1R27B

Crystal structure of nargh complex
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
465
structure length
465
Chain Sequence
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKPGQGFPTDWENQEKYKGGWIRKINGKLQPRMGNRAMLLGKIFANPHLPGIDDYYEPFDFDYQNLHTAPEGSKSQPIARPRSLITGERMAKIEKGPNWEDDLGGEFDKLAKDKNFDNIQKAMYSQFENTFMMYLPRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKDLYQRQLDVFLDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMVWYVPPLSPIQSAADAGELGSNGILPDVESLRIPVQYLANLLTAGDTKPVLRALKRMLAMRHYKRAETVDGKVDTRALEEVGLTEAQAQEMYRYLAIANYEDRFVVPSSHREL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Respiratory nitrate reductase 1 alpha chain
publication title Architecture of NarGH reveals a structural classification of Mo-bisMGD enzymes
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 149
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature ec 1.7.5.1: Nitrate reductase (quinone).
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
B PF14711 Nitr_red_bet_C Respiratory nitrate reductase beta C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3650.10 Mainly Alpha Orthogonal Bundle nitrate reductase domain fold nitrate reductase domain like 1r27B03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r27B01
2C3OA 1FRIA 3HKZD 1GT8A 3MM6A 2C3MA 4Y28C 1AXQA 4OMFG 6FD1A 1H0HB 2GMJA 1FXRA 1FDNA 5L8RC 4YDDB 1FERA 1WTFA 1FRJA 2Y0SD 1FXDA 2PDAA 1CLFA 1ROFA 2VPWB 1JB0C 3MM9A 1FRXA 7FDRA 2FJDB 3MM7A 6FDRA 1FDDA 2O01C 1BWEA 2C42A 1C4AA 4XDCA 5FD1A 1Y4ZB 1FDBA 2C3YA 4OV1A 1D3WA 2C3PA 2UZAA 1PC5A 3EUNA 1DFDA 1HFEL 4XK8C 5E7OB 4CI0B 1FF2A 3MMBB 4ID8A 5BYRA 7FD1A 1FD2A 1GTHA 1K0TA 2FGOA 1B0TA 1RGVA 1Y5NB 3EXYA 5CH7B 1KQGB 4DHVA 1FDAA 1Y5IB 1H7WA 2WSFC 1XERA 1A6LA 1F5CA 1Y5LB 1FEHA 3OR2B 3OR2A 3PNIA 1IQZA 1KEKA 1BD6A 1BQXA 1G6BA 3MM5B 1F2GA 1GTEA 3EGWB 3MM5A 3C8YA 1JNZB 5CHCB 1FRMA 1JNRB 2VPZB 3MMBA 2VPXB 2V2KA 2V4JB 1IR0A 3IR5B 1FRKA 4L6V3 1B0PA 2PA8D 3IR7B 3GYXB 1H7XA 1SIZA 1KQFB 4AYBD 1Q16B 5BYSA 1SIWB 3MM8B 2WAQD 3MMAB 3LW5C 1SJ1A 3MMAA 1R27B 4XDDA 1B0VA 2VKRA 3IR6B 3MMCB 2FJAB 3MM6B 2XSJB 1H98A 3MMCA 2XSJA 2Z8QA 2WB1D 1DURA 1FTCA 2IVFB 1GAOA 1FCAA 1FRHA 1PC4A 4KT0C 2FD2A 1FRLA 2V4JA 2FJBB 2FDNA 2ZVSA 2C3UA 1F5BA 3MM9B 2FJEB 3MM7B 2WSCC 1BLUA 1BC6A 1C4CA 1VJWA 4RKUC 1G3OA 3MM8A 3OR1B 3OR1A 1DAXA 2PMZD 2VPYB 5BYQA 2WSEC 2GMHA
chains in the Genus database with same CATH superfamily
3L7PA 1RT1A 2AQ4A 1TELA 2H51B 2RU3A 2IA0A 1C1CA 3LP1A 4HLBA 1NRKA 2CQGA 1NHVA 3T1AA 3KLHA 3EUNA 5HMWA 2ZE2A 2ZITA 2X51A 5J2MB 4CTAB 1CJUB 3AODA 2YX7A 3DU5A 4NMLA 4BC9A 4AFFA 1B4SA 1NLKL 1R8BA 3I87A 1X4BA 4C8NA 1F9HA 3MEEA 5HN0A 1NSPA 2IRXA 3SFGA 2VFSA 4KKOA 5IT0A 5LMNJ 1VQSA 2RKIA 1OSDA 4R25A 1CS4A 2H5JB 2JNJA 4WFZA 5M2RA 1HWLA 4PWDA 1NB2A 4H4OB 3JSYA 1X7VA 1MWYA 2WONB 1VK3A 2ZD1B 2Q43A 4NEZA 1RAAB 1UPMB 3FCVA 2CPZA 4OI2A 2FHJA 1FXRA 4K4YA 3PEHA 3CCLS 2GHPA 2V68A 1AFIA 3OW2R 1IKWA 4ED2A 4LR9A 2A3JA 1U1KA 2B43A 2YPYA 1BWEA 1VIOA 1RA7A 2BW2A 2FGCA 1RTDB 2NS1B 1QAIA 1L3VA 5IV4A 5KFJA 3K5OA 2MGZA 2DO0A 2D1CA 3NGKA 4A46A 3M1VB 3VQTA 3Q8QB 2KYZA 2DCUB 4R8UA 4I2PA 5DGBA 5AE2A 2M0GB 4UZCA 4AE5A 1NHUA 3M8ZA 3NCRA 1X5SA 1FFWB 3KDOA 2MJUA 2JDJA 1D1UA 4M5DB 4RU2A 3W2VB 1P9QC 1S1XA 2MEWA 1XMOF 2JVOA 4DUYJ 4MIBA 3R5GA 2FVPA 3ZNUA 1Q7LB 1IKYA 4X62F 1XR7A 1U8SA 2AHOB 2ZH2A 5L1IA 3A8IA 5GMEA 2JH3A 4F26A 2V2VA 2J5AA 1MWQA 4KQZA 1WKKA 4Y28C 1NCLA 4PXBA 2FLLA 1OSCA 5GMKa 1NDLA 2PD1A 3OTBA 1J2VA 1W7WA 4CZCA 2KG0A 2BJ3A 2E1CA 3RGIA 3BBFA 5D15A 5KFVA 3MUMP 2V50A 4DG1B 3C16B 1TL7A 4ZHRB 2NPIA 4WKRA 2R42A 2HYIB 1Q8IA 3F44A 3J7A1 3BH7B 2RF2B 2DR5A 4D3GA 3M2UB 1YRXA 3UDLA 3TZXA 3R5BA 3MAAA 4BS2A 1A0OB 1NM2A 2ZH6A 4JV2A 4OLPA 1HQUB 1I1GA 2XSJB 4WYLA 4J9RA 4YR0A 3LOUA 1NAQA 2AMCB 1LWCA 4CH7A 3QIPA 2ZOFA 2FUG9 4FNHA 1WHVA 5AJ3F 4P73A 5DDRC 1X5OA 2XS7A 1JLEB 2A10A 1P27B 1QE1A 3BS9A 3DU6A 2MDAA 4K5SA 2R7XA 2W25A 4PG5A 4DL5A 2DNRA 4F3MA 2RDIA 1N36J 1CJTA 3OSNA 3J7ZT 4IRDA 2OPQB 4DR1J 2W8LA 2PFFB 4ZVEA 4ZVRB 1RACB 1UWAA 3KLVA 3ZC4A 3TVKA 2FJVA 4ITSA 3DRRA 3C14B 4RW4B 1UJ4A 2MQPA 1KD1T 3HHDA 2XLIA 3TWZA 4ICLB 2CVEA 4Y3CA 3M30B 3J80U 4OX9F 3SQGB 3F56A 4C3KA 1WSVA 2IJRA 4NLPA 4ALZA 4ECTA 4G1QB 4X66J 1HW9A 2HVEA 4FF1A 1RISA 5B0AA 4OYBA 2BA9A 5GAGU 1LK5A 1I5OB 1S99A 2C2MB 4DSLA 4KC5A 3DOMA 1Y11A 1KHWA 1T7PA 3RU0A 2XSFA 3H4DA 3GP9A 3N0VA 2Y1LB 5CYMA 3H59A 1N48A 2VBYA 1DQAA 2N7YA 3W9HA 3DYAB 5GADU 3JTPA 1X9SA 4ZVOB 4NXNF 4W98A 4EU0A 3G71S 4G6VB 5BXIA 3RBDA 3FDSA 3MUTP 5ETKA 4OV1A 1WSRA 2C3PA 3K58A 4GC6A 2UXCJ 2HW3A 2HHHF 2ZWOA 2ZH9A 2C1EB 4LF5J 2DHSA 1V3ZA 1HIYA 2IAJB 5BR8F 4LR8A 2HG4A 3UR3C 5L39A 2ACYA 2ZNYA 1YJWS 2RDJA 3GV5B 1H74A 2E7WA 4LRDA 4O3QA 4N7TA 2Z0GA 3PW5A 2GQCA 2P6TA 4RW6A 3DXSX 1D8YA 3W65A 2OD6A 2G1HA 4RNHA 2OTJS 2E1AA 4FBUA 3MEKA 2KG1A 1ZA2B 1CEZA 1RHRB 1RWXB 2YBVA 1UFLA 4ED6A 1EHWA 3HJFA 5KT6A 5LMUJ 1Z1ZA 2RQ4A 2LQ9A 2AEFA 4M95A 1KQKA 4YHHF 5IQQA 2M4MA 3OR1B 5D4NA 3G82A 4YR3A 2VPYB 2UXBJ 2B5JA 3NGDA 4DR6J 1NDCA 3QAEA 4A8OA 3AA9A 4HI2A 4OZ3A 4DSKA 4OZ1A 3W5XA 8RUCA 2KTQA 3K8WA 4ED5A 4P7VA 3J81Y 1HR0F 2VG5A 3EZUA 3JXOA 4O4GB 4B02A 5HQLA 2AYGA 4ZVUB 1E6YA 3MUVP 3THTA 1LKZA 