4O0NA

2.4 angstrom resolution crystal structure of putative nucleoside diphosphate kinase from toxoplasma gondii.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
153
Chain Sequence
AKQQERTYIMVKPDGVQRGLVSEVIRRFEQRGYKLVALKMKSPDATLLEEHYADLKGKPFFPGLISYMTSGPVVCMVWEGTDVVKQGRRMLGETRPLESNPGTLRGDFCIDVGRNIVHGSDSVESANKEISLWFTPEEICEWTSAQHKWVYEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title 2.4 Angstrom Resolution Crystal Structure of Putative Nucleoside Diphosphate Kinase from Toxoplasma gondii.
rcsb
source organism Toxoplasma gondii me49
total genus 49
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4o0nA00
3FBFA 4EK2A 4UOGA 1F6TA 3Q83A 4DI6A 3ZTRA 3Q8UA 3B54A 4UOFA 2DXDA 1XQIA 3VVTA 5CAAA 2BX6A 3EVWA 3FC9A 3FCVA 1BHNA 5C7PA 3B6BA 3WX8A 5CABA 5IOLA 4DUTA 3NGTA 1LWXA 2ZUAA 3L7UA 2B8QA 3NGRA 3VGUA 3ETMA 4KPCA 2VU5A 2DYAA 1K44A 1MN7A 1NDPA 1B99A 3ELHA 2HURA 4FKXA 4ANEA 3ZTPA 1BUXA 4F36A 2AZ1A 3EICA 3GPAA 2DXFA 4HR2A 3NGSA 2BEFA 3EE3A 1S57A 3VGTA 3BH6B 4F4AA 3BBBA 1HHQA 2DY9A 3VGVA 1WKKA 1U8WA 3G2XA 1PKUA 1WKJA 1NLKL 1NUEA 1VYAA 3EMTA 1EHWA 1HIYA 2HVEA 3PRVA 3BBCA 1PAEX 4C6AA 4FKYA 4ANCA 1LEOA 1NSKL 4DZ6A 3ZTOA 3VVUA 3EVOA 3VGSA 1ZS6A 1UCNA 4ANDA 1NDKA 1WKLA 3JS9A 2AZ3A 3BH7B 1MN9A 1NCLA 3DDIA 3NGUA 3Q86A 1S59A 1NDLA 4WBFA 3ZTQA 1W7WA 2HVDA 3Q8YA 3FBBA 3Q8VA 4UOHA 4W98A 3ZTSA 1HLWA 1S5ZA 3R9LA 3FKBA 1XIQA 2DXEA 3PJ9A 3FBEA 1NSQA 3MPDA 1KDNA 5BXIA 3EJMA 3Q89A 4ENOA 3FBCA 2B8PA 2CWKA 1NB2A 1NPKA 3DKDA 3ENAA 3EVMA 1F3FA 4CP5A 2NCKL 1NHKL 4O0NA 3FCWA 4S0MA 1B4SA 3EM1A 3GP9A 1BE4A 1NSPA 1JXVA 1NDCA 3BBFA
chains in the Genus database with same CATH superfamily
2IRYA 2FVPA 3IC1A 4CT8A 2L08A 1HR0J 3QMQA 2FC9A 4PPZA 1TP7A 1S6PB 3PYDA 4OHWA 4ED7A 1FKAF 3ZXWA 2VFVA 3TEGA 4FKXA 3A8IA 4YMEA 4WWSA 2RUSA 4KQZA 4DUZJ 3MR3A 4WZMA 1WORA 4WP3A 3EMTA 1IN0A 4UOCA 3PW5A 3PJWA 4OYZA 2ZE2B 2DGQA 3HHNB 2VZ9A 1SCJB 1UFWA 5A2QY 4WXWA 1XNRJ 4DPWA 2QGFB 2CPHA 4B3TJ 2ACMA 1JLBA 3TJ8A 3MMCA 3D5MA 4FNIA 2GGPB 1DQAA 4WFAQ 2XMUA 1VQYA 3KHRA 1PO6A 1UPPA 5EWEA 2X1AA 2GVDB 4ZPWR 1FRIA 3ISNC 2J7WA 2Y0BB 4J9RA 4MKBA 1WF2A 5AJ3J 5DG9A 3R5JB 4ZP7A 2RDJA 2Z2MA 4U7UK 4NCGB 2RVJA 1X4AA 4FDFA 5HLFB 2VH7A 1F5AA 2VQFJ 1D9FA 2F4VJ 3D6FB 3NL0A 4DV5F 2QX0A 4CO0A 3OTDA 2CAJA 1HA1A 1C1BA 3CJSA 2XWXA 1X7VA 2KL8A 4M5HA 4U6PA 2IYGA 2POKA 2HVEA 1CVJA 2XHWA 1Q8IA 1UVKA 2Z0GA 3K0JA 5D8HB 2VBWA 4LF6F 1GXLA 4ZPDA 4LF1A 2HGLA 1EX8A 1HNVA 1I1GA 2VUGA 3HHLC 4W90B 1S97A 2VOOA 1RWUA 2J7UA 4BC7A 2QFJA 2ZZNA 1FEEA 3FCWA 4NZ0A 4WCEQ 1JLBB 3RRHA 3MMCB 1P1TA 3CJ0A 2OJ3A 4O4GA 4ECUA 4OZJA 3QJJA 3HI9A 2UUTA 1RT3A 2ATLA 5E3PA 4Z7CA 2P9EA 1U47A 4MIAA 5DG8A 3KLFA 1UTAA 1BY9A 1F3VA 4N56A 4B3RF 3HCXA 1GK8A 4DR5J 2MZQA 2HHUA 4YY3J 1PYSB 2GHWA 4V19J 2YWHA 3SSRA 2LU1A 3BQ1A 3OLBA 4IUFA 2OD4A 2WTFA 4X4SA 3TA0A 3OTCA 5A0YA 4NPOA 1C1BB 1UCNA 1WC6A 2W8LA 1MWYA 2XWYA 5BR8J 1ZM9A 2RRBA 4DL0C 2F63A 2XMJA 4UOHA 5HROA 4O3QA 4P6QA 3DU6A 2GQCA 2AQ4A 1JMTA 1D1UA 2G0JA 1X5SA 2RU9A 4RUCA 1EKRA 3NGDA 1HNVB 3W9HA 4J9OA 2Z58B 3T19A 1WG1A 1EIYB 3HFZB 1VC6A 3ZTRA 2H4WB 4ED1A 1QAXA 4DX6A 2UVWA 2W2NP 3I96A 1N56A 3FCVA 4ZP6A 4ECYA 4RZRA 1UJ6A 2DBBA 4O4GB 4NLDA 5KFHA 1RUSA 5G4DA 1RT3B 2BUNA 2WVBA 4I69A 3KLFB 4I1TA 1EKSA 3L09A 4ELVA 3A13A 3R3TA 5IQQA 2XGPA 3MI7X 1UPMB 2ZH8A 4RW8A 3BR8A 2R42A 4F4XA 1PSDA 2ADBA 1HARA 1S99A 2MKSA 5F8NA 2DEJA 3TUPA 4DHVA 1NDLA 3OVAA 2OPRA 1RTDA 4RUHA 4ZCKA 3DI6A 5A0YB 2V4JA 4FN5A 2A10A 3EYZA 2EKYA 1ZH5A 2DK2A 4NMXA 3LA0A 2GIFA 2JH3A 3TX8A 3RRGA 5HROB 4Q43A 4H4KA 2LKZA 4WYWA 2V8DA 2CVIA 2ZD1A 1HNZJ 3QIDA 2QRRA 1FF2A 1FTCA 3CCWA 4N47A 1QVGR 2CVEA 2NXUA 1SJQA 5LL6d 4DCOB 4RU2A 2VG6A 2CZVC 4YR3A 2N4CA 2HRYA 2Y8YA 3QQCD 4JI7F 2HVZA 2UXDF 4P52A 1Z1ZA 4RW8B 2W9AA 4LF5F 2BR0A 4QU6A 5AXKA 5AE2A 1XJWB 2W24A 1QE1A 3PNIA 4H4OA 2ZKUA 1RHUB 4Z7YA 3TQEA 3UD3P 1FDNA 2ZBQA 2EFNA 2OPRB 2WVEA 1RTDB 3DI6B 1M5HA 2QSFA 2V4JB 1WHYA 1VQ8S 4K4WA 1VBZA 2EI5A 1Q79A 1X5OA 4Y28C 2DJWA 1NK9A 2C2OB 4DXLA 3BYRA 3JYTA 2ZH2A 1KS2A 4LRBA 1JNZB 1YQHA 2NUHA 2NYIA 2CQCA 4F3QA 1U1OA 2WRMA 1R0BG 2OELA 4KGVB 4K4SA 1APSA 4NLQA 2GIRA 4LREA 2E1CA 2MLXA 3MWBA 4KT0C 2QMWA 4NCAA 2E1AA 2WZ1A 4X62J 3OFEA 4JBCA 4DR6F 2HHSA 1YRUA 2VICA 3UCZP 4CIOA 5KT7A 2VG6B 3G6XA 3CB4A 4RO0A 2K06A 2R7VA 3NCRA 5K14A 4ZPAA 2MQOA 3OXLA 5J2PA 2ZM6J 4C3KA 2BW2A 3GJQB 4QZVB 3PR5B 2B3TB 4DL6A 2HS3A 1RXOB 5CA5A 1H7XA 4IDKA 2HGNA 3GCXP 4M5JA 3MPWA 9ATCB 3K5OA 1U2FA 3VAGA 1QE1B 5D4NA 4H4OB 3GYGA 2XO6A 3U1LA 1I94F 4DR3F 3PZPA 3HM9A 1SH0A 3UN5A 1DRZA 3L4BC 1VISA 4GO5X 1N8RT 2C2MB 3EWGA 3SEOA 1MROA 1YIJS 2DR5A 2VFSA 2IBKA 2WBRA 3TVZA 1Q82T 3QYYA 3AH6A 5KFKA 2JEIA 1UKUA 1AUSL 1TK0A 3JYTB 3M9NB 3WZ0A 3NOGA 2FQQB 4DJBA 4ZCIA 3TZYA 3IBCB 3TP2A 4Y6IA 2CYYA 2ALYB 3J7AN 2R2RA 5FLXY 3KWMA 2WOMA 1OQ6A 4DV7F 2RHSB 1N88A 1SH3A 1PGZA 3D6MB 2QJ3A 2HS0A 2RQMA 2XBPA 3H5YA 4NLOA 2W2MP 2Q66A 1U2CA 4P10A 1T03A 4EFAC 1R27B 4DX5A 1KOHA 2DNOA 3HDSA 4GMKA 1L3SA 5F8MA 2HW3A 3KDOA 4J9VA 2NREA 4G65A 5K14B 5LT5A 3T1YF 1EZZB 3HD1A 5H9FJ 5J2PB 4RW4A 3ZZYA 5CZVA 4N5SA 1IKWA 1Q8LA 1JQGA 4X4RA 4IDKB 2I0XA 1BQMA 1CQNA 1MNEA 2HSEB 3HK2A 3PEJA 2EBEA 3MDFA 3NS5A 3IG1A 2HBZB 2VC1A 4NX9A 3HP6A 1L3VA 1PC4A 1MROB 4KGZB 1KONA 4CM0A 1NUEA 3J7ZT 3JTPA 3L7OA 4DR4J 3CJTA 1VRUA 4HI1A 2A6MA 3M6XA 5CHCB 3KJQB 1NXIA 4QWDA 1N33J 1V5VA 2FLOA 3GU0A 4IRDA 3Q22A 4X4QA 2WOMB 3CCLS 3BPDA 2X3DA 4X4NA 5A2QU 1NB2A 4JYAJ 4X84A 3LOUA 5DLFA 1AROP 1BE4A 3TA1A 2QA4S 4M5KA 1VJWA 3ILIA 3KLEA 1T03B 1V3SA 1M5SA 5C25A 4P75A 2VIHA 3IA0A 2R2SA 1U6FA 1AXQA 1F9HA 2ZHOA 1K0TA 2E1MC 4RW4B 2A18A 1IKWB 2F8MA 1Q0NA 2HYIB 2XMMA 3RBXA 3HSGA 5DJBA 2DY9A 4NLVA 2LEPA 2ZH4A 4H4KC 1BQMB 1FNOA 3N9UC 4KGKA 2DGXA 3QT7A 2VQEJ 3IG1B 4USIA 3LP1A 4L74A 1X9SA 2H5IB 5IT9Y 2H5JB 2HWTA 5ETQA 2J8SA 4CZCA 4M63A 1GFWB 4WTOB 1D9DA 4DFJA 3FMBA 3Q8YA 3CCVS 3D0IE 2CQIA 2EKNA 8RUCA 2IDLA 3EGVA 4K5SA 1VRUB 1XIQA 2JX2A 3HPOA 1G2EA 3FBEA 1NKBA 3G96A 3MPDA 3U7JA 5IFMA 3BO4A 3E8OA 3AQOA 4RX6A 2DNHA 4U95A 1K1QA 4QIFA 3EDQB 3FRZA 3CT9A 5DDRC 1J5EF 3R97A 4UOGA 1XMOF 1IKVB 1BLUA 1AB8A 4Z2XA 2CNLB 4G3IA 1S0NA 2HNYA 1AUDA 3H59A 1T02A 2XZWA 4LBHA 2RAQA 3QRPA 4IO9Q 4ZPTR 3CUNA 3OTOJ 5AE1A 2NZ4A 5H1SV 2E9RX 3ELHA 2NUUG 5H9FK 3KLEB 3BYPA 2C3PA 5HQLA 3CDEA 3W60A 3T9NA 3SV4A 5ETKA 1HR0F 5C25B 1M5KC 4MAKA 2HKEA 4ZS6A 1U02A 1WI6A 4KYZA 2LDYA 1I3OB 2OLWA 3GG1A 1R8BA 1C4AA 3SQOP 4X4TA 1Q53A 4JB8B 2HBQB 1H2UX 4ECZA 4DUZF 1VJQA 3QPIA 1VOMA 2NZCA 4J37A 1TKTA 2GW8A 1XEZA 2AKWB 3LP1B 4JI6J 4X65J 1UL3A 1Y3KA 2ZZMA 4LF2A 4XTTA 4OI1A 3CNQP 2MQQA 4GC7A 3MR2A 3SI8A 1RTZA 4ZPBA 2WVCA 1XNRF 2KXNB 3GIRA 2C2ZB 4B3TF 4LF4J 1HNWJ 2ZOFA 1YJRA 2ZBPA 2ZEJA 2HFZA 1P8GA 4LFBJ 1ZBTA 5H9EJ 3DLLQ 2J9DA 2PI4A 2W8KA 5AJ3F 4EBEA 2FY1A 4WZQA 4DV4J 3OL7A 2R7XA 2NS1B 3QZ7A 5KFFA 2HNYB 1C1CA 3RR7A 1YX2A 5KFVA 2OEJA 2DD8S 1Q1KA 1K73T 4O4RA 1RBOB 1T8EA 2VQFF 2XY5A 2F4VF 4IFVA 4M5LA 4ANDA 4DPYA 4CRJA 4J9PA 1QSSA 2FZGB 1NZAA 3HJVA 4CLZA 1RADB 2J8AA 2KT5A 4XK8C 3BB5A 3GSDA 4C2MA 2DXEA 1FFSB 1UFLA 4HDGA 2P6SA 4I67A 3SSSA 3W62A 2W4CA 4RBVA 5BYRA 1TKTB 3OT9A 1RHKB 3QWUA 3TZZA 3Q83A 1HWUA 2R9LA 3BSCA 3HVRA 4DZDA 1SL0A 1AFIA 2F40A 4F3OA 3BGOP 1TV6A 2E5LF 4CTAA 4WIIA 2IAJA 2O67A 4FBUA 1EETA 2HFNA 4PG6A 1KKHA 4Z37A 2HHVA 3R27A 1BMQB 1Y7PA 4PR6A 3HVAA 3K5LA 3NBPA 4NZ6A 5ADZA 3PW0A 3GG0A 1T9XA 4J9SA 2XC9A 3I9ZA 5BYQA 2F8EX 2WVDA 3QBCA 1FWKA 1HW9A 4NLUA 1C1CB 3R6LB 3K5MA 4DR5F 1T9WA 3VAJA 3SCJE 1D8ZA 3OLAA 4YY3F 2ZKTA 3QIPA 5HO4A 3G8TA 3IWXA 2CQDA 2DGVA 4DLEA 3PX0A 3IWNC 3ENVA 4NCBA 3TO8A 3HHEA 2P9GA 4IFVB 2Y9HA 5KT4A 2QIFA 3Q89A 2YTCA 3FBCA 2B8PA 3I0SA 3SCKE 2DIVA 4NYOA 1U8SA 1WEYA 4H4MA 2RIJA 5BR8F 3OFFA 4WJBA 5F0WA 1X4CA 3I4HX 2GMLA 3TYTA 3R7BB 1R0AA 1HD1A 1S4EA 2N7YA 2PN6A 1JLQA 2HVHA 1FFGB 1VLOA 2KYXA 1QVFR 2PMWA 1X0PA 1VHIA 4WK1A 3VGTA 4A8XA 1TV6B 1IWAA 4CTAB 4F4AA 2IAJB 2H4YB 5H9EK 1EETB 3CC4S 4Y65A 5J1NA 3UW1A 2QG9B 1YBUA 2CQ0A 2HFVA 3NBPB 4UQGA 1AFJA 3UVJA 3ILJA 3AD9C 2PA3A 2XM3A 1NZ8A 2MZRA 3P4UB 2BABA 2CG8A 4ZJOA 5J1PA 3H2LA 4NI2A 4V1Ak 3QIPB 4KGMA 1TL5A 3RB3A 4OL8A 4DSLA 4RL1A 2AHOB 2ROPA 3R6GB 4DU7A 2JHEA 3P6YC 1Y3JA 1B64A 4DN9A 3I0SB 4EEYA 3W66A 1OWXA 4H4MB 2G0IA 3JB9k 2LQ8A 3IAS9 1LWCA 4KR0B 2HURA 3UCUP 2XSFA 4CO1A 2C22A 4HR2A 1R0AB 1M1KT 4QIGA 5C2GA 4J9LA 1UJ4A 2PFDA 1JLQB 4EMDA 1U6BA 3MECA 1YITS 2I38A 1HNZF 2YNFA 1PJ5A 4RU9A 5L46A 1CJUA 4PZVA 3RG6A 2YWWA 5KFEA 4OX7A 1WC1A 4R8UA 1N5QA 2UP1A 4O44A 4NA2A 2CPJA 3KJFB 4ICLA 4P2XA 1XBWA 2PT0A 5F8JA 3UVJB 4FF4A 4BWMA 3US5A 4JV1A 3M8ZA 2ZVIA 3QRQA 1SXLA 2OPQA 5FJ4A 3OR1A 4M5NA 4EO8A 4CLSA 4A8FA 1UZDA 5DZ7A 5B0DA 3IN5A 5A8WA 1KSPA 1Q8BA 2QA4G 2KZMA 4OJGA 1MWQA 3EZ5A 3EDRB 2J76E 1YJUA 2HHHJ 4HHJA 1UW4A 1VDHA 1KQGB 2YKQA 3FK4A 5DDPC 4LRCA 3BBBA 4ES3A 3M8SA 4URSA 1KWMA 5HI7A 1LWCB 4M94A 1CJVA 2W25A 2IY5B 2IVFB 4XO0A 4JI5J 2MSTA 3MECB 4MKYA 4CO4A 3DN9A 3LW5C 1MG7A 3Q8VA 4TU8A 2YNFB 3NKYA 1MMNA 1S1WA 2WONA 3IAM9 2F1FA 2GC8A 3BREA 2DNKA 3B78A 2QYCA 4X62F 1CJUB 2ZBRA 2ASJA 2BJ3A 1RWVB 5J2QA 2QLJB 1REVA 4CCHA 2VPZB 4O44B 4CH0S 4ICLB 2KHDA 1VMBA 2MDAA 1UVLA 2AU0A 2C2RA 2ZM6F 1FERA 4Y00A 1T7PA 3IRXA 1BGXT 3AJDA 1OO0B 3HZEA 4CDIA 1KP6A 5KFSA 2OPQB 1CBKA 4ZHRA 1QUVA 2KZZA 5CQGA 2CJXB 3OR1B 2C3UA 1SKSA 4ED4A 2ZH6A 1J27A 2AZ1A 2I6WA 1RE1B 2PE8A 5A8WB 2ILYA 3BV8A 4JV2A 4YHHJ 5KFOA 1QAIA 4YDDB 4QIWD 1PILA 1VHFA 4EO6A 3BJYA 1SC3B 2IYIA 3CXCR 2AJ1A 2ZUGA 1NCLA 1FTRA 2MB0B 4OYMA 3WQPA 2WSEC 1P1LA 1CJVB 3O1LA 4PABA 1N0VC 3I55S 3VTIA 2ZH5A 1PBAA 4IR9A 3OPKA 4ID5A 3VWSA 1HQ2A 1WACA 2DISA 5AXNA 2WB1D 1S1WB 2WONB 4ZN3A 2P8IA 5CCLA 1RWNB 3RW7A 4AL6A 1IR2A 5C7PA 1S7HA 3HF5A 1KTQA 5SUHA 1REVB 4DBQA 5HMZA 3ZC4A 2VONA 2R2TA 4AFFA 2GO8A 2Y3YA 2QFIA 2CPZA 3CCQS 2V68A 2ZJRQ 1PJ6A 2BEFA 2DR9A 3IRXB 1V9OA 1VRQC 3VGVA 4ZHRB 3BO3A 4IOCQ 1PAEX 4DV1J 2KYZA 2ABYA 3VVUA 4I6YA 5DETA 3OD2A 4PG8A 2C2KB 2ZDOA 3JS9A 1H2TZ 1B0VA 4FYVB 2U2FA 3CCJS 2CPYA 2UUWA 3LAMA 3V6KA 3IR5B 4RBUA 2CNKB 5L1KA 1NJXA 4DR4F 1RAOA 5AT1B 2M88A 3T41A 4L72B 1PG5B 1BWEA 2FYXA 1N33F 1T9YA 3MGJA 3PRVA 4QPXA 1U1LA 2VD3A 3V5RA 3HFVA 4LSZB 2G1DA 3BSAA 3MM9A 2IA6A 5B08A 4ID5B 4UY85 4J9UE 4JYAF 1H3DA 3UI3A 4MKVA 1G6BA 2W9BA 2R8HA 4K7QA 1RSCA 2UUAJ 5HJYA 3H98A 2NXCA 3PKYA 3JQMA 3WDOA 2AMCB 3GYXB 1UMJA 4TYAA 2PI5A 4ZITA 3N4WA 5F8IA 2D9PA 3CCUS 3D67A 3GFYA 5IC6B 2YKMA 2DHHA 2DY1A 4ZCLA 3CIZA 3D0HE 2DRBA 4TVAB 4DX7A 3S6EA 2MZ1A 2EEYA 2RUGA 2YWKA 1ZTTA 3NOCA 4ZLNA 3AXKA 1Q8KA 5L38A 2VQEF 2XTJP 1NHKL 2HNDA 5F9LA 3JQKA 3Q2SC 2Z2ZA 2XNQA 1YZ6A 4YB1P 2DCLA 5IT4A 2J0WA 4O3PA 3K17A 3NGKA 2QA2A 1TAQA 2IMWP 4BBYA 