1B4SA

Structure of nucleoside diphosphate kinase h122g mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Nucleophilic activation by positioning in phosphoryl transfer catalyzed by nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 43
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1998-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1b4sA00
1W7WA 1UCNA 3NGSA 4UOHA 1WKJA 3FKBA 3BBBA 3Q8YA 5BXIA 3EVOA 1WKLA 3EICA 2DXFA 1S5ZA 5IOLA 3FBFA 3ZTSA 1NSKL 1PKUA 4O0NA 1LEOA 4ANEA 4W98A 1PAEX 3BH6B 3EM1A 3VGSA 4ANCA 3DKDA 4DI6A 3GPAA 3FBEA 2AZ3A 3ETMA 2HVEA 4FKYA 2VU5A 1NHKL 1ZS6A 3ZTRA 3NGRA 4KPCA 2BEFA 1F3FA 1NDCA 4HR2A 3PJ9A 3BBFA 3BH7B 1HHQA 1NPKA 3JS9A 3ENAA 4EK2A 3PRVA 3ZTQA 1NDPA 2DXEA 1LWXA 1NCLA 2DY9A 3G2XA 3VGVA 1BE4A 4UOFA 3L7UA 1B99A 4FKXA 3EJMA 4CP5A 1NDKA 1HLWA 1KDNA 1WKKA 1BHNA 1NLKL 3EE3A 3ZTOA 3FBBA 1VYAA 3ELHA 3Q8VA 3FBCA 2B8PA 3B6BA 1NSQA 4S0MA 3VVTA 3B54A 2CWKA 3FCWA 4ENOA 1MN7A 4UOGA 2DXDA 1XQIA 3BBCA 3Q8UA 4C6AA 1HIYA 3VGTA 3Q83A 1BUXA 1B4SA 1U8WA 3GP9A 5CABA 3Q86A 1S57A 5C7PA 3FC9A 3NGUA 3WX8A 1JXVA 1NDLA 1EHWA 3R9LA 2NCKL 1XIQA 2BX6A 2HURA 3VGUA 3EVWA 1NSPA 2B8QA 3EMTA 3MPDA 4F4AA 3EVMA 1K44A 3NGTA 1NB2A 2AZ1A 5CAAA 1NUEA 3Q89A 3VVUA 4ANDA 3ZTPA 4DUTA 2DYAA 2HVDA 4DZ6A 3DDIA 4WBFA 2ZUAA 1F6TA 1MN9A 4F36A 3FCVA 1S59A
chains in the Genus database with same CATH superfamily
2ZOFA 2KTQA 2AWZA 3AJ1A 4KR0B 1S6QA 1CPZA 4NXNJ 5DG7A 1WF2A 4KFBA 4DMZA 1LWFA 1S1TA 2EVZA 5H9FK 2KHDA 4TNOA 4DCOB 1WELA 3ZNUA 5EUHA 4JI8J 1UA0A 3R5GA 1X4FA 2ZC4A 4KH0B 2B56A 3SIPB 4ECQA 3KLHB 2DH7A 2F8MA 3ITHB 4L3NA 3NOGA 4OYBA 2MLXA 1RUSA 3OR2B 4M94A 2VG7A 3VALA 1M90T 2EG1A 3R2DJ 3CCTA 4I64A 2UUAF 1VQ9S 5EWGA 1JWWA 4OYAA 3DHWC 5HJYA 5C7PA 4F4XA 5KT2A 4BC7A 5DDQC 4GC7A 2G1DA 4USHA 2CVEA 1YRXA 2IM3A 2DNMA 3T1YJ 2EG2A 5I3QA 4CIOA 3AT1B 2D69A 2XHWA 1RT5A 3VAJA 1YJRA 3OD2A 3ILIA 3R7NB 1CBKA 1F6TA 2IRUA 2C28A 3L9ZA 3U1LA 4F0HA 4ECWA 4M5GA 3CJ4A 4UOCA 3M1VB 2HMIA 1TKZB 3M2RB 3Q8QB 3MOZA 3AA9A 3NNAA 2FHKA 5C42B 3RYLA 4O44B 4LF8F 2H5EA 2RUSA 1MWQA 1T8EA 4C4WA 4KV8A 4DU8A 2PMWA 4PWDB 1P9QC 5CD4A 1EQMA 4J5OA 2W1BA 4IYQA 2RH3A 3PIPQ 2BM1A 1FFSB 4J9MA 2LDYA 4U6PA 3CD6S 1Q53A 1T02A 1YQHA 4U8YA 1RTJA 2YWKA 1DTQA 4GMKA 2DNRA 3US5A 1RU1A 2ASJA 2NZCA 1CSJA 4YHHJ 4ELTA 4Z7YA 1D09B 4KT0C 4ZIWA 5AJ3J 4ES3A 2LECA 1FWPA 3EVWA 1NSPA 3D6TB 2UZAA 3KJQB 2BA9A 1IR1A 1D9FA 4L3KA 1T03B 2XI3A 2AU0A 2QYCA 3BQ0A 1AUDA 5HROA 4JI6F 3IRXA 1TELA 3TUPA 1LEOA 1TKTB 3SSQA 2AP6A 3KLFA 4X64J 5G0RA 4ECYA 3M8RA 3UCGA 5HAOA 3PR5B 4V19J 4RJVA 3HFVA 1LNQA 2DISA 2IMWP 3BGFA 3TI0A 1FNXH 3JYTA 1G7CB 1H7WA 3PKYA 3H8YA 1T9XA 2KM8C 3GILA 4RU2A 5GMKa 2HQCA 2PI4A 4LMZA 4NEYA 1VQKS 3H4DA 2V4JA 4BWJA 1NKCA 4H4KA 2DNZA 2IJFA 1RTIA 2JJ4D 1RSCA 2JNJA 2X3DA 1XTZA 1RWVB 4DSIA 1LFWA 1S10A 3R6LB 2HQFA 3QZ7A 1XK8A 2VA3A 2GFFA 4LVOP 4H4KC 1RA6A 1S1XA 5KFIA 1T95A 1Q7YT 2VPYB 1SL1A 2XYHB 3OLBA 5J2MA 2R8JA 4PQAA 1BQNA 1T11A 2MZJA 2UUBF 4X4QA 2D3OR 1ZM9A 2YQ1A 5GAEI 4R0JA 3TA1A 5AE1A 2DR7A 1H0HB 2A2CA 5ETOA 4ZKAA 3GJTB 2DNHA 1C0UA 3L7UA 4CP5A 1X5PA 4H4MA 2NSCA 2R7OA 1GXLA 1N32F 4OX6A 3CJKB 2KYXA 2LKZA 3KUHA 6FD1A 5HQLA 4NI2B 1RWOB 4CTAA 1LWCB 2CJXB 3VGUA 4FNIA 2VL1A 2IM0A 3MM6B 3WC0A 3IN5A 4NZ7A 3SFUA 1P1LA 2IVFB 5B09A 2XMTA 3EGZA 1GTHA 1NZ8A 3POTB 5KFTA 3VZIA 2NREA 4DZ6A 2NSBA 1YJVA 3GB0A 1GT8A 5IC4B 1Y11A 3EXYA 4NLGA 1VLYA 4CO1A 1WI8A 4L6V3 1DJ0A 2Z2YB 4JV0A 3DNCA 2HVZA 1R8CA 2KI2A 1UWAA 1KWMA 1ZH5A 4ED4A 3GFHA 3V6DB 4ECSA 1REVA 2DHGA 2D74B 2B4VA 1NPPA 1H98A 2E1CA 2LQ8A 1VRTA 2BV3A 3UI3A 4EK2A 4DV3F 4F4YA 4J9UE 3M2UB 2OEJA 2DIVA 2BRLA 5FJ4A 3CCES 4G3IA 4OYWA 3VAFA 1RTHB 1MU2A 4F4WA 8ATCB 2DHSA 2QO3A 1R8BA 1WD6A 2W9CA 2HHPA 2RRAA 4F3OA 4MKAA 5KFLA 1B70B 3FMWA 3V4MA 2KXFA 3PJXA 2EK6A 5EDWA 1ZA2B 4AL7A 3C6TA 3ZO7A 3ENQA 1WOSA 4P7TA 4RNMA 5T7LA 1RAFB 5DM6Q 2XO7A 4J9OA 1HNIA 2IDEA 4ECXA 2A0FB 3WX4A 5DZ7A 3N79A 1IR0A 1R8PA 4R25A 1VLOA 2G0IA 1F3VA 2E5JA 4A8OA 1REGX 4X4RA 4QQBA 5D4LA 3DLHA 2IYGA 5D8HB 2VU5A 3Q2SC 3RG6A 4LFBJ 4DOZA 1MMLA 1VC6A 4DV0F 4Y00A 3IGVA 3F41A 2CJYB 2DTJA 2YKPA 2DR8A 3MMCB 4M5IA 3NS6A 1NCLA 2JSXA 2CPHA 3W7BA 4GO7X 1SC6A 3NEKA 1HLWA 3IMQJ 3RU0A 3UDVA 3AXKA 1SQFA 4MKVA 3MR3A 4ZS6A 3V2UC 2DNKA 4GVBB 1I94F 3DOKB 3M05A 1M5HA 2YWWA 4DV7J 3GSDA 4O0IA 5JVHQ 1K0TA 3PV8A 3KKFA 2ZNYA 3MAQA 3BREA 3T5KA 3VF0B 2MB0B 4ZP7A 5B7WA 3TUZC 3ZNJ1 4LSLA 4USMA 1Q82T 4GKKF 2AD9A 2B5JB 2IMOA 2VFTA 3J7AN 4M1KA 2W2NP 3W1YC 3UE2A 3A1YG 2B7BB 4Q7AA 4NCGA 1PAEX 3EM1A 1KD1T 3H2LA 2CA9A 5DLFA 4ZP8A 3M32B 4FKYA 4PRFA 3TQ1A 3R5DA 2PMZD 1UVNA 2Z0GA 2GAHC 2HHXA 4CM0A 2CDRB 5HVHA 3PRVA 4UTGA 3FQKA 4Y2IA 1WC1A 1S1VB 3HT3A 1G2EA 1L3UA 3D6HB 4MT1A 2HHHF 3S01A 2APOA 3E01A 4DV6J 4S0MA 2V5HG 4Y2KA 1LOUA 2WB1D 1CJUA 5CZVA 4CYUA 2WOMA 5M2RA 1CS4A 3MPVA 4NMLA 1YJ7A 3FRZA 4P74A 2DB1A 3G87A 1U4BA 1ACMB 2NXEA 2P2CB 4DFPA 5D77A 4F36A 4QIFA 3KJVA 4EEYA 1FRXA 2QSWA 4OLOA 4DSEA 4K4UA 4KGVB 1CJKA 2FLPA 1HNZF 5F3TA 2V34A 1S0MA 2R7SA 1FRMA 4MFBA 3CJSA 2YQ3A 3C15A 2GMJA 2UVRA 4C3LA 2C2ZB 1NK9A 2CRLA 3BV8A 1HL6A 3W66A 1QY7A 4LR7A 1N34F 1VHFA 3IAM9 4B08A 2Z2LA 4KRWA 4I69A 2M2BA 3X3UA 2FGOA 3CF5Q 5F8IA 2VBWA 2XSJB 3CMES 3LANA 1N5YB 2UUWA 1NDLA 3THVA 2NCKL 2JDJA 1S6PB 2RMLA 1JLBB 4I1TA 2R2SA 2IVYA 4ED2A 5B0FA 3HVAA 5KFBA 4FYYB 3E2EA 3NS7B 5D0RA 2IAJB 4QPXA 4MMOA 2B4UA 2LEPA 3HZGA 3KJNB 2KT3A 3KLVA 3MEGB 2E9ZA 3K5OA 2UUTA 4U8VA 3KWMA 5D3GB 1NH8A 1JNRB 1Q1KA 1UW9A 2RKIA 3B4MA 4RU9A 2W8LA 4ZVEA 3GTYX 3KJFB 4NLDA 3NKYA 2Q43A 4NA1A 2HLTA 2QA4S 1E6YA 2LQ9A 2MPUA 1RT7A 3LP0B 2QIFA 1QTNB 1U02A 4CLYA 1S57A 2XNQA 1FXLA 4DLGA 2CQ1A 3AD8C 3AFGA 3W2WA 2YNFA 3H90A 4DL3A 4URQU 3EMTA 4FF3A 1W2BR 1S99A 4KO0B 3T5HA 2VQEF 1JB0C 2OGUA 2CQBA 2FPHX 4OMFG 2V50A 4FDFA 5IS2A 2OPQB 3PR4A 4M5MA 2D9OA 1K47A 4LRCA 5GADU 4MAKA 4LF4F 3BGOP 3QLHB 3T1HJ 2ATLA 3P5TL 5D78A 2OD4A 5K8PA 5C25B 3M30A 2ATCB 1UEVA 2F9DA 3D3CJ 3DDNA 3R6GB 5A6PA 2GS8A 4OI0A 4ZPCA 2QLXA 1FI4A 1WC3A 1HNXJ 1OQ6A 2R7QA 4ZK7M 3M6UA 4OL8A 2CFXA 3K58A 2M88A 3IFEA 4J9RA 3MCNA 2NUHA 2MJUA 3GCWP 2DHXA 2ZITA 2WAQD 2VFUA 1QSYA 1AUSL 3GJSB 3DM2B 3HX9A 3W62A 1C1BB 1VQYA 1IBKF 3K5MA 2W4CA 4IUFA 1OY6A 1ICEB 3OL7A 3N0VA 2DGOA 1TUVA 3DMJB 2VQFF 3DFEA 4QOTA 4DUZJ 1TV6B 3JQKA 4YB1P 2RVJA 2GGPA 2GO8A 3C16A 1X4AA 1RI7A 1IM6A 4F67A 4NXMF 3QRPA 1G3OA 3N4WA 3H0PA 1RT2B 5HBMA 1EETB 4QBUA 4IG3B 2R2UA 1U1QA 4ID5B 3ET6B 1R89A 1N0VC 3V81B 1NK7A 1QJHA 3H40A 5EHHA 5AJ3F 3DLBA 2LA4A 2FZGB 4EBEA 2CPYA 5I3UB 1W25A 5IT4A 4K0KJ 4HEA9 4P2FA 2HNYB 2UU9F 4TU8A 4A46A 1HNWJ 1N5TA 1S97A 3HF5A 1NK4A 3BDPA 3W8GA 1XNQJ 3N9UC 4U96A 1ZM4A 1BXNA 3JB9k 3M4XA 2HBZB 4Y34A 3GE9A 2XWYA 4C8KA 1HIYA 3IWNC 3PFEA 3HHLB 3KOAA 3EPIA 2KFYA 3M8SA 3W3SA 4C0OC 1ZAXA 2YH0A 4J9LA 3B78A 5IQ6A 2QGFB 2PE8A 1UWBB 4F3MA 3GFYA 4GKJF 1HBUA 1VJWA 1C2PA 1NMEB 5K8MA 1FNOA 2QJ3A 2YWFA 4PUOA 2VBYA 3KTQA 3FFIA 2VDHA 2LXFA 2Q6BA 3LP2B 3EZ5A 3D9BA 4P2SA 4DL6A 3CIMA 2IRYA 3G8SA 5CYMA 4RW7B 3O3LA 2HVEA 3SMZA 1AFIA 4Q8FA 1NHKL 2F9JA 1JIHA 2G0CA 1Z4UA 2RU9A 4PXEA 4YFUA 4XPCA 5E7OB 3BQ1A 3CIZA 4PAAA 4KYZA 1O51A 3AXMA 9RUBA 4U7UK 3CDWA 1SV5A 2L9WA 5ETNA 5SUHA 3T9ZA 2NS1B 2C3YA 2VV5A 2B9WA 4BLGA 1MN7A 3RBEA 3MEEA 4OI3A 3UR3C 1N4LA 2FDNA 3RJMB 4HH0A 3AQOA 4ZN3A 3G6ES 4E8UA 3RBXA 5KFXA 2L48A 2JWNA 3QO9A 5LMNF 2YKQA 4E98A 4M63A 1TP7A 2VD3A 2RQ4A 4DR4J 3H42A 4LF7J 3M2VA 2VFVA 5IWAF 1T9UA 4K2XA 4J91A 3PW5A 3DRRB 1UFKA 4GC6A 1U0HB 5L46A 3K0JA 2J6UA 3MM9A 4MK7A 5AT1B 4E2FB 1FWKA 1N0UA 4CH0S 2HZVA 5C24B 2OKQA 2AW0A 2E66A 2WW4A 1T9WA 4WZQA 1S4FA 2F5GA 5IM0A 4WFAQ 1L3TA 4FBUA 2FIUA 4UQTA 6AT1B 5MAOA 2JH3A 4DV5F 4HI2A 4K4ZA 3BS9A 5J1NA 2B43A 2FD2A 3FCWA 4A8YA 3VGTA 1B4SA 1RYRA 5LXRA 1WC6A 4N77A 2AYEA 1J5OA 2HVIA 7AT1B 1ITPA 2CQHA 4ZCLA 5RUBA 3PACA 1IKYB 3J81j 5E33A 4I2PA 1EARA 2EFVA 4NYOA 5M2PA 3C14B 4Q44A 1KVJA 2H4YB 2YBVA 2ABYA 3PIOQ 1QUPA 3JAMY 3HULA 1Y5IB 1N52B 2I5JB 3AOCA 1BLUA 4UT4A 1K0VA 2ZDOA 1YJNS 2UUCF 2BE7D 4USWA 2HHVA 4RW8A 3ENVA 1H72C 5T14A 2GVZA 4C8YA 5HJXA 2HGLA 3R1LA 5HP1B 3MGJA 3X1LB 2FZKB 1PBUA 2BVZA 1CLFA 4PXCA 4WKYA 1SPBP 2POKA 3H20A 2AEJA 1N88A 3TR5A 3C46A 4N47A 2Z2MA 3CVKA 1TMJA 1FKPA 2MZRA 5IT0A 5F8NA 1Q8IA 3BBCA 1UJ6A 2EI5A 2RB7A 3MCOA 3TNVA 2MQOA 1R6YA 1OPIA 1VK3A 3TZZA 4WJBA 1KVIA 3MD1A 4QJVA 2DNLA 2VKZG 1MG7A 1UPPA 2EKNA 2UV8A 4OHVA 4IRCA 2KYZA 3Q23A 5HMZA 2C2OB 4DL4A 4EO6A 1KN6A 2WONA 2CPDA 3Q24A 1TKXA 4FN5A 4LR8A 3D67A 2I1RA 2J7KA 4CLKA 5DGAA 5KT7A 2IM2A 3I82A 1ZS6A 3G71S 2MHEA 4FXDA 2CVIA 2DO4A 1PC5A 4JP8A 3PJ9A 2MXYA 2ZOMA 3KHHA 4OZ2A 4PWWA 2YKNB 1XR7A 3QT6A 2DRDA 5KFVA 1N6QA 2NR0A 1U45A 1MWYA 3GV7B 1G6BA 1TFWA 3LP1B 2ZEJA 2E1MC 2UXCJ 1FXRA 1C0TB 4QR2A 4NWBA 1Q81T 3BDEA 4NCBA 2QT7A 5L1JA 1CC7A 4QYZJ 4RNFA 2VUGA 2RIJA 4I56A 4WFXA 4J9KA 5DGBA 4IDKB 4IFVA 3RW7A 1O6XA 1HBOB 9ATCB 3MUVP 5D4OA 4J7CA 1EJ7L 4YB5A 2J0SD 3NBPA 1NUEA 3Q89A 4ALZA 2MKJA 2E7VA 3R5JB 5F0UA 3EZUA 1H2VZ 3BKUA 4LQ9A 2MQQA 5IT9U 4PG4A 1JXEA 1RJJA 2MHNA 1S6QB 1HARA 3BH6B 4LSNB 2J6SA 1GMUA 3FEYB 4WE1A 3MMBA 4KFBB 4QIGA 3NS5A 1LWFB 1S1TB 2PDAA 1TL1A 4A47A 1PO6A 2DY1A 3GYGA 3T19A 1R0AA 5IC6B 2V2ZA 1NDPA 2OIHA 4I7FA 3T41A 1LWXA 4DQRA 2HNDA 3CWJA 1IKWA 2H9ZA 2HNZA 5LM7E 4UW2A 4E0DA 1UEUA 2L3MA 2VG7B 3D4JA 1U1PA 4RO0A 1U8SA 1FDNA 3CJTA 2HGNA 3FSYA 2B4OA 2DH8A 1K8AT 4N7TA 4JV5J 4DCPB 1YG0A 2ZFHA 1FWLA 2Q6CA 1N33F 4HVZA 3DCAA 1DZ5A 3FZ2A 1F5BA 5A0YA 2ZM6F 1FDDA 5EWFA 1XWLA 1RBOB 3W9IA 2VH7A 1RT5B 1IM4A 3HHEA 2G2YA 4ELUA 4OX7A 2I9SA 3ZTSA 3OVAA 3CJ3A 3FSIA 2HMIB 1IQZA 3NCRA 4B9NA 3PYDA 2OH2A 3JQJA 1M5PC 4P75A 5LMUJ 1F60B 3TA2A 2YKMA 4DZDA 3LAMA 1PGZA 3BQ2A 5ETLA 1JLCA 4ED5A 1PJ7A 2B9XA 1WHWA 1OSDA 4KV8B 3U02A 1DTTA 2W9BA 3A13A 2BXJA 4CI0B 3HHLD 3TARA 1FO1A 1LK7A 1Q78A 3UD3P 3ILJA 3R5CA 3VVTA 2ZJQQ 2MLYA 2AJ2A 4TXSA 4CT9A 4LFCJ 1YBAA 3CO9A 3MTJA 2IJRA 1QVFR 2P9CA 1DTQB 3Q2TC 2ZD1A 2DKOB 3DLJA 2XWXA 1RZMA 1GNKA 2E7XA 2W7PA 2AIRB 2ZH1A 4P9SA 4DFKA 3MEDA 1KS2A 1VS3A 3P45B 4DV2F 1X5TA 4L75A 1FX2A 1NXIA 1N8RT 5A2QU 4WU2A 1JJCB 5BXIA 4WP9A 3IRXB 4X4TA 2ZDPA 2KM8B 1K73T 3KLFB 3EPGA 5G0RB 1VBZA 1F9FA 3BYRA 2CUYA 1FHTA 2RRBA 4G1QA 5HVGA 3CCVS 3EGWB 1U2RA 1TUWA 2PGCA 3JYTB 1FEHA 4TN2A 2HHTA 3G4SS 5CCMA 3AHPA 4ED6A 5K14A 4IOCQ 2R7XA 4QZVB 2LDIA 2V4JB 2VICA 2DXDA 1MW7A 1RTIB 1B0VA 5KAKA 5BR8J 2ROPA 4WXWA 1HPZA 3TVYA 3QIPA 3I56S 1XMQF 4DR7F 2Y1IA 1FEEA 2AJ4A 1BD6A 5DG9A 3S1TA 2V2KA 4O3NA 1S1XB 2SXLA 2CPEA 1QDUB 3H5SA 1KP6A 2YH1A 2Z4PA 1RWWB 1D0EA 4CM2A 2L41A 2Y8WA 5HI7A 2ZH8A 2L08A 2MZ1A 1SJQA 3D68A 3MEKA 4ANCA 1IKVA 2XHCA 5FDLA 3I5BA 4F50A 