1TUVA

Crystal structure of ygin in complex with menadione
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein ygiN
publication title Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tuvA00
3LGMA 5A6PA 2AW0A 3TOQA 2K1RA 3DXSX 2QLWA 2ASYA 3F44A 3KG1A 4HH0A 5B0FA 1FD8A 3IWXA 4DPOA 5B09A 1N5SA 2G9OA 2RU9A 1MWYA 3T9NA 3GZ7A 1JK9B 3MCSA 2KT2A 2OAUA 4OJ3A 1GXUA 4FNHA 3CJKB 2FHMA 1TR0A 4YEAA 2BJEA 1FVQA 1N5TA 1YJUA 2Q3PA 5T7LB 1Q53A 5T7LA 2BBEA 1SB6A 1VQSA 2AJ1A 2K2PA 1X8DA 1TUVA 3MZIA 1N5QA 4Y2MA 5B0BA 2GFFA 2ZDPA 2BJDA 4A47A 1QUPA 1RJJA 5IXUA 5B0GA 2GV1A 2XMMA 2XMVA 1X0PA 2JDJA 1YG0A 2BYCA 1AFJA 2GO8A 2QYCA 3HHLB 3VTIA 5B08A 1Y9OA 2RSQA 1Y0HA 2K1RB 3HF5A 1AFIA 2OMOA 2VH7A 1URRA 1OSDA 2LQ9A 3FMBA 4DN9A 2AP6A 3UDCA 3HDSA 5B0EA 2XMJA 5KAKA 3LO3A 2AJ0A 2GGPA 2K7KA 1TL5A 1W2IA 2GGPB 2N4CA 3HHLC 2LDIA 2HLUA 2LXFA 2XMTA 4OJHA 4HI1A 4A48A 2FB0A 2FIUA 4QOTA 4A4JA 1JWWA 1S6UA 1N5VA 4A46A 1AW0A 1SQEA 3FRYA 1R6YA 2N4DA 3K7RA 3HX9A 1FEEA 2HLTA 5B0DA 1YRXA 1YJTA 1SI9A 4OIXA 1P8GA 2RMLA 1X7VA 3KG0A 2N7YA 4OJ1A 3WDOA 3BGUA 1P6TA 3I9ZA 2CRLA 4OJGA 1KVIA 1Y3KA 1MWZA 4Q2MA 2OFGX 3TNVA 1Q8BA 3BM7A 2XMWA 2W4CA 4ZA1A 4ZOSA 2ROPA 4NPOA 1TL4A 1YJRA 1CC8A 3E8OA 4Q2LA 3TRGA 2BUNA 2QIFA 2ZDOA 1Y3JA 4HI2A 5B0CA 1TZ0A 1Q8LA 2XMKA 2HQIA 3BDEA 3FGVA 4HL9A 4DL0C 1CC7A 2HFOA 3HFKA 2W4PA 5F0WA 1OPZA 1OQ6A 1V3ZA 2LQBA 3KNGA 2GCFA 2PD1A 1FE4A 1KVJA 1FVSA 2RILA 2W4DA 3QMQA 1FESA 2FTRA 2KT3A 2L3MA 2OP5A 3DCAA 1Q4RA 2OD6A 2KKHA 5B0AA 2XMUA 2OFHX 1WD6A 2IYGA 2PGCA 2ROEA 4HH1A 1XBWA 1K0VA 1IUJA 1GXTA 3BN7A 4NL5A 2OKQA 4EFAC 1U7LA 1YJVA 2K7JA 1FE0A 2HIQA 1OQ3A 1S6OA 2GA7A 2ROGA 1APSA 2ACYA 2VV5A 4YDXA 5K9FA 1KQKA 4FNIA 3CJKA 1ULRA 4Y2IA 3BF4A 2HFNA 3BB5A 4F67A 2OD4A 4Y2KA 3LGNA 1CPZA 2EW9A 3BR8A 3QGPA 2KYZA 3HHLD 2QLXA 3KKFA 1VQYA 2IYIA 4U9RA 5F0UA 5A6WA 2IFXA 3IWLA 1LQ9A 3HHLA
chains in the Genus database with same CATH superfamily
3TOQA 4DV0J 1J5EJ 4ZPTR 3NNAA 2RRNA 3HHNB 4KT0C 1RWOB 2C2NA 4OYAA 5IC6B 1SKSA 1FFSB 4MYUA 4RLEA 4CLPA 5DGBA 4I64A 1NSAA 2CPHA 1UA0A 4G1QB 4OJ1A 1WOPA 1U2RA 4R25A 2XMWA 2E66A 1SUQB 1NDKA 3HFZB 1KKHA 3VAFA 2ZBIA 4B9SA 3KK3A 2W2MP 2P5VA 1RWKB 1GT8A 1XTZA 4LT6A 3CC4S 2HNDB 3H5XA 3PZPA 1JX4A 1HA1A 2P6TA 2ILYA 3MM8A 5MLCV 3HHDA 2VF3A 3R1LA 3NNHA 4DV6J 3K2YA 1W26A 2JWNA 2AX1A 3V81A 1JLGB 1VQ9S 8RUCA 2VASA 2SXLA 2C3MA 2CG4A 3ILIA 3D7SB 1SB6A 3FZ2A 1IBMJ 5D78A 1NNDA 1P9YA 2ASLA 1WDTA 4A8OA 2KM8B 4IUFA 2UXDJ 1M0SA 2CQCA 2P8IA 3NAHA 2JC1A 2XM3A 3EDQB 2F4VJ 3HX9A 4DUYJ 1YJTA 5DDRC 1ZPWX 1HBUB 1FHTA 5IZHA 4O3NA 4QIGA 4QQBA 1PYOB 3OTDA 3S01A 2CDRB 5ETNA 1LWEA 4Q43A 1PJ7A 2WCXA 4JV1A 1CSJA 2L9NA 2Y0SD 5DM7Q 4B3OB 2H5EA 3PR4A 4FBTA 4MFBB 3T1YF 4B9NA 2HFNA 2XMAA 4ZVSB 2RU3A 3E01B 4QU6A 4O3SA 1RCXB 3OFEA 2XC9A 3KWMA 2ZBRA 1GMWA 2H48B 3NGUA 5L1JA 4HH0A 3WC0A 1LWFA 4WFZA 2WHOA 3GZ7A 4UOFA 2VQEJ 2NXUA 2Y1LB 1D9DA 3D1OA 2XZTB 3CO0P 1XERA 1IBKJ 4Y2MA 3TI0A 1U6FA 1WC0A 3LALA 2WBMA 1RJJA 2HS3A 4U7UD 1ZZNA 2CQ4A 2KDOA 2R4FA 4MH8A 2L9WA 1TVRA 3G9CA 3GFHA 2DHXA 2B9WA 4BHQA 2J0QD 2MYFA 3FC9A 1X4BA 3HCXA 2QV6A 4CH0S 3ZTQA 4YB5A 5D0RA 1LEOA 1S6PA 1UWBA 3P96A 5D15A 5GAHI 2ZHBA 2APOA 1PYSB 1WC4A 2OD6A 2WB1D 4IG0B 4PG5A 1Q81T 2XMUA 2ROEA 5KG3A 1QSYA 4PPDA 3I5CA 2B9YA 4AL6A 1CQNA 1RU2A 1XK8A 4DFPA 3BGLA 4ZCMA 5AE2A 5A2QY 2J0SD 3EGNA 9ATCB 2MQ8A 3FVYA 2XSFA 3M6VA 4WF9Q 3JAMU 3ZZPA 4X62J 4L72B 1TKTB 4CCHA 4B9TA 4RW8A 4L74A 4ZIVA 2CVEA 1C4AA 1UFLA 1F0XA 3BPDA 4JI7J 3D6FB 1TMJA 5BXIA 4OYOA 2Y0BB 1K9MT 3PRBA 1UL3A 1NPPA 4J5OA 4MT1A 4B3MJ 5K20B 2E5LF 2JNJA 4MIWA 1RWUA 1HWJA 5FLXY 3M2VA 1RYRA 1KVKA 2AWZA 4HI1A 1XMOJ 2J6UA 1FK9B 3NG8A 1FNXH 2AEMA 5M2RA 3DOLA 3GIIA 2V5HG 1YHQS 2OEMA 3WBZA 1TZ0A 2C2RA 4OYWA 4GO5X 3PJ9A 4KPYA 1ZZFA 3TR5A 3A8JA 1NB7A 4DPUA 3B54A 3EE3A 4LFCF 3A3NB 4EBDA 2R2UA 5IM0A 1QAIA 3R7SB 1RTDA 2M70A 4ZKAA 2G2OA 4DFKA 4YUDA 1JLBA 1LXJA 3EYZA 4ITSA 5HMYA 2F1FA 3W2WB 4ECYA 5LMUF 1E6YA 2EEYA 2VG5B 4JV2A 2V67A 1YJWS 1XMQJ 2ZH1A 4YOEA 2IRXA 5KFSA 2RS2A 1U6ZA 4J9QA 4DV7J 1HW8A 1OIAA 2YX4A 4RJVA 4O4GB 2HLUA 4ZVEA 2YKAA 1VBZA 5J2PB 2RKIA 3TA1A 1XC9A 2V4JA 2DBBA 3CDEA 4OHZA 3D3BJ 4QBUA 4WXOA 3M6XA 3MM7A 1S99A 5GMKa 3VALA 2UVWA 3L7OA 4RR5A 2HFOA 1G1XA 3R5DA 1IVZA 4YMEA 1VYAA 1S48A 1Q7YT 3EZ5A 4NZ7A 3TP2A 2AX0A 1PSDA 1ULRA 4TLRA 1TFYA 3V6KA 1K73T 5IQQA 1U1MA 3HT0A 1DTQA 4FYXB 2CQHA 3HSZA 4FKYA 3MF5A 1GAOA 1CLFA 2DR6A 3J80U 1RHMB 4KH1B 2Q3PA 1YJNS 3CMQA 4K4TA 4ZPAA 5EX3A 4KE5A 1SJQA 2JDJA 3CCZA 3KJNB 4Q45A 3GV5B 2HYIB 3ELHA 3DM2A 1E6VB 4GKKF 2DRDA 2O5DA 4DV0F 1MMNA 2W9BB 4OI6A 1OS5A 5HLFB 2HVIA 2M0GB 2C2MB 3MEEB 2IAJA 1X4FA 5JXSA 1YITS 4ZPVR 4OI1A 3MMCA 4OYXA 4ECSA 2BUNA 5KTQA 3EWGA 2LQJA 2ASDA 3DLJA 3O3LA 2HIYA 3U02A 2GIFA 2FJDB 4ES2A 3H20A 4OZJA 3ITHB 4NXMJ 3N5BA 2R7SA 3EICA 1XWLA 4IYQA 4ANCA 1S59A 5T14A 5KFKA 2ZH5A 3IBFB 1FFWB 4JI5F 3C15A 4LVNP 1V5IB 2B4VA 2QA4S 2XYGB 2E9TA 3DLLQ 4PEOA 4M5MA 2P9GA 2XYHB 2ZH8A 3GR0A 3VTIA 4W92B 1SJRA 4TKTA 3WIVA 3NMRA 2GC8A 2RUGA 3SCKE 2NQPA 2FZCB 1D8YA 3UN3A 3NBPB 1IBLF 1H7XA 1IBMF 4L3KA 4KGKA 1UEVA 1VR6A 