1R27B

Crystal structure of nargh complex
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
465
structure length
465
Chain Sequence
MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKPGQGFPTDWENQEKYKGGWIRKINGKLQPRMGNRAMLLGKIFANPHLPGIDDYYEPFDFDYQNLHTAPEGSKSQPIARPRSLITGERMAKIEKGPNWEDDLGGEFDKLAKDKNFDNIQKAMYSQFENTFMMYLPRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKDLYQRQLDVFLDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMVWYVPPLSPIQSAADAGELGSNGILPDVESLRIPVQYLANLLTAGDTKPVLRALKRMLAMRHYKRAETVDGKVDTRALEEVGLTEAQAQEMYRYLAIANYEDRFVVPSSHREL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of NarGH reveals a structural classification of Mo-bisMGD enzymes
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Respiratory nitrate reductase 1 alpha chain
total genus 149
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature ec 1.7.5.1: Nitrate reductase (quinone).
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
B PF14711 Nitr_red_bet_C Respiratory nitrate reductase beta C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3650.10 Mainly Alpha Orthogonal Bundle nitrate reductase domain fold nitrate reductase domain like 1r27B03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r27B01
2C3PA 1FERA 2C3MA 3MMBB 1FXRA 3MM9A 2C3YA 2WAQD 4DHVA 1H7XA 3MM8B 3C8YA 6FDRA 2IVFB 4Y28C 3GYXB 1HFEL 1H0HB 2O01C 1DURA 2C3OA 1Y4ZB 4XDDA 3MMCB 2FJEB 2FJDB 1D3WA 2ZVSA 1BD6A 4CI0B 1SJ1A 1JB0C 4ID8A 4AYBD 1BWEA 1XERA 3EUNA 1AXQA 1FXDA 2VPWB 3MM5A 3IR5B 5L8RC 4KT0C 2FJAB 1SIWB 3MM9B 2Z8QA 4OMFG 3MMBA 4L6V3 2VPXB 2WSFC 1IR0A 1F2GA 1A6LA 1ROFA 1DFDA 1FRXA 1FRHA 2XSJB 2FDNA 3MM5B 6FD1A 2WB1D 1H98A 1FRLA 3EGWB 4RKUC 2VPZB 1B0PA 1FF2A 2FD2A 2WSEC 1PC4A 3OR2B 1BLUA 1GT8A 3MMCA 1C4AA 1Y5IB 1PC5A 3OR1B 1GTHA 1FRJA 2FGOA 2V4JB 1C4CA 1DAXA 1F5CA 1SIZA 1H7WA 3HKZD 3MMAA 2PDAA 2WSCC 2GMJA 4OV1A 1FRKA 1KEKA 3MM8A 2C42A 1R27B 1FRIA 1CLFA 1F5BA 4XK8C 2UZAA 3EXYA 5BYRA 1VJWA 2PA8D 2Y0SD 3LW5C 1IQZA 1JNRB 2VKRA 2C3UA 5BYQA 1RGVA 1FEHA 1G6BA 1FCAA 3MM7A 3MMAB 4YDDB 1FDNA 2GMHA 2V4JA 1FRMA 1FTCA 1KQGB 1GTEA 3MM6B 1WTFA 7FD1A 1B0VA 1G3OA 1Y5NB 3OR1A 3PNIA 2VPYB 3MM7B 5BYSA 1FDDA 3OR2A 1FDBA 2V2KA 3IR7B 1GAOA 5E7OB 5CH7B 1BQXA 3IR6B 1FD2A 2XSJA 7FDRA 1JNZB 3MM6A 1Q16B 2PMZD 5CHCB 2FJBB 1FDAA 1KQFB 1B0TA 4XDCA 5FD1A 1Y5LB 1BC6A 1K0TA
chains in the Genus database with same CATH superfamily
4BLGA 2B7CB 2ZWPA 5KTQA 4K2XA 4DL0C 1TELA 1UL3A 3R5BA 2HZCA 4USJC 5KG1A 2XGQA 4RNOA 4CNYA 1KHVA 4KGKA 1VQ5S 2J9EA 1IM6A 4CLFA 5K20B 1S79A 1S1TB 1W26A 2BVZA 2OGUA 2QLJB 4NLWA 5A6WA 4F4ZA 2BE2A 3CB4A 3W9IA 4FVMA 5DQIA 1SKWA 1H7XA 3MM8B 2V5HG 2NXEA 4CO2A 3DM2A 1TUGB 3GR0A 4U95A 5C25A 1VIOA 4ECQA 3Q2TC 3ZZPA 2I1RA 1KLMA 4PG4A 5F8NA 1YZ7A 1K8AT 2CPIA 2D41A 1OY8A 2YBVA 2BJ1A 1NSQA 1WKLA 4O3NA 4CO0A 4IG3A 4CLKA 1KR4A 5KFKA 2YWKA 5B0FA 3SSRA 4E8UA 3FEZA 2FJEB 3MTKA 3IBCB 3A8KA 4LIWA 4YQWA 3LWMA 4F2SA 1CC7A 4RNHA 3KK3B 2DNNA 1RTDA 5GAEI 5CQGA 1IBKF 3FBCA 1PKUA 4LBPA 2VFRA 1VC6A 2BW2A 3WX4A 1BMQB 4FKYA 3C16B 1DARA 3EZ5A 1B64A 4FPIA 5FDLA 1SIWB 1MU2B 2MYFA 2QJ3A 3ZFVA 5A0YB 1S12A 5B7WA 5DDOC 5I42A 3BO2A 1Q5YA 5CD4H 4PPDA 3UW1A 1X4FA 4LUBA 2QMXA 5K8OA 4NCGB 2AU0A 1KRPA 2NCKL 1IKXA 1TKDA 2ROEA 1FWLA 2B6AB 1A6LA 2V67A 2M0GB 2B8PA 4Q8EA 1WOSA 3U1LA 2VDIA 4CH0S 4NEYA 3PYEA 3EVMA 4ZLNA 1RCXB 5F3ZA 3OUYA 3KLEA 4NCBA 3RAMA 3MR5A 1HHTP 2HNDB 2RQKA 3OT9A 4ZVEA 3RRKA 3TVKA 4J9RA 2E9ZA 4LFBJ 3CDWA 4RUHA 1QLNA 2ZFHA 2DGTA 3GCXP 4NLYA 1TV6B 4CLPA 3GU0A 3DRRB 3OR1B 1PC5A 4F4XA 3S1TA 3HK2A 1N33J 1LWEB 1RTJA 3AA8A 3UD3P 2RNEA 1QY7A 3HHLA 1G1XA 2IVYA 1AROP 1BY9A 2BJ9A 4YDXA 1U49A 1HYSB 3C2PA 3EZOA 4ES2A 4OHVA 4I2QB 3AAWB 1X5SA 3FK4A 3FSYA 5AXKA 1PJ6A 5DETA 2ALYB 4NXMJ 1UEKA 5DM6Q 2UXCJ 1U1LA 2CJXB 4JOUA 4ETXA 4RR5A 1IBMJ 2QG9B 2WONB 2Y0SD 3U1NA 3CJ3A 1OIAA 2WVBA 3EPIA 1YK9A 1SH0A 2JJ4D 4O44B 4ZCKA 3W5XA 3WC2A 5K9FA 1UFLA 1ZZNA 1AA1B 2G1HA 3KJNB 1SH2A 2WOMA 1YLXA 5HBMA 1NJIT 2YQ3A 2V4JA 6AT1B 2DGVA 5F0WA 2UXDF 2M7SA 2ZBRA 4WZQA 5DGAA 2ASDA 3TQEA 1KNZA 3OLBA 4FPRA 4ZPTR 2AV5A 3BREA 1M5KC 2VPYB 3RBXA 1RU2A 3W9HA 4MT1A 1FDBA 3HD1A 1TL4A 2HQGA 1VK8A 4V19X 5KG4A 1ACMB 2I5JA 2BZ2A 2ZHBA 2RF2B 3KDOA 2HFNA 3HCXA 1VQ6S 1BQXA 3IGNA 2IIHA 5BJRA 4JI4F 4RU9A 1N33F 4WTYA 4LF5F 1JNZB 3MM6A 1QAIA 2HHHJ 5C42B 1IR2A 4OJHA 3D0GE 2PMZD 1URNA 1RWKB 2VG6B 2KM8C 4DR5J 3SSQA 3ZTPA 5FD1A 2FHKA 2LXUA 3M32A 3ZO7A 5LMUF 4N76A 4R8UA 1VLYA 4WP8A 5L39A 2RU3A 3KK2A 2VF3A 2PEBA 3A3OB 3THVA 4Y6IA 3ZTRA 4QR0A 2AYGA 2NYHA 1UETA 2MZJA 2DB1A 5KAKA 4CZCA 3IO1A 3Q23A 3BBBA 1E6YA 3ISNC 4O3PA 1U1QA 4DWIA 4CM0A 1CVJA 3DOKA 3KOAA 4P2XA 3D1QA 2BKOA 2DPJA 1S1UB 2E1AA 2EXUA 2V8PA 1JLAB 1MMDA 1PBUA 1TKZA 3C6TA 3D7SB 4FYWB 4OQJA 3KK3A 4PRFA 5KT4A 1UMJA 2OEMA 2DD8S 1UKUA 3FKBA 2W4PA 2D3OR 4J9QA 3UNGC 2JX2A 2MQMA 1OPIA 2XMVA 1HNWJ 2M8HA 1DHMA 2YWHA 3D5MA 2C3OA 3LOUA 4OZJA 4K4YA 2UUCJ 3JXOA 3F44A 1RB0A 4KV8A 4J9NA 3M8YA 3MD3A 1HQUA 1SI9A 3NCQA 2FUG9 2OPRA 3TAMA 4ENOA 5CAAA 1S4EA 1HBNA 1GEHA 3ILIA 2QLXA 4M5DA 1N5TA 2R8KA 3MM5A 2GHWA 3P5BP 3W64A 4C3LA 1KQKA 4CLYA 4KT0C 4DOZA 2R2UA 3O2IA 2GGPA 3SDEA 1WELA 5LOQA 3HLUA 4XIUA 1QSYA 3MMBA 2ZC4A 2M3DA 