2HLTA

Solution structure of bacillus subtilis acylphosphatase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
publication title Solution Structure of Bacillus subtilis Acylphosphatase in free and bound states
rcsb
source organism Bacillus subtilis
total genus 25
structure length 91
sequence length 91
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hltA00
4FNHA 2GV1A 1X7VA 1OSDA 4HI1A 3HHLC 2PD1A 2VV5A 3BR8A 2AJ1A 1QUPA 4U9RA 1OPZA 1Y3JA 2IYIA 1N5VA 3LO3A 3WDOA 1GXUA 1ULRA 2OD6A 3QMQA 2OFHX 1P6TA 2GGPB 2HFNA 2RMLA 2BJEA 2K1RB 3HF5A 3HHLA 4OJ3A 3FRYA 1CC8A 3BN7A 4QOTA 4DN9A 2HLTA 3HX9A 4EFAC 2W4CA 3HDSA 4HL9A 2GO8A 1VQYA 2AW0A 2HLUA 2W4DA 3DCAA 3FGVA 1AW0A 4F67A 2VH7A 4Q2LA 4FNIA 1JWWA 1Y9OA 3KNGA 3F44A 1MWYA 3E8OA 1FVQA 2AP6A 2XMKA 1Q8BA 1V3ZA 3BGUA 2IFXA 2K7KA 1AFIA 1GXTA 1YRXA 1YJRA 1U7LA 2QLXA 3KG1A 4ZA1A 5B0EA 1YG0A 4A4JA 5KAKA 2RILA 1R6YA 2ACYA 2G9OA 1P8GA 1FE0A 5A6PA 5B0GA 2GGPA 3UDCA 1KQKA 4YDXA 3IWXA 2RU9A 2HIQA 3KG0A 2K1RA 3TNVA 1W2IA 3GZ7A 1FEEA 1Y0HA 2FHMA 2HFOA 1MWZA 1Q53A 2IYGA 2XMTA 2XMUA 2ROPA 1OQ3A 2LDIA 1OQ6A 2XMMA 3DXSX 3HFKA 4OIXA 2OFGX 1TR0A 2EW9A 2CRLA 2OP5A 3LGNA 5F0UA 3T9NA 5K9FA 2BBEA 3CJKB 2KKHA 4NPOA 2L3MA 1SI9A 2LQBA 2FTRA 3BB5A 1N5TA 2GA7A 3IWLA 4HH1A 1Q4RA 2ZDOA 4Y2MA 3TOQA 3TRGA 1TUVA 2FB0A 5F0WA 1IUJA 1CC7A 1SB6A 3QGPA 5B09A 2AJ0A 2GFFA 2RSQA 5B08A 2OAUA 1KVIA 4DPOA 1K0VA 1TL4A 1FE4A 5B0DA 2K7JA 2OMOA 2KT2A 1CPZA 1TL5A 1FESA 2ZDPA 2Q3PA 2HQIA 2QIFA 3HHLD 2N7YA 4OJHA 4Y2KA 4YEAA 5B0FA 3VTIA 4OJ1A 1X8DA 4ZOSA 2GCFA 3KKFA 2OKQA 2W4PA 2ASYA 2FIUA 1YJUA 2XMVA 3BDEA 2PGCA 2XMWA 2K2PA 1YJVA 3LGMA 3MZIA 4OJGA 4A47A 2QYCA 3MCSA 2BUNA 1N5SA 2KT3A 2QLWA 2BJDA 3K7RA 1FD8A 1X0PA 5T7LB 4A46A 4DL0C 5B0BA 1TZ0A 4Y2IA 2ROEA 4HI2A 4HH0A 5B0AA 4A48A 1KVJA 2ROGA 1WD6A 1S6OA 1LQ9A 1S6UA 1FVSA 2N4CA 5B0CA 1Q8LA 2XMJA 2BYCA 1APSA 1URRA 1JK9B 2N4DA 2LXFA 1AFJA 1XBWA 3HHLB 5IXUA 1Y3KA 1YJTA 3BM7A 3FMBA 4Q2MA 1SQEA 3BF4A 3CJKA 1RJJA 1VQSA 2OD4A 2LQ9A 2KYZA 5T7LA 1N5QA 5A6WA 3I9ZA 4NL5A 2JDJA
chains in the Genus database with same CATH superfamily
2AWZA 2OUGA 1T95A 3K2YA 2JEFA 5HLFB 3KK3A 2C22A 4I64A 1NDCA 3W2VB 2YKMA 2XSFA 4QYZJ 5HO4A 2J76E 1YG0A 1O8BA 2YX1A 2PFFB 3OFGA 1UTAA 3C15B 4OZ3A 4ES2A 1NK7A 1WEZA 2NSBA 3HMJG 1T9VA 1UL3A 2HEKA 3EUNA 2ZZMA 4USUA 1I6JA 4IR1A 4K4WA 1FRIA 2BXJA 3I6PA 3BQ2A 2ZITA 4QBUA 2BKPA 4I6AA 2RQ4A 4NWBA 2AHOB 1N88A 4UOHA 1DQ8A 5BYSA 4NA1A 4IYQA 3NG8A 1YZ7A 1S1WB 1U8SA 2AV5A 1WDDA 4GMKA 1J5EJ 5CYQB 2DHHA 3HHNB 1PJ6A 4DPYA 1RDRA 1RE1B 2RRAA 3FBCA 3NGRA 4GVBA 2V0NA 1NJXA 5ETRA 4DR1F 4KR0B 3C8YA 4PUOB 1SC1B 3FNNA 4UQGA 2D3UA 3BQ1A 1YBUA 1MW7A 3KLIA 4C2MA 2VHGA 3BBCA 2V2QA 1XERA 3S1TA 4NI2A 3MUMP 1WHWA 4ECQA 5E2QA 2RRBA 1WHVA 4OYMA 1WF0A 1KBRA 2BM1A 4DSFA 2ACMA 3U1MA 1XMOJ 2KM8B 5EWGA 4K59A 4Y2KA 1NCLA 3BDEA 3LP2A 4DV0J 3CD7A 2NXJA 3U02A 1DY3A 5IC6B 1HBMA 1HNXJ 4WBFA 2QN6B 2XHWA 1OS5A 3TEHB 4LBPA 4WIIA 5DS7A 4KT0C 1RWUA 4QJVA 1HNZJ 3DC2A 1YSJA 2D3ZA 2VODA 4F7VA 4GO5X 4ZLPA 2HLUA 3M9MB 3CIMA 3HHKA 1KNZA 3R2DJ 5KFTA 4OYIA 2NXNA 2E5JA 1HQ2A 2XBPA 1SL1A 2JHEA 3CJ0A 3M2UA 3UDCA 2MB0B 4USKA 2OO4A 9ATCB 4OX7A 1KHVA 1H6KX 4EBDA 4K0KJ 1RKIA 4NOHA 3QSYB 4HH1A 3MOJB 1UW9A 2W2NP 3F73A 1X4CA 3IG1A 1RT4B 4DCJB 1WOPA 1ZM3A 2KFNA 1XR5A 1EKRA 1X8DA 3JSRA 4DI6A 4I0WA 1D9DA 5B0BA 3PVXA 4RNNA 4MK7A 3CO9A 1OYDA 3IRXB 2XMJA 3MOZA 3MFHA 2XQCA 3FUYA 4ANCA 2DNOA 2RVJA 3GIIA 2HQCA 3TAQA 5ETQA 2B9YA 2KU7A 4DSJA 4LFCJ 3CDAA 7FDRA 2IAJA 3BGRA 4XAKA 3MD3A 4RR5A 3MM8B 2NSCA 4O4RA 3CC2S 3H4DA 1NJWA 3THTA 1U6FA 5HVGA 1N5YA 3PW0A 3CDWA 3PACA 4OHVA 3DYAB 5KG1A 2CPZA 3BSAA 4OZ5A 1HHQA 4AE5A 3CCLS 4UOFA 4FPRA 1AUSL 1Q8IA 4LR8A 4ECZA 5FD1A 4L3KA 1CQMA 4O3QA 1XR7A 1WC4A 2BM0A 3S6EA 2VBWA 2WVEA 3SCLE 2XLIA 3RAQA 3P5TL 1RT1B 2GA7A 3OVSA 2VOPA 4A8OA 2GX8A 3FFIA 2I1RA 1NSKL 2CNNB 2CQ4A 6AT1B 2MHNA 2BKOA 1UVMA 2QC3A 4ZJQA 3SYZA 1Q81T 3DN9A 4MK9A 1ZH5A 2WSEC 3UDEA 2IMWP 4O44A 1UWAA 5J1EA 3TEGA 3T9ZA 3DRRB 2X1BA 1SIZA 4J9QA 1SC3B 4DV6J 2C3UA 1JLAB 1WKJA 4XO0A 4LF4F 3N6MA 4P72A 1SUQA 1U1KA 1VQSA 2UP1A 2M4MA 4MKYA 3QAUA 4OZ0A 4Y65A 2CQ1A 2GV1A 2QFIA 4ANDA 3H4BA 3B78A 1RT7A 3M1VB 4WYWA 4KO0B 2HS4A 2WVCA 4GC6A 3IWNC 3FSIA 1L5UA 2YVSA 3GSIA 1FRXA 1U4BA 1XMQF 5HLFA 2HFUA 1B0VA 4ZVFA 2O3DA 2X51A 1D09B 4L74A 1O5JA 2VFRA 1F9FA 2CQPA 1U26A 1KTVA 2YKQA 2F4VJ 1K1QA 5KFCA 3EVWA 4C3LA 9RUBA 1RAJA 3LTOA 1KQFB 2E9ZA 2NUUG 2DGOA 1YIJS 5FIIA 2W25A 1FKOB 4X4PA 2VC0A 3Q8PB 1Q5VA 3G8QA 1IR2A 2VFVA 3D6TB 1NSAA 5L9XA 2QLBB 5LSRA 4DV7F 3TR5A 4DSIA 1IBMF 2R42A 1REVB 1Q79A 3QZ8A 1TKTB 1FNXH 1S1WA 4C8OA 3OFEA 4BWMA 4Q2LA 5GAEI 2C2MB 2CQCA 5HSPA 5CYQA 4X65J 2QA4G 3MCOA 2AJFE 4C8KA 1P9YA 4CYUB 2FVCA 3UD5A 4UW2A 5F8LA 4AL7A 2CNKB 1OO0B 2XY5A 3HSDA 4TVAB 5CD4H 2DTJA 4PUOA 4WK3A 1H98A 3TX8A 2YH1A 4DR3J 5D4PA 5KFNA 3HFZB 1WG5A 5DM7Q 4YOEA 2LQ5A 4OZJA 3FJ2A 4L3NA 3C14B 3DDIA 2DNQA 3RRGA 2ROEA 4LR7A 3KUHA 2M52A 4ECVA 1VK8A 1TMMA 4RNFA 3BS9A 1XN9A 2R7UA 2OD4A 2ZH3A 4NCAA 1KLMA 5HJYA 1LW0B 4X4OA 4DL7A 2KZMA 4IUFA 1P1LA 4RLEA 1OSDA 4KFBB 1KS2A 1EJ7L 4EFAC 3CD6S 