1TUVA

Crystal structure of ygin in complex with menadione
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Protein ygiN
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tuvA00
1P8GA 2QIFA 2RMLA 2PD1A 2AJ0A 4NL5A 2AP6A 2RSQA 2VV5A 5B0DA 3QMQA 2ROGA 3IWLA 2GV1A 2KT3A 3HHLC 2FB0A 4OJ1A 2QLWA 4Y2MA 3KG1A 2EW9A 1N5SA 2K1RB 3HF5A 2OAUA 3WDOA 1OQ3A 2W4PA 2ROEA 4YEAA 1URRA 2GFFA 2GGPB 2GO8A 2K7KA 1Y0HA 5K9FA 4OJ3A 4A47A 4Y2IA 1MWZA 1Q8BA 4HH1A 2ZDOA 2OFGX 4HH0A 5B0BA 1FESA 4A48A 1P6TA 1YJTA 1Y3JA 2ACYA 2KKHA 3VTIA 2LQ9A 3HFKA 4U9RA 2BYCA 3MZIA 5B0EA 2QYCA 3IWXA 5B09A 2XMVA 3F44A 1TR0A 2N4CA 1TL5A 4ZA1A 1W2IA 1FVSA 2HQIA 2AW0A 2HFNA 2HIQA 2L3MA 2RILA 3FGVA 3KNGA 1KVJA 1AFIA 1N5TA 4OIXA 1CC7A 2OKQA 1YJVA 1AW0A 4FNHA 1YG0A 3E8OA 5IXUA 4EFAC 3DCAA 2FIUA 1YJRA 1YRXA 1FE0A 1KQKA 1Q8LA 5B0CA 2XMTA 3GZ7A 1Q4RA 1APSA 1K0VA 1X8DA 2AJ1A 3LO3A 4OJGA 2VH7A 2LDIA 2K2PA 3LGMA 5B0AA 5T7LB 5A6PA 4QOTA 1VQSA 4ZOSA 3FRYA 1Y3KA 3HHLB 2BUNA 1TL4A 1MWYA 2XMMA 2IYIA 4F67A 2OFHX 1SQEA 3I9ZA 2OMOA 1OPZA 1XBWA 3UDCA 3HHLA 3KG0A 5F0WA 2CRLA 2BJEA 2PGCA 1QUPA 1WD6A 5T7LA 3MCSA 4DPOA 2K7JA 1GXUA 1U7LA 2XMJA 3KKFA 4HI1A 1LQ9A 2BBEA 2FTRA 1AFJA 1ULRA 4DN9A 1SB6A 2IFXA 3BN7A 2JDJA 1TZ0A 1N5QA 1SI9A 1V3ZA 3FMBA 2ZDPA 3CJKB 4NPOA 2RU9A 4Q2LA 5B08A 1TUVA 3TRGA 3K7RA 2IYGA 2LQBA 2GA7A 2GCFA 2XMKA 3HHLD 3HX9A 2ROPA 1X7VA 4FNIA 3DXSX 5B0FA 5A6WA 4A46A 2KT2A 1Y9OA 2BJDA 1R6YA 3BF4A 3T9NA 2OD6A 4OJHA 4Q2MA 2QLXA 2G9OA 3HDSA 2XMWA 2FHMA 1FVQA 1OSDA 2HFOA 3BR8A 3QGPA 4HI2A 5F0UA 1FD8A 1JK9B 2N4DA 1VQYA 2OP5A 4HL9A 1JWWA 2W4DA 2GGPA 2Q3PA 4DL0C 3TOQA 5B0GA 1CPZA 3TNVA 2K1RA 1FEEA 3BM7A 1RJJA 1YJUA 1IUJA 2ASYA 2KYZA 5KAKA 1CC8A 2OD4A 2HLUA 4YDXA 2XMUA 1S6UA 2HLTA 2LXFA 1GXTA 2W4CA 1KVIA 4A4JA 2N7YA 1Q53A 3CJKA 1S6OA 3BB5A 1X0PA 1FE4A 4Y2KA 1N5VA 3LGNA 3BDEA 1OQ6A 3BGUA
chains in the Genus database with same CATH superfamily
2CJKA 3QZ7A 4WXWA 2RMLA 3FZBA 1VQ9S 3LP2B 4YR2A 3H40A 4DPYA 4B08A 1H38A 4DWIA 3OUYB 1RWXB 2H1YA 2UXBJ 4NCAA 5GADI 3LP0B 2C2OB 5K8MA 4RUBA 3SXLA 2AQ4A 1IN0A 4KGKA 2P9CA 4P75A 4LRBA 3WDOA 3KWMA 5I3UA 4IDKB 5K9FA 4KGZB 1OY6A 3UN5A 2AIRB 4OJ3A 4PQUA 1GX5A 1WJ9A 1F2HA 1TUWA 4ZVRB 4G1PA 5EN1A 4IG0A 1Z2LA 3NWRA 3SV3A 1Q8IA 4YY3J 5LM7E 5A76A 3M9MB 4NLUA 3TJ8A 2ZOMA 3I32A 2BYCA 2ZFHA 1RCXB 1CJVA 4WJBA 3NEKA 3AD7C 3A8EA 3OTBA 4AQYF 4PQUB 2ZEJA 3OLBA 1JX4A 2R8JA 2NUHA 1Q95G 1Y5LB 2BXJA 2ADBA 1XWLA 2YPZA 4H4OB 4KHMA 5A8KB 3NXZA 1NMEB 1HQEB 2OEJA 3M4XA 3GV5B 4RW8B 2Y1JA 3MCOA 1IR1A 5LSRA 2WOMB 4U8VA 2IJFA 2JVOA 1CJVB 4RU9A 4ER8A 1J2VA 5IC6B 3J7Z5 4KHPJ 2MSTA 2LEAA 1UFWA 2YNGA 1QVGR 3TUIC 1BE4A 1K0VA 2CPIA 5T7LB 1EETB 1VIXA 4NLDA 4AT1B 4C98A 1NJYA 4CTAA 2I5JB 3LALA 4ZOSA 2RDDA 4B3MF 3GIJA 1U24A 2YKMB 2V8GA 3HZEA 1HD0A 2BJ3A 1FJGF 2MB0B 4OI1A 1NH8A 1SV5B 3R7BB 1NDCA 3QYYA 2OMOA 2XSJA 3KHGA 3HHLA 1WOSA 1YBUA 1S77D 2AYMA 1BWVA 4W98A 2D3O1 2UV8G 3JXOA 2KVIA 4QYZK 1Y7PA 2BEFA 2K7JA 3CD0A 3HD2A 3LGHA 4HTIA 1FI4A 1RA6A 3MEEB 3R5JB 2NXEA 4NWBA 5CA5A 4TU9A 2QLFB 5ETNA 3D2WA 3PW7A 4ZPTR 3RB3A 1C2PA 2HFVA 4O4GB 2DIVA 3BN7A 1I3OB 1PBAA 2V5HG 4LR8A 4DR3J 4A8SA 1WHYA 3A8IA 4J37A 4MFBB 3JAMU 1BQMA 2MQOA 1U1KA 4UTGA 3NGRA 2M8DB 4Y34A 4U95A 1PILA 4KKOB 1HBMA 4LBPA 1FJCA 3VR1A 1XMQF 4KAIA 2J6UA 1RT6B 3Q89A 4H4KC 2DRAA 2ZZTA 3KDOA 4K0KF 3GYXB 4BC9A 1UA0A 3KFWX 2FZGB 2W2QP 3Q8RB 2JWNA 4QW9A 2ZH3A 1Q82T 5L1LA 4KE5A 2QA4S 1OSDA 4DOZA 4DLEA 2CVIA 2WHOA 4PYDA 2OLWA 2VDIA 5DLFA 1JWWA 2DR9A 2JLFA 2Z2YB 3W9IA 4FBTA 1C0TA 3V6DA 3KLFB 3TA0A 1OYEA 3FBCA 3MR5A 4IUFA 1UVIA 3DLJA 2HEKA 4IO9Q 4W92B 2NPIA 1VRUA 2JL9A 5A8WB 2CG4A 3DOMB 4E2FB 1YJ9S 5K14A 1X0PA 3MFHA 1VLOA 2XNRA 1QSYA 4OYZA 3VF0B 1F1BB 4EZ6A 5KFZA 4DU8A 1UAWA 2OPQB 4RJVA 3P8BB 1FCAA 1GT8A 3DXBA 4DQIA 1FDNA 1CJUA 1KWMA 3IA0A 4OHWA 1RE1B 1FF2A 2HGMA 3D54A 4I1TA 3TEGA 1C1BA 4AL5A 1GH8A 1NKBA 2DNKA 2JOQA 3PRDA 4X66F 1HNXJ 4FYXB 4Y2MA 1UW9A 3P49B 1MSWD 1VQOS 2EW9A 4USVA 1OQ3A 1ZPVA 2M88A 2W4PA 3US5A 4AYBD 4AL7A 1H3DA 4UUXA 2I9SA 3DU6A 5CZVA 1B0TA 4C3MA 3D1QA 3SZ2A 3BV8A 3OJSA 4TY9A 3GLJA 4YDDB 1H72C 3OT9A 4RPFA 3BO3A 2H5IB 2CWKA 3NBPB 5CAAA 3E01A 3LA0A 1RT4B 3TVZA 3W2WB 4M5IA 3MUTP 3KJNB 4WP8A 4CH1A 2YXLA 2Z4PA 3MEGB 5D78A 2C3YA 1K47A 3AAWB 2HMIA 4B9UA 1FVSA 3GFHA 3CCES 4FXDA 2HQ3A 4USJC 5B7WA 4R8UA 1IKVB 2GVZA 3W5XA 5KFUA 4F26A 5EX3A 3NMRA 3MMJA 4NA1A 4ZVQB 2P5VA 1RUSA 2HZAA 5KFMA 2QA4G 1NKEA 2HAIA 2OPRA 2X1FA 2ZBPA 3R5GA 3TZZA 3ULHA 1IM4A 1OWXA 1X4AA 2QN6B 4K8RA 4P74A 1O0PA 3R5DA 2XEXA 4WYLA 3FK4A 2O1PA 5F9LA 5DM6Q 3G6YA 4M94A 3LGMA 2RHQB 1ICEB 1VQSA 1AZSB 1FJGJ 3FEYB 4EO8A 3EGNA 3JB9k 3I0SB 2YBVA 2BQ3A 1S6PB 3VZHA 3VAGA 4N7TA 2KB2A 1NSAA 1RHJB 1C0UA 2BJ1A 4G6VB 4L76A 1HBOA 4NLPA 2ZJPQ 2DY9A 3AJ2A 3QAUA 3VGTA 1WNEA 4OX6A 5L9XA 2N82B 1TMMA 5C24A 2Y0SD 2CRLA 3I4HX 4WKYA 2GJFA 3T1AA 1N33J 3H5YA 4N76A 2MQNA 1FWKA 1S0OA 4N41A 2G1DA 2RUSA 3CCTA 1Y11A 4PG5A 4RW4A 2FC9A 5KFGA 4YB6A 3GJQB 3MR6A 1HNXF 4M8LA 1T9XA 4KV8A 1U49A 2IBKA 1H73A 2F4VJ 1KKHA 4X66J 4EMDA 1CG2A 1R43A 2AGOA 5IM0A 1KS2A 1ZYQA 3QJJA 1QAJA 2UUTA 