2ZJRQ

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zjrQ00
2CPYA 2BZ2A 3LQVA 5GAGU 2ERRA 2ZJQQ 4CQ1A 1YJ9S 1DRZA 4LMZA 3SXLA 1SJRA 5H1SV 3MXHP 1VQKS 4QPTA 2O3DA 2M88A 1FJCA 4FXVA 5DDPC 1NO8A 2YTCA 3R27A 2AYEA 3P3DA 2DH8A 1QVFR 1UW4A 2N3OA 1DHMA 1YJNS 2K3KA 1YWXA 1WHXA 2CQCA 2EK6A 2M8HA 4ERDA 1DBDA 2LXUA 5LXYA 2DISA 1WHVA 3CCES 1VQOS 1Q7YT 4P6QA 2CQHA 2CPJA 4UY8T 3ZZZA 3FEYB 2EVZA 4C0OC 2MKHA 1YTYA 2MY7A 1U1MA 3NS6A 3BO4A 1YIJS 2E5HA 5LJ5Y 4WFBQ 2NZ4A 2CQDA 2KM8C 1M5PC 3Q2SC 1N8RT 1PO6A 2M4MA 3ZZYA 3MUTP 1WHWA 4WFNQ 3PIOQ 2RU3A 1FXLA 4CH0S 1D9AA 2DHGA 1WG1A 2N7CA 1X4FA 2GHPA 5IFMA 1U1RA 1S79A 2LA4A 4Z2XA 1X4AA 1VQ4S 1WI8A 1VQ5S 2LKZA 1PGZA 2DGOA 2RQCA 2DNQA 2RVJA 3HHNB 3NMRA 1JJ2R 1WF1A 2L08A 5IM0A 2A3JA 2CPIA 2KXHA 4TU7A 1YHQS 1VC0A 2JRSA 1WELA 5DDRC 2MHNA 2VODA 1WHYA 3S7RA 2VONA 2MY8A 3CCMS 2MQLA 2CPZA 1RK8A 5ITHA 3S8SA 3MDFA 2CQIA 4W92B 2M52A 5IQQA 2FPHX 5LSOA 2KXNB 1X0FA 2B0GA 2CPFA 2DH7A 1QVGR 3Q2TC 2MGZA 3VAHA 2KG0A 2OTLS 1SJFA 1F9FA 1FHTA 1X4BA 4OZ1A 2OSRA 3CCRS 1IQTA 3SDEB 3IRWP 2MXYA 2DGQA 1YJWS 2HVZA 5LXRA 2DNMA 1UP1A 3B4DA 3MD1A 4IOCQ 1ZH5A 1K9MT 5DM6Q 2K8GA 2V94A 2CQ1A 3CUNA 1YI2S 2U1AA 3S01A 3MOJB 1HD0A 3I55S 2KFYA 4QQBA 4UQTA 2EK1A 2JX2A 3G4SS 3NNAA 2RQ4A 1WF2A 2AYMA 3VAMA 1R8HA 1M5OC 2PEHA 2JVOA 2Q79A 2DGUA 1U1OA 1X4CA 4QU7A 2E44A 2FC9A 3P5TL 1M5KC 1N54B 2X1GA 2KU7A 1NJIT 4WCEQ 2M2BA 1X5TA 3MUMP 1YITS 1X4EA 2DHSA 2RUGA 5DDQC 5MLCV 1RKJA 2CPEA 2F3JA 5GVQA 2DH9A 3S6EA 2BOPA 2RRAA 1X4GA 5GAHU 3J7YU 2LEBA 1U2FA 2E5GA 3UD4P 1Q81T 4WF9Q 4PR6A 2D9PA 3CCSS 2KM8B 1U1NA 1VC5A 3MD3A 1URNA 1JJHA 2DNYA 3HI9A 5DM7Q 2YH0A 3G6ES 2DNNA 2G4BA 4WKRA 3B4MA 4WFAQ 1L3KA 3PIPQ 3VF0B 4Y00A 3N9UC 2DK2A 2DNPA 3P6YC 1UFWA 2AYBA 5D77A 3SDEA 2LYVA 2U2FA 2N3LA 3IWNC 2HGNA 3JB9k 2MKJA 1N88A 4IO9Q 2DHXA 2KG1A 1VQLS 3UWTA 1WG5A 2MQPA 2UP1A 2RNEA 2J76E 2HZCA 2NLWA 2RT3A 1QM9A 1WTBA 1BY9A 1SJ4P 2MKSA 2CPHA 4A8XA 2MKCA 2G1DA 1P1TA 3MI7X 2XSFA 3THPA 2ZJPQ 1FNXH 5HO4A 4F02A 3EX7B 5CYJA 2KT5A 2MZ1A 3VAKA 3D2WA 2JVRA 3RW7A 3CCLS 1U1KA 4U67Q 2ZJRQ 1A9NB 4FXWA 5CXTA 5LSLA 4M5DB 3BEGB 1H2VZ 2DNRA 3EGNA 5DETA 3VAFA 2J0QD 5D78A 5GADU 5JVGQ 2DO0A 2OJ3A 2XNQA 1OPIA 3ULHA 4YUDA 1WEYA 1DZ5A 3CULA 2OTJS 3H2UB 2OIHA 2FY1A 4C7QA 2MB0B 5BJRA 2D9OA 3VAIA 1VC6A 2XS7A 2KXFA 3G9CA 2L9WA 3SMZA 4YB1P 1CVJA 2X1BA 1NU4A 2AYGA 1VQNS 2GO9A 2RS2A 3DXBA 3U1LA 2MJUA 1O0PA 2CQ4A 2YH1A 2CQBA 1WWHA 2J0SD 2CQGA 2LCWA 2J8AA 3UD3P 1K8AT 2MMYA 3I56S 4Y0FA 2MYFA 1VBZA 2OSQA 1M90T 3NS5A 1H2TZ 1FJEB 5HL7Q 3UCZP 4PRFA 3CXCR 3CCVS 2CQ0A 3P49B 2XB2D 3J7ZT 1WG4A 1KOOA 1K73T 1AUDA 2E5IA 3TO8A 2M9KA 1SXLA 2YKAA 1FO1A 2KVIA 3VAGA 3G71S 3CC4S 3MUVP 1VQ9S 3CC7S 2LQ5A 1G2EA 2G0CA 4TU8A 2M8DB 4CIOA 3H2VE 1XN9A 4QU6A 3EGZA 1OIAA 2DGVA 2E5JA 2MJNA 2KHCA 2XS5A 1X5PA 1N52B 2HGLA 1H6KX 2LMIA 3R1HA 4OZ0A 2JWNA 2WBRA 4PKDB 3G8SA 3BS9A 2DGSA 2MQNA 2DB1A 2MZTA 2CQ2A 4LIRA 1WEZA 2RS8A 1S72S 2DGWA 1W2BR 1Q86T 2ADBA 2MZRA 4EGLA 1SJ3P 2FC8A 1HL6A 1X5SA 1R8PA 2I38A 2DIVA 3R1LA 1U1LA 5CA5A 2KN4A 2YWKA 5IM0B 2MZQA 3BO3A 2DNKA 2MSTA 2L41A 2I2YA 1FT8A 3CCJS 1X5OA 2DHAA 2DNZA 2KRRA 4YOEA 3OW2R 2DNLA 2CPXA 1U1QA 1HD1A 3UCUP 2D3OR 1KD1T 3K0JA 1KOHA 2X1AA 2MZJA 2N82B 3CF5Q 4V19X 2MKIA 2DNHA 1VQPS 2MQMA 1VQMS 3CD6S 2MQQA 3CCUS 2DITA 2PE8A 1UAWA 3L3CA 4LJMA 2CPDA 1SJQA 2MZSA 2LEAA 3TP2A 2QA4S 3VAJA 1Q82T 3BO2A 1HA1A 2KRBA 3THTA 2ADCA 2FHOB 3G96A 1KQSR 1U6FA 1ZZFA 3UCGA 2RRBA 3VALA 3CC2S 2SXLA 2F9DA 2HYIB 1VQ6S 1X4DA 1KC8T 3V4MA 1P27B 1VBXA 2KI2A 1M5VC 3US5A 1H2UX 1U6BA 2VOOA 3CMAS 2HGMA 2XS2A 5FJ4A 3LPYA 3CCQS 4WIIA 2MKKA 1U1PA 2LXIA 2XNRA 3RW6A 4IOAQ 2CQPA 4C4WA 2LECA 3UE2A 2DO4A 2CJKA 4TU9A 1JMTA 4ZKAA 5GAEU 2CQ3A 2QFJA 1OO0B 2DGTA 4F26A 1VBYA 2X1FA 1A7GE 1WF0A 5GMKa 1M1KT 2KH9A 3CPWR 2AD9A 4RU2A 4ED5A 5EN1A 2VOPA 5JVHQ 1WI6A 2DNOA 1ZZNA 1JJ4A 4F25A 2F9JA 2QEXS 4CH1A 3CTRA 2MPUA 4IUFA 2M0GB 3TYTA 5LJ3Y 3NNHA 1VQ8S 2DGXA 1OWXA 1WEXA 4BS2A 2KYXA 2M7SA 3FEXB 1B7FA 1X4HA 3MURP 2DNGA 2MQOA 3CMES 4TLQA 2LA6A 3NNCA 3DLLQ 4W90B 3G8TA 4J5OA 5DDOC 1FJ7A 2MSSA 2M70A 3U1MA 1D8ZA 2MGZB 2DIUA 1VQ7S
chains in the Genus database with same CATH superfamily
1CC7A 4W4MA 2ZOMA 3NGTA 5GAGU 3I82A 2XY5A 4DBQA 4CQ1A 2YWWA 1UVMA 4ZIWA 4LVNP 2P5VA 4ZVGA 1BQMA 4CNYA 2UV8G 4M5NA 3KXDA 5SZTA 3DMJB 1N34J 4JI1F 4JI5F 5IT9U 4ANCA 2KDOA 5AE3A 1EZZB 2M88A 1UVJA 4FXVA 2V2QA 2YNGA 2YTCA 5BYRA 5J1EA 4KKOA 2F7VA 3P3DA 2DH8A 3GE9A 3NY0A 4WYWA 4QIEA 1IM6A 1FNMA 3OL6A 2K3KA 2W9BA 2FUG9 5B0GA 3V6KA 1J5EF 1I51B 4N56A 3CNQP 1PILA 1YWXA 3NGRA 1NAQA 1SVDA 4H4OB 1IQZA 2AX0A 2M8HA 4F0KA 3K17A 1DBDA 2VL1A 4JI4J 2DY1A 2DISA 4HHUA 2R7VA 1I1GA 2UXDF 1RT4A 2HVHA 3K5PA 3CCES 5HBMA 1W26A 1Q7YT 3K58A 5E33A 4UY8T 2ZNYA 3D4JA 3IS9A 2FVSA 2NPIA 3M9OB 2YKOA 2KVQE 3DOLB 2K06A 1RJJA 2ZC3A 3GIMA 2Z4PA 5B0BA 1N5QA 5GMDA 2MY7A 1Y4ZB 2QV6A 4RBVA 1RT7A 3NS6A 5FD1A 3Q0AA 3BO4A 1YIJS 1LWEB 2F40A 2OLWA 2HFUA 1WUUA 2JEGA 1N8RT 4K59A 5FLXY 4C2MA 1KNZA 3ZZYA 1WHWA 4I6YA 1FWKA 2IJRA 2BW2A 3FGVA 2HPUA 2I8EA 3NBPB 3GP9A 1S1XB 2XY6A 1FXLA 