1TUVA

Crystal structure of ygin in complex with menadione
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ygiN
publication title Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tuvA00
1YJUA 1MWYA 3IWXA 1GXTA 4Q2LA 1SB6A 2HLUA 5B0GA 1S6OA 3TNVA 1N5VA 1RJJA 2GFFA 3CJKA 2ROEA 3UDCA 3HX9A 2OAUA 4HH1A 3HHLD 3LGNA 1U7LA 2K1RA 1N5TA 2K7JA 1FE0A 2N4CA 3BR8A 4Q2MA 4NPOA 4HH0A 2XMTA 1TUVA 2ROPA 4FNHA 5B0CA 2FB0A 3BM7A 3HHLB 1P8GA 2CRLA 3FMBA 4OJGA 3GZ7A 5F0WA 2K7KA 5A6WA 3CJKB 2RSQA 2K1RB 3DXSX 3T9NA 1ULRA 3BF4A 4OJHA 4ZOSA 1YJTA 2FHMA 1KQKA 5B0BA 4EFAC 2BUNA 3BDEA 2GCFA 4NL5A 2LQBA 1YRXA 2N7YA 4OJ1A 4YEAA 5K9FA 2OP5A 4HI1A 1X0PA 1WD6A 2BJEA 1TL5A 2PD1A 5T7LA 1W2IA 1APSA 3BB5A 2OD6A 4Y2KA 5B09A 2BBEA 2FIUA 4HL9A 1VQYA 1Y9OA 2W4DA 3BN7A 2OFGX 3HHLA 4OJ3A 1GXUA 2ZDPA 2JDJA 2QLWA 2QIFA 1CPZA 4A46A 2Q3PA 2AJ1A 1MWZA 5T7LB 1JWWA 1IUJA 1Q8BA 2G9OA 1Q8LA 2GV1A 5A6PA 2XMVA 2OKQA 3DCAA 4ZA1A 2XMKA 3I9ZA 2LXFA 1YJRA 2GGPB 2KT2A 4A4JA 1FE4A 2ZDOA 3FGVA 1XBWA 3E8OA 1K0VA 3MZIA 2HFNA 1FEEA 2HQIA 2N4DA 2KKHA 4HI2A 5IXUA 3TOQA 2FTRA 2VV5A 3HF5A 4QOTA 1OQ6A 4F67A 1YJVA 3F44A 2EW9A 2XMUA 3KG1A 2XMJA 2W4CA 1Q53A 3K7RA 2ASYA 1S6UA 3FRYA 2GGPA 4Y2MA 3IWLA 2AJ0A 2OMOA 3QGPA 4DPOA 5KAKA 2VH7A 2AP6A 2IFXA 2IYIA 2HIQA 1N5QA 2LQ9A 4A48A 5F0UA 1TR0A 2RILA 4OIXA 2IYGA 2ROGA 1Y0HA 2BYCA 1FVSA 2KT3A 1N5SA 1CC7A 1SQEA 2XMMA 3LO3A 1AFJA 2OFHX 1KVIA 1OPZA 2RU9A 1TL4A 2GA7A 2BJDA 1Q4RA 1CC8A 2RMLA 2XMWA 1OQ3A 1FESA 4A47A 2L3MA 3HHLC 1OSDA 1P6TA 1SI9A 1V3ZA 2QLXA 3LGMA 1FVQA 2ACYA 1QUPA 1TZ0A 1Y3KA 1YG0A 2QYCA 4DL0C 4FNIA 2GO8A 2PGCA 1X8DA 4DN9A 1X7VA 3QMQA 5B0FA 1LQ9A 2HFOA 2LDIA 1FD8A 2HLTA 2W4PA 5B0DA 2KYZA 2AW0A 3HDSA 3MCSA 1Y3JA 3BGUA 1VQSA 3KG0A 2K2PA 3KKFA 1AFIA 3KNGA 1KVJA 5B0EA 4YDXA 1AW0A 1R6YA 1JK9B 4U9RA 1URRA 3TRGA 5B08A 4Y2IA 3HFKA 5B0AA 3WDOA 2OD4A 3VTIA
chains in the Genus database with same CATH superfamily
3WX4A 3IWXA 3TNVA 4FYYB 1S1TB 2MQOA 4U7UD 2H1YA 1TV6A 2AGOA 3VR1A 4LF5F 2A2DA 4URSA 3TX0A 4WTOB 2V8VA 3D0HE 4ED2A 4FS1A 2J7WA 4IO9Q 5DZ6A 4ETZA 4HL9A 5BYRA 2W4DA 1JNZB 1CJKB 2EFQA 1VQ4S 1QSYA 2GV1A 3C15B 1UFWA 2F65A 2CA9A 2MQMA 1M1GA 3NGSA 1SJRA 5HROA 4K5RA 5D4NA 2EFOA 4M5LA 1MLAA 2JEFA 1T9TA 1JLBB 2ZKTA 3N9UC 2ASJA 1MN9A 2E7VA 1RTIB 3N5BA 1CC7A 1M5OC 1KHWA 1QAJA 5HLFB 4JI7F 2HBQB 3NBPA 2JVOA 2QRRA 2COLA 3V6DA 4DSFA 1T9WA 5KG6A 2QA4S 2G0CA 3M9OB 1RZMA 1IKVB 3HD1A 3KYLA 2HWIA 5ETOA 5GMKa 2V67A 3JSRA 2DGSA 2HHUA 3BQ2A 4JI1F 4PKDB 1NK9A 4H4OB 1I51B 1R3NA 4RUBA 1BQMA 5F0WA 4M5DA 1TL3B 2Y0BB 4YR3A 3MFIA 3LOUA 3MF5A 3FBBA 4Q8FA 1B0PA 2QSFA 4RNFA 2HRYA 4UF4A 2D41A 1Y5LB 1N33J 3ZTRA 2FY1A 3DRRB 3CXCR 1NJWA 3WX8A 3EDRB 5IC4B 3TA2A 1E6VB 3NCRA 1BC6A 3IXQA 1YJNS 1HYSA 3PRVA 3MCOA 2BJ9A 1C0TA 5LJ5Y 1GH8A 4R5PB 3O1LA 5DZ7A 1IN0A 4GC6A 2W2OP 1RK8A 1SKUB 2IVYA 1ITPA 1HBMA 4EWTA 3OFFA 1X60A 2L41A 4NZ6A 1B0VA 2PA3A 4J37A 1LW0A 3DOMA 5I3UA 3TP2A 4X4QA 3R7BB 3H25A 2L9WA 1XN9A 4I68A 4WU3A 1N5TA 2VPYB 4HHHA 4JI5J 2ZH5A 1HA1A 4D3GA 2ZH9A 3CO9A 2GMLA 1ZAXA 3R5CA 5JXSA 3I5AA 3VAJA 3GYNA 3RUBL 1HI1A 1RWMB 5DRKA 5KT3A 3JTPA 1CJVB 2Q3PA 4LFBJ 3JSMA 1OO0B 2XMKA 1VQ5S 1H7WA 2BQRA 3CCMS 2AJ2A 1N32F 2BJ3A 2NR0A 2ZJPQ 3DGVA 1RT4A 4I6WA 1O8BA 3H20A 1VLYA 3W5XA 4PEOA 2MKYA 3UNYA 2QFJA 2P9GA 2L3MA 1OYDA 3CCLS 4I6YA 1YBTA 3CDEA 3PR5B 3WC0A 4C8YA 3MEDB 3ILLA 4DR7F 1WHXA 5DQIA 1FKOB 1TKTB 4HEA9 1F9EB 8AT1B 4PQAA 5D8HB 3H2VE 1NKCA 4KC5A 3SCLE 4ZCLA 1Z4UA 2BW7A 5HJXA 4P9SA 3V81A 1WOSA 1T9UA 1VJWA 4K50A 2MLXA 2MGZA 3ENQA 1J5OA 5JVHQ 1RAOA 3AOBA 3UD5A 3AD7C 2Q1LA 1WC1A 2OFGX 4OZLA 3CJTA 1F3VA 4YB7A 2JC0A 5HN0A 4DV3J 2HQIA 1X31C 1CJKA 1OS5A 3C15A 2YNIB 2W2QP 1SCJB 1I5OB 2XS5A 3UO0A 5L1KA 2UXCJ 4DPTA 1JLBA 3H4BA 1RTIA 2F4VJ 1FVQA 5K20B 2KG0A 4I1TA 2AD9A 1NNDA 5HLFA 1NBEB 2H3EB 1XMBA 2HFOA 2ILYA 2V6AA 1HBUB 1KVJA 2HNYB 1LOUA 5L9NA 2CJBA 1J5EF 4H4KA 3W60A 3ETOA 2FGOA 5E3PA 2FLPA 2K1RB 3T9NA 2GMHA 3HSZA 4H4OA 4UQTA 1RBOB 2VDHA 3P4UB 2XYGB 1X4CA 4HI1A 1W2IA 1MNEA 1NB7A 1TL3A 2W9BB 1AA1B 2LA4A 1F2GA 2AU0A 4QIVA 1JJ4A 4B9LA 3GFXA 5FD1A 4NXNF 2KKHA 4PRFA 5DDPC 2V2QA 1E6VA 4M5KA 3BV8A 2R2SA 4F4WA 1FCAA 1DHMA 1AUSL 2XLJA 1MSWD 4YR0A 3DM2A 3DRYA 4USWA 4R25A 4A48A 5CXTA 3EPGA 3H42A 3BGLA 1X4FA 3G6XA 1KVKA 4K4TA 5HANA 4R5PA 4GVBB 3UD4P 2DGOA 1MMDA 2B9YA 1WG5A 4J9LA 5RUBA 1FJCA 4OX6A 1X8DA 2CZ4A 3QMQA 5L8RC 2EC0A 1LFPA 3T1AA 1H2VZ 4OX7A 2E5HA 3MEEB 2YWGA 4DV0F 5C24A 1NSKL 2F3JA 1HL6A 3VTIA 2WVFA 4GKKJ 3ZXWA 1WELA 2J9DE 1RWNB 4FKXA 4F02A 1X9MA 2DD8S 2HQGA 4HTIA 1CS4A 2QN6B 2GW8A 4MK7A 1HI8A 2DNQA 2X1FA 1I3OB 4URGA 2UVVA 5CYJA 5HMXA 3D28A 4TYBA 3HJFA 4PPZA 4CIOA 4KO0B 4CLWA 3RB4A 2C3MA 5KFYA 3MR2A 4ZP7A 4F67A 1CJVA 4JI6F 2W4CA 4H4KC 5G0RB 4CO5A 2VA3A 2OPQB 2I9SA 3RR7A 2Z57B 2HZAA 5LMUF 3D6FB 2JZ5A 1TL1B 1R8HA 3R9LA 2VA2A 4X4VA 3M30B 1OSDA 1FRLA 4DZDA 1V3ZA 2R7XA 2KXFA 1HQUB 3R2CJ 4B3RJ 4DBQA 3QO9B 3JYTA 4UW2A 3R5JB 3U1MA 1PCAA 4TQSA 3AJDA 5AT1B 3PFOA 4TU7A 2D3ZA 3OR1B 3HHLB 1RGVA 1UVMA 3I4HX 4O3QA 2RQ4A 2BEFA 2R7OA 2ZZMA 2QLBB 1FFSB 2C28A 3TVZA 1RTZA 2I6WA 4P2MA 