1R27B

Crystal structure of nargh complex
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
465
structure length
465
Chain Sequence
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKPGQGFPTDWENQEKYKGGWIRKINGKLQPRMGNRAMLLGKIFANPHLPGIDDYYEPFDFDYQNLHTAPEGSKSQPIARPRSLITGERMAKIEKGPNWEDDLGGEFDKLAKDKNFDNIQKAMYSQFENTFMMYLPRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKDLYQRQLDVFLDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMVWYVPPLSPIQSAADAGELGSNGILPDVESLRIPVQYLANLLTAGDTKPVLRALKRMLAMRHYKRAETVDGKVDTRALEEVGLTEAQAQEMYRYLAIANYEDRFVVPSSHREL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Respiratory nitrate reductase 1 alpha chain
publication title Architecture of NarGH reveals a structural classification of Mo-bisMGD enzymes
pubmed doi rcsb
total genus 149
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature ec 1.7.5.1: Nitrate reductase (quinone).
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
B PF14711 Nitr_red_bet_C Respiratory nitrate reductase beta C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3650.10 Mainly Alpha Orthogonal Bundle nitrate reductase domain fold nitrate reductase domain like 1r27B03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r27B01
1Y5IB 3MM7B 1FRXA 1D3WA 5CHCB 1H98A 1CLFA 3IR5B 1JNZB 2PA8D 2PDAA 3EXYA 3OR2A 4KT0C 1B0TA 5BYRA 4DHVA 4YDDB 1F2GA 1FXRA 1BLUA 4L6V3 1H0HB 3MMAB 3MM7A 2FJDB 1GAOA 2Z8QA 1DAXA 1DFDA 1FRLA 2FD2A 1DURA 4CI0B 2V2KA 2WSCC 2C3YA 2V4JA 1B0VA 3EUNA 3MMAA 1SIWB 4AYBD 1C4CA 2C42A 1Y5NB 3MM8B 5E7OB 2VPXB 1BC6A 1FDAA 3C8YA 1B0PA 3LW5C 2FGOA 1BD6A 1GT8A 1FCAA 1Q16B 1BWEA 1FDDA 3IR7B 1FRKA 2WAQD 1IQZA 2FJBB 1Y5LB 3MM8A 1XERA 1FERA 2VKRA 1FDBA 2IVFB 1FEHA 3GYXB 7FD1A 1FD2A 1G3OA 4OV1A 2GMHA 2O01C 3OR1B 2C3OA 2VPWB 1KQFB 1R27B 1FRIA 1GTHA 1H7WA 1F5BA 3MMBB 2PMZD 2C3MA 1GTEA 5L8RC 1FF2A 1K0TA 3OR1A 1BQXA 2WB1D 3OR2B 1ROFA 3HKZD 1FRMA 1KQGB 1AXQA 3PNIA 6FD1A 2C3PA 3MMCB 2ZVSA 2XSJB 3MM6B 4ID8A 1PC5A 3MMBA 1C4AA 4Y28C 1FRJA 3MM5B 5BYQA 2FDNA 5BYSA 4OMFG 5CH7B 4XDDA 1F5CA 2WSEC 1JB0C 1FDNA 2VPYB 1VJWA 3MMCA 2VPZB 2XSJA 3MM6A 1KEKA 1G6BA 2FJAB 3MM9B 4XDCA 1JNRB 1PC4A 2V4JB 1A6LA 4RKUC 6FDRA 3IR6B 3EGWB 3MM5A 1WTFA 5FD1A 2C3UA 1H7XA 2Y0SD 2GMJA 1SJ1A 1IR0A 1HFEL 4XK8C 2WSFC 1FXDA 1SIZA 2FJEB 7FDRA 2UZAA 1RGVA 1FRHA 3MM9A 1FTCA 1Y4ZB
chains in the Genus database with same CATH superfamily
4ZPVR 1WTBA 1S9GA 1TUWA 5T14A 2JFKA 1AB8A 2E9ZA 3FVYA 3ZTOA 4CYUB 5KFVA 1WF0A 5HLFB 3EDRB 4LRCA 4WP3A 4GVBB 5IZHA 4X64F 2APOA 3K5LA 1BWVA 4JI1J 1WC1A 5EWFA 3TEGA 4CLSA 3MHYA 2HNDB 3CO0P 1C0UA 2E5IA 1U26A 1VR6A 1FERA 2RUGA 4RUBA 5HSPA 1HNZF 4DV2F 4LF8F 3RW6A 4NWBA 2RRBA 1RABB 2RRAA 3HHLD 3MTKA 3PY8A 2PMZD 4CNYA 1FF2A 2KRBA 4JV2A 4NA1A 1WG1A 3LP1A 2FVCA 4K50A 4ANDA 4F26A 4J9QA 1KVIA 2QA2A 3LAMA 2VQEJ 4E8UA 4NXMF 3CE8A 2F4VF 3P49B 2FIUA 3PW0A 1CBKA 2BJ3A 2RKIB 3KLEA 1HWKA 4DR1F 1JWWA 3PYGA 3W9HA 4CM0A 3VAGA 2FLPA 1Y5IB 4ICLA 1N48A 1D3WA 2FLLA 2OEMA 2AYGA 1EHWA 3CMAS 1E6YA 3G82A 4ED2A 3RB4A 1IN0A 2FD2A 3D0GE 1S1UB 3GFZA 5GADU 4DL4A 2V63A 1JLQB 4X4NA 1FKPA 3W62A 1FCAA 4F4ZA 4NE9C 1HBNA 2ZZTA 3I5AA 4ETZA 4ZK7M 2M0GB 2DH7A 5IS2A 3DC2A 2LP4A 1WKJA 2HWHA 2B6AB 1FXLA 3J81Y 4PG5A 2KFYA 1IM6A 2J7KA 3MMBB 1CJKB 1SJRA 2YY3A 2LXUA 4USJC 2C2MB 2G0IA 5DQIA 3TZYA 3HT3A 2MB0B 2XS2A 2WVEA 1XMQF 3PHEA 1U1PA 3CJKB 2DNZA 3I6PA 3PM9A 5F0WA 3MM9B 1QSYA 3G87A 2QL5B 1SC4B 2VASA 4P2MA 3SFGA 3PRDA 1WC5A 1UFLA 1NXIA 3M7VA 1UVNA 2VG6A 2HQIA 3TZZA 1N33F 2YBVA 4O0IA 2KM8B 1S1TA 4C0BA 4DQIA 3OQ2A 1QE1B 4IRDA 1Z2ZA 3EGZA 2EC0A 3BREA 4PXBA 1WI8A 4IFYB 2K1RA 5D0HA 2BA9A 1R43A 2BUNA 3ZZYA 1RHMB 3LW5C 3IA0A 3Q89A 3HVWA 2LA4A 1FE4A 2UXDF 1YX2A 2MJUA 1S6PA 3H5SA 2DTJA 2JFDA 4MKVA 3C14B 3HF5A 3QT6A 4DR7F 1WELA 2MZQA 3D7SB 3Q8PB 4DSEA 4LF2A 1YJTA 2RMLA 3LTOA 2CPYA 4F50A 3H4DA 4IUFA 4PG7A 2GX8A 2BE9B 3MM5B 1VMBA 1YWXA 4URGA 2W2PP 1XNQF 1NPPA 2NCKL 3U1MA 3EGWB 2LDIA 4DR3J 1ZPVA 3D0HE 4QZVB 1WORA 1P27B 1FWPA 4NLWA 3VCDA 3TZXA 4LFCF 4EGLA 2GGPB 4ZIVA 4EWTA 5DM6Q 5CCLA 2FVSA 1BQNA 3MECB 4JB8B 4EU0A 1VQSA 2C3YA 3F0NA 4MIWA 1DZ5A 4OHYA 4YOEA 3QRQA 4FPIA 1PYOB 1UKUA 3M1VA 1JMTA 1FDBA 1JLFA 1NM2A 2LA6A 3DDKA 5D0EA 2D69A 5KFGA 5IC4B 5J2QA 1CQNA 4G65A 3SDEB 2ASLA 2KH9A 3CMES 4JV0A 5IQ6A 3V4IB 2H1YA 1JNRB 5DG8A 3THVA 1FK9B 2UU9J 4A8XA 3DLLQ 4I7FA 4F0MA 2GAHC 3LAKA 5IWAJ 3POTA 4LJMA 1NKBA 2UZAA 5IOLA 4CM2A 5SUHA 5D6GA 3OFHA 4CCHA 2F1FA 4C3KA 1JNZB 4GKJF 3W8GA 2WVBA 2F9DA 1NCLA 1MG7A 1NEEA 2MZRA 2OPSB 2C2EA 3GG0A 5F0UA 1KC8T 2BV3A 2IFXA 3PJWA 2ZH1A 5G0RA 2QN6B 2XSFA 3OW2R 4QJVA 4FXWA 4C11A 2D74B 4F4WA 3SSSA 1W7WA 4RNNA 2H4WB 3IN5A 3M2UA 2OEJA 4ILLA 3MAAB 4HR2A 4EYIB 4K4YA 3J80U 3DOKB 4BDPA 1NK7A 3R2CJ 4DWIA 3M32B 5E0OA 4JI3J 1RWXB 5C42B 2AV5A 1S6UA 4O44B 3CWJA 4I56A 5KFMA 1T95A 4CLLA 4C8ZA 4PZVA 1RT2A 1D9AA 2V8VA 2XWXA 2E1AA 3Q22A 4DV0J 3IM9A 1VQPS 2B43A 3QLHB 4U95A 3JQJA 3KLIA 1YJRA 2IMOA 2CJXB 5KFUA 2OPRB 2R9LA 1Y4ZB 2HMIA 1BQMB 1WI6A 3V81A 5FLXU 3HDSA 4CZCA 1F9HA 5HROA 5L1IA 2GW8A 4W98A 3A8IA 4JYAJ 5L39A 1SIWB 1DY3A 3CJRA 1S97A 1FJGJ 1UVIA 3TUIC 2XZDB 1R0BG 4OZ5A 3UN5A 1MMNA 2X3GA 2DB1A 3DFEA 1WC3A 2RDDA 4ZP8A 1N5YA 