2A0FB 1X4HA 3RUBL 2XG8A 2BABA 1IN0A 3H4BA 5J2QB 5J2QA 3T1YF 1IR0A 2WB4A 2PI5A 3LP1A 3PACA 3BKTA 5HI7A 1XMQF 2VG5B 1WOPA 2ZITA 3W65A 3MM5B 5IC4B 4E98A 4DXLA 5IZHA 3QIDA 2OFGX 1ZA1B 4F4WA 1B0PA 2HQ3A 4UTGA 1ZTWA 5EWEA 1HWKA 1TL7B 1V3ZA 4H4KA 4P2MA 1W2IA 2ZBQA 4QIFA 5F8IA 5K8NA 2H48B 3LQVA 3G6VA 1TVRB 1EIYB 3CXCR 1OO0B 2YH1A 2HVZA 5D4LA 2NSCA 2AWZA 3V6JA 3X1LB 2F5GA 4BS2A 1S72S 1OY6A 2IA0A 3MCSA 2PEHA 2R8GA 1RABB 1TFYA 1VQYA 4MK7A 4MYTA 3KK2B 2LKZA 2NUUG 1U1MA 3QQCD 1F5CA 2F3JA 4USUA 3K89A 3UN2A 1ZS6A 3OVSA 1FRKA 3MD1A 1KEKA 4M5KA 4DV3J 2QRRA 1FKOB 4A8SA 1U02A 2W2PP 3L4BC 4OZLA 1Q7LB 2Z57B 2XY7A 2HAIA 5C2CA 5JXSA 3VALA 2EG1A 2MJNA 2RT3A 5LXRA 4B3TF 2RF2A 2EVZA 1CS4B 1IQZA 3D6MB 3IS9B 5D78A 2M8DB 3KTQA 1G7CB 2MSTA 3HULA 2EBGA 3KLIB 1U0SA 4DR2F 1S1VA 2ADBA 2I9SA 3R2DJ 3TUPA 4PG7A 1K1QA 2XZWA 1Z2ZA 4F36A 1FEEA 2CQIA 4K5SA 2ERRA 2HMIB 5F8HA 4OX8A 1GMUA 3W3SA 1RA6A 5I3UA 1KQGB 1JLBA 2XULA 1RT6A 3MEDB 3Q86A 1AUSL 4O23A 4ER8A 4DCPB 8AT1B 5HBMB 1X60A 1BQMA 2C2OB 3OR2A 3AA9A 1A7GE 4HDHA 2I2YA 2E9TA 1SL1A 1TZ0A 5L46A 4DR1F 2FJXA 4A8KA 2Y8YA 4X4VA 2DGOA 4OX9F 1F9EB 3CGIA 2ALZA 2ZNZA 4E0DA 5HMWA 2CJAA 2WK4A 4KR0B 2YX7A 5AE1A 3KLHB 2DNGA 1MROB 4LRCA 2MGZB 4PG6A 2P5VA 3PJWA 4Y2MA 4ED2A 1MN7A 1O5JA 1RBOB 3QNWB 4XDCA 3RW7A 3U1MA 1TMMA 3MMJA 1XTZA 2W4CA 2FB0A 3JQJA 3QGHA 4U9RA 4ZVHA 5HROA 4O3SA 3KHLA 3HHLB 4X64F 4ELUA 4YB1P 2HQIA 3DLBA 2HEKA 3ILJA 1BWVA 3OFFA 2BANA 4C8ZA 2NPFA 2VQFF 4M8LA 3NWRA 3R7BB 3SCLE 5I4MA 3N6MA 5IT4A 3DRRA 2B4UA 5KFPA 1S4FA 2XO6A 2CNOB 1IBKJ 2F8HA 2YKNA 1VQMS 1XJWB 2XO7A 4XTTA 3R97A 1R6VA 3JTOA 5K14B 4BC9A 1RWPB 2CPYA 5FLXU 4OI1A 2UVRA 2RHSB 1HFEL 4ED4A 4KYZA 3BYRA 3VGSA 3NEKA 4LRBA 5KFNA 3ILOA 4FDFA 1IKXB 4JI0J 2Y3YA 3PY8A 1TV6A 2FVCA 2AIRB 1KBRA 3E01A 1YRUA 2ZJPQ 1EQMA 5FDLB 3Q0AA 2XI3A 4LF4F 1RWUA 2HVDA 3DMJB 4UZCA 5ETOA 4DSJA 3OUYB 2FLOA 2UXCF 1WKJA 3O8WA 2B4VA 2MTLA 2QSFA 3J7AN 2Z8QA 1URRA 1HI1A 1N8RT 3Q89A 2P9GA 4MKAA 5LM7E 3U27A 3S6EA 1SKUB 5J1NA 2X1BA 4ZN1A 3HHNB 5SZTA 1NK9A 2WSFC 1R0CB 2D1CA 4YN3B 4ZVUB 3UDEA 2CQ3A 3MPWA 2GO9A 4HI2A 3MUVP 2ZJQQ 5DDQC 2XB2D 2NPIA 1I3OB 3KK1A 1FRHA 2CADA 1RT2B 2W7AA 2RD5C 2XSJB 4I2PB 4KC5A 1QTNB 4DFJA 1U45A 4B3RJ 5IT9Y 3F0NA 2WCXA 4OJGA 2L08A 1VDHA 3H5SA 4WU3A 4KB7A 4UOFA 2VPZB 4DV3F 1FJCA 4KJIA 3EJMA 3H59A 1KTVA 2DXDA 3C14B 4K4TA 1KC8T 1HNZF 4ECYA 2VONA 4WYLA 4LVNP 2A3JA 3BGLA 1P1TA 3NNAA 4B08A 2CQGA 1CQNA 4IRKA 1UPPA 1VQ9S 4WXOA 2FGOA 4QCLA 4Q44A 1YSJA 3QT6A 4B9VA 1JQGA 1D09B 2KU7A 4A8QA 1R43A 1Q8IA 1TUVA 3N01A 4NWBA 1FKAF 2GMJA 2F8MA 4DPWA 1FJGF 3DHWC 3FCHA 4K8RA 2EK6A 4USWA 4DL2A 1U1RA 2FVRA 2ACYA 2PFFB 2LQJA 1T05A 5CXTA 5HK4A 4DF4A 2A6OA 3BBFA 1F5BA 4P7VA 4KTQA 4XAKA 3D68A 1PJ7A 5CYMB 2ZUAA 2OSQA 5KT5A 3A4TA 1T03B 2C3UA 1RGVA 3CDBA 5T14A 4WKRA 4OX9J 1N5SA 1G6BA 2AZ3A 3LGMA 4JI4J 3GMGA 1SCJB 3RYLA 2GFFA 3NGDA 3Q83A 5G0RB 5HVFA 5D4PA 2MKKA 4KPYA 2FHJD 2KVQE 4FVCA 3D1HA 1LQ9A 1GX5A 3TW0A 2BDPA 2GMLA 3VF0B 2HIYA 3KXDA 4GVBA 3RG6A 3MM7B 3PRVA 4HT5A 4IFYA 5J2PB 1NPRA 4X4RA 3WQPA 4PWDB 4ECSA 3M8PA 4G1IA 5CCLA 4UQGA 1NUEA 3GCWP 3KUGA 1FX4A 4IFYB 1C0TB 2BE7D 2HAFA 4ZPVR 4B3OA 4ETZA 1Q0NA 3HVAA 4LSNA 2NSBA 2GJFA 2QMWA 4ZIVA 5DQGA 3G6YA 2R7SA 4P52A 3HHKA 3NMAA 1N54B 2Q6BA 2CUYA 3EVWA 2HFZA 3IFEA 3W2VB 1V9OA 5KT7A 3EX7B 2R7UA 2LXFA 3UQSA 3ZC4A 1T0TV 4YY3J 2PFDA 2X1AA 2W9CB 3BSNA 4CIOA 3DOLB 3ITHA 4P2SA 1QAYA 4DZ6A 1RWVB 3SSSA 4DG1B 3T9ZA 3UCZP 4CWBA 4DX5A 3MURP 1LWCA 2YWGA 1OPZA 2V50A 3HF5A 3KDNA 4WU2A 4NA2A 1RE1B 2F40A 4GO5X 1WI8A 3CIZA 3LPYA 4ZVSB 4F3MA 1XNQJ 2KL8A 1QVGR 3SQGA 3CCSS 4O3RA 4OYBA 1S0VA 4CM2A 5HAOA 1UA0A 3PO4A 2JFKA 3O1LA 4ZVOB 4CLLA 6FDRA 5A8RA 3PZPA 2ZKTA 1ZAVA 2OPSA 4X4QA 2V2QA 1D0EA 4Q0BA 1GH8A 2DXFA 4WYWA 2BOAA 3OLAA 3H0PA 4QR1A 4OLOA 3PHTA 1QSSA 4K2JA 5KFFA 4ECWA 2F8EX 1S97A 1U0HB 1U0HA 1ZPWX 3H5UA 2XYHB 2OIHA 4N41A 3TZXA 2E5LF 2OPSB 4CI0B 3AOAA 4WFXA 1UW9A 5HLFB 1VR6A 2KFNA 3EUNA 1XR7A 1YGYA 2QLWA 1ZA2B 5A6PA 2W9AA 3CJRA 1MG7A 2XYGB 3ZZYA 3KJVB 4LFAF 1NK8A 4TU8A 4PUOA 1FE4A 4NA3A 1GQEA 2FC8A 4DG1A 3NRBA 1IKVB 2HFUA 2GCFA 3KG0A 4ES3A 4JI1J 2RU9A 3PFOA 2OD6A 2X7IA 3M8ZA 2UVUA 1SL0A 4C11B 3RRGA 3Q8VA 3W2VA 2OLWA 1YZ6A 2ZH9A 1SQFA 1NB2A 4IRCA 5L1IA 1FRXA 2FDNA 2K1RA 1XMOJ 1DQ8A 2E5IA 4F04B 4C8KA 3FRYA 2UUTA 1WF0A 1S57A 2FVSA 2B9WA 4KH1B 4W90B 3MXHP 2OTLS 3CJTA 3HX9A 2RHQB 2IC3B 3P4UB 4ICLB 4PWDA 4C4WA 4FN5A 4MMOA 2M88A 2V9KA 3KG1A 5F41A 4RUCA 1I94J 1NEEA 4JI5F 2N3LA 2KXHA 3QPIA 3TUJC 2ASJA 4YEAA 2CPZA 3ZZ0A 4DR3J 1HNXF 3A13A 3PKYA 2BRLA 1M90T 3P49B 4ECVA 3PO5A 2BXJA 1IKYA 5BXIA 3MFHA 3SYZA 3IP0A 2BQRA 2CPHA 2ZKUA 1RBAA 1SJQA 3GPAA 1CJUA 1VQKS 2KZMA 4MTPA 4K4ZA 4C0BA 3H42A 5KFSA 2AEMA 3FRZA 2CNKB 2YKNB 1PAEX 1R27B 3AFGA 3MEKA 4TU7A 2YNIB 3UN3A 3I0RB 2RDJA 3QJPA 3QRRA 5CYMA 3BQ0A 2QA2A 1HKAA 3LW5C 1FTRA 2L9WA 1HMVB 1T05B 5MAOA 4DJBA 3K59A 2PIIA 4CCHA 5DM7Q 2CQPA 3BF4A 2PGCA 2H4YB 2WBMA 4AXIA 3G71S 1C0UB 3MMAB 4EEYA 2IM0A 1JXLA 4TYBA 3D2WA 3R1HA 4CDIA 2QZ8A 1R8AA 3CCLS 5KT6A 4AQYF 2Y1JA 3H7HB 4UF4A 3RR8A 4BCAA 1XMOF 2XNRA 2L48A 3RR7A 3T1AA 1KHWA 3MAHA 5HMZA 2P9EA 3CDAA 2RRNA 3QO9B 2IYIA 1WI6A 1TU0B 3DI6B 5KFHA 1U6BA 2HWIA 1NDCA 1S6PA 5KG7A 2QL9B 3CCQS 2H54B 1BQMB 1LK5A 