4QIFA 4ANDA 1JLEB 4DN0A 2DY9A 2GJ2A 2HFNA 1NSPA 2JOQA 3CO0P 2XY7A 3BH7B 2IFXA 2IYIA 1RCXB 3E51A 2YH1A 2YNIA 2EPIA 4B02A 4PPDA 3MXHP 3OD2A 3L7OA 1VRTB 4Z7CA 2WB1D 2EBGA 3ICLA 3WQPA 4OV6A 2V2ZA 5LT5A 2ZZNA 1XEZA 2KDOA 1HMVB 3JB9k 5LJ3Y 4P74A 3GCWP 1UAWA 4DHVA 1HBUA 4Q2MA 4AL6A 4OZ5A 2HVZA 2V8HA 1KFSA 2HNYA 2XSFA 5FLXY 4LSNB 1G4CA 4NL5A 3K5MA 1AB8A 3D67A 1IM4A 2QL5B 4LFAJ 4BC7A 1VQYA 4J9UE 1VRQC 5DDQC 3RRHA 1EZZB 2VBZA 5CA5A 5IS2A 4EZ6A 2D69A 2J9DA 2PMWA 3GQCA 2W9BA 4QOTA 2D7SA 2GHVC 3TAMB 1Q5YA 2HQDA 2XHCA 1LWCB 3A3OB 3N0VA 3DFEA 4ZLJA 1KVIA 4RNMA 2MHNA 3MCNA 3HI9A 2CNKB 4S0MA 3GV8B 2RHQB 1QAXA 2FC9A 1SPBP 2LVWA 5KFQA 5J2MB 1JK9B 3CMAS 1OY9A 2ZOMA 1KR4A 2VKZG 2ZWOA 2HNZB 3EGWB 1QAYA 3MHYA 4CYUB 3KHGA 3ITHB 3MEEA 4FNHA 2DGUA 5A6WA 2V8DA 3IRXB 1Q82T 3T3FA 4MJKA 5SZTA 3R7SB 5HQMA 3NGUA 4ECTA 1LV5A 4P6QA 4JV5J 1U4BA 3RGIA 1DFDA 3WZ0A 3FJ2A 4NZ7A 2AZ1A 3DNCA 3HULA 1DTTB 1YGYA 3BKUA 4JV1A 4KHPJ 2YPZA 3CULA 2PSZA 2D9PA 2XLIA 5IXUA 2VV5A 4WFXA 1NLKL 3UCUP 2J6UA 1U1QA 2G0JA 4X2BA 5KFHA 4C4WA 3OVSA 4KO0A 2J0XA 2HW3A 2OPRB 4DJBA 3OVAA 1KC8T 1NHKL 5G0RA 2HHXA 1H2UX 1BD6A 1F9FA 2OPQA 4UUWA 1IBKF 5HVFA 1W26A 2ZEJA 1FJ7A 2NYHA 3PEHA 1T3OA 1TL1A 4F3OA 1UFLA 3M30A 3EUNA 4O44B 4F4KA 1RQ0A 2VG7B 5K8NA 3POTB 3A8EA 2V9KA 3W66A 3GJQB 4LR9A 3ILOA 1G3OA 2J0WA 1RHQB 3ZTOA 3LAKA 4AE5A 4DQRA 2UU9J 2E9RX 2IA6A 3THPA 1RLDA 3AA9A 2X7IA 3P5TL 2CQDA 3HHLA 1IVZA 5E41A 2Z2MA 4PWDB 1S0NA 3ZZUA 3CC7S 1NKEA 3VZIA 2XSJA 2KU7A 3EXCX 2V5HG 4QYZK 2DNPA 2IRYA 3T19A 1C1BB 3BPSP 1RAIB 3C6UB 1S48A 3V2UC 1U8WA 1UETA 5T14A 2CPIA 2DVIA 1FKPB 5KFZA 4LF7J 2HZVA 2WW8A 3ENVA 3IM8A 1X5TA 1HPZB 2RQMA 1S9EB 1AFJA 4LVNP 4WWSA 1WSVA 4WZQA 1VQ9S 4A8WA 2GHWA 4IH7A 1S5ZA 4A8YA 4USMA 4UQGA 2B4VA 3RG6A 3BKFA 3R6LB 1SQFA 4U8VA 4BWMA 4IKAA 2VICA 3UDCA 4ZVUB 4C8KA 3OFGA 3UDLA 3CDUA 3CJKB 4DWIA 1HMVA 3RAQA 4LFCF 3QRPA 3A8IA 2RDJA 2FVPA 3ELHA 4DZ6A 1IBMJ 4NWBA 4LF8J 5F9LA 2F63A 3ZFVA 4K8RA 3AY0A 3KK1B 3BO4A 3MMCB 1WORA 2D3O1 3LGHA 4LSNA 2HQFA 2AMCB 2NREA 2ZDOA 2RU3A 2PEHA 4P10A 2VFRA 2EXUA 3KJVB 1JLQB 1L3VA 2FLOA 1RTHA 2YPYA 4M95A 3PM9A 1NZAA 1IR2A 1DZ5A 1HHTP 1S4FA 3TAMA 3KHRA 2HMIB 2D3UA 4MTPA 3HHLC 1LWCA 4JV2A 1TU0B 2JLEA 2AHOB 2MYFA 4HT5A 3T1YJ 1TKXA 1NDLA 3FCVA 2EFPA 3IBFB 3W5ZA 4DV4F 4C0BA 3FFIA 3OBIA 2YKMB 3VAGA 3KLHB 4P2XA 3K17A 2FYXA 4O3NA 3GWCA 1KP6A 2VZ9A 3R5AA 3TA0A 3C2PA 3EE3A 3Q86A 1RWWB 2HNZA 4WPAA 2N7YA 4P7TA 3ITHA 1P9YA 4MFBB 1EETB 4LF1A 2VQEJ 3LTOA 2OTJS 4DL2A 2WVEA 1RYSA 4LSLB 2HFZA 5HMWA 3EZOA 3Q2SC 2BQ3A 3D1OA 1Q8KA 3ET6B 4RW4B 3LALA 4ED3A 3D5MA 2ZITA 4DFKA 4DUYF 4ECZA 1FRJA 3OTOF 1WTFA 5E33A 4A47A 4YHHF 4HKQA 5KFAA 1XR7A 4ZVPB 5LOQA 4HDGA 3CNQP 3M6WA 3ILIA 3NGRA 1VQPS 4DUZF 2DY1A 2VASA 1M5HA 3GFZA 5AXLA 3HCXA 4KFBB 4ED0A 7FD1A 5HMYA 3HX9A 4F26A 3UQSA 1HR0F 2BVZA 1AW0A 4BBYA 1WI8A 2K7KA 2CNNB 4X4UA 2M9KA 2DR5A 3POTA 4GRSA 4N8NA 1FRIA 2U1AA 1GXUA 4ILMA 3TI0A 1TFWA 2ZE2B 2JWNA 1WSRA 2OTLS 3B8HA 4DLGA 2KT5A 1B0TA 4LF9F 3JTOA 4PWDA 4N77A 2B4PA 3BYRA 3FC9A 1PILA 3LP2B 4FS2A 4I56A 3ONQA 3C6UA 2VD3A 2KT3A 3MAQA 4X65F 1FKPA 3TUIC 4QIWD 1SL0A 4A8KA 3HT3A 1HPZA 1QUPA 4KHRA 1S9GA 2RH3A 1S9EA 1S0VA 4X4PA 2XB2D 1VQNS 2ZHAA 3KKFA 2GAHC 3P49B 3MM6B 3RZAA 4DOZA 5IWAF 4CLLA 2XNRA 2HHWA 4AL5A 5KT5A 2Y8YA 4L73A 1VIOA 2JFKA 1TUVA 5FDLB 1RHMB 4O3RA 4ZOSA 4OI3A 2HQCA 3NMAA 4GO7X 4OZ1A 2ZH2A 4FYWB 3RB0A 2UP1A 5ETKA 3S1TA 4CM0A 3FUYA 2DGWA 3JSYA 3PW2A 2LXFA 3IO1A 2BJ1A 1VHIA 2RKIA 3HXMA 2G2OA 4PABA 3I4PA 4U96A 3MMCA 3UPFA 4L3NA 4ATNA 4KB7A 4G1QB 1Q0NA 3H2UB 1IBLJ 3KJVA 1JLQA 1FVSA 2IPOB 1R31A 4JI4J 4KBIA 4X4RA 2WSFC 3NL0A 2IHR1 2MQPA 4FF4A 2RVJA 1WNEA 1P27B 4F3QA 3SV4A 1C2PA 4ID5A 1U0SA 2AW0A 3K0JA 2VG5B 4QU7A 4B9NA 1QVFR 2VU5A 4LF4J 2VPZB 2UUCJ 5KOWA 1PJ7A 4TN2A 3G8SA 1RYRA 3KLEB 1P1LA 3PY8A 3TA1A 3QWPA 2HVIA 4KGKA 4JI2F 3TAQA 1YQHA 1XK8A 3NGKA 4IRCA 4NPOA 3AXMA 3PX4A 3DXSX 4O4GB 1QUVA 1XR5A 2YTCA 1GX6A 3KLHA 1R7IA 1NH8A 4OYZA 4J9PA 4TU9A 4WE1B 1SIZA 4DV7F 1FERA 1BQNB 2CVIA 2KG1A 3X1LB 4MKYA 3PIOQ 2E1PA 3HHKA 3ZZYA 2MQQA 4DPUA 2QGFB 3BREA 3FK4A 4I7FB 4ZKAA 1PSDA 3US5A 1EETA 5JJBA 1UA1A 4RW8B 2OPSB 4OYOA 2NSCA 5IT0A 4DR2F 5J2QB 3EVMA 3UVJB 5CCLA 3DDNA 1ROFA 2R42A 2LXIA 4WFYA 4M5NA 2JEIA 4HT7A 2FJAB 1S76D 3ET6A 4CH1A 2M8HA 4K2XA 4DQQA 2DNKA 1TKZA 2HLTA 4IUFA 4LREA 3K59A 4TY9A 3ZNUA 1WG1A 2IJNA 4RL1A 1T03A 1FRMA 2IVMA 5AE3A 3FSYA 1FJGF 2XM3A 3HKWA 4KFBA 2QL9B 1TMMA 1MG7A 1KQKA 4KH0B 4EFAC 3K5OA 5IM0B 2LCWA 2CNOB 2B7BB 2C2ZB 4DV5J 4FF2A 4RBTA 5T7LA 2O66A 3QIPB 3V6KA 2AF6A 2QLWA 1IJEB 1G1XA 6FD1A 1HQ2A 1UPPA 1D1UA 4A4JA 2B43A 2V4JB 5CYQB 2GQ2A 4F25A 2HSEB 1VBXA 2DCUB 5CZVA 4U7CA 4EI2A 4DV2J 1HD1A 5L38A 1F9HA 4ZVTB 2O3DA 2NQPA 5I42A 3KLGB 4QU6A 4FYDA 1SJ3P 2Q79A 2BYCA 2WBRA 1YI2S 1ZBTA 4NLRA 1SJ4P 3SYZA 3ETMA 1FXRA 3G86A 3HZEA 4BLGA 3IRWP 1FNMA 2ZBCA 1HBNB 2BM0A 2KH9A 2F8HA 3SQOP 2KTQA 4Y6IA 4RLEA 4B3TJ 2IC3B 3T1HJ 3H40A 4A8MP 1NPKA 1IXKA 2FZGB 2MKKA 1NSAA 1T3NA 2OMLA 4JI3J 3MM6A 2E1RA 3RU0A 3KMSA 3M1VB 4IDKA 1RT2A 4RPFA 1TAUA 5J2PA 5DS7A 2SXLA 4HDHA 2IM0A 1U6FA 2RQKA 