1B64A

Solution structure of the guanine nucleotide exchange factor domain from human elongation factor-one beta, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
91
structure length
91
Chain Sequence
MLVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGATION FACTOR 1-BETA
publication title The solution structure of the guanine nucleotide exchange domain of human elongation factor 1beta reveals a striking resemblance to that of EF-Ts from Escherichia coli.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Guanine nucleotide exchange factor
total genus 12
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b64A00
4KHPF 2UXBF 4DR7F 3OTOF 4LF6F 1IBMF 4JI6F 2ZM6F 1LOUA 4JYAF 4LF8F 4LFBF 1N32F 1VMBA 1HNWF 4X62F 4LF7F 4LF9F 5IWAF 1B64A 3R3TA 1N34F 2KJWA 4GKJF 4DV4F 1CQNA 4JI5F 2VQFF 4B3SF 2YY3A 1CQMA 1XNRF 1GH8A 2J5AA 2E5LF 4DR3F 1F60B 4JI0F 4JI8F 2UU9F 2F4VF 1HR0F 4DR2F 4X66F 1HNZF 4X65F 4OX9F 2B7CB 4YHHF 4DUZF 1QJHA 4DV7F 2UUCF 1XMOF 2BXJA 1XMQF 2UXCF 3T1HF 4DR6F 4B3MF 2B7BB 2UUAF 2RJZA 1IBKF 4LF4F 4DV5F 4GKKF 4DV2F 1HNXF 4JI1F 2UUBF 4JI7F 1N36F 2VQEF 1IBLF 3T1YF 4DR4F 2HHHF 5AJ3F 4YY3F 4JI2F 3ZZPA 2KJVA 4B3TF 4DV6F 4JI3F 4LFCF 4DV1F 5BR8F 4DUYF 1N33F 1J5EF 4NXNF 5LMUF 4DR5F 4AQYF 1I94F 4DR1F 1RISA 4B3RF 2BVZA 4K0KF 1FKAF 1IJFB 1FJGF 4DV3F 4JV5F 4NXMF 1G1XA 1IJEB 1G7CB 2UXDF 5LMNF 4LFAF 1XNQF 4LF5F 4JI4F 4X64F 4DV0F
chains in the Genus database with same CATH superfamily
3C66A 5C25B 4KHPF 1RDRA 1S79A 2IPOB 3ZC4A 3KK2A 4ZPCA 1VIOA 4K5SA 1UVJA 2YNFA 3RG6A 3UFCX 4A8WA 3V4MA 3PX6A 3HP6A 1AB8A 4IO1A 3EPGA 2OEMA 1U09A 2CZ4A 2OD6A 1KONA 2R7WA 5GMEA 2KT3A 1SXLA 4ZVGA 1FJ7A 4O0NA 2MQ8A 2ZD1A 2DHAA 2J5AA 3ZTQA 2I38A 4PKDB 2EK1A 4V19X 2VPXB 4XAKA 1U24A 1F5AA 3ZZ0A 3IBFB 2FC9A 1XMQF 1HYSA 2KI2A 4ZCKA 2G0JA 2OO4A 4QIVA 4M5NA 1FD8A 2RKIB 1H2VZ 1RWPB 1RT5A 4L76A 5CD4H 3WC0A 3EYZA 4I2PA 2EVZA 1FESA 3QSYB 3CB4A 4MK9A 1M5VC 4JB8B 2VIHA 1C4AA 4IG3B 5J1NA 1N5YA 1RLCL 4HACA 3FC9A 1G7CB 4AQYJ 3ETMA 2PGCA 2BZ2A 3BQ0A 3RAXA 2HMIB 4JYAF 1RWKB 5J1EA 5IQ6A 4GVLA 1AYEA 1O8BA 4HTJA 3LPEA 2AT1B 4NLYA 4HI2A 4OJ3A 1FK9A 1Q5YA 3FBCA 1WI6A 4R5PB 4DX5A 1NPKA 1YZ7A 4A8SA 4Y2KA 5AXKA 2IAJA 2LVWA 1A0OB 3QNWB 2HFSA 2BXJA 2ZKTA 2C3UA 5CQGA 2EFGA 1KR4A 4PPZA 5JVHQ 3X1LB 4K4UA 4AT1B 4GKKJ 1VBYA 2MYFA 5KFZA 5HAOA 4EU0A 2AJ1A 2YX7A 5IOLA 4P2FA 4QQBA 4DV1J 1S1XB 1VRTB 1FJGF 3NNCA 3QRQA 2C3PA 2K3IA 4X4SA 3CD7A 5IV3A 1UW4A 2NS1B 3C6UA 3VHQA 2HURA 1HQUB 1VI7A 3W1YC 1XNQJ 1VBZA 1B7FA 2F63A 1MMDA 4DR7J 4LQ9A 1K1SA 2HIQA 1RGVA 1HBMA 1FKOA 2DR9A 1FD2A 5GAGI 4HEA9 4ED1A 2AMCB 4RUCA 2KDOA 3H2UB 4A48A 3G8SA 3QAEA 1FXLA 1T9WA 1HPZA 1EHWA 2YKNB 5ETKA 5BYRA 5A8WA 4L74A 4WYWA 2UU9J 1S1WB 1YVFA 5F3TA 2GQ2A 4DV7J 3KNGA 5J2MA 3D67A 5GADI 3W2WB 5DM7Q 1LNQA 1HW9A 1FO1A 4K4XA 3MCNA 1X0FA 2BV3A 2LU2A 4G65A 2A18A 3LP1B 5KT5A 5KFOA 5A8KA 2QSWA 2LECA 4Z2XA 2IBKA 1RAHB 3WHIA 1NNDA 2CG8A 1KOOA 3SCIE 3NOCA 2HGNA 3R7SB 1KHVA 2ZDOA 5L9NA 1LOUA 2FY8A 3MM8B 2JLEA 3KLIA 5E2QA 2VC0A 4DQSA 4A8OA 3V6HA 4ZJLA 3QT7A 3CF5Q 1YJ9S 2XGPA 3OR2B 1SQFA 5LXRA 2M4MA 1N6QA 3DDIA 1IKWA 1RHQB 3KDOA 5D4LA 1P1TA 3IR5B 3SQOP 3AJDA 1QSSA 2RDDA 2QMUB 2HHVA 1R0AA 4PG7A 1HNIB 4RW8B 1S76D 5HVGA 2UUBF 4XTTA 4IFYB 1NB7A 2ZH1A 2N3LA 5KT7A 3CJRA 3HULA 3G6YA 4TLRA 2F5GA 3GPAA 3O3LA 5ETVA 1MMLA 4ZVRB 3GFHA 3TNVA 3TOQA 2R2UA 2HVDA 2R8HA 1CJKB 5CABA 2E5JA 5CYQB 2LFVA 4FS1A 1Z1ZA 3HXMA 3DXBA 3EICA 2DGSA 3GCWP 1IBMF 3UE2A 2VUGA 1RACB 1LWCB 1FKPB 2JH3A 2IVFB 2AZ3A 4DQRA 1C0TA 3JQKA 2OSRA 5E3RA 5L38A 1BWEA 5C5JA 1JJHA 2OKQA 3GSDA 1NK9A 3RU0A 1LFWA 2RS8A 1VRQC 1Q86T 2UUAJ 3DRSB 1ZPWX 1U6ZA 1YITS 2UUCF 2BDPA 3TAMA 1FHTA 3M6UA 2ATCB 3MM6B 1ZPVA 4V1Ak 1R27B 3ZZPA 2KB2A 1R43A 2CG4A 1R8AA 5HMXA 2PDAA 3V5RA 3HZEA 4Y28C 4IH7A 3US5A 4Q5VA 3PRVA 3NNAA 1CJUB 3B4MA 4ANCA 3HVTA 3CCJS 3R1LA 4P72A 2ZJQQ 1X9WA 3CCMS 4LFAF 3N6MA 2XHWA 2ZH4A 3OT9A 5B08A 2VG6B 4EFAC 2EKNA 4YR3A 1HMVB 1JLFA 4DUTA 4OZ1A 1KN6A 3IRXA 4B9VA 2VPZB 4PQUA 1HBNB 1RT2B 1BQNB 4DSFA 3HVAA 8RUCA 1LWXA 2C1EB 4NI2A 3CJ3A 3TA1A 4B02A 2MJUA 5KFTA 5I4MA 3D9BA 1VIXA 2GGPB 1WKLA 1QSLA 5KG1A 1CQMA 4KHMA 2OTJS 5E7OB 1FF2A 2KT5A 3Q0AA 4ED4A 3D5MA 2AZ1A 4RLEA 3NS5A 5KFCA 1URNA 1TKZA 5CCLA 2VFTA 1AW0A 3DKDA 1GFWB 3UVJA 4HL9A 4DR4J 1U1PA 3JXOA 4WFNQ 3T5KA 4CTAA 3BO2A 2PEBA 2LXUA 4ID5A 1KRPA 4DXLA 1IWGA 3BGLA 2RF2B 2QA2A 3NRBA 2Z2ZA 2AJ0A 4ZJOA 2HWIA 3JQJA 1I94J 3T6BA 1EX8A 4PAAA 1I51B 4KBIA 4OHZA 3KUEA 3ZNUA 5MAOA 1RTJA 2H5IB 2CWXA 1VISA 4WXWA 5LJ5Y 4C8KA 1QD1A 1NO8A 1NKCA 4JI5J 3THTA 1YLXA 3MPDA 3D54A 4GKJF 4CH0S 4P73A 5JJBA 1M5KC 2DXEA 4P74A 1ZOTA 4ZCIA 1H72C 4MIAA 2B7CB 3QLHB 1D8ZA 3SFUA 2L9WA 2RJZA 4AYBD 3DYAA 2XTJP 1H3DA 1B0TA 4NCAA 2VICA 2LEAA 3SZ2A 1DFDA 2OSQA 1RT7B 2VQEJ 1JLQA 1QAIA 1PC5A 3RBDA 1QAXA 2EXUA 1VOMA 1VBKA 4CYUB 1EAYC 4K0KF 1HL6A 5KFQA 4Q2MA 2HPUA 2IJRA 1WI8A 3LANA 4L72B 2UZAA 2DR6A 4C97A 2MZRA 4P10A 4OYBA 3W66A 2M0GB 4E8UA 3RW6A 4NXMJ 4NMXA 1QLNA 2O3DA 2PC6A 2ZOMA 5KG0A 3DLHA 2DR7A 1QVGR 3L4BC 3I56S 1S6UA 4F4XA 1RT6A 2WB4A 3BO4A 4ZLLA 3BYPA 4TU8A 3I9V9 5J1PA 4NLTA 2V4QA 2WSFC 1TL3A 1S0NA 5DO2A 