2HLTA

Solution structure of bacillus subtilis acylphosphatase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Bacillus subtilis Acylphosphatase in free and bound states
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Probable acylphosphatase
total genus 25
structure length 91
sequence length 91
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2006-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hltA00
4A47A 1CC8A 4U9RA 4F67A 1S6OA 2K2PA 2RMLA 4OJ3A 3T9NA 2OP5A 1YJVA 3BB5A 1X7VA 3FMBA 2ROGA 3MZIA 1APSA 3IWLA 1Y3KA 4HH0A 4OJHA 1Y0HA 4A48A 2RSQA 3BGUA 2BBEA 1FVQA 2GA7A 1FD8A 1YJUA 1YJTA 4NPOA 5B0GA 2AW0A 2XMWA 2HQIA 2ROEA 3BDEA 3TOQA 4ZOSA 2IFXA 1YJRA 1FESA 1XBWA 2FIUA 2XMMA 2IYGA 2OD4A 3LGNA 3FRYA 1AW0A 4Y2KA 1N5TA 1SB6A 2OD6A 3LGMA 1KVIA 2K1RA 1GXTA 1GXUA 1TL4A 1MWZA 2QYCA 2K7KA 2ROPA 1Q53A 3KKFA 5F0UA 4FNHA 3UDCA 3HFKA 3K7RA 2QIFA 3HHLC 4OJGA 2FHMA 5IXUA 1Q8BA 1FE4A 1R6YA 2HLUA 2JDJA 2OFHX 5K9FA 1OQ3A 2K1RB 1OPZA 2AP6A 5B0CA 3QGPA 3BN7A 3KG0A 1SQEA 2KKHA 1N5QA 1Y3JA 2N7YA 5B0AA 1RJJA 3TRGA 3BR8A 4DPOA 2BYCA 1MWYA 2OKQA 3HDSA 1IUJA 2VV5A 3FGVA 3HHLB 1OSDA 2QLWA 1AFIA 2L3MA 4NL5A 2HFNA 5KAKA 2ASYA 2LXFA 3F44A 4Y2IA 2AJ0A 1X8DA 2KT3A 1FVSA 1ULRA 1VQSA 3WDOA 5B08A 1V3ZA 3I9ZA 3GZ7A 2N4CA 3DCAA 1AFJA 3BM7A 3DXSX 3HF5A 1P6TA 1LQ9A 1WD6A 1YG0A 2GCFA 2HIQA 3HHLA 2XMKA 1N5SA 2K7JA 4HI1A 5T7LB 3CJKB 4OJ1A 4A4JA 3MCSA 2GO8A 4EFAC 1JK9B 2BJDA 1Q4RA 2BJEA 3VTIA 2VH7A 2LQBA 1TZ0A 1TUVA 5A6WA 1S6UA 2KT2A 1K0VA 2XMTA 1CPZA 1JWWA 3CJKA 2Q3PA 5T7LA 5F0WA 5B0EA 3E8OA 3IWXA 2EW9A 3BF4A 1SI9A 1Y9OA 2IYIA 1X0PA 4YDXA 1Q8LA 1P8GA 1KVJA 5B0DA 2XMJA 2GGPA 1N5VA 2PGCA 1URRA 2GFFA 2OFGX 2RU9A 4QOTA 2BUNA 4HH1A 2HFOA 4Y2MA 2PD1A 2QLXA 1FE0A 2G9OA 3HX9A 4YEAA 2FTRA 2GV1A 5B09A 2ZDOA 1U7LA 4FNIA 4DL0C 1W2IA 2LQ9A 2N4DA 2OAUA 3HHLD 2ACYA 5A6PA 3QMQA 2W4PA 1CC7A 2GGPB 2LDIA 3TNVA 2XMUA 4ZA1A 1FEEA 2OMOA 2FB0A 3LO3A 4Q2LA 5B0FA 1KQKA 2HLTA 3KG1A 4DN9A 4HI2A 2ZDPA 1TL5A 1VQYA 4OIXA 2KYZA 1QUPA 4Q2MA 2RILA 4A46A 2CRLA 4HL9A 1OQ6A 3KNGA 5B0BA 2W4CA 2XMVA 1TR0A 2AJ1A 2W4DA 1YRXA
chains in the Genus database with same CATH superfamily
4F67A 1H6KX 1LWFA 1S6OA 2P8IA 4NZ0A 1SL1A 1I51B 1XR6A 2OPRA 2C3OA 2BW2A 4OJ3A 4PXEA 3VQSA 3JXOA 3S6EA 3W9HA 2H3EB 3OVAA 4DV4J 3FSYA 4G65A 2KHDA 3QSYB 2P9CA 5SUHA 3W7BA 3DRPA 1VHFA 1Y4ZB 2FVCA 3JTNA 4B3SF 4H4MA 5EHHA 1WHWA 1KOHA 4IYQA 5B0GA 1LWFB 1V5IB 2HNYA 4LBIA 2IMWP 5C7PA 3Q86A 3RU0A 1FESA 2LKZA 3GSIA 1R8BA 2DIUA 4KH0B 2ZM6F 1GNKA 3R6LB 3Q2TC 4J9QA 3D6HB 2OPPB 5THWA 2MQ8A 2Z2ZA 4O3OA 3HD1A 2PT0A 1FERA 4GVBB 5M2RA 2VFVA 3A12A 1K0VA 3PKYA 5T14A 1YIJS 1I94J 4LFAJ 2Y1IA 1NKBA 1NM2A 2R8IA 2M52A 3MDFA 1HD1A 4DV6J 2H9ZA 4DR1J 1M1KT 4TKTA 5DLGA 1HPZB 5K9FA 1NHVA 2RNEA 3GYXB 3QGPA 1N5QA 4R0JA 3LQVA 2LECA 3G6YA 2YKMA 3GG1A 2AGQA 4JV1A 5H9FK 4ZCIA 2YWFA 1RWNB 5J1EA 1RT5A 4QWAA 2DNRA 1VQ9S 1S9EB 3QFWA 4RWWA 5A8RB 5B08A 1FI4A 3DRSA 3OVBA 3NXZA 4A8QA 1SH3A 1WOOA 2N3LA 5DJBA 3Q8RB 2MEWA 4N77A 3HJFA 3OQ2A 4JV0A 3AD8C 3NKYA 5EWFA 4RUAA 4DL2A 5T7LB 1HA1A 1FEHA 2DKOB 1RWXB 4NA3A 3J81Y 1JK9B 2CQGA 2HMIB 1JQGA 4JI7F 2H65B 1QTMA 1NAQA 2IVMA 4OZ1A 3PR5B 4JUZA 4NZ7A 3OXGA 2I5JA 1CPZA 5H9EK 4K2XA 2J76E 2VBWA 1JX4A 3IN5A 3NGRA 3B4DA 4B9VA 4AXJA 4UY85 1TK5A 5DS7A 4DPTA 3E8OA 2XCAA 1N33F 3F41A 1UJ4A 2C2MB 2HQ3A 2BE2B 2ZH5A 2X3DA 5GAEI 2LA6A 1Q8LA 1RSCA 2A6MA 4ID5A 4Y0FA 4M5DB 1FKPA 3PR4A 3OFEA 5E3AA 1AUDA 3UCGA 3TP2A 4FDFA 4QCLA 2MQMA 2PGCA 2QA4G 2XB2D 4GKJJ 4DOZA 2YKAA 4C3LA 4UOGA 3MTJA 7AT1B 4GC7A 5IQQA 2FTRA 3BQ0A 2XMAA 4L3KA 3RG6A 2LP4A 5IT9Y 3EZUA 3JB9k 1JLGB 3I9V9 3WZ0A 3ET6B 1VQKS 1KFDA 5ETMA 3I31A 3W62A 4RW8B 5A8WA 3R27A 4ZA1A 4IRKA 1RISA 4WKYA 3IA0A 2FB0A 2ZWOA 2MY7A 3POTA 4LIWA 2ZH7A 2CPJA 1RXOB 2BE9B 3CWJA 2E7VA 2CIMA 5GVQA 2KYZA 4KKOA 2AEJA 2CRLA 2XZTB 1RT1A 3QPIA 4HL9A 4OZ2A 1WC4A 4EYHB 4DUTA 3GIMA 2MPUA 4ZLJA 2V8HA 1RZMA 5E3QA 2OELA 4M5MA 4ZVRB 1L3SA 1ELOA 1HNXF 4I7FB 3EGZA 4K4YA 4ZVPB 3WX4A 2MQQA 2BRKA 5KG0A 8ATCB 3RAQA 2RUSA 2JJ4D 1H74A 4OZJA 2PI4A 2U2FA 1X7VA 4FF1A 1F3FA 4X4SA 3MR6A 4Q44A 2B7BB 1NNDA 3KLIB 4QZVB 3SCJE 5KFFA 1S12A 3O2IA 5I42B 3ZXWA 3HSZA 2O01C 4I2PA 4DR6J 2HGMA 3BDEA 3TOQA 1C0TB 1TKZA 5I4MA 2MKCA 1YJRA 5AE1A 1RCXB 5K8OA 4NCGA 3ZZRA 4A8SA 3VHQA 3OLAA 1RWPB 4JI8F 1N52B 2HS3A 3F73A 5LSRA 2OPSA 2DR5A 3KJVA 1PKUA 4Y3CA 3KLHA 4H4KC 3GIKA 1X0FA 4ZHRA 1N4LA 2KZMA 2CQ1A 4ZCMA 1WACA 2IY5B 1VLOA 2HYIB 4C8KA 2B9WA 4O4GA 2KRBA 4PQAA 5GADU 2RU3A 3NLCA 3T1YF 3GJSB 3DLGA 3HHLC 5AJ3F 1UVJA 2M4MA 3P49B 1SJQA 2V8DA 3E01B 3M8QA 3QT5A 2KYXA 3A3PB 4TNOA 5FD1A 3JSMA 4F0HA 2D7SA 5L38A 3OL7A 3BO3A 3MI7X 1UWBA 2ZM6J 3HDSA 4M5KA 3W2WB 3RB3A 4B3MF 2GVZA 3PY8A 5KFWA 2AT1B 2HFNA 1RT3A 2I0XA 4QPXA 5C42A 2YKNB 4K8RA 4URGA 5KT6A 3KMSA 1HNIB 5BJRA 3RRHA 3PXGa 2HVHA 3QZ8A 3O44A 2NXCA 1VQ8S 1RWMB 2FHKA 1JKHA 3OL9A 4DZDA 3HVAA 2KXNB 2CVIA 1R7IA 1UWBB 2QL7B 1FXDA 3CCLS 3E51A 1CJVA 2YPYA 3J7Z5 1RA7A 1F5CA 5KFEA 1X9SA 4JB8B 2GO8A 3LP1B 4NMLA 1P9QC 2ZOMA 2UUWA 3LF0A 4Z2XA 1SJ3P 4W4MA 5HVGA 3MAHA 4LSZB 2VH7A 1XJWB 4C0HA 2V2QA 3C15A 1S6UA 2KT2A 