5FDLA 2FY8A 5DETA 5A0YB 1WTBA 1ZAWA 2DXEA 4TYAA 4DCOB 4L74A 1FNXH 2J8AA 1YLXA 2CG4A 2OMOA 4ZPVR 1OPIA 4ECQA 2HIQA 4UUXA 2MSTA 3LO3A 3LP1B 2VJVA 4M5IA 2BANA 1CC8A 2XTJP 2QJ3A 4FBUA 1S10A 3P8BB 2AIRB 1QDUB 2AYEA 3ULHA 4DR3J 3CJQA 2QLFB 2OPPA 4C3LA 3MPDA 1OY6A 2GAGC 2VG5A 5B0CA 1WWHA 1FDAA 2Q43A 1A7GE 3KLEA 1XMOJ 4CO4A 4OI2A 3M32B 3NP5A 3ZZOA 3PEJA 4C0OC 2MHEA 3KLFB 3MR3A 3FEZA 4MIAA 1NXIA 4JUZA 2UVUA 5H1SV 5KFJA 3HSGA 1Y10A 2MKIA 1NM2A 3RTVA 4WE1A 2KRBA 2ZOFA 3U1LA 2AJ0A 5K5MA 1NMEB 3RAXA 3D3BJ 2ZHOA 3B4MA 3I5BA 4YB6A 1OPZA 4RW8A 2PN6A 5J2QA 3KLVA 3B6BA 2OEKA 3UVJA 3DI6B 1Q1KA 1QY7A 3CTRA 1R0CB 1YG0A 3TZXA 1R6VA 4RNOA 3O2IA 4DL3A 4MK8A 2X3GA 4OZ3A 3R1LA 2ZD1B 4MH8A 3MM8B 4B3OB 3RRGA 3C8YA 1HWIA 3AT1B 1NHUA 4HH0A 2DNRA 3LP0A 4K4ZA 1P8GA 4LBHA 5I3QA 4JV0A 3OW2R 3F56A 4RU2A 1LW2B 2V0NA 2B6AB 4KHMA 2EEYA 2JLGA 1ZOTA 1S72S 4ZA1A 4ZCMA 5IM0A 5KG2A 2NS1B 5H9FK 3VAMA 3I31A 1T8EA 1M5SA 3QIPA 3EYZA 4NLPA 1X9SA 3GIRA 2CQ1A 2KVQE 1MMNA 4X84A 1JLCB 3T5JA 4B3MJ 3KJQB 2V4JA 4NX9A 5CYQA 2QLJB 2IM2A 1TR0A 5C7PA 2IA0A 3NNCA 2W8LA 3FBEA 3FVYA 2Z58B 2AKWB 3KLGA 5ETRA 3FEXB 3NKYA 5LMNF 2CDRB 2LXUA 1GT8A 2FD2A 1Z2ZA 4ZVSB 2VKRA 4IFYB 4DV6F 4UOCA 4AD6A 4WU2A 3MTKA 4C7QA 4KKOB 3KNAA 3UWTA 2KHDA 3O8WA 2WHOA 2K7JA 1F6TA 3IAM9 3OL6A 1EX8A 2GIFA 3AHPA 3TZZA 4OJGA 4YUDA 2PI4A 2PO4A 4RKUC 1ZA2B 2MZ1A 3CCRS 3OT9A 3K5PA 1WJ9A 1DARA 5CAAA 3NWGA 3H5YA 3M1VA 3G2XA 3N01A 4B17A 1VQOS 4OHVA 4X4NA 1KD1T 2XZTB 5DGBA 1UP1A 1D9DA 3PJXA 1U8SA 3T5HA 3F44A 5A0YA 5KFDA 2VL1A 4MKAA 1HIYA 4ELVA 3D1QA 3DDIA 3JQJA 4R8UA 2UZAA 2QMWA 1T94A 2FLNA 4DQSA 4ZVQB 3F73A 1BQXA 2ATLA 1RXOB 3LP1A 4DL0C 4KGVB 3PDNA 3D68A 2W4PA 3KG4A 3PCOB 4R0JA 5DQGA 5D0GA 4CO0A 3HSJA 5J1EA 2LDYA 3HP6A 3RW6A 1DBDA 5HVHA 4TKTA 2RSQA 3I32A 2XY6A 4EZ9A 4CNZA 2XO7A 3KHLA 3L3CA 4C8LA 3W8PA 2C3YA 3HPOA 3IGVA 1SC3B 3FSXA 4GC7A 2DH9A 4ZPCA 2FDNA 4HVZA 4NLQA 4DI6A 2KT2A 2YKQA 1E6YB 3EVOA 3M32A 1N5YA 2AGQA 2MQNA 3MZIA 5EWEA 2QA4G 3KLFA 3IR5B 1CVJA 3M8SA 5KG1A 5LXYA 1KLNA 2DYAA 1KKHA 5DLFA 1H38A 4RW9B 3TARA 3GP9A 1LWEB 1TUGB 2YBVA 3CJ3A 1KRPA 3EGZA 4KYZA 3BBFA 2CQHA 4IFVB 2E5IA 2LA6A 2VJUA 1VQ6S 3GYGA 3N5FA 2OIHA 4LIWA 3KNGA 1WKKA 1RT1B 3DI6A 4HHUA 1WC4A 4ZIWA 1SB6A 2ZJQQ 2KZMA 4WXWA 1UEKA 4LF6J 2J76E 1F0XA 3R2DJ 2RDDA 4CM2A 4F4YA 3QT7A 1RUSA 1UVNA 4CTAB 1NPPA 4YS2A 1AROP 3C14B 4B3OA 1JXVA 1T7PA 2M52A 3NGDA 1TL7B 4ZIVA 5DM6Q 2LMIA 2V8PA 3IR6B 2VBYA 2XC9A 5IOLA 2ZZTA 1LW2A 4DR4J 4NA3A 4NXMJ 2KHCA 1NO8A 3T5LA 3C6TB 4YY3J 1SBRA 4K4XA 1H73A 2HG4A 2VF3A 5KFKA 1Y11A 5L1LA 2ZH6A 1UJ5A 3IFEA 2DPIA 2YWFA 3J81Y 4DPXA 4WP8A 2Q66A 2DHXA 4DQPA 3GJSB 1PJ5A 4ECVA 1AFIA 3D6HB 2KI2A 3LPEA 4YOEA 4IH5A 3BS9A 1XQIA 4IFYA 3M8RA 4FXWA 3J7YI 4ZPAA 2RE1A 2NUUG 1WC5A 4PG8A 1NJYA 3QLHB 1A6LA 4Y2CA 1JJ2R 1Q78A 3GIIA 3JSBA 3PRDA 2MEWA 2CWKA 1LFWA 3W9IA 4P2SA 4JI0J 1NUEA 2FJDB 1JWWA 4WYWA 4DR6J 2J5AA 1N33F 3E8OA 3GILA 3NMRA 2XS2A 1VJQA 1FEHA 4RNHA 4QYRA 3T41A 3JTNA 3QNWB 3RBEA 3ISNC 4NLDA 5KFWA 3KK2B 5LSOA 2B0GA 2B5JB 3ZTPA 5A8WB 2CQCA 2W7AA 3Q8SB 3PG9A 3A3NB 3QATA 4EU0A 4LMZA 3G4SS 3AJ1A 4I64A 3GMGA 5EX3A 1UCNA 2VPXB 4ZN3A 3KTQA 1PAEX 5DGAA 3U02A 4DV1J 2LU2A 4FYVB 3BM7A 2L08A 1IM6A 4N56A 1BGXT 5D4LA 5B0BA 2A10A 1HBOB 3MEKA 1IWGA 1JMTA 4B9UA 2PI5A 4JI5F 2FZKB 2DHAA 3QQCD 5KG4A 2PT0A 4LVOP 3OHBA 1OY8A 4CLZA 4LIRA 2I5JB 1D9FA 4UZCA 4LFBF 2HHVA 4X64J 3MM9B 3H5SA 3NAIA 3R5DA 3TX8A 2ASYA 3PV8A 1E6YA 5KFRA 3J7ZT 4I4BA 3BSAA 2UUBJ 1DAXA 3QGIA 3CUNA 3SIPB 2DNHA 3S6EA 1SC1B 4IRDA 1FI4A 3H0PA 1LWEA 1M5PC 1RT5B 3Q8PB 1T05B 3B78A 4DL4A 4IFVA 1SUQB 4OYMA 2K3KA 1EP4B 2WSEC 1ZETA 2R7QA 1NRKA 3IBCB 2PFFB 4KE5A 1PG5B 3THVA 1TMJA 2LYVA 5KFCA 3R7NB 1RADB 1URNA 1F1BB 3NS7B 2CPXA 4DSJA 2MZRA 1H6KX 1NH7A 3SSQA 1JJHA 1TVRB 3TYTA 1VC6A 1OIAA 3FRZA 4RUAA 2GJIA 4J9SA 5D4OA 4PXEA 1OQ6A 1RT7A 3ENAA 4OZNA 2HFVA 1CSJA 2LU1A 4DV3F 2A2CA 3MPVA 2NXUA 2IYGA 4Q7AA 2CPJA 3M6UA 1S79A 3CDAA 1V6HA 4IG0B 3AQOA 3TR5A 2R7RA 3C6TA 4ZJOA 3A13A 1ZYQA 2H4WB 3J80Y 1IKYA 2IJRA 2UXCF 1PC4A 3JQMA 3LW5C 3BGUA 2YX7A 4BDPA 4B9SA 2F4VF 5B0AA 2OD4A 3TZWA 2H54B 4G65A 4A8XA 3PW5A 3QT5A 2W2NP 5CZXA 4G1IA 2KO1A 1VR6A 2WBMA 4NYZA 1YRXA 2H51B 2RUSA 3C66A 3A8JA 2C2MB 2HAIA 2ZHBA 4OJ3A 3G6ES 5H9FJ 5BR8J 3OL7A 3VAFA 2KZZA 1QTNB 1NHVA 1YJRA 4KRWA 4J9NA 2AZ3A 3QLHA 3LANA 1XNRJ 3K57A 2HFSA 1NAQA 4P52A 3M6VA 3D54A 2G4BA 2MKSA 4Z2XA 1MROA 2GVZA 1N4LA 4B3SJ 3NGTA 5KG3A 4NI2B 1P6TA 4LRFA 4DU8A 1KLMB 4X62J 1WC6A 2GIQA 4RW6B 1Q86T 4J90A 2LEBA 3W9JA 1NK6A 3KK2A 1GMUA 2DBBA 4Z37A 1L3KA 2PMZD 5C2CA 2B5JA 3VGTA 4Q2LA 4QWEA 2B4OA 4DCJB 3QWUA 2JVRA 4X4TA 1O51A 3SDEB 1N0UA 4PYDA 3N6MA 5EHHA 4GKKF 4J9RA 4QIGA 2HS0A 4BS2A 3HVTA 3GFHA 4OYAA 2BBEA 4ZLLA 1M5KC 4MYTA 2QSWA 2VB6A 5A76A 1HBOA 4IRKA 1RAEB 4WCEQ 1UWBB 1KONA 3OTCA 4HACB 4NMXA 1VISA 1VQKS 2I5JA 2ZM6J 4WK1A 3TEGA 3MM9A 5F8IA 2LECA 5E0OA 3J7YU 2A6OA 3P5BP 3Q83A 5IT9Y 4A8OA 1VDHA 3EZUA 1FFWB 1U1PA 1GMVA 3MOJB 2CJAA 3BDPA 3MPYA 4DR5J 1Q7YT 4K4UA 4N7TA 3QRRA 4QR0A 4NEYA 4B3RF 1Y00A 1V9OA 4GKJJ 2ZWPA 5J1NA 1RT5A 2ROPA 5AXKA 1T05A 1YJ7A 3PACA 