2CG8A 5CH7B 2IM1A 2H65B 3GFYA 3GIIA 3BSOA 4LBIA 2XSJA 2HMIA 3GFZA 3CCUS 2XHCA 2B5JA 2ZNYA 1TFWA 5I3UB 4KGMA 3AQPA 1AZSA 2GV1A 3T9NA 2GW8A 3D1OA 2RRBA 3K7RA 3D9BA 2AYEA 2YKQA 2C3PA 4C8MA 4HH0A 5J2MA 2DRBA 3R8YA 1EKSA 1NHUA 2IMOA 1EETA 4I7FB 4LF9F 4N8NA 3KMSA 3IM8A 4OYOA 1CS4A 1UP1A 3QATA 3K57A 1NKEA 1LNQA 1K1SA 2VC0A 4KGZB 3RGIA 2J9DE 2E5JA 3DGPA 4ZLLA 4QWCA 2EI5A 1KD1T 1SH3A 1EHWA 3K8VA 4PEOA 4IUFA 1TL1A 2CVEA 2VV5A 4RBVA 5L1LA 1WC3A 1TL5A 4IFVA 1RADB 1W7WA 3MZIA 3V6KA 3V81A 5CZVA 1XIQA 3TVZA 4K5RA 1WORA 2MQ8A 1TKXB 2E7WA 2DR6A 2GAGC 4AQYJ 2POKA 1H2TZ 4X62J 2DNYA 2P9CA 3OTEA 1RT3B 2BM0A 3W2WA 2GVDB 4TNOA 4KHPJ 4DPTA 4NXNF 2DRDA 1ZAWA 3W5YA 4IH6A 5CD4A 5KG3A 3OVBA 4NRUA 1N36F 3LH2S 4ZA1A 3R27A 4DSLA 3N4WA 1FKPB 1FXDA 3QRQA 3BGOP 1O51A 5L8RC 4DR6F 2U2FA 1TMJA 3A3NB 1HW8A 5C5JA 5DZ6A 5IS2A 2DRAA 2XBPA 1UWBB 2DY1A 2DNPA 1RWMB 2I8EA 1RAHB 4RUBA 3ETOA 3OFGA 5K8PA 1FFGB 4DX6A 3M9NB 1IKWB 1RK8A 1HWLA 2JRSA 2V34A 1MROA 1PAUB 1FK9A 5C24A 3WDOA 3ZTQA 3GIMA 2Y1IA 2AGPA 1L3UA 1DTTB 4IRDA 2MZ1A 1BQNB 1SC4B 1JIHA 4TN2A 3LF0A 2QLBB 2OTJS 3HJFA 4NPOA 4Y2KA 2OPRB 3B6BA 2IJFA 2KG0A 4LRAA 3BH7B 4ED5A 2DCUB 2Z2MA 3TR5A 4U7UD 2MLZA 1S1XB 4QWDA 1KWMA 4KHRA 1IWAA 1GT8A 2YX4A 1UW4A 4USVA 2AX1A 3AOCA 3UO0A 1GTHA 3FVYA 5A8KB 4CLUA 5KFJA 1H2VZ 4DV5F 2QEXS 4IR1A 3VAFA 3CC7S 1KONA 2XZDB 3UE2A 4WK1A 3JQKA 4ZN3A 5HJYA 3CCVS 4F0MA 2R7XA 3R6GB 2FVPA 2KRRA 1S1VB 3BN4A 4GO7X 1S1UA 1TK5A 2YX1A 2RB7A 2VHGA 4RU2A 3FZ2A 3I87A 3P45B 4ED6A 3EM1A 3VAJA 1OJ4A 4C3MA 3HXMA 2VC1A 2FPHX 1B3TA 3THPA 4U7CA 1JNRB 4CT9A 2GS8A 3D66A 1FKOA 4F3QA 3SQOP 1V3SA 4KAIA 3BH6B 4FXVA 4YDDB 3BGRB 1WF1A 1VQ8S 1KOOA 2C2RA 1UWAA 4JI8F 1VK3A 1YJWS 4NEZA 5C42A 3RTVA 1GTEA 3MM6B 2MDAA 1O8BA 2AEJA 2J9DA 2M9KA 4C0OC 3KYLA 2VG7B 1QVFR 3G87A 4DBQA 5GAHU 1UCNA 2YNGA 1S1XA 3CE8A 1TL7A 2V8GA 3J80U 4OI4A 3KLVA 2OJ3A 2CFXA 1T9XA 2CQ2A 2ZE2A 2VKZG 4I4BA 1JJ4A 5E7OB 1FHTA 2GVZA 4WBFA 4DX8H 3HSGA 4DV5J 3M30A 4RNNA 1HQEB 2UXBJ 2JLFA 1KOHA 2BMBA 2VZ9A 1TL3A 2CVIA 1Y11A 5IC6B 2NS1B 3VQSA 5LJ3Y 1VQPS 1Y10A 1SXLA 2J8AA 2RVJA 4LRDA 4QIWD 4JBCA 2X3DA 4DZDA 3Q8QB 1WTBA 4H4KC 4FF2A 1UA1A 3SDEB 4LF8F 3CWJA 3IBFB 1N5QA 4K4SA 4MH8A 2ZH4A 4KO0B 2HG4A 1FKPA 2N3OA 1FFWB 4JV5J 2YWFA 3O5TB 1ELOA 3VWSA 4HTJA 4DUZF 4IO1A 2LQ9A 4F25A 1EJ7L 2KJVA 3DNCA 3M7VA 3HKWA 2KDOA 3OL7A 2HZVA 4AD6A 4DF8A 3D0HE 4DV6J 2LCWA 4RW7A 3TANA 3W2WB 3ZZRA 2JHEA 1S59A 1RWXB 1RACB 2YPZA 3AXKA 3I96A 4KKOA 2K8GA 4RL1A 4ID5A 4ZVGA 4CLZA 3G4SS 3I0SA 2HPUA 4ECRA 1HNXJ 1F1BB 2GAHC 5KFEA 3SCIE 4KFBB 3OHBA 3HHDA 4J9KA 5IQ6A 2VFSA 1WC6A 1KKHA 3PXGa 4GKJF 2GA7A 4K7QA 4ID8A 2EKNA 2HS0A 3VGUA 4DN9A 4DS5A 4EZ9A 3MI7X 2Q79A 3L7UA 4CO5A 4NE9C 3C3LA 4UY8T 4KBIA 4A8MP 2RS2A 2O3DA 2CQDA 2FJAB 2P2CB 4DV7J 3FC9A 3HZEA 2HIQA 2JEFA 1O0PA 2N7YA 3GFXA 5IT0A 5KFMA 3DRPA 3IG1A 4B9LA 2A18A 3MECA 2ILYA 2P8IA 1X7VA 2APOA 1GXTA 1H6KX 2OEJA 3NS7B 4RW6A 4U96A 3M2UA 4PR6A 2XC9A 3HZGA 2Q43A 1RHUB 4ED8A 2G2YA 1MU2A 2JNJA 1K0VA 2OMLA 4ZPDA 2KRBA 4O4GB 2KT5A 3ETMA 4USIA 2BOPA 4EYIB 1T9WA 4RO0A 2V4RA 1LKZA 4JUZA 2I5JB 2UVVA 3TZWA 1S6QA 1FF2A 3DKDA 4JYAF 3CCZA 3UR3C 1RUSA 2DIVA 2KZZA 1C4AA 1Y5IB 1J27A 1OY9A 2AJ2A 4FNHA 2KH9A 4C8YA 5HANA 1IM4A 4KRWA 3RBEA 4Q0BB 1YRXA 3LAKA 1L5UA 2PI4A 2VUGA 2V4JB 5GMEA 3CC2S 1YBUA 2VL1A 3T6JA 1SIZA 3TX8A 1C0UA 3MMAA 2VDHA 3QT5A 4DI6A 5I3QA 3K58A 3DM2B 1M5VC 3PW0A 2ZOMA 2R8HA 2KN4A 3MM8A 4O44A 4LFBF 1JLCA 4GVLA 4JI2J 4YHHF 2WONA 3A8EA 4XK8C 4LFCF 3N6NA 1S10A 1XNQF 3CO9A 3DCAA 1WHWA 2YNIA 3EZUA 1U8WA 3FQKA 4KH0B 5DLFA 1ZYQA 2B7BB 4I2QA 4X4UA 3RB4A 2WBRA 1HHSA 2N4CA 2I6WA 2CNLB 2L9NA 5D0GA 1SJ4P 3AXMA 4FYYB 1RAJA 3CNQP 1FRMA 2W01A 3AB4B 4KSEB 4NLVA 4WJBA 1LWEA 1RTJB 3GP9A 3QGPA 3PNIA 3BGFA 3D6FB 5LSLA 5J2NA 1NHKL 1S9EA 4FF4A 3MTJA 4RLEA 3I9V9 3US5A 1V6HA 1PYTA 3POTA 3JTPA 1REGX 3KJQB 5KFYA 5HMYA 1BXNA 4D3HA 2C22A 2HHWA 3H20A 3CJKB 1KDNA 1JLQA 2FZGB 3R6LB 3OL8A 2VBZA 1PG5B 3L9ZA 1R0BG 3BKUA 4KIAA 1QDUB 2QYCA 2WVCA 1FDAA 2WVDA 3OFEA 3WX8A 2MXYA 3M6WA 3J81Y 2V2ZA 4MKBA 1J2VA 5KG6A 1VBXA 1C1CA 3NCRA 4B9TA 1YJRA 2CZ4A 2MJUA 4LSLA 5IWAF 1CC8A 1LEOA 5GMKa 4JI0F 5I42B 4LF7J 2IY5B 4ZITA 3M8QB 2KI2A 3W5ZA 4K4WA 3QBCA 3BV8A 3TJ8A 3T5KA 2QV6A 1NK5A 1XMBA 1CJTA 1UVKA 5M2PA 1I51B 5B09A 1N52B 2CWKA 4YFUA 3S8SA 3QZ8A 2LECA 2RE1A 2RAQA 3GG0A 4R0JA 1VQOS 2OH2A 2Q1LA 3TJ9A 4QR2A 3U02A 1Q4RA 2NUHA 3V4MA 2R8IA 4OJ1A 1X9WA 2ZH6A 1VBYA 3BBCA 3N0VA 2GQQA 4WP3A 3CD6S 3ENWA 3H2UB 1RWNB 2EFQA 2HFOA 1DURA 2LFVA 4X65F 3OW2R 2F63A 4RBTA 4M5NA 5L9XA 4ECTA 1GMWA 2OO4A 1HHQA 1IJEB 1XK8A 3OFHA 3R1LA 2O67A 3BJYA 2DGUA 1C1BA 2QL7B 3H90A 2C2EA 2QN6B 3RZAA 2ZH8A 1D9FA 4HTIA 2LA4A 1H73A 2KHCA 2LXIA 2OELA 3IMQJ 2IM2A 3G6ES 3KWMA 3DFEA 4QWBA 5HSPA 3CUNA 2QX0A 3LALA 3CJSA 3K17A 4K4VA 3G82A 1ZTTA 3N5BA 4G1QB 1FJEB 1R8CA 1FD8A 2XNQA 1QUPA 4L6V3 4X84A 5IWAJ 2RUGA 5KFXA 4WIQA 4DSKA 1UVNA 2W2NP 1Q8BA 4H4MA 4XO0A 2V69A 3M05A 1ROFA 2LA6A 3QLHB 3J7Z5 2W9BA 1H38A 4TQSA 2X1FA 4MK9A 2KM8B 2EEYA 3T1HJ 1KFSA 3MPUB 4ZPAA 4OI6A 2HVEA 1HBOB 4W4MA 2CZVC 1VQ4S 1PIEA 3KG4A 1S6QB 1FRLA 1EB0A 2DNZA 5KG0A 4X2BA 4DCJB 3IRXB 2R7TA 1PC4A 1MN9A 2DNMA 3FMWA 3AQOA 3TA0A 1VQSA 3VVUA 1OYEA 2OMOA 4GRSA 4GVBB 2XLIA 2EG2A 2LVWA 