3IBCB 4J37A 2ZH1A 2DNGA 2GW8A 2LXIA 4IQXA 2Q3PA 1RBLA 3US5A 2DGXA 4HDGA 3NCRA 3IWXA 2FGOA 4L75A 2NPFA 3VVUA 1RKIA 3NS7B 2ALZA 1JLQB 4ZIVA 2DT9A 4DSFA 3BEGB 2QMXA 4I0WA 2KM8C 1IKWA 1IBCB 5B0DA 4CDIA 2YQ0A 3W8GA 5BR8F 1X60A 1EETA 5BYQA 4J9PA 4OYXA 2RU9A 1G7CB 1U1NA 5KFZA 2W8LA 2YX4A 2C3MA 3N79A 5CYMB 3W2VA 1VHIA 3NG8A 3VGSA 4LT6A 2ZDOA 2C42A 5IS2A 1UWAA 3AOCA 4FNIA 2LQ9A 4B9NA 1E6YA 2K3KA 2XI3A 2X1BA 4ID8A 1U45A 4Q5VA 3FJ2A 1ZA2B 1CJUB 3D2WA 2DPIA 3DOKB 4B3RF 1EJ7L 1K1QA 1MN9A 3RB6A 3S1TA 3BSCA 4YR0A 5AE2A 1X4HA 2RRBA 4I56A 2KG1A 4JI2J 1URNA 4ENOA 3HULA 2XMVA 3CD7A 3R5CA 3H59A 4M5HA 3UD3P 3DLBA 1D9DA 1LK5A 3S8SA 2C3PA 2DNYA 4URSA 2WTFA 4A8XA 2XO6A 3IM8A 3ISNC 3TEGA 4PWWA 3KJQB 2ZC3A 1DTTB 4I6YA 1BWEA 3SFGA 1REVA 4Y6IA 3SFUA 4USKA 4PXCA 1LWEA 4JI3J 1RT1B 3BGLA 1K8AT 3JTOA 1K1SA 1Y10A 4WE1A 2YPZA 2VG7A 4HH0A 3BH6B 4NLUA 4Y65A 4IO9Q 1Y0HA 1QSSA 3CEDA 4C3MA 3V81A 4LF9J 3JAMU 3HD2A 3CJ8A 1JLEB 3TX8A 2RS2A 2F5GA 1XN9A 4HYKA 1B0VA 1LXJA 1XMBA 1LW0A 5CA5A 2BR0A 2BW7A 4CLYA 1G4CA 4WU2A 4KO0B 2ACMA 4O0IA 3MUMP 5I3UB 2D3O1 3UCUP 1NSKL 4ZDNA 4JV2A 1AW0A 2J6TA 3KDNA 3GIIA 3M8ZA 2A2DA 4IKAA 1NK9A 3FNNA 5D4NA 1IM6A 2EWHA 2QFJA 3J80Y 4DPXA 4ELVA 2KN4A 1YWXA 2F4VF 1UW4A 1FTCA 5A76A 3W9IA 1Q1KA 4OYPA 2MHNA 2PFDA 2YXLA 2XSFA 4WFBQ 1MNEA 4CZCA 3KKFA 3UW1A 4DG1A 7FD1A 5LSLA 5GMDA 3M8RA 3IS9B 3QJPA 4OZNA 4QR0A 2OSRA 1HNZJ 1S9EA 3MFIA 2IBKA 1VBZA 1PJ7A 1TTHB 4A8FA 3L7OA 2RQKA 3DFEA 1JKHB 4YR2A 1EAYC 3D6FB 2G1DA 2KKHA 3F0NA 1J2VA 4XTTA 1CJKB 3AJDA 4KBIA 4BC7A 3H5YA 4ECWA 2VA2A 2XC9A 4WP9A 4V19X 3D0GE 1T11A 3IAS9 2IVFB 2DYAA 1J5OB 1GH8A 1O51A 2XGPA 4FF2A 3R5AA 4Z37A 4ZVFA 5IT9U 2MJUA 1GK8A 2GJ2A 2A1BA 3Q23A 3NOGA 1PBUA 4ER8A 3I0SB 1OO0B 2YQ1A 5D4OA 5K8MA 2GHVC 2JEIA 2XQCA 2MQLA 2AEMA 5J1NA 1S48A 2JX2A 3NBPA 4X4UA 1SC6A 3T1AA 4Q7AA 4USIA 1B3TA 1HBNB 4HHUA 1RU1A 2ZE2A 4J9UE 5DRKA 4F7VA 1NK4A 1KOOA 3DOLA 1HWJA 5F9NA 2FJEB 3QYYA 3PIOQ 5LL6d 3EICA 4C97A 1HNWJ 3FEXB 3QT8A 2ZKUA 3SZ2A 4USTA 3QIPB 3H2LA 4YB5A 2E1MC 2DJWA 4RWXA 2VQFF 1BD6A 2V8VA 2XCPA 1QD1A 2NSBA 2WSCC 1Q86T 3RB0A 1HKAA 1EQ0A 4PQUA 4FBTA 2IYIA 1JNZB 4LF2A 1U1KA 1HHTP 3T9ZA 4LSNB 1T9UA 5C25B 3OSNA 2Z30B 2ZNZA 1YTYA 3J81U 3QIPA 2UUCJ 2YVSA 5U47A 2MQOA 2VDIA 2VHGA 4B9TA 1Y5LB 2AD9A 1GQEA 1TUWA 1TMMA 1PCAA 5JJBA 4DL4A 1Q82T 4N7TA 2CQ4A 1X31C 5CD4H 1FKAF 3QAUA 4UT4A 4F4WA 2BOPA 1HMVB 3HHLD 3QBCA 2AGOA 2DTJA 1WKJA 2J5AA 3C6UB 3FBCA 3H5UA 1ZPVA 1RDRA 4PG7A 4TU9A 5D15A 3M9OB 1IBLF 3L4BC 3FBFA 3KG1A 1BQNA 1FRJA 1DY3A 4E8UA 4C2MA 2W9BA 5H9EJ 3ENAA 1VQPS 1JLGA 3CIZA 1OQ6A 1ZAVA 3AOBA 2G0JA 1CS4A 1HQUA 1RTHA 1WOPA 3KNGA 1RB0A 1UEUA 4ZS6A 5J2MB 5F8IA 4XIUA 1N48A 3R2CJ 3AJ1A 5F8NA 4HHHA 5CABA 2W4DA 1ZZFA 2ASDA 4U67Q 4CP5A 4RU2A 4WFNQ 4OL8A 2K2PA 2Q66A 4YN3B 4X66J 1NJXA 2RVJA 4KB7A 2POKA 1WC0A 2CQ0A 2HQCA 4FKXA 1Z1ZA 4KY3A 3VWSA 4X4QA 5I3UA 2BXJA 1LNQA 3PEJA 4OYZA 2CUYA 4DFPA 4EO8A 4ZMMA 4JBCA 2XHWA 1B0TA 4WK1A 3VAIA 1R3NA 3DLEA 4F0KA 4X4PA 2HRUA 2M2BA 3A3OB 3L9ZA 5IC4B 2IFXA 1OJ4A 1JB0C 2G13A 2ZBPA 2OD4A 3MPWA 2EG2A 4DU8A 2F4VJ 2AWZA 3SDEA 2UXBF 3AFGA 4ANEA 1XMQF 1KRPA 2LU1A 3M8WA 5ETQA 5D0RA 3H4BA 2QO3A 1T9VA 2WVBA 3RW6A 2CDQA 3OHBA 1HARA 1RWWB 1OS5A 4WPAA 1NZ8A 3V6HA 3QRRA 2XWXA 3J7AN 2JHEA 2H51B 2MKJA 4OMFG 1VI7A 2U1AA 5HATA 4RNFA 2HRYA 1WC1A 3Q24A 1RGVA 4OI4A 2KTQA 1C1BB 2UUTA 4NLPA 4PWUA 2XY6A 4CNZA 3H2VE 1OQ3A 5LJ5Y 3HSJA 3FUYA 3DM2A 1YGYA 2B3TB 3W65A 1SQEA 1RE1B 2DGOA 4JI0F 3MFHA 3RBDA 2LQJA 4CYUA 2YNHB 1U2FA 4DV0J 3MEGA 4F3OA 5HO4A 2W8KA 2WONB 4AE5A 4DR5J 3T5JA 4RO0A 1GMWD 3UVJB 2E5LF 3R2DJ 4ZVOB 5KOXA 2KFYA 3IR6B 1HBNA 4F3QA 1X8DA 2GJIA 1FVSA 3EGVA 3JYTB 2R9LA 4OX9J 1V3ZA 1VCTA 2A2CA 4OI2A 2DHGA 1MROB 2KU7A 4PXBA 1ICEB 1B4SA 2Z56B 1U6ZA 3FMWA 1S9GA 3IG1A 5KFRA 2YKQA 4EGLA 3ZTOA 5L1LA 3O8WA 2GCFA 3CJKB 4C3KA 5LJ3Y 1VRTA 3MM7A 1ZTTA 2AJ2A 1NXIA 1WEXA 3QGGA 2XLJA 4ECUA 3DRSB 2LQ8A 2WB4A 4CO0A 1QAIA 3EJMA 2XI2A 2DGVA 4I68A 1WF2A 4KFBA 3R8YA 1HBOB 4DJBA 1N0UA 4KHRA 3MEEB 4MIWA 3N9UC 2AMCB 4LFAF 1FTRA 1JLAB 3A13A 1Y5IB 5CAAA 1HL6A 5KFNA 3TW0A 1NLKL 2HZVA 2HEKA 2G2OA 4IOBA 2N7CA 2LDYA 2UUBJ 2PI5A 1HMVA 2VG6B 2AHOB 4Y28C 4U7UD 4CLUA 3I56S 3T6JA 2MMYA 2Y1RI 4OX8A 1FRHA 4MMOA 1H72C 2W2MP 3SI8A 4OYMA 1C1CA 5KOWA 4Q0BB 1WC3A 1V6HA 1TKTA 4IRDA 5KFTA 1HNVB 4RBVA 2W9BB 1Q5VA 4X65J 4RW7A 3OHAA 2BJ9A 3CDWA 3K5OA 1IBLJ 5K14A 4C48A 1LW2A 3TNVA 1GX6A 1IR0A 2YBVA 3VZHA 1UJ6A 4DSLA 2EFNA 1U49A 5B0FA 4NXMF 2R7VA 1RHJB 5EDWA 4W98A 3OTDA 2BVZA 3MCNA 3UD4P 4X4VA 1QUPA 2DCUB 2NR0A 1N0VC 1PGZA 3UNYA 3JTPA 1X5PA 4X4OA 2V67A 3TVKA 1JLCA 1L3UA 2YY3A 2UUCF 4JI7J 2XLKA 4LR7A 2EEYA 4D3HA 3L7PA 1KKHA 2BM0A 3NAHA 3UO0A 1K9MT 1JXLA 5K20B 2DY1A 2RMLA 2HSEB 4ELTA 1KLMA 1XIQA 2AU0A 3DLJA 1HBMB 1T8EA 2CWXA 5EUHA 3BB5A 2R7RA 3M9NB 2HVZA 1MWQA 4FPIA 4OJHA 1BQMA 3EVOA 1RABB 1Y5NB 2DHAA 4MIAA 3KK2B 4C4WA 2XTJP 4Z7YA 2ZHBA 4C9DA 2JLFA 1YJTA 3HHDA 1KHWA 2XMWA 2OPRB 4UF4A 4RUBA 4UQGA 1QM9A 4KGZB 4P72A 3W5XA 2D74B 3ZNJ1 2GNKA 2Q43A 3BH7B 1R0BG 3RW7A 4J5OA 1IKVA 3FC9A 2OD6A 4BDPA 1Y00A 3CMQA 1KVIA 3HHKA 3V4IA 1RHMB 1U2RA 2KVQE 4RW4A 2KB2A 1HW8A 