3FCVA 3O6QA 1AZSA 3D1QA 3OL7A 2UXDF 2ADCA 1FI4A 2ZITA 2E1MC 3NCPA 2BDPA 2PI5A 3PY8A 4NCGA 1L3KA 4DUYF 4ED2A 5E41A 4U8YA 3DLKB 1MN7A 1KQSR 3G8SA 1L3UA 1SL1A 3DOMB 5J2NA 4E2FB 1S10A 1FJGJ 2KTQA 1HHTP 3MD1A 4LF4J 4HDHA 1NEEA 2JFDA 3L7UA 1LWCB 2EI5A 4LF8J 3O5TB 3OLBA 1Q5YA 4IRCA 1PJ5A 2FC8A 3UQSA 3FFIA 3QQCD 5B08A 1N5YA 4YR3A 3O1LA 4N56A 2B51A 1C2PA 3LAKA 4C8OA 5CQGA 4IDKB 5ETSA 2VQFJ 3QIDA 5L38A 1EQMA 3MECB 2M8HA 1JQGA 1SH3A 4ICLB 2UUWA 2HVDA 4RNFA 1HMVA 3MAQA 1B99A 1FNMA 3TRGA 2MKKA 1LW0B 4WP9A 1Q8LA 4QWDA 1JKHA 1VBKA 2J6TA 2FY8A 3RBZA 2YY3A 4TYAA 1HPZA 1SC3B 3KUHA 3MAAA 2QEXS 4NLXA 1LWXA 3GJTB 2RQMA 4KHPJ 5ADZA 3E3XA 3IA0A 4K4ZA 3GU0A 2HHSA 1U1NA 3Q0AA 4F4XA 3BSOA 1HFEL 2YNFB 4B3SJ 3T9NA 2OIHA 3IG1B 2KU7A 4WFNQ 2RHSB 3QYYA 1YJUA 4EO6A 1REVA 4QPTA 4P6QA 1JXVA 1OSCA 2C2OB 5IFMA 5J1PA 1NBEB 4QU7A 1MMLA 5IT4A 2H1YA 1X0PA 3PJWA 4DR6F 1Q0NA 4FYYB 4X62F 5E3PA 2IHR1 4C98A 1W2BR 2O3DA 2PSZA 3NGKA 5F8HA 2P6SA 1VC5A 1YK9A 1FEEA 4CT8A 1ZAVA 5E3QA 5F8NA 5B0CA 4ED0A 3SZ2A 1K8AT 2M9KA 5K8MA 3WHIA 4B3MF 3OFHA 3D2WA 3UD5A 5DS7A 4W90B 1ZTWA 4RBVA 4P2XA 3ISNC 1F1BB 3SCLE 2GCFA 2RE1A 1XNRJ 1WF2A 4PG7A 3TEHB 1NK9A 1CJVA 2HWTA 1S1WA 1B4SA 1UCNA 4DS5A 1XMOF 1WELA 3SDEA 4BS2A 2QC3A 2XI3A 5AT1B 2IJFA 2NPIA 4C3MA 4W98A 3LGNA 3LQVA 4EK2A 2GVZA 4KAIA 1WF1A 5KFHA 2EFNA 5ETVA 3BKFA 4KH0B 2BW7A 1LW2B 3HJFA 1SQGA 3W2VB 3I4HX 4DV3J 2DCUB 1G7CB 2R42A 3ZZZA 1VQ8S 3THVA 4P2MA 3CD5A 3OW2R 2QN6B 3LPEA 4PABA 1FRJA 2KVIA 4EZ9A 5A76A 4WU3A 4A8QA 2KJVA 1TK0A 3DRPA 4GRSA 2ZZMA 4KPCA 3MM9B 3C46A 2R7TA 3BGUA 2I0XA 1XMQF 3Q8VA 2MZTA 1MSWD 2OPSB 4O4RA 3POTB 2DIUA 4DV7F 3BREA 3D6HB 3T5JA 2W25A 5F9NA 4P71A 2HHVA 3KDNA 2B7CB 1D1UA 1KDNA 1FDNA 2VC1A 3HJVA 4K4YA 2KO1A 2QA1A 1YWXA 1VFJA 3GONA 3VAMA 3FBEA 3K57A 5DZ6A 2ACMA 4CDIA 5A6PA 1PIEA 5K14A 4J91A 4URSA 1JLAA 2HPUA 2YNIA 4USTA 4MAKA 2AF6A 1JLCA 3PCOB 4QPXA 1NKBA 2NXCA 1MU2B 3JSBA 1NJZA 1N0VC 3MCOA 4KY3A 3HF5A 2VH7A 3I82A 1OSDA 5GADU 1QSLA 3I0RB 2GX8A 3VR1A 5KG2A 1HHQA 1TKXB 4LMZA 1NK0A 2ZBCA 3JS9A 3SV4A 2CPYA 1WHXA 3SI8A 3SFGA 1VISA 4JUZA 4FXDA 5CYQA 4CYUA 1VCTA 2W4PA 5ETMA 5KFPA 4PG8A 5HROA 1Q4RA 2OLWA 3NEKA 3QLHA 2HEKA 1KSPA 2B3TB 3BKUA 3WIUA 4DX5A 3MEKA 3KDOA 3LP1A 4ZP8A 1D8ZA 2Y1IA 1RE1B 2MLZA 1WORA 5A8RA 5KG1A 4U8VA 2HMIA 1DARA 2A10A 3QAUA 5C5JA 2E1PA 1HBMB 1NJYA 1FKOB 2YQ0A 3E2EA 2RU9A 3L7PA 3SCIE 4OJ3A 5KFQA 3ZZTA 4J90A 3UW1A 4QW8A 1TU0B 2DGXA 2PDAA 4NLSA 1TUVA 4B08A 4YB1P 1ZTTA 3RB6A 4JV5J 2CJBA 2F40A 1RT4B 1N33J 1XN9A 3W5XA 2CFXA 2HVZA 1SJFA 1M1GA 2BZ2A 2HWIA 2N4CA 3BGRA 4AL5A 4LF9F 1NHUA 4OIXA 2N7YA 3TW0A 1P6TA 2R7UA 4OZNA 1GH8A 2XGPA 2HWHA 5C2CA 3QRQA 1S1VA 3ZTOA 1VRUA 2BRLA 2DGSA 2F5GA 2AZ3A 1IUJA 3T9ZA 1FRMA 4YR2A 2KXNB 2CDQA 4YDXA 1RWVB 4JOUA 3BB5A 4U67Q 2MQNA 2P9CA 2Z8QA 1RBLA 4IG3A 1AB8A 2G0JA 3KK3B 4RKUC 3BV8A 3MEDA 3U1LA 5H9EJ 3VGSA 1DTTA 3DLGA 3OT9A 1KWMA 3C14A 1AYEA 3MR3A 1VQ4S 2EFOA 2ZDPA 3D5MA 2VD3A 2R8KA 2LYVA 3V81B 2HRUA 4TQRA 3RU0A 2GQQA 3I87A 4ILRA 2XSJA 1IKYA 4LF4F 5CABA 5KFAA 3VHQA 4B17A 3DOKB 1QVFR 3AT1B 2XNQA 2OTJS 4WE1A 3CCTA 2VKZG 3IFEA 1XMBA 1KONA 1WC6A 2UXBJ 4IKAA 4PWWA 5KFXA 2KN4A 3RTVA 2VQFF 2RS8A 4RBTA 3NXZA 1T9XA 2VIHA 5J2MA 2KKHA 1L3SA 2ALZA 2HIQA 1HNIB 3SBMA 1XR7A 2OSRA 2ABYA 4O23A 4FXVA 5AXLA 2QL7B 3TJ8A 1JJ2R 1YZ6A 1Q79A 4C8LA 4OHWA 5L9NA 1UPPA 1S0MA 3MCNA 4ED5A 3U1MA 3SQGB 4NLOA 4F26A 1SC6A 2DB1A 4TY8A 4Q7AA 2E5JA 4KHPF 3OFGA 4ELUA 5DDPC 3VWSA 4QIWD 1QM9A 5AE1A 4PZVA 1LWFB 5A8KA 1RHKB 4NMXA 2K7KA 4WJBA 2ZKUA 4B3SF 1F3FA 1JJHA 3FNNA 2WVBA 3MOZA 2VPYB 2JLGA 1YRUA 3A4TA 3S8SA 2FLPA 1I94J 1HNXJ 2E5HA 1TVRB 5GAGI 4C2MA 4GVBB 1NHKL 4ZN1A 4U7UK 3SQOP 3HVRA 3BSCA 2CQIA 1NJXA 5A0YB 1S6PB 4DLGA 1UWBB 2ERRA 5HVFA 4M1KA 1L3TA 1OWXA 5A8WA 1M5OC 1YBTA 1U2CA 1K1QA 1U09A 5FIIA 2V34A 4DG1A 4M5HA 2VONA 3I31A 1GNKA 2XCPA 3CJ8A 4YQWA 1XNRF 4ZVPB 1RHQB 1SL0A 2R9LA 1IM6A 3VGTA 2JVOA 1UMJA 3M8SA 5KFDA 1FO1A 1RSCA 2DH8A 1HNZJ 1FKAF 5KFRA 3B6BA 4O3PA 3T1HF 3UDCA 3Q89A 5B0EA 4WK3A 2CJ9A 3AXMA 3SYZA 4OZ2A 4OJGA 1PILA 3M2VB 3ZNJ1 3KJFB 2FD2A 3MTKA 1YI2S 1N52B 2GNKA 1X4CA 4ATNA 1T11A 5M2PA 2AHOB 1FDDA 3BKTA 3M2RA 3W65A 2R3VA 3DOLB 1S4EA 2GAGC 1LNQA 4KB7A 4XTTA 4MK8A 3HULA 3TVKA 3PW5A 4WFYA 4CNYA 3KKFA 1RCOB 4M94A 1QSSA 4KRWA 1R0BG 5ETPA 1XQIA 3OR2B 4OZ5A 2COLA 1X4EA 4M5DA 3OFFA 3F73A 1ZA2B 2OPRA 3HVWA 2VDIA 4ANEA 2UV8G 2BJEA 4YHHF 1BY9A 1YVFA 1KP6A 1JLBB 2QO3A 4K8RA 2F8HA 1HQ2A 5LM7E 3VAKA 3MUMP 3H4DA 5KFEA 3HDSA 1DQ8A 2IPOB 3BBFA 4P52A 2Y8YA 3J81j 3FRYA 2YKPA 1RTJB 1DZ5A 2IDEA 1T03B 5MAOA 2AQ4A 2FHJD 3FCHA 3BM7A 4LR7A 1EIYB 4KO0A 4P2FA 4ZK7M 1UVMA 2HHTA 1AA1B 1KN6A 2AZ1A 4W4MA 2RKIB 2V4JB 3RUBL 3IM9A 2CQ2A 2VU5A 4CO0A 4ZVOB 3MM7B 2ZOMA 4LJMA 3LF0A 5K8NA 2WVFA 5KT7A 3W62A 4G3IA 1HW9A 2CPFA 3ENAA 5DG7A 1WI6A 4YFUA 1YZ7A 2A2CA 3ZTPA 3DC2A 4MKYA 2BQ3A 2V9KA 4ZITA 1FWPA 2HHXA 4N8OA 3GCXP 3B4DA 5T7LA 3CW2C 1HI1A 1QUPA 2CZ4A 2EXUA 3H4BA 2DGWA 4DCOB 5DM6Q 1RAAB 2FYXA 2YKNB 2HRTA 4OV1A 2CJQA 2W7OA 2NZ4A 2P2CB 2MKYA 3OJSA 5FJ4A 5KFBA 3R97A 4DU8A 2ATLA 1UEUA 1S7IA 3E51A 1PBUA 3DM2B 3IRXB 