2ZJRQ

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zjrQ00
3CCUS 2MYFA 3CTRA 4WFAQ 2KM8C 2CQGA 1DRZA 2MJUA 1O0PA 1R8HA 1HL6A 3FEYB 2EK1A 2RQCA 1WG5A 1P27B 3MUVP 3CCSS 2MSTA 2XB2D 4Y0FA 2FC8A 2MZJA 2KXFA 2OSQA 1HD1A 3DLLQ 1FXLA 3MURP 2E5GA 1JJ2R 2HGMA 3CC4S 2YH1A 4ED5A 4V19X 5GADU 2DNMA 2N82B 3R1LA 2SXLA 2DNPA 1UP1A 3NS5A 1YITS 3S01A 3BEGB 2GO9A 1D8ZA 1U1RA 2K8GA 3PIOQ 2QFJA 2CPXA 3SMZA 2CQ3A 2OSRA 1A9NB 1VC5A 2DGXA 2ERRA 2DHGA 1URNA 1R8PA 1ZZFA 5HL7Q 2D9PA 3VF0B 3G8SA 1KOHA 1N52B 2ZJPQ 3CCVS 1VQ4S 2JVOA 1WEZA 3CMAS 2DNNA 2KHCA 4PKDB 4A8XA 2HGLA 3UD3P 4UY8T 2L08A 3US5A 3NMRA 5EN1A 2YKAA 2FY1A 2MB0B 1YI2S 2CJKA 2OJ3A 2LKZA 4YOEA 1DBDA 5LSOA 2I2YA 3IRWP 3VAKA 2CPHA 1U1MA 2VOPA 2QA4S 4W92B 2KN4A 5LJ5Y 3MUTP 5JVGQ 1X4AA 2CQDA 2LA4A 3TYTA 5GVQA 3SDEA 3TO8A 5BJRA 3G71S 2DNKA 2LEBA 4CQ1A 4YB1P 3CF5Q 1N88A 3V4MA 2X1BA 4QU6A 3THTA 2X1AA 5CYJA 1IQTA 3ZZZA 1VC0A 3G9CA 1X4GA 2DGOA 2FC9A 3P49B 1U1LA 1WHXA 3CCRS 2XS2A 2AD9A 1U6BA 5LJ3Y 2VOOA 2CPEA 1YHQS 3MXHP 2JX2A 3L3CA 2XS5A 3HI9A 2MGZB 2CQIA 1Q81T 1WF2A 1JJ4A 2MQQA 2RU3A 2KU7A 3RW7A 2KG1A 3I56S 1VQ5S 3G8TA 1SJ4P 1K73T 3VAJA 1WI8A 2HYIB 4PR6A 2MKJA 1YWXA 2DGTA 1VBYA 2DGVA 1OIAA 2J8AA 3S8SA 3CCMS 2DNOA 2LYVA 4TU8A 1Q7YT 2F9JA 3IWNC 1X5OA 2M4MA 1AUDA 1X0FA 3ZZYA 2AYGA 5D78A 4PRFA 2DGSA 3VAFA 4P6QA 1WG1A 3J7ZT 1UFWA 3UCGA 2DO4A 1UAWA 4QU7A 1UW4A 1ZH5A 2M8DB 2DGQA 2KG0A 2F3JA 3HHNB 4TU9A 1KOOA 1YJ9S 2E5IA 2VONA 2DIVA 3S7RA 2PEHA 1U2FA 4WFBQ 1QVFR 1VQPS 3EGNA 1YTYA 2DH8A 4EGLA 1WF0A 2DNYA 3DXBA 2EVZA 1S72S 1FJEB 2I38A 4CIOA 2KM8B 3UCZP 2M2BA 2Q79A 2MY8A 5LXYA 1CVJA 4Z2XA 1HD0A 1D9AA 1NO8A 2DK2A 1RKJA 2LXUA 1N54B 2LECA 3CC7S 1U1KA 1W2BR 3LQVA 2MSSA 3CCES 4CH1A 3CPWR 2LA6A 2KXHA 5LXRA 1H2UX 2RS8A 2M8HA 2HZCA 4IOAQ 5IM0A 1DZ5A 3JB9k 3VAHA 2VODA 1H2TZ 1SXLA 2CQPA 2X1GA 2ADBA 1X4EA 2LMIA 4OZ0A 2L41A 2MXYA 3CULA 2MZSA 4WKRA 2MQOA 2F9DA 1VC6A 1VQ8S 1WWHA 2MHNA 2OTLS 2LCWA 2MZTA 2CQ0A 2E5HA 1WF1A 2U1AA 2EK6A 1KQSR 2MQLA 2CQCA 1YJNS 4CH0S 1K8AT 2KI2A 2DNLA 2M88A 2O3DA 2B0GA 3CCJS 5ITHA 3CCQS 2CQBA 3BO2A 2MQMA 2DNHA 3TP2A 5DETA 1KC8T 2MMYA 2RS2A 3CXCR 2YWKA 3MI7X 3SDEB 3MUMP 2A3JA 2CPDA 1U1QA 3K0JA 4ZKAA 3BO4A 1FT8A 4C4WA 2MQNA 2G1DA 4BS2A 2PE8A 5GMKa 3CC2S 4YUDA 2XSFA 2J0QD 1XN9A 2CPFA 2CQHA 2DNZA 2DO0A 2DIUA 5HO4A 3R1HA 2GHPA 2XNRA 1WHYA 1JJHA 1HA1A 5DDOC 5IQQA 5DDRC 2DHSA 2MQPA 2FHOB 2JRSA 2RUGA 5GAEU 5DDQC 2HVZA 2MZ1A 2QEXS 2BOPA 1U1PA 1YIJS 3FEXB 2OTJS 2G4BA 1K9MT 1Q86T 2WBRA 1FO1A 1VQ7S 1WHWA 2M7SA 3I55S 2AYBA 3P5TL 2CPZA 2RT3A 3UCUP 4WCEQ 3U1MA 1X4HA 2MKKA 3THPA 4IOCQ 2DITA 2KVIA 1X4DA 1M5VC 4C7QA 1H2VZ 2RNEA 1VQ6S 4UQTA 1VQOS 2MKHA 2CQ2A 3H2UB 1WEYA 4TLQA 3G4SS 2D3OR 1VQMS 2FPHX 1M5OC 3EGZA 5DDPC 2KH9A 1FJ7A 2ZJRQ 2X1FA 2E44A 1PO6A 1BY9A 2DGWA 1VQNS 