1B4SA

Structure of nucleoside diphosphate kinase h122g mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleophilic activation by positioning in phosphoryl transfer catalyzed by nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 43
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1998-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1b4sA00
3BBCA 1NSKL 2DXEA 1XIQA 3BH6B 3FBFA 3ETMA 3VVUA 4UOHA 3ZTQA 3GPAA 2BEFA 1NHKL 1NDPA 3EJMA 2BX6A 3EVMA 3VGVA 3FCVA 2CWKA 1VYAA 3Q83A 3GP9A 1S59A 4WBFA 3VVTA 2DXFA 3PJ9A 1NUEA 4FKXA 4CP5A 1PKUA 4S0MA 2AZ3A 3DKDA 3FKBA 1MN9A 3EE3A 2NCKL 5C7PA 1LWXA 1K44A 4UOGA 3NGUA 1NSPA 1HLWA 2HVEA 4ANEA 4ANDA 3BH7B 4EK2A 1HIYA 2AZ1A 1F3FA 3ZTOA 4DZ6A 1WKJA 1KDNA 3Q86A 3EMTA 3NGTA 4ENOA 3FBBA 5CAAA 1B4SA 1NDCA 3EVOA 2DXDA 1NPKA 5IOLA 3VGUA 5CABA 1MN7A 2HVDA 1LEOA 3Q89A 1NDLA 4UOFA 4F4AA 1XQIA 3B6BA 4DUTA 1EHWA 3MPDA 3FBCA 1NB2A 3ZTRA 1S57A 1HHQA 4C6AA 1NDKA 4FKYA 3R9LA 3ZTPA 1WKLA 3NGSA 1NSQA 3JS9A 1W7WA 3EM1A 3NGRA 4HR2A 1NLKL 3ELHA 1UCNA 3ENAA 3EICA 3FBEA 3DDIA 1B99A 3BBFA 3G2XA 1PAEX 2DY9A 3B54A 1F6TA 3FCWA 3PRVA 4KPCA 5BXIA 3Q8VA 4O0NA 4W98A 2VU5A 2B8PA 1JXVA 3VGTA 4DI6A 1BHNA 2B8QA 1U8WA 2DYAA 3EVWA 4ANCA 3Q8YA 1NCLA 3FC9A 1ZS6A 3L7UA 3Q8UA 1BUXA 3VGSA 4F36A 2ZUAA 2HURA 1BE4A 3BBBA 3ZTSA 1WKKA 3WX8A 1S5ZA
chains in the Genus database with same CATH superfamily
2E5JA 4PXCA 4URSA 3FBFA 1FD8A 4M63A 5IWAJ 3G6XA 2VJVA 2H51B 3QNWB 3O8WA 3CO9A 1BWEA 2WSEC 1BQXA 1KQGB 3I0SB 1IKVB 4ZP7A 3FEZA 3UR3C 9ATCB 5ADZA 1SH2A 1NMEB 2C2ZB 5KFAA 1PG5B 2LXFA 5KFOA 2BE7D 3Q83A 3M32B 5DG9A 1IBLJ 4FVMA 3L95X 1ZOTA 4ZP9A 2G0JA 2BA9A 5J1NA 2UUCF 4FKXA 3BGRB 4QIGA 2LQ9A 2E5HA 2YVSA 3N01A 3V6DB 3I87A 4LF9F 2HS0A 3TAPA 2ADCA 1IN0A 2IYGA 1U45A 2WVCA 2R7XA 1TU0B 1Q78A 2XO6A 1S9FA 4R5PB 3IGNA 3NGUA 3P3DA 1GX5A 4LR7A 1WSRA 4KGZB 3LGHA 3R1HA 4RW9B 3KLHB 4C11A 1JXEA 3A3OB 5HMWA 1OYEA 4OX7A 3GCXP 1DTTA 2YH0A 4X4TA 5EWFA 4EWTA 3GQCA 4QU6A 3AQOA 4RW8A 4AYBD 2QFJA 2CPDA 4K5SA 1RLDA 1W26A 4CM2A 4DG1B 2F4VF 2BE2A 4ES1A 2BACA 3LWMA 3MCNA 2W7PA 2K8GA 2WONA 2HZAA 1YBUA 3DLKB 3VV2B 2CRLA 2GCFA 4L72B 4B17A 2V8GA 5I3UB 4USUA 3OPKA 3KLIB 4EYIB 3KJQB 1UL3A 2GMJA 1UJ5A 1BMQB 3KK2A 2D7SA 5L1LA 4I0WA 2L41A 5A6PA 5JJBA 2RQKA 1F9FA 2R7WA 4NLOA 3V4IA 3HDSA 1RWPB 1Q53A 3IRXB 4DUTA 1G3OA 2PD1A 5H1SV 2ZDOA 3FJ2A 4LT6A 1DBDA 1LWEA 2ILYA 4C11B 4CQ1A 1I3OB 2VPZB 4MIBA 3HI9A 4KR0B 3IBCB 1DTTB 1RAJA 4LR9A 3THTA 5KFFA 2L9NA 1RT4A 2MKIA 3TX8A 1XMQJ 1EQ0A 4NYZA 4KTQA 1A7GE 1FF2A 4OJ3A 2HHXA 4B9SA 2IM2A 2H48B 1YX2A 1IKWB 2HZVA 2V8VA 3MM6A 4OYIA 4QIWD 4WKYA 2RT3A 1NRKA 4ZN3A 5AE1A 4X4QA 3T5LA 1GT8A 1W7WA 1H2TZ 3RYLA 2VG6B 4NEYA 4DL6A 3QWUA 4B3TJ 2QLXA 1UCNA 3BJYA 5DLGA 1WF0A 3MPUB 2ROGA 1RU2A 4QWCA 2XMWA 3M9NB 3QT7A 1QVGR 4Q7AA 2CJXB 2RS2A 3UD3P 4WFBQ 4PYAA 2FLLA 1LWEB 5D0GA 2AJ0A 2YWGA 4TY8A 4ED0A 1FWPA 1UVJA 2OPQB 5DLFA 4NXMF 3SBMA 3LWLA 1WOSA 2F63A 2FJEB 5HN0A 1U1NA 1OY6A 3AODA 2OPSB 3BGUA 1H3DA 4KH1B 2DGWA 5F3TA 1RT2B 3FEXB 4ATNA 2OTJS 1QAJA 4ANCA 1IKWA 2MJUA 5GAEI 1CEZA 4A4JA 2RD5C 1M1HA 5C25A 3KG1A 4DR2J 4YOEA 4O4GB 2VG6A 2F9JA 2KVQE 3S1TA 1H7XA 2KXFA 2ZUAA 3GYNA 3ZTSA 2Z2ZA 1YBAA 2JWNA 2X3GA 3NY0A 3LPYA 4OYOA 5C42A 1OO0B 1JKHB 1UW4A 2WW8A 3PTWA 4OFZA 4CLTA 2J6TA 1EETA 1H2UX 2R2SA 3BSAA 5T7LB 5KFMA 3ETMA 5KFLA 3BQ0A 3Q22A 3UVJA 1J5EJ 2QL7B 1TUWA 2BEFA 2VPYB 4NEZA 1HL6A 1IKXA 1QE1B 4J9QA 2IYIA 3QAEA 4TNOA 4WZMA 4OL8A 3K57A 3BYRA 3GP9A 3PHTA 4WK1A 3CCQS 1P1LA 5LXRA 4OYWA 2B4PA 4C3KA 1V3RA 1N88A 1PYSB 2GJFA 2LLZA 3D0IE 4PXEA 2VQEF 2FJWA 1X0PA 3EGNA 3OFGA 1Z2LA 2VD3A 3IR5B 4LSNA 4N77A 5B0BA 2WB4A 1XMOF 2WVFA 2K06A 4WCEQ 2JLEA 2CAJA 1U49A 2X1FA 4I6YA 2FY1A 3MDFA 3DLBA 2DNHA 4DV1J 1O51A 3TUIC 3BSOA 3CCTA 2EK6A 4QWAA 4W92B 2WCXA 2ATCB 4ZPCA 1K73T 2DIUA 4ZITA 2CQHA 2RILA 3HSGA 3DC2A 5B0GA 3S01A 1PIEA 3QGIA 2YNFA 3QQCD 5D77A 4YQWA 1UAWA 4RPFA 3PZPA 4X2BA 2MZSA 4OZ0A 2HBRB 1UVKA 1OPIA 3BH7B 4J90A 4PRFA 4LIWA 1WF2A 3VZHA 4ER8A 3KMSA 1XMQF 1RKIA 4NX9A 2QLFB 2RUSA 4YDDB 3QZ7A 2HW3A 2DT9A 1NAQA 2VFTA 3W62A 1NZAA 2MEWA 3NXZA 5IM0A 3M7VA 4Z37A 5F0WA 2F8MA 1S99A 2XI2A 1T9WA 2JL9A 3HHDA 1DAXA 3ILIA 4KGKA 2XQCA 3UCGA 3VGUA 1T05B 4DU7A 2L9DA 3K58A 4IFYB 1X9WA 2BRKA 3DRPB 1N5TA 5KFWA 2KKHA 3HD2A 4ID5A 2MTLA 1KOOA 4AT1B 1C2PA 2VBYA 1LW2B 3HHLC 1WI8A 4J9SA 1PGZA 4ZVGA 2VOOA 5HROB 1QTNB 2V8DA 2ZNZA 5A8RA 2DGUA 3R5GA 4ZCIA 3G82A 1WHYA 1ZM4A 2VG5B 1A6LA 3OUYB 4NA2A 1DQAA 2HKEA 3K5PA 2QMWA 4C6AA 2PMHA 4ELVA 3CIZA 2VUGA 3G86A 3A8EA 4KKOA 1HNIB 4FNHA 4QZVB 1O6XA 2Y1RI 4ETZA 1DLOA 4LIRA 3BV8A 3KKFA 5BR8J 3PX4A 1WKLA 4ZS6A 5IM0B 2HQCA 3ZZUA 1VQPS 1TKXA 1W2IA 2CNNB 2OGUA 3G8QA 4PR6A 5J2NB 4DPXA 3LTOA 4B3OB 1T05A 3B78A 3BR9A 4ID8A 4BC7A 3IG1B 2KHCA 3UNGC 4IH7A 2FIUA 4NLSA 4LRCA 3ADAC 5DZ6A 2JEFA 3NOCA 4TLQA 2XB2D 4K2XA 2EG1A 3PRDA 1TL1B 3AA8A 1QD1A 2B4UA 3HVWA 2YBVA 1BQMB 2P6TA 3IR6B 1UMJA 2R2RA 5K14A 2J0QD 3UD5A 3U1LA 1TV6B 2QGFB 1F0XA 3G82B 3K17A 1FXDA 3KUGA 3WHIA 2ZH9A 2AD9A 3I0SA 1S10A 3MTKA 3U27A 1K0TA 2PFFB 1HMVB 2KT5A 2LCWA 3DGPB 5LJ5Y 1IBKJ 2EFOA 1S7IA 2QO3A 2Z8QA 2M8HA 2DNMA 3C15A 1O8BA 3RGIA 2VDHA 1OQ3A 2HWIA 3M32A 4PPDA 3ZC4A 1RCOB 5CD4A 2CG4A 1C4CA 2G4BA 3CCES 4OYXA 4YY3F 3HKZD 3EPIA 1GXTA 2KFNA 3CJKB 5KG4A 4B3OA 4GVBB 2FHKA 2ZHBA 2U1AA 2E7VA 1M90T 3HJFA 3E51A 1JLBA 3HHLD 2HHHJ 3IP0A 5JVHQ 4ZVTB 1S0NA 1GMVA 4PG7A 3HXMA 4M5LA 3K5MA 1Q7LB 4K59A 2K7KA 4YR3A 2HHVA 1SQFA 3BPDA 4RL1A 4P6QA 2B51A 2DXEA 4NCGA 3LQVA 5L9NA 4Y6IA 1NJXA 1BQMA 3OTOF 1M1GA 4LFAF 1VBYA 1Q0NA 3CCZA 3HHLA 3VAGA 1ZTTA 2W2PP 3AD9C 3L4BC 3AB2B 4AUKA 3QJJA 1S1VB 2W01A 1HMVA 2ACMA 4J9KA 2DTJA 3NRBA 3MR2A 3RB6A 3P45B 3FCVA 4IDKB 1NK5A 1VMBA 1VYAA 2CA9A 2GW8A 3QO9B 3S6EA 2QT7A 3VAFA 4Q0BB 5E3AA 3MAAB 3UDCA 3SQGA 4EFAC 2AT1B 1FJ7A 1X4GA 3CJKA 3CB4A 1VOMA 3GFYA 4GVBA 5J1PA 4NASA 2UU9F 3T1YF 2CG8A 2M88A 3DLGB 3NOGA 3SXLA 4DF8A 1U24A 2HLTA 1TQLA 2XMKA 1IXKA 1UPMB 2EBEA 2WVEA 4L76A 4NCGB 3OHAA 2ZD1B 2AU0A 1T03B 1GXLA 4DDFA 2BM0A 5K9FA 5IT9U 4O4RA 1S1VA 3NP5A 1AUDA 2IRUA 2FTRA 4DFKA 2W4PA 2EFGA 4DV7J 1VQLS 1RT4B 1YZ6A 2MZJA 4IDKA 4JI7F 2B5JA 4WP9A 5L9XA 1S72S 2DGXA 2ZWOA 3L09A 3NNAA 4JI2F 1HIYA 4I64A 2AEFA 3H5UA 4NLUA 4QPTA 5GMEA 1U6BA 1UVNA 4OHYA 4DZ6A 1D9DA 4CO3A 3OJUA 2CJAA 2FPHX 3QWPA 2O3DA 1HWIA 2FC9A 2DNOA 2W2OP 3EMTA 4ICLB 3I6PA 4M5JA 4OHVA 1R31A 1S4EA 5HK4A 2R8IA 1RE1B 5IFMA 3FBBA 3TWZA 3A13A 2X3DA 1Q86T 3EVOA 2UXCF 4J7CA 1JJCB 4CZCA 1VQYA 4GO5X 1CC7A 2YX7A 2A1BA 1DQ9A 2CQGA 4IRDA 2NXUA 1OWXA 2ZH1A 3HZGA 4NLWA 4PUOA 2WVBA 5D0HA 4ZVEA 2DB1A 3FFIB 4LUBA 2LQBA 3UO0A 3THPA 1RA7A 3VQTA 3C19A 4KSEB 2DCLA 3DOLB 4M5HA 1JLGA 3CNQP 3MR6A 3SI8A 3SCIE 1ZTWA 2Y3YA 5B0CA 3PX0A 2BKNA 2QE5A 2GV1A 3A3PB 2OMLA 1RYRA 3MXHP 3UNYA 1PO6A 2CQ1A 1Y3KA 2AW0A 8ATCB 1F5AA 3CO0P 5DGBA 3Q24A 4X4UA 1KTVA 4O4GA 2V8PA 2X1GA 2B6AB 3HCXA 1HBUB 4ECXA 3NGRA 2HHQA 5E3QA 4TU7A 7FDRA 2NZCA 1RUSA 3MMJA 4KYZA 4L73A 3LAKA 2NXEA 3KLGA 4F0HA 1EETB 2RF2B 4DV2J 4ZJQA 2VKZG 4DL3A 4J9PA 4U7UK 4WFNQ 3N79A 2O67A 1TUGB 1VI7A 1DTQB 3PYGA 3ILLA 4DPUA 1HD1A 4W98A 3OL7A 1MMLA 1FRMA 5M2PA 2VF3A 3N5FA 2LU1A 1QE1A 1JLGB 1YZ7A 5F8GA 1HHSA 1X0FA 2IDLA 4MFBA 1U1QA 4NLVA 1XMOJ 2PI5A 2Y0BB 2MGZA 3UFCX 4NL5A 1WHXA 5GAHI 3PR5B 4KT0C 2E5IA 2IC3B 3JSBA 2EFNA 1U8SA 2MQ8A 5LM7E 3TJ9A 4EYHB 4JI1F 4ZPBA 5IT9Y 2C3PA 2B6AA 1JB0C 4RWXA 2KYZA 3HZEA 5CHCB 2JFDA 4BLGA 2R7VA 2Q43A 2X7IA 3G96A 4URGA 3BBBA 3OFFA 4JYAF 3A8KA 1HYSB 4N56A 1X4DA 4OZJA 1S5ZA 4LF5F 2FHMA 1NSKL 1XK8A 4KO0B 2NSBA 1RP5A 1RAHB 3V2UC 1J5EF 3CCUS 2R8KA 3GJQB 1NJYA 3IO1A 3C6TB 1HWKA 1FRXA 3FZ2A 2XGPA 5C24A 4NLRA 2XMMA 3RW6A 3AY0A 2ZITA 4MYUA 2VHGA 2YNHB 2R2TA 5GADU 1R8AA 3GTYX 4JB8B 2GHWA 5KFJA 2QA2A 2RHSB 3K5OA 3PJ9A 2YQ1A 1XR7A 5L1JA 3M30A 5HQMA 3B82A 1HPZB 2M8DB 1N5VA 2ZH6A 3K0JA 1RCXB 1ELOA 1O5JA 4DV6J 2ZNYA 2HVIA 4DL5A 1T9YA 2C2NA 4HL9A 3J80U 1HNXF 2UUAJ 3KUEA 3W3SA 1HYSA 3PIPQ 1FNMA 1PSDA 3RRGA 3IM9A 2OI2A 2Q1LA 4KHPJ 3MWBA 4CLLA 2YPYA 3UW1A 1SI9A 4HTJA 4QPXA 4Z7YA 2ZKTA 1U1KA 1SKRA 4N41A 1FFWB 2C1EB 2KDOA 3DDKA 2HHPA 3P8BB 4K8RA 4QWDA 3OL8A 4WP8A 3MEGB 4OV1A 2KM8C 2FZKB 2J7KA 4HI2A 4RO0A 2GGPB 2V5HG 4RW6B 4ZLPA 2E66A 5IQQA 1VHIA 5B08A 2D3ZA 2RIJA 4RUAA 4WXWA 3RB4A 4K4YA 1TKXB 2ERRA 2YX4A 4ILRA 1V3ZA 1LXNA 2QA4G 3PYDA 2AGQA 3IG1A 4OZ3A 3CCVS 1SL2A 4I7FA 1P1TA 4XPCA 4RU2A 2CJQA 5EGYA 1NKEA 3LPEA 4OZNA 3OL9A 2GJ2A 1RACB 2DISA 3RZAA 4LVOP 4DCJB 1B3TA 2DGSA 4DL4A 4YP3A 2I8EA 2V4JA 3PFEA 3HX9A 2Y0SD 2FJXA 4JI5J 1N5YB 5D78A 4YFUA 5DGAA 3IFEA 2PE8A 2I38A 3MR5A 2JX2A 3C15B 1Y7PA 3J7YU 5H9EJ 4RW6A 4B3MJ 3HK2A 4DR4F 3HULA 3PEHA 2N3OA 1YI2S 2HNDB 4LF7F 1IWAA 4WIQA 4HEA9 2MZ1A 4DL2A 4DF4A 1ZYQA 4K4XA 5SZTA 2FGOA 3CJ8A 3I9ZA 1FXRA 3DMJB 3OR2A 3CJ5A 3ZTPA 2N3LA 3V4MA 2BJ3A 4ZCMA 1N5QA 1HR0J 3N0VA 4U95A 4ELTA 5LL6d 4LF2A 1JLBB 3M8SA 3CMAS 5M2RA 3D0HE 1WG1A 2GZOA 4M5KA 4UTGA 1KQFB 5I4MA 1LW0A 2AMCB 3A12A 3PM9A 3WQPA 1NZ8A 3OFEA 4QBUA 1M0SA 3G2XA 4EBCA 4ZJOA 4MMOA 1R0AB 3W63A 1F6TA 1DJ0A 1C0TB 1C1CB 3FCWA 5EHHA 2KZZA 2VA3A 3DM2A 1KFDA 2V4JB 5IZHA 1VQ9S 4N7TA 2J76E 5LMNF 5AXKA 3FRZA 4DUYJ 3BKTA 4ZVSB 2DO4A 1Z4UA 1FERA 2HBZB 1SQGA 3HSJA 4LREA 2XY5A 2DJWA 2IRXA 4NMLA 3MAAA 1GMUA 4RWWA 3T6BA 4DCPB 1X9MA 2PEHA 3SEOA 4P72A 3DMJA 2V67A 1LKZA 3Q8YA 1SQEA 4DUZJ 1EP4A 1TELA 2RQCA 2HHHF 1G1XA 1YJRA 2NSCA 1TVRB 5F8LA 3D4JA 4QW9A 3TYTA 5DQHA 2CPJA 2N4DA 4C8ZA 3IS9A 3LGNA 4DR6F 1RB0A 1D3WA 4OZ5A 3RG6A 4CNYA 5E33A 1VQ6S 5KG2A 3NGDA 5ETQA 3TQ1A 1HNWF 4RUCA 4KGVB 1WHVA 5IT0A 3VVUA 1VRQC 2DCUB 2EG2A 2RQMA 3GE9A 2QYCA 1K8AT 1YG0A 2DGVA 1KHVA 1MWQA 1VQSA 2B5JB 3ENVA 4HI1A 3VCDA 3EZUA 3V5RA 1Q8LA 1N54B 4J37A 3I82A 1OMSA 2VDIA 3N9UC 3RW7A 3TUZC 3CEDA 3HFZB 1S59A 3OV7A 4DSJA 2B43A 3M05A 3DI6A 1WACA 5D6GA 1PBAA 1U0HB 4A8KA 2LEBA 3KDOA 1O0PA 4R8UA 3T9NA 1N33F 2R7TA 3KJVA 2OIHA 3CGIA 2OAUA 1FWLA 2BXJA 2O66A 4LSLB 2Z30B 2C3MA 2LA4A 1FFSB 3CJ4A 3IC1A 4P2XA 1LQ9A 1K44A 2Z2LA 4FPIA 5M2UA 4HH0A 5KFEA 4RU9A 2ZJPQ 3QT5A 3MECB 4N47A 2R2UA 3SYZA 1CJKA 1SKWA 4Q43A 3GFZA 1T02A 3LUYA 1ZETA 3CC4S 2P9GA 3QRPA 5I42A 2Y8WA 5HBMB 1D9AA 1CBKA 5GVQA 3KMQA 1SJQA 3R97A 2RDJA 2UXDJ 4WZQA 4K4ZA 2QMUB 3CC2S 2CUYA 2ASLA 2ZE2B 2XNQA 4DWIA 1Q95G 2W9CA 2C22A 1YJTA 4PABA 1F2GA 1KLNA 4RLEA 5DDPC 1F9EB 3TX0A 4ENOA 3IRWP 4ZCLA 2G0IA 5ETSA 2AYBA 2ASYA 1S12A 2HVHA 2UZAA 4LFBF 4U6PA 1OPZA 1DARA 2V94A 5CABA 3H4DA 2KL8A 4CRJA 1I5OB 2AYMA 4EK2A 2ZOFA 5HP1B 4RKUC 4DPOA 4NRUA 3P49B 1RTHB 3PY8A 2LECA 1KVKA 2HIYA 3AOBA 3CDAA 1REGX 2HYIB 2BDPA 4TY9A 2NYIA 4ZLJA 3QATA 3PW0A 2DNKA 3LANA 2LEAA 4O3QA 4OJ1A 2ZWPA 