3M6XA 3CJKB 4LF6F 2B9XA 4WP3A 1KNZA 2XCAA 1RLCL 3IR6B 3Q0AA 2NZ4A 1U2RA 3DOLA 3J81j 2FD2A 2GCFA 2AGQA 4LF4J 4PUOB 3ZTRA 5A0YB 3W64A 1GQEA 2KT2A 8AT1B 2C2EA 1KQFB 3AXKA 1CBKA 1NLKL 2ZHBA 1NUEA 1RAJA 2F7VA 1LEOA 1F3VA 1KTQA 3CEDA 3PEHA 1HBUB 4KT0C 2AYGA 1FHTA 3B54A 1FVQA 4ZJLA 5F0UA 1K9MT 5D3GA 2WONB 4ZVEA 4R0EA 3CT9A 4DFJA 2XLKA 2N4DA 1VQYA 3MHYA 1X4DA 5CH7B 2C2RA 2M8HA 3UDVA 2ZH4A 5F8LA 1Q5VA 2P8IA 2CQBA 3BBFA 3HJVA 3M30B 3Q8PB 2XQCA 1RTDB 4TNOA 1VBYA 1O6XA 4DV2F 2XSJB 3HO1A 2NCKL 1Q7YT 1RT3B 2JC0A 2NREA 2GC8A 4U7UK 2UVVA 1IVZA 5EGYA 4JI3F 2ZH7A 3M9OB 1HHQA 3N5BA 1KVIA 1JLAB 4ETZA 1RAIB 2FJBB 4Y2KA 2KDOA 1A7GE 4KHRA 2YNIB 3QFHA 3MTJA 3OR1A 1HWIA 3FRZA 1P9QC 4JV2A 2F1FA 2CQ4A 2QIFA 3R27A 2WAQD 4DR5J 4J9OA 1NCLA 4UQTA 4CDIA 5B0DA 4P10A 1KR4A 4AUKA 4C8KA 1RU1A 3KOAA 3D28A 3HHLC 4HVZA 1BWEA 3LAMA 4OJ1A 4DL7A 1FKPB 3BSNA 1RHRB 5AJ3J 1IBLF 1U6FA 2LXIA 4PPDA 2J0SD 3FJ2A 2J6SA 3JQMA 5ETKA 4F0MA 2OPSB 1PC4A 1XIQA 2DRDA 1HA1A 2DK2A 3LQVA 3T6BA 2LECA 4WFNQ 1LWXA 5CYMB 3IAM9 5KFQA 2VBWA 5L1KA 1BQXA 1VQ5S 4WF9Q 2KTQA 3TWZA 4Y65A 2MLXA 3VAMA 5F8JA 5E33A 5DM7Q 2W25A 5B0EA 3IWXA 1RZMA 4U67Q 2AHOB 5LJ5Y 2XMVA 2BM1A 1S1UB 2HZCA 3IFEA 4DV6J 2AW0A 4K4SA 5KG1A 3RTVA 3UCZP 2NR0A 5F41A 3OSNA 4ZVGA 3KLHA 3PHTA 4OX8A 3LWMA 3O1LA 2EVZA 4ZK7M 3BKFA 2Q1LA 1HD1A 2KVQE 3RAQA 2HKEA 2F8EX 2MHNA 2P9EA 1KHVA 4NLOA 4RUAA 4V1Ak 2YPYA 4DFPA 1LOUA 3ENWA 5KG7A 1KFSA 3MMCB 2ZBQA 3GSDA 4Q44A 1IWAA 3OVSA 4LFAF 4K4UA 1KRPA 4GMKA 1X4BA 4JV5F 2EBGA 2RIJA 4DL2A 2PFFB 1I1GA 2R7VA 3V6HA 2FZKB 1XNRJ 3CDWA 1CJKA 1Y3KA 3CDAA 3EDQB 3Q8UA 3TEHB 2G2OA 4OZ0A 2BUNA 2FJWA 2HNZB 4DX6A 1EHWA 1W25A 4Q0BA 4ZPCA 1UL3A 1XR5A 2CQIA 1DURA 4XAKA 3KLGA 2PMHA 3G8TA 1S1UA 2QL7B 2HIYA 3WC0A 4F36A 2JVRA 4N5SA 2R4FA 4L3NA 3M8RA 3BKUA 2JLEA 4C0OC 3PYFA 2XMJA 2OSRA 1NAQA 5AJ3F 4FF4A 2UZAA 1SCJB 2J5AA 1JLFA 3MMCA 1HNZJ 2WOMA 2EKNA 1ZAWA 2P6TA 1S6QB 2PI4A 1QVFR 4TLQA 2RNEA 1N0VC 1UEKA 4C8MA 2Y9HA 3FFIB 1TUVA 1SIWB 4MK7A 3HPOA 3QLHA 3H4DA 1QDUB 1MWQA 2LP4A 3OHBA 3I56S 1BLUA 3DLBA 4KGMA 1X7VA 1VS3A 2VJVA 1TV6A 2FZCB 2W2MP 4M95A 1SIZA 3OTOF 4ECRA 1X9MA 4J9PA 3PR5B 5BYSA 2CQ0A 2VOPA 4HLBA 2RVJA 3ZTPA 4CM0A 2FYXA 1WHVA 1OO0B 4DV5J 1NJZA 4CRJA 1WEYA 3MOZA 1E6VA 4HI2A 2CQ2A 3HXMA 2FY8A 2HFUA 2VA3A 3I82A 2OP5A 3QRPA 1FKOA 3H59A 1RCOB 2NLWA 3TOQA 4WZQA 2E5HA 5HO4A 2EFGA 4CP5A 1GMWD 3DYAA 1S0NA 1PJ6A 1S1VB 3CJ5A 2V4RA 1RAGB 4USKA 4N8NA 3F0NA 5CQGA 4Z2XA 3F41A 3SDEA 5IT9Y 4A8WA 4LR7A 3HCXA 4PXEA 4RNNA 3MPDA 3AA9A 4DF8A 1WC5A 2WONA 5G0RB 3TX0A 4ECWA 3H2UB 3BDEA 3DGPB 2IIHA 3M9NB 1NJWA 4OX9J 3E2EA 4OI6A 3W8GA 3KLIB 2VDHA 1JLQA 3DOKA 4UOCA 3RR7A 3MM6B 2FJAB 5AE2A 4O3OA 3ZZRA 4BS2A 2CQDA 3GFYA 2ROGA 3BGFA 3IWLA 2LEBA 3MECA 2J7KA 2WBRA 4DLGA 1RT7A 2E1RA 2CNNB 4YHHF 2HHHF 2KN4A 6FDRA 4C9DA 3MF5A 2WTFA 1HR0F 1S4EA 1FO1A 4LSZB 2Y1LB 5GMEA 3JS9A 3CMAS 1Q8BA 1U0HA 4AQYJ 3FZ2A 3UQSA 3OL6A 1PO6A 3UWTA 3I4PA 3GCWP 3NNCA 4QR2A 3RG6A 1JQGA 3LH2S 2IBOA 4U9RA 3NS7B 3CJQA 1IKXB 3V4MA 2NXNA 2JFDA 3NKYA 2N4CA 3VALA 4TQSA 2YWWA 2HFNA 5MLCV 2VG5B 1K44A 1JJCB 2YKPA 4ENOA 3RU0A 2C3OA 4JB8B 2XGQA 1HQUA 3CMQA 1X4GA 3EVOA 3ISND 4ZLJA 4WU3A 5B0CA 1Q8LA 4DR7J 3R5AA 5SZTA 2V4JA 1JLCA 3A8JA 4NXMJ 1VFJA 2RKIB 2ZVIA 1RHMB 1U0HB 5DGBA 2HG4A 3WC2A 1KVKA 4ERDA 1RI7A 1JLEA 1UP1A 4IFVB 3MM5A 3ILIA 1LFWA 4W4MA 2M2BA 1TL4A 4HTJA 3J81U 4USMA 3AODA 1KLMB 3N5FA 4O23A 2VICA 2ASLA 4OI3A 1IBCB 4IQXA 4C4WA 5D0EA 4CO4A 5I3QA 2FJEB 3Q8SB 5DDOC 2KM8C 4J9SA 2M70A 4I2QB 4KFBB 4DPOA 3DOKB 1WG1A 4DUTA 4X4RA 1X5TA 3CCMS 3KKFA 1UVLA 4IH6A 3Q8QB 3AB4B 2F9JA 2IMOA 3PX6A 2QEXS 4TYBA 1RK8A 1ULRA 4IRDA 2OPRB 3TJ9A 1ZM9A 2BKOA 1MU2A 3DLGA 5KFXA 4RO0A 1DTTB 4RW6A 2JEJA 4ANEA 3VAIA 1XTZA 4CLYA 1HKAA 1U6BA 3Q83A 1M5SA 1R0CB 1VRQC 2AF6A 2EEYA 3MMAA 1K73T 3M8PB 3BH7B 3IWNC 3PW0A 3PX0A 3PRVA 4CYUB 1IKYB 1WWHA 2KRRA 3NS5A 2A18A 1SC1B 3B8HA 3JTOA 1KONA 1JLQB 1R6YA 1DTQB 4USUA 1B3TA 2MKYA 2OPQA 3C19A 3E01B 2ZH2A 4DUZF 4QWCA 4NLGA 2DR7A 3DU5A 3SCKE 4JI7F 1NSKL 2HNYA 2IM1A 4UT4A 3TAPA 2R3VA 2BX6A 3MMBB 5I3PA 3VAHA 4TQRA 4QYZJ 2HVZA 4PKDB 3IN5A 3NL0A 2K1RA 4KR0B 4Z37A 2UXBF 5KAKA 1S9GB 2HWHA 4IO1A 4ZPVR 1WOOA 3VVTA 5KFNA 2DHHA 4WKRA 4DSKA 1C1BB 5LL6d 1SH0A 3V4IA 1U45A 2E5GA 3UI3A 2N7YA 2GHPA 2B6AB 4MIWA 3SEOA 2VG6B 2R7OA 2CQCA 1I6JA 4NEZA 4KTQA 3PJXA 1JLFB 7FD1A 3TZWA 5IWAJ 4QU6A 3H7HB 2DNOA 1FNMA 3QSYB 2B3TB 3IR5B 5J2MA 2FVPA 1PGZA 2QMXA 5K14B 1K1QA 4RW9B 4BBYA 4J90A 4LF2A 1GTHA 3BGOP 1SH3A 2D1CA 2F65A 2FB0A 1MN9A 4XPCA 3HULA 2HBZB 5F8HA 3CUNA 1NNDA 1SKWA 4GVLA 1NBEB 2MJNA 5L1IA 2CJ9A 2G4BA 5KFEA 1HQ2A 1FRLA 4O4GA 4LF8F 1UETA 4EBEA 2QSFA 4WZMA 1X4CA 3OFEA 4LSNB 2W7OA 3UD4P 4DL6A 4X2BA 2CQPA 1ZTTA 2DVIA 1C1CA 1T9WA 3DI6A 4DQSA 5GAEU 3IGVA 3R5CA 2QFJA 3IC1A 4J9QA 4GVBB 4K4WA 1LKZA 1J5EF 2FPHX 2VUGA 4OMFG 3H5SA 1FK9B 1U02A 2R2SA 4C8LA 5KFOA 5J2PA 2HQIA 2H9ZA 3H8YA 1R8BA 3Q86A 4B3TJ 3IRXB 5AXNA 2QSWA 2BABA 2E5LF 2JFKA 1RAOA 1UFKA 4F3MA 2MDAA 4N56A 1AW0A 3PFEA 2YKMA 1QAYA 2KJVA 2XG8A 5IXUA 5D6GA 4NXNJ 4XPEA 2Q6CA 3UVJA 3SCJE 3LTOA 3ZFVA 3EPGA 4FVMA 4OZLA 