3PYGA 1FKAF 4LF2A 1KTQA 2HZCA 3FZ2A 4OLOA 4HR2A 2CQ3A 3MMAB 1EP4A 4K4WA 2IBKA 3DLBA 1CEZA 1ACMB 3CEDA 2HBYB 3BGRA 4ED7A 4YQWA 3ZTSA 3CWJA 2UV8G 2V50A 1TFYA 2XULA 2N7CA 5DM7Q 2CPDA 3UDVA 4QBUA 2O1PA 4YR2A 1S7IA 3AB4B 3IWLA 1TVRA 1U1NA 2N3LA 1LXNA 1RHUB 1U25A 5HL7Q 2R7SA 1RHRB 1NSQA 3GSIA 4Q43A 4MIBA 1FESA 4W4MA 1X4DA 5CQGA 2CQGA 1Q7LB 4PWUA 4Y34A 4CLYA 3IMQJ 3KLIB 2DO4A 1RAHB 2JX2A 4IG0A 2KXHA 2XI3A 2DGTA 1ZTTA 2CQIA 4C3KA 2E29A 2ATCB 3BJYA 2DH8A 2ASDA 2HS3A 1AT1B 1U47A 4XIUA 3M2UB 1O0PA 3M8QB 3DLGA 4HLBA 1SV5B 5ETQA 1WDDA 1I94J 1R8PA 2DHHA 2MMYA 5KG7A 2H5JB 3NOCA 3AA8A 4Q8EA 2CJ9A 3VZHA 5MLCV 2VUGA 4ZVRB 2FIUA 5IC6B 2EVZA 2CJQA 5JVGQ 4PUOB 1HQEB 3FGVA 4LFAF 2YWEA 3M2VB 5I4MA 2YWHA 1DJ0A 3R27A 5B7WA 5IZHA 3VVTA 2I1RA 5HSPA 4W90B 4WZMA 2UUAJ 5GADI 1MW7A 4ZHRA 2P9EA 2JNJA 3DOLB 2Z2LA 3PR4A 3BBBA 1WEXA 1AZSB 4JI8J 3PZPA 1JJCB 3HM9A 1K1QA 4NI2A 4YDXA 2KFNA 3PW4A 1KLMA 1UEUA 4DQIA 4QWBA 2BABA 4RW6A 1RJJA 4OZJA 2QMUB 4ITSA 3CCES 4MMOA 1Q8IA 3GZ7A 3QRQA 4ICLB 3VGVA 1YJTA 4M5MA 2LQ5A 4C8MA 3K2YA 2VG6B 3RR8A 8RUCA 4JV5F 2GQCA 3NRBA 4CLFA 1RKIA 3W2WB 4WFAQ 2M2BA 2J9EA 3CSKA 1OWXA 4KHPF 4BC9A 2Z8QA 2V69A 2E1MC 1UWBA 4W92B 2CADA 5D78A 3JAMY 1RU2A 3J81U 3GONA 3PXGa 1UL3A 8ATCB 2UXBJ 4HACA 4KAIA 1Q79A 3W9HA 2HYIB 4FXVA 5A8KB 2VBWA 2KB2A 4U8YA 1UTAA 3Q8VA 4CLUA 1VQSA 1S1TA 1TQLA 1DLOB 1XMQJ 3EWGA 5DJBA 1JLGB 4NCBA 1PYSB 4OHZA 3HVAA 1GK8A 4LRCA 5L9XA 3IWNC 3SI8A 1U1KA 4C3MA 5HBMB 2GNKA 3G82B 3A8KA 4ZJQA 5ITHA 2GC8A 2UU9F 4FXDA 1IUJA 3S7RA 1ZAVA 3UI3A 3CVKA 1QAIA 2XI2A 2HHHJ 3PYDA 1M0SA 2HGMA 2XMJA 4Y2MA 2FJEB 2CQPA 1HNWJ 4NLGA 5KT4A 3GTYX 3QT8A 4PQUB 5KFIA 3WC2A 1DQAA 5AE2A 4RR5A 1IKVA 4LF7F 3KMQA 4ED5A 4P2FA 4IO1A 4DN9A 2LDIA 1WEYA 2HVDA 2K2PA 3IG1B 3VAKA 4WTYA 4NYOA 4C98A 1PO6A 3DRPB 4N5SA 2R7UA 1S99A 3CDBA 2HVHA 4BWJA 2YXLA 1KQGB 3DRRA 3M2UA 1QSLA 3M8QA 1N36J 4E98A 1EARA 2APOA 2XQCA 4QWDA 1LK5A 1NDCA 1U45A 1W7WA 1IBMF 4LF8F 4EBCA 2FGCA 4P7VA 2MB0B 3DGPB 2V63A 3W5YA 2XGPA 3D0GE 4PUOA 1VFJA 1HQEA 2XYHB 3K7RA 1FDNA 2XBPA 2WONB 1VBKA 1NPRA 1ZZFA 1MN7A 2H4YB 3VAIA 2R3VA 2QFIA 1SXLA 4ZPDA 3PHTA 3NLCA 2R8KA 1H0HB 3M8ZA 4OHXA 1GTEA 3M9MB 1H3DA 4XPEA 4ALZA 4B9MA 3W63A 5THWA 5A2QY 4FNIA 2CYYA 5GAHI 3DOLA 3RYLA 1AZSA 2H65B 4W98A 3T1YF 5DG8A 2VONA 2C3UA 3G87A 4OZ2A 4FVMA 5B0GA 1KSPA 3HSDA 1RT3B 1QD1A 2E7XA 5HQLA 2M8DB 4ZVGA 3H4DA 5DDRC 4OJHA 2FHMA 2UUWA 3DRSB 4D3HA 2LQBA 4NCGB 3Q0AA 1RLCL 5ETNA 4Y2KA 1Y9OA 3BN7A 2EKYA 4ICLA 1WKLA 4KGZB 4ZDNA 2DEIA 5A6PA 1L3TA 4DR1J 4WFZA 2QMXA 3H7HB 4DF8A 2DT9A 3R97A 1K0VA 5DQHA 2VQEF 2QA2A 3SFGA 1B7FA 2HWHA 1HW8A 4JB8B 2VG6A 2BA9A 1Q53A 1BHNA 1HD0A 3CCSS 3FRYA 1TK8A 4IOBA 5KFXA 5KAKA 4NOHA 5HATA 3GSDA 2ROGA 5KG5A 1Q95G 1RTJB 3Q24A 4ECYA 2EG1A 3MEDA 3FMWA 2RMLA 3IS9B 5KFLA 4PG5A 1FKOA 2ZC3A 2NXNA 1EIYB 1TKTA 2HHSA 1D3WA 4LUBA 1XNQJ 1HFEL 4NASA 3M8PB 3TUJC 4BCAA 4GVLA 3ZC4A 1Y5NB 4P72A 5A8KA 5H9EK 4ZK7M 5FIIA 2CPEA 3E2EA 1DLOA 2WW4A 1SC4B 1U0HB 1G7CB 4WKRA 1UFKA 1JLGA 5GADU 2DR8A 2M70A 2BM1A 4J9VA 1W2BR 1VQLS 1EQ0A 2CFXA 2JLFA 4DF4A 4ECSA 1U1LA 1N0VC 1Q8LA 3UD3P 1F2HA 5HBMA 3G82A 4RBVA 3K89A 1FEEA 2Z2ZA 1SKSA 1UKUA 3TOQA 3GYXB 2EFGA 2MLZA 5L1JA 4FF3A 1UPMB 3MUVP 1K8AT 4FZVA 1SQEA 5C42B 2E5LJ 1FHTA 3TUZC 4NLTA 4ZJLA 3MMBB 4PQUA 3UCZP 2WVBA 3PX6A 2FVCA 4UOHA 3CMES 3M7VA 3PHEA 3AOCA 2CPYA 2K1RA 3D4JA 5L39A 4QPXA 1VMBA 3LH2S 1U26A 4YMEA 3WBZA 5CH7B 1U2RA 3DRPA 2IIHA 2RQCA 1GAOA 2GCFA 3MPUB 2R8JA 2HBZB 4FDFA 1WD6A 4ZLNA 3DC2A 2E5GA 4F0HA 4KPYA 2R2UA 3MDFA 5KFSA 3I6PA 2MPUA 1UVIA 4PXBA 2HHPA 4IH6A 4UT4A 2Z30B 4X66J 1S49A 2ZKUA 5HAOA 3D6MB 5KOXA 3OSNA 4NA1A 5HROB 3UR3C 2DGVA 4AXJA 5IT9U 2JJ4D 3QSYB 4GVBA 5ETVA 2UVRA 2ZBQA 2HKEA 1RWPB 2HWTA 1NK0A 1JXEA 1RWOB 1V3SA 2WONA 4DFMA 2R7TA 2F9JA 4ES1A 1IBLF 2BKNA 3NBPB 5HVGA 1WC3A 3MUTP 2JC1A 5D0HA 4WK3A 4YB1P 4UOGA 3CJ8A 4KQZA 4JI4F 4KH1B 1F3FA 3HO1A 2Y1LB 1EKSA 1HW9A 2NXJA 1L5UA 1SH2A 5J1PA 3MD1A 2ADBA 4OZ0A 4ZP6A 2YQ3A 1AYEA 4LF4F 1OSCA 2HK2A 2CRLA 4FYXB 2UUCF 1R8CA 1WF2A 2VC0A 1HNXJ 4LJMA 4P73A 3HJVA 3OLAA 4M5DB 2Y1IA 3T6JA 4QWAA 3HHDA 2MY7A 1NZ8A 2E9ZA 5KG0A 1XIQA 1NDKA 3R1HA 3DRSA 2YWWA 4NCGA 4OYIA 4LR8A 4ZVHA 3HF5A 4CCHA 2DISA 3MTJA 1HYSB 4HTJA 3HMJG 3V6JA 4DX7A 4DX8H 3W3SA 2YKPA 1C0TB 4N47A 2YKNB 2HS4A 4RX6A 3MR6A 3UN2A 4DX6A 4Q0BB 2CQ0A 4AL7A 2XMWA 3K8WA 1HQUA 2V2VA 5DO2A 3OTBA 5HJYA 3P45B 3QO9A 4PG6A 3SCKE 3MOZA 2PGCA 1I1GA 1X7VA 3A3PB 1R43A 2B8QA 3W2VB 3MR7A 2W01A 3IS9A 4M5HA 5I3UB 4DCPB 3FCWA 3OR1A 4WFBQ 3C46A 1X5OA 3V6HA 1UVKA 4CWBA 2L48A 3HHLD 2PDAA 3M8PA 2Y3YA 4ED1A 2E7WA 2RT3A 2MLYA 2BE9B 2JEGA 2IRXA 1UVJA 2DR9A 2ALZA 4QCLA 3GR0A 1SH3A 2RRAA 2QZ8A 2ZDPA 2OEJA 1JLEA 1FWLA 4Q44A 4DV5F 4LBIA 1BLUA 5GAHU 4L76A 3BEGB 1YSJA 4RZRA 1VIXA 3OHAA 4DSEA 2B51A 4ES2A 2D74B 2G2YA 2AV5A 2CXEA 3MFHA 4DV2F 4TLQA 1FNOA 2Y0SD 4ES3A 3H5XA 4NZ0A 1VRTA 3N6LA 3OLBA 2OI2A 3PIPQ 1S0MA 4RWWA 1K1SA 4ENOA 1BXNA 4PWWA 2CPFA 1U49A 1DQ8A 3PTWA 3Q89A 1ZPWX 5C42A 5EX0A 1YBUA 2P6SA 4ED8A 1JNRB 3TRGA 4H4MB 2J8SA 3MMBA 3DMJB 5L1IA 4B3TF 3GG0A 3M9NB 3T1HF 2AEFA 3PRBA 2JL9A 