4DX7A 2ZBIA 1VLYA 5KFCA 2GIFA 4GC7A 2HBRB 3RRKA 3OFEA 3B78A 4DSKA 2ZE2B 5CQGA 4LR8A 4OMFG 5HI7A 4NCGB 4PQAA 1DTTA 1PSDA 1ZH5A 1RAIB 1KLMA 3R1HA 3CJTA 4UQTA 1JX4A 2RQKA 1Z1ZA 3HLUA 4NLUA 1HQUB 1TZ0A 3MPVA 1RAFB 3H2VE 3UW1A 3FCWA 2PI5A 5J1EB 3FQKA 3AT1B 3PW7A 1XMOF 3BYRA 1GQEA 4A48A 1YJ7A 4DFPA 2HPUA 1S5ZA 4QIEA 4RWWA 3BGRB 1RZMA 3PTWA 5LMUF 4RU9A 5EHHA 2YH0A 2C3OA 2AU0A 4I6WA 4DR3F 3S7RA 4CLWA 1WSRA 4I2QA 1S9EB 2VFTA 1RT6A 4L75A 2JDJA 1T0TV 3OLAA 1Y11A 2WSEC 3AJ2A 2HHVA 1NU4A 1J5OA 3W2VA 3MR7A 4DOZA 4KPYA 2XNRA 3MPUB 3M30A 2G2YA 1KN6A 1F1BB 1VCTA 2UUWA 5C5JA 1RJJA 4IFVB 2VG5B 1NJXA 4DFJA 5DGBA 5A8WB 1Z4UA 2XC9A 1JLBB 2AGOA 1VIXA 2AX0A 2B9XA 3BH7B 2YVSA 3R5CA 1M1KT 2HQGA 2XMWA 4PUOB 2UUTA 4FBTA 5CYMB 4RUCA 1ZAVA 4TQSA 2BOPA 3O6QA 3ZZPA 2GQCA 1RT3B 2BMBA 4O0NA 1CJTA 3GV5B 2V94A 2HHPA 4CNZA 1SV5B 5AXKA 5L1KA 2D3O1 1VRUB 1ZZNA 1FE0A 4FYWB 3GR1A 1RI7A 2PEHA 1Q82T 2J0WA 4LSZB 2QSFA 3GP9A 4M95A 3BM7A 2CJKA 4ZVTB 4Q0BA 1YZ6A 5B7WA 1A7GE 2DR7A 2VU5A 4QW8A 1J5EF 1VRQC 5IFMA 1AW0A 4JI0F 3VF0B 4KAIA 4UUXA 4U7UD 3MAHA 4B9UA 1UJ4A 1FFWB 4DPWA 1V3ZA 1KS2A 3ZZ0A 4YR0A 2FYXA 3D67A 4R25A 5E3AA 4AE5A 1SL1A 3CCQS 2J6TA 4BLGA 2DGUA 3IRWP 1Q0NA 2BRLA 1M5HA 1R0AB 4FYXB 4CO2A 3A3PB 3HD1A 4JI3F 5E7OB 5LOQA 4QYZJ 2DEIA 4KR0B 5F8MA 4MIAA 3T1AA 4CO1A 3T41A 2J9DE 3AY0A 3CCLS 3RB0A 3VGSA 2FHJD 4Y2KA 4DUZJ 4V19X 1S9FA 5AE3A 1V9OA 3ZC4A 2Z0GA 4ECQA 5RUBA 4K4WA 1WOOA 4ANEA 2FHMA 1Q78A 2B51A 2UUAJ 2YX1A 3FDSA 3DRRB 4DSFA 1IJEB 5HO4A 4ZPBA 2DO0A 2ACYA 1RCOB 5LSOA 1EAYC 2VPZB 4KYZA 2GMJA 2OELA 2ZHBA 3KJFB 4WFXA 5D8HB 3NGTA 4IRKA 2I9SA 3EPIA 1FJGF 2V2ZA 1EETA 1Y0HA 4N7TA 3K8VA 2L08A 3MXHP 1RWPB 2KVIA 4WP9A 4OZJA 2IDLA 3MEDA 5DGAA 5D4NA 4GO5X 2PIIA 5J2PB 2WSCC 5HMXA 4XAKA 1H74A 2AWZA 2RHQB 1VOMA 2CQ1A 1HHQA 3W9IA 3VALA 2JH3A 1LWEB 1HBMB 4BWMA 4FF3A 1UAWA 2DRAA 1U47A 3NP5A 2JZ5A 2P9EA 4I0WA 2HK3A 3OL7A 5KTQA 1RTDB 2KFNA 2UXBJ 1MWQA 3M2RB 4XDDA 3D1HA 4LBIA 1JB0C 3AFGA 4Z37A 3ISND 1F3VA 4XDCA 4I69A 1VQ8S 4WE1B 3WZ0A 1WOPA 3N4WA 3N6LA 2HFUA 3AQOA 1XNRF 4J9UE 3C6TB 3RB3A 3HVTA 3RR7A 1SC3B 2NUUG 4LRAA 2YX7A 4ITSA 3FSIA 3BV8A 1YQHA 2KRRA 2PA8D 3EXYA 2YXLA 4U96A 5AJ3J 1FKOB 1X5PA 2ASYA 1TKZA 5KFKA 4ID5B 1S1XA 2GO9A 4C0HA 4Q43A 1S7HA 2DNOA 4QOTA 5K8OA 2GJ2A 2FZKB 1ZAXA 3M8SA 2V67A 1T05A 2BANB 2L9WA 2Q6CA 2LEBA 1GT8A 2YNFA 4X66J 2MGZB 2J7WA 2HAFA 2RF2B 1HR0J 4CH1A 1NH7A 3GV8B 1NUEA 3CMQA 1KR4A 5KG2A 2V8GA 1BXNA 3ILOA 4RLEA 2BXJA 3N5BA 4J9LA 3L4BC 3UDLA 2Z2LA 1WC4A 1YRTA 4OJ3A 4RU2A 3B4MA 4MKBA 1H2UX 4AQYJ 4DXLA 3MMCB 3S01A 3OVAA 2MQQA 3BF4A 4UZCA 1X0PA 2UUCF 4IRCA 4C98A 4J7CA 4P6QA 1X8DA 1AROP 2YKNB 4HLBA 4F67A 4AXJA 1TL4A 1TK8A 4DQQA 3F44A 3EGVA 1HARA 5DLGA 4DX5A 3AB4B 3TVYA 3D28A 4LF9J 1SQEA 4IG3A 1T03A 4J9OA 3HD2A 3T3FA 1QM9A 4NLSA 3DI6B 8AT1B 1DAXA 3D0IE 3U02A 1UEKA 4IDKA 5DQHA 4YR2A 2D41A 1C2PA 3HULA 5ADZA 1K73T 4KC5A 1NSPA 1HYSA 5A0YA 4ANCA 2DY1A 2EK6A 4NLGA 4CTAA 1F2HA 2V5HG 5DLFA 3E2EA 1URNA 1I3OB 1OPZA 3G6ES 1RP5A 3QPIA 3TA1A 3HK2A 1LWCA 2GVDB 1YJNS 3NKYA 3PIPQ 1HNIA 3KOAA 1SJFA 1C4AA 4EUVA 2DNKA 4OZ0A 4PRFA 1NSQA 4B3TF 5FJ4A 2HVDA 2HSEB 3K17A 2CFXA 3KK1A 6AT1B 4WKYA 3E01A 2K3IA 2HQCA 5KFXA 1N5QA 2GJFA 2ZH4A 2PE8A 1VQLS 2VIHA 4Q2LA 4J9RA 4ER8A 3BSNA 2LVWA 4Y3CA 3BR9A 2B5JB 2EFNA 3KYLA 4LF6F 1YJ9S 1MWZA 4HI2A 4IG0B 1N8RT 1X4GA 5EN1A 1IKXA 4Y6IA 2W01A 4C3MA 3W7BA 4BHQA 4EO6A 1SH3A 5D15A 2VD3A 4WYWA 4H54A 3RAXA 2KYZA 4U6PA 2ZBQA 5HVHA 4XO0A 4ZLJA 3T1HJ 4UF4A 4WFBQ 3HMJG 3KUHA 4A46A 2NXJA 3LPEA 5DZ6A 2HW3A 4LFBJ 1RLCL 4DF8A 5LSLA 2HVIA 2JLEA 1X4AA 3M2VA 1U1MA 3UNGC 2YWKA 2J8SA 2GMLA 5A2QU 4DQRA 2YKOA 4HEA9 4OX9F 4FYVB 5L38A 4AXIA 3IXQA 3DDIA 1REVB 4RX6A 1S1VA 2LCWA 4ZKAA 1S9GB 1HBUA 1SPBP 2NSBA 1PJ7A 2CNNB 1JKHA 5JJBA 5K20B 1YZ7A 3GQCA 2IC3A 3OR2A 5BYRA 4JBCA 2DNPA 3MM7A 4QU6A 2DHXA 1C0UB 2HZAA 3KHRA 3CCJS 2ZM6J 5HVGA 4NLQA 2MSSA 3MF5A 5EWEA 3PFOA 4RUAA 3RW7A 4YR3A 1YRUA 3FBFA 3MM8A 4ZPTR 2V0NA 1HBOA 2XZWA 3A4TA 4NYOA 4WXWA 3OFFA 2KO1A 1Q95G 2OUGA 2HRUA 2AMCB 3LP1B 4BS2A 2EKNA 3JSRA 3MI7X 5U47A 2E5HA 4X4VA 3VAMA 2XLKA 3RYLA 3NNHA 4U9RA 3Q23A 3KLEB 2OI2A 4B3MJ 3T19A 4DS4A 3GMGA 3LWMA 4ILRA 3VAJA 1SKWA 4LF1A 1QUPA 4ICLB 2AT1B 3O8WA 4I6YA 3SIPB 2RNEA 4N56A 4X4PA 3SI8A 3KLVA 3BGFA 3BQ2A 4G1IA 2HHTA 2IRXA 4LSLA 1F3FA 1E6YB 3P96A 3G82B 1VK8A 3BR8A 2YQ3A 4ECSA 3BO4A 3EVWA 4KFBA 2ZH5A 2KN4A 4H4OA 1HBNB 2HRTA 4QPTA 2OGUA 4C0OC 3US5A 2B3TB 4ZCMA 2XGQA 2EFGA 1UZHA 3LPYA 1S6QA 1U0SA 3PX6A 3SCKE 1TUVA 1QAYA 3ENWA 4KQZA 3EICA 1F5BA 4NX9A 4OLPA 4FF4A 4ZMMA 4PXDA 5J1NA 2AJ4A 4LF9F 1KOHA 4K4TA 2ERRA 1H3DA 4DUYJ 4FXVA 2R7OA 2VV5A 3KHHA 1JLCA 2JHEA 2DVIA 1JXVA 4USIA 2IM0A 1PG5B 1G6BA 3EDQB 2BABA 1R8HA 3TUPA 3DLJA 4ZVGA 2VG6B 3JSYA 2CQ0A 2QMXA 4DU7A 2DGTA 4KHRA 1S1TB 3PYEA 3QO9A 2XLJA 1H98A 2F9JA 1NJYA 1M5OC 3OJUA 2K1RB 4XTTA 3RGIA 2IPOB 2DGOA 4L3KA 1TFWA 1LW0A 1WEYA 1X31C 1Y5NB 5KFFA 4WKRA 2YH1A 1WKLA 2E5LF 2I1RA 3N6MA 1NDCA 2YNHA 3ULHA 4U7CA 2H3EB 2I5JA 1NPRA 3ILJA 3KKFA 1B99A 3R97A 4X4UA 2VBZA 1GXTA 3C46A 5D4LA 4NCAA 2BBEA 5I4MA 2C28A 4EYHB 2HHUA 2CPXA 1KP6A 3HSDA 1B70B 1YLXA 2ZBCA 2HWTA 3BJYA 1PJ5A 2IRYA 4P52A 4C8MA 4D3HA 2GQ2A 2HNYA 2DY9A 4X4SA 5DO2A 2PO4A 5ETMA 5F3ZA 2NUHA 4ZN1A 