4OYBA 4DR6J 2DHGA 1WG1A 2XZTB 1VDHA 2QYGA 4CLZA 4X66F 2GZOA 2IJFA 2HQCA 1T02A 2GHPA 4NLWA 2CZ9A 3V5RA 3WX8A 4NLTA 4G6VB 4PG7A 1GX5A 2RDDA 4PPDA 3OHAA 1T7PA 2LKZA 1J27A 1Q8LA 2EEYA 2L9DA 3MEKA 2IAJB 4IG0B 4URGA 3EM1A 3DXSX 2RVJA 2XLKA 2IAJA 4IG0A 1YLXA 4WTOB 3HHNB 1C1CA 3PRDA 3R6LB 2VHGA 5E0OA 2P9CA 3FRYA 3U27A 2A3JA 2CPIA 3W2VB 3ZZPA 4NCAA 4KHPJ 4OIXA 1R6VA 1HNIB 1KQGB 2XTJP 2JJ4D 2QTWA 3EGVA 2UU9J 2MHNA 2ZKUA 5DLGA 4C8LA 1Q16B 3S7RA 4ELVA 2XWXA 4ZPWR 2Y8WA 5EX0A 4C0HA 1N0VC 6FD1A 3CCMS 4J9MA 3MF5A 2CPZA 3FFIB 4X65F 4C8YA 1I94J 2XZDB 2JNJA 2F8HA 3L7OA 4K4XA 1JX4A 1IBMJ 4P73A 1ZAVA 2E9TA 4LVOP 1L3SA 2W25A 3BJYA 1RT3B 4ANEA 1KHWA 1PYSB 1YBAA 3EVWA 4ID8A 4DV7J 4OL8A 4E8UA 4NMLA 2FYXA 4ZVOB 3CCZA 3FVYA 5IT0A 1TK8A 3OL9A 2B0GA 3RG6A 4O3OA 4LF5F 1VHIA 5L1JA 2VFUA 3CCWA 1UMJA 3F0NA 3D7SB 3FNNA 4OYMA 1QVGR 2BJEA 3NGKA 2FIUA 2JH3A 1XMOF 2WBMA 2Z57B 3JQMA 2KG0A 1H0HB 1S1TB 2GVDB 3EDQB 1C1BA 1SJFA 2BJ8A 3JQKA 3QT7A 4F7VA 1HLWA 2C2ZB 4QIWD 1DTQA 1ZAWA 3OT9A 4WYLA 4DFMA 1JK9B 1RT1A 5F8GA 1RWVB 4Y3CA 4F67A 2FY8A 3W64A 3KJFB 4K2JA 1OQ6A 3IRXA 5EHHA 1PAUB 4DR7F 3CCRS 1IM4A 3SDEB 2RKIA 1J5EJ 4UUXA 4Y2CA 1L3TA 4B3RF 2W8KA 1CG2A 4HT7A 2ACMA 3VGUA 3L4BC 1YJWS 1P1LA 1RKIA 2V2KA 5KG7A 4B9NA 1F1BB 1X9SA 2VUGA 2DNMA 3MD1A 5LXRA 3NWRA 3PW0A 3MMBA 1K9MT 3BGLA 2H5EA 1QSLA 1WSVA 2RQMA 2HHSA 1NZAA 3RB3A 2XMWA 1J5OA 1YRTA 2V8GA 4K4YA 2V94A 3DRSB 2FHKA 1LWCB 3GILA 1TV6B 3EE3A 3M8ZA 5HLFB 1JIHA 3L7UA 3MPUB 3M7VA 4WE1B 3BPDA 4FPIA 1IKVA 2KFYA 3K5MA 2F4VF 3G86A 1S9GA 4UQTA 5DRKA 4M5HA 4ELUA 2RQ4A 2GGPA 4XDCA 2R7QA 2XHCA 3PX4A 3W5ZA 2YWGA 1R8HA 4DR1J 4GMKA 2JVOA 5CZVA 3SSSA 4OYXA 2ASJA 2OPSA 3V6DB 1F0XA 2DGUA 3OXGA 4QU7A 2FC9A 4OHXA 2YKMA 5F8LA 3KG4A 3IN5A 2X1GA 2WB4A 2KU7A 4J9SA 2G13A 1YGYA 4C0BA 5KTQA 1F9EB 5HMYA 2QE5A 2C2DA 1X5TA 5J2NA 5IT9Y 3ENAA 1HYSB 5KFFA 4U96A 2CRLA 4DG1A 2BJDA 1C0TA 5MLCV 1RKJA 4QYZJ 1NRKA 2CPEA 1WDDA 3MPVA 4WTYA 2R8GA 1CQNA 4ILLA 2IRUA 2KO1A 2PO4A 3QFWA 3BB5A 4Y6IA 1SUQB 3S6EA 3T9ZA 1X4GA 2E1MC 3DN9A 4YY3J 5GAHU 3M05A 4IOBA 2YPZA 1HQEB 5F9LA 3QFHA 2VBZA 1U24A 3GIRA 4DL3A 2DNYA 4WWSA 1IR1A 3KJQB 5DM7Q 1LW0B 3QYYA 2DNNA 2FHMA 2VBYA 2WCXA 3P5BP 1LW0A 4WFAQ 3E01B 4O0NA 2G4BA 1U02A 1MG7A 1L3KA 4MKBA 4GVBA 1H72C 3N9UC 2A2CA 3TA2A 2VFVA 2DNPA 3P6YC 1UFWA 2AYBA 4DFKA 4EZ6A 4JI4F 5L38A 2CXEA 2H51B 1R0CB 2OAUA 2EFVA 1HW9A 1TUWA 3D28A 8ATCB 2XWYA 4ED6A 3HP6A 1VJQA 2QC3A 5FLXU 3JB9k 4USVA 3VZIA 3C2PA 4RW6B 2NR0A 2KG1A 3TVKA 3M2RB 3BGUA 5HSPA 5KG0A 1SKWA 3R97A 3UWTA 2UP1A 1RAHB 2J76E 4FYXB 3H4DA 4LMZA 1FK9A 1WC1A 2NLWA 2OPRB 5HQLA 1QM9A 1NK5A 4IH6A 3HJVA 1FESA 1I3OB 1WTBA 3CJKA 1VFJA 1FERA 1LEOA 3MR7A 1RWMB 3OXFA 4DN0A 2UV8A 1FXRA 2AHOB 3FSXA 3OTBA 1G7CB 3QIDA 2JEFA 4ILMA 3M8RA 1FEEA 1N32J 4A8XA 4ZITA 1HNVB 2V50A 2MKCA 1TL3A 1RHQB 3DLKA 1P1TA 2H9ZA 4X84A 5ETSA 1U45A 2HFZA 5D8HB 4AL7A 1UWBA 4B3SF 2HVIA 4L73A 2HNYA 1FEHA 1TAQA 2E1RA 3FBFA 5KFKA 1T05B 3GFZA 5HO4A 3ONQA 3M8YA 1HMVB 5CYJA 1JXEA 4N5SA 2E29A 2B9EA 1HMVA 5AJ3F 5DGAA 4NWBA 3CJQA 3D2WA 2V2VA 2IM0A 3RW7A 1YJ7A 4WU2A 1WORA 2VFRA 4B3SJ 1FTRA 3HKZD 1XIQA 5F0UA 2PFFB 1P8GA 5IZHA 4F3OA 3OLAA 2AZ3A 1H2VZ 5FIIA 4U95A 3LPEA 1HBUB 2RF2B 4B9SA 2VG5A 2DNRA 5A8KB 5CCLA 2F4VJ 3AH6A 4LRBA 2DY9A 1D9DA 1UVIA 4HACA 4JI7J 1HWJA 3OTEA 1S0VA 2QZ8A 2KT2A 3Q8PB 3I6PA 3ULHA 4X66J 1HI0P 3A8IA 4OI4A 3PYGA 3OVSA 4WPAA 3R7NB 1QY7A 2OTJS 3V6JA 1AZSA 1BHNA 1OY8A 1VYAA 4GRSA 3TW0A 3KLHB 4DS5A 2P2CB 3GPAA 3C6TA 1SH2A 4KAIA 3NCPA 4CI0B 3KKFA 4C7QA 2IVYA 3C16A 5BJRA 4BC7A 3GSDA 2D9OA 3VAIA 3G9CA 4DV2J 2KXFA 4LBHA 4C97A 1ZAXA 4KGZB 4C11A 2BQ3A 4LF7J 2YQ0A 3HKWA 4DOZA 2XLJA 2C2RA 1UL3A 4UY85 4PWDB 3DYAB 3PR5B 3W61A 1JLBA 4CLPA 2KFZA 3D1QA 1RBAA 1NU4A 1NUEA 1TP7A 4LF5J 1VQSA 5C42B 2I5JB 2CVIA 2GO9A 3E3XA 1JQGA 1P9YA 1S1UB 3NNHA 1S1UA 1MROB 1S0NA 3U1LA 3KHGA 2MJUA 1DAXA 3MCOA 1O0PA 3ICLA 2BE9B 4QWBA 5KAKA 3OL8A 2BYCA 2CQ4A 4IDKB 1NSAA 4KGXB 4CP5A 2VQFJ 2YH1A 4FBUA 4CT8A 4WFNQ 4DR2F 2FJVA 4HH1A 3BSNA 4DV4F 2GIFA 2EG2A 3POTB 1WSRA 2LCWA 5ETOA 4KGVB 2E1AA 2Y1IA 1KEKA 3A8KA 4N41A 1DARA 4LIWA 3IGVA 1Q4RA 4A8SA 2VJUA 1Y5LB 2HRYA 2RHQB 3QWPA 3E8OA 4A47A 5K8PA 4G3IA 3CDUA 1FFSB 3LUYA 2K7JA 2OSQA 4MKYA 3NS5A 1HBMB 3KK3B 1XMOJ 1D0EA 1DQ8A 3BBCA 3KK3A 2DVIA 1LFPA 2W2OP 5HL7Q 3CXCR 3P8BB 2CQ0A 2FLNA 2Q6BA 4KV8B 2KHDA 3JSBA 3IXQA 3H40A 4B9MA 4TKTA 4HH0A 3U7JA 2EXUA 1HWUA 1T3NA 1DQ9A 1SXLA 3QAEA 2H3EB 3GU0A 1CULB 2XGPA 2UVVA 2XMTA 2IRYA 1RAFB 3MAQA 2AU0A 1H73A 3CC7S 4G1PA 4GC6A 1AW0A 2G0CA 3ITHA 4M5IA 4WXWA 4GKKJ 3RBXA 1RT4B 2QMUB 4TYAA 4ZLPA 4JYAJ 2WVEA 1XN9A 1NLKL 1FJCA 3M2VA 1XR5A 2KHCA 5A8RA 2X51A 3UVJB 3IMQJ 2ZHBA 2XS5A 4LSLA 3BREA 4EEYA 3PW7A 1B0PA 2HGLA 2QL9B 1H6KX 3FSYA 3NRBA 1TKTA 3QSYB 3OSPA 2IPOB 4MH8A 4JV1A 1T3OA 2P6TA 5IQ6A 2XQCA 1HKAA 1FKOA 2IIHA 2HFOA 4LSNB 4IO1A 4PKDB 9RUBA 1H3DA 2YNIB 2LDIA 3M4XA 4P52A 4CYUA 2HWTA 1RWUA 3AJ1A 2W24A 4M5JA 2OI2A 1HPZA 3DLGA 2DGWA 4ETXA 2WSFC 3KLEB 3O6QA 1Q86T 3M6VA 2ADBA 5G4DA 1TFYA 3RAQA 2VASA 4WJBA 2HBQB 2FC8A 2AF6A 3L95X 1X5SA 1QE1B 4QR1A 1GXLA 