2HLTA

Solution structure of bacillus subtilis acylphosphatase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Bacillus subtilis Acylphosphatase in free and bound states
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
total genus 25
structure length 91
sequence length 91
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hltA00
4YEAA 3QGPA 2RU9A 2OFGX 2AJ1A 2GCFA 1K0VA 3GZ7A 4FNIA 4A47A 1VQYA 2KYZA 1YRXA 2RILA 1N5SA 4DPOA 2ASYA 1YJRA 2N7YA 3HDSA 1SI9A 4FNHA 1OSDA 2GFFA 1RJJA 5T7LA 2HLTA 1Y9OA 3UDCA 5B09A 2Q3PA 2N4CA 3E8OA 3HHLC 2OP5A 1Y3JA 2W4DA 1LQ9A 1QUPA 2AJ0A 1P6TA 1U7LA 3TNVA 2XMMA 2HIQA 5K9FA 5F0WA 1S6UA 1S6OA 1X7VA 4OJ3A 1KQKA 3CJKA 3VTIA 2XMJA 2LQ9A 1KVIA 1GXUA 1Q8LA 2FB0A 3BB5A 1Y3KA 1URRA 2ZDOA 1FVQA 4A48A 2BYCA 4Y2KA 5B08A 2ACYA 3BN7A 2JDJA 4Y2MA 2PD1A 2OD6A 4A4JA 2OD4A 1FE0A 2QYCA 4DN9A 3TOQA 2KT2A 4ZOSA 3BGUA 2FIUA 2K2PA 1W2IA 1FVSA 5B0FA 2GGPA 5KAKA 1P8GA 3BM7A 4HH0A 1WD6A 3LO3A 1XBWA 2LDIA 1JK9B 3BF4A 4HL9A 2BJEA 1OQ3A 5B0AA 4EFAC 4Y2IA 2LXFA 2QLWA 2HFNA 4HI2A 4U9RA 3CJKB 4YDXA 2XMUA 1OPZA 4OIXA 2GV1A 1YG0A 3IWXA 1IUJA 1CC7A 4OJ1A 2BUNA 1AW0A 5B0DA 2IYIA 2OMOA 1FEEA 2RSQA 1TL5A 4HI1A 1MWYA 1FESA 1MWZA 2GA7A 2OKQA 5A6PA 1CC8A 2FHMA 1TL4A 2N4DA 2W4CA 3LGNA 1V3ZA 3LGMA 4F67A 2BBEA 2KT3A 4NPOA 2CRLA 2VV5A 3IWLA 1YJTA 2G9OA 3QMQA 1TUVA 2QIFA 2HFOA 1Q4RA 4ZA1A 3T9NA 2OAUA 3F44A 3BR8A 3BDEA 2ROPA 1TR0A 2EW9A 3DXSX 2PGCA 3HX9A 5B0CA 3WDOA 3DCAA 2GO8A 2K7JA 2QLXA 3FMBA 1N5TA 2OFHX 1R6YA 3HHLA 5B0BA 2BJDA 3HFKA 1VQSA 2XMKA 2ZDPA 2AP6A 2FTRA 1YJVA 1Q8BA 2XMWA 2ROGA 2VH7A 1FD8A 3I9ZA 3KG1A 4DL0C 4Q2MA 5B0EA 2RMLA 2AW0A 1OQ6A 2K1RA 2ROEA 1Y0HA 2IFXA 3KKFA 1X0PA 5A6WA 1AFJA 1ULRA 1AFIA 4Q2LA 1YJUA 1X8DA 2GGPB 1TZ0A 3HF5A 3HHLB 2K1RB 2LQBA 3K7RA 1JWWA 2KKHA 2K7KA 3FGVA 4QOTA 1SQEA 1FE4A 3TRGA 3MZIA 2XMVA 1CPZA 1APSA 5B0GA 2W4PA 1SB6A 5IXUA 3HHLD 5F0UA 4HH1A 4OJHA 3KG0A 2HQIA 2IYGA 3MCSA 4A46A 2HLUA 2L3MA 1N5VA 2XMTA 1KVJA 1N5QA 3KNGA 5T7LB 1Q53A 1GXTA 4NL5A 3FRYA 4OJGA
chains in the Genus database with same CATH superfamily
4DLEA 4W98A 1RWVB 3OHAA 1C1BA 1PYOB 3PG9A 5BYRA 2AJ1A 3Q8VA 2ZH3A 3QWUA 4FF3A 4CO4A 3U1NA 4LFAF 3H5XA 2NPIA 4B3OB 4EGLA 3SFGA 1OY6A 2XYPB 5CYQB 3A3PB 3T1AA 3W5ZA 2IAJA 4DZ6A 1M5HA 2Q3PA 4ZJOA 5LMUF 3IFEA 4LF9F 1LWFA 3BH7B 1S77D 3D3CJ 1U0HB 2P2CB 4ZN3A 2CDRB 2PIIA 3FK4A 1NK4A 3IGVA 5KFQA 3QYYA 1C1CB 2RT3A 1B3TA 3ISZA 4X4PA 4F26A 2ILZA 3D3BJ 5KG2A 3RU0A 1WG1A 3MD3A 2YNIB 1ZTWA 1S72S 1I94J 3R27A 4IR1A 2DKOB 5FIIA 2MSSA 4ES3A 5BJRA 1UJ5A 3P5BP 5SZTA 4GC6A 4A4JA 4A8FA 3CJ3A 1FE0A 2DGVA 2WW4A 4GRSA 4L6V3 3HVTA 4DCPB 2J9CA 3RR8A 2ZJRQ 5ADZA 1FD2A 2XI3A 1IBMJ 2GQ2A 3UFCX 4C0HA 2C3MA 1KN6A 1RACB 3UDLA 3UD4P 2MZRA 1X9WA 3KLFB 2LCWA 3TA2A 1LW2A 4NLXA 3I0SB 2JZ5A 4U9RA 4ZPCA 2IHR1 5CHCB 1HD1A 3MMCA 3KUGA 4X4VA 3N6MA 2XHWA 4USKA 4WP9A 3SDEB 2YH0A 4Q44A 3R9LA 4ECVA 4FF4A 2Y8WA 4LF4J 4XPCA 2Y8YA 1U1PA 2G2ZA 4ID8A 3E01A 1RT1B 2OMOA 1YZ6A 2HEKA 4I6WA 4NA3A 3CCRS 4ZLJA 2DH7A 2HAIA 2NSCA 2QZ8A 1NKEA 3BDPA 1UVJA 3RW6A 1SV5A 3B4MA 4OZ3A 4S0MA 1TL4A 3MEGA 4ZMMA 4NLVA 1NPKA 1WKKA 2DCUB 4JB8B 1U0HA 2XY5A 2KT3A 2X51A 2QG9B 3GE9A 1AXQA 5LSLA 1BGXT 3HXMA 2JC1A 2QJ3A 2HGNA 3QPIA 3FSIA 1ZAVA 2A0FB 1S9FA 2UUAF 2EFPA 1HA1A 1TR0A 3C6UA 1UFKA 3GYGA 1X31C 3DM2A 1IJFB 1AYEA 3O6QA 2MZJA 2IRYA 2IVFB 1YJ9S 4M94A 1HMVB 1QM9A 2ZVSA 3GIMA 3M4XA 2KH9A 2ASJA 4ED8A 1WNEA 3K2YA 2CQ1A 2DY1A 4P75A 4X65J 5C2CA 3QIDA 2HFVA 3RB4A 1VHFA 2U1AA 3LQVA 5KT6A 1AZSA 5D3GB 2FY8A 2FTRA 4RW6B 5FLXY 1D9AA 4BBYA 2QLBB 1O5JA 2QRRA 4PG6A 4C3KA 2F9JA 4JV2A 2FJDB 1FD8A 1E6VA 1VIXA 4HTJA 3SV3A 1XMOF 4DR3J 5D4PA 2Q66A 2B5JB 3CSKA 3AQOA 1KQSR 3PIPQ 2D41A 1K9MT 3BYPA 4MIAA 4USMA 5D6GA 1VQ6S 4NLUA 2X1AA 2E5LJ 4LFBF 3VALA 4J9MA 1FRXA 1WC0A 1R31A 4KFBA 1NJIT 2W1BA 2F8EX 4DF4A 5KG3A 2HQIA 3I32A 5E0OA 4YMEA 4ZIVA 3R8YA 4X64J 3SQGB 1I1GA 1I51B 3T5KA 5KFJA 1FWKA 4PPZA 1CEZA 2R2RA 1A9NB 2QO3A 5ETSA 4C0BA 3DHXA 2ASDA 3QGPA 1C0TA 4PUOA 4KBIA 3TVKA 3QO9A 3MCOA 5AE3A 2V2QA 2M4MA 3BGFA 1SC6A 3TX8A 4KGVB 1VQYA 3U7JA 2PT0A 1HLWA 1JLFB 3C66A 2W9CB 3OTOJ 4DCJB 3W64A 1RK8A 2RDIA 5LJ3Y 2G0IA 3SBMA 4KSEB 2OSRA 3E8OA 1X4BA 4EWTA 5HJXA 1YBAA 5HMYA 1AZSB 2QA1A 4ZVFA 1J5EJ 4IOBA 1LQ9A 3PRVA 1J27A 1FEHA 2C2ZB 1TKTB 1F5AA 3D0IE 5KG0A 3OR1B 4LF8J 3EXCX 2MY7A 2CG4A 2ZBPA 4DPUA 2W7AA 3SYZA 4ECTA 3FBEA 3M8ZA 1NHUA 1H3DA 2NXCA 4PABA 1RT5A 3FQLA 3DOMA 5AT1B 4ZCKA 1RKJA 4JYAJ 1KVIA 3PCOB 4ZVRB 3NY0A 1FJEB 2FVQA 3CDUA 5K8OA 3IA0A 4ZVGA 1DLOA 1VR6A 5DDRC 4FVCA 3OL8A 2XZTB 2R2UA 5BR8F 3MMCB 2G0CA 3ISNC 1S1TB 4DHVA 3D7SB 8ATCB 4DUZJ 3KLGB 2CZ9A 1D9FA 2M8HA 4J91A 4M5GA 1VYAA 2B56A 1MMNA 3ZNUA 3KUHA 1KLNA 1PKUA 4RZRA 4KHMA 2XO7A 3UVJB 1Y5IB 3A8KA 4CNZA 1HPZB 2J5AA 1VJQA 2GVDA 3HO1A 1X5TA 2AF6A 3DLKB 5EWEA 3H90A 2UVVA 1S76D 4DL7A 1EKRA 1FK9B 4FPRA 4ZS6A 5LL6d 4OI6A 2AGOA 2FVCA 2AQ4A 3PO5A 1F2HA 1WOSA 2BR0A 2DNLA 2CJXB 1SH3A 2HFZA 2XZDB 2ZOMA 3CJ2A 3I4PA 5HSPA 4WZQA 2B8QA 3GSIA 3OFGA 3NL0A 2OO4A 3NWGA 4USIA 3O8WA 4FP9A 2QFIA 3SXLA 4R8UB 1ZAWA 4RU9A 2XY7A 2W9CA 2VA3A 2COLA 2JLFA 4LF6F 1FESA 