3MM5B 2FY1A 5IV4A 5KT6A 4OZ1A 3A8KA 3CJ8A 3ZZUA 4JV1A 2KFNA 3MURP 4NCAA 4TY9A 4PWUA 2ZUGA 4NX9A 1U2FA 2R4FA 3GLJA 4Z2XA 5T41A 1C0UB 3QAEA 2H4WB 4BHQA 4H4MB 5LL6d 1UMJA 2JZ5A 5DDPC 4DV1F 4P73A 1CVJA 4M5DA 4Y2MA 3KNGA 4YMEA 3K59A 4BS2A 1XR6A 4CTAB 2EFNA 3HSJA 4KJIA 3GIIA 2AV5A 2BW7A 5MLCV 2MJNA 4KHRA 4KH1B 1KFDA 3R5AA 3QNWB 2GVDA 1F9HA 2UUAJ 1WI6A 3OL8A 4JBCA 4IG0A 3MPUB 3IGNA 1FFGB 2HPUA 2OTJS 2C42A 3BKFA 2ZJPQ 1FRIA 4MIAA 3RB3A 2DPJA 3H7HB 2XS7A 2YX1A 5I42A 2H5JB 3LO3A 1YITS 1RWKB 3HCXA 4MIWA 3UD5A 2IYIA 1VRTB 1UJ5A 4NL5A 1X4BA 3OUYA 3OLAA 3TAMA 4YUDA 2ZH4A 4ILLA 3D66A 2H65B 1MU2B 2HWTA 2IM1A 2XO6A 3IS9A 4H54A 1WTBA 5CABA 4B3MJ 3FC9A 2XY5A 1NJZA 1X7VA 2DBBA 3UN5A 3PZPA 3OW2R 4OYZA 1F1BB 2AGOA 1U48A 1X9SA 2HBYB 1UVIA 3VAKA 5T7LB 3TYTA 1U2CA 4WBFA 3CCUS 2C2RA 2FQQB 2GO9A 2DNQA 1HNIB 3TJ8A 4UOHA 5KFJA 5CYJA 4XPEA 1SIWB 4EYIB 1KTQA 1UAWA 3PM9A 3DRXA 1HWJA 3R97A 5L9NA 1VQOS 1LXNA 2XZTB 1KRPA 4P2MA 2E1PA 2ASDA 3LWMA 2FZCB 1NO8A 5CD4H 4LF7F 4JI6J 2HIQA 3BGLA 2NXNA 3LUYA 2J9DE 3F0NA 3PJWA 4TYAA 2K06A 2Q3PA 1QM9A 3LGMA 1ZOTA 2I6WA 2QFJA 4DFMA 2C2NA 3JSYA 5KFQA 4AL6A 4X4PA 4MYUA 2CQ0A 4CLWA 2VKRA 1I5OB 4I0WA 2NXCA 4QR0A 2BX6A 3EXCX 3N5FA 3U1MA 4IRDA 1FA0A 4RW6B 2JVRA 2QYGA 4CO2A 1NHVA 2PD1A 3LTOA 1V3ZA 2DGVA 4H4OB 1Y9OA 1DHMA 2AEFA 4LSLB 4IH5A 5C2CA 1WSVA 4EU0A 4Z37A 2HW3A 2Y0BB 5A2QY 2XSFA 4LVNP 4NCGB 1GMWA 4ZDNA 3EX7B 1FDBA 1R7IA 1BY9A 4AL5A 1X5SA 3BSCA 2FVSA 3DI6A 2QLFB 5KG3A 2ZBRA 4C0BA 2ILYA 5GMDA 1K1QA 4IH6A 3NG8A 5KG7A 2FJVA 4G1IA 5U47A 4X4NA 3KDOA 4IH7A 4Q0BB 3NMAA 2YVSA 3GIKA 3QWPA 2UUBJ 1S1WA 4KSEB 1HKAA 4RBUA 2V8VA 5IV3A 3E01B 4CWBA 3KHLA 2IVMA 3P96A 4DLEA 4JUZA 2KRBA 2J7UA 5ETTA 3L95X 1LXJA 1CJUB 2ACMA 2P5VA 3G8QA 1VQ7S 1CS4B 1KLNA 1Y10A 1VQLS 1V5IB 1N32J 3T9NA 1NK5A 5E3QA 5CAAA 1QSLA 2HQ3A 1UVMA 1GXTA 3BO3A 3HSZA 3HK2A 1T3OA 3QYYA 3ZZOA 2AHOB 3KJVB 3BBBA 5K5MA 2GQCA 2DEIA 3RRGA 1S9FA 3PVXA 1KFSA 4J9VA 5AE3A 1CJVA 4NLPA 2VG5A 1CJKB 4MK8A 4Y3CA 3DRSA 2LFVA 3AH6A 2OELA 1JMTA 2KN4A 3LPYA 2CPJA 2CQGA 3D28A 4MFBB 3CCZA 3C15B 3QQCD 5KFCA 2MKKA 3CDAA 3WBZA 3JSBA 3QJPA 1B7YB 3MECA 3BN4A 2FVPA 5HSPA 1P1TA 1ZA1B 2YPZA 1R31A 3HI9A 1Q8LA 1X0FA 2CYYA 3D7SB 2YNGA 3F73A 1FNMA 2UXBF 4DV3J 4EGLA 1VQNS 3KHGA 1RAJA 2M8HA 2DD8S 2VJUA 5ADZA 1C4AA 4WFNQ 2WVBA 4X66F 4EUVA 1RTDA 4I6WA 3W60A 3QZ8A 3PHTA 4FZVA 3QIDA 2DT9A 4TVAB 1MN9A 1FXDA 1BQXA 4HDHA 1V3RA 1VGYA 2W4PA 2X1GA 2FB0A 1V3SA 3N5BA 4CO3A 4QWCA 2BQ3A 1R27B 2IPOB 4J37A 5B0AA 3CT9A 1D9AA 1LW2A 2VF3A 2YX4A 3VAMA 2HQDA 4RUCA 1FFWB 1RHKB 5EN1A 3K57A 2PI5A 2E44A 2FVRA 2O66A 4DQSA 3MD3A 5B0BA 2YWGA 5JMNA 2M9KA 3CE8A 2RKIB 2J5AA 4KAIA 1UVLA 1URRA 3W2VA 3FBCA 2FJAB 4KE5A 4PWDA 3HP6A 4TLQA 4DV0J 2KJVA 3Q83A 1E6YB 4OI1A 2QL7B 4U95A 1TZ0A 2NXJA 3ZFVA 3W2WB 1PSDA 3MPWA 3A4TA 4HHHA 1I3OB 2RRNA 1I94J 2BBEA 1BMQB 3AD7C 4OV1A 1KQKA 4PG7A 1XNRF 4FF1A 1XMBA 1T03A 4KHPF 3CJ0A 4QIVA 3M30B 3CCMS 1OWXA 4WTYA 4NZ0A 4AXJA 4W4MA 2HBRB 4J9QA 4IR9A 4MKBA 2ZHAA 3BZQA 2E1AA 3M6VA 4EWTA 3RRKA 3LOUA 4K4YA 4GKKJ 2OFHX 4OV6A 1TKTA 4PABA 4NLXA 1O8BA 3KUGA 3GU0A 1TK0A 3DOMA 3R7SB 2DGUA 4K4TA 2XMMA 1X8DA 4CO0A 2NXUA 4K4WA 2KFZA 4O3QA 3T1AA 4F4KA 1YDLA 4UOGA 1T05A 4ZPVR 5KFHA 3TX8A 3I87A 1OIAA 2WVDA 4WF9Q 3IO1A 4JI4F 1UP1A 3RRHA 5DJBA 4ZHRA 2HHHJ 2GGPB 3FK4A 3C16B 2NZ4A 4ZPDA 6FDRA 1QLNA 1J5EF 3V6HA 1CC8A 2M8DB 2RUGA 3HKWA 2R2TA 1TL7A 3GG1A 5HBMB 1VQ4S 3D1QA 2DNPA 2OEKA 2XC9A 3K5LA 3VQTA 3M8YA 5CYQA 3AAWB 1H38A 2BABA 2D9PA 1SBRA 4U67Q 2HRUA 1X4CA 1NK8A 1NKBA 3MFHA 1ZPWX 3RB6A 4LQ3A 4ES1A 4B3TF 5D6GA 3VR1A 3QWUA 1TL4A 4O4GA 3VHQA 4OYIA 3PG9A 4ZVQB 1RT4A 1WEXA 2CIMA 4RUBA 3BO2A 1AB8A 1J27A 3UDCA 1TAQA 1KDNA 1NNDA 1HNZJ 2WSFC 4XDCA 5HL7Q 3OTOF 1KHWA 2M3DA 1NJIT 2CWKA 4PXBA 5BYRA 2PFFB 2ZZNA 2RS2A 3RR7A 4YN3B 4Y28C 4DUYF 3DXSX 1N34J 2MQLA 3VAIA 1U49A 4Q8EA 3SDEA 2CXEA 4NI2A 3K17A 3OJSA 1OS5A 4PPDA 2LXUA 2BOAA 5H9EJ 5HANA 1D8ZA 4WFYA 4PUOB 2EFOA 2A3JA 2C2EA 4ICLA 2ZH5A 5CYMB 3R2CJ 3SCKE 3HJFA 3T6JA 1NPRA 1MLAA 2Y1RI 1OO0B 4LF9F 2MKYA 2DCLA 3V6DA 5KTQA 4O3OA 4CZCA 3K5NA 1TK8A 1FK9A 1RAEB 4FF4A 3DN9A 3GZ7A 2J9CA 2WB4A 4ZVUB 3VQSA 2BJ9A 5EWEA 1XQIA 4C6AA 1S48A 2AYMA 3Q86A 3PRBA 2VG6A 1T7PA 2HS4A 2WVEA 2FGCA 1VQMS 4BDPA 2XB2D 4ED7A 4L74A 3QO9B 3BYPA 1TVRA 4NYPA 2XYGB 4PPZA 5ETRA 2EEYA 3SV4A 2G2OA 3QGIA 4NLOA 4CLPA 2VODA 2W2PP 2QSFA 1CULA 4ZITA 3M2VB 2YXLA 5JUMA 3I0RA 3CC4S 4K5RA 1PKUA 5ETKA 4C11A 3VTIA 1UVKA 3DOLA 2VQEJ 1H2UX 1RTZA 3MM9B 1P6TA 2JVOA 1S9EB 2HSEB 2KZMA 4KPCA 3O5TB 4LF5F 4QCLA 2QN6B 1QAIA 4LF4J 3SCIE 3DLGA 5KT4A 4ZP9A 4RW9A 2MSTA 5IM0B 3DC2A 4KB7A 3O2IA 1BHNA 1UL3A 3OR1A 2BUNA 3QT8A 3WQPA 4B3RF 1RHUB 1FVQA 4UZCA 5KT3A 3HD2A 1RT3A 1IUJA 2DNNA 2ZHBA 2UVVA 4KGZB 2GJIA 4OHWA 1OY8A 3UDLA 7FDRA 2CQPA 1J5OB 2CNNB 4GVBA 5J2QB 3NRBA 4R0EA 1VISA 1N36F 4UUWA 4NEZA 4N76A 3H2VE 4B9UA 2Z8QA 1IBKJ 2MKIA 1BWEA 4I2PB 1DURA 1RWMB 1U7LA 1VQ6S 2VQFJ 4ZVFA 2HGMA 2W7AA 3UQSA 3W5XA 1VC5A 1GQEA 2OMOA 2YNIA 2QG9B 4B3MF 4K4XA 3CNQP 2EWHA 4RW8B 3R7BB 4NXMJ 3QJLA 1ZM3A 3KMQA 4HACA 5LSOA 2RJZA 1HMVA 1RADB 5ETMA 1WWHA 4UQGA 2GVZB 4C2MA 2KVIA 1HA1A 3PO5A 3PX4A 3I5CA 1HI0P 2VOPA 2U2FA 1DARA 2W7OA 3ICLA 2MTLA 2YKAA 1WTFA 4PYAA 3KLGB 3H25A 3SEOA 2HVHA 3I4HX 4DR1F 4WFBQ 2UU9J 3CEDA 1PYSB 1S9GA 2FY8A 3I32A 3I5AA 5M2UA 2FLLA 2I38A 4K4SA 4B9MA 5HATA 5A8KA 1XEZA 3MAHA 1UETA 4NLUA 1VHIA 1F2GA 1GH8A 1Q86T 5K8OA 3TJ9A 4YY3F 2V94A 3FKBA 2Q66A 1YJUA 2WONB 3GYXB 3G9CA 1TKXB 4F2SA 4HDGA 3W63A 4JI2F 3MR2A 2IY5B 4GRSA 4CO5A 5KG1A 4GKJJ 1R6VA 1U47A 2QA2A 3THTA 3LGNA 4RNNA 1SKUB 3SV3A 3ENAA 4C0HA 4ZIVA 1U09A 1QAYA 2MKSA 4ZVOB 1BQMB 1KOHA 3ZTOA 1Y3KA 4X62J 1EAYC 4DS4A 1YZ6A 1FX4A 2IBOA 3SQGB 1K1SA 2LP4A 2JLFA 3FEXB 1QAXA 3J7YU 4OI4A 4Q2MA 4ZPWR 4DXLA 4DX6A 2XMJA 2LVWA 1VQ5S 3M9OB 1YRTA 4IFVB 1IJEB 2LU2A 1IN0A 3L7PA 1XBWA 3NBPB 1WNEA 4ZVTB 1RU2A 2DR6A 4OHYA 1FDAA 3ILOA 4ETZA 1JLBA 1S7IA 1SC4B 4W98A 5LMNJ 1OSCA 5A8WA 3G82A 5GAHI 1R0CB 3D2WA 4O3RA 4NLVA 4WE1B 2KH9A 1N48A 3MMBB 3ZZRA 4USUA 2IAJA 1TL1B 5IWAJ 2R9LA 2L9DA 5L1KA 2XULA 4TU9A 3HVWA 1R0AB 4I7FB 1UZHA 2ASYA 2HNDB 1IKWB 1QE1A 4F8RA 2JFKA 5KOXA 5DS7A 2HFUA 5D3GA 1EZZB 1ZTWA 1ZAWA 2F8HA 3K2YA 2ZVSA 2GW8A 2P9EA 2HHUA 3FZBA 5G4DA 4ZP6A 1TUGB 3DHXA 2IC3A 1SJ3P 4AQYF 2CZ4A 2Y0SD 5CH7B 5LJ3Y 5HLFA 4J9PA 4DV5J 1SKSA 3NMRA 2VBXA 3CUNA 3MCSA 2ZZMA 5A0YB 2JFDA 1W2IA 1N5SA 4ZA1A 1U0SA 4KO0A 2I2YA 1RQ0A 3SCJE 4B9SA 2DHAA 1OYEA 3EGNA 4FP9A 5THWA 4DS5A 2DGXA 3ETMA 2U1AA 2A10A 2IRXA 3OFGA 3QLHA 1S49A 3W9HA 5F8HA 2GQQA 1DTTB 2W9BB 2UUCJ 2WSEC 2YWEA 2V8DA 3P8BB 4IFYA 1ZPVA 1WOPA 2B8PA 3CDUA 4C3MA 2RDDA 3W9JA 2OSQA 5E3RA 1NBEB 4ZLNA 2BDPA 3A3PB 3DU6A 1BWVA 3RTVA 1VR6A 1XMOF 4A8KA 1HQ2A 1G4CA 1RACB 2XZWA 3ISZA 3H59A 4BWMA 4CLSA 1C1BA 1M1HA 2ZD1B 2A6OA 2IIHA 2DCUB 1VC0A 1RK8A 5F8MA 2D3O1 3MEDB 3CCSS 1EP4A 3IC1A 1MROA 3T3FA 1SC1B 4A8QA 2YPYA 4GO5X 1BC6A 2OP5A 1GTEA 2BOPA 4ILMA 2MKHA 4YB7A 2NLWA 4JOUA 4NRUA 4DFJA 4F26A 1YJ9S 1VQSA 4FXVA 4HR2A 3BBFA 3MM8A 1B0PA 4G1QB 1EIYB 3PW2A 1RAAB 2GCFA 2HK3A 3RAMA 2HHWA 5I3UA 1ZM2A 3HHNB 2CJ9A 1NDKA 1KLMB 1CEZA 2B6AB 5DDRC 1YZ7A 4N41A 1WUUA 4I6AA 4N56A 5K14B 1Z2ZA 1JLEA 2FJWA 1TKDA 2QX0A 4XK8C 1T9YA 1RWNB 4HH1A 4URGA 1FRJA 4TY8A 1S76D 4ZN1A 2CPZA 4CT8A 2KG1A 4PKDB 5F8GA 4UZBA 4QWEA 3JSMB 4F25A 1HPZB 2G4BA 3N28A 3QIPB 1RHMB 1TMMA 1HBNA 4G65A 2MGZA 2NYHA 4QW9A 1HWUA 3U7JA 4C3KA 1B64A 1W7WA 3R1HA 3C8YA 2UXDF 3NAHA 5B0EA 3UR0A 1IKVB 1CQMA 2HK2A 3J7A1 4ZJLA 5GAEU 1RGVA 5FDLB 2V2VA 2XY7A 4DEZA 2PN6A 1F2HA 2F63A 2ROGA 1JQGA 4K7QA 1BE4A 3KK1B 4ID8A 3MDFA 3MR6A 1P8GA 3I55S 1UFWA 1NSQA 2OPSA 1R0BG 2XCAA 4M5DB 1LW0A 2WRMA 2W01A 3M8PB 3TJAA 2JHEA 3TEHB 3TO8A 1YI2S 2O01C 1JLFA 2PFDA 3UNGC 3L7OA 3WC2A 3MPYA 3D3BJ 3HXMA 4FYXB 4WIQA 2C2KB 4PG5A 4BCAA 1S59A 3NGSA 2J76E 5ETQA 4FVCA 4NLTA 1N33J 2HFNA 4IG0B 3B8HA 5DG8A 4MKYA 2KZZA 2VC0A 3VV2B 2ZM6J 1B0TA 1FKOA 2GMHA 2GHPA 1NJXA 4KC5A 2HEKA 4RKUC 1SJRA 3MXHP 2QMUB 3Q22A 4HTIA 3OUYB 2RF2A 2YQ0A 4IQMA 4ZVGA 4RWWA 3TAMB 3AJDA 4NLRA 5DQIA 1LK5A 2DNGA 3UW1A 4CLUA 3IS9B 4B3SF 1M5SA 2B9YA 2W2QP 1AXQA 2D3UA 2KJWA 4ZLJA 1DFDA 1HNVA 2H48B 3OTDA 2E7WA 4DF4A 2KRRA 2IA6A 4M5HA 1SQGA 3LH2S 5HO4A 2DXFA 3CTRA 5DRKA 4P7VA 1PG5B 4ANEA 1RKIA 3SSSA 4RPFA 2R8HA 3RAXA 2RHQB 3SCLE 5J1EA 2EFPA 2VPZB 3E51A 2WBMA 1SIZA 3O6QA 3RBZA 4DV2J 2CWXA 3MCMA 2PA3A 5B0CA 2MQPA 1HBMA 2MY7A 3GYNA 4FYDA 3MUTP 1IJFB 4R8UA 5KFOA 4JI3F 2A18A 3D6FB 4O3SA 1TL3A 1U1NA 1Q5VA 4DX8H 3I9V9 1IVZA 2F4VJ 3AB2B 2J9EA 2DNYA 4LUBA 4ELVA 3GP9A 1FTRA 3IWXA 3WX8A 3ZZTA 5HMYA 3J81U 4TLRA 5CCLA 3HJVA 5J2NA 4C8LA 3G6XA 1Y5NB 3F44A 1YJWS 3ZTPA 5C2GA 1OYDA 2FJBB 3TVKA 3TAPA 1YIJS 2OUGA 1WKLA 1MMDA 1YRUA 4MJKA 1XMQJ 3RW6A 2PC6A 5DETA 4DR7J 4WCEQ 2JOQA 4DI6A 3CD0A 3IP0A 5GMEA 1ELOA 1Q4RA 4ZLLA 5DLGA 2R8KA 3BGRB 4RL1A 3Q0AA 3DI6B 5CQGA 3W8PA 4ECVA 2VFSA 1Y4ZB 3QMQA 1VQPS 2WSCC 3CD7A 2E9TA 1AA1B 5D4NA 2MDAA 1Y7PA 2YNHA 3FRYA 3MOJB 1A6LA 1HWIA 5KFPA 1SUQA 3HSDA 1S1WB 3ZZ0A 2EPIA 3OJUA 4Q45A 3BN7A 4G1PA 1W26A 1YBUA 3DRPA 1VOMA 3O44A 1QSSA 4CRJA 2FJXA 3EDQB 2R8IA 1SXLA 4LFAF 1C0TA 4ZVSB 4B02A 4M5JA 3H5XA 3M8QA 4DV1J 1LV5A 1RCXB 2N4DA 3OL6A 1RDRA 3IBFB 3RB4A 1UJ4A 2VJVA 5H9FJ 1HI1A 1IWGA 1NSKL 4CLZA 2IHR1 3DKDA 5LJ5Y 4RZRA 1CJVB 1Q8KA 2VG5B 5B0GA 1DQ9A 3HVTA 3DRSB 2AYGA 1KBRA 4XO0A 2KT5A 3UVJB 2Y1LB 2VFRA 3GJRB 4DX7A 4LSNA 2GZOA 1WC0A 4YS2A 3EJMA 1NZAA 3MECB 1SJFA 4OJHA 3HT0A 1C4CA 1FCAA 3HM9A 3S6EA 4DR5F 3HHKA 1FT8A 1KQGB 3MAAA 2AMCB 2Y8YA 4LF6F 3CJRA 4HYKA 2YNGB 1SCJB 2QC3A 1JXVA 4CLTA 2X51A 4JI7F 4P71A 5L39A 5JVGQ 1RTDB 1QVGR 1Q8BA 4DR3F 1FJGJ 4X62F 1WDDA 3SFGA 4ZCIA 1YGYA 2BW2A 2BKNA 1S1UA 4DV4F 5JJBA 3FGVA 3MM7A 3UDEA 2Y1JA 2ZKUA 1WG1A 3CCRS 1LW2B 2J8SA 3MR5A 3KUEA 2Q1LA 1GX6A 3TW0A 4FNHA 1IBLF 1U1MA 1Y5LB 2DY9A 3PY8A 4OJGA 4DPYA 2GC8A 1SC3B 3Q8VA 3HFKA 5DQHA 1BGXT 3GIJA 3W2VB 2C1EB 3P49B 3V5RA 4CLLA 1X9WA 1U8WA 4PR6A 1YJTA 2NPIA 1C1CB 2B4PA 1JKHB 4PQUA 1EHWA 1VIOA 5LSLA 2B8QA 4DSLA 1Q5YA 5EGYA 3KLIA 3DGPA 1OY9A 3KFWX 3OFFA 3BKTA 4P72A 2WVFA 3DDIA 4KHMA 4M8LA 4FS1A 1H73A 4EMDA 2K3IA 3OSPA 4KGXB 3D6MB 3QT5A 2C3MA 4WKRA 1DLOA 3A3OB 4L76A 3NWRA 1B7FA 1S79A 2MEWA 4KTQA 4OZ0A 4Q43A 1LQ9A 3TEGA 4NOHA 4PG8A 2F65A 3DOMB 4A4JA 1FTCA 1SJ1A 2GQ2A 2PEHA 3QT7A 2BE2B 3CJQA 2AJ1A 2CG8A 4CO4A 2OI2A 3M8ZA 5KFKA 3TANA 1T05B 2BANA 4OZJA 3NGDA 1SQEA 1URNA 1DQ8A 4AT1B 5DZ6A 4KBIA 2JEJA 4ZHRB 4CNYA 1IBMF 3QRRA 3J80U 3I9ZA 2HRYA 3J81Y 1DRZA 4WK3A 5CHCB 1WSRA 4LREA 1UCNA 1TL7B 1RT6A 3HLUA 1U1KA 3FQLA 3E3XA 3C19A 2QL5B 2O67A 4DQQA 1FF2A 2O5DA 1WHYA 2RQMA 3GJQB 5CYQB 2VPWB 3ISNC 