1B64A

Solution structure of the guanine nucleotide exchange factor domain from human elongation factor-one beta, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
91
structure length
91
Chain Sequence
MLVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Guanine nucleotide exchange factor
molecule keywords ELONGATION FACTOR 1-BETA
publication title The solution structure of the guanine nucleotide exchange domain of human elongation factor 1beta reveals a striking resemblance to that of EF-Ts from Escherichia coli.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 1999-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b64A00
4NXNF 1N36F 2YY3A 4DV0F 4JI3F 4JI4F 1IBMF 4B3SF 4DR1F 2F4VF 4DR3F 4OX9F 2UXBF 4YHHF 1N33F 1QJHA 4DV6F 4DV7F 4JI1F 2UU9F 1LOUA 3T1YF 1N34F 4LF5F 2KJWA 2UUAF 1XNRF 4B3MF 1HR0F 4GKKF 1HNXF 4DR5F 4JV5F 4B3TF 4YY3F 4LF4F 1IBKF 4KHPF 1XMOF 5BR8F 4DR2F 2UUCF 1HNZF 1I94F 4LF9F 5IWAF 2BVZA 4LFAF 2UUBF 4DV3F 4JI7F 4LF6F 1IJFB 4X62F 2E5LF 1J5EF 3R3TA 3ZZPA 5LMNF 2VQFF 3OTOF 5AJ3F 4DV5F 4LF8F 1FJGF 1XMQF 1XNQF 4B3RF 4LFCF 2ZM6F 4JYAF 1RISA 4JI5F 2B7CB 2J5AA 4X66F 4DV1F 4NXMF 4GKJF 1HNWF 4DUZF 2UXDF 4DR4F 5LMUF 4DR7F 3T1HF 4JI2F 4LFBF 1CQMA 1G7CB 1B64A 1CQNA 1IBLF 4DV2F 4X64F 2VQEF 1F60B 2KJVA 2B7BB 1GH8A 4AQYF 4K0KF 1IJEB 4X65F 4DUYF 1FKAF 2BXJA 4DV4F 1G1XA 2UXCF 4JI8F 1VMBA 2RJZA 4JI0F 4JI6F 4DR6F 2HHHF 4LF7F 1N32F
chains in the Genus database with same CATH superfamily
4Y3CA 4NCAA 4QW8A 3LP0A 1R0AA 4IQMA 2KYZA 2XMAA 3MFHA 5DGAA 3MECA 3LALA 3U27A 3NGDA 1FRXA 3JAMU 1TUVA 3HFKA 3W64A 1RKIA 2XSFA 4PXCA 2J0WA 1RT4B 2KG0A 2E66A 4B08A 2WRMA 1LK7A 3QLHA 5DLGA 4FKYA 5KFGA 2RAQA 1HBOB 4TLQA 2YTCA 4DV0J 3I0RB 3OSPA 1W7WA 1HW8A 2E9RX 1RHQB 2CJYB 1GNKA 4WTYA 3B78A 4CI0B 2Z30B 2WB4A 3LOUA 4F50A 2JHEA 2VKZG 2W8KA 5F0WA 3A12A 2N4DA 4LVNP 1FRLA 3GG1A 3IRXB 3DGPB 1VBYA 4DOZA 4LJMA 4X4UA 1VIXA 1FKPA 1NK6A 4KGZB 5CD4H 4TXSA 3G87A 2V8VA 3Q2SC 1TFWA 1Q7YT 4DV6F 4MIWA 4R0EA 2M8DB 4U95A 3OL6A 1B0VA 4USMA 2W9CB 2IIHA 1U49A 3TUJC 3S1TA 4A8XA 5G0RA 4PYDA 3Q86A 3J81j 3A3PB 2ZDPA 3U1NA 1JKHA 2JLFA 2UUCF 3DMJA 4G6VB 3RW6A 4Y6IA 4ECZA 4DJBA 2HAFA 2CPDA 1FE4A 1IJFB 2J6TA 2DPIA 3KJVB 1R8BA 3KG1A 5K8OA 1RU2A 1GT8A 6FD1A 4FYWB 2W1BA 2V4RA 3I5BA 5DRKA 5GMKa 3VZIA 3QGPA 1HNIB 5EX3A 4Y2AA 5KFUA 4LSNB 3KLGA 4MKAA 1F6TA 4C98A 1YKWA 2V4JA 2MQLA 4ZPWR 2J9DE 1S1VA 2EG1A 5LL6d 3RG6A 1PAEX 4RWXA 5KG6A 1FXDA 3PNIA 3TX0A 1G6BA 1GMVA 3EDQB 3VAMA 4C8LA 4YMEA 4AYBD 2W9BA 2MGZA 2IAJA 4L3KA 2MKIA 4P52A 3LGNA 3ILIA 2VL1A 1WSRA 2X51A 1LXNA 4YEAA 2HK2A 2GW8A 4A8QA 3CD0A 3R2CJ 2F4FA 3DRSB 2RDJA 4TU7A 4OL8A 3GSDA 2DNOA 1RAIB 2FJDB 4M5JA 3HJVA 1YRUA 4CO3A 4LF8F 3UD3P 1UVLA 3HVWA 3TQEA 2MKCA 3I31A 1DAXA 5H9EK 3ZTRA 4F4AA 4Q0BB 5KFCA 1NEEA 3OXGA 4LFBF 3Q8RB 1B64A 2BJ7A 3TO8A 1SCJB 1N8RT 1ZBTA 3FBFA 2R7WA 2JJ4D 3LP0B 1R0AB 2YQ1A 3IGVA 1LEOA 3MECB 3UDLA 4DI6A 2R3VA 3TW0A 2H5JB 4K5SA 3Q8UA 2YWKA 3M6XA 4G1IA 4NEZA 2NCKL 4ANDA 1WDTA 2ZHBA 2YQ0A 2OI2A 4FXDA 1PG5B 4AL5A 3C66A 1T9VA 1NHVA 3IBWA 2HQFA 1Z2LA 2DR5A 2IJRA 3ZFVA 1RWXB 3SBMA 3QLHB 1SL2A 1IQTA 1Q1KA 2WVCA 3CMQA 1TAQA 3PDNA 3K7RA 2Q43A 4Q8EA 2P9CA 5EUHA 3H90A 3V81A 3EXYA 4OLPA 2DHAA 4PAAA 5SUHA 3X3UA 1VQLS 2C28A 2E5IA 2IM0A 4ES1A 4FZVA 4DR7F 1TQLA 4D3GA 1RHMB 1MSWD 1UEUA 3SCJE 1FKPB 2DNMA 2XO7A 3I0SA 5DDRC 1CC7A 2CJXB 2V0NA 4Y2KA 1Y5IB 3R5BA 4DU8A 1FDNA 1TMJA 5G0RB 1EP4A 1P1TA 3QJPA 3RBEA 2MKKA 4FKXA 2F1FA 3IWLA 3DMJB 4KRWA 3O2IA 4LF2A 3IM8A 1BWEA 2VIHA 2DNRA 1URRA 4TQSA 4ELTA 3IG1A 1BY9A 1MU2A 2LQ9A 1U48A 4OZ5A 3CO0P 4OX9J 3DGVA 1NM2A 4IH7A 4ZDNA 2HBQB 3BZQA 3CVKA 3PKMA 3PO4A 3W8PA 2W4CA 3NMAA 2VDIA 3W7BA 2FVCA 1NB2A 3TA0A 3KLFA 5SZTA 5E33A 2EG2A 3KLGB 4DR4F 2V4JB 3C19A 3KHGA 3OHBA 2G9OA 1QVFR 1SQFA 2VH7A 2WONA 1S1VB 3MUVP 1AA1B 1QUVA 1AFIA 1WF0A 2A1BA 1XMBA 4Q2LA 5HMYA 2FY8A 1U45A 4ZVUB 3M8WA 2WVEA 2XMTA 2N3LA 1OSDA 4RW6A 2W9BB 3MM8A 2MGZB 2IAJB 1SKRA 3OBIA 2XY6A 3W62A 4ETXA 4GRSA 5KAKA 2E5LJ 2VC1A 4EGLA 3L7UA 2ZH5A 3SV3A 2AIRB 4P9SA 1XMQJ 1D1UA 3CJQA 2HHVA 4OJGA 2CA9A 3MF5A 8ATCB 3PFOA 2VASA 1HHSA 2IVFB 2Y1IA 5KT3A 1H7WA 3R8YA 5A8KB 3PJWA 4IQXA 5FIIA 2HS3A 2F7VA 2W2QP 2R7OA 1UPPA 4HR2A 5KG1A 2LDYA 1PYOB 1VR6A 1D9DA 1VQ7S 2XHCA 3M8YA 1TV6A 3IA0A 4WP8A 2IRYA 4EYHB 4K4SA 1EETB 3LO3A 2HFSA 3VAHA 3OR2A 3VGSA 1NK9A 3OJUA 3IMQJ 5T14A 2VPZB 2K1RB 3NNCA 1HNZJ 2IC3A 4PCQA 1E6VA 4GKJJ 1TAUA 3QT5A 3C14B 3MM5A 1FRIA 1IBMF 1T03A 4YHHF 3MPYA 4ED1A 1CJUA 5LSLA 4ZA1A 2HG4A 5BXIA 3T5KA 4LF5F 4QOTA 4MIAA 2UP1A 2UZAA 3SSQA 3RAQA 1CLFA 3CB4A 5IFMA 3VVTA 2JL9A 2U2FA 2XHWA 2AX1A 4JI2J 3NS5A 1Y9OA 4OI4A 3TQ1A 4N77A 3R6GB 2RHQB 1HI0P 4F7VA 1RTDA 1RKJA 2QYGA 3GJTB 2DXFA 2CQ3A 2UXCJ 3R5AA 4YY3J 2IA6A 2CQ1A 3ZZYA 4HYKA 2VFSA 3AD8C 4XDCA 1XNQF 5LXYA 1KONA 1S1TA 4MAKA 1F2HA 3KDNA 4TY8A 1UW9A 3MCMA 3CCVS 2ZKTA 1WKLA 3OVSA 1CQMA 4PPDA 3G71S 3I0SB 1UTAA 4B9VA 3EZ5A 2Z2YB 2BUNA 4FBTA 3MEDB 4NLXA 1EP4B 3OVBA 2WB1D 3G86A 4WZQA 1S1XB 4LIRA 1T0TV 1KFDA 2OMOA 1SH0A 1RT5A 2K7KA 1QAYA 4RBVA 2DY9A 1FJGJ 3QFWA 2DYAA 1Q86T 1MU2B 2O66A 3BSCA 3BO3A 2OLWA 4DL3A 3SMZA 2E5GA 4K50A 