1WELA 2N3LA 1NU4A 1VBXA 3UD4P 2DNRA 2KXNB 3VALA 1SJQA 2D9OA 1WG4A 4WF9Q 1X4FA 1M5PC 4IUFA 4LMZA 3B4DA 4Y00A 4RU2A 2NZ4A 3CD6S 1ZZNA 5MLCV 2MPUA 1DHMA 1NJIT 2ZJQQ 1OWXA 1QVGR 2MZRA 5GAHU 2DB1A 3G96A 5FJ4A 2LEAA 2LXIA 2CPIA 2CPJA 3Q2TC 3ULHA 4F25A 1VQKS 1SJ3P 2KFYA 1OO0B 3P3DA 1U6FA 4ERDA 4FXWA 5IM0B 2OIHA 3UE2A 2KT5A 2G0CA 3BO3A 1M90T 3P6YC 3NNCA 1OPIA 2DH7A 2KRRA 3LPYA 2XS7A 1H6KX 4TU7A 2AYMA 5GAGU 2KYXA 4FXVA 5DM7Q 5JVHQ 3PIPQ 2RRAA 3B4MA 2M52A 3EX7B 3J7YU 1YJWS 1F9FA 2MKSA 2DH9A 3RW6A 3NS6A 2DHXA 4IO9Q 4C0OC 2MJNA 2MKCA 3CUNA 2RVJA 2YTCA 2MZQA 1VQ9S 5DM6Q 1X4BA 2JVRA 1U1NA 5IFMA 3NNAA 3BS9A 3SXLA 2N7CA 2MKIA 3MD1A 4QQBA 1A7GE 3VAIA 4J5OA 4F26A 2LQ5A 1Q82T 3Q2SC 4OZ1A 2N3OA 2L9WA 2RRBA 2J76E 2YH0A 1SJFA 3VAMA 3U1LA 2M70A 2NLWA 4F02A 1WHVA 2DHAA 3OW2R 1M1KT 2BZ2A 4LIRA 2XNQA 3CCLS 2DNGA 2DNQA 4U67Q 2JWNA 3R27A 4W90B 3MOJB 5D77A 1VQLS 1X5SA 4WIIA 2UP1A 2M0GB 1B7FA 1X5PA 3NNHA 1X4CA 1L3KA 2K3KA 4WFNQ 3N9UC 2MGZA 1M5KC 1U1OA 1FJCA 2MY7A 1FNXH 1G2EA 2KRBA 2ADCA 3MDFA 1SJRA 4M5DB 5CXTA 3G6ES 2AYEA 2CPYA 2HGNA 3H2VE 2CQ1A 4LJMA 2V94A 1PGZA 1KD1T 5CA5A 2U2FA 2DISA 2M9KA 1RK8A 1VBZA 2E5JA 1QM9A 1WEXA 3VAGA 3MD3A 1WTBA 1N8RT 1S79A 1WI6A 5LSLA 3S6EA 3UWTA 5H1SV 3CMES 3D2WA 1FHTA 2J0SD 2RQ4A 2DGUA 1P1TA 1JMTA 2CQ4A 4QPTA 1X5TA
chains in the Genus database with same CATH superfamily
3MECA 1U2CA 3MUVP 2OUGA 1FRIA 3V81B 2FC8A 2UVVA 2E5GA 1VMBA 4I4BA 1TUWA 4B3SJ 3JXOA 2FLLA 1SPBP 3UQSA 3AHPA 3N01A 1HYSB 4JV5F 4JI8J 4OX8A 1QE1A 3AQOA 1S1TA 1FDAA 5KFUA 4I6WA 4USIA 2W7AA 2CPXA 2CQ3A 5K8MA 4QW8A 4KRWA 4TVAB 4LFAF 2HURA 3MAHA 5D6GA 1UPMB 5ETOA 1KVIA 5F8MA 3DLKB 2CJKA 3QFHA 2A18A 3LW5C 2L9NA 4DFMA 4O44A 3BQ1A 4CNYA 3RRGA 3MUTP 1VLYA 3KWMA 2VG5A 2FJAB 3GU0A 3EICA 2GQQA 4WXOA 4DSKA 3ZTOA 3QGPA 4QU6A 2X1AA 2VKZG 2A2CA 4CTAB 4O23A 3K5OA 2CA9A 1U0HB 4PPDA 4C2MA 2VG6B 1FVSA 2OI2A 4ZPCA 2BANB 3WQPA 1NUEA 4DL5A 3BQ2A 1XK8A 2X51A 3W1YC 3VQSA 1UFWA 5CZVA 2IM0A 4D3GA 5KFAA 3TEHB 1RWXB 3E3XA 4IFVA 5ETSA 1J5EJ 3HHNB 1GEHA 2RQMA 4NLUA 4DU7A 3QFWA 4BLGA 3WIUA 1UWBB 3CCWA 2HHQA 5DJBA 4E8UA 2FHKA 1JXLA 1YJ7A 4H4MA 1HARA 2HQGA 2UUBF 1HD0A 4Q43A 1IBMJ 4CLUA 4CT9A 1SL1A 1YRXA 3N6MA 1R8CA 3CCES 1Q8LA 1D9DA 2DRBA 4XPCA 5IXUA 2B43A 3PEJA 2MHNA 3JTPA 2APOA 3MEDA 1KHVA 1PAUB 5HROA 5D3GB 1BXNA 4USMA 2YNGA 2M88A 5GAGI 4OI3A 3IRXA 2CG4A 5ITHA 1GT8A 3NCPA 3TVZA 3SDEB 3MUMP 1HNWF 1APSA 1OY9A 4DU8A 1EQMA 1KQGB 2CYYA 3W62A 2J6UA 2DIUA 3UFCX 3ONQA 3PFOA 2D3UA 4LR7A 3SQGA 3BZQA 4H4OB 2W7OA 2ZH3A 3OJUA 5DDQC 3KNAA 3J81U 3SIPB 2I5JA 3RGIA 1T8EA 2CNOB 1KONA 3O8WA 3CJ5A 1B0VA 3MTJA 2VC1A 3R2CJ 2UXCF 1CBKA 2YX7A 2BR0A 3PV8A 1X4HA 1NZ8A 3MM9A 4IH5A 4MKVA 4O0NA 2YX1A 2GW8A 5DZ7A 5KFEA 1RU2A 1D9FA 1V5VA 1MLAA 4RPFA 1BMQB 3TJAA 2RHQB 1N56A 2EG1A 2V69A 