1RWPB 4LIWA 1UKUA 5DO2A 5E3AA 2HWHA 5F9NA 3I0SA 4OYOA 1UPMB 1JJ2R 3C6UA 4M5LA 4DG1A 1D1UA 1D3WA 4O4GB 3ZXWA 3OTEA 2RDIA 4UOFA 1RT4B 1X4HA 4FXWA 3CO0P 3MM5A 4JI0F 4WFZA 4OJ3A 1SJ4P 4EFAC 2CJKA 3SQOP 4LBIA 4DR6F 3DYAA 1FJ7A 2PO4A 3H98A 5D0EA 1JLAA 4EZ6A 2UVWA 4R5PA 2E5IA 3SDEB 2OPPA 2NPFA 2ASLA 2HFZA 3KG0A 2HVDA 2B9EA 3CDEA 2AEMA 5DDOC 4I2QA 2N4CA 2OPRB 2QA4G 1KQSR 2MLZA 2UXBJ 2ZH7A 3T6BA 3OTCA 2ZH3A 2DK2A 1JLGA 4DQIA 1WEZA 5AXKA 2DH9A 3KLEA 3QATA 4X66J 3KG4A 2J0QD 2GA7A 1CJTA 2CPFA 2LQJA 2FHJA 3DLEA 2DGSA 2R7RA 3WZ0A 3CD5A 4ICLB 4KY3A 3JTOA 4RUAA 2M52A 2ZWPA 4WYWA 1NDCA 2GHWA 1SKRA 3T5LA 2JC1A 2ZVIA 2VBZA 3OFHA 5AXNA 4ED1A 1TU0B 1YWXA 4LBHA 5LT5A 1Y0HA 5A8RB 4X4SA 3FMBA 1FK9B 3H5YA 3OQ2A 1T0TV 4KKOB 3P4UB 4F0MA 4QPTA 4HTJA 4DDFA 2Z58B 2AJFE 4NASA 2AT1B 2HYIB 2P6TA 1RT1A 2MQ8A 3FDSA 3QJJA 3ZZZA 3PEJA 2VG6B 2XQCA 5HVFA 4ECUA 2E5GA 2BACA 3GR0A 4DSJA 2BYCA 3EWGA 2HHSA 4LRBA 4QYZK 4DQPA 4C9DA 3VVUA 2BKOA 2V69A 2VONA 2A6MA 1TK5A 1PC4A 1TVRB 1X0PA 3OHBA 3D5MA 3L3CA 1LWEA 1HFEL 1GMWD 3TOQA 4HI1A 1U6ZA 1VI7A 3CW2C 4JYAF 1CULB 1VRUA 4RR5A 3K89A 3I0RB 2G2ZA 4DCJB 4C11B 1V9OA 3DOLB 2V4QA 2BQUA 2N82B 2VZ9A 3LAKA 1N5QA 3MMAA 1RAGB 3EUNA 2DRBA 3QSYB 4F0KA 1XNRJ 3DLGB 4RW9B 5CZXA 2VC1A 4KHPJ 4X2BA 4QWDA 4P6QA 1FJCA 4LBPA 2V9WA 3OR1B 1JLQA 1AROP 4N8OA 3MI7X 4C8ZA 1SI9A 4TQRA 1IR2A 3BPDA 4WWSA 1HHSA 5A6WA 3UFCX 4QR1A 3SSRA 2PIIA 4HKQA 1RT3B 1AFJA 5B08A 4PG6A 1FRLA 4NZ6A 1X5OA 5FD1A 4QYRA 1VBKA 4DPUA 3H4BA 2VIHA 5E5NA 2OEMA 4URSA 1FD2A 2LYVA 2XLJA 5J2PA 5DQGA 4RW6A 5GADI 4JI4J 3AOBA 2ZE2A 1SL0A 3P6YC 4LF2A 1U1RA 1KSPA 4USVA 4HHJA 4MTPA 4H4OA 2YNIB 2HZAA 2BZ2A 5KT5A 1J5EJ 4ZVRB 4QU7A 3KK2A 4I68A 2FC9A 4ED3A 2B7CB 4HACB 1VQ8S 1HMVB 2CQIA 1RTJB 3I4PA 1UTAA 3NCQA 2CAJA 1H3DA 1TAUA 4I6YA 4NMXA 4MIBA 4UY8T 4Q5VA 2LA6A 2DGQA 1NEEA 4XTTA 2KG0A 1V6HA 4DR2F 4KIAA 1YTYA 3D0IE 4B3TJ 3TRGA 1RHRB 2Z30B 5KG2A 3MR7A 5DM7Q 1S6UA 3UWTA 3RGIA 3T5JA 4Q0BA 3MWBA 1P9YA 2RNEA 1S9GB 2ADBA 4AYBD 3A8EA 2VOOA 1XR5A 3DLKA 5HROB 3OSNA 3OTOJ 3KK3A 1PJ5A 5A8KB 2CDQA 4ANDA 1KR4A 2A2DA 1NSAA 3N6MA 3J80Y 4JI5F 1S0NA 2FTRA 3FNNA 1H6KX 2CNLB 2V8GA 4WIIA 2EBEA 3TQEA 4DUYJ 2F4VF 1GMVA 5AE2A 4O0NA 4QIWD 3IG1A 2DR5A 2D41A 1UZDA 5B0DA 3NXZA 1O0PA 1X9MA 1NJYA 2VPXB 3AOAA 2AYBA 1HQUA 4X65F 2QLWA 2AF6A 3QAUA 2H1YA 3CULA 4K4VA 3CC2S 1HYSA 2XMVA 4WZMA 3TZYA 1S0OA 4AUKA 3BR8A 4LSZB 3QFHA 4CH1A 4LF9J 1F5AA 1VIXA 4WP3A 2GMLA 1SH2A 4YR2A 3VAGA 1OMSA 5SZTA 2UV8G 2HURA 4CH7A 1DAXA 2EFQA 3IBWA 4Y2CA 2GHVC 3TP2A 5J2MB 4XDDA 5JXSA 1BQNB 4TQSA 2PSZA 3KG1A 4PZVA 2ZOGA 4LRDA 4YEAA 4OX9J 3BSOA 1U24A 3O8WA 1KEKA 1RCOB 5KG0A 4N8NA 1T3NA 2B3TB 3GMGA 4ZVPB 2C22A 3K8VA 1AZSA 1EB0A 3DLLQ 5A8WB 4DL5A 3G82B 3NGRA 2BEFA 2KXHA 3OXGA 1S4EA 1RWXB 4A8SA 5FLXU 3V4IA 2Z2ZA 5KG6A 2K1RA 2DGWA 4IR1A 2RE1A 5IZHA 5F3ZA 2OHDA 5LXYA 2QFIA 4IO1A 5BJRA 2H54B 1QE1B 2W9AA 4DX5A 2J0XA 4RLEA 1QD1A 3B4DA 3TX0A 4LF5J 4Q2LA 3Q8PB 3UNYA 4W90B 2QLJB 2JRSA 4NXNF 2IC3B 2BJ3A 5HLFB 5HK4A 1RHQB 5IT9Y 4B3RJ 2IDLA 1IKXA 5L9XA 3G96A 1HQEA 5EX3A 4JI8F 1FRHA 2JEIA 1REVB 5HQMA 3RB0A 4KGMA 2ZBCA 5D15A 3JAMU 4EO8A 1N36J 4USJC 3CJ2A 3WHIA 2MMYA 1RKJA 4RW4A 3K8WA 5K8NA 1M1GA 2O3DA 2DR9A 2DJWA 3PW4A 3BGUA 2WCXA 1NB7A 4EI2A 1HHQA 3PHEA 1FJGF 2FVCA 1VCTA 4ZPAA 3W61A 2W9CB 2QL9B 5KFRA 1APSA 2ADCA 3T1YF 2LU1A 2OAUA 2O1PA 1V5VA 3C6TB 2R42A 4IFYB 3QSIA 1NRKA 1KVKA 1DQAA 4A48A 3GFXA 4FS2A 3HZEA 2BJ8A 1XIQA 1ZAVA 2R7VA 3HFZB 3ULHA 8RUCA 2BQRA 2AJ0A 3NGKA 2EFGA 3PW0A 2ZBPA 3D1OA 4DR1J 1EP4B 1MROB 3PO4A 2DPIA 2RQKA 2V4RA 3GSIA 3ILLA 1ZBTA 2XM3A 2JLGA 2QV6A 3GPAA 3FBEA 2M4MA 3TAQA 3CCQS 3J7ZT 1X60A 3GV8B 2RQCA 2V8HA 4YY3J 1UFLA 3LQVA 3OVSA 4YHHF 2L9NA 3SZ2A 1PAUB 2PEBA 3MM8B 3WDOA 2VB6A 4DPXA 1CQNA 4JI2J 1U6BA 3MMJA 2XMWA 1TL5A 4IQXA 4KQZA 3PCOB 5F9LA 2UP1A 3GG0A 1Q7LB 1RE1B 1JLEB 1JJ4A 3NLCA 3Q8UA 2XS2A 2YY3A 3A12A 5AXLA 1K9MT 2XI2A 4TY8B 4M95A 1GX5A 4QWBA 1NHUA 4YP3A 3HHDA 4F04B 4X64F 1HBNB 4B9LA 2RAQA 2DYAA 1ZETA 2MGZB 3BPSP 3GR1A 2IFXA 2DIUA 3GQCA 2QMXA 1RXOB 3KYLA 3IM8A 2J9DA 1RB0A 4LJMA 5ETPA 5L1LA 2EC0A 2C3PA 4B3OA 4WPAA 2FHOB 4HHUA 3BF4A 4C8MA 1NAQA 5E3CA 4A8FA 4OZLA 1YHQS 2DVIA 2WK4A 2LLZA 2MZQA 3NCPA 3IWLA 3UD4P 3CCWA 3BM7A 1U1LA 2HS3A 3K7RA 1WG5A 1Y00A 2M7SA 4RBVA 4CYUB 2WOMB 2FC8A 3LWLA 4QW8A 2OPSB 4ZOSA 1GXUA 2OO4A 1SL2A 3UPFA 2K2PA 1E6VA 1LW0B 4ZPTR 2ZBIA 1JJHA 4OI2A 2V63A 5CXTA 5KFEA 2WTFA 1X4GA 1JLFB 3GIRA 1GK8A 2F3JA 3IBCB 4I4BA 3L4BC 4K59A 4OHZA 1TR0A 4F02A 1WDTA 2OMLA 4BC9A 3KHRA 2Y9HA 4AQYJ 3CCLS 1T9VA 1PJ6A 3LW5C 2XY6A 2N3OA 4C97A 3SYZA 2QMWA 1IQTA 3ZTRA 2X1AA 3N6LA 1FKOB 1RHJB 3BH7B 4DN9A 3KLHA 5GAGU 3D54A 3ITHA 2NYIA 2KB2A 4AXIA 2J7WA 1S9EA 1PYTA 3OR2A 2EXUA 5KFAA 3QGHA 3PXGa 5FLXY 4J9SA 3NOCA 4X4OA 2RF2B 4DWIA 4IO9Q 1OPZA 2RSQA 1EKRA 2XZDB 2V8PA 4ERDA 3THPA 3I31A 3TWZA 2F8EX 4NLWA 2R7TA 3EGVA 2J8AA 1D8YA 1RBLA 1WHXA 5GVQA 1DBDA 3CPWR 5C5JA 1IBCB 1HNVB 3PTWA 4AD6A 3KNAA 2HLUA 1XMOJ 3M1VA 5E3PA 1XC9A 2P9GA 3Q8YA 1NK0A 5J2QA 2YTCA 1M5OC 3OVBA 1RA7A 2RS8A 1TKZA 3M2RA 1FERA 1R8AA 4LT6A 3SBMA 4FYWB 1WOOA 1WF1A 5KFZA 5C42A 1EX8A 2WBRA 4O44A 5HN0A 3W64A 3H5UA 5J1EB 4OQJA 2FLOA 4USKA 2ZHOA 3WIUA 3CCJS 2LQ5A 5HQ8A 1PILA 1HBMB 2VA2A 1RT7B 1VRQC 2D1CA 4KGKA 2YWHA 1I51B 3N01A 1T9TA 4R8UB 4Y65A 2YNFB 2IJNA 2WW8A 4IRKA 2R2RA 1FD8A 1TL3B 1PYOB 5E2QA 4A8WA 5A76A 1AW0A 4NLSA 2E29A 1L3SA 1J2VA 1RBAA 4OZNA 2H51B 1RP5A 3KLGA 1DY3A 2ZWOA 3DGVA 5J2NB 4J9NA 3IR5B 4LFBF 4PEOA 2HAFA 4IOAQ 1KNZA 3M6WA 2RDJA 4B17A 2ZNZA 3EVOA 2ACYA 1FKAF 4U7UD 1EQ0A 4DL0C 4DPWA 3C2PA 2H5IB 2YX7A 2V0NA 2YKOA 4WU3A 2AZ3A 2ZH6A 2D3ZA 2XGPA 2XMKA 2AX0A 3GFZA 1YKWA 3RUBL 2XCPA 1F3FA 2AQ4A 4ES2A 1Y3JA 5ETVA 2XMAA 4DV7F 2UXDJ 4CLFA 1GAOA 3ADAC 4XIUA 1NLKL 3ELHA 1HD1A 3PEHA 2YNHB 3PYFA 2ZKTA 3EDRB 1SUQB 3BSNA 3OPKA 2CJQA 1BQMA 2EBGA 3DRPB 3R8YA 2WHOA 2G1HA 3SQGA 5CA5A 1F9EB 4F7VA 4DPTA 1A7GE 1IWAA 2ERRA 3PYGA 2HQGA 3M8QB 5KG5A 3WIVA 1YVFA 1YLXA 3I96A 1TFYA 2NUUG 4EYHB 2V68A 2E5HA 1LKZA 2AKWB 4DJBA 1YBTA 2E5LJ 4F3QA 2M0GB 4DV6F 1FJEB 3HVTB 3OTBA 2HFSA 4FPIA 3W65A 3MF5A 1WG4A 4BBYA 4RNOA 2FJEB 4HL9A 4V19X 5J1PA 3FVYA 1KHVA 4OZ5A 3CJKA 4DN0A 2PMHA 3W5ZA 5FIIA 5IQQA 4CNZA 3OXLA 1BUXA 3MAAB 1LWCA 2QLBB 1HBUB 1RAOA 2M5YA 2Y3YA 4IKAA 3GCXP 3MM6A 2G13A 1WORA 3FFIB 1IXKA 3EVMA 3POTA 4FVMA 4RX6A 1YK9A 1HR0J 4NRTA 1MWZA 3TUJC 3W5YA 3GIMA 4B3SJ 2KVQE 2LMIA 3MHYA 3BEGB 3TZXA 1FRKA 2QA1A 1N56A 1HD0A 3IM9A 5H9EK 1S1UB 1D9DA 3MM7B 4HT7A 1ZZFA 3IR7B 5E0OA 3BJYA 1UA1A 1SV5B 3MTKA 1RAIB 1FE4A 1X4EA 1WF0A 2MKCA 1I6JA 3M2UA 3CDBA 3G86A 2J0WA 3ZTQA 3UCUP 3HO1A 4OX9F 3MEEB 2X1FA 1RTHA 4DBQA 3EE3A 1VYAA 2A1BA 4L73A 1HW8A 3B54A 5KOWA 4N5SA 5BYQA 2V6AA 3PFOA 4K2JA 3HVRA 1XJWB 4FF2A 2XLKA 2XNRA 4LRFA 2HAIA 3NGUA 3AODA 2DITA 2QEXS 4PQUB 2LQBA 3QPIA 1EKSA 2F40A 3C66A 2KO1A 4JI3J 3KLIB 2KHCA 3DGPB 3EYZA 4O23A 1XERA 4U7CA 4M5KA 4MH8A 1TQLA 2FLNA 4AE5A 3PNIA 1R43A 2KL8A 2JEGA 1R3NA 1X4DA 2N7YA 2HRTA 2FHMA 1YX2A 2LEBA 1U6FA 1DLOB 4F4ZA 4EZ9A 2J6TA 3MMCA 3AB4B 2COLA 1NPKA 3SI8A 1QAJA 4G6VB 3QFWA 2DXEA 1R8HA 3OV7A 4WP8A 3CSKA 3C3LA 1S6OA 2BJDA 4ER8A 4LR9A 5ITHA 3HPOA 3DOKA 1G1XA 1H74A 2F1FA 3G6VA 1AT1B 4JI1J 1OJ4A 4YOEA 4O4RA 3V6KA 1KLMA 3IR6B 5F0WA 3VAHA 4JB8B 2B6AA 4UUXA 3T1HF 2BANB 2CZVC 3U27A 4HLBA 1Q0NA 3OHAA 4F4AA 2GIQA 1SH0A 2Z57B 1HNXF 3P5BP 3FCHA 2B5JA 3JTNA 2DHHA 4ECRA 4MK9A 2G9OA 4P10A 3JSMA 1RT6B 4Z7CA 4LFAJ 2R3VA 3M32A 1L5UA 4B9TA 4QWAA 4ZJOA 1VFJA 4USIA 3ETOA 1M0SA 3F56A 2AX1A 2CZ9A 3PKMA 4ZVHA 3FSXA 5L8RC 3I0SB 4CCHA 1FKPB 4USTA 4XAKA 3MZIA 2HHQA 3C6UB 3EZOA 2KU7A 1S1VA 4DG1B 4DUZF 3D0GE 1A9NB 4Y2AA 2ZZTA 1HI8A 1UVJA 2HBQB 3KK1A 4ED8A 3DYAB 1ZTTA 2XGQA 2GV1A 1KKHA 2FYXA 2ILZA 4NPOA 2V67A 3JSRA 1JLAB 3R5BA 4UY85 2N3LA 3GWCA 2QRRA 3KMSA 4DU7A 4R5PB 4DR5J 3FJ2A 2OPPB 4K0KF 2GJFA 1GEHA 5KFSA 1JK9B 3M8PA 3PRDA 4LF6J 1ULRA 4OYXA 1ZYQA 4I2QB 3M9MB 1KTVA 3JTPA 4JI7J 3LALA 3CB4A 3RZAA 3H2UB 1HNWF 1JLGB 1VJQA 2K8GA 1VBXA 3KLEB 3AJ2A 2OD6A 1KOOA 2JC0A 4PCQA 1CJTB 2EW9A 2GIFA 3DLEB 4UF4A 3O1LA 4OX8A 2ZBQA 3PW7A 4X84A 1XNQF 3CJ5A 4DR3J 4OIXA 1N6QB 4YQWA 5E41A 2CPXA 2EK1A 1JX4A 3OBIA 4DV4J 2K7KA 4ZLPA 2XMUA 5KFWA 4ZCMA 4FBTA 5F8LA 1RLCL 3FBBA 4PXDA 4W92B 3UO0A 3IA0A 1GFWB 1PCAA 1SH3A 3NY0A 2XSJA 4ENOA 1NK6A 1N5YA 2E1RA 3HMJG 4YB6A 1RT1B 5GAGI 1IBLJ 4PYDA 2CQCA 1HWKA 3JQMA 5D0GA 1S6PA 2HKEA 2GNKA 2CQ2A 1UW4A 1VBYA 3IRWP 2W2MP 2WVCA 2OLWA 1K44A 3SXLA 3NGTA 1NB2A 1RYSA 4LF8J 2OJ3A 4A8XA 3G8TA 2ZUAA 4EBCA 1WKJA 4CQ1A 3HDSA 1LWEB 2DEJA 1ROFA 2Q79A 2R8GA 1SVDA 1VMBA 4ZPBA 2C3UA 5KG4A 3RBDA 1VRUB 1NKEA 3MEGA 4JV2A 1VDHA 1JNZB 5KFUA 2HNZB 4ZMMA 2XTJP 5LOQA 4HT5A 2QZ8A 4NE9C 1QTMA 1Z1ZA 3MMAB 1LFPA 3AY0A 1RABB 3RR8A 3DU5A 2EKYA 3G2XA 4X4VA 5KFYA 3R3TA 4TYBA 1PBAA 1NH7A 1WC5A 3LGHA 4J90A 3B6BA 2QE5A 2X7IA 1NJWA 1JLQB 1Q16B 4DR4F 3FEZA 3LP0A 4NA3A 2X3GA 4D3GA 5KFFA 2BJ7A 1OQ3A 4OI6A 4FYVB 2DNOA 1Q79A 1WJ9A 2H3EB 3IXQA 5KFGA 3M6XA 5BYSA 3NAIA 4P2XA 1PIEA 2HFVA 3B82A 3KDNA 2LEAA 2W25A 2KDOA 2OPQA 1RISA 2JL9A 2JLEA 2HS0A 4GVLA 5J2PB 2YKMB 2D7SA 2XLIA 5I4MA 1S12A 1JLCB 1WHVA 2CKWA 5C25A 2ZE2B 2E9RX 5AXMA 4V1Ak 2B51A 1IBMJ 3IAS9 4L72B 4KPYA 2XBPA 1A0OB 3PX0A 3NWGA 1F5CA 3A3NB 4WK1A 3KK2B 2M70A 2HIYA 4WTOB 3DM2A 2R7WA 4D3HA 3CMAS 3BGRA 3M9NB 4DSKA 2RD5C 4DL2A 3PYEA 3DMJA 2ROEA 2I0XA 2HZCA 1HW9A 4B9VA 1S72S 1TV6A 4C98A 3PX6A 2XG8A 3QRQA 4C7QA 2BJEA 3DRYA 2AGQA 3OXFA 4JI0J 1KQFB 2CQDA 3DLKB 1RWUA 3LF0A 4OFZA 3NL0A 2V2QA 3KK3B 4YDDB 1RT2A 5KFMA 1EETA 4CDIA 4NLYA 4IG3A 3FCVA 4DR6J 1FE0A 4ID5A 3ET6A 3I6PA 3V81A 3M7VA 5H1SV 1KC8T 2C2DA 3FBFA 3OT9A 1U25A 3OFEA 3UCZP 4NYZA 3IG1B 3N6NA 3UN2A 2FJDB 2QTWA 4OJ1A 3DDKA 3HKZD 2HNYA 1U26A 1WEYA 3D0HE 4ATNA 1KONA 3DXBA 1HQUB 4A8MP 3R27A 3BO4A 1B99A 3S7RA 3MUMP 3UVJA 1MSWD 2CPIA 2GJ2A 4DSFA 1HYSB 3ENWA 3J7Z5 3HHLA 4P52A 2KXNB 1Z2LA 1MNEA 1B3TA 3CMQA 2N7CA 1UWBA 3MPDA 2PA8D 4QU6A 2CG4A 1RLDA 2RHSB 1M1KT 3HHLC 4RUHA 3ZZYA 1TTHB 3AD9C 3BSAA 4C8NA 3LP2A 4YR0A 2HG4A 3G6YA 3AA8A 2ZC3A 4ECZA 2MSSA 3P3DA 5GAHU 4RW7A 2G0JA 3BR9A 1L3KA 4OZ3A 4ECTA 2IA0A 2F4FA 1AZSB 5K20B 5LSRA 5KFDA 2UXCF 2BRKA 2HFOA 3GV5B 3VCDA 1QUVA 1H2TZ 2OTLS 5F41A 4JYAJ 3HSGA 5KFNA 3FUYA 2F7VA 3V4IB 3CXCR 2K1RB 1HHTP 1WKKA 4YR3A 4YDXA 5D4PA 3L09A 2E5LF 2CADA 4DHVA 2WZ1A 2MY8A 3NNHA 3ISND 2BMBA 4OYPA 2GVDB 2RILA 2W24A 3AQPA 2MYFA 3OL9A 4NLQA 1C1CA 2GX8A 1JKHA 1IKXB 5HMWA 1HQEB 2XEXA 1O5JA 3DRRA 3NP5A 1T94A 1S5ZA 4DF8A 5I42B 2OSRA 1U0HA 1F0XA 2Z56B 1Q95G 2AGPA 1NU4A 3U1NA 3D1HA 3VGSA 2ALZA 2MZTA 3Q8RB 1ZZNA 3TUIC 5C24A 2EC2A 2JX2A 2IBKA 4RW4B 1YSJA 2CJAA 4IOBA 1HR0F 1FVSA 3VZHA 1L3VA 1FESA 2ZH9A 4JV5F 2C3OA 5ETSA 3VGVA 4DL7A 4C48A 4C8OA 2LCWA 4K8RA 2LXIA 4ITSA 3LA0A 4ZCKA 3VWSA 4Y6IA 4FPRA 2K7JA 1M5KC 3CC7S 1N54B 2FVQA 3R9LA 5EX0A 2I8EA 2BE2A 2DGTA 1IKYA 2P6SA 2VHGA 1WC4A 1S77D 1UEKA 4ILRA 4DR2J 3BB5A 2MZSA 4DUTA 2CNKB 2V9KA 3C14A 3UN3A 2VDIA 5LMUF 1SB6A 3V6JA 2BR0A 2PT0A 4ZJQA 2FHJD 3TA0A 2BKPA 2I5JA 3A8IA 5F8JA 2UVUA 1U1OA 4TU7A 1S0VA 3EICA 4O3PA 5IOLA 4AFFA 3LPEA 1RAHB 4M5NA 3NNCA 2C2MB 2CNOB 2DRAA 4EBDA 3K5PA 4Y0FA 2ZH2A 1N5VA 3TZWA 2X1BA 2NQPA 1CG2A 5HP1A 1WACA 4LFCF 4JI5J 2K3KA 4OYMA 2ZJRQ 3JXOA 3QGGA 2CQ4A 2KKHA 5IXUA 3E8OA 2B0GA 3MFIA 4FKXA 1SKWA 3KXDA 2OFGX 4RBTA 2HWIA 1S7HA 2MQNA 1NM2A 4WXOA 1H7XA 2CJBA 2VASA 4OLPA 4X65J 5HMXA 3A8JA 2BJ1A 2DO0A 1VK8A 2JEFA 4ETXA 3PDNA 1AYEA 2AJQA 2BM0A 5IFMA 1I1GA 2P8IA 4X4UA 3QBCA 1HWLA 2KT2A 1JXLA 4OHXA 3M8WA 4JI1F 2ALYB 4WYLA 2RU3A 1XN9A 7FD1A 3TVZA 2R7UA 5L38A 1M5VC 4K5SA 4B3OB 2OPRA 5I3PA 2CQ3A 4RNHA 2RT3A 4MYTA 5L1IA 4LRAA 3JS9A 2XYPB 5K9FA 5BR8F 3S8SA 2YKNA 3ZC4A 4F2RA 2BE9B 4NA2A 3GONA 4LF1A 3LP1A 3ZZPA 2GAGC 4QIEA 3HD1A 2HQIA 3QGPA 1MMNA 2W8KA 3Q8SB 4TKTA 1X31C 2FUG9 2W4DA 4I67A 3CGIA 5A8RA 2MQMA 3J7YI 4IDKA 1E6VB 4RWXA 1HBOA 1P27B 4KKOA 4ED0A 5D0HA 4LIRA 8AT1B 2XS5A 3RAQA 4DPOA 2AZ1A 2W2OP 4U9RA 3ONQA 2GIRA 4K50A