2OPRA 4DFMA 2VZ9A 3PYFA 2J9EA 1RWUA 3KLFB 2G1HA 1R6YA 2WONB 1Q16B 4WIIA 3HPOA 4H4KA 4PABA 2C3OA 2E1RA 2F4VJ 1WTFA 2B9XA 3HJFA 3GV8B 2VPXB 3GG0A 1BD6A 1RAEB 2LFVA 1PO6A 4DZ6A 4UUXA 5B7WA 4RW6B 3MM8B 1LV5A 1H7XA 2DCUB 2YX1A 4X65F 3F56A 3V2UC 3I6PA 2N7YA 5D6GA 1ULRA 2ZKUA 2IMWP 1LFPA 3GILA 1WG5A 3W3SA 4ECVA 3IAS9 3KNGA 4BDPA 2PSZA 2UVVA 1Q8KA 3TJ8A 4IRCA 1WF2A 1UVIA 2KT5A 3E2EA 2M88A 5C24A 1RAFB 2R7UA 2AWZA 5KG0A 5KT5A 3SQOP 1ZA1B 5KFRA 3LA0A 2R42A 2XTJP 2KM8C 4MK7A 3ENAA 1IKWA 1ZH5A 1RTHA 3IR7B 1NLKL 4OQJA 2V2ZA 3OXFA 2HHXA 3NGKA 2BJ3A 3OFFA 1N5VA 1TV6B 2HWIA 4LF4J 2DGXA 1IM6A 1V9OA 2CJBA 4DR1J 3VGTA 3OR2B 3KLHA 3CGIA 1RP5A 5CAAA 3EXCX 1K8AT 2JLGA 3H2LA 2IC3B 1D9AA 3MM5B 1P1LA 3M8QA 3LANA 2HURA 4QBUA 1T03B 2O1PA 4I69A 1CJUB 2YKAA 5AXMA 1NDLA 2HZAA 3GWCA 2RU3A 5CHCB 3PR5B 2GQ2A 5GAGU 2RRBA 3A13A 1ZOTA 3NRBA 4LUBA 5B0AA 3BKUA 3G4SS 1TTHB 4DF4A 1T3OA 3DXBA 2O01C 4JV5F 3EWGA 5HK4A 2NSCA 2ERRA 5K8MA 4C8YA 1LW0A 2O5DA 4USTA 3QNWB 3UWTA 4CLUA 1VBXA 4O23A 1WHXA 3JTNA 3R7NB 1S1TB 4TY8B 2I5JA 3RRHA 3KWMA 2HHHJ 2OPQA 3ZZ0A 3ZTSA 1DHMA 1ZZFA 3H20A 4V19X 5HMWA 1S99A 4NLPA 3QO9A 3MUMP 2IMOA 3KJFB 4CRJA 1HNXJ 3BGRA 1HPZA 4DN9A 5KFFA 3RB6A 2DITA 3M2UA 1RT5B 4ZOSA 2PT0A 4W4MA 1N88A 3AD9C 4MH8A 5IOLA 4JI4F 1K0TA 1R0BG 4PR6A 3DU6A 2C3PA 3D0GE 4P72A 4O3NA 5AT1B 1CJKA 5HN0A 2OPRB 1OWXA 3GSIA 3M05A 2FJVA 3OXLA 1UVMA 2C2DA 2DRDA 1FNOA 2V9WA 2C2NA 4EBDA 4DV2J 1HI1A 4KFBA 2LVWA 3CJ3A 4LF1A 3NG8A 1OPZA 5J2NA 4R8UA 1NHKL 3T19A 2RILA 3LWLA 1WEYA 2ASLA 2RF2A 4HTIA 4WXOA 2XULA 4HEA9 4F0HA 4J9KA 1YLXA 2UUTA 1VYAA 2MHEA 4CO1A 1NDPA 2F63A 4OYOA 4MK9A 5AE1A 3P96A 5C42B 4AL6A 2IVMA 4DMZA 5ETRA 1I1GA 5C24B 4JI3F 4DSIA 1UWBB 3N0VA 1KEKA 3JQMA 3QYYA 1R8HA 5LMNJ 4RUCA 1SV5A 3V6HA 3UD5A 2M8HA 2XYGB 2AEFA 1VRTA 1IKWB 6AT1B 1RTHB 2FTRA 3GLJA 3EVOA 3NAHA 2B5JA 3SIPB 4PG6A 5JJBA 4CLTA 4EZ9A 3AHPA 4F36A 5M2RA 3KLHB 4NYPA 4KGKA 4B3RF 2AGPA 1NKCA 2DT9A 2PI4A 4B9NA 1Q53A 4WE1A 4DL4A 2R7RA 3M8QB 2PGCA 2VHGA 3UD4P 3A3NB 2BW2A 1QE1A 3CD6S 1O0PA 4F4ZA 2LEPA 1XMOJ 3V5RA 4DUTA 2C2EA 1VMBA 5D3GB 3PEJA 1HWIA 2H9ZA 1FX4A 1UVNA 3ITHB 1VS3A 1NK7A 4JI1F 1LW0B 5IT9Y 2GZOA 1X7VA 2XYPB 4OYIA 2QV6A 1U1OA 1IBKF 4TLRA 2AJ1A 2QGFB 2DISA 1B4SA 4ECXA 2I5JB 3K5PA 3W5YA 1BUXA 3JYTA 1FT8A 2P8IA 3HMJG 2OPQB 2QFJA 1P27B 2R2UA 5AJ3F 3QO9B 4KQZA 2XZDB 3G9CA 4NXNJ 3C6UA 3L7OA 1DLOA 4DUZF 3RB4A 1FKOA 3BGRB 3DOMA 1HPZB 3M2UB 1NSPA 3TUPA 4UY8T 3TAMA 2YPYA 1RAOA 2C2RA 2FZGB 4LRDA 2Z0GA 3FJ2A 2M5YA 4M5IA 2FLLA 1PC4A 2EBEA 4P74A 5LM7E 2ZDOA 1BC6A 2C3UA 1CJKB 1VQ6S 2UUBJ 1P9YA 1L5UA 2NXEA 1FI4A 2VQEJ 4L72B 3ZNJ1 1VQYA 3H98A 2Q3PA 4KFBB 5HI7A 1TL5A 3EZUA 5J2NB 2V67A 4R8UB 4G3IA 2FZKB 3W60A 5B0FA 1S10A 5HMXA 2HRUA 2RF2B 1DRZA 4U7CA 3FEZA 5E3AA 5IV3A 5A8RA 2ZUAA 2QIFA 3K58A 4LRBA 1JLCA 4NRUA 3J81U 1R43A 2YPZA 3PV8A 1YRTA 3HFVA 1KRPA 2W4DA 5IT4A 1FCAA 2RNEA 2ILYA 3MOJB 3SV4A 4M94A 4LR8A 3MUTP 3BEGB 4AXJA 2RRNA 5L1IA 3DLLQ 2FHMA 3OT9A 2VA2A 1U2CA 3BKFA 5GAHU 2X3GA 1VQ5S 2W01A 2R8KA 1AYEA 4JV2A 3C2PA 3K0JA 2HVHA 2MYFA 2KT2A 3PW7A 4OYWA 1DZ5A 1M1KT 4O0IA 1K73T 4LSZB 5A0YA 2CPXA 3P5TL 2K7JA 1QSYA 1QLNA 4DV3J 3JSMA 1VRTB 3C16A 1KQFB 3GZ7A 3I96A 2E29A 1NRKA 3UE2A 2K06A 3HHDA 3QBCA 3TYTA 1QM9A 3TA1A 1P8GA 2OEMA 1CPZA 2YX7A 1OY6A 2WW4A 2ZJRQ 3QATA 1NPKA 5FD1A 4W90B 1BLUA 1RA6A 4TNOA 3QGGA 3BQ0A 2V69A 2QA4S 1KD1T 1WD6A 2V2KA 1XN9A 4AQYJ 2YWHA 2FVSA 2G2YA 1TVRA 5J2QA 2AHOB 4RNHA 4JI8J 3LGHA 4WE1B 1IUJA 2IDEA 2XQCA 4OMFG 4B3OA 5IV4A 2L9WA 2Z2ZA 4G1PA 4O0NA 4PG5A 4RLEA 2R7QA 2UXBJ 1QE1B 1GK8A 2UVWA 4DV7J 2EKNA 1AW0A 5K8PA 4ECQA 1PSDA 3RAMA 3QIPA 3THVA 2R2RA 3DRPA 1UFKA 4QZVB 1WG4A 2BJ1A 4JI0F 1KQGB 2ZZMA 2UXDJ 4A8SA 4X62J 3WIVA 4R5PA 3QSYB 4DCPB 2QFIA 1XK8A 3GE9A 1U6FA 4YDXA 1D0EA 1F9FA 5B08A 3DCAA 4OYZA 3HVRA 1HNWJ 3T5HA 1PKUA 7FD1A 1WUUA 3JYTB 3K59A 4PXBA 2JZ5A 3HZGA 2V94A 3M6UA 1JIHA 2F8HA 2VD3A 3C6UB 4WKYA 3DLJA 3LUYA 1J5EF 4RUBA 2KG1A 2XSJA 1FKOB 2NQPA 3DOMB 4WXWA 1GX5A 1RISA 2CQGA 1EAYC 4LIWA 2X7IA 3W1YC 1H38A 1DARA 4OX7A 1MNEA 3ZTPA 2ZUGA 2UU9J 3HO1A 1FJCA 5A2QY 1N5YA 2Y0SD 1QTMA 4KT0C 2W7AA 2UUAJ 2Y9HA 4Q8FA 4AUKA 1B7YB 3W8GA 5GADU 2R8IA 2MZJA 1RT2B 4FYDA 3US5A 3FEYB 2A18A 4DL5A 4DV1J 4U67Q 2GJ2A 1B0PA 3BN4A 3RU0A 4HACB 3EUNA 1N6QA 3W2WB 3CE8A 1SQEA 2X1BA 1LWCA 5K5MA 4B9LA 2EFOA 5A8RB 4XDDA 3BF4A 2BX6A 1SQGA 1ZTWA 2EPIA 1JLCB 3ILLA 5KFDA 1OIAA 4WKRA 4S0MA 2OMLA 1XJWB 2ROGA 3VGUA 1YBUA 3NCPA 3NBPA 1TKDA 4LR7A 3N6LA 4F4WA 2OELA 2F40A 4XIUA 2DBBA 1CBKA 1A6LA 3MFIA 2JSXA 2XLIA 2CWKA 3UQSA 5A0YB 3LAKA 3PEHA 3GR0A 1UJ5A 4YQWA 3K5LA 3KTQA 3MEGA 3C16B 3JSMB 1NK0A 2GQCA 3P8BB 1YIJS 2B0GA 2V50A 4LF7F 4JBCA 1R89A 5F41A 1N48A 1XBWA 2FY1A 4IG0A 2PC6A 2HSEB 5KFEA 3CJRA 4QIEA 2BKNA 5DG8A 3TR5A 1SL0A 4DXLA 1RQ0A 2EBGA 3BBFA 1FFGB 4OHWA 1OSCA 1TVRB 2CQIA 5E41A 2Q6BA 3O5TB 1Q7LB 1JJ2R 2CQDA 4PG7A 1RBOB 2OFGX 4B3OB 3BREA 1YX2A 2WSFC 2V34A 4DSKA 3OTOF 3CJSA 1XQIA 4F4KA 3G8TA 3M9MB 1PJ5A 1VQNS 1GMWA 3QIPB 1W26A 1C0UB 1PJ6A 4CCHA 4NLWA 2ZE2A 3AJ2A 2ZNZA 1U09A 1JLQA 3ZXWA 1Y10A 5CYQA 2FZCB 1EB0A 4ED4A 5H9FJ 1Q95G 4XPCA 1Z2ZA 4WFNQ 1QY7A 4DR2J 4JV0A 1TELA 2ZEJA 