3J81j 1HNZJ 2PA8D 3I0SB 4FPRA 1KLMA 3R1LA 1AT1B 3PHEA 4L76A 4DR2J 3FQKA 1GTEA 3BM7A 3LANA 3NXZA 5K14A 2BANB 4OX8A 3KK1B 3ZZUA 1F60B 5K14B 1CBKA 2MZQA 3H98A 2DNKA 3WC2A 2E7WA 3TJ9A 2I2YA 1Q78A 2RH3A 2GS8A 3GV5B 1G1XA 2DHAA 4CRJA 3KK2B 2V2ZA 4MK7A 4YOEA 3MGJA 4JI1J 1UA1A 1QDUB 3OW2R 4JI5J 1VR6A 3IBCB 3SSQA 2CPXA 3OSNA 1U1QA 2YKNA 1REVB 2YQ3A 3UCUP 5KFWA 2XG8A 2W2MP 3C6UA 3IWLA 1KRPA 2N82B 2H5IB 1SH0A 2B6AB 2BA9A 2BW7A 4IFYB 2ZH2A 1HBNB 1VQYA 1MU2B 3D3BJ 1VQMS 2KZMA 2GIQA 2CIMA 3JS9A 4OJGA 3CD6S 3CCUS 5CCMA 1EARA 1UAWA 3QIPB 3L3CA 3W66A 3Q24A 3QIPA 1CJUA 1RTJB 4NLOA 1JLAA 1RUSA 5HANA 1RT6B 3VAJA 4ZLNA 1RT6A 2FB0A 3LP0B 3THTA 2ADCA 4N8OA 3OUYA 4LFCJ 3QLHA 2RDIA 2WZ1A 4OI1A 2ILYA 1FA0A 1VJWA 2J9CA 1PYOB 5BR8F 2BOAA 3KLFB 2FVRA 4U9RA 1TKZB 4NZ0A 2JLEA 2R2UA 1FD2A 2QMWA 3QAUA 2IC3A 3I96A 4OQJA 3TVYA 2ZD1B 4D3HA 2IC3B 1RWKB 2SXLA 2EPIA 3ZTRA 4KB7A 1FDAA 2H65B 1JLCB 1KC8T 4QIGA 2DRDA 4KHRA 4EZ9A 2KI2A 3H5UA 3KJVA 2QO3A 4F04B 5BR8J 4RJVA 2XS2A 3KJVB 4YP3A 2VOOA 1YJTA 1RWPB 1XNQJ 4TY8A 1UFLA 1FI4A 4PAAA 2NUUG 3OQ2A 5T41A 4EMDA 2XCAA 4KY3A 1EB0A 4X64J 2GC8A 3CCQS 4WIIA 2MKKA 3HHEA 3SYZA 4Y2MA 2OELA 2XNRA 3RW6A 4BLGA 4IOAQ 4DR1F 2COLA 1A6LA 1PYTA 4C4WA 2ZUAA 3UE2A 5D15A 5ETPA 4RZRA 2HMIB 4LF8F 1B4SA 1Q5VA 4ZKAA 4BBYA 2VG6B 3H42A 3OTOF 1Q53A 4ED2A 4DPWA 2DGTA 3JTOA 3VR1A 1VBYA 1S4FA 3VCDA 2BXJA 4YEAA 2HBZB 4CO0A 1TKDA 1CJVA 2X1FA 3OL7A 5KFDA 2AD9A 4OFZA 5D0EA 3N5BA 3SV3A 2JEIA 4NE9C 2R7UA 1W7WA 5AE1A 1ZZNA 1JJ4A 4JI2J 1ZYQA 1E6YA 5LSRA 4CH1A 3CTRA 4KIAA 4AL6A 2QEXS 1PG5B 3K5LA 2BJ1A 3R5JB 3FBEA 4OV6A 5AXMA 5A8WB 3KJNB 1U7LA 3E51A 1NK6A 2A0FB 4RX6A 2IBKA 1VQ8S 2EBGA 1OWXA 2WB1D 1WEXA 3RAMA 3FDSA 4F4XA 4LFBF 1H38A 5ETKA 3FEXB 5F8MA 2J9DE 3CJSA 3BKUA 3K89A 1JLFB 3P96A 4IKAA 4OHVA 1T03B 1TELA 2Y1RI 4C6AA 3JSMB 3N6NA 5HROB 1RAOA 5EWEA 3DKDA 3RB6A 3LGMA 3NNCA 2GAHC 3ETMA 4B3OB 4K0KJ 5GMEA 4B3MJ 2HNZB 3MAAA 1JKHB 4J5OA 3AXKA 4NCGA 5I3UB 1UVKA 1Q0NA 5FDLA 2VDIA 3K2YA 3TA0A 4BHQA 5DDOC 4ECXA 1K44A 2MSSA 1FJ7A 4RUBA 3MFHA 2W01A 3CJTA 3DOMA 3I0RA 3HD2A 4C8NA 5C24B 5D3GB 1NKBA 1N36J 1L3UA 2R8KA 4O3SA 2DIUA 1K0TA 5J2MB 2AX1A 5C25A 2AP6A 2BZ2A 4B3MF 2HWHA 2Z30B 3AA9A 3SXLA 1YG0A 2ZBCA 2ZC4A 1N48A 3RRKA 4ZPTR 1JLGA 4HKQA 2FLLA 4DHVA 4OZ2A 4KRWA 3CW2C 3ILOA 3O1LA 2V69A 1TTHB 1NPPA 1TZ0A 3KLGA 3H25A 2BUNA 1QVFR 1U8SA 1UW4A 2OO4A 3EICA 4KPCA 4NLXA 3SQGB 2N3OA 1YJNS 1N32F 3DOKB 4K8RA 3SI8A 1UW9A 1TQLA 2DR8A 4ERDA 1RHMB 1S6OA 3GIIA 2HNDB 5LXYA 4AE5A 2P8IA 4P2XA 1WHVA 5KT7A 1VQOS 3PW4A 1MWZA 4ITSA 2DCUB 3ZZZA 5IV3A 4AQYJ 3MAHA 4J9KA 1ZA2B 1V5IB 4DR4F 4C0OC 1B3TA 1NHKL 1R43A 4ECTA 2PMWA 4DSFA 2E5HA 4UOGA 1T05A 1T94A 2BJ7A 2YNFB 5LJ5Y 4CO2A 2KM8C 3T3FA 3M6WA 2JC0A 2E1CA 4OI0A 3HVTA 5LMNJ 2E5LJ 1APSA 1V5VA 3W65A 1KSPA 3NOGA 1FTCA 1Y11A 3JQJA 5L1IA 4IR1A 1B0VA 2ATLA 2IFXA 1NDLA 4CLFA 4CLTA 5KFMA 4DSKA 2B3TB 1DFDA 4ZP6A 1NJWA 1C0UB 2ROGA 2OD4A 1LKZA 4ECUA 1EKSA 1EETA 1PJ6A 4HDGA 5IFMA 1FDBA 1U1RA 1X31C 2D41A 3O5TB 5C5JA 4Z2XA 2R7SA 1U09A 3DM2B 4ECYA 1VQ5S 3F56A 1PGZA 1RU1A 1HW8A 1UEUA 1XJWB 1VMBA 2QLFB 3AD7C 2DNQA 2IRXA 3BGRA 5C7PA 1KQSR 5F0WA 1JJ2R 2MQ8A 1RT5B 4RNOA 2N7YA 3KHRA 1RCOB 4MYUA 4CO3A 2KXHA 1YHQS 1OJ4A 3WDOA 2J7KA 4R5PB 3V81B 3BH6B 1U6ZA 5DDRC 2FJEB 3M8QB 5KFZA 5F8IA 2VODA 3EXYA 4M8LA 3HFVA 3SIPB 3W9HA 4CLYA 4YR2A 1XR6A 2MQLA 1RHUB 2HVEA 3R8YA 4DR5J 2L48A 1RK8A 3QSIA 4WXOA 2ZH7A 4ZVQB 1LV5A 3T5JA 2V34A 5ITHA 4MIWA 2X3DA 4FVCA 4NEZA 1X9MA 3S8SA 1QUPA 4OZLA 5D0RA 5KG5A 3AJ2A 3MDFA 4CM0A 1CLFA 3W60A 4NRTA 3N4WA 4OHWA 5T7LA 4EUVA 3BQ0A 4NA1A 2K1RB 2JDJA 1NMEB 3N79A 3NGUA 1GMVA 2K1RA 4QPXA 1X0FA 1BQNA 4X65J 1EP4B 3SEOA 4PQUA 2Z2ZA 3I87A 4WZQA 2VBWA 1HARA 4J9LA 2RQKA 2BJ9A 4NPOA 3VAHA 1NK4A 1REGX 2UUAJ 2BQRA 1FF2A 2AJ4A 4AQYF 3HJFA 1FHTA 3AB4B 4A8KA 5I3QA 1WNEA 1VRTA 4FYVB 5E3QA 1ZTTA 1QAXA 1J2VA 1RACB 2FHJA 4LF4F 5D6GA 3HLUA 1BQMB 3BYPA 4RL1A 4CLUA 2IMWP 2J9EA 2JOQA 1IQTA 2KZZA 3FC9A 3IRWP 3Q89A 4DUYJ 1R3NA 2V67A 2Q3PA 2MXYA 1BQXA 1T9YA 5B0FA 3I31A 4ER8A 1X7VA 2W2PP 5J2QA 1AA1B 1U2CA 1V3ZA 2O1PA 3HHKA 3QT6A 4CLSA 1UP1A 3BYRA 3D5MA 3N5FA 4IOCQ 4NCBA 1L3VA 4LF9J 2VQEJ 4V1Ak 1FKAF 1HI1A 5I4MA 4TXSA 3CD0A 2YVSA 4U7UK 5B09A 3EUNA 4AD6A 1YI2S 1O8BA 2WW8A 2U1AA 3S01A 1WOPA 3W2WB 3AOAA 3WHIA 1MN9A 4KQZA 2E1PA 1XTZA 4K4UA 3EMTA 3KG1A 3GJTB 3MMJA 2I9SA 4OYWA 4RNHA 4CCHA 4UOFA 3NNAA 2NXJA 3G4SS 1XWLA 2G0JA 2MLYA 2O5DA 2W4PA 4ILRA 1IBLJ 2AYMA 4KO0B 2QFIA 3OJSA 4DL6A 2ASYA 4LR7A 2CNLB 1KVJA 3N6LA 4ZCIA 3PCOB 1CEZA 4HI2A 1TK5A 4F3QA 2KKHA 1NH8A 4JBCA 5EGYA 3NCRA 4DLEA 3HPOA 4FP9A 4YY3F 2E44A 3IM9A 4OX9J 1N54B 1KWMA 4LSNA 1FVQA 1DQAA 1SCJB 2M2BA 5IT4A 5DZ7A 4EYIB 4DL7A 1S1XA 4PUOB 5J2NB 2HIQA 4M5DA 3TNVA 1DTTA 1X4EA 3MUMP 3QT8A 2R2TA 4IG3A 1NNDA 3UDVA 1NSPA 3GQCA 1D3WA 2A18A 1O6XA 3KWMA 4IG3B 1XMBA 2CZ4A 3GFXA 4NLQA 2F3JA 4UZCA 4C3KA 4OYPA 2PT0A 2DH9A 2DKOB 5CYQB 4D3GA 2EC0A 4JYAF 2BOPA 1AB8A 4U7UD 1A0OB 4L72B 1WC0A 2GQCA 3J7YU 4MFBB 1G4CA 4PYDA 4F0MA 3PM9A 3CT9A 1Q81T 4WF9Q 1DLOA 2D9PA 2CVEA 2RHSB 2KM8B 1U1NA 4I64A 2HBYB 1FX2A 