2HLTA

Solution structure of bacillus subtilis acylphosphatase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acylphosphatase
publication title Solution Structure of Bacillus subtilis Acylphosphatase in free and bound states
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 25
structure length 91
sequence length 91
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hltA00
4OJGA 2EW9A 2ROGA 2XMJA 1N5QA 2XMWA 3I9ZA 4OIXA 2GO8A 1Q8BA 2ZDOA 3LGNA 2L3MA 2XMTA 5B0EA 2IFXA 3HF5A 3BF4A 3HX9A 5B0FA 2RU9A 1U7LA 1WD6A 3BDEA 5A6WA 5T7LB 3TNVA 2HQIA 1RJJA 4DL0C 1Y3JA 1JK9B 1GXTA 1S6UA 1URRA 3BN7A 4F67A 3KNGA 1FE0A 2GA7A 1OQ3A 2XMKA 4Y2MA 5B0BA 3BR8A 2KT2A 2KYZA 3HHLD 3QGPA 3E8OA 4HL9A 3BB5A 2QIFA 1MWZA 1AFJA 4A4JA 2KKHA 4ZOSA 5B08A 4HI1A 1TR0A 2ACYA 5K9FA 1FD8A 2HLTA 1SB6A 5A6PA 1R6YA 3TOQA 4HI2A 3GZ7A 1FE4A 1XBWA 2W4DA 1OPZA 1Y9OA 5B0DA 3IWXA 1X0PA 4OJ3A 1KVIA 2OMOA 1P6TA 4NPOA 5B0GA 2AW0A 2ZDPA 3BGUA 2ROPA 1TL5A 2N4DA 4A46A 2FTRA 2LDIA 3HHLA 4FNHA 4DN9A 1TL4A 1X7VA 2K1RA 3VTIA 1IUJA 1N5TA 3CJKA 5KAKA 4A47A 2GCFA 2AP6A 2ASYA 2Q3PA 2W4PA 4DPOA 2BJDA 3HFKA 4OJ1A 1YRXA 2XMVA 2BJEA 1YJRA 1YJUA 2LQ9A 2FB0A 4OJHA 2IYIA 2AJ0A 1Q4RA 3F44A 4HH0A 3HDSA 5F0UA 1CPZA 4Q2LA 3FRYA 1YJTA 4YDXA 2IYGA 3TRGA 1P8GA 2XMMA 4ZA1A 2OP5A 3KG1A 2W4CA 2QYCA 1CC7A 3IWLA 4U9RA 1TZ0A 4EFAC 2N7YA 1Q53A 3HHLB 1AW0A 2FHMA 2K1RB 2JDJA 2K7JA 4Y2KA 1Q8LA 1S6OA 2QLXA 2RMLA 1K0VA 2PGCA 1QUPA 2FIUA 2BYCA 3MZIA 4YEAA 2HFOA 1VQSA 2K2PA 5T7LA 2LQBA 3KG0A 3WDOA 4A48A 2OFHX 3BM7A 1FEEA 1OSDA 1X8DA 1FESA 2K7KA 4Q2MA 2OKQA 1YG0A 2G9OA 2HIQA 2OAUA 2AJ1A 4QOTA 2QLWA 3LGMA 5F0WA 2GGPA 3K7RA 2XMUA 2LXFA 2ROEA 5B0AA 1MWYA 1V3ZA 1GXUA 5B0CA 1N5VA 1ULRA 1KVJA 1SI9A 3LO3A 2CRLA 1LQ9A 1YJVA 1FVSA 3T9NA 1FVQA 1VQYA 5B09A 1APSA 3KKFA 1Y0HA 1CC8A 2OD4A 3UDCA 4FNIA 1Y3KA 3FGVA 1JWWA 2N4CA 3MCSA 2VV5A 3FMBA 1OQ6A 2PD1A 3QMQA 3CJKB 1TUVA 3DCAA 4NL5A 2BBEA 2VH7A 2HFNA 1W2IA 1N5SA 2RSQA 2GGPB 5IXUA 1SQEA 2HLUA 4HH1A 2GFFA 4Y2IA 1KQKA 2BUNA 2RILA 2KT3A 3HHLC 1AFIA 3DXSX 2OD6A 2GV1A 2OFGX
chains in the Genus database with same CATH superfamily
1KP6A 2W9BB 2YNIA 3DDIA 2AZ1A 3POTA 4ECUA 1N0UA 1EKSA 3FRZA 1NDCA 1F5BA 1FDBA 2HLTA 1UVIA 3DOKA 4WZQA 4KHRA 1U6FA 3W9IA 4ID8A 3CEDA 4HR2A 4RBVA 4UTGA 4E2FB 1RLCL 3IS9B 3MM7A 4K59A 2GVDB 5DETA 1JLFA 2ZVIA 1U24A 4I69A 3AODA 1O5JA 3QBCA 3VAIA 3DC2A 4I7FB 2J9CA 4Y00A 5KT7A 1JX4A 3BGRA 3OHBA 1RACB 5KFAA 1NCLA 3H25A 3MM5A 3MR5A 1PYTA 4TLRA 2M70A 3WHIA 2IC3A 4YR2A 4RNMA 3AJ1A 2LU1A 4W4MA 4QPXA 1KQGB 1CULB 2XO6A 3CMQA 2M8HA 4TKTA 3CC7S 1HNIA 1RT6A 3RRGA 2JC0A 2CVEA 4C8KA 4ZP8A 1C0TB 3CCTA 4ICLB 3M30A 4OHYA 4OMFG 2C2EA 2KHDA 1W26A 4PG7A 1BMQB 5CYMA 2IJNA 2VOOA 3UO0A 2CVIA 4UW2A 4DPUA 1KSPA 4EMDA 3G6ES 1TK5A 4B3RJ 3G87A 4A8XA 2F65A 1HWUA 5EWGA 2CJQA 1D3WA 3UD5A 3IMQJ 1S79A 4EBEA 4FYDA 1YJUA 4NA3A 1B99A 3OR2B 3KHLA 3CTRA 4BBYA 3QLHB 1PKUA 3RRHA 4DR7F 1I51B 3R6LB 2Y1LB 1M1HA 3DHWC 1BQNB 4NI2B 3M2RB 4E98A 3DHXA 4CO3A 2VFVA 2NREA 1FCAA 3V81B 1H3DA 4P7TA 3EMTA 1Z1ZA 1X60A 4YHHJ 1Y5IB 3E3XA 1RXOB 3J7Z5 2HNDB 4A8OA 4RW4B 4DR5J 3TX8A 4YB5A 4OV6A 2BW7A 1CEZA 5DJBA 1UJ6A 3TX0A 4QW8A 4LBHA 1X4GA 2XSJA 4QR0A 2MQMA 4DPXA 4URQU 3FEZA 1S9FA 3BB5A 3LPYA 4DV5F 2ZC4A 2U1AA 1W2BR 4L72B 4LQ9A 3GZ7A 1RISA 4WYWA 1YJ7A 1WG5A 3EE3A 2FTRA 1TL4A 3CJKA 4A47A 1IKXA 2FLLA 5K14B 4FXDA 2HEKA 3AOBA 4EYIB 2HS0A 1MN7A 3KK1B 3CJTA 4JI2J 1F6TA 4NASA 1QAXA 4GVBB 3WC2A 4RLEA 2JNJA 3CNQP 3N5FA 2Y9HA 4MJKA 2DGVA 3L09A 3OL9A 4ENOA 2CQPA 3MCSA 1UA1A 1FHTA 3NGDA 5A76A 3I5CA 4J90A 3AA9A 3MD1A 4WFAQ 4JI0F 3JAMY 3KJVA 4WP3A 1NK0A 5D15A 5IT9U 3Q86A 4WFBQ 3HVTA 4LFBF 3QWPA 3SSRA 2CAJA 2NUHA 1Y3JA 3N6NA 3QZ7A 4NXNF 1T3OA 2O5DA 3EGNA 1EETA 7FDRA 3D9BA 5L9NA 2FQQB 4N8NA 2AQ4A 1DHMA 2CPIA 1DJ0A 2HBYB 3H59A 4YN3B 4Y2CA 1YZ7A 4RUHA 4AUKA 1YJRA 5T41A 2VD3A 4K0KJ 4LR9A 2HVEA 3V6DA 2K3KA 2UUCJ 2JH3A 4C8OA 4OZ3A 2K1RB 1RYSA 3L7UA 2RDDA 1RT1A 1S9GB 1F2GA 1B3TA 4G65A 5F8LA 1KVJA 1ULRA 5L46A 2DNZA 3TZYA 3Q83A 1YDLA 4FF3A 2HAIA 4NZ0A 4LQ3A 3V4IA 2E5LF 1TL1B 3BGOP 2W2OP 3T6JA 4RWXA 4L73A 2H54B 4PAAA 1I94J 4FYWB 1SIWB 1PC5A 1NLKL 1RKIA 1OPIA 2OFGX 2G13A 1U4BA 2VBYA 2EKYA 1NZAA 1ICEB 1Q8BA 2UXCJ 3OVBA 1KOOA 3LOUA 2MKKA 2ZD1A 1JJ2R 3PO5A 3GIRA 2DR9A 4GKKF 3PHEA 4OI4A 2JL9A 1FD2A 1YITS 3MEEA 3UVJB 1MG7A 5F41A 1U8SA 1NB2A 3Q0AA 3A3PB 1WKJA 3SCIE 3HSDA 3HHLA 4EBDA 1FXRA 4OI0A 1HR0J 3HM9A 3BREA 4IUFA 2RRBA 5HROB 4KFBA 4Y2KA 1FRMA 2XGPA 3VCDA 4F26A 1LWXA 1NSPA 2B9WA 3GSDA 5FLXU 4Y2AA 2GHVC 2DR5A 1V5VA 4OYXA 1MSWD 2FY8A 3T5LA 2IVFB 5DG7A 2AYEA 3IR7B 2W8KA 3OUYA 3DDKA 3PCOB 2A10A 4MYTA 3NBPB 4Y2IA 1O51A 3T1AA 1M90T 4UF4A 3W3SA 1U25A 1HQEB 2U2FA 2ZKTA 1NK8A 3OR1A 4O3SA 2MKHA 1GK8A 5B0FA 1HNZJ 4RNNA 2C2DA 1VIOA 3TEGA 1R43A 3Q2SC 1ZYQA 4ZVQB 4ZMMA 1OS5A 5J2QB 2PC6A 1T11A 1X4HA 1X9WA 2CQGA 3US5A 2AX0A 5EWEA 1HI1A 2V9KA 4DR6J 3B8HA 5K8NA 4QPTA 1PAUB 3C19A 3FCVA 1VQMS 3AXKA 2R7SA 4K4UA 1PJ7A 2ZM6F 3EZ5A 1WELA 4ZVGA 5I3PA 1QAYA 4LFCJ 2E5GA 2GHPA 3O5TB 1OYDA 2ATLA 4DR7J 4FF2A 1FWKA 3VGSA 3TAQA 4M5DB 1NPKA 4EZ6A 2QX0A 3LGMA 1VRUA 3AOAA 