1R27B

Crystal structure of nargh complex
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
465
structure length
465
Chain Sequence
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKPGQGFPTDWENQEKYKGGWIRKINGKLQPRMGNRAMLLGKIFANPHLPGIDDYYEPFDFDYQNLHTAPEGSKSQPIARPRSLITGERMAKIEKGPNWEDDLGGEFDKLAKDKNFDNIQKAMYSQFENTFMMYLPRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKDLYQRQLDVFLDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMVWYVPPLSPIQSAADAGELGSNGILPDVESLRIPVQYLANLLTAGDTKPVLRALKRMLAMRHYKRAETVDGKVDTRALEEVGLTEAQAQEMYRYLAIANYEDRFVVPSSHREL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Respiratory nitrate reductase 1 alpha chain
publication title Architecture of NarGH reveals a structural classification of Mo-bisMGD enzymes
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 149
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature ec 1.7.5.1: Nitrate reductase (quinone).
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
B PF14711 Nitr_red_bet_C Respiratory nitrate reductase beta C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3650.10 Mainly Alpha Orthogonal Bundle nitrate reductase domain fold nitrate reductase domain like 1r27B03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r27B01
1H98A 1FTCA 3MMAA 5BYRA 3HKZD 1BWEA 1D3WA 1SIWB 7FD1A 3MM5B 2V4JB 1BLUA 3MM5A 1GT8A 1FEHA 2V4JA 1FRHA 1Q16B 1FRJA 1IQZA 1B0TA 2WSEC 1FXDA 2GMJA 2IVFB 1C4CA 2Y0SD 4Y28C 2WSCC 1FDBA 4CI0B 5L8RC 1F5CA 1FERA 2FDNA 1FRXA 3MM8B 1F5BA 1B0VA 1VJWA 3MM8A 1Y5NB 1FDAA 3GYXB 4KT0C 1BD6A 7FDRA 4DHVA 1R27B 1H0HB 3MMBB 3MMBA 3MM7B 2WB1D 2ZVSA 3MM7A 3IR6B 1IR0A 2FD2A 3MM9B 1C4AA 1F2GA 2C3MA 5E7OB 6FDRA 1SIZA 2XSJB 2XSJA 1SJ1A 1FF2A 5CH7B 1Y5LB 1GTEA 1G6BA 3EUNA 2WSFC 1GTHA 2C3UA 2PDAA 1FRKA 4XDDA 1FDNA 1WTFA 1DURA 1RGVA 1DFDA 1AXQA 2FGOA 5CHCB 1DAXA 5BYSA 3EXYA 4OMFG 4ID8A 4YDDB 1ROFA 2FJEB 2VPWB 2UZAA 3OR2B 3OR2A 1KEKA 1HFEL 3MM9A 2FJBB 1FRIA 2C42A 2FJAB 1Y4ZB 2VPYB 1GAOA 1FD2A 5FD1A 3LW5C 2Z8QA 1A6LA 1PC4A 1FRLA 1FRMA 2GMHA 4XK8C 1H7WA 2C3PA 4L6V3 1CLFA 3MMAB 3IR5B 2PA8D 1Y5IB 1JNRB 2VPZB 1B0PA 3PNIA 5BYQA 2VPXB 6FD1A 1K0TA 1XERA 2FJDB 1BQXA 1FXRA 3OR1B 4AYBD 3OR1A 2PMZD 1JB0C 1PC5A 1KQGB 1FDDA 4OV1A 4RKUC 2O01C 2WAQD 1G3OA 3C8YA 1BC6A 4XDCA 2VKRA 1H7XA 2C3YA 2V2KA 1FCAA 3MMCB 1KQFB 3MMCA 3MM6B 1JNZB 3MM6A 3IR7B 3EGWB 2C3OA
chains in the Genus database with same CATH superfamily
3H59A 1N33J 4B3OB 1FEHA 2V4JA 2V63A 2X51A 2Z58B 3HSDA 3KLIA 2RILA 4DQQA 3C16B 3S1TA 3IWLA 4CRJA 1UL3A 2BW2A 1XIQA 1RA7A 3QO9A 2N4CA 4X64F 3TWZA 2PMHA 2DT9A 2HURA 5H9FK 1SH2A 3HPOA 1OY8A 2KB2A 4WE1A 4CLFA 2HQFA 3T5KA 1SJ1A 3H20A 1FWPA 2JEJA 1RTDB 2UVWA 2R7SA 4CYUB 1P1LA 1NK6A 3NCQA 5CZVA 3P5BP 2ZJPQ 1VQ9S 2CG4A 2CPXA 2M8HA 1S9GB 3GCXP 1RTIA 1Q7LB 4MIBA 3DOMA 1NDLA 2A3JA 1T9TA 4XPEA 3LAKA 1RWVB 1YKWA 2AQ4A 1T0TV 3CC2S 2MKIA 1CJTA 3NG8A 2AF6A 3QBCA 1S1XB 3I0RB 5CABA 1X0PA 2BABA 4X4OA 3M32B 1T03A 3ENVA 3NP5A 2FZKB 2DIUA 1FVQA 2PEHA 3VGTA 5HLFB 2VA3A 2CPJA 2LQ5A 1QTNB 1RZMA 4FYWB 1IQZA 1DQ9A 4LR7A 2ZJRQ 1WSVA 3MR5A 4LRDA 4NXMJ 4DSKA 3JAMY 5KFNA 4USTA 1CC8A 1GX6A 1RB0A 1RAGB 3HM9A 1PAEX 3H2UB 4ES2A 3KKFA 3MCSA 2VHGA 3PV8A 3H2VE 1GTEA 2LEPA 2H3EB 3K17A 4QIGA 1DURA 1DTQB 4OI6A 3BGFA 3T19A 2CQDA 2P5VA 4KR0B 4DX8H 5E3QA 2OPQB 4OJHA 2OTLS 4MAKA 4DV2F 3TVYA 3PX6A 1KBRA 1HW9A 2KM8C 4EO8A 4NMLA 4QR0A 3QGIA 1T9VA 2R8GA 2OFHX 2R2TA 1SBRA 3VAMA 3MAAB 3ITHB 2XZWA 3NGKA 2W2MP 7FD1A 3D4JA 3GIJA 4M5DB 1Q16B 4ZLPA 1P6TA 4ZMMA 4RW9B 3RRGA 3V81A 4FS1A 3LTOA 4BBYA 2QL7B 4EU0A 1LFPA 5B0DA 3GJQB 2YXLA 3L7OA 5ETPA 2DK2A 4NLSA 2HZVA 1AW0A 1CJVA 2B56A 1FNXH 2X1FA 6FDRA 4ES3A 4G65A 4M63A 1TVRA 2XSJB 4NX9A 1UJ6A 4PG7A 3G82B 2WBMA 5ETNA 3I5AA 4AE5A 3FKBA 1MMNA 1ROFA 4ZLLA 5IT9Y 3DLGB 3NS6A 1LWFA 2XYHB 3FBFA 1C1CB 4LUBA 4R5PA 1HNXJ 4NLTA 5DQGA 5D15A 2E5LF 1J27A 4QIVA 5DM6Q 2IYIA 4ZPVR 4YDXA 4DEZA 3KHRA 1D0EA 2NXCA 1S5ZA 3V6HA 2K7JA 4ES1A 2G0JA 2Z2ZA 4RNMA 1VISA 3TQEA 1NJZA 2AHOB 2NZCA 3GFZA 5FDLA 5C24A 4X62F 2QT7A 5D3GB 1ZAWA 3CC4S 1YJUA 3G6VA 1RJJA 4ZK7M 1SJ3P 3N9UC 4MH8A 4ZN1A 5FJ4A 5J2NA 1W7WA 4WZQA 3GYGA 4FZVA 2OPRA 4G1PA 2VODA 4J90A 3MAQA 2AU0A 3VQTA 3MTJA 1Y5LB 5HO4A 3HX9A 1RHUB 4DU7A 4IH5A 1LV5A 2WVBA 2O1PA 5KT7A 5KFMA 4P72A 3NS7B 1HBNB 2G2YA 3Q89A 4WU2A 1T8EA 3CF5Q 5I42A 3H8YA 2GHWA 1WWHA 3OJUA 2HWIA 3NWRA 5D77A 5B0GA 4AYBD 5L1IA 3GILA 1IBKF 2ALYB 4URQU 1F6TA 4USJC 3L9ZA 4IUFA 4ED2A 3GFHA 2FPHX 1RU2A 3TW0A 3SXLA 1QUVA 2U1AA 1UW9A 2D9PA 2KT5A 3NMAA 3HHNB 4FBTA 4WP8A 2XO6A 4TXSA 4MJKA 3ZXWA 4X2BA 3SDEB 3KLFA 4RW6A 2AYGA 2Y8YA 4UT4A 3A13A 4RO0A 1F9FA 2GA7A 2OTJS 2ZWPA 1OPZA 3WIVA 4BWMA 4HHHA 5A2QY 1VR6A 1CEZA 3PX4A 1U2CA 4E0DA 4PWDA 5K9FA 2R7UA 2FY8A 2L9NA 5U47A 4RUAA 4FP9A 4QR1A 3N01A 1HWJA 2P9GA 2ZM6J 3EPIA 2RVJA 1XMOJ 1VS3A 3LQVA 1FJ7A 4MKVA 4AQYF 4KHPF 2MHNA 4MKYA 2ZH6A 3HLUA 2D41A 1S7HA 4LF1A 1DQAA 3I32A 4DR7F 5KT2A 2NUUG 3ILLA 1FT8A 5B08A 1R8HA 2MKYA 4UOGA 3EZ5A 2MXYA 1L3VA 1S1WA 4Y34A 3UCUP 2VOOA 1Z2LA 2BDPA 4M5KA 3JAMU 2WRMA 3Q24A 3BN4A 4DL2A 1KDNA 1GTHA 3M1VB 1YJWS 1MROA 4U7UD 3WBZA 3GTYX 3V5RA 2R7OA 2ACMA 2BJEA 4R0JA 3FEZA 2LLZA 4E2FB 4RW4B 2LU1A 1KONA 3PRDA 1V9OA 