1RHKB 1EP4A 2D3ZA 2H3EB 2DH7A 3QMQA 4OYPA 4YMEA 5EWGA 3I6PA 2E7XA 2PMWA 3AODA 3GTYX 3TNVA 4NOHA 5KFBA 1Q7YT 4NLSA 5H9FK 4DFPA 4DV2J 3DRXA 1T9YA 3DLJA 4NLOA 2Q6CA 4J9PA 3MECB 3W1YC 1PYSB 4IG0A 1X31C 1M1HA 4ITSA 3Q24A 3NS5A 2C42A 5ETSA 3WHIA 4I68A 3F73A 1T7PA 1QM9A 3OL6A 4M5LA 5B0BA 3JYTB 3BO4A 1T03A 1U1NA 5KFGA 3WBZA 1MSWD 4LR7A 1CLFA 3EXYA 1N32F 4DV0F 4N5SA 4Y2AA 3MAAA 3M1VA 2DKOB 2HRYA 1N5YA 1NDKA 2LEAA 2VU5A 4NI2A 4R0EA 4OFZA 1ULRA 2MQNA 3DLGB 1CQMA 3H40A 2Y1LB 4ID5B 2YKMA 2X51A 1CJVA 3GYNA 3UD5A 4N56A 2EC2A 1SC1B 1WACA 1GXLA 5EGYA 2GHPA 2GQCA 2Z0GA 3M6VA 5A76A 5HL7Q 2HHSA 1Y5NB 1UVIA 3H98A 3V2UC 3MR2A 3PM9A 2QE5A 1F9HA 3MAQA 4A8FA 4LF8J 3CJ0A 4YUDA 1WOOA 3TX0A 2YWEA 1CEZA 2J7KA 2W4DA 3UD4P 1FWPA 3AJ1A 2LQ8A 4KO0A 4DV0J 1KS2A 4P6QA 3UN5A 4Y65A 1NK7A 5KFOA 4HHUA 3E3XA 2PD1A 1ZETA 2IPOB 2MQOA 2HVIA 1WC5A 1XNRF 2W8KA 1F3FA 3A3PB 1ICEB 1M1KT 1NZ8A 4K4XA 4WTOB 1HD1A 4DMZA 5GVQA 4BDPA 4IQMA 5F8LA 1TL3B 2J9CA 4WFYA 4OYIA 3FSIA 2LQBA 5ETPA 3RB3A 3DLLQ 3V6HA 1IVZA 5B08A 1U26A 2M4MA 3M30B 3PYFA 3EGVA 2GVZB 3GJTB 2LEBA 3GWCA 4JI6J 1SUQB 3LA0A 4W98A 1FI4A 1RHQB 4M5JA 1RAGB 1RQ0A 2Z2YB 3ENQA 3V6DA 2E9RX 1XQIA 1DBDA 2IDEA 2YNGB 4PXBA 3LP2A 2VG7A 3ZZUA 5A2QY 1UJ5A 3JSRA 4ZVQB 2HBZB 1YDLA 4AUKA 1M5OC 3GSDA 3GYXB 2YTCA 2C2NA 2ZH7A 1T3NA 1ZH5A 1J5OB 1RBLA 4NYZA 2Y0BB 1Y00A 4DSIA 1FNOA 2AP6A 1P27B 1D3WA 2EFOA 3KUEA 1KQSR 1EARA 1SJ1A 1VRUB 4CT8A 3DLKB 4H4OA 3MWBA 1N48A 4ZHRA 5CYQB 5A8WA 3TQ1A 4WXWA 4USMA 2HFVA 4P10A 2J0SD 2RKIA 4ZP7A 2VPWB 1FVQA 4DL6A 1NMEB 2L9DA 4ZVRB 3PIPQ 1JLFA 1VHIA 3FSXA 3K8WA 3VCDA 4YS2A 3MR6A 1HIYA 4OMFG 3GIKA 4ECXA 1X8DA 3R7NB 1NLKL 2YH0A 3EE3A 4LVOP 3CCES 1S99A 2HURA 2QIFA 4ED1A 3A12A 2ZEJA 4EO8A 1WG5A 3CJ4A 5DZ7A 3TEHB 2XY5A 1B99A 3GJSB 1QJHA 4RW8B 2DITA 5HQMA 2CA9A 2OD4A 2JC0A 1X0FA 1LW2A 3PCOB 2DJWA 2H5EA 1RJJA 2HHPA 1X4DA 4J7CA 1RWOB 1YG0A 2MHNA 2MY8A 2WSEC 2ZD1B 4A8YA 3OR2B 4OI0A 4HACA 5IV3A 1YRTA 2DGSA 3MMCA 4YB5A 4CTAB 5IM0A 4J9LA 5L1JA 2B43A 2AF6A 2C2KB 5E3RA 4E2FB 2VFVA 2NR0A 4MFBB 5T41A 4DL3A 1VRTA 3SI8A 1S0NA 3UWTA 1S7HA 2RRAA 3T19A 5ITHA 3DOMA 4WE1B 1HNVB 1YJTA 2OUGA 2JL9A 5KT3A 3J7ZT 3T5HA 1RU1A 4JI8J 2KO1A 2PO4A 3GB0A 3FJ2A 2J0QD 2W1BA 1T9UA 3G8TA 4TQRA 2E1PA 1RISA 1F9FA 1SQGA 3ZZTA 4QPTA 3MEGB 4I56A 4C98A 2ZJRQ 1NKBA 1I6JA 4Y34A 4OJ3A 4L76A 1SKSA 2R7RA 3NBPA 1JK9B 2E5HA 3JSBA 1U48A 4PWUA 3Q8SB 3CCJS 4NRTA 4LMZA 2MQPA 3KHGA 2JVRA 4ZLJA 2D7SA 1UVJA 1TKXA 4DR7J 4RBUA 1TUWA 1UFWA 4OL8A 2ZDOA 2F9DA 1U09A 1YBTA 2B0GA 1TVRA 2VH7A 1DTQB 4ZDNA 5THWA 3Q22A 3V81B 2QC3A 1UEVA 4L3NA 4PG8A 3MPYA 5HVGA 3V6DB 3R7SB 4UZBA 4D3GA 1SUQA 3PEJA 4FXDA 2ASYA 1HBUB 1P1LA 3DGPB 1R8HA 1S9FA 5GADI 1YJNS 4YB6A 5EX0A 3CJ5A 4Q43A 3RB0A 2B3TB 4OLPA 2J7WA 2EFVA 1AUDA 1DJ0A 4YP3A 2MKJA 1F2HA 2F65A 5J1EB 1Q81T 1HI0P 3MMBB 2C3MA 4OZ0A 1V3RA 1R7IA 4MFBA 1VGYA 4I0WA 3M2RA 2HS4A 4IQXA 4F4KA 3QT7A 3DDKA 2XHWA 3IGVA 4PAAA 3VHQA 4YR3A 4CH7A 4JV1A 1QD1A 4NL5A 4CH1A 2H51B 3FDSA 4M5DB 3OD2A 5D8HB 5D0HA 4J9SA 1TTHB 1NKCA 2Y9HA 1WEYA 4JB8B 4ZS6A 5ETNA 3KNGA 1D9AA 3R5AA 3TRGA 2H1YA 3ULHA 4EZ6A 2F7VA 4NYPA 4WIIA 3JSMA 4GC6A 1RHRB 2BJ3A 4Y28C 4J90A 3HT3A 2E29A 4RPFA 3HSZA 4OYXA 1CJVB 1P8GA 5LSOA 5FJ4A 3EPGA 4TXSA 3KUHA 1IR1A 2DT9A 4O0IA 3BSCA 2ZOFA 3DGVA 3JAMY 3BPDA 2C2ZB 3MR7A 2ZVSA 2FJVA 4LQ3A 1MWQA 4WCEQ 1TKTB 3AJ2A 4DUYF 1VQNS 2RDDA 2DPIA 4J9UE 1ZZFA 2CAJA 3AD7C 3CDEA 1AT1B 1B4SA 1MWZA 2MMYA 3T3FA 4LR8A 2FGCA 5IQQA 1E6YB 3MCNA 4F26A 2DNHA 4ZPCA 5CYQA 3OL9A 1FWKA 2HGLA 3DC2A 3FGVA 4IG0B 2ADCA 3DLKA 1Q82T 1M5PC 5HVHA 1RT1A 2K3KA 1Z1ZA 2X3GA 4QOTA 4LREA 3BQ1A 1QTMA 1IKYB 1RZMA 1NXIA 2HGMA 1XEZA 1F2GA 2FTRA 1V5IB 1WHYA 3EDRB 1RYRA 2AMCB 1E6VB 2PMHA 4KHPF 5CABA 1N5VA 1WUUA 2R3VA 3MUMP 1ZPVA 2AGOA 1X9SA 3N9UC 4S0MA 3TZZA 2VA2A 4IH5A 4DQSA 4FBTA 3M2VB 3M6XA 4Q7AA 1JWWA 2YVSA 3SFUA 3DRSA 5L1KA 2NYIA 2HK2A 1NU4A 2DTJA 2JC1A 2VJUA 1IBLJ 3GLJA 4M63A 4LSZB 4MAKA 3P8BB 3T5JA 1AFJA 4I6WA 1RT4B 3CCMS 4C11A 4NLXA 2BR0A 2WOMB 1TAUA 4B3MF 3G96A 2NREA 4ILLA 2HKEA 3J7YI 2XMTA 3CTRA 4R5PA 2HNYB 4A46A 2FC9A 3K5NA 1FRIA 2DEJA 4O3OA 1RTHA 4CP5A 3OTOJ 2R7WA 1JXVA 1R8PA 3DRYA 5D3GB 2XZTB 3DXBA 4ZJOA 5KFRA 1NSKL 1RTIB 1U6ZA 5GAHI 1YJ9S 5F9NA 1RT5A 3VVTA 1NB7A 1C1BB 2ROGA 3C15B 1IBLF 1HR0J 1NHVA 4U8YA 4DQRA 4WWSA 1APSA 3UVJB 2QGFB 2OAUA 2VBYA 5ETRA 1VQ7S 1HYSA 2KG1A 2Z30B 2AJ0A 3M9OB 2AJFE 1YQHA 4U6PA 4FYDA 4Z7CA 2CQ4A 4UOHA 1FVSA 4Z37A 4DFMA 2EFGA 1WF2A 2R7OA 3OR1A 3VTIA 2O5DA 3CD5A 3I4HX 2MZSA 4B17A 4NI2B 2A6MA 4Q45A 3G2XA 2Q3PA 1JJ2R 5HQLA 3M1VB 4ZCMA 2CJ9A 2AT1B 2B56A 2UV8A 1XMQJ 1NK0A 1Z4UA 3PR5B 1NCLA 1F5AA 2B51A 2AW0A 2LDYA 2Z2ZA 3HFZB 3QWUA 4Q2LA 4ZP6A 3KLEB 4F8RA 1DLOA 1Q16B 3IWXA 1AB8A 4LSLB 2K2PA 2YNFA 4OZ2A 3KHRA 1NZAA 3PW4A 4RZRA 2G2OA 4LF9J 4I67A 1S6OA 4FXWA 1SJFA 2HHXA 4OHWA 4NCGA 1D1UA 3QYYA 3I5AA 2BBEA 3TO8A 5B0DA 3TUZC 5KFCA 4X65J 2WZ1A 1H3DA 4IDKB 4QIVA 3N6LA 4PKDB 4ZVPB 1EP4B 5K5MA 4DHVA 3DLHA 4LFCJ 1IQTA 2JEIA 5JJBA 4ZOSA 3LGNA 5D4NA 5IOLA 2KJWA 2E1CA 4FF3A 2KYXA 3POTB 5HP1B 3EVOA 3IRXA 3NGKA 9ATCB 2CKWA 1FJGJ 1SV5B 5KG5A 4RNFA 1EZZB 1DZ5A 2BACA 2CNNB 1KSPA 2HBRB 1S9GB 1Q53A 1QE1B 4NMLA 4EK2A 2HLUA 2DY9A 4P9SA 4B9NA 1PO6A 2KT2A 4KHMA 3A8JA 2QA4S 3PFEA 