2K8GA 1ZTTA 1HBUA 5KFKA 4W98A 4Y2AA 5LJ3Y 1T05B 1FE4A 1CC7A 3ET6B 2MQQA 2CPIA 1RTHB 1EP4B 2R7XA 1GK8A 3HHLD 4CO3A 3O6QA 2RRNA 4OYMA 3DNCA 1IQTA 1V5IB 1FTCA 4IYQA 1YJWS 1CJTA 3GIJA 2MY8A 3G8QA 1RAAB 5AXLA 3PW4A 2V0NA 4ZVHA 2MKCA 4C8YA 1TELA 1JNRB 3JTOA 4WCEQ 2FJBB 2QL5B 1C2PA 3UN3A 3DDNA 4RW4A 2QA4G 2UVVA 1X5TA 3L3CA 1Q95G 4EBCA 2CQ1A 2M8DB 2C2ZB 4OYXA 5J2QB 4P2MA 2VG5A 2GHVC 6AT1B 5CXTA 4KGVB 4TN2A 2OFHX 3A8IA 2AJ2A 3Q89A 2PMHA 5LT5A 1U25A 4DI6A 4ZITA 2ZVSA 5D4NA 1JMTA 3T1AA 3MOJB 2MKHA 3MEEA 1B7YB 2HBZB 1B70B 3EXCX 3VZIA 2EFPA 4PYAA 4USWA 2YWGA 2YKMA 2BEFA 3CCTA 1KP6A 1J5EF 2JEJA 3AH6A 2XCPA 4YR0A 2GX8A 4PXCA 3CO0P 3VQTA 3E8OA 1OQ3A 1PAEX 2V68A 5DJBA 3VAJA 3P5BP 2K1RA 1U0HA 4QWAA 2DY9A 1KDNA 4PYDA 2W7OA 4EEYA 1Q4RA 4F3QA 1OPIA 1QE1A 1NSQA 2W9CB 2HBYB 5FLXY 3CJKB 1C1BB 3O1LA 4TYBA 2LMIA 3RB6A 3NGRA 5CCMA 1XERA 2X1AA 1TK0A 1GT8A 1MROA 4L3KA 4NEZA 3NG8A 4ZP9A 4IOBA 1TUWA 2VD3A 4DEZA 2FHJA 4YHHF 1RA6A 3OVBA 3W5ZA 2Z30B 3I31A 2OPQA 1YJTA 4LVOP 2ALYB 2KKHA 1X9MA 1CS4B 2CWKA 1OSCA 1ZM2A 1UJ6A 3QATA 2V2KA 3AOBA 4UY8T 4NYPA 2MMYA 4U8YA 1NHKL 4CNYA 2OTLS 5C42A 1A9NB 2HWTA 1RT4A 3CMAS 1P8GA 3GLJA 4U7CA 2IY5B 5EDWA 4C3LA 1PAUB 1ZM3A 4PRFA 1GNKA 4KGXB 3DLBA 3V81A 1WTBA 4O0IA 1S1VB 2BMBA 4K5RA 3MEGA 3H7HB 3W9HA 2UXDJ 5D0HA 2XS2A 2MGZB 3CCZA 3TVKA 4YOEA 4IUFA 5KG7A 3OTOJ 3HFVA 1IKYA 3H40A 4X4UA 3NAIA 1YTYA 4Y00A 1S9EA 4C98A 5K20B 4DR6J 2E5LF 1UVMA 2XY6A 2WVFA 3MPVA 4CM2A 3D28A 2IRUA 1S7IA 4A8MP 2CVEA 1Q82T 1JLCB 2DNHA 5CYJA 2VZ9A 2ZHAA 1R6VA 2GJ2A 4UW2A 2DGTA 1VQPS 1TK8A 3ITHB 4YY3J 1QUVA 4MIBA 2L3MA 2CJXB 3PG9A 5H1SV 2BANA 1S4FA 2VBXA 1T9YA 3HZGA 1T8EA 3QYYA 3E3XA 3CDBA 4HT7A 3NLCA 3TZYA 1EETB 1YRXA 1LEOA 4CZCA 1KLMA 4UF4A 4R0EA 1XC9A 1APSA 4NLVA 1EKRA 1RWUA 3PV8A 3O5TB 1H73A 4ICLA 2VPYB 2UVRA 3PDNA 3BH7B 1VQNS 2PIIA 3H42A 1RAEB 3D68A 2V2ZA 3TQEA 1M5SA 4NRTA 2ACYA 2HRUA 2Z2MA 4LRDA 1I3OB 2QL7B 1F2GA 3SSQA 3C3LA 5J2PB 2VJVA 3HJVA 2NLWA 3FRZA 4PPDA 4JI3J 1U8WA 1AXQA 4D3GA 3DRRA 5DZ6A 4HH0A 5HBMB 4J37A 2AEJA 3OL9A 3RGIA 3OTDA 1RXOB 2GA7A 5I3UA 4ZVUB 2R2TA 4X64F 5DGAA 1U2CA 4J7CA 4HKQA 3BSAA 1QAYA 4E98A 3D3CJ 3H4DA 4C6AA 2XQCA 4MFBB 3Q8RB 5KTQA 2MHNA 4IO9Q 1M1HA 3GFZA 3QQCD 3TUZC 2IVMA 3HT0A 5IXUA 4RUBA 4NLSA 3SEOA 3LALA 1WC3A 2F4VF 4H54A 3TZZA 3W2VA 2AGQA 3B4DA 3IBWA 3QJJA 2WCXA 2XMKA 3GR0A 2ZDPA 2BJ1A 1J27A 3CNQP 5LL6d 4XPCA 3JTNA 3Q24A 2DNZA 1F9HA 3T1YJ 1FXDA 2HFVA 2A10A 1DRZA 1X4DA 1FX2A 2DRAA 5DDPC 2L08A 1SJFA 2ZFHA 2OD4A 3W63A 3RJMB 4RW7A 4K8RA 1FEEA 1F9FA 4C0OC 2P9GA 4E2FB 4IRCA 8ATCB 4C11B 4B9MA 3B6BA 1WC5A 4C8MA 3LGHA 2YPYA 5FDLA 1UW9A 4OV1A 4F4WA 4M5JA 4PXEA 1K8AT 3ONQA 5HQLA 2MPUA 3A8EA 1G3OA 3SQGB 2YKAA 2X51A 3MCMA 1ZZNA 1VLOA 2MB0B 4GRSA 1HNVB 3VV2B 1XIQA 3M8WA 4B08A 3LGNA 1IBCB 4X4QA 2IM3A 3EWGA 4LMZA 3OUYB 3V6KA 4ATNA 2EKYA 1RTIB 3KG0A 1L3VA 2VF3A 2GC8A 2KH9A 3EZ5A 1PGZA 3D0IE 3O8WA 4CLKA 2IDLA 1LW2B 1VS3A 2RHSB 5L9XA 1FNOA 1QVFR 4J9OA 3MPWA 2DNNA 1NDPA 3PY8A 1O51A 3B82A 3QT6A 2J7KA 2XBPA 3GWCA 3I0SA 1DLOB 2CPFA 4MK7A 2ZWPA 3PJXA 3CCES 1SC3B 3R8YA 3BPSP 3JSMA 1P6TA 3R7NB 3HSGA 4CO4A 4O23A 1JLEA 3R97A 3M2VB 3ENVA 4DSJA 4CH7A 2W1BA 3T5JA 1SL0A 4OYWA 2VODA 4ZPVR 4QCLA 1Q0NA 3QSIA 4EZ9A 4X66F 1UETA 1ZYQA 1T3OA 4ED2A 2JHEA 3FQLA 2OPRA 2CPEA 1CBKA 3KOAA 1HWJA 1WDDA 2M88A 2D1CA 2Y1RI 3I87A 3BPDA 1MWZA 5KFVA 2IC3B 3JSYA 1LK5A 3KHRA 2D7SA 1YQHA 5HMYA 4NCGA 4I67A 1SKSA 1FTRA 4WZMA 2FYXA 4RNNA 1S6PA 1R7IA 5A8RA 1TK5A 1A6LA 3GP9A 4LRFA 2JVOA 2IYIA 3N0VA 3G82A 4RPFA 1G1XA 2KG1A 5LMUJ 4TQSA 2HHWA 2YBVA 4EMDA 3TAPA 3I5AA 1FJCA 4U7UK 4LF6F 1XBWA 2W2PP 5IT4A 2HVEA 2JDJA 1PCAA 4YN3B 1S6QA 2DNQA 2DR8A 1SC6A 1XWLA 3PYGA 2ILZA 3PXGa 2RS2A 1NCLA 5K8MA 4LF9F 4PWUA 4DL3A 5IC6B 1JLBB 3GIKA 3NL0A 2QGFB 2D3OR 5E3AA 5F8HA 3M9NB 2HQ3A 3KDNA 2A2CA 3J81U 1Y3KA 4I1TA 5D3GB 3OHBA 3CWJA 3H0PA 1P1LA 3TX8A 3GYGA 3Q8PB 4TLQA 4YDXA 2IJFA 4DX7A 1ZETA 4CH1A 2V2QA 1RCOB 4TKTA 4B3MJ 1M0SA 3AT1B 4J9KA 3C6TA 2CIMA 2OPPA 2H5JB 3ZZTA 3KLEA 4UY85 2PA3A 1GQEA 5A6WA 2Q3PA 2EWHA 3HVWA 3I6PA 4ZPDA 2HG4A 3PW5A 3OXFA 2X3GA 4N8NA 1RYRA 4JV5F 3C19A 1MLAA 1Y9OA 2RU9A 1CLFA 2YQ3A 1SIWB 1X8DA 1F5BA 4OX6A 4AFFA 1R8BA 1TL1B 3DM2A 2YWFA 4M5IA 2CJYB 4ED7A 5F41A 4PZVA 4TXSA 2VASA 1N5SA 3KYLA 2HW3A 2GIRA 3RTVA 4X84A 3LH2S 5IWAF 1TKXB 4BHQA 5KOWA 3POTB 3KK3A 1HNWJ 1WDTA 1NUEA 3FFIA 3RW7A 2ZBRA 4I56A 1WF2A 1N5QA 5I3PA 3PR5B 3BGRB 2VG7B 4CT8A 3TX0A 4DV6J 4KY3A 3FNNA 1RWVB 3BBCA 3A12A 1GMUA 1SUQA 4I4BA 1V9OA 2PMZD 2FVSA 2WOMB 1AT1B 4M5DA 4JI1J 2HQIA 2Q79A 2YH0A 2GZOA 2HNZB 3UDCA 4G1PA 4NCBA 2P6TA 3PO5A 1LKZA 2HLUA 3KJVB 2FC8A 4KKOB 5C25A 2JFKA 2J0XA 1WHWA 1NU4A 2AKWB 1VRUB 3GJRB 1NDKA 1OIAA 1FRXA 2YVSA 2KG0A 3LP2B 3H20A 5AE1A 4DCJB 1L3TA 2WZ1A 2GMHA 4KHPJ 3VAKA 4LFBF 3AXMA 3PX0A 5HK4A 3M32A 4RKUC 2J0SD 2BW7A 2VONA 4QIFA 2RRAA 1MWQA 4B3SF 4BDPA 1LWFA 1REVA 1SJRA 2Y3YA 4PG8A 4KRWA 3EM1A 4NE9C 4LRAA 4F0KA 3DRXA 4M95A 3K57A 5D77A 4WZQA 4HHJA 2CDRB 1FJEB 3IG1B 1XMQJ 3C16B 2ZH8A 2GIFA 5K14A 2GJFA 4J9UE 1ZA1B 3MMJA 2WVCA 4USMA 4IG3A 1NHVA 3H2VE 4CP5A 1RHKB 3M8QB 2FVPA 3EDRB 2VV5A 2HZVA 3BB5A 1NXIA 1U0SA 2HMIA 3GCXP 4ELUA 