4JUZA 2RDIA 3MAQA 1LWXA 5E2QA 3HKZD 1MLAA 1R89A 2DYAA 2FUG9 5KFYA 4C3MA 1B7YB 1H0HB 3V6DA 1XK8A 3EICA 2AJ4A 4DQIA 2L3MA 4ILRA 3UDCA 2FIUA 2BW7A 1H2VZ 4KBIA 3T5JA 2MQLA 1GX6A 2N4DA 2W9BB 3OTOF 2QV6A 2XLIA 1HL6A 3W5ZA 2MEWA 3MTKA 1IBCB 1RAJA 1FESA 1FXRA 4ZVGA 3M8RA 2JVRA 4LIWA 4OIXA 1FNMA 3HJFA 3R5DA 2YKMB 4RBTA 1WC5A 4DFPA 2Z56B 4WPAA 5EGYA 2QLWA 4WFYA 3MUMP 1O5JA 3DLGB 4PQAA 1L5UA 2MJNA 3RJMB 2E29A 4URQU 1HWLA 5D77A 4LFAF 2CPDA 4DL4A 4D3HA 4AE5A 4JI6F 4X65F 4F3MA 2HNDB 1GXTA 2CNOB 3NP5A 2E1RA 4FXWA 2DGTA 3D0GE 2KFZA 2F65A 5IV3A 4R5PA 2G2OA 2MKKA 4LF4F 3KHLA 5JVGQ 1HNWF 4DFKA 1TL7A 4DCPB 4CYUA 1OYEA 3DXSX 4KY3A 4QYRA 4BLGA 2FJBB 4LFBF 4DQQA 3MR7A 3FGVA 1F2GA 4ITSA 1FRMA 1RHQB 4CLLA 4ECVA 1D9AA 4C6AA 2GVZA 4FKYA 3V6DB 2J0XA 5U47A 5D15A 3FUYA 4DV4F 4ECWA 4YR2A 4RW9B 1SUQA 4WBFA 4RUBA 3BDEA 1DARA 3TRGA 3ILOA 1NO8A 4K5RA 3QAEA 2FZKB 3IS9A 2QT7A 4J7CA 5D4PA 2ZFHA 3M2VA 1X5PA 2NCKL 4QR2A 2J9CA 3CJ2A 3I4PA 1V6HA 2BRLA 2FLPA 1TMMA 3H42A 3MCSA 5A8KA 3OSPA 3H8YA 4MK7A 3W63A 3JSYA 3KXDA 1A9NB 1N6QA 1P27B 3NS6A 1TUVA 1RBAA 2QO3A 3GFXA 3K57A 3CVKA 1HI1A 3GJRB 2FJAB 4R5PB 1OQ3A 3HD2A 1EHWA 2AYGA 1HI0P 1TL7B 4CYUB 1MN9A 5J1EA 2WW4A 3QSIA 3FBBA 3M6VA 3PM9A 5L1LA 2GVZB 5B0EA 2Q1LA 5EWFA 3I31A 3EGZA 1F3FA 4TLQA 1SUQB 4J9QA 1OSDA 1M1HA 5KG2A 3EXCX 1NSPA 2YWFA 3MR6A 2OEMA 3IS9B 3O8WA 1JNRB 2UUCJ 2BX6A 5LOQA 3M2VB 1C0UA 2E44A 3DM2A 2HFSA 4KPCA 3CJ3A 1RZMA 1RT6B 3P96A 2OMOA 5I4MA 2J0QD 3ICLA 1RI7A 3TWZA 5A8KB 3I87A 4W4MA 3C66A 2IM0A 2KXFA 4KHPJ 4N8OA 1N6QB 3DMJA 2RILA 3M05A 5E3AA 3VF0B 3AA8A 4B08A 4YEAA 3K5PA 2UXBJ 3CCSS 3HKWA 2NR0A 4OV6A 1IKYA 4DUYJ 4I7FA 4OJHA 3MFHA 4ES1A 3P5TL 2E5GA 1N48A 1YJWS 4RWXA 3H5SA 2MKCA 4E0DA 3KLGA 1H73A 2XS7A 3A8KA 3LALA 3DLEA 1UFKA 2ZOMA 3C16A 3M7VA 5J1EB 2RB7A 1KQFB 1M5PC 4KFBA 2DHAA 3E01A 3P5BP 2QLBB 1RAHB 2QLXA 3M1VA 2H48B 1D3WA 1H98A 2E66A 3MHYA 3G6YA 1S72S 4CWBA 4QQBA 2KFNA 2V0NA 1TU0B 4I4BA 3IR6B 1FK9A 2V9WA 2AYMA 4QPTA 2EK1A 1EQ0A 1S1XA 3H2VE 4C8NA 2ZBCA 3EUNA 4AQYJ 1W2BR 5E3CA 1C0UB 4ED8A 3DM2B 5SZTA 3P3DA 1PC5A 2H9ZA 2OPSA 2CRLA 4PRFA 4MYUA 1RWKB 2W7PA 5EX3A 1EAYC 4ECRA 2DR7A 3FNNA 5HATA 4ALZA 1XWLA 1WKLA 3DFEA 3DMJB 3KHGA 1U09A 3TW0A 2XZTB 4K8RA 6FDRA 2O5DA 1DAXA 4Q8EA 2FPHX 1IKYB 1OYDA 1S79A 4I7FB 4LFCJ 3M8QA 3BKFA 4K4VA 3CJKA 4DV3J 5K20B 2HQCA 5KFAA 2VV5A 4ZOSA 1JJHA 3KLGB 2E7WA 5J2NA 4OI4A 3DLEB 4L73A 2AJ0A 3C16B 1QTNB 1IWGA 3QWPA 2ZJQQ 4KFBB 4YUDA 1XR7A 3E01B 1LNQA 4R0JA 1QTMA 2YVSA 3VALA 5F41A 3GR0A 3ISZA 3SIPB 2EC2A 1FVQA 3TX0A 3M1VB 4ZIWA 5KT5A 2C3YA 5KTQA 1DJ0A 3UDLA 1CJTA 2DO0A 3LAKA 2Y1IA 1B0PA 3N0VA 3OL9A 1FK9B 2HRTA 3E51A 5GAHU 1S1XB 1BD6A 5KG7A 2D1CA 1ZM2A 4JV5J 2B43A 2HHHF 3IMQJ 4G1PA 4DU8A 1M0SA 5IZHA 2HG4A 2YQ3A 2HRUA 2OPSB 5LSOA 3GFHA 5A8RB 3I0RA 3ET6A 1DLOA 2G4BA 3GSIA 5K9FA 2XYPB 2LA4A 3NLCA 2HHWA 3GV7B 3CJ8A 4JI5F 4Q2MA 4A8QA 4IH7A 3OJSA 4K4YA 2VJUA 3D6TB 3M8QB 4BHQA 3S8SA 3MTJA 1KLMA 3CCES 4G6VB 1BQXA 1PAUB 1TR0A 3CJKB 1ITPA 1UP1A 3RAXA 3MM8A 3T1HJ 3TANA 2ZITA 5CD4H 2R3VA 5J2NB 4M5DA 1BUXA 4F36A 3GLJA 2PC6A 1GTHA 2RNEA 2XYHB 2DTJA 1O6XA 3CWJA 3RBZA 2G1HA 1NAQA 1YBTA 2RH3A 3SXLA 2B9WA 1Y11A 1SV5A 1CJTB 4FP9A 1K0VA 2AZ3A 2J7KA 1NK6A 4YHHF 4LBPA 2JDJA 4RW6A 3TAPA 3MXHP 4FVCA 4CLKA 1XMQJ 3VAIA 3TI0A 4WE1A 2LFVA 2X1FA 3U1NA 3VQSA 2LXFA 4OZ0A 4ECQA 1AT1B 2Q6BA 3NG8A 4LR8A 4DQRA 4EI2A 1N5YA 1VQNS 4DR7J 3I0RB 1EB0A 2HK2A 4F7VA 5HVGA 2ZH1A 3ET6B 1DLOB 2AV5A 2G0CA 4DV2J 1U6ZA 2KVQE 4IQMA 2XHCA 3CJ4A 4ZN1A 4C0BA 2ZH3A 1NRKA 2MJUA 3RU0A 3LANA 3N5BA 3ZZPA 2FHMA 4UUXA 4NRUA 2BJ1A 2Z4PA 1L3UA 4Y34A 5CYMA 1KLMB 1FD8A 2D3ZA 4HDHA 3MM8B 1RA6A 2MKHA 4X2BA 3T5HA 4HHUA 2YWGA 1Y5LB 3ONQA 1IQZA 4M5DB 3NAHA 3P8BB 4OYAA 2V2QA 3KK3A 5CH7B 1DZ5A 1GMWD 3DCAA 4F25A 1HWJA 1CULA 3RR8A 1RACB 1T3NA 4JI2J 2UVUA 2W2PP 2D74B 1FI4A 1CJKA 2DRDA 4F0KA 4DS4A 1SV5B 4WFNQ 2PGCA 4DV1F 2AGOA 3EJMA 2RD5C 2QZ8A 5MLCV 4HL9A 3G71S 1SVDA 1RTIA 4ZVUB 4RW6B 4U7UD 1B0TA 3I56S 1N5TA 2KRRA 2OFHX 2E5HA 1F9EB 3I5CA 4WE1B 1KVIA 4ZDNA 4UUWA 1N5YB 2JZ5A 2B8QA 2CQ1A 3KNGA 1RB0A 1QM9A 4I64A 3H0PA 2O01C 3R7NB 2JWNA 3O44A 2BYCA 2JOQA 1G4CA 3AOCA 3GIMA 4DR2J 2RRNA 3PYEA 1FCAA 5CYQA 3VCDA 3I5BA 1UA1A 3JSRA 2PFFB 1SC1B 4CO5A 2QEXS 3IM9A 2V9KA 3I82A 5CYMB 1S1UA 2YNGA 2UUAF 3AOBA 1YDLA 1S9GA 1VQ9S 4LRAA 1GQEA 1SJ3P 1WD6A 2DNPA 5D3GA 2C1EB 3OFHA 5EUHA 4DR1J 3CCRS 4TYBA 5B0AA 4QWCA 4NA3A 4UT4A 3KK3B 5G0RA 3MCMA 1N34J 1CULB 4RLEA 3T5KA 3D7SB 5C42A 4OJ3A 4FF1A 2C42A 2KB2A 4KTQA 4YB6A 2RJZA 2QMXA 2WAQD 5DS7A 2R7OA 1CJKB 2MLZA 2COLA 2JLEA 3OVSA 3SFGA 1WEZA 5I42A 3HT3A 4C8MA 1RTIB 1FRJA 1IXKA 4YB5A 1S1VA 2ZOGA 4FYXB 2FHKA 2K3KA 1V5IB 2R7WA 5KG4A 3BN4A 3I5AA 3M2RA 1KC8T 1LOUA 4DPUA 1WDDA 4UTGA 5K8NA 5I3PA 5LXRA 1L3TA 3LTOA 3H90A 1Q5VA 3POTA 5KOXA 1QAJA 3IGNA 1ZETA 3D68A 1JLGA 1NNDA 4ZLPA 1NK0A 3FZ2A 5CYQB 5KFNA 4HVZA 1U2RA 2Z30B 3W61A 1NPPA 1S1UB 3O6QA 2YNGB 2MSSA 5B09A 1LK5A 1IUJA 1RHRB 1S9GB 2LP4A 2X3GA 3P45B 1JXEA 5HMWA 2AX1A 1I51B 1KLNA 5D3GB 3FSIA 2BXJA 3DLKA 1MU2A 1XR5A 4DSJA 5G0RB 2IA0A 2ALZA 3MZIA 2D3UA 2G2YA 4L75A 2V5HG 5I3QA 3FC9A 5C42B 3RBDA 2YKOA 3G8QA 1VIXA 1Q95G 4DUTA 2BQUA 4HTIA 2E9ZA 1FE4A 5DQGA 3ETOA 4P7TA 2OKQA 2WB4A 1OY8A 4U8VA 1UWAA 1UVMA 4E2FB 5KFUA 2IRUA 5I42B 2XMTA 3AT1B 2MY8A 1S1VB 2PA8D 3ZZTA 2XI2A 2W9CA 2LLZA 3FJ2A 5EX0A 1LEOA 2HLTA 2BZ2A 3M2RB 2HMIA 2FVQA 3JTNA 3CSKA 4CLWA 3THVA 1TVRA 1UVIA 1HNIA 1QY7A 2RMLA 4PG4A 2LA6A 3PW4A 2DNMA 3POTB 2A2DA 2W7OA 2DRAA 1JLGB 2UU9J 1ZYQA 1HW8A 1TAUA 3SDEA 4ZVQB 1YJ9S 4OJ1A 4ZLJA 2MQPA 1S7IA 4XAKA 2O1PA 4WU3A 4CO2A 1UA0A 3CTRA 3FMWA 1NJIT 1WC3A 2CJ9A 2GZOA 5F3TA 2DR6A 3GR1A 4R25A 2YQ0A 2N3LA 3DLKB 1MU2B 1YHQS 5LXYA 4IH6A 2C3MA 2HNZA 2H51B 4ED3A 3WC2A 1EJ7L 5B0FA 1N5VA 4NEYA 4OI6A 4I0WA 1RT4A 2P2CB 2VA3A 2KXHA 3A8EA 3EPGA 3AFGA 2IMOA 2DNYA 4FVMA 5EDWA 1VFJA 2PEHA 3ULHA 3BSNA 3K58A 1M5VC 1NH7A 3DRPA 4A8MP 5KG0A 2W9CB 3C15A 3S7RA 4IO1A 2CKWA 2D9OA 2B4PA 3PYFA 5EHHA 2HMIB 3UD4P 2K2PA 1A0OB 2YY3A 5KFBA 2J9EA 4PKDB 3M30A 3Q0AA 3PKMA 1TVRB 5LSLA 4NLGA 1HNIB 4I2PA 4AYBD 4Q8FA 2NPFA 2FLLA 3G86A 1UZHA 1R31A 3EX7B 3CJRA 3GYNA 2BKNA 1RAGB 3SDEB 3OTEA 4B3RJ 1RCXB 1UEVA 2V69A 1F5BA 4BS2A 2MKJA 1X60A 4OX8A 3QGHA 1ZM4A 3DU5A 1K8AT 3MOJB 3N28A 2HWHA 2CA9A 1FJCA 7FDRA 3QGGA 1GNKA 2EG2A 4Q7AA 2OH2A 1VYAA 1E6YA 3M32A 4PEOA 4ILLA 2HNZB 4GRSA 3UWTA 1IJEB 1RWPB 4WKRA 1RABB 1N36J 1OY6A 1RT4B 1LV5A 3KG4A 4KHPF 5GAHI 2XO7A 2B9XA 3ZTQA 4EBCA 1C0TA 1MSWD 2ILZA 5IWAJ 3PJ9A 1KQSR 3N6MA 3DRPB 2A6OA 3VQTA 3ITHA 2UXBF 4MIWA 5HQMA 4DUYF 3C15B 3UNYA 1VS3A 4ERDA 3MEEA 2YKNA 1F6TA 2AT1B 3B54A 1H38A 1BWVA 4LJMA 3M30B 3M2UA 2NXJA 3JSMA 4I2PB 2FVSA 3B82A 3P49B 2KJVA 2HIYA 2ZHAA 4B3OA 1JKHA 2HLUA 1GAOA 1RWXB 1F1BB 2V8GA 2YBVA 2YWEA 1SKUB 2VG5A 1H6KX 1CEZA 1ZM3A 5LM7E 5HK4A 3PY8A 1WHWA 3ILLA 3AHPA 4P2SA 1WWHA 4AT1B 4AQYF 3CD5A 2VFUA 1UEKA 3FSXA 3OW2R 1E6YB 3M32B 3ZTSA 1HLWA 2NPIA 2AF6A 4LR9A 1T05A 4ATNA 2V63A 4KJIA 1VBKA 5KT3A 1C0TB 2RRAA 4LQ3A 2DH9A 2XMKA 2HS4A 2ASLA 4P71A 4PWUA 3BZQA 4JI4J 4JV0A 3GZ7A 2M4MA 3ITHB 4NMLA 4XDCA 5DO2A 3R7SB 4OI2A 3G6ES 4LFCF 2W4PA 3PW2A 3MEEB 1XERA 2YKNB 3UCGA 4DV3F 2BOAA 2BM1A 1ZAWA 1SQFA 3M2UB 3JSMB 1X4BA 3A3PB 5E7OB 2I5JA 4XIUA 5K8MA 4IKAA 1HHTP 5B7WA 4TU9A 4B3OB 1WG4A 2QTWA 1AW0A 1JKHB 1U1NA 1T0TV 4C4WA 4GC6A 3CO0P 4DG1A 2GV1A 2VG5B 4USJC 2UXDJ 2CQGA 1X4GA 4LF5J 3CD6S 2HWIA 4GKKJ 4ZLLA 3GTYX 4L6V3 2RQKA 5LMUJ 1TUGB 5D4OA 3CC2S 4JV5F 3I9V9 2VBZA 1T05B 1RK8A 4C11A 3W8GA 2AJQA 1U1KA 2XY7A 1G3OA 4IG3A 3ZZOA 5GMDA 2XLJA 2LEBA 1ZPVA 1RWWB 2R7QA 4QWBA 3ZZRA 4Q44A 2DPJA 4Y0FA 4AL7A 5M2UA 3W8PA 3Q2TC 4NLPA 1LW2A 1YRXA 1RT1A 4OZLA 3HSDA 2CJYB 1YLXA 2JLGA 4USVA 2XCPA 1PKUA 2X7IA 2V94A 3CE8A 3SSQA 4ZVSB 5T7LA 1U49A 3RW6A 5GMKa 2VPXB 3BN7A 3C8YA 1CS4A 2I5JB 4IOAQ 4V19X 2L41A 4G1IA 1RQ0A 2WSFC 1Z2ZA 5ETNA 1H74A 2VKRA 4MFBA 3FKBA 1S9EA 3N6NA 3SZ2A 1KHVA 2V8PA 1XMBA 5A76A 4AUKA 1DQ8A 2BKPA 3HZGA 4DG1B 2BOPA 4X66J 3UFCX 1ZZFA 3GP9A 3HXMA 1NDCA 2OPPA 2JC1A 3D1QA 2JNJA 1AYEA 2RT3A 5B0BA 1XMQF 3NNCA 4OZNA 1HBUA 2VBYA 2N82B 2CQHA 4C11B 1NDPA 3UR3C 2QMUB 4DR7F 3OVBA 4IG3B 2AEJA 1DURA 4WU2A 1KFSA 3KKFA 3EE3A 2IJNA 3TAQA 3SV3A 2MGZA 3TARA 2B5JA 4KC5A 1ROFA 1IKVA 2VHGA 1QDUB 1T9TA 1LW2B 4ED2A 1RT1B 3TEHB 2ZNYA 3MAHA 4EYHB 2KFYA 2ZH9A 5F0UA 1SPBP 4HT7A 5T7LB 5L8RC 2Q6CA 4YP3A 3KJVA 2AGPA 4P72A 4K50A 1CS4B 2CFXA 3D9BA 4RNFA 2EFQA 2Z2YB 4ENOA 1R43A 3R5BA 5L9NA 1FDAA 4B3SJ 5FIIA 2V2VA 1E6VA 1JXVA 3QT8A 4MFBB 4L3KA 4MH8A 1S9EB 2EFGA 1R8AA 4JI2F 1TELA 3OUYA 4KGXB 1FDBA 1YSJA 3CCMS 4WTYA 3RAQA 2QL9B 2DGUA 2OPPB 2MPUA 2GCFA 4OQJA 4HACA 4ID8A 4CH7A 3KDNA 1HBUB 2GX8A 1FJ7A 2CIMA 2FC8A 3Q8RB 1DBDA 2ACYA 4A8KA 1CLFA 5E3RA 3PIPQ 2PDAA 1U26A 1O0PA 4PAAA 1SC6A 2JL9A 4J5OA 4DZ6A 1N52B 4NLSA 4OYXA 2UZAA 1FFWB 4NXNJ 1TKXA 2Y1LB 4U96A 2HVDA 4IYQA 8AT1B 2MGZB 5HL7Q 4DR2F 2B5JB 3D28A 3DDNA 4OI0A 2VFTA 2IM3A 1HPZA 5KG6A 2YX7A 2LDIA 2MKIA 3CDAA 2M8HA 3EXYA 1S49A 1S1TA 5D0RA 2GJIA 4OMFG 1MWZA 4F04B 2HHXA 2F8HA 3KJVB 2UXCJ 1N32J 3S01A 4ELUA 4TN2A 2UUBJ 4DR1F 4ZVEA 1YI2S 3BKUA 2DT9A 4Q5VA 1N34F 1E6VB 3VHQA 4A4JA 6FD1A 2KU7A 1D09B 3LGNA 4J90A 3OUYB 3AJ1A 1U48A 2RQCA 4QJVA 1VLYA 2E1PA 3H4BA 3W9IA 3PR4A 1Z2LA 5ETPA 3IRWP 2RS2A 3C14A 1URRA 3VAMA 4OYPA 3V4MA 4HACB 4TNOA 2YNIA 2FZCB 2P9CA 2XLKA 1S0MA 2IJRA 1U0HA 2FHOB 2AGQA 4C3LA 4C9DA 1S59A 5KFGA 3RAMA 4NLXA 1DFDA 2IM1A 2MMYA 1LFWA 2X51A 1QLNA 2R8IA 4Y2AA 2V2ZA 1TKXB 1RP5A 1Q81T 1OSCA 4DF4A 2KG1A 3CO9A 3FBFA 1HPZB 1VR6A 2M2BA 3Q8PB 3UPFA 2R7SA 3VVTA 1X4DA 1Y00A 1X31C 1S1TB 1WC0A 3AXMA 3VGUA 2BV3A 4MK9A 1IM6A 4P2MA 2WK4A 5HVHA 1LWFA 4AD6A 4DSIA 1LWEA 3UQSA 3MEGA 3HSJA 3FFIA 3JSBA 4NLWA 1YTYA 1RCOB 1ZS6A 1T95A 4IR1A 1NH8A 3C14B 2RE1A 4N77A 1NPRA 2YNIB 4IQXA 2EWHA 3GB0A 1U0HB 4JI8J 2AX0A 4AXIA 2CXEA 4I6WA 1TMJA 1JIHA 3EPIA 2GMJA 2F7VA 2HBYB 3CJ5A 1RJJA 5IXUA 3LGMA 2J6UA 4PXCA 2C2NA 4W92B 1RKIA 2DHGA 4ZVFA 3HVWA 4RNMA 3BS9A 3T6JA 4GVBA 2XMAA 3LWLA 1NKEA 1CSJA 4ZPVR 4K4XA 3C6TA 4UQTA 2BJ9A 4RPFA 2UU9F 3QGIA 2HQIA 3BGFA 1NJYA 3J7A1 4YN3B 4X4VA 3ZTPA 2HBRB 1X9WA 2IM2A 4EU0A 1RT7A 2I9SA 3HSZA 3CDUA 1IR1A 4NLYA 1LWFB 3MM7A 4OZ2A 5KAKA 2R7UA 1LWEB 4QR0A 4Q45A 4PWDA 4DV0J 3H20A 1TK8A 3MMBA 1LFPA 4NWBA 1XTZA 3MEGB 3FFIB 1JWWA 3RUBL 4OYIA 5LSRA 5K8OA 1KVJA 2AEFA 3QAUA 4KH1B 2F9JA 3VV2B 2Q79A 4LSNA 5ETOA 3QSYB 3U1MA 4WK3A 3PFEA 2DNZA 2V6AA 1ZA1B 2DHSA 4O0IA 3FEYB 2XQCA 3WIUA 1XNQJ 5EN1A 3AA9A 1AA1B 2HIQA 3DYAA 4M5MA 2HZVA 1RHJB 4TQRA 2E5LJ 5HSPA 2CJBA 2X1GA 2WW8A 1K44A 1MN7A 3RB6A 1W26A 3L95X 3W2WA 3DHWC 4GVBB 4DFMA 2ZWOA 3C6TB 1U24A 3BGRA 3RTVA 4UW2A 1XR6A 2LU2A 3LP2A 2HAFA 