1HHTP 1R8AA 3HD2A 2V6AA 5C24A 5E3QA 4JI6J 2YX7A 2QSFA 1ZOTA 3OVAA 2B6AA 4WKRA 2VB6A 2DHSA 1L3TA 4B9MA 4DSLA 2YTCA 1X5PA 2VG7A 4DZDA 4DLGA 4NPOA 1YIJS 2JEFA 4V1Ak 1CS4B 4DL2A 3K0JA 3ZZYA 4RW8A 4YUDA 4KPYA 5HLFB 1ZPWX 4UOGA 3BDEA 2CA9A 2CPDA 3MPYA 2ZZTA 2MEWA 3GYNA 4KRWA 5G0RA 3M7VA 4DR2J 1VQ7S 3H25A 4GKKF 3K5LA 1M5KC 1Y00A 3JSBA 3EGZA 1R6YA 2BOAA 2KM8C 2GHPA 1S1XA 4JI5F 4QW8A 5F3ZA 2RAQA 4OX7A 1U25A 1S5ZA 2ZDPA 3VAGA 4ES1A 1HI1A 2XMWA 5ETKA 2ALYB 3D0HE 3JAMU 4EO8A 3MF5A 4YFUA 2KL8A 1SUQA 1GMWA 2CQCA 3VCDA 4RUHA 3DU6A 4TXSA 4Q5VA 4B9VA 5ETOA 2CNNB 2K8GA 4DL5A 4B9SA 4ECUA 3NEKA 4YR3A 3M32A 2DD8S 1CULB 5E2QA 1JLCB 4L72B 4P52A 1TZ0A 3GFXA 2ZBCA 3L95X 4IH5A 1RI7A 2B9YA 4Q43A 1JLEB 2AEFA 1L3VA 2CUYA 3TZXA 3CO9A 1H2TZ 5DQGA 2KXNB 1IBCB 1SIWB 2JLGA 2YWKA 4OJHA 2HW3A 3CWJA 3O5TB 3MCSA 2VG5B 3P96A 1ZS6A 1N5QA 1WWHA 4WBFA 5E3CA 3RZAA 1UVMA 2DGUA 1JQGA 1RABB 2XNQA 2VASA 2CXEA 3AA8A 3DOKB 4IH7A 7FDRA 3KYLA 1HYSB 2V4JB 3RJMB 1SC1B 5GVQA 2BQ3A 3MAAA 3KUEA 3Q8YA 1NSQA 4OYXA 1DZ5A 3L9ZA 4OYOA 3ILOA 1WSRA 4CLUA 2N7YA 5HVGA 2UZAA 3W63A 1EIYB 2A3JA 2KVQE 2CQ2A 3MDFA 3MMAA 1E6YA 1YLXA 2XHCA 3MR6A 2FHOB 4ECRA 4NEZA 2GMJA 4C48A 1WDDA 3TARA 2X7IA 1JLAB 2AJ0A 4Q8FA 1UPMB 2CJBA 4BWJA 3TNVA 1R89A 1WG4A 4NX9A 4O3OA 3PX4A 2MB0B 2JEIA 2CVEA 3TAQA 4JV5J 1VQOS 3BV8A 5CCMA 2BW7A 5HJYA 1DHMA 4EMDA 5GAHU 3LP1B 1P9QC 1TL7B 3CTRA 3PW7A 1URRA 2YH1A 1NK7A 2VL1A 4F2SA 2MXYA 1QLNA 3VVTA 2HNYA 3H0PA 4CYUB 2VFUA 4Y28C 1RBAA 2HNDB 5D78A 1RAEB 3W8GA 3RB3A 2FY1A 2CQHA 2W9BB 3T1YJ 1JLEA 4K4UA 2ACMA 3CDAA 4RW7A 1HBUB 1FWPA 1T9WA 2C22A 2G4BA 3SCKE 2UV8A 2PA8D 3BBCA 1WD6A 1JJ2R 3RW7A 2GMHA 2PDAA 3UR0A 2ZH2A 4LFCF 1H0HB 2O3DA 2J8AA 1RT3A 4EFAC 1WHYA 4M5DA 1RWWB 2HFNA 5I3UB 1LK7A 2P8IA 5A2QU 1SH0A 2D74B 3D6HB 3SSQA 1EB0A 3OBIA 2MQMA 1TV6A 1NH8A 3IR5B 2VIHA 5C25B 1NJXA 1YWXA 3M6WA 1N34J 2UXBJ 2E5IA 3F73A 1KTVA 4ZLLA 3AJDA 1K8AT 1QJHA 5B0DA 3AOCA 2OPSB 4RW8B 4DPWA 4Q0BA 1F5BA 5A6PA 1Q78A 1ZA1B 4OYMA 1TFYA 1F9EB 2IVYA 4HDGA 2GNKA 2BACA 5CYMA 5AXKA 2FQQB 3MFHA 3ZZ0A 4A8KA 1NK9A 2ALZA 2CRLA 1XN9A 2ZZNA 2DO4A 2DNPA 3A3OB 5KFLA 3CF5Q 4O3SA 1HWIA 1R8HA 2D1CA 3UDEA 4ZJQA 2Z56B 3RAQA 4JV1A 3BR8A 1KVKA 2R7TA 1KWMA 3MHYA 4NLOA 1KR4A 2EW9A 3HMJG 1HKAA 4G65A 3K17A 5I3PA 4CTAA 3TI0A 4BDPA 1RISA 3DCAA 2GO8A 5E33A 4J9PA 1QSYA 2KZZA 4FKXA 1A0OB 2G2OA 1CG2A 4OX8A 4R25A 3GU0A 1VIOA 4UOFA 3NS7B 2YNGB 4H4OB 4MKVA 2VC0A 1CULA 3VGUA 2BJDA 5KOXA 1TKXB 4FPIA 4XPEA 1IWAA 2BJ1A 2CPZA 2EK6A 3ITHA 4KGXB 3EVWA 4X84A 2R7RA 3POTA 3EYZA 4OZ1A 3GQCA 1SJQA 1HFEL 1HARA 2RHSB 2YKPA 4CP5A 2FC8A 3DI6B 3IGNA 4F0MA 1FXDA 1JMTA 2WK4A 1PC5A 1ZM4A 1HW9A 1VCTA 2BANB 2FC9A 4MAKA 5DG9A 3G96A 2UVWA 1UAWA 4YB5A 3GFZA 2J0XA 4I2PA 2ZE2B 4DX6A 4MKYA 4NI2B 3P6YC 5F9NA 2OIHA 1F9HA 5KFGA 5KG7A 3DNCA 4B9LA 3FGVA 3QT5A 3D0GE 2H5EA 3TRGA 1RCXB 2MDAA 1CJUA 4M5MA 1XMOJ 1X9SA 1N56A 2PMZD 5HROB 1HNWJ 3UVJA 4KY3A 3NGDA 1SB6A 3H59A 4DU8A 1XWLA 5IXUA 1FX4A 4IOCQ 4M5LA 1BQXA 2J76E 4O3NA 1RHQB 4TU7A 4J9NA 2YWWA 1Q53A 2E9ZA 2R7QA 4YHHF 5K14A 1HQEA 1S4FA 4C11B 1U1NA 2X1BA 4HTIA 2HS4A 4PCQA 4ELTA 2DHHA 2C1EB 2MY8A 3IAM9 4NASA 2NXEA 3CJRA 2UUWA 2WBRA 4PZVA 2KFYA 5IT9U 1JX4A 2XBPA 2B5JA 1X0FA 4TY9A 3T1YF 5FJ4A 4OHXA 1O0PA 3QJPA 1DJ0A 3GJSB 5GAHI 1M90T 2YPYA 2NYHA 5EWGA 4V19X 2XWYA 3PYEA 1S1WB 4UF4A 1Q79A 1K47A 1WC1A 3VR1A 1R6VA 1KDNA 1VDHA 4F3OA 1NB7A 5AXNA 1WHWA 2C2DA 1LV5A 2I38A 1N33J 5D0GA 4WZMA 3E01B 4F4ZA 2G2YA 4DV7F 4A8OA 4G3IA 3CVKA 1QAXA 5GMKa 4X64F 1SV5B 1RWPB 4D3HA 1VRUB 1S59A 3JTNA 4NLYA 4X66J 3J7Z5 5CQGA 1NK5A 2I6WA 4ECZA 4USVA 1SJFA 4JI4J 1CJKB 5KFWA 2RE1A 2JEGA 1X4EA 3Q83A 4KH0B 3MTKA 2HWTA 3PFEA 2VFTA 4IFVB 2RQMA 4OV6A 1HQUB 1U1RA 4JP8A 4G1QA 4MTPA 2IBKA 3JYTB 2BE9B 5B0AA 2W25A 4Y2IA 2ZHAA 1RWXB 4N7TA 2XB2D 1RADB 2P6TA 4DQRA 3PACA 1KSPA 3DDNA 1FDDA 3M32B 4LSLA 2WVEA 3DRSA 3WBZA 5L1KA 1JB0C 3OL7A 4URGA 4RR5A 1UMJA 4JI8F 4DF8A 1IUJA 2AYEA 1ZA2B 5DQIA 3R7SB 1G4CA 1LWEB 4YB1P 3UDVA 4LFCJ 4OQJA 2NYIA 4I7FB 1HI0P 2E1MC 3DLGB 3J80Y 2AIRB 4OV1A 3MEDA 2MKHA 1FXRA 3LGMA 5HBMA 3WQPA 4DSEA 2J6UA 2AEMA 3NGSA 1F60B 1S1WA 3D4JA 2AZ3A 2BBEA 1RT2B 4KT0C 3TAMB 3UNYA 4ZJLA 4ID5B 4LR9A 3FZ2A 4GO7X 3NG8A 3KLGA 3HHNB 1D3WA 2HFOA 4TN2A 1S1VA 4DR3F 1RCOB 1TKZA 4WP8A 2VQFJ 2ZH7A 1FKOA 1RQ0A 1TK8A 1HWUA 3RG6A 3KK2A 3BPDA 4OHYA 2OEMA 3DXSX 2LLZA 3GMGA 3N4WA 2HVEA 3PEJA 4U8VA 4BCAA 1VQ4S 2J0SD 5CCLA 1FK9A 4CLZA 2D3O1 4WU3A 3OVSA 1ELOA 2A1BA 2LKZA 4ZN1A 2CG8A 5DS7A 5T14A 3TUIC 5H9EJ 3SV4A 2I9SA 5HMZA 2RH3A 1RA7A 4WTOB 2YXLA 4NWBA 4P73A 3CPWR 2AJ2A 3P45B 2CPJA 3D6FB 3M2RA 5HN0A 4Y3CA 2N3OA 2NS1B 2L08A 5D8HB 3SFUA 5FDLA 3V81A 3AB4B 2IM3A 3AD9C 1V5VA 4WKYA 3RUBL 1NLKL 4DL3A 2UXDJ 2GVZB 4LR8A 4LF7F 3OT9A 3C14A 2Z4PA 2VG7B 3J81Y 3M8RA 3KLEB 4R0EA 3BJYA 3EGVA 5EHHA 3KMQA 3HHLB 1F0XA 2I5JB 3I6PA 3V6JA 5EDWA 4RW7B 4X4RA 1IKWB 2R7WA 3IC1A 4DN0A 5F8IA 4ANDA 2UUCJ 3N5BA 3RBEA 4RU2A 2JHEA 1S99A 1VC6A 3M9MB 4ZP9A 1TK5A 2V8DA 1FRIA 3BKFA 2GO9A 2KB2A 4LBPA 4B9UA 2E9TA 5GMEA 3NNHA 3MR2A 3FUYA 4OZ5A 1S1XB 1ZM2A 3QJJA 2WVFA 1G1XA 2WONA 3CC7S 2O1PA 3MECA 1U45A 2QTWA 