2FJWA 3W5ZA 4DR4J 4GVLA 1C4AA 2C2KB 2K7KA 2ROPA 1HR0F 1UPMB 4NCGB 4DV6F 1U1PA 2MZRA 4DFJA 3UVJA 5AXLA 1OMSA 5DLFA 1CEZA 2WOMB 1APSA 2DO0A 5L39A 2CJ9A 2NXUA 3DOMA 4HACA 5ETSA 5KT2A 3CCRS 4ED1A 1QVFR 1CLFA 1RHRB 2QLJB 3T5HA 2H48B 2R8HA 2E1RA 3T1HJ 2N7YA 1IBMJ 2IDEA 1HBUB 1S9GB 4CM0A 3B6BA 3QLHB 4AL7A 5HAOA 4IUFA 2ZZTA 2HK2A 1WSVA 4ZN1A 1UFKA 2QJ3A 4DV5F 3HVRA 2LXFA 2PN6A 3MR3A 3EMTA 3KTQA 4DWIA 4JYAJ 4NE9C 2IJFA 4CO4A 3WDOA 5HMZA 4MAKA 1NPPA 2Q79A 2VFSA 3ZTSA 3RTVA 2YNGA 1HWIA 4A8OA 2I5JB 1FK9B 3DXSX 4AUKA 3LGHA 5F8MA 4YHHF 2B9YA 4YB7A 3TAPA 1YBUA 3PYEA 3U1MA 5A2QU 3WC2A 2CPHA 2MZQA 3MCSA 4KPCA 5BYSA 4M5LA 4CTAB 3UR3C 1U1LA 1ZM3A 2DR8A 2Q1LA 5KFLA 4FXWA 1LOUA 4EO6A 4K0KF 3W60A 2MQPA 3ELHA 3I6PA 3D0HE 3BGRB 2V2ZA 3EZOA 4WP8A 2VJVA 3BSOA 1QE1A 4DPWA 3AQOA 3BSNA 2W01A 4IG3B 1WTBA 1EZZB 2DY9A 3A4TA 3EXYA 2B8QA 5GMEA 1TK8A 1S1TB 4OYBA 1RAAB 3CJTA 5F0WA 4LFCF 3OT9A 1UA1A 4M5JA 1VQ6S 4AL5A 2HZCA 4FVCA 3CT9A 1QDUB 2EKNA 4ECVA 2K06A 3WC0A 2EBGA 5LMUJ 2KXHA 3MMCB 2FHJA 1WELA 2BABA 3ET6A 5ADZA 3CJSA 3W63A 4ZPTR 2CQBA 2IJRA 2WHOA 2PD1A 1XQIA 3OFHA 5K8NA 2P6SA 3E2EA 4QBUA 4LFBF 1WORA 4B3TF 1FDBA 2YWEA 3QMQA 2DVIA 1HQUB 4YB1P 2W9CB 1C0UB 1ZAXA 1SUQA 1SBRA 2C1EB 4DV7F 4C8YA 3M2RA 3F56A 3HZEA 4RR5A 4MKVA 4GMKA 2EBEA 1TKTB 5DDRC 3MMAB 4ZPBA 1XTZA 5GMKa 3I0RA 1UJ5A 3H98A 2B7CB 4MT1A 4DCJB 4ZLNA 4A46A 1HLWA 2ZNYA 2E44A 1O0PA 1U0HB 4PKDB 5K14B 1U8SA 2QC3A 4DL7A 1FKOB 1WHXA 2L08A 3K8VA 1BY9A 1FX2A 4IO1A 4MKBA 2FY8A 3PYFA 5D0GA 5HP1B 2HQDA 4JI5J 1KHVA 1CQMA 4FXVA 3CB4A 3L3CA 2BANB 2HNYB 1NPRA 2P9EA 1UP1A 2GJFA 2OP5A 2XZDB 4AYBD 1NJYA 4P2SA 2GVDA 3M8PB 1TL7A 1ZA1B 3FMBA 3WX8A 5IQ6A 3PJXA 2FC9A 3I4HX 2OPSB 1N6QA 4DDFA 4K2JA 3KLHB 4LF7J 3NL0A 1M5OC 2BANA 5K8PA 4LJMA 3N28A 1Q16B 2ROEA 2CNLB 2ZITA 1RP5A 4EBEA 3NGTA 4ECQA 4X62J 3LP2A 2C22A 4ZPCA 3OLBA 4HTJA 4DR3F 2VONA 1A0OB 1S79A 2V34A 3P5BP 1FWKA 2IM0A 2EC2A 3IS9A 4YB6A 5G0RB 6FD1A 2FVRA 3U1NA 4Y2KA 1UA0A 3LANA 4O44B 5DZ6A 3T5KA 1FNXH 2RQMA 2K1RA 3OL6A 1M5VC 2D3OR 1GXUA 1MWZA 1TKZB 1NUEA 3MWBA 4RUHA 2VPXB 5F0UA 4HR2A 4CCHA 2CA9A 3UDCA 4O3NA 4DCOB 4U7CA 2NLWA 2LYVA 2ATCB 3TJAA 5CXTA 2VG5A 4B17A 1T9XA 2WCXA 3R9LA 1YRUA 2IPOB 2O3DA 3FFIB 4GRSA 4USMA 4WYLA 3R97A 4ELUA 1KNZA 1GT8A 4KR0B 3FCVA 1Y3JA 5LXYA 3BR8A 2QZ8A 3W5YA 4JI3F 2MLXA 1RAIB 1RK8A 2XYGB 2J9DA 3VGUA 5L9NA 4IH6A 4CLZA 5E41A 4OI3A 3HFVA 1KS2A 4J9VA 3HM9A 4L72B 1RACB 1RLDA 3RR7A 1DLOA 3C14A 1RLCL 3DYAB 3ENQA 3TANA 3CCES 2XYHB 3GR1A 3RRKA 5LMNJ 4TLQA 1S10A 4IG3A 4NCAA 2WVEA 1S5ZA 1XMOF 1S1TA 2MXYA 3HPOA 2HHQA 5HLFB 1S4FA 2ZVIA 2VKZG 3QSIA 4OJ1A 1T7PA 2VL1A 1YQHA 1UVKA 5HSPA 5A8KB 1HWUA 4YY3F 4DV2J 1KC8T 3CULA 1RHQB 4PXDA 2UU9F 1CULB 1UKUA 3WQPA 1NB2A 9ATCB 3MAQA 4DL5A 2OTJS 3D6TB 4NYZA 5MLCV 2FJVA 1FKPB 2CADA 2CJBA 1M0SA 2DNHA 2FZCB 4U8YA 5GAGU 1D8YA 3NNAA 1JWWA 2ILYA 2PEBA 3LW5C 4PAAA 4BBYA 1RWVB 3FQKA 2V4RA 4WTOB 1WI8A 8AT1B 3VAHA 4OV1A 2D41A 2OEJA 1UVNA 3CMAS 5E3PA 1RYRA 3SSRA 3D1HA 5IT4A 2XMJA 5DETA 2GQQA 2W7OA 5EGYA 2MGZB 1Q8IA 2CAJA 4QIVA 2OJ3A 2CDRB 1KEKA 5KFOA 2E66A 3PHTA 2M8HA 1S1WA 1VJWA 2BJ3A 2QLXA 3DRRA 1SKRA 1BQNB 4ILRA 5H1SV 3NS5A 1AZSA 1W25A 2B4VA 4X62F 5DDPC 2HHUA 1IWAA 2EFGA 4DPUA 5SZTA 4FS2A 3Q8YA 4WBFA 4KGMA 4YS2A 1RTJA 4NLYA 1EETB 3OV7A 1DZ5A 4M5NA 4C8ZA 3QNWB 3J7ZT 4ED8A 3NP5A 1FEEA 4LF6F 2M0GB 3LO3A 2PMWA 1MSWD 3LAKA 2WVFA 2HLTA 3DU6A 3KLFB 3RR8A 1BXNA 3CD0A 4BS2A 3HLUA 1JLBA 1GMWA 2NUUG 3PEHA 1KQFB 3BGFA 2VU5A 3ENWA 2RHSB 1H7WA 3IRWP 1GX5A 1GXLA 1TL7B 3R5BA 4UW2A 2B5JA 4QR2A 2JC1A 3AXMA 4X4RA 2E7XA 2BQRA 1GAOA 2EFPA 2QE5A 4DV1F 3DHWC 4IFYB 5LOQA 1IKYA 1YBAA 3EE3A 1XC9A 2HHWA 2UUAF 3MMAA 3OR2B 2V9KA 3WBZA 4B3TJ 1D09B 3ETOA 1RUSA 1RTIA 2GIQA 2DNPA 3D3BJ 3ZZTA 1OPIA 2NYIA 3SYZA 4ECRA 1IBKJ 1B64A 2QTWA 1UEVA 1R0CB 1WF0A 3T6BA 1S59A 2OPPA 5FIIA 3TJ8A 2O1PA 3V4MA 2OMLA 2HWIA 2VPZB 4PWDB 3QO9B 2AW0A 3G6VA 1RHUB 2HQIA 3LP0A 5IV4A 4DR1F 4ZOSA 4EBCA 4JI8J 2XMMA 1S9FA 4K4VA 1JXVA 1H2TZ 4ETZA 4JI0J 1E6VB 3TZZA 4YDDB 3M8PA 1VQMS 1J5EJ 1I1GA 4DV0F 4DBQA 1TFWA 1VQLS 1BMQB 4H4MB 3PW2A 4OZ3A 2C2OB 2BE7D 4FVMA 1RU2A 4I64A 3N01A 2IHR1 3KLEA 1IQTA 2EXUA 1QAJA 4ZITA 3LAMA 1TL4A 2Z8QA 4C8MA 3VZIA 4JOUA 1K44A 4PRFA 3ZZOA 4QWCA 2DNNA 4RNOA 1WDDA 4JP8A 2GVZB 8RUCA 3FEZA 5J1EB 4HEA9 1FE4A 1D8ZA 4G1PA 4OV6A 4L74A 1T03B 3QGHA 1NHUA 1SV5A 1V5VA 2DNKA 4O23A 4PCQA 5B0CA 1SKWA 3BN7A 2OH2A 4X4TA 5HVFA 3TA0A 2N82B 4CT8A 5KT3A 4O4GB 3THVA 3RYLA 1TKDA 4G3IA 3VF0B 1UFLA 2F8MA 3IRXB 5DQHA 4GC6A 2YQ3A 3ONQA 2YNFA 3H0PA 1R31A 4OX7A 3ICLA 5KFYA 3MMBB 2HHVA 4DQRA 1SV5B 3PRVA 5F3ZA 5KFBA 1X4GA 2ZC4A 1WUUA 1NKEA 1R0AA 1V3SA 1RHKB 4KFBB 4I6WA 4WIIA 1FD2A 3HHLA 3MEEA 5CHCB 2UVWA 3OL8A 1J5OA 3EPGA 2R7TA 2AZ1A 3KXDA 3RRGA 4TXSA 4WJBA 2HFZA 3A8IA 1XMQJ 3G87A 2ZJQQ 1KBRA 1RWOB 2UVRA 4DSJA 2HNZA 1FK9A 4CLLA 2PMZD 4CLFA 1FRKA 3CJKA 2FC8A 3LPEA 3M6UA 3NBPB 4RPFA 1Q95G 5HLFA 2JEFA 1BLUA 2F3JA 2E1PA 3C19A 3N5FA 4N5SA 2VDHA 3M6VA 3BPSP 4ZP6A 1FNMA 3D9BA 1X4BA 3KYLA 1SJ4P 3HK2A 3MM8B 4RW6A 5CQGA 3RZAA 2DHSA 4RBTA 1U6BA 2FVQA 4B3OA 3CSKA 4URQU 1QE1B 4CH7A 1DQ9A 5A8WB 1N5VA 2V5HG 