2HLTA

Solution structure of bacillus subtilis acylphosphatase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
b'MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acylphosphatase
publication title Solution Structure of Bacillus subtilis Acylphosphatase in free and bound states
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 25
structure length 91
sequence length 91
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hltA00
2VV5A 3K7RA 1TL5A 2HQIA 2HLTA 3CJKA 2ACYA 2W4DA 4FNIA 3F44A 5B0AA 3FGVA 5B0EA 1TUVA 2ROEA 2KYZA 3E8OA 3T9NA 3FRYA 1KVIA 1OQ6A 2OAUA 2OKQA 1OQ3A 1WD6A 1FD8A 4DL0C 2OD6A 1N5VA 1FEEA 1AW0A 3LO3A 1GXUA 3BF4A 1AFIA 1YJVA 1CPZA 2XMUA 1MWZA 3TNVA 4Y2KA 3UDCA 2K2PA 4Q2LA 1RJJA 2AP6A 5A6WA 2BYCA 5F0UA 1FVSA 1P6TA 1TZ0A 2AJ0A 3IWXA 2BUNA 2VH7A 5K9FA 5B0BA 1Y9OA 1S6OA 1X8DA 5B08A 3HX9A 4U9RA 1W2IA 1MWYA 3QMQA 1YJRA 3WDOA 3TOQA 1FVQA 1IUJA 1SB6A 2ROPA 1KQKA 3KKFA 4Y2IA 4A4JA 2GV1A 4A47A 2JDJA 2XMKA 2BBEA 5IXUA 2K7JA 2W4PA 3MZIA 4OIXA 1FE0A 2GFFA 2LXFA 4YEAA 2QIFA 3BB5A 2RILA 4HH1A 2RMLA 3DCAA 3VTIA 1V3ZA 1GXTA 3BM7A 2RSQA 1OPZA 2HLUA 2N4CA 1URRA 2W4CA 4A48A 1S6UA 4HI2A 1LQ9A 2KKHA 1YJUA 2BJDA 4HI1A 2FTRA 1APSA 2Q3PA 2FB0A 2ZDOA 1FESA 2XMTA 1VQYA 1Q8BA 2OD4A 1Y3KA 1Q53A 1JK9B 2LQBA 2HFOA 4HH0A 5B09A 4QOTA 2GGPB 2L3MA 3HHLB 4YDXA 5T7LB 4DN9A 4F67A 2AW0A 2QLWA 2OMOA 1KVJA 4OJ3A 4HL9A 1QUPA 2EW9A 2XMVA 4OJGA 2FIUA 4OJHA 4EFAC 2AJ1A 2GGPA 3HHLA 1K0VA 5T7LA 1CC7A 4OJ1A 3FMBA 3I9ZA 1SI9A 2IYIA 4ZA1A 2ASYA 3HHLC 1VQSA 2KT3A 4Q2MA 1Y0HA 2PGCA 3MCSA 5B0DA 1R6YA 2HIQA 1YJTA 2G9OA 2KT2A 1XBWA 1X0PA 2QYCA 3BN7A 3KG0A 2K7KA 1JWWA 2PD1A 1CC8A 1TL4A 1OSDA 1SQEA 3LGMA 2XMMA 2GO8A 3KNGA 2BJEA 2IFXA 4A46A 3HFKA 2GCFA 5B0FA 3IWLA 1ULRA 5B0CA 2RU9A 5B0GA 3BGUA 2GA7A 3QGPA 1Q8LA 5A6PA 1YRXA 2LDIA 2K1RB 4NL5A 2QLXA 1N5TA 3HF5A 2IYGA 1AFJA 1TR0A 2LQ9A 2FHMA 2ROGA 3KG1A 3DXSX 2K1RA 1Q4RA 2N4DA 2CRLA 3BR8A 3GZ7A 1Y3JA 2OFHX 1X7VA 3LGNA 4FNHA 2N7YA 1P8GA 4Y2MA 2XMJA 2XMWA 4NPOA 2HFNA 5KAKA 1U7LA 2ZDPA 3HHLD 3HDSA 3TRGA 1N5QA 2OP5A 1YG0A 2OFGX 3CJKB 4DPOA 1N5SA 4ZOSA 3BDEA 1FE4A 5F0WA
chains in the Genus database with same CATH superfamily
1XNQJ 3UNYA 2HNDB 2Q79A 2AYBA 3HO1A 2LXIA 2EBEA 2HSEB 3TAQA 4FF2A 3HLUA 3I6PA 3IWXA 5GMEA 3R7NB 1SJFA 3OFHA 4EBCA 1VCTA 4J9KA 2OPRA 1NMEB 2YH1A 2RDIA 2V67A 2HHPA 3BH7B 1FD2A 1OO0B 3DLKA 4PR6A 3HHKA 1RT3A 4JV0A 3P5TL 3GFZA 4CLKA 2MQNA 4NLRA 3IWNC 1IBKJ 1H2TZ 2VZ9A 3VAIA 5D0RA 3SBMA 2XNRA 2ZE2A 3BSOA 3I5AA 2J6SA 4OI3A 2JEJA 2WVBA 1UZHA 3NRBA 1MN9A 2VICA 3X1LB 3A3PB 5HATA 1B7FA 2QEXS 2Y8WA 2RQCA 1YJNS 1DTTA 5KOXA 2HQFA 3PRBA 2AD9A 1J5OA 4RKUC 2Y0BB 2YX7A 1UFWA 3R1LA 3MFIA 2V8HA 3UD5A 2BZ2A 2PEBA 4XPEA 2A2CA 2H5IB 2R8GA 3FKBA 4WZQA 4IO1A 2DT9A 1R8HA 3MR6A 1FFSB 1HHTP 1ICEB 1KSPA 3UCZP 2V2KA 2Z2LA 3IO1A 2OPRB 3M05A 3QMQA 4B9SA 9ATCB 2MKCA 4DMZA 1UA0A 3NMRA 4DCJB 3DLKB 2IDLA 4DPYA 1RT3B 4JI1J 3CB4A 2CDRB 1QJHA 2DHAA 2ZUAA 4X4TA 1I3OB 1X5TA 3QGIA 2U2FA 5D4PA 2ZE2B 5KFPA 4ZVGA 1N48A 2MQPA 5KT7A 2CQGA 5KFIA 5AJ3F 1T94A 1FDNA 2C3UA 2BKOA 3KNGA 1DFDA 4C8KA 1DTTB 1J5OB 1N5TA 4Q43A 4KGXB 4M1KA 2BKPA 2RU3A 1FJGF 1IKYA 5F3TA 3J7Z5 2QZ8A 5IFMA 1XMOF 2O1PA 2W4DA 1FWKA 4RNMA 5T14A 3GCWP 4RX6A 1NDLA 3BO2A 5E2QA 2PIIA 5T41A 3HVAA 2ZITA 3KFWX 1UCNA 1JNZB 3OL9A 4LF6J 3QT7A 1DURA 2I0XA 4H4MA 2BW7A 4WYWA 4F3MA 2XS7A 2YBVA 3MCNA 2VFSA 3RTVA 4NMXA 1Q53A 4F7VA 1SQFA 3QYYA 1VQNS 8ATCB 5ETTA 1REVB 1WHWA 1S7HA 2ATCB 1UZDA 2PGCA 2QG9B 1FDBA 3HKZD 3TYTA 2O01C 3V4MA 1ULRA 1KQSR 3EGVA 4NLVA 1J5EF 3A13A 2DNRA 1N54B 1HQUA 2W9AA 1IKYB 4AL7A 1NB7A 1S0MA 2EG2A 3MAHA 2OEMA 5DS7A 3CUNA 1XTZA 3V6HA 1TFYA 3VGUA 4OZ1A 3F44A 4KHRA 3S01A 1M5PC 1S76D 3E2EA 4QIWD 1FEEA 2JEFA 1XN9A 3G6ES 4P7TA 5K9FA 3VGSA 4ZPVR 4MFBB 1RHMB 1PILA 3UW1A 2XZWA 2ZC4A 3C2PA 3ICLA 2XMAA 1J2VA 2GIRA 1U2CA 1RAIB 2UXCF 3V4IA 2DXFA 2ZH7A 2WVFA 2FQQB 1S9FA 1DRZA 5E3PA 3ZZPA 1X4CA 3AOCA 4KE5A 3MTJA 4RNFA 4RPFA 3GFXA 4J7CA 4ZA1A 3MMAA 4F36A 1ITPA 5K14A 3OXGA 2X7IA 3UD3P 3P8BB 3W65A 5B0CA 4S0MA 3VF0B 2ZH4A 1FJEB 1RB0A 1HQUB 1XNQF 2JVOA 2MHNA 4AT1B 3N6MA 4LVNP 3W60A 3ULHA 1Q79A 2UXBJ 3N4WA 2YKNA 5F0WA 2EK1A 5KG4A 1OQ6A 3I96A 3OVSA 3UVJA 3PW0A 4DV3F 1TZ0A 3ENVA 4F4YA 4K0KF 2J76E 4UOCA 2CJKA 3NKYA 3V4IB 4QIEA 5FIIA 1F5BA 5KFLA 2RMLA 2H51B 4X4OA 4HHUA 1DTQA 2V5HG 1NK9A 3KJVA 4LF9J 1AUSL 2XULA 1RWPB 4B3TJ 1T9TA 2MZRA 4WXWA 1U1RA 3I4HX 1NPRA 4DV1J 5BYQA 5IWAJ 4TLRA 1XR7A 4OJ3A 3ZTQA 2Z57B 3MMAB 2F3JA 1FDDA 5K14B 2QYCA 1RWNB 5KT6A 2PSZA 2EC2A 2ZUGA 3NOCA 2IMOA 2B8PA 4YOEA 3HT3A 2R2TA 3PCOB 3ISZA 3GR0A 2LQ9A 1BE4A 4KRWA 2DITA 2QRRA 3SSRA 1UVMA 3PG9A 2YKNB 4DL4A 1ZBTA 4BWJA 2XC9A 2JEIA 2QFIA 3FEYB 4MAKA 2ZBRA 2VU5A 2G13A 1X4EA 1SJ1A 3G96A 3JSYA 3UVJB 1B99A 4KH1B 2IY5B 3V6DB 1LV5A 2FJDB 1NK5A 1RA7A 3H5SA 1R8BA 4JI1F 2HS0A 1T9XA 2Z56B 3NGUA 2P2CB 2OPSA 1VRQC 1DTQB 3LP1A 3HSGA 3KJVB 1X4DA 2RSQA 1WHVA 2AYMA 1B64A 2HGNA 1HQEA 2CQHA 5F8LA 1Q78A 3CJ0A 2YX1A 1UP1A 2F5GA 2LQ8A 3QJJA 1JWWA 5DQGA 2BKNA 2OH2A 5AXLA 3FSIA 4ILLA 2ZC3A 2V8PA 3RR7A 5CQGA 4P7VA 3EGZA 1CVJA 5K8NA 5A8KA 4NRTA 2DR6A 