1N33F 3BO4A 4TY9A 2D3UA 2HQGA 2L3MA 5GMDA 2IAJB 3PYGA 2D3O1 3DN9A 4OQJA 1NB2A 1YJVA 2LKZA 1APSA 3QWPA 4DXLA 2CQGA 4PG4A 2ZBQA 5CCLA 1D9FA 2R7RA 3AOCA 3MWBA 3VGVA 1XNQJ 1W25A 2VOOA 1J5OA 1FKPB 4UOGA 4F0KA 1CULB 3W1YC 3AHPA 5IWAJ 1AXQA 5FDLA 2D41A 2CQBA 3C15B 1S1XB 3KG4A 4XDCA 4LR8A 2RIJA 1I51B 1XR5A 4O3QA 5G4DA 2EC2A 1NRKA 5J1NA 4A46A 3K5PA 2BJ3A 3KTQA 1F60B 4OV6A 4DOZA 1IR0A 3TNVA 2H3EB 2GMLA 1U0HB 4USMA 4X65F 2X3GA 3D9BA 1ZS6A 3L09A 2V68A 2J0XA 4NOHA 5D0GA 2XGQA 2CWXA 4KGXB 4GC7A 2YKOA 4MKVA 4OLPA 4I67A 1M5PC 2CADA 1F6TA 4JP8A 1NSKL 4I0WA 2DNPA 3IO1A 3JTNA 4NCGB 3W60A 1ROFA 3ETOA 4YB7A 1VQ7S 3MR6A 3KLFB 1VQLS 4UT4A 2BJDA 4OZ0A 5J2NB 4K50A 1CJKA 4ZN3A 4PQAA 2RF2A 2EFGA 2AGQA 1F2HA 3QT5A 5KFUA 1NJWA 2PMZD 3H59A 3THPA 3QIPA 1TELA 3LP0B 4LSLB 2H4YB 4OI3A 1H73A 1MWZA 2ZOFA 3IXQA 3FFIB 5EWEA 2HQ3A 2M8DB 4DX7A 5KT5A 1U2FA 1FDAA 3OR1B 5D4OA 5L8RC 5IV3A 4EBCA 2MQQA 2CUYA 2PC6A 4DHVA 2PGCA 1WUUA 1R89A 2J7WA 2DNNA 4EFAC 2CNKB 2RT3A 1X31C 2HGNA 2DNMA 4MKAA 1N32F 2OD4A 1RADB 3X1LB 3TX8A 1JKHB 1K47A 3MMJA 1RU1A 1HPZB 3TZXA 3D28A 2HHHJ 4I56A 2G2ZA 1FRXA 3FMWA 2XS5A 5LMNJ 1YSJA 3N5FA 2BR0A 2DNYA 4CH1A 4IH5A 2FY1A 4UZCA 4J37A 4L3NA 1VHIA 1QE1A 4WZMA 1PCAA 2CPDA 4R0EA 3KHLA 1S9GA 4XPCA 1REVB 4CO1A 2JH3A 5F41A 4UW2A 2M88A 1KVIA 1C1CA 3R1HA 1SIWB 1HNZF 4WZQA 2LXUA 2XNRA 1RZMA 4P75A 4PRFA 3RBDA 4GMKA 2YWGA 3DMJA 5AXMA 4NMLA 2PE8A 4WFBQ 1UFWA 3BZQA 3CC2S 4DSJA 3VV2B 5F3ZA 3TARA 4ID8A 4F36A 3W9IA 4DU7A 2MTLA 2WW4A 5L1LA 1VMBA 2AW0A 1CJVB 1IR2A 1KR4A 1S1WB 2IY5B 3UDEA 1Q8IA 3SDEB 4OL8A 1N8RT 3BYRA 4DSEA 2KG1A 1KQGB 4X4TA 1K0TA 4OYZA 2A1BA 2K2PA 3MZIA 2JLEA 2GVZB 3R2CJ 2VJVA 1FJ7A 2KFZA 4OYMA 2DR7A 3MUTP 4F3MA 1GMVA 3CIZA 1G3OA 2UUAJ 2MKSA 4ED3A 2XEXA 4LF7J 3NCQA 1SJ3P 3C8YA 2AGOA 1IM4A 4RW9A 3EJMA 2R7WA 4CLSA 3DRPB 5CXTA 5D8HB 5E3RA 2X7IA 4ZHRB 2KT3A 5AJ3F 2HS0A 5ETRA 3LANA 2KHCA 2PA8D 4Y2IA 1QAYA 3OXFA 2WAQD 1FXDA 2VFSA 2GHVC 2HQCA 3C16A 2MB0B 2YQ1A 4U9RA 3Q23A 1F9HA 3J7A1 2HK2A 2B43A 3H8YA 2C2DA 4OI4A 1MMDA 1RWXB 2IA0A 3NLCA 6FDRA 4DPWA 4K59A 2F8MA 1S79A 4PXEA 1JJCB 2J8AA 2NCKL 2V69A 2WSCC 1A9NB 3EXCX 4RU9A 3QPIA 5K14B 4EU0A 2GGPB 1HYSA 1WC1A 2X1FA 2YNIB 3K7RA 5I4MA 1JLCB 2L08A 1RT5A 4X4NA 2B5JA 4PWDA 3W9JA 2AJQA 3I56S 2J9EA 1M5SA 4N8NA 1VHFA 1TL1A 3HFVA 4HKQA 2YX7A 4CM0A 4JI3F 2QGFB 5F8MA 2CJXB 2MQOA 2JOQA 4I6AA 4XPEA 1L3VA 2OTLS 1F5BA 4NLQA 5C7PA 3LH2S 5DO2A 5CYQB 4FZVA 4R0JA 3KLHA 4B9MA 4Y2KA 1HI0P 2EG1A 2BXJA 2YNGB 2WZ1A 5HROB 3KMQA 2VBYA 3M8YA 1UVLA 2V8VA 3EXYA 2MSSA 1OY9A 4R5PA 4NCBA 3LP1B 4ECWA 1N5TA 4DSFA 1T9YA 1KQFB 4P9SA 4P10A 4NRTA 5A8RB 1HNVA 2LU2A 1RT1A 1XNQF 2LVWA 3M05A 2GHWA 2I38A 2HVHA 2LDIA 4O3RA 2DT9A 2IJNA 2IA6A 2RJZA 5IWAF 3MR5A 2VKRA 1SC1B 4FVMA 3KHRA 1TK8A 5IC4B 3MOJB 2F9DA 1YJRA 1YGYA 1S6QA 1QD1A 1UVIA 3GLJA 2BJ9A 4CLYA 2VC0A 4ECVA 3H2LA 3TA2A 3RG6A 4QIEA 1NHVA 2XYPB 3GFYA 3CUNA 4FKXA 1IKWA 1WEYA 2FVPA 1U48A 1NDPA 2FJEB 1YQHA 3BJYA 1ZM9A 4CLTA 2WK4A 2XZDB 2J7KA 3A1YG 3A13A 3J81Y 4DV4J 3VAHA 3NWRA 3UI3A 1VLOA 5B0FA 3K59A 3OSNA 3M30A 1PAUB 5I3UA 1VOMA 3AODA 5D0HA 1S0OA 1KOOA 2GFFA 4IG3B 3FUYA 2Z2MA 5AXNA 3T1YJ 4NZ6A 4OYPA 4ETXA 3V4IA 3MEDB 2EWHA 3CCWA 1DTTB 3DLGB 2A6OA 2FB0A 2FIUA 3LA0A 1IWGA 4PWUA 2H5JB 2IJRA 4B3TF 5IT9U 3HKZD 1XEZA 3G82A 3PIOQ 1ITPA 2CZ9A 1KD1T 1IKYB 4DLEA 2C22A 3SSSA 2MHEA 3T41A 2PMHA 1FCAA 1CJUA 3UNGC 5HP1A 2M2BA 1Q82T 4WE1B 2OKQA 3W64A 1KFDA 2VV5A 4KC5A 3GFXA 1HR0J 4M5GA 4LIRA 4FBUA 2Z57B 1VC0A 3VZIA 2MKJA 2KG0A 5HQLA 4CO3A 1JNZB 1HIYA 1H0HB 2QRRA 5J2MB 2W8LA 4URGA 4DWIA 3RAMA 2OGUA 2QMXA 3D0HE 4NA1A 4RWWA 3C6UA 1ELOA 2NREA 3MEGB 2H5IB 4AL7A 1X4AA 1WF0A 4QIFA 1RYSA 5BR8J 2FHJA 2ZWOA 2AYMA 4KV8A 4H4OB 3LAMA 3MAHA 1CBKA 3LO3A 1RWWB 3D0IE 1HWIA 4K0KJ 4DQSA 4PUOB 2B9EA 4FPRA 2HZAA 4YN3B 3K5NA 3G6VA 4F4ZA 1F9FA 2KFYA 2QX0A 1Z1ZA 5A8KB 1IXKA 3OVAA 2VB6A 2E5LJ 2RDJA 1S72S 2QA4G 2WONA 4CLZA 2NUHA 2PEHA 2LDYA 4ZPCA 3MM6A 1KBRA 3EX7B 2ACYA 1KRPA 2LXIA 5LXRA 3EGWB 3ZZ0A 5G0RB 2U2FA 1U25A 3PHTA 1P27B 5LL6d 4RUCA 3AQOA 3OV7A 2AIRB 1EAYC 4BDPA 2XWYA 2E9ZA 1FA0A 2MJNA 3KXDA 3NNCA 5RUBA 5A8WB 5KFGA 4ALZA 1N5QA 2P9EA 4L76A 4LFCJ 5IXUA 4DG1B 2GO8A 1HKAA 1P9QC 2OMOA 4DN9A 3Q22A 1RT6A 3NL0A 1Q7LB 4J9MA 1BLUA 4MIAA 3DKDA 2XWXA 3ZO7A 3G87A 4UTGA 2MZJA 1EP4A 4QIVA 3CCVS 2KXFA 4CP5A 3ZTRA 4I2QA 4RW4B 4ZJQA 5K5MA 1VJWA 3CB4A 4DL6A 1JIHA 2UUAF 3I9V9 3MUVP 4Q44A 2XZWA 1BGXT 2FLOA 5B7WA 1N56A 5L39A 3RJMB 2DK2A 1CQMA 4Y0FA 2UU9F 1X5TA 4F3OA 1TAUA 3H90A 2WVEA 2WSEC 3KMSA 3RRHA 2C1EB 4MYTA 5HMXA 2ZM6J 2FHMA 3W3SA 1FEHA 4WYWA 1HQUA 4EWTA 3AH6A 1TKZA 4M5NA 3OTOJ 4HYKA 3OTCA 4M5DB 4BLGA 4ZS6A 3NOGA 1D3WA 2XMJA 2OPRB 1MN9A 3RRKA 2JHEA 4TYBA 2N4DA 4H4KC 3MR2A 2RQKA 3G8QA 1VGYA 1BC6A 3AOAA 1RT2A 4G1IA 4DPYA 2WVCA 8ATCB 3CJ0A 4OLOA 5H9FK 1S49A 1RDRA 1QJHA 3I5BA 2R8JA 4GKKJ 2QMUB 2HNDA 2K7JA 1PC5A 2I6WA 1NM2A 2ZNZA 4CTAA 3JB9k 2B8QA 4KO0B 5KG5A 3GG0A 3BGOP 3TAPA 3O2IA 5L1IA 1F5AA 4DX8H 2CAJA 3DYAA 1XR6A 1JLGA 4J9OA 3HLUA 2HBQB 3ZZOA 1VDHA 3ENVA 2FJVA 4USIA 1SC4B 3M9NB 2HAIA 1WJ9A 2E29A 3FMBA 1VBXA 2BQRA 4JI5J 