3RJMB 2RDIA 2OFGX 3H8YA 3ADAC 3EDRB 5F8HA 2HFOA 3R7BB 3R7SB 1WKKA 5HN0A 2MLZA 4YY3J 4DV2F 1W26A 3HX9A 2V6AA 4UOHA 3I32A 5KFVA 3KHGA 5B09A 5D3GB 3K8WA 4F4AA 1QAXA 5I3PA 1W2IA 2HHPA 2V63A 3OTBA 5CYQB 4TU7A 1L3TA 4JI5F 1KN6A 2RJZA 4OX9F 3L09A 5JUMA 3AT1B 1VIOA 3NNHA 3RAMA 1VQ4S 3V5RA 4ZCKA 4DN0A 2HWHA 3KHRA 1AT1B 2FQQB 3BGOP 1T05B 4JI4F 3MECA 3R3TA 3D68A 5D3GA 4PR6A 1FFWB 1RAEB 3VV2B 5F8JA 2E5IA 2ZBCA 4GO7X 4RLEA 2M9KA 2W4CA 1U1QA 5E3RA 5J2QB 3CJRA 3UQSA 5A0YB 5M2UA 4LF5J 2DXDA 4CO3A 5H9FJ 3DHXA 5L1JA 1RAOA 1F60B 1NDLA 2X1AA 4DR2J 2DNLA 4X64J 3GJRB 1RCOB 1K47A 2VF3A 3Q2SC 4RU9A 3ULHA 3BS9A 2WB1D 3V6DB 3DI6B 1XNRF 1PYTA 2Y0SD 3MZIA 5IFMA 2CYYA 3ISZA 1N36J 4E0DA 3EX7B 2O66A 1H98A 3IWLA 4FF4A 1B7FA 4LQ9A 4ZIWA 3BGUA 5IT0A 4NLVA 3BQ1A 2JWNA 2RUGA 1M5SA 1UFWA 1YJUA 4KHMA 2VJUA 3DGPA 1S1UB 1UETA 3SMZA 2RIJA 4CWBA 4FS1A 3OJSA 1SL2A 2CKWA 4HDHA 5LM7E 3CCQS 3GLJA 2F9JA 2GC8A 1B70B 5KG4A 2HKEA 2C2EA 2EPIA 3NNCA 4DV1J 2V94A 4K50A 1N6QB 5GAHI 3FCHA 4IDKB 4ZVTB 1Y7PA 2WSFC 1XWLA 1NO8A 2FYXA 5D4LA 3W1YC 3ZZPA 1DHMA 4PWDA 4PYAA 4CI0B 2QYCA 4K4TA 1LWXA 3O6QA 5AXMA 4KH1B 1UZDA 3EGNA 2ZHAA 2AYGA 2PC6A 2RB7A 4FNHA 2ERRA 2FHJD 2B56A 3G9CA 2EI5A 3TA2A 1RT3B 4Y2CA 4PEOA 2FHMA 5F41A 5LSOA 3G6XA 2GS8A 3BZQA 1HNIA 2HLUA 2ZJPQ 2IVYA 1BGXT 4F3MA 4LMZA 2V9WA 1MU2B 4AQYJ 2N3OA 4WZQA 2CZ4A 3CCMS 4LBPA 4NA1A 3IG1B 3H5XA 2CJYB 4ZLLA 1AFIA 1TL1A 3JSYA 3L95X 4P74A 5E0OA 1SC3B 2VC1A 4OYIA 3T19A 1F9FA 3DLGB 3K5LA 4U8VA 4DV3F 1YBTA 3U27A 4Y2IA 4P7TA 1HPZA 4JV5J 3FFIA 1LFWA 3NRBA 3UD5A 3EDQB 1DTQA 1EB0A 2EK1A 2F4FA 3CJ5A 2R7SA 2N4CA 2C2NA 5ETOA 1AFJA 4WU3A 2B0GA 3MEGB 3UN3A 1TL1B 3KUEA 3G6ES 5ETVA 4DR7F 1IJFB 2LXUA 4CQ1A 4N76A 3R5JB 4PQUB 3FSXA 4OLPA 2FJDB 2PEHA 5GAGI 3FSIA 4UOFA 4Y00A 1TUVA 1VR6A 4LF5F 1J27A 3HHNB 4WP3A 2WBRA 1WOSA 1HI0P 4ZP7A 2JLGA 4ZKAA 1HWKA 3CCTA 1SKUB 2AF6A 2MYFA 2QGFB 3T41A 3Q0AA 1HR0J 1PC5A 1VQNS 4N8OA 3FZ2A 3OD2A 2CJQA 2CQDA 3OTOF 2RH3A 4YDXA 4QWBA 3TYTA 4Q8FA 2E5HA 3D7SB 2HVIA 2PA8D 1XEZA 2B8PA 1N54B 2GIFA 4LSLB 5DDOC 3HXMA 1SJFA 1FCAA 4FYVB 5F9LA 3M9MB 3QJLA 3KNAA 5KFUA 3MTKA 3P8BB 4YQWA 2GZOA 3GCWP 2FLLA 2I2YA 2DR6A 3GSDA 4MK8A 3GFXA 1LFPA 4NLGA 3BKFA 3ETMA 1TL3A 3IGNA 4DUYF 1RA6A 4ED7A 1UTAA 1VRQC 2G1HA 4HTIA 5DO2A 3NMRA 4ECXA 1MMLA 1P27B 3BSAA 4LREA 4R5PB 1R27B 2MGZA 2WBMA 2F8HA 4KTQA 1IKYB 3AJ2A 3Q8VA 5LXRA 1U26A 1NH7A 2D3UA 4RJVA 2ZKTA 1AZSB 2ZDPA 1U1OA 1G1XA 3VR1A 3BBBA 2VBZA 4Q2MA 4YHHJ 5AXNA 2UXCF 5B7WA 3UWTA 5MAOA 3PJ9A 1N34F 4L76A 3DDKA 4YR3A 5DGBA 4K0KJ 2W9CA 4R5PA 3R6GB 1N32J 2KZZA 4KE5A 2HK3A 2DGQA 1N8RT 1T05A 1KONA 1J5EF 4OZ5A 4KGVB 4A47A 3E3XA 4OI6A 7FDRA 4K4SA 1S1UA 1LW0B 3PYDA 2ADBA 1AYEA 4DXLA 1HHSA 4CRJA 2M88A 3CJ3A 2SXLA 3NWGA 3CF5Q 1S72S 1CS4B 1KDNA 3GONA 3G4SS 5CCLA 3AH6A 2UP1A 4DL3A 1RT6B 3QQCD 3ZZZA 4JV5F 3G86A 1YDLA 3K2YA 2BBEA 1IN0A 1Z2ZA 3M2UB 4ICLB 4FXDA 4QWDA 2BV3A 2RF2A 3ZZYA 1RTZA 4ITSA 5RUBA 2HNDA 4F8RA 4NLOA 4ZCLA 1FNOA 1KLMB 3MF5A 3EVWA 4QIEA 3OFFA 2WZ1A 1BE4A 4H4OB 3OSPA 2E9TA 2Y8YA 1VIXA 1ZM2A 3A3NB 5E5NA 4YMEA 4O3RA 4OI0A 4JI6J 3NGSA 4W90B 1MN7A 2IC3A 4LVOP 2BJ7A 4Q8EA 4OLOA 4XPEA 4F25A 5F8LA 1WG1A 4ECSA 4OHZA 3EGWB 3TVZA 5DM6Q 5HROB 4X66F 2J6UA 3W3SA 5FJ4A 2YKMB 3IAM9 1LXNA 5HQ8A 2PE8A 1KTQA 2IRXA 3QIDA 1OIAA 2YNFB 3FKBA 2A0FB 2QX0A 1WG5A 2K1RB 4J9MA 2NXNA 1OPZA 1F9EB 1SC4B 3P96A 2DNOA 2E5LJ 2IRUA 1DARA 4M94A 2FUG9 1YK9A 1YX2A 4DQQA 4WF9Q 2KL8A 2VV5A 2XEXA 5E2QA 4E2FB 3NGUA 2V2KA 2EFVA 5EN1A 4I4BA 2RHQB 1YJWS 3F44A 2XY5A 3VVTA 4AT1B 2F40A 2NPIA 1H2VZ 2KT3A 3A1YG 4IH5A 3RBEA 4USHA 3I9ZA 2QA2A 3VAJA 4FPRA 2AV5A 4PPDA 4UQTA 1S6QA 3AD9C 3DLKA 2FZKB 5F8GA 1WWHA 2DNMA 2JEJA 2K7JA 1T3OA 2OO4A 5HJYA 4IR1A 2K3IA 1UEKA 1ITPA 1TU0B 4BC9A 5T41A 4NCBA 2Y3YA 3QT7A 3DKDA 1NSAA 1DAXA 1PO6A 2VBYA 3H2UB 3O5TB 2DPJA 2R8JA 1FJGJ 4X2BA 4F02A 4CO1A 3GJQB 1G3OA 2DD8S 2MLYA 2UUBF 1C1CB 1Y11A 5T7LA 1R8CA 5FDLA 3RUBL 3N4WA 4U95A 4YFUA 4DV4F 1IWGA 1NB7A 4EEYA 2VODA 2ZE2B 1PAUB 2EW9A 3CXCR 1YJ9S 2C3UA 4ZVGA 2R2UA 3HKZD 4FYDA 1F5BA 4AXIA 1H3DA 4F4KA 1FXLA 1YSJA 1NMEB 2ZZMA 3H42A 4ILMA 4KV8A 2GAGC 1TP7A 2WVCA 2XHCA 2DCLA 4NMXA 5FDLB 3MCOA 3TX0A 4X65F 3R1LA 3TZXA 3K58A 4MKYA 2E5GA 2CFXA 2UUAJ 4DLGA 5DZ7A 2W1BA 3GU0A 4ZPVR 4B3MJ 1AB8A 1Z2LA 2VG6A 2Z2MA 3BR9A 2YX7A 4KKOB 4NI2A 3WIUA 4EZ9A 3CDAA 4LRBA 1R89A 2GGPB 2LDIA 5JMNA 2R2TA 5BXIA 1N5YA 2ZH2A 1AUSL 4FBUA 4IFYA 4ETXA 3VGVA 4N41A 2EC0A 1F1BB 2ZD1B 4UZCA 1KQKA 1HYSB 1RAJA 2ZVSA 1DTTA 4HI2A 3HZGA 2FVPA 3EUNA 4OIXA 3HT3A 4KJIA 4DX5A 3CCZA 4IRCA 4QIGA 4ERDA 3M30A 2JVRA 2LMIA 4CT9A 2XO7A 1LW2B 1GTHA 4IR9A 5LT5A 4IOAQ 1TR0A 2UZAA 3KJNB 4UUXA 1RT4A 5J2NA 2HW3A 4GO5X 1IVZA 3UFCX 3SIPB 5ETNA 2R8GA 1C0TA 3I55S 1Q81T 5KFAA 2I8EA 4R0EA 5HQMA 3K89A 2ROGA 2VUGA 5A2QY 2VQFJ 5J2QA 2B5JB 3C6TA 3DMJB 3KUHA 3KFWX 5D78A 2RS8A 1Q7YT 3C46A 2MKKA 4TLRA 2HWTA 1NK8A 1OY9A 3SEOA 3TUJC 3R1HA 1QSYA 5IOLA 1FWPA 2AJFE 3DRYA 1HQEB 3H25A 1FDAA 2H4WB 2VC0A 6AT1B 4RZRA 2Y1JA 3PVXA 5HROA 5GAHU 5C2GA 1PIEA 2OI2A 5L1IA 1X9WA 4DR4F 2PA3A 2M7SA 3V81B 2GMLA 4LBHA 2XS5A 3DXBA 1HI1A 1JLEA 4ZK7M 4I2PB 2YKOA 1RI7A 3QO9A 