4WPAA 3MPDA 4ZCLA 3HP6A 3R5AA 5AJ3F 2RU9A 2JLEA 2MKSA 4F3MA 1NBEB 2ZBIA 3DOKA 3FEXB 3M8WA 4A47A 5KFNA 4ANEA 1AT1B 5HO4A 3RRHA 4F04B 3OQ2A 2L9DA 2HAFA 5LXRA 4YN3B 2QMWA 1ZBTA 1OSDA 4MMOA 1BE4A 2BVZA 4H4KC 3CJ8A 3PIOQ 4QCLA 2MLYA 1RHUB 4L73A 2BKNA 2XULA 1Q7LB 2AEJA 2GHVC 1X4HA 2ZKTA 1HBNA 1IR2A 1S7IA 1WC3A 2XMMA 3LW5C 1XMQF 2R8HA 2VQEJ 4PXBA 2VFSA 5F0WA 3CJKA 4N77A 4TYAA 4DV6F 5AXMA 3LP0A 1SL1A 2NXUA 4L76A 3FFIB 2ZBQA 4QPXA 2VG5A 2HQDA 1GH8A 1F5CA 4XO0A 3CW2C 5C24B 2YKMB 3DRPA 1CJTB 1FRJA 2NUHA 2OD4A 4J9QA 4N8OA 2KT2A 3IG1A 1FI4A 3NAIA 4B02A 2DR5A 1EHWA 1S0VA 3IM9A 1TELA 1W2IA 1W7WA 4HACB 3VQSA 5K20B 1CJVA 1YGYA 2C2MB 3PM9A 5DLGA 3VAHA 2HZVA 1MN9A 1OQ3A 3AOBA 1L5UA 4LF6J 5KFBA 3PV8A 1IKYA 4DR5F 3PW4A 1KLMB 4K4ZA 5HVHA 3AFGA 1TQLA 4ZCMA 3GYXB 1NSKL 3TZZA 2F63A 1DQ8A 1JKHB 2DGXA 3M2UB 2XYHB 2ZC4A 5KFCA 3DYAA 4ENOA 5IT4A 4KGMA 1GNKA 4ZHRB 3OTCA 2UXCF 2DNOA 3KLIB 4WP3A 4DU7A 5LT5A 4QU6A 4O3RA 2E29A 1LNQA 3RTVA 1WEYA 4TQRA 2EC2A 2P6SA 1UW4A 5BR8J 2GC8A 2OAUA 2L9NA 3F44A 2C2KB 3MAHA 4NZ0A 5DM7Q 1T8EA 2QEXS 4J9VA 1DURA 2A6OA 4OX6A 2DH9A 2AX1A 1HNXF 3MFIA 3WIUA 3TUZC 1IKVA 5EX0A 1VK3A 3FSXA 2DY9A 5D4OA 3B54A 3CCTA 3BGRA 4OHZA 1VISA 2QLXA 4I0WA 3C19A 5MLCV 1HMVA 1CSJA 4DOZA 1QSLA 2H48B 3FMWA 2XLKA 2AKWB 2HS3A 3HFKA 3S8SA 4ETZA 3VQTA 2OPPA 4DI6A 4USUA 4BC9A 3Q2SC 3PJWA 1SKWA 4URSA 1UL3A 1X4CA 5IC6B 1RAFB 4F7VA 3A8IA 4AYBD 2AW0A 4JI1J 3FDSA 4OI3A 4RX6A 1HNZF 1FFWB 4DPYA 1GX5A 2M88A 1BLUA 2GGPB 2JRSA 3K7RA 3MECB 5KT7A 3JQJA 1LW2B 2CNKB 4QOTA 3DYAB 4KKOB 4C3LA 9ATCB 3MAQA 1QVGR 2X3DA 4U8YA 2CQPA 4RO0A 3UCGA 1RTJA 5B0GA 3C16A 4CTAB 3M6UA 4TY8A 3SDEA 4GO5X 5DETA 1RWNB 2U2FA 4HYKA 2DO0A 3JB9k 1B0VA 2HBZB 3D9BA 1PGZA 1JLGA 4ZPVR 3BPSP 5GADI 4TU8A 4CRJA 4K7QA 2MTLA 2GJFA 4LRFA 4W90B 1N52B 2IJRA 3FRYA 1PSDA 1WC4A 3T5JA 2M2BA 4KPCA 1J2VA 2BJ9A 2AGPA 1R8CA 4X4OA 2R8JA 3OL9A 3V6DB 5K8PA 4K0KJ 2A2DA 3J80U 1NCLA 1YJRA 3G2XA 1WHVA 4OFZA 4PPDA 4UW2A 2F9DA 2GFFA 4WJBA 1PAUB 1GFWB 4IUFA 1P9YA 2QSWA 5A8WA 4O0IA 3N5FA 4USTA 1FHTA 5KFIA 4Y65A 2E1CA 5J2PB 3MM6A 4KHRA 1QUPA 1Q95G 2F3JA 1P6TA 3WC0A 1YDLA 1D0EA 3CC4S 1CQMA 1S1VB 1XR6A 1N0UA 3MUVP 4X2BA 2V8VA 3ZXWA 1S6UA 4UUWA 3FZBA 3IS9B 3RAXA 1QTNB 2CQBA 2XMJA 2XYGB 1Q8LA 3O3LA 3OL6A 1KFDA 4HVZA 1YTYA 1NSAA 2OTLS 3KXDA 1VRTA 4ZCIA 2LECA 2M0GB 3LP2A 2EKNA 2IDEA 3M2VB 2J6SA 1I3OB 4WFAQ 1TV6B 2XSFA 4L74A 1M5SA 1G7CB 1H73A 4JI2F 2ERRA 2FJWA 4EBCA 2V50A 4BC7A 4HLBA 3DMJB 2NREA 3TA0A 1B7FA 4ZOSA 2FIUA 2KXFA 2MLXA 3G6XA 2H54B 3H2UB 1N48A 1DAXA 4TLQA 3SMZA 2HRUA 2AV5A 1UEKA 1M5OC 2BJEA 2JOQA 4QYZK 1WI8A 4R0JA 2QLWA 4ED1A 4MK7A 1OO0B 1IXKA 3BYRA 3FEYB 3I5BA 5E3RA 3UW1A 3TX0A 4B3SJ 4NMXA 2MLZA 1U4BA 2DHXA 1VMBA 3LTOA 2DRAA 3PRDA 3W65A 2E66A 2PA3A 1HR0F 1S6PA 4NYPA 1AW0A 3G71S 3UN3A 1FKPB 1UEUA 1REVB 3POTB 1TUWA 3QLHB 4RPFA 2MGZA 1IBKF 4WTYA 2PI4A 1B0TA 4AQYF 3GFYA 1BQNB 4USHA 4DR4F 1WEXA 4NOHA 1CLFA 1PG5B 2BMBA 4JI8J 1GMVA 2HHWA 2AD9A 3BO2A 4HKQA 2M52A 1IQTA 1DTTB 2WHOA 3PRBA 4WFZA 2HZAA 1M1HA 1R3NA 2P5VA 3HSJA 2B43A 2ROPA 4ZP7A 2PGCA 4QIEA 1YJWS 2VBYA 3UD5A 3ZZPA 2RUGA 1XNQF 4C4WA 1V3RA 1V6HA 3QWPA 4HEA9 5FD1A 3RYLA 3IRWP 4V19J 5H9FK 3ULHA 3DLJA 3VZIA 2FPHX 1S4EA 2R7OA 3MM8B 2HWHA 2KHDA 4LRAA 5F8GA 4NI2A 2QL5B 5D4LA 2VICA 2ZOGA 5J2MA 1S57A 1G6BA 2ZJPQ 3RGIA 3QSIA 1C4AA 1HQEB 1PILA 2DYAA 1G2EA 4ZPTR 3MPWA 4OLOA 2YKNA 5DRKA 2XSJA 4DL0C 3BBBA 3R6GB 2CPYA 2W2OP 3KLVA 2V8HA 3L7PA 3M2RB 5MAOA 4ED5A 2K1RA 3MOZA 2GIRA 3BSAA 5KFTA 4ETXA 2JVRA 1S9GB 5CH7B 3SIPB 3VAIA 4PWWA 4Q2LA 4OYWA 4IG3A 4ANCA 3LUYA 4C11A 2LQBA 2MSTA 3C14B 4G1IA 1IKXA 2KG0A 1VOMA 2OLWA 3DLKA 1J5EF 4B3MJ 1H7WA 3PY8A 4C6AA 1H38A 2XMVA 1H74A 2LEBA 3D68A 1KQFB 4ED0A 1FO1A 3CCJS 3O2IA 3THTA 4ZVOB 1B0PA 1FFGB 5A8RB 2YNHB 1S6QA 2EPIA 5JMNA 2F7VA 2R7VA 1IKYB 4CQ1A 3H42A 3CB4A 3M6VA 2ZITA 4KV8B 2V8PA 3BQ1A 3PHTA 3ISND 3CDEA 4KB7A 3TYTA 2N82B 1SL0A 4CCHA 4FDFA 2CQDA 3T1HJ 4YEAA 2FLPA 2CJKA 1K0VA 5KG6A 1ZM9A 2VJUA 1HYSA 3LANA 3NLCA 2V34A 2R2TA 1RBLA 1BWVA 1UEVA 4HR2A 2HYIB 4I56A 1X4DA 1SI9A 3QIPB 1KONA 3OSPA 4ECSA 2QA2A 1Y9OA 3C15B 2GJIA 1FNMA 2HVDA 3CEDA 4CLYA 5HL7Q 5LMNF 2CQ0A 5G0RB 3ZTQA 2E1PA 1Y10A 1E6YB 1S12A 2DJWA 1K1SA 3CJ0A 4RNMA 1PYTA 1NJZA 1NDCA 2R42A 4HT7A 4QIWD 2E5JA 3ZZZA 4EBDA 2IMWP 1PCAA 3W66A 3CJSA 2F8HA 3JYTA 4NA2A 4TNOA 2NXJA 5E3AA 1Y3KA 4M95A 1S9GA 2F8MA 1RAGB 4PWDA 1OSCA 2ACYA 2DHGA 2KJVA 3CCWA 3EPGA 1TL3A 1B64A 2DXFA 4AUKA 3ZC4A 1SXLA 1FTCA 2ZHOA 2VQEF 3GCXP 1U6BA 3P3DA 3ZZUA 3DRPB 4JI6F 4JI5J 1UVKA 1G3OA 2R2SA 4H4KA 1AB8A 1EETB 4KO0B 1OY8A 1GXLA 1LEOA 2GJ2A 3N0VA 3JSYA 4LQ3A 2ZC3A 1FKPA 1P1TA 4IO1A 3V6KA 3T9ZA 1IM6A 4WK3A 4ED7A 1PO6A 4RNHA 4IO9Q 1XQIA 1RT4B 2DNYA 3M8QB 3JSMA 5CXTA 1DTQB 5J1EA 3OLBA 2XS7A 5E5NA 3W2VA 1OY9A 2LA6A 2KG1A 1YQHA 1U2CA 5CYQA 1NH7A 2LEAA 3QGHA 2WVCA 4H4MA 4F8RA 1KKHA 1MMDA 4KHPF 5J2MB 1JXEA 2LP4A 4NLTA 5LMNJ 3LGNA 1LKZA 3KJQB 4DEZA 1WOOA 4FF2A 4NEYA 4Y2AA 1T9TA 4KE5A 3IWLA 1XR5A 3CCMS 5CZVA 1NJWA 4AXIA 5CA5A 4J9OA 4FYVB 2D7SA 4LBIA 5EX3A 3LWLA 2D3OR 1ACMB 2XWXA 5CD4A 4OYPA 1DARA 2BA9A 3W62A 1NB2A 3VF0B 4F0KA 1X60A 