4AE5A 4HT7A 3EUNA 5KT2A 3T5HA 3T19A 2RMLA 3KG0A 3ZZYA 5DQGA 3V4MA 1BQMA 2CNNB 4PXBA 3UN2A 1RLDA 4DN0A 2YQ3A 1KLMA 2CQPA 4HL9A 4X2BA 2IBOA 1FE4A 1GX6A 2WW8A 3ULHA 3QSYB 4GO7X 4TU9A 1NH8A 3P6YC 1IBLJ 3UR0A 3AFGA 3E01A 2VBZA 2RD5C 1SKWA 4AXIA 4Q5VA 3OSPA 3H5YA 2D1CA 3PO4A 4PR6A 3X3UA 4RW7B 4EYHB 2LLZA 4IFYA 2UZAA 5DGAA 1OYDA 2CA9A 4ELTA 3UCUP 4ZLJA 1RA7A 2BW2A 2DNLA 3ZC4A 3TJ9A 3FRZA 4DQPA 1T0TV 4DV4F 3QRRA 2MJUA 2GJ2A 4HHJA 3HHLC 1WI8A 3G4SS 2VBWA 2OELA 1AW0A 1O8BA 1SH2A 1RTHB 2ZH4A 5FDLB 2A2DA 5DQHA 1EX8A 2DISA 3TANA 2VFUA 5I3PA 3DXBA 3MFHA 3V6DB 3PIPQ 1TL4A 1H7WA 1NSQA 4ZVRB 1RB0A 3RAXA 2Z2ZA 3FGVA 3P5BP 4QR1A 5LSLA 4IG0A 5IOLA 2IYGA 1KNZA 4ZP7A 3CD6S 4C8KA 3M6UA 4ES1A 4ED8A 1NSPA 2UUBJ 3J7YI 5ITHA 1U8SA 1X5SA 1GMUA 3W7BA 4WTYA 2V2QA 2CWKA 1SV5A 1TL3A 3MM5A 3UD4P 2XS2A 2AJFE 2ATCB 3BBBA 1HR0F 2XCAA 1SPBP 2Y3YA 5KG7A 4JI1F 2VG7B 3O44A 4L73A 4IQXA 1NKCA 4NLVA 4F4AA 1R43A 3AY0A 4RW6B 3UNYA 1RAEB 5B0DA 4AYBD 1FK9A 4TQSA 4YDDB 1IKXA 3MMAB 1UZDA 3J7YU 4NE9C 4ZA1A 3C6TA 2RF2B 1CC8A 3AOBA 4HVZA 3FDSA 4NLTA 3FEXB 5BR8F 2CQ0A 1NK6A 4KYZA 2NLWA 4DR6J 4ER8A 3GJRB 4KGZB 4K0KF 2MZQA 1PAEX 3TVYA 2VPZB 1WHYA 2KJWA 1B7YB 2CQ3A 4MIBA 4X66F 4NYPA 4X4QA 5KG0A 3R7NB 2IYIA 3RR7A 1LOUA 2DXEA 4LRDA 4K7QA 3H25A 1TAQA 4DPOA 5HBMB 2V63A 2VPWB 4C6AA 4JI4J 3SSQA 4UZBA 2ZBPA 1R8BA 2YNHB 2DRAA 2R7OA 1SVDA 5JJBA 2MEWA 4AUKA 3M9MB 4ZDNA 2VA3A 2DR9A 4BC9A 3IAM9 4Q8FA 4JI2J 4B9VA 1H3DA 2M5YA 3AB4B 4MK9A 4O4GA 5LOQA 2V4QA 2LXFA 1DFDA 3MHYA 2IVMA 1U1QA 4DL2A 3M8QA 4DSLA 1HWKA 3BPSP 4Y00A 4N77A 4N7TA 2X1AA 1H2VZ 3BSAA 1QE1B 4NX9A 4HACA 2YKMA 4FYDA 1OPZA 2BJ8A 2LQBA 4LFBF 3GYXB 1S9GB 2IM0A 3KLVA 3EVWA 3R27A 1S57A 2UVRA 1PJ6A 1YDLA 4NEZA 4DS4A 1JLQB 2E7XA 5DZ7A 3M8ZA 4ZIWA 3CCRS 4LRCA 3KJVA 2E7WA 5KFJA 4I7FA 3DGPA 1XIQA 2ALYB 1T9TA 1UAWA 3DMJB 1KS2A 5LSRA 3QT8A 3NY0A 4KFBA 2NZCA 3KFWX 1VQNS 3DLEB 5E0OA 3PJXA 1EHWA 2F63A 4P7VA 5A2QU 3JXOA 3DDNA 1UTAA 3TWZA 1E6VA 2W9BA 2BKNA 3OPKA 3FKBA 4C11A 1N5VA 4X64F 3MEEA 2V94A 2ZM6F 3VQSA 2UUCF 4ZLNA 4PXCA 1Q86T 1Q8BA 2DNGA 1G6BA 4DFMA 3TZYA 3VVTA 3OTOF 2HQIA 4A8WA 1A0OB 5FLXU 1PBAA 2W9CA 4EEYA 1Y11A 3J7Z5 2YTCA 4AT1B 4DR4J 3OBIA 4PYAA 4OHVA 4ED7A 2W1BA 4NI2A 4JBCA 5HANA 2NS1B 1FE0A 1NPRA 3UR3C 1CJTB 1S9EA 3R6LB 1RWNB 3TJAA 2M7SA 5EUHA 3WQPA 1RAJA 1LQ9A 4X4RA 2MQPA 2DYAA 2KYXA 3IP0A 3P8BB 4ZMMA 2HFUA 4DR3J 1IJEB 2V2ZA 3G86A 3UDLA 5KFMA 2KZMA 2DHAA 1FF2A 3C16B 1RT3A 1RAOA 2MZRA 4DX6A 2BA9A 2NR0A 3OXLA 2ZEJA 2G2YA 7FD1A 1M90T 3QZ7A 2XMTA 4KJIA 1H38A 2K8GA 3FZBA 3KK2A 3TUZC 3UWTA 4LVOP 1P1LA 1UEKA 2CG8A 1SL2A 1U26A 1TL7A 4LR9A 1PKUA 2JFKA 2KRBA 1R0CB 2XLIA 3K8WA 1HYSB 4NLRA 5ETQA 1Q1KA 1RTIA 4XK8C 1RT5B 1R27B 5GAEU 2C2KB 2B5JB 2KXHA 4LF9J 4EO8A 3CJKA 4DV1F 3LTOA 1TL1B 3DLKA 1NLKL 1VRTA 2IRYA 3HKWA 4ED1A 3CJ5A 5EGYA 3DOMA 3MURP 3BQ1A 3QT6A 4K5SA 4Z7CA 1JK9B 6AT1B 4J9SA 2XS7A 1SKRA 4S0MA 5K8OA 5LJ3Y 3KLHB 5H9EK 4RL1A 3BH6B 3SCJE 2IIHA 4A47A 3RB3A 3KJQB 1FWKA 5EX0A 3CCMS 4UQTA 1AFIA 3HP6A 3NOCA 1SQFA 4Y2AA 2E9RX 3M1VB 3N79A 2BACA 1KTVA 1KOHA 3M8WA 1KC8T 1KHVA 1RT1B 3GR1A 4CLFA 2KVQE 4DMZA 4K2JA 4C9DA 1LW0A 2MMYA 5DDOC 1IN0A 1S77D 3EM1A 2G0IA 1EKSA 4ZCLA 2LP4A 4IR9A 1OPIA 2B9XA 1QTNB 3OUYA 4CNZA 1N6QB 5BJRA 4UF4A 3PRDA 3TUJC 3CJTA 2X1BA 3UFCX 2QMWA 3C3LA 3N9UC 2ZJQQ 1QDUB 2F4FA 2V2VA 1EETA 3IR5B 3CDBA 5F8JA 4F2RA 1VLYA 1ACMB 2YNFA 1MWYA 2NPFA 3VCDA 1X9SA 1GXUA 5KFCA 2I1RA 4DQQA 4WBFA 1RHUB 2BBEA 1B0PA 2UUBF 5E33A 2YWEA 3M30B 5IV4A 2IMOA 3CO9A 2ZH2A 1S6UA 2YH1A 4LRFA 3LWMA 2DNOA 3D0GE 1BUXA 1Y7PA 2EFPA 5C42B 4FPIA 4XO0A 1HHSA 2UVUA 3DU6A 5E3CA 2M3DA 3CC7S 4NXNJ 4OHXA 4DV2J 2VODA 3I0SA 3QGIA 3DRRB 5CHCB 1RQ0A 4CI0B 1R31A 2LECA 3UD3P 3ET6A 3BR8A 3BYPA 8AT1B 5HP1B 1Q5VA 4NA2A 2K1RA 3H0PA 3GCWP 3PX0A 3W63A 4NZ0A 1WOOA 2BV3A 1CS4A 2O01C 2M52A 3ISND 1FX2A 2FJXA 1NZAA 2XO6A 4U6PA 2VICA 2N82B 4D3GA 3K17A 3BQ0A 4GKJJ 3IS9A 1ZETA 4WFAQ 4JI4F 3C6UB 1LFWA 3ILLA 4I4BA 1ZPVA 3QBCA 9RUBA 2DY1A 4KV8B 3RRGA 3Q8SB 1FT8A 3IGVA 1NK4A 4KKOB 4JI2F 3VGUA 2N7CA 1S0NA 2KFNA 2DH7A 4H4MA 3T1HJ 2HZVA 2DCLA 4OI2A 3GQCA 4UQGA 1S6OA 2J9DA 4CLKA 4CO5A 2UXCF 4FF1A 1NZ8A 2QLXA 2ZE2B 1HL6A 3MM6B 1HBNA 3NKYA 4FN5A 3IWNC 3TUPA 5J2QB 1U0SA 4RNNA 3CULA 1SCJB 4LF2A 2ZD1B 2FGCA 5C24A 4QYRA 3PG9A 5HVGA 4RWXA 5B0GA 4CWBA 2XMMA 1RGVA 4WP8A 2YPZA 4WIIA 5CYMA 4K5RA 2AT1B 4I2PA 3KLIA 3AD8C 2H51B 5GADI 4V1Ak 5KOWA 1TTHB 1TQLA 4QYZJ 1WKLA 4YHHJ 3QT7A 2LCWA 2X3DA 2UUTA 5DETA 3BDEA 4F4KA 1RT6B 4FS2A 3G6YA 1U24A 2GQ2A 2G1HA 4WU2A 3SFUA 3QRPA 1OMSA 3TUIC 4LF1A 3ENWA 1HQEA 2JVRA 2HRYA 4KIAA 2FJBB 3HHLA 1HBMA 1WSRA 4DL4A 4DR4F 1RXOB 2Y1RI 3M4XA 3MCSA 1X4HA 2R2TA 4YEAA 3PYDA 2R2RA 4M5JA 2MGZA 4ID5A 2PI4A 3GB0A 2XMVA 1RT4A 3CJQA 5HO4A 1WG5A 3HO1A 2DPJA 3D6TB 2D7SA 2R8GA 4O0IA 1WKJA 1BWVA 4DR3F 1Z2LA 3HD2A 4DFJA 2L9DA 3W61A 2MY7A 2V4RA 3RBXA 1HQUB 5HVHA 1TKZB 4JI8F 3T6BA 2QYGA 3BO3A 1Y3JA 4LIWA 2LU1A 3CVKA 3R9LA 1S7HA 4WCEQ 3HFKA 1X5OA 2GIRA 3THTA 2VG6A 4I68A 1Z4UA 2KT5A 1WKKA 4TVAB 2W2NP 1C4CA 1RT2B 5T41A 3FEYB 4F25A 4ECQA 1YTYA 2XULA 5I42A 1U02A 3K0JA 3PM9A 