1B4SA

Structure of nucleoside diphosphate kinase h122g mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Nucleophilic activation by positioning in phosphoryl transfer catalyzed by nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 43
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1998-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1b4sA00
1MN9A 3ENAA 4CP5A 3EVMA 4ENOA 3WX8A 1NDPA 3BBBA 4DUTA 4C6AA 1S5ZA 3VGSA 2HURA 4DZ6A 3EVOA 3FBCA 3PRVA 4WBFA 2AZ1A 5IOLA 1LEOA 4EK2A 1PAEX 3ZTSA 3FCVA 2DXFA 2DXDA 1NHKL 2DY9A 1NDLA 5CABA 1UCNA 3G2XA 3VGVA 1W7WA 3NGUA 4KPCA 1BUXA 3FCWA 3DDIA 4UOGA 1HIYA 3JS9A 4UOFA 1JXVA 4UOHA 1F6TA 3Q8VA 3ZTQA 3VGTA 3ETMA 3Q8UA 3BBFA 3FBFA 1BE4A 1NSQA 3ZTPA 2HVEA 4ANEA 3MPDA 3FKBA 3EE3A 3B6BA 1LWXA 4DI6A 4FKYA 1NPKA 1U8WA 2B8PA 3FBEA 2AZ3A 4W98A 1PKUA 3ZTOA 3BH6B 3Q86A 3Q8YA 1K44A 1NLKL 1BHNA 4ANDA 4O0NA 3Q83A 2VU5A 3NGSA 3VVTA 2B8QA 1ZS6A 3DKDA 1HHQA 3PJ9A 3FBBA 4FKXA 3FC9A 1NSPA 1NB2A 1MN7A 2BEFA 2DYAA 1S57A 1F3FA 1HLWA 1WKLA 1B4SA 3EMTA 1EHWA 3GP9A 2HVDA 1XQIA 2NCKL 1NDKA 3BBCA 5BXIA 3R9LA 2DXEA 1NDCA 3EICA 1NCLA 1NUEA 3VGUA 2CWKA 3NGRA 3EM1A 1S59A 1WKJA 2BX6A 3GPAA 3B54A 3EVWA 3ZTRA 1KDNA 1NSKL 3Q89A 3VVUA 4F4AA 3L7UA 5CAAA 3BH7B 4S0MA 4ANCA 2ZUAA 3NGTA 1WKKA 1VYAA 1XIQA 4HR2A 3ELHA 4F36A 1B99A 3EJMA 5C7PA
chains in the Genus database with same CATH superfamily
2J5AA 4FZVA 2CA9A 2Y0SD 4RW6A 2QA2A 3AJ1A 2FB0A 3J80U 3AOAA 3DRRA 4HLBA 4B3TF 5FIIA 3WQPA 2O67A 4AT1B 4USUA 4ZVOB 3D6MB 2QSFA 2J9DE 2C28A 1JXVA 1RAHB 3PO5A 1VC5A 2JVRA 1HWUA 1S1TA 1VCTA 1HNVB 2ZJRQ 5K14B 5HAOA 1VQNS 2KHDA 5L1IA 3GCWP 2AJQA 4IUFA 4ETZA 1K44A 4C97A 2WONA 2VU5A 4EO6A 1U49A 4FBUA 4XDDA 4KC5A 3V2UC 1LK5A 4ZVQB 2EFQA 2VL1A 3C6TA 5BR8F 1MWQA 2HWIA 1KVIA 1H98A 5IV4A 3J80Y 4A8SA 2D7SA 3K5OA 4ZP7A 1MN9A 5F8LA 3TA2A 4NLRA 1OY9A 4PRFA 2ROGA 2PA8D 1RT4B 5J1NA 4O4GB 1S76D 4LRAA 1D9AA 2QA4S 2PI5A 2V4JB 2MLXA 4KGVB 1XC9A 1TUVA 4RL1A 3HZEA 2LDIA 1WHVA 1TL7A 2WB1D 1U1RA 1M0SA 4I69A 5CYQB 5KFRA 2UXDJ 4DQSA 3MD1A 4PQUB 3M30B 5H9FJ 4BBYA 1WOSA 2A2CA 2XHWA 2XMMA 3H8YA 4F04B 2QE5A 4P10A 3CCZA 4L76A 4K59A 4WK3A 2OPSA 3GMGA 3GJTB 4ZJOA 3UD4P 3EXCX 5HLFB 2MY7A 4PPDA 1GMWD 3DXBA 1APSA 2MSSA 5A8RB 3CCQS 1NB7A 5D77A 3NCQA 2GJIA 3LP2B 3I32A 2IRYA 4UT4A 1Y0HA 2G9OA 4YY3F 4F0HA 5IWAJ 4L73A 3N5FA 1FO1A 3W60A 1TELA 3AXKA 1T05B 3LO3A 4NZ7A 3TVKA 1L3TA 2DBBA 1V6HA 5F9NA 3JSYA 2UP1A 4QBUA 2IA6A 4WU3A 4DX8H 4HH1A 3TAPA 3SZ2A 2M88A 4O0IA 5KFYA 4QR2A 3U02A 1R0CB 4CLWA 1R0AA 3MR6A 3KLIA 1JLEA 3R6GB 3AD7C 3IP0A 3NLCA 2DNKA 2YNFB 4FYYB 4DV3F 3T5LA 3MEEB 3S01A 4K8RA 3DI6A 5ITHA 1N5YB 3ILOA 2G2YA 4QIFA 4EU0A 2EXUA 2NLWA 2KFNA 2PT0A 3CD5A 3Q8QB 2KL8A 1YRTA 4ECSA 4IRCA 2HFOA 2YH0A 4Q43A 2QMUB 4K4SA 3ET6B 4NXNF 2QFJA 3Q2SC 5DO2A 3I96A 2G0CA 5ETRA 4PG5A 1IBMF 4G1PA 4I7FB 2EG1A 2B6AA 2VBWA 3FGVA 2HK3A 3BGOP 1PBUA 2QGFB 2W9AA 4DR1J 3L4BC 2ZOGA 2ACMA 1AB8A 2C2EA 4NWBA 4R5PA 5ETQA 5GAEI 1QVGR 3ZZTA 3GLJA 3MMBB 1G6BA 1RKIA 2FD2A 3FRYA 1G7CB 5D0HA 2DYAA 5KFFA 1ZAXA 4J9QA 2B43A 5F41A 1E6VB 1D09B 4P2SA 2V4QA 2RMLA 1SIWB 2E1RA 3NEKA 2LA4A 3DDNA 5RUBA 4OZ3A 3DFEA 3OSPA 2F9JA 2YKAA 2OPRA 4NA3A 3QT8A 2OJ3A 2K7JA 3VAHA 3WX8A 1ZM9A 4A8YA 4L75A 2R7WA 4CO5A 4I6AA 5C2CA 1OWXA 1GAOA 4DV7J 4FVCA 3TX8A 1MLAA 4TY8A 4N77A 1HIYA 3UCGA 2L9WA 3V6KA 3W5ZA 2BA9A 2GMJA 4GKJF 4ZJQA 1UEUA 2IVYA 4HI1A 4KY3A 4EEYA 2XSJA 2RQKA 1UZHA 1YGYA 3E8OA 1RAGB 2EVZA 2XY5A 5KG7A 2DVIA 4W90B 1QTNB 2VICA 3L7PA 3HZGA 5K8PA 2FHJD 4LF1A 1R3NA 2BEFA 4NLSA 3RU0A 2WCXA 2A3JA 5C42B 2HVDA 3M1VB 4JI6J 1QE1B 3POTB 4ELVA 2KZMA 2AJ1A 2HVHA 4RWWA 4IQXA 5KFUA 4MKBA 3NGDA 4AXIA 5J2PB 4L3KA 2C3YA 3BQ0A 4C8ZA 2CPJA 2NYIA 2ZEJA 2FTRA 2MB0B 2JEIA 4V19J 2CQPA 2ZNYA 3G4SS 4Q45A 1Q53A 1X9MA 2HHHJ 2F4VJ 5ETVA 4QWBA 2YQ3A 1S1XA 4KQZA 3H2UB 2VQFJ 3HMJG 4LRDA 2Q6BA 3IR5B 3VAIA 1R31A 5DGBA 4RU2A 4LF6J 5CH7B 2DR5A 1HWKA 2ZBRA 4ID5A 2VKRA 4DPOA 2KKHA 3QLHB 1CSJA 2FVRA 1SH0A 1RWXB 3JAMU 2DHAA 1FEHA 2DRAA 3K5MA 3OR2A 2CADA 5C25A 4P75A 1B4SA 1SJQA 3FFIA 4BC9A 2DNPA 3LH2S 3GP9A 4DR5F 3TZZA 1TL5A 3OL8A 4CCHA 1WG5A 2VDIA 4OYAA 2LXFA 1UFWA 5KFXA 4JV1A 2DR9A 3C6UB 4PG4A 4HHUA 2PMWA 2HRUA 1CBKA 1Q1KA 4RKUC 2EFVA 3KJVB 2ZZMA 1AA1B 3G6VA 3DLKA 3C2PA 1F0XA 2WVEA 1X4FA 4USKA 4LIWA 4Y34A 1FKOB 4E98A 2JH3A 1SH2A 2R8JA 1JLAB 3M9OB 4LR7A 2DTJA 1RT3A 3JAMY 3CXCR 3LP1A 1WC3A 3QO9B 2W7OA 4J37A 2R2SA 5DZ6A 3Q86A 3PHTA 1SJ1A 2K1RA 3D9BA 1KOOA 3Q83A 1N32J 3M32A 3AOBA 1NB2A 3ENQA 3F56A 1R6VA 3DYAA 3GR0A 3BS9A 1RTDB 3GV8B 1RT7A 4CLTA 2GZOA 2YWGA 3DMJA 4FF2A 4OI6A 3D54A 3ZZRA 5DQIA 1YWXA 2R8KA 4WWSA 1M5HA 4ZA1A 5KFVA 1UP1A 5CYJA 3OTOF 2RRBA 1RT6A 4MIAA 2ACYA 4DV1J 1JWWA 5DM6Q 1IBLJ 1XK8A 5KT2A 4OYPA 1CG2A 2YNGA 2IYIA 3IAS9 2UU9F 2CJKA 3Q8VA 5H9EK 3SFUA 2KTQA 5FD1A 2H4YB 2YX7A 2CQBA 4K0KF 3AT1B 3V4IA 3TYTA 2J0WA 2YNIA 2VPYB 5IXUA 2C3UA 1K0TA 3ZZZA 3SQGA 1WOPA 4ER8A 3FMWA 5AXMA 2KT2A 1MN7A 4DFPA 4O23A 4X64F 1DQ8A 3QIPA 4NXMF 1JLBB 3OL9A 3FCHA 2P6TA 2HKEA 2HWTA 2V9KA 4WZQA 1R43A 4OZ1A 1NPRA 3DOLA 3ENWA 4YEAA 3MCMA 4ECTA 2RKIB 2IIHA 3VAGA 4PWDB 1H38A 4MTPA 2J0SD 3VCDA 3VVUA 2CG8A 5THWA 2BOPA 3PO4A 4U8YA 4HR2A 4KR0B 1U2FA 3QSYB 4GC6A 3M8PB 2CQ1A 2AF6A 3T1AA 1VISA 4F26A 5D4LA 2GCFA 3V6DA 3I31A 5D0GA 2C1EB 1SB6A 4ZJLA 4C4WA 4KRWA 1I5OB 3GJRB 2GIFA 1NNDA 4ZP8A 2OFGX 2JWNA 4RJVA 4TU7A 5GAGU 3ETOA 3QWUA 1FDNA 3J7YI 3GZ7A 1WG1A 3QQCD 2RVJA 1X0PA 3AB2B 4DR4F 4LF4J 1RAFB 1BWEA 1JLQB 3M8ZA 1RT1A 4NLXA 5HQ8A 4RBVA 1WKLA 2DCUB 5I3UA 2MXYA 3OJSA 1UW9A 1FNMA 3PEJA 3OFFA 2X3GA 4BWMA 3EVWA 2Y3YA 1S6QB 3MPVA 2WOMB 2ZUAA 4YOEA 4JI7F 4F4XA 2DNYA 1YSJA 4ZVUB 3M6VA 2JLEA 1V5VA 2ZH4A 4F7VA 1KLMB 4F3OA 3QJPA 3CULA 4ED5A 3O8WA 4O3QA 1HKAA 1NDLA 2AJ0A 3G96A 4FS1A 4DV2F 3P96A 1X4AA 5ETOA 2DGVA 4P71A 3KTQA 2N3LA 1FXRA 1IUJA 2EI5A 2D3O1 1D9FA 2YX1A 2HRTA 5K20B 1WUUA 4RNOA 1RTJB 1PCAA 1GQEA 3HHLA 1A0OB 4Y2MA 1V3ZA 2H4WB 1KC8T 5KFKA 1GXUA 1U0HB 1FCAA 1RCOB 4JI5J 5DLGA 4GKKF 1FRMA 4EI2A 1N48A 3CCVS 2Z2ZA 2CKWA 1XMQJ 1J5EJ 1U1MA 1TR0A 3OL6A 4OJGA 1RISA 4HEA9 4USWA 2C2ZB 1P1LA 5KG4A 4Y0FA 3EGWB 2DH9A 4QU7A 2KH9A 2QZ8A 4ZCKA 2HNDB 2WSFC 2BQUA 1KSPA 4C98A 4CM0A 3IR6B 3QAEA 3P3DA 2HHWA 1OJ4A 1BUXA 3GCXP 3B8HA 3VGTA 4KE5A 1KP6A 1C1BB 2XI2A 1RT4A 4O4GA 4QW9A 4I56A 4C8NA 1ZAVA 2AD9A 4KO0B 2Q6CA 3OFEA 4IOCQ 1ELOA 3PRDA 2VONA 3EPIA 2BKPA 4LF5F 2VBXA 4JI2J 2B0GA 2ZBPA 5K9FA 3WX4A 2ATLA 4O0NA 5FDLB 2FVQA 2RDIA 2B8QA 3QWPA 1HHQA 4C8MA 4KYZA 1IKVB 1NSPA 3T1YJ 2L9DA 3G71S 2OD6A 1VQYA 4ZPBA 2VG7B 4WIIA 1I1GA 3MUMP 3EX7B 1ACMB 2BANB 2KM8B 3NGTA 1RACB 4NLWA 3A1YG 2CJBA 4FXWA 3I5BA 3T6BA 1TKZB 3KHHA 4QIWD 2V4RA 1S10A 2J0XA 5HLFA 3HFKA 4K5SA 2VZ9A 3SEOA 3KG0A 1WF2A 4NLVA 3UD3P 3D4JA 4Y6IA 2EBGA 4ZK7M 4JI4J 4PXDA 3MPWA 3IWNC 4TN2A 2B9EA 3VAMA 4CLSA 1HARA 3N0VA 5J2MA 4O3OA 1UVNA 1VOMA 3VAFA 4U95A 3QT7A 2RB7A 1PKUA 5LJ3Y 4OZ5A 3NXZA 2M70A 2GFFA 5KFPA 2VA2A 3W2WB 4CNYA 4HHJA 4OYOA 2UUCF 1GH8A 4PUOA 3IGNA 1X5OA 2YWFA 1MU2A 5KFHA 2RQCA 2GAHC 1RHMB 2PEHA 3LQVA 3LOUA 2ZD1B 3EDQB 4PXCA 4LT6A 3CT9A 4LSZB 4TY9A 1NKEA 3G6ES 3MMCB 1RADB 2HZAA 3PX0A 1Z1ZA 1VQPS 1VQ9S 4ZKAA 4ATNA 4RZRA 2UUBF 3UD5A 2KG0A 4DJBA 4AYBD 2DJWA 1XTZA 4NLOA 1A7GE 4F0MA 4WTOB 1XMOJ 2XZWA 1ZZFA 2M8HA 4DSJA 4NMXA 1LV5A 2H54B 3G2XA 5E41A 1IBCB 1WG4A 3W2VA 3ET6A 3L7OA 4N47A 4GVLA 2ADCA 2X1AA 2DISA 5B0DA 3I9ZA 2IC3B 2VD3A 4I7FA 2MPUA 2AZ3A 3WIUA 2FHKA 1T9XA 3BR9A 1JXLA 4LFAF 3TJAA 3GIRA 5E33A 2E1MC 4ED3A 3VVTA 5F3TA 1AFIA 2XO7A 4ZIWA 1CJKB 3PDNA 1MSWD 2DNHA 4XO0A 2GW8A 3QGPA 4JI3J 1GEHA 3C19A 4X65F 5JJBA 3HK2A 4H4MA 5HQLA 3W62A 1NZ8A 2HQGA 5EUHA 5KG1A 3ZZ0A 3VV2B 2JFKA 2YH1A 2CVIA 1O0PA 7FD1A 1E6VA 2HHVA 4ZITA 2QO3A 3Q22A 2H1YA 2GAGC 4IG0B 4NLDA 5GMEA 5T41A 2RRNA 1BQMB 1U2CA 1LFWA 1BXNA 1FHTA 2LXUA 1X5PA 2K06A 4QWDA 2B56A 2BJDA 3DRSB 3PFOA 3PKYA 2MQMA 2AIRB 4DR3J 2APOA 3H0PA 4LF7F 1Z2ZA 3HKWA 2K3IA 2CIMA 3DKDA 2RUSA 4XK8C 3IBWA 2KG1A 3LW5C 2J76E 3US5A 4WF9Q 5IC6B 2IBKA 3BSNA 1BY9A 4YS2A 3U1NA 4LR9A 3MAAA 5GVQA 3UDLA 3CJ5A 4OL8A 3UDEA 5HJYA 5GAHU 1YJTA 4CIOA 4OI0A 4PCQA 1U6FA 2N7YA 3E51A 2IMWP 1RWNB 4DS5A 4M5KA 1S72S 4JV5F 4IYQA 4Q8EA 4DUYF 2FHOB 1M5OC 3O6QA 2WHOA 1DTQA 4QWAA 4ZPTR 1VJWA 3DM2B 4NZ0A 3H4BA 2DHHA 2ZH5A 1SI9A 1OYEA 2KZZA 1X5TA 3F73A 3BPSP 3CIZA 1T95A 1EB0A 1FXLA 5LSRA 3ZTOA 1KQGB 4M5GA 3SDEB 3EGZA 2PSZA 4MK7A 1XNQJ 2HQCA 3L95X 1XNRF 2ZUGA 5FJ4A 4PYAA 4MKVA 2LCWA 4NCGA 2R7XA 3BO2A 1K8AT 1C1CA 2CWXA 3DNCA 1IQTA 3K5LA 5HANA 3JB9k 3IBFB 5ETMA 2HS3A 2FIUA 2FVSA 4ECVA 4AQYJ 1L3UA 2ZITA 4CM2A 4V19X 3GILA 2IBOA 2RU9A 4QIEA 1VRTA 1S9EA 2X1GA 2C2DA 3TA0A 1W25A 3T5HA 2GHVC 3ENAA 2F8MA 4CLLA 4DX6A 2M0GB 4HACB 1REVB 4C9DA 3QT5A 1RT2B 4RW7B 4F3MA 5IOLA 1NM2A 4B3OB 4N8NA 4U9RA 1K73T 1LW0B 2HHSA 4UY8T 3TZYA 1T9WA 2CZ4A 3C6UA 4K4ZA 2B9WA 2PFFB 2JVOA 4FF3A 2OPPB 3PYDA 4MYTA 1BE4A 2UVWA 3V81B 1V9OA 3T41A 5KFCA 3EE3A 2B8PA 2WTFA 5F3ZA 4BHQA 3ZNJ1 3Q8YA 1VR6A 1JLAA 1H2VZ 2Z57B 1GX6A 3FMBA 2H3EB 2VDHA 2F4FA 1T3OA 4I4BA 1UFLA 1TFWA 2MSTA 3QO9A 1NK5A 1FF2A 2JEGA 2IM1A 1X9SA 2ZOFA 4LRCA 4DR2J 2V9WA 1UVIA 1CJUB 2LQ8A 2BX6A 1NZAA 2W25A 2VFTA 4PWUA 1S9FA 1RBAA 4ECZA 1RTDA 2BJ3A 4KV8A 1HW9A 1S4EA 3FZBA 3VZHA 2BOAA 1FXDA 4HKQA 1UWBB 1NKBA 5L39A 4R8UA 2DY9A 2VFUA 2WK4A 4ETXA 3B82A 3PTWA 2C3MA 4WE1B 2YWHA 5HBMA 1UW4A 3U1LA 1YJ9S 2OO4A 5IWAF 4OHYA 5I42B 1RYSA 1U26A 3MZIA 2ZHAA 1H72C 1M5KC 4PG6A 3KMSA 3BGRB 3BZQA 3UR3C 5DS7A 2Y1LB 4ZDNA 3M8YA 2LDYA 3CDBA 2DHGA 4JBCA 3ISZA 3KUEA 2EKNA 3N6NA 3MM6A 4C8YA 2E66A 4XIUA 3IXQA 2OSRA 1TU0B 1A6LA 3GFHA 1FD2A 1PJ7A 2LQJA 2Z0GA 2E1CA 5J2NB 3RR8A 2BUNA 4KFBB 3UFCX 2G0IA 1EJ7L 1TL3B 2OLWA 2D9PA 1VBYA 1TL1B 3LGHA 4XPEA 2RHSB 3RRKA 2XHCA 1JNRB 1HYSA 4L74A 2AW0A 2W01A 1RE1B 3I0RA 1UFKA 4EFAC 1Q8IA 1WEYA 4HVZA 1P8GA 3SSQA 5IFMA 2O1PA 3ZZPA 1KHVA 2CAJA 5CCMA 1WACA 4H4KC 4URQU 5AJ3J 4DV4J 4RW6B 4JI1F 2VBZA 1U1PA 3DRRB 2K7KA 4K4YA 3IM9A 3TI0A 3IO1A 2DR6A 2UUAJ 4OV6A 2W8KA 2CQ4A 2AP6A 1LW2B 3D0GE 3HJVA 3PYGA 2XWYA 1VC6A 1M5VC 2I8EA 1T3NA 2Z58B 2WW8A 1FRKA 2CDQA 1S1TB 5KG6A 3JSRA 3MEGB 2OP5A 1JLQA 4CLYA 1T9TA 1FRHA 4IRKA 2FPHX 5K8MA 2GIQA 3HP6A 1TVRB 2EWHA 4CP5A 4OHXA 1GXLA 2WONB 5ADZA 4UF4A 1IR2A 2CNNB 1NK7A 1IWGA 2MQLA 2XYPB 2V2KA 3CDAA 2F1FA 3CW2C 2FY1A 1Q5YA 2E7VA 4PPZA 2P9EA 2FGOA 3NWRA 3UN3A 2IVFB 4OHWA 2WVDA 2D41A 3PG9A 2Y1JA 4F2RA 2BJ9A 4B02A 5DJBA 5E3QA 3FEYB 3MTJA 2VBYA 1HQEA 3H5YA 2YVSA 4ANDA 2J6TA 4DR6F 3SBMA 2Q1LA 4YR2A 1MWYA 4A46A 3CNQP 3CIMA 2XG8A 1B0TA 1R27B 2KM8C 1XMBA 3BGFA 4MK9A 3PX6A 1AUDA 4Q2LA 4M1KA 4KHPJ 2IM3A 5ETPA 1RXOB 4NLQA 3I4HX 3GSDA 1NUEA 