1R27B

Crystal structure of nargh complex
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
465
structure length
465
Chain Sequence
b'MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVETKPGQGFPTDWENQEKYKGGWIRKINGKLQPRMGNRAMLLGKIFANPHLPGIDDYYEPFDFDYQNLHTAPEGSKSQPIARPRSLITGERMAKIEKGPNWEDDLGGEFDKLAKDKNFDNIQKAMYSQFENTFMMYLPRLCEHCLNPACVATCPSGAIYKREEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEKCIFCYPRIEAGQPTVCSETCVGRIRYLGVLLYDADAIERAASTENEKDLYQRQLDVFLDPNDPKVIEQAIKDGIPLSVIEAAQQSPVYKMAMEWKLALPLHPEYRTLPMVWYVPPLSPIQSAADAGELGSNGILPDVESLRIPVQYLANLLTAGDTKPVLRALKRMLAMRHYKRAETVDGKVDTRALEEVGLTEAQAQEMYRYLAIANYEDRFVVPSSHREL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Respiratory nitrate reductase 1 alpha chain
publication title Architecture of NarGH reveals a structural classification of Mo-bisMGD enzymes
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 149
structure length 465
sequence length 465
chains with identical sequence D
ec nomenclature ec 1.7.5.1: Nitrate reductase (quinone).
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
B PF14711 Nitr_red_bet_C Respiratory nitrate reductase beta C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3650.10 Mainly Alpha Orthogonal Bundle nitrate reductase domain fold nitrate reductase domain like 1r27B03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r27B01
1ROFA 4XK8C 2WAQD 3MMAA 1PC4A 1FRIA 1FTCA 1H98A 2Y0SD 2Z8QA 3MM9A 4DHVA 3GYXB 1SJ1A 2V2KA 1G6BA 2WB1D 1KQGB 1FCAA 2C3OA 2WSCC 1JNZB 2GMJA 4OV1A 1WTFA 1FDAA 1F5CA 3MMAB 3EUNA 1C4AA 1JNRB 3IR7B 1F5BA 1FRKA 2UZAA 3EXYA 3OR2A 1KQFB 2WSFC 3LW5C 1FRMA 1GT8A 1CLFA 1SIZA 1BLUA 1GTEA 3MM5A 4AYBD 1FDDA 1H7WA 3OR1B 1BC6A 4XDDA 3MMBA 1DURA 1Y5NB 1RGVA 2PMZD 3EGWB 2WSEC 1BD6A 1FF2A 2FJEB 3MM6A 2C3MA 3MM8A 1B0VA 1GAOA 3MM7A 5L8RC 5FD1A 2IVFB 3MMBB 5BYSA 2FJAB 1A6LA 3IR5B 3MM9B 2FJBB 3PNIA 2PA8D 1FERA 1Y5LB 3MMCA 4OMFG 4XDCA 2FJDB 2ZVSA 3MM8B 1FRLA 1DAXA 2VPXB 2VPZB 2FGOA 4ID8A 1R27B 1H0HB 2XSJA 2GMHA 4Y28C 3OR2B 1G3OA 1XERA 1Y4ZB 2C3UA 1JB0C 1BWEA 7FDRA 1B0TA 3IR6B 1BQXA 3C8YA 7FD1A 4RKUC 1Q16B 3MM5B 1FRJA 5CHCB 1C4CA 1KEKA 6FDRA 2VPWB 1FRHA 5BYRA 1FDBA 1D3WA 2C3PA 5CH7B 3HKZD 5E7OB 2PDAA 1B0PA 1FEHA 1VJWA 2FD2A 4L6V3 2VKRA 3MM6B 2V4JA 1IR0A 1K0TA 3MM7B 2C42A 1FDNA 4YDDB 6FD1A 2VPYB 1HFEL 1H7XA 1DFDA 1F2GA 1PC5A 1FXRA 1GTHA 5BYQA 1AXQA 1IQZA 2C3YA 3OR1A 3MMCB 1SIWB 2V4JB 1Y5IB 1FD2A 1FRXA 1FXDA 2XSJB 4CI0B 2O01C 2FDNA 4KT0C
chains in the Genus database with same CATH superfamily
4LRAA 3CJ0A 2RIJA 5KFDA 4DSLA 1NPRA 3BQ1A 3UDVA 1LV5A 1V6HA 3EXYA 5HK4A 3G82A 3BBBA 4YY3J 1UFWA 3Q8SB 4LREA 5T7LB 4K8RA 1XQIA 1YK9A 2GMLA 2C3MA 3MFHA 4DCOB 4XIUA 2G0CA 1CJUA 1SPBP 3M8QA 3V4IA 5L38A 1I51B 2OPPB 1UVJA 2KVQE 2C28A 4LSLA 3MUVP 4ECQA 2GMHA 4IFYA 2W4DA 4UQTA 2DYAA 1PIEA 3T6JA 2P6TA 1E6VA 2YNIB 4OYMA 1YG0A 3QZ8A 4B9VA 1SC1B 2VG6B 3U1MA 1Y3KA 2CZ9A 1X4BA 1KVJA 3W7BA 2GGPA 2XO7A 5EUHA 1HI1A 2CRLA 2Q1LA 3IN5A 4C0OC 1FRIA 1KC8T 2RF2B 5GAEI 3OL8A 3H5XA 2V0NA 5DDOC 4JBCA 1QSSA 2O3DA 1NJIT 3H5UA 3OXFA 1CJTB 1U1LA 4TQRA 2MQQA 1ZAXA 1N48A 3J80Y 4Q5VA 3A3PB 3PYDA 4TLRA 4ZITA 3OBIA 4DR3F 2VB6A 5CQGA 1B0VA 4OL8A 3TX8A 2NYIA 4IG3A 2VQFJ 1T8EA 3MTJA 3KLVA 2E1AA 2CNKB 3N4WA 2HQ3A 1WWHA 2KL8A 1Q5YA 1HBUB 4P6QA 1PCAA 4PG6A 2ZWOA 1PAEX 4PZVA 1P1TA 1RKIA 1XMBA 1HYSB 3TUPA 2FVQA 4FKYA 4MMOA 4DFPA 3KHLA 2Q43A 4Q45A 3AAWB 4TY8A 4USWA 2FJWA 4P7TA 3BM7A 1X9MA 5D0GA 1Y7PA 3IG1B 4YMEA 3C66A 4OZ0A 2BDPA 4FXDA 2GVZB 3LP0B 1S6QB 1RDRA 1YZ7A 2HRYA 1VQLS 3KFWX 3EVOA 1NHUA 4FZVA 1S1TA 1FCAA 2KM8C 2KZMA 1BQNB 3NNAA 3HULA 3OJUA 3NCQA 1Q81T 2ZJPQ 5KFNA 2MQPA 2MLXA 2YNGB 2ZZTA 3WBZA 4ZPBA 2OMLA 3IGVA 3EGWB 5SZTA 1R8HA 2A1BA 1B4SA 2RHQB 2KKHA 4I2QB 4JI3F 1FTRA 5ADZA 4CRJA 4RW6A 3C16B 3DRRA 1B7FA 1D8ZA 3IRXB 3R2CJ 5H9EJ 2ZOGA 2PI5A 2WW4A 2H1YA 1EIYB 4PR6A 2B56A 4ZA1A 5DLGA 2OPRB 4WK3A 1RT5A 2HHUA 1LW0B 5C24A 1S49A 1FJEB 2GIQA 3ZC4A 2QLXA 2RKIA 4A8FA 3FCHA 2FY8A 2YVSA 4HR2A 1VRTB 3BR8A 4Q2MA 4RW4B 5K20B 5C42B 3UD3P 1AXQA 4EBEA 5GAHU 3SDEA 4ED4A 2DNGA 2HIYA 1Z2LA 5G0RA 4MKVA 3DNCA 2JVRA 5D3GA 1R8CA 2YBVA 2XQCA 2HHHJ 3VVUA 4KRWA 1Q5VA 4LF9J 1NK8A 2ZH1A 4FF4A 3CCQS 2BRKA 1W7WA 3TA1A 3R5JB 1RZMA 4PWWA 1DURA 1UJ4A 4X84A 1HNVB 3HSZA 4Y2AA 4LJMA 4PEOA 1OO0B 2W2QP 4KFBB 3RAQA 3VVTA 2AW0A 3D5MA 3QAEA 3QT6A 2VPXB 3SQGA 1S4EA 2RQ4A 2OEJA 3HJFA 5DQIA 2ZBQA 2Y8YA 3IMQJ 2GQQA 4M5DB 3HX9A 3GIJA 1UWBA 3Q24A 3ZZTA 4URSA 4WBFA 3KK2A 4FN5A 3OW2R 1YKWA 1TL7B 5IQQA 1BQMA 4OX6A 1N4LA 2KH9A 4FS2A 2AJ4A 2APOA 2QMXA 5J1EB 3VAMA 2GMJA 5DG9A 2YY3A 3I31A 4I56A 1X4FA 4UOGA 2ZITA 4OI4A 4UQGA 1KLMB 3QO9A 3PM9A 3P8BB 3DOMB 3RAXA 3DXBA 1NH8A 2PMWA 3KJQB 5CXTA 1Y5NB 4F7VA 3P3DA 2ZC3A 2CIMA 4UT4A 3VGSA 4OX9J 1WC1A 4IUFA 1N33F 4EBCA 3OQ2A 1SUQB 4JV5F 2BM0A 1GMWA 2KN4A 4P2XA 1SBRA 5KG1A 4DL3A 1REGX 1UL3A 2EBGA 3G96A 3RB3A 1HQEB 3F41A 5DS7A 4BHQA 2J0QD 4WU2A 4Y0FA 4WZMA 3IBFB 5JXSA 2HBZB 3PFEA 4PKDB 4ER8A 4FBUA 3RYLA 4J9KA 2BOPA 1EJ7L 1R0BG 3M05A 3W5YA 2FZCB 2Y1LB 2AGPA 1YZ6A 1UVKA 1D0EA 2RRBA 2UU9J 1DQ9A 4J9PA 2FZGB 1VJQA 3SZ2A 3G2XA 3Q8PB 1R0AB 4EMDA 2O67A 4B9SA 4NXNF 2UXCF 3IXQA 1R6VA 2KU7A 1UA0A 2YWFA 4DR4F 3TJAA 