2FJWA 4F3OA 2ZOMA 3OR2A 4TU9A 6AT1B 3RAQA 5L8RC 4H4OA 2H54B 4UUWA 3ILLA 2BYCA 5F0UA 4WK1A 2OPSB 1W2IA 1A9NB 2D41A 2ASLA 1VK8A 2J9EA 3LP1B 3TZXA 1HFEL 2HQCA 4DPTA 2J0WA 5LSLA 3QRRA 2DGUA 4WK3A 2GHVC 1HQEB 3DHXA 2CPEA 2A18A 2XB2D 3POTA 4KJIA 2HURA 3T5HA 4YQWA 1FXRA 1M90T 2B9WA 2UUTA 1CLFA 3W5YA 1HNWF 3LOUA 3NXZA 4JI3F 1K1QA 4PXCA 3HT0A 2PN6A 3A1YG 5A8KB 1EB0A 1CULA 2RDJA 1T7PA 2VG7A 2UZAA 1OPIA 3K0JA 3G6YA 4QU6A 2CNLB 1ZPVA 4H4OB 3MR2A 2ACYA 3HVRA 1S5ZA 4ZJQA 2DBBA 2RF2A 3HZEA 3TA0A 4CLTA 4N8NA 1S6QA 4DUYJ 2R2RA 4C8OA 4P2SA 1MWYA 3BKUA 2FJEB 2J0XA 4CRJA 1KONA 3TJ8A 1Y4ZB 1LXJA 3HM9A 1WG1A 4HH1A 5GMDA 3D4JA 4NLGA 2M5YA 4M5NA 2ZM6J 3POTB 3J81j 3BQ1A 3KK1A 2MY7A 1KLMA 2RHSB 1D1UA 1D9FA 4O4GA 3MPDA 5C2CA 2EFPA 3IS9A 3JXOA 1VQ6S 3A3NB 2E66A 4PKDB 2UXBF 3FZBA 2ZH8A 1G2EA 4ATNA 3MMCA 1KC8T 5KTQA 2MKKA 1CULB 1N32F 2VG7B 4YDDB 3NG8A 2XYPB 2DJWA 3N6NA 1WKKA 4JI6J 3AHPA 1N5SA 1RHUB 5KT5A 2RF2B 2HHXA 2C2EA 3O2IA 3GIKA 3Q8QB 1S6QB 1FHTA 2W2PP 3OT9A 1RAJA 1N33J 3TUZC 1IVZA 1VFJA 4B3TF 1V5IB 3CC7S 3KHHA 2QO3A 2LXFA 2KFZA 3LAMA 4DV1F 4DV6J 4ECTA 4EGLA 1MU2A 3MMJA 4HI1A 3OBIA 2W7OA 4CTAA 2MKJA 2JZ5A 1KLMB 2IC3A 4DR2J 3T3FA 4OJHA 3OFGA 4O4GB 4Q45A 3I9ZA 4HTJA 1CBKA 2DYAA 3QLHA 4DSKA 3DLHA 3IS9B 4LF4J 4USKA 2XO6A 3AAWB 3SDEA 4WKYA 4PCQA 3K58A 1VC0A 2M4MA 2I9SA 4LVOP 3MMCB 2EG1A 2YH0A 4AXIA 1RBOB 2VUGA 1TL3A 4OYMA 3NNHA 3RBDA 3V81A 3TUPA 2VV5A 5M2UA 4JI0J 3KUGA 3FGVA 3E8OA 5IV4A 3SI8A 1UWBA 2J8SA 4OYPA 1ZA2B 1AW0A 3RRGA 2OTJS 2K2PA 2IMWP 3N28A 3GJQB 3WDOA 5BR8J 3CWJA 1MU2B 4J9MA 1L3UA 2CJAA 4CTAB 4WU2A 5D4LA 2IC3B 2FHOB 4JI4F 2B6AB 1HIYA 4IH6A 1EP4A 4F67A 5T7LA 2VASA 2WW8A 5EWEA 1C4CA 4M8LA 1TFWA 5DQIA 1O6XA 3RG6A 5LOQA 1U1PA 4DQQA 4QWBA 4Q0BA 2WVDA 2WB1D 1TL3B 4USIA 2FHMA 3ELHA 4I6AA 4ZIWA 2DHXA 3V81B 5HI7A 4DSEA 3EXYA 4OX6A 4C0HA 1ZZNA 2AIRB 2OSQA 2CNNB 1U0HA 1PJ6A 3WHIA 4BBYA 4CDIA 5J2QB 1XNRF 2CQ1A 1LNQA 4LR8A 2KO1A 3SCIE 1GXUA 3EYZA 2QLJB 4QYZK 1KEKA 3MFHA 4OL8A 4RU2A 2W9BA 4DU8A 2RDDA 2ROPA 3NGDA 3MEGA 1JNRB 5DGBA 5DDQC 2UUCJ 1EP4B 1ZETA 2HKEA 5B09A 2FLLA 4E98A 5T7LB 3MM6A 1NJXA 2AMCB 2D69A 1ZYQA 4NRUA 4P2MA 4LRCA 1JLCA 3LW5C 3LPEA 2FVPA 2O66A 2VPXB 4DU7A 3H98A 4C7QA 4K4ZA 4Q0BB 1F9FA 5GADI 2XLIA 4K2JA 2GMJA 2DTJA 3H40A 2Q6BA 2V0NA 3QWPA 3MXHP 3GJTB 4QWDA 4I56A 2NPFA 2NYIA 2VG5A 1U0HB 1MN7A 4DUYF 4WP3A 4HYKA 3PJXA 3HVWA 2DY9A 4ECVA 1O5JA 3AQOA 3D68A 5KG0A 2W9BB 5IT4A 2HHTA 4NWBA 4K4XA 2BW2A 3RU0A 1HWIA 3U27A 5DZ7A 3MEGB 2VBZA 2NXJA 3BQ0A 4QPTA 1RTIA 4OZ2A 3OPKA 2KU7A 1VLYA 1IN0A 2GMLA 3KYLA 4GMKA 4N76A 2EW9A 1JLCB 3FSYA 4I0WA 1FJ7A 1TMMA 3S6EA 5GAEI 1CC7A 3NCQA 2D9PA 4DR5J 5ADZA 4B9MA 3PKYA 4DX6A 5A2QY 4DL3A 2W7PA 5G0RA 3O44A 4RW9A 3CVKA 4NLUA 4M5IA 3ISND 2QYGA 1Y3JA 4HHJA 2HHQA 2N7YA 3G8SA 4A8SA 1RHKB 2VG5B 3FBBA 1EZZB 4HKQA 4RUHA 3CJ8A 2JJ4D 2HLTA 1B7YB 2ZWOA 2HFSA 2MJNA 1FD8A 2ABYA 2PC6A 4X2BA 3BYRA 2HNZA 3EPIA 3CD6S 4DV6F 3IAS9 2KTQA 5F8IA 3CCUS 4WWSA 1G7CB 3M9NB 2K8GA 2P9GA 1GXTA 4DR2F 1RTIB 1TKXA 5D4NA 2CDQA 4NI2A 4A48A 2BQUA 4OX7A 5KT3A 2Q3PA 2V68A 2QL7B 2YWEA 2VG6A 3MWBA 4E2FB 4R0JA 3P45B 4RW4B 3NL0A 5KFFA 3NWGA 1LWXA 2D3UA 3H4BA 1W2BR 1R7IA 1U2FA 2XLJA 5G0RB 2MZJA 4RW9B 1RU1A 3L7UA 2UUAF 4Y6IA 4ECQA 4OHYA 5FJ4A 4RUCA 5J2MA 3MF5A 3ZTSA 2QLXA 4CLWA 4I6YA 3Q2TC 2CZVC 4C11B 3BS9A 3RW7A 2CRLA 4NXMJ 4ZITA 4LRFA 5KFSA 4OI0A 2IVFB 1SJ4P 1RACB 5EX3A 2MKYA 4FBTA 1VJQA 3ZNUA 3KK2A 4HR2A 1CQNA 2MXYA 3M2UB 1RT1A 2HNZB 3CSKA 5KFUA 5DM6Q 3FCHA 2J0SD 3QT8A 5CZXA 1IQZA 1PG5B 5IC6B 1UVNA 1UETA 3VAFA 4NI2B 1VHFA 2MZ1A 2BRLA 1GX6A 4FPIA 4CLUA 2VG6B 4ZVOB 1NK8A 3KG4A 2B7BB 2E5GA 2P5VA 2J5AA 1MNEA 2XMVA 4EZ6A 5ETQA 5KT2A 1HBUA 2UUBJ 3GYGA 5HVGA 1GQEA 3P4UB 4LF5F 4ZPTR 4DR4F 2M7SA 4WTYA 2F8MA 4MH8A 1M5OC 3RBXA 1VRTA 1RWVB 1JX4A 2OFHX 2CJQA 3NOGA 3CDUA 4F0HA 3T41A 3KK2B 4LF2A 4B9VA 4CO3A 4C48A 3V6KA 3CJSA 3GJRB 5DG7A 1RT1B 4J9VA 1Q8KA 5B0AA 4N56A 3PO5A 1HA1A 4ZCLA 3TNVA 3CJ2A 1WEZA 3R97A 4PAAA 2RT3A 1NBEB 4X64J 4NEYA 2W9CA 2UUCF 3KWMA 4WKRA 2Y1RI 1RT6A 4QR1A 1U02A 1URRA 2KKHA 5ETNA 2GQQA 4DHVA 5ITHA 4RL1A 1ZAWA 1YJ7A 2ZZMA 2GQCA 4IG3A 2EFQA 1H7WA 1WC5A 3H5XA 1FRIA 2VA2A 3IGNA 1HBUB 2VJUA 1K0VA 1WSVA 3NP5A 2VBYA 2GVDA 3BN7A 3QATA 2VF3A 3EM1A 4OV6A 3K5OA 4IH7A 1VRTB 1D9DA 1BWEA 4CO0A 1L3KA 2COLA 2CJYB 3KHLA 1H72C 4GVLA 3CJQA 1Q4RA 3DRYA 3KOAA 4M5KA 1UPMB 2FJBB 5HMWA 2YKQA 1SKSA 1T9YA 2QV6A 3M6WA 3PYFA 4TU8A 4QWCA 5AXMA 2XWYA 4NLSA 3BN4A 1PAEX 3ZXWA 3H7HB 3J7AN 4MIBA 2CADA 1RWKB 3TZWA 2B4VA 1OQ3A 2V63A 2XM3A 4DL0C 2R7XA 1YJVA 1JKHB 3GV7B 2DGXA 3DNCA 5LXYA 2W9CB 2KG1A 2MY8A 4I2QA 4X65F 3TJ9A 1FVQA 2DPJA 1KR4A 1RT6B 2C2OB 1OS5A 4ENOA 1U09A 1Y5LB 2V4JA 2HWIA 4G3IA 1T05A 4HI2A 1E6VA 4FZVA 2BJ8A 2QMUB 4IG3B 2XG8A 2JL9A 3OTEA 4B02A 2GS8A 4X62J 7FD1A 4ED8A 1S1UA 4FYYB 2GVDB 3FMBA 5EX0A 2MKSA 1YJTA 1HPZB 1U1MA 4N7TA 5JVGQ 4LIRA 3H4DA 3FQKA 2XQCA 2DNKA 3NGSA 1VBXA 4RZRA 4R8UA 2VQEJ 2HVZA 3PX6A 3NS6A 3BDEA 1SKWA 1JQGA 2EFNA 2HBRB 1HD1A 3TEHB 4USVA 2V2QA 3L3CA 3OXFA 1SKRA 2YQ1A 1F3VA 3TAMA 4I2QB 1S48A 3PDNA 1FVSA 5M2PA 5B0BA 2V4JB 3GWCA 2Q66A 5IXUA 1T05B 2CQBA 1E6VB 2KDOA 