2ZH1A 3TJ8A 2C3PA 4YQWA 2PI5A 2VFRA 3DU5A 4Z7CA 1NDLA 3OSNA 4J5OA 1XNRJ 2MJUA 2JEJA 1GAOA 2V2KA 4DPXA 3HHLA 4CI0B 3PR5B 1YRTA 5B0BA 2B6AB 4CH0S 2XMKA 5DO2A 2QGFB 4DV2F 5HP1A 2ATLA 2N3LA 1BY9A 1H6KX 1LW0B 1RT6A 1S1UA 4P9SA 2C3OA 4TLRA 2BRLA 2MQOA 5JXSA 2EBEA 3W61A 2KM8B 3RRGA 1UP1A 2VPXB 4Q2MA 5C5JA 1WHXA 2LVWA 3GWCA 3N9UC 2OELA 5EUHA 4DV4F 1SJ1A 4WE1A 3H2LA 2ZH5A 3DLEA 2K7KA 1RT3B 2PMWA 3WHIA 4FKYA 3I56S 4ATNA 2V63A 3QT7A 3TUPA 4O23A 4DR4J 3M8PB 1IKVB 1C0UA 3HHLD 2V2VA 3UN5A 2DXDA 2Q1LA 2Z2YB 3UR3C 2EFOA 1RTJB 1B7YB 3OFFA 1B70B 3EICA 3ZZOA 3BN4A 4WFBQ 2OUGA 4N41A 2RQKA 3OFHA 4ZK7M 4DQIA 4F36A 4PG8A 1HI8A 3TAPA 6FD1A 3M05A 1DBDA 1OYDA 1Z4UA 3ET6B 4F4KA 1RBOB 1RAOA 3RB6A 3R97A 2K06A 3X3UA 3LP0B 4ED2A 1FTRA 2KFZA 4PAAA 4ZPBA 2W01A 4DFMA 2QMXA 1NPPA 9RUBA 4BS2A 1RJJA 1SPBP 3KDOA 1SKRA 1D8YA 4JYAF 4KHPJ 3KK3B 3TQ1A 3C6UB 4RW6A 5E41A 3HHLC 3DKDA 5SUHA 4B3MF 1XERA 2DVIA 3OV7A 2C2NA 3KLHB 5L1LA 2V67A 1HR0J 1YJ7A 1U2RA 2ZBRA 3JXOA 4OZ0A 4P2SA 1SCJB 4TVAB 1M1KT 2UXDF 3W9JA 2XMAA 2ZWOA 5ETLA 3PDNA 4Q0BB 4WF9Q 2GX8A 3BB5A 3QGGA 1BC6A 1WOPA 1FRKA 2E7WA 2RUSA 1VBZA 5A0YA 5KT4A 2XO6A 4DR7F 5J1NA 2XTJP 5LSOA 1KLMA 3D6TB 5ETTA 1RAJA 1F9FA 4Q45A 2NUUG 2RIJA 1MMLA 2FJEB 4K2XA 2Y0BB 4I68A 3BGUA 3CMAS 3OFEA 2KVIA 3F41A 5KFHA 3D1HA 4RUCA 1ITPA 4HH0A 1QTMA 4IFVA 5DJBA 1MU2A 4KGKA 1JK9B 4ZVPB 2MQNA 2JFKA 4DQSA 1HIYA 3DFEA 4LR7A 4LREA 2CFXA 4P74A 3D67A 2OH2A 4X4TA 3DHWC 5AJ3J 3FRZA 2F4FA 2WAQD 2Z2ZA 1NZAA 4QIFA 1LWXA 5KG4A 4LSLB 3Q89A 2C2OB 4CO3A 1S48A 3OD2A 3BZQA 1KQGB 4NCGB 1XIQA 4YB7A 2WW8A 4MH8A 3LAKA 5A8KB 4QWCA 2Z30B 3QO9B 1UVNA 1HNIB 2YKOA 4P2MA 2D9OA 2KXHA 4LF4F 3CD0A 3JTPA 2KRRA 2CNOB 1TUVA 1NNDA 3RBDA 4ZP8A 3ZZRA 2J9DA 4QWEA 2E44A 4IR9A 3Q23A 2B3TB 4FBUA 2WOMA 3HHDA 4C0OC 1YJNS 3MI7X 4DV5F 4NXNJ 3N79A 5D77A 1T9VA 2VG6A 4QWAA 1RTDA 1IBMF 2HKEA 2ZJQQ 3B78A 5CZXA 2AZ1A 2FDNA 2PEBA 1NK6A 3GLJA 1FT8A 1L3KA 4NRUA 4M63A 2AMCB 4DUTA 3EZ5A 4MT1A 3NAHA 4CDIA 2FYXA 4EEYA 1QD1A 3D54A 1GTHA 1JLBB 5B0EA 4JV5F 5IC4B 3SEOA 1TAUA 5A6WA 1Y0HA 4PWDB 3OTBA 1HPZA 4LRBA 2B8PA 2NPFA 4ZITA 1VQ9S 2XLJA 3KLEA 3CDWA 2HQGA 3JTOA 2YQ1A 4DV2J 2K1RB 3BGOP 3TW0A 1JWWA 2A18A 3HZGA 3CT9A 3MM9B 2R3VA 2AYGA 4J9KA 4IKAA 3WX8A 3BO3A 5GMDA 1U2FA 5HAOA 4KO0A 3TZYA 4AQYJ 1VQKS 4ECYA 4CO1A 2PE8A 3ITHB 4RW9A 4LFAJ 2IRXA 4X4UA 5DZ7A 4UY85 2P9GA 5IQ6A 4CH1A 3HULA 1JJ4A 4D3GA 2J0QD 3FJ2A 1EKSA 1TL1B 1YX2A 2ZD1A 5J1PA 4OYIA 1QE1B 5IWAJ 1NDKA 1N8RT 1UZHA 2XG8A 2ZUGA 1WG5A 3KTQA 4LF5J 5KFDA 5ETVA 2RS2A 5T7LA 3OLAA 1MN7A 8RUCA 4X65F 2QN6B 2CQ3A 4J9LA 2B9EA 2N4CA 3BBFA 1TAQA 1SJ3P 3DRSB 4EBEA 1Q16B 1U7LA 2B7CB 2R7XA 5F41A 5KFPA 5LJ5Y 5T41A 3UQSA 2DGOA 3TWZA 5L1JA 1FF2A 2X1FA 2Q43A 4F4WA 2DNGA 2VA2A 1FERA 2CQIA 1GXUA 1AA1B 1S6PB 1Q82T 1JLCA 1NK0A 1QAJA 2YNHA 1LK5A 4MK9A 1KFSA 4UQGA 1KC8T 3T6JA 4A48A 3DDIA 5IM0A 2ZH9A 3GJTB 2QYCA 4EK2A 3P8BB 4OI4A 3IXQA 4Z2XA 1W26A 4IG0A 3W9IA 3MCMA 5HP1B 3EE3A 2O01C 3QAEA 4QR1A 4ED3A 3EMTA 3BM7A 4K4VA 4WFNQ 1EP4B 3UO0A 4GMKA 4WFYA 2MGZB 3CCLS 1T03A 3O1LA 5HQMA 4HI2A 2WSCC 4WXOA 3VAKA 3HJVA 3CE8A 1V3SA 3HT0A 3LPEA 1UFWA 1OPZA 2VZ9A 3PX6A 3FKBA 3A8EA 5C42B 3TA1A 2ILYA 4RW4B 4OI1A 1X4AA 3IMQJ 1CC7A 2IAJB 3AHPA 2BUNA 3GJRB 1S1TA 4MYUA 2WVBA 3NOGA 4OJ1A 5ETPA 5K5MA 2HSEB 2P9EA 2Y1JA 1LXNA 2OKQA 3MWBA 2GA7A 4BHQA 1RHJB 2W4CA 2YWEA 1HQUA 4IOAQ 1OJ4A 3CDBA 2EFVA 1KOOA 2QX0A 3DDKA 1FDNA 3KLIA 4LSZB 1VHIA 3QGIA 3V2UC 2VG6B 1RTDB 4B3TJ 3NCQA 5KFMA 4ZA1A 2JVOA 3T9NA 2DXEA 3FC9A 3WZ0A 4I1TA 2AX0A 3M1VB 2RNEA 3VZHA 3HX9A 4QW9A 3EX7B 3TUJC 1K0TA 3AH6A 2E1AA 2BABA 2DBBA 3TJAA 2H4YB 5B0CA 1UW9A 1HBMA 1RLDA 2V9KA 2Y1RI 2J7KA 5EGYA 4DUZF 1N5TA 2XC9A 1R27B 4A8MP 4I67A 2EVZA 2RRAA 4IG3B 4JUZA 2W7OA 1FNXH 3WC2A 4YOEA 3HSZA 1F2GA 2ZFHA 5HBMB 1WI6A 4I2PB 1Y7PA 4FYYB 5IWAF 3C46A 1YJVA 1MLAA 1LOUA 1WKJA 1XMBA 3LALA 2FVPA 1CJUB 1RT7B 4DSKA 1EAYC 1LW0A 4EU0A 4DFKA 3B82A 1LFPA 4PYAA 1XR7A 4NXMF 4YR2A 4B17A 3TP2A 4P10A 5G4DA 4KGZB 3CCUS 4USWA 2AYBA 3FCHA 1TL1A 3K5MA 3P49B 4L3KA 4HHJA 2HVZA 4FXWA 1EQ0A 2ZM6F 1APSA 1YHQS 2DTJA 3HJFA 4KAIA 4DBQA 1S0MA 3ENWA 3TJ9A 1RAHB 1XNQJ 2IPOB 2AT1B 2FUG9 3C15A 4DV3J 3FBBA 4PQAA 4ILRA 3AXKA 5LOQA 3GV8B 1VS3A 1WSVA 3N6NA 2H65B 3GIRA 4PXEA 3MXHP 3BH6B 4N8NA 4K4TA 2RDDA 4DX5A 3R5GA 5F8NA 2DGTA 4KH1B 3TVZA 2RILA 2AGQA 3I31A 1HBMB 4DPOA 2XEXA 2W8LA 3HDSA 3MM5A 3T5HA 3KOAA 4OYZA 3ADAC 2WSFC 2EFGA 3UDCA 2ZHBA 2BXJA 4HHUA 1F1BB 4UOCA 2I8EA 1J5OA 1D1UA 3NWRA 4RKUC 2BKPA 5L9XA 3U1MA 2HHVA 5J2QB 1BMQB 2HS0A 3LOUA 2HIQA 2B4PA 2Q6BA 2QLFB 3LA0A 1UWBB 2DT9A 4NZ6A 4OJ3A 2MZ1A 3PVXA 4B3TF 1URNA 4CLLA 3DOLA 5DLFA 2FB0A 1RXOB 4OL8A 3E3XA 1VQLS 4FS2A 1I5OB 2DPIA 1N4LA 2CAJA 3CIMA 3M6XA 4PXCA 3IM8A 1U49A 4NYZA 2HK3A 3DRRA 1UVIA 2VODA 3AQPA 3LGHA 3VAMA 4Y2MA 3DGVA 4C7QA 5HROA 2J9DE 4ED6A 4LIRA 4K2JA 5M2UA 3SQGA 4QPTA 4NLDA 3S01A 4CZCA 4U7CA 3QZ7A 3GILA 4DSFA 4P2FA 2OPRA 2YWFA 2ZZMA 3QJLA 5L39A 1EARA 3C6TA 2NLWA 4Z37A 3E2EA 5IT0A 1D9DA 3GJQB 2LDIA 3Q86A 4NE9C 4LVNP 3UNGC 2EEYA 2B9XA 4LQ9A 1JLBA 3US5A 4I7FA 3CJKB 1U1QA 1PJ5A 3BGRB 3OPKA 5L8RC 3GIIA 2HWIA 4QWBA 