1FFSB

Chey-binding domain of chea in complex with chey from crystals soaked in acetyl phosphate
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
ARRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Further insights into the mechanism of function of the response regulator CheY from crystallographic studies of the CheY--CheA(124--257) complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1ffsB00
1EAYC 1FFGB 1FFWB 2LP4A 1FWPA 1A0OB 1FFSB
chains in the Genus database with same CATH superfamily
5C25A 2FJAB 2ZNZA 4S0MA 1RAGB 2WHOA 2YNHA 1HI1A 4I2QA 4QWDA 1FWKA 3NGRA 1N54B 3N5BA 4HLBA 4HHHA 1CULA 4KH1B 2R9LA 2BM0A 4IDKB 5L1IA 3X3UA 1H74A 2DCUB 5KT3A 2GIQA 3BKUA 2LXFA 3HSDA 5JUMA 3KOAA 2A10A 4HHUA 4GO5X 3BSCA 1ZA2B 5A2QY 3V5RA 2HHWA 4ZVRB 5LMUF 1HBUA 2GVDA 3I0RA 2Y0SD 3D1HA 1RT3B 1GNKA 1VOMA 1YJ9S 1XERA 2VG6A 1AUDA 4PZVA 2IDEA 3C15A 2GCFA 1KOHA 4BHQA 3TZYA 1Q81T 4X65J 1YJVA 1P9YA 3JTPA 4Y34A 1CJUB 2ZVIA 1Q4RA 4ECQA 2GO8A 1U7LA 3QT6A 4R8UB 3VAMA 1S5ZA 2BJ9A 4IOAQ 2R3VA 4OZJA 4M8LA 2E1MC 3C6UB 3QJJA 4URGA 4DCJB 4LF6F 1F5AA 4JUZA 1E6VA 1K0VA 3TAQA 1XR6A 5B0CA 4MMOA 2V4JA 2IIHA 4RW4A 3HM9A 4FPIA 2IM3A 4FF4A 1GFWB 3ZC4A 3VHQA 4FP9A 2F40A 3NNAA 1OYDA 3S6EA 2KXNB 2ATCB 5L9NA 4QIEA 2EG2A 2ZITA 4ID8A 2K7KA 1J5OB 2H5JB 1M0SA 3Q8YA 1JWWA 3MM9A 1YG0A 3QT8A 3O6QA 3VAIA 2Y1JA 3AODA 1RHUB 1IBKF 2F7VA 1GH8A 5KG2A 2ZZMA 1H73A 4C3LA 3D7SB 3NAHA 2DNLA 2MGZA 5IT9U 2Z58B 4CO2A 2W9CA 1RT4A 2J0XA 3I6PA 2HVHA 1WSRA 3NS6A 5AXKA 1N36J 2I2YA 3MCOA 4UT4A 1R27B 3PJWA 3MGJA 3MFHA 3M1VA 3SEOA 2MKHA 4X4NA 5BR8F 3MXHP 3M9OB 3A8EA 1HA1A 1OSDA 3THTA 4CH0S 4UY85 1NM2A 4R5PA 4RW8A 4J9MA 5CXTA 2BKNA 2DB1A 3NBPA 3B4MA 3F41A 4AQYJ 2H3EB 3OR2B 1U0SA 1Y4ZB 2OPSA 1HNIA 1U8SA 4P7VA 5CABA 2GA7A 2F4FA 1C1CB 4CNYA 1A9NB 1F0XA 4CLYA 1RT6B 5JVHQ 4JI7F 5D0GA 4B9SA 4FYDA 1UFLA 3ET6B 1HYSB 3PDNA 4NCGB 4DFPA 3DU6A 4ZVUB 3RR8A 3NKYA 5D0HA 4YR2A 2LXIA 2B8QA 4C48A 2C2KB 3V6DA 3UW1A 5I3PA 4M5JA 3M8SA 2HQFA 2V6AA 1QVGR 2FC9A 1MNEA 2R2UA 5A8RA 3P45B 3TW0A 2LECA 1U09A 5KFVA 3C6TA 5AXMA 1S6QB 1CPZA 2BYCA 5ETNA 2YKAA 3DRSA 4PPZA 1DFDA 1ZZNA 4XTTA 1NKCA 3BR8A 3M30A 4ZOSA 4L3KA 5F8JA 4ZVOB 3FC9A 3D1OA 4ED5A 4DFJA 1RT7B 3TJ8A 3MAHA 2QIFA 1LW2A 2VBZA 3C16A 3P4UB 4DV0J 2PC6A 2E7VA 4FVCA 3C14B 2HWHA 3SZ2A 4CH7A 2XSJA 3HP6A 1HI8A 3DLKB 3UFCX 3ZNUA 4LQ3A 1WF1A 2KDOA 5J1EA 2UUTA 2W7PA 2KRRA 4CM0A 3EM1A 4USWA 1RHMB 4HDHA 1V5VA 3T6BA 3FMBA 3OTOF 4NLGA 1HWJA 2HAIA 4I7FB 4RL1A 2LA4A 3QAUA 1SKUB 4DG1A 2GQCA 4WP3A 3HXMA 3IR5B 2JDJA 3N5FA 3OPKA 2RQCA 2WOMB 2GGPA 2Q66A 3I5AA 1P1LA 4X4QA 2QX0A 4DS5A 5IWAJ 4FF2A 2I0XA 4LF8J 3R5CA 3W2VA 1YHQS 4DSIA 4J91A 1SJ1A 3R1LA 1RXOB 2V50A 3IWXA 4A8KA 2J7WA 3MUMP 4A8WA 4C11A 4RUAA 4EUVA 2BJDA 2XNQA 1CJTA 5G0RA 3ZTPA 4M94A 4NLQA 3UN3A 1FKPA 4F2SA 1UZHA 3GIRA 1RKIA 4YHHF 4B3MF 2V8VA 2VFSA 3JYTA 5CZVA 5IC4B 3CIMA 1TFWA 4C9DA 3TZZA 2VB6A 1QY7A 2GO9A 2DXDA 3CJ2A 3HT3A 1WTFA 4DQQA 4L6V3 3PEHA 4AE5A 2MPUA 2PDAA 2P8IA 2C2DA 4YY3J 3EXYA 4R0JA 1TL7B 3D3CJ 1JLCB 4CLPA 4TKTA 2CYYA 4HI2A 3J7YI 4KB7A 2VPYB 3GCXP 1Q95G 4LR7A 4ZA1A 4F67A 1WOPA 4QWEA 1T3NA 3RW6A 1TZ0A 3OW2R 5FIIA 4U8YA 2VG7B 3KDOA 4WJBA 1A6LA 1B99A 3CJTA 3WQPA 3J7YU 1VLOA 4GVBA 1N5YB 3GR0A 3CUNA 3BO3A 3PX0A 2D74B 2JH3A 4W90B 4ZVGA 5J1PA 3CF5Q 1SVDA 3VTIA 4F0KA 2YWHA 2UV8A 4JV1A 3R6LB 2UXBF 1RT2A 1Q82T 3QBCA 4ANDA 4LBPA 3SCKE 2B6AB 5T7LB 2NR0A 4OFZA 2OPRA 4ZPCA 3M2VB 1VC0A 3MM5B 4DX8H 3BGLA 4DBQA 1AXQA 2QA1A 1NPKA 3UVJA 2BJEA 1JJ4A 1HR0F 3MOJB 2HAFA 4DLEA 3PIPQ 4P2FA 1M5HA 5KFFA 1KS2A 2DITA 1RT5B 1PIEA 2B43A 2BJ1A 1HKAA 3R2CJ 1H98A 3KLVA 2PN6A 1IBMF 2ZH4A 3QIDA 3G6XA 2CQGA 3AJDA 5HL7Q 3NWGA 1HMVA 5DLFA 3M8WA 1NH7A 4IRCA 4X62J 4DEZA 4LF9F 2POKA 4JV0A 4NXMJ 3L95X 2XZWA 4CT9A 1CJVA 3PEJA 2LYVA 4NI2B 4JI0J 4FYXB 3OXLA 3MEEA 3G8TA 5KFZA 1NZAA 2OKQA 3H5YA 4CZCA 4DDFA 4NLWA 1VRQC 4NXNF 3OR1A 2G0JA 4EU0A 4ER8A 1FRIA 4ZPDA 3RB4A 4NYZA 3TJ9A 3TARA 2P9GA 3FVYA 1MW7A 4L72B 4DR4F 3T41A 5A8KB 1TMJA 1BC6A 5LSLA 1S76D 3CJ4A 5E3QA 3CIZA 4DQIA 3MR5A 1KWMA 2RQ4A 5J1NA 2V0NA 2AW0A 2DNKA 2A2DA 1HNZF 2KT5A 4WE1B 1FVQA 3EPGA 4M5DA 3H90A 3G9CA 2OAUA 3DOKB 5CA5A 2KVQE 2E5JA 1E6YB 1WACA 1AA1B 3T1YJ 5DZ6A 2CQ1A 2MLZA 1F5BA 2HRYA 4XK8C 4WKYA 3LO3A 1IKVA 2KN4A 4LRCA 2KVIA 1C1BB 1X4AA 2JVRA 5K9FA 1CVJA 1JXEA 4I67A 4PQAA 4DOZA 4P6QA 2GMJA 5D4NA 3KJVA 4LF5J 5B0BA 1TVRA 2QYGA 1YRXA 2QSFA 1J2VA 3H40A 4OYAA 4Y2CA 2BJ3A 4A8OA 1TMMA 3KDNA 2D9PA 4ZVQB 4HTIA 4ATNA 3JAMY 2J76E 5CYMA 1I51B 4DV1F 3HZEA 4JI2J 1W25A 1D8YA 2RUGA 1LXJA 2N3OA 4H4MB 1SJ3P 2DJWA 3TRGA 2JX2A 2VONA 4A47A 5E3AA 2JNJA 3D3BJ 1B4SA 2JEJA 2J0QD 2ZNYA 2VQFJ 3NXZA 1TL5A 2BQRA 3JSYA 5FLXU 3DXSX 4OV1A 1Q7YT 2JWNA 4L3NA 2KB2A 2Y3YA 3HDSA 3DC2A 3TQ1A 4LR8A 1YX2A 3M8YA 1K9MT 1HARA 2I6WA 2EXUA 5BXIA 1QJHA 2RS2A 4YB7A 3BYRA 1JLGB 3T9NA 1I94J 5HJYA 2OPPB 3FBBA 5HMWA 1FA0A 1DLOB 1RISA 4PUOA 2H4WB 2M8HA 3R5JB 1NSQA 2J9CA 1SUQA 3NNCA 3QFHA 3HHLD 4B3OA 4NYPA 3C66A 3IRWP 2ZOGA 3IGNA 1BY9A 3W66A 1S79A 4NCAA 2RJZA 1NK0A 4M5GA 1GMWD 2R2SA 3DOMA 2C2NA 3BKFA 4P71A 3H5XA 4AT1B 5CYQB 2UXCJ 1DQ8A 2OD6A 1X0PA 4B3RF 3RYLA 1M1KT 4KO0A 3NS5A 2ILZA 4NEYA 3PZPA 2W9AA 1VK3A 1NEEA 3KHRA 4B9MA 3W64A 4QIVA 3PJXA 1IKWA 4Q8FA 1W26A 3NGKA 4GKKJ 5KG3A 4TU9A 2BXJA 1IM4A 1U6BA 3VZIA 1H3DA 2XYGB 2CJQA 4IQXA 2HK2A 2HNDB 3ETMA 3T1HF 2H4YB 3MM7A 1RT1A 1VRUB 1RTIA 3M2RB 3OVBA 3MTKA 3AOAA 3E3XA 2Y8WA 4GMKA 1RWUA 5L38A 2QLXA 4P75A 4UQTA 3GU0A 4QZVB 4CNZA 1BQNA 1ZBTA 1RGVA 2OEKA 3T6JA 4ECXA 2CJ9A 3TAMB 3BYPA 1VIXA 2AJ4A 1S9GB 1CS4B 4UY8T 2QJ3A 1D0EA 1SV5A 2GAHC 5J2PA 1F6TA 4RBUA 4O0NA 3RAXA 1T7PA 1KTQA 3OUYB 4OYWA 2OJ3A 3GG0A 3UDEA 4P2MA 5LMUJ 4JI1F 4CO3A 1LQ9A 1VQ6S 1RTDA 4L74A 2GNKA 5KOWA 2M88A 1TKZA 3D6FB 2QLJB 2DYAA 3OTBA 5H9EJ 1R89A 2ZH9A 1SH2A 2R8GA 3KLIA 2WVCA 2V9KA 3OL8A 3CC2S 1CLFA 2K1RA 3PFOA 4DWIA 2O66A 5GMKa 5LXYA 5EGYA 1H2TZ 4UZBA 4J9PA 3CTRA 2AEMA 1FNOA 2JFKA 4KHPF 4DPWA 4XPCA 4M5NA 1WDDA 2J6UA 2ZBIA 4FS2A 2BM1A 3UI3A 1DTQB 3CJ5A 2QL9B 4X64J 2MQPA 2GFFA 2BE2A 2HHVA 3H2VE 4F7VA 3IO1A 3HVTA 3ETOA 1FFGB 4P74A 5LM7E 4F04B 3CCUS 1LK5A 2UUWA 4FS1A 4LIRA 5HLFA 5DJBA 3FZ2A 3HVRA 2IVMA 2YWGA 2KKHA 1X4DA 2DNMA 2W9BB 3SXLA 2RB7A 1LWCB 3N01A 3CCQS 4PG8A 4XPEA 4PPDA 4QYZJ 4OHWA 1QM9A 2DD8S 3C6UA 2UU9F 2DNZA 4NMXA 1YRTA 1S1TB 4CTAA 2IM2A 1IBKJ 1UEUA 3F0NA 1XMQF 2OHDA 4WK3A 3T5JA 4YEAA 5ETSA 2ZM6F 2EC0A 1P27B 2CQ0A 3CGIA 2HNZA 4YDXA 3SSQA 1D09B 3LGMA 3M4XA 1EQMA 4YB6A 1WORA 1WF2A 2AZ3A 4RUBA 1S7HA 4NOHA 2ALYB 3TI0A 4DZ6A 1N0VC 2HHUA 1VQ7S 4C8KA 4DPXA 5BR8J 1J5OA 5F8HA 1ZM2A 1TKXB 1WWHA 3DHXA 3MPWA 2R8HA 3CCES 4WYWA 3IP0A 3QPIA 2AGQA 3CDAA 1UPMB 2RQMA 1N5SA 1R6VA 1JLFB 1HNWJ 2ZEJA 5H9FJ 3FCWA 4FYVB 3FNNA 1RWPB 3OBIA 2WVBA 1B0PA 2DRAA 2KHDA 1RHRB 3OL6A 2BABA 4K4VA 1TK8A 1JNRB 2VPWB 5F0UA 3A13A 4DF8A 4B9LA 2J0WA 5L8RC 4WFBQ 2E7XA 3QGPA 4ED2A 3PKYA 4OMFG 1L3SA 2AGPA 2M9KA 5KFLA 2UXDF 2KT3A 1EP4B 5D77A 2HNYB 2B3TB 4A8SA 2V2KA 3ZZPA 4NLUA 1S4EA 3DYAB 2JVOA 4AL7A 4TY8B 4NA3A 4I2PA 3MURP 4NLVA 4EYHB 4DL7A 4DUZF 2QN6B 2IY5B 3LTOA 3EDRB 4N7TA 1Q5YA 4PQUA 2KO1A 1FESA 4CI0B 3TYTA 4Q7AA 3CDUA 3BQ1A 2VOOA 1B0VA 3EVWA 3MOZA 5F8GA 4F3OA 3KK2A 2FTRA 4EZ9A 4ZLPA 4IG0B 1OJ4A 1DURA 3GZ7A 3IXQA 1EX8A 2QGFB 1RT6A 4Q0BA 1KQKA 2W2PP 3GIJA 1HYSA 3T5KA 1G3OA 5KFQA 1NB2A 5CCLA 2NZCA 1VQPS 4F02A 3DRPA 2BZ2A 5RUBA 2MXYA 3D0IE 3PW5A 1H0HB 1TL3B 3UWTA 1AB8A 1N33F 3IM8A 5HP1B 2DXEA 1N88A 2GC8A 4ZJLA 1S6QA 1SBRA 1NO8A 2FHOB 3OTOJ 1IJFB 1SC3B 1DRZA 2DTJA 1XWLA 3MR2A 1WTBA 4ZP7A 2KI2A 2MSSA 3J80U 2XO7A 2HFZA 2E5GA 1R8BA 5KFUA 1SQGA 2QA2A 4OYIA 2MKIA 2HIQA 2QLFB 3V2UC 2I5JB 3C3LA 1IQZA 3C14A 4FXWA 5KFRA 2WONB 2ASYA 5ETRA 2EEYA 5M2UA 3L4BC 2MZTA 2E5IA 3H42A 3AB4B 2HHTA 2V9WA 1QE1A 2FJBB 4ZIVA 4IFVB 4OI4A 3HHNB 4OIXA 2YNGB 2M52A 4UQGA 4B3MJ 1H7XA 3Q0AA 3MM8B 4UW2A 1HWLA 3OLAA 1L3VA 4I7FA 1HBOB 3FQLA 3F73A 4B3TF 1RTHA 2CPXA 1U8WA 5B0EA 3L9ZA 3RBXA 4Q8EA 4XDDA 3KLGA 4ZITA 5AXNA 4NRTA 3N6LA 4OX9F 2RDDA 4KE5A 3CC7S 4QOTA 1T9XA 2YNFA 1GX5A 4UOGA 2NUHA 4WTOB 1J27A 3AXKA 1HD0A 4HR2A 2DGQA 2IDLA 4RR5A 3R97A 2MMYA 4YP3A 4K59A 2NPFA 4DU7A 3QWPA 5F8NA 3D1QA 2F9DA 3KK3B 3W1YC 2XSFA 1JQGA 1SJRA 2ZE2A 4CLFA 3SFUA 4JI5F 1VYAA 4DV4J 2X51A 3EX7B 3F44A 2RU3A 3DRRB 3EICA 3CE8A 3SSRA 5ADZA 4ZMMA 3CSKA 2UXBJ 1UJ5A 1B0TA 3VGVA 2UVWA 3GCWP 3RBZA 1HPZB 2VQEF 1ZYQA 3LAKA 4CM2A 1X8DA 1UVKA 3K17A 4B9TA 4NA2A 4YOEA 4IH5A 3W7BA 2R2RA 1HR0J 2EPIA 2L3MA 3V6KA 1W2IA 2PMWA 2OPQB 2VH7A 4FF3A 1T3OA 2HFSA 1IBMJ 1ZM9A 2QFIA 4UOFA 3UD3P 5LXRA 4LR9A 1HBNB 4OX6A 3FRYA 1RADB 4LF9J 4K4XA 1NK9A 3CCMS 1TKTA 2H54B 1U47A 1TUWA 1VIOA 5HVGA 1KR4A 4N77A 2R8JA 1UJ6A 4PWDB 1RBLA 1FDAA 1JLBB 2E9TA 2GX8A 1K1QA 3EGVA 1FJGJ 3O1LA 4FXDA 1SCJB 4NXNJ 3DOLA 4YB1P 4KJIA 2MQQA 2PGCA 1HHSA 3VVUA 3CO9A 5EDWA 3LANA 4P7TA 1S1VB 2QZ8A 2N3LA 2KXFA 2EFPA 5AXLA 4O44A 3PFEA 2B9XA 2AQ4A 3GQCA 2CNLB 1CQMA 1SI9A 4DR4J 4KV8A 3DM2B 5KAKA 2QFJA 1WDTA 2M8DB 3MAAB 4KGMA 4OI3A 2XY5A 5J2MB 2FHJA 4O3QA 1NDLA 1SH3A 5IOLA 1XQIA 3FRZA 4I6YA 1HQEB 1VRTA 2R7TA 1WG1A 3D6HB 3CD0A 3R3TA 2BKOA 1WNEA 3Q8QB 4U95A 3CCJS 4QR0A 4KC5A 3CJSA 3EGZA 1REVA 4ICLB 4B3SF 2Z30B 3CJ0A 2DIVA 2V63A 3U1MA 3UDVA 2YNIA 2DEIA 2O1PA 4QW9A 5HBMA 2XQCA 2GW8A 1T03A 2AEJA 1O51A 4IFYA 4NLOA 3R9LA 4J9LA 3MMBB 3CNQP 1MMNA 1N5TA 3PM9A 5DZ7A 3KKFA 2VC1A 3MUTP 2V8GA 3NGSA 3V4IB 1JIHA 2XC9A 4JV5F 1R8HA 1XR5A 1R31A 4USTA 2DNGA 1KD1T 4ES2A 3LGHA 2LQ5A 1SJFA 1OQ3A 3DMJA 2MLXA 2HPUA 2G1DA 4ED1A 3HSZA 3WC0A 2CQIA 4IYQA 2ILYA 4QIWD 1FF2A 1YITS 3FSYA 4NZ0A 2AJQA 3C19A 3DLJA 4MKYA 3RB6A 1M5SA 2DR6A 3BQ2A 3AY0A 3G87A 3HPOA 3PW4A 1TU0B 5B7WA 4ID5A 1S1UA 2RU9A 1XR7A 1EKSA 1KQGB 2XMKA 1R0CB 3W60A 3L7OA 4WF9Q 2LQ9A 1Y10A 3T3FA 4IRDA 1FDDA 2HS4A 1WOOA 2A6OA 4RNHA 2COLA 3H7HB 4N76A 3VALA 2LEPA 3B54A 1BMQB 1Q8KA 4K4YA 4DL4A 1H38A 2CDQA 3W9JA 2HLTA 4LF1A 1UVJA 4MYTA 4DL2A 1KQSR 3CO0P 4RLEA 1TELA 3K8VA 4QYRA 3MFIA 3MMJA 3LAMA 3LWMA 3B82A 3OQ2A 3H2UB 1Y5LB 4I69A 1NKBA 3TVZA 5KT5A 3PIOQ 2C42A 4IOBA 3VQSA 