2NREA 4LRAA 1OS5A 3QWUA 1OMSA 1YJVA 1CULA 3R5BA 4TU8A 1EJ7L 2YX1A 3ZZ0A 3M7VA 3SIPB 2DRDA 4P9SA 5THWA 1V3RA 2BKPA 3SFGA 5RUBA 4RKUC 1RAEB 3CCWA 4QIFA 2UP1A 1PYTA 2HFUA 3IAM9 2FJVA 1ZH5A 4GVBB 4PKDB 4X4TA 5LMUF 1HI1A 2FVQA 3E8OA 4JV1A 1JIHA 2R4FA 4QWBA 4LSNA 4KRWA 3UW1A 4OHWA 2JHEA 4CLWA 2ZD1A 2AD9A 4ECTA 3GYXB 3HDSA 5LMNJ 3D6HB 3CJKA 4RUBA 4FDFA 2M3DA 2F40A 1XN9A 5HROA 1RSCA 1VRQC 4CM2A 4G1QB 1MW7A 2JZ5A 5I42B 1SJ4P 2FVPA 5EX3A 3PR4A 5HL7Q 2MZ1A 4BWJA 3MEGB 3H40A 1EZZB 3UNYA 1B7YB 2W2PP 2B6AB 1A6LA 3QYYA 5IT9U 2PI4A 2KZZA 1H74A 3QRQA 4OYWA 3IGNA 2ZBQA 4FS2A 6FD1A 1S12A 4OV1A 4F4WA 4F4XA 1U02A 1XTZA 4NYOA 5E3RA 1NHUA 4Q8FA 2YKNA 4JI3F 1N32J 3ZZOA 2E5GA 2VJUA 2OUGA 4RW6B 1IUJA 1NPPA 4IRCA 3OJSA 4JV2A 1SKSA 3QMQA 4HKQA 3TA1A 3MD1A 1WG5A 4QJVA 1HQUB 1HA1A 4GKKF 2NZ4A 3WC2A 1ZM4A 4NZ0A 3MR6A 3TZXA 3A8JA 1IJEB 2UUBF 2XS5A 5D0RA 4ZVFA 4MTPA 1L3KA 2M5YA 2C2NA 1VQ4S 5KT5A 5IM0B 1JMTA 3I4PA 3AQOA 4ZJQA 2RQ4A 3BDEA 1AYEA 4M5MA 4UF4A 5IOLA 1HYSA 2Y9HA 1NB7A 1O0PA 5LXRA 3KK1A 3THTA 2UV8A 4DFMA 2K3IA 4USIA 3KLHA 3M05A 2D7SA 3KHHA 3FDSA 2MKSA 1SJRA 3S7RA 2CJKA 4LFCF 2RKIB 1PBAA 5F0WA 1SIWB 2JOQA 2V5HG 2XMVA 4C3KA 1FRJA 3ZC4A 1X9SA 1GXLA 1RT2A 4CP5A 1OWXA 1BUXA 3DGVA 2OPPB 2W25A 4K0KF 3DOLA 1TL3B 4ITSA 4P52A 1FI4A 1W2IA 3H5XA 1FO1A 5IFMA 1FK9A 4PQUA 2CYYA 2E1MC 3VAKA 3CJSA 1SQFA 3WC0A 1ZTWA 2RAQA 5BJRA 3KDOA 3TP2A 4RX6A 3T9ZA 1QD1A 5A2QU 2GQ2A 1YJNS 3R3TA 4LF7F 2G2ZA 1F2HA 1FRLA 2IM0A 5HSPA 4F7VA 4P71A 3W62A 2VDIA 1KFDA 3I96A 3V6KA 3K58A 1UA0A 3ZTOA 3D6TB 4EYHB 3OFGA 1KN6A 5KFJA 2J0XA 2GAHC 4F4YA 1ELOA 1WHVA 5EWEA 4EGLA 1X5OA 1XC9A 2I6WA 1X5PA 4DSLA 4A48A 3QIPA 2O3DA 1D1UA 3IRXA 5B0CA 2BOAA 3R97A 4NASA 1TQLA 1NPKA 1CVJA 2Q66A 3HVWA 1Q8BA 2E9RX 2W7PA 5C2GA 1S48A 3G6XA 5DRKA 4C4WA 2ADBA 2CWKA 2XWYA 4B3TF 4ZVTB 4RJVA 2D3OR 1CJUB 4WWSA 1FRIA 2C42A 4HI2A 3DDIA 2V9WA 3C15A 4NWBA 2NLWA 4ETXA 3D3CJ 4O4RA 1S0OA 4RNOA 4JI1J 2GFFA 4USUA 3GMGA 2EFPA 1HW8A 3GIKA 2G1HA 5D0HA 3QWPA 4WTOB 1WF1A 1B3TA 1QJHA 2UXBJ 3UDEA 2VKRA 3VGVA 4OYXA 4CWBA 2KFZA 3IR7B 2DY1A 1EETB 5HQLA 1BLUA 1SKRA 2AYEA 2AJ4A 2QX0A 5FIIA 2IJFA 3W1YC 2GMJA 4EBDA 4DR6J 3W9HA 1REGX 5HN0A 5C42B 4X84A 3KG0A 1UPPA 3JQJA 1Q7YT 1U1PA 2IMOA 4LVNP 3V6DA 2YH0A 2DEJA 2CJQA 1RHRB 2MJNA 1HNZJ 3NNHA 2Y8WA 1HKAA 2QO3A 3DYAB 3D2WA 1HYSB 3EDQB 4DV3J 2OFGX 2RDIA 4F4KA 4W90B 1IBMF 4J91A 4C3MA 3D28A 2QFIA 2OJ3A 2LECA 4YB5A 4KO0B 3OR2B 1DARA 4YHHF 3J7A1 2DNOA 2GMLA 2IA0A 1RT5B 4DSFA 3KLHB 2LXUA 2DR7A 2VBYA 2DBBA 2C3PA 5CA5A 2ZE2A 4Y6IA 3K5PA 2RH3A 1DTTA 2XBPA 2ZOFA 3FC9A 1XERA 2FJDB 1ZAVA 3P49B 4FF1A 2LA4A 1QAYA 1RWWB 1HNWJ 3OXFA 2KFNA 2ZKUA 2C3OA 3A8IA 3I5BA 2R7WA 1PAUB 2RF2B 2NR0A 4PQUB 4MYTA 2FB0A 2DITA 3DXSX 3MM8B 5KFEA 4DCOB 1SJQA 2DH7A 4ANDA 1KVKA 1YBAA 5AXLA 1HBUA 4LFBF 3I56S 1MSWD 4HACB 3D9BA 4TYBA 3W66A 5F8JA 1JLQB 1HBOB 2A2CA 3BO4A 4EBEA 2QLFB 1UVJA 4DPOA 2JC0A 1VQNS 3FGVA 3BBBA 1IBLF 2YTCA 3UQSA 4AXIA 4F26A 4WIQA 2DISA 2IAJB 2V67A 1FX2A 3CJ8A 3LWMA 2FJAB 3M30A 3BR8A 1HWUA 2LQ8A 5FLXY 1XWLA 4QW8A 3CMES 5HQMA 2CPHA 2CJBA 4CTAA 4RW7B 2NPFA 1N5VA 3N5FA 5HP1B 1YBTA 2E7WA 3QIPB 3IRXB 3OPKA 1UFLA 4BHQA 2EFOA 4FF3A 5SZTA 2ATLA 3NGRA 5GAEU 4YY3F 3BF4A 1L3TA 2QEXS 5CAAA 5K8OA 3OHAA 2ASLA 5CYQB 3L4BC 2DH9A 3BSCA 1FRXA 2J6TA 3J7YI 2HHHJ 1MMDA 1YTYA 5KG2A 3LO3A 3MOZA 2Y1IA 1RK8A 2Z56B 3O2IA 3MUTP 4JBCA 1SV5A 1RI7A 2DYAA 3PJ9A 4A4JA 1G6BA 5LSOA 1FDNA 3GR0A 4HTJA 2OEJA 1U1RA 2VG7B 2YNHA 2H51B 1N34J 4PRFA 3FNNA 3EWGA 2M4MA 3J81Y 3ILOA 1WKKA 3VVTA 3BBFA 2VC1A 2VG6B 3MUVP 4K4UA 3OL8A 4LRBA 2XG8A 2XLJA 2DNMA 2G0IA 3PNIA 4AL7A 2DNPA 4L72B 3HULA 2C2ZB 4LBPA 1Z1ZA 4CH7A 1G7CB 5LL6d 4XDCA 2HMIA 4DL5A 2MYFA 4LIWA 4J9VA 4DV4F 4J9MA 3KFWX 2YWHA 2CFXA 4C8KA 1X0FA 1G1XA 4QWEA 3M8QA 2DGXA 3JSBA 4NI2B 3M2UB 2UU9J 4KJIA 5IXUA 1SVDA 3DGPB 3BH6B 5HBMB 1W26A 1VRTB 3GPAA 2RRNA 4DR5J 4QU6A 1RWKB 3RBZA 3MECA 4YMEA 2QFJA 1H2UX 3DLEB 2EK1A 1KSPA 2VQFF 7AT1B 2QMUB 4OI4A 3QAUA 4N7TA 5G0RB 4CLLA 3UR3C 2MQLA 3AH6A 3BGRA 4I2QA 4KBIA 2A0FB 4RUCA 3M2VA 1KLMA 3C6TA 1UA1A 3HO1A 3BKTA 2YPZA 4DV6J 4OHZA 4WFXA 5T7LB 1TKXA 2PO4A 1S72S 2Q43A 1D3WA 3KHGA 1FRHA 5EN1A 2FDNA 4QYRA 1QUPA 1LOUA 1RAHB 3MEDA 4OLPA 2YBVA 3RR8A 4ZHRA 2FD2A 5ADZA 2ZWOA 5J1EA 4H4OA 3M30B 1MWQA 3TX0A 2CKWA 5AJ3J 1EKSA 2W7AA 2FQQB 2QL5B 3GWCA 1AXQA 1LFWA 3CCZA 1JLAB 4LF4F 4XIUA 3MPDA 4LBHA 4TY8A 5B0FA 2OGUA 4NCAA 3ZTQA 4KKOA 5DLFA 3PM9A 4ZA1A 2YNIB 2GNKA 3N28A 1S6OA 5KFQA 2PA8D 1KP6A 2V9KA 3GE9A 3P8BB 3L7PA 2E1CA 1TUGB 2IBKA 5K5MA 4J9OA 4FKXA 3ZTPA 4WZMA 3R7BB 3G87A 2O5DA 4IRDA 3C8YA 3L3CA 4DUYF 1S9EA 3EGZA 4IOCQ 4ED1A 4HL9A 1FD8A 4ZPWR 2ZH3A 5JVHQ 1SV5B 3QT8A 3HMJG 3JSRA 2R7XA 5BR8F 5IQQA 1RWUA 4QOTA 4NLGA 3EGVA 2VOPA 2HFVA 2Y1JA 2OPSB 4KGXB 2YQ3A 3PYGA 2B8PA 2N3LA 2IYGA 2QIFA 3OT9A 4PG4A 1RAIB 2KG1A 1FKPB 3PRVA 4M5NA 4KH1B 2F4VF 2RD5C 3CB4A 2BRLA 2XY6A 4ID5B 4K2JA 4KTQA 5D78A 1E6YB 3CCES 4ZVHA 2A6OA 1YI2S 4ECVA 4LFAJ 4UQGA 3RBDA 2NXNA 4DR2J 1S49A 4L6V3 2I9SA 4OX9J 1RT6B 3ZZPA 1RP5A 5E33A 5FLXU 3PW2A 4G3IA 3OQ2A 5HJXA 2W2NP 5HMYA 1M5HA 4PZVA 1T7PA 3I9V9 1F0XA 3VF0B 3CULA 3MM6B 4U96A 3UNGC 1VLOA 1J5EJ 3P96A 5HMXA 1RT1A 1EKRA 1U1LA 1U8SA 4RNNA 4ZP7A 4LR9A 1CBKA 3ZZUA 2I2YA 1GMVA 