2XMUA 3MEEB 4RNFA 5L46A 4DX8H 2WBMA 1NKCA 1VFJA 2GV1A 3FCVA 4O3QA 3OTEA 4NA1A 4ELUA 2A2CA 1U0SA 3IWXA 3I0RA 5LM7E 1SQGA 5KFSA 4CLKA 4EYHB 2JC0A 1NXIA 1HWJA 3HVRA 2RSQA 2FZKB 4P7VA 4HI1A 2KFNA 4DG1A 3TZWA 1RT6B 1NHKL 2KI2A 4WFXA 5A0YB 2DEJA 2N4DA 3FQKA 3NBPB 1I6JA 2FLLA 2UUCF 2CJYB 4ELVA 3R3TA 2OGUA 2O66A 4RBVA 3DOMB 4CM0A 3V4MA 4DV5J 4NXNF 4YY3J 3QT8A 4J90A 3HVWA 2QIFA 4LFBJ 1Q4RA 3MR5A 2W7PA 2R7SA 1T94A 1DLOB 3VVUA 1S1UB 3AXMA 5DM6Q 3H40A 3AJ1A 2BV3A 2UVUA 4QIVA 5HQLA 2ZWPA 3B8HA 3MMBB 4DL6A 3A8JA 2DRDA 5AXLA 1VQNS 3ENAA 1ZZNA 5D0HA 2FLNA 1JNZB 2HBYB 4K5SA 3Q8RB 3ELHA 4YB6A 2GVDB 4TYBA 3OTDA 4U7UK 4FXDA 3K5OA 2BKOA 4K4XA 2H51B 2HG4A 1MROB 1RTIB 2KN4A 5JVGQ 4Z7YA 3DGPB 4A8WA 4ECQA 2R7UA 2VH7A 2B4OA 4EI2A 4XDDA 2QV6A 2HGLA 1IBLJ 3ICLA 3V6DA 1FWLA 1VRQC 3W2WB 1YRUA 3VV2B 4NLQA 1GQEA 1HWKA 4PEOA 1YITS 2Z2LA 4TKTA 3Q2TC 3Q8SB 1ULRA 2FHJD 2EBGA 4G1QB 4R5PB 3Q22A 1FX2A 5HANA 5KFVA 2C28A 3B4DA 1KTQA 1RSCA 3DLGA 4UZBA 4IG0B 2NQPA 1FE4A 2CJQA 3OTOF 3PZPA 1BQMA 4K5RA 4M5JA 2CDQA 2UVRA 1U6ZA 2E7XA 3B6BA 4CT9A 4I6YA 5F8HA 1WF0A 1ZM3A 3FBFA 4F4XA 2CQGA 4DV4J 1M5PC 1MWQA 4OZ2A 1N5YA 1M1GA 5KFYA 1HHQA 3H2VE 5HLFA 4FYWB 3I5CA 2HURA 2BJ7A 3W9HA 4DMZA 2BQRA 1Q81T 3OR2A 1Q8IA 4ZLNA 5CYJA 4EZ9A 3QRPA 1T9XA 1TFWA 1T9UA 5ETRA 1O8BA 1Y11A 3BS9A 4EYIB 2J6TA 3G8QA 2E5HA 4N56A 2CWKA 3KJFB 1VLYA 1N5SA 5F8MA 3GCWP 4X62J 2AJQA 1RT1A 2RU3A 2HLTA 4DV1F 3W5XA 4GC7A 2RKIA 3EJMA 3NXZA 4TY8B 1Y3JA 2M3DA 4DL4A 1RWOB 3IBWA 4KIAA 3EWGA 4X66F 1YVFA 2UUTA 3BQ0A 3U1LA 5K14B 2VBXA 3VTIA 2QA4G 3Q8QB 4DR5J 2K3IA 4LMZA 4N5SA 4RNNA 4ZP6A 2J7UA 1U24A 1WC5A 3R2CJ 1CJVB 2LQJA 3BGLA 5EWFA 2L48A 3T41A 3BEGB 3LAMA 4DV3F 1Z1ZA 3BN7A 1YKWA 4QQBA 3W1YC 4ED4A 5BYSA 3CIZA 3CMQA 1QAYA 3MR7A 1VJWA 4DN9A 5KFZA 1BUXA 1DTTA 2Y1LB 1V5IB 5KFAA 4X62F 7FD1A 2ZM6J 5IM0B 3VAFA 3FBCA 4F3QA 2KO1A 4A8QA 2CJAA 3GSDA 4OHVA 1QAIA 2OPQA 2YNIA 2ZEJA 2G13A 2RHQB 2QMUB 3V6HA 2HHXA 2BDPA 2P9CA 3LO3A 5A8KA 2W2PP 3BF4A 4LVOP 3NMRA 1IKXB 1JXLA 1UVLA 4K8RA 2V2ZA 1RZMA 3HVTB 3NGTA 1OMSA 2HRYA 4LF2A 3LWMA 5I42B 2KYXA 2IC3B 3MMAB 1CJKA 3AD7C 1RHRB 1FEEA 3ONQA 3AOAA 4E2FB 1TL5A 1MWZA 1PBUA 4CH7A 1L3UA 4RUAA 2FHMA 3AJ2A 3W60A 4OLPA 1HBNB 3CD7A 4C97A 4MKAA 5KFOA 5GAEI 2H4WB 5KG5A 1U1MA 2NZ4A 2YPZA 4J9RA 1WJ9A 2VV5A 1IWGA 4YP3A 2F1FA 1GX6A 1KHVA 4O44B 2E5LF 2BRKA 1HHSA 2BW2A 2FZCB 3QIPA 3HI9A 3HKWA 4C8MA 1JLFA 4ZPAA 3U27A 1L3SA 4YHHJ 2OSQA 2W8KA 3BO4A 1MROA 1UWAA 4PG7A 1RP5A 3P4UB 1UTAA 3D28A 4K4SA 3CO0P 4JI7F 1REGX 3VGTA 4G6VB 4J9SA 3DLLQ 3MM5B 2HVIA 4M5IA 4XIUA 3GIKA 3M8SA 3FMBA 2PSZA 4KV8A 5D0EA 1HNWF 3J7AN 1Q0NA 2VBWA 1TU0B 2MKJA 2RRNA 3HHEA 3CMES 2PEHA 1TUGB 3CJ5A 4F02A 1R8PA 2ZD1B 1TP7A 2DHAA 4K59A 4K50A 2IM2A 4A8YA 1TKZB 1ZETA 2GS8A 4GKKJ 2VFVA 1S7HA 2RD5C 2IJNA 3I96A 3ZO7A 1XTZA 4ZIWA 4OX9J 4JI0F 1H98A 3NCRA 2GW8A 3OJSA 1ZAXA 5IV3A 1X0PA 5I42A 2YWGA 2OMLA 5D3GA 2UV8G 3HD1A 2PC6A 3HF5A 4N47A 2WTFA 4W92B 1KBRA 2J7WA 3AODA 3NNCA 2AYMA 5KT3A 3LH2S 2RVJA 2N7CA 4WXWA 3CC2S 5J2NA 1IVZA 3DN9A 2W2QP 2M70A 2CZ4A 4PG4A 4NLPA 4ES2A 3CCSS 2I2YA 5ETQA 2LQ5A 5F8JA 4IRCA 5DG7A 3K8VA 1N5VA 2XMTA 3BREA 2XSJB 1TMJA 3CXCR 4GKJF 2HFUA 2LYVA 4JV0A 1C1CA 4NL5A 1YK9A 3R5BA 4OJGA 2IY5B 1M0SA 3HT3A 2DNRA 3BKTA 3MM6B 2JFDA 2ZH4A 2YQ0A 1NO8A 5KFKA 4IRDA 1U6FA 5F9LA 2KYZA 4DG1B 1YRXA 3D2WA 2CPFA 1LFWA 2ASYA 5F3TA 1XNRF 3H5YA 4FNHA 1UZDA 3ENVA 1OWXA 5IFMA 1XJWB 4L3NA 2C2EA 1VRTB 2KU7A 2H3EB 2EI5A 4XAKA 3M8QA 3KK3A 3JSMB 4PUOB 1N54B 2KHCA 4MYTA 1S9EB 2DIVA 1Q5VA 3R5JB 4UTGA 5M2RA 2MKKA 4UUXA 2FLOA 4OZLA 2W2MP 4LBHA 2PFDA 3I0SA 1VK8A 1SQFA 5K9FA 2VPWB 2FJXA 4IRKA 3OVBA 1RT2A 1WELA 2MKCA 4M8LA 1OS5A 3THVA 1U1LA 2NXNA 3PR4A 2C2RA 3GG0A 1QDUB 1CVJA 3T6BA 2OD6A 3OJUA 1JXVA 2CNLB 2GZOA 3QFHA 3IN5A 1KRPA 2OEKA 4PG5A 3NGRA 4CNYA 4DR1F 2K2PA 1RTIA 2YX1A 3SSSA 2GGPA 5K8MA 5KAKA 5JVHQ 1U48A 1N0VC 4WE1B 4LJMA 3EUNA 2MKYA 2V4RA 4PR6A 4CLSA 4KKOA 4F4YA 3DLEB 3T5LA 1BWEA 3HFVA 2CPXA 2F65A 5DDQC 5KFEA 2JX2A 1X5OA 4RL1A 2DH8A 4YDXA 1F6TA 2CPEA 2QC3A 5J2QA 4PKDB 2Y1IA 1SC3B 2YKMA 2IM1A 3HPOA 2R8KA 3I87A 2QFJA 5ETMA 2HGMA 4A8SA 2GVZA 4LIWA 4LF8F 2IVMA 2FHKA 2CPIA 4C8KA 4JI2J 4WK1A 3VWSA 2GIFA 1PJ6A 2I1RA 4OZJA 1Q1KA 2WB4A 2UP1A 4LUBA 3UE2A 4ZLPA 2V4QA 4F67A 2VPYB 1TMMA 4E0DA 1C1BB 1WORA 3ET6A 2YNGA 2NCKL 2LFVA 2M8DB 7AT1B 2Y9HA 5IT9Y 2D3ZA 1PJ7A 3IS9A 3PYGA 2F4VJ 5GAGI 4FXVA 3L7OA 1UA1A 4ZPWR 1BHNA 1N6QA 3GB0A 3DRYA 1T3NA 2QLJB 2YY3A 1VRUA 3EPIA 4OMFG 2UU9F 2A10A 4RNOA 2B51A 1FJGJ 1RUSA 1LWFB 4B3SF 2HIYA 3EVOA 3UN2A 5EN1A 1C0UB 3W3SA 3NS6A 3QT6A 4J37A 3GR1A 3ETOA 1VBKA 3SI8A 3OXGA 2OFHX 2YWHA 4IQMA 2EK1A 4RBTA 2DNZA 1WEZA 2MHEA 3L09A 5IZHA 3T1HF 4NLRA 2HZCA 3UI3A 3WX4A 2E1RA 3AA9A 4OYAA 1M5VC 2B4VA 3TVYA 3NS5A 2ROGA 1JJHA 2HNDA 2Z8QA 2FHJA 2MQQA 3KKFA 1R8BA 3R7NB 2UUAJ 3QRRA 4IFYB 1AFJA 1C0TB 5BXIA 1XEZA 2G1DA 1RDRA 1X8DA 1RE1B 5GAGU 1REVA 3QLHA 3I9V9 4I4BA 3UCUP 5DGAA 4DQPA 2ZH8A 4WU2A 3MMBA 3DM2B 2X1GA 4RWWA 2OPPB 5F0UA 5LSRA 3I55S 2VONA 4AE5A 3HFZB 3CCZA 5C25A 3MOJB 2DNHA 1FKOB 2IA6A 3ZZTA 3KJNB 4C8YA 4C9DA 3KNGA 2MPUA 4EUVA 3ILIA 2VQFF 3ZTRA 