4RW7B 1IBMJ 1S6PA 5D4NA 2YKQA 4EU0A 2ADCA 5LL6d 1ZA1B 2MKHA 2ZVIA 3KLHB 2FJDB 2WCXA 2WK4A 2F65A 2BJ8A 2QL9B 3GFHA 4CO1A 2EKNA 3D66A 4GC7A 1OIAA 2GS8A 5KFWA 2IDLA 2HQGA 5E41A 4DQIA 4KIAA 1D09B 1QUVA 2UXBJ 1AT1B 2V8PA 4C3LA 3K89A 1U26A 5EWFA 1PYOB 1TZ0A 3EZ5A 2VKRA 3D0GE 2DXDA 4BC7A 3PY8A 2XTJP 4HT5A 1CJTA 2YH1A 1X5SA 4OJGA 1GTHA 5GAGU 2VIHA 3J7AN 4ZVPB 2CYYA 1AZSA 2ZH4A 3DGPB 2LVWA 3Q0AA 4K7QA 3Q83A 2PE8A 4PYAA 2GJFA 4RUAA 4N8OA 1LK7A 5F0UA 4JUZA 1NH7A 2BR0A 5J2MB 4MAKA 2IBOA 1HBUA 2JEFA 3ENVA 2WSFC 4EZ9A 4QR1A 3EDQB 4U7UK 2W2NP 1UEKA 5HROB 3OFGA 4CLUA 5KG3A 2LP4A 1HYSA 3OFHA 2VJUA 2ALYB 1DTQB 3G9CA 3ICLA 4EYIB 1RACB 1SH0A 4A8XA 5HVGA 4DV4J 4XDCA 1RI7A 5KFYA 4DPOA 1T9TA 5CZVA 2JX2A 2XS5A 1VIXA 3MECB 2GVZA 3HHKA 1WC3A 1N54B 2XYPB 3VHQA 2FVCA 3UD5A 3PJ9A 3M30B 4NPOA 2YNGA 4HL9A 3CDAA 1UVMA 3FRZA 2XMAA 1RHUB 4WXWA 4ELUA 1HWLA 4OYIA 3D1QA 1TL3B 7AT1B 2CVEA 4NLOA 2DXEA 4A8YA 2D3O1 3IRXA 5F0WA 4YB1P 2E44A 3K5NA 3QT8A 4FYYB 1LFPA 4ZPCA 1EKSA 2WVEA 2CQCA 1WJ9A 5ETKA 2CQHA 4WYWA 4OJHA 3MCSA 2J8AA 1NDCA 1VRTA 3BEGB 4ZLNA 5C42A 4HDHA 1PKUA 1WEYA 4EYHB 1I94F 2JFDA 2GW8A 5IT0A 4DV1J 4MJKA 4C8KA 4ZPAA 1VLYA 3RBEA 3UR0A 4CM0A 4QIEA 4YS2A 3DOLB 3UDCA 1XTZA 2DNMA 4KYZA 2RT3A 2QYCA 1TVRB 3HLUA 5HAOA 5E33A 3DLGB 3BGOP 2DK2A 4ZLLA 1FKAF 2BQRA 2AJFE 2F4VF 3R5CA 2M3DA 1HNVA 4RZRA 1RAJA 2H4YB 3MWBA 3CD0A 4KFBA 3R5GA 1X0PA 3B82A 2LECA 2M8HA 1T05A 3GIIA 4S0MA 5GAEU 1X9SA 2BM1A 1U48A 2XMJA 1H2TZ 3UDEA 5H9FJ 2M4MA 1F0XA 4PAAA 3AJ1A 4NLXA 4M5DA 4HTJA 2OFHX 3IRWP 1IBLF 4NLUA 5E0OA 3CCLS 3NOGA 2JHEA 4EK2A 2CVIA 1NDPA 3K8WA 5D0RA 2V8GA 4YB7A 1TL7A 5IXUA 5ETTA 2IIHA 1BQXA 2MQLA 4M63A 3SIPB 1T9XA 3M4XA 3KUHA 1QAXA 5DM7Q 1FE0A 5HMZA 5J1EA 4P71A 2KYZA 5GMEA 3UVJB 4RU2A 4YEAA 1XR5A 3FBEA 2C2OB 2F3JA 1DFDA 4ECWA 3R27A 3CCTA 3L7UA 4RUCA 4EO8A 4P2SA 5HP1A 3FMWA 2DNRA 1ZPWX 2O01C 4FYVB 2RS8A 4QWDA 3ET6B 5GADI 1S1VB 4ZPTR 1SUQA 2FLPA 1M1GA 1RHKB 2HK2A 2KG1A 1NEEA 3ZZ0A 3V6HA 1FI4A 3A8EA 1HQEA 5CD4H 2OIHA 3C19A 1HR0J 3GV8B 2E1PA 4DPXA 3GCXP 2CFXA 1S9FA 3AT1B 1WHXA 2Z56B 4NLDA 3EYZA 2HVHA 2OEMA 2EG1A 5AXLA 1S0MA 3VCDA 1JLAB 2KJWA 2C2KB 4RW8A 2HQFA 4F0KA 2OFGX 3KLIA 3QMQA 2MXYA 2R7WA 2M2BA 2WHOA 1WC5A 1YHQS 5HN0A 2AGQA 2ZBRA 2P2CB 4PWDB 3BPSP 3MOZA 2D3OR 3DFEA 1R0AA 2O66A 4FP9A 3T1HF 4X4UA 3PW4A 1YDLA 2DH9A 3QQCD 3HFKA 5KFKA 2VDHA 2AEFA 2GVDB 2VC0A 3CDBA 3C6UA 1N56A 4OYOA 3BDEA 3K8VA 4PXDA 1QY7A 1UVIA 1CG2A 2ZUGA 1TELA 1YJUA 1F5CA 3EUNA 5THWA 1KQFB 1ZBTA 2W4PA 4F02A 4DI6A 1VYAA 2BJ1A 3A3NB 3HVTB 4ALZA 3EJMA 2GO8A 2B8QA 1U24A 4OI6A 4ZLPA 2QSFA 5J2QB 4RW9B 1TTHB 1XERA 3RU0A 3PZPA 2DO4A 5F8IA 2MY7A 3G8TA 3OTOF 3IC1A 3QLHB 2HHHF 1K44A 5KFJA 5J2MA 3DLBA 3PRBA 2UUWA 2PDAA 3H59A 4HH0A 3TOQA 1TL5A 4NLVA 2YNHA 2CQBA 4NL5A 3UNGC 1K1SA 4ANEA 3M9NB 1NSPA 1NCLA 4LF1A 1VRUA 4CH1A 1FTCA 2XMVA 1TK5A 1PO6A 2A2CA 1M0SA 3I32A 3PIOQ 3CC4S 2LEPA 1N6QB 1CEZA 4C98A 3MECA 2B7BB 2JRSA 3H2UB 2R7SA 2LU2A 2EXUA 3OD2A 4B9UA 1EARA 2CQ4A 2BX6A 3QWUA 3RZAA 3JB9k 3QRRA 2AJ2A 3MAHA 1N34J 1QTMA 1S7HA 2B9XA 2E7VA 3TZZA 2PSZA 1HWIA 1TL3A 2CDQA 2HNYB 4NI2B 1RE1B 1KS2A 4K4WA 3OLBA 2HBYB 3OL9A 1IBKF 1N8RT 3A3OB 1U1KA 3BKFA 4H4KA 3M8RA 3CD6S 5D15A 2ASJA 1GQEA 4YR3A 3OTCA 5BYQA 1XMOJ 4K4VA 2EKYA 3MAAB 3UO0A 2FUG9 2HS4A 1DARA 2DNKA 1XR6A 2Y8WA 3THVA 4J9SA 1NRKA 2WTFA 2RB7A 4OX9F 1KQGB 1JK9B 2Z2LA 3T1AA 2YWGA 3B8HA 3C3LA 1EHWA 3E3XA 4LF7J 2HNZA 4ES3A 3ILJA 2MKIA 2K7JA 1ZS6A 2ZHOA 2J9DE 5F3ZA 3CEDA 2ABYA 1J5EJ 2R2TA 4QJVA 5KT5A 1JXVA 4JI6J 1TVRA 4ID5A 2DHGA 3HMJG 4JI2F 2EC2A 2DGWA 5BR8J 4ZDNA 1TUGB 4K4XA 2VPZB 3JSMB 4DEZA 2EC0A 3HF5A 4HH1A 1YBAA 1Q16B 4DWIA 2MB0B 2UU9F 2MEWA 4OHYA 1VQ7S 2I1RA 4YOEA 4FXVA 4LF4J 2V63A 1IR0A 2YQ3A 1IQTA 2VQEF 1VQSA 1WOSA 5KFGA 2OPSA 2G2YA 2LLZA 4ZCLA 2R8HA 1JXLA 4OX7A 2VFTA 2OD6A 4FNIA 5L46A 3EVWA 1F60B 3IM8A 1Q8KA 1SJ4P 3EMTA 4CO3A 3I0RB 2IDEA 4B3RF 4OYAA 2LMIA 2ZBPA 4YHHJ 1CBKA 4LF5J 5T14A 3UVJA 3D6FB 4C97A 5K8PA 1UFKA 3NRBA 3DLHA 3KHRA 2DEIA 4A4JA 2YWWA 4DV6F 4KE5A 4DFJA 3TUJC 5AXMA 4MIAA 1TKZA 1U7LA 2K06A 5F8HA 4R8UA 4O3OA 3EE3A 1NB2A 3HHEA 3FCWA 4NLTA 3KUEA 4I7FB 2ASDA 4HT7A 2N3OA 4QCLA 2AMCB 1RT3B 1VQMS 2K3KA 1S59A 3E8OA 4P7VA 3VAJA 5L1JA 4HI1A 4USVA 4DS4A 4DR1F 2C3OA 4PXBA 1HNWF 1IM6A 4ATNA 3NGTA 2CPZA 4JI5J 1SC3B 1RISA 2ZHAA 4PWDA 2L9WA 4O3QA 1RBAA 1FDDA 2DNNA 3F56A 3GONA 2K1RB 5DZ7A 4DCPB 3KJVB 3N6LA 1OMSA 3M6XA 2I9SA 2BEFA 3AJ2A 4I67A 2XGQA 4R0JA 3O44A 2H65B 4G65A 4PCQA 1NO8A 3I5AA 2MQ8A 1SV5B 2J7KA 4IOCQ 4WFXA 3Q86A 4MK7A 3CCJS 2B51A 3KOAA 2KG0A 2GVDA 1SL1A 4IOAQ 1VMBA 2FTRA 2AZ3A 2HVZA 3OV7A 2HFVA 3OR2B 2HBRB 4FDFA 3BYPA 1F2HA 1DRZA 4F4KA 5M2RA 4USTA 1X7VA 1WD6A 4DV2J 1ZAVA 3WX8A 2IAJB 2NZ4A 1VOMA 1U02A 3PR4A 3CC2S 3MEEA 3T1YF 3EWGA 3NY0A 4DJBA 3HI9A 2G9OA 3D1HA 2HW3A 3CIZA 1SI9A 3IFEA 2SXLA 4ZHRB 2A2DA 2PT0A 4KGXB 1KSPA 3N0VA 2MKJA 5A2QU 1XBWA 4QWEA 4NA3A 3QZ7A 4M94A 2QEXS 5DGBA 2HHXA 3WX4A 1WC0A 5J2QA 3CIMA 4ZP6A 5IM0B 4MYUA 4RW9A 3DDIA 3BSNA 4X4TA 3IBWA 4IRKA 1S5ZA 4DV1F 1NKCA 1H3DA 3AD8C 2W7AA 4DX7A 3QLHA 2BE7D 1RKJA 1S1WA 5A8WB 4ELVA 3ZZOA 4K59A 2KZZA 1RABB 2OI2A 3FQKA 3MM8A 3PO5A 4QPTA 2VHGA 5D0EA 5HLFB 4JI0F 4FBTA 3B6BA 3QFWA 1NJYA 2EFQA 2UUCJ 2CUYA 3ZTQA 2WW8A 2CG4A 2RSQA 1Y10A 