2HAFA 3NCQA 4Y00A 2XMTA 5KFCA 4JI6F 3OTCA 2C2ZB 4UQGA 1J5OB 1SBRA 5B0AA 3CCSS 3GIRA 2FJDB 3QSIA 2EC2A 3IG1B 4KPYA 4Q8EA 2VG7A 1T11A 2MQPA 1U6ZA 2MQLA 3R6GB 4DV1F 2HHXA 5IQQA 1H74A 2F5GA 1UWAA 1NK0A 4J91A 1B4SA 2ZWPA 1Q78A 4LRCA 4CT9A 3BQ1A 3SBMA 1H2TZ 1F5CA 2DGWA 2CJBA 4TY8B 3RBEA 2JZ5A 2LQ8A 4F04B 2XBPA 2ZHAA 3CD7A 3VVUA 2J7UA 3MMBA 4MYUA 1YRTA 3AFGA 3AJDA 3P5TL 5CYQA 4B9LA 2KRBA 1WDTA 1HI8A 1W7WA 3TI0A 1YZ6A 3DRPB 3BPSP 1VC5A 4Q45A 1RBAA 2C3MA 3GSIA 2OPSA 1YDLA 5D4PA 2KG0A 1M5PC 2RE1A 3PXGa 1UVJA 3KJVA 4FKYA 2BMBA 2BRLA 1NJIT 1NM2A 1TAQA 3ZZOA 5L38A 3G6ES 2IYGA 3MM9B 1RBOB 2GA7A 2VFTA 4DHVA 3DLKB 3OUYA 4A46A 1KN6A 2J8AA 4NLSA 4P72A 3PW2A 2BJDA 4DBQA 5DLGA 3CO9A 4LIWA 3DLGB 3VGVA 1HMVB 4EUVA 2PFDA 1IKWB 2LDYA 3D6FB 2H5JB 3PO4A 4YR3A 3HMJG 2Y8YA 2JJ4D 1AB8A 2CADA 2MSSA 1U1RA 2W8LA 2DR5A 1S12A 1G4CA 3C8YA 2FHJD 4N77A 3DM2A 4NLQA 3D5MA 5L9NA 2HNDB 2ERRA 2QA1A 2BANA 3ENVA 4Y2CA 3DOLB 1WOPA 1CC8A 1JLGB 2HLUA 2B9WA 5BR8F 2GVDA 1GXTA 1RTDA 1NK7A 4MMOA 1JJHA 4X4UA 2RRAA 3ZZUA 2BM0A 3W2VB 4ZCKA 5HVFA 4DCPB 4UOFA 1ZS6A 3AHPA 2LA4A 2NSBA 4TLRA 2RHSB 3TVKA 2DNPA 2ZH6A 2J8SA 5HROB 3BQ2A 2BOPA 2M9KA 1OJ4A 1CULB 2ZOFA 3K2YA 3MR7A 3Q2SC 4EGLA 4ECYA 5J2QB 2J7WA 5HP1A 4J9MA 2VV5A 1NB2A 4Y28C 4MK9A 5U47A 2UUAJ 1Z2ZA 2PMWA 1R8PA 2RAQA 2MY8A 3PCOB 5DDQC 1UWBB 1C0UB 2G0JA 1BQNA 3ZO7A 2CG8A 2OAUA 4QIVA 4ZN3A 1SC4B 1DJ0A 1F3FA 1WG5A 1JLBB 4B9NA 2GO8A 2Z8QA 5HMZA 4IFVA 3UPFA 3HVTB 3IS9A 1EP4B 3UD5A 2MY7A 2E9ZA 1AZSA 1T9UA 2EBEA 4WTOB 4FS1A 2YNHB 5KFIA 1PYTA 5IC4B 1FESA 3M05A 3CIZA 1HBNA 1LW2A 3PHEA 3VTIA 2QFIA 2NZCA 4ED3A 4P9SA 1HWUA 5KT3A 1D9AA 1V6HA 2CQHA 2ZC3A 2HHVA 3QT6A 4IH7A 3F44A 2X3GA 1EP4A 4NLVA 4ZVPB 3PZPA 3JYTB 1W2IA 2DNHA 2HIQA 2KZZA 2RILA 3J7A1 4NCGA 1YITS 4DI6A 2M0GB 1S6PA 3VHQA 1UWBA 2CPDA 2IDLA 4JOUA 3CJSA 1EJ7L 4HACA 3R8YA 4KBIA 5KFBA 3VZIA 2FC8A 2ILYA 2CYYA 4OYBA 4ZIVA 4F4ZA 1SKSA 4C0BA 1L3SA 4ELVA 1YRXA 5T14A 2F63A 2G1HA 4BHQA 3I5BA 1RYSA 1GFWB 2BJ9A 1YTYA 3NBPA 1SPBP 2AX1A 3FCVA 4DSLA 3HSDA 2LDIA 1RWKB 1KC8T 4IOCQ 1WF0A 1ZH5A 2CQ3A 3NG8A 3GYGA 1GXLA 2DGVA 5J2NB 3T1HF 2CIMA 2NYHA 1VR6A 1WHWA 2KZMA 1AA1B 1MMLA 2IYIA 2KU7A 2UUCJ 4JYAF 4LIRA 4ZIWA 2AGPA 4B3SJ 3QJPA 1QAXA 3J80Y 3CW2C 2XZDB 1BD6A 3UDCA 5HLFB 2HMIB 1TL1B 1RGVA 4DG1B 5SUHA 2BJEA 2I8EA 4MKAA 3JSBA 3J7YU 2FLNA 3VAJA 1RTIB 2K06A 3GV8B 2YWKA 3G82A 2HWIA 4FKXA 2EC0A 2A10A 1OMSA 1WUUA 1X5SA 1FDDA 2Z2ZA 2AYEA 3MPWA 3UD3P 3L7UA 4NI2A 3MM8B 2IFXA 4LREA 1VI7A 2UXDF 1R8AA 1IR2A 5HJYA 4DN0A 1FFWB 2CZ9A 2MHEA 1ZOTA 2RU9A 3HSJA 2J0XA 2NXUA 3DLKA 3TP2A 3C16B 4LVNP 2Z57B 2XS2A 2YNFB 4BLGA 3DRXA 3K59A 1U2FA 4NLTA 3PNIA 3A3PB 2OD6A 3GFZA 4KGVB 4ICLB 4C11A 1KSPA 4ED2A 1GEHA 2DJWA 1RT2B 4LRFA 4UY85 2APOA 2UXDJ 2R7UA 4HT7A 2DISA 2E1MC 2Y1RI 3MTKA 1Y4ZB 1HNWJ 3D6MB 2VKZG 2Z56B 5KT7A 5D0GA 4KIAA 3TNVA 1BQNB 3GU0A 1UVKA 4PXCA 4IH5A 2IRYA 4ZVSB 5F3ZA 3MD3A 3M1VA 2FUG9 4H54A 1LW0B 3ZTOA 2V8PA 3QLHB 1QJHA 3AJ1A 3VQSA 1K8AT 4CLLA 2CQ1A 1BQMB 4ED7A 4NYOA 1L3VA 4B3SF 7AT1B 1FE4A 5C5JA 4GKKF 1IR0A 3FCWA 1CULA 3LGNA 1Z1ZA 1MN7A 2ILZA 4G1QB 4ID5A 1SKRA 4LQ3A 1OQ6A 3UCGA 2RT3A 1LXJA 1XK8A 2HFSA 3J80U 2DH9A 3T1HJ 3M2VA 3ZZPA 1BMQB 2ZZNA 1E6YB 3ISNC 1FX4A 2MGZB 4B9SA 4ILMA 3ZNJ1 2R8GA 1WC4A 2B4PA 4UW2A 3FSYA 4F4YA 2E9RX 3S8SA 2WB1D 3M2RB 2VQEF 2G0CA 2KXNB 5HVHA 2IPOB 2MZSA 3D1HA 4F4WA 1RYRA 2IRUA 4F4XA 1V9OA 4I56A 2VU5A 2H4YB 1TKTB 3D1OA 1N5SA 4KB7A 2MQQA 1U1MA 5AXKA 2HRUA 1VRTA 1URRA 1YKWA 3AA8A 3QRRA 2VPWB 3EUNA 1Y0HA 3B4DA 3FKBA 4NA2A 3CCZA 3H2LA 1X4EA 3OBIA 3HHNB 4DUYF 1MWZA 1P1LA 4GKJJ 2COLA 2F8HA 3M6UA 4HH0A 2MMYA 3DI6B 4JV0A 1QE1A 1WF1A 1AXQA 2QLJB 2WVDA 3FBBA 5I4MA 1QSLA 1ITPA 1Q0NA 2V0NA 4CO2A 2R42A 2ZOGA 3CDBA 3FNNA 1VQMS 4RBTA 1VJQA 3MEDB 2B4UA 3I0RA 5J1NA 2R8KA 4Y2AA 1YGYA 2CPZA 2HSEB 2L3MA 1A0OB 2IA0A 3KJVB 4JV5J 1KVJA 3CVKA 1L3KA 2HWTA 3NGUA 1YK9A 3PJ9A 3C3LA 2NQPA 3OTDA 2PO4A 1S1TB 1S0MA 4YHHJ 4K50A 4OHZA 3DRSA 4OHYA 1S1XA 1RADB 3V6JA 4OV6A 2IC3A 1N34J 3C6TA 4IKAA 4OYAA 2YNGB 3RGIA 5KFFA 5DDRC 1G2EA 5EHHA 2VF3A 4OJGA 2W9BA 1D8YA 5K8PA 4DR6F 1KBRA 2DY1A 1RHUB 3UE2A 5A6PA 1SJFA 1NK5A 1EARA 2UUCF 1IBKF 1RU2A 1TVRA 1XEZA 2VASA 2FDNA 4OX9F 3HVAA 1VIOA 5ETQA 1OIAA 4CT8A 4CIOA 2CUYA 2O5DA 3B78A 3DNCA 2AD9A 2VG7B 3PIOQ 1HHTP 1IJEB 2HPUA 1TVRB 2OMLA 3CO0P 3L9ZA 2ZM6F 1TL3B 3IG1A 4NXMF 4RWWA 1QLNA 3N79A 1TKZA 4WPAA 4RNMA 1FX2A 3RBDA 4X62J 3MR2A 4M5KA 2UUBJ 1RTJA 2HVDA 3NLCA 1W2BR 3H5XA 3FCHA 2C3UA 5LXYA 3PVXA 3W8PA 3RB6A 3EGZA 3WX4A 4DV5F 1DTQA 1SQGA 4IDKA 5FD1A 4I7FB 1M5HA 1VRTB 4OHXA 4RWXA 1EB0A 4ZVUB 3DKDA 4OI0A 2XZTB 1JJ4A 3MAHA 3OTOJ 3C15A 1MMDA 2LQBA 4NYPA 4XDDA 1J27A 5E3QA 4EK2A 4WFBQ 1FXDA 2ROPA 1RABB 3HD1A 2XO6A 4GKKJ 3SSSA 1WORA 2DYAA 3S01A 4WFYA 5HN0A 1R6VA 3M2VB 4JI1F 4USHA 1PAEX 2YQ0A 5LXRA 3Q22A 2AYBA 3BPDA 2N3LA 4KV8B 4AD6A 5C2CA 4JV1A 1HYSB 3OL8A 1RTHA 3T5KA 2F8MA 3LOUA 3TQEA 3V2UC 2R9LA 2PE8A 2XS7A 1S7IA 1MROA 7FDRA 2HHUA 2NS1B 4O3QA 1TKTA 4PUOA 3BM7A 3MWBA 1IUJA 2QC3A 1HBOB 1BC6A 1LWCB 1VYAA 2XMUA 4MH8A 2W4CA 4WK1A 5D77A 2XO7A 1Q8KA 5K8OA 3GCXP 1JMTA 