2W9BB 4K0KF 1VRQC 4IG3B 4H4MB 2IJNA 2E5GA 1WC4A 3C66A 5G0RA 2CJQA 4HH1A 3F56A 4Y2IA 1S77D 2EC0A 4QU6A 1CSJA 2LU1A 1NK4A 2G4BA 3DLEA 2VD3A 1SL2A 4U67Q 1HWJA 2IAJA 2MKCA 4ZLPA 2J6SA 4C0HA 1B7FA 1TR0A 4QBUA 2QFIA 3NGRA 1JLCB 3NXZA 1RWWB 2DGXA 4BHQA 3GV7B 3Q8YA 2R7VA 5CCMA 2DO0A 3PJ9A 5D15A 1NPPA 4ED3A 5KFWA 3VZIA 4WFAQ 3IA0A 4X4PA 4DDFA 1X5OA 2JOQA 3QIPA 3G6XA 3H2LA 2XMAA 2BX6A 4C3KA 2W25A 4DV2F 4DV4J 2UXDJ 3JTNA 2KB2A 3HHLD 3NAIA 3R5CA 1QE1A 2XCPA 1S9GA 5DS7A 1OSDA 4LF6F 2WB1D 4UT4A 2DHHA 4PYDA 3EGWB 1TAQA 2H5IB 4P7TA 4P75A 2XTJP 4CLSA 2BV3A 1HBMA 1LWXA 3GV8B 2FJWA 3F41A 3JB9k 2V2VA 2Z58B 3FMBA 4B3SJ 4IKAA 1RT2A 4I2PA 4C9DA 1VBZA 4X4NA 2RUSA 3SV3A 4CYUB 3QWPA 4ED0A 3HHLC 2OKQA 4NX9A 1X5TA 2R2RA 1NJZA 1DRZA 3B8HA 3HVTA 2ZH3A 3CO0P 2ATLA 1VBKA 3BEGB 1XNRJ 4A8OA 5LMUJ 1GFWB 5JUMA 3O3LA 3M9MB 1WSRA 3HSJA 1S0MA 4AXJA 4A47A 1QSLA 4ECZA 3AB2B 3BQ2A 3CJ2A 2E7VA 1VC5A 4DR1J 2ZBIA 4PQUB 1S7IA 3RRHA 1RT7B 3CDUA 5KFQA 4JI7J 4I69A 2V8DA 1R89A 4R25A 2UV8G 3I5BA 5F8MA 3EYZA 3FZBA 5HATA 4B02A 5KFTA 4UOGA 1HNIA 1WWHA 1UZHA 4HEA9 4OHXA 5H9FJ 1FA0A 2MEWA 1B0VA 1MNEA 1YBAA 3N79A 4DV1F 4EBDA 3CJ8A 2ZM6F 5K14A 4EU0A 3PRDA 3AOBA 3UVJA 2E5LJ 1F0XA 4LQ9A 1P9YA 2DYAA 1YIJS 5GADU 5AE2A 4GKKF 5E5NA 1OWXA 1RTIA 1WD6A 2ZZNA 2HYIB 3ZZOA 4JI3J 5HO4A 3IR6B 5D3GA 2HFSA 4LJMA 4OZNA 2CRLA 7FDRA 2FQQB 3V4IB 5ETVA 1FO1A 3DYAA 5DO2A 3CD0A 4F4AA 3UNYA 4LIRA 3BO3A 1B0TA 5HROB 2CXEA 3OXFA 8RUCA 3OJUA 1RT4A 4OYZA 1T9VA 2EFNA 2MQLA 1XC9A 3DXSX 2GIQA 3OVAA 1XR5A 4I6AA 2ZE2B 1AFIA 2HNYA 2YNHA 2VICA 4ZVFA 3M2VA 5A2QU 3AY0A 4XPCA 1Q1KA 3BKFA 3MCMA 2FY1A 2J76E 1Q8KA 4NXNJ 3QFHA 5AXMA 1K73T 3RU0A 2F4FA 2GNKA 2OEKA 1VYAA 2PSZA 4PG5A 5ETKA 4ZJQA 3T1YJ 1RHJB 4DQIA 1HLWA 4M5GA 1TP7A 2BKNA 4PXCA 2CDRB 2NXUA 4GMKA 5LMNJ 2B4OA 2IYGA 4WFBQ 2R8JA 1UVLA 3DRPB 5CA5A 2LLZA 4ZP9A 2DXEA 3IS9A 4ZCIA 8ATCB 1DY3A 1AXQA 1H72C 3BR8A 3W8GA 5DQHA 1N32J 4IH7A 3MM9B 3THTA 1T9TA 4B3SF 3D6HB 2M52A 1LOUA 4MIBA 2AD9A 3IXQA 4DSFA 1X5PA 2MLXA 2IA6A 3KMQA 2Z56B 3TVYA 3W61A 3I0SB 1RKIA 3HFKA 5E3PA 4CO4A 4BBYA 1RAEB 5B0AA 4TYAA 4DUTA 2CIMA 1SJRA 1V5VA 1M5HA 2COLA 3EDQB 3CIMA 4IOBA 4PWWA 3W66A 3J81j 1S1WA 4AT1B 3M8RA 3JSMB 1RP5A 4J9MA 1NBEB 1S0OA 1N36J 3K5MA 2IRYA 2D3O1 2YQ1A 1TKTA 1DQAA 1BQNA 1WC1A 3DDIA 3QSYB 1N34J 1NNDA 3UDLA 2OP5A 4XPEA 3NNCA 4W92B 5GAEU 1FK9B 1G4CA 3D54A 1X9MA 1S6UA 3L7PA 4EBCA 2AQ4A 1X4CA 2CQHA 4PXDA 2W7PA 1S48A 3OHAA 2OPPB 4M5IA 4L3KA 1M5SA 4G6VB 3RBDA 3VQTA 5DDRC 2WSCC 2DHSA 1X4AA 5ETQA 2DGQA 4O3QA 4F0KA 3AD9C 5B0CA 4LF6J 3NGUA 3QJJA 5C2GA 1HQEA 3I31A 2N4DA 4WP9A 4A8XA 4LF7F 1H2UX 3SV4A 5GMDA 2XEXA 3FFIB 5HN0A 3PDNA 5G4DA 1HBUA 3OTBA 1NH7A 4RW9A 5BYQA 3VGVA 5DDPC 4K4UA 1AYEA 3KHHA 5E3CA 1D9DA 3TUIC 2D9OA 1DTQA 3JS9A 5J1EA 3HO1A 1Q86T 4KV8B 2JZ5A 1HI8A 1LW0B 1FDNA 1O6XA 1Y0HA 1YHQS 4DR4F 4C6AA 1N0VC 4FZVA 5B0GA 3UPFA 7FD1A 2GHVC 3W9JA 4ATNA 5KFDA 1JKHB 3PRBA 5RUBA 1VC0A 3VAKA 3RB6A 3NBPB 4M95A 4URGA 4EMDA 4TY8B 3LAMA 1TL1B 1X4GA 4NMXA 4NLDA 3IR7B 1ZOTA 2ABYA 2LEPA 3EICA 1WHVA 4MJKA 2KTQA 2ZBPA 1W25A 2JH3A 3SZ2A 3KNAA 2RJZA 2W8LA 2GJIA 4DUZJ 4IOAQ 4J5OA 3GYGA 5K8MA 2QMUB 1NRKA 3AH6A 1EETB 2QL5B 2AKWB 1UZDA 1S76D 3AD8C 4F67A 1MMLA 1VFJA 4DU7A 3BPSP 1LWFB 1Y5LB 3M32B 1ZM9A 1HNVA 2D3UA 4NLPA 2VFTA 4V19J 4KGVB 2AJ4A 3TA1A 1AZSB 3PW7A 1VRTB 1Q8LA 2RILA 1H74A 3CD7A 4HR2A 4YHHJ 3HPOA 2C3YA 3HJVA 4G3IA 4PZVA 3MEGA 4M1KA 2E1MC 3D3BJ 3T1HF 2KXFA 5D0RA 1UVMA 1VJQA 2R2TA 1GX6A 3VAMA 1FNXH 3N5FA 3K0JA 1S6PB 5DG7A 4EI2A 2VB6A 3DI6A 1U1KA 3PKMA 1X4EA 3PEHA 2AJ1A 1TQLA 3KLGA 3OPKA 2ZHAA 3QGGA 3SCJE 2OHDA 4OIXA 5LJ5Y 2CPEA 3DOMB 1Q5VA 3DDNA 4WE1A 3KLFB 2EFPA 3D3CJ 4DR7F 1T11A 3VR1A 1IKWA 4QQBA 1R0AB 2A1BA 1J5EF 4CTAA 2WVEA 2XMKA 2FHMA 3SEOA 4XDDA 3DU6A 3MMCB 2MZRA 5IM0B 2KVIA 9RUBA 4HACB 1RHMB 2NZCA 3R5JB 3TAPA 1U1PA 1BD6A 1HW9A 2XMJA 3KLGB 3LTOA 4B3MJ 1JB0C 4PABA 3I55S 1HMVA 3TEGA 1ZM2A 1EKRA 3UFCX 4AYBD 1UFKA 2UUWA 4DSEA 2UUBF 4F3OA 4NCAA 1BWEA 1LW2B 2RKIB 3GONA 4DQQA 2UXBF 3HT0A 5D6GA 2UU9F 4RW8A 4ZHRB 1N34F 4L75A 2XS5A 3ELHA 3FUYA 3MPVA 1EX8A 1CJUB 2J8SA 4DR2J 1RA7A 4Y3CA 2UUCF 3D0IE 2DR8A 4ED7A 4WF9Q 3BSAA 3IM9A 3PX4A 3P96A 4OYAA 4WFZA 3W62A 3TZYA 1Z2LA 2D9PA 4ALZA 2WRMA 5KFAA 4B9SA 2R42A 3MGJA 1OS5A 1WJ9A 2HNDA 4FF1A 2ZBCA 2J6UA 1NPKA 2HRTA 5HJXA 3MR3A 3BM7A 2Y8WA 2AJQA 4HKQA 1JXEA 4IYQA 1BUXA 3PYGA 5AJ3F 1T8EA 2G0IA 1QUVA 3CCWA 1RLDA 3HMJG 4QWEA 3CCRS 4I7FA 1N4LA 2FYXA 4M94A 5DRKA 5DG9A 2MB0B 4NZ7A 3ENVA 5J2MB 3HVWA 5H9EK 5LMNF 4DR5F 3GIRA 5KFZA 3VZHA 3CMES 3LP2B 1H7WA 4DUYJ 1IKVA 2ZZMA 2XLKA 1TK0A 4B3RF 4DS4A 2I0XA 2VOOA 3CVKA 4L74A 2B5JB 1RXOB 4RW9B 4V1Ak 4DLEA 2M70A 3DHXA 2IBKA 4DL7A 2LU2A 5BYRA 4BWJA 1VJWA 2DNQA 4BWMA 5HLFA 2DR5A 1FEHA 4ZJLA 3Q8PB 4CO1A 3CULA 2JEJA 1FCAA 5FLXY 1OYDA 1U8SA 2J5AA 1WC0A 3R9LA 1YJ7A 3NS6A 4USHA 1T02A 2BEFA 2FVQA 2GMHA 1SBRA 2M5YA 2OPPA 2DISA 4DPOA 3DYAB 1WTFA 2K7JA 3NL0A 3MUTP 3T5LA 2G0CA 5E0OA 1KLMB 4X64J 4ZPWR 3MPDA 5BYSA 1FDDA 2LQ5A 3N28A 3HSDA 3UDVA 5C25B 3LPEA 3JAMU 2XY6A 1IBCB 2JLEA 4DR6J 2HW3A 3SQGB 3EMTA 3UR0A 3IN5A 4HL9A 3K2YA 3P5TL 1S1TA 4Q8FA 5KOXA 1WNEA 4CLTA 3J81U 2XLJA 2E1RA 2C2MB 3I0RA 5DLGA 3I9ZA 3Q2SC 2HS3A 2V68A 1HNIB 3X3UA 4UUXA 1Q78A 3DOLA 