3QZ8A 1ZA2B 2GGPA 3NXZA 1WORA 3DNCA 1ZPVA 4IQXA 2FHJA 3GJTB 4UZBA 4OJGA 2YX7A 3QPIA 4OZJA 3MMBA 4DFKA 5HATA 4R8UB 1QAIA 2H48B 4NRTA 1SQGA 4P74A 3BO2A 1GFWB 4YEAA 5A8KB 2GHVC 1N4LA 1D9FA 2BYCA 5HI7A 2MY7A 3GP9A 3DMJA 4KPCA 1VBZA 3EM1A 4NLVA 4MMOA 3J81U 5C2CA 5KFSA 2VPXB 4DS5A 3ELHA 5AXMA 2M88A 3C14A 1BC6A 4JI2F 4ECUA 3A3PB 2ZJQQ 1BHNA 2IC3A 1KVIA 3MEDB 2APOA 1IR2A 5CYMA 5J1EB 2FLLA 2PA3A 3QSIA 1TP7A 3TAPA 3RAQA 1KLNA 3FBEA 1N6QA 3GB0A 4FNHA 2LP4A 4DR3J 2CRLA 2RRAA 1I51B 4KFBA 1OPIA 1NSPA 1HMVA 1SH3A 4P2FA 4OYZA 2V69A 3T1AA 1HNVA 3H0PA 4O3QA 2XI2A 1GX5A 3IG1B 4U9RA 2PIIA 3Q23A 2L48A 1LKZA 3DLKB 1C0UB 4WK3A 3MM9A 5B0EA 2Q79A 3B78A 4EEYA 1S9EB 2XY7A 4GC6A 8ATCB 1TL1A 3POTA 2AKWB 3GU0A 3Q8RB 4AL6A 5J2PB 2YKPA 3ENQA 1AUSL 3SSSA 1IN0A 2N3OA 4UOCA 4USWA 2KTQA 1BQMA 5E5NA 1QVGR 1TV6A 3PRBA 5L1JA 4H54A 1MNEA 2CDQA 1GNKA 1U45A 5HANA 2WK4A 3PO4A 5L39A 4LF2A 4ZOSA 2P8IA 3DM2B 2ZH7A 1FXDA 2QA1A 2MMYA 2L3MA 3F73A 3TAQA 3E2EA 1RUSA 2IJNA 4J9LA 5ETKA 1ITPA 3TZYA 2J0WA 2HS0A 4DG1B 3RAXA 1TTHB 3MFIA 2B9EA 3PCOB 5K20B 3LP1A 2Y1RI 4Q0BB 2QLXA 3D6MB 3HSZA 2B4UA 2V94A 2VL1A 2RJZA 3AXKA 2L41A 1Y4ZB 2XMMA 2XO7A 2RT3A 4B9TA 5DZ7A 2H4WB 3PW0A 4JI5F 4X64J 1IKWA 2EG1A 5KFZA 2HLUA 5ETSA 1N5SA 2EBGA 3VAHA 1KQGB 3KMQA 1Y3JA 2EPIA 4YUDA 3K5LA 3SI8A 2DTJA 4ZLNA 1UEVA 4P73A 1X4BA 1KFSA 1SUQA 2HK3A 5KG4A 1F5CA 5I4MA 4X4PA 2PT0A 2CWXA 3PYFA 7FDRA 4P7TA 3VV2B 3THPA 1REVA 2Z0GA 5MAOA 3SMZA 3MEKA 2OEKA 3DMJB 4OZNA 1RKJA 3AAWB 3OL7A 2RDJA 4XDDA 3NKYA 1URNA 3M9MB 1LW0A 3KXDA 4KV8A 1VFJA 1SL0A 4NLUA 3PDNA 1T9XA 2QRRA 5GMDA 4CLUA 4B9UA 3EX7B 1RWOB 1LEOA 2Y0BB 5CYMB 1FE4A 1HQEB 3GSIA 3OR1A 4W4MA 3CJTA 1S7IA 2BOPA 3PFOA 2W2OP 2CA9A 2CQ0A 4PUOB 3DRXA 3EGWB 2ZDPA 1H98A 1TL7A 4NMXA 1PGZA 1QE1A 3D1HA 1RTZA 3J7AN 2YKMA 2BZ2A 1HMVB 3MF5A 2WTFA 4Q2LA 1ZYQA 4QYZK 1XJWB 2AZ1A 3T6JA 4DV2J 4TLRA 3MM9B 1RWPB 3D0HE 1RHMB 4JV5J 3WQPA 4C7QA 5EUHA 3FVYA 2B3TB 4DZ6A 3D54A 1TMJA 1XMQF 2JX2A 4W98A 4DV5J 1SXLA 3VAGA 3ETMA 2DCLA 4OI3A 3DRRB 4JI6J 2SXLA 1X5TA 1RCOB 1TL4A 2CAJA 2UVRA 2DHAA 2JL9A 4XAKA 4B9LA 1K8AT 2XGPA 2I1RA 2MPUA 2R9LA 4M5JA 2ZNYA 4ILRA 4RUHA 3VAIA 4P2SA 2NXEA 5K14B 1D8ZA 1HWIA 4DN0A 2XQCA 2KVQE 3G6ES 4U6PA 1G3OA 2KDOA 3Q0AA 3HVRA 2GO8A 1RT3A 3SQOP 1WC3A 3U1MA 4OZLA 2CQCA 1TKTB 2DY9A 5A8WA 4P75A 2R8IA 1VC0A 2IM3A 1OSCA 4DLGA 1UVNA 3NGDA 1LXNA 3DOKB 3GG0A 3PFEA 4M8LA 1C4AA 2E5LJ 4M1KA 4NYZA 3JSMA 1D09B 4K4ZA 2V8VA 1HNXF 3W5ZA 4HHUA 5ETTA 2IVYA 2VIHA 1NRKA 4PXCA 1FHTA 3FQKA 1H38A 3EPGA 3FEYB 2Q6BA 2DD8S 1ZM2A 5DDQC 3SSQA 3VR1A 2JWNA 4ECYA 5F8LA 4M5LA 2ZFHA 2IPOB 3P4UB 1CLFA 1U24A 1QSSA 2W9AA 3N79A 3PIPQ 5HMZA 5KT4A 1W25A 1F3FA 3A8EA 4DQRA 1IKXA 3MMCB 3IWNC 2YWFA 4X65J 2L9WA 4IFVB 5DLGA 2IHR1 4O4GB 3W2VB 2GO9A 5HVGA 4QWAA 4ELTA 2EK6A 2YQ1A 3NMRA 2ZZNA 1U1KA 3CDAA 5DDRC 2R2UA 4KV8B 2GJ2A 2ZVSA 4C0OC 4FYDA 3B4DA 4OX6A 3KTQA 1MU2B 2AEMA 4EMDA 3LUYA 3EVMA 3CGIA 1LK7A 2BE7D 5EDWA 4AD6A 3MPYA 3OLBA 5DDOC 4URGA 3FUYA 3RAMA 5AXNA 3WHIA 2UUAF 1FRMA 2QYGA 3FFIB 1TKDA 2ILZA 3QRPA 4ALZA 1QE1B 2YKMB 3ET6A 1BXNA 2U2FA 2KXNB 4CO3A 4JI0J 3Q86A 1M0SA 2MLXA 2HAFA 2NSBA 5T41A 3KK2A 1SC6A 3TA0A 2HIYA 2B9XA 4IG3A 5KT6A 3QJPA 2KYXA 2FVRA 1D8YA 3G96A 4B9VA 4WXOA 2IFXA 1R3NA 2W9BB 1O51A 3GV8B 2BKOA 1NHVA 3IR6B 3HJFA 1P27B 4NCBA 3BSOA 2R7VA 3J7Z5 3NBPB 2I0XA 3R5DA 3CO0P 3ZZRA 2PDAA 2MQ8A 2C28A 2PN6A 4AQYJ 4QCLA 1HWLA 4KHPJ 2HZAA 1VQLS 1RT7B 1RISA 1KD1T 3CSKA 2HFNA 4DFJA 4DR7J 4DCPB 1R89A 2ZOMA 3I0SB 3R5CA 4V1Ak 2KHCA 1ICEB 4B3SJ 3GCWP 1DRZA 2F8EX 4Q45A 3KLEA 3MFHA 3FRZA 3B82A 4OYIA 1WG1A 2CPIA 4IOBA 4F0HA 2K2PA 2BQ3A 1U2RA 9RUBA 4IG0A 1HR0J 1JX4A 1GMWA 2KG0A 3AD7C 3C16A 2PE8A 4ZLJA 1G4CA 2ZH1A 4A46A 1U48A 5KG7A 2FJXA 4IRKA 2WB4A 1YITS 2VG5B 1I1GA 2EXUA 4ETZA 3HZEA 2CQGA 1XNRJ 3RZAA 2YH1A 3BKUA 3FSXA 1JKHB 3TYTA 2IDLA 4CYUA 1PILA 3DLHA 1N0VC 6AT1B 3W8GA 5L9XA 5BYSA 3S01A 1HWKA 2Q3PA 2CPDA 4PAAA 2BVZA 1S9GA 5J2QB 4K5RA 4A8KA 3MDFA 4IFYB 3AA8A 3TNVA 3LA0A 4P2MA 4WTYA 3MTKA 3IBFB 4OYMA 4ZVOB 3BDPA 3HHKA 1S1XA 3I0RA 4K4VA 4U7UK 3GV7B 2DNLA 5CCMA 3M32A 4ENOA 2KT2A 1WJ9A 3IRWP 1Y11A 1WDTA 3JTOA 1B7FA 3L95X 1NM2A 4F25A 5F9LA 3LP0B 5HLFA 3TX8A 2VICA 1FKOB 3DLJA 2XHWA 2BXJA 2YKQA 4ILMA 4UY8T 5LT5A 3OTOJ 1BD6A 3SQGB 2POKA 4ECZA 3DLBA 2N4DA 2V8HA 2D3UA 3NWGA 2IVMA 1N5TA 4DX5A 1FJCA 4FVMA 2E7XA 1VGYA 3IC1A 3PW7A 4LRFA 4OI2A 2KL8A 4FYXB 4JI3J 5F8HA 1DTQA 4U67Q 1A0OB 1YSJA 1WTBA 3NGUA 2OPQA 4J7CA 2BE2B 2R8HA 1VCTA 3IBCB 2DPJA 4Z2XA 1PJ5A 4GKKJ 2GIQA 1R31A 5SUHA 2MEWA 3M8PB 2FLPA 4ED3A 1AT1B 2A6MA 2OHDA 3KG4A 2V4RA 3W9JA 2UUBJ 3MAAA 3ITHA 5L1KA 3F41A 2YNFB 3S6EA 4M5DA 2AWZA 1GXUA 4RW9A 2K8GA 2ROGA 1S6PB 3L09A 1NJWA 3P5TL 4OYPA 2HNZB 2JLGA 1H6KX 3TAMA 2EG2A 1N88A 2XSJA 1BMQB 2VV5A 3AXMA 1GEHA 1RCXB 3G82A 4OHYA 3GIMA 2CZ4A 3OFFA 2BJ7A 4LFCJ 4USHA 2VPWB 5B0AA 4ZP8A 2M2BA 5DO2A 4JI4F 3TJ9A 1C1CA 3EZOA 4DV0F 3K8VA 2XMWA 1JQGA 1ZETA 2KJVA 5L46A 4USVA 2GJIA 4ECSA 4K0KJ 1RADB 3PIOQ 4K59A 4IR9A 3LOUA 4I68A 1RWNB 2XSFA 4NLPA 3CDEA 4CNYA 1U0HB 1BWEA 2CQ1A 1RT4B 3HI9A 3MM5B 1X4GA 3WZ0A 2QA2A 2HHPA 4A8QA 3A8KA 1FNOA 1YVFA 1I94F 1WC4A 3EICA 4D3HA 2XMJA 3BQ2A 3IMQJ 5D3GA 2NXUA 1KTQA 3BM7A 2V2VA 4ZPAA 4FF2A 4KHMA 5C25B 5J2MB 1ZPWX 1F2GA 