1TL7B 3HVTA 2ASJA 2FLPA 1AZSB 1FRXA 4H4KA 1U0HA 2W4CA 1EKSA 2KJWA 3AY0A 3MCNA 2AT1B 3N6LA 1N5SA 4MIBA 3G86A 5H9EJ 4DQPA 5F8IA 3KFWX 3A3OB 3H20A 1IBKF 3CCWA 5T7LB 2AJ2A 1EQMA 3KUGA 2OPSB 2X1FA 2XMWA 1TTHB 4IH6A 2HNDA 1JQGA 2FJVA 4U7UD 2E7XA 2NPFA 2ZH9A 3QJLA 3N28A 2MY8A 3EZ5A 4I6YA 4DPUA 1C0TA 3TAMA 1KEKA 4FNHA 1ZS6A 2BQRA 1UMJA 4LF6F 3D66A 2RJZA 3ULHA 3KMQA 4C3KA 3M4XA 3GIKA 1Q86T 3PW7A 2JLFA 3G6XA 4J91A 2N7CA 4EGLA 2CJAA 2OMOA 5FDLA 5A8KA 2C2NA 4ELTA 2OMLA 1B64A 4FYWB 2YWWA 3ELHA 4QOTA 2VG7A 1U8SA 2VQEJ 4NYPA 4DMZA 1R0AB 1XBWA 4LF2A 1FX4A 3KLIB 2HVZA 3QGGA 1JLEB 2JEJA 3OV7A 3SIPB 4OZJA 1YJWS 3DI6B 2N82B 2EPIA 3N01A 1S1UB 3AOCA 4KIAA 2XYHB 2FLLA 3E2EA 4TXSA 1R8PA 5D4NA 3QJJA 4ED0A 3CJ0A 5KFZA 4H54A 2PI4A 1F9EB 4ZLJA 3R8YA 4ZLNA 1N56A 2MHEA 4NCAA 2Z56B 2PD1A 2MKHA 4X4OA 1LWCA 4KH1B 2G2ZA 4YN3B 2CPYA 4X62F 2FY8A 1XR5A 4PG7A 4UUXA 1NK4A 4ECUA 4QPXA 1B0VA 5HO4A 4CT8A 4P6QA 5EGYA 2CQHA 4LJMA 4O44A 2UXCF 4PKDB 4EZ6A 3OD2A 4C3LA 3NNAA 2DIVA 2VPZB 5C5JA 1N32F 4TLRA 3AB4B 3KUHA 4X4VA 1HNXJ 2I6WA 4DV6J 3MDFA 3EPGA 2E5LJ 1T9UA 2AZ1A 1UVKA 3NOGA 3ISNC 4F3QA 1I94F 3R1LA 4CRJA 1FRLA 3DGPA 3H2LA 4PR6A 3JTNA 2MEWA 1Z2LA 2LEAA 5A6PA 2ZKTA 1GMWA 3WHIA 4HDHA 5KOXA 5DG8A 3W5YA 2MQPA 3D28A 3GIMA 2NUUG 4KSEB 1RBOB 3LPEA 2KB2A 1FJGJ 4AXJA 4WFAQ 3I0SB 4BLGA 3MEKA 3H5XA 4UZBA 3RB4A 1GT8A 3TANA 5CZVA 3BKUA 1F9HA 4TY8B 4DQRA 1FK9A 1JK9B 5HK4A 3HX9A 4DLGA 1Y7PA 1NCLA 4DL3A 2R8HA 1WTFA 3LAKA 2RF2A 4FYXB 2XSJB 2YWEA 4LBPA 1RI7A 4HTIA 2Y8YA 1FT8A 4LFBJ 2R7VA 5A2QU 4KKOA 5CXTA 4O3RA 1WELA 2WVFA 3R5AA 2QLJB 3DXSX 4ZMMA 5LMNF 2M52A 1NJXA 5KT6A 2DGSA 3H2VE 1CULA 1XEZA 1TL4A 4EYIB 1MROA 3UPFA 4C3MA 2KU7A 3W61A 2XYGB 1Y00A 4YUDA 1YJNS 1BWVA 1RBLA 4NLYA 2AJFE 2KYZA 4ANEA 3MPDA 1YTYA 4IG0A 2ILZA 3UO0A 5D6GA 3KOAA 3TA1A 4JYAJ 4ZN3A 3IM8A 1PYSB 2ZBQA 1C4CA 4OJ3A 3UNYA 2MLZA 2PEBA 5KTQA 3BQ2A 3ONQA 2QA4G 2C3OA 4J9KA 1TK8A 3R9LA 2V8PA 4B08A 1TAQA 5A2QY 1JNZB 2VPXB 2Z8QA 4DPWA 5CZXA 1QM9A 4ID5B 4NRUA 4DXLA 2DEJA 2U2FA 3FEZA 3BDPA 2D3ZA 2FVCA 2ILYA 2ZBCA 2CJQA 1NDPA 3MFIA 4B3TJ 3VGSA 2HVIA 1JX4A 2G2OA 3OR2B 1LEOA 5C25B 4IH5A 2CJXB 5IT9U 1U2RA 4CO0A 4IOAQ 1VK3A 3FFIB 3QT6A 3J81U 1YRUA 1X7VA 4WYLA 2R9LA 3KHLA 1WC5A 2XLJA 1NSQA 1HFEL 2RILA 2BR0A 1SJ4P 1CVJA 2DEIA 1RT5A 2GO8A 3RAXA 2CQ2A 1RTIA 4B3MF 1XWLA 4YMEA 1H2UX 4YB5A 2DH8A 3UI3A 1FE0A 1CEZA 2GQCA 2CNKB 4RW9A 1MNEA 2IM2A 2FZCB 2HG4A 3DC2A 4QJVA 3DLKB 4UY85 3MM5B 1CQMA 4JV0A 5BR8J 5J1PA 2QMXA 5F8HA 3SDEA 4MMOA 3A4TA 1NH7A 4ZVTB 3AODA 1RT3B 3UCZP 3HD2A 3LP1B 1SH3A 2ZNZA 2DNOA 5IT9Y 5C2GA 3NP5A 2BJ1A 3J81Y 2H51B 1YZ7A 1HMVA 3TP2A 1FD8A 1J5EF 3HKZD 2IPOB 4ZP6A 4C8LA 3DYAB 5B0GA 3JTOA 1YJ7A 2FHJA 1RT7B 3CMES 1YVFA 4Z37A 2MJNA 4RX6A 3DMJB 3W66A 5F8NA 2CFXA 3S6EA 3RG6A 3G8TA 3VHQA 2CQGA 4HACA 4DL0C 4B3SF 4N41A 2OH2A 3DLGA 1Q8BA 4B3OA 4C7QA 3SV4A 1TK5A 3QZ8A 2ZH2A 3H5SA 2MKYA 1YQHA 2E5HA 4I2PB 1SUQA 2MQNA 1RT6B 1SKWA 2P9GA 4J9RA 3V81A 2CXEA 3L09A 4U7UK 3IWXA 4ZLLA 2BJ8A 2YNGB 3TUIC 4WKRA 2FJXA 5KFWA 1ULRA 1GX5A 4YHHF 2B4OA 3IRXA 4O3NA 2POKA 1S0VA 3LPYA 4B9NA 1RAOA 3QRRA 1IM4A 1NO8A 1H73A 5IZHA 4R0EA 5LSOA 3DHWC 3SXLA 3QFWA 4A4JA 3LGNA 3V4IB 3D2WA 3DOKA 3CB4A 2YNIB 1WC0A 4YY3J 3SQGB 1NBEB 4RW8B 5DRKA 3CJ2A 1CPZA 1CJTA 4RUHA 3QIPB 4CNZA 1UL3A 2HBQB 2LLZA 2DCLA 5B0EA 3IFEA 4W92B 4Y2KA 4ED4A 4IQMA 1VLOA 1BGXT 1ZETA 1WDTA 4C0HA 1RUSA 1LKZA 5I3QA 3D1OA 1W2IA 5HATA 4DV3J 2BKOA 2HNZA 1HLWA 2FLOA 3MGJA 1JLGB 1VI7A 4K4XA 1PO6A 1YIJS 5KG3A 5DZ7A 5J2QA 2W2OP 4NL5A 2ZJPQ 3BGRA 2CPHA 2EFGA 3J7ZT 3U7JA 2XMUA 3QFHA 1RP5A 4N5SA 2JDJA 2PFDA 5L1JA 4OJ1A 3BPDA 1YJUA 4B9MA 5GADU 2V2VA 1NXIA 3IBCB 3K7RA 5EWEA 3RAMA 1KD1T 4NXNJ 4I0WA 4NOHA 2F7VA 1RT1B 2HW3A 3UR0A 1IBMJ 2QYCA 5I3UB 1U0SA 1KHWA 5J2NA 3OQ2A 1ROFA 1NHVA 2JC1A 1QDUB 5KAKA 1X0FA 2XLIA 1ZAWA 3CCES 2W9CB 1XMOF 2BACA 3T9NA 4JP8A 1ICEB 2GA7A 1R8AA 5CCLA 2CDRB 4DV5F 4LRFA 3RR7A 2CPZA 2CJ9A 2W8LA 3M2UA 3UN5A 3PW4A 1I6JA 1KQSR 5CA5A 1BQNA 1Q81T 4TU8A 3DRPA 1B70B 1N34F 1IJEB 3CD7A 4W4MA 3VGUA 4G65A 1HNZF 1LW2A 2VH7A 3RZAA 1PYTA 4Y28C 1JKHB 4Q8FA 2B5JA 3HHLB 1F5AA 3FRZA 4URGA 2VIHA 2F40A 3MEGA 1YX2A 1HNIA 4USTA 4F4KA 2RS8A 1PAEX 2DGQA 4IG3B 1SVDA 4DF4A 4KPYA 1VRQC 4NE9C 1SC6A 4DR7J 2P5VA 1TVRA 4UOHA 3Q8UA 3UQSA 2FYXA 3OLAA 4GKJJ 4J5OA 4TLQA 2ABYA 2GHWA 4CLPA 3OXGA 1D8YA 4ZPCA 2NXUA 1LWXA 3TEGA 4DU8A 1PG5B 2ZH1A 1RYRA 2ZJQQ 4TU9A 2XC9A 2NXCA 1NKCA 1QSYA 4Y2IA 1DARA 3OUYB 1JLFA 1WTBA 2CQDA 3EMTA 2UZAA 1NAQA 1HWLA 1G3OA 4DR3F 3TR5A 2R4FA 1S59A 1H7XA 4BCAA 2LKZA 4P7VA 4NX9A 2ZWPA 2C2RA 4LREA 3S1TA 3EJMA 2CRLA 2P6SA 4Z7CA 4ED1A 3EWGA 5DDQC 2B3TB 1DURA 2QA1A 1FKPA 4X2BA 5C24B 3CCUS 2WSEC 3K89A 2I5JB 1AZSA 2KI2A 2GMHA 1NK8A 2AKWB 4HDGA 4LSLA 4OIXA 5EDWA 3GSIA 4XTTA 2ZH7A 1F2HA 2GVDB 3M6WA 3ZTPA 2I1RA 3KHRA 5T7LA 3TUJC 3I4PA 3AA9A 4DI6A 3D6HB 1FEEA 5DGAA 3NOCA 3F0NA 3HFZB 2MLYA 2Z4PA 4NLTA 1FWKA 3M2RB 2FJWA 1QD1A 1WC4A 1FTCA 4IFYA 2FJEB 5A8WA 2HQ3A 4I64A 2LMIA 1N36F 3D0HE 3IS9B 3PW5A 2ZOMA 1XR7A 4YB6A 2V6AA 3M8RA 1WSVA 3LF0A 1PSDA 4MKAA 5J2MB 2EC2A 4DDFA 3EUNA 2MYFA 1R7IA 3GE9A 4YDXA 3W8PA 4TQSA 4PUOB 4LSNA 3NCRA 2HHQA 1MU2B 2HBZB 1JXEA 3MHYA 1O51A 2U1AA 4X66F 2AGOA 2HPUA 3KLEA 2HZVA 2OHDA 3KJNB 3TVYA 2RQMA 4FPIA 1Q5VA 3MTKA 3HXMA 3DLEA 3KG4A 4FN5A 4Z2XA 2RU3A 3B4MA 2UXBF 4FVMA 4NYOA 3ILJA 1HR0F 2VJUA 3DLLQ 4CH7A 3CD6S 1S1UA 2I38A 1DRZA 4WPAA 1VQ7S 2DRBA 5GMKa 1UVMA 1TUWA 1YI2S 3CUNA 3ENVA 4GVBA 4LFCF 4WIQA 3W2VB 2BE9B 4PXEA 3H98A 3UWTA 5HJXA 3TQ1A 1NJIT 2A2DA 2RE1A 4DPTA 4J9PA 4OZ2A 4OZLA 4M5MA 5KFNA 2Z2LA 4LRBA 3V6HA 1V3RA 3NRBA 3D0IE 3OTOJ 2ZH8A 1RK8A 2MZJA 3JQMA 4DCJB 2G1DA 4URSA 4ZS6A 4USHA 3N5BA 4I6WA 2EG2A 1SC4B 3FEXB 2CVEA 3MUTP 1VIXA 2GIRA 2FVPA 2UU9J 2KFZA 4H4MB 1LWEA 5AE2A 3OHBA 3SCKE 4M5IA 1RGVA 4DFKA 4JUZA 2AYEA 2RDJA 3A8EA 4DG1B 5HROA 4F67A 3I9V9 2NSBA 2EW9A 2V2QA 3TO8A 4K0KJ 4WCEQ 2DNQA 2EKYA 2MQ8A 4WP3A 3LWMA 4M5JA 1HW8A 4V1Ak 5HN0A 4DOZA 2FDNA 2JZ5A 3W9HA 4WFXA 3NGSA 3GWCA 4NA2A 3QRPA 4X64J 1F3VA 4NXMJ 2Y1RI 3AQPA 5MAOA 2MKCA 1FJEB 3HO1A 1NDCA 2ALYB 2GS8A 4XAKA 4RPFA 3I0SA 3TZXA 2L48A 4ALZA 4F4AA 2BVZA 4A8OA 5CD4A 3W64A 3W8GA 1Z4UA 3OLBA 1XN9A 4GMKA 4ZPVR 2NREA 4U6PA 3MPYA 2ERRA 2HGMA 3ZTSA 2UV8G 2R2UA 3PIPQ 2ADBA 2M7SA 3BN4A 2P8IA 1YJRA 3FCWA 1Q8KA 4P2MA 1PBAA 3MAAB 3ADAC 1WF1A 1KFDA 2BM1A 4UUWA 4MFBA 1HNWF 4PAAA 2E5IA 4PABA 3MMAA 4F2SA 2QX0A 3R27A 1VHIA 4M5DB 4Y00A 4DR4J 3BH6B 3FSYA 2ZFHA 2OI2A 4KH0B 2Q43A 1PGZA 3LP0B 1RA7A 5DG7A 1DTQB 2KRRA 5KG0A 5ETTA 4RUCA 2XM3A 2ZKUA 1VGYA 2X1BA 1URRA 1T03A 3SCJE 4ZP9A 3HPOA 1S77D 1MW7A 1U45A 2ZBIA 1QTMA 5D4OA 2YQ0A 1GTEA 3BJYA 2JNJA 4C0OC 5IM0A 5E0OA 3AJ2A 4NCGB 4DV0F 1C1CB 2QL5B 4LIRA 2HHXA 4LF8F 4DV2J 2VODA 5HL7Q 2ZH3A 5AXLA 2JEFA 3VR1A 1YBUA 1VRTB 4RNHA 1S9EB 4ID8A 4NLUA 3IAM9 1IKYA 5J1EB 3CTRA 2YKOA 3D3BJ 1IKWA 1RHRB 3T3FA 3OVBA 4KT0C 3P5BP 4RU9A 1FFWB 2BYCA 4AD6A 4N76A 4DFMA 3C15A 2GMLA 2EC0A 3IC1A 4IDKA 2X3DA 2QSWA 4G1IA 3VF0B 1L5UA 4GKKJ 5KFBA 4DF8A 1PJ5A 5D78A 5AE1A 2J0QD 4ZHRA 1KLNA 1KKHA 3CJ4A 1S0MA 3LANA 2KRBA 3L7UA 4MIWA 1ZTTA 3ZO7A 1WSRA 5DQHA 4BDPA 3PJXA 2AJ4A 3MM5A 1NJZA 2HEKA 4A8MP 3QZ7A 4QYZJ 3FQLA 1T8EA 5IT0A 3MPUB 3GIJA 4KHPF 3DU6A 2IYGA 4ERDA 1X4CA 4ES3A 4UZCA 1H74A 2HIQA 4P7TA 1UEVA 3X1LB 2GX8A 1U09A 2G13A 1U1NA 2DIUA 4M5LA 4KV8B 2LEPA 1NPKA 1JLCA 4M5HA 4LF5J 5LMUF 3D3CJ 2YKPA 2Y8WA 2HNYB 1PC4A 3NGKA 6FD1A 3HSZA 3KDNA 4R8UB 5LM7E 2BM0A 1I3OB 3HVAA 3KLVA 1OO0B 3BSCA 4DZDA 3HHDA 4X4NA 4P2FA 2XQCA 1N5VA 3PCOB 3CGIA 4ECRA 3TARA 4KAIA 1AW0A 4GRSA 1ZH5A 2PMZD 3BBCA 5HBMB 4I2PA 4DEZA 3H7HB 2C22A 1M1KT 2RD5C 2UVUA 2ZDOA 2M3DA 3I55S 5HVFA 1H3DA 1VFJA 3CC2S 1YG0A 3CJRA 3P45B 3EVMA 1RU1A 4AL5A 3GJQB 4CO4A 4ZVFA 2QMWA 2FGCA 4U7CA 3I82A 2DPIA 2E1AA 2ZZNA 4X4QA 4DZ6A 1S12A 4O3PA 3RRGA 4DFJA 1K9MT 4J9NA 4Y2CA 4L3NA 3MM6B 4NEZA 4AL6A 1J5OA 5IQ6A 1S0NA 4RW8A 2MKSA 1CJVA 4RW4A 3MM9A 1M90T 2DD8S 1SC3B 3AH6A 1YLXA 1HBMB 3FBEA 2MJUA 2Q3PA 1T02A 8RUCA 4M95A 5M2UA 5DDPC 1U1QA 2UUCJ 4WJBA 4MKYA 3T5JA 3HT3A 3FC9A 1HYSB 1MMNA 1FNOA 3I0RB 4RLEA 2RIJA 2CZ9A 2QLBB 1F2GA 3HHLC 3C46A 1SIZA 4IOBA 2D1CA 4Y2AA 1BD6A 2QJ3A 4J7CA 4A48A 1JLGA 1X9WA 2LYVA 2JFDA 4EUVA 4CO1A 1WI8A 1KTQA 2EFPA 3EVOA 2QTWA 3MFHA 1Q8LA 2MTLA 3HLUA 1TUGB 3CC7S 1F5BA 1HBOB 1U1KA 1X4HA 3HSJA 2AYGA 4P9SA 1ZYQA 1QY7A 1N4LA 1U8WA 3GYGA 3ITHA 3NNHA 2AEJA 2VF3A 4LFAJ 4WKYA 2W7PA 4DCOB 1FTRA 4E0DA 3K8WA 2CQ0A 4X4RA 2AU0A 2V94A 3JSMA 2BJEA 1SJ3P 2W9CA 4DUZF 1T9VA 4HTJA 2HFVA 4X65J 2J8AA 2MZRA 2GC8A 1WC6A 2J6SA 5B08A 2X51A 3FJ2A 1SL0A 2RT3A 4J9VA 2PA3A 3CPWR 3M9NB 1XIQA 1HQEB 2VG6A 4ED7A 2QYGA 1GNKA 1MMDA 3PEHA 2VOOA 2AX0A 1YDLA 2PMHA 1VMBA 4TYBA 2MZSA 2LP4A 3NGUA 3TUZC 2KO1A 3KLGA 3OHAA 4DPXA 1A9NB 3ZTQA 1JKHA 3TZWA 5LT5A 3HVTB 2R3VA 1YKWA 1VQSA 3MR3A 1RTHA 3Q8SB 2OAUA 4B9SA 2MKKA 1B7FA 4IG3A 2E7WA 3MEDB 4HYKA 1TFYA 2NUHA 1VBKA 3G9CA 2J7KA 2F5GA 2VG5A 2CPDA 1YJVA 4IR9A 1FX2A 1H0HB 4F50A 1NSAA 1LXNA 3DLBA 3NG8A 5HVHA 3BYRA 3V6JA 2V68A 4EWTA 2BKNA 1VLYA 3EICA 3LA0A 2J9CA 5JVHQ 4X4SA 2FC9A 1Q79A 4P52A 3OUYA 3TEHB 4B9UA 3DGVA 4CT9A 1C0TB 2CPXA 1FE4A 3TAMB 5I4MA 3CWJA 4FPRA 2K2PA 4JV5J 4R0JA 1RAJA 1F5CA 3R5CA 3CJKB 4FP9A 3QYYA 2FJDB 4JI8F 1RWOB 4X4PA 2VC1A 2KHCA 4DL6A 1YK9A 3ICLA 3DOMB 2HSEB 3CJTA 1S48A 1ZPVA 5A8KB 5C24A 4ICLB 3SSSA 2OIHA 3R6LB 2I5JA 2M9KA 3HJFA 6AT1B 4USIA 4X84A 2DNGA 1HWJA 3VZIA 1URNA 2UUWA 4ES2A 3HI9A 2M2BA 2C2MB 2F8HA 1XNRJ 3C66A 2GO9A 5A76A 2EEYA 2GVDA 4JI0F 4TYAA 4YR0A 3BEGB 3QIDA 5DG9A 4QR0A 4YFUA 2PC6A 3NMAA 3NS5A 3K17A 3BREA 3M2RA 3ZTRA 3U27A 3C3LA 1LWCB 2XLKA 3OTDA 3WBZA 3IS9A 1KFSA 2C42A 4ZPAA 3MR5A 2VPWB 3KJQB 4OHZA 2R8GA 1Q95G 1PAUB 4OX6A 2DXDA 3RTVA 2XS7A 3BGUA 3GYNA 4CLFA 3PNIA 4O44B 1ZTWA 1UA1A 3AD9C 2E5GA 3BO4A 1RTZA 3GG1A 1XR6A 4C8OA 3R97A 4I2QB 1KONA 4LVOP 2LA6A 1JJ4A 4L6V3 2ZDPA 2VV5A 4Y3CA 3W9JA 2V8VA 2Z2MA 2CJYB 1N8RT 2HQIA 4CLZA 1UA0A 4CYUB 1U02A 3J7AN 3SYZA 1Y5IB 4OYXA 3DGPB 2L41A 2I0XA 1Y3JA 2H65B 3GQCA 3KLHB 4DN0A 3QGHA 3JYTA 4C11B 2V5HG 2YKNA 5L9XA 3TAQA 5E2QA 1PC5A 1RLDA 3MM7A 2UV8A 5C7PA 1AXQA 1LWFA 1MWZA 4ILRA 1WNEA 1FVSA 2YXLA 1S1WB 4WBFA 3BKFA 1IR1A 3OXLA 3KLFA 4TNOA 1UEKA 1W7WA 1FK9B 3UN2A 3DDIA 4KJIA 1F6TA 1KBRA 1CS4B 1EETA 3EDRB 3RUBL 4WFBQ 2RF2B 2DH7A 3MM8A 1IKXB 1Y4ZB 2YQ1A 2O66A 4ILMA 1IJFB 4KGKA 2XMJA 2HHTA 4KKOB 2ZC3A 4LUBA 4K7QA 3G6YA 2AGPA 3H42A 2IJFA 4DG1A 2BMBA 1LQ9A 4OYWA 1CULB 1HQUA 4DSEA 1HL6A 1WDDA 1MROB 2JHEA 2DHXA 3V4MA 4RNFA 1F60B 1NDKA 1Y5NB 3Q23A 1HBUA 4ZVHA 2ASLA 2V50A 3NWGA 2OTLS 2ZH6A 3I5CA 1S0OA 2AV5A 3JTPA 4QCLA 2V34A 4HHHA 8AT1B 3AD8C 2XMVA 