2MKKA 1UVMA 3K8WA 2R8HA 1TZ0A 2BKOA 4USWA 2DR5A 1JLQA 1HBOB 2NUUG 5D4NA 2PO4A 1NK7A 5BYRA 2LEPA 3NS5A 2EW9A 3U02A 3POTB 1XNRJ 1PYTA 1NSQA 3NCPA 2ZJQQ 2GHPA 5F8IA 1X5TA 3D1QA 4DR3J 1H38A 4PG4A 5A76A 1RHJB 1VFJA 2CQIA 4LRFA 2P9CA 3EGZA 1HI8A 2ROEA 2ALZA 1VC6A 3NL0A 3G6ES 1D1UA 3QJPA 1CC8A 5ETKA 4MK9A 4DN0A 4JI3J 3PRVA 4H4KA 1V9OA 2WOMB 3UI3A 5GAHU 3JSMA 2MY7A 3W66A 3ZZYA 1VQ4S 3BR8A 3PO4A 3MZIA 1LWFA 3BZQA 2UUBJ 1XR5A 1ZM2A 2A2DA 2KJVA 2JLFA 3PIOQ 4J9NA 1GXUA 1U47A 4DL7A 3KHRA 4RNMA 2D9PA 2DHHA 1SVDA 1U8WA 1V6HA 2QL5B 4X4OA 4K4WA 2DEIA 2LP4A 3C6UB 1ACMB 1Q16B 2CZVC 3GONA 2H1YA 4J9UE 1HPZA 2P2CB 1L3TA 4B9TA 1UFWA 1KS2A 3CSKA 4M5NA 1KWMA 3R8YA 3BO3A 3PW4A 2FVPA 1SC6A 2M70A 4ZPWR 3AA9A 4AL7A 1WKKA 1PJ5A 4OYZA 4XDCA 3LH2S 2OHDA 3WX8A 1DURA 2V0NA 2W8KA 2Q6BA 4WE1B 2BABA 4YMEA 2L9WA 2JHEA 2HFUA 2UV8A 4CLSA 1J27A 4WJBA 4H54A 3VAMA 4G6VB 1VCTA 1VDHA 1HBNB 5F3ZA 1NBEB 1EKSA 2B3TB 3EJMA 3NS7B 2LU2A 3R5CA 4KH0B 1Y10A 3J81Y 3TA1A 3N6LA 4PWWA 2CQPA 1S6QA 3OXGA 2GA7A 2GGPA 3W65A 1L3UA 3C6UA 2LQ5A 1RT1A 3HT3A 3MM8A 2D69A 1WC6A 1PAUB 3OFHA 3W9JA 2BM1A 4PQAA 5LT5A 2H65B 5HMXA 3R7BB 2ZHOA 3MHYA 4CO1A 2R8JA 4V19J 5T14A 2E5LJ 3PJWA 4MKYA 3ZZOA 1TKZA 3UD4P 3UE2A 3IXQA 3HVRA 4OHZA 1MN9A 2PDAA 3HHKA 4I7FB 1TL7A 5KT3A 3U1NA 2M2BA 3V6KA 2BV3A 4CTAA 2PI4A 3MGJA 2MHNA 4PG8A 2FDNA 4DV5F 3MD1A 4IFVA 1R0BG 4DV3J 3ZO7A 1Y11A 2OELA 3D3BJ 3DN9A 4CYUA 2EPIA 4WF9Q 1WTFA 2EFPA 1KONA 4CWBA 4FXDA 2UXBJ 4ANEA 2HHUA 1N0VC 2Y1IA 2W7OA 3EYZA 1UEVA 2SXLA 4XTTA 5SUHA 1S4FA 1ZAVA 3K59A 1N48A 2YX1A 1VHFA 2PEBA 3S8SA 4PAAA 1FTCA 2DGOA 3C8YA 4R0JA 1XEZA 2KH9A 2YKNB 2C2OB 3FEYB 3EZ5A 1M5KC 3G8TA 1YJUA 3BKUA 2KM8B 2QEXS 4NLGA 5CYMB 3CJ3A 1NPKA 3O2IA 4B08A 1R0CB 3HHEA 4PCQA 4DLGA 3QRQA 2EK1A 3TAMB 4A8SA 4UOFA 1QLNA 5H9EK 1EZZB 4NYOA 1FRHA 3QPIA 5J1EA 4IOBA 3VALA 5L8RC 4ZA1A 3WDOA 3W5YA 1BXNA 3CD0A 3ILJA 4B9VA 4B3SJ 2EFQA 4KPYA 1AYEA 2VH7A 3NEKA 4CDIA 1WC4A 3TUJC 4E98A 4F3MA 5BJRA 5GMKa 5KFCA 3V6JA 4X64J 2QG9B 3M2RA 4OJGA 2HRUA 4QR0A 2RQ4A 1SUQB 4GC6A 3DRRB 2AF6A 5G0RB 3N6NA 4EO6A 1CS4B 3MPYA 1RT7A 2XY6A 3PRBA 3AOAA 3HKWA 4Y2CA 1Q79A 2MPUA 1XTZA 5CYMA 5KFZA 4YS2A 4ZLLA 2HGNA 3HM9A 1T03A 1FKOA 3MEKA 2CIMA 2AQ4A 3GV8B 4PQUA 1VQ7S 1LXJA 3QLHB 2IFXA 1HI1A 2A3JA 3DOMA 1PAEX 2AJFE 1RWXB 4DN9A 1NHUA 4DV0F 4LQ9A 2ZKUA 3EXCX 4TVAB 5DDQC 2D1CA 4CO5A 5AT1B 3RU0A 3BF4A 4U67Q 4K50A 2CZ9A 4I69A 4KRWA 4JI0F 2ALYB 3LO3A 1RWNB 3FRYA 2D3UA 3OR1B 5D0RA 3QYYA 1G4CA 3OTBA 5L38A 1RADB 4LF8J 4QR2A 2AIRB 3MM5A 1KVJA 1E6YB 1OQ6A 5G0RA 1RTDA 2FJAB 1CS4A 5HI7A 1HBMB 1C4AA 5EDWA 1JJ2R 1U0HA 1ZS6A 4KHMA 2FHOB 2C3UA 2XCPA 4CCHA 1YITS 1X60A 2DHGA 1BUXA 2F5GA 1E6VA 2OO4A 3LP1B 3T1AA 4IR1A 3OVBA 1MLAA 4Y00A 1MW7A 3PACA 5DO2A 5A2QU 1LFWA 3DOKA 2UUWA 4FP9A 5DG7A 4M1KA 3RB0A 3CDWA 3VAKA 1S0OA 5ETLA 5B0EA 3BO2A 4RBTA 1IR1A 4H4OB 4C98A 5I42B 3FGVA 2KYXA 1F5CA 3BN4A 5HBMA 5BR8F 5GADI 2XNRA 3PHEA 3DDNA 3FUYA 4QYRA 6FD1A 1KLMB 5LMUJ 3MMAA 2VQFF 2GQ2A 1RTDB 4E0DA 2LXUA 3RAMA 4LFBJ 2W24A 3LP0A 1HW9A 1U1MA 3V81B 4X66J 2XBPA 1JNZB 1I6JA 3BB5A 3M8QB 2HMIB 1K1SA 1PJ6A 2AX0A 2MQLA 3BGLA 4U7CA 4DLEA 2QMXA 4YB6A 1S77D 2E9RX 3FQLA 1UJ6A 1RHUB 1WEXA 5KFHA 4I67A 2JH3A 2MYFA 3FKBA 3MPWA 2ZH4A 3KUHA 1WHWA 3JXOA 2ZH2A 3JYTA 4IO9Q 4CO0A 2CPEA 2DPJA 1RHKB 2J0SD 2QSWA 2E5GA 1RTHA 5B0AA 2KFZA 2B9WA 4OZLA 1TP7A 2GAGC 4JI2J 1EAYC 5E41A 1S1UA 3G6VA 2AV5A 4ED1A 3EUNA 1YJ9S 3F56A 5T41A 1RGVA 1NK4A 3M8PB 3MMAB 2NXCA 3D1OA 1VK8A 3PYFA 5ETTA 5ETNA 1JLQB 1HBOA 1GQEA 1PJ7A 1MWZA 4KQZA 2G13A 4Q2MA 5D4LA 3W2VB 4DMZA 2KG1A 5E3PA 1UETA 5E2QA 2JSXA 4QQBA 5KFXA 2XEXA 4JOUA 3SIPB 3WIVA 2A6MA 3L7OA 2HMIA 1KDNA 3WX4A 5CD4H 5KG6A 1F9HA 3QGGA 2DD8S 4X62J 3FSXA 1HKAA 3EPGA 3RRHA 3E2EA 4OHWA 5KAKA 1MMDA 2DXDA 2YY3A 4RUBA 1MROB 1JLEB 1LWCA 4FXWA 4JI8F 4OX9J 4Y2KA 1XNQJ 3TA0A 2HS3A 1KR4A 1PC5A 2BYCA 2GQCA 2F8EX 2Z56B 4HHHA 1S9EB 3TP2A 4IO1A 4JV1A 2GQQA 3GYXB 2W25A 4FF1A 3THVA 4L75A 4AL5A 5HLFA 2OP5A 1J5OB 1LWFB 1AROP 2MQMA 3HMJG 4B9MA 5J2MB 1P27B 1NB2A 3FBCA 4RNNA 4K0KJ 4OMFG 1RJJA 3CMES 4YB5A 3ZTRA 1WDTA 2ASDA 4KY3A 3A8JA 1PCAA 3W2VA 4EO8A 1JK9B 2GVZA 3BKFA 2IJRA 5CCMA 4LF4J 3Q8SB 3H7HB 3T1HJ 4YR2A 2FVQA 3RR8A 1HA1A 4DQPA 4DR3F 3MI7X 1MSWD 3GIJA 2WBRA 1JWWA 1FDNA 3DXBA 3ZZTA 2AJQA 1IKYA 3H90A 2ZVIA 4FN5A 2DR7A 3C16B 4KC5A 2FHJD 1MROA 2Z57B 2DR8A 1P9QC 4RW7B 2F65A 2V6AA 5A8WA 1B99A 5KG0A 1S9EA 4X84A 1T9UA 2LQ8A 2MKYA 3O44A 4KPCA 4ZVUB 1PBUA 1OY8A 2DKOB 1I94F 1F60B 5K8PA 2BJ1A 3ET6A 1JLFA 5J2MA 2KG0A 2B8PA 4RZRA 2Y9HA 2B56A 3DGVA 3OW2R 3MM9A 5LSRA 1RAEB 1U2CA 2GVZB 1CVJA 2R7SA 1U1PA 3MM8B 4KB7A 4RBUA 3UN5A 5LMUF 1R6YA 1S1TA 1ZBTA 1CSJA 2B9EA 3O6QA 4I2PA 2BE9B 3FC9A 5J2PB 2B9YA 3MOZA 4QJVA 1IBLF 3GG0A 3L7UA 3JAMY 4ZPVR 3M8RA 3G9CA 2XZDB 1LK5A 1H73A 2HURA 1H98A 2R42A 3MMCA 2VL1A 2DEJA 1B7YB 3DLEB 3DRXA 4OI3A 3VWSA 3KLFA 1ROFA 4ECUA 1Q7YT 2UXBF 1V5VA 2B7CB 2HRYA 2QZ8A 1R43A 2MKCA 3JAMU 3EZOA 3NLCA 5F8HA 1RT5A 3KLVA 1HQUB 5IC6B 1TK5A 2VG7A 3AB4B 3MM9B 1JIHA 1GFWB 1OS5A 1S6PB 3NG8A 1CQNA 3K5NA 1UA0A 4JI4F 4KV8B 2E1PA 5AXMA 2X1AA 3DRSA 2APOA 2QRRA 3WZ0A 2QLWA 3H0PA 2RB7A 3K89A 3ZZ0A 4J9LA 5J2PA 1VQOS 2PN6A 4G1IA 2XGQA 4DOZA 1AT1B 2MJNA 2DNGA 1QAIA 2AEJA 3NGKA 3TEHB 2XZTB 1RI7A 3QT8A 3PFOA 4L6V3 4ES2A 3MMCB 4OJHA 4OV6A 1U0SA 3BN7A 4UZBA 4X62F 3VF0B 1FDBA 4O3OA 3PW2A 3RAXA 3EE3A 3KNAA 4GRSA 2FUG9 1S76D 2HIQA 2K7JA 2JNJA 4OIXA 2VOPA 1WEZA 2VPXB 4FPRA 3MMBB 4J91A 3C2PA 3I9V9 1WTBA 1QAXA 1S6OA 2VC0A 2ZEJA 8AT1B 2C42A 1HQUA 3FZBA 4N8NA 1QSLA 2JEGA 3BGOP 2VG7B 4K4VA 1HLWA 2NUHA 1LNQA 5LMNJ 2LA6A 1IQZA 3KLHA 1SJ3P 4GMKA 2ZBRA 1S6PA 4A46A 2P6SA 3DRRA 2V4RA 2LKZA 2AGOA 2E1CA 4I1TA 4USJC 1HD0A 1WKJA 3IR7B 2D74B 4NE9C 2V2VA 4F25A 4NMXA 1HWJA 1IBKF 1RWMB 2XYHB 3KFWX 4FYYB 2WZ1A 3SSRA 1T8EA 3KLIA 4AE5A 4K4TA 1PILA 3QGHA 2FLNA 4TYBA 1BD6A 2V2KA 4YY3J 2OPRA 1N5SA 1Y0HA 6AT1B 3DOMB 1WEYA 1K47A 2DR6A 4NWBA 2J7WA 4NA3A 1A0OB 2RU9A 4UT4A 3W5XA 2CQ3A 4I6WA 4LF4F 2VPWB 2XMJA 3AH6A 3IRXA 1NJIT 2PIIA 4EBDA 4O3NA 2HFNA 1M5PC 1VQNS 4GKJF 3GG1A 1UKUA 1JXLA 3CCLS 3M2VA 4MKBA 3AOCA 3MM5B 1VGYA 1WSVA 4DZDA 2ZM6F 4WYWA 3PW5A 4FF2A 2NZ4A 2BOPA 2K1RB 1HBMA 4ZP8A 4ECSA 4C8MA 1RDRA 3R9LA 2LDIA 1AB8A 3OTCA 4ZMMA 1D8ZA 1P6TA 2JEIA 1RAGB 3FVYA 4CO4A 2B4VA 1IBMF 1HWLA 2PA3A 5KG7A 5MAOA 4HR2A 4FBTA 4UOCA 1IR2A 2UVUA 1ZPVA 1DY3A 2J8AA 1MG7A 1S1WA 3DOKB 3CE8A 3QSIA 4IQMA 4DX7A 5DQIA 3KYLA 2XS5A 3NCRA 4MK7A 3NNHA 2ZVSA 3LAMA 2DY9A 5ETMA 4HH1A 4H4OA 2NPFA 3HHNB 5EX0A 3CJQA 1SPBP 3M6VA 3QAUA 4WK3A 3B4MA 1NSAA 2MSTA 5E3RA 2PT0A 2XWXA 2KB2A 2CJKA 4EEYA 1H74A 1SKSA 1X4FA 3RR7A 4ILMA 1CULB 2MDAA 4DG1A 3PYEA 4WU2A 1FO1A 2BE2B 5E0OA 1CJUB 2GNKA 3M2UB 1KFSA 1BY9A 4ITSA 1UTAA 4DQSA 3FMBA 2YNGB 4WKRA 4W90B 2WW4A 1EX8A 2CPYA 3BPSP 1FJEB 3MAQA 3GJRB 1CG2A 4AXJA 4C2MA 5JMNA 1S97A 5CA5A 3OQ2A 1UZHA 1V3SA 3BBCA 4ZN1A 4JV5F 2B4OA 2VASA 4DXLA 3I55S 4NRTA 4WWSA 2DVIA 3BH6B 2UXCJ 4ELUA 1S1UB 2H5EA 1ITPA 2VZ9A 2GHVC 1NHKL 4Q5VA 3ZZRA 3AD8C 2L08A 1HR0F 3W61A 4DX6A 1S0MA 1FK9B 2H9ZA 1CULA 2O1PA 4NI2A 5JXSA 1KP6A 4OLPA 4NLQA 3M6UA 2I5JB 2CVIA 1Q8KA 2FB0A 2QA1A 3K7RA 3ISND 1NUEA 1UEKA 2YNGA 4L74A 5HVHA 1SIZA 2E7WA 1FWKA 3CW2C 2F8HA 3J80Y 5D4OA 2CWXA 7AT1B 1HHTP 2ZBQA 4K0KF 1TKDA 2C2MB 4LVNP 4PXBA 2NQPA 1XC9A 1LK7A 5HJXA 2X1BA 3RB3A 2OMOA 3KHHA 4Y65A 1OYDA 1UWBB 4DSFA 5HLFB 4P2FA 1ULRA 1WC1A 4TY8B 3UN3A 3G6YA 5D0EA 3SZ2A 3M4XA 1U1RA 2DK2A 3GCWP 2VODA 4F67A 4DV2F 2GJIA 3CIMA 2XLJA 1YJNS 4O3RA 1FK9A 4DJBA 4AFFA 2ZH7A 2MQNA 1HNWJ 3UWTA 4EU0A 3RJMB 5KFNA 3OSPA 2MQOA 1RKJA 3GWCA 4PZVA 2I5JA 2IIHA 4MIWA 3W2WB 4N5SA 1TK0A 1M5VC 1RZMA 1TL3A 1Q8BA 4I68A 5CYJA 5C25B 3J7ZT 2BJDA 5IXUA 2KHDA 2ABYA 4Y28C 3E01B 4F02A 1NK0A 4U8YA 1RISA 2VJUA 4AL6A 1JKHA 3LW5C 1Y5IB 3MUTP 5B09A 2ZH5A 3IBWA 2ZH8A 2IA0A 2MZTA 3KG4A 1SJ1A 2CPZA 2YTCA 5T7LA 1IJFB 1R8BA 1NKCA 3MOJB 1RTJB 2D41A 4F2SA 5HROA 2C28A 1RBLA 5A8RB 2MQQA 4ED3A 1GAOA 3MPDA 2FZCB 1RABB 3ZZPA 3CD6S 3GIMA 1L3VA 3OD2A 4ZCKA 3DHXA 4ZHRB 3MFHA 1NJWA 1WOOA 4K4SA 1L3SA 2E9ZA 4I2PB 1HNIA 2FJDB 2POKA 4U8VA 3WIUA 4RJVA 1EARA 4B3TF 5EN1A 1H7WA 4CLWA 1NB7A 1WJ9A 3R1LA 4LSNB 2KN4A 1H0HB 5FLXU 3D2WA 2RU3A 3NMRA 2WAQD 4J5OA 3KNGA 1APSA 4PEOA 2EFVA 2UUBF 1RBAA 3GU0A 3BQ1A 1M5SA 3EDRB 4C3MA 4X4PA 5KFTA 3TO8A 3VZIA 2XLIA 1T3NA 3HT0A 3X3UA 4DV6F 5ETRA 1HQEB 4QU7A 3DHWC 1X9SA 4O0NA 2JDJA 2I6WA 3PKYA 1NH8A 2JVOA 4K7QA 4J9VA 3ZNUA 3HF5A 2IVYA 3TEGA 3VGTA 5I3QA 2V9KA 2E44A 4ZHRA 3TAQA 4OI0A 2CQDA 2PMZD 2W8LA 1VBXA 2RRAA 4C8YA 2RVJA 3SDEA 2KZMA 2Y1LB 3K8VA 1AZSB 2AJ2A 2V68A 3DNCA 3N5BA 4KHRA 5K5MA 3S7RA 4QOTA 3MR3A 1GTHA 5D3GA 2KJWA 5I3UA 2RKIA 3PCOB 4D3HA 2HG4A 2VFUA 4UUXA 1NPRA 3C46A 2HVZA 2NXNA 4IFYA 4X4RA 3D68A 3DRPA 3MCOA 1HNVA 1VBZA 2KRRA 3GIKA 3MMBA 2OTLS 1XNRF 1RLCL 1LW2A 4GKKJ 3M8ZA 3NWGA 4LR8A 1HQEA 1NM2A 3V4IB 4UOHA 1FKPA 2H3EB 2GMHA 3FMWA 3GPAA 1D8YA 1F5BA 4JBCA 5AE2A 2HAFA 2V69A 4FZVA 3KHGA 1DQ8A 4JI3F 3ETOA 2RHQB 3R2CJ 3LP2B 1SC3B 3M8YA 1SKUB 2VB6A 2FY8A 1Q4RA 5FJ4A 4WBFA 3VVTA 2RSQA 1U4BA 2WSCC 3SQGB 2MZRA 1OIAA 3H8YA 3QIPB 5F41A 5D3GB 3PDNA 2YQ0A 3MM6B 4G65A 3BGRA 4IOAQ 1UWAA 4Y2IA 4Y2AA 4BCAA 2DGTA 4J9MA 2VONA 2XM3A 3QMQA 4P2MA 1AXQA 3DLHA 4GKJJ 4AQYJ 4KIAA 2J9CA 2NCKL 3OLAA 1LWXA 2AJ4A 1TL1A 3M9OB 2HHSA 4P52A 3PXGa 5KOXA 4LMZA 5KFPA 4CH1A 1Q81T 5LOQA 4RNHA 1RBOB 3JQJA 4DU8A 1TV6A 2BUNA 1WC3A 4RW9A 4QWEA 2QLJB 3D5MA 1X31C 4XK8C 2RE1A 3RBDA 1QSSA 1KC8T 2ZZNA 2R7UA 1HNZF 1CLFA 2HNZB 1VC0A 1YRUA 3IAS9 3LP2A 3BO4A 2GMLA 1KRPA 2UP1A 4LF6F 2HSEB 1RT2A 2AZ1A 4HHUA 4WFZA 4TQRA 3QIPA 2WONB 3DLKA 2UUCJ 2ZFHA 1BC6A 2ZDPA 4QW8A 4OI2A 4LSZB 3P5TL 4ALZA 4A47A 3DYAA 4DUYF 3NGTA 1RHRB 3QSYB 5CZVA 4NZ7A 2K3IA 3KK2B 2ZZMA 1UA1A 1M5OC 2DNRA 2YXLA 1JLCA 5C42B 1IVZA 2LDYA 4GC7A 4RUHA 4F4WA 4DEZA 5CCLA 1VS3A 1FCAA 3CJ0A 3GFXA 3GB0A 1CQMA 3DRYA 4GO7X 2QIFA 2DRDA 4PYDA 2HQ3A 4URQU 2OJ3A 2Y8YA 2C2KB 4YDXA 4XO0A 1JNRB 3B4DA 3R3TA 1SV5A 4A48A 2JRSA 3CCWA 2HNZA 3O5TB 2XZWA 2KT3A 1VJWA 3QO9A 3DOLA 2E5LF 1HHQA 4Q0BA 3CDBA 2Q3PA 3AJ1A 4TKTA 3M2UA 2NPIA 2QC3A 1X4EA 1TAQA 1DZ5A 1S79A 4P7TA 5KT2A 1T9VA 3TARA 2HQGA 3DYAB 1VLYA 2MQPA 3EM1A 5KFYA 3DLGA 4JV0A 4C0BA 3MFIA 1R6VA 2CNLB 1VBKA 2XHCA 3H2UB 1JLCB 2HPUA 2CPXA 2QJ3A 4ZLNA 1XBWA 4X4SA 2ZD1A 3BBFA 2IDEA 2Z2MA 4NPOA 5KFRA 1WELA 5C2GA 3GLJA 1UEUA 5BXIA 4K2JA 5KT4A 3RBEA 4GKKF 4H4KC 1N32F 1SV5B 3NKYA 4Q8FA 4DX8H 2BVZA 2XO7A 3PW7A 2MMYA 3CULA 4ED5A 2CVEA 3V6HA 1JXVA 2YNFB 2RNEA 3ICLA 2ADBA 1TUVA 1MMNA 2EWHA 4UZCA 2F3JA 3R7SB 1R8PA 3T19A 2XC9A 4DFJA 2UVWA 2J0XA 4B3SF 5HMZA 2IC3A 2GIQA 3T6JA 4DL0C 2RS8A 3CDUA 