4PQUA 1LWCB 5HI7A 4ZKAA 2XZWA 2B4UA 2WCXA 3HVAA 3D6MB 3J81j 1F3FA 1FFSB 2XS5A 4RJVA 4DSIA 2RDJA 4LRDA 3DOLB 2ATCB 2RRBA 1UFLA 3W2WA 1VGYA 1IBLF 1RAIB 1ZZFA 2KZMA 3SSRA 4H54A 4DFJA 1N32F 1P27B 1FCAA 2OPSA 4ILMA 3OHBA 2AHOB 1S0NA 2OP5A 3QBCA 2V0NA 2W4DA 1V9OA 2Z0GA 8AT1B 4MJKA 3ZTSA 4DXLA 3K59A 3HSGA 4K0KF 4QWDA 3DLHA 4OI2A 1KQKA 3KHLA 2B9WA 3EM1A 2LQ9A 3G82B 4NCGA 2JWNA 5E7OB 1HNZJ 1FJGF 3OXLA 1EETA 3EZOA 2DRBA 3W5YA 2HQFA 3HHKA 4KTQA 2RF2B 1RYRA 4I64A 1KP6A 2LMIA 2F4VF 3MEEA 3SZ2A 5B7WA 5M2PA 2CADA 1LWEA 4FYDA 1SJRA 4U7UD 5I4MA 1U1OA 3I0RB 1T95A 1H2UX 2CPHA 1Y5LB 3EXYA 1DTQA 2HQCA 5B0FA 5J1EB 3T19A 2GAHC 2KT5A 1FA0A 1H2VZ 3MEDB 3I4HX 3FSYA 1XBWA 3MPUB 3L4BC 2HVHA 4OZNA 1X4GA 4CLWA 1KS2A 4H4MB 3KHHA 2FGCA 2J0WA 2E7VA 2KJWA 4AL7A 4C8OA 4UOHA 4JI3J 2UU9J 4AXJA 3A4TA 1RTHA 1X9MA 1BXNA 3NCPA 1A6LA 2QL9B 5A8RA 3LP2B 1JNRB 4JI1F 1S79A 3L3CA 4MIWA 2BANA 3J7YU 3K5PA 1NRKA 3KK1A 3PX0A 3MUMP 3OW2R 5IOLA 4Q7AA 2VOOA 4O4GA 1U09A 2VPZB 2B0GA 1TKDA 3DGPA 1CC8A 4LF9J 4DR1J 4ZDNA 3NKYA 2BX6A 2HQ3A 3NOCA 4W4MA 2HRTA 3V5RA 1NZ8A 4MK8A 3CCES 1U1KA 3DLBA 1NJYA 1ZH5A 3CNQP 1IQZA 3NGKA 4DUYJ 3HSDA 4JI3F 2MYFA 2DGSA 1CJTA 2C42A 5KFUA 3S7RA 1VLOA 3PHEA 5L1IA 2MZSA 3HCXA 3ZTOA 5KFRA 1VC5A 4RUBA 2Y3YA 4WYWA 2K7JA 4EO6A 3HZEA 2R9LA 5C7PA 1LXJA 3ZTPA 3JSRA 1T3OA 1U8SA 4QJVA 1UKUA 2UXCJ 4O4RA 2IC3A 1HNIA 1VQSA 2IBOA 2LQ8A 1B4SA 2BE2A 5IV4A 3KDNA 4CLTA 3QATA 5A8WB 4I69A 4NLGA 3EGNA 3I9ZA 5DQHA 4YR0A 4M5KA 1GMUA 2EXUA 2G1HA 4U67Q 4K4WA 1Z2ZA 4ZVHA 3JAMY 3ZFVA 3G6VA 3KHRA 3CCQS 2MQ8A 2V4JA 1TKXA 3D1OA 1N36F 1AUDA 1Q8KA 4IDKA 5D15A 3CUNA 4Q8EA 2R8GA 1T05B 4ZHRA 4C8LA 5D4NA 1YI2S 2ZNYA 1H72C 3MM8A 2KKHA 2ADBA 1T03B 2IMOA 3IP0A 2HHPA 1JJCB 4O4GB 4K4YA 5C2GA 3MZIA 1DRZA 4YDDB 3HLUA 2H5JB 4NLWA 4LF1A 2FVRA 1OYEA 1EQMA 1MW7A 1FNOA 2EFNA 4FVMA 4WYLA 1FJ7A 3N01A 4HHHA 3R6LB 3DMJA 4A46A 1HW8A 3IBCB 3QNWB 5GADU 4DR7J 4LRCA 4X4NA 1FDAA 2YQ3A 2HMIA 3A12A 1KNZA 3DC2A 2V8GA 1VQ8S 1GXTA 2FD2A 2RQ4A 1SJ4P 2LA4A 2CWXA 3GR0A 3J81U 4ECWA 4JI0J 4XDCA 3OXFA 4DFPA 2CIMA 3IAS9 2GCFA 1TVRA 2HHUA 3PW5A 2XGPA 3ETMA 4FYXB 2FJBB 4ICLB 3QRQA 4C8NA 3M9NB 2DR7A 1RWUA 5HQ8A 2DPJA 5B09A 3ILLA 4AFFA 2CZVC 2KDOA 2GQCA 2RF2A 1GTEA 3M1VA 2VKZG 2VUGA 4HDHA 2ZH6A 2BZ2A 1W2BR 1Z2LA 2Q6CA 1VI7A 1EZZB 1N6QB 1RT5B 2IIHA 2HNZA 2UUBJ 2HHSA 4M5DB 5I3UA 4ID5A 3NRBA 4B08A 2LU1A 1ZYQA 2WSEC 1HBOB 3KJVB 3M9OB 1QE1A 1RGVA 2O5DA 2ZDOA 1RYSA 3K57A 1DQ9A 4KR0B 3MR3A 2BM1A 2BYCA 1R43A 3M8YA 4MFBB 4J7CA 5B08A 3RAMA 5AE1A 3KK2B 3C16B 1VQPS 3C2PA 1YZ7A 4YY3F 1SUQB 2UUBF 1UPPA 1JKHA 2YKAA 3BR9A 3M2UA 5FDLB 1FDBA 1VBXA 4ZVSB 1NM2A 1WUUA 3QQCD 4AT1B 2BE7D 5CYMB 1NSPA 3AY0A 4CIOA 1SC4B 2AJFE 1RWKB 4Y00A 2C3YA 2SXLA 3QZ8A 1K1QA 4OI0A 5KT2A 2XM3A 2LXFA 2HMIB 2I5JA 4Y2CA 4DUYF 3PEHA 2BJ3A 3V81B 4ILLA 1IR1A 1VC0A 2FVSA 4PXDA 1JLAA 6FDRA 4OIXA 1FXLA 3Q8UA 3VHQA 4LSNA 3C3LA 1R0BG 3PXGa 4ZVQB 2JH3A 3NGUA 3F0NA 4O0NA 4CT8A 4QR2A 3SQOP 4ICLA 1T7PA 1MWYA 2YNFA 1DQAA 2BEFA 1GK8A 3CGIA 3E51A 4F0HA 3KLFA 3I82A 4C3MA 4JBCA 3KLHA 2XY6A 4NXMJ 2VDIA 3RBZA 3ILJA 4ALZA 4E98A 2HHTA 2HHQA 2GAGC 4U6PA 3PKYA 3G9CA 4DV6J 1LWCA 1U26A 2ZKUA 3AB2B 2HNZB 2MMYA 3ENQA 3QMQA 5THWA 1YBTA 2HK2A 3D5MA 4DS4A 3RR7A 3R1HA 2J8SA 3M2VA 1S6QB 3MEKA 5KFFA 3W2VB 2MJNA 1KD1T 1N36J 1J5OB 1N34F 2UXBF 3PW2A 2C3UA 1RAAB 1T9YA 2DNQA 1WDTA 2Z58B 3MEGB 4LT6A 2XLIA 2XQCA 4UZCA 3GV7B 4DV0F 1UWBA 2WVDA 4BLGA 1CBKA 2H9ZA 2OI2A 3H8YA 5HATA 3AD8C 2MHNA 3CJTA 4I2QB 4WWSA 1VBYA 2VC1A 2VDHA 3G86A 4IDKB 4M5HA 2W24A 1TK0A 3IRXB 1CQNA 3IO1A 3IR6B 5HMWA 2LDYA 3OUYB 1YSJA 4P71A 2W9BA 3HK2A 2CYYA 4EZ6A 1NK8A 2MQLA 1MG7A 5DDOC 2DITA 4DDFA 2IRUA 2VBZA 4B3RF 3GONA 3SCJE 2V69A 1JLQA 3GG1A 3GIJA 3C6TB 1C2PA 2D3UA 2LU2A 3FFIA 1MSWD 1W25A 3N28A 1IR0A 4WIIA 1D8ZA 5H9EK 3TANA 4DQQA 5DZ6A 4KJIA 3O44A 5HK4A 1S9EA 4BWMA 4CO2A 3V4IA 2IA0A 1TL3B 2W4PA 1CPZA 4HH1A 3KG0A 5DG8A 2DEIA 2JNJA 2K3KA 1FRMA 1SBRA 4F4AA 1RLCL 2EG1A 2HLUA 3G4SS 5IS2A 2VHGA 2ZUAA 1RU2A 3H20A 5T7LB 2AU0A 4HT5A 5D0RA 1KVJA 4P72A 3JQMA 1GMWD 2OEJA 3AT1B 4P6QA 4DCOB 3MAAB 3PNIA 3CD6S 2WOMB 2DR6A 4QIGA 1WF1A 2PN6A 3TEHB 5H1SV 1RWMB 2OPRB 3THPA 2YKQA 3BKUA 3F56A 1NUEA 3RBXA 3RB0A 5KOWA 3DI6A 1HD0A 2DR8A 2DNNA 2ZOFA 4TQSA 3LPYA 1NMEB 2MKIA 3KFWX 1VQMS 2MQPA 1ROFA 3TR5A 4MFBA 2A6MA 3AAWB 3IRXA 4PRFA 4XK8C 5A76A 2NSBA 1SH2A 4QBUA 3J7YI 2EFQA 2EWHA 1WKLA 2ASLA 5HVFA 3TEGA 1UJ6A 2MZTA 5AE2A 2E5GA 2DB1A 5LXYA 1WC6A 2VU5A 5IQQA 2BM0A 2V5HG 3CCVS 3KWMA 1SKSA 1JLQB 1YBUA 1FVQA 1X5SA 2L9WA 3NBPA 1Q5YA 1SIZA 2VD3A 2PFFB 2JDJA 5KFXA 2M7SA 2PD1A 4CWBA 4FZVA 3G6YA 5CABA 4PQUB 4DPTA 2WZ1A 4FS1A 3FCWA 3TOQA 5KT5A 1GEHA 4QYRA 4ITSA 2ABYA 2V68A 3DXBA 3EGWB 4RWXA 2BOPA 4LSNB 3QFWA 2JL9A 1FVSA 5C42A 2ZE2A 1P8GA 4R5PA 1D09B 1S10A 1GT8A 3MD1A 5CD4H 4JI7J 2OTJS 1FRHA 2CQ4A 5JUMA 1SVDA 2R4FA 3MM9A 4I6AA 2YNFB 4G1PA 4CLPA 3MPVA 3TQEA 1RU1A 4U95A 3UCZP 4KYZA 1RHMB 3MM7B 1RA6A 2LEPA 1R0AA 3X1LB 4LF7J 4TU9A 2JSXA 2HFSA 4RW9B 4CO5A 4HACA 4DR2F 4NLSA 2CJ9A 3M30B 1YG0A 4QR0A 2Q79A 2PO4A 3QAUA 3W7BA 4WCEQ 2IYIA 1N88A 3UPFA 2F40A 4Y0FA 4JI4F 1QY7A 