1VCTA 4NA2A 2ZJRQ 5ETQA 3MOJB 1XERA 1PJ7A 1RUSA 4TU8A 3MFIA 1V6HA 2M7SA 3LPYA 4ETXA 3NS6A 3A3NB 1U26A 3PX4A 5CHCB 4CT8A 3C6UA 4E98A 1M1KT 4P75A 2CQBA 2QE5A 2ASJA 1NKEA 2FLNA 1B0VA 2VKRA 2W7AA 2ZZTA 3RR7A 3CC4S 7AT1B 3OXLA 4C7QA 4KIAA 3PRDA 2D3O1 4X4PA 5C42A 1CSJA 5KT3A 1SV5A 2ROPA 2FTRA 1K9MT 1PJ6A 2QLWA 2V4RA 3POTB 3OUYA 2QTWA 3PFOA 3WZ0A 4XAKA 3N28A 1QTNB 3ZZOA 2PA3A 1G7CB 3D0HE 3BPDA 4WZMA 2N3OA 2AYMA 4GVLA 1X9WA 4TQRA 2BANB 2CQCA 2XMTA 3I9ZA 1B99A 3MR2A 2DRDA 3FK4A 1XR5A 2I38A 1U45A 1HHTP 2IHR1 3PIPQ 4FPIA 1WC4A 2H5EA 1RWNB 2EKYA 5C25A 4TY9A 3OVSA 1TL1A 3K5PA 3D67A 1CULA 3NY0A 3QWUA 4WCEQ 3KG4A 1U4BA 2Y1RI 2DHXA 1OQ6A 1XMQF 1NK4A 2FJBB 3TVZA 2W2MP 4XIUA 4F4KA 4B3TF 3JS9A 3CCMS 1GQEA 3AAWB 3TJ8A 2SXLA 4DBQA 2MKIA 4ZCLA 4ECYA 4XTTA 1PSDA 3HSGA 2PDAA 4WU3A 1RT3B 4NA3A 3D1HA 4M5KA 3V4MA 4C98A 3IBCB 3LGNA 3T5LA 2QJ3A 2HHTA 2DR6A 5HLFA 1LW2A 3EPIA 2CQDA 3KMQA 4DDFA 1T8EA 4D3HA 3EXYA 5CABA 2RS2A 4FXDA 4TVAB 2HVHA 2DIVA 1FFGB 3GJQB 1Q7YT 4USJC 4OZNA 1NUEA 2DGQA 4IG0B 1TP7A 1FVSA 3A3OB 3MM8B 4KYZA 2L9NA 3SQOP 5E3PA 2IY5B 3A8KA 2GVDB 4DCPB 2ZBPA 3JSBA 3UCUP 4GO7X 1RI7A 2PMHA 2F1FA 2OPSA 1ZYQA 5BJRA 4DX6A 4JP8A 1OJ4A 2CJBA 3W1YC 1RT2A 4FF2A 1VFJA 2ALYB 2WB4A 1JLBA 4WFAQ 2ZH4A 2K06A 4NLOA 3IMQJ 2DVIA 2K7JA 3V2UC 1TL4A 3ZTQA 5LOQA 3U27A 4LBPA 1BHNA 2LECA 1JKHA 2E5LF 1UVMA 5E3AA 1VRTB 1H7WA 4I67A 5I42B 1FI4A 1FEHA 1UW4A 4OX6A 2VV5A 5B08A 2R7QA 4JI6J 3MCSA 2B56A 5IT4A 2HFSA 4ZCIA 1HNXF 2WRMA 4LF8F 2H9ZA 3OTOF 1N54B 3LP2A 3CJQA 2EVZA 4DL3A 3I55S 2Z2LA 4TYAA 1S0VA 3UD5A 1J5OB 4WJBA 3KUEA 1F2HA 1S7IA 3HK2A 2BKOA 4YY3J 1DY3A 1LWEA 4LRBA 2EBEA 4LF6J 2C2DA 5DLGA 4J90A 2AP6A 3US5A 2M8HA 4F0KA 2OEMA 1IXKA 4EBCA 2WW8A 3NLCA 4NYOA 1DTTB 4LSNB 2BW7A 1JLQB 4XK8C 4KTQA 3I4HX 4CO5A 3L95X 4PXCA 4N56A 4H4KC 3BBBA 1GX6A 1YX2A 4NLXA 1JJHA 3OXGA 1RADB 3TAPA 4B9UA 3PW2A 4NE9C 4IG3A 3HSZA 1UTAA 4ILLA 2EPIA 2W9BA 3IM8A 1N8RT 2H65B 2ZM6J 1L3SA 5HATA 4F02A 3M6WA 4U96A 3AOAA 3A1YG 5GAEU 2ATCB 2OMLA 1RT6B 1F5BA 2NCKL 4ZIWA 3P6YC 1S6PA 4I69A 4K5RA 2AX0A 1QUVA 2E1RA 2UU9F 1NK6A 2PO4A 4I7FA 3DLGA 1FRIA 3TA1A 2PGCA 2F4VJ 6FD1A 4DV1J 3PX6A 3BJYA 3B78A 3L3CA 1RAHB 1TZ0A 2MMYA 1NXIA 2VKZG 2YNFA 1FD8A 2QMXA 3TUZC 4OZLA 3FJ2A 2OEJA 4RBVA 1EX8A 2AJ1A 4B08A 1U48A 1TFWA 1WOOA 1GFWB 1HBUA 5HMXA 1OY9A 2D3UA 1RCXB 3HHLA 4WWSA 3TAMA 1KNZA 2X1GA 2NLWA 4MJKA 3CNQP 3OFFA 3E51A 2V6AA 2PIIA 2M9KA 1P8GA 1X4GA 5KTQA 2P6SA 4UT4A 4I6YA 2MZSA 4IFVB 1R27B 2YWKA 1OPIA 2HQDA 3C3LA 4QR0A 4BC7A 5U47A 2Z8QA 2HHPA 1TKXA 1V3SA 4F4YA 2NQPA 4Q8EA 1RQ0A 3RB0A 2M88A 4CH0S 4ED4A 1ZH5A 5GADI 5D0GA 5IWAF 1IKXA 3TZWA 1SBRA 2I9SA 4CLKA 2WTFA 2VIHA 2LEBA 5HP1B 3GONA 3W62A 5HQMA 1Y3KA 4DQPA 3DRSB 2EFVA 2Y0SD 3E8OA 4Y2KA 1U6ZA 4O0NA 4AUKA 1NZAA 3UPFA 5DRKA 2HFOA 2DXFA 2MLYA 2HMIA 1MU2A 3FC9A 2FVSA 2ZJPQ 4PXDA 2C2EA 3UNYA 1RB0A 1IBMF 4Y6IA 3AHPA 1VS3A 2XZDB 2Z2MA 3D0IE 3FFIA 4B3OB 4ZLJA 2R8HA 2UXDF 1SQFA 1RTIB 4BLGA 2H54B 2NYIA 1OWXA 1RJJA 1R6VA 4FXWA 5J2PA 1HYSB 3W8PA 4E8UA 4NCGB 3KK1B 1BQMA 2CZVC 1X0PA 2W24A 3H98A 4FXVA 3I56S 3VAKA 2MKYA 4RW7A 3HVTA 2L48A 2Y9HA 1VQLS 3PCOB 2RE1A 3CMQA 3I32A 1T0TV 2GMJA 1YBTA 3ITHB 1NJZA 1SC1B 3X1LB 5T14A 3DMJB 4I2QA 3BGUA 5HBMA 6FDRA 5HSPA 1EJ7L 3M8PA 1XNQF 2Y1IA 2CNKB 2J0XA 1LW0A 3LGMA 4PUOA 1RAGB 2VJUA 3TI0A 2HGMA 3IG1A 3GSIA 4QQBA 4NLRA 4ELUA 4IOCQ 1U0HA 4EWTA 5KFUA 4P74A 1JMTA 3QT5A 4F8RA 1JLGB 4B3MF 4HHUA 3M32A 2BJ7A 1NPKA 4UOCA 1WHXA 4GVBA 3NKYA 5HVFA 3MEGA 2CKWA 3VCDA 3ZTPA 1XNRF 1PIEA 3TR5A 5D3GB 1DURA 5KFIA 2JFKA 4RX6A 2XY7A 2MLZA 2CQ3A 2AJ2A 2LQBA 1RWVB 5LT5A 1HBMB 1A9NB 4UZBA 2YNGA 3NWGA 2DGXA 3Q89A 2VQFF 3OL9A 3TOQA 3I0RB 2JEIA 3L7OA 3OTCA 3FQKA 4URSA 4A47A 4RL1A 3M05A 1T9XA 4MK9A 4FDFA 1LV5A 5J1PA 2W4PA 5I4MA 4P2MA 2Z30B 1BWVA 1EAYC 5SUHA 4CM0A 2KO1A 4LBHA 1PGZA 2M2BA 4WU2A 2FY8A 2F9JA 3VTIA 2IC3A 2MKKA 2FHKA 6AT1B 2E29A 1YWXA 4FNIA 3CJKA 3CXCR 3D1OA 3PIOQ 3JYTA 1UJ5A 2A6MA 3QYYA 3D6MB 3K57A 3NGUA 3LH2S 2R7WA 3GWCA 3RBEA 3QJPA 2GAHC 2IA6A 3R27A 2ADCA 1KVIA 2AYBA 2X7IA 4OYMA 3W2WB 4NYPA 2HWTA 2XZWA 3MD1A 5ETOA 5FLXY 5F8GA 1N34J 3CC7S 4PG8A 4AL5A 4DMZA 5IXUA 4RUHA 4K4SA 2XB2D 1JLFA 1TV6A 2W2PP 3MZIA 1TK0A 4DN9A 2NXCA 2CADA 4K4WA 1GX5A 2CPYA 4OHZA 4HACA 3NBPA 4KGXB 4K2XA 1YDLA 3GFYA 1R31A 1MMLA 4PEOA 3PRVA 2GAGC 4DQRA 3P4UB 2HVZA 4YFUA 1J27A 1ZTWA 4ZPCA 1F5CA 2QSFA 5CZVA 3I0SA 5AE1A 3N6NA 4DV7J 2IVMA 5AXKA 4HVZA 4J9VA 4CH1A 3DLJA 2UV8G 3MAHA 3T6JA 2CYYA 1U1QA 2EG2A 2ZWPA 2DEIA 4DV3J 3ETOA 2JLEA 4ZLNA 3E01B 2RAQA 1BLUA 2YKPA 2B9EA 5BYQA 2MJNA 5DG7A 3PTWA 3QT7A 2RNEA 1NK0A 1RBAA 4YDDB 3A13A 3RAQA 2LDYA 3QZ8A 3JSMB 2E5JA 5KG1A 1YBUA 3SV4A 2LXIA 1B7YB 3CDWA 4CWBA 3MMJA 5T7LB 2FGOA 1FNXH 4QBUA 3D6FB 2BX6A 4QR2A 3F73A 2DD8S 5I3PA 4JI7F 4TN2A 3L4BC 2E7VA 1MMDA 1N0UA 1IR0A 1S4EA 4F4AA 4F3QA 4LF2A 4I6WA 4X4SA 3S6EA 3P96A 4USVA 3CC2S 1URRA 3NRBA 2IIHA 5K14B 1S48A 2O66A 1HPZA 4NLVA 2ASDA 1XC9A 4KGZB 1SQGA 3JQJA 4NLUA 2YWHA 1XBWA 1I94F 3BYPA 2AWZA 4H4MA 5F41A 3IS9A 1IKVB 1D9FA 1CPZA 1C0TA 4EUVA 4ED3A 1TTHB 1FERA 3Q22A 5D4LA 3KK2A 4GKKF 1D0EA 2OPPA 4HHHA 1DJ0A 2XWYA 1WC6A 4LSZB 1N5VA 5EGYA 1DLOB 3DLEA 2W8KA 3PVXA 4LF4J 1PG5B 3ZZZA 1P9YA 2PEBA 2L41A 4LQ3A 1N33F 1VI7A 1VQMS 