1FFSB

Chey-binding domain of chea in complex with chey from crystals soaked in acetyl phosphate
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
68
structure length
68
Chain Sequence
ARRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Further insights into the mechanism of function of the response regulator CheY from crystallographic studies of the CheY--CheA(124--257) complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/signaling protein
total genus 18
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09078 CheY-binding CheY binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits CheY-binding domain of CheA 1ffsB00
1FWPA 1FFGB 1FFWB 1FFSB 1A0OB 1EAYC 2LP4A
chains in the Genus database with same CATH superfamily
3K5NA 1IWGA 3KMSA 2UP1A 3D1HA 2AEJA 3MPUB 4DFKA 3Q8SB 3B4MA 3OL7A 3GJQB 4B9UA 3AD9C 3GJTB 2G2YA 1PSDA 3I6PA 4RUCA 2VBXA 4RNOA 4H4OA 1HBUB 3PX0A 2OGUA 3K58A 3W9JA 1QTNB 3HD2A 1B0VA 4KRWA 1JLAB 1BWVA 2X1FA 2VFTA 1RAJA 3KNAA 1EARA 5G4DA 5HSPA 5HI7A 3HT0A 1YBAA 3EGWB 1WDTA 2ZITA 4N8OA 4J9VA 1ZA2B 4PG6A 3PW0A 1FE4A 4OLPA 3NOCA 4IG3A 2MQNA 4KHRA 2PN6A 3CIMA 4PYDA 1DZ5A 2VF3A 1RHRB 3DDKA 5SUHA 4PABA 3DOKB 3RG6A 4QU7A 4IQMA 4HACA 3C6TA 4C2MA 3B54A 4ED0A 4B3TF 5G0RB 2IMWP 3M4XA 1HBOB 1PILA 3MMCA 4A46A 4LF8F 1UVNA 2HMIA 2AJ2A 4NLDA 3OTBA 2MZ1A 3MEDA 3BM7A 1E6YA 1UAWA 3HI9A 4Q45A 8ATCB 1TQLA 4FS2A 2JRSA 4P2XA 4DQQA 2KDOA 4IR1A 2EEYA 2E7XA 3RW7A 3BR8A 2RDJA 1LFPA 5A2QY 1LFWA 2QX0A 3IRWP 4C8MA 4O3PA 4XIUA 2Z2YB 1B0PA 3NGDA 3MEGA 2B5JA 3T5JA 4DLGA 4PAAA 4E0DA 3QFHA 2EW9A 3S7RA 4OHZA 2I5JA 2NLWA 4MJKA 4GKKF 4ID5A 4X4NA 2KYXA 3J7Z5 3G4SS 4I64A 3TAPA 1XWLA 4OJ3A 1MNEA 4MK9A 5HVFA 4IKAA 3JQKA 4NE9C 3CXCR 2NR0A 1BMQB 3ZTPA 4LSZB 2GQ2A 3GR0A 2Z2ZA 5KFMA 1Y5LB 4A8MP 2HQCA 1C0TA 1FA0A 4G6VB 5HJXA 4RPFA 1LWEB 3C2PA 3PHEA 4X64F 3FKBA 3FFIB 1VBYA 1BLUA 3X3UA 4K2JA 4ZCKA 1IKXA 5E3RA 3LA0A 1KNZA 1U6FA 4WK1A 1VLYA 3DLKB 2NS1B 1NNDA 5BYRA 5FIIA 4K59A 2I0XA 3OSPA 3TJAA 1KVJA 4NLVA 1PIEA 3GJSB 2OPPA 4CP5A 3E8OA 1S48A 1VOMA 4PG8A 4DR3F 5KFFA 4OYBA 2FJWA 3W62A 2QA2A 1NK0A 2PA3A 4RW8B 2EXUA 1RTJB 2JEJA 2B4PA 4NPOA 3IG1A 3RB3A 2J0WA 7AT1B 2XHCA 3SFUA 3QRQA 1I3OB 4YHHJ 4DSKA 2OSQA 1ZTWA 3CJ3A 3E01A 4X4RA 2CWXA 3CD6S 2JOQA 1FE0A 1UZDA 4P73A 3UNGC 4J91A 4DV1J 1YIJS 1FRMA 2HNYB 3ENVA 2H9ZA 2HRUA 3W7BA 3R5GA 4K2XA 4TXSA 2A6MA 1PO6A 4X65J 3Q8VA 1C1BB 3EDRB 3NGUA 2POKA 1DFDA 1VI7A 4MIBA 5C7PA 2NXNA 4V19X 4OHVA 1NK5A 4C4WA 2GIFA 3W2WB 4P71A 1HNXJ 1RT5B 5AXNA 1F9EB 2E5LJ 4UZCA 3V6DA 2CPFA 1Q8LA 4C8YA 4PQUB 1N32J 3CDAA 3G6YA 5HP1B 1QVFR 2W9CA 3UI3A 3SQGB 3W2VB 4F50A 1KVIA 3VGVA 2AV5A 2JL9A 1U2RA 1X4HA 3TWZA 1HNVA 3OL6A 2HBYB 4DL3A 5KG4A 3UVJA 2BM0A 2JSXA 1WI8A 1OQ3A 3D2WA 3EM1A 1XR7A 3MD3A 3OJSA 2IHR1 3HFKA 2OFGX 3V5RA 3VALA 4MK8A 2YNIB 4Y2KA 4K4XA 1T03A 5C42B 3A12A 2BUNA 2FC8A 2XHWA 3GONA 4ZVRB 1RSCA 3MM9A 4R0JA 1HQEB 1FWLA 4KE5A 2OPQB 1M5SA 1HD1A 3SSRA 3KWMA 1CEZA 3CJTA 2E9RX 3LWMA 3EMTA 3OVAA 1H7XA 1UA1A 3IM9A 2XEXA 2OTLS 4Q2MA 2V4JA 1CJTA 1UFLA 4JBCA 3CDBA 2B51A 2ILYA 1P6TA 2HLUA 2RHQB 3MR7A 5KFSA 4G1QB 1S9EB 1GK8A 1VK3A 1C2PA 1TKZA 2FLNA 4DJBA 4LFCF 2GVDB 1N56A 4QOTA 4UUWA 4C0OC 3VAHA 3O8WA 5K14B 3TZZA 2EC2A 4DUYJ 3GFHA 4NLQA 3DYAB 1TL3A 2AZ3A 4DSJA 5F8GA 1MROB 4GO7X 4L6V3 2HQIA 4O44B 1P9QC 3TUZC 1ZPVA 4NXMF 2FJDB 2YH0A 5D0HA 1IQTA 1ZAVA 4OI6A 2IVYA 2NYHA 2AQ4A 1FI4A 1FWKA 3M8WA 4PUOB 1QSSA 1V9OA 4OZ1A 5A0YA 2PEBA 2W4PA 4GKJF 4OZLA 3FZ2A 1D1UA 5KFGA 1Y3JA 2EKNA 1E6VA 3RB6A 4FF2A 4QYZK 1SIZA 1YSJA 1QAYA 4YDXA 2MZRA 4ZJOA 2ZH1A 4ZVUB 2ALYB 5BJRA 3PX4A 1M5KC 5L38A 4Y2IA 2BMBA 3AH6A 1FX4A 5BYSA 3ITHB 2E66A 5E33A 1KLMB 1PJ7A 5KG5A 2PI4A 2OEMA 1KQSR 3DRPA 2KYZA 2HG4A 1NZAA 2LP4A 3QJPA 5L1KA 3Q8PB 2DNKA 5JXSA 5L46A 3R7NB 4KTQA 5KFHA 1IBKJ 3UR3C 5DETA 5EDWA 1YDLA 3ZZOA 2RKIA 3PG9A 1VRQC 3VAKA 1GXLA 5DGAA 1CSJA 3TJ9A 2HYIB 4RW6B 4PXDA 4BDPA 4QYZJ 1RHMB 1TUGB 5IQQA 2J9DA 4J9MA 1Q0NA 4YB5A 3CDWA 4DPXA 4K0KJ 2HHUA 3AB2B 1XIQA 4CLWA 3WZ0A 4PWUA 1RAOA 2HQGA 3W5ZA 3OPKA 4P2FA 5C24A 2V2QA 3B78A 4FXDA 5CAAA 2KVQE 3V6KA 2WSFC 2WBRA 4OX9J 3LP2A 1CC7A 3HM9A 4AFFA 1T8EA 5J2QB 5IXUA 1DARA 2BJDA 4ZJLA 3PKYA 4AD6A 5E5NA 4DV3F 3UCZP 1S4FA 1SPBP 4X66F 3FRZA 1N34F 3BH7B 3M2RA 2GMHA 4DR7J 2YNHA 1I94J 2GMJA 1T9WA 2YWHA 4BWMA 3ILIA 3H59A 3IRXB 5IV4A 4DL0C 1X9WA 2KT3A 3K7RA 1SC6A 2MQ8A 4HL9A 2DGUA 2ACYA 2DGOA 4USMA 1PCAA 1VQPS 3BREA 3TEHB 4LR9A 4J37A 3ICLA 3PXGa 3I5CA 1NEEA 5K8OA 4ZVQB 4JI8J 1FEHA 2WOMB 3CEDA 4RW9A 3VWSA 4MYTA 3US5A 4MKAA 2MZSA 4NLWA 3CTRA 1RAFB 3OL8A 1NJYA 3Q8RB 3M2VB 5IOLA 1KN6A 2P9EA 3CSKA 5ETRA 1QY7A 2XMKA 1H72C 4AQYF 3BPDA 2AMCB 2A2CA 3M6UA 1OY6A 1A0OB 3N28A 1KTVA 3BGFA 3BO4A 2CNLB 1YVFA 4WWSA 2BVZA 4DPWA 1SL0A 4F3QA 5K8MA 3X1LB 3EYZA 3I0SA 1N5YB 5HMYA 2PD1A 3K2YA 4O0NA 3QNWB 2BJ3A 1GNKA 1N36F 2GVZA 2CNNB 2KXNB 2KXHA 2DRBA 1B7YB 1UJ5A 2XYPB 2HEKA 4WYLA 2QN6B 3FZBA 2DT9A 5E3QA 1TFWA 5HK4A 2VD3A 4FNIA 1LK7A 3MI7X 4ED3A 3M30B 2J0SD 2SXLA 1N54B 5C25A 4I7FA 3V81B 1F3FA 4NCAA 4F0KA 5GMKa 3MGJA 3G82B 3GG1A 2R7RA 2OTJS 3RAMA 3EUNA 1WELA 2OUGA 3M8ZA 2XLIA 4ELUA 4TQSA 1AZSB 2VODA 3FSYA 4B9LA 3QGIA 3OLBA 3ZFVA 4K4SA 1HBMA 1S1WA 2IC3B 2Y9HA 1O6XA 2LDIA 3BGOP 4UTGA 2P8IA 2DHXA 3T5LA 2ZD1B 5L8RC 4O3QA 1RA6A 3FK4A 5DQGA 2B4OA 2P5VA 4WP8A 3MMBB 5CHCB 1T05B 3BGUA 4TYBA 4FDFA 2DGQA 3MM5A 1W2IA 2CKWA 1EX8A 1OMSA 2GC8A 3PO4A 2ALZA 4OHYA 4NMLA 2ZUAA 3ENAA 3ONQA 3MR3A 5KOWA 1X5SA 4DR4J 3QGHA 2HKEA 2RU9A 3PDNA 2C3PA 3MCOA 4HDGA 3HHNB 3A3PB 1CQNA 5JMNA 2HNZB 1LWFB 2XWXA 2GS8A 4DR6J 1U1OA 1GMWD 3CJ0A 2CQ3A 1EAYC 3TAMA 2PSZA 2J9DE 2Q3PA 2IDLA 1ZZFA 3MECA 1N33F 3KDOA 1NO8A 5DLFA 2D9OA 4CH0S 2BQ3A 1S1TB 1HFEL 3LGMA 1M1HA 4HH0A 1H6KX 3BGLA 5KG1A 3O44A 4C3KA 2C2OB 1HBNA 1N52B 2OD6A 3JSRA 2L48A 3NS5A 3M8YA 3NBPA 2XY5A 3DM2B 4OI3A 1RT2B 1RYRA 2LQ8A 4CT9A 3LPEA 1MWQA 4WFBQ 2H3EB 2RH3A 1WEZA 3DDNA 2VC1A 1EP4A 2FUG9 4DF4A 4ZPAA 4DCPB 1VC6A 1ZM4A 2OMOA 2FJEB 3UE2A 4A47A 3I32A 3H5UA 4PXEA 1LQ9A 2V4RA 4J5OA 4LF6J 4USTA 1RB0A 2VONA 1RKIA 4DZDA 5I4MA 4L75A 4YR0A 3VAJA 1WG4A 3GZ7A 1F1BB 2F4VF 2NXEA 2HHQA 2W24A 3CCTA 1NSPA 1S5ZA 4FBUA 4LRFA 4JUZA 1RHUB 2XM3A 3R9LA 4DV7F 3PR5B 3JXOA 3TRGA 4DG1B 5CZVA 4K4TA 3OW2R 1KD1T 1HNIA 1M0SA 4H4MB 5T7LB 3MZIA 3TUIC 3EWGA 3CD5A 4L3KA 4YMEA 1KONA 4FKXA 3OD2A 5DO2A 4PG7A 5DRKA 3WDOA 1NPPA 4IG0A 1BWEA 4UOHA 4P2MA 1GEHA 1NDLA 2X1BA 4DV0F 2VICA 2VL1A 3UCUP 4YB6A 3U7JA 1Q81T 1IKWA 3C6TB 3PVXA 1OYEA 4P9SA 2ZM6F 2B9XA 4M8LA 1HWKA 2RE1A 1U2CA 1QAXA 2EFOA 3KLIA 2ILZA 4N5SA 2JC1A 2UZAA 4EBDA 3DGPA 2CIMA 4IUFA 3RB0A 1E6YB 3H20A 4QWDA 5THWA 3K5MA 3P4UB 5ETMA 1X5PA 4PRFA 2QYGA 3DU6A 1PJ5A 1X5OA 3CJ2A 2XI2A 1JLQB 2ZKTA 1X9SA 1SKUB 1FXRA 2CQBA 3BN7A 3ULHA 2V2ZA 1JB0C 5D8HB 3JQJA 4DQSA 4M5JA 4OYWA 5KFZA 1NDPA 2AEFA 1Y00A 2C3OA 5KFLA 3RTVA 2YY3A 2B5JB 3ETOA 5JJBA 2F1FA 2M2BA 4USJC 4LFBJ 3L7OA 1RTHB 3DI6B 2E5IA 4F67A 2J76E 2I5JB 3T3FA 4NEZA 1XN9A 1IR1A 2VV5A 2EFVA 1S72S 2G2OA 2KZMA 3H90A 5KT3A 4W92B 3D9BA 3T9NA 4OZNA 5LSOA 1HPZA 1B99A 2Q6CA 4DQIA 2AJ0A 3N6NA 3HX9A 1AT1B 3SZ2A 2LEAA 1SKRA 3E3XA 3MAAA 2CPHA 3GIMA 1SKSA 1CJVA 4BLGA 3D67A 2RS8A 3QGGA 1UWBB 5LJ3Y 2W8KA 3BQ2A 1D9FA 2ZZNA 5K20B 1S7IA 3GG0A 3A3OB 2OEKA 2ZH5A 1QUVA 4B3TJ 4DL2A 2HHHJ 4OYXA 2GV1A 1UJ6A 4LF8J 3DU5A 4FKYA 2X1AA 5A6WA 3KHGA 4Y65A 3BDEA 5K8NA 2CG8A 4IR9A 3GIIA 2OPPB 2F8HA 3AA9A 3NNAA 3PJWA 2IFXA 2DH9A 2EI5A 4ECXA 3D3CJ 3HO1A 3R7BB 4F36A 3M32B 4EWTA 3CCSS 3QIPA 3RRHA 4WK3A 5DZ6A 3MMAB 4F4ZA 1SB6A 4NA3A 2XGQA 3BS9A 2CG4A 3QT8A 4X4QA 1FHTA 1JKHB 3NXZA 4D3HA 2FHKA 3TEGA 5MLCV 4GKKJ 5IQ6A 5HVHA 3OR1B 4ED1A 3N5FA 3CCJS 1MN7A 3LPYA 5AE3A 3NAHA 2E9ZA 2HVHA 4OZ2A 3LP0A 1JX4A 2LCWA 4PXBA 3OBIA 1KS2A 4U8YA 1CULB 3F0NA 2PO4A 2XZDB 2HURA 4FYDA 2DCUB 5AJ3J 5K5MA 5DM7Q 2VFVA 4X64J 5MAOA 4IH6A 1V5VA 1HNZF 2GJ2A 2X51A 2DNQA 4XK8C 3OT9A 1RT1B 4TU9A 4DU8A 3CDEA 4KPCA 2H5IB 3W1YC 1HW9A 1FT8A 4ED4A 3PX6A 2Q1LA 1KBRA 3AT1B 2B9YA 1TL1B 3JTNA 4ZK7M 1T03B 3PR4A 4DR3J 2I8EA 2R3VA 2WONA 2JNJA 3CJKA 4M5IA 5KT7A 3MAHA 4RW4B 1RLDA 1KOHA 2KRRA 3WQPA 3OTOF 2GO9A 4EYIB 4P74A 2LXIA 3OHAA 1JJHA 4TQRA 3WC2A 2RRBA 2J8AA 1CJTB 5LMUF 1D3WA 3LW5C 1UETA 2XMTA 1RHJB 4PZVA 2UUTA 1FJCA 1FRKA 4NYZA 2ZDOA 1H98A 5CZXA 2J9CA 1URNA 3VQSA 5KFKA 1HA1A 1WC6A 3SCKE 1J5EJ 1KP6A 1Q7LB 3R5JB 3HMJG 1YZ7A 2X1GA 1AUDA 3A8IA 1FFWB 2CJBA 3C14A 2ZUGA 4J9PA 3ZC4A 1PAEX 4EUVA 5C2GA 5KG2A 4W98A 2W2MP 1S76D 2RNEA 4OYAA 2BXJA 2R8HA 3ADAC 1RWWB 4ALZA 5EGYA 4UOFA 4QIFA 3I31A 1KQKA 4DX8H 3D6FB 1GMVA 2APOA 3U02A 4LR7A 3SEOA 1V6HA 2RUSA 2FHOB 4NCGA 5LMNF 3SYZA 2QA4G 2UU9J 5L9XA 4KV8B 2BANA 4WKYA 2DXEA 5F8MA 4JI6F 3GFYA 1MMNA 4XDDA 3DMJA 4QWAA 4QIVA 1TVRA 1DTQA 2R7VA 1RAIB 4L74A 2HHSA 1AXQA 2L9NA 1LEOA 2G9OA 4NLPA 4CYUB 3DOLA 3PW7A 1SBRA 4O3SA 2VG7B 2IVFB 1UEUA 2KT5A 3OR2B 3R3TA 2MQQA 2DHSA 2K7KA 1XNQF 4LFCJ 4ECRA 1X4FA 3M2UA 1VQ7S 5CA5A 4MIAA 4E8UA 1UL3A 3MXHP 4NZ0A 2RILA 3M8RA 2DR8A 2NCKL 4C8OA 2XSJB 4DCOB 1HBUA 2MXYA 3SMZA 3CCMS 1TFYA 5IWAF 5BXIA 4LRBA 1PAUB 5KFCA 1AUSL 1JLAA 1RWNB 2RQ4A 3NS7B 1Q86T 4I2QA 1JMTA 4NXMJ 3FCVA 5HMWA 5D0GA 4WZQA 9ATCB 3SFGA 4JI4F 2DR6A 3HULA 3DNCA 3VVUA 1U09A 1TTHB 4HVZA 4CLZA 4ZMMA 2WTFA 4DFJA 2DNPA 2NUHA 2KT2A 4ED2A 4PWWA 3GILA 2XGPA 2FHJA 1MLAA 5B09A 2KFZA 2IA0A 5D4PA 1LV5A 1YBUA 5HJYA 1TUWA 3DOKA 2UUAF 4IRDA 4OQJA 2IRXA 3I0RB 4QJVA 5G0RA 4ZCLA 4NOHA 1HBOA 5A76A 2N82B 4Q2LA 4H4KA 2QEXS 3TA1A 3BV8A 1CPZA 4HLBA 3D4JA 1HYSA 4C9DA 1J2VA 1RYSA 3W60A 1B4SA 3C46A 3QYYA 3GYNA 1TKXA 3GFXA 2ZWPA 5KFNA 1TELA 1XJWB 2J6UA 2NZ4A 2ZNZA 4WP9A 1UJ4A 2HLTA 4F4XA 2HS4A 1IUJA 4J9KA 2DGXA 2CQ2A 4DR1F 2M52A 4OJHA 2O01C 2UXCJ 4OX8A 4G65A 1W25A 2QLFB 1IBMF 2CVIA 4PXCA 2CXEA 3SQOP 5IT9U 1FX2A 3KG1A 2VOOA 1FNOA 4OI4A 5D6GA 4B08A 2CDRB 2J6SA 4NLXA 3IWLA 3JSYA 4F3MA 2HAFA 1VLOA 2A0FB 4Q44A 5KTQA 1CG2A 4WBFA 4CLUA 1JNZB 4EI2A 1IQZA 2W7OA 2I2YA 3V2UC 5L1JA 2HWHA 2PEHA 1LWEA 2CNOB 2CYYA 1JJ2R 1PYOB 5RUBA 5IZHA 3FFIA 4I68A 1TK0A 2JLGA 3H25A 5C2CA 4QR1A 5DG8A 1NH7A 3BKUA 3NGKA 4KHMA 4OJ1A 