2DO4A 2KM8B 3RBEA 2ZWOA 4Y3CA 5JMNA 2CPXA 3QPIA 2MZ1A 1VQSA 2M70A 2B5JB 4I7FB 2MDAA 2B6AA 1RU1A 2X1GA 2MKKA 2Q66A 2YNGB 1ACMB 5AE2A 4JYAJ 3KLGA 2QA4S 3AA8A 3HD1A 3UCUP 3LP0B 4CLYA 2B51A 4DR3F 2PSZA 2CAJA 4PG4A 3EVWA 5EHHA 1BY9A 1NLKL 3M6WA 1FDNA 2V8DA 4QR0A 2CVIA 3IGNA 3ISNC 1DTQB 1VQOS 1KFDA 2RQMA 4JI7F 5BXIA 2Z4PA 3CMES 1SQEA 5ETOA 1KNZA 3I55S 3G2XA 4RL1A 2A6MA 2CNKB 3AD7C 4YB7A 5IZHA 4MKBA 4OI3A 3OTCA 3JSBA 1RSCA 3CO9A 2CJBA 4NEYA 3MR7A 2VBYA 2CQ4A 3TRGA 5E41A 4WE1B 3IWNC 2RD5C 2P9CA 2OAUA 1UTAA 1RISA 2M2BA 4R0JA 1HQUA 1VQ9S 4NLDA 1LWEB 3C14A 4CDIA 3JAMU 1FJGJ 4DN0A 3NGDA 5BYSA 2N7YA 3N5BA 3OD2A 2Y9HA 1KC8T 1RE1B 8AT1B 3VCDA 3GYNA 5HMWA 4M5KA 1N52B 1AZSB 3FKBA 2HQFA 1R0BG 2PFFB 3R9LA 3KUGA 2QO3A 2KYZA 4DLEA 5A2QU 5E33A 4N76A 4JI8F 3LO3A 4OI2A 1PIEA 1XMOF 3IFEA 3W2WA 2AD9A 4NLPA 4FN5A 3IMQJ 3LWMA 4ZVTB 2AU0A 3DOLA 3QO9A 3S6EA 3TWZA 2BRLA 1TVRB 1VDHA 3DDKA 2DJWA 3M2UB 4DOZA 2NPIA 2FPHX 3ISZA 1Y3JA 1LW0B 5B7WA 1HWUA 4Y2CA 3O2IA 3B54A 3UD5A 3CD5A 2DGUA 5B0EA 1IJFB 2VKZG 4LR7A 4EO6A 5B0AA 5LMNF 1WELA 1WEZA 3B78A 4CO5A 4FS2A 3BDEA 5B0FA 5L39A 3IRWP 1TL7B 2V2VA 4WPAA 1N5TA 4I6AA 4ZHRB 3N79A 4MYTA 3WIUA 1L3UA 4QPXA 3PM9A 4HLBA 1OO0B 3IWXA 2QSFA 4F3OA 5DDRC 1EQ0A 3DGPB 2FHKA 3FMWA 3CCRS 2RQCA 3QWUA 4DUZF 3KK2B 5GAHI 1X4HA 1S99A 3F56A 4KJIA 3G9CA 1DAXA 4DPUA 4KQZA 4TU9A 2HHHF 1IN0A 4IG0A 1U26A 5AXNA 2WAQD 3BR9A 1F3VA 3J7YI 1RHRB 2UUBJ 2E9TA 2UP1A 1CJKA 5DETA 2MZJA 2DNLA 2F3JA 3N4WA 2YNHA 1YG0A 3PR4A 1JLGA 3RBZA 3GIRA 1PKUA 1LWCA 1FKPA 1N5VA 1FFSB 2ZC3A 1JXEA 2DNOA 3AB4B 3ENAA 4DMZA 3K59A 1GTHA 1SBRA 4MAKA 4C0BA 1RT5B 5HJYA 3M6XA 2E7VA 3MUVP 1WWHA 4DS4A 3D1QA 1IBMJ 3TP2A 4I2PB 1FRLA 4D3HA 2ADBA 1UEVA 1MN9A 3CSKA 2FLNA 4RUAA 5C24A 4OJGA 1RWMB 4HACB 4QZVB 2MHEA 3MD1A 1RT1A 2MSTA 1X7VA 4OX9F 1HNXJ 3HT3A 2IM0A 2G13A 1TKTB 5F9NA 4S0MA 2MQLA 1OQ6A 3NCQA 4A8XA 5SZTA 1NZAA 5ETPA 1Y10A 3KG1A 4LSLA 2HRYA 1L5UA 2GFFA 5ETLA 1FK9B 3IP0A 5E3CA 2Z8QA 3WDOA 1TP7A 2HGLA 1B3TA 1FKAF 2GAHC 4FXWA 5KT6A 3VGSA 2HHUA 2VFVA 3EX7B 2AJ4A 1ZH5A 4ZVQB 1RT2A 3UNGC 1T9TA 1YI2S 1U8SA 1T0TV 3EE3A 4DJBA 3NWRA 1WOPA 5F0WA 4LFAJ 2GGPA 2L9DA 4QIGA 5EX3A 3UDLA 1IKXA 4RBVA 1NAQA 3KUHA 1FI4A 5M2UA 1XEZA 5AXMA 3BKUA 1HHQA 5A76A 3H2LA 3EVMA 2OEKA 3JB9k 3CW2C 2X1BA 4NZ7A 4J9NA 4QBUA 5EN1A 3HHLB 3C6UB 3U1LA 1JNZB 2C2OB 4EYIB 1T3NA 2BJ8A 2QC3A 3MAAA 2VC1A 2ZNYA 4NLXA 2Y8WA 3MM7A 2AIRB 2IFXA 1HBMB 5I42B 2DHHA 2QLXA 2LDYA 3IC1A 3T9NA 5ETSA 3OJSA 2H65B 2J9DE 1HPZB 2R8KA 3L09A 2F8HA 4NX9A 4CLSA 1GXLA 3U1NA 5A8WB 4OHWA 4ZJQA 3MMBA 3FEYB 2OI2A 2UXBF 5H9EJ 2V34A 3D6FB 5J2MB 1U1MA 2DBBA 2W8KA 5DLFA 1S1UA 3A3OB 3VGUA 2DGWA 1WEXA 2ILYA 4C7QA 4WFXA 3VWSA 4Q8EA 2OLWA 2W2OP 5A8KB 1PBAA 3QLHA 2VQFF 1L3KA 1H2TZ 3M1VA 1C1CA 2DRDA 4GKJJ 4F4AA 1R89A 1FWPA 3MCSA 2HWHA 1RT3A 3LAMA 2FGOA 1RT7A 1N0UA 3NKYA 3PEJA 5H9EK 2HBRB 1RKJA 1UJ5A 4W92B 4CYUA 5HANA 3ILOA 2IA0A 1AA1B 4ZP8A 1IKWB 1UPMB 3GV8B 2DNPA 2WSEC 1R0AB 3DHWC 2OFGX 2Q1LA 4TY8A 4JV1A 1HIYA 2DD8S 4A47A 4MK8A 4FF3A 4K0KJ 4IFVA 2IJNA 1JWWA 4QR1A 4IDKA 2PD1A 3E01A 1N88A 5LSLA 1V3SA 3BYRA 3PX4A 5L1JA 1GMWA 4FPRA 3R5JB 4WJBA 5F8IA 3FEXB 2OIHA 3J7ZT 2DH9A 1RAJA 3R3TA 2V5HG 4QYRA 3JS9A 3EMTA 3PNIA 3HM9A 1CVJA 4U9RA 1HNZF 2AYMA 4OMFG 2W2NP 4B3OB 2JNJA 2FVRA 2UUAF 1RTHA 1EP4A 2DNRA 2FJAB 3BJYA 1FFWB 2BKNA 1FDAA 4P9SA 3CVKA 3HKWA 3EGZA 2IIHA 4YMEA 1C0TB 4IKAA 4LF2A 1RHJB 2EG1A 3K7RA 3J7AN 1VQ6S 1O6XA 5FJ4A 3HFZB 1F9EB 3SXLA 2A2DA 3KHHA 5GMKa 4C8ZA 4PG6A 5HQ8A 1HWLA 2BBEA 2C2EA 1YRUA 3PVXA 4U7UD 2ATLA 3A13A 3NCRA 1VYAA 1T9XA 4URQU 2VA3A 3AQOA 1HBOB 4PEOA 2HS3A 3PHEA 4CLZA 1N32F 1UWBA 1KLNA 2CKWA 2BJEA 4I2QA 4O4GA 1U1NA 2IA6A 2YWWA 1HWIA 2HHPA 4GC6A 2Y1IA 3R2CJ 4CI0B 1M1KT 2EI5A 3M8RA 1YBAA 2AEMA 3VVUA 4QPTA 1X5OA 2GO8A 2C22A 2BACA 1JLFB 2ZH9A 1XJWB 3IRXB 4NA2A 2GAGC 3EXYA 4PQUB 1N36F 3D66A 4FF4A 4P7TA 4LRBA 4DSLA 2RNEA 4NI2B 4WKRA 2DO0A 3CJ8A 2RILA 2SXLA 1U02A 2E1PA 3Q86A 2LEBA 3PCOB 3Q8SB 1S9GA 2MZTA 1FWLA 2YNIA 1J5EJ 3MR3A 3OR1A 2W9CA 2HIYA 4OHVA 2XB2D 1TKZB 2C2RA 3H5SA 3RZAA 3OQ2A 2IM1A 2CUYA 2J76E 2E1CA 2ZM6F 3GIMA 2JFDA 3UVJB 4DV4J 4C3MA 3HI9A 4FYYB 3CC4S 2QFJA 1YJ7A 3QT8A 4OI4A 4CTAB 2H3EB 3P49B 3T9ZA 2XMUA 1L3SA 3TA2A 2HRTA 4IQXA 3N6LA 4JI5F 3TAQA 2VFRA 2HQDA 3MF5A 4X2BA 3M8YA 4TU7A 1F60B 3JAMY 5KOXA 3PW2A 4AL6A 4ITSA 4ECUA 2UV8A 4ZLNA 4Q8FA 2UXCF 2CPJA 4DN9A 1AROP 4WP8A 4F02A 2NXJA 2FUG9 2VDHA 3CDUA 1DTTB 3MOZA 1TMJA 4C48A 4LFCF 1WHYA 2DIVA 1R6YA 5A2QY 4WFBQ 2RSQA 3RB3A 3CJ5A 4DR5F 4DR1F 1LXJA 4MMOA 1KTVA 1UJ4A 4F36A 4MYUA 1S1VA 3BKFA 1TMMA 3BH6B 4URGA 2JLGA 3DYAB 2MGZA 4M8LA 2L9NA 2FIUA 3GZ7A 3A3NB 3OSPA 3CUNA 4IH5A 2E9RX 5CH7B 1IWAA 2XLIA 1HHSA 4FYDA 1RWNB 4P71A 1CJVA 4I69A 4F04B 3M2RA 4CLFA 4M63A 2I0XA 1EKSA 4N8OA 2KL8A 1XNRF 2VH7A 1VQYA 2QYGA 3DLKA 3J80U 1H7WA 1HR0F 1JLCA 1RJJA 3M8SA 3OFFA 1G6BA 2E1RA 3ZZZA 2E5LJ 2Z57B 3QWPA 2ASDA 4O3RA 3WZ0A 1ROFA 5KFRA 1K0TA 1OYEA 4DL7A 2IBOA 2HS0A 1HD0A 4KGKA 3UQSA 2CYYA 4BWJA 1NH8A 3AOAA 1RT6B 3BZQA 1H98A 2K7JA 4YB5A 5DS7A 4B9NA 2MKSA 3VGTA 2IMWP 3NGKA 2ZOFA 3ENQA 1TL3B 1HBUB 4PABA 1C0UA 5GVQA 1ICEB 3VQSA 4MT1A 2E5GA 4OI1A 