5ETNA 2EK6A 4R5PB 3GV7B 3MPVA 1UPMB 3DHXA 4CO0A 1N32F 4I6AA 2OJ3A 2H3EB 1U1KA 2DRBA 2XGQA 3MPUB 4YB1P 3M2VA 1JJCB 4M5DA 2N3OA 1RLDA 2ZBIA 1YJNS 4F25A 2VBXA 5I42A 4RZRA 1HA1A 3PG9A 2DNYA 1OY9A 1FVSA 1KVKA 1FD8A 1T05A 7FDRA 1YVFA 4HDGA 5DG7A 3MEEA 4B02A 3FNNA 2DR7A 1U0HA 2MQNA 2XSJB 4ZPVR 3AJ1A 2LQJA 5I3PA 3VAGA 1SH3A 2C2MB 2GS8A 1N54B 4QWAA 2GA7A 3R3TA 2HQDA 2LA6A 3M30A 1N5YB 1H74A 1DQ9A 4YB5A 2DCLA 4CIOA 3RRGA 4PWWA 3LWMA 1HL6A 5KFNA 1FRJA 1JX4A 1FXLA 2QLFB 1S7IA 1WC4A 3CIMA 3IM9A 3CCES 2BKOA 8AT1B 1PYSB 4CQ1A 2B8PA 3UNYA 2BYCA 1JLEB 2HBYB 4ZPDA 4W92B 1RTJA 1RBAA 3HD2A 5LT5A 2BABA 2G0JA 1I6JA 1U2RA 5DDQC 4UY85 4ZVFA 1FWKA 4P2SA 5D15A 1F9EB 1ROFA 1VJWA 5KFQA 4NXMJ 4RNMA 2GX8A 3TVYA 3CCSS 3H4DA 4F3QA 1H2TZ 1CJVA 1FRHA 3NWGA 1IBLJ 4X64J 1IBCB 1JLFB 1YZ7A 3S6EA 4MK8A 4TU8A 2YKQA 4JI6J 2FHKA 1XR6A 4E2FB 4C97A 1NO8A 5KFLA 3N5BA 4OYXA 4GO7X 1AROP 4PWUA 1YWXA 5HVGA 4OZ0A 4BWMA 4Z2XA 2G2OA 2CJ9A 3UDCA 1ZM2A 2WVDA 3MEGB 2PFDA 4A47A 1ZETA 1B99A 4M95A 4V1Ak 1JNZB 3KK1A 3T3FA 4CLSA 1RZMA 4IG0B 3ZZOA 5IWAJ 1OMSA 3BR9A 4ECUA 3CXCR 3CCMS 4OX9F 3JSRA 5KG7A 3Q8QB 2HGMA 2QL5B 1CSJA 2QA1A 2LA4A 4ZP8A 3FRYA 3Q23A 2AEJA 3MAHA 3CJ4A 4FYYB 3MR6A 3HHLC 5T41A 2DEJA 2ZITA 4RO0A 1Q8IA 4LT6A 4CLZA 3OUYA 2NUHA 3BSNA 2IPOB 2CNOB 3QZ7A 4PQUA 3GQCA 4I0WA 3HM9A 5HQMA 3SCKE 2FC8A 3SCLE 4B3MJ 1FJEB 3KUHA 4A8FA 2ZE2B 2JVOA 4PKDB 5KFJA 4CM0A 1JLQB 5KFWA 1V5IB 3I32A 3DDNA 1M5VC 2MQQA 5CYQB 2DB1A 3KG0A 2HWHA 2NR0A 3J7ZT 2KU7A 4TKTA 2IM2A 1J27A 4NLGA 2V2QA 1FD2A 5D8HB 4DQSA 3MMBA 2CQHA 1RT3A 2GMHA 3MR2A 4KC5A 1QSLA 2NSBA 1HQUA 4M5DB 4QPTA 3DFEA 5DDPC 3D6MB 3GJRB 3V6KA 1ZM3A 4DR3F 5I42B 2B4PA 4USJC 5DJBA 1DURA 3AB4B 3PXGa 4DSFA 1FHTA 3TJ9A 1T05B 1LK5A 3MEEB 2D9PA 2HS4A 1S1WA 1QVGR 1OY8A 1EHWA 3CWJA 2DR9A 3UPFA 5HJYA 4UW2A 3HFZB 4N8NA 2CJQA 3CT9A 4ZMMA 3M30B 1LWXA 3TNVA 4I67A 4DUYJ 5HP1A 4URSA 2X1GA 3BSOA 2X1FA 4WP3A 2DNNA 3EGNA 1R3NA 2R8HA 3DOKA 4GKJF 2D69A 5KT4A 2AZ3A 1WORA 1U24A 3EGWB 1RAGB 1NU4A 3T1HF 2QE5A 4Y0FA 2IDLA 1VRQC 2B7BB 5HSPA 1RTJB 2OHDA 4C8NA 2HHPA 3OPKA 1RT7A 2RVJA 2ZC3A 4FF3A 4L76A 3RB0A 4CDIA 2KYXA 4DFJA 1N36F 1JNRB 2MLYA 2ZC4A 2MZSA 2JLEA 3CSKA 1SJQA 1J5OA 3CJTA 4E0DA 1IVZA 5DO2A 1CJVB 1CEZA 1C2PA 4DSEA 4YY3F 4KPCA 1SJ4P 3Q8YA 2BKPA 3VVUA 3AXKA 1TKTA 5ETTA 3IWNC 3KHLA 4QYRA 1Y4ZB 5D77A 1U26A 3DLKA 3R1HA 3AOBA 3ETOA 3SSSA 2QA2A 1SC1B 3RBZA 2NXJA 2J0SD 4NLSA 3MM7A 2B3TB 3R5GA 4DV6J 5DLFA 3D0IE 1RLCL 2E7VA 3ILOA 1RGVA 1JMTA 2E1PA 2ZJQQ 4DFPA 2CWXA 4QR1A 1RTIA 3LH2S 3TWZA 1UMJA 2VONA 4DX6A 2UUCJ 2WBMA 3CJKA 2VFRA 5HATA 1SJFA 3H4BA 4JV1A 4RW4A 4A46A 3HKWA 3MMCA 3M1VA 4CP5A 3I55S 3K5MA 3RW7A 3OUYB 2F9DA 3PW4A 5CCMA 1RA7A 2L48A 4PQUB 2XNRA 3J7YI 4J91A 3H5YA 3KK2A 2VC0A 3PX6A 2PMHA 4LFAF 4DSJA 3MPDA 1MW7A 1S79A 3GIRA 1R27B 5JUMA 4AT1B 3IXQA 2EKYA 1NHUA 2LXUA 4Y2MA 3HSDA 2QMWA 2YQ3A 4DEZA 5IZHA 2KFYA 2MKHA 3LPEA 1HIYA 3QJJA 1AFJA 3WQPA 3MMBB 3J80Y 1RT3B 4F67A 1HQUB 3NEKA 2UUWA 3UDEA 2ZH6A 3DOLA 3PIPQ 1MLAA 1PIEA 1KWMA 3VALA 2FJEB 4EEYA 4EUVA 4EMDA 4ED3A 2J6SA 5ETOA 1VC5A 5A8WA 1VC6A 5I4MA 5J2PA 3R9LA 2ADCA 3DXSX 3LW5C 3M9OB 2VBZA 1HBMA 3PRDA 4LF8J 2KRRA 5E3PA 1SC3B 5EHHA 3QT8A 4LF4F 2GHWA 5F8IA 1WKKA 4NZ7A 6FDRA 2D3UA 5HP1B 4LFBJ 3MR5A 4ANEA 5HL7Q 3ZTQA 2X1AA 2CPJA 2FVQA 2WTFA 1VQ9S 2D7SA 2CQCA 3MMAA 4JI7F 4K4VA 4F8RA 2IM1A 1H0HB 3G6ES 3V6DA 2NPIA 1U1RA 1UFWA 4RPFA 1F3FA 2G1DA 4J9SA 1L3KA 3DHWC 2A3JA 2KXHA 4URQU 1B0TA 3JQKA 2HNDA 3Q24A 1U1LA 1N5TA 2DIVA 3G8SA 3QFHA 1RT7B 3VR1A 2ACYA 4B17A 1GH8A 2RQ4A 5IM0A 4OZNA 3OR1B 2BE7D 4UTGA 5M2UA 2P5VA 1U7LA 3IAM9 1FVQA 1S76D 1J5OB 2N4CA 2WVFA 3GMGA 3UI3A 2GVDA 3BPDA 1TKTB 2XB2D 3KLIA 2CG4A 5AE3A 1NXIA 2BV3A 4DZDA 2DGUA 5THWA 2M70A 2AJQA 2H4WB 4DR7J 3CF5Q 1D3WA 1JLAA 1RSCA 1RCOB 1AB8A 3B8HA 3N4WA 3LP2A 1DTTA 3KDOA 1PAUB 2Q1LA 1QAIA 3MM7B 4ES3A 4QW9A 5EWEA 2KM8B 3DLBA 5FJ4A 2MJNA 1NK5A 2I6WA 1JB0C 1ICEB 1RTIB 3LAMA 4C8KA 3AB2B 3E8OA 2XWXA 4IUFA 3HHNB 1VK8A 1CQNA 3EX7B 2LKZA 3CJKB 2FUG9 3F0NA 2ZH7A 2H48B 3BGLA 2NLWA 2VG6A 2VBYA 3BQ2A 4RW4B 3FMWA 2Y1LB 2F9JA 2H4YB 2VB6A 3AY0A 4X66J 4LRAA 5HAOA 2ZH8A 2RD5C 1YRXA 3V4IA 2LQ8A 3AA9A 3MMCB 3M1VB 3QJLA 1RHRB 4KYZA 2E7XA 4X4SA 1T9XA 1VLOA 1FDAA 1IQZA 2JEGA 5KT7A 1HR0F 4ZCMA 4HHUA 1T94A 2FJAB 3KK2B 4CO2A 4DR4J 4ID5A 5F8MA 4IO9Q 2YWWA 3I9ZA 1UVJA 2XYHB 4OZLA 3D6FB 3VHQA 5D4LA 3GFHA 5F0UA 4CZCA 4B3SJ 4F4YA 3MI7X 3ZC4A 2KXFA 4O3PA 5GAGI 3BSAA 2AF6A 2XCPA 1S57A 2MJUA 2A0FB 2AP6A 4H54A 2HS0A 3A3OB 4YDDB 4Q43A 4UQGA 1IXKA 4F3OA 1TL1A 1KKHA 1MG7A 2MTLA 3RRKA 2G2ZA 3W9IA 2LLZA 4FXVA 2I1RA 3DOLB 3QGHA 1WWHA 5D0HA 3C15A 3AQPA 1KN6A 3MR7A 1KLMA 1LW2A 1NDKA 3N6NA 4KV8A 3DKDA 3HVTA 5A8WB 2CPZA 4L3NA 3O44A 2FJBB 4YR2A 4CTAA 3BDEA 2V63A 3TZWA 1HBMB 1NSQA 1VHIA 4ILMA 2CFXA 3FDSA 3J7Z5 1OQ6A 2R8GA 1I5OB 3JXOA 2HQ3A 2OPSA 5L1JA 1KVJA 1KQSR 4I4BA 2W2NP 3VQSA 3PY8A 3H2UB 4I6WA 3H7HB 3V6DB 3TEGA 2VODA 2PEBA 5E3QA 4UZBA 3Q2TC 4LF6F 1K1QA 3W5XA 2B9YA 2ABYA 4IRKA 2B56A 3OTBA 2HNDB 2MQPA 3QSIA 4HKQA 4U8VA 1IBMJ 2XGPA 4DPWA 2R2TA 2ZHAA 4Y65A 4YFUA 3BGFA 5IM0B 4J9LA 3N79A 4UQTA 5CXTA 5HLFA 4LF5J 2V6AA 2NXNA 2PEHA 1FRKA 5DETA 