4NRTA 1FWLA 3PHEA 3KK3A 5GADI 5KG4A 4NASA 1OO0B 2NS1B 4ZOSA 2OIHA 1T3NA 3BGFA 1Z1ZA 4QZVB 1RT2A 3EX7B 3UDCA 3EWGA 5DS7A 1ICEB 4B9TA 2A6MA 3NKYA 5KG1A 1RLDA 4RUBA 4NEYA 3HK2A 3D67A 1CJVB 2UVRA 3GG1A 2GIFA 3RBEA 1T9WA 2BMBA 2J76E 1RAEB 5SZTA 1RWNB 4HT5A 2XNQA 2J0WA 4G6VB 2FVCA 3CSKA 1WC5A 1KWMA 3WC0A 1X4CA 1L3KA 4CLKA 4WFNQ 4P2FA 2VG7B 1U1OA 1G2EA 5C2CA 4RW4A 3CDUA 4LJMA 1PGZA 3F41A 3EVOA 2MDAA 2U2FA 1U7LA 5J2NA 1IVZA 2OKQA 4U6PA 2JZ5A 1WTBA 1NSPA 4USJC 1OYDA 4DUZF 4O4GA 4FF1A 2R2SA 2J0SD 1N0VC 5BR8J 4CM2A 4OMFG 1CJKA 2NSBA 1R8HA 3GIJA 2QMUB 2HFVA 3MECB 2CDRB 1QUVA 3T1YJ 3O6QA 3LP2A 3AA8A 2IIHA 2CKWA 4OX9J 2NQPA 4F0HA 4IR1A 5IC4B 2AEMA 3T41A 1YITS 1XMOJ 2G2YA 3M6VA 3POTA 1SKSA 3R6GB 3HKWA 1JKHA 4FN5A 1S9GA 4IFYB 2V0NA 1G7CB 4OYBA 1RSCA 9ATCB 5GAHI 1XQIA 3TARA 1SJ1A 4ZVOB 5K14B 1SUQB 2ZZTA 4OFZA 3TO8A 4FF4A 4Y2AA 4O44B 3R5JB 2L48A 1JLGB 1TK0A 3KHHA 3EMTA 2DJWA 3C6TB 4ED7A 4A8MP 1Q8BA 1J5OB 4OZLA 5E33A 2IRYA 1SH0A 4NEZA 4DCPB 3MCNA 3EJMA 1OQ6A 3D28A 2JX2A 2H4WB 3DKDA 1CULA 2GIRA 3RW7A 4LFBF 2V63A 4QW9A 2VHGA 3VAJA 2MKJA 3BGLA 3RR7A 4NRUA 4Q8EA 3M1VA 4WWSA 2O1PA 1TKTA 1TKXB 1X0FA 1F2HA 5GAEI 4P6QA 1VOMA 6AT1B 2GX8A 1HHQA 1UW4A 3KJVB 3KYLA 4DR4J 1NLKL 1ELOA 3OSNA 3RBZA 4CYUB 1RP5A 4EGLA 3Q89A 1S72S 3GIIA 2I38A 3UCZP 3GYGA 2MY8A 2ZDPA 1PYOB 3KFWX 2R8HA 3TZYA 5EUHA 1TVRA 3OTDA 3OQ2A 3FFIA 3LQVA 2F4VF 3PO5A 4QYRA 1QSLA 5C5JA 3PW2A 2LLZA 2AJ1A 3H59A 2WVCA 4N8NA 4N41A 5AXLA 4WKYA 1B70B 4IDKB 2RDIA 2CQCA 2AX1A 2DNLA 1X9WA 5B0EA 2K7KA 2JNJA 4DI6A 3HHLA 2HS3A 4WJBA 4RJVA 4DL2A 4FDFA 1RT5B 1WD6A 5E41A 4ED0A 3BGRA 2Z2MA 2D74B 3PR5B 1SC3B 4F4WA 2OAUA 3NEKA 4ZPWR 1K1SA 1WHYA 2LQJA 3AOAA 3SQGB 4A46A 1E6YA 2NUHA 3HMJG 4NCGA 2K1RA 2QC3A 4KGVB 2ZVSA 4R5PA 2IMOA 3LPEA 4E2FB 3BREA 3MM9B 4F2RA 3DOLB 5KG0A 2FJBB 1TELA 3ZZRA 2XY7A 2V50A 1NJWA 2CNLB 4A8KA 2C3UA 2FPHX 3F44A 1M5OC 1VQSA 5DQHA 1FJ7A 1HKAA 2HWIA 2N3LA 3W2WA 1UJ4A 3EM1A 4TKTA 4CO4A 2C2RA 1JNZB 4CZCA 2QN6B 3KLFB 3VGTA 3GR0A 2BOAA 2E1MC 5FJ4A 1M1HA 5E3AA 4RLEA 2CPIA 2N7YA 2KJVA 1SJ3P 2FJDB 5KT2A 1S0OA 4ZVPB 5IM0B 2POKA 2HHUA 4EU0A 3X1LB 3M2UA 4YY3J 1WKKA 4O0IA 4AQYF 2Z30B 4B3MJ 1YJWS 7FD1A 3D68A 3MGJA 1VQ9S 2NXJA 4DR5J 3Q8PB 1U1NA 1J27A 4PXEA 4NL5A 3VAIA 4U7CA 1B7YB 2WVEA 4ZVGA 3BSAA 3OUYA 2PT0A 2A0FB 2D69A 1VFJA 1C4CA 4LQ3A 2VJVA 3CCLS 1F2GA 1JJCB 3MEKA 2QIFA 3UDEA 1RJJA 1X5PA 3V6DB 2MY7A 3G6ES 4PG8A 2VIHA 5B0BA 1NZAA 5ETTA 3K5MA 2HFUA 3TAMB 2DXFA 5E3CA 3SI8A 1FD8A 4Y2IA 3FZ2A 1SL0A 3OXFA 2H5JB 3TR5A 2ZEJA 5LSLA 2YNHA 1V6HA 2R8JA 3C2PA 4QPTA 1IKXA 1MG7A 1BD6A 3I0SB 5HK4A 2J7KA 2D1CA 4R8UA 1SQFA 2ZVIA 1RT6A 1VLOA 3OT9A 4X66J 5JUMA 4I67A 3CB4A 3DLLQ 3A3PB 4G1PA 1HWIA 3VTIA 3OBIA 1F5BA 4NXMJ 1CPZA 1PJ5A 4DG1A 3SMZA 3PHTA 1GMUA 3SV4A 3A12A 1RT3A 4N5SA 5CD4H 4PG5A 