3ITHB 3ONQA 4F0HA 2ATCB 3DLGA 3MFIA 3LP0A 2K06A 4JI1F 1UEUA 1FERA 5D0EA 2ZM6J 3MOJB 1LFWA 2DH8A 3HDSA 3PYDA 1Y9OA 3CEDA 3OTDA 4OV6A 1RT7A 3NOGA 1VI7A 3MM9A 5KFLA 2RQCA 4ELTA 4ZPBA 2BUNA 3QAUA 1RAOA 2NXJA 2BE9B 1RTZA 3MF5A 3DN9A 2V8VA 2NLWA 1WG4A 4KQZA 4MIWA 2RQMA 4HVZA 2CPJA 3QAEA 3KFWX 2K7KA 5HMXA 4PQAA 4X4TA 3ICLA 4J9OA 3QSIA 4BC7A 1RYSA 4DPYA 1ZBTA 4N77A 1CULB 1REVA 4ZCLA 2M2BA 4X66J 5L9NA 4DQPA 3J7YU 3FBFA 3HVTB 3G8SA 2IVMA 3ZNJ1 1HPZA 4DPXA 4DV1J 3PV8A 2MHEA 2JSXA 3GZ7A 3UDCA 1Y4ZB 2DHGA 4RX6A 3I56S 1K9MT 2F4VF 2HHQA 1R8BA 3IAM9 2A2CA 2UUAF 4ZP8A 2XMMA 4JV2A 2R2SA 5IT9U 4WFNQ 4FKXA 3L7OA 4TU9A 1S5ZA 5IXUA 4RUAA 2YNHB 1XERA 5F9LA 4F7VA 3KJVA 1HBOA 2XQCA 1G2EA 1YX2A 2HHVA 2KT3A 5DGBA 1U2FA 4DX7A 1U2CA 3QIPB 3IRWP 1Q79A 3FCVA 4OI2A 3SMZA 2MY7A 3CMAS 2CQBA 3B82A 2ASLA 1LFPA 3WIVA 2Z2LA 3IBWA 3TYTA 1SC3B 1HWUA 3V4IA 2J0XA 4EGLA 5LSRA 1EQ0A 1U2RA 1WG1A 2LP4A 3C14A 1B7YB 1GXUA 6FD1A 2RIJA 5EHHA 1Y3KA 3MOZA 3NNHA 5KT2A 5M2UA 2FD2A 1CJTB 2MKSA 4Y0FA 1JLGA 2GC8A 3PG9A 4LF1A 2A2DA 2GJ2A 3L95X 5JVGQ 3UCUP 4QYZK 4HHJA 2HVHA 4DCOB 3KK1B 1LWCB 2B4PA 1NDPA 2HGNA 3NCPA 1GMVA 3LWLA 2W9CA 1RI7A 3GG1A 2G13A 4JV0A 4HT7A 5C7PA 2AGQA 3VAIA 1F60B 5LXYA 3IWNC 1TK8A 5ETLA 3PVXA 2VBWA 4PQUA 3MDFA 2AYBA 3CJKA 2VQFJ 1XBWA 2BA9A 3M8QA 2GO8A 3BN7A 2VKRA 3E01B 4GKKJ 2CQ0A 3M8PB 4NLQA 3E8OA 4NLTA 2EPIA 3Q8UA 2OPQA 2KKHA 3FCWA 3IAS9 4QWAA 1GMWD 5F3TA 1C1CB 1YJVA 4LT6A 1UAWA 4TKTA 1OSCA 1D8YA 3H8YA 2AEFA 1NAQA 1R6YA 4QW8A 4YOEA 1SQEA 4DR3F 2XM3A 1JLQB 1HQ2A 2NXCA 2W2QP 4MIAA 3SBMA 3HVRA 4PPZA 1HBMB 2Q66A 2G9OA 5E3AA 4ZVTB 4KGXB 2JVOA 1BGXT 5EX3A 5CYJA 4Z7YA 2IM3A 3OSNA 1YI2S 5J2NB 4J91A 4FS2A 3R2CJ 3K5OA 1X4BA 3NGTA 1JJCB 1F6TA 2FY8A 3BB5A 4LFAJ 2CZ9A 4ZK7M 4DL4A 2UU9J 4OZ3A 4QYRA 2DR9A 2XS7A 3I4PA 2FJBB 1KQFB 2PE8A 1FXLA 3DU5A 3SXLA 4WKYA 1U1OA 3OSPA 1BC6A 1K0TA 4NZ6A 2JDJA 3CMQA 1FXRA 1EAYC 1MW7A 4WPAA 3KLHA 2FHOB 2WAQD 3H4DA 1U47A 1UJ4A 2U1AA 3CW2C 3CF5Q 2LDIA 1RTHB 2IBOA 4EYHB 2A10A 5EN1A 1QAXA 2QTWA 2IAJB 4TVAB 3DLEB 3QGIA 2UP1A 2HQFA 3NAHA 5KFUA 1RDRA 4O4GA 2YKOA 4EFAC 7AT1B 3FQLA 2XMUA 1RT6B 2JFDA 2RH3A 3MEDA 2DCLA 3SCKE 4C48A 3PW2A 1I94F 4JI5J 2L3MA 2O01C 2MZTA 3BDEA 1HPZB 3ISZA 1HA1A 4RWWA 3B78A 3PIOQ 3M2UB 4ZIWA 3D6TB 2D74B 2HNZB 3CSKA 4X4OA 1U7LA 1ZM3A 3D4JA 4RW6B 3VAHA 2VOPA 1REVB 1U6FA 3JQMA 1U24A 5H1SV 3WZ0A 3DRSB 3J7A1 1WKKA 3OJSA 1IWGA 2CPXA 4JI6F 1SV5A 1N0UA 2ILZA 4G1PA 5HP1A 4ERDA 2HZAA 2RS8A 4ECUA 2WVFA 1YTYA 2QSWA 3OTCA 3IR5B 3DMJA 4NLRA 3NWGA 4CO3A 1T3OA 1XWLA 2AYMA 1LXNA 1E6VA 1RCOB 4EUVA 3BR9A 4IDKA 3PJXA 4X66F 2C28A 4Y2CA 1KLNA 1B70B 1JLEB 2V4QA 4FP9A 3KJFB 3LP0B 2QO3A 4TLRA 2VPXB 1VISA 3W60A 4C97A 4OHZA 5L38A 3IG1B 4QPXA 2QA4G 4B9MA 5HQ8A 5D4OA 2YNFB 1T95A 2CPFA 2HRUA 1DLOB 2HSEB 2NXNA 3NKYA 3RBZA 2FZCB 2P6TA 4A48A 2DR7A 4PYAA 3TAQA 2BJ8A 2VFUA 4LF4J 1UJ6A 3NY0A 4EBEA 5GAGI 1L3KA 1HARA 2JWNA 3OXGA 4N47A 4MKYA 5M2RA 4IR9A 5AXLA 4QU7A 1HWIA 3ZXWA 1IUJA 3SIPB 4KFBA 2WTFA 2YPYA 4MYUA 4DN0A 2ZOGA 2VG5A 4NZ0A 4JI7F 2MKIA 3PX0A 2BANB 3LP1B 2I38A 3ADAC 1J5EJ 4KKOB 4N8OA 3ENAA 2WW8A 1C4CA 4DL5A 3GQCA 1GK8A 2B9YA 1OQ3A 2CPDA 2KYZA 4RW4B 4RW7B 4P72A 2GQ2A 1WEXA 3HKZD 5T7LA 2PDAA 2BM1A 2ZHOA 4AE5A 2GIFA 2YWWA 2YKPA 2GGPB 4ES1A 3MHYA 5F8JA 1M1GA 2PC6A 2H5JB 2MGZA 3C15A 4QW9A 1NH8A 1VCTA 4OZ1A 1RT5B 4OZ5A 3RAXA 1YITS 2VASA 1HNZJ 3E2EA 5AE3A 3K5LA 1IXKA 2CDQA 1LK7A 4I6YA 2IHR1 3M2RB 4R5PB 1WSVA 2F1FA 2XWYA 2H9ZA 4AL6A 4U8VA 3TJAA 3PR4A 1HQUB 1SKRA 2GIRA 2VODA 1AW0A 2WW4A 2QA1A 3IC1A 3HFVA 4IOCQ 1FTCA 3L09A 1JLBB 3E51A 2ROPA 4KE5A 1UTAA 4X62F 2J6TA 3FNNA 2DEIA 1G3OA 3EXCX 1N6QB 3G86A 4P74A 4Q2MA 5LL6d 1JLAA 2V2KA 3C6TB 4FNIA 4RJVA 3NP5A 4TY9A 2CG4A 1PILA 3KLIA 3RW6A 5IV4A 3LO3A 5J1PA 1GAOA 1HR0F 3GIJA 2IRUA 4OX7A 4RWXA 5B0EA 4JV5F 2DNLA 2XWXA 4I64A 5AJ3J 5EDWA 1W2BR 2YQ0A 5JVHQ 2CYYA 1R31A 1FD2A 2DH9A 1NJXA 4O4RA 5KOWA 3VAGA 4FS1A 1MWYA 2BJEA 3BGRA 4R8UB 1NSPA 1YJUA 1T94A 2QT7A 1RT1B 2DIUA 2FHJA 2Z4PA 3R5DA 2G0JA 1VS3A 2JLGA 1YKWA 2JEGA 3T41A 2HHUA 1C2PA 4EO6A 1JJHA 4MK8A 4CQ1A 4OHYA 3U7JA 5E33A 1PGZA 4P73A 3C8YA 3OBIA 4QIEA 3K5PA 3H5YA 2VQEJ 5CZXA 3HP6A 1Y3JA 4QYZJ 2OI2A 5JMNA 4JYAJ 2V6AA 3O44A 1N6QA 4OX6A 1A9NB 2G2ZA 2AHOB 4HHHA 2CWXA 5C24B 5EWFA 2ZH5A 4M5MA 2EKYA 1H0HB 1R0AA 2PN6A 5KFIA 2ACMA 5A8KA 2FLNA 3H5XA 2C1EB 3R5GA 2AZ1A 1JMTA 3KLFA 2HWHA 3JSYA 2X1GA 4YB7A 4URQU 2LMIA 3UCGA 4DU8A 2W7OA 3O6QA 1UWBA 2QFJA 2OSRA 3QZ7A 3QT8A 2XS2A 5F8GA 3Q8RB 1S49A 2O66A 2V8HA 3CJQA 2EWHA 4F50A 1DTTA 2DO4A 1PSDA 2XMWA 3NOCA 1SVDA 3L3CA 2NZ4A 2RMLA 1HBNB 4B3TJ 4CLWA 1SJ3P 3PX6A 1MLAA 1RAAB 1YVFA 3TAMB 1FT8A 2P6SA 4UUWA 1HD0A 5T7LB 2IDLA 2PT0A 4J9VA 3NG8A 4RW4A 3I32A 2BKPA 2GVDA 3EGZA 3QJLA 1LWFA 1RT3A 3GJRB 2CJYB 5F0UA 3WC0A 2F4VJ 1FFSB 2MKHA 2E44A 2O1PA 4P71A 4C2MA 3T6BA 3VGTA 2V0NA 4DPUA 3FBBA 1OQ6A 2BJ7A 1P9QC 2LYVA 3ZTSA 2H4WB 3B54A 1X0PA 2ZVIA 4IFVB 2VA3A 1H98A 4QJVA 1TKZB 4RKUC 4FBUA 4H4OB 1VRUA 2CQCA 4DV7F 3P6YC 3WIUA 3UI3A 5BR8J 4TY8A 2HHTA 3DOKB 4J37A 4Y00A 1BLUA 2Y1RI 2XGPA 1JKHA 2ZH2A 2PA3A 4CRJA 2SXLA 3TI0A 4PCQA 4JI3F 3ZZZA 2MSSA 1LXJA 4LRFA 4U7UK 3C46A 5E2QA 2MPUA 5ETMA 2W24A 1LW0A 1VOMA 2EBEA 1DAXA 4EWTA 5ADZA 3HM9A 1JLEA 3GR1A 1NK6A 2RQ4A 