3I0SA 5DS7A 1YWXA 4ECUA 4OZ3A 2EG2A 3EE3A 3QQCD 3MAAA 2YKAA 3IMQJ 1RT2A 1O51A 2ZH1A 2P6SA 3NGDA 2DB1A 3CJ4A 4HHUA 4QBUA 3AD8C 3I5AA 2EFVA 3VAFA 3KUEA 1JB0C 1ROFA 3OSPA 1M0SA 1RB0A 4LFAJ 4OLOA 2HBQB 4DR1F 2QLWA 2YKOA 3CCVS 4B02A 1WTBA 2CPHA 2K1RB 4J9UE 4IRCA 3DC2A 2KO1A 4LRDA 4R8UB 2H54B 3D66A 4HR2A 4YEAA 2WVEA 3OR2B 4IQMA 4J5OA 4CLWA 4F25A 4YR0A 2B7CB 2L48A 1NSPA 4P71A 1NH7A 3OVAA 1PYOB 1T94A 2DITA 2GNKA 5I42A 3TUPA 2H5EA 1N33F 2AJQA 3QIPB 2KI2A 2UVWA 1F60B 3NS6A 3QWPA 5IZHA 2HHSA 4PWDB 2G2ZA 4A8XA 4ICLA 4ZS6A 1WC0A 1Y3JA 2KKHA 2VC0A 3HHKA 2RS2A 1T03A 1DHMA 3CGIA 1O8BA 2MXYA 2QYCA 4B17A 2R2UA 2WSCC 4CO1A 3A3OB 4ED1A 2DR8A 3CCJS 2LXUA 1LXNA 1TR0A 4ZA1A 3D4JA 4DQQA 4ED8A 3MMAB 4ECQA 1WI8A 1RWVB 1YZ7A 4DZ6A 1DFDA 4OI4A 1IKVA 2GVZB 3ONQA 4NASA 1RT7B 3W62A 4RNFA 5IQ6A 5CD4H 5HQ8A 1CC7A 3MR3A 4ECZA 2XY5A 1YJWS 4X64J 4JI5J 4FNHA 3FSIA 4YQWA 1JNZB 3H0PA 1YBAA 1FE0A 3VQTA 1N5YB 2X1AA 4NZ0A 5HBMB 4PWUA 1YIJS 1N32F 1APSA 3OFGA 4DSJA 1ZBTA 1RKIA 4KFBA 3H5UA 2XTJP 2GAHC 3A1YG 4DV7J 3EVMA 4C2MA 3U02A 3FRYA 2VL1A 2B8PA 1UVMA 3VGSA 2XY7A 2Z2MA 3HT3A 3K8VA 4V19J 2Y8WA 4LUBA 4FP9A 1MWYA 2VBYA 3K5PA 1XNRF 1N36J 2OFHX 5F3TA 1DQAA 3TJAA 3CXCR 1Q5YA 4R25A 3O5TB 1ZAVA 3LPEA 4CNZA 4NMLA 3CJ2A 4IR9A 1BHNA 4JI3J 3PRBA 2AJ4A 2IRXA 1CS4A 2B5JA 5E3PA 3C6UB 2B4VA 2A1BA 3JSMA 3DDNA 3VCDA 1TAUA 3H20A 5CD4A 3HKWA 1HQUB 2J9DE 1SJRA 4NCBA 9ATCB 4HHHA 2GMJA 2JDJA 2LU2A 1V3ZA 4L6V3 5M2PA 4DV6F 2KFZA 2CA9A 1F5AA 2FGOA 5GAGI 3CIMA 5HMWA 1J5EJ 4LF9J 1XNQJ 2HHWA 4QIWD 2HVEA 4KKOA 3NAIA 2AEFA 2F9DA 3N9UC 2XMKA 1S9EB 1X31C 1XQIA 2H51B 1LV5A 4FF2A 4B3RF 3MI7X 2PT0A 2DGUA 4I6WA 4PG8A 4QWEA 2WCXA 3PKYA 5EX0A 1SC3B 1RTHB 2HURA 3KK2B 1T05B 2V69A 2QLXA 1IM6A 3QO9B 2DGQA 4HHJA 2HFOA 4U8YA 2XZWA 1MNEA 2K3IA 5BJRA 4RBUA 2V68A 4QPXA 1JKHA 1RDRA 1DQ8A 3I31A 3FQKA 3BBCA 3TA1A 3MCMA 3GR1A 2WSEC 3SFGA 4NLRA 1HBMB 1JLGA 1M1GA 4N8OA 5FDLB 3ZZYA 2X1GA 1T8EA 1N52B 4WFXA 2HNDA 1IWGA 3TVYA 1D8ZA 2RRBA 2MKSA 3M8QB 1MROB 1I5OB 4F4KA 5J2QA 1U1LA 4N47A 1XR6A 4OQJA 3IM9A 4M1KA 2DO0A 5M2UA 2Y1IA 2V63A 3M2UB 4RUCA 4WXOA 5ETPA 4DQRA 3DGPA 1YJNS 2UXCF 5F8NA 1HMVA 4LBIA 1Q7LB 1P8GA 2V9WA 2VZ9A 3PW4A 4WBFA 1VBZA 1JXLA 2I2YA 2KG1A 2J6TA 1NHVA 4DFMA 4TKTA 3A3NB 3EMTA 4LRAA 3HKZD 1HNZF 3PJWA 4YB7A 3MM9A 5JUMA 1DLOB 3DYAB 3Q2TC 2FLPA 1NPKA 3DM2B 2V34A 1FKOB 1FDBA 5DRKA 3KTQA 4JI2J 3PM9A 2JHEA 3EICA 4DUZJ 4AL6A 2I5JA 5HQMA 4OV1A 5ETMA 4X4QA 1SUQA 3MDFA 3KHRA 4NOHA 5CYQB 4NLWA 5BYRA 4DS5A 1V3SA 4DQPA 1YJTA 4MAKA 1D9FA 4DR4F 4PYAA 2B51A 1R0BG 1TL3A 4TY8A 5G4DA 4I6AA 1FRHA 1PBUA 4EU0A 5DDPC 4B3MJ 1WACA 5ETRA 4CO3A 1NO8A 4K4YA 1K0TA 2PEBA 3EWGA 3TAMB 4UZBA 2GO9A 2H4WB 3KG4A 5K20B 4ECXA 3ET6B 1AUSL 1DLOA 1Y10A 3N6NA 2MEWA 3ZZTA 3K5NA 5AT1B 3MEDA 4I0WA 1OSCA 2XGPA 4DV3F 2E7XA 5KFJA 1X9SA 2EFOA 2JRSA 2O01C 1KQKA 1FNXH 5D4NA 3T19A 4I68A 4WK3A 3W65A 2CNLB 2XNQA 5DQHA 3F73A 2K2PA 2DTJA 2X51A 1SUQB 2DNGA 3JQJA 3CD5A 3G8QA 3QT5A 3DRSB 5KG0A 4KYZA 2L9NA 3L95X 3OXGA 1S1WA 1N48A 2AEMA 2EWHA 3ITHB 5LMUF 4OFZA 3C14B 2VJUA 2HQGA 4Q8FA 5C2GA 4M5DA 3WHIA 4TU8A 1U8SA 1S0VA 4DCOB 3EX7B 2HS3A 1REGX 3LUYA 3SQGA 1XBWA 2PA8D 4B9MA 3B6BA 3GPAA 3M30A 1YI2S 1HI0P 1U1NA 2OPPA 4URGA 3LANA 3T5LA 5ETVA 4DR7F 3OQ2A 3M8WA 3LP2A 3GFXA 3S6EA 4JI2F 4Y6IA 1D3WA 1RWNB 4QR0A 4TYAA 3KK3A 1E6YA 1QE1B 3CJRA 4EZ9A 4ZDNA 4JBCA 5DGAA 1N88A 5D15A 3UVJB 3R7SB 1SB6A 2KFNA 5CCLA 2BDPA 1N5QA 2JH3A 1WC1A 2WZ1A 3M8QA 4ZKAA 4DR5F 2BQRA 4X4VA 1T02A 2ALYB 3D9BA 4PG7A 1JXEA 5LMNF 5J1EA 1REVB 2PDAA 6FD1A 3HHLD 5JXSA 4C7QA 2CFXA 2MZJA 4EYIB 3CWJA 4RW9A 1T95A 3HLUA 4YN3B 1FEHA 3CCQS 2YQ1A 1RWWB 3BO4A 2VFUA 1QSSA 5IM0B 1R31A 3T1YF 4DV2J 3ZZZA 5KG3A 3IBWA 2V2ZA 2ZWOA 1L3TA 2C42A 5IV3A 3CCLS 3G6XA 4DR3F 3QGPA 4K4VA 4ID5B 1ZA2B 4RW4B 1TFYA 2C3PA 2VHGA 4HL9A 2Z58B 1ZM4A 4HDGA 4DX5A 2GIRA 2DXDA 3M8YA 1A9NB 4RBVA 2OH2A 3M1VB 4JI7J 4LJMA 2CDRB 2VPYB 4PABA 1S9GA 1YJ7A 2D9PA 5L46A 4PRFA 4U7CA 4P2FA 2AMCB 4X84A 4A8YA 1S4FA 2W2PP 1S79A 2B8QA 2CNOB 4ZPBA 1Q53A 4YUDA 5HVGA 2D3OR 3AY0A 1WEXA 1VQLS 4PPZA 1DY3A 1N5VA 5HSPA 2HQFA 4O0IA 1I94F 2EG1A 1PAUB 2DPIA 1RSCA 3HHDA 4K5SA 3KJFB 2V8DA 4DJBA 2EFPA 4LF4F 5HAOA 5GMDA 2GJ2A 2VPZB 1UA1A 1N56A 1N0UA 3GWCA 2ZJRQ 2DGSA 4C0HA 1RTIA 2VC1A 1VBKA 2AP6A 3TO8A 5KFKA 1CJTA 2MKIA 3DHWC 5ADZA 4DG1A 2NYIA 1IKYA 5KFWA 2BR0A 1EKRA 4MIBA 3M8PA 2DNQA 5IV4A 3Q24A 2DKOB 4KHPF 4I2PA 4CLFA 4IFYB 3CF5Q 4LQ9A 4L72B 1U2CA 3C46A 3HJFA 4LSLA 3PR4A 5ETSA 1DTTA 1H98A 3ADAC 5E7OB 4PXBA 2E66A 3SQOP 2MKKA 2E9TA 2ABYA 4PAAA 1HBUA 2GHVC 2MZRA 4YMEA 4CCHA 2JC1A 3ETMA 1CVJA 3W2WA 4A48A 3SSQA 1ZA1B 4IG3B 4RNOA 1OS5A 1UPMB 4BC7A 1R7IA 2V8HA 5C42A 2W9CA 2VA2A 4ZLNA 3CPWR 3RAXA 2LFVA 3NAHA 3RB0A 3OXFA 1MMNA 4DF4A 3PX4A 4CO5A 3A13A 3W5YA 2U1AA 3CB4A 1DARA 4ITSA 4KGXB 4PXDA 1RT1B 1HW9A 4O3NA 1H0HB 4OZJA 1JNRB 4CLTA 4H4KA 3TAQA 5DQGA 1TKXA 2LEPA 5LSOA 3P96A 1RHKB 2DNYA 4AFFA 4CO0A 1T7PA 1B7YB 1JLEB 1MU2B 4Z7CA 4EFAC 2W8KA 2KYXA 1SXLA 2DIUA 3EJMA 3V81B 5L8RC 3W9JA 2GMLA 2IA6A 2WVCA 3KK1B 4IOBA 2RKIA 1NPRA 2V4JB 4F4AA 4BDPA 2HK2A 1BGXT 3NOGA 