2DB1A 1LQ9A 4IFYB 3W63A 4CH0S 1S1UB 4DQSA 2HK3A 2OI2A 5IOLA 4KHPJ 2FIUA 4JV5F 4Y00A 4C0OC 1U2RA 2HBQB 4ZVPB 1HW9A 1VQ9S 2NYHA 1ZTTA 1WI8A 3UE2A 3FRZA 4OZLA 1RLDA 1DY3A 3H20A 2RHQB 2VKZG 2IRXA 3RBEA 4R8UB 5E5NA 2XMWA 1Y10A 3LH2S 4DR3J 4U95A 1A7GE 1C2PA 2RRNA 5LMUF 4FNIA 4DFPA 2D1CA 5B0EA 2OLWA 4PXBA 1XR5A 4X66J 3TAMB 4H54A 5FD1A 1RK8A 1VQMS 5E41A 3W66A 3MEKA 3S1TA 3CCQS 5ETSA 2HWHA 2OPPA 1S12A 4Y65A 5HMZA 4K59A 1N8RT 2HQGA 5HQ8A 2CPZA 3IRXA 2JWNA 1D9AA 4KTQA 2BANA 2RUSA 1A6LA 1UAWA 3R5AA 3TA1A 1D8YA 3EWGA 2LVWA 4NYPA 5CD4A 1R0CB 3K17A 4EMDA 3J81U 2UU9J 1R89A 2NXEA 4FXVA 4J37A 1U24A 1Y7PA 3KHRA 1S59A 4OHVA 2C2NA 1TR0A 2CQCA 4N5SA 4ANEA 3W9JA 1I1GA 1PKUA 3Q22A 2DCLA 3SMZA 4LREA 3IM8A 5L38A 1HR0J 5K8MA 3U7JA 1B4SA 1CS4A 2CPYA 4F0MA 1WF1A 1PJ5A 2OAUA 4IOBA 4X4UA 4DV5J 1U1NA 2VONA 2VFUA 1ELOA 4LRAA 3WZ0A 4JI2J 1XMBA 3QRPA 3VCDA 1M1HA 2OO4A 4J9OA 5LJ5Y 3IRXB 2FHJA 4RWXA 2BANB 1FESA 1ZM9A 1HMVA 2IM1A 1SI9A 3W9HA 4DX7A 1IKVA 3PACA 5DLGA 3T1HJ 2IDEA 2ZZTA 3QGHA 4PEOA 4A46A 4JI5J 3KLIA 4KH0B 1GTEA 2NREA 2WW4A 2JC1A 3H42A 1ZM4A 3M9OB 1S4FA 2NZ4A 5D8HB 3CMAS 5KG7A 2MLZA 1YQHA 1CS4B 1RDRA 2XCPA 5L1KA 3NBPA 2ACMA 3FBEA 2L9WA 1G1XA 4LIWA 4OI2A 1RTZA 4XDCA 4WZMA 4ZP6A 1WORA 5DDOC 1LKZA 4FS2A 4KYZA 4OYIA 3G71S 1T3OA 3TOQA 1D0EA 3BZQA 1TP7A 1AXQA 2R7RA 2Y1JA 4B3MJ 3KKFA 2BA9A 4ZVRB 3T5KA 2JEGA 4TNOA 3PR5B 4X62F 4OFZA 2W4CA 2PI5A 1P1LA 2H9ZA 3OJUA 3OTCA 2H5EA 1YX2A 3CCJS 3THTA 1IXKA 2HEKA 1VK3A 4X4PA 1FI4A 3GFYA 2XI3A 1IKVB 2ILYA 3M8QA 3Q86A 3NEKA 3KLIB 1X31C 4HVZA 3QJPA 5CA5A 2CAJA 4I1TA 5IT9Y 2OEJA 4ES2A 2VQEF 1CJTA 3SV3A 3AT1B 1S97A 4IDKA 3DOKA 3PV8A 3W8PA 1SL2A 4JYAJ 1RISA 4ICLA 1HWJA 4A8KA 2VOPA 3LAKA 1FRHA 2YY3A 2HBYB 3NBPB 4EK2A 4OV1A 1K8AT 3NGTA 1WD6A 2CA9A 2X1BA 1CPZA 5L1LA 2X1GA 1JMTA 3OFFA 2DKOB 3TZYA 1FRXA 2AF6A 4O23A 3GTYX 2DXEA 2K7JA 2VB6A 4L75A 2HZVA 3D66A 3BR9A 1O8BA 3LWLA 2ADBA 3UPFA 2NXUA 2CNOB 2B3TB 3MD1A 1SJQA 2AW0A 3M8QB 4UW2A 4DV7F 1L5UA 4QCLA 2AX1A 2BQ3A 3F0NA 4NYOA 1M1KT 1F2GA 1CJTB 2NSCA 1HNXF 2CG8A 4IYQA 2POKA 4IDKB 3QGPA 3ET6B 4ED7A 4ZVEA 4TQRA 2ZNYA 3HSZA 1ZZFA 4Y0FA 4JV2A 3SV4A 2CWKA 4ICLB 2E7WA 1L3VA 2Z0GA 5THWA 4LBHA 1IKWA 2ZDPA 3HHLD 2EWHA 4OZJA 3RJMB 2F7VA 4AXJA 4DPOA 4RUAA 1FEHA 1TELA 3R2CJ 1NSKL 2UV8G 2MLXA 3MR3A 4YMEA 2AV5A 3P49B 4J5OA 3AY0A 4QYRA 5B08A 2K3KA 1NSQA 3L95X 2J7KA 1NRKA 3RW6A 2GFFA 3BBBA 2KT5A 2CFXA 4YR0A 1V3ZA 3PEJA 2MKHA 5GADU 4ELVA 2KL8A 2CQDA 1R8PA 1NKEA 2N3LA 4ED6A 3M8SA 3I0RA 3KLEA 1WDTA 1SBRA 1KVJA 1IJEB 1N0UA 1UW4A 3D1QA 3L09A 2OIHA 1JJHA 1WOOA 1VQSA 3LP2A 3B8HA 3MI7X 2UXDJ 3VALA 2GVZA 2DIUA 1M0SA 4F02A 4DBQA 2CWXA 5J1PA 1F3FA 1IKWB 4KGZB 3CDBA 3EDQB 4DV5F 2GAGC 4RNOA 1CQMA 3GYNA 4EZ9A 1UFKA 2LCWA 4LFAF 3CCWA 2QSWA 4ID5A 3UR3C 4RBVA 4ZS6A 4B3SJ 3KMSA 2QN6B 4TY9A 1AFIA 3OUYB 2FJVA 2ZEJA 3PYDA 4CYUA 3Q8SB 2I38A 3R6GB 5CABA 2B51A 1N88A 2IBKA 1LEOA 2P6SA 1SJRA 6FD1A 3SQOP 4F50A 1IWGA 3OR1A 4DV0J 3ENWA 3RBZA 4DS4A 2IHR1 3KLEB 2BDPA 3D6MB 1VS3A 3G8QA 2DNQA 3LP2B 1OMSA 3PFEA 3O5TB 4ZCMA 4PWWA 1Q81T 3B54A 1SXLA 3PIPQ 1TK8A 2GHWA 2GVZB 3PNIA 3KLVA 1Z2ZA 4DR7F 1PC5A 2HBZB 4DLEA 4NLTA 4CLFA 4P75A 2WZ1A 3FBFA 1K9MT 2Q6CA 5CCMA 2PMZD 4C0BA 3KLGA 3NS5A 3C6TA 1YBUA 4WYLA 4IRCA 2ZH6A 3GQCA 4DDFA 1KOOA 3KNAA 1SCJB 4ID5B 3MPVA 3BGLA 3W5XA 1QAXA 3K89A 1MSWD 2DCUB 1OWXA 1TKZA 4CYUB 1QAYA 3IG1A 2PFDA 2RVJA 2XBPA 4X4QA 2ZBCA 2UUWA 1HQ2A 4DOZA 3OR1B 3N79A 4ELTA 2YQ0A 4NA1A 1WEXA 1RADB 2LDYA 4BCAA 1VDHA 2Z4PA 3W7BA 4WF9Q 2FLPA 1U8WA 2BVZA 3KJNB 2DR8A 2YQ3A 1S9EA 1H3DA 2YWGA 4YY3F 4YR2A 2X51A 4K4VA 1OSDA 1JXEA 2GO8A 1FWPA 2ZJQQ 3Q2SC 4BLGA 3QFWA 2KM8B 4HDHA 3KLGB 1C1CA 2F65A 1XQIA 3CCSS 4U8YA 1VC6A 2KM8C 4DPXA 2LMIA 1P9YA 3PFOA 1U7LA 4ECXA 3GG0A 4CLSA 1N36J 1VC5A 3RZAA 2GO9A 1TKZB 4ZVTB 1PAUB 3FCVA 5HVFA 3MM8A 3IG1B 4QU7A 4NZ0A 4DUTA 2B5JA 4C8LA 4M95A 3HSDA 3OXLA 2A0FB 1MW7A 1YJ9S 2HFVA 1HHQA 2UV8A 1BMQB 1IJFB 4ECYA 2RB7A 5HK4A 2E9TA 2VBXA 4PWDA 1UFLA 1WG4A 2VODA 2Y8YA 3T6JA 2ZH2A 3HFZB 1NSPA 4J9NA 2YKOA 2QLWA 1T03B 5EHHA 4ZN1A 2IRUA 4NYZA 1S9EB 2MDAA 4IFVA 2KT3A 4OHZA 1OY9A 2HIQA 4C3KA 1S79A 3E01A 3DRSA 4FDFA 1C1CB 5AE2A 3SZ2A 4UZBA 5AXNA 3MR5A 4OI4A 2CIMA 1O0PA 2MMYA 3JQKA 1UW9A 1URNA 1YGYA 4U7UD 1EHWA 4KGMA 4RR5A 2F1FA 3CIZA 4ZOSA 1RAFB 1Y5IB 3DYAA 1JLBB 3JTOA 4YB7A 3MM8B 3CCTA 4FPRA 4RWWA 1MWZA 2B5JB 2AJ0A 3HX9A 2AX0A 2V34A 3HHNB 4J9PA 4LT6A 1UPPA 4ZIVA 4PWDB 1BC6A 3C19A 5DJBA 3KUHA 4X4NA 1R8CA 1PYSB 1UJ5A 2FD2A 2E7XA 7AT1B 3H5UA 2QFJA 3UDLA 1CJKB 3D5MA 3VGTA 1KN6A 2VIHA 3CCLS 4FXDA 2A2DA 4QWAA 3R7SB 3R5JB 2GW8A 4IFVB 2PDAA 2KZMA 4OJ1A 1WG5A 3E01B 5HVHA 3DRSB 2AJ4A 3F41A 2AZ1A 2W2NP 4CO1A 2M8DB 3PX0A 3M8RA 3WX4A 5EDWA 1S6PA 2GA7A 3RR8A 1FRKA 2JX2A 2VPZB 2ZOGA 1KRPA 3VQSA 4YHHF 3TAPA 1K73T 1QD1A 1NSAA 3DYAB 1JXLA 1TL5A 3Q0AA 1GFWB 2HVIA 3RUBL 3NGRA 1S77D 3FRYA 3AODA 4NLDA 2KXFA 3EX7B 4R0EA 4C6AA 1QE1A 1UKUA 4ECZA 4CH7A 4OMFG 4LF8J 4DV0F 2UVWA 2G2OA 3HCXA 1XMQJ 1KQKA 5KFEA 5FLXY 3C15A 1TL1A 5F8JA 2V9KA 2Z8QA 1ZA1B 2FGCA 5F8NA 3AOAA 3ZZOA 2XYHB 5SUHA 1IBLF 5AT1B 2E1RA 3CDAA 2BOAA 4HTIA 2M8HA 1IBMF 3X3UA 4RO0A 