1CPZA 3H98A 2W7AA 2K2PA 2HNYA 1JMTA 3TJ8A 3VGSA 1TFYA 2Z58B 1KQKA 1N36F 4JV5J 1UPPA 4IG3A 1N0UA 1S9GA 5CQGA 2QTWA 2MXYA 4HHJA 2XMAA 1WNEA 1UWBA 2V50A 1FEHA 1TAUA 5HANA 1AA1B 1NKBA 5HATA 1VRUA 4IKAA 3UVJB 3E3XA 3ZTQA 5IV3A 3GILA 1N34F 4OZ2A 5KT7A 4NXMJ 2VIHA 1NDPA 1IKXB 4WXOA 1Q1KA 4NCAA 2R4FA 2VBXA 4M5GA 3MTJA 4X4VA 2YNHA 2VA2A 4U7UD 1U26A 5AJ3J 1C1BB 4PG6A 2XMTA 1CJVA 1FEEA 1FT8A 2CDQA 3FCHA 4G1QA 1TL3B 2C3YA 2DXFA 3P4UB 3H2LA 3N28A 4FYVB 4J9OA 1DLOB 2CQ2A 5DQGA 1B0PA 3OL6A 2HZCA 4OLOA 5KFDA 4RBVA 1GMWA 4MKVA 1AFIA 2EXUA 4P73A 5E3CA 3CMQA 4DV0J 2YWWA 3RBXA 4NOHA 2FLPA 4IG3B 4LFCJ 4YB7A 4HKQA 5E7OB 1IUJA 1N8RT 2J7UA 5C7PA 3IWLA 4JI0J 4C0HA 2H5IB 1YBTA 1RT6A 2M0GB 4XIUA 2DRAA 2V63A 1DTQA 3QBCA 2HQFA 1WI6A 2CJBA 2OSQA 3ITHB 2C2EA 5K14B 4JI7J 1XN9A 3OSNA 2OFHX 1SCJB 4FYWB 4ES3A 3HSDA 2IVMA 4MFBB 3O3LA 1S6UA 3DGPA 1VISA 1Z1ZA 1S1XB 2RRBA 2QV6A 3LOUA 4DV7F 3RAQA 1B64A 5BYQA 1W2BR 4F3OA 4G1QB 1DHMA 4Q44A 2HFOA 5THWA 3U1MA 4ECRA 1JJHA 3MEDA 4NLYA 3CJTA 3TRGA 4F0MA 2IAJB 5HO4A 2I0XA 5F8NA 1WORA 2QYGA 4JP8A 3TW0A 2IM3A 3ZNJ1 5IWAF 5F8JA 2JLGA 4E8UA 4ZPDA 4ERDA 4WYLA 4A8QA 1OSCA 3K2YA 1P8GA 2HVDA 1LEOA 4ID5B 4LBIA 4RW4B 3GSIA 4B9NA 1XQIA 1OJ4A 1AW0A 3AHPA 3Q8PB 2V2ZA 1YKWA 3ITHA 2MKJA 2VQFJ 1JJ4A 2H5JB 1EHWA 2XMUA 5DM7Q 1UVLA 3HVTA 4I56A 3TVKA 4YHHJ 2OEKA 2G2OA 4CT9A 3JTPA 3M8WA 3OUYA 1N32J 3HJVA 1GTEA 4M8LA 2HGLA 2DHXA 1NDKA 2IMWP 2A18A 4KKOB 3W8PA 3KK1A 4OX8A 4M94A 4A8MP 1Z2ZA 2DH9A 3SDEB 3NAIA 3M30B 2IAJA 3A1YG 2GO9A 3KDNA 1SL1A 3MPVA 2BOAA 2RKIB 5J2NA 3CD5A 3DFEA 1XR6A 1GEHA 3SCLE 4F7VA 1IQTA 3IGVA 4DV4F 3F41A 4CLPA 1NLKL 3FSIA 2MLZA 3W5ZA 1HNVB 3ENAA 2YKPA 4LRAA 2YWFA 4HDGA 1N36J 1T11A 3JB9k 1NPPA 3MF5A 1BGXT 2GIFA 2VKRA 2ASJA 3I32A 4A8FA 2E7XA 1FKPB 2NS1B 2MKHA 1REVB 2DHSA 1KNZA 3Q8VA 3EX7B 2F4VJ 2D3OR 1XNQF 4DPYA 4JI8J 4I2QA 4ED7A 3PO5A 1PYOB 1FHTA 3MEGA 1UW9A 1MWYA 3MAHA 4MKAA 2B8QA 2CNOB 1HWUA 2D9OA 3IM8A 5DM6Q 4WFAQ 4NXNJ 8RUCA 4F3QA 1RU1A 3RBZA 1FTRA 2YPZA 4OX9F 3L3CA 4DR5F 2BW7A 2XI3A 3CCMS 3CJ2A 4NZ6A 2PSZA 2XLKA 1RWWB 3D54A 2YWEA 4ICLA 2DH7A 4XDDA 3TVZA 4DX5A 3LGMA 4XPEA 2M5YA 4JI1J 1RHQB 5FD1A 2J9DA 1FD2A 1FXLA 1XJWB 3DCAA 1Y5NB 3EGVA 1K9MT 1FVQA 4M5MA 4PXDA 3VAHA 4UW2A 2AYEA 3HHLB 4Q45A 2DPIA 1REVA 4FYDA 1DFDA 1FJGF 5KOWA 1IM4A 3J81U 2HWHA 3H59A 3FFIA 4P74A 4DFMA 1N5YA 1IWGA 1SH0A 3IWXA 1OY9A 3TOQA 2BX6A 1FE4A 2HFSA 2M52A 3DXSX 3W9IA 3VGVA 1YDLA 4LBHA 4DCOB 3PJXA 4DSIA 2CWKA 2HNDA 4A8YA 3W7BA 3PV8A 1FDDA 3Q8RB 1N6QA 2G9OA 4DQIA 1RT3B 1WC5A 2RJZA 3OXFA 2E1MC 1ICEB 4P75A 3OJSA 3DU6A 4F4ZA 2Z0GA 5KFKA 1FJCA 4JI6J 2H4YB 3RTVA 5F8MA 1HBUA 1U7LA 1WG4A 3AD7C 1J2VA 3DLJA 3OXLA 2LYVA 2M7SA 4HDHA 4CO2A 1LV5A 1R0AA 3QJLA 3SCJE 2RF2A 5CH7B 1HFEL 2UUAF 5H9FJ 2KI2A 4JV2A 3D67A 2BZ2A 2KRBA 3NAHA 5L1IA 1WG5A 2F40A 4HACA 2ROPA 3GJTB 3OTEA 2A2CA 2GO8A 2J8SA 2V8HA 4AD6A 5BYSA 1KEKA 4UY85 3IA0A 4F2RA 2Q66A 3LALA 3JTOA 5IS2A 4YHHF 2IM0A 3MM7B 2EC0A 2CDRB 2ZJRQ 4USIA 1RT3A 1TKTA 2GVDB 1K0VA 2MGZB 2G1DA 1YGYA 5HMYA 2V4QA 4CT8A 1XERA 1WUUA 3BGFA 3P5BP 4CLKA 4NYPA 3D6TB 5KT6A 3WC0A 3TZZA 2AJ1A 3N6MA 4KGXB 5FLXY 3HPOA 4JI4J 2WVDA 4LF8F 3IS9B 5IOLA 2C2DA 2HGMA 1X8DA 1X7VA 3B8HA 1Y4ZB 3WC2A 5B0FA 3I4PA 2FD2A 3BEGB 5D4PA 4EUVA 1YVFA 4CLZA 5ITHA 2UV8G 2CADA 1S48A 5CXTA 4IH5A 3CCJS 2FHJA 4PUOB 4HACB 4MTPA 2UVVA 4X65F 5ETOA 3ISZA 2XSJB 1YRTA 4EBEA 4ZVQB 2H54B 4ZDNA 4IRKA 5C24B 2XHWA 4DQQA 3OHBA 1RSCA 1S57A 2DNYA 3BREA 3D6MB 3KWMA 3H20A 1TKTB 2GVDA 2DRBA 3JQMA 1T94A 1GK8A 3DI6B 3BS9A 1IR0A 2CFXA 3UCZP 2HNYB 2OD4A 4UF4A 3KJVB 3KLGB 2Z2YB 1S9GB 3EICA 4X66F 3I56S 3DDIA 4C7QA 4F0KA 5L46A 3HP6A 1FA0A 1S7HA 1R89A 1S49A 5CZXA 1B0VA 1VRUB 5AJ3F 3TJAA 2CZ4A 4C8NA 4A8OA 3G8SA 2JEJA 2XSJA 2AX1A 2QLBB 4D3GA 2KO1A 3SMZA 3A3NB 4ED6A 2F4FA 3CUNA 1FJGJ 4Q8EA 2DHAA 1FRJA 1W25A 1C1BA 2BQUA 1CJVB 2MSSA 5HL7Q 1X4BA 5F9NA 2W9CB 4ECQA 3W8GA 1FVSA 2IJFA 2VV5A 2HAIA 3D6HB 1NCLA 2PC6A 3R5JB 3W9HA 5D8HB 2OPPB 5U47A 2O5DA 1XMBA 2JC0A 2ZC4A 3BDEA 4HTIA 4DR1J 2CJ9A 1I51B 2Z4PA 3ENWA 2MY8A 3SCKE 1U25A 4OI4A 3KK3B 3GV5B 2DIVA 4F4XA 4KO0A 1RT6B 2GAHC 1H72C 1U09A 2AEMA 3R6LB 4KGMA 4O23A 3ZZZA 3J81j 2FJVA 3FK4A 3UPFA 4IQXA 4YR0A 1KN6A 1RTZA 4ECWA 3C6TA 4ZIWA 1SJ4P 1SH3A 5KFUA 4ED4A 2N7CA 3TVYA 4PWDA 4ZP6A 5I3PA 2QN6B 1U48A 1IBCB 4KFBA 1S1XA 4UUWA 2B7BB 2ZBCA 2UVRA 1ZAXA 4MK8A 2ILZA 2LMIA 1U02A 4OYPA 2WTFA 3UN2A 1RT1B 5JUMA 3MEDB 4MJKA 1F3VA 3W60A 3ONQA 4FF3A 3D9BA 3POTA 2OPPA 4P9SA 1UZDA 1TTHB 1U1LA 1VC5A 1FE0A 3I0RA 4JYAJ 2E1AA 1A9NB 3HO1A 2W1BA 3KK3A 4IUFA 3Q8QB 2XTJP 3M6XA 1MNEA 1KTQA 4RW4A 1KBRA 5MLCV 2EEYA 4WTYA 2MHEA 2ACYA 2MLXA 1TL5A 2U2FA 4HT7A 4FDFA 2EC2A 3HVTB 2IMOA 1FKAF 1FESA 1R8CA 1VQKS 3DM2B 4FVCA 5E5NA 4PWDB 1QY7A 2CQ0A 2HVEA 3FNNA 2UXDF 2GFFA 4KFBB 4ANDA 4USKA 1FI4A 2MZQA 2WHOA 3OVSA 2BW2A 3IBFB 3KK1B 4DV4J 4PG5A 1I94J 1TL4A 4F8RA 2HBYB 2HBQB 2IJNA 3FSYA 1T9XA 4X64F 1VR6A 4B3RF 2R8GA 4XAKA 2ZUGA 4MH8A 1UFLA 5A6WA 1KSPA 3SFUA 3O1LA 5DDRC 3OTOJ 4LFAJ 2W4DA 1NK8A 3J7Z5 1NDCA 1V5IB 4X4NA 3W64A 3GYGA 2DNZA 4QWBA 4I4BA 3G4SS 5F0UA 4Z7CA 3CTRA 2PA8D 3AJDA 3I5AA 1R27B 3ULHA 3V6DA 1NK6A 3R2DJ 4DPWA 3H5XA 4NZ0A 1SC4B 5J1EB 1HBNA 3TZYA 1YJVA 4I2QB 1YWXA 6FDRA 3UDEA 2FJBB 1JX4A 4EMDA 4DR5J 1RTIA 1WF1A 2UU9J 1SC1B 2OFGX 3D3CJ 4DSEA 3T1YJ 2DO0A 1LOUA 4Q2LA 5GAGU 4ZVRB 4USVA 3D66A 4LJMA 4NA1A 1SUQA 3OR2B 3AAWB 4Y34A 3CF5Q 1KVIA 1Q5YA 4ECVA 4P71A 2WBMA 4LF1A 3JS9A 2AWZA 4ZVPB 3U7JA 1TKZB 1YSJA 2VFRA 1ZAWA 4YN3B 4R8UB 1N4LA 4TYAA 4WFYA 3ZFVA 4FS2A 2EI5A 1RK8A 1GNKA 3KG0A 1LW0B 1FKOB 3PG9A 4PKDB 4YB1P 3ENQA 4CTAB 4DS5A 2LQJA 4B02A 1C0TA 1C1CA 1TR0A 1R7IA 1NU4A 2EKYA 2UUTA 3AFGA 3QLHA 4IFVB 1RA6A 2G2ZA 4KBIA 4CYUB 3MECA 4AXIA 5GAEU 2AGPA 1CJKB 3PX6A 2VICA 2VU5A 2CYYA 2YWKA 3GMGA 2ATLA 4NXNF 4C0OC 1G7CB 4M5IA 2L48A 2YQ3A 2IY5B 4DI6A 1VJQA 1ZPWX 3KJNB 4EZ9A 5B7WA 4JI6F 3G87A 4DBQA 4ECYA 1N6QB 2DBBA 2ZOMA 2R9LA 4P7VA 4LBPA 1VQ5S 1ZH5A 2GX8A 4BWMA 1T9TA 1EP4B 5GMDA 2X51A 1QDUB 2XULA 4ECTA 4DV1F 4IOCQ 3H40A 3CWJA 3Q8UA 1L5UA 2HQIA 2WK4A 2QX0A 3LP1A 4B9LA 2J9DE 4M95A 2CPHA 2CKWA 4OX6A 1SJFA 3NMAA 4EZ6A 4MIAA 3CXCR 3AT1B 1X4CA 3TA2A 2BJ9A 2LFVA 2VFVA 4MYTA 2E9TA 1NEEA 3QRRA 4ZIVA 4WIIA 4ZJLA 1QAYA 2W4CA 1T0TV 3C14A 3VQSA 3Q0AA 3EVMA 1M5HA 3K5LA 2PGCA 3MM7A 1M1KT 1SL0A 5K8MA 4F50A 1Q8IA 1Y00A 3OT9A 4ED8A 3QFWA 3T5KA 3ZXWA 1RWOB 1D9FA 3QGPA 3D28A 4QR1A 2BQ3A 2H4WB 2IM1A 4ZKAA 3X1LB 2BJEA 4B3RJ 2XMVA 4CP5A 3KLEB 5DG8A 4G3IA 2R3VA 4S0MA 2CXEA 2Q6CA 3DKDA 2JOQA 2QL9B 3A8IA 4DR6J 4LSLA 4WPAA 4OYBA 3TANA 4TN2A 2XS7A 4CIOA 2Y1JA 3BSNA 3GIRA 2FYXA 4FNIA 1R8HA 4RR5A 4BDPA 2KT2A 2OEJA 2YKOA 5CYQA 2WOMA 3JSMB 3C14B 3BM7A 3I5CA 2F1FA 2FQQB 2CQ4A 2V2QA 1YJWS 1KD1T 2IRYA 2WRMA 2DNQA 3HVAA 4P2SA 3PEJA 1JQGA 4CH7A 1B0TA 2YKQA 2J9EA 2HFZA 1C0UB 2ZE2A 3R27A 1IJEB 3IWNC 4WP3A 3TNVA 1D0EA 1ZA1B 3ZTOA 2A6OA 1N33J 4YUDA 1F2HA 2M3DA 2XSFA 4HT5A 5KTQA 3PKMA 3NWRA 3KLEA 1E6VB 2J0WA 5IC4B 4F4YA 3VHQA 5CAAA 1B4SA 1WC0A 2RMLA 3Q2SC 1YK9A 1MN7A 3M6WA 5IV4A 3R5AA 4C3LA 5HP1A 1RXOB 3I31A 3Q89A 2N7YA 1NDLA 1NHVA 4X65J 2E1RA 4DFPA 4WE1A 3N4WA 2W2NP 5CYQB 1NNDA 2VFSA 5FIIA 3JTNA 5DZ7A 4QIEA 1YRXA 2XG8A 1J5OA 3HD1A 1IM6A 3EXYA 4U9RA 4J9RA 4DQRA 3R6GB 2W2QP 1WWHA 1VQ8S 4DPTA 1C0UA 4ZPTR 2R7RA 2YWHA 1EJ7L 2W9BA 3VAJA 4DR7F 2AKWB 1X5SA 4CH0S 3CC7S 2ZH3A 2O01C 5EWGA 2P5VA 4AQYF 2K3KA 2JC1A 2FZGB 4GVLA 1BWVA 2GIRA 2IBKA 3RUBL 1EKRA 2AHOB 4EGLA 2NYHA 2CQCA 3HFKA 4LF6J 4W4MA 5L1KA 4UY8T 3GIIA 3C16A 2B0GA 4K5RA 2Q79A 4TXSA 1TL7B 4EI2A 4OYMA 5IT4A 4USMA 2D3O1 3OLBA 1HNZJ 3NBPA 4NCBA 4CLYA 3B54A 3F0NA 5DJBA 3EDQB 4HYKA 2J6SA 4KJIA 4C97A 5KG1A 1SIWB 1TMJA 2N4CA 1JLFB 2IHR1 5HVFA 1QTMA 4OYAA 4U96A 4QYZK 4IRCA 2HK2A 2M4MA 2R7QA 5KT5A 4BC9A 4F4KA 3L9ZA 3PR4A 2W9BB 3D6FB 3SSQA 3M1VA 3RRKA 4TU8A 2ZHAA 3EVWA 1RWVB 4CI0B 5HQ8A 5ETVA 1OSDA 2FGCA 4MAKA 2NLWA 4DR1F 3I0RB 2LVWA 5L39A 4O3SA 1FRIA 1ZM3A 1HARA 3SFGA 2KXNB 1T7PA 5LSLA 3ISNC 3QFHA 4O0IA 1NJZA 1RAOA 2ZBPA 3TZWA 1JLEA 1I1GA 2COLA 5KFQA 3T3FA 1L3KA 3GZ7A 4IG0B 2V9WA 4JI5F 3H42A 1WOPA 2ZZTA 2KU7A 3MEEB 3UR0A 3DLLQ 5HSPA 1Q82T 2C2RA 4DHVA 2M9KA 5EX3A 2RH3A 5A0YB 4O44B 4LF7J 1RT5B 2YKAA 3D7SB 1VRTA 1SJRA 2HQDA 5LJ3Y 3MD3A 4UQTA 5H9FK 1S6QB 3R5DA 2MLYA 4UQGA 1TFWA 3D1HA 2I1RA 2EVZA 3UCUP 2BMBA 2YNIB 4KV8A 5DDOC 3T1HF 2I2YA 1UVIA 3QZ8A 3DRSB 2YKMB 4V1Ak 3BDPA 1TK8A 5A2QY 1GH8A 4O3PA 1RT7B 3AQPA 2KTQA 4QIFA 1IKYB 4RNFA 4JUZA 4PWUA 3P96A 2XWYA 3HFVA 4WTOB 5IQ6A 3CPWR 2BRLA 1BQNB 1N52B 2OSRA 2VBZA 3BSCA 1Y9OA 2HS4A 1Y5LB 2GC8A 4IG0A 1G6BA 4WFXA 5A8WB 1RYSA 3JSRA 5AXNA 2CPIA 3D0GE 4TU9A 4QIVA 4LF9J 4LRDA 2BR0A 5KFSA 3BQ2A 4F26A 3MUVP 3ET6B 1B70B 1N34J 2HFVA 2IA6A 1YLXA 1VRTB 4N8OA 2MB0B 4CLFA 1NSPA 3TI0A 1RTIB 3GV7B 5B0DA 3EWGA 1URRA 5RUBA 2HLUA 2G1HA 3C3LA 3OR1A 1IKVA 2QFIA 4USTA 2VC1A 5AXLA 3KTQA 1UP1A 3G71S 4LQ3A 1S1TB 2YKMA 2PFDA 4CM0A 5HJYA 3A4TA 2YKNA 1CJTA 3Q86A 2FVSA 2CQBA 3NNCA 1UFKA 1AFJA 2DNNA 2YH1A 3H4BA 1RWKB 2DNLA 1SBRA 3DLEA 1F1BB 3MURP 3HLUA 4ZVHA 1PC4A 3T41A 5K8NA 4DSKA 1IBMJ 2HHWA 2L3MA 3TAMA 2OPRB 1WD6A 3F73A 4DV5J 3NS6A 4A8XA 4F4AA 4DV3F 1NXIA 1H2VZ 4ZVFA 2G0CA 5DETA 2BKPA 3B6BA 4R5PA 1VK3A 1DRZA 4K4UA 2CPFA 3J7YI 4L3KA 5J2QB 4LF5J 3UQSA 1RAAB 1QVFR 3M2RB 3W1YC 4I6AA 1FNXH 3M2VB 1VIOA 1VIXA 3BYPA 1KLMA 2CJYB 3QIDA 2W2MP 1R3NA 4RW8B 4Z2XA 3H25A 2K1RA 2F7VA 3QT6A 1RAIB 1CJTB 4ZPAA 5K20B 4TQSA 3M8QA 1URNA 3NGSA 3VTIA 1U6FA 5JVGQ 1KQSR 1WDDA 4KE5A 3C66A 4V19X 3ELHA 1HNXJ 3JQKA 4PQUB 3JSYA 3FBEA 3KXDA 1S1WB 1RHMB 4OI6A 2DR9A 1QUPA 1X4AA 2B9XA 5DS7A 5KFIA 3GSDA 4ZOSA 3LA0A 2QSFA 3T5HA 5KFGA 1VLOA 1T95A 1H6KX 1KHWA 5FDLA 2RUGA 5LSOA 2KFYA 5J2QA 1VQMS 3TUPA 4ETXA 3P6YC 2NR0A 4RX6A 4DSLA 1K1QA 1BHNA 1X4HA 2XYPB 1P9YA 2DYAA 3M8PA 2XY7A 1E6YA 3CCRS 2FVRA 2BANB 4IR9A 1FNOA 1FFGB 1HW8A 3L7PA 3TZXA 2JJ4D 3M9MB 1D09B 1NO8A 2DY1A 4G1PA 2OEMA 4KAIA 5EWEA 4FBUA 1T3OA 2P9EA 4TLRA 4KHPF 2RAQA 4F36A 1ZM9A 1FX4A 1BE4A 2QA4S 1Y3JA 3CVKA 3VR1A 4C48A 4HVZA 4MT1A 1LWCB 3CJRA 4OQJA 5A8KB 3SV3A 1XIQA 2ZOGA 3T5JA 4CLUA 5FDLB 3MCMA 4FXVA 4HLBA 3Q23A 4B9UA 4C8LA 4BWJA 1YIJS 2OKQA 3KHLA 2OPQA 5EUHA 3V81A 5KFVA 1G2EA 2BANA 2FC8A 3UDVA 1JLAA 2OPSA 3LP0B 1RWUA 2F9DA 2ZBIA 1YTYA 4RNOA 2EBGA 5KG3A 3H5YA 4QYZJ 4F04B 1MU2B 1ZA2B 2DGQA 2I9SA 4OHXA 5C2CA 4ZK7M 3SSSA 5HVGA 1HQ2A 1PKUA 4DR4J 3GJSB 4DR2F 2A0FB 2AZ3A 3R7NB 3VAIA 4BHQA 3IMQJ 2JVRA 2VQEJ 4L3NA 2OLWA 4PPZA 3JYTB 5ETPA 2JZ5A 1KKHA 4R25A 1NH7A 2J5AA 3AJ2A 4M5DA 5A8KA 4WU3A 4YEAA 4UOGA 3IN5A 4B3MF 4BS2A 4ILLA 3T9ZA 1QSYA 1SB6A 3UDLA 1KOHA 2E29A 3IAM9 4CNZA 3CDEA 5KG5A 2BJ8A 2MKSA 2BQRA 1JLAB 7FD1A 4R0EA 1U2RA 3AXKA 1CJUA 1GMWD 2C3OA 4ECZA 4DS4A 3OTDA 1MU2A 1F3FA 2WSFC 3HSZA 4Y0FA 1ZZNA 1EB0A 2AYGA 1S0VA 3TR5A 1QM9A 4H4MB 3DU5A 3EGWB 4C4WA 5C5JA 2IPOB 4DR7J 2KVIA 3H2VE 3MUMP 2FVCA 3E01A 3PVXA 2CNKB 2BJ7A 4FS1A 4IYQA 1RQ0A 3CJSA 3KLFB 4C8KA 4M5DB 3NBPB 4P10A 1X5PA 3H5SA 3GFHA 1EQMA 1QJHA 2IBOA 2FLOA 1RTJA 2LXIA 2RDDA 3I4HX 4IH6A 4NLTA 3PNIA 3NCQA 3I5BA 1YJ7A 2DH8A 4NLXA 2ZM6J 1TMMA 5GAGI 4OZ1A 4DUZF 2RDIA 3AXMA 4FF4A 3MR7A 5HAOA 3E8OA 1GX6A 4NI2B 2KXHA 4ZVOB 3M1VB 1EIYB 1AUSL 4C9DA 4FKYA 1YHQS 5D15A 5G4DA 5LXYA 1BLUA 2EKNA 2RRNA 2XCAA 1SXLA 2AP6A 2R7OA 3F44A 3CT9A 3R5BA 4E2FB 3Q2TC 1U2FA 4H4MA 1Q5VA 5AE3A 5DRKA 3J7AN 5HQLA 4C8OA 3OVAA 3CCSS 2VBWA 2OUGA 1HI0P 1N56A 2N82B 4RW7A 3MEEA 4ED2A 2HRTA 1RAFB 2DNPA 1TVRA 3CD7A 4Y2MA 2NXJA 2HK3A 2WB1D 3FQKA 4NLPA 1UJ4A 4O44A 2OD6A 3I96A 3ILOA 3MCSA 5A0YA 4OI1A 9RUBA 2J6UA 1ZZFA 1FRKA 4LFCF 3GR0A 2HWTA 1QUVA 1YQHA 3KJFB 3US5A 3OBIA 1U1OA 2XS2A 5F9LA 3TQEA 1FX2A 2VG5A 5K8OA 2OH2A 4A8WA 4USHA 1FDAA 4NLDA 4N76A 3SQOP 2YNIA 3W2WA 2HHTA 1B7FA 2PMWA 2P8IA 2V34A 1NK9A 4QCLA 1U6ZA 1LFPA 3FDSA 3GR1A 5KFBA 2JFKA 4Y3CA 3SV4A 3LF0A 2NREA 1AZSA 4BBYA 3J7A1 2XYGB 2G2YA 4FYXB 2GS8A 2IVFB 2DITA 1BQNA 2BBEA 3WBZA 1XWLA 2A10A 2ZC3A 1X5OA 4LRBA 3KOAA 2HEKA 2W9AA 1FRLA