4ZVRB 3TI0A 3AODA 2PFDA 4LF5F 1M5SA 4KIAA 4KGZB 4N5SA 5I3UB 2N82B 3CCRS 4RBTA 1NMEB 2CPYA 2WHOA 2VFSA 2ZDOA 4DSIA 1HBNA 4UOFA 4O3OA 2PFFB 4XK8C 4C98A 1ZA1B 2J7KA 3I87A 4F0KA 4Q7AA 3MHYA 5I3QA 5EX0A 4DPWA 5LJ5Y 3CVKA 2FZCB 4RZRA 2BRKA 5GAGU 3SZ2A 2C3YA 1MMLA 2J7WA 2EVZA 1JNZB 3W3SA 1FTCA 2LKZA 3GV5B 2ZOGA 2K1RB 3UD5A 4CQ1A 3Q22A 1SL2A 2W01A 2XLKA 2ZBCA 4KGKA 1B0VA 2B5JA 5EWGA 1VRUB 3OFEA 5F3TA 3SDEA 2AX1A 1UJ4A 3R5AA 4RBVA 3OTEA 2AJFE 3JSYA 2R7TA 1FVSA 3CTRA 2BA9A 2UXDF 3ZTRA 1RGVA 3EYZA 2I5JB 5KAKA 2FLNA 1SKUB 3WX4A 2UXBF 5L38A 1IKVA 4OZ0A 2KO1A 5GADI 4DR1F 1BGXT 1X4HA 2KVIA 4MYUA 1R7IA 4IDKB 5F9NA 3ISNC 1X31C 1JJHA 1UW4A 2XNQA 3N6MA 3DDKA 3E3XA 4ZVPB 3HKWA 4DR6F 1N52B 1SH0A 3SBMA 2RMLA 2CPEA 1NK9A 1Y3KA 2E1AA 1KRPA 4ECQA 1OY6A 3W2WB 3TAMB 1IBMJ 1X4AA 1NK7A 1EIYB 4L3KA 3KJFB 2HHTA 3CO9A 4RPFA 4PWUA 4PG8A 1NBEB 4YHHJ 3IS9B 3KJVB 2KT3A 1VQPS 1TMMA 4CH0S 3QGGA 3X3UA 2OSQA 3UDCA 4O0NA 1MWYA 2EKYA 1YJTA 3M1VA 1T05A 4H4MB 1VHIA 3HHLB 4OZ5A 5DJBA 3ADAC 2RUSA 1RAFB 4RW4A 1J2VA 4BC9A 2AP6A 2CQHA 3RRHA 2UXCJ 2HVIA 1U47A 4JYAJ 1FJGF 2E5IA 3IBWA 3JQKA 5C7PA 4KH0B 2ZUGA 1VHFA 4HDGA 2WONA 5JVGQ 1FXRA 3UN3A 1I6JA 3PHEA 5EHHA 1X9MA 3W63A 4BDPA 5M2RA 3TJ8A 4GVBA 1WHXA 4O3PA 1C2PA 1IBLJ 2BEFA 1MWZA 4HR2A 4ATNA 4ED5A 3BEGB 1NSKL 2MZJA 4I6WA 5KG6A 2RE1A 4ED8A 4EBCA 5E7OB 2BQUA 3PVXA 4NA3A 4CO0A 3AB4B 4G1QA 2B43A 4C0BA 1R6YA 2MQOA 3NNCA 4ELVA 5IT4A 3U1NA 1O5JA 8AT1B 1UKUA 1E6VB 1WACA 3FBCA 3MEGA 4CLZA 2B6AA 5LSLA 4B02A 1VQYA 1UVKA 2A18A 1PSDA 3GONA 4V19X 1Y5IB 5A8RB 1K47A 3MUMP 2W4PA 1H73A 2E1RA 2HRUA 4NZ6A 2MZTA 3LWLA 4O44B 3CC7S 5CXTA 3ICLA 5IV3A 2HHHF 4I2PB 2B5JB 3W8PA 1Q95G 2FJWA 2R7QA 1VK3A 2QZ8A 1GT8A 2XC9A 2MSTA 3AD8C 4ECWA 4TY9A 3HHDA 3QFWA 1XNQJ 2Z2MA 2Q1LA 1HQUA 1WI8A 4R25A 4K4YA 3UR0A 2EC0A 3MM7B 2CNNB 3MEEB 3SCLE 1IKVB 1FX4A 4J9UE 3TEGA 1QAJA 4X4QA 2LFVA 3DC2A 2H5JB 2X3DA 5IM0A 2XNRA 3TUPA 2LQ9A 3QQCD 3TVZA 2VPYB 2PGCA 3ZZZA 1GAOA 1QVFR 3MR2A 2VC0A 3H5UA 1KQKA 2FY1A 2PC6A 2MKJA 3PYEA 2HNDA 5F41A 4L76A 2YWKA 5DS7A 4DSJA 2X1GA 1N5YA 2O01C 1EAYC 3CIMA 1RKIA 2VH7A 2OIHA 3M9NB 4C97A 3M6XA 2RHQB 3IM9A 2RKIA 2KRRA 3QJJA 2V2ZA 1NDPA 1S1TB 4U95A 2M9KA 2GVDB 4DR5F 3HXMA 2VQFJ 4AXJA 3MGJA 3FBBA 1T05B 4JOUA 2OMOA 1QTMA 4I64A 4C8OA 2OPPA 1UJ5A 2HS3A 3BZQA 1TL3A 4YB7A 4ICLB 4JUZA 1B4SA 2E44A 4J37A 2FYXA 2XZDB 3UFCX 3QLHB 2BANB 4NCGB 3DCAA 3C46A 2IM2A 5IZHA 1VYAA 2XMTA 3ILJA 3RJMB 2WONB 3MCMA 2F8MA 2GX8A 4DUTA 1UEUA 2DVIA 2GW8A 2ZKTA 4I6YA 4Y2MA 1M90T 4F3QA 2GMHA 1U0SA 2ASDA 1H2VZ 5DG7A 2QLBB 4NZ7A 2B7BB 5EWFA 4NLWA 1UETA 3UDVA 3BS9A 2B4PA 4NLXA 1FA0A 3V4IB 1YLXA 4JI8F 4NXNJ 1IWAA 3T6BA 3OL9A 4LF4J 4K4WA 5AJ3F 3OUYB 1R0AB 5KFDA 3UCGA 3U1LA 1PYSB 3JB9k 1S99A 3RTVA 4X4NA 5DGAA 5A0YB 1IKYA 4CLSA 5LJ3Y 2QYCA 2KJWA 5HK4A 4BLGA 2F7VA 1FF2A 1NB2A 1DJ0A 2ASYA 2FTRA 2NQPA 3LP2B 1CJUA 1EX8A 5BR8J 4DBQA 4TKTA 4IH6A 2XB2D 2CJAA 4DL3A 3RBXA 4WU3A 2KXFA 4JB8B 1M5PC 1OYEA 2RU3A 4C11B 3H5SA 4UOHA 1IVZA 4Q5VA 3PX0A 4OI0A 3VAFA 1R0CB 2YWEA 2F4VJ 3HKZD 1EETA 2DHGA 2LU2A 3DFEA 1RTJA 5H9EJ 1X8DA 2D9OA 2VFUA 2HFSA 3LANA 1FTRA 4B3MF 4Q43A 1WOPA 1VBKA 3OHBA 3SEOA 5C42A 2EFNA 4EZ9A 5KFPA 4KPYA 5CD4H 1N36F 4PQAA 1VQ7S 1VIXA 4PR6A 1S6QB 5B0BA 4FXDA 3D1QA 4PXDA 5IWAJ 3PW5A 5CYJA 4DR2F 3DYAA 2VA2A 2HNDB 1BQNB 4WFNQ 5T14A 4HHJA 2B4OA 4KY3A 2ZH4A 1DAXA 2DNGA 4KO0A 3OR2A 1Q5VA 1RT5A 1N5YB 3CT9A 4FPIA 1B99A 3R1HA 5HJYA 4ZCKA 2VUGA 2QMXA 1T9WA 5K8PA 2Q6CA 1J5EF 4F3MA 5CQGA 1FFGB 4ECRA 3G8QA 2XHCA 5B7WA 3Q8PB 2R2SA 1P9QC 5KFWA 1C1BB 3OV7A 1ACMB 4WYWA 2DGTA 2GVZB 3KYLA 1S4EA 2V50A 3AOBA 4RW8B 2GQQA 2RF2A 2WSEC 2HVDA 3MZIA 1FDBA 2VQEJ 3MM8A 2Z2YB 3A12A 5DDPC 3T5HA 4OYOA 4LT6A 3DRYA 2RNEA 4HACA 4QQBA 1OYDA 1JLQA 1TFWA 2AZ3A 1QY7A 1NSQA 4WCEQ 1HBOA 4PG5A 3VCDA 3D7SB 3KUHA 4JI2J 2FZGB 1DLOA 2WOMA 3UD4P 3D67A 2RUGA 2V8PA 2IAJA 2IRXA 4OIXA 4NRUA 4CO1A 4GKJF 4DCJB 1Q78A 5HVFA 1ZZFA 4UY85 2HNYB 1HARA 4MK8A 3TANA 4L74A 4CM0A 1XR7A 4RW7A 2HAIA 4LVOP 1WELA 5HP1A 5E41A 1LXJA 1IM4A 3ZFVA 4IR1A 3UN5A 1JLBB 1Y9OA 3D5MA 2H4YB 2Z4PA 1IKYB 2C2OB 3DRSB 3P3DA 2K06A 4OHVA 4FN5A 5CYQA 4ZPDA 2G0CA 2W2QP 3SCIE 4OYAA 3CE8A 1TK5A 1NK0A 1LWCB 1H3DA 3HHLC 5ETLA 5K8NA 4ZVGA 1L5UA 3IP0A 2JC1A 5L9NA 2CNKB 2RIJA 2F4FA 4YB1P 4ZPCA 4C3LA 2MHEA 2NUHA 3US5A 3OL6A 4QBUA 3DRPB 3D1OA 2VG7A 3G2XA 3N5BA 3I6PA 1R8AA 3FCVA 1AZSB 1GQEA 3EVOA 3UCZP 1T02A 4CT9A 3FZBA 2VG6A 3TJAA 1H2TZ 2GIFA 4KC5A 3G9CA 1OSDA 4OZ2A 1RAJA 3C3LA 3KLGA 1RTJB 2BJ9A 3TZZA 3V4MA 3NS5A 2W9CB 2DH8A 1K9MT 2V2KA 1VQ6S 1QAXA 3GFYA 2MQPA 3SCKE 3T9NA 2QA4G 2LEBA 1NNDA 4HVZA 2UVUA 3RR7A 4DQSA 1HBMB 3W64A 2XTJP 3W61A 3SSRA 4MKBA 1ZOTA 2HBQB 3UVJB 1L3UA 2JEIA 1URRA 4MFBA 1HHTP 3O44A 5L1LA 1VJWA 2HQIA 3NL0A 3OD2A 2DGSA 1S77D 1N5QA 4NI2A 3M2UA 1PKUA 2FC8A 2HGLA 4YP3A 2RS8A 4JI5J 2Z30B 2C3MA 3DGPA 5HBMA 1VOMA 3CJ4A 3N0VA 1VRTA 1FNMA 1T9UA 3NCRA 1Q5YA 1FRKA 4OL8A 1U25A 2DXDA 1RHKB 3I82A 1NUEA 2LQBA 3J81j 1DFDA 1RDRA 2QV6A 2X7IA 2MGZA 2OP5A 3CCUS 1LWEB 3DLEA 1S1UB 3H2LA 3RU0A 2BJ8A 2A2DA 4EK2A 4URSA 4OI1A 5ETRA 4LF9F 1HPZB 5G0RA 1U1NA 2DEIA 1RHJB 3PJXA 1MN7A 3M8YA 3WIUA 3R5GA 2V4QA 1SB6A 5M2UA 3RW7A 3N6LA 1UEKA 1Z4UA 4OJ1A 1C0TB 4FYVB 3DN9A 3C2PA 4ILLA 5T7LA 2X1BA 