4GKKF 2WSEC 1PCAA 3ZZYA 1S6PB 2MZSA 1SV5A 2HGMA 2MKIA 1SC6A 3PEHA 2B0GA 3J80Y 4ZCIA 4WU3A 3FC9A 3SCJE 3AQPA 2QL9B 1F6TA 3GZ7A 3HVTA 1P8GA 4Y2MA 1N5YA 2QE5A 3T5JA 1LW0A 5I4MA 2WK4A 2BJ7A 4DPUA 3US5A 4RU9A 1QTMA 4U7UK 3MOZA 1BGXT 1HWUA 1RAEB 1S4EA 1RGVA 1XJWB 3W62A 4GVBA 2LLZA 4B3RJ 2N3OA 1QE1B 2DR9A 3AJ2A 1WJ9A 2FVSA 3ILJA 2GC8A 8AT1B 4DQRA 4EEYA 3C15B 1WKJA 4F4XA 4OIXA 3U1MA 1TL1B 3QBCA 1RA6A 3G2XA 1TVRA 2WAQD 2ZDOA 4CNZA 5D0HA 4AQYF 1F1BB 4ID8A 2OMOA 5H9FJ 1DJ0A 1P27B 5CYMA 3AD7C 1Z4UA 1XBWA 1B3TA 2XZDB 4K4YA 1SV5B 2WCXA 1BXNA 4NOHA 2R8JA 4MJKA 2RKIA 1I94J 3NLCA 3GYXB 3DHWC 5ETLA 1N36F 1AFJA 3HVTB 1N5YB 4PG8A 1LW0B 2OTLS 2W1BA 1SVDA 3MEEA 3H8YA 1M5VC 2L9DA 3UO0A 3R9LA 2E29A 4GVBB 1N34J 1QDUB 3CEDA 1JJ2R 4ERDA 5J2PA 2RAQA 5GVQA 4YN3B 5KFVA 5RUBA 2IM2A 1GMWA 4ILMA 5L1JA 2H48B 2ZH9A 4DSLA 3T1AA 2GV1A 3PYGA 4YEAA 1TVRB 4GKJF 1K0TA 1REVA 5D0EA 1PO6A 4C8MA 1Q95G 4DEZA 4KSEB 1S57A 2ATLA 3TUJC 1NK0A 4TYBA 1B0TA 2V4RA 5CYMB 2WTFA 3P6YC 1U1OA 2E9ZA 1T0TV 3T5LA 2G9OA 2KVIA 1BQNA 1YWXA 3MTKA 2FGOA 2RKIB 2HAIA 5K8PA 3ITHA 4OZ0A 5B0GA 1JJ4A 3BEGB 2CPXA 3DRPA 3ZZZA 2DGQA 3H25A 2A6OA 3MEEB 4LRDA 4HEA9 1DQAA 1R27B 4EYHB 1LWEA 2OP5A 4WPAA 5D78A 4FVCA 4MFBA 4CCHA 5F9NA 5J2PB 3UCGA 2A10A 2R7SA 1QVFR 3CDEA 2LA4A 4Q2LA 3DM2A 2AP6A 1Q82T 1NKBA 1VRUA 2HFZA 4QZVB 3MZIA 5HANA 2W7AA 3D3BJ 4LFBJ 4FYWB 1NNDA 3M8ZA 4OYWA 2IRYA 2XLKA 3CCES 4UF4A 4JP8A 3D1HA 1BQNB 3MUTP 3CF5Q 2UP1A 3EGWB 3ITHB 1EQMA 3HFKA 3EPGA 2LYVA 4UY8T 3DRPB 2A3JA 3BGUA 4PG5A 4P73A 2HHHJ 1NUEA 4EBDA 4ES1A 2EVZA 2RNEA 3B6BA 3C8YA 2O67A 1FO1A 3WIUA 1QAIA 1HNIA 1LWEB 4F4AA 3I31A 3I82A 1FNMA 4NLYA 4NXNJ 1TUVA 2FPHX 1XMQF 4XK8C 5KG1A 3DM2B 2AEFA 1WC4A 1P6TA 2VH7A 5KFXA 1VRUB 3BSNA 2ZH1A 4NMLA 4ER8A 3H59A 4L72B 3BM7A 3OTOF 2NXNA 4L74A 3W8GA 3N0VA 3AOBA 1FTRA 2CKWA 3K8VA 1EX8A 1RKJA 1VQYA 2MQMA 4URQU 4NA3A 2LQBA 2FC8A 4YDXA 4UTGA 3QSYB 3UDEA 5JJBA 1ROFA 3D67A 1VQ8S 2IBOA 1TL4A 5ETKA 2HRUA 2GCFA 4Z7CA 3OSNA 4IKAA 2YPZA 1U1QA 4U6PA 5CHCB 1HNIB 3PZPA 2QT7A 1U47A 3HK2A 3V6DA 1V3SA 4DSIA 2DRAA 3OTBA 3DFEA 2R8KA 4Z7YA 1PC4A 3E3XA 1IBKF 1U6BA 1VBYA 2V9WA 1NHVA 1LK5A 4EO6A 2FJXA 4MKVA 4QIFA 1ACMB 1UWAA 1ZM3A 1KTVA 3GP9A 1U8SA 4OX8A 1GH8A 5LM7E 2ZJRQ 1VR6A 4LFCJ 2EFVA 1BQMA 4PPDA 3SFUA 1EJ7L 2DISA 4JB8B 1PYTA 3HZGA 1BLUA 1I94F 1REGX 4DZ6A 3MCSA 3L7PA 1R6YA 3GCXP 3KG0A 3CD5A 4I64A 4LSLA 1FKAF 4V19J 2ZHOA 4LRBA 5IZHA 1NDPA 3PW5A 1TKDA 1SQGA 4M5LA 4ZPBA 2CJBA 3KG1A 5H9EJ 2YNFA 2ZWPA 1IKXA 1RT5B 2VKRA 2R8IA 3JB9k 1S0OA 3UI3A 2J0QD 4K50A 1RU2A 5L46A 1TMJA 1F60B 5KFQA 1S7IA 3MEDA 4M5GA 2B9EA 1UMJA 2B4UA 3JAMY 2B4OA 3AD9C 1TUGB 1U6FA 3GU0A 2BUNA 3W5ZA 2C3PA 4V19X 2E1PA 2QLBB 4URSA 3I0SA 1NAQA 2CPDA 2W4PA 1S99A 3TVKA 4CWBA 1OPZA 2V8GA 1BQMB 2JLGA 4IUFA 2NZCA 3ZC4A 3AJDA 3TA2A 2XGQA 2W25A 4MYUA 4DV4J 2KYXA 3UN3A 2VHGA 1TKTA 4C9DA 3OHAA 4LSLB 5E3RA 1SC1B 2I2YA 1X4BA 3CGIA 4FYVB 2BEFA 5B0FA 3ZZ0A 2HYIB 2ZOFA 5HL7Q 2YNFB 1QLNA 1IKXB 4ECWA 5DG8A 4LF6F 2Z2YB 2W24A 4K5SA 1N5QA 5KFAA 4R25A 1YVFA 3SCLE 2WBRA 3HJFA 3MEDB 5IC4B 2ADCA 5HQMA 3DDNA 4Q8FA 2ZVSA 3PHEA 5KFOA 2QC3A 3U1LA 4B9LA 4M94A 1RJJA 2DNGA 2VD3A 1X8DA 1KOHA 5HROA 1HARA 3I0SB 2BE2A 3P3DA 1FNOA 2W2QP 3IBWA 1FRJA 3L7OA 1VBKA 1FNXH 2DXDA 2V2VA 2DNYA 2W2OP 1VQ4S 3NS7B 5KFKA 4C8NA 1IM4A 1Q7YT 3KMQA 3CW2C 4FKYA 3LGHA 1TKTB 5BYRA 2CJXB 2P6TA 5HP1A 3VAMA 4V1Ak 2VL1A 3EVOA 3IBFB 4ECSA 2Q1LA 4OLPA 3TX0A 3FSXA 1WF2A 4A8YA 4K4SA 4J9LA 4CI0B 5BYSA 2RIJA 5KFCA 1WTBA 2DO0A 1VHIA 3BO4A 4J9SA 2XY5A 5HROB 4A8FA 5K20B 1RT2A 2BE2B 3DLEA 5EWGA 3ZZTA 3EICA 4O44A 1HBMA 1TAQA 4GO5X 5AE1A 2BJ3A 4OZ3A 2C2MB 3EZUA 3EGNA 3KDNA 1V3RA 3M6VA 2PI4A 4DX8H 4G1PA 2LXUA 5LMNJ 2WOMA 5HP1B 1YZ6A 1PIEA 2KB2A 2QLFB 3VQTA 4LJMA 5KFDA 2FDNA 4DSJA 4O0IA 1NZAA 2I8EA 1HI1A 2AKWB 1HNVA 1RBLA 2G0CA 1SPBP 1WNEA 1U49A 4LF9F 4K4WA 1BY9A 1KDNA 1XERA 1KNZA 3HD1A 2HQDA 2YNGA 2ROEA 5IWAF 2OD6A 1RT2B 1NK7A 3DLEB 5J1NA 4DQPA 3VAKA 4O44B 1U0SA 4DSFA 1HBMB 4ED5A 4DV2J 4P9SA 5HLFA 4LFCF 2E1AA 2B6AA 3KK3A 5A76A 4O3PA 3NCRA 2FUG9 4EWTA 1T11A 4ZP8A 1JLQA 4PG4A 1WOSA 2M2BA 1FJGJ 1AT1B 4R5PA 1VQPS 4WP8A 4WXOA 2V94A 2WOMB 1P9QC 1IR0A 3DU6A 4FYXB 2AYEA 2KHCA 4OJGA 4DFKA 3FCWA 2DIVA 4TKTA 5GAGI 3IR5B 5F8HA 1VGYA 2CJ9A 2DEJA 1SQEA 4GRSA 3O6QA 1YHQS 3VVUA 2LEAA 5D4OA 4OHXA 1T3NA 1V5VA 1HNVB 2NCKL 4HDGA 2AYGA 2A1BA 1XIQA 5J2QA 3SXLA 2AEMA 3NAIA 4U67Q 4B9TA 5CYQA 2VPYB 5KAKA 4PRFA 2YNGB 3F56A 2WB4A 3QNWB 4RJVA 1MG7A 1BQXA 2LU2A 3B4MA 3KJFB 3R3TA 3VV2B 3H5YA 5E3QA 1VQ5S 1B70B 4BHQA 5HLFB 4XDDA 2QA4G 2J9DA 3UFCX 2RH3A 3KK3B 1J5EJ 2YKMA 1SKUB 5HJXA 1AROP 4UQTA 2XMKA 1JLQB 2EKNA 4XAKA 1X5OA 2BOPA 4R5PB 2HVDA 2FVRA 3SFGA 4J91A 1ZS6A 3PY8A 4RNHA 4XIUA 3K2YA 3D28A 4Y3CA 2MGZA 4M5HA 2NPIA 2E5LJ 4HACA 4O4RA 5EN1A 5HBMA 1Q5VA 1S1VA 1R31A 1TTHB 2Y1LB 2AU0A 3PXGa 2CNKB 2FLOA 2UXCJ 3BDPA 2HGLA 1BUXA 1RQ0A 5E7OB 5CYQB 2MB0B 1RHQB 3TQEA 5A8WB 2M88A 4U96A 1WF0A 3DOMA 1UJ6A 8RUCA 3V6JA 3PRDA 2IA6A 2BJ9A 4J9UE 4N47A 1N5VA 2CPFA 5A6WA 3OL8A 2YKMB 5F41A 2DNZA 3U02A 2VFTA 2HS4A 3C66A 1U1LA 2PA3A 2ZBIA 4KHMA 5CZVA 1RTDA 9RUBA 2HVHA 2U1AA 3C14A 