chains in the Genus database with same CATH topology
1W7WA 1UCNA 3NGSA 4UOHA 1WKJA 3FKBA 3BBBA 3Q8YA 5BXIA 3EVOA 1WKLA 3EICA 2DXFA 1S5ZA 5IOLA 3FBFA 3ZTSA 1NSKL 1PKUA 4O0NA 1LEOA 4ANEA 4W98A 1PAEX 3BH6B 3EM1A 3VGSA 4ANCA 3DKDA 4DI6A 3GPAA 3FBEA 2AZ3A 3ETMA 2HVEA 4FKYA 2VU5A 1NHKL 1ZS6A 3ZTRA 3NGRA 4KPCA 2BEFA 1F3FA 1NDCA 4HR2A 3PJ9A 3BBFA 3BH7B 1HHQA 1NPKA 3JS9A 3ENAA 4EK2A 3PRVA 3ZTQA 1NDPA 2DXEA 1LWXA 1NCLA 2DY9A 3G2XA 3VGVA 1BE4A 4UOFA 3L7UA 1B99A 4FKXA 3EJMA 4CP5A 1NDKA 1HLWA 1KDNA 1WKKA 1BHNA 1NLKL 3EE3A 3ZTOA 3FBBA 1VYAA 3ELHA 3Q8VA 3FBCA 2B8PA 3B6BA 1NSQA 4S0MA 3VVTA 3B54A 2CWKA 3FCWA 4ENOA 1MN7A 4UOGA 2DXDA 1XQIA 3BBCA 3Q8UA 4C6AA 1HIYA 3VGTA 3Q83A 1BUXA 1B4SA 1U8WA 3GP9A 5CABA 3Q86A 1S57A 5C7PA 3FC9A 3NGUA 3WX8A 1JXVA 1NDLA 1EHWA 3R9LA 2NCKL 1XIQA 2BX6A 2HURA 3VGUA 3EVWA 1NSPA 2B8QA 3EMTA 3MPDA 4F4AA 3EVMA 1K44A 3NGTA 1NB2A 2AZ1A 5CAAA 1NUEA 3Q89A 3VVUA 4ANDA 3ZTPA 4DUTA 2DYAA 2HVDA 4DZ6A 3DDIA 4WBFA 2ZUAA 1F6TA 1MN9A 4F36A 3FCVA 1S59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7W A;  1UCN A;  3NGS A;  4UOH A;  1WKJ A;  3FKB A;  3BBB A;  3Q8Y A;  5BXI A;  3EVO A;  1WKL A;  3EIC A;  2DXF A;  1S5Z A;  5IOL A;  3FBF A;  3ZTS A;  1NSK L;  1PKU A;  4O0N A;  1LEO A;  4ANE A;  4W98 A;  1PAE X;  3BH6 B;  3EM1 A;  3VGS A;  4ANC A;  3DKD A;  4DI6 A;  3GPA A;  3FBE A;  2AZ3 A;  3ETM A;  2HVE A;  4FKY A;  2VU5 A;  1NHK L;  1ZS6 A;  3ZTR A;  3NGR A;  4KPC A;  2BEF A;  1F3F A;  1NDC A;  4HR2 A;  3PJ9 A;  3BBF A;  3BH7 B;  1HHQ A;  1NPK A;  3JS9 A;  3ENA A;  4EK2 A;  3PRV A;  3ZTQ A;  1NDP A;  2DXE A;  1LWX A;  1NCL A;  2DY9 A;  3G2X A;  3VGV A;  1BE4 A;  4UOF A;  3L7U A;  1B99 A;  4FKX A;  3EJM A;  4CP5 A;  1NDK A;  1HLW A;  1KDN A;  1WKK A;  1BHN A;  1NLK L;  3EE3 A;  3ZTO A;  3FBB A;  1VYA A;  3ELH A;  3Q8V A;  3FBC A;  2B8P A;  3B6B A;  1NSQ A;  4S0M A;  3VVT A;  3B54 A;  2CWK A;  3FCW A;  4ENO A;  1MN7 A;  4UOG A;  2DXD A;  1XQI A;  3BBC A;  3Q8U A;  4C6A A;  1HIY A;  3VGT A;  3Q83 A;  1BUX A;  1B4S A;  1U8W A;  3GP9 A;  5CAB A;  3Q86 A;  1S57 A;  5C7P A;  3FC9 A;  3NGU A;  3WX8 A;  1JXV A;  1NDL A;  1EHW A;  3R9L A;  2NCK L;  1XIQ A;  2BX6 A;  2HUR A;  3VGU A;  3EVW A;  1NSP A;  2B8Q A;  3EMT A;  3MPD A;  4F4A A;  3EVM A;  1K44 A;  3NGT A;  1NB2 A;  2AZ1 A;  5CAA A;  1NUE A;  3Q89 A;  3VVU A;  4AND A;  3ZTP A;  4DUT A;  2DYA A;  2HVD A;  4DZ6 A;  3DDI A;  4WBF A;  2ZUA A;  1F6T A;  1MN9 A;  4F36 A;  3FCV A;  1S59 A; 
#chains in the Genus database with same CATH topology
 2ZOF A;  2KTQ A;  2AWZ A;  3AJ1 A;  4KR0 B;  1S6Q A;  1CPZ A;  4NXN J;  5DG7 A;  1WF2 A;  4KFB A;  4DMZ A;  1LWF A;  1S1T A;  2EVZ A;  5H9F K;  2KHD A;  4TNO A;  4DCO B;  1WEL A;  3ZNU A;  5EUH A;  4JI8 J;  1UA0 A;  3R5G A;  1X4F A;  2ZC4 A;  4KH0 B;  2B56 A;  3SIP B;  4ECQ A;  3KLH B;  2DH7 A;  2F8M A;  3ITH B;  4L3N A;  3NOG A;  4OYB A;  2MLX A;  1RUS A;  3OR2 B;  4M94 A;  2VG7 A;  3VAL A;  1M90 T;  2EG1 A;  3R2D J;  3CCT A;  4I64 A;  2UUA F;  1VQ9 S;  5EWG A;  1JWW A;  4OYA A;  3DHW C;  5HJY A;  5C7P A;  4F4X A;  5KT2 A;  4BC7 A;  5DDQ C;  4GC7 A;  2G1D A;  4USH A;  2CVE A;  1YRX A;  2IM3 A;  2DNM A;  3T1Y J;  2EG2 A;  5I3Q A;  4CIO A;  3AT1 B;  2D69 A;  2XHW A;  1RT5 A;  3VAJ A;  1YJR A;  3OD2 A;  3ILI A;  3R7N B;  1CBK A;  1F6T A;  2IRU A;  2C28 A;  3L9Z A;  3U1L A;  4F0H A;  4ECW A;  4M5G A;  3CJ4 A;  4UOC A;  3M1V B;  2HMI A;  1TKZ B;  3M2R B;  3Q8Q B;  3MOZ A;  3AA9 A;  3NNA A;  2FHK A;  5C42 B;  3RYL A;  4O44 B;  4LF8 F;  2H5E A;  2RUS A;  1MWQ A;  1T8E A;  4C4W A;  4KV8 A;  4DU8 A;  2PMW A;  4PWD B;  1P9Q C;  5CD4 A;  1EQM A;  4J5O A;  2W1B A;  4IYQ A;  2RH3 A;  3PIP Q;  2BM1 A;  1FFS B;  4J9M A;  2LDY A;  4U6P A;  3CD6 S;  1Q53 A;  1T02 A;  1YQH A;  4U8Y A;  1RTJ A;  2YWK A;  1DTQ A;  4GMK A;  2DNR A;  3US5 A;  1RU1 A;  2ASJ A;  2NZC A;  1CSJ A;  4YHH J;  4ELT A;  4Z7Y A;  1D09 B;  4KT0 C;  4ZIW A;  5AJ3 J;  4ES3 A;  2LEC A;  1FWP A;  3EVW A;  1NSP A;  3D6T B;  2UZA A;  3KJQ B;  2BA9 A;  1IR1 A;  1D9F A;  4L3K A;  1T03 B;  2XI3 A;  2AU0 A;  2QYC A;  3BQ0 A;  1AUD A;  5HRO A;  4JI6 F;  3IRX A;  1TEL A;  3TUP A;  1LEO A;  1TKT B;  3SSQ A;  2AP6 A;  3KLF A;  4X64 J;  5G0R A;  4ECY A;  3M8R A;  3UCG A;  5HAO A;  3PR5 B;  4V19 J;  4RJV A;  3HFV A;  1LNQ A;  2DIS A;  2IMW P;  3BGF A;  3TI0 A;  1FNX H;  3JYT A;  1G7C B;  1H7W A;  3PKY A;  3H8Y A;  1T9X A;  2KM8 C;  3GIL A;  4RU2 A;  5GMK a;  2HQC A;  2PI4 A;  4LMZ A;  4NEY A;  1VQK S;  3H4D A;  2V4J A;  4BWJ A;  1NKC A;  4H4K A;  2DNZ A;  2IJF A;  1RTI A;  2JJ4 D;  1RSC A;  2JNJ A;  2X3D A;  1XTZ A;  1RWV B;  4DSI A;  1LFW A;  1S10 A;  3R6L B;  2HQF A;  3QZ7 A;  1XK8 A;  2VA3 A;  2GFF A;  4LVO P;  4H4K C;  1RA6 A;  1S1X A;  5KFI A;  1T95 A;  1Q7Y T;  2VPY B;  1SL1 A;  2XYH B;  3OLB A;  5J2M A;  2R8J A;  4PQA A;  1BQN A;  1T11 A;  2MZJ A;  2UUB F;  4X4Q A;  2D3O R;  1ZM9 A;  2YQ1 A;  5GAE I;  4R0J A;  3TA1 A;  5AE1 A;  2DR7 A;  1H0H B;  2A2C A;  5ETO A;  4ZKA A;  3GJT B;  2DNH A;  1C0U A;  3L7U A;  4CP5 A;  1X5P A;  4H4M A;  2NSC A;  2R7O A;  1GXL A;  1N32 F;  4OX6 A;  3CJK B;  2KYX A;  2LKZ A;  3KUH A;  6FD1 A;  5HQL A;  4NI2 B;  1RWO B;  4CTA A;  1LWC B;  2CJX B;  3VGU A;  4FNI A;  2VL1 A;  2IM0 A;  3MM6 B;  3WC0 A;  3IN5 A;  4NZ7 A;  3SFU A;  1P1L A;  2IVF B;  5B09 A;  2XMT A;  3EGZ A;  1GTH A;  1NZ8 A;  3POT B;  5KFT A;  3VZI A;  2NRE A;  4DZ6 A;  2NSB A;  1YJV A;  3GB0 A;  1GT8 A;  5IC4 B;  1Y11 A;  3EXY A;  4NLG A;  1VLY A;  4CO1 A;  1WI8 A;  4L6V 3;  1DJ0 A;  2Z2Y B;  4JV0 A;  3DNC A;  2HVZ A;  1R8C A;  2KI2 A;  1UWA A;  1KWM A;  1ZH5 A;  4ED4 A;  3GFH A;  3V6D B;  4ECS A;  1REV A;  2DHG A;  2D74 B;  2B4V A;  1NPP A;  1H98 A;  2E1C A;  2LQ8 A;  1VRT A;  2BV3 A;  3UI3 A;  4EK2 A;  4DV3 F;  4F4Y A;  4J9U E;  3M2U B;  2OEJ A;  2DIV A;  2BRL A;  5FJ4 A;  3CCE S;  4G3I A;  4OYW A;  3VAF A;  1RTH B;  1MU2 A;  4F4W A;  8ATC B;  2DHS A;  2QO3 A;  1R8B A;  1WD6 A;  2W9C A;  2HHP A;  2RRA A;  4F3O A;  4MKA A;  5KFL A;  1B70 B;  3FMW A;  3V4M A;  2KXF A;  3PJX A;  2EK6 A;  5EDW A;  1ZA2 B;  4AL7 A;  3C6T A;  3ZO7 A;  3ENQ A;  1WOS A;  4P7T A;  4RNM A;  5T7L A;  1RAF B;  5DM6 Q;  2XO7 A;  4J9O A;  1HNI A;  2IDE A;  4ECX A;  2A0F B;  3WX4 A;  5DZ7 A;  3N79 A;  1IR0 A;  1R8P A;  4R25 A;  1VLO A;  2G0I A;  1F3V A;  2E5J A;  4A8O A;  1REG X;  4X4R A;  4QQB A;  5D4L A;  3DLH A;  2IYG A;  5D8H B;  2VU5 A;  3Q2S C;  3RG6 A;  4LFB J;  4DOZ A;  1MML A;  1VC6 A;  4DV0 F;  4Y00 A;  3IGV A;  3F41 A;  2CJY B;  2DTJ A;  2YKP A;  2DR8 A;  3MMC B;  4M5I A;  3NS6 A;  1NCL A;  2JSX A;  2CPH A;  3W7B A;  4GO7 X;  1SC6 A;  3NEK A;  1HLW A;  3IMQ J;  3RU0 A;  3UDV A;  3AXK A;  1SQF A;  4MKV A;  3MR3 A;  4ZS6 A;  3V2U C;  2DNK A;  4GVB B;  1I94 F;  3DOK B;  3M05 A;  1M5H A;  2YWW A;  4DV7 J;  3GSD A;  4O0I A;  5JVH Q;  1K0T A;  3PV8 A;  3KKF A;  2ZNY A;  3MAQ A;  3BRE A;  3T5K A;  3VF0 B;  2MB0 B;  4ZP7 A;  5B7W A;  3TUZ C;  3ZNJ 1;  4LSL A;  4USM A;  1Q82 T;  4GKK F;  2AD9 A;  2B5J B;  2IMO A;  2VFT A;  3J7A N;  4M1K A;  2W2N P;  3W1Y C;  3UE2 A;  3A1Y G;  2B7B B;  4Q7A A;  4NCG A;  1PAE X;  3EM1 A;  1KD1 T;  3H2L A;  2CA9 A;  5DLF A;  4ZP8 A;  3M32 B;  4FKY A;  4PRF A;  3TQ1 A;  3R5D A;  2PMZ D;  1UVN A;  2Z0G A;  2GAH C;  2HHX A;  4CM0 A;  2CDR B;  5HVH A;  3PRV A;  4UTG A;  3FQK A;  4Y2I A;  1WC1 A;  1S1V B;  3HT3 A;  1G2E A;  1L3U A;  3D6H B;  4MT1 A;  2HHH F;  3S01 A;  2APO A;  3E01 A;  4DV6 J;  4S0M A;  2V5H G;  4Y2K A;  1LOU A;  2WB1 D;  1CJU A;  5CZV A;  4CYU A;  2WOM A;  5M2R A;  1CS4 A;  3MPV A;  4NML A;  1YJ7 A;  3FRZ A;  4P74 A;  2DB1 A;  3G87 A;  1U4B A;  1ACM B;  2NXE A;  2P2C B;  4DFP A;  5D77 A;  4F36 A;  4QIF A;  3KJV A;  4EEY A;  1FRX A;  2QSW A;  4OLO A;  4DSE A;  4K4U A;  4KGV B;  1CJK A;  2FLP A;  1HNZ F;  5F3T A;  2V34 A;  1S0M A;  2R7S A;  1FRM A;  4MFB A;  3CJS A;  2YQ3 A;  3C15 A;  2GMJ A;  2UVR A;  4C3L A;  2C2Z B;  1NK9 A;  2CRL A;  3BV8 A;  1HL6 A;  3W66 A;  1QY7 A;  4LR7 A;  1N34 F;  1VHF A;  3IAM 9;  4B08 A;  2Z2L A;  4KRW A;  4I69 A;  2M2B A;  3X3U A;  2FGO A;  3CF5 Q;  5F8I A;  2VBW A;  2XSJ B;  3CME S;  3LAN A;  1N5Y B;  2UUW A;  1NDL A;  3THV A;  2NCK L;  2JDJ A;  1S6P B;  2RML A;  1JLB B;  4I1T A;  2R2S A;  2IVY A;  4ED2 A;  5B0F A;  3HVA A;  5KFB A;  4FYY B;  3E2E A;  3NS7 B;  5D0R A;  2IAJ B;  4QPX A;  4MMO A;  2B4U A;  2LEP A;  3HZG A;  3KJN B;  2KT3 A;  3KLV A;  3MEG B;  2E9Z A;  3K5O A;  2UUT A;  4U8V A;  3KWM A;  5D3G B;  1NH8 A;  1JNR B;  1Q1K A;  1UW9 A;  2RKI A;  3B4M A;  4RU9 A;  2W8L A;  4ZVE A;  3GTY X;  3KJF B;  4NLD A;  3NKY A;  2Q43 A;  4NA1 A;  2HLT A;  2QA4 S;  1E6Y A;  2LQ9 A;  2MPU A;  1RT7 A;  3LP0 B;  2QIF A;  1QTN B;  1U02 A;  4CLY A;  1S57 A;  2XNQ A;  1FXL A;  4DLG A;  2CQ1 A;  3AD8 C;  3AFG A;  3W2W A;  2YNF A;  3H90 A;  4DL3 A;  4URQ U;  3EMT A;  4FF3 A;  1W2B R;  1S99 A;  4KO0 B;  3T5H A;  2VQE F;  1JB0 C;  2OGU A;  2CQB A;  2FPH X;  4OMF G;  2V50 A;  4FDF A;  5IS2 A;  2OPQ B;  3PR4 A;  4M5M A;  2D9O A;  1K47 A;  4LRC A;  5GAD U;  4MAK A;  4LF4 F;  3BGO P;  3QLH B;  3T1H J;  