2UU9J 3CTRA 3ZFVA 3D0GE 2GHVC 4IKAA 3TVKA 2IDLA 4B9UA 1VCTA 4ZP6A 1O6XA 5EX3A 3H0PA 3D3CJ 3H5SA 2OP5A 5A8WA 2VPYB 2Q6CA 4DL2A 2PMZD 3QSIA 3IWLA 3OJSA 1TKZA 2APOA 2VFUA 5M2RA 3OR2A 1OPIA 2KG0A 2ADCA 4KHPJ 3M6UA 3NS5A 4HEA9 1SC4B 4ILRA 3B54A 4K2JA 3LP1B 2K2PA 2LEBA 3MECA 1KHWA 4MJKA 2NYIA 1S6OA 3E3XA 2H4WB 1K0TA 4OI6A 3T5JA 1C0TA 1AFJA 1EAYC 3SSRA 1NB7A 3W64A 1WOSA 4A8YA 1Q5YA 1M5OC 4XPEA 3OTBA 3KWMA 1KONA 3MM5B 2AQ4A 1T8EA 1HNVA 3T1AA 3DLGA 3ZZTA 3FGVA 4F67A 2VH7A 4DR6F 3PRDA 4JP8A 3VAFA 1Q8BA 4WZMA 4ILLA 1TV6A 2ZH1A 1ZZNA 2FGCA 4UTGA 1FXRA 1YJRA 4ZVSB 2BOPA 2IM2A 2AGPA 1EARA 3MM8A 3A3OB 4ZN1A 4EI2A 1YGYA 2A18A 2RF2A 3LP0B 3GV5B 2E7XA 2UUAJ 3TP2A 1CJUB 4H4KC 2ZDOA 4O3OA 2E5IA 3GYXB 1TQLA 5LMUF 1IN0A 4RW6B 1N36J 4LF9F 2UXDF 2U1AA 1SKSA 3D0IE 4A47A 3R5BA 2H5IB 3K7RA 3EVMA 1LOUA 3GP9A 3HVTB 4K50A 4LF7J 4OX6A 2QE5A 2WHOA 1ZOTA 3J7Z5 2HKEA 4M5DB 4DPTA 1IKWA 3BDPA 2IYIA 2DGXA 1JLAA 4O3NA 4DN9A 1SJ4P 4CLFA 2V67A 1PKUA 5KT6A 1HI8A 2RDDA 2DT9A 2Y1LB 4A8KA 1RT3B 5A6PA 2R8HA 3NWGA 1NPPA 2GIRA 3M8PB 4KO0A 3CCMS 1TL7B 4TLRA 4GKKF 3C6UA 2CADA 2CXEA 1WACA 2KN4A 3PKYA 2LQBA 3MD1A 3NBPB 4OI2A 2EI5A 3GV7B 1FF2A 2P9GA 3P8BB 5LM7E 5H1SV 2HNDB 1EB0A 1SQFA 5JXSA 4ERDA 2LXIA 5IFMA 1JJHA 4CT8A 2BE9B 5HL7Q 3PEHA 1KVJA 5GMKa 3NOGA 2MZQA 1FVSA 5I42B 2JEJA 4GRSA 1YRUA 4DUZF 3AQOA 1XWLA 5KFBA 4K8RA 1FKOA 3MGJA 4OZ2A 3LPYA 3HHLC 2MQQA 2UVWA 5A0YB 4DFJA 3NXZA 4UT4A 1CC8A 3GJQB 2HWHA 3CJQA 2XULA 1IR0A 4JI7F 4M5JA 4ECRA 1FJ7A 4YS2A 4UUWA 2AJQA 4PWUA 2AMCB 1K44A 1ACMB 3RAXA 5CHCB 1R0AB 4N5SA 5GAHU 2HIYA 4A8SA 2HHTA 2GQQA 2CQHA 3QGIA 3AD8C 3MR2A 2MY7A 2ZUGA 3RR7A 3FVYA 3I96A 3FK4A 4PQAA 1RHUB 2CVIA 4ZMMA 4J9OA 3OFFA 2IY5B 3VAJA 3KMSA 3RB6A 2MLZA 2HVDA 1T7PA 4FBUA 3TUIC 2QFJA 4ZCKA 1HQEA 3A8EA 3L95X 2C2NA 2DGTA 2J7KA 2HQ3A 2YNIA 2IJFA 5GAHI 2MSSA 4ZVUB 5KFJA 5KFRA 1JJCB 3CCUS 3VAHA 1GTEA 3AHPA 5KFPA 4ED4A 5JVHQ 1LW0A 3PG9A 2CPJA 2JEIA 3H40A 4DX5A 5DG7A 4DL5A 2RILA 4E98A 2PDAA 3PDNA 4CZCA 3M8ZA 2YWKA 4AXJA 5DRKA 1RLDA 3DU5A 4CNZA 2CJKA 3EGWB 4F36A 3QT5A 3T19A 3PR5B 5FDLB 4WCEQ 1UMJA 1QE1A 3RW7A 4HT5A 2AEJA 3OL6A 2QLJB 5AXNA 3J7ZT 2AZ1A 4CM2A 3K5MA 2FVRA 4LF8J 4P73A 2VL1A 5DO2A 4P2MA 2DPIA 5DJBA 1VK3A 2OPPB 4DV4J 2N4CA 2QA2A 2ATCB 2CAJA 2MGZA 2NR0A 4L72B 5J1NA 2BMBA 1D0EA 4I7FB 3GWCA 2OEKA 4ANEA 4X64J 1R31A 1RHRB 1HBUB 5KFOA 2B7BB 2P9EA 2YPZA 5ETMA 4ECXA 1ELOA 4DUYJ 4URSA 2JH3A 2MJNA 3R27A 2FC9A 2SXLA 3PTWA 2JZ5A 2LQJA 1LXJA 3AH6A 4U6PA 3R2CJ 3T5HA 3OSPA 1XK8A 2KO1A 2IA0A 2VFSA 1BUXA 3TZWA 2L9WA 3FBEA 2XS7A 1FJGJ 4DL6A 2K3IA 2EC0A 3LP0A 4P74A 1FESA 2NLWA 3HHLD 5B0DA 2ZE2A 1JLEB 3FEXB 5IT0A 1K73T 1H7WA 1CJUA 4MYTA 1Q86T 2MZRA 3L09A 2M8DB 1RYSA 3CNQP 4F0KA 2UXBJ 2LEPA 3QZ7A 3EPIA 5IQQA 3POTA 4RW6A 2DGUA 2DKOB 3P3DA 2Y1IA 2ZM6F 3B8HA 2DB1A 2CA9A 3CD5A 3TUZC 4JI8J 4WKRA 4LIRA 4DV3F 1DRZA 3QT7A 1VIXA 4YB5A 3HVTA 1HMVB 4WP9A 4ELUA 5KFQA 1ZA2B 3W9JA 1DTTB 4I6WA 4M5DA 1YX2A 3I0RB 3J80U 4DQPA 4ZA1A 4CNYA 1AT1B 1RA7A 2E44A 1LWFB 2WCXA 3VR1A 2HIQA 4C9DA 1VQNS 1ZM4A 2XMUA 3OXFA 1K47A 1VRTB 1S79A 1H0HB 2O5DA 2JL9A 5KT3A 3DXBA 4CCHA 1SXLA 2ZJRQ 1AXQA 1FWPA 1RT3A 1N5TA 3M6VA 3DRPA 4OMFG 5HQMA 5IM0B 1RLCL 2C2ZB 2FLPA 4MYUA 2U2FA 2VDIA 4DPOA 3ISZA 1TL7A 3CWJA 3G6XA 4FXVA 2QA4S 1QAXA 5H9EJ 5E33A 5KFKA 3P6YC 2BE7D 4OJGA 4C6AA 4ZJOA 2XTJP 5KT4A 3BKTA 2IM3A 1B0TA 3BKUA 3I5AA 2MDAA 2H1YA 2HPUA 1TKXA 3M8RA 4JYAF 1Q8KA 1R7IA 2FJAB 2D3OR 1RI7A 4KHMA 3H25A 2KVQE 1HQUB 4IOAQ 3VHQA 2XZTB 5LXYA 3GIRA 5IWAJ 5I42A 4ECTA 2CQBA 1VQKS 3MEGB 4RWXA 1SV5A 2W2PP 3IFEA 4C3MA 4B3MF 2CQDA 3RG6A 3HULA 1P8GA 3ZNUA 1SL0A 4I69A 4YDXA 1KDNA 1B0PA 3PX0A 2NYHA 3W1YC 3HZGA 3QYYA 3KUEA 2ROPA 2I8EA 3CUNA 5DGAA 3QQCD 3RYLA 2V2VA 4HTJA 1VQLS 4JI1F 5DLFA 3WHIA 3MFIA 1R0AA 4W98A 2DEIA 2QG9B 3UFCX 4PEOA 3N9UC 1GMUA 3DOLB 1EP4B 1WTBA 3NMRA 3RAMA 1S77D 4YR2A 2CPHA 1GMWD 2AX0A 2FPHX 1T9WA 2FQQB 3MTJA 3PRVA 3I9ZA 1K8AT 3BYRA 4LJMA 3Q8SB 3QMQA 1FO1A 3HKWA 4NYOA 2DHAA 4OYZA 1FKPB 4B3TJ 4ECUA 3M2RA 1WC3A 3HD1A 2LFVA 3CCQS 4JV5F 2FY1A 4A4JA 2IRXA 5F3ZA 2ZBCA 3AJ1A 4M5GA 5LSOA 3D9BA 5CQGA 3M8SA 5D0EA 4DX8H 1IKYA 3A8KA 3CJRA 1X9WA 4C97A 5IS2A 4ECYA 4IG0B 3LANA 1NJZA 4WWSA 1RT2A 2AJ4A 1S72S 4I4BA 3VQSA 3U1LA 1GMVA 1HNIA 1TMJA 4DWIA 1WEYA 8RUCA 2WK4A 3MZIA 4PQUB 2ZHBA 5F3TA 1VR6A 1AYEA 4LSZB 4YB1P 3MR6A 5FDLA 5C42B 4DQSA 1QAYA 2FVQA 4FDFA 1IJFB 5KG0A 2IA6A 1XBWA 1TAQA 1OJ4A 1UA0A 4EYIB 1IWGA 2G1HA 2FGOA 5FLXY 1OSCA 3TQEA 2H3EB 3KLFB 2BJ8A 1RTDB 3H2LA 1ZM2A 4I7FA 2YXLA 2BQRA 2Y0BB 2XWYA 3CW2C 3X1LB 3A13A 3W60A 1HBUA 2ZWOA 1H7XA 2PEBA 2RHQB 3RB4A 2GQ2A 1EIYB 3T5LA 2EFVA 5IZHA 2RNEA 5JMNA 3MEDA 4K4TA 2L08A 2RD5C 3QGPA 4JOUA 2CWKA 2B5JB 1U1OA 4DR1J 3ZO7A 2MQPA 3G71S 1SJRA 4OI3A 3TUPA 5DG8A 2B3TB 4LSNB 4IH6A 2GVZB 1XIQA 2HBQB 3DOKA 4YDDB 3SBMA 4OHYA 3CVKA 2B4PA 4ZVEA 3I55S 1JLEA 4OLOA 2OPSB 1NNDA 2ERRA 3I5CA 4RW9B 4F2SA 2X1GA 5EUHA 3ADAC 1WG1A 2VG5B 5K8OA 4IOBA 3AODA 1WF2A 1ULRA 4ED0A 4HL9A 4LUBA 1VISA 5ETPA 1KFSA 1VBXA 2VZ9A 1WC6A 2E5GA 4LRDA 3Q83A 3GV8B 2YH0A 4NLUA 1HI0P 3QWPA 4TYAA 1Y7PA 4UOGA 2DXEA 4C3KA 4PG7A 5K9FA 4V19X 