3A8JA 1W26A 3Q89A 3DLKA 5AXLA 2DK2A 2WZ1A 3BSAA 3QT5A 3JB9k 3EZOA 4QU6A 1YKWA 5C25B 1Z1ZA 3M6WA 1TL7B 2IM0A 1R8BA 2MJUA 1YHQS 3HD1A 4DV3J 4XO0A 2K7JA 4OYIA 5E0OA 1UVKA 2GA7A 4X66J 1N34J 1GXUA 3IR6B 3W66A 4Y2CA 3R2CJ 2HW3A 4KB7A 1CQMA 2K1RB 3PJXA 3G2XA 1R0CB 2QL7B 3T9ZA 1GQEA 1S1WB 4LF7F 2PFFB 2OI2A 2RS2A 3T41A 4GC6A 4F2SA 1GMUA 4USIA 1DJ0A 4Y34A 2UVVA 2YKMB 3D6HB 2DO4A 2XCPA 3J81U 2D3OR 4MAKA 2HNYA 4RNNA 4AQYJ 1SL1A 1VQ6S 3C3LA 1F2GA 2OD4A 1ULRA 4HDHA 3PO5A 2FJBB 3D0GE 1C1BA 4ZN1A 2VKZG 4KO0B 3CMQA 1XMOF 1N36J 5F8HA 3W2WA 3G6ES 3U1MA 3HF5A 4NXNF 4TKTA 4B9VA 2ROEA 1RT5A 2YKQA 1PGZA 3HSGA 4JI5F 2Z2LA 1B64A 1U0HB 3GV7B 4B3RJ 5D15A 1U1RA 7FD1A 3HDSA 4DMZA 4PQUA 2R2RA 4CCHA 1SJ1A 1VQMS 5HP1A 2QRRA 4LQ3A 2BA9A 3SQGA 3W2VA 1SL2A 5D4NA 4YY3F 4RBTA 3M6XA 5F0WA 1TR0A 1GH8A 3W8GA 2LYVA 4HHUA 4H4KC 4N7TA 2HRYA 2QSWA 4HHHA 1VQNS 4NA2A 3VR1A 5B0EA 2E5HA 5IM0B 5I3UB 3R8YA 1S57A 3LH2S 4ED5A 3JQMA 4DV5F 1UKUA 2E9TA 1HQEA 3SDEB 2P2CB 5AXMA 2CPEA 5GAEU 4LF4F 4Q43A 2AT1B 4HHJA 4DL6A 2HFZA 2V9KA 1NK9A 2MLYA 4YS2A 1D9DA 1WUUA 4NLYA 3ZZPA 1DY3A 4O0IA 3P45B 2PGCA 1X4BA 3KLGA 1RT4B 4G1QA 4DR5F 1S9EA 4OX7A 2F63A 2GVDA 3UR0A 2ZH2A 1EQMA 4Y0FA 1OY9A 3I82A 4K5SA 2WVDA 3FUYA 4OFZA 5K14A 3FBEA 3FVYA 2UV8A 2Z57B 4PKDB 2HBZB 5B7WA 3DYAA 1Q16B 2GFFA 1AFJA 2FVRA 4EFAC 4FBTA 1IWAA 2OPRB 2GJIA 4KGXB 1RWPB 4MTPA 2XMAA 1U6BA 1JJCB 3NGTA 2FZKB 4OI2A 1NK4A 1N33J 1NSKL 3KJQB 3P96A 5KFAA 1VC0A 1IKVA 1NPKA 2QTWA 5A2QU 2W9BB 1G1XA 2UXBF 4AT1B 2OO4A 4RJVA 2FLPA 4LSNB 2R7WA 2J7KA 4A8SA 4JI7F 1HI0P 2AJFE 3HP6A 1YK9A 5JUMA 4CNZA 2UV8G 3V4MA 4DV2F 4KGMA 3DGPB 4GVBB 2YX4A 2FGCA 3A8EA 1RWKB 5T14A 3VAIA 5D4LA 3MPYA 2ATCB 3NY0A 2V94A 1HW8A 4P6QA 2NXCA 1K9MT 1IR2A 4N76A 3ITHA 5KT4A 3R2DJ 1KLMA 5DJBA 4ANDA 4P7TA 2M7SA 5EWEA 3CCES 1VFJA 1MMDA 2CQGA 1RAHB 2ZJPQ 4ZVPB 4ZLNA 3UDEA 5ITHA 3CO9A 2HFVA 2WRMA 3QIDA 2A6OA 1BQNB 4EZ9A 2AYGA 2W25A 1F60B 2BEFA 1DTTB 4OV6A 3NCPA 1WOPA 3NCQA 2NZCA 4LF1A 2OIHA 4DV7J 3M8SA 1HPZB 3D7SB 2GW8A 4RW6A 1MU2B 2LDYA 5GMEA 1HD0A 3NGRA 3CB4A 3DLHA 3PW5A 1YZ6A 2BW2A 3UW1A 1CJKB 1NDKA 1HI8A 4PYAA 4KGKA 3DXSX 2DISA 1RTIB 4ZCMA 2RDDA 1JNRB 3BGRA 4K4VA 5LSLA 4DV0J 3PNIA 2EKYA 2LQ5A 1FCAA 4WFNQ 1U1MA 1L3SA 2ZOGA 4DL7A 4N56A 2KJWA 4DL5A 4FF1A 1ZS6A 3FDSA 3D68A 2RJZA 2ZHOA 5KFIA 3EVWA 3TYTA 2L9DA 1IR0A 3O1LA 2PT0A 4ZOSA 5J2QA 3HJFA 2YKPA 3M8QB 1QTMA 3BH6B 3ISZA 4WFYA 5D0RA 4ZVHA 2DR5A 2VOPA 3DLEB 4WCEQ 2R7SA 3P5TL 5A8WA 3OUYA 3PYFA 2BQUA 4X4UA 1UVJA 2W2OP 4I4BA 2MMYA 1LW0B 4YR2A 1A9NB 1M90T 4DI6A 4JI0F 1NB7A 1KVKA 2MZQA 3DRSB 4GC7A 3LOUA 2CZ9A 1EQ0A 1NDCA 2WOMA 3A13A 1T9VA 1S4EA 3QJJA 1U2FA 3LP0B 3P6YC 2XS5A 4Z7YA 2I6WA 5KFJA 2ASDA 3RRGA 4A8XA 2JZ5A 3M2VA 4K5RA 2DNGA 3HZGA 4DFMA 4C8KA 3PTWA 2ZHBA 1SJQA 3MD1A 2QMXA 2YNFB 1N5YA 3GU0A 4DSEA 4F0MA 3BSOA 2A10A 1URRA 3NLCA 1WD6A 2P6SA 2FVCA 4PPDA 3LP1B 2HHPA 4ZLLA 1FRHA 1QUPA 4ICLB 5IT9Y 1Q1KA 3RU0A 4LQ9A 2I9SA 5E41A 2BOPA 2M8DB 1WHWA 4F4KA 2MZJA 4DV6F 1T0TV 2EK6A 2NXUA 4BC7A 3V81A 3SSSA 3EE3A 2IM1A 2C2RA 1YJTA 5H9EK 2F5GA 3G82A 4DOZA 1DQ9A 4A8YA 3VQTA 4NLOA 3R6LB 3KLHB 5L39A 2PMZD 3CC4S 3EZ5A 1AZSA 2MB0B 5BR8F 3QMQA 1RE1B 3MAQA 1L3TA 1RTDB 3G6VA 4Q0BB 1HKAA 1XMQF 4QIWD 2OH2A 3IBCB 2ZD1A 2P9CA 4NLSA 3MM8A 1TU0B 3MMBA 3Q23A 1WSRA 3WIUA 3BPSP 1RLCL 3E51A 1MWZA 1T05A 3H5YA 3B8HA 4ZVFA 3PYGA 3HSJA 3PEJA 2FHMA 2C28A 4FYXB 2Z30B 4ED6A 2Q79A 1TKDA 1C4AA 2B9WA 5J1PA 4TY9A 3M6VA 3HVWA 1LW2B 1HHSA 2IBKA 4JV1A 2HHTA 4MYUA 4ED7A 3C8YA 5H9EJ 1SJ3P 3KDNA 3GSIA 3UN3A 2EFQA 5ETOA 2HNZA 1LWFA 3AB4B 4WXWA 4B3SF 3GCWP 1WC4A 4KHPJ 3FBFA 1P27B 3HKWA 5KT6A 4CO4A 2GIRA 2ZJQQ 3JTPA 4M94A 1C0UA 4J9NA 4ECYA 2FDNA 4ZCIA 2OFHX 4HI1A 1S1TA 2JFDA 2ZH4A 1UW9A 2V8HA 3TQ1A 3OTOJ 2DNYA 1RWUA 5HL7Q 2JH3A 4X4OA 1CC8A 1TVRB 4ETXA 4U67Q 3TI0A 4DV4F 4ZJQA 4ZHRA 1QVGR 3IMQJ 3AQOA 3I5BA 3Q0AA 3U1NA 2EVZA 2HAIA 3DM2A 1RBLA 2CUYA 3TJ8A 3MFHA 1RT2A 2W8LA 4P75A 2Z0GA 4RNFA 4IRCA 1VHIA 3BQ0A 1F5AA 3P5BP 4M95A 1FKOA 3MFIA 3M2UB 4R25A 4AL7A 1S1XA 2BJ8A 3OQ2A 3D0HE 3AOCA 1WG5A 1R0BG 4JV5F 1TMMA 4K4WA 1G6BA 3MF5A 2M4MA 2RDIA 4M5MA 1ZETA 3UNYA 3RRKA 3N6MA 3K5LA 2KTQA 4URQU 4CLYA 4I2QB 2DR7A 4OI1A 1G3OA 2XYGB 4DG1A 1Y5IB 2BRLA 4H4MA 2V8DA 5T7LA 4DPYA 3B82A 3O5TB 4K50A 4DHVA 4ZVSB 1BQXA 2E1CA 3K57A 3OFFA 3J7YI 2F4FA 2AHOB 1N0VC 3KTQA 1Q79A 3IFEA 2DY9A 4AXIA 3LANA 5HROB 1S0VA 1U1NA 4C8NA 2ZOMA 3KFWX 1FVQA 5LMNJ 4LF5J 3GQCA 3QGPA 1T02A 1APSA 5F8LA 2VKRA 4DCJB 1WHXA 2JWNA 1FFSB 3HHLD 4LT6A 3OV7A 2KN4A 3TNVA 4EBEA 4QIEA 1JLFB 4DN9A 3DHWC 1HYSB 5AE1A 1SKWA 2LU1A 2VA3A 2R8KA 1Y4ZB 1JLEB 1U4BA 1TKXB 1TL5A 4K7QA 2L9WA 1RZMA 1JLQA 3C16A 5M2PA 1KWMA 4CO1A 2AKWB 4FPRA 4BHQA 2RU3A 4USWA 2VH7A 1XNQJ 2VBWA 5CXTA 4NYOA 3MPVA 2G1DA 1SUQA 1YX2A 1NZ8A 1RTHA 3DI6A 4U7UK 4ANCA 1S1VB 2CAJA 1H2UX 1XK8A 3OVSA 2CPZA 1UCNA 3QSIA 5IWAJ 4WFAQ 2MZTA 1ZYQA 3KK2A 3GMGA 1B7FA 3OTEA 3CT9A 3D6MB 1JLBB 3I9ZA 5L1IA 2LEBA 3KUGA 2GCFA 3OFHA 2HVDA 3NEKA 5B08A 4X65F 1LXJA 4RR5A 1NJWA 3MM7A 1FRXA 1NK6A 5DDOC 1X0PA 1UWBA 2IRYA 3IAM9 2HGLA 2D74B 2MGZB 4J9OA 4B17A 1HNXF 2WK4A 4Y2AA 2V63A 2Y0BB 2UUAJ 1N32F 4KR0B 1AROP 4DLEA 3THVA 4A8KA 4I56A 3AD8C 2MLXA 5CD4H 2WBMA 1CS4B 3ILOA 1REGX 2QMWA 2CVEA 2M5YA 2FYXA 4LRDA 3LGHA 3SCIE 2DITA 3QPIA 2FJVA 1YRTA 4LJMA 2MSTA 1LNQA 2RIJA 2L08A 2IAJB 2ROGA 4MT1A 2UVUA 4JYAF 2YNGB 3M32A 2XNQA 3FBBA 2GHVC 2DB1A 2JVRA 1SC4B 3MMAA 1S7HA 1EIYB 2IRUA 1JKHA 4U8VA 5KOXA 2W4CA 2AF6A 1VISA 4PG5A 1L3UA 1R43A 3DN9A 3IO1A 3H40A 2Y0SD 3HCXA 3OR1A 3CCWA 1RTZA 1YJ7A 4QW8A 2XS7A 1CJUA 1HNWF 1Z2LA 5IV3A 5IT4A 2FIUA 3EJMA 4LBHA 4OX6A 2VPXB 3W8PA 3CNQP 2WVBA 1YITS 3QRRA 1XBWA 4IH5A 4DQRA 1N48A 1CULA 4PQAA 1OY8A 4DPOA 3DKDA 4GO5X 2C22A 3AXMA 2VFSA 3UN5A 4TU8A 4CLPA 4WFXA 3LF0A 4OMFG 3UO0A 2YX7A 5DG7A 1D0EA 5K9FA 2YH1A 4LF9F 2IDEA 2W2QP 4DUYF 1O8BA 2HQFA 3EVOA 4X4VA 1Z4UA 2EG2A 3T5KA 2WVEA 1MW7A 1RT1A 3BB5A 3QLHA 5E3PA 4DU7A 2HFOA 2R7TA 3RAQA 3ILLA 1M1KT 2C42A 3KLEB 1GTEA 1HI1A 3SCLE 1AYEA 3ELHA 1X4GA 1NSAA 1U8WA 2J8SA 2F65A 2ZOFA 3GB0A 1TL1A 3JS9A 3KHRA 1SH0A 3RB4A 1YJRA 3JTOA 2XMVA 1U1KA 4RW4A 1ZH5A 2E1RA 2QLJB 4MH8A 3RYLA 4LF7J 2CJXB 4JI3F 1IJFB 2K3KA 3MR6A 2VG5B 2E1AA 4TN2A 3LALA 3BDPA 1SJ4P 1VK8A 3HHDA 2QV6A 1MG7A 2FTRA 5HMZA 3EXCX 3BYPA 3Q24A 2ZBRA 5KT5A 4NX9A 2XWYA 3KLGB 2CZVC 3PEHA 1NHVA 4K8RA 2DNLA 1BGXT 2CPIA 3OXFA 1GX5A 2RAQA 2F7VA 1X0FA 1JIHA 2CWKA 1FFGB 5LXYA 1LXNA 1N5SA 3C19A 1XMOJ 4DUZF 2GO8A 3PYEA 3MUMP 2GX8A 2IM3A 4JI5J 3VTIA 8AT1B 1U7LA 5B0FA 3A1YG 4OLOA 2W9AA 2AP6A 1SVDA 3U1LA 2HGNA 1WKKA 3SV4A 1VS3A 4OYOA 3C15A 2EFNA 2JHEA 3JAMY 1TP7A 1HLWA 3MUVP 3VGSA 4R5PB 1IKVB 2D69A 1I51B 2RVJA 4M5KA 3SBMA 4C0HA 2ZC3A 2LQBA 1FO1A 1D9AA 3I55S 3RBZA 3K8VA 2ABYA 4ZP6A 3AY0A 2OHDA 2UVWA 3IR5B 1CVJA 3AAWB 2A18A 4KV8A 8RUCA 4OX9F 4DV5J 1RXOB 2CADA 2PA8D 1R8PA 1RHQB 1NM2A 2FHJD 2DNMA 2DNRA 2XB2D 5HANA 4Z2XA 2R9LA 4RBVA 3AHPA 3V4IB 3TVZA 4CYUA 2Q43A 4BS2A 1BD6A 3C66A 3HKZD 2VG7A 4FXVA 3OR2A 2CJKA 5HBMB 2ZEJA 4DL4A 2DGSA 1NH8A 4EMDA 5H1SV 1S6UA 1TKTB 1WORA 3DRRA 4ZPBA 3I56S 1A6LA 2XSJA 2HZVA 1VYAA 3HXMA 3PIOQ 1FTCA 2KL8A 1KSPA 4JI8F 1VJWA 5AE2A 1WKJA 2JLEA 1WOOA 4R0EA 2ATLA 2XNRA 2FD2A 1KDNA 4Y6IA 5A8RB 2AJQA 1S0MA 3MUTP 1NK8A 3LWLA 4ELTA 5GAGI 4LF2A 5E7OB 3BGRB 5DQHA 2DNZA 2ZC4A 3THTA 3H2UB 2ZH7A 5HLFA 3CO0P 2VG6B 3FMWA 2Y1RI 3QATA 3EZUA 3THPA 2DBBA 3BBCA 2PMWA 3DLLQ 2YQ3A 4B3OA 3TUJC 3M9OB 3I0RA 2H4YB 1QD1A 4CTAB 2GQQA 3TUPA 3KK3A 1U49A 4XPCA 3CD0A 3IWXA 2CQ1A 2QIFA 2V8PA 1FJEB 2Z58B 2F40A 5A8WB 3OUYB 4W4MA 2MKJA 1VRTB 4AXJA 4DUTA 4EU0A 2XCAA 3TZWA 1VHFA 3K5OA 1FD8A 4IH7A 4DS4A 2VDIA 2MKSA 2GAHC 2YVSA 1QE1B 2NSCA 3FQKA 3ZXWA 1NPRA 1HMVB 1U26A 3IR7B 1KEKA 2M70A 2M88A 3UDCA 5CYQB 4PPZA 1U02A 1PYTA 1SXLA 3A4TA 4CDIA 2DH7A 2OPSB 5B0BA 4DSFA 4KFBB 3BZQA 1HIYA 4EYHB 1FKAF 2WSCC 2Q66A 2QGFB 1Z2ZA 5KG0A 2K8GA 1S9GB 1N0UA 2D3UA 2BKPA 3WX4A 3OLAA 3D54A 3H0PA 2FQQB 1S6PB 1SH2A 3R97A 1R31A 6AT1B 5D77A 2KHDA 5C5JA 2XULA 1ELOA 4A4JA 4F4AA 3MM6B 2IM2A 5E3CA 1RQ0A 4OZ3A 3MCMA 1WDDA 3POTB 1UEKA 5CYJA 1V5IB 2HIQA 4LBPA 3UDLA 3QFWA 2AYBA 4O4GB 5DLGA 2NUUG 3VZHA 5J2PB 2CPYA 5EX0A 2ADBA 4ZN3A 2LXUA 2B7CB 4NYPA 4QR2A 1KRPA 2LMIA 3CCZA 3N4WA 4ENOA 3AOBA 4UQTA 4QR0A 2V2KA 2MKCA 2CJAA 1IN0A 4DR6F 4LR8A 2G0JA 1VR6A 4X4PA 4ERDA 1K73T 1GTHA 4KAIA 1BHNA 4F25A 5KFEA 1ZTTA 1TL7A 2PDAA 4ELVA 4CRJA 2JJ4D 3VAMA 3EGZA 1JLGB 2O5DA 2BJ1A 4HTIA 1K8AT 5D3GA 4MK7A 3TZYA 4NI2B 2WCXA 2K1RA 4C3LA 1YRXA 4DBQA 5H9FK 1VBZA 2RQMA 3HVAA 2DPJA 3O6QA 5LXRA 5B0CA 4CO0A 3DLJA 4RL1A 4YFUA 3HVTB 1WC5A 3W63A 3GFZA 3MM8B 2BJEA 2K3IA 3G8TA 3QWUA 3J80Y 2N3OA 2YKMA 4DSIA 2LECA 1QM9A 1ICEB 1B0TA 1AB8A 2QO3A 1YLXA 4CNYA 1ACMB 3TA2A 2DR9A 4ES1A 2OMLA 1U24A 4M5GA 3I4PA 1HQUB 1IXKA 2EPIA 5IFMA 1FNMA 3B6BA 5KFYA 1T7PA 1L3KA 5ETLA 1RA7A 1DLOB 2KB2A 4KO0A 4ATNA 3DOMB 4LRCA 3M1VB 4DEZA 5HN0A 1TL4A 2OAUA 3T1HJ 4PG4A 5H9FJ 4YUDA 4WXOA 1U0HA 5L9NA 3UD4P 4U95A 1WEYA 4F8RA 2DHHA 3BQ1A 1NHKL 1C0UB 1FDAA 2QG9B 4CLLA 4X4TA 2BJ7A 1O0PA 1AW0A 1OIAA 1U1LA 3H5XA 2V0NA 5EX3A 2C3UA 4LSLB 4RW7B 2MQLA 1HWUA 5KG3A 3KLFB 4ZHRB 3GE9A 2MYFA 2DRDA 1VIXA 4BWJA 3MR5A 5IM0A 5BR8J 5I3UA 3PY8A 1KR4A 2H5JB 1GXTA 3SDEA 2CQDA 2XY7A 3D28A 2GJFA 1K1QA 3KJVB 1RT6B 4M5DB 4LFAF 2EFGA 2EBEA 2GHPA 4IFVB 2DYAA 5KFQA 5FDLB 1FKOB 1F0XA 4UQGA 3PW2A 5A6PA 2EC0A 1T9UA 1I1GA 1S1XB 4QZVB 1C1CB 4O4RA 2ASJA 2ASYA 3NCRA 3KKFA 2E7VA 1RT4A 3FGVA 3R5BA 3H4DA 1XEZA 1IBCB 4LFBF 3PACA 1IKYA 1IBLF 4ILMA 1P9YA 3PRVA 4O3RA 2NQPA 2IJFA 3OL9A 2AEMA 3QAEA 3PV8A 4ES2A 2BE2B 4JI2J 1SCJB 4ZPDA 3KYLA 4ZPWR 5F8JA 1X9MA 3HT3A 4B3SJ 4KKOB 3ILJA 5DM6Q 2OPRA 3FNNA 1J27A 4CZCA 2NSBA 5DG9A 3GR1A 1S97A 4QQBA 4OZ0A 1U6ZA 4FF4A 2N4DA 2UUWA 2HBRB 2W9BA 3OTDA 4LSNA 2HFSA 3RZAA 2L3MA 1BY9A 4WKRA 3T6JA 4PCQA 1VRUB 1V3ZA 2XO7A 1HWJA 4WE1A 2JX2A 1C4CA 1DRZA 1S0OA 4W90B 4DV4J 4GVBA 2J5AA 3PCOB 4RUAA 2BV3A 2HHHF 2IVMA 4ZLPA 3H2VE 1Q7YT 4F4YA 4J9RA 3DHXA 3L95X 1NKEA 4DX7A 4C97A 1RT3B 3C16B 1OSCA 3QQCD 3QJLA 3AJ1A 4B3MF 3OTCA 4USUA 5B0DA 4YR3A 2R8JA 3E2EA 1H2VZ 2QYCA 3UQSA 