1XK8A 2MJNA 2ASJA 1FRXA 1BQNB 4KT0C 5E2QA 3CJ2A 1IKWA 3JTOA 5C2CA 1X4CA 3SMZA 1Y10A 2A3JA 4DPYA 3VVUA 3GJTB 1RBLA 4MFBA 3A8EA 1VS3A 3M1VB 4DR4F 4LFBF 3O1LA 4DQPA 1IBKJ 1S57A 3CDWA 2XCPA 4NXNF 2C2KB 1M1HA 2R8KA 4JI8F 3CJ5A 4NLVA 5J2QB 3Q24A 2W8KA 3OL6A 4PXCA 2XEXA 1RT1A 4QU7A 3B6BA 1SJ3P 3MEGA 2WB4A 2AKWB 3WBZA 2D3ZA 4TLQA 3CW2C 1L3VA 4ZVSB 2RQCA 2MQ8A 4DV4J 4I7FB 1SQGA 5HQMA 3POTB 3NAHA 5E33A 2XI3A 2MEWA 4DLEA 2UXCF 5FD1A 3DMJA 2RILA 1N36J 2JEGA 2QE5A 2XLIA 4W90B 5MLCV 3ELHA 1FX2A 3PX4A 1QAXA 5G0RB 2M88A 4C11B 1Q81T 4HI1A 1H6KX 1FNOA 1REGX 2NYIA 2ZJPQ 2LYVA 2MKKA 2DO4A 4L73A 4CO4A 3QAUA 3EVMA 5EGYA 3ET6A 2WAQD 2MYFA 3G6YA 2NLWA 2QX0A 4KPCA 4B3MF 4DZ6A 1S7IA 2R2TA 4DR6J 1HPZA 1KQFB 2CQDA 2IIHA 2FVQA 1RT2B 1AUSL 5CZVA 1QVFR 4O23A 1LFWA 5E3RA 4Y2CA 2XMVA 3MOZA 2LQ8A 4JI2J 4DN0A 3VZIA 3DGPA 3KLIB 3HZEA 4PR6A 3Q2TC 3T5LA 1UTAA 2HIYA 2X51A 2R7SA 3V81B 1K47A 3CVKA 4DV7J 1FRHA 5CYJA 4OZNA 5HROB 4KE5A 4L3NA 4WWSA 4F36A 3BSOA 1A9NB 2XHCA 3ZZRA 3FMWA 3J7ZT 2EFPA 5AE1A 5L1LA 4CI0B 2A1BA 2GIQA 4X4RA 5JVHQ 5KFRA 5F8HA 3PG9A 2EG1A 4MK8A 2WRMA 4FDFA 1U49A 2XB2D 3D1OA 1WC0A 3G6XA 3MR6A 1R8PA 3KG1A 3DRYA 2JL9A 1VIOA 1N5YB 4DL3A 5BJRA 3GFHA 4KY3A 4BC9A 2YKAA 3CJ8A 1Y3JA 3OV7A 2ZKTA 2FPHX 3KHLA 3PYDA 2R8IA 1KFDA 4ZJQA 4O3QA 2H48B 1DTTB 2GA7A 4M1KA 2FY1A 3LO3A 5CH7B 4I2PA 2KU7A 2V4JB 2C2NA 3LP2A 2KJVA 2OO4A 1RT7A 1QJHA 1WWHA 4WU2A 4OJ1A 2B9YA 1FT8A 3UR3C 4LQ9A 1X4FA 1K8AT 4I68A 2BACA 2AEMA 3I55S 2YWHA 1Q8KA 3QJLA 4YQWA 2HS3A 2FQQB 1TKDA 2RAQA 3HVAA 3UPFA 1DRZA 2ATCB 4M5JA 4AYBD 2F40A 3IGNA 3TJAA 4M5LA 5J1PA 1BD6A 1LK7A 2E44A 4NCBA 4CRJA 2W4PA 2DD8S 4WFYA 4HACA 1SL0A 4I2QB 4ZCIA 2G4BA 1X5TA 4DL0C 5CAAA 1RT6B 4Z7YA 4LRFA 2VFVA 2WOMA 1XR5A 5B0DA 2RD5C 2NQPA 2KXHA 1J5OB 1KVKA 2BM1A 1U1KA 4ZHRA 3M30B 2V9WA 2BW7A 3L7UA 4B9SA 3C3LA 2XYPB 4JP8A 1AUDA 2V2QA 1XR6A 2M3DA 4IKAA 4H4MA 1IXKA 2DNRA 2V34A 5ETLA 1LQ9A 4PPZA 4I64A 1TU0B 1R89A 1RAGB 2VONA 2FLNA 1KWMA 4FF2A 4NOHA 4U8YA 2Z2ZA 4IR9A 1CJTB 2RU9A 1NB2A 3CO9A 2NR0A 2M9KA 1ZM2A 3W5XA 3DXBA 1IQZA 1KSPA 2JWNA 4UY8T 3KFWX 3NXZA 4FYDA 1G3OA 3KLGA 3H42A 4DLGA 4E2FB 4Q0BB 3TP2A 2CPZA 4LVOP 4LF5F 5B0FA 5A8RA 3TI0A 3GFYA 2N7YA 2IA0A 5DQGA 2ZFHA 3NGUA 2MXYA 1X9WA 4ED5A 4USTA 4KTQA 3CCES 1KFSA 1CSJA 2MTLA 4RNHA 3HT0A 3P4UB 5DDQC 4NPOA 5K8NA 3CD0A 3JXOA 3AXKA 2OHDA 2W7OA 2ZOMA 3DLGA 4ZP7A 4JOUA 2CQ2A 1RCXB 2LECA 2ZH9A 2CZVC 4W92B 3UCGA 2QA4G 1WG4A 2DNHA 3D9BA 3KJVA 3C16A 4DR6F 2KJWA 2R7UA 4FP9A 4PKDB 4K4SA 5K9FA 1D09B 3HFKA 1U4BA 3QT8A 1VC0A 4J9SA 4O3RA 2CVEA 4OZ1A 3M6WA 4A47A 2IBOA 2N4DA 4B3SJ 4OV1A 3PO4A 4MYUA 1KQSR 1GTHA 1HNVA 2P9CA 5KFTA 1HMVA 2ROEA 3CJSA 3IBCB 3LP0A 1NB7A 1U09A 1YJWS 3VZHA 3MUMP 3ITHA 2OTLS 1OQ3A 1FFSB 1HNXF 4GRSA 1I5OB 2MSTA 4UQGA 3MEDB 1RLDA 1WUUA 4ELTA 1VBXA 3ZXWA 4GKKJ 1RWUA 1QLNA 2CQBA 2MKSA 3KLHA 3PVXA 1EKSA 2Z8QA 5D0RA 3PJ9A 1AZSA 4ED7A 3JAMU 2YWGA 2H5IB 1GX6A 4KH0B 1NSAA 5IT0A 3QNWB 2XCAA 2I6WA 2D9OA 4HTIA 1R8AA 1D0EA 4DPOA 5KFEA 4WK3A 3RJMB 4RBUA 3PCOB 4JI6J 2DR8A 3FK4A 3OPKA 3FQLA 4LVNP 2ZJRQ 3HKWA 4NZ7A 3GONA 1T3NA 3HSGA 2BOAA 1T94A 3RUBL 4OLOA 3R8YA 4Q44A 4ZPCA 1NK9A 1XN9A 3HVTB 3TARA 1UETA 1TKZB 3UCUP 1R8CA 1V5IB 1K1QA 2PDAA 1S1XB 3UN2A 3N6NA 2DGWA 4LBHA 2XMMA 3OBIA 2XZTB 4MH8A 1LXNA 2DHAA 1DQ8A 1RT4A 1ZM9A 3FSYA 3UI3A 2YNFB 1TL1A 1ACMB 1VDHA 3ETMA 4XPEA 2LQ5A 1RTIB 1IVZA 2BJ9A 4DZDA 4TXSA 7FD1A 3D3CJ 2PGCA 4DSLA 4AFFA 4TYBA 1HNZJ 1UFKA 4DV2J 3MCNA 4LF8J 3TUJC 3LGHA 3FEZA 1QAIA 1GTEA 4R8UA 1V3SA 2UVUA 3ENQA 4OI0A 2HZVA 4J9MA 2XG8A 4PCQA 3GR0A 1YG0A 4NXMJ 2F4VJ 4RW9A 4ECTA 1UJ5A 3WQPA 3LUYA 1H7XA 4IG3B 1T03B 7FDRA 2DPIA 4C6AA 2XMTA 4DR1J 3IM8A 3NGDA 1YJVA 3T6JA 1MNEA 2ABYA 1HW8A 4NI2A 3DLBA 4IDKB 1U48A 1RYSA 3S6EA 4FKXA 3D3BJ 2AD9A 1TK0A 1DURA 2MQMA 2UUBF 1HYSB 5A0YB 3CCVS 4B9TA 4CTAB 3AD9C 2OJ3A 4TY8A 1VLOA 1LWFA 2XI2A 3DU5A 4CYUA 3QJPA 4OI4A 3M05A 1HWLA 4TYAA 1MN9A 4DG1A 3AJ1A 1HI1A 4USUA 3UD5A 2VUGA 1UA1A 1HNIB 4WXOA 1N34F 4ZVFA 3MR2A 5L8RC 5KAKA 2XS7A 2DPJA 1U24A 5GAHI 4K4XA 3H98A 3W66A 1NMEB 2JSXA 3KK1B 4YB1P 1RE1B 1NKCA 3E01B 2K7KA 1RHKB 1XMQJ 4HH0A 3ZTQA 3CXCR 3WC0A 1C1BA 1SJ1A 2W9CA 1FNXH 1VC6A 2R7WA 4ZLLA 1I1GA 4WBFA 1HWIA 3MEKA 1LW2A 4RPFA 4KSEB 5CHCB 2IRUA 1B7FA 5LXRA 4YHHF 5A8KA 2HVZA 2B8QA 2KHDA 2CJ9A 1IKXB 4B3SF 1S4FA 4WFZA 1N33J 1PYSB 1MROA 1KD1T 2R8JA 2BJDA 1WHWA 2GZOA 1EZZB 4ECYA 4NYZA 4PXEA 3Q8UA 4DEZA 2KT2A 2AEFA 2V69A 3JQMA 4KKOA 2N4CA 1KRPA 3TANA 3QZ8A 1IKVA 1RKIA 2J9DA 2OD4A 3VR1A 3L95X 2VKZG 1RWVB 4RNMA 4RO0A 4A8FA 2UXDJ 2AZ1A 5T7LA 2DXEA 2VH7A 1K0TA 4DR7J 4O4GA 4MKYA 3TAMA 2XMJA 1S1VB 1HBUB 2RHSB 2G0CA 3PKMA 1O6XA 3HHDA 3GZ7A 3IR6B 4O3OA 4DL6A 3CJ0A 2IC3B 5B09A 1XNQJ 1D8ZA 4TVAB 2MQOA 2IAJA 2ZC4A 3O5TB 5F41A 3MM7B 2FTRA 4HT5A 3I9V9 4YS2A 1S10A 4DL2A 1Q1KA 2LEAA 4LFCJ 3FC9A 3K59A 1TKXA 3C19A 3PYFA 1RAJA 3PIOQ 2DGSA 3MM8B 1HBOB 1B0PA 4BWJA 2CQIA 3W61A 2Y1JA 2JEFA 2ZOFA 1SL2A 5H9FJ 3V6JA 1MW7A 2CJYB 1RWNB 5EX3A 4YP3A 3MEEA 1Q79A 2WW4A 5SZTA 2W24A 3I4PA 4CT8A 5KFZA 1TL7A 2J9EA 5HK4A 4KJIA 4QYRA 5KG5A 1NLKL 1NPKA 3GU0A 2VC0A 4LSLB 1O8BA 2Z57B 3R1LA 1NSKL 2OH2A 2EW9A 5GAHU 4CLTA 4KFBB 2HS0A 4DV5F 4GKJJ 4H4OB 2Y8WA 3KG4A 1U1OA 4DCJB 3I0RA 5LL6d 4A8YA 2CUYA 1S6QB 