2FGCA 2L9NA 1U45A 1RT7B 3CULA 3BGLA 3LPEA 1SH2A 3UE2A 3ZFVA 4W98A 3MM7B 4TKTA 1WC4A 5MAOA 1NU4A 4PWDB 3R8YA 1VQMS 1DY3A 2WCXA 3MMBB 1NSQA 1U1PA 1P9YA 4O0NA 1N36F 4JP8A 2OMLA 1B4SA 1FWLA 1LK7A 4DV6J 2G13A 2CPEA 4LSNB 5IWAF 2OEKA 3O2IA 2OSRA 4F4YA 4F26A 2MHEA 4QIVA 3AB2B 3ZNJ1 2AJFE 1IBLJ 4LF9J 2HQDA 3DYAB 4DWIA 4ECTA 3PX4A 3MFIA 1WNEA 5I3UA 2DH7A 2DITA 5L1IA 2MQMA 1ICEB 1FRXA 2R8JA 3U27A 4ED6A 4ZVRB 3W2WB 3V2UC 1RT5A 4NYZA 5FLXU 2JFDA 4ZMMA 3C6UA 1L3KA 2JEGA 5HMYA 1OPZA 3BGRB 3GJTB 3DC2A 2LXUA 2B4OA 1BXNA 4DQPA 3LP2B 3M9OB 4IH5A 2KI2A 1GMVA 1UVNA 3RB4A 2IIHA 2CQBA 4PCQA 4DPTA 1P9QC 2OO4A 4C97A 1O8BA 5GVQA 5AXMA 1LW0A 3PJXA 4M5GA 1TKZA 3I6PA 1SBRA 5LJ3Y 3D2WA 1IKXA 2LEAA 4Y3CA 1ZTWA 3PHEA 5CABA 4WFZA 2OTLS 5DGBA 2YKPA 3GFZA 3NS7B 4JI4F 3NGSA 2UV8G 3WC0A 3TA2A 2LQ5A 3NWGA 4UZCA 2DHXA 1BC6A 1FDDA 4P73A 1WKJA 3MEKA 2CQPA 3NMAA 2GAHC 5I3UB 1RGVA 4EBDA 4O3SA 4MKAA 3CPWR 4KPYA 5KFMA 4QYZJ 2LVWA 4MYTA 2B56A 4O23A 5HANA 5DM6Q 1RT5B 2OP5A 2VJVA 2YPYA 3C6UB 2AWZA 4HT5A 3IR7B 2B7CB 1FX2A 3KLIA 5F3ZA 3F56A 4DLGA 1KEKA 4NOHA 2ZVSA 4I56A 2BA9A 5FDLA 2CG4A 3OXGA 4GKKF 1X0FA 3CMAS 4RWWA 2P5VA 2PMHA 2W1BA 5LMUF 4HEA9 3K2YA 1DHMA 1LW0B 2CPXA 9RUBA 1JLAA 1TKZB 4WKYA 2B4VA 4NLRA 1IKXB 3RB0A 3VZIA 2E7VA 2XGQA 2UVVA 4F2SA 2EC0A 1PYTA 4F0MA 1K1SA 3PVXA 5IV4A 1NMEB 3TZWA 3VR1A 5F9NA 5IQ6A 5IT9U 1FX4A 4PXDA 2APOA 1WDTA 1WI8A 2ZD1B 4DPOA 1SIZA 2KT3A 1WEXA 1JLFA 3DRXA 4P9SA 4OFZA 2HHTA 2EG1A 2NXEA 4KV8A 2A3JA 4B9LA 2MLYA 2XCAA 2BKOA 3VZHA 4HLBA 1EQMA 1MW7A 4RUAA 3LWMA 3K5NA 3HULA 5CCMA 4K2JA 3MR5A 3QATA 1VBXA 2D3OR 3HO1A 1JXLA 3CD7A 4LQ9A 5KFXA 3KLIB 3D6HB 4PYAA 5D78A 3JXOA 3VAKA 1D8YA 3IBWA 4X66F 1NK4A 5FDLB 2W01A 3JTOA 4TLRA 2B7BB 1HKAA 2VL1A 2J6TA 3F41A 2KHCA 3L3CA 1JLAB 1FNXH 5F8LA 1I5OB 5ETRA 5KT2A 3F0NA 2QE5A 2VASA 4FXDA 1N4LA 4B9NA 2W4DA 4F4KA 3K8WA 5E0OA 1SC4B 2H5EA 2ZH7A 2VKZG 3A12A 4JI0J 1HD0A 2F5GA 2CWKA 3OTBA 4ZA1A 2GS8A 4B9SA 4QYZK 5GAGI 4LF8J 1JLFB 4PXBA 4PXEA 4LBIA 2FLNA 3B4MA 4ZPCA 1TUWA 4ECXA 4KV8B 3OBIA 3BM7A 3IBFB 3W7BA 5L39A 1ZAXA 2DNGA 2M5YA 4UY8T 3MM6A 2ZC4A 3MM5A 3IO1A 1TL4A 4B3SF 1Y5IB 3KUGA 3PDNA 2ROGA 2V2KA 5CYJA 2O66A 4U8YA 2RSQA 2DXFA 2OFGX 2MZTA 4HI2A 3DHXA 1OY9A 2BBEA 5KFRA 4OX9J 4X64J 3DLGA 1WELA 2BJEA 2IC3A 3J7Z5 1RAFB 3PHTA 5DLGA 1UEUA 2CPIA 2VBXA 4PG7A 3NGUA 3J80Y 3KG0A 2AYBA 2ZC3A 4ES2A 2C2DA 2AJ2A 2RKIA 4LF7J 1Y10A 2DNQA 2ASYA 3QT5A 4I2QA 2B51A 1NPKA 3H5UA 1YWXA 2XY6A 5D0HA 4S0MA 1NKCA 4NXNF 4JI3J 3ZZZA 1ZZNA 1GT8A 3I32A 2V67A 1ZA2B 1TFYA 2H3EB 1XN9A 1N0UA 4RW9A 2VA2A 5KFPA 4RNOA 1AZSA 5FD1A 2CJKA 1RU2A 3NNAA 2JVOA 4DSFA 4RNNA 2UXCF 1N32F 2I8EA 2V4QA 4OYWA 2UUBF 1V3ZA 2V8VA 3MM6B 1YJTA 2EFPA 1WJ9A 3MM5B 3F73A 1SJ1A 3BEGB 3G2XA 2AP6A 2XEXA 1S77D 3TAMA 2HQGA 2EXUA 1OPIA 1TL3A 2YKAA 1U25A 3EVOA 3VGSA 3D1OA 2AEMA 2XI3A 3LO3A 3M8YA 3BH7B 4IG0A 5IC4B 3RBEA 2IHR1 2DNLA 1HWIA 1YVFA 2IC3B 5KOWA 2GHVC 1SJ4P 1U0SA 3T1AA 3FQKA 2OGUA 2PEBA 2HPUA 1NK8A 3BPSP 2R4FA 4N8NA 1YKWA 2MQ8A 2FY8A 3ENAA 1PCAA 2JEFA 4K4ZA 1WSRA 2RKIB 3SMZA 3HMJG 1R8CA 1PBUA 3PX6A 4I2QB 2J0SD 4DOZA 1HBMA 4OYOA 3V4IA 3H7HB 2GIQA 1UW9A 2YX4A 4LSLA 3N6LA 3PG9A 4C0HA 2EPIA 3R2CJ 4E8UA 1QJHA 1AZSB 1X9MA 4D3GA 1NLKL 1Y5NB 3QFHA 1SL2A 2GO9A 1QSLA 1ULRA 3W2VA 3DNCA 2XULA 2OSQA 5THWA 2OIHA 3Q24A 3D3CJ 5KFZA 2LYVA 1RT6A 3TAMB 1KBRA 2OUGA 1TL3B 1GTEA 2BDPA 3R5GA 5D0GA 2NSBA 1KN6A 1U1MA 4IG0B 3CCTA 2Y1JA 4PQUA 3ADAC 3C46A 3PRDA 4QU7A 3DXBA 4FYDA 4F02A 1G1XA 4LFAJ 2YH0A 4OZ1A 4JI8F 3QFWA 2O3DA 3KFWX 4L76A 4EZ6A 2JC0A 4IRCA 3NGRA 3FRYA 1WG5A 5CZXA 3AB4B 2KT2A 4NXMJ 2A2CA 3D4JA 4JI1J 3TUIC 4DDFA 3NEKA 2XNRA 1F9FA 5J2MA 4F8RA 1MMDA 3WX4A 3R1HA 3O3LA 3J81Y 3G8SA 1Q4RA 4WFBQ 1HBMB 3GE9A 3V4IB 1Y4ZB 5CXTA 3DOLA 3WIVA 1WKKA 2KG0A 1DTQA 5KFLA 4LSLB 1RKJA 1S9FA 3PACA 4ZP8A 3KTQA 4P74A 2JFKA 1NSKL 4OHYA 1ACMB 3GCWP 2HGMA 1T9VA 2DCUB 4WFXA 4ZP9A 4R0EA 3X1LB 1VQPS 4ER8A 4EZ9A 4USHA 4WXOA 3AAWB 3W2VB 1YBAA 2NXNA 4NEZA 4O3NA 1HQEA 4QIEA 1HYSA 1YGYA 1GEHA 1R7IA 4DV0F 1URNA 5LMNJ 4PWWA 4IFYA 2N3OA 2DKOB 2OHDA 1YRTA 1FEHA 4CM2A 3Q8UA 1YJVA 5T41A 4B9MA 5EWGA 1SQGA 3VAFA 1XC9A 3EVWA 1VK8A 4NZ7A 1RYRA 4PQUB 1KQKA 3KLHA 5IOLA 3HVTA 3NGTA 2BJ7A 1T9UA 2QL5B 1WHVA 1LQ9A 2VPYB 1XNQF 1IBKJ 4OHZA 4KE5A 2DB1A 2QLFB 4I6AA 5F8HA 1S6UA 2IVYA 1U8WA 3H4DA 4NLTA 2BE7D 5HJXA 2I1RA 1HNXJ 2UV8A 5J2MB 1JX4A 2D69A 3PIOQ 2HFUA 2VODA 5HBMA 3SQGA 1NHVA 3DOLB 3ENQA 3FVYA 2FJXA 1HBNA 1W7WA 1DTQB 1IVZA 1NBEB 5IM0A 1S5ZA 1IM4A 1S10A 5KG5A 3R5AA 3C3LA 3DGPA 1J2VA 3DKDA 3EVMA 3VAHA 3B8HA 3DOMA 3EGNA 2V4RA 3SCIE 5JJBA 1T94A 5E33A 1H72C 1HQEB 1KHWA 1HYSB 3OL6A 4BWJA 1U4BA 1GH8A 4IFYB 4FF2A 4O3OA 4DMZA 4A8WA 4USKA 4C48A 2IJFA 3LF0A 3B4DA 3TJAA 3FSYA 1TZ0A 5A8RA 4C8YA 4DV6F 3THPA 4HH0A 3CCZA 3TVYA 5C24A 2XSJA 2DVIA 1RU1A 3PTWA 3ZZ0A 3KLHB 3PYGA 3FCHA 3HVTB 3KUHA 1ZPWX 1FXDA 2R7TA 3BR9A 4ZVOB 2MXYA 5L9XA 3EZUA 4A8YA 4RJVA 2ATCB 2MKYA 4TXSA 1IBLF 4LF9F 2FVCA 4C8ZA 4KHMA 2A1BA 3J81j 2C2EA 3PW7A 4B9UA 2HZCA 4MTPA 4F2RA 3K7RA 3TZXA 2HZAA 4RNHA 3J7YU 2YH1A 4ELTA 4NYPA 2PMZD 3OHBA 3NMRA 1KVKA 5HBMB 3LP0A 2Z2LA 3SQGB 4ZJLA 4CLFA 4EWTA 3GIKA 1M1GA 4CP5A 3G87A 4QW8A 4Y2CA 1HBNB 2XB2D 4X4OA 5DZ6A 5IM0B 2DR8A 4USMA 3BQ0A 2BM0A 4QOTA 4DI6A 4UOFA 1RAIB 2U1AA 1RWMB 3DGPB 2FHJA 4MT1A 1HHSA 1BHNA 2H1YA 3DOMB 2M7SA 1JJCB 1ZOTA 3L7UA 3ZO7A 5E41A 2ZBIA 2GNKA 1FRKA 3CDWA 3EGWB 4F4ZA 2F4FA 1GMWA 5AE3A 1SL1A 1LKZA 3CEDA 1NHUA 4LVNP 3MEDA 4BCAA 1FA0A 2FB0A 1SB6A 3ZZUA 2KKHA 3KK2A 1WOOA 3NAIA 4U9RA 4ZVTB 3BSOA 5C24B 5JMNA 2XSJB 1V3RA 4EGLA 1X4HA 4WYLA 2WBMA 2GAGC 4X4PA 1GMUA 4FPRA 2FD2A 2BJ8A 1KR4A 2BE2A 3X3UA 2MZJA 5DM7Q 4C0OC 1FD2A 2KTQA 2DNNA 2HEKA 5IT0A 1VQ7S 2K1RA 3E3XA 1R8PA 2CUYA 1RYSA 4C8LA 4F50A 1WTFA 2J9DE 5E5NA 3MURP 2VDHA 1WTBA 3RRKA 2IRXA 3LP0B 4C8OA 3IM8A 3PCOB 1QD1A 4OLOA 4Y2KA 1JLCA 3B6BA 2CQ3A 4DSEA 3ETMA 1SKRA 2MZSA 2PIIA 2K8GA 3HHKA 4B3MJ 4NI2B 2RHQB 4WIQA 1R3NA 2ZNZA 4NA1A 1JJ2R 2K7KA 2JLFA 1IBMJ 3TR5A 1VQ5S 4QCLA 2B9YA 2NLWA 3ZTOA 1K47A 4F0HA 2V8HA 2C28A 3MEDB 2N7CA 1I6JA 3KK2B 2R8GA 3OJUA 2NYHA 1YJ7A 4NE9C 2V50A 4QWEA 2RQ4A 3TOQA 1DTTA 3QT6A 4Y2IA 3DGVA 4XPCA 2Q43A 4FZVA 5ETLA 2A0FB 4ZK7M 3J80U 1QSYA 4XDDA 2BE2B 3LH2S 4MMOA 5DQIA 2K1RB 4DPXA 2GFFA 1SKWA 5HAOA 3T3FA 2FHJD 2E7XA 2LECA 5DG7A 1VQOS 4MK8A 2H54B 4R8UB 2IBOA 2ZHBA 2XS5A 1CG2A 1YJNS 2VPWB 3DLJA 3AY0A 4FYWB 4OHVA 1FO1A 1FKOA 1NB7A 1W2IA 1JLCB 3UN3A 1S57A 3BH6B 4K4TA 4KAIA 2HHQA 3DLBA 4CT9A 4OZ5A 1VBYA 3MF5A 4KO0A 4UZBA 1C2PA 3M8WA 3QJLA 4CNZA 3S1TA 3NXZA 4OZ3A 2H65B 5HN0A 2LQJA 1VRTA 2J5AA 2Z57B 3NRBA 4G1QA 5ETSA 3SBMA 5DQHA 4MIBA 2OD6A 4CLTA 3CW2C 5RUBA 1OS5A 3ZNUA 1SIWB 2E5JA 1VQ6S 3UO0A 3QZ8A 4U7CA 1PJ7A 1RTHA 2CQ2A 1WF0A 2QYGA 3H2UB 2RS8A 2MHNA 1DTTB 2B6AA 4JI0F 4WP9A 1S6OA 2W2OP 4C7QA 2DGOA 4Q0BA 4AL5A 1REGX 2M9KA 4OLPA 2WHOA 4LF8F 3GWCA 1TL1A 4ANEA 5HQ8A 4C98A 1TFWA 2R8KA 4HH1A 5DRKA 5HVFA 3KMQA 5J2QB 1U1QA 3GJSB 2EFOA 4P2FA 5JXSA 4U67Q 5KT6A 2DO4A 3N5FA 3MMJA 2BRKA 5ETTA 3AD8C 2EBGA 5D6GA 1VIOA 1S4FA 1FKOB 2JJ4D 3BQ2A 2HQFA 3DDIA 1RTJA 4LMZA 2BE9B 2KJWA 3CF5Q 3R1LA 2DIUA 1EP4A 2Q3PA 4KO0B 1N5SA 4OX9F 4X64F 2M0GB 1R6VA 5DDOC 3PEHA 2CADA 4OV1A 5GADU 2ERRA 3Q8SB 3KG1A 4K0KJ 4NRTA 2B9EA 4WF9Q 1VRTB 3FEXB 1WF1A 2SXLA 4G1QB 4ILMA 4GKJJ 2DXDA 1T11A 1EARA 2KO1A 1G7CB 1QAYA 4LF7F 1TK5A 2YXLA 2ZJPQ 1FJGJ 3H5XA 1C4CA 3M6WA 3KJNB 3D1HA 5L1JA 1RTHB 4CLUA 4TY8A 5KFCA 2MY7A 2VG7A 2FDNA 3LPYA 1S76D 4DN0A 5CD4A 2LMIA 3LUYA 4JI3F 2IVMA 2NSCA 1JK9B 2B6AB 2BANA 3WBZA 3JAMY 3V6HA 3W5XA 4Q0BB 1KFDA 5HMXA 2ASDA 3D54A 1HHQA 5BJRA 1WSVA 4J91A 4GVLA 3CIMA 2R7RA 2B4UA 5IS2A 1TL1B 5T14A 2LQBA 3DDKA 1UETA 3L9ZA 2RDDA 4O3RA 2OI2A 2JEJA 3M6UA 3J81U 5K5MA 4AXJA 1HFEL 4OI3A 1X5TA 1MMLA 4I68A 1RISA 3GIIA 2M3DA 2QC3A 3NWRA 2LQ9A 1KNZA 1HI8A 4GO7X 2WVFA 1RTJB 3KOAA 1SI9A 1EP4B 1RLCL 1UVJA 1UAWA 2VB6A 4IRKA 2VOPA 4JOUA 4L3NA 3GIJA 1SQEA 2BVZA 1KOOA 3CD0A 2G9OA 4ZVHA 3GQCA 1FHTA 4M1KA 2KRBA 2DH8A 3D66A 2X1BA 2PO4A 1HWKA 2MYFA 4FF3A 4A8OA 4TQSA 2BACA 8ATCB 3TUZC 4PYDA 1JLEA 3A3OB 3U02A 3OHAA 1WUUA 3H25A 4CNYA 4USWA 3HFKA 4TY8B 2D7SA 3M9MB 2VG7B 1UJ5A 5KFWA 3CMES 4LUBA 3QNWB 3BBCA 5KG1A 4DX8H 1RT2A 2BANB 3N01A 4YDXA 3MM9B 4K2XA 3GILA 2KN4A 4CO3A 5A6PA 4RW7A 1KD1T 3DLHA 4N76A 3DRYA 3R9LA 1X8DA 5D4LA 2CDRB 3GV5B 4WP8A 1KTVA 1RLDA 1FVSA 3F44A 1KDNA 4M5IA 1QUPA 4DQSA 1RAAB 3DOKA 2YQ1A 4FXVA 4DV5J 3EM1A 1P6TA 2AYEA 5ETMA 4F4WA 2CZ9A 2AIRB 4XPEA 1YK9A 3M8PA 3QJPA 3EZOA 3HX9A 3RYLA 3MPUB 4H54A 4TY9A 5KG3A 4M95A 3RZAA 5KFQA 4LF6J 1BQNA 2BJDA 2VF3A 1NEEA 5GAEU 2XS2A 3MOZA 4N41A 3M4XA 2QN6B 2EFVA 2D41A 3MCNA 5C2CA 1R6YA 1JLEB 3UD5A 1X4FA 4CLPA 4NXMF 2FVRA 2Y1RI 3FDSA 2KM8B 1B70B 4JI1F 1JB0C 3AODA 3IFEA 1O51A 4QBUA 2XZDB 4ZCMA 1RT2B 2QA1A 3G4SS 2VC0A 2EK6A 3MD1A 2L9WA 2DGSA 2G2ZA 3PO5A 2GA7A 3RGIA 4NASA 3UDVA 3J7YI 2CDQA 5B0CA 2LXIA 1SJFA 3CC7S 3H40A 1VI7A 4RW7B 1D0EA 4EK2A 3K59A 3T6BA 3KMSA 1YZ7A 4K59A 1T3OA 2IFXA 3DOKB 2UUCF 2XYGB 3G9CA 3K8VA 3SCLE 3K89A 5LMNF 1WOSA 3M8PB 5JUMA 4ETZA 2CPFA 3HHDA 1FJEB 1S48A 4HKQA 1CC7A 4KB7A 4DEZA 4MJKA 3KUEA 3V6JA 4ED0A 4KKOA 1PIEA 1BQNB 1HQUA 4DCJB 3OL8A 2UVRA 5DGAA 1A6LA 2FJDB 3C2PA 3QLHA 4FNHA 2PD1A 4ZVPB 2GJ2A 1IBKF 2CZ4A 4LT6A 1FXLA 4DL3A 3THTA 1GX5A 4A47A 1HNXF 1R0CB 1VQKS 4C8KA 3QRRA 1HBOA 1FE0A 4ZJQA 1S6QA 4KSEB 4YOEA 3MUVP 4BDPA 5KFDA 3Q23A 1B3TA 2VFRA 4DF8A 1U1RA 5F8GA 2GMHA 1ZAVA 2HVIA 2I2YA 1WOPA 1Q7LB 1KRPA 2DNRA 2W2QP 3MMAA 3AJ2A 1Y0HA 3FQLA 1B99A 2C3OA 3T9ZA 1ELOA 2V34A 4N7TA 1S12A 4RR5A 2YX1A 1Y9OA 3MPVA 2M52A 4J9NA 1IR0A 1Q78A 4ETXA 3HT0A 1UWBA 4DL5A 2HAIA 3G82A 4DL7A 3KK1A 2EW9A 2XMWA 2GJFA 1W25A 3AD7C 2BMBA 3OFGA 3SFUA 1S0OA 4KKOB 1HQUB 2BQ3A 1S0VA 3IWLA 3LGHA 3MAAA 3PFOA 4K4UA 3QLHB 4Y2MA 5AXLA 2DGWA 3TJ9A 4LIRA 5K8PA 7FD1A 5LJ5Y 1M90T 4CQ1A 3DRRA 1X4EA 4A48A 1CPZA 3W5YA 4QR1A 4BC9A 2J6SA 1Z4UA 2YNHA 3N79A 1HBOB 1S6QB 4YB7A 3E2EA 2KH9A 2F9DA 1OIAA 2ZDPA 3IXQA 1VC0A 3W64A 7AT1B 4JI7J 3GPAA 2E5IA 2KDOA 3G6VA 2WSCC 3MMAB 4E98A 1Q86T 2GQ2A 3CDBA 2FGOA 4A46A 4RKUC 1VQLS 2AW0A 1FKPA 1NDKA 2VDIA 2CNNB 5KFTA 3C19A 2CWXA 1UWBB 5E3QA 3BDPA 3UNGC 2HFOA 4PPDA 1TTHB 3G82B 3OR2A 2AD9A 1RWOB 2CJAA 3OQ2A 3KK1B 2KM8C 3A1YG 3PO4A 2L9DA 2XG8A 5A6WA 4CLYA 4FPIA 1FRLA 1FWPA 3MAAB 2XMVA 2ZZTA 1RAEB 2MQNA 2HQ3A 3DRRB 3D3BJ 2VU5A 4J9MA 1M5OC 2YNHB 3T1HF 4DR6J 4OHXA 1VK3A 1NK7A 2KVIA 4F67A 4QW9A 3OXFA 3AOAA 5DDQC 4PG5A 4HTJA 3SYZA 2RF2A 1HIYA 3BGUA 2JRSA 2MTLA 2IDEA 2YPZA 4KH0B 3HLUA 2NQPA 4B3MF 4LVOP 2BQRA 3BO2A 2W7AA 2M8DB 3PXGa 1NK5A 3L7PA 3Q86A 1U7LA 4ZIVA 3AQPA 3KYLA 5B0GA 1R8HA 3CMQA 1I94J 4DR3J 1VQ4S 3DRSA 3TQ1A 1IBMF 1FKPB 2RU3A 2EVZA 2DPIA 5BYSA 1PYOB 5GMEA 3JQJA 3BBFA 3OR2B 3QGPA 4FS2A 4LRDA 5GADI 3LQVA 1XQIA 4DV2F 4J9KA 5HP1A 5C5JA 2PSZA 3WX8A 3V81A 2ZUAA 3R5CA 6AT1B 3HHLA 4DL2A 4KRWA 3MPYA 2F3JA 4DV7J 4FBTA 4QWAA 2D3O1 1VC5A 3MD3A 1NJWA 1CC8A 3GONA 1WHXA 4HYKA 3TVKA 1SJRA 4YFUA 1RA7A 3MCOA 4M8LA 3W1YC 1FT8A 2GHPA 3IGVA 5KFJA 4YQWA 3W9JA 2CQ4A 1NJZA 3JAMU 2HK3A 2L48A 1VQSA 2FTRA 2HHPA 3TNVA 1F5CA 1F0XA 1NSAA 3PV8A 3UN2A 2RF2B 3T1YJ 4B9TA 1YG0A 3GMGA 5D0EA 5M2PA 1VGYA 4DSKA 1HMVA 5BXIA 2GQQA 2M70A 3QO9A 4X4UA 4OYBA 2DEIA 1DQ9A 3UR0A 3A3NB 1Q5YA 3KLVA 4KIAA 4PUOA 2R2UA 4IOBA 3DRSB 1OMSA 3A8JA 2CJQA 3UDEA 1IJFB 2ADCA 4FYYB 4CH1A 3WHIA 5KFIA 3FEZA 3OSNA 1K9MT 3A4TA 2K7JA 4YR0A 3MUTP 1FRHA 2FJEB 4USUA 3KHHA 1RHMB 5HP1B 2ROEA 4DS5A 3V81B 3PRBA 5ETVA 3ISND 4OX6A 3HHLB 3NCPA 4EYIB 3CGIA 3Q8QB 4ED5A 1LXJA 2OAUA 4ANCA 1B7FA 4TU7A 1A7GE 2IPOB 4URGA 1J5OA 4Q2LA 1OJ4A 2JSXA 4B02A 3W65A 4NL5A 1Q16B 2Z8QA 1S6PA 1TKDA 5JVHQ 3NY0A 4ZKAA 1N54B 1HMVB 5CAAA 3QO9B 4ECSA 2FJWA 3FZBA 3IP0A 1RDRA 2QSWA 4K0KF 4PUOB 1IQTA 1TQLA 3HHLD 1VCTA 4HHHA 3T5LA 2ZE2A 4EUVA 4GKJF 3O5TB 4LR7A 4UF4A 2B0GA 5ITHA 3CJQA 4FS1A 4B9VA 3NCQA 5GAEI 1FJGF 4KHRA 1NM2A 3NNHA 4CI0B 1Q7YT 2GGPA 2LCWA 5GAGU 2K3IA 1H7WA 2ZWPA 3KNAA 1GXUA 2GVDA 4LRFA 3GV8B 1F2HA 2Y8WA 4A8SA 5M2RA 1J5EJ 2E9TA 1XMOJ 3BKTA 1CQMA 3R2DJ 4YS2A 1RBLA 2P6TA 3W3SA 3ENWA 4P7VA 3BF4A 1LXNA 4B17A 1F60B 4NCGA 3OV7A 3TUJC 2OTJS 1JJ4A 4USTA 2Y0SD 1J5OB 5HLFA 2FJVA 2QL7B