5EHHA 1KLNA 1SUQB 1XC9A 2AWZA 4B9NA 2ZFHA 2JC0A 4JV5J 4NMXA 1BQNA 1G4CA 3TOQA 2ADCA 1RT7B 5EWFA 2AZ1A 3Q2SC 2KVIA 1IJEB 1SV5B 1M5HA 4J9LA 4I67A 2BABA 1V3SA 1DTTA 3KK2B 5FLXU 2H54B 4USVA 2YTCA 4I2PB 2PC6A 4DQPA 1YBTA 1OQ6A 1WKLA 1MU2A 2DHAA 5F9LA 4CO2A 5HMXA 2R8IA 2RRAA 3MM7B 4HKQA 3L3CA 3VAGA 2ERRA 1CJKA 2IJRA 3DLGB 3KHHA 1H38A 4TNOA 3PJ9A 2H1YA 1RTIA 5AJ3F 2ZJRQ 3WHIA 2WHOA 3OSNA 1RWXB 2C3MA 2XTJP 3KK1A 2YKOA 1PJ6A 3H8YA 2OSRA 3DC2A 3F44A 3KJFB 2F8EX 2BE9B 5M2RA 1D8ZA 4ZVOB 2MHEA 1KOOA 1M5VC 4HTJA 3R5CA 2VU5A 4CO5A 4X2BA 4E98A 3LTOA 1QJHA 3SI8A 4ZP8A 4BC9A 3JSMB 2VC0A 1L3VA 3M9NB 1RAAB 3M8QA 1M5PC 5BYQA 1Q4RA 1S99A 5LOQA 5I42B 1GX6A 3DLEA 2Z2MA 3GV8B 5GMDA 2BBEA 4KT0C 3NL0A 3MR2A 2B4UA 5KFPA 2QZ8A 3DRXA 1UWAA 1N88A 2JLFA 2RT3A 4A8QA 1LW0A 3UCGA 1MN9A 1KKHA 2IIHA 3DRSA 1CJUB 2HFNA 1JJ4A 4S0MA 1WTFA 2U2FA 4F7VA 3UD3P 2MQPA 4L3NA 4EGLA 3SIPB 4C48A 2VBZA 2DRAA 4KJIA 1R89A 3S8SA 2HIYA 4PWDB 3VCDA 1J5EF 4J9QA 2ZE2B 2HRTA 2YBVA 2B9EA 2B0GA 3FJ2A 4NCBA 2YNFA 2M0GB 2HK3A 1ZPWX 3BR9A 2HQ3A 2V8GA 3QLHB 1WWHA 4X4SA 4DR2F 4YB7A 3LP1A 1TV6B 4ICLA 3EDQB 3FCHA 2CQHA 4FYVB 4FYWB 1TUVA 4QPXA 2J0XA 2UUCF 1S1UB 2I1RA 2V68A 1Q95G 5HVGA 1S6QA 3AFGA 1LWCB 3HFZB 4IFYA 3NOGA 5HAOA 2XZWA 5ETVA 1Y9OA 4ANEA 5IS2A 1M5OC 1A7GE 4XDCA 4JV0A 1MWYA 5GAGU 4JYAJ 4DN0A 5DS7A 2UU9F 2FJAB 2R8GA 3KLHA 3R5DA 1X8DA 2UXDF 2XC9A 3GP9A 3GYXB 4ZP9A 2FZGB 2VUGA 1SQFA 1RTDA 1X7VA 4Q0BA 4DX6A 1R0AB 3EXYA 1UVMA 2J7UA 1HNWJ 4GRSA 1U25A 2XS2A 4NZ7A 4UZBA 1LKZA 1UVLA 1OSDA 1K0VA 3OXGA 1R8HA 1VQKS 4I1TA 2DNOA 1ZOTA 2YXLA 2ZWOA 1H2TZ 2XMUA 2UUBF 2Q6BA 2V8VA 1NSQA 2HHVA 3GIKA 1LW2A 2KM8B 3LQVA 4EEYA 1TK5A 1RAGB 2ROPA 4LF9J 2ZKUA 5A8KB 5ETSA 5DDQC 4L73A 1KTQA 4RZRA 2BW7A 3C15B 2MKKA 3JYTB 1NHUA 1KHWA 2VFUA 4RKUC 2F9JA 1FD2A 2DH8A 4IOAQ 4N41A 2P9GA 4JOUA 2GGPB 2N4CA 4IYQA 1FKPA 2VB6A 3UWTA 1OWXA 3AA8A 4OYZA 3T1YF 1REVB 2HWTA 4ITSA 2DCLA 2WVFA 2GHWA 1PBUA 3IS9B 2KFYA 3KG0A 2BDPA 1BXNA 3GIJA 5D78A 3B4DA 3MOZA 1NRKA 3TVYA 3UPFA 2QE5A 4JI3J 4V1Ak 3QWPA 3Q8UA 1S59A 1F9HA 2W7AA 3NWGA 2IBOA 4TU7A 2VPWB 4WTYA 2V5HG 1VCTA 4L76A 3MWBA 5KFTA 2D3ZA 3IBWA 1RKJA 2FLOA 3ISNC 3EPGA 4KPYA 2WSEC 3FC9A 3JSBA 5KFRA 2E5JA 2HWIA 2YWWA 3G71S 1FJGF 3J81j 3DRRB 2N7YA 1VQ4S 4DUZJ 1R27B 4EK2A 4WIQA 2LKZA 2UXCF 1VQ5S 3QSYB 1ZZNA 4JI1F 1SIWB 1S6OA 1WF0A 3IBFB 3HLUA 3CULA 1N4LA 1NJIT 3ZZTA 1OPZA 4TYAA 3H4BA 3P49B 2CA9A 3G86A 3ZZRA 3RUBL 3W61A 3HPOA 4CLSA 2C2ZB 2EBGA 1IM6A 1WOSA 2HZCA 5HLFB 2GNKA 2L41A 1PG5B 4HEA9 2VDHA 4GKJJ 1YRUA 4RUHA 5CYMB 2DY1A 3AXKA 5HROA 3TVKA 4KGVB 2EK1A 2PMHA 3K89A 3LO3A 4B3OB 2E44A 3R1HA 3ET6B 2CPDA 2IMOA 4WJBA 1U8SA 5ETPA 3KK3B 4F2RA 3BO2A 1JLFA 4NASA 2GQCA 1U48A 2MSSA 3TARA 1S10A 1JLEA 4C11B 4ETZA 1Q78A 5LL6d 3BKFA 4ZVEA 1EHWA 5EN1A 4TY8B 2U1AA 2Y8YA 5CABA 2B4VA 4MKYA 3W5YA 3A8KA 1N5QA 3WX8A 4G3IA 4V19J 2R42A 2CJQA 2Z8QA 1EETA 2G0IA 3OFEA 4KIAA 3OJUA 4YP3A 3ENWA 1S1VA 2HPUA 3O2IA 1J5OB 3G8SA 1YWXA 1RGVA 1K1SA 1KFDA 2RF2B 2E1MC 3V6HA 3CJ5A 2V9WA 4A48A 3UD5A 1OJ4A 4F26A 1VBXA 3VF0B 5DDRC 2XY6A 1JLBA 2BZ2A 2GAGC 9RUBA 3CVKA 2HGMA 1NB2A 3M8PB 5HQ8A 1WJ9A 5I3QA 4WZMA 1FDDA 1WG1A 1YJUA 3CJSA 5F3ZA 4QW9A 1OYDA 4G1PA 4RLEA 2O66A 2AGQA 3MEEB 2MGZA 2W2NP 1Q53A 4I69A 4F4WA 4XTTA 1NXIA 2YQ0A 5ETNA 5FLXY 4WIIA 1JXVA 4B3RF 2KHCA 1GAOA 1JLCA 2R7OA 2MKYA 4E2FB 2C2MB 2H5EA 1RUSA 5KFVA 2G1HA 2WAQD 4C98A 1AFIA 1FK9B 1U1QA 4BCAA 2CQIA 2OJ3A 3MHYA 1CS4A 3BBFA 5D3GB 4OI0A 1FVSA 2O67A 4DWIA 1Y0HA 1SI9A 4NA1A 2CQCA 4IO9Q 3IWNC 4NLGA 3W3SA 2JFKA 4USHA 2IAJA 4DS5A 4XAKA 2B56A 1R6YA 2YNGA 2B43A 2F3JA 1JXEA 2DGWA 2JVOA 1QAIA 3M9MB 2NPFA 1NKBA 2MLZA 2ZNYA 1SH3A 3N0VA 5DGBA 4B9TA 2V34A 2VQFF 1NCLA 5CQGA 2VPZB 3DDIA 1DQ8A 4ECQA 5KG6A 1KC8T 4EO6A 3SCJE 2HVZA 2R2UA 5LT5A 1XTZA 3ZO7A 3KLVA 2J6TA 4WYWA 3VV2B 3IGNA 3TANA 3S1TA 5FD1A 1N8RT 1H7WA 1WC0A 2HBQB 3FSIA 1FXDA 1CLFA 3F73A 2W7PA 4OHWA 2WB4A 3OFGA 4YQWA 4KSEB 4P10A 5J2NB 3QT7A 2HNDB 3RBEA 3OHBA 1T94A 3Q2TC 2XBPA 2VJVA 3L7PA 2WB1D 5DDPC 3KLEA 1RWVB 5ETTA 4QWBA 4J9SA 3D66A 4LIWA 2C2EA 3PRDA 5IC6B 3IC1A 1F6TA 3D1OA 3MMJA 1I5OB 1CBKA 2RQKA 4YOEA 5J1EB 4I0WA 2B6AB 3R27A 1WTBA 2RUGA 1UP1A 3FEXB 1O5JA 6FDRA 4A8OA 4QCLA 4LRAA 4NZ6A 5KFOA 1XMBA 1HR0F 4K4UA 1H0HB 5KFUA 5J2MA 3RR8A 4ZVTB 4IRKA 2VG5A 4IDKB 4Y28C 1BQMA 1UW4A 5GADI 1T11A 2Y3YA 5CCLA 3C6UB 4ILRA 1U1PA 1Y3KA 3L09A 2E5GA 3RJMB 3CC2S 2QLXA 2DGTA 1RWOB 2DGVA 1X4AA 2QL9B 4FXWA 5F0UA 3KG4A 1NJXA 3N9UC 3Q8QB 4ZIVA 1RK8A 1N6QA 1IKYB 3W65A 2ZBQA 4ZVGA 1TAUA 4H4OB 4USKA 2A1BA 1RCOB 2Z4PA 1TK8A 3MPWA 3KUHA 2IY5B 2AX0A 5ETKA 3NWRA 4G1IA 4QYRA 3PKMA 5KFXA 4U7CA 4CWBA 1S77D 1Y10A 3TW0A 4RNHA 1FTRA 3VZIA 1UFWA 4IG3B 4R5PA 1X4DA 1EZZB 3CCVS 2AD9A 3PIPQ 3OVBA 1DURA 2BACA 4HI2A 3FRYA 4KH0B 3RGIA 4R8UA 3AD7C 4WE1B 2C2DA 1LK5A 7FDRA 1SJFA 4HACB 1PC4A 4OV1A 2KI2A 1SC3B 2FY8A 2HS0A 2IYGA 1BUXA 3MMCB 1HWIA 2HMIB 2V2VA 2RMLA 2M8HA 3Q86A 1MSWD 3MEDB 3G8QA 4C7QA 4RX6A 2HHXA 4LFAJ 4CT8A 2IJNA 1XR6A 2HK2A 1WHVA 4N8NA 1PYSB 3FSXA 3R6GB 2NYIA 2EWHA 2QA4S 3EGVA 3V4IA 2WVCA 3BKTA 4HYKA 5F8NA 2XI3A 4H54A 5DZ7A 3MEGB 3LGNA 3QT6A 3NNHA 3CCRS 2D41A 3FBCA 5HBMA 2F4VJ 1IBLJ 3HK2A 3UN2A 3HSDA 3I9V9 4Q8EA 3TP2A 4ID5B 1RWMB 1TKTA 4HR2A 3FEYB 1U0SA 3FCWA 3PM9A 2R7QA 5EUHA 1P1TA 4FZVA 1FDBA 1WNEA 1RABB 3RAXA 2BRKA 2Y1LB 2Z56B 1K44A 4M5LA 4UW2A 1C0TB 5A8RA 2ZDPA 2DHGA 1FJ7A 3HHLA 1YI2S 1L5UA 2CQ0A 3W9HA 2OKQA 3G96A 3O3LA 3ZNJ1 3KK1B 2QJ3A 3BSCA 3DCAA 1R3NA 2QFJA 3KJNB 3CC7S 3A3NB 2VG6A 1IKXB 2ZM6J 4CQ1A 5GAEI 4RWWA 1VQLS 2H4WB 1V3RA 1X4EA 1GFWB 1RCXB 2KG1A 1R7IA 3WC0A 4FVCA 4QPTA 2MY8A 4DXLA 1YQHA 2ZH6A 4CI0B 1YJ9S 1RI7A 3H7HB 4NRUA 3PYDA 1B70B 5CCMA 4YN3B 4CTAA 5HQMA 5KFDA 3ZTSA 4X62F 2ASLA 4B3MJ 3TR5A 2AU0A 5IT0A 2DPIA 4OYPA 4JV2A 3MCSA 1LWXA 2B8PA 1RISA 2B7BB 1VC5A 3SV3A 5GAHI 1FEEA 1FRLA 1VRTA 4I6AA 2GZOA 1VDHA 2M9KA 3AOAA 3IG1B 3UDVA 5HQLA 3WBZA 1VGYA 4O3NA 3EVMA 1QE1A 3W64A 5CD4A 1HMVA 3E01B 4IOBA 5CYQA 1RBAA 2D3O1 1JQGA 2IPOB 2OPSA 4RU2A 4M5HA 4F3OA 4KFBA 2HSEB 3TO8A 2R4FA 2BYCA 2RSQA 4Y2MA 1S9GA 4ECTA 2AGPA 1Q8KA 2LXFA 2PFDA 1S6PA 4DSLA 3BF4A 2LU2A 2LQ9A 4EZ6A 2UVRA 3K5PA 2LA4A 3MM6A 3GPAA 3POTA 3SXLA 5JVHQ 2XQCA 3ZZUA 2VQEF 1SQGA 2RQCA 4O4GA 3PRBA 3QZ7A 1XNRF 5J2PA 2MPUA 3NMAA 1N5TA 2ZBCA 3V6DB 1FRJA 2FY1A 2FVPA 1Q5YA 1Q82T 2FGOA 3QRPA 2W9CB 1QLNA 2XSFA 4HH1A 1VQ9S 4M1KA 3D5MA 2KXFA 1NAQA 5F9NA 4TLRA 1HNVB 2QFIA 4KHPF 1IVZA 5HO4A 1S6QB 3UVJB 3K59A 1ZM2A 4FPIA 2MKIA 3GCXP 4IFYB 2ACMA 3WIVA 4DPTA 2V50A 4LVNP 1JLGA 1Q8BA 2HVEA 2G4BA 4NI2A 3MM9B 3CJ8A 2IYIA 5B0AA 4I6YA 4KC5A 2QA1A 4F04B 1LOUA 3Q8YA 2FVQA 2XMWA 5JVGQ 3N6LA 3J7A1 4FF3A 3HVTA 3FEZA 1T9YA 2CNKB 2V4JB 2A2DA 2YKNA 1JK9B 1RU2A 3JAMU 4YDDB 5IC4B 1FDNA 4PEOA 3CUNA 1TKZB 2VA2A 1ZM3A 1EKRA 3VVTA 2DVIA 1HQUA 1RU1A 3NGSA 5L1LA 1H74A 2XZTB 3UFCX 1HNZJ 3J7AN 1DLOA 1F2HA 2CJYB 1H3DA 2QL5B 4D3GA 1TL3B 1T9XA 4OZJA 1RP5A 3DOMA 3BSNA 4Q5VA 3HHLC 3M1VA 4RWXA 4MFBA 3QZ8A 4DR2J 4DX5A 1I6JA 2O1PA 1H73A 4ZIWA 1X5TA 2AJ1A 1VQ8S 4FP9A 6FD1A 2VJUA 4WPAA 5M2UA 1FKPB 5J1NA 4ZITA 3QO9A 2UUCJ 3U27A 4C3MA 2HHWA 1VBKA 2FLLA 2K2PA 3HVRA 5A0YB 1GT8A 4Q7AA 3PZPA 3GJRB 2J9EA 2R7XA 2ZH9A 5EWGA 1Q8IA 5LSRA 3HJVA 1P1LA 3DGVA 3TQEA 3I4HX 1T3NA 4LSLA 3KHLA 1R6VA 3L7UA 4RW7A 3VAFA 4F02A 1E6VB 4LF5F 3KLFA 2AYMA 2XYHB 4UF4A 4YB1P 2UXDJ 2ZBPA 2K06A 1ZBTA 5U47A 4EBCA 1ZM9A 2JEFA 3I96A 1X60A 4C8LA 5LMUJ 3PW4A 3CCUS 4DPUA 3L9ZA 4WU3A 2QC3A 3KJVA 1RT6A 4M5DA 1YJWS 4IFVA 3L4BC 2MJNA 5FDLA 3DRPB 3G6XA 1F5BA 4IO1A 3CJRA 4ZA1A 4LIRA 3AJ2A 1C1CA 3T6BA 2COLA 4HT7A 2V67A 3VHQA 4FVMA 5K8PA 3Q83A 3IAS9 3VGUA 1WC3A 2UUBJ 3IN5A 4ECUA 3D3BJ 5D0EA 4RO0A 2XLJA 2KH9A 4UOCA 2RKIB 1XERA 1EKSA 4LREA 2XG8A 3BO3A 1WF2A 1SQEA 4WF9Q 2LA6A 5LJ5Y 4XPEA 1PBAA 4QWCA 2DD8S 3KXDA 4C6AA 2BE2A 5AT1B 3CF5Q 4KKOA 4B02A 1X4CA 1HARA 2ZVSA 4Y00A 3HFVA 3IP0A 2YX1A 5C24B 1RDRA 3T1YJ 4J9UE 2KO1A 3CDUA 1W2BR 2D9PA 1S0NA 1HWLA 4ZKAA 4JI6J 3LP2B 3TA0A 1S49A 3H98A 2YPZA 2OLWA 1VRUA 2WW8A 4X84A 2WW4A 2AIRB 2MQMA 5KT2A 2YPYA 3AJDA 2YWFA 2EG1A 2YQ1A 2BJ9A 1VIOA 1BE4A 4MKBA 1SJRA 1NMEB 3KOAA 3GIRA 5CH7B 5HATA 1RT3A 1UEVA 3M2RB 3MEKA 2B3TB 3KMQA 2YNHB 3W5XA 4FS1A 4JB8B 2GMLA 1EJ7L 4AUKA 5ETQA 1T3OA 4OHXA 4ZPTR 2C3YA 2V6AA 1WC1A 4CH1A 4UY8T 1EETB 2FB0A 1FJGJ 4P2SA 4GMKA 2JEGA 2YWGA 2H65B 3M05A 4L72B 1RT7A 2MTLA 2QLWA 4P52A 4UUXA 4YHHF 4JI1J 4RW9B 1VQSA 1SV5A 2HFUA 2B8QA 1RBOB 4CLTA 2R2TA 1VMBA 3CMES 4DV1F 1UTAA 2F8MA 4I2PA 1VJQA 4JI4J 5GADU 1TZ0A 4LUBA 2IA6A 5KG7A 2E29A 4CM2A 3I0SB 2X7IA 1BC6A 3G87A 3DLGA 1UPPA 3ISND 2GVZB 3AQPA 2CZ4A 4JP8A 4NEYA 1YJVA 5F8IA 4KYZA 2ZH8A 2E5LF 1FWPA 4CH7A 4LVOP 1JLCB 2AX1A 2DNHA 4CLKA 4A8FA 2CPJA 2MQOA 2X3DA 3J80U 1Y5NB 1QSYA 4Z7CA 3EPIA 2LEPA 4I7FB 1M1GA 2NPIA 2BKNA 3JSMA 4I6WA 4J90A 5I42A 2DIVA 1UPMB 4KQZA 2LQJA 1AA1B 3H5SA 3D0IE 5B0GA 2ZHAA 4DR1J 2EFPA 1B3TA 3ENQA 2YWKA 5KFBA 1FESA 1HBMB 4A8WA 3I87A 4RW8A 2ZZMA 1RTJA 1OS5A 2XMMA 1IBMJ 4M5NA 4DDFA 3AODA 2W4DA 1XR5A 3MTKA 1ZAWA 3CD7A 1UVIA 3MM5B 2KFNA 2D1CA 3CCQS 2FVSA 4HT5A 1VQOS 3ZTRA 2DKOB 1R8CA 1NUEA 4PWDA 1NK7A 4ECWA 4AL6A 3NP5A 2I38A 1F3VA 2ZE2A 4GVLA 4ZDNA 2G13A 4J7CA 1OO0B 1S12A 2VPYB 2DXDA 1RJJA 4MKVA 4RNMA 5F3TA 1PC5A 4OJGA 3F41A 4RUBA 1QDUB 3RBXA 2HZAA 3IM8A 3KNGA 3TAMB 3LAKA 1F9FA 1SC1B 1TV6A 4P72A 2AGOA 4WTOB 3F56A 3MECB 4IQXA 4ZPVR 4OYMA 2KU7A 3RR7A 2QT7A 5LM7E 2A3JA 1S1UA 4Q8FA 1NLKL 1ITPA 2CQ4A 2BR0A 2AJ4A 4ZS6A 4NWBA 3NG8A 2DEJA 3K0JA 2X3GA 4N47A 1LWCA 3HHKA 1RACB 3CGIA 4RU9A 4FNHA 2MEWA 3FMBA 5T41A 1HBNB 3SSQA 3NNCA 2CFXA 3ZZZA 5J2MB 3BYRA 2YNIA 1YJNS 1K47A 5C42A 3NBPB 2BM1A 3CCLS 1BQMB 2OP5A 1HQ2A 2OPQA 3RW6A 1ZA1B 2VQFJ 3N5BA 1EP4B 3K8WA 1R0AA 4KBIA 3CMAS 2BE7D 2BQRA 3MURP 3ZZYA 2W01A 1KQFB 3KUEA 1N6QB 1D09B 4B9SA 2V69A 3CJ4A 3NS6A 1T9TA 3GSDA 1GMWA 1WSVA 2JEIA 2QSFA 4OL8A 3MTJA 1IBKF 4AE5A 5GAHU 4NXNJ 3NMRA 3TAQA 5A8KA 1HNIB 4CLFA 1S79A 3M7VA 1MROA 3BN4A 2R2SA 3JYTA 2HVIA 2O3DA 4YY3J 3D6TB 4O44A 1UFKA 4K0KF 2D7SA 2F9DA 2GGPA 2LVWA 4AL5A 4IG0B 4N77A 1NBEB 3MOJB 1EB0A 4U96A 3G9CA 3IA0A 4ECSA 3PHTA 4R8UB 