3Q2SC 3G96A 3OL8A 2KI2A 2W7AA 4DQIA 2RUSA 1DJ0A 1I1GA 1IQTA 2BVZA 3RB0A 2ZUGA 2AMCB 4CTAB 3QAEA 5B0BA 2PO4A 2HK3A 5HN0A 2MKCA 2GAHC 5CD4H 1WHWA 5F8IA 3WZ0A 2PEBA 3DYAB 4LQ9A 5HK4A 4WPAA 4ZPBA 3R5AA 1WTFA 3KUGA 3DOKA 3PTWA 2WBRA 1VIXA 1S1TA 4K4VA 4ZOSA 2ROPA 4HTIA 1FTCA 4J9UE 3JAMY 2BE2A 4YS2A 2CXEA 4NLDA 1T05A 2EFVA 4KSEB 3R8YA 1UWAA 3CPWR 3ISZA 3W9HA 1BQMB 3DGVA 1HNIA 5D4NA 5D4PA 1KLMB 3EZOA 4F2SA 3MM8B 1S1UA 4WIQA 1IBCB 4C3KA 1T7PA 1T02A 3U1NA 4DCJB 4OYIA 3ENQA 3ILJA 3PR5B 3FJ2A 1QVGR 4X65J 2XY6A 3SQGA 4X84A 1FXRA 3KUEA 2Z0GA 2AYGA 1UJ4A 1MWQA 2DD8S 3F56A 3B82A 2K06A 4RUHA 1ZAXA 2NXEA 4URQU 2KZZA 3Q2TC 3WX4A 5LT5A 3IC1A 4RNHA 4B9UA 2R8IA 4IFYB 2AJ0A 3DI6A 3NMAA 2HFVA 4C8MA 1Q78A 4DR5F 1V6HA 4F0MA 3EVMA 3H5SA 1HLWA 4BWJA 3GV7B 4GVBA 1B0TA 3KLGA 4ZJLA 1RHJB 3DHXA 3PFEA 1S76D 1LWEB 1EQ0A 2CPZA 2C42A 1WC3A 1XBWA 1GEHA 3RGIA 5A0YA 1NMEB 4E0DA 4DPXA 1WEZA 3VAGA 1HBOA 4RPFA 1VQMS 1N36F 2OH2A 2VFRA 2MZSA 3HZEA 2XQCA 4DSIA 3PACA 1FX4A 4IFVA 4WTOB 2KH9A 3IWXA 2DNQA 1UW4A 3CSKA 4NXNF 4TN2A 4DV2F 2LEBA 5ETTA 2VZ9A 2E1RA 3CCUS 2KL8A 3AQPA 3CJ4A 2ZUAA 1JB0C 5EWFA 1SJ4P 1ZBTA 1N32J 4RNMA 3G8TA 2DRBA 1NPKA 2QSFA 3GE9A 1SV5B 1TL3B 3MM5B 4GVLA 2KHDA 3PDNA 3VAJA 1GTHA 5GAHU 3I4PA 4KGVB 1QAXA 3V6HA 3AA8A 1M5KC 2YH0A 3MXHP 2QTWA 4KHMA 4EBEA 1SH0A 2BE7D 2DTJA 2GVDA 3CJ3A 2LA4A 3GIMA 3Q24A 2PD1A 1FESA 2FTRA 4USKA 4GKJF 4IQMA 3J80Y 4ECTA 1EZZB 1R7IA 1IKXB 1JLEA 2DNHA 4LF6J 4N76A 3C6TB 1N4LA 3JSRA 1PG5B 2Q79A 3OVBA 3HXMA 3DLHA 3PX6A 1EJ7L 3OR2A 3GJQB 5KOXA 4RW8B 1F9EB 3T1AA 2HSEB 5HQMA 4M95A 2Z56B 4G6VB 4P7TA 2EVZA 4C7QA 1LK5A 4ECUA 3G6XA 4A8KA 1VK8A 3AB2B 3IAS9 5CD4A 3CT9A 1YJ9S 5IQ6A 4K2XA 2FLLA 4Y65A 5BYSA 1DHMA 5CZXA 2CJKA 4HHUA 2JL9A 2GQCA 1UETA 5L1KA 1RTJA 1Y5IB 1LFPA 3DDIA 1SI9A 1T03A 2MQMA 2FVQA 2YWHA 5DG8A 3OQ2A 4DDFA 2Z30B 5KT3A 1WHVA 1NK5A 3A3PB 3GYNA 3MPVA 4DEZA 4RUAA 2DGUA 5SZTA 3M8QB 4ZPWR 2HHQA 2VFVA 1T9VA 5IM0B 4CM2A 4PCQA 2JEJA 1RTDB 3CCQS 4HACB 2YKMB 4DBQA 3L3CA 4IRKA 3TX0A 1WC5A 4J9PA 4NLGA 2EKYA 2IM2A 3P45B 2FHKA 5SUHA 5E7OB 5DLGA 4HTJA 1E6YB 2C3YA 5AJ3J 3DNCA 5DG9A 3GILA 1Q53A 1BQNA 3KJVB 4I7FB 3N6LA 3CF5Q 3DGPB 2CPIA 4F02A 1YG0A 4OMFG 4AQYF 2HBYB 2YKNA 4KFBB 3FBCA 3SMZA 4OJHA 3RBEA 3D6MB 1RT7A 4XDDA 3N4WA 5EDWA 1FJEB 2OFGX 5IT0A 3BR9A 1F5CA 3E8OA 3IRXA 1X5PA 2YX1A 1J5EF 4C11B 1V3ZA 3HVTA 2JEIA 2F7VA 3LP2A 3RB4A 2V8GA 1H72C 3MPYA 3K5OA 5E5NA 3SIPB 2QFJA 3RR8A 3EGVA 4UY85 3HI9A 4LFAJ 2VA2A 4YY3J 4CT9A 5H9FJ 3ZFVA 1HI8A 4ED4A 2BEFA 2W9CB 5KFNA 2QE5A 1KFSA 1SBRA 4C8ZA 2IFXA 3IWLA 3K5MA 1TFWA 3ETMA 1DTQB 1FKPA 3EZUA 4NI2B 4LF5J 4ZJOA 5J1EA 1U1KA 1CULA 1V9OA 3JYTA 1IKVA 4JI3J 2FC9A 2BM1A 1KHWA 4OX9J 3A8KA 5LXYA 1S9EB 3ZZUA 1S4FA 1B3TA 4DJBA 4RNOA 1U49A 1S1XA 3W5YA 1QUVA 3PFOA 4WKRA 3H42A 3PW7A 1M1HA 4RU2A 3Q8UA 2BKPA 2DO4A 3D3CJ 2FHOB 2GIQA 4DUZJ 4CLUA 2I9SA 1J27A 3UVJA 1RT3B 1Y3KA 3CXCR 3PVXA 3MMCB 1PO6A 2ZH7A 1GX5A 3AJ1A 4XAKA 4DV6F 5HJXA 1U0HA 3FSIA 1BHNA 2BRKA 2W2OP 3QMQA 1UJ5A 3NRBA 1ZOTA 4A8XA 3KK2B 4A8YA 3UDVA 3MMBA 1YIJS 1XJWB 4KTQA 1RAHB 2C3UA 1TL7B 3M32A 5C25A 2Z2YB 3OL9A 2B6AA 2OO4A 4C4WA 1RTIB 2NYHA 2F4VF 3PV8A 2I2YA 2MHNA 1OY6A 3GSIA 3CJKB 4CO2A 3CJSA 3KLFA 1VRTB 4DZ6A 2EK6A 2CJAA 5HSPA 1EKRA 2GV1A 5H1SV 4O3OA 2X51A 1RISA 4NEYA 1KTQA 4K4UA 3OL6A 3R3TA 2PMWA 2XTJP 3JTOA 7FDRA 3BS9A 1WOSA 4RZRA 1U1OA 2CQ1A 3LP0A 1FERA 4YR0A 4LSLA 1VIOA 4ZP9A 2A6MA 2Q1LA 3GWCA 3DFEA 1RKJA 1NU4A 1Y5LB 3OR1A 1AZSB 1PGZA 1YBUA 2VQEF 2VBXA 2YVSA 1A6LA 4L75A 2JSXA 3PYEA 5LSOA 2MY8A 1MROA 2F8EX 1IBKF 4P74A 4Q0BA 3JSMA 3PYFA 4B3TJ 2VFTA 4E8UA 1C1BA 3T3FA 1VQYA 5KG6A 2IM3A 2VL1A 3DRSA 5K8PA 2ASYA 3PNIA 3OUYB 4DZDA 3KNAA 3R7BB 3CJRA 4IH7A 3BH7B 2PN6A 2ZH9A 1WDDA 1T9WA 2B4PA 4HR2A 1EETB 2VJUA 2RNEA 4FP9A 3HHEA 3FQLA 1N5YB 2AP6A 3J7ZT 1VJQA 2ASJA 2KM8C 4A4JA 5KFWA 1SQEA 2HG4A 2A3JA 3HMJG 2V8PA 1HMVB 1R0AA 5JVGQ 2BM0A 2HZCA 4KGMA 3I55S 4CLLA 3UO0A 4OFZA 1DLOA 4C0OC 2NSCA 1KVJA 1OY8A 4WWSA 2Q6CA 4JI7F 4OYBA 1RA6A 1ZAWA 3MAAB 4ZVGA 2WOMA 1IJFB 3LWLA 2HQDA 3NGTA 2OMLA 2HNYA 3H40A 1C0UA 1JLFA 1NK7A 1T94A 2DY9A 3I0SB 4JI0J 2HHPA 2ZOGA 1N54B 3EPGA 5FD1A 4LF6F 1HD0A 1SIZA 4QWCA 2HVEA 2C2ZB 3ET6B 1X9WA 3EMTA 4IRDA 1S12A 4OZLA 2H4WB 2PFFB 4NWBA 3F41A 2ZNYA 2YWKA 2K1RB 2D9PA 3S1TA 4I69A 3M6WA 4CIOA 2OUGA 2OPQA 2FDNA 2HHUA 1TL5A 2ZVSA 1CS4B 1Y10A 1JWWA 2HURA 1UVKA 2EC0A 1KEKA 3QSIA 2MDAA 2YPYA 3UN5A 4C8YA 2B7BB 5U47A 4D3HA 1C0TA 2W2PP 4MTPA 4JB8B 1BD6A 3KLEA 3QATA 5CAAA 1T9UA 1PC4A 1NUEA 2ZH6A 3IS9B 4Y28C 4ZHRA 4I6YA 4O0NA 2OJ3A 4P73A 1GQEA 4ECZA 1AROP 1FDBA 5ETKA 5IS2A 2IVFB 4KHRA 4FNIA 2HQFA 2KRRA 1BXNA 1W7WA 3CEDA 4ELVA 2B4OA 2KYZA 1X4DA 2MLYA 3WX8A 3A8EA 4H4MB 2IVYA 3DU5A 3R2DJ 2GO9A 1V3SA 2RDDA 2CNOB 2POKA 4GC6A 3SSRA 2HFZA 3Q8YA 4NLPA 2XHCA 2XO7A 1RP5A 4ILLA 3CE8A 1AFJA 2LFVA 7AT1B 1HBNB 5HMZA 2LQ9A 5HL7Q 4OX8A 1D0EA 3MI7X 2DHSA 2GGPA 2UU9J 4NA3A 4TLQA 3CD7A 2DJWA 4WKYA 5C24B 4UUXA 1LV5A 5EN1A 4OI0A 3P5TL 1PYTA 1RAGB 2QZ8A 5CYMB 1HNWJ 2KB2A 4I2PB 3CCJS 1FWLA 2HNZA 1L5UA 1D9AA 4A8MP 4LSZB 3KLIB 4UOCA 1FVSA 3D54A 3GV8B 2OP5A 