chains in the Genus database with same CATH topology
3FBFA 4EK2A 4UOGA 1F6TA 3Q83A 4DI6A 3ZTRA 3Q8UA 3B54A 4UOFA 2DXDA 1XQIA 3VVTA 5CAAA 2BX6A 3EVWA 3FC9A 3FCVA 1BHNA 5C7PA 3B6BA 3WX8A 5CABA 5IOLA 4DUTA 3NGTA 1LWXA 2ZUAA 3L7UA 2B8QA 3NGRA 3VGUA 3ETMA 4KPCA 2VU5A 2DYAA 1K44A 1MN7A 1NDPA 1B99A 3ELHA 2HURA 4FKXA 4ANEA 3ZTPA 1BUXA 4F36A 2AZ1A 3EICA 3GPAA 2DXFA 4HR2A 3NGSA 2BEFA 3EE3A 1S57A 3VGTA 3BH6B 4F4AA 3BBBA 1HHQA 2DY9A 3VGVA 1WKKA 1U8WA 3G2XA 1PKUA 1WKJA 1NLKL 1NUEA 1VYAA 3EMTA 1EHWA 1HIYA 2HVEA 3PRVA 3BBCA 1PAEX 4C6AA 4FKYA 4ANCA 1LEOA 1NSKL 4DZ6A 3ZTOA 3VVUA 3EVOA 3VGSA 1ZS6A 1UCNA 4ANDA 1NDKA 1WKLA 3JS9A 2AZ3A 3BH7B 1MN9A 1NCLA 3DDIA 3NGUA 3Q86A 1S59A 1NDLA 4WBFA 3ZTQA 1W7WA 2HVDA 3Q8YA 3FBBA 3Q8VA 4UOHA 4W98A 3ZTSA 1HLWA 1S5ZA 3R9LA 3FKBA 1XIQA 2DXEA 3PJ9A 3FBEA 1NSQA 3MPDA 1KDNA 5BXIA 3EJMA 3Q89A 4ENOA 3FBCA 2B8PA 2CWKA 1NB2A 1NPKA 3DKDA 3ENAA 3EVMA 1F3FA 4CP5A 2NCKL 1NHKL 4O0NA 3FCWA 4S0MA 1B4SA 3EM1A 3GP9A 1BE4A 1NSPA 1JXVA 1NDCA 3BBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBF A;  4EK2 A;  4UOG A;  1F6T A;  3Q83 A;  4DI6 A;  3ZTR A;  3Q8U A;  3B54 A;  4UOF A;  2DXD A;  1XQI A;  3VVT A;  5CAA A;  2BX6 A;  3EVW A;  3FC9 A;  3FCV A;  1BHN A;  5C7P A;  3B6B A;  3WX8 A;  5CAB A;  5IOL A;  4DUT A;  3NGT A;  1LWX A;  2ZUA A;  3L7U A;  2B8Q A;  3NGR A;  3VGU A;  3ETM A;  4KPC A;  2VU5 A;  2DYA A;  1K44 A;  1MN7 A;  1NDP A;  1B99 A;  3ELH A;  2HUR A;  4FKX A;  4ANE A;  3ZTP A;  1BUX A;  4F36 A;  2AZ1 A;  3EIC A;  3GPA A;  2DXF A;  4HR2 A;  3NGS A;  2BEF A;  3EE3 A;  1S57 A;  3VGT A;  3BH6 B;  4F4A A;  3BBB A;  1HHQ A;  2DY9 A;  3VGV A;  1WKK A;  1U8W A;  3G2X A;  1PKU A;  1WKJ A;  1NLK L;  1NUE A;  1VYA A;  3EMT A;  1EHW A;  1HIY A;  2HVE A;  3PRV A;  3BBC A;  1PAE X;  4C6A A;  4FKY A;  4ANC A;  1LEO A;  1NSK L;  4DZ6 A;  3ZTO A;  3VVU A;  3EVO A;  3VGS A;  1ZS6 A;  1UCN A;  4AND A;  1NDK A;  1WKL A;  3JS9 A;  2AZ3 A;  3BH7 B;  1MN9 A;  1NCL A;  3DDI A;  3NGU A;  3Q86 A;  1S59 A;  1NDL A;  4WBF A;  3ZTQ A;  1W7W A;  2HVD A;  3Q8Y A;  3FBB A;  3Q8V A;  4UOH A;  4W98 A;  3ZTS A;  1HLW A;  1S5Z A;  3R9L A;  3FKB A;  1XIQ A;  2DXE A;  3PJ9 A;  3FBE A;  1NSQ A;  3MPD A;  1KDN A;  5BXI A;  3EJM A;  3Q89 A;  4ENO A;  3FBC A;  2B8P A;  2CWK A;  1NB2 A;  1NPK A;  3DKD A;  3ENA A;  3EVM A;  1F3F A;  4CP5 A;  2NCK L;  1NHK L;  4O0N A;  3FCW A;  4S0M A;  1B4S A;  3EM1 A;  3GP9 A;  1BE4 A;  1NSP A;  1JXV A;  1NDC A;  3BBF A; 
#chains in the Genus database with same CATH topology
 2IRY A;  2FVP A;  3IC1 A;  4CT8 A;  2L08 A;  1HR0 J;  3QMQ A;  2FC9 A;  4PPZ A;  1TP7 A;  1S6P B;  3PYD A;  4OHW A;  4ED7 A;  1FKA F;  3ZXW A;  2VFV A;  3TEG A;  4FKX A;  3A8I A;  4YME A;  4WWS A;  2RUS A;  4KQZ A;  4DUZ J;  3MR3 A;  4WZM A;  1WOR A;  4WP3 A;  3EMT A;  1IN0 A;  4UOC A;  3PW5 A;  3PJW A;  4OYZ A;  2ZE2 B;  2DGQ A;  3HHN B;  2VZ9 A;  1SCJ B;  1UFW A;  5A2Q Y;  4WXW A;  1XNR J;  4DPW A;  2QGF B;  2CPH A;  4B3T J;  2ACM A;  1JLB A;  3TJ8 A;  3MMC A;  3D5M A;  4FNI A;  2GGP B;  1DQA A;  4WFA Q;  2XMU A;  1VQY A;  3KHR A;  1PO6 A;  1UPP A;  5EWE A;  2X1A A;  2GVD B;  4ZPW R;  1FRI A;  3ISN C;  2J7W A;  2Y0B B;  4J9R A;  4MKB A;  1WF2 A;  5AJ3 J;  5DG9 A;  3R5J B;  4ZP7 A;  2RDJ A;  2Z2M A;  4U7U K;  4NCG B;  2RVJ A;  1X4A A;  4FDF A;  5HLF B;  2VH7 A;  1F5A A;  2VQF J;  1D9F A;  2F4V J;  3D6F B;  3NL0 A;  4DV5 F;  2QX0 A;  4CO0 A;  3OTD A;  2CAJ A;  1HA1 A;  1C1B A;  3CJS A;  2XWX A;  1X7V A;  2KL8 A;  4M5H A;  4U6P A;  2IYG A;  2POK A;  2HVE A;  1CVJ A;  2XHW A;  1Q8I A;  1UVK A;  2Z0G A;  3K0J A;  5D8H B;  2VBW A;  4LF6 F;  1GXL A;  4ZPD A;  4LF1 A;  2HGL A;  1EX8 A;  1HNV A;  1I1G A;  2VUG A;  3HHL C;  4W90 B;  1S97 A;  2VOO A;  1RWU A;  2J7U A;  4BC7 A;  2QFJ A;  2ZZN A;  1FEE A;  3FCW A;  4NZ0 A;  4WCE Q;  1JLB B;  3RRH A;  3MMC B;  1P1T A;  3CJ0 A;  2OJ3 A;  4O4G A;  4ECU A;  4OZJ A;  3QJJ A;  3HI9 A;  2UUT A;  1RT3 A;  2ATL A;  5E3P A;  4Z7C A;  2P9E A;  1U47 A;  4MIA A;  5DG8 A;  3KLF A;  1UTA A;  1BY9 A;  1F3V A;  4N56 A;  4B3R F;  3HCX A;  1GK8 A;  4DR5 J;  2MZQ A;  2HHU A;  4YY3 J;  1PYS B;  2GHW A;  4V19 J;  2YWH A;  3SSR A;  2LU1 A;  3BQ1 A;  3OLB A;  4IUF A;  2OD4 A;  2WTF A;  4X4S A;  3TA0 A;  3OTC A;  5A0Y A;  4NPO A;  1C1B B;  1UCN A;  1WC6 A;  2W8L A;  1MWY A;  2XWY A;  5BR8 J;  1ZM9 A;  2RRB A;  4DL0 C;  2F63 A;  2XMJ A;  4UOH A;  5HRO A;  4O3Q A;  4P6Q A;  3DU6 A;  2GQC A;  2AQ4 A;  1JMT A;  1D1U A;  2G0J A;  1X5S A;  2RU9 A;  4RUC A;  1EKR A;  3NGD A;  1HNV B;  3W9H A;  4J9O A;  2Z58 B;  3T19 A;  1WG1 A;  1EIY B;  3HFZ B;  1VC6 A;  3ZTR A;  2H4W B;  4ED1 A;  1QAX A;  4DX6 A;  2UVW A;  2W2N P;  3I96 A;  1N56 A;  3FCV A;  4ZP6 A;  4ECY A;  4RZR A;  1UJ6 A;  2DBB A;  4O4G B;  4NLD A;  5KFH A;  1RUS A;  5G4D A;  1RT3 B;  2BUN A;  2WVB A;  4I69 A;  3KLF B;  4I1T A;  1EKS A;  3L09 A;  4ELV A;  3A13 A;  3R3T A;  5IQQ A;  2XGP A;  3MI7 X;  1UPM B;  2ZH8 A;  4RW8 A;  3BR8 A;  2R42 A;  4F4X A;  1PSD A;  2ADB A;  1HAR A;  1S99 A;  2MKS A;  5F8N A;  2DEJ A;  3TUP A;  4DHV A;  1NDL A;  3OVA A;  2OPR A;  1RTD A;  4RUH A;  4ZCK A;  3DI6 A;  5A0Y B;  2V4J A;  4FN5 A;  2A10 A;  3EYZ A;  2EKY A;  1ZH5 A;  2DK2 A;  4NMX A;  3LA0 A;  2GIF A;  2JH3 A;  3TX8 A;  3RRG A;  5HRO B;  4Q43 A;  4H4K A;  2LKZ A;  4WYW A;  2V8D A;  2CVI A;  2ZD1 A;  1HNZ J;  3QID A;  2QRR A;  1FF2 A;  1FTC A;  3CCW A;  4N47 A;  1QVG R;  2CVE A;  2NXU A;  1SJQ A;  5LL6 d;  4DCO B;  4RU2 A;  2VG6 A;  2CZV C;  4YR3 A;  2N4C A;  2HRY A;  2Y8Y A;  3QQC D;  4JI7 F;  2HVZ A;  2UXD F;  4P52 A;  1Z1Z A;  4RW8 B;  2W9A A;  4LF5 F;  2BR0 A;  4QU6 A;  5AXK A;  5AE2 A;  1XJW B;  2W24 A;  1QE1 A;  3PNI A;  4H4O A;  2ZKU A;  1RHU B;  4Z7Y A;  3TQE A;  3UD3 P;  1FDN A;  2ZBQ A;  2EFN A;  2OPR B;  2WVE A;  1RTD B;  3DI6 B;  1M5H A;  2QSF A;  2V4J B;  1WHY A;  1VQ8 S;  4K4W A;  1VBZ A;  2EI5 A;  1Q79 A;  1X5O A;  4Y28 C;  2DJW A;  1NK9 A;  2C2O B;  4DXL A;  3BYR A;  3JYT A;  2ZH2 A;  1KS2 A;  4LRB A;  1JNZ B;  1YQH A;  2NUH A;  2NYI A;  2CQC A;  4F3Q A;  1U1O A;  2WRM A;  1R0B G;  2OEL A;  4KGV B;  4K4S A;  1APS A;  4NLQ A;  2GIR A;  4LRE A;  2E1C A;  2MLX A;  3MWB A;  4KT0 C;  2QMW A;  4NCA A;  2E1A A;  2WZ1 A;  4X62 J;  3OFE A;  4JBC A;  4DR6 F;  2HHS A;  1YRU A;  2VIC A;  3UCZ P;  4CIO A;  5KT7 A;  2VG6 B;  3G6X A;  3CB4 A;  4RO0 A;  2K06 A;  2R7V A;  3NCR A;  5K14 A;  4ZPA A;  2MQO A;  3OXL A;  5J2P A;  2ZM6 J;  4C3K A;  2BW2 A;  3GJQ B;  4QZV B;  3PR5 B;  2B3T B;  4DL6 A;  2HS3 A;  1RXO B;  5CA5 A;  1H7X A;  4IDK A;  2HGN A;  3GCX P;  4M5J A;  3MPW A;  9ATC B;  3K5O A;  1U2F A;  3VAG A;  1QE1 B;  5D4N A;  4H4O B;  3GYG A;  2XO6 A;  3U1L A;  1I94 F;  4DR3 F;  3PZP A;  3HM9 A;  1SH0 A;  3UN5 A;  1DRZ A;  3L4B C;  1VIS A;  4GO5 X;  1N8R T;  2C2M B;  3EWG A;  3SEO A;  1MRO A;  1YIJ S;  2DR5 A;  2VFS A;  2IBK A;  2WBR A;  3TVZ A;  1Q82 T;  3QYY A;  3AH6 A;  5KFK A;  2JEI A;  1UKU A;  1AUS L;  1TK0 A;  3JYT B;  3M9N B;  3WZ0 A;  3NOG A;  2FQQ B;  4DJB A;  4ZCI A;  3TZY A;  3IBC B;  3TP2 A;  4Y6I A;  2CYY A;  2ALY B;  3J7A N;  2R2R A;  5FLX Y;  3KWM A;  2WOM A;  1OQ6 A;  4DV7 F;  2RHS B;  1N88 A;  1SH3 A;  1PGZ A;  3D6M B;  2QJ3 A;  2HS0 A;  2RQM A;  2XBP A;  3H5Y A;  4NLO A;  2W2M P;  2Q66 A;  1U2C A;  4P10 A;  1T03 A;  4EFA C;  1R27 B;  4DX5 A;  1KOH A;  2DNO A;  3HDS A;  4GMK A;  1L3S A;  5F8M A;  2HW3 A;  3KDO A;  4J9V A;  2NRE A;  4G65 A;  5K14 B;  5LT5 A;  3T1Y F;  1EZZ B;  3HD1 A;  5H9F J;  5J2P B;  4RW4 A;  3ZZY A;  5CZV A;  4N5S A;  1IKW A;  1Q8L A;  1JQG A;  4X4R A;  4IDK B;  2I0X A;  1BQM A;  1CQN A;  1MNE A;  2HSE B;  3HK2 A;  3PEJ A;  2EBE A;  3MDF A;  3NS5 A;  3IG1 A;  2HBZ B;  2VC1 A;  4NX9 A;  3HP6 A;  1L3V A;  1PC4 A;  1MRO B;  4KGZ B;  1KON A;  4CM0 A;  1NUE A;  3J7Z T;  3JTP A;  3L7O A;  4DR4 J;  3CJT A;  1VRU A;  4HI1 A;  2A6M A;  3M6X A;  5CHC B;  3KJQ B;  1NXI A;  4QWD A;  1N33 J;  1V5V A;  2FLO A;  3GU0 A;  4IRD A;  3Q22 A;  4X4Q A;  2WOM B;  3CCL S;  3BPD A;  2X3D A;  4X4N A;  5A2Q U;  1NB2 A;  4JYA J;  4X84 A;  3LOU A;  5DLF A;  1ARO P;  1BE4 A;  3TA1 A;  2QA4 S;  4M5K A;  1VJW A;  3ILI A;  3KLE A;  1T03 B;  1V3S A;  1M5S A;  5C25 A;  4P75 A;  2VIH A;  3IA0 A;  2R2S A;  1U6F A;  1AXQ A;  1F9H A;  2ZHO A;  1K0T A;  2E1M C;  4RW4 B;  2A18 A;  1IKW B;  2F8M A;  1Q0N A;  2HYI B;  2XMM A;  3RBX A;  3HSG A;  5DJB A;  2DY9 A;  4NLV A;  2LEP A;  2ZH4 A;  4H4K C;  1BQM B;  1FNO A;  3N9U C;  4KGK A;  2DGX A;  3QT7 A;  2VQE J;  3IG1 B;  4USI A;  3LP1 A;  4L74 A;  1X9S A;  2H5I B;  5IT9 Y;  2H5J B;  2HWT A;  5ETQ A;  2J8S A;  4CZC A;  4M63 A;  1GFW B;  4WTO B;  1D9D A;  4DFJ A;  3FMB A;  3Q8Y A;  3CCV S;  3D0I E;  2CQI A;  2EKN A;  8RUC A;  2IDL A;  3EGV A;  4K5S A;  1VRU B;  1XIQ A;  2JX2 A;  3HPO A;  1G2E A;  3FBE A;  1NKB A;  3G96 A;  3MPD A;  3U7J A;  5IFM A;  3BO4 A;  3E8O A;  3AQO A;  4RX6 A;  2DNH A;  4U95 A;  1K1Q A;  4QIF A;  3EDQ B;  3FRZ A;  3CT9 