4NLVA 3VF0B 3LGMA 1HBUA 2BUNA 1CC7A 2ZC4A 3CMAS 4QCLA 2FY8A 4DV4J 2J6TA 1RBLA 3TX0A 1S5ZA 4ER8A 3HHKA 3VAKA 3C16A 3JSRA 2QA2A 4X62J 3PTWA 1PSDA 3CJQA 4Q2LA 1TL4A 2WW8A 1N88A 3QJLA 4Y2CA 4DX5A 4FF2A 1X4GA 2BJ3A 4G1IA 1RTZA 5AXMA 5AE2A 2ZBCA 1IM4A 4DLEA 3Q22A 5A8RA 3HDSA 2NUUG 4G65A 1WI8A 1YWXA 1CULB 5HBMB 4KR0B 1DLOB 2YWEA 5H9FJ 1ZAXA 4DUYF 1IKYB 1X5OA 3SSRA 1X60A 5DGBA 2DGSA 2DT9A 4WP9A 2NPFA 3R7BB 1YTYA 1D1UA 4DF4A 2VUGA 3MM8B 5CZXA 2FVPA 5A0YA 1T05A 4YQWA 4FBTA 3SFUA 1RLCL 4FF3A 2O67A 4WE1A 1HPZB 1JLFA 2VODA 2ADBA 5B7WA 4C48A 2XHCA 4ZLLA 4OX6A 2B9WA 1LK5A 5CABA 3DLGA 1ZM4A 1FRKA 1RACB 2HWHA 2QG9B 3QWPA 4X4SA 1CS4A 4NZ6A 3TP2A 2MMYA 2ASLA 3MI7X 3MMAA 3GYXB 2CPDA 3GSIA 4IQXA 3FMWA 4M5MA 3K5NA 4PWUA 1PC4A 4P2SA 1RT7B 4F4XA 3OTEA 3AB2B 3D54A 1HA1A 2DPIA 4NOHA 4WK1A 3MPWA 3HD2A 1S9FA 1SC4B 2RHSB 3CDEA 2YPZA 2HQDA 1K9MT 3WDOA 3OR1B 2RT3A 2JFKA 2V2QA 3PO4A 4WCEQ 4KPCA 3JSMB 1FDNA 3Q8UA 2XMMA 2H5EA 1H3DA 4MIBA 4M95A 1H2VZ 4U8YA 2B4OA 2MHEA 2CDQA 4DF8A 4FVCA 4L3KA 2EPIA 3GFHA 2XO7A 1PO6A 4LSZB 3G87A 4OI6A 3ETMA 4C97A 1WG4A 1S1VA 3E51A 1M5PC 3DGPA 1P9QC 1ZZNA 2J0XA 2OD6A 5GAHU 5KT3A 2ZITA 2GVZB 2WONA 4JI5F 2AYMA 2J9DA 2ZOGA 1I3OB 3QGHA 8AT1B 2WB1D 2HHVA 2F65A 1H7WA 2R42A 1HBNB 3ISNC 1KVKA 5IWAJ 4XPEA 2XGQA 4HT7A 2D41A 1GXLA 4NMXA 3HSDA 1UCNA 2Z57B 2ALZA 1KSPA 4NE9C 1Y5LB 3NWRA 2P9GA 1M5KC 2QLBB 2R7VA 3OTOJ 2IY5B 2AGPA 5D4OA 3TI0A 4WU3A 2L3MA 2CPYA 5G4DA 2DYAA 1R3NA 5KFYA 3DOKA 2YKMB 2ZM6F 1RK8A 2X3GA 1AZSA 2XC9A 3ILIA 3MR5A 1TL1B 5J1EB 1FHTA 3GCWP 4B17A 1RHJB 1T03B 3CTRA 3R5DA 4MFBA 4K50A 3GIRA 5A2QU 4D3HA 3DLHA 2W4PA 3M6UA 2OELA 3G8QA 2R7XA 3LF0A 1RT6B 3N5BA 4M5GA 1FXLA 2R7UA 1R7IA 2WOMA 3CC4S 4MYUA 4CH7A 1RTDB 4A8OA 5ETMA 1Y11A 3I31A 1RQ0A 1YG0A 5CYMA 2QYCA 2AKWB 3PG9A 2H4YB 1LKZA 1P6TA 2EBEA 4JV1A 3CMQA 2DRDA 1UVKA 2YKNA 2HW3A 2AJ4A 2AZ1A 2HRUA 2UUCJ 4DV3J 1N6QA 1LWCB 2V9KA 3GV5B 3UDLA 2IYGA 3UD3P 5KT6A 4HTJA 5HVFA 5KFIA 1DBDA 3QJJA 4ZLJA 2KZZA 4B3SF 3J81Y 3IG1A 2ZUAA 4DV2F 1X9MA 2BJEA 2CVIA 1N5YA 3I6PA 4JI3F 4JI8F 4ELUA 2PMZD 4CQ1A 6FDRA 1GMWD 1HNXJ 2FVSA 2FVQA 5CYJA 1G4CA 2Z2LA 1FEEA 3RYLA 1B99A 2G1HA 3DM2A 4YB7A 1IJEB 3KJNB 4RW7A 1I94J 4LQ9A 2CQIA 4QWEA 4IG0A 3R7SB 2MQQA 1VQ5S 3H98A 3OFHA 5HVGA 1UZDA 2BRLA 3I96A 4K8RA 2OHDA 2AYGA 3JQJA 3M2VA 1Q4RA 1DQAA 1HLWA 4JI2F 1IBLF 3V6KA 1PYSB 4UOGA 1T11A 4LBHA 4ZK7M 3Q8RB 3NP5A 3ET6A 4LIWA 3IP0A 3A8IA 3DXBA 3RR8A 3M05A 3ILJA 2HHSA 1RE1B 1WORA 3EXCX 1T05B 2C2MB 4WP3A 2BYCA 1U1KA 1NEEA 1QTNB 3L09A 1TP7A 4DR7J 2RS8A 4JUZA 2F1FA 1CQMA 2VZ9A 1VI7A 1NKBA 4OZ0A 2XI2A 5DZ6A 1J5EF 5KG5A 3VZHA 1VQ8S 4ZP7A 3OVSA 4A8QA 2CQ0A 2E5HA 1Q79A 5LT5A 1LWEB 4LUBA 3OHBA 1AFIA 3DLGB 2ZH8A 3DRPA 6FD1A 1UEVA 3VCDA 1XMQF 3PJ9A 1RKIA 1QSSA 3H0PA 2XZDB 3CC2S 1KBRA 2XMTA 1CJUB 