5EGYA 3TI0A 2N82B 2QV6A 2V2KA 3FGVA 4QIFA 5C5JA 2CADA 2P6TA 4TQSA 2YX1A 2CNNB 5LJ3Y 1F9FA 4RU9A 3WIUA 1TV6B 1NJXA 2CPDA 2HRYA 4ZHRA 4QWDA 2CQ1A 5HJYA 1U0HB 4HTJA 3FBFA 3BF4A 3EXCX 5LJ5Y 1YJNS 1U2FA 4O3PA 4ZITA 2HGLA 3BR8A 3C6UB 2R2RA 1M5PC 4F3QA 2QA4S 4F0KA 1R8CA 2E29A 5C2GA 4DV5J 4KYZA 3CIZA 3ZNJ1 3TANA 3OL7A 1WDTA 4DQSA 2ROPA 3F73A 3A13A 4NMXA 4WFXA 3VTIA 2POKA 4OX8A 2WVEA 3QT5A 3S8SA 3OBIA 1URNA 4FF4A 2EK1A 4ID5A 4KGZB 4JYAF 5CD4H 1VQ7S 1PYOB 5ETMA 1Q95G 3E2EA 2DNNA 3BDPA 3QIDA 1YSJA 1FNXH 2QO3A 3BGLA 1JLCA 2LU2A 4ZK7M 3D68A 4ZP9A 3DLGB 5KG4A 2RF2A 4YY3F 3P5TL 2ZHOA 2XLJA 4WBFA 4QIWD 3KLIB 3C15A 2GW8A 3DLEA 5CZVA 1HFEL 3IAS9 1TP7A 3J80U 2R7QA 2V5HG 2YH1A 2ZBPA 3QIPA 2L41A 4B08A 1X5PA 3LGNA 4DU7A 4R5PB 3HX9A 4JI0J 4X4NA 3CJQA 4LVOP 3W2WB 5ETQA 1WEXA 1PC4A 4C8LA 1HIYA 2AX1A 5CYQB 4LFBJ 3CD7A 4K4SA 3MPDA 3UDEA 4NXNJ 1BE4A 2OI2A 4KT0C 2OIHA 2IM1A 3I0RA 3JSMB 1Q1KA 3D3CJ 1NRKA 1S1XB 2ALYB 1KBRA 4DFJA 1IWAA 2M5YA 2YNIB 3DMJA 3POTB 1VBKA 1J27A 5J2PB 1LK7A 4YDDB 2I38A 1JQGA 1MW7A 3ILOA 5HP1A 2R8JA 4Q0BA 2K7KA 3DOKB 4ANCA 4YUDA 5B0AA 3UE2A 1N5VA 3V5RA 3VAHA 3G8QA 3MM7B 1JLFB 1SCJB 1OQ6A 1VQKS 1SQEA 2QN6B 2FHKA 4J7CA 1Y11A 4X4SA 4A4JA 4CRJA 2H5EA 4QIVA 1NZ8A 3BGRB 1FKOB 1U7LA 5KG6A 4Q5VA 3ENVA 8AT1B 4WKRA 3UR3C 2JVOA 1NAQA 4GKKJ 2N3LA 2IC3B 4ED1A 3SDEB 2B9XA 4ZIVA 1X0PA 2MYFA 3DYAA 1S97A 1HNIB 4BLGA 2NXJA 4DOZA 1A7GE 1NM2A 3R7BB 3H4BA 5HN0A 3AD8C 5CYMB 1Z4UA 1WC1A 2I5JB 4BC9A 4FYYB 2R7XA 3GPAA 4J9PA 1CSJA 1OSDA 2AJ1A 1KHVA 1ZPVA 5IV3A 2K06A 4OL8A 4UOHA 1S6QA 3KKFA 2WVCA 3GIKA 5C42A 1RAFB 2HHWA 2HLUA 5HLFA 5CYJA 3LP0A 4KV8A 3RR7A 1FFSB 4DL3A 2MDAA 1AZSA 2YKNA 1GXTA 4QW9A 1KDNA 2ASLA 3QGPA 1QVGR 4IFYA 3PX4A 3I82A 3BPSP 3NOCA 2IAJB 3BJYA 2XS7A 2MQPA 3W60A 1L3TA 4JV1A 1E6YB 3BGUA 3SI8A 2AJFE 3IR6B 2VPYB 2ASYA 4CLYA 1DQ9A 1LWCA 3PKYA 3TA0A 2V6AA 5KTQA 3CC2S 4J5OA 3TJ9A 3B6BA 4NWBA 2YKAA 1FESA 3QJLA 5K20B 2B7BB 2JHEA 2GQ2A 3UCUP 3LO3A 3BYRA 3IA0A 3JS9A 3IRXA 4DF4A 1JWWA 2QMUB 2J9EA 3CJKB 3FC9A 1N4LA 3R5AA 2BE2A 2FZGB 3BGFA 4OX6A 4X84A 2ZH9A 2JEIA 3W8PA 1LW0A 1XR7A 2VOPA 5ETRA 1N6QA 3RW6A 4KPCA 2PA3A 3OLAA 2EBGA 4FKYA 3K59A 1XMOF 4IQXA 2KXHA 1B70B 3FVYA 3W64A 3ZO7A 3FQLA 4LF1A 3BQ0A 1WC5A 1NH8A 4LJMA 1WKLA 3TAMA 1KVIA 2DIVA 1K9MT 3I0SA 4OZJA 2YX4A 3JTNA 1MNEA 1UVKA 3BQ2A 4B3MF 5DQHA 3KJVB 4JV5F 3EGWB 3GV7B 2BJ9A 3SCKE 3LH2S 3HVTB 4DG1A 4K4TA 3T1HF 1M5KC 3DRPB 2XEXA 4JYAJ 1K0VA 2AYMA 2FIUA 3GR1A 4X64F 3V6HA 1SJQA 1EETB 2D1CA 4DFMA 3WC0A 1SI9A 2HW3A 2IDLA 3S1TA 5KFNA 4CLWA 2RJZA 3EYZA 4YY3J 4JUZA 2MZQA 4NLDA 4OYMA 1FT8A 2XYHB 4PG5A 2QMWA 3VV2B 2E9ZA 2XNQA 3BO3A 2MXYA 3HD1A 3Q8YA 1XR6A 3K57A 2GC8A 2AGPA 1G3OA 1RU2A 4IOCQ 1H6KX 1FRIA 2XMWA 4FN5A 4IRKA 2L3MA 1GX6A 2PN6A 3ZXWA 1R89A 4EO6A 1WD6A 2BJ1A 1RT1B 3M2VA 2C3YA 2VZ9A 3KJFB 1VQ4S 1ZS6A 4KH0B 5I4MA 4PXBA 1S99A 2UXBJ 2V4RA 5BYQA 2VG5A 5KFVA 1HL6A 3JAMU 5DDQC 1JLGA 4USVA 4L3KA 4KQZA 1HBMA 4LF8J 4ZPDA 2R2UA 1CVJA 3VAMA 3OTCA 1TKZA 4DZDA 4F0MA 1SQFA 5BR8F 2ZD1B 4EFAC 2FHMA 3NMAA 1ZTTA 2RKIB 5KFFA 2VU5A 2Y0SD 2YTCA 4DPTA 2HIQA 5F0WA 3KTQA 2YNFA 3MEEB 2QC3A 4DSEA 2NYIA 2H51B 1CJVA 3F41A 2VV5A 3UNYA 5JVGQ 1LXJA 2KJVA 1VK8A 1TVRB 2NXUA 4CYUA 1RA7A 3X3UA 1YX2A 4B02A 2BANA 4KFBB 3MEGA 5J2NA 1LV5A 2ZWOA 1RWPB 2EVZA 2VG6B 3MFIA 3MPUB 3RAMA 2VUGA 2XM3A 2ASDA 1R27B 4WE1A 1TKTA 1WF1A 1IBLF 4J37A 3EDRB 4DV0F 3UN3A 4PG8A 4DCOB 2V68A 3T9ZA 1DAXA 3HZGA 3OTOF 5L39A 4AE5A 4J9MA 1OWXA 1R8HA 1RWVB 2BABA 3OR1B 3VQTA 4EZ9A 1C2PA 4C97A 1YJTA 1P8GA 4PEOA 4OI3A 4YB7A 2D3ZA 1KHWA 1TMJA 1QUPA 3RB0A 5F9NA 3DRSA 3SCJE 2KHCA 1C0UA 3GP9A 1E6VB 1Q5VA 1I1GA 2DJWA 2DH7A 3M7VA 5H9EK 1WTBA 3E01A 3GR0A 1RBLA 4JI4J 2GGPB 1X4AA 3C8YA 4X62J 3DLKA 1HWLA 1EHWA 4KB7A 3I55S 2QJ3A 3SQGA 1FI4A 5CXTA 4K4YA 3HHDA 4P9SA 5H1SV 2VJUA 4GC7A 1OY9A 4G6VB 3T1YJ 3DI6B 3JSYA 1F5AA 2DEJA 1NPPA 1T3NA 1Q7YT 4A8QA 2QZ8A 2MQQA 4LSZB 3T41A 1RB0A 1IUJA 4R25A 2FJDB 1NKCA 4ES3A 3CCRS 4K2XA 2Z30B 3LWMA 4LF4F 1CPZA 2FHJA 3B54A 2ZJPQ 3NNAA 1T9TA 4FXVA 3S01A 3OSPA 1XEZA 1J5EF 7FD1A 3DU5A 1G6BA 2N7CA 3OVSA 1P1LA 2ZH6A 1U1LA 4PXCA 1WC6A 3T5HA 1PJ6A 2PEHA 2WVBA 5KFYA 1JXLA 4OI6A 4PUOA 3Q2TC 2C3OA 3SXLA 4MKBA 4PG6A 2C28A 5KFHA 2B4PA 3AD7C 2GVZA 1T9UA 1NSAA 4WIIA 5CAAA 3R9LA 3FSYA 4P2SA 1IXKA 3R7SB 3FBCA 3NS5A 2E44A 2UXDF 1WKKA 2LXIA 1AROP 3BBBA 4RW8A 4ZJOA 2F4FA 3TNVA 4ECQA 2DXEA 5KG3A 3C16A 2J7UA 2HHSA 5BYRA 2BQUA 1UETA 2RF2B 3PG9A 1TL3A 2XLKA 4RBUA 4PRFA 3C15B 3T19A 4NCGA 4UOCA 2CQ2A 3DLEB 1RT7A 3R5JB 4Y0FA 3SFGA 3NGUA 2LDIA 1UJ4A 2RH3A 3RGIA 3ZTOA 3RR8A 5HQMA 4KO0B 4C3MA 2MZJA 2Z56B 2QYCA 2OEKA 3TUPA 1Q8LA 3PJWA 4YEAA 3KHHA 1IKVA 2HK3A 3M8WA 2I8EA 1N34J 2MY8A 3VAFA 1GMVA 2UVVA 1IJFB 4OHVA 3CIMA 2IDEA 2J6TA 2IVMA 3RZAA 1NO8A 1L3VA 4I2PA 3K8WA 2VQEJ 2BOPA 1KVKA 2DNHA 3EGVA 4V1Ak 5KFDA 4ZPCA 3MTKA 3BEGB 4Q45A 2IY5B 5HP1B 2FJXA 4LVNP 3SQOP 4Q0BB 4NYZA 1FF2A 2HZAA 4ECWA 4NEZA 4E8UA 2QFJA 4QWEA 2V4QA 3H0PA 1S0VA 4HI2A 2YH0A 3M6UA 3TW0A 2ZNYA 3U1LA 2VKZG 2XY7A 4X66F 2X1GA 3G4SS 5HAOA 1N5TA 1MROB 4Q43A 3O8WA 4LF6J 1U09A 2HHUA 1CJUA 2QEXS 3PHTA 2NXEA 3N6LA 5DM6Q 