5KAKA 2LEPA 3ZZOA 4ECSA 4DU7A 4ZPBA 1RP5A 2QJ3A 3W7BA 1SL2A 4OZLA 3LA0A 4N7TA 3IO1A 1Q8BA 1YX2A 1MU2A 1CJTB 3W9IA 2CPYA 3N6NA 4J9QA 1IM4A 3QT5A 3I32A 4R25A 2QT7A 1IKVA 3KLFB 1RWXB 2DYAA 4RWXA 3BGFA 1YHQS 1RUSA 1KQSR 3MR5A 2B8QA 2PI5A 2ZZTA 5A0YB 3N5FA 2HFOA 2FLPA 3K2YA 2YWKA 1BC6A 4P2SA 4F2RA 2DRBA 1FRMA 5ETQA 4NWBA 5SUHA 4USKA 2VG5B 1NJWA 4B3RF 4QYZK 3CCUS 3FBFA 4ZOSA 3GFYA 3RB0A 4F4KA 3QGGA 1YIJS 2H51B 3OLBA 4A8YA 2BE9B 5HP1B 1SB6A 2YKOA 4DG1A 3CJQA 4X64J 2EEYA 2G1DA 3P6YC 3PIOQ 4LF8F 2IRXA 2YKMB 2W7PA 2B0GA 4J9VA 4OHYA 4O3SA 5ITHA 5T7LA 1U7LA 3MWBA 4RW6B 2O5DA 3AJ2A 2XY7A 2MQNA 1HARA 3D4JA 5HVFA 1FEHA 4JI0F 2XULA 2E44A 3T5HA 2ZH7A 3L7PA 2K1RB 1U0HB 1VJWA 4ZVEA 2XLJA 2W4DA 1QE1B 1PO6A 2F4VJ 2AQ4A 1KHWA 4JOUA 3S7RA 2HHQA 3UNYA 4LSNB 4J9RA 3CDWA 2XYPB 1TAQA 2R42A 1MROB 5C2CA 4OYAA 2PO4A 3CCWA 4Q45A 2B4VA 1X4BA 4DV0J 4BLGA 3QZ8A 1JJCB 2MLZA 2OPQB 3A8KA 2Q6BA 2HS4A 2AJQA 3GV5B 3NGUA 3RRKA 5J2NA 2C3OA 2BUNA 3TI0A 4G1QA 5D15A 3BQ1A 1FVQA 2CXEA 2Z2LA 3PKMA 5C42B 3J7Z5 3AD8C 4KR0B 4Y34A 1RT4B 4KO0A 2JZ5A 1WKKA 2JWNA 2KXFA 2HNDB 2VOOA 2ZH6A 1NK4A 4UQTA 1DQ9A 4ZVSB 2G9OA 3OUYA 4W4MA 3JTPA 3V81B 2FZKB 4DR6F 1I5OB 1W25A 3MEGB 2CNLB 4DF4A 4B3TJ 3UI3A 3IN5A 3V6DA 3RRHA 3NBPB 2D3UA 3MEDA 1FWKA 2UVWA 2CJ9A 1SI9A 3AFGA 1B99A 3NCPA 1IKYB 1LW2A 5KFJA 4LT6A 2D3O1 2GQQA 2JC0A 3RBXA 4QWEA 5K8NA 1JKHA 1U6BA 3D1HA 4EBDA 2DTJA 2EFNA 2IYGA 4USTA 3UW1A 3L95X 4NL5A 3G87A 4CIOA 1CULA 1UFLA 3TZXA 2O67A 5T41A 1QUPA 3S8SA 4GO7X 1FRIA 5ETNA 3H5YA 2CJKA 1VC6A 2ZHOA 4K50A 2FVCA 4X62F 2FGCA 3OFGA 3SCJE 4J91A 4OV6A 3SFGA 5JUMA 1RYSA 3WX4A 2RH3A 2LLZA 3ZZRA 5CA5A 4Z37A 4O4RA 4DQPA 2B56A 3MPYA 2ASYA 3HO1A 4ILLA 1KLMB 4X66J 3DOKB 2I1RA 2J7UA 5F8GA 2LYVA 2C3MA 5E5NA 1S1TA 2P8IA 4ZPAA 2D9OA 4L6V3 4FBTA 5IT0A 3DLGB 1WF1A 2AYEA 4JV0A 2F9DA 1IJEB 3THPA 1ZAVA 5IV4A 2N7CA 4ECQA 2R4FA 2DKOB 4DX8H 2DEJA 1JLBA 5KG2A 4LBPA 4ALZA 4JI6F 2X1FA 5B0BA 4KE5A 1KS2A 3KJNB 4WP3A 2RDIA 3K8WA 2RUSA 2EBEA 4LF6J 3UR0A 4OZ0A 2XSJB 4RO0A 2EC2A 4ECTA 2GO9A 3VF0B 4BC9A 3DRRB 4DL2A 5KG3A 5D3GA 4ED5A 4LF9J 1TZ0A 4DFPA 4DF8A 1SH3A 4M5MA 1NRKA 1T02A 5K8PA 4MIWA 1RAOA 1CG2A 2DCLA 2W8LA 4DV5F 1AFIA 2Y0BB 1VLYA 1WACA 5I3QA 4CO0A 2LQJA 1YSJA 1TV6A 2YWHA 3I5BA 5M2PA 3FBBA 4HT5A 1SV5B 1JJ2R 4DL4A 1N33F 1Q7LB 3MR2A 3W2VB 2MZQA 1SH2A 3QZ7A 1X5PA 2NPFA 4NLGA 1QM9A 5B09A 4JV5J 4EI2A 1W26A 2BX6A 3AD9C 4ZLPA 2E1MC 3K89A 5KFAA 1TKXA 2ASJA 3POTA 1ULRA 1VGYA 2AX0A 1N54B 2AF6A 5IS2A 2ZH3A 2QMXA 3NGSA 4K4ZA 4K2XA 2HVHA 2R7UA 3TO8A 4LBIA 4NRUA 3U02A 2ALZA 1X5SA 5DDOC 2X3DA 4PR6A 1PYOB 3I82A 1NSKL 1BHNA 5IWAJ 3PTWA 2R7RA 4KAIA 1K44A 3R5CA 2KHCA 2WOMA 3OFEA 3OTEA 4LQ3A 4M94A 4LF4F 1XMBA 3W8PA 3K17A 4BCAA 1RTDB 2J8AA 1S0VA 3P8BB 3LW5C 4MJKA 4CO2A 5GAGU 3OL6A 3ZTSA 3QGHA 2XC9A 1WKJA 2FZCB 4B9TA 1S72S 2BM0A 5F0UA 1UEUA 4CO1A 2X7IA 3P3DA 2HNYA 1BQMA 5DQHA 4C9DA 3PRBA 4A8QA 4ES3A 4FXVA 4H4KA 1V5VA 5GADU 1G4CA 1ZS6A 4PXDA 5K5MA 4YFUA 4OFZA 2E1AA 4LF7J 3G86A 3TJ8A 3CIZA 1KQFB 4DPYA 3NY0A 3IXQA 1U47A 3QIDA 4HR2A 1IUJA 3MURP 2MY7A 1X4GA 1VR6A 2I5JA 4LFBJ 2PEHA 1UPPA 2BW2A 1NJZA 5D0RA 4TYAA 1OY6A 1OY9A 4MKYA 4UQGA 4X65F 3IG1A 4WIIA 1HLWA 4B3SJ 4AL5A 1WHXA 3DOMB 4Y0FA 4B17A 2LXFA 2ZZNA 1PG5B 4H4MA 4OJ1A 2M5YA 2AGOA 1J5OA 1JLEB 1R31A 2KZMA 2W9BA 2A0FB 4J5OA 2ZKUA 3U27A 1W7WA 3J80Y 3NS6A 3AJ1A 2V50A 2A6OA 3U7JA 4AL7A 2C3YA 2MQPA 5HLFA 2OPRB 2B5JA 4I7FA 3TQ1A 2KVQE 2CQ2A 5KFHA 1PYTA 4EK2A 2DY1A 4FDFA 2B8PA 4ED6A 4BS2A 1FDDA 4I0WA 4ECZA 2H5EA 1VQMS 3LP0A 2W25A 4UZCA 1U1LA 3PFEA 1NH7A 3G82B 1ZZFA 1DTQA 3MM5A 1H2UX 1X4EA 2EK6A 5KFXA 2XS5A 4NPOA 4OZNA 1X4FA 5HN0A 4P75A 2B7BB 3PACA 5HROA 1IBKF 4ZVFA 4C2MA 4DR3J 1RI7A 1S6QB 4F25A 3M30A 4I6WA 3IR7B 2NXCA 2LU1A 2PFDA 2XI3A 4LSZB 4Q7AA 2U1AA 2DGOA 2OPSA 3BM7A 2K7KA 5ETTA 4OLPA 4LJMA 5F8JA 4JI7J 4FXDA 1RAGB 1RB0A 2FLOA 2D41A 1VQLS 2MJNA 2NUHA 1XR7A 4ZCLA 2UVUA 1XR6A 2HK3A 2FHOB 5G0RA 1WUUA 5AT1B 4MH8A 3EGWB 3M8PA 2XZTB 4I6YA 2RT3A 4IRKA 3FEZA 2OGUA 1Q79A 1X60A 2M52A 3MAQA 3FCVA 2OPPB 4FF1A 3CJ0A 4KFBA 3KLEB 1B4SA 1RADB 2QMWA 4NZ0A 3KHGA 3FVYA 4ETXA 3TANA 3MZIA 2CFXA 1UFKA 3SCKE 4RU2A 4M5LA 1P27B 3MHYA 3H90A 4DPOA 4DR2F 6FD1A 2AYBA 3G6VA 4PUOB 3CCQS 1S48A 3UDVA 4NLQA 1T9UA 3H5XA 3LAKA 2E9ZA 3T41A 4JI8J 1TVRA 4LF1A 1KQKA 2PI4A 3WIVA 1BLUA 1Q78A 2F4FA 3EZOA 4U96A 2DCUB 2VFSA 4DV6F 1H6KX 2NR0A 4CT9A 1SJ4P 3MMAB 2E5IA 4ERDA 4CQ1A 2G4BA 3FFIB 4NYOA 3I0RA 3WX8A 2XNQA 3I9ZA 2BRKA 3CCSS 2R7TA 2AP6A 1VBXA 1NHUA 4OL8A 3BF4A 2YTCA 2NXNA 5L46A 5IM0A 1TL7A 1I1GA 4WP9A 1SUQB 4C8OA 1URRA 1WD6A 1NSAA 5DM6Q 3PJWA 3TA0A 5LMNJ 3W9JA 4RWWA 4M5DB 3MEKA 2CQGA 2GNKA 4Q43A 3QGIA 4W90B 4ES1A 3RAQA 1REGX 2OJ3A 4BC7A 4ED3A 2NSCA 2KTQA 1RHMB 1N34F 2WW4A 5GAEI 4XPEA 2KVIA 2UUWA 1JLAB 2ADCA 2WONB 7AT1B 3R5DA 4KIAA 2RB7A 2B9EA 2DXDA 3CDAA 2ZOGA 2LQ5A 1OMSA 4DUZJ 5BJRA 5AJ3F 4NLWA 3V6JA 3P96A 2KJVA 5IT9U 4C0HA 3M32B 4QW8A 4O3NA 1E6YA 1TQLA 3BEGB 2HHHJ 1LWFB 3KLVA 1REVB 1NK5A 1HA1A 3LQVA 3C8YA 1AUDA 4ZK7M 2KT2A 4I64A 2HHXA 1M5PC 2CRLA 4KPCA 1NPPA 2WVBA 2M7SA 5KFSA 3QIPA 2DVIA 3DLEB 2HKEA 3A4TA 4PWDB 5K14B 1K47A 2D74B 4J9MA 3I4PA 3ZO7A 1ELOA 