1HQEA 1X4DA 4OZ0A 4TVAB 3TAQA 3Q8QB 1XNQJ 3L7UA 1EX8A 4LF4F 2DB1A 4G1QA 3LWLA 2D3ZA 3QLHA 2HFVA 3V6KA 1FRXA 2IAJA 3GP9A 1SCJB 1KQSR 2BKPA 1X5SA 1YRTA 3UDLA 4AFFA 4ED4A 1IBMF 3JQJA 1VYAA 3AXKA 3BDPA 1S7HA 3V4IB 3H7HB 4CLWA 2R7QA 1MMDA 4OHVA 2E9ZA 4OFZA 3CD6S 5CYJA 3KG0A 5IV3A 1WF1A 3ENVA 4YOEA 2IM2A 4EK2A 1JJHA 2BYCA 2IDLA 2P9GA 3B78A 4F0MA 1IUJA 1NU4A 4DF4A 1WJ9A 1OSDA 3H20A 1T3NA 3SCLE 1IBKF 4OQJA 5L1KA 2HQGA 1A6LA 4RNMA 1UAWA 3K5PA 4PZVA 2AJ0A 2M3DA 2ZH4A 3K59A 2B4PA 4M5IA 1VQSA 1TELA 5L9XA 3TR5A 3WIVA 2HMIA 1RT7B 4PG4A 3OFGA 2ZUGA 1PJ6A 2OTLS 5J2PB 4O3PA 4GKKJ 1YLXA 3ZFVA 1S6PA 1TKXB 3P6YC 2HFSA 4HI1A 4ZN3A 4F4YA 4RKUC 4MFBB 2ZBIA 3GFYA 2BJEA 3VTIA 2C28A 3CVKA 2ZWPA 3MUVP 3MM9A 1IKXA 1D3WA 1R43A 2DIVA 2HBYB 3MOZA 4K59A 4LSLA 3T3FA 2QMUB 2HGLA 2H5JB 2IRYA 1L3KA 4EYIB 2B4OA 2ZHOA 2JSXA 4NEYA 4ED0A 4TYBA 2IM1A 1F6TA 1UVLA 4UY8T 3G8TA 3OW2R 2BOAA 3LUYA 1HNVA 3BF4A 1VGYA 2GIRA 4MK9A 2ZH6A 1RAHB 2CQPA 3QATA 4PG6A 4P9SA 3RGIA 2E5JA 4DX6A 1P8GA 1PYSB 2H5EA 3B54A 3IXQA 2YKPA 4USJC 2YH1A 2BRLA 1HNZF 2DBBA 2QN6B 4KT0C 2AJ4A 3JAMY 2UXCJ 2GQ2A 4HH1A 2BA9A 2LA4A 3OPKA 2DITA 4YEAA 3BJYA 4LRAA 4RX6A 4DR2F 3NY0A 2AZ3A 3G8SA 1CSJA 2FZGB 4H54A 4X64F 2HFUA 2D9PA 2MQNA 1H2UX 2ACYA 3WHIA 4ZJQA 3MEDB 2E9RX 1XR5A 1ZAWA 2RRNA 2NSCA 5HK4A 3CDEA 4QU7A 1GEHA 2R2SA 2V50A 1FHTA 4DN9A 3CGIA 4X84A 4B3RJ 1Q0NA 4ZVEA 2W24A 3K17A 4IH7A 4K4ZA 2NZCA 1HBMA 3J81j 2WSEC 3HVTB 4WXWA 5D0EA 5LMUF 2XM3A 2KHCA 4NX9A 3MAAB 2LLZA 5KFMA 2VA3A 3M2RB 4X4NA 4NLWA 1NRKA 3TQEA 2VIHA 3ZZUA 4DL6A 3MM6A 4J7CA 1CC8A 4U9RA 1HYSA 2J0SD 5KFQA 5KT7A 5L46A 1Z4UA 2A3JA 4EMDA 2GMHA 5AE3A 2R3VA 4OYOA 2KXFA 3GV5B 3S01A 1VC5A 3C2PA 1VRUB 1VJQA 2AIRB 2X7IA 5KFHA 2BZ2A 1HI8A 3D6MB 4G1IA 2ZH3A 2XY7A 3MAAA 2BQ3A 1K73T 2XYPB 4QYRA 1QSLA 3OR1B 1EARA 4CM2A 2QV6A 2F65A 4GVBA 4I7FA 4P71A 3OR2A 5HANA 1UCNA 4MIBA 4YP3A 1LWEB 3O3LA 1XBWA 5IWAJ 1T9YA 3V6DA 1U1MA 5JXSA 1RAGB 4HT5A 4P7VA 3MPVA 3CMES 3SXLA 2MSSA 4DG1B 4WFXA 1U4BA 1U8WA 4LRFA 2BEFA 3KLIA 3OJUA 1KVKA 1SB6A 1WEYA 2CNNB 4KSEB 1VQOS 2RF2B 4KHPJ 2BJ1A 3B4MA 2JZ5A 4MYUA 4ZPWR 2ASLA 3IC1A 1FDDA 3TJ9A 1Q53A 3K57A 3KOAA 1B0PA 3EXCX 1SIWB 3GYGA 2LEAA 2LCWA 1NPKA 4R25A 3CW2C 2YWWA 2A18A 3I82A 2V0NA 4OJGA 3HMJG 1ZS6A 3N6MA 1R6YA 2JDJA 5BR8J 3KJVB 4NEZA 2KI2A 5L8RC 1S0MA 3GQCA 5C2CA 3DDNA 5CCMA 3ZZ0A 3UPFA 4C11B 4JI4J 4WKRA 5EX3A 4U7UK 2XNQA 1O5JA 1QUVA 1SQFA 4K5RA 3QFHA 3G96A 2BQUA 4QYZJ 3HT0A 4WK3A 3J80U 2AQ4A 2FDNA 2JOQA 3C3LA 2Y1LB 2WOMA 3M1VA 3MPDA 1C1BA 4MFBA 5J1PA 1FJGF 4HVZA 4LVNP 4DF8A 2HURA 2AYMA 1ULRA 5I3QA 2V68A 3N0VA 1ZM4A 5KFJA 4XDCA 3G71S 2CNKB 3BBFA 1QLNA 2AX0A 5GADI 1VBYA 4WWSA 1P6TA 5E7OB 4FP9A 2CWKA 4M1KA 3PZPA 4P6QA 5KG2A 1PAEX 4IFVB 4CNYA 3CD5A 4ZPDA 4QIWD 1JJ4A 2OHDA 2R7XA 1EP4B 1RT7A 3SBMA 3CC7S 2LQBA 4I1TA 4WXOA 1WNEA 1FF2A 3LH2S 3H5SA 4B3OB 1S1VA 4NYPA 1HNWF 3J7YI 3RBZA 2XMTA 4DFMA 2IBOA 2QEXS 2E1CA 4UOCA 1FJEB 4ED5A 1TKXA 3X3UA 2APOA 3CJ2A 4QIFA 1SH0A 1U0SA 4WFZA 3DN9A 4C8LA 3W64A 4JI1F 1U2CA 3K5MA 3C66A 4DV7J 3KG4A 3AY0A 1HD0A 3RBXA 1PSDA 1E6YB 3UNGC 1WKLA 1BQXA 1FXRA 1S0OA 3PW7A 3KLGA 4EBDA 4V1Ak 3IR7B 6FDRA 4EUVA 2HG4A 1NSPA 4N56A 1W2BR 1XMOJ 5HMWA 2ZD1A 1YJ7A 4KAIA 4Q43A 2GV1A 4P75A 3Q83A 2P5VA 4H4KA 3GIRA 3HHEA 1TQLA 5CZXA 3I96A 2AYBA 2W4PA 4DSEA 4F4XA 1RTHB 3G82B 4F26A 3EVMA 4NXNF 5A0YA 1ZYQA 4LF8J 4LRDA 2D1CA 1VLYA 3H90A 2C2ZB 2FGCA 4Q2LA 4XO0A 1TV6A 2CXEA 1R8HA 3FEYB 2HZAA 2KO1A 1SQGA 3MD1A 4XPCA 2RQCA 2L9DA 4DLEA 1VQ5S 4V19J 2KG0A 2RILA 4M8LA 4RW7B 4CLPA 4GKJF 1NEEA 2CNOB 2CPZA 5B0BA 3JSRA 3C6UA 3JS9A 1C0UA 2X3GA 1T02A 3DLHA 5IC6B 2FJAB 3NGDA 3N5BA 3ITHB 2AJ1A 2ZBRA 4KRWA 2WK4A 4O4RA 4RL1A 3KK2A 3M2UA 3K5NA 3TZYA 1RWKB 3CO0P 1HHQA 2BM1A 3M05A 1TAQA 4OYAA 2FD2A 2PDAA 1YJVA 4N8NA 3LP2B 1IQZA 3CCSS 2MB0B 1U25A 5G0RA 1FKOA 1P1LA 2XBPA 3MPYA 5KT5A 1U47A 3OXFA 2IA6A 4WZMA 4PUOA 3MOJB 1WC6A 3CO9A 3GR0A 4O44A 1ZM9A 3TI0A 3MM6B 2OPQB 4NPOA 1RT2A 4TY8B 1QAYA 4RW4B 1TUGB 3PX6A 2UU9J 2Z4PA 2FIUA 2RT3A 1AA1B 2GVDB 1OSCA 2KDOA 3DNCA 1VRUA 3NWRA 1M5KC 4DX7A 5D8HB 3BV8A 1Q5YA 4PUOB 2MZ1A 1LEOA 3ZC4A 2VG5B 4LQ3A 2DH9A 2WVDA 3D1QA 3SQGA 3CCJS 1FT8A 2VQEJ 2E29A 3JQMA 2JL9A 3DGPB 4MKAA 4ZJLA 3CC4S 2KVIA 4TN2A 1CJKA 5KFXA 1XERA 1KWMA 3D28A 3GPAA 4DS4A 3PW5A 3SV3A 2YH0A 1KLNA 1YI2S 2J6SA 4ED3A 1OYEA 3FBBA 4C8OA 2OFHX 3BYRA 4I6AA 4P2MA 3THTA 4DCPB 3TAMB 4OZLA 1MROA 3PKMA 1T95A 1F0XA 4DR5F 4M95A 1EIYB 4IG0B 1CJVB 3W66A 3CC2S 1VRTB 1O6XA 4UTGA 2JRSA 1HNXJ 1I5OB 2QG9B 3BKUA 4IFVA 2HHTA 1FWLA 4ZJOA 1LKZA 3AODA 1MW7A 4KHPF 2QRRA 2FJBB 2DGWA 4PG5A 4R8UB 3DGVA 4JI2F 1IJEB 3BM7A 4ZP8A 2CPEA 4DUZJ 4K4UA 1A7GE 4F2SA 3GFHA 2HBQB 2RD5C 4FN5A 2PMHA 4DR7J 3H4DA 1CQNA 1FRIA 2BJDA 2XSJA 1L5UA 3TVYA 3Q22A 1S49A 4E98A 3JYTA 3HO1A 3HKWA 4QYZK 2PO4A 4FYYB 3MMCA 4NA2A 5A6WA 3T5LA 2XNRA 2B9EA 2HHSA 2JC0A 3D5MA 5AT1B 2PSZA 4EI2A 2ZH9A 1S6PB 1U09A 3R7NB 4ATNA 1WDTA 1QTNB 2VB6A 4IQMA 1S1WB 1NK0A 3G8QA 2M70A 3MM5A 4J91A 3ZTRA 2CQ2A 1L3VA 1NBEB 3P3DA 4LR9A 3PTWA 5HI7A 1NK5A 4B9UA 2XS2A 1S1VB 2G0CA 4NLSA 3EWGA 2B6AB 2CZ9A 2DHHA 3AOAA 2GHWA 2I38A 3TO8A 1HBOA 1XK8A 