1VISA 1FJGJ 3PY8A 3D28A 2WCXA 4PQAA 5KT2A 1FRKA 1SUQB 3EXCX 1RDRA 3GYXB 1CJVA 1D09B 3ET6A 1U47A 3OPKA 1UVNA 3TA0A 4ZPDA 2VODA 2FYXA 5CYQA 2J7UA 5K20B 2DT9A 1JLCA 2KYXA 4TQSA 1RCOB 3BGRB 4LF7F 2YWWA 4Z7CA 3UE2A 3H8YA 1DZ5A 4S0MA 4DUZF 4P72A 3BF4A 3HPOA 3GFXA 1RT1B 3KJNB 5L1KA 4OMFG 1Q4RA 1K1QA 4N76A 1C1CB 1K47A 2BEFA 3Q8VA 3LP1B 4L3NA 2AGQA 1QAJA 2HHUA 4UY8T 1HMVA 3CJTA 3CPWR 1RAFB 4ZLLA 1UEKA 3KLHB 1WELA 2XGQA 2C2RA 1FO1A 1S72S 2GIQA 4KFBA 2HQCA 1NSAA 4DX8H 4GMKA 2ERRA 1RK8A 1DARA 4ZOSA 1W2BR 5DZ7A 2G2ZA 3FVYA 1HQEA 4CLWA 3PJ9A 3PNIA 1NEEA 5EN1A 4HDGA 3B4DA 3MEEB 2VICA 1OPZA 2FVCA 3NCQA 2BRLA 5LXYA 3T19A 2QEXS 2MY7A 1CJKB 2JVRA 2YPZA 3H4BA 1MROA 2RHQB 3UI3A 4PWDB 3K0JA 5THWA 3IFEA 4M5MA 1SC3B 4DV6F 3LQVA 2NXEA 2YNHA 4ED7A 3V6DB 1VJWA 5HK4A 3LUYA 3SCLE 4LJMA 1XMBA 4IQMA 1MN9A 1KLMB 4M94A 4YB5A 2VQEJ 2ZH5A 2Q3PA 2KT5A 4LF9J 4X2BA 1Y0HA 3QATA 2G2OA 5I3UA 2E66A 4JI3F 2LMIA 5KG7A 2UUBF 5E7OB 3EMTA 3M7VA 3T1YJ 4DHVA 3CD7A 1MN7A 4X4VA 3DOLB 2XMAA 3ZZ0A 5K8OA 5HJXA 2DB1A 5DQGA 4B3SJ 1CQMA 2GHWA 3QSIA 2ZBCA 2E44A 4O44A 4QPXA 3H2LA 1S6UA 3SSSA 3BO4A 3U7JA 2CVIA 5GVQA 1D8ZA 4KRWA 4RW8A 2NXUA 1IBKF 4KT0C 1R0CB 3C15B 1ZM4A 2YKNA 4OIXA 2MKSA 2KZMA 4USMA 1K8AT 2HBZB 4LIRA 4OYIA 4C0BA 3CE8A 3C66A 4QOTA 2B8PA 3S01A 5CXTA 2HRYA 1VRUA 7FDRA 4GKJJ 3IGNA 3TANA 2FHJD 4CO0A 4NX9A 2BE7D 5K8PA 1HFEL 4BWMA 5B0EA 1D9AA 3GU0A 2DITA 2XMMA 4QIEA 2FC9A 3CTRA 1ICEB 5J2QB 4NLQA 3TNVA 4PPZA 2ASYA 2DGSA 2AJQA 3ILOA 5ETMA 5C7PA 3W3SA 5C2CA 4HKQA 3CJRA 2HWHA 3B6BA 4JI2F 2V2KA 3ZZTA 3W5ZA 3MAAB 5LSLA 2YKOA 1X5PA 1RT5B 4P52A 3MMCA 5F8IA 5EHHA 3QIPB 3UFCX 3MM7B 3EM1A 2LVWA 1QE1B 4ZP7A 2IM2A 3HKZD 1VQPS 1CJTB 1C0UB 2KRBA 2QC3A 3DHXA 1T94A 1F0XA 1FDDA 2BMBA 2E5HA 2Q6CA 5B0FA 3DGVA 1YSJA 4F4WA 3IRXA 1AFJA 3M8RA 1Q79A 3QZ7A 1Y5NB 3IP0A 3THVA 1S1WA 2WSFC 3J80Y 1BD6A 1TKZA 4HDHA 2HS4A 5J1NA 1S10A 3EGWB 2AT1B 4KGMA 2D74B 5B7WA 3HT3A 3BKTA 2LQJA 3KNAA 5C24A 2MHEA 4CTAA 4F25A 1CJUA 4NXMJ 1ZM3A 4Q7AA 1YHQS 3GB0A 1JLAB 2CQ1A 4JV1A 5JXSA 4BHQA 3P3DA 1XR6A 1FK9B 1ZS6A 3I5AA 1X5TA 2DNGA 4DU7A 1UMJA 2C2OB 3MM9B 3Q23A 2VONA 2JEGA 3DLBA 4Y2MA 2XS5A 4KO0B 4C8LA 4DV5J 1VLOA 4H4OA 3DI6B 1RT4B 4BCAA 3M9OB 4CM2A 3HF5A 4ZA1A 3IAM9 2YTCA 4YR2A 1PYSB 4EO8A 4CI0B 4KHPJ 4X65F 4UOFA 4G1PA 3ZO7A 2V69A 1JJ4A 3R5JB 1EKRA 4C11A 1Q81T 4JYAJ 1WJ9A 3A8EA 3D7SB 4DR2J 2QX0A 4HT5A 3HHKA 4ZVGA 2ZH8A 1RTDA 5ETTA 3E2EA 1H6KX 1REGX 1R8AA 5HO4A 3O1LA 4CLUA 2HRTA 3CD0A 1SIZA 3ZTRA 2L08A 4DF8A 1ZBTA 5DJBA 2IBOA 2OAUA 5HANA 3EDQB 1EKSA 2BJ9A 2R7RA 4BDPA 4P2FA 1MG7A 2JSXA 1WF1A 4RWXA 1U2CA 4M1KA 4CT9A 3PDNA 2GMLA 3SEOA 5A6WA 2PMZD 4OZ5A 3MURP 1R43A 2NSCA 3D6TB 4FYWB 2V2QA 2Z2ZA 4ZMMA 3H40A 1V5IB 3PXGa 1GXUA 1X4HA 2XMKA 1Q5VA 1X0FA 2FVQA 2JJ4D 5AE3A 3VHQA 2VPWB 1UFKA 1S4FA 2O01C 4ZPBA 4DR5F 2VG5B 2GIFA 4B3RF 1QAXA 1E6YB 2BJDA 5SZTA 2JOQA 4ES2A 2EFOA 2P8IA 4DL2A 3GR0A 4OJGA 4DR3J 3OR2A 3LF0A 4U8VA 4DQSA 3CF5Q 4DG1A 3C16A 4A8XA 1VQ7S 4DV4F 4NI2B 4EMDA 4ZHRA 2FC8A 4DV0F 3EPGA 2RF2A 1SXLA 3M2UA 3QRQA 3OSPA 3OL7A 1SJQA 3RRKA 2CQ4A 1HQ2A 1UL3A 3VGSA 2WSEC 4MTPA 3FKBA 3OUYB 2E9TA 4ES1A 3T41A 3LANA 2CG8A 1WTFA 2AIRB 1YBAA 3B82A 2WVCA 4YDXA 3I9V9 1JLEA 1YZ6A 4YEAA 4CO2A 1KTVA 2DK2A 3IM9A 4DV2F 3CJ0A 4DL4A 5BYRA 3UVJB 2OPQA 2KXFA 4WFXA 3OT9A 5DETA 3MI7X 2AGPA 3R2DJ 4J7CA 4ZLPA 1OQ3A 3N9UC 4IO9Q 3IR5B 4ZCKA 3C14A 3P45B 1QVFR 3SXLA 4KJIA 5C25B 1AB8A 4EEYA 2EK6A 2RQCA 1HNWJ 1CULB 3MECB 4MKAA 2GJIA 2KJWA 2VZ9A 3DLKB 4TXSA 3ZFVA 5J2NA 2QMUB 1NB7A 4O4RA 1EETB 3JQMA 4LRAA 1GMWA 4G1QA 3KHHA 5KFFA 1UP1A 1JX4A 2KU7A 2WBRA 1VGYA 3G2XA 1AUSL 4FS2A 1ELOA 2LEPA 2EXUA 1EZZB 3P5TL 3OFHA 1HI0P 1W2IA 4QU6A 2I6WA 2ZBIA 1CLFA 4JBCA 3FNNA 5M2PA 5DLFA 5M2UA 2HNDB 4K0KJ 2HLUA 2CG4A 4OHYA 4X4UA 4N77A 3DYAA 2BDPA 5KFXA 4OJ1A 4R5PA 4NASA 2ATLA 1LW2B 4PWWA 2AEJA 4A48A 3OHAA 4LFAJ 1ZM9A 1NDPA 1HWJA 4CIOA 2EW9A 2VD3A 4O0IA 2OTLS 3AD8C 1FHTA 3T5JA 3SSRA 5LMNF 1R0BG 1APSA 2IAJA 1ZM2A 2B7CB 4U95A 4ED1A 4FF4A 4FYXB 1IM4A 1QJHA 4MYTA 3BYRA 3GV7B 3DGPA 2K3KA 2XS2A 4J9MA 2CWXA 3QGPA 2OPSB 1FWLA 2CZ9A 2W01A 3IWLA 4OZJA 2B4UA 3R7BB 5KOWA 1SC6A 1HHSA 3FUYA 1C2PA 2AGOA 5H1SV 1RABB 1HBNB 4QW9A 4YB6A 1QSSA 2LCWA 4QWEA 2H3EB 2Z56B 3DM2B 4USHA 4IUFA 2V8VA 4WFBQ 4WTOB 2DGVA 4MIWA 4AL7A 1JKHB 1UZHA 5F0WA 1G1XA 2DH8A 1VQNS 3DC2A 1H3DA 3CCUS 2D69A 1NJXA 2QA4G 1WEXA 2MY8A 3J81U 4JI5J 3KK3A 4O4GA 1FVQA 5HI7A 4CLLA 5L9NA 1O51A 4TNOA 4A8MP 3GJSB 3RB4A 3EYZA 2IPOB 2ZDOA 2UVWA 1S6OA 4DUYF 2OD4A 3BDEA 1LK7A 4X64J 3UR0A 4Q2MA 1L3TA 2VG7B 2ZUAA 4K59A 4CDIA 3J81j 1H73A 2IYIA 4OL8A 2AZ1A 1EARA 1Q95G 4FKYA 4K4XA 2Z58B 3MPWA 4J9QA 3CIZA 3PW7A 3ULHA 3W9JA 2W1BA 2GMHA 1LWEB 1IM6A 1DQ8A 1RHKB 2MKHA 4C6AA 3QSYB 4P9SA 1H2UX 2ASLA 1MLAA 3HFVA 4ECWA 1U1RA 2KFYA 4P7TA 4RWWA 4MMOA 1RLDA 1BQNB 2MXYA 4ZN3A 4F67A 4Y0FA 3MMBB 4LFBJ 3U1MA 3PRBA 7FD1A 5A8KB 1YGYA 5ETLA 2B51A 2BM0A 2WBMA 1XTZA 1UA0A 3R6GB 2W2QP 1V3RA 2RQKA 3R5DA 2NR0A 3MPYA 1WC3A 3HZEA 1SH3A 2B9WA 1KQFB 4CNYA 1SCJB 3NGSA 1ZETA 1SJ1A 2W9BB 2J9EA 4K4UA 4J9SA 3OLAA 2GCFA 4RNFA 1M5PC 2DNQA 3PG9A 3MM6B 3QJJA 3BQ2A 4YUDA 5A0YA 2CDRB 3GLJA 2LA4A 2VBXA 4AQYJ 2CAJA 1S6PB 1VMBA 3QWPA 1VQ5S 3T1HJ 2DGWA 4C97A 1N36F 2P5VA 4I7FB 1S9GB 2CJXB 3DLGB 