4EBEA 1BWVA 2CPYA 4M63A 3UR3C 3JS9A 2H5EA 3TZZA 3TI0A 3KG4A 2NXUA 3D0HE 1K44A 4PQAA 1VHFA 3OVAA 4NA1A 2FD2A 4DV4F 4GO5X 2RJZA 2HGNA 2WW8A 4C7QA 1HLWA 1SC4B 3KLIB 3NGUA 2G13A 2AKWB 2MY8A 4EU0A 3BH7B 5F9NA 2J7KA 4DU7A 4B9SA 1FWPA 4ZVQB 3MPWA 4B9MA 3GFXA 1WHWA 1X60A 4YB7A 2HBZB 4K5RA 2LU2A 4NLVA 2KDOA 1WTBA 2AJFE 4X84A 1K47A 3LP2B 1DTTB 2E1AA 1RYRA 4E98A 1Y0HA 2APOA 2MB0B 1X4DA 2CQ0A 1EZZB 2DNZA 1YJ7A 4ES2A 4GC7A 1M5OC 2BVZA 3MAQA 1Q82T 3FMBA 2OEKA 4KY3A 4LMZA 5FLXU 3KUGA 4HI1A 1S9GA 1M5SA 1XNRJ 4CYUA 4ED6A 4NLTA 5KFXA 3HI9A 1BXNA 4ZPCA 3F41A 4CH0S 3KMQA 2ZH9A 4CNYA 4WZMA 4OI0A 3Q0AA 3TOQA 4YS2A 1VIOA 5EWGA 3J80U 4RBUA 5E3CA 2PMWA 3EICA 5K8NA 2VQEF 1N4LA 2DXEA 3RGIA 4KBIA 1NDCA 3V4IB 2IYIA 2D3O1 3PFEA 4GC6A 2MQMA 2JOQA 3GYNA 1V3SA 1JJHA 2RRAA 1UZDA 1UFLA 4QR2A 2Z8QA 4ID5B 3PZPA 2POKA 2VG5B 2XEXA 3PX0A 4GVBA 2Q6CA 2X3DA 4LSLA 2RSQA 4N47A 3J7A1 2HHQA 4C4WA 2M2BA 3PYDA 1TL4A 5F8JA 4Z37A 5KG2A 3CIZA 1RJJA 2WZ1A 4EFAC 4EO6A 4X65J 4P73A 4ELUA 1TL1B 2EEYA 3EZOA 1VK3A 4DV5F 1T7PA 1FERA 4DG1A 1PBAA 3C15B 2UV8G 4OYAA 1KLMB 4OHVA 1LW2B 1MROA 1VLYA 3V4MA 4KV8B 4IYQA 2D74B 3HVTB 3TARA 3CDEA 1PJ7A 1RAAB 4ZIWA 1GMUA 4CTAB 1H2UX 4MMOA 2KXNB 4I56A 4ZVRB 3G82A 5E3RA 2Q79A 1T9TA 2YBVA 2HIQA 2B43A 1GXLA 2OPSB 4RL1A 4RJVA 1U1PA 1VRUA 1Q5YA 3OLBA 1HBNA 2YKOA 3TUIC 4KJIA 3IBFB 5B0GA 1LWEA 1NJYA 3AD7C 2BE2A 4IRDA 3MD1A 2LQBA 4A8MP 1H98A 3AQOA 4J7CA 5AXKA 4PG4A 1X4EA 4MFBA 3HF5A 4KKOA 3FC9A 5HMZA 4OLOA 1A7GE 4NCGA 3L7PA 1DQAA 3FCVA 2COLA 3GJSB 4X4TA 3DRXA 9RUBA 3DM2A 4NOHA 5HLFB 2DR8A 2MKYA 3HP6A 4M5KA 2UXDF 4NYOA 1N5SA 4ZVTB 4KB7A 3THPA 1E6YA 2DGWA 4CH1A 5ETPA 4ZVGA 1GTHA 4AE5A 3AT1B 4NEYA 1KC8T 1JKHB 3AOAA 3K5OA 3WX8A 3BGOP 4OFZA 1G1XA 5I3UA 2WVBA 3ENVA 4A48A 4BCAA 4C9DA 3EVMA 2OP5A 1N33F 2QN6B 4F0KA 2FGCA 1WOSA 4PG8A 4FP9A 3MM9A 1JXEA 3CO9A 1KOHA 3DU5A 3D28A 2QRRA 2O67A 3TAPA 2QJ3A 2M52A 2BRLA 4J9QA 2EK1A 1U1MA 1HNVA 1YHQS 2QMUB 3SSRA 1S9GB 4CYUB 3DI6A 4OZ1A 3HCXA 2UVRA 1UW4A 1OYDA 1PC5A 2ZWOA 4L6V3 4YR3A 3PHTA 4FF4A 4DV1F 3PKYA 3UFCX 1HWJA 2CPHA 3ETMA 1PYTA 1MMLA 4DX8H 3IS9A 1TZ0A 3THTA 1VQOS 3D2WA 2Y1JA 3X1LB 2HVIA 1UWAA 1JWWA 5L38A 3PVXA 4J9OA 2V68A 3OL7A 2GNKA 4GVBB 1SKWA 2DNHA 1SKSA 4ED2A 3ICLA 2JRSA 4NRTA 2NYIA 4IFVA 1P6TA 2GVZA 2XMUA 1S6QA 3DRRA 1FRMA 1SC6A 4OZJA 5C2CA 1ZZNA 3L3CA 4QU7A 3GFZA 2CNKB 4FN5A 4ZHRA 2H54B 1XERA 2DGVA 3OV7A 2RU9A 1GQEA 3BO2A 3NNAA 2AYEA 2OD4A 3L4BC 1MROB 3JAMY 4C8MA 4N41A 4Q7AA 3CCLS 1B7FA 2Z56B 4JI5F 4JI3J 3G6YA 1VDHA 5ETLA 3R27A 2D3ZA 3CJ5A 4ILRA 3LPYA 4P2XA 1SVDA 3A4TA 3G82B 1K0VA 4H4MA 2IY5B 2E7WA 1FF2A 2GFFA 4AFFA 2KN4A 2XS7A 4UUWA 3QRRA 2VFVA 1VJQA 3G2XA 1F2GA 1VRUB 3I4PA 3D67A 4NPOA 3ZNUA 2VBWA 5F3ZA 2F3JA 4NZ0A 1HBNB 2HQGA 3V81B 2VOOA 2AMCB 2BE2B 4U8YA 3ZTOA 1N5QA 4U9RA 5KT2A 1Z4UA 5GADI 1H2VZ 3IGNA 4ECWA 2HKEA 4KKOB 4KHMA 4NCGB 1RUSA 2AU0A 4AXIA 4UZCA 1FJ7A 4LRFA 3BDPA 2M3DA 1RABB 3DM2B 1U6BA 2I9SA 1S77D 3PRVA 2DH8A 3CCWA 3FKBA 3LF0A 3CC4S 1HFEL 2RKIA 2KHCA 1E6YB 2XCAA 2L3MA 3FSXA 4ZJOA 3GIMA 3FQKA 3FFIA 4JI1J 3FBBA 5EX0A 5I3UB 1KFSA 3M6WA 1NH8A 5DM7Q 1IBKJ 2OH2A 2QA4G 2YKPA 4OJ3A 3OLAA 3IG1B 1U6ZA 1LXJA 2H51B 4DS4A 3RB3A 4DQPA 2QC3A 3DLEA 4OI2A 4N56A 5F9LA 1Y7PA 2XI3A 3SQGA 5AJ3J 1RADB 1HNVB 2RQCA 2HNZA 2VFUA 3DI6B 3FUYA 2J8AA 2NREA 1OYEA 2Y3YA 4ZN3A 1I94F 2YXLA 4ED7A 3WC0A 1T02A 1RHJB 1ZYQA 4HH1A 2HVZA 4OYPA 1S72S 2RHSB 1WI6A 3IS9B 2IFXA 3NKYA 3HHLA 1FEEA 3CMAS 2ZBPA 2SXLA 5L1KA 2HFVA 3D1QA 2XLJA 1C4CA 4A8KA 1T9YA 3TA2A 1RT4A 2XMMA 2RQKA 2J0XA 4WFAQ 1IKXA 2BM1A 5H9FK 4CM2A 4IFVB 1SJ1A 4WK3A 4HVZA 2GVZB 4IOCQ 1S6QB 1KVIA 3DRRB 3AFGA 3R7BB 2WAQD 1TR0A 5D0GA 4ZHRB 1D9FA 4ANCA 2F8EX 3M8SA 1KQKA 2ASJA 2EWHA 2G4BA 4QYZK 2YH0A 4NLQA 3IR6B 3UR0A 3OL8A 1H3DA 3C8YA 1RB0A 3PW0A 3MAAA 4DL0C 3ZZTA 1WC0A 1E6VB 3CDUA 2MY7A 2LYVA 2W9CA 2EFGA 4LFCF 3UVJA 1VQMS 1BQNA 1YJRA 2CAJA 2IJNA 1ZPVA 1Q4RA 4FXWA 1U47A 5HO4A 1VQSA 1JK9B 1PGZA 4C0BA 3RR7A 1C0TA 5I3QA 3BB5A 2CKWA 1RDRA 2OUGA 3T5LA 2KO1A 1FKAF 4RW7A 1O5JA 1Q8BA 2QLBB 1DJ0A 3W5ZA 2F65A 1KNZA 2B4OA 3O3LA 4ETZA 1RTDB 1XIQA 2DGOA 3IO1A 2DEIA 3I4HX 4NWBA 1N34F 1SIWB 4RR5A 3Q22A 4B3MF 4K4XA 2GO9A 1U25A 4ZJQA 3EPGA 3VAFA 3HK2A 1IWGA 5BR8F 3B54A 4USHA 4L75A 3PYEA 4DLGA 4C0OC 3T5JA 1EKSA 2RUSA 2EVZA 1IKYA 1X31C 3CNQP 2Y8WA 3SDEA 2BE9B 5EDWA 1VC0A 4P2FA 1Y3KA 3GU0A 2CZVC 2CXEA 4JI0J 3FFIB 3GFYA 4NCBA 1RWNB 1KP6A 4JOUA 1VCTA 3CDBA 3VTIA 2G0CA 2EC0A 3DYAA 1WSVA 4UOFA 1XR7A 5L8RC 2MQOA 1RI7A 4PRFA 2KVIA 4FYVB 4ZJLA 3DLEB 3HKZD 3B6BA 4HL9A 3SQGB 3MGJA 4FVCA 1YSJA 4OV6A 3L9ZA 1HQ2A 2A10A 2HNZB 2HK3A 1J5EJ 1ZPWX 2L9DA 4CO5A 1NJWA 4IH5A 2EW9A 1MWQA 2DD8S 2W2OP 4DR5F 2GHVC 2LDIA 2CQPA 2CNNB 5KFZA 3KLEA 3TZXA 1KOOA 5DM6Q 1AUDA 3Q8PB 4I2QA 4ERDA 4EI2A 2DNPA 3HHLB 4DQIA 5B0EA 4QU6A 2VQFF 2GQQA 3VF0B 1N0VC 2PFFB 4OYBA 4FPIA 1SPBP 4ZVHA 7AT1B 4DBQA 1SB6A 2MKSA 4G1QA 4YP3A 4IO1A 2FQQB 4K4UA 1IR2A 4NLYA 1S4FA 3HSZA 5CABA 4M5LA 1EQMA 4NLDA 1IKXB 3HT0A 4DL7A 4K0KF 1PILA 2GMJA 4C11A 3BYPA 2U1AA 2BJDA 4DR6F 5B09A 3JSYA 5U47A 3E01A 4PYAA 1F9HA 2GGPA 2LXFA 2P6TA 1CS4A 1HD1A 3LP1A 3SI8A 2Q66A 3Q89A 3GJQB 2ZD1A 4NYZA 4USWA 5KFIA 