2ATL A;  3P5T L;  5D78 A;  2OD4 A;  5K8P A;  5C25 B;  3M30 A;  2ATC B;  1UEV A;  2F9D A;  3D3C J;  3DDN A;  3R6G B;  5A6P A;  2GS8 A;  4OI0 A;  4ZPC A;  2QLX A;  1FI4 A;  1WC3 A;  1HNX J;  1OQ6 A;  2R7Q A;  4ZK7 M;  3M6U A;  4OL8 A;  2CFX A;  3K58 A;  2M88 A;  3IFE A;  4J9R A;  3MCN A;  2NUH A;  2MJU A;  3GCW P;  2DHX A;  2ZIT A;  2WAQ D;  2VFU A;  1QSY A;  1AUS L;  3GJS B;  3DM2 B;  3HX9 A;  3W62 A;  1C1B B;  1VQY A;  1IBK F;  3K5M A;  2W4C A;  4IUF A;  1OY6 A;  1ICE B;  3OL7 A;  3N0V A;  2DGO A;  1TUV A;  3DMJ B;  2VQF F;  3DFE A;  4QOT A;  4DUZ J;  1TV6 B;  3JQK A;  4YB1 P;  2RVJ A;  2GGP A;  2GO8 A;  3C16 A;  1X4A A;  1RI7 A;  1IM6 A;  4F67 A;  4NXM F;  3QRP A;  1G3O A;  3N4W A;  3H0P A;  1RT2 B;  5HBM A;  1EET B;  4QBU A;  4IG3 B;  2R2U A;  1U1Q A;  4ID5 B;  3ET6 B;  1R89 A;  1N0V C;  3V81 B;  1NK7 A;  1QJH A;  3H40 A;  5EHH A;  5AJ3 F;  3DLB A;  2LA4 A;  2FZG B;  4EBE A;  2CPY A;  5I3U B;  1W25 A;  5IT4 A;  4K0K J;  4HEA 9;  4P2F A;  2HNY B;  2UU9 F;  4TU8 A;  4A46 A;  1HNW J;  1N5T A;  1S97 A;  3HF5 A;  1NK4 A;  3BDP A;  3W8G A;  1XNQ J;  3N9U C;  4U96 A;  1ZM4 A;  1BXN A;  3JB9 k;  3M4X A;  2HBZ B;  4Y34 A;  3GE9 A;  2XWY A;  4C8K A;  1HIY A;  3IWN C;  3PFE A;  3HHL B;  3KOA A;  3EPI A;  2KFY A;  3M8S A;  3W3S A;  4C0O C;  1ZAX A;  2YH0 A;  4J9L A;  3B78 A;  5IQ6 A;  2QGF B;  2PE8 A;  1UWB B;  4F3M A;  3GFY A;  4GKJ F;  1HBU A;  1VJW A;  1C2P A;  1NME B;  5K8M A;  1FNO A;  2QJ3 A;  2YWF A;  4PUO A;  2VBY A;  3KTQ A;  3FFI A;  2VDH A;  2LXF A;  2Q6B A;  3LP2 B;  3EZ5 A;  3D9B A;  4P2S A;  4DL6 A;  3CIM A;  2IRY A;  3G8S A;  5CYM A;  4RW7 B;  3O3L A;  2HVE A;  3SMZ A;  1AFI A;  4Q8F A;  1NHK L;  2F9J A;  1JIH A;  2G0C A;  1Z4U A;  2RU9 A;  4PXE A;  4YFU A;  4XPC A;  5E7O B;  3BQ1 A;  3CIZ A;  4PAA A;  4KYZ A;  1O51 A;  3AXM A;  9RUB A;  4U7U K;  3CDW A;  1SV5 A;  2L9W A;  5ETN A;  5SUH A;  3T9Z A;  2NS1 B;  2C3Y A;  2VV5 A;  2B9W A;  4BLG A;  1MN7 A;  3RBE A;  3MEE A;  4OI3 A;  3UR3 C;  1N4L A;  2FDN A;  3RJM B;  4HH0 A;  3AQO A;  4ZN3 A;  3G6E S;  4E8U A;  3RBX A;  5KFX A;  2L48 A;  2JWN A;  3QO9 A;  5LMN F;  2YKQ A;  4E98 A;  4M63 A;  1TP7 A;  2VD3 A;  2RQ4 A;  4DR4 J;  3H42 A;  4LF7 J;  3M2V A;  2VFV A;  5IWA F;  1T9U A;  4K2X A;  4J91 A;  3PW5 A;  3DRR B;  1UFK A;  4GC6 A;  1U0H B;  5L46 A;  3K0J A;  2J6U A;  3MM9 A;  4MK7 A;  5AT1 B;  4E2F B;  1FWK A;  1N0U A;  4CH0 S;  2HZV A;  5C24 B;  2OKQ A;  2AW0 A;  2E66 A;  2WW4 A;  1T9W A;  4WZQ A;  1S4F A;  2F5G A;  5IM0 A;  4WFA Q;  1L3T A;  4FBU A;  2FIU A;  4UQT A;  6AT1 B;  5MAO A;  2JH3 A;  4DV5 F;  4HI2 A;  4K4Z A;  3BS9 A;  5J1N A;  2B43 A;  2FD2 A;  3FCW A;  4A8Y A;  3VGT A;  1B4S A;  1RYR A;  5LXR A;  1WC6 A;  4N77 A;  2AYE A;  1J5O A;  2HVI A;  7AT1 B;  1ITP A;  2CQH A;  4ZCL A;  5RUB A;  3PAC A;  1IKY B;  3J81 j;  5E33 A;  4I2P A;  1EAR A;  2EFV A;  4NYO A;  5M2P A;  3C14 B;  4Q44 A;  1KVJ A;  2H4Y B;  2YBV A;  2ABY A;  3PIO Q;  1QUP A;  3JAM Y;  3HUL A;  1Y5I B;  1N52 B;  2I5J B;  3AOC A;  1BLU A;  4UT4 A;  1K0V A;  2ZDO A;  1YJN S;  2UUC F;  2BE7 D;  4USW A;  2HHV A;  4RW8 A;  3ENV A;  1H72 C;  5T14 A;  2GVZ A;  4C8Y A;  5HJX A;  2HGL A;  3R1L A;  5HP1 B;  3MGJ A;  3X1L B;  2FZK B;  1PBU A;  2BVZ A;  1CLF A;  4PXC A;  4WKY A;  1SPB P;  2POK A;  3H20 A;  2AEJ A;  1N88 A;  3TR5 A;  3C46 A;  4N47 A;  2Z2M A;  3CVK A;  1TMJ A;  1FKP A;  2MZR A;  5IT0 A;  5F8N A;  1Q8I A;  3BBC A;  1UJ6 A;  2EI5 A;  2RB7 A;  3MCO A;  3TNV A;  2MQO A;  1R6Y A;  1OPI A;  1VK3 A;  3TZZ A;  4WJB A;  1KVI A;  3MD1 A;  4QJV A;  2DNL A;  2VKZ G;  1MG7 A;  1UPP A;  2EKN A;  2UV8 A;  4OHV A;  4IRC A;  2KYZ A;  3Q23 A;  5HMZ A;  2C2O B;  4DL4 A;  4EO6 A;  1KN6 A;  2WON A;  2CPD A;  3Q24 A;  1TKX A;  4FN5 A;  4LR8 A;  3D67 A;  2I1R A;  2J7K A;  4CLK A;  5DGA A;  5KT7 A;  2IM2 A;  3I82 A;  1ZS6 A;  3G71 S;  2MHE A;  4FXD A;  2CVI A;  2DO4 A;  1PC5 A;  4JP8 A;  3PJ9 A;  2MXY A;  2ZOM A;  3KHH A;  4OZ2 A;  4PWW A;  2YKN B;  1XR7 A;  3QT6 A;  2DRD A;  5KFV A;  1N6Q A;  2NR0 A;  1U45 A;  1MWY A;  3GV7 B;  1G6B A;  1TFW A;  3LP1 B;  2ZEJ A;  2E1M C;  2UXC J;  1FXR A;  1C0T B;  4QR2 A;  4NWB A;  1Q81 T;  3BDE A;  4NCB A;  2QT7 A;  5L1J A;  1CC7 A;  4QYZ J;  4RNF A;  2VUG A;  2RIJ A;  4I56 A;  4WFX A;  4J9K A;  5DGB A;  4IDK B;  4IFV A;  3RW7 A;  1O6X A;  1HBO B;  9ATC B;  3MUV P;  5D4O A;  4J7C A;  1EJ7 L;  4YB5 A;  2J0S D;  3NBP A;  1NUE A;  3Q89 A;  4ALZ A;  2MKJ A;  2E7V A;  3R5J B;  5F0U A;  3EZU A;  1H2V Z;  3BKU A;  4LQ9 A;  2MQQ A;  5IT9 U;  4PG4 A;  1JXE A;  1RJJ A;  2MHN A;  1S6Q B;  1HAR A;  3BH6 B;  4LSN B;  2J6S A;  1GMU A;  3FEY B;  4WE1 A;  3MMB A;  4KFB B;  4QIG A;  3NS5 A;  1LWF B;  1S1T B;  2PDA A;  1TL1 A;  4A47 A;  1PO6 A;  2DY1 A;  3GYG A;  3T19 A;  1R0A A;  5IC6 B;  2V2Z A;  1NDP A;  2OIH A;  4I7F A;  3T41 A;  1LWX A;  4DQR A;  2HND A;  3CWJ A;  1IKW A;  2H9Z A;  2HNZ A;  5LM7 E;  4UW2 A;  4E0D A;  1UEU A;  2L3M A;  2VG7 B;  3D4J A;  1U1P A;  4RO0 A;  1U8S A;  1FDN A;  3CJT A;  2HGN A;  3FSY A;  2B4O A;  2DH8 A;  1K8A T;  4N7T A;  4JV5 J;  4DCP B;  1YG0 A;  2ZFH A;  1FWL A;  2Q6C A;  1N33 F;  4HVZ A;  3DCA A;  1DZ5 A;  3FZ2 A;  1F5B A;  5A0Y A;  2ZM6 F;  1FDD A;  5EWF A;  1XWL A;  1RBO B;  3W9I A;  2VH7 A;  1RT5 B;  1IM4 A;  3HHE A;  2G2Y A;  4ELU A;  4OX7 A;  2I9S A;  3ZTS A;  3OVA A;  3CJ3 A;  3FSI A;  2HMI B;  1IQZ A;  3NCR A;  4B9N A;  3PYD A;  2OH2 A;  3JQJ A;  1M5P C;  4P75 A;  5LMU J;  1F60 B;  3TA2 A;  2YKM A;  4DZD A;  3LAM A;  1PGZ A;  3BQ2 A;  5ETL A;  1JLC A;  4ED5 A;  1PJ7 A;  2B9X A;  1WHW A;  1OSD A;  4KV8 B;  3U02 A;  1DTT A;  2W9B A;  3A13 A;  2BXJ A;  4CI0 B;  3HHL D;  3TAR A;  1FO1 A;  1LK7 A;  1Q78 A;  3UD3 P;  3ILJ A;  3R5C A;  3VVT A;  2ZJQ Q;  2MLY A;  2AJ2 A;  4TXS A;  4CT9 A;  4LFC J;  1YBA A;  3CO9 A;  3MTJ A;  2IJR A;  1QVF R;  2P9C A;  1DTQ B;  3Q2T C;  2ZD1 A;  2DKO B;  3DLJ A;  2XWX A;  1RZM A;  1GNK A;  2E7X A;  2W7P A;  2AIR B;  2ZH1 A;  4P9S A;  4DFK A;  3MED A;  1KS2 A;  1VS3 A;  3P45 B;  4DV2 F;  1X5T A;  4L75 A;  1FX2 A;  1NXI A;  1N8R T;  5A2Q U;  4WU2 A;  1JJC B;  5BXI A;  4WP9 A;  3IRX B;  4X4T A;  2ZDP A;  2KM8 B;  1K73 T;  3KLF B;  3EPG A;  5G0R B;  1VBZ A;  1F9F A;  3BYR A;  2CUY A;  1FHT A;  2RRB A;  4G1Q A;  5HVG A;  3CCV S;  3EGW B;  1U2R A;  1TUW A;  2PGC A;  3JYT B;  1FEH A;  4TN2 A;  2HHT A;  3G4S S;  5CCM A;  3AHP A;  4ED6 A;  5K14 A;  4IOC Q;  2R7X A;  4QZV B;  2LDI A;  2V4J B;  2VIC A;  2DXD A;  1MW7 A;  1RTI B;  1B0V A;  5KAK A;  5BR8 J;  2ROP A;  4WXW A;  1HPZ A;  3TVY A;  3QIP A;  3I56 S;  1XMQ F;  4DR7 F;  2Y1I A;  1FEE A;  2AJ4 A;  1BD6 A;  5DG9 A;  3S1T A;  2V2K A;  4O3N A;  1S1X B;  2SXL A;  2CPE A;  1QDU B;  3H5S A;  1KP6 A;  2YH1 A;  2Z4P A;  1RWW B;  1D0E A;  4CM2 A;  2L41 A;  2Y8W A;  5HI7 A;  2ZH8 A;  2L08 A;  2MZ1 A;  1SJQ A;  3D68 A;  3MEK A;  4ANC A;  1IKV A;  2XHC A;  5FDL A;  3I5B A;  4F50 A;  3MM5 B;  2FY1 A;  5IV4 A;  5KT6 A;  4OZ1 A;  3A8K A;  3CJ8 A;  3ZZU A;  4JV1 A;  2KFN A;  3MUR P;  4NCA A;  4TY9 A;  4PWU A;  2ZUG A;  4NX9 A;  1U2F A;  2R4F A;  3GLJ A;  4Z2X A;  5T41 A;  1C0U B;  3QAE A;  2H4W B;  4BHQ A;  4H4M B;  5LL6 d;  1UMJ A;  2JZ5 A;  5DDP C;  4DV1 F;  4P73 A;  1CVJ A;  4M5D A;  4Y2M A;  3KNG A;  4YME A;  3K59 A;  4BS2 A;  1XR6 A;  4CTA B;  2EFN A;  3HSJ A;  4KJI A;  3GII A;  2AV5 A;  2BW7 A;  5MLC V;  2MJN A;  4KHR A;  4KH1 B;  1KFD A;  3R5A A;  3QNW B;  2GVD A;  1F9H A;  2UUA J;  1WI6 A;  3OL8 A;  4JBC A;  4IG0 A;  3MPU B;  3IGN A;  1FFG B;  2HPU A;  2OTJ S;  2C42 A;  3BKF A;  2ZJP Q;  1FRI A;  4MIA A;  3RB3 A;  2DPJ A;  3H7H B;  2XS7 A;  2YX1 A;  5I42 A;  2H5J B;  3LO3 A;  1YIT S;  1RWK B;  3HCX A;  4MIW A;  3UD5 A;  2IYI A;  1VRT B;  1UJ5 A;  4NL5 A;  1X4B A;  3OUY A;  3OLA A;  3TAM A;  4YUD A;  2ZH4 A;  4ILL A;  3D66 A;  2H65 B;  1MU2 B;  2HWT A;  2IM1 A;  2XO6 A;  3IS9 A;  4H54 A;  1WTB A;  5CAB A;  4B3M J;  3FC9 A;  2XY5 A;  1NJZ A;  1X7V A;  2DBB A;  3UN5 A;  3PZP A;  3OW2 R;  4OYZ A;  1F1B B;  2AGO A;  1U48 A;  1X9S A;  2HBY B;  1UVI A;  3VAK A;  5T7L B;  3TYT A;  1U2C A;  4WBF A;  3CCU S;  2C2R A;  2FQQ B;  2GO9 A;  2DNQ A;  1HNI B;  3TJ8 A;  4UOH A;  5KFJ A;  5CYJ A;  4XPE A;  1SIW B;  4EYI B;  1KTQ A;  1UAW A;  3PM9 A;  3DRX A;  1HWJ A;  3R97 A;  5L9N A;  1VQO S;  1LXN A;  2XZT B;  1KRP A;  4P2M A;  2E1P A;  2ASD A;  3LWM A;  2FZC B;  1NO8 A;  5CD4 H;  4LF7 F;  4JI6 J;  2HIQ A;  3BGL A;  2NXN A;  3LUY A;  2J9D E;  3F0N A;  3PJW A;  4TYA A;  2K06 A;  2Q3P A;  1QM9 A;  3LGM A;  1ZOT A;  2I6W A;  2QFJ A;  4DFM A;  2C2N A;  3JSY A;  5KFQ A;  4AL6 A;  4X4P A;  4MYU A;  2CQ0 A;  4CLW A;  2VKR A;  1I5O B;  4I0W A;  2NXC A;  4QR0 A;  2BX6 A;  3EXC X;  3N5F A;  3U1M A;  4IRD A;  1FA0 A;  4RW6 B;  2JVR A;  2QYG A;  4CO2 A;  1NHV A;  2PD1 A;  3LTO A;  1V3Z A;  2DGV A;  4H4O B;  1Y9O A;  1DHM A;  2AEF A;  4LSL B;  4IH5 A;  5C2C A;  1WSV A;  4EU0 A;  4Z37 A;  2HW3 A;  2Y0B B;  5A2Q Y;  2XSF A;  4LVN P;  4NCG B;  1GMW A;  4ZDN A;  3EX7 B;  1FDB A;  1R7I A;  1BY9 A;  4AL5 A;  1X5S A;  3BSC A;  2FVS A;  3DI6 A;  2QLF B;  5KG3 A;  2ZBR A;  4C0B A;  2ILY A;  5GMD A;  1K1Q A;  4IH6 A;  3NG8 A;  5KG7 A;  2FJV A;  4G1I A;  5U47 A;  4X4N A;  3KDO A;  4IH7 A;  4Q0B B;  3NMA A;  2YVS A;  3GIK A;  3QWP A;  2UUB J;  1S1W A;  4KSE B;  1HKA A;  4RBU A;  2V8V A;  5IV3 A;  3E01 B;  4CWB A;  3KHL A;  2IVM A;  3P96 A;  4DLE A;  4JUZ A;  2KRB A;  2J7U A;  5ETT A;  3L95 X;  1LXJ A;  1CJU B;  2ACM A;  2P5V A;  3G8Q A;  1VQ7 S;  1CS4 B;  1KLN A;  1Y10 A;  1VQL S;  1V5I B;  1N32 J;  3T9N A;  1NK5 A;  5E3Q A;  5CAA A;  1QSL A;  2HQ3 A;  1UVM A;  1GXT A;  3BO3 A;  3HSZ A;  3HK2 A;  1T3O A;  3QYY A;  3ZZO A;  2AHO B;  3KJV B;  3BBB A;  5K5M A;  2GQC A;  2DEI A;  3RRG A;  1S9F A;  3PVX A;  1KFS A;  4J9V A;  5AE3 A;  1CJV A;  4NLP A;  2VG5 A;  1CJK B;  4MK8 A;  4Y3C A;  3DRS A;  2LFV A;  3AH6 A;  2OEL A;  1JMT A;  2KN4 A;  3LPY A;  2CPJ A;  2CQG A;  3D28 A;  4MFB B;  3CCZ A;  3C15 B;  3QQC D;  5KFC A;  2MKK A;  3CDA A;  3WBZ A;  3JSB A;  3QJP A;  1B7Y B;  3MEC A;  3BN4 A;  2FVP A;  5HSP A;  1P1T A;  1ZA1 B;  2YPZ A;  1R31 A;  3HI9 A;  1Q8L A;  1X0F A;  2CYY A;  3D7S B;  2YNG A;  3F73 A;  1FNM A;  2UXB F;  4DV3 J;  4EGL A;  1VQN S;  3KHG A;  1RAJ A;  2M8H A;  2DD8 S;  2VJU A;  5ADZ A;  1C4A A;  4WFN Q;  2WVB A;  4X66 F;  4EUV A;  1RTD A;  4I6W A;  