4YB5A 2G0IA 3OJUA 3K58A 3IGNA 4QOTA 3SV4A 4FYYB 1NPPA 2EK1A 3HFZB 3MPYA 1S57A 2C2NA 2ZH9A 5HJXA 1Q81T 4HACB 1S10A 1HNVA 3QBCA 4QWBA 2UXCJ 1KLMA 3TR5A 3RW7A 5F8IA 1EIYB 2VFRA 4U96A 3UCUP 2OSQA 4A8FA 5C25B 4MKVA 1NZAA 2FGCA 5F0WA 2L9DA 1IKXA 1UPPA 4ZJQA 3V6DB 1SJ4P 1M1KT 2PGCA 2XLIA 3QPIA 1LW2B 1JLCB 2WBMA 1TMJA 1F9EB 1Q16B 4EEYA 1CQMA 2HQDA 1C4CA 3KK1A 2Q6BA 1AFJA 2YX7A 5KG4A 4DR1J 3KDNA 1WDDA 1VOMA 5DZ6A 4DN9A 3HVTA 4FF3A 3FMBA 3LAKA 4JI8J 3CCUS 1B0VA 1TKXB 4ANDA 4O3SA 1TL7B 3OV7A 3TRGA 1WC6A 3CC2S 1RT1A 3K7RA 1FRMA 1HNIB 1LK7A 2OEMA 3C15B 4F2SA 2Y3YA 2G2YA 3HVWA 5KG6A 3THTA 2OGUA 3VWSA 5E3RA 5KFDA 4DSFA 4MKYA 3DRYA 3DXSX 1VQNS 3WZ0A 3JTPA 4OX7A 1ELOA 1S97A 4TVAB 2BE2B 5HK4A 2GZOA 3T9NA 3ENQA 4EWTA 2ZD1A 3DHXA 2UV8A 3VGUA 3BQ0A 4LF6J 2GS8A 4WE1A 4RR5A 1NHKL 2GIFA 2XMWA 4LFBJ 2KHCA 1VGYA 4GRSA 2FVRA 4FXWA 2YWHA 3M6WA 1JK9B 4QWAA 3FDSA 3KK3B 2W4DA 2AZ3A 2XYPB 2PMZD 4B9VA 5KFYA 3HSZA 3JTNA 4C8NA 2NPFA 1FEEA 2R7SA 1JIHA 5LJ3Y 3MD1A 1F6TA 2MZ1A 4YDXA 3SQGB 2BANB 3QRQA 1M5KC 1S6UA 2PIIA 3L09A 4M5DB 5KFHA 1S48A 2DGXA 3D0IE 3MM6A 3DMJB 1UCNA 4C48A 5EWFA 1DBDA 2KL8A 2A2DA 4NLYA 1PC5A 1RTJB 2IAJA 4KC5A 3PY8A 4YS2A 1RAFB 5GMKa 3C6TB 4K4TA 1D0EA 1WKLA 3KLEA 4NMXA 1UJ5A 6AT1B 3QMQA 3W9HA 1U1OA 2D3UA 2OO4A 2KT3A 3UNGC 2IDEA 4ZCIA 2X7IA 5MAOA 2EXUA 2GHWA 2UUBF 5KT2A 5JMNA 2RF2A 4OYPA 1UJ4A 4X62F 2C28A 2FVCA 2ZITA 1S6QA 3GE9A 2YKQA 2C2MB 4FPRA 3DRPA 4WIQA 1H2VZ 3PFOA 4EI2A 2DBBA 2YX4A 2OFGX 3OFHA 1HLWA 1FNOA 4M5GA 4QYRA 4EBCA 1YX2A 4LT6A 4C3LA 5IS2A 2FVQA 2MLZA 1PYSB 1URNA 4F50A 2C1EB 1IBKJ 3GMGA 2DEJA 4EYHB 1U4BA 4NRUA 4IRKA 1LWFA 3D3BJ 1XN9A 3FGVA 3ELHA 4WP9A 4DS4A 5I3UB 4ELUA 1BUXA 1PJ7A 4RW7A 3MURP 4JI4J 5HMYA 4DV3J 2DGOA 2ZH8A 2PA3A 1TK0A 1UTAA 5I42B 2ZBIA 4O3PA 1G1XA 1FTCA 3Q8YA 4A8QA 2OJ3A 2CZ4A 1RT5B 2LKZA 2B9EA 2N7CA 1J5OA 4ZITA 2W7AA 3JQKA 3H90A 5FIIA 1FTRA 2JEIA 1VHIA 1NDPA 4DR4J 4NLXA 2YKNB 1Z4UA 5DETA 4FBUA 1WTFA 3T3FA 2OUGA 1SQEA 2HNZA 3I9ZA 4J9VA 5THWA 2QZ8A 1NB7A 4YY3F 3NY0A 3CDEA 4WTYA 4YP3A 1IBMF 4P2XA 2M52A 4DU7A 3P45B 3ZNUA 5LT5A 4K2JA 1U47A 2D41A 1JKHB 1QUPA 3U1MA 2KFYA 1F0XA 3I55S 2OIHA 2CQGA 1GXUA 3NCPA 2XI2A 1WG4A 3ZXWA 3D6TB 3RB4A 1SL2A 3PYEA 2QL9B 4X64F 1PIEA 4JI5F 2AKWB 2QT7A 1HIYA 1UZHA 4O3RA 2QX0A 4LR9A 4RW8A 3U1LA 1PCAA 3W5ZA 4C11B 5F8MA 3KK2A 3K89A 1TZ0A 1AT1B 1RQ0A 4Y3CA 2MYFA 2FQQB 2QYGA 4RW7B 4H4OA 5ITHA 4IYQA 2ASDA 1MW7A 1VBXA 4CLSA 3BKTA 3PYDA 1U09A 4ZVTB 5KFVA 3OL9A 4K0KJ 4IOAQ 3R3TA 4FDFA 3UFCX 1XMQJ 2P2CB 5B0FA 2BW7A 2IVMA 5AE1A 2H65B 1EKSA 1Y9OA 2SXLA 4NE9C 2UVRA 4PEOA 5K5MA 4OJHA 4JI0J 2ATCB 2IAJB 2FHKA 2R7XA 1ZETA 9RUBA 3AOBA 3R2CJ 4CLUA 4KQZA 1L5UA 2YVSA 1RAHB 4OZ2A 1S49A 3AB2B 4OZNA 5D4OA 3JSMB 3G82B 1U1PA 5CXTA 3P6YC 4I67A 2ZBCA 1G3OA 1KTVA 1U25A 3UDLA 5AE3A 4ELTA 1HNWF 1RJJA 2VPXB 3QIDA 4LFBF 2DT9A 2OD4A 4DPUA 3C16A 3K17A 2Z0GA 4UOHA 4ZP9A 2E29A 3ILOA 2HS0A 4M63A 2OTJS 4RL1A 2Q43A 3R6LB 4NZ6A 3W60A 4Y0FA 3KLEB 4PR6A 2V67A 4B3RJ 3I9V9 1RWOB 3IO1A 1I94J 2EFNA 5HQLA 1VHFA 4NI2B 1F9HA 2VBZA 3WIVA 3G9CA 3FEXB 3M2UA 3BGUA 3OR1B 5LMUJ 4C8YA 3CJTA 2BKPA 3SFUA 4OL8A 4C6AA 3POTB 4J7CA 3RRKA 1LFPA 2BE2A 2HFZA 4NL5A 5D4LA 4E98A 2RSQA 3WX8A 1EX8A 1TL1A 1RT3A 2F4VF 5K8NA 4CYUA 4J9KA 3DLLQ 2DXEA 5HLFA 1N34F 1FXLA 2ZE2B 1TL7A 3PTWA 2OELA 2JEFA 1RLDA 2LA6A 3RRGA 1G7CB 4USTA 3BH6B 3MGJA 4LFCJ 2BKNA 2IJNA 1HARA 5E5NA 2XMAA 5A2QY 3CJ8A 4P2MA 3KXDA 4WE1B 2AT1B 1T05A 1F2GA 2HZVA 1VQPS 2R7QA 3HT0A 2YNHA 2J9DA 3HFKA 3IR7B 3MZIA 3OTEA 3QIPA 5LMNJ 2V94A 4RKUC 3TZYA 3GIIA 4DV7F 3T5HA 2C22A 2R2TA 1TL5A 4ZMMA 2DHXA 3G4SS 4G65A 4H4MA 3N0VA 3QJLA 4E8UA 3GB0A 3CE8A 2HHTA 8RUCA 2B0GA 3MM5B 2I6WA 3PIPQ 3N6LA 4K59A 4FN5A 3E8OA 4KO0A 2VQFF 2E1CA 2WK4A 3OPKA 2YWEA 1YBTA 3GZ7A 5HMXA 1NDKA 1P9YA 4ZN1A 5KT6A 1RAAB 2R7WA 2KXHA 1HFEL 5ETOA 2HBYB 5C24B 4WCEQ 3V81A 1T0TV 2W7PA 4E0DA 2J9EA 4DXLA 4M5HA 3S7RA 4KY3A 2IVFB 2KH9A 2W9AA 3OLAA 2HW3A 3WQPA 2HYIB 3GP9A 4F0KA 1KQSR 5D0HA 1TUGB 4FS2A 1HNVB 3NMAA 3KG0A 3MECB 4DR6J 2EI5A 3EXCX 3WIUA 5H9EJ 3MEGA 2CPEA 1FERA 1V5IB 5HL7Q 3K8WA 1AYEA 1R89A 2W1BA 4G3IA 3RW6A 3MCSA 1P27B 2BE7D 3CCWA 1RT4A 4M5JA 3V5RA 4U7UD 2QE5A 5HBMA 1RTZA 1GMUA 4L74A 2DHSA 3BYPA 3K5OA 3HP6A 5EWEA 3PW5A 3UDEA 3W2VA 4LSLB 3C2PA 1UVNA 4CM2A 3MM7A 3IP0A 1ZZFA 5B08A 4Q2LA 4TU7A 3NGSA 3Q8VA 2KJWA 4IFYA 4MIAA 3SDEB 2FVSA 2MZTA 2RU3A 1S1VA 1VQ4S 1NXIA 4I6YA 2ASJA 2PC6A 5A6WA 2R8IA 4F8RA 2XWXA 4I7FA 3MXHP 4OYXA 3KMSA 4RLEA 4ES1A 4XIUA 4DUYJ 4IG3A 4GKJF 2YX1A 4LF9F 1B99A 3O44A 4QQBA 4Q5VA 1XNQF 4KJIA 3H4BA 2FY1A 3EZUA 4LMZA 2E1AA 4ED5A 4ATNA 2CPJA 1NK4A 1IKWA 1TK8A 4R5PA 4LBHA 1Y5NB 2D74B 3HK2A 1S5ZA 1NU4A 2QA2A 4KPCA 1RA7A 5GAHU 2CVEA 2Q3PA 1TV6B 1T9TA 3JAMY 1XC9A 2HBRB 1CPZA 3QT7A 3R1HA 2CNKB 3D68A 3EYZA 2CZVC 4JI1J 2ZHOA 5CYJA 4YFUA 3EVWA 3UN2A 3R97A 3UW1A 3BO2A 2EK6A 2MKCA 2HVIA 2V8VA 3SSRA 1FJEB 5IT9U 3GJTB 3BDPA 2WSFC 4PWWA 2I38A 1N36F 1RWUA 2DGTA 2CAJA 3G8SA 4NRTA 1UMJA 2VKRA 3KLVA 3T6JA 3BREA 3CCRS 1HWKA 2C2KB 2ZUAA 3L4BC 4DL5A 2PI5A 4PG6A 2JEGA 2IC3B 5H1SV 1D9DA 1RT6A 1N54B 3QNWB 2LU1A 5A8WA 