1RWMB 2LMIA 4C0HA 1M1KT 2E44A 1KQKA 2HGMA 4LSNA 1FFGB 2B8PA 4F7VA 3OXGA 2YNGA 4PKDB 2QLWA 2RQ4A 4Z37A 5KFYA 3AAWB 4DR2J 1JLAB 1BWEA 5DDQC 2XY7A 4LFAF 3C19A 1HQEB 4YY3F 2CYYA 3UCZP 1NO8A 3HHLB 1Y9OA 2RHQB 4O44A 2CPXA 1CEZA 2A0FB 3HM9A 4LF5F 2AJ4A 2WB4A 4B3RJ 3IN5A 2IM1A 4NXMF 2DEIA 4NLUA 3H7HB 4USJC 3LGHA 4OX9F 2MGZB 4ID5B 2F9JA 3I9ZA 1N0UA 5D3GA 2BANA 4LBPA 1TKDA 1Z2ZA 1B70B 5DJBA 4CLWA 2RRAA 4CYUB 2DVIA 1VRQC 4AD6A 2QL5B 5F8LA 4DUZF 1N48A 4ETZA 4DL7A 4NL5A 3QLHB 3MCMA 3HT3A 1UA1A 5KG4A 1MNEA 4ZPDA 2QA2A 1FNOA 1VS3A 4YB6A 3RZAA 3QGPA 1RI7A 4OX7A 1NK8A 4WK1A 4LUBA 3W8GA 2HMIB 2VG6B 2DKOB 2DO0A 5KFZA 3Q86A 3QJJA 1O6XA 3PHEA 3UPFA 1GK8A 1HWLA 3AD7C 5BYRA 1DRZA 2D3ZA 5I42B 4F8RA 4N5SA 2W7PA 3D1HA 1URNA 3SXLA 2DPIA 3IR6B 4QWBA 4AFFA 3UCGA 4HLBA 1WSVA 3PEHA 3QO9A 2PIIA 1R3NA 3BGRB 2VHGA 1RACB 3G71S 4IO1A 2HLTA 1GFWB 4LRBA 3FQKA 4F04B 4NCAA 3VF0B 3G6ES 1O5JA 1T3NA 3AA9A 2AYEA 4N47A 5EWGA 1YJ7A 1FJGF 5C2GA 1S1VB 2MLXA 1VRUB 1P1TA 3U7JA 3N6MA 3DCAA 1ZYQA 4LBIA 2PT0A 4TNOA 4LF8F 1S1TB 4FYWB 5KFFA 1IR1A 1ZM4A 4M5LA 4J9KA 3M8PA 2B0GA 3P4UB 2BE2B 2C3OA 2EW9A 4WYLA 2G1DA 1T05B 1WG4A 4FVCA 4IOBA 2AEFA 1HD1A 2DNRA 1N5SA 2Z2LA 3FBBA 2CIMA 2J8SA 3HSGA 3I5AA 3C14B 1S1UB 3MEGA 3NAIA 4P2SA 2OPPA 5AXKA 2IC3A 1DURA 2QT7A 2G0CA 1ZM3A 4H4OA 5KAKA 4JI6J 3IBCB 4X4UA 2XSJB 2FGOA 4PUOA 1R6YA 2BOAA 1YRXA 4CH7A 3TQEA 3GFZA 4Q2MA 2GMHA 5F3TA 3EVOA 2AD9A 3L9ZA 2X1GA 3JTPA 2W01A 2IDLA 4JI1J 3HVAA 4Y6IA 3DI6B 1FTRA 2NXJA 2C3PA 2DNZA 1RAFB 3QGHA 4I6WA 1NH7A 1K0VA 4WFXA 1WNEA 3NGDA 1OQ3A 2UP1A 4K4XA 4PG6A 4R8UA 5G0RA 2BKOA 3KLGB 2PA3A 3MDFA 1I3OB 5DQIA 4QJVA 2KT2A 3KK1A 1HBOB 3K58A 4F3QA 1H6KX 2RVJA 4TY8B 2BJ7A 2HGLA 2JJ4D 4DF8A 1DY3A 4M5KA 4IFVB 1U47A 1IWAA 2HFSA 3J81U 3P49B 1Y0HA 3CCES 4X66J 1URRA 2LQ5A 1AT1B 3HD1A 3HSJA 4B02A 4PQUA 1W2IA 5CA5A 2QG9B 3I6PA 4FS1A 4JI0F 1EB0A 5GAGU 3GJSB 5KFVA 1S0VA 3LPYA 4WP3A 3BDPA 1O51A 1UFKA 2AYBA 2MQLA 5L46A 3TZWA 1MLAA 1TV6A 2HW3A 3HPOA 1YBAA 4DR7J 1VK3A 4EZ6A 2GZOA 4DV3F 1REGX 4RW4A 1J2VA 2YXLA 3BQ2A 2FVRA 2YWFA 2I5JA 3ZTSA 4PYDA 1RK8A 4DUTA 2DGTA 1U1RA 3TQ1A 1Q16B 2GVDB 3OD2A 4A8SA 5M2UA 1U6BA 1JLEB 3M9OB 4LFBJ 4J7CA 4J9LA 2JC0A 3T6JA 4JYAJ 3QJLA 5GMEA 2V0NA 2XLJA 1WTBA 5F8GA 2QFIA 4OZ3A 2RSQA 3R5CA 2RB7A 3BN4A 3O8WA 4QW9A 1OYEA 3HK2A 1S5ZA 2WRMA 4UOHA 1K44A 3TAMA 2FLNA 1U1LA 1RKIA 4IO9Q 4ZVQB 3AJ2A 4DL5A 3GIRA 2CRLA 2JEGA 3M2UA 1UJ6A 1B0VA 1UVJA 2E5IA 3EPIA 1NAQA 3GIJA 3H2UB 1SKUB 3LW5C 5HI7A 3KHGA 3QGGA 4HH1A 3GIKA 3OVSA 3K5LA 3M2RB 1UKUA 2AJ2A 4X64J 1UP1A 4DPTA 3FSYA 2DH9A 2O1PA 3OTBA 5KFLA 1G2EA 1H2TZ 4FF4A 2UUCJ 2HBRB 1HNWF 1DQAA 4QZVB 2K3IA 5HAOA 2Q66A 4ZVTB 3PW4A 3DLBA 2IRUA 4ANDA 3MFIA 2JRSA 3OHBA 2OEKA 3CD0A 1H2UX 4BBYA 4FDFA 1QTMA 4G1QA 4ZVHA 1V5VA 3FCWA 5CYJA 4DR1J 4DQRA 4FXWA 3DRYA 2BX6A 3C2PA 2UV8A 1SUQA 1T95A 1TK5A 4A48A 2N3LA 3SEOA 2JLFA 1BQNB 2V9WA 4DR2F 2QLFB 3WDOA 1S97A 1Y5NB 2Y8WA 1Y00A 3IRWP 2B4UA 2MSTA 2DNKA 4CRJA 4DL0C 2FPHX 3ILOA 2RILA 4B3RF 1ZA1B 1RT7B 4P72A 3GPAA 4F50A 4M5IA 1U7LA 3US5A 1R8PA 1CG2A 4JV5F 2MXYA 4MJKA 2PFDA 3MTJA 3MGJA 1WEXA 3HVTB 2Q6BA 3LP2B 1LXNA 2AEJA 3SV3A 1VQ6S 3N6NA 4EUVA 4RW7A 3CDWA 4PAAA 3IR7B 1RLCL 2GJFA 5T7LB 3FBFA 3Q8RB 5HATA 2FQQB 4XIUA 1HBUA 3LOUA 4Y34A 4DV1J 4ZCIA 3J7AN 2CVIA 3MPWA 5J1EB 3JYTB 1IKVB 2DGVA 4U96A 1IQZA 1TMMA 2EFQA 1BQXA 1RTHA 2AU0A 3P3DA 4EMDA 4PXDA 4B3OA 1YRTA 4MFBA 3V6DA 1I6JA 2QIFA 2ZDOA 3GG1A 4ED6A 2J0WA 2OEJA 4F4WA 1FRHA 3NS5A 2D9OA 2XI2A 3UVJB 4BWMA 4V19X 1UVNA 2DIVA 5B0AA 1WD6A 2NSBA 3CCSS 2NYIA 4C97A 2GA7A 2HKEA 2ZHAA 1H74A 2FVSA 3Q83A 4BC7A 5CCMA 4DV5J 2FZGB 3OLAA 3HHLD 3B4MA 2FUG9 1DQ9A 3PW0A 2UVVA 1Q8KA 2DGQA 1J5OB 3VAIA 3DXSX 3MMBB 3CCLS 3D4JA 1F2GA 2DR8A 2VUGA 3UE2A 3CMES 2UXBF 3M32B 5C25B 3I96A 4YP3A 2B6AB 2L41A 3PO5A 4IR1A 5CZVA 5AE3A 2RAQA 2VG7A 2NUUG 2QYCA 3PKMA 4IH6A 1A7GE 4WXWA 3V5RA 3BSNA 4IOAQ 2CPEA 5HQ8A 2VPXB 3HHKA 4RW6A 1U8WA 1FJCA 1RAIB 4ZP6A 3MMAA 1KLNA 4ES3A 5LJ5Y 4ZVFA 2HAFA 1M5VC 1SJ1A 1R8CA 2XMKA 5ETLA 3GMGA 2EG2A 1DAXA 1VBYA 2BMBA 2C28A 4JI6F 1QAJA 2MKHA 1TKTA 4K4WA 1GTEA 1T3OA 3BN7A 1VC6A 2H54B 3ADAC 3W8PA 4DSKA 3CIMA 4TXSA 1U45A 1CPZA 2YWWA 2DXDA 2W9AA 3JQKA 4J9RA 2YBVA 1NXIA 1U4BA 1VQKS 2W24A 2R7QA 2ZFHA 1MROB 5HBMA 5B09A 2QLBB 4ENOA 4Q0BB 1FVQA 1YKWA 1I94F 2YNHA 4NYZA 1HNXF 3JSMB 1JXEA 4K4SA 1C1BB 1N88A 2AKWB 4HHHA 2V50A 3IM8A 3L95X 3N0VA 4OHYA 1CJKB 3V6JA 3DRSB 5D0EA 2CQDA 4X4PA 4X4SA 2D74B 1TUWA 3KOAA 2FVCA 3FEZA 3OHAA 4UY8T 5KFTA 2IMWP 2VOPA 3QIPB 5JVHQ 1X7VA 4ILMA 1MG7A 1X0FA 3PKYA 2R7VA 3TO8A 4DF4A 1M5HA 3FSXA 4M8LA 4FF2A 2BOPA 4RBUA 2W4DA 3R5GA 2WSFC 3NCRA 1VI7A 2L48A 3W2WA 1R0AB 1JLQA 4IOCQ 3NGSA 2VG5A 5K9FA 4QWEA 2WTFA 5ETOA 1VQOS 3AJDA 4KQZA 1DLOB 6FD1A 5A6WA 4KBIA 3V2UC 1B7FA 3QFWA 3F44A 4DR7F 1FRLA 2J9CA 3GYGA 3H2VE 3DLEA 5J2PA 2WOMB 2R7XA 5JUMA 3MPDA 3TZZA 1GMWD 2HNYB 2DGOA 1C0UB 2UXCJ 4LBHA 1JLFB 1ZH5A 2OI2A 3PW2A 3M8RA 5D6GA 2ZH3A 3DHWC 1T8EA 4F4YA 4AXJA 1C1CB 4JYAF 3D66A 3RW7A 2Y9HA 4NPOA 4Q2LA 1QY7A 3JSYA 2OPQB 2G4BA 4QYZK 1RBOB 3CGIA 1N34J 2EBEA 4USUA 1C0TB 2AV5A 2MZ1A 