3KK1A 3OFHA 2JOQA 1HI1A 1KVIA 3PKYA 3P5TL 5HL7Q 5HO4A 1TKTA 4DZDA 3MDFA 1YGYA 4DSKA 2V4JB 3R7BB 3UN5A 3G6ES 2I8EA 1VQKS 3M8ZA 2B6AB 4OX9J 4LIWA 3D1OA 4EUVA 2C42A 2BKPA 6FDRA 2I6WA 1KEKA 2WB1D 2E66A 1R8HA 3PRDA 1HQEB 2GQCA 3KLGB 2BYCA 5LOQA 2PN6A 4HDHA 2EFVA 2CZ9A 2JLFA 3DMJA 1DY3A 1DBDA 1V3ZA 1DURA 1IQZA 3NAHA 3QFWA 2WBMA 4HYKA 1D3WA 3N9UC 1S77D 5RUBA 2J6UA 3JSRA 2Q6CA 1PYSB 5FLXU 1TUVA 2FVQA 1NZ8A 3IAM9 3K5OA 3KXDA 4L73A 1FA0A 5B0GA 2XYGB 5HQMA 4F50A 2P2CB 2ZE2A 4DWIA 2MQOA 2JSXA 2POKA 3HHLA 2VDIA 4DFJA 2FJEB 2Y0SD 1NMEB 3C14B 4CLPA 1OYDA 1QTMA 5I42A 3TEGA 3DRYA 7FD1A 3V4IB 1JXVA 1RWWB 4HI1A 4JI2F 2BOPA 3G6XA 2BJDA 2IHR1 4WK1A 3MXHP 2VB6A 4LIRA 4DUYF 5JVGQ 4R8UB 1S4EA 1X31C 3MAHA 1FFGB 3AY0A 3SSRA 3QJLA 4WIQA 2GVZA 3AB2B 4OYPA 4GO5X 4XK8C 1ZA2B 1MNEA 2LCWA 3OW2R 4LF5F 3M9OB 4F7VA 3DOLB 3QO9B 3DLJA 3TJ9A 1S10A 3WC2A 4XIUA 2FY1A 2UXBJ 5ETMA 3PYFA 2BQUA 3A8JA 1TFYA 5DGBA 4K59A 2XMAA 3DC2A 2MQMA 1GH8A 1NM2A 1HW8A 5A6PA 2VQFJ 3T1HF 3M05A 2UUTA 1GXTA 4DV2F 1NK0A 2BJ3A 2AGPA 1D09B 4ED8A 3F41A 4GVBB 4ELTA 2EBGA 4DDFA 4E0DA 3B8HA 3TUJC 1HQ2A 3VVTA 4NXNF 1GAOA 4ILRA 3LPYA 2D69A 2J0WA 4Q0BB 1WG4A 4OIXA 3KFWX 3VR1A 4DSEA 1Q5VA 2QA1A 1RTZA 5HJXA 2J9DA 4RNHA 3L7OA 3F73A 3OSNA 4K7QA 1RHUB 1RU2A 2M9KA 4IG0B 3W8GA 1NK8A 4C8LA 3R5BA 2YQ1A 4P52A 3ISND 3BDPA 2W01A 4NOHA 2J9CA 4B3OA 2QIFA 4BBYA 2YNHB 4RNOA 2MZSA 4QWDA 1JLGB 3BSNA 3A1YG 3V2UC 2ASLA 1F5CA 1D9FA 4LRCA 3MUMP 3JYTA 3C15B 3PFOA 2LQ8A 4ZN3A 4K4SA 2BOAA 3O44A 2CZVC 3G96A 5IFMA 4RR5A 1HNZJ 1HNXF 3SDEB 1IBLF 3P45B 3EPIA 3W3SA 2J7WA 3HSJA 2V8GA 2HVIA 3EZUA 3DI6B 5C24B 3CDEA 4ZKAA 4B9UA 3R2DJ 4K4YA 4H4OB 4IQMA 4JBCA 4DCPB 1RT1B 2FHJD 2JEFA 3NS7B 4GMKA 2GVDA 4DV3F 1HBOA 3S01A 4U6PA 5GAEU 2GS8A 2PE8A 1WNEA 1N56A 4JI4F 3W62A 2VJUA 2RQ4A 4QU6A 5DQGA 3GG0A 2QG9B 3HX9A 4LSLB 4YS2A 1KSPA 3MR6A 3R27A 1AUSL 4CLWA 4DL0C 3VGVA 1Y5NB 1PC4A 1N32J 4P6QA 1E6VB 4ECYA 3M7VA 3NXZA 3MM9B 1JQGA 1RBLA 4KH0B 4MKVA 2CQDA 3CT9A 1VHFA 1TAUA 2B4OA 1RKIA 4X4OA 2RQKA 3FCWA 2FZGB 3NNHA 2E29A 5LM7E 1IKXB 4KV8A 4O44A 2R7VA 1NDCA 4CM0A 2ZBQA 4J90A 3KMQA 5B0CA 2BE2A 5BR8F 1N36J 5F8LA 1ZM9A 1SKRA 4DPXA 2QLJB 3IS9A 2CQCA 2JC1A 1OS5A 2W24A 3GILA 2ZJRQ 3VTIA 3MAAB 3IAS9 3GONA 1NB2A 3MM7B 3TVYA 3FK4A 2MSSA 3GSIA 2QFIA 1BUXA 3CEDA 4ES2A 2G1HA 2VKRA 3UD3P 5D6GA 1KBRA 2ZM6J 2H4YB 4PCQA 4TNOA 2CQPA 2WRMA 1YJRA 2V8PA 5C7PA 1U1RA 2CNOB 3T19A 3AODA 1NK7A 5CYMB 2DPIA 3AA9A 3MMBB 3MMCA 1DTTA 2XYHB 5EWGA 5E3PA 2Z2YB 2W4PA 1S1UB 4QR2A 2QLWA 2UXCJ 3SYZA 3NMAA 2DPJA 5F8NA 2ZBCA 1M5OC 3OL7A 4ZVOB 1WHVA 2HBQB 2OMLA 4H4KC 2ZBPA 5KFFA 1K0VA 2YXLA 3M1VB 1C1CB 4LFCJ 4P7VA 1GMVA 3NWGA 2ERRA 1F2HA 2DH8A 4DFMA 1RT3B 4DR5J 4DR1J 3ZXWA 4M1KA 4NZ6A 2E7WA 4FKYA 4RZRA 2R8IA 3Q8VA 4ZP7A 2AW0A 2YKQA 4ZN1A 4A8KA 3MTKA 4FPIA 1WG1A 1BQXA 3H98A 4O3QA 1QDUB 3DLLQ 2RKIA 3SV4A 1Z4UA 1VC5A 1D9DA 4TY8B 2XI2A 1WG5A 4DFKA 4N47A 2NXEA 4IFVB 4OHXA 4IDKB 2IRYA 3E01B 3IA0A 2KXHA 1XNRJ 3GV7B 2Y1LB 1HR0J 1RWOB 3BQ2A 2P9EA 1EARA 3AAWB 3ILLA 4USUA 2KM8C 4QW9A 3HHDA 3D0HE 4ECXA 3DCAA 3RRGA 5MLCV 3H5UA 1WF0A 2LQBA 3GTYX 1MSWD 3D3BJ 2WVDA 2VBZA 1YDLA 3BGOP 2ZH2A 1U4BA 3SMZA 1T03B 4WU2A 4R5PA 2B4UA 4OZ3A 4ZLJA 4ZIVA 2CQIA 2COLA 5M2RA 3NOGA 4LUBA 1X4CA 5IT9Y 4RBUA 2CNNB 1TR0A 3FJ2A 3IGVA 2UV8G 2HK2A 3KLHB 2ROPA 3BN4A 4X4TA 4UZBA 1YRTA 3KLFA 3D6MB 1U49A 3KJFB 5K9FA 5EUHA 2YY3A 4JUZA 5DG9A 4OX7A 2NYIA 1S1XA 2RUGA 1VRTA 5A0YA 1UA1A 3BKTA 4K4TA 1OSDA 2CPDA 3SIPB 3MGJA 1FDBA 4ER8A 2EC0A 4CRJA 1UWBB 5CD4A 2JX2A 1KVJA 1UCNA 1SQGA 4I2QB 4O4GB 5HATA 3VAFA 2W7AA 2B9XA 4LVNP 1P9QC 2C2MB 4KHRA 4KT0C 2FHMA 4F2SA 4CNZA 4XDCA 2OUGA 3IR6B 3M9MB 5HP1A 2HLTA 2OHDA 5CZVA 2XY5A 2V6AA 2OELA 2C2KB 3HK2A 3MFHA 3CPWR 4B3RJ 2YKNA 3R6LB 3AHPA 1IXKA 2QX0A 3CD6S 4HHUA 1S1WA 4RW6A 1Q1KA 1RZMA 2XHCA 3QMQA 2KN4A 1U1QA 1S9GB 2MEWA 2WSCC 2HSEB 2YNIB 4LF8J 2R7QA 4DV4F 2CJAA 3OR1B 3LP1A 4DS5A 3TYTA 1SKUB 4WBFA 2W2QP 3N28A 3RUBL 1RCXB 2G2ZA 4LSNA 3CJ4A 2BJ9A 3HKZD 4JI0J 2G0IA 1MWYA 2H4WB 4PXBA 2ACMA 3K58A 3MECB 3K5NA 1T7PA 4EZ6A 4QIEA 2XS7A 1HKAA 4FVCA 3F0NA 3MM8A 4RBTA 1O0PA 3MTJA 1N4LA 1X9SA 1SL1A 3UCGA 4OLOA 3MUTP 1XK8A 3OR2A 3ULHA 2J6TA 1Q8IA 2HHSA 2DK2A 2B9YA 2F1FA 4RW9B 3HHKA 2G2YA 1HNIA 4RW8A 3KHLA 2RAQA 3DRPB 4HTIA 2KYXA 2HNDA 4IFYA 1X0PA 3QJPA 2R7SA 4XDDA 1M90T 2DHXA 3CJSA 2XLKA 2YNFB 1UKUA 3E51A 2HYIB 1ZTWA 3LOUA 3FCHA 1UVNA 3EGVA 2CQ0A 3NBPA 3HHNB 2DNKA 4OQJA 1HFEL 5H9FJ 2GMLA 3ETOA 2XG8A 2ZD1B 5LXYA 1RK8A 5CYQA 3ADAC 2AX1A 2BABA 1HYSB 3CMQA 2KFYA 3VAGA 1CJVB 3G8TA 3PO4A 3M2RB 1EIYB 5EGYA 5EWFA 4F8RA 1X4AA 1VQ4S 2CQ3A 1S57A 4HHHA 4AQYF 3DLKB 1N8RT 2E7XA 1VQ5S 3CE8A 1QTNB 4AXIA 1Q53A 3DRSA 3FZ2A 3SI8A 1N5YB 3M6VA 7FDRA 5H9FK 1IR0A 1GX5A 1PSDA 1IR1A 3OVSA 1S9FA 1JX4A 3MM6A 1Q8KA 2I9SA 4Q2LA 2BJ7A 1D8YA 2R2RA 2KFNA 4IR9A 5FIIA 2FD2A 4KPYA 3HCXA 3LWLA 3FQKA 4G6VB 1JIHA 5J1EB 4X62J 2UUCJ 2N3OA 3MPUB 2XGQA 1PJ7A 4DL5A 1C0UB 1CJUA 3C46A 2HFNA 4LREA 1F3FA 3DOKA 2BQRA 3HLUA 4CWBA 1U1KA 2RRBA 4GKKF 1EZZB 4U67Q 2Y1JA 2IAJB 2J8SA 2VG6A 2HFUA 1HMVA 2BKOA 3W5XA 5KT3A 1QSYA 3OPKA 4WWSA 2DT9A 3DLGA 4DV1F 3GIIA 1HBNA 4OI0A 1MU2B 1BQNA 4G3IA 