5GADU 2V50A 5LOQA 1REVA 1U0SA 1S1TA 2L9WA 4I69A 2Z2LA 4ZPDA 3ZC4A 4RUHA 3OHAA 2QLBB 4KSEB 2L08A 4UF4A 2E7WA 4U6PA 3CD6S 2QMUB 5KFTA 4FXVA 2WW4A 1CJKB 2GAGC 2B9YA 3IAS9 4DZDA 2ZVSA 1M5OC 1VQKS 5DQIA 2V2VA 1C1CB 4QJVA 3KHLA 5KOXA 5E2QA 2RH3A 4ZPWR 2XB2D 1FA0A 4KH0B 4YOEA 3RBXA 1EAYC 3EGWB 4ED0A 5EDWA 2E5JA 1U48A 1N4LA 3QT8A 3KNAA 1TQLA 2O3DA 2UVUA 2DNRA 3KLGB 1R8HA 3KNGA 2PN6A 4CLKA 3KLHB 1HI1A 1FFSB 1X5PA 3LF0A 4Q0BB 1N5TA 3D3CJ 3HZGA 4OIXA 3R1LA 1AFIA 3CNQP 3O2IA 4V19X 1S1WB 3GIMA 3IRWP 4QWDA 2D7SA 1TKDA 2VONA 5E3AA 1GX6A 3NOCA 4CTAB 3UR3C 3G6VA 1TFWA 2GQ2A 1X5OA 1IQZA 2F4FA 3BEGB 3PEJA 5J2MB 3CC7S 2RQ4A 3K5LA 4PCQA 4ZHRB 2J0QD 3QWUA 4QIGA 2VH7A 1TKZB 1N8RT 3R2DJ 2NXJA 2OPPB 4LVOP 4LF5F 4LF7F 2BW2A 4G1QA 3U7JA 1UEVA 3W66A 4CWBA 3HHLB 1SVDA 2XC9A 3V6KA 3ET6A 2RRNA 3NP5A 3SCLE 2B6AA 2UU9F 3BSAA 2V2KA 1SV5A 3RZAA 2XMMA 5J1PA 5D0RA 1XMOF 3LPYA 2XWYA 4F67A 1QTMA 1UJ6A 3C14A 1HPZA 3ZZ0A 3BN4A 2K8GA 1LWFB 3FUYA 2GQQA 2ZNYA 2FLOA 1OY9A 3DDKA 2U2FA 3G86A 5HANA 1N32J 5IFMA 4LF8J 1GK8A 5BR8J 1U1QA 1WD6A 3R5BA 5AXLA 5T7LA 4CLZA 4DFKA 2MKHA 1A6LA 1U7LA 2WB4A 3KJQB 4C3KA 1LQ9A 4R5PB 4G1IA 1SJ3P 2BBEA 1VC0A 2MLYA 2XULA 1VISA 4JP8A 1UEUA 1B70B 1W26A 2HRTA 4DPWA 3QAEA 3D0HE 2VQEJ 2LMIA 2KHDA 3E3XA 5A8KA 5FLXY 3VV2B 3JSRA 1B64A 4B9TA 2RQMA 4FZVA 5CABA 2NXCA 1ZZNA 3LP0A 1YLXA 1WF2A 2DNNA 3AOAA 3QATA 4FNIA 3HX9A 5DG8A 5IWAF 3T5JA 4B3OB 3IBFB 4O0NA 3TA2A 1KEKA 2A2CA 5DG7A 4RW6B 3X3UA 2L41A 1VQ6S 2YH1A 1TELA 1YRUA 2AEJA 1SC6A 1XJWB 1EQ0A 2B7BB 2GQCA 4P2SA 3I5CA 4IG0B 2FHMA 2YNIA 2RDIA 2ZJQQ 3MFIA 3JSYA 3UN3A 3SYZA 2HK3A 3TZXA 3HI9A 4C8OA 4UUWA 1FRJA 3QGGA 5B0GA 4MJKA 1UFLA 4DX8H 2UP1A 4AXJA 4ECTA 4RZRA 2DNLA 4X65F 3OVBA 3ZTSA 4K2XA 1HWLA 5JVGQ 2B4OA 2HLTA 3GJRB 3U1NA 5KG5A 4WU2A 2FJXA 5AXMA 4X4PA 2ZM6J 1RP5A 3CJKA 3MM7B 1S6OA 2DNZA 2CJXB 3UR0A 5J2NA 3K57A 4HKQA 1XMOJ 2WRMA 4EBDA 3L3CA 4ZP8A 3FSXA 3GJSB 3MPVA 1QTNB 2V6AA 2IM2A 3A4TA 5DO2A 1LWEA 1O5JA 2ADCA 2HHQA 2ZD1B 2AX0A 3TW0A 3MAQA 1VLYA 1T9YA 1TTHB 1U26A 2AJ0A 2LQJA 2PD1A 3P4UB 4I2QA 1RAEB 4AE5A 2Q66A 4J9LA 3K0JA 1ZTWA 4QIFA 1S9EA 2LVWA 4KO0B 3RRHA 1YVFA 3O6QA 3EPIA 2CPYA 1NSQA 2YTCA 4DV4F 2QO3A 2RD5C 2VG5A 4USWA 4ZJOA 1GMVA 2ZH5A 3AH6A 1GMWA 2O66A 4FPIA 1Q79A 5KFLA 2E1PA 3BSCA 4HYKA 2CPFA 3MEKA 2RS8A 8ATCB 3TANA 3QO9A 2ZDOA 1T9VA 3GYNA 1ZAXA 1R8CA 4O4RA 3GV7B 1IQTA 3PG9A 1R0AB 3B82A 3FBFA 4J9NA 3TUZC 2H3EB 3PACA 1D1UA 1PG5B 1GNKA 1ZPWX 2YNFA 3DLEB 5GVQA 1QD1A 4XO0A 5JVHQ 2OHDA 4CLPA 5C25A 2HHPA 1JLBA 3CDUA 3K5MA 3NGTA 3KHHA 1TK5A 3G96A 1TP7A 1B0PA 2B43A 4DL3A 3UO0A 3THVA 4H4MB 2OKQA 3NGKA 4M5MA 2CDQA 3VAKA 2QL5B 4K4XA 4GO5X 4DCJB 4UY8T 4C8ZA 1P1TA 3TQ1A 4CQ1A 2RUGA 1MG7A 1VK8A 2VQFJ 3T9ZA 1FJ7A 1NHUA 3OFFA 4URSA 1KQGB 3KLIA 2ZZMA 3BSOA 3M6VA 5KOWA 1GTEA 3QFWA 4GC6A 1S7HA 1CS4B 1WELA 2B5JB 3NRBA 3D7SB 1N5YA 3CC4S 4DR2F 3T41A 2AWZA 3MUMP 3KUHA 4DPTA 1YSJA 2A6OA 1FKAF 3HFVA 2EPIA 2I1RA 5F8GA 3MOJB 4QU7A 2ZE2A 4I2PB 4W90B 4LF5J 1FWPA 4LF7J 2N3OA 5HI7A 3DRRA 3O3LA 4P52A 2OTLS 3FC9A 4Q43A 3NNAA 1WSRA 4ED4A 1CJTB 1S76D 4OHVA 1XMBA 4QZVB 2F40A 1CJUB 2LYVA 2RQKA 1RHQB 4L73A 2KT5A 4DPXA 4OYMA 2W9CB 2VIHA 4DV4J 3POTA 3J7AN 2H48B 1VCTA 2PSZA 1XR7A 3RYLA 2CWXA 3QGIA 4OZ5A 4DV0J 5E41A 2JLGA 4ANCA 2YWGA 4B3TF 2XI3A 1S9FA 4QW8A 1SI9A 1ZM2A 2W01A 1LK5A 3WBZA 3LWLA 1S72S 3W3SA 3DDIA 5KTQA 4B3OA 1QM9A 1WKKA 5H9EK 3OXLA 4D3GA 4ES2A 5DG9A 3PDNA 4ZP7A 4ZPAA 1SJ1A 3EDRB 4A8KA 1V5VA 2B56A 1C0TB 1CQNA 1Q86T 2MJUA 4BWMA 3M7VA 1L3UA 1AROP 4XDCA 2GIQA 1C4AA 4X4OA 3S1TA 1KFDA 1CSJA 4Q2MA 4CZCA 4FYDA 1RBLA 2BACA 2DH8A 1BXNA 1N6QB 1Q1KA 1FRXA 2JX2A 3OL7A 2RQCA 3DN9A 4MKBA 2RJZA 3HHEA 2DNMA 3IS9B 1FD8A 4MYTA 2IVYA 4F3QA 5BXIA 1VRUB 2D69A 1DAXA 1X4FA 1TU0B 1YJUA 2NUUG 3D0GE 2DHGA 3BGLA 1EQMA 1GAOA 3ILLA 1DQ9A 2IM0A 2NSCA 2XLJA 2YKNA 1S59A 4JYAJ 1LWEB 5CCMA 3CSKA 1YQHA 2M5YA 4FYWB 2DR6A 3I96A 4IR1A 3KMQA 4ZHRA 1FT8A 5T41A 5JJBA 2R7TA 4ZVFA 1RT5A 4ZLLA 2BRKA 4F2RA 2ZC4A 1QUVA 2XHCA 2GVDB 4Q7AA 2DEIA 2GV1A 3THPA 3BZQA 1XERA 1FRKA 2OI2A 2XYGB 5IOLA 1X0FA 3FVYA 2E5IA 5IT4A 4P7TA 3IRXA 5DJBA 2QMWA 2ROEA 2GGPB 3B4MA 3H98A 1PSDA 2K7KA 4MFBA 1IJFB 3GONA 1FK9A 4L75A 4Y2IA 3C66A 3EGVA 4P73A 3ZTQA 1Y5IB 3PO5A 2MQ8A 1PKUA 4HH1A 1IBMJ 1CEZA 5B0BA 3GQCA 2QV6A 2YQ3A 2D9OA 2VD3A 3ILJA 1G6BA 1P6TA 3IXQA 2CXEA 4ZCLA 4ALZA 2R8HA 2ACYA 5KT4A 2AU0A 2UU9J 2RDJA 3FEZA 3MCNA 2J0WA 2EKYA 2HS4A 4QR1A 2Y0BB 4ZLPA 3M8SA 1EZZB 4MTPA 1NDLA 2X3DA 2P9GA 4UOGA 4JI6J 4S0MA 2V9KA 3TAMA 1NEEA 3KYLA 4NZ7A 4DV0F 1HR0J 2PEHA 1FKPA 4R0JA 4URQU 3ITHA 5HATA 1YJVA 4QIEA 4DEZA 5L1JA 4CNYA 5M2RA 1YG0A 4MT1A 3BBBA 4NXNF 1HWJA 1FD2A 2FIUA 3TYTA 1YJRA 4ZVOB 4PQAA 1JXVA 2A6MA 1UW4A 2KXFA 3AT1B 2DRBA 3BS9A 3GG0A 1Q4RA 1NKCA 2UUAF 4K4ZA 1X8DA 3LO3A 5CHCB 4A4JA 2FLLA 4ID8A 4NX9A 2R7RA 3NNHA 1S99A 2CJQA 3KUGA 5CYMA 3SCIE 1KLNA 3P5BP 5DZ7A 3GR0A 2VG6A 4NYZA 4GC7A 1HQEA 4LF1A 2Z30B 1JLAA 2ZKTA 2AJ2A 1HPZB 5RUBA 3J7YI 2RF2B 1OYDA 3AQOA 5BYQA 2VOOA 4X4NA 1CLFA 4DR2J 2MQMA 3FBEA 4OZ1A 1OPZA 2W2OP 3CTRA 4CI0B 1R27B 4M5LA 4D3HA 4DSEA 2W2NP 5E3CA 2HRYA 