1YX2A 4LRCA 4DF8A 2HQGA 4X66F 4I0WA 2AX0A 4HH0A 3CDWA 4IH7A 1UWBB 3M2RB 5GMEA 1TELA 2ZHOA 2IMWP 2FHJD 1DLOB 5ETVA 2WOMB 3KHLA 2KH9A 2FHOB 5F3ZA 3T1HJ 1HNIB 3KK3A 1RTHA 1IXKA 4ZVEA 2YKAA 4Y2AA 2QSWA 4ZPBA 2UVVA 2WSFC 3G71S 2C3UA 4KGMA 1Q79A 3RYLA 1RBOB 3R5JB 1U8WA 3I9ZA 1K1SA 3OTBA 1P9YA 3PHTA 4HT7A 4RWXA 1X60A 1JLAA 3QIDA 4YDDB 4HI1A 3DU6A 2DGVA 1M1GA 2H5EA 4TQSA 2RRBA 2LA6A 3SV3A 4ZCMA 5F8IA 2XMAA 3MOJB 2VBXA 1HI8A 5KOWA 1Y00A 2YNIA 2V68A 3JYTB 3KWMA 3D68A 2R42A 2W7OA 1UZHA 3H42A 4DI6A 2GJFA 3BBCA 3T1YF 2BACA 1O8BA 4ED4A 1CS4B 4NLYA 1NKEA 4AT1B 1U7LA 3ZNUA 1Q4RA 1RYSA 1LW2B 2J7UA 4L75A 4PCQA 3C6UA 3UWTA 2HWTA 4QR2A 4JV5F 2M7SA 1XMQJ 5D4NA 2IVFB 3GIIA 1DBDA 1V3ZA 4HTIA 4DX7A 3TUJC 3VVUA 3U02A 2OPSA 1YZ7A 1U2FA 4DV5F 4JI6F 2DR8A 1U1OA 3HJVA 4M95A 3H98A 3IA0A 3PEHA 1FKPA 1XBWA 1M1HA 1TKZB 3MURP 1J5OB 3PACA 4ID5A 3KLGB 2CQPA 2E9ZA 1E6YA 2RQKA 3T5JA 3UDLA 3RUBL 1WF0A 2OO4A 3M8ZA 4DR4F 4YR3A 3OVBA 2LCWA 1VJQA 4PXEA 1H7WA 3EVWA 4CCHA 3R2CJ 1RT6A 2B51A 1IM6A 2J9CA 1X9WA 5KFRA 1WF2A 2PMZD 4O23A 1EP4B 1NO8A 4MFBB 4N47A 8RUCA 3DKDA 3R1LA 3MM6A 4ZIVA 2DJWA 2V4JB 5ETOA 3KLIB 2JEGA 2CQ3A 1F1BB 4DQPA 4YFUA 2W8LA 3LF0A 2WW4A 3QO9B 4WYLA 3FEXB 5MLCV 4XPCA 3W9IA 4YB6A 1Y5NB 2QLJB 3GYNA 2VFTA 1R27B 4DUZJ 2MGZB 1UFKA 2YY3A 4Y65A 1VDHA 3UN2A 2ZVIA 1Q82T 4R8UA 4WE1B 5KG3A 2DR9A 3K0JA 1RWXB 4IO1A 1YQHA 4LSLA 2OI2A 3I4HX 4EUVA 4DV1J 4N56A 1YK9A 4JP8A 4KB7A 4E8UA 1KOOA 5A8KA 2CZ9A 4NEZA 1RTIB 3DOMB 4WKYA 3LW5C 3OFHA 4X65F 3MWBA 1CJTB 2DR6A 2G1DA 5LOQA 4NE9C 5LM7E 2UUWA 3H5YA 2J9EA 1B0PA 3GLJA 2W24A 2F1FA 1T03B 4F04B 3DI6A 2ATCB 3AHPA 4TLQA 5IC4B 3OVSA 2EEYA 1EARA 3O3LA 2K3KA 3MMAA 4O3SA 1U6BA 1JXLA 2HG4A 3KK3B 4Y0FA 1RTHB 3BN7A 1HL6A 2F3JA 3TQ1A 5IT0A 1X7VA 3ISND 4B08A 4JI7F 4YN3B 2IY5B 3VTIA 2UUAJ 4QU7A 1M5KC 3CCQS 2HEKA 1AUDA 4FXVA 1EQ0A 2ZBPA 1U6ZA 2RB7A 4N8OA 2FIUA 1IWGA 4CNZA 2C22A 4B9MA 4ER8A 3IG1A 3RB4A 1VC6A 3DLKA 1JLEA 2ADCA 1C0UA 3UO0A 4JI0F 1A7GE 4TN2A 1WSRA 3CWJA 4Q2MA 4ED7A 2HFOA 1FE0A 2FHKA 1UP1A 3ZTSA 2XEXA 2BM1A 3H4BA 1A9NB 4J9NA 2XULA 5J2PA 3C6UB 1P1TA 1NZAA 2ZH5A 4ZCIA 4NLDA 5DGBA 3HF5A 2GV1A 2E66A 2JVRA 2BJDA 1NH8A 1HIYA 5D4PA 1GMUA 4DMZA 3CD7A 2RQMA 3J7YU 1RACB 5H9FJ 2AJQA 3DM2A 4G6VB 3V81B 4I1TA 2MQMA 1BE4A 3FJ2A 2WSCC 2MKCA 3QT6A 2KU7A 5GMKa 3JS9A 4KT0C 3NOGA 2ZEJA 1CJVB 3Q8SB 4ED6A 2OEMA 1KTVA 2XS7A 4NL5A 2BJ1A 3EJMA 1TVRB 1S1VA 4DG1A 1F3VA 2Y3YA 1SL1A 2J5AA 5C5JA 3OXLA 4DV7F 4Q0BA 4B3SF 2J6UA 3GR1A 2UUCJ 2FGOA 1UWAA 3EXYA 4ID8A 1RYRA 4DSEA 1LWFB 4NEYA 4F3OA 3TUZC 3RB3A 4R5PB 3CXCR 2Z2LA 2YQ0A 1HR0F 3LALA 5DETA 2F9JA 1NU4A 2J9DE 4F0MA 3RB0A 3AD9C 3N6NA 3CCLS 4B3RF 3LPYA 4WFAQ 2XGQA 1Q86T 2E29A 1UFWA 3QGPA 5IQ6A 4M5GA 4CLKA 3K59A 1S4FA 3EZUA 1XNRF 2D69A 5FDLB 3FSIA 4LSLB 5C24B 2L08A 1CQNA 1F9EB 3HT0A 3DHWC 5J2NB 5IS2A 4DU8A 1WG4A 4ZP6A 4PG6A 4P6QA 3HSJA 2OPRB 3R6LB 3W60A 4RNHA 2PMWA 2P6TA 1JJ2R 4C8ZA 1PO6A 4ANEA 1XQIA 4RNFA 1NKCA 3H4DA 4ERDA 4O3NA 4AUKA 5A76A 4E98A 4FVCA 1UVLA 1NLKL 3DI6B 3GSDA 3MMAB 4UW2A 3AOAA 2DHSA 2F5GA 2MZSA 2B0GA 4OHXA 4DWIA 3IO1A 1HQEA 1UPMB 1X4CA 3D66A 3OTOF 2GHPA 5KFKA 4J9QA 2OELA 2NXJA 1QSYA 4CLYA 4PUOA 1Z2ZA 3MR7A 1OQ6A 3CJ0A 3CJ3A 1JJ4A 4WFYA 4ZJLA 4LF8F 3HHEA 4DPYA 2HRTA 5ETQA 3S8SA 2QC3A 3F56A 4H4KC 9ATCB 2HBRB 4M94A 1F5BA 5KFIA 1FDAA 4HT5A 1UZDA 3KLFB 3O8WA 1JLEB 1NCLA 3QATA 5CCLA 1YIJS 4A8OA 5KFXA 4DPXA 2BKNA 1Q0NA 2NSCA 2VJVA 3CCVS 2M52A 2B4VA 1X4DA 1KNZA 4ANCA 4PWDB 3R6GB 3G6YA 1T11A 2PEBA 4I7FA 4F8RA 3R9LA 1R43A 4I56A 3DRRA 4LMZA 4Z7CA 2HBZB 2DPIA 3BR9A 3EE3A 4LF6J 2HRYA 2QL9B 4OX8A 4CLPA 3LGNA 1AFIA 1RABB 2R3VA 5K14A 4WF9Q 5JMNA 1KKHA 2MDAA 4CIOA 4ZVSB 2E1PA 3FMBA 2VFVA 4DLEA 2J8SA 3TEHB 3CD0A 2X1AA 1LNQA 4YR2A 2ROPA 3KUGA 2C2KB 2JNJA 1S10A 4X4SA 3GZ7A 3K8WA 2OAUA 2P9CA 1S1VB 1TKTA 2WVCA 1KWMA 2AYBA 2HBYB 2XY5A 1S1WB 4JI4J 1CPZA 5KFHA 1R0BG 4F36A 4DV0J 2BR0A 3CD6S 1Q8LA 2J76E 2W4DA 5B09A 2W1BA 2ZC4A 3MAHA 5F0UA 5KFOA 3DOKA 3CMAS 2A10A 1PBUA 1UTAA 1VI7A 5CH7B 2CPFA 1MROB 3AQPA 3ZNJ1 1N33F 2VDHA 5KFCA 2B9YA 1WEYA 2FJEB 2UZAA 3V6JA 2MTLA 3TUIC 3B6BA 3VGUA 5JXSA 5DG9A 4L3NA 1CULB 3K5NA 1I94J 3E01A 3VHQA 1AROP 4F67A 4Q8EA 4OX7A 2VPZB 2P9EA 5KFBA 2XYGB 4ZS6A 4A47A 2J9DA 1XMBA 1PC5A 2XLIA 1VBXA 4LF5J 4N77A 3MMCA 1KQFB 3TVKA 2JDJA 3RBEA 2QG9B 1GMWD 4IFVA 2HHSA 4O4GA 3W2VA 4LSNB 3HSGA 2VZ9A 4Y28C 1V5IB 2KI2A 1FERA 2ZD1B 1Y0HA 5IV4A 2DGUA 3CJKB 5GAEI 1WC5A 4NLOA 3W5XA 2CJ9A 5HROB 1UVMA 1MU2A 3LH2S 4RBUA 3MXHP 1FKAF 2XMKA 2LXIA 3CNQP 1NK4A 3CJQA 2QTWA 3IGVA 2FVCA 4GO5X 2H54B 2AT1B 2ZH8A 3EXCX 2FJBB 4NXMF 2CXEA 3HD1A 1SC3B 3QGHA 1OQ3A 2G9OA 5GAHI 4ELUA 2H65B 4OFZA 2HVZA 5J1PA 1AFJA 4DL6A 3FFIA 4USKA 1U4BA 2B9WA 4Y3CA 3M8WA 2C2DA 2DRAA 1FFWB 2AW0A 1WD6A 2G2OA 4TU9A 2PD1A 2XWXA 4TNOA 4C0HA 2YKNB 2JEFA 2V8DA 3PTWA 1VC5A 2B8QA 5DQHA 3P45B 2LVWA 4IKAA 1ZAXA 3CMQA 3KNGA 3BO3A 2UXDJ 2F63A 1U6FA 2R8JA 2ERRA 2CDRB 2VBWA 4DR1J 4EI2A 2W9BA 4J9RA 1CC7A 2BBEA 1TZ0A 1SKWA 2UUTA 3TZWA 5KG5A 4I7FB 1YDLA 2WBRA 3HFVA 4TQRA 2HIQA 4U8YA 3NBPA 2ZITA 4QPXA 3DDNA 4WPAA 5CZXA 2DNKA 2DNYA 2HLTA 3DXBA 1RT7A 3D6FB 1VMBA 2PI5A 1NH7A 3NY0A 4HH1A 4WK1A 4B17A 3I0SA 2GIRA 3PKMA 4NA1A 5KFVA 3KK1B 3THVA 2HHUA 2JVOA 2EC2A 2G13A 1H72C 