4IR1A 3RB3A 3CJ8A 1FRLA 3H20A 4B3RJ 4TY9A 5KG7A 3IS9A 3QT5A 1JLGA 2MZ1A 2CPFA 1WC3A 2OFGX 4RWWA 1UVMA 2OPPA 1B7FA 1C2PA 3LP1A 5HK4A 2G4BA 1Y9OA 4LVOP 2XBPA 3PRVA 3TX0A 2ZC4A 3ZZ0A 2HLUA 5KFOA 1RACB 4G1IA 2DBBA 2ASLA 3BPSP 8ATCB 4EWTA 1DTTB 3K2YA 1VQ4S 5D15A 5GVQA 3I31A 3T1HJ 3MF5A 1SJQA 3CCZA 3V4MA 3CD5A 4U67Q 4PYDA 1PYOB 2XYHB 1T94A 2ROGA 4DR1F 1FWPA 3OJSA 1VISA 2XZDB 3KK1B 4QYZK 1TV6B 3SFGA 3VZHA 2CRLA 4K5SA 1SL0A 4N56A 2ZJQQ 5E3PA 2EI5A 4J7CA 1NNDA 4M5KA 7FDRA 1Y0HA 1FD2A 1U2FA 3MTJA 3OFFA 2AHOB 4UOHA 1PYTA 5M2RA 3BGFA 2FVRA 3TZXA 1XC9A 3AJ2A 1XIQA 2NXUA 3LWLA 2HVEA 2A2CA 3KLEB 2HZVA 2HNDA 1NJZA 4TVAB 1GMUA 1BQXA 1WEYA 3I0SA 3POTB 2HBRB 1VRUA 3MM6B 1RU1A 4JI1J 3KFWX 3ZZTA 4DX6A 4F4WA 3R1HA 1X4EA 1ZZFA 1XTZA 1S9EB 2FYXA 2PA8D 1PAUB 3MECB 3A8IA 4KT0C 2HHHJ 5HROB 5H9FK 2YKMB 2BOPA 5ETVA 1H2VZ 4ERDA 4U6PA 3PHTA 3GJRB 2VJUA 3TAMA 4ZHRB 2XY7A 2CJKA 1RYSA 2R7OA 2IA6A 1ZM3A 3PCOB 2LA6A 2B56A 4KHPJ 2HGNA 1UFWA 1FVSA 3KHLA 4U8VA 4DV7F 5C2CA 1U6ZA 2MYFA 3DN9A 3OUYA 3M32B 3JSMA 2AYEA 4C4WA 4ZLLA 2DGXA 2M0GB 5KG0A 1X5TA 2G2ZA 1PC5A 2RDIA 5KFIA 1HNVB 3N4WA 1IJEB 3BH6B 4ES1A 3DLHA 4IG3B 3MEDB 2RD5C 1LKZA 2B51A 3BQ0A 1UL3A 1F9EB 4USUA 2E5HA 3HFZB 2H5IB 2RF2A 4QW8A 4V1Ak 3BGUA 3MR7A 4I64A 3PACA 5DGAA 1P1TA 2HZCA 3BDEA 1DTQA 3DLGA 3K5MA 3VAGA 2PT0A 3H4BA 4ZK7M 2ZM6J 2OD4A 4OJHA 4ZN1A 1NDPA 3W3SA 3DHWC 2MHEA 2DGUA 1HWIA 3OL9A 5EWGA 4C8OA 1IKXA 1Q16B 1T9UA 3TVKA 4DR3F 4OYXA 3AA9A 1YJWS 2LU2A 5LMNF 1L3KA 2W9BA 5A0YA 4Y2IA 2XS7A 1G1XA 2CQDA 1NK6A 1C0UB 1PILA 3GG1A 1WKLA 4C6AA 1LWFA 4GKJJ 1VQOS 1LW0A 3BO2A 4ALZA 5DETA 4N41A 5C42A 1DQAA 1T9WA 1T11A 3GLJA 2W4DA 4PEOA 1RTJA 7FD1A 2LFVA 4C8YA 5E5NA 5ETQA 5AJ3F 2VDIA 5DG9A 4C8NA 4KPCA 3AOBA 2YWEA 2QRRA 2V67A 1WC5A 3I4HX 4FYWB 4PWWA 2DHSA 3LF0A 1FXDA 5D4PA 3C8YA 2PMHA 3QGHA 4RO0A 5J2NB 3O2IA 3WX8A 3RB0A 1ZPWX 1NK5A 4Q44A 3SV4A 2XS2A 4CYUB 5KFSA 3J81Y 1TAQA 4FKXA 4DUZJ 4H4KC 1FI4A 4USHA 4GC7A 1ZTWA 5A8WB 4ENOA 1IBLF 1NK8A 1ZS6A 1RAFB 2ACYA 4DJBA 2C3OA 4DSEA 2HQ3A 3Q86A 1C0TB 4JYAF 2YWKA 5K8NA 4TXSA 5HMYA 5D3GA 6FD1A 3TA2A 1EP4A 2HNYA 2ZH3A 3KG4A 3MAQA 3M9NB 2N7YA 4LRDA 4QPTA 1RBAA 1FD8A 2YQ0A 2VFRA 1VJQA 4Y3CA 4ECTA 3EJMA 4TY8A 1SC1B 5ETMA 2K7JA 2DNPA 1T95A 5HN0A 1Z4UA 4I6AA 2I9SA 3G8QA 4RNFA 1TK0A 1PCAA 1WKKA 3PRDA 1ICEB 5C24B 3MCMA 3M8ZA 1LWEB 1IWAA 5JJBA 2I1RA 2BW2A 1SL2A 1QTNB 1CJKB 2R8IA 4NE9C 5EX3A 4WFYA 4BLGA 2FY1A 5LSOA 3T9ZA 1FJ7A 1UVLA 3PYFA 1EETB 2FZKB 4RJVA 3QLHB 4N8NA 4ZJQA 4KKOB 2HS3A 4J9SA 1KTVA 3B78A 2VG5A 2IAJA 2QO3A 1NK4A 1FFWB 2Q6CA 4Y6IA 4PXDA 1U0HB 1YZ7A 1OY9A 2GHVC 4K4UA 2CDRB 2YXLA 4K4ZA 3OXFA 4FN5A 4O3OA 4OJGA 4CRJA 2E7WA 5LL6d 2L9NA 4KQZA 2CQ3A 5E0OA 3A3OB 2OIHA 3BSNA 5FJ4A 2IRUA 4ZCKA 1X4BA 2QMWA 1YGYA 4DCOB 3J81U 1RDRA 1WHVA 1UTAA 2A18A 4LFBF 1TTHB 4B3TJ 2UVVA 4OV6A 1S10A 2CWKA 4J5OA 4LSLB 2DT9A 1WC6A 2I5JA 2YQ1A 2Z8QA 3AFGA 3I5CA 2P9EA 4E2FB 3IAM9 1FKOA 3JXOA 3ILOA 2GMHA 2ADCA 2WCXA 5KFJA 3US5A 4HH0A 9RUBA 5KFWA 4J37A 2JC0A 5J2QA 4OL8A 4WFZA 4LFAJ 4EGLA 4F4ZA 1S72S 2VDHA 1V6HA 1S9FA 2YH0A 4CLKA 5DM7Q 3SQGA 5CD4H 3G4SS 3NOCA 2YX4A 3N6MA 3K5NA 2Y1LB 5BJRA 4JI5J 3CCLS 1DARA 2MJUA 3KG1A 3KJNB 3VAJA 2OH2A 3D54A 2KM8C 1R43A 2YKNB 2XCPA 4Y2AA 4XDCA 1YSJA 1WEZA 1VHFA 3IBCB 3R7NB 3UPFA 2H51B 2VQEJ 3P8BB 3W61A 4X4OA 1MWZA 4MKAA 3AB2B 3RW7A 2D41A 1JNZB 4TU8A 4DXLA 5F3TA 5A6WA 3EPIA 4TQSA 4MFBB 4H4OB 4B9NA 3FKBA 1P6TA 4QBUA 2MKJA 3DGPA 3DU5A 3QZ7A 4PXEA 2NQPA 2AEFA 2DHHA 4C2MA 3HKWA 4JI8J 2K3KA 5IV4A 2Y1RI 3DRRA 5E41A 2V5HG 2DNQA 5K8MA 3NOGA 2WSCC 2DH7A 2YX1A 4KRWA 5DQIA 1HLWA 3N79A 2W8KA 2PI5A 4C8LA 3MPVA 2HRUA 1HPZA 4E0DA 3NGDA 5C25B 2WW4A 4TNOA 4I2QB 2MQOA 3NCQA 5K14B 4KR0B 1CULB 3V81A 5I4MA 1KRPA 3D6TB 2JC1A 4KFBA 4OZ5A 4WCEQ 2OPQA 1IKYB 1U2RA 1X9MA 2FB0A 3OXGA 2D3UA 2JZ5A 3G82B 1HBUB 4MJKA 1TP7A 3PW0A 2MQMA 3I0RB 4X2BA 4F4XA 2EWHA 4K50A 2XI3A 1K73T 4MAKA 1NSKL 3KLFA 3C15B 5HQ8A 4FNHA 4ZJOA 5KFKA 1Q78A 4ILLA 1S0MA 1IR2A 2RMLA 3PVXA 4ZS6A 3UCGA 2JEFA 3KWMA 4UUXA 3W5YA 4YN3B 3KMQA 4WIIA 2KM8B 2ZH5A 1Z2LA 4DMZA 3I9V9 2HFVA 1WKJA 1QTMA 1M90T 3B8HA 2IVYA 3HHKA 4ZPAA 3GJSB 3AJ1A 1E6VB 2FZGB 1VQ5S 2AIRB 1OMSA 2HVIA 5KFMA 3UO0A 1AUSL 4KTQA 2DNRA 5J2MA 2VASA 5I3UB 4M5HA 1JJHA 2H9ZA 1QAJA 2CQ2A 3GJQB 2EFVA 4NRUA 4MIBA 4X65F 4A8FA 2XHWA 2OELA 3QZ8A 3HFKA 1YJNS 3H5SA 1PAEX 2BJ7A 1U45A 3BJYA 2WRMA 4IR9A 4JV5J 3OJUA 2XMAA 1FDNA 3WX4A 3EGWB 2V4RA 3M8QB 3MM9B 4ZVFA 3LPYA 3TEGA 2MZRA 4ICLA 1H2UX 4LF2A 3CCTA 1Q8LA 4BS2A 1Q79A 3AD9C 1XEZA 3FSIA 3HI9A 4WP8A 5AT1B 4WU2A 2FY8A 3JTNA 4JI6F 2HQIA 2MGZB 3EZ5A 2KTQA 5F8LA 1RHJB 1Y5IB 5IM0A 2BVZA 3SQOP 3BO4A 4JI4F 2RRAA 1XBWA 3FJ2A 3M1VB 1JLQA 3UNYA 4P9SA 4YR3A 3EXCX 3PJ9A 5A2QU 4X4RA 3AHPA 3K5OA 4J9RA 4RW8B 2ADBA 2DHGA 1KFSA 4JI3F 3KG0A 3IMQJ 3NBPB 1HNXF 3DNCA 4E8UA 1YDLA 1UEVA 4F50A 2H5EA 2B0GA 3DDNA 2OPSB 3VGUA 3FFIB 1HNIB 1T9YA 4DCPB 3LUYA 4NYOA 2ZKUA 3HT0A 3SDEA 1R6YA 3CMAS 2VFVA 2EKYA 2V34A 3EZOA 3PR5B 4G65A 3QT7A 2DPJA 3X1LB 5GADI 3CDBA 5E33A 3GIKA 3CMES 2CG4A 2VV5A 5KG6A 2ZH7A 1LV5A 3VWSA 2XWYA 5CD4A 2XLKA 1MG7A 1LOUA 1BWEA 1X4CA 1FTCA 2IYIA 1N4LA 3MEGA 2LMIA 3BN7A 3WZ0A 5GADU 1OS5A 3M8PB 1N34F 3HZGA 5A8RB 2VZ9A 1NHUA 3AQPA 2KFYA 3MR3A 3C6TB 1HBMB 2RSQA 4B02A 1DHMA 4GVLA 4D3HA 2XMWA 3GFXA 2KFZA 3NS7B 3BF4A 2N4CA 3AAWB 1TUGB 2FVQA 3ZZYA 2WVEA 1LW2B 3EVOA 3PX4A 2LQBA 2L48A 1YLXA 3BBBA 2BKPA 1HFEL 2CZ4A 3QRQA 5GAGI 1NMEB 2CPIA 2XYPB 4DSLA 1YTYA 1RI7A 1HQUA 2XSJB 1U1LA 5DG7A 4KY3A 2CQBA 3Q2TC 3I9ZA 5J1EB 2LDIA 4BWJA 5D4OA 4OHVA 1NZ8A 1H6KX 2E9ZA 3LA0A 2UUCJ 2ZH2A 2VA3A 1KLMB 1DTTA 5IS2A 5GAGU 1X31C 4AL5A 2XMVA 1R8AA 2YY3A 4DG1B 3HX9A 2QLWA 3IR6B 5KFXA 1DBDA 3D9BA 3H2LA 3Q24A 3QJLA 3BS9A 4K4SA 2MQNA 3K59A 3KK1A 3W63A 3W2VB 2CFXA 5E2QA 2RKIA 2C3PA 1KSPA 3MEKA 2JLGA 3G6VA 3VAFA 3FMWA 4OJ3A 4RW6B 2YX7A 5K20B 2ZBPA 4ED4A 2QC3A 4Z7CA 1LNQA 2HK3A 5ETTA 4WP9A 3THVA 1CJTB 3MMCB 5G0RB 1FKPB 2X1AA 3J81j 3EDQB 2KU7A 1MMDA 3D4JA 2XGQA 1GTEA 4X66F 1YZ6A 1S59A 3POTA 2KJVA 2ZH1A 4ZKAA 3KLHA 3BPDA 2CQ4A 1V3SA 1MROB 1RHKB 1UPPA 2P6SA 2OGUA 5G4DA 3CXCR 2IRXA 5IWAF 4LF8F 3B6BA 4DL0C 3MECA 5HMZA 4WFXA 1F9HA 5HROA 3GP9A 4JOUA 1P9QC 5DLGA 4KGVB 4F25A 3NGUA 2ZD1A 2MKSA 2C2EA 2LDYA 3QGGA 4ECYA 4X4PA 1XMOJ 1LXNA 3QIPA 1T0TV 1K0TA 2CJAA 2FJXA 2OTJS 4LF4J 1F60B 3HO1A 1RLCL 2HBYB 2HS0A 2ZJRQ 3GFHA 5DGBA 3VGSA 1PC4A 1U02A 4V19J 4M5MA 3CDWA 2FGCA 1M5OC 2VOPA 2MJNA 4A8YA 5CZXA 2IMWP 1RT2B 1UP1A 1N56A 2ZHOA 1HW9A 3MEDA 4AXJA 3Q8UA 2OPRB 4YQWA 2BANB 4OI1A 2O67A 3PRBA 4BWMA 1IXKA 3HHEA 3UVJB 1RWWB 3A12A 4ZLJA 3R5GA 3CJKA 3A8JA 5KFTA 4HDGA 2HHSA 4Y00A 2YKPA 1DJ0A 3KMSA 3MD1A 3TO8A 2JRSA 1FCAA 2DNYA 3ZZUA 4Y65A 5DRKA 1CC8A 1G2EA 2BRKA 2XI2A 4OZ0A 2PEHA 3PO4A 3M6WA 4BC7A 3MPYA 1UAWA 3TZWA 1CJVB 1CC7A 5AJ3J 4IRKA 2ZKTA 2E66A 2ZHBA 4ECRA 3MEEB 3DLEA 1RU2A 3VV2B 3IBFB 2VD3A 4P2XA 3QGIA 1XJWB 3BSAA 1X5PA 2YKOA 8AT1B 1N48A 1NCLA 2G1HA 4X62F 4NLPA 5CAAA 1U1PA 5KFEA 3AXMA 5KFDA 5EN1A 1V3RA 2K8GA 2XLJA 4O4GA 4JI0F 5KT6A 2HFOA 4DN0A 4JYAJ 3H5UA 3OV7A 3P49B 4OYMA 3O8WA 2OLWA 1JLAA 4J9VA 2QMUB 2CNOB 4NPOA 3FCVA 4DHVA 4DL6A 2LLZA 4M5DB 5GMDA 4CIOA 3B4DA 3HHDA 3H59A 2CXEA 4RWXA 3ZTRA 4ZDNA 4CYUA 4ECSA 2BUNA 2FZCB 2VUGA 1IKVB 1XK8A 1U6FA 5A8WA 1JLEA 1WF0A 2IJNA 3S01A 2P6TA 1VQLS 3GFYA 5EWEA 3IAS9 3L3CA 3TQEA 1OO0B 1PO6A 1VC5A 3KJVB 1BQMB 1F9FA 1TVRB 2KRBA 4H54A 2KYXA 2DNHA 7AT1B 1I1GA 2OUGA 2XGPA 3Q23A 3UR0A 1MMLA 2J8SA 2FVCA 3AQOA 3T1YF 2HW3A 3UQSA 2F9JA 5CYMB 2VKZG 4BDPA 4A46A 3ITHA 5D8HB 1G6BA 3CT9A 5B0DA 2C2OB 4HYKA 2ALZA 3SSSA 2W7AA 3G6ES 2DEJA 1JKHA 2EFNA 3MDFA 1CJKA 3KUGA 1FTRA 3M05A 2O01C 1ZTTA 4LF5F 4QWBA 1FRJA 4RPFA 4KKOA 4LFBJ 3W62A 1Q0NA 2HWIA 2XM3A 2AX1A 3Q2SC 3DLBA 2V94A 4DR7F 4DU8A 1MN7A 4I0WA 2MDAA 3R5BA 1P8GA 1YBTA 2BRLA 2IC3B 1XNRJ 3C2PA 1NHVA 3LH2S 2NUUG 3HFVA 1SUQB 3RU0A 4B3OB 1N32J 1EIYB 1TL1A 3NAIA 4LUBA 4ED6A 3S7RA 3HVAA 4QR2A 4WPAA 1D3WA 3T5HA 3E8OA 1RLDA 2D3OR 2QL5B 3DOMB 2YH1A 3ONQA 1KOOA 1SC6A 2C3YA 2NSCA 3GE9A 2VU5A 2F63A 5KT2A 5CYJA 3J7Z5 2F8HA 2OSQA 1MWQA 1I94F 2G2YA 3D66A 1JJCB 4BBYA 4CLLA 1UW4A 3D0GE 4EMDA 1N0UA 2IMOA 4RNOA 4DQRA 2DR5A 4N8OA 2C2ZB 1IKWB 4MKVA 3W2WA 1UMJA 1BUXA 5CCMA 3W9HA 2MTLA 3EGNA 1MU2A 4ZVHA 1U1OA 2VFTA 3GPAA 2V2VA 5KFAA 2YWWA 2NCKL 3JQKA 1HWUA 8RUCA 2RHQB 3JAMU 1RT1B 2CPDA 5AE1A 1RA7A 4IO9Q 3PKMA 3R5AA 4FF1A 3CD6S 1RWXB 2YKNA 4OQJA 2B4VA 5HATA 1U4BA 3LGNA 4J9OA 4P10A 4RU9A 3FEXB 2DY1A 1U1MA 3UD4P 1BQNB 4DQPA 1VGYA 2UZAA 3KJFB 2UVRA 3A8KA 4DX5A 3GJTB 1YWXA 3OFGA 2AX0A 2EBEA 3LALA 4MFBA 3Q8SB 4HACA 2K2PA 1NKEA 1SV5B 5J2PB 1K44A 1WI8A 4ELVA 4A8QA 2CQCA 2YWFA 3GV8B 5KFNA 2R42A 4HKQA 3G71S 5EUHA 2CWXA 1VBYA 4DQSA 3LP2B 3WC2A 2VPXB 4OLOA 2PMZD 1WC0A 5KFYA 3MUVP 4L76A 5B0GA 4XIUA 2CJXB 1GEHA 1TKZB 2YVSA 5K5MA 3R8YA 4EFAC 3D68A 4P52A 4IH6A 3UR3C 3W8GA 1Y00A 4FVMA 4EO6A 1A0OB 3L09A 3BSOA 4CWBA 3HHLC 1EB0A 5DQGA 3KLIB 3OT9A 4LF7F 2ROPA 3RJMB 3ZTOA 5K14A 2K1RB 4JP8A 2GVZA 3HD1A 3IM9A 5IT9Y 3HSGA 2DKOB 2AF6A 5SZTA 3DLLQ 1IKYA 2W7OA 2AJ1A 3ZNJ1 4LRFA 4DPUA 1S57A 4QJVA 1TFYA 2HURA 4OZLA 3CCRS 4G3IA 4IDKA 3G82A 4K5RA 3SMZA 5HO4A 2BE2B 3TP2A 2BACA 3BM7A 3O44A 3RUBL 1KC8T 4OI0A 3HVTB 4WKRA 4LF6J 3QO9B 3PY8A 2G9OA 5L1JA 3I96A 2A1BA 4Z7YA 1S12A 1EJ7L 4DX7A 1KN6A 3JSBA 2AT1B 2MLYA 4MIAA 2F8EX 5HLFB 1RT3A 4NL5A 4Q45A 1K8AT 2OSRA 4K0KF 3U27A 2XULA 3LPEA 3SYZA 4YB5A 5DDPC 2B9YA 2ZH6A 3BH7B 4UUWA 4E98A 3KYLA 3BV8A 1CJUA 4CTAB 1SJ4P 2WK4A 1RKJA 2FJEB 2G0IA 3RAMA 2WSEC 1RBOB 1WG4A 4X64F 1SH0A 3LOUA 4R8UA 2LEBA 1OIAA 1FRKA 4USKA 2APOA 4ETXA 2ABYA 1VBXA 1JX4A 4CO5A 4ITSA 2ZUGA 2HNZB 4JI6J 4Q2MA 2E5LF 5I3UA 2WSFC 4OLPA 4KAIA 2J7UA 1FJCA 4CQ1A 2W1BA 4JI4J 2BV3A 4Q5VA 5IXUA 2DGVA 4JB8B 3NLCA 3TUIC 3M8QA 2Z4PA 3MCNA 5KT4A 4C0OC 1GXUA 4WFAQ 4D3GA 2NXCA 2C2RA 3R2DJ 3FDSA 4JI3J 3HHLB 1RAOA 1HIYA 4RBVA 1OPIA 4QQBA 1HNXJ 4F8RA 1FXLA 2NSBA 3P3DA 4CLZA 2QA4S 3PYDA 4WZQA 1S6OA 2NYIA 2ZWOA 1ZAWA 4U7UK 2DCLA 3IN5A 1Y3KA 4Y2KA 4DV5F 3FCHA 2HZAA 3I87A 2HQDA 5B09A 3THPA 2EK6A 5HMXA 4CDIA 