4LBPA 2MGZB 4MIWA 1WUUA 2MJUA 3ISNC 1ZPWX 4HACB 5HBMB 2GGPA 4YFUA 3D7SB 1S1VB 2IJNA 5LT5A 4ANDA 3I55S 4DV3J 3G6XA 4K0KJ 3WC0A 3Q8PB 1T02A 1EETA 4UUXA 3CC4S 2VDIA 1CEZA 3EVWA 4IOAQ 2ROGA 1KHVA 4IQMA 5HMYA 3DOMB 3RAMA 1YRTA 3GIRA 1HLWA 6FDRA 1XEZA 1G4CA 2EKYA 3PO4A 1NH7A 2ZM6F 3RB3A 2NQPA 2N7CA 3GFHA 1DQ9A 4ZJLA 3TWZA 4TQSA 3D6FB 4CIOA 4X84A 1U6ZA 3I87A 2SXLA 3KLFA 3D9BA 3RGIA 1S6OA 4MYTA 1D3WA 3W61A 3LP0A 1HNZJ 1CJUA 1RTDB 2AJFE 4WBFA 3HMJG 4ED3A 4RW4A 5LMNF 3C14B 4QJVA 5L9XA 3H2UB 1R0BG 1SH3A 4F4WA 4YP3A 1LWFA 2XWXA 2GGPB 3D54A 3RAXA 4JI6F 4ZVHA 2RRBA 3M8YA 2H4WB 3KHGA 4H4KA 1DQ8A 3UCUP 1GNKA 4F3QA 4C11A 3TQ1A 4MTPA 4QWEA 1EETB 2IFXA 1OJ4A 1BHNA 1N33F 5HO4A 2KI2A 3MR7A 2IA0A 1WTFA 3M2UA 5IV3A 4F04B 1S1TA 2X1FA 2B9YA 3D6HB 4PG7A 2V8DA 4QPXA 4AL6A 2ZVIA 2W2MP 4DL5A 1KQFB 1OY8A 3Q8UA 1RKIA 4DV2F 4QIGA 4ZVSB 3KLFB 3BSCA 3G82A 2P9EA 3LP0B 3AXKA 1GK8A 1CJUB 4CO4A 1FA0A 3GPAA 4LF4F 2JC0A 3A8EA 2QA1A 5KFMA 3RB0A 1GTHA 5J2NA 1WC1A 2NUHA 1LWFB 1WACA 3SSQA 1GAOA 2DGTA 2IJFA 5AE3A 4MIAA 5DM7Q 2XY6A 2ASJA 1OYDA 4DN9A 3MECA 1FKPA 4A8XA 4MK7A 4JI0F 4K2XA 1R6VA 1X0PA 4H4KC 4ES3A 3FUYA 3T9ZA 4F4KA 2WVEA 3PR4A 2PFFB 3BJYA 4USJC 5C5JA 3FEZA 3EVMA 5GAHI 3I5BA 5BR8F 1S1TB 4F4ZA 2D3O1 3BR8A 2QA2A 4NPOA 2JLFA 4UOHA 1SIZA 3DKDA 1HKAA 4WCEQ 1RAOA 1R8AA 4QW9A 1KVIA 1AZSA 3DC2A 3G82B 1H0HB 2D3OR 1IR2A 4OI1A 4JV1A 1HNWJ 4JI3J 3N5FA 3TI0A 2Y9HA 5KFBA 5J2NB 3F73A 4UY85 3VTIA 2BR0A 2E5LF 1N0VC 1EQ0A 3G6VA 2HHWA 1U1KA 1VBZA 3IP0A 2AJQA 2E44A 3MECB 1FKPB 3ADAC 1QUVA 2C3MA 4P2XA 3DXBA 1TUWA 4H4MB 5LSOA 1NO8A 3UWTA 1CC8A 1X9MA 2E9RX 3AB2B 3MAAA 4ZJOA 4ZVFA 3HI9A 3IMQJ 1HD0A 1GMWD 3GONA 4KY3A 1JKHA 5DDPC 3GLJA 3PHTA 4ZK7M 3R27A 3VAJA 2DH9A 1AZSB 2VFVA 2KXHA 1F2HA 2OKQA 4CLZA 2CPHA 5KG3A 3S7RA 3LA0A 5KFYA 1X0FA 1JLFA 4X4SA 2RS8A 3HFVA 3SEOA 2OUGA 2C22A 5DG9A 3DGVA 2RQKA 1N32J 4WFYA 4E8UA 4DFMA 2YPYA 3R5CA 3SIPB 2CZ9A 2XZTB 5DO2A 1HPZA 2XMTA 4Y28C 4YB5A 4AUKA 1PYOB 2HFOA 3QZ7A 2KRBA 3DDIA 5HN0A 4PABA 3KLHA 4J90A 5EUHA 3H90A 2OJ3A 3Q89A 3CD0A 3MAAB 5KFNA 3O8WA 4G6VB 1IQTA 3HSJA 4LQ3A 4W4MA 5A2QU 3IAM9 3THPA 5DETA 3CCZA 2DH7A 2K1RA 1RUSA 2L48A 1JLEA 1NJZA 2DD8S 4I2PA 3JQMA 3AXMA 1S0NA 4DXLA 1Q16B 3BGOP 3JSRA 5KT4A 1HNZF 3MPWA 4EU0A 3RRKA 1VIOA 1JLFB 4DR5F 4C4WA 1D8ZA 2QMWA 4FN5A 5IQQA 4IFYA 3JTPA 1S72S 2FZGB 1QVGR 4Q5VA 2CQ4A 2G2YA 1YI2S 4MKYA 5IT0A 1WC6A 3RRHA 5J1EA 4RLEA 1YBAA 2DEIA 1NJIT 3G87A 2J7WA 2GIQA 2KRRA 3SQGA 2HHVA 2BJDA 5A0YA 3VZHA 3MD3A 4KC5A 3GIMA 4K5RA 4QOTA 2L3MA 2Z2MA 3KLHB 3OJSA 3KXDA 3UNGC 4OX9J 3C3LA 2FVQA 4WJBA 1H2VZ 4JOUA 3H2VE 5DQHA 3GR1A 2BE7D 2XEXA 3QJLA 3V5RA 3CT9A 2C2ZB 4ZPDA 4CP5A 2K1RB 2HHSA 4PQUA 2JOQA 4RBUA 1JLEB 3WC2A 3K5LA 2E7VA 1X7VA 4I2PB 4XPCA 1UEKA 2E5JA 4JI4J 4M63A 4B08A 3C46A 3AA9A 1TQLA 2XHWA 3Q8VA 5IM0A 3Q24A 1B0VA 1NLKL 4WTOB 3RB4A 1SH2A 4Y2KA 4DL7A 3BBFA 3KJQB 5HSPA 4CZCA 1W26A 2FHKA 5J1EB 1F5CA 1HW8A 2AWZA 3SQGB 5A0YB 1FXLA 3ZZUA 4NXMF 4K8RA 1RCXB 3NY0A 1I5OB 3J7YI 2LP4A 4ZPAA 2F8EX 1XNRJ 2BMBA 4B9NA 2N82B 3NAHA 2LEBA 5MAOA 1UEVA 4WFNQ 1WI6A 3M1VA 2J8AA 4LMZA 2B7CB 4CLLA 3QT5A 2M70A 3IWLA 4PQUB 2RU9A 3GMGA 4DN0A 4ED1A 4B17A 4USMA 2ZFHA 4ZVQB 5F3ZA 2R42A 2OSRA 1OIAA 3CCRS 4UQGA 1KVKA 1EARA 2IM0A 4YUDA 4X4VA 1H38A 1AB8A 2ZH3A 1FX2A 3QSIA 3FZ2A 5IM0B 4K4TA 2HRYA 3M4XA 5LL6d 1NPKA 2ZH5A 2XY7A 4CLPA 1UVIA 2LEPA 2UUBF 3OR2B 4DCOB 4DFJA 5EWFA 1JXVA 1KQGB 3CO9A 2ZJPQ 3A8KA 2JFDA 3MGJA 3BB5A 3SCKE 1C4AA 2RQMA 3EUNA 1M1GA 5U47A 3ZTOA 1R43A 2IIHA 2E1MC 3G86A 2XYGB 2EBGA 2BE9B 1VOMA 2M3DA 4HL9A 1QUPA 2CVIA 3BH6B 2D3ZA 3NCPA 4FKXA 4D3GA 3M1VB 2CQ2A 4NLOA 4EI2A 2ZZNA 3QO9A 3TVYA 2HRTA 4TY8A 4USTA 2JNJA 4LQ9A 4IRKA 2OELA 1H73A 4X64F 1TK0A 4NA2A 2JLEA 1JLAA 2XSFA 2HNYA 5JXSA 4DCPB 3W3SA 5B7WA 4N77A 1U26A 4TXSA 3TANA 2B9XA 4B9UA 2NS1B 1HWLA 4YB6A 4BC9A 2MZTA 2EI5A 1RHJB 1WELA 4I67A 3JSBA 1Q7LB 1ZM2A 5DLFA 5I3PA 3A4TA 3PJ9A 4I6WA 2FLNA 2FTRA 4ZKAA 4EUVA 3TW0A 3SSSA 3TVZA 1JK9B 4QR2A 3UR0A 3NNCA 2R8HA 3HHLA 1PGZA 2DVIA 3QO9B 4TY8B 2VC1A 2CUYA 1RCOB 3BYPA 4NLXA 3KK1B 4ZPCA 2Y1IA 4ZN3A 1JLAB 2GJIA 1IM6A 3VAGA 1YZ7A 4PWUA 1K47A 1S1WA 2DNHA 2HNYB 4DWIA 2AJ2A 1RSCA 2DH8A 2R7TA 2ILZA 1WKLA 4L3NA 2DHGA 3QT6A 4LF7J 4LUBA 4FF4A 2V69A 3CDWA 4DL2A 2BM0A 2UUAJ 1YRUA 3MM7A 3OQ2A 3TARA 2G2ZA 2FY1A 3Q8YA 1LOUA 1FFWB 2X3DA 2HFUA 4YS2A 3VWSA 2F4FA 4KGVB 5JMNA 5L1IA 5GAGU 4IR1A 2H1YA 2RILA 3O3LA 2Z58B 3DLLQ 2GZOA 2DNLA 3C16A 4OX9F 3PKMA 4OQJA 2HAFA 1DAXA 4EYIB 1Y3KA 4WFBQ 3HHLB 4JI7J 1FF2A 1WEYA 2VJVA 1Z1ZA 2CYYA 3ET6A 3HHLC 1RTHA 4IG0A 1FRLA 3G8TA 3PM9A 2FJAB 3DU5A 2O5DA 2KFNA 1HHSA 1G6BA 4DLGA 3K5PA 3N01A 1C0UA 4ITSA 3IR7B 1S1WB 2CQPA 4OYBA 3QLHB 3FNNA 4DR1J 4CM0A 5F8MA 5D0GA 1U45A 3SDEB 1X5PA 3CJ4A 1NDKA 2DGSA 2W8LA 4Q44A 2YNHA 3MM7B 1D09B 4LF5J 4KHPF 2VPWB 4NCBA 3MDFA 5C24A 4DR4J 4NZ7A 3EZ5A 3T19A 2LU1A 1F9HA 1FWLA 2MLYA 2C2KB 5KG2A 2JDJA 1VQLS 1UWBB 3A8IA 3ZNJ1 1FE0A 3C16B 3QFHA 3JSMA 1OSCA 3BREA 3DN9A 3QZ8A 1ZTWA 5CH7B 5G4DA 1X9WA 3M30A 4ZDNA 4ZPWR 4C97A 5IQ6A 2R7QA 3GSDA 1QSLA 5DZ6A 4DR3F 1RTHB 4IG0B 4FP9A 4KIAA 2BM1A 2ZBPA 1VMBA 4X66F 4LBIA 4A8QA 1C0UB 