3DRPA 4GO5X 4KHRA 4HEA9 4DR1F 3RAMA 3RB3A 2KL8A 2V67A 4FN5A 3SCJE 1HNVB 3PKMA 1N0VC 1RWWB 3UD4P 1NJIT 4ZJQA 4U9RA 4FP9A 4ILMA 4PG7A 4QJVA 3GCWP 4X4QA 4IR1A 1HBUB 5F8LA 1RT3A 4PZVA 4DF4A 5IT9Y 3TAMB 1S7HA 3H5UA 4TYBA 4QW8A 1ZOTA 2WVEA 4X66F 4UQTA 2F7VA 4RZRA 1O5JA 4MFBB 3CCES 1SIWB 1OIAA 4DLEA 4DI6A 2J9DA 1SL2A 2EFGA 2QG9B 5JJBA 4Q43A 3K5NA 5DO2A 4W92B 1MWZA 1VIXA 2BYCA 2MTLA 4OYWA 2QGFB 3CCRS 4IG0A 4IOBA 1TMMA 4E2FB 3MM8A 1KQSR 2ABYA 4ANCA 1Q1KA 3AJ2A 3M6VA 2X1BA 2CQPA 1T9WA 4ZS6A 2B9YA 3MR5A 4QIWD 4ECQA 2BABA 2CWKA 1S5ZA 3D1QA 4AXIA 2UXCF 1HD1A 2PE8A 4LF5F 2V8HA 3IWNC 2HMIB 3PYEA 2WVDA 2X1FA 1CC8A 4DJBA 2ZHOA 3ZXWA 3JTOA 1HA1A 2KVIA 3IRWP 3ELHA 5C2GA 2V4JB 4Y2AA 4K7QA 3HHLD 4PG4A 4KBIA 2V9WA 3RRHA 4A8KA 4U7CA 4JI1J 1NHKL 5D0HA 5I42A 4I0WA 4ZP9A 4CLFA 4K4ZA 5LMUF 5DM7Q 2HFUA 3HCXA 5HMZA 2BE9B 2DPJA 1AT1B 1BQMB 2UXBF 3AD7C 2KJVA 3LP0B 4RW7B 5L1LA 5L38A 3HVTB 4DR6F 4HHJA 1TUWA 1LQ9A 5CCMA 3U1NA 1U1OA 1M1GA 1VQ4S 3GYGA 2FIUA 1S59A 2C2NA 2B7BB 1IN0A 4I2QB 4Z37A 5D0EA 1J5OA 3U02A 4EZ6A 4OX8A 1WORA 4CQ1A 1LW0B 1NJYA 1NNDA 2RMLA 1SPBP 4URQU 2DCLA 3G6VA 2VDHA 4DPOA 1U0HB 4UUWA 3G87A 3DHWC 3CJ3A 2DNLA 1AZSA 1SVDA 3KKFA 4GKKJ 2HK2A 2AYEA 1WWHA 1T9YA 4Y65A 4P10A 5A8WB 1JLQA 2CFXA 2G4BA 2LEAA 1OY8A 4TLQA 1TK5A 3IN5A 2BE2A 1YRTA 4ECRA 1T05A 5GAHU 3THPA 1NO8A 1FT8A 3PEJA 4XDDA 9ATCB 2YH1A 1F6TA 2WK4A 4QYZK 2RS8A 2FLPA 3MPDA 3CJ5A 1FXLA 3M8QB 3QRRA 2KT2A 3NAHA 3W64A 1TQLA 2G0IA 4ELTA 3HVRA 1RWKB 5CD4H 3CCTA 1VC5A 2HBRB 2XZTB 1NU4A 1VK8A 4DX5A 5IC6B 4LSLA 3UQSA 1CBKA 4QIVA 1RT6A 1XJWB 2EKNA 1E6VB 3CJ8A 4J9UE 2ZZMA 1HNIA 1NPPA 2V63A 2GGPA 3G6ES 3LAMA 2V0NA 1GTHA 3HP6A 1EQMA 3KYLA 3FQLA 3MEDB 2OLWA 3G9CA 4DR4J 3GCXP 1Y5LB 1YLXA 4OJHA 2AKWB 2WZ1A 4WF9Q 2APOA 3M9MB 1NKBA 2JC0A 1FE0A 2ZZNA 2XULA 3GR1A 4UTGA 4OI0A 2V34A 3OFGA 4IH5A 4EK2A 1FTCA 3VZIA 4ZPAA 4Z7YA 3HJVA 5HVGA 3G6XA 3I31A 3G8SA 4IFVA 1FKPA 4DLGA 2CJQA 2HLTA 3CDEA 2BKNA 4ERDA 2YX4A 4NZ6A 4PABA 4CLSA 3KHGA 2H4WB 3KG0A 4L74A 3EICA 4ZCMA 2FZCB 2QA1A 1UW9A 2J76E 4LUBA 1KRPA 2YH0A 2LKZA 1WI8A 1U24A 4PWUA 2DNNA 1A6LA 2CIMA 3FBFA 2OPRB 3QBCA 1HARA 1KDNA 4TKTA 4B9LA 2E9ZA 4FKXA 3I0SB 2HNZA 2QYCA 4DPXA 1FRMA 2IVYA 2XYHB 4M5JA 1UVKA 1QD1A 5HROA 3GIMA 1SL0A 4F4XA 2QFIA 2QL7B 2F8MA 3QNWB 1ZPVA 2D9OA 1RTJB 1N5YB 3JAMU 1S6QB 1B70B 2DNOA 5JVHQ 1F60B 2EC0A 5D0RA 3SSQA 2DKOB 5DGAA 3BB5A 3KLEA 2L3MA 4Q8FA 5LJ5Y 2ZBQA 1S1VB 1U6BA 1S9EB 2XTJP 3NP5A 3PO4A 5FJ4A 4NCGA 4UQGA 1FESA 1VQOS 3DOKB 4ID5B 1WG1A 4DL7A 3CULA 4C48A 3H5XA 4ZITA 4RBUA 3PZPA 5KFMA 1WG4A 5AXLA 2GJ2A 3FBCA 1FF2A 3HD1A 2JLGA 1M5KC 3H0PA 3V6KA 1K0TA 1Q0NA 1NK5A 3M2VA 2W4DA 3M9NB 3DXBA 4OYPA 5KFTA 3FEYB 3A8JA 4FYDA 1WACA 3F41A 4JI6F 1GMUA 2KN4A 3BEGB 1HNZJ 2CQIA 4I4BA 3NL0A 1T11A 4KHMA 2EG1A 3Q2SC 4PG6A 1EP4A 2VASA 1TL5A 5AT1B 4WYWA 2O67A 1JLGA 2HQGA 4ED0A 2UUWA 3IO1A 3WC2A 3KNGA 2ZVSA 2ILYA 4YY3F 3ILJA 3ZZUA 4LF6F 1PBUA 1JWWA 1UVIA 1S1TA 4ES3A 2QIFA 4JI2J 3HX9A 1KBRA 1XEZA 3FRYA 2ZVIA 4Y00A 5CCLA 5H9FK 3SCKE 1QAYA 3EVOA 1X4AA 3KK2B 3PACA 2MQMA 3DLHA 1AROP 5B0DA 1TVRB 5FD1A 3WC0A 2ZC4A 3D3BJ 2LP4A 1QVGR 1HBMA 5B0BA 1MMNA 1LFWA 3BPSP 2W9AA 5HQ8A 3HVWA 3SBMA 3I0RA 2RSQA 3BM7A 2BJ8A 4JI0J 4JI4J 1ZAWA 2XYPB 4OYAA 2BVZA 4FYVB 2GS8A 3ZTOA 1U25A 4LRFA 2ZM6F 1CJVB 3BSAA 4OV6A 3ETMA 4CO4A 3SDEA 4AYBD 5JMNA 1EIYB 5CYQB 1N52B 2AJFE 4KV8A 3FRZA 1YJVA 1JLCB 4DPWA 4UW2A 3LWMA 3K59A 3W60A 8ATCB 2COLA 2VFVA 2F4VF 2UP1A 4DCJB 4DV1F 3R6LB 3EGNA 1N5SA 3UN5A 1UA1A 2Z4PA 2CQ0A 1RBOB 2F3JA 3O3LA 3D2WA 3BREA 2J0WA 4ZVSB 2GO8A 4F04B 3GYNA 3TW0A 2VH7A 5FLXU 3L7UA 4IR9A 5D4PA 3ISND 4C8MA 5C5JA 3D9BA 1TKTB 4CLZA 2R2UA 1RTHA 2DXDA 2BACA 4FYYB 4F4ZA 3SI8A 1QM9A 2R4FA 3DDIA 3WX4A 2R2RA 1TU0B 3HSDA 3R8YA 2QSWA 3BQ1A 4OYXA 3OBIA 1KOOA 4LT6A 3LTOA 3FSIA 1MW7A 3GJTB 1QSLA 2KHCA 2I2YA 1EB0A 1SL1A 3HLUA 2L9DA 1MROB 2ZFHA 5EX0A 3KJFB 4YB1P 2BJ1A 4WP3A 1PO6A 2J6TA 2CPIA 2RD5C 2EFNA 1C1BB 4AD6A 1VR6A 1WHWA 1NDKA 3Q8UA 2EK1A 1PKUA 3VAMA 4ZIVA 1VDHA 2QFJA 1RT7A 1MNEA 3UDEA 1KFSA 2A0FB 2GX8A 2UUCF 3U1LA 4EGLA 1JXVA 3KLGB 3BO2A 3IA0A 4Q45A 3R1LA 2D3ZA 1WTBA 1KVKA 3VWSA 5KFBA 4YP3A 1Y5IB 1XQIA 2Y3YA 1FKOA 4A8FA 5ETNA 5LM7E 3HHNB 2K1RA 3MM5A 4RU9A 4WTYA 2A2CA 4DR5J 1VOMA 5ETPA 5T7LA 4KGKA 1GXLA 3ZZYA 3G86A 3AJDA 2IFXA 4O44B 3WX8A 1LXNA 2QRRA 4F2SA 2IRUA 4DSIA 1DTQA 4JV5J 2JL9A 1ZZNA 1IBLJ 4C2MA 2FQQB 2YKNB 2X1AA 2A18A 1WEYA 5K14A 4ZP6A 3HD2A 4DV4J 2YKQA 3L09A 3BSNA 2FJWA 1S49A 3TQEA 2BM1A 2CJ9A 3ENWA 2UVRA 3ENVA 1REVB 1AW0A 2WOMB 3OD2A 4F7VA 2AW0A 3HT0A 3JQKA 2J8SA 2F5GA 4LIWA 2JWNA 1IKVA 3GV8B 2ILZA 1RAOA 2ZKUA 4USUA 2CXEA 1JQGA 3BDPA 5IZHA 2DH9A 2W9CB 3UDCA 2PN6A 2PT0A 3TX8A 1JIHA 1F2GA 5F9LA 2LLZA 4PQUB 2A2DA 3KDNA 4L6V3 2ZC3A 4U67Q 4F0HA 5EDWA 5GAHI 1N32J 2GVZB 2BBEA 1WI6A 1N5QA 1SC4B 2OP5A 3MMCB 3UWTA 2CZ4A 3O44A 1T9VA 1B64A 5KFRA 2FZGB 2O3DA 3R7NB 2J9DE 1SUQA 2GZOA 2CJKA 4LFCJ 2A6OA 3MCMA 4TY8A 2HNYA 2DGOA 4CYUB 2IM1A 4BBYA 2D9PA 2OJ3A 3CT9A 2CPJA 3BGRA 3CCZA 2GFFA 1U2RA 3NS7B 2XLKA 3IWXA 2R2SA 4O3RA 2DRBA 4J9OA 3KHRA 1RZMA 1PAEX 3C2PA 3IRXB 4OI6A 2QN6B 4K50A 4URGA 5GAGI 2IYGA 2WHOA 1S1WB 4DFKA 5HMYA 3Q83A 3B8HA 3P8BB 2O1PA 3EE3A 2D7SA 1KEKA 2DNHA 5IM0A 1TKZB 3FSXA 2ROGA 1DBDA 