1H0HB 4E0DA 1K73T 5BR8J 2GIRA 1N32F 3IC1A 2OFHX 2Z8QA 2HQDA 1S5ZA 4DBQA 3RB3A 2R7WA 1S48A 3CT9A 5G4DA 3DYAB 5I3UB 1DZ5A 1KLNA 3DGVA 2UUBF 1U02A 2EPIA 4P7VA 3NCRA 2BJ8A 3UFCX 4MTPA 2JSXA 3VALA 3A3OB 2HWHA 2MQ8A 5A2QY 3E8OA 3NLCA 5HJXA 4QJVA 1S6QB 2EFNA 1IBLJ 3HSZA 1CS4A 5C42B 1HARA 3UDVA 5K5MA 3OPKA 3LP0B 2GCFA 4DPOA 3W63A 2BJDA 1DRZA 4KV8B 2BACA 3LP2B 2VC1A 2IYIA 3HDSA 5F0UA 1N0VC 2YKNB 1WEYA 4WWSA 3I4HX 2HFUA 4M5GA 3RTVA 4CLUA 3B82A 5HSPA 4RW9A 2IMWP 3G6XA 4LSLA 1SL0A 3GG1A 2H3EB 3RYLA 4QYRA 1FRXA 1UJ5A 3FEXB 2A6MA 4DUYF 2KTQA 2W2QP 3WIVA 4LF7F 3I31A 2XHWA 2FJVA 2QLBB 1FJCA 3CO9A 1LWCB 2PA8D 2ZH1A 4DV4F 1KFSA 3DDNA 3DGPA 2J8AA 3CVKA 4QQBA 4YQWA 2FZKB 1RT5A 2HZVA 3N9UC 3P5BP 2OTLS 3CDAA 1HQUA 3R2DJ 3UCZP 3H7HB 3B78A 3IRXB 4WPAA 1G1XA 4ZVFA 2VBXA 3MEKA 1RHUB 5JVHQ 4O3NA 4MYUA 1IM6A 4HT7A 3NCPA 2I0XA 3ITHA 1LW0B 4KJIA 1RDRA 4N76A 3WBZA 4PCQA 1B0TA 1JNRB 2GX8A 3PNIA 3O1LA 3ZZTA 1T95A 1SVDA 2QLXA 2LA6A 4EEYA 1HNXF 2K2PA 2J9DE 1J5EJ 4L76A 4XTTA 4NRTA 3NG8A 5D6GA 4WJBA 2Y8WA 5GVQA 4HACA 1SUQA 3BKUA 3I0SB 4DL7A 2VFRA 2IRXA 4B9VA 4OI2A 2DY1A 3DU6A 4Z7CA 4WIQA 3IM9A 3MR3A 4GC6A 3EWGA 3OTEA 4DG1B 3F56A 3J7A1 1B7FA 2MB0B 2YQ1A 3RW7A 3MHYA 2XULA 2F8EX 2UXDJ 4H54A 2W24A 3BBFA 5HBMA 3CCZA 2WK4A 1Q0NA 1U1QA 2VIHA 4DQRA 2WTFA 2JZ5A 2J6UA 2A2CA 3NS6A 3FNNA 2R7TA 4J9KA 1R6YA 2A1BA 3DNCA 3TQEA 5ETOA 1H2VZ 4QZVB 5DZ6A 4M8LA 3T3FA 1X5OA 3D5MA 4RZRA 2BJEA 2X1BA 4ERDA 4M5LA 2DVIA 1Y5NB 5KG5A 4K4ZA 4OHZA 2B0GA 2NXCA 3M2VB 2DPIA 1Q53A 3KG0A 3HPOA 3KNAA 1VRTA 1DBDA 1IBCB 2MMYA 4J9SA 1V3ZA 3FBBA 3UCGA 2AGQA 3JTPA 2ZWPA 1JLGB 4AL7A 3D28A 2CQHA 3H2VE 1HBMB 3GFHA 3QJPA 4NCBA 2MKYA 1TKZB 3BQ1A 3LW5C 2KZZA 3ICLA 3LP1B 4GVLA 2K3IA 2WBMA 1ZOTA 2E1CA 4LRFA 4FS1A 1VQLS 1S12A 3DRXA 2IRUA 3Q8QB 3PIPQ 3GG0A 2E7WA 1RHQB 1CJVB 2UU9J 2V34A 2GZOA 3GLJA 4DHVA 1U45A 4IR1A 2OMOA 1P6TA 3BO2A 2XI2A 1UFWA 4A46A 3MUMP 1OMSA 1B0PA 1NK4A 3JQKA 4NYOA 2BANB 5J2NB 3MEGB 3PKMA 1Z2LA 5H9FK 2DCLA 4C6AA 3GONA 4J9UE 1RWKB 2UUAF 5GMDA 3H20A 3HP6A 2CQCA 2RMLA 5D4OA 4WE1B 1TKTB 1VLOA 2DNGA 5KT3A 3MCNA 4JV0A 2L9NA 3C14A 2N3OA 2EI5A 5LSLA 3Q8RB 2F5GA 2NLWA 5DS7A 2MGZA 5RUBA 4WU2A 5ADZA 5KG0A 1VBXA 2MZ1A 2GMJA 1KR4A 3RAQA 3DLHA 4V19X 2XYGB 1CJKA 1FFGB 2IFXA 1OY8A 3QRQA 2DXDA 1WC0A 3AQPA 4XPEA 1BHNA 2BV3A 3CJ4A 2VFTA 3NGRA 1FRLA 4F4ZA 3PRBA 1FRHA 5IWAF 4FPRA 1C1BA 2ZZTA 2CWKA 3UPFA 3FCWA 1QVFR 3IG1A 2OPPA 3QT7A 4DN9A 3SQGB 3M2UA 5D77A 2CIMA 2NPFA 3U1NA 4U8VA 3LGHA 2RRAA 1QTNB 2IYGA 5D78A 1T94A 4K4XA 2WW4A 2DHAA 4LIRA 4URSA 1RAOA 3WDOA 2BM0A 2XLIA 4CT8A 2JEGA 3GJRB 4K2JA 4CDIA 2WB4A 4EO8A 2Q66A 1GH8A 3BSNA 4A8YA 4K5RA 1YVFA 1EP4A 2LQJA 3CB4A 4DL5A 4C98A 3I9ZA 3H42A 4DV4J 1ACMB 1HBNA 2HQIA 1V9OA 1LW2A 1J5OA 4WYLA 3D6HB 2RHQB 4PUOB 1SJ4P 2BE9B 2GVZB 5IT4A 4J91A 4ZVSB 3V6JA 2AW0A 4Z7YA 3CCLS 3KMQA 3ISND 2ACMA 4NLRA 1VQ9S 5ETLA 5HMXA 4RW8B 1MLAA 2E7VA 4K8RA 2C2RA 4Q2LA 3VVTA 3IBFB 4U7UD 2LYVA 2O3DA 4DR3F 1I3OB 2EWHA 3Q8VA 5DO2A 2DO4A 2BKNA 1SH0A 2EK6A 2BRLA 1TL3B 1HNXJ 1JLQA 2UZAA 3MAQA 4USJC 3EXYA 1S1VB 1RT7B 2HBQB 3K5OA 4ATNA 1P9YA 1TELA 5E3CA 2HSEB 4CLLA 3H5UA 3PACA 1S0OA 2DISA 4ZCKA 2M52A 1IKVB 2PDAA 2VHGA 3KLFA 4RPFA 4RWWA 6FD1A 2DR8A 3THVA 3DLLQ 2VICA 2RIJA 1T9XA 2ZE2A 1R3NA 1Y9OA 4I2PB 4BWJA 3JYTB 4NXMF 1WTFA 2OSQA 2EG2A 3DLJA 5LXRA 3TJAA 2AP6A 4ZP7A 4I2QB 1M0SA 5J1EA 4M63A 5E7OB 4EYHB 3P6YC 4YDXA 4J9OA 2AZ3A 4O4GA 1FXDA 3IWLA 3NRBA 2E9TA 1IJEB 1ZBTA 1JLEA 3N5BA 4WTOB 1KLMB 4F4XA 1GTEA 1L3KA 3DLBA 1H72C 4GKJF 4TQRA 1HW8A 2XTJP 2YX7A 5DDPC 3J7YI 3T6BA 2ZH8A 1FNOA 4MK7A 1RQ0A 1AFIA 1CJUB 2QA4G 5GADU 1DURA 2HVZA 3BN4A 1RBAA 4ECYA 2F4VF 1F0XA 2YKPA 1GT8A 1Y5LB 4F67A 5BXIA 3ISNC 4D3HA 2VFUA 3KUGA 4J9NA 4TYAA 4U8YA 2NPIA 1S49A 3ZZOA 5CD4A 4OX9F 2GQCA 4NA1A 4DL4A 3R5DA 1U1NA 3ILIA 3JXOA 2PMWA 4X65F 2X3DA 2M9KA 2OP5A 2JLGA 5LXYA 4IKAA 5FIIA 1UW9A 3I4PA 3IR5B 1FJEB 2UUAJ 1FEEA 1NJYA 4KTQA 3H2LA 2QL7B 2WAQD 2LXFA 3MCOA 2A18A 5SZTA 1CS4B 3PEJA 2GMLA 3PM9A 2OGUA 4QU7A 4X4RA 4DSJA 2MQOA 3OHAA 1M1GA 4DV1F 4LRCA 5IOLA 1IBMF 4DI6A 1NUEA 2AYBA 1F5CA 1D1UA 1LOUA 4ZVRB 3V2UC 1HHQA 4KRWA 3F0NA 5CH7B 3NOGA 4ZVUB 2H1YA 4O0NA 4C7QA 3H90A 4LSLB 2LLZA 2MJUA 3BR9A 1FKPB 4I56A 4FS2A 2J6SA 3OTBA 4XPCA 4OZ0A 1VJQA 2W7PA 1FE4A 2LEPA 2CA9A 3D4JA 4CM0A 3LALA 1SIZA 3A1YG 4KGKA 5IWAJ 1BWEA 3KJQB 5A2QU 4DS4A 4UUWA 3DGPB 3UWTA 1UW4A 2DKOB 3RUBL 1PAEX 1WC4A 4CLSA 3CCWA 3M9NB 3M8RA 2AJQA 2QA1A 3ZC4A 2UVWA 4F02A 4EI2A 3DOLB 3PJ9A 3M6VA 1O0PA 5D0HA 1EZZB 2W9CB 3PJXA 4A8MP 1UFLA 2VBZA 4J9LA 1D8ZA 1VR6A 2PSZA 2O1PA 1ZM4A 3KHGA 5LSRA 4G1IA 3TZWA 3I6PA 3AHPA 5JXSA 5KFWA 2DXFA 3TZZA 2HWTA 1N5YB 1HWJA 3SYZA 3FDSA 3KDNA 1SC6A 1KD1T 1BWVA 2BQRA 1SV5A 2DGUA 2BRKA 3HVWA 4UOFA 2WVDA 2BJ3A 4HACB 4IFVA 1SUQB 4K4WA 1TK8A 3M8YA 4FP9A 2DRBA 5L1LA 2UUWA 3FMWA 3IFEA 2CPXA 4DLGA 5HBMB 4FKXA 3GTYX 1FX2A 4MKVA 4CLFA 1YIJS 3NXZA 2BYCA 2H4YB 4XIUA 1IBKF 1JXEA 4RW6B 2KRBA 4CLZA 4NLGA 4DWIA 4DUZF 1X4EA 2VDIA 3U1MA 1EX8A 1SKUB 3EM1A 5A8KB 1HHTP 1X31C 2OPRA 2OHDA 2E7XA 4J9RA 1RTDB 3K17A 1U1KA 4AQYF 3W2VB 1XMBA 4ZLLA 2NR0A 4MKAA 1X9MA 4LT6A 4WKYA 