1C1CA 2AT1B 3CJ0A 4HHHA 3MAAB 2RMLA 4EK2A 3UVJB 2CZ4A 4RUAA 1BQNB 3M8RA 3T41A 4F2SA 4LF7J 2OGUA 4ZK7M 2ZM6F 1ZAXA 1C0TB 1QDUB 2R7VA 2OD6A 5J1PA 1Z1ZA 4RW7B 1RT6A 1S1UA 3CCJS 2KRBA 1V3RA 1DBDA 1M1GA 3CD7A 4A8OA 1RU1A 5IT0A 2XG8A 2CQBA 4I2PA 4RNFA 2QO3A 3EYZA 3N28A 4QWEA 1NKEA 3KFWX 4PWDA 3IP0A 3B4DA 3K2YA 3IFEA 5CA5A 1ACMB 1NB7A 3OTOJ 1UZHA 3I9V9 5EN1A 2GC8A 2V8HA 1M0SA 1UA0A 3NGSA 3QT6A 3E3XA 1PBUA 3SYZA 1IKYB 4ER8A 3WC2A 3SDEB 3KJNB 5KFMA 2DNLA 2L41A 1SL1A 2PD1A 3H2VE 3EMTA 4CLYA 1NKBA 2XNQA 4XTTA 1KLNA 4MTPA 2M0GB 1R8AA 3E51A 5B0CA 1W2BR 2R2SA 3DYAB 4KR0B 1YBTA 2CNLB 2RS8A 4K4YA 1N32J 4EYIB 2W2PP 1GXUA 2EFVA 3ISNC 3RBDA 2KFZA 2ZZNA 3POTA 2R9LA 4KGVB 4H4OA 2CZ9A 1OJ4A 2XWYA 3MURP 3D1OA 3QPIA 2HLUA 3LGMA 2AYGA 2H5IB 5A8KA 3A1YG 1CJTA 3PYGA 1RWPB 2DNQA 3I87A 2ZH3A 5J1EA 2W2MP 1NMEB 4RX6A 4Y28C 4OZ2A 3KLEB 5A76A 3WX4A 4MKBA 2W24A 2AQ4A 2RDIA 4FPRA 4GKKF 1EETA 1FE0A 4I2QB 8RUCA 1MWYA 3MTKA 1RAJA 2K1RA 3WBZA 2KI2A 5AE2A 3CC7S 4LF9F 3GONA 3H42A 3KOAA 3C14A 2BJ8A 1Q5VA 4G1QB 4DWIA 2HMIA 2JX2A 1R31A 2P2CB 4IH6A 1P9QC 3RBXA 2BQ3A 3H25A 1WHVA 3M32A 1SV5B 5C25A 4WTOB 4C11B 3CULA 2K3IA 3RAXA 1L3SA 1FNMA 4Y2IA 1FX2A 4U96A 3ADAC 4YN3B 3IWXA 4ITSA 3T9NA 3E01B 1XWLA 1W2IA 2B5JB 1WOOA 4ZP9A 1R0CB 3Q83A 2GGPB 1NAQA 2A2CA 1CS4B 2W8LA 1XEZA 2YY3A 3BH6B 3LP1B 3R1LA 4DX5A 5K20B 2RB7A 3D3CJ 4QIWD 4ZVPB 2ZD1B 2WSEC 5E2QA 4GVLA 1C1CB 1ZAWA 3PACA 3CW2C 1D8YA 4B3TF 4NA3A 1BMQB 4UOHA 4WBFA 2VG7A 1AUSL 3MEDA 4J5OA 4X4VA 1RWKB 1S1XA 1X9MA 2EFNA 2EXUA 4X4PA 1FDBA 4ILLA 2CQ2A 1C1BA 1S0VA 2FVPA 2GO8A 2LP4A 1T9UA 2DHXA 4X66F 4ED5A 1RT6B 4Q45A 1S1UB 3BS9A 4EWTA 2CVEA 4RWWA 5LMUF 3TEHB 1KSPA 3FBEA 2I8EA 2XLKA 5H1SV 1F5CA 4I2PB 4F2RA 1R6VA 3W66A 4FF2A 2RQMA 4ZCKA 4PWDB 2VJUA 4I1TA 3PR4A 1YI2S 3KXDA 3S01A 4B9TA 4OX6A 1W25A 4B3SF 4FS1A 5L39A 2KL8A 2DGQA 5D0RA 2RH3A 3A8JA 2ZBCA 4F4XA 2PIIA 3T1YF 3M6VA 3S7RA 1M5KC 3HZEA 1RWWB 1X4HA 1H6KX 1DLOB 3TVKA 5DZ6A 4B9UA 2AEMA 5HBMA 4ECSA 3VQTA 3U1LA 3VWSA 2QTWA 3TAMB 3KLVA 4QJVA 4FNHA 3PW5A 3ZZPA 1WEZA 2HVDA 2B4VA 3QRQA 3PIOQ 1S12A 3P4UB 3POTB 3W65A 3TJAA 1CULA 4H4OB 4CNZA 3NOGA 1S59A 5KFHA 4HTJA 4KHPJ 3R7SB 2HVEA 4DR3J 4M5MA 1L3UA 4CH7A 3D4JA 1H73A 1CJTB 1X4FA 3AA8A 5J1EB 5L9XA 5ITHA 4V19J 2J7WA 1M5HA 1FFWB 3DN9A 1IR1A 1YBAA 3QGIA 1TK0A 1X8DA 4DPOA 3FSYA 3UO0A 2CADA 3QRPA 2WCXA 4DV0F 3IRWP 1WEXA 3O1LA 2IJFA 4J9RA 5FDLA 1B70B 3NXZA 1UEKA 4ZVSB 4C3KA 3FGVA 1VOMA 3NAIA 4HLBA 3UCZP 1S97A 3J7YU 2CPEA 1WG1A 2AZ1A 2M7SA 4NLOA 5GAEU 4O4RA 2J9DA 3S8SA 4U7UD 3T1HJ 2V5HG 4QWCA 4K2JA 2HMIB 2ALZA 1S6UA 4Z7YA 3D1HA 2IA0A 2OFHX 3OD2A 3MCSA 3M2RA 5KG4A 4OIXA 3QZ8A 4TYBA 2CDRB 3GIIA 1CC8A 4EBCA 1BHNA 4J37A 3BYRA 2I2YA 4C8OA 3M32B 4O3OA 5C25B 1MWZA 2XMWA 4BS2A 1A0OB 1N36J 1EJ7L 5DDOC 1RWVB 2NXCA 5HQ8A 4TU9A 3RUBL 2K3KA 3OHAA 3HHLD 1WHYA 3ET6A 2VA3A 1ZAVA 2VJVA 2HFUA 3SZ2A 1NNDA 2HQIA 2KB2A 5IT9U 1RTZA 3G6XA 4JYAJ 1KHVA 2ACMA 4AL7A 1RWOB 3G8QA 2MZTA 1TK8A 2F5GA 5G4DA 2VG7B 5J2QB 4NZ6A 3K17A 3F44A 5K9FA 3OW2R 1AZSA 4ZITA 3D3BJ 1XNRF 4GMKA 1QAJA 4F0MA 1WELA 3OFGA 4UOGA 3GP9A 2LQ5A 2V8PA 2DHHA 1YDLA 1ZM4A 4OHXA 1C1BB 5HQLA 2JH3A 3DRPB 4TYAA 2G0IA 1RK8A 3VAJA 3RR8A 2M4MA 5D4NA 1DFDA 3VGVA 3K57A 1X9SA 2LEAA 3D6HB 1NSAA 4YB6A 1KTQA 2DNGA 3UCUP 3BN7A 3ONQA 3H40A 1QD1A 3QAEA 1TL7A 1FDDA 5M2PA 4QYZJ 4LFAJ 2BMBA 5BYQA 4YOEA 1NH7A 3AAWB 4OJ1A 5KFBA 3HSGA 3HD1A 3ZZZA 1U8SA 4KGXB 2BJEA 5HBMB 1EKRA 1IKVA 3MCNA 2C3MA 1TFYA 1SBRA 3FVYA 2OEJA 4BC9A 3BQ1A 3IC1A 4BLGA 4QR0A 1MMNA 3D6TB 1S7HA 2W25A 5KG3A 1V3ZA 2IHR1 4WF9Q 3W61A 5C42A 3JTOA 3PO5A 3H8YA 3OJSA 5F3TA 1CULB 5KTQA 1UWBA 2J8SA 5J2MA 2CJKA 3PX4A 2HW3A 3UN3A 5E7OB 5CYMA 4ZN1A 4IKAA 1N6QB 4QPXA 2XY7A 3BPSP 3WZ0A 3J81Y 2JDJA 4DDFA 2QLXA 1LWCB 3JQJA 5FDLB 3CMES 1IR0A 1AXQA 4WYLA 5KG5A 4JI7J 3T6JA 4NASA 4R0JA 3TX8A 1U2FA 3NBPB 2FPHX 4KHRA 1M90T 2IRUA 2AJ0A 2HHUA 2YKNA 3DNCA 4PEOA 2DJWA 3NCQA 2B4UA 3M2RB 2H1YA 2ATLA 4BWJA 2BW7A 1U0SA 5D3GA 2BANA 4OZ3A 3HHEA 2A6MA 2JC1A 2ZVIA 4WJBA 5JXSA 3ZZRA 3W9JA 3EVWA 3ITHA 5C5JA 1NCLA 2QL7B 1NPRA 3BKTA 4M5GA 4PXDA 4TN2A 2HNYA 3ET6B 2VKRA 4RW9A 4XK8C 3BBCA 2JFKA 2DO4A 1JQGA 3TANA 2JEIA 1UJ6A 2MSSA 1H72C 2RUGA 3K8WA 4DS5A 2Y8YA 4P6QA 2RDDA 2E1MC 2N82B 3WDOA 1AZSB 1EX8A 2ASDA 2BA9A 2L08A 1ITPA 4LBPA 2EFQA 4OHYA 2ROPA 3D54A 1LOUA 2DH7A 4KTQA 1XC9A 3N01A 2HRTA 3R2DJ 3C3LA 2DY1A 1JLGA 1HHQA 4Z7CA 4HT5A 4USKA 5ETSA 3MOZA 3H59A 4DSLA 1Y11A 4A8WA 1VBZA 4OJHA 4DPTA 2C22A 2QLWA 2W4PA 1LQ9A 4NX9A 3VCDA 5A2QU 3LTOA 4LBHA 4Y00A 5LXRA 2E5LF 2D41A 5C7PA 2YNFA 2E9ZA 1TKZA 3UN5A 3VV2B 1XMQF 1FO1A 1SUQA 5EGYA 2J5AA 5IC4B 4EZ6A 3M2VB 5AXNA 3H0PA 3QWPA 1TL7B 2FGOA 4QWBA 1GTEA 4C3LA 1HR0J 4XO0A 4NMXA 3QMQA 5KFAA 3GIJA 1AT1B 2OPPA 1IJEB 2QT7A 1S9EA 2CVIA 4U7UK 4F04B 2NS1B 4DFKA 1IM4A 1U0HB 4QWDA 5HROA 2CJAA 1IKVB 2YH1A 1X4BA 3JB9k 3EGZA 3CCTA 1HD0A 2P9EA 3QAUA 1SIZA 3OTDA 2GHPA 3N5FA 1KDNA 4Q2MA 4QIVA 3P6YC 3OTEA 4BC7A 5LSOA 1GEHA 1TU0B 1WOPA 2B6AA 1HNZF 5J2MB 3C6TA 4L73A 2BDPA 3M7VA 4M8LA 3V6JA 3GCXP 2DR6A 1S0NA 4IDKA 4CLPA 1WACA 5CYMB 3W63A 4TY9A 2R4FA 2AYBA 4X4RA 1F1BB 3CCUS 2GIRA 2D1CA 3M8PA 4USUA 3GYXB 5D4OA 