2IM1A 3BH6B 2HFSA 3HFZB 5DDOC 2DIUA 4NMXA 2FJBB 5AXMA 4MIBA 3NEKA 3MCOA 2MQPA 1K44A 4V19J 3BKTA 2CNKB 3RTVA 4CLPA 3BO2A 3EXCX 2Q3PA 3PRVA 2A2DA 1JLCB 4RL1A 4E0DA 3NL0A 4OYZA 2KL8A 4KGVB 1ZM4A 4IO9Q 3QIPA 1SC6A 3Q86A 2G0JA 4JV5J 2BZ2A 4F8RA 5GAEI 2DBBA 1U2RA 1U02A 1VI7A 3QO9B 1TK5A 1HL6A 4PG4A 1OYDA 3U1LA 2NPFA 1P6TA 1BHNA 1AT1B 4DPXA 3WC2A 3PDNA 4Q7AA 2LU1A 1VHIA 4O3SA 1MU2A 1FXRA 2QMUB 2FJXA 1LW0B 3FBEA 2RB7A 4O3NA 4F4YA 3R5GA 3LQVA 3ONQA 1NBEB 1RHQB 2CA9A 4IYQA 4M5IA 2I38A 2YNHB 2C2OB 1RK8A 5HL7Q 1BMQB 5M2PA 4Q45A 5EUHA 3H5XA 3SCIE 2NYHA 3ILIA 1T9TA 2FY8A 2DGXA 2OPSA 2JNJA 4ZN3A 1L3SA 3T5KA 3O2IA 3PFEA 2EK1A 3E3XA 4IH6A 1M0SA 2BJ8A 3J7Z5 1JIHA 3AXMA 5DG9A 1EIYB 3GIRA 2HK2A 3JTPA 3AOCA 4NEZA 5J2MA 2HNYB 1FJEB 2XSJA 5KT2A 2VQFJ 4KB7A 3GIIA 4OHVA 3HHNB 3OHBA 2GHPA 2C2RA 5LMNF 2U1AA 4WYLA 2C2ZB 2FJEB 1IKWB 1GK8A 2MY7A 2QLJB 1S77D 5IXUA 2Q66A 1DLOA 4A8MP 3NWRA 4MFBB 3NS6A 4CLZA 2QL9B 2CZ9A 4OIXA 2VDIA 2KVQE 3QLHA 1F0XA 2AJ2A 5F3TA 3KHGA 3UFCX 4RW8A 4CLUA 1BC6A 3I5BA 1XMOJ 4Y2IA 2IA6A 8RUCA 2WTFA 2HLUA 4P75A 1FEHA 3PJXA 4KGKA 1WNEA 1XIQA 3H5YA 5LMUJ 1FD8A 1N0VC 2QGFB 3LGNA 5HP1A 2BQRA 4IH5A 2DJWA 4Y34A 1F9EB 4YDXA 3I5CA 5LT5A 3HVRA 6FD1A 4X2BA 1S12A 1JLGA 3DMJB 2IYGA 4USVA 3K0JA 4LF4J 4X4TA 2HQFA 3VAFA 4WU3A 2W1BA 1IR1A 2O67A 1U2CA 1CEZA 4R0EA 1OIAA 1FWKA 3BKFA 4DI6A 3U7JA 4N41A 5DG7A 5CCMA 1R8BA 1AYEA 3UD3P 3B54A 3SQGA 1RU2A 4A4JA 3PR4A 2W7AA 5GAEU 3Q8VA 3TRGA 3H0PA 3ET6B 4PAAA 1QY7A 2PD1A 3QGIA 4ZVHA 4UOGA 1HPZB 5F9LA 4EEYA 2VKRA 4DV1J 3BB5A 2E1RA 4G6VB 3IWNC 1YSJA 4RR5A 4C4WA 3DHWC 2RU3A 4NYPA 3DGPB 3SZ2A 2MZJA 2P6TA 2XQCA 1U25A 2ADBA 3IWXA 1ELOA 1OY6A 3NMRA 3I87A 2MDAA 3MCMA 1WF2A 2G1DA 2MLYA 4Y0FA 2YWFA 3CDAA 1J5EJ 2BKNA 2DH8A 4JI0J 4HT7A 4UY85 4DPTA 1CJUA 3I9ZA 4DV6F 1H2TZ 1Y9OA 1U6BA 1N32F 4PQUA 4KHPJ 3WIVA 5F8LA 2VDHA 4MKAA 4ZJLA 4S0MA 3VVTA 1NDPA 3NS5A 2DXDA 4DFMA 3DHXA 1SBRA 4NLOA 3LANA 2W7PA 4NMLA 3BPDA 3V4MA 5IV3A 3HXMA 1PILA 4KBIA 3OUYA 4R0JA 3PW2A 4IR1A 4OYOA 4JV5F 2AW0A 4PYAA 4B17A 2QFIA 3L3CA 1TAUA 5ETNA 1EJ7L 2N3OA 3H20A 2J0XA 3PW4A 5CYMA 4FXDA 3ISNC 4I2PB 4WTYA 4TLRA 2NS1B 1VQMS 3BGOP 3M4XA 3LP2B 3D6MB 2M7SA 5BYSA 2W2NP 2HHWA 4ZJOA 1UA0A 4QW9A 2NXCA 1TQLA 3QGPA 1RT7B 3Q8RB 2ZJQQ 2ZWPA 2WCXA 1OQ6A 2DNMA 4JI7F 3VTIA 5KT7A 1WJ9A 2WHOA 3Q83A 2EWHA 3AH6A 3WX4A 5BR8F 1PBAA 1HQ2A 1RA7A 4HTJA 5F8JA 2AYBA 4XIUA 4ZLPA 2MKJA 4DL5A 3CSKA 4DSIA 4GO7X 4HACB 3P5BP 2WW8A 4B08A 2QYCA 4GMKA 2NZCA 1YK9A 2WOMB 4LSNB 3IGVA 2AGQA 5CYQA 2VQFF 1NHUA 1U8SA 4OZ2A 2BE2A 5HBMA 3H59A 1SI9A 2BJ1A 3CCWA 3AOAA 4WF9Q 4OYBA 4CO3A 2I2YA 4ZHRB 2F5GA 3CJ3A 2AJ0A 4RUHA 1ROFA 5IT9U 1S99A 3W1YC 4OYIA 2KZZA 3SV4A 3ZZUA 3QGHA 5K8MA 4F2SA 4FZVA 5CXTA 3LGMA 2OD6A 2R2UA 4J5OA 6FDRA 4H4MB 2M8DB 2V4RA 1NHVA 2DEJA 2EKYA 2X1GA 1URRA 3R9LA 1XNRJ 2HYIB 2KTQA 1WHYA 3LH2S 2ZH3A 4ECRA 1VQ9S 2XM3A 1QTNB 1F2GA 3QJJA 2BEFA 2VJVA 1UJ6A 1GFWB 1B7YB 1IWGA 2X7IA 4FN5A 4ES2A 1FRLA 1GXUA 2R3VA 1EB0A 1SVDA 2AX1A 4C8YA 5B0BA 1VFJA 2HBQB 1MMLA 4ELVA 3C2PA 5GMDA 3OHAA 3KLGB 1HNWF 3DM2A 2C1EB 4ZITA 5AT1B 5ETKA 5KFYA 4LF4F 2RT3A 4F3OA 2CYYA 1TL5A 3TOQA 2UVVA 3NNAA 3QT7A 2E5JA 2JX2A 2E9TA 4ZA1A 4K4ZA 2LFVA 3KNGA 3MPDA 2P8IA 1BGXT 4WCEQ 1Z2LA 1KNZA 2FZGB 3JB9k 2UUCJ 1OY9A 2Q43A 3OTCA 4FNHA 2VODA 2LLZA 3R7BB 3D66A 3DLGB 2MZSA 1OSCA 4OYMA 3G6VA 3P8BB 4OI3A 3KJVB 3C16B 1LV5A 5F9NA 1WC6A 4DV1F 1ZTTA 2Y1RI 4QCLA 4AT1B 1ULRA 4OX6A 2LU2A 3BBCA 3QRPA 2OSRA 2Z2YB 2HVHA 2EBGA 1PKUA 1CG2A 4WE1A 4F2RA 2YKMA 2CPJA 2NXUA 1RTJA 2CG8A 5A6WA 1UPMB 4Q8FA 2A0FB 4J90A 4TU9A 5K14B 1N5TA 1HNVB 2WK4A 1WDDA 1NDLA 2KXNB 1HMVB 1FKOA 4RWXA 3DOLB 3LP0B 3IMQJ 3G8SA 4N8OA 2J6SA 1SKUB 1M5PC 3ITHB 2BANA 1B64A 1W26A 3HKZD 1RHJB 1T3OA 1VQOS 4FVCA 3G86A 3WX8A 3J80Y 1DTQB 2GHWA 4KHPF 4HHUA 4QR2A 2HEKA 1ZBTA 1JJHA 3TR5A 3FEXB 2MGZA 1KQKA 2YPYA 2W25A 2X1BA 1TTHB 4WFAQ 3RRHA 4EK2A 4B3TJ 4EO8A 1RBOB 4YMEA 2V8HA 4ES1A 4F4AA 1SIZA 3P45B 2J5AA 3KLHB 2FLOA 1U1RA 3PO5A 1XWLA 3V5RA 1Q5VA 4DDFA 3T1YJ 1AZSB 4RW4A 4DL7A 1CS4A 3J7AN 2ZITA 2XMKA 4LF6J 4DR2F 5FLXY 2HNZA 3EUNA 5KT3A 1NJZA 3T5HA 1NK8A 1S1WA 1NO8A 1N88A 3J81U 3O3LA 1XMBA 2KZMA 1LK5A 2W9AA 4TQRA 2VOPA 5HN0A 1NZAA 1APSA 2ROPA 2E29A 4PABA 3FZ2A 1OS5A 4P2XA 2R2RA 4USKA 2PFFB 4JV1A 2ZZNA 3CTRA 1GMWD 2F8HA 1MLAA 2KM8C 4FNIA 2DITA 3TEHB 2DHHA 4ID8A 3T9ZA 1D9FA 1CQMA 3MUTP 1YI2S 4OHXA 4OV6A 4OX9J 2HBZB 4QYZK 1TL3A 1FI4A 5G4DA 3OVSA 1RT4B 4LQ3A 2ZC3A 4N76A 2XY6A 1TL1B 2E1MC 3BKUA 2ADCA 4TNOA 1FTRA 3ETOA 2RRNA 1FVSA 1MMDA 4M8LA 2QO3A 3AD8C 1HHTP 1NAQA 1UWBA 3QZ7A 4X62F 5KFSA 2VOOA 4LT6A 1HQEA 3CC4S 4DCOB 2YTCA 3EVOA 3JTNA 4R8UB 3M9NB 4OYPA 4X65F 2YPZA 4A8WA 2ZUGA 4OI1A 2F65A 5HATA 1V3RA 3R5BA 2VA2A 2H5JB 3KG0A 5KT5A 4RW9B 1U1NA 5KFHA 3V6HA 3KMSA 3EJMA 1RB0A 1ITPA 1YBUA 5A6PA 2K3KA 3UWTA 3FUYA 2FHOB 2NXNA 5D3GB 3AJDA 3N5FA 4NI2B 3DRPA 4BBYA 3IS9B 2W4CA 4KV8A 4DHVA 1SXLA 2DYAA 5MAOA 2GIRA 3J7A1 2V4QA 3KTQA 3GCXP 3I31A 4FKYA 2OIHA 4TY8B 1JJ4A 3VAIA 1LWFB 2H54B 4RNOA 2VPXB 3C8YA 3DOMA 3IG1A 4A8OA 1FDDA 1XTZA 4DG1B 1YHQS 2D9PA 1S76D 1RWMB 2J7UA 2VPWB 1R27B 4ES3A 1ICEB 3MUVP 3D54A 3DN9A 1CC8A 9RUBA 1M5SA 1VJQA 1GMWA 2F8EX 2RIJA 2DK2A 1C1BB 4YB7A 2W9CB 2FJWA 4ECZA 2LMIA 2ZZMA 1LW2B 