3U02A 3OUYB 3D54A 2DHXA 3DOKA 2G9OA 3I5BA 3MECB 3B8HA 5ETTA 4N47A 4C98A 4EU0A 5EWEA 2BKOA 2HHXA 2BE2A 3PFOA 2CJKA 3C16A 4NASA 4RW9B 2HBRB 2HBZB 1YKWA 4LF8F 2WW8A 4BWMA 5A6PA 3LTOA 3SV4A 1RBAA 1FA0A 2DNQA 2E1AA 2CPYA 3UDVA 4JYAF 4KIAA 2XMUA 4ZVSB 4ECYA 4B02A 3QRPA 3TARA 4LIRA 1BC6A 5CYMA 1VFJA 2B43A 2HRTA 3M32B 1X4EA 2O67A 1GMVA 4DSIA 4C0OC 1MLAA 3C16B 4RW9A 1HW9A 2Z2LA 1B7YB 3KMQA 4KQZA 5KFSA 3LWMA 2XG8A 2LFVA 3C6TB 3TUPA 1IM4A 1NHKL 4RNNA 3AA8A 2QYGA 4BHQA 2KT5A 5M2PA 3PW4A 4TYAA 4ED6A 4B9LA 1ACMB 2HNDB 4PABA 1CJTB 1RTDA 4B9MA 4LFCJ 1DJ0A 2YTCA 4ED2A 2QFIA 1JLCB 3I4PA 5HMXA 3MR2A 3DU5A 3Q8PB 3BO2A 2ZZNA 4F2RA 1YJNS 1IKVB 4NWBA 2MY8A 1WTFA 3W9JA 5KG5A 3TUIC 4ZVQB 1HWLA 1F5AA 2HVDA 2CPFA 4CLSA 2ATLA 2CJXB 4G1QB 3PO5A 2NUHA 2M5YA 2AYEA 2RE1A 3FRYA 5F3TA 1RT6A 5HVHA 3MHYA 1ZTWA 2NXEA 2LEPA 4CIOA 2FPHX 3QWUA 4WFYA 3OR1A 5KTQA 3I5CA 2FJXA 5CZVA 3E01A 3SCIE 2EG1A 1GXTA 4USWA 3JSMB 1JJ2R 3K0JA 4C11A 4CLTA 2J0WA 3IBWA 3M4XA 4L73A 1VQ7S 3MXHP 3CCWA 2VFTA 3H40A 1KP6A 3W2WA 3KK1A 1T0TV 4BLGA 1C2PA 3HSDA 1TVRA 2QIFA 2QLBB 2Z0GA 5HBMA 3UE2A 4DEZA 2F9DA 2YKNA 1Q8BA 3QWPA 4CH1A 4DU7A 1FX4A 3LA0A 3FDSA 1O8BA 1DTQB 2ALYB 2KH9A 4NRUA 5B0AA 3Q8SB 4ECTA 1NDKA 3IP0A 1RJJA 3CCUS 4K4WA 2FY1A 4C7QA 3QGIA 2VPWB 4UUWA 5ETLA 2EVZA 2CQ3A 2QLWA 3R5DA 2QLFB 4U96A 2GQCA 2OEMA 3OBIA 2J8SA 4CH0S 1R8PA 4FYXB 4NYOA 4FZVA 3CPWR 2R8KA 2UXDJ 2KJVA 1F2HA 2XLIA 2LEBA 2BDPA 2KFNA 1N88A 3BGRA 2AEFA 2Z57B 4P52A 4DQIA 3D66A 2AKWB 1LQ9A 1PILA 1YG0A 2WONA 3D3CJ 4WTYA 4I2QB 2CPDA 3SQOP 1JLAA 2JVOA 4CO2A 3PX0A 1NJIT 1JIHA 1VC0A 3I5AA 3KJFB 1D9AA 1T9TA 1SJRA 3IFEA 1EKSA 3KLVA 4FKYA 4KV8B 1S6QB 3AA9A 2A10A 5J2PA 3PYGA 1SJ1A 1N36F 3GCXP 2AX1A 1YZ6A 1A9NB 4AD6A 4LF4J 2I1RA 4RNHA 2CPIA 4A8KA 1XNQF 3MM7B 1S77D 1CG2A 1JMTA 5DG9A 4EZ6A 2CQHA 2ADCA 3DOLB 1CULA 1EP4A 1IKXB 4B08A 2YWHA 1VMBA 2FHOB 3G82A 1GMUA 4MK7A 4QOTA 2DISA 2IMOA 1NSQA 5KFIA 2HIYA 2V8GA 5KG3A 4ES2A 1CJUA 1R8AA 4Y2MA 3FRZA 4USVA 3UN5A 1SH2A 3M32A 5HJXA 3MM5B 4DHVA 1TK0A 2AJQA 4LFBJ 4Z7CA 3EPIA 2N4DA 2KFZA 1WEZA 4DZ6A 2CPXA 1CC7A 4M5GA 2JNJA 5HP1A 4HT7A 3GE9A 4ZVHA 1G2EA 3PNIA 2V4QA 1S57A 1VDHA 3I87A 3M2VB 1F3VA 1TL5A 2Q6BA 2YX1A 1AROP 4OX6A 5KG7A 9RUBA 1FRLA 4DMZA 4TQSA 2R7WA 5G4DA 3TZWA 1IR1A 1RYSA 2HHHJ 1BWVA 2L48A 2VG7B 2J9DE 1SUQB 1S97A 1YHQS 4DV3J 1YRXA 4NZ6A 3GB0A 1VK8A 3CDBA 5IZHA 5HL7Q 1TAUA 4KGXB 2MSTA 1QVGR 3CIMA 3HJVA 2R4FA 2ZUAA 4H4OA 2MZJA 2VQEF 3P5TL 4AL6A 5J2MA 1GTEA 3M6WA 1D1UA 4LF7F 2QSFA 3GYNA 3BQ2A 1FD8A 1ROFA 1TMJA 2MTLA 1REVB 5D0HA 3IR5B 4NLXA 3TUZC 2MJNA 2K8GA 4KGKA 4DR3J 2DK2A 2IYGA 3NS6A 1VISA 1H73A 4J9SA 1S1XB 1NH8A 1PC4A 4F36A 5C5JA 5DGAA 1FRMA 4AQYF 2C2DA 1NDPA 3SCKE 1SXLA 2JLEA 1LWCB 3DMJA 3W8PA 1N32F 1N5TA 4WCEQ 1R6VA 5ITHA 3LGMA 3VQTA 3TQ1A 1T03A 1VC6A 1ZETA 2COLA 2HPUA 2QL5B 1U02A 4F04B 4A8YA 2M8DB 1Q78A 3R5GA 3MCMA 2GHPA 3KK3B 2IM3A 2L9NA 1UZHA 3HFKA 1QJHA 2HVEA 1OWXA 2W2QP 3AAWB 3SSSA 4DUZF 4I69A 3SQGB 4F50A 1UPPA 4K7QA 1RWUA 3UN2A 1CBKA 2CG4A 2EK6A 3ZNUA 4MH8A 3EYZA 4ZVUB 1NJWA 1KD1T 4R8UA 2G2ZA 1R0AB 2V8PA 3IO1A 1M1HA 3PG9A 2QA4S 3X1LB 3FGVA 5FLXY 1X4AA 1YZ7A 3BO4A 3QRQA 1TVRB 5HBMB 5DM7Q 2W2PP 4U6PA 3NAIA 4NXMJ 4LF1A 1RBOB 1I94F 1S99A 4CLKA 3A8JA 1MU2A 4LUBA 5KFCA 1OY6A 3U1LA 3DCAA 1XNRJ 1HQ2A 3PRBA 4ES1A 4EWTA 1SIZA 1ZZNA 2DRBA 1WD6A 5KFPA 2HIQA 1N5SA 3IRXA 2X1FA 2KJWA 5C42B 2P2CB 2YWGA 2XULA 3HCXA 3HSGA 4QW8A 3GIJA 1NKCA 5KFKA 3LOUA 1M1GA 1Q4RA 4OHYA 2QA1A 1JLQA 4PPZA 2RDDA 1RAFB 3GWCA 2HHHF 4NLQA 1TZ0A 1V9OA 1BUXA 4OHWA 1DBDA 3GTYX 2W9AA 1S4EA 3OTEA 4C8NA 4DX8H 2IIHA 2RKIA 3CCVS 4NLTA 4Q0BA 1SVDA 3CJ0A 3QJJA 4QJVA 5HQLA 2J7WA 3NCQA 1IXKA 1I3OB 1KQGB 1Y9OA 3GJTB 3MM9B 1QY7A 4DI6A 3V6JA 3ILLA 2OUGA 4OHXA 1KVJA 1RTJB 1VS3A 2FLNA 1G6BA 4LRCA 2KM8B 2XS7A 2GFFA 3MR7A 1U24A 2BUNA 2MKSA 2WW4A 4JI6F 1N34J 4DFKA 3BYPA 1FE0A 1X4FA 3KLFA 2RQ4A 2ASJA 1F9HA 3IGVA 3I0RB 2CQIA 2DXEA 1JJCB 1U7LA 4MYTA 4FYWB 4PYDA 3QZ7A 2D9OA 2LVWA 2UVUA 5CD4A 2HS0A 2UVVA 4NRTA 3KLGB 4Y2AA 2GO9A 4J9OA 1WHVA 2JH3A 3DRRB 2F63A 2ZEJA 3LPYA 5BYRA 2W7PA 2CG8A 4RUCA 3T1YJ 1VQYA 3N6LA 4J90A 2CJAA 3M7VA 1CJTA 1BHNA 1RTDB 2Y9HA 3T1HF 4NLRA 4I67A 1EQMA 4TQRA 1YITS 3KUGA 3VAMA 2LQ5A 5KT4A 3MPUB 3QAEA 4WE1B 2DRAA 2DH7A 4K5SA 3ILJA 4NOHA 3QT6A 2MKHA 4B9SA 3POTB 4M63A 2I9SA 1N56A 4ICLA 1UL3A 1TV6B 3PFEA 1WHYA 3M2VA 2J9CA 2I6WA 3CDUA 3LP0B 3T9NA 2DGUA 1RADB 3UR0A 4ANDA 1S1XA 3HVWA 3NGKA 3IWNC 3SSQA 2FVSA 2VFUA 2OEKA 3AB4B 3A8EA 4G6VB 5LMNF 2RSQA 3ITHA 3W61A 1FDNA 1JXEA 1VOMA 2B51A 2IC3B 2VZ9A 1FVQA 4XAKA 3MURP 1ZBTA 5HMYA 4ZHRB 2DR7A 3OTOJ 4DSKA 2ZOFA 5CH7B 1GFWB 1RTIB 3TA1A 1UVMA 3JSBA 5ETPA 1KFSA 2DRDA 2WRMA 5DG8A 1FJ7A 3KK1B 1NK7A 5DQIA 4XK8C 1DFDA 2FLPA 2HAFA 2HAIA 5DDQC 1NK6A 2VOPA 2PFFB 2BJ8A 2F1FA 3BBCA 3CNQP 3P4UB 3TWZA 3CUNA 4DUYJ 1RQ0A 4P2XA 4J9NA 1H0HB 2DH8A 1JLFA 2H1YA 4ILLA 2G0IA 2H5IB 4L3NA 5C24A 4ES3A 4KO0A 2RAQA 2IA0A 3DDIA 1PJ5A 1X5OA 1FJCA 5ETRA 2OIHA 2BACA 3RAXA 2EFOA 3K7RA 3M1VB 4ZPAA 5IXUA 1S76D 1LK7A 1UMJA 4IDKA 3D4JA 3DC2A 3UCZP 3D0IE 3N6NA 2HQFA 1JLFB 1Q8KA 1XR7A 2J7UA 4S0MA 1KR4A 3TRGA 1M90T 1U6FA 