3R2DJ 4GVLA 5LMUJ 2DR9A 3LF0A 4RLEA 4ER8A 4B3OA 1XK8A 4DR6F 4AL5A 4F2RA 1V3ZA 4DV7J 1XC9A 1VQ5S 5E3PA 1B99A 3UD3P 3Q24A 4C2MA 1S97A 1S0OA 1KHWA 4WIQA 1OIAA 4CM2A 2G9OA 1NU4A 1YJTA 3K89A 3MCNA 4JOUA 4X4SA 5A2QY 3H98A 2E9RX 2YKNB 3IR7B 4O44A 3HKZD 3PJXA 1KEKA 3QSYB 2XNRA 2ZVIA 4B3RJ 1NAQA 1RB0A 3J7ZT 3K58A 2RKIB 1QUVA 4DR6J 5BYQA 4ZPDA 4AL6A 1IJEB 2D9PA 2HHHF 1A7GE 4UY8T 3WDOA 4UT4A 3BSNA 3GV5B 4KQZA 1NKBA 3H4BA 1IKWA 3N6LA 1SKUB 3EDRB 2XCPA 4DV1J 2GQQA 1EP4A 3K8WA 3KK1B 1X4FA 4NZ7A 3A1YG 3K5NA 4NYOA 1AROP 2HBRB 2VKRA 2HPUA 4ZVTB 1RT4A 2HHHJ 1T02A 4IH6A 3PYDA 3S1TA 1ZTTA 4LF5F 2H5IB 2FZGB 3P5TL 2G0JA 2B7BB 3PTWA 2KTQA 4RW4A 4FBTA 1PBAA 2RS8A 2JJ4D 2VF3A 3TAMA 1AFIA 4DJBA 3VAJA 1T0TV 1YJUA 1P1LA 4FN5A 3C8YA 2H1YA 1SQEA 1N32J 1IBKJ 1WF2A 4DV0J 5H9FJ 1ZPVA 2RB7A 4DSJA 2LXIA 4P2XA 2DNMA 2QL7B 5L38A 2IYGA 4QZVB 3TO8A 2IJFA 2L3MA 3PYFA 1UA0A 2CVIA 4J9UE 3T3FA 3R5CA 2YX4A 2J9EA 5GAEU 1RKIA 4OHWA 4GKJJ 2D69A 2QE5A 1FKAF 2PMHA 3PFOA 2M5YA 5K8NA 3KNAA 3JQKA 4PWUA 5RUBA 3G8TA 2OFGX 2XS2A 1IN0A 3HM9A 3SCLE 3G82A 1XMQJ 1EX8A 3GZ7A 4FNIA 2DGQA 1U47A 2APOA 4MKBA 3D66A 3IWNC 3MURP 2DNKA 2LXUA 1JLGB 1K44A 3NNAA 3NMAA 1TKTA 4E8UA 4O3PA 4L75A 2GHWA 3GPAA 3SCIE 1R7IA 1WACA 2DCLA 2RJZA 3I5AA 4F25A 2DIUA 4NCAA 5JJBA 1BQNA 1NPRA 3NP5A 3BSCA 4ZVEA 1NHVA 2EKYA 1R0CB 3CJ4A 3GP9A 2R8IA 1FJCA 1S6OA 1X7VA 3MTJA 4OX9F 2ZNZA 3VGVA 5L9NA 4ECXA 1FRLA 3H5UA 5F8LA 4R8UA 1HL6A 5DDPC 1AUSL 1Q86T 2FJVA 1U02A 4UQTA 2FJAB 4M5NA 3FEZA 4Y2KA 5J2PA 1S49A 2OJ3A 3EDQB 2WONB 1RTHB 3M8PA 4X4QA 1RT7A 2BQUA 3MM7A 1R0AB 2FGOA 2Z2MA 3VGSA 3PO4A 2W2NP 1CS4A 3R7BB 4Y34A 2QYGA 5FLXU 3M30A 1TVRB 1PAEX 3MUTP 3MGJA 2I0XA 4GVBA 3R1LA 4KFBB 2XGQA 3ZNJ1 3LP1A 1Y4ZB 2Y0SD 1ICEB 4HL9A 3KHGA 2WRMA 4AD6A 2POKA 4U96A 4IYQA 5J2NB 4N76A 1MNEA 3G8SA 4B9NA 1QVFR 4IQXA 1HQ2A 3Q0AA 2X3GA 1HNVB 3GTYX 3PJ9A 2QT7A 6AT1B 1EJ7L 1WTBA 1H7XA 2F5GA 2MZQA 5KTQA 1HBUA 3WIVA 5I3QA 1UETA 3PW0A 2ADCA 1RHKB 1TL7A 1HBOA 5ITHA 1F3VA 4ZVUB 1JIHA 1WTFA 3UWTA 2BE2B 3PKMA 2DGWA 3R5DA 5U47A 3W8PA 2EC0A 2OPQB 1T11A 1PIEA 3CD5A 2NZCA 2CKWA 2WB1D 2XCAA 1N5YB 2AWZA 4FF1A 3IG1B 3CJQA 4CLFA 3H4DA 3OR1A 5HMXA 2NR0A 3IBFB 2GMLA 3MMJA 3DRRB 1BD6A 2DISA 2HBQB 2KRBA 1Q7YT 1NEEA 4C8ZA 5ETNA 3DRXA 4B9TA 3FVYA 4KC5A 3BQ2A 3JS9A 4DWIA 3A3NB 3RRKA 3J7A1 3Q8PB 2QA4S 2BJ8A 4URQU 1PYSB 4QU7A 1SL2A 1C4CA 2V94A 2Z57B 1MU2B 4F50A 3H7HB 1T05A 4YS2A 2YVSA 2OHDA 4RBUA 4GVBB 2W9AA 2AP6A 1Q8BA 1Y5NB 2AJ4A 1HNXJ 1QSSA 5DGBA 1K73T 2GIQA 4A8XA 3G87A 3KG1A 1TTHB 2YBVA 1O6XA 1BQMB 3U02A 3CULA 4MIBA 2RMLA 3OUYA 1IM4A 1DY3A 1OQ6A 2ROEA 2IFXA 1PC4A 4USJC 3A13A 1HNVA 4XTTA 4NCBA 2DK2A 2O67A 3D1QA 1O51A 1NDPA 4NRTA 1I94F 4QYZJ 4IFYA 1UCNA 3EZUA 4ERDA 2IM0A 4C98A 1RTZA 4P7TA 5CAAA 3OR2B 4M1KA 4NMLA 1UJ4A 1E6VB 4OYBA 4PYDA 2L41A 2XI2A 2IDLA 3EVMA 3GFHA 4DS5A 5KG1A 3S6EA 4Y6IA 1U8WA 2VJVA 3FNNA 3BSOA 3G6ES 2EG2A 2RQCA 3V4IB 4CO0A 1KOHA 4H4OA 3KJVA 4I2QA 2V9WA 3H5SA 4DX7A 1OPIA 2VOPA 2HNYB 4CYUA 1DFDA 2M9KA 1N33F 3KMSA 3KG4A 1HWLA 3L7UA
chains in the Genus database with same CATH topology
4DLEA 3OHAA 1C1BA 5BYRA 2AJ1A 2ZH3A 4FF3A 3QWUA 4CO4A 3U1NA 4LFAF 3H5XA 2NPIA 4B3OB 4EGLA 3SFGA 5CYQB 3T1AA 5LMUF 2IAJA 1M5HA 2Q3PA 4LF9F 3IFEA 1LWFA 1S77D 2PIIA 1NK4A 3IGVA 5KFQA 3QYYA 1C1CB 2RT3A 3ISZA 4X4PA 2ILZA 5KG2A 3RU0A 1WG1A 3MD3A 2YNIB 1ZTWA 1S72S 4IR1A 3R27A 5FIIA 2MSSA 4ES3A 5BJRA 1UJ5A 4A8FA 5SZTA 4GC6A 4A4JA 1BC6A 3CJ3A 1FE0A 2DGVA 4L6V3 3HVTA 3RR8A 2J9CA 5ADZA 1FD2A 2XI3A 2GQ2A 3UFCX 4C0HA 2C3MA 1KN6A 3UDLA 3UD4P 2MZRA 1X9WA 3KLFB 2LCWA 3TA2A 1LW2A 4NLXA 3I0SB 2JZ5A 4U9RA 4ZPCA 2IHR1 5CHCB 1HD1A 3MMCA 4X4VA 3N6MA 2XHWA 4Q44A 3SDEB 4ECVA 2YH0A 4FF4A 4XPCA 1U1PA 4ID8A 3E01A 1RT1B 2OMOA 4I6WA 4NA3A 1NKEA 3CCRS 3BDPA 2DH7A 2HAIA 2NSCA 2QZ8A 1UVJA 3RW6A 1SV5A 3B4MA 1TL4A 3MEGA 4ZMMA 4NLVA 2DCUB 2XY5A 2KT3A 2X51A 3GE9A 1AXQA 5LSLA 1BGXT 3HXMA 2JC1A 2HGNA 3QPIA 3FSIA 1ZAVA 1S9FA 2UUAF 2EFPA 1HA1A 1TR0A 3C6UA 3DM2A 1IJFB 3O6QA 2MZJA 2IRYA 2IVFB 1YJ9S 4M94A 1HMVB 1QM9A 2ZVSA 3GIMA 3M4XA 2KH9A 2ASJA 4ED8A 1WNEA 3K2YA 2CQ1A 3QIDA 3RB4A 1VHFA 2U1AA 3LQVA 5KT6A 5D3GB 2FTRA 4RW6B 5FLXY 1D9AA 4BBYA 4C3KA 1O5JA 2QRRA 4PG6A 2F9JA 4JV2A 2FJDB 1FD8A 1E6VA 1VIXA 4HTJA 3SV3A 1XMOF 5D4PA 2Q66A 2B5JB 3CSKA 3AQOA 1KQSR 3PIPQ 2D41A 1K9MT 4MIAA 5D6GA 1VQ6S 4NLUA 2X1AA 4LFBF 3VALA 4J9MA 1FRXA 1R31A 4KFBA 1NJIT 2F8EX 4DF4A 5KG3A 2HQIA 3I32A 5E0OA 4YMEA 3SQGB 1I1GA 3T5KA 5KFJA 4PPZA 1CEZA 2R2RA 1A9NB 2QO3A 4C0BA 3DHXA 2ASDA 3QGPA 1C0TA 4PUOA 4KBIA 3TVKA 3QO9A 5AE3A 2M4MA 3BGFA 1SC6A 3TX8A 1VQYA 3U7JA 2PT0A 1JLFB 3C66A 2W9CB 1RK8A 2RDIA 5LJ3Y 4KSEB 2OSRA 3E8OA 1X4BA 4EWTA 5HMYA 1YBAA 1N5YB 4ZVFA 2QA1A 4IOBA 1LQ9A 1FEHA 1TKTB 3D0IE 1F5AA 5KG0A 3OR1B 3EXCX 2MY7A 2CG4A 3SYZA 2W7AA 4ECTA 1NHUA 1H3DA 1RT5A 3FQLA 3DOMA 4ZCKA 1RKJA 1KVIA 1FJEB 2FVQA 3CDUA 5K8OA 3IA0A 4ZVGA 1DLOA 2R2UA 5DDRC 4FVCA 3OL8A 5BR8F 3MMCB 2G0CA 3ISNC 1S1TB 4DHVA 3KLGB 1D9FA 2M8HA 2B56A 1MMNA 1KLNA 4RZRA 4KHMA 2XO7A 1Y5IB 4CNZA 1HPZB 2J5AA 3HO1A 1X5TA 2AF6A 3DLKB 5EWEA 2UVVA 1S76D 4DL7A 1FK9B 4FPRA 4ZS6A 