3MMAB 1YK9A 2JLFA 1C1CB 1F3VA 1JJHA 2VH7A 3HI9A 2OPQA 1URNA 1YJVA 3M9NB 1OY6A 3G6ES 3G6XA 4WKRA 4ECWA 3UN5A 4DU8A 1JLEB 1HIYA 3PIPQ 4Y00A 5KT4A 4GVBB 1N5SA 3CGIA 4DPYA 1SB6A 3GSIA 3MTKA 4J9RA 1Q79A 4M94A 4PWUA 3JXOA 2XZWA 3GG1A 4U8VA 3PR4A 2UVRA 1HQUA 1D1UA 3E2EA 2DPIA 2AZ1A 2AV5A 3GB0A 4TYBA 3IWNC 1E6VA 2XYGB 1ELOA 2IM1A 2QLWA 3QBCA 2HWIA 4F0HA 3D54A 4IO9Q 3DLEB 4I2PB 3MEGA 2WOMA 2CADA 1XQIA 4RW8A 3DLEA 4I2PA 4DV6J 1F3FA 1N4LA 3AQOA 2HZCA 2FHJD 2H5JB 2AJ0A 3IA0A 2YY3A 4TQRA 2WW4A 3TEHB 3EVOA 1RTHB 1RCXB 1BY9A 4P10A 1RAAB 4JI8F 1SJ4P 4IH5A 1R89A 2QYCA 4FZVA 5IWAF 1R6YA 2MKSA 4RO0A 2ZH9A 4A8FA 2CWXA 4EO8A 5CD4H 2DXDA 1SC6A 2G1DA 5KG1A 3DI6A 4FXDA 2B4VA 3FQLA 4F2SA 3V6HA 4QR0A 4DUTA 1DTQB 2XSFA 4X64F 5KFNA 3H4BA 2ZNZA 1UEVA 5CYMA 2HNYB 2HQGA 1X9WA 5CYMB 3EX7B 5M2PA 2MDAA 3DRRA 3TUIC 2KT5A 3VAKA 1Q7LB 1RP5A 2JVRA 4WK3A 4M5GA 4YB6A 3NS7B 2JC1A 5ETQA 4UUWA 2QRRA 1XERA 1U1KA 3W5YA 4DQIA 2UXBJ 2AKWB 4HL9A 1A9NB 3TAMA 2FLOA 3BDEA 3T19A 4NMXA 4C8MA 3EPIA 2J0QD 5DETA 3DRSA 4PYAA 5D78A 5A0YB 5JVGQ 2K3IA 4RBUA 5A0YA 2C28A 2OJ3A 2XNQA 4LR9A 4DV5J 3NOCA 3AY0A 1B7YB 1IKVB 1RWOB 4DR6F 3PEHA 3ZXWA 3NAHA 2FGOA 3K8VA 5L9NA 2NXCA 4M5LA 2B7CB 4P7VA 3J7Z5 1PSDA 3A4TA 1UKUA 4ZLJA 4HHHA 3MM5B 3MM6A 4RWXA 2AIRB 4ICLA 3E01A 4DV5F 4QYZK 3H5XA 4RNMA 2GAGC 2ZBIA 2RE1A 2NXUA 1NH7A 4ZVRB 1RTDA 4ZCKA 3HDSA 4I68A 2PEBA 1OY9A 4PABA 2EFQA 2AYGA 1FRHA 1UEKA 2CKWA 2VFSA 4HHJA 5J1PA 2QJ3A 2KTQA 1GQEA 2R42A 1N0UA 2LXFA 3QRQA 3DXBA 2J0XA 5BYSA 3M2RA 1UCNA 4I6AA 4A8OA 4DF8A 2ZVIA 4JI6F 4ZMMA 4B3TF 3PY8A 1FK9B 2R9LA 4C9DA 3MECA 2IYGA 4MIAA 1QTMA 2CQBA 1WWHA 3F41A 3GV8B 2J0SD 2EFNA 1JKHA 4H54A 1HQEA 1QAIA 3CD7A 2ROEA 3D9BA 1WDTA 4O4GB 1K8AT 4FYDA 2X3GA 3DOMB 2GO8A 3I0RB 4H4KA 3TARA 3I56S 5MAOA 1S1WA 1WD6A 3ZNJ1 4Y0FA 3R2CJ 1S12A 2G2OA 1EJ7L 2AEFA 4ZIVA 3K7RA 3Q22A 2HFSA 3P45B 2G2YA 2J7WA 1T8EA 1K47A 3P4UB 1IKYA 4A46A 5ETTA 1GMUA 1FWLA 2DXFA 1M5SA 3GJSB 1FJEB 1XMQJ 1NZ8A 3HVRA 1S7IA 1ZTWA 4DV6F 2BKOA 1IKWB 1FNOA 3D1HA 4X4NA 2VDHA 2D3O1 3J7ZT 2GHWA 5J1EB 2V4JB 1WG4A 3NKYA 4OZJA 3OBIA 4Q0BB 3HSJA 3TUPA 2ZVSA 4WZMA 1KTQA 2Q1LA 3IFEA 3LALA 2C3MA 4MMOA 3TO8A 5KFOA 3HCXA 3LP2A 2YKAA 1CSJA 4Q43A 1HBUA 5KFJA 3VAGA 2HLUA 2GW8A 4A48A 1UVLA 3G71S 3MUVP 2YX7A 4NXNF 2VZ9A 1N34F 4KH1B 3TX8A 2LQ5A 1G2EA 1RT2B 1U48A 1V9OA 1U26A 4I7FA 1NSKL 5HK4A 2HW3A 4CIOA 5SUHA 2BKPA 5HBMB 4Z37A 3MMCB 3M8PA 4OJHA 3VZHA 1OIAA 2VIHA 3IS9B 3M8PB 2D7SA 4DUZJ 3DLKB 1X5PA 4NXNJ 4AL5A 2BV3A 1F5AA 1PIEA 1FRIA 2QSFA 3M32A 1NDCA 4ZVEA 3ZZRA 4ZN3A 5HJYA 5AJ3J 2IM2A 3FRZA 2MLXA 3ZNUA 2WBRA 3DRPA 3DYAA 2HBRB 3PYFA 1WKKA 3KMSA 1JLBB 1S4EA 2F63A 3MR3A 4ED8A 2DGSA 4QW8A 2DB1A 3NBPA 4Y28C 5L1LA 2MZTA 2CQ2A 4LIRA 1N6QA 2AJ2A 2RS8A 1S72S 2YKQA 4ZP7A 5A2QY 3TAPA 2HKEA 3ET6B 4UT4A 2DT9A 4O0IA 1RSCA 3MM9A 3DRYA 4EGLA 2PGCA 4NYOA 2HHUA 3LWMA 2PI5A 4YHHF 5D4LA 2QLXA 4RUAA 1LQ9A 5CA5A 3ZFVA 2V5HG 2KN4A 2IA6A 1RT5A 3KHLA 4KGKA 2YWKA 1VRQC 3M1VA 1RI7A 1RBOB 3BO3A 1N36F 2DR7A 4WP9A 1SL1A 1SV5A 2UUBJ 3IO1A 2UUTA 4ECQA 1X5OA 1SV5B 4U7CA 3OFFA 4KYZA 4PXEA 1T9XA 1IBKF 2DNZA 2J9DA 2B43A 3QATA 4YDXA 4O3PA 3EZUA 1M1GA 3KK2A 1Y00A 1G3OA 4GKJF 2GMLA 2V8DA 2RSQA 2VPXB 2WSCC 1IJEB 2DNLA 4N7TA 1SI9A 3FFIA 1F5BA 3H59A 3BDPA 1FX4A 4KKOB 5F9NA 4DR3F 4K4VA 4JI3F 1SBRA 3GLJA 5CAAA 2GMJA 2BR0A 2DNHA 1X0PA 1VQPS 2D3ZA 1MN7A 4H4OA 1N33J 3EYZA 2Z56B 4K50A 4O23A 1SJQA 2LEAA 1T9WA 4NOHA 3RAXA 3ITHB 1Z2LA 3LW5C 1JLAB 3POTA 3HULA 5D0GA 2DEIA 3RUBL 2HS4A 5F41A 1JLQB 2BE2B 2PN6A 3BO2A 3TQ1A 3MZIA 3BQ2A 3DRXA 4M95A 3OVBA 2NS1B 4DR4J 1GT8A 3QLHB 3G96A 4OYZA 1U6FA 4USTA 4OI2A 3UCGA 3UVJA 1RA7A 4B08A 5HP1A 4LSLB 1C1BB 3VALA 3M6UA 2Y0SD 2VPWB 3HSGA 4RW9A 3KG0A 4RW9B 3RBEA 2HYIB 3KUEA 4LF6J 4A8MP 1VQ6S 4ZOSA 3M30B 1JLCA 3SBMA 3TEGA 4NLSA 1VBXA 1F2HA 1M5VC 2EC2A 2LQ8A 1H2UX 1SKUB 4P71A 4L3NA 3KTQA 2ZHOA 2WAQD 3GR0A 1JWWA 2ZZMA 5FJ4A 4LF8J 1GAOA 3MEDB 3LPYA 3CVKA 3SCLE 2RIJA 4CTAB 3HF5A 1R8AA 4ANDA 5M2UA 3UPFA 2V6AA 1RA6A 2LXIA 4X62J 3D0HE 2LLZA 2UXBF 4LFAJ 2HHHJ 4ZP9A 3AQPA 4PQAA 2V68A 2OGUA 5DQHA 1F6TA 4GKKF 4DV1J 2I0XA 5B0DA 2APOA 1Y5NB 2DO4A 5BXIA 3H7HB 3BQ1A 4X62F 1HWKA 2CA9A 3N28A 3D6FB 2CJBA 4P72A 5B0EA 2BANA 1HHTP 1R0AB 2VG6A 3O44A 1YX2A 4B9UA 1Y3JA 2OPPB 5HAOA 1RT7B 1YQHA 2EFGA 2OPPA 1M1KT 2R8JA 1VK3A 1LWEA 2MTLA 3TANA 4RU2A 4X4SA 4PG8A 1ICEB 1AROP 3O8WA 4MKVA 5EN1A 2ZWOA 3EZOA 3T1HJ 3TJ8A 2F9JA 4X4UA 3M8WA 2XMMA 5HMXA 2QA4G 4N47A 1EHWA 3WQPA 1NXIA 4TN2A 5A6WA 2UU9F 1LW2B 5D4OA 2VG7A 1NPRA 1D9FA 1ZM2A 3TYTA 1S6QB 2H54B 5LJ3Y 4Q5VA 3GYNA 2YX1A 2DGXA 4DR5F 2EWHA 4OMFG 2KYXA 1QTNB 2VPYB 1C0TB 2M7SA 3I5BA 2QX0A 3QQCD 2ZFHA 4IQMA 4QYRA 2CDRB 2QT7A 1B7FA 1KVIA 3I32A 1BWEA 2J8SA 2CUYA 3IG1B 2YKPA 3BBBA 5EUHA 3ZO7A 4W90B 3ZTOA 2O66A 3MCSA 1QE1A 1RTJA 4USKA 4ZVSB 1VCTA 3I0SA 2EG1A 2WVFA 2NSCA 3R6GB 4PG5A 5JXSA 3PW5A 2KT3A 2J7UA 1TKXB 3N6MA 4PXCA 5CQGA 4KHMA 3U1MA 4CDIA 4HDHA 3EZ5A 5D0HA 1IBCB 5GAEI 3Q8YA 3QZ8A 4F4KA 1HNIA 2CPYA 3EXCX 3Q86A 3LQVA 5ETNA 3OR2B 4G1QB 4CZCA 5HVGA 2ZJQQ 2QLJB 1YJ9S 4UTGA 4LRAA 4Q8FA 1S48A 