4H4OB 3OSNA 4G1QA 2DT9A 4J90A 2HFSA 5B0AA 3C14A 3ZXWA 4LR8A 5B0CA 5F9LA 1QSLA 5L46A 1R0BG 1UJ6A 2QLXA 3AJDA 4QW8A 2RRAA 5A0YA 4ZVPB 2ZM6F 2BDPA 2HBRB 1WHXA 3QNWB 3UVJB 3K5NA 1RABB 3MWBA 2J9DA 2B51A 3CMQA 3ISND 5L9NA 4C0BA 2DNRA 4A8QA 4ITSA 1KQFB 2HZCA 1M5PC 4JI1J 3DHXA 4A8WA 1RHUB 1FWPA 5BJRA 1C0UB 2HAFA 5KFSA 4P72A 1SV5A 3IG1B 4OX9F 1VQ5S 2M4MA 3M05A 5HP1A 2LQ9A 4M5DA 4RNNA 4WFZA 2E1PA 3LGMA 1U25A 4PG8A 4B3RF 2V63A 3NAIA 3OPKA 3TNVA 4B9LA 2CWKA 4D3GA 3LP0A 2RNEA 2NR0A 1DY3A 1RT5B 1RTIB 3BH7B 2UVVA 3CF5Q 1SKSA 4PYDA 1P9QC 3GJSB 4RW9B 4UW2A 1QUVA 1V3SA 3DLHA 3UDVA 4NASA 1RZMA 2FUG9 4UTGA 4LQ3A 2XMTA 3THTA 3SQOP 2AHOB 3MCOA 3OTBA 1HBNB 1N6QA 5HSPA 2R42A 1B3TA 1LFPA 5KOWA 2XWXA 2K3KA 3MMJA 3NKYA 1WD6A 4QWCA 2BZ2A 4QZVB 4K4WA 2OD4A 4Q7AA 3E01A 2ZE2A 4Q44A 2XGQA 4W98A 2JSXA 8ATCB 4Z7YA 4IRDA 4DR7F 4DR6J 1HMVB 4IR1A 4QYRA 3T1HJ 5KFIA 2N4DA 5J1EA 2E9TA 2PO4A 2QN6B 3X3UA 2HFZA 1J27A 3K5PA 1R8HA 4TVAB 5DDRC 2HLTA 1H7WA 2YKMA 4ZIVA 1IM6A 2GGPB 4KTQA 3DLGB 4S0MA 5EWGA 3BR8A 3KNAA 4J9OA 3CJSA 2XEXA 4LF9J 3E3XA 3M9MB 1SUQB 2V0NA 2KDOA 2O3DA 4BWJA 1IBKJ 1BMQB 3BB5A 3FBCA 3IN5A 3H40A 1WI6A 1TKTA 3N6MA 2OTJS 3HFVA 2BJ7A 1U7LA 2GQ2A 1SJFA 3IRXB 1EZZB 3M8QB 3O5TB 3KK2A 4MYUA 2MZTA 3BYPA 2AGQA 4GC7A 1HPZA 3CJ3A 3DOKB 2LECA 3MAHA 3QRQA 4ZLPA 3H25A 2UXDF 2IM0A 3VAJA 2HHUA 3MCSA 1CJTB 4ZPDA 2HQFA 1GK8A 2GJ2A 2XB2D 5F8MA 2HS4A 4K2XA 3R3TA 2VJVA 5HMZA 2HNYA 1S6PA 4KGMA 3P4UB 3RAQA 3WC0A 2UUTA 1U1OA 1UVLA 2B4VA 1RWMB 4B9TA 2BRKA 2YWKA 3IA0A 4C48A 1OPIA 5ETNA 1UPPA 4IFVB 1TK0A 2QFIA 1ZZNA 2W9BA 3ZZUA 2HAIA 2HNZB 1TKXA 1FFGB 2DGXA 2B7BB 4OX7A 4P73A 2DGUA 3FK4A 2R7RA 2L9NA 4J9UE 2IDEA 2WVCA 4EMDA 1E6YB 2V8DA 5J2QB 2C2KB 2OEJA 3BO3A 2AYBA 2RHQB 3GFXA 1Y3KA 2MGZA 5HMWA 4OYZA 1M1GA 3KK3B 4JOUA 4X62J 1J2VA 1DZ5A 1VC0A 3R7BB 2VASA 3K59A 1RAIB 2ASDA 5G0RB 1NJYA 4WTYA 4KHMA 1HA1A 3T6JA 2DNZA 3PJ9A 4FYDA 1OIAA 3DRXA 4LBHA 4WZMA 3RBXA 3CE8A 3A12A 3WDOA 2PE8A 4CH0S 2QRRA 4HL9A 1HBMA 3UE2A 5U47A 4CZCA 5EX3A 2UXCJ 5I3PA 5DETA 4PZVA 4QPTA 3O2IA 2FJBB 1WOOA 4OZNA 1C4AA 4CLUA 3B78A 1O5JA 3MI7X 4NI2A 1I51B 2XZDB 4OMFG 3EXYA 3FDSA 4NRTA 1HQ2A 2KT3A 3M2UB 2XSFA 2MQQA 1FJCA 3C16A 1WC1A 3K8VA 1SCJB 1BQNB 4A47A 1I94J 4Q0BA 3DRPB 3NS6A 4KPCA 4DN9A 2VA3A 3CCSS 4WYWA 2DPJA 2V69A 1DHMA 4AFFA 2LU2A 4TQRA 4DR1F 5EWFA 1T94A 1HBOA 2B5JB 2OEKA 2WRMA 2IAJB 4OHVA 2BXJA 2RUGA 2HGLA 2KXHA 1HNIB 5KFEA 3D1HA 5B0FA 2D69A 2KXFA 1RHJB 5ETLA 1UJ4A 2J7UA 2QT7A 1U24A 3HHKA 1ZBTA 1RJJA 4PEOA 5KFGA 2RQ4A 1OQ6A 3FSIA 2BE7D 2W24A 3P6YC 1DJ0A 5CAAA 3BKTA 2R7OA 2ALZA 2D3UA 4QU6A 1O6XA 5LL6d 4NLGA 1X8DA 3CCMS 4F36A 5GADI 9ATCB 2D9OA 2WBRA 2CQIA 1P6TA 5LMNJ 3CSKA 4X4UA 3N4WA 2WAQD 2HURA 3KDOA 1JLFB 3PM9A 2VUGA 3A8JA 4OFZA 1OMSA 3R5DA 4NLPA 2AWZA 4DV7F 2B7CB 3R2DJ 3HHNB 2H5EA 2JX2A 3JQKA 4Y65A 2PIIA 3H4DA 3AAWB 1ZM3A 1U47A 4ED8A 5L8RC 4RR5A 4ILLA 2OKQA 3RB6A 3M2VA 2GVZA 2N3OA 1FKPB 3CEDA 3BSOA 2HLUA 2CZVC 1X4GA 3PR4A 4ZCIA 1D1UA 2EBEA 4FF1A 1LXJA 3MURP 1CLFA 2XCAA 2DNLA 3MEDA 2BE2B 3H90A 2KYXA 1U1LA 2NCKL 4LSLB 4CDIA 3P49B 1P27B 4JI6F 3OVSA 3Q0AA 1RWPB 3TJ9A 4I67A 3UDCA 2FC8A 2R7TA 3W63A 4YP3A 3KKFA 3CDUA 4K2JA 4PQAA 5LSLA 3D68A 3DU5A 4FBTA 2IDLA 4RBTA 3PRVA 4IFYB 2OPQB 5A8WB 3W9IA 4WK1A 4OJHA 3RGIA 5B7WA 2HHHF 2F4VF 1Q7YT 5D15A 5B09A 1SKUB 3PIOQ 2DB1A 4OYIA 2VQFF 4RWXA 3K57A 4DLEA 3BBFA 5DLFA 5AT1B 3OVAA 4B3MJ 1DTTB 2WSCC 3FKBA 3CJKA 1MG7A 4CTAB 4HT7A 1DLOB 3PKMA 3ZC4A 2CPEA 3SCLE 3DOMA 1X4DA 4ED2A 4P74A 2I2YA 1RDRA 4LVNP 4CH1A 2QEXS 4LSNB 4ICLA 1K1QA 1FJ7A 1S57A 3OFGA 4FXVA 2BW2A 1G4CA 3MUVP 2F9DA 3HCXA 3PYEA 4U96A 3KLEB 4DQQA 3PW0A 3VALA 1T11A 1Q82T 2AQ4A 5IS2A 3DLEB 3A3NB 3D67A 5E5NA 1VQLS 3B54A 1RAEB 1HNVA 1S6OA 4OI2A 5CD4H 3TW0A 5K14A 3KK1B 1TV6B 3RBEA 4K4UA 2DR8A 1U6ZA 2GV1A 3SSRA 1M1HA 4GVBB 3OJUA 1NHKL 3OBIA 4OYBA 1EQ0A 1UJ5A 3GV7B 1KNZA 1EARA 4B3SJ 3MXHP 4OLOA 3RB0A 1DQ9A 3HVWA 5L38A 2YX4A 3KJFB 3OR1B 3HM9A 4F02A 1WEZA 2Q79A 5D3GB 3BDEA 1HD1A 2R8IA 5KFOA 2VFVA 2UVRA 4X4TA 4OV1A 3LALA 3EGVA 2E29A 4I2QA 4M8LA 4HH0A 1VS3A 1X60A 2V4JA 1OYDA 1LWEB 6FDRA 2E9RX 4N56A 1Y10A 4YHHJ 5DM7Q 4L72B 2XI3A 3MF5A 2DXEA 1GFWB 4ZPWR 2N4CA 5HROB 5GMDA 4CYUA 1PYOB 2XO6A 4UOCA 5IC4B 3K58A 2NSCA 2B9XA 4I68A 5CYQA 3ZZYA 2OEMA 3O44A 2NQPA 3KLHA 2ZHOA 2XMAA 4PQUA 2HK2A 3M30A 2NZCA 1EIYB 1CQNA 4C11A 4EK2A 2GNKA 4EYHB 4QIGA 4DV1F 2B4PA 1IBLF 2RAQA 2QLFB 2RSQA 1UZDA 1EAYC 4F25A 3GTYX 5ETSA 4QIVA 1S1WA 5KFTA 2MQOA 1WWHA 5A8RA 1AUSL 3FSXA 4ZVSB 4K5RA 1WORA 2DK2A 1K0VA 3LP2A 3AXMA 1CS4A 5GAEU 2C3PA 1ITPA 1IKXA 3FVYA 3KG1A 4DWIA 2CQ3A 1T05A 1SKRA 2MKJA 4YB1P 4AL7A 4MFBB 1TZ0A 3WC2A 3Q89A 5FLXU 5JVGQ 3MMAB 3HVRA 3PFEA 3CCJS 3NL0A 1HHSA 1B99A 2HMIB 1FA0A 2HFNA 7FDRA 5IQQA 4XDCA 2W4DA 5HVGA 1FDDA 2DO4A 4ECYA 1AROP 2YNFA 4H4OA 3MEEA 2NZ4A 1T03B 4WFYA 1EX8A 3VAKA 3T19A 2HHPA 1N5YA 1VQKS 1NK0A 2J7WA 1N0UA 1OPZA 2ASYA 1JIHA 3PV8A 3NMRA 1N33J 1QSSA 4G6VB 4OLPA 5D0EA 4DV5J 2HQDA 3AA8A 5IM0B 1JB0C 3CMAS 4F4WA 4BS2A 1ZPWX 3UVJA 4PWWA 1D8ZA 2CG4A 1RHQB 4LF4F 4J9LA 5D8HB 2VHGA 4OZ0A 4IO9Q 1RCXB 1S7HA 5FLXY 4IKAA 1N34J 3NCPA 1NEEA 1NJWA 3VQSA 2YY3A 1QLNA 1YRXA 4B9VA 1F9FA 1C0UA 1Y9OA 3EM1A 3OT9A 1FDAA 4WP8A 1HNZJ 1IKYB 1HI8A 4CO2A 3IG1A 2WW4A 5EX0A 1IKWB 4USMA 4ZVGA 3OW2R 1KVKA 3C15B 1S5ZA 2DRDA 3OTCA 4USVA 3A8KA 3MMBA 4IDKB 3M8WA 3KWMA 3T5KA 4DX5A 2MDAA 4ECQA 4JV2A 3RJMB 4UOFA 4N8OA 3J81j 1NK9A 3WZ0A 4ZHRB 1M5SA 1UVJA 1S7IA 3I5AA 3D6FB 1U48A 3RBDA 4LMZA 5T14A 1CC8A 1HBNA 5ETKA 2GQQA 4NEYA 3TQEA 1HI0P 5AXNA 2D3OR 1BHNA 3BM7A 5KFDA 2VC0A 4FKXA 4DL7A 4C2MA 2XMKA 3W5XA 4JI5F 3RW6A 2R7SA 2AYMA 1FWLA 3FZ2A 3T9ZA 4A8XA 1XMQF 1NSKL 1QUPA 4HT5A 3TX0A 1JLCB 1L3VA 3PJWA 2H5IB 2AEMA 5DQGA 2GGPA 3DN9A 3SCIE 1N5TA 5KT7A 2W2PP 2CQCA 5C42A 2ZVSA 1ZA2B 3M1VA 3HDSA 1ZA1B 1QE1A 1Q4RA 3POTA 1X31C 3ILIA 3P8BB 3TUPA 3CC4S 2W2MP 2HVEA 4NZ6A 3D7SB 2NPIA 5J2PA 1BQXA 1B0PA 2K8GA 3AHPA 2XNRA 2CYYA 1H2TZ 2YPZA 4JI2F 2Y9HA 3M8QA 2MHNA 1T9YA 4ZCMA 1XJWB 1N36J 4F4ZA 3T1YF 1N54B 4QWEA 5IT4A 3HSDA 3CD0A 1MMLA 4UQGA 1J5OB 2XBPA 2QIFA 2YPYA 1OQ3A 2BW7A 2DITA 1CJVB 4RW4B 1KQKA 3MM9B 1WEXA 2NXEA 2YNHB 1VYAA 2IRXA 5JUMA 4ZVRB 3QLHA 4U8VA 2DHSA 4LQ9A 4ENOA 5H1SV 2MZQA 4EZ9A 3PZPA 2BBEA 2MKIA 1JJ2R 2DXFA 3LAMA 1VRUB 1NHUA 4X66J 2PDAA 1UCNA 4FYVB 4I1TA 2AMCB 5KFJA 1P9YA 3JS9A 4IFVA 3GONA 5HQMA 4MJKA 4F0KA 4JI4F 4K50A 2UXBJ 1NPPA 1EP4B 1HR0J 1UKUA 2CNLB 3R2CJ 4RNMA 1EKRA 2DO0A 2BV3A 4D3HA 3NBPB 3G8SA 2ROPA 3M8SA 1RWKB 1E6YA 5EN1A 2J6UA 1UPMB 3QATA 4AE5A 1PILA 4KGZB 1VBZA 3KJVA 1FRJA 4LFCJ 4DS4A 2NXJA 3FQKA 3KK3A 5F0WA 1D9DA 3GYXB 4A8FA 1KS2A 1WJ9A 1VIOA 1FKOA 5G0RA 3GIIA 2CUYA 3CJQA 4MAKA 2I9SA 2NYHA 3PHEA 3ITHB 3GFYA 5CYMB 3H5UA 1QAJA 2EK6A 2R7UA 2FJAB 1RU2A 1IVZA 4RUAA 1ZM2A 1S1VB 4WFNQ 3JSMB 4DHVA 1RWVB 2W1BA 3FCVA 3SV3A 3G82B 4ES1A 3ETMA 3GB0A 3GV5B 4DL4A 2IFXA 1YBTA 4OI4A 1IQZA 2O01C 4KGXB 2XCPA 3L9ZA 2SXLA 2VG6B 3SFGA 3J7YU 4DSKA 1X5SA 4EBDA 1SQFA 4RO0A 3PACA 2KN4A 1Y11A 1OSCA 3S8SA 3KLGB 1SJRA 2LFVA 1HI1A 4JI3F 1EHWA 3GFZA 5F8JA 4E8UA 3A8IA 2IAJA 3QAUA 1D0EA 2HGNA 5H9FK 1RTHB 1WKJA 4JB8B 1Q0NA 1G1XA 1N88A 1OY8A 4NPOA 4DCPB 2WB4A 2VG5B 2V2ZA 1FNXH 5KT5A 3HHLD 3DRYA 3H59A 4DL2A 3PXGa 1GXTA 5GAGI 3DDKA 2NS1B 1IR0A 1TAUA 5AE3A 1AYEA 1PJ6A 1JLBA 2LU1A 3KXDA 3HSGA 2P9CA 4DL5A 3ZFVA 3ZNUA 4O3SA 3J7A1 2FZKB 2RKIA 1HNWJ 1NU4A 1KTVA 1S9GB 4PWDA 5IV3A 3Q2TC 1F1BB 1JJHA 3THPA 1RWUA 3HD1A 2EFNA 2ZWOA 2GHPA 4ZN1A 3M8PA 4ZOSA 1DQAA 2ATCB 5E7OB 2B9YA 3PX4A 3MECB 4M5NA 1QAXA 4FNIA 1F3FA 3HULA 1Q16B 3KNGA 3OL7A 2DGTA 3O3LA 3IMQJ 1B7YB 2JC0A 2OFHX 3BV8A 1KDNA 3S7RA 1YBAA 5BYQA 3ILLA 3CVKA 3THVA 2BE2A 1OY6A 5EHHA 5KFQA 4DV0J 4GO5X 2HWHA 1HD0A 5BYSA 1NMEB 1DAXA 4LF8J 1RHKB 2IJNA 2KVQE 3R7SB 3SMZA 1S49A 4KBIA 4DQIA 4WXOA 4DBQA 1D3WA 1AFJA 1UAWA 3L3CA 1FRIA 2QL7B 4UQTA 3K0JA 2OPQA 1S6QA 1KR4A 2WOMA 4DR5J 2E5JA 3C6TB 3NAHA 1VQ6S 5E3CA 1BLUA 1XNQF 5DDOC 1KLMA 2ROEA 2NXNA 3NNCA 1DTTA 2XTJP 2WZ1A 2A0FB 4DX7A 2FQQB 4J9SA 2V67A 4CTAA 3TWZA 5KT3A 1DLOA 2AX1A 3MR7A 5BXIA 2QL9B 4AQYF 4C8KA 3NGRA 4ED6A 2FHMA 3A13A 2LVWA 3T1HF 2Y1IA 1VQOS 4ANCA 2ZC4A 4E2FB 2Y0BB 1Y5LB 1UWAA 1NK6A 3CCLS 4N7TA 3R7NB 2Q66A 1VQ4S 1RTJA 5M2RA 3BSAA 3NY0A 3C8YA 3KK1A 4UOGA 3K2YA 1TV6A 4ECXA 3JYTB 3G8QA 2QC3A 3CJ8A 3I56S 4LF9F 3TJ8A 5KFLA 1CC7A 2YKNB 2P2CB 4RUBA 2WVBA 1O8BA 2QV6A 5E3PA 4RBUA 5LOQA 3MM7B 5LMUJ 3UCUP 5M2PA 1LWFB 2RH3A 2F65A 3PVXA 5KFMA 1BC6A 1OS5A 3HF5A 5D4PA 3KLFB 3Q24A 2MMYA 2EFOA 2L08A 3OR1A 2IMOA 5D3GA 4DR2F 2A6OA 1EETB 2IVMA 1SQGA 4FS2A 3EZUA 5KT4A 1C1BA 4DSLA 3MM8B 1RB0A 1RSCA 3M6XA 1VQMS 4CLKA 2H5JB 3V5RA 4KO0A 1IWAA 4TKTA 5SZTA 5K8OA 3CCRS 1HHTP 4EBCA 3N79A 4DUTA 3BGLA 3VQTA 4ZVEA 4BC7A 5F8GA 1HQUB 1IKVA 5HMYA 4YDDB 3Q8PB 5K5MA 2XGPA 1HBUB 2W2NP 1RLCL 4WP9A 3FBFA 2G0JA 1R8BA 2BANA 2KT5A 4IO1A 1X4BA 2GJFA 1U6BA 2JL9A 4G1QB 4FF4A 2HRYA 4J9MA 1PIEA 1TKZA 2XS2A 5E3RA 1NLKL 2YKQA 3C14B 3U1MA 2H9ZA 3FBBA 4OI1A 5A0YB 2BQ3A 3M7VA 1FVQA 2ZZTA 1XQIA 4DSIA 2XZTB 3O1LA 2JRSA 2W7AA 2LQBA 1TMJA 2B4UA 2B6AB 4CO3A 3VTIA 4LBIA 5L1KA 1UTAA 3W2WA 3PW2A 1SV5B 5L1LA 2A18A 2F3JA 1X4EA 3A3PB 3Q8RB 5HP1B 4R5PB 1NH8A 4MK8A 3CCTA 2ZD1A 2HMIA 2COLA 1N5QA 1JMTA 4NA1A 5HMXA 4O4RA 4MH8A 2XY6A 3MMCA 4KB7A 3WIVA 2Z2YB 2V8HA 3PRBA 3ZZOA 3EGNA 4QYZK 5AJ3F 4XPCA 1R89A 4DV4F 1RQ0A 3I87A 4JI7J 1TKDA 4DUZJ 2W2QP 2UUAF 1H6KX 2IJRA 3D6TB 3LTOA 2OPRB 1V5IB 1N6QB 1KVJA 1GMUA 1G2EA 1S79A 4NMLA 3JQJA 5E3AA 3E01B 2ZE2B 1SQEA 2C2OB 2VB6A 1SC1B 2J9EA 3W7BA 2J8SA 2IC3A 2YBVA 3PYFA 2CPFA 2M5YA 3BBBA 1LOUA 2O5DA 4C6AA 2R7QA 1CJKA 1RAAB 4CI0B 1SL1A 3D5MA 1R6YA 1NRKA 5LXYA 2YKMB 2ZHBA 4F8RA 4A8KA 1QVFR 4YB7A 5KG2A 3OTEA 2AEFA 4G3IA 4CWBA 3MOJB 4YQWA 4WXWA 5GAHI 2A10A 1R8CA 1WHWA 3RB3A 1TKTB 2E9ZA 1QAIA 3EYZA 3RYLA 5D0RA 4USJC 3QSIA 2Z30B 1YHQS 4OX8A 4R25A 1BQMA 3KK2B 4DPYA 3FUYA 1S99A 2BRLA 4M94A 1VHFA 1HPZB 3UNGC 3BN7A 3DRSA 1S1XB 2G1HA 4DU7A 3OXFA 2DGOA 4M63A 1AT1B 2HBYB 3TOQA 3HHEA 1SL2A 2DY1A 4JI8J 1KRPA 3DLJA 4P2XA 5CABA 3JXOA 1N0VC 3JSBA 1UETA 4DSFA 1S6PB 3IRWP 2KFYA 1FKAF 2H48B 3BQ1A 2DKOB 3RRHA 4FXDA 4K4VA 1FERA 2ZVIA 2CNOB 3B6BA 3CO0P 2FLNA 1P1TA 3R5BA 1T7PA 1YITS 3DCAA 5B0BA 2HYIB 4WU2A 4GO7X 2W9BB 4JI0J 1OSDA 1TKXB 3NS7B 3MAQA 4ECWA 4Q2MA 2QLWA 5KFAA 2IA0A 3DM2A 3AFGA 2X7IA 1W2BR 2WBMA 4CQ1A 4PXBA 5SUHA 1KWMA 2MGZB 2F63A 3G87A 2XY7A 3MOZA 2BABA 3CDWA 3QMQA 4B17A 2CPIA 1N52B 2KXNB 2PN6A 3FNNA 1VDHA 3J7Z5 2VQEF 1T0TV 1TP7A 4NCBA 2YNHA 1VK8A 3VGVA 4QR1A 2XNQA 2K1RB 2E44A 3PY8A 4EO8A 1K47A 1DFDA 1QJHA 5CQGA 3M32B 3B4DA 4NI2B 3KYLA 4FKYA 2DGWA 1VRUA 4FDFA 5BYRA 2YTCA 1S6UA 2D74B 3C16B 1REVA 2XULA 2FZGB 5MLCV 1RT2A 1S97A 4RW7A 1KN6A 5CHCB 1EP4A 3BF4A 3W65A 3IR7B 4Q0BB 1IXKA 2VKZG 2HS0A 2KJVA 3M6UA 2UUBJ 1LW0A 2VFRA 3NBPA 4F4YA 4HI2A 1KOHA 3TVZA 3KHGA 1L3SA 2OPPA 1C2PA 5LJ5Y 1LNQA 2DNMA 4MT1A 2JLGA 4U67Q 3SI8A 3RBZA 2LXIA 1IN0A 4ZCLA 1HNXF 3EZOA 4DV6F 1RWWB 1L3KA 2E5LF 2DNNA 3W3SA 2OUGA 3MR2A 5CYMA 1WF0A 1U4BA 2IHR1 2EK1A 2RS2A 4Q5VA 1FESA 1CJUA 1DBDA 3GR1A 1Q78A 7AT1B 1S1VA 5G4DA 3PR5B 5KG5A 3G82A 2KVIA 1VBXA 5JXSA 4AUKA 2G4BA 5F0UA 1HWIA 2LQ5A 2PGCA 3DOLB 5JMNA 4QQBA 5AXKA 9RUBA 2DR7A 1UWBA 1FJGF 2L3MA 4YR3A 4NYZA 1FI4A 5K8NA 2VFSA 3GU0A 1VQ8S 4WE1A 5LXRA 3P5TL 3RW7A 3HT0A 1GMVA 2LEBA 1GTHA 3V6DB 2R2TA 2RDDA 3I6PA 2IRUA 5I42A 1WHYA 1YZ6A 3M2VB 2GVZB 1Q7LB 3F41A 1QAYA 4LFBF 2XS5A 3N9UC 1VJQA 3GG0A 3TRGA 2OSQA 3R1HA 2A6MA 4OYMA 1SXLA 3LWLA 4EBEA 2ZM6J 3IGVA 1RA6A 2JOQA 1REGX 4LF7J 4IH7A 4KHRA 5A6WA 3R5GA 1TQLA 1K1SA 2JJ4D 2W4PA 1XERA 4OQJA 1SBRA 2IY5B 1FDBA 1TMMA 2HFUA 3AQOA 2V8GA 3QGIA 3OFHA 3LUYA 2R2RA 1RKJA 3CDEA 4KFBA 2HIYA 3D1QA 1TL3A 3MD3A 3W1YC 3VWSA 4JYAF 1FFSB 1S9GA 1W26A 4OX9J 1TL1A 2M8DB 1LK7A 2OGUA 3IWLA 1N33F 2VOPA 2QG9B 2MZ1A 3CO9A 4OI3A 4ELUA 4B3RJ 3QPIA 2A1BA 1S4FA 1ZM4A 3R5JB 3UW1A 2OELA 4DUYJ 3GPAA 5HI7A 3MECA 4K4TA 1WKKA 3QBCA 1ZOTA 1SPBP 3F44A 2F8EX 1JJCB