5GAGU 1TUWA 3K5PA 2VPWB 3I0RA 2F1FA 3TYTA 5E3PA 3VAGA 4HKQA 2JLGA 4XK8C 3UNYA 2XZWA 2B43A 5D0HA 1VRTA 4P10A 4OJHA 3A3NB 4KV8B 2X1FA 3G9CA 1YJVA 5ETTA 1UA1A 4DV5F 4Y2IA 2Y8YA 2EFOA 4WTYA 1PIEA 1FRHA 2BJ9A 1UEKA 3HPOA 4OX9J 1A7GE 2HK2A 2NPIA 2HAIA 5GAGI 2ZOGA 2HHWA 5I3PA 4M5MA 1SIWB 3CCWA 1R0CB 4G6VB 2K1RB 3D3BJ 2DXFA 2CVEA 4O0NA 3C6TB 5FLXU 3MMBA 3SDEB 4PXEA 3GB0A 4ATNA 5E41A 4WU2A 2FHJA 4B9SA 4FF2A 1Y0HA 2IYGA 3MEGA 2XMMA 4CQ1A 1TR0A 5E3CA 2FZKB 2OHDA 4NXMF 3TQ1A 3I82A 5CCMA 3QJJA 2BDPA 4PRFA 2ZBQA 4N76A 5IT4A 1WC0A 4C0OC 1S1VB 4A8FA 1CJVA 1RADB 2YWHA 4UUXA 4DQIA 1C1CA 3UCGA 1N0VC 3CC7S 3KXDA 4TYBA 3AOCA 5LJ3Y 2DGVA 2N4DA 2XY7A 2OMLA 5KFYA 5E3AA 4MT1A 4Q8EA 2RKIB 1V3SA 4OX8A 3AD7C 4IO9Q 3QFWA 4WPAA 2VV5A 4QWBA 3DOLA 5AJ3F 4KHRA 3UN5A 1KFDA 2RS8A 3DOMB 4QW8A 4IFYB 2QV6A 4KKOB 1YTYA 1KKHA 2IJNA 2IHR1 3TVZA 2C2EA 3EGVA 3CJ8A 1LW2A 4LF4J 1S99A 3Q2SC 4LR9A 4USTA 2H65B 4HTIA 2ILZA 5IT9Y 1Q78A 4WFZA 1FKPA 2KL8A 4MFBA 4QU6A 5F41A 3CJ3A 4UF4A 1GK8A 2AZ3A 2PMHA 4B9MA 4F4AA 3ET6B 1NDPA 4X4UA 2W2OP 3KK2B 1AUDA 3QRQA 3P5BP 1CLFA 3L7UA 1PJ7A 1XMQJ 2HHHF 2BV3A 4DCOB 2KT3A 3PRBA 2W9CB 1FD8A 3KLVA 4IG0A 4GVLA 2A2CA 3DI6B 3LWMA 2J9DE 4YN3B 3R5DA 1VQ6S 5F8HA 3EM1A 1PGZA 1PILA 4BS2A 2G2ZA 5C42A 4NCGB 2NUHA 5KOWA 1I94F 1KRPA 3U7JA 4ZVQB 3QIPB 3IS9A 2RDJA 4P6QA 2YQ1A 3PYGA 3KNAA 2M88A 2ZJQQ 3FQKA 1SKUB 2ZWPA 1MWYA 3SI8A 2QLXA 3DM2A 3P96A 3Q8YA 1PAUB 1C0UB 4DV7J 4DMZA 2MKHA 4I1TA 3EGNA 1IBMJ 1S6QB 3RB0A 5ITHA 2DYAA 1RBAA 1T03A 2JLEA 4MAKA 5KT2A 1KTQA 4NLXA 3LGHA 4OV1A 3RW6A 2BRKA 5AXKA 3IBFB 4QIWD 3D66A 5DZ7A 4J9SA 1RACB 1KVKA 4MKAA 3PW5A 2V8DA 5C24B 2C2DA 1JLCB 4PG8A 1X7VA 2HFZA 2G13A 4J9PA 4FYWB 3ZTPA 4G1QB 4OJ3A 4N41A 2OPSA 2FVPA 5G4DA 1S7HA 4FVCA 4RW9A 2HVHA 1JLBA 1SBRA 1X4HA 1Y9OA 1XQIA 2VG5A 3C16B 4MKBA 2J7WA 1YRTA 1G3OA 2R2RA 2J8AA 5AXLA 5D6GA 3MXHP 2O67A 1CJKA 4M95A 4RUCA 2VA2A 3GG0A 1SQGA 2E29A 4B3RF 1RTHB 2IC3A 2X7IA 5C2GA 2W9AA 3K5OA 1QSSA 2HZVA 1IQZA 4PXCA 1FTRA 4K4VA 3H5XA 4JI4F 4J9MA 2ZH2A 1OYEA 4KIAA 3V6DA 1RWOB 1RUSA 3SQOP 2VPXB 4WU3A 4A48A 3PW2A 2GJIA 3UI3A 1OMSA 3OXGA 1SQEA 5LXRA 3HO1A 4WTOB 4RU2A 2E5LF 2J9EA 2BKNA 4NL5A 2BW7A 4HI1A 3OL9A 2R7XA 2E1MC 2W2MP 4ZP7A 4DBQA 4PR6A 1U48A 2DBBA 2BA9A 2R8IA 5HP1A 1RBOB 3ZZ0A 3OL7A 2JC1A 1MNEA 4HHJA 1DBDA 1NK6A 2K1RA 4LBIA 2L41A 1OQ6A 4LF5F 2KKHA 4PWWA 5ETVA 4RPFA 5E0OA 3SDEA 3MAQA 1B64A 3NP5A 1M90T 1RABB 3NGDA 2HW3A 4P75A 2FJVA 2IIHA 1AB8A 1VQ4S 3RRHA 3GFZA 4DR6J 4HYKA 2DNPA 2EFNA 4OJ1A 1J5OB 3KDOA 4IDKB 3MMJA 4CO1A 1TZ0A 5LJ5Y 5HROA 2DR7A 4JV1A 4X4VA 1O51A 1VQOS 1T0TV 3T6JA 2FYXA 1RA6A 2CPFA 4CT9A 1S1VA 2Q66A 5CYJA 1VBYA 2HBZB 2F4FA 2ALYB 3PO5A 1JXEA 3QRRA 5HVHA 5AE1A 5I3QA 3FEYB 2BANA 2VG6B 2KHDA 5LMUJ 3TANA 5C5JA 1M1HA 1NJYA 1BWVA 4LF9J 2D69A 2OPQB 4QOTA 2K06A 1H72C 2UXDJ 2LLZA 4OV6A 4JI5F 2RKIA 3GE9A 3ILLA 2J9CA 4F3QA 3HVWA 1MU2B 1VQ5S 4OZNA 2A6MA 1OWXA 3KK1B 2BX6A 3DOMA 2GJFA 3DMJB 2PEHA 3MR5A 4ICLA 4KKOA 4RW8B 1RISA 1VJQA 2OSRA 3M8QB 4NLWA 2GMHA 2HNYB 4I2QA 3Q0AA 3DLKA 1HYSB 5M2PA 4Y2AA 2EKYA 2OI2A 2CKWA 3J81Y 3D1QA 3KK3B 3MAAA 1S9EB 4PCQA 2Y3YA 4KGKA 4A8XA 3ET6A 3Q8RB 3KK2A 1VRUA 5LOQA 1NPRA 4GKKJ 4CWBA 2C2RA 4J9RA 2D7SA 2LXFA 3NMAA 5IXUA 4M5HA 3QAEA 3QATA 2W9CA 2RUSA 5EHHA 4YUDA 1T11A 3DI6A 3BR8A 4EZ6A 2VG7A 1FHTA 2A3JA 2ZH8A 4DFKA 5CAAA 2RAQA 1RHMB 2MQLA 4HACB 2KJVA 2PN6A 3EMTA 3FKBA 1BE4A 1OY9A 2VB6A 1MMNA 3HVRA 2C2KB 5KFHA 2CQ2A 4DUZJ 1GX5A 1SC6A 4YHHF 2Z4PA 2J6SA 4MMOA 3N01A 1EZZB 2V69A 1F3FA 1CVJA 2B4UA 1WKLA 1U02A 1M5SA 1UZDA 5AXMA 2P2CB 1TVRB 3US5A 3NS7B 4JI7J 3LGMA 1S6QA 2HNZA 5MAOA 4DF8A 2FZGB 5IC4B 4K2XA 2ZBRA 1S49A 3ISND 2BVZA 3RJMB 3M4XA 1UVIA 2HHXA 5HJXA 2XWXA 1WJ9A 4FF1A 2H54B 2JSXA 1QUPA 4U7UD 5DETA 2GHPA 5C24A 2QJ3A 1JLCA 4IH5A 1NO8A 1RAOA 1TUGB 2GW8A 3LP2B 3IM8A 3C19A 5LL6d 1YVFA 2DPJA 5LSLA 1RHKB 1XNRF 4LRBA 2OPRB 3MR7A 4E8UA 4G1QA 2I0XA 1PCAA 1RWNB 1NZ8A 1JLFB 1SI9A 2YWGA 5EX0A 2LU1A 1VRQC 5KFMA 4YR3A 2R7QA 2VONA 4X66F 3Q23A 1R8PA 4ZVOB 2WBMA 5B0FA 4RU9A 3J81U 2ASYA 5D8HB 4HT7A 1UWBA 3D68A 3I87A 1IQTA 4OFZA 2B0GA 3G8TA 2V8HA 3J7AN 2JOQA 1RU2A 1RAFB 3BO3A 3K8VA 1HFEL 2HMIB 1HNWF 4L75A 2W7PA 5J1PA 4K4XA 4MK8A 2XHCA 3G82B 1R6VA 1PJ5A 2YKOA 1TP7A 1NSPA 3IG1B 4EU0A 2H51B 2VPZB 3ZTOA 1VQ7S 1FA0A 2J5AA 3R7BB 3PEJA 1JWWA 1Z2ZA 4DS4A 3AJDA 1P1TA 1F5AA 1JLGB 4NRTA 4WFNQ 3M7VA 3C66A 2VBZA 4D3HA 2ZD1B 2E66A 3QBCA 1UZHA 3AD9C 4JI0F 3UR0A 4I56A 1Y5NB 3Q22A 1RK8A 5THWA 1RU1A 4XIUA 3M8WA 2FB0A 3VZIA 3ENQA 1VHFA 1F60B 5DM6Q 5EGYA 1HARA 2KT2A 4K5RA 5F8MA 3FC9A 2HBYB 4NLQA 3SCKE 1KQSR 4RKUC 3G86A 1A9NB 4HH0A 6FD1A 5KFXA 3W66A 1WD6A 1WSVA 3DHWC 4QIVA 1I1GA 2B6AB 3JQKA 1S0MA 1J5OA 1FERA 1ZAVA 4QCLA 1TFYA 4F4KA 5IV3A 4MIAA 1B7FA 1QAJA 3WIUA 2KYXA 4ED3A 4J7CA 5E5NA 1IKVA 1NHVA 4KRWA 3BN7A 2GVDA 4DOZA 5KG5A 4NLVA 2XZDB 4DEZA 3N6LA 1VHIA 1ZA1B 3B4MA 4CLWA 4O44B 2VG6A 2ZFHA 5J1EB 1P27B 1BWEA 2CJ9A 3OTEA 2I2YA 2OPQA 4OYXA 4DF4A 2ZM6J 1DQ9A 4DV3J 3GPAA 5F8GA 3ILOA 3HCXA 3TRGA 3KK1A 3N5BA 2EBGA 3PXGa 4O4GB 4RW8A 1V9OA 3UR3C 5EWEA 3R97A 4NASA 3M8QA 1TK5A 2HNYA 1HYSA 2C2OB 1NHUA 4TY9A 