A;  5DDR C;  1J5E F;  3R97 A;  4UOG A;  1XMO F;  1IKV B;  1BLU A;  1AB8 A;  4Z2X A;  2CNL B;  4G3I A;  1S0N A;  2HNY A;  1AUD A;  3H59 A;  1T02 A;  2XZW A;  4LBH A;  2RAQ A;  3QRP A;  4IO9 Q;  4ZPT R;  3CUN A;  3OTO J;  5AE1 A;  2NZ4 A;  5H1S V;  2E9R X;  3ELH A;  2NUU G;  5H9F K;  3KLE B;  3BYP A;  2C3P A;  5HQL A;  3CDE A;  3W60 A;  3T9N A;  3SV4 A;  5ETK A;  1HR0 F;  5C25 B;  1M5K C;  4MAK A;  2HKE A;  4ZS6 A;  1U02 A;  1WI6 A;  4KYZ A;  2LDY A;  1I3O B;  2OLW A;  3GG1 A;  1R8B A;  1C4A A;  3SQO P;  4X4T A;  1Q53 A;  4JB8 B;  2HBQ B;  1H2U X;  4ECZ A;  4DUZ F;  1VJQ A;  3QPI A;  1VOM A;  2NZC A;  4J37 A;  1TKT A;  2GW8 A;  1XEZ A;  2AKW B;  3LP1 B;  4JI6 J;  4X65 J;  1UL3 A;  1Y3K A;  2ZZM A;  4LF2 A;  4XTT A;  4OI1 A;  3CNQ P;  2MQQ A;  4GC7 A;  3MR2 A;  3SI8 A;  1RTZ A;  4ZPB A;  2WVC A;  1XNR F;  2KXN B;  3GIR A;  2C2Z B;  4B3T F;  4LF4 J;  1HNW J;  2ZOF A;  1YJR A;  2ZBP A;  2ZEJ A;  2HFZ A;  1P8G A;  4LFB J;  1ZBT A;  5H9E J;  3DLL Q;  2J9D A;  2PI4 A;  2W8K A;  5AJ3 F;  4EBE A;  2FY1 A;  4WZQ A;  4DV4 J;  3OL7 A;  2R7X A;  2NS1 B;  3QZ7 A;  5KFF A;  2HNY B;  1C1C A;  3RR7 A;  1YX2 A;  5KFV A;  2OEJ A;  2DD8 S;  1Q1K A;  1K73 T;  4O4R A;  1RBO B;  1T8E A;  2VQF F;  2XY5 A;  2F4V F;  4IFV A;  4M5L A;  4AND A;  4DPY A;  4CRJ A;  4J9P A;  1QSS A;  2FZG B;  1NZA A;  3HJV A;  4CLZ A;  1RAD B;  2J8A A;  2KT5 A;  4XK8 C;  3BB5 A;  3GSD A;  4C2M A;  2DXE A;  1FFS B;  1UFL A;  4HDG A;  2P6S A;  4I67 A;  3SSS A;  3W62 A;  2W4C A;  4RBV A;  5BYR A;  1TKT B;  3OT9 A;  1RHK B;  3QWU A;  3TZZ A;  3Q83 A;  1HWU A;  2R9L A;  3BSC A;  3HVR A;  4DZD A;  1SL0 A;  1AFI A;  2F40 A;  4F3O A;  3BGO P;  1TV6 A;  2E5L F;  4CTA A;  4WII A;  2IAJ A;  2O67 A;  4FBU A;  1EET A;  2HFN A;  4PG6 A;  1KKH A;  4Z37 A;  2HHV A;  3R27 A;  1BMQ B;  1Y7P A;  4PR6 A;  3HVA A;  3K5L A;  3NBP A;  4NZ6 A;  5ADZ A;  3PW0 A;  3GG0 A;  1T9X A;  4J9S A;  2XC9 A;  3I9Z A;  5BYQ A;  2F8E X;  2WVD A;  3QBC A;  1FWK A;  1HW9 A;  4NLU A;  1C1C B;  3R6L B;  3K5M A;  4DR5 F;  1T9W A;  3VAJ A;  3SCJ E;  1D8Z A;  3OLA A;  4YY3 F;  2ZKT A;  3QIP A;  5HO4 A;  3G8T A;  3IWX A;  2CQD A;  2DGV A;  4DLE A;  3PX0 A;  3IWN C;  3ENV A;  4NCB A;  3TO8 A;  3HHE A;  2P9G A;  4IFV B;  2Y9H A;  5KT4 A;  2QIF A;  3Q89 A;  2YTC A;  3FBC A;  2B8P A;  3I0S A;  3SCK E;  2DIV A;  4NYO A;  1U8S A;  1WEY A;  4H4M A;  2RIJ A;  5BR8 F;  3OFF A;  4WJB A;  5F0W A;  1X4C A;  3I4H X;  2GML A;  3TYT A;  3R7B B;  1R0A A;  1HD1 A;  1S4E A;  2N7Y A;  2PN6 A;  1JLQ A;  2HVH A;  1FFG B;  1VLO A;  2KYX A;  1QVF R;  2PMW A;  1X0P A;  1VHI A;  4WK1 A;  3VGT A;  4A8X A;  1TV6 B;  1IWA A;  4CTA B;  4F4A A;  2IAJ B;  2H4Y B;  5H9E K;  1EET B;  3CC4 S;  4Y65 A;  5J1N A;  3UW1 A;  2QG9 B;  1YBU A;  2CQ0 A;  2HFV A;  3NBP B;  4UQG A;  1AFJ A;  3UVJ A;  3ILJ A;  3AD9 C;  2PA3 A;  2XM3 A;  1NZ8 A;  2MZR A;  3P4U B;  2BAB A;  2CG8 A;  4ZJO A;  5J1P A;  3H2L A;  4NI2 A;  4V1A k;  3QIP B;  4KGM A;  1TL5 A;  3RB3 A;  4OL8 A;  4DSL A;  4RL1 A;  2AHO B;  2ROP A;  3R6G B;  4DU7 A;  2JHE A;  3P6Y C;  1Y3J A;  1B64 A;  4DN9 A;  3I0S B;  4EEY A;  3W66 A;  1OWX A;  4H4M B;  2G0I A;  3JB9 k;  2LQ8 A;  3IAS 9;  1LWC A;  4KR0 B;  2HUR A;  3UCU P;  2XSF A;  4CO1 A;  2C22 A;  4HR2 A;  1R0A B;  1M1K T;  4QIG A;  5C2G A;  4J9L A;  1UJ4 A;  2PFD A;  1JLQ B;  4EMD A;  1U6B A;  3MEC A;  1YIT S;  2I38 A;  1HNZ F;  2YNF A;  1PJ5 A;  4RU9 A;  5L46 A;  1CJU A;  4PZV A;  3RG6 A;  2YWW A;  5KFE A;  4OX7 A;  1WC1 A;  4R8U A;  1N5Q A;  2UP1 A;  4O44 A;  4NA2 A;  2CPJ A;  3KJF B;  4ICL A;  4P2X A;  1XBW A;  2PT0 A;  5F8J A;  3UVJ B;  4FF4 A;  4BWM A;  3US5 A;  4JV1 A;  3M8Z A;  2ZVI A;  3QRQ A;  1SXL A;  2OPQ A;  5FJ4 A;  3OR1 A;  4M5N A;  4EO8 A;  4CLS A;  4A8F A;  1UZD A;  5DZ7 A;  5B0D A;  3IN5 A;  5A8W A;  1KSP A;  1Q8B A;  2QA4 G;  2KZM A;  4OJG A;  1MWQ A;  3EZ5 A;  3EDR B;  2J76 E;  1YJU A;  2HHH J;  4HHJ A;  1UW4 A;  1VDH A;  1KQG B;  2YKQ A;  3FK4 A;  5DDP C;  4LRC A;  3BBB A;  4ES3 A;  3M8S A;  4URS A;  1KWM A;  5HI7 A;  1LWC B;  4M94 A;  1CJV A;  2W25 A;  2IY5 B;  2IVF B;  4XO0 A;  4JI5 J;  2MST A;  3MEC B;  4MKY A;  4CO4 A;  3DN9 A;  3LW5 C;  1MG7 A;  3Q8V A;  4TU8 A;  2YNF B;  3NKY A;  1MMN A;  1S1W A;  2WON A;  3IAM 9;  2F1F A;  2GC8 A;  3BRE A;  2DNK A;  3B78 A;  2QYC A;  4X62 F;  1CJU B;  2ZBR A;  2ASJ A;  2BJ3 A;  1RWV B;  5J2Q A;  2QLJ B;  1REV A;  4CCH A;  2VPZ B;  4O44 B;  4CH0 S;  4ICL B;  2KHD A;  1VMB A;  2MDA A;  1UVL A;  2AU0 A;  2C2R A;  2ZM6 F;  1FER A;  4Y00 A;  1T7P A;  3IRX A;  1BGX T;  3AJD A;  1OO0 B;  3HZE A;  4CDI A;  1KP6 A;  5KFS A;  2OPQ B;  1CBK A;  4ZHR A;  1QUV A;  2KZZ A;  5CQG A;  2CJX B;  3OR1 B;  2C3U A;  1SKS A;  4ED4 A;  2ZH6 A;  1J27 A;  2AZ1 A;  2I6W A;  1RE1 B;  2PE8 A;  5A8W B;  2ILY A;  3BV8 A;  4JV2 A;  4YHH J;  5KFO A;  1QAI A;  4YDD B;  4QIW D;  1PIL A;  1VHF A;  4EO6 A;  3BJY A;  1SC3 B;  2IYI A;  3CXC R;  2AJ1 A;  2ZUG A;  1NCL A;  1FTR A;  2MB0 B;  4OYM A;  3WQP A;  2WSE C;  1P1L A;  1CJV B;  3O1L A;  4PAB A;  1N0V C;  3I55 S;  3VTI A;  2ZH5 A;  1PBA A;  4IR9 A;  3OPK A;  4ID5 A;  3VWS A;  1HQ2 A;  1WAC A;  2DIS A;  5AXN A;  2WB1 D;  1S1W B;  2WON B;  4ZN3 A;  2P8I A;  5CCL A;  1RWN B;  3RW7 A;  4AL6 A;  1IR2 A;  5C7P A;  1S7H A;  3HF5 A;  1KTQ A;  5SUH A;  1REV B;  4DBQ A;  5HMZ A;  3ZC4 A;  2VON A;  2R2T A;  4AFF A;  2GO8 A;  2Y3Y A;  2QFI A;  2CPZ A;  3CCQ S;  2V68 A;  2ZJR Q;  1PJ6 A;  2BEF A;  2DR9 A;  3IRX B;  1V9O A;  1VRQ C;  3VGV A;  4ZHR B;  3BO3 A;  4IOC Q;  1PAE X;  4DV1 J;  2KYZ A;  2ABY A;  3VVU A;  4I6Y A;  5DET A;  3OD2 A;  4PG8 A;  2C2K B;  2ZDO A;  3JS9 A;  1H2T Z;  1B0V A;  4FYV B;  2U2F A;  3CCJ S;  2CPY A;  2UUW A;  3LAM A;  3V6K A;  3IR5 B;  4RBU A;  2CNK B;  5L1K A;  1NJX A;  4DR4 F;  1RAO A;  5AT1 B;  2M88 A;  3T41 A;  4L72 B;  1PG5 B;  1BWE A;  2FYX A;  1N33 F;  1T9Y A;  3MGJ A;  3PRV A;  4QPX A;  1U1L A;  2VD3 A;  3V5R A;  3HFV A;  4LSZ B;  2G1D A;  3BSA A;  3MM9 A;  2IA6 A;  5B08 A;  4ID5 B;  4UY8 5;  4J9U E;  4JYA F;  1H3D A;  3UI3 A;  4MKV A;  1G6B A;  2W9B A;  2R8H A;  4K7Q A;  1RSC A;  2UUA J;  5HJY A;  3H98 A;  2NXC A;  3PKY A;  3JQM A;  3WDO A;  2AMC B;  3GYX B;  1UMJ A;  4TYA A;  2PI5 A;  4ZIT A;  3N4W A;  5F8I A;  2D9P A;  3CCU S;  3D67 A;  3GFY A;  5IC6 B;  2YKM A;  2DHH A;  2DY1 A;  4ZCL A;  3CIZ A;  3D0H E;  2DRB A;  4TVA B;  4DX7 A;  3S6E A;  2MZ1 A;  2EEY A;  2RUG A;  2YWK A;  1ZTT A;  3NOC A;  4ZLN A;  3AXK A;  1Q8K A;  5L38 A;  2VQE F;  2XTJ P;  1NHK L;  2HND A;  5F9L A;  3JQK A;  3Q2S C;  2Z2Z A;  2XNQ A;  1YZ6 A;  4YB1 P;  2DCL A;  5IT4 A;  2J0W A;  4O3P A;  3K17 A;  3NGK A;  2QA2 A;  1TAQ A;  2IMW P;  4BBY A;  4JUZ A;  2RDI A;  3MAQ A;  1LWX A;  5E2Q A;  3HKZ D;  1MLA A;  1R89 A;  2DYA A;  2FUG 9;  5KFY A;  4C3M A;  1B7Y B;  1H0H B;  3V6D A;  1XK8 A;  3EIC A;  2AJ4 A;  4DQI A;  2L3M A;  4ILR A;  3UDC A;  2FIU A;  2BW7 A;  1H2V Z;  4KBI A;  3T5J A;  2MQL A;  1GX6 A;  2N4D A;  2W9B B;  3OTO F;  2QV6 A;  2XLI A;  1HL6 A;  3W5Z A;  2MEW A;  3MTK A;  1IBC B;  1RAJ A;  1FES A;  1FXR A;  4ZVG A;  3M8R A;  2JVR A;  4LIW A;  4OIX A;  1FNM A;  3HJF A;  3R5D A;  2YKM B;  4RBT A;  1WC5 A;  4DFP A;  2Z56 B;  4WPA A;  5EGY A;  2QLW A;  4WFY A;  3MUM P;  1O5J A;  3DLG B;  4PQA A;  1L5U A;  2MJN A;  3RJM B;  2E29 A;  4URQ U;  1HWL A;  5D77 A;  4LFA F;  2CPD A;  4DL4 A;  4D3H A;  4AE5 A;  4JI6 F;  4X65 F;  4F3M A;  2HND B;  1GXT A;  2CNO B;  3NP5 A;  2E1R A;  4FXW A;  2DGT A;  3D0G E;  2KFZ A;  2F65 A;  5IV3 A;  4R5P A;  2G2O A;  2MKK A;  4LF4 F;  3KHL A;  5JVG Q;  1HNW F;  4DFK A;  1TL7 A;  4DCP B;  4CYU A;  1OYE A;  3DXS X;  4KY3 A;  4QYR A;  4BLG A;  2FJB B;  4LFB F;  4DQQ A;  3MR7 A;  3FGV A;  1F2G A;  4ITS A;  1FRM A;  1RHQ B;  4CLL A;  4ECV A;  1D9A A;  4C6A A;  2GVZ A;  4FKY A;  3V6D B;  2J0X A;  5U47 A;  5D15 A;  3FUY A;  4DV4 F;  4ECW A;  4YR2 A;  4RW9 B;  1SUQ A;  4WBF A;  4RUB A;  3BDE A;  1DAR A;  3TRG A;  3ILO A;  1NO8 A;  4K5R A;  3QAE A;  2FZK B;  3IS9 A;  2QT7 A;  4J7C A;  5D4P A;  2ZFH A;  3M2V A;  1X5P A;  2NCK L;  4QR2 A;  2J9C A;  3CJ2 A;  3I4P A;  1V6H A;  2BRL A;  2FLP A;  1TMM A;  3H42 A;  3MCS A;  5A8K A;  3OSP A;  3H8Y A;  4MK7 A;  3W63 A;  3JSY A;  3KXD A;  1A9N B;  1N6Q A;  1P27 B;  3NS6 A;  1TUV A;  1RBA A;  2QO3 A;  3GFX A;  3K57 A;  3CVK A;  1HI1 A;  3GJR B;  2FJA B;  4R5P B;  1OQ3 A;  3HD2 A;  1EHW A;  2AYG A;  1HI0 P;  1TL7 B;  4CYU B;  1MN9 A;  5J1E A;  2WW4 A;  3QSI A;  3FBB A;  3M6V A;  3PM9 A;  5L1L A;  2GVZ B;  5B0E A;  2Q1L A;  5EWF A;  3I31 A;  3EGZ A;  1F3F A;  4TLQ A;  1SUQ B;  4J9Q A;  1OSD A;  1M1H A;  5KG2 A;  3EXC X;  1NSP A;  2YWF A;  3MR6 A;  2OEM A;  3IS9 B;  3O8W A;  1JNR B;  2UUC J;  2BX6 A;  5LOQ A;  3M2V B;  1C0U A;  2E44 A;  3DM2 A;  2HFS A;  4KPC A;  3CJ3 A;  1RZM A;  1RT6 B;  3P96 A;  2OMO A;  5I4M A;  2J0Q D;  3ICL A;  1RI7 A;  3TWZ A;  5A8K B;  3I87 A;  4W4M A;  3C66 A;  2IM0 A;  2KXF A;  4KHP J;  4N8O A;  1N6Q B;  3DMJ A;  2RIL A;  3M05 A;  5E3A A;  3VF0 B;  3AA8 A;  4B08 A;  4YEA A;  3K5P A;  2UXB J;  3CCS S;  3HKW A;  2NR0 A;  4OV6 A;  1IKY A;  4DUY J;  4I7F A;  4OJH A;  3MFH A;  4ES1 A;  3P5T L;  2E5G A;  1N48 A;  1YJW S;  4RWX A;  3H5S A;  2MKC A;  4E0D A;  3KLG A;  1H73 A;  2XS7 A;  3A8K A;  3LAL A;  3DLE A;  1UFK A;  2ZOM A;  3C16 A;  3M7V A;  5J1E B;  2RB7 A;  1KQF B;  1M5P C;  4KFB A;  2DHA A;  3E01 A;  3P5B P;  2QLB B;  1RAH B;  2QLX A;  3M1V A;  2H48 B;  1D3W A;  1H98 A;  2E66 A;  3MHY A;  3G6Y A;  1S72 S;  4CWB A;  4QQB A;  2KFN A;  2V0N A;  1TU0 B;  4I4B A;  3IR6 B;  1FK9 A;  2V9W A;  2AYM A;  4QPT A;  2EK1 A;  1EQ0 A;  1S1X A;  3H2V E;  4C8N A;  2ZBC A;  3EUN A;  4AQY J;  1W2B R;  5E3C A;  1C0U B;  4ED8 A;  3DM2 B;  5SZT A;  3P3D A;  1PC5 A;  2H9Z A;  2OPS A;  2CRL A;  4PRF A;  4MYU A;  1RWK B;  2W7P A;  5EX3 A;  1EAY C;  4ECR A;  2DR7 A;  3FNN A;  5HAT A;  4ALZ A;  1XWL A;  1WKL A;  3DFE A;  3DMJ B;  3KHG A;  1U09 A;  3TW0 A;  2XZT B;  4K8R A;  6FDR A;  2O5D A;  1DAX A;  4Q8E A;  2FPH X;  1IKY B;  1OYD A;  1S79 A;  4I7F B;  4LFC J;  3M8Q A;  3BKF A;  4K4V A;  3CJK A;  4DV3 J;  5K20 B;  2HQC A;  5KFA A;  2VV5 A;  4ZOS A;  1JJH A;  3KLG B;  2E7W A;  5J2N A;  4OI4 A;  3DLE B;  4L73 A;  2AJ0 A;  3C16 B;  1QTN B;  1IWG A;  3QWP A;  2ZJQ Q;  4KFB B;  4YUD A;  1XR7 A;  3E01 B;  1LNQ A;  4R0J A;  1QTM A;  2YVS A;  3VAL A;  5F41 A;  3GR0 A;  3ISZ A;  