1S0MA 3AH6A 4JI2F 5KT6A 3EM1A 4WU2A 4Y34A 3F73A 2GJIA 3KKFA 4MIBA 1KTVA 4N5SA 3CTRA 2UXCF 3VAKA 1VQ8S 2XZWA 1F5BA 3UN2A 4J9UE 2R7XA 1UCNA 2YKNB 4LF6J 5BYSA 1YK9A 2B9EA 4OX8A 2E44A 3GR1A 1EARA 2OSQA 2VDHA 3OFEA 1T3NA 4I7FA 1FA0A 2BANB 1REGX 1X5PA 4WFYA 1NK8A 5IXUA 1M1HA 4O4GA 1S4EA 2WK4A 2DPJA 4OYMA 1WC1A 2HFOA 3FZBA 2HWTA 2HNYB 3KK1B 4RW9B 5H9EJ 2J0QD 4DV4J 4ZKAA 2R7TA 1FJGF 1Q78A 3Q8VA 1YJWS 2BM0A 2V8DA 1RAHB 2RS2A 4NLUA 2XS2A 2V2VA 1VQPS 2FDNA 1K9MT 1ELOA 2QEXS 3FRZA 4O44A 3R5JB 5A6PA 3OSNA 3R97A 2ZOMA 2DK2A 2MDAA 4ZVOB 3OTCA 2AJ2A 2CPIA 3QWUA 4DPUA 2YNIA 3NMRA 2QX0A 3EGVA 1NPPA 3SEOA 5F8LA 2JNJA 5AXLA 2F4VF 2ZVSA 1FESA 1QJHA 2LEBA 2ZJPQ 5IQQA 1JLGB 5ETMA 1LWFA 1TK5A 3K5NA 2KZZA 4LQ3A 1YG0A 2MPUA 5KFOA 3H5SA 1L3TA 1RT2A 4OI1A 2BZ2A 2RIJA 2A6OA 3D7SB 4PZVA 2C1EB 2YNFB 1QTNB 1TKZB 5GMEA 1X4GA 1SUQB 4HACA 1DY3A 3EDRB 2PMZD 1NJZA 4K2XA 3R5CA 2BOPA 3W2WA 5BYRA 3SXLA 2FJWA 2JEJA 5CCLA 2Z2MA 4M1KA 3DDKA 2OPPB 3HXMA 1Y5LB 2MLXA 1S9EB 3OFHA 1S1WB 4P2MA 4ALZA 5HROB 4N7TA 1WC6A 4IOAQ 3P3DA 4LR9A 3EJMA 3FK4A 2CPFA 3ENQA 2XS5A 2YNGA 2HLTA 2EC2A 5JMNA 4DR1F 1B3TA 2XMKA 3KYLA 3UNGC 2QG9B 4DV5J 4JUZA 2FJXA 4RBTA 1J2VA 3VAIA 2B6AB 3C6TB 3DOKB 1DQ8A 3QQCD 3G96A 2I38A 3N6MA 1RXOB 4WIQA 2BBEA 3ULHA 5L9NA 4IDKB 4RNOA 3DDIA 2ZH2A 2WOMA 3GCWP 3KK3A 3MCOA 1WKJA 4F26A 4PUOA 3MMJA 3M8PB 2W9AA 2K2PA 1U4BA 5ETQA 1Q81T 3RJMB 4PXEA 1VGYA 4CO4A 5BJRA 1S48A 4P10A 2HBRB 5B0DA 2HEKA 4OV1A 3GB0A 2GMLA 2ASYA 4XAKA 4P7VA 2FHJA 3DC2A 3CCQS 2A2DA 2VPWB 3NL0A 1RE1B 1YJVA 2E9TA 4RU9A 1NUEA 3UDVA 3ZZUA 1TKXA 3KHHA 1FWLA 1G4CA 3D5MA 1UETA 5L46A 3PJ9A 3DLKB 2HHHF 4ZP7A 3HULA 2QL9B 4KPYA 4C2MA 4I7FB 3R6LB 1C0UA 3JTPA 2HGLA 1F3VA 1VQ4S 4O4GB 4KO0A 1HNXF 3BR8A 3HHKA 1BE4A 1NZ8A 2NZCA 2KKHA 4KAIA 2PN6A 2GCFA 4ZVEA 4ELVA 5CZXA 1R8PA 2M9KA 3PM9A 3RTVA 2YNHA 4F3MA 1YTYA 3CEDA 1LFWA 2AD9A 5IQ6A 4KGMA 1FXRA 1BGXT 3SFUA 2BRKA 4KH0B 2Z2LA 1N33J 5GVQA 2CIMA 2AGOA 4O44B 3NP5A 2VV5A 3PCOB 2KZMA 2MEWA 4DV2F 1UAWA 2YNIB 3UW1A 2Y1RI 2ZH1A 1U1NA 4P71A 2FLPA 4RW8A 2MLZA 4KSEB 1SJRA 3TUZC 3I5CA 3T9ZA 1LWFB 5E5NA 2B8QA 1T95A 1Y3JA 2CUYA 4WWSA 5CQGA 9ATCB 2C2OB 4F02A 1R7IA 2DXDA 3FCHA 1KS2A 5K14A 4Q44A 3GPAA 1OS5A 3GTYX 1RT1A 2E5JA 1JLEA 4O3SA 1N56A 1XTZA 1GMWD 5DS7A 3MM6A 5LMNF 3IR5B 5CD4A 1UVKA 2YWEA 2DRAA 4NE9C 1YGYA 2FHOB 2QSWA 4NL5A 3B4MA 2E1CA 1S0OA 5J2PB 1URNA 2QLJB 1NBEB 1SH2A 2FIUA 1OO0B 5DZ7A 4EO8A 4O3QA 1I51B 1HI8A 5DGBA 5GMDA 2DIUA 1JLFA 2FVRA 2YNGB 2ZBRA 4DQRA 2VOPA 4CT9A 5L1LA 3MMAB 3W9HA 4JB8B 2HFNA 1YQHA 1G3OA 1WC5A 3ZO7A 2CQ4A 3NGRA 1HWUA 2OO4A 5T7LA 5D78A 2WOMB 4IG3A 4WFZA 4QIGA 4JI5J 3WIUA 3KK3B 4DHVA 2EI5A 5MLCV 4PUOB 2PE8A 4HI2A 1XMOF 3AXMA 3CCZA 4FVMA 4DCJB 3AJDA 4FS2A 2B51A 2ATCB 4YHHJ 5HANA 4C48A 3AOCA 1TUGB 3FQLA 2XZTB 1JXLA 4R25A 4AD6A 2DH9A 3MEKA 2C42A 2MMYA 4MKVA 2E5HA 2GVDB 1TKXB 4C8ZA 4KE5A 4HDHA 5CZVA 5ETKA 5F8GA 2HPUA 2IYGA 4LBIA 1CVJA 2XO6A 1RHUB 2MZQA 1HQEA 4HT7A 2AV5A 3CD5A 1OPIA 2D9OA 3OQ2A 3L95X 3ELHA 1JLAB 1X4AA 1XNQJ 2AYMA 2W7PA 1MN7A 5CYJA 2PDAA 4KO0B 4NXNF 4ICLA 2I0XA 1V5VA 1TL3A 1F5AA 2P6SA 4URGA 1QUPA 1HBUA 2NUUG 3ENWA 4L74A 2MHNA 3NNHA 1K1SA 1APSA 4K59A 2YNHB 3GV5B 4MYTA 5KOWA 4DN0A 4K8RA 1HYSA 3JSBA 3NOCA 1X5SA 2ZWPA 2DKOB 3NLCA 3M4XA 4ZPTR 2UUBF 1UA1A 2VG6B 1IWAA 4LRCA 3D68A 5LJ3Y 5MAOA 4FF1A 3J7AN 1TUWA 3FSIA 4OI3A 3TRGA 2BQRA 4RW8B 3VZHA 4BHQA 5ETVA 4DPYA 3FCWA 3U7JA 3CC2S 3C46A 5HJXA 4DQQA 3NWRA 1LNQA 1YJTA 2CDQA 1Y00A 1I94J 1O51A 4J9MA 1SI9A 4FDFA 1FTCA 2VPYB 4RNNA 3HX9A 1GX6A 1U1QA 1QAXA 2PI5A 4CLFA 5K14B 4X4NA 2DGSA 1RWMB 4A4JA 1RT1B 5KFSA 3MHYA 2ZZTA 3KNAA 2R8JA 3I5AA 5HVFA 5KFYA 3ILJA 1YZ6A 1U02A 2JFDA 3MXHP 1REVA 1CG2A 3MM6B 2FLOA 1QSSA 4DF8A 1FK9A 3MD3A 3OL9A 4DV3F 4U6PA 3EE3A 3PHEA 3H5XA 3DLGA 1HMVA 2RT3A 3FBCA 3LQVA 1S9FA 3NS7B 2B9WA 5A6WA 2HHTA 4RU2A 5KOXA 4WCEQ 1BQXA 1Q79A 1EIYB 4JP8A 1NSKL 2KVQE 2O3DA 4AQYF 4G65A 4NI2A 4NMLA 4JI8F 3NCRA 5JVGQ 4QCLA 5T7LB 2CRLA 4USVA 1UKUA 3D9BA 4IG3B 2UXBF 2OSRA 3I82A 1A9NB 4DV7F 4ZLNA 5KFKA 2H65B 1DTQA 4I64A 4ECYA 3GIKA 2KFNA 4LFCJ 1T11A 2CG8A 2LU1A 4H4KC 3P45B 1VQKS 3TVZA 5LOQA 2XMJA 4P7TA 2FB0A 3BJYA 2V8GA 1M5PC 2KHDA 4X62F 2DNKA 3BO4A 4JV5J 2IM3A 4IOBA 2DGTA 1RACB 1GFWB 4UOCA 4D3HA 4CLKA 3HDSA 1HQEB 1HNWF 2DHGA 2XC9A 1OQ3A 2YWFA 5D4PA 5LJ5Y 1N34J 3CUNA 2DHSA 2OTLS 5DQGA 2KJVA 4ID8A 3TZYA 2Z4PA 4DX7A 2R7SA 4ICLB 5BR8J 5KFVA 4X2BA 2J6UA 1TL3B 5GAHI 1JXVA 2QMXA 1O8BA 1HBUB 4CWBA 2LCWA 1Q0NA 2J76E 2HQCA 4FYXB 4WPAA 2J9CA 1X0FA 5KFTA 2UU9F 4OHZA 2LMIA 3Q8SB 1G2EA 3PJXA 2UUAF 2HRYA 1C4AA 3CJ8A 2IBKA 1HYSB 4WK1A 1YITS 4KHPF 3CDAA 2BQUA 4JI4J 3RYLA 2C2KB 1UP1A 1WC3A 1FFSB 1X5OA 2HZVA 1RBLA 2GAHC 1TMMA 2JEFA 1RCXB 1VBKA 2QZ8A 1FEHA 2ZOGA 1X0PA 2VUGA 1YJUA 4UT4A 1V6HA 4C3MA 2DVIA 1WF1A 1GAOA 4DR5J 3BV8A 1F60B 3MR3A 3B82A 4LSLB 2KT3A 2HFZA 1S6PA 4RKUC 2MQ8A 2MSTA 2Y0BB 2HAIA 3CCRS 2HHSA 3PTWA 3A8KA 3H5UA 2UVUA 2HZCA 3M8ZA 1UEVA 4YR0A 3UCGA 3W2VA 2VQFJ 3KJQB 4A8YA 4ZCLA 2HIYA 2AW0A 1S5ZA 1REVB 5D0EA 2XI2A 5JVHQ 4DG1B 1X4CA 2NPFA 1HARA 1FK9B 2W7OA 2EFPA 3OR1A 4C6AA 4FBUA 2AX0A 1NK4A 2ZBQA 1GXTA 4N8OA 3DLGB 3D66A 3O6QA 4W98A 