1HL6A 2GJFA 2RD5C 1FCAA 2WVCA 5C42A 1WOPA 4KV8A 1RP5A 2IYGA 4ZLNA 4NLWA 2HZAA 4O3RA 1WDDA 3BPSP 4HT7A 3BV8A 3HULA 1AUDA 3OUYA 1IWAA 1YG0A 4ZMMA 3EDRB 3DRXA 2YNHB 3IN5A 4WFXA 5C24B 1QTNB 1RAHB 3LO3A 2KH9A 4RW6A 3W1YC 5KG5A 2KG0A 3OL7A 2G0JA 1A0OB 2UU9F 2X3GA 1H2UX 1WHYA 4CH1A 3S8SA 3JSMB 4JBCA 3I5CA 2G1DA 1L3SA 4NE9C 3R6LB 3W2VA 1GXLA 3M30B 4Q8EA 2OD4A 1TK5A 4AYBD 2J6UA 3FJ2A 2K3IA 4P6QA 2RQ4A 1HR0F 1KHWA 2R7UA 3OFEA 1AA1B 3QAEA 2JH3A 5BJRA 3DLJA 1RYRA 3IGVA 1GEHA 3MURP 5C42B 4X65J 2V4QA 2OPQA 3DLGA 3GG1A 4CT9A 1FFGB 4DX5A 4KV8B 3MM6B 1N4LA 2FC9A 4USWA 4JI2F 3L4BC 3IA0A 1RHRB 4C2MA 2MQLA 2F63A 3FFIA 2PMWA 4GC6A 2H65B 2YVSA 4ZP9A 2XSJA 3MPYA 4A8OA 3BGFA 3GILA 1S1XA 3OHBA 3FMWA 1C1BA 1RBAA 1SJ3P 3P96A 1CG2A 3M6UA 4RW6B 3BBCA 3ILIA 1NKCA 4ZCKA 3R5DA 3I4PA 4DS5A 4IR9A 2C28A 2DNNA 3T1HF 2ASDA 4NCGA 2WHOA 1WC3A 4JI5F 4A4JA 2WSCC 1RLCL 1ZAVA 1Q1KA 2XNQA 3W2VB 2AGOA 2L9NA 1R0AA 4M5MA 1YJUA 4FVMA 5HMXA 1MWQA 3J7A1 4HH0A 2BJ1A 4BS2A 2J9DE 5H9FK 4AE5A 1S10A 2JVRA 3M32A 5D77A 2ASYA 2PE8A 2K06A 2OPQB 3DLGB 5ETPA 2UVRA 1YITS 3LALA 2BJEA 3QPIA 2HWTA 4HLBA 4NZ6A 2M0GB 1EAYC 3ILOA 3FFIB 2KVQE 4B3MF 4LF7F 1X5SA 2V50A 5IT9U 2XSJB 3MCMA 3Q83A 1UVKA 2L41A 1S1XB 4I7FA 1C1BB 4JV5J 5EGYA 2IPOB 3B4DA 3CXCR 3BF4A 4OYOA 4RUBA 4NCGB 4F2RA 3ZZRA 4FXWA 1GT8A 4KB7A 2IVYA 1VISA 1NZ8A 4ZP7A 2DNPA 2GQ2A 3OVBA 2HK2A 1T03A 2WSFC 4L73A 1R0AB 4ED0A 2NUUG 3CNQP 3DCAA 2HZCA 4JI7F 1O51A 3AB4B 3VHQA 2ALYB 4ALZA 4KT0C 1YIJS 4YB1P 3MUMP 3LTOA 4CQ1A 4ECUA 4JYAF 5GAHU 5LMUJ 3NWRA 1VLOA 1MMNA 3M32B 2G4BA 2VOOA 4P72A 2DY1A 3W2WA 4L76A 1TKXB 3OLBA 5AXKA 1FKOA 1F0XA 3QIDA 2R3VA 2ZKUA 4O3NA 3H0PA 1DBDA 3MM5A 1HI0P 4DR1F 3M7VA 4OI6A 4C8ZA 4MKAA 4IRDA 4WE1A 1NK6A 1HWKA 1JLBA 3VAHA 1NHKL 2MQQA 2RE1A 4I7FB 4N8OA 2C1EB 1Y5NB 3EMTA 1SL0A 5J2MB 2AHOB 3QIPA 3RYLA 5F8GA 3RB6A 4MT1A 2KXNB 3BGRA 2FZCB 2BRKA 3D0IE 4DI6A 1CJKA 5MLCV 3OW2R 3CTRA 3JQJA 3D6TB 4NCAA 1RT4A 3WIVA 2GHPA 1RWUA 3M6XA 1L3TA 3HHDA 3ZO7A 2A6MA 1FT8A 2AQ4A 3W2WB 3J81Y 1FKOB 3D1OA 4JUZA 1R3NA 3FBCA 4B3OA 2AT1B 3MM5B 1ZAXA 3LGMA 1RI7A 2GNKA 5KFWA 5I42A 2FYXA 3QRQA 4WE1B 5D3GA 3HF5A 2H3EB 4ELUA 2OMLA 5ETRA 4CLYA 3K5MA 4UOFA 4XO0A 4P71A 1W7WA 3QIPB 1N52B 2DNOA 2OFGX 1QM9A 5HQLA 2D9OA 3GIIA 2VBWA 2IVMA 2FZKB 3CJKA 4XTTA 2EFOA 4P74A 2RUGA 3BGRB 4FF3A 4WIQA 4O3OA 2DNMA 3OV7A 3FK4A 2GX8A 2MSSA 4USHA 3HJVA 3AA8A 3W9IA 1SUQA 2LFVA 1RT4B 4G1QA 4QYZJ 2R7WA 2UXDF 4U9RA 4NLQA 4F8RA 1RWXB 2MSTA 1DZ5A 2E1CA 3FEXB 2PEHA 3PIOQ 4NX9A 1K1SA 5ETOA 1YKWA 4W90B 2C2DA 2XTJP 4OYXA 4PG6A 2IJRA 4A8MP 4TN2A 3TZZA 3CIMA 4B3OB 4OZ5A 2I5JA 5B0DA 2AZ3A 2D74B 4B3SF 3G4SS 3N5BA 2F8HA 5I42B 2WBMA 5CAAA 2BQRA 1LWCA 5D3GB 3CULA 3FQLA 2F4VJ 5KFHA 1X4FA 3M8PA 5SZTA 3U1NA 3UDVA 3OD2A 1KWMA 2HFNA 2MPUA 2CQIA 1H7XA 3K57A 3CJKB 1TAUA 2RRAA 3DDKA 1NPPA 1RWMB 4Q7AA 2NSBA 2Y3YA 2FY8A 1RAAB 2JSXA 1QSYA 1SUQB 2UVVA 1GX5A 4G1QB 3BQ2A 4E0DA 4CO2A 1RTJA 5CYJA 1M5KC 5C2GA 2CXEA 1UA1A 3I32A 2HMIA 1SC3B 4UT4A 5F9LA 1P1TA 5A8RA 2HLUA 5E3CA 2VA3A 1U25A 1Q8BA 3MMBA 1NU4A 4RBTA 3T6BA 2I5JB 3OVAA 1WHXA 1UVLA 2WONA 2B8QA 1IBCB 1LWCB 4M5JA 3EE3A 3UD4P 1HI8A 3M8PB 4QQBA 5H9EK 5A6PA 4KPYA 2J7UA 3B82A 4DG1A 4UOGA 4U7CA 2AGPA 1YLXA 5KFGA 3TUIC 2CPIA 1NHUA 4DV7J 1EIYB 2KYZA 3PX4A 4KGKA 1MROA 4ED4A 3KTQA 4QBUA 1RTJB 3J7YU 1HNXJ 5JUMA 2F40A 1LK7A 1TU0B 1WWHA 3ZFVA 4AD6A 1FDAA 3QGGA 5E3AA 2HMIB 4LSZB 2PMHA 1WSRA 5A8RB 4ETZA 1EKRA 2EFGA 4ZLPA 3MMBB 5BXIA 2C3YA 2YXLA 1UJ4A 4NLPA 2YX4A 2DPIA 1KD1T 2Z30B 1FJCA 2WONB 2XS2A 1H6KX 2B43A 3BKTA 2DHHA 4CNYA 3TX8A 1LXNA 1LFWA 2NXCA 1H98A 3ENAA 4JI8J 2BACA 3HPOA 4QR0A 4ZLLA 5C25A 4DG1B 3IR6B 1F9EB 1JJCB 3NGKA 2R7OA 4OYAA 3BSAA 1XR6A 3HXMA 2R7VA 1BWVA 2MTLA 3CO0P 2XCAA 2AEJA 5KFTA 4WFAQ 1MROB 1GMVA 4P52A 4NASA 3AFGA 2HG4A 1G3OA 3UDCA 3T1YJ 4I4BA 2ERRA 1YJRA 4DF8A 3OL6A 5IS2A 4LSNA 2QMXA 3HP6A 4PXEA 1JB0C 2R9LA 7FDRA 4DZDA 2I6WA 1Q86T 3J7ZT 4LFAJ 2Y0SD 2QGFB 3IBCB 3TP2A 2OPPB 1KS2A 2LA6A 1T9UA 4RW8A 3WBZA 5LXRA 2V2ZA 3D0GE 1U4BA 2J6TA 4IO9Q 1H74A 5C7PA 4IQXA 3CMES 2PD1A 2YTCA 2M9KA 2EEYA 3PRVA 3VR1A 5C25B 4X4RA 2QX0A 4F26A 1E6YA 3CMQA 1YJWS 1M5SA 2DHSA 3PYEA 3LGNA 4ED2A 4QIVA 3HDSA 1X4AA 2JRSA 1YK9A 2HQIA 1FRMA 3CJ3A 4ZLJA 4KKOA 3K59A 3MUVP 3LPYA 4J9RA 2W01A 4PUOA 4DR7J 4PZVA 4OHWA 1VYAA 4Y34A 5KFZA 2LECA 4DR6J 4LSNB 4KPCA 1SB6A 2OHDA 4OZNA 1N56A 5I3UA 1B0PA 3LF0A 4O0NA 3BPDA 3KDOA 2KHDA 3OLAA 1RABB 3D2WA 5FLXU 2H4YB 1F5AA 4FS1A 4RW8B 1RXOB 1C0TA 1CJVA 3AJ1A 1FX4A 5DGAA 3MPUB 3M9MB 3DGPA 1T9VA 2F4VF 3N6LA 2HIYA 1LFPA 1Q0NA 3Q23A 1E6YB 2V6AA 1T9WA 1HMVB 4LF8F 1FK9A 3MHYA 1LW2A 3GIJA 2G1HA 2GAHC 1HBOA 2YNIA 3PJWA 3J80U 4DF4A 3TRGA 1FERA 2HW3A 2P9CA 4FF1A 4K7QA 1XK8A 1RAGB 4KKOB 2HPUA 2R2UA 3UN5A 1JLGA 4YY3J 4PUOB 2ZBQA 2XGPA 1NCLA 1KKHA 4J9QA 5KFJA 3Q8RB 2XI2A 5I3UB 2MZQA 2VC0A 4Y2IA 3JYTA 4FBUA 3PW7A 1UL3A 4Z2XA 3CE8A 3TEGA 2N4CA 1PBAA 5ETVA 4W98A 1VJWA 4IH5A 1APSA 1KLNA 4KFBA 4ILRA 1W25A 1C0TB 1CJVB 2HVEA 1UEUA 3MOJB 2BXJA 3DGPB 3AH6A 3MM9A 2F9DA 3GJSB 1Y0HA 1KBRA 1RT5A 4B3RF 3E51A 2R2SA 1Z2LA 2P8IA 3D3CJ 1FK9B 4WIIA 1LW2B 1NXIA 2FHJD 2GJ2A 1RT7A 