2NXJA 2LFVA 4PUOA 1REVA 2Y1JA 1IKWB 4ES3A 3J7ZT 4DF8A 3EX7B 2ZH3A 1DAXA 1O51A 3IS9A 1N5VA 2P6TA 3TX0A 3IGVA 1OPIA 3GYGA 2RD5C 3KLIB 1HR0J 2V4QA 3NRBA 2MY7A 4NRTA 4LF4J 3DRYA 4NL5A 4TLQA 2N3LA 3IXQA 1RAEB 4TVAB 2QLBB 3GLJA 4ED8A 3OXLA 4LBIA 2DTJA 1U45A 4ILLA 2R7UA 3N79A 1NJZA 2YKAA 2H48B 4DR7F 1I94F 4DR5J 4RBUA 2MHNA 2JDJA 2C1EB 2HQDA 3GTYX 1HL6A 2C2NA 4UOGA 4ZLJA 3VGTA 3CPWR 1VQYA 4URGA 4YEAA 2CDQA 2KJVA 5FJ4A 1IM4A 2PI5A 3EICA 4U7UD 2G2ZA 2J0QD 2FJXA 2Y1IA 1FNXH 3NAIA 4P7VA 5KAKA 3MAAB 1CJVB 3HHLB 2AYEA 4B9MA 3ZTQA 3V6JA 5KFWA 2FZCB 2Y8WA 3DLBA 2BX6A 2UXBJ 1NU4A 4CO3A 4JI7J 3P3DA 1HHQA 5CYMA 2RB7A 4DZ6A 3S01A 4DV2J 2CPXA 3Q22A 2W1BA 3QAUA 4Y3CA 5SZTA 2W2PP 3PFEA 1DQAA 3ET6A 3T19A 2FPHX 2AW0A 1DHMA 4ZP7A 1MMLA 3CWJA 5D4OA 4K4ZA 2OEJA 1KFSA 4KH1B 1WACA 3CE8A 2YWEA 2LLZA 4CM0A 1UZHA 2ZBIA 5I3PA 5AXKA 3GWCA 3CJQA 4UT4A 4C11A 2DNNA 1TAQA 2DO0A 1JWWA 2ZZTA 5E3AA 2BOAA 4TY8A 1Q5VA 3QIPB 3LAMA 4K4YA 3N01A 3IRXA 2DJWA 4C8ZA 2FC9A 2DIUA 3GV5B 5ADZA 2XMJA 1WF1A 3LUYA 5DQIA 4F0HA 3H2LA 1FF2A 3W9IA 2E1PA 3BJYA 1J5OA 2VASA 4U9RA 1UMJA 1RHKB 2KM8C 2RF2A 5GVQA 3ETMA 3NKYA 1WHYA 4KGZB 1TMJA 2RRNA 5F41A 4DFPA 3M8PA 1K0TA 4O23A 4QIGA 4DR4F 2ZVIA 4M63A 2C2KB 3HZEA 4QBUA 1XQIA 3MEEA 3T1HF 2VIHA 2XO6A 3P8BB 4ID8A 2XLKA 2QMUB 3T5HA 1KHVA 4UY85 2CJ9A 2GIQA 1ROFA 4AYBD 3MCNA 4NLTA 4NLRA 4X62J 3M30A 2HS3A 1FK9A 1JXLA 3K17A 4WP3A 2WONB 1YGYA 3CJKB 2NREA 3J7YU 1DBDA 3ZTOA 4MMOA 1Y7PA 3ZNUA 3MDFA 3EGNA 3HHEA 3FQLA 4ER8A 1X31C 1KQGB 4JI0J 4C0BA 4URSA 4ECZA 2VBYA 3DFEA 4IOCQ 2PE8A 2RHSB 3DXBA 2YKNB 2CRLA 1PKUA 2IC3A 2KG0A 2DXFA 4PR6A 2VFRA 4LMZA 1ZAXA 2MKHA 1G7CB 1FXLA 2M3DA 4BBYA 3H42A 1WEXA 4NLUA 4LF6F 2E7WA 1W7WA 1RADB 2CQPA 2BKOA 1YG0A 1WI6A 2VQEJ 1YTYA 2H51B 3T1AA 1D8YA 4OIXA 3C14B 4OZ5A 1XNRJ 4MFBB 3R7SB 1R8AA 1HHTP 2DEIA 4CIOA 1UA0A 3CW2C 3RBDA 4Z37A 4JI2F 4KY3A 1Y11A 5J2NA 3QO9B 2HNDA 3J81Y 1FRIA 5E2QA 4FYYB 2KKHA 4DV6J 1T95A 2J7WA 1G2EA 4EO8A 2VHGA 3R5AA 4WU2A 3QBCA 1S9FA 1U47A 1QSLA 3ZZ0A 3S6EA 4NCGB 4ECVA 4U6PA 4O3OA 2N7CA 4WFZA 1FERA 2MDAA 2VZ9A 2BANB 2G0CA 1P8GA 5J1EA 2B6AA 2PIIA 3MPDA 3DMJB 3HSZA 3TX8A 3PFOA 3TZXA 2OELA 1DTQB 1F5CA 4QWEA 1QAJA 4ZPCA 1XMQJ 3R1LA 2KZZA 4FN5A 3BEGB 4IDKA 3CIZA 3DOLB 4MIWA 3I5AA 3D1QA 1NKCA 3C6UA 3BBBA 2KRBA
chains in the Genus database with same CATH topology
1FWPA 1FFGB 1FFWB 1FFSB 1A0OB 1EAYC 2LP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWP A;  1FFG B;  1FFW B;  1FFS B;  1A0O B;  1EAY C;  2LP4 A; 
#chains in the Genus database with same CATH topology
 3K5N A;  1IWG A;  3KMS A;  2UP1 A;  3D1H A;  2AEJ A;  3MPU B;  4DFK A;  3Q8S B;  3B4M A;  3OL7 A;  3GJQ B;  4B9U A;  3AD9 C;  3GJT B;  2G2Y A;  1PSD A;  3I6P A;  4RUC A;  2VBX A;  4RNO A;  4H4O A;  1HBU B;  3PX0 A;  2OGU A;  3K58 A;  3W9J A;  1QTN B;  3HD2 A;  1B0V A;  4KRW A;  1JLA B;  1BWV A;  2X1F A;  2VFT A;  1RAJ A;  3KNA A;  1EAR A;  5G4D A;  5HSP A;  5HI7 A;  3HT0 A;  1YBA A;  3EGW B;  1WDT A;  2ZIT A;  4N8O A;  4J9V A;  1ZA2 B;  4PG6 A;  3PW0 A;  1FE4 A;  4OLP A;  3NOC A;  4IG3 A;  2MQN A;  4KHR A;  2PN6 A;  3CIM A;  4PYD A;  1DZ5 A;  2VF3 A;  1RHR B;  3DDK A;  5SUH A;  4PAB A;  3DOK B;  3RG6 A;  4QU7 A;  4IQM A;  4HAC A;  3C6T A;  4C2M A;  3B54 A;  4ED0 A;  4B3T F;  5G0R B;  2IMW P;  3M4X A;  1HBO B;  1PIL A;  3MMC A;  4A46 A;  4LF8 F;  1UVN A;  2HMI A;  2AJ2 A;  4NLD A;  3OTB A;  2MZ1 A;  3MED A;  3BM7 A;  1E6Y A;  1UAW A;  3HI9 A;  4Q45 A;  8ATC B;  1TQL A;  4FS2 A;  2JRS A;  4P2X A;  4DQQ A;  2KDO A;  4IR1 A;  2EEY A;  2E7X A;  3RW7 A;  3BR8 A;  2RDJ A;  1LFP A;  5A2Q Y;  1LFW A;  2QX0 A;  3IRW P;  4C8M A;  4O3P A;  4XIU A;  2Z2Y B;  1B0P A;  3NGD A;  3MEG A;  2B5J A;  3T5J A;  4DLG A;  4PAA A;  4E0D A;  3QFH A;  2EW9 A;  3S7R A;  4OHZ A;  2I5J A;  2NLW A;  4MJK A;  4GKK F;  4ID5 A;  4X4N A;  2KYX A;  3J7Z 5;  3G4S S;  4I64 A;  3TAP A;  1XWL A;  4OJ3 A;  1MNE A;  4MK9 A;  5HVF A;  4IKA A;  3JQK A;  4NE9 C;  3CXC R;  2NR0 A;  1BMQ B;  3ZTP A;  4LSZ B;  2GQ2 A;  3GR0 A;  2Z2Z A;  5KFM A;  1Y5L B;  4A8M P;  2HQC A;  1C0T A;  1FA0 A;  4G6V B;  5HJX A;  4RPF A;  1LWE B;  3C2P A;  3PHE A;  4X64 F;  3FKB A;  3FFI B;  1VBY A;  1BLU A;  3X3U A;  4K2J A;  4ZCK A;  1IKX A;  5E3R A;  3LA0 A;  1KNZ A;  1U6F A;  4WK1 A;  1VLY A;  3DLK B;  2NS1 B;  1NND A;  5BYR A;  5FII A;  4K59 A;  2I0X A;  3OSP A;  3TJA A;  1KVJ A;  4NLV A;  1PIE A;  3GJS B;  2OPP A;  4CP5 A;  3E8O A;  1S48 A;  1VOM A;  4PG8 A;  4DR3 F;  5KFF A;  4OYB A;  2FJW A;  3W62 A;  2QA2 A;  1NK0 A;  2PA3 A;  4RW8 B;  2EXU A;  1RTJ B;  2JEJ A;  2B4P A;  4NPO A;  3IG1 A;  3RB3 A;  2J0W A;  7AT1 B;  2XHC A;  3SFU A;  3QRQ A;  1I3O B;  4YHH J;  4DSK A;  2OSQ A;  1ZTW A;  3CJ3 A;  3E01 A;  4X4R A;  2CWX A;  3CD6 S;  2JOQ A;  1FE0 A;  1UZD A;  4P73 A;  3UNG C;  4J91 A;  4DV1 J;  1YIJ S;  1FRM A;  2HNY B;  3ENV A;  2H9Z A;  2HRU A;  3W7B A;  3R5G A;  4K2X A;  4TXS A;  2A6M A;  1PO6 A;  4X65 J;  3Q8V A;  1C1B B;  3EDR B;  3NGU A;  2POK A;  1DFD A;  1VI7 A;  4MIB A;  5C7P A;  2NXN A;  4V19 X;  4OHV A;  1NK5 A;  4C4W A;  2GIF A;  3W2W B;  4P71 A;  1HNX J;  1RT5 B;  5AXN A;  1F9E B;  2E5L J;  4UZC A;  3V6D A;  2CPF A;  1Q8L A;  4C8Y A;  4PQU B;  1N32 J;  3CDA A;  3G6Y A;  5HP1 B;  1QVF R;  2W9C A;  3UI3 A;  3SQG B;  3W2V B;  4F50 A;  1KVI A;  3VGV A;  2AV5 A;  2JL9 A;  1U2R A;  1X4H A;  3TWZ A;  1HNV A;  3OL6 A;  2HBY B;  4DL3 A;  5KG4 A;  3UVJ A;  2BM0 A;  2JSX A;  1WI8 A;  1OQ3 A;  3D2W A;  3EM1 A;  1XR7 A;  3MD3 A;  3OJS A;  2IHR 1;  3HFK A;  2OFG X;  3V5R A;  3VAL A;  4MK8 A;  2YNI B;  4Y2K A;  4K4X A;  1T03 A;  5C42 B;  3A12 A;  2BUN A;  2FC8 A;  2XHW A;  3GON A;  4ZVR B;  1RSC A;  3MM9 A;  4R0J A;  1HQE B;  1FWL A;  4KE5 A;  2OPQ B;  1M5S A;  1HD1 A;  3SSR A;  3KWM A;  1CEZ A;  3CJT A;  2E9R X;  3LWM A;  3EMT A;  3OVA A;  1H7X A;  1UA1 A;  3IM9 A;  2XEX A;  2OTL S;  4Q2M A;  2V4J A;  1CJT A;  1UFL A;  4JBC A;  3CDB A;  2B51 A;  2ILY A;  1P6T A;  2HLU A;  2RHQ B;  3MR7 A;  5KFS A;  4G1Q B;  1S9E B;  1GK8 A;  1VK3 A;  1C2P A;  1TKZ A;  2FLN A;  4DJB A;  4LFC F;  2GVD B;  1N56 A;  4QOT A;  4UUW A;  4C0O C;  3VAH A;  3O8W A;  5K14 B;  3TZZ A;  2EC2 A;  4DUY J;  3GFH A;  4NLQ A;  3DYA B;  1TL3 A;  2AZ3 A;  4DSJ A;  5F8G A;  1MRO B;  4GO7 X;  4L6V 3;  2HQI A;  4O44 B;  1P9Q C;  3TUZ C;  1ZPV A;  4NXM F;  2FJD B;  2YH0 A;  5D0H A;  1IQT A;  1ZAV A;  4OI6 A;  2IVY A;  2NYH A;  2AQ4 A;  1FI4 A;  1FWK A;  3M8W A;  4PUO B;  1QSS A;  1V9O A;  4OZ1 A;  5A0Y A;  2PEB A;  2W4P A;  4GKJ F;  4OZL A;  3FZ2 A;  1D1U A;  5KFG A;  1Y3J A;  2EKN A;  1E6V A;  3RB6 A;  4FF2 A;  4QYZ K;  1SIZ A;  1YSJ A;  1QAY A;  4YDX A;  2MZR A;  4ZJO A;  2ZH1 A;  4ZVU B;  2ALY B;  5BJR A;  3PX4 A;  1M5K C;  5L38 A;  4Y2I A;  2BMB A;  3AH6 A;  1FX4 A;  5BYS A;  3ITH B;  2E66 A;  5E33 A;  1KLM B;  1PJ7 A;  5KG5 A;  2PI4 A;  2OEM A;  1KQS R;  3DRP A;  2KYZ A;  2HG4 A;  1NZA A;  2LP4 A;  3QJP A;  5L1K A;  3Q8P B;  2DNK A;  5JXS A;  5L46 A;  3R7N B;  4KTQ A;  5KFH A;  1IBK J;  3UR3 C;  5DET A;  5EDW A;  1YDL A;  3ZZO A;  2RKI A;  3PG9 A;  1VRQ C;  3VAK A;  1GXL A;  5DGA A;  1CSJ A;  3TJ9 A;  2HYI B;  4RW6 B;  4PXD A;  4BDP A;  4QYZ J;  1RHM B;  1TUG B;  5IQQ A;  2J9D A;  4J9M A;  1Q0N A;  4YB5 A;  3CDW A;  4DPX A;  4K0K J;  2HHU A;  3AB2 B;  1XIQ A;  4CLW A;  3WZ0 A;  4PWU A;  1RAO A;  2HQG A;  3W5Z A;  3OPK A;  4P2F A;  5C24 A;  2V2Q A;  3B78 A;  4FXD A;  5CAA A;  2KVQ E;  3V6K A;  2WSF C;  2WBR A;  4OX9 J;  3LP2 A;  1CC7 A;  3HM9 A;  4AFF A;  1T8E A;  5J2Q B;  5IXU A;  1DAR A;  2BJD A;  4ZJL A;  3PKY A;  4AD6 A;  5E5N A;  4DV3 F;  3UCZ P;  1S4F A;  1SPB P;  4X66 F;  3FRZ A;  1N34 F;  3BH7 B;  3M2R A;  2GMH A;  4DR7 J;  2YNH A;  1I94 J;  2GMJ A;  1T9W A;  2YWH A;  4BWM A;  3ILI A;  3H59 A;  3IRX B;  5IV4 A;  4DL0 C;  1X9W A;  2KT3 A;  3K7R A;  1SC6 A;  2MQ8 A;  4HL9 A;  2DGU A;  2ACY A;  2DGO A;  4USM A;  1PCA A;  1VQP S;  3BRE A;  3TEH B;  4LR9 A;  4J37 A;  3ICL A;  3PXG a;  3I5C A;  1NEE A;  5K8O A;  4ZVQ B;  4JI8 J;  1FEH A;  2WOM B;  3CED A;  4RW9 A;  3VWS A;  4MYT A;  3US5 A;  4MKA A;  2MZS A;  4NLW A;  3CTR A;  1RAF B;  3OL8 A;  1NJY A;  3Q8R B;  3M2V B;  5IOL A;  1KN6 A;  2P9E A;  3CSK A;  5ETR A;  1QY7 A;  2XMK A;  1H72 C;  4AQY F;  3BPD A;  2AMC B;  2A2C A;  3M6U A;  1OY6 A;  1A0O B;  3N28 A;  1KTV A;  3BGF A;  3BO4 A;  2CNL B;  1YVF A;  4WWS A;  2BVZ A;  4DPW A;  1SL0 A;  4F3Q A;  5K8M A;  3X1L B;  3EYZ A;  3I0S A;  1N5Y B;  5HMY A;  2PD1 A;  3K2Y A;  4O0N A;  3QNW B;  2BJ3 A;  1GNK A;  1N36 F;  2GVZ A;  2CNN B;  2KXN B;  2KXH A;  2DRB A;  1B7Y B;  1UJ5 A;  2XYP B;  2HEK A;  4WYL A;  2QN6 B;  3FZB A;  2DT9 A;  5E3Q A;  1TFW A;  5HK4 A;  2VD3 A;  4FNI A;  1LK7 A;  3MI7 X;  4ED3 A;  3M30 B;  2J0S D;  2SXL A;  1N54 B;  5C25 A;  4I7F A;  3V81 B;  1F3F A;  4NCA A;  4F0K A;  5GMK a;  3MGJ A;  3G82 B;  3GG1 A;  2R7R A;  2OTJ S;  3RAM A;  3EUN A;  1WEL A;  2OUG A;  3M8Z A;  2XLI A;  4ELU A;  4TQS A;  1AZS B;  2VOD A;  3FSY A;  4B9L A;  3QGI A;  3OLB A;  3ZFV A;  4K4S A;  1HBM A;  1S1W A;  2IC3 B;  2Y9H A;  1O6X A;  2LDI A;  3BGO P;  4UTG A;  2P8I A;  2DHX A;  3T5L A;  2ZD1 B;  5L8R C;  4O3Q A;  1RA6 A;  3FK4 A;  5DQG A;  2B4O A;  2P5V A;  4WP8 A;  3MMB B;  5CHC B;  1T05 B;  3BGU A;  4TYB A;  4FDF A;  2DGQ A;  3MM5 A;  1W2I A;  2CKW A;  1EX8 A;  1OMS A;  2GC8 A;  3PO4 A;  2ALZ A;  4OHY A;  4NML A;  2ZUA A;  3ENA A;  3ONQ A;  3MR3 A;  5KOW A;  1X5S A;  4DR4 J;  3QGH A;  2HKE A;  2RU9 A;  3PDN A;  2C3P A;  3MCO A;  4HDG A;  3HHN B;  3A3P B;  1CQN A;  5JMN A;  2HNZ B;  1LWF B;  2XWX A;  2GS8 A;  4DR6 J;  1U1O A;  1GMW D;  3CJ0 A;  2CQ3 A;  1EAY C;  3TAM A;  2PSZ A;  2J9D E;  2Q3P A;  2IDL A;  1ZZF A;  3MEC A;  1N33 F;  3KDO A;  1NO8 A;  5DLF A;  2D9O A;  4CH0 S;  2BQ3 A;  1S1T B;  1HFE L;  3LGM A;  1M1H A;  4HH0 A;  1H6K X;  3BGL A;  5KG1 A;  3O44 A;  4C3K A;  2C2O