2MSSA 4Z7YA 2HVEA 3QJLA 2RS2A 4TNOA 2BUNA 3V81B 2OUGA 2MGZB 4JI3F 3DLKB 4WKYA 2MKCA 4ZVEA 3R8YA 2UXDJ 1FE4A 3PNIA 1RTDB 4NRUA 1BUXA 3GG1A 2HHTA 2XMUA 2C2EA 1V3RA 4WFNQ 4K4YA 3JAMU 4OYWA 3QGPA 1L3SA 4F04B 2F8EX 1X5SA 2XMAA 3CDWA 2C3PA 1FJEB 1FTRA 3NXZA 5AXNA 2R7WA 2M88A 2GX8A 1HWKA 3BSNA 3J7Z5 3K58A 3O5TB 2IJFA 4CH7A 5CABA 2ASLA 1BWEA 3VVUA 1V5IB 5J2MA 5ETPA 2MJNA 1WHWA 3K5LA 1Y3JA 3GV5B 2PEBA 3I56S 1S1XB 2DNLA 3ZZ0A 4CYUA 1GXTA 2GFFA 2ZBPA 1U7LA 3IRXA 4DLEA 3TQ1A 4UTGA 4DR3F 1TKDA 4MIWA 3ZZTA 2E66A 1X0FA 1VK3A 3BF4A 1X4HA 3DLEB 3GE9A 2QL7B 2HK3A 4ETXA 1FRHA 4K4SA 1DTTA 1FXDA 1XMOF 4OI4A 2GGPB 2YNGB 1FD2A 3SZ2A 1UJ4A 4E0DA 1REGX 2N4DA 5KFNA 1ZA1B 1K44A 2W7PA 2AQ4A 1JKHB 1VYAA 4H54A 2QYGA 3KG1A 3BR9A 2NZ4A 3OJSA 3MCMA 2OPRA 2BX6A 2FJVA 4Y2AA 3TWZA 1JQGA 5E2QA 3DM2B 2OFHX 4LBPA 3M8WA 2GZOA 2X3DA 2BJDA 3KDNA 4DDFA 2DNMA 3I96A 2YKNA 1RBLA 3OFHA 2BRKA 1RSCA 4TLRA 4IR9A 4A8QA 4Q0BA 4O44A 1DTQB 1U6ZA 2P8IA 2VG7A 3IR7B 4IOAQ 4FN5A 2BKPA 1R6YA 2R2RA 2XLKA 4CT9A 5C24B 3U1NA 2XZDB 3CJ5A 2MQ8A 2L9DA 7AT1B 1FTCA 3W2VA 1NK8A 1YBAA 2B9EA 1SQGA 2BACA 1ULRA 3G6YA 4QQBA 3FBFA 4OJ1A 1X0PA 1PGZA 2OH2A 3RRKA 1CS4B 1VC5A 4UY8T 2YVSA 3BSCA 1RAFB 4A46A 1KOOA 3TEHB 4DSLA 1Q8BA 2RB7A 2G9OA 1C1BA 3H5UA 4BHQA 1S7HA 4J7CA 4WBFA 2WCXA 2CJYB 4WP3A 1S6PB 4QIEA 3LPYA 1PYOB 4OYBA 1JLAB 3X3UA 2DH7A 3RB6A 1QSSA 4B3MF 5A2QU 4RW7B 2IDEA 1Q16B 5KTQA 4EYIB 3AD9C 1IR0A 3H8YA 2ZJRQ 4RO0A 1FD8A 5D4PA 5BJRA 4ZVFA 3VQTA 5KFFA 2JRSA 5H9EJ 2BR0A 3Q22A 1FF2A 3JYTB 3Q2TC 1N5VA 3CJKA 3OXFA 3LWLA 4FPRA 2IAJB 2O67A 3FNNA 4F36A 1D9AA 1UZHA 3CCWA 4H4MA 4AT1B 4OLPA 3FZBA 4CLTA 3KK1A 1GQEA 5K9FA 5FJ4A 3DMJA 2KM8B 4OFZA 4NRTA 1CPZA 3M05A 2OELA 4Y28C 2GIRA 1HNZJ 5DG7A 4JYAJ 1N54B 3N4WA 3DLKA 1U1OA 3I87A 2OLWA 5K14B 1UZDA 2I0XA 4ZCIA 4OYXA 2DTJA 2VQFJ 1RTDA 2DNZA 4HHJA 4XTTA 2V34A 3IA0A 5AJ3J 2B9XA 2HMIA 4FBTA 3IGNA 2AWZA 2R9LA 3H90A 1LNQA 3E01B 1XR6A 1NDPA 2G2ZA 2B4UA 1NK7A 2F7VA 4ZVOB 3SMZA 3D2WA 4ZPBA 4CLSA 6AT1B 3MEGB 2OHDA 1PC5A 1RWKB 2YKMA 4U9RA 3PX0A 5MAOA 1R89A 3L7UA 1S6OA 1S1UB 2CVEA 4RNNA 1UW4A 1SKRA 2Z0GA 4GO5X 1GTHA 3HT0A 1S1XA 1B3TA 3GCXP 2C2DA 3B54A 1OYEA 1C0UB 1LK7A 3BDEA 3CD6S 4LRBA 4MFBA 4CZCA 2EBEA 3L9ZA 2Z2YB 3MPWA 4K0KJ 2RRNA 2P2CB 4LQ9A 4LSLA 3UNGC 4ZS6A 2RD5C 3DLEA 4F0KA 4I69A 4OX9J 2RS8A 1N34J 2ZH7A 3NY0A 3MURP 3O44A 4PR6A 4J9QA 4RW4A 5DLGA 4FKYA 2GGPA 2YNGA 3M2RB 2OGUA 3JS9A 2FVQA 4F4ZA 3H98A 1JKHA 3HFVA 4JP8A 2KJWA 2OO4A 5FLXU 2FJWA 5F3ZA 1YZ6A 2U2FA 2DRDA 5K8PA 4V19J 4XDDA 4YP3A 4K5SA 3IAS9 4AQYJ 5B0EA 3I5CA 1RA7A 3DLJA 2WVCA 1S1WB 1HNIB 1DTQA 1MWQA 1T0TV 3GB0A 4L6V3 4NLUA 4ED6A 5ETMA 4E8UA 4FF1A 1G2EA 3E3XA 4LF6F 1GNKA 1VRUB 1UVLA 2BJEA 1TL5A 3BB5A 3O6QA 2NYIA 2ZE2A 3GLJA 2BDPA 4DG1B 4USUA 2CJXB 1PIEA 3EPIA 5KFBA 5CCMA 2J6SA 4HI2A 1IJFB 3LP2A 2KYXA 1TP7A 4FPIA 1F5AA 3BN4A 4DR4F 2MKHA 3M6XA 4NXMF 5EGYA 3NCPA 3FSIA 3MD3A 1LKZA 1TELA 4RWXA 1S6PA 2JSXA 4YY3F 3QIDA 5ETTA 1QVGR 3A4TA 1WACA 2CJKA 2QLXA 4F4AA 1JLAA 3TJ9A 5EDWA 4I2PB 3HDSA 4RW7A 4M8LA 3GPAA 3SV3A 2HQ3A 3M8YA 1MWYA 4C11B 4LF5J 3DLLQ 4QYZJ 2B7CB 1YRUA 5C25B 5ETSA 3OTDA 4CI0B 1O6XA 4M63A 1RAGB 4U7UK 2K06A 5IV3A 2HURA 1KQSR 2IAJA 4KJIA 4X4SA 4OI1A 5KFPA 2XCAA 2YX1A 2LKZA 3NOGA 2DNOA 3NCQA 2AYMA 1PJ6A 2QX0A 1B70B 1ZZNA 4JI0F 2XSJB 5AE1A 2Z4PA 2FTRA 2Y9HA 4G1QA 2D1CA 4ELUA 1NB2A 4DR6F 2FJXA 4JI7J 3J81j 4K7QA 1WHVA 3R3TA 1PBUA 3BKTA 2C2KB 2VOPA 1KQFB 3CPWR 3THTA 3QSIA 2V68A 3HHEA 1WDTA 5K14A 1WUUA 5IQQA 1RAJA 3H59A 4JI1J 4NLOA 3G96A 3FKBA 4RUHA 1X9WA 2GHPA 2MQLA 3D0IE 3E01A 4X4OA 1FRXA 2X1BA 1TTHB 4K59A 1BWVA 3LGNA 4NE9C 3MEGA 4O4GA 2P9CA 1U1MA 2Y8WA 1R0BG 1N8RT 2X1AA 1S1UA 4DV1F 1WG4A 1YIJS 2RNEA 1BQNA 4CO1A 4MT1A 4V1Ak 3CC4S 4KGXB 1NK5A 1XERA 2LEPA 2OKQA 1C0UA 1HHQA 2CKWA 2CZ9A 4I7FA 3VALA 3L4BC 4J9OA 2HHQA 1NK4A 2OPSA 1WHYA 1U6BA 1M1HA 3QGHA 5F41A 3KWMA 2DHSA 2A1BA 2AP6A 1RTHB 2HRTA 4X64F 2RF2B 1LXJA 2XMMA 1TL4A 2R8HA 1U48A 4M5GA 2DNYA 3HLUA 4LQ3A 3M2RA 3A1YG 5GAGI 2UUBF 3BQ0A 3W64A 2IVFB 4KT0C 2VPWB 3CF5Q 2KM8C 1TKXB 3G6VA 2B8PA 2ZBRA 3ZZZA 4DS5A 3KXDA 2PA8D 5U47A 4TVAB 4QW9A 4F7VA 3FFIB 4NLYA 2R2TA 5KFEA 3DHWC 5EWFA 2GJFA 1S1WA 3N6NA 1S6QB 5IV4A 1HNIA 2AX0A 2IMOA 3VCDA 2MXYA 3AJ2A 3PJ9A 1N32J 2ZVIA 3JQKA 2FPHX 4JOUA 1L3UA 2VFVA 1SL2A 4C9DA 1ICEB 1VRUA 2AJ4A 3HVRA 3KJNB 1IKWB 4DG1A 2J9CA 2CQ4A 2FLLA 3CIZA 4IG3B 3TO8A 5D3GB 2GMJA 2DJWA 5IT4A 4L72B 1JXLA 4DR7J 4ECRA 1HBNA 2VODA 3W1YC 2WZ1A 2DR6A 2ZUAA 4NEZA 2R7VA 3D3CJ 3DXBA 1SI9A 1EKRA 3LGMA 1SC6A 1YWXA 2IC3A 4L75A 3OV7A 1BMQB 4RU9A 3VQSA 1U2CA 5GAEI 4DS4A 1PBAA 4I2PA 1S0OA 1PYTA 4IQMA 1RDRA 1UW9A 1UWAA 1SJFA 5A8RB 2DIVA 5BYQA 4C11A 1FFGB 5KFGA 2V4RA 2VFSA 2NCKL 2A18A 4ELTA 4I0WA 5C25A 2AJ1A 2Z56B 2E44A 3EICA 1QJHA 2WRMA 1IKXB 2ZH1A 4EO8A 5BR8F 2CWXA 2EK6A 1B7YB 1GX5A 2IM1A 1U24A 2IRUA 1VI7A 3QPIA 1ZH5A 1XNRF 4OQJA 3R5BA 6FDRA 1ZM2A 4EUVA 4G1PA 4NMLA 4OI6A 1VLOA 1WC0A 2J7KA 3ENWA 5LM7E 2ACYA 4OHYA 4MKVA 1GXLA 4B3SF 3EZ5A 2EK1A 4A8SA 2QEXS 1S9FA 5ADZA 1J5EJ 1S9GB 4FVCA 4O3OA 4AUKA 4X62F 2WK4A 1M1KT 2BW2A 2XWYA 4AYBD 5LSRA 4ZP8A 