1XK8A 1KEKA 1S1UB 3JSRA 3IWXA 4QU7A 3I82A 4AL6A 4RBUA 3NNHA 3Q8UA 4L6V3 2XM3A 3G71S 3R2DJ 2J6UA 4L74A 2RDDA 2UP1A 5FLXU 3RBXA 3ZZRA 1C0TB 4CLFA 4JI7F 3BSOA 3ZTPA 1X4AA 2BW7A 2ASYA 2MSSA 1YRUA 1S7IA 5F3TA 5ITHA 2J7WA 4H4MB 1REVA 2R2UA 4KPCA 2ZD1B 1SQGA 1VQ4S 4DSEA 3OSPA 4PQUB 2HNYA 4NI2A 2X1GA 3FUYA 1YIJS 1RTIB 2DY9A 3CDWA 2PMZD 2ZM6F 1WNEA 3A13A 5KFIA 1X4DA 3DHWC 1TV6A 2V2QA 3AJDA 3MMBB 4LSZB 3DOKA 2M52A 1WC6A 3CMAS 3S7RA 1WOPA 3DU6A 1ICEB 4X66F 3KHGA 4IRCA 2DHXA 3F0NA 3MCNA 3B4MA 3FVYA 4J9RA 4RX6A 4C8OA 3RUBL 1ULRA 4ZPVR 1GXTA 4Y6IA 4I6AA 2RAQA 2N7YA 5C5JA 4JV1A 4QR2A 1YJ7A 3I87A 1RQ0A 1O6XA 2J9CA 2RQCA 2MQOA 1FXDA 1N36F 1RAAB 2GNKA 2AEJA 3MMAA 4OJ1A 1WG5A 4FYWB 3C14A 2KXNB 1J5OB 1G4CA 4GKKJ 4N7TA 3JSMA 4K4YA 1MW7A 4RBTA 4DUZJ 3Q8YA 3A12A 5JVHQ 3DM2B 1GK8A 3SFGA 2FIUA 2E7XA 5I3UB 2ZFHA 1M5SA 4N8NA 4J37A 4PG8A 4IG0B 3W3SA 2BZ2A 2NUUG 2B9EA 4KY3A 2RUSA 3NL0A 2V8VA 1T95A 4WFAQ 5HI7A 2XULA 5IV3A 1JLBB 4G3IA 4AE5A 1FVSA 1JB0C 3SSQA 1HBOA 1RWPB 7FD1A 3MM5B 3OFEA 2ZKTA 4V19J 1D3WA 3NNCA 1UTAA 3UN5A 2JWNA 2K8GA 2J5AA 2QMWA 5HVHA 1U49A 1KD1T 3JXOA 4XAKA 2YKMB 2DGXA 2W2PP 3VZHA 2NLWA 2KHCA 5AJ3J 3WC0A 3PX6A 3R7SB 1KDNA 2RRNA 4I2PA 4GVBB 5KFTA 4XO0A 2RHSB 2VFRA 2OP5A 2ZEJA 4DQSA 4U8YA 3TP2A 2MZJA 3KDNA 3KK3B 2KT5A 1TAQA 5D6GA 1BC6A 3CCUS 3OL6A 4PUOA 3EPIA 2A6MA 3PKMA 3OTEA 3N9UC 4I7FA 3M32A 2VF3A 4AXJA 5I4MA 3EGZA 1S4FA 5K9FA 1RT3A 1LW2B 1NK0A 1MN7A 3LGNA 3PACA 2XZTB 1SJ3P 1MG7A 3ILLA 1H6KX 2VG5A 4JI8J 3RTVA 2A18A 1RWXB 4KAIA 1UAWA 3O1LA 2VONA 4N77A 4AL5A 1ITPA 2XLKA 2CJXB 2HWTA 1RCXB 4UF4A 4DF4A 4J7CA 2DIUA 3KJVA 4B3SJ 2HFNA 3PXGa 3ZNUA 1WSRA 1Y11A 4L73A 3BGLA 3MAQA 3QIPA 3FJ2A 2N7CA 2W2MP 3AH6A 1SV5A 4L75A 2WB1D 4DUYF 2EEYA 4DL7A 2XMMA 3NXZA 3B54A 5E3QA 1N34F 4B3MJ 3NBPB 3U02A 3NMAA 1FDAA 3FFIB 4O23A 2UUAJ 2IHR1 3OR2A 4ZVTB 2YKPA 2B6AB 5A0YB 5C2GA 4MKBA 2WONA 4ES2A 2AX0A 3NGRA 4ZVUB 3QBCA 3O5TB 1N32J 1XNRJ 1Z2ZA 3OTBA 3G6YA 4A8KA 2H51B 1XN9A 1CJVB 3QGIA 4F4XA 4OZ5A 1CPZA 2B5JB 3CWJA 2XMWA 3VGTA 1FRLA 1TFYA 1WSVA 3BF4A 1H0HB 1VQPS 2HAFA 2GZOA 4ZHRA 3TEGA 5CHCB 1GH8A 5AXNA 1XJWB 2CJKA 5KFHA 4LF2A 4W98A 1V3ZA 1EP4B 2DT9A 1OJ4A 5HATA 4Q2LA 4ZS6A 3IAM9 2IY5B 1Y00A 4Z7YA 4EO6A 3BO4A 3QATA 2GIRA 3SMZA 2NXEA 3KLEB 2E5GA 1J5EF 1GNKA 4RNHA 2NYHA 4DBQA 4Q8EA 4L72B 2EWHA 1N5QA 2C2NA 3V81B 2BE2B 5HLFA 2CQ3A 5H9EK 2W1BA 2X51A 5ETMA 5F8MA 1SJFA 1JLFB 2XC9A 1IN0A 2D41A 5F9LA 4DPWA 5IWAJ 4LFBF 1H72C 1AROP 3R5AA 1S1UA 4KV8B 4GVLA 5B0BA 3DXSX 3W8GA 2EVZA 3W2VB 1IKXB 3CCMS 4WTYA 3IGNA 3R5BA 4X4NA 3D3BJ 3I6PA 1S48A 4DG1A 1S6OA 2P9EA 3TR5A 4A8WA 1XNQJ 2ZE2B 4LQ3A 2DGUA 3F44A 3U1NA 1RT6B 4DR6J 2ZD1A 3RB0A 4PQUA 5K14B 4QZVB 4DPYA 2CWXA 3DRXA 4MH8A 3W5ZA 5LJ3Y 4DSJA 4B3TJ 1RTIA 4YHHF 2MLZA 3MOJB 3ADAC 3K7RA 1A7GE 4NZ7A 2RRAA 3M8SA 4OI3A 3MXHP 1WACA 2DR8A 2PGCA 5E3AA 4OV1A 1MLAA 1CS4B 5AE3A 1DBDA 3DI6A 2BACA 3RR7A 5KOWA 1X4GA 1CQNA 1P27B 5IT9Y 1G7CB 4YN3B 2UVRA 4ED6A 1FJ7A 4X64F 3GIMA 2XY7A 4X4RA 2QIFA 3BGUA 2IA6A 1PBAA 1X0FA 3ZTOA 3U1LA 5MLCV 1WTBA 4ECUA 3AQPA 1EB0A 2V68A 3IM9A 3M1VB 5HBMA 1G2EA 3FCVA 3SSRA 1AW0A 1ACMB 1QM9A 2DNYA 2H5IB 1VDHA 3D28A 1U0HB 2HFSA 2OAUA 2ZBIA 1DZ5A 2LXUA 4JI5F 3FQLA 2IBKA 1VBXA 1IQZA 2XY6A 5I3UA 1QSYA 4OZNA 4RNOA 4F25A 5CA5A 4IG0A 4WFZA 4KT0C 4HI2A 4C2MA 1LKZA 4X4QA 3P45B 3OVBA 5M2UA 3RBZA 3PEHA 1B7YB 3BGFA 2IM2A 1IWAA 5HANA 3J7YI 3TVKA 3CCES 3K57A 2ZH5A 3MM5A 2GHVC 2OHDA 5LJ5Y 3G82B 1KQSR 2CWKA 4DV2F 4NXMJ 2UV8A 3ETMA 1RADB 2FPHX 3LOUA 5G4DA 3PVXA 1QVGR 1CJUB 1XIQA 4LSLB 5EHHA 4OZLA 4OYZA 4F0MA 4GKJJ 4IFYB 2VKZG 3J80U 1M5OC 1D8YA 3NMRA 4C0BA 2IM3A 1E6VB 1WEZA 2H9ZA 1RHJB 5K8NA 2CPJA 2LXIA 3DKDA 1YJNS 1S0NA 3NGSA 4IOBA 2V2VA 2AZ1A 2E5JA 5LT5A 1RWOB 2EFPA 3FSYA 4H4KC 3K5LA 3HHLD 2H48B 1HHSA 1MNEA 3G87A 3KNAA 3CJSA 1YRXA 4I4BA 1DHMA 2FHOB 2ILZA 4M5IA 4WCEQ 1U1OA 3GQCA 2ZDPA 4DL2A 3UN3A 5IC6B 2RMLA 4K4UA 1WELA 4PWUA 1SL0A 3HD2A 1ZH5A 1OS5A 1Q0NA 1Y5LB 1N5YB 4CNYA 2F1FA 4F4ZA 3I0SB 1SKRA 4IG3B 1VI7A 1X5TA 1NSAA 1TKDA 1FD8A 2IPOB 2HZVA 1LNQA 2JOQA 4JI4F 3LA0A 2ZKUA 1IR1A 5KFLA 1E6YB 2FD2A 3MM6B 1YI2S 4FVCA 1P9QC 1IKVB 3QGPA 4AXIA 3GTYX 4I6YA 2JC1A 5BJRA 3TQEA 1JXEA 3ZFVA 1UPMB 3EM1A 3H90A 3PYGA 1Z4UA 1YRTA 1LXJA 2ACMA 3PO4A 2BKPA 1XWLA 3Q23A 1TFWA 1T9UA 4ILLA 2CNLB 2F8EX 3AA9A 2B5JA 3NGKA 2Q3PA 2I2YA 3C6TA 1LWFA 1N5TA 1NPKA 1WF0A 1KNZA 4DV7J 1S1TB 4QU6A 1MU2B 1FJGJ 4P2FA 3HK2A 4EGLA 3QSYB 5D4OA 3MPYA 3N79A 1FF2A 4QW8A 3BJYA 4PXEA 1SQFA 3PYFA 5FD1A 1TAUA 4AL7A 4ED8A 2DGVA 1BE4A 2ZVSA 4KH1B 3KLEA 4RW6B 4HKQA 3DRRB 1RLDA 7FDRA 5DETA 4RKUC 4JYAJ 3IP0A 5ETPA 2DR6A 4LSNB 4LF8F 3GJTB 1NK5A 3V81A 3AD7C 2KDOA 4F4AA 1U2CA 3FKBA 2BJDA 2CJQA 1WKKA 1I5OB 1RT5B 2ATCB 2Y9HA 1FHTA 1ZZNA 1AUSL 2GV1A 3BO3A 3BR9A 3R8YA 4CH7A 3DYAA 4YFUA 1UEVA 2XYHB 3GJRB 2XY5A 1N0VC 1IKXA 3SDEB 3FNNA 2VFUA 2VD3A 5D3GB 1D9AA 3KG4A 4DUTA 3P49B 1CULB 1V5IB 4DQPA 4Q44A 3ENWA 4I69A 1HD1A 2LFVA 3VV2B 2NXCA 4ED7A 2ZE2A 4Y3CA 2HS3A 3C2PA 3CCWA 4ZCIA 1KHWA 5K14A 3H42A 4ZIWA 2WZ1A 2HHSA 2DNZA 1SC4B 2D74B 2J76E 2C3UA 3NEKA 4M8LA 1LK5A 3MEGA 3DLKB 2JVOA 2Z30B 3CXCR 1C4CA 4LUBA 4B08A 2IRYA 2W4CA 2IJRA 2ACYA 1HNZJ 3AODA 3H2VE 3ISND 4USIA 2ZOFA 4USHA 4B3OA 2MHEA 2HIQA 1X31C 2A10A 3E01B 2NS1B 2HGLA 