1CJTA 3KLEB 1R8HA 1WACA 1H98A 1YX2A 2WVDA 1ZM2A 2VDHA 3ZNUA 4ZLPA 4JV0A 3QJPA 2OAUA 2XG8A 4HT5A 5HLFA 3CDAA 1HARA 4NLYA 3L4BC 4TU7A 1BE4A 5D77A 1FXLA 2Q43A 4Y2CA 4ECXA 4C48A 5I3QA 3MR7A 2O66A 3CNQP 2K3KA 4LRAA 2BABA 4NYOA 3ITHA 1UZHA 3RYLA 3F0NA 4DR1F 3MD3A 2LQ8A 2R8HA 4RW9B 4M63A 2D3OR 1OQ6A 3RW6A 1O0PA 5HJYA 3TA0A 4CZCA 4Z2XA 3H5UA 3A12A 1S9FA 2Z58B 3BGFA 3W66A 4MKBA 4Q8EA 3Q8PB 2J76E 3PEJA 4HEA9 3BF4A 5BYQA 3R5JB 4X4OA 1TUGB 5GAEI 2HNZB 1VQ5S 2W8KA 4JI8J 5E3AA 5THWA 1NDLA 3W5ZA 2ZHOA 5HMWA 2ZC3A 3S7RA 3ONQA 4FNHA 4LSNB 1WG1A 2JX2A 2HS4A 2R2SA 1VQSA 3NBPA 5IT9Y 3D68A 1TP7A 3CWJA 4ZVUB 2GMJA 2CPJA 2CKWA 3FK4A 3M1VA 1FRIA 2V6AA 1WWHA 3I32A 2D69A 2JEFA 2E1CA 1ICEB 2E7VA 2XBPA 2Z4PA 4Z7YA 3A8IA 4PWDB 2YKQA 3CMAS 2W4CA 1QLNA 3JQMA 4O44B 4NASA 2BE9B 4FYVB 4X4VA 2J5AA 3R5BA 4ZCKA 2ZZNA 1R6VA 3B8HA 3K8VA 4I1TA 2E1AA 1N6QA 5D3GB 2BANB 2LEPA 1V3RA 3WC2A 4NLWA 1LWCA 4F67A 1YLXA 3GSDA 4RO0A 2CNLB 3Q8QB 2FZKB 5JMNA 2FJWA 4DCPB 1RABB 1NKEA 3KG1A 4ECRA 3EDRB 4E98A 4IDKA 3NWGA 2W2QP 4R5PB 5KT4A 3MECA 1FD2A 2GJIA 4DI6A 4C0BA 2IBKA 2V8DA 4J9VA 4ICLA 4DV5F 3GTYX 1HNVB 2F65A 2BYCA 2RQCA 1JNRB 3H98A 3G2XA 3N01A 2B56A 3VVUA 5KFIA 1NCLA 1P8GA 3JQJA 1RHRB 4LQ3A 1F3VA 2HBZB 3ZXWA 3QWUA 5C42A 5EHHA 4V19J 3RAQA 3TYTA 4HI2A 4N41A 1S6QB 1RBAA 2J9DE 1RWPB 3QO9B 1JMTA 4USHA 2QJ3A 4MMOA 4NRUA 1IKWB 4C8NA 3IG1A 2RDIA 3DRRA 3PRVA 2J6SA 2RH3A 1SXLA 4DR5J 3NGRA 4KR0B 4C3LA 3DRXA 1OJ4A 4A8FA 3CTRA 2AGPA 4TU8A 2XB2D 2DXFA 3GP9A 4RX6A 1X4GA 5I3UB 3T5KA 3VQTA 3M8PB 1LK7A 2EK1A 3B78A 4QR2A 4CQ1A 1I5OB 1B64A 2H65B 3S6EA 3ZZRA 2M4MA 1GXLA 1HWUA 2DR5A 1N36J 3V4IB 1JJ4A 3DDKA 3QNWB 4G65A 5KFOA 3M7VA 2XY5A 5E2QA 2ZZTA 2LEAA 2ZJRQ 2LA6A 3NS6A 2ZC4A 2BQUA 3KYLA 4U7CA 2OPPB 2IC3B 4LREA 4J9NA 2NXNA 2ZWPA 3G82B 2HHWA 3PXGa 2HHHF 4QR0A 4KKOA 3R6GB 4FF3A 3KNGA 2GW8A 1CJUB 4USVA 3IMQJ 2CZVC 5LMNF 1LKZA 1LW2A 4H4KA 2EPIA 1RTZA 4MK7A 3W2VA 3N28A 1AUSL 3CDUA 1UPMB 3AD9C 3NP5A 2ZE2A 5F0UA 2Y1JA 3QZ8A 2EKNA 3QFHA 3LGMA 1X60A 2DITA 3BEGB 1FD8A 3IGNA 2G9OA 3PX4A 5J2QA 3MPUB 1BMQB 1TR0A 2OSQA 2ZKTA 4R8UB 2O67A 2AJ1A 1X8DA 2ZD1A 3MM9A 2N3OA 3NS7B 2EBGA 5F9LA 2OPSA 2CJYB 3POTA 3OJUA 3KK1B 2DHHA 1X9MA 4QOTA 2JZ5A 4F0HA 3HZGA 3U27A 3TAQA 4B9LA 5DRKA 1NJIT 1D09B 1U1PA 4U95A 4USWA 1Q95G 4PQUB 2WONB 2J7UA 2V2KA 2V8HA 2E5GA 2OFHX 4ERDA 2QSWA 1AUDA 3BBCA 5LMUJ 2ILZA 4H54A 3OTEA 2ROGA 2A18A 5D4LA 1K1SA 2GHPA 3ICLA 1TV6B 4OX6A 4EYIB 1NDCA 3TEGA 2MKIA 4BCAA 4EI2A 1MU2A 1VQPS 5KT6A 1N34F 2H9ZA 4G1PA 5CH7B 2I5JB 2U1AA 3C66A 3I0RA 2XLKA 3EGZA 3A3OB 1UW9A 2C2EA 4QCLA 3IBWA 4LF7F 5DLFA 4QWAA 1TKXA 2ZVIA 2I8EA 2XHWA 2F3JA 3K89A 4RUBA 4UUWA 1CVJA 3HSDA 2G13A 2BJ1A 1OO0B 3AXKA 1Y4ZB 1EARA 4OZ1A 4PPZA 5GVQA 4CO4A 3BO2A 4Y3CA 1JXLA 1RUSA 5L9XA 2QLJB 4EGLA 3KHHA 4ZLLA 1EP4B 2MPUA 2DHGA 1G4CA 3VZHA 1CC7A 5F0WA 2DEJA 3TAMB 2QL9B 1DBDA 4AQYJ 1FRKA 4HDGA 4I2QB 1R8AA 4DL3A 3D67A 1GXTA 1MW7A 1FKOA 2GS8A 2RRBA 3M2UB 2FJAB 2ADBA 2OHDA 3CJ2A 3T5LA 4L6V3 2ZJPQ 3LUYA 3TVZA
chains in the Genus database with same CATH topology
3TOQA 2MQPA 2KYXA 2QLWA 2RQ4A 4Z37A 4MKYA 4ZMMA 2BQ3A 2V9KA 5KFYA 4ZPTR 3NNAA 1IJEB 3AAWB 2RRNA 3G86A 3HHNB 2HHXA 1JLAB 4N8OA 1BWEA 5DDQC 3B4DA 5T7LA 2XY7A 3UDLA 5KFMA 1HI1A 4KT0C 4LFAF 1HQEB 2KZMA 1SKSA 4YY3F 2CYYA 2DHAA 1FF2A 3UCZP 1QUPA 1RT3A 4MYUA 2MZRA 1NO8A 2CZ4A 3H4BA 3HHLB 2DGWA 1Y9OA 2BA9A 2NR0A 5DM6Q 4RLEA 3OXLA 4O44A 2CPXA 5DGBA 1CEZA 2YKNB 4I64A 4OV1A 7FD1A 3HM9A 2AJ4A 2WB4A 1M90T 4LF5F 3QZ7A 2XMTA 3IN5A 2CJQA 2IM1A 4KJIA 2W7OA 4NXMF 2NZ4A 1H38A 4NLUA 2K8GA 3FZBA 4USJC 3KK2A 3OJSA 3TUZC 2CPHA 1UA0A 3UWTA 4OX9F 5FJ4A 4LVOP 2MGZB 4G1QB 4ID5B 2F9JA 4OJ1A 1P1LA 5KFBA 3I9ZA 1N0UA 2ATLA 1UEUA 1U2RA 5D3GA 2BANA 4R25A 2XMWA 1TKDA 1SL2A 3E51A 1Z2ZA 1U26A 2JFKA 3DM2B 2E66A 1SUQB 2KRBA 3IRXB 5DJBA 2RRAA 1N33F 3BO4A 4TY9A 2XLIA 3K8WA 3VAFA 2ZBIA 4NLRA 2DVIA 1HYSB 4B9SA 2D3UA 3KK3A 2L3MA 2P5VA 1GT8A 2IAJB 1XTZA 1Q1KA 1RTIA 4LT6A 4XK8C 1RT5B 5F8LA 4DUZF 1N48A 3DN9A 1R27B 4ETZA 4OQJA 5GAEU 4DL7A 3CC4S 2B5JB 2HNDB 4NL5A 3H5XA 3QLHB 1YJVA 3PZPA 2KXHA 3HT3A 2LKZA 1UA1A 1APSA 3QWPA 1MNEA 5KG4A 1JX4A 1HA1A 2CQGA 4EO8A 2P6TA 4ZPDA 3CJKA 2ILYA 4PG4A 4DV1F 2QA2A 1TL1B 3DLKA 5CCLA 1D9FA 1FNOA 1VS3A 3MM8A 4YB6A 5MLCV 3RZAA 1VRTA 2IRYA 2R7RA 3HHDA 3HKWA 3MWBA 3QGPA 4ED1A 3CJ5A 1RI7A 5EGYA 3DOMA 4OX7A 1W25A 1NK8A 4WK1A 3MURP 4LUBA 3BQ1A 2HMIB 2VG6B 4K5SA 3R1LA 5KFZA 2DO0A 1J5OA 2VOOA 1FKPB 3NNHA 3QJJA 3PHEA 3K2YA 3UPFA 2JWNA 2AX1A 1JK9B 3V81A 1HWLA 1JLGB 1VQ9S 2VASA 4J9SA 2XS7A 2SXLA 3AHPA 1SKRA 2C3MA 5K8OA 2CG4A 1AXQA 5LJ3Y 3KLHB 1SB6A 3FZ2A 5BYRA 1DRZA 2D3ZA 5I42B 5D78A 3SCJE 5FDLA 1NNDA 2ASLA 4A47A 3RB3A 4F8RA 2D41A 2CQBA 4N5SA 2W7PA 1S1XB 3D1HA 5EX0A 1URNA 4A8OA 2KM8B 3CCMS 4UQTA 3SXLA 2DPIA 4IUFA 1AFIA 3KG4A 4XDCA 3HP6A 2RIJA 3IR6B 4QWBA 4AFFA 1M0SA 1XR5A 3UCGA 4O3QA 5G4DA 4HLBA 1NRKA 2CQCA 4Y2AA 3PEHA 3QO9A 2E9RX 2PIIA 1R3NA 3BGRB 3M1VB 3NAHA 5J1NA 4A46A 3K5PA 2JC1A 3G71S 4IO1A 3HX9A 2HLTA 3N79A 2BACA 3FQKA 1YJTA 3KTQA 5DDRC 4NCAA 1KTVA 3VF0B 1F60B 1ZPWX 1KOHA 4DOZA 1HBUB 1IR0A 