2NXEA 4WP9A 1OMSA 1S97A 3L09A 4ILLA 1APSA 2PD1A 1VOMA 1CG2A 3I0SB 4NXNJ 2NSBA 5L46A 4FP9A 1J2VA 4K4VA 2CQBA 1VHFA 3W7BA 2KN4A 1CJUB 2WVDA 3D6TB 4DL7A 2VHGA 1MMLA 2RKIB 2DGQA 3CT9A 4NLWA 2W9AA 3KK3B 2XGQA 3CD5A 2RU9A 3LUYA 5E5NA 4DL5A 2F9DA 1O5JA 2MZJA 5T41A 7FDRA 1OQ3A 4KR0B 1B99A 1H72C 2CPZA 2ZM6F 4DV0J 2NPFA 4C2MA 2XWXA 5KFMA 4USIA 3IP0A 2RF2A 4DPWA 5AXMA 2ZD1A 2W25A 3FDSA 3MM8A 1M90T 1RACB 4J9KA 3OXGA 4ID5B 4DR5F 3R5GA 3WHIA 3ISND 5DDOC 4I2QB 3GU0A 4OL8A 1KWMA 1T9VA 1WEZA 5GVQA 5ETLA 2QG9B 3B4DA 3CJ4A 4PXCA 3OVBA 2B6AA 4GKJF 2BXJA 2PIIA 1H7XA 1WKJA 1DQ9A 3NNAA 1ZM4A 1C4AA 2EC2A 1FO1A 2ILZA 4WF9Q 4JI6J 1S6QA 3BZQA 3MMJA 3SCIE 1VQMS 1D09B 4ILRA 1JLCA 2ZOGA 3ZO7A 1JIHA 5LMUJ 3IN5A 1XC9A 3OXLA 1WF1A 1RISA 2AEMA 4DFPA 3CCJS 1IKWA 2FQQB 5BXIA 1KOHA 3MM5B 2YQ1A 4J91A 3G8QA 4CQ1A 4IG3A 5D3GA 2H5IB 5B0FA 1NJXA 5LXRA 3MCSA 2FVRA 4KKOA 1F60B 1TKZB 3HHNB 2PMHA 2IM3A 4ZPTR 3NS6A 2GO9A 4ZLPA 3BGOP 3W62A 2I8EA 3HKZD 1T03B 2EG2A 2H5EA 3TAPA 2KXNB 2XEXA 2C3OA 1I94F 1GMWA 1GMWD 2FZCB 3ISZA 5A8RA 5T7LB 5F3TA 2ZH4A 3DCAA 4LRDA 5GAGU 1LEOA 3TQEA 2E5JA 4PG7A 2YY3A 2D3OR 2ZVSA 1IKXA 3LAMA 5I42B 2ERRA 3T5KA 4V19X 1DURA 1N88A 3RW7A 2W24A 2XO6A 3MM7B 2UUAF 4NLSA 3TVYA 1QE1B 1R27B 3BGFA 4M5JA 4L3KA 1SIWB 2KYZA 1KS2A 3MGJA 3MECB 1WI6A 3DN9A 3O3LA 1URRA 2ZBIA 4JI8F 4ECXA 1IQTA 3HFKA 1H98A 2QC3A 4F8RA 4DXLA 2QV6A 1RT6B 2V8GA 2IBOA 1SJQA 3KUEA 5LSLA 1F5BA 4IDKB 1RT2B 4O23A 5J2PB 2WB4A 2DB1A 1KEKA 5EWGA 5KFUA 2E9TA 1UA0A 3HD2A 2I2YA 5KT2A 1FT8A 4OMFG 3I0SA 1YTYA 2W9CB 4TXSA 3GR1A 4RW9A 5GAEU 1CJUA 1K47A 4NA2A 1LWXA 1FDBA 4CT8A 2HGLA 2AYBA 5GMDA 3ZZRA 2XY5A 2MY8A 2BOPA 2WSCC 2BANB 3GJTB 2W1BA 3KK3A 4LT6A 4OYPA 2PFDA 2XS7A 1A9NB 2UXBF 1RT1A 4EGLA 2HFUA 4QJVA 5B0DA 4O0NA 1PKUA 2DR7A 5HO4A 3T9ZA 1SH0A 3U7JA 3EVWA 5E3RA 2M7SA 5D6GA 3QJJA 2WOMB 4CTAA 2NPIA 3B82A 3SXLA 3C14A 2OPPB 1JX4A 4IR1A 1XMQF 2DXDA 2KRRA 1M5VC 3QYYA 1TL7A 4I2QA 3MWBA 1P9QC 5KFVA 2G13A 3N79A 5HI7A 3ZNJ1 2R8IA 4LR7A 5F9NA 4USKA 2YNFB 3OSPA 3OUYB 3OTEA 1KBRA 2NZCA 1Z2LA 1J27A 3EM1A 1R0AB 4J5OA 1N5QA 2LQ9A 1HWUA 1VK8A 1U1RA 1VQ7S 2HHHF 2CG8A 4KV8B 1IBKJ 1Y0HA 4M1KA 4WXOA 1RABB 2CZVC 1HNWF 2GS8A 2BOAA 2E1AA 2X1GA 1ZM9A 1JLFB 2YNHB 3F0NA 1C4CA 4DMZA 3GIJA 1LQ9A 3C16B 5IQ6A 2K3IA 3MM5A 1KDNA 2ROEA 2PC6A 4G6VB 3Q8YA 3GV7B 2HGNA 2LQ8A 1Q81T 1K73T 2HAFA 3SSRA 1B4SA 3CB4A 4CRJA 3LP0B 1WOOA 4GMKA 2AJFE 2RDIA 4N41A 2EI5A 2W8KA 4TU8A 3SFUA 2QIFA 4E2FB 3G8TA 1PAUB 1Y7PA 1N36F 1EJ7L 3SQGB 4UZBA 3R6GB 2KJVA 2LEAA 4I67A 3EXYA 2WAQD 3Q8RB 5F0UA 3CCTA 2M4MA 4F0MA 1YHQS 2DIUA 2RAQA 3UE2A 3UFCX 1N56A 2BKOA 1N48A 2A0FB 4MKBA 5A8WA 2P5VA 1VBZA 4A8FA 1FRKA 4M94A 2POKA 4QR1A 2QA1A 3MM7A 5D0RA 3DKDA 4Y2IA 4O3SA 1IR1A 5EUHA 3CMQA 1QE1A 2AJQA 3DOKB 4EBEA 4LFCJ 4MK9A 3VV2B 4PZVA 4F4XA 5I3PA 1T9YA 4USJC 3MECA 2QT7A 2FB0A 1YDLA 3NWRA 5HMZA 4Q5VA 1GEHA 1ELOA 3U27A 1TAQA 3S8SA 1RT6A 3I9V9 2FVSA 1P1TA 1FWKA 5CHCB 1RI7A 1X5PA 4UY85 4Y0FA 2CNLB 2DITA 4DR1F 4CLPA 3G9CA 3TANA 4DU7A 2W9CA 2Q6BA 4F2SA 4R8UB 3QJPA 1JB0C 4DV4J 4DSIA 5CD4H 1YX2A 2JEJA 1G6BA 1SUQA 5E3AA 4PCQA 4CP5A 2XZWA 4B9VA 4RBUA 3KDOA 1XNQF 3VGSA 3LQVA 2BV3A 2B9WA 2VFUA 4P71A 4HH1A 4RJVA 2MZQA 3AAWB 5J1EB 4U95A 3D1HA 2QO3A 2WOMA 2XHWA 2DXFA 2N82B 2VC1A 1ZPVA 5F8MA 2CQ2A 4B08A 3FQLA 1RU1A 4QZVB 2FJBB 1N5YB 1VC0A 4URQU 4DUYJ 2CPHA 3OTOJ 3CD0A 4C8NA 2K8GA 4RUCA 2M5YA 2YNFA 4YHHJ 1UJ6A 5D0EA 3OUYA 3RB3A 1X4AA 2ZC4A 3MR5A 1REVB 1DRZA 4DUZJ 1R0AA 4KV8A 2FHJA 3UW1A 2FHJD 4EK2A 3KUHA 4KSEB 2E5LF 3BQ1A 1FX4A 3QZ8A 2F5GA 1HR0J 1HWLA 3FQKA 3PFEA 2HNDB 5B08A 1JLFA 2YNHA 3C19A 2MZTA 1CULB 9RUBA 2RJZA 4PAAA 1B64A 1EB0A 3C16A 3BO3A 1T9XA 2MJUA 3OR2B 2I38A 5D15A 1RP5A 1YKWA 2J0SD 3LF0A 4F2RA 3V4MA 3BH6B 2A3JA 1TUWA 4LF9J 1Y4ZB 2YKOA 5JMNA 2HPUA 3KJFB 3EDQB 3HZGA 2M0GB 4YB5A 5F8LA 3TUPA 1IBCB 3RBDA 2HBRB 5LL6d 1U2FA 3OQ2A 4X65J 1D8YA 1RAAB 2BJ7A 4IYQA 3SQGA 4X66F 4ZP9A 4C0HA 1NU4A 4ID8A 4WJBA 5SUHA 2RIJA 1VS3A 2C1EB 1SL1A 4WYLA 3QGGA 3VWSA 2XYPB 2MKJA 4O3PA 5E3QA 1KN6A 3WIUA 3CJ2A 4ER8A 2ZFHA 3CJ0A 5IWAJ 1X4GA 2GO8A 1RBAA 3NS5A 3ZTQA 2C42A 2EFNA 4C8OA 3UN3A 4AFFA 3D9BA 3I55S 1CBKA 3DLHA 4CO3A 5D77A 3SDEA 1YRTA 3A12A 3DHXA 2OAUA 4OI0A 1EHWA 2WTFA 2N4CA 5DG9A 2LLZA 1S12A 3PW7A 1H74A 3AQPA 3DOKA 2BJ8A 3W61A 2PE8A 1RB0A 3L95X 2BQUA 3CGIA 1HNXF 4ZITA 3P6YC 4U6PA 3AB2B 2LFVA 2A6MA 3FCHA 4NLXA 1S77D 4KPCA 4USHA 4XDCA 2Q6CA 1ZS6A 1YJ9S 2BZ2A 2BRLA 1YVFA 2ADCA 4OV1A 1ZTWA 1N6QB 2W2MP 5G4DA 1QTMA 1S6UA 1S1VB 3DYAB 2O5DA 3SBMA 1HNVB 2F1FA 1CQNA 1D8ZA 1N5SA 5HK4A 2GA7A 1HWJA 3MUMP 3MAHA 3PO4A 1XJWB 2YH0A 1TK0A 4CO2A 1CJTB 4QWCA 1UEVA 3RBXA 1I6JA 4C8ZA 2R4FA 3VF0B 4JI2J 5HP1B 3CJSA 2CIMA 3VHQA 2HLUA 2FUG9 4IOCQ 3ADAC 2F40A 3J7AN 3QFHA 3FMBA 2IMWP 1AXQA 3MMAA 4DV7J 1S59A 4WIQA 3ILJA 5IFMA 3P96A 1BY9A 4Y65A 1NJZA 1V5VA 2ZH8A 4LSZB 2JDJA 2BE2B 1HI0P 2ALYB 3F41A 1SKWA 3DU5A 2QTWA 4DR2J 2KL8A 1ZM3A 2B3TB 3GIKA 2R8GA 3IM9A 1D0EA 2ZNZA 4B9TA 4C48A 3I0RB 1K9MT 5K8OA 4YN3B 3MAAB 4PG4A 2RILA 2ZUGA 1S57A 1FX2A 3CD7A 2P6TA 5CD4A 3TJAA 3KLIA 1RKJA 1Y3KA 1VBYA 3V4IB 1VQ8S 