5KOXA 4LIWA 3T3FA 1FT8A 4KBIA 1NLKL 2ALZA 4EO8A 4DHVA 1S9EA 1LEOA 4A8QA 1WNEA 1Y3KA 3FMBA 1VLOA 1X31C 1SJ3P 4BLGA 3HSJA 3TWZA 4C7QA 3EICA 2KRRA 4ITSA 3R9LA 3MDFA 1NH7A 2E5HA 2OTLS 2G2YA 4USIA 2R7OA 5K14A 3EJMA 4JI3F 2JFKA 8ATCB 5E7OB 4L6V3 2FJWA 2V50A 3KHRA 4KGVB 1TFWA 5L46A 5DLGA 3CCJS 2BW2A 1FRMA 3R6GB 3Q8QB 4JYAJ 3KG0A 1T9UA 3GZ7A 4FPIA 3O3LA 2MKJA 4HACA 2EW9A 5D0GA 2GIQA 5ETLA 2EFGA 2BE2B 2GMJA 2OGUA 2E9RX 1BQNA 5CXTA 1Q7LB 1RWKB 2B9XA 2C3MA 1WORA 3MPVA 4B3MJ 2Y1JA 2R2TA 2EC2A 4GKJF 4C8MA 2G0CA 4DFPA 5KFIA 6FDRA 2FJEB 4LBHA 5B0CA 1TVRA 1MSWD 2F5GA 1R8BA 3Q89A 3BGFA 1ROFA 1NZAA 2HS3A 1T9YA 4JI1J 4CO0A 1IR1A 1U45A 4LF2A 4ER8A 5KT7A 4DR4F 2XNQA 4TQSA 1I5OB 5GMDA 4UOCA 2BRLA 1PC4A 3H2UB 1C2PA 3W8PA 3GFYA 1SH0A 1XJWB 5DDRC 4LQ9A 2XYGB 1SJ1A 4J9LA 4C8NA 2MKIA 3NAHA 3AT1B 1RYRA 1KLMB 4FP9A 1W2BR 4A8MP 1WUUA 2AYMA 3K58A 3CJ2A 2OPRA 2V9WA 3T41A 2AEMA 4MIBA 2QZ8A 4KGXB 1JLFA 4JV5J 1U8WA 1W25A 2BUNA 4QPTA 2QLWA 3QGHA 1U0SA 2ROGA 4RUHA 1QTNB 2A10A 3H98A 2CG4A 4ZKAA 3DDKA 4CRJA 4IQXA 2YNFB 5A8WB 4WYLA 3IR5B 3A4TA 2VKRA 2BEFA 2E7VA 2DNZA 1FRKA 5K5MA 2OTJS 1TKZB 2GZOA 3OR2B 2GGPB 4WFAQ 2VC1A 2HMIA 2MSTA 2GS8A 3GU0A 3V6JA 4EMDA 5KG4A 3R7SB 2YBVA 4OX9F 3G82A 1FDNA 4S0MA 3DGPB 1ZS6A 1S0OA 3MECB 1YQHA 4DSKA 2MTLA 3MMCB 1JXVA 3BO2A 1L3VA 2UUCF 1BD6A 3NGKA 4O23A 1C0TB 2CWXA 2BBEA 1RTZA 3PHEA 2XCPA 2PO4A 3TAPA 2NPFA 4AT1B 1O0PA 1NMEB 3MM7B 2KJWA 1Q4RA 1JLGA 2ADBA 1XNQF 2EXUA 2ZD1A 1EQ0A 1HNVB 1TL5A 4DDFA 3DLGB 1YI2S 4LREA 3BQ0A 2Z2ZA 2CYYA 1FI4A 4FXWA 4OQJA 4ZPCA 1M1GA 1RP5A 1TV6B 3JAMU 5KFEA 1Q1KA 2GHWA 3HHEA 5D78A 3I5BA 4CLKA 4U7UK 3ZZZA 4DG1A 2R7VA 2RF2B 3HJFA 4BBYA 2KYZA 2OLWA 5D0RA 4LFBF 1FEHA 1S10A 1GXUA 3VGUA 1YKWA 4KH1B 4ZVRB 1S1TA 1Y00A 2B6AA 4YP3A 3HF5A 3PIOQ 4CLTA 1RAIB 4IQMA 1HKAA 3F0NA 3R6LB 2O1PA 2M0GB 3DLHA 2AYGA 1RBLA 4HVZA 3WZ0A 4UZCA 4M5LA 1C1BB 3LGNA 1BQXA 3IBWA 4MKVA 3RUBL 2DHGA 2XI3A 4Y28C 1QUVA 4TLQA 3K5LA 1IKWB 4Y2MA 4ZCIA 1NK8A 4OL8A 5T14A 3EXCX 4EUVA 1DQAA 3M30B 4WZQA 2XGQA 3R5GA 1YJUA 2DRDA 3LH2S 2XMAA 1S6PB 4YMEA 3GJTB 2VQFF 3KLHA 4TNOA 4O4GA 4CM0A 2R7SA 2COLA 3UNGC 1XC9A 2IVMA 4ZLNA 3C6UB 4PKDB 2D9PA 1RJJA 1WC5A 2MPUA 3I0SB 2AJ1A 5HBMA 3VGVA 3KJFB 5F8NA 4DV5J 1QAIA 1WTFA 2EWHA 2UVUA 4ES3A 2R8JA 2NXUA 3BYPA 1U7LA 3ZNJ1 1NUEA 1FE0A 3TVYA 3WBZA 1IBLF 3GILA 1B3TA 4BCAA 5EDWA 5C25A 2CQGA 2PA8D 1HHSA 5KFSA 2UVRA 5CA5A 1X4DA 1KEKA 5A8RA 5IV4A 2G0JA 1Y4ZB 3KOAA 1YWXA 3NRBA 1JNRB 4OIXA 1TU0B 2BE2A 4LRAA 3MCSA 4XTTA 4A46A 2AJ2A 4B3OB 3AQPA 1U1QA 3MPUB 2YX7A 2DR5A 1ZPVA 2V94A 3EZUA 1X4BA 4NXMJ 3PCOB 5HANA 1N52B 1VQ8S 3ZZOA 1N48A 3MPYA 2I38A 3MCMA 2H48B 4JI6F 5KFAA 3UPFA 4ECSA 2WVDA 3NY0A 4DQQA 2W4DA 5A2QU 1TK8A 1ITPA 4OZLA 4RW4A 4P2FA 2AP6A 2AYBA 4QIGA 4NZ0A 3BGUA 4IG3B 3BEGB 3AAWB 1PBAA 3LA0A 1JIHA 1Q95G 3E01B 3HSZA 5DDPC 2KVIA 3PM9A 1HQEB 1H2UX 1CULA 3HP6A 3G8SA 3CDEA 2YNIB 4ED1A 3GCWP 5AJ3J 3CB4A 4CI0B 1DHMA 5HVFA 2AJ0A 2A1BA 3OD2A 2FY8A 4LRFA 2W8LA 1KR4A 5CABA 2MY8A 3M32A 4YY3F 1NDLA 3TZZA 2QL5B 3NGUA 3MM9B 4DV2J 4AQYF 2MZTA 2GAGC 5C7PA 4O3PA 3CCES 4ZVPB 2DR6A 3NNAA 1QE1B 1S1UB 2YNFA 5K8PA 4KE5A 3VGSA 3GCXP 5LMNF 4OZ1A 2HHHJ 3KNGA 3RZAA 3VF0B 1JJ2R 2XMKA 4Q43A 2GGPA 1IJEB 1M5HA 1L3KA 3KHHA 3L7OA 1TKDA 2MGZB 4DV1F 1X5TA 4PPDA 3DGPA 1NSQA 4F4YA 1I94J 3S01A 4ZHRA 3RBXA 3MMCA 3CPWR 4H4MA 4BWJA 5B09A 4I67A 4AFFA 4Q0BA 2QMXA 4ZPBA 2G4BA 3ITHB 1QD1A 4QIEA 3MM7A 1RT6A 3CDBA 2PI5A 4E0DA 2RQMA 4PWDB 4WJBA 4V1Ak 2KB2A 1Z2LA 4NA2A 3IA0A 1JK9B 4URGA 2FHJD 3TJ9A 2B8QA 2V4RA 4ZVTB 3CMQA 3CJKA 3D67A 2OH2A 4N77A 3CJ5A 2DY9A 2WONB 1JNZB 1OPZA 5DGBA 1N54B 3UW1A 1VQYA 2ZE2B 2PT0A 5CH7B 3KFWX 1IM6A 3V4MA 4KY3A 2QRRA 2WB1D 4Q8FA 3KLGB 2ASDA 2RT3A 3POTB 1TAUA 3ENWA 4LF6F 1QVFR 3GR1A 4HHHA 4WK1A 2WSCC 1DJ0A 5JVGQ 5F0WA 1VQPS 1X5SA 2X1AA 2VBYA 3K0JA 3D6MB 1A6LA 2C3YA 1RTJA 1YJ7A 3ILIA 3UQSA 2AGQA 1GMWA 2M8HA 1C1BA 2D3O1 4ZPAA 3QJLA 1MROA 4H4OB 2QYCA 3LF0A 8AT1B 1LWCB 3RGIA 3A3PB 3O8WA 4X62F 4F3MA 1N56A 5KFFA 3V2UC 1R27B 3M30A 4DXLA 3AXKA 4CO5A 4B3RJ 1V3RA 2LEAA 5MLCV 1S6PA 4G3IA 3SIPB 4Z7YA 2HG4A 3DRPB 4OHWA 2LQ8A 3N5FA 4DU8A 5H9FK 4JI4J 2D1CA 4EK2A 5I3UB 4F0MA 2W4CA 3MF5A 3HDSA 4M1KA 2ZVIA 1U1PA 3I0SA 4KSEB 4FYDA 4M63A 1KN6A 5RUBA 3FCVA 4QWEA 1NDKA 3FQLA 1ZTTA 3V6KA 1U49A 4EWTA 2YNHB 3HJVA 1TKXB 2E5LJ 1C4CA 3DRXA 1MLAA 3DLJA 2G1DA 1KQGB 4CIOA 1S4EA 3W62A 4PAAA 2IVFB 2F8EX 3LUYA 5D4OA 2NXCA 2FIUA 1SV5B 5ETKA 3E2EA 1AA1B 2VUGA 2QTWA 4F3OA 3BGLA 4FYVB 3LPEA 3CD0A 3MPWA 4ENOA 1RB0A 1RZMA 1VLYA 1AZSA 5D77A 3K17A 1CS4A 3NCPA 4LF5J 3GQCA 1HPZA 1V5VA 1YJTA 1U1NA 3W5YA 4KAIA 3CXCR 4B3OA 5CZVA 4CLYA 1X4AA 1MN7A 3KJQB 2VQEF 1U6ZA 3WIVA 3IR6B 3OT9A 2L48A 3MEKA 4O3SA 4JBCA 1DURA 2VU5A 1X9MA 2A6OA 4FF4A 2IM0A 4ZCMA 3K59A 4K5SA 3NS6A 3N4WA 3Q8VA 1VQMS 4TQRA 2AT1B 3NCQA 4O3RA 1ZPWX 1J2VA 5DDOC 4IG3A 3BJYA 4AL5A 4DU7A 2ZHOA 4TU7A 1SKRA 2VBXA 3E01A 3NL0A 2VICA 4JI5J 4PG4A 4BHQA 2GAHC 3JQJA 3GIJA 4CH7A 3M2RB 2QEXS 2EK6A 3IAS9 4NX9A 2RQCA 2FJBB 5J2QB 2R9LA 4WP8A 5ETOA 2RH3A 1RT5B 5DQHA 3J80Y 3TW0A 3GONA 2BJ1A 2CNOB 1IKYB 3IBCB 4B08A 2H9ZA 4IO1A 1XEZA 