1UEUA 3GZ7A 4RNMA 5C24B 1TL3B 4LF1A 2R3VA 4ECZA 4XPEA 5F8MA 3CVKA 3KJVB 5G0RB 4FS1A 3QLHB 2FVRA 2M70A 2IMOA 4C3MA 2YQ3A 4QPTA 1ZA1B 4A8QA 2GV1A 4L75A 1N34F 2BJEA 4KR0B 1NJWA 2BOAA 3RB6A 2VA2A 2VBWA 3CCSS 1OYDA 4EBDA 5RUBA 4DQQA 1CJKA 2HFZA 1HWKA 4DSJA 4QWCA 2HHSA 4RPFA 1T3OA 1D9DA 1RWOB 5MAOA 1AA1B 3V6DA 1F5AA 3X3UA 2KXNB 3R5CA 1PJ5A 3MF5A 1KLMA 1T03B 4C11B 4QU7A 1H2TZ 3R2CJ 1FDAA 4DV7F 2P9CA 1FWKA 1Q86T 3AD9C 2QA2A 4H54A 1YITS 2VPZB 2ZH1A 2G2YA 2DXEA 3I4PA 4DV3F 5IFMA 1UPPA 3DOLA 2XMWA 4IH7A 2FJAB 1YIJS 5HVHA 1O6XA 2BRKA 4J9LA 2C3UA 1URNA 3MHYA 1BY9A 4UUXA 5HAOA 4RJVA 1S0NA 3P5BP 2V8GA 4DR7J 1KKHA 4RW9A 5D77A 4NLWA 4J5OA 2A1BA 3QO9B 3C15A 5E5NA 1J5EJ 3ZTSA 2J7KA 5HL7Q 4L73A 4C8KA 3H5SA 1FWPA 3LPEA 1JJCB 4OHXA 4P71A 3T9NA 3K17A 4HL9A 2FZKB 4QIGA 3OR2B 2F8EX 4LBIA 1R0AB 1FNOA 2XO7A 4WXWA 4QCLA 2UVVA 2RILA 2YY3A 1YVFA 4G3IA 3AQPA 3GE9A 5J2QA 3PFEA 3MMAA 1Y00A 5E33A 1YTYA 2CNOB 2Q6BA 3TVYA 4J9PA 1LWFA 3VAHA 2KFZA 3CMES 4TU7A 2CPEA 3PYGA 2RRNA 2CPHA 3V4IB 4JOUA 5KFKA 1RT5A 3KLIB 1RLCL 3MFHA 4KE5A 3I82A 4WFYA 4JI8J 1UWBA 1UFWA 4USTA 3ENAA 1UEVA 4LRCA 1TAQA 3RBXA 2YWFA 4FBTA 3MM7A 2XLJA 4LF4F 3BSOA 3ZZPA 1L5UA 2GNKA 1KVJA 3S7RA 1U1LA 2OSRA 1Q8KA 2R9LA 1KFDA 4U8YA 2HGLA 2GJFA 1C0UA 1FJGF 2FLOA 3BN4A 2HURA 5F8NA 3G4SS 4DU8A 3DNCA 3MXHP 4NLGA 3MDFA 2HHWA 1HL6A 4FF3A 2OEKA 1BUXA 4J37A 2G0JA 2N4DA 5J2NB 4IFYA 1GAOA 2AX1A 2K2PA 2G13A 2GQQA 3N79A 5G4DA 3QJLA 4LREA 4UOHA 4W90B 5KFOA 2I0XA 4U7UD 4ANDA 4KPCA 2MKJA 1JLAA 2V2ZA 5A8RA 2KDOA 3WHIA 1TFYA 1FE4A 3Q8YA 1FK9A 3V6HA 2BV3A 3PHEA 2R7TA 1B3TA 2OGUA 3RZAA 2VC0A 3MM9A 3QT6A 3KLFA 2P9EA 4C3LA 3WDOA 5ETVA 4KO0A 1PAUB 1YZ7A 2ZNZA 4R5PB 3M2RB 2W2NP 4K8RA 1R6YA 2BQRA 1Z2ZA 2YNIB 2ROEA 2XM3A 4EZ9A 4N41A 1YJRA 3DI6A 1RT4A 4Z2XA 4ATNA 3J7Z5 3NWRA 3GILA 1A7GE 1VQ9S 1YG0A 3C8YA 4C8OA 5A2QU 2LA6A 4OQJA 3MGJA 2LXFA 3BKUA 3V6JA 1N56A 3O8WA 1SKWA 2AF6A 4MIAA 1IQTA 3HO1A 2YKMA 3DGPB 4N8OA 2XWXA 3SMZA 5DG8A 3P49B 1XMOJ 2YQ1A 1JK9B 3K89A 3PR5B 1NK8A 3OJSA 2KB2A 4X62J 4WFNQ 1UJ6A 3M8YA 3BSCA 2VQEF 5KFZA 3C19A 3D6HB 2JFDA 4LF9F 1GMWD 2E5IA 5F3ZA 2OKQA 4NLTA 3EGVA 4YB7A 1R8CA 1Y4ZB 3CD5A 1Q82T 1UCNA 2GIRA 4PCQA 3J7AN 1PC5A 3AB4B 3T1YF 2VOPA 2XO6A 2Y8WA 2ZH7A 1SI9A 2HHVA 3MOZA 4A8YA 2U2FA 4B3SF 4L3KA 3QGHA 3KK3B 4ZJOA 1N6QA 1KHVA 1RHQB 3KWMA 4IKAA 1P1TA 2JEFA 3UDVA 1CVJA 1X31C 1S77D 2R7VA 3HDSA 4IOAQ 1U1MA 3PJWA 5J1EA 3GIKA 1VBXA 4Q0BB 4ZDNA 5FDLA 4P2XA 5T41A 3WBZA 3CIMA 3PW0A 3O5TB 5EWEA 3K7RA 2YXLA 4M5NA 1CC7A 3BR9A 4WKYA 3A3PB 4RO0A 1JXEA 3Q0AA 3QIDA 4EYHB 4NI2A 2PI5A 2ACMA 4WBFA 4IDKB 3BGOP 1BE4A 2BR0A 3FBEA 5AJ3J 2IJNA 4NEYA 2CNNB 3MR6A 1S76D 1FDNA 4GKJF 2HBYB 5KG0A 4DQIA 1IUJA 1HBOB 4NPOA 5DQHA 3V81A 4R0EA 2CUYA 3C6TA 1F9EB 4ANEA 4USKA 2K7KA 2MZTA 3NG8A 2DTJA 2DNKA 3NNCA 1H72C 1FTRA 3EGZA 3PR4A 1ZZFA 1FA0A 2HS0A 2HPUA 5FIIA 5GAEI 2NXNA 4WP9A 1CQNA 1K1SA 3CDUA 1WC5A 3KOAA 1M5SA 3SFUA 2UVUA 4NLDA 4WIQA 4WE1B 4OX9J 2UUTA 3UVJA 5IS2A 3LW5C 3JSRA 2ZHBA 4OLOA 2E9RX 1SKRA 1R89A 4RNOA 5A0YB 2XI3A 2KXHA 5KT7A 4QWBA 2QO3A 1QTMA 3GIRA 3QQCD 2VU5A 1RSCA 3M6XA 2DPIA 2OIHA 3DRPB 2UUAF 2OFGX 3MECA 2ZE2B 3DLKA 5ADZA 3W9IA 5DQIA 2VG6A 1EETA 2LQ5A 3ICLA 4EBEA 1WDDA 3CCWA 5KFQA 4NXNJ 2DY1A 3VF0B 3LWLA 1SKUB 5IV3A 4ZVTB 2HEKA 2HSEB 4KKOB 5CH7B 2HHHJ 2H1YA 1KS2A 2G1DA 2RKIB 5L46A 4KB7A 2HNDA 1CS4B 2D3OR 3IXQA 2HVIA 3VGTA 5BR8J 2MB0B 1OY6A 4NXMF 3BQ0A 2HAFA 2IBKA 2J0QD 3PM9A 2LQ8A 3SIPB 3R5AA 3RYLA 5KFPA 2WB1D 1FKAF 4CRJA 4GC7A 1IKWB 4NRTA 2KHDA 4DV5F 4EYIB 2MQLA 1IWAA 1DAXA 3CMAS 3SZ2A 4J9NA 4YHHJ 4OX7A 1HI8A 5CZXA 2MGZB 1KONA 1Q78A 4C0HA 1GXTA 1PYOB 3PJXA 1KTQA 4RR5A 4DSFA 2J8AA 1YK9A 4R8UB 2H5IB 3KTQA 2FJDB 4I2PB 4V1Ak 2Q1LA 4KHPF 1UVLA 2IM3A 3W7BA 3H2UB 4JYAF 1KWMA 4I64A 4DR2F 1HR0J 1HBNA 4NYZA 1IJFB 2K8GA 1V5VA 2DR8A 1S1XB 1VC0A 2DHHA 2V94A 2ZKTA 3DM2A 2HAIA 1WKLA 3RW6A 4RUCA 5F3TA 2B6AA 1IKYB 1QDUB 2PI4A 4YMEA 4LR7A 2XCAA 1SH2A 3QAUA 1XN9A 2I5JA 4AXJA 5F8HA 5CD4A 2XMUA 2C2KB 4U6PA 2VFTA 3UNGC 3TARA 4IO1A 3OJUA 4PKDB 1WOPA 2GC8A 4DX7A 1U1PA 4OI3A 3RG6A 2M8DB 2XI2A 2XBPA 5JVGQ 2VG7A 1CG2A 1GT8A 2V9KA 5B0GA 1U1NA 1TL7B 1SJRA 4ZKAA 3MTJA 2RUGA 4UF4A 5E2QA 3BH6B 4MYUA 4B9MA 4P2SA 2DGUA 2B3TB 1WHYA 2CRLA 3N6LA 4DR3F 1S1UA 2LFVA 1R8HA 1WC0A 1ZAVA 3OQ2A 4B9SA 1AZSB 4CO1A 2VC1A 2W4CA 1BQXA 4OZ0A 1BQNA 1LWCB 3FBBA 5AXNA 3AA8A 2GW8A 3MMBA 1WF2A 2OH2A 1MSWD 4O3SA 3W8GA 3IR7B 2BE2B 4ECSA 3OL6A 5A8KA 1T05B 4CP5A 5L9XA 1NKCA 5D6GA 4L72B 1NH8A 4V19X 3CJ4A 3TJ9A 3CCVS 4FVCA 3UCZP 3GSDA 4XPCA 3SV3A 4K4VA 1WF0A 3KFWX 4U7UK 1XMQJ 1NK7A 4M5GA 1PYTA 3MM6A 2C3MA 3GPAA 4B3TJ 3DRRB 1Q8LA 1Z4UA 3IC1A 4LSLB 2VOOA 4E0DA 3B54A 3BN7A 3Q24A 2FHMA 2V4QA 5LJ3Y 4F36A 2BXJA 3Q8SB 3GG1A 1HNIB 1D3WA 1KLNA 3CSKA 1S9GA 3PYFA 2H48B 3A4TA 2E5GA 1SB6A 2GGPB 1AUDA 1DRZA 1YJTA 1Q8BA 2VL1A 1WKJA 5J2MA 1HNVA 4O3OA 4QWDA 5F0UA 5JUMA 1VBZA 3DOMB 2K3IA 2B0GA 3CO0P 1ZAXA 1HNWF 4B9TA 1I6JA 4W4MA 5CYMB 4DPTA 2C22A 3MR7A 3TZZA 3OTEA 1M1HA 1NMEB 2R7OA 5IT9U 2CPDA 3FSYA 2MKCA 3HI9A 3W66A 4MFBA 4J9KA 3N6MA 4A8SA 4MK8A 2G9OA 2WSCC 2WONA 2D41A 2ZD1A 1FKPB 5EWGA 3MR3A 4CO3A 2C3OA 3B4MA 4L76A 2NYHA 4K0KF 1R3NA 3A12A 1TUGB 3OXFA 1QSYA 2HGNA 5F8JA 3EX7B 4I6AA 4LFAF 1T02A 1RBLA 