2ZH9A 5H9FK 1UZHA 4DHVA 2V2KA 2XZDB 2LDIA 4CWBA 3KK2B 1D9FA 4QWCA 1BQMB 2AJ0A 4ZVEA 5CCMA 3GJQB 1TMJA 5B08A 3EX7B 3M1VA 2M9KA 3VAIA 1GTEA 5L39A 5KFCA 1LWXA 4JI8F 1R7IA 4CH0S 5DG8A 4C3MA 2J9DA 3N5FA 5LMNJ 5KG0A 4ED2A 2CJYB 5DRKA 5DDQC 4N76A 1U25A 2WVBA 4ED1A 1GX6A 4WIQA 3OHAA 1XC9A 5MAOA 3N5BA 3UNYA 3R6LB 2VFSA 3E2EA 2RILA 4TKTA 4Y34A 3W5XA 1N52B 4NA1A 3VQSA 5A8KB 5BYRA 1KQKA 2DIVA 3PEJA 1KP6A 4KHMA 4WIIA 2HYIB 4R5PA 1H7XA 3TJ9A 4DFKA 1R31A 1PJ7A 2K3IA 1ZA2B 4DFMA 1U2RA 1N0UA 3KTQA 1N32F 4I1TA 2Y0SD 2QJ3A 3W62A 5J1NA 1U6FA 3D54A 4QYZK 3MEDB 1Q95G 1L3VA 4ZVGA 3MPUB 2YKOA 4DV0J 3BN4A 1OY9A 3HVWA 2KTQA 2ASLA 3QYYA 2HSEB 1FFSB 3W9HA 1KVKA 4F3OA 3P96A 4LF6F 4LFCF 1HW9A 1LXNA 1LWCB 5LXRA 1S6PB 1L5UA 1N5VA 3MFIA 3IO1A 3S8SA 3KUGA 3M2VA 3D2WA 2MZQA 4UTGA 2QRRA 2BW2A 3LAKA 3SYZA 2O5DA 3BN7A 4NZ0A 2RH3A 2EFVA 2WBRA 3BPDA 1SVDA 1U0SA 4DL0C 1DTTB 1CC7A 5IWAF 1Q8LA 2D3UA 3EICA 2XEXA 3PX0A 1SL2A 5A6PA 5HMYA 2KT3A 4DDFA 2VU5A 3MI7X 1HWKA 2X3GA 3DRSA 2VASA 3A8JA 1N5YA 4D3GA 5ETLA 1AZSB 3R3TA 3DMJA 1X60A 4PG7A 5HO4A 3I0SA 1SJQA 5A6WA 2FLNA 4C11A 4F2RA 2GFFA 4QW9A 1SB6A 1E6YA 4JI1J 2E5IA 2L9DA 3MM6A 1FWPA 1IKVA 1HNXF 1NJZA 4XPCA 3ZZZA 3QJPA 1YJWS 1SH3A 2FC9A 5EGYA 2ZOMA 5DDPC 3L09A 3DLEB 1YX2A 2PA3A 1RWUA 1UVNA 2JNJA 3KK1B 3WDOA 4ZP9A 3GP9A 1V9OA 1KRPA 3KLFA 1NHKL 4F0HA 4DR2F 1F2GA 4TQSA 3I9ZA 2NREA 3H40A 1MU2A 4IR9A 2CAJA 2XYGB 2IJNA 2NR0A 2HAIA 3K58A 2C2RA 4OQJA 2V94A 4O3NA 3SCKE 2UUBF 1XMQF 4F26A 1G6BA 4AD6A 1T02A 5KFVA 4LR7A 5E5NA 3PKYA 4OHWA 1S77D 2LQ8A 1SIZA 2E29A 2M5YA 4LSNA 1RXOB 2RNEA 3WHIA 4DV5J 1IM4A 1MSWD 2WOMA 5K5MA 5IV4A 4X62J 3J7YU 3E51A 2A3JA 2EFOA 1S0VA 2AJQA 5L8RC 1RAOA 3R5DA 1SKSA 3NCRA 2OO4A 4CM2A 5AT1B 3P5TL 3HJVA 2FJBB 1U4BA 2DCUB 3NS5A 4EI2A 2OLWA 1BGXT 1RJJA 2BOAA 3CO9A 5B0GA 5F8LA 3K5MA 1NDKA 2BE9B 6FDRA 3L3CA 1TU0B 5CH7B 5JMNA 3TA2A 3GFXA 2W25A 1CULA 1U45A 1KVIA 2KO1A 2L9NA 4PYDA 2HHTA 1NUEA 4ECXA 1YGYA 1P9YA 1YBTA 5L9XA 2VDIA 1P8GA 4F3MA 4QYRA 3G86A 1WTFA 4NXMF 2DR7A 1Q8BA 3DLKA 4PXCA 2PC6A 4DL5A 1PGZA 1Y0HA 2VG7B 5DGAA 2QSWA 1T05B 2CQPA 2XS7A 1P1LA 1O0PA 4USMA 2OSQA 1C1CA 5E3CA 3TZWA 2ZH2A 4NE9C 5KFSA 2BQ3A 2GAHC 3E01A 4IH5A 2HRUA 1FK9A 4CLKA 4BS2A 2L08A 4NYOA 1FRHA 1MWZA 4U6PA 4N47A 2LQ5A 3HKZD 3MR2A 1S57A 4KC5A 4KPYA 2EK1A 3CJ3A 2X1AA 2C42A 3GPAA 2VOOA 1CJKA 3B4DA 1MROA 2G0JA 4DR3J 2QG9B 1WEXA 3FBFA 4ZJOA 4CLLA 4OHZA 3POTB 1C1BB 2FDNA 5KFBA 2F40A 2IMWP 1OWXA 5HP1B 2CPXA 2ZNYA 2LQJA 4CO2A 4QQBA 2IM0A 2UXDJ 3HSDA 3HKWA 5A8KA 2NXNA 3GMGA 4CIOA 2KT2A 4CLSA 1MMNA 2FHJD 2QLFB 1TP7A 4RO0A 2FGCA 2E5LJ 3PW0A 4BBYA 2ZH7A 3UE2A 3LANA 2RDJA 4PRFA 2OD4A 5CYJA 4FPRA 4NLGA 4RW8B 2A6OA 1Y4ZB 1JLQB 4Q0BB 3L4BC 4DPTA 3KLIB 2CJBA 2PIIA 3N01A 4F4YA 1VQ9S 4N5SA 4A8QA 3MEKA 3MEDA 1RT1A 4P52A 4NEZA 1PILA 4PQAA 1VISA 3LGMA 3RG6A 4GRSA 2WB4A 3A1YG 4DV7F 2Y3YA 3GE9A 4UY85 3NCPA 4C8NA 4JI3J 2DVIA 4FF2A 3C6UB 5M2PA 1LWCA 4ZJQA 5HQMA 5ETQA 4J9OA 3LPEA 5IOLA 3UQSA 3GFZA 2YQ0A 1VGYA 4Y00A 4WU3A 2BV3A 1FFGB 3VF0B 4JYAF 3J81Y 1BD6A 3Q8RB 2DNLA 4RR5A 3KNGA 1C0UB 5L1IA 3K5PA 4USJC 2AT1B 1DTTA 8RUCA 1OPZA 2GQ2A 4ZN1A 1GX5A 3JAMY 1YITS 3B78A 5K8MA 1HNIB 2I5JA 1K9MT 1VQ8S 4J90A 4C8YA 4TXSA 4DR5F 1JQGA 2HQCA 4ZKAA 2DRBA 5ETSA 2GQCA 1UFLA 5B7WA 3CUNA 3HHLA 5KT4A 3LWLA 4GMKA 4KTQA 3CDEA 1PYTA 2J6TA 2YNHB 3CJTA 3Q89A 2XS2A 3LP2A 1JLGA 4U8VA 4U67Q 2D69A 3PJXA 3PHTA 3X1LB 5CD4A 2CZVC 2C2DA 3D68A 1VRUB 3DLEA 1JJ4A 3NWGA 3GZ7A 3HXMA 3KYLA 3KK1A 4X4OA 4LFAF 3PW7A 2CG8A 3VGVA 1S79A 4LRCA 2BMBA 4M95A 4HVZA 2ZJQQ 5JJBA 1HNZF 3BS9A 2UVUA 5DJBA 4JB8B 3NGUA 4OLPA 4DPUA 5KG2A 2HZAA 1NK6A 4R0EA 3CJ8A 1JX4A 4J9VA 1MMDA 4U95A 5HL7Q 2P9CA 2HZCA 2JLEA 4M5KA 6FD1A 3TJ8A 2LYVA 3THPA 3H5YA 3BZQA 2DKOB 4RL1A 2W9AA 1M5PC 4DCJB 4WZQA 3O3LA 3X3UA 1XEZA 3I55S 2ATLA 4FF3A 1N33J 1S72S 3SSSA 2YXLA 3NS6A 2R7TA 2DBBA 1WDDA 3LWMA 1QLNA 3S6EA 4D3HA 3CJ5A 1QAIA 2GC8A 5IT4A 4Q43A 1D9DA 4WP8A 2QX0A 3S1TA 3ZZUA 4MKYA 3T6BA 5J2PB 1ZAWA 2HNZB 1B70B 3TEHB 3S01A 1RHMB 4MTPA 2LDYA 4ILMA 3NOCA 1IUJA 3ZZYA 1I1GA 1RU2A 2JC0A 4G6VB 1DAXA 4ID5B 3AFGA 3FMBA 1S1XA 3SFUA 3G6ES 4CLZA 4TY9A 3UW1A 4RNNA 2R7RA 4YY3F 4NXNJ 1B3TA 4DZ6A 2UXCJ 3GFYA 1ZM3A 4M5GA 3C46A 3CPWR 2KYXA 4NRUA 2CDRB 2B43A 4DR4J 2W9CB 3KLGB 2W2OP 2ZWPA 4DV0F 3EXCX 2VG7A 1YQHA 2M8DB 1N5SA 1RBOB 4B9LA 3OXLA 1WG1A 2OPSB 3FRYA 3M2RB 3SCJE 2XBPA 2J0WA 3WZ0A 3GYXB 3FDSA 1Q79A 4CT9A 5J1PA 3T5JA 4ZCKA 3OUYA 1Q7YT 4ZVSB 1TQLA 3UPFA 2J9EA 2W24A 2DPIA 4ZVFA 1BXNA 4C8LA 3J7Z5 3NWRA 1Q82T 3MCOA 1LWEB 3M8PA 1T0TV 2W9BA 5F8JA 2IYGA 4OMFG 3K0JA 3O2IA 2RVJA 5L1KA 2V5HG 3POTA 3T3FA 4ICLB 1C1BA 1X5PA 1VFJA 2F8HA 2YX4A 4NLRA 1FXLA 3UN2A 2KHDA 2HS0A 5E7OB 2E5HA 1TKZB 3CNQP 3UD4P 4R8UB 2YX7A 3U7JA 1CC8A 4QWBA 2VQFF 1NAQA 1T9WA 2KFYA 2Z4PA 3TAMB 4E2FB 2IC3B 1JLCA 3L95X 2H5EA 2LA6A 5F41A 2BKNA 4K0KJ 3LALA 1VBKA 1JLQA 4Q0BA 2C2ZB 1BLUA 3M7VA 3ITHA 1OYDA 4LRBA 3KG0A 1AUDA 2JEGA 1EKRA 3GG1A 2ADBA 2HHQA 2X1BA 2E66A 4GO5X 4F36A 2R8IA 3M8YA 2NSBA 1EQ0A 4RPFA 3AHPA 1X9WA 1WC4A 1G3OA 1BHNA 1RYSA 1QSLA 4C8MA 3ULHA 4ED5A 3LPYA 4X2BA 4J9MA 1FO1A 2J0XA 3JQMA 4NCGB 1FDNA 1F6TA 4LIWA 4CO4A 1K8AT 3QNWB 1K0VA 1HARA 2F7VA 5C25B 3KMSA 4DV3J 4KJIA 1IVZA 2LEBA 4CLPA 3MEEB 1HWUA 2DISA 4X62F 