4ZN3A 3W2WB 1LKZA 2QYGA 2HFNA 1WHXA 3MM9A 1RT2B 2X3DA 1T05B 1HNIB 3OHBA 1QVGR 3QT6A 1NJIT 2YPYA 1HBNA 2CPXA 4KGZB 3UCZP 2HHPA 2B4VA 1S1UA 2HVZA 1N34F 2OJ3A 1GFWB 2GIFA 2RS2A 3HHDA 3BV8A 1T02A 4MH8A 4I68A 5L8RC 3VGTA 2AYEA 3I31A 3QJPA 2GNKA 4I2PA 1VYAA 4AXIA 3D7SB 4P2SA 1BLUA 5BXIA 1F6TA 1OY8A 2BABA 4YEAA 2XMWA 3KDNA 3L9ZA 4PZVA 2VF3A 4W92B 2M70A 3TX0A 3IGVA 4YHHJ 2ZHAA 1LQ9A 3OW2R 2YY3A 2YTCA 1LFWA 4WXWA 2DRAA 3FRZA 1UCNA 3ITHA 1FCAA 3HLUA 3C46A 4R8UB 2HGNA 3MEDB 4PWDA 4NLYA 2YKNA 3HXMA 1WSRA 3CE8A 2VA3A 3HZEA 4PXDA 3R5CA 3MURP 2DH8A 1OY6A 2MLXA 2IFXA 2WONA 3DOKB 3FBFA 3PKMA 4ZIWA 1EHWA 2F7VA 1FD2A 1UJ6A 4NA3A 3KLGA 3KLEB 1JKHB 2HVEA 4AL6A 3L7PA 1K0VA 2FJDB 1S76D 2XMVA 2EPIA 3FEZA 2YX4A 5HN0A 1XNRJ 2DD8S 2JLFA 4G65A 3VV2B 3UDVA 2D41A 3BH7B 4H4OA 2QLFB 1RCOB 3W63A 4YFUA 1LWCA 1U25A 2DNRA 2P6SA 1E6YB 4YR0A 1R8HA 4X66J 1BMQB 3WX8A 3I4HX 1DZ5A 3B6BA 5F8JA 1FVQA 3KTQA 2B9WA 2HGMA 1TL1A 4NZ7A 3AB2B 3PZPA 2JRSA 3QGGA 2CJXB 3CCZA 3GFHA 5I3UA 1HNWJ 1W2IA 1YK9A 1DLOA 3DNCA 2HS0A 4PXBA 4ED6A 4OYAA 4GC7A 2MZJA 4JI2F 4J37A 2LA4A 3ZZPA 1ZYQA 2ZH4A 1FFGB 3GYGA 3JB9k 1HBOA 4DZ6A 4TXSA 2DGSA 2YNHA 1RCXB 2XSJB 1IKXA 1Y10A 2QIFA 2ZJPQ 3ZTSA 5EWFA 2C28A 1UVKA 4LSLA 2HZAA 2Q79A 1N5SA 3MMBB 4DJBA 3L4BC 4LF1A 4UQTA 2ZKUA 4DR5F 4JI0J 4K4ZA 3S8SA 5L1LA 3LOUA 3ZXWA 1U2RA 5A6WA 3NKYA 4L76A 2R8KA 3K89A 4Q44A 2PD1A 2FDNA 5K8MA 5JJBA 2XGPA 1QM9A 2MZ1A 2NCKL 2POKA 1RAEB 1U1MA 5KG6A 4EBCA 1HWUA 3W9HA 5FJ4A 1R0BG 3SQGA 4KTQA 1CJVB 4PG5A 3OQ2A 1F9EB 1C1CB 3FCWA 1MMLA 1U24A 2L9NA 3BBBA 3G87A 4OI4A 4K4UA 3D4JA 1SCJB 1LFPA 3JTPA 4Y3CA 2P6TA 3NEKA 1WI8A 3F56A 3PY8A 4CLLA 3LAMA 4PYDA 1IUJA 1QDUB 2IMOA 1TL4A 3DDNA 3K5NA 3O2IA 2HWTA 2KG1A 4HDHA 3OXLA 2PGCA 4KPCA 2FLNA 2QL9B 4DL0C 4WXOA 3KHGA 2DY1A 4WIQA 5L9NA 1LW2B 3W5XA 1S6UA 3MR3A 3OV7A 2XCAA 1X4GA 3OBIA 3TJAA 4N8NA 3MMAB 4MFBB 3VQTA 1M5PC 3FCHA 1S1XB 5J2QA 2RIJA 1UJ5A 4EO6A 4ZDNA 3KJVB 1S5ZA 1RT5A 3IO1A 4RW7A 1U2CA 4GO7X 4CP5A 2RUGA 1ZTWA 4QYZK 2O66A 4Z37A 3W2WA 2UUWA 4KYZA 2J6TA 3IWXA 3DRSA 1Q7YT 1G1XA 2UV8A 2WOMB 1T05A 4X2BA 1R43A 1Q16B 2DGWA 1S0NA 1UVLA 5AT1B 1WELA 2W24A 3TOQA 1WDTA 3CEDA 4DLEA 3MTKA 4JI3J 3W2VA 3IS9B 3OTOF 1N4LA 3P4UB 1FFSB 3KKFA 1F2HA 4X4QA 4B17A 3GLJA 2YQ3A 4RL1A 3DM2B 3MAHA 3R8YA 5IOLA 2XYHB 2XB2D 2LA6A 3C15A 4FKYA 1WHYA 2KI2A 5ADZA 1U47A 3A1YG 5GAEU 3EZ5A 1ZZFA 1RWVB 2DNNA 2YQ0A 5M2UA 4NRUA 4DCPB 4NMLA 1T03B 4HHUA 2YWEA 2F8MA 1RXOB 5KG7A 3SEOA 4GKJJ 4R8UA 3FBBA 3N28A 4LT6A 3TNVA 3I56S 3CF5Q 5JUMA 2LDIA 3U1NA 2YKAA 1BQMB 3UDLA 3D54A 4M5KA 1GQEA 2YNGB 2CJBA 3G6ES 4DR4J 1WOOA 2JVRA 3UO0A 1LWXA 2XG8A 3M6WA 3ETMA 2VFTA 2E1PA 1S59A 4ED2A 3WQPA 1JLBB 4I6YA 4DPXA 3P45B 1UAWA 3KLEA 1JKHA 2DHXA 3I32A 1CG2A 3QIDA 4CO3A 3ENVA 3VWSA 1CJKB 3GFXA 2W7AA 2DXDA 5HATA 2K3KA 4F8RA 2XY6A 2HHQA 4RX6A 2IC3B 1LXNA 1KOHA 1VBKA 1YLXA 2P8IA 1WG4A 4NZ6A 2B51A 3CSKA 1CQNA 3V6DB 1D3WA 3PW7A 1E6YA 3MI7X 1YZ6A 3T5KA 2QGFB 1I51B 1T94A 1TL3B 2HYIB 1UEVA 2DCLA 4J9KA 3QFHA 2AGOA 4OHXA 1WC1A 4XDDA 5L38A 3TARA 2DCUB 1HR0F 2KRBA 4U8YA 4Y0FA 2ZVSA 1IXKA 2ZC4A 5HQLA 5HP1B 1NBEB 1IBKF 4LMZA 2UUCJ 2EEYA 1S12A 1CEZA 3X3UA 1GAOA 3TI0A 2XSJA 2MYFA 3IAM9 3RRKA 3RBEA 1RWXB 4DR7F 1XNQJ 4HR2A 2QL7B 1RT4A 4YB7A 1WKKA 1JLQB 1HHTP 4M94A 3DCAA 2RHSB 2XS2A 4TN2A 1U09A 2V63A 4ID5B 3D6HB 1YBAA 2ZH7A 5HROB 3KHLA 3IRXA 2XLJA 1M0SA 1VC6A 2N3OA 4ZITA 4F02A 4C8ZA 1SPBP 4LFBJ 2LXUA 1ZBTA 4LFAF 2BOAA 1G6BA 3CJTA 2LYVA 4F2RA 2BANB 4U96A 2LU2A 1B99A 4RJVA 1YJ9S 1FE4A 4F4XA 3BREA 3DU6A 2KFYA 2Q3PA 2N7YA 3DYAA 4ZCLA 4FKXA 1W26A 2WB4A 2V34A 2V68A 4HI2A 2GC8A 2XM3A 2V6AA 3NGSA 3O6QA 2AF6A 2V8VA 4ICLB 1RHJB 4NLPA 1MWQA 1VMBA 3M8YA 1N5QA 1RT1A 4I2QB 2CPYA 5DDQC 2HBRB 2JDJA 3DLKB 2G0IA 3ZC4A 3IGNA 1N5VA 5A76A 3OVBA 3N6NA 2CDRB 2DHSA 3EGZA 3MAAB 3MMAA 1BHNA 4DV2F 3LWLA 3OLBA 3KJNB 3GJRB 4TU8A 2VQFJ 1S1XA 4U67Q 1D8ZA 1XR6A 2XEXA 3KJVA 1MMDA 3DRRA 1VRUB 2J7UA 2Y1RI 4G1IA 2RQKA 1NKBA 3BSCA 2CG8A 4ES1A 2DO4A 2CZVC 2EBEA 3ELHA 2RSQA 5B08A 2EG1A 2VG7B 3M1VA 2WOMA 3W61A 2RU3A 1NM2A 2FLLA 4LQ3A 2MJUA 5KTQA 3H42A 1SJQA 1TTHB 2ZZNA 1H2VZ 3G4SS 3MUTP 1IBLJ 2DRBA 2M7SA 1F9HA 4Z2XA 1QJHA 1Q8LA 2HHUA 1WEXA 3AY0A 4FS2A 4QPXA 3OLAA 2LQ9A 2KDOA 4ECWA 3GJSB 4QZVB 5KG3A 3SV4A 4RBVA 3RB3A 1FWKA 4X4NA 1R8AA 3CC4S 3T1HF 4IOCQ 3UVJB 4ED7A 3OR1B 2HNZB 1FDAA 2ZNYA 1DTQB 2RDIA 1T9XA 1KD1T 4USVA 3M6XA 4Y2CA 3HFKA 1D8YA 4C11B 2HRTA 2MLYA 2PIIA 4Y00A 1R8CA 5HMXA 4JI6J 1REVA 1NK0A 1D9FA 2GFFA 5DQGA 3I4PA 4TKTA 1S9GB 1TKTA 4Y6IA 3FMWA 4ILMA 4ETXA 3HVAA 3FDSA 1N32F 1BQMA 1JMTA 4ZOSA 1VS3A 5J2PB 2YNGA 2X3GA 1VJWA 1U6BA 2BJDA 3SMZA 4TY8B 4DLGA 2ZOMA 4DR2F 1RWPB 4IFVB 1UVJA 4QU7A 2V2KA 4CYUA 3OHAA 2ATLA 3PJXA 1URNA 1PAEX 4CLSA 1FDBA 3LAKA 2QX0A 3WC2A 1HWLA 2W01A 2W1BA 1Z1ZA 3MEEB 3CGIA 1K9MT 1S48A 1LWEB 3O1LA 4DX7A 3W9IA 2IBKA 3SV3A 4AUKA 3HX9A 1VFJA 1L3TA 4YY3J 4OYOA 3C14A 3PR4A 1V3ZA 3UCUP 1UWBB 2QMUB 2XO7A 2ILYA 4EBEA 5KFWA 4AQYJ 1HWIA 3C3LA 4M8LA 3ZTRA 4WKYA 4UZBA 2OFGX 1U1RA 2VASA 1F1BB 2NS1B 2UUTA 4KFBA 2XNRA 1FXLA 1PG5B 1KVIA 1S97A 5LMNJ 3EDQB 4NCBA 4Q5VA 2CPIA 2ZDPA 4AYBD 2HQIA 