2ZBQA 1L5UA 3DDIA 3M8PB 1RABB 2HIQA 3A3OB 3O1LA 3CCZA 1HWKA 2W2QP 3RAMA 4ED4A 3E01A 2HSEB 2QEXS 1YIJS 1C0TB 1AYEA 4P7VA 3W5XA 1RGVA 2M7SA 4M5KA 3GB0A 4L73A 3PW7A 3QWUA 1CLFA 3BBBA 1U47A 1FX2A 1UKUA 2CQ2A 2WSEC 4LFAJ 1Q0NA 1MSWD 2X1FA 1BY9A 3I82A 3ZTSA 1RHQB 4EI2A 3K59A 4CLWA 5F3TA 3HM9A 4HDGA 4FKYA 1NJIT 4HDHA 4WTYA 1FFWB 1LOUA 1VBKA 2VQEF 1R27B 1S7HA 4J9VA 5JJBA 1M90T 4I0WA 1IKVA 2KRRA 4N8OA 5KFQA 3CJKB 5E3QA 1B0TA 3F56A 2OFHX 1F9FA 2VD3A 3ZXWA 2Z56B 4GRSA 2JVRA 3EZ5A 3DI6A 3NNAA 3AXMA 4NCAA 4J5OA 2EG2A 5ETQA 3MR3A 1SJFA 2RRBA 4USVA 4XO0A 2DHAA 5L1IA 4WYLA 2DNGA 5A8KB 1MMDA 2BJ9A 1RHRB 5KFWA 4DQQA 2M0GB 1B7FA 3GILA 2KRBA 3PJXA 1RI7A 4Z37A 4K0KF 1KD1T 1TL7B 5HQLA 2BE9B 5A6PA 1VBZA 1FA0A 5L1KA 1S79A 1FK9B 4ETXA 4UUXA 1O0PA 2AJQA 2B4VA 1F5AA 3L4BC 2HK2A 1ZM9A 2ZE2A 4LRDA 3R97A 2I0XA 4O4RA 2OPPB 1N32F 3QYYA 5EX3A 2DCUB 2OPSB 1Q8IA 2YX4A 1B64A 3TVYA 3TRGA 5AE1A 1BUXA 2KHDA 1DFDA 3HFVA 4MK7A 5CYMB 4PQAA 3NOGA 4KY3A 5BR8F 5HANA 1LWFA 3ZNUA 3CJ3A 2CRLA 3NWGA 1K0VA 4TXSA 3H5XA 4K4UA 3GMGA 3W60A 4A8XA 1JWWA 2YKAA 3T1YF 1YI2S 4YOEA 1RT1A 1EP4B 2CPHA 4HI1A 3FMBA 5HQ8A 1XMOF 1HBOA 2VFTA 4FPIA 4ZA1A 5B09A 2CWKA 1S6UA 4PWDA 3THTA 4DL0C 5CH7B 3ZZZA 1HFEL 5HMYA 3MZIA 3MXHP 3J80U 1HNVB 5C24A 5FDLB 2QGFB 3PFEA 2NXUA 1QSYA 2HYIB 4TY9A 3S8SA 1ULRA 5IZHA 3ENAA 4N56A 4ZP6A 2NSCA 2V8DA 2AZ3A 1DTTB 1OYEA 2DO4A 3G6XA 4KHPJ 2HHXA 1W26A 3PYGA 2WSFC 1TU0B 2E5IA 2K7JA 4C8MA 4LBPA 2CJQA 1VQPS 1KR4A 1RBOB 4DSLA 1FESA 1KTQA 2VQFF 2IVMA 4M94A 3RBXA 2MSSA 1H2UX 2FLOA 2HZCA 4CLLA 2HNYB 3AJ2A 2EXUA 1XNRF 3M2RB 2VPYB 1GMWA 4C3MA 4Y3CA 2DR7A 1UETA 2F9DA 3CEDA 4P10A 4KC5A 3K7RA 4BWJA 4R0EA 1QJHA 2PA8D 3IWLA 4YDXA 2HQFA 1O51A 4DCOB 3AB4B 2DNHA 4OX7A 1KC8T 3DRSB 2HFSA 3DFEA 5GMDA 1NDCA 1U1QA 3D3CJ 4F67A 1P1LA 4DUZJ 3PACA 2E7WA 1K1QA 1UTAA 3BSNA 2XCAA 3BQ0A 4I2PA 3J81j 3CJRA 4NZ7A 4DFPA 4ZVEA 4C8KA 1HMVA 4DS4A 4L6V3 4KIAA 1AROP 1YZ6A 1RDRA 2MZ1A 2BQRA 2IM3A 4I56A 1O5JA 2W2NP 1C0UB 1NJYA 2MKKA 3THPA 3A4TA 3M32B 4OYZA 3M9NB 1R6YA 3K17A 3C15A 4H54A 1XERA 1VCTA 1X0PA 3VVUA 4N47A 4Q0BA 2E44A 4DPYA 5AE3A 1BE4A 1NDKA 3EDRB 3OFFA 3GIKA 3PX6A 5MLCV 4IH7A 1UVIA 2LXIA 2BQ3A 1GXUA 4ERDA 2DR8A 5I42A 3BO3A 2UVUA 1XEZA 4CCHA 2ZOFA 1TMMA 5JVHQ 1IKVB 1GX6A 4JI1F 2IDLA 2JFDA 1Q95G 2IC3B 5KT7A 2QV6A 3D1QA 2KYZA 1DARA 3O3LA 3BR9A 4FS1A 2ATCB 1GMVA 1FNMA 1RAHB 4LF1A 2NLWA 4ILRA 3FJ2A 4PZVA 1T95A 1IM6A 1PILA 3FRYA 3PNIA 1WC0A 2ILZA 4I2QA 4KGXB 4X4PA 1HI8A 4KO0B 1NDPA 1RHMB 2XHWA 1FJCA 1W7WA 5KFXA 2LQBA 1DTQA 5CA5A 4M5IA 3GE9A 2EI5A 1I6JA 3D0HE 3KLHA 4OQJA 2EFVA 1UVMA 3IR5B 2MLXA 3SQOP 2KVQE 1FERA 3KK2B 2LDYA 2MYFA 4DQPA 2CIMA 3UNYA 5I4MA 4BCAA 1Q1KA 3TUPA 4PABA 2DCLA 4MKBA 4BC9A 5K8NA 2F8EX 2V8HA 1YRTA 4DPOA 3LP1A 2N82B 4YR0A 2OMOA 2DNPA 3DLBA 1S6OA 4IG3B 