B;  1HBN A;  1N52 B;  2OD6 A;  3JSR A;  2L48 A;  3NS5 A;  3M8Y A;  3NBP A;  2XY5 A;  3DM2 B;  4OI3 A;  1RT2 B;  1RYR A;  2LQ8 A;  4CT9 A;  3LPE A;  1MWQ A;  4WFB Q;  2H3E B;  2RH3 A;  1WEZ A;  3DDN A;  2VC1 A;  1EP4 A;  2FUG 9;  4DF4 A;  4ZPA A;  4DCP B;  1VC6 A;  1ZM4 A;  2OMO A;  2FJE B;  3UE2 A;  4A47 A;  3I32 A;  3H5U A;  4PXE A;  1LQ9 A;  2V4R A;  4J5O A;  4LF6 J;  4UST A;  1RB0 A;  2VON A;  1RKI A;  4DZD A;  5I4M A;  4L75 A;  4YR0 A;  3VAJ A;  1WG4 A;  3GZ7 A;  1F1B B;  2F4V F;  2NXE A;  2HHQ A;  2W24 A;  3CCT A;  1NSP A;  1S5Z A;  4FBU A;  4LRF A;  4JUZ A;  1RHU B;  2XM3 A;  3R9L A;  4DV7 F;  3PR5 B;  3JXO A;  3TRG A;  4DG1 B;  5CZV A;  4K4T A;  3OW2 R;  1KD1 T;  1HNI A;  1M0S A;  4H4M B;  5T7L B;  3MZI A;  3TUI C;  3EWG A;  3CD5 A;  4L3K A;  4YME A;  1KON A;  4FKX A;  3OD2 A;  5DO2 A;  4PG7 A;  5DRK A;  3WDO A;  1NPP A;  4IG0 A;  1BWE A;  4UOH A;  4P2M A;  1GEH A;  1NDL A;  2X1B A;  4DV0 F;  2VIC A;  2VL1 A;  3UCU P;  4YB6 A;  3U7J A;  1Q81 T;  1IKW A;  3C6T B;  3PVX A;  1OYE A;  4P9S A;  2ZM6 F;  2B9X A;  4M8L A;  1HWK A;  2RE1 A;  1U2C A;  1QAX A;  2EFO A;  3KLI A;  2ILZ A;  4N5S A;  2JC1 A;  2UZA A;  4EBD A;  3DGP A;  2CIM A;  4IUF A;  3RB0 A;  1E6Y B;  3H20 A;  4QWD A;  5THW A;  3K5M A;  3P4U B;  5ETM A;  1X5P A;  4PRF A;  2QYG A;  3DU6 A;  1PJ5 A;  1X5O A;  3CJ2 A;  2XI2 A;  1JLQ B;  2ZKT A;  1X9S A;  1SKU B;  1FXR A;  2CQB A;  3BN7 A;  3ULH A;  2V2Z A;  1JB0 C;  5D8H B;  3JQJ A;  4DQS A;  4M5J A;  4OYW A;  5KFZ A;  1NDP A;  2AEF A;  1Y00 A;  2C3O A;  5KFL A;  3RTV A;  2YY3 A;  2B5J B;  3ETO A;  5JJB A;  2F1F A;  2M2B A;  4USJ C;  4LFB J;  3L7O A;  1RTH B;  3DI6 B;  2E5I A;  4F67 A;  2J76 E;  2I5J B;  3T3F A;  4NEZ A;  1XN9 A;  1IR1 A;  2VV5 A;  2EFV A;  1S72 S;  2G2O A;  2KZM A;  3H90 A;  5KT3 A;  4W92 B;  3D9B A;  3T9N A;  4OZN A;  5LSO A;  1HPZ A;  1B99 A;  2Q6C A;  4DQI A;  2AJ0 A;  3N6N A;  3HX9 A;  1AT1 B;  3SZ2 A;  2LEA A;  1SKR A;  3E3X A;  3MAA A;  2CPH A;  3GIM A;  1SKS A;  1CJV A;  4BLG A;  3D67 A;  2RS8 A;  3QGG A;  1UWB B;  5LJ3 Y;  2W8K A;  3BQ2 A;  1D9F A;  2ZZN A;  5K20 B;  1S7I A;  3GG0 A;  3A3O B;  2OEK A;  2ZH5 A;  1QUV A;  4B3T J;  4DL2 A;  2HHH J;  4OYX A;  2GV1 A;  1UJ6 A;  4LF8 J;  3DU5 A;  4FKY A;  2X1A A;  5A6W A;  3KHG A;  4Y65 A;  3BDE A;  5K8N A;  2CG8 A;  4IR9 A;  3GII A;  2OPP B;  2F8H A;  3AA9 A;  3NNA A;  3PJW A;  2IFX A;  2DH9 A;  2EI5 A;  4ECX A;  3D3C J;  3HO1 A;  3R7B B;  4F36 A;  3M32 B;  4EWT A;  3CCS S;  3QIP A;  3RRH A;  4WK3 A;  5DZ6 A;  3MMA B;  4F4Z A;  1SB6 A;  4NA3 A;  2XGQ A;  3BS9 A;  2CG4 A;  3QT8 A;  4X4Q A;  1FHT A;  1JKH B;  3NXZ A;  4D3H A;  2FHK A;  3TEG A;  5MLC V;  4GKK J;  5IQ6 A;  5HVH A;  3OR1 B;  4ED1 A;  3N5F A;  3CCJ S;  1MN7 A;  3LPY A;  5AE3 A;  3NAH A;  2E9Z A;  2HVH A;  4OZ2 A;  3LP0 A;  1JX4 A;  2LCW A;  4PXB A;  3OBI A;  1KS2 A;  4U8Y A;  1CUL B;  3F0N A;  2PO4 A;  2XZD B;  2HUR A;  4FYD A;  2DCU B;  5AJ3 J;  5K5M A;  5DM7 Q;  2VFV A;  4X64 J;  5MAO A;  4IH6 A;  1V5V A;  1HNZ F;  2GJ2 A;  2X51 A;  2DNQ A;  4XK8 C;  3OT9 A;  1RT1 B;  4TU9 A;  4DU8 A;  3CDE A;  4KPC A;  2H5I B;  3W1Y C;  1HW9 A;  1FT8 A;  4ED4 A;  3PX6 A;  2Q1L A;  1KBR A;  3AT1 B;  2B9Y A;  1TL1 B;  3JTN A;  4ZK7 M;  1T03 B;  3PR4 A;  4DR3 J;  2I8E A;  2R3V A;  2WON A;  2JNJ A;  3CJK A;  4M5I A;  5KT7 A;  3MAH A;  4RW4 B;  1RLD A;  1KOH A;  2KRR A;  3WQP A;  3OTO F;  2GO9 A;  4EYI B;  4P74 A;  2LXI A;  3OHA A;  1JJH A;  4TQR A;  3WC2 A;  2RRB A;  2J8A A;  1CJT B;  5LMU F;  1D3W A;  3LW5 C;  1UET A;  2XMT A;  1RHJ B;  4PZV A;  2UUT A;  1FJC A;  1FRK A;  4NYZ A;  2ZDO A;  1H98 A;  5CZX A;  2J9C A;  1URN A;  3VQS A;  5KFK A;  1HA1 A;  1WC6 A;  3SCK E;  1J5E J;  1KP6 A;  1Q7L B;  3R5J B;  3HMJ G;  1YZ7 A;  2X1G A;  1AUD A;  3A8I A;  1FFW B;  2CJB A;  3C14 A;  2ZUG A;  4J9P A;  3ZC4 A;  1PAE X;  4EUV A;  5C2G A;  5KG2 A;  4W98 A;  2W2M P;  1S76 D;  2RNE A;  4OYA A;  2BXJ A;  2R8H A;  3ADA C;  1RWW B;  4ALZ A;  5EGY A;  4UOF A;  4QIF A;  3I31 A;  1KQK A;  4DX8 H;  3D6F B;  1GMV A;  2APO A;  3U02 A;  4LR7 A;  3SEO A;  1V6H A;  2RUS A;  2FHO B;  4NCG A;  5LMN F;  3SYZ A;  2QA4 G;  2UU9 J;  5L9X A;  4KV8 B;  2BAN A;  4WKY A;  2DXE A;  5F8M A;  4JI6 F;  3GFY A;  1MMN A;  4XDD A;  3DMJ A;  4QWA A;  4QIV A;  1TVR A;  1DTQ A;  2R7V A;  1RAI B;  4L74 A;  2HHS A;  1AXQ A;  2L9N A;  1LEO A;  2G9O A;  4NLP A;  4CYU B;  3DOL A;  3PW7 A;  1SBR A;  4O3S A;  2VG7 B;  2IVF B;  1UEU A;  2KT5 A;  3OR2 B;  3R3T A;  2MQQ A;  2DHS A;  2K7K A;  1XNQ F;  4LFC J;  4ECR A;  1X4F A;  3M2U A;  1VQ7 S;  5CA5 A;  4MIA A;  4E8U A;  1UL3 A;  3MXH P;  4NZ0 A;  2RIL A;  3M8R A;  2DR8 A;  2NCK L;  4C8O A;  2XSJ B;  4DCO B;  1HBU A;  2MXY A;  3SMZ A;  3CCM S;  1TFY A;  5IWA F;  5BXI A;  4LRB A;  1PAU B;  5KFC A;  1AUS L;  1JLA A;  1RWN B;  2RQ4 A;  3NS7 B;  1Q86 T;  4I2Q A;  1JMT A;  4NXM J;  3FCV A;  5HMW A;  5D0G A;  4WZQ A;  9ATC B;  3SFG A;  4JI4 F;  2DR6 A;  3HUL A;  3DNC A;  3VVU A;  1U09 A;  1TTH B;  4HVZ A;  4CLZ A;  4ZMM A;  2WTF A;  4DFJ A;  2DNP A;  2NUH A;  2KT2 A;  4ED2 A;  4PWW A;  3GIL A;  2XGP A;  2FHJ A;  1MLA A;  5B09 A;  2KFZ A;  2IA0 A;  5D4P A;  1LV5 A;  1YBU A;  5HJY A;  1TUW A;  3DOK A;  2UUA F;  4IRD A;  4OQJ A;  2IRX A;  3I0R B;  4QJV A;  5G0R A;  4ZCL A;  4NOH A;  1HBO A;  5A76 A;  2N82 B;  4Q2L A;  4H4K A;  2QEX S;  3TA1 A;  3BV8 A;  1CPZ A;  4HLB A;  3D4J A;  1HYS A;  4C9D A;  1J2V A;  1RYS A;  3W60 A;  1B4S A;  3C46 A;  3QYY A;  3GYN A;  1TKX A;  3GFX A;  2ZWP A;  5KFN A;  1TEL A;  1XJW B;  2J6U A;  2NZ4 A;  2ZNZ A;  4WP9 A;  1UJ4 A;  2HLT A;  4F4X A;  2HS4 A;  1IUJ A;  4J9K A;  2DGX A;  2CQ2 A;  4DR1 F;  2M52 A;  4OJH A;  2O01 C;  2UXC J;  4OX8 A;  4G65 A;  1W25 A;  2QLF B;  1IBM F;  2CVI A;  4PXC A;  2CXE A;  3SQO P;  5IT9 U;  1FX2 A;  3KG1 A;  2VOO A;  1FNO A;  4OI4 A;  5D6G A;  4B08 A;  2CDR B;  2J6S A;  4NLX A;  3IWL A;  3JSY A;  4F3M A;  2HAF A;  1VLO A;  2A0F B;  4Q44 A;  5KTQ A;  1CG2 A;  4WBF A;  4CLU A;  1JNZ B;  4EI2 A;  1IQZ A;  2W7O A;  2I2Y A;  3V2U C;  5L1J A;  2HWH A;  2PEH A;  1LWE A;  2CNO B;  2CYY A;  1JJ2 R;  1PYO B;  5RUB A;  5IZH A;  3FFI A;  4I68 A;  1TK0 A;  2JLG A;  3H25 A;  5C2C A;  4QR1 A;  5DG8 A;  1NH7 A;  3BKU A;  3NGK A;  4KHM A;  4OJ1 A;  3A8J A;  1W26 A;  3Q89 A;  3DLK A;  5AXL A;  2DK2 A;  2WZ1 A;  3BSA A;  3QT5 A;  3JB9 k;  3EZO A;  4QU6 A;  1YKW A;  5C25 B;  1Z1Z A;  3M6W A;  1TL7 B;  2IM0 A;  1R8B A;  2MJU A;  1YHQ S;  3HD1 A;  4DV3 J;  4XO0 A;  2K7J A;  4OYI A;  5E0O A;  1UVK A;  2GA7 A;  4X66 J;  1N34 J;  1GXU A;  3IR6 B;  3W66 A;  4Y2C A;  3R2C J;  2HW3 A;  4KB7 A;  1CQM A;  2K1R B;  3PJX A;  3G2X A;  1R0C B;  2QL7 B;  3T9Z A;  1GQE A;  1S1W B;  4LF7 F;  2PFF B;  2OI2 A;  2RS2 A;  3T41 A;  4GC6 A;  4F2S A;  1GMU A;  4USI A;  1DJ0 A;  4Y34 A;  2UVV A;  2YKM B;  3D6H B;  2DO4 A;  2XCP A;  3J81 U;  2D3O R;  4MAK A;  2HNY A;  4RNN A;  4AQY J;  1SL1 A;  1VQ6 S;  3C3L A;  1F2G A;  2OD4 A;  1ULR A;  4HDH A;  3PO5 A;  2FJB B;  3D0G E;  1C1B A;  4ZN1 A;  2VKZ G;  4KO0 B;  3CMQ A;  1XMO F;  1N36 J;  5F8H A;  3W2W A;  3G6E S;  3U1M A;  3HF5 A;  4NXN F;  4TKT A;  4B9V A;  2ROE A;  1RT5 A;  2YKQ A;  1PGZ A;  3HSG A;  4JI5 F;  2Z2L A;  1B64 A;  1U0H B;  3GV7 B;  4B3R J;  5D15 A;  1U1R A;  7FD1 A;  3HDS A;  4DMZ A;  4PQU A;  2R2R A;  4CCH A;  1SJ1 A;  1VQM S;  5HP1 A;  2QRR A;  4LQ3 A;  2BA9 A;  3SQG A;  3W2V A;  1SL2 A;  5D4N A;  4YY3 F;  4RBT A;  3M6X A;  5F0W A;  1TR0 A;  1GH8 A;  3W8G A;  2LYV A;  4HHU A;  4H4K C;  4N7T A;  2HRY A;  2QSW A;  4HHH A;  1VQN S;  4NA2 A;  3VR1 A;  5B0E A;  2E5H A;  5IM0 B;  5I3U B;  3R8Y A;  1S57 A;  3LH2 S;  4ED5 A;  3JQM A;  4DV5 F;  1UKU A;  2E9T A;  1HQE A;  3SDE B;  2P2C B;  5AXM A;  2CPE A;  5GAE U;  4LF4 F;  4Q43 A;  2AT1 B;  4HHJ A;  4DL6 A;  2HFZ A;  2V9K A;  1NK9 A;  2MLY A;  4YS2 A;  1D9D A;  1WUU A;  4NLY A;  3ZZP A;  1DY3 A;  4O0I A;  3P45 B;  2PGC A;  1X4B A;  3KLG A;  1RT4 B;  4G1Q A;  4DR5 F;  1S9E A;  4OX7 A;  2F63 A;  2GVD A;  3UR0 A;  2ZH2 A;  1EQM A;  4Y0F A;  1OY9 A;  3I82 A;  4K5S A;  2WVD A;  3FUY A;  4OFZ A;  5K14 A;  3FBE A;  3FVY A;  2UV8 A;  2Z57 B;  4PKD B;  2HBZ B;  5B7W A;  3DYA A;  1Q16 B;  2GFF A;  1AFJ A;  2FVR A;  4EFA C;  4FBT A;  1IWA A;  2OPR B;  2GJI A;  4KGX B;  1RWP B;  4MTP A;  2XMA A;  1U6B A;  1JJC B;  3NGT A;  2FZK B;  4OI2 A;  1NK4 A;  1N33 J;  1NSK L;  3KJQ B;  3P96 A;  5KFA A;  1VC0 A;  1IKV A;  1NPK A;  2QTW A;  5A2Q U;  2W9B B;  1G1X A;  2UXB F;  4AT1 B;  2OO4 A;  4RJV A;  2FLP A;  4LSN B;  2R7W A;  2J7K A;  4A8S A;  4JI7 F;  1HI0 P;  2AJF E;  3HP6 A;  1YK9 A;  5JUM A;  4CNZ A;  2UV8 G;  3V4M A;  4DV2 F;  4KGM A;  3DGP B;  4GVB B;  2YX4 A;  2FGC A;  3A8E A;  1RWK B;  5T14 A;  3VAI A;  5D4L A;  3MPY A;  2ATC B;  3NY0 A;  2V94 A;  1HW8 A;  4P6Q A;  2NXC A;  1K9M T;  1IR2 A;  4N76 A;  3ITH A;  5KT4 A;  3R2D J;  1KLM A;  5DJB A;  4AND A;  4P7T A;  2M7S A;  5EWE A;  3CCE S;  1VFJ A;  1MMD A;  2CQG A;  1RAH B;  2ZJP Q;  4ZVP B;  4ZLN A;  3UDE A;  5ITH A;  3CO9 A;  2HFV A;  2WRM A;  3QID A;  2A6O A;  1BQN B;  4EZ9 A;  2AYG A;  2W25 A;  1F60 B;  2BEF A;  1DTT B;  4OV6 A;  3NCP A;  1WOP A;  3NCQ A;  2NZC A;  4LF1 A;  2OIH A;  4DV7 J;  3M8S A;  1HPZ B;  3D7S B;  2GW8 A;  4RW6 A;  1MU2 B;  2LDY A;  5GME A;  1HD0 A;  3NGR A;  3CB4 A;  3DLH A;  3PW5 A;  1YZ6 A;  2BW2 A;  3UW1 A;  1CJK B;  1NDK A;  1HI8 A;  4PYA A;  4KGK A;  3DXS X;  2DIS A;  1RTI B;  4ZCM A;  2RDD A;  1JNR B;  3BGR A;  4K4V A;  5LSL A;  4DV0 J;  3PNI A;  2EKY A;  2LQ5 A;  1FCA A;  4WFN Q;  1U1M A;  1L3S A;  2ZOG A;  4DL7 A;  4N56 A;  2KJW A;  4DL5 A;  4FF1 A;  1ZS6 A;  3FDS A;  3D68 A;  2RJZ A;  2ZHO A;  5KFI A;  3EVW A;  3TYT A;  2L9D A;  1IR0 A;  3O1L A;  2PT0 A;  4ZOS A;  5J2Q A;  3HJF A;  2YKP A;  3M8Q B;  1QTM A;  3BH6 B;  3ISZ A;  4WFY A;  5D0R A;  