3W60 A;  3QZ8 A;  3PHT A;  4FZV A;  3QID A;  2DT9 A;  4TVA B;  1MN9 A;  1FXD A;  1BQX A;  4HDH A;  1V3R A;  1VGY A;  2W4P A;  2X1G A;  2FB0 A;  1V3S A;  3N5B A;  4CO3 A;  4QWC A;  2BQ3 A;  1R27 B;  2IPO B;  4J37 A;  5B0A A;  3CT9 A;  1D9A A;  1LW2 A;  2VF3 A;  2YX4 A;  3VAM A;  2HQD A;  4RUC A;  1FFW B;  1RHK B;  5EN1 A;  3K57 A;  2PI5 A;  2E44 A;  2FVR A;  2O66 A;  4DQS A;  3MD3 A;  5B0B A;  2YWG A;  5JMN A;  2M9K A;  3CE8 A;  2RKI B;  2J5A A;  4KAI A;  1UVL A;  1URR A;  3W2V A;  3FBC A;  2FJA B;  4KE5 A;  4PWD A;  3HP6 A;  4TLQ A;  4DV0 J;  2KJV A;  3Q83 A;  1E6Y B;  4OI1 A;  2QL7 B;  4U95 A;  1TZ0 A;  2NXJ A;  3ZFV A;  3W2W B;  1PSD A;  3MPW A;  3A4T A;  4HHH A;  1I3O B;  2RRN A;  1I94 J;  2BBE A;  1BMQ B;  3AD7 C;  4OV1 A;  1KQK A;  4PG7 A;  1XNR F;  4FF1 A;  1XMB A;  1T03 A;  4KHP F;  3CJ0 A;  4QIV A;  3M30 B;  3CCM S;  1OWX A;  4WTY A;  4NZ0 A;  4AXJ A;  4W4M A;  2HBR B;  4J9Q A;  4IR9 A;  4MKB A;  2ZHA A;  3BZQ A;  2E1A A;  3M6V A;  4EWT A;  3RRK A;  3LOU A;  4K4Y A;  4GKK J;  2OFH X;  4OV6 A;  1TKT A;  4PAB A;  4NLX A;  1O8B A;  3KUG A;  3GU0 A;  1TK0 A;  3DOM A;  3R7S B;  2DGU A;  4K4T A;  2XMM A;  1X8D A;  4CO0 A;  2NXU A;  4K4W A;  2KFZ A;  4O3Q A;  3T1A A;  4F4K A;  1YDL A;  4UOG A;  1T05 A;  4ZPV R;  5KFH A;  3TX8 A;  3I87 A;  1OIA A;  2WVD A;  4WF9 Q;  3IO1 A;  4JI4 F;  1UP1 A;  3RRH A;  5DJB A;  4ZHR A;  2HHH J;  2GGP B;  3FK4 A;  3C16 B;  2NZ4 A;  4ZPD A;  6FDR A;  1QLN A;  1J5E F;  3V6H A;  1CC8 A;  2M8D B;  2RUG A;  3HKW A;  2R2T A;  1TL7 A;  3GG1 A;  5HBM B;  1VQ4 S;  3D1Q A;  2DNP A;  2OEK A;  2XC9 A;  3K5L A;  3VQT A;  3M8Y A;  5CYQ A;  3AAW B;  1H38 A;  2BAB A;  2D9P A;  1SBR A;  4U67 Q;  2HRU A;  1X4C A;  1NK8 A;  1NKB A;  3MFH A;  1ZPW X;  3RB6 A;  4LQ3 A;  4ES1 A;  4B3T F;  5D6G A;  3VR1 A;  3QWU A;  1TL4 A;  4O4G A;  3VHQ A;  4OYI A;  3PG9 A;  4ZVQ B;  1RT4 A;  1WEX A;  2CIM A;  4RUB A;  3BO2 A;  1AB8 A;  1J27 A;  3UDC A;  1TAQ A;  1KDN A;  1NND A;  1HNZ J;  2WSF C;  4XDC A;  5HL7 Q;  3OTO F;  1KHW A;  2M3D A;  1NJI T;  2CWK A;  4PXB A;  5BYR A;  2PFF B;  2ZZN A;  2RS2 A;  3RR7 A;  4YN3 B;  4Y28 C;  4DUY F;  3DXS X;  1N34 J;  2MQL A;  3VAI A;  1U49 A;  4Q8E A;  3SDE A;  2CXE A;  4NI2 A;  3K17 A;  3OJS A;  1OS5 A;  4PPD A;  2LXU A;  2BOA A;  5H9E J;  5HAN A;  1D8Z A;  4WFY A;  4PUO B;  2EFO A;  2A3J A;  2C2E A;  4ICL A;  2ZH5 A;  5CYM B;  3R2C J;  3SCK E;  3HJF A;  3T6J A;  1NPR A;  1MLA A;  2Y1R I;  1OO0 B;  4LF9 F;  2MKY A;  2DCL A;  3V6D A;  5KTQ A;  4O3O A;  4CZC A;  3K5N A;  1TK8 A;  1FK9 A;  1RAE B;  4FF4 A;  3DN9 A;  3GZ7 A;  2J9C A;  2WB4 A;  4ZVU B;  3VQS A;  2BJ9 A;  5EWE A;  1XQI A;  4C6A A;  1S48 A;  2AYM A;  3Q86 A;  3PRB A;  2VG6 A;  1T7P A;  2HS4 A;  2WVE A;  2FGC A;  1VQM S;  4BDP A;  2XB2 D;  4ED7 A;  4L74 A;  3QO9 B;  3BYP A;  1TVR A;  4NYP A;  2XYG B;  4PPZ A;  5ETR A;  2EEY A;  3SV4 A;  2G2O A;  3QGI A;  4NLO A;  4CLP A;  2VOD A;  2W2P P;  2QSF A;  1CUL A;  4ZIT A;  3M2V B;  2YXL A;  5JUM A;  3I0R A;  3CC4 S;  4K5R A;  1PKU A;  5ETK A;  4C11 A;  3VTI A;  1UVK A;  3DOL A;  2VQE J;  1H2U X;  1RTZ A;  3MM9 B;  1P6T A;  2JVO A;  1S9E B;  2HSE B;  2KZM A;  4KPC A;  3O5T B;  4LF5 F;  4QCL A;  2QN6 B;  1QAI A;  4LF4 J;  3SCI E;  3DLG A;  5KT4 A;  4ZP9 A;  4RW9 A;  2MST A;  5IM0 B;  3DC2 A;  4KB7 A;  3O2I A;  1BHN A;  1UL3 A;  3OR1 A;  2BUN A;  3QT8 A;  3WQP A;  4B3R F;  1RHU B;  1FVQ A;  4UZC A;  5KT3 A;  3HD2 A;  1RT3 A;  1IUJ A;  2DNN A;  2ZHB A;  2UVV A;  4KGZ B;  2GJI A;  4OHW A;  1OY8 A;  3UDL A;  7FDR A;  2CQP A;  1J5O B;  2CNN B;  4GVB A;  5J2Q B;  3NRB A;  4R0E A;  1VIS A;  1N36 F;  4UUW A;  4NEZ A;  4N76 A;  3H2V E;  4B9U A;  2Z8Q A;  1IBK J;  2MKI A;  1BWE A;  4I2P B;  1DUR A;  1RWM B;  1U7L A;  1VQ6 S;  2VQF J;  4ZVF A;  2HGM A;  2W7A A;  3UQS A;  3W5X A;  1VC5 A;  1GQE A;  2OMO A;  2YNI A;  2QG9 B;  4B3M F;  4K4X A;  3CNQ P;  2EWH A;  4RW8 B;  3R7B B;  4NXM J;  3QJL A;  1ZM3 A;  3KMQ A;  4HAC A;  5LSO A;  2RJZ A;  1HMV A;  1RAD B;  5ETM A;  1WWH A;  4UQG A;  2GVZ B;  4C2M A;  2KVI A;  1HA1 A;  3PO5 A;  3PX4 A;  3I5C A;  1HI0 P;  2VOP A;  2U2F A;  1DAR A;  2W7O A;  3ICL A;  2MTL A;  2YKA A;  1WTF A;  4PYA A;  3KLG B;  3H25 A;  3SEO A;  2HVH A;  3I4H X;  4DR1 F;  4WFB Q;  2UU9 J;  3CED A;  1PYS B;  1S9G A;  2FY8 A;  3I32 A;  3I5A A;  5M2U A;  2FLL A;  2I38 A;  4K4S A;  4B9M A;  5HAT A;  5A8K A;  1XEZ A;  3MAH A;  1UET A;  4NLU A;  1VHI A;  1F2G A;  1GH8 A;  1Q86 T;  5K8O A;  3TJ9 A;  4YY3 F;  2V94 A;  3FKB A;  2Q66 A;  1YJU A;  2WON B;  3GYX B;  3G9C A;  1TKX B;  4F2S A;  4HDG A;  3W63 A;  4JI2 F;  3MR2 A;  2IY5 B;  4GRS A;  4CO5 A;  5KG1 A;  4GKJ J;  1R6V A;  1U47 A;  2QA2 A;  3THT A;  3LGN A;  4RNN A;  1SKU B;  3SV3 A;  3ENA A;  4C0H A;  4ZIV A;  1U09 A;  1QAY A;  2MKS A;  4ZVO B;  1BQM B;  1KOH A;  3ZTO A;  1Y3K A;  4X62 J;  1EAY C;  4DS4 A;  1YZ6 A;  1FX4 A;  2IBO A;  3SQG B;  1K1S A;  2LP4 A;  2JLF A;  3FEX B;  1QAX A;  3J7Y U;  4OI4 A;  4Q2M A;  4ZPW R;  4DXL A;  4DX6 A;  2XMJ A;  2LVW A;  1VQ5 S;  3M9O B;  1YRT A;  4IFV B;  1IJE B;  2LU2 A;  1IN0 A;  3L7P A;  1XBW A;  3NBP B;  1WNE A;  4ZVT B;  1RU2 A;  2DR6 A;  4OHY A;  1FDA A;  3ILO A;  4ETZ A;  1JLB A;  1S7I A;  1SC4 B;  4W98 A;  5LMN J;  1OSC A;  5A8W A;  3G82 A;  5GAH I;  1R0C B;  3D2W A;  4O3R A;  4NLV A;  4WE1 B;  2KH9 A;  1N48 A;  3MMB B;  3ZZR A;  4USU A;  2IAJ A;  1TL1 B;  5IWA J;  2R9L A;  2L9D A;  5L1K A;  2XUL A;  4TU9 A;  3HVW A;  1R0A B;  4I7F B;  1UZH A;  2ASY A;  2HND B;  1IKW B;  1QE1 A;  4F8R A;  2JFK A;  5KOX A;  5DS7 A;  2HFU A;  5D3G A;  1EZZ B;  1ZTW A;  1ZAW A;  2F8H A;  3K2Y A;  2ZVS A;  2GW8 A;  2P9E A;  2HHU A;  3FZB A;  5G4D A;  4ZP6 A;  1TUG B;  3DHX A;  2IC3 A;  1SJ3 P;  4AQY F;  2CZ4 A;  2Y0S D;  5CH7 B;  5LJ3 Y;  5HLF A;  4J9P A;  4DV5 J;  1SKS A;  3NMR A;  2VBX A;  3CUN A;  3MCS A;  2ZZM A;  5A0Y B;  2JFD A;  1W2I A;  1N5S A;  4ZA1 A;  1U0S A;  4KO0 A;  2I2Y A;  1RQ0 A;  3SCJ E;  4B9S A;  2DHA A;  1OYE A;  3EGN A;  4FP9 A;  5THW A;  4DS5 A;  2DGX A;  3ETM A;  2U1A A;  2A10 A;  2IRX A;  3OFG A;  3QLH A;  1S49 A;  3W9H A;  5F8H A;  2GQQ A;  1DTT B;  2W9B B;  2UUC J;  2WSE C;  2YWE A;  2V8D A;  3P8B B;  4IFY A;  1ZPV A;  1WOP A;  2B8P A;  3CDU A;  4C3M A;  2RDD A;  3W9J A;  2OSQ A;  5E3R A;  1NBE B;  4ZLN A;  2BDP A;  3A3P B;  3DU6 A;  1BWV A;  3RTV A;  1VR6 A;  1XMO F;  4A8K A;  1HQ2 A;  1G4C A;  1RAC B;  2XZW A;  3ISZ A;  3H59 A;  4BWM A;  4CLS A;  1C1B A;  1M1H A;  2ZD1 B;  2A6O A;  2IIH A;  2DCU B;  1VC0 A;  1RK8 A;  5F8M A;  2D3O 1;  3MED B;  3CCS S;  1EP4 A;  3IC1 A;  1MRO A;  3T3F A;  1SC1 B;  4A8Q A;  2YPY A;  4GO5 X;  1BC6 A;  2OP5 A;  1GTE A;  2BOP A;  4ILM A;  2MKH A;  4YB7 A;  2NLW A;  4JOU A;  4NRU A;  4DFJ A;  4F26 A;  1YJ9 S;  1VQS A;  4FXV A;  4HR2 A;  3BBF A;  3MM8 A;  1B0P A;  4G1Q B;  1EIY B;  3PW2 A;  1RAA B;  2GCF A;  2HK3 A;  3RAM A;  2HHW A;  5I3U A;  1ZM2 A;  3HHN B;  2CJ9 A;  1NDK A;  1KLM B;  1CEZ A;  2B6A B;  5DDR C;  1YZ7 A;  4N41 A;  1WUU A;  4I6A A;  4N56 A;  5K14 B;  1Z2Z A;  1JLE A;  2FJW A;  1TKD A;  2QX0 A;  4XK8 C;  1T9Y A;  1RWN B;  4HH1 A;  4URG A;  1FRJ A;  4TY8 A;  1S76 D;  4ZN1 A;  2CPZ A;  4CT8 A;  2KG1 A;  4PKD B;  5F8G A;  4UZB A;  4QWE A;  3JSM B;  4F25 A;  1HPZ B;  2G4B A;  3N28 A;  3QIP B;  1RHM B;  1TMM A;  1HBN A;  4G65 A;  2MGZ A;  2NYH A;  4QW9 A;  1HWU A;  3U7J A;  4C3K A;  1B64 A;  1W7W A;  3R1H A;  3C8Y A;  2UXD F;  3NAH A;  5B0E A;  3UR0 A;  1IKV B;  1CQM A;  2HK2 A;  3J7A 1;  4ZJL A;  5GAE U;  1RGV A;  5FDL B;  2V2V A;  2XY7 A;  4DEZ A;  2PN6 A;  1F2H A;  2F63 A;  2ROG A;  1JQG A;  4K7Q A;  1BE4 A;  3KK1 B;  4ID8 A;  3MDF A;  3MR6 A;  1P8G A;  3I55 S;  1UFW A;  1NSQ A;  2OPS A;  1R0B G;  2XCA A;  4M5D B;  1LW0 A;  2WRM A;  2W01 A;  3M8P B;  3TJA A;  2JHE A;  3TEH B;  3TO8 A;  1YI2 S;  2O01 C;  1JLF A;  2PFD A;  3UNG C;  3L7O A;  3WC2 A;  3MPY A;  3D3B J;  3HXM A;  4FYX B;  4WIQ A;  2C2K B;  4PG5 A;  4BCA A;  1S59 A;  3NGS A;  2J76 E;  5ETQ A;  4FVC A;  4NLT A;  1N33 J;  2HFN A;  4IG0 B;  3B8H A;  5DG8 A;  4MKY A;  2KZZ A;  2VC0 A;  3VV2 B;  2ZM6 J;  1B0T A;  1FKO A;  2GMH A;  2GHP A;  1NJX A;  4KC5 A;  2HEK A;  4RKU C;  1SJR A;  3MXH P;  2QMU B;  3Q22 A;  4HTI A;  3OUY B;  2RF2 A;  2YQ0 A;  4IQM A;  4ZVG A;  4RWW A;  3TAM B;  3AJD A;  4NLR A;  5DQI A;  1LK5 A;  2DNG A;  3UW1 A;  4CLU A;  3IS9 B;  4B3S F;  1M5S A;  2B9Y A;  2W2Q P;  1AXQ A;  2D3U A;  2KJW A;  4ZLJ A;  1DFD A;  1HNV A;  2H48 B;  3OTD A;  2E7W A;  4DF4 A;  2KRR A;  2IA6 A;  4M5H A;  1SQG A;  3LH2 S;  5HO4 A;  2DXF A;  3CTR A;  5DRK A;  4P7V A;  1PG5 B;  4ANE A;  1RKI A;  3SSS A;  4RPF A;  2R8H A;  3RAX A;  2RHQ B;  3SCL E;  5J1E A;  2EFP A;  2VPZ B;  3E51 A;  2WBM A;  1SIZ A;  3O6Q A;  3RBZ A;  4DV2 J;  2CWX A;  3MCM A;  2PA3 A;  5B0C A;  2MQP A;  1HBM A;  2MY7 A;  3GYN A;  4FYD A;  3MUT P;  1IJF B;  4R8U A;  5KFO A;  4JI3 F;  2A18 A;  3D6F B;  4O3S A;  1TL3 A;  1U1N A;  1Q5V A;  4DX8 H;  3I9V 9;  1IVZ A;  2F4V J;  3AB2 B;  2J9E A;  2DNY A;  4LUB A;  4ELV A;  3GP9 A;  1FTR A;  3IWX A;  3WX8 A;  3ZZT A;  5HMY A;  3J81 U;  4TLR A;  5CCL A;  3HJV A;  5J2N A;  4C8L A;  3G6X A;  1Y5N B;  3F44 A;  1YJW S;  3ZTP A;  5C2G A;  1OYD A;  2FJB B;  3TVK A;  3TAP A;  1YIJ S;  2OUG A;  1WKL A;  1MMD A;  1YRU A;  4MJK A;  1XMQ J;  3RW6 A;  2PC6 A;  5DET A;  4DR7 J;  4WCE Q;  2JOQ A;  4DI6 A;  3CD0 A;  3IP0 A;  5GME A;  1ELO A;  1Q4R A;  4ZLL A;  5DLG A;  2R8K A;  3BGR B;  4RL1 A;  3Q0A A;  3DI6 B;  5CQG A;  3W8P A;  4ECV A;  2VFS A;  1Y4Z B;  3QMQ A;  1VQP S;  2WSC C;  3CD7 A;  2E9T A;  1AA1 B;  5D4N A;  2MDA A;  1Y7P A;  2YNH A;  3FRY A;  3MOJ B;  1A6L A;  1HWI A;  5KFP A;  1SUQ A;  3HSD A;  1S1W B;  3ZZ0 A;  2EPI A;  3OJU A;  4Q45 A;  3BN7 A;  4G1P A;  1W26 A;  1YBU A;  3DRP A;  1VOM A;  3O44 A;  1QSS A;  4CRJ A;  2FJX A;  3EDQ B;  2R8I A;  1SXL A;  4LFA F;  1C0T A;  4ZVS B;  4B02 A;  4M5J A;  3H5X A;  3M8Q A;  4DV1 J;  1LV5 A;  1RCX B;  2N4D A;  3OL6 A;  1RDR A;  3IBF B;  3RB4 A;  1UJ4 A;  2VJV A;  5H9F J;  1HI1 A;  1IWG A;  1NSK L;  4CLZ A;  2IHR 1;  3DKD A;  5LJ5 Y;  4RZR A;  1CJV B;  1Q8K A;  2VG5 B;  5B0G A;  1DQ9 A;  3HVT A;  3DRS B;  2AYG A;  1KBR A;  4XO0 A;  2KT5 A;  3UVJ B;  2Y1L B;  2VFR A;  3GJR B;  4DX7 A;  4LSN A;  2GZO A;  1WC0 A;  4YS2 A;  3EJM A;  1NZA A;  3MEC B;  1SJF A;  4OJH A;  3HT0 