4ZVUB 2GHVC 3S01A 1Y5NB 3SSQA 1U1RA 2OSRA 4MJKA 5HL7Q 1XNQJ 1VQYA 2Z8QA 4QBUA 3GLJA 1REVA 4CLTA 1RTHA 4X66F 1MN7A 3QAUA 1MMLA 4KV8B 2FY1A 1VRUB 5I3UA 5ETKA 3N5FA 1OJ4A 2V2ZA 4KFBA 1TV6B 3O44A 5JVGQ 4KAIA 1JLAB 1UJ5A 3KNGA 1S49A 1HQEB 2PMWA 5KG2A 3OLBA 3CF5Q 1RTIA 4HYKA 4ILMA 4K4WA 4NLYA 1S9EB 4JI0J 1IWAA 2VPZB 4KKOA 1EKSA 2Q6CA 4F0KA 2XMAA 4U95A 3A8KA 1Q81T 4DV4F 3DRXA 3G8TA 2V4JA 3W9HA 1GQEA 5C24B 3C46A 5G0RA 2AP6A 1N5VA 1EETA 5J2PA 1SB6A 2KG0A 4CLYA 1KOOA 1S99A 2IAJA 4E98A 1CJTA 3W65A 4WFBQ 4TQRA 4RW9A 1VJQA 4F36A 2M2BA 2Q79A 4C98A 4C8LA 4EYHB 3JSBA 3D1OA 3CPWR 5LXRA 3N6NA 3KHRA 1H2TZ 2DPJA 4DOZA 4P71A 2ZZNA 1FEHA 4NLPA 3R6LB 2J9EA 4Y2KA 2B6AB 1U49A 2C28A 4QR1A 4DEZA 1KLNA 2F8HA 3J7YI 4USKA 5KFRA 1SV5A 2Q43A 4CO0A 5I3QA 1N4LA 1E6VA 4NLTA 5J1PA 1IR2A 3KUEA 4FBUA 5HATA 2RQKA 3SSSA 2AW0A 5A2QY 1S6QA 5C25A 2HKEA 2YNFB 1QAIA 1EARA 2YNIB 1JJHA 4B9NA 3R2DJ 5IQQA 5M2RA 1LW0B 3BKTA 1ZPVA 4CO5A 2E9RX 5T7LB 3ZZOA 4LF4F 1HMVB 5CCMA 5DQGA 4MKAA 1AFJA 2AYBA 3CJSA 2HNZB 3RB4A 3MR2A 4DQSA 2HMIB 3LP0A 2AGQA 1I51B 1SKRA 3TZZA 4B9LA 4UQTA 5HMZA 2GV1A 2L9DA 5KFKA 3Q86A 3M9OB 2DD8S 3UD4P 4UY85 3AY0A 4ZLPA 4UOHA 2UUAJ 2H48B 1HYSA 2XLKA 3KKFA 4I7FB 5K8OA 2AJ2A 1BQMB 3WHIA 1BHNA 1QVGR 4I6AA 5F3ZA 3ADAC 3K5PA 1LXNA 2JEFA 3UN2A 3FUYA 5D4PA 4EFAC 4J9MA 1RWVB 2CZ9A 4DMZA 4TU7A 1QD1A 2CAJA 1IXKA 3NS6A 5HJXA 3JTOA 3FQLA 1HW9A 3DLKA 1X4BA 2W9AA 3L7OA 4NA2A 4LF7F 3Q83A 3NGUA 1EZZB 4E0DA 4RO0A 4B9SA 1XR5A 4U67Q 1FWPA 4CTAA 3K57A 4K2XA 1S77D 2LU1A 4C6AA 1SKWA 3GV8B 3IM9A 3IFEA 4C0BA 1FNXH 4CP5A 4F4KA 5AXKA 3HP6A 4HLBA 4LFCF 4KYZA 2BANA 2V94A 3UN5A 2P5VA 4ZCIA 3N28A 5IWAF 4ENOA 4DQIA 5H1SV 1KP6A 4L76A 2PD1A 3FDSA 1JMTA 2HHWA 2AX0A 4MKYA 5B0GA 4GC6A 1VK3A 2W4CA 2KXFA 2OSQA 2QSWA 2BM0A 3OTOF 1XJWB 4ED5A 3BGOP 4Y65A 3AQPA 4YHHJ 3NCRA 1HW8A 4XIUA 1OSCA 3DOMB 2OD4A 4WTOB 4X2BA 4ZPAA 4DL4A 3FSIA 3MMJA 4TN2A 2DNNA 5D3GA 3W8PA 3EGVA 4EMDA 5LSOA 2RDJA 1SQGA 4KH1B 4QIWD 1J2VA 1WOOA 1F0XA 4EZ9A 3KLIB 3FZBA 3QSIA 1KFSA 2KFNA 3SDEA 2BACA 4YB1P 4KFBB 3F0NA 2XG8A 5EDWA 4HHUA 5KFCA 3PR4A 2KT3A 1IQTA 3LA0A 1KEKA 3HJFA 4OYIA 4RBTA 4DV3F 1U6BA 3DMJB 4O3NA 2IVYA 3FSYA 4H4OA 5F0UA 4WP8A 1WF2A 3KMSA 1Y00A 2C1EB 2KG1A 2VFSA 3TQ1A 3CJ4A 4B02A 3WC2A 4PR6A 2RB7A 1VBYA 4PQUB 3K89A 1RTJB 2CZ4A 5J2MA 1S1WB 1VK8A 5CD4A 3EPIA 1RWUA 4NA1A 3VAFA 1KQKA 5G0RB 1JLCB 1HNXF 2XQCA 2ASJA 2HBQB 1IKWB 2F5GA 4YB6A 4JI5J 3OD2A 3CVKA 5EWFA 3GFXA 2JOQA 1WF0A 1SQEA 2FJVA 2C2DA 3BB5A 1FJEB 3AOCA 4HKQA 4F7VA 5LXYA 2DXEA 4BHQA 5HJYA 2FLNA 4WPAA 4NPOA 3TOQA 2NR0A 4ZVSB 2ROEA 3HVTB 4LT6A 2LA6A 4U7UD 3PKYA 5AXNA 1ZS6A 1T02A 3F73A 2LMIA 2ZWOA 1DY3A 3Q23A 2MZTA 2U1AA 1IQZA 1MW7A 4Z7YA 1CJVA 2QJ3A 3CJ0A 4NLXA 3TVKA 3CCQS 2GO8A 3CXCR 2ZM6J 5C7PA 1TFYA 1WOSA 3UR3C 4P2MA 3K0JA 