3LP1A 5CH7B 2N4CA 2FJAB 1MMNA 5L46A 2HAIA 4QPTA 2O3DA 2CJYB 4HR2A 1FRXA 4LSZB 5DDPC 1FCAA 3FKBA 3OR1A 1NO8A 4EYHB 4LUBA 5HQ8A 4ED4A 4TY8B 4R0EA 5IWAJ 1DHMA 3KLGB 2AJQA 4ES1A 2RD5C 4WU3A 5GADI 3RB0A 4HTJA 4KHPF 2C2OB 3CJ2A 3C14B 3OFGA 4TY9A 4X4OA 2EK6A 4L75A 4F8RA 1XEZA 4F4WA 1CJUB 2LXUA 1YBUA 2J6UA 2HURA 3HHLA 1KHVA 4P6QA 1N5YA 2CPJA 3TR5A 1HNWF 1XK8A 2V0NA 4NA2A 3TVZA 2GVDA 1DY3A 1TL3B 2EVZA 3WX4A 1XNRF 2VICA 1YTYA 3R5DA 1U1MA 1GNKA 2IA0A 4OX7A 5D4PA 4QWEA 1CS4A 2PD1A 2NZ4A 2CQDA 1M5PC 1TL4A 3Q2SC 4PXDA 1S6PA 1PO6A 2RKIB 3FCWA 1IVZA 1Q1KA 3OTDA 1SH3A 1U2RA 4OX6A 5EWGA 3MTJA 4DSJA 3MM8B 2IJNA 2RU3A 4E0DA 5HMZA 4CH0S 3FEZA 4JI7F 1D9AA 3F44A 1V3RA 3MMBB 4LRDA 4Q2LA 4FF1A 1X4FA 3GCWP 3HHDA 3W62A 2GA7A 2UXCF 3SFUA 1S79A 2C3PA 4J7CA 5AXLA 3CJ3A 3I5CA 2W7PA 2OEKA 3NMAA 4ETZA 2R4FA 5LMNF 1X4AA 2JFDA 1WI8A 3C8YA 1P9QC 1VQ4S 2Y8YA 4X2BA 3GCXP 2GVZA 3CO9A 5ETLA 4NA3A 1HNXJ 1VRUB 2HMIA 2V9WA 1RZMA 1WF1A 1RAGB 2GHVC 4PEOA 4DPOA 1B99A 2QLBB 5IM0A 1FKPB 3V2UC 1VC0A 1VBKA 4TU7A 1BGXT 1FKPA 1HWIA 1OYDA 2ZDPA 3MM6B 3MM5A 3FCHA 4OZ5A 5E7OB 4J9QA 2JRSA 1RGVA 1WELA 2FZGB 4ZP8A 2W9CA 3V81A 3CDWA 4NLGA 2KFNA 3G82A 1VK8A 4M1KA 2WVBA 4I0WA 1S9EA 2YKMB 2LEPA 4LF1A 2WTFA 2Z2YB 4USJC 3MEEB 2VONA 3JAMY 3H20A 3MEEA 2XEXA 2Z2MA 2MY8A 3A8EA 3EJMA 1MLAA 5L1KA 3TAQA 2F8EX 3OJUA 1GXUA 1NHUA 3JTPA 4ZHRA 1X8DA 2HAFA 3ZZTA 3MFIA 2EI5A 3IBWA 3K59A 3HX9A 3VVUA 2CWKA 2ALZA 1MROA 1RADB 2HVDA 3ETOA 3RYLA 1OS5A 1RHKB 1CJTB 4W98A 5KG3A 4O3RA 4R0JA 1VIXA 2AWZA 3MHYA 4DV3J 4IQXA 4FF4A 4V19J 2KYZA 4BWJA 3UW1A 4PG4A 4ZVHA 1IWAA 2M52A 5IQQA 2FPHX 5LSOA 3CJKB 3MAAB 1AFJA 3B8HA 3G6VA 3FSIA 3MM7B 4PZVA 1JNRB 1ZA1B 1SKSA 4IH7A 3IP0A 3GMGA 2C3YA 3GJQB 3VGVA 4F36A 1SIWB 2BMBA 2P9GA 4WKYA 4NX9A 5D3GA 4CO1A 2ZH4A 4U6PA 1MMDA 2MGZA 5LL6d 2I6WA 2B9YA 2OTLS 1X4BA 4OZ1A 1U25A 3M9MB 1W2IA 3MR2A 2OSRA 3PJ9A 4LFAF 3KUHA 1B70B 2E7XA 5ETVA 3DLHA 2JHEA 2X7IA 1HWLA 3QO9B 2UVWA 4JOUA 3PX6A 1CPZA 5I42B 2ASLA 5CZXA 2Z58B 2FVPA 1UJ4A 2W4CA 5IXUA 2VB6A 3RZAA 4BC9A 2HVZA 4K4TA 1AYEA 2W9BB 4ELTA 2C2EA 4DL5A 4ZK7M 2ILZA 2UZAA 4DQPA 3BR9A 4AXJA 2K8GA 5DM6Q 4KPYA 1CC8A 3D1OA 4F4AA 3ENWA 2XULA 2CQ1A 4LQ3A 1RWWB 3TI0A 4GC7A 1XC9A 3D6MB 4RPFA 1PJ5A 1H98A 3HT3A 4KJIA 3SCKE 4QQBA 3V4IA 3BGRB 1MSWD 3MCMA 1ZS6A 3A13A 3M2VB 3CJ5A 3C6TB 4ZDNA 2PMHA 1WF2A 2OP5A 4QJVA 5A8RB 4YR3A 2R7WA 3GFYA 3RRGA 3DU5A 4ZPAA 1NB2A 3W2VA 4AXIA 4A8QA 2PEHA 1M5OC 2NYIA 4J91A 4OI3A 3MOZA 2BABA 4F4YA 3D67A 1WTFA 3HZEA 1I6JA 2Q79A 4C11B 5AE2A 3HFZB 1DURA 3P5TL 1M5KC 1RLCL 4C8ZA 2VU5A 3J80U 1R27B 2B5JA 1NJIT 2AEJA 4IRKA 1TVRA 4PPZA 1IUJA 4ED3A 1VS3A 4WCEQ 2UXCJ 5G0RA 1BD6A 3HD1A 4IFVB 4CYUB 2B51A 2PFDA 3H5SA 4HEA9 4NYZA 1YITS 3TQEA 3NGDA 2DHSA 2ZH1A 2RUGA 5DDQC 1HPZB 3DLGB 5I3PA 1HFEL 1EIYB 2ZHAA 1IR0A 2B4UA 2IBOA 1EETB 1URRA 4DX6A 2PI4A 4FNIA 2PC6A 1ITPA 3BBFA 5CYQA 2RRAA 3GZ7A 3R5BA 4YS2A 1SL0A 4M63A 1U2FA 4HVZA 2E5GA 4YFUA 4RW7B 1Q95G 4PR6A 1RISA 3CD5A 4USHA 3RRHA 4OZNA 1MNEA 4DX8H 3PRVA 5LMUF 3MMAA 5AT1B 2YH0A 5M2RA 5HQMA 3M1VB 3C16B 2G1HA 1D8YA 3LGNA 1S1TA 4P2FA 1QAJA 2HZVA 1SC4B 4N77A 1GTHA 4ED0A 3M8QA 3VF0B 4YQWA 2NQPA 2DK2A 1NK0A 1QLNA 1T0TV 4JP8A 1R7IA 4K7QA 5KFYA 1UTAA 1ZBTA 3IRXB 1HNZF 1BC6A 2CJQA 2WONA 2XBPA 4KT0C 4ZJLA 3JYTB 3SDEA 1XBWA 3I4PA 3JAMU 2LYVA 2U2FA 2N3LA 2DBBA 3VTIA 2HGNA 2MKJA 1E6VB 1EX8A 4MK8A 2CG4A 4J90A 1VQLS 2MQPA 1WG5A 4RW8B 1T95A 1RQ0A 4X4TA 3FBBA 3ISND 1QUVA 2HHXA 5T7LB 2XO6A 1TV6A 2C2MB 2OEMA 4UW2A 4ZPDA 1AFIA 3OFEA 2FTRA 1EP4A 1S1VA 3IM8A 2CPHA 3L7PA 3ENQA 3CSKA 4WBFA 4Z7YA 4LF6F 1RAEB 3OUYB 3CIMA 1YVFA 3PRBA 3KOAA 2CG8A 4C98A 1KBRA 3LA0A 3NP5A 2MKYA 4OI6A 5F3TA 4B3RJ 1VRTB 3BN4A 3PHTA 4I2QA 3RBDA 1FNXH 1KFSA 1BXNA 4F02A 4XIUA 1S77D 5L8RC 3WIVA 2OMLA 3BN7A 3KDNA 4IRDA 1FKOB 3M30A 3QGHA 1KVKA 4LR8A 3CCLS 3KMQA 1K0VA 3T5KA 5DQGA 1VLOA 3W8PA 5LSLA 1HYSA 3BEGB 2QN6B 3NGSA 4YMEA 4OLOA 2JLGA 4CWBA 2YXLA 5E2QA 3J80Y 1TMJA 3TUJC 1CJKB 1T9UA 2QSWA 4EFAC 1FWPA 5KFAA 4B9LA 5HLFA 3J7A1 2YX4A 1OPIA 4WE1A 2R3VA 4YN3B 1WEYA 3PKMA 4USUA 1T03A 2HEKA 1DZ5A 4DZDA 3ZTSA 3CULA 1FD8A 4KSEB 1V6HA 3IR7B 3H2UB 4FS1A 5LT5A 3SZ2A 2GGPB 2OIHA 3B82A 4DCJB 3H5YA 1R0AA 3EVMA 3IGNA 1K1QA 4DPTA 3KLVA 2MB0B 3WIUA 3DHWC 1TKTB 2QA2A 4ZCMA 3ADAC 2NUHA 1HR0J 2AEMA 3CDAA 4K2XA 2OPSB 4RBTA 3SMZA 2OFGX 3H0PA 1M1HA 4Y2KA 4EK2A 4YB1P 4ES3A 4DSEA 2B7BB 1U0SA 2WRMA 4RUHA 3Q23A 5KFGA 2XY7A 1HQUB 1AUSL 3HSDA 4JV2A 4PUOA 1VQNS 2MHEA 4NLYA 2POKA 4LT6A 5B0CA 4OJ3A 3PNIA 3V6DA 4K0KF 1RDRA 3W63A 2WK4A 1G6BA 2L3MA 2WOMB 2HFNA 3AA8A 3FBCA 4NEYA 3GIKA 2E9RX 4P7TA 1T9VA 1Y10A 4FNHA 2BBEA 4C3LA 1R31A 4JI2F 2BDPA 1NHVA 2NZCA 3BR8A 5KFVA 3QJLA 5H9EJ 4EBCA 3TA1A 3DDIA 3FMBA 4I56A 4DV3F 4DL0C 3J7AN 2K7KA 2BX6A 2DCLA 5KFUA 2J8AA 4NI2A 3QZ7A 3KK1A 2MMYA 2ATCB 1TKXA 2WVCA 3AD8C 3O3LA 2MYFA 4B9VA 4HI1A 4P2SA 3Q8UA 2CJXB 1M90T 1K1SA 2HG4A 2ZUGA 2E66A 1H2TZ 1OSDA 2VBXA 4DZ6A 1W25A 3QJPA 2ZKTA 3PZPA 3WC0A 2Y9HA 3CCVS 1RLDA 1U0HA 3BH7B 1SC3B 1WOOA 4XO0A 1IKWA 1BMQB 3ENVA 1X60A 2Y1JA 3D0IE 1KOOA 2GCFA 3AOCA 3BSAA 3Q8QB 