1WDTA 2E1PA 3S8SA 4NL5A 2KKHA 3MTKA 2HRUA 5KFEA 3N01A 5D78A 4RW6B 3VZHA 3TQ1A 3M1VA 2ADBA 2R8JA 2E5LJ 3M8SA 4HH0A 2F40A 4HTJA 2UV8A 2HNZB 2UUCJ 2VF3A 5HROB 4M5DA 2RT3A 3W2VA 2HIQA 4DPUA 4DS4A 3G82B 3QT8A 3NNAA 3M8WA 2B5JB 4N5SA 1IBCB 3FZ2A 1HNXJ 1U09A 3DFEA 4LF8J 2FY1A 3OTOJ 3TAQA 3JAMY 2V4JA 2EI5A 1HW8A 2JEJA 3KLEB 2MZRA 3FCHA 3J7YU 5GMDA 4KY3A 4ZJLA 3OVAA 2HQ3A 4F3OA 1FX4A 4Q44A 3N5FA 4NLYA 1NZ8A 4DWIA 4WP8A 1FXDA 2CA9A 4DSEA 3DN9A 5E3RA 3D54A 2MSTA 2QLBB 2JHEA 2XHCA 3NAIA 5DM6Q 2ZEJA 3LP0A 3DRXA 2QZ8A 1GNKA 3OLBA 3HFKA 3FGVA 1U8WA 3C6UB 1LFPA 2N7CA 4M5LA 1GMVA 4I1TA 2C28A 4JI5F 1H38A 2LU1A 3M2VB 1T95A 2OMOA 1U49A 1N88A 3PV8A 4GRSA 3RTVA 3UCGA 3GMGA 4X64F 4USIA 1NBEB 5C42B 3VGVA 4Y2CA 4OI4A 1EP4B 1RKIA 1SV5B 3NMAA 2DBBA 3Q8RB 2KI2A 2MZ1A 1HQUA 2XSJA 3Q2TC 2Y1JA 1S57A 3HHEA 3IGVA 5A8WA 2F65A 3C46A 4IYQA 4RNNA 1WD6A 5KFLA 4ZVHA 1S1TB 2BQ3A 1G3OA 1Y10A 3N5BA 3UD3P 2OUGA 1OMSA 3SYZA 2LU2A 2AJ0A 1HHQA 2UU9J 3M8QA 2MZQA 4MAKA 2AV5A 1TMJA 1X4CA 2HKEA 4LFBF 1FDBA 1X60A 3E3XA 3NEKA 2VBZA 4NRUA 2B4VA 4J91A 4NA1A 4WIIA 3NOCA 4RW4A 1TL1B 5A76A 4ICLA 1E6VA 3M30A 3MD3A 2LDIA 3SQGA 5DDPC 2JRSA 4MT1A 2XQCA 3ZNJ1 3SDEB 3MEDA 2Q66A 4AQYF 2V8DA 3QGGA 4KV8B 2BQUA 1SH0A 2HBQB 4CLPA 3T1HF 3M6UA 2FPHX 2F4FA 2OO4A 5HLFB 3OHBA 5L8RC 1QY7A 5IWAJ 2DGTA 2F63A 1SQEA 1GH8A 2DIUA 2I1RA 3VALA 2B4PA 1C4AA 2C3YA 1RYRA 1RTHB 3K5LA 2Y8YA 3DKDA 1FD2A 3R7SB 3AJ1A 1QLNA 1ZTTA 1KP6A 2RUSA 5KFGA 2ZJQQ 4B17A 2EEYA 2HFVA 4ZP8A 2N82B 3CO9A 3DLLQ 4ECXA 3M4XA 1GTEA 2ZUGA 1IBMJ 1X9MA 1JJ2R 1VHIA 3ILIA 1B0PA 5IC4B 3UN2A 3EVMA 1HWUA 1RT2B 5D4OA 2OPRA 2UXDJ 1RHMB 3T5KA 1JLBB 1HLWA 3LA0A 2IVFB 2DO4A 3AOCA 1R8PA 1FX2A 3TZYA 3TO8A 5HJYA 4OHWA 5KG5A 3OR1A 4LQ9A 4WZQA 1PBAA 5KFWA 4HI1A 3BR8A 2XY6A 4IQXA 1NPRA 1AXQA 1RTJA 1X4EA 3HSJA 2FJXA 1XK8A 1N5YA 3N4WA 4FZVA 2VDIA 3VVTA 1ROFA 2XMJA 1RT7B 1S6QA 2YWEA 5KG2A 2XG8A 2O5DA 3FMWA 3ONQA 8AT1B 3G8QA 2U1AA 2Z2YB 1S1VA 3I96A 1S9EA 5K8NA 3CCJS 4ID8A 1XNQJ 2J7WA 2GO9A 2XGPA 2CDQA 1SJFA 2CQ2A 2AU0A 1KQGB 3DOKA 4ID5A 2PMWA 4NCAA 1FKOB 3TJAA 2HVDA 3LP2B 3RUBL 2P2CB 4DFPA 2K1RB 3MM5B 4JI1F 2CJYB 1FNMA 1JNRB 4JUZA 1YRUA 4F50A 4B3MJ 1F3FA 3T9ZA 2EFPA 3O6QA 2NZCA 3NGRA 4IRKA 2DHGA 1DTQB 1BGXT 1TUVA 5KFHA 1WG5A 1XNRJ 2J9CA 4IRCA 4AL6A 3NNHA 1TKDA 4KPYA 3H7HB 3GFZA 4X4OA 1KSPA 5I3QA 2MQQA 2YWGA 5KFYA 1F3VA 3H42A 3CDBA 4KH1B 2M3DA 3POTA 1H0HB 3R1HA 2YKAA 4I68A 4NOHA 5DDOC 2VQFJ 1VBKA 2DHAA 4H4KA 1ULRA 2CQHA 4ECUA 1U02A 2BANA 3IBWA 4IG3B 2RB7A 4ZPWR 1TVRA 4NWBA 3CEDA 1VBYA 3H5YA 2PC6A 1JXLA 4MKYA 1OO0B 2KRRA 4EO6A 1U2FA 3RJMB 3EWGA 4NMXA 3G6YA 4YOEA 3QPIA 3GIIA 1WC1A 5KG4A 1GK8A 3W5YA 2YNFB 4TY8B 3VV2B 3W61A 2HNYB 2NUUG 1FJ7A 4NLSA 4PYAA 4OHVA 4RUBA 4WPAA 3TYTA 3HHLB 2FHOB 3BGFA 2GHVC 5DS7A 1LEOA 2BOPA 4JV0A 1IVZA 4DZ6A 4C9DA 1OYEA 4DR4F 2CJAA 4OJ3A 2F9DA 2AEMA 1H2VZ 1RU1A 2XYGB 2H4YB 5IM0B 2QLXA 3RRGA 2EWHA 4DL6A 5EX3A 1TKXB 1OS5A 2OSQA 4WK1A 3NOGA 1TKTA 2KM8B 4ENOA 4B9VA 5K8MA 5DG9A 5DDQC 1Q16B 2V5HG 4OI1A 5IOLA 4ZPVR 5KFAA 2CPFA 2WVFA 1IKXB 4OZ2A 3CWJA 3LAKA 3TEGA 2GVDA 1M5HA 2X3GA 1RP5A 2OELA 1FCAA 4OFZA 5IQ6A 1DQ9A 1NSQA 1HD0A 3L9ZA 1WNEA 2MQOA 4NCBA 4ZN1A 1ZPWX 2QMWA 1YJUA 1W25A 1YJ9S 1F1BB 2JLFA 1M90T 1MU2B 2IRYA 2R7UA 2GA7A 1IWGA 3UN3A 1FJCA 1S9FA 3H20A 4XDCA 3KUHA 1UKUA 1RWUA 1C1BA 3FFIB 4C8YA 3OVBA 3D66A 5ETRA 2JC1A 4RBTA 3PO5A 2KT3A 2VHGA 3RAXA 2R7SA 2QL9B 3HM9A 1VRTA 9RUBA 3KMSA 1RAJA 3MCOA 5J2PB 1SJ4P 1YI2S 1UETA 3KLGA 2W7OA 4JI7J 4UY85 3R9LA 4ER8A 5LL6d 1VLYA 3DDNA 4C0OC 4ZVQB 1S12A 3MPVA 1LWXA 2AZ3A 4USWA 4NZ0A 2DEJA 1H98A 5CAAA 2NPFA 4BWJA 3IBFB 2YVSA 3J7YI 2XHWA 5HBMB 4LVNP 3TUPA 2NSBA 3M8PB 4QYRA 3NCPA 1SKSA 4PUOB 2M52A 3LGHA 5F9NA 1LXJA 2JZ5A 4RW9B 3IG1B 1I94J 2ALZA 2RHSB 3GJRB 1FRJA 5KG3A 2KFNA 3MAQA 5CA5A 2DISA 1RAEB 1DTTA 1IJEB 3BGLA 5KFNA 4LSNA 3M32B 1I3OB 5CYJA 3H2VE 3AXKA 4GVBB 1REVA 1X4DA 3MEGB 2WOMA 1VRQC 1HNZF 1RAIB 2EFQA 3VAJA 4JB8B 4CCHA 2NUHA 1N33J 1G2EA 4M5IA 5CQGA 3BBCA 3VGUA 1H7XA 3D68A 3MMAB 2ZDPA 3WIUA 2W9CA 1LWFB 2YNGB 5A6PA 2ZOMA 4ETZA 4MKBA 5AXMA 1RTZA 1KN6A 4PQUA 3F0NA 3T3FA 4MH8A 4PPDA 2GVZA 2VUGA 3CGIA 2Z57B 3D4JA 3CD6S 4KGVB 5KOXA 1VC6A 1T9TA 2AJ4A 4LF7J 3EDRB 1UWBB 3LALA 2HWIA 2DNZA 1U0SA 5KAKA 2HZCA 4DUZJ 3D3CJ 1W26A 4M63A 2ZHAA 1S0MA 1K0VA 2R8GA 1X4FA 2DR7A 2IC3B 2NXJA 2UZAA 1B7FA 3KJQB 2XY5A 3HMJG 1L3UA 3RW7A 5LXRA 4CYUA 3CJKB 4YQWA 3HHLC 4ECVA 2UUAJ 4K4TA 3JYTB 4JI0F 4YS2A 4JI4F 2XNRA 3ENQA 4MK7A 2DNMA 2QYGA 2HIYA 2DNPA 3PX0A 2N4CA 3Q8PB 2VJVA 2KH9A 4PRFA 4Y2IA 1VQ8S 2N3LA 1S0OA 3FCWA 4DCOB 3OTDA 5K9FA 3GG0A 1VHFA 3VAFA 4QZVB 3CJSA 3IR6B 3JTNA 1JLFB 2KM8C 2DNYA 4IFYB 1LNQA 1TV6B 4M5HA 3MPUB 2FD2A 1LOUA 1FRLA 2RU9A 3CUNA 1TL3A 1TR0A 5KG6A 1RYSA 3K8VA 4CLYA 4HACB 3AH6A 4V19J 3NBPB 3KJVA 5G0RA 2V8PA 3QLHA 3D5MA 4N8NA 4DV6J 4NZ7A 5A8RB 2EC2A 4KAIA 5HP1A 4C4WA 1M0SA 4ZVPB 1Y7PA 1SJ3P 3HULA 3WIVA 3DRSA 1DHMA 1O8BA 5E41A 4X4NA 2G0CA 3KLFB 3VVUA 3ILLA 3HKWA 2RJZA 1VJQA 2X3DA 3ISZA 3QMQA 1K73T 2W2OP 1KR4A 4RUAA 4DFMA 4JI3J 1B0TA 4QYZJ 3UW1A 2XMVA 1Q53A 2UUBJ 4HH1A 2KVQE 1IR1A 1I51B 2AD9A 2PEHA 4XO0A 2HFNA 1N5TA 5A2QY 3HZGA 2QL5B 3TEHB 4QWAA 1T03A 4B3OA 4EI2A 4DS5A 2W7PA 1RTIA 4DEZA 4WK3A 2ZH3A 1NK9A 1NH7A 2NREA 