4O23A 1S7IA 1VRTB 4L6V3 1GAOA 4O3OA 3HMJG 2P9EA 1NXIA 2UV8G 1JB0C 1RK8A 1U8WA 1L5UA 2KG1A 2Y1IA 2BW2A 2DGXA 1HWIA 1RE1B 4NXMJ 2PI5A 3QGGA 4ZIWA 1WWHA 4JI6J 4LR7A 1C1CA 1AW0A 1SQGA 3MM8B 1W25A 2DTJA 1UMJA 4OQJA 4JI1F 4WXOA 4NZ7A 3KLGA 3UI3A 1FTCA 4GMKA 1N56A 1B0VA 5AJ3J 2HBZB 4OZ5A 1JXVA 4USKA 2XQCA 3IWNC 3MECA 3KK3A 2CZ9A 4F3OA 2R4FA 2UVRA 4B9LA 3MI7X 4ECZA 1VJWA 2UV8A 3OL6A 1EB0A 1I5OB 5GAGI 3HHNB 5JUMA 1PO6A 2CPEA 2PI4A 2V63A 1BD6A 2F4VJ 2BKOA 1VRQC 1XNRF 3RBEA 3G8SA 2FHOB 2UVUA 2V2VA 4EBCA 1GMWA 1XR5A 2GQQA 4TN2A 1WOSA 1R0AB 2W4DA 1CJTA 2X1AA 4I4BA 1TL5A 2VPWB 5ETSA 1S77D 2RB7A 1TKXB 2OO4A 1IKWA 1CJKB 3I56S 4WFYA 3ZZ0A 5C2CA 1HBUB 4XO0A 3FSIA 6AT1B 5IC6B 4ZA1A 3L9ZA 1NEEA 4X65J 4DU8A 2C2ZB 3CJ8A 4CH0S 2DNOA 1DTTA 4O3QA 3ENAA 2WSEC 2D3UA 1C1BB 4ZLPA 3L7PA 2V8HA 3PYFA 3IG1B 1VGYA 2OPPB 5HANA 1WHVA 4I0WA 2HMIA 4NE9C 2PMHA 3M2UB 3H40A 2DBBA 1B64A 1IBMJ 2VG7A 3ISZA 4IG0B 2YNHA 3PYDA 3MMAA 2KT2A 4PQUA 3CJ3A 1N36F 3A8IA 3KWMA 2XHCA 4ECXA 1XJWB 4WK3A 1PSDA 1LWFA 3W8GA 5ETPA 2X3GA 4DV3F 2ZBQA 3IBCB 5FDLA 1S1TB 1EP4B 4ZVPB 3AXMA 3MXHP 4F36A 2R7VA 2NXNA 1H98A 3V4MA 3RRKA 5HMWA 4HHJA 1SH3A 4CH7A 2IBKA 2HHXA 2FVRA 5KFCA 1FRKA 1LW2B 2B8QA 1U1MA 2YVSA 2V8PA 1HBOB 5C25A 2CJYB 2YY3A 2HG4A 1QAJA 1OO0B 2V4JA 2R8KA 2KZMA 3R97A 2R2TA 4DV6F 5H9FJ 4KHPJ 1IM4A 3CDWA 5E3AA 5HMYA 2GO8A 4IOAQ 3A8KA 1P1TA 3CCJS 1XTZA 3K5MA 2D3O1 1K47A 2Y0BB 5K8OA 2EFPA 1JLQB 3HXMA 4FPIA 3M8QA 1ZM2A 1EKRA 2B4VA 1XMQJ 2XCPA 2F8MA 1R8PA 2JRSA 1RT4A 4DX5A 1IKYA 2KVQE 4W92B 5ETTA 4B3OB 4WFZA 1RBOB 1R8BA 2ZVSA 4U67Q 1H38A 2PFFB 3THTA 3OLBA 2XMVA 2P6SA 3MPVA 2KXFA 3KG1A 1RAJA 2BEFA 3R7NB 4JI5F 2ZH4A 1VC6A 3MMCA 1M5OC 4KIAA 2EXUA 4R0JA 3DFEA 2ZE2B 2BE7D 2CPZA 4DR2F 1LXNA 1APSA 2B56A 1HHSA 2HNZA 2UUTA 2QG9B 2XWYA 1ZTWA 1UZDA 2MSSA 4ZVTB 5J1EB 2RSQA 3HT3A 2J0QD 2Z2ZA 2RILA 3UDCA 5CQGA 4O4GB 4B3TF 4OLOA 5D4NA 4IYQA 3MM9B 1QJHA 4B3SF 4AQYJ 2AEFA 5A6WA 4ZPVR 1RWXB 4Q44A 2XS2A 1FNMA 3OT9A 2RDIA 1YBUA 2OPQB 3NL0A 4PABA 4HLBA 2MHEA 2XMAA 4PQAA 4LF5F 2C2NA 1FDDA 4DF8A 2EC2A 3TR5A 2CJKA 6FDRA 1JNZB 5F8GA 1KS2A 2F9DA 4IO9Q 1HW9A 1XNQJ 1CULA 4FYXB 1U48A 1UEVA 2F8HA 4OYIA 4JI1J 2D74B 1UVJA 1T7PA 1RLDA 1LQ9A 3PR5B 1GEHA 3EUNA 1SL2A 2KN4A 2FLNA 4ZP6A 1C0TA 3TARA 4KBIA 4MIBA 4G1PA 3P96A 4DL6A 2ZH5A 4X4OA 1RT2B 4O3RA 4NLSA 1FTRA 2NZCA 2ZFHA 1SL1A 2HNYA 4J9QA 4HHHA 3HF5A 4NLPA 4A8WA 3ILLA 4UQTA 1YKWA 2JX2A 3IGNA 2L08A 4CLTA 4NLWA 1SH2A 5KFZA 4YP3A 1XNRJ 1FX4A 1MMNA 2HQ3A 1WOOA 2KH9A 3RU0A 4ED8A 1GTHA 2I9SA 2BVZA 1MU2A 3QLHA 3P4UB 5F3ZA 4KE5A 4FXWA 1BQNA 1HWKA 3PFOA 5E33A 4NI2A 4P2MA 5CCMA 2YNGA 3M2RA 2JC1A 1FK9B 3LTOA 4UY8T 3I32A 1NMEB 4AXJA 5HI7A 3RB6A 2ZC3A 4BC7A 3V81A 4DL2A 1R7IA 2CZVC 2QSWA 2ZUGA 1XK8A 2GNKA 3UNGC 2DR7A 2E5JA 1D0EA 2W2MP 2YQ3A 4JI3F 5ETKA 2E1MC 1EARA 3CDEA 4DZ6A 2QL9B 2KT3A 3OQ2A 4OZ2A 4C48A 2C3UA 5B0EA 4LF2A 4DR4F 2Q79A 1Q16B 1KFDA 4LUBA 4CQ1A 2YPZA 4ZOSA 5B7WA 2W25A 4PR6A 3MDFA 1NK6A 5GAEI 2QGFB 2JEFA 5D0GA 1SKRA 1U2CA 2IPOB 4DV3J 4ELVA 1V6HA 1SJ1A 4ANEA 3CDBA 1ZZFA 4GVBA 4ETXA 3D66A 1TKDA 1KTQA 4MIWA 2MLYA 3D1OA 2ZJRQ 2XG8A 3QATA 4DN0A 2VA2A 1SV5B 2QLWA 1JLAB 2DK2A 2FUG9 3HLUA 1WDDA 2KFYA 1VOMA 1Y0HA 3ONQA 3FMBA 5M2UA 3SV4A 2RS8A 1RTIA 1T05A 3CULA 3G8TA 1YRTA 3M6XA 3MCMA 1C4AA 3NAHA 1UVMA 1VQOS 5KG1A 3BO4A 2I6WA 3QGHA 1S6PA 2MTLA 2LDYA 2KM8B 1TAQA 5I42B 3R1LA 5J1PA 2APOA 3AQOA 3QGIA 3VWSA 4F4YA 2DHXA 2EFVA 1QD1A 2K1RA 2FVSA 3CJSA 4CH1A 2IA0A 4CLKA 3NGKA 1VHFA 2AJ0A 3I9V9 2XY5A 4RKUC 1AUDA 8ATCB 4G3IA 3KXDA 2CJ9A 3QNWB 5KOWA 5IM0A 2J8SA 3HKZD 3EGZA 3J81j 1YG0A 2VF3A 4H4OA 4USWA 2OPSB 4CIOA 2V8DA 4P75A 3M8PA 4N41A 4P2XA 3T9NA 1HD1A 4OV1A 3CWJA 3FEYB 1A6LA 3HVRA 5KG2A 1PILA 1VFJA 4F7VA 5KFJA 1OSCA 3M8ZA 3MMBA 1VLYA 2JJ4D 1YQHA 3KLEB 1K0TA 2MQLA 2B6AA 1C1CB 4OIXA 3I5AA 3QFWA 2HKEA 4B3TJ 2OTJS 3CJ2A 2DNYA 3SFUA 5G0RA 4OZ1A 5AT1B 2UP1A 3O44A 2Q1LA 4KY3A 2CJXB 2Y8YA 2KVIA 4MAKA 4DCPB 2ZBIA 1UTAA 1SKSA 2EFGA 3KOAA 3MFHA 2FVQA 5HROA 3HT0A 3FKBA 3R5CA 4IH7A 2RQCA 4LRAA 3SV3A 1KONA 2CFXA 4ES2A 4B3RF 2VKRA 2G0IA 3MM6A 2KL8A 1LEOA 1GQEA 2M3DA 3UQSA 4LF9F 1H73A 1JKHA 2VDHA 1K8AT 2E5LJ 2G2ZA 2MZRA 1U6BA 4NX9A 1HI8A 2DITA 4F4AA 4H4KC 3G2XA 1IQZA 1HLWA 1CJTB 2DRAA 4R8UA 2VODA 2JLFA 2VH7A 1IKWB 3MM5B 2YBVA 2HQCA 2GFFA 2G0JA 1W7WA 2EW9A 3TA2A 2LMIA 4YHHF 5F8IA 1RT6B 1DTTB 4DR5F 1F3VA 2FJBB 2Q43A 5L38A 3PX0A 3PO4A 3M30B 1M5HA 2R7RA 2HMIB 3D3BJ 4M5NA 5F8MA 5EUHA 2AYGA 3LAKA 3TUZC 1YBAA 2W1BA 4PZVA 5DGBA 3C6TA 5DQIA 2VG7B 3LF0A 2ZKUA 1T9WA 3MMAB 5ETNA 3H98A 3J7AN 1Q7LB 2DH9A 3TEHB 3AY0A 2DIUA 4PQUB 4MKYA 1NH7A 3GJSB 1X5SA 1G7CB 2MKCA 1K1SA 2HHPA 4UY85 5JJBA 2CQ0A 4NMLA 5E2QA 4UOGA 4JB8B 1VC0A 4QR1A 4JI3J 4ZPTR 4DX8H 4DV7F 4AL6A 2GV1A 2IJRA 3PIOQ 2XS5A 4L74A 3C6UA 4OYWA 3W1YC 5L8RC 3KUEA 3GV8B 1ZAXA 2DEIA 1FEHA 2X51A 1LFWA 2V4JB 3H5SA 4BDPA 2IA6A 2IRYA 2J9DA 2XSJB 3TOQA 2ZM6J 1U6ZA 3TO8A 2QLFB 1YI2S 2CYYA 2RUGA 2CPFA 2XBPA 1QLNA 2M0GB 3HI9A 1TL7A 4TNOA 2CG8A 5D8HB 3KG4A 4F04B 2FGOA 2IHR1 4DQIA 1N54B 5AE1A 4X4VA 2CQDA 3M8QB 3BYPA 3D0IE 1IKXB 2PT0A 1AYEA 4K0KF 4RJVA 3KLHA 2Y1JA 1RT4B 