chains in the Genus database with same CATH topology
3BBCA 1NSKL 2DXEA 1XIQA 3BH6B 3FBFA 3ETMA 3VVUA 4UOHA 3ZTQA 3GPAA 2BEFA 1NHKL 1NDPA 3EJMA 2BX6A 3EVMA 3VGVA 3FCVA 2CWKA 1VYAA 3Q83A 3GP9A 1S59A 4WBFA 3VVTA 2DXFA 3PJ9A 1NUEA 4FKXA 4CP5A 1PKUA 4S0MA 2AZ3A 3DKDA 3FKBA 1MN9A 3EE3A 2NCKL 5C7PA 1LWXA 1K44A 4UOGA 3NGUA 1NSPA 1HLWA 2HVEA 4ANEA 4ANDA 3BH7B 4EK2A 1HIYA 2AZ1A 1F3FA 3ZTOA 4DZ6A 1WKJA 1KDNA 3Q86A 3EMTA 3NGTA 4ENOA 3FBBA 5CAAA 1B4SA 1NDCA 3EVOA 2DXDA 1NPKA 5IOLA 3VGUA 5CABA 1MN7A 2HVDA 1LEOA 3Q89A 1NDLA 4UOFA 4F4AA 1XQIA 3B6BA 4DUTA 1EHWA 3MPDA 3FBCA 1NB2A 3ZTRA 1S57A 1HHQA 4C6AA 1NDKA 4FKYA 3R9LA 3ZTPA 1WKLA 3NGSA 1NSQA 3JS9A 1W7WA 3EM1A 3NGRA 4HR2A 1NLKL 3ELHA 1UCNA 3ENAA 3EICA 3FBEA 3DDIA 1B99A 3BBFA 3G2XA 1PAEX 2DY9A 3B54A 1F6TA 3FCWA 3PRVA 4KPCA 5BXIA 3Q8VA 4O0NA 4W98A 2VU5A 2B8PA 1JXVA 3VGTA 4DI6A 1BHNA 2B8QA 1U8WA 2DYAA 3EVWA 4ANCA 3Q8YA 1NCLA 3FC9A 1ZS6A 3L7UA 3Q8UA 1BUXA 3VGSA 4F36A 2ZUAA 2HURA 1BE4A 3BBBA 3ZTSA 1WKKA 3WX8A 1S5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBC A;  1NSK L;  2DXE A;  1XIQ A;  3BH6 B;  3FBF A;  3ETM A;  3VVU A;  4UOH A;  3ZTQ A;  3GPA A;  2BEF A;  1NHK L;  1NDP A;  3EJM A;  2BX6 A;  3EVM A;  3VGV A;  3FCV A;  2CWK A;  1VYA A;  3Q83 A;  3GP9 A;  1S59 A;  4WBF A;  3VVT A;  2DXF A;  3PJ9 A;  1NUE A;  4FKX A;  4CP5 A;  1PKU A;  4S0M A;  2AZ3 A;  3DKD A;  3FKB A;  1MN9 A;  3EE3 A;  2NCK L;  5C7P A;  1LWX A;  1K44 A;  4UOG A;  3NGU A;  1NSP A;  1HLW A;  2HVE A;  4ANE A;  4AND A;  3BH7 B;  4EK2 A;  1HIY A;  2AZ1 A;  1F3F A;  3ZTO A;  4DZ6 A;  1WKJ A;  1KDN A;  3Q86 A;  3EMT A;  3NGT A;  4ENO A;  3FBB A;  5CAA A;  1B4S A;  1NDC A;  3EVO A;  2DXD A;  1NPK A;  5IOL A;  3VGU A;  5CAB A;  1MN7 A;  2HVD A;  1LEO A;  3Q89 A;  1NDL A;  4UOF A;  4F4A A;  1XQI A;  3B6B A;  4DUT A;  1EHW A;  3MPD A;  3FBC A;  1NB2 A;  3ZTR A;  1S57 A;  1HHQ A;  4C6A A;  1NDK A;  4FKY A;  3R9L A;  3ZTP A;  1WKL A;  3NGS A;  1NSQ A;  3JS9 A;  1W7W A;  3EM1 A;  3NGR A;  4HR2 A;  1NLK L;  3ELH A;  1UCN A;  3ENA A;  3EIC A;  3FBE A;  3DDI A;  1B99 A;  3BBF A;  3G2X A;  1PAE X;  2DY9 A;  3B54 A;  1F6T A;  3FCW A;  3PRV A;  4KPC A;  5BXI A;  3Q8V A;  4O0N A;  4W98 A;  2VU5 A;  2B8P A;  1JXV A;  3VGT A;  4DI6 A;  1BHN A;  2B8Q A;  1U8W A;  2DYA A;  3EVW A;  4ANC A;  3Q8Y A;  1NCL A;  3FC9 A;  1ZS6 A;  3L7U A;  3Q8U A;  1BUX A;  3VGS A;  4F36 A;  2ZUA A;  2HUR A;  1BE4 A;  3BBB A;  3ZTS A;  1WKK A;  3WX8 A;  1S5Z A; 
#chains in the Genus database with same CATH topology
 2E5J A;  4PXC A;  4URS A;  3FBF A;  1FD8 A;  4M63 A;  5IWA J;  3G6X A;  2VJV A;  2H51 B;  3QNW B;  3O8W A;  3CO9 A;  1BWE A;  2WSE C;  1BQX A;  1KQG B;  3I0S B;  1IKV B;  4ZP7 A;  3FEZ A;  3UR3 C;  9ATC B;  5ADZ A;  1SH2 A;  1NME B;  2C2Z B;  5KFA A;  1PG5 B;  2LXF A;  5KFO A;  2BE7 D;  3Q83 A;  3M32 B;  5DG9 A;  1IBL J;  4FVM A;  3L95 X;  1ZOT A;  4ZP9 A;  2G0J A;  2BA9 A;  5J1N A;  2UUC F;  4FKX A;  3BGR B;  4QIG A;  2LQ9 A;  2E5H A;  2YVS A;  3N01 A;  3V6D B;  3I87 A;  4LF9 F;  2HS0 A;  3TAP A;  2ADC A;  1IN0 A;  2IYG A;  1U45 A;  2WVC A;  2R7X A;  1TU0 B;  1Q78 A;  2XO6 A;  1S9F A;  4R5P B;  3IGN A;  3NGU A;  3P3D A;  1GX5 A;  4LR7 A;  1WSR A;  4KGZ B;  3LGH A;  3R1H A;  4RW9 B;  3KLH B;  4C11 A;  1JXE A;  3A3O B;  5HMW A;  1OYE A;  4OX7 A;  3GCX P;  1DTT A;  2YH0 A;  4X4T A;  5EWF A;  4EWT A;  3GQC A;  4QU6 A;  3AQO A;  4RW8 A;  4AYB D;  2QFJ A;  2CPD A;  4K5S A;  1RLD A;  1W26 A;  4CM2 A;  4DG1 B;  2F4V F;  2BE2 A;  4ES1 A;  2BAC A;  3LWM A;  3MCN A;  2W7P A;  2K8G A;  2WON A;  2HZA A;  1YBU A;  3DLK B;  3VV2 B;  2CRL A;  2GCF A;  4L72 B;  4B17 A;  2V8G A;  5I3U B;  4USU A;  3OPK A;  3KLI B;  4EYI B;  3KJQ B;  1UL3 A;  2GMJ A;  1UJ5 A;  1BMQ B;  3KK2 A;  2D7S A;  5L1L A;  4I0W A;  2L41 A;  5A6P A;  5JJB A;  2RQK A;  1F9F A;  2R7W A;  4NLO A;  3V4I A;  3HDS A;  1RWP B;  1Q53 A;  3IRX B;  4DUT A;  1G3O A;  2PD1 A;  5H1S V;  2ZDO A;  3FJ2 A;  4LT6 A;  1DBD A;  1LWE A;  2ILY A;  4C11 B;  4CQ1 A;  1I3O B;  2VPZ B;  4MIB A;  3HI9 A;  4KR0 B;  3IBC B;  1DTT B;  1RAJ A;  4LR9 A;  3THT A;  5KFF A;  2L9N A;  1RT4 A;  2MKI A;  3TX8 A;  1XMQ J;  1EQ0 A;  4NYZ A;  4KTQ A;  1A7G E;  1FF2 A;  4OJ3 A;  2HHX A;  4B9S A;  2IM2 A;  2H48 B;  1YX2 A;  1IKW B;  2HZV A;  2V8V A;  3MM6 A;  4OYI A;  4QIW D;  4WKY A;  2RT3 A;  1NRK A;  4ZN3 A;  5AE1 A;  4X4Q A;  3T5L A;  1GT8 A;  1W7W A;  1H2T Z;  3RYL A;  2VG6 B;  4NEY A;  4DL6 A;  3QWU A;  4B3T J;  2QLX A;  1UCN A;  3BJY A;  5DLG A;  1WF0 A;  3MPU B;  2ROG A;  1RU2 A;  4QWC A;  2XMW A;  3M9N B;  3QT7 A;  1QVG R;  4Q7A A;  2CJX B;  2RS2 A;  3UD3 P;  4WFB Q;  4PYA A;  2FLL A;  1LWE B;  5D0G A;  2AJ0 A;  2YWG A;  4TY8 A;  4ED0 A;  1FWP A;  1UVJ A;  2OPQ B;  5DLF A;  4NXM F;  3SBM A;  3LWL A;  1WOS A;  2F63 A;  2FJE B;  5HN0 A;  1U1N A;  1OY6 A;  3AOD A;  2OPS B;  3BGU A;  1H3D A;  4KH1 B;  2DGW A;  5F3T A;  1RT2 B;  3FEX B;  4ATN A;  2OTJ S;  1QAJ A;  4ANC A;  1IKW A;  2MJU A;  5GAE I;  1CEZ A;  4A4J A;  2RD5 C;  1M1H A;  5C25 A;  3KG1 A;  4DR2 J;  4YOE A;  4O4G B;  2VG6 A;  2F9J A;  2KVQ E;  3S1T A;  1H7X A;  2KXF A;  2ZUA A;  3GYN A;  3ZTS A;  2Z2Z A;  1YBA A;  2JWN A;  2X3G A;  3NY0 A;  3LPY A;  4OYO A;  5C42 A;  1OO0 B;  1JKH B;  1UW4 A;  2WW8 A;  3PTW A;  4OFZ A;  4CLT A;  2J6T A;  1EET A;  1H2U X;  2R2S A;  3BSA A;  5T7L B;  5KFM A;  3ETM A;  5KFL A;  3BQ0 A;  3Q22 A;  3UVJ A;  1J5E J;  2QL7 B;  1TUW A;  2BEF A;  2VPY B;  4NEZ A;  1HL6 A;  1IKX A;  1QE1 B;  4J9Q A;  2IYI A;  3QAE A;  4TNO A;  4WZM A;  4OL8 A;  3K57 A;  3BYR A;  3GP9 A;  3PHT A;  4WK1 A;  3CCQ S;  1P1L A;  5LXR A;  4OYW A;  2B4P A;  4C3K A;  1V3R A;  1N88 A;  1PYS B;  2GJF A;  2LLZ A;  3D0I E;  4PXE A;  2VQE F;  2FJW A;  1X0P A;  3EGN A;  3OFG A;  1Z2L A;  2VD3 A;  3IR5 B;  4LSN A;  4N77 A;  5B0B A;  2WB4 A;  1XMO F;  2WVF A;  2K06 A;  4WCE Q;  2JLE A;  2CAJ A;  1U49 A;  2X1F A;  4I6Y A;  2FY1 A;  3MDF A;  3DLB A;  2DNH A;  4DV1 J;  1O51 A;  3TUI C;  3BSO A;  3CCT A;  2EK6 A;  4QWA A;  4W92 B;  2WCX A;  2ATC B;  4ZPC A;  1K73 T;  2DIU A;  4ZIT A;  2CQH A;  2RIL A;  3HSG A;  3DC2 A;  5B0G A;  3S01 A;  1PIE A;  3QGI A;  2YNF A;  3QQC D;  5D77 A;  4YQW A;  1UAW A;  4RPF A;  3PZP A;  4X2B A;  2MZS A;  4OZ0 A;  2HBR B;  1UVK A;  1OPI A;  3BH7 B;  4J90 A;  4PRF A;  4LIW A;  1WF2 A;  3VZH A;  4ER8 A;  3KMS A;  1XMQ F;  1RKI A;  4NX9 A;  2QLF B;  2RUS A;  4YDD B;  3QZ7 A;  2HW3 A;  2DT9 A;  1NAQ A;  2VFT A;  3W62 A;  1NZA A;  2MEW A;  3NXZ A;  5IM0 A;  3M7V A;  4Z37 A;  5F0W A;  2F8M A;  1S99 A;  2XI2 A;  1T9W A;  2JL9 A;  3HHD A;  1DAX A;  3ILI A;  4KGK A;  2XQC A;  3UCG A;  3VGU A;  1T05 B;  4DU7 A;  2L9D A;  3K58 A;  4IFY B;  1X9W A;  2BRK A;  3DRP B;  1N5T A;  5KFW A;  2KKH A;  3HD2 A;  4ID5 A;  2MTL A;  1KOO A;  4AT1 B;  1C2P A;  2VBY A;  1LW2 B;  3HHL C;  1WI8 A;  4J9S A;  1PGZ A;  4ZVG A;  2VOO A;  5HRO B;  1QTN B;  2V8D A;  2ZNZ A;  5A8R A;  2DGU A;  3R5G A;  4ZCI A;  3G82 A;  1WHY A;  1ZM4 A;  2VG5 B;  1A6L A;  3OUY B;  4NA2 A;  1DQA A;  2HKE A;  3K5P A;  2QMW A;  4C6A A;  2PMH A;  4ELV A;  3CIZ A;  2VUG A;  3G86 A;  3A8E A;  4KKO A;  1HNI B;  4FNH A;  4QZV B;  1O6X A;  2Y1R I;  4ETZ A;  1DLO A;  4LIR A;  3BV8 A;  3KKF A;  5BR8 J;  3PX4 A;  1WKL A;  4ZS6 A;  5IM0 B;  2HQC A;  3ZZU A;  1VQP S;  1TKX A;  1W2I A;  2CNN B;  2OGU A;  3G8Q A;  4PR6 A;  5J2N B;  4DPX A;  3LTO A;  4B3O B;  1T05 A;  3B78 A;  3BR9 A;  4ID8 A;  4BC7 A;  3IG1 B;  2KHC A;  3UNG C;  4IH7 A;  2FIU A;  4NLS A;  4LRC A;  3ADA C;  5DZ6 A;  2JEF A;  3NOC A;  4TLQ A;  2XB2 D;  4K2X A;  2EG1 A;  3PRD A;  1TL1 B;  3AA8 A;  1QD1 A;  2B4U A;  3HVW A;  2YBV A;  1BQM B;  2P6T A;  3IR6 B;  1UMJ A;  2R2R A;  5K14 A;  2J0Q D;  3UD5 A;  3U1L A;  1TV6 B;  2QGF B;  1F0X A;  3G82 B;  3K17 A;  1FXD A;  3KUG A;  3WHI A;  2ZH9 A;  2AD9 A;  3I0S A;  1S10 A;  3MTK A;  3U27 A;  1K0T A;  2PFF B;  1HMV B;  2KT5 A;  2LCW A;  3DGP B;  5LJ5 Y;  1IBK J;  2EFO A;  1S7I A;  2QO3 A;  2Z8Q A;  2M8H A;  2DNM A;  3C15 A;  1O8B A;  3RGI A;  2VDH A;  1OQ3 A;  2HWI A;  3M32 A;  4PPD A;  3ZC4 A;  1RCO B;  5CD4 A;  2CG4 A;  1C4C A;  2G4B A;  3CCE S;  4OYX A;  4YY3 F;  3HKZ D;  3EPI A;  1GXT A;  2KFN A;  3CJK B;  5KG4 A;  4B3O A;  4GVB B;  2FHK A;  2ZHB A;  2U1A A;  2E7V A;  1M90 T;  3HJF A;  3E51 A;  1JLB A;  3HHL D;  2HHH J;  3IP0 A;  5JVH Q;  4ZVT B;  1S0N A;  1GMV A;  4PG7 A;  3HXM A;  4M5L A;  3K5M A;  1Q7L B;  4K59 A;  2K7K A;  4YR3 A;  2HHV A;  1SQF A;  3BPD A;  4RL1 A;  4P6Q A;  2B51 A;  2DXE A;  4NCG A;  3LQV A;  5L9N A;  4Y6I A;  1NJX A;  1BQM A;  3OTO F;  1M1G A;  4LFA F;  1VBY A;  1Q0N A;  3CCZ A;  3HHL A;  3VAG A;  1ZTT A;  2W2P P;  3AD9 C;  3L4B C;  3AB2 B;  4AUK A;  3QJJ A;  1S1V B;  2W01 A;  1HMV A;  2ACM A;  4J9K A;  2DTJ A;  3NRB A;  3MR2 A;  3RB6 A;  3P45 B;  3FCV A;  4IDK B;  1NK5 A;  1VMB A;  1VYA A;  2CA9 A;  2GW8 A;  3QO9 B;  3S6E A;  2QT7 A;  3VAF A;  4Q0B B;  5E3A A;  3MAA B;  3UDC A;  3SQG A;  4EFA C;  2AT1 B;  1FJ7 A;  1X4G A;  3CJK A;  3CB4 A;  1VOM A;  3GFY A;  4GVB A;  5J1P A;  4NAS A;  2UU9 F;  3T1Y F;  2CG8 