4FVMA 3GFHA 2YKMB 4CLTA 1S97A 3D0GE 4HYKA 3AQOA 3FMBA 3HXMA 1HYSA 3DCAA 2VA3A 4PAAA 3CJ2A 2KZZA 4MKVA 3KK1A 2MQ8A 3QRPA 1IBKJ 1GEHA 5ITHA 5B0CA 5ETSA 4G1IA 4PR6A 4DUTA 4FPRA 3WQPA 1XWLA 2C2ZB 3ITHA 2CPXA 3I6PA 2R8KA 3DMJA 1FRXA 4LVOP 1RWPB 3R3TA 3TA2A 2Y0BB 1O0PA 3AFGA 2J6UA 2XCPA 3GQCA 5EUHA 4Q5VA 1T3NA 3VAGA 1EQ0A 3DDKA 5E0OA 4PXEA 5MLCV 5EWFA 4O3PA 2QLFB 1RGVA 5LSOA 1VQ6S 1RA6A 3QO9A 1HPZB 3ADAC 3K2YA 3H25A 1N6QB 1NSKL 2OI2A 1JNZB 2Q79A 1FJEB 1F9FA 1V9OA 3BZQA 4X4TA 5J1EB 2XNQA 4DPYA 2VB6A 4JV5F 2RRBA 5FDLB 4H4MB 5K5MA 1IBLF 3IS9B 1M5OC 1Y3JA 2OHDA 5D3GA 2MLXA 1C0TB 1R0AA 1PC4A 3EZOA 2OPPB 1AYEA 4CNZA 4ZVFA 4AT1B 1BC6A 1C4CA 3BV8A 2EBGA 2HZVA 3DLEB 2HS3A 1FFSB 2XC9A 1TAUA 3V4IA 1IR2A 3V81B 2C42A 2GQ2A 3Q86A 4OYOA 5DZ6A 3KHLA 3C6TB 3KLIA 2DH7A 5KFCA 1G4CA 3TRGA 2L9WA 5LSRA 3TP2A 4DOZA 1Y9OA 2J0SD 3ET6B 3AB2B 1N4LA 3IAS9 3LO3A 3AOBA 1IQZA 5L1JA 1WOSA 4G65A 4N47A 1N32F 3K5MA 5D8HB 2MQNA 2RVJA 1RWMB 2OFHX 2VPXB 2MSSA 1HI1A 3OL8A 1YJ7A 4OYZA 4QIFA 2IM0A 2RDDA 1XIQA 2CNLB 1QUPA 4LFCF 5KFDA 2HZAA 3R97A 2BZ2A 2QA4S 2FDNA 3W2WA 1UAWA 2IMWP 3T5HA 4X4RA 3GTYX 3VR1A 1HMVB 1VYAA 1VQYA 2HQFA 4M8LA 2IJFA 4KFBB 3I5BA 2RH3A 4EFAC 2VG6B 5KT5A 4TLRA 2YX1A 5KT4A 1HQEB 3CB4A 1T9UA 3EZ5A 3AY0A 3EVWA 4O23A 4Y34A 3CCQS 5H9EK 1R7IA 1WEZA 3MWBA 1RKJA 3TX0A 1RHUB 1PILA 3KXDA 3T6BA 1RU2A 4TU9A 4X65J 2MPUA 2BKPA 4DN0A 1P1LA 4ELVA 2IDLA 3M2RA 4A4JA 4F2RA 2YNIA 2PA8D 2YNHB 2WAQD 3RBZA 5H9FJ 3RR8A 1L3KA 3NGTA 4KSEB 3KUGA 2E7XA 3HVAA 1FRHA 3FEZA 3E01A 2BUNA 2P9GA 2FJEB 5I3UB 2B8QA 4ILRA 1RXOB 4O3NA 3NS5A 1HWIA 2HHXA 2RIJA 2VFUA 4QR1A 3QGIA 1ACMB 1KOHA 1PCAA 3QFWA 3OFEA 1P6TA 4UOGA 3JSMA 2LYVA 3O2IA 2NZ4A 1YJNS 2F8HA 2R8IA 1DFDA 2DYAA 3TUIC 2J6SA 4B3RJ 4RLEA 4DZDA 2R2TA 2DY9A 4ZK7M 2MHNA 4PYDA 1KC8T 2WW4A 2ZBRA 2B6AB 4C8ZA 2HHQA 1G6BA 4B9NA 3DRYA 2JX2A 4RW8B 3JB9k 1Z2LA 3I5CA 4F0MA 2I5JB 3SCIE 5KFSA 2MYFA 4WXOA 3MCNA 1ITPA 2DRAA 3UO0A 3PYDA 1BMQB 2B9XA 4DV0J 2WVBA 5E3QA 3QFHA 1S79A 2VFRA 3CW2C 1VRUB 2B4OA 1K44A 1VQKS 4DR7F 2XEXA 4RKUC 3NXZA 3BO3A 4Q0BA 3ISNC 4KH0B 2DJWA 1FEEA 3AXMA 3PHTA 4Q2LA 3V5RA 5E3CA 4X84A 1BXNA 2I8EA 3PW4A 1J5EF 4P6QA 4HT7A 1JB0C 5H9EJ 4DXLA 2M5YA 4I56A 4IDKA 3S1TA 2E1MC 2QLJB 3W63A 1DLOA 2IDEA 2PSZA 1X8DA 3VQSA 1M5VC 4DFJA 4ED8A 1S1UB 2ZOGA 3G8TA 3VAIA 4DV2J 2POKA 1RE1B 3NMRA 2PFDA 3CDAA 4A8WA 1YKWA 4HR2A 1HBOA 4R0JA 1RHJB 3FZBA 1HKAA 4K2JA 2YQ0A 3BKFA 2QV6A 5B09A 3G96A 1U7LA 3EJMA 1WUUA 3H90A 5BYSA 3AT1B 4ZPTR 2QT7A 4HTIA 1TK8A 3TUJC 2RQMA 3FEXB 3HFZB 2MZJA 4YN3B 2HK3A 2HQIA 4DL0C 2FB0A 3KG1A 3ZZRA 2RRAA 1U6FA 1UZDA 3OV7A 4WE1A 2DR9A 4LMZA 4IH6A 3GIJA 1UVJA 4JI8F 1Q5YA 3PKYA 2LXUA 1YQHA
chains in the Genus database with same CATH topology
2C3OA 3L7PA 3IS9A 3B4MA 1IKVB 1D9FA 1RT1A 1CPZA 1C0TA 3NP5A 2AQ4A 4EUVA 3PO4A 4K0KF 4ED3A 5FJ4A 1R3NA 1FERA 2RU3A 5D4LA 4NCGA 2IA0A 3KK2A 3Q22A 4GKKF 4UQGA 1C1CA 1FESA 1VQOS 1D0EA 2OPPA 3DOKB 3LP1A 4ID5B 4HLBA 3OXFA 1NRKA 2CQGA 1DJ0A 1WG1A 1QSYA 2HGNA 2XWYA 4DL7A 5F8JA 3CULA 3EX7B 1NHVA 3H5XA 4RBUA 3PZPA 5KFMA 1N5VA 3T1AA 3KLHA 5EGYA 4I6AA 1DLOB 1WG4A 1T02A 3DLEA 3EUNA 5HMWA 5AXLA 2ZE2A 2W8KA 3PVXA 4LFAF 2GJ2A 2ZITA 3S8SA 1FF2A 4NL5A 2JLGA 2KKHA 1M5KC 3MTKA 3ZZZA 3V6KA 2X51A 2HRUA 5J2MB 4CTAB 5KFEA 3N01A 5D78A 1K0TA 2YX7A 4RW6B 2L41A 3DU5A 4NMLA 3VZHA 1NK5A 4LQ3A 3TQ1A 1VI7A 2W4DA 3M2VA 1N33F 1VQMS 3M9NB 3DXBA 3M1VA 2ADBA 2R8JA 5KFTA 4BC9A 4AFFA 3FEYB 4FYDA 1WACA 3M8SA 3PY8A 3F41A 3D28A 4JI6F 4HH0A 2F40A 1R8BA 4HTJA 2UV8A 3I87A 2HNZB 2KN4A 1X4BA 3BEGB 4C8NA 2CQIA 4I4BA 2WCXA 3MEEA 4PQAA 3NL0A 4KHMA 5HN0A 5KT2A 2EG1A 1FRKA 3Q2SC 5HROB 1SUQB 3EXCX 2IRXA 1RDRA 4M5DA 3GYXB 2RT3A 3SFGA 3W2VA 2HIQA 1EP4A 4PG6A 2VASA 2VFSA 4KKOA 5IT0A 4DS4A 1U47A 1TL5A 3OPKA 1VQSA 2RKIA 3TA0A 1UVNA 1OSDA 4R25A 3NNAA 4ZPDA 2VODA 5CYQA 2B5JB 4WYWA 4N5SA 2J7UA 4WFZA 2O67A 1JLGA 4ED0A 3FZ2A 2UUWA 3IO1A 2DT9A 5M2RA 1JLCA 1U09A 3DFEA 1HWLA 2KYXA 4PWDA 3WC2A 3KNGA 2FY1A 4H4OB 3JSYA 3TAQA 3JAMY 2V4JA 1X7VA 4TQSA 2ZVSA 2EI5A 3BGRB 2ILYA 1MWYA 4YY3F 4LF7F 3ZZUA 2WONB 1VK3A 1HW8A 2JEJA 2ZD1B 2MZRA 2Q43A 3FCHA 3KLEB 4LF6F 3J7YU 1JWWA 1UVIA 1S1TA 4ES3A 2QIFA 3UE2A 3HX9A 3H8YA 1XEZA 3FRYA 1DZ5A 2CPZA 4DUZF 3BF4A 4Y00A 4OI2A 3HPOA 5CCLA 3GFXA 3OVAA 1RT1B 3SCKE 5L1KA 2FHJA 4OMFG 2HQ3A 1QAYA 4F3OA 1Q4RA 1FXRA 4Q44A 3N5FA 1K1QA 4K4YA 1X4AA 3PEHA 4NLYA 3KK2B 3CCLS 2GHPA 4N76A 1AFIA 1C1CB 4DWIA 3OW2R 4L3NA 1IKWA 1FXDA 3LP1B 3PACA 2AGQA 4ED2A 4DSEA 3DN9A 1QAJA 2MQMA 3DLHA 1AROP 3D54A 2MSTA 5E3RA 2JHEA 5B0DA 3NAIA 2HHUA 2A3JA 5DM6Q 1U1KA 2B43A 4UY8T 1HMVA 3LP0A 1BWEA 3CPWR 3DRXA 1TVRB 1VIOA 2QZ8A 5FD1A 1GNKA 1RA7A 2BW2A 3WC0A 2FGCA 3KLHB 2ZC4A 1RTDB 1WELA 3OLBA 2NS1B 2XGQA 2C2RA 1QAIA 1QVGR 3HFKA 1L3VA 1HBMA 3FGVA 1FO1A 5B0BA 5KFJA 1S72S 2GIQA 3C6UB 4KFBA 3K5OA 1MMNA 1LFPA 2N7CA 2MGZA 4DX8H 4GMKA 2ERRA 1LFWA 2DO0A 2W9AA 1RK8A 5HQ8A 2D1CA 1DARA 3NGKA 4I1TA 4ZOSA 2C28A 4JI5F 1W2BR 1H38A 2LU1A 3M2VB 4A46A 3M1VB 3FVYA 3VQTA 1HQEA 3Q8QB 2KYZA 2DCUB 3HVWA 3I0RA 4R8UA 4I2PA 1T95A 2RSQA 3BM7A 3PNIA 2OMOA 1NEEA 5DGBA 5AE2A 2M0GB 5EN1A 4AE5A 4HDGA 1ZAWA 1U49A 1NHUA 1N88A 3NCRA 3B4DA 3MEEB 3PV8A 2BVZA 1X5SA 3RTVA 3UCGA 3GMGA 1U25A 2MJUA 4X64F 1OPZA 