1R0BG 2XC9A 2OFHX 2J6SA 1Q8KA 2ZBRA 3I9ZA 3TAMB 1NB7A 2M9KA 4FKYA 4O44B 1FO1A 5C2GA 3LP2B 2LFVA 3PV8A 9ATCB 1LWCA 2WVDA 2XI3A 2RUSA 4LRFA 1ZM9A 4HACB 2JEJA 2RB7A 4TU8A 1KQKA 3D68A 2M8DB 2ZEJA 3FCVA 2DPJA 4QR2A 4NLDA 1HQ2A 1NJZA 4IRCA 3EGZA 3NG8A 4QU6A 1AZSB 2BRLA 4MJKA 3KLHA 2E5JA 1YDLA 2LQBA 2MJNA 4OHYA 4NYPA 2HSEB 4KFBA 4CT9A 2VA3A 1RHRB 2HFVA 1T9TA 2EKYA 2CJAA 2ZD1A 1XNRJ 2F65A 1N5VA 2A2DA 2LMIA 4NLUA 1BWVA 4OZ0A 2FZKB 4GO7X 2YNHA 3WBZA 3OTOJ 2QA4S 1ZETA 1KONA 3NWGA 4WIQA 1N56A 5E3RA 2W8LA 1RTDB 5A8WA 5E3PA 2MQNA 3G87A 2VKZG 1UVNA 4I67A 5C42A 1QAYA 4DG1B 1UETA 1LXNA 1ZPWX 4RW4A 3MR6A 1N6QB 1TL7A 1C0UA 2IDLA 1VGYA 3KLIB 3SCJE 2ABYA 2HQ3A 5KFIA 4OV1A 5LM7E 4DPUA 2ZH6A 4DLGA 1NDKA 1EKRA 1HHQA 1YSJA 3C19A 3IWXA 4USWA 3VQTA 4CO5A 5F8HA 1SJ3P 1TAUA 2GJIA 2VQFF 4GKJJ 1R8PA 1VI7A 4YDDB 2NXEA 3TX0A 5FDLB 1U1LA 4DV2F 3UI3A 4DV4J 3QGIA 4DR3J 5IM0B 4FKXA 4KE5A 1U47A 3RGIA 2MSTA 1F5CA 2H4YB 4QIFA 1LOUA 2ROPA 1S49A 5C25B 6FDRA 5A2QU 4Q44A 3CCJS 4PXBA 2AJ1A 4KR0B 2EFOA 1UA0A 2HHWA 2AT1B 2HIYA 1RHJB 2GNKA 2H48B 2XYHB 2Z2LA 3BV8A 2KRRA 3G82B 4RR5A 5J2PA 4PWDA 4DV7F 2B56A 3OHBA 1OYEA 3W1YC 4Z7CA 1S7HA 4OYIA 2RJZA 4ECZA 1KTVA 1KD1T 3HHLC 3K0JA 4RW6A 2DYAA 4M5MA 2MZJA 2X1AA 1GH8A 4ECRA 2VA2A 2XMVA 2J6TA 4NLRA 1TU0B 2MKIA 4C8OA 5HROA 2H1YA 4IDKA 4P2MA 2RAQA 2DITA 2PE8A 5KT3A 1S10A 3K57A 4U8YA 4J9NA 4DL2A 4LJMA 2CPDA 1WKLA 2PSZA 3K5OA 1Z4UA 7FD1A 5L39A 1BQNB 4ZPVR 1HA1A 3H90A 2KRBA 4PQUB 2XCPA 1I5OB 2DXEA 4JI0J 3CJRA 3DOLA 2HRUA 2HLTA 1ZZFA 3G2XA 1HBOB 3RU0A 2ZDOA 3KDOA 2C22A 1HBOA 2RRBA 2KJVA 2V4RA 2AGPA 2HHVA 3CDEA 1SC1B 5A76A 4A8WA 2DD8S 3BPSP 1H7WA 2XMKA 4XTTA 3DMJA 1ZM4A 1GFWB 3Q8RB 4UZBA 5K9FA 3PO4A 3QO9A 1FE4A 3D6TB 1P27B 3HVTB 3V4MA 2FJWA 4F2RA 3DRPB 3US5A 3HO1A 2F8MA 3CDBA 3CMAS 2HGMA 1VISA 2LQ9A 5KFSA 1PJ7A 3IAS9 1S57A 1N5TA 5HVFA 1F9HA 2GIRA 2BRKA 1DJ0A 2ZE2B 5DS7A 2R7RA 4OHZA 4H4MB 4LF4J 1GXTA 2CQPA 2LQJA 1RT2A 1IKXA 4CH7A 1XNQF 4CM2A 1LK7A 3DM2A 2LU2A 4FDFA 4I7FB 7FDRA 4P74A 1GMWD 2HZAA 4EBEA 6AT1B 3V4IB 1JMTA 4ZPBA 4XPCA 3B78A 5K20B 2CQ3A 5B7WA 5E41A 4KO0A 4B17A 2QFJA 4F26A 3THVA 1A7GE 2EBEA 3AD9C 5GMKa 2XMUA 2YNFA 3CPWR 4ED5A 1S6UA 2VOPA 4CLWA 2E9ZA 1KN6A 5DGBA 3T6BA 2MPUA 3R7SB 5H9FK 1HR0F 4IUFA 2BE7D 3DLJA 4R25A 3NAIA 2F5GA 4ED7A 2M0GB 5IV4A 1ROFA 1Z2ZA 2XGQA 1REVA 2HQIA 4N8NA 1WC6A 3QRPA 2FLPA 1MWQA 1EQ0A 2ACYA 1IBMF 3MURP 2N4DA 1Y3KA 2DNGA 3ZZ0A 3CWJA 1NK7A 1MU2A 3TRGA 4TLQA 5KFXA 4XAKA 3U02A 4DCOB 4E2FB 7AT1B 3KYLA 3G8TA 4OYAA 4CLKA 3S1TA 5IOLA 1DLOB 3ELHA 4LFBJ 3KHHA 4KGMA 4P9SA 2K2PA 2O01C 2OUGA 5DQIA 1ZOTA 4X4QA 4K5SA 2FVQA 3C46A 1D8ZA 1V3SA 4J9UE 5K8OA 4JI6J 2UUBF 4R5PA 1KS2A 2CFXA 2QG9B 4I4BA 2ERRA 1JLEA 1C2PA 1YRUA 4O3NA 3MCNA 1DRZA 3PEJA 1Y7PA 1SJRA 2O67A 1LWFB 5H1SV 3TJAA 3JTNA 2BEFA 1KFDA 1MW7A 2CYYA 3GG0A 2QGFB 3QT5A 3R7BB 4ZN1A 1VQKS 3PDNA 3MXHP 1SKRA 3C6UB 2V9KA 2AYEA 1PC5A 2A1BA 3R27A 3N01A 4OLPA 4RNNA 3BGFA 3OVAA 3TUZC 2CDQA 2GV1A 3MEGB 5KG2A 1N33F 2FGCA 1VLYA 2YPYA 1RT3A 3DDNA 5EDWA 2JZ5A 1SJ1A 1WHXA 2CQCA 1Q8BA 2W2QP 3CE8A 3DGVA 1NDPA 1PC4A 4UQGA 4QCLA 2KB2A 5GAHI 4HLBA 3LH2S 2AGOA 3UN3A 3OLBA 5CABA 1JB0C 3BKTA 1KLNA 2RMLA 4NASA 2XMAA 3LP0A 1RWXB 2CQHA 1JJCB 1TUVA 1UJ6A 1Y0HA 2D3UA 3D0GE 2PMZD 3W3SA 2DRAA 1UZHA 3QMQA 2G0IA 3AT1B 1YJUA 3FEYB 3ISNC 4QBUA 3UDCA 3RBZA 2ZZNA 2GQ2A 2MKHA 3DI6B 1TUGB 2EFPA 2J5AA 5KFEA 2R7OA 4I2QB 4WFBQ 4JI8J 2BM0A 3T9NA 2ZITA 5KOXA 3CJ0A 2IVMA 1Y5IB 3CMQA 3DRRB 2M4MA 3JSMA 1S6PB 4F3MA 1NSQA 3MUTP 1RABB 5HP1B 1FDDA 2A6MA 1TL5A 3A12A 3HT0A 3K8WA 5AXKA 3UDLA 3VV2B 3T1AA 3PIOQ 3T1YF 1NK9A 1LW2A 4ED1A 5T14A 3MM8A 4K4SA 1Q8IA 1RTZA 4CTAA 4DN9A 2VQEF 4J37A 4UF4A 2Q43A 3LAKA 3R3TA 3IR6B 2ZWPA 1WACA 4RUCA 1JXVA 2N7CA 2DR5A 5KT2A 1JLFA 3ILJA 4WFXA 3DU6A 3UD5A 4URSA 2LA4A 2PA3A 3UFCX 1VIOA 4MIBA 3IG1A 1LNQA 4MFBA 3W5XA 4J9VA 2AQ4A 1UFKA 3AOBA 3T6JA 3JSYA 4B02A 1KLMB 4MYTA 2DGOA 2RQCA 4RNFA 3AHPA 2C2KB 3ISZA 3NMRA 2L08A 1VRUA 1QJHA 2B8QA 2OEJA 4URQU 2CNOB 3A3PB 1HI8A 1FVSA 5EWFA 5H9EK 5J2MA 1CJVB 2V8HA 3PX0A 5HN0A 2ZM6F 4FBTA 3PW2A 2GMHA 1WHYA 3D6HB 3RJMB 4F50A 1LFWA 5AXNA 3H2LA 5ADZA 1RYRA 2RRNA 4QWDA 2GX8A 4NXMF 3IBFB 4XK8C 1WC3A 2YKNB 4FF2A 1TFWA 2UVUA 2QL7B 3HFKA 5KFLA 4QIVA 2E7VA 3D3CJ 3AAWB 1RYSA 2FJBB 3FK4A 2Y0BB 1HBNA 2I1RA 3FMWA 2WSEC 5KFBA 1H74A 2B4PA 2CQIA 2VF3A 2UXDJ 4FF3A 3J7YI 4W92B 2ZOFA 4HT5A 2JL9A 2KXNB 1F2GA 5D4NA 4DQSA 4NCGB 2CPFA 1VOMA 4ZVFA 4EBDA 3VQSA 3GYGA 2D69A 3EWGA 2DH7A 1U49A 3TWZA 2OPQB 2R8IA 1PAEX 4NI2B 3Q2TC 2C3UA 2JFKA 4LREA 2W1BA 2VFTA 1KP6A 1TKZA 4GO5X 1F9FA 2HS3A 3R5CA 4C48A 1RT1B 3PJXA 4C3MA 1AXQA 4JI0F 3VGSA 1RWNB 1GX6A 3T41A 2KL8A 2QMXA 5IC6B 4Q7AA 4UOHA 2P9EA 2ZH3A 3PJWA 3G8QA 5KT6A 2DGQA 3W8GA 3CO0P 2VKRA 2V4JA 1P6TA 4TLRA 4BCAA 2FZCB 4ATNA 3B4DA 1RBLA 3SQGA 3EDRB 1ZH5A 3GIJA 3DCAA 3UDEA 2V63A 3DOKA 1J5OB 3DC2A 2OPRA 5JMNA 4NLVA 1UPPA 5A8KA 3M2UA 1IBLF 1XR7A 2DR9A 3CUNA 5JJBA 4DR7J 3MOJB 3HSZA 1HD0A 2Z0GA 3I55S 2F4FA 2LDYA 1NJYA 2YBVA 1H7XA 1UJ5A 3OXLA 4FVMA 4L6V3 1HNVA 2EK1A 2JX2A 4RKUC 1FRJA 1RTIA 3MPYA 3DGPB 