4LSNB 2CNKB 3LP0B 3NWRA 3QSIA 3GILA 1FRXA 3PNIA 1LFPA 2WB1D 2AYGA 1SIZA 4IO1A 1AW0A 2D7SA 5CQGA 1HNWF 4JI7J 2J6TA 3R5DA 3Q83A 5HAOA 4I2PB 2MY7A 2Q1LA 3OVSA 4CLUA 2W2MP 2K06A 2PA3A 2ZOFA 1N34J 2IBOA 3CDEA 2LXUA 3FFIA 4PQUB 3ILJA 5FD1A 3OR2A 2HGLA 4ED0A 3KK2B 4ANCA 2ZZTA 2GZOA 4W4MA 2J9DA 4K8RA 4Q0BB 2CJBA 1BE4A 2MKCA 1C1CA 4ZVTB 3I32A 2Q3PA 4KHRA 3HVWA 4ECUA 3PW2A 1VQYA 3DRPB 1QAXA 1TR0A 1SQEA 2EW9A 2KHCA 2C2MB 2RILA 4KIAA 3ET6A 2F5GA 4FBUA 4NCGA 2FHJD 4A4JA 1K47A 2IM0A 2ZHAA 3M8PA 4EYIB 3TUPA 2JHEA 1ZA1B 1T05B 4KGZB 2FDNA 2DGTA 4KSEB 5LJ3Y 5F9NA 1HBMA 1FE4A 2JLEA 1W2BR 3M8RA 1URNA 2M70A 3BBCA 3ZTSA 1HWKA 4YMEA 1VHIA 1S0OA 2XMJA 2U1AA 3TUZC 2XHCA 4ZPWR 2ZWPA 1OWXA 1RTZA 3WIUA 4KPYA 4WXOA 1RT7A 1IQTA 2GQQA 3DDKA 3RRHA 3FBEA 1L5UA 4RKUC 2Y9HA 3CMQA 1VQ8S 2IPOB 4OYOA 2XZTB 2IYGA 3DLKA 1QE1B 2HSEB 1KLMA 1AZSB 3JTOA 1Z2ZA 1N8RT 5KFPA 3I56S 4NCBA 1VJWA 3MZIA 4X66J 3PTWA 5DO2A 1V5IB 2F4VF 1CG2A 2R7QA 4CP5A 4OHXA 2ASJA 4C3MA 3GSIA 3IWLA 4YHHJ 1RTHB 5M2PA 1XNQF 1SKRA 4QIFA 5FDLB 4HL9A 3OFHA 3IGVA 3PO5A 2GJFA 3KLGB 5E3CA 1J5EF 2HVZA 3K5PA 3UN2A 1NJYA 2WAQD 4OZ2A 3ZZOA 2B4PA 1QSSA 1WC4A 2UUAF 4RW6A 3JQJA 2WOMA 4O23A 2YNFB 1S0NA 1CBKA 2CKWA 2GJIA 2VBWA 3I4PA 3MMCA 1CSJA 1REGX 4LRAA 2IA0A 4OI6A 2XEXA 4QPXA 1X5SA 4C3KA 1B64A 3HULA 4PRFA 2GIFA 3LQVA 4PCQA 4RW9B 4W92B 2FHMA 1RAIB 1S77D 1GTHA 2ZE2B 3GB0A 4O4RA 3K8WA 1MROA 2HYIB 1UETA 2WW8A 2IFXA 2RRNA 1WJ9A 1HHQA 2DY9A 5IZHA 2OEJA 4DR5F 3FSXA 3A3PB 1Y11A 3FZBA 2CPJA 3Q22A 3UN5A 2GHWA 1VI7A 1QVFR 3PG9A 1OQ6A 1TL7A 1JLCA 2EVZA 3SIPB 1IBCB 4OZNA 3W8PA 2U2FA 3OD2A 1SPBP 1X5OA 4URQU 3KUEA 4A8XA 2F8MA 2VKRA 3HSJA 4USVA 1PSDA 3ISND 2VHGA 1M5KC 4DV4F 2VG7A 1S7IA 4U96A 2MKKA 3ZZZA 1MLAA 1TKTB 1N5YA 4N5SA 1WELA 1L3TA 4K2JA 4AD6A 1GX6A 1OY6A 4G1PA 4WYLA 4RW7B 3OL7A 2BANA 1T9VA 4W98A 2IBKA 3QMQA 3ZO7A 1HW8A 2BQ3A 1PJ5A 4CO4A 3V6HA 5HANA 2B6AA 5T7LA 2EKNA 4MK8A 1PGZA 2VC0A 3DOLB 2FGOA 5C2GA 2Z57B 1ULRA 2J0SD 3M2VA 3MM5A 1HI0P 1TUVA 5GMEA 4OZ1A 3ZXWA 3M7VA 4O44B 2R7SA 4Z2XA 1LK7A 1RT5A 1C4AA 4DPYA 2QLBB 4I6WA 2DR9A 1RAAB 2DH8A 4KV8B 1B7YB 2AYMA 4PG5A 2MSTA 4X4UA 2OI2A 4QU7A 2ZBRA 2F65A 3D0HE 1AT1B 5LOQA 4DV3F 2QT7A 2J7KA 4ZCLA 5AE2A 4Z37A 2BMBA 1VRTB 1NU4A 4NI2A 2YTCA 1FJGF 3D28A 1SQFA 4WK1A 3NMRA 3J7ZT 2IVFB 2V2ZA 3MR6A 1VQ9S 1Y3JA 1NSAA 4K4TA 2UP1A 1FNXH 5FLXY 2E1RA 1HNZJ 1REVB 3RBDA 3CB4A 2CVEA 2MQ8A 5ETLA 1RUSA 2FLOA 4JBCA 4LMZA 1LEOA 2YNIB 1CQNA 5HBMB 1VBKA 3IRXB 1AROP 1ACMB 1T03B 1DAXA 4IFYB 4K4WA 1U48A 2XB2D 1CEZA 2CQPA 3QFWA 3R6GB 4WWSA 2VFUA 1V3ZA 2R4FA 2MZJA 2R7UA 3NEKA 3M6UA 2FD2A 1K1SA 3FEYB 4CT8A 2FPHX 1S0VA 4YFUA 2EK1A 3CJRA 1PKUA 3GIIA 4NZ7A 5A8KA 2HQCA 3NMAA 2B4OA 3M2UB 3ISNC 3ELHA 5HVHA 3PW7A 5EWFA 2NXJA 3K0JA 4KBIA 2AU0A 2X7IA 3DMJB 4QWCA 1A7GE 4HTJA 1BGXT 4WE1A 4PR6A 4DI6A 4DS4A 3RGIA 3CJQA 4CLSA 2KYZA 3DOKA 4BC9A 1TKDA 1E6YA 4DV1J 5AE3A 2W4CA 3S1TA 2DRBA 4MH8A 2CZ9A 1C1BA 2WB4A 3ZTQA 4ID5B 1S1UB 6AT1B 1BQMA 4Q2LA 3EZUA 4FXVA 5IC6B 2Q6BA 2HMIB 1EHWA 1WEXA 4RX6A 2KZMA 2ZDOA 1X0FA 1UWAA 2XLIA 2DNOA 5HJXA 4DR7J 2YPZA 5D4LA 5B0FA 2ZUAA 3GYGA 4OYBA 3CULA 3CCWA 5DDOC 2X1FA 2XY6A 3GWCA 5B0AA 2R7WA 4AXIA 3EVMA 2R7RA 4DR2F 5D6GA 4A48A 3T1AA 4HHJA 2HG4A 4U7UD 1YI2S 5H1SV 5BYSA 1FRHA 4X84A 1NB7A 4H4MA 1EZZB 1T9TA 1NJXA 5F0WA 5CHCB 3PR4A 3HD2A 3ADAC 2V8PA 3OSPA 3R27A 2MHNA 3U1LA 1G7CB 5H9EK 2NZ4A 1FHTA 3G2XA 3IS9B 5DG8A 2ROEA 4ZVEA 4C0HA 3TNVA 1FK9B 1I6JA 2IC3A 1VQSA 2RIJA 3LP1B 2PFDA 1S97A 2VIHA 1DY3A 2V69A 4U7CA 2J5AA 3N28A 2RAQA 3GIMA 2JSXA 3W65A 4X4TA 2B7BB 3I82A 4EK2A 4CLTA 1O6XA 1DLOA 2BJ8A 1U24A 3ICLA 3GR1A 4J9UE 3AD7C 3NNHA 2DGWA 1UJ4A 2OTLS 4WZMA 4M1KA 1R0BG 1FFSB 1KVJA 2UUBF 5B08A 2B9WA 2AD9A 4IUFA 3R7BB 5U47A 2ZFHA 2LVWA 3K5LA 5CYQA 3T19A 3QRRA 4NA1A 3Q89A 4TYAA 2CPZA 2UV8G 4LVNP 2Z2ZA 2FQQB 1ZPVA 3SI8A 1PYSB 3AOCA 4C8MA 5L9XA 1UZDA 2Z2MA 1RSCA 1VK8A 2D69A 3IR7B 3K57A 1RP5A 3I0SB 2VL1A 2FUG9 1L3UA 4ED8A 5K8PA 5HI7A 1G4CA 1D9DA 2CVIA 4RU2A 3AD8C 1ZH5A 3CCSS 2HFNA 2AMCB 3IG1B 4IOCQ 2ZDPA 3M2RA 2IRYA 3G86A 4P2SA 4IH7A 4GO7X 4LF7J 5KT7A 3E2EA 4QWAA 3FBCA 4ZCMA 4C0BA 1S6PB 5T14A 1KP6A 3MMAB 1N6QB 1WD6A 2VA2A 1S9GA 1CS4A 1R8PA 2YKQA 3LP2A 3JSMB 4DUYF 4USMA 2B4UA 3TOQA 5C5JA 1NH8A 4CO0A 1M5PC 1NPRA 2AJ2A 4LFCF 4DV2F 3P6YC 2W4PA 4GC6A 2HHHF 4TLQA 3OVAA 2MZQA 2EBGA 3SCLE 2GAGC 4AUKA 4O3SA 4F4YA 2EG1A 1RJJA 4LBHA 2QMXA 3DFEA 4K0KJ 4FKYA 5HVFA 1UKUA 2RF2B 3VAKA 1MWYA 1URRA 4DF4A 4AFFA 2FC8A 3DLGB 1ZM4A 4RNMA 2GQ2A 5F41A 2P2CB 4ED3A 3I5BA 3CC4S 3G8SA 3UCUP 2X1BA 1R7IA 2Z0GA 4PXCA 4PWUA 1YJTA 2LP4A 3DDIA 2UU9J 3CVKA 3A1YG 5BYRA 2Y0BB 3CW2C 2E5LJ 3QO9A 4F2RA 1NDKA 4HVZA 5LJ5Y 2JFDA 1XMQJ 5GAEI 1PG5B 3IBWA 1KHWA 1IKXB 2GV1A 4J9KA 3SCJE 5K8OA 3HMJG 3BKTA 1NK7A 2C28A 4OJ1A 4DPOA 1OPZA 3K58A 2R8KA 5A0YB 3RZAA 1IVZA 1RAEB 3MPDA 1SIWB 4YDDB 3BBFA 2H1YA 1N5QA 2B7CB 5GAEU 1Y5NB 1BHNA 1LWCA 1LWFB 3RRGA 1LW0B 3NCPA 2ZZNA 5C42B 2CPEA 1S1TA 3TJAA 2G0CA 1RTJB 2A0FB 4M95A 1RABB 1QUVA 4PG6A 4TLRA 2V4QA 4DV5J 4OHYA 1U49A 2HRTA 1SL1A 1PBAA 3QATA 4F36A 4NASA 1U26A 1WI6A 1RWOB 1FERA 2RDJA 2YQ3A 3DRYA 5EX0A 4QR1A 3QSYB 1RK8A 2UXDJ 5I42B 5LT5A 3QRPA 3Q8RB 4PYAA 3HHLA 1Q8IA 2Q43A 4GKJF 2RE1A 1TKXA 3J80Y 3KNAA 1FE0A 2AZ1A 2ZJPQ 5ETPA 4EO8A 4EBEA 3WDOA 9ATCB 2G2OA 1JLFA 4N47A 3GMGA 4Y2MA 4RNNA 4FYYB 1GMWA 4MTPA 1M1HA 3CCVS 4K7QA 1XN9A 3OTEA 3L7PA 1RE1B 3U1NA 1X4HA 2DRDA 5D3GB 3DI6B 2C1EB 4KGKA 4LSNA 5KOXA 3LP0A 4ELTA 2VICA 2PIIA 2NLWA 2DHXA 4KGXB 4WXWA 2I38A 4QU6A 2B8PA 2OMOA 2W2QP 2RVJA 2DNNA 3JSRA 5EHHA 4CO1A 4RZRA 1GXLA 3IFEA 3DYAA 1SB6A 2J9EA 2P5VA 4ZLNA 4B9VA 3BGRB 1FO1A 3QAEA 3QJPA 1N33J 2HKEA 3UCZP 3V6JA 1UA1A 4CCHA 3J7A1 3H98A 5KFBA 4K2XA 2CAJA 3NP5A 1S1XB 4MK9A 1S1WB 2ZC3A 2R7VA 2DR7A 2VG5B 2KG1A 2IAJB 5KFHA 4IG0A 1JB0C 1YJRA 3RR7A 1KVIA 4U9RA 1VFJA 5F9LA 3GV5B 3BR9A 4M63A 1O8BA 3VCDA 1T8EA 4B17A 2QE5A 1X9WA 2X1GA 1NJWA 4HT7A 1X7VA 4G1QB 4ZPVR 1T05A 3RG6A 4X4VA 2PFFB 1FX4A 1TL3A 2HHPA 2BR0A 4HT5A 5IFMA 4AL6A 5HP1A 4LRBA 1RB0A 4ELUA 2AP6A 1VQNS 2DPIA 2F4VJ 5D78A 3GONA 1S6UA 4EZ6A 1GAOA 1SXLA 2M4MA 2AJ0A 1XNQJ 3EMTA 2E1PA 4EI2A 2ZVSA 4RUHA 1J5EJ 4XO0A 1AFJA 3DRXA 2B5JB 2JL9A 1FKOB 1X4GA 2UUAJ 1FX2A 4TU7A 4CH1A 1SKWA 1RYRA 2WONA 1QSYA 2V2QA 1O5JA 4OX9J 5J2QB 4B9UA 5DDQC 2CUYA 2IM1A 1AZSA 2W2NP 1QAYA 4ZN3A 3M9MB 3EE3A 2BQUA 2DXFA 2E29A 1I3OB 4HI1A 3IA0A 1IN0A 1XMBA 2CIMA 3CJ3A 3SQGB 2W24A 4IFVA 2VBYA 2YNGA 5JXSA 3MM8A 3M6VA 5FDLA 4PG7A 1ITPA 1UWBB 4I56A 1HBOA 2V8HA 1WC1A 4ZP9A 2C22A 3OSNA 4NLYA 2HFUA 1EKRA 4DR5J 2JJ4D 3BGOP 4DR6F 3FBFA 3JS9A 1R0AB 2J8AA 1TL4A 1O0PA 4MYUA 4NLTA 1RWKB 4ZCIA 2C3UA 2M7SA 1LWXA 4WBFA 4WFNQ 4ECZA 4LFAF 5GAHI 2D1CA 3KJQB 4NLSA 2V68A 2FJDB 2W25A 3E01B 4RW9A 1F3FA 1PJ7A 2O3DA 3DGPB 1BWVA 1TAUA 3I55S 2GHPA 2D9OA 4FZVA 3UDCA 1WHYA 2ATLA 2CQHA 2AGOA 4NLRA 2R7XA 2JLFA 4PAAA 2QA4G 3HLUA 2DH9A 3ILLA 1OSCA 1KLNA 3EWGA 4YUDA 5GAHU 2R2TA 4NZ6A 3KK3A 2X3DA 1F5CA 1QUPA 1R8CA 2WVFA 1U1KA 1NBEB 2O5DA 4LQ9A 2E1CA 1LFWA 3WIVA 3TA0A 5DM6Q 1D9FA 3V81B 3S8SA 4KFBB 3N0VA 2ZOMA 5KG4A 4L75A 4F0MA 2HBZB 2HWTA 2YNHB 1DQ9A 5DS7A 2WTFA 2LEAA 3NG8A 4JI8F 4Y28C 1Y7PA 4DV6F 1ZOTA 2FLPA 1MSWD 1VMBA 3UE2A 4MKBA 4EBDA 4ILMA 1HBNA 3KLFB 4DV3J 1B3TA 4M5LA 4RW7A 2XMTA 2GVDB 5IQQA 1Z1ZA 2IHR1 2LU1A 2VG6B 2L41A 2EFGA 3QNWB 4PWDA 3NRBA 1VCTA 1IUJA 3D6MB 1JLBA 1FNMA 1BD6A 3HK2A 4RUCA 4I4BA 2L08A 2W2OP 4QCLA 2MB0B 2NS1B 1VS3A 1S1VA 5KTQA 1B70B 2BE7D 1NUEA 4B3SJ 4C97A 3EYZA 5ETKA 1V9OA 4OYZA 4OX7A 2SXLA 2V4JB 3DM2A 1EQ0A 4RW4B 1F2HA 1IR0A 3MAAA 2FJVA 1RAHB 4OYPA 2DHAA 2EC2A 1X9SA 4KH0B 2HGMA 2FHKA 2LCWA 1UCNA 1HQEA 1GQEA 1W7WA 1BXNA 1SC4B 4R0EA 2HHQA 1ELOA 2CZVC 3T5LA 3JB9k 3IRXA 5D0RA 4V19X 4ZVPB 1RWNB 1JJ2R 4O3PA 4ILRA 1YKWA 1KKHA 2N4DA 2AWZA 3BZQA 5IM0B 2EFQA 2OP5A 2RQKA 1S99A 1JXVA 3N6NA 3DKDA 3M2UA 3RBEA 2W9CB 2GJ2A 1RT4B 4EEYA 1GMVA 3MMBA 4CLWA 4B08A 1JLQB 1D1UA 2WBRA 2F3JA 1Q8BA 4LBIA 2DVIA 2J9DE 1EARA 3V4IA 4IKAA 1FJEB 1VLYA 4KYZA 2ZBCA 5F8IA 2BX6A 2ZH8A 2ZBQA 2KXHA 1DZ5A 4LREA 4PG4A 5IQ6A 4DR2J 4NLDA 2Q79A 1D8ZA 4R5PB 3KHHA 5HQLA 1YK9A 3OLBA 1APSA 3W5XA 3FGVA 2P9CA 3ENQA 2CA9A 3SDEB 3ILIA 1TQLA 1VDHA 4UF4A 2D3ZA 3VF0B 5A6PA 4X4SA 1KONA 4KHMA 2HMIA 3P5TL 2X3GA 4F4KA 3MI7X 1N36F 3BN4A 3NGTA 2L9DA 4OZ3A 4HH1A 3TA1A 4ECWA 2A6MA 3TUJC 3IC1A 3PXGa 3MEGB 1VBZA 4FBTA 1QLNA 1ZAXA 4MIWA 4MK7A 2CG8A 2DO4A 1GXTA 3UDLA 4ZIWA 3QYYA 1U25A 1NSPA 2MY8A 2RS8A 3V6DB 4AQYF 1Q5VA 1Q1KA 1VC6A 2IJFA 2FLNA 3GV7B 2G13A 4Y0FA 3UD5A 1SKSA 3JQMA 4J90A 2UUBJ 3OFEA 3OTDA 2DR8A 3DRSB 4P72A 4J9NA 3H25A 1WUUA 1TK5A 3M30B 4IQMA 1YVFA 1FK9A 3G6YA 1WG5A 4M5IA 3ZZRA 1HQUB 3P5BP 5THWA 5MLCV 3ENWA 1U1RA 4ES3A 4DR1J 3C16B 3WBZA 2KL8A 4L73A 3O3LA 1M1GA 2LQJA 3BDPA 3FEZA 2PE8A 3KXDA 1RWMB 1PJ6A 4DSJA 2QTWA 3TWZA 2KH9A 2XS5A 4TN2A 5HQMA 3Q8PB 2XMMA 1VQKS 5KG1A 3TANA 2M3DA 2RHSB 2VBXA 3R7SB 3CD7A 2VODA 4HEA9 3KUHA 3F56A 4USIA 1RWVB 2K3IA 2C3MA 5IV3A 1QDUB 1KFDA 4C7QA 1S49A 2RKIB 1H72C 4DV0F 5JVGQ 2M5YA 2GGPB 1UEKA 4NMLA 4ZP8A 1TV6A 2UUCF 2VPZB 4DSKA 1RAJA 1HL6A 4AYBD 3L7UA 4C11B 1YJ7A 1YQHA 4OHZA 1UVIA 4DFKA 4O0IA 4DPTA 4F0HA 2N7CA 3KLHB 4DUYJ 4NEZA 1YBAA 6FDRA 2KT2A 3W9IA 2DK2A 3JYTB 2J6SA 1FT8A 3KLEA 2KG0A 2RH3A 1QAIA 3HF5A 3VR1A 4LFCJ 2F1FA 2DISA 4DV2J 4DV7J 4DLGA 2QEXS 3K89A 2D3O1 2NYHA 3IG1A 1VQMS 4DN9A 5E3RA 2PI4A 3MM6A 3G96A 2E44A 2FIUA 5F8MA 2GS8A 1OYEA 4JV2A 4G6VB 1AYEA 1S9EA 3LW5C 2A3JA 2ZD1B 1YRUA 3ENVA 2CNNB 1UW9A 1S6PA 2YKMA 4FDFA 2UVUA 1MN9A 4PXBA 3MMAA 1N6QA 1YBUA 4ZHRA 1ZAVA 5IT0A 3QIPB 1I5OB 2OO4A 1F1BB 1H7WA 5KFGA 2RUSA 3D67A 3TVYA 2N82B 2NXNA 3D2WA 5L1LA 4DZDA 1AFIA 5L46A 2VF3A 5L39A 3M32A 1S4FA 2Z56B 1BLUA 4GVBB 4C98A 3KNGA 4YY3F 2DIUA 2PSZA 4I1TA 1RCXB 2HQGA 4GRSA 1HQ2A 4A8MP 1HNVA 4NLXA 1JXLA 2Y1IA 4IG3A 1FKAF 2QG9B 2BW7A 4DR3J 2AYBA 1IR1A 3FQKA 3O5TB 3HJFA 3CJKB 1XMOF 5LMNJ 2FLLA 2FVSA 1U1NA 2PD1A 3A4TA 4LF4F 3OHBA 1Q86T 3QQCD 2KJWA 1UFKA 1WOSA 1S48A 1FDBA 2QL7B 1KQFB 3ULHA 2GIRA 5A76A 5KFCA 2OFHX 3QWUA 2HEKA 3AH6A 1HMVB 4DL3A 2QYCA 2RNEA 4F3QA 