A;  1C4C A;  1FCA A;  3HM9 A;  3S6E A;  4DR5 F;  3HHK A;  1FT8 A;  1KQG B;  3MAA A;  2AMC B;  2Y8Y A;  4LF6 F;  3CJR A;  4HYK A;  2YNG B;  1SCJ B;  2QC3 A;  1JXV A;  4CLT A;  2X51 A;  4JI7 F;  4P71 A;  5L39 A;  5JVG Q;  1RTD B;  1QVG R;  1Q8B A;  4DR3 F;  1FJG J;  4X62 F;  1WDD A;  3SFG A;  4ZCI A;  1YGY A;  2BW2 A;  2BKN A;  1S1U A;  4DV4 F;  5JJB A;  3FGV A;  3MM7 A;  3UDE A;  2Y1J A;  2ZKU A;  1WG1 A;  3CCR S;  1LW2 B;  2J8S A;  3MR5 A;  3KUE A;  2Q1L A;  1GX6 A;  3TW0 A;  4FNH A;  1IBL F;  1U1M A;  1Y5L B;  2DY9 A;  3PY8 A;  4OJG A;  4DPY A;  2GC8 A;  1SC3 B;  3Q8V A;  3HFK A;  5DQH A;  1BGX T;  3GIJ A;  3W2V B;  2C1E B;  3P49 B;  3V5R A;  4CLL A;  1X9W A;  1U8W A;  4PR6 A;  1YJT A;  2NPI A;  1C1C B;  2B4P A;  1JKH B;  4PQU A;  1EHW A;  1VIO A;  5LSL A;  2B8Q A;  4DSL A;  1Q5Y A;  5EGY A;  3KLI A;  3DGP A;  1OY9 A;  3KFW X;  3OFF A;  3BKT A;  4P72 A;  2WVF A;  3DDI A;  4KHM A;  4M8L A;  4FS1 A;  1H73 A;  4EMD A;  2K3I A;  3OSP A;  4KGX B;  3D6M B;  3QT5 A;  2C3M A;  4WKR A;  1DLO A;  3A3O B;  4L76 A;  3NWR A;  1B7F A;  1S79 A;  2MEW A;  4KTQ A;  4OZ0 A;  4Q43 A;  1LQ9 A;  3TEG A;  4NOH A;  4PG8 A;  2F65 A;  3DOM B;  4A4J A;  1FTC A;  1SJ1 A;  2GQ2 A;  2PEH A;  3QT7 A;  2BE2 B;  3CJQ A;  2AJ1 A;  2CG8 A;  4CO4 A;  2OI2 A;  3M8Z A;  5KFK A;  3TAN A;  1T05 B;  2BAN A;  4OZJ A;  3NGD A;  1SQE A;  1URN A;  1DQ8 A;  4AT1 B;  5DZ6 A;  4KBI A;  2JEJ A;  4ZHR B;  4CNY A;  1IBM F;  3QRR A;  3J80 U;  3I9Z A;  2HRY A;  3J81 Y;  1DRZ A;  4WK3 A;  5CHC B;  1WSR A;  4LRE A;  1UCN A;  1TL7 B;  1RT6 A;  3HLU A;  1U1K A;  3FQL A;  3E3X A;  3C19 A;  2QL5 B;  2O67 A;  4DQQ A;  1FF2 A;  2O5D A;  1WHY A;  2RQM A;  3GJQ B;  5CYQ B;  2VPW B;  3ISN C;  1RWP B;  4LIW A;  1UKU A;  5DO2 A;  5E3A A;  2HWH A;  5F9N A;  3I0S A;  4OYO A;  1UPM B;  1JJ2 R;  3C6U A;  4M5L A;  4DG1 A;  1D1U A;  1D3W A;  4O4G B;  3ZXW A;  3OTE A;  2RDI A;  4UOF A;  1RT4 B;  1X4H A;  4FXW A;  3CO0 P;  3MM5 A;  4JI0 F;  4WFZ A;  4OJ3 A;  1SJ4 P;  4EFA C;  2CJK A;  3SQO P;  4LBI A;  4DR6 F;  3DYA A;  1FJ7 A;  2PO4 A;  3H98 A;  5D0E A;  1JLA A;  4EZ6 A;  2UVW A;  4R5P A;  2E5I A;  3SDE B;  2OPP A;  2NPF A;  2ASL A;  2HFZ A;  3KG0 A;  2HVD A;  2B9E A;  3CDE A;  2AEM A;  5DDO C;  4I2Q A;  2N4C A;  2OPR B;  2QA4 G;  1KQS R;  2MLZ A;  2UXB J;  2ZH7 A;  3T6B A;  3OTC A;  2ZH3 A;  2DK2 A;  1JLG A;  4DQI A;  1WEZ A;  5AXK A;  2DH9 A;  3KLE A;  3QAT A;  4X66 J;  3KG4 A;  2J0Q D;  2GA7 A;  1CJT A;  2CPF A;  2LQJ A;  2FHJ A;  3DLE A;  2DGS A;  2R7R A;  3WZ0 A;  3CD5 A;  4ICL B;  4KY3 A;  3JTO A;  4RUA A;  2M52 A;  2ZWP A;  4WYW A;  1NDC A;  2GHW A;  1SKR A;  3T5L A;  2JC1 A;  2ZVI A;  2VBZ A;  3OFH A;  5AXN A;  4ED1 A;  1TU0 B;  1YWX A;  4LBH A;  5LT5 A;  1Y0H A;  5A8R B;  4X4S A;  3FMB A;  1FK9 B;  3H5Y A;  3OQ2 A;  1T0T V;  4KKO B;  3P4U B;  4F0M A;  4QPT A;  4HTJ A;  4DDF A;  2Z58 B;  2AJF E;  4NAS A;  2AT1 B;  2HYI B;  2P6T A;  1RT1 A;  2MQ8 A;  3FDS A;  3QJJ A;  3ZZZ A;  3PEJ A;  2VG6 B;  2XQC A;  5HVF A;  4ECU A;  2E5G A;  2BAC A;  3GR0 A;  4DSJ A;  2BYC A;  3EWG A;  2HHS A;  4LRB A;  4QYZ K;  4DQP A;  4C9D A;  3VVU A;  2BKO A;  2V69 A;  2VON A;  2A6M A;  1TK5 A;  1PC4 A;  1TVR B;  1X0P A;  3OHB A;  3D5M A;  3L3C A;  1LWE A;  1HFE L;  1GMW D;  3TOQ A;  4HI1 A;  1U6Z A;  1VI7 A;  3CW2 C;  4JYA F;  1CUL B;  1VRU A;  4RR5 A;  3K89 A;  3I0R B;  2G2Z A;  4DCJ B;  4C11 B;  1V9O A;  3DOL B;  2V4Q A;  2BQU A;  2N82 B;  2VZ9 A;  3LAK A;  1N5Q A;  3MMA A;  1RAG B;  3EUN A;  2DRB A;  3QSY B;  4F0K A;  1XNR J;  3DLG B;  4RW9 B;  5CZX A;  2VC1 A;  4KHP J;  4X2B A;  4QWD A;  4P6Q A;  1FJC A;  4LBP A;  2V9W A;  3OR1 B;  1JLQ A;  1ARO P;  4N8O A;  3MI7 X;  4C8Z A;  1SI9 A;  4TQR A;  1IR2 A;  3BPD A;  4WWS A;  1HHS A;  5A6W A;  3UFC X;  4QR1 A;  3SSR A;  2PII A;  4HKQ A;  1RT3 B;  1AFJ A;  5B08 A;  4PG6 A;  1FRL A;  4NZ6 A;  1X5O A;  5FD1 A;  4QYR A;  1VBK A;  4DPU A;  3H4B A;  2VIH A;  5E5N A;  2OEM A;  4URS A;  1FD2 A;  2LYV A;  2XLJ A;  5J2P A;  5DQG A;  4RW6 A;  5GAD I;  4JI4 J;  3AOB A;  2ZE2 A;  1SL0 A;  3P6Y C;  4LF2 A;  1U1R A;  1KSP A;  4USV A;  4HHJ A;  4MTP A;  4H4O A;  2YNI B;  2HZA A;  2BZ2 A;  5KT5 A;  1J5E J;  4ZVR B;  4QU7 A;  3KK2 A;  4I68 A;  2FC9 A;  4ED3 A;  2B7C B;  4HAC B;  1VQ8 S;  1HMV B;  2CQI A;  1RTJ B;  3I4P A;  1UTA A;  3NCQ A;  2CAJ A;  1H3D A;  1TAU A;  4I6Y A;  4NMX A;  4MIB A;  4UY8 T;  4Q5V A;  2LA6 A;  2DGQ A;  1NEE A;  4XTT A;  2KG0 A;  1V6H A;  4DR2 F;  4KIA A;  1YTY A;  3D0I E;  4B3T J;  3TRG A;  1RHR B;  2Z30 B;  5KG2 A;  3MR7 A;  5DM7 Q;  1S6U A;  3UWT A;  3RGI A;  3T5J A;  4Q0B A;  3MWB A;  1P9Y A;  2RNE A;  1S9G B;  2ADB A;  4AYB D;  3A8E A;  2VOO A;  1XR5 A;  3DLK A;  5HRO B;  3OSN A;  3OTO J;  3KK3 A;  1PJ5 A;  5A8K B;  2CDQ A;  4AND A;  1KR4 A;  2A2D A;  1NSA A;  3N6M A;  3J80 Y;  4JI5 F;  1S0N A;  2FTR A;  3FNN A;  1H6K X;  2CNL B;  2V8G A;  4WII A;  2EBE A;  3TQE A;  4DUY J;  2F4V F;  1GMV A;  5AE2 A;  4O0N A;  4QIW D;  3IG1 A;  2DR5 A;  2D41 A;  1UZD A;  5B0D A;  3NXZ A;  1O0P A;  1X9M A;  1NJY A;  2VPX B;  3AOA A;  2AYB A;  1HQU A;  4X65 F;  2QLW A;  2AF6 A;  3QAU A;  2H1Y A;  3CUL A;  4K4V A;  3CC2 S;  1HYS A;  2XMV A;  4WZM A;  3TZY A;  1S0O A;  4AUK A;  3BR8 A;  4LSZ B;  3QFH A;  4CH1 A;  4LF9 J;  1F5A A;  1VIX A;  4WP3 A;  2GML A;  1SH2 A;  4YR2 A;  3VAG A;  1OMS A;  5SZT A;  2UV8 G;  2HUR A;  4CH7 A;  1DAX A;  2EFQ A;  3IBW A;  4Y2C A;  2GHV C;  3TP2 A;  5J2M B;  4XDD A;  5JXS A;  1BQN B;  4TQS A;  2PSZ A;  3KG1 A;  4PZV A;  2ZOG A;  4LRD A;  4YEA A;  4OX9 J;  3BSO A;  1U24 A;  3O8W A;  1KEK A;  1RCO B;  5KG0 A;  4N8N A;  1T3N A;  2B3T B;  3GMG A;  4ZVP B;  2C22 A;  3K8V A;  1AZS A;  1EB0 A;  3DLL Q;  5A8W B;  4DL5 A;  3G82 B;  3NGR A;  2BEF A;  2KXH A;  3OXG A;  1S4E A;  1RWX B;  4A8S A;  5FLX U;  3V4I A;  2Z2Z A;  5KG6 A;  2K1R A;  2DGW A;  4IR1 A;  2RE1 A;  5IZH A;  5F3Z A;  2OHD A;  5LXY A;  2QFI A;  4IO1 A;  5BJR A;  2H54 B;  1QE1 B;  2W9A A;  4DX5 A;  2J0X A;  4RLE A;  1QD1 A;  3B4D A;  3TX0 A;  4LF5 J;  4Q2L A;  3Q8P B;  3UNY A;  4W90 B;  2QLJ B;  2JRS A;  4NXN F;  2IC3 B;  2BJ3 A;  5HLF B;  5HK4 A;  1RHQ B;  5IT9 Y;  4B3R J;  2IDL A;  1IKX A;  5L9X A;  3G96 A;  1HQE A;  5EX3 A;  4JI8 F;  1FRH A;  2JEI A;  1REV B;  5HQM A;  3RB0 A;  4KGM A;  2ZBC A;  5D15 A;  3JAM U;  4EO8 A;  1N36 J;  4USJ C;  3CJ2 A;  3WHI A;  2MMY A;  1RKJ A;  4RW4 A;  3K8W A;  5K8N A;  1M1G A;  2O3D A;  2DR9 A;  2DJW A;  3PW4 A;  3BGU A;  2WCX A;  1NB7 A;  4EI2 A;  1HHQ A;  3PHE A;  1FJG F;  2FVC A;  1VCT A;  4ZPA A;  3W61 A;  2W9C B;  2QL9 B;  5KFR A;  1APS A;  2ADC A;  3T1Y F;  2LU1 A;  2OAU A;  2O1P A;  1V5V A;  3C6T B;  2R42 A;  4IFY B;  3QSI A;  1NRK A;  1KVK A;  1DQA A;  4A48 A;  3GFX A;  4FS2 A;  3HZE A;  2BJ8 A;  1XIQ A;  1ZAV A;  2R7V A;  3HFZ B;  3ULH A;  8RUC A;  2BQR A;  2AJ0 A;  3NGK A;  2EFG A;  3PW0 A;  2ZBP A;  3D1O A;  4DR1 J;  1EP4 B;  1MRO B;  3PO4 A;  2DPI A;  2RQK A;  2V4R A;  3GSI A;  3ILL A;  1ZBT A;  2XM3 A;  2JLG A;  2QV6 A;  3GPA A;  3FBE A;  2M4M A;  3TAQ A;  3CCQ S;  3J7Z T;  1X60 A;  3GV8 B;  2RQC A;  2V8H A;  4YY3 J;  1UFL A;  3LQV A;  3OVS A;  4YHH F;  2L9N A;  3SZ2 A;  1PAU B;  2PEB A;  3MM8 B;  3WDO A;  2VB6 A;  4DPX A;  1CQN A;  4JI2 J;  1U6B A;  3MMJ A;  2XMW A;  1TL5 A;  4IQX A;  4KQZ A;  3PCO B;  5F9L A;  2UP1 A;  3GG0 A;  1Q7L B;  1RE1 B;  1JLE B;  1JJ4 A;  3NLC A;  3Q8U A;  2XS2 A;  2YY3 A;  3A12 A;  5AXL A;  1K9M T;  2XI2 A;  4TY8 B;  4M95 A;  1GX5 A;  4QWB A;  1NHU A;  4YP3 A;  3HHD A;  4F04 B;  4X64 F;  1HBN B;  4B9L A;  2RAQ A;  2DYA A;  1ZET A;  2MGZ B;  3BPS P;  3GR1 A;  2IFX A;  2DIU A;  3GQC A;  2QMX A;  1RXO B;  3KYL A;  3IM8 A;  2J9D A;  1RB0 A;  4LJM A;  5ETP A;  5L1L A;  2EC0 A;  2C3P A;  4B3O A;  4WPA A;  2FHO B;  4HHU A;  3BF4 A;  4C8M A;  1NAQ A;  5E3C A;  4A8F A;  4OZL A;  1YHQ S;  2DVI A;  2WK4 A;  2LLZ A;  2MZQ A;  3NCP A;  3IWL A;  3UD4 P;  3CCW A;  3BM7 A;  1U1L A;  2HS3 A;  3K7R A;  1WG5 A;  1Y00 A;  2M7S A;  4RBV A;  4CYU B;  2WOM B;  2FC8 A;  3LWL A;  4QW8 A;  2OPS B;  4ZOS A;  1GXU A;  2OO4 A;  1SL2 A;  3UPF A;  2K2P A;  1E6V A;  1LW0 B;  4ZPT R;  2ZBI A;  1JJH A;  4OI2 A;  2V63 A;  5CXT A;  5KFE A;  2WTF A;  1X4G A;  1JLF B;  3GIR A;  1GK8 A;  2F3J A;  3IBC B;  4I4B A;  3L4B C;  4K59 A;  4OHZ A;  1TR0 A;  4F02 A;  1WDT A;  2OML A;  4BC9 A;  3KHR A;  2Y9H A;  4AQY J;  3CCL S;  1T9V A;  1PJ6 A;  3LW5 C;  2XY6 A;  2N3O A;  4C97 A;  3SYZ A;  2QMW A;  1IQT A;  3ZTR A;  2X1A A;  3N6L A;  1FKO B;  1RHJ B;  3BH7 B;  4DN9 A;  3KLH A;  5GAG U;  3D54 A;  3ITH A;  2NYI A;  2KB2 A;  4AXI A;  2J7W A;  1S9E A;  1PYT A;  3OR2 A;  2EXU A;  5KFA A;  3QGH A;  3PXG a;  5FLX Y;  4J9S A;  3NOC A;  4X4O A;  2RF2 B;  4DWI A;  4IO9 Q;  1OPZ A;  2RSQ A;  1EKR A;  2XZD B;  2V8P A;  4ERD A;  3THP A;  3I31 A;  3TWZ A;  2F8E X;  4NLW A;  2R7T A;  3EGV A;  2J8A A;  1D8Y A;  1RBL A;  1WHX A;  5GVQ A;  1DBD A;  3CPW R;  5C5J A;  1IBC B;  1HNV B;  3PTW A;  4AD6 A;  3KNA A;  2HLU A;  1XMO J;  3M1V A;  5E3P A;  1XC9 A;  2P9G A;  3Q8Y A;  1NK0 A;  5J2Q A;  2YTC A;  1M5O C;  3OVB A;  1RA7 A;  2RS8 A;  1TKZ A;  3M2R A;  1FER A;  1R8A A;  4LT6 A;  3SBM A;  4FYW B;  1WOO A;  1WF1 A;  5KFZ A;  5C42 A;  1EX8 A;  2WBR A;  4O44 A;  5HN0 A;  3W64 A;  3H5U A;  5J1E B;  4OQJ A;  2FLO A;  4USK A;  2ZHO A;  3WIU A;  3CCJ S;  2LQ5 A;  5HQ8 A;  1PIL A;  1HBM B;  2VA2 A;  1RT7 B;  1VRQ C;  2D1C A;  4KGK A;  2YWH A;  1I51 B;  3N01 A;  1T9T A;  4R8U B;  4Y65 A;  2YNF B;  2IJN A;  2WW8 A;  4IRK A;  2R2R A;  1FD8 A;  1TL3 B;  1PYO B;  5E2Q A;  4A8W A;  5A76 A;  1AW0 A;  4NLS A;  2E29 A;  1L3S A;  1J2V A;  1RBA A;  4OZN A;  2H51 B;  1RP5 A;  3KLG A;  1DY3 A;  2ZWO A;  3DGV A;  5J2N B;  4J9N A;  3IR5 B;  4LFB F;  4PEO A;  2HAF A;  4IOA Q;  1KNZ A;  3M6W A;  2RDJ A;  4B17 A;  2ZNZ A;  3EVO A;  2ACY A;  1FKA F;  4U7U D;  1EQ0 A;  4DL0 C;  4DPW A;  3C2P A;  2H5I B;  2YX7 A;  2V0N A;  2YKO A;  4WU3 A;  2AZ3 A;  2ZH6 A;  2D3Z A;  2XGP A;  2XMK A;  2AX0 A;  3GFZ A;  1YKW A;  3RUB L;  2XCP A;  1F3F A;  2AQ4 A;  4ES2 A;  1Y3J A;  5ETV A;  2XMA A;  4DV7 F;  2UXD J;  4CLF A;  1GAO A;  3ADA C;  4XIU A;  1NLK L;  3ELH A;  1HD1 A;  3PEH A;  2YNH B;  3PYF A;  2ZKT A;  3EDR B;  1SUQ B;  3BSN A;  3OPK A;  2CJQ A;  1BQM A;  2EBG A;  3DRP B;  3R8Y A;  2WHO A;  2G1H A;  3SQG A;  5CA5 A;  1F9E B;  