3SIP B;  2EC2 A;  1FVQ A;  3TX0 A;  3M1V B;  4ZIW A;  5KT5 A;  2C3Y A;  5KTQ A;  1DJ0 A;  3UDL A;  1CJT A;  2DO0 A;  3LAK A;  2Y1I A;  1B0P A;  3N0V A;  3OL9 A;  1FK9 B;  2HRT A;  3E51 A;  5GAH U;  1S1X B;  1BD6 A;  5KG7 A;  2D1C A;  1ZM2 A;  4JV5 J;  2B43 A;  2HHH F;  3IMQ J;  4G1P A;  4DU8 A;  1M0S A;  5IZH A;  2HG4 A;  2YQ3 A;  2HRU A;  2OPS B;  5LSO A;  3GFH A;  5A8R B;  3I0R A;  3ET6 A;  1DLO A;  2G4B A;  3GSI A;  5K9F A;  2XYP B;  2LA4 A;  3NLC A;  2HHW A;  3GV7 B;  3CJ8 A;  4JI5 F;  4Q2M A;  4A8Q A;  4IH7 A;  3OJS A;  4K4Y A;  2VJU A;  3D6T B;  3M8Q B;  4BHQ A;  3S8S A;  3MTJ A;  1KLM A;  3CCE S;  4G6V B;  1BQX A;  1PAU B;  1TR0 A;  3CJK B;  1ITP A;  1UP1 A;  3RAX A;  3MM8 A;  3T1H J;  3TAN A;  2ZIT A;  5CD4 H;  2R3V A;  5J2N B;  4M5D A;  1BUX A;  4F36 A;  3GLJ A;  2PC6 A;  1GTH A;  2RNE A;  2XYH B;  2DTJ A;  1O6X A;  3CWJ A;  3RBZ A;  2G1H A;  1NAQ A;  1YBT A;  2RH3 A;  3SXL A;  2B9W A;  1Y11 A;  1SV5 A;  1CJT B;  4FP9 A;  1K0V A;  2AZ3 A;  2J7K A;  1NK6 A;  4YHH F;  4LBP A;  2JDJ A;  4RW6 A;  3TAP A;  3MXH P;  4FVC A;  4CLK A;  1XMQ J;  3VAI A;  3TI0 A;  4WE1 A;  2LFV A;  2X1F A;  3U1N A;  3VQS A;  2LXF A;  4OZ0 A;  4ECQ A;  1AT1 B;  2Q6B A;  3NG8 A;  4LR8 A;  4DQR A;  4EI2 A;  1N5Y A;  1VQN S;  4DR7 J;  3I0R B;  1EB0 A;  2HK2 A;  4F7V A;  5HVG A;  2ZH1 A;  3ET6 B;  1DLO B;  2AV5 A;  2G0C A;  4DV2 J;  1U6Z A;  2KVQ E;  4IQM A;  2XHC A;  3CJ4 A;  4ZN1 A;  4C0B A;  2ZH3 A;  1NRK A;  2MJU A;  3RU0 A;  3LAN A;  3N5B A;  3ZZP A;  2FHM A;  4UUX A;  4NRU A;  2BJ1 A;  2Z4P A;  1L3U A;  4Y34 A;  5CYM A;  1KLM B;  1FD8 A;  2D3Z A;  4HDH A;  3MM8 B;  1RA6 A;  2MKH A;  4X2B A;  3T5H A;  4HHU A;  2YWG A;  1Y5L B;  3ONQ A;  1IQZ A;  4M5D B;  3NAH A;  3P8B B;  4OYA A;  2V2Q A;  3KK3 A;  5CH7 B;  1DZ5 A;  1GMW D;  3DCA A;  4F25 A;  1HWJ A;  1CUL A;  3RR8 A;  1RAC B;  1T3N A;  4JI2 J;  2UVU A;  2W2P P;  2D74 B;  1FI4 A;  1CJK A;  2DRD A;  4F0K A;  4DS4 A;  1SV5 B;  4WFN Q;  2PGC A;  4DV1 F;  2AGO A;  3EJM A;  2RD5 C;  2QZ8 A;  5MLC V;  4HL9 A;  3G71 S;  1SVD A;  1RTI A;  4ZVU B;  4RW6 B;  4U7U D;  1B0T A;  3I56 S;  1N5T A;  2KRR A;  2OFH X;  2E5H A;  1F9E B;  3I5C A;  4WE1 B;  1KVI A;  4ZDN A;  4UUW A;  1N5Y B;  2JZ5 A;  2B8Q A;  2CQ1 A;  3KNG A;  1RB0 A;  1QM9 A;  4I64 A;  3H0P A;  2O01 C;  3R7N B;  2JWN A;  3O44 A;  2BYC A;  2JOQ A;  1G4C A;  3AOC A;  3GIM A;  4DR2 J;  2RRN A;  3PYE A;  1FCA A;  5CYQ A;  3VCD A;  3I5B A;  1UA1 A;  3JSR A;  2PFF B;  1SC1 B;  4CO5 A;  2QEX S;  3IM9 A;  2V9K A;  3I82 A;  5CYM B;  1S1U A;  2YNG A;  2UUA F;  3AOB A;  1YDL A;  1S9G A;  1VQ9 S;  4LRA A;  1GQE A;  1SJ3 P;  1WD6 A;  2DNP A;  5D3G A;  2C1E B;  3OFH A;  5EUH A;  4DR1 J;  3CCR S;  4TYB A;  5B0A A;  4QWC A;  4NA3 A;  4UT4 A;  3KK3 B;  5G0R A;  3MCM A;  1N34 J;  1CUL B;  4RLE A;  3T5K A;  3D7S B;  5C42 A;  4OJ3 A;  4FF1 A;  2C42 A;  2KB2 A;  4KTQ A;  4YB6 A;  2RJZ A;  2QMX A;  2WAQ D;  5DS7 A;  2R7O A;  1CJK B;  2MLZ A;  2COL A;  2JLE A;  3OVS A;  3SFG A;  1WEZ A;  5I42 A;  3HT3 A;  4C8M A;  1RTI B;  1FRJ A;  1IXK A;  4YB5 A;  1S1V A;  2ZOG A;  4FYX B;  2FHK A;  2K3K A;  1V5I B;  2R7W A;  5KG4 A;  3BN4 A;  3I5A A;  3M2R A;  1KC8 T;  1LOU A;  4DPU A;  1WDD A;  4UTG A;  5K8N A;  5I3P A;  5LXR A;  1L3T A;  3LTO A;  3H90 A;  1Q5V A;  3POT A;  5KOX A;  1QAJ A;  3IGN A;  1ZET A;  3D68 A;  1JLG A;  1NND A;  4ZLP A;  1NK0 A;  3FZ2 A;  5CYQ B;  5KFN A;  4HVZ A;  1U2R A;  2Z30 B;  3W61 A;  1NPP A;  1S1U B;  3O6Q A;  2YNG B;  2MSS A;  5B09 A;  1LK5 A;  1IUJ A;  1RHR B;  1S9G B;  2LP4 A;  2X3G A;  3P45 B;  1JXE A;  5HMW A;  2AX1 A;  1I51 B;  1KLN A;  5D3G B;  3FSI A;  2BXJ A;  3DLK A;  1MU2 A;  1XR5 A;  4DSJ A;  5G0R B;  2IA0 A;  2ALZ A;  3MZI A;  2D3U A;  2G2Y A;  4L75 A;  2V5H G;  5I3Q A;  3FC9 A;  5C42 B;  3RBD A;  2YKO A;  3G8Q A;  1VIX A;  1Q95 G;  4DUT A;  2BQU A;  4HTI A;  2E9Z A;  1FE4 A;  5DQG A;  3ETO A;  4P7T A;  2OKQ A;  2WB4 A;  1OY8 A;  4U8V A;  1UWA A;  1UVM A;  4E2F B;  5KFU A;  2IRU A;  5I42 B;  2XMT A;  3AT1 B;  2MY8 A;  1S1V B;  2PA8 D;  3ZZT A;  2XI2 A;  2W9C A;  2LLZ A;  3FJ2 A;  5EX0 A;  1LEO A;  2HLT A;  2BZ2 A;  3M2R B;  2HMI A;  2FVQ A;  3JTN A;  3CSK A;  4CLW A;  3THV A;  1TVR A;  1UVI A;  1HNI A;  1QY7 A;  2RML A;  4PG4 A;  2LA6 A;  3PW4 A;  2DNM A;  3POT B;  2A2D A;  2W7O A;  2DRA A;  1JLG B;  2UU9 J;  1ZYQ A;  1HW8 A;  1TAU A;  3SDE A;  4ZVQ B;  1YJ9 S;  4OJ1 A;  4ZLJ A;  2MQP A;  1S7I A;  4XAK A;  2O1P A;  4WU3 A;  4CO2 A;  1UA0 A;  3CTR A;  3FMW A;  1NJI T;  1WC3 A;  2CJ9 A;  2GZO A;  5F3T A;  2DR6 A;  3GR1 A;  4R25 A;  2YQ0 A;  2N3L A;  3DLK B;  1MU2 B;  1YHQ S;  5LXY A;  4IH6 A;  2C3M A;  2HNZ A;  2H51 B;  4ED3 A;  3WC2 A;  1EJ7 L;  5B0F A;  1N5V A;  4NEY A;  4OI6 A;  4I0W A;  1RT4 A;  2P2C B;  2VA3 A;  2KXH A;  3A8E A;  3EPG A;  3AFG A;  2IMO A;  2DNY A;  4FVM A;  5EDW A;  1VFJ A;  2PEH A;  3ULH A;  3BSN A;  3K58 A;  1M5V C;  1NH7 A;  3DRP A;  4A8M P;  5KG0 A;  2W9C B;  3C15 A;  3S7R A;  4IO1 A;  2CKW A;  2D9O A;  2B4P A;  3PYF A;  5EHH A;  2HMI B;  3UD4 P;  2K2P A;  1A0O B;  2YY3 A;  5KFB A;  2J9E A;  4PKD B;  3M30 A;  3Q0A A;  3PKM A;  1TVR B;  5LSL A;  4NLG A;  1HNI B;  4I2P A;  4AYB D;  4Q8F A;  2NPF A;  2FLL A;  3G86 A;  1UZH A;  1R31 A;  3EX7 B;  3CJR A;  3GYN A;  2BKN A;  1RAG B;  3SDE B;  3OTE A;  4B3R J;  1RCX B;  1UEV A;  2V69 A;  1F5B A;  4BS2 A;  2MKJ A;  1X60 A;  4OX8 A;  3QGH A;  1ZM4 A;  3DU5 A;  1K8A T;  3MOJ B;  3N28 A;  2HWH A;  2CA9 A;  1FJC A;  7FDR A;  3QGG A;  1GNK A;  2EG2 A;  4Q7A A;  2OH2 A;  1VYA A;  1E6Y A;  3M32 A;  4PEO A;  4ILL A;  2HNZ B;  4GRS A;  3UWT A;  1IJE B;  1RWP B;  4WKR A;  1RAB B;  1N36 J;  1OY6 A;  1RT4 B;  1LV5 A;  3KG4 A;  4KHP F;  5GAH I;  2XO7 A;  2B9X A;  3ZTQ A;  4EBC A;  1C0T A;  1MSW D;  2ILZ A;  5IWA J;  3PJ9 A;  1KQS R;  3N6M A;  3DRP B;  2A6O A;  3VQT A;  3ITH A;  2UXB F;  4MIW A;  5HQM A;  4DUY F;  3C15 B;  3UNY A;  1VS3 A;  4ERD A;  3MEE A;  2YKN A;  1F6T A;  2AT1 B;  3B54 A;  1H38 A;  1BWV A;  4LJM A;  3M30 B;  3M2U A;  2NXJ A;  3JSM A;  4I2P B;  2FVS A;  3B82 A;  3P49 B;  2KJV A;  2HIY A;  2ZHA A;  4B3O A;  1JKH A;  2HLU A;  1GAO A;  1RWX B;  1F1B B;  2V8G A;  2YBV A;  2YWE A;  1SKU B;  2VG5 A;  1H6K X;  1CEZ A;  1ZM3 A;  5LM7 E;  5HK4 A;  3PY8 A;  1WHW A;  3ILL A;  3AHP A;  4P2S A;  1WWH A;  4AT1 B;  4AQY F;  3CD5 A;  2VFU A;  1UEK A;  3FSX A;  3OW2 R;  1E6Y B;  3M32 B;  3ZTS A;  1HLW A;  2NPI A;  2AF6 A;  4LR9 A;  1T05 A;  4ATN A;  2V63 A;  4KJI A;  1VBK A;  5KT3 A;  1C0T B;  2RRA A;  4LQ3 A;  2DH9 A;  2XMK A;  2HS4 A;  2ASL A;  4P71 A;  4PWU A;  3BZQ A;  4JI4 J;  4JV0 A;  3GZ7 A;  2M4M A;  3ITH B;  4NML A;  4XDC A;  5DO2 A;  3R7S B;  4OI2 A;  3G6E S;  4LFC F;  2W4P A;  3PW2 A;  3MEE B;  1XER A;  2YKN B;  3UCG A;  4DV3 F;  2BOA A;  2BM1 A;  1ZAW A;  1SQF A;  3M2U B;  3JSM B;  1X4B A;  3A3P B;  5E7O B;  2I5J A;  4XIU A;  5K8M A;  4IKA A;  1HHT P;  5B7W A;  4TU9 A;  4B3O B;  1WG4 A;  2QTW A;  1AW0 A;  1JKH B;  1U1N A;  1T0T V;  4C4W A;  4GC6 A;  3CO0 P;  4DG1 A;  2GV1 A;  2VG5 B;  4USJ C;  2UXD J;  2CQG A;  1X4G A;  4LF5 J;  3CD6 S;  2HWI A;  4GKK J;  4ZLL A;  3GTY X;  4L6V 3;  2RQK A;  5LMU J;  1TUG B;  5D4O A;  3CC2 S;  4JV5 F;  3I9V 9;  2VBZ A;  1T05 B;  1RK8 A;  4C11 A;  3W8G A;  2AJQ A;  1U1K A;  2XY7 A;  1G3O A;  4IG3 A;  3ZZO A;  5GMD A;  2XLJ A;  2LEB A;  1ZPV A;  1RWW B;  2R7Q A;  4QWB A;  3ZZR A;  4Q44 A;  2DPJ A;  4Y0F A;  4AL7 A;  5M2U A;  3W8P A;  3Q2T C;  4NLP A;  1LW2 A;  1YRX A;  1RT1 A;  4OZL A;  3HSD A;  2CJY B;  1YLX A;  2JLG A;  4USV A;  2XCP A;  1PKU A;  2X7I A;  2V94 A;  3CE8 A;  3SSQ A;  4ZVS B;  5T7L A;  1U49 A;  3RW6 A;  5GMK a;  2VPX B;  3BN7 A;  3C8Y A;  1CS4 A;  2I5J B;  4IOA Q;  4V19 X;  2L41 A;  4G1I A;  1RQ0 A;  2WSF C;  1Z2Z A;  5ETN A;  1H74 A;  2VKR A;  4MFB A;  3FKB A;  1S9E A;  3N6N A;  3SZ2 A;  1KHV A;  2V8P A;  1XMB A;  5A76 A;  4AUK A;  1DQ8 A;  2BKP A;  3HZG A;  4DG1 B;  2BOP A;  4X66 J;  3UFC X;  1ZZF A;  3GP9 A;  3HXM A;  1NDC A;  2OPP A;  2JC1 A;  3D1Q A;  2JNJ A;  1AYE A;  2RT3 A;  5B0B A;  1XMQ F;  3NNC A;  4OZN A;  1HBU A;  2VBY A;  2N82 B;  2CQH A;  4C11 B;  1NDP A;  3UR3 C;  2QMU B;  4DR7 F;  3OVB A;  4IG3 B;  2AEJ A;  1DUR A;  4WU2 A;  1KFS A;  3KKF A;  3EE3 A;  2IJN A;  3TAQ A;  3SV3 A;  2MGZ A;  3TAR A;  2B5J A;  4KC5 A;  1ROF A;  1IKV A;  2VHG A;  1QDU B;  1T9T A;  1LW2 B;  4ED2 A;  1RT1 B;  3TEH B;  2ZNY A;  3MAH A;  4EYH B;  2KFY A;  2ZH9 A;  5F0U A;  1SPB P;  4HT7 A;  5T7L B;  5L8R C;  2Q6C A;  4YP3 A;  3KJV A;  2AGP A;  4P72 A;  4K50 A;  1CS4 B;  2CFX A;  3D9B A;  4RNF A;  2EFQ A;  2Z2Y B;  4ENO A;  1R43 A;  3R5B A;  5L9N A;  1FDA A;  4B3S J;  5FII A;  2V2V A;  1E6V A;  1JXV A;  3QT8 A;  4MFB B;  4L3K A;  4MH8 A;  1S9E B;  2EFG A;  1R8A A;  4JI2 F;  1TEL A;  3OUY A;  4KGX B;  1FDB A;  1YSJ A;  3CCM S;  4WTY A;  3RAQ A;  2QL9 B;  2DGU A;  2OPP B;  2MPU A;  2GCF A;  4OQJ A;  4HAC A;  4ID8 A;  4CH7 A;  3KDN A;  1HBU B;  2GX8 A;  1FJ7 A;  2CIM A;  2FC8 A;  3Q8R B;  1DBD A;  2ACY A;  4A8K A;  1CLF A;  5E3R A;  3PIP Q;  2PDA A;  1U26 A;  1O0P A;  4PAA A;  1SC6 A;  2JL9 A;  4J5O A;  4DZ6 A;  1N52 B;  4NLS A;  4OYX A;  2UZA A;  1FFW B;  4NXN J;  1TKX A;  2Y1L B;  4U96 A;  2HVD A;  4IYQ A;  8AT1 B;  2MGZ B;  5HL7 Q;  4DR2 F;  2B5J B;  3D28 A;  3DDN A;  4OI0 A;  2VFT A;  2IM3 A;  1HPZ A;  5KG6 A;  2YX7 A;  2LDI A;  2MKI A;  3CDA A;  2M8H A;  3EXY A;  1S49 A;  1S1T A;  5D0R A;  2GJI A;  4OMF G;  1MWZ A;  4F04 B;  2HHX A;  2F8H A;  3KJV B;  2UXC J;  1N32 J;  3S01 A;  4ELU A;  4TN2 A;  2UUB J;  4DR1 F;  4ZVE A;  1YI2 S;  3BKU A;  2DT9 A;  4Q5V A;  1N34 F;  1E6V B;  3VHQ A;  4A4J A;  6FD1 A;  2KU7 A;  1D09 B;  3LGN A;  4J90 A;  3OUY B;  3AJ1 A;  1U48 A;  2RQC A;  4QJV A;  1VLY A;  2E1P A;  3H4B A;  3W9I A;  3PR4 A;  1Z2L A;  5ETP A;  3IRW P;  2RS2 A;  3C14 A;  1URR A;  3VAM A;  4OYP A;  3V4M A;  4HAC B;  4TNO A;  2YNI A;  2FZC B;  2P9C A;  2XLK A;  1S0M A;  2IJR A;  1U0H A;  2FHO B;  2AGQ A;  4C3L A;  4C9D A;  1S59 A;  5KFG A;  3RAM A;  4NLX A;  1DFD A;  2IM1 A;  2MMY A;  1LFW A;  2X51 A;  1QLN A;  2R8I A;  4Y2A A;  2V2Z A;  1TKX B;  1RP5 A;  1Q81 T;  1OSC A;  4DF4 A;  2KG1 A;  3CO9 A;  3FBF A;  1HPZ B;  1VR6 A;  2M2B A;  3Q8P B;  3UPF A;  2R7S A;  3VVT A;  1X4D A;  1Y00 A;  1X31 C;  1S1T B;  1WC0 A;  3AXM A;  3VGU A;  2BV3 A;  4MK9 A;  1IM6 A;  4P2M A;  2WK4 A;  5HVH A;  