3G6ES 3TNVA 1KC8T 1KHVA 1RT1B 1FHTA 3GR1A 1O5JA 1T3NA 3AA9A 5IZHA 4DMZA 2AYEA 4O3NA 4N47A 2GMLA 4QIGA 4QQBA 5EWGA 3OTDA 3S01A 4C9DA 1LW0A 2MMYA 1FJGF 5DDOC 1S1VB 1IN0A 1S77D 4X65F 1VRUB 2X3GA 4ZCLA 1LWEA 1P1TA 4Q43A 2WCXA 3U7JA 3N6MA 4IR9A 3L09A 3DCAA 1OPIA 2B9XA 4JV1A 1ZYQA 2PT0A 1CSJA 4TNOA 4LF8F 2L9NA 2Y0SD 1S1TB 2J0XA 4NOHA 5DM7Q 5KFFA 4B3OB 1ZM4A 2H5EA 3OUYA 4J9KA 4CNZA 1N6QB 5BJRA 3PR4A 3PRDA 3TUJC 4FBTA 2XGQA 4MFBB 3M8PA 2B0GA 3T1YF 2X1BA 3UFCX 4GC7A 2QMWA 4B9NA 2HFNA 2YKOA 3C3LA 2BE2B 3N9UC 2RU3A 3E01B 2C3OA 4OLPA 4I67A 2EW9A 4WYLA 2ZJQQ 1M5PC 4QU6A 1EETA 4O3SA 3IR5B 3CDBA 2G1DA 1T05B 5F8JA 3OFEA 1WG4A 4I0WA 4F2RA 1VLYA 4FVCA 3KWMA 2XC9A 2DNPA 3IO1A 5L1JA 3JTNA 2YNFA 4HH0A 4IOBA 4NCGB 2DNRA 3WC0A 1N5SA 1LWFA 2Z2LA 1MWYA 1ROFA 2WHOA 3GZ7A 4WFZA 2NPFA 3VCDA 1X9SA 2CIMA 1GXUA 3ETOA 5KFCA 2NXUA 2I1RA 4DQQA 1D9DA 3D1OA 3I5AA 4YB7A 1VQ7S 2BBEA 3MR6A 3KLFB 1S1UB 1B0PA 1XERA 4Y2MA 1VQLS 3TI0A 1U6FA 3MEGA 3NAIA 2BJDA 4OZ0A 3LALA 4P2SA 2OPPA 2WBMA 1RJJA 5AXKA 5J2NB 2IC3A 4K50A 2HS3A 4PQAA 2UUBF 1DURA 2QT7A 5E33A 1ZZNA 2CQ4A 2G0CA 2EFGA 2RF2A 1ZM3A 2KDOA 2R4FA 4MH8A 2AGQA 2L9WA 1TVRA 4H4OA 2YWEA 3G9CA 3GFHA 3M30B 2IMOA 5KAKA 3CO9A 4X4UA 5KFUA 1NJWA 2ZH2A 2XSJB 2DHXA 1S6UA 2FGOA 4PUOA 2PMZD 2B9WA 2YH1A 1R6YA 3LWMA 4BHQA 3H59A 3THPA 1YRXA 3LP0B 3QIPA 2J0QD 2MYFA 4LSLB 4CH7A 2DNOA 1X4BA 3D0GE 3GFZA 4OI3A 2QV6A 4CH0S 4YB5A 1MWZA 4Q2MA 2ZOFA 1Y7PA 3IXQA 2EFPA 2GMHA 3FFIB 1S6PA 1UWBA 3P96A 5EWEA 5C42B 5F3TA 2AD9A 2HQ3A 2M8DB 4XO0A 5KT5A 2X1GA 1HHSA 3JTPA 1U2FA 1FDAA 2UVUA 3DU6A 5E3CA 3OR1B 5D4OA 5GAHI 3HVAA 5L8RC 4Y6IA 2ZHBA 3DI6B 2APOA 1FTRA 4EBCA 2C3PA 2DNZA 2MQQA 3QGHA 2M3DA 2PC6A 4DHVA 2OD6A 2WB1D 4I6WA 4IG0B 4PG5A 2XMUA 2ROEA 2PGCA 1NH7A 5KG3A 1Q81T 1QSYA 3CC7S 4PPDA 3I5CA 4WFXA 1R89A 2J7WA 4OHXA 1WNEA 2B9YA 4AL6A 2DNNA 1CQNA 4EFAC 3NGDA 2VODA 1XK8A 1OQ3A 4DFPA 3BGLA 4ZCMA 3I0SA 2RT3A 3QGIA 5AE2A 5A2QY 3DRRB 2UP1A 2J0SD 4K4XA 3EGNA 2HGNA 2DNMA 4MKAA 1N32F 2OD4A 4PG6A 5CHCB 3FVYA 1RQ0A 4R8UA 5G0RA 4CI0B 3X1LB 1R31A 3TX8A 2LECA 3UD3P 1JKHB 3BR8A 3KLGB 2XSFA 3MMJA 3M6VA 4WF9Q 2PA3A 3ZZPA 4L72B 1TKTB 4CCHA 3MDFA 4B9TA 5HP1B 4NA2A 5DQIA 4RW8A 2K1RA 1HPZB 3D28A 3PX0A 2CVEA 4QJVA 1C4AA 4I56A 2KT2A 4NZ0A 1UFLA 3KK1A 2BV3A 1HBOB 1FRXA 3K58A 1F0XA 2O01C 3FMWA 4F3QA 1H6KX 2XS5A 2RVJA 4TY8B 1K9MT 1YSJA 2M52A 3PRBA 1UL3A 2HGLA 3N5FA 2JJ4D 4J5OA 4DF8A 2BR0A 2DNYA 3ISND 4IFVB 1U47A 2E5LF 4MIWA 4IH5A 4CH1A 2FJXA 2FY1A 4J37A 1NZAA 1RWUA 4L3NA 1HWJA 4U6PA 3P49B 2N82B 1Y0HA 4D3GA 5FLXY 3M2VA 1RYRA 3CCES 1URRA 1QE1A 4WZMA 2LQ5A 4PQUA 4B02A 2AWZA 1W2IA 5CA5A 3BQ0A 2CPDA 3I6PA 4R0EA 3IS9A 4HI1A 3KHLA 1ZETA 1S9GA 4XPCA 1REVB 4FS1A 4WFAQ 4JI0F 4JI4F 3C6UB 2JH3A 4CO1A 2J6UA 5GAGU 1FK9B 4UW2A 1LFWA 5F41A 3NG8A 1FNXH 5M2RA 2M88A 5KFVA 4I4BA 1C1CA 1KVIA 1S0VA 3R1HA 3DOLA 3GIIA 3LPYA 2V5HG 1ZPVA 1YHQS 1SIWB 3BDPA 3WBZA 1O51A 2AYBA 4KV8B 1HNZF 1TZ0A 3RRGA 2MQLA 2C2RA 4WZQA 2LXUA 2XNRA 3Q8SB 4GO5X 1FT8A 3IGVA 1TV6A 1NK4A 4KPYA 2HW3A 4KKOB 1ZZFA 4JI2F 3TR5A 2N7CA 4PRFA 1S0NA 2KFNA 2DH7A 3RBDA 4GMKA 3HPOA 1YBAA 2YWGA 1VK3A 4H4MA 1NB7A 4EZ6A 4DV3F 4RW4A 1J2VA 2DCLA 3DMJA 4OI2A 5AXMA 3GQCA 4NMLA 3BQ2A 2PE8A 4WFBQ 2FVRA 4UQGA 1UFWA 2YWFA 2I5JA 3BZQA 3CC2S 4DSJA 4LFCF 1S6OA 2J9DA 4EBDA 2R2UA 5IM0A 1QAIA 1RK8A 5F3ZA 1RTDA 4CO5A 2M70A 4ZKAA 2DGTA 1U1RA 3TARA 2UXCF 3TQ1A 1Q16B 4A8SA 4FF1A 4ID8A 4YUDA 5M2UA 4DFKA 1JLBA 1LXJA 2QLXA 2ZE2B 3EYZA 4ITSA 1U6BA 1HL6A 5HMYA 3MM6B 5L1LA 1VMBA 2AW0A 1KR4A 1HBNA 1S1WB 2F1FA 3NKYA 3W2WB 4FN5A 4ECYA 1Q8IA 1JLEB 3SDEB 3M9OB 3IWNC 5LMUF 4OL8A 1N8RT 1E6YA 2VG5B 4JV2A 5J2QB 4DSEA 4RNNA 2KG1A 4J9LA 3CULA 1KQGB 4X4TA 1K0TA 1YJWS 2A1BA 2K2PA 2JC0A 2ZH1A 3MZIA 4YOEA 3T6JA 2ZD1B 2IRXA 2FGCA 5C24A 2V0NA 5KFSA 4QYRA 2JLEA 2XLJA 2RS2A 1U6ZA 1WTBA 4RWXA 5B0GA 2XMMA 5F8GA 1RGVA 2RSQA 1FJ7A 2KFZA 2DR7A 4J9QA 4WIIA 3MUTP 5CYMA 4K5RA 3R5CA 1HW8A 1OIAA 4I2PA 2YX4A 2RB7A 3BN4A 4F3MA 3O8WA 4QW9A 4O4GB 3HK2A 2HLUA 4ZVEA 2WRMA 2YKAA 1VBZA 3TAMA 5J2PB 3KLIA 2FLNA 3CIZA 1U1LA 2RKIA 1RKIA 4Q0BB 3TA1A 4IO9Q 1G3OA 1XC9A 2V4JA 2DBBA 3AJ2A 4DL5A 1I94F 5GADI 3CDEA 4OHZA 2MKSA 4ED3A 2XEXA 5KOWA 2CRLA 4QBUA 4WXOA 1TQLA 3M6XA 4QYZJ 3NCQA 2LCWA 1SJ3P 3MM7A 1S99A 3C8YA 5GMKa 2JEGA 3VALA 3M2UA 2UVWA 1UJ6A 1B0VA 3L7OA 1UVJA 2UUTA 1IM4A 2E5IA 2AGOA 4RW9A 3EPIA 5DETA 3BDEA 1NAQA 4F4KA 2HFOA 1G1XA 3R5DA 1RT6B 3GIJA 3H2UB 2R7WA 3LW5C 5HI7A 4FS2A 3DRPB 5CXTA 3KHGA 3G6YA 5E3RA 4ZHRB 5D8HB 4YMEA 1S48A 2KT3A 3QGGA 5AJ3F 1U24A 2GQ2A 2HS0A 1Q7YT 4HH1A 3LANA 2KHCA 3GIKA 4WU2A 3OVSA 3K5LA 3SFUA 3EZ5A 3M2RB 4NZ7A 1UKUA 3TP2A 2PA8D 1UP1A 2AX0A 3FSYA 2DH9A 2O1PA 1PSDA 1ULRA 4TLRA 4Y2IA 1QAYA 3OTBA 5KFLA 3TUIC 1TFYA 3OXFA 1G2EA 2WAQD 1H2TZ 4FF4A 3ENWA 1HQEA 1FXDA 2VFSA 2JVRA 2HRYA 3V6KA 2GHVC 1HNWF 4KIAA 1K73T 1DQAA 5IQQA 2MB0B 4U9RA 4QZVB 3Q23A 1U1MA 3J7A1 2FJBB 3HHLA 1DTQA 2K3IA 1HBMA 2B43A 2CQHA 4DL4A 3H8YA 4DR4F 2Q66A 2Y1RI 3M4XA 1GAOA 3MF5A 3PW4A 3DLBA 1CLFA 2IRUA 3MCSA 2C2DA 3MFIA 1X4HA 2JRSA 4OI4A 3OHBA 1MMDA 2IA0A 2R2TA 4YEAA 2Q3PA 3NLCA 1YJNS