4ZVH A;  2DR5 A;  2VOP A;  3DLE B;  4WCE Q;  2R7S A;  3P5T L;  5A8W A;  3OUY A;  3PYF A;  2BQU A;  4X4U A;  1UVJ A;  2W2O P;  4I4B A;  2MMY A;  1LW0 B;  4YR2 A;  1A9N B;  1M90 T;  4DI6 A;  4JI0 F;  1NB7 A;  1KVK A;  2MZQ A;  3DRS B;  4GC7 A;  3LOU A;  2CZ9 A;  1EQ0 A;  1NDC A;  2WOM A;  3A13 A;  1T9V A;  1S4E A;  3QJJ A;  1U2F A;  3LP0 B;  3P6Y C;  2XS5 A;  4Z7Y A;  2I6W A;  5KFJ A;  2ASD A;  3RRG A;  4A8X A;  2JZ5 A;  3M2V A;  4K5R A;  2DNG A;  3HZG A;  4DFM A;  4C8K A;  3PTW A;  2ZHB A;  1SJQ A;  3MD1 A;  2QMX A;  2YNF B;  1N5Y A;  3GU0 A;  4DSE A;  4F0M A;  3BSO A;  2A10 A;  1URR A;  3NLC A;  1WD6 A;  2P6S A;  2FVC A;  4PPD A;  3LP1 B;  2HHP A;  4ZLL A;  1FRH A;  1QUP A;  4ICL B;  5IT9 Y;  1Q1K A;  3RU0 A;  4LQ9 A;  2I9S A;  5E41 A;  2BOP A;  2M8D B;  1WHW A;  4F4K A;  2MZJ A;  4DV6 F;  1T0T V;  2EK6 A;  2NXU A;  4BC7 A;  3V81 A;  3SSS A;  3EE3 A;  2IM1 A;  2C2R A;  1YJT A;  5H9E K;  2F5G A;  3G82 A;  4DOZ A;  1DQ9 A;  4A8Y A;  3VQT A;  4NLO A;  3R6L B;  3KLH B;  5L39 A;  2PMZ D;  3CC4 S;  3EZ5 A;  1AZS A;  2MB0 B;  5BR8 F;  3QMQ A;  1RE1 B;  3MAQ A;  1L3T A;  1RTD B;  3G6V A;  4Q0B B;  1HKA A;  1XMQ F;  4QIW D;  2OH2 A;  3IBC B;  2ZD1 A;  2P9C A;  4NLS A;  3MM8 A;  1TU0 B;  3MMB A;  3Q23 A;  1WSR A;  3WIU A;  3BPS P;  1RLC L;  3E51 A;  1MWZ A;  1T05 A;  3H5Y A;  3B8H A;  4ZVF A;  3PYG A;  3HSJ A;  3PEJ A;  2FHM A;  2C28 A;  4FYX B;  2Z30 B;  4ED6 A;  2Q79 A;  1TKD A;  1C4A A;  2B9W A;  5J1P A;  4TY9 A;  3M6V A;  3HVW A;  1LW2 B;  1HHS A;  2IBK A;  4JV1 A;  2HHT A;  4MYU A;  4ED7 A;  3C8Y A;  5H9E J;  1SJ3 P;  3KDN A;  3GSI A;  3UN3 A;  2EFQ A;  5ETO A;  2HNZ A;  1LWF A;  3AB4 B;  4WXW A;  4B3S F;  3GCW P;  1WC4 A;  4KHP J;  3FBF A;  1P27 B;  3HKW A;  5KT6 A;  4CO4 A;  2GIR A;  2ZJQ Q;  3JTP A;  4M94 A;  1C0U A;  4J9N A;  4ECY A;  2FDN A;  4ZCI A;  2OFH X;  4HI1 A;  1S1T A;  2JFD A;  2ZH4 A;  1UW9 A;  2V8H A;  3TQ1 A;  3OTO J;  2DNY A;  1RWU A;  5HL7 Q;  2JH3 A;  4X4O A;  1CC8 A;  1TVR B;  4ETX A;  4U67 Q;  3TI0 A;  4DV4 F;  4ZJQ A;  4ZHR A;  1QVG R;  3IMQ J;  3AQO A;  3I5B A;  3Q0A A;  3U1N A;  2EVZ A;  2HAI A;  3DM2 A;  1RBL A;  2CUY A;  3TJ8 A;  3MFH A;  1RT2 A;  2W8L A;  4P75 A;  2Z0G A;  4RNF A;  4IRC A;  1VHI A;  3BQ0 A;  1F5A A;  3P5B P;  4M95 A;  1FKO A;  3MFI A;  3M2U B;  4R25 A;  4AL7 A;  1S1X A;  2BJ8 A;  3OQ2 A;  3D0H E;  3AOC A;  1WG5 A;  1R0B G;  4JV5 F;  1TMM A;  4K4W A;  1G6B A;  3MF5 A;  2M4M A;  2RDI A;  4M5M A;  1ZET A;  3UNY A;  3RRK A;  3N6M A;  3K5L A;  2KTQ A;  4URQ U;  4CLY A;  4I2Q B;  2DR7 A;  4OI1 A;  1G3O A;  2XYG B;  4DG1 A;  1Y5I B;  2BRL A;  4H4M A;  2V8D A;  5T7L A;  4DPY A;  3B82 A;  3O5T B;  4K50 A;  4DHV A;  4ZVS B;  1BQX A;  2E1C A;  3K57 A;  3OFF A;  3J7Y I;  2F4F A;  2AHO B;  1N0V C;  3KTQ A;  1Q79 A;  3IFE A;  2DY9 A;  4AXI A;  3LAN A;  5HRO B;  1S0V A;  1U1N A;  4C8N A;  2ZOM A;  3KFW X;  1FVQ A;  5LMN J;  4LF5 J;  3GQC A;  3QGP A;  1T02 A;  1APS A;  5F8L A;  2VKR A;  4DCJ B;  1WHX A;  2JWN A;  1FFS B;  3HHL D;  4LT6 A;  3OV7 A;  2KN4 A;  3TNV A;  4EBE A;  4QIE A;  1JLF B;  4DN9 A;  3DHW C;  1HYS B;  5AE1 A;  1SKW A;  2LU1 A;  2VA3 A;  2R8K A;  1Y4Z B;  1JLE B;  1U4B A;  1TKX B;  1TL5 A;  4K7Q A;  2L9W A;  1RZM A;  1JLQ A;  3C16 A;  5M2P A;  1KWM A;  4CO1 A;  2AKW B;  4FPR A;  4BHQ A;  2RU3 A;  4USW A;  2VH7 A;  1XNQ J;  2VBW A;  5CXT A;  4NYO A;  3MPV A;  2G1D A;  1SUQ A;  1YX2 A;  1NZ8 A;  1RTH A;  3DI6 A;  4U7U K;  4ANC A;  1S1V B;  2CAJ A;  1H2U X;  1XK8 A;  3OVS A;  2CPZ A;  1UCN A;  3QSI A;  5IWA J;  4WFA Q;  2MZT A;  1ZYQ A;  3KK2 A;  3GMG A;  1B7F A;  3OTE A;  3CT9 A;  3D6M B;  1JLB B;  3I9Z A;  5L1I A;  2LEB A;  3KUG A;  2GCF A;  3OFH A;  2HVD A;  3NEK A;  5B08 A;  4X65 F;  1LXJ A;  4RR5 A;  1NJW A;  3MM7 A;  1FRX A;  1NK6 A;  5DDO C;  1X0P A;  1UWB A;  2IRY A;  3IAM 9;  2HGL A;  2D74 B;  2MGZ B;  4J9O A;  4B17 A;  1HNX F;  2WK4 A;  4Y2A A;  2V63 A;  2Y0B B;  2UUA J;  1N32 F;  4KR0 B;  1ARO P;  4DLE A;  3THV A;  4A8K A;  4I56 A;  3AD8 C;  2MLX A;  5CD4 H;  2WBM A;  1CS4 B;  3ILO A;  1REG X;  2QMW A;  2CVE A;  2M5Y A;  2FYX A;  4LRD A;  3LGH A;  3SCI E;  2DIT A;  3QPI A;  2FJV A;  1YRT A;  4LJM A;  2MST A;  1LNQ A;  2RIJ A;  2L08 A;  2IAJ B;  2ROG A;  4MT1 A;  2UVU A;  4JYA F;  2YNG B;  3M32 A;  2XNQ A;  3FBB A;  2GHV C;  2DB1 A;  2JVR A;  1SC4 B;  3MMA A;  1S7H A;  1EIY B;  2IRU A;  1JKH A;  4U8V A;  5KOX A;  2W4C A;  2AF6 A;  1VIS A;  4PG5 A;  1L3U A;  1R43 A;  3DN9 A;  3IO1 A;  3H40 A;  2Y0S D;  3HCX A;  3OR1 A;  3CCW A;  1RTZ A;  1YJ7 A;  4QW8 A;  2XS7 A;  1CJU A;  1HNW F;  1Z2L A;  5IV3 A;  5IT4 A;  2FIU A;  3EJM A;  4LBH A;  4OX6 A;  2VPX B;  3W8P A;  3CNQ P;  2WVB A;  1YIT S;  3QRR A;  1XBW A;  4IH5 A;  4DQR A;  1N48 A;  1CUL A;  4PQA A;  1OY8 A;  4DPO A;  3DKD A;  4GO5 X;  2C22 A;  3AXM A;  2VFS A;  3UN5 A;  4TU8 A;  4CLP A;  4WFX A;  3LF0 A;  4OMF G;  3UO0 A;  2YX7 A;  5DG7 A;  1D0E A;  5K9F A;  2YH1 A;  4LF9 F;  2IDE A;  2W2Q P;  4DUY F;  1O8B A;  2HQF A;  3EVO A;  4X4V A;  1Z4U A;  2EG2 A;  3T5K A;  2WVE A;  1MW7 A;  1RT1 A;  3BB5 A;  3QLH A;  5E3P A;  4DU7 A;  2HFO A;  2R7T A;  3RAQ A;  3ILL A;  1M1K T;  2C42 A;  3KLE B;  1GTE A;  1HI1 A;  3SCL E;  1AYE A;  3ELH A;  1X4G A;  1NSA A;  1U8W A;  2J8S A;  2F65 A;  2ZOF A;  3GB0 A;  1TL1 A;  3JS9 A;  3KHR A;  1SH0 A;  3RB4 A;  1YJR A;  3JTO A;  2XMV A;  1U1K A;  4RW4 A;  1ZH5 A;  2E1R A;  2QLJ B;  4MH8 A;  3RYL A;  4LF7 J;  2CJX B;  4JI3 F;  1IJF B;  2K3K A;  3MR6 A;  2VG5 B;  2E1A A;  4TN2 A;  3LAL A;  3BDP A;  1SJ4 P;  1VK8 A;  3HHD A;  2QV6 A;  1MG7 A;  2FTR A;  5HMZ A;  3EXC X;  3BYP A;  3Q24 A;  2ZBR A;  5KT5 A;  4NX9 A;  2XWY A;  3KLG B;  2CZV C;  3PEH A;  1NHV A;  4K8R A;  2DNL A;  1BGX T;  2CPI A;  3OXF A;  1GX5 A;  2RAQ A;  2F7V A;  1X0F A;  1JIH A;  2CWK A;  1FFG B;  5LXY A;  1LXN A;  1N5S A;  3C19 A;  1XMO J;  4DUZ F;  2GO8 A;  3PYE A;  3MUM P;  2GX8 A;  2IM3 A;  4JI5 J;  3VTI A;  8AT1 B;  1U7L A;  5B0F A;  3A1Y G;  4OLO A;  2W9A A;  2AP6 A;  1SVD A;  3U1L A;  2HGN A;  1WKK A;  3SV4 A;  1VS3 A;  4OYO A;  3C15 A;  2EFN A;  2JHE A;  3JAM Y;  1TP7 A;  1HLW A;  3MUV P;  3VGS A;  4R5P B;  1IKV B;  2D69 A;  1I51 B;  2RVJ A;  4M5K A;  3SBM A;  4C0H A;  2ZC3 A;  2LQB A;  1FO1 A;  1D9A A;  3I55 S;  3RBZ A;  3K8V A;  2ABY A;  4ZP6 A;  3AY0 A;  2OHD A;  2UVW A;  3IR5 B;  1CVJ A;  3AAW B;  2A18 A;  4KV8 A;  8RUC A;  4OX9 F;  4DV5 J;  1RXO B;  2CAD A;  2PA8 D;  1R8P A;  1RHQ B;  1NM2 A;  2FHJ D;  2DNM A;  2DNR A;  2XB2 D;  5HAN A;  4Z2X A;  2R9L A;  4RBV A;  3AHP A;  3V4I B;  3TVZ A;  4CYU A;  2Q43 A;  4BS2 A;  1BD6 A;  3C66 A;  3HKZ D;  2VG7 A;  4FXV A;  3OR2 A;  2CJK A;  5HBM B;  2ZEJ A;  4DL4 A;  2DGS A;  1NH8 A;  4EMD A;  5H1S V;  1S6U A;  1TKT B;  1WOR A;  3DRR A;  4ZPB A;  3I56 S;  1A6L A;  2XSJ A;  2HZV A;  1VYA A;  3HXM A;  3PIO Q;  1FTC A;  2KL8 A;  1KSP A;  4JI8 F;  1VJW A;  5AE2 A;  1WKJ A;  2JLE A;  1WOO A;  4R0E A;  2ATL A;  2XNR A;  2FD2 A;  1KDN A;  4Y6I A;  5A8R B;  2AJQ A;  1S0M A;  3MUT P;  1NK8 A;  3LWL A;  4ELT A;  5GAG I;  4LF2 A;  5E7O B;  3BGR B;  5DQH A;  2DNZ A;  2ZC4 A;  3THT A;  3H2U B;  2ZH7 A;  5HLF A;  3CO0 P;  2VG6 B;  3FMW A;  2Y1R I;  3QAT A;  3EZU A;  3THP A;  2DBB A;  3BBC A;  2PMW A;  3DLL Q;  2YQ3 A;  4B3O A;  3TUJ C;  3M9O B;  3I0R A;  2H4Y B;  1QD1 A;  4CTA B;  2GQQ A;  3TUP A;  3KK3 A;  1U49 A;  4XPC A;  3CD0 A;  3IWX A;  2CQ1 A;  2QIF A;  2V8P A;  1FJE B;  2Z58 B;  2F40 A;  5A8W B;  3OUY B;  4W4M A;  2MKJ A;  1VRT B;  4AXJ A;  4DUT A;  4EU0 A;  2XCA A;  3TZW A;  1VHF A;  3K5O A;  1FD8 A;  4IH7 A;  4DS4 A;  2VDI A;  2MKS A;  2GAH C;  2YVS A;  1QE1 B;  2NSC A;  3FQK A;  3ZXW A;  1NPR A;  1HMV B;  1U26 A;  3IR7 B;  1KEK A;  2M70 A;  2M88 A;  3UDC A;  5CYQ B;  4PPZ A;  1U02 A;  1PYT A;  1SXL A;  3A4T A;  4CDI A;  2DH7 A;  2OPS B;  5B0B A;  4DSF A;  4KFB B;  3BZQ A;  1HIY A;  4EYH B;  1FKA F;  2WSC C;  2Q66 A;  2QGF B;  1Z2Z A;  5KG0 A;  2K8G A;  1S9G B;  1N0U A;  2D3U A;  2BKP A;  3WX4 A;  3OLA A;  3D54 A;  3H0P A;  2FQQ B;  1S6P B;  1SH2 A;  3R97 A;  1R31 A;  6AT1 B;  5D77 A;  2KHD A;  5C5J A;  2XUL A;  1ELO A;  4A4J A;  4F4A A;  3MM6 B;  2IM2 A;  5E3C A;  1RQ0 A;  4OZ3 A;  3MCM A;  1WDD A;  3POT B;  1UEK A;  5CYJ A;  1V5I B;  2HIQ A;  4LBP A;  3UDL A;  3QFW A;  2AYB A;  4O4G B;  5DLG A;  2NUU G;  3VZH A;  5J2P B;  2CPY A;  5EX0 A;  2ADB A;  4ZN3 A;  2LXU A;  2B7C B;  4NYP A;  4QR2 A;  1KRP A;  2LMI A;  3CCZ A;  3N4W A;  4ENO A;  3AOB A;  4UQT A;  4QR0 A;  2V2K A;  2MKC A;  2CJA A;  1IN0 A;  4DR6 F;  4LR8 A;  2G0J A;  1VR6 A;  4X4P A;  4ERD A;  1K73 T;  1GTH A;  4KAI A;  1BHN A;  4F25 A;  5KFE A;  1ZTT A;  1TL7 A;  2PDA A;  4ELV A;  4CRJ A;  2JJ4 D;  3VAM A;  3EGZ A;  1JLG B;  2O5D A;  2BJ1 A;  4HTI A;  1K8A T;  5D3G A;  4MK7 A;  3TZY A;  4NI2 B;  2WCX A;  2K1R A;  4C3L A;  1YRX A;  4DBQ A;  5H9F K;  1VBZ A;  2RQM A;  3HVA A;  2DPJ A;  3O6Q A;  5LXR A;  5B0C A;  4CO0 A;  3DLJ A;  4RL1 A;  4YFU A;  3HVT B;  1WC5 A;  3W63 A;  3GFZ A;  3MM8 B;  2BJE A;  2K3I A;  3G8T A;  3QWU A;  3J80 Y;  2N3O A;  2YKM A;  4DSI A;  2LEC A;  1QM9 A;  1ICE B;  1B0T A;  1AB8 A;  2QO3 A;  1YLX A;  4CNY A;  1ACM B;  3TA2 A;  2DR9 A;  4ES1 A;  2OML A;  1U24 A;  4M5G A;  3I4P A;  1HQU B;  1IXK A;  2EPI A;  5IFM A;  1FNM A;  3B6B A;  5KFY A;  1T7P A;  1L3K A;  5ETL A;  1RA7 A;  1DLO B;  2KB2 A;  4KO0 A;  4ATN A;  3DOM B;  4LRC A;  3M1V B;  4DEZ A;  5HN0 A;  1TL4 A;  2OAU A;  3T1H J;  4PG4 A;  5H9F J;  4YUD A;  4WXO A;  1U0H A;  5L9N A;  3UD4 P;  4U95 A;  1WEY A;  4F8R A;  2DHH A;  3BQ1 A;  1NHK L;  1C0U B;  1FDA A;  2QG9 B;  4CLL A;  4X4T A;  2BJ7 A;  1O0P A;  1AW0 A;  1OIA A;  1U1L A;  3H5X A;  2V0N A;  5EX3 A;  2C3U A;  4LSL B;  4RW7 B;  2MQL A;  1HWU A;  5KG3 A;  3KLF B;  4ZHR B;  3GE9 A;  2MYF A;  2DRD A;  1VIX A;  4BWJ A;  3MR5 