1NHKL 1QVGR 3HZGA 3BS9A 5A8KB 4F4KA 1WDTA 2UV8A 4CLKA 2MQLA 1MROB 5DZ7A 3SSQA 3DXSX 3ENVA 1IBMF 4IQMA 4B3RF 2VG7A 2HGMA 3E8OA 3GB0A 1CJVA 3A13A 5CZXA 4OQJA 2F4FA 2A6OA 3BZQA 4KKOB 3U1NA 3BQ1A 5C24A 1IKVB 4ZP6A 4F25A 1TP7A 5ETQA 1VQ4S 1OSDA 2GS8A 2R7TA 4MTPA 3N28A 3K2YA 4JI5J 2E5LJ 4NL5A 5T7LB 3NCPA 2KYXA 2ZNZA 3NLCA 1FJCA 4O4GB 3TAMB 3W65A 4M5DA 3MD3A 4ZDNA 2M2BA 1M5VC 3BSCA 3KK3A 3OTEA 3RG6A 1RAHB 3OJSA 1Q7YT 4KH1B 1VHFA 3BN7A 3T1YF 3IC1A 4LF7J 1U1LA 3MM6A 5I3UA 2IAJB 2W9BA 2Y1IA 4ED8A 3H2UB 3HX9A 3L7OA 2CPFA 1JXLA 3DRSB 1RHUB 3DRXA 2CNLB 2WZ1A 3BBFA 3GIKA 1TKXB 8ATCB 2I0XA 2QRRA 2DGQA 1HD0A 2LXIA 5C25A 2J0SD 1K0VA 2IJFA 4G1QA 4FS1A 1KOOA 1T8EA 2FGOA 4DR4J 1YTYA 5IV4A 2D7SA 3CDUA 3QIDA 3MEEB 4NXNJ 4K5SA 2V2VA 1SUQA 2HQ3A 2CJBA 2VFRA 4JI8J 2E7WA 1TL7B 2VJUA 1VBZA 5LM7E 2OP5A 4CH7A 3H90A 3DYAA 4ZCLA 1HI8A 2M5YA 4DBQA 1BQXA 3RB6A 4HDHA 1XEZA 1UW9A 3FGVA 3ZNJ1 3D1QA 3N01A 2EG2A 3P3DA 4RW6A 1WTFA 1VBYA 4NA2A 3HHLA 2UXCJ 2ZWOA 2QLFB 1S0VA 2CKWA 1SB6A 4B9MA 1U1QA 1PO6A 2JEIA 1J2VA 4ZVPB 4PG8A 5DS7A 3L7PA 2MMYA 3I0RB 1JLEA 4B3OA 1JLAA 3PEJA 3SYZA 3K7RA 2J0QD 3M8ZA 3UE2A 2XYGB 3H8YA 1C1CA 2PEBA 3I4HX 4M94A 1X9MA 1Y5LB 1UEVA 5KFLA 3CCUS 2IVFB 5A76A 3NOGA 2B56A 2O01C 4QIFA 5JVGQ 2E5GA 2GV1A 1OYEA 2DNQA 2GHVC 2D3UA 3QIPB 2IY5B 2FC8A 4ZS6A 2OPPA 4C7QA 1ZA1B 1CPZA 4FBUA 2QIFA 1WEZA 1IM4A 1VK3A 1I6JA 4JI4F 4GC6A 3OT9A 5J2NA 2IJNA 3QT5A 3R7SB 4DN9A 3BEGB 3TJ8A 3W5ZA 4DF4A 4QIGA 4TU8A 1FKPB 3ZZZA 3PX0A 3IO1A 1MU2B 1UZDA 1HI0P 4HHJA 4C8LA 5E3QA 3THPA 3VGVA 2BR0A 4HVZA 5HMWA 1HD1A 4MK9A 4P9SA 5IQQA 4JI1F 2O3DA 4WZQA 3TO8A 2FJDB 1V6HA 2V9KA 1EKRA 1RAOA 3MMAA 1WKKA 1PYTA 1S59A 1IBCB 1VRTA 2EFQA 2ATLA 2CJQA 3CCRS 4PG6A 5K5MA 3RBEA 1Q5YA 4F0HA 5DM7Q 2Z2MA 3I32A 5B08A 2HAIA 3HO1A 3CT9A 3GSIA 3NBPA 4M5HA 1T9UA 5FDLA 4X4QA 5ETPA 5KG4A 5HMZA 4U67Q 1FFGB 2VQEF 5J2MB 3R3TA 2XSJB 2DNYA 2R7XA 2B4PA 4DMZA 2CDQA 2LKZA 2KI2A 2NPIA 2FJAB 3G8TA 3P5TL 3VQTA 1S48A 2BX6A 1DQAA 2GNKA 1DLOB 4EZ9A 3GCWP 1EQ0A 1W25A 5D78A 3BDPA 2AP6A 1XJWB 3T5JA 3QRRA 1N6QA 3M8PA 1S6PB 4PWUA 4JI5F 1QSSA 3SV3A 2YKQA 3UVJA 3OTDA 3C15A 3SBMA 4NLDA 4RW8B 3G2XA 1QDUB 2VBWA 3BBBA 2JEJA 2JLFA 4CWBA 2CXEA 3IR7B 3MCSA 5L46A 2JVRA 3AA8A 2H51B 5HP1B 4LF7F 4UZBA 3MAQA 3HSJA 3AQPA 1KHVA 3W2WA 1TR0A 2P6SA 3CNQP 2H5EA 4R5PA 2EEYA 2CIMA 2HHQA 1JLGB 2GVZA 2KHCA 5CD4H 4A8QA 5I42A 2CQ3A 5KG1A 5JUMA 3UQSA 4U7UK 4F0KA 2G2ZA 1FEEA 2CWXA 3TWZA 2EPIA 3GTYX 4G3IA 2ZVIA 1FWLA 3KUEA 2HLTA 1B4SA 2HFZA 1KKHA 1T9YA 2AF6A 1TKTA 1U0HA 5A2QY 3SQGB 2XWYA 2HHHJ 4F02A 1RAAB 3IR5B 1CULA 4YDDB 4LMZA 5IT4A 1HWUA 4MK7A 1JLFB 1DARA 4DCPB 2YNIA 1IBLJ 3CF5Q 2DRBA 1P8GA 1CC7A 2CPHA 3K8WA 2V4JA 2XYHB 3GJRB 2BW2A 2HWIA 4A8KA 4WIQA 4N47A 2D3OR 4C2MA 2FUG9 4KRWA 1PGZA 4LFAJ 3CC2S 2K2PA 3KUGA 1NDKA 1NNDA 2JLGA 3NGRA 4P74A 2CJAA 3DNCA 2MHNA 1FRMA 1ZETA 4LF5J 2VFSA 3HFVA 2CQ4A 1U7LA 4WTOB 3BDEA 4RKUC 1CJUB 3JSMA 2ROGA 1G7CB 2UVRA 2MPUA 1NKEA 4PQUB 4ELUA 3DDNA 3ILLA 3G9CA 1SJ4P 3M2UB 2EBEA 2DR5A 2A2CA 1CLFA 2KG1A 4EFAC 1UP1A 3A12A 2R8GA 1EP4A 2AEJA 1PAUB 4L6V3 3M8QA 3MZIA 1L5UA 3PKYA 4CO0A 1I94J 3H40A 4QQBA 1G2EA 3NCQA 1TELA 1HLWA 2R4FA 3OUYB 1T02A 3EZ5A 4NLPA 1Q8BA 2SXLA 2ASDA 3DGVA 2RH3A 4UUWA 5KT6A 2XHWA 5KFWA 2HIQA 2EFVA 3ZFVA 2OFHX 4FF1A 3IAM9 3HI9A 5B0CA 4K0KJ 3N79A 5L9NA 3RAQA 2C3MA 2HMIB 1WEXA 2LDYA 3DKDA 1Y7PA 1S4EA 3PNIA 4ALZA 3BYPA 4AL6A 4DFKA 3UDEA 3SQOP 4P10A 2QA1A 1LOUA 2XMAA 3F56A 2E7XA 3NAIA 2RS2A 1SCJB 1VJWA 2UU9F 5IWAF 3BO3A 3UN3A 1OMSA 2CQPA 5ETVA 1PAEX 1KBRA 4J9KA 3H4BA 2BQUA 2DIVA 1HNXJ 3PR5B 5DETA 2B9EA 2XNQA 2AYEA 4YY3J 2Z4PA 5EWGA 2OSQA 4QPXA 3EWGA 1RAEB 4WPAA 2RDJA 1Y00A 3MGJA 3G8QA 2X1FA 4O4RA 1C0TA 2QG9B 3ZZTA 5KT4A 5K8PA 2HFOA 2MKHA 4I4BA 3ZNUA 4ZVEA 4KGXB 5KFAA 5CYQB 4E98A 2Y9HA 2BE2B 5HBMB 3GYXB 2HG4A 4CO5A 2HVEA 2M70A 4H4KC 1G1XA 3TJ9A 1KLMB 2DCUB 2OAUA 5M2UA 2QLXA 1VBKA 1SKSA 3I0SA 4C9DA 2AZ3A 1WHXA 5LSRA 2ZVSA 1H73A 5AXLA 2Y8YA 4Y28C 1S49A 1Q53A 4DV0F 4CIOA 3NGSA 2G2OA 1U2FA 3KLFA 2CADA 3I82A 4QIWD 4MYTA 5IM0A 4FS2A 1SQFA 2NSCA 4Q5VA 4QWEA 1ZAWA 3PW5A 1IR0A 3QSYB 2WVFA 2CPIA 2BVZA 2WSFC 3W8PA 4LRDA 3A8KA 2XO6A 2OPQA 4OX7A 1X4HA 4ECUA 2RS8A 3ADAC 3T9NA 3SFUA 3EE3A 4JYAF 2YNGA 4NA3A 1DFDA 2ILYA 1X5SA 3FRYA 3DM2B 3AB2B 1YBTA 2AQ4A 2RVJA 2XY5A 1TFYA 4ENOA 5CA5A 4OFZA 3BQ0A 3CJQA 3OXLA 2R7VA 3W2VB 3RRGA 3U27A 3KK2A 1HKAA 3FFIA 1L3KA 2NXEA 2VB6A 3W60A 2GAGC 3RBZA 2CAJA 1W2IA 2KXFA 2KB2A 2HHHF 4M5MA 2MQNA 1GEHA 1O0PA 1PIEA 5E41A 1Q7LB 3GWCA 4QWDA 1IBLF 3RBDA 1UFWA 1F9FA 1R6VA 2BKPA 4L72B 2QZ8A 3TA0A 4X4OA 3W3SA 2QTWA 1AA1B 2ZH8A 1N54B 3HSZA 2YQ1A 1NZ8A 4IO1A 4YN3B 3QWUA 4UOCA 4LFAF 4G1PA 1K9MT 4PWDA 1UL3A 1H38A 2MZ1A 2YKMB 4ILMA 2ZBPA 3M6VA 1RTJB 3C66A 3UO0A 3TX8A 1ZZFA 1C4CA 4LIWA 3HJFA 2UUBJ 2BQ3A 4C8NA 1IKYA 3QQCD 1G4CA 3KJQB 1BWEA 3ZTRA 4AL5A 1NK4A 2EC2A 2GJIA 4Z7CA 5GMKa 2GMHA 1QUVA 3H2LA 3NRBA 2QYGA 3TUZC 3OR1A 2EVZA 3FKBA 1N34J 3MMJA 4RZRA 3RU0A 3NWGA 3IAS9 3DLHA 1RTIA 1YBAA 1OO0B 3HP6A 1K1SA 3D6HB 4ED3A 2FHJA 1I94F 2CDRB 1NK0A 2CZ4A 1TVRA 2QA4S 4ECWA 1ZA2B 1QSLA 4ZP9A 3GIMA 3C6UA 4CT9A 3DLEA 4RW4B 5EX0A 2ALYB 1CS4B 3SCJE 3L9ZA 2HGNA 2HNZB 3GG1A 3VGTA 4YHHJ 2QLWA 1TMMA 1S1WB 3QFWA 4K0KF 5ETOA 