3J7A1 2F65A 2CPHA 5KG5A 1IKVB 1W2IA 2GHPA 2DR5A 3LGMA 2ZITA 1XN9A 1XNQF 3MCOA 3CULA 2ZZMA 4DR7F 2XSJA 1S6OA 2GV1A 3CIMA 3HHLC 2MTLA 4CLUA 1QY7A 4UUWA 2DGVA 2QTWA 4JI6J 5HVHA 5C2GA 2Y8YA 4GC7A 4ZCMA 1GX6A 1FNXH 1SC4B 2LDIA 2ROEA 4KTQA 3R5AA 1IM6A 4ETZA 1FKOB 1HI8A 2UU9F 4N5SA 2JEIA 4TVAB 3GU0A 2MLYA 2PA8D 1D1UA 4DV7F 2N4CA 2RF2A 3ZTPA 1Y11A 4DG1B 1Q81T 1SV5A 2KXNB 2NZCA 3J81Y 2HZAA 4J9PA 2BE7D 4DV5J 4DQIA 3TARA 4KC5A 3FDSA 5T7LB 3OV7A 1TL4A 2NSBA 2M3DA 2JJ4D 3ZNJ1 1XQIA 1N33J 4DPTA 5HSPA 4TQRA 1HHTP 3WBZA 4K4VA 4V19J 2XMVA 3QBCA 3UN2A 4ZA1A 4DV0F 2XWXA 3D0GE 1UP1A 2OP5A 2DIUA 5KFUA 2MKYA 1LFPA 2R3VA 2CQBA 2LA6A 2E5HA 1ITPA 2HQCA 1LQ9A 4Y6IA 1TU0B 3KLIB 1R3NA 2F9JA 2K06A 4Z7CA 1RTDA 2XNRA 3HMJG 4ANEA 4QIWD 3RR8A 3P4UB 4B9LA 5J2NB 2R9LA 3J81j 4G1QB 1N6QB 2YQ0A 4FKXA 4F4ZA 1VQ8S 2WBRA 2A3JA 2YX4A 3QRRA 4B3TF 3UPFA 4LF4J 1RAIB 3ICLA 3UDEA 5D78A 1WC0A 4RX6A 4RNMA 3OLAA 4KO0B 4ZIWA 2YX1A 2J0QD 2AV5A 3PYEA 3QRPA 1N0VC 3PJ9A 2RE1A 2F7VA 1NDLA 3W65A 3K5LA 3AQPA 1RBOB 4QOTA 4NA1A 4FF2A 1GTEA 5B0DA 4AXJA 1WC6A 3FZBA 2V4RA 2VHGA 2L48A 3V6DB 1CPZA 3TZWA 3PZPA 1SH0A 3MEDB 5F8MA 4CLTA 1DQ8A 4CLLA 4XO0A 1VFJA 5CAAA 3L7UA 1VQ7S 1T05A 3VAHA 2OH2A 3ET6A 1YJUA 2FJXA 2NQPA 1JKHB 3DOMA 2ZJPQ 5DG8A 1B0PA 3I5CA 1CULB 3W61A 3I4HX 1T94A 5CHCB 5DRKA 3VALA 3T5LA 4K4WA 3Q8UA 3RB4A 3EUNA 1S0MA 2EFQA 2NXUA 4X65J 1NPRA 3FMBA 4DPWA 5IC4B 3TAMB 2ZH5A 1NKEA 1W2BR 4QWCA 2V9WA 2GJIA 2HFZA 4YP3A 2GMJA 1JB0C 4FYVB 1KQGB 3BSOA 5GAHU 2BVZA 4NLUA 4HDGA 3MI7X 3DXSX 5KFWA 5J2QA 3EVOA 3HVTB 3J7YU 4YB6A 3VAIA 1SPBP 2RHQB 3MD3A 4IH6A 3UWTA 1S1TB 1G2EA 4QU7A 5L1LA 3IBCB 5KT4A 3OTBA 1FRHA 1V3RA 3FSIA 1XTZA 5FD1A 1R0CB 3THVA 3OXGA 2IVYA 1VK8A 3C2PA 2DNYA 3BN7A 3CCLS 1DZ5A 3PYDA 1BGXT 1UMJA 4YEAA 2DITA 4O3PA 4DR4F 1M5HA 1RQ0A 4J9LA 1JK9B 1IBKJ 5L1IA 2QLBB 5HMZA 3CJKA 4Q44A 1Z2ZA 5U47A 1C1BA 2B4PA 2V69A 4PG5A 5KG4A 4OJHA 3OJUA 1WSRA 1MN7A 1I94F 1Q8LA 2FJDB 1HD1A 4WXOA 5D8HB 1FNMA 4NMLA 2QN6B 1F1BB 3H4BA 4NA3A 2QYCA 1VC0A 1K1QA 4UOGA 1OWXA 5D4OA 5KFGA 4ID5B 1TV6B 3BR8A 5DLGA 1T95A 1CS4A 1RLDA 4UOCA 2AHOB 3PEHA 1RTJB 4CCHA 2R2SA 2HGMA 4PUOA 1Y7PA 2KRRA 4F67A 3Q8YA 4YHHJ 3CC2S 4RUHA 3Q83A 4IOAQ 4WF9Q 4WTYA 3HFKA 4YB1P 4WFYA 4Z7YA 2HAIA 2QEXS 2VOPA 2KFZA 1LXNA 2XMMA 2VFUA 3MMAA 4DR2J 1WC4A 2VQEF 2FTRA 4KB7A 3CTRA 5EWEA 1HWKA 2DHSA 4FZVA 1J2VA 4MTPA 1U2RA 2WK4A 4IR1A 4AE5A 3TVZA 3W64A 4UT4A 2F8EX 2DISA 1MW7A 1YKWA 3TEHB 3KNAA 1JLQB 4EWTA 4NXMF 1ZBTA 1Y5IB 3OL8A 5KFMA 3FSYA 4KGZB 3SSSA 4FNHA 3CD0A 5KFDA 2Q43A 2HAFA 3T3FA 1UWAA 4ZS6A 4WFZA 2BQ3A 1CSJA 4LF7F 4TY9A 1JLAA 1FX4A 2WONA 2D3ZA 2M8HA 4KSEB 3A3PB 2HNYB 5E0OA 3ITHA 3TW0A 5L1KA 1BQMB 3UO0A 3HF5A 4FP9A 3E2EA 4FYWB 4WU3A 3R5GA 1N34J 4NLRA 2ZVIA 1PILA 4YQWA 1WJ9A 4Y2IA 3MFIA 2OMOA 2HQGA 3HHEA 4A8FA 3HJFA 4UUXA 1WOOA 3PHTA 3LUYA 1JJ4A 2O1PA 1EETA 3GB0A 2QRRA 1DARA 2I5JB 2EG2A 3L9ZA 5AJ3J 3FUYA 3DLEA 3K8VA 1FRJA 2ZUAA 4PWDA 3D6TB 4H4MB 2WTFA 2P6SA 4QYZJ 2YPZA 1MMNA 1H74A 2RVJA 1J5OB 2W9BB 3NEKA 4N41A 2MXYA 2XZDB 5KT2A 4FYXB 1HI0P 5J2PA 3SCLE 2VL1A 4NYZA 4RW4B 1BE4A 5IQQA 1YWXA 2V4JA 1VJQA 5HLFB 1UA0A 4WFAQ 3H8YA 3Q2SC 2K2PA 4HVZA 2MKJA 5HBMA 4RNFA 2VPWB 3GJQB 3R6GB 2JL9A 1HQEA 3F44A 1YK9A 1UVIA 2VA2A 3TJAA 3FGVA 4IRDA 4Y2MA 3T6JA 4MFBA 2Z0GA 3MEEB 2V8HA 4ZDNA 3MM5B 2ZHBA 1NJYA 1S7HA 5HROB 4J9SA 5E3QA 2N82B 3ILIA 2H48B 4X4PA 3M30B 3N01A 5F9LA 3H25A 1NEEA 4EGLA 2XM3A 2OPSB 5DG7A 3TUPA 1SJ1A 1WEYA 4JV2A 3G4SS 2BA9A 5D0GA 2GW8A 2KZZA 3GFXA 2J9EA 2NZ4A 2FJWA 4M5HA 3DGVA 4DHVA 5G0RB 1KKHA 1DJ0A 3BREA 1PJ5A 4ID8A 3FRYA 3V4IA 4ZVPB 3M8PB 3RYLA 4G1IA 1QJHA 2K3KA 3SV3A 1H7XA 1NK6A 2EW9A 2F8MA 4KFBB 3KKFA 2B3TB 1Y4ZB 3FSXA 1GMWD 4R8UA 4X4NA 3QAUA 4USHA 4C11A 2VU5A 1PJ6A 3WQPA 1T11A 1UVLA 1CC8A 4WKYA 4JI2J 4DU8A 1YZ6A 4NASA 1TFWA 2CADA 4OZ2A 4U8VA 4DUYJ 3OHAA 3SQGA 2LQ9A 2XCAA 2UXDF 2XO7A 2WHOA 1NKBA 1HNVA 3BBFA 1R8CA 1EB0A 4F4YA 3OTOF 2CA9A 2LXIA 4U95A 4LF5J 2MKIA 4A46A 3CJ2A 2GCFA 1RTIA 3RAMA 1GXUA 3I0RB 1M1GA 2WVEA 2EFOA 1CQNA 4I68A 3HSZA 2XMJA 1NBEB 4YUDA 3GR1A 3ZFVA 4L75A 1Q7YT 4DSIA 2B43A 3K0JA 2QLFB 5IM0B 4GVBA 2R8GA 2N4DA 2DHGA 3LTOA 4F0HA 5KFIA 1S9EB 1GEHA 3VAMA 1S59A 1U48A 2XMTA 2HEKA 1DLOA 4FVMA 2R7OA 4YY3F 3T1HJ 1UL3A 3JQMA 2GHWA 4Q0BA 1TTHB 4DV2J 3SBMA 4OYOA 5DZ7A 5K8OA 1KVKA 4RU9A 1SCJB 3M2VA 1KWMA 2RU3A 2KU7A 3D7SB 1S0OA 1OPZA 4AD6A 1D9AA 2WW8A 2ZEJA 4NXNJ 4X4RA 4QWBA 3NP5A 2ZBIA 4ZPWR 3HPOA 3HSDA 3CXCR 3KWMA 2BANB 1S5ZA 3ZTOA 4WK3A 4YDDB 1UAWA 1F6TA 3FBEA 4C3KA 3NGTA 3BGUA 3ZTRA 4OYIA 1Q16B 1E6YB 2G2OA 2ROGA 4ANDA 2C28A 3X3UA 2IC3A 4EYHB 3CCVS 2L41A 3TUIC 2P5VA 2RDJA 1B64A 3C15A 2PMWA 1FT8A 1FVSA 2CJQA 2I2YA 3IWLA 1KTQA 3CJTA 3SDEA 1KOHA 3QIPB 4DCOB 4ICLB 1RBAA 5KFYA 3DI6A 4USVA 1UFWA 4H4OA 1Y5LB 4JI3F 1ZAXA 2QV6A 3KK1B 2CQHA 1IBLJ 3W60A 5KG6A 9ATCB 3Q2TC 2RIJA 2YKPA 4USIA 3Q23A 4OZ5A 3KJQB 3OXLA 4ENOA 2IMOA 2W9AA 3LF0A 3DU6A 3BO3A 2F40A 1IVZA 4DL6A 1S12A 3UR3C 3R1HA 2DNMA 4C4WA 3D2WA 1H38A 2FQQB 2OEJA 1KFSA 2ZUGA 5KFEA 1OJ4A 2FB0A 4DV3J 2FDNA 4ZPTR 2NCKL 2XEXA 2QL9B 2LA4A 4JI4J 5I3UB 2AEFA 2IDEA 2H1YA 1E6VA 3GE9A 2C2NA 2G0CA 2KO1A 2CPZA 3MM9A 3DMJB 