A;  5IM0 A;  5BR8 J;  5I3U A;  3PY8 A;  1KR4 A;  2H5J B;  1GXT A;  3SDE A;  2CQD A;  2XY7 A;  3D28 A;  2GJF A;  1K1Q A;  3KJV B;  1RT6 B;  4M5D B;  4LFA F;  2EFG A;  2EBE A;  2GHP A;  4IFV B;  2DYA A;  5KFQ A;  5FDL B;  1FKO B;  1F0X A;  4UQG A;  3PW2 A;  5A6P A;  2EC0 A;  1T9U A;  1I1G A;  1S1X B;  4QZV B;  1C1C B;  4O4R A;  2ASJ A;  2ASY A;  3NCR A;  3KKF A;  2E7V A;  1RT4 A;  3FGV A;  3R5B A;  3H4D A;  1XEZ A;  1IBC B;  4LFB F;  3PAC A;  1IKY A;  1IBL F;  4ILM A;  1P9Y A;  3PRV A;  4O3R A;  2NQP A;  2IJF A;  3OL9 A;  2AEM A;  3QAE A;  3PV8 A;  4ES2 A;  2BE2 B;  4JI2 J;  1SCJ B;  4ZPD A;  3KYL A;  4ZPW R;  5F8J A;  1X9M A;  3HT3 A;  4B3S J;  4KKO B;  3ILJ A;  5DM6 Q;  2OPR A;  3FNN A;  1J27 A;  4CZC A;  2NSB A;  5DG9 A;  3GR1 A;  1S97 A;  4QQB A;  4OZ0 A;  1U6Z A;  4FF4 A;  2N4D A;  2UUW A;  2HBR B;  2W9B A;  3OTD A;  4LSN A;  2HFS A;  3RZA A;  2L3M A;  1BY9 A;  4WKR A;  3T6J A;  4PCQ A;  1VRU B;  1V3Z A;  2XO7 A;  1HWJ A;  4WE1 A;  2JX2 A;  1C4C A;  1DRZ A;  1S0O A;  4W90 B;  4DV4 J;  4GVB A;  2J5A A;  3PCO B;  4RUA A;  2BV3 A;  2HHH F;  2IVM A;  4ZLP A;  3H2V E;  1Q7Y T;  4F4Y A;  4J9R A;  3DHX A;  3L95 X;  1NKE A;  4DX7 A;  4C97 A;  1RT3 B;  3C16 B;  1OSC A;  3QQC D;  3QJL A;  3AJ1 A;  4B3M F;  3OTC A;  4USU A;  5B0D A;  4YR3 A;  2R8J A;  3E2E A;  1H2V Z;  2QYC A;  3UQS A;  5EHH A;  1KLN A;  1SUQ B;  1XC9 A;  2AWZ A;  4B9N A;  2ZFH A;  2JC0 A;  4JV5 J;  4NMX A;  1BQN A;  1G4C A;  3TOQ A;  2ADC A;  1RT7 B;  5EWF A;  2AZ1 A;  3Q2S C;  2KVI A;  1IJE B;  1SV5 B;  1M5H A;  4J9L A;  4I67 A;  2BAB A;  1V3S A;  1DTT A;  3KK2 B;  5FLX U;  2H54 B;  4USV A;  2YTC A;  4I2P B;  2PC6 A;  4DQP A;  1YBT A;  1OQ6 A;  1WKL A;  1MU2 A;  2DHA A;  5F9L A;  4CO2 A;  5HMX A;  2R8I A;  2RRA A;  3MM7 B;  4HKQ A;  3L3C A;  3VAG A;  2ERR A;  1CJK A;  2IJR A;  3DLG B;  3KHH A;  1H38 A;  4TNO A;  3PJ9 A;  2H1Y A;  1RTI A;  5AJ3 F;  2ZJR Q;  3WHI A;  2WHO A;  3OSN A;  1RWX B;  2C3M A;  2XTJ P;  3KK1 A;  2YKO A;  1PJ6 A;  3H8Y A;  2OSR A;  3DC2 A;  3F44 A;  3KJF B;  2F8E X;  2BE9 B;  5M2R A;  1D8Z A;  4ZVO B;  2MHE A;  1KOO A;  1M5V C;  4HTJ A;  3R5C A;  2VU5 A;  4CO5 A;  4X2B A;  4E98 A;  3LTO A;  1QJH A;  3SI8 A;  4ZP8 A;  4BC9 A;  3JSM B;  2VC0 A;  1L3V A;  3M9N B;  1RAA B;  3M8Q A;  1M5P C;  5BYQ A;  1Q4R A;  1S99 A;  5LOQ A;  5I42 B;  1GX6 A;  3DLE A;  2Z2M A;  3GV8 B;  5GMD A;  2BBE A;  4KT0 C;  3NL0 A;  3MR2 A;  2B4U A;  5KFP A;  2QZ8 A;  3DRX A;  1UWA A;  1N88 A;  2JLF A;  2RT3 A;  4A8Q A;  1LW0 A;  3UCG A;  1MN9 A;  1KKH A;  2IIH A;  3DRS A;  1CJU B;  2HFN A;  1JJ4 A;  4S0M A;  1WTF A;  2U2F A;  4F7V A;  3UD3 P;  2MQP A;  4L3N A;  4EGL A;  3SIP B;  4C48 A;  2VBZ A;  2DRA A;  4KJI A;  1R89 A;  3S8S A;  2HIY A;  4PWD B;  3VCD A;  1J5E F;  4J9Q A;  2ZE2 B;  2HRT A;  2YBV A;  2B9E A;  2B0G A;  3FJ2 A;  4NCB A;  2YNF A;  2M0G B;  2HK3 A;  1ZPW X;  3BR9 A;  2HQ3 A;  2V8G A;  3QLH B;  1WWH A;  4X4S A;  4DR2 F;  4YB7 A;  3LP1 A;  1TV6 B;  4ICL A;  3EDQ B;  3FCH A;  2CQH A;  4FYV B;  4FYW B;  1TUV A;  4QPX A;  2J0X A;  2UUC F;  1S1U B;  2I1R A;  2V68 A;  1Q95 G;  5HVG A;  1S6Q A;  3AFG A;  1LWC B;  3HFZ B;  4IFY A;  3NOG A;  5HAO A;  2XZW A;  5ETV A;  1Y9O A;  4ANE A;  5IS2 A;  1M5O C;  1A7G E;  4XDC A;  4JV0 A;  1MWY A;  5GAG U;  4JYA J;  4DN0 A;  5DS7 A;  2UU9 F;  2FJA B;  2R8G A;  3KLH A;  3R5D A;  1X8D A;  2UXD F;  2XC9 A;  3GP9 A;  3GYX B;  4ZP9 A;  2FZG B;  2VUG A;  1SQF A;  1RTD A;  1X7V A;  4Q0B A;  4DX6 A;  1R0A B;  3EXY A;  1UVM A;  2J7U A;  1HNW J;  4GRS A;  1U25 A;  2XS2 A;  4NZ7 A;  4UZB A;  1LKZ A;  1UVL A;  1OSD A;  1K0V A;  3OXG A;  1R8H A;  1VQK S;  4I1T A;  2DNO A;  1ZOT A;  2YXL A;  2ZWO A;  1H2T Z;  2XMU A;  2UUB F;  2Q6B A;  2V8V A;  1NSQ A;  2HHV A;  3GIK A;  1LW2 A;  2KM8 B;  3LQV A;  4EEY A;  1TK5 A;  1RAG B;  2ROP A;  4LF9 J;  2ZKU A;  5A8K B;  5ETS A;  5DDQ C;  4L73 A;  1KTQ A;  4RZR A;  2BW7 A;  3C15 B;  2MKK A;  3JYT B;  1NHU A;  1KHW A;  2VFU A;  4RKU C;  2F9J A;  1FD2 A;  2DH8 A;  4IOA Q;  4N41 A;  2P9G A;  4JOU A;  2GGP B;  2N4C A;  4IYQ A;  1FKP A;  2VB6 A;  3UWT A;  1OWX A;  3AA8 A;  4OYZ A;  3T1Y F;  1REV B;  2HWT A;  4ITS A;  2DCL A;  2WVF A;  2GHW A;  1PBU A;  3IS9 B;  2KFY A;  3KG0 A;  2BDP A;  1BXN A;  3GIJ A;  5D78 A;  3B4D A;  3MOZ A;  1NRK A;  3TVY A;  3UPF A;  2QE5 A;  4JI3 J;  4V1A k;  3QWP A;  3Q8U A;  1S59 A;  1F9H A;  2W7A A;  3NWG A;  2IBO A;  4TU7 A;  2VPW B;  4WTY A;  2V5H G;  1VCT A;  4L76 A;  3MWB A;  5KFT A;  2D3Z A;  3IBW A;  1RKJ A;  2FLO A;  3ISN C;  3EPG A;  4KPY A;  2WSE C;  3FC9 A;  3JSB A;  5KFR A;  2E5J A;  2HWI A;  2YWW A;  3G71 S;  1FJG F;  3J81 j;  3DRR B;  2N7Y A;  1VQ4 S;  4DUZ J;  1R27 B;  4EK2 A;  4WIQ A;  2LKZ A;  2UXC F;  1VQ5 S;  3QSY B;  1ZZN A;  4JI1 F;  1SIW B;  1S6O A;  1WF0 A;  3IBF B;  3HLU A;  3CUL A;  1N4L A;  1NJI T;  3ZZT A;  1OPZ A;  4TYA A;  3H4B A;  3P49 B;  2CA9 A;  3G86 A;  3ZZR A;  3RUB L;  3W61 A;  3HPO A;  4CLS A;  2C2Z B;  2EBG A;  1IM6 A;  1WOS A;  2HZC A;  5HLF B;  2GNK A;  2L41 A;  1PG5 B;  4HEA 9;  2VDH A;  4GKJ J;  1YRU A;  4RUH A;  5CYM B;  2DY1 A;  3AXK A;  5HRO A;  3TVK A;  4KGV B;  2EK1 A;  2PMH A;  3K89 A;  3LO3 A;  4B3O B;  2E44 A;  3R1H A;  3ET6 B;  2CPD A;  2IMO A;  4WJB A;  1U8S A;  5ETP A;  3KK3 B;  4F2R A;  3BO2 A;  1JLF A;  4NAS A;  2GQC A;  1U48 A;  2MSS A;  3TAR A;  1S10 A;  1JLE A;  4C11 B;  4ETZ A;  1Q78 A;  5LL6 d;  3BKF A;  4ZVE A;  1EHW A;  5EN1 A;  4TY8 B;  2U1A A;  2Y8Y A;  5CAB A;  2B4V A;  4MKY A;  3W5Y A;  3A8K A;  1N5Q A;  3WX8 A;  4G3I A;  4V19 J;  2R42 A;  2CJQ A;  2Z8Q A;  1EET A;  2G0I A;  3OFE A;  4KIA A;  3OJU A;  4YP3 A;  3ENW A;  1S1V A;  2HPU A;  3O2I A;  1J5O B;  3G8S A;  1YWX A;  1RGV A;  1K1S A;  1KFD A;  2RF2 B;  2E1M C;  3V6H A;  3CJ5 A;  2V9W A;  4A48 A;  3UD5 A;  1OJ4 A;  4F26 A;  1VBX A;  3VF0 B;  5DDR C;  2XY6 A;  1JLB A;  2BZ2 A;  2GAG C;  9RUB A;  3CVK A;  2HGM A;  1NB2 A;  3M8P B;  5HQ8 A;  1WJ9 A;  5I3Q A;  4WZM A;  1FDD A;  1WG1 A;  1YJU A;  3CJS A;  5F3Z A;  4QW9 A;  1OYD A;  4G1P A;  4RLE A;  2O66 A;  2AGQ A;  3MEE B;  2MGZ A;  2W2N P;  1Q53 A;  4I69 A;  4F4W A;  4XTT A;  1NXI A;  2YQ0 A;  5ETN A;  5FLX Y;  4WII A;  1JXV A;  4B3R F;  2KHC A;  1GAO A;  1JLC A;  2R7O A;  2MKY A;  4E2F B;  2C2M B;  2H5E A;  1RUS A;  5KFV A;  2G1H A;  2WAQ D;  4C98 A;  1AFI A;  1FK9 B;  1U1Q A;  4BCA A;  2CQI A;  2OJ3 A;  3MHY A;  1CS4 A;  3BBF A;  5D3G B;  4OI0 A;  1FVS A;  2O67 A;  4DWI A;  1Y0H A;  1SI9 A;  4NA1 A;  2CQC A;  4IO9 Q;  3IWN C;  4NLG A;  3W3S A;  2JFK A;  4USH A;  2IAJ A;  4DS5 A;  4XAK A;  2B56 A;  1R6Y A;  2YNG A;  2B43 A;  2F3J A;  1JXE A;  2DGW A;  2JVO A;  1QAI A;  3M9M B;  2NPF A;  1NKB A;  2MLZ A;  2ZNY A;  1SH3 A;  3N0V A;  5DGB A;  4B9T A;  2V34 A;  2VQF F;  1NCL A;  5CQG A;  2VPZ B;  3DDI A;  1DQ8 A;  4ECQ A;  5KG6 A;  1KC8 T;  4EO6 A;  3SCJ E;  2HVZ A;  2R2U A;  5LT5 A;  1XTZ A;  3ZO7 A;  3KLV A;  2J6T A;  4WYW A;  3VV2 B;  3IGN A;  3TAN A;  3S1T A;  5FD1 A;  1N8R T;  1H7W A;  1WC0 A;  2HBQ B;  3FSI A;  1FXD A;  1CLF A;  3F73 A;  2W7P A;  4OHW A;  2WB4 A;  3OFG A;  4YQW A;  4KSE B;  4P10 A;  5J2N B;  3QT7 A;  2HND B;  3RBE A;  3OHB A;  1T94 A;  3Q2T C;  2XBP A;  2VJV A;  3L7P A;  2WB1 D;  5DDP C;  3KLE A;  1RWV B;  5ETT A;  4QWB A;  4J9S A;  3D66 A;  4LIW A;  2C2E A;  3PRD A;  5IC6 B;  3IC1 A;  1F6T A;  3D1O A;  3MMJ A;  1I5O B;  1CBK A;  2RQK A;  4YOE A;  5J1E B;  4I0W A;  2B6A B;  3R27 A;  1WTB A;  2RUG A;  1UP1 A;  3FEX B;  1O5J A;  6FDR A;  4A8O A;  4QCL A;  4LRA A;  4NZ6 A;  5KFO A;  1XMB A;  1HR0 F;  4K4U A;  1H0H B;  5KFU A;  5J2M A;  3RR8 A;  4ZVT B;  4IRK A;  2VG5 A;  4IDK B;  4Y28 C;  1BQM A;  1UW4 A;  5GAD I;  1T11 A;  2Y3Y A;  5CCL A;  3C6U B;  4ILR A;  1U1P A;  1Y3K A;  3L09 A;  2E5G A;  3RJM B;  3CC2 S;  2QLX A;  2DGT A;  1RWO B;  2DGV A;  1X4A A;  2QL9 B;  4FXW A;  5F0U A;  3KG4 A;  1NJX A;  3N9U C;  3Q8Q B;  4ZIV A;  1RK8 A;  1N6Q A;  1IKY B;  3W65 A;  2ZBQ A;  4ZVG A;  1TAU A;  4H4O B;  4USK A;  2A1B A;  1RCO B;  2Z4P A;  1TK8 A;  3MPW A;  3KUH A;  2IY5 B;  2AX0 A;  5ETK A;  3NWR A;  4G1I A;  4QYR A;  3PKM A;  5KFX A;  4U7C A;  4CWB A;  1S77 D;  1Y10 A;  3TW0 A;  4RNH A;  1FTR A;  3VZI A;  1UFW A;  4IG3 B;  4R5P A;  1X4D A;  1EZZ B;  3CCV S;  2AD9 A;  3PIP Q;  3OVB A;  1DUR A;  2BAC A;  4HI2 A;  3FRY A;  4KH0 B;  3RGI A;  4R8U A;  3AD7 C;  4WE1 B;  2C2D A;  1LK5 A;  7FDR A;  1SJF A;  4HAC B;  1PC4 A;  4OV1 A;  2KI2 A;  1SC3 B;  2FY8 A;  2HS0 A;  2IYG A;  1BUX A;  3MMC B;  1HWI A;  2HMI B;  2V2V A;  2RML A;  2M8H A;  3Q86 A;  1MSW D;  3MED B;  3G8Q A;  4C7Q A;  4RX6 A;  2HHX A;  4LFA J;  4CT8 A;  2IJN A;  1XR6 A;  2HK2 A;  1WHV A;  4N8N A;  1PYS B;  3FSX A;  3R6G B;  2NYI A;  2EWH A;  2QA4 S;  3EGV A;  3V4I A;  2WVC A;  3BKT A;  4HYK A;  5F8N A;  2XI3 A;  4H54 A;  5DZ7 A;  3MEG B;  3LGN A;  3QT6 A;  3NNH A;  3CCR S;  2D41 A;  3FBC A;  5HBM A;  2F4V J;  1IBL J;  3HK2 A;  3UN2 A;  3HSD A;  3I9V 9;  4Q8E A;  3TP2 A;  4ID5 B;  1RWM B;  1TKT A;  4HR2 A;  3FEY B;  1U0S A;  3FCW A;  3PM9 A;  2R7Q A;  5EUH A;  1P1T A;  4FZV A;  1FDB A;  1WNE A;  1RAB B;  3RAX A;  2BRK A;  2Y1L B;  2Z56 B;  1K44 A;  4M5L A;  4UW2 A;  1C0T B;  5A8R A;  2ZDP A;  2DHG A;  1FJ7 A;  3HHL A;  1YI2 S;  1L5U A;  2CQ0 A;  3W9H A;  2OKQ A;  3G96 A;  3O3L A;  3ZNJ 1;  3KK1 B;  2QJ3 A;  3BSC A;  3DCA A;  1R3N A;  2QFJ A;  3KJN B;  3CC7 S;  3A3N B;  2VG6 A;  1IKX B;  2ZM6 J;  4CQ1 A;  5GAE I;  4RWW A;  1VQL S;  2H4W B;  1V3R A;  1X4E A;  1GFW B;  1RCX B;  2KG1 A;  1R7I A;  3WC0 A;  4FVC A;  4QPT A;  2MY8 A;  4DXL A;  1YQH A;  2ZH6 A;  4CI0 B;  1YJ9 S;  1RI7 A;  3H7H B;  4NRU A;  3PYD A;  1B70 B;  5CCM A;  4YN3 B;  4CTA A;  5HQM A;  5KFD A;  3ZTS A;  4X62 F;  2ASL A;  4B3M J;  3TR5 A;  2AU0 A;  5IT0 A;  2DPI A;  4OYP A;  4JV2 A;  3MCS A;  1LWX A;  