3Q0AA 3R5DA 2C42A 4OL8A 3EPGA 1P9YA 3Q8YA 5FIIA 3D5MA 2IYIA 5BXIA 4EI2A 1VQ6S 4N5SA 2P5VA 3KWMA 5I3QA 3FCVA 3QBCA 1VISA 4YEAA 1YDLA 4C97A 2DKOB 4YFUA 1EETB 3QGGA 4F3MA 1X4BA 5KFBA 4YUDA 2C3PA 3CCTA 2A10A 2XMUA 4YY3F 2PA3A 1P9QC 4AD6A 2IVYA 1UCNA 2KFZA 1TL3B 2DNGA 3TYTA 3MURP 3V6DA 3TVKA 2Y0SD 4CDIA 3CD6S 3CULA 2QC3A 3NOCA 1FTCA 1UVJA 1LFPA 2CNOB 2XY7A 1IQTA 3BGUA 3K5NA 2BE7D 3KNAA 4KGZB 4I6AA 2W2MP 3UDCA 2ZOGA 4Q8EA 2V8PA 4J9VA 1RACB 1DBDA 1UWBB 5L1JA 4YB6A 5DDRC 2LQJA 2WONA 4OJGA 3LALA 3H7HB 1HQEB 1AFJA 3FMBA 3D4JA 2HZCA 4JUZA 2R7QA 4DUZF 3GFXA 3UD4P 4ZVQB 3GLJA 5B0AA 3EZOA 2QSWA 2VICA 1RT5A 1LKZA 2L41A 3B82A 3GPAA 4DU8A 2DCLA 5B0EA 3KDOA 3GSDA 2N3LA 4WJBA 2UUAF 2QFJA 3AHPA 2BYCA 3VWSA 2HGLA 3M8RA 1RWWB 4I67A 4DQSA 2DGVA 3GIJA 4K7QA 2CPDA 2GC8A 3IWLA 1SH0A 1T9XA 3N0VA 2LEPA 2V68A 1T05B 3DRPB 1M5KC 4KV8B 3HJVA 1KDNA 1D8YA 1M1GA 1Q8IA 3B4DA 1O51A 2XULA 1RU1A 5KFPA 2JVOA 4XPCA 1AFIA 2W2QP 3IRXA 1E6VA 4YB5A 4DV5J 3DOMB 4QR0A 1RSCA 3IG1B 3GILA 1VGYA 3JYTA 3CCMS 4RW7A 3TAPA 1RHRB 4EMDA 3CJ4A 2ACMA 2VA3A 1T9VA 1RISA 4MAKA 3V6KA 1WG5A 3GYNA 5KFIA 1RTHA 3R7NB 5C2GA 4PPDA 3DLKA 4HKQA 1H7WA 1XC9A 3MDFA 3OSNA 1TV6A 3FZBA 4FPRA 4OYWA 4ZPAA 4P7TA 5JMNA 2UXBF 2GQQA 4NASA 2MHEA 3H25A 4RJVA 4Y65A 3G4SS 3S8SA 2VFUA 1JXEA 2ZD1A 1F5CA 1N52B 2X1AA 4ZCKA 4RBVA 5LXYA 2FC9A 3VV2B 1A6LA 2PFDA 1I51B 2ZKUA 2C3UA 1HFEL 1S0MA 3OFGA 3GJSB 2ZH2A 3ZTSA 1O5JA 2QMWA 5AJ3F 2VG7B 2XS5A 1CJVB 9ATCB 4KO0A 3CPWR 3FCHA 1GMUA 1KHWA 4B02A 4QWBA 2A18A 1SJQA 2MLXA 1DHMA 1X4EA 5C24B 5HLFA 1LWCB 4MJKA 2V2KA 1N56A 4GVBA 4X66F 1M90T 4NZ6A 4HYKA 5GVQA 1HR0F 4DUTA 3VHQA 2VHGA 3M6UA 2HNDA 3OTBA 1N4LA 2GCFA 3FNNA 1HW9A 4M5DB 2J76E 2ZDPA 1KONA 3KK3B 4PYDA 1BY9A 2H65B 4OX8A 2O1PA 2J6UA 4AQYF 3VQSA 3MPWA 2R42A 1SH2A 4P72A 4DR5J 3MM6B 5I3UB 1YJUA 1FRJA 1NRKA 1QTMA 1KLNA 2W9BB 4OZLA 1RYRA 1UW4A 3M8YA 2HS4A 1R7IA 1PC4A 2L3MA 2FB0A 4L76A 3T6BA 4ED1A 5LMNJ 2RKIA 4J91A 4KHMA 3WDOA 5KG7A 2J8AA 5C25B 3TA2A 3UCZP 2GO8A 5F8IA 2IJRA 5GAGI 4G1QB 3QSIA 4M5GA 3R2DJ 3JSBA 1UWAA 3SXLA 3BPSP 3M2VB 2CQCA 3NY0A 2ZEJA 1SUQB 1S1UA 2DHSA 3NNCA 3FJ2A 1JLQA 2NZ4A 3EGNA 2E66A 1BUXA 3EM1A 1U8WA 3DYAB 3JAMY 2HQDA 3IP0A 3EZUA 1JKHB 4WK1A 4NZ0A 3OTOJ 2B6AA 2Z56B 2OMLA 2I8EA 2WB1D 3MTJA 3OR2B 1SKRA 4WFNQ 3VAHA 3J7YI 4RW6B 3MMBA 1CJKA 4PEOA 2E7VA 5KFJA 2W8LA 3CB4A 3HHLB 2ALZA 4P7VA 5DDPC 1YRXA 1ZOTA 3CJKA 4P71A 2PT0A 3AAWB 2LQBA 1FVQA 2QEXS 3MM9A 4PWWA 4BC7A 5HQLA 1JLEB 1X5OA 4B3OB 4IOCQ 1JLAB 3NCRA 4D3GA 2YQ0A 1OWXA 2UV8G 3CDBA 5I3PA 5D0GA 4QR1A 1C1CB 4LUBA 1RBAA 1B0VA 1QE1A 2EXUA 2L48A 2ZHOA 4ZVUB 4BCAA 1P1LA 2H4YB 2EFOA 1Q16B 4IFYA 4P2FA 3M9OB 4URQU 2V8DA 3T1HF 3QYYA 3MPYA 1OY8A 1VQNS 2OPPB 2L9NA 5B0GA 1X9SA 4HH1A 1FNMA 2N7CA 2HFNA 2Q79A 3R5AA 1GNKA 2VC1A 4HL9A 2HRYA 2AJQA 5J2NB 3C14A 2AIRB 1T9WA 7AT1B 3IBWA 4ED4A 2P9GA 4F04B 3CIZA 2VPYB 3ISZA 3EMTA 1L3UA 2DR9A 4OHZA 3MM5A 2KG0A 2BJEA 4B9NA 1N5VA 1GH8A 2DISA 3I96A 5KFNA 4DSJA 5H9FK 4NLTA 1FO1A 2VL1A 2Q6BA 2F8MA 2OKQA 4DV6J 3VAKA 1N32J 5HJXA 2QJ3A 3MMAB 1B3TA 4Y2AA 1VRTB 4C8OA 2ZM6F 2GGPA 5LJ3Y 4F3QA 3RBXA 1WOSA 1W2BR 3OL9A 3O44A 3QMQA 2FVRA 3MECA 1R31A 3PXGa 2W4DA 2ILZA 3NBPB 4K5RA 2RQMA 3N9UC 2PMHA 2A6MA 4OI6A 1VYAA 5FDLB 5GAGU 1HHSA 2MKIA 2WBMA 1NH8A 1RWOB 1ZTWA 1UPPA 3CDEA 1FX4A 2MKCA 3CEDA 1QAJA 3F73A 3SDEA 3PEHA 2H9ZA 3HHKA 2PC6A 1Q4RA 1MSWD 1N6QB 3V4IA 3M8PB 1XBWA 2Y0BB 4LIRA 4B9LA 1PJ6A 1FK9A 4JI7J 1IR2A 3UVJB 3C15B 2VZ9A 3J7YU 4ZOSA 2I5JB 1EQMA 5KOXA 2OFGX 3Q2SC 2FVPA 2G1HA 4USHA 2N82B 2CPEA 2DT9A 3TVZA 5BR8J 3FBBA 1A0OB 3D68A 3PHTA 2QV6A 4NLYA 3W64A 4CQ1A 4LREA 1X7VA 3D2WA 4DR5F 4RBTA 4Z2XA 2BM0A 3W2WB 3WHIA 4K2XA 2D1CA 4R5PB 1IUJA 4EZ6A 2GVZB 2CRLA 5KOWA 5I42B 4DV3J 3Q8QB 3MAAA 4B9VA 1DJ0A 3DOKA 3MR3A 4OI2A 4OZ3A 1RUSA 4DUYF 3AOBA 2HHSA 1Q8LA 5HVFA 1YIJS 2AJ1A 5T41A 3M32A 5C42A 5M2RA 3AODA 4O44A 2DXFA 4ECVA 2B4OA 1FESA 1TKTB 1U0HB 2YWEA 2K8GA 4IOAQ 2F7VA 4M5KA 1CULB 1FXDA 4HHHA 3MD1A 2L9DA 1RGVA 4C3LA 2KKHA 2YNIB 1RWKB 3PRBA 1X60A 2WBRA 2OPRA 1YVFA 4CP5A 1R0CB 3QFHA 5E3PA 1BQMA 5LJ5Y 3QATA 2IM3A 2R8HA 3A3NB 1RT1B 2JRSA 1JK9B 4M63A 4GVLA 3MEGB 3OTOF 2KDOA 2BRKA 3OSPA 4WP8A 1D1UA 1FDAA 1U45A 3V2UC 2YKPA 1S6OA 2FGCA 2QL7B 4ZIWA 1XERA 1LWXA 3UR0A 1XR7A 2JOQA 1HNWJ 5C7PA 1GX5A 3LA0A 3BGLA 2IDEA 4OJHA 3HHEA 3AD7C 3SCLE 2UP1A 3NMAA 4DPUA 1KQGB 3S1TA 3JSMB 1D9DA 3CGIA 3TQ1A 3JQKA 2G9OA 2ZE2A 1S72S 3M8WA 1YITS 4LSNA 1UEUA 2DRDA 2JC0A 4NCGA 4P2SA 3K57A 1EP4B 5D4PA 3UDVA 3M8QB 1KTVA 3CD5A 2C2DA 3D6TB 1RA6A 3W5YA 4N8NA 4ZPWR 2Z58B 3PACA 3X1LB 1SC1B 2JC1A 1KVJA 5DRKA 1EARA 1HWJA 1PBUA 4LR7A 4ZVRB 3HPOA 4RNFA 1PCAA 3GV7B 1ZYQA 1HQUA 3ZZOA 3KDNA 3P6YC 1IBKF 2CG4A 5L9XA 5J1EA 2M4MA 3GE9A 3F41A 3CC7S 2B9WA 2Y1LB 3OL8A 2MLZA 2O5DA 4I1TA 2BKOA 2Y3YA 3CUNA 2DNNA 4NEYA 1TMJA 4DX6A 1FJ7A 2OEKA 3BGRA 1WHVA 3MWBA 1J27A 3Q8SB 2HKEA 1S0OA 5KFQA 4K4UA 1Y3KA 4DV4F 3MOJB 1S9EA 2CQGA 1RQ0A 1N36F 4K8RA 2DNLA 3FSXA 3MFHA 1YKWA 2EI5A 2RSQA 4J9PA 4Q2MA 1FKAF 5CD4A 1VQ7S 1WD6A 4IFVA 2VG5A 2HFVA 1C0TB 5A8WA 3R6LB 3PZPA 1JLBA 4TY9A 4C8KA 2KT3A 2Q1LA 2ZHAA 2AGPA 1HIYA 2F63A 3B8HA 4DR2J 1YGYA 3G71S 3CD7A 2VBYA 4PUOA 2POKA 4OHWA 2JJ4D 4CLFA 2GFFA 2PN6A 1RT3A 4QIVA 2K7JA 3IFEA 1UVKA 