1S97A 3K5PA 2ZNZA 1QAJA 2KRBA 2KJWA 4A4JA 1FRKA 4IOCQ 1YJVA 1A7GE 1DHMA 1BD6A 2V67A 4UOFA 4N56A 2O01C 3RR7A 5DQIA 5D0EA 4USJC 4L3NA 4WTOB 2DB1A 3T1YF 1D0EA 2ZC4A 1TL1A 3EDQB 2ZE2B 5D4PA 2JRSA 1UZDA 2BM1A 2O66A 4ECVA 1T9VA 3BV8A 3K5MA 4PQAA 2FLLA 4OYZA 2AWZA 4LR9A 2V63A 4KYZA 4OX8A 5BR8J 3I96A 2VBWA 3H59A 1V6HA 4B9SA 2GIQA 2YWEA 1SJQA 1RA7A 1MG7A 4AUKA 3OVAA 3BGRA 2XZWA 2VG7A 1BMQB 5LSOA 4RW7B 3W5YA 3HD2A 3BS9A 3GJSB 2J6SA 4DLGA 4UTGA 4OZJA 3KTQA 1RABB 5CYMA 2C2DA 1BWVA 2FJVA 2HZCA 2HNZA 5CZXA 5FDLB 5ADZA 4ECRA 2GVZB 1Y00A 4P2XA 3KJVA 2AYGA 4KKOA 2XO6A 1OY8A 4ZMMA 1O5JA 2ABYA 1VRUA 1EQMA 3GG1A 2HHTA 4BWMA 3UD4P 1NJXA 3LP2A 3GYXB 2RMLA 2DGQA 1R8PA 1TUGB 2NYHA 3ELHA 4DBQA 5ETRA 3DN9A 3UCZP 2R8JA 3BSCA 1IR2A 5EX0A 3IM9A 4X4VA 1CEZA 3G71S 4M5GA 2U2FA 1PBUA 4EBEA 2V8VA 5DDQC 2XWYA 2PT0A 1YJNS 1VMBA 3I0SB 3GMGA 1H0HB 3EGNA 3C16A 3KG4A 4KGMA 2HVZA 3KMSA 2V9KA 1TKDA 3QFHA 3JSMB 5KFBA 4KH1B 3VZHA 9RUBA 4K2JA 3DU5A 1U1OA 1SJ3P 3M8QA 2NREA 5KFLA 2DNGA 1N48A 4F3MA 2W2MP 4QJVA 5T14A 4ILMA 2JEGA 5LSRA 2B9WA 4DX6A 2EPIA 1WTFA 1YBUA 2H54B 5KFNA 2LP4A 1T03A 5F3ZA 1Y0HA 5LMUF 2YNGA 4LR8A 4NCGB 3CGIA 3ILJA 3JYTB 1S6PB 5A8RB 4PWWA 4URSA 2DH7A 1VCTA 3S1TA 3ZZUA 2MLXA 2NUUG 4RJVA 3KLHA 3PIPQ 1WC1A 2Z56B 2H9ZA 4YR2A 3AOCA 5GMDA 1NSPA 2DXFA 1RAFB 3U1MA 1XR5A 1P9YA 3HDSA 5G4DA 3IM8A 2XMWA 1SKWA 1SIZA 2Z58B 4F0MA 2CDQA 1NJIT 2GVDB 4Y65A 1UVKA 1TL5A 3EJMA 4WE1A 2APOA 2V94A 1Z2LA 1FXRA 4LBHA 1K9MT 4B3MF 1SC1B 4WYLA 5AE3A 3DHXA 1LWEA 1FERA 1SVDA 3PW0A 3HVRA 1KD1T 4ZP6A 4HH1A 2LKZA 1DQAA 3OBIA 2XSFA 4DZ6A 1VK3A 1WORA 1AZSA 3BBBA 4MKAA 1U2FA 3C6TB 5L8RC 3QGPA 1YBTA 1B0VA 3DFEA 4O3OA 1UZHA 4N77A 4C8NA 1FE0A 5KFPA 4KV8B 1JXLA 4O44B 2JVRA 4OI6A 1K73T 1I6JA 1UEKA 1WSVA 5JXSA 2BE2B 3Q8QB 2W4CA 4UOHA 1HNWF 5HI7A 1FCAA 5BYQA 1VHIA 3DM2B 3IS9B 2IM2A 1AFJA 4EO8A 3ZZYA 2YH1A 1ZM4A 4F26A 3M2UA 1XMOJ 4FBUA 4DQQA 3D6HB 1F0XA 1LW0A 2BR0A 3MECA 4JP8A 3KK3B 1C4CA 5THWA 2DEIA 3GJTB 3Q22A 3NMRA 2A1BA 4JI1F 3CC7S 3M4XA 3PW7A 4NLOA 1BXNA 1LV5A 4FNIA 2AJFE 2D9PA 2DGXA 4ELVA 3AXKA 1S49A 4ZHRA 1LK7A 1WOSA 4RW9A 4ED0A 2QZ8A 3TR5A 1EJ7L 2KHDA 3GQCA 3MMCB 4ECWA 2QE5A 3DRPA 3DGPA 3ENWA 1U6FA 1ZAWA 1U45A
chains in the Genus database with same CATH topology
3C66A 5C25B 1F5BA 4KHPF 1RDRA 3SI8A 4OX6A 1S79A 4AFFA 1R8BA 2N7CA 3ZC4A 3KK2A 4ECQA 1TL1B 2R4FA 3DM2A 4ZPCA 2YWFA 4DX8H 1VIOA 3M6VA 1N5YB 7FDRA 1JLBA 5KG2A 4K5SA 4ALZA 1IR0A 4JI6F 2X1FA 1GX5A 5B0BA 1PSDA 4KE5A 3OVSA 4ED7A 1KS2A 1S9FA 1JX4A 5F41A 1UVJA 3MM6A 2RDIA 4TXSA 2YNFA 3K8WA 3UFCX 4A8WA 2EBEA 1N5SA 2I9SA 2VASA 4Q2LA 3V4MA 3HP6A 3KYLA 3PX6A 3UR0A 4IO1A 2GIRA 2XSJB 4OZ0A 3EPGA 1U09A 2CZ4A 2OD6A 3RTVA 2R2RA 4ECTA 1D8YA 2GO9A 4X84A 1KONA 3LH2S 3VF0B 5FIIA 4BC9A 5IWAF 2R7WA 4IR9A 2FD2A 1TKXB 3DRRB 4KPYA 4BHQA 5KOWA 3POTB 4DL2A 5KG3A 3LWLA 3KK3A 3FQKA 4G6VB 1JIHA 2KT3A 5J1EB 1SXLA 5D3GA 4ZVGA 1FJ7A 4ED5A 1TZ0A 2ZD1A 2N3OA 2DHAA 3FFIA 2XGQA 4DFPA 2J5AA 4DF8A 4C8OA 1SH3A 4DL5A 1C0UB 2I38A 4PKDB 3C46A 3RW7A 2EK1A 4I56A 1WF2A 2HFNA 4V19X 2VPXB 4XAKA 1U24A 1F5AA 3DOKA 3ZZ0A 1N5QA 5I3PA 3PR5B 2FC9A 2BQRA 3HLUA 3BGRB 1U1KA 1XMQF 1NRKA 1T02A 2RRBA 1HYSA 2VG7B 5K8PA 4MIWA 1CG2A 2DCLA 4CT8A 2W8LA 2KI2A 4DV5F 4GKKF 1AFIA 1VLYA 1WACA 5I3QA 4CO0A 4ZCKA 3FNNA 4U67Q 2Y1JA 2LQJA 2IAJB 2VG6A 1SUQA 1YSJA 4I4BA 1V9OA 1TV6A 2PMZD 2YWHA 1HMVA 2OO4A 3I5BA 5M2PA 5KT3A 2FVSA 2WOMB 4QIVA 1QSYA 1FD8A 3OPKA 2RKIB 2DT9A 1H2VZ 4HT5A 3DLGA 4M5DA 1RT5A 1SV5B 4DV1F 1JJ2R 2HQIA 5CD4H 3GIIA 1HBNA 4OI0A 1MU2B 1BQNA 2Q79A 2YH0A 2HNZB 3UDCA 4DL4A 4G1PA 4G3IA 1N33F 4NCBA 2P6TA 3WC0A 3PO5A 3EYZA 1LKZA 4I2PA 2EVZA 2HLUA 1FESA 3KJVB 3J7A1 2FC8A 2CPHA 1Q7LB 3CB4A 4KKOB 3MR2A 4MK9A 2JFKA 5C25A 5KG5A 1M5VC 1IKVB 3W2VB 1W2IA 2J0XA 1C4AA 2MZQA 4IG3B 5J1NA 1WHWA 2GHPA 1NU4A 2DR5A 3LGMA 1VRUB 1N5YA 2ZITA 1XN9A 1SH2A 3QZ7A 1OIAA 1X5PA 1G7CB 1FRXA 2YVSA 2NPFA 2KG0A 1XNQF 3LP2B 2PGCA 4NLGA 3H20A 1QM9A 5B09A 5AE1A 3CULA 2ZZMA 4DR7F 2BZ2A 2XSJA 3BQ0A 1L3TA 1S6OA 2GV1A 4ZLPA 2E1MC 3CIMA 3HHLC 3RAXA 2HMIB 5KFAA 1TKXA 2ASJA 3POTA 4JYAF 2GMHA 1QY7A 5J1EA 3VAKA 5IQ6A 1ULRA 4LFBF 1O8BA 1VGYA 2AX0A 1N54B 4UUWA 2AF6A 5IS2A 2ZH3A 2QMXA 3PX0A 2DGVA 4K4ZA 4K2XA 4HTJA 2HVHA 3M32A 4RKUC 2J0SD 2R7UA 3TO8A 2VONA 4NRUA 4GC7A 4ZCMA 4QIFA 1GX6A 3U02A 4NLYA 1FNXH 2RRAA 2LDIA 2ALZA 1X5SA 4HI2A 4OJ3A 2ROEA 4KTQA 4B3SF 1FK9A 1WI6A 3R5AA 5DDOC 4R5PB 4BDPA 1LWFA 4PR6A 1REVA 4ETZA 3I82A 1FKOB 1HI8A 1SJRA 4A8SA 2UU9F 4Y2KA 4N5SA 2JEIA 5AXKA 2IAJA 2LVWA 2R7RA 1D1UA 2PA8D 4KAIA 4DV7F 2N4CA 3R5CA 2KHCA 2BXJA 2ZKTA 2WOMA 4PG8A 2RF2A 3OFEA 3OTEA 4LQ3A 2C3UA 4KRWA 4M94A 4LF4F 5CQGA 1XMBA 4DG1B 1Q81T 1SV5A 3DRXA 4M95A 3K57A 2KXNB 4BCAA 5D77A 1RTDB 3J81Y 2J8AA 1S0VA 4WZQA 2HW3A 2EFGA 4HHJA 3LW5C 1KR4A 4MJKA 4J9PA 3IG1B 4CO2A 4PPZA 5JVHQ 1FJEB 3X1LB 4K4UA 5GAGU 3OL6A 1VBYA 3QGHA 2MYFA 5KFZA 2ZH8A 2XC9A 5K14A 4DQIA 3TARA 3MMJA 4B9TA 4KC5A 3FDSA 1S72S 4IG3A 5T7LB 4EU0A 2BM0A 3OV7A 1TL4A 2AJ1A 5F0UA 2YX7A 2NSBA 1NHVA 1UEUA 2M3DA 3H2VE 4QQBA 2JJ4D 4CO1A 3M8QB 1S1XB 2FVPA 3P3DA 2VV5A 1VRTB 2HNYA 4TQRA 3NNCA 1FJGF 3BB5A 1HHTP 2C3PA 2K3IA 3WBZA 1BQMA 