3M6XA 3VCDA 2Z58B 3DRXA 4C6AA 3HHLB 2NZ4A 2IAJB 3AHPA 2L3MA 1REGX 3OTCA 2V4JB 5KAKA 2ASYA 4ANCA 4CTAA 2Y8WA 3LALA 2UV8A 4GKKF 1X5TA 2VD3A 2ZBQA 4ECZA 3M8QB 2GMJA 4J9KA 4LF6J 1V3RA 3TAMA 2NYHA 2OSQA 1OY8A 3HF5A 3GFZA 3U7JA 2HGNA 4KC5A 1P9YA 1LV5A 1RT5B 4EFAC 2MKIA 4DS5A 1S7IA 2DXFA 3VALA 5DG7A 1Q7LB 3J7A1 2MDAA 2QL9B 5A8RA 3TEHB 3DYAA 4L6V3 4KPYA 4BWJA 5C25A 5EX0A 2P6TA 3I0SA 1DQ8A 4CO5A 1U1RA 3NMAA 2R7UA 3OUYA 3D1OA 2VKRA 3D67A 3AB2B 2RRAA 1D9FA 3UI3A 3CJ4A 2MHEA 3M8YA 3MGJA 5B0EA 1IR2A 3W2VB 3LP1A 5JVHQ 4KYZA 4HLBA 5E3CA 1SI9A 1X0PA 1SKSA 4LF9F 1X4CA 3M8SA 2XWYA 3VAFA 2ZJRQ 2ZFHA 3KDOA 3RB4A 2QT7A 2Y0BB 2HNZB 3MEDA 2GGPA 4DPYA 1NCLA 1WSRA 2VICA 4K4XA 1URRA 1MG7A 3EZ5A 1N5YB 1D0EA 2RKIB 2O5DA 2R42A 1M5PC 2DEJA 2R2RA 1UVIA 4A8MP 4TY9A 3C8YA 3ZTPA 4W92B 3VAGA 4QWEA 4DL0C 4USUA 3VAKA 2G4BA 4LSNA 1U0HA 1IKWB 4NXNJ 3HVTA 3PRDA 4B3SJ 2B9XA 4P2FA 4WFAQ 5KFDA 1TFYA 3MMJA 5KG1A 4DV5J 2OMOA 2J9EA 4OI1A 2A6OA 1SPBP 3MD3A 1DQAA 1T94A 5ETKA 2W25A 3MEKA 2NREA 5IM0A 2PIIA 2G2YA 1C4CA 1KSPA 4P10A 3ZTQA 3J7YU 4RW8A 1Q79A 5D4PA 1MMNA 5JVGQ 4Q45A 1RT2B 2D69A 3B82A 2DGSA 5KFGA 4WYWA 1JLBB 1OYDA 3A8KA 2J0QD 2V69A 2W2OP 2L9WA 2YNIA 4D3GA 5FLXU 3M30B 2ILZA 2H4YB 1B99A 2ABYA 3FBEA 3GV8B 3SDEB 3PIPQ 2V2VA 1Y3KA 3FZBA 4DQPA 3BKTA 4O3QA 4QR1A 4A48A 4QU6A 3NCPA 3FCWA 3KLEB 2GA7A 1I6JA 2HS4A 3O1LA 5E33A 2XZWA 2Z2YB 1M5HA 2R7OA 3GMGA 4J9LA 4LR8A 2BKNA 2JEGA 3AQPA 4NLDA 2BMBA 1PYOB 2JFDA 3DI6A 3ILIA 2DNZA 3LGNA 3MUTP 3HFZB 2XGQA 3DRPB 3DLLQ 3KHHA 2E7WA 1ZH5A 2KRRA 1F2GA 1X9MA 1YVFA 3DOMB 4HACB 4IOCQ 1T9WA 4QPTA 5I42A 2UXBJ 2OPQA 3BPDA 4TY8A 3DM2B 4UZBA 3DLEB 3GILA 3HP6A 3IBFB 1WG4A 1HBUA 1UW9A 2YNHA 1E6VA 2GAHC 2VOOA 2CVEA 2OLWA 1EKRA 1NZAA 2NCKL 1LWCA 1DURA 1NDCA 1DRZA 2FLOA 2DO4A 4PG8A 2AP6A 1DLOB 2DEIA 3BREA 3C14B 1RKJA 1H38A 1AXQA 1JNRB 2JFKA 3AD7C 4Y34A 2CZVC 2YNGB 5C24B 4A8WA 3PM9A 2YWKA 3DLKB 4DPOA 5IWAF 1MWYA 2OKQA 3P45B 1H7XA 3KK3A 3PX4A 3VGTA 4QW9A 3V2UC 1NJZA 4FF3A 4NL5A 3PW0A 3S7RA 3PV8A 1N33J 3ILOA 1VK3A 4BCAA 1HIYA 1K0TA 2NXJA 2W7AA 4MJKA 4OYWA 1PBAA 3PACA 2VASA 3G2XA 2H54B 3C15B 3GZ7A 3PDNA 3ISND 4CYUB 5AJ3J 2X1GA 2CQCA 1FO1A 2MZTA 3KWMA 4IG0A 4HKQA 4C0BA 2XMKA 2WAQD 4A4JA 3EM1A 4O3SA 1W7WA 2V4JA 3CTRA 3MMBA 2QSWA 3JQKA 3UDEA 2GX8A 3ZO7A 3FQLA 2C3YA 3OXLA 4RBUA 5D6GA 2NS1B 3PJWA 1WI6A 2C2RA 5AXKA 4RW6B 2J0XA 1S0NA 2VPYB 4M5DA 1SL0A 2VBXA 2B6AA 4JI1J 5KG6A 4XDDA 3KHLA 3PHEA 1CVJA 3Q8UA 3FK4A 3FVYA 5DQGA 4I2QA 4O0NA 1ZOTA 5K5MA 4YUDA 4TU8A 5A8KA 2XSJB 1VBKA 3PCOB 1KTVA 1S0VA 1WC5A 3GG0A 4QQBA 2Q6CA 2VFRA 5D77A 2BX6A 1P1TA 2IJNA 1SC1B 2LU2A 2MZSA 3BN4A 1U48A 2J8AA 2F7VA 4ZLPA 2W2NP 3CE8A 2NQPA 1ZPWX 2RDJA 2DR9A 4HHJA 3NEKA 2OAUA 3MM8A 4F4ZA 5IM0B 2X51A 2OGUA 2ZOGA 3HI9A 4ID5B 4J9RA 3IMQJ 4ZP9A 5EWGA 4P73A 2QMWA 2J7KA 2EFQA 1EHWA 2ZH8A 2F8EX 1RT4B 5J2NB 3MR5A 1VBXA 1FFSB 3THPA 5GAEU 4DQSA 1TL3B 4DR6F 3NOCA 3Q89A 5CYQA 2YNIB 2DGTA 3IM9A 4NI2B 2B4UA 4WIQA 3GV7B 2MKYA 3OVSA 4MTPA 3CJQA 4ALZA 1BQMB 1FFGB 2AGPA 3PO4A 1HFEL 2UV8G 2UXDF 1PG5B 2L41A 2EKYA
chains in the Genus database with same CATH topology
4F67A 1H6KX 1LWFA 1S6OA 4NZ0A 1SL1A 1XR6A 2OPRA 2C3OA 2BW2A 4OJ3A 4PXEA 3VQSA 3S6EA 3OVAA 3FSYA 2KHDA 2P9CA 5SUHA 3W7BA 3DRPA 1VHFA 1Y4ZB 2FVCA 3JTNA 4B3SF 4H4MA 5EHHA 1WHWA 1KOHA 4IYQA 5B0GA 1LWFB 2HNYA 2IMWP 3RU0A 1FESA 2LKZA 1R8BA 2DIUA 2ZM6F 1GNKA 3Q2TC 4J9QA 2OPPB 5THWA 4O3OA 2PT0A 1FERA 5M2RA 2VFVA 3PKYA 5T14A 1YIJS 2Y1IA 1NKBA 2R8IA 2M52A 3MDFA 1HD1A 2H9ZA 1M1KT 4TKTA 5DLGA 1HPZB 5K9FA 1NHVA 2RNEA 3GYXB 3QGPA 1N5QA 4R0JA 3LQVA 2LECA 3G6YA 2YKMA 3GG1A 2AGQA 4JV1A 4ZCIA 2YWFA 5J1EA 1RT5A 4QWAA 2DNRA 1VQ9S 1S9EB 4RWWA 5A8RB 5B08A 3DRSA 3OVBA 4A8QA 1SH3A 5DJBA 2N3LA 3Q8RB 4N77A 3HJFA 3OQ2A 4JV0A 3NKYA 5EWFA 4RUAA 4DL2A 5T7LB 1HA1A 1FEHA 4NA3A 3J81Y 1JK9B 2CQGA 2HMIB 4JI7F 1QTMA 1NAQA 2IVMA 4OZ1A 3PR5B 4JUZA 4NZ7A 3OXGA 2I5JA 1CPZA 4K2XA 2J76E 2VBWA 1JX4A 3IN5A 4B9VA 3B4DA 4UY85 4AXJA 1TK5A 5DS7A 3E8OA 2XCAA 1N33F 3F41A 1UJ4A 2HQ3A 2BE2B 2ZH5A 5GAEI 2LA6A 1Q8LA 4Y0FA 3PR4A 4ID5A 4M5DB 1FKPA 1AUDA 3OFEA 5E3AA 3UCGA 3TP2A 4QCLA 2MQMA 2PGCA 2QA4G 2XB2D 4DOZA 2YKAA 4C3LA 3MTJA 4GC7A 5IQQA 2FTRA 3BQ0A 5IT9Y 3EZUA 3JB9k 1JLGB 3I9V9 3WZ0A 1VQKS 1KFDA 5A8WA 3I31A 4RW8B 3R27A 4ZA1A 4IRKA 1RISA 4WKYA 3IA0A 2FB0A 3POTA 2MY7A 4LIWA 2ZH7A 2CPJA 3CWJA 2CIMA 5GVQA 2KYZA 4KKOA 2CRLA 3QPIA 1RT1A 4HL9A 4EYHB 3GIMA 2MPUA 2V8HA 5E3QA 1L3SA 1ELOA 1HNXF 4I7FB 3EGZA 4K4YA 3WX4A 2MQQA 2BRKA 5KG0A 3RAQA 2JJ4D 4OZJA 2PI4A 2U2FA 1X7VA 4FF1A 4X4SA 3MR6A 4Q44A 2B7BB 1NNDA 3KLIB 4QZVB 3SCJE 5KFFA 5I42B 3O2IA 2O01C 4I2PA 2HGMA 3BDEA 3TOQA 1C0TB 1TKZA 5I4MA 2MKCA 1YJRA 5AE1A 5K8OA 4NCGA 3ZZRA 4A8SA 3OLAA 4JI8F 1N52B 2HS3A 3F73A 5LSRA 2OPSA 2DR5A 3KJVA 4Y3CA 3KLHA 4H4KC 3GIKA 1X0FA 4ZHRA 1N4LA 2KZMA 2CQ1A 4ZCMA 1WACA 2HYIB 4C8KA 2B9WA 4O4GA 2KRBA 4PQAA 5GADU 2RU3A 3NLCA 3T1YF 3DLGA 3HHLC 5AJ3F 1UVJA 2M4MA 3P49B 1SJQA 2V8DA 3E01B 3M8QA 4TNOA 2KYXA 5FD1A 3JSMA 2D7SA 5L38A 3OL7A 3BO3A 3MI7X 1UWBA 3HDSA 3W2WB 3RB3A 4B3MF 3PY8A 5KFWA 2HFNA 5C42A 1RT3A 2I0XA 4QPXA 2YKNB 4URGA 5KT6A 1HNIB 