chains in the Genus database with same CATH topology
1MN9A 3ENAA 4CP5A 3EVMA 4ENOA 3WX8A 1NDPA 3BBBA 4DUTA 4C6AA 1S5ZA 3VGSA 2HURA 4DZ6A 3EVOA 3FBCA 3PRVA 4WBFA 2AZ1A 5IOLA 1LEOA 4EK2A 1PAEX 3ZTSA 3FCVA 2DXFA 2DXDA 1NHKL 2DY9A 1NDLA 5CABA 1UCNA 3G2XA 3VGVA 1W7WA 3NGUA 4KPCA 1BUXA 3FCWA 3DDIA 4UOGA 1HIYA 3JS9A 4UOFA 1JXVA 4UOHA 1F6TA 3Q8VA 3ZTQA 3VGTA 3ETMA 3Q8UA 3BBFA 3FBFA 1BE4A 1NSQA 3ZTPA 2HVEA 4ANEA 3MPDA 3FKBA 3EE3A 3B6BA 1LWXA 4DI6A 4FKYA 1NPKA 1U8WA 2B8PA 3FBEA 2AZ3A 4W98A 1PKUA 3ZTOA 3BH6B 3Q86A 3Q8YA 1K44A 1NLKL 1BHNA 4ANDA 4O0NA 3Q83A 2VU5A 3NGSA 3VVTA 2B8QA 1ZS6A 3DKDA 1HHQA 3PJ9A 3FBBA 4FKXA 3FC9A 1NSPA 1NB2A 1MN7A 2BEFA 2DYAA 1S57A 1F3FA 1HLWA 1WKLA 1B4SA 3EMTA 1EHWA 3GP9A 2HVDA 1XQIA 2NCKL 1NDKA 3BBCA 5BXIA 3R9LA 2DXEA 1NDCA 3EICA 1NCLA 1NUEA 3VGUA 2CWKA 3NGRA 3EM1A 1S59A 1WKJA 2BX6A 3GPAA 3B54A 3EVWA 3ZTRA 1KDNA 1NSKL 3Q89A 3VVUA 4F4AA 3L7UA 5CAAA 3BH7B 4S0MA 4ANCA 2ZUAA 3NGTA 1WKKA 1VYAA 1XIQA 4HR2A 3ELHA 4F36A 1B99A 3EJMA 5C7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MN9 A;  3ENA A;  4CP5 A;  3EVM A;  4ENO A;  3WX8 A;  1NDP A;  3BBB A;  4DUT A;  4C6A A;  1S5Z A;  3VGS A;  2HUR A;  4DZ6 A;  3EVO A;  3FBC A;  3PRV A;  4WBF A;  2AZ1 A;  5IOL A;  1LEO A;  4EK2 A;  1PAE X;  3ZTS A;  3FCV A;  2DXF A;  2DXD A;  1NHK L;  2DY9 A;  1NDL A;  5CAB A;  1UCN A;  3G2X A;  3VGV A;  1W7W A;  3NGU A;  4KPC A;  1BUX A;  3FCW A;  3DDI A;  4UOG A;  1HIY A;  3JS9 A;  4UOF A;  1JXV A;  4UOH A;  1F6T A;  3Q8V A;  3ZTQ A;  3VGT A;  3ETM A;  3Q8U A;  3BBF A;  3FBF A;  1BE4 A;  1NSQ A;  3ZTP A;  2HVE A;  4ANE A;  3MPD A;  3FKB A;  3EE3 A;  3B6B A;  1LWX A;  4DI6 A;  4FKY A;  1NPK A;  1U8W A;  2B8P A;  3FBE A;  2AZ3 A;  4W98 A;  1PKU A;  3ZTO A;  3BH6 B;  3Q86 A;  3Q8Y A;  1K44 A;  1NLK L;  1BHN A;  4AND A;  4O0N A;  3Q83 A;  2VU5 A;  3NGS A;  3VVT A;  2B8Q A;  1ZS6 A;  3DKD A;  1HHQ A;  3PJ9 A;  3FBB A;  4FKX A;  3FC9 A;  1NSP A;  1NB2 A;  1MN7 A;  2BEF A;  2DYA A;  1S57 A;  1F3F A;  1HLW A;  1WKL A;  1B4S A;  3EMT A;  1EHW A;  3GP9 A;  2HVD A;  1XQI A;  2NCK L;  1NDK A;  3BBC A;  5BXI A;  3R9L A;  2DXE A;  1NDC A;  3EIC A;  1NCL A;  1NUE A;  3VGU A;  2CWK A;  3NGR A;  3EM1 A;  1S59 A;  1WKJ A;  2BX6 A;  3GPA A;  3B54 A;  3EVW A;  3ZTR A;  1KDN A;  1NSK L;  3Q89 A;  3VVU A;  4F4A A;  3L7U A;  5CAA A;  3BH7 B;  4S0M A;  4ANC A;  2ZUA A;  3NGT A;  1WKK A;  1VYA A;  1XIQ A;  4HR2 A;  3ELH A;  4F36 A;  1B99 A;  3EJM A;  5C7P A; 
#chains in the Genus database with same CATH topology
 2J5A A;  4FZV A;  2CA9 A;  2Y0S D;  4RW6 A;  2QA2 A;  3AJ1 A;  2FB0 A;  3J80 U;  3AOA A;  3DRR A;  4HLB A;  4B3T F;  5FII A;  3WQP A;  2O67 A;  4AT1 B;  4USU A;  4ZVO B;  3D6M B;  2QSF A;  2J9D E;  2C28 A;  1JXV A;  1RAH B;  3PO5 A;  1VC5 A;  2JVR A;  1HWU A;  1S1T A;  1VCT A;  1HNV B;  2ZJR Q;  5K14 B;  5HAO A;  1VQN S;  2KHD A;  5L1I A;  3GCW P;  2AJQ A;  4IUF A;  4ETZ A;  1K44 A;  4C97 A;  2WON A;  2VU5 A;  4EO6 A;  1U49 A;  4FBU A;  4XDD A;  4KC5 A;  3V2U C;  1LK5 A;  4ZVQ B;  2EFQ A;  2VL1 A;  3C6T A;  5BR8 F;  1MWQ A;  2HWI A;  1KVI A;  1H98 A;  5IV4 A;  3J80 Y;  4A8S A;  2D7S A;  3K5O A;  4ZP7 A;  1MN9 A;  5F8L A;  3TA2 A;  4NLR A;  1OY9 A;  4PRF A;  2ROG A;  2PA8 D;  1RT4 B;  5J1N A;  4O4G B;  1S76 D;  4LRA A;  1D9A A;  2QA4 S;  2PI5 A;  2V4J B;  2MLX A;  4KGV B;  1XC9 A;  1TUV A;  4RL1 A;  3HZE A;  2LDI A;  1WHV A;  1TL7 A;  2WB1 D;  1U1R A;  1M0S A;  4I69 A;  5CYQ B;  5KFR A;  2UXD J;  4DQS A;  3MD1 A;  4PQU B;  3M30 B;  5H9F J;  4BBY A;  1WOS A;  2A2C A;  2XHW A;  2XMM A;  3H8Y A;  4F04 B;  2QE5 A;  4P10 A;  3CCZ A;  4L76 A;  4K59 A;  4WK3 A;  2OPS A;  3GMG A;  3GJT B;  4ZJO A;  3UD4 P;  3EXC X;  5HLF B;  2MY7 A;  4PPD A;  1GMW D;  3DXB A;  1APS A;  2MSS A;  5A8R B;  3CCQ S;  1NB7 A;  5D77 A;  3NCQ A;  2GJI A;  3LP2 B;  3I32 A;  2IRY A;  4UT4 A;  1Y0H A;  2G9O A;  4YY3 F;  4F0H A;  5IWA J;  4L73 A;  3N5F A;  1FO1 A;  3W60 A;  1TEL A;  3AXK A;  1T05 B;  3LO3 A;  4NZ7 A;  3TVK A;  1L3T A;  2DBB A;  1V6H A;  5F9N A;  3JSY A;  2UP1 A;  4QBU A;  2IA6 A;  4WU3 A;  4DX8 H;  4HH1 A;  3TAP A;  3SZ2 A;  2M88 A;  4O0I A;  5KFY A;  4QR2 A;  3U02 A;  1R0C B;  4CLW A;  1R0A A;  3MR6 A;  3KLI A;  1JLE A;  3R6G B;  3AD7 C;  3IP0 A;  3NLC A;  2DNK A;  2YNF B;  4FYY B;  4DV3 F;  3T5L A;  3MEE B;  3S01 A;  4K8R A;  3DI6 A;  5ITH A;  1N5Y B;  3ILO A;  2G2Y A;  4QIF A;  4EU0 A;  2EXU A;  2NLW A;  2KFN A;  2PT0 A;  3CD5 A;  3Q8Q B;  2KL8 A;  1YRT A;  4ECS A;  4IRC A;  2HFO A;  2YH0 A;  4Q43 A;  2QMU B;  4K4S A;  3ET6 B;  4NXN F;  2QFJ A;  3Q2S C;  5DO2 A;  3I96 A;  2G0C A;  5ETR A;  4PG5 A;  1IBM F;  4G1P A;  4I7F B;  2EG1 A;  2B6A A;  2VBW A;  3FGV A;  2HK3 A;  3BGO P;  1PBU A;  2QGF B;  2W9A A;  4DR1 J;  3L4B C;  2ZOG A;  2ACM A;  1AB8 A;  2C2E A;  4NWB A;  4R5P A;  5ETQ A;  5GAE I;  1QVG R;  3ZZT A;  3GLJ A;  3MMB B;  1G6B A;  1RKI A;  2FD2 A;  3FRY A;  1G7C B;  5D0H A;  2DYA A;  5KFF A;  1ZAX A;  4J9Q A;  2B43 A;  5F41 A;  1E6V B;  1D09 B;  4P2S A;  2V4Q A;  2RML A;  1SIW B;  2E1R A;  3NEK A;  2LA4 A;  3DDN A;  5RUB A;  4OZ3 A;  3DFE A;  3OSP A;  2F9J A;  2YKA A;  2OPR A;  4NA3 A;  3QT8 A;  2OJ3 A;  2K7J A;  3VAH A;  3WX8 A;  1ZM9 A;  4A8Y A;  4L75 A;  2R7W A;  4CO5 A;  4I6A A;  5C2C A;  1OWX A;  1GAO A;  4DV7 J;  4FVC A;  3TX8 A;  1MLA A;  4TY8 A;  4N77 A;  1HIY A;  3UCG A;  2L9W A;  3V6K A;  3W5Z A;  2BA9 A;  2GMJ A;  4GKJ F;  4ZJQ A;  1UEU A;  2IVY A;  4HI1 A;  4KY3 A;  4EEY A;  2XSJ A;  2RQK A;  1UZH A;  1YGY A;  3E8O A;  1RAG B;  2EVZ A;  2XY5 A;  5KG7 A;  2DVI A;  4W90 B;  1QTN B;  2VIC A;  3L7P A;  3HZG A;  5K8P A;  2FHJ D;  4LF1 A;  1R3N A;  2BEF A;  4NLS A;  3RU0 A;  2WCX A;  2A3J A;  5C42 B;  2HVD A;  3M1V B;  4JI6 J;  1QE1 B;  3POT B;  4ELV A;  2KZM A;  2AJ1 A;  2HVH A;  4RWW A;  4IQX A;  5KFU A;  4MKB A;  3NGD A;  4AXI A;  5J2P B;  4L3K A;  2C3Y A;  3BQ0 A;  4C8Z A;  2CPJ A;  2NYI A;  2ZEJ A;  2FTR A;  2MB0 B;  2JEI A;  4V19 J;  2CQP A;  2ZNY A;  3G4S S;  4Q45 A;  1Q53 A;  1X9M A;  2HHH J;  2F4V J;  5ETV A;  4QWB A;  2YQ3 A;  1S1X A;  4KQZ A;  3H2U B;  2VQF J;  3HMJ G;  4LRD A;  2Q6B A;  3IR5 B;  3VAI A;  1R31 A;  5DGB A;  4RU2 A;  4LF6 J;  5CH7 B;  2DR5 A;  1HWK A;  2ZBR A;  4ID5 A;  2VKR A;  4DPO A;  2KKH A;  3QLH B;  1CSJ A;  2FVR A;  1SH0 A;  1RWX B;  3JAM U;  2DHA A;  1FEH A;  2DRA A;  3K5M A;  3OR2 A;  2CAD A;  5C25 A;  4P75 A;  1B4S A;  1SJQ A;  3FFI A;  4BC9 A;  2DNP A;  3LH2 S;  3GP9 A;  4DR5 F;  3TZZ A;  1TL5 A;  3OL8 A;  4CCH A;  1WG5 A;  2VDI A;  4OYA A;  2LXF A;  1UFW A;  5KFX A;  4JV1 A;  2DR9 A;  3C6U B;  4PG4 A;  4HHU A;  2PMW A;  2HRU A;  1CBK A;  1Q1K A;  4RKU C;  2EFV A;  3KJV B;  2ZZM A;  1AA1 B;  3G6V A;  3DLK A;  3C2P A;  1F0X A;  2WVE A;  1X4F A;  4USK A;  4LIW A;  4Y34 A;  1FKO B;  4E98 A;  2JH3 A;  1SH2 A;  2R8J A;  1JLA B;  3M9O B;  4LR7 A;  2DTJ A;  1RT3 A;  3JAM Y;  3CXC R;  3LP1 A;  1WC3 A;  3QO9 B;  2W7O A;  4J37 A;  2R2S A;  5DZ6 A;  3Q86 A;  3PHT A;  1SJ1 A;  2K1R A;  3D9B A;  1KOO A;  3Q83 A;  1N32 J;  3M32 A;  3AOB A;  1NB2 A;  3ENQ A;  3F56 A;  1R6V A;  3DYA A;  3GR0 A;  3BS9 A;  1RTD B;  3GV8 B;  1RT7 A;  4CLT A;  2GZO A;  2YWG A;  3DMJ A;  4FF2 A;  4OI6 A;  3D54 A;  3ZZR A;  5DQI A;  1YWX A;  2R8K A;  4WWS A;  1M5H A;  4ZA1 A;  5KFV A;  1UP1 A;  5CYJ A;  3OTO F;  2RRB A;  1RT6 A;  4MIA A;  2ACY A;  4DV1 J;  1JWW A;  5DM6 Q;  1IBL J;  1XK8 A;  5KT2 A;  4OYP A;  1CG2 A;  2YNG A;  2IYI A;  3IAS 9;  2UU9 F;  2CJK A;  3Q8V A;  5H9E K;  3SFU A;  2KTQ A;  5FD1 A;  2H4Y B;  2YX7 A;  2CQB A;  4K0K F;  3AT1 B;  3V4I A;  3TYT A;  2J0W A;  2YNI A;  2VPY B;  5IXU A;  2C3U A;  1K0T A;  3ZZZ A;  3SQG A;  1WOP A;  4ER8 A;  3FMW A;  5AXM A;  2KT2 A;  1MN7 A;  4DFP A;  4O23 A;  4X64 F;  1DQ8 A;  3QIP A;  4NXM F;  1JLB B;  3OL9 A;  3FCH A;  2P6T A;  2HKE A;  2HWT A;  2V9K A;  4WZQ A;  1R43 A;  4OZ1 A;  1NPR A;  3DOL A;  3ENW A;  4YEA A;  3MCM A;  4ECT A;  2RKI B;  2IIH A;  3VAG A;  4PWD B;  1H38 A;  4MTP A;  2J0S D;  3VCD A;  3VVU A;  2CG8 A;  5THW A;  2BOP A;  3PO4 A;  4U8Y A;  4HR2 A;  4KR0 B;  1U2F A;  3QSY B;  4GC6 A;  3M8P B;  2CQ1 A;  2AF6 A;  3T1A A;  1VIS A;  4F26 A;  5D4L A;  2GCF A;  3V6D A;  3I31 A;  5D0G A;  2C1E B;  1SB6 A;  4ZJL A;  4C4W A;  4KRW A;  1I5O B;  3GJR B;  2GIF A;  1NND A;  4ZP8 A;  2OFG X;  2JWN A;  4RJV A;  4TU7 A;  5GAG U;  3ETO A;  3QWU A;  1FDN A;  3J7Y I;  3GZ7 A;  1WG1 A;  3QQC D;  2RVJ A;  1X0P A;  3AB2 B;  4DR4 F;  4LF4 J;  1RAF B;  1BWE A;  1JLQ B;  3M8Z A;  1RT1 A;  4NLX A;  5HQ8 A;  4RBV A;  1WKL A;  2DCU B;  5I3U A;  2MXY A;  3OJS A;  1UW9 A;  1FNM A;  3PEJ A;  3OFF A;  2X3G A;  4BWM A;  3EVW A;  2Y3Y A;  1S6Q B;  3MPV A;  2WOM B;  2ZUA A;  4YOE A;  4JI7 F;  4F4X A;  2DNY A;  1YSJ A;  4ZVU B;  3M6V A;  2JLE A;  1V5V A;  2ZH4 A;  4F7V A;  1KLM B;  4F3O A;  3QJP A;  3CUL A;  4ED5 A;  3O8W A;  4O3Q A;  1HKA A;  1NDL A;  2AJ0 A;  3G96 A;  4FS1 A;  4DV2 F;  3P96 A;  1X4A A;  5ETO A;  2DGV A;  4P71 A;  3KTQ A;  2N3L A;  1FXR A;  1IUJ A;  2EI5 A;  2D3O 1;  1D9F A;  2YX1 A;  2HRT A;  5K20 B;  1WUU A;  4RNO A;  