1NK4A 3VAMA 1TL3A 2W4PA 3NNCA 4P7TA 1G4CA 1SH3A 3D6FB 1N8RT 1KOOA 3T6BA 3J7YU 1GEHA 1PBUA 4DV1J 2HSEB 1PYTA 2F63A 3CULA 3SSSA 2OSQA 4ELVA 2JEGA 2KH9A 5CD4A 2I9SA 3AA9A 3FZ2A 3SFGA 1X0FA 3A8JA 1X4EA 3LP1A 2B8PA 2Z0GA 3KG1A 4ZPWR 1RTIB 1JLQA 3CCSS 3J7YI 3BR9A 4DS5A 2Y9HA 2XO6A 2DIUA 1VC0A 2KFZA 1M5VC 2LP4A 4ID5A 4CO2A 1XMBA 4DL3A 1FX2A 2UUBF 3N79A 5F9NA 1YHQS 2CZ9A 3VAIA 4IRCA 3MM5A 3F41A 4JUZA 4WE1B 2DK2A 3FSXA 1IKVB 1EKSA 3LALA 2GVDB 4RO0A 1HW8A 4X4TA 4W90B 1FKAF 1F2GA 1M5KC 4KH0B 1HL6A 4QIFA 1QSLA 5B0AA 1SL2A 4LF6J 1CBKA 2V8GA 4HDGA 4U7CA 2IDEA 4EEYA 2I5JB 4MIWA 2EFPA 1UEUA 4ZK7M 2WRMA 5E3RA 3T1YF 3FZBA 3ONQA 2RMLA 2KTQA 1NPKA 1NHKL 1G7CB 4B3SF 5BR8F 1HLWA 4NXNF 2DH7A 4KPYA 2ZBIA 4X62J 1KLNA 2R7TA 3KMQA 4URQU 1NK5A 1UKUA 1ZAXA 1GX6A 2V5HG 4D3GA 4OYPA 2EG2A 2CPDA 3GTYX 2AD9A 3EWGA 4OI1A 3V6HA 3PO4A 4ZIVA 1MWZA 1N33F 2V2ZA 2VKZG 1F5CA 1R3NA 4NPOA 2BQUA 4OLPA 1X9SA 4Y34A 4ZVGA 2J9DA 2UXCF 3HI9A 2OAUA 2P9CA 2PA3A 2K7JA 1IWAA 5K14B 1VBZA 3GR0A 1L3UA 1UP1A 3FSYA 4NLRA 3M8PA 1GNKA 4C8YA 1F3VA 1D1UA 3HD2A 2BR0A 1S0VA 2DNGA 3NBPA 3CDUA 3PFOA 1JB0C 1BQNB 3MM6B 2CQ0A 4CLUA 4N47A 2HNDA 3BSNA 1VI7A 3FRYA 3TA2A 4LVNP 2IJRA 5D4NA 4KQZA 2HRYA 2M2BA 1RAAB 1VDHA 2DITA 3DRYA 5KAKA 4NLGA 4NLOA 2G9OA 4FYXB 1I3OB 1OIAA 3AOBA 3NGTA 1T3NA 2W7OA 1BXNA 1YJNS 3AFGA 4PYAA 3UVJA 3OR1A 3NCRA 1RQ0A 4TU9A 2CIMA 1DTQA 2VQEJ 1S4FA 5A0YA 1J5EF 4Q45A 4K7QA 2FD2A 4J91A 4C11A 4XDCA 3TJ8A 3VTIA 2GCFA 1FTCA 2N82B 5A8KB 2J0QD 4FF3A 1S9GA 1LK7A 3QNWB 4ZPTR 2Y8WA 1DAXA 2DNLA 2IVYA 2VOOA 3G2XA 3ICLA 4USWA 5J2PA 1M1KT 1KWMA 2WZ1A 2B56A 4TY8A 2Z30B 4FYYB 4IFVA 2ZH6A 1V6HA 4U9RA 2JX2A 3THPA 2OFHX 4QR2A 4CH1A 2HAFA 2VJUA 2BJEA 4NYZA 3G6VA 1E6VB 2F8HA 2DNYA 1LNQA 3QRPA 1XMOF 1QSYA 5HI7A 3MEEA 1LWEA 4DV0F 2PSZA 1R6YA 1S57A 4OYBA 2RU9A 2MQ8A 2DNMA 1CJTB 1HNXF 3JTOA 3DXSX 4P71A 1KSPA 5KFDA 5HK4A 2WSFC 3HFVA 1HNZF 2ZZTA 3D0HE 1FK9B 3THVA 4DL4A 2MKSA 2XYPB 4B9NA 3SFUA 2EVZA 2F3JA 4QWAA 1B7YB 1X60A 3ENAA 2DO0A 2Z56B 2DEJA 1H38A 4C98A 2DISA 1N34J 4ZJLA 1FNMA 3JTNA 3W7BA 1GT8A 3BM7A 1S9FA 1P9QC 2E1RA 5GVQA 2DJWA 1RWMB 2LVWA 3OPKA 4DPUA 2CJYB 1NB2A 3TA0A 4K0KF 4RZRA 3OSNA 1P6TA 3MPDA 3GYNA 4RBUA 3M9OB 2PMWA 2WVFA 3VVUA 3LQVA 2OPPA 3ZZRA 5IQ6A 5G0RB 1UPPA 4R5PB 1UFLA 4DG1B 4U8VA 4ED5A 2OIHA 5KFLA 2Z2MA 2XMTA 2YWFA 2J6UA 3G96A 2HZCA 3TA1A 3J7A1 1HW9A 2ZH9A 1RAGB 1RTIA 4LFCF 4ZP8A 1X5OA 3AXMA 3MCNA 4C0HA 1S1TB 3HM9A 4EYHB 4IRKA 4BC7A 2KHCA 2IM1A 2KXHA 4ED8A 3O44A 4QWDA 4U95A 1RHQB 2ZBPA 4WE1A 2LECA 2DH9A 5ETNA 3PW4A 5D3GB 2JNJA 4DFMA 2BZ2A 1JX4A 3W65A 3RBDA 1IVZA 1N0UA 4C4WA 1NKEA 2RRNA 3BGOP 3ZZUA 3UD3P 2MKKA 3GG1A 2BJ3A 2P5VA 1GTHA 3RU0A 1MG7A 4X4SA 2I5JA 4OI0A 4JV0A 1JQGA 5E3QA 4M5IA 2JJ4D 2ACYA 2CJAA 3OUYB 3KLHB 4IR9A 1QY7A 3S7RA 4H54A 1CPZA 2ZNZA 2CRLA 4DV6F 2FTRA 3TO8A 2Y0SD 5DG9A 1V5IB 4QR0A 2FLOA 5LT5A 2C42A 5HBMB 4F0HA 1HMVA 4XPCA 4F26A 4ZLJA 1DTTA 1H2TZ 4R0JA 5HMYA 1WWHA 5H9EK 2ABYA 5DQIA 5HQ8A 3NWRA 1LWFA 3CIZA 3R1HA 2DR8A 2A0FB 3JXOA 2M5YA 1Q0NA 5D4LA 4JI2J 2YWWA 2J8SA 5C25B 3V4IB 2FC8A 2R8GA 4FBTA 3IC1A 2VIHA 3D1HA 4FNHA 5IM0A 5A8RB 2RB7A 3UN3A 4KJIA 1RWWB 3D1OA 1PO6A 2HFSA 1UPMB 2F4VF 2JFDA 2HWIA 4ZLLA 1Y11A 2AIRB 2IRYA 1RSCA 3JSBA 4DR5J 5KFVA 3MM6A 1S7IA 4W4MA 2F40A 2I6WA 3JAMY 4USHA 1FEEA 4G1PA 1HWKA 2NZ4A 2LDYA 2AX1A 4CH0S 2FVSA 1HQUA 3IN5A 4L73A 1CC7A 3Q8UA 3JS9A 3J81j 2OMOA 2XI2A 2VJVA 4RW4B 3KYLA 2H5JB 3BH6B 4QWCA 3H5UA 2MKYA 4LVOP 1C4AA 4X65F 2WVBA 3NNHA 3GIMA 2J0XA 3BBFA 3HHLB 3SCIE 1CULB 2E1CA 2VDHA 3P49B 1MN9A 2QT7A 3HKZD 3D2WA 3CMES 5A8KA 1SJFA 5J2MB 4WFYA 2HLTA 4DR3F 3JQMA 4P7VA 4NEZA 4DX6A 4K4YA 2GO8A 1AW0A 2H5EA 2XC9A 1AROP 3E51A 4NE9C 1FWLA 3EZOA 3ULHA 4OYWA 4CO4A 3M32B 2K7KA 1UW4A 5B0GA 4B9TA 1EP4A 1IBCB 3R3TA 1E6VA 1RKJA 2WBRA 1DFDA 4ALZA 3M9NB 5F9LA 2CDQA 2V4JB 1TK0A 2WAQD 4USMA 3QPIA 1CJTA 3V5RA 3UN2A 1B70B 3GMGA 4RWWA 3MWBA 4EGLA 4KGMA 4JV2A 2UU9F 3W8GA 1FK9A 3AOAA 3K8WA 4PG6A 1N6QB 7AT1B 3PX6A 2C1EB 3EE3A 4Q2MA 2MEWA 3BF4A 3BZQA 2UZAA 3GSDA 3OJUA 1PSDA 3PNIA 4M5NA 4ZHRB 4DQRA 1ZAWA 3OTOJ 1YJWS 4H4MB 3IMQJ 4F04B 4JB8B 2HURA 3JSMB 1X5PA 4ZPDA 4Q0BB 2VD3A 3DKDA 4KHPF 4PQUA 4YQWA 3PHTA 2CJQA 1RT6B 2ZH5A 2Q43A 2DNHA 4RUAA 2W8KA 3L3CA 3CJKB 2OEJA 5U47A 2L3MA 4F4ZA 3HK2A 2KT5A 2WTFA 3SZ2A 3TUJC 4F50A 4K4SA 2QA1A 7FD1A 1SH2A 1UJ4A 4IRDA 5G0RA 3U27A 4R5PA 3R5JB 4Q7AA 3TAMB 4C48A 3KLFA 2M3DA 3B82A 4F25A 1RTDA 4FZVA 4DZDA 2MKCA 5CCLA 4B9LA 3BPSP 3SCJE 3M2VB 1PYSB 4WFBQ 2YKPA 3Q24A 1U0HB 5CZXA 3IM9A 5A2QY 3QWUA 5GMEA 4N56A 2M9KA 1VQ9S 3DHXA 1APSA 1FXDA 5HMWA 4P9SA 1U2FA 2FUG9 3RBZA 2HRUA 1FRJA 3R5AA 1J27A 2KM8C 2UUAF 4C8LA 2IPOB 2XS5A 1Q82T 5D3GA 2B5JA 1BGXT 1RTJB 3QO9B 4YB6A 1N36F 1MROB 4LSNA 3UD4P 2GVZA 3OVAA 4NEYA 2OELA 2NQPA 5K8NA 5CYMB 3DGVA 3OL8A 2L9DA 3EXYA 1ZETA 1A0OB 4KB7A 4LF7F 2WW4A 3BB5A 2Z57B 3PYEA 2LKZA 4UY85 2E7WA 1EETB 3OUYA 1TUVA 2RE1A 4DN0A 4OHZA 4H4KA 2R2SA 2QSFA 1HIYA 1YBTA 1FRLA 3CCVS 2Z2LA 1HA1A 4B02A 2XLKA 5AE2A 3HT0A 2FZCB 3CJ4A 5T7LB 2HVIA 2V8PA 5IT9U 2HK3A 3TZYA 3BKFA 2F9JA 3CMAS 1SVDA 3RR8A 1FFWB 1URRA 3NAIA 3BO4A 1NH8A 2F9DA 