3EUNA 4ANEA 2LKZA 2XG8A 3RAQA 3GSDA 3VGTA 1F3VA 4C8ZA 1NHKL 2OMLA 1RHQB 1GT8A 1T02A 3DLEB 1U1QA 3P96A 4P73A 3DGVA 5ITHA 2AKWB 3AT1B 3MPUB 3HJVA 1FRMA 4OI2A 2RT3A 5ETOA 2NPIA 1OY8A 3MHYA 1NXIA 2H48B 3PX6A 4YS2A 5IT4A 3SBMA 2GMLA 3OR1B 1C0UA 4PABA 2WVDA 1NLKL 5DDRC 2FJWA 1JMTA 4URSA 3TR5A 2NXEA 2DGOA 3UNGC 4O4GB 3GTYX 3MD3A 3SCIE 1IBLJ 4ZPBA 1JLAB 4NXMF 1KNZA 3MWBA 2L9WA 3RTVA 4ED7A 4USJC 5BYQA 1X60A 5LSRA 1QD1A 5L1KA 3CWJA 5I42A 4ECVA 2B9EA 4LIWA 4LT6A 2XMUA 1UA0A 1FXRA 3IWNC 2XNRA 1WSVA 3MCSA 5J2NA 2CPYA 2NREA 1Q53A 1JLEB 1KHVA 2YBVA 4DUTA 3RRKA 3ISZA 4NWBA 3VQTA 2M2BA 2DO0A 2H65B 1NDCA 5E7OB 3NCRA 3BREA 5DQHA 2QV6A 4NX9A 4UZCA 2XWXA 1UVNA 1FEEA 3DI6A 2OEMA 3FUYA 2RRBA 1RCOB 2FVPA 1C0TA 2V8DA 4DL5A 4WTYA 1RA6A 2JOQA 2HVDA 2HBQB 2CADA 2MZSA 3GFZA 1NAQA 3AA8A 1FEHA 4I68A 2BDPA 1NPPA 2CJYB 3ITHB 1NJIT 4Q43A 2DGSA 4TQRA 4F3MA 2JEGA 1ROFA 1WHXA 3BGRA 1JKHB 2LQ8A 2IJRA 3M6XA 1N52B 3C46A 3TAPA 1GK8A 2AJFE 5C24A 1LWEA 1S1XA 3CPWR 2EFOA 1S1WA 2BBEA 4YR0A 2YPYA 1YJUA 3TEHB 3GYNA 1EETA 3SV3A 3QLHA 2XTJP 3DCAA 5D0EA 2MKYA 3VAHA 2Y8YA 3KHGA 3GYXB 3NY0A 5F3ZA 4FPRA 4G1QA 3HCXA 1U0HA 2HIYA 3ZFVA 3ENAA 4JI2F 2E1AA 2I8EA 1TL1B 3BB5A 4PUOB 2ERRA 1U2CA 3PV8A 3K7RA 1R3NA 4TYBA 3OTCA 2VQFF 1N5VA 5JMNA 4LJMA 3DXBA 3VVTA 4BCAA 2MEWA 2QSWA 1NRKA 1IM6A 3H8YA 4H4KA 5SUHA 4LSZB 4OX8A 3TX8A 2JEIA 3W5ZA 1HD1A 3U7JA 1KDNA 2B5JA 3H0PA 3BEGB 4DR6J 4LSLA 1Q7LB 1XNRF 4XAKA 3NL0A 4WU3A 4O3RA 4KO0B 5HSPA 2ACMA 4FNIA 2Z2YB 1X4FA 4ZVSB 1N32F 4ETZA 2VJVA 2XCAA 1KVKA 1ZETA 3W2WB 1M5VC 5C7PA 4PKDB 2AV5A 1MU2B 4UOCA 2XO6A 2ASDA 2HHXA 1PBUA 1D9AA 1JK9B 3WHIA 3FK4A 4F4AA 1UWBA 3U02A 2BA9A 3N9UC 2Z2LA 3MM7B 1F2GA 4ZP6A 2W01A 1R0AA 2BE9B 1KBRA 2UXCF 2PO4A 3A3NB 1RTIB 4MT1A 3H4DA 4UTGA 2WBMA 2BOAA 5KG5A 1IWGA 3Q8VA 3KTQA 2BEFA 3D5MA 2E9RX 3J7AN 4RBTA 2CPHA 4F26A 5T41A 4QIGA 3E01A 4HACB 1KEKA 4O3NA 1RQ0A 2KFNA 4DFMA 3OHAA 2MQLA 5CH7B 3PYGA 4R25A 3E51A 5MAOA 4GKKF 1FWLA 4H4OA 2W8LA 2WZ1A 4DV6J 1YIJS 5I3QA 1WHWA 1HHTP 3CEDA 3PYEA 3HKZD 4DSFA 1EAYC 3PHEA 4WIQA 4J9QA 4EBCA 2KZZA 1RZMA 1RTDB 1QSLA 1C4CA 2PEBA 1VR6A 2GVZB 4ZPTR
chains in the Genus database with same CATH topology
1EAYC 1FFGB 1FFWB 2LP4A 1FWPA 1A0OB 1FFSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAY C;  1FFG B;  1FFW B;  2LP4 A;  1FWP A;  1A0O B;  1FFS B; 
#chains in the Genus database with same CATH topology
 5C25 A;  2FJA B;  2ZNZ A;  4S0M A;  1RAG B;  2WHO A;  2YNH A;  1HI1 A;  4I2Q A;  4QWD A;  1FWK A;  3NGR A;  1N54 B;  3N5B A;  4HLB A;  4HHH A;  1CUL A;  4KH1 B;  2R9L A;  2BM0 A;  4IDK B;  5L1I A;  3X3U A;  1H74 A;  2DCU B;  5KT3 A;  2GIQ A;  3BKU A;  2LXF A;  3HSD A;  5JUM A;  3KOA A;  2A10 A;  4HHU A;  4GO5 X;  3BSC A;  1ZA2 B;  5A2Q Y;  3V5R A;  2HHW A;  4ZVR B;  5LMU F;  1HBU A;  2GVD A;  3I0R A;  2Y0S D;  3D1H A;  1RT3 B;  1GNK A;  1VOM A;  1YJ9 S;  1XER A;  2VG6 A;  1AUD A;  4PZV A;  2IDE A;  3C15 A;  2GCF A;  1KOH A;  4BHQ A;  3TZY A;  1Q81 T;  4X65 J;  1YJV A;  1P9Y A;  3JTP A;  4Y34 A;  1CJU B;  2ZVI A;  1Q4R A;  4ECQ A;  2GO8 A;  1U7L A;  3QT6 A;  4R8U B;  3VAM A;  1S5Z A;  2BJ9 A;  4IOA Q;  2R3V A;  4OZJ A;  4M8L A;  2E1M C;  3C6U B;  3QJJ A;  4URG A;  4DCJ B;  4LF6 F;  1F5A A;  4JUZ A;  1E6V A;  1K0V A;  3TAQ A;  1XR6 A;  5B0C A;  4MMO A;  2V4J A;  2IIH A;  4RW4 A;  3HM9 A;  4FPI A;  2IM3 A;  4FF4 A;  1GFW B;  3ZC4 A;  3VHQ A;  4FP9 A;  2F40 A;  3NNA A;  1OYD A;  3S6E A;  2KXN B;  2ATC B;  5L9N A;  4QIE A;  2EG2 A;  2ZIT A;  4ID8 A;  2K7K A;  1J5O B;  2H5J B;  1M0S A;  3Q8Y A;  1JWW A;  3MM9 A;  1YG0 A;  3QT8 A;  3O6Q A;  3VAI A;  2Y1J A;  3AOD A;  1RHU B;  1IBK F;  2F7V A;  1GH8 A;  5KG2 A;  2ZZM A;  1H73 A;  4C3L A;  3D7S B;  3NAH A;  2DNL A;  2MGZ A;  5IT9 U;  2Z58 B;  4CO2 A;  2W9C A;  1RT4 A;  2J0X A;  3I6P A;  2HVH A;  1WSR A;  3NS6 A;  5AXK A;  1N36 J;  2I2Y A;  3MCO A;  4UT4 A;  1R27 B;  3PJW A;  3MGJ A;  3MFH A;  3M1V A;  3SEO A;  2MKH A;  4X4N A;  5BR8 F;  3MXH P;  3M9O B;  3A8E A;  1HA1 A;  1OSD A;  3THT A;  4CH0 S;  4UY8 5;  1NM2 A;  4R5P A;  4RW8 A;  4J9M A;  5CXT A;  2BKN A;  2DB1 A;  3NBP A;  3B4M A;  3F41 A;  4AQY J;  2H3E B;  3OR2 B;  1U0S A;  1Y4Z B;  2OPS A;  1HNI A;  1U8S A;  4P7V A;  5CAB A;  2GA7 A;  2F4F A;  1C1C B;  4CNY A;  1A9N B;  1F0X A;  4CLY A;  1RT6 B;  5JVH Q;  4JI7 F;  5D0G A;  4B9S A;  4FYD A;  1UFL A;  3ET6 B;  1HYS B;  3PDN A;  4NCG B;  4DFP A;  3DU6 A;  4ZVU B;  3RR8 A;  3NKY A;  5D0H A;  4YR2 A;  2LXI A;  2B8Q A;  4C48 A;  2C2K B;  3V6D A;  3UW1 A;  5I3P A;  4M5J A;  3M8S A;  2HQF A;  2V6A A;  1QVG R;  2FC9 A;  1MNE A;  2R2U A;  5A8R A;  3P45 B;  3TW0 A;  2LEC A;  1U09 A;  5KFV A;  3C6T A;  5AXM A;  1S6Q B;  1CPZ A;  2BYC A;  5ETN A;  2YKA A;  3DRS A;  4PPZ A;  1DFD A;  1ZZN A;  4XTT A;  1NKC A;  3BR8 A;  3M30 A;  4ZOS A;  4L3K A;  5F8J A;  4ZVO B;  3FC9 A;  3D1O A;  4ED5 A;  4DFJ A;  1RT7 B;  3TJ8 A;  3MAH A;  2QIF A;  1LW2 A;  2VBZ A;  3C16 A;  3P4U B;  4DV0 J;  2PC6 A;  2E7V A;  4FVC A;  3C14 B;  2HWH A;  3SZ2 A;  4CH7 A;  2XSJ A;  3HP6 A;  1HI8 A;  3DLK B;  3UFC X;  3ZNU A;  4LQ3 A;  1WF1 A;  2KDO A;  5J1E A;  2UUT A;  2W7P A;  2KRR A;  4CM0 A;  3EM1 A;  4USW A;  1RHM B;  4HDH A;  1V5V A;  3T6B A;  3FMB A;  3OTO F;  4NLG A;  1HWJ A;  2HAI A;  4I7F B;  4RL1 A;  2LA4 A;  3QAU A;  1SKU B;  4DG1 A;  2GQC A;  4WP3 A;  3HXM A;  3IR5 B;  2JDJ A;  3N5F A;  3OPK A;  2RQC A;  2WOM B;  2GGP A;  2Q66 A;  3I5A A;  1P1L A;  4X4Q A;  2QX0 A;  4DS5 A;  5IWA J;  4FF2 A;  2I0X A;  4LF8 J;  3R5C A;  3W2V A;  1YHQ S;  4DSI A;  4J91 A;  1SJ1 A;  3R1L A;  1RXO B;  2V50 A;  3IWX A;  4A8K A;  2J7W A;  3MUM P;  4A8W A;  4C11 A;  4RUA A;  4EUV A;  2BJD A;  2XNQ A;  1CJT A;  5G0R A;  3ZTP A;  4M94 A;  4NLQ A;  3UN3 A;  1FKP A;  4F2S A;  1UZH A;  3GIR A;  1RKI A;  4YHH F;  4B3M F;  2V8V A;  2VFS A;  3JYT A;  5CZV A;  5IC4 B;  3CIM A;  1TFW A;  4C9D A;  3TZZ A;  2VB6 A;  1QY7 A;  2GO9 A;  2DXD A;  3CJ2 A;  3HT3 A;  1WTF A;  4DQQ A;  4L6V 3;  3PEH A;  4AE5 A;  2MPU A;  2PDA A;  2P8I A;  2C2D A;  4YY3 J;  3EXY A;  4R0J A;  1TL7 B;  3D3C J;  1JLC B;  4CLP A;  4TKT A;  2CYY A;  4HI2 A;  3J7Y I;  4KB7 A;  2VPY B;  3GCX P;  1Q95 G;  4LR7 A;  4ZA1 A;  4F67 A;  1WOP A;  4QWE A;  1T3N A;  3RW6 A;  1TZ0 A;  3OW2 R;  5FII A;  4U8Y A;  2VG7 B;  3KDO A;  4WJB A;  1A6L A;  1B99 A;  3CJT A;  3WQP A;  3J7Y U;  1VLO A;  4GVB A;  1N5Y B;  3GR0 A;  3CUN A;  3BO3 A;  3PX0 A;  2D74 B;  2JH3 A;  4W90 B;  4ZVG A;  5J1P A;  3CF5 Q;  1SVD A;  3VTI A;  4F0K A;  2YWH A;  2UV8 A;  4JV1 A;  3R6L B;  2UXB F;  1RT2 A;  1Q82 T;  3QBC A;  4AND A;  4LBP A;  3SCK E;  2B6A B;  5T7L B;  2NR0 A;  4OFZ A;  2OPR A;  4ZPC A;  3M2V B;  1VC0 A;  3MM5 B;  4DX8 H;  3BGL A;  4DBQ A;  1AXQ A;  2QA1 A;  1NPK A;  3UVJ A;  2BJE A;  1JJ4 A;  1HR0 F;  3MOJ B;  2HAF A;  4DLE A;  3PIP Q;  4P2F A;  1M5H A;  5KFF A;  1KS2 A;  2DIT A;  1RT5 B;  1PIE A;  2B43 A;  2BJ1 A;  1HKA A;  3R2C J;  1H98 A;  3KLV A;  2PN6 A;  1IBM F;  2ZH4 A;  3QID A;  3G6X A;  2CQG A;  3AJD A;  5HL7 Q;  3NWG A;  1HMV A;  5DLF A;  3M8W A;  1NH7 A;  4IRC A;  4X62 J;  4DEZ A;  4LF9 F;  2POK A;  4JV0 A;  4NXM J;  3L95 X;  2XZW A;  4CT9 A;  1CJV A;  3PEJ A;  2LYV A;  4NI2 B;  4JI0 J;  4FYX B;  3OXL A;  3MEE A;  3G8T A;  5KFZ A;  1NZA A;  2OKQ A;  3H5Y A;  4CZC A;  4DDF A;  4NLW A;  1VRQ C;  4NXN F;  3OR1 A;  2G0J A;  4EU0 A;  4ER8 A;  1FRI A;  4ZPD A;  3RB4 A;  4NYZ A;  3TJ9 A;  3TAR A;  2P9G A;  3FVY A;  1MW7 A;  4L72 B;  4DR4 F;  3T41 A;  5A8K B;  1TMJ A;  1BC6 A;  5LSL A;  1S76 D;  3CJ4 A;  5E3Q A;  3CIZ A;  4DQI A;  3MR5 A;  1KWM A;  2RQ4 A;  5J1N A;  2V0N A;  2AW0 A;  2DNK A;  2A2D A;  1HNZ F;  2KT5 A;  4WE1 B;  1FVQ A;  3EPG A;  4M5D A;  3H90 A;  3G9C A;  2OAU A;  3DOK B;  5CA5 A;  2KVQ E;  2E5J A;  1E6Y B;  1WAC A;  1AA1 B;  3T1Y J;  5DZ6 A;  2CQ1 A;  2MLZ A;  1F5B A;  2HRY A;  4XK8 C;  4WKY A;  3LO3 A;  1IKV A;  2KN4 A;  4LRC A;  2KVI A;  1C1B B;  1X4A A;  2JVR A;  5K9F A;  1CVJ A;  1JXE A;  4I67 A;  4PQA A;  4DOZ A;  4P6Q A;  2GMJ A;  5D4N A;  3KJV A;  4LF5 J;  5B0B A;  1TVR A;  2QYG A;  1YRX A;  2QSF A;  1J2V A;  3H40 A;  4OYA A;  4Y2C A;  2BJ3 A;  4A8O A;  1TMM A;  3KDN A;  2D9P A;  4ZVQ B;  4HTI A;  4ATN A;  3JAM Y;  2J76 E;  5CYM A;  1I51 B;  4DV1 F;  3HZE A;  4JI2 J;  1W25 A;  1D8Y A;  2RUG A;  1LXJ A;  2N3O A;  4H4M B;  1SJ3 P;  2DJW A;  3TRG A;  2JX2 A;  2VON A;  4A47 A;  5E3A A;  2JNJ A;  3D3B J;  1B4S A;  2JEJ A;  2J0Q D;  2ZNY A;  2VQF J;  3NXZ A;  1TL5 A;  2BQR A;  3JSY A;  5FLX U;  3DXS X;  4OV1 A;  1Q7Y T;  2JWN A;  4L3N A;  2KB2 A;  2Y3Y A;  3HDS A;  3DC2 A;  3TQ1 A;  4LR8 A;  1YX2 A;  3M8Y A;  1K9M T;  1HAR A;  2I6W A;  2EXU A;  5BXI A;  1QJH A;  2RS2 A;  4YB7 A;  3BYR A;  1JLG B;  3T9N A;  1I94 J;  5HJY A;  2OPP B;  3FBB A;  5HMW A;  1FA0 A;  1DLO B;  1RIS A;  4PUO A;  2H4W B;  2M8H A;  3R5J B;  1NSQ A;  2J9C A;  1SUQ A;  3NNC A;  3QFH A;  3HHL D;  4B3O A;  4NYP A;  3C66 A;  3IRW P;  2ZOG A;  3IGN A;  1BY9 A;  3W66 A;  1S79 A;  4NCA A;  2RJZ A;  1NK0 A;  4M5G A;  1GMW D;  2R2S A;  3DOM A;  2C2N A;  3BKF A;  4P71 A;  3H5X A;  4AT1 B;  5CYQ B;  2UXC J;  1DQ8 A;  2OD6 A;  1X0P A;  4B3R F;  3RYL A;  1M1K T;  4KO0 A;  3NS5 A;  2ILZ A;  4NEY A;  3PZP A;  2W9A A;  1VK3 A;  1NEE A;  3KHR A;  4B9M A;  3W64 A;  4QIV A;  3PJX A;  1IKW A;  4Q8F A;  1W26 A;  3NGK A;  4GKK J;  5KG3 A;  4TU9 A;  2BXJ A;  1IM4 A;  1U6B A;  3VZI A;  1H3D A;  2XYG B;  2CJQ A;  4IQX A;  2HK2 A;  2HND B;  3ETM A;  3T1H F;  2H4Y B;  3MM7 A;  1RT1 A;  1VRU B;  1RTI A;  3M2R B;  3OVB A;  3MTK A;  3AOA A;  3E3X A;  2Y8W A;  4GMK A;  1RWU A;  5L38 A;  2QLX A;  4P75 A;  4UQT A;  3GU0 A;  4QZV B;  4CNZ A;  1BQN A;  1ZBT A;  1RGV A;  2OEK A;  3T6J A;  4ECX A;  2CJ9 A;  3TAM B;  3BYP A;  1VIX A;  2AJ4 A;  1S9G B;  1CS4 B;  4UY8 T;  2QJ3 A;  1D0E A;  1SV5 A;  2GAH C;  5J2P