5GVQA 3OSNA 1TL5A 2DCUB 2HQCA 1XR6A 2AGQA 2RHSB 2MKKA 2CNLB 1R6VA 5KG1A 4QZVB 1QLNA 1PCAA 1RWMB 4NLQA 2Y0SD 5K8MA 1RT2B 4C8LA 4DOZA 4J9PA 1FJGJ 3DOLB 2VG5A 5KTQA 2VD3A 1KHWA 2UXCF 1FK9B 2KRBA 4JYAF 4P7VA 3FMWA 4PYDA 2K7KA 1JKHA 2AIRB 3NOCA 4IQMA 3E01B 2AJ0A 4X62J 1WTFA 3G4SS 1T3NA 1Q8IA 2CG8A 2EFQA 2MQQA 1X5SA 4DL4A 3OBIA 2W4CA 2CQIA 1VLYA 3Q2TC 5J2QA 3QT5A 3BGOP 3M4XA 5JJBA 4IFYA 2YNGA 3KMSA 3R27A 3CCTA 2GAGC 2DIVA 3M8RA 3HHLD 3HFKA 1JLFA 1NDKA 1BQXA 2VU5A 1AB8A 2OH2A 3KNAA 1PYOB 5F8MA 2E5JA 4EYIB 2ZC3A 3VZHA 3A4TA 4G1IA 4LJMA 3LP0A 4QW9A 3BGUA 1FKOA 1S59A 2NPIA 2MLZA 3HVAA 4R0EA 3K7RA 4K4TA 3LPEA 4D3GA 1IBKJ 3C19A 1NKBA 3SQGA 4DF4A 1WI6A 2RS2A 4MT1A 3Q2SC 4CO2A 3HFZB 3ZO7A 2ZZTA 5F8NA 3HD2A 2J6SA 4A8SA 2YVSA 5DQIA 4N41A 3TOQA 1SCJB 3TA2A 3FRYA 3KOAA 3C15B 2BX6A 2H5IB 2NCKL 4KHRA 1U26A 2BE2A 2D74B 5GAHU 2DNNA 3R8YA 2HQDA 3R7NB 1PIEA 4KAIA 4C8MA 3M8PA 1VQMS 1XNQF 4USMA 1FDDA 3MPVA 2AEFA 2ZH2A 1FCAA 1RBLA 2O66A 1EB0A 2MZQA 1QM9A 5KFGA 2EI5A 2YNFA 5G4DA 3NLCA 2ZM6F 3J7ZT 3PR5B 1XMOF 3VWSA 4QIWD 3NNAA 3W7BA 3BGLA 1S6PA 2COLA 4DN9A 2HNZA 5D4OA 3V6DB 1UMJA 2YX4A 4F4ZA 1VBYA 2NYHA 1SIZA 4MK9A 4W92B 5D0EA 5IC6B 4O3RA 4A8FA 1NEEA 4LR8A 1NJIT 5CHCB 1LQ9A 4OMFG 1DZ5A 5KFLA 2E9TA 3TR5A 2ZH9A 2Z8QA 1WEZA 4NPOA 4WKRA 4ZVQB 4X4UA 4A8XA 2VB6A 5KOXA 4PPZA 2ZE2B 1DTTB 1LWXA 4RU2A 3CIZA 5BYQA 2KYZA 3OTDA 2OD4A 3M6WA 1K1QA 4KGVB 4C9DA 1MN9A 3KDNA 3HT3A 3AT1B 4K50A 1RA6A 1U0HA 1RT4A 2OMLA 3MM5A 5H1SV 3B4MA 1CSJA 2HPUA 4FBUA 2XM3A 2LXFA 2FVSA 2VASA 1FJEB 4FXWA 2KZMA 4ZVUB 2OKQA 4DHVA 1S6UA 4I67A 1HBUB 1BY9A 1V5VA 5C25A 5J2MA 4Y2CA 2DNZA 4WIIA 1YWXA 2ALZA 5LMUJ 1JXEA 2YNGB 3FK4A 3WX8A 4TVAB 2DKOB 2XS2A 2BE9B 4ECXA 2GQCA 3QRRA 1SI9A 3KLVA 1XK8A 4U8VA 5I3UA 1Y10A 5HVHA 1D9AA 4DJBA 4A8WA 1JLFB 3UI3A 1NSAA 4I6AA 1TR0A 3M8SA 4JI8J 4QWDA 2C2MB 2EKNA 1S9FA 1U1QA 5DM7Q 5LMNF 5DZ6A 3SFUA 1JXVA 5E2QA 3CPWR 4NXNF 5J1NA 4CTAB 2CIMA 3CUNA 4F02A 1SC4B 1KQSR 2XZTB 4FNIA 2BUNA 1H7XA 2CJXB 1SPBP 4EZ6A 3PYDA 3ENWA 4K2XA 2K1RA 1V6HA 2OD6A 3H25A 4UUWA 1WC6A 1WOOA 1QSLA 1VRUA 2F9DA 2MSSA 3T5LA 1NXIA 5AT1B 2V2QA 4RL1A 1X4EA 4K4XA 1LK5A 4ZIWA 1N32F 4C6AA 1UCNA 3KJNB 1JWWA 2C2EA 1S79A 1VQ8S 3SYZA 5D6GA 4ZPTR 4I69A 3FCWA 2I5JA 4C48A 2BJ3A 1N8RT 2RSQA 2YNHB 3UPFA 3RB6A 3SCJE 3EDRB 4DX6A 2JH3A 4CH1A 2FUG9 1SQEA 4IDKA 1WOSA 4B3MJ 3MCOA 3BQ0A 1FEEA 2OSRA 4UQTA 1WUUA 1K0TA 5AE2A 3DHXA 4Y00A 1N36J 3MR3A 3Q83A 3B54A 2ACYA 2HMIB 3QFHA 2EW9A 3G86A 3W2WA 3AOCA 1U49A 1VQOS 1VQ5S 1FWKA 2BM0A 1RE1B 5IWAF 1JLCA 1N0UA 2QGFB 1YGYA 1KOHA 1B64A 1C4CA 1NJYA 3IS9A 3KJVA 3M8QB 2XCAA 4F50A 4YOEA 3BREA 1H0HB 5KG0A 1APSA 2GZOA 1U09A 2IJRA 4PWWA 2JSXA 1YBUA 2QSFA 4PEOA 4PXBA 4CT8A 4XTTA 5KFYA 3QZ7A 2P2CB 3U7JA 1FFSB 2DGWA 2XMUA 1RBAA 4J5OA 4H4MA 3MECB 3HHLA 3PG9A 5DG8A 3LAMA 3I5CA 2HKEA 2H1YA 3MD3A 2IRYA 1GK8A 2IM1A 1WKJA 4BCAA 4NLRA 1FXLA 3BGRB 3GG1A 4I2QB 3BSAA 3M6VA 1MLAA 2AJ1A 3BSNA 1WDDA 3M2VB 1KLMB 3C6TB 2VQEF 1WNEA 4X4RA 5E3CA 1F9HA 1W2BR 1TKXB 4LF7J 2ILYA 2J0QD 1S0VA 1CJKA 4FPRA 3GJRB 2J8AA 3PXGa 2BMBA 3OW2R 1K73T 4GKJJ 1QDUB 1NJXA 3DLLQ 1XEZA 5D8HB 4ZHRB 4GC7A 4H4OB 4ZJOA 3IM8A 4CO5A 3AB2B 3PJWA 5D0GA 4BC7A 3N4WA 2NS1B 2XCPA 4EO6A 3MPWA 1JK9B 4TY8B 3AJ1A 1E6VA 3VGSA 1KEKA 1HFEL 3F44A 1ZS6A 4KKOB 5D4LA 2D3ZA 4OJ3A 3K89A 1U1MA 3AJDA 1WC0A 3H7HB 1Y7PA 3K5OA 1OO0B 4B3TJ 4ZKAA 3D3BJ 1IQTA 5A8RA 4TYAA 3LGHA 2HWHA 4AFFA 2YKOA 4IOAQ 1ZM9A 4IO9Q 5M2PA 4O44A 1DHMA 1T3OA 2QMWA 4DPUA 4I2PA 2M70A 2EFVA 4OZ1A 1SJFA 3UE2A 4K4SA 2D3O1 3GQCA 4B9NA 1UAWA 4EFAC 3GIRA 2HHWA 2AGOA 4JI1F 3GJSB 1GXTA 4WXWA 3PZPA 3QSYB 2DNRA 2HVEA 2E7VA 3IN5A 4AL5A 2Z57B 3MM7A 2O67A 3MEEA 1N56A 4XO0A 3CCSS 3PEJA 3WDOA 3I55S 1R8PA 2HS4A 1DY3A 3Q8UA 4QWCA 4PPDA 2DO0A 4NOHA 5HAOA 1S97A 5LXYA 1OIAA 4KE5A 3DU5A 4M5IA 2VONA 2MZRA 1PJ7A 3G8TA 1HNZF 2F8HA 1JLCB 3T41A 2G4BA 4F4AA 4KYZA 3O5TB 4WJBA 4DV3F 2AGPA 4L73A 3W65A 2LEAA 2HHVA 2FHMA 3CJRA 1RT1B 1S1TA 4BS2A 3A3OB 2QLWA 2GVDA 2V8GA 4NA2A 2C1EB 2CNOB 1Q81T 2JLFA 3ZZTA 2GGPB 2IDEA 4MKAA 2LDYA 1KVJA 2KFYA 4LF9J 1RQ0A 2WVEA 5CD4A 1ZM3A 2H9ZA 2KN4A 3EGNA 3MMBB 4N8NA 4QIEA 2N7YA 5H9EK 4ICLA 5HMWA 2DO4A 5KFUA 1HNWF 3ILIA 4N76A 1YZ6A 4DDFA 3ONQA 3QLHA 3Q8YA 4DQIA 2BANA 4NCGA 3VZIA 2DXFA 4B9SA 3VALA 1UVIA 4DPTA 2UV8G 3SV4A 4LFBJ 2PSZA 4X66J 1TAUA 3CJ2A 2DGOA 1AA1B 3NRBA 3RGIA 4DZDA 3ETOA 1CJKB 2QA4S 2R2RA 1R8BA 2V34A 4OYBA 4Y2KA 4HYKA 1HI0P 2LMIA 4NYPA 4WBFA 3PKYA 3C14B 3OXGA 3OSPA 3LGMA 4S0MA 3HK2A 1Q53A 2IC3B 4QPTA 3T1HF 4FF4A 2DHXA 3V4IA 1WHWA 1GH8A 3OUYA 2V6AA 5ITHA 1R0AA 2CVEA 3AJ2A 3W5YA 2AV5A 1WC1A 3BQ1A 1N6QB 3VAJA 2L9DA 4WFBQ 1XR5A 1RXOB 5A0YA 3F0NA 4KFBB 4ZP9A 4YY3J 2EFGA 3ZZYA 3ULHA 4CLTA 3A3NB 4FYYB 4JV0A 1K0VA 3T1YJ 3EUNA 1PG5B 2I8EA 1HNVB 3PY8A 2E5HA 3LP2A 2OLWA 4OLOA 1YJ7A 1ZBTA 3BYPA 2CVIA 1TL1B 4GO7X 3POTB 4K5SA 1NK5A 3NAHA 3QNWB 2HQ3A 3PW4A 3BH7B 4DL0C 4Z37A 3FZ2A 2WVFA 3VQSA 2MKHA 3ENAA 1BQMB 4ZCLA 3HP6A 2ZUAA 1NDCA 3B8HA 1TV6B 2CPZA 2LYVA 2LQJA 2AYMA 4ZN3A 5AE3A 2R8KA 4C11A 3FSYA 2MJUA 3NGTA 1KS2A 3FQLA 3KUEA 1N34F 1YJRA 2Y1LB 2CQ4A 3CCMS 2X3GA 4OZ3A 3QJLA 1R8CA 1ZZNA 5L8RC 4DR4J 3D0IE 4V19J 1YG0A 4DV4J 3JTPA 2DR5A 2KHDA 4LQ9A 2HHQA 1S6QA 3LP1B 1YRTA 5GADU 3HVTA 1SC1B 1BQNA 