2YY3A 3LW5C 4FYVB 4BWJA 5D8HB 1NK6A 2W9BB 2JNJA 3NCRA 2XSFA 4HI1A 3GIKA 5D3GB 1VK3A 1WKJA 2FTRA 2HGLA 2JSXA 2HNYB 1S1XB 2CJAA 4K5RA 2DHAA 2VODA 2BJ8A 1R3NA 3A12A 2RB7A 3DMJA 3FQLA 4NPOA 3AXMA 2BE9B 2BVZA 5A0YA 2DCUB 4CH0S 4RU2A 2I0XA 5J2PB 4J9RA 3U27A 5KFSA 1UZDA 3I0RB 4A8MP 3SI8A 1AUDA 2DXFA 4ILLA 1NZ8A 4WIIA 5A8RB 5EUHA 3E51A 1RWMB 3FMWA 2A0FB 3EZOA 4GVBA 5GAEI 3GILA 3BF4A 3M32B 2HGNA 2AV5A 3M8ZA 2MGZA 1JJ2R 4PG4A 2POKA 3QZ8A 4I4BA 2G9OA 4LSNA 3HDSA 4LFCF 1HL6A 4ZVHA 2VFSA 4DX7A 1D09B 3BR8A 4K7QA 1NRKA 1NK9A 5FJ4A 4PZVA 5KFAA 5KT5A 4OYOA 3EM1A 3RUBL 1NK8A 2GGPA 4USIA 4DL0C 2CKWA 3G87A 3SMZA 2V2QA 1B7FA 2GX8A 4DSIA 2FHOB 4X4SA 2KYZA 2ASYA 2MTLA 2HVHA 4NA3A 5FDLA 2K3KA 4WYWA 1HNIA 2IY5B 1WI6A 4YB1P 2A3JA 3AQPA 3M2RA 3PV8A 1VQ8S 4KRWA 3Q23A 1QAIA 1KP6A 2FJVA 4F02A 2J76E 2AJFE 2GJIA 3QGHA 1H6KX 3HSGA 2XM3A 1SJQA 5CZXA 4DV1J 2QRRA 1K1SA 2KM8B 2YH0A 3D6HB 2ATLA 2BQUA 5H9FK 1DZ5A 2LQ5A 3BYRA 1WC3A 2D3ZA 5L39A 2IHR1 2XS5A 4HT5A 4ECVA 4HEA9 2C2DA 2BA9A 4A8OA 4JI8F 2CJYB 3V4IB 4UZCA 1SL1A 1LW0A 2UUWA 4ETXA 1IXKA 2M7SA 2OEKA 4CH7A 2LCWA 1HHSA 1KOHA 4O44A 3KG1A 5C7PA 3HF5A 4ED6A 4QCLA 1FFGB 4ZCMA 2ZBRA 4MK8A 1X4HA 2GFFA 1WEZA 1WHXA 3P3DA 4Z7YA 2X1BA 2ZKUA 4JI4F 1VDHA 5ETLA 3TX8A 4A47A 3MM8A 1WSVA 4FVCA 3IM8A 3TUJC 1N6QA 3ICLA 3MPUB 2MKJA 3BGRA 4ECSA 1ACMB 3RJMB 5C42B 1SQFA 3L7OA 3AOCA 3R9LA 4L3KA 2V4QA 5FLXU 2R2RA 3C6UA 2LQ9A 2IMWP 1SKUB 1FXRA 3LP1B 5B09A 1PJ5A 3HM9A 5IT0A 4WWSA 3OW2R 2XY6A 4F7VA 3DRRB 2O67A 2MZQA 1U8WA 5GAGU 3MUVP 2WW8A 2XCPA 3O8WA 2E7VA 4OYIA 3EZ5A 3I6PA 3RAMA 1KHWA 4XTTA 1FRIA 1M5VC 1BY9A 2WVFA 3DCAA 5LSLA 3LP1A 3F56A 1FDAA 1KOOA 2ZUGA 3I87A 4ES3A 3A8KA 4I64A 4C97A 3N4WA 4F3OA 2AZ1A 2ACMA 1RWPB 4PWDA 2AJ1A 2BV3A 2QJ3A 4OLPA 4RNHA 1I51B 4X4TA 3SIPB 1VMBA 2WVBA 3ETOA 3N28A 5KFRA 3X1LB 1KDNA 4OI2A 5G0RA 5H9FJ 2BJ7A 4WFAQ 1M1HA 3OR2A 4QPTA 4NCGB 1T3OA 2DO4A 3DOMA 2IJRA 2DD8S 3ISZA 2E44A 4O44B 4TXSA 1NJXA 1ZM3A 2FHJA 4DMZA 2QGFB 2M3DA 3CJ0A 3W61A 3TARA 3DLEA 2ZNZA 4TN2A 3J7ZT 2HQCA 4ILRA 1OPIA 1T03B 4M5NA 2VBXA 1HBNB 2HHHJ 4DDFA 2QTWA 1H2UX 3CULA 1E6VB 1V3RA 3BGRB 3N01A 5ETTA 5A2QU 2DPJA 1X9WA 3BJYA 3MAAB 1RXOB 1FWLA 1SH2A 2E5LJ 3G71S 4OYWA 3CMES 2XHWA 3J81Y 1F5BA 1RACB 2ALZA 4P7VA 5E0OA 2VFVA 4RX6A 2ZDPA 3BR9A 2GMHA 1VJWA 4AXIA 4KH1B 2VB6A 4P6QA 3W7BA 3RR8A 1KD1T 1DRZA 2BZ2A 2W24A 3D67A 3OD2A 1QY7A 4NEYA 4XK8C 5J1EB 3JYTA 1RKJA 3L7PA 3KLFA 2DH7A 3FFIA 1R0AA 3IBCB 3UNYA 2DCLA 2G13A 5HP1B 5KG2A 4BCAA 1VQ7S 3DLHA 1H7XA 2QG9B 1LNQA 3H42A 5F9NA 4X65J 1SL0A 4WFZA 3GG1A 3PKMA 3CJ3A 4DL4A 1M90T 2XYHB 3MEEA 2BOAA 2IM3A 3NWGA 2F3JA 3DGVA 3R7NB 4JUZA 2LLZA 1IBLJ 3M32A 2YWFA 2MPUA 3HVRA 1VC6A 2CPXA 1Y00A 3N6MA 5A8RA 5GAHI 1HW8A 3EXYA 3PYGA 1F9FA 1LWCA 1OY8A 1UKUA 2J9CA 3GTYX 3RBZA 5EWGA 2M4MA 2GW8A 4ZP6A 3H25A 2LXFA 1RISA 1MLAA 1X60A 4HDHA 3ENAA 3T1YJ 3W1YC 4JI0F 1H7WA 3BB5A 3H2VE 3AD9C 3W63A 1YHQS 2EFQA 3DFEA 5HROA 4GO7X 1T3NA 4FF1A 5KFPA 2Q79A 1HYSA 3G2XA 4F0HA 4EO6A 1EETA
chains in the Genus database with same CATH topology
2CJKA 3QZ7A 4WXWA 2RMLA 3FZBA 1VQ9S 3LP2B 4YR2A 3H40A 1H38A 4B08A 4DWIA 3OUYB 4NCAA 5GADI 3LP0B 5K8MA 3SXLA 2AQ4A 1IN0A 4KGKA 2P9CA 3WDOA 5I3UA 3KWMA 4IDKB 5K9FA 4PQUA 4OJ3A 1GX5A 5EN1A 4G1PA 4IG0A 1Z2LA 3SV3A 1Q8IA 3M9MB 4NLUA 2ZOMA 3I32A 2BYCA 2ZFHA 4WJBA 3A8EA 3OTBA 4AQYF 4PQUB 3OLBA 1JX4A 2R8JA 2NUHA 1Y5LB 2BXJA 2ADBA 1XWLA 4H4OB 4KHMA 5A8KB 3M4XA 1HQEB 3GV5B 4RW8B 2Y1JA 5LSRA 4RU9A 2WOMB 2IJFA 2JVOA 1J2VA 3J7Z5 2MSTA 2LEAA 1UFWA 2YNGA 1QVGR 3TUIC 1K0VA 2CPIA 5T7LB 1EETB 1VIXA 4NLDA 4C98A 1NJYA 4CTAA 2I5JB 3LALA 4ZOSA 4B3MF 3GIJA 1U24A 2YKMB 2V8GA 3HZEA 1HD0A 1FJGF 2MB0B 4OI1A 1NH8A 1SV5B 3QYYA 2OMOA 2XSJA 3KHGA 3HHLA 1S77D 2AYMA 2UV8G 2KVIA 1Y7PA 2K7JA 3CD0A 4HTIA 4WYWA 4NWBA 5CA5A 1RA6A 3MEEB 1FNXH 2FJXA 4TU9A 3D2WA 3PW7A 4ZPTR 3RB3A 1C2PA 4O4GB 5I42A 2DIVA 3BN7A 4A8SA 2V5HG 1F2GA 1WHYA 4J37A 4MFBB 1BQMA 2MQOA 1U1KA 2M8DB 4Y34A 1PILA 4KKOB 1HBMA 1FJCA 3VR1A 1XMQF 4KAIA 2J6UA 1RT6B 4H4KC 2DRAA 4K0KF 3GYXB 4BC9A 1UA0A 3KFWX 3Q8RB 2JWNA 4QW9A 2ZH3A 1Q82T 5L1LA 4KE5A 2QA4S 1OSDA 4DOZA 4DLEA 2CVIA 2WHOA 2OLWA 5DLFA 1JWWA 2DR9A 2JLFA 4FBTA 1C0TA 3V6DA 3KLFB 3TA0A 3MR5A 1UVIA 3DLJA 4IO9Q 4W92B 2NPIA 1VRUA 2JL9A 5A8WB 2CG4A 1YJ9S 5K14A 1X0PA 3MFHA 2XNRA 1QSYA 3VF0B 4EZ6A 5KFZA 1UAWA 2OPQB 4DQIA 1FCAA 1GT8A 3DXBA 1FDNA 3IA0A 4OHWA 4AL5A 1FF2A 2HGMA 3D54A 4I1TA 1GH8A 1C1BA 1NKBA 2DNKA 2JOQA 3PRDA 4X66F 4Y2MA 3P49B 1MSWD 1VQOS 2EW9A 1OQ3A 1ZPVA 2M88A 2W4PA 3US5A 4AYBD 4AL7A 1H3DA 4UUXA 2I9SA 3DU6A 5CZVA 1B0TA 4C3MA 3D1QA 3SZ2A 3OJSA 4TY9A 4YDDB 3BO3A 3NBPB 3E01A 1RT4B 3TVZA 3W2WB 3MUTP 4CH1A 3MEGB 2Z4PA 5D78A 2C3YA 3AAWB 2HMIA 4B9UA 4FXDA 1FVSA 3GFHA 3CCES 2HQ3A 4USJC 5B7WA 4R8UA 1IKVB 3NMRA 4F26A 5KFUA 5EX3A 3MMJA 4NA1A 2P5VA 1NKEA 2QA4G 5KFMA 2HAIA 2OPRA 2X1FA 3ULHA 1IM4A 1OWXA 1X4AA 4WYLA 1BC6A 1O0PA 3R5DA 2XEXA 5F9LA 5DM6Q 2O1PA 4M94A 3G6YA 3LGMA 1VQSA 3FEYB 4EO8A 3EGNA 3JB9k 3I0SB 2BQ3A 1S6PB 3VZHA 3VAGA 2KB2A 4G6VB 4NLPA 1C0UA 2ZJPQ 1HBOA 1WNEA 3AJ2A 3QAUA 4OX6A 5L9XA 2N82B 