3SEOA 1FT8A 3EUNA 2AJFE 1KKHA 2EEYA 5E0OA 3T1AA 4O3OA 2IYIA 5HN0A 3I5BA 1DQ8A 1FE4A 2PDAA 3D7SB 2V68A 2HZAA 1YLXA 1WSVA 3UCUP 4DJBA 5IV3A 1F60B 3R5CA 3I0RB 4DXLA 2IRUA 3OXGA 5GMEA 1M5VC 5LMUF 3UR0A 2QA1A 2ZC3A 1HI0P 3FVYA 5HP1B 4WZQA 3G4SS 4EWTA 5DDPC 3LGHA 4EBDA 3VWSA 1OY8A 4ZHRB 3KG1A 4RBUA 2UU9F 4ITSA 2DNRA 3MEEB 4KHRA 2AIRB 4A8YA 4DV2J 1CQNA 1DHMA 2NXCA 2LVWA 4AE5A 4JI3J 2O5DA 3BV8A 1ITPA 4IFYA 1U6FA 3HZEA 1WTFA 2G0CA 3VVTA 3QGGA 3A1YG 1NB2A 2AHOB 2FDNA 2XEXA 1V3ZA 2NXEA 3J80Y 4KGKA 3AT1B 3CD5A 1YBAA 3BS9A 5KFVA 1S12A 1Y3KA 2HNDA 4DX7A 4EK2A 5K14A 1SUQA 3QBCA 2N3OA 3CIZA 3VAMA 3U1LA 1JLGA 2XYGB 4J9PA 3C6TA 1MU2B 1WSRA 3OW2R 3TWZA 2OPRB 1NNDA 1J5OA 2JLEA 3WX8A 1DJ0A 2GVDA 1HBMA 4JI2J 1IBLJ 4ZN3A 3NNHA 3EVWA 3OL9A 1R89A 2AYEA 2QO3A 2KO1A 1FE0A 2KFZA 2CQ1A 4CDIA 4OHWA 1TKZB 2GJ2A 4I1TA 1IUJA 1TKXA 2E5JA 2LXFA 2QZ8A 4KPYA 1MWZA 3KUHA 3MR7A 2RQ4A 4ZPBA 3KJVA 3Q8SB 5JMNA 1VYAA 1WG5A 5KAKA 3UVJB 2XCPA 4CYUA 2VDIA 2VICA 4AXIA 1JJ2R 3UDVA 2EW9A 3RBDA 2FJEB 3HPOA 1UP1A 1RU1A 3KDOA 1HNZF 2GO9A 4H4KA 5IT4A 2CADA 2J5AA 1XMQJ 1FKPB 2H1YA 2XGPA 1R8PA 4LSLA 1IWGA 5DQIA 2ZJPQ 1U45A 4LVOP 4IDKA 4DCJB 4AL5A 4PKDB 4UY8T 4RBVA 1PG5B 3AJDA 4X65J 2VOPA 1C1BA 3KXDA 4ED2A 3OR2B 1S1XB 4NLRA 3W2VA 2ZH5A 2LFVA 1RT5A 3MM6B 1S76D 4I64A 4GO7X 1U1LA 4TYBA 4ANEA 2HWTA 2VOOA 2FJXA 3HT3A 2MGZB 4RNOA 1MROB 1K47A 2OEJA 2DBBA 4IYQA 2D7SA 3A13A 1AUDA 3H90A 5LSRA 4KHMA 2ZH1A 5J2MB 3OHAA 2VQEJ 2DGQA 3DOLA 2VA2A 3L9ZA 2GS8A 1H98A 2BJDA 2EFNA 1QVFR 3EGNA 4LR8A 5HI7A 2GAHC 3W61A 4DBQA 3KLFA 2LXUA 4OI0A 4L75A 1KLMB 4OZ3A 2AEFA 4JV2A 3M8RA 1LWXA 5IM0A 2B8QA 2XLIA 1X4EA 4KHPF 5SUHA 1TQLA 4TNOA 4F0MA 5F8NA 2IJNA 5F9NA 3CO9A 1D8YA 4CH0S 4V19J 3NG8A 3C19A 4PG7A 1NK0A 3QRQA 2C3YA 4K0KJ 4TY8B 4LBIA 2PMHA 4F8RA 4JI6J 2V4RA 4LF8J 4C8YA 3ICLA 2BEFA 2ZNZA 3T6BA 5DRKA 1QAXA 1XTZA 2R9LA 3Q8YA 2GNKA 2XMJA 3BM7A 2DO0A 1F3FA 1KDNA 1NDLA 2BV3A 3V6DA 3TZXA 2W25A 1RYRA 2XMKA 4HH1A 3NCQA 3WIVA 4QPXA 3ZZUA 4LSNA 5DG7A 2UXBF 3GFZA 5CYQB 5A6WA 3TAMA 4K4SA 1FO1A 4TQSA 5KFPA 2B56A 3I55S 4DR3F 1N32J 2JSXA 2XYHB 4J9LA 3I0SA 4PUOA 3KOAA 3ZTRA 3H2UB 2MEWA 3A8JA 1HWLA 4LF9J 1XMBA 3TAQA 4NXNF 4GO5X 4JI4F 4OJ3A 3MM5B 1NJZA 4KQZA 3UO0A 4RKUC 1JXEA 1H74A 3M30A 4OYAA 2PFDA 2FQQB 2DRAA 4MAKA 1QDUB 4B9VA 3NBPB 3TNVA 1U2RA 3QZ8A 4O3QA 2DHXA 2C2KB 1BQNB 3WBZA 4WYWA 3VGSA 4LF5F 3MD1A 1U48A 2VASA 3QIPB 1OS5A 1V3RA 2UXDF 2HNDB 3L95X 2CJ9A 3PM9A 3IBWA 2C2ZB 1X7VA 3CWJA 1NK6A 3FKBA 1L3SA 3H5YA 2I8EA 2HFOA 3RB0A 2HLUA 7AT1B 4CWBA 2GVDB 2R8KA 1HBMB 5DG9A 2XMWA 3MAAA 2JEGA 4ELTA 3OLAA 2Z0GA 4YR3A 5HBMA 3H2VE 2Z2YB 1FWKA 1ACMB 2IM1A 1DLOA 1WC1A 4RNHA 1IKYA 1QM9A 1WEXA 2VQFJ 2HRTA 4AL7A 4MTPA 1XNRJ 2RRNA 1HL6A 2HFNA 3GJSB 4Y0FA 2RE1A 4GMKA 1UJ6A 3T9ZA 3MM8A 3T5KA 2D3O1 4NX9A 5CAAA 