5BJRA 3RRHA 3PXGa 2HVHA 3QZ8A 3O44A 1VQ8S 2FHKA 3OL9A 1JKHA 3HVAA 2KXNB 2CVIA 1R7IA 1UWBB 1FXDA 3CCLS 3E51A 3J7Z5 1RA7A 1F5CA 5KFEA 1X9SA 4NMLA 2GO8A 3LP1B 1P9QC 2ZOMA 2UUWA 3LF0A 4Z2XA 1SJ3P 3MAHA 2VH7A 4C0HA 1S6UA 2KT2A 4J37A 2ZH1A 2DNGA 2GW8A 2LXIA 4IQXA 2Q3PA 3US5A 2DGXA 4HDGA 3NCRA 3IWXA 2FGOA 2NPFA 2ALZA 1RKIA 1JLQB 2DT9A 4DSFA 3BEGB 2QMXA 4I0WA 2KM8C 1IKWA 1S0NA 5B0DA 4KPYA 5BR8F 4J9PA 1EETA 5BYQA 2RU9A 1G7CB 1U1NA 5KFZA 2W8LA 2YX4A 2C3MA 3N79A 5CYMB 3W2VA 3NG8A 4LT6A 2ZDOA 2C42A 5IS2A 4FNIA 2LQ9A 4B9NA 1E6YA 2K3KA 2XI3A 2X1BA 4ID8A 1U45A 4Q5VA 3FJ2A 3D2WA 2DPIA 3DOKB 4B3RF 1K1QA 3RB6A 3S1TA 3BSCA 4YR0A 5AE2A 1X4HA 2RRBA 4I56A 2KG1A 1URNA 2XMVA 3CD7A 3R5CA 3H59A 3DLBA 3UD3P 1D9DA 1LK5A 3S8SA 2C3PA 2DNYA 4URSA 2WTFA 4A8XA 3ISNC 2ZC3A 1DTTB 4I6YA 1BWEA 3SFGA 1REVA 4Y6IA 3SFUA 4PXCA 1LWEA 1RT1B 3BGLA 1K8AT 3JTOA 1K1SA 4WE1A 4Y65A 2VG7A 4HH0A 4NLUA 4IO9Q 1QSSA 1Y0HA 3CEDA 4C3MA 3V81A 1JLEB 3TX8A 2RS2A 1XN9A 4HYKA 1B0VA 1LXJA 1XMBA 1LW0A 5CA5A 2BR0A 4WU2A 4KO0B 4O0IA 3MUMP 5I3UB 3UCUP 4ZDNA 4JV2A 1AW0A 2J6TA 3GIIA 2A2DA 4IKAA 1NK9A 3FNNA 5D4NA 2QFJA 2EWHA 3J80Y 2F4VF 4ELVA 2KN4A 1YWXA 1UW4A 1FTCA 1Q1KA 2MHNA 4WFBQ 2XSFA 1MNEA 4CZCA 3KKFA 3UW1A 4DG1A 7FD1A 5LSLA 3M8RA 3IS9B 3QJPA 4OZNA 4QR0A 2OSRA 1S9EA 3MFIA 2IBKA 1VBZA 4A8FA 3L7OA 2RQKA 3DFEA 1JKHB 4YR2A 4BC7A 2G1DA 2KKHA 1J2VA 3H5YA 4KBIA 4ECWA 2VA2A 2XC9A 4V19X 3D0GE 3IAS9 2IVFB 1GH8A 1J5OB 1O51A 2XGPA 4FF2A 3R5AA 4Z37A 4ZVFA 2MJUA 2GJ2A 2A1BA 3Q23A 3I0SB 1OO0B 5D4OA 5K8MA 2GHVC 2JEIA 2MQLA 5J1NA 1S48A 2JX2A 3NBPA 4X4UA 1SC6A 3T1AA 4Q7AA 4USIA 1HBNB 1NK4A 2ZE2A 5DRKA 1KOOA 3DOLA 1HWJA 5F9NA 2FJEB 3QYYA 3PIOQ 5LL6d 4C97A 3FEXB 2ZKUA 3SZ2A 3QIPB 3H2LA 4YB5A 2E1MC 2DJWA 4RWXA 2VQFF 1BD6A 2V8VA 2XCPA 2NSBA 2WSCC 1Q86T 3RB0A 4PQUA 4FBTA 2IYIA 1JNZB 1HHTP 1U1KA 3T9ZA 4LSNB 3OSNA 5C25B 2ZNZA 1YTYA 3QIPA 2YVSA 5U47A 2MQOA 4B9TA 1Y5LB 2AD9A 1GQEA 5JJBA 4DL4A 1Q82T 2CQ4A 5CD4H 1FKAF 3QAUA 4F4WA 2BOPA 1HMVB 3HHLD 2AGOA 2DTJA 2J5AA 4TU9A 3C6UB 3H5UA 4PG7A 1ZPVA 1RDRA 3M9OB 1IBLF 3KG1A 1BQNA 1FRJA 4C2MA 4E8UA 2W9BA 1VQPS 1JLGA 3CIZA 1OQ6A 1ZAVA 3KNGA 1HQUA 1RTHA 4ZS6A 5J2MB 4C8ZA 1UEUA 4XIUA 1N48A 5F8IA 5F8NA 3AJ1A 2W4DA 1ZZFA 2ASDA 4U67Q 4RU2A 4WFNQ 4OL8A 2K2PA 2Q66A 1NJXA 2RVJA 4KB7A 2POKA 2CQ0A 3VWSA 1Z1ZA 4X4QA 5I3UA 2BXJA 3PEJA 4DFPA 4EO8A 4ZMMA 4JBCA 2XHWA 1B0TA 4WK1A 3VAIA 1R3NA 3DLEA 4X4PA 2HRUA 2M2BA 2IFXA 1JB0C 2G13A 2OD4A 3MPWA 2EG2A 2AWZA 3SDEA 2UXBF 1XMQF 1KRPA 2LU1A 3H4BA 2QO3A 3RW6A 2CDQA 3OHBA 1HARA 1OS5A 3V6HA 2XWXA 2JHEA 2MKJA 4OMFG 1VI7A 2U1AA 4RNFA 3Q24A 2HRYA 2KTQA 1RGVA 4OI4A 1C1BB 2UUTA 4NLPA 4PWUA 2XY6A 4CNZA 3H2VE 1OQ3A 5LJ5Y 3DM2A 1YGYA 2B3TB 1SQEA 3RBDA 2DGOA 4JI0F 3MFHA 2LQJA 4F3OA 2YNHB 1U2FA 1TAUA 3MEGA 5HO4A 2W8KA 2WONB 4AE5A 3T5JA 2E5LF 5KOXA 2KFYA 3IR6B 1HBNA 4F3QA 1X8DA 2GJIA 1FVSA 2R9LA 3JYTB 1V3ZA 2A2CA 4OI2A 2DHGA 1MROB 2KU7A 4PXBA 3FMWA 5KFRA 1U6ZA 5L1LA 1S9GA 3IG1A 4EGLA 2YKQA 3O8WA 2GCFA 3CJKB 4C3KA 5LJ3Y 1VRTA 3MM7A 1ZTTA 1WEXA 3QGGA 2XLJA 4ECUA 3DRSB 2WB4A 4CO0A 1QAIA 4I68A 2XI2A 2DGVA 1WF2A 4KFBA 4DJBA 1HBOB 1N0UA 4KHRA 3MEEB 4MIWA 3N9UC 4LFAF 1FTRA 1JLAB 5KFNA 1Y5IB 1HL6A 3TW0A 4IOBA 2N7CA 2LDYA 1HMVA 2VG6B 4Y28C 3I56S 3T6JA 2MMYA 2Y1RI 4OX8A 1FRHA 4MMOA 3SI8A 1C1CA 5KOWA 4Q0BB 1V6HA 1TKTA 4IRDA 5KFTA 1HNVB 4RBVA 2W9BB 4RW7A 3OHAA 3K5OA 3CDWA 5K14A 1LW2A 3TNVA 1GX6A 1IR0A 3VZHA 1UJ6A 4DSLA 2EFNA 1U49A 5B0FA 4NXMF 2R7VA 5EDWA 3OTDA 2BVZA 3UD4P 4X4VA 1QUPA 2DCUB 2NR0A 1N0VC 1PGZA 3JTPA 1X5PA 4X4OA 3TVKA 1JLCA 1L3UA 2YY3A 2UUCF 2XLKA 4D3HA 3L7PA 2BM0A 3NAHA 1K9MT 1JXLA 4ELTA 2RMLA 1KLMA 2AU0A 3DLJA 1HBMB 1T8EA 5EUHA 3BB5A 2R7RA 3M9NB 2HVZA 4OJHA 1BQMA 1Y5NB 2DHAA 4MIAA 3KK2B 4C4WA 4C9DA 2ZHBA 2JLFA 1YJTA 3HHDA 1KHWA 2XMWA 2OPRB 4UQGA 1QM9A 2D74B 2GNKA 2Q43A 3RW7A 4J5OA 1IKVA 4BDPA 2OD6A 1KVIA 1Y00A 3HHKA 3V4IA 2FJWA 1U2RA 4RW4A 2KB2A 1HW8A 1HR0F 1C4AA 2K7KA 2ROPA 1U1PA 4NCGB 4DV6F 2MZRA 4DFJA 5AXLA 5DLFA 1CEZA 2WOMB 2DO0A 5L39A 2CJ9A 2NXUA 3DOMA 5KT2A 3CCRS 4ED1A 1QVFR 1CLFA 3T5HA 2R8HA 2E1RA 2N7YA 1HBUB 1S9GB 4IUFA 3QLHB 4AL7A 4DV5F 3HVRA 2LXFA 2PN6A 3MR3A 3KTQA 4DWIA 2IJFA 4CO4A 3WDOA 5HMZA 4MAKA 2Q79A 2VFSA 3RTVA 2YNGA 1HWIA 4A8OA 2I5JB 1FK9B 3DXSX 4AUKA 5F8MA 4YHHF 3TAPA 2B9YA 4YB7A 3U1MA 3WC2A 2CPHA 2MZQA 3MCSA 5BYSA 4CTAB 3UR3C 1U1LA 1ZM3A 2DR8A 2Q1LA 5KFLA 4FXWA 1LOUA 4EO6A 4K0KF 2MQPA 3I6PA 3D0HE 3BGRB 3BSOA 1U4BA 1QE1A 2PI5A 3AQOA 3BSNA 1WTBA 4IG3B 3EXYA 1TK8A 1S1TB 4LFCF 5F0WA 1UA1A 4AL5A 1VQ6S 2HZCA 4FVCA 3CT9A 4ECVA 3WC0A 2EBGA 2KXHA 3MMCB 2FHJA 1WELA 2BABA 5ADZA 4ZPTR 2CQBA 2WHOA 2PD1A 3OFHA 3E2EA 5K8NA 2P6SA 4QBUA 4LFBF 4B3TF 1FDBA 2YWEA 3QMQA 2DVIA 1HQUB 4YB1P 2W9CB 1C0UB 1ZAXA 1SUQA 1SBRA 4DV7F 4C8YA 3M2RA 3F56A 3HZEA 4GMKA 2EBEA 1TKTB 5DDRC 3MMAB 4ZPBA 1XTZA 5GMKa 3I0RA 1UJ5A 3H98A 2B7CB 4A46A 2ZNYA 2E44A 1O0PA 4PKDB 5K14B 1U8SA 4DL7A 1FKOB 1WHXA 2L08A 3K8VA 1BY9A 4IO1A 4MKBA 3KMSA 5HP1B 1KHVA 1CQMA 4FXVA 3CB4A 3L3CA 2BANB 2HNYB 2P9EA 1UP1A 2OP5A 4AYBD 1NJYA 4P2SA 3M8PB 3FMBA 5IQ6A 3PJXA 2FC9A 3I4HX 2OPSB 1N6QA 4DDFA 3KLHB