1C0UA 3HSJA 3R1HA 2XHCA 1WKJA 2FVSA 4DQQA 4K4ZA 2KRBA 3FK4A 2CXEA 4MIWA 2YPZA 1JNRB 1LQ9A 1FRKA 4OLOA 2EPIA 2CNNB 4TNOA 4K4TA 1HNIA 2PEBA 1URNA 3T19A 1YBUA 1U1QA 4IDKB 5LSLA 4O3RA 2OKQA 1QJHA 4CO0A 3WC2A 1O8BA 4DN9A 1F3FA 1S1WB 4DS5A 2F4VJ 3MM8B 1UETA 4DZDA 2MQMA 4V19X 3GSDA 5GMKa 4LF9F 3BREA 3O8WA 4MYTA 4Y2IA 5IC4B 4LBHA 1FFWB 2IYIA 2WVDA 2W7OA 3TW0A 1HBMB 2CQ1A 2PD1A 1VK8A 3BH6B 4IRDA 4DX5A 3EDRB 2V4JA 3QT7A 3IS9B 4KKOA 3MM7B 1JKHA 1HA1A 3LO3A 2AJ1A 2I38A 1V3RA 1NHVA 1WKLA 3KXDA 4PPDA 1VC6A 3ETOA 2HKEA 4HACB 3HP6A 3FSIA 4IO9Q 3AB4B 4I0WA 2XI3A 2PMHA 1IBLJ 1H73A 1Q4RA 4LRFA 2DGOA 1JNZB 1NB7A 3H2LA 4RWWA 4ZVHA 1LOUA 1BMQB 2OPQB 5ETNA 2FZKB 1NKBA 4C7QA 4KSEB 3BGRB 1REVB 1S6UA 1VLOA 3OL7A 5FDLA 2M7SA 1UPPA 1HPZA 4OV6A 2Z58B 3OFFA 4DOZA 2ZDOA 3V6JA 5D77A 1TV6B 4TVAB 3SEOA 5LXYA 1IKYB 2Z0GA 4P75A 3M9MB 3DOKB 4GO7X 1VK3A 1X8DA 4F4WA 3K17A 4URGA 2OUGA 2MJNA 1IJFB 1RAGB 4YDDB 1VHFA 1RWMB 5F8NA 1RWKB 2KFZA 2UXDF 4CZCA 3GYNA 2V69A 2HNDA 5J2PA 4RLEA 2M88A 4ENOA 1RCOB 2R42A 1FRXA 1NPPA 2Q66A 2E5LF 3PFOA 1PBUA 4BWMA 1HI8A 2I6WA 4ZP8A 2DNHA 3ENAA 3MMAB 2FHMA 2V9WA 1EETB 3C14B 2QA4G 1Q78A 3KG1A 4AYBD 1VBYA 3OR1B 4OZJA 3T1HJ 3OTDA 2MKSA 3R97A 4IQMA 3T5HA 2B4OA 2CPYA 4O4GB 4X65J 1GAOA 2BXJA 3PG9A 2W9CA 3KLGA 4OZ3A 2PEHA 4P74A 4CCHA 1EZZB 4K4SA 2Z2MA 3AA8A 1R27B 1VCTA 3R1LA 5I3QA 4YR0A 3M2RA 3TYTA 1C2PA 2KM8B 3TUIC 4ED0A 2MJUA 2GCFA 2R7OA 3QPIA 1HBOB 1IBMF 1AB8A 2B0GA 3T41A 1HFEL 4DF8A 1DLOA 4DSFA 2R3VA 3T9NA 1W2IA 4DSIA 1LWEA 2AHOB 2I8EA 1H98A 2MKKA 2HHVA 1NK4A 1A9NB 3CO0P 2UXBF 3Q22A 1C4AA 1W25A 4ICLA 2XHWA 4I2PB 4FYXB 1GMVA 3OTOJ 3HVAA 2WSEC 3JQJA 3CCSS 2H54B 2R8GA 4Y2CA 3D6HB 1H2VZ 2HHPA 3MDFA 1DQ8A 2KXHA 5CAAA 1RWWB 4PUOB 1YJTA 4O3SA 2ZZNA 1RT4B 2CPHA 3W2WA 3M32B 3TAMA 3I5CA 4P2MA 3IA0A 2IC3A 4NOHA 1YVFA 2DEJA 2OTJS 2VG5B 3FEYB 3TI0A 5KFXA 2YNFB 2PI4A 3NKYA 4DV4F 2YKNA 4RBVA 3GWCA 4WF9Q 3US5A 2FHJA 2QGFB 2Z8QA 3VAHA 1WOOA 1OSDA 2YQ1A 3QIPB 2UZAA 5KFUA 1U1RA 1S99A 3FZ2A 2GO9A 4NCAA 1KWMA 1U09A 1H7WA 1TKTA 1SKWA 3ILIA 2DD8S 4QIWD 1F9FA 1NMEB 3M2UA 3KWMA 1IBKJ 4UY8T 2CA9A 3W9JA 2WONB 4NCGA 4F67A 2HWIA 1VQKS 2DNOA 4K50A 3RRGA 2J0SD 3PNIA 2DHHA 5C25A 2D9PA 4ETXA 4NCBA 2NXUA 3D67A 5IZHA 1HD0A 2BBEA 2CQ0A 2LEAA 3TO8A 1QAJA 2CPFA 3BQ2A 4ECRA 2W8KA 3L7PA 2DHAA 4BC9A 3AB2B 2VBZA 2XNQA 1YWXA 2DB1A 2IFXA 1TUVA 3RW7A 3JYTB 1TL4A 1NSKL 3GG0A 3GV5B 1VIOA 4IDKA 3VZIA 5HMXA 1L3SA 2B4VA 1UP1A 4JI2J 3H7HB 3RJMB 1S9EB 3BO2A 3W9IA 2MHNA 1VQNS 5T7LA 1F5BA 4UOHA 4B9NA 1U8WA 3TARA 2MY8A 1U47A 5HQ8A 1AA1B 5U47A 1T11A 1HBMA 1H2UX 3QSIA 4OZ2A 2OPPA 3IS9A 3I5BA 2VQEJ 3MM7A 2HEKA 2JL9A 3QJLA 1R8PA 3CJRA 2VC1A 2MMYA 2DH8A 2B4PA 4HACA 4OHVA 4ID8A 5I42B 4MKAA 4Y28C 1NZ8A 2KFNA 2B3TB 1U6BA 4UUWA 2YNIA 1P6TA 5CYQB 3HCXA 2FJVA 2VG6A 3D4JA 1H38A 1RSCA 4DG1B 4B3RJ 2QN6B 2YH0A 2OJ3A 1RWNB 2OPQA 4OIXA 1FWKA 1BY9A 2QZ8A 5KT6A 3V5RA 2YKAA 3RR8A 4U7CA 3BGRA 1R8BA 3GYGA 2RF2A 1FX2A 1Y5IB 4TYBA 1N88A 3H20A 4DMZA 5IT9U 2B9WA 4KGZB 4ZJLA 4NMXA 5HSPA 1JJ2R 4DSKA 3AOBA 1CSJA 2VH7A 4DV6J 2FQQB 1IR2A 4OYXA 5F8GA 2CQIA 3N6MA 2QL7B 3I56S 1IKYA 3MZIA 4CLWA 3HFVA 1CLFA 1Q1KA 3WIVA 2HRTA 3CJ4A 9RUBA 2L48A 3ILOA 2OEKA 2MGZB 3LAMA 3A8KA 2FJEB 3LUYA 3KJFB 1U1MA 2MPUA 1J27A 3DI6B 2WRMA 4ZP7A 1AFIA 2FGOA 5FJ4A 1ZETA 2CQGA 3TAPA 2ERRA 3QJJA 3BB5A 3UCUP 1HR0F 4DR1J 3D7SB 1HNWJ 2CJAA 1K73T 5KFOA 5HBMB 3KJNB 2V67A 1EETA 4K0KF 4EEYA 3IG1A 1Z1ZA 3LP0A 3OR1A 1S6QA 3MPDA 2YX1A 3TVZA 4F3QA 3RGIA 3PDNA 4O4GA 1BQNA 2C1EB 2LU1A 2WAQD 4I6WA 2E9TA 2FY1A 2RE1A 3HHLC 5B09A 4LQ9A 2XSFA 2Y1IA 5KFZA 4O3PA 4KHRA 4KGKA 4I2QA 3VAFA 3C16A 3W66A 4YQWA 4E98A 3D0HE 3T1YJ 2OPRA 2VBWA 3M8ZA 4JOUA 1HL6A 4ZK7M 3CCRS 2FLLA 1LW0A 3OVSA 4DV3F 5E3PA 3MUTP 2HMIB 2DITA 3D6TB 1ZYQA 2QLJB 4RW4A 1QDUB 3NGDA 5KG6A 1APSA 2L3MA 3UWTA 3J7ZT 1VQ5S 3H98A 3FBCA 2JZ5A 2U2FA 1UZDA 1RAFB 1NJWA 1ZZFA 2JLGA 4ZLJA 5CCLA 2MTLA 2CZ4A 4NX9A 5KT2A 1ROFA 2V8DA 1SJ1A 2FJXA 3I4HX 4JI0J 1RK8A 3PRDA 4ECZA 1RT4A 4LVOP 4YB5A 1SQEA 3L7OA 1WHWA 4LR9A 4IR1A 1HKAA 1KR4A 2YWHA 1VR6A 1UJ6A 2POKA 5AE1A 1RBLA 2YNFA 2JEIA 4QWAA 2IVFB 4A8OA 2V4QA 3ELHA 3IR5B 4L3NA 4G1IA 4NLPA 4RU9A 2HFOA 3CJ2A 4TU9A 4UZBA 3JS9A 4JI7J 4KBIA 4K2XA 3H0PA 2PFFB 4M5HA 3CB4A 2Z57B 4U96A 2KXFA 2ZJRQ 2GA7A 1TMMA 1B0PA 2E9RX 2BANB 4DX8H 2HBQB 3CTRA 2QA2A 5LMUJ 1SIWB 1FKOB 3TWZA 2ZM6J 3GIKA 3MCMA 4F04B 2DXFA 3FGVA 4ECVA 5DLFA 2BJ7A 2MDAA 4KHPJ 2QFIA 3MR3A 4DQRA 3BYRA 1KLMA 2G13A 3DOMA 2GJ2A 2HFUA 2AQ4A 2UV8G 3H4BA 3ZO7A 4X66J 1TK0A 2ILYA 4WK1A 3C6TB 1LWFB 2LCWA 4DL6A 2HQDA 1XMOF 5JVGQ 1AYEA 3GV7B 1FEEA 1WDTA 2ROEA 1UMJA 4C3KA 3JYTA 3CGIA 2DR9A 3H25A 1LEOA 4PG4A 1N36J 1NLKL 4LF7F 5DQHA 3KMQA 3J7A1 4Z7CA 1FRJA 2XI2A 1WHVA 1PG5B 3VAGA 1S9EA 2ZUAA 1IBCB 1K1QA 1YJVA 4QYZJ 3TRGA 3VGUA 4JI6F 1QE1B 3GR0A 4MK8A 4UW2A 1OSCA 3M9OB 2KB2A 3DDKA 2LQ9A 4LMZA 2AEMA 3ISNC 5BR8F 4ERDA 4QOTA 3AXMA 1HQ2A 3BH7B 4A46A 2H3EB 4OZ1A 4X65F 3DYAB 4Z2XA 4NZ6A 3CVKA 4RW7A 2VFVA 4XTTA 3SCIE 1NK9A 5I42A 4LF4F 1GT8A 2ZH8A 2NPIA 1YJ9S 3H8YA 5KFEA 5CYQA 4XDDA 1F9EB 2XWXA 3KLHA 2AD9A 1VRQC 4WFYA 1S76D 1A6LA 3R7BB 3H4DA 3W61A 1RP5A 2FLOA 2HPUA 1I3OB 1RUSA 3HSGA 4M5MA 2J8SA 2JSXA 2N4DA 4KGVB 4LF5F 3HO1A 1NNDA 2GX8A 1HLWA 4NMLA 1FEHA 4O0NA 3MEGB 