A;  2M88 A;  3DLG B;  3NOG A;  3SXL A;  4DF8 A;  1U24 A;  2HLT A;  1TQL A;  2XMK A;  1IXK A;  1UPM B;  2EBE A;  2WVE A;  4L76 A;  4NCG B;  3OHA A;  2ZD1 B;  2AU0 A;  1T03 B;  1GXL A;  4DDF A;  2BM0 A;  5K9F A;  5IT9 U;  4O4R A;  1S1V A;  3NP5 A;  1AUD A;  2IRU A;  2FTR A;  4DFK A;  2W4P A;  2EFG A;  4DV7 J;  1VQL S;  1RT4 B;  1YZ6 A;  2MZJ A;  4IDK A;  4JI7 F;  2B5J A;  4WP9 A;  5L9X A;  1S72 S;  2DGX A;  2ZWO A;  3L09 A;  3NNA A;  4JI2 F;  1HIY A;  4I64 A;  2AEF A;  3H5U A;  4NLU A;  4QPT A;  5GME A;  1U6B A;  1UVN A;  4OHY A;  4DZ6 A;  1D9D A;  4CO3 A;  3OJU A;  2CJA A;  2FPH X;  3QWP A;  2O3D A;  1HWI A;  2FC9 A;  2DNO A;  2W2O P;  3EMT A;  4ICL B;  3I6P A;  4M5J A;  4OHV A;  1R31 A;  1S4E A;  5HK4 A;  2R8I A;  1RE1 B;  5IFM A;  3FBB A;  3TWZ A;  3A13 A;  2X3D A;  1Q86 T;  3EVO A;  2UXC F;  4J7C A;  1JJC B;  4CZC A;  1VQY A;  4GO5 X;  1CC7 A;  2YX7 A;  2A1B A;  1DQ9 A;  2CQG A;  4IRD A;  2NXU A;  1OWX A;  2ZH1 A;  3HZG A;  4NLW A;  4PUO A;  2WVB A;  5D0H A;  4ZVE A;  2DB1 A;  3FFI B;  4LUB A;  2LQB A;  3UO0 A;  3THP A;  1RA7 A;  3VQT A;  3C19 A;  4KSE B;  2DCL A;  3DOL B;  4M5H A;  1JLG A;  3CNQ P;  3MR6 A;  3SI8 A;  3SCI E;  1ZTW A;  2Y3Y A;  5B0C A;  3PX0 A;  2BKN A;  2QE5 A;  2GV1 A;  3A3P B;  2OML A;  1RYR A;  3MXH P;  3UNY A;  1PO6 A;  2CQ1 A;  1Y3K A;  2AW0 A;  8ATC B;  1F5A A;  3CO0 P;  5DGB A;  3Q24 A;  4X4U A;  1KTV A;  4O4G A;  2V8P A;  2X1G A;  2B6A B;  3HCX A;  1HBU B;  4ECX A;  3NGR A;  2HHQ A;  5E3Q A;  4TU7 A;  7FDR A;  2NZC A;  1RUS A;  3MMJ A;  4KYZ A;  4L73 A;  3LAK A;  2NXE A;  3KLG A;  4F0H A;  1EET B;  2RF2 B;  4DV2 J;  4ZJQ A;  2VKZ G;  4DL3 A;  4J9P A;  4U7U K;  4WFN Q;  3N79 A;  2O67 A;  1TUG B;  1VI7 A;  1DTQ B;  3PYG A;  3ILL A;  4DPU A;  1HD1 A;  4W98 A;  3OL7 A;  1MML A;  1FRM A;  5M2P A;  2VF3 A;  3N5F A;  2LU1 A;  1QE1 A;  1JLG B;  1YZ7 A;  5F8G A;  1HHS A;  1X0F A;  2IDL A;  4MFB A;  1U1Q A;  4NLV A;  1XMO J;  2PI5 A;  2Y0B B;  2MGZ A;  3UFC X;  4NL5 A;  1WHX A;  5GAH I;  3PR5 B;  4KT0 C;  2E5I A;  2IC3 B;  3JSB A;  2EFN A;  1U8S A;  2MQ8 A;  5LM7 E;  3TJ9 A;  4EYH B;  4JI1 F;  4ZPB A;  5IT9 Y;  2C3P A;  2B6A A;  1JB0 C;  4RWX A;  2KYZ A;  3HZE A;  5CHC B;  2JFD A;  4BLG A;  2R7V A;  2Q43 A;  2X7I A;  3G96 A;  4URG A;  3BBB A;  3OFF A;  4JYA F;  3A8K A;  1HYS B;  4N56 A;  1X4D A;  4OZJ A;  1S5Z A;  4LF5 F;  2FHM A;  1NSK L;  1XK8 A;  4KO0 B;  2NSB A;  1RP5 A;  1RAH B;  3V2U C;  1J5E F;  3CCU S;  2R8K A;  3GJQ B;  1NJY A;  3IO1 A;  3C6T B;  1HWK A;  1FRX A;  3FZ2 A;  2XGP A;  5C24 A;  4NLR A;  2XMM A;  3RW6 A;  3AY0 A;  2ZIT A;  4MYU A;  2VHG A;  2YNH B;  2R2T A;  5GAD U;  1R8A A;  3GTY X;  4JB8 B;  2GHW A;  5KFJ A;  2QA2 A;  2RHS B;  3K5O A;  3PJ9 A;  2YQ1 A;  1XR7 A;  5L1J A;  3M30 A;  5HQM A;  3B82 A;  1HPZ B;  2M8D B;  1N5V A;  2ZH6 A;  3K0J A;  1RCX B;  1ELO A;  1O5J A;  4DV6 J;  2ZNY A;  2HVI A;  4DL5 A;  1T9Y A;  2C2N A;  4HL9 A;  3J80 U;  1HNX F;  2UUA J;  3KUE A;  3W3S A;  1HYS A;  3PIP Q;  1FNM A;  1PSD A;  3RRG A;  3IM9 A;  2OI2 A;  2Q1L A;  4KHP J;  3MWB A;  4CLL A;  2YPY A;  3UW1 A;  1SI9 A;  4HTJ A;  4QPX A;  4Z7Y A;  2ZKT A;  1U1K A;  1SKR A;  4N41 A;  1FFW B;  2C1E B;  2KDO A;  3DDK A;  2HHP A;  3P8B B;  4K8R A;  4QWD A;  3OL8 A;  4WP8 A;  3MEG B;  4OV1 A;  2KM8 C;  2FZK B;  2J7K A;  4HI2 A;  4RO0 A;  2GGP B;  2V5H G;  4RW6 B;  4ZLP A;  2E66 A;  5IQQ A;  1VHI A;  5B08 A;  2D3Z A;  2RIJ A;  4RUA A;  4WXW A;  3RB4 A;  4K4Y A;  1TKX B;  2ERR A;  2YX4 A;  4ILR A;  1V3Z A;  1LXN A;  2QA4 G;  3PYD A;  2AGQ A;  3IG1 A;  4OZ3 A;  3CCV S;  1SL2 A;  4I7F A;  1P1T A;  4XPC A;  4RU2 A;  2CJQ A;  5EGY A;  1NKE A;  3LPE A;  4OZN A;  3OL9 A;  2GJ2 A;  1RAC B;  2DIS A;  3RZA A;  4LVO P;  4DCJ B;  1B3T A;  2DGS A;  4DL4 A;  4YP3 A;  2I8E A;  2V4J A;  3PFE A;  3HX9 A;  2Y0S D;  2FJX A;  4JI5 J;  1N5Y B;  5D78 A;  4YFU A;  5DGA A;  3IFE A;  2PE8 A;  2I38 A;  3MR5 A;  2JX2 A;  3C15 B;  1Y7P A;  3J7Y U;  5H9E J;  4RW6 A;  4B3M J;  3HK2 A;  4DR4 F;  3HUL A;  3PEH A;  2N3O A;  1YI2 S;  2HND B;  4LF7 F;  1IWA A;  4WIQ A;  4HEA 9;  2MZ1 A;  4DL2 A;  4DF4 A;  1ZYQ A;  4K4X A;  5SZT A;  2FGO A;  3CJ8 A;  3I9Z A;  1FXR A;  3DMJ B;  3OR2 A;  3CJ5 A;  3ZTP A;  2N3L A;  3V4M A;  2BJ3 A;  4ZCM A;  1N5Q A;  1HR0 J;  3N0V A;  4U95 A;  4ELT A;  5LL6 d;  4LF2 A;  1JLB B;  3M8S A;  3CMA S;  5M2R A;  3D0H E;  1WG1 A;  2GZO A;  4M5K A;  4UTG A;  1KQF B;  5I4M A;  1LW0 A;  2AMC B;  3A12 A;  3PM9 A;  3WQP A;  1NZ8 A;  3OFE A;  4QBU A;  1M0S A;  3G2X A;  4EBC A;  4ZJO A;  4MMO A;  1R0A B;  3W63 A;  1F6T A;  1DJ0 A;  1C0T B;  1C1C B;  3FCW A;  5EHH A;  2KZZ A;  2VA3 A;  3DM2 A;  1KFD A;  2V4J B;  5IZH A;  1VQ9 S;  4N7T A;  2J76 E;  5LMN F;  5AXK A;  3FRZ A;  4DUY J;  3BKT A;  4ZVS B;  2DO4 A;  1Z4U A;  1FER A;  2HBZ B;  1SQG A;  3HSJ A;  4LRE A;  2XY5 A;  2DJW A;  2IRX A;  4NML A;  3MAA A;  1GMU A;  4RWW A;  3T6B A;  4DCP B;  1X9M A;  2PEH A;  3SEO A;  4P72 A;  3DMJ A;  2V67 A;  1LKZ A;  3Q8Y A;  1SQE A;  4DUZ J;  1EP4 A;  1TEL A;  2RQC A;  2HHH F;  1G1X A;  1YJR A;  2NSC A;  1TVR B;  5F8L A;  3D4J A;  4QW9 A;  3TYT A;  5DQH A;  2CPJ A;  2N4D A;  4C8Z A;  3IS9 A;  3LGN A;  4DR6 F;  1RB0 A;  1D3W A;  4OZ5 A;  3RG6 A;  4CNY A;  5E33 A;  1VQ6 S;  5KG2 A;  3NGD A;  5ETQ A;  3TQ1 A;  1HNW F;  4RUC A;  4KGV B;  1WHV A;  5IT0 A;  3VVU A;  1VRQ C;  2DCU B;  2EG2 A;  2RQM A;  3GE9 A;  2QYC A;  1K8A T;  1YG0 A;  2DGV A;  1KHV A;  1MWQ A;  1VQS A;  2B5J B;  3ENV A;  4HI1 A;  3VCD A;  3EZU A;  3V5R A;  1Q8L A;  1N54 B;  4J37 A;  3I82 A;  1OMS A;  2VDI A;  3N9U C;  3RW7 A;  3TUZ C;  3CED A;  3HFZ B;  1S59 A;  3OV7 A;  4DSJ A;  2B43 A;  3M05 A;  3DI6 A;  1WAC A;  5D6G A;  1PBA A;  1U0H B;  4A8K A;  2LEB A;  3KDO A;  1O0P A;  4R8U A;  3T9N A;  1N33 F;  2R7T A;  3KJV A;  2OIH A;  3CGI A;  2OAU A;  1FWL A;  2BXJ A;  2O66 A;  4LSL B;  2Z30 B;  2C3M A;  2LA4 A;  1FFS B;  3CJ4 A;  3IC1 A;  4P2X A;  1LQ9 A;  1K44 A;  2Z2L A;  4FPI A;  5M2U A;  4HH0 A;  5KFE A;  4RU9 A;  2ZJP Q;  3QT5 A;  3MEC B;  4N47 A;  2R2U A;  3SYZ A;  1CJK A;  1SKW A;  4Q43 A;  3GFZ A;  1T02 A;  3LUY A;  1ZET A;  3CC4 S;  2P9G A;  3QRP A;  5I42 A;  2Y8W A;  5HBM B;  1D9A A;  1CBK A;  5GVQ A;  3KMQ A;  1SJQ A;  3R97 A;  2RDJ A;  2UXD J;  4WZQ A;  4K4Z A;  2QMU B;  3CC2 S;  2CUY A;  2ASL A;  2ZE2 B;  2XNQ A;  4DWI A;  1Q95 G;  2W9C A;  2C22 A;  1YJT A;  4PAB A;  1F2G A;  1KLN A;  4RLE A;  5DDP C;  1F9E B;  3TX0 A;  4ENO A;  3IRW P;  4ZCL A;  2G0I A;  5ETS A;  2AYB A;  2ASY A;  1S12 A;  2HVH A;  2UZA A;  4LFB F;  4U6P A;  1OPZ A;  1DAR A;  2V94 A;  5CAB A;  3H4D A;  2KL8 A;  4CRJ A;  1I5O B;  2AYM A;  4EK2 A;  2ZOF A;  5HP1 B;  4RKU C;  4DPO A;  4NRU A;  3P49 B;  1RTH B;  3PY8 A;  2LEC A;  1KVK A;  2HIY A;  3AOB A;  3CDA A;  1REG X;  2HYI B;  2BDP A;  4TY9 A;  2NYI A;  4ZLJ A;  3QAT A;  3PW0 A;  2DNK A;  3LAN A;  2LEA A;  4O3Q A;  4OJ1 A;  2ZWP A;  2MKK A;  1UVM A;  3K8W A;  2R8H A;  1TZ0 A;  2BKO A;  4USW A;  2DR5 A;  1JLQ A;  1HBO B;  2NUU G;  5D4N A;  2PO4 A;  1NK7 A;  5BYR A;  2LEP A;  3NS5 A;  2EW9 A;  3U02 A;  3POT B;  1XNR J;  1PYT A;  1NSQ A;  3NCP A;  2ZJQ Q;  2GHP A;  5F8I A;  1X5T A;  3D1Q A;  4DR3 J;  1H38 A;  4PG4 A;  5A76 A;  1RHJ B;  1VFJ A;  2CQI A;  4LRF A;  2P9C A;  3EGZ A;  1HI8 A;  2ROE A;  2ALZ A;  1VC6 A;  3NL0 A;  3G6E S;  1D1U A;  3QJP A;  1CC8 A;  5ETK A;  4MK9 A;  4DN0 A;  4JI3 J;  3PRV A;  4H4K A;  1V9O A;  2WOM B;  3UI3 A;  5GAH U;  3JSM A;  2MY7 A;  3W66 A;  3ZZY A;  1VQ4 S;  3BR8 A;  3PO4 A;  3MZI A;  1LWF A;  3BZQ A;  2UUB J;  1XR5 A;  1ZM2 A;  2A2D A;  2KJV A;  2JLF A;  3PIO Q;  4J9N A;  1GXU A;  1U47 A;  4DL7 A;  3KHR A;  4RNM A;  2D9P A;  2DHH A;  1SVD A;  1U8W A;  1V6H A;  2QL5 B;  4X4O A;  4K4W A;  2DEI A;  2LP4 A;  3C6U B;  1ACM B;  1Q16 B;  2CZV C;  3GON A;  2H1Y A;  4J9U E;  1HPZ A;  2P2C B;  1L3T A;  4B9T A;  1UFW A;  1KS2 A;  3CSK A;  4M5N A;  1KWM A;  3R8Y A;  3BO3 A;  3PW4 A;  2FVP A;  1SC6 A;  2M70 A;  4ZPW R;  3AA9 A;  4AL7 A;  1WKK A;  1PJ5 A;  4OYZ A;  4XDC A;  3LH2 S;  2OHD A;  3WX8 A;  1DUR A;  2V0N A;  2W8K A;  2Q6B A;  4WE1 B;  2BAB A;  4YME A;  2L9W A;  2JHE A;  2HFU A;  2UV8 A;  4CLS A;  1J27 A;  4WJB A;  4H54 A;  3VAM A;  4G6V B;  1VCT A;  1VDH A;  1HBN B;  5F3Z A;  1NBE B;  1EKS A;  2B3T B;  3EJM A;  3NS7 B;  2LU2 A;  3R5C A;  4KH0 B;  1Y10 A;  3J81 Y;  3TA1 A;  3N6L A;  4PWW A;  2CQP A;  1S6Q A;  3OXG A;  2GA7 A;  2GGP A;  3W65 A;  1L3U A;  3C6U A;  2LQ5 A;  1RT1 A;  3HT3 A;  3MM8 A;  2D69 A;  1WC6 A;  1PAU B;  3OFH A;  3W9J A;  2BM1 A;  4PQA A;  5LT5 A;  2H65 B;  5HMX A;  3R7B B;  2ZHO A;  3MHY A;  4CO1 A;  2R8J A;  4V19 J;  5T14 A;  2E5L J;  3PJW A;  4MKY A;  3ZZO A;  1TKZ A;  3UD4 P;  3UE2 A;  3IXQ A;  3HVR A;  4OHZ A;  1MN9 A;  2PDA A;  3HHK A;  4I7F B;  1TL7 A;  5KT3 A;  3U1N A;  2M2B A;  3V6K A;  2BV3 A;  4CTA A;  2PI4 A;  3MGJ A;  2MHN A;  4PG8 A;  2FDN A;  4DV5 F;  3MD1 A;  4IFV A;  1R0B G;  4DV3 J;  3ZO7 A;  1Y11 A;  2OEL A;  3D3B J;  3DN9 A;  4CYU A;  2EPI A;  4WF9 Q;  1WTF A;  2EFP A;  1KON A;  4CWB A;  4FXD A;  2UXB J;  4ANE A;  2HHU A;  1N0V C;  2Y1I A;  2W7O A;  3EYZ A;  1UEV A;  2SXL A;  4XTT A;  5SUH A;  1S4F A;  1ZAV A;  3K59 A;  1N48 A;  2YX1 A;  1VHF A;  2PEB A;  3S8S A;  4PAA A;  1FTC A;  2DGO A;  3C8Y A;  4R0J A;  1XEZ A;  2KH9 A;  2YKN B;  2C2O B;  3FEY B;  3EZ5 A;  1M5K C;  3G8T A;  1YJU A;  3BKU A;  2KM8 B;  2QEX S;  4NLG A;  5CYM B;  3CJ3 A;  1NPK A;  3O2I A;  4B08 A;  1R0C B;  3HHE A;  4PCQ A;  4DLG A;  3QRQ A;  2EK1 A;  3TAM B;  4A8S A;  4UOF A;  1QLN A;  5H9E K;  1EZZ B;  4NYO A;  1FRH A;  3QPI A;  5J1E A;  4IOB A;  3VAL A;  5L8R C;  4ZA1 A;  3WDO A;  3W5Y A;  1BXN A;  3CD0 A;  3ILJ A;  4B9V A;  4B3S J;  2EFQ A;  4KPY A;  1AYE A;  2VH7 A;  3NEK A;  4CDI A;  1WC4 A;  3TUJ C;  4E98 A;  4F3M A;  5BJR A;  5GMK a;  5KFC A;  3V6J A;  4X64 J;  2QG9 B;  3M2R A;  4OJG A;  2HRU A;  4QR0 A;  2RQ4 A;  1SUQ B;  4GC6 A;  3DRR B;  2AF6 A;  5G0R B;  3N6N A;  4EO6 A;  1CS4 B;  3MPY A;  1RT7 A;  2XY6 A;  3PRB A;  3AOA A;  3HKW A;  4Y2C A;  1Q79 A;  2MPU A;  1XTZ A;  5CYM A;  5KFZ A;  4YS2 A;  4ZLL A;  2HGN A;  3HM9 A;  1T03 A;  1FKO A;  3MEK A;  2CIM A;  2AQ4 A;  3GV8 B;  4PQU A;  1VQ7 S;  1LXJ A;  3QLH B;  2IFX A;  1HI1 A;  2A3J A;  3DOM A;  1PAE X;  2AJF E;  1RWX B;  4DN9 A;  1NHU A;  4DV0 F;  4LQ9 A;  2ZKU A;  3EXC X;  