1IKYB 3CF5Q 4JI7F 2UUCF 5HVGA 3CC4S 3QJJA 4OYOA 1SJ3P 3IM8A 4PYAA 3M32A 1JLBA 3W2WA 2HRUA 3MTJA 4YFUA 1WORA 1N5QA 3MMCB 2XY6A 2W2NP 1JJ4A 1AT1B 3M9MB 2VA3A 3MMJA 3PW4A 1I94F 3D67A 2Z0GA 3AH6A 3TVZA 2QIFA 4O0IA 3RAXA 2UXCF 2ZH3A 1IN0A 3CD0A 3EPIA 2HNZB 3D0GE 2CPHA 5J2PA 3W66A 5IT0A 3IAM9 5DDRC 4ZVEA 3UN5A 2GS8A 1WSVA 3NCQA 3AJ2A 4OJ1A 4BHQA 2ZH7A 2HQFA 4N7TA 4K4VA 4QU6A 1U49A 3P45B 4IR9A 3G9CA 1GMUA 4N56A 1RWNB 5CCLA 1H74A 1RT3A 3FFIA 3HFZB 3ZZPA 2DGTA 3MD3A 4UUXA 1MMDA 1HR0F 5AXKA 1F1BB 2GAGC 1R0CB 2KJWA 3V6DB 1RYRA 1LWEA 1CLFA 4I1TA 4NEYA 2KT5A 4WCEQ 1FKOA 4JP8A 3RB4A 1QY7A 3V6KA 1WJ9A 4H4MA 3V4IB 3OXLA 1RAIB 1D9AA 2FJAB 4CI0B 1S72S 3SDEA 4ETZA 5KFRA 5AE2A 3KK2A 1UEKA 4UT4A 3ZNUA 2QT7A 1TFWA 1HNZF 4IDKA 2V67A 1NU4A 3ZTPA 1FWLA 2JFKA 2I5JA 2HNYB 5AE3A 1GX5A 4MMOA 2H5JB 4DDFA 5A0YA 3UW1A 2YWHA 2CXEA 3MR6A 4DR6F 2N7YA 3HHLB 4CP5A 4LF9J 2V94A 2B4UA 4F2SA 1OJ4A 2ASJA 1F2HA 1HNVA 1SJFA 3PZPA 3CMES 2FGCA 3GU0A 4ED3A 4LFCF 4L75A 1MU2B 2DGQA 4JBCA 3OVAA 4XDCA 4OZNA 4WP8A 2WONA 2E1RA 1REGX 4DV2F 4DFKA 2BUNA 2YNGB 1FA0A 3PW7A 2E66A 3IP0A 2RAQA 3NWRA 4CO4A 2NSBA 2ROGA 4N47A 3HHEA 2IAJA 3OUYB 5HVHA 1RJJA 4P52A 2MKSA 4FDFA 3DN9A 3NEKA 4Y2MA 1E6YA 5DGAA 4HI1A 4QWAA 5F3TA 2AD9A 1Q81T 3UDLA 4I6AA 1I6JA 5B0GA 1WNEA 4IH6A 2HFSA 2LKZA 2HGNA 2VB6A 2LCWA 3MF5A 2AKWB 3QRPA 1RSCA 2B8PA 5CZXA 2YKMA 2IVYA 3BM7A 1VBZA 4X4TA 4M5KA 2V0NA 3ULHA 3CW2C 2XMUA 5B0CA 1NKEA 2CNLB 1OYEA 1IR2A 5B09A 4LSNA 3MAAA 2DY9A 1U0SA 3EVOA 3AAWB 3MAHA 2HK2A 3FSXA 1RI7A 2XO7A 1N5SA 4EK2A 1VRUB 1RWWB 3M1VA 3NAIA 1LK5A 3SBMA 4PYDA 4RUCA 1BXNA 4OJGA 4CO0A 4DV7J 2XMTA 3H2UB 4I6WA 1OQ3A 4C8MA 1P9QC 4ZHRB 1MWZA 2J7KA 1N48A 3WX8A 2IBOA 4OJ3A 1RTIB 1T05B 3DRPA 3CCVS 4MFBA 2VONA 4RW7A 5KAKA 2DCUB 5HQ8A 2CJAA 4MK9A 4NLTA 3VR1A 4UZBA 1S6PB 1SBRA 2B43A 4NLVA 5IV4A 5C24A 1N33F 2PGCA 4CO1A 2VPXB 8RUCA 1D9DA 4CO2A 4ID5B 2ROEA 5U47A 4K7QA 4WF9Q 4TU9A 1WSRA 1X4BA 1FVSA 3GB0A 1OY6A 4TY9A 4JI7J 1TTHB 2P9GA 2NS1B 3UN2A 3M8SA 1JLCB 2Q6BA 3K5PA 2YWFA 4HDHA 3KFWX 1O8BA 3M4XA 2QLJB 2MKIA 2MZSA 1RHRB 2JFDA 4LRBA 1MMLA 2XMJA 4EGLA 1XMOJ 4M5IA 5D0EA 1RWOB 1T9YA 5IM0B 2XC9A 3OFGA 1S57A 4G1QA 4USUA 2R8GA 1TU0B 4ANDA 4EWTA 5AXNA 3GJTB 1RAEB 4H4OB 3QIPB 3M8PB 4C3KA 5A6PA 4B3MJ 1RGVA 4YS2A 4JV5J 1GMWD 1ZAWA 3MMBB 3T1HJ 4DX6A 1DLOA 4UQGA 2N4DA 3SIPB 2AV5A 4B9NA 4FNHA 3WX4A 4X64J 2B6AB 2RKIA 3I0RB 4KPYA 4AFFA 1VHIA 1O6XA 3FK4A 2KM8C 1WACA 5G0RB 4NLYA 2Y3YA 2YKQA 3DMJB 3NNCA 2LQBA 2XYPB 1WEZA 1XWLA 3NS7B 3T5JA 1WHWA 1TVRA 4PWDA 1KQSR 4QWBA 2HGMA 3A4TA 1BQXA 4Y28C 1UFKA 2VG6A 4AT1B 3MM6B 1MWQA 1UVLA 3CJ0A 4OZLA 4FF1A 4TU8A 4MIAA 3I5BA 1JKHB 1YTYA 3R27A 3H8YA 3HVAA 2WRMA 4CZCA 3VF0B 3BN7A 1ELOA 1FE0A 2VPZB 3AA8A 4ITSA 4USTA 2W9AA 4W90B 2W7OA 2FC8A 2H9ZA 3FCHA 4R8UB 4BCAA 2GIQA 1AXQA 2KFZA 3R5GA 3BBCA 5J1NA 4QBUA 1XQIA 2AHOB 4LBPA 3NGTA 1HKAA 2XCAA 1NHVA 2SXLA 4DSKA 2ZOMA 1HQ2A 4RUAA 1E6VA 5ITHA 4HKQA 1VBYA 4C9DA 3TAPA 4P6QA 4B17A 5LSOA 2Z4PA 2OAUA 5LOQA 2GGPA 4KKOA 1EQ0A 2LFVA 1FDAA 1A9NB 1JJHA 1SXLA 4DPYA 3Q23A 2B51A 3PXGa 1S0MA 3C6TB 3GYXB 3OJUA 2R8HA 3EX7B 3DI6A 2DHSA 3P3DA 4DV2J 1XIQA 2BQ3A 3R3TA 4DQPA 2AT1B 1JMTA 3IO1A 4DV0J 2D69A 4Y65A 5HLFB 2HHTA 1WG4A 3BH6B 1FJ7A 3AB2B 3OTOJ 4ILLA 1PYSB 3SSSA 3TZXA 1UVNA 1AZSB 3A8EA 4N8OA 3CGIA 2HIYA 4CT9A 4F50A 1REVA 5LM7E 3DKDA 4ED4A 4IFYB 4OHWA 2R8IA 4DQQA 3FJ2A 2B3TB 3W62A 2FB0A 2OUGA 3ZZRA 4NLUA 1VMBA 4NLXA 3EZUA 1X4DA 1H7XA 3H4DA 1Q5YA 4JI8F 4FBUA 1T9VA 4M95A 4HYKA 4D3GA 3IGVA 4KHMA 2OEJA 2B7CB 2CDRB 2NYHA 4BS2A 5D3GA 3JSRA 1TL7B 3TWZA 2YPYA 4Z2XA 2GIFA 5HO4A 1G2EA 2BE2B 1S10A 4GRSA 3ZTQA 3KLHB 4IRCA 1IR0A 3GE9A 1N6QB 4X4PA 3OFHA 4CNYA 2DB1A 4LF4J 4KO0A 1RU1A 3VGVA 2HAFA 3M32B 2ZH2A 1JLBB 3JQJA 4C8ZA 4I67A 2UXBF 3C66A 2BXJA 2PFDA 2PMZD 3OXGA 4TY8A 5L9XA 3TAMB 1UCNA 3UD3P 2J7WA 3N79A 4U9RA 1TZ0A 4LF8F 4TXSA 4CNZA 4W98A 3TUIC 5T7LA 1EJ7L 1UZHA 1N33J 3VGUA 2VC0A 1QTMA 1YBTA 5KT2A 4QYZK 3PTWA 1J2VA 3K5LA 2C3MA 5LMUF 1R6VA 4IRDA 3GCXP 1RADB 2PEBA 2IIHA 1TQLA 2E1AA 2IM2A 4EU0A 2O01C 3CO0P 1ZA2B 3OTDA 5E0OA 1RT3B 3FFIB 1MN9A 2YXLA 2V2ZA 3HHLD 1IVZA 2V2QA 2GO9A 1LWEB 3HCXA 1FD8A 4LRDA 1MROA 3PYGA 2OJ3A 1XBWA 4ZJLA 4WP9A 3PFEA 4QIEA 2VG5B 2LECA 1HMVA 1X7VA 4H4MB 3BSCA 4LREA 3AFGA 4YR0A 1IWGA 2F9JA 1YRXA 1NBEB 1UL3A 4ILMA 1S1UA 4ZLJA 4HDGA 1VQPS 3HFVA 2DT9A 2J0WA 2OLWA 4AD6A 3KK2B 4U95A 5I3UA 2NUUG 4JOUA 1KKHA 4B9MA 1DQ8A 1F9EB 3W65A 2RHSB 4IDKB 2V50A 1RTZA 2BA9A 2A6OA 5IQQA 4ZJQA 4FNIA 2PD1A 2ABYA 2LQ5A 3R8YA 2YNFB 4C0BA 1QUVA 3C3LA 3DXSX 5A0YB 1SC4B 2LEAA 1L3SA 3PX6A 2CNOB 2L9DA 1DTQA 4A8SA 4NZ6A 5CA5A 1X5TA 1HNVB 4JI4F 5E41A 4CYUB 1PG5B 4C3LA 4X62F 4N77A 4ZN1A 1S59A 3MOJB 2KYZA 4X66J 2Q6CA 3BS9A 3ZZYA 4YOEA 5EDWA 3LP2A 1KN6A 1LKZA 1H2TZ 5CHCB 3T1YF 3MGJA 2WONB 3D1QA 2ADBA 2ILZA 2RS2A 3NNHA 5LMNF 5F8JA 3U02A 1RWUA 2W4PA 3N01A 1N32J 1OIAA 1ZETA 1H7WA 4ER8A 2RD5C 3CCQS 1BQMA 1VYAA 2KDOA 4BWMA 3TRGA 4Q8FA 2W4CA 3N6MA 4PPDA 3CJ5A 1AUSL 2EFQA 3S7RA 1SKWA 2EG1A 1SC1B 1X8DA 2FVCA 2QFIA 1QM9A 2UUBJ 1VC5A 1ZM3A 4XK8C 3W7BA 3QFHA 2MHNA 3SEOA 3CDUA 4K50A 3DRSB 3MPWA 2AEMA 