3VAMA 1EAYC 2XHWA 1UWBB 1S59A 2C42A 3DGPA 4EU0A 3W9IA 2E5LF 5GAGI 4JV5J 4DV1F 2DHHA 5KFQA 2MLZA 5E3CA 3ZTQA 4WP8A 1U1OA 1X4CA 3CB4A 3DHXA 3O2IA 4K5RA 3I4HX 3SCIE 2IM3A 1TVRB 1NEEA 1WC5A 1O51A 1RU2A 2HK2A 5G0RB 3TZYA 4LRCA 4EI2A 2DJWA 1YZ6A 4DPXA 4F4ZA 1LWXA 2RDJA 4RW4B 2XO7A 3T1HF 3DLBA 4UOCA 4I6WA 3FJ2A 5GVQA 4ECVA 5HI7A 5HJXA 2PDAA 1QSYA 3QRRA 4ZVUB 2LEBA 4C8KA 3UD4P 1IXKA 5DG8A 3C66A 1NJXA 1R8CA 1Y9OA 4TQSA 3CCSS 1WJ9A 1VC5A 2BM1A 3MM7A 3MD3A 2HRTA 4B3TJ 2HHTA 2AW0A 2YWHA 4P75A 4YR0A 2IVFB 3ZTPA 3T5LA 2NCKL 2B4OA 2G9OA 3B6BA 4NRUA 3GR1A 1BE4A 3B4MA 2GJFA 2PIIA 3A1YG 3ZZOA 1KQFB 1BLUA 1HBMA 1S9EB 1FRLA 2BJ3A 4WP3A 4HTIA 4XDDA 3NEKA 4E98A 4KC5A 4QWAA 4OYOA 3M8SA 5D77A 4DS4A 4NZ7A 3DNCA 2I5JA 5L9XA 3JYTA 2YNGB 3HK2A 4ZHRB 5LMUJ 3A8JA 1GK8A 1N88A 1XMQF 5B0AA 2DHXA 1WOSA 2A6OA 4LFCF 2RNEA 1CULA 1SQEA 4LBIA 4TVAB 5KFCA 2OHDA 2RT3A 3LTOA 4Q2MA 5CHCB 3QPIA 3OD2A 3ZC4A 1FRMA 4X4RA 2R8HA 2HNDA 2AGQA 3GFHA 1MWYA 2NYHA 3UNYA 5KFPA 1OMSA 5DZ6A 4X4PA 3EPGA 2NREA 1S1VB 3MMCA 5B08A 1S1WB 3HHLD 4DU7A 5K8NA 4CO4A 3EGWB 4USIA 4DSLA 3MI7X 2VC0A 4Y65A 3THPA 1IN0A 2ZJPQ 3FUYA 4PCQA 2XMJA 5KFRA 2ZH5A 2OH2A 4JV5F 4QOTA 3AJDA 2MZ1A 3GONA 2ALYB 3OTCA 4LF9F 1NBEB 2WHOA 4KV8A 2YNIA 2NXNA 4DI6A 2HQFA 5JUMA 5KT5A 1S76D 3QJJA 4GVLA 4U67Q 4A4JA 2ZJRQ 4IFVA 5F8NA 4FXWA 3PXGa 5CXTA 4M5DB 5RUBA 5IS2A 2RF2A 2ZE2A 3LAMA 1SQGA 1YRXA 1IR2A 1RAJA 4DEZA 2A10A 4ZJQA 4H4MA 5DLFA 3ET6A 4DWIA 3EGNA 2D74B 3VVTA 3UR0A 2XI2A 3VAFA 1RXOB 1CJKA 2MEWA 4ID5A 5GADU 2DO0A 4ID5B 3KNAA 3W2WA 5C2CA 3DDKA 4DV0J 3X1LB 4DCPB 1NK8A 4YUDA 4USMA 2OMOA 2P6SA 2W9AA 1S9FA 4DUZF 1SQFA 3HVWA 3AB2B 2Q6CA 4JUZA 3TOQA 2LU1A 2FY1A 2ZOGA 3HVAA 2B8PA 4OZ3A 2ASDA 2W7OA 3TZXA 3VHQA 4A8YA 2XS7A 1VC6A 1MMLA 4RWWA 1TR0A 1KR4A 2L9WA 2DEJA 3GTYX 3MWBA 2ZBQA 2OD6A 1CVJA 2QA1A 1YJRA 2X1BA 3CC4S 3MR5A 2IYIA 2XSJA 4QWCA 3IAM9 2VG7B 2HS0A 2FVCA 2XSJB 3KUGA 1S6QA 1FFGB 2RS2A 1UPMB 4DFPA 4DL4A 1M5HA 2UUAF 4ZVPB 3MM9B 3TZWA 4CLLA 4WFYA 3UO0A 2LVWA 2CNKB 2CJ9A 2UUCJ 4LF7F 4FN5A 2HHPA 4Y34A 2IDEA 1TL1B 3C15A 5E3AA 1SIZA 1FFWB 1RTHA 3TZZA 1TL1A 3C15B 3FZBA 1I94F 2AMCB 2CQGA 2IHR1 2M5YA 3BF4A 3ILLA 3LGHA 3PYDA 1OPZA 4WFZA 5U47A 3I9V9 1JLQA 2BE2A 4ES2A 4DX5A 4DUYF 3GJRB 3U1NA 3UD3P 3LO3A 5K5MA 4AT1B 2IY5B 2G2ZA 4DMZA 1IBKJ 1GEHA 2Y3YA 2QIFA 2VC1A 1VBZA 4K4WA 3NL0A 4ENOA 2C1EB 3AFGA 3LP1B 4YB7A 1UWAA 5K8MA 1LWFA 1U8WA 3UCZP 4PRFA 2W7AA 2WONB 1ACMB 4JI3J 4L74A 3P49B 1SL2A 4FS2A 1U0HB 3UQSA 2XB2D 1RB0A 3BSOA 5J2QB 3MEDA 1NM2A 2V8VA 4AUKA 1YZ7A 2B6AA 1PBUA 1K73T 1AUDA 2E5IA 2FJXA 4IFYA 2B9WA 5ETMA 4DJBA 4DX7A 4K4ZA 3WZ0A 2KVIA 4KBIA 2ZZTA 4O44A 3L9ZA 3PACA 4I1TA 1S5ZA 1QD1A 3MPDA 3I5AA 1FRKA 3C14A 3GYXB 4IYQA 4M5KA 4ZLLA 5KFHA 1VQ9S 1RE1B 4KH0B 4O3QA 2R7XA 1NCLA 3PFOA 2V8PA 1IJFB 3J81Y 1UZDA 3DFEA 2DTJA 4FYWB 1WC4A 4S0MA 1S9GB 2ZBPA 3H2VE 4ZA1A 3HXMA 4I69A 2DGVA 3CJ4A 2J0WA 2C2NA 2FJDB 2YWFA 3QNWB 3C3LA 3T1YJ 3NLCA 1U4BA 4B9TA 4RU9A 3HZGA 2D1CA 3J81U 1IWGA 3CCTA 4KFBB 1N52B 2FDNA 4DXLA 4J9OA 1QSSA 4PWWA 4ICLB 2UUWA 4WK1A 3AODA 1OQ3A 4AYBD 3RR7A 3R1HA 4RLEA 2JWNA 1B64A 4KTQA 1YBTA 2AJFE 2DR6A 2W2NP 5F3ZA 3F73A 2GQQA 4ZJOA 2BVZA 3IR5B 3G8SA 3OFHA 3BS9A 3GWCA 4L3KA 1OSCA 3PG9A 1ULRA 1C4CA 5E5NA 2FQQB 1DTTB 4OX9F 4JB8B 1WEZA 1YKWA 2BACA 1RAIB 4TNOA 3KLEA 2ZH8A 4DQRA 4EO6A 2H4WB 1B0TA 3CIZA 1W2BR 4NZ6A 1TL7B 1M0SA 2MZRA 2YWEA 3KLIA 1SUQA 3LOUA 4MAKA 4CNZA 1HNXF 4QZVB 3PO5A 1ZPVA 4B3OA 4ZCLA 3KFWX 1HL6A 3MECB 2BKNA 1C4AA 4LQ9A 2ZM6J 2GFFA 2UUCF 2I38A 2DIVA 3G6YA 5I3UA 2HHQA 2R2SA 4MKAA 1LXJA 1GMWA 5C24A 4NXMJ 2EKNA 1PKUA 2L41A 4H4KC 1FT8A 3K5NA 4R8UA 5LOQA 2C3OA 8RUCA 2W9CB 1JNZB 4O4RA 4R8UB 2HQDA 3W9JA 2B9XA 1S0MA 2HK3A 1IKYB 1HHSA 3R5AA 1JXLA 4YB5A 5J2PB 1JLGB 2VD3A 4MK9A 5ETRA 5A6PA 4X4VA 2CZVC 2GJ2A 3OPKA 5HATA 1HD1A 2D3OR 3L09A 2M3DA 1Z1ZA 1KOHA 1O5JA 2Z8QA 2FD2A 3A3NB 4Y2AA 1NKEA 2XLIA 3CF5Q 1T11A 4V19X 3VWSA 2DRBA 3PYEA 1CJTA 2MQMA 2XYPB 2LP4A 4MT1A 4DFJA 2QL5B 2OKQA 2MQQA 3OV7A 3AXMA 1VHFA 3KNGA 4Q8EA 3T5HA 1LK5A 1NPKA 5IC4B 3UN2A 2CNNB 3VGTA 3SV4A 2MZSA 3IC1A 3FZ2A 4OJ1A 4ZVTB 4LF2A 3TP2A 4FYYB 1TMMA 3HHLB 1S99A 1Q82T 1SPBP 1N5YB 4NL5A 3CJ8A 2W4DA 1FXDA 2FHOB 5HMWA 3GV7B 4BDPA 3KLFA 3HMJG 4MTPA 2RILA 3OR2A 4G1QA 2V4QA 3LF0A 4ZS6A 3UR3C 3CC2S 2Q66A 5F8JA 2F9DA 4DSIA 3QGGA 1FJGF 1X4DA 3RTVA 2NSBA 2YNHB 4J9PA 3QWUA 5DG7A 5BYQA 2HHHF 4IR9A 1U6BA 3OR1B 5I42A 2R7TA 4G65A 3MPWA 1CQMA 5HVHA 1EQMA 4ECSA 3BSCA 2VPZB 4Q0BA 2IMOA 1KKHA 1ZM3A 3BGOP 1Q5YA 4XPEA 3H8YA 3R9LA 2VG5B 1U1PA 3R5GA 5H9FJ 1WKJA 1S97A 4DDFA 2BQUA 3JSRA 3M2UB 4LBPA 4Y2IA 4ZPCA 4JV0A 2XM3A 3LWLA 1L5UA 2LECA 1IKXB 4NLPA 5EX3A 1KDNA 2RU9A 2GVZB 2CJKA 2VV5A 1PCAA 3BKFA 4TU9A 3Q8SB 4DV0F 5GAEU 4HYKA 1RTIB 5CD4A 2L9NA 1OO0B 5DJBA 5KG4A 1FE0A 2EW9A 1FJGJ 3X3UA 3B54A 3SFGA 4G1IA 2Y1LB 1D09B 1WF0A 2KH9A 1CS4B 3M32B 5JVHQ 2KJWA 1WI6A 1E6YB 2DNOA 4EWTA 1BUXA 4F25A 3HM9A 4N76A 4DF4A 1FDNA 3CEDA 2B5JB 3PFEA 8AT1B 3N0VA 2JSXA 4BWMA 2YQ1A 3QGPA 3RR8A 3A3OB 4ALZA 3D66A 4BS2A 1NKCA 1HNWJ 3Q8VA 2F1FA 5KG6A 4YHHJ 3UNGC 1X4HA 3BZQA 1PBAA 5J1NA 4DQQA 2MQOA 4PG6A 3CMES 3R2DJ 4QW9A 2LA6A 3PVXA 2HNZA 5THWA 3DLLQ 3NCQA 3W7BA 5DG9A 4RW7A 2R2RA 3PKYA 3SQOP 3RB4A 1S0OA 3M6XA 3Q83A 2VJVA 3ILIA 4O4GA 5DO2A 2M70A 3SSRA 2CAJA 1R8BA 5KFTA 2NPFA 5KOWA 1TK0A 4AFFA 4Q45A 3PTWA 2MGZB 1VQ7S