5BJRA 1XTZA 5H9FJ 4CTAB 3PFEA 1HR0J 2EK1A 2NREA 1UFWA 5BYRA 3V4IA 3D28A 4KV8A 4J9NA 1IBKJ 5KFGA 3CCTA 1UFKA 2B9EA 2HQDA 1NXIA 1YRXA 4CLPA 3VCDA 4F4WA 1D9AA 3V81B 4NLTA 1AZSB 1CS4B 1UETA 2EFQA 4KC5A 2WW8A 2H4YB 3ETOA 1HPZB 5SZTA 2BJ7A 4DR7J 3AA8A 3KUGA 1WI6A 3ZZYA 4P52A 3ISNC 2PI4A 3Q2TC 3DLEB 1LK5A 3EDRB 4DSEA 3A12A 3C6TA 3H8YA 3JYTB 1G2EA 5KFUA 3MHYA 2KXFA 4AD6A 2Q6BA 3EPGA 2MQMA 2K8GA 5T41A 1TELA 4P2XA 3H5YA 1ZM9A 2JVOA 4ETZA 2MXYA 4LFAJ 2E1AA 2GJ2A 2W9BB 2D74B 2ZUAA 4RNOA 2FHOB 3LO3A 1H3DA 3H2VE 4J5OA 2JC0A 3HHLA 2CUYA 1JXLA 3ILJA 4FNIA 4IH7A 3F44A 3DFEA 1GXTA 2ASLA 1L3SA 3VAKA 2NZCA 5SUHA 3PIPQ 1GXLA 4WP3A 2CQ3A 2R2UA 5J2MA 3R1LA 1PYOB 4RNMA 4HLBA 5J2NB 4CLZA 2C3OA 1K1SA 1RGVA 1VGYA 4IFYA 3UE2A 3QLHB 3M05A 2PC6A 4FS1A 4RUBA 4DPWA 2V4JA 3VALA 1FJEB 5I4MA 1HBNB 3SSQA 3O5TB 3OFHA 3EYZA 3NOCA 4NLSA 3EVOA 3C2PA 2YKMB 3AB4B 4WF9Q 4ZPVR 1EX8A 2GMLA 4QW9A 4QQBA 4I2PB 1N6QA 3DLBA 1WF1A 1VC5A 4DSLA 4LRCA 5C2CA 2MZSA 2R7RA 4RBTA 2AW0A 4PPZA 1FJCA 1DARA 2O01C 4A8WA 1NEEA 4C0BA 1AFIA 4UY8T 2DGQA 1JJ4A 1HI1A 5KT5A 1ICEB 2N3LA 3CJSA 4LF8F 3HSGA 3JSMA 4CDIA 3Q86A 3N0VA 4NYPA 2CPEA 2V4QA 4ZVHA 4DV4F 3H20A 4ID8A 2QSWA 4V19J 3K57A 4NCGA 2RJZA 4PABA 1SB6A 4N7TA 3QIPA 4USJC 2YKNB 5L39A 4X64F 1IM4A 3T1HJ 4J9UE 5ETSA 3AJ2A 2E9TA 2OKQA 2ZC3A 5DZ6A 2DR9A 4DUYF 2PFDA 1T9TA 2EKNA 2FHKA 2J0SD 3DLLQ 3TAMA 1C0UA 2R3VA 2HQFA 3LW5C 2W2QP 2FJXA 2UVVA 4NMXA 1BC6A 3UWTA 3IP0A 4GVBB 1Y5IB 1HWJA 3M2VA 4FN5A 3BSOA 1U0HA 3D5MA 2G2OA 4ZS6A 2OD6A 1W7WA 1LV5A 1N32J 3KLIB 2MQNA 1FJGF 4DR2J 4NI2B 1YDLA 2LMIA 3H90A 5B0EA 1FX4A 5L1KA 3MUVP 2B7CB 2MQOA 2UXBF 2BACA 3QO9A 2B4OA 2DNKA 2A2DA 2C3PA 1NAQA 4QYRA 2D9OA 2CQIA 2ZKTA 3SXLA 5GADU 4JI8F 2QO3A 3BN4A 5CYMA 1HBMB 4BC9A 2Z2YB 2F65A 3HT3A 1FNOA 1HD0A 5HMZA 2AU0A 2N7CA 1NRKA 3TZXA 3C16A 3W5ZA 1TL1B 1EETA 2ASJA 3I9V9 3OTCA 1NK9A 3PX4A 1R89A 2HFVA 1KP6A 2GO9A 2V9KA 4Z7CA 1DLOB 4WFXA 2MHEA 1RTHA 5T7LA 5L1IA 1PC5A 5L1JA 2J0WA 1CSJA 3H7HB 1KC8T 5GADI 3B4DA 1Y3JA 3WDOA 2ZEJA 1HBOB 3M2UB 2HGLA 2MMYA 1IKXB 1QLNA 4LSLB 3OTDA 4X84A 4CTAA 3ZTQA 1Z4UA 2Z58B 4R25A 2JWNA 3CT9A 2AKWB 1VIOA 2BQ3A 1BY9A 2HFOA 1Q53A 3VZHA 1OQ3A 5B7WA 5F0UA 1F0XA 1REGX 2LCWA 3BPDA 2HHVA 3V81A 2CFXA 2CZ4A 1B4SA 5IWAF 4FXDA 4ELTA 3A8IA 3SQGB 4J90A 4R0EA 1X0PA 4N8OA 1FDDA 2IAJB 3DLEA 2HHSA 3BGRB 3EX7B 1F5BA 2BYCA 1GH8A 3G6YA 2IRUA 1N5YB 4QR1A 2UUBJ 3JYTA 2HQGA 5HAOA 4RNHA 2QMWA 1RAHB 2NXEA 4NLDA 4DUTA 1VOMA 3PYDA 2DVIA 2KXNB 3VVTA 1H74A 5BYQA 2Q1LA 3IR7B 3PJ9A 3RTVA 1T3OA 3CCRS 2R7WA 2UV8G 4IDKA 2AEFA 2W9BA 3E8OA 1NKCA 3R7NB 2IBOA 3CO0P 3FFIB 3KG4A 4FVMA 5F8IA 1KQKA 2OEMA 3PJWA 5AE3A 3H59A 5D15A 2FHMA 5K20B 5KG2A 4O0IA 3QT8A 2PE8A 3T9NA 1NU4A 3T1YJ 3IRWP 5KFZA 2CNLB 1QTMA 2Z8QA 2KZZA 1HD1A 1X4FA 4X4RA 4B3SJ 5BR8J 4NXNJ 1Y5LB 3GIKA 2GQCA 4RW7B 3WC0A 4J9VA 5J2NA 1SUQB 1H73A 3WX4A 1MU2A 2R4FA 1EQMA 4ZP9A 4B3TF 1U1LA 4B9VA 1YITS 4BDPA 3DMJA 1N33J 3DRSB 3QLHA 5EN1A 3JSYA 4MTPA 3IXQA 1RT7B 2DIVA 1SKWA 4EZ9A 3NLCA 4E2FB 3PV8A 3W3SA 1UVNA 2UXCJ 3PYFA 2ZOFA
chains in the Genus database with same CATH topology
2AWZA 5K8OA 3MPYA 2I9SA 4IOBA 1T95A 2I38A 3K2YA 2JEFA 1WF2A 1ULRA 3AA9A 5HLFB 3KK3A 4JI6F 3FZ2A 5KFAA 3UPFA 3SFGA 2C22A 4I64A 3W2VB 4ECSA 4DQQA 4ED0A 2YKMA 2XSFA 4HL9A 1X0FA 1X4EA 4LUBA 2W4DA 1TK8A 1KFSA 3LP1A 4OZLA 4QYZJ 4RW4A 1VBXA 2AP6A 2AYBA 2VZ9A 4QIGA 5HO4A 4NZ0A 3BGUA 2J76E 2E5GA 3BEGB 4IG3B 2Z0GA 3KG1A 1YG0A 1O8BA 3AAWB 4ZPWR 1RTIB 2YX1A 3GV8B 2PFFB 1JLQA 1JIHA 3CCSS 2YH0A 4NLUA 3J7YI 1HI0P 3OFGA 3E01B 3BR9A 5DDPC 2KVIA 4DS5A 3PM9A 1HQEB 1H2UX 3QWPA 4TYAA 4ES2A 1NK7A 2DIUA 1VC0A 1Y7PA 3HP6A 3CDEA 3G8SA 1WEZA 4C3KA 4PG7A 5K9FA 1M5VC 2NSBA 4ID5A 4V19X 5GAGU 3K5PA 2KFZA 2VPWB 2YNIB 4CO2A 3HMJG 4ED1A 1XMBA 3I0RA 4DL3A 2F1FA 2UUBF 3N79A 3TYTA 5F9NA 5E3PA 1YHQS 3VAGA 3CB4A 1UL3A 4CI0B 3VAIA 4IRCA 1DHMA 4HKQA 3MM5A 3F41A 4JUZA 3EUNA 2AJ0A 2JLGA 2A1BA 2ZZMA 1I6JA 4IR1A 4WE1B 4XK8C 4K4WA 2DK2A 2XZWA 2B43A 3FSXA 1FRIA 1IKVB 1VRTA 3LALA 2BXJA 3I6PA 4OJHA 1HW8A 4X4TA 2W8LA 2ZITA 3BQ2A 4KV8B 2X1FA 3G9CA 4W90B 1FKAF 4QBUA 1KR4A 1F2GA 1YJVA 1UA1A 4I6AA 2MY8A 1M5KC 3M32A 2RQ4A 4DV5F 4NWBA 1N88A 4YY3F 1HL6A 4Y2IA 4QIFA 1QSLA 1DQ8A 5B0AA 5BYSA 1SL2A 4NA1A 2EFOA 4WTYA 2V8GA 4IYQA 1FRHA 3MM9B 4HDGA 3NG8A 3HPOA 4U7CA 4AQYF 1A7GE 2MZTA 1S1WB 1U8SA 2NPIA 2HAIA 4EEYA 2I5JB 4MIWA 2AV5A 5GAGI 4GMKA 2EFPA 4O3PA 3CCES 2ZOGA 5CYQB 2HHWA 1UEUA 5I3PA 4ZK7M 3NNAA 2WRMA 5E3RA 3T1YF 3HHNB 1SIWB 3CCWA 1QE1B 3FZBA 4G6VB 3ONQA 2RMLA 2KTQA 2K1RB 1S1UB 2YNFA 1RDRA 5K8PA 2RRAA 4KE5A 1G7CB 4OZ1A 5LMNF 4B3SF 2CVEA 5BR8F 4NXNF 2V0NA 1NJXA 2DH7A 4KPYA 3KNGA 2ZBIA 3C6TB 3RZAA 4DR1F 3VF0B 1JJ2R 2XMKA 4Q43A 3MMBA 1KLNA 2R7TA 3SDEB 4KR0B 4PXEA 3KMQA 4URQU 3C8YA 3GB0A 1NK5A 1UKUA 4PUOB 1ZAXA 1GX6A 2V5HG 4D3GA 3FNNA 2GGPA 4UQGA 2D3UA 4ATNA 2EG2A 2CPDA 5E41A 3BQ1A 1IJEB 4WU2A 2AD9A 1M5HA 1L3KA 1MW7A 3L7OA 3KHHA 2FHJA 3KLIA 4OI1A 4C2MA 1TKDA 4B9SA 3V6HA 3PO4A 4FF2A 1Y0HA 2MGZB 2IYGA 1MWZA 4DV1F 3MEGA 2XMMA 1N33F 1X5TA 1XERA 4CQ1A 1TR0A 1F5CA 2VKZG 4PPDA 1R3NA 3DGPA 5E3CA 3S1TA 4NPOA 3MUMP 2BQUA 