A;  1F6T A;  4RBU A;  4O0N A;  3RAX A;  1T7P A;  1KTQ A;  3OUY B;  4OYW A;  2OJ3 A;  3GG0 A;  3UDE A;  4P2M A;  5LMU J;  4JI1 F;  4CO3 A;  1LQ9 A;  1VQ6 S;  1RTD A;  4L74 A;  2GNK A;  5KOW A;  2M88 A;  1TKZ A;  3D6F B;  2QLJ B;  2DYA A;  3OTB A;  5H9E J;  1R89 A;  2ZH9 A;  1SH2 A;  2R8G A;  3KLI A;  2WVC A;  2V9K A;  3OL8 A;  3CC2 S;  1CLF A;  2K1R A;  3PFO A;  4DWI A;  2O66 A;  5GMK a;  5LXY A;  5EGY A;  1H2T Z;  4UZB A;  4J9P A;  3CTR A;  2AEM A;  1FNO A;  2JFK A;  4KHP F;  4DPW A;  4XPC A;  4M5N A;  1WDD A;  2J6U A;  2ZBI A;  4FS2 A;  2BM1 A;  3UI3 A;  1DTQ B;  3CJ5 A;  2QL9 B;  4X64 J;  2MQP A;  2GFF A;  2BE2 A;  2HHV A;  3H2V E;  4F7V A;  3IO1 A;  3HVT A;  3ETO A;  1FFG B;  4P74 A;  5LM7 E;  4F04 B;  3CCU S;  1LK5 A;  2UUW A;  4FS1 A;  4LIR A;  5HLF A;  5DJB A;  3FZ2 A;  3HVR A;  2IVM A;  2YWG A;  2KKH A;  1X4D A;  2DNM A;  2W9B B;  3SXL A;  2RB7 A;  1LWC B;  3N01 A;  3CCQ S;  4PG8 A;  4XPE A;  4PPD A;  4QYZ J;  4OHW A;  1QM9 A;  2DD8 S;  3C6U A;  2UU9 F;  2DNZ A;  4NMX A;  1YRT A;  1S1T B;  4CTA A;  2IM2 A;  1IBK J;  1UEU A;  3F0N A;  1XMQ F;  2OHD A;  4WK3 A;  3T5J A;  4YEA A;  5ETS A;  2ZM6 F;  2EC0 A;  1P27 B;  2CQ0 A;  3CGI A;  2HNZ A;  4YDX A;  3SSQ A;  1D09 B;  3LGM A;  3M4X A;  1EQM A;  4YB6 A;  1WOR A;  1WF2 A;  2AZ3 A;  4RUB A;  1S7H A;  4NOH A;  2ALY B;  3TI0 A;  4DZ6 A;  1N0V C;  2HHU A;  1VQ7 S;  4C8K A;  4DPX A;  5BR8 J;  1J5O A;  5F8H A;  1ZM2 A;  1TKX B;  1WWH A;  3DHX A;  3MPW A;  2R8H A;  3CCE S;  4WYW A;  3IP0 A;  3QPI A;  2AGQ A;  3CDA A;  1UPM B;  2RQM A;  1N5S A;  1R6V A;  1JLF B;  1HNW J;  2ZEJ A;  5H9F J;  3FCW A;  4FYV B;  3FNN A;  1RWP B;  3OBI A;  2WVB A;  1B0P A;  2DRA A;  2KHD A;  1RHR B;  3OL6 A;  2BAB A;  4K4V A;  1TK8 A;  1JNR B;  2VPW B;  5F0U A;  3A13 A;  4DF8 A;  4B9L A;  2J0W A;  5L8R C;  4WFB Q;  2E7X A;  3QGP A;  4ED2 A;  3PKY A;  4OMF G;  1L3S A;  2AGP A;  2M9K A;  5KFL A;  2UXD F;  2KT3 A;  1EP4 B;  5D77 A;  2HNY B;  2B3T B;  4A8S A;  2V2K A;  3ZZP A;  4NLU A;  1S4E A;  3DYA B;  2JVO A;  4AL7 A;  4TY8 B;  4NA3 A;  4I2P A;  3MUR P;  4NLV A;  4EYH B;  4DL7 A;  4DUZ F;  2QN6 B;  2IY5 B;  3LTO A;  3EDR B;  4N7T A;  1Q5Y A;  4PQU A;  2KO1 A;  1FES A;  4CI0 B;  3TYT A;  4Q7A A;  3CDU A;  3BQ1 A;  2VOO A;  1B0V A;  3EVW A;  3MOZ A;  5F8G A;  4F3O A;  3KK2 A;  2FTR A;  4EZ9 A;  4ZLP A;  4IG0 B;  1OJ4 A;  1DUR A;  3GZ7 A;  3IXQ A;  1EX8 A;  2QGF B;  1RT6 A;  4Q0B A;  1KQK A;  2W2P P;  3GIJ A;  1HYS A;  3T5K A;  1G3O A;  5KFQ A;  1NB2 A;  5CCL A;  2NZC A;  1VQP S;  4F02 A;  3DRP A;  2BZ2 A;  5RUB A;  2MXY A;  3D0I E;  3PW5 A;  1H0H B;  1TL3 B;  3UWT A;  1AB8 A;  1N33 F;  3IM8 A;  5HP1 B;  2DXE A;  1N88 A;  2GC8 A;  4ZJL A;  1S6Q A;  1SBR A;  1NO8 A;  2FHO B;  3OTO J;  1IJF B;  1SC3 B;  1DRZ A;  2DTJ A;  1XWL A;  3MR2 A;  1WTB A;  4ZP7 A;  2KI2 A;  2MSS A;  3J80 U;  2XO7 A;  2HFZ A;  2E5G A;  1R8B A;  5KFU A;  1SQG A;  2QA2 A;  4OYI A;  2MKI A;  2HIQ A;  2QLF B;  3V2U C;  2I5J B;  3C3L A;  1IQZ A;  3C14 A;  4FXW A;  5KFR A;  2WON B;  2ASY A;  5ETR A;  2EEY A;  5M2U A;  3L4B C;  2MZT A;  2E5I A;  3H42 A;  3AB4 B;  2HHT A;  2V9W A;  1QE1 A;  2FJB B;  4ZIV A;  4IFV B;  4OI4 A;  3HHN B;  4OIX A;  2YNG B;  2M52 A;  4UQG A;  4B3M J;  1H7X A;  3Q0A A;  3MM8 B;  4UW2 A;  1HWL A;  3OLA A;  1L3V A;  4I7F A;  1HBO B;  3FQL A;  3F73 A;  4B3T F;  1RTH A;  2CPX A;  1U8W A;  5B0E A;  3L9Z A;  3RBX A;  4Q8E A;  4XDD A;  3KLG A;  4ZIT A;  5AXN A;  4NRT A;  3N6L A;  4OX9 F;  2RDD A;  4KE5 A;  3CC7 S;  4QOT A;  1T9X A;  2YNF A;  1GX5 A;  4UOG A;  2NUH A;  4WTO B;  1J27 A;  3AXK A;  1HD0 A;  4HR2 A;  2DGQ A;  2IDL A;  4RR5 A;  3R97 A;  2MMY A;  4YP3 A;  4K59 A;  2NPF A;  4DU7 A;  3QWP A;  5F8N A;  3D1Q A;  2F9D A;  3KK3 B;  3W1Y C;  2XSF A;  1JQG A;  1SJR A;  2ZE2 A;  4CLF A;  3SFU A;  4JI5 F;  1VYA A;  4DV4 J;  2X51 A;  3EX7 B;  3F44 A;  2RU3 A;  3DRR B;  3EIC A;  3CE8 A;  3SSR A;  5ADZ A;  4ZMM A;  3CSK A;  2UXB J;  1UJ5 A;  1B0T A;  3VGV A;  2UVW A;  3GCW P;  3RBZ A;  1HPZ B;  2VQE F;  1ZYQ A;  3LAK A;  4CM2 A;  1X8D A;  1UVK A;  3K17 A;  4B9T A;  4NA2 A;  4YOE A;  4IH5 A;  3W7B A;  2R2R A;  1HR0 J;  2EPI A;  2L3M A;  3V6K A;  1W2I A;  2PMW A;  2OPQ B;  2VH7 A;  4FF3 A;  1T3O A;  2HFS A;  1IBM J;  1ZM9 A;  2QFI A;  4UOF A;  3UD3 P;  5LXR A;  4LR9 A;  1HBN B;  4OX6 A;  3FRY A;  1RAD B;  4LF9 J;  4K4X A;  1NK9 A;  3CCM S;  1TKT A;  2H54 B;  1U47 A;  1TUW A;  1VIO A;  5HVG A;  1KR4 A;  4N77 A;  2R8J A;  1UJ6 A;  4PWD B;  1RBL A;  1FDA A;  1JLB B;  2E9T A;  2GX8 A;  1K1Q A;  3EGV A;  1FJG J;  3O1L A;  4FXD A;  1SCJ B;  4NXN J;  3DOL A;  4YB1 P;  4KJI A;  2MQQ A;  2PGC A;  1HHS A;  3VVU A;  3CO9 A;  5EDW A;  3LAN A;  4P7T A;  1S1V B;  2QZ8 A;  2N3L A;  2KXF A;  2EFP A;  5AXL A;  4O44 A;  3PFE A;  2B9X A;  2AQ4 A;  3GQC A;  2CNL B;  1CQM A;  1SI9 A;  4DR4 J;  4KV8 A;  3DM2 B;  5KAK A;  2QFJ A;  1WDT A;  2M8D B;  3MAA B;  4KGM A;  4OI3 A;  2XY5 A;  5J2M B;  2FHJ A;  4O3Q A;  1NDL A;  1SH3 A;  5IOL A;  1XQI A;  3FRZ A;  4I6Y A;  1HQE B;  1VRT A;  2R7T A;  1WG1 A;  3D6H B;  3CD0 A;  3R3T A;  2BKO A;  1WNE A;  3Q8Q B;  4U95 A;  3CCJ S;  4QR0 A;  4KC5 A;  3CJS A;  3EGZ A;  1REV A;  4ICL B;  4B3S F;  2Z30 B;  3CJ0 A;  2DIV A;  2V63 A;  3U1M A;  3UDV A;  2YNI A;  2DEI A;  2O1P A;  4QW9 A;  5HBM A;  2XQC A;  2GW8 A;  1T03 A;  2AEJ A;  1O51 A;  4IFY A;  4NLO A;  3R9L A;  4J9L A;  3MMB B;  3CNQ P;  1MMN A;  1N5T A;  3PM9 A;  5DZ7 A;  3KKF A;  2VC1 A;  3MUT P;  2V8G A;  3NGS A;  3V4I B;  1JIH A;  2XC9 A;  4JV5 F;  1R8H A;  1XR5 A;  1R31 A;  4UST A;  2DNG A;  1KD1 T;  4ES2 A;  3LGH A;  2LQ5 A;  1SJF A;  1OQ3 A;  3DMJ A;  2MLX A;  2HPU A;  2G1D A;  4ED1 A;  3HSZ A;  3WC0 A;  2CQI A;  4IYQ A;  2ILY A;  4QIW D;  1FF2 A;  1YIT S;  3FSY A;  4NZ0 A;  2AJQ A;  3C19 A;  3DLJ A;  4MKY A;  3RB6 A;  1M5S A;  2DR6 A;  3BQ2 A;  3AY0 A;  3G87 A;  3HPO A;  3PW4 A;  1TU0 B;  5B7W A;  4ID5 A;  1S1U A;  2RU9 A;  1XR7 A;  1EKS A;  1KQG B;  2XMK A;  1R0C B;  3W60 A;  3L7O A;  4WF9 Q;  2LQ9 A;  1Y10 A;  3T3F A;  4IRD A;  1FDD A;  2HS4 A;  1WOO A;  2A6O A;  4RNH A;  2COL A;  3H7H B;  4N76 A;  3VAL A;  2LEP A;  3B54 A;  1BMQ B;  1Q8K A;  4K4Y A;  4DL4 A;  1H38 A;  2CDQ A;  3W9J A;  2HLT A;  4LF1 A;  1UVJ A;  4MYT A;  4DL2 A;  1KQS R;  3CO0 P;  4RLE A;  1TEL A;  3K8V A;  4QYR A;  3MFI A;  3MMJ A;  3LAM A;  3LWM A;  3B82 A;  3OQ2 A;  3H2U B;  1Y5L B;  4I69 A;  1NKB A;  3TVZ A;  5KT5 A;  3PIO Q;  2C42 A;  4IOB A;  3VQS A;  4IR1 A;  3RB3 A;  3CJ8 A;  1FRL A;  3H20 A;  4B3R J;  4TY9 A;  5KG7 A;  3IS9 A;  3QT5 A;  1JLG A;  2MZ1 A;  2CPF A;  1WC3 A;  2OFG X;  4RWW A;  1UVM A;  2OPP A;  1B7F A;  1C2P A;  3LP1 A;  5HK4 A;  2G4B A;  1Y9O A;  4LVO P;  2XBP A;  3PRV A;  3TX0 A;  2ZC4 A;  3ZZ0 A;  2HLU A;  5KFO A;  1RAC B;  4G1I A;  2DBB A;  2ASL A;  3BPS P;  8ATC B;  4EWT A;  1DTT B;  3K2Y A;  1VQ4 S;  5D15 A;  5GVQ A;  3I31 A;  3T1H J;  3MF5 A;  1SJQ A;  3CCZ A;  3V4M A;  3CD5 A;  4U67 Q;  4PYD A;  1PYO B;  2XYH B;  1T94 A;  2ROG A;  4DR1 F;  1FWP A;  3OJS A;  1VIS A;  2XZD B;  3KK1 B;  4QYZ K;  1TV6 B;  3SFG A;  3VZH A;  2CRL A;  4K5S A;  1SL0 A;  4N56 A;  2ZJQ Q;  5E3P A;  2EI5 A;  4J7C A;  1NND A;  4M5K A;  7FDR A;  1Y0H A;  1FD2 A;  1U2F A;  3MTJ A;  3OFF A;  2AHO B;  4UOH A;  1PYT A;  5M2R A;  3BGF A;  2FVR A;  3TZX A;  1XC9 A;  3AJ2 A;  1XIQ A;  2NXU A;  3LWL A;  2HVE A;  2A2C A;  3KLE B;  2HZV A;  2HND A;  1NJZ A;  4TVA B;  1GMU A;  1BQX A;  1WEY A;  3I0S A;  3POT B;  2HBR B;  1VRU A;  3MM6 B;  1RU1 A;  4JI1 J;  3KFW X;  3ZZT A;  4DX6 A;  4F4W A;  3R1H A;  1X4E A;  1ZZF A;  1XTZ A;  1S9E B;  2FYX A;  2PA8 D;  1PAU B;  3MEC B;  3A8I A;  4KT0 C;  2HHH J;  5HRO B;  5H9F K;  2YKM B;  2BOP A;  5ETV A;  1H2V Z;  4ERD A;  4U6P A;  3PHT A;  3GJR B;  2VJU A;  3TAM A;  4ZHR B;  2XY7 A;  2CJK A;  1RYS A;  2R7O A;  2IA6 A;  1ZM3 A;  3PCO B;  2LA6 A;  2B56 A;  4KHP J;  2HGN A;  1UFW A;  1FVS A;  3KHL A;  4U8V A;  4DV7 F;  5C2C A;  1U6Z A;  2MYF A;  3DN9 A;  3OUY A;  3M32 B;  3JSM A;  2AYE A;  4C4W A;  4ZLL A;  2DGX A;  2M0G B;  5KG0 A;  1X5T A;  2G2Z A;  1PC5 A;  2RDI A;  5KFI A;  1HNV B;  3N4W A;  1IJE B;  3BH6 B;  4ES1 A;  3DLH A;  4IG3 B;  3MED B;  2RD5 C;  1LKZ A;  2B51 A;  3BQ0 A;  1UL3 A;  1F9E B;  4USU A;  2E5H A;  3HFZ B;  2H5I B;  2RF2 A;  4QW8 A;  4V1A k;  3BGU A;  3MR7 A;  4I64 A;  3PAC A;  5DGA A;  1P1T A;  2HZC A;  3BDE A;  1DTQ A;  3DLG A;  3K5M A;  3VAG A;  2PT0 A;  3H4B A;  4ZK7 M;  2ZM6 J;  2OD4 A;  4OJH A;  4ZN1 A;  1NDP A;  3W3S A;  3DHW C;  2MHE A;  2DGU A;  1HWI A;  3OL9 A;  5EWG A;  4C8O A;  1IKX A;  1Q16 B;  1T9U A;  3TVK A;  4DR3 F;  4OYX A;  3AA9 A;  1YJW S;  2LU2 A;  5LMN F;  1L3K A;  2W9B A;  5A0Y A;  4Y2I A;  2XS7 A;  1G1X A;  2CQD A;  1NK6 A;  1C0U B;  1PIL A;  3GG1 A;  1WKL A;  4C6A A;  1LWF A;  4GKJ J;  1VQO S;  1LW0 A;  3BO2 A;  4ALZ A;  5DET A;  4N41 A;  5C42 A;  1DQA A;  1T9W A;  1T11 A;  3GLJ A;  2W4D A;  4PEO A;  1RTJ A;  7FD1 A;  2LFV A;  4C8Y A;  5E5N A;  5ETQ A;  5AJ3 F;  2VDI A;  5DG9 A;  4C8N A;  4KPC A;  3AOB A;  2YWE A;  2QRR A;  2V67 A;  1WC5 A;  3I4H X;  4FYW B;  4PWW A;  2DHS A;  3LF0 A;  1FXD A;  5D4P A;  3C8Y A;  2PMH A;  3QGH A;  4RO0 A;  5J2N B;  3O2I A;  3WX8 A;  3RB0 A;  1ZPW X;  1NK5 A;  4Q44 A;  3SV4 A;  2XS2 A;  4CYU B;  5KFS A;  3J81 Y;  1TAQ A;  4FKX A;  4DUZ J;  4H4K C;  1FI4 A;  4USH A;  4GC7 A;  1ZTW A;  5A8W B;  4ENO A;  1IBL F;  1NK8 A;  1ZS6 A;  1RAF B;  2ACY A;  4DJB A;  2C3O A;  4DSE A;  2HQ3 A;  3Q86 A;  1C0T B;  4JYA F;  2YWK A;  5K8N A;  4TXS A;  5HMY A;  5D3G A;  6FD1 A;  3TA2 A;  1EP4 A;  2HNY A;  2ZH3 A;  3KG4 A;  3MAQ A;  3M9N B;  2N7Y A;  4LRD A;  4QPT A;  1RBA A;  1FD8 A;  2YQ0 A;  2VFR A;  1VJQ A;  4Y3C A;  4ECT A;  3EJM A;  4TY8 A;  1SC1 B;  5ETM A;  2K7J A;  2DNP A;  1T95 A;  5HN0 A;  