3VHQA 5F8HA 4DCJB 1PBAA 1C0UB 2X7IA 2HFNA 2BDPA 2HYIB 3HHLC 3X1LB 4CM2A 4F4KA 3E01B 2QE5A 2J0XA 3HSJA 3PW5A 2KG0A 2YKMB 4RNOA 3DLKB 1EIYB 3C46A 1T03A 2B4OA 3DRYA 1C4CA 1RAHB 4LSNB 3MAAB 4ECSA 4CTAA 5FJ4A 3IWXA 3NY0A 4ZCLA 4KSEB 5KFEA 3M1VB 3UR0A 5HVFA 3MR2A 1WC3A 2HHHF 4QR2A 1M5VC 5EX3A 4RBTA 2XMMA 4DUYJ 4U96A 4LF7J 2K8GA 1NSKL 2MJNA 1CBKA 4JI8J 2E5IA 3GCWP 4B9SA 1S1WA 4KR0B 4MFBB 3GYGA 3QMQA 4RW7B 1N34F 4C4WA 4QIGA 5IZHA 2C42A 1RZMA 5F9LA 1NK9A 1BY9A 3H5YA 2DH8A 3QSYB 4YB1P 3KJNB 4ED0A 5C24B 1FRJA 2AMCB 2VQEF 1JK9B 3EVMA 3L95X 3BSAA 5BYSA 2WW8A 3QSIA 2DNRA 5K9FA 3BH7B 3C16B 1VDHA 1ZAVA 2RRNA 2ZJQQ 5DQGA 3KHRA 2R42A 3HULA 1GFWB 1U1PA 4NCGB 3JSBA 4F4WA 4G1QB 1T0TV 1HI0P 4S0MA 5L1JA 3Q22A 3AJDA 4DSIA 3ENWA 2YWWA 4LF6F 3R2CJ 4N5SA 3QAUA 4Q2MA 3O2IA 2XI3A 3OSNA 4NCAA 1HA1A 3HJVA 1X4CA 2FJWA 5J2MA 1VQYA 1CC8A 1DLOB 3VZIA 3LP1A 4YB6A 4TU7A 4HH1A 3VZHA 5LMUJ 3HK2A 4C2MA 2DYAA 3BKTA 2XB2D 5B0BA 1PGZA 2KKHA 4ILRA 1AA1B 3Q24A 1D8YA 4PWDB 4HHUA 7AT1B 1RCXB 4OYPA 3CUNA 2CPJA 3A12A 2YWKA 2BM1A 3LA0A 1RWMB 5E3QA 2Z2MA 3R1HA 1B4SA 3GFZA 3HD2A 3OV7A 5KFQA 3FRYA 3MUTP 3SSQA 4KH1B 2F63A 1IR1A 2XGQA 2VQFF 2CPYA 2DO0A 3MZIA 2Z2YB 3PDNA 2CDQA 5KG7A 4ZS6A 2WCXA 1UWBA 2WB1D 1AB8A 2P9CA 1S4FA 3ZZUA 3NP5A 3G71S 2W2PP 2CKWA 2HVHA 1TK0A 1QSLA 4RU2A 2M2BA 4DR1F 3I87A 5KFPA 4IQMA 1S7HA 2LA4A 4NLQA 2CUYA 2G1HA 2QTWA 3A3NB 2A3JA 2C2KB 4KKOB 1U47A 5KFIA 3ZFVA 2QL5B 3Q89A 2HHQA 3GIIA 5DZ7A 1QSSA 1SB6A 3KMSA 3WZ0A 5DG9A 1RAAB 1RP5A 1HPZA 3LWLA 2FYXA 4DSLA 5D0RA 4WTYA 4DX7A 2YWGA 2NZ4A 3MPYA 3HFKA 5LMNJ 2D41A 2LP4A 5MAOA 1H2UX 3CD6S 1VQSA 2KO1A 5MLCV 3RBDA 2V8GA 4HVZA 3LPEA 2KB2A 3OFEA 3I96A 1REVB 1YHQS 3BV8A 3D2WA 3NKYA 4RW9B 1K44A 1NHKL 2W7AA 1UP1A 4PWWA 5F8NA 3HSGA 2AJ2A 4ELTA 5EX0A 1FERA 1FFWB 4C11A 3PR4A 2CZ4A 1Q86T 3EZOA 3EJMA 2WOMA 5KFOA 3WQPA 1S76D 3AT1B 3P49B 4C8YA 2VL1A 4F0HA 3A8JA 2ACYA 1RT5B 3S6EA 1YZ6A 4O4RA 1HQUB 5D3GB 2C1EB 4ZCIA 1PIEA 2G2YA 5K8PA 2WVFA 4HH0A 2HHHJ 2DHGA 5HL7Q 4ECTA 4DEZA 3MEDA 1ZM9A 1RUSA 3BSOA 5LT5A 1S1VA 2HQGA 2P2CB 3ITHB 1Z2ZA 4M1KA 4I6YA 3QRRA 4Y3CA 9RUBA 1ITPA 1S9EA 3P8BB 2Y1RI 2FLOA 1NK5A 1UPPA 4ECRA 3RJMB 4TY8B 2MY7A 2PO4A 1HD0A 2F3JA 3ETOA 3L7OA 3BKFA 1NJWA 1PJ5A 4P2FA 1XN9A 4USIA 5T7LB 1RA6A 2LQ8A 1TMMA 2DGSA 5L1KA 2V69A 3JYTA 2ADCA 2E5HA 2VASA 3GFYA 2RNEA 3QO9A 4I2QA 3GWCA 5KT5A 4M5JA 2EEYA 2G2OA 1G4CA 2Z58B 3EDQB 3LAMA 4DR3J 5M2PA 4ED5A 1KLMA 3PW0A 3PY8A 3E51A 2O67A 2M4MA 2UU9F 4PWUA 2LQ9A 1F60B 4OJHA 3OXFA 1PCAA 2D9OA 2WZ1A 2AIRB 5HATA 1BGXT 1S6OA 4F3MA 4MT1A 3JTOA 2C22A 3FQKA 2MZTA 4QOTA 2DNQA 2RQKA 1QAIA 3BPDA 5HMZA 1RTJA 3QT8A 1X4FA 1ZH5A 5DRKA 2OMLA 5KFBA 1HMVB 3W5YA 2KXNB 2H48B 1R0BG 4NL5A 1IQTA 2BOAA 1S1UB 3IRWP 1QE1A 3GIMA 2GJFA 2NSCA 1Q79A 3TQ1A 5IC4B 4Q8EA 3KNGA 2ZUAA 3Q8SB 4U7CA 2ZBCA 3SZ2A 3G82A 4I64A 4CCHA 3UD4P 1EAYC 4M94A 3ZTSA 2Z57B 4OFZA 4GKJJ 1DTQB 2DR6A 2DNPA 4O44A 1VQNS 2P8IA 2D3OR 2EBEA 2MSTA 3MURP 2JOQA 2ERRA 1R8AA 2RQ4A 4ELUA 2XZWA 2HFOA 4A48A 2VQFJ 3K7RA 4DMZA 3J7YU 3TJ8A 4OYZA 3K8VA 2RE1A 1JJCB 1UAWA 1DFDA 1TFYA 2DGWA 3B4MA 2D7SA 3C14B 5KFTA 1BQMB 4C0HA 3J81Y 4RL1A 2MGZB 2HBRB 4DR1J 1FKPA 2KYXA 1HNWF 3GJQB 1HYSA 1RKJA 2I1RA 1SJRA 4QYZJ 3OFFA 4OX9J 2F1FA 2JLEA 1DQAA 2WSFC 4NOHA 4TYBA 1FKAF 2OSRA 2ZHBA 3CCSS 5E3PA 3U27A 5A8RA 3ZZZA 3CCUS 2YKOA 2OELA 2FHJD 2GJIA 2RVJA 4NA2A 2FJEB 3OJSA 1FXLA 2HPUA 3DOLA 4Y6IA 4ED6A 3HKWA 4WXWA 2W9CA 1T03B 3T5KA 3MWBA 4DV1J 4AL5A 2OKQA 2VFSA 3AD9C 1N88A 4CTAB 1NJIT 9ATCB 3PYEA 4Y34A 4RNHA 1KQFB 3HZEA 4PKDB 2CQ3A 2DD8S 1Y7PA 3R6GB 1N5YA 1WI8A 1KQKA 3K89A 3VQSA 1RHKB 1RTHA 3QPIA 2R9LA 4WK1A 4ZVHA 3U7JA 2JVRA 3DM2A 2CG4A 2HFVA 1PBUA 1V5IB 2B5JA 2WSCC 1YWXA 3D7SB 5E3RA 2DGOA 1S1WB 1WF0A 4USHA 2PIIA 2IM0A 5A8WA 1HBNB 3QQCD 3PW2A 1J5OB 1OPZA 4NPOA 4A8FA 4ALZA 3IBWA 3PV8A 4PXEA 2R2SA 4RR5A 1VS3A 1CG2A 1Q4RA 1YJWS 4RW6A 2AJ4A 4P72A 1CC7A 2A2DA 1P27B 4IG3A 1GXLA 3W9HA 2FLPA 4F25A 4U6PA 1U1RA 5A8KA 2ILYA 1MWYA 1RTDA 4NLOA 2FC9A 2HVIA 3W2VA 3DRRA 4CWBA 2V8VA 1U2RA 3ET6A 2QYGA 2G0CA 5FD1A 2YQ0A 3GMGA 5GADI 3CMAS 3VAJA 2H4WB 4HT5A 3OW2R 1Q8KA 2COLA 2E1PA 2B9EA 3DOMA 1NNDA 1URRA 4H4KA 3HJFA 3W9JA 5J2MB 3D1HA 3KLFB 3ETMA 3MUVP 1VQ6S 1BLUA 2ATCB 3FUYA 4I68A 1A0OB 3MM8A 3NMRA 3O6QA 5AXLA 1IBKJ 2BJ7A 4LIWA 4RX6A 1ZA1B 4LBIA 3F44A 1LNQA 2ZOGA 2JWNA 3CXCR 2W9BA 2GAHC 4DUZJ 2MLZA 3MR7A 2HURA 2EC0A 3D54A 3IXQA 3N28A 4OI1A 4RO0A 2MLXA 4ZDNA 4URGA 3K5NA 1JLEB 2ZZMA 1NDLA 1KTVA 3D6FB 3TVKA 4PG4A 2BMBA 4X2BA 1TUVA 3DCAA 4ZKAA 2BZ2A 2AWZA 3IS9A 2CQ4A 2GVDA 4R0EA 4P10A 2OD6A 5LL6d 2FD2A 1VQ8S 1T02A 2RU9A 4I7FA 4F2RA 5GAHU 1DARA 1R0AA 2ZHAA 1UWBB 4HL9A 2W01A 4MK8A 3R5BA 1TR0A 2M88A 1ZZNA 3TVYA 1TKXA 1WUUA 1HBUA 5DLGA 1NB7A 3GV5B 5ETVA 2KU7A 4DSFA 1NK7A 5KT4A 4FBTA 1QDUB 2J76E 5KFSA 3GQCA 4PXDA 1UWAA 2O66A 2K7JA 1SC3B 2NQPA 4ICLA 2HFZA 2EFOA 3THPA 1NJZA 5KFMA 5JMNA 1FO1A 4NRUA 5IQ6A 4USMA 1HPZB 2RDJA 4OX7A 3W61A 4ECVA 3FBEA 5THWA 4IG0A 4P71A 4DFPA 1W2IA 2LXUA 4GO7X 4RUBA 4PPZA 3GSIA 4ZVOB 4CLPA 4FZVA 2ZITA 1YGYA 5M2RA 2ZDOA 4P73A 5GAGU 2B9YA 4ED2A 2FVPA 1NHUA 2HWIA 3OR2A 4EUVA 1T8EA 1WHXA 