1REVA 4O0IA 2ABYA 2B56A 1FJGJ 3AD8C 1KFDA 3UR0A 3WDOA 3BSOA 1SV5A 3D66A 5HQ8A 2C2OB 2XCPA 2HNDA 2C2RA 1XWLA 2RUGA 1CULA 2DK2A 3FBCA 1RE1B 3RJMB 3PYFA 4N76A 3CC2S 3CE8A 2XG8A 1IQZA 3OR2A 4HYKA 3PO5A 1U09A 2XMVA 3M2VA 1VCTA 2YWKA 4K2JA 3C3LA 4TY8B 1XBWA 3W65A 4PXDA 2UXDF 2EKNA 9ATCB 3SSSA 3QFWA 1XTZA 4ANCA 1RHJB 3CW2C 1YITS 4NYPA 2KFZA 4EEYA 3OFEA 1RT7B 3EGNA 1MU2B 4JBCA 2VIHA 3EGVA 2KFYA 2OEMA 3CJRA 3GFYA 3IBWA 2NUHA 3AH6A 4QPTA 2J6TA 1Q4RA 1Q5VA 1UMJA 2DEJA 2V9WA 2OSQA 2QYCA 3L7PA 2Y1RI 4EBDA 5GMEA 2VOOA 1IKYB 3HK2A 3EJMA 1CLFA 1YJUA 3KHHA 1OJ4A 1RHKB 4DPYA 1T02A 3K5NA 2C22A 2M3DA 2RRBA 4XK8C 3NG8A 4KY3A 2KVIA 3SEOA 2W7OA 4CLKA 2H48B 4MAKA 4ED4A 3W2WA 2YX4A 4QW8A 4DEZA 3I9ZA 3AFGA 4CH0S 3J80U 1TK5A 4Y00A 3Q8QB 2YKAA 3NAHA 3CCUS 3LA0A 3OPKA 2BE7D 5CYMB 3AXKA 2DRAA 4N8OA 5EN1A 1HHSA 2MDAA 2DKOB 2DNNA 1N6QA 2H9ZA 5C5JA 5C2GA 2W2PP 1S1VA 1NJIT 1MROB 3DYAA 3QBCA 2GVZB 1YK9A 1HARA 3TZYA 1HNVA 2GVDB 3Q23A 3D7SB 1FXLA 3OL9A 3P3DA 4QR2A 3KG0A 1YJWS 3QAEA 3KFWX 1RWUA 3AOAA 2JFDA 1CJTA 2HEKA 4DUTA 1NKBA 1F5CA 2O01C 2CUYA 2JH3A 3PJWA 4DSKA 3PYEA 3UCGA 5HP1A 4U67Q 2VFTA 3OJUA 3K8VA 1RWVB 3JXOA 1DY3A 2DNGA 4YEAA 4XAKA 2V2KA 2FHOB 2Y1JA 3S01A 3HVTB 5J2NB 2G0IA 4F3MA 1C1CB 1LWFB 2DPJA 3MI7X 5F8JA 1FWPA 4F50A 3VGUA 1FK9B 1SVDA 2BE2A 3IC1A 3H2LA 3CCQS 2AGPA 3TW0A 2VH7A 4P75A 3ZZPA 4KIAA 4OIXA 1BE4A 3J7A1 4O4RA 1VGYA 2IDLA 3I0RA 4KGMA 3PW0A 2OSRA 3UDEA 3MAAA 5K8MA 1T95A 2MZSA 2DCLA 3EMTA 3FEYB 4OHWA 3IG1A 1AUDA 2CDQA 2D9OA 3DU6A 2DRBA 3GIMA 1NEEA 4Y3CA 2LQJA 1TV6B 1KHVA 4ZMMA 5JUMA 2AT1B 3N28A 3QZ7A 1N52B 1HKAA 3V4IA 2GQQA 3BBCA 2VBXA 3BR8A 2XMTA 3KOAA 2OJ3A 1CQMA 1EAYC 1U02A 3TVKA 2J7UA 3HFZB 3KUGA 2CAJA 4CNYA 3CCVS 1WF0A 4WIIA 4USVA 1X4EA 2E1CA 1KTVA 4DX5A 3DGPA 3BGRB 1SJ1A 2J0QD 4LRAA 5KFOA 5BYSA 2F4FA 2ZH3A 2EW9A 1R8AA 4OX8A 3W8GA 4NCAA 1HNZF 2EFVA 4JYAF 3V6DB 3OL8A 4ANEA 2NLWA 4DL6A 1T11A 4TY8A 5LMNJ 3PVXA 4ZPWR 3G71S 5M2PA 4C97A 2VQFF 3UN5A 3CIMA 4DV6J 4TQRA 1RCOB 1MU2A 2VDIA 1GFWB 3V5RA 5AJ3F 2DHGA 2FHKA 3BYPA 1IWAA 3VAHA 5KT7A 3PKMA 1BQMB 2X51A 2MTLA 1RT3A 3HVWA 1NCLA 2V94A 4R0EA 2UVWA 3DLGB 2N3OA 4I6AA 4MYUA 5F8NA 2V4QA 1A0OB 2ACMA 5B09A 3Q8UA 3BPDA 1HLWA 2C2NA 3I82A 3TJ8A 1MWZA 2JHEA 3NNHA 3EX7B 2UUTA 3T6BA 4K0KF 4XPCA 4EYHB 1WOPA 2ZNYA 4ECUA 5M2RA 3BO2A 1HBMB 4ERDA 4OX9F 1RA6A 1N34F 2AX1A 2AYGA 4DPOA 2G1HA 1RTJA 3WIVA 5F8HA 5CYMA 2HIYA 1LW0B 3DOMB 4NLVA 1Y5IB 4KTQA 4PYAA 3QT6A 4ZHRB 5E7OB 1TZ0A 1X4BA 1FA0A 2DO0A 1K0TA 1QM9A 3CCZA 1H2TZ 3QAUA 2GVDA 3DRXA 4ECWA 4IQXA 4AQYF 4Q45A 2FC8A 1U0HA 1FE0A 2G1DA 1Z1ZA 1FDDA 4J9MA 2IY5B 2LP4A 2BMBA 3JSMB 3GJRB 4ZN1A 4YDDB 2OP5A 3DDKA 3LWMA 2OD6A 1RWXB 3RAMA 1RT4B 5KFTA 3M4XA 5F8GA 4EO6A 4ZCKA 1R8BA 4XO0A 2UV8A 4C6AA 5J2NA 1YJVA 3RBZA 3SCJE 1EQMA 1W25A 5KT6A 1C1CA 4CDIA 4G3IA 1LWFA 3NEKA 2DGXA 2HRUA 2AEJA 1FK9A 4DFJA 4EMDA 3AODA 5E3CA 2NXCA 3PKYA 1S4EA 1QLNA 4USTA 1YZ7A 2L9NA 2QE5A 4AXIA 2EWHA 1KNZA 2RHSB 4UOFA 2XNQA 4YFUA 2F8MA 2YQ0A 5M2UA 1J5OB
chains in the Genus database with same CATH topology
3WX4A 4DR5F 3IWXA 3TNVA 2C3UA 5B0GA 1KSPA 4FVMA 1S1TB 1IXKA 3ISND 2MQOA 5DDOC 2MKKA 4I2QB 4OL8A 1T3NA 1RT3B 1WEZA 2OMLA 2E7XA 5GVQA 2M8DB 3MM6A 4ZVGA 3H4DA 5DDRC 2E1RA 1TV6A 3B4DA 3RU0A 2AGOA 3CJ4A 3KMSA 3VR1A 4LF5F 3M1VB 4OJHA 2A2DA 2FHMA 2UUWA 3DRSB 1RT2A 4IDKA 4URSA 4D3HA 4PXCA 3OVBA 1TAUA 2LQBA 2B6AA 4GKJF 2BXJA 2PIIA 1H7XA 4NCGB 1DQ9A 5DS7A 2SXLA 2V8VA 3D0HE 4HDHA 3Q0AA 4ED2A 2IM0A 4FS1A 3NNAA 1ZM4A 2J7WA 4IO9Q 1U6FA 4Y2KA 4ETZA 2RQKA 4HL9A 1Y9OA 2W4DA 3BN7A 5FDLA 5BYRA 1JNZB 5DETA 2EKYA 1C4AA 4ICLA 2EFQA 1VQ4S 5A0YB 1QSYA 1WTBA 4ZDNA 2GV1A 5A6PA 1FO1A 2ILZA 1L3TA 4WF9Q 1S6QA 1ZAWA 3BZQA 3MMJA 4WFZA 3SCIE 1UFWA 2QMXA 1VQMS 4DF8A 2DT9A 4TYAA 1K0VA 4ILRA 1JLCA 2MQMA 5DQHA 2QA2A 2ZOGA 2VQEF 1FNXH 1SJRA 5HROA 3SFGA 1B7FA 2HWHA 1HW8A 2J8AA 4K5RA 5D4NA 2EFOA 2VG6A 2BA9A 2JEFA 1Q53A 1HD0A 2CG4A 1JLBB 2ZKTA 3N9UC 1JIHA 2ASJA 3CCSS 3FRYA 1TK8A 2OMOA 3IN5A 4IOBA 5KFXA 1XC9A 3OXLA 4ZPVR 1OPIA 1WF1A 5KAKA 4ECQA 1RISA 4NOHA 1RTIB 2HIQA 4UUXA 3GSDA 3N5BA 4DFPA 2ROGA 3CCJS 5KG5A 2MSTA 3LO3A 3LP1B 1CC7A 1M5OC 1KHWA 1QAJA 5HLFB 1IKWA 1RTJB 4JI7F 2BANA 3Q24A 3NBPA 4ECYA 2EG1A 2JVOA 3MEDA 1CC8A 2QRRA 2COLA 2RMLA 3FMWA 1KOHA 4DSFA 3V6DA 3IS9B 5KFLA 3MM5B 4FBUA 3G8QA 4PG5A 1FKOA 5KG6A 2ZC3A 4IG3A 4CQ1A 2QA4S 2G0CA 3M9OB 1TKTA 5D3GA 2HHSA 1IKVB 3KYLA 1S10A 1D3WA 4LUBA 1HFEL 5B0FA 2HWIA 3M8PB 1NJXA 3TUJC 5LXRA 3MCSA 2FVRA 4KKOA 5GMKa 4BCAA 1F60B 3JSRA 2DGSA 2HHUA 1TKZB 2AYEA 3ULHA 3ZC4A 3BQ2A 4JI1F 1Y5NB 3HHNB 4PKDB 1NK9A 5A8KA 2PMHA 4H4OB 2IM3A 2OPPA 3NS6A 2GO9A 4ZPTR 4C3LA 1R3NA 4ZLPA 4ZK7M 2VG5A 5FIIA 2I8EA 5B0CA 2CPEA 3HKZD 1T03B 1BQMA 5F0WA 1DLOA 4M5DA 1TL3B 2EG2A 3E2EA 4YR3A 3MFIA 1WWHA 1FDAA 2Q43A 2H5EA 3LOUA 1A7GE 3MF5A 1G7CB 3TAPA 4WKRA 4Q8FA 1B0PA 2QSFA 3KLEA 4RNFA 4CO4A 4OI2A 2HRYA 3M32B 2KXNB 2XEXA 2D41A 1JLGA 1Y5LB 3NP5A 5GADU 2C3OA 3ZZOA 3PEJA 2DR8A 2M70A 2BM1A 4C0OC 1I94F 3DRRB 3CXCR 2MHEA 1NJWA 3KLFB 3MR3A 1W2BR 2FY1A 1VQLS 2CFXA 2JLFA 3TA2A 1E6VB 3NCRA 1BC6A 3ISZA 3FEZA 