1HBOB 2YNIB 3R5BA 2JFKA 2QJ3A 4I69A 2NR0A 2DGOA 2MQ8A 1S49A 2W8KA 4ZVUB 3A3OB 3K7RA 4DUZJ 3JS9A 2D7SA 1JLGB 2CG4A 3DOKB 1YBTA 3P5BP 2J9CA 2E5HA 1WC0A 2ZHBA 4ZHRA 3QWUA 2X1AA 2RJZA 1ZH5A 2BX6A 3G9CA 2MYFA 1NB2A 1SH0A 2DO4A 3JYTB 1RWOB 2OGUA 2XS5A 2KFYA 3A12A 2CZ4A 4KFBB 4MK9A 2DRBA 3GE9A 3LQVA 3IM9A 3CPWR 4Y2CA 2V8VA 1QY7A 5M2RA 3MM9B 4LF1A 1YDLA 4EFAC 2KN4A 4JI8F 1KFDA 1SC4B 1KP6A 1N34F 2DK2A 2KT2A 3PW4A 2EXUA 4WFZA 3CJRA 3H2LA 1S9GA 3HKWA 1RT7B 1Y00A 3V2UC 3FVYA 3EXCX 1X60A 4QW8A 1VIXA 1YTYA 2ZKTA 2PO4A 3LWMA 4PYDA 5D15A 4PXDA 5GMKa 2KJVA 4AL5A 1JIHA 5KFRA 2LQJA 1N6QA 2NLWA 4TLQA 3T1YF 2CVEA 3VGVA 1RYSA 4PPZA 4Z37A 4ZHRB 4P10A 3EJMA 5ETMA 1SIWB 3SYZA 5DRKA 4AFFA 3MAQA 2UVUA 4DQIA 4KO0A 3DOLA 4IOCQ 4YR3A 4A47A 4YHHJ 2VQFJ 4LR7A 3DMJA 3O1LA 3R1HA 1VQ7S 4MKBA 2VFRA 1YSJA 3QQCD 5GAEU 3C6UA 3GV8B 1J27A 2VDHA 3HHEA 1U48A 1X9SA 2XHCA 1MLAA 4KBIA 3CD7A 3MCOA 4Q2MA 1S9GB 2K7KA 3KUEA 3M2VA 3I0RB 4W92B 3K5NA 3HD2A 3IXQA 4EBEA 2I1RA 3CC2S 4FYDA 3QAUA 4P2FA 3TR5A 5LSRA 3ENQA 4NL5A 4D3HA 4OYZA 2MEWA 2XO7A 4Y2AA 2C2RA 4HT5A 4RW7A 5L39A 4C3LA 4MK8A 4GO7X 1N6QB 1IBLJ 1TL7A 2OEKA 4BDPA 4LFBF 4KAIA 3GSIA 2LQ5A 2F9JA 3VZIA 1Q8IA 4DR6F 1IBMJ 2C3OA 1V9OA 4TVAB 1V6HA 3I56S 1FTCA 1NEEA 4GKKJ 3BO3A 3EZOA 3R2DJ 4KO0B 3DOLB 2PA8D 3CJ5A 2YWFA 4WP9A 3AD8C 4EO8A 4DPWA 2BBEA 3IFEA 4ETXA 5DDRC 2KZZA 3DMJB 2HHHF 2AGQA 1KTQA 5JVHQ 4ANCA 2ZHAA 1HYSA 1XWLA 3C6UB 5CD4H 1BD6A 2YKAA 4F2SA 1DHMA 3A8JA 4NXNF 1RZMA 1HBNA 2O3DA 1NM2A 3LANA 3GV5B 1QAJA 3M2VB 1Q5YA 2GIFA 1TV6A 2EPIA 5D6GA 4G1IA 2GMHA 4CT8A 4KQZA 2BV3A 4K4UA 1I6JA 5H1SV 4RW7B 4FNHA 4HHHA 1TL7B 4AQYJ 2LKZA 5CCLA 2YWHA 3VVTA 3NMAA 3C6TB 3DRRA 4C98A 3DI6A 4L6V3 1GMUA 4PQAA 3NNAA 1FXDA 2QL5B 1SL1A 3UQSA 1UVJA 2DR7A 4A8WA 5E33A 3M8WA 1DLOA 2IM3A 5K5MA 4USUA 3R7BB 2M52A 1HYSB 1UTAA 1CSJA 2FB0A 1RWWB 3WX8A 3GB0A 1HBNB 2QSFA 3L9ZA 2ZD1A 1TV6B 4CM2A 1NJWA 3OSPA 3IRWP 4N41A 2B4PA 3BKFA 3CJTA 4G65A 4LR9A 5KG6A 1VQKS 3M2RA 2BABA 5FDLA 3CCVS 4ECRA 1M5HA 4GKJJ 1YRXA 3UN2A 4DUZF 5AJ3J 2YKPA 2PT0A 1NK4A 3JTNA 1MMLA 2YWKA 5K8OA 1OYEA 2HS3A 3DRRB 3T9NA 3DLBA 3DI6B 2Q43A 2R4FA 5CXTA 3IC1A 4BC7A 1I51B 3ZTRA 3PW2A 1VQOS 2APOA 4NEZA 1Y9OA 1XMOJ 4DJBA 1DLOB 3JAMU 1XC9A 2DRDA 2FVCA 1PBUA 1OY6A 4O3SA 2IAJA 1X4HA 3THVA 5LJ3Y 2MHEA 3B78A 1S6UA 2CQ3A 1MMDA 2DGVA 3PTWA 3W64A 1DARA 3TO8A 3FDSA 2ZD1B 2AJ1A 1PJ7A 4L3KA 4U8VA 2IYIA 2EK6A 3I9V9 3M2RB 4M5DA 2Z2ZA 5A8WA 5FDLB 1VI7A 1T95A 3R8YA 2ZNZA 3K8WA 2JHEA 4OLOA 2QA4S 2HHUA 1AYEA 1T8EA 3DXSX 4C8YA 2C42A 3OTDA 2ALZA 1NH8A 4URGA 5HJYA 4DV4F 1NDCA 2KJWA 3D0HE 2DR5A 5I3QA 3ETMA 2HNDA 4I68A 4MMOA 2XMUA 2VQFF 1IR1A 4F25A 3ONQA 2H5JB 1IUJA 4BWMA 1RE1B 2IAJB 4CO5A 4TU7A 3WQPA 3N9UC 2QTWA 4PYAA 1PSDA 2QIFA 1Y11A 2EC0A 2RS2A 3LUYA 4UZCA 2WRMA 3CCMS 4TYAA 3TJAA 2HQ3A 1KFSA 4O3QA 4GC7A 2CQ0A 4KR0B 3PVXA 1EKSA 3ETOA 4M5DB 5HAOA 1X4GA 2YWWA 2B56A 2DGWA 2E5IA 2XMMA 5L9NA 5E0OA 1ZOTA 1K44A 3ZTPA 1Q8LA 1NJYA 2LDIA 4DL6A 3OTOJ 3R5GA 2N4DA 2G0IA 4RNNA 2L08A 2XMJA 1S0VA 2CPJA 5KOWA 4C3MA 4F0KA 1QSSA 1FE4A 2MQOA
chains in the Genus database with same CATH topology
2YNHB 1F60B 2EFNA 3IN5A 2HNDB 5KFQA 2Q79A 4WFXA 2AYBA 3MEDA 3HO1A 1HD1A 2LXIA 5C24B 1UMJA 2EBEA 2B4UA 3JAMY 2B4OA 3L3CA 3LO3A 3OXFA 2KH9A 1SKRA 3TAQA 1U6FA 4FF2A 4RW6A 3TAMA 5KG5A 2KG0A 3HLUA 4I2QB 1S48A 3PDNA 1FVSA 5M2PA 3I6PA 3IWXA 5B0BA 2BUNA 3OL7A 1SJFA 2C3PA 3OFHA 4V19X 2UU9F 4EBCA 2X3GA 1H2UX 1WHYA 4J9KA 4CH1A 2OPRA 3S8SA 4URSA 2V4JB 3GWCA 3I0SA 2YH1A 3JSMB 1NAQA 2RDIA 2HHPA 2Q66A 2CPDA 5IXUA 4JBCA 2W4PA 1FD2A 1T05B 1S99A 3I5CA 2CQBA 2G1DA 3TVKA 1L3SA 1OO0B 3DLKA 1E6VB 1OPZA 2KDOA 2V8GA 4PR6A 1BQMB 2JLGA 4IUFA 2DB1A 1LQ9A 3W2VA 3ZC4A 4IFYB 3HHKA 1RT3A 4JV0A 3TA2A 2XGQA 1GXLA 3P5TL 3M30B 2W25A 3GFZA 4MYUA 4Q8EA 4CH0S 2OD4A 2MQNA 4NLRA 1TK5A 3IWNC 4AYBD 1S1UB 4DQSA 2KYXA 2J6UA 3FJ2A 2K3IA 4P6QA 2FIUA 4JV5F 1H2TZ 2VZ9A 2RQ4A 4Y00A 4C0OC 1HR0F 3VAIA 1TKTA 1KHWA 1U2RA 4C9DA 3OFEA 2R7UA 3OHAA 3QAEA 2JH3A 5BJRA 2XNRA 3DLJA 2ZE2A 4LSLB 5E3RA 3BSOA 1RYRA 3I5AA 2I2YA 3IGVA 1HW9A 1VQ9S 2J6SA 4OI3A 3MURP 5C42B 1ZTTA 1X4BA 2V4QA 2JEJA 3CGIA 2OPQA 1WI8A 3DLGA 3GG1A 4CT9A 4KV8B 5B0FA 3MM6B 3NRBA 3UE2A 3ZZ0A 2HYIB 3FRZA 1N4LA 3X1LB 2ZOFA 4OZLA 2FC9A 5HL7Q 2YNFB 1QLNA 1B7FA 2QEXS 1IKXB 4JI2F 2RQCA 4ECWA 1DTTA 5KOXA 1YJNS 3IA0A 3H20A 3PRBA 4C2MA 5DG8A 2AD9A 1J5OA 2MQLA 2VKZG 2IRXA 4RKUC 3RBEA 4LF6F 4R8UB 3FFIA 4GC6A 2YX7A 2YVSA 1UFWA 2W24A 5E5NA 4ZP9A 3R1LA 2XMWA 3MFIA 2V8HA 2XSJA 3MPYA 2BZ2A 4K5SA 1N5QA 5KFAA 4R25A 1YVFA 4A8OA 3SCLE 4XPEA 2WBRA 3LH2S 2A2CA 3BGFA 3GILA 2R8GA 3HJFA 1S1XA 3MEDB 3OHBA 1A7GE 3FMWA 1C1BA 2ADCA 1C2PA 2RRNA 3DDNA 5LMUF 4FNIA 1SJ3P 4DFPA 2D1CA 5B0EA 4WZQA 4IO1A 4Q8FA 2DT9A 2ZVSA 3PHEA 3P96A 1R8HA 5KFOA 1CG2A 2OLWA 3M6UA 1XR5A 4PXBA 3MR6A 4RW6B 3TAMB 4H54A 1HHTP 1KSPA 1NKCA 4ZCKA 3U1LA 4B9LA 3R5DA 3I4PA 4DS5A 3UCZP 4M94A 1RJJA 5FD1A 1RK8A 2V2KA 2DNGA 2Z2LA 1VQMS 5E41A 3IO1A 2OPRB 2VD3A 4IR9A 2C28A 2DNNA 1X8DA 1KOHA 3T1HF 1HARA 5HROA 3I0SB 3M05A 3MEKA 2ASDA 3QMQA 4B9SA 3S1TA 3CCQS 2BE2A 3P3DA 2WHOA 1FNOA 4NCGA 2MKCA 4DMZA 1UA0A 