1JLGA 1TUVA 3NEKA 1L3SA 3ISZA 3JTNA 2JRSA 1ZTTA 1BWVA 1PC4A 2IIHA 2UU9F 3CJ5A 4ZITA 2RQCA 2LDIA 1IKWB 1JNRB 3TARA 1HD0A 1YRUA 3R2DJ 4U7CA 4C2MA 3P6YC 1ULRA 4CDIA 2KM8B 4DUZF 1C1BA 2MLYA 2R7RA 1F5AA 2GVZA 3M6UA 1CQMA 3Q8VA 4RW8A 1DQ8A 4HEA9 1T95A 1SUQB 3RG6A 2ROEA 1B70B 3AA9A 2ZHBA 2WCXA 3J80Y 2CQ2A 2DNQA 4DV1F 1OY9A 1IR1A 1TAQA 5KFTA 2BW7A 1REVB 3MI7X 1IR0A 2RU9A 1FESA 5AXKA 2HW3A 1RU1A 1Q8KA 3Q8QB 4DV6F 2DNHA 2EBEA 2JFDA 2W8KA 1S0MA 2DRBA 1LW0B 3U27A 1WHYA 3M9OB 5E3PA 3T3FA 5LSRA 2I38A 1D9DA 4FKYA 3R7SB 3TO8A 1X4FA 5FD1A 4P10A 3BYRA 1HD1A 2QE5A 3BPDA 2HNYA 2B7CB 1Q1KA 4JI7J 3OR1B 3EMTA 5I3PA 3BB5A 4CO4A 2DHHA 4WP9A 4OV6A 2WAQD 2ZBRA 4IYQA 4MIAA 1JLBA 3E51A 1TL7B 4RR5A 4PYAA 4CZCA 3DRSA 2P6SA 4HLBA 3QAEA 4C8NA 1B0TA 3IAS9 4MK7A 1RAOA 1YRXA 4K7QA 5EGYA 5HQ8A 4DUYJ 1N54B 2HK2A 1S57A 3TRGA 4F2RA 2F65A 2HVHA 1O6XA 3BKFA 1LWCA 1K44A 3HCXA 1EHWA 1RAAB 3O1LA 2KXHA 2YWGA 2CJYB 3JQMA 3DRPA 2WW8A 4LSZB 2FC9A 2MY8A 1IBCB 2WZ1A 1HLWA 1AZSA 1FWLA 3CD5A 1M5VC 1S0NA 1VQKS 3OLAA 2HHXA 4P2XA 2XYPB 4I4BA 3IR5B 5F8GA 1CG2A 4UZCA 3AFGA 2ZZMA 1JB0C 3HZGA 2W9CA 2FGCA 3K2YA 1RT3B 4RWWA 2ZBIA 3D0GE 3L7UA 4Y2IA 4DV7J 3OTCA 1YHQS 3NAIA 2M0GB 2BQRA 4MIWA 1HBMA 5A6PA 4LFAF 5A8WB 4KQZA 3AY0A 3I31A 1T9YA 4Q44A 1KR4A 4LBIA 4LREA 3UVJA 4TU7A 3BV8A 5KFAA 3HVTB 4OX9F 2UUCF 1JLGB 1S76D 1HQ2A 4GMKA 4C8YA 4PABA 2D1CA 4B3OA 4H4KA 3MPUB 1NHKL 3JSMB 3MMJA 4J9SA 1NAQA 2EWHA 2ZHAA 1WKLA 2FLOA 1PJ6A 4B3RJ 4Z7YA 2AEJA 2MQNA 3BJYA 1LWEA 1KHVA 1S1UA 4LQ3A 2C2RA 3UD3P 4OQJA 2HYIB 1IJFB 4ED0A 1HPZA 2HSEB 1NPRA 1RTDA 1NZ8A 1G2EA 3QT7A 2JLEA 2CQBA 4F2SA 2ABYA 5A6WA 3K5MA 2IRUA 2CZVC 3K57A 4KSEB 3NCPA 4GRSA 2AMCB 3IXQA 1C0TA 3RW6A 1IKXB 5KFFA 1V3SA 2A1BA 4QYZJ 4X4VA 1TU0B 3KG1A 4A8YA 5GAGI 1TFYA 3V2UC 2VKZG 4DL7A 1UWBA 2WVDA 1MG7A 3M2RA 2JJ4D 4WFZA 2DB1A 2HGMA 3IWXA 4HDHA 3NGSA 1RLDA 1TK8A 4O0IA 1HHQA 1HNIA 2V0NA 5JUMA 4EWTA 5BXIA 1VQSA 3CDBA 1OJ4A 3FCHA 2GS8A 1HHSA 3O6QA 2VFRA 5KT3A 2GC8A 1VIOA 1YJ9S 3BPSP 4LF8J 3C66A 3IFEA 1FD2A 3KJQB 4DR3F 1VK8A 3CDUA 1P8GA 3JYTA 1NK8A 3A1YG 4DXLA 2N7CA 2VF3A 1KC8T 4DS4A 3ET6B 4ZDNA 3X1LB 1CS4A 2BV3A 3PO5A 4YS2A 4RU9A 1TUWA 3RRKA 2ZNZA 3KK2B 5E0OA 5BYRA 2DXEA 1LW2A 2HFZA 2QJ3A 3OVAA 4RLEA 2MB0B 3MCNA 2HGNA 4IG3B 2KKHA 3CEDA 1EQMA 3GFXA 3H90A 3JXOA 4CI0B 3CCJS 5AE1A 2IA6A 4GVLA 4YR0A 1I3OB 4YQWA 2WB1D 1M1KT 3J80U 1N48A 2RDDA 4UUXA 4A8MP 2AJ2A 4LF6F 1RHQB 1I5OB 2CUYA 4K8RA 1TKZA 4UTGA 1J5OA 2IBOA 2M8DB 2VBZA 3CW2C 3G8SA 2XI3A 4LIRA 2J0SD 2ASJA 1JJCB 1T94A 2GCFA 4M5HA 4DFPA 1F60B 1M5OC 5E3AA 5ETMA 2YWWA 2YPYA 2QN6B 2HZCA 4WP3A 1TK0A 2CADA 1RLCL 3KLEB 3DLGA 2DGQA 1EP4A 1WEXA 2JFKA 2NYIA 4IG0B 4J9KA
chains in the Genus database with same CATH topology
2RKIA 2KRRA 3H59A 3QJJA 3P96A 4QZVB 5HMXA 1RT1A 1S1TB 2M9KA 4B3OB 1FEHA 2V4JA 2X51A 1QLNA 1U1LA 3KLIA 1U8SA 4RNNA 4ZP7A 2RILA 4DR5F 4NLQA 4DQQA 3HXMA 3ZZUA 3S1TA 3IWLA 2I2YA 3QZ8A 2Y0SD 4AXJA 1RT2B 5K8MA 2GGPA 4C8LA 3DNCA 1UL3A 3MGJA 2BW2A 1ZPVA 1T05B 4IQXA 4DOZA 4JOUA 4J9PA 2FHJA 1RA7A 3QO9A 2N4CA 4X64F 2OMOA 2PMHA 1QTMA 2DT9A 4OJGA 2YX7A 3QPIA 4I64A 4C8OA 4OZJA 2OPPA 3MMBA 3DOLB 1UJ5A 2HS3A 4DFKA 1SH2A 3BZQA 3HPOA 2VG5A 1TL3A 2KB2A 5KTQA 4YB7A 4R8UB 2VD3A 4ICLB 1KHWA 2UXCF 4WE1A 1FK9B 2KRBA 4JUZA 4JYAF 3T5KA 1SJ1A 3H20A 4P7VA 3FMWA 2JEJA 1QAIA 2E44A 4J37A 4NRTA 2K7KA 1RTDB 3UFCX 1JKHA 2UVWA 2R7SA 3QLHB 2BANB 4NCGB 4IQMA 3DCAA 3E01B 3C46A 2AJ0A 3BO2A 1P1LA 2IM2A 5IZHA 1WTFA 3G4SS 1NK6A 1T3NA 2XMTA 3NCQA 4YEAA 5CZVA 1Q8IA 2ZJPQ 5A8KB 2GHVC 2EFQA 2MQQA 1X5SA 2WONB 1VQ9S 2CG4A 4DL4A 2BYCA 2CPXA 3OBIA 1N4LA 2F8MA 1S9GB 2M8HA 2W4CA 2GX8A 1UEUA 1RTIA 1Q7LB 4MIBA 2CQIA 3DOMA 2DVIA 5HI7A 1VLYA 3Q2TC 5J2QA 2A3JA 2GW8A 2MY7A 2ZKTA 3M4XA 5JJBA 3DMJA 4XPEA 4I6YA 4Y2MA 4IFYA 2YNGA 1M90T 4F3QA 3KMSA 3LAKA 1VBZA 3R27A 2AQ4A 2GMHA 3CC2S 2MKIA 3CCTA 2ASDA 3NG8A 4NLVA 2DIVA 4MMOA 2AF6A 3M8RA 3HHLD 1H2VZ 3HFKA 5DG7A 1S1XB 3I0RB 1JLFA 5KFSA 2VPXB 4NZ7A 4DS5A 1BQXA 1X0PA 5AXMA 2BABA 2M88A 4X4OA 2OH2A 3M32B 1T03A 3KNAA 3ENVA 3NP5A 1BC6A 2B7BB 4JI2F 4ECUA 5F8MA 5EWFA 2ZJQQ 4NLWA 2E5JA 1UETA 4EYIB 2ZC3A 3BS9A 2IC3A 3VZHA 2B4PA 2DIUA 1KVIA 1FVQA 2PEHA 3MEDB 4G1IA 4NLXA 1FA0A 4LJMA 5HLFB 3LP0A 3V4IB 4QW9A 2VA3A 4JI8F 2CPJA 2LQ5A 2APOA 3BGUA 5CYMA 1FKOA 5J1EB 3T6BA 3OL9A 2FLLA 4K4WA 2PA3A 5AJ3F 3OUYB 1R0AB 1IQZA 1DQ9A 2ZJRQ 1TP7A 2NPIA 3TAPA 3HVAA 4R0EA 5KFDA 3MR5A 3K7RA 4K4TA 3UCGA 4DSKA 3JAMY 3U1LA 4D3GA 5KFNA 3RAQA 1NKBA 1KLNA 1N6QA 1CC8A 3GB0A 3SQGA 1GX6A 4DF4A 1WI6A 3JB9k 2RS2A 1S99A 4FNHA 3RTVA 3HM9A 4X4NA 3H2UB 2CRLA 2RRAA 4ES2A 3Q2SC 5A0YB 5DGAA 1IKYA 4CO2A 3KKFA 3MCSA 4KFBA 5LJ3Y 3PV8A 5F8NA 2QYCA 2KJWA 1OPIA 3H2VE 2F7VA 1HMVA 1FF2A 2J6SA 1SH3A 1GTEA 3J7YI 2LEPA 1DJ0A 2ASYA 4A8SA 2YVSA 3T1AA 5DQIA 1HNVA 4N41A 4QIGA 4O3QA 2XI2A 1GX5A 3IG1B 3TOQA 1DURA 4U9RA 2PIIA 3TA2A 2FTRA 3Q23A 2NQPA 2L48A 1DTQB 1LKZA 3LP2B 3BGFA 4OI6A 3T19A 3DLKB 2CQDA 1C0UB 3FRYA 4WK3A 2P5VA 4KR0B 3MM9A 5B0EA 4DX8H 3KOAA 2Q79A 5E3QA 2OPQB 3B78A 4OJHA 4EEYA 2OTLS 1S9EB 2XY7A 4KHRA 1U26A 4GC6A 1TL1A 2BE2A 3POTA 3Q8RB 2D74B 4MAKA 4DV2F 4DBQA 4TKTA 3TVYA 5J2PB 4AL6A 4IH6A 2YKPA 3PX6A 5GAHU 3ENQA 2XB2D 2CJAA 4DL3A 5KFFA 2DNNA 3SSSA 1IN0A 2N3OA 