5LL6d 2AGOA 4OI6A 2AQ4A 2FVCA 3PO5A 4X4UA 2BR0A 2DNLA 2HFZA 1SH3A 3CJ2A 2ZOMA 3I4PA 4WZQA 3OFGA 3NL0A 2OO4A 3NWGA 4USIA 3O8WA 4FP9A 3SXLA 4R8UB 4RU9A 1ZAWA 2XY7A 2VA3A 2W9CA 4LF6F 2COLA 2JLFA 1FESA 1HHTP 1R8AA 5C24A 5E3QA 2YX7A 2QSFA 1ZOTA 2B6AA 4WKRA 2VB6A 2DHSA 1L3TA 4B9MA 4DSLA 2YTCA 1X5PA 2VG7A 4DLGA 1YIJS 4NPOA 2JEFA 4DL2A 3K0JA 3ZZYA 4RW8A 4YUDA 4KPYA 5HLFB 1ZPWX 3BDEA 3MPYA 2CPDA 5G0RA 4KRWA 3GYNA 1VQ7S 3H25A 4GKKF 3K5LA 1M5KC 1Y00A 3JSBA 3EGZA 1R6YA 2KM8C 4JI5F 2GHPA 1S1XA 4QW8A 5F3ZA 4OX7A 1U25A 2ZDPA 3VAGA 4ES1A 1HI1A 2XMWA 3D0HE 4EO8A 3MF5A 4YFUA 3VCDA 1SUQA 4RUHA 2CQCA 3DU6A 4TXSA 4Q5VA 4B9VA 2K8GA 4DL5A 4B9SA 4ECUA 4YR3A 3M32A 2DD8S 5E2QA 1JLCB 4L72B 1TZ0A 3GFXA 2ZBCA 3L95X 4IH5A 1RI7A 2B9YA 4Q43A 1JLEB 1L3VA 2KXNB 3CO9A 1H2TZ 5DQGA 2JLGA 1SIWB 2HHWA 2YWKA 4OJHA 2HW3A 3CWJA 3O5TB 3MCSA 2VG5B 3P96A 1N5QA 1WWHA 5E3CA 3RZAA 1UVMA 2DGUA 2XNQA 3DOKB 3KYLA 2VASA 3AA8A 4IH7A 7FDRA 1HYSB 2V4JB 5GVQA 2BQ3A 1DZ5A 2N7YA 2UZAA 2A3JA 2CQ2A 3MDFA 3MMAA 1E6YA 3MR6A 2FHOB 4ECRA 2GMJA 3TARA 1JLAB 2AJ0A 4Q8FA 2CJBA 4BWJA 3TNVA 2JEIA 1R89A 1WG4A 4NX9A 4O3OA 3PX4A 2MB0B 2CVEA 3TAQA 1VQOS 5CCMA 5GAHU 1DHMA 3LP1B 1P9QC 3PW7A 3CTRA 1URRA 2YH1A 1NK7A 2VL1A 4F2SA 2MXYA 1QLNA 2HNYA 2VFUA 4Y28C 2FY1A 2HNDB 5D78A 3RB3A 2CQHA 2W9BB 1JLEA 4K4UA 3CDAA 4RW7A 1HBUB 2C22A 2G4BA 3SCKE 2UV8A 2PA8D 1WD6A 1JJ2R 3RW7A 2GMHA 2PDAA 3UR0A 2ZH2A 4LFCF 1H0HB 2O3DA 1RT3A 2J8AA 4EFAC 1WHYA 4M5DA 5I3UB 2HFNA 1PO6A 1LK7A 1SH0A 2D74B 3SSQA 3OBIA 2MQMA 1TV6A 1NH8A 3IR5B 1NJXA 5C25B 1YWXA 3M6WA 2E5IA 3F73A 1KTVA 1K8AT 1QJHA 5B0DA 2OPSB 4RW8B 4Q0BA 1F5BA 5A6PA 1Q78A 1TFYA 2IVYA 4HDGA 2GNKA 2BACA 5CYMA 5AXKA 4A8KA 3MFHA 3ZZ0A 1NK9A 2ALZA 2CRLA 1XN9A 2ZZNA 2DO4A 2DNPA 3CF5Q 5KFLA 4O3SA 1HWIA 1R8HA 2D1CA 3RAQA 4JV1A 2R7TA 3BR8A 3MHYA 4NLOA 1KR4A 2EW9A 3HMJG 5I3PA 4CTAA 3TI0A 4BDPA 1RISA 3DCAA 2GO8A 5E33A 4J9PA 1QSYA 2KZZA 1CG2A 4OX8A 4R25A 1VIOA 4H4OB 2YNGB 5KOXA 3RB0A 2VC0A 4XPEA 2BJDA 3J7ZT 1TKXB 2HVIA 2EK6A 2CPZA 3ITHA 2R7RA 1M1KT 4X84A 3POTA 3EYZA 4OZ1A 3GQCA 1SJQA 1HFEL 1HARA 2YKPA 2FC8A 3DI6B 3IGNA 5GADI 1FXDA 1JMTA 2WK4A 1PC5A 1ZM4A 1HW9A 2BANB 2FC9A 4MAKA 5DG9A 3G96A 2UVWA 1UAWA 4YB5A 3GFZA 2J0XA 4I2PA 2ZE2B 3P6YC 5F9NA 2OIHA 5KFGA 5KG7A 4B9LA 3DNCA 3FGVA 3TRGA 3D0GE 2H5EA 2MDAA 1X9SA 1N56A 2PMZD 5HROB 4IOCQ 3NGDA 1SB6A 3H59A 5IXUA 1XWLA 1BQXA 2J76E 4O3NA 4TU7A 4J9NA 2E9ZA 1Q53A 2R7QA 4YHHF 5K14A 1HQEA 1S4FA 4C11B 1U1NA 2X1BA 4HTIA 2HS4A 4PCQA 4ELTA 2MY8A 3IAM9 2KFYA 2UUWA 2WBRA 1JX4A 2XBPA 2B5JA 1X0FA 4TY9A 3T1YF 5FJ4A 4OHXA 1O0PA 3QJPA 1DJ0A 5GAHI 1M90T 5EWGA 2XWYA 1S1WB 1Q79A 3VR1A 4F3OA 1NB7A 5AXNA 1WHWA 2C2DA 1LV5A 2I38A 4WZMA 3E01B 4F4ZA 4DV7F 4A8OA 4G3IA 3CVKA 1QAXA 5GMKa 4X64F 1SV5B 4D3HA 1VRUB 3JTNA 4NLYA 3J7Z5 5CQGA 1NK5A 4ECZA 1SJFA 5KFWA 2RE1A 2JEGA 1X4EA 3MTKA 2HWTA 3PFEA 2VFTA 4IFVB 2RQMA 1HQUB 1U1RA 4G1QA 4MTPA 2IBKA 3JYTB 5B0AA 2W25A 4Y2IA 2ZHAA 2XB2D 2P6TA 4DQRA 3PACA 1KSPA 3DDNA 1FDDA 3M32B 4LSLA 3DRSA 3WBZA 5L1KA 1JB0C 3OL7A 4URGA 1UMJA 4JI8F 4DF8A 1IUJA 2AYEA 5DQIA 1LWEB 4YB1P 4OQJA 2NYIA 4I7FB 1HI0P 2E1MC 3DLGB 3J80Y 4OV1A 3MEDA 2MKHA 1FXRA 3LGMA 5HBMA 4DSEA 2J6UA 2HHSA 4KT0C 1F60B 1S1WA 3TAMB 2BBEA 5HMZA 1RT2B 4ID5B 3KLGA 3FZ2A 4GO7X 3NG8A 3HHNB 1D3WA 2HFOA 4TN2A 1S1VA 4DR3F 1TKZA 2ZH7A 1FKOA 1RQ0A 1TK8A 1HWUA 3KK2A 4OHYA 3DXSX 3GMGA 2LLZA 3N4WA 3PEJA 4BCAA 5CCLA 1FK9A 4WU3A 3OVSA 1ELOA 2A1BA 2LKZA 5DS7A 5T14A 3TUIC 5H9EJ 3SV4A 2I9SA 2RH3A 1RA7A 4NWBA 3CPWR 5HN0A 2CPJA 2N3OA 3M2RA 4Y3CA 2NS1B 2L08A 5D8HB 3SFUA 5FDLA 3V81A 3AB4B 2IM3A 4WKYA 4DL3A 4LF7F 2Z4PA 2VG7B 3J81Y 3M8RA 3KLEB 4R0EA 3BJYA 5EHHA 3KMQA 3HHLB 1F0XA 2I5JB 3I6PA 3V6JA 5EDWA 4RW7B 4X4RA 1IKWB 2R7WA 3IC1A 4DN0A 5F8IA 3N5BA 3RBEA 4RU2A 2JHEA 1S99A 1VC6A 3M9MB 4ZP9A 1TK5A 2V8DA 1FRIA 2GO9A 2KB2A 2E9TA 4B9UA 3NNHA 3MR2A 4OZ5A 1S1XB 1ZM2A 3QJJA 1G1XA 2WONA 3CC7S 2O1PA 3MECA 1U45A 4ZCLA 3HP6A 3R5AA 5AJ3F 2RU9A 2JLEA 2MKSA 4F3MA 2ZBIA 3DOKA 3FEXB 4A47A 5KFNA 3RRHA 5HO4A 3OQ2A 2L9DA 5LXRA 2QMWA 1ZBTA 1OSDA 4MMOA 2BVZA 3PIOQ 4H4KC 4QCLA 2XULA 1Q7LB 2GHVC 1X4HA 2ZKTA 1HBNA 2XMMA 1XMQF 3LW5C 2R8HA 4PXBA 2VFSA 5F0WA 3CJKA 4N77A 4TYAA 4DV6F 5AXMA 3LP0A 1SL1A 2NXUA 3FFIB 4QPXA 2VG5A 1GH8A 1F5CA 4XO0A 5C24B 2YKMB 3DRPA 1FRJA 2NUHA 2OD4A 4J9QA 4N8OA 2KT2A 3IG1A 3NAIA 4B02A 2DR5A 1S0VA 1W2IA 3VQSA 1YGYA 5DLGA 3PM9A 3VAHA 1OQ3A 1L5UA 5KFBA 3PV8A 1IKYA 4DR5F 3PW4A 1KLMB 4K4ZA 1TQLA 4ZCMA 3GYXB 1DQ8A 1JKHB 2DGXA 3M2UB 2ZC4A 5KFCA 3DYAA 5IT4A 4KGMA 1GNKA 4ZHRB 3OTCA 2UXCF 2DNOA 3KLIB 5LT5A 4QU6A 4O3RA 2E29A 3RTVA 1WEYA 4TQRA 2P6SA 1UW4A 2GC8A 2OAUA 2L9NA 3F44A 3MAHA 1T8EA 4NZ0A 5DM7Q 2QEXS 1DURA 4OX6A 2DH9A 2AX1A 1HNXF 3MFIA 3TUZC 1IKVA 5EX0A 1VK3A 3FSXA 5D4OA 3CCTA 3BGRA 4OHZA 2QLXA 4I0WA 5MLCV 1HMVA 1CSJA 4DOZA 1QSLA 3FMWA 2XLKA 2HS3A 3HFKA 3S8SA 4ETZA 3VQTA 2OPPA 4BC9A 3Q2SC 3PJWA 1SKWA 4URSA 1UL3A 1X4CA 4AYBD 2AW0A 3FDSA 4OI3A 4RX6A 1HNZF 1GX5A 2M88A 1BLUA 2GGPB 2JRSA 3K7RA 3MECB 5KT7A 3OLBA 1LW2B 4QOTA 3MAQA 3DYAB 4KKOB 4C3LA 1QVGR 2CQPA 3UCGA 1RTJA 5B0GA 4CTAB 3M6UA 4TY8A 3SDEA