1Z4U A;  4I6A A;  2I9S A;  3G8Q A;  4RNF A;  1TK0 A;  1PCA A;  1WKK A;  3PRD A;  1ICE B;  5C24 B;  3MCM A;  3M8Z A;  1LWE B;  1IWA A;  5JJB A;  2I1R A;  2BW2 A;  1SL2 A;  1QTN B;  1CJK B;  2R8I A;  4NE9 C;  5EX3 A;  4WFY A;  4BLG A;  2FY1 A;  5LSO A;  3T9Z A;  1FJ7 A;  1UVL A;  3PYF A;  1EET B;  2FZK B;  4RJV A;  3QLH B;  4N8N A;  4ZJQ A;  4KKO B;  2HS3 A;  4J9S A;  1KTV A;  3B78 A;  2VG5 A;  2IAJ A;  2QO3 A;  1NK4 A;  1FFW B;  2Q6C A;  4Y6I A;  4PXD A;  1U0H B;  1YZ7 A;  1OY9 A;  2GHV C;  4K4U A;  2CDR B;  2YXL A;  4K4Z A;  3OXF A;  4FN5 A;  4O3O A;  4OJG A;  4CRJ A;  2E7W A;  5LL6 d;  2L9N A;  4KQZ A;  2CQ3 A;  5E0O A;  3A3O B;  2OIH A;  3BSN A;  5FJ4 A;  2IRU A;  4ZCK A;  1X4B A;  2QMW A;  1YGY A;  4DCO B;  3J81 U;  1RDR A;  1WHV A;  1UTA A;  2A18 A;  4LFB F;  1TTH B;  4B3T J;  2UVV A;  4OV6 A;  1S10 A;  2CWK A;  4J5O A;  4LSL B;  2DT9 A;  1WC6 A;  2I5J A;  2YQ1 A;  2Z8Q A;  3AFG A;  3I5C A;  2P9E A;  4E2F B;  3IAM 9;  1FKO A;  3JXO A;  3ILO A;  2GMH A;  2ADC A;  2WCX A;  5KFJ A;  3US5 A;  4HH0 A;  9RUB A;  5KFW A;  4J37 A;  2JC0 A;  5J2Q A;  4OL8 A;  4WFZ A;  4LFA J;  4EGL A;  4F4Z A;  1S72 S;  2VDH A;  1V6H A;  1S9F A;  2YH0 A;  4CLK A;  5DM7 Q;  3SQG A;  5CD4 H;  3G4S S;  3NOC A;  2YX4 A;  3N6M A;  3K5N A;  2Y1L B;  5BJR A;  4JI5 J;  3CCL S;  1DAR A;  2MJU A;  3KG1 A;  3KJN B;  3VAJ A;  2OH2 A;  3D54 A;  2KM8 C;  1R43 A;  2YKN B;  2XCP A;  4Y2A A;  4XDC A;  1YSJ A;  1WEZ A;  1VHF A;  3IBC B;  3R7N B;  3UPF A;  2H51 B;  2VQE J;  3P8B B;  3W61 A;  4X4O A;  1MWZ A;  4MKA A;  3AB2 B;  3RW7 A;  2D41 A;  1JNZ B;  4TU8 A;  4DXL A;  5F3T A;  5A6W A;  3EPI A;  4TQS A;  4MFB B;  4H4O B;  4B9N A;  3FKB A;  1P6T A;  4QBU A;  2MKJ A;  3DGP A;  3DU5 A;  3QZ7 A;  4PXE A;  2NQP A;  2AEF A;  2DHH A;  4C2M A;  3HKW A;  4JI8 J;  2K3K A;  5IV4 A;  2Y1R I;  3DRR A;  5E41 A;  2V5H G;  2DNQ A;  5K8M A;  3NOG A;  2WSC C;  2DH7 A;  2YX1 A;  4KRW A;  5DQI A;  1HLW A;  3N79 A;  2W8K A;  2PI5 A;  4C8L A;  3MPV A;  2HRU A;  1HPZ A;  4E0D A;  3NGD A;  5C25 B;  2WW4 A;  4TNO A;  4I2Q B;  2MQO A;  3NCQ A;  5K14 B;  4KR0 B;  1CUL B;  3V81 A;  5I4M A;  1KRP A;  3D6T B;  2JC1 A;  4KFB A;  4OZ5 A;  4WCE Q;  2OPQ A;  1IKY B;  1U2R A;  1X9M A;  2FB0 A;  3OXG A;  2D3U A;  2JZ5 A;  3G82 B;  1HBU B;  4MJK A;  1TP7 A;  3PW0 A;  2MQM A;  3I0R B;  4X2B A;  4F4X A;  2EWH A;  4K50 A;  2XI3 A;  1K73 T;  4MAK A;  1NSK L;  3KLF A;  3C15 B;  5HQ8 A;  4FNH A;  4ZJO A;  5KFK A;  1Q78 A;  4ILL A;  1S0M A;  1IR2 A;  2RML A;  3PVX A;  4ZS6 A;  3UCG A;  2JEF A;  3KWM A;  4UUX A;  3W5Y A;  4YN3 B;  3KMQ A;  4WII A;  2KM8 B;  2ZH5 A;  1Z2L A;  4DMZ A;  3I9V 9;  2HFV A;  1WKJ A;  1QTM A;  1M90 T;  3B8H A;  2IVY A;  3HHK A;  4ZPA A;  3GJS B;  3AJ1 A;  1E6V B;  2FZG B;  1VQ5 S;  2AIR B;  1OMS A;  2HVI A;  5KFM A;  3UO0 A;  1AUS L;  4KTQ A;  2DNR A;  5J2M A;  2VAS A;  5I3U B;  4M5H A;  1JJH A;  2H9Z A;  1QAJ A;  2CQ2 A;  3GJQ B;  2EFV A;  4NRU A;  4MIB A;  4X65 F;  4A8F A;  2XHW A;  2OEL A;  3QZ8 A;  3HFK A;  1YJN S;  3H5S A;  1PAE X;  2BJ7 A;  1U45 A;  3BJY A;  2WRM A;  4IR9 A;  4JV5 J;  3OJU A;  2XMA A;  1FDN A;  3WX4 A;  3EGW B;  2V4R A;  3M8Q B;  3MM9 B;  4ZVF A;  3LPY A;  3TEG A;  2MZR A;  4ICL A;  1H2U X;  4LF2 A;  3CCT A;  1Q8L A;  4BS2 A;  1Q79 A;  3AD9 C;  1XEZ A;  3FSI A;  3HI9 A;  4WP8 A;  5AT1 B;  4WU2 A;  2FY8 A;  3JTN A;  4JI6 F;  2HQI A;  2MGZ B;  3EZ5 A;  2KTQ A;  5F8L A;  1RHJ B;  1Y5I B;  5IM0 A;  2BVZ A;  3SQO P;  3BO4 A;  4JI4 F;  2RRA A;  1XBW A;  3FJ2 A;  3M1V B;  1JLQ A;  3UNY A;  4P9S A;  4YR3 A;  3EXC X;  3PJ9 A;  5A2Q U;  4X4R A;  3AHP A;  3K5O A;  4J9R A;  4RW8 B;  2ADB A;  2DHG A;  1KFS A;  4JI3 F;  3KG0 A;  3IMQ J;  3NBP B;  1HNX F;  3DNC A;  4E8U A;  1YDL A;  1UEV A;  4F50 A;  2H5E A;  2B0G A;  3DDN A;  2OPS B;  3VGU A;  3FFI B;  1HNI B;  1T9Y A;  4DCP B;  3LUY A;  4NYO A;  2ZKU A;  3HT0 A;  3SDE A;  1R6Y A;  3CMA S;  2VFV A;  2EKY A;  2V34 A;  3EZO A;  3PR5 B;  4G65 A;  3QT7 A;  2DPJ A;  3X1L B;  5GAD I;  3CDB A;  5E33 A;  3GIK A;  3CME S;  2CG4 A;  2VV5 A;  5KG6 A;  2ZH7 A;  1LV5 A;  3VWS A;  2XWY A;  5CD4 A;  2XLK A;  1MG7 A;  1LOU A;  1BWE A;  1X4C A;  1FTC A;  2IYI A;  1N4L A;  3MEG A;  2LMI A;  3BN7 A;  3WZ0 A;  5GAD U;  1OS5 A;  3M8P B;  1N34 F;  3HZG A;  5A8R B;  2VZ9 A;  1NHU A;  3AQP A;  2KFY A;  3MR3 A;  3C6T B;  1HBM B;  2RSQ A;  4B02 A;  1DHM A;  4GVL A;  4D3H A;  2XMW A;  3GFX A;  2KFZ A;  3NS7 B;  3BF4 A;  2N4C A;  3AAW B;  1TUG B;  2FVQ A;  3ZZY A;  2WVE A;  1LW2 B;  3EVO A;  3PX4 A;  2LQB A;  2L48 A;  1YLX A;  3BBB A;  2BKP A;  1HFE L;  2CZ4 A;  3QRQ A;  5GAG I;  1NME B;  2CPI A;  2XYP B;  4DSL A;  1YTY A;  1RI7 A;  1HQU A;  2XSJ B;  1U1L A;  5DG7 A;  4KY3 A;  2CQB A;  3Q2T C;  3I9Z A;  5J1E B;  2LDI A;  4BWJ A;  5D4O A;  4OHV A;  1NZ8 A;  1H6K X;  2E9Z A;  3LA0 A;  2UUC J;  2ZH2 A;  2VA3 A;  1KLM B;  1DTT A;  5IS2 A;  5GAG U;  1X31 C;  4AL5 A;  2XMV A;  1R8A A;  2YY3 A;  4DG1 B;  3HX9 A;  2QLW A;  3IR6 B;  5KFX A;  1DBD A;  3D9B A;  3H2L A;  3Q24 A;  3QJL A;  3BS9 A;  4K4S A;  2MQN A;  3K59 A;  3KK1 A;  3W63 A;  3W2V B;  2CFX A;  5E2Q A;  2RKI A;  2C3P A;  1KSP A;  3MEK A;  2JLG A;  3G6V A;  3VAF A;  3FMW A;  4OJ3 A;  4RW6 B;  2YX7 A;  5K20 B;  2ZBP A;  4ED4 A;  2QC3 A;  4Z7C A;  1LNQ A;  2HK3 A;  5ETT A;  4WP9 A;  3THV A;  1CJT B;  3MMC B;  5G0R B;  1FKP B;  2X1A A;  3J81 j;  3EDQ B;  2KU7 A;  1MMD A;  3D4J A;  2XGQ A;  1GTE A;  4X66 F;  1YZ6 A;  1S59 A;  3POT A;  2KJV A;  2ZH1 A;  4ZKA A;  3KLH A;  3BPD A;  2CQ4 A;  1V3S A;  1MRO B;  1RHK B;  1UPP A;  2P6S A;  2OGU A;  5G4D A;  3CXC R;  2IRX A;  5IWA F;  4LF8 F;  3B6B A;  4DL0 C;  3MEC A;  5HMZ A;  4WFX A;  1F9H A;  5HRO A;  3GP9 A;  4JOU A;  1P9Q C;  5DLG A;  4KGV B;  4F25 A;  3NGU A;  2ZD1 A;  2MKS A;  2C2E A;  2LDY A;  3QGG A;  4ECY A;  4X4P A;  1XMO J;  1LXN A;  3QIP A;  1T0T V;  1K0T A;  2CJA A;  2FJX A;  2OTJ S;  4LF4 J;  1F60 B;  3HO1 A;  1RLC L;  2HBY B;  2HS0 A;  2ZJR Q;  3GFH A;  5DGB A;  3VGS A;  1PC4 A;  1U02 A;  4V19 J;  4M5M A;  3CDW A;  2FGC A;  1M5O C;  2VOP A;  2MJN A;  4A8Y A;  5CZX A;  2IMW P;  1RT2 B;  1UP1 A;  1N56 A;  2ZHO A;  1HW9 A;  3MED A;  4AXJ A;  3Q8U A;  2OPR B;  4YQW A;  2BAN B;  4OI1 A;  2O67 A;  3PRB A;  4BWM A;  1IXK A;  3HHE A;  3UVJ B;  1RWW B;  3A12 A;  4ZLJ A;  3R5G A;  3CJK A;  3A8J A;  5KFT A;  4HDG A;  2HHS A;  4Y00 A;  2YKP A;  1DJ0 A;  3KMS A;  3MD1 A;  3TO8 A;  2JRS A;  1FCA A;  2DNY A;  3ZZU A;  4Y65 A;  5DRK A;  1CC8 A;  1G2E A;  2BRK A;  2XI2 A;  4OZ0 A;  2PEH A;  3PO4 A;  3M6W A;  4BC7 A;  3MPY A;  1UAW A;  3TZW A;  1CJV B;  1CC7 A;  5AJ3 J;  4IRK A;  2ZKT A;  2E66 A;  2ZHB A;  4ECR A;  3MEE B;  3DLE A;  1RU2 A;  3VV2 B;  3IBF B;  2VD3 A;  4P2X A;  3QGI A;  1XJW B;  3BSA A;  1X5P A;  2YKO A;  8AT1 B;  1N48 A;  1NCL A;  2G1H A;  4X62 F;  4NLP A;  5CAA A;  1U1P A;  5KFE A;  3AXM A;  5KFD A;  5EN1 A;  1V3R A;  2K8G A;  2XLJ A;  4O4G A;  4JI0 F;  5KT6 A;  2HFO A;  4DN0 A;  4JYA J;  3H5U A;  3OV7 A;  3P49 B;  4OYM A;  3O8W A;  2OLW A;  1JLA A;  4J9V A;  2QMU B;  2CNO B;  4NPO A;  3FCV A;  4DHV A;  4DL6 A;  2LLZ A;  4M5D B;  5GMD A;  4CIO A;  3B4D A;  3HHD A;  3H59 A;  2CXE A;  4RWX A;  3ZTR A;  4ZDN A;  4CYU A;  4ECS A;  2BUN A;  2FZC B;  2VUG A;  1IKV B;  1XK8 A;  1U6F A;  5A8W A;  1JLE A;  1WF0 A;  2IJN A;  3S01 A;  2P6T A;  1VQL S;  3GFY A;  5EWE A;  3IAS 9;  3L3C A;  3TQE A;  1OO0 B;  1PO6 A;  1VC5 A;  3KJV B;  1BQM B;  1F9F A;  1TVR B;  2KRB A;  4H54 A;  2KYX A;  2DNH A;  7AT1 B;  1I1G A;  2OUG A;  2XGP A;  3Q23 A;  3UR0 A;  1MML A;  2J8S A;  2FVC A;  3AQO A;  3T1Y F;  2HW3 A;  3UQS A;  2F9J A;  5CYM B;  2VKZ G;  4BDP A;  4A46 A;  3ITH A;  5D8H B;  1G6B A;  3CT9 A;  5B0D A;  2C2O B;  4HYK A;  2ALZ A;  3SSS A;  2W7A A;  3G6E S;  2DEJ A;  1JKH A;  2EFN A;  3MDF A;  1CJK A;  3KUG A;  1FTR A;  3M05 A;  2O01 C;  1ZTT A;  4LF5 F;  4QWB A;  1FRJ A;  4RPF A;  4KKO A;  4LFB J;  3W62 A;  1Q0N A;  2HWI A;  2XM3 A;  2AX1 A;  3Q2S C;  3DLB A;  2V94 A;  4DR7 F;  4DU8 A;  1MN7 A;  4I0W A;  2MDA A;  3R5B A;  1P8G A;  1YBT A;  2BRL A;  2IC3 B;  1XNR J;  3C2P A;  1NHV A;  3LH2 S;  2NUU G;  3HFV A;  1SUQ B;  3RU0 A;  4B3O B;  1N32 J;  1EIY B;  1TL1 A;  3NAI A;  4LUB A;  4ED6 A;  3S7R A;  3HVA A;  4QR2 A;  4WPA A;  1D3W A;  3T5H A;  3E8O A;  1RLD A;  2D3O R;  2QL5 B;  3DOM B;  2YH1 A;  3ONQ A;  1KOO A;  1SC6 A;  2C3Y A;  2NSC A;  3GE9 A;  2VU5 A;  2F63 A;  5KT2 A;  5CYJ A;  3J7Z 5;  2F8H A;  2OSQ A;  1MWQ A;  1I94 F;  2G2Y A;  3D66 A;  1JJC B;  4BBY A;  4CLL A;  1UW4 A;  3D0G E;  4EMD A;  1N0U A;  2IMO A;  4RNO A;  4DQR A;  2DR5 A;  4N8O A;  2C2Z B;  1IKW B;  4MKV A;  3W2W A;  1UMJ A;  1BUX A;  5CCM A;  3W9H A;  2MTL A;  3EGN A;  1MU2 A;  4ZVH A;  1U1O A;  2VFT A;  3GPA A;  2V2V A;  5KFA A;  2YWW A;  2NCK L;  3JQK A;  1HWU A;  8RUC A;  2RHQ B;  3JAM U;  1RT1 B;  2CPD A;  5AE1 A;  1RA7 A;  4IO9 Q;  3PKM A;  3R5A A;  4FF1 A;  3CD6 S;  1RWX B;  2YKN A;  4OQJ A;  2B4V A;  5HAT A;  1U4B A;  3LGN A;  4J9O A;  4P10 A;  4RU9 A;  3FEX B;  2DY1 A;  1U1M A;  3UD4 P;  1BQN B;  4DQP A;  1VGY A;  2UZA A;  3KJF B;  2UVR A;  3A8K A;  4DX5 A;  3GJT B;  1YWX A;  3OFG A;  2AX0 A;  2EBE A;  3LAL A;  4MFB A;  3Q8S B;  4HAC A;  2K2P A;  1NKE A;  1SV5 B;  5J2P B;  1K44 A;  1WI8 A;  4ELV A;  4A8Q A;  2CQC A;  2YWF A;  3GV8 B;  5KFN A;  2R42 A;  4HKQ A;  3G71 S;  5EUH A;  2CWX A;  1VBY A;  4DQS A;  3LP2 B;  3WC2 A;  2VPX B;  4OLO A;  2PMZ D;  1WC0 A;  5KFY A;  3MUV P;  4L76 A;  5B0G A;  4XIU A;  2CJX B;  1GEH A;  1TKZ B;  2YVS A;  5K5M A;  3R8Y A;  4EFA C;  3D68 A;  4P52 A;  4IH6 A;  3UR3 C;  3W8G A;  1Y00 A;  4FVM A;  4EO6 A;  1A0O B;  3L09 A;  3BSO A;  4CWB A;  3HHL C;  1EB0 A;  5DQG A;  3KLI B;  3OT9 A;  4LF7 F;  2ROP A;  3RJM B;  3ZTO A;  5K14 A;  2K1R B;  4JP8 A;  