4TVA B;  5DDQ C;  2D1C A;  4CO5 A;  5AT1 B;  3RU0 A;  3BF4 A;  4U67 Q;  4K50 A;  2CZ9 A;  4I69 A;  4KRW A;  4JI0 F;  2ALY B;  3LO3 A;  1RWN B;  3FRY A;  2D3U A;  3OR1 B;  5D0R A;  3QYY A;  1G4C A;  3OTB A;  5L38 A;  1RAD B;  4LF8 J;  4QR2 A;  2AIR B;  3MM5 A;  1KVJ A;  1E6Y B;  1OQ6 A;  5G0R A;  1RTD A;  2FJA B;  1CS4 A;  5HI7 A;  1HBM B;  1C4A A;  5EDW A;  1JJ2 R;  1U0H A;  1ZS6 A;  4KHM A;  2FHO B;  2C3U A;  2XCP A;  4CCH A;  1YIT S;  1X60 A;  2DHG A;  1BUX A;  2F5G A;  1E6V A;  2OO4 A;  3LP1 B;  3T1A A;  4IR1 A;  3OVB A;  1MLA A;  4Y00 A;  1MW7 A;  3PAC A;  5DO2 A;  5A2Q U;  1LFW A;  3DOK A;  2UUW A;  4FP9 A;  5DG7 A;  4M1K A;  3RB0 A;  3CDW A;  3VAK A;  1S0O A;  5ETL A;  5B0E A;  3BO2 A;  4RBT A;  1IR1 A;  4H4O B;  4C98 A;  5I42 B;  3FGV A;  2KYX A;  1F5C A;  3BN4 A;  5HBM A;  5BR8 F;  5GAD I;  2XNR A;  3PHE A;  3DDN A;  3FUY A;  4QYR A;  6FD1 A;  1KLM B;  5LMU J;  3MMA A;  2VQF F;  2GQ2 A;  1RTD B;  4E0D A;  2LXU A;  3RAM A;  4LFB J;  2W24 A;  3LP0 A;  1HW9 A;  1U1M A;  3V81 B;  4X66 J;  2XBP A;  1JNZ B;  1I6J A;  3BB5 A;  3M8Q B;  2HMI B;  1K1S A;  1PJ6 A;  2AX0 A;  2MQL A;  3BGL A;  4U7C A;  4DLE A;  2QMX A;  4YB6 A;  1S77 D;  2E9R X;  3FQL A;  1UJ6 A;  1RHU B;  1WEX A;  5KFH A;  4I67 A;  2JH3 A;  2MYF A;  3FKB A;  3MPW A;  2ZH4 A;  3KUH A;  1WHW A;  3JXO A;  2ZH2 A;  3JYT A;  4IO9 Q;  4CO0 A;  2CPE A;  2DPJ A;  1RHK B;  2J0S D;  2QSW A;  2E5G A;  1RTH A;  5B0A A;  2KFZ A;  2B9W A;  4OZL A;  1TP7 A;  2GAG C;  4JI2 J;  1EAY C;  5E41 A;  1S1U A;  3G6V A;  2AV5 A;  4ED1 A;  3EUN A;  1YJ9 S;  3F56 A;  5T41 A;  1RGV A;  1NK4 A;  3M8P B;  3MMA B;  2NXC A;  3D1O A;  1VK8 A;  3PYF A;  5ETT A;  5ETN A;  1JLQ B;  1HBO A;  1GQE A;  1PJ7 A;  1MWZ A;  4KQZ A;  2G13 A;  4Q2M A;  5D4L A;  3W2V B;  4DMZ A;  2KG1 A;  5E3P A;  1UET A;  5E2Q A;  2JSX A;  4QQB A;  5KFX A;  2XEX A;  4JOU A;  3SIP B;  3WIV A;  2A6M A;  3L7O A;  2HMI A;  1KDN A;  3WX4 A;  5CD4 H;  5KG6 A;  1F9H A;  3QGG A;  2DD8 S;  4X62 J;  3FSX A;  1HKA A;  3EPG A;  3RRH A;  3E2E A;  4OHW A;  5KAK A;  1MMD A;  2DXD A;  2YY3 A;  4RUB A;  1MRO B;  1JLE B;  1LWC A;  4FXW A;  4JI8 F;  4OX9 J;  4Y2K A;  1XNQ J;  3TA0 A;  2HS3 A;  1KR4 A;  1PC5 A;  2BYC A;  2GQC A;  2F8E X;  2Z56 B;  4HHH A;  1S9E B;  3TP2 A;  4IO1 A;  4JV1 A;  2GQQ A;  3GYX B;  2W25 A;  4FF1 A;  3THV A;  4L75 A;  4AL5 A;  5HLF A;  2OP5 A;  1J5O B;  1LWF B;  1ARO P;  2MQM A;  3HMJ G;  4B9M A;  5J2M B;  1P27 B;  1NB2 A;  3FBC A;  4RNN A;  4K0K J;  4OMF G;  1RJJ A;  3CME S;  4YB5 A;  3ZTR A;  1WDT A;  2ASD A;  4KY3 A;  3A8J A;  1PCA A;  3W2V A;  4EO8 A;  1JK9 B;  2GVZ A;  3BKF A;  2IJR A;  5CCM A;  4LF4 J;  3Q8S B;  3H7H B;  3T1H J;  4YR2 A;  2FVQ A;  3RR8 A;  1HA1 A;  4DQP A;  4DR3 F;  3MI7 X;  1MSW D;  3GIJ A;  2WBR A;  1JWW A;  1FDN A;  3DXB A;  3ZZT A;  2AJQ A;  1IKY A;  3H90 A;  2ZVI A;  4FN5 A;  2DR7 A;  3C16 B;  4KC5 A;  2FHJ D;  1MRO A;  2Z57 B;  2DR8 A;  1P9Q C;  4RW7 B;  2F65 A;  2V6A A;  5A8W A;  1B99 A;  5KG0 A;  1S9E A;  4X84 A;  1T9U A;  2LQ8 A;  2MKY A;  3O44 A;  4KPC A;  4ZVU B;  1PBU A;  1OY8 A;  2DKO B;  1I94 F;  1F60 B;  5K8P A;  2BJ1 A;  3ET6 A;  1JLF A;  5J2M A;  2KG0 A;  2B8P A;  4RZR A;  2Y9H A;  2B56 A;  3DGV A;  3OW2 R;  3MM9 A;  5LSR A;  1RAE B;  1U2C A;  2GVZ B;  1CVJ A;  2R7S A;  1U1P A;  3MM8 B;  4KB7 A;  4RBU A;  3UN5 A;  5LMU F;  1R6Y A;  1S1T A;  1ZBT A;  1CSJ A;  2B9E A;  3O6Q A;  4I2P A;  2BE9 B;  3FC9 A;  5J2P B;  2B9Y A;  3MOZ A;  4QJV A;  1IBL F;  3GG0 A;  3L7U A;  3JAM Y;  4ZPV R;  3M8R A;  3G9C A;  2XZD B;  1LK5 A;  1H73 A;  2HUR A;  1H98 A;  2R42 A;  3MMC A;  2VL1 A;  2DEJ A;  1B7Y B;  3DLE B;  3DRX A;  4OI3 A;  3VWS A;  3KLF A;  1ROF A;  4ECU A;  1Q7Y T;  2UXB F;  1V5V A;  2B7C B;  2HRY A;  2QZ8 A;  1R43 A;  2MKC A;  3JAM U;  3EZO A;  3NLC A;  5F8H A;  1RT5 A;  3KLV A;  1HQU B;  5IC6 B;  1TK5 A;  2VG7 A;  3AB4 B;  3MM9 B;  1JIH A;  1GFW B;  1OS5 A;  1S6P B;  3NG8 A;  1CQN A;  3K5N A;  1UA0 A;  4JI4 F;  4KV8 B;  2E1P A;  5AXM A;  2X1A A;  3DRS A;  2APO A;  2QRR A;  3WZ0 A;  2QLW A;  3H0P A;  2RB7 A;  3K89 A;  3ZZ0 A;  4J9L A;  5J2P A;  1VQO S;  2PN6 A;  4G1I A;  2XGQ A;  4DOZ A;  1AT1 B;  2MJN A;  2DNG A;  1QAI A;  2AEJ A;  3NGK A;  3TEH B;  2XZT B;  1RI7 A;  3QT8 A;  3PFO A;  4L6V 3;  4ES2 A;  3MMC B;  4OJH A;  4OV6 A;  1U0S A;  3BN7 A;  4UZB A;  4X62 F;  3VF0 B;  1FDB A;  4O3O A;  3PW2 A;  3RAX A;  3EE3 A;  3KNA A;  4GRS A;  2FUG 9;  1S76 D;  2HIQ A;  2K7J A;  2JNJ A;  4OIX A;  2VOP A;  1WEZ A;  2VPX B;  4FPR A;  3MMB B;  4J91 A;  3C2P A;  3I9V 9;  1WTB A;  1QAX A;  1S6O A;  2VC0 A;  2ZEJ A;  8AT1 B;  2C42 A;  1HQU A;  3FZB A;  4N8N A;  1QSL A;  2JEG A;  3BGO P;  2VG7 B;  4K4V A;  1HLW A;  2NUH A;  1LNQ A;  5LMN J;  2LA6 A;  1IQZ A;  3KLH A;  1SJ3 P;  4GMK A;  2ZBR A;  1S6P A;  4A46 A;  2P6S A;  3DRR A;  2V4R A;  2LKZ A;  2AGO A;  2E1C A;  4I1T A;  4USJ C;  1HD0 A;  1WKJ A;  3IR7 B;  2D74 B;  4NE9 C;  2V2V A;  4F25 A;  4NMX A;  1HWJ A;  1IBK F;  1RWM B;  2XYH B;  3KFW X;  4FYY B;  2WZ1 A;  3SSR A;  1T8E A;  3KLI A;  4AE5 A;  4K4T A;  1PIL A;  3QGH A;  2FLN A;  4TYB A;  1BD6 A;  2V2K A;  4YY3 J;  2OPR A;  1N5S A;  1Y0H A;  6AT1 B;  3DOM B;  1WEY A;  1K47 A;  2DR6 A;  4NWB A;  2J7W A;  4NA3 A;  1A0O B;  2RU9 A;  4UT4 A;  3W5X A;  2CQ3 A;  4I6W A;  4LF4 F;  2VPW B;  2XMJ A;  3AH6 A;  3IRX A;  1NJI T;  2PII A;  4EBD A;  4O3N A;  2HFN A;  1M5P C;  1VQN S;  4GKJ F;  3GG1 A;  1UKU A;  1JXL A;  3CCL S;  3M2V A;  4MKB A;  3AOC A;  3MM5 B;  1VGY A;  1WSV A;  4DZD A;  2ZM6 F;  4WYW A;  3PW5 A;  4FF2 A;  2NZ4 A;  2BOP A;  2K1R B;  1HBM A;  4ZP8 A;  4ECS A;  4C8M A;  1RDR A;  3R9L A;  2LDI A;  1AB8 A;  3OTC A;  4ZMM A;  1D8Z A;  1P6T A;  2JEI A;  1RAG B;  3FVY A;  4CO4 A;  2B4V A;  1IBM F;  1HWL A;  2PA3 A;  5KG7 A;  5MAO A;  4HR2 A;  4FBT A;  4UOC A;  1IR2 A;  2UVU A;  1ZPV A;  1DY3 A;  2J8A A;  1MG7 A;  1S1W A;  3DOK B;  3CE8 A;  3QSI A;  4IQM A;  4DX7 A;  5DQI A;  3KYL A;  2XS5 A;  3NCR A;  4MK7 A;  3NNH A;  2ZVS A;  3LAM A;  2DY9 A;  5ETM A;  4HH1 A;  4H4O A;  2NPF A;  3HHN B;  5EX0 A;  3CJQ A;  1SPB P;  3M6V A;  3QAU A;  4WK3 A;  3B4M A;  1NSA A;  2MST A;  5E3R A;  2PT0 A;  2XWX A;  2KB2 A;  2CJK A;  4EEY A;  1H74 A;  1SKS A;  1X4F A;  3RR7 A;  4ILM A;  1CUL B;  2MDA A;  4DG1 A;  3PYE A;  4WU2 A;  1FO1 A;  2BE2 B;  5E0O A;  1CJU B;  2GNK A;  3M2U B;  1KFS A;  1BY9 A;  4ITS A;  1UTA A;  4DQS A;  3FMB A;  2YNG B;  4WKR A;  4W90 B;  2WW4 A;  1EX8 A;  2CPY A;  3BPS P;  1FJE B;  3MAQ A;  3GJR B;  1CG2 A;  4AXJ A;  4C2M A;  5JMN A;  1S97 A;  5CA5 A;  3OQ2 A;  1UZH A;  1V3S A;  3BBC A;  4ZN1 A;  4JV5 F;  2B4O A;  2VAS A;  4DXL A;  3I55 S;  4NRT A;  4WWS A;  2DVI A;  3BH6 B;  2UXC J;  4ELU A;  1S1U B;  2H5E A;  1ITP A;  2VZ9 A;  2GHV C;  1NHK L;  4Q5V A;  3ZZR A;  3AD8 C;  2L08 A;  1HR0 F;  3W61 A;  4DX6 A;  1S0M A;  1FK9 B;  2H9Z A;  1CUL A;  2O1P A;  4NI2 A;  5JXS A;  1KP6 A;  4OLP A;  4NLQ A;  3M6U A;  2I5J B;  2CVI A;  1Q8K A;  2FB0 A;  2QA1 A;  3K7R A;  3ISN D;  1NUE A;  1UEK A;  2YNG A;  4L74 A;  5HVH A;  1SIZ A;  2E7W A;  1FWK A;  3CW2 C;  2F8H A;  3J80 Y;  5D4O A;  2CWX A;  7AT1 B;  1HHT P;  2ZBQ A;  4K0K F;  1TKD A;  2C2M B;  4LVN P;  4PXB A;  2NQP A;  1XC9 A;  1LK7 A;  5HJX A;  2X1B A;  3RB3 A;  2OMO A;  3KHH A;  4Y65 A;  1OYD A;  1UWB B;  4DSF A;  5HLF B;  4P2F A;  1ULR A;  1WC1 A;  4TY8 B;  3UN3 A;  3G6Y A;  5D0E A;  3SZ2 A;  3M4X A;  1U1R A;  2DK2 A;  3GCW P;  2VOD A;  4F67 A;  4DV2 F;  2GJI A;  3CIM A;  2XLJ A;  1YJN S;  4O3R A;  1FK9 A;  4DJB A;  4AFF A;  2ZH7 A;  2MQN A;  1HNW J;  3UWT A;  4EU0 A;  3RJM B;  5KFN A;  3OSP A;  2MQO A;  1RKJ A;  3GWC A;  4PZV A;  2I5J A;  2IIH A;  4MIW A;  3W2W B;  4N5S A;  1TK0 A;  1M5V C;  1RZM A;  1TL3 A;  1Q8B A;  4I68 A;  5CYJ A;  5C25 B;  3J7Z T;  2BJD A;  5IXU A;  2KHD A;  2ABY A;  4Y28 C;  3E01 B;  4F02 A;  1NK0 A;  4U8Y A;  1RIS A;  2VJU A;  4AL6 A;  1JKH A;  3LW5 C;  1Y5I B;  3MUT P;  5B09 A;  2ZH5 A;  3IBW A;  2ZH8 A;  2IA0 A;  2MZT A;  3KG4 A;  1SJ1 A;  2CPZ A;  2YTC A;  5T7L A;  1IJF B;  1R8B A;  1NKC A;  3MOJ B;  1RTJ B;  2D41 A;  4F2S A;  5HRO A;  2C28 A;  1RBL A;  5A8R B;  2MQQ A;  4ED3 A;  1GAO A;  3MPD A;  2FZC B;  1RAB B;  3ZZP A;  3CD6 S;  3GIM A;  1L3V A;  3OD2 A;  4ZCK A;  3DHX A;  4ZHR B;  3MFH A;  1NJW A;  1WOO A;  4K4S A;  1L3S A;  2E9Z A;  4I2P B;  1HNI A;  2FJD B;  2POK A;  4U8V A;  3WIU A;  4RJV A;  1EAR A;  4B3T F;  5EN1 A;  1H7W A;  4CLW A;  1NB7 A;  1WJ9 A;  3R1L A;  4LSN B;  2KN4 A;  1H0H B;  5FLX U;  3D2W A;  2RU3 A;  3NMR A;  2WAQ D;  4J5O A;  3KNG A;  1APS A;  4PEO A;  2EFV A;  2UUB F;  1RBA A;  3GU0 A;  3BQ1 A;  1M5S A;  3EDR B;  4C3M A;  4X4P A;  5KFT A;  3TO8 A;  3VZI A;  2XLI A;  1T3N A;  3HT0 A;  3X3U A;  4DV6 F;  5ETR A;  1HQE B;  4QU7 A;  3DHW C;  1X9S A;  4O0N A;  2JDJ A;  2I6W A;  3PKY A;  1NH8 A;  2JVO A;  4K7Q A;  4J9V A;  3ZNU A;  3HF5 A;  2IVY A;  3TEG A;  3VGT A;  5I3Q A;  2V9K A;  2E44 A;  4ZHR A;  3TAQ A;  4OI0 A;  2CQD A;  2PMZ D;  2W8L A;  1VBX A;  2RRA A;  4C8Y A;  2RVJ A;  3SDE A;  2KZM A;  2Y1L B;  3K8V A;  1AZS B;  2AJ2 A;  2V68 A;  3DNC A;  3N5B A;  4KHR A;  5K5M A;  3S7R A;  4QOT A;  3MR3 A;  1GTH A;  5D3G A;  2KJW A;  5I3U A;  2RKI A;  3PCO B;  4D3H A;  2HG4 A;  2VFU A;  4UUX A;  1NPR A;  3C46 A;  2HVZ A;  2NXN A;  4IFY A;  4X4R A;  3D68 A;  3DRP A;  3MCO A;  1HNV A;  1VBZ A;  2KRR A;  3GIK A;  3MMB A;  2OTL S;  1XNR F;  1RLC L;  1LW2 A;  4GKK J;  3M8Z A;  3NWG A;  4LR8 A;  1HQE A;  1NM2 A;  3V4I B;  4UOH A;  1FKP A;  2H3E B;  2GMH A;  3FMW A;  3GPA A;  1D8Y A;  1F5B A;  4JBC A;  5AE2 A;  2HAF A;  2V69 A;  4FZV A;  3KHG A;  1DQ8 A;  4JI3 F;  3ETO A;  2RHQ B;  3R2C J;  3LP2 B;  1SC3 B;  3M8Y A;  1SKU B;  2VB6 A;  2FY8 A;  1Q4R A;  5FJ4 A;  4WBF A;  3VVT A;  2RSQ A;  1U4B A;  2WSC C;  3SQG B;  2MZR A;  1OIA A;  3H8Y A;  3QIP B;  5F41 A;  5D3G B;  3PDN A;  2YQ0 A;  3MM6 B;  4G65 A;  3BGR A;  4IOA Q;  1UWA A;  4Y2I A;  4Y2A A;  4BCA A;  2DGT A;  4J9M A;  2VON A;  2XM3 A;  3QMQ A;  4P2M A;  1AXQ A;  3DLH A;  4GKJ J;  4AQY J;  4KIA A;  2J9C A;  2NCK L;  3OLA A;  1LWX A;  2AJ4 A;  1TL1 A;  3M9O B;  2HHS A;  4P52 A;  3PXG a;  5KOX A;  4LMZ A;  5KFP A;  4CH1 A;  1Q81 T;  5LOQ A;  4RNH A;  1RBO B;  3JQJ A;  4DU8 A;  1TV6 A;  2BUN A;  1WC3 A;  4RW9 A;  4QWE A;  2QLJ B;  3D5M A;  1X31 C;  4XK8 C;  2RE1 A;  3RBD