chains in the Genus database with same CATH topology
1CC7A 2ZOMA 5GAGU 3I82A 2XY5A 4DBQA 4CQ1A 4LMZA 1UVMA 4LVNP 2P5VA 4ZVGA 1BQMA 4CNYA 2UV8G 5SZTA 4C8OA 4JI1F 3DMJB 4JI5F 2KDOA 5AE3A 2M88A 1UVJA 4FXVA 2YNGA 2YTCA 5BYRA 5J1EA 4KKOA 2F7VA 3P3DA 2DH8A 3GE9A 4WYWA 2W9BA 4QIEA 3V6KA 1FNMA 3OL6A 2K3KA 1J5EF 2FUG9 1PILA 1YWXA 1NAQA 4H4OB 1IQZA 2AX0A 2M8HA 1DBDA 2VL1A 2DISA 2R7VA 1I1GA 2UXDF 1RT4A 2HVHA 3K5PA 3CCES 5HBMA 1Q7YT 3K58A 5E33A 4UY8T 2ZNYA 3IS9A 2FVSA 2NPIA 3M9OB 2YKOA 3DOLB 2ZC3A 1RJJA 3GIMA 2Z4PA 5B0BA 1N5QA 2MY7A 1Y4ZB 2QV6A 4RBVA 1RT7A 3NS6A 5FD1A 3Q0AA 3BO4A 1YIJS 1LWEB 2F40A 2OLWA 2JEGA 1N8RT 4K59A 5FLXY 4C2MA 1KNZA 3ZZYA 1WHWA 4I6YA 2BW2A 3FGVA 2HPUA 2I8EA 3NBPB 2XY6A 1S1XB 1FXLA 2DHGA 1WG1A 4X66F 2IJFA 1T02A 2GHPA 4NLWA 3V5RA 4NLTA 4G6VB 4PG7A 1GX5A 4PPDA 3OHAA 1T7PA 2LKZA 1Q8LA 2L9DA 3MEKA 2IAJB 4IG0B 4URGA 2XLKA 3DXSX 2RVJA 3HHNB 2IAJA 4IG0A 1C1CA 3PRDA 5E0OA 2P9CA 3FRYA 3U27A 2A3JA 2CPIA 3W2VB 4NCAA 4OIXA 1HNIB 1KQGB 2JJ4D 2MHNA 2ZKUA 5DLGA 4C8LA 1Q16B 3S7RA 4ELVA 2XWXA 4ZPWR 5EX0A 4C0HA 1N0VC 6FD1A 3CCMS 4J9MA 3MF5A 2CPZA 3FFIB 4X65F 4C8YA 2F8HA 3L7OA 4K4XA 1JX4A 1ZAVA 2E9TA 4LVOP 1L3SA 2W25A 3BJYA 1RT3B 1KHWA 1YBAA 4ID8A 4OL8A 4E8UA 4NMLA 3CCZA 3FVYA 5IT0A 1TK8A 3OL9A 2B0GA 4LF5F 4O3OA 5L1JA 2VFUA 3CCWA 1UMJA 3FNNA 1QVGR 2BJEA 3NGKA 2FIUA 2JH3A 1XMOF 2WBMA 2KG0A 1H0HB 1S1TB 1C1BA 1SJFA 4QIWD 1DTQA 1ZAWA 4WYLA 4DFMA 1S10A 1JK9B 1RT1A 5F8GA 4F67A 4Y3CA 5EHHA 1OQ6A 3IRXA 4DR7F 3CCRS 1IM4A 3SDEB 2RKIA 4B3RF 4UUXA 4Y2CA 1L3TA 2W8KA 1CG2A 4HT7A 1YJWS 1P1LA 1RKIA 2V2KA 5KG7A 4B9NA 1X9SA 2VUGA 2DNMA 3MD1A 5LXRA 3PW0A 3MMBA 1K9MT 3BGLA 2H5EA 1QSLA 2RQMA 2HHSA 1NZAA 3RB3A 2XMWA 1J5OA 1YRTA 2V8GA 4K4YA 2V94A 3DRSB 2FHKA 1LWCB 3GILA 1TV6B 5HLFB 1JIHA 4WE1B 1IKVA 2KFYA 3K5MA 2F4VF 3G86A 1S9GA 4UQTA 5DRKA 4ELUA 2RQ4A 2GGPA 4XDCA 2R7QA 3PX4A 2YWGA 1R8HA 4GMKA 2JVOA 5CZVA 3SSSA 2ASJA 2OPSA 3V6DB 1F0XA 2DGUA 3OXGA 4QU7A 2FC9A 4OHXA 2YKMA 5F8LA 3KG4A 3IN5A 2X1GA 2WB4A 2KU7A 4J9SA 2G13A 1YGYA 4C0BA 5KTQA 5HMYA 2QE5A 1X5TA 5J2NA 5IT9Y 1HYSB 5KFFA 2CRLA 4DG1A 1C0TA 2BJDA 5MLCV 1RKJA 4QYZJ 1NRKA 2CPEA 3MPVA 4WTYA 2R8GA 1CQNA 4ILLA 2IRUA 2KO1A 2PO4A 3S6EA 3BB5A 4Y6IA 1SUQB 3T9ZA 1X4GA 2E1MC 3DN9A 5GAHU 3M05A 4IOBA 1HQEB 5F9LA 2VBZA 1U24A 4DL3A 2DNYA 5DM7Q 1LW0B 3QYYA 2DNNA 2FHMA 2VBYA 2WCXA 1RYRA 1LW0A 4WFAQ 3E01B 2G4BA 1L3KA 4MKBA 3N9UC 2A2CA 3TA2A 2VFVA 2DNPA 3P6YC 1UFWA 2AYBA 4DFKA 4EZ6A 4JI4F 5L38A 2OAUA 2EFVA 1HW9A 3D28A 2XWYA 4ED6A 3HP6A 3JB9k 3C2PA 3VZIA 4RW6B 2NR0A 2KG1A 3TVKA 3M2RB 3BGUA 1SKWA 5KG0A 3UWTA 2UP1A 2J76E 3H4DA 1FK9A 2OPRB 2NLWA 1QM9A 1NK5A 4IH6A 1FESA 1WTBA 3CJKA 1VFJA 1FERA 4DN0A 3OXFA 2UV8A 1FXRA 3QIDA 3FSXA 3OTBA 1G7CB 2JEFA 4ILMA 3M8RA 1FEEA 4A8XA 1HNVB 2MKCA 1TL3A 3DLKA 4X84A 1P1TA 2H9ZA 1U45A 2HFZA 5D8HB 4AL7A 1UWBA 4B3SF 2HVIA 2HNYA 1FEHA 1TAQA 2E1RA 1T05B 5KFKA 3GFZA 5HO4A 3ONQA 1HMVB 5CYJA 1JXEA 4N5SA 2E29A 5AJ3F 1HMVA 5DGAA 4NWBA 3D2WA 2IM0A 3RW7A 4WU2A 2VFRA 2PFFB 1FTRA 3HKZD 5F0UA 1P8GA 5IZHA 4F3OA 3OLAA 1H2VZ 5FIIA 1HBUB 2RF2B 4B9SA 2VG5A 2DNRA 5A8KB 5CCLA 3AH6A 1D9DA 1S0VA 1UVIA 1HWJA 3OTEA 2QZ8A 2KT2A 3Q8PB 3I6PA 3ULHA 1HI0P 4OI4A 3OVSA 1QY7A 2OTJS 3V6JA 3KLHB 3TW0A 4DS5A 3C6TA 1SH2A 4KAIA 3NCPA 4CI0B 3KKFA 4C7QA 2IVYA 5BJRA 4BC7A 3GSDA 2D9OA 3VAIA 3G9CA 2KXFA 4C97A 1ZAXA 4C11A 2BQ3A 3HKWA 4DOZA 2XLJA 2C2RA 1UL3A 4UY85 4PWDB 3DYAB 3PR5B 1JLBA 2KFZA 3D1QA 1NU4A 1TP7A 1VQSA 5C42B 2I5JB 2CVIA 2GO9A 3E3XA 1S1UB 1S1UA 1MROB 1S0NA 3U1LA 3KHGA 2MJUA 1DAXA 1O0PA 3ICLA 4QWBA 3OL8A 5KAKA 2BYCA 2CQ4A 4IDKB 4FBUA 2YH1A 4CT8A 4DR2F 2FJVA 4HH1A 3BSNA 4DV4F 2EG2A 3POTB 2LCWA 2Y1IA 2E1AA 1KEKA 4N41A 1DARA 4LIWA 3IGVA 1Q4RA 4A8SA 3OVBA 1Y5LB 2HRYA 3QWPA 3E8OA 4A47A 5K8PA 4G3IA 3CDUA 3LUYA 2K7JA 2OSQA 4MKYA 3NS5A 1HBMB 3KK3B 1D0EA 1DQ8A 2DVIA 3KK3A 1LFPA 5HL7Q 3CXCR 2CQ0A 2FLNA 2Q6BA 4KV8B 2KHDA 3JSBA 3IXQA 3H40A 4B9MA 4TKTA 4HH0A 3U7JA 1HWUA 1T3NA 1DQ9A 1SXLA 3QAEA 2XGPA 2UVVA 2XMTA 2IRYA 3MAQA 2AU0A 3CC7S 4G1PA 4GC6A 1AW0A 2G0CA 3ITHA 4WXWA 1RT4B 4TYAA 4ZLPA 1XN9A 3M2VA 1XR5A 2KHCA 5A8RA 2X51A 2ZHBA 2XS5A 4LSLA 3BREA 4EEYA 3PW7A 1B0PA 2HGLA 1H6KX 3FSYA 3NRBA 1TKTA 3OSPA 4MH8A 4JV1A 1T3OA 2P6TA 5IQ6A 1FKOA 2HFOA 4LSNB 4IO1A 4PKDB 1H3DA 2YNIB 2LDIA 3M4XA 2HWTA 1RWUA 3AJ1A 2W24A 1HPZA 3DLGA 2DGWA 4ETXA 2WSFC 3KLEB 3O6QA 1Q86T 3M6VA 2ADBA 5G4DA 1TFYA 3RAQA 2VASA 4WJBA 2FC8A 2AF6A 3L95X 1X5SA 1QE1B 4QR1A 1GXLA 2PA8D 3I0SB 4FPRA 1KLMA 3R1LA 3PHEA 3FQKA 1GTEA 3BM7A 3LANA 5K14A 2BANB 4OX8A 3KK1B 3ZZUA 1F60B 5K14B 2MZQA 3H98A 2DNKA 3WC2A 2E7WA 2I2YA 1Q78A 2RH3A 3GV5B 1G1XA 2DHAA 3KK2B 4MK7A 4YOEA 3MGJA 1UA1A 3OW2R 3SSQA 2CPXA 3OSNA 1U1QA 2YKNA 1REVB 2YQ3A 3UCUP 5KFWA 2XG8A 3C6UA 3IWLA 1KRPA 2N82B 1SH0A 2B6AB 2BA9A 4IFYB 2ZH2A 1HBNB