3I0SB 4NLRA 3TX0A 1X0FA 1SV5A 1QD1A 2IMWP 3WIUA 1VRUA 2K06A 3KLFB 4EBCA 5KG0A 4JI2F 4UOHA 5IM0B 2O66A 5H1SV 3A8JA 5HAOA 3NG8A 1UMJA 2OTJS 4TKTA 2E1CA 5K14A 2KT5A 2CVIA 2J9CA 2OPQB 5ETSA 4DV7F 4IQXA 3BN4A 3DOLA 2RDIA 5ETRA 2MKYA 3M9MB 4KIAA 2YNGB 2B7BB 2XBPA 3EYZA 2FHKA 5HJYA 5E3CA 1DTQA 2PMWA 3W9JA 3CCSS 3L09A 1ZM3A 2OMOA 3THTA 1WSVA 5F8NA 4DV3F 3ZTPA 2MZTA 4K4VA 5HMYA 1F6TA 1RTZA 1GMVA 3KMQA 2B0GA 4A8SA 3KK2B 1R0AA 4O3PA 2B4UA 3AA9A 3FFIB 2BJ7A 3HM9A 3CCZA 3CIMA 1JJ2R 4X62J 4C48A 4UT4A 5ITHA 3RZAA 1BE4A 4F7VA 1FRIA 4EBEA 2RUSA 1VQ5S 4X65J 3E51A 2E1PA 1VQKS 3HHLC 1NK5A 3LF0A 3R6GB 2B7CB 3GJQB 1X4DA 4KGMA 5BYQA 3EX7B 4NRUA 3PV8A 2HHXA 4EBDA 3VGUA 3DRRA 4ZLNA 2F3JA 5D77A 2M8HA 4V1Ak 3TNVA 4ATNA 4PWDB 3DCAA 4U8VA 3FBCA 4ERDA 3D6FB 1LEOA 4N77A 1TUGB 4ETXA 1IWAA 2X3DA 2LQ9A 3GYGA 5F8GA 3IBFB 5THWA 3R27A 1IKYB 5A8RB 3TW0A 1RDRA 2ZUAA 3X3UA 3W63A 1H72C 5J2PA 1JQGA 1RADB 1FRKA 1H2VZ 1N5SA 2V50A 3FRZA 3TAQA 4L74A 5H9EJ 4OYAA 2ZDOA 4LR9A 3DU6A 4X64J 3KXDA 2VBXA 2ZNYA 3OR1B 1WF1A 3OXFA 1LWEA 1HBMA 1S0NA 4LBPA 2COLA 4IOBA 3SSRA 1LNQA 1S79A 1NK6A 2ZBRA 2W2OP 1F60B 1TVRB 1WACA 2WVDA 3NS7B 4OYXA 1RTDA 2QT7A 4DJBA 2CWKA 2QLBB 3OXGA 3C6UB 3M2RA 3ICLA 1OJ4A 3DLEB 5AE2A 2P2CB 4WZMA 2M52A 2MY8A 2R7RA 4CH0S 1UVLA 2CQHA 3C6TA 1T7PA 1B0TA 1EX8A 3A1YG 3A3OB 5HQ8A 1BLUA 2BDPA 1HA1A 4FVMA 4TU7A 4MT1A 1IBMJ 4ECXA 4B3RJ 3MFIA 1NJWA 2XO7A 2HURA 2FJVA 4FYYB 3NGKA 5H9EK 4ID5A 5D3GA 4WIIA 4AL7A 2IM2A 1L3TA 1NJIT 1XQIA 4HDGA 4UTGA 4DX8H 2C22A 2PI4A 3IS9A 5KFDA 4K2JA 4ED0A 4MMOA 1RXOB 1FD2A 1KTQA 2AHOB 2RF2A 2IVMA 1UVMA 2R2SA 3TZWA 3G96A 3K5OA 3ENAA 1MWYA 2YX4A 4URSA 2ZH7A 1CVJA 4UOFA 3V6DB 1V5VA 1ZS6A 3UNYA 4ZVOB 4K59A 4NRTA 3MMCA 2U2FA 3JS9A 1OPIA 1VC5A 3J81j 4USMA 2YKNA 4UW2A 1DQ9A 1R3NA 1U6ZA 2HBYB 4M5NA 2XGPA 2OLWA 5IC6B 2WONB 2YWWA 5KG6A 1R6YA 2AYMA 1N0UA 5JXSA 1Q86T 3DI6A 3QAEA 2E9RX 4QBUA 4LRBA 1U6FA 2G13A 4IH7A 3M6XA 4J37A 5AXNA 3OLBA 1TAQA 5E5NA 1VQYA 1RT5B 4W4MA 2IHR1 2V6AA 4Y00A 2B8PA 3OVBA 4ED6A 5DJBA 5HANA 1IJFB 2B4VA 2FZCB 4QWAA 1PC5A 1GXLA 2DH9A 3HCXA 2GVDA 3KJNB 2FDNA 2DR6A 2VF3A 3OD2A 1FHTA 5ETTA 2WVCA 5CABA 3ZO7A 5GADI 5IT9Y 2PSZA 4TN2A 4XK8C 1LXJA 5D4OA 5GMEA 1P1TA 4GKKF 3IRXB 5KFOA 5EDWA 1E6VB 3QWPA 2IBKA 4H4KA 4J9NA 1H0HB 4USWA 3TQEA 1JJCB 1GAOA 3FEYB 3JYTB 4RW7B 1F5AA 1ZPWX 4AUKA 2XTJP 2ZH6A 3K89A 2NREA 3R5JB 2B5JA 3K58A 5KG3A 4IG0A 2LXFA 4NLXA 2AJFE 4JI6F 2DHGA 1RTHB 1MN7A 3DRSA 3RR8A 3DLKB 1TV6B 1FA0A 2RJZA 3H5UA 2RE1A 4DS5A 4ZPDA 1T11A 4F4XA 1RKJA 4Y2MA 4X84A 2Z30B 2ZD1B 2UVWA 3LWLA 1AXQA 3LOUA 3RAMA 4CLYA 3I56S 3MR5A 4P73A 1FDNA 3K5PA 3BSAA 1KEKA 3K5MA 4JI4J 4QWCA 3SEOA 4KO0B 1REVA 2RQ4A
chains in the Genus database with same CATH topology
4ZP9A 4ZPVR 5F3ZA 3GIMA 1S9GA 2NUHA 3C6UA 1WTBA 1XK8A 2MJNA 2ASJA 1FRXA 4CT9A 3DLEA 5T14A 1BQNB 2JFKA 4RW4B 5EX0A 4KT0C 5E2QA 2E9ZA 3FVYA 3CJ2A 1IKWA 5KFVA 1WF0A 2WHOA 3SCJE 5HLFB 2EWHA 3AH6A 3JTOA 2HGNA 1X4CA 3WX4A 2HNZB 3GG1A 5IZHA 4X64F 5BR8F 2QLWA 3SMZA 2APOA 3K5LA 1S1WB 1RA7A 4HTJA 2A3JA 5EWFA 4K0KF 5F8JA 4MFBA 3A8EA 3Q0AA 3R5DA 1VS3A 3M1VB 3MHYA 2C42A 4XIUA 4ZLPA 2MKJA 4DL5A 2HNDB 2AYBA 4DR4F 4LFBF 4OL8A 3CSKA 3EPGA 1C0UA 2E5IA 3O1LA 4DQPA 4DSIA 4GO7X 1U26A 5FIIA 3D5MA 2IYIA 3CDWA 2XCPA 4NXNF 2WW8A 4B08A 2QYCA 4GMKA 2R8KA 4JI8F 1FERA 3CJ5A 4NLVA 5J2QB 2RUGA 1VQ6S 4N5SA 3Q24A 2WOMB 2P5VA 2W8KA 1HNZF 3KWMA 5I3QA 4DV2F 4LSNB 3IGVA 3OL6A 2AGQA 5CYQA 4LF8F 4PXCA 2VQFF 3RW6A 1NHUA 1U8SA 4NWBA 2RRBA 2XEXA 2RRAA 3HHLD 2BE2A 4YEAA 5HBMA 1RT1A 4QU7A 3MTKA 3H59A 1SI9A 4C97A 4YFUA 3CCWA 4WF9Q 1SJ3P 4CO3A 2I2YA 3MEGA 2WB4A 2PMZD 4CNYA 4ZHRB 3PY8A 1FF2A 3CJ3A 2KRBA 3WBZA 2D3ZA 2AJ0A 4TLQA 4JV2A 1EETB 3QGGA 4NA1A 4RUHA 1ROFA 1S99A 1WG1A 3LP1A 4F3MA 1L3VA 1X4BA 5KFBA 4YUDA 2C3PA 2FVCA 2KZZA 4K50A 4F26A 3CCTA 4J9QA 3SV4A 1KVIA 2QA2A 3LAMA 2A10A 2RQCA 3ZZUA 4E8UA 4NXMF 3QGHA 2XMUA 5K8MA 2PA3A 3CE8A 4YY3F 4F2SA 1P9QC 4FZVA 2F4VF 2IVYA 4I7FB 5CXTA 3LGMA 3P49B 2KFZA 2FIUA 2OD6A 3PW0A 3POTB 1TL3B 2R2UA 3NAHA 5E33A 2DNGA 3TYTA 3MURP 2XI3A 3TVKA 3V6DA 4J5OA 4DLEA 6FDRA 2RKIB 4H4MB 3KLEA 5FD1A 2UXCF 2M8DB 3DMJA 2RILA 2Y0SD 1HWKA 2V4RA 1NHVA 4DR1F 1JWWA 2EKYA 3CD6S 2X1GA 1URRA 3CULA 3VAGA 2JEGA 2QE5A 1FTCA 2FLPA 2HYIB 1Y5IB 4ICLA 1UVJA 1N48A 2XLIA 2KTQA 1WHYA 4W90B 5MLCV 1LFPA 3LH2S 2ZH3A 1D3WA 2XY7A 4ECRA 1VQ9S 3PX4A 2FLLA 1IQTA 1QAXA 1F2GA 2AYGA 3QJJA 5G0RB 3BGUA 3K5NA 3KNAA 1UJ6A 4I6AA 3CMAS 2M88A 4C11B 3UDCA 2ZOGA 1E6YA 4Q8EA 4ED2A 3RB4A 1Q81T 4FN5A 4HI1A 4ES2A 1FRLA 1GXUA 1H6KX 1IN0A 2FD2A 1DBDA 3D0GE 1S1UB 1UWBB 1FNOA 3GFZA 2AX1A 5L1JA 2NYIA 4YB6A 5GADU 2ZJPQ 2LYVA 4C8YA 4DL4A 5DDRC 2LQJA 2DO4A 2MKKA 2WONA 5B0BA 1JLQB 4X4NA 4OJGA 4CO4A 3LALA 1VFJA 1FKPA 1HQEB 1MMLA 1AFJA 4ELVA 3QAUA 3C2PA 3FMBA 2HZCA 1FCAA 5EGYA 4F4ZA 3OHAA 3KLGB 1HBNA 3I5AA 4JUZA 4ETZA 4ZK7M 3DM2A 2M0GB 1HNWF 2WAQD 2R7QA 2DH7A 5IS2A 3DC2A 4DUZF 2MYFA 3GFXA 3G6YA 2NLWA 3UD4P 4B3MF 2HWHA 2B6AB 5B0AA 1FXLA 2R2TA 2QSWA 5KFYA 4LF4F 3J81Y 1HPZA 1RT5A 2RT3A 4PG5A 1LKZA 2KFYA 2L41A 1KQFB 4F3OA 2CQDA 2CYYA 3B82A 1TL5A 2DCLA 2J7KA 5B0EA 3TOQA 3MMBB 2UVVA 3GSDA 1SJRA 2FVQA 1RT2B 5CZVA 1QVFR 3NNAA 2N3LA 4WJBA 2UUAF 4O23A 2E5JA 2QFJA 3AHPA 2YY3A 2BYCA 