4JI5F 3NMRA 3IBWA 4A4JA 2WSCC 2HWHA 2OPPA 3DLKB 1FRJA 1ZAVA 3L7OA 4Y65A 5HMZA 4K59A 1Q1KA 1N8RT 1FNXH 2DNYA 2XNQA 3W2VB 2AGOA 1VQ4S 2L9NA 1RT3B 3CB4A 1R0AA 5HQ8A 2CPZA 5KFKA 3IRXA 2JWNA 1YJUA 4C8NA 1D9AA 1IM4A 1Q7YT 1QJHA 2DHAA 4FVMA 5HMXA 4KTQA 3KMQA 4X4TA 3J7A1 2BANA 4HH0A 1A6LA 4BS2A 1UAWA 2J9DE 1X5TA 3R5AA 3QGIA 1TKTB 3TA1A 5BYRA 2U2FA 4AE5A 1D8YA 1S10A 2P6TA 2JVRA 2LVWA 4NYPA 2ZE2B 5D4PA 5KFPA 3M32A 4ZVGA 5D77A 5HP1A 2ASYA 1N48A 3VAMA 2PE8A 2MQPA 2OPQB 2VL1A 3DLGB 5KT7A 2CQGA 5KFIA 1R89A 5AJ3F 1T94A 1FDNA 2UVRA 2C3UA 1YITS 4ECSA 3KNGA 3LALA 2BJEA 1DFDA 4FXVA 4C8KA 3QPIA 2HWTA 2Q1LA 4J37A 4OLPA 4HLBA 1DTTB 1U24A 1Y7PA 4NZ6A 3KHRA 3FSXA 1J5OB 2M0GB 1WF2A 4OHVA 1N5TA 3FFIB 1TR0A 4Q43A 4B3MF 2CQCA 4LF7F 1X5SA 4A8YA 4K4SA 2XSJB 4N5SA 4M1KA 4J9LA 1I1GA 4CI0B 1UVKA 2L41A 1S1XB 4I7FA 2RU3A 1C1BB 5BYSA 3Q22A 1FJGF 2DCLA 3SMZA 1IKYA 2RIJA 5F3TA 5L38A 5KFCA 2QZ8A 3J7Z5 5EGYA 5K8MA 5IFMA 1XMOF 2O1PA 3B4DA 2W4DA 3U7JA 1WTBA 2CPYA 1WF1A 2DO0A 4RNMA 2OAUA 4IOBA 5T14A 3BO4A 4X4UA 4J9SA 1U1NA 3CXCR 4RX6A 3BF4A 3BO2A 2XY5A 5E2QA 2VONA 5HROB 2VFUA 2PIIA 4A8FA 1ELOA 5T41A 1RT2A 2ZITA 3HVAA 2BE2B 4NCGB 3KFWX 3DLEA 4F2RA 3ZZRA 5EWGA 3ZZTA 3WZ0A 4FXWA 1GT8A 4O44A 4KB7A 2IVYA 1XMBA 1JNZB 1HBMA 2DNPA 4ZP7A 3VCDA 2GQ2A 1TAQA 3OVBA 4GO5X 3OL9A 1T03A 1DURA 2WSFC 1R0AB 2OO4A 4J9OA 5AE1A 4ED0A 5LJ5Y 2NUUG 3DCAA 4JI7F 2HZCA 2I0XA 3IRXB 1O51A 3AB4B 4H4MA 4ALZA 4KT0C 3EZUA 4WYWA 2FHJA 4YB1P 1YIJS 3EGNA 4RWXA 4F3MA 1V3RA 3MUMP 2BANB 2XS7A 3M6VA 2PI4A 2VFSA 4DX8H 1FESA 4CQ1A 3RTVA 4G1PA 4ECUA 4JYAF 2LXUA 1Q53A 5GAHU 1MMNA 3QYYA 3M32B 2WOMA 2G4BA 1VQNS 2VOOA 3W2WA 5HP1B 1ZM9A 1HMVA 1TKXB 3OLBA 1REVB 5AXKA 2IM1A 1FKOA 1SI9A 1F0XA 1WHWA 1S7HA 2PGCA 1IKVA 2KB2A 3QIDA 3VQTA 3PACA 5DLGA 1FDBA 3HKZD 2ZKUA 4O3NA 4LJMA 3TYTA 5KFDA 2O01C 3QGHA 1DBDA 3MM5A 1HI0P 4DR1F 4A46A 2FDNA 3V4MA 4OI6A 1ULRA 4DSJA 3KLIA 4O0IA 1NZAA 4C8ZA 1KQSR 2I8EA 1HI1A 1GTEA 4MKAA 4NLVA 1J5EF 4IRDA 4WE1A 1NK6A 2NREA 1HWKA 1JLBA 3VAHA 2JC1A 1HNVA 1ZM4A 2DNRA 3M9OB 2MQQA 1S4FA 1N54B 1HQUA 2RE1A 2NZ4A 4I7FB 2G0CA 2W9AA 4N8OA 1IKYB 5D8HB 4AL7A 3CMAS 1NB7A 1Y5NB 5KG7A 1S0MA 1WNEA 1U49A 2EG2A 3MAHA 1SL0A 4LF9F 5J2MB 5DS7A 4K4WA 1BY9A 1XERA 3QIPA 1YQHA 3CUNA 1KNZA 1RDRA 1XTZA 2XCPA 3V6HA 1TFYA 5L1KA 4OZ1A 3F44A 4KHRA 2YNGA 3S01A 2ROEA 1M5PC 3NBPA 3RYLA 5F8GA 2L9WA 5IWAF 3RB6A 1S76D 3E2EA 4QIWD 2OD6A 1FEEA 2KXNB 1RT2B 2JEFA 1XN9A 3BGRA 1NK7A 3DLEB 3G6ES 2BRKA 5J1NA 1G1XA 4P7TA 4LIWA 4DQPA 4OI2A 3D0IE 4XDCA 4O44B 3VAKA 4WZMA 5K9FA 4ZP6A 4DSFA 1HBMB 4ZPVR 4MFBB 5MLCV 5DDOC 3OW2R 1LKZA 4FS2A 4ED5A 3CTRA 3G71S 1T3OA 1PILA 3TOQA 1D0EA 3BZQA 5HLFA 4NCAA 4LFCF 1RT4A 1AXQA 1TP7A 2E1AA 3UW1A 2R7RA 2Y1JA 2B6AA 2XZWA 2GHPA 3KKFA 2ZC4A 2BA9A 3C2PA 3ICLA 3KK3A 3T5KA 1J2VA 2JEGA 4TNOA 3NCRA 4O3PA 2GIRA 2FUG9 3PR5B 1RWUA 4EWTA 2UXCF 4X62F 3M6XA 3V4IA 4OFZA 4ZP8A 1JLQA 2ZH7A 4PG4A 2W4CA 2M2BA 2PI5A 1P1LA 4R5PA 2H9ZA 3OJUA 1S9FA 1VQPS 1L3TA 3OTCA 4WXOA 1DRZA 3HHDA 1FT8A 2V94A 2WOMB 2H5EA 2AQ4A 1P9QC 1IR0A 5E3PA 3W2WB 3ZZPA 3DU6A 3J81Y 3CCJS 3THTA 1X4CA 1IXKA 2AYEA 2KHCA 4OJGA 1FKOB 3D1OA 4JUZA 4KE5A 1VK3A 3MTJA 4RNFA 4X4PA 4DFKA 3GFYA 2XI3A 1IKVB 3GFXA 1R3NA 2DIVA 2ILYA 4TKTA 5GAGI 3M8QA 4ZA1A 3IR5B 5F8HA 4B3OA 3MMAA 3MM5B 1VGYA 5K14A 1ZAXA 3KLIB 3OXGA 2CJ9A 1SQEA 3LGMA 3UD3P 3O6QA 1RI7A 2GNKA 4HVZA 5KFWA 1YHQS 3QJPA 5CA5A 4I1TA 5IT9Y 5I42A 5B0CA 3VF0B 2LEAA 4ES2A 2VQEF 2ZH4A 3SV3A 4WE1B 5D4OA 1S97A 1FJEB 4OHXA 1T3NA 5D3GA 1HNVB 4IDKA 3HF5A 4HDGA 1HQUB 3DOKA 3PV8A 2AYGA 1XNQF 2A1BA 4ELUA 1SL2A 2OMLA 5J2QA 3SXLA 2JVOA 3NAIA 4XO0A 3K5MA 4U67Q 2MHNA 3N6MA 1RISA 4LVNP 5CYQA 4B9TA 3ULHA 2VPYB 4ICLA 1Q79A 5KAKA 3QIPB 1HWJA 1N52B 4A8KA 3LAKA 2VOPA 3N4WA 2DNOA 2OFGX 1QM9A 2YKNA 4PRFA 1FRHA 2D9OA 2YY3A 2YNGB 5F0WA 3NBPB 3GIIA 4OV1A 2VBWA 2IVMA 3CJKA 3F56A 2EFOA 2WB4A 2EK1A 1K8AT 5KG4A 2RUGA 3BGRB 4FF3A 1OQ6A 1BQXA 1WD6A 2LU2A 3B4MA 3I96A 4O3OA 2DNMA 3OV7A 3R3TA 3H5YA 2X1BA 5E3QA 3OVSA 1VQ5S 1CPZA 2GX8A 2MSSA 5L1LA 4USHA 3PW0A 3AA8A 4BHQA 4DV3F 1TZ0A 1SUQA 5HLFB 3ENVA 4XDDA 1YTYA 1RT4B 4G1QA 2QA4G 2J9DA 4F4YA 3UFCX 4QYZJ 2X1GA 2R7WA 4U9RA 2RH3A 2UXDF 4K0KF 4NLQA 1JMTA 2J76E 4UOCA 3KK3B 2CJKA 3OFFA 4F8RA 1FRXA 2MSTA 2YKMA 1DZ5A 1AROP 4UQTA 2AF6A 2XMKA 2E1CA 3NKYA 4O23A 3V4IB 1JLQB 4QIEA 2K7JA 4XAKA 5FIIA 1F5BA 5KFLA 1X5OA 2VB6A 2PEHA 3FEXB 2RMLA 2BOPA 4X4OA 3PIOQ 1DTQA 2V5HG 4R5PB 3BR9A 1O8BA 4NX9A 3LWLA 2ADBA 3UPFA 1K1SA 1NK9A 2FVRA 3KJVA 3SFGA 4W90B 2NXUA 2C2DA 3PY8A 2XULA 4RNHA 4XIUA 2B3TB 3K2YA 2MZRA 3D28A 3MD1A 4PG6A 4WXWA 1U1RA 4Y3CA 2MGZA 1SJQA 3I4HX 4A8MP 2AW0A 5BYQA 4TLRA 4TN2A 1XR7A 2NPIA 4OJ3A 3M8QB 4O4RA 3CIMA 4UW2A 4DV7F 4B3OB 4OZ5A 3MMAB 5HBMA 1L5UA 4QCLA 5EN1A 2F3JA 2I5JA 1FDDA 5K14B 5B0DA 1S1VA 2D74B 2AX1A 2BQ3A 4B3SF 2QYCA 3G4SS 3N5BA 1R31A 2F8HA 4NYOA 5KT6A 5I42B 2AU0A 1M1KT 3PXGa 1F2GA 2PSZA 2WBMA 2FLOA 2NSCA 2BQRA 1HNXF 1LWCA 4IYQA 5D3GB 2ZUGA 2POKA 4IDKB 2IMOA 4YOEA 3QGPA 3CULA 3HT3A 3FQLA 2R2TA 3PO5A 4ED7A 3ISZA 3GR0A 4ZVEA 3BDPA 5KFHA 1X4FA 2HGLA 2LQ9A 3M8PA 5SZTA 4TQRA 2ZNYA 1RQ0A 1ZZFA 4Y0FA 5E7OB 3U1NA