4DF4A 4MIAA 5A8RA 4ECSA 1U1LA 1N0VC 5T7LB 5F3TA 4JUZA 2ZH4A 1Q8LA 3DCAA 2UVUA 5H1SV 5KFJA 3UD3P 5GAGU 3IXQA 5HBMA 4RBVA 1YJNS 2MKIA 2E5JA 1HYSA 1FEEA 4PG7A 1SKSA 3RTVA 1UKUA 3TOQA 4WE1A 2KRBA 2YY3A 2ZOFA 1C0TA 5LJ5Y 1GH8A 4R5PB 3U1LA 3GYXB 3O1LA 2D3OR 2AJ0A 5K5MA 1IN0A 2EFGA 4GC6A 2ZVSA 1IKXA 1RK8A 3LAMA 5I42B 2ERRA 2IVYA 5L1JA 3T5KA 4FF3A 3RAXA 2ZHOA 3MUVP 3B4MA 1K8AT 4FZVA 3I5BA 1SQEA 5J2PA 4V19X 4YB6A 1OPZA 5C42B 1HBMA 1DURA 4EWTA 1N88A 4RW8A 2PN6A 3OFFA 2W24A 3RW7A 3MM7B 5J2QA 1FHTA 3TUZC 3KLVA 2UUAF 3DI6B 4NLSA 3TVYA 4NLTA 1Q1KA 1QY7A 1QE1B 3CTRA 1YG0A 2L41A 1R27B 3BGFA 3MMBB 4PQUA 4NZ6A 4RNOA 1B0VA 3O2IA 2PA3A 4DL3A 3UCZP 4J37A 4MK8A 1LW0A 1SIWB 2KYZA 2X3GA 3DOMA 5I3UA 3TP2A 1KS2A 3MGJA 4X4QA 3MECB 1WI6A 3DN9A 3O3LA 3H25A 1URRA 2ZBIA 4JI8F 4ECXA 3R1LA 3HFKA 2L9WA 2ZD1B 3PX6A 1XN9A 4I68A 2FVCA 1H98A 1IQTA 4MH8A 3CMES 4F8RA 3MM8B 3PHEA 4B3OB 2CPYA 4WU3A 3RRGA 2QV6A 2K1RA 1N5TA 3C8YA 1HWIA 5L39A 1NHUA 1RT6B 2VPYB 4HH0A 4QPXA 1VMBA 2DNRA 3LP0A 3LH2S 1U26A 4YMEA 2V8GA 2ZH5A 4K4ZA 1HA1A 1P8GA 4D3GA 2ZH9A 2IBOA 3WBZA 3CO9A 2GMLA 5CH7B 1U2RA 3DRPA 1ZAXA 1SJQA 5I3QA 2RQCA 4JV0A 3R5CA 1GAOA 2GCFA 3OW2R 5JXSA 3I5AA 3VAJA 2R8JA 3F56A 5LSLA 1F5BA 1WD6A 4RU2A 3GYNA 1LW2B 4IDKB 1RT2B 1HI1A 3DC2A 2E5GA 4KPYA 2V0NA 2B6AB 4KHMA 4O23A 5DRKA 5KT3A 5J2PB 3JTPA 2R2UA 3MDFA 2Q3PA 2WB4A 2JLGA 5KFSA 1ZOTA 3JSMA 1S72S 1OO0B 2DB1A 3I6PA 4ZA1A 4ZCMA 5IM0A 2XMKA 1KEKA 5KG2A 2MPUA 5EWGA 5KFUA 1UVIA 2NS1B 2E9TA 1VQ5S 1H7WA 1UA0A 2BQRA 3CCMS 1N32F 2I2YA 5KT2A 2NR0A 4PXBA 2ZJPQ 2HHPA 3VAMA 4IH6A 3I31A 1FT8A 1T8EA 1M5SA 3QIPA 4OMFG 3EYZA 4NLPA 1RT4A 3I0SA 4I6WA 1X9SA 1S49A 2CQ1A 2ZKUA 1MMNA 1YTYA 4X84A 2W9CB 5KOXA 1JLCB 3OSNA 3T5JA 1O8BA 3H20A 4TXSA 4NA1A 5HROB 3GR1A 4NX9A 2V4JA 5CYQA 3UR3C 4RW9A 1VLYA 2DGVA 5GAEU 2IM2A 1TR0A 4AXJA 2IA0A 2JJ4D 4NA2A 3NNCA 1FDBA 4CT8A 2HGLA 2UVRA 2W8LA 2AYBA 3FVYA 3ZZRA 2XY5A 2MY8A 2HWTA 2QFJA 1NK0A 1JXEA 2WONA 1V3SA 2BOPA 2P9GA 2WSCC 4DFMA 3KLGA 2L3MA 2R7TA 2F9JA 2BANB 3FEXB 4ES1A 3NKYA 1IBLF 3NBPB 4I6YA 3CCLS 5LMNF 3CDEA 3MUTP 3PR5B 3WC0A 4C8YA 3KK3A 3MEDB 2LXUA 4LT6A 2JC1A 4DR7F 4WK3A 1GT8A 4YB1P 2XS7A 2FD2A 1WHXA 1A9NB 1Z2ZA 1RT1A 2UXBF 4EGLA 5DQIA 1FKOB 4QJVA 2VKRA 4IFYB 4KQZA 5B0DA 4JI4F 1TKTB 2DR7A 5HO4A 4DV6F 4HEA9 4UOCA 3HO1A 4WU2A 3T9ZA 1HW9A 1SH0A 3MTKA 3U7JA 2VONA 4C7QA 1L5UA 5E3RA 4KKOB 4PQAA 1SH2A 5J1PA 3MD1A 3KNAA 3UWTA 2M7SA 5D8HB 5D6GA 3QJJA 2KHDA 3H2VE 1NKCA 2ADBA 3O8WA 2WHOA 4KC5A 2WOMB 4OZ0A 3SCLE 2K7JA 4ZP6A 4ZCLA 2YQ3A 3IAM9 1Z4UA 4CTAA 2NPIA 3B82A 3OL6A 3SXLA 4LF4F 3AHPA 1OSCA 2UUCF 2CRLA 4OJGA 4YUDA 1R8CA 2OPPB 2PO4A 1WF2A 1JX4A 2VC0A 3V81A 2PI4A 4LJMA 1VJWA 4IR1A 4K50A 1XMQF 4RKUC 2MGZA 3ENQA 1J5OA 2MZ1A 3CCRS 5JVHQ 3OLAA 2KRRA 1M5VC 3QYYA 4M5DB 2Y1IA 3K5PA 3T6JA 4QWAA 4I2QA 3HHDA 2MY7A 2E9ZA 3MWBA 2Q1LA 5KG0A 1DARA 2OFGX 4OZLA 1P9QC 5KFVA 2G13A 3N79A 5HI7A 4YB7A 3NWGA 3H5YA 3M1VA 3R1HA 3DRSA 3N01A 2R8IA 4B17A 1VQOS 4OHVA 4X4NA 2JC0A 4NCGA 5HN0A 5F9NA 1KD1T 2YNFB 2HQIA 5DGBA 3OSPA 4ZVHA 3OUYB 1UP1A 1D9DA 3HF5A 3OTEA 3PJXA 1U8SA 3T5HA 1Z2LA 3F44A 1OS5A 4CCHA 5A0YA 2DISA 3MTJA 1HYSB 4HTJA 5KFDA 2YNIB 2VL1A 4MKAA 3HMJG 3V6JA 4DX8H 3W3SA 4ELVA 1R0AB 2YKPA 1C0TB 4J5OA 4N47A 1N5QA 2LQ9A 2YKNB 2HS4A 1HWUA 1VK8A 3D1QA 4RX6A 1VQ7S 1U1RA 2HHHF 2XS5A 3MR6A 4R8UA 4KV8B 1Y0HA 4M1KA 4Q0BB 2UZAA 4WXOA 5L1KA 2CQ0A 2CZVC 2QMWA 1JLBA 4AL7A 2XMWA 1HNWF 3K8WA 1T94A 2FLNA 1HQUA 2E1AA 5DO2A 2X1GA 1ZM9A 1RTIA 3OTBA 3H4BA 4DQSA 3F73A 1JLFB 2YNHB 1FVQA 1BQXA 3QO9A 4PG6A 2ATLA 1C4CA 2KG0A 3SCKE 4I1TA 3LP1A 3MOZA 4DL0C 4DMZA 2PGCA 2AD9A 1NNDA 3PDNA 1I1GA 1X7VA 5HLFA 3GIJA 1LQ9A 1R43A 1XMBA 2HFOA 2ILYA 2W4PA 3KG4A 1HBUB 4R0JA 5DQGA 5IQ6A 3W2VB 1KVJA 2HNYB 2K3IA 3IS9A 1LOUA 3MM5A 5L9NA 5I3UB 3C46A 3OR1A 4WFBQ 2CJBA 1X5OA 3V6HA 1UVKA 4CO0A 2ROEA 2L48A 1J5EF 2PC6A 2LDYA 3HHLD 4G6VB 5J1EA 2PDAA 3M8PA 4H4KA 1DBDA 2FGOA 3ETOA 5E3PA 3HP6A 3RW6A 3GV7B 4TKTA 2HGNA 4ED1A 2E7WA 1Q81T 1K73T 2FLPA 2RT3A 2RSQA 2K1RB 3I32A 3T9NA 3SSRA 2JEGA 2XY6A 2GMHA 2IRXA 3CB4A 1UVJA 3LP0B 2DR9A 2ALZA 4EZ9A 4GMKA 4CNZA 4H4OA 2XO7A 4UQTA 3KHLA 2AJFE 2RDIA 3L3CA 4N41A 4QCLA 4C8LA 2EI5A 1SH3A 3GR0A 1X4CA 4HI1A 2RRAA 1W2IA 2C3YA 3HPOA 1MNEA 2QZ8A 3IGVA 2W8KA 4TU8A 1NB7A 1TL3A 2ZDPA 3FSXA 4GC7A 2W9BB 3SFUA 2QIFA 3G8TA 2DH9A 1JLEA 4ZPCA 2FDNA 2LA4A 1Y7PA 1F2GA 4HVZA 2AU0A 4NLQA 2KT2A 2YKQA 1E6YB 4Q44A 1N36F 4DV5F 3M32A 4QIVA 1N5YA 2AGQA 2MQNA 1JJ4A 1BLUA 3GFXA 4B9LA 3MZIA 5EWEA 5FD1A 3SQGB 5GAHU 2QA4G 2KKHA 4NXNF 3KLFA 3BEGB 4PRFA 5DDPC 1YSJA 3IR5B 1CVJA 2KJVA 2LEAA 1E6VA 2R2SA 4F4WA 3M8SA 1FCAA 4RZRA 1DHMA 2XLJA 5KG1A 1MSWD 1VIXA 4YR0A 4I67A 3OHAA 3EXYA 5LXYA 4DSEA 2B51A 4ES2A 2D74B 1KLNA 3DM2A 2AV5A 3DRYA 2WAQD 4R25A 4A48A 3Q8RB 3MFHA 5DLFA 5F0UA 4TLQA 1FNOA 2Y0SD 3CCTA 4ES3A 4DV2F 4NZ0A 3H5XA 1H38A 2M4MA 1YHQS 5CXTA 3EPGA 3BGLA 1X4FA 2DIUA 3G6XA 4K4TA 4RW9B 3UE2A 1VRTA 3UFCX 3TARA 3N6LA 3OLBA 4R5PA 1N56A 1N48A 1LWEB 4MKBA 5A8WA 3UD4P 2P5VA 3PIPQ 3CJ3A 1S0MA 1VBZA 1KRPA 2DGOA 3EGZA 4RWWA 1MMDA 1K1SA 1FRKA 2B9YA 4A8FA 2CPFA