A;  1QSS A;  1KC8 T;  2ZZN A;  2R7U A;  1HNZ F;  1CLF A;  2HNZ B;  1VC0 A;  1YRU A;  3IAS 9;  3LP2 A;  3BO4 A;  2GML A;  1KRP A;  2UP1 A;  4LF6 F;  2HSE B;  1RT2 A;  2AZ1 A;  4HHU A;  4WFZ A;  4TQR A;  3QIP A;  2WON B;  3DLK A;  2UUC J;  2ZFH A;  1BC6 A;  2ZDP A;  4QW8 A;  4OI2 A;  4LSZ B;  3P5T L;  4ALZ A;  4A47 A;  3DYA A;  4DUY F;  3NGT A;  1RHR B;  3QSY B;  5CZV A;  4NZ7 A;  2K3I A;  3KK2 B;  2ZZM A;  1UA1 A;  1M5O C;  2DNR A;  2YXL A;  1JLC A;  5C42 B;  1IVZ A;  2LDY A;  4GC7 A;  4RUH A;  4F4W A;  4DEZ A;  5CCL A;  1VS3 A;  1FCA A;  3CJ0 A;  3GFX A;  3GB0 A;  1CQM A;  3DRY A;  4GO7 X;  2QIF A;  2DRD A;  4PYD A;  2HQ3 A;  4URQ U;  2OJ3 A;  2Y8Y A;  2C2K B;  4YDX A;  4XO0 A;  1JNR B;  3B4D A;  3R3T A;  1SV5 A;  4A48 A;  2JRS A;  3CCW A;  2HNZ A;  3O5T B;  2XZW A;  2KT3 A;  1VJW A;  3QO9 A;  3DOL A;  2E5L F;  1HHQ A;  4Q0B A;  3CDB A;  2Q3P A;  3AJ1 A;  4TKT A;  3M2U A;  2NPI A;  2QC3 A;  1X4E A;  1TAQ A;  1DZ5 A;  1S79 A;  4P7T A;  5KT2 A;  1T9V A;  3TAR A;  2HQG A;  3DYA B;  1VLY A;  2MQP A;  3EM1 A;  5KFY A;  3DLG A;  4JV0 A;  4C0B A;  3MFI A;  1R6V A;  2CNL B;  1VBK A;  2XHC A;  3H2U B;  1JLC B;  2HPU A;  2CPX A;  2QJ3 A;  4ZLN A;  1XBW A;  4X4S A;  2ZD1 A;  3BBF A;  2IDE A;  2Z2M A;  4NPO A;  5KFR A;  1WEL A;  5C2G A;  3GLJ A;  1UEU A;  5BXI A;  4K2J A;  5KT4 A;  3RBE A;  4GKK F;  4H4K C;  1N32 F;  1SV5 B;  3NKY A;  4Q8F A;  4DX8 H;  2BVZ A;  2XO7 A;  3PW7 A;  2MMY A;  3CUL A;  4ED5 A;  2CVE A;  3V6H A;  1JXV A;  2YNF B;  2RNE A;  3ICL A;  2ADB A;  1TUV A;  1MMN A;  2EWH A;  4UZC A;  2F3J A;  3R7S B;  1R8P A;  3T19 A;  2XC9 A;  4DFJ A;  2UVW A;  2J0X A;  4B3S F;  5HMZ A;  2IC3 A;  2GIQ A;  3T6J A;  4DL0 C;  2RS8 A;  3CDU A;  1CPZ A;  3H98 A;  2W7A A;  2K2P A;  2HNY A;  1JMT A;  3TJ8 A;  3VGS A;  1TFY A;  2Z58 B;  1KQK A;  1N36 F;  4JV5 J;  1UPP A;  4IG3 A;  1N0U A;  1S9G A;  5CQG A;  2QTW A;  2MXY A;  4HHJ A;  2XMA A;  1WNE A;  1UWB A;  2V50 A;  1FEH A;  1TAU A;  5HAN A;  1AA1 B;  1NKB A;  5HAT A;  1VRU A;  4IKA A;  3UVJ B;  3E3X A;  3ZTQ A;  5IV3 A;  3GIL A;  1N34 F;  4OZ2 A;  5KT7 A;  4NXM J;  2VIH A;  1NDP A;  1IKX B;  4WXO A;  1Q1K A;  4NCA A;  2R4F A;  2VBX A;  4M5G A;  3MTJ A;  4X4V A;  2YNH A;  2VA2 A;  4U7U D;  1U26 A;  5AJ3 J;  1C1B B;  4PG6 A;  2XMT A;  1CJV A;  1FEE A;  1FT8 A;  2CDQ A;  3FCH A;  4G1Q A;  1TL3 B;  2C3Y A;  2DXF A;  3P4U B;  3H2L A;  3N28 A;  4FYV B;  4J9O A;  1DLO B;  2CQ2 A;  5DQG A;  1B0P A;  3OL6 A;  2HZC A;  4OLO A;  5KFD A;  4RBV A;  1GMW A;  4MKV A;  1AFI A;  2EXU A;  4P73 A;  5E3C A;  3CMQ A;  4DV0 J;  2YWW A;  3RBX A;  4NOH A;  2FLP A;  4IG3 B;  4LFC J;  4YB7 A;  4HKQ A;  5E7O B;  1IUJ A;  1N8R T;  2J7U A;  5C7P A;  3IWL A;  4JI0 J;  4C0H A;  2H5I B;  1YBT A;  1RT6 A;  2M0G B;  4XIU A;  2DRA A;  2V63 A;  1DTQ A;  3QBC A;  2HQF A;  1WI6 A;  2CJB A;  2OSQ A;  3ITH B;  2C2E A;  5K14 B;  4JI7 J;  1XN9 A;  3OSN A;  2OFH X;  1SCJ B;  4FYW B;  4ES3 A;  3HSD A;  2IVM A;  4MFB B;  3O3L A;  1S6U A;  3DGP A;  1VIS A;  1Z1Z A;  1S1X B;  2RRB A;  2QV6 A;  3LOU A;  4DV7 F;  3RAQ A;  1B64 A;  5BYQ A;  1W2B R;  4F3O A;  4G1Q B;  1DHM A;  4Q44 A;  2HFO A;  5THW A;  3U1M A;  4ECR A;  1JJH A;  3MED A;  4NLY A;  3CJT A;  3TRG A;  4F0M A;  2IAJ B;  5HO4 A;  2I0X A;  5F8N A;  1WOR A;  2QYG A;  4JP8 A;  3TW0 A;  2IM3 A;  3ZNJ 1;  5IWA F;  5F8J A;  2JLG A;  4E8U A;  4ZPD A;  4ERD A;  4WYL A;  4A8Q A;  1OSC A;  3K2Y A;  1P8G A;  2HVD A;  1LEO A;  4ID5 B;  4LBI A;  4RW4 B;  3GSI A;  4B9N A;  1XQI A;  1OJ4 A;  1AW0 A;  3AHP A;  3Q8P B;  2V2Z A;  1YKW A;  3ITH A;  2MKJ A;  2VQF J;  1JJ4 A;  2H5J B;  1EHW A;  2XMU A;  5DM7 Q;  1UVL A;  3HVT A;  4I56 A;  3TVK A;  4YHH J;  2OEK A;  2G2O A;  4CT9 A;  3JTP A;  3M8W A;  3OUY A;  1N32 J;  3HJV A;  1GTE A;  4M8L A;  2HGL A;  2DHX A;  1NDK A;  2IMW P;  2A18 A;  4KKO B;  3W8P A;  3KK1 A;  4OX8 A;  4M94 A;  4A8M P;  1Z2Z A;  2DH9 A;  3SDE B;  3NAI A;  3M30 B;  2IAJ A;  3A1Y G;  2GO9 A;  3KDN A;  1SL1 A;  3MPV A;  2BOA A;  2RKI B;  5J2N A;  3CD5 A;  3DFE A;  1XR6 A;  1GEH A;  3SCL E;  4F7V A;  1IQT A;  3IGV A;  4DV4 F;  3F41 A;  4CLP A;  1NLK L;  3FSI A;  2MLZ A;  3W5Z A;  1HNV B;  3ENA A;  2YKP A;  4LRA A;  2YWF A;  4HDG A;  1N36 J;  1T11 A;  3JB9 k;  1NPP A;  3MF5 A;  1BGX T;  2GIF A;  2VKR A;  2ASJ A;  3I32 A;  4A8F A;  2E7X A;  1FKP B;  2NS1 B;  2MKH A;  1REV B;  2DHS A;  1KNZ A;  3Q8V A;  3EX7 B;  2F4V J;  2D3O R;  1XNQ F;  4DPY A;  4JI8 J;  4I2Q A;  4ED7 A;  3PO5 A;  1PYO B;  1FHT A;  3MEG A;  1UW9 A;  1MWY A;  3MAH A;  4MKA A;  2B8Q A;  2CNO B;  1HWU A;  2D9O A;  3IM8 A;  5DM6 Q;  4WFA Q;  4NXN J;  8RUC A;  4F3Q A;  1RU1 A;  3RBZ A;  1FTR A;  2YPZ A;  4OX9 F;  3L3C A;  4DR5 F;  2BW7 A;  2XI3 A;  3CCM S;  3CJ2 A;  4NZ6 A;  2PSZ A;  2XLK A;  1RWW B;  3D54 A;  2YWE A;  4ICL A;  2DH7 A;  4XDD A;  3TVZ A;  4DX5 A;  3LGM A;  4XPE A;  2M5Y A;  4JI1 J;  1RHQ B;  5FD1 A;  2J9D A;  1FD2 A;  1FXL A;  1XJW B;  3DCA A;  1Y5N B;  3EGV A;  1K9M T;  1FVQ A;  4M5M A;  4PXD A;  3VAH A;  4UW2 A;  2AYE A;  3HHL B;  4Q45 A;  2DPI A;  1REV A;  4FYD A;  1DFD A;  1FJG F;  5KOW A;  1IM4 A;  3J81 U;  2HWH A;  3H59 A;  3FFI A;  4P74 A;  4DFM A;  1N5Y A;  1IWG A;  1SH0 A;  3IWX A;  1OY9 A;  3TOQ A;  2BX6 A;  1FE4 A;  2HFS A;  2M52 A;  3DXS X;  3W9I A;  3VGV A;  1YDL A;  4LBH A;  4DCO B;  3PJX A;  4DSI A;  2CWK A;  2HND A;  4A8Y A;  3W7B A;  3PV8 A;  1FDD A;  3Q8R B;  1N6Q A;  2G9O A;  4DQI A;  1RT3 B;  1WC5 A;  2RJZ A;  3OXF A;  2E1M C;  1ICE B;  4P75 A;  3OJS A;  3DU6 A;  4F4Z A;  2Z0G A;  5KFK A;  1FJC A;  4JI6 J;  2H4Y B;  3RTV A;  5F8M A;  1HBU A;  1U7L A;  1WG4 A;  3AD7 C;  1J2V A;  3DLJ A;  3OXL A;  2LYV A;  2M7S A;  4HDH A;  4CO2 A;  1LV5 A;  1R0A A;  3QJL A;  3SCJ E;  2RF2 A;  5CH7 B;  1HFE L;  2UUA F;  5H9F J;  2KI2 A;  4JV2 A;  3D67 A;  2BZ2 A;  2KRB A;  3NAH A;  5L1I A;  1WG5 A;  2F40 A;  4HAC A;  2ROP A;  3GJT B;  3OTE A;  2A2C A;  2GO8 A;  2J8S A;  2V8H A;  4AD6 A;  5BYS A;  1KEK A;  4UY8 5;  3IA0 A;  4F2R A;  2Q66 A;  3LAL A;  3JTO A;  5IS2 A;  4YHH F;  2IM0 A;  3MM7 B;  2EC0 A;  2CDR B;  2ZJR Q;  4USI A;  1RT3 A;  1TKT A;  2GVD B;  1K0V A;  2MGZ B;  2G1D A;  1YGY A;  5HMY A;  2V4Q A;  4CT8 A;  1XER A;  1WUU A;  3BGF A;  3P5B P;  4CLK A;  4NYP A;  3D6T B;  5KT6 A;  3WC0 A;  3TZZ A;  2AJ1 A;  3N6M A;  4KGX B;  5FLX Y;  3HPO A;  4JI4 J;  2WVD A;  4LF8 F;  3IS9 B;  5IOL A;  2C2D A;  2HGM A;  1X8D A;  1X7V A;  3B8H A;  1Y4Z B;  3WC2 A;  5B0F A;  3I4P A;  2FD2 A;  3BEG B;  5D4P A;  4EUV A;  1YVF A;  4CLZ A;  5ITH A;  2UV8 G;  2CAD A;  1S48 A;  5CXT A;  4IH5 A;  3CCJ S;  2FHJ A;  4PUO B;  4HAC B;  4MTP A;  2UVV A;  4X65 F;  5ETO A;  3ISZ A;  2XSJ B;  1YRT A;  4EBE A;  4ZVQ B;  2H54 B;  4ZDN A;  4IRK A;  5C24 B;  2XHW A;  4DQQ A;  3OHB A;  1RSC A;  1S57 A;  2DNY A;  3BRE A;  3D6M B;  3KWM A;  3H20 A;  1TKT B;  2GVD A;  2DRB A;  3JQM A;  1T94 A;  1GK8 A;  3DI6 B;  3BS9 A;  1IR0 A;  2CFX A;  3UCZ P;  2HNY B;  2OD4 A;  4UF4 A;  3KJV B;  3KLG B;  2Z2Y B;  1S9G B;  3EIC A;  4X66 F;  3I56 S;  3DDI A;  4C7Q A;  4F0K A;  5L46 A;  3HP6 A;  1FA0 A;  1S7H A;  1R89 A;  1S49 A;  5CZX A;  1B0V A;  1VRU B;  5AJ3 F;  3TJA A;  2CZ4 A;  4C8N A;  4A8O A;  3G8S A;  2JEJ A;  2XSJ A;  2AX1 A;  2QLB B;  4D3G A;  2KO1 A;  3SMZ A;  3A3N B;  4ED6 A;  2F4F A;  3CUN A;  1FJG J;  4Q8E A;  2DHA A;  1FRJ A;  1W25 A;  1C1B A;  2BQU A;  1CJV B;  2MSS A;  5HL7 Q;  1X4B A;  5F9N A;  2W9C B;  4ECQ A;  3W8G A;  1FVS A;  2IJF A;  2VV5 A;  2HAI A;  3D6H B;  1NCL A;  2PC6 A;  3R5J B;  3W9H A;  5D8H B;  2OPP B;  5U47 A;  2O5D A;  1XMB A;  2JC0 A;  2ZC4 A;  3BDE A;  4HTI A;  4DR1 J;  2CJ9 A;  1I51 B;  2Z4P A;  3ENW A;  2MY8 A;  3SCK E;  1U25 A;  4OI4 A;  3KK3 B;  3GV5 B;  2DIV A;  4F4X A;  4KO0 A;  1RT6 B;  2GAH C;  1H72 C;  1U09 A;  2AEM A;  3R6L B;  4KGM A;  4O23 A;  3ZZZ A;  3J81 j;  2FJV A;  3FK4 A;  3UPF A;  4IQX A;  4YR0 A;  1KN6 A;  1RTZ A;  4ECW A;  3C6T A;  4ZIW A;  1SJ4 P;  1SH3 A;  5KFU A;  4ED4 A;  2N7C A;  3TVY A;  4PWD A;  4ZP6 A;  5I3P A;  2QN6 B;  1U48 A;  1IBC B;  4KFB A;  1S1X A;  4UUW A;  2B7B B;  2ZBC A;  2UVR A;  1ZAX A;  4MK8 A;  2ILZ A;  2LMI A;  1U02 A;  4OYP A;  2WTF A;  3UN2 A;  1RT1 B;  5JUM A;  3MED B;  4MJK A;  1F3V A;  3W60 A;  3ONQ A;  4FF3 A;  3D9B A;  3POT A;  2OPP A;  4P9S A;  1UZD A;  1TTH B;  1U1L A;  1VC5 A;  1FE0 A;  3I0R A;  4JYA J;  2E1A A;  1A9N B;  3HO1 A;  2W1B A;  3KK3 A;  4IUF A;  3Q8Q B;  2XTJ P;  3M6X A;  1MNE A;  1KTQ A;  4RW4 A;  1KBR A;  5MLC V;  2EEY A;  4WTY A;  2MHE A;  2ACY A;  2MLX A;  1TL5 A;  2U2F A;  4HT7 A;  4FDF A;  2EC2 A;  3HVT B;  2IMO A;  1FKA F;  1FES A;  1R8C A;  1VQK S;  3DM2 B;  4FVC A;  5E5N A;  4PWD B;  1QY7 A;  2CQ0 A;  2HVE A;  3FNN A;  2UXD F;  2GFF A;  4KFB B;  4AND A;  4USK A;  1FI4 A;  2MZQ A;  2WHO A;  3OVS A;  2BW2 A;  3IBF B;  3KK1 B;  4DV4 J;  4PG5 A;  1I94 J;  1TL4 A;  4F8R A;  2HBY B;  2HBQ B;  2IJN A;  3FSY A;  1T9X A;  4X64 F;  1VR6 A;  4B3R F;  2R8G A;  4XAK A;  2ZUG A;  4MH8 A;  1UFL A;  5A6W A;  1KSP A;  3SFU A;  3O1L A;  5DDR C;  3OTO J;  4LFA J;  2W4D A;  1NK8 A;  3J7Z 5;  1NDC A;  1V5I B;  4X4N A;  3W64 A;  3GYG A;  2DNZ A;  4QWB A;  4I4B A;  3G4S S;  5F0U A;  4Z7C A;  3CTR A;  2PA8 D;  3AJD A;  3I5A A;  1R27 B;  3ULH A;  3V6D A;  1NK6 A;  3R2D J;  4DPW A;  3H5X A;  4NZ0 A;  1SC4 B;  5J1E B;  1HBN A;  3TZY A;  1YJV A;  4I2Q B;  1YWX A;  6FDR A;  3UDE A;  2FJB B;  1JX4 A;  4EMD A;  4DR5 J;  1RTI A;  1WF1 A;  2UU9 J;  1SC1 B;  2OFG X;  3D3C J;  4DSE A;  3T1Y J;  2DO0 A;  1LOU A;  4Q2L A;  5GAG U;  4ZVR B;  4USV A;  3D66 A;  4LJM A;  4NA1 A;  1SUQ A;  3OR2 B;  3AAW B;  4Y34 A;  3CF5 Q;  1KVI A;  1Q5Y A;  4ECV A;  4P71 A;  2WBM A;  4LF1 A;  3JS9 A;  2AWZ A;  4ZVP B;  3U7J A;  1TKZ B;  1YSJ A;  2VFR A;  1ZAW A;  4YN3 B;  4R8U B;  1N4L A;  4TYA A;  4WFY A;  3ZFV A;  4FS2 A;  2EI5 A;  1RK8 A;  1GNK A;  3KG0 A;  1LW0 B;  1FKO B;  3PG9 A;  4PKD B;  4YB1 P;  3ENQ A;  4CTA B;  4DS5 A;  2LQJ A;  4B02 A;  1C0T A;  1C1C A;  1TR0 A;  1R7I A;  1NU4 A;  2EKY A;  2UUT A;  3AFG A;  3QLH A;  4IFV B;  1RA6 A;  2G2Z A;  4KBI A;  4CYU B;  3MEC A;  4AXI A;  5GAE U;  2AGP A;  1CJK B;  3PX6 A;  2VIC A;  2VU5 A;  2CYY A;  2YWK A;  3GMG A;  2ATL A;  4NXN F;  4C0O C;  1G7C B;  4M5I A;  2L48 A;  2YQ3 A;  2IY5 B;  4DI6 A;  1VJQ A;  1ZPW X;  3KJN B;  4EZ9 A;  5B7W A;  4JI6 F;  3G87 A;  