2LXUA 1LFWA 4USJC 5E3RA 2JX2A 2E9TA 4ZA1A 5DQIA 4K4ZA 3VWSA 2HGLA 3KNGA 3HT3A 3M8RA 2MB0B 4Y2CA 2XMVA 2XS2A 3MOZA 4I67A 1BGXT 2DGVA 3VZIA 4DN0A 4WCEQ 1Z2LA 3GIJA 3DGPA 4DQSA 1XMQF 3PHEA 3KLIB 1U1PA 3CJKB 2CPDA 1KNZA 2GC8A 3IWLA 2DNZA 3I6PA 3JB9k 3HZEA 4PR6A 1SH0A 3PM9A 3Q2TC 3N0VA 5F0WA 2LEPA 3MM9B 3T5LA 1T05B 1QSYA 3DRPB 2X51A 2R7SA 1M5KC 4KO0B 2Q43A 3V81B 2VASA 3OTCA 4FNHA 4KV8B 2VODA 2LLZA 3DLGB 3CVKA 2MZSA 1OSCA 3SFGA 3G6VA 1D8YA 3PRDA 1FRHA 5CYJA 1UFLA 4OZNA 4KE5A 5HROB 4L3NA 1Q8IA 1UVNA 4OI3A 3B4DA 2VG6A 1O51A 3KJVB 2HQIA 2XULA 1LV5A 1N33F 4O0IA 2KM8B 5F9NA 5KFPA 4DV1F 1S1TA 4C0BA 1ZTTA 2JVOA 3BSOA 3OQ2A 4DQIA 1A9NB 1QE1B 2Y1RI 4XPCA 4IRDA 4QCLA 1Z2ZA 3EGZA 1AFIA 1ULRA 3IRXA 3ZZRA 3FMWA 2EC0A 1E6VA 4OX6A 4YB5A 2LU2A 2HVHA 2OSRA 3J7ZT 2EBGA 2EFPA 3BREA 5AE1A 4PXBA 5L1LA 4QR0A 3IG1B 1WI8A 2A1BA 4CI0B 2GIQA 1CG2A 4X4RA 4IFYB 4WE1A 5KFRA 5JVHQ 2K1RA 3GILA 5F8HA 2BA9A 1VGYA 3JYTA 4F2RA 2YKMA 3CCMS 1R43A 4RW7A 2BUNA 3TAPA 2CPJA 2NXUA 2EG1A 4MK8A 1RTJA 3CJ4A 3ZZYA 2WRMA 5A6WA 3LW5C 1U49A 4Q8FA 2XB2D 3D1OA 3G6XA 3MR6A 1R8PA 3KG1A 3IA0A 3DRYA 4TU9A 3HVWA 5K14B 1N5TA 2JL9A 1HNVB 2VA3A 1VIOA 1N5YB 4DL3A 2WK4A 2KXNB 2LA4A 1RISA 1HMVB 1FKOA 1FE4A 2UXDF 5BJRA 4MAKA 4RWXA 3V6KA 2MJUA 1S6PA 1WG5A 3H5SA 3GFHA 2DTJA 3DOLB 2JFDA 3GYNA 3LP0B 1RTHA 5KFIA 3G8SA 4PPDA 3DLKA 4HKQA 1H7WA 1XC9A 3MDFA 4BC9A 3OSNA 3HF5A 2YKAA 1TV6A 1Y3JA 4N8OA 3OV7A 4DR7F 3FZBA 4FPRA 2ZKTA 1WELA 2J6SA 2FPHX 4ZPAA 4P7TA 2MZQA 2BANA 3ITHB 3Q8PB 3KHLA 4DSEA 1M5PC 2UXBF 1B64A 2GQQA 3HKZD 2R8IA 1YJTA 2MHEA 3H25A 2RMLA 1T3OA 1VQOS 2CPYA 1KFDA 4Y65A 4FVCA 3G86A 3S8SA 3G4SS 4O3QA 3J80Y 3H4DA 4F50A 4PG7A 4IUFA 2GX8A 1DTQB 2GHWA 4KHPF 3MM5B 1DTTB 2VFUA 2GA7A 4M1KA 1JXEA 4QR2A 2ZD1A 2FY1A 3LO3A 5CH7B 1F5CA 1ZBTA 1JJHA 3TR5A 1N52B 3FEXB 2MGZA 4I2PA 4ZCKA 1KQKA 2X1AA 2W25A 2X1BA 1VMBA 4RBVA 5LXYA 2FC9A 1YWXA 4URGA 2KU7A 1XNQF 4WFAQ 3RRHA 2V4JB 1A6LA 3U1MA 3EGWB 2LDIA 3LP2A 2ZKUA 4EO8A 2C3UA 2KJVA 1HFEL 4YMEA 1S0MA 1ZPVA 3OFGA 2OO4A 2V8HA 3D0HE 4ES1A 4QZVB 1SIZA 2ZH2A 1O5JA 1P27B 1RT7A 2J5AA 1QJHA 2QMWA 3KLHB 1SKRA 1WWHA 2FLOA 2VG7B 4NLWA 5AJ3F 1U1RA 2XS5A 4WU2A 4OJ1A 3VCDA 2B9YA 4EGLA 4LFCF 3PO5A 2GGPB 1XWLA 1FT8A 3UR3C 4LQ9A 1X4FA 1K8AT 3V5RA 4KO0A 4I68A 4DDFA 4EWTA 2BACA 3CPWR 3FCHA 5DM6Q 1KHWA 4B02A 5CCLA 4QWBA 3I55S 2A18A 2YWHA 2FVSA 1SJQA 1BQNA 4RW4A 3MECB 4DL7A 1DHMA 3QJLA 1X4EA 4YQWA 5C24B 5HLFA 2HS3A 1TKDA 4EU0A 1LWCB 2ZITA 3HVAA 4MJKA 2XMKA 2V2KA 3UPFA 4DR2F 5FLXY 1VQSA 2C3YA 2HNZA 4MIWA 3EUNA 5KT3A 1N56A 1DRZA 1NJZA 4AYBD 3T5HA 2F40A 3IGNA 1NK8A 1S1WA 1NO8A 4X66F 1N88A 1DZ5A 3O3LA 1M90T 1XMBA 4NZ6A 5J1PA 1BD6A 4HYKA 4OHYA 2KZMA 4YOEA 1LK5A 5GVQA 1HR0F 2W9AA 1UKUA 1LK7A 2E44A 3M1VA 4NCBA 3M6UA 2HNDA 3OTBA 1N4LA 2GCFA 1JMTA 3FNNA 2W4PA 4TQRA 2VOPA 1FDBA 5HN0A 1NZAA 2DD8S 1JLFA 1APSA 1HW9A 4M5DB 2ROPA 4WFYA 2J76E 2E29A 2ZDPA 1KONA 3KK3B 2LA6A 1SL0A 3FZ2A 4I2QB 4ZCIA 2G4BA 3DDKA 1X5TA 1OS5A 1BY9A 4DL0C 5KFGA 1RT6B 2R2RA 5J2QA 1CQNA 4OX8A 2VFVA 2WOMA 2PFFB 2O1PA 4JV1A 2ZZNA 3CTRA 2J6UA 2F8HA 4AQYF 3VQSA 1XR5A 2KM8C 5B0DA 2RD5C 3SDEB 3MPWA 4FNIA 2NQPA 2DITA 2KXHA 1J5OB 1SH2A 3MM6B 3T9ZA 4ID8A 5I3UB 1YJUA 2BM1A 1U1KA 1FRJA 1NRKA 4ZHRA 1D9FA 2ASLA 1QTMA 1KLNA 3M30B 2W9BB 2KH9A 4OZLA 1RYRA 1CQMA 3MUTP 1YI2S 4OHXA 1UW4A 2V9WA 3CMES 2HS4A 4JV0A 5IQ6A 3V4IB 1R7IA 1JNRB 1PC4A 5DG8A 4B9SA 2L3MA 3THVA 1FK9B 2FB0A 3C3LA 4A8XA 3DLLQ 4I7FA 3T6BA 3LAKA 1AUDA 3POTA 1TL3A 4LJMA 1NKBA 2UZAA 1XR6A 4ED1A 5SUHA 2M3DA 5D6GA 4IKAA 5G4DA 2RKIA 4H4MA 1IXKA 2DNRA 3OVSA 4KHMA 3OFHA 4CCHA 2F1FA 3WDOA 1JNZB 4C3KA 4GKJF 1RT4B 1LQ9A 4PPZA 4LQ3A 4I64A 2ZC3A 5KG7A 1R89A 2J8AA 5C25B 3TA2A 3UCZP 2GO8A 4N76A 5F8IA 2F9DA 1NEEA 2OPSB 2MZRA 2XY6A 5GAGI 2C2EA 4G1QB 3GG0A 5F0UA 1KC8T 1TL1B 2BV3A 2VONA 2E1MC 2IFXA 3PJWA 3JSBA 2ZH1A 2FLNA 5G0RA 2ADCA 4NOHA 4FF2A 4TNOA 1FTRA 2XSFA 4IR9A 3ETOA 2RRNA 3OW2R 4QJVA 2RU9A 4FXWA 4C11A 2D74B 3SXLA 1FVSA 4F4WA 3SSSA 3M2VB 1MMDA 4M8LA 4RNNA 2QO3A 3CO9A 2CQCA 1HHTP 1NAQA 2NR0A 1SUQB 2M9KA 1S1UA 1UWBA 2DHSA 3IN5A 3NNCA 1ZM2A 3QZ7A 3DXBA 3M2UA 1IQZA 4X62F 5KFSA 3FJ2A 1JLQA 4LT6A 2VOOA 2NZ4A 1HQEA 3EGNA 1KSPA 2E66A 2JWNA 3CC4S 4UY8T 4ILLA 2YTCA 3KFWX 3DYAB 3JAMY 4FYDA 3JTNA 1G3OA 4EYIB 4K4YA 4R8UB 3KLGA 3EZUA 3DOKB 3M9NB 4X65F 1JKHB 4BDPA 1NK7A 4DLGA 4WK1A 4Q0BB 4NZ0A 3TP2A 2CPZA 4LVOP 4LF5F 5B0FA 2B6AA 4A8WA 3M32B 4DWIA 5E0OA 5A8RA 5C42B 2ZUGA 2OMLA 2AV5A 2I8EA 2WB1D 4OI1A 3GFYA 3TI0A 2N7YA 1V3RA 2IA0A 3MTJA 3OR2B 2ZFHA 3R5BA 5DQGA 1S6UA 4O44B 4WFNQ 2MXYA 3CWJA 4I56A 5KFMA 1T95A 3KG0A 3VAHA 2VA2A 1X9WA 3J7YI 4C8ZA 4ED5A 4KTQA 4RW6B 3CCES 1KFSA 5KT5A 1CSJA 3MMBA 4RW9B 1U1NA 1RT2A 5KFJA 5KFHA 3V6HA 3KMSA 1D9AA 2W8LA 3CB4A 2V8VA 2XWXA 3HHLB 2E1AA 3Q22A 4RNHA 2ALZA 5A6PA 2K3KA 4P7VA 3UWTA 5DDPC 1VQPS 2B43A 3QLHB 1YRXA 2FHOB 4NPOA 5DDQC 5K8NA 3KLIA 1YJRA 1ZOTA 2IMOA 3CJKA 3CD0A 5D3GB 2PT0A 3AAWB 2LQBA 5KFUA 1FVQA 3N5FA 2OPRB 2QEXS 2R9LA 3MM9A 2W7OA 1Y4ZB 4BC7A 3DRPA 4BBYA 1JLEB 2HMIA 1X5OA 3IS9B 1BQMB 1WI6A 2W4CA 2ZOMA 4B3OB 4IOCQ 3V81A 4KV8A 1JLAB 3HDSA 3NCRA 4DHVA 1SXLA 3DLGA 4ZP7A 4JOUA 4D3GA 2CQ2A 4CZCA 1OWXA 2LECA 5HROA 2UV8G 3CDBA 5MAOA 2ZH9A 5I3PA 2GIRA 3J7A1 5L1IA 2V4QA