1HMVB 2ADBA 3CPWR 2LXIA 4K4TA 4K0KJ 2ZH4A 3P49B 1S6OA 4Q5VA 3I56S 3NY0A 3HT3A 4DR6J 2AGQA 1TP7A 1ZTTA 4JYAF 1U8WA 3KHRA 3TP2A 2K8GA 3BGUA 3CJ2A 2NZ4A 2QYCA 4WU3A 2OAUA 2RE1A 4NI2B 5B0BA 4ED0A 1LWEB 1WI8A 3BBBA 3IBCB 4M5NA 3BM7A 4B3RJ 1WJ9A 4KH1B 2C3YA 3IN5A 3PW2A 4ZCIA 1T9WA 4MFBB 2F8MA 4QIFA 1DTQB 2IVYA 1HWLA 3SCIE 3DLHA 2CYYA 2GIQA 2YVSA 5DQHA 2KTQA 2BR0A 2WHOA 1EQ0A 3A8EA 2L9NA 4ZLLA 2ZM6J 3P5BP 2OKQA 3T6BA 4QQBA 1NZAA 4DR2F 1ZA2B 2PA8D 4LREA 3G6VA 2V4QA 3GYGA 4I6YA 2C2ZB 5EWFA 4HH0A 5CH7B 4TQRA 4MKYA 4HHJA 4USIA 4M5HA 2IBOA 2QSFA 2ZNYA 3NGTA 2VF3A 4IR9A 2MKJA 2LECA 4ZPBA 4MJKA 1N52B 1VFJA 2MXYA 5GAEI 2VU5A 5F8HA 3O8WA 4IR1A 3MWBA 5FLXY 2V9KA 1JLBA 2WSCC 2GJFA 1Q8LA 2Z58B 4ZPAA 4WYWA 3FEXB 1D8ZA 3MM9B 4ED8A 2BJ9A 3HVAA 3MDFA 3AODA 4J9PA 2FHJD 4DL2A 1X9WA 4CLWA 3MZIA 4ECTA 2JVRA 2MZRA 1BQMA 4DUZJ 4IFYA 3U1MA 2PA3A 2YKMA 2UV8A 1WDDA 3T1AA 3SFGA 3M9NB 1R8CA 5J1NA 4J9VA 1L3VA 1MN9A 4MYUA 4WFXA 3FZ2A 4P75A 3TAQA 2JWNA 1NJXA 1SKUB 2MZ1A 1FTRA 2BEFA 2XY5A 2OTJS 1I3OB 1UL3A 1VISA 3DRYA 1KBRA 4J9NA 4KIAA 3HLUA 2HHWA 4ZS6A 3ISZA 1LKZA 4BBYA 4ECRA 4DCOB 4DPXA 1NJIT 4Y2CA 4NXMF 2GIFA 1HBOA 1S6PB 4CT8A 3N9UC 4GKKJ 5IC6B 2BOAA 3I0RA 2YWGA 1IBLF 1VI7A 4FNIA 4X64F 2KH9A 4E8UA 4OI6A 1Y5NB 1PCAA 2BXJA 3CDWA 3W2VB 4ZIVA 4PPZA 2DTJA 4LF9J 4NA2A 4JI6F 2P9GA 3IRXA 3MTJA 3DGPA 2JC0A 2XBPA 4NLRA 2YX4A 2FC9A 2KJWA 2ALYB 1RHKB 2ZFHA 2GAGC 4DL6A 5KFPA 2FLNA 2AJ4A 2ILZA 4ATNA 2PO4A 1HKAA 5DQIA 1WNEA 5IWAF 4XPEA 5F8NA 4H4MB 2J7UA 3HSJA 1ZM9A 4LQ9A 2ZOFA 2VFTA 1JJ4A 3L09A 4LVOP 4N76A 2XMVA 4WFBQ 5ADZA 1RYSA 2WBRA 3EPIA 4WP9A 3K89A 2B7CB 1IN0A 1HW9A 3K8VA 2VICA 3KJVA 3NS6A 1SJ3P 4O3RA 2HYIB 1F0XA 3U02A 4TVAB 2D3OR 4B3TJ 3PRBA 2ROEA 1HNIA 2IRXA 4LSNA 5DG9A 4MT1A 5HVHA 2ZHOA 2FYXA 5IS2A 1ZS6A 4J90A 1UJ4A 3ISND 2N7CA 2NYHA 4X4QA 5C2GA 3R5DA 4X4OA 1N0UA 1S49A 2RKIB 1KR4A 4C0HA 1HWKA 1T8EA 1KHWA 4YUDA 3A8IA 1SXLA 5LMUJ 4RUHA 4DLEA 3KMSA 4ZLJA 4ENOA 4UF4A 5E0OA 1D09B 1YJ9S 3DRSA 2OIHA 2VG5A 1JLBB 2BACA 4K4ZA 3QIDA 3QT7A 4ZP6A 2GV1A 2DO0A 4K7QA 4CLLA 3RZAA 3T1YJ 2XM3A 1FNXH 1O6XA 1G7CB 4I68A 5LSRA 1MMDA 1BQMB 4Q0BA 4IFYB 3KUEA 4DUYF 2YKMB 1HHTP 4ZLPA 3WHIA 5RUBA 4K4WA 1XR5A 2Z57B 1X5TA
chains in the Genus database with same CATH topology
1B0PA 3BN4A 4Y3CA 3RU0A 4NCAA 3OL7A 2GNKA 2CJAA 1IKVB 3LP0A 4QW8A 1X4BA 2YH1A 1R0AA 4IQMA 1SKWA 3JB9k 3EGZA 3CCTA 2DNHA 2KYZA 1HD0A 1SKSA 4ED2A 2P9EA 3QAUA 3MFHA 3EUNA 3ICLA 5DGAA 1SIZA 3MECA 2JRSA 3OTDA 4NRTA 2NYIA 3LALA 2GHPA 4IFVA 3U27A 1N6QA 3NGDA 1P6TA 3N5FA 3W2WB 2XMUA 1S6QA 4Q2MA 4QIVA 3P6YC 3CE8A 1SQEA 3OTEA 1FRXA 3DRRA 1FRMA 4BC7A 5LSOA 2X1BA 1TUVA 1LWCA 1SC6A 3HFKA 4OZJA 5K5MA 4B9LA 2EFOA 1RKIA 1ZZNA 2B6AA 5A8RB 1HNZF 3L3CA 4XDDA 5J2MB 4QU7A 3BF4A 3C6TA 2XSFA 3GFZA 4FN5A 2BDPA 1ZTWA 4ZHRA 2EPIA 1JLCB 1XERA 4PXCA 4M8LA 5KFDA 2J0WA 2DGVA 3OV7A 3V6JA 1OIAA 4WKRA 1RT4B 2OMLA 2KG0A 2RU9A 1GQEA 2ROGA 2E66A 3BO2A 1S0NA 4IDKA 3NNAA 2AYEA 1WACA 5CYMB 4B08A 2WRMA 4TY9A 1LK7A 2OD4A 2R4FA 3QLHA 3NCPA 1MROB 3NBPA 3JAMY 4C8MA 5DLGA 5KFGA 2AYBA 4X4RA 1HBOB 1TKDA 4N41A 4Q7AA 4TLQA 3N6LA 3CCUS 3CCLS 1B7FA 2GIRA 2D1CA 4F4WA 4JI5F 2YTCA 2F40A 3M8PA 3I0RB 4XIUA 3OSPA 3G6YA 2DBBA 1HW8A 3GYXB 5D4OA 3R27A 2D3ZA 3CJ5A 2E9RX 1S0MA 4ILRA 3AH6A 1A6LA 3LPYA 4JI2F 5KT6A 1GNKA 4WTYA 3MFIA 3B78A 4CI0B 2JSXA 1K0VA 2WB4A 4H4MA 3LOUA 4WU2A 2XLIA 4F50A 2JHEA 4Y34A 3F73A 2E7WA 2GJIA 2VKZG 1FF2A 3KKFA 4MIBA 3UQSA 2W8KA 2GFFA 5A0YB 3LAKA 1KTVA 3PEHA 5F0WA 4AFFA 2KN4A 2N4DA 4LVNP 3GR0A 2XS7A 1UJ5A 4YQWA 4UUWA 1FRLA 4N5SA 3GG1A 3K5LA 3IRXB 3KTQA 3CTRA 3MEGA 3JSMB 2VFVA 1NK0A 1F2GA 1VBYA 2GQCA 4DOZA 3VAKA 1VRUB 2UXCF 4LJMA 1VQ8S 1YIJS 2XZWA 3I4PA 1VIXA 4X4UA 1FKPA 2B0GA 4LF7F 1NK6A 4JBCA 4NPOA 1R89A 1F5BA 5F41A 1N48A 2R7XA 1XBWA 2VBWA 5CD4H 5F3ZA 4TXSA 2FY1A 2F3JA 2YKNB 4NZ0A 2V8VA 5BYSA 1HBNB 3Q2SC 1Q7YT 4IG0A 1TFWA 4DV6F 4MIWA 4OX8A 2PC6A 4R0EA 2M8DB 2E44A 3GR1A 3V81B 3OL6A 2VOOA 5KFEA 2BE2B 1B0VA 4QIEA 1N5QA 2W9CB 2OSQA 1U49A 3TUJC 4U9RA 5KT2A 3OFEA 3S1TA 1Z4UA 4A8XA 5G0RA 4I7FA 1T3NA 1FA0A 2BANB 5GADI 1H2VZ 1X5PA 3IGNA 4WFYA 3TR5A 5DG8A 1SL0A 2ZDPA 3U1NA 1NK8A 5IXUA 1JKHA 1RQ0A 2JLFA 4ECWA 2EBGA 2UUCF 4O4GA 3DMJA 4KKOB 4KHMA 4OHWA 4NCGB 4G6VB 1OSCA 2WK4A 1TVRB 2CQIA 4AXIA 5E41A 2AU0A 1FJ7A 2Q6BA 3BDPA 2DPJA 3O5TB 3RW6A 1Q7LB 1JJ2R 2CQDA 2HFOA 3FZBA 2M3DA 4Y6IA 4PG7A 2HWTA 4ECZA 2OFGX 4B3OB 4DJBA 3DM2B 1U6BA 2CPDA 2HNYB 2I9SA 3BREA 3KK1B 1FE4A 1IJFB 2J6TA 1S77D 4RW9B 2DPIA 2WSFC 5H9EJ 2DH8A 3CCWA 2J0QD 4DSKA 3OTOF 4ZKAA 2R7TA 3KJVB 4F4KA 1FJGF 1R8BA 1Q78A 3KG1A 3G8TA 3M9MB 1YJWS 3LF0A 5K8OA 3CC4S 2BM0A 1HFEL 2RKIA 1GT8A 2V8DA 1VQNS 6FD1A 2RS2A 2KHCA 3QIPB 4NLUA 1E6YB 2V4RA 2XS2A 3I5BA 2XCAA 5DRKA 2L3MA 5GMKa 3FSXA 3VZIA 3QGPA 1C0UB 4CCHA 1HNIB 3GIMA 3FQKA 5EX3A 4NLWA 4Y2AA 5KFUA 2ZE2A 3FFIA 3AJ2A 4LSNB 1VQPS 2ZNZA 2FDNA 1U09A 3KLGA 1JLQA 5EX0A 4MKAA 1K9MT 5I3UB 4C98A 1KFSA 5CYQA 2V4JA 1ELOA 2QEXS 2MQLA 3FRZA 4O44A 5H9FJ 4ZPWR 3M6WA 5A6PA 4XPCA 1Z2ZA 2J9DE 4WFNQ 1NH8A 1S1VA 3OSNA 5DM7Q 1QY7A 2EG1A 5LL6d 2OH2A 2QA4G 4JV0A 2YKPA 4OJ3A 2ZOMA 2DK2A 3OLAA 2MDAA 4RWXA 4R5PB 3IG1B 2EK6A 