2HHWA 2DHSA 3PTWA 1RA7A 5I3PA 3HZEA 2GAGC 1AFJA 5BXIA 2V8HA 3DGPA 2F9JA 4ITSA 3F73A 2QO3A 3CMES 4NYPA 1FD2A 2MGZA 1GXLA 3UCZP 3CJKB 2DRAA 1JLEB 2G1DA 4RNMA 1B64A 2V2ZA 1I6JA 1JWWA 4DLEA 4B3OB 3LF0A 3DDNA 3A4TA 5ETOA 4EFAC 5HROA 1VC5A 2EK6A 2DO0A 5KOXA 2I0XA 4YB6A 1RHQB 1DTQA 1K47A 3ZXWA 2R8KA 1UKUA 1FE4A 3JSYA 4RUBA 1KHVA 1SJRA 5L1LA 3CE8A 3JTOA 3J81j 3KKFA 2E1MC 4WPAA 4CLTA 4ANCA 2VBYA 1A0OB 2AGOA 2IVMA 3M30A 4DUYJ 2RJZA 4QPXA 1T9VA 2D1CA 4ZVQB 4EBDA 2P9GA 4G1PA 2BRLA 4R5PB 3D6MB 4HYKA 2KJVA 5EN1A 2AYMA 3SV3A 3EVMA 3P5BP 2UVVA 1TUWA 3GLJA 3KDOA 1KOOA 2ROPA 3V4MA 2ZHBA 2HMIA 3QGGA 4WP9A 1PSDA 2GJIA 1RTDB 3NS7B 1VQOS 1RTZA 3KHHA 3GB0A 3K2YA 1VHIA 5GVQA 3CCZA 3PW5A 3VALA 4CO5A 2AYBA 4Q8FA 3GSIA 5HVFA 2XB2D 2PN6A 4IH6A 1O51A 4M5NA 3V2UC 3LP1B 8AT1B 3DOLA 5C2CA 2EI5A 3DLGA 4RWXA 2MZTA 3M2VB 2OGUA 3Q2SC 4K5RA 1K0TA 4P10A 4HHHA 1FVQA 4NA2A 4LFBJ 2C2MB 2IRUA 4FF1A 2WVCA 2R9LA 5DDRC 2XSJB 5B0EA 2UUCF 2N82B 2ZNZA 1VBZA 3W63A 2XLJA 3HD1A 1S9GB 3MURP 4BWJA 3DRSB 2G1HA 3MGJA 1RAEB 1MWYA 2NSCA 1FRMA 2FHKA 4PABA 4RJVA 2EFGA 1QD1A 2OMOA 1GXUA 3DMJB 4HHJA 2X1FA 3TX0A 5EX3A 1BWVA 4BDPA 4ELTA 2QL5B 3ENQA 3MD3A 4C11B 3HM9A 2BANA 1QAYA 5JUMA 1S97A 5BYSA 3UFCX 3TNVA 1M5VC 4DR7J 3O6QA 1FKOA 3CCVS 1Q53A 3TANA 3RB6A 5D8HB 4CYUB 3DRPB 1JIHA 5B0FA 3ZTSA 4IQXA 3FBBA 1SKUB 1KKHA 4YP3A 1IJEB 1FJCA 3EZUA 5FIIA 1QVFR 3W65A 1SC6A 4HEA9 2U1AA 2CQ2A 4HHUA 2V6AA 2AU0A 3CW2C 3KLFB 3ET6A 1S1VA 3VQTA 2R2SA 1NSQA 1NDLA 2ZH3A 4X64J 2E1CA 2LA4A 2QE5A 4I64A 3U27A 1PYSB 3FSXA 2WSCC 2V50A 5B0AA 3HHDA 1R89A 3IR7B 1FNOA 5E2QA 1RHRB 4CP5A 2EW9A 3LQVA 4A8MP 1JLAA 1QE1A 2HFZA 2XNRA 4ZOSA 2WOMB 2E9ZA 2RQKA 4DU7A 4HDGA 3LH2S 4GKKF 3W8PA 2MLYA 4LIRA 3TVYA 2DGQA 2FB0A 1WF2A 4DUZF 3P6YC 1ZM2A 2R4FA 3V6DB 3DC2A 2EBEA 5E3RA 3PYEA 1SH2A 4WYLA 2F9DA 2C3YA 1IWGA 3MMCB 4LT6A 5LOQA 4J9LA 3GU0A 4NYZA 1UW4A 4Q7AA 1WF1A 2RUGA 5IFMA 1NXIA 2CJ9A 2AYGA 4WE1B 3CMQA 4JP8A 1S12A 2X3DA 3M6UA 2MYFA 2AF6A 2W01A 2CPDA 4F8RA 2XO6A 4YUDA 3HVTA 4P72A 2G2OA 3M8WA 3DN9A 5AJ3F 1HHQA 2Z2ZA 3QRPA 3DU5A 4W92B 2FJAB 4ECTA 4EWTA 3UCGA 5B0DA 1WI8A 3TA0A 3CJKA 3T5KA 1JLEA 1C1CB 3IR6B 4KR0B 3MR5A 2V9KA 5DO2A 1NK7A 2R7QA 5IQ6A 1NKEA 1FK9B 2HG4A 4UZCA 4X4PA 4CT8A 1O5JA 5KT7A 2EFNA 2CNOB 4M5JA 1BUXA 4MIBA 3PCOB 1KTVA 4NLWA 1RYRA 2JH3A 2LKZA 1YLXA 4JV2A 3IWNC 1CJKB 1KLNA 2NXJA 1NJXA 1N6QA 4KH0B 5GMDA 2Q6CA 1MROB 4IFVB 5EWGA 3EPGA 4B9MA 2XG8A 2P8IA 2LXFA 1RTJB 3EGVA 5KFAA 2HGNA 4P9SA 3OJSA 2M0GB 2RDIA 2CADA 5C7PA 2J7UA 2XMKA 2MZRA 4JI4J 4B3SF 2LQBA 2HVDA 4E8UA 3MF5A 5J2NB 3PJWA 2ZZMA 3RAMA 3JQKA 1SXLA 2N4CA 4RNFA 2PA8D 2C22A 3Q2TC 2JDJA 4A47A 5LMUF 5GADU 4B3MF 3MR6A 2UUAF 1UW9A 1FESA 5KFFA 3I96A 3HZGA 2P6SA 4KHPF 1T94A 4NLYA 2BVZA 4N41A 2HQIA 4OJ3A 2Z2YB 1F1BB 1XNRF 4USKA 3NLCA 2RU3A 2ALZA 3HT0A 2FC8A 1HMVB 3MAAA 1D1UA 3GCWP 4K5SA 2HWHA 3SI8A 1RTDA 3J81U 3AOAA 1RT1B 2K7KA 4LRDA 2OSRA 5B0CA 2VBXA 3G4SS 1NBEB 4FS1A 1M5KC 3ZTRA 5D78A 3JAMU 4K2JA 1T9YA 4UUXA 5EX0A 4KQZA 2KI2A 5HMWA 3LP1A 4QIGA 3RW6A 4MFBB 3ZNJ1 4LF8J 5A8RB 1RT2B 2B8PA 1V5VA 3UDLA 2RD5C 2HVEA 2QA1A 1YSJA 4R25A 1PAUB 4TU7A 4ZVOB 3MD1A 4L3KA 3TQ1A 2G0IA 1CVJA 2R7XA 1RT7B 3UI3A 1T03B 3D0IE 4OI2A 1J2VA 2XSJA 4EZ6A 1UVLA 3OPKA 1S9GA 1FX4A 5AE2A 4NLSA 2I5JB 2W8LA 4WKRA 4AQYJ 2QA4S 4F2SA 1V3SA 4ECSA 3DLJA 1XR7A 3Q8QB 4MT1A 3HHLB 5KG5A 3G8QA 3BQ0A 3ONQA 2GIFA 3NAHA 4LBIA 2WBMA 3I0RA 2P5VA 5H1SV 2VZ9A 2V4RA 1XNQF 3LP2B 1JLGB 1HQUB 1RTHB 1VC0A 1JMTA 4KO0B 2B7CB 1VS3A 4CYUA 2W7PA 4DR6F 3DRPA 1ZOTA 4H54A 2JFKA 3IAS9 2R7VA 1GFWB 4YR2A 4B3TF 1IKWB 1FNXH 4U7UD 4FKXA 4XPEA 4FVMA 3QGHA 5IS2A 4ZPWR 5T41A 1TR0A 2IJFA 4NRTA 4IH7A 5AXKA 2VODA 3HFZB 3QAUA 5KFQA 4MK9A 2G2ZA 3LTOA 4N56A 2AV5A 2AWZA 4Y2MA 2KRRA 4O0IA 2Y1RI 4HTIA 5KG7A 2DNQA 3D1OA 1L3TA 1PC5A 3PIPQ 1HBNB 1RB0A 2DTJA 5ETVA 2PFDA 2QT7A 2YTCA 4OI1A 4CLYA 2BJ9A 1VQ6S 1YTYA 4OYBA 2RS2A 2FVPA 5EWEA 4OX8A 1WI6A 1F9HA 4WP3A 3M6WA 2K1RA 2F4FA 3CC7S 2NPFA 1TKXB 3V6DA 3G8SA 3TZXA 4B02A 5EDWA 2HLUA 2Y1JA 1DJ0A 4CQ1A 2HURA 1FA0A 2IVYA 1KTQA 4G1QB 1GEHA 3JTNA 2AIRB 3MMCA 2COLA 2H5JB 1OYEA 1X5OA 3T9ZA 4OI0A 2BYCA 2G4BA 5D4LA 3I9V9 1R8AA 3A8IA 2IAJA 4WWSA 1DQAA 4TLQA 1S1XB 5ETRA 4JV0A 1JJHA 3IBCB 4C0HA 1Q7LB 3M6VA 1VJWA 4DLGA 4WE1A 3QWPA 4ECYA 2OELA 4AT1B 1FXRA 3C15B 1PJ6A 5CZXA 1OQ3A 3OLAA 3Q8VA 3L9ZA 4B17A 2M70A 3AXKA 4CI0B 5D0HA 4F50A 3BV8A 4LF6J 4LFCJ 4XK8C 2Q6BA 5IM0A 5KFMA 3DLLQ 3RRKA 1B99A 3G6VA 3OXGA 3MTKA 1HI0P 4GKJF 2A0FB 3W60A 2VL1A 5L9NA 2XGPA 3T5LA 2BABA 5A8WA 2AYEA 3UR3C 3OUYB 4A8SA 2QYGA 2IA0A 2XMUA 4RUHA 4U9RA 4ETZA 1W2BR 1KOHA 1NM2A 1U1NA 4CTAB 1T3OA 3THTA 5HJYA 2FVRA 4V1Ak 1GMUA 3DGVA 4C48A 5A2QY 2CPEA 3M8PB 5HQLA 1U6ZA 2IRXA 3CD5A 2W9BB 1B0TA 4IFVA 4OYWA 3N28A 3PHEA 2DJWA 3HHNB 3AOCA 4UOFA 2N3LA 2VOPA 2QV6A 1FDBA 1RTJA 6AT1B 1C0TA 2VPYB 4LVNP 4QR0A 3QFHA 4O4RA 4DX6A 5LSRA 4DL4A 5K8OA 1ZTWA 4CNZA 5J2NA 2IM1A 2ZC4A 3BKTA 9ATCB 4H4MA 1HNXJ 4ZN3A 2JJ4D 1NU4A 3CSKA 3D3CJ 2HK3A 3RBDA 4P73A 3HT3A 2J6SA 3VWSA 4M5LA 2MQNA 2EG2A 4J5OA 1X4CA 3VAKA 4DR7F 1FT8A 1T3NA 1JLCB 2BJEA 4NWBA 5DZ6A 3R9LA 1L3UA 1X4HA 2BUNA 4Z37A 3MMBA 3BBFA 1UWAA 1F3VA 1Y9OA 5FLXY 3N6NA 4DR2J 3ITHB 1HMVA 2GHWA 1W26A 2QMUB 3MM9B 4FYDA 2MKCA 4H4OB 5KT3A 4IO1A 