2GVZ A;  3HD1 A;  3IM9 A;  5IT9 Y;  3HSG A;  2DKO B;  2AF6 A;  5SZT A;  3DLL Q;  1IKY A;  2W7O A;  2AJ1 A;  3ZNJ 1;  4LRF A;  4DPU A;  1S57 A;  4QJV A;  1TFY A;  2HUR A;  4OZL A;  3CCR S;  4G3I A;  4IDK A;  3G82 A;  4K5R A;  3SMZ A;  5HO4 A;  2BE2 B;  3TP2 A;  2BAC A;  3BM7 A;  3O44 A;  3RUB L;  1KC8 T;  4OI0 A;  3HVT B;  4WKR A;  4LF6 J;  3QO9 B;  3PY8 A;  2G9O A;  5L1J A;  3I96 A;  2A1B A;  4Z7Y A;  1S12 A;  1EJ7 L;  4DX7 A;  1KN6 A;  3JSB A;  2AT1 B;  2MLY A;  4MIA A;  2F8E X;  5HLF B;  1RT3 A;  4NL5 A;  4Q45 A;  1K8A T;  2OSR A;  4K0K F;  3U27 A;  2XUL A;  3LPE A;  3SYZ A;  4YB5 A;  5DDP C;  2B9Y A;  2ZH6 A;  3BH7 B;  4UUW A;  4E98 A;  3KYL A;  3BV8 A;  1CJU A;  4CTA B;  1SJ4 P;  2WK4 A;  1RKJ A;  2FJE B;  2G0I A;  3RAM A;  2WSE C;  1RBO B;  1WG4 A;  4X64 F;  1SH0 A;  3LOU A;  4R8U A;  2LEB A;  1OIA A;  1FRK A;  4USK A;  2APO A;  4ETX A;  2ABY A;  1VBX A;  1JX4 A;  4CO5 A;  4ITS A;  2ZUG A;  2HNZ B;  4JI6 J;  4Q2M A;  2E5L F;  5I3U A;  2WSF C;  4OLP A;  4KAI A;  2J7U A;  1FJC A;  4CQ1 A;  2W1B A;  4JI4 J;  2BV3 A;  4Q5V A;  5IXU A;  2DGV A;  4JB8 B;  3NLC A;  3TUI C;  3M8Q A;  2Z4P A;  3MCN A;  5KT4 A;  4C0O C;  1GXU A;  4WFA Q;  4D3G A;  2NXC A;  2C2R A;  3R2D J;  3FDS A;  4JI3 J;  3HHL B;  1RAO A;  1HIY A;  4RBV A;  1OPI A;  4QQB A;  1HNX J;  4F8R A;  1FXL A;  2NSB A;  3P3D A;  4CLZ A;  2QA4 S;  3PYD A;  4WZQ A;  1S6O A;  2NYI A;  2ZWO A;  1ZAW A;  4U7U K;  2DCL A;  3IN5 A;  1Y3K A;  4Y2K A;  4DV5 F;  3FCH A;  2HZA A;  3I87 A;  2HQD A;  5B09 A;  3THP A;  2EK6 A;  5HMX A;  4CDI A;  4LSN B;  2CNK B;  3LP0 B;  3NWR A;  3QSI A;  3GIL A;  1FRX A;  3PNI A;  1LFP A;  2WB1 D;  2AYG A;  1SIZ A;  4IO1 A;  1AW0 A;  2D7S A;  5CQG A;  1HNW F;  4JI7 J;  2J6T A;  3R5D A;  3Q83 A;  5HAO A;  4I2P B;  2MY7 A;  2Q1L A;  3OVS A;  4CLU A;  2W2M P;  2K06 A;  2PA3 A;  2ZOF A;  1N34 J;  2IBO A;  3CDE A;  2LXU A;  3FFI A;  4PQU B;  3ILJ A;  5FD1 A;  3OR2 A;  2HGL A;  4ED0 A;  3KK2 B;  4ANC A;  2ZZT A;  2GZO A;  4W4M A;  2J9D A;  4K8R A;  4Q0B B;  2CJB A;  1BE4 A;  2MKC A;  1C1C A;  4ZVT B;  3I32 A;  2Q3P A;  4KHR A;  3HVW A;  4ECU A;  3PW2 A;  1VQY A;  3DRP B;  1QAX A;  1TR0 A;  1SQE A;  2EW9 A;  2KHC A;  2C2M B;  2RIL A;  4KIA A;  3ET6 A;  2F5G A;  4FBU A;  4NCG A;  2FHJ D;  4A4J A;  1K47 A;  2IM0 A;  2ZHA A;  3M8P A;  4EYI B;  3TUP A;  2JHE A;  1ZA1 B;  1T05 B;  4KGZ B;  2FDN A;  2DGT A;  4KSE B;  5LJ3 Y;  5F9N A;  1HBM A;  1FE4 A;  2JLE A;  1W2B R;  3M8R A;  1URN A;  2M70 A;  3BBC A;  3ZTS A;  1HWK A;  4YME A;  1VHI A;  1S0O A;  2XMJ A;  2U1A A;  3TUZ C;  2XHC A;  4ZPW R;  2ZWP A;  1OWX A;  1RTZ A;  3WIU A;  4KPY A;  4WXO A;  1RT7 A;  1IQT A;  2GQQ A;  3DDK A;  3RRH A;  3FBE A;  1L5U A;  4RKU C;  2Y9H A;  3CMQ A;  1VQ8 S;  2IPO B;  4OYO A;  2XZT B;  2IYG A;  3DLK A;  1QE1 B;  2HSE B;  1KLM A;  1AZS B;  3JTO A;  1Z2Z A;  1N8R T;  5KFP A;  3I56 S;  4NCB A;  1VJW A;  3MZI A;  4X66 J;  3PTW A;  5DO2 A;  1V5I B;  2F4V F;  1CG2 A;  2R7Q A;  4CP5 A;  4OHX A;  2ASJ A;  4C3M A;  3GSI A;  3IWL A;  4YHH J;  1RTH B;  5M2P A;  1XNQ F;  1SKR A;  4QIF A;  5FDL B;  4HL9 A;  3OFH A;  3IGV A;  3PO5 A;  2GJF A;  3KLG B;  5E3C A;  1J5E F;  2HVZ A;  3K5P A;  3UN2 A;  1NJY A;  2WAQ D;  4OZ2 A;  3ZZO A;  2B4P A;  1QSS A;  1WC4 A;  2UUA F;  4RW6 A;  3JQJ A;  2WOM A;  4O23 A;  2YNF B;  1S0N A;  1CBK A;  2CKW A;  2GJI A;  2VBW A;  3I4P A;  3MMC A;  1CSJ A;  1REG X;  4LRA A;  2IA0 A;  4OI6 A;  2XEX A;  4QPX A;  1X5S A;  4C3K A;  1B64 A;  3HUL A;  4PRF A;  2GIF A;  3LQV A;  4PCQ A;  4RW9 B;  4W92 B;  2FHM A;  1RAI B;  1S77 D;  1GTH A;  2ZE2 B;  3GB0 A;  4O4R A;  3K8W A;  1MRO A;  2HYI B;  1UET A;  2WW8 A;  2IFX A;  2RRN A;  1WJ9 A;  1HHQ A;  2DY9 A;  5IZH A;  2OEJ A;  4DR5 F;  3FSX A;  3A3P B;  1Y11 A;  3FZB A;  2CPJ A;  3Q22 A;  3UN5 A;  2GHW A;  1VI7 A;  1QVF R;  3PG9 A;  1OQ6 A;  1TL7 A;  1JLC A;  2EVZ A;  3SIP B;  1IBC B;  4OZN A;  3W8P A;  2U2F A;  3OD2 A;  1SPB P;  1X5O A;  4URQ U;  3KUE A;  4A8X A;  2F8M A;  2VKR A;  3HSJ A;  4USV A;  1PSD A;  3ISN D;  2VHG A;  1M5K C;  4DV4 F;  2VG7 A;  1S7I A;  4U96 A;  2MKK A;  3ZZZ A;  1MLA A;  1TKT B;  1N5Y A;  4N5S A;  1WEL A;  1L3T A;  4K2J A;  4AD6 A;  1GX6 A;  1OY6 A;  4G1P A;  4WYL A;  4RW7 B;  3OL7 A;  2BAN A;  1T9V A;  4W98 A;  2IBK A;  3QMQ A;  3ZO7 A;  1HW8 A;  2BQ3 A;  1PJ5 A;  4CO4 A;  3V6H A;  5HAN A;  2B6A A;  5T7L A;  2EKN A;  4MK8 A;  1PGZ A;  2VC0 A;  3DOL B;  2FGO A;  5C2G A;  2Z57 B;  1ULR A;  2J0S D;  3M2V A;  3MM5 A;  1HI0 P;  1TUV A;  5GME A;  4OZ1 A;  3ZXW A;  3M7V A;  4O44 B;  2R7S A;  4Z2X A;  1LK7 A;  1RT5 A;  1C4A A;  4DPY A;  2QLB B;  4I6W A;  2DR9 A;  1RAA B;  2DH8 A;  4KV8 B;  1B7Y B;  2AYM A;  4PG5 A;  2MST A;  4X4U A;  2OI2 A;  4QU7 A;  2ZBR A;  2F65 A;  3D0H E;  1AT1 B;  5LOQ A;  4DV3 F;  2QT7 A;  2J7K A;  4ZCL A;  5AE2 A;  4Z37 A;  2BMB A;  1VRT B;  1NU4 A;  4NI2 A;  2YTC A;  1FJG F;  3D28 A;  1SQF A;  4WK1 A;  3NMR A;  3J7Z T;  2IVF B;  2V2Z A;  3MR6 A;  1VQ9 S;  1Y3J A;  1NSA A;  4K4T A;  2UP1 A;  1FNX H;  5FLX Y;  2E1R A;  1HNZ J;  1REV B;  3RBD A;  3CB4 A;  2CVE A;  2MQ8 A;  5ETL A;  1RUS A;  2FLO A;  4JBC A;  4LMZ A;  1LEO A;  2YNI B;  1CQN A;  5HBM B;  1VBK A;  3IRX B;  1ARO P;  1ACM B;  1T03 B;  1DAX A;  4IFY B;  4K4W A;  1U48 A;  2XB2 D;  1CEZ A;  2CQP A;  3QFW A;  3R6G B;  4WWS A;  2VFU A;  1V3Z A;  2R4F A;  2MZJ A;  2R7U A;  3NEK A;  3M6U A;  2FD2 A;  1K1S A;  3FEY B;  4CT8 A;  2FPH X;  1S0V A;  4YFU A;  2EK1 A;  3CJR A;  1PKU A;  3GII A;  4NZ7 A;  5A8K A;  2HQC A;  3NMA A;  2B4O A;  3M2U B;  3ISN C;  3ELH A;  5HVH A;  3PW7 A;  5EWF A;  2NXJ A;  3K0J A;  4KBI A;  2AU0 A;  2X7I A;  3DMJ B;  4QWC A;  1A7G E;  4HTJ A;  1BGX T;  4WE1 A;  4PR6 A;  4DI6 A;  4DS4 A;  3RGI A;  3CJQ A;  4CLS A;  2KYZ A;  3DOK A;  4BC9 A;  1TKD A;  1E6Y A;  4DV1 J;  5AE3 A;  2W4C A;  3S1T A;  2DRB A;  4MH8 A;  2CZ9 A;  1C1B A;  2WB4 A;  3ZTQ A;  4ID5 B;  1S1U B;  6AT1 B;  1BQM A;  4Q2L A;  3EZU A;  4FXV A;  5IC6 B;  2Q6B A;  2HMI B;  1EHW A;  1WEX A;  4RX6 A;  2KZM A;  2ZDO A;  1X0F A;  1UWA A;  2XLI A;  2DNO A;  5HJX A;  4DR7 J;  2YPZ A;  5D4L A;  5B0F A;  2ZUA A;  3GYG A;  4OYB A;  3CUL A;  3CCW A;  5DDO C;  2X1F A;  2XY6 A;  3GWC A;  5B0A A;  2R7W A;  4AXI A;  3EVM A;  2R7R A;  4DR2 F;  5D6G A;  4A48 A;  3T1A A;  4HHJ A;  2HG4 A;  4U7U D;  1YI2 S;  5H1S V;  5BYS A;  1FRH A;  4X84 A;  1NB7 A;  4H4M A;  1EZZ B;  1T9T A;  1NJX A;  5F0W A;  5CHC B;  3PR4 A;  3HD2 A;  3ADA C;  2V8P A;  3OSP A;  3R27 A;  2MHN A;  3U1L A;  1G7C B;  5H9E K;  2NZ4 A;  1FHT A;  3G2X A;  3IS9 B;  5DG8 A;  2ROE A;  4ZVE A;  4C0H A;  3TNV A;  1FK9 B;  1I6J A;  2IC3 A;  1VQS A;  2RIJ A;  3LP1 B;  2PFD A;  1S97 A;  2VIH A;  1DY3 A;  2V69 A;  4U7C A;  2J5A A;  3N28 A;  2RAQ A;  3GIM A;  2JSX A;  3W65 A;  4X4T A;  2B7B B;  3I82 A;  4EK2 A;  4CLT A;  1O6X A;  1DLO A;  2BJ8 A;  1U24 A;  3ICL A;  3GR1 A;  4J9U E;  3AD7 C;  3NNH A;  2DGW A;  1UJ4 A;  2OTL S;  4WZM A;  4M1K A;  1R0B G;  1FFS B;  1KVJ A;  2UUB F;  5B08 A;  2B9W A;  2AD9 A;  4IUF A;  3R7B B;  5U47 A;  2ZFH A;  2LVW A;  3K5L A;  5CYQ A;  3T19 A;  3QRR A;  4NA1 A;  3Q89 A;  4TYA A;  2CPZ A;  2UV8 G;  4LVN P;  2Z2Z A;  2FQQ B;  1ZPV A;  3SI8 A;  1PYS B;  3AOC A;  4C8M A;  5L9X A;  1UZD A;  2Z2M A;  1RSC A;  1VK8 A;  2D69 A;  3IR7 B;  3K57 A;  1RP5 A;  3I0S B;  2VL1 A;  2FUG 9;  1L3U A;  4ED8 A;  5K8P A;  5HI7 A;  1G4C A;  1D9D A;  2CVI A;  4RU2 A;  3AD8 C;  1ZH5 A;  3CCS S;  2HFN A;  2AMC B;  3IG1 B;  4IOC Q;  2ZDP A;  3M2R A;  2IRY A;  3G86 A;  4P2S A;  4IH7 A;  4GO7 X;  4LF7 J;  5KT7 A;  3E2E A;  4QWA A;  3FBC A;  4ZCM A;  4C0B A;  1S6P B;  5T14 A;  1KP6 A;  3MMA B;  1N6Q B;  1WD6 A;  2VA2 A;  1S9G A;  1CS4 A;  1R8P A;  2YKQ A;  3LP2 A;  3JSM B;  4DUY F;  4USM A;  2B4U A;  3TOQ A;  5C5J A;  1NH8 A;  4CO0 A;  1M5P C;  1NPR A;  2AJ2 A;  4LFC F;  4DV2 F;  3P6Y C;  2W4P A;  4GC6 A;  2HHH F;  4TLQ A;  3OVA A;  2MZQ A;  2EBG A;  3SCL E;  2GAG C;  4AUK A;  4O3S A;  4F4Y A;  2EG1 A;  1RJJ A;  4LBH A;  2QMX A;  3DFE A;  4K0K J;  4FKY A;  5HVF A;  1UKU A;  2RF2 B;  3VAK A;  1MWY A;  1URR A;  4DF4 A;  4AFF A;  2FC8 A;  3DLG B;  1ZM4 A;  4RNM A;  2GQ2 A;  5F41 A;  2P2C B;  4ED3 A;  3I5B A;  3CC4 S;  3G8S A;  3UCU P;  2X1B A;  1R7I A;  2Z0G A;  4PXC A;  4PWU A;  1YJT A;  2LP4 A;  3DDI A;  2UU9 J;  3CVK A;  3A1Y G;  5BYR A;  2Y0B B;  3CW2 C;  2E5L J;  3QO9 A;  4F2R A;  1NDK A;  4HVZ A;  5LJ5 Y;  2JFD A;  1XMQ J;  5GAE I;  1PG5 B;  3IBW A;  1KHW A;  1IKX B;  2GV1 A;  4J9K A;  3SCJ E;  5K8O A;  3HMJ G;  3BKT A;  1NK7 A;  2C28 A;  4OJ1 A;  4DPO A;  1OPZ A;  3K58 A;  2R8K A;  5A0Y B;  3RZA A;  1IVZ A;  1RAE B;  3MPD A;  1SIW B;  4YDD B;  3BBF A;  2H1Y A;  1N5Q A;  2B7C B;  5GAE U;  1Y5N B;  1BHN A;  1LWC A;  1LWF B;  3RRG A;  1LW0 B;  3NCP A;  2ZZN A;  5C42 B;  2CPE A;  1S1T A;  3TJA A;  2G0C A;  1RTJ B;  2A0F B;  4M95 A;  1RAB B;  1QUV A;  4PG6 A;  4TLR A;  2V4Q A;  4DV5 J;  4OHY A;  1U49 A;  2HRT A;  1SL1 A;  1PBA A;  3QAT A;  4F36 A;  4NAS A;  1U26 A;  1WI6 A;  1RWO B;  1FER A;  2RDJ A;  2YQ3 A;  3DRY A;  5EX0 A;  4QR1 A;  3QSY B;  1RK8 A;  2UXD J;  5I42 B;  5LT5 A;  3QRP A;  3Q8R B;  4PYA A;  3HHL A;  1Q8I A;  2Q43 A;  4GKJ F;  2RE1 A;  1TKX A;  3J80 Y;  3KNA A;  1FE0 A;  2AZ1 A;  2ZJP Q;  5ETP A;  4EO8 A;  4EBE A;  3WDO A;  9ATC B;  2G2O A;  1JLF A;  4N47 A;  3GMG A;  4Y2M A;  4RNN A;  4FYY B;  1GMW A;  4MTP A;  1M1H A;  3CCV S;  4K7Q A;  1XN9 A;  3OTE A;  3L7P A;  1RE1 B;  3U1N A;  1X4H A;  2DRD A;  5D3G B;  3DI6 B;  2C1E B;  4KGK A;  4LSN A;  5KOX A;  3LP0 A;  4ELT A;  2VIC A;  2PII A;  2NLW A;  2DHX A;  4KGX B;  4WXW A;  2I38 A;  4QU6 A;  2B8P A;  2OMO A;  2W2Q P;  2RVJ A;  2DNN A;  3JSR A;  5EHH A;  4CO1 A;  4RZR A;  1GXL A;  3IFE A;  3DYA A;  1SB6 A;  2J9E A;  2P5V A;  4ZLN A;  4B9V