5KG6A 1FXDA 1U6ZA 2CPIA 3OTCA 3QWUA 3MPVA 3GV7B 1LXJA 3PNIA 4DS4A 2YNIA 3NMRA 3DHXA 1G6BA 4CO0A 1N32F 4I6AA 3RB3A 4DQPA 3SEOA 2OJ3A 5F8LA 1U1KA 3DLEA 5AXLA 2DRBA 2F4VF 4OI2A 2XGQA 3VAMA 4C8LA 4YB1P 2ZVSA 4N56A 1FESA 3M2VA 4YMEA 1QJHA 2LEBA 5F9LA 2ZJPQ 4AYBD 1Y7PA 1JLGB 5IQQA 4M5DA 2N3OA 2XI3A 3SQGA 2W9BA 2MGZA 2ZBIA 2IAJA 1LWFA 2MKIA 1HNVB 1TK5A 1YJNS 3K5NA 4F25A 2KZZA 2VBXA 3LGNA 2VL1A 2RQCA 2HNZA 2X51A 5I42A 1LXNA 4YEAA 2VFUA 4RZRA 1HA1A 3DI6B 4LQ3A 1YG0A 2DNYA 2GW8A 2MPUA 5KFOA 4A8QA 3H5SA 1FVSA 1L3TA 1RT2A 1FD8A 2J8AA 3CD0A 4OI1A 7FDRA 1T05A 2BZ2A 2RIJA 1YVFA 2NREA 4HDGA 5DG7A 3MEEA 4B02A 1I94F 3FNNA 2DR7A 3DRSB 2RDJA 2MQNA 4TU7A 4OL8A 2XSJB 3GSDA 4ZPVR 2DNOA 2YNFB 3AJ1A 4ED7A 3WC0A 1TKZB 2LQJA 5I3PA 1T02A 3VAGA 1X4GA 1SUQB 2FJDB 1SH3A 1N54B 4QWAA 1ZYQA 2GA7A 4HH1A 3R3TA 2HVZA 2LA6A 3M30A 2PMZD 1NJZA 1YRUA 4CO3A 1S72S 4LF8F 3UD3P 1UVLA 3HVWA 4K2XA 1N5YB 3R5CA 2MKCA 3W2WA 5BYRA 2BOPA 3SXLA 3I31A 1DAXA 1WI6A 3IS9B 2FJWA 2IFXA 2JEJA 3NKYA 3HHLA 1DQ9A 4YB5A 5CCLA 2DCLA 4CIOA 3RRGA 2Z2MA 4M1KA 1FEEA 3LWMA 3CMAS 1HL6A 4Q0BB 3DDKA 5KFNA 2OPPB 1NEEA 5KFCA 1FRJA 1JX4A 3OXGA 2SXLA 1FXLA 3HXMA 1Y5LB 5L1KA 1S9EB 3D1QA 4LFBF 3Q8RB 1B64A 2XLJA 1C4CA 3OFHA 3CIMA 4A8KA 3TO8A 1S1WB 4ALZA 5HROB 1N8RT 3TA2A 1ZBTA 1RT4A 2XMMA 2R7WA 2JJ4D 4IOAQ 3LP0B 3CCES 2RQKA 3P3DA 1R0AB 2J0XA 4CQ1A 3IGVA 4WFAQ 1IKXA 2BM1A 2BYCA 2CPFA 1JLEB 3MECB 3UDLA 4ZPDA 3ENQA 3TW0A 2XS5A 4W92B 2YNGA 4IFVB 2HLTA 1RTJA 1SJ1A 4WK3A 4DR1F 4HVZA 4K5SA 5LT5A 4IOCQ 2XMKA 1S6QB 2BABA 3KYLA 1KVIA 3UNGC 2YWKA 1I6JA 3DRRB 3M6XA 4G1IA 1U2RA 5DDQC 4UY85 4ZVFA 2WAQD 2FJXA 4JUZA 4RBTA 1J2VA 1TR0A 2ZHBA 3VAIA 4P2SA 2B6AB 4FXDA 4AL5A 3C6TB 3C66A 3DOKB 1DQ8A 4ZHRB 1ROFA 1VJWA 5KFQA 1D9FA 1NHVA 3G96A 3IBWA 2F8EX 2I38A 3N6MA 1Z2LA 4RNMA 2GX8A 2BBEA 3TVYA 3ULHA 3M8SA 3CCSS 3H4DA 2DR5A 5L9NA 4F3QA 3ZFVA 1H2TZ 4IDKB 1KQKA 4RNOA 2ZH2A 2WOMA 2ASJA 1FRHA 2EWHA 2G4BA 3QLHB 1SL2A 1IQTA 3KK3A 3NWGA 1Q1KA 2YH0A 4NLQA 4F26A 4PUOA 3IR6B 1TAQA 3MMJA 1JLFB 3UR0A 3S6EA 3OL8A 1H3DA 3PDNA 3K7RA 3C8YA 4MK8A 2Q43A 3M8PB 4TU8A 2P9CA 4Q8EA 2W9AA 5EUHA 2K2PA 1U4BA 3PW0A 2YKQA 4DL0C 3ZZTA 1Q81T 3V81A 1E6VB 3CDUA 2MY7A 2LYVA 4PXEA 1VGYA 4CO4A 2FHKA 5BJRA 2W9CA 1XR6A 1S48A 2EFGA 3EXYA 4LFCF 4OLPA 2DHAA 5SUHA 3X3UA 1VQMS 1BQNA 1VQLS 5B0DA 1YJRA 4C97A 2C28A 1NO8A 5KFLA 3N5BA 4OV1A 2IJNA 3GB0A 4GO7X 1ZPVA 1AROP 1Q4RA 2E5IA 2IM0A 4FXWA 4PWUA 1YWXA 2GMLA 4FZVA 2ASYA 4XAKA 4ES1A 4P7VA 1U47A 4DR7F 4OZ0A 4BWMA 4Z2XA 2CJ9A 1TQLA 3UDCA 5HO4A 4D3GA 2FHJA 1VQSA 1ZM2A 1JK9B 3DC2A 3MEGB 3CCQS 2A2DA 1PGZA 2VPWB 1MSWD 1UEUA 3NL0A 4A47A 4C0BA 3RR7A 1YJVA 1C0TA 1ZETA 5I3QA 4M95A 2E9TA 3SCJE 4RU9A 1FKPB 3BB5A 3ZZUA 1TKXA 2CKWA 3KHHA 1JNZB 1RDRA 3KK1A 3T3FA 3T5LA 3D5MA 2DNMA 2KO1A 1UETA 4RW7A 2XO7A 1FKAF 4IG0B 1O5JA 3I0SA 5DDRC 1CC7A 1Q8BA 3ZZOA 3DLKB 2HHHF 2V0NA 1DJ0A 4ZP7A 4Y2KA 3BR9A 1KNZA 1Y5IB 2B4OA 3O3LA 4KPYA 4ETZA 4ECUA 1RTDB 3R5BA 3CXCR 4C2MA 3CCMS 4OX9F 1FDNA 5G0RB 1EP4A 1P1TA 3JSRA 4I7FB 5KG7A 3Q8QB 3QJPA 1C0UA 3RBEA 2DGOA 3JTPA 3IO1A 2HGLA 2MKKA 2HGMA 2F1FA 1VQ4S 3I4HX 4NWBA 3IWLA 1N34F 4O4GB 3DMJB 4KO0A 1SIWB 4KRWA 3Q22A 4B3MF 1HNXF 3BR8A 4K4XA 3HHKA 3O2IA 1CSJA 2GO9A 2QA1A 2LA4A 1U25A 1BWEA 3EPGA 3VAFA 2DNRA 2KKHA 4ZP8A 3FRYA 4KAIA 3HK2A 3Q23A 1URRA 3MAHA 2PN6A 2GCFA 4ZVEA 4TQSA 4ELTA 3CJ4A 5BR8F 4ELVA 5CZXA 3MR6A 1R8PA 2M9KA 3HHLC 5T41A 3IG1A 1BY9A 2ZITA 3PM9A 1MU2A 4USHA 2LQ9A 1U48A 1Q8IA 4LT6A 4OZ5A 3OUYA 4DLGA 4C0OC 2NUHA 3RTVA 3T5JA 3BSNA 2YNHA 2EVZA 4IH7A 1IKYA 3QZ7A 4PQUA 3GQCA 4I0WA 4ZDNA 3HM9A 4F3MA 1YTYA 3CEDA 1LFWA 3BZQA 3CVKA 3PKMA 3SCKE 2FC8A 3SDEA 3SCLE 5EDWA 3PO4A 1VC0A 1Y3KA 1FJEB 2AD9A 2W4CA 3NMAA 5IQ6A 4A8FA 2CZVC 2ZE2B 3FFIB 3GFYA 3W7BA 2FVCA 4KGMA 2JVOA 4NCBA 4PKDB 3TA0A 3KLFA 4JOUA 5KFJA 5SZTA 1FXRA 1BGXT 5E33A 3CDBA 2EG2A 3VTIA 1JLQB 3SFUA 5KFWA 3KLGB 2BRKA 3I32A 2G0CA 2Z2LA 3DDNA 2MQQA 1M5VC 4DR4F 5CYQB 5GVQA 2CIMA 2DB1A 2V4JB 3KHGA 3KG0A 2HWHA 3OHBA 4O44B 2G9OA 2AGOA 1QVFR 2EC0A 3DYAA 3NP5A 2NR0A 2VH7A 2WONA 1S1VB 2VV5A 3J7ZT 2KU7A 2KZMA 4TKTA 1XR7A 3MUVP 2IM2A 4DV2F 1UAWA 1QUVA 5L8RC 2YNIB 1AFIA 2MQOA 3UW1A 1WF0A 4NLGA 2A1BA 1XMBA 2Y1RI 4Q2LA 2ZH1A 1U1NA 1RI7A 5HMYA 1U45A 1FD2A 2FLPA 4PRFA 5D8HB 2KVIA 4RW8A 4DQSA 3DLEB 3MMBA 4V19X 2CQHA 1RT3A 3HKZD 2GMHA 3MR2A 4KC5A 1QSLA 2XMTA 2NSBA 2N3LA 1OSDA 4HL9A 1HQUA 4KSEB 1SJRA 3TUZC 3I5CA 4M5DB 4QPTA 4RW6A 3SQGB 3MGJA 3MM8A 4FVCA 3DFEA 3T9ZA 1YSJA 2IAJB 5DDPC 1LWFB 2MGZB 1SKRA 5E5NA 3V6KA 3OBIA 2XY6A 2A10A 1ZM3A 2HNZB 5I42B 4DR3F 4ETXA 2B4PA 5KAKA 4USJC 1ZPWX 1T95A 2L9DA 2VC1A 1Y3JA 5DJBA 4CO5A 4EGLA 1DURA 2ZH5A 5CQGA 3AB4B 3PXGa 4DSFA 1NJWA 1FHTA 4IH5A 2EW9A 3SV3A 1T05B 1LK5A 4F02A 2DD8S 3MEEB 4DR5F 1R7IA 1D1UA 2GHVC 2LDIA 2D9PA 2HS4A 1S1WA 1QVGR 2CQPA 5KFZA 3KLEA 3FCHA 1KS2A 3CWJA 2DR9A 3UPFA 4OJGA 2HHVA 3MF5A 5K14A 3PFOA 4Q44A 4UW2A 4N8NA 1KOOA 1OS5A 2CJQA 5DM6Q 1RT1A 2VASA 3CT9A 2E5JA 1AUDA 1HHSA 4ZMMA 3M30B 2IVFB 3Q8PB 4I2QA 1JLEA 4O3SA 4ERDA 2Y1IA 5KT3A 1N56A 1H7WA 3TNVA 1XTZA 4I67A 5A8KB 5HP1A 2DNPA 3HHLB 4URSA 5DS7A 4DQIA 3MM6A 5B0EA 2X1GA 3PJWA 3BSOA 5LMNF 2X1FA 4