4WZMA 3CPWR 4DL0C 2NCKL 4LFAF 1S6UA 1HNWJ 3G6VA 2R7OA 4FYVB 2VBWA 2CJBA 2HS3A 5E5NA 1S1TA 2QSFA 3C2PA 1R31A 2XSFA 3QWUA 2M8DB 2I2YA 2LEBA 1N8RT 4ZPBA 4IO1A 2L48A 1VQ5S 4C11B 4RNFA 4X4UA 3Q8PB 1HBOA 4ZPAA 1ZPWX 2HNDA 4RW4A 1K1QA 2J0SD 2WOMB 2KRRA 2P5VA 4IH5A 4DUTA 1VISA 4QCLA 3AB4B 4B9TA 1U26A 4F8RA 2FY1A 5C7PA 3N4WA 1TUWA 3RBZA 5DM7Q 1X9SA 1YJVA 5IT9Y 4JV2A 2DRDA 2BBEA 2WBRA 3LQVA 2EKNA 3JB9k 1UEUA 1UA0A 2WHOA 3CCES 3K0JA 3TUJC 1N36J 2DNMA 3MEDB 3M9OB 4TLQA 2V9WA 4HTIA 1M5SA 5K14A 3KDOA 2GA7A 4B3OA 3KK1A 5B08A 2CQIA 4ZN3A 2OH2A 1S9EB 4KGVB 3EPGA 2J5AA 1GNKA 3TA1A 2JEJA 1L3UA 4C8NA 3LUYA 1V3SA 1RAGB 2ZEJA 2XZDB 4IFVB 1FJGF 3QZ8A 3AOCA 1YLXA 5H9EJ 2BX6A 4DPWA 4CO5A 5DDOC 2X1FA 5L1IA 1KNZA 3OD2A 3QT6A 2R3VA 2XZTB 1Q78A 4DV6J 2C2OB 3OL8A 5DLFA 1BUXA 1WF2A 3QO9B 3TYTA 3RG6A 3EVWA 4ZCMA 1D9FA 4JI6F 3DXBA 3ADAC 3CJRA 2N4CA 4FVCA 3MM9A 1Y10A 1JIHA 3TP2A 1DY3A 5AJ3F 3K58A 1YRUA 3NWGA 2GHWA 2CNKB 2OPRB 3ZTRA 2OPQA 4C0OC 4ES1A 5HK4A 3ELHA 2RU3A 4B9UA 5SUHA 4LR8A 5KFGA 3GILA 3W5ZA 1S9GA 1RTJB 1WG1A 5KFLA 3CCMS 4A8KA 3PEHA 1NKBA 5GMKa 1YJ9S 1B7YB 1KRPA 5D4PA 5B0DA 2D9PA 1UKUA 2ZDPA 1TL1A 4ZPWR 4JI5J 4M5HA 4Q7AA 3IN5A 5FLXY 1QE1B 3VAGA 1TAUA 2GJ2A 1RHJB 1NSQA 1WOPA 1QSYA 4DR2J 1M1KT 4OLPA 2E9RX 1S0NA 3O3LA 2FZCB 2IMOA 3G82B 1RT2A 3KYLA 3PRVA 4IOBA 1N52B 1RABB 1Y3KA 3UVJA 3LANA 1F3FA 4B3SJ 2HZCA 3M6WA 5DG8A 3KLGB 3N0VA 1CQNA 4OYBA 3QAEA 3L3CA 2FPHX 4O44B 5CABA 3MECB 2QRRA 1S4EA 3KK3B 5T14A 4KC5A 2VJVA 5I3QA 4YMEA 3VVUA 2F40A 3BDEA 2RT3A 1WI6A 1V3RA 2MEWA 4L3NA 4OYAA 4HEA9 5HQLA 2XMKA 1AFJA 4GO5X 4LF5J 4TVAB 2H65B 4P74A 3D6TB 2Z2LA 3K2YA 5IS2A 3Q8UA 3SMZA 1SPBP 1FK9A 3VAKA 4ZLNA 3SCLE 2Q3PA 4U7UK 2GMHA 3NBPA 1YK9A 1LFPA 2XNRA 1UPMB 2QMXA 5KFUA 3L4BC 1X0FA 3ENQA 4MH8A 3NGSA 5KFXA 1KOHA 3ILJA 1HYSB 2XWXA 1HQEA 2MKJA 2R7UA 4YR3A 4Z37A 1VK3A 3EICA 5AXMA 5EWFA 2BKPA 2CQBA 4X4QA 2G9OA 5A8RB 3J7ZT 1F9HA 3JQMA 2DPJA 5J2QA 4DS5A 3BZQA 1FVQA 2F7VA 2HVDA 3B4DA 3D0HE 2IM3A 3CD5A 5IXUA 4AYBD 1RHMB 2HHVA 2C3PA 1VI7A 1NDPA 2MPUA 2YWEA 4KHPF 3FZBA 1XC9A 2C2MB 4LFAJ 3KUHA 1WHYA 3HO1A 2HRTA 2RUSA 2YNHB 1CQMA 4M5DA 1BC6A 1FDNA 4LMZA 3J81U 5EHHA 3RBXA 4ED7A 3G86A 2DNLA 2CWXA 5K8MA 4M5MA 2DNKA 1XMQF 1RTHB 1Q8IA 5EN1A 4DJBA 4QWCA 1Q82T 3DM2B 4XAKA 2RQMA 1TV6A 2LVWA 1LWFB 1Y4ZB 2BR0A 1JLAA 3H5XA 5KFKA 1U0HA 2AF6A 5FDLB 2B5JB 2JDJA 1ROFA 4JI2F 1XERA 3J80Y 4XDDA 1FWPA 3PRDA 3GYNA 5A8WB 2OEMA 2DHHA 4UZCA 2CRLA 1TUGB 3PVXA 5C25B 5BJRA 3MOZA 4DR4J 2L9WA 3G6YA 3GFXA 3G96A 2ZNZA 2KFNA 3KLVA 2W8LA 5I42A 4K5SA 4WFNQ 3VGTA 4IG3B 1RCOB 4KGXB 1EQMA 4V19J 2IJFA 3HHKA 2ZOFA 4NYPA 4AXIA 1VCTA 3FZ2A 3DLGA 3DRRB 5GAEU 3ET6B 5GMEA 5GAHI 3KLIA 5KT6A 1NPRA 1U1OA 2MQNA 2ZBRA 4KGMA 2AEJA 2H5IB 5D4LA 2ZZNA 2G1DA 1FJGJ 5IFMA 1KC8T 2OPSA 1Y00A 3DOMB 1D09B 4KAIA 3QYYA 2G4BA 4R5PA 2AU0A 4DXLA 2AGOA 2QA2A 1KEKA 4FVMA 5CYQA 2HS4A 1VIXA 2FDNA 1GXUA 3GIJA 3KLEA 3W5XA 3CE8A 1KWMA 5KOXA 3CSKA 4J9VA 1NDKA 2A0FB 2OD4A 3JSMA 2KI2A 2M7SA 2PE8A 3M05A 1XNQF 4DLEA 1S1XA 3D6MB 4WU3A 2ALZA 4OHXA
chains in the Genus database with same CATH topology
2W9BB 2YNIA 2EPIA 3H5YA 2DH8A 3POTA 4P7VA 2C3UA 3NCRA 4YB1P 4ECUA 5B0EA 1N0UA 4ED0A 5C24B 3UFCX 1FRJA 4MTPA 4DR4F 2JSXA 2VQEF 3VALA 2Q79A 1Q16B 1JK9B 1KFDA 3FRZA 3L95X 2HWHA 4LUBA 3BSAA 5BYSA 4CQ1A 5A2QY 2WW8A 1F5BA 3E8OA 1FDBA 3NLCA 4ZOSA 4QJVA 2DNRA 5K9FA 2HLTA 5B7WA 1UVIA 1S6QB 2EFNA 2W25A 3DOKA 4WZQA 4KHRA 1U6FA 4PR6A 3MDFA 1NK6A 4ID8A 3CEDA 4RBVA 5GAEI 1HARA 5C42B 1ZAVA 2RRNA 2JEFA 3IS9B 3MM7A 2ZJQQ 4K59A 5DQGA 5DETA 1JLFA 1U24A 5K5MA 3KHRA 1SKRA 3OPKA 3LP0B 4ELVA 1U1PA 1V6HA 2GCFA 4DPOA 1SJ1A 2BJDA 4I69A 1DRZA 4NCGB 3CDBA 3JSBA 2BACA 4KV8B 3LP2B 1ZZFA 1O5JA 2IYIA 2VC1A 4F4WA 3HDSA 5F0UA 3VAIA 3DC2A 4I7FB 4G1QB 2J9CA 4Y00A 5KT7A 1N0VC 2YKNB 4ETXA 1TKDA 1WEYA 1HI0P 3I4HX 1JX4A 3BGRA 1KTQA 3OHBA 4MIWA 3RTVA 3D1OA 3Q22A 5L1JA 2ZJRQ 4DSIA 2XG8A 3ENWA 3B82A 4DN0A 2VA2A 1SV5B 4LF6F 4N5SA 5KFAA 4RW9A 3QAUA 4Q2MA 2IMWP 3O2IA 2XI3A 3H25A 3G6XA 2QLWA 3OSNA 3MM5A 4LSLA 3GG1A 1JLAB 4TLRA 3MR5A 1SL0A 2M70A 4NCAA 2DK2A 2FUG9 3HLUA 3RYLA 4QYRA 1FRXA 1HA1A 1UJ5A 1X4CA 3FEXB 2IC3A 4DUYF 2FJWA 2KTQA 4YR2A 5J2MA 4RNMA 1VQYA 2KFYA 1VOMA 1Y0HA 1CC8A 1DLOB 3AJ1A 3ONQA 4LF7F 3I31A 2LU1A 3VZIA 3FMBA 4QPXA 5M2UA 2XHWA 3SV4A 3LP1A 2FJVA 1KQGB 4YB6A 2RS8A 4TU7A 1RTIA 1T05A 3CULA 1FJCA 4HH1A 2M8HA 3G8TA 3CO9A 3VZHA 4TKTA 1LWCB 3CC7S 2PA8D 1HNIA 1RT6A 2ZH1A 3RRGA 1YRTA 2JC0A 3M6XA 4DV4F 3HK2A 4C2MA 1KFSA 3DDNA 1C4AA 3DGPA 2CVEA 3NAHA 2J8AA 3CVKA 1VQOS 4C8KA 1UVMA 4ZP8A 1C0TB 5KG1A 3CCTA 2XB2D 4QQBA 4YQWA 4ICLB 1RT5A 3M30A 4OHYA 3BO4A 4OMFG 3QGHA 1S6PA 2KHDA 3N9UC 2C2EA 5CYMA 4PG7A 2IJNA 5B0BA 2LDYA 2VOOA 2OTLS 1PGZA 2KM8B 2CVIA 2KKHA 1TAQA 3CDAA 1HQUA 4ILRA 4UW2A 5J1PA 5I42B 3UCZP 3Q24A 3R1LA 1D8YA 4PWDB 2APOA 1KSPA 3B78A 3AQOA 3IRXB 3QGIA 3G6ES 1TK5A 1G1XA 3CUNA 4ZVFA 3VWSA 2VBXA 2CPJA 3MEKA 4F4YA 4A8XA 5JVHQ 1HWUA 5EWGA 2YWKA 2CJQA 2DHXA 4O3NA 1D3WA 2EFVA 2BM1A 4MYUA 5E3QA 1S79A 2K1RA 2Z2MA 2FVSA 4HT7A 3NCPA 4EBEA 4CH1A 3R1HA 2IA0A 2I0XA 4FYDA 3ITHA 1YJUA 3NGKA 1LW0B 4NA3A 