1HW9A 2KM8C 4KAIA 4UOCA 4EO8A 4NMLA 4C8MA 2KTQA 1BQMA 5E5NA 3M8PA 1VQMS 4WU3A 1XNQF 4QR0A 3QGIA 2KXFA 1QVGR 1TV6A 3PRBA 5L1JA 1M5PC 4H54A 1FDDA 4C11B 2RU3A 1MNEA 3MPVA 2CDQA 1GNKA 1U45A 3H5SA 2R8GA 2OFHX 2ZH2A 1FCAA 1SBRA 2R2TA 2O66A 4Q5VA 3VAMA 3ITHB 3PX0A 4OI0A 2XZWA 2WK4A 3VAFA 3PO4A 2YWEA 3NGKA 5L39A 2MZQA 3HKZD 1EETA 1QM9A 7FD1A 5KFGA 3GIJA 2DHGA 2LU2A 2EI5A 2YNFA 4M5DB 3DFEA 5G4DA 4ZOSA 1Q16B 1RTJA 3NLCA 4ZLPA 1P6TA 3DM2B 5H9EJ 4ZMMA 1X8DA 2D9OA 4RW9B 2ZM6F 3RRGA 2ZH7A 1FXDA 2VFUA 3LANA 3J7ZT 3PR5B 3V81A 1XMOF 2QA1A 1FTRA 4B3MF 4FS1A 4Q43A 2MMYA 3VWSA 4QIWD 3NNAA 3W7BA 3OHBA 3BGLA 2L3MA 1S6PA 3SEOA 2COLA 5C42A 3F73A 4DN9A 2HNZA 5D4OA 4BBYA 3TAQA 3E2EA 2EFNA 4EU0A 1LFPA 5B0DA 4EZ9A 2IJNA 4J9LA 3V6DB 3L7OA 5KFPA 2DK2A 1UMJA 4NLSA 4KPYA 1AW0A 2J0WA 5CD4H 1N36F 2YX4A 4PQAA 1VQ7S 1VIXA 2HS0A 2B56A 4PR6A 4F4ZA 1S6QB 6FDRA 4ES3A 1VBYA 1FNXH 2X1FA 4M63A 4DG1B 1SIZA 1TVRA 2XSJB 4NX9A 5B0BA 3D1QA 3MFIA 4MK9A 3RAXA 4PXDA 4W92B 4FXDA 3PW5A 1UJ6A 5CYJA 4PG7A 4DR2F 3DYAA 4O3RA 2VA2A 2WBMA 4A8FA 3LP1A 2Y1RI 4Q0BB 2HNDB 1BQNB 2QLXA 4WFNQ 1NEEA 5T14A 1NJIT 3I5AA 5CHCB 4HHJA 2B4UA 2B4OA 2ZH4A 1DAXA 1LQ9A 2V94A 2VL1A 4AE5A 4OMFG 1DZ5A 2DNGA 2RJZA 1MMNA 1ROFA 4KO0A 2L41A 3OR2A 5IT9Y 3DLGB 3NS6A 5KFLA 1LWFA 1RT5A 2E9TA 1N5YB 3CT9A 1Y4ZB 1C1CB 4LUBA 2XMMA 2XO7A 2RT3A 3TR5A 2ZH9A 3R1HA 2Z8QA 1WEZA 4R5PA 4ZCKA 2VUGA 2QMXA 5K8PA 4B9TA 4NPOA 4WKRA 2Q6CA 1J5EF 4F3MA 4NLTA 3PW0A 4X4UA 5CQGA 4A8XA 5DQGA 2VB6A 4JI5F 4ECRA 5KOXA 4PPZA 2ZE2B 2E5LF 1DTTB 1IKWA 2IYIA 4QIVA 5DM6Q 4RU2A 4ZPVR 3CIZA 3G8QA 4YDXA 5BYQA 2EG1A 5KFZA 2KYZA 2HLUA 4DEZA 3KHRA 3OTDA 5B7WA 2OD4A 1N5SA 2EBGA 3VAHA 3M6WA 1K1QA 1KQGB 3KMQA 3Q8PB 2R2SA 4C9DA 1D0EA 1Y3JA 1P9QC 2EPIA 5KFWA 1C1BB 3HT3A 3V6HA 2K7JA 4YUDA 3OV7A 4WYWA 4ES1A 2DGTA 3KYLA 3K5LA 4ILLA 1RA6A 4K50A 4RNMA 2DTJA 3SI8A 1RT4A 2OMLA 1UEVA 3MM5A 5H1SV 4RW8B 1X4BA 2GQQA 1KFSA 3B4MA 1NJZA 2RF2A 2WSEC 1CSJA 1SUQA 3GFZA 3MZIA 2HPUA 1FDBA 4FBUA 5FDLA 2LXFA 5KG4A 2FVSA 1F5CA 5C24A 4X62F 2VASA 1FJEB 2QT7A 5I4MA 4X4PA 5D3GB 1ZAWA 3MM8A 4FXWA 3CC4S 1YJUA 2KZMA 3G6VA 2PT0A 2OKQA 1RJJA 7FDRA 4P7TA 4DHVA 4ZK7M 1S6UA 5DDPC 3T5HA 1SJ3P 3THPA 4I67A 1HBUB 3N9UC 4MH8A 1REVA 1BY9A 5FJ4A 5J2NA 5C25A 2Z0GA 4LT6A 5J2MA 4WZQA 3DRYA 2RNEA 4QQBA 4FZVA 4Y2CA 5MAOA 1JLQA 2DNZA 4WIIA 1TFWA 3SMZA 3MEKA 1YWXA 2OPRA 4G1PA 2ALZA 3MAQA 2AU0A 1QY7A 2VODA 3DMJB 1JXEA 3VQTA 2YNGB 3MTJA 4WCEQ 1Y5LB 1HBOA 4OZNA 1RKJA 5HO4A 3AAWB 4PG5A 3OL7A 3HX9A 2RDJA 3VCDA 2XS2A 4ECXA 2GQCA 4XDDA 3NKYA 1URNA 3M9MB 1LW0A 4IH5A 1SI9A 3KLVA 1DLOA 1XK8A 2WOMA 5I3UA 1LV5A 3UD4P 1D9AA 4DJBA 4A8WA 4KV8A 1JLFB 3UI3A 2O1PA 2RUGA 4I6AA 3M8SA 1TR0A 1VFJA 1SL0A 4NLUA 3PDNA 5KT7A 4QWDA 2IAJA 2IRXA 4OIXA 5KFMA 4NRUA 4CO1A 4GKJF 1HBNB 1S9FA 1Q78A 1U1QA 5DM7Q 2QRRA 5LMNF 3SFUA 4WU2A 1T8EA 3CF5Q 4B9UA 1ZZFA 5I42A 4UY85 3H8YA 5E2QA 2HNYB 3EX7B 1HARA 3CPWR 4NXNF 4MK8A 2GHWA 5J1NA 1WWHA 3TANA 3OJUA 4CTAB 5CYMB 2CIMA 3CUNA 1XR7A 4RW7A 1FE4A 4F02A 2HAIA 2HWIA 1HQEB 4LVOP 1WELA 5HP1A 5D77A 5B0GA 4AYBD 5L1IA 3OR1A 3GILA 5E41A 1LXJA 1IBKF 1KQSR 2BOPA 3PFOA 4FNIA 1IM4A 1H7XA 2BUNA 3ZFVA 4IR1A 4URQU 4USJC 4IUFA 1JLBB 2CQ0A 1Y9OA 4ED2A 3D5MA 3GFHA 3DRXA 4PUOB 3EGWB 2ZDPA 1H98A 2Z4PA 2FPHX 4EZ6A 1IKYB 1PGZA 3DRSB 3TW0A 1QE1A 3ENWA 3SXLA 3D1HA 1QUVA 2U1AA 4K2XA 2YKMA 2BZ2A 2K1RA 1HMVB 1V6HA 2D9PA 2KT5A 3P3DA 2OD6A 3MF5A 4OHVA 3NMAA 3H25A 2WTFA 3HHNB 4Q2LA 4UUWA 4FN5A 5CYQA 4ZPDA 4FBTA 2G0CA 1ZYQA 1QSLA 4TXSA 4MJKA 1VRUA 2F9DA 2MSSA 3T6JA 4X2BA 3SCIE 3T5LA 3SDEB 3CE8A 3KLFA 1TK5A 4RW6A 1NK0A 2AYGA 1LWCB 4TLRA 3MM9B 1H3DA 3HHLC 5K8NA 4ZVGA 1L5UA 3D0HE 1X4EA 1F9FA 2GA7A 4K4XA 1LK5A 2OTJS 2JC1A 1OPZA 1N32F 4BWMA 4C7QA 5L9NA 5EUHA 1JWWA 3FVYA 5A2QY 2RIJA 2C2EA 1S79A 1VQ8S 1CEZA 3SYZA 5D6GA 2B3TB 4ZPCA 4ZPTR 2MHEA 2NUHA 4I69A 3US5A 4C3LA 4YB1P 3OL6A 4QBUA 3PX4A 2I5JA 3D54A 5K9FA 3RB6A 2RSQA 3DRPB 1XMQF 2YNHB 3UPFA 1N8RT 2R7UA 3D1OA 2JX2A 2VG7A 3SCJE 2L9NA 5U47A 1SXLA 4RUAA 3N5BA 3VAGA 4FP9A 4QR1A 3I6PA 3N01A 1HWJA 1R8AA 2DCLA 4OI3A 3DRRB 1GQEA 2JH3A 1X5TA 2SXLA 1TL4A 4CH1A 2P9GA 3UCZP 2FUG9 1SQEA 1T02A 3EPIA 2RVJA 2UVRA 4IDKA 4CT9A 3FZBA 2VG6A 2DHAA 1VS3A 1H2TZ 2JL9A 3BQ0A 3LQVA 4XAKA 4B9LA 1K8AT 1FEEA 2XGPA 2I1RA 2MPUA 4KC5A 3G9CA 1OSDA 2R9LA 1RAJA 3C3LA 3KLGA 2ZNYA 4ILRA 4RUHA 2OSRA 3VAIA 1RTJB 4P2SA 4UQTA 1FJ7A 5K14B 1D8ZA 1HWIA 4DN0A 1K0TA 5AE2A 3DHXA 3V4MA 3NS5A 3G6ES 4Y00A 4U6PA 3MR3A 2W9CB 1G3OA 2ACYA 4AQYF 2KDOA 3Q0AA 2DH8A 1K9MT 3HVRA 2V2KA 4KHPF 2MHNA 2HMIB 1VQ6S 2GO8A 1QAXA 1RT3A 3GFYA 2MQPA 4MKYA 3SCKE 2ZH6A 2EW9A 3HLUA 3T9NA 2QA4G 2LEBA 1NNDA 4HVZA 2D41A 3G86A 3W2WA 1S7HA 1U49A 1VQOS 3U1MA 2UVUA 4OZLA 3RR7A 1VQ5S 4DQSA 1HBMB 2CQCA 1DQAA 2BM0A 5IWAF 3I32A 1JLCA 1TKTB 4DR7F 1N0UA 5KT2A 3SSRA 2NUUG 4MKBA 5A8WA 1ZOTA 1FT8A 5B08A 1YGYA 1KOHA 1B64A 1C4CA 1R8HA 2R8IA 1L3UA 1NJYA 3EZ5A 3IS9A 1VC0A 2JEIA 2IM3A 2MXYA 1L3VA 1URRA 4MFBA 3KJVA 1HHTP 3O44A 5L1LA 1VJWA 2HQIA 1S1WA 3M8QB 4Y34A 3NL0A 3UCUP 2XCAA 1OSCA 4F50A 2DGSA 2VOOA 1S77D 1N5QA 3BREA 4YOEA 1Z2LA 1H0HB 3M2UA 5KG0A 2BDPA 2FC8A 2HGLA 4DLGA 1UVNA 1APSA 1U09A 4YP3A 2RS8A 3NGDA 1LXNA 3DOKB 2JSXA 3GG0A 3PFEA 4M8LA 2WRMA 1C4AA 2QSFA 2C3MA 3DGPA 5HBMA