4X4SA 4I1TA 5DJBA 2VG6A 2ZUGA 4OYWA 1R3NA 2HK3A 3S7RA 3C16A 1NSAA 5E41A 2FLPA 4NYOA 2D69A 2GZOA 2YKAA 2UZAA 3C19A 3FFIA 3H2VE 3SFGA 5AXNA 1N56A 3B4MA 2DNOA 4FYVB 4CNZA 4K59A 5EUHA 3GILA 5U47A 3G9CA 1XN9A 3GFHA 3QO9A 4C8LA 2W2MP 2HNZA 3R3TA 1VLOA 2VIHA 4QIGA 3BGUA 3ISND 4FYXB 1SB6A 4WK3A 5MLCV 1N88A 2J7UA 2XI2A 3AT1B 1DQ9A 3GJQB 3M8SA 2C2DA 1RAIB 1FE0A 4H54A 4IO9Q 2DNRA 2VBXA 5I3PA 2BYCA 2N82B 4GC7A 1K47A 4LBHA 4M5HA 5DG8A 2DVIA 4NXMF 2E66A 2HBQB 1FX2A 2ZC3A 4USKA 3GV5B 2ZWOA 2BQ3A 1ZM4A 1YWXA 2B9EA 2ZD1A 2UUAJ 5BR8F 1WEZA 2N7CA 4F2RA 1I5OB 1WHXA 1WDTA 1CPZA 2G1DA 2BW7A 1S1WB 1SC6A 4UOCA 3TWZA 4AL7A 1KFDA 4K50A 1PCAA 5LT5A 4UY85 1L3TA 3BDPA 1PBAA 4NA1A 2QYGA 2KFYA 4QZVB 2KFZA 3LANA 4C8NA 2RSQA 4L73A 4ELVA 3D67A 3CCTA 3MEEA 4L72B 4B9UA 1MMNA 1NO8A 4OI3A 3FEXB 3NLCA 4YR0A 2DBBA 4ANEA 1VHFA 1WDDA 3HHEA 4KPCA 2V63A 1JLFB 3CT9A 2J0WA 3TA2A 1L3VA 3I5CA 1NM2A 3FBEA 3TP2A 3RJMB 4Z2XA 4DV4F 3TARA 1HL6A 1KP6A 3QFWA 4A8WA 1OMSA 1KTQA 2BRKA 5A8WB 2XCAA 4ICLA 1Q95G 4P2FA 1ZAXA 2B9XA 3EWGA 5H9EJ 3C6UA 3AHPA 3MCOA 3OQ2A 3W7BA 2IVFB 2HWTA 4DEZA 1RLCL 1FNMA 1UPMB 1RKJA 1J5OA 2B8QA 1XR6A 3CPWR 4F02A 2B6AA 1KVKA 1Y7PA 2DGWA 1VMBA 1K44A 2FJDB 4JP8A 2EW9A 3M4XA 2IFXA 2IC3A 2MKYA 2OPQB 2MQQA 4ILMA 2R9LA 5A0YA 2UVWA 4PUOB 4UQTA 4A4JA 1I1GA 3AJDA 2KXNB 4C7QA 2W2OP 2K1RB 4PXEA 3OTOF 1NJYA 3HI9A 2V9WA 4G65A 4LF5J 3A1YG 3OXLA 2EK1A 1IBMF 3PHEA 1P6TA 3NMRA 3QLHA 4NLGA 1RTDB 2WHOA 4F4YA 4YY3F 5KFVA 3W8PA 4G1QA 2DHAA 3H25A 3G82B 3ET6A 2L41A 1U4BA 1ITPA 1PJ5A 4YR2A 2DHXA 3ILLA 2XYPB 4ANCA 3BZQA 3ZNUA 3KKFA 1QAJA 1JLGB 1M0SA 3W63A 3LGHA 5IFMA 3GSIA 4LR9A 3IWLA 2MZQA 4JI2F 1U25A 2QLFB 3TOQA 2YXLA 3EGNA 3P3DA 2IJRA 2F9JA 1CG2A 2BE2B 2YY3A 2NQPA 2VJVA 4HLBA 1DFDA 1F3VA 5ETTA 2AX0A 3PTWA 4K0KJ 1FRJA 2HLTA 3ET6B 3FEYB 5SUHA 5E3QA 2YKMB 3VV2B 4C8OA 4N7TA 4NASA 1PYOB 4GKJJ 4HDGA 3V5RA 4DFKA 2DK2A 4O0NA 5A8RB 1CJKB 4OV1A 1LV5A 3NGSA 2IMWP 5KG2A 3S01A 1N5YB 2MLYA 2UUBJ 3LUYA 4NLUA 2R7QA 2R4FA 3MAAB 4ILRA 3CC4S 3M6UA 4LSNB 2HQDA 4ZKAA 4B3OB 2BQUA 2PA8D 4DLGA 3HD2A 3B4DA 4AFFA 3JYTA 1RAFB 4UW2A 3GE9A 4ZMMA 2CQ1A 1FJ7A 5FIIA 3QRPA 2KHDA 1KVIA 3BYPA 3I82A 3BS9A 1GNKA 2VQEF 3RAQA 3D28A 3MM7A 3ZTOA 5J2PA 1BE4A 1SPBP 4Q5VA 2HHHF 4KY3A 2HQCA 4MKVA 2XSFA 2OFHX 2FZKB 4HYKA 2FIUA 2IRXA 2CJKA 1NDLA 3PW5A 1D8ZA 1VIXA 2FLLA 2RDIA 4CYUA 4HI1A 1HNWF 2DNKA 2K3IA 1CULA 1FESA 1C0TA 4TLQA 4USTA 5D77A 2V94A 2ZZTA 3C6UB 1KVJA 4URSA 1KN6A 3OV7A 2GX8A 1S9EB 1CBKA 3G8QA 2ZH1A 2CJBA 4ANDA 1RSCA 4LF2A 4AL5A 1IJFB 4OYMA 1JX4A 2HBYB 5GAGU 1NJWA 3A8IA 1VQLS 2BJDA 5AT1B 4RNMA 1L3SA 4WZMA 1A0OB 5CHCB 4DV6F 4DR4J 1CJKA 1BHNA 3M8WA 3J80Y 2ZDPA 3MEEB
chains in the Genus database with same CATH topology
2B7CB 5KTQA 4K2XA 4DL0C 1UL3A 3R5BA 4USJC 2HZCA 2XGQA 5KG1A 4RNOA 4CNYA 1KHVA 4KGKA 1VQ5S 2J9EA 1S79A 1S1TB 2BVZA 4F4ZA 4NLWA 5A6WA 2BE2A 3CB4A 4FVMA 5DQIA 1H7XA 3MM8B 2V5HG 4CO2A 3DM2A 3GR0A 3Q2TC 5C25A 1VIOA 4ECQA 3ZZPA 2I1RA 1KLMA 4PG4A 5F8NA 1K8AT 2CPIA 2D41A 4CO0A 4O3NA 4IG3A 1KR4A 5KFKA 2YWKA 5B0FA 3SSRA 4E8UA 3FEZA 2FJEB 3MTKA 4F2SA 4LIWA 4YQWA 3LWMA 1CC7A 4RNHA 2DNNA 1RTDA 5GAEI 5CQGA 1IBKF 2VFRA 1VC6A 2BW2A 3WX4A 1B64A 3EZ5A 1DARA 5FDLA 1SIWB 1MU2B 2MYFA 3ZFVA 5A0YB 5DDOC 2ZHAA 5B7WA 5I42A 3BO2A 5CD4H 4PPDA 3UW1A 1X4FA 4LUBA 2QMXA 5K8OA 4NCGB 2AU0A 1KRPA 1IKXA 1TKDA 2ROEA 2B6AB 1A6LA 2M0GB 4Q8EA 3U1LA 3VAJA 4CH0S 5F3ZA 4NCBA 3OUYA 3KLEA 3RAMA 3MR5A 1HHTP 2HNDB 2RQKA 3TVKA 4ZVEA 3RRKA 4J9RA 2E9ZA 3CDWA 4RUHA 1QLNA 2ZFHA 2DGTA 4NLYA 1TV6B 3DRRB 3OR1B 1PC5A 4F4XA 3S1TA 3HK2A 1LWEB 1RTJA 3AA8A 3UD3P 2RNEA 1QY7A 3HHLA 1G1XA 2IVYA 1AROP 1BY9A 1U49A 4YDXA 1HYSB 3C2PA 4ES2A 4OHVA 4I2QB 3AAWB 1X5SA 5AXKA 3FSYA 5DETA 5DM6Q 1U1LA 4JOUA 4ETXA 2WONB 2Y0SD 3U1NA 3CJ3A 1OIAA 3EPIA 4O44B 1SH0A 2JJ4D 4ZCKA 3WC2A 5K9FA 1UFLA 1ZZNA 1SH2A 2WOMA 5HBMA 1NJIT 2YQ3A 2V4JA 2DGVA 5F0WA 2UXDF 2M7SA 4WZQA 5DGAA 2ASDA 1KNZA 3OLBA 4FPRA 4ZPTR 2AV5A 3BREA 2VPYB 1FDBA 1TL4A 4V19X 1VK8A 5KG4A 2I5JA 2BZ2A 2ZHBA 2RF2B 2HFNA 1VQ6S 1BQXA 3IGNA 5BJRA 4JI4F 4RU9A 1N33F 4WTYA 4LF5F 1JNZB 3MM6A 1QAIA 5C42B 1URNA 4OJHA 3D0GE 2PMZD 2KM8C 2VG6B 3SSQA 4N76A 5FD1A 2FHKA 2LXUA 3M32A 5LMUF 4R8UA 1VLYA 5L39A 2RU3A 3KK2A 3THVA 4Y6IA 4QR0A 2AYGA 1UETA 2MZJA 2DB1A 5KAKA 4CZCA 3IO1A 3Q23A 4O3PA 1E6YA 3ISNC 1U1QA 4DWIA 1CVJA 3DOKA 3KOAA 3D1QA 2DPJA 1S1UB 2E1AA 3P49B 1JLAB 1MMDA 3C6TA 1TKZA 4OQJA 3KK3A 4PRFA 5KT4A 1UMJA 2DD8S 1UKUA 2W4PA 2D3OR 4J9QA 3UNGC 2XMVA 2JX2A 2MQMA 1OPIA 2M8HA 1DHMA 2YWHA 3D5MA 2C3OA 3LOUA 4OZJA 4K4YA 3F44A 4KV8A 4J9NA 3MD3A 1HQUA 1SI9A 3NCQA 2FUG9 2OPRA 3TAMA 1HBNA 2QLXA 4M5DA 1N5TA 2R8KA 3MM5A 2GHWA 4DOZA 4C3LA 2R2UA 1KQKA 4KT0C 3O2IA 2GGPA 3SDEA 1WELA 3HLUA 4XIUA 1QSYA 3MMBA 2ZC4A 2M3DA 3H4BA 1X4HA 5J2QB 2XG8A 2BABA 1IN0A 5J2QA 3T1YF 1IR0A 2WB4A 2PI5A 3LP1A 3PACA 5HI7A 1XMQF 2VG5B 2ZITA 3MM5B 4E98A 5IZHA 3QIDA 2OFGX 4F4WA 1B0PA 2HQ3A 1ZTWA 5EWEA 1HWKA 1V3ZA 4H4KA 4QIFA 1X9MA 1W2IA 5F8IA 3G6VA 5K8NA 3LQVA 1TVRB 3CXCR 1OO0B 2YH1A 2HVZA 5D4LA 2NSCA 2AWZA 3V6JA 3X1LB 4BS2A 1S72S 2IA0A 3MCSA 2PEHA 2R8GA 1VQYA 4MK7A 4MYTA 3KK2B 2LKZA 2NUUG 1U1MA 1F5CA 2F3JA 3OVSA 1FRKA 3MD1A 1KEKA 2QRRA 1FKOB 4A8SA 4OZLA 2XY7A 1Q7LB 2HAIA 