1RTJ B;  1PCA A;  1GQE A;  3HHL A;  1A0O B;  4Y2M A;  1V3Z A;  2H4W B;  1KC8 T;  5KFK A;  1GXU A;  1U0H B;  1FCA A;  1RCO B;  4JI5 J;  5DLG A;  4GKK F;  1FRM A;  4EI2 A;  1N48 A;  3CCV S;  2Z2Z A;  2CKW A;  1XMQ J;  1J5E J;  1U1M A;  1TR0 A;  3OL6 A;  4OJG A;  1RIS A;  4HEA 9;  4USW A;  2C2Z B;  1P1L A;  5KG4 A;  4Y0F A;  3EGW B;  2DH9 A;  4QU7 A;  2KH9 A;  2QZ8 A;  4ZCK A;  2HND B;  2WSF C;  2BQU A;  1KSP A;  4C98 A;  4CM0 A;  3IR6 B;  3QAE A;  3P3D A;  2HHW A;  1OJ4 A;  1BUX A;  3GCX P;  3B8H A;  3VGT A;  4KE5 A;  1KP6 A;  1C1B B;  2XI2 A;  1RT4 A;  4O4G A;  4QW9 A;  4I56 A;  4C8N A;  1ZAV A;  2AD9 A;  4KO0 B;  2Q6C A;  3OFE A;  4IOC Q;  1ELO A;  3PRD A;  2VON A;  3EPI A;  2BKP A;  4LF5 F;  2VBX A;  4JI2 J;  2B0G A;  2ZBP A;  5K9F A;  3WX4 A;  2ATL A;  4O0N A;  5FDL B;  2FVQ A;  2RDI A;  2B8Q A;  3QWP A;  1HHQ A;  4C8M A;  4KYZ A;  1IKV B;  1NSP A;  3T1Y J;  2L9D A;  3G71 S;  2OD6 A;  1VQY A;  4ZPB A;  2VG7 B;  4WII A;  1I1G A;  3MUM P;  3EX7 B;  1ACM B;  2BAN B;  2KM8 B;  3NGT A;  1RAC B;  4NLW A;  3A1Y G;  2CJB A;  4FXW A;  3I5B A;  3T6B A;  1TKZ B;  3KHH A;  4QIW D;  2V4R A;  1S10 A;  2J0X A;  5HLF A;  3HFK A;  4K5S A;  2VZ9 A;  3SEO A;  3KG0 A;  1WF2 A;  4NLV A;  3UD3 P;  3D4J A;  4Y6I A;  2EBG A;  4ZK7 M;  4JI4 J;  4PXD A;  3MPW A;  3IWN C;  4TN2 A;  2B9E A;  3VAM A;  4CLS A;  1HAR A;  3N0V A;  5J2M A;  4O3O A;  1UVN A;  1VOM A;  3VAF A;  4U95 A;  3QT7 A;  2RB7 A;  1PKU A;  5LJ3 Y;  4OZ5 A;  3NXZ A;  2M70 A;  2GFF A;  5KFP A;  2VA2 A;  3W2W B;  4CNY A;  4HHJ A;  4OYO A;  2UUC F;  1GH8 A;  4PUO A;  3IGN A;  1X5O A;  2YWF A;  1MU2 A;  5KFH A;  2RQC A;  2GAH C;  1RHM B;  2PEH A;  3LQV A;  3LOU A;  2ZD1 B;  3EDQ B;  4PXC A;  4LT6 A;  3CT9 A;  4LSZ B;  4TY9 A;  1NKE A;  3G6E S;  3MMC B;  1RAD B;  2HZA A;  3PX0 A;  1Z1Z A;  1VQP S;  1VQ9 S;  4ZKA A;  4ATN A;  4RZR A;  2UUB F;  3UD5 A;  2KG0 A;  4DJB A;  4AYB D;  2DJW A;  1XTZ A;  4NLO A;  1A7G E;  4F0M A;  4WTO B;  1XMO J;  2XZW A;  1ZZF A;  2M8H A;  4DSJ A;  4NMX A;  1LV5 A;  2H54 B;  3G2X A;  5E41 A;  1IBC B;  1WG4 A;  3W2V A;  3ET6 A;  3L7O A;  4N47 A;  4GVL A;  2ADC A;  2X1A A;  2DIS A;  5B0D A;  3I9Z A;  2IC3 B;  2VD3 A;  4I7F A;  2MPU A;  2AZ3 A;  3WIU A;  2FHK A;  1T9X A;  3BR9 A;  1JXL A;  4LFA F;  3TJA A;  3GIR A;  5E33 A;  2E1M C;  4ED3 A;  3VVT A;  5F3T A;  1AFI A;  2XO7 A;  4ZIW A;  1CJK B;  3PDN A;  1MSW D;  2DNH A;  4XO0 A;  2GW8 A;  3QGP A;  4JI3 J;  1GEH A;  3C19 A;  4X65 F;  5JJB A;  3HK2 A;  4H4M A;  5HQL A;  3W62 A;  1NZ8 A;  2HQG A;  5EUH A;  5KG1 A;  3ZZ0 A;  3VV2 B;  2JFK A;  2YH1 A;  2CVI A;  1O0P A;  7FD1 A;  1E6V A;  2HHV A;  4ZIT A;  2QO3 A;  3Q22 A;  2H1Y A;  2GAG C;  4IG0 B;  4NLD A;  5GME A;  5T41 A;  2RRN A;  1BQM B;  1U2C A;  1LFW A;  1BXN A;  1FHT A;  2LXU A;  1X5P A;  2K06 A;  4QWD A;  2B56 A;  2BJD A;  3DRS B;  3PFO A;  3PKY A;  2MQM A;  2AIR B;  4DR3 J;  2APO A;  3H0P A;  4LF7 F;  1Z2Z A;  3HKW A;  2K3I A;  2CIM A;  3DKD A;  2RUS A;  4XK8 C;  3IBW A;  2KG1 A;  3LW5 C;  2J76 E;  3US5 A;  4WF9 Q;  5IC6 B;  2IBK A;  3BSN A;  1BY9 A;  4YS2 A;  3U1N A;  4LR9 A;  3MAA A;  5GVQ A;  3UDL A;  3CJ5 A;  4OL8 A;  3UDE A;  5HJY A;  5GAH U;  1YJT A;  4CIO A;  4OI0 A;  4PCQ A;  1U6F A;  2N7Y A;  3E51 A;  2IMW P;  1RWN B;  4DS5 A;  4M5K A;  1S72 S;  4JV5 F;  4IYQ A;  4Q8E A;  4DUY F;  2FHO B;  1M5O C;  3O6Q A;  2WHO A;  1DTQ A;  4QWA A;  4ZPT R;  1VJW A;  3DM2 B;  4NZ0 A;  3H4B A;  2DHH A;  2ZH5 A;  1SI9 A;  1OYE A;  2KZZ A;  1X5T A;  3F73 A;  3BPS P;  3CIZ A;  1T95 A;  1EB0 A;  1FXL A;  5LSR A;  3ZTO A;  1KQG B;  4M5G A;  3SDE B;  3EGZ A;  2PSZ A;  4MK7 A;  1XNQ J;  2HQC A;  3L95 X;  1XNR F;  2ZUG A;  5FJ4 A;  4PYA A;  4MKV A;  2LCW A;  4NCG A;  2R7X A;  3BO2 A;  1K8A T;  1C1C A;  2CWX A;  3DNC A;  1IQT A;  3K5L A;  5HAN A;  3JB9 k;  3IBF B;  5ETM A;  2HS3 A;  2FIU A;  2FVS A;  4ECV A;  4AQY J;  1L3U A;  2ZIT A;  4CM2 A;  4V19 X;  3GIL A;  2IBO A;  2RU9 A;  4QIE A;  1VRT A;  1S9E A;  2X1G A;  2C2D A;  3TA0 A;  1W25 A;  3T5H A;  2GHV C;  3ENA A;  2F8M A;  4CLL A;  4DX6 A;  2M0G B;  4HAC B;  1REV B;  4C9D A;  3QT5 A;  1RT2 B;  4RW7 B;  4F3M A;  5IOL A;  1NM2 A;  4B3O B;  4N8N A;  4U9R A;  1K73 T;  1LW0 B;  2HHS A;  4UY8 T;  3TZY A;  1T9W A;  2CZ4 A;  3C6U A;  4K4Z A;  2B9W A;  2PFF B;  2JVO A;  4FF3 A;  2OPP B;  3PYD A;  4MYT A;  1BE4 A;  2UVW A;  3V81 B;  1V9O A;  3T41 A;  5KFC A;  3EE3 A;  2B8P A;  2WTF A;  5F3Z A;  4BHQ A;  3ZNJ 1;  3Q8Y A;  1VR6 A;  1JLA A;  1H2V Z;  2Z57 B;  1GX6 A;  3FMB A;  2H3E B;  2VDH A;  2F4F A;  1T3O A;  4I4B A;  1UFL A;  1TFW A;  2MST A;  3QO9 A;  1NK5 A;  1FF2 A;  2JEG A;  2IM1 A;  1X9S A;  2ZOF A;  4LRC A;  4DR2 J;  2V9W A;  1UVI A;  1CJU B;  2LQ8 A;  2BX6 A;  1NZA A;  2W25 A;  2VFT A;  4PWU A;  1S9F A;  1RBA A;  4ECZ A;  1RTD A;  2BJ3 A;  4KV8 A;  1HW9 A;  1S4E A;  3FZB A;  3VZH A;  2BOA A;  1FXD A;  4HKQ A;  1UWB B;  1NKB A;  5L39 A;  4R8U A;  2DY9 A;  2VFU A;  2WK4 A;  4ETX A;  3B82 A;  3PTW A;  2C3M A;  4WE1 B;  2YWH A;  5HBM A;  1UW4 A;  3U1L A;  1YJ9 S;  2OO4 A;  5IWA F;  4OHY A;  5I42 B;  1RYS A;  1U26 A;  3MZI A;  2ZHA A;  1H72 C;  1M5K C;  4PG6 A;  3KMS A;  3BGR B;  3BZQ A;  3UR3 C;  5DS7 A;  2Y1L B;  4ZDN A;  3M8Y A;  2LDY A;  3CDB A;  2DHG A;  4JBC A;  3ISZ A;  3KUE A;  2EKN A;  3N6N A;  3MM6 A;  4C8Y A;  2E66 A;  4XIU A;  3IXQ A;  2OSR A;  1TU0 B;  1A6L A;  3GFH A;  1FD2 A;  1PJ7 A;  2LQJ A;  2Z0G A;  2E1C A;  5J2N B;  3RR8 A;  2BUN A;  4KFB B;  3UFC X;  2G0I A;  1EJ7 L;  1TL3 B;  2OLW A;  2D9P A;  1VBY A;  1TL1 B;  3LGH A;  4XPE A;  2RHS B;  3RRK A;  2XHC A;  1JNR B;  1HYS A;  4L74 A;  2AW0 A;  2W01 A;  1RE1 B;  3I0R A;  1UFK A;  4EFA C;  1Q8I A;  1WEY A;  4HVZ A;  1P8G A;  3SSQ A;  5IFM A;  2O1P A;  3ZZP A;  1KHV A;  2CAJ A;  5CCM A;  1WAC A;  4H4K C;  4URQ U;  5AJ3 J;  4DV4 J;  4RW6 B;  4JI1 F;  2VBZ A;  1U1P A;  3DRR B;  2K7K A;  4K4Y A;  3IM9 A;  3TI0 A;  3IO1 A;  2DR6 A;  2UUA J;  4OV6 A;  2W8K A;  2CQ4 A;  2AP6 A;  1LW2 B;  3D0G E;  3HJV A;  3PYG A;  2XWY A;  1VC6 A;  1M5V C;  2I8E A;  1T3N A;  2Z58 B;  2WW8 A;  1FRK A;  2CDQ A;  1S1T B;  5KG6 A;  3JSR A;  3MEG B;  2OP5 A;  1JLQ A;  4CLY A;  1T9T A;  1FRH A;  4IRK A;  2FPH X;  5K8M A;  2GIQ A;  3HP6 A;  1TVR B;  2EWH A;  4CP5 A;  4OHX A;  1GXL A;  2WON B;  5ADZ A;  4UF4 A;  1IR2 A;  2CNN B;  1NK7 A;  1IWG A;  2MQL A;  2XYP B;  2V2K A;  3CDA A;  2F1F A;  3CW2 C;  2FY1 A;  1Q5Y A;  2E7V A;  4PPZ A;  2P9E A;  2FGO A;  3NWR A;  3UN3 A;  2IVF B;  4OHW A;  2WVD A;  2D41 A;  3PG9 A;  2Y1J A;  4F2R A;  2BJ9 A;  4B02 A;  5DJB A;  5E3Q A;  3FEY B;  3MTJ A;  2VBY A;  1HQE A;  3H5Y A;  2YVS A;  4AND A;  2J6T A;  4DR6 F;  3SBM A;  2Q1L A;  4YR2 A;  1MWY A;  4A46 A;  3CNQ P;  3CIM A;  2XG8 A;  1B0T A;  1R27 B;  2KM8 C;  1XMB A;  3BGF A;  4MK9 A;  3PX6 A;  1AUD A;  4Q2L A;  4M1K A;  4KHP J;  2IM3 A;  5ETP A;  1RXO B;  4NLQ A;  3I4H X;  3GSD A;  1NUE A;  1TL7 B;  3HVT A;  2ASJ A;  2FLP A;  1AZS B;  1FRX A;  4H4K A;  1U0H A;  2W4C A;  1EKS A;  2KJW A;  3AY0 A;  3MCN A;  2AT1 B;  3N6L A;  1N5S A;  4MIB A;  3G86 A;  5H9E J;  4DQP A;  5F8I A;  3KFW X;  3A3O B;  3H20 A;  1IBK F;  3CCW A;  5T7L B;  2AJ2 A;  1EQM A;  3KUG A;  2OPS B;  2X1F A;  2XMW A;  1TTH B;  4IH6 A;  2HND A;  1JQG A;  2FJV A;  4U7U D;  2E7X A;  2NPF A;  2ZH9 A;  3QJL A;  3N28 A;  2MY8 A;  3EZ5 A;  4I6Y A;  4DPU A;  1C0T A;  3TAM A;  1KEK A;  4FNH A;  1ZS6 A;  2BQR A;  1UMJ A;  4LF6 F;  3D66 A;  2RJZ A;  3ULH A;  3KMQ A;  4C3K A;  3M4X A;  3GIK A;  1Q86 T;  3PW7 A;  2JLF A;  3G6X A;  4J91 A;  2N7C A;  4EGL A;  2CJA A;  2OMO A;  5FDL A;  5A8K A;  2C2N A;  4ELT A;  2OML A;  1B64 A;  4FYW B;  2YWW A;  3ELH A;  4QOT A;  2VG7 A;  1U8S A;  2VQE J;  4NYP A;  4DMZ A;  1R0A B;  1XBW A;  4LF2 A;  1FX4 A;  3KLI B;  2HVZ A;  3QGG A;  1JLE B;  2JEJ A;  3OV7 A;  3SIP B;  4OZJ A;  1YJW S;  3DI6 B;  2N82 B;  2EPI A;  3N01 A;  1S1U B;  3AOC A;  4KIA A;  2XYH B;  2FLL A;  3E2E A;  4TXS A;  1R8P A;  5D4N A;  3QJJ A;  4ED0 A;  3CJ0 A;  5KFZ A;  4H54 A;  2PI4 A;  1F9E B;  4ZLJ A;  3R8Y A;  4ZLN A;  1N56 A;  2MHE A;  4NCA A;  2Z56 B;  2PD1 A;  2MKH A;  4X4O A;  1LWC A;  4KH1 B;  2G2Z A;  4YN3 B;  2CPY A;  4X62 F;  2FY8 A;  1XR5 A;  4PG7 A;  4UUX A;  1NK4 A;  4ECU A;  4QPX A;  1B0V A;  5HO4 A;  4CT8 A;  4P6Q A;  5EGY A;  2CQH A;  4LJM A;  4O44 A;  2UXC F;  4PKD B;  4EZ6 A;  3OD2 A;  4C3L A;  3NNA A;  2DIV A;  2VPZ B;  5C5J A;  1N32 F;  4TLR A;  3AB4 B;  3KUH A;  4X4V A;  1HNX J;  2I6W A;  4DV6 J;  3MDF A;  3EPG A;  2E5L J;  1T9U A;  2AZ1 A;  1UVK A;  3NOG A;  3ISN C;  4F3Q A;  1I94 F;  3R1L A;  4CRJ A;  1FRL A;  3DGP A;  3H2L A;  4PR6 A;  3JTN A;  2MEW A;  1Z2L A;  2LEA A;  5A6P A;  2ZKT A;  1GMW A;  3WHI A;  4HDH A;  5KOX A;  5DG8 A;  3W5Y A;  2MQP A;  3D28 A;  3GIM A;  2NUU G;  4KSE B;  1RBO B;  3LPE A;  2KB2 A;  1FJG J;  4AXJ A;  4WFA Q;  3I0S B;  4BLG A;  3MEK A;  3H5X A;  4UZB A;  3RB4 A;  1GT8 A;  3TAN A;  5CZV A;  3BKU A;  1F9H A;  4TY8 B;  4DQR A;  1FK9 A;  1JK9 B;  5HK4 A;  3HX9 A;  4DLG A;  1Y7P A;  1NCL A;  4DL3 A;  2R8H A;  1WTF A;  3LAK A;  2RF2 A;  4FYX B;  2XSJ B;  2YWE A;  4LBP A;  1RI7 A;  4HTI A;  2Y8Y A;  1FT8 A;  4LFB J;  2R7V A;  5A2Q U;  4KKO A;  5CXT A;  4O3R A;  1WEL A;  2WVF A;  3R5A A;  2QLJ B;  3DXS X;  4ZMM A;  5LMN F;  2M52 A;  1NJX A;  5KT6 A;  2DGS A;  3H2V E;  1CUL A;  1XEZ A;  1TL4 A;  4EYI B;  1MRO A;  3UPF A;  4C3M A;  2KU7 A;  3W61 A;  2XYG B;  1Y00 A;  4YUD A;  1YJN S;  1BWV A;  1RBL A;  4NLY A;  2AJF E;  2KYZ A;  4ANE A;  3MPD A;  1YTY A;  4IG0 A;  2ILZ A;  3UO0 A;  5D6G A;  3KOA A;  3TA1 A;  4JYA J;  4ZN3 A;  3IM8 A;  1PYS B;  2ZBQ A;  1C4C A;  4OJ3 A;  3UNY A;  2MLZ A;  2PEB A;  5KTQ A;  3BQ2 A;  3ONQ A;  2QA4 G;  2C3O A;  4J9K A;  1TK8 A;  3R9L A;  2V8P A;  4B08 A;  1TAQ A;  5A2Q Y;  1JNZ B;  2VPX B;  2Z8Q A;  4DPW A;  5CZX A;  1QM9 A;  4ID5 B;  4NRU A;  4DXL A;  2DEJ A;  2U2F A;  3FEZ A;  3BDP A;  2D3Z A;  2FVC A;  2ILY A;  2ZBC A;  2CJQ A;  1NDP A;  3MFI A;  4B3T J;  3VGS A;  2HVI A;  1JX4 A;  2G2O A;  3OR2 B;  1LEO A;  5C25 B;  4IH5 A;  2CJX B;  5IT9 U;  1U2R A;  4CO0 A;  4IOA Q;  1VK3 A;  3FFI B;  3QT6 A;  3J81 U;  1YRU A;  1X7V A;  4WYL A;  2R9L A;  3KHL A;  1WC5 A;  2XLJ A;  1NSQ A;  1HFE L;  2RIL A;  2BR0 A;  1SJ4 P;  1CVJ A;  2DEI A;  1RT5 A;  2GO8 A;  3RAX A;  2CQ2 A;  1RTI A;  4B3M F;  1XWL A;  4YME A;  