2B8P A;  1RIS A;  2B7B B;  1VC5 A;  3SV3 A;  5GAH I;  1FEE A;  1FRL A;  1VRT A;  4I6A A;  2GZO A;  1VDH A;  2M9K A;  3AOA A;  3IG1 B;  3UDV A;  5HQL A;  3WBZ A;  1VGY A;  4O3N A;  3EVM A;  1QE1 A;  3W64 A;  5CD4 A;  1HMV A;  3E01 B;  4IOB A;  5CYQ A;  1RBA A;  2D3O 1;  1JQG A;  2IPO B;  2OPS A;  4RU2 A;  4M5H A;  4F3O A;  4KFB A;  2HSE B;  3TO8 A;  2R4F A;  2BYC A;  2RSQ A;  4Y2M A;  1S9G A;  4ECT A;  2AGP A;  1Q8K A;  2LXF A;  2PFD A;  1S6P A;  4DSL A;  3BF4 A;  2LU2 A;  2LQ9 A;  4EZ6 A;  2UVR A;  3K5P A;  2LA4 A;  3MM6 A;  3GPA A;  3POT A;  3SXL A;  5JVH Q;  2XQC A;  3ZZU A;  2VQE F;  1SQG A;  2RQC A;  4O4G A;  3PRB A;  3QZ7 A;  1XNR F;  5J2P A;  2MPU A;  3NMA A;  1N5T A;  2ZBC A;  3V6D B;  1FRJ A;  2FY1 A;  2FVP A;  1Q5Y A;  1Q82 T;  2FGO A;  3QRP A;  2W9C B;  1QLN A;  2XSF A;  4HH1 A;  1VQ9 S;  4M1K A;  3D5M A;  2KXF A;  1NAQ A;  5F9N A;  4TLR A;  1HNV B;  2QFI A;  4KHP F;  1IVZ A;  5HO4 A;  1S6Q B;  3UVJ B;  3K59 A;  1ZM2 A;  4FPI A;  2MKI A;  3GCX P;  4IFY B;  2ACM A;  3WIV A;  4DPT A;  2V50 A;  4LVN P;  1JLG A;  1Q8B A;  2HVE A;  2G4B A;  4NI2 A;  3MM9 B;  3CJ8 A;  2IYI A;  5B0A A;  4I6Y A;  4KC5 A;  2QA1 A;  4F04 B;  1LOU A;  3Q8Y A;  2FVQ A;  2XMW A;  5JVG Q;  3N6L A;  3J7A 1;  4FF3 A;  3HVT A;  3FEZ A;  1T9Y A;  2CNK B;  2V4J B;  2A2D A;  2YKN A;  1JK9 B;  1RU2 A;  3JAM U;  4YDD B;  5IC4 B;  1FDN A;  4PEO A;  3CUN A;  1TKZ B;  2VA2 A;  1ZM3 A;  1EKR A;  3VVT A;  2DVI A;  1HQU A;  1RU1 A;  3NGS A;  5L1L A;  1H74 A;  2XZT B;  3UFC X;  1HNZ J;  3J7A N;  1DLO A;  1F2H A;  2CJY B;  1H3D A;  2QL5 B;  4D3G A;  1TL3 B;  1T9X A;  4OZJ A;  1RP5 A;  3DOM A;  3BSN A;  4Q5V A;  3HHL C;  3M1V A;  4RWX A;  4MFB A;  3QZ8 A;  4DR2 J;  4DX5 A;  1I6J A;  2O1P A;  1H73 A;  4ZIW A;  1X5T A;  2AJ1 A;  1VQ8 S;  4FP9 A;  6FD1 A;  2VJU A;  4WPA A;  5M2U A;  1FKP B;  5J1N A;  4ZIT A;  3QO9 A;  2UUC J;  3U27 A;  4C3M A;  2HHW A;  1VBK A;  2FLL A;  2K2P A;  3HVR A;  5A0Y B;  1GT8 A;  4Q7A A;  3PZP A;  3GJR B;  2J9E A;  2R7X A;  2ZH9 A;  5EWG A;  1Q8I A;  5LSR A;  3HJV A;  1P1L A;  3DGV A;  3TQE A;  3I4H X;  1T3N A;  4LSL A;  3KHL A;  1R6V A;  3L7U A;  4RW7 A;  3VAF A;  4F02 A;  1E6V B;  4LF5 F;  3KLF A;  2AYM A;  2XYH B;  4UF4 A;  4YB1 P;  2UXD J;  2ZBP A;  2K06 A;  1ZBT A;  5U47 A;  4EBC A;  1ZM9 A;  2JEF A;  3I96 A;  1X60 A;  4C8L A;  5LMU J;  3PW4 A;  3CCU S;  4DPU A;  3L9Z A;  4WU3 A;  2QC3 A;  3KJV A;  1RT6 A;  4M5D A;  1YJW S;  4IFV A;  3L4B C;  2MJN A;  5FDL A;  3DRP B;  3G6X A;  1F5B A;  4IO1 A;  3CJR A;  4ZA1 A;  4LIR A;  3AJ2 A;  1C1C A;  3T6B A;  2COL A;  4HT7 A;  2V67 A;  3VHQ A;  4FVM A;  5K8P A;  3Q83 A;  3IAS 9;  3VGU A;  1WC3 A;  2UUB J;  3IN5 A;  4ECU A;  3D3B J;  5D0E A;  4RO0 A;  2XLJ A;  2KH9 A;  4UOC A;  2RKI B;  1XER A;  1EKS A;  4LRE A;  2XG8 A;  3BO3 A;  1WF2 A;  1SQE A;  4WF9 Q;  2LA6 A;  5LJ5 Y;  4XPE A;  1PBA A;  4QWC A;  2DD8 S;  3KXD A;  4C6A A;  2BE2 A;  5AT1 B;  3CF5 Q;  4KKO A;  4B02 A;  1X4C A;  1HAR A;  2ZVS A;  4Y00 A;  3HFV A;  3IP0 A;  2YX1 A;  5C24 B;  1RDR A;  3T1Y J;  4J9U E;  2KO1 A;  3CDU A;  1W2B R;  2D9P A;  1S0N A;  1HWL A;  4ZKA A;  4JI6 J;  3LP2 B;  3TA0 A;  1S49 A;  3H98 A;  2YPZ A;  2OLW A;  1VRU A;  2WW8 A;  4X84 A;  2WW4 A;  2AIR B;  2MQM A;  5KT2 A;  2YPY A;  3AJD A;  2YWF A;  2EG1 A;  2YQ1 A;  2BJ9 A;  1VIO A;  1BE4 A;  4MKB A;  1SJR A;  1NME B;  3KOA A;  3GIR A;  5CH7 B;  5HAT A;  1RT3 A;  1UEV A;  3M2R B;  3MEK A;  2B3T B;  3KMQ A;  2YNH B;  3W5X A;  4FS1 A;  4JB8 B;  2GML A;  1EJ7 L;  4AUK A;  5ETQ A;  1T3O A;  4OHX A;  4ZPT R;  2C3Y A;  2V6A A;  1WC1 A;  4CH1 A;  4UY8 T;  1EET B;  2FB0 A;  1FJG J;  4P2S A;  4GMK A;  2JEG A;  2YWG A;  2H65 B;  3M05 A;  4L72 B;  1RT7 A;  2MTL A;  2QLW A;  4P52 A;  4UUX A;  4YHH F;  4JI1 J;  4RW9 B;  1VQS A;  1SV5 A;  2HFU A;  2B8Q A;  1RBO B;  4CLT A;  2R2T A;  1VMB A;  3CME S;  4DV1 F;  1UTA A;  2F8M A;  4I2P A;  1VJQ A;  4JI4 J;  5GAD U;  1TZ0 A;  4LUB A;  2IA6 A;  5KG7 A;  2E29 A;  4CM2 A;  3I0S B;  2X7I A;  1BC6 A;  3G87 A;  3DLG A;  1UPP A;  3ISN D;  2GVZ B;  3AQP A;  2CZ4 A;  4JP8 A;  4NEY A;  1YJV A;  5F8I A;  4KYZ A;  2ZH8 A;  2E5L F;  1FWP A;  4CH7 A;  4LVO P;  1JLC B;  2AX1 A;  2DNH A;  4CLK A;  4A8F A;  2CPJ A;  2MQO A;  2X3D A;  3J80 U;  1Y5N B;  1QSY A;  4Z7C A;  3EPI A;  2LEP A;  4I7F B;  1M1G A;  2NPI A;  2BKN A;  3JSM A;  4I6W A;  4J90 A;  5I42 A;  2DIV A;  1UPM B;  4KQZ A;  2LQJ A;  1AA1 B;  3H5S A;  3D0I E;  5B0G A;  2ZHA A;  4DR1 J;  2EFP A;  1B3T A;  3ENQ A;  2YWK A;  5KFB A;  1FES A;  1HBM B;  4A8W A;  3I87 A;  4RW8 A;  2ZZM A;  1RTJ A;  1OS5 A;  2XMM A;  1IBM J;  4M5N A;  4DDF A;  3AOD A;  2W4D A;  1XR5 A;  3MTK A;  1ZAW A;  3CD7 A;  1UVI A;  3MM5 B;  2KFN A;  2D1C A;  3CCQ S;  2FVS A;  4HT5 A;  1VQO S;  3ZTR A;  2DKO B;  1R8C A;  1NUE A;  4PWD A;  1NK7 A;  4ECW A;  4AL6 A;  3NP5 A;  2I38 A;  1F3V A;  2ZE2 A;  4GVL A;  4ZDN A;  2G13 A;  4J7C A;  1OO0 B;  1S12 A;  2VPY B;  2DXD A;  1RJJ A;  4MKV A;  4RNM A;  5F3T A;  1PC5 A;  4OJG A;  3F41 A;  4RUB A;  1QDU B;  3RBX A;  2HZA A;  3IM8 A;  3KNG A;  3TAM B;  3LAK A;  1F9F A;  1SC1 B;  1TV6 A;  4P72 A;  2AGO A;  4WTO B;  3F56 A;  3MEC B;  4IQX A;  4ZPV R;  4OYM A;  2KU7 A;  3RR7 A;  2QT7 A;  5LM7 E;  2A3J A;  1S1U A;  4Q8F A;  1NLK L;  1ITP A;  2CQ4 A;  2BR0 A;  2AJ4 A;  4ZS6 A;  4NWB A;  3NG8 A;  2DEJ A;  3K0J A;  2X3G A;  4N47 A;  1LWC A;  3HHK A;  1RAC B;  3CGI A;  4RU9 A;  4FNH A;  2MEW A;  3FMB A;  5T41 A;  1HBN B;  3SSQ A;  3NNC A;  2CFX A;  3ZZZ A;  5J2M B;  3BYR A;  2YNI A;  1YJN S;  1K47 A;  5C42 A;  3NBP B;  2BM1 A;  3CCL S;  1BQM B;  2OP5 A;  1HQ2 A;  2OPQ A;  3RW6 A;  1ZA1 B;  2VQF J;  3N5B A;  1EP4 B;  3K8W A;  1R0A A;  4KBI A;  3CMA S;  2BE7 D;  2BQR A;  3MUR P;  3ZZY A;  2W01 A;  1KQF B;  3KUE A;  1N6Q B;  1D09 B;  4B9S A;  2V69 A;  3CJ4 A;  3NS6 A;  1T9T A;  3GSD A;  1GMW A;  1WSV A;  2JEI A;  2QSF A;  4OL8 A;  3MTJ A;  1IBK F;  4AE5 A;  5GAH U;  4NXN J;  3NMR A;  3TAQ A;  5A8K A;  1HNI B;  4CLF A;  1S79 A;  3M7V A;  1MRO A;  3BN4 A;  2R2S A;  3JYT A;  2HVI A;  2O3D A;  4YY3 J;  3D6T B;  4O44 A;  1UFK A;  4K0K F;  2D7S A;  2F9D A;  2GGP A;  2LVW A;  4AL5 A;  4IG0 B;  4N77 A;  1NBE B;  3MOJ B;  1EB0 A;  4U96 A;  3G9C A;  3IA0 A;  4ECS A;  3PHT A;  4R8U B;  2NXJ A;  2LFV A;  4PUO A;  1REV A;  2Y1J A;  1IKW B;  4ES3 A;  3J7Z T;  4DF8 A;  3EX7 B;  2ZH3 A;  1DAX A;  1O51 A;  3IS9 A;  1N5V A;  2P6T A;  3TX0 A;  3IGV A;  1OPI A;  3GYG A;  2RD5 C;  3KLI B;  1HR0 J;  2V4Q A;  3NRB A;  2MY7 A;  4NRT A;  4LF4 J;  3DRY A;  4NL5 A;  4TLQ A;  2N3L A;  3IXQ A;  1RAE B;  4TVA B;  2QLB B;  3GLJ A;  4ED8 A;  3OXL A;  4LBI A;  2DTJ A;  1U45 A;  4ILL A;  2R7U A;  3N79 A;  1NJZ A;  2YKA A;  2H48 B;  4DR7 F;  1I94 F;  4DR5 J;  4RBU A;  2MHN A;  2JDJ A;  2C1E B;  2HQD A;  3GTY X;  1HL6 A;  2C2N A;  4UOG A;  4ZLJ A;  3VGT A;  3CPW R;  1VQY A;  4URG A;  4YEA A;  2CDQ A;  2KJV A;  5FJ4 A;  1IM4 A;  2PI5 A;  3EIC A;  4U7U D;  2G2Z A;  2J0Q D;  2FJX A;  2Y1I A;  1FNX H;  3NAI A;  4P7V A;  5KAK A;  3MAA B;  1CJV B;  3HHL B;  2AYE A;  4B9M A;  3ZTQ A;  3V6J A;  5KFW A;  2FZC B;  2Y8W A;  3DLB A;  2BX6 A;  2UXB J;  1NU4 A;  4CO3 A;  4JI7 J;  3P3D A;  1HHQ A;  5CYM A;  2RB7 A;  4DZ6 A;  3S01 A;  4DV2 J;  2CPX A;  3Q22 A;  2W1B A;  3QAU A;  4Y3C A;  5SZT A;  2W2P P;  3PFE A;  1DQA A;  3ET6 A;  3T19 A;  2FPH X;  2AW0 A;  1DHM A;  4ZP7 A;  1MML A;  3CWJ A;  5D4O A;  4K4Z A;  2OEJ A;  1KFS A;  4KH1 B;  1WAC A;  3CE8 A;  2YWE A;  2LLZ A;  4CM0 A;  1UZH A;  2ZBI A;  5I3P A;  5AXK A;  3GWC A;  3CJQ A;  4UT4 A;  4C11 A;  2DNN A;  1TAQ A;  2DO0 A;  1JWW A;  2ZZT A;  5E3A A;  2BOA A;  4TY8 A;  1Q5V A;  3QIP B;  3LAM A;  4K4Y A;  3N01 A;  3IRX A;  2DJW A;  4C8Z A;  2FC9 A;  2DIU A;  3GV5 B;  5ADZ A;  2XMJ A;  1WF1 A;  3LUY A;  5DQI A;  4F0H A;  3H2L A;  1FF2 A;  3W9I A;  2E1P A;  3BJY A;  1J5O A;  2VAS A;  4U9R A;  1UMJ A;  1RHK B;  2KM8 C;  2RF2 A;  5GVQ A;  3ETM A;  3NKY A;  1WHY A;  4KGZ B;  1TMJ A;  2RRN A;  5F41 A;  4DFP A;  3M8P A;  1K0T A;  4O23 A;  4QIG A;  4DR4 F;  2ZVI A;  4M63 A;  2C2K B;  3HZE A;  4QBU A;  1XQI A;  3MEE A;  3T1H F;  2VIH A;  2XO6 A;  3P8B B;  4ID8 A;  2XLK A;  2QMU B;  3T5H A;  1KHV A;  4UY8 5;  2CJ9 A;  2GIQ A;  1ROF A;  4AYB D;  3MCN A;  4NLT A;  4NLR A;  4X62 J;  3M30 A;  2HS3 A;  1FK9 A;  1JXL A;  3K17 A;  4WP3 A;  2WON B;  1YGY A;  3CJK B;  2NRE A;  3J7Y U;  1DBD A;  3ZTO A;  4MMO A;  1Y7P A;  3ZNU A;  3MDF A;  3EGN A;  3HHE A;  3FQL A;  4ER8 A;  1X31 C;  1KQG B;  4JI0 J;  4C0B A;  4URS A;  4ECZ A;  2VBY A;  3DFE A;  4IOC Q;  2PE8 A;  2RHS B;  3DXB A;  2YKN B;  2CRL A;  1PKU A;  2IC3 A;  2KG0 A;  2DXF A;  4PR6 A;  2VFR A;  4LMZ A;  1ZAX A;  2MKH A;  1G7C B;  1FXL A;  2M3D A;  4BBY A;  3H42 A;  1WEX A;  4NLU A;  4LF6 F;  2E7W A;  1W7W A;  1RAD B;  2CQP A;  2BKO A;  1YG0 A;  1WI6 A;  2VQE J;  1YTY A;  2H51 B;  3T1A A;  1D8Y A;  4OIX A;  3C14 B;  4OZ5 A;  1XNR J;  4MFB B;  3R7S B;  1R8A A;  1HHT P;  2DEI A;  4CIO A;  1UA0 A;  3CW2 C;  3RBD A;  4Z37 A;  4JI2 F;  4KY3 A;  1Y11 A;  5J2N A;  3QO9 B;  2HND A;  3J81 Y;  1FRI A;  5E2Q A;  4FYY B;  2KKH A;  4DV6 J;  1T95 A;  2J7W A;  1G2E A;  4EO8 A;  2VHG A;  3R5A A;  4WU2 A;  3QBC A;  1S9F A;  1U47 A;  1QSL A;  3ZZ0 A;  3S6E A;  4NCG B;  4ECV A;  4U6P A;  4O3O A;  2N7C A;  4WFZ A;  1FER A;  2MDA A;  2VZ9 A;  2BAN B;  2G0C A;  1P8G A;  5J1E A;  2B6A A;  2PII A;  3MPD A;  3DMJ B;  3HSZ A;  3TX8 A;  3PFO A;  3TZX A;  2OEL A;  1DTQ B;  1F5C A;  4QWE A;  1QAJ A;  4ZPC A;  1XMQ J;  3R1L A;  2KZZ A;  4FN5 A;  3BEG B;  4IDK A;  3CIZ A;  3DOL B;  4MIW A;  3I5A A;  3D1Q A;  1NKC A;  3C6U A;  3BBB A;  2KRB A; 
#chains in the Genus database with same CATH homology
 1FWP A;  1FFG B;  1FFW B;  1FFS B;  1A0O B;  1EAY C;  2LP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...