1LWF A;  4AD6 A;  4DSI A;  1LWE A;  3UQS A;  3MEG A;  3HSJ A;  3FFI A;  3JSB A;  4NLW A;  1YTY A;  1RCO B;  1ZS6 A;  1T95 A;  4IR1 A;  1NH8 A;  3C14 B;  2RE1 A;  4N77 A;  1NPR A;  2YNI B;  4IQX A;  2EWH A;  3GB0 A;  1U0H B;  4JI8 J;  2AX0 A;  4AXI A;  2CXE A;  4I6W A;  1TMJ A;  1JIH A;  3EPI A;  2GMJ A;  2F7V A;  2HBY B;  3CJ5 A;  1RJJ A;  5IXU A;  3LGM A;  2J6U A;  4PXC A;  2C2N A;  4W92 B;  1RKI A;  2DHG A;  4ZVF A;  3HVW A;  4RNM A;  3BS9 A;  3T6J A;  4GVB A;  2XMA A;  3LWL A;  1NKE A;  1CSJ A;  4ZPV R;  4K4X A;  3C6T A;  4UQT A;  2BJ9 A;  4RPF A;  2UU9 F;  3QGI A;  2HQI A;  3BGF A;  1NJY A;  3J7A 1;  4YN3 B;  4X4V A;  3ZTP A;  2HBR B;  1X9W A;  2IM2 A;  4EU0 A;  1RT7 A;  2I9S A;  3HSZ A;  3CDU A;  1IR1 A;  4NLY A;  1LWF B;  3MM7 A;  4OZ2 A;  5KAK A;  2R7U A;  1LWE B;  4QR0 A;  4Q45 A;  4PWD A;  4DV0 J;  3H20 A;  1TK8 A;  3MMB A;  1LFP A;  4NWB A;  1XTZ A;  3MEG B;  3FFI B;  1JWW A;  3RUB L;  4OYI A;  5LSR A;  5K8O A;  1KVJ A;  2AEF A;  3QAU A;  4KH1 B;  2F9J A;  3VV2 B;  2Q79 A;  4LSN A;  5ETO A;  3QSY B;  3U1M A;  4WK3 A;  3PFE A;  2DNZ A;  2V6A A;  1ZA1 B;  2DHS A;  4O0I A;  3FEY B;  2XQC A;  3WIU A;  1XNQ J;  5EN1 A;  3AA9 A;  1AA1 B;  2HIQ A;  3DYA A;  4M5M A;  2HZV A;  1RHJ B;  4TQR A;  2E5L J;  5HSP A;  2CJB A;  2X1G A;  2WW8 A;  1K44 A;  1MN7 A;  3RB6 A;  1W26 A;  3L95 X;  3W2W A;  3DHW C;  4GVB B;  4DFM A;  2ZWO A;  3C6T B;  1U24 A;  3BGR A;  3RTV A;  4UW2 A;  1XR6 A;  2LU2 A;  3LP2 A;  2HAF A;  2FGC A;  2L9N A;  1U45 A;  1RT7 B;  3CUL A;  3BGL A;  3LPE A;  1SH2 A;  3UE2 A;  3ZFV A;  4W98 A;  3MM7 B;  4TKT A;  1WC4 A;  5MAO A;  1NU4 A;  4PWD B;  3R8Y A;  1VQM S;  1DY3 A;  2WCX A;  3MMB B;  1NSQ A;  1U1P A;  1P9Y A;  4O0N A;  1N36 F;  4JP8 A;  2OML A;  1B4S A;  1FWL A;  1LK7 A;  4DV6 J;  2G13 A;  2CPE A;  4LSN B;  5IWA F;  2OEK A;  3O2I A;  2OSR A;  4F4Y A;  4F26 A;  2MHE A;  4QIV A;  3AB2 B;  3ZNJ 1;  2AJF E;  1IBL J;  4LF9 J;  2HQD A;  3DYA B;  4DWI A;  4ECT A;  3PX4 A;  3MFI A;  1WNE A;  5I3U A;  2DH7 A;  2DIT A;  5L1I A;  2MQM A;  1ICE B;  1FRX A;  2R8J A;  3U27 A;  4ED6 A;  4ZVR B;  3W2W B;  3V2U C;  1RT5 A;  4NYZ A;  5FLX U;  2JFD A;  4ZMM A;  3C6U A;  1L3K A;  2JEG A;  5HMY A;  1OPZ A;  3BGR B;  3GJT B;  3DC2 A;  2LXU A;  2B4O A;  1BXN A;  4DQP A;  3LP2 B;  3M9O B;  4IH5 A;  2KI2 A;  1GMV A;  1UVN A;  3RB4 A;  2IIH A;  2CQB A;  4PCQ A;  4DPT A;  1P9Q C;  2OO4 A;  4C97 A;  1O8B A;  5GVQ A;  5AXM A;  1LW0 A;  3PJX A;  4M5G A;  1TKZ A;  3I6P A;  1SBR A;  5LJ3 Y;  3D2W A;  1IKX A;  2LEA A;  4Y3C A;  1ZTW A;  3PHE A;  5CAB A;  4WFZ A;  2OTL S;  5DGB A;  2YKP A;  3GFZ A;  3NS7 B;  4JI4 F;  3NGS A;  2UV8 G;  3WC0 A;  3TA2 A;  2LQ5 A;  3NWG A;  4UZC A;  2DHX A;  1BC6 A;  1FDD A;  4P73 A;  1WKJ A;  3MEK A;  2CQP A;  3NMA A;  2GAH C;  5I3U B;  1RGV A;  4EBD A;  4O3S A;  4MKA A;  3CPW R;  4KPY A;  5KFM A;  4QYZ J;  2LVW A;  4MYT A;  2B56 A;  4O23 A;  5HAN A;  5DM6 Q;  1RT5 B;  2OP5 A;  2VJV A;  2YPY A;  3C6U B;  2AWZ A;  4HT5 A;  3IR7 B;  2B7C B;  1FX2 A;  3KLI A;  5F3Z A;  3F56 A;  4DLG A;  1KEK A;  4NOH A;  2ZVS A;  4I56 A;  2BA9 A;  5FDL A;  2CG4 A;  3OXG A;  4GKK F;  1X0F A;  3CMA S;  4RWW A;  2P5V A;  2PMH A;  2W1B A;  5LMU F;  4HEA 9;  3K2Y A;  1DHM A;  1LW0 B;  2CPX A;  9RUB A;  1JLA A;  1TKZ B;  4WKY A;  2B4V A;  4NLR A;  1IKX B;  3RB0 A;  3VZI A;  2E7V A;  2XGQ A;  2UVV A;  4F2S A;  2EC0 A;  1PYT A;  4F0M A;  1K1S A;  3PVX A;  5IV4 A;  1NME B;  3TZW A;  3VR1 A;  5F9N A;  5IQ6 A;  5IT9 U;  1FX4 A;  4PXD A;  2APO A;  1WDT A;  1WI8 A;  2ZD1 B;  4DPO A;  1SIZ A;  2KT3 A;  1WEX A;  1JLF A;  3DRX A;  4P9S A;  4OFZ A;  2HHT A;  2EG1 A;  2NXE A;  4KV8 A;  2A3J A;  4B9L A;  2MLY A;  2XCA A;  2BKO A;  3VZH A;  4HLB A;  1EQM A;  1MW7 A;  4RUA A;  3LWM A;  3K5N A;  3HUL A;  5CCM A;  4K2J A;  3MR5 A;  3QAT A;  1VBX A;  2D3O R;  3HO1 A;  1JXL A;  3CD7 A;  4LQ9 A;  5KFX A;  3KLI B;  3D6H B;  4PYA A;  5D78 A;  3JXO A;  3VAK A;  1D8Y A;  3IBW A;  4X66 F;  1NK4 A;  5FDL B;  2W01 A;  3JTO A;  4TLR A;  2B7B B;  1HKA A;  2VL1 A;  2J6T A;  3F41 A;  2KHC A;  3L3C A;  1JLA B;  1FNX H;  5F8L A;  1I5O B;  5ETR A;  5KT2 A;  3F0N A;  2QE5 A;  2VAS A;  4FXD A;  1N4L A;  4B9N A;  2W4D A;  4F4K A;  3K8W A;  5E0O A;  1SC4 B;  2H5E A;  2ZH7 A;  2VKZ G;  3A12 A;  4JI0 J;  1HD0 A;  2F5G A;  2CWK A;  3OTB A;  4ZA1 A;  2GS8 A;  4B9S A;  4QYZ K;  5GAG I;  4LF8 J;  1JLF B;  4PXB A;  4PXE A;  4LBI A;  2FLN A;  3B4M A;  4ZPC A;  1TUW A;  4ECX A;  4KV8 B;  3OBI A;  3BM7 A;  3IBF B;  3W7B A;  5L39 A;  1ZAX A;  2DNG A;  2M5Y A;  4UY8 T;  3MM6 A;  2ZC4 A;  3MM5 A;  3IO1 A;  1TL4 A;  4B3S F;  1Y5I B;  3KUG A;  3PDN A;  2ROG A;  2V2K A;  5CYJ A;  2O66 A;  4U8Y A;  2RSQ A;  2DXF A;  2OFG X;  2MZT A;  4HI2 A;  3DHX A;  1OY9 A;  2BBE A;  5KFR A;  4OX9 J;  4X64 J;  3DLG A;  1WEL A;  2BJE A;  2IC3 A;  3J7Z 5;  1RAF B;  3PHT A;  5DLG A;  1UEU A;  2CPI A;  2VBX A;  4PG7 A;  3NGU A;  3J80 Y;  3KG0 A;  2AYB A;  2ZC3 A;  4ES2 A;  2C2D A;  2AJ2 A;  2RKI A;  4LF7 J;  1Y10 A;  2DNQ A;  2ASY A;  3QT5 A;  4I2Q A;  2B51 A;  1NPK A;  3H5U A;  1YWX A;  2XY6 A;  5D0H A;  4S0M A;  1NKC A;  4NXN F;  4JI3 J;  3ZZZ A;  1ZZN A;  1GT8 A;  3I32 A;  2V67 A;  1ZA2 B;  1TFY A;  2H3E B;  1XN9 A;  1N0U A;  4RW9 A;  2VA2 A;  5KFP A;  4RNO A;  1AZS A;  5FD1 A;  2CJK A;  1RU2 A;  3NNA A;  2JVO A;  4DSF A;  4RNN A;  2UXC F;  1N32 F;  2I8E A;  2V4Q A;  4OYW A;  2UUB F;  1V3Z A;  2V8V A;  3MM6 B;  1YJT A;  2EFP A;  1WJ9 A;  3MM5 B;  3F73 A;  1SJ1 A;  3BEG B;  3G2X A;  2AP6 A;  2XEX A;  1S77 D;  3TAM A;  2HQG A;  2EXU A;  1OPI A;  1TL3 A;  2YKA A;  1U25 A;  3EVO A;  3VGS A;  3D1O A;  2AEM A;  2XI3 A;  3LO3 A;  3M8Y A;  3BH7 B;  4IG0 A;  5IC4 B;  3RBE A;  2IHR 1;  2DNL A;  1HWI A;  1YVF A;  2IC3 B;  5KOW A;  2GHV C;  1SJ4 P;  1U0S A;  3T1A A;  3FQK A;  2OGU A;  2PEB A;  2HPU A;  1NK8 A;  3BPS P;  2R4F A;  4N8N A;  1YKW A;  2MQ8 A;  2FY8 A;  3ENA A;  1PCA A;  2JEF A;  4K4Z A;  1WSR A;  2RKI B;  3SMZ A;  3HMJ G;  1R8C A;  1PBU A;  3PX6 A;  4I2Q B;  2J0S D;  4DOZ A;  1HBM A;  4OYO A;  3V4I A;  3H7H B;  2GIQ A;  1UW9 A;  2YX4 A;  4LSL A;  3N6L A;  3PG9 A;  4C0H A;  2EPI A;  3R2C J;  4E8U A;  1QJH A;  1AZS B;  1X9M A;  4D3G A;  1NLK L;  1Y5N B;  3QFH A;  1SL2 A;  2GO9 A;  1QSL A;  1ULR A;  3W2V A;  3DNC A;  2XUL A;  2OSQ A;  5THW A;  2OIH A;  3Q24 A;  3D3C J;  5KFZ A;  2LYV A;  1RT6 A;  3TAM B;  1KBR A;  2OUG A;  1TL3 B;  1GTE A;  2BDP A;  3R5G A;  5D0G A;  2NSB A;  1KN6 A;  1U1M A;  4IG0 B;  3CCT A;  2Y1J A;  4PQU A;  3ADA C;  3C46 A;  3PRD A;  4QU7 A;  3DXB A;  4FYD A;  4F02 A;  1G1X A;  4LFA J;  2YH0 A;  4OZ1 A;  4JI8 F;  3QFW A;  2O3D A;  3KFW X;  4L76 A;  4EZ6 A;  2JC0 A;  4IRC A;  3NGR A;  3FRY A;  1WG5 A;  5CZX A;  3AB4 B;  2KT2 A;  4NXM J;  2A2C A;  3D4J A;  4JI1 J;  3TUI C;  4DDF A;  3NEK A;  2XNR A;  1F9F A;  5J2M A;  4F8R A;  1MMD A;  3WX4 A;  3R1H A;  3O3L A;  3J81 Y;  3G8S A;  1Q4R A;  4WFB Q;  1HBM B;  3GE9 A;  3V4I B;  1Y4Z B;  5CXT A;  3DOL A;  3WIV A;  1WKK A;  2KG0 A;  1DTQ A;  5KFL A;  4LSL B;  1RKJ A;  1S9F A;  3PAC A;  4ZP8 A;  3KTQ A;  4P74 A;  2JFK A;  1NSK L;  4OHY A;  1ACM B;  3GCW P;  2HGM A;  1T9V A;  2DCU B;  4WFX A;  4ZP9 A;  4R0E A;  3X1L B;  1VQP S;  4ER8 A;  4EZ9 A;  4USH A;  4WXO A;  3AAW B;  3W2V B;  1YBA A;  2NXN A;  4NEZ A;  4O3N A;  1HQE A;  4QIE A;  1HYS A;  1YGY A;  1GEH A;  1R7I A;  4DV0 F;  1URN A;  5LMN J;  4PWW A;  4IFY A;  2N3O A;  2DKO B;  2OHD A;  1YRT A;  1FEH A;  4CM2 A;  3Q8U A;  1YJV A;  5T41 A;  4B9M A;  5EWG A;  1SQG A;  3VAF A;  1XC9 A;  3EVW A;  1VK8 A;  4NZ7 A;  1RYR A;  4PQU B;  1KQK A;  3KLH A;  5IOL A;  3HVT A;  3NGT A;  2BJ7 A;  1T9U A;  2QL5 B;  1WHV A;  1LQ9 A;  2VPY B;  1XNQ F;  1IBK J;  4OHZ A;  4KE5 A;  2DB1 A;  2QLF B;  4I6A A;  5F8H A;  1S6U A;  2IVY A;  1U8W A;  3H4D A;  4NLT A;  2BE7 D;  5HJX A;  2I1R A;  1HNX J;  2UV8 A;  5J2M B;  1JX4 A;  2D69 A;  3PIO Q;  2HFU A;  2VOD A;  5HBM A;  3SQG A;  1NHV A;  3DOL B;  3ENQ A;  3FVY A;  2FJX A;  1HBN A;  1W7W A;  1DTQ B;  1IVZ A;  1NBE B;  5IM0 A;  1S5Z A;  1IM4 A;  1S10 A;  5KG5 A;  3R5A A;  3C3L A;  3DGP A;  1J2V A;  3DKD A;  3EVM A;  3VAH A;  3B8H A;  3DOM A;  3EGN A;  2V4R A;  3SCI E;  5JJB A;  1T94 A;  5E33 A;  1H72 C;  1HQE B;  1KHW A;  1HYS B;  3OL6 A;  4BWJ A;  1U4B A;  1GH8 A;  4IFY B;  4FF2 A;  4O3O A;  4DMZ A;  4A8W A;  4USK A;  4C48 A;  2IJF A;  3LF0 A;  3B4D A;  3TJA A;  3FSY A;  1TZ0 A;  5A8R A;  4C8Y A;  4DV6 F;  3THP A;  4HH0 A;  3CCZ A;  3TVY A;  5C24 A;  2XSJ A;  2DVI A;  1RU1 A;  3PTW A;  3ZZ0 A;  3KLH B;  3PYG A;  3FCH A;  3HVT B;  3KUH A;  1ZPW X;  1FXD A;  2R7T A;  3BR9 A;  4ZVO B;  2MXY A;  5L9X A;  3EZU A;  4A8Y A;  4RJV A;  2ATC B;  2MKY A;  4TXS A;  1IBL F;  4LF9 F;  2FVC A;  4C8Z A;  4KHM A;  2A1B A;  3J81 j;  2C2E A;  3PW7 A;  4B9U A;  2HZC A;  4MTP A;  4F2R A;  3K7R A;  3TZX A;  2HZA A;  4RNH A;  3J7Y U;  2YH1 A;  4ELT A;  4NYP A;  2PMZ D;  3OHB A;  3NMR A;  1KVK A;  5HBM B;  3LP0 A;  2Z2L A;  3SQG B;  4ZJL A;  4CLF A;  4EWT A;  3GIK A;  1M1G A;  4CP5 A;  3G87 A;  4QW8 A;  4Y2C A;  1HBN B;  2XB2 D;  4X4O A;  5DZ6 A;  5IM0 B;  2DR8 A;  4USM A;  3BQ0 A;  2BM0 A;  4QOT A;  4DI6 A;  4UOF A;  1RAI B;  2U1A A;  1RWM B;  3DGP B;  2FHJ A;  4MT1 A;  1HHS A;  1BHN A;  2H1Y A;  3DOM B;  2M7S A;  1JJC B;  1ZOT A;  3L7U A;  3ZO7 A;  5E41 A;  2ZBI A;  2GNK A;  1FRK A;  3CDW A;  3EGW B;  4F4Z A;  2F4F A;  1GMW A;  5AE3 A;  1SL1 A;  1LKZ A;  3CED A;  1NHU A;  4LVN P;  3MED A;  4BCA A;  1FA0 A;  2FB0 A;  1SB6 A;  3ZZU A;  2KKH A;  3KK2 A;  1WOO A;  3NAI A;  4U9R A;  4ZVT B;  3BSO A;  5C24 B;  5JMN A;  2XSJ B;  1V3R A;  4EGL A;  1X4H A;  4WYL A;  2WBM A;  2GAG C;  4X4P A;  1GMU A;  4FPR A;  2FD2 A;  2BJ8 A;  1KR4 A;  2BE2 A;  3X3U A;  2MZJ A;  5DM7 Q;  4C0O C;  1FD2 A;  2KTQ A;  2DNN A;  2HEK A;  5IT0 A;  1VQ7 S;  2K1R A;  3E3X A;  1R8P A;  2CUY A;  1RYS A;  4C8L A;  4F50 A;  1WTF A;  2J9D E;  5E5N A;  3MUR P;  2VDH A;  1WTB A;  3RRK A;  2IRX A;  3LP0 B;  4C8O A;  3IM8 A;  3PCO B;  1QD1 A;  4OLO A;  4Y2K A;  1JLC A;  3B6B A;  2CQ3 A;  4DSE A;  3ETM A;  1SKR A;  2MZS A;  2PII A;  2K8G A;  3HHK A;  4B3M J;  4NI2 B;  2RHQ B;  4WIQ A;  1R3N A;  2ZNZ A;  4NA1 A;  1JJ2 R;  2K7K A;  2JLF A;  1IBM J;  3TR5 A;  1VQ5 S;  4QCL A;  2B9Y A;  2NLW A;  3ZTO A;  1K47 A;  4F0H A;  2V8H A;  2C28 A;  3MED B;  2N7C A;  1I6J A;  3KK2 B;  2R8G A;  3OJU