1H2U X;  4YB5 A;  2DH8 A;  3UI3 A;  1FE0 A;  1CEZ A;  2GQC A;  2CNK B;  4RW9 A;  1MNE A;  2IM2 A;  2FZC B;  2HG4 A;  3DC2 A;  4QJV A;  3DLK B;  4UY8 5;  3MM5 B;  1CQM A;  4JV0 A;  5BR8 J;  5J1P A;  2QMX A;  5F8H A;  3SDE A;  4MMO A;  3A4T A;  1NH7 A;  4ZVT B;  3AOD A;  1RT3 B;  3UCZ P;  3HD2 A;  3LP1 B;  1SH3 A;  2ZNZ A;  2DNO A;  5IT9 Y;  5C2G A;  3NP5 A;  2BJ1 A;  3J81 Y;  2H51 B;  1YZ7 A;  1HMV A;  3TP2 A;  1FD8 A;  1J5E F;  3HKZ D;  2IPO B;  4ZP6 A;  4C8L A;  3DYA B;  5B0G A;  3JTO A;  1YJ7 A;  2FHJ A;  1RT7 B;  3CME S;  1YVF A;  4Z37 A;  2MJN A;  4RX6 A;  3DMJ B;  3W66 A;  5F8N A;  2CFX A;  3S6E A;  3RG6 A;  3G8T A;  3VHQ A;  2CQG A;  4HAC A;  4DL0 C;  4B3S F;  4N41 A;  2OH2 A;  3DLG A;  1Q8B A;  4B3O A;  4C7Q A;  3SV4 A;  1TK5 A;  3QZ8 A;  2ZH2 A;  3H5S A;  2MKY A;  1YQH A;  2E5H A;  4I2P B;  1SUQ A;  2MQN A;  1RT6 B;  1SKW A;  2P9G A;  4J9R A;  3V81 A;  2CXE A;  3L09 A;  4U7U K;  3IWX A;  4ZLL A;  2BJ8 A;  2YNG B;  3TUI C;  4WKR A;  2FJX A;  5KFW A;  1ULR A;  1GX5 A;  4YHH F;  2B4O A;  3IRX A;  4O3N A;  2POK A;  1S0V A;  3LPY A;  4B9N A;  1RAO A;  3QRR A;  1IM4 A;  1NO8 A;  1H73 A;  5IZH A;  4R0E A;  5LSO A;  3DHW C;  3SXL A;  3QFW A;  4A4J A;  3LGN A;  3V4I B;  3D2W A;  3DOK A;  3CB4 A;  2YNI B;  1WC0 A;  4YY3 J;  3SQG B;  1NBE B;  4RW8 B;  5DRK A;  3CJ2 A;  1CPZ A;  1CJT A;  4RUH A;  3QIP B;  4CNZ A;  1UL3 A;  2HBQ B;  2LLZ A;  2DCL A;  5B0E A;  3IFE A;  4W92 B;  4Y2K A;  4ED4 A;  4IQM A;  1VLO A;  1BGX T;  1ZET A;  1WDT A;  4C0H A;  1RUS A;  1LKZ A;  5I3Q A;  3D1O A;  1W2I A;  5HAT A;  4DV3 J;  2BKO A;  2HNZ A;  1HLW A;  2FLO A;  3MGJ A;  1JLG B;  1VI7 A;  4K4X A;  1PO6 A;  1YIJ S;  5KG3 A;  5DZ7 A;  5J2Q A;  2W2O P;  4NL5 A;  2ZJP Q;  3BGR A;  2CPH A;  2EFG A;  3J7Z T;  3U7J A;  2XMU A;  3QFH A;  1RP5 A;  4N5S A;  2JDJ A;  2PFD A;  5L1J A;  4OJ1 A;  3BPD A;  1YJU A;  4B9M A;  5GAD U;  2V2V A;  1NXI A;  3IBC B;  3K7R A;  5EWE A;  3RAM A;  1KD1 T;  4NXN J;  4I0W A;  4NOH A;  2F7V A;  1RT1 B;  2HW3 A;  3UR0 A;  1IBM J;  2QYC A;  5I3U B;  1U0S A;  1KHW A;  5J2N A;  3OQ2 A;  1ROF A;  1NHV A;  2JC1 A;  1QDU B;  5KAK A;  1X0F A;  2XLI A;  1ZAW A;  3CCE S;  2W9C B;  1XMO F;  2BAC A;  3T9N A;  4JP8 A;  1ICE B;  2GA7 A;  1R8A A;  5CCL A;  2CDR B;  4DV5 F;  4LRF A;  3RR7 A;  2CPZ A;  2CJ9 A;  2W8L A;  3M2U A;  3UN5 A;  3PW4 A;  1I6J A;  1KQS R;  5CA5 A;  1BQN A;  1Q81 T;  4TU8 A;  3DRP A;  1B70 B;  1N34 F;  1IJE B;  3CD7 A;  4W4M A;  3VGU A;  4G65 A;  1HNZ F;  1LW2 A;  2VH7 A;  3RZA A;  1PYT A;  4Y28 C;  1JKH B;  4Q8F A;  2B5J A;  3HHL B;  1F5A A;  3FRZ A;  4URG A;  2VIH A;  2F40 A;  3MEG A;  1YX2 A;  1HNI A;  4UST A;  4F4K A;  2RS8 A;  1PAE X;  2DGQ A;  4IG3 B;  1SVD A;  4DF4 A;  4KPY A;  1VRQ C;  4NE9 C;  1SC6 A;  4DR7 J;  2P5V A;  1TVR A;  4UOH A;  3Q8U A;  3UQS A;  2FYX A;  3OLA A;  4GKJ J;  4J5O A;  4TLQ A;  2ABY A;  2GHW A;  4CLP A;  3OXG A;  1D8Y A;  4ZPC A;  2NXU A;  1LWX A;  3TEG A;  4DU8 A;  1PG5 B;  2ZH1 A;  1RYR A;  2ZJQ Q;  4TU9 A;  2XC9 A;  2NXC A;  1NKC A;  1QSY A;  4Y2I A;  1DAR A;  3OUY B;  1JLF A;  1WTB A;  2CQD A;  3EMT A;  2UZA A;  1NAQ A;  1HWL A;  1G3O A;  4DR3 F;  3TR5 A;  2R4F A;  1S59 A;  1H7X A;  4BCA A;  2LKZ A;  4P7V A;  4NX9 A;  2ZWP A;  2C2R A;  4LRE A;  3S1T A;  3EJM A;  2CRL A;  2P6S A;  4Z7C A;  4ED1 A;  3EWG A;  5DDQ C;  2B3T B;  1DUR A;  2QA1 A;  1FKP A;  4X2B A;  5C24 B;  3CCU S;  2WSE C;  3K89 A;  2I5J B;  1AZS A;  2KI2 A;  2GMH A;  1NK8 A;  2AKW B;  4HDG A;  4LSL A;  4OIX A;  5EDW A;  3GSI A;  4XTT A;  2ZH7 A;  1F2H A;  2GVD B;  3M6W A;  3ZTP A;  2I1R A;  3KHR A;  5T7L A;  3TUJ C;  3I4P A;  3AA9 A;  4DI6 A;  3D6H B;  1FEE A;  5DGA A;  3NOC A;  3F0N A;  3HFZ B;  2MLY A;  2Z4P A;  4NLT A;  1FWK A;  3M2R B;  2FJW A;  1QD1 A;  1WC4 A;  1FTC A;  4IFY A;  2FJE B;  5A8W A;  2HQ3 A;  4I64 A;  2LMI A;  1N36 F;  3D0H E;  3IS9 B;  3PW5 A;  2ZOM A;  1XR7 A;  4YB6 A;  2V6A A;  3M8R A;  1WSV A;  3LF0 A;  1PSD A;  4MKA A;  5J2M B;  2EC2 A;  4DDF A;  3EUN A;  2MYF A;  1R7I A;  3GE9 A;  4YDX A;  3W8P A;  4TQS A;  4PUO B;  4LSN A;  3NCR A;  2HHQ A;  1MU2 B;  2HBZ B;  1JXE A;  3MHY A;  1O51 A;  2U1A A;  4X66 F;  2AGO A;  2HPU A;  3KLE A;  2HZV A;  2OHD A;  3KJN B;  3TVY A;  2RQM A;  4FPI A;  1Q5V A;  3MTK A;  3HXM A;  3DLE A;  3KG4 A;  4FN5 A;  4Z2X A;  2RU3 A;  3B4M A;  2UXB F;  4FVM A;  4NYO A;  3ILJ A;  1HR0 F;  2VJU A;  3DLL Q;  4CH7 A;  3CD6 S;  1S1U A;  2I38 A;  1DRZ A;  4WPA A;  1VQ7 S;  2DRB A;  5GMK a;  1UVM A;  1TUW A;  1YI2 S;  3CUN A;  3ENV A;  4GVB A;  4LFC F;  4WIQ A;  3W2V B;  2BE9 B;  4PXE A;  3H98 A;  3UWT A;  5HJX A;  3TQ1 A;  1NJI T;  2A2D A;  2RE1 A;  4DPT A;  4J9P A;  4OZ2 A;  4OZL A;  4M5M A;  5KFN A;  2Z2L A;  4LRB A;  3V6H A;  1V3R A;  3NRB A;  3D0I E;  3OTO J;  2ZH8 A;  1RK8 A;  2MZJ A;  3JQM A;  4DCJ B;  2G1D A;  4URS A;  4ZS6 A;  4USH A;  3N5B A;  4I6W A;  2EG2 A;  1SC4 B;  3FEX B;  2CVE A;  3MUT P;  1VIX A;  2GIR A;  2FVP A;  2UU9 J;  2KFZ A;  4H4M B;  1LWE A;  5AE2 A;  3OHB A;  3SCK E;  4M5I A;  1RGV A;  4DFK A;  4JUZ A;  2AYE A;  2RDJ A;  3A8E A;  4DG1 B;  5HRO A;  4F67 A;  3I9V 9;  2NSB A;  2EW9 A;  2V2Q A;  3TO8 A;  4K0K J;  4WCE Q;  2DNQ A;  2EKY A;  2MQ8 A;  4WP3 A;  3LWM A;  4M5J A;  1HW8 A;  4V1A k;  5HN0 A;  4DOZ A;  2FDN A;  2JZ5 A;  3W9H A;  4WFX A;  3NGS A;  3GWC A;  4NA2 A;  3QRP A;  4X64 J;  1F3V A;  4NXM J;  2Y1R I;  3AQP A;  5MAO A;  2MKC A;  1FJE B;  3HO1 A;  1NDC A;  2ALY B;  2GS8 A;  4XAK A;  4RPF A;  3I0S A;  3TZX A;  2L48 A;  4ALZ A;  4F4A A;  2BVZ A;  4A8O A;  5CD4 A;  3W64 A;  3W8G A;  1Z4U A;  3OLB A;  1XN9 A;  4GMK A;  4ZPV R;  2NRE A;  4U6P A;  3MPY A;  2ERR A;  2HGM A;  3ZTS A;  2UV8 G;  2R2U A;  3PIP Q;  2ADB A;  2M7S A;  3BN4 A;  2P8I A;  1YJR A;  3FCW A;  1Q8K A;  4P2M A;  1PBA A;  3MAA B;  3ADA C;  1WF1 A;  1KFD A;  2BM1 A;  4UUW A;  4MFB A;  1HNW F;  4PAA A;  2E5I A;  4PAB A;  3MMA A;  4F2S A;  2QX0 A;  3R27 A;  1VHI A;  4M5D B;  4Y00 A;  4DR4 J;  3BH6 B;  3FSY A;  2ZFH A;  2OI2 A;  4KH0 B;  2Q43 A;  1PGZ A;  3LP0 B;  1RA7 A;  5DG7 A;  1DTQ B;  2KRR A;  5KG0 A;  5ETT A;  4RUC A;  2XM3 A;  2ZKU A;  1VGY A;  2X1B A;  1URR A;  1T03 A;  3SCJ E;  4ZP9 A;  3HPO A;  1S77 D;  1MW7 A;  1U45 A;  2ZBI A;  1QTM A;  5D4O A;  2YQ0 A;  1GTE A;  3BJY A;  2JNJ A;  4C0O C;  5IM0 A;  5E0O A;  3AJ2 A;  4NCG B;  4DV0 F;  1C1C B;  2QL5 B;  4LIR A;  2HHX A;  4LF8 F;  4DV2 J;  2VOD A;  5HL7 Q;  2ZH3 A;  5AXL A;  2JEF A;  3VR1 A;  1YBU A;  1VRT B;  4RNH A;  1S9E B;  4ID8 A;  4NLU A;  3IAM 9;  1IKY A;  5J1E B;  3CTR A;  2YKO A;  3D3B J;  1IKW A;  1RHR B;  3T3F A;  3OVB A;  4KT0 C;  3P5B P;  4RU9 A;  1FFW B;  2BYC A;  4AD6 A;  4N76 A;  4DFM A;  3C15 A;  2GML A;  2EC0 A;  3IC1 A;  4IDK A;  2X3D A;  2QSW A;  4G1I A;  3VF0 B;  1L5U A;  4GKK J;  5KFB A;  4DF8 A;  1PJ5 A;  5D78 A;  5AE1 A;  2J0Q D;  4ZHR A;  1KLN A;  1KKH A;  3CJ4 A;  1S0M A;  3LAN A;  2KRB A;  3L7U A;  4MIW A;  1ZTT A;  3ZO7 A;  1WSR A;  5DQH A;  4BDP A;  3PJX A;  2AJ4 A;  3MM5 A;  1NJZ A;  2HEK A;  4A8M P;  3QZ7 A;  4QYZ J;  3FQL A;  1T8E A;  5IT0 A;  3MPU B;  3GIJ A;  4KHP F;  3DU6 A;  2IYG A;  4ERD A;  1X4C A;  4ES3 A;  4UZC A;  1H74 A;  2HIQ A;  4P7T A;  1UEV A;  3X1L B;  2GX8 A;  1U09 A;  2G13 A;  1U1N A;  2DIU A;  4M5L A;  4KV8 B;  2LEP A;  1NPK A;  1JLC A;  4M5H A;  4LF5 J;  5LMU F;  3D3C J;  2YKP A;  2Y8W A;  2HNY B;  1PC4 A;  3NGK A;  6FD1 A;  3HSZ A;  3KDN A;  4R8U B;  5LM7 E;  2BM0 A;  1I3O B;  3HVA A;  3KLV A;  1OO0 B;  3BSC A;  4DZD A;  3HHD A;  4X4N A;  4P2F A;  2XQC A;  1N5V A;  3PCO B;  3CGI A;  4ECR A;  3TAR A;  4KAI A;  1AW0 A;  4GRS A;  1ZH5 A;  2PMZ D;  3BBC A;  5HBM B;  4I2P A;  4DEZ A;  3H7H B;  2C22 A;  1M1K T;  2RD5 C;  2UVU A;  2ZDO A;  2M3D A;  3I55 S;  5HVF A;  1H3D A;  1VFJ A;  3CC2 S;  1YG0 A;  3CJR A;  3P45 B;  3EVM A;  1RU1 A;  4AL5 A;  3GJQ B;  4CO4 A;  4ZVF A;  2QMW A;  2FGC A;  4U7C A;  3I82 A;  2DPI A;  2E1A A;  2ZZN A;  4X4Q A;  4DZ6 A;  1S12 A;  4O3P A;  3RRG A;  4DFJ A;  1K9M T;  4J9N A;  4Y2C A;  4L3N A;  3MM6 B;  4NEZ A;  4AL6 A;  1J5O A;  5IQ6 A;  1S0N A;  4RW8 A;  2MKS A;  1CJV A;  4RW4 A;  3MM9 A;  1M90 T;  2DD8 S;  1SC3 B;  3AH6 A;  1YLX A;  1HBM B;  3FBE A;  2MJU A;  2Q3P A;  1T02 A;  8RUC A;  4M95 A;  5M2U A;  5DDP C;  1U1Q A;  2UUC J;  4WJB A;  4MKY A;  3T5J A;  3HT3 A;  3FC9 A;  1HYS B;  1MMN A;  1FNO A;  3I0R B;  4RLE A;  2RIJ A;  2CZ9 A;  2QLB B;  1F2G A;  3HHL C;  3C46 A;  1SIZ A;  4IOB A;  2D1C A;  4Y2A A;  1BD6 A;  2QJ3 A;  4J7C A;  4A48 A;  1JLG A;  1X9W A;  2LYV A;  2JFD A;  4EUV A;  4CO1 A;  1WI8 A;  1KTQ A;  2EFP A;  3EVO A;  2QTW A;  3MFH A;  1Q8L A;  2MTL A;  3HLU A;  1TUG B;  3CC7 S;  1F5B A;  1HBO B;  1U1K A;  1X4H A;  3HSJ A;  2AYG A;  4P9S A;  1ZYQ A;  1QY7 A;  1N4L A;  1U8W A;  3GYG A;  3ITH A;  3NNH A;  2AEJ A;  2VF3 A;  4LFA J;  4WKY A;  2W7P A;  4DCO B;  1FTR A;  4E0D A;  3K8W A;  2CQ0 A;  4X4R A;  2AU0 A;  2V94 A;  3JSM A;  2BJE A;  1SJ3 P;  2W9C A;  4DUZ F;  1T9V A;  4HTJ A;  2HFV A;  4X65 J;  2J8A A;  2MZR A;  2GC8 A;  1WC6 A;  2J6S A;  5B08 A;  2X51 A;  3FJ2 A;  1SL0 A;  2RT3 A;  4J9V A;  2PA3 A;  3CPW R;  3M9N B;  1XIQ A;  1HQE B;  2VG6 A;  4ED7 A;  2QYG A;  1GNK A;  1MMD A;  3PEH A;  2VOO A;  2AX0 A;  1YDL A;  2PMH A;  1VMB A;  4TYB A;  2MZS A;  2LP4 A;  3NGU A;  3TUZ C;  2KO1 A;  3KLG A;  3OHA A;  4DPX A;  1A9N B;  3ZTQ A;  1JKH A;  3TZW A;  5LT5 A;  3HVT B;  2R3V A;  1YKW A;  1VQS A;  3MR3 A;  1RTH A;  3Q8S B;  2OAU A;  4B9S A;  2MKK A;  1B7F A;  4IG3 A;  2E7W A;  3MED B;  4HYK A;  1TFY A;  2NUH A;  1VBK A;  3G9C A;  2J7K A;  2F5G A;  2VG5 A;  2CPD A;  1YJV A;  4IR9 A;  1FX2 A;  1H0H B;  4F50 A;  1NSA A;  1LXN A;  3DLB A;  3NG8 A;  5HVH A;  3BYR A;  3V6J A;  2V68 A;  4EWT A;  2BKN A;  1VLY A;  3EIC A;  3LA0 A;  2J9C A;  5JVH Q;  4X4S A;  2FC9 A;  1Q79 A;  4P52 A;  3OUY A;  3TEH B;  4B9U A;  3DGV A;  4CT9 A;  1C0T B;  2CPX A;  1FE4 A;  3TAM B;  5I4M A;  3CWJ A;  4FPR A;  2K2P A;  4JV5 J;  4R0J A;  1RAJ A;  1F5C A;  3R5C A;  3CJK B;  4FP9 A;  3QYY A;  2FJD B;  4JI8 F;  1RWO B;  4X4P A;  2VC1 A;  2KHC A;  4DL6 A;  1YK9 A;  3ICL A;  3DOM B;  2HSE B;  3CJT A;  1S48 A;  1ZPV A;  5A8K B;  5C24 A;  4ICL B;  3SSS A;  2OIH A;  3R6L B;  2I5J A;  2M9K A;  3HJF A;  6AT1 B;  4USI A;  4X84 A;  2DNG A;  1HWJ A;  3VZI A;  1URN A;  2UUW A;  4ES2 A;  3HI9 A;  2M2B A;  2C2M