1WHWA 4OLPA 4F4YA 4NXMF 3TQ1A 1X9SA 4ECQA 5E2QA 3S01A 2RRBA 4ZHRA 3I82A 1WHVA 4Y34A 4ZVGA 5CCMA 2BDPA 3QJJA 3MMCA 3CPWR 2J9DA 2UXCF 3HI9A 4H4MA 1WF0A 4BWJA 5B09A 2BM1A 2OAUA 4I67A 4DSFA 4AFFA 2P9CA 2PA3A 4PRFA 3U1MA 2K7JA 4N76A 2KM8B 4Q0BA 5EWGA 4K59A 5K14B 5IT4A 4C0OC 2QMXA 4Y2KA 1VBZA 3BDEA 4ZPBA 3LP2A 1S1VB 2G4BA 3ITHB 3GR0A 3CD7A 4A8FA 4QIEA 3MM7A 1RT6A 3CDBA 3U02A 2YWHA 4UUXA 1L3UA 1UP1A 4DQIA 1HBMA 2PI5A 4E0DA 1C1CA 3FSYA 3UCGA 2RQMA 4PWDB 4WJBA 4NLRA 1N0VC 3CC7S 2KB2A 2XHWA 3M8PA 1Z2LA 4NA2A 1OS5A 4TYBA 5LJ3Y 1GNKA 1JK9B 3IA0A 4URGA 4C8YA 2DGVA 2N4DA 4WIIA 2XY7A 2FHJD 1D1UA 2OMLA 5DS7A 4KT0C 1RWUA 4QJVA 5KFYA 5E3AA 2V4RA 3CJKA 4Q8EA 3DC2A 1YSJA 2RKIB 2BR0A 2OH2A 4N77A 1S0VA 1V3SA 2DNGA 3NBPA 3CJ5A 3CDUA 3PFOA 4OX8A 4IO9Q 1JB0C 2D3ZA 2VODA 2VV5A 2WONB 1JNZB 1OPZA 4QWBA 3DOLA 5AJ3F 5DGBA 1BQNB 4KHRA 3MM6B 1KFDA 2RS8A 4GO5X 4QW8A 2CQ0A 1N54B 4N47A 2HNDA 3BSNA 1VI7A 3FRYA 2QV6A 4IFYB 3TA2A 4ZLPA 4LVNP 3UW1A 5D4NA 1VQYA 2HLUA 4KQZA 4KKOB 2HRYA 2ZE2B 3M9MB 2M2BA 1YTYA 3CIMA 3HHKA 1KNZA 5KFTA 2PT0A 5CH7B 3KFWX 2DITA 2IJNA 2IHR1 2E5JA 3DRYA 3V4MA 3TVZA 5KAKA 2C2EA 2XBPA 1SL1A 2QRRA 2WB1D 2JHEA 3CJ0A 4NLOA 4NLGA 4Q8FA 2G9OA 3KLGB 1OIAA 1LW2A 3M2UA 3UDCA 2ASDA 2MB0B 2RT3A 2OO4A 1T3NA 1S99A 3Q2SC 2W7OA 4HTIA 3POTB 4OX7A 2ILZA 1TAUA 1Q78A 5IT9Y 3ENWA 1YJNS 4LF6F 1QVFR 3GR1A 4WFZA 1FKPA 4WK1A 1KHVA 4MFBA 4QU6A 1H6KX 5F41A 2WSCC 4EBDA 3OR1A 3CJ3A 1RKIA 4NOHA 1DJ0A 3NCRA 1RQ0A 4TU9A 4HH1A 2CIMA 1DTQA 2PMHA 5JVGQ 3MOJB 4B9MA 5F0WA 1S4FA 1VQPS 5A0YA 1J5EF 1X5SA 2X1AA 2VBYA 3F73A 1X4CA 3K0JA 4X4UA 3IG1A 1RT4B 4Q45A 3KK2B 1A6LA 2C3YA 1RTJA 3UQSA 1AUDA 2FD2A 2AGQA 1ZM3A 2M8HA 4C11A 1C1BA 2KFNA 4ZPAA 4XDCA 1XR5A 3VTIA 3QJLA 1CLFA 1X8DA 2GCFA 1MROA 3JSRA 1FTCA 4H4OB 2QYCA 4I0WA 2BV3A 1D9DA 2KT3A 3PRBA 2W9CB 3LF0A 1FD8A 2HHHF 5B0BA 3KLVA 1LWCB 3PVXA 2N82B 4IG0A 2A2CA 3O8WA 3DI6B 4X62F 5A8KB 4F3MA 2J0QD 4RNNA 3LWMA 4MK7A 1S9GA 3CO9A 2J9DE 1N56A 5KFFA 4FF3A 1LK7A 3IRXB 4ZPTR 3V2UC 2XMJA 3MOZA 3MFHA 1DAXA 3R5DA 1R27B 2DNLA 2DNOA 3M30A 2RVJA 1VQ6S 2IVYA 4CO5A 5F8HA 3GIIA 2VOOA 3ICLA 1V3RA 5J2PA 1M1KT 3TAQA 1PGZA 2LEAA 1PILA 2B9YA 5MLCV 1S6PA 4G3IA 2B56A 2KU7A 4DSJA 3CDAA 4BS2A 4TY8A 7FDRA 2IAJA 2HG4A 3DRPB 4NCGB 5C42A 4IFVA 4OHWA 3N5FA 2ZH6A 2NUHA 1V6HA 5KOWA 3BGRA 4U9RA 2JX2A 4XAKA 3MD3A 3THPA 1I94F 1KRPA 3U7JA 3MM8B 2OFHX 4QR2A 2D1CA 4CH1A 2NSCA 3QIPB 3IS9A 5I3UB 2BJEA 4NYZA 4O4RA 4P6QA 3G6VA 3H4DA 3THTA 2RDJA 3CC2S 1NJWA 3KNAA 1U6FA 1N5YA 1E6VB 2F8HA 2DNYA 2W4CA 2M88A 3CDWA 3HDSA 3MF5A 4M1KA 2ZJQQ 3PACA 3FQKA 3DYAB 4OHVA 5KG1A 1XMOF 2CPZA 3BSAA 1MWYA 1U1PA 1QSYA 5HI7A 4OZ5A 3MEEA 3I0SA 3SI8A 4KSEB 1LWEA 2QLXA 4AE5A 3DM2A 4DV0F 4FYDA 4M63A 2PSZA 1KN6A 1R6YA 3CCLS 4QWEA 3P96A 3FQLA 2RU9A 4FPRA 1ZTTA 3V6KA 1C0UB 2DNMA 1Q8IA 1U49A 4EWTA 4DMZA 1HNXF 2YNHB 4ECZA 5FD1A 1TKXB 1C4CA 3DRXA 3JTOA 2MKHA 1CQMA 3DXSX 4O3QA 1XR7A 2BM0A 3DLJA 3S6EA 2VBWA 2XLIA 4I1TA 3SCLE 5KFDA 1KSPA 3EGNA 3RAQA 3P5TL 2G1DA 1RT1B 2GA7A 3OVSA 2VOPA 1S6QB 2WSFC 3RB0A 4A8OA 1HNZF 2GX8A 3FFIA 1KQGB 2I1RA 5ITHA 4CIOA 3D0HE 1FK9B 2CQ4A 1T03A 3THVA 2JLEA 4MAKA 4DL4A 2IVFB 2MHNA 2F8EX 2MKSA 5KT2A 1KTQA 1UVMA 3LUYA 4B9NA 5D4OA 4NLXA 4OV1A 3SFUA 3DN9A 3SYZA 1Q81T 4MK9A 2EVZA 2F3JA 3RW6A 2FIUA 1ZH5A 2BRKA 2WSEC 1SV5B 5AXKA 4QWAA 4QIWD 2IMWP 2DO0A 3E2EA 4O44A 2VUGA 1H38A 5J1EA 4C98A 4F3OA 2DISA 3BGLA 4J9SA 3CD0A 3MPWA 3T9ZA 3DRRB 1FNMA 1VLYA 3JTNA 2X1BA 5D77A 1SIZA 3W7BA 1GT8A 4J9QA 3NCPA 4MKAA 3PW5A 2V8DA 2C3UA 3GQCA 1HPZA 1JLAB 4XO0A 4LF4F 3N6MA 1YJTA 3BM7A 1S9FA 5C24B 1P9QC 2C2DA 1SUQA 1JLCB 1U1NA 1U1KA 1VQSA 2UP1A 2M4MA 2E1RA 3QAUA 5GVQA 4MKYA 2DJWA 2LVWA 3OPKA 4KAIA 4OZ0A 4Y65A 3CXCR 4B3OA 2CQ1A 2GV1A 4PG8A 1X7VA 3TA0A 2HFZA 4K0KF 2G13A 5CZVA 4J9PA 1X4AA 4RZRA 3H4BA 3OSNA 2VQEF 3B78A 1P6TA 1RT7A 1U6ZA 3M1VB 3GYNA 4WYWA 4G1QB 4OJ3A 4N41A 2OPSA 2FVPA 4KO0B 5G4DA 2HS4A 3IR6B 1S7HA 4FVCA 4RBUA 4RW9A 2HVHA 2L48A 3MEKA 4GC6A 4O3SA 3IWNC 1JLBA 1SBRA 1X4HA 1Y9OA 3FSIA 4JBCA 1L5UA 2VG5A 2YVSA 3M9OB 1DURA 1X9MA 4MKBA 2J7WA 1YRTA 4FF4A 2IM0A 1FRXA 1U4BA 4ZCMA 1G3OA 2R2RA 3K59A 4K5SA 1XMQF 5HLFA 2J8AA 3LQVA 2OPPA 3NS6A 5AXLA 3ZZRA 5IQ6A 5D6GA 3MXHP 3N4WA 1B0VA 2O67A 5G0RB 1VQMS 4R5PB 1UFLA 4DG1B 4ED5A 2OIHA 5KFLA 2Z2MA 4M95A 4RUCA 4TQRA 2VA2A 2XMTA 4ZVFA 3NCQA 2YWFA 2J6UA 3GG0A 2HZCA 3G96A 4O3RA 3TA1A 2E29A 1ZPWX 2O3DA 3J7A1 4B3RF 2X51A 1J2VA 1HW9A 5DDOC 4IG3A 3BJYA 1RTHB 4AL5A 2IC3A 2ZH9A 1O5JA 2VFRA 1F9FA 2W9AA 2CQPA 1U26A 1RTIA 2ZHOA 4TU7A 1SKRA 4LFCF 3K5OA 4ZP8A 1QSSA 1KTVA 2YKQA 2VBXA 1IQZA 1X5OA 3E01A 4PXCA 3NL0A 1K1QA 4C0HA 1FTRA 1S1TB 5KFCA 4PG4A 4K4VA 3H5XA 3HM9A 4EYHB 4IRKA 4JI4F 4BC7A 4C3LA 4J9MA 2ZH2A 1RAJA 2KHCA 1KQFB 2E9ZA 4BHQA 2NUUG 2DGOA 1YIJS 2IM1A 5FIIA 4KIAA 3V6DA 2W25A 1FKOB 2KXHA 4CH7A 2VC0A 4X4PA 3M2RB 3Q8PB 3GIJA 4ED8A 2EK6A 2QEXS 3G8QA 2VFVA 2VPXB 4WU3A 3IAS9 4NX9A 2RQCA 3O44A 4A48A 2FJBB 4QWDA 5J2QB 2R9LA 3PW2A 4WE1A 2LECA 2DH9A 5L9XA 2GJIA 2RH3A 1RT5B 5DQHA 3J80Y 3UI3A 3PW4A 5D3GB 3TW0A 4DFMA 5LSRA 2BZ2A 3OXGA 4DV7F 1SQEA 3TR5A 1JX4A 3RBDA 5LXRA 3HO1A 4RU2A