3GFZA 1VHFA 2AJ0A 3OV7A 3I9V9 3OR2B 5KFQA 4KJIA 1RDRA 4N76A 3FRYA 3WBZA 4PCQA 3MUTP 1B0TA 3CTRA 3KHLA 2XY5A 4RKUC 1AUDA 4G3IA 1JNRB 2GX8A 3PNIA 3SSQA 4BBYA 2CJ9A 3QLHB 3O1LA 3ZZTA 3RRHA 1T95A 4DR7F 5KOWA 5IM0A 2XGQA 2VQFF 2CPYA 2DO0A 2QLXA 2LA6A 4EEYA 1HNXF 3MZIA 3DHWC 2K2PA 3PDNA 3HKZD 1BQNB 2CDQA 2J9DE 3EGZA 3M2RB 5KG7A 1YG0A 4H4OA 2OPSB 4NRTA 4ZS6A 2WCXA 1UWBA 4E98A 3NG8A 2WB1D 4CIOA 3DHXA 4CO3A 5D6GA 2VFVA 4WJBA 2V8DA 2NREA 5GVQA 2P9CA 3M8PA 1FCAA 4N41A 1S4FA 3T9NA 3V81B 4OV1A 3CWJA 3FEYB 3ZZUA 1HD1A 1A6LA 3NP5A 3HVRA 1H3DA 5KG2A 1PILA 1SUQA 1VFJA 3G71S 2CKWA 3I0SB 4P7TA 2VFRA 4DL7A 5KFJA 1OSCA 2HVHA 2IRXA 1Z1ZA 1TK0A 3MMBA 4B9VA 1VLYA 4OI2A 2JJ4D 1Y5IB 1QSLA 3E3XA 3DU6A 3J7Z5 1YQHA 2HNDB 3KLEB 3MR3A 1K0TA 4A8OA 4RW4B 4GC6A 4RU2A 3OTEA 3TX8A 2M2BA 4DR1F 3I87A 2MQLA 4DG1B 2B6AA 4YB5A 3F56A 3J7A1 1C1CB 4OIXA 2MB0B 5KFPA 1B7FA 3I5AA 3RW7A 1CEZA 3MHYA 5DJBA 2XULA 2F8EX 4IQMA 1UJ6A 1S7HA 2LA4A 2OTJS 4H54A 4QW8A 3CJ2A 1X4GA 2W24A 2XSJA 2DNYA 4QR0A 2MQMA 4NLQA 3CCZA 5HBMA 3SFUA 2WK4A 5G0RA 4OZ1A 1U1QA 2UP1A 4DQRA 2A3JA 3O44A 4KKOB 3FEZA 4URQU 1U47A 2WTFA 2JZ5A 3BB5A 1S9FA 3LPYA 2Q1LA 5KFIA 3ZFVA 2J6UA 2A2CA 4DV5F 3NS6A 2HHQA 3FNNA 2ZC4A 2KVIA 2R7TA 4MAKA 3GIIA 4J9KA 2U1AA 1QSSA 1SB6A 1R6YA 3KMSA 2A1BA 3DNCA 3WZ0A 2ZBIA 1W2BR 4L72B 4LQ9A 3GZ7A 5DG9A 1RISA 1SKSA 1RP5A 4WYWA 1HPZA 1WG5A 2EFGA 3KOAA 1H2VZ 3LWLA 3MFHA 4QZVB 4DSLA 2FVQA 5HROA 4WTYA 3R5CA 4IH7A 2RQCA 2FTRA 4M8LA 3SV3A 1TL4A 2YWGA 3CJKA 1X5OA 4A47A 3T3FA 2NZ4A 3D5MA 3MPYA 1KONA 2CFXA 4ES2A 3HFKA 2VKRA 4RZRA 4B3RF 2BJEA 2X1BA 4ERDA 1IKXA 3MM6A 2FLLA 2DVIA 1Y5NB 5KG5A 1GQEA 2M3DA 2D41A 3UQSA 4OHZA 4K4ZA 4LF9F 5K14B 4FXDA 2B0GA 3M2VB 2DPIA 1Q53A 5MAOA 1JKHA 4EYIB 1K8AT 1H2UX 3CD6S 2HS0A 1VQSA 3KK1B 2MZRA 2KO1A 3KG0A 5MLCV 3HPOA 3KNAA 1VRTA 3RBDA 2V8GA 4HVZA 4NX9A 1U6BA 1HI8A 1QAXA 2DITA 1DBDA 2KB2A 4Q0BA 3WC2A 2MMYA 3OFEA 4J9SA 1V3ZA 4RLEA 3I96A 4H4KC 1REVB 3N5FA 1YHQS 4MJKA 3UCGA 1IQZA 2DGVA 2AGQA 3L09A 3JTPA 2DRAA 1JLGB 3D2WA 3OL9A 4AL7A 3D28A 2CQHA 3H2VE 1HBMB 2CQPA 3MCSA 4R8UA 1UA1A 3NKYA 4RW9B 2VODA 1FHTA 3NGDA 2JLFA 2VH7A 3GFHA 3QJPA 3I5CA 1IKWB 3MM5B 2W7AA 4NCBA 1UP1A 1TKZB 2GFFA 3BQ1A 5F8NA 3LW5C 3AA9A 2KZZA 3MD1A 4ELTA 4WFAQ 5EX0A 1FERA 4C11A 3PR4A 2EW9A 3TA2A 4JI0F 3JAMY 3ICLA 2CZ4A 3KJVA 1Q86T 3LP1B 1NK0A 4WFBQ 2LMIA 2K3IA 2WBMA 4YHHF 1ZOTA 2E1CA 5F8IA 3HVTA 4LFBF 3QWPA 2WOMA 3SSRA 5KFOA 4FS1A 2NUHA 1S76D 1Y3JA 3N6NA 1VQLS 1RT6B 1DTTB 3DRXA 3QZ7A 3P49B 4NXNF 2IRUA 4DR5F 3Q8QB 1T3OA 2FJBB 2O5DA 3PIPQ 2Q43A 5L38A 4C8YA 2VL1A 3GG0A 3PX0A 2ACYA 3EGNA 3PO4A 1EETA 2E7WA 7FDRA 5L9NA 1RT5B 3M30B 1M5HA 4N8NA 2AQ4A 1DHMA 2R7RA 2CPIA 2HMIB 4DHVA 3S6EA 1DJ0A 1U45A 4IR1A 2OMOA 5F8MA 1P6TA 3BO2A 2XI2A 4O4RA 5EUHA 2AYGA 1HQUB 1UFWA 5D3GB 3H59A 4A46A 3LAKA 4ZCIA 3TUZC 3MUMP 1NK4A 1B0PA 1YBAA 4Y2CA 4RUHA 5DGBA 4NYOA 5K8PA 2BANB 5J2NB 3MEGB 4AUKA 1YJRA 3PKMA 1Z2LA 5T41A 3C6TA 5DQIA 2VG7B 3LF0A 2ZKUA 2DCLA 4HH0A 2VD3A 2DHGA 3MMAB 5HL7Q 3H98A 4ECTA 4DEZA 2K3KA 3V6DA 1Q7LB 2DH9A 3MEDA 2JH3A 2UUAF 3H20A 4C8OA 1ZM9A 2DIUA 2K1RB 3AY0A 3BSOA 3HP6A 2CQCA 5LT5A 1RYSA 2RMLA 1S1VA 4PQUB 5D4OA 4MKYA 3ITHB 4WE1B 1RT1A 1S9GB 1NH7A 1TKTB 1Z2ZA 1F2GA 4M1KA 1X5SA 4I6YA 2DNGA 5KT3A 1G7CB 5F8LA 2MKCA 1KVJA 1ULRA 1K1SA 4JV0A 4Y3CA 2L9NA 2DNZA 2HHPA 4UY85 4FF3A 5JJBA 2N3OA 2EI5A 2CQ0A 2HAIA 4NZ0A 5LSLA 3Q8RB 3V4IA 2E5LF 1S9EA 4LQ3A 1TL1B 3T6JA 4NMLA 2NLWA 5DS7A 5E2QA 2MGZA 4RWXA 2Y1RI 2FLOA 1NK5A 4WU2A 5ADZA 1VC0A 4ECRA 4QR1A 1SIWB 5KG0A 1PC5A 1VBXA 4TY8B 4ZPTR 1RKIA 1OPIA 4DX8H 2MZ1A 2GMJA 4DV7F 4AL6A 2GV1A 2OFGX 1KR4A 3PIOQ 2G13A 1U4BA 2VBYA 2MY7A 2XS5A 2EKYA 3RAQA 3DLHA 4V19X 1NZAA 3C6UA 2PO4A 1HD0A 1Q8BA 2F3JA 3ETOA 3OVBA 3L7OA 1KOOA 2IFXA 3LOUA 1NJWA 5L8RC 1XN9A 4USIA 5T7LB 2MKKA 3GV8B 1RA6A 1ZAXA 2ZD1A 1JJ2R 3PO5A 2DGSA 3AQPA 4XPEA 2DR9A 4GKKF 5L1KA 3PHEA 3CJ4A 2BV3A 1FEHA 3JYTA 2ADCA 2X51A 1LFWA 2E5HA 2V4JB 2VFTA 3H5SA 2VASA 4OI4A 3GFYA 4BDPA 2RNEA 2IA6A 1FRLA 2IRYA 1FD2A 2JL9A 3QO9A 4F4ZA 2J9DA 4I2QA 3PRBA 1FRHA 2XSJB 3TOQA 3GWCA 3MEEA 5KT5A 1YITS 5IWAF 4FPRA 1C1BA 1U6ZA 5F41A 3UPFA 3TO8A 1U8SA 3LAMA 3Q0AA 3IG1A 1QVFR 3SCIE 2OPPA 5M2PA 1YI2S 4ED5A 3HHLA 2CYYA 2RUGA 4DN9A 1KLMA 3PW0A 3PY8A 3E51A 4EBDA 1FXRA 2O67A 2M4MA 3SQGB 3M2UA 2CPFA 5D77A 2UU9F 4PWUA 2CIMA 2XBPA 2NPFA 2LQ9A 4OI0A 1F60B 4OJHA 1QLNA 2M0GB 3U1NA 3HI9A 4TNOA 3OXFA 2D9OA 2RRAA 3HM9A 3BREA 4IUFA 5D8HB 3KG4A 2IYGA 2FGOA 2RRBA 2IHR1 5D78A 4DQIA 1N54B 1T94A 5HROB 4KFBA 5AE1A 4K4XA 4X4VA 1BGXT 4Y2KA 1FRMA 1S6OA 2CQDA 2DHAA 4LIRA 3M8QB 4F3MA 2XGPA 4URSA 3D0IE 3VCDA 3WDOA 4F26A 3JTOA 1IKXB 2BM0A 2PT0A 2C22A 2B9WA 3GSDA 3FQKA 4Y2AA 2XLIA 2MZTA 4QOTA 2DNQA 4CT8A 2GHVC 2JEGA 2DR5A 2RQKA 1QAIA 4K0KF 3KLHA 2Y1JA 1RT4B 5HMZA 1MSWD 1RTJA 1IKYB 3CF5Q 3T5LA 2IVFB 2UUCF 4JI7F 3CC4S 1X4FA 1ZH5A 5DG7A 3QJJA 5DRKA 2OMLA 5KFBA 2AYEA 1HMVB 2KXNB 3IR7B 2WB4A 4EO8A 2Q66A 2W8KA 4NL5A 3OUYA 1IQTA 1SJ3P 3BSNA 1GH8A 3DDKA 3M32A 1JLBA 2A10A 4MYTA 3W2WA 4K5RA 3NBPB 4A8YA 4Y2IA 1O51A 1YVFA 3T1AA 1M90T 1S1UB 2HRUA 3MTJA 1EP4A 2LQJA 3CB4A 4YFUA 4DL5A 3W