B;  2F8H A;  1XNR J;  3C66 A;  2GO9 A;  5A76 A;  2EEY A;  2GVD A;  4JI0 F;  4TYA A;  4YR0 A;  3BEG B;  3QID A;  5DG9 A;  4QR0 A;  4YFU A;  2PC6 A;  3NMA A;  3NS5 A;  3K17 A;  3BRE A;  3M2R A;  3ZTR A;  3U27 A;  3C3L A;  1LWC B;  2XLK A;  3OTD A;  3WBZ A;  3IS9 A;  1KFS A;  2C42 A;  4ZPA A;  3MR5 A;  2VPW B;  3KJQ B;  4OHZ A;  2R8G A;  1Q95 G;  1PAU B;  4OX6 A;  2DXD A;  3RTV A;  2XS7 A;  3BGU A;  3GYN A;  4CLF A;  3PNI A;  4O44 B;  1ZTW A;  1UA1 A;  3AD9 C;  2E5G A;  3BO4 A;  1RTZ A;  3GG1 A;  1XR6 A;  4C8O A;  3R97 A;  4I2Q B;  1KON A;  4LVO P;  2LA6 A;  1JJ4 A;  4L6V 3;  2ZDP A;  2VV5 A;  4Y3C A;  3W9J A;  2V8V A;  2Z2M A;  2CJY B;  1N8R T;  2HQI A;  4CLZ A;  1UA0 A;  4CYU B;  1U02 A;  3J7A N;  3SYZ A;  1Y5I B;  4OYX A;  3DGP B;  2L41 A;  2I0X A;  1Y3J A;  2H65 B;  3GQC A;  3KLH B;  4DN0 A;  3QGH A;  3JYT A;  4C11 B;  2V5H G;  2YKN A;  5L9X A;  3TAQ A;  5E2Q A;  1PC5 A;  1RLD A;  3MM7 A;  2UV8 A;  5C7P A;  1AXQ A;  1LWF A;  1MWZ A;  4ILR A;  1WNE A;  1FVS A;  2YXL A;  1S1W B;  4WBF A;  3BKF A;  1IR1 A;  3OXL A;  3KLF A;  4TNO A;  1UEK A;  1W7W A;  1FK9 B;  3UN2 A;  3DDI A;  4KJI A;  1F6T A;  1KBR A;  1CS4 B;  1EET A;  3EDR B;  3RUB L;  4WFB Q;  2RF2 B;  2DH7 A;  3MM8 A;  1IKX B;  1Y4Z B;  2YQ1 A;  2O66 A;  4ILM A;  1IJF B;  4KGK A;  2XMJ A;  2HHT A;  4KKO B;  2ZC3 A;  4LUB A;  4K7Q A;  3G6Y A;  2AGP A;  3H42 A;  2IJF A;  4DG1 A;  2BMB A;  1LQ9 A;  4OYW A;  1CUL B;  1HQU A;  4DSE A;  1HL6 A;  1WDD A;  1MRO B;  2JHE A;  2DHX A;  3V4M A;  4RNF A;  1F60 B;  1NDK A;  1Y5N B;  3Q23 A;  1HBU A;  4ZVH A;  2ASL A;  2V50 A;  3NWG A;  2OTL S;  2ZH6 A;  3I5C A;  1S0O A;  2AV5 A;  3JTP A;  4QCL A;  2V34 A;  4HHH A;  8AT1 B;  3AD8 C;  2XMV A;  4H4O B;  3OSN A;  4G1Q A;  2DT9 A;  4J90 A;  2HFS A;  5B0A A;  3C14 A;  3ZXW A;  4LR8 A;  5B0C A;  5F9L A;  1QSL A;  5L46 A;  1R0B G;  1UJ6 A;  2QLX A;  3AJD A;  4QW8 A;  2RRA A;  5A0Y A;  4ZVP B;  2ZM6 F;  2BDP A;  2HBR B;  1WHX A;  3QNW B;  3UVJ B;  3K5N A;  1RAB B;  3MWB A;  2J9D A;  2B51 A;  3CMQ A;  3ISN D;  5L9N A;  4C0B A;  2DNR A;  4A8Q A;  4ITS A;  1KQF B;  2HZC A;  1M5P C;  4JI1 J;  3DHX A;  4A8W A;  1RHU B;  1FWP A;  5BJR A;  1C0U B;  2HAF A;  5KFS A;  4P72 A;  1SV5 A;  3IG1 B;  4OX9 F;  1VQ5 S;  2M4M A;  3M05 A;  5HP1 A;  2LQ9 A;  4M5D A;  4RNN A;  4WFZ A;  2E1P A;  3LGM A;  1U25 A;  4PG8 A;  4B3R F;  2V63 A;  3NAI A;  3OPK A;  3TNV A;  4B9L A;  2CWK A;  4D3G A;  3LP0 A;  2RNE A;  2NR0 A;  1DY3 A;  1RT5 B;  1RTI B;  3BH7 B;  2UVV A;  3CF5 Q;  1SKS A;  4PYD A;  1P9Q C;  3GJS B;  4RW9 B;  4UW2 A;  1QUV A;  1V3S A;  3DLH A;  3UDV A;  4NAS A;  1RZM A;  2FUG 9;  4UTG A;  4LQ3 A;  2XMT A;  3THT A;  3SQO P;  2AHO B;  3MCO A;  3OTB A;  1HBN B;  1N6Q A;  5HSP A;  2R42 A;  1B3T A;  1LFP A;  5KOW A;  2XWX A;  2K3K A;  3MMJ A;  3NKY A;  1WD6 A;  4QWC A;  2BZ2 A;  4QZV B;  4K4W A;  2OD4 A;  4Q7A A;  3E01 A;  2ZE2 A;  4Q44 A;  2XGQ A;  4W98 A;  2JSX A;  8ATC B;  4Z7Y A;  4IRD A;  4DR7 F;  4DR6 J;  1HMV B;  4IR1 A;  4QYR A;  3T1H J;  5KFI A;  2N4D A;  5J1E A;  2E9T A;  2PO4 A;  2QN6 B;  3X3U A;  2HFZ A;  1J27 A;  3K5P A;  1R8H A;  4TVA B;  5DDR C;  2HLT A;  1H7W A;  2YKM A;  4ZIV A;  1IM6 A;  2GGP B;  4KTQ A;  3DLG B;  4S0M A;  5EWG A;  3BR8 A;  3KNA A;  4J9O A;  3CJS A;  2XEX A;  4LF9 J;  3E3X A;  3M9M B;  1SUQ B;  2V0N A;  2KDO A;  2O3D A;  4BWJ A;  1IBK J;  1BMQ B;  3BB5 A;  3FBC A;  3IN5 A;  3H40 A;  1WI6 A;  1TKT A;  3N6M A;  2OTJ S;  3HFV A;  2BJ7 A;  1U7L A;  2GQ2 A;  1SJF A;  3IRX B;  1EZZ B;  3M8Q B;  3O5T B;  3KK2 A;  4MYU A;  2MZT A;  3BYP A;  2AGQ A;  4GC7 A;  1HPZ A;  3CJ3 A;  3DOK B;  2LEC A;  3MAH A;  3QRQ A;  4ZLP A;  3H25 A;  2UXD F;  2IM0 A;  3VAJ A;  2HHU A;  3MCS A;  1CJT B;  4ZPD A;  2HQF A;  1GK8 A;  2GJ2 A;  2XB2 D;  5F8M A;  2HS4 A;  4K2X A;  3R3T A;  2VJV A;  5HMZ A;  2HNY A;  1S6P A;  4KGM A;  3P4U B;  3RAQ A;  3WC0 A;  2UUT A;  1U1O A;  1UVL A;  2B4V A;  1RWM B;  4B9T A;  2BRK A;  2YWK A;  3IA0 A;  4C48 A;  1OPI A;  5ETN A;  1UPP A;  4IFV B;  1TK0 A;  2QFI A;  1ZZN A;  2W9B A;  3ZZU A;  2HAI A;  2HNZ B;  1TKX A;  1FFG B;  2DGX A;  2B7B B;  4OX7 A;  4P73 A;  2DGU A;  3FK4 A;  2R7R A;  2L9N A;  4J9U E;  2IDE A;  2WVC A;  4EMD A;  1E6Y B;  2V8D A;  5J2Q B;  2C2K B;  2OEJ A;  3BO3 A;  2AYB A;  2RHQ B;  3GFX A;  1Y3K A;  2MGZ A;  5HMW A;  4OYZ A;  1M1G A;  3KK3 B;  4JOU A;  4X62 J;  1J2V A;  1DZ5 A;  1VC0 A;  3R7B B;  2VAS A;  3K59 A;  1RAI B;  2ASD A;  5G0R B;  1NJY A;  4WTY A;  4KHM A;  1HA1 A;  3T6J A;  2DNZ A;  3PJ9 A;  4FYD A;  1OIA A;  3DRX A;  4LBH A;  4WZM A;  3RBX A;  3CE8 A;  3A12 A;  3WDO A;  2PE8 A;  4CH0 S;  2QRR A;  4HL9 A;  1HBM A;  3UE2 A;  5U47 A;  4CZC A;  5EX3 A;  2UXC J;  5I3P A;  5DET A;  4PZV A;  4QPT A;  3O2I A;  2FJB B;  1WOO A;  4OZN A;  1C4A A;  4CLU A;  3B78 A;  1O5J A;  3MI7 X;  4NI2 A;  1I51 B;  2XZD B;  4OMF G;  3EXY A;  3FDS A;  4NRT A;  1HQ2 A;  2KT3 A;  3M2U B;  2XSF A;  2MQQ A;  1FJC A;  3C16 A;  1WC1 A;  3K8V A;  1SCJ B;  1BQN B;  4A47 A;  1I94 J;  4Q0B A;  3DRP B;  3NS6 A;  4KPC A;  4DN9 A;  2VA3 A;  3CCS S;  4WYW A;  2DPJ A;  2V69 A;  1DHM A;  4AFF A;  2LU2 A;  4TQR A;  4DR1 F;  5EWF A;  1T94 A;  1HBO A;  2B5J B;  2OEK A;  2WRM A;  2IAJ B;  4OHV A;  2BXJ A;  2RUG A;  2HGL A;  2KXH A;  1HNI B;  5KFE A;  3D1H A;  5B0F A;  2D69 A;  2KXF A;  1RHJ B;  5ETL A;  1UJ4 A;  2J7U A;  2QT7 A;  1U24 A;  3HHK A;  1ZBT A;  1RJJ A;  4PEO A;  5KFG A;  2RQ4 A;  1OQ6 A;  3FSI A;  2BE7 D;  2W24 A;  3P6Y C;  1DJ0 A;  5CAA A;  3BKT A;  2R7O A;  2ALZ A;  2D3U A;  4QU6 A;  1O6X A;  5LL6 d;  4NLG A;  1X8D A;  3CCM S;  4F36 A;  5GAD I;  9ATC B;  2D9O A;  2WBR A;  2CQI A;  1P6T A;  5LMN J;  3CSK A;  4X4U A;  3N4W A;  2WAQ D;  2HUR A;  3KDO A;  1JLF B;  3PM9 A;  2VUG A;  3A8J A;  4OFZ A;  1OMS A;  3R5D A;  4NLP A;  2AWZ A;  4DV7 F;  2B7C B;  3R2D J;  3HHN B;  2H5E A;  2JX2 A;  3JQK A;  4Y65 A;  2PII A;  3H4D A;  3AAW B;  1ZM3 A;  1U47 A;  4ED8 A;  5L8R C;  4RR5 A;  4ILL A;  2OKQ A;  3RB6 A;  3M2V A;  2GVZ A;  2N3O A;  1FKP B;  3CED A;  3BSO A;  2HLU A;  2CZV C;  1X4G A;  3PR4 A;  4ZCI A;  1D1U A;  2EBE A;  4FF1 A;  1LXJ A;  3MUR P;  1CLF A;  2XCA A;  2DNL A;  3MED A;  2BE2 B;  3H90 A;  2KYX A;  1U1L A;  2NCK L;  4LSL B;  4CDI A;  3P49 B;  1P27 B;  4JI6 F;  3OVS A;  3Q0A A;  1RWP B;  3TJ9 A;  4I67 A;  3UDC A;  2FC8 A;  2R7T A;  3W63 A;  4YP3 A;  3KKF A;  3CDU A;  4K2J A;  4PQA A;  5LSL A;  3D68 A;  3DU5 A;  4FBT A;  2IDL A;  4RBT A;  3PRV A;  4IFY B;  2OPQ B;  5A8W B;  3W9I A;  4WK1 A;  4OJH A;  3RGI A;  5B7W A;  2HHH F;  2F4V F;  1Q7Y T;  5D15 A;  5B09 A;  1SKU B;  3PIO Q;  2DB1 A;  4OYI A;  2VQF F;  4RWX A;  3K57 A;  4DLE A;  3BBF A;  5DLF A;  5AT1 B;  3OVA A;  4B3M J;  1DTT B;  2WSC C;  3FKB A;  3CJK A;  1MG7 A;  4CTA B;  4HT7 A;  1DLO B;  3PKM A;  3ZC4 A;  2CPE A;  3SCL E;  3DOM A;  1X4D A;  4ED2 A;  4P74 A;  2I2Y A;  1RDR A;  4LVN P;  4CH1 A;  2QEX S;  4LSN B;  4ICL A;  1K1Q A;  1FJ7 A;  1S57 A;  3OFG A;  4FXV A;  2BW2 A;  1G4C A;  3MUV P;  2F9D A;  3HCX A;  3PYE A;  4U96 A;  3KLE B;  4DQQ A;  3PW0 A;  3VAL A;  1T11 A;  1Q82 T;  2AQ4 A;  5IS2 A;  3DLE B;  3A3N B;  3D67 A;  5E5N A;  1VQL S;  3B54 A;  1RAE B;  1HNV A;  1S6O A;  4OI2 A;  5CD4 H;  3TW0 A;  5K14 A;  3KK1 B;  1TV6 B;  3RBE A;  4K4U A;  2DR8 A;  1U6Z A;  2GV1 A;  3SSR A;  1M1H A;  4GVB B;  3OJU A;  1NHK L;  3OBI A;  4OYB A;  1EQ0 A;  1UJ5 A;  3GV7 B;  1KNZ A;  1EAR A;  4B3S J;  3MXH P;  4OLO A;  3RB0 A;  1DQ9 A;  3HVW A;  5L38 A;  2YX4 A;  3KJF B;  3OR1 B;  3HM9 A;  4F02 A;  1WEZ A;  2Q79 A;  5D3G B;  3BDE A;  1HD1 A;  2R8I A;  5KFO A;  2VFV A;  2UVR A;  4X4T A;  4OV1 A;  3LAL A;  3EGV A;  2E29 A;  4I2Q A;  4M8L A;  4HH0 A;  1VS3 A;  1X60 A;  2V4J A;  1OYD A;  1LWE B;  6FDR A;  2E9R X;  4N56 A;  1Y10 A;  4YHH J;  5DM7 Q;  4L72 B;  2XI3 A;  3MF5 A;  2DXE A;  1GFW B;  4ZPW R;  2N4C A;  5HRO B;  5GMD A;  4CYU A;  1PYO B;  2XO6 A;  4UOC A;  5IC4 B;  3K58 A;  2NSC A;  2B9X A;  4I68 A;  5CYQ A;  3ZZY A;  2OEM A;  3O44 A;  2NQP A;  3KLH A;  2ZHO A;  2XMA A;  4PQU A;  2HK2 A;  3M30 A;  2NZC A;  1EIY B;  1CQN A;  4C11 A;  4EK2 A;  2GNK A;  4EYH B;  4QIG A;  4DV1 F;  2B4P A;  1IBL F;  2RAQ A;  2QLF B;  2RSQ A;  1UZD A;  1EAY C;  4F25 A;  3GTY X;  5ETS A;  4QIV A;  1S1W A;  5KFT A;  2MQO A;  1WWH A;  5A8R A;  1AUS L;  3FSX A;  4ZVS B;  4K5R A;  1WOR A;  2DK2 A;  1K0V A;  3LP2 A;  3AXM A;  1CS4 A;  5GAE U;  2C3P A;  1ITP A;  1IKX A;  3FVY A;  3KG1 A;  4DWI A;  2CQ3 A;  1T05 A;  1SKR A;  2MKJ A;  4YB1 P;  4AL7 A;  4MFB B;  1TZ0 A;  3WC2 A;  3Q89 A;  5FLX U;  5JVG Q;  3MMA B;  3HVR A;  3PFE A;  3CCJ S;  3NL0 A;  1HHS A;  1B99 A;  2HMI B;  1FA0 A;  2HFN A;  7FDR A;  5IQQ A;  4XDC A;  2W4D A;  5HVG A;  1FDD A;  2DO4 A;  4ECY A;  1ARO P;  2YNF A;  4H4O A;  3MEE A;  2NZ4 A;  1T03 B;  4WFY A;  1EX8 A;  3VAK A;  3T19 A;  2HHP A;  1N5Y A;  1VQK S;  1NK0 A;  2J7W A;  1N0U A;  1OPZ A;  2ASY A;  1JIH A;  3PV8 A;  3NMR A;  1N33 J;  1QSS A;  4G6V B;  4OLP A;  5D0E A;  4DV5 J;  2HQD A;  3AA8 A;  5IM0 B;  1JB0 C;  3CMA S;  4F4W A;  4BS2 A;  1ZPW X;  3UVJ A;  4PWW A;  1D8Z A;  2CG4 A;  1RHQ B;  4LF4 F;  4J9L A;  5D8H B;  2VHG A;  4OZ0 A;  4IO9 Q;  1RCX B;  1S7H A;  5FLX Y;  4IKA A;  1N34 J;  3NCP A;  1NEE A;  1NJW A;  3VQS A;  2YY3 A;  1QLN A;  1YRX A;  4B9V A;  1F9F A;  1C0U A;  1Y9O A;  3EM1 A;  3OT9 A;  1FDA A;  4WP8 A;  1HNZ J;  1IKY B;  1HI8 A;  4CO2 A;  3IG1 A;  2WW4 A;  5EX0 A;  1IKW B;  4USM A;  4ZVG A;  3OW2 R;  1KVK A;  3C15 B;  1S5Z A;  2DRD A;  3OTC A;  4USV A;  3A8K A;  3MMB A;  4IDK B;  3M8W A;  3KWM A;  3T5K A;  4DX5 A;  2MDA A;  4ECQ A;  4JV2 A;  3RJM B;  4UOF A;  4N8O A;  3J81 j;  1NK9 A;  3WZ0 A;  4ZHR B;  1M5S A;  1UVJ A;  1S7I A;  3I5A A;  3D6F B;  1U48 A;  3RBD A;  4LMZ A;  5T14 A;  1CC8 A;  1HBN A;  5ETK A;  2GQQ A;  4NEY A;  3TQE A;  1HI0 P;  5AXN A;  2D3O R;  1BHN A;  3BM7 A;  5KFD A;  2VC0 A;  4FKX A;  4DL7 A;  4C2M A;  2XMK A;  3W5X A;  4JI5 F;  3RW6 A;  2R7S A;  2AYM A;  1FWL A;  3FZ2 A;  3T9Z A;  4A8X A;  1XMQ F;  1NSK L;  1QUP A;  4HT5 A;  3TX0 A;  1JLC B;  1L3V A;  3PJW A;  2H5I B;  2AEM A;  5DQG A;  2GGP A;  3DN9 A;  3SCI E;  1N5T A;  5KT7 A;  2W2P P;  2CQC A;  5C42 A;  2ZVS A;  1ZA2 B;  3M1V A;  3HDS A;  1ZA1 B;  1QE1 A;  1Q4R A;  3POT A;  1X31 C;  3ILI A;  3P8B B;  3TUP A;  3CC4 S;  2W2M P;  2HVE A;  4NZ6 A;  3D7S B;  