4F7V A;  4DPT A;  1A7G E;  1IWA A;  2ERR A;  3PYG A;  2HQG A;  3M8Q B;  5KG5 A;  3WIV A;  1YVF A;  1YLX A;  3I96 A;  1TFY A;  2NUU G;  4EYH B;  2V68 A;  2E5H A;  1LKZ A;  2AKW B;  4DJB A;  1YBT A;  2E5L J;  4F3Q A;  2M0G B;  4DV6 F;  1FJE B;  3HVT B;  3OTB A;  2HFS A;  4FPI A;  3W65 A;  3MF5 A;  1WG4 A;  4BBY A;  4RNO A;  2FJE B;  4HL9 A;  4V19 X;  5J1P A;  3FVY A;  1KHV A;  4OZ5 A;  3CJK A;  4DN0 A;  2PMH A;  3W5Z A;  5FII A;  5IQQ A;  4CNZ A;  3OXL A;  1BUX A;  3MAA B;  1LWC A;  2QLB B;  1HBU B;  1RAO A;  2M5Y A;  2Y3Y A;  4IKA A;  3GCX P;  3MM6 A;  2G13 A;  1WOR A;  3FFI B;  1IXK A;  3EVM A;  3POT A;  4FVM A;  4RX6 A;  1YK9 A;  1HR0 J;  4NRT A;  1MWZ A;  3TUJ C;  3W5Y A;  3GIM A;  4B3S J;  2KVQ E;  2LMI A;  3MHY A;  3BEG B;  3TZX A;  1FRK A;  2QA1 A;  1N56 A;  1HD0 A;  3IM9 A;  5H9E K;  1S1U B;  1D9D A;  3MM7 B;  4HT7 A;  1ZZF A;  3IR7 B;  5E0O A;  3BJY A;  1UA1 A;  1SV5 B;  3MTK A;  1RAI B;  1FE4 A;  1X4E A;  1WF0 A;  2MKC A;  1I6J A;  3M2U A;  3CDB A;  3G86 A;  2J0W A;  3ZTQ A;  3UCU P;  3HO1 A;  4OX9 F;  3MEE B;  2X1F A;  1RTH A;  4DBQ A;  3EE3 A;  1VYA A;  2A1B A;  4L73 A;  1HW8 A;  3B54 A;  5KOW A;  4N5S A;  5BYQ A;  2V6A A;  3PFO A;  4K2J A;  3HVR A;  1XJW B;  4FF2 A;  2XLK A;  2XNR A;  4LRF A;  2HAI A;  3NGU A;  3AOD A;  2DIT A;  2QEX S;  4PQU B;  2LQB A;  3QPI A;  1EKS A;  2F40 A;  3C66 A;  2KO1 A;  4JI3 J;  3KLI B;  2KHC A;  3DGP B;  3EYZ A;  4O23 A;  1XER A;  4U7C A;  4M5K A;  4MH8 A;  1TQL A;  2FLN A;  4AE5 A;  3PNI A;  1R43 A;  2KL8 A;  2JEG A;  1R3N A;  1X4D A;  2N7Y A;  2HRT A;  2FHM A;  1YX2 A;  2LEB A;  1U6F A;  1DLO B;  4F4Z A;  4EZ9 A;  2J6T A;  3MMC A;  3AB4 B;  2COL A;  1NPK A;  3SI8 A;  1QAJ A;  4G6V B;  3QFW A;  2DXE A;  1R8H A;  3OV7 A;  4WP8 A;  3CSK A;  3C3L A;  1S6O A;  2BJD A;  4ER8 A;  4LR9 A;  5ITH A;  3HPO A;  3DOK A;  1G1X A;  1H74 A;  2F1F A;  3G6V A;  1AT1 B;  4JI1 J;  1OJ4 A;  4YOE A;  4O4R A;  3V6K A;  1KLM A;  3IR6 B;  5F0W A;  3VAH A;  4JB8 B;  2B6A A;  4UUX A;  3T1H F;  2BAN B;  2CZV C;  3U27 A;  4HLB A;  1Q0N A;  3OHA A;  4F4A A;  2GIQ A;  1SH0 A;  2Z57 B;  1HNX F;  3P5B P;  3FCH A;  2B5J A;  3JTN A;  2DHH A;  4ECR A;  4MK9 A;  2G9O A;  4P10 A;  3JSM A;  1RT6 B;  4Z7C A;  4LFA J;  2R3V A;  3M32 A;  1L5U A;  4B9T A;  4QWA A;  4ZJO A;  1VFJ A;  4USI A;  3ETO A;  1M0S A;  3F56 A;  2AX1 A;  2CZ9 A;  3PKM A;  4ZVH A;  3FSX A;  5L8R C;  3I0S B;  4CCH A;  1FKP B;  4UST A;  4XAK A;  3MZI A;  2HHQ A;  3C6U B;  3EZO A;  2KU7 A;  1S1V A;  4DG1 B;  4DUZ F;  3D0G E;  1A9N B;  4Y2A A;  2ZZT A;  1HI8 A;  1UVJ A;  2HBQ B;  3KK1 A;  4ED8 A;  3DYA B;  1ZTT A;  2XGQ A;  2GV1 A;  1KKH A;  2FYX A;  2ILZ A;  4NPO A;  2V67 A;  3JSR A;  1JLA B;  3R5B A;  4UY8 5;  2N3L A;  3GWC A;  2QRR A;  3KMS A;  4DU7 A;  4R5P B;  4DR5 J;  3FJ2 A;  2OPP B;  4K0K F;  2GJF A;  1GEH A;  5KFS A;  1JK9 B;  3M8P A;  3PRD A;  4LF6 J;  1ULR A;  4OYX A;  1ZYQ A;  4I2Q B;  3M9M B;  1KTV A;  3JTP A;  4JI7 J;  3LAL A;  3CB4 A;  3RZA A;  3H2U B;  1HNW F;  1JLG B;  1VJQ A;  2K8G A;  1VBX A;  3KLE B;  3AJ2 A;  2OD6 A;  1KOO A;  2JC0 A;  4PCQ A;  1CJT B;  2EW9 A;  2GIF A;  3DLE B;  4UF4 A;  3O1L A;  4OX8 A;  2ZBQ A;  3PW7 A;  4X84 A;  1XNQ F;  3CJ5 A;  4DR3 J;  4OIX A;  1N6Q B;  4YQW A;  5E41 A;  2CPX A;  2EK1 A;  1JX4 A;  3OBI A;  4DV4 J;  2K7K A;  4ZLP A;  2XMU A;  5KFW A;  4ZCM A;  4FBT A;  5F8L A;  1RLC L;  3FBB A;  4PXD A;  4W92 B;  3UO0 A;  3IA0 A;  1GFW B;  1PCA A;  1SH3 A;  3NY0 A;  2XSJ A;  4ENO A;  1NK6 A;  1N5Y A;  2E1R A;  3HMJ G;  4YB6 A;  1RT1 B;  5GAG I;  1IBL J;  4PYD A;  2CQC A;  1HWK A;  3JQM A;  5D0G A;  1S6P A;  2HKE A;  2GNK A;  2CQ2 A;  1UW4 A;  1VBY A;  3IRW P;  2W2M P;  2WVC A;  2OLW A;  1K44 A;  3SXL A;  3NGT A;  1NB2 A;  1RYS A;  4LF8 J;  2OJ3 A;  4A8X A;  3G8T A;  2ZUA A;  4EBC A;  1WKJ A;  4CQ1 A;  3HDS A;  1LWE B;  2DEJ A;  1ROF A;  2Q79 A;  2R8G A;  1SVD A;  1VMB A;  4ZPB A;  2C3U A;  5KG4 A;  3RBD A;  1VRU B;  1NKE A;  3MEG A;  4JV2 A;  1VDH A;  1JNZ B;  5KFU A;  2HNZ B;  4ZMM A;  2XTJ P;  5LOQ A;  4HT5 A;  2QZ8 A;  4NE9 C;  1QTM A;  1Z1Z A;  3MMA B;  1LFP A;  3AY0 A;  1RAB B;  3RR8 A;  3DU5 A;  2EKY A;  3G2X A;  4X4V A;  5KFY A;  3R3T A;  4TYB A;  1PBA A;  1NH7 A;  1WC5 A;  3LGH A;  4J90 A;  3B6B A;  2QE5 A;  2X7I A;  1NJW A;  1JLQ B;  1Q16 B;  4DR4 F;  3FEZ A;  3LP0 A;  4NA3 A;  2X3G A;  4D3G A;  5KFF A;  2BJ7 A;  1OQ3 A;  4OI6 A;  4FYV B;  2DNO A;  1Q79 A;  1WJ9 A;  2H3E B;  3IXQ A;  5KFG A;  3M6X A;  5BYS A;  3NAI A;  4P2X A;  1PIE A;  2HFV A;  3B82 A;  3KDN A;  2LEA A;  2W25 A;  2KDO A;  2OPQ A;  1RIS A;  2JL9 A;  2JLE A;  2HS0 A;  4GVL A;  5J2P B;  2YKM B;  2D7S A;  2XLI A;  5I4M A;  1S12 A;  1JLC B;  1WHV A;  2CKW A;  5C25 A;  2ZE2 B;  2E9R X;  5AXM A;  4V1A k;  2B51 A;  1IBM J;  3IAS 9;  4L72 B;  4KPY A;  2XBP A;  1A0O B;  3PX0 A;  3NWG A;  1F5C A;  3A3N B;  4WK1 A;  3KK2 B;  2M70 A;  2HIY A;  4WTO B;  3DM2 A;  2R7W A;  4D3H A;  3CMA S;  3BGR A;  3M9N B;  4DSK A;  2RD5 C;  4DL2 A;  3PYE A;  3DMJ A;  2ROE A;  2I0X A;  2HZC A;  1HW9 A;  4B9V A;  1S72 S;  1TV6 A;  4C98 A;  3PX6 A;  2XG8 A;  3QRQ A;  4C7Q A;  2BJE A;  3DRY A;  2AGQ A;  3OXF A;  4JI0 J;  1KQF B;  2CQD A;  3DLK B;  1RWU A;  3LF0 A;  4OFZ A;  3NL0 A;  2V2Q A;  3KK3 B;  4YDD B;  1RT2 A;  5KFM A;  1EET A;  4CDI A;  4NLY A;  4IG3 A;  3FCV A;  4DR6 J;  1FE0 A;  4ID5 A;  3ET6 A;  3I6P A;  3V81 A;  3M7V A;  5H1S V;  1KC8 T;  2C2D A;  3FBF A;  3OT9 A;  1U25 A;  3OFE A;  3UCZ P;  4NYZ A;  3IG1 B;  3N6N A;  3UN2 A;  2FJD B;  2QTW A;  4OJ1 A;  3DDK A;  3HKZ D;  2HNY A;  1U26 A;  1WEY A;  3D0H E;  4ATN A;  1KON A;  3DXB A;  1HQU B;  4A8M P;  3R27 A;  3BO4 A;  1B99 A;  3S7R A;  3MUM P;  3UVJ A;  1MSW D;  2CPI A;  2GJ2 A;  4DSF A;  1HYS B;  3ENW A;  3J7Z 5;  3HHL A;  4P52 A;  2KXN B;  1Z2L A;  1MNE A;  1B3T A;  3CMQ A;  2N7C A;  1UWB A;  3MPD A;  2PA8 D;  4QU6 A;  2CG4 A;  1RLD A;  2RHS B;  1M1K T;  3HHL C;  4RUH A;  3ZZY A;  1TTH B;  3AD9 C;  3BSA A;  4C8N A;  3LP2 A;  4YR0 A;  2HG4 A;  3G6Y A;  3AA8 A;  2ZC3 A;  4ECZ A;  2MSS A;  3P3D A;  5GAH U;  4RW7 A;  2G0J A;  3BR9 A;  1L3K A;  4OZ3 A;  4ECT A;  2IA0 A;  2F4F A;  1AZS B;  5K20 B;  5LSR A;  5KFD A;  2UXC F;  2BRK A;  2HFO A;  3GV5 B;  3VCD A;  1QUV A;  1H2T Z;  2OTL S;  5F41 A;  4JYA J;  3HSG A;  5KFN A;  3FUY A;  2F7V A;  3V4I B;  3CXC R;  2K1R B;  1HHT P;  1WKK A;  4YR3 A;  4YDX A;  5D4P A;  3L09 A;  2E5L F;  2CAD A;  4DHV A;  2WZ1 A;  2MY8 A;  3NNH A;  3ISN D;  2BMB A;  4OYP A;  2GVD B;  2RIL A;  2W24 A;  3AQP A;  2MYF A;  3OL9 A;  4NLQ A;  1C1C A;  2GX8 A;  1JKH A;  1IKX B;  5HMW A;  1HQE B;  2XEX A;  1O5J A;  3DRR A;  3NP5 A;  1T94 A;  1S5Z A;  4DF8 A;  5I42 B;  2OSR A;  1U0H A;  1F0X A;  2Z56 B;  1Q95 G;  2AGP A;  1NU4 A;  3U1N A;  3D1H A;  3VGS A;  2ALZ A;  2MZT A;  3Q8R B;  1ZZN A;  3TUI C;  5C24 A;  2EC2 A;  2JX2 A;  2IBK A;  4RW4 B;  1YSJ A;  2CJA A;  4IOB A;  1HR0 F;  1FVS A;  3VZH A;  1L3V A;  1FES A;  2ZH9 A;  4JV5 F;  2C3O A;  5ETS A;  3VGV A;  4DL7 A;  4C48 A;  4C8O A;  2LCW A;  4K8R A;  2LXI A;  4ITS A;  3LA0 A;  4ZCK A;  3VWS A;  4Y6I A;  4FPR A;  2K7J A;  1M5K C;  3CC7 S;  1N54 B;  2FVQ A;  3R9L A;  5EX0 A;  2I8E A;  2BE2 A;  2DGT A;  1IKY A;  2P6S A;  2VHG A;  1WC4 A;  1S77 D;  1UEK A;  4ILR A;  4DR2 J;  3BB5 A;  2MZS A;  4DUT A;  2CNK B;  2V9K A;  3C14 A;  3UN3 A;  2VDI A;  5LMU F;  1SB6 A;  3V6J A;  2BR0 A;  2PT0 A;  4ZJQ A;  2FHJ D;  3TA0 A;  2BKP A;  2I5J A;  3A8I A;  5F8J A;  2UVU A;  1U1O A;  4TU7 A;  1S0V A;  3EIC A;  4O3P A;  5IOL A;  4AFF A;  3LPE A;  1RAH B;  4M5N A;  3NNC A;  2C2M B;  2CNO B;  2DRA A;  4EBD A;  3K5P A;  4Y0F A;  2ZH2 A;  1N5V A;  3TZW A;  2X1B A;  2NQP A;  1CG2 A;  5HP1 A;  1WAC A;  4LFC F;  4JI5 J;  2K3K A;  4OYM A;  2ZJR Q;  3JXO A;  3QGG A;  2CQ4 A;  2KKH A;  5IXU A;  3E8O A;  2B0G A;  3MFI A;  4FKX A;  1SKW A;  3KXD A;  2OFG X;  4RBT A;  2HWI A;  1S7H A;  2MQN A;  1NM2 A;  4WXO A;  1H7X A;  2CJB A;  2VAS A;  4OLP A;  4X65 J;  5HMX A;  3A8J A;  2BJ1 A;  2DO0 A;  1VK8 A;  2JEF A;  4ETX A;  3PDN A;  1AYE A;  2AJQ A;  2BM0 A;  5IFM A;  1I1G A;  2P8I A;  4X4U A;  3QBC A;  1HWL A;  2KT2 A;  1JXL A;  4OHX A;  3M8W A;  4JI1 F;  2ALY B;  4WYL A;  2RU3 A;  1XN9 A;  7FD1 A;  3TVZ A;  2R7U A;  5L38 A;  1M5V C;  4K5S A;  4B3O B;  2OPR A;  5I3P A;  2CQ3 A;  4RNH A;  2RT3 A;  4MYT A;  5L1I A;  4LRA A;  3JS9 A;  2XYP B;  5K9F A;  5BR8 F;  3S8S A;  2YKN A;  3ZC4 A;  4F2R A;  2BE9 B;  4NA2 A;  3GON A;  4LF1 A;  3LP1 A;  3ZZP A;  2GAG C;  4QIE A;  3HD1 A;  2HQI A;  3QGP A;  1MMN A;  2W8K A;  3Q8S B;  4TKT A;  1X31 C;  2FUG 9;  2W4D A;  4I67 A;  3CGI A;  5A8R A;  2MQM A;  3J7Y I;  4IDK A;  1E6V B;  4RWX A;  1HBO A;  1P27 B;  4KKO A;  4ED0 A;  5D0H A;  4LIR A;  8AT1 B;  2XS5 A;  3RAQ A;  4DPO A;  2AZ1 A;  2W2O P;  4U9R A;  3ONQ A;  2GIR A;  4K50 A; 
#chains in the Genus database with same CATH homology
 1W7W A;  1UCN A;  3NGS A;  4UOH A;  1WKJ A;  3FKB A;  3BBB A;  3Q8Y A;  5BXI A;  3EVO A;  1WKL A;  3EIC A;  2DXF A;  1S5Z A;  5IOL A;  3FBF A;  3ZTS A;  1NSK L;  1PKU A;  4O0N A;  1LEO A;  4ANE A;  4W98 A;  1PAE X;  3BH6 B;  3EM1 A;  3VGS A;  4ANC A;  3DKD A;  4DI6 A;  3GPA A;  3FBE A;  2AZ3 A;  3ETM A;  2HVE A;  4FKY A;  2VU5 A;  1NHK L;  1ZS6 A;  3ZTR A;  3NGR A;  4KPC A;  2BEF A;  1F3F A;  1NDC A;  4HR2 A;  3PJ9 A;  3BBF A;  3BH7 B;  1HHQ A;  1NPK A;  3JS9 A;  3ENA A;  4EK2 A;  3PRV A;  3ZTQ A;  1NDP A;  2DXE A;  1LWX A;  1NCL A;  2DY9 A;  3G2X A;  3VGV A;  1BE4 A;  4UOF A;  3L7U A;  1B99 A;  4FKX A;  3EJM A;  4CP5 A;  1NDK A;  1HLW A;  1KDN A;  1WKK A;  1BHN A;  1NLK L;  3EE3 A;  3ZTO A;  3FBB A;  1VYA A;  3ELH A;  3Q8V A;  3FBC A;  2B8P A;  3B6B A;  1NSQ A;  4S0M A;  3VVT A;  3B54 A;  2CWK A;  3FCW A;  4ENO A;  1MN7 A;  4UOG A;  2DXD A;  1XQI A;  3BBC A;  3Q8U A;  4C6A A;  1HIY A;  3VGT A;  3Q83 A;  1BUX A;  1B4S A;  1U8W A;  3GP9 A;  5CAB A;  3Q86 A;  1S57 A;  5C7P A;  3FC9 A;  3NGU A;  3WX8 A;  1JXV A;  1NDL A;  1EHW A;  3R9L A;  2NCK L;  1XIQ A;  2BX6 A;  2HUR A;  3VGU A;  3EVW A;  1NSP A;  2B8Q A;  3EMT A;  3MPD A;  4F4A A;  3EVM A;  1K44 A;  3NGT A;  1NB2 A;  2AZ1 A;  5CAA A;  1NUE A;  3Q89 A;  3VVU A;  4AND A;  3ZTP A;  4DUT A;  2DYA A;  2HVD A;  4DZ6 A;  3DDI A;  4WBF A;  2ZUA A;  1F6T A;  1MN9 A;  4F36 A;  3FCV A;  1S59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...