5LM7E 3MPWA 4QIVA 2UUBJ 1XMQJ 2KVIA 1WUUA 3BBCA 2NCKL 2VUGA 3WQPA 1JJCB 1FJGF 3SXLA 3I4PA 1S0OA 1HHTP 1FKPB 2PO4A 4DN0A 3JSBA 4MFBA 2MKYA 1GMWD 1TK8A 2XCAA 3FEXB 4WFBQ 5A8RA 1MWQA 1RT2A 1DY3A 2DNPA 2BKOA 1J5OA 1TL1B 4J9UE 3TAQA 4M1KA 4BCAA 3DM2A 3WIUA 1RT7A 5CYMB 1T03A 2E1RA 2Q79A 4O44B 3W64A 3GR1A 2VV5A 1RWVB 4CDIA 4FNHA 4E0DA 2F5GA 2WVFA 2MSTA 3RRHA 4J9NA 4OHXA 2QC3A 1RU1A 4NASA 1JLBA 1QUPA 1RAHB 3CF5Q 3DCAA 4TU8A 2RU9A 4LBPA 4AFFA 2HVIA 1RA6A 3SCLE 1QTNB 4GC6A 2D3ZA 3CT9A 1VQYA 2BA9A 1UEUA 5GAHI 1HQUA 1RTHA 1KFDA 2F8MA 4KO0A 4UOCA 1OY6A 1G1XA 2YKMA 1EAYC 4WTOB 3PR5B 2NZCA 3V4IB 3M8QB 2V4JB 4KKOB 1IKWA 1JKHB 1R3NA 3K5OA 1UA1A 1L3KA 4GVBA 5DM6Q 2CQDA 3QIDA 4AUKA 1OPIA 5D4PA 2D9OA 3NP5A 2IMOA 3NG8A 2DGSA 2QLBB 3KK3A 2QFJA 1X4EA 1M90T 2JEJA 1SCJB 1WG4A 3AY0A 4TN2A 5KG4A 4WKYA 2C2EA 3OVAA 2MZSA 2RQMA 2GGPB 4OYPA 5DG7A 3D9BA 2OTLS 1LW2A 4YDXA 3PW2A 1IXKA 3OT9A 5FDLB 1HBNA 1HPZB 4ILRA 5RUBA 3V6KA 2DRDA 3MPVA 3DHXA 1FWLA 2VPWB 4X4SA 2C3PA 1RLCL 5KAKA 3R6GB 4KGMA 1H74A 5LMNF 3FZBA 4L76A 3CD7A 2YPYA 3OSNA 3CDUA 1TKXA 4OFZA 3PX4A 4JV5J 3BSCA 3VR1A 2XCPA 1UCNA 4EUVA 3W1YC 1MN9A 3OHBA 1KONA 5F9NA 1PJ5A 4C9DA 3NBPA 3FFIA 2HNDB 3MUMP 4G1QA 1WORA 4ZMMA 2B6AA 5A0YA 1URRA 1KN6A 4DU8A 1KBRA 1FNMA 1S10A 2ZBCA 3EZOA 4PPZA 2XLIA 1CJVA 2FYXA 5KTQA 2AP6A 2D7SA 4TY8B 4NLQA 3GJSB 4KB7A 1MMLA 3GILA 3H5SA 2OH2A 3TUZC 2H4WB 3FEZA 1T7PA 4WFNQ 3QRQA 3C15A 1UJ5A 2DH7A 1Y3JA 4ZVRB 5HJXA 2ROGA 2UUTA 4DXLA 1BWEA 2AX1A 4ANDA 1CQMA 4ZIVA 1EP4A 2VJVA 2QTWA 1R6YA 3VTIA 3BKUA 3MHYA 3AD9C 2ZH6A 4HLBA 3HDSA 2F63A 1Q86T 3BDPA 3GIRA 1RAIB 3PRVA 1ZPVA 1EX8A 2BE2A 4WXOA 1DLOB 1ZTTA 5CABA 1JLFA 4CTAA 1PC4A 3K59A 5C24B 3RB4A 3ISZA 2RKIB 3PV8A 2QLWA 4KV8A 2GHPA 4C6AA 2XZWA 4USUA 4I68A 8ATCB 3MR7A 1WHYA 1ZM4A 3W2VA 4ED3A 4B9TA 1RGVA 3IWLA 2MZ1A 4W90B 4DR5J 5G0RB 4C4WA 2CPIA 1KFSA 2BQUA 4ZPDA 2DGTA 4QBUA 3NAIA 4AQYF 3SQOP 1FERA 4ES1A 4IYQA 1U8SA 1EQMA 2VA2A 2B4UA 2X7IA 1R43A 1OY8A 3DRYA 3LGHA 3HVRA 3QT5A 4A48A 3G6XA 5LSOA 1RT6A 2VICA 3CJQA 3W2WB 2VA3A 5GAGI 5KFPA 2Y0BB 2YWKA 1Q8IA 1M1HA 4JI1F 1HIYA 2BJ3A 2DR5A 2O1PA 2E7WA 4LR8A 4LFAJ 1HWJA 3FC9A 3SQGB 4NEYA 4FXWA 4IKAA 4BLGA 3ZZPA 3MMJA 4X4VA 2YKNB 3MM9A 1CS4A 2L41A 4C8ZA 5KFRA 1HW8A 2NUHA 2R7UA 4H4OA 3P4UB 1LFWA 4J91A 3HPOA 1F5AA 4J9QA 4FPIA 2DY1A 4PG5A 4Y65A 3LW5C 2HLTA 3R7NB 1OQ6A 1YJRA 3SBMA 1UWBB 5A76A 2V34A 1U2FA 4Y2KA 2R2RA 2DPJA 3BSAA 1FKPA 1R0CB 1TKTB 2AKWB 1NZAA 4TYAA 1M1KT 3M2UB 4URQU 1ELOA 2HGMA 2XMTA 2XWYA 2NQPA 2JLFA 4QIFA 2YWEA 3QO9B 2UVWA 1U0HA 1TL1A 3C8YA 2DCLA 4W4MA 4DV5F 1ZM9A 5CYMA 4O44A 4ZCMA 3AQOA 1I94J 5DQGA 3CULA 2CKWA 1M5HA 2K2PA 2R8JA 5SUHA 1U1PA 4WJBA 3SV4A 3TZYA 3JTPA 2B9YA 3EGNA
chains in the Genus database with same CATH topology
1I6JA 1JWWA 3CJ0A 4DLEA 4FF2A 4B3OB 3LF0A 2RIJA 3C6UB 5M2PA 3DDNA 2ASYA 5KFDA 2MSSA 4DSLA 1LWCA 1YRUA 5F3TA 4EFAC 5ITHA 5HROA 1VC5A 2J7WA 2EK6A 4H4MB 1REVA 4J9OA 2R2UA 3BQ1A 2DO0A 1LV5A 1V6HA 2ZD1B 5KOXA 1VQ4S 3EXYA 2I0XA 4DSEA 3UQSA 4YB6A 3OSPA 3GFZA 4PQUB 1VGYA 1DTQA 4Y00A 4WU3A 2BV3A 2HNYA 1UFWA 2R8KA 2X1GA 3Q8SB 3VF0B 1YIJS 1RTIB 1UKUA 5T7LB 1FE4A 3CDWA 2PMZD 4JYAF 2ZM6F 3JSYA 3J81Y 1WNEA 1BD6A 1KHVA 3Q8RB 1SJRA 5KFIA 2DNLA 2GMLA 1X4DA 2C3MA 3DHWC 3MFHA 1TV6A 3KNGA 1C0UB 4XIUA 3MMBB 5L1IA 2G0CA 3K5PA 4USJC 1DTTA 3V4IA 3M8QA 5L1LA 3CE8A 3JTOA 5L38A 3DOKA 2OPPB 1UVJA 2M52A 1OPZA 2E1MC 2GQ2A 3KKFA 2C28A 4LSLA 3CMAS 3S7RA 1GX5A 2VBYA 3MUVP 4ECQA 3JAMY 2GMHA 3DU6A 1YITS 3B78A 5K8MA 4X66F 3KHGA 4IRCA 2AGOA 2DHXA 4IFYA 1HNIB 2W4DA 2IVMA 2I5JA 1K9MT 3M30A 1VQ8S 3B4MA 4UQTA 3FVYA 2RJZA 4QPXA 4C8YA 3T6JA 4TXSA 2P6TA 4J9RA 4DR5F 2D1CA 1E6VA 2DRBA 4ZKAA 2YNIB 4RX6A 4C8OA 2GQCA 1UFLA 1YG0A 5B7WA 3QZ8A 3CUNA 1ULRA 3HHLA 1GXTA 4ZPVR 4B9VA 2VG6B 4Y6IA 4EBDA 5KT4A 2P9GA 3U1MA 4G1PA 4I6AA 3LWLA 2N7YA 2BRLA 5C5JA 1Y3KA 4JV1A 1X4BA 4QR2A 1KVJA 3W7BA 4GMKA 3I87A 4KTQA 1RQ0A 2GGPA 2XO7A 3CDEA 5EUHA 1HI1A 2YNHB 4R5PB 2J6TA 2J9CA 2RQCA 2CRLA 2MQOA 1FXDA 4HYKA 2Q1LA 1N36F 3IN5A 4C0OC 3LP2A 2XS2A 1JLGA 2GNKA 2KJVA 2DVIA 4U67Q 3PJXA 3MMAA 5EN1A 1FRIA 1KC8T 2RF2B 2AYMA 4OJ1A 3X1LB 5GAEI 1WG5A 3OL8A 3SV3A 2UVVA 3H5XA 2CZVC 2V0NA 5DDOC 4JBCA 2KXNB 2C2DA 1J5OB 1KOOA 1VRUB 2ROPA 3V4MA 2ZHBA 1QSSA 3JSMA 2O3DA 4K4YA 1NJIT 1MW7A 2HMIA 3H5UA 3OXFA 3DLEA 4RBTA 1JJ4A 3QGGA 5JVHQ 1U1LA 4TQRA 3DM2B 3NWGA 2MQQA 1PSDA 2GJIA 1ZAXA 1RTDB 1VQOS 3SFGA 3GZ7A 2FIUA 1N48A 3HXMA 3J80Y 2E7XA 5I3UB 4Q5VA 3KK1A 3KYLA 3KHHA 4X4OA 3GB0A 2ZFHA 3K2YA 5GVQA 4LFAF 3PW7A 1M5SA 4TLRA 3CCZA 3OBIA 4N8NA 4J37A 4DR3F 2VB6A 3PW5A 4PG8A 1S79A 5CQGA 3VALA 4IG0B 3W3SA 4M95A 1B0VA 2BZ2A 4CO5A 2NUUG 2AYBA 4HVZA 3TX8A 4OL8A 2NYIA 4IG3A 2ZJQQ 5JJBA 4Q8FA 1T8EA 3MTJA 3KLVA 3NL0A 2E1AA 2V8VA 2XB2D 2PN6A 3N4WA 1T95A 2HQ3A 1WWHA 4WFAQ 1HNZF 1HBUB 3BS9A 2XULA 5HI7A 2UVUA 5DJBA 4IH6A 1O51A 1JLBB 4G3IA 3V2UC 4AE5A 1FVSA 3LP1B 4P6QA 1JB0C 3DOLA 3SSQA 1HBOA 4OLPA 5KG2A 2EI5A 4PG6A 7FD1A 1NK6A 3MM5B 4R0EA 3OFEA 3DLGA 2ZKTA 1JX4A 4V19J 1P1TA 4RWXA 1RKIA 1MMDA 2MZTA 1D3WA 1XMBA 1HYSB 3M2VB 5HL7Q 3NNCA 2FVQA 3Q2SC 4K5RA 1K0TA 2P9CA 2HZCA 2JLEA 6FD1A 2LYVA 3THPA 1FVQA 3H5YA 2JWNA 2K8GA 3BZQA 4MMOA 4NA2A 2J5AA 4DFPA 2QMWA 3KHLA 1U49A 1KD1T 2Q43A 4Q45A 3AAWB 2W9AA 