A;  2NYH A;  1YJ7 A;  4NE9 C;  2V50 A;  4QWE A;  2RQ4 A;  3TOQ A;  1DTT A;  3QT6 A;  4Y2I A;  3DGV A;  4XPC A;  2Q43 A;  4FZV A;  5ETL A;  2A0F B;  4ZK7 M;  3J80 U;  1QSY A;  4XDD A;  2BE2 B;  3LH2 S;  4MMO A;  5DQI A;  2K1R B;  4DPX A;  2GFF A;  1SKW A;  5HAO A;  3T3F A;  2FHJ D;  2E7X A;  2LEC A;  5DG7 A;  1VQO S;  4MK8 A;  2H54 B;  4R8U B;  2IBO A;  2ZHB A;  2XS5 A;  1CG2 A;  1YJN S;  2VPW B;  3DLJ A;  3AY0 A;  4FYW B;  4OHV A;  1FO1 A;  1FKO A;  1NB7 A;  1W2I A;  1JLC B;  3UN3 A;  1S57 A;  3BH6 B;  4K4T A;  4KAI A;  2HHQ A;  3DLB A;  4CT9 A;  4OZ5 A;  1VBY A;  3MF5 A;  4KO0 A;  4UZB A;  1C2P A;  3M8W A;  3QJL A;  4CNZ A;  3S1T A;  3NXZ A;  4OZ3 A;  2H65 B;  5HN0 A;  2LQJ A;  1VRT A;  2J5A A;  2Z57 B;  3NRB A;  4G1Q A;  5ETS A;  3SBM A;  5DQH A;  4MIB A;  2OD6 A;  4CLT A;  3CW2 C;  5RUB A;  1OS5 A;  3ZNU A;  1SIW B;  2E5J A;  1VQ6 S;  3UO0 A;  3QZ8 A;  4U7C A;  1PJ7 A;  1RTH A;  2CQ2 A;  1WF0 A;  2QYG A;  3H2U B;  2RS8 A;  2MHN A;  1DTT B;  2B6A A;  4JI0 F;  4WP9 A;  1S6O A;  2W2O P;  4C7Q A;  2DGO A;  4Q0B A;  4AL5 A;  1REG X;  2M9K A;  4OLP A;  2WHO A;  4LF8 F;  3GWC A;  1TL1 A;  4ANE A;  5HQ8 A;  4C98 A;  1TFW A;  2R8K A;  4HH1 A;  5DRK A;  5HVF A;  3KMQ A;  5J2Q B;  1U1Q A;  3GJS B;  2EFO A;  4P2F A;  5JXS A;  4U67 Q;  5KT6 A;  2DO4 A;  3N5F A;  3MMJ A;  2BRK A;  5ETT A;  3AD8 C;  2EBG A;  5D6G A;  1VIO A;  1S4F A;  1FKO B;  2JJ4 D;  3BQ2 A;  2HQF A;  3DDI A;  1RTJ A;  4LMZ A;  2BE9 B;  2KJW A;  3CF5 Q;  3R1L A;  2DIU A;  1EP4 A;  2Q3P A;  4KO0 B;  1N5S A;  4OX9 F;  4X64 F;  2M0G B;  1R6V A;  5DDO C;  3PEH A;  2CAD A;  4OV1 A;  5GAD U;  2ERR A;  3Q8S B;  3KG1 A;  4K0K J;  4NRT A;  2B9E A;  4WF9 Q;  1VRT B;  3FEX B;  1WF1 A;  2SXL A;  4G1Q B;  4ILM A;  4GKJ J;  2DXD A;  1T11 A;  1EAR A;  2KO1 A;  1G7C B;  1QAY A;  4LF7 F;  1TK5 A;  2YXL A;  2ZJP Q;  1FJG J;  3H5X A;  1C4C A;  3M6W A;  3KJN B;  3D1H A;  5L1J A;  1RTH B;  4CLU A;  4TY8 A;  5KFC A;  2MY7 A;  2VG7 A;  2FDN A;  3LPY A;  1S76 D;  4DN0 A;  5CD4 A;  2LMI A;  3LUY A;  4JI3 F;  2IVM A;  2NSC A;  1JK9 B;  2B6A B;  2BAN A;  3WBZ A;  3JAM Y;  3V6H A;  3W5X A;  4Q0B B;  1KFD A;  5HMX A;  2ASD A;  3D54 A;  1HHQ A;  5BJR A;  1WSV A;  4J91 A;  4GVL A;  3CIM A;  2R7R A;  2B4U A;  5IS2 A;  1TL1 B;  5T14 A;  2LQB A;  3DDK A;  1UET A;  3L9Z A;  2RDD A;  4O3R A;  2OI2 A;  2JEJ A;  3M6U A;  3J81 U;  5K5M A;  4AXJ A;  1HFE L;  4OI3 A;  1X5T A;  1MML A;  4I68 A;  1RIS A;  3GII A;  2M3D A;  2QC3 A;  3NWR A;  2LQ9 A;  1KNZ A;  1HI8 A;  4GO7 X;  2WVF A;  1RTJ B;  3KOA A;  1SI9 A;  1EP4 B;  1RLC L;  1UVJ A;  1UAW A;  2VB6 A;  4IRK A;  2VOP A;  4JOU A;  4L3N A;  3GIJ A;  1SQE A;  2BVZ A;  1KOO A;  3CD0 A;  2G9O A;  4ZVH A;  3GQC A;  1FHT A;  4M1K A;  2KRB A;  2DH8 A;  3D66 A;  2X1B A;  2PO4 A;  1HWK A;  2MYF A;  4FF3 A;  4A8O A;  4TQS A;  2BAC A;  8ATC B;  3TUZ C;  4PYD A;  1JLE A;  3A3O B;  3U02 A;  3OHA A;  1WUU A;  3H25 A;  4CNY A;  4USW A;  3HFK A;  4TY8 B;  2D7S A;  3M9M B;  2VG7 B;  1UJ5 A;  5KFW A;  3CME S;  4LUB A;  3QNW B;  3BBC A;  5KG1 A;  4DX8 H;  1RT2 A;  2BAN B;  3N01 A;  4YDX A;  3MM9 B;  4K2X A;  3GIL A;  2KN4 A;  4CO3 A;  5A6P A;  4RW7 A;  1KD1 T;  3DLH A;  4N76 A;  3DRY A;  3R9L A;  1X8D A;  5D4L A;  2CDR B;  3GV5 B;  4WP8 A;  1KTV A;  1RLD A;  1FVS A;  3F44 A;  1KDN A;  4M5I A;  1QUP A;  4DQS A;  1RAA B;  3DOK A;  2YQ1 A;  4FXV A;  4DV5 J;  3EM1 A;  1P6T A;  2AYE A;  5ETM A;  4F4W A;  2CZ9 A;  2AIR B;  4XPE A;  1YK9 A;  3M8P A;  3QJP A;  3EZO A;  3HX9 A;  3RYL A;  3MPU B;  4H54 A;  4TY9 A;  5KG3 A;  4M95 A;  3RZA A;  5KFQ A;  4LF6 J;  1BQN A;  2BJD A;  2VF3 A;  1NEE A;  5GAE U;  2XS2 A;  3MOZ A;  4N41 A;  3M4X A;  2QN6 B;  2EFV A;  2D41 A;  3MCN A;  5C2C A;  1R6Y A;  1JLE B;  3UD5 A;  1X4F A;  4CLP A;  4NXM F;  2FVR A;  2Y1R I;  3FDS A;  2KM8 B;  1B70 B;  4JI1 F;  1JB0 C;  3AOD A;  3IFE A;  1O51 A;  4QBU A;  2XZD B;  4ZCM A;  1RT2 B;  2QA1 A;  3G4S S;  2VC0 A;  2EK6 A;  3MD1 A;  2L9W A;  2DGS A;  2G2Z A;  3PO5 A;  2GA7 A;  3RGI A;  4NAS A;  3UDV A;  3J7Y I;  2CDQ A;  5B0C A;  2LXI A;  1SJF A;  3CC7 S;  3H40 A;  1VI7 A;  4RW7 B;  1D0E A;  4EK2 A;  3K59 A;  3T6B A;  3KMS A;  1YZ7 A;  4K59 A;  1T3O A;  2IFX A;  3DOK B;  2UUC F;  2XYG B;  3G9C A;  3K8V A;  3SCL E;  3K89 A;  5LMN F;  1WOS A;  3M8P B;  5JUM A;  4ETZ A;  2CPF A;  3HHD A;  1FJE B;  1S48 A;  4HKQ A;  1CC7 A;  4KB7 A;  4DEZ A;  4MJK A;  3KUE A;  3V6J A;  4ED0 A;  4KKO A;  1PIE A;  1BQN B;  1HQU A;  4DCJ B;  3OL8 A;  2UVR A;  5DGA A;  1A6L A;  2FJD B;  3C2P A;  3QLH A;  4FNH A;  2PD1 A;  4ZVP B;  2GJ2 A;  1IBK F;  2CZ4 A;  4LT6 A;  1FXL A;  4DL3 A;  3THT A;  1GX5 A;  4A47 A;  1HNX F;  1R0C B;  1VQK S;  4C8K A;  3QRR A;  1HBO A;  1FE0 A;  4ZJQ A;  1S6Q A;  4KSE B;  4YOE A;  3MUV P;  4BDP A;  5KFD A;  3Q23 A;  1B3T A;  2VFR A;  4DF8 A;  1U1R A;  5F8G A;  2GMH A;  1ZAV A;  2HVI A;  2I2Y A;  1WOP A;  1Q7L B;  1KRP A;  2DNR A;  2W2Q P;  3MMA A;  3AJ2 A;  1Y0H A;  3FQL A;  1B99 A;  2C3O A;  3T9Z A;  1ELO A;  2V34 A;  4N7T A;  1S12 A;  4RR5 A;  2YX1 A;  1Y9O A;  3MPV A;  2M52 A;  4J9N A;  1IR0 A;  1Q78 A;  4ETX A;  3HT0 A;  1UWB A;  4DL5 A;  2HAI A;  3G82 A;  4DL7 A;  3KK1 A;  2EW9 A;  2XMW A;  2GJF A;  1W25 A;  3AD7 C;  2BMB A;  3OFG A;  3SFU A;  1S0O A;  4KKO B;  1HQU B;  2BQ3 A;  1S0V A;  3IWL A;  3LGH A;  3MAA A;  3PFO A;  4K4U A;  3QLH B;  4Y2M A;  5AXL A;  2DGW A;  3TJ9 A;  4LIR A;  5K8P A;  7FD1 A;  5LJ5 Y;  1M90 T;  4CQ1 A;  3DRR A;  1X4E A;  4A48 A;  1CPZ A;  3W5Y A;  4QR1 A;  4BC9 A;  2J6S A;  1Z4U A;  2YNH A;  3N79 A;  1HBO B;  1S6Q B;  4YB7 A;  3E2E A;  2KH9 A;  2F9D A;  1OIA A;  2ZDP A;  3IXQ A;  1VC0 A;  3W64 A;  7AT1 B;  4JI7 J;  3GPA A;  2E5I A;  2KDO A;  3G6V A;  2WSC C;  3MMA B;  4E98 A;  1Q86 T;  2GQ2 A;  3CDB A;  2FGO A;  4A46 A;  4RKU C;  1VQL S;  2AW0 A;  1FKP A;  1NDK A;  2VDI A;  2CNN B;  5KFT A;  3C19 A;  2CWX A;  1UWB B;  5E3Q A;  3BDP A;  3UNG C;  2HFO A;  4PPD A;  1TTH B;  3G82 B;  3OR2 A;  2AD9 A;  1RWO B;  2CJA A;  3OQ2 A;  3KK1 B;  2KM8 C;  3A1Y G;  3PO4 A;  2L9D A;  2XG8 A;  5A6W A;  4CLY A;  4FPI A;  1FRL A;  1FWP A;  3MAA B;  2XMV A;  2ZZT A;  1RAE B;  2MQN A;  2HQ3 A;  3DRR B;  3D3B J;  2VU5 A;  4J9M A;  1M5O C;  2YNH B;  3T1H F;  4DR6 J;  4OHX A;  1VK3 A;  1NK7 A;  2KVI A;  4F67 A;  4QW9 A;  3OXF A;  3AOA A;  5DDQ C;  4PG5 A;  4HTJ A;  3SYZ A;  2RF2 A;  1HIY A;  3BGU A;  2JRS A;  2MTL A;  2IDE A;  2YPZ A;  4KH0 B;  3HLU A;  2NQP A;  4B3M F;  4LVO P;  2BQR A;  3BO2 A;  2W7A A;  2M8D B;  3PXG a;  1NK5 A;  3L7P A;  3Q86 A;  1U7L A;  4ZIV A;  3AQP A;  3KYL A;  5B0G A;  1R8H A;  3CMQ A;  1I94 J;  4DR3 J;  1VQ4 S;  3DRS A;  3TQ1 A;  1IBM F;  1FKP B;  2RU3 A;  2EVZ A;  2DPI A;  5BYS A;  1PYO B;  5GME A;  3JQJ A;  3BBF A;  3OR2 B;  3QGP A;  4FS2 A;  4LRD A;  5GAD I;  3LQV A;  1XQI A;  4DV2 F;  4J9K A;  5HP1 A;  5C5J A;  2PSZ A;  3WX8 A;  3V81 A;  2ZUA A;  3R5C A;  6AT1 B;  3HHL A;  4DL2 A;  4KRW A;  3MPY A;  2F3J A;  4DV7 J;  4FBT A;  4QWA A;  2D3O 1;  1VC5 A;  3MD3 A;  1NJW A;  1CC8 A;  3GON A;  1WHX A;  4HYK A;  3TVK A;  1SJR A;  4YFU A;  1RA7 A;  3MCO A;  4M8L A;  3W1Y C;  1FT8 A;  2GHP A;  3IGV A;  5KFJ A;  4YQW A;  3W9J A;  2CQ4 A;  1NJZ A;  3JAM U;  2HK3 A;  2L48 A;  1VQS A;  2FTR A;  2HHP A;  3TNV A;  1F5C A;  1F0X A;  1NSA A;  3PV8 A;  3UN2 A;  2RF2 B;  3T1Y J;  4B9T A;  1YG0 A;  3GMG A;  5D0E A;  5M2P A;  1VGY A;  4DSK A;  1HMV A;  5BXI A;  2GQQ A;  2M70 A;  3QO9 A;  4X4U A;  4OYB A;  2DEI A;  1DQ9 A;  3UR0 A;  3A3N B;  1Q5Y A;  3KLV A;  4KIA A;  4PUO A;  2R2U A;  4IOB A;  3DRS B;  1OMS A;  3A8J A;  2CJQ A;  3UDE A;  1IJF B;  2ADC A;  4FYY B;  4CH1 A;  3WHI A;  5KFI A;  3FEZ A;  3OSN A;  1K9M T;  3A4T A;  2K7J A;  4YR0 A;  3MUT P;  1FRH A;  2FJE B;  4USU A;  3KHH A;  1RHM B;  5HP1 B;  2ROE A;  4DS5 A;  3V81 B;  3PRB A;  5ETV A;  3ISN D;  4OX6 A;  3HHL B;  3NCP A;  4EYI B;  3CGI A;  3Q8Q B;  4ED5 A;  1LXJ A;  2OAU A;  4ANC A;  1B7F A;  4TU7 A;  1A7G E;  2IPO B;  4URG A;  1J5O A;  4Q2L A;  1OJ4 A;  2JSX A;  4B02 A;  3W65 A;  4NL5 A;  1Q16 B;  2Z8Q A;  1S6P A;  1TKD A;  5JVH Q;  3NY0 A;  4ZKA A;  1N54 B;  1HMV B;  5CAA A;  3QO9 B;  4ECS A;  2FJW A;  3FZB A;  3IP0 A;  1RDR A;  2QSW A;  4K0K F;  4PUO B;  1IQT A;  1TQL A;  3HHL D;  1VCT A;  4HHH A;  3T5L A;  2ZE2 A;  4EUV A;  4GKJ F;  3O5T B;  4LR7 A;  4UF4 A;  2B0G A;  5ITH A;  3CJQ A;  4FS1 A;  4B9V A;  3NCQ A;  5GAE I;  1FJG F;  4KHR A;  1NM2 A;  3NNH A;  4CI0 B;  1Q7Y T;  2GGP A;  2LCW A;  5GAG U;  2K3I A;  1H7W A;  2ZWP A;  3KNA A;  1GXU A;  2GVD A;  4LRF A;  3GV8 B;  1F2H A;  2Y8W A;  4A8S A;  5M2R A;  1J5E J;  2E9T A;  1XMO J;  3BKT A;  1CQM A;  3R2D J;  4YS2 A;  1RBL A;  2P6T A;  3W3S A;  3ENW A;  4P7V A;  3BF4 A;  1LXN A;  4B17 A;  1F60 B;  4NCG A;  3OV7 A;  3TUJ C;  2OTJ S;  1JJ4 A;  4UST A;  2Y0S D;  1J5O B;  5HLF A;  2FJV A;  2QL7 B; 
#chains in the Genus database with same CATH homology
 3FBF A;  4EK2 A;  4UOG A;  1F6T A;  3Q83 A;  4DI6 A;  3ZTR A;  3Q8U A;  3B54 A;  4UOF A;  2DXD A;  1XQI A;  3VVT A;  5CAA A;  2BX6 A;  3EVW A;  3FC9 A;  3FCV A;  1BHN A;  5C7P A;  3B6B A;  3WX8 A;  5CAB A;  5IOL A;  4DUT A;  3NGT A;  1LWX A;  2ZUA A;  3L7U A;  2B8Q A;  3NGR A;  3VGU A;  3ETM A;  4KPC A;  2VU5 A;  2DYA A;  1K44 A;  1MN7 A;  1NDP A;  1B99 A;  3ELH A;  2HUR A;  4FKX A;  4ANE A;  3ZTP A;  1BUX A;  4F36 A;  2AZ1 A;  3EIC A;  3GPA A;  2DXF A;  4HR2 A;  3NGS A;  2BEF A;  3EE3 A;  1S57 A;  3VGT A;  3BH6 B;  4F4A A;  3BBB A;  1HHQ A;  2DY9 A;  3VGV A;  1WKK A;  1U8W A;  3G2X A;  1PKU A;  1WKJ A;  1NLK L;  1NUE A;  1VYA A;  3EMT A;  1EHW A;  1HIY A;  2HVE A;  3PRV A;  3BBC A;  1PAE X;  4C6A A;  4FKY A;  4ANC A;  1LEO A;  1NSK L;  4DZ6 A;  3ZTO A;  3VVU A;  3EVO A;  3VGS A;  1ZS6 A;  1UCN A;  4AND A;  1NDK A;  1WKL A;  3JS9 A;  2AZ3 A;  3BH7 B;  1MN9 A;  1NCL A;  3DDI A;  3NGU A;  3Q86 A;  1S59 A;  1NDL A;  4WBF A;  3ZTQ A;  1W7W A;  2HVD A;  3Q8Y A;  3FBB A;  3Q8V A;  4UOH A;  4W98 A;  3ZTS A;  1HLW A;  1S5Z A;  3R9L A;  3FKB A;  1XIQ A;  2DXE A;  3PJ9 A;  3FBE A;  1NSQ A;  3MPD A;  1KDN A;  5BXI A;  3EJM A;  3Q89 A;  4ENO A;  3FBC A;  2B8P A;  2CWK A;  1NB2 A;  1NPK A;  3DKD A;  3ENA A;  3EVM A;  1F3F A;  4CP5 A;  2NCK L;  1NHK L;  4O0N A;  3FCW A;  4S0M A;  1B4S A;  3EM1 A;  3GP9 A;  1BE4 A;  1NSP A;  1JXV A;  1NDC A;  3BBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...