2NPI A;  5J2P A;  1BQX A;  1B0P A;  2K8G A;  3AHP A;  2XNR A;  2CYY A;  1H2T Z;  2YPZ A;  4JI2 F;  2Y9H A;  3M8Q A;  2MHN A;  1T9Y A;  4ZCM A;  1XJW B;  1N36 J;  4F4Z A;  3T1Y F;  1N54 B;  4QWE A;  5IT4 A;  3HSD A;  3CD0 A;  1MML A;  4UQG A;  1J5O B;  2XBP A;  2QIF A;  2YPY A;  1OQ3 A;  2BW7 A;  2DIT A;  1CJV B;  4RW4 B;  1KQK A;  3MM9 B;  1WEX A;  2NXE A;  2YNH B;  1VYA A;  2IRX A;  5JUM A;  4ZVR B;  3QLH A;  4U8V A;  2DHS A;  4LQ9 A;  4ENO A;  5H1S V;  2MZQ A;  4EZ9 A;  3PZP A;  2BBE A;  2MKI A;  1JJ2 R;  2DXF A;  3LAM A;  1VRU B;  1NHU A;  4X66 J;  2PDA A;  1UCN A;  4FYV B;  4I1T A;  2AMC B;  5KFJ A;  1P9Y A;  3JS9 A;  4IFV A;  3GON A;  5HQM A;  4MJK A;  4F0K A;  4JI4 F;  4K50 A;  2UXB J;  1NPP A;  1EP4 B;  1HR0 J;  1UKU A;  2CNL B;  3R2C J;  4RNM A;  1EKR A;  2DO0 A;  2BV3 A;  4D3H A;  3NBP B;  3G8S A;  2ROP A;  3M8S A;  1RWK B;  1E6Y A;  5EN1 A;  2J6U A;  1UPM B;  3QAT A;  4AE5 A;  1PIL A;  4KGZ B;  1VBZ A;  3KJV A;  1FRJ A;  4LFC J;  4DS4 A;  2NXJ A;  3FQK A;  3KK3 A;  5F0W A;  1D9D A;  3GYX B;  4A8F A;  1KS2 A;  1WJ9 A;  1VIO A;  1FKO A;  5G0R A;  3GII A;  2CUY A;  3CJQ A;  4MAK A;  2I9S A;  2NYH A;  3PHE A;  3ITH B;  3GFY A;  5CYM B;  3H5U A;  1QAJ A;  2EK6 A;  2R7U A;  2FJA B;  1RU2 A;  1IVZ A;  4RUA A;  1ZM2 A;  1S1V B;  4WFN Q;  3JSM B;  4DHV A;  1RWV B;  2W1B A;  3FCV A;  3SV3 A;  3G82 B;  4ES1 A;  3ETM A;  3GB0 A;  3GV5 B;  4DL4 A;  2IFX A;  1YBT A;  4OI4 A;  1IQZ A;  2O01 C;  4KGX B;  2XCP A;  3L9Z A;  2SXL A;  2VG6 B;  3SFG A;  3J7Y U;  4DSK A;  1X5S A;  4EBD A;  1SQF A;  4RO0 A;  3PAC A;  2KN4 A;  1Y11 A;  1OSC A;  3S8S A;  3KLG B;  1SJR A;  2LFV A;  1HI1 A;  4JI3 F;  1EHW A;  3GFZ A;  5F8J A;  4E8U A;  3A8I A;  2IAJ A;  3QAU A;  1D0E A;  2HGN A;  5H9F K;  1RTH B;  1WKJ A;  4JB8 B;  1Q0N A;  1G1X A;  1N88 A;  1OY8 A;  4NPO A;  4DCP B;  2WB4 A;  2VG5 B;  2V2Z A;  1FNX H;  5KT5 A;  3HHL D;  3DRY A;  3H59 A;  4DL2 A;  3PXG a;  1GXT A;  5GAG I;  3DDK A;  2NS1 B;  1IR0 A;  1TAU A;  5AE3 A;  1AYE A;  1PJ6 A;  1JLB A;  2LU1 A;  3KXD A;  3HSG A;  2P9C A;  4DL5 A;  3ZFV A;  3ZNU A;  4O3S A;  3J7A 1;  2FZK B;  2RKI A;  1HNW J;  1NU4 A;  1KTV A;  1S9G B;  4PWD A;  5IV3 A;  3Q2T C;  1F1B B;  1JJH A;  3THP A;  1RWU A;  3HD1 A;  2EFN A;  2ZWO A;  2GHP A;  4ZN1 A;  3M8P A;  4ZOS A;  1DQA A;  2ATC B;  5E7O B;  2B9Y A;  3PX4 A;  3MEC B;  4M5N A;  1QAX A;  4FNI A;  1F3F A;  3HUL A;  1Q16 B;  3KNG A;  3OL7 A;  2DGT A;  3O3L A;  3IMQ J;  1B7Y B;  2JC0 A;  2OFH X;  3BV8 A;  1KDN A;  3S7R A;  1YBA A;  5BYQ A;  3ILL A;  3CVK A;  3THV A;  2BE2 A;  1OY6 A;  5EHH A;  5KFQ A;  4DV0 J;  4GO5 X;  2HWH A;  1HD0 A;  5BYS A;  1NME B;  1DAX A;  4LF8 J;  1RHK B;  2IJN A;  2KVQ E;  3R7S B;  3SMZ A;  1S49 A;  4KBI A;  4DQI A;  4WXO A;  4DBQ A;  1D3W A;  1AFJ A;  1UAW A;  3L3C A;  1FRI A;  2QL7 B;  4UQT A;  3K0J A;  2OPQ A;  1S6Q A;  1KR4 A;  2WOM A;  4DR5 J;  2E5J A;  3C6T B;  3NAH A;  1VQ6 S;  5E3C A;  1BLU A;  1XNQ F;  5DDO C;  1KLM A;  2ROE A;  2NXN A;  3NNC A;  1DTT A;  2XTJ P;  2WZ1 A;  2A0F B;  4DX7 A;  2FQQ B;  4J9S A;  2V67 A;  4CTA A;  3TWZ A;  5KT3 A;  1DLO A;  2AX1 A;  3MR7 A;  5BXI A;  2QL9 B;  4AQY F;  4C8K A;  3NGR A;  4ED6 A;  2FHM A;  3A13 A;  2LVW A;  3T1H F;  2Y1I A;  1VQO S;  4ANC A;  2ZC4 A;  4E2F B;  2Y0B B;  1Y5L B;  1UWA A;  1NK6 A;  3CCL S;  4N7T A;  3R7N B;  2Q66 A;  1VQ4 S;  1RTJ A;  5M2R A;  3BSA A;  3NY0 A;  3C8Y A;  3KK1 A;  4UOG A;  3K2Y A;  1TV6 A;  4ECX A;  3JYT B;  3G8Q A;  2QC3 A;  3CJ8 A;  3I56 S;  4LF9 F;  3TJ8 A;  5KFL A;  1CC7 A;  2YKN B;  2P2C B;  4RUB A;  2WVB A;  1O8B A;  2QV6 A;  5E3P A;  4RBU A;  5LOQ A;  3MM7 B;  5LMU J;  3UCU P;  5M2P A;  1LWF B;  2RH3 A;  2F65 A;  3PVX A;  5KFM A;  1BC6 A;  1OS5 A;  3HF5 A;  5D4P A;  3KLF B;  3Q24 A;  2MMY A;  2EFO A;  2L08 A;  3OR1 A;  2IMO A;  5D3G A;  4DR2 F;  2A6O A;  1EET B;  2IVM A;  1SQG A;  4FS2 A;  3EZU A;  5KT4 A;  1C1B A;  4DSL A;  3MM8 B;  1RB0 A;  1RSC A;  3M6X A;  1VQM S;  4CLK A;  2H5J B;  3V5R A;  4KO0 A;  1IWA A;  4TKT A;  5SZT A;  5K8O A;  3CCR S;  1HHT P;  4EBC A;  3N79 A;  4DUT A;  3BGL A;  3VQT A;  4ZVE A;  4BC7 A;  5F8G A;  1HQU B;  1IKV A;  5HMY A;  4YDD B;  3Q8P B;  5K5M A;  2XGP A;  1HBU B;  2W2N P;  1RLC L;  4WP9 A;  3FBF A;  2G0J A;  1R8B A;  2BAN A;  2KT5 A;  4IO1 A;  1X4B A;  2GJF A;  1U6B A;  2JL9 A;  4G1Q B;  4FF4 A;  2HRY A;  4J9M A;  1PIE A;  1TKZ A;  2XS2 A;  5E3R A;  1NLK L;  2YKQ A;  3C14 B;  3U1M A;  2H9Z A;  3FBB A;  4OI1 A;  5A0Y B;  2BQ3 A;  3M7V A;  1FVQ A;  2ZZT A;  1XQI A;  4DSI A;  2XZT B;  3O1L A;  2JRS A;  2W7A A;  2LQB A;  1TMJ A;  2B4U A;  2B6A B;  4CO3 A;  3VTI A;  4LBI A;  5L1K A;  1UTA A;  3W2W A;  3PW2 A;  1SV5 B;  5L1L A;  2A18 A;  2F3J A;  1X4E A;  3A3P B;  3Q8R B;  5HP1 B;  4R5P B;  1NH8 A;  4MK8 A;  3CCT A;  2ZD1 A;  2HMI A;  2COL A;  1N5Q A;  1JMT A;  4NA1 A;  5HMX A;  4O4R A;  4MH8 A;  2XY6 A;  3MMC A;  4KB7 A;  3WIV A;  2Z2Y B;  2V8H A;  3PRB A;  3ZZO A;  3EGN A;  4QYZ K;  5AJ3 F;  4XPC A;  1R89 A;  4DV4 F;  1RQ0 A;  3I87 A;  4JI7 J;  1TKD A;  4DUZ J;  2W2Q P;  2UUA F;  1H6K X;  2IJR A;  3D6T B;  3LTO A;  2OPR B;  1V5I B;  1N6Q B;  1KVJ A;  1GMU A;  1G2E A;  1S79 A;  4NML A;  3JQJ A;  5E3A A;  3E01 B;  2ZE2 B;  1SQE A;  2C2O B;  2VB6 A;  1SC1 B;  2J9E A;  3W7B A;  2J8S A;  2IC3 A;  2YBV A;  3PYF A;  2CPF A;  2M5Y A;  3BBB A;  1LOU A;  2O5D A;  4C6A A;  2R7Q A;  1CJK A;  1RAA B;  4CI0 B;  1SL1 A;  3D5M A;  1R6Y A;  1NRK A;  5LXY A;  2YKM B;  2ZHB A;  4F8R A;  4A8K A;  1QVF R;  4YB7 A;  5KG2 A;  3OTE A;  2AEF A;  4G3I A;  4CWB A;  3MOJ B;  4YQW A;  4WXW A;  5GAH I;  2A10 A;  1R8C A;  1WHW A;  3RB3 A;  1TKT B;  2E9Z A;  1QAI A;  3EYZ A;  3RYL A;  5D0R A;  4USJ C;  3QSI A;  2Z30 B;  1YHQ S;  4OX8 A;  4R25 A;  1BQM A;  3KK2 B;  4DPY A;  3FUY A;  1S99 A;  2BRL A;  4M94 A;  1VHF A;  1HPZ B;  3UNG C;  3BN7 A;  3DRS A;  1S1X B;  2G1H A;  4DU7 A;  3OXF A;  2DGO A;  4M63 A;  1AT1 B;  2HBY B;  3TOQ A;  3HHE A;  1SL2 A;  2DY1 A;  4JI8 J;  1KRP A;  3DLJ A;  4P2X A;  5CAB A;  3JXO A;  1N0V C;  3JSB A;  1UET A;  4DSF A;  1S6P B;  3IRW P;  2KFY A;  1FKA F;  2H48 B;  3BQ1 A;  2DKO B;  3RRH A;  4FXD A;  4K4V A;  1FER A;  2ZVI A;  2CNO B;  3B6B A;  3CO0 P;  2FLN A;  1P1T A;  3R5B A;  1T7P A;  1YIT S;  3DCA A;  5B0B A;  2HYI B;  4WU2 A;  4GO7 X;  2W9B B;  4JI0 J;  1OSD A;  1TKX B;  3NS7 B;  3MAQ A;  4ECW A;  4Q2M A;  2QLW A;  5KFA A;  2IA0 A;  3DM2 A;  3AFG A;  2X7I A;  1W2B R;  2WBM A;  4CQ1 A;  4PXB A;  5SUH A;  1KWM A;  2MGZ B;  2F63 A;  3G87 A;  2XY7 A;  3MOZ A;  2BAB A;  3CDW A;  3QMQ A;  4B17 A;  2CPI A;  1N52 B;  2KXN B;  2PN6 A;  3FNN A;  1VDH A;  3J7Z 5;  2VQE F;  1T0T V;  1TP7 A;  4NCB A;  2YNH A;  1VK8 A;  3VGV A;  4QR1 A;  2XNQ A;  2K1R B;  2E44 A;  3PY8 A;  4EO8 A;  1K47 A;  1DFD A;  1QJH A;  5CQG A;  3M32 B;  3B4D A;  4NI2 B;  3KYL A;  4FKY A;  2DGW A;  1VRU A;  4FDF A;  5BYR A;  2YTC A;  1S6U A;  2D74 B;  3C16 B;  1REV A;  2XUL A;  2FZG B;  5MLC V;  1RT2 A;  1S97 A;  4RW7 A;  1KN6 A;  5CHC B;  1EP4 A;  3BF4 A;  3W65 A;  3IR7 B;  4Q0B B;  1IXK A;  2VKZ G;  2HS0 A;  2KJV A;  3M6U A;  2UUB J;  1LW0 A;  2VFR A;  3NBP A;  4F4Y A;  4HI2 A;  1KOH A;  3TVZ A;  3KHG A;  1L3S A;  2OPP A;  1C2P A;  5LJ5 Y;  1LNQ A;  2DNM A;  4MT1 A;  2JLG A;  4U67 Q;  3SI8 A;  3RBZ A;  2LXI A;  1IN0 A;  4ZCL A;  1HNX F;  3EZO A;  4DV6 F;  1RWW B;  1L3K A;  2E5L F;  2DNN A;  3W3S A;  2OUG A;  3MR2 A;  5CYM A;  1WF0 A;  1U4B A;  2IHR 1;  2EK1 A;  2RS2 A;  4Q5V A;  1FES A;  1CJU A;  1DBD A;  3GR1 A;  1Q78 A;  7AT1 B;  1S1V A;  5G4D A;  3PR5 B;  5KG5 A;  3G82 A;  2KVI A;  1VBX A;  5JXS A;  4AUK A;  2G4B A;  5F0U A;  1HWI A;  2LQ5 A;  2PGC A;  3DOL B;  5JMN A;  4QQB A;  5AXK A;  9RUB A;  2DR7 A;  1UWB A;  1FJG F;  2L3M A;  4YR3 A;  4NYZ A;  1FI4 A;  5K8N A;  2VFS A;  3GU0 A;  1VQ8 S;  4WE1 A;  5LXR A;  3P5T L;  3RW7 A;  3HT0 A;  1GMV A;  2LEB A;  1GTH A;  3V6D B;  2R2T A;  2RDD A;  3I6P A;  2IRU A;  5I42 A;  1WHY A;  1YZ6 A;  3M2V B;  2GVZ B;  1Q7L B;  3F41 A;  1QAY A;  4LFB F;  2XS5 A;  3N9U C;  1VJQ A;  3GG0 A;  3TRG A;  2OSQ A;  3R1H A;  2A6M A;  4OYM A;  1SXL A;  3LWL A;  4EBE A;  2ZM6 J;  3IGV A;  1RA6 A;  2JOQ A;  1REG X;  4LF7 J;  4IH7 A;  4KHR A;  5A6W A;  3R5G A;  1TQL A;  1K1S A;  2JJ4 D;  2W4P A;  1XER A;  4OQJ A;  1SBR A;  2IY5 B;  1FDB A;  1TMM A;  2HFU A;  3AQO A;  2V8G A;  3QGI A;  3OFH A;  3LUY A;  2R2R A;  1RKJ A;  3CDE A;  4KFB A;  2HIY A;  3D1Q A;  1TL3 A;  3MD3 A;  3W1Y C;  3VWS A;  4JYA F;  1FFS B;  1S9G A;  1W26 A;  4OX9 J;  1TL1 A;  2M8D B;  1LK7 A;  2OGU A;  3IWL A;  1N33 F;  2VOP A;  2QG9 B;  2MZ1 A;  3CO9 A;  4OI3 A;  4ELU A;  4B3R J;  3QPI A;  2A1B A;  1S4F A;  1ZM4 A;  3R5J B;  3UW1 A;  2OEL A;  4DUY J;  3GPA A;  5HI7 A;  3MEC A;  4K4T A;  1WKK A;  3QBC A;  1ZOT A;  1SPB P;  3F44 A;  2F8E X;  1JJC B; 
#chains in the Genus database with same CATH homology
 1MN9 A;  3ENA A;  4CP5 A;  3EVM A;  4ENO A;  3WX8 A;  1NDP A;  3BBB A;  4DUT A;  4C6A A;  1S5Z A;  3VGS A;  2HUR A;  4DZ6 A;  3EVO A;  3FBC A;  3PRV A;  4WBF A;  2AZ1 A;  5IOL A;  1LEO A;  4EK2 A;  1PAE X;  3ZTS A;  3FCV A;  2DXF A;  2DXD A;  1NHK L;  2DY9 A;  1NDL A;  5CAB A;  1UCN A;  3G2X A;  3VGV A;  1W7W A;  3NGU A;  4KPC A;  1BUX A;  3FCW A;  3DDI A;  4UOG A;  1HIY A;  3JS9 A;  4UOF A;  1JXV A;  4UOH A;  1F6T A;  3Q8V A;  3ZTQ A;  3VGT A;  3ETM A;  3Q8U A;  3BBF A;  3FBF A;  1BE4 A;  1NSQ A;  3ZTP A;  2HVE A;  4ANE A;  3MPD A;  3FKB A;  3EE3 A;  3B6B A;  1LWX A;  4DI6 A;  4FKY A;  1NPK A;  1U8W A;  2B8P A;  3FBE A;  2AZ3 A;  4W98 A;  1PKU A;  3ZTO A;  3BH6 B;  3Q86 A;  3Q8Y A;  1K44 A;  1NLK L;  1BHN A;  4AND A;  4O0N A;  3Q83 A;  2VU5 A;  3NGS A;  3VVT A;  2B8Q A;  1ZS6 A;  3DKD A;  1HHQ A;  3PJ9 A;  3FBB A;  4FKX A;  3FC9 A;  1NSP A;  1NB2 A;  1MN7 A;  2BEF A;  2DYA A;  1S57 A;  1F3F A;  1HLW A;  1WKL A;  1B4S A;  3EMT A;  1EHW A;  3GP9 A;  2HVD A;  1XQI A;  2NCK L;  1NDK A;  3BBC A;  5BXI A;  3R9L A;  2DXE A;  1NDC A;  3EIC A;  1NCL A;  1NUE A;  3VGU A;  2CWK A;  3NGR A;  3EM1 A;  1S59 A;  1WKJ A;  2BX6 A;  3GPA A;  3B54 A;  3EVW A;  3ZTR A;  1KDN A;  1NSK L;  3Q89 A;  3VVU A;  4F4A A;  3L7U A;  5CAA A;  3BH7 B;  4S0M A;  4ANC A;  2ZUA A;  3NGT A;  1WKK A;  1VYA A;  1XIQ A;  4HR2 A;  3ELH A;  4F36 A;  1B99 A;  3EJM A;  5C7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...