1M5PC 4TY8A 4XAKA 2FJWA 2IRUA 4FF1A 4WZQA 4P7TA 3O3LA 3BM7A 2YKMB 1X9MA 3X3UA 2DGXA 1XEZA 3I55S 3VZHA 2R9LA 2ATLA 2NLWA 1Y7PA 2XSJB 5DDRC 2KHCA 5B0EA 2UUCF 4FF3A 3IG1B 3WC0A 2ZNZA 3C66A 4OZ0A 4YMEA 2N82B 2BDPA 1VBZA 3LP0B 3PX6A 4FXDA 1S6QB 1RDRA 1S72S 2XLJA 2HRYA 1VQLS 3KFWX 1NHUA 4FZVA 1S1TA 3SSSA 2RRNA 1FCAA 1S9GB 4I2PA 2KM8C 3MURP 2KZMA 1BQNB 5KFTA 3NS6A 2R7TA 4XO0A 2DBBA 2VFRA 3NNAA 2OP5A 4BWJA 3DRSB 3NCQA 3OJUA 3LWMA 4DQSA 1Q81T 1QLNA 2ZJPQ 5KFNA 3MGJA 3S6EA 4D3HA 1MWYA 3TP2A 2MQPA 2MZJA 2NSCA 2YNGB 3CJ5A 3KK3B 1FRMA 2FHKA 1QAIA 3WBZA 2GC8A 2EFGA 2KT5A 5IT4A 4Q43A 1D9DA 1TAQA 2OMOA 1GXUA 5D6GA 3DMJB 3S1TA 3ZZUA 1BC6A 4ZPBA 3T6BA 4MKYA 4HHJA 5J2PB 2OMLA 3IGVA 2X1FA 1ZAWA 3EGWB 3CCUS 5EX3A 2HNZB 4BDPA 4ELTA 5SZTA 1R8HA 3OL6A 3ENQA 4PUOA 3EPIA 3MD3A 4C11B 2A1BA 2BANA 3HM9A 3S01A 3PKMA 3OTEA 3N9UC 4I7FA 1QAYA 2KKHA 4I2QB 4MTPA 2LDYA 5JUMA 1FTRA 1S97A 4JI3F 3M32A 5ADZA 5BYSA 1IUJA 3ZZYA 4AXJA 5I4MA 4RW6A 3UFCX 3EGZA 1I1GA 3DRRA 3TNVA 1S4FA 1D8ZA 3IRXB 1B7FA 5K9FA 1RT3A 1M5VC 5H9EJ 1LW2B 1NK0A 3O6QA 1FKOA 2JC0A 3PACA 3LGNA 4G6VB 1DAXA 1Q53A 2ZOGA 3CCVS 3TANA 3RB6A 1SJ3P 2PI5A 5D8HB 4ID5B 1H6KX 3FMBA 4PR6A 1S1XA 3SFUA 2VG5A 3G6ES 3DRPB 2B56A 4ZA1A 5DLGA 2OPRB 1JIHA 4WK3A 1RT5A 3RTVA 4TY9A 5B0FA 2HHUA 2A18A 1LW0B 5C24A 3UW1A 4RNNA 4IQXA 1S49A 2R7RA 4KAIA 4YY3F 1FJEB 2GIQA 1UAWA 3ZC4A 3O1LA 2QLXA 2RKIA 4A8FA 2VONA 3FCHA 3GFYA 4N77A 4AL5A 2YVSA 2XLKA 1ZM3A 1VRTB 4YP3A 3C46A 3CPWR 2KYXA 1IJEB 3BR8A 4NRUA 1FJCA 4Q2MA 4RW4B 2B43A 3EZUA 5FIIA 2W9CB 5C42B 2HWTA 3KLGB 1QVFR 1SC6A 4HEA9 4DV0F 2U1AA 2CQ2A 3UD3P 1AXQA 4EBEA 4DF4A 2DIUA 5GAHU 2AU0A 3KJVA 3SDEA 3EXCX 2VG7A 3KLFB 2HFNA 2DNGA 3PXGa 1YQHA 1S1VA 2M8DB 1N5SA 1Z2LA 3OXLA 4B9LA 5G0RA 1WG1A 3BGLA 3DNCA 3MAQA 2JVRA 2OPSB 3FRYA 3VQTA 3M2RB 2R2SA 1R8CA 5D3GA 3QIPA 3FJ2A 3SCJE 2N7CA 2ZH3A 3AH6A 2XBPA 2J0WA 2E1CA 3WZ0A 1SV5A 3GYXB 2LA4A 2QE5A 2WB1D 3FDSA 4I64A 3U27A 1Q79A 4DUYF 4KRWA 4CT9A 3FSXA 5J1PA 2WSCC 2XMMA 3T5JA 4DL7A 4ZCKA 5E3QA 3OUYA 1NK8A 1Q7YT 3NBPB 1N34F 3U02A 2ZH1A 3NMAA 1FDAA 5B0AA 3FFIB 4FF4A 3HHDA 1R89A 4O23A 3IR7B 2IHR1 3OR2A 3CCQS 1TQLA 1FNOA 3UPFA 2YKPA 2B6AB 2J9EA 5E2QA 5A0YB 2BRKA 2W24A 3TA1A 2EW9A 4MKBA 2WONA 2DPIA 3LQVA 4A8MP 4ZVFA 1JLAA 4ES2A 2AX0A 4C8LA 3J7Z5 1DURA 1UJ4A 3O5TB 1Q82T 1Z2ZA 3OTBA 4X84A 3G6YA 4A8KA 1XN9A 1LWEB 1HNVB 3QGIA 1QE1A 4Y2AA 2HFZA 4F4XA 4OZ5A 3M8PA 4LJMA 2XNRA 1OO0B 4ZOSA 4KFBB 2WOMB 3RAQA 2E9ZA 1CPZA 2W9BA 2RQKA 2B5JB 3CWJA 5F8JA 2AW0A 2IYGA 2XMWA 3D5MA 3QAEA 4OMFG 3K0JA 4HDGA 3O2IA 1FRLA 3LH2S 1TFYA 3BF4A 2VPXB 2RVJA 3SQGA 2RQ4A 4GKKF 1H0HB 4LIRA 3TVYA 1VQPS 5L1KA 4ZHRA 2DGQA 2V5HG 3POTA 2FB0A 3T3FA 1WF2A 4ICLB 1C1BA 4DUZF 3P6YC 1ZM2A 1X5PA 1VFJA 2R4FA 5CHCB 2F8HA 2YX4A 3V6DB 3HJFA 4NLRA 1FXLA 1GH8A 3DC2A 2KHDA 2EBEA 2HS0A 5DQIA 5AXNA 5E7OB 2CJKA 2E5HA 1TKZB 3UD4P 5KFHA 1V3ZA 1EP4B 2DT9A 4R8UB 2YX7A 2GQQA 5E3RA 4M5DB 3U7JA 1CC8A 1SH2A 3HX9A 4Q2LA 4WYLA 4QWBA 2F9DA 4ZS6A 2VQFF 1NAQA 3GIJA 2C3YA 1UWBA 3IAM9 3MMCB 4LT6A 1Y00A 4EO6A 2KFYA 3BO4A 4J9LA 3Q24A 3ZZTA 4URSA 2GIRA 3SMZA 2Z4PA 3KK2A 3KLEB 4FN5A 2E5GA 3OW2R 5IQQA 1J5EF 1GNKA 1BQMA 4OX6A 4RNHA 3TAMB 1N4LA 4DBQA 4Q8EA 2IC3B 2KH9A 4NYZA 4FS2A 4L72B 2AJ4A 2APOA 2EWHA 1N5QA 1JLCA 2QMXA 1UW4A 3L95X 2H5EA 2LA6A 4Q7AA 3V81B 2BE2B 5F41A 5J1EB 5HLFA 1WF1A 3VAMA 2CQ3A 2GMJA 2RUGA 5DG9A 2X51A 5F8MA 2YY3A 3I31A 4I56A 1SJFA 1X4FA 3LALA 1JLFB 2ZITA 2CJ9A 5IFMA 1IN0A 2D41A 4OI4A 4WE1B 2XC9A 2AYGA 5F9LA 4UQGA 1KLMB 3QO9A 3PM9A 1JLQA 4Q0BA 3RAXA 3DXBA 1BLUA 4LFBF 1NH8A 3M6UA 2MYFA 1AROP 3ITHA 3R5AA 2AF6A 2CPDA 3KG0A 1S1UA 1AUDA 4F8RA 5CXTA 4KV8B 1Y5NB 2JEGA 4YUDA 3HVTA 3P3DA 2ZC3A 5B0BA 3GG1A 3DXSX 2CIMA 2EVZA 2ADBA 3W2VB 2HHQA 3DN9A 2X1BA 2E66A 1IKXB 4GO5X 5AJ3F 4IUFA 3DU5A 3CCMS 4W92B 1N33F 2FJAB 2R8IA 4ECTA 4WTYA 3UCGA 4EWTA 2NSBA 4EBCA 3OQ2A 5B0DA 3IGNA 1SUQB 4JV5F 3R5BA 4X4NA 2BM0A 1WI8A 2KN4A 3AHPA 1SBRA 1X9WA 3TA0A 3I6PA 5KG1A 4DL3A 3CJKA 1S48A 1G3OA 3T5KA 1JLEA 1UL3A 1C1CB 2EBGA 4DG1A 3G96A 3RB3A 1HQEB 1RYSA 3IR6B 4KR0B 3F41A 1QSLA 1S6OA 4C8MA 3MR5A 3ULHA 4ED5A 2P9EA 3TR5A 2V9KA 5DO2A 5DS7A 1NK7A 4BHQA 2J0QD 4WU2A 3LPYA 4A8WA 2R7QA 5IQ6A 1NKEA 4Y0FA 4X2BA 1FK9B 2HG4A 4J9MA 1FO1A 2ZE2B 4LQ3A 2J0XA 4X4PA 4CT8A 2DGUA 3F44A 3U1NA 4WZMA 1O5JA 1RT6B 2ZD1A 5JXSA 4NCGB 3PFEA 5KT7A 4PKDB 2EFNA 3RB0A 1FDNA 4LIWA 4CO4A 4PQUA 5K14B 4QZVB 1K8AT 4FBUA 3RYLA 3DRXA 4MH8A 1K0VA 5LJ3Y 4J9KA 1HARA 2F7VA 4DSJA 5C25B 4MIBA 3KMSA 2BOPA 1KTVA 1RTIA 4KJIA 2LEBA 4NLWA 4YHHF 3M05A 1RYRA 2JH3A 2AGPA 2LKZA 3MOJB 3MEEB 4JV2A 1UVKA 1HWUA 3K7RA 1D0EA 2DISA 1A7GE 3IWNC 2RRBA 4NZ7A 1DQ9A 4X62F 4J9PA 1C0UA 1NJXA 1N6QA 1KLNA 2Q6CA 2RRAA 3SZ2A 3R1HA 3M8SA 1MROB 4OI3A 4IFVB 5EWGA 3MXHP 1WACA 3EPGA 2DR8A 3Q8PB 1R0AB 2PGCA 2O67A 2FVSA 4DQQA 4B9SA 5E3AA 4B9MA 4NXNF 2XG8A 4K4ZA 2KRBA 2LXFA 1RTJB 2UXCF 4OV1A 3IXQA 5KFAA 4MIWA 2HGNA 2KU7A 1JNRB 1LQ9A 1FRKA 3OJSA 4OLOA 2M0GB 1UA0A 2EPIA 5AE3A 2YWFA 4TNOA 2RDIA 4DR4F 4K4TA 1HNIA 1DBDA 2J7UA 4RW7B 2XMKA 2MZRA 1URNA 3T19A 3DI6A 4B3SF 2LQBA 2BACA 4E8UA 3RR7A 5KOWA 3MF5A 1X4GA 3PJWA 5J2NB 1U1QA 4IDKB 5LSLA 2ZZMA 1CQNA 1S6PA 1P27B 2OKQA 4O3RA 1QJHA 2YKQA 5D4NA 4EU0A 5IT9Y 1G7CB 5LL6d 4CO0A 2ADCA 3WC2A 1O8B