3VALA 5JXSA 2EG1A 2MJNA 2RT3A 5LXRA 4B3TF 2RF2A 2EVZA 5D78A 1IQZA 3IS9B 2M8DB 3KTQA 1G7CB 2MSTA 2EBGA 3KLIB 4DR2F 1S1VA 2ADBA 2I9SA 4PG7A 1K1QA 2XZWA 1Z2ZA 1FEEA 2CQIA 4K5SA 2ERRA 5F8HA 4OX8A 3W3SA 1RA6A 5I3UA 1KQGB 1JLBA 2XULA 1RT6A 3MEDB 4O23A 5HBMB 1BQMA 3OR2A 3AA9A 1A7GE 4HDHA 2I2YA 2E9TA 1SL1A 1TZ0A 4DR1F 2FJXA 4A8KA 4X4VA 2DGOA 4OX9F 3CGIA 2ALZA 2ZNZA 5HMWA 2CJAA 2WK4A 4KR0B 2YX7A 5AE1A 3KLHB 2DNGA 1MROB 2MGZB 4ED2A 4PG6A 2P5VA 3PJWA 4Y2MA 1O5JA 4XDCA 3U1MA 3RW7A 1XNRF 5HROA 3MMJA 1XTZA 2W4CA 2FB0A 3QGHA 4U9RA 4ZVHA 4O3SA 2HHXA 3KHLA 3HHLB 4X64F 4ELUA 4YB1P 2HQIA 3DLBA 3OFFA 2BANA 4C8ZA 2NPFA 2VQFF 4M8LA 5IT4A 3SCLE 5I4MA 3N6MA 3DRRA 2B4UA 5KFPA 1S4FA 2F8HA 2YKNA 1VQMS 2XO7A 3JTOA 5K14B 4BC9A 2CPYA 4OI1A 2UVRA 1HFEL 5KFNA 1IKXB 3PY8A 1TV6A 2FVCA 3E01A 1YRUA 2ZJPQ 3Q0AA 5FDLB 4LF4F 2XI3A 1RWUA 3DMJB 4DSJA 3OUYB 2FLOA 2UXCF 3O8WA 2B4VA 2QSFA 2Z8QA 1URRA 1HI1A 1N8RT 2P9GA 4MKAA 3U27A 3HHNB 3S6EA 5J1NA 2X1BA 5SZTA 1NK9A 2WSFC 2D1CA 2CQ3A 3MPWA 2GO9A 4HI2A 3MUVP 2ZJQQ 5DDQC 2XB2D 2NPIA 3KK1A 1FRHA 2XSJB 1RT2B 2W7AA 2RD5C 4I2PB 4KC5A 4DFJA 1U45A 2HMIB 5IT9Y 2WCXA 4OJGA 2L08A 4WU3A 3H5SA 4DV3F 4KB7A 1FJCA 2VPZB 4KJIA 3H59A 1KTVA 4K4TA 1HNZF 2VONA 4WYLA 4LVNP 2A3JA 3BGLA 1P1TA 3NNAA 4B08A 2CQGA 1CQNA 4IRKA 1VQ9S 4WXOA 2FGOA 4QCLA 4Q44A 1YSJA 4B9VA 2KU7A 4A8QA 1R43A 1Q8IA 1TUVA 3N01A 4NWBA 1FKAF 2GMJA 2F8MA 1FJGF 3DHWC 3FCHA 1U1RA 2EK6A 4DL2A 2FVRA 2ACYA 2PFFB 2LQJA 1T05A 5CXTA 4DF4A 1F5BA 4P7VA 4KTQA 4XAKA 5CYMB 5KT5A 2OSQA 1T03B 2C3UA 1RGVA 3CDBA 5T14A 4WKRA 1N5SA 1G6BA 3LGMA 3GMGA 3RYLA 2GFFA 3NGDA 5G0RB 5D4PA 2MKKA 4KPYA 2FHJD 4FVCA 3TW0A 3D1HA 1GX5A 1LQ9A 2BDPA 2GMLA 3VF0B 3MM7B 4HT5A 4IFYA 5J2PB 4X4RA 4PWDB 4ECSA 3M8PA 4G1IA 5CCLA 4UQGA 4IFYB 1C0TB 4ZPVR 4B3OA 4ETZA 4LSNA 3HVAA 5DQGA 2NSBA 2QMWA 3G6YA 2R7SA 3HHKA 3NMAA 1N54B 2Q6BA 3W2VB 2R7UA 2HFZA 3IFEA 3EX7B 1V9OA 5KT7A 2LXFA 3UQSA 3ZC4A 2X1AA 2W9CB 3BSNA 4CIOA 3DOLB 3ITHA 4P2SA 1QAYA 3SSSA 4DG1B 3T9ZA 3UCZP 3MURP 1LWCA 2YWGA 1OPZA 3HF5A 4WU2A 4NA2A 2F40A 4GO5X 1WI8A 3CIZA 3LPYA 4F3MA 1QVGR 3SQGA 3CCSS 1S0VA 1UA0A 3PO4A 2JFKA 3O1LA 6FDRA 3PZPA 5A8RA 2ZKTA 1ZAVA 2OPSA 4X4QA 4Q0BA 1D0EA 1GH8A 4WYWA 3OLAA 4QR1A 4OLOA 1QSSA 4ECWA 5KFFA 2F8EX 1S97A 1ZPWX 3H5UA 2OIHA 4N41A 2E5LF 2OPSB 4CI0B 4WFXA 5HLFB 2KFNA 3EUNA 1XR7A 1YGYA 2QLWA 5A6PA 2W9AA 3ZZYA 4LFAF 3KJVB 1NK8A 4TU8A 4PUOA 1FE4A 4NA3A 1GQEA 2FC8A 4DG1A 3NRBA 1IKVB 2GCFA 3KG0A 4ES3A 2RU9A 3PFOA 2OD6A 2UVUA 3RRGA 1SL0A 4C11B 3W2VA 2OLWA 2ZH9A 4IRCA 5L1IA 1FRXA 2FDNA 2K1RA 1DQ8A 2E5IA 4C8KA 3FRYA 2UUTA 1WF0A 2FVSA 2B9WA 4W90B 3MXHP 2OTLS 3HX9A 4ICLB 4PWDA 2IC3B 4C4WA 4FN5A 4MMOA 2M88A 2V9KA 3KG1A 5F41A 4RUCA 4JI5F 1NEEA 2N3LA 2KXHA 3QPIA 3TUJC 2ASJA 4YEAA 2CPZA 3ZZ0A 1HNXF 4WZMA 3PKYA 2BRLA 1M90T 4ECVA 3PO5A 2BXJA 1IKYA 3MFHA 3SYZA 2BQRA 2CPHA 2ZKUA 2KZMA 1SJQA 1VQKS 4MTPA 4K4ZA 4C0BA 5KFSA 3FRZA 2YKNB 3MEKA 1R27B 4TU7A 2RDJA 2YNIB 3QJPA 3I0RB 5CYMA 3BQ0A 2QA2A 3LW5C 1FTRA 2L9WA 1HMVB 1T05B 5MAOA 4DJBA 3K59A 2PIIA 4CCHA 5DM7Q 2CQPA 3BF4A 2PGCA 2WBMA 4AXIA 3G71S 4EEYA 1C0UB 3MMAB 1JXLA 2IM0A 4TYBA 3D2WA 3R1HA 2QZ8A 1R8AA 3CCLS 5KT6A 4AQYF 2Y1JA 3RR8A 2XNRA 4BCAA 1XMOF 2L48A 3RR7A 3T1AA 1KHWA 3MAHA 5HMZA 2P9EA 3CDAA 2RRNA 3QO9B 2IYIA 1WI6A 3DI6B 5KFHA 1U6BA 2HWIA 1S6PA 5KG7A 3CCQS 1BQMB 1LK5A 5CH7B 2IM1A 3GIIA 3GFYA 3BSOA 2XSJA 2HMIA 3GFZA 3CCUS 2ZNYA 2B5JA 1TFWA 5I3UB 4KGMA 3AQPA 2GV1A 3T9NA 2GW8A 3D1OA 2RRBA 3K7RA 2YKQA 2AYEA 2C3PA 4C8MA 4HH0A 5J2MA 2DRBA 1NHUA 2IMOA 1EETA 4I7FB 4N8NA 3KMSA 3K57A 1UP1A 1NKEA 1K1SA 2VC0A 2J9DE 2E5JA 3DGPA 4QWCA 1KD1T 2EI5A 1SH3A 3K8VA 4IUFA 1TL1A 2CVEA 2VV5A 4RBVA 5L1LA 1TL5A 4IFVA 3MZIA 3V6KA 3V81A 5CZVA 3TVZA 4K5RA 1TKXB 2E7WA 2POKA 1H2TZ 2DNYA 2P9CA 3OTEA 1RT3B 2BM0A 3W2WA 4TNOA 1ZAWA 4IH6A 5KG3A 3OVBA 4NRUA 1N36F 3LH2S 4ZA1A 3R27A 4DSLA 3N4WA 1FKPB 1FXDA 1O51A 5L8RC 4DR6F 2U2FA 1HW8A 5C5JA 5IS2A 2DRAA 2XBPA 1UWBB 2DNPA 2I8EA 3ETOA 3OFGA 5K8PA 3M9NB 1IKWB 1RK8A 1HWLA 2JRSA 1MROA 1FK9A 5C24A 3WDOA 3GIMA 2Y1IA 2AGPA 1L3UA 1DTTB 4IRDA 2MZ1A 1BQNB 1JIHA 4TN2A 3LF0A 2OTJS 3HJFA 4NPOA 4Y2KA 2OPRB 2KG0A 2IJFA 4ED5A 2DCUB 2Z2MA 3TR5A 1S1XB 4QWDA 4KHRA 1GT8A 2YX4A 1UW4A 2AX1A 5A8KB 4DV5F 1GTHA 3FVYA 5KFJA 2QEXS 4IR1A 1H2VZ 3VAFA 3CC7S 1KONA 3UE2A 4WK1A 3CCVS 2R7XA 2FVPA 2KRRA 1S1VB 3BN4A 4GO7X 1S1UA 1TK5A 2YX1A 2RB7A 4RU2A 3FZ2A 3I87A 4ED6A 4C3MA 3HXMA 2VC1A 2FPHX 3THPA 4U7CA 1JNRB 4CT9A 1FKOA 4F3QA 1V3SA 4KAIA 4FXVA 4YDDB 3BGRB 1WF1A 1VQ8S 1KOOA 2C2RA 4JI8F 1YJWS 1VK3A 1UVMA 3RTVA 5C42A 1GTEA 3MM6B 2MDAA 1O8BA 2J9DA 2M9KA 4C0OC 3KYLA 2VG7B 1QVFR 4DBQA 5GAHU 2YNGA 1S1XA 3CE8A 3KLVA 2V8GA 4OI4A 2OJ3A 2CFXA 2CQ2A 2ZE2A 2VKZG 4I4BA 1JJ4A 5E7OB 1FHTA 4DX8H 3M30A 4RNNA 1HQEB 2JLFA 1KOHA 2VZ9A 1TL3A 2CVIA 3VQSA 5LJ3Y 2NS1B 1VQPS 1SXLA 2J8AA 2RVJA 4QIWD 4JBCA 3Q8QB 1WTBA 4H4KC 4FF2A 1UA1A 3SDEB 4LF8F 3CWJA 1N5QA 4K4SA 4MH8A 4KO0B 2HG4A 1FKPA 2N3OA 2YWFA 3O5TB 1ELOA 3VWSA 4HTJA 4DUZF 4IO1A 2LQ9A 4F25A 2KJVA 3DNCA 3HKWA 2KDOA 3OL7A 4DF8A 3D0HE 2LCWA 4RW7A 3TANA 3W2WB 3ZZRA 2JHEA 4KKOA 4ECYA 4ZVGA 3I96A 2K8GA 3G4SS 4ID5A 4ECRA 4O3RA 3I0SA 2HPUA 5KFEA 3SCIE 4KFBB 3OHBA 3HHDA 4J9KA 5IQ6A 2VFSA 3PXGa 4GKJF