A;  3BGR B;  1FO1 A;  3QAE A;  3QJP A;  1N33 J;  2HKE A;  3UCZ P;  3V6J A;  1UA1 A;  4CCH A;  3J7A 1;  3H98 A;  5KFB A;  4K2X A;  2CAJ A;  3NP5 A;  1S1X B;  4MK9 A;  1S1W B;  2ZC3 A;  2R7V A;  2DR7 A;  2VG5 B;  2KG1 A;  2IAJ B;  5KFH A;  4IG0 A;  1JB0 C;  1YJR A;  3RR7 A;  1KVI A;  4U9R A;  1VFJ A;  5F9L A;  3GV5 B;  3BR9 A;  4M63 A;  1O8B A;  3VCD A;  1T8E A;  4B17 A;  2QE5 A;  1X9W A;  2X1G A;  1NJW A;  4HT7 A;  1X7V A;  4G1Q B;  4ZPV R;  1T05 A;  3RG6 A;  4X4V A;  2PFF B;  1FX4 A;  1TL3 A;  2HHP A;  2BR0 A;  4HT5 A;  5IFM A;  4AL6 A;  5HP1 A;  4LRB A;  1RB0 A;  4ELU A;  2AP6 A;  1VQN S;  2DPI A;  2F4V J;  5D78 A;  3GON A;  1S6U A;  4EZ6 A;  1GAO A;  1SXL A;  2M4M A;  2AJ0 A;  1XNQ J;  3EMT A;  2E1P A;  4EI2 A;  2ZVS A;  4RUH A;  1J5E J;  4XO0 A;  1AFJ A;  3DRX A;  2B5J B;  2JL9 A;  1FKO B;  1X4G A;  2UUA J;  1FX2 A;  4TU7 A;  4CH1 A;  1SKW A;  1RYR A;  2WON A;  1QSY A;  2V2Q A;  1O5J A;  4OX9 J;  5J2Q B;  4B9U A;  5DDQ C;  2CUY A;  2IM1 A;  1AZS A;  2W2N P;  1QAY A;  4ZN3 A;  3M9M B;  3EE3 A;  2BQU A;  2DXF A;  2E29 A;  1I3O B;  4HI1 A;  3IA0 A;  1IN0 A;  1XMB A;  2CIM A;  3CJ3 A;  3SQG B;  2W24 A;  4IFV A;  2VBY A;  2YNG A;  5JXS A;  3MM8 A;  3M6V A;  5FDL A;  4PG7 A;  1ITP A;  1UWB B;  4I56 A;  1HBO A;  2V8H A;  1WC1 A;  4ZP9 A;  2C22 A;  3OSN A;  4NLY A;  2HFU A;  1EKR A;  4DR5 J;  2JJ4 D;  3BGO P;  4DR6 F;  3FBF A;  3JS9 A;  1R0A B;  2J8A A;  1TL4 A;  1O0P A;  4MYU A;  4NLT A;  1RWK B;  4ZCI A;  2C3U A;  2M7S A;  1LWX A;  4WBF A;  4WFN Q;  4ECZ A;  4LFA F;  5GAH I;  2D1C A;  3KJQ B;  4NLS A;  2V68 A;  2FJD B;  2W25 A;  3E01 B;  4RW9 A;  1F3F A;  1PJ7 A;  2O3D A;  3DGP B;  1BWV A;  1TAU A;  3I55 S;  2GHP A;  2D9O A;  4FZV A;  3UDC A;  1WHY A;  2ATL A;  2CQH A;  2AGO A;  4NLR A;  2R7X A;  2JLF A;  4PAA A;  2QA4 G;  3HLU A;  2DH9 A;  3ILL A;  1OSC A;  1KLN A;  3EWG A;  4YUD A;  5GAH U;  2R2T A;  4NZ6 A;  3KK3 A;  2X3D A;  1F5C A;  1QUP A;  1R8C A;  2WVF A;  1U1K A;  1NBE B;  2O5D A;  4LQ9 A;  2E1C A;  1LFW A;  3WIV A;  3TA0 A;  5DM6 Q;  1D9F A;  3V81 B;  3S8S A;  4KFB B;  3N0V A;  2ZOM A;  5KG4 A;  4L75 A;  4F0M A;  2HBZ B;  2HWT A;  2YNH B;  1DQ9 A;  5DS7 A;  2WTF A;  2LEA A;  3NG8 A;  4JI8 F;  4Y28 C;  1Y7P A;  4DV6 F;  1ZOT A;  2FLP A;  1MSW D;  1VMB A;  3UE2 A;  4MKB A;  4EBD A;  4ILM A;  1HBN A;  3KLF B;  4DV3 J;  1B3T A;  4M5L A;  4RW7 A;  2XMT A;  2GVD B;  5IQQ A;  1Z1Z A;  2IHR 1;  2LU1 A;  2VG6 B;  2L41 A;  2EFG A;  3QNW B;  4PWD A;  3NRB A;  1VCT A;  1IUJ A;  3D6M B;  1JLB A;  1FNM A;  1BD6 A;  3HK2 A;  4RUC A;  4I4B A;  2L08 A;  2W2O P;  4QCL A;  2MB0 B;  2NS1 B;  1VS3 A;  1S1V A;  5KTQ A;  1B70 B;  2BE7 D;  1NUE A;  4B3S J;  4C97 A;  3EYZ A;  5ETK A;  1V9O A;  4OYZ A;  4OX7 A;  2SXL A;  2V4J B;  3DM2 A;  1EQ0 A;  4RW4 B;  1F2H A;  1IR0 A;  3MAA A;  2FJV A;  1RAH B;  4OYP A;  2DHA A;  2EC2 A;  1X9S A;  4KH0 B;  2HGM A;  2FHK A;  2LCW A;  1UCN A;  1HQE A;  1GQE A;  1W7W A;  1BXN A;  1SC4 B;  4R0E A;  2HHQ A;  1ELO A;  2CZV C;  3T5L A;  3JB9 k;  3IRX A;  5D0R A;  4V19 X;  4ZVP B;  1RWN B;  1JJ2 R;  4O3P A;  4ILR A;  1YKW A;  1KKH A;  2N4D A;  2AWZ A;  3BZQ A;  5IM0 B;  2EFQ A;  2OP5 A;  2RQK A;  1S99 A;  1JXV A;  3N6N A;  3DKD A;  3M2U A;  3RBE A;  2W9C B;  2GJ2 A;  1RT4 B;  4EEY A;  1GMV A;  3MMB A;  4CLW A;  4B08 A;  1JLQ B;  1D1U A;  2WBR A;  2F3J A;  1Q8B A;  4LBI A;  2DVI A;  2J9D E;  1EAR A;  3V4I A;  4IKA A;  1FJE B;  1VLY A;  4KYZ A;  2ZBC A;  5F8I A;  2BX6 A;  2ZH8 A;  2ZBQ A;  2KXH A;  1DZ5 A;  4LRE A;  4PG4 A;  5IQ6 A;  4DR2 J;  4NLD A;  2Q79 A;  1D8Z A;  4R5P B;  3KHH A;  5HQL A;  1YK9 A;  3OLB A;  1APS A;  3W5X A;  3FGV A;  2P9C A;  3ENQ A;  2CA9 A;  3SDE B;  3ILI A;  1TQL A;  1VDH A;  4UF4 A;  2D3Z A;  3VF0 B;  5A6P A;  4X4S A;  1KON A;  4KHM A;  2HMI A;  3P5T L;  2X3G A;  4F4K A;  3MI7 X;  1N36 F;  3BN4 A;  3NGT A;  2L9D A;  4OZ3 A;  4HH1 A;  3TA1 A;  4ECW A;  2A6M A;  3TUJ C;  3IC1 A;  3PXG a;  3MEG B;  1VBZ A;  4FBT A;  1QLN A;  1ZAX A;  4MIW A;  4MK7 A;  2CG8 A;  2DO4 A;  1GXT A;  3UDL A;  4ZIW A;  3QYY A;  1U25 A;  1NSP A;  2MY8 A;  2RS8 A;  3V6D B;  4AQY F;  1Q5V A;  1Q1K A;  1VC6 A;  2IJF A;  2FLN A;  3GV7 B;  2G13 A;  4Y0F A;  3UD5 A;  1SKS A;  3JQM A;  4J90 A;  2UUB J;  3OFE A;  3OTD A;  2DR8 A;  3DRS B;  4P72 A;  4J9N A;  3H25 A;  1WUU A;  1TK5 A;  3M30 B;  4IQM A;  1YVF A;  1FK9 A;  3G6Y A;  1WG5 A;  4M5I A;  3ZZR A;  1HQU B;  3P5B P;  5THW A;  5MLC V;  3ENW A;  1U1R A;  4ES3 A;  4DR1 J;  3C16 B;  3WBZ A;  2KL8 A;  4L73 A;  3O3L A;  1M1G A;  2LQJ A;  3BDP A;  3FEZ A;  2PE8 A;  3KXD A;  1RWM B;  1PJ6 A;  4DSJ A;  2QTW A;  3TWZ A;  2KH9 A;  2XS5 A;  4TN2 A;  5HQM A;  3Q8P B;  2XMM A;  1VQK S;  5KG1 A;  3TAN A;  2M3D A;  2RHS B;  2VBX A;  3R7S B;  3CD7 A;  2VOD A;  4HEA 9;  3KUH A;  3F56 A;  4USI A;  1RWV B;  2K3I A;  2C3M A;  5IV3 A;  1QDU B;  1KFD A;  4C7Q A;  1S49 A;  2RKI B;  1H72 C;  4DV0 F;  5JVG Q;  2M5Y A;  2GGP B;  1UEK A;  4NML A;  4ZP8 A;  1TV6 A;  2UUC F;  2VPZ B;  4DSK A;  1RAJ A;  1HL6 A;  4AYB D;  3L7U A;  4C11 B;  1YJ7 A;  1YQH A;  4OHZ A;  1UVI A;  4DFK A;  4O0I A;  4DPT A;  4F0H A;  2N7C A;  3KLH B;  4DUY J;  4NEZ A;  1YBA A;  6FDR A;  2KT2 A;  3W9I A;  2DK2 A;  3JYT B;  2J6S A;  1FT8 A;  3KLE A;  2KG0 A;  2RH3 A;  1QAI A;  3HF5 A;  3VR1 A;  4LFC J;  2F1F A;  2DIS A;  4DV2 J;  4DV7 J;  4DLG A;  2QEX S;  3K89 A;  2D3O 1;  2NYH A;  3IG1 A;  1VQM S;  4DN9 A;  5E3R A;  2PI4 A;  3MM6 A;  3G96 A;  2E44 A;  2FIU A;  5F8M A;  2GS8 A;  1OYE A;  4JV2 A;  4G6V B;  1AYE A;  1S9E A;  3LW5 C;  2A3J A;  2ZD1 B;  1YRU A;  3ENV A;  2CNN B;  1UW9 A;  1S6P A;  2YKM A;  4FDF A;  2UVU A;  1MN9 A;  4PXB A;  3MMA A;  1N6Q A;  1YBU A;  4ZHR A;  1ZAV A;  5IT0 A;  3QIP B;  1I5O B;  2OO4 A;  1F1B B;  1H7W A;  5KFG A;  2RUS A;  3D67 A;  3TVY A;  2N82 B;  2NXN A;  3D2W A;  5L1L A;  4DZD A;  1AFI A;  5L46 A;  2VF3 A;  5L39 A;  3M32 A;  1S4F A;  2Z56 B;  1BLU A;  4GVB B;  4C98 A;  3KNG A;  4YY3 F;  2DIU A;  2PSZ A;  4I1T A;  1RCX B;  2HQG A;  4GRS A;  1HQ2 A;  4A8M P;  1HNV A;  4NLX A;  1JXL A;  2Y1I A;  4IG3 A;  1FKA F;  2QG9 B;  2BW7 A;  4DR3 J;  2AYB A;  1IR1 A;  3FQK A;  3O5T B;  3HJF A;  3CJK B;  1XMO F;  5LMN J;  2FLL A;  2FVS A;  1U1N A;  2PD1 A;  3A4T A;  4LF4 F;  3OHB A;  1Q86 T;  3QQC D;  2KJW A;  1UFK A;  1WOS A;  1S48 A;  1FDB A;  2QL7 B;  1KQF B;  3ULH A;  2GIR A;  5A76 A;  5KFC A;  2OFH X;  3QWU A;  2HEK A;  3AH6 A;  1HMV B;  4DL3 A;  2QYC A;  2RNE A;  4F3Q A;  3EUN A;  4ANE A;  2LKZ A;  2XG8 A;  3RAQ A;  3GSD A;  3VGT A;  1F3V A;  4C8Z A;  1NHK L;  2OML A;  1RHQ B;  1GT8 A;  1T02 A;  3DLE B;  1U1Q A;  3P96 A;  4P73 A;  3DGV A;  5ITH A;  2AKW B;  3AT1 B;  3MPU B;  3HJV A;  1FRM A;  4OI2 A;  2RT3 A;  5ETO A;  2NPI A;  1OY8 A;  3MHY A;  1NXI A;  2H48 B;  3PX6 A;  4YS2 A;  5IT4 A;  3SBM A;  2GML A;  3OR1 B;  1C0U A;  4PAB A;  2WVD A;  1NLK L;  5DDR C;  2FJW A;  1JMT A;  4URS A;  3TR5 A;  2NXE A;  2DGO A;  3UNG C;  4O4G B;  3GTY X;  3MD3 A;  3SCI E;  1IBL J;  4ZPB A;  1JLA B;  4NXM F;  1KNZ A;  3MWB A;  2L9W A;  3RTV A;  4ED7 A;  4USJ C;  5BYQ A;  1X60 A;  5LSR A;  1QD1 A;  5L1K A;  3CWJ A;  5I42 A;  4ECV A;  2B9E A;  4LIW A;  4LT6 A;  2XMU A;  1UA0 A;  1FXR A;  3IWN C;  2XNR A;  1WSV A;  3MCS A;  5J2N A;  2CPY A;  2NRE A;  1Q53 A;  1JLE B;  1KHV A;  2YBV A;  4DUT A;  3RRK A;  3ISZ A;  4NWB A;  3VQT A;  2M2B A;  2DO0 A;  2H65 B;  1NDC A;  5E7O B;  3NCR A;  3BRE A;  5DQH A;  2QV6 A;  4NX9 A;  4UZC A;  2XWX A;  1UVN A;  1FEE A;  3DI6 A;  2OEM A;  3FUY A;  2RRB A;  1RCO B;  2FVP A;  1C0T A;  2V8D A;  4DL5 A;  4WTY A;  1RA6 A;  2JOQ A;  2HVD A;  2HBQ B;  2CAD A;  2MZS A;  3GFZ A;  1NAQ A;  3AA8 A;  1FEH A;  4I68 A;  2BDP A;  1NPP A;  2CJY B;  3ITH B;  1NJI T;  4Q43 A;  2DGS A;  4TQR A;  4F3M A;  2JEG A;  1ROF A;  1WHX A;  3BGR A;  1JKH B;  2LQ8 A;  2IJR A;  3M6X A;  1N52 B;  3C46 A;  3TAP A;  1GK8 A;  2AJF E;  5C24 A;  1LWE A;  1S1X A;  3CPW R;  2EFO A;  1S1W A;  2BBE A;  4YR0 A;  2YPY A;  1YJU A;  3TEH B;  3GYN A;  1EET A;  3SV3 A;  3QLH A;  2XTJ P;  3DCA A;  5D0E A;  2MKY A;  3VAH A;  2Y8Y A;  3KHG A;  3GYX B;  3NY0 A;  5F3Z A;  4FPR A;  4G1Q A;  3HCX A;  1U0H A;  2HIY A;  3ZFV A;  3ENA A;  4JI2 F;  2E1A A;  2I8E A;  1TL1 B;  3BB5 A;  4PUO B;  2ERR A;  1U2C A;  3PV8 A;  3K7R A;  1R3N A;  4TYB A;  3OTC A;  2VQF F;  1N5V A;  5JMN A;  4LJM A;  3DXB A;  3VVT A;  4BCA A;  2MEW A;  2QSW A;  1NRK A;  1IM6 A;  3H8Y A;  4H4K A;  5SUH A;  4LSZ B;  4OX8 A;  3TX8 A;  2JEI A;  3W5Z A;  1HD1 A;  3U7J A;  1KDN A;  2B5J A;  3H0P A;  3BEG B;  4DR6 J;  4LSL A;  1Q7L B;  1XNR F;  4XAK A;  3NL0 A;  4WU3 A;  4O3R A;  4KO0 B;  5HSP A;  2ACM A;  4FNI A;  2Z2Y B;  1X4F A;  4ZVS B;  1N32 F;  4ETZ A;  2VJV A;  2XCA A;  1KVK A;  1ZET A;  3W2W B;  1M5V C;  5C7P A;  4PKD B;  2AV5 A;  1MU2 B;  4UOC A;  2XO6 A;  2ASD A;  2HHX A;  1PBU A;  1D9A A;  1JK9 B;  3WHI A;  3FK4 A;  4F4A A;  1UWB A;  3U02 A;  2BA9 A;  3N9U C;  2Z2L A;  3MM7 B;  1F2G A;  4ZP6 A;  2W01 A;  1R0A A;  2BE9 B;  1KBR A;  2UXC F;  2PO4 A;  3A3N B;  1RTI B;  4MT1 A;  3H4D A;  4UTG A;  2WBM A;  2BOA A;  5KG5 A;  1IWG A;  3Q8V A;  3KTQ A;  2BEF A;  3D5M A;  2E9R X;  3J7A N;  4RBT A;  2CPH A;  4F26 A;  5T41 A;  4QIG A;  3E01 A;  4HAC B;  1KEK A;  4O3N A;  1RQ0 A;  2KFN A;  4DFM A;  3OHA A;  2MQL A;  5CH7 B;  3PYG A;  4R25 A;  3E51 A;  5MAO A;  4GKK F;  1FWL A;  4H4O A;  2W8L A;  2WZ1 A;  4DV6 J;  1YIJ S;  5I3Q A;  1WHW A;  1HHT P;  3CED A;  3PYE A;  3HKZ D;  4DSF A;  1EAY C;  3PHE A;  4WIQ A;  4J9Q A;  4EBC A;  2KZZ A;  1RZM A;  1RTD B;  1QSL A;  1C4C A;  2PEB A;  1VR6 A;  2GVZ B;  4ZPT R; 
#chains in the Genus database with same CATH homology
 1EAY C;  1FFG B;  1FFW B;  2LP4 A;  1FWP A;  1A0O B;  1FFS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...