2FVCA 2JDJA 3NCQA 2ZM6F 1D1UA 4USIA 4M5DB 4RU2A 3BSAA 5C42B 4Y2CA 4OI4A 3W2VB 1EP4B 1RKIA 3SDEA 4AYBD 4CO4A 1P9QC 1S1XA 1SV5B 2BRLA 3NMAA 2DBBA 5LXYA 3Q8RB 3T19A 2KI2A 1XMOF 2QEXS 2MZ1A 1HQUA 5CYQB 1N52B 2MY7A 2JVOA 2JVRA 2XSJA 3Q2TC 2Y1JA 3HHEA 2AJFE 3IGVA 4MIBA 4KV8A 1MROA 3FRZA 3H4BA 1YJVA 2FVPA 1JLCB 3UI3A 1Q7LB 4PWDB 5A8WA 5THWA 3K0JA 4UW2A 3LWMA 3IFEA 1IKYA 4X62F 1XR7A 3K59A 3C46A 1U8SA 4IYQA 4RNNA 1WD6A 5KFLA 4DV6F 2ZH2A 2COLA 3LQVA 4ZVHA 2YNHA 5L1IA 4ED7A 3V6DB 1S1TB 1VJWA 2VFVA 2BQ3A 1G3OA 2F4VF 3N5BA 2UP1A 2JH3A 3LUYA 4F26A 4DV1F 2J5AA 3SCLE 3UD3P 3EGNA 4KQZA 1N5SA 3SYZA 2LU2A 4LJMA 2AJ0A 1XMBA 4Y28C 4IQMA 1UA1A 1KLMB 4M94A 2Z4PA 4PXBA 4YB5A 2CQ0A 2FLLA 2F3JA 3M8QA 3O3LA 3D2WA 2MZQA 4MAKA 2ZH5A 2AV5A 2Q3PA 1OSCA 3BREA 2KT5A 5GMKa 2J0WA 2PD1A 2GO8A 1X4CA 4X2BA 1Y0HA 3GYNA 3TW0A 3OTBA 5I3UA 2VH7A 4LFBF 1J2VA 1FDBA 4CZCA 5D4PA 4IR9A 3E3XA 2E66A 4JI3F 3ISND 2VBZA 4C8MA 2LMIA 4NRUA 5KG7A 2B4VA 2UUBF 5C5JA 5E7OB 2KG0A 4NA1A 2E1CA 1TKTB 4WIIA 2R2UA 1RTHA 5KFVA 3MUMP 2BACA 4DG1B 4F4ZA 3SI8A 4RW4A 1TL1B 4DHVA 1QM9A 2R4FA 4ZHRB 2NPIA 5F41A 3CD7A 4WKRA 4X4VA 3DOLB 2HYIB 4ICLA 1E6VA 1Q8IA 3F44A 3M30A 3J7A1 3WX4A 3ZZ0A 3MD3A 5K8OA 2RF2B 2R2RA 2LDIA 2DB1A 5DQGA 3SQGA 5DDPC 2DR5A 2JRSA 2QSWA 4D3GA 3M2UB 1YRXA 3UDLA 1CQMA 2GHWA 3BQ1A 3SDEB 3OBIA 3R5BA 1KOOA 4LT6A 2ZBCA 4BS2A 3FSIA 2ZH6A 1MW7A 4JV2A 2E44A 3MEDA 4O44A 1QSLA 4QPXA 2Q66A 4OLPA 2KHCA 1HQUB 3H2LA 2I2YA 1S6UA 4AQYF 2V8DA 1SL1A 1I1GA 2XSJB 3QGGA 3HLUA 4WYLA 3SSSA 2L9DA 3BO4A 4YR0A 4J9RA 3LOUA 4KV8B 1MROB 3U7JA 2ZFHA 2CVIA 5GVQA 1NAQA 1D8ZA 2BQUA 1SH0A 4KRWA 4RW8A 2NXUA 1LWCA 3T1HF 1IBKF 4KT0C 4CH7A 3QIPA 2ZOFA 3M6UA 5EX0A 2FUG9 4FNHA 1WHVA 4YB1P 5AJ3F 1ZM4A 2YKNA 5DDRC 1X5OA 2XS7A 4OIXA 1JLEB 2MKSA 2KZMA 2A10A 1P27B 1QE1A 3BS9A 2FPHX 2MDAA 3DU6A 1K8AT 1PO6A 4K5SA 2J6TA 2R7XA 2W25A 2CPIA 2RD5C 4LIRA 4PG5A 4DL5A 2OO4A 2DNRA 1C1BB 2EFNA 4C0BA 4F3MA 5HLFB 1WHWA 2RDIA 3C66A 3CE8A 3OSNA 3OHBA 4QOTA 5L8RC 2EK1A 1QY7A 3J7ZT 4IRDA 2OPQB 3VAMA 2DGTA 1SQEA 1GH8A 2DIUA 2W8LA 2QFJA 2I1RA 3S01A 5CXTA 3VALA 2HRYA 2PFFB 1RT7A 1MNEA 1VRUA 7FDRA 4ZVEA 1KFSA 2GX8A 3IGNA 2B4PA 1C4AA 3TANA 2UUCF 2C3YA 2FHJD 4CO0A 4NX9A 3U1LA 1RYRA 3KLVA 4EGLA 3KLGB 3ZC4A 3TVKA 3BO2A 3IA0A 2FJVA 5K8PA 1HFEL 4Q45A 3R1LA 4ITSA 4BWMA 5B0EA 1RTHB 1D9AA 2D3ZA 3K5LA 3DRRA 1WTBA 3VWSA 2DITA 2XMMA 4QIEA 1FD2A 2FC9A 3AJ1A 1QLNA 3CTRA 1ZTTA 4RW4B 1UJ4A 5KFGA 5KFBA 2MQPA 4YP3A 5J2QB 1KD1T 3HHDA 4NLQA 2XLIA 2ZJQQ 1Y5IB 4B17A 3TNVA 4PPZA 4ZP8A 4ICLB 2ASYA 2CVEA 4Y3CA 2DGSA 2AJQA 2N82B 1FKOA 3M30B 4A8FA 3CO9A 4OX9F 3DLLQ 4ECXA 3W3SA 3SQGB 3F56A 3HHNB 3M4XA 4C3KA 2K1RA 1GTEA 3MM5A 4HKQA 2ZUGA 4RU9A 4NLPA 4ALZA 4WTYA 2A2CA 2HWHA 4JI2F 2V2KA 1VOMA 4ECTA 1X9MA 1JJ2R 4G1QB 3ZZTA 1B0PA 5T7LA 4KGKA 1GXLA 1HW9A 5LSLA 3ZZYA 3G86A 1HWUA 2YKOA 4FF1A 1RISA 5B0AA 1RT2B 1X5PA 5D4OA 2IFXA 1RT5B 2BA9A 4O44B 5GAGU 1LK5A 1LXNA 2OPRA 2QRRA 1S99A 2IRUA 4F2SA 3T5KA 3MMCA 4DSIA 1DTQA 1JLBB 2JL9A 2IVFB 5F8IA 1ZZNA 4DSLA 4KC5A 3DOMA 5EHHA 1KHWA 2DO4A 1T7PA 3RU0A 2XSFA 1R8PA 3QIPB 4C2MA 3H4DA 3N0VA 3UFCX 5CYMA 3H59A 1N48A 2YKNB 3MM7B 2VBYA 3TO8A 1DQAA 2N7YA 2X1AA 2LVWA 1QE1B 2A18A 4OHWA 5KG5A 3OR1A 1WEYA 3DYAB 4LQ9A 5K14A 4WZQA 5KFWA 4ZP6A 4HI1A 4ZP7A 2IM2A 5GADU 3HKZD 2YKQA 3JTPA 1X9SA 3L09A 3BSNA 2FJWA 3BR8A 2XY6A 1VQPS 1S49A 4IQXA 1AXQA 2BM1A 2CJ9A 3ENWA 2UVRA 1C0UB 1RTJA 1X4EA 3ENVA 4NXNF 2KRBA 2FJXA 1XK8A 1REVB 1N5YA 3N4WA 4FZVA 3DHXA 1AW0A 1ROFA 2WOMB 2XMJA 1T94A 4EU0A 1RT7B 1S6QA 2YWEA 5KG2A 3G71S 2XG8A 4G6VB 2O5DA 3FDSA 3FMWA 1F0XA 3ONQA 3MUTP 3RBDA 1FDDA 2AW0A 2E5HA 2Q6CA 5B0FA 3G8QA 4LIWA 4OV1A 2U1AA 2C3PA 1YSJA 3K58A 1S1VA 3I96A 4GC6A 2JWNA 1S9EA 2HW3A 4F4WA 2HHHF 5K8NA 3IRXA 1IKVA 3CCJS 4ID8A 3GV8B 2ILZA 2J7WA 2GO9A 2ZH9A 1AFJA 2ZKUA 2DHSA 3M8RA 1Q79A 1V3ZA 3QZ7A 2IAJB 1Y5NB 5BR8F 2CDQA 2XGPA 2CQ2A 1SJFA 2AU0A 3THVA 1KQGB 2HG4A 3DOKA 1S1WA 2WSFC 4ID5A 3BDPA 5IZHA 3UR3C 2DH9A 4NCAA 2W9CB 1FKOB 5L39A 3J80Y 3UDCA 2ACYA 2ZNYA 2PN6A 3LP2B 4DFPA 1YJWS 1BD6A 2PT0A 2RDJA 3TX8A 1TKZA 4HDHA 2HS4A 2K1RB 3GV5B 3MM5B 1JIHA 5J1NA 1S10A 1F2GA 3EGWB 2E7WA 4JI1F 4KGMA 4O3QA 1FNMA 1JNRB 2D74B 5F9LA 5B7WA 3HT3A 2LLZA 4PQUB 2A2DA 4L6V3 2LQJA 2ZC3A 4U67Q 2Z0GA 5C24A 5EDWA 2MHEA 4JUZA 3KNAA 4CTAA 4F25A 2GQCA 2P6TA 5GAHI 3PW5A 1YRUA 1ZM3A 2BBEA 4RW6A 3T9ZA 4F50A 2EFPA 3DXSX 3O6QA 1WI6A 1N5QA 1D8YA 4Q7AA 4IRKA 2OD6A 2DHGA 4RNHA 1YHQS 2OTJS 2OP5A 3GB0A 1JLAB 2CQ1A 3MMCB 4JV1A 2E1AA 5JXSA 1DTQB 3UWTA 4FBUA 4BHQA 2CZ4A 1BGXT 1TUVA 3MEKA 5KFHA 1WG5A 2KG1A 3P3DA 1CEZA 1XR6A 2J9CA 1FK9B 4IRCA 4AL6A 3O44A 3NNHA 1UFLA 4ED6A 1TKDA 3I5AA 1X5TA 2DNGA 3HJFA 5KT6A 1B64A 5KFRA 1UMJA 1Z1ZA 2O3DA 2J9DE 3MM9B 4KPYA 3Q23A 2VONA 1SUQA 2RQ4A 2LQ9A 2CJKA 3GFZA 4M95A 1KQKA 2JEGA 4TY8A 4YHHF 5IQQA 2M4MA 4X4OA 3OR1B 3DLBA 4Y2MA 5D4NA 1KSPA 2HNYA 5I3QA 2MQQA 2XS5A 4KO0B 2VPYB 4YR3A 4C8LA 2YWGA 5KFYA 2DGOA 3CDBA 2B5JA 3NGDA 2M3DA 3POTA 1H0HB 3R1HA 2IM1A 3QAEA 4A8OA 3AA9A 2YKAA 4I68A 4BBYA 2D9PA 4HI2A 4NOHA 4H4OA 2OJ3A 3CT9A 4DSKA 4OZ1A 2CPJA 3DI6B 1RT4B 3BGRA 2KTQA 3CCZA 3K8WA 4ED5A 2GFFA 1U2RA 4BCAA 3M9OB 2XLKA 4P7VA 3IWXA 3J81Y 2R2SA 4O3RA 1HR0F 2DRBA 2VG5A 3EZUA 4B02A 3HF5A 4O4GB 2DHAA