4K4VA 2HMIA 5DQHA 4C9DA 3PRBA 4A8QA 4ES3A 4X4SA 3CD7A 4FXVA 4H4KA 5GADU 2DO4A 4ELUA 4V19J 2KM8B 3RBEA 1UW4A 2XMVA 4PXDA 4DV0F 4ZA1A 2XWXA 5K5MA 4Y3CA 2NS1B 3D0GE 1UP1A 3C6UA 4YFUA 2CPXA 3QPIA 2OP5A 2MZ1A 2DIUA 4OFZA 2E1AA 1HQUB 1VQSA 1VI7A 3G86A 5KFUA 2M70A 3CIZA 1KQFB 1VBZA 2B5JB 4I7FB 1B7FA 2MDAA 2B6AA 3IXQA 1LFPA 1U47A 3QIDA 1MMDA 2X1GA 4LQ9A 1K1SA 2HIQA 2MKKA 2CQBA 1RGVA 1HBMA 1FKOA 1IUJA 3MURP 2DR9A 2MY7A 2Q66A 2LA6A 2E5HA 2YNGB 5AE2A 1X4GA 1FD2A 5GAGI 1LQ9A 2I5JA 4HEA9 4ED1A 3KLGA 2QA4S 4Y6IA 3AA8A 2KDOA 2PEHA 3H2UB 4RUCA 3UCUP 4A48A 3G8SA 3KLIB 1R3NA 3LP0B 2F9JA 3QAEA 1FXLA 2BW2A 2B51A 1NJZA 4DR3F 2PSZA 4PG4A 1HPZA 5EHHA 1BY9A 4TYAA 1RTDA 4MKYA 3M6WA 2XNRA 1FDNA 3HMJG 4UQGA 2YKNB 4X65F 3IG1A 4QIWD 4WIIA 2V8DA 4AL5A 3RR8A 4QR0A 1WHXA 5BYRA 5A8WA 4Y0FA 4B17A 4B9LA 5J2NB 2CVIA 2LXFA 2R9LA 3IGNA 2ZZNA 3ISNC 4WYWA 4G1QB 1DTQB 1N6QB 1VQOS 4H4MA 1KFDA 4OJ1A 4F4ZA 1S1WB 2RQMA 2M5YA 1YVFA 1VQ8S 5F3TA 4JI7F 2WBRA 2GQ2A 2Z4PA 3CMES 1SQEA 2A3JA 1KNZA 3KNGA 2YX4A 5J2MA 2AGOA 3I55S 1J5OA 5GADI 1JLEB 3W2WB 4B3TF 1R31A 3UPFA 5DM7Q 2KZMA 3ICLA 2W9BA 5D78A 1HW9A 4RX6A 1FO1A 4RNMA 4J5OA 4YB7A 3OLAA 5IZHA 2ZKUA 4K4XA 2KFNA 4MKBA 1X0FA 4KO0B 4OI3A 3OTCA 3JSBA 2BV3A 2YX1A 3U27A 2J0QD 2LU2A 3CO9A 2AV5A 2CJBA 2VBYA 2CQ4A 1N0VC 3TRGA 5E41A 2A18A 3LP1B 2RE1A 5KT5A 3J80Y 2F7VA 4WE1B 3IWNC 5KFOA 3NS6A 2RD5C 3AJ1A 2P9CA 2OAUA 3K5LA 3AQPA 1RISA 5A8KA 4QOTA 3U7JA 4NA1A 4FF2A 4AL7A 2M2BA 1GTEA 4R0JA 1HQUA 2C3YA 5B0DA 2QSWA 4NLDA 1VQ9S 2LECA 4Z2XA 4AXJA 2MQPA 2OPRB 5HLFA 2IBKA 2B5JA 4I7FA 1LWEB 3FZBA 3TQ1A 1NNDA 2CQ2A 2V4RA 1KOOA 3SCIE 2L48A 5KFHA 2HGNA 3V6DB 1CPZA 1KHVA 3PZPA 4DN0A 2ZDOA 1SH0A 3MEDB 3NGDA 5L9NA 5BYSA 2N7YA 3N5BA 5F8MA 4ED6A 4BS2A 1FDDA 1DQ8A 4I0WA 1KC8T 4XO0A 4ECZA 1LOUA 2H5EA 1VFJA 3VCDA 3GYNA 3MM8B 5HMWA 2JLEA 1VQ7S 1N52B 3KLIA 1VQMS 3LP0A 1T05A 5E2QA 3VAHA 2VC0A 4DQSA 2OH2A 4A8OA 2W25A 3V6HA 1U1LA 2PFFB 3PFEA 1NH7A 1YJUA 2QO3A 2FJXA 3CF5Q 1YJ9S 2XGPA 3OR2B 2NQPA 1JKHB 3DOMA 2KYZA 5LXRA 2ZJPQ 4DLEA 5E33A 1ZZFA 4N76A 2M4MA 1DTQA 1N6QA 3MM5A 4JI8F 1IKWA 5DG8A 3LO3A 1B0PA 4OI2A 1H2UX 5D4LA 1P1TA 3I5CA 3IR5B 1X4EA 2EK6A 5KFXA 2XS5A 4NPOA 3I4HX 4OZNA 1QSSA 1X4FA 5HN0A 1T94A 3IFEA 5CHCB 5DRKA 3W2WA 2AD9A 1XMOF 3VALA 1R0AA 2HHVA 2B7BB 3T5LA 3PACA 1HNIB 4PG7A 5HROA 4RW8B 1IBKF 4ZVFA 4C2MA 4NLPA 4K4WA 1S76D 3RB4A 1RI7A 3EUNA 1S6QB 1S0MA 4FN5A 4F25A 2EFQA 3LWMA 2UUBF 2NXUA 3M30A 4I6WA 3IR7B 2AU0A 3FMBA 2LU1A 4IFYB 2XI3A 4Q7AA 3DOLA 2U1AA 1NB7A 2DGOA 2ZH1A 2N3LA 3QO9A 3TAMB 5KT7A 3S6EA 2ZH5A 1NKEA 2OPSA 3BM7A 2K7KA 1W2BR 4QWCA 2BRLA 4OLPA 4LJMA 1TVRB 5F8JA 2V9WA 4FXDA 2GJIA 2FLOA 2D41A 3DDKA 1VQLS 2HFZA 2MJNA 2DJWA 3G6YA 4TLRA 4YP3A 2NUHA 3M2UB 4DOZA 1XR7A 2GMJA 3O3LA 4ZCLA 2NPIA 1JB0C 1MMLA 2FPHX 3ISZA 2UVUA 1Y3JA 1LW0B 3GFHA 5B7WA 1KQGB 1HWUA 1XR6A 4Y2CA 3O2IA 2FHOB 3BSOA 3TNVA 5GAHU 5G0RA 3CD5A 2DGUA 2BVZA 3TOQA 2R2UA 5B0EA 1IJFB 2R8HA 4MH8A 4HDGA 3EGWB 4NLUA 2VKZG 3MI7X 2E5JA 4EO6A 3DXSX 5B0AA 5LMNF 5KFWA 5J2QA 5CYQB 1WELA 3M8PA 4FS1A 4I6YA 1WEZA 1Z1ZA 3B78A 2RT3A 4IRKA 3HVTB 3DXBA 4YB6A 4CO5A 3J7YU 3HXMA 3VAIA 2DGSA 3FEZA 4FS2A 1Q79A 2M52A 3BDEA 3MAQA 1IBMF 2OPPB 4FF1A 3CJ0A 3MD3A 4KFBA 5B0FA 3KLEB 4IH6A 3UE2A 5L39A 2VUGA 3UWTA 1S1TB 2QMWA 1G2EA 3IRWP 4QU7A 4NZ0A 3KHGA 5L1LA 1LWCB 1FKPB 1N5TA 5KT4A 4I6AA 4ZHRB 3N79A 3OTBA 1FRHA 4MYTA 1L3UA 2JH3A 3FVYA 2IVFB 1V3RA 4ETXA 4QPXA 4DQRA 1C0TA 5E3RA 2OSRA 3FSIA 1XTZA 3PM9A 5FD1A 5L38A 3MZIA 3TANA 1BWEA 5C5JA 1JJHA 2CFXA 4HLBA 2OKQA 3GSDA 1NK9A 1OO0B 3RU0A 3SCKE 4RU2A 3IWXA 2QSFA 4F3OA 1LFWA 1P27B 2RS8A 3MHYA 5DDRC 1Q86T 3THVA 2FHKA 3FMWA 2IVYA 3OXGA 1VK8A 3DRSB 3C2PA 3CCRS 2RQCA 4DPOA 1ZPWX 6FD1A 4DR2F 3G6VA 2AYBA 2DNYA 4PUOB 3CCQS 1U6ZA 3QWUA 3BN7A 3CCLS 4DUZF 1YITS 1DZ5A 1S48A 4NLQA 2UUCF 3KK2B 2BDPA 3TAMA 3H5XA 1BGXT 5GAHI 3LAKA 1UMJA 1X4HA 1S99A 2E9ZA 4YEAA 2DITA 3F56A 1FHTA 4KJIA 1TVRA 3M6UA 3G9CA 1DAXA 4O3PA 1KQKA 4KQZA 2PI4A 4TU9A 3MM6B 1ZPVA 4DR4F 1BLUA 1M5HA 1Q78A 2HHHF 2DCUB 1RQ0A 1R27B 3ZZPA 1IN0A 2KB2A 1U26A 4IG0A 1R43A 2VFSA 2CG4A 2WAQD 5AXNA 1JK9B 4J9LA 4DV6F 3BR9A 1H6KX 2NR0A 3J7YI 4CT9A 1SJ4P 1R8AA 5L1IA 3MMAB 5HMZA 5HMXA 2PDAA 3CJKA 2E5IA 3V5RA 4Q44A 2E9TA 1Z2ZA 3HZEA 5U47A 1C1BA 2UP1A 4ERDA 4CQ1A 2B4PA 4Y28C 4IH7A 4PG5A 3US5A 5KG4A 5DETA 4OJHA 4Q5VA 3OJUA 2G4BA 3FFIB 2MZJA 4NYOA 3NNAA 2DNLA 2F3JA 3B4MA 1I94F 3I0RA 1Q8LA 2FJDB 1HD1A 4WXOA 3HVTA 2XNQA 3I9ZA 5D8HB 2BRKA 3N4WA 3CCSS 3CCJS 2R7TA 1FNMA 1YG0A 2YNHA 3PR4A 3R1LA 2ZJQQ 1X9WA 4NMLA 2AP6A 3H4BA 3CCMS 1VBXA 1NHUA 1JLGA 4OL8A 3BF4A 4NA3A 2QYCA 2YTCA 4LFAF 1VC0A 3N6MA 1K1QA 2XHWA 2ZH4A 5IM0A 1OWXA 5B08A 1I1GA 5D4OA 5KFGA 1LWCA 1FKPA 1N5VA 2VG6B 1SUQB 2ZC3A 4ID5B 4EFAC 4YR3A 1TV6B 1HMVB 1JXEA 1JLFA 1URRA 1WD6A 2DNOA 3AB4B 4DMZA 3BR8A 4OZ1A 5DM6Q 3K59A 1GTHA 3PJWA 1SBRA 3TA0A 1KN6A 3IRXA 4MAKA 4B9VA 5DLGA 1T95A 2VPZB 4RWWA 4C0BA 4M5DB 1RT5B 3MEKA 2CQGA 2GNKA 4PQUA 4Q43A 3QGIA 1HBNB 3M6XA 1RT2B 1BQNB 4UOCA 4DSFA 4W90B 3HVAA 3MUVP 4ES1A 3PEHA 1WWHA 3RAQA 4DS4A 3D1QA 1RTJB 3TP2A 2OJ3A 4I2PB 3CJ3A 3TA1A 4B02A 2R2SA 4BC7A 4CCHA 1FRLA 2MJUA 5KFTA 5I4MA