5C24A 2Y0SD 2CRLA 3I4HX 4WKYA 3T1AA 3H5YA 4N76A 2MQNA 1S0OA 4N41A 2G1DA 3CCTA 4PG5A 5KFGA 4RW4A 2FC9A 4YB6A 3MR6A 1HNXF 4M8LA 4KV8A 1U49A 1CG2A 1R43A 2AGOA 5IM0A 1KS2A 1ZYQA 3QJJA 1QAJA 2UUTA 3M6XA 3CJKB 4LF6F 2B9XA 1KNZA 2XCAA 3IR6B 3Q0AA 2NZ4A 1U2RA 3DOLA 2FD2A 2GCFA 2AGQA 4PUOB 5A0YB 1GQEA 2KT2A 2C2EA 1KQFB 2ZHBA 1RAJA 2F7VA 3CEDA 1KTQA 1FHTA 3PEHA 4KT0C 1HBUB 1FVQA 1K9MT 5F0UA 5D3GA 2WONB 4ZVEA 4R0EA 3CT9A 4DFJA 2XLKA 2N4DA 1VQYA 3MHYA 1X4DA 5CH7B 2C2RA 2M8HA 2ZH4A 5F8LA 1RTDB 2CQBA 3M30B 3Q8PB 4TNOA 1VBYA 4DV2F 2XSJB 3HO1A 1Q7YT 1RT3B 2JC0A 2NREA 2GC8A 4U7UK 2UVVA 5EGYA 4JI3F 2ZH7A 3M9OB 1KVIA 3N5BA 1JLAB 4ETZA 2FJBB 4Y2KA 2KDOA 1A7GE 4KHRA 2YNIB 3MTJA 3OR1A 1HWIA 3FRZA 1P9QC 4JV2A 2F1FA 2CQ4A 2QIFA 3R27A 2WAQD 4J9OA 4UQTA 5B0DA 4C8KA 4AUKA 1KR4A 1BWEA 3D28A 3HHLC 4HVZA 3LAMA 4OJ1A 4DL7A 1FKPB 3BSNA 1IBLF 1U6FA 2LXIA 4PPDA 2J0SD 3FJ2A 2J6SA 2OPSB 1PC4A 2YH1A 3LQVA 1HA1A 2DK2A 3T6BA 2LECA 4WFNQ 5CYMB 5L1KA 3IAM9 5KFQA 2VBWA 1BQXA 1VQ5S 4WF9Q 2KTQA 4Y65A 3VAMA 5F8JA 5E33A 5DM7Q 2W25A 5B0EA 3IWXA 4U67Q 5LJ5Y 2XMVA 2BM1A 1S1UB 2HZCA 3IFEA 2AW0A 4K4SA 5KG1A 3RTVA 3UCZP 2NR0A 5F41A 3OSNA 4ZVGA 3KLHA 4OX8A 3LWMA 3O1LA 2EVZA 4ZK7M 1HD1A 2Q1LA 3RAQA 2P9EA 2MHNA 2F8EX 1KHVA 4NLOA 4RUAA 4DFPA 1KFSA 1LOUA 3ENWA 5KG7A 3MMCB 3GSDA 4Q44A 3OVSA 4LFAF 4K4UA 1KRPA 4GMKA 1X4BA 4JV5F 2EBGA 2RIJA 4DL2A 2PFFB 1I1GA 2R7VA 3V6HA 3CDWA 1Y3KA 3CDAA 4OZ0A 2BUNA 2FJWA 2HNZB 4Q0BA 1W25A 4ZPCA 1UL3A 1XR5A 2CQIA 1DURA 4XAKA 3KLGA 2PMHA 3G8TA 1S1UA 3WC0A 2JVRA 4N5SA 2R4FA 4L3NA 3M8RA 4C0OC 2JLEA 2XMJA 2OSRA 1NAQA 5AJ3F 4FF4A 2UZAA 3MMCA 2J5AA 1JLFA 2WOMA 1ZAWA 2P6TA 1S6QB 2PI4A 1QVFR 4TLQA 2RNEA 1N0VC 4C8MA 3FFIB 1TUVA 1SIWB 4MK7A 3HPOA 3QLHA 3H4DA 3OHBA 3I56S 1BLUA 3DLBA 4KGMA 1X7VA 1VS3A 1TV6A 4M95A 1SIZA 3OTOF 4ECRA 1X9MA 4J9PA 3PR5B 5BYSA 2CQ0A 2VOPA 4HLBA 2RVJA 1WHVA 1OO0B 1NJZA 1WEYA 3MOZA 1E6VA 4HI2A 2CQ2A 3HXMA 2VA3A 3I82A 2OP5A 1FKOA 3H59A 3TOQA 2NLWA 4WZQA 2E5HA 5HO4A 2EFGA 1S0NA 3DYAA 1S1VB 3CJ5A 2V4RA 4N8NA 5CQGA 4Z2XA 3F41A 3SDEA 5IT9Y 4A8WA 4PXEA 4RNNA 3AA9A 4DF8A 2WONA 4F3OA 5G0RB 4ECWA 3H2UB 3BDEA 3M9NB 1NJWA 3E2EA 4OI6A 3KLIB 3DOKA 1JLQA 4UOCA 3RR7A 3MM6B 2FJAB 5AE2A 4O3OA 3ZZRA 4BS2A 2CQDA 3GFYA 3BGFA 2ROGA 3IWLA 2LEBA 3MECA 2J7KA 2WBRA 4DLGA 1RT7A 2E1RA 4YHHF 2HHHF 2KN4A 6FDRA 4C9DA 3MF5A 2WTFA 1HR0F 1FO1A 3CMAS 1Q8BA 3FZ2A 3UQSA 3OL6A 1PO6A 3UWTA 3I4PA 3NNCA 4QR2A 3LH2S 4U9RA 2IBOA 1IKXB 3V4MA 3NKYA 2JFDA 2N4CA 3VALA 4TQSA 2HFNA 5MLCV 2VG5B 2YKPA 3RU0A 2C3OA 2XGQA 1HQUA 1X4GA 3ISND 4WU3A 5B0CA 1Q8LA 3R5AA 5SZTA 2V4JA 1JLCA 1VFJA 2RKIB 5DGBA 2HG4A 3WC2A 4ERDA 1RI7A 1JLEA 1UP1A 4IFVB 3MM5A 1LFWA 2M2BA 1TL4A 4HTJA 1KLMB 3N5FA 4O23A 2ASLA 4OI3A 4IQXA 4C4WA 4CO4A 5I3QA 2FJEB 3Q8SB 5DDOC 2KM8C 4J9SA 2M70A 4I2QB 4KFBB 4DPOA 3DOKB 1WG1A 4X4RA 1X5TA 3CCMS 3KKFA 4IH6A 3Q8QB 3AB4B 2F9JA 2IMOA 3PX6A 2QEXS 4TYBA 1RK8A 1ULRA 4IRDA 2OPRB 1ZM9A 5KFXA 1MU2A 3DLGA 1DTTB 4RW6A 2JEJA 1XTZA 1U6BA 1M5SA 2AF6A 3MMAA 3M8PB 3IWNC 3PX0A 1IKYB 1WWHA 2KRRA 3NS5A 2A18A 3B8HA 3JTOA 1KONA 1JLQB 1R6YA 1DTQB 2OPQA 3E01B 2ZH2A 4DUZF 4NLGA 4QWCA 2DR7A 3DU5A 3SCKE 4JI7F 2HNYA 2IM1A 3TAPA 3MMBB 5I3PA 3VAHA 4TQRA 4QYZJ 2HVZA 4PKDB 3IN5A 3NL0A 2K1RA 4KR0B 4Z37A 2UXBF 5KAKA 1S9GB 2HWHA 4IO1A 4ZPVR 5KFNA 4WKRA 4DSKA 1C1BB 5LL6d 1SH0A 3V4IA 1U45A 2E5GA 3UI3A 2N7YA 2GHPA 2B6AB 4MIWA 3SEOA 2VG6B 2R7OA 2CQCA 1I6JA 4KTQA 3PJXA 1JLFB 7FD1A 4QU6A 2DNOA 1FNMA 2B3TB 3IR5B 5J2MA 2FVPA 1PGZA 2QMXA 5K14B 1K1QA 4RW9B 4BBYA 1GTHA 1SH3A 2D1CA 2FB0A 4XPCA 5F8HA 3CUNA 1NNDA 1SKWA 2MJNA 5L1IA 2CJ9A 2G4BA 5KFEA 4O4GA 1FRLA 4LF8F 1UETA 4EBEA 2QSFA 4WZMA 1X4CA 3OFEA 4LSNB 2W7OA 3UD4P 4DL6A 4X2BA 2CQPA 1ZTTA 1C1CA 3DI6A 4DQSA 1K73T 5GAEU 3IGVA 3R5CA 4K4WA 3IC1A 4J9QA 1LKZA 1J5EF 2FPHX 2VUGA 4OMFG 3H5SA 1FK9B 2R2SA 5KFOA 5J2PA 2HQIA 2H9ZA 3H8YA 1R8BA 3IRXB 5AXNA 2QSWA 2BABA 2E5LF 2JFKA 4F3MA 4N56A 2MDAA 1AW0A 3PFEA 2YKMA 1QAYA 2KJVA 2XG8A 5IXUA 5D6GA 4XPEA 2Q6CA 3ZFVA 3SCJE 3EPGA 4FVMA 4OZLA 3NCQA 4Y00A 2XMTA 5KFCA 4JI6F 3OTCA 4UQGA 1J5OB 1SBRA 5B0AA 3CCSS 2FJDB 3IG1B 4KPYA 4Q8EA 2VG7A 2MQPA 1U6ZA 2MQLA 4DV1F 2HHXA 5IQQA 1NK0A 1Q78A 4CT9A 3BQ1A 1H2TZ 1F5CA 2DGWA 2CJBA 4TY8B 3RBEA 2JZ5A 2XBPA 2ZHAA 3CD7A 2J7UA 3MMBA 4MYUA 1YRTA 3P5TL 5CYQA 4B9LA 2KRBA 1HI8A 3TI0A 3DRPB 1VC5A 4Q45A 2C3MA 2OPSA 5D4PA 2KG0A 1M5PC 2RE1A 3PXGa 1UVJA 3KJVA 2BRLA 1NJIT 1TAQA 3ZZOA 5L38A 3G6ES 2IYGA 3MM9B 2GA7A 2VFTA 4DHVA 3DLKB 3OUYA 4A46A 1KN6A 2J8AA 4NLSA 3PW2A 2BJDA 4DBQA 5DLGA 3CO9A 4LIWA 3DLGB 4EUVA 1HMVB 1IKWB 2LDYA 3PO4A 4YR3A 3HMJG 2JJ4D 2MSSA 1U1RA 2W8LA 2DR5A 3C8YA 2FHJD 4N77A 3DM2A 4NLQA 3D5MA 5L9NA 2HNDB 2ERRA 2QA1A 2BANA 3ENVA 4Y2CA 3DOLB 1CC8A 1JLGB 2HLUA 2B9WA 5BR8F 1GXTA 1RTDA 1NK7A 4MMOA 1JJHA 4X4UA 2RRAA 3ZZUA 2BM0A 3W2VB 4ZCKA 3AHPA 2LA4A 2NSBA 4TLRA 3TVKA 2DNPA 2ZH6A 2BOPA 5HROB 2M9KA 2ZOFA 3K2YA 3Q2SC 4EGLA 4ECYA 5J2QB 2J7WA 5HP1A 4J9MA 2VV5A 4Y28C 4MK9A 5U47A 1Z2ZA 1R8PA 2MY8A 5DDQC 1UWBB 1C0UB 1BQNA 2OAUA 4QIVA 1DJ0A 1WG5A 1JLBB 4B9NA 2GO8A 2Z8QA 5HMZA 4IFVA 3UPF