4DBQ A;  4ECY A;  1N6Q B;  2DBB A;  2ZOM A;  2R9L A;  4P7V A;  4LBP A;  1VQ5 S;  1ZH5 A;  2GX8 A;  4BWM A;  1T9T A;  1EP4 B;  5GMD A;  2X51 A;  1QDU B;  2XUL A;  4ECT A;  4DV1 F;  4IOC Q;  3H40 A;  3CWJ A;  3Q8U A;  1L5U A;  2HQI A;  2WK4 A;  2QX0 A;  3LP1 A;  4B9L A;  2J9D E;  4M95 A;  2CPH A;  2CKW A;  4OX6 A;  1SJF A;  3NMA A;  4EZ6 A;  4MIA A;  3CXC R;  3AT1 B;  1X4C A;  3TA2 A;  2BJ9 A;  2LFV A;  2VFV A;  4MYT A;  2E9T A;  1NEE A;  3QRR A;  4ZIV A;  4WII A;  4ZJL A;  1QAY A;  2W4C A;  1T0T V;  3C14 A;  3VQS A;  3Q0A A;  3EVM A;  1M5H A;  3K5L A;  2PGC A;  3MM7 A;  1M1K T;  1SL0 A;  5K8M A;  4F50 A;  1Q8I A;  1Y00 A;  3OT9 A;  4ED8 A;  3QFW A;  3T5K A;  3ZXW A;  1RWO B;  1D9F A;  3QGP A;  3D28 A;  4QR1 A;  2BQ3 A;  2H4W B;  2IM1 A;  4ZKA A;  3X1L B;  2BJE A;  4B3R J;  2XMV A;  4CP5 A;  3KLE B;  5DG8 A;  4G3I A;  2R3V A;  4S0M A;  2CXE A;  2Q6C A;  3DKD A;  2JOQ A;  2QL9 B;  3A8I A;  4DR6 J;  4LSL A;  4WPA A;  4OYB A;  3TAN A;  4TN2 A;  2XS7 A;  4CIO A;  2Y1J A;  3BSN A;  3GIR A;  2FYX A;  4FNI A;  1R8H A;  4RR5 A;  4BDP A;  2KT2 A;  2OEJ A;  2YKO A;  5CYQ A;  2WOM A;  3JSM B;  3C14 B;  3BM7 A;  3I5C A;  2F1F A;  2FQQ B;  2CQ4 A;  2V2Q A;  1YJW S;  1KD1 T;  2IRY A;  2WRM A;  2DNQ A;  3HVA A;  4P2S A;  3PEJ A;  1JQG A;  4CH7 A;  1B0T A;  2YKQ A;  2J9E A;  2HFZ A;  1C0U B;  2ZE2 A;  3R27 A;  1IJE B;  3IWN C;  4WP3 A;  3TNV A;  1D0E A;  1ZA1 B;  3ZTO A;  2A6O A;  1N33 J;  4YUD A;  1F2H A;  2M3D A;  2XSF A;  4HT5 A;  5KTQ A;  3PKM A;  3NWR A;  3KLE A;  1E6V B;  2J0W A;  5IC4 B;  4F4Y A;  3VHQ A;  5CAA A;  1B4S A;  1WC0 A;  2RML A;  3Q2S C;  1YK9 A;  1MN7 A;  3M6W A;  5IV4 A;  3R5A A;  4C3L A;  5HP1 A;  1RXO B;  3I31 A;  3Q89 A;  2N7Y A;  1NDL A;  1NHV A;  4X65 J;  2E1R A;  4DFP A;  4WE1 A;  3N4W A;  2W2N P;  5CYQ B;  1NND A;  2VFS A;  5FII A;  3JTN A;  5DZ7 A;  4QIE A;  1YRX A;  2XG8 A;  1J5O A;  3HD1 A;  1IM6 A;  3EXY A;  4U9R A;  4J9R A;  4DQR A;  3R6G B;  2W2Q P;  1WWH A;  1VQ8 S;  4DPT A;  1C0U A;  4ZPT R;  2R7R A;  2YWH A;  1EJ7 L;  2W9B A;  3VAJ A;  4DR7 F;  2AKW B;  1X5S A;  4CH0 S;  3CC7 S;  2ZH3 A;  2O01 C;  5EWG A;  2P5V A;  4AQY F;  2K3K A;  2JC1 A;  2FZG B;  4GVL A;  1BWV A;  2GIR A;  2IBK A;  3RUB L;  1EKR A;  2AHO B;  4EGL A;  2NYH A;  2CQC A;  3HFK A;  4LF6 J;  4W4M A;  5L1K A;  4UY8 T;  3GII A;  3C16 A;  2B0G A;  4K5R A;  2Q79 A;  4TXS A;  1TL7 B;  4EI2 A;  4OYM A;  5IT4 A;  4USM A;  2D3O 1;  3OLB A;  1HNZ J;  3NBP A;  4NCB A;  4CLY A;  3B54 A;  3F0N A;  5DJB A;  3EDQ B;  4HYK A;  2J6S A;  4KJI A;  4C97 A;  5KG1 A;  1SIW B;  1TMJ A;  2N4C A;  1JLF B;  2IHR 1;  5HVF A;  1QTM A;  4OYA A;  4U96 A;  4QYZ K;  4IRC A;  2HK2 A;  2M4M A;  2R7Q A;  5KT5 A;  4BC9 A;  4F4K A;  3L9Z A;  3PR4 A;  2W9B B;  3D6F B;  3SSQ A;  3M1V A;  3RRK A;  4TU8 A;  2ZHA A;  3EVW A;  1RWV B;  4CI0 B;  5HQ8 A;  5ETV A;  1OSD A;  2FGC A;  4MAK A;  2NLW A;  4DR1 F;  3I0R B;  2LVW A;  5L39 A;  4O3S A;  1FRI A;  1ZM3 A;  1HAR A;  3SFG A;  2KXN B;  1T7P A;  5LSL A;  3ISN C;  3QFH A;  4O0I A;  1NJZ A;  1RAO A;  2ZBP A;  3TZW A;  1JLE A;  1I1G A;  2COL A;  5KFQ A;  3T3F A;  1L3K A;  3GZ7 A;  4IG0 B;  2V9W A;  4JI5 F;  3H42 A;  1WOP A;  2ZZT A;  2KU7 A;  3MEE B;  3UR0 A;  3DLL Q;  5HSP A;  1Q82 T;  2C2R A;  4DHV A;  2M9K A;  5EX3 A;  2RH3 A;  5A0Y B;  4O44 B;  4LF7 J;  1RT5 B;  2YKA A;  3D7S B;  1VRT A;  1SJR A;  2HQD A;  5LJ3 Y;  3MD3 A;  4UQT A;  5H9F K;  1S6Q B;  3R5D A;  2MLY A;  4UQG A;  1TFW A;  3D1H A;  2I1R A;  2EVZ A;  3UCU P;  2BMB A;  2YNI B;  4KV8 A;  5DDO C;  3T1H F;  2I2Y A;  1UVI A;  3QZ8 A;  3DRS B;  2YKM B;  4V1A k;  3BDP A;  1TK8 A;  5A2Q Y;  1GH8 A;  4O3P A;  1RT7 B;  3AQP A;  2KTQ A;  4QIF A;  1IKY B;  4RNF A;  4JUZ A;  4PWU A;  3P96 A;  2XWY A;  3HFV A;  4WTO B;  5IQ6 A;  3CPW R;  2BRL A;  1BQN B;  1N52 B;  2OSR A;  2VBZ A;  3BSC A;  1Y9O A;  2HS4 A;  1Y5L B;  2GC8 A;  4IG0 A;  1G6B A;  4WFX A;  5A8W B;  1RYS A;  3JSR A;  5AXN A;  2CPI A;  3D0G E;  4TU9 A;  4QIV A;  4LF9 J;  4LRD A;  2BR0 A;  5KFS A;  3BQ2 A;  4F26 A;  3MUV P;  3ET6 B;  1B70 B;  1N34 J;  2HFV A;  2IA6 A;  1YLX A;  1VRT B;  4N8O A;  2MB0 B;  4CLF A;  1NSP A;  3TI0 A;  1RTI B;  3GV7 B;  5B0D A;  3EWG A;  1URR A;  5RUB A;  2HLU A;  2G1H A;  3C3L A;  3OR1 A;  1IKV A;  2QFI A;  4UST A;  2VC1 A;  5AXL A;  3KTQ A;  1UP1 A;  3G71 S;  4LQ3 A;  1S1T B;  2YKM A;  2PFD A;  4CM0 A;  5HJY A;  3A4T A;  2YKN A;  1CJT A;  3Q86 A;  2FVS A;  2CQB A;  3NNC A;  1UFK A;  1AFJ A;  2DNN A;  2YH1 A;  3H4B A;  1RWK B;  2DNL A;  1SBR A;  3DLE A;  1F1B B;  3MUR P;  3HLU A;  4ZVH A;  1PC4 A;  3T41 A;  5K8N A;  4DSK A;  1IBM J;  2HHW A;  2L3M A;  3TAM A;  2OPR B;  1WD6 A;  3F73 A;  4DV5 J;  3NS6 A;  4A8X A;  4F4A A;  4DV3 F;  1NXI A;  1H2V Z;  4ZVF A;  2G0C A;  5DET A;  2BKP A;  3B6B A;  4R5P A;  1VK3 A;  1DRZ A;  4K4U A;  2CPF A;  3J7Y I;  4L3K A;  5J2Q B;  4LF5 J;  3UQS A;  1RAA B;  1QVF R;  3M2R B;  3W1Y C;  4I6A A;  1FNX H;  3M2V B;  1VIO A;  1VIX A;  3BYP A;  1KLM A;  2CJY B;  3QID A;  2W2M P;  1R3N A;  4RW8 B;  4Z2X A;  3H25 A;  2K1R A;  2F7V A;  3QT6 A;  1RAI B;  1CJT B;  4ZPA A;  5K20 B;  4TQS A;  3M8Q A;  1URN A;  3NGS A;  3VTI A;  1U6F A;  5JVG Q;  1KQS R;  1WDD A;  4KE5 A;  3C66 A;  4V19 X;  3ELH A;  1HNX J;  3JQK A;  4PQU B;  3JSY A;  3FBE A;  3KXD A;  1S1W B;  1RHM B;  4OI6 A;  2DR9 A;  1QUP A;  1X4A A;  2B9X A;  5DS7 A;  5KFI A;  3GSD A;  4ZOS A;  3LA0 A;  2QSF A;  3T5H A;  5KFG A;  1VLO A;  1T95 A;  1H6K X;  1KHW A;  5FDL A;  2RUG A;  5LSO A;  2KFY A;  5J2Q A;  1VQM S;  3TUP A;  4ETX A;  3P6Y C;  2NR0 A;  4RX6 A;  4DSL A;  1K1Q A;  1BHN A;  1X4H A;  2XYP B;  1P9Y A;  2DYA A;  3M8P A;  2XY7 A;  1E6Y A;  3CCR S;  2FVR A;  2BAN B;  4IR9 A;  1FNO A;  1FFG B;  1HW8 A;  3L7P A;  3TZX A;  2JJ4 D;  3M9M B;  1D09 B;  1NO8 A;  2DY1 A;  4G1P A;  2OEM A;  4KAI A;  5EWE A;  4FBU A;  1T3O A;  2P9E A;  4TLR A;  4KHP F;  2RAQ A;  4F36 A;  1ZM9 A;  1FX4 A;  1BE4 A;  2QA4 S;  1Y3J A;  3CVK A;  3VR1 A;  4C48 A;  4HVZ A;  4MT1 A;  1LWC B;  3CJR A;  4OQJ A;  5A8K B;  3SV3 A;  1XIQ A;  2ZOG A;  3T5J A;  4CLU A;  5FDL B;  3MCM A;  4FXV A;  4HLB A;  3Q23 A;  4B9U A;  4C8L A;  4BWJ A;  1YIJ S;  2OKQ A;  3KHL A;  2OPQ A;  5EUH A;  3V81 A;  5KFV A;  1G2E A;  2BAN A;  2FC8 A;  3UDV A;  1JLA A;  2OPS A;  3LP0 B;  1RWU A;  2F9D A;  2ZBI A;  1YTY A;  4RNO A;  2EBG A;  5KG3 A;  3H5Y A;  4QYZ J;  4F04 B;  1MU2 B;  1ZA2 B;  2DGQ A;  2I9S A;  4OHX A;  5C2C A;  4ZK7 M;  3SSS A;  5HVG A;  1HQ2 A;  1PKU A;  4DR4 J;  3GJS B;  4DR2 F;  2A0F B;  2AZ3 A;  3R7N B;  3VAI A;  4BHQ A;  3IMQ J;  2JVR A;  2VQE J;  4L3N A;  2OLW A;  4PPZ A;  3JYT B;  5ETP A;  2JZ5 A;  1KKH A;  4R25 A;  1NH7 A;  2J5A A;  3AJ2 A;  4M5D A;  5A8K A;  4WU3 A;  4YEA A;  4UOG A;  3IN5 A;  4B3M F;  4BS2 A;  4ILL A;  3T9Z A;  1QSY A;  1SB6 A;  3UDL A;  1KOH A;  2E29 A;  3IAM 9;  4CNZ A;  3CDE A;  5KG5 A;  2BJ8 A;  2MKS A;  2BQR A;  1JLA B;  7FD1 A;  4R0E A;  1U2R A;  3AXK A;  1CJU A;  1GMW D;  2C3O A;  4ECZ A;  4DS4 A;  3OTD A;  1MU2 A;  1F3F A;  2WSF C;  3HSZ A;  4Y0F A;  1ZZN A;  1EB0 A;  2AYG A;  1S0V A;  3TR5 A;  1QM9 A;  4H4M B;  3DU5 A;  3EGW B;  4C4W A;  5C5J A;  2IPO B;  4DR7 J;  2KVI A;  3H2V E;  3MUM P;  2FVC A;  3E01 A;  3PVX A;  2CNK B;  2BJ7 A;  4FS1 A;  4IYQ A;  1RQ0 A;  3CJS A;  3KLF B;  4C8K A;  4M5D B;  3NBP B;  4P10 A;  1X5P A;  3H5S A;  3GFH A;  1EQM A;  1QJH A;  2IBO A;  2FLO A;  1RTJ A;  2LXI A;  2RDD A;  3I4H X;  4IH6 A;  4NLT A;  3PNI A;  3NCQ A;  3I5B A;  1YJ7 A;  2DH8 A;  4NLX A;  2ZM6 J;  1TMM A;  5GAG I;  4OZ1 A;  4DUZ F;  2RDI A;  3AXM A;  4FF4 A;  3MR7 A;  5HAO A;  3E8O A;  1GX6 A;  4NI2 B;  2KXH A;  4ZVO B;  3M1V B;  1EIY B;  1AUS L;  4C9D A;  4FKY A;  1YHQ S;  5D15 A;  5G4D A;  5LXY A;  1BLU A;  2EKN A;  2RRN A;  2XCA A;  1SXL A;  2AP6 A;  2R7O A;  3F44 A;  3CT9 A;  3R5B A;  4E2F B;  3Q2T C;  1U2F A;  4H4M A;  1Q5V A;  5AE3 A;  5DRK A;  3J7A N;  5HQL A;  4C8O A;  3OVA A;  3CCS S;  2VBW A;  2OUG A;  1HI0 P;  1N56 A;  2N82 B;  4RW7 A;  3MEE A;  4ED2 A;  2HRT A;  1RAF B;  2DNP A;  1TVR A;  3CD7 A;  4Y2M A;  2NXJ A;  2HK3 A;  2WB1 D;  3FQK A;  4NLP A;  1UJ4 A;  4O44 A;  2OD6 A;  3I96 A;  3ILO A;  3MCS A;  5A0Y A;  4OI1 A;  9RUB A;  2J6U A;  1ZZF A;  1FRK A;  4LFC F;  3GR0 A;  2HWT A;  1QUV A;  1YQH A;  3KJF B;  3US5 A;  3OBI A;  1U1O A;  2XS2 A;  5F9L A;  3TQE A;  1FX2 A;  2VG5 A;  5K8O A;  2OH2 A;  4A8W A;  4USH A;  1FDA A;  4NLD A;  4N76 A;  3SQO P;  2YNI A;  3W2W A;  2HHT A;  1B7F A;  2PMW A;  2P8I A;  2V34 A;  1NK9 A;  4QCL A;  1U6Z A;  1LFP A;  3FDS A;  3GR1 A;  5KFB A;  2JFK A;  4Y3C A;  3SV4 A;  3LF0 A;  2NRE A;  1AZS A;  4BBY A;  3J7A 1;  2XYG B;  2G2Y A;  4FYX B;  2GS8 A;  2IVF B;  2DIT A;  1BQN A;  2BBE A;  3WBZ A;  1XWL A;  2A10 A;  2ZC3 A;  1X5O A;  4LRB A;  3KOA A;  2HEK A;  2W9A A;  1FRL A; 
#chains in the Genus database with same CATH homology
 3BBC A;  1NSK L;  2DXE A;  1XIQ A;  3BH6 B;  3FBF A;  3ETM A;  3VVU A;  4UOH A;  3ZTQ A;  3GPA A;  2BEF A;  1NHK L;  1NDP A;  3EJM A;  2BX6 A;  3EVM A;  3VGV A;  3FCV A;  2CWK A;  1VYA A;  3Q83 A;  3GP9 A;  1S59 A;  4WBF A;  3VVT A;  2DXF A;  3PJ9 A;  1NUE A;  4FKX A;  4CP5 A;  1PKU A;  4S0M A;  2AZ3 A;  3DKD A;  3FKB A;  1MN9 A;  3EE3 A;  2NCK L;  5C7P A;  1LWX A;  1K44 A;  4UOG A;  3NGU A;  1NSP A;  1HLW A;  2HVE A;  4ANE A;  4AND A;  3BH7 B;  4EK2 A;  1HIY A;  2AZ1 A;  1F3F A;  3ZTO A;  4DZ6 A;  1WKJ A;  1KDN A;  3Q86 A;  3EMT A;  3NGT A;  4ENO A;  3FBB A;  5CAA A;  1B4S A;  1NDC A;  3EVO A;  2DXD A;  1NPK A;  5IOL A;  3VGU A;  5CAB A;  1MN7 A;  2HVD A;  1LEO A;  3Q89 A;  1NDL A;  4UOF A;  4F4A A;  1XQI A;  3B6B A;  4DUT A;  1EHW A;  3MPD A;  3FBC A;  1NB2 A;  3ZTR A;  1S57 A;  1HHQ A;  4C6A A;  1NDK A;  4FKY A;  3R9L A;  3ZTP A;  1WKL A;  3NGS A;  1NSQ A;  3JS9 A;  1W7W A;  3EM1 A;  3NGR A;  4HR2 A;  1NLK L;  3ELH A;  1UCN A;  3ENA A;  3EIC A;  3FBE A;  3DDI A;  1B99 A;  3BBF A;  3G2X A;  1PAE X;  2DY9 A;  3B54 A;  1F6T A;  3FCW A;  3PRV A;  4KPC A;  5BXI A;  3Q8V A;  4O0N A;  4W98 A;  2VU5 A;  2B8P A;  1JXV A;  3VGT A;  4DI6 A;  1BHN A;  2B8Q A;  1U8W A;  2DYA A;  3EVW A;  4ANC A;  3Q8Y A;  1NCL A;  3FC9 A;  1ZS6 A;  3L7U A;  3Q8U A;  1BUX A;  3VGS A;  4F36 A;  2ZUA A;  2HUR A;  1BE4 A;  3BBB A;  3ZTS A;  1WKK A;  3WX8 A;  1S5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...