5BYRA 2YH1A 2OEMA 1HR0F 4ED3A 5EX0A 1PKUA 1IR1A 5F8LA 3M8QB 1YRUA 1T9TA 1HPZA 1AUSL 3DDKA 3PYDA 2DHHA 4ICLA 4IRCA 1BGXT 5KT5A 2D9PA 3AJ1A 2ZD1B 2KKHA 5B0CA 2JVOA 4LSLB 4DDFA 2HZVA 5EN1A 2E5LF 5F0WA 4F50A 2I2YA 1R8AA 4X4RA 4C9DA 2KN4A 5LJ5Y 3V4IB 1ZOTA 4UT4A 4IRDA 4DV1J 1C1BB 1RHKB 2WK4A 2XY6A 2FHJD 4QWBA 3JYTB 1W25A 3W2VB 3VV2B 5IC6B 1VC0A 1XNQF 1G1XA 3UD5A 1T0TV 1RT7A 3D0IE 3KG0A 4QWAA 3MEGB 3TX8A 3QRPA 4ZMMA 1G3OA 3FEZA 3BSOA 2R8IA 3RG6A 3HKZD 1OIAA 4QWDA 1U02A 2Z4PA 1CG2A 2RU9A 1Q7YT 4DPTA 3OR1A 2M4MA 2Q3PA 3JSMA 3QPIA 1RAFB 2GMHA 4JI0F 3DU5A 2YVSA 2R7OA 2PSZA 3DU6A 4O3PA 2YWFA 3VHQA 2Q6BA 3D6HB 4QIFA 3KLEB 1OPZA 4JI1J 2VPXB 2FZKB 3BPSP 3ENQA 2KM8B 3LANA 1UWAA 4RNMA 3BPDA 1I5OB 1NK8A 3BBFA 4B9UA 3ITHA 2GMLA 1G6BA 4MK9A 4CH1A 2NCKL 1RXOB 4EO8A 3OV7A 5CCLA 2X1GA 2GVZA 2ZDOA 1LEOA 4OI4A 4P9SA 1TL3B 2ABYA 2MXYA 3CULA 2G0IA 4X64F 4DHVA 4DV0F 1K8AT 2KI2A 2WW4A 4HVZA 1HBNA 2KZMA 2GAGC 4ECUA 3H2LA 3T5JA 2RS2A 3NAHA 1WDTA 3GCXP 4K5SA 4YUDA 3M8SA 1NSKL 4ECYA 3FCWA 1PJ7A 4USWA 5KFMA 1U6ZA 2GFFA 2HFZA 2GA7A 3BBCA 3W7BA 2E7VA 1M0SA 3FBCA 2YKMA 4BWMA 4LSNB 4F3QA 3U1MA 1TL1A 5J1EA 1ZBTA 1T03A 5EWGA 4ID5B 2A1BA 4DSJA 2V5HG 1VQOS 2ZH9A 4DS5A 3ZZTA 4PUOB 3PCOB 1C1CB 3FBFA 5B0FA 4ZCLA 5A8WA 2KXNB 2W9BB 1RTDA 2DTJA 2R7WA 2NYIA 4S0MA 1PBAA 2QFIA 3M30B 3CW2C 2QX0A 3H4DA 2C3MA 3EZOA 4AXJA 3CGIA 2XS7A 1H6KX 1XR6A 1LWCA 4EO6A 4HI2A 5GAGU 2QA4G 2M3DA 4FXVA 2R3VA 3B4MA 3SCLE 2HS4A 3QIDA 2KJWA 3UN3A 2X3DA 4OZJA 2N7CA 4XDCA 4DN0A 2H3EB 2Y3YA 2UUAF 2HEKA 4OJHA 3N6LA 2HLTA 4NI2B 1WHVA 1M1KT 3QLHB 4L74A 3D66A 2G0JA 4G1QB 2JWNA 2VBYA 1UVNA 1VQLS 2F40A 3N9UC 4WBFA 3H20A 4NLWA 1SJRA 4M5DB 5CXTA 4WXWA 5E7OB 3MAAB 3MMBB 2B8PA 3MD3A 3DXSX 2W1BA 1JLEA 3CMES 3D2WA 2QMWA 3FNNA 3TUIC 3QT6A 1X5TA 5J2QB 3B82A 4RWXA 4RUCA 4YDDB 1LV5A 2RQCA 1NJXA 2C2OB 2MZJA 5C42B 5GADU 4J37A 1N33F 1TUVA 3R1LA 1WACA 5T14A 2C3OA 3H7HB 3P8BB 1URRA 5E2QA 3MR6A 2BE2A 3IS9B 5DLFA 4LREA 1S57A 3I5AA 3W5ZA 4ED8A 2DGXA 3R8YA 2FJWA 2GHWA 3GTYX 4B3OB 2R7QA 3OL7A 2W01A 4ICLB 2YQ0A 1WEZA 2QLWA 2KHCA 1LWEA 3BR8A 2LKZA 1T9UA 4J9KA 3ENWA 5CHCB 4LF4J 1ZPWX 1Q7LB 4GVLA 2B5JB 2ZH4A 4YHHF 3MMCB 5ETLA 4RU9A 4EUVA 2ROGA 1CJUA 2YWWA 3G9CA 3GQCA 2FC9A 3M8PA 4PWWA 2JH3A 1AA1B 3GJRB 4NCBA 1ZAWA 4FYXB 1PBUA 4DSEA 1JJ4A 5F8IA 2JLFA 1C0TA 1VR6A 4UW2A 2QE5A 1U4BA 4HR2A 5D8HB 2I1RA 4J90A 4Y28C 1WG1A 5C2GA 2KB2A 1S1UB 2AF6A 3GV7B 4RW6B 3C6UB 1S6PB 2HVHA 1HNIB 2DH8A 2UZAA 4HACB 4RZRA 2RJZA 1BC6A 1GFWB 3FSXA 5LM7E 2HHTA 1NO8A 1N54B 4LF7J 2KT2A 2B7BB 4PYAA 3NGSA 2EFGA 3VZIA 3CD0A 3ITHB 2FHJA 3MM7A 2QTWA 4YP3A 3CJKA 1IBCB 1FX4A 3SZ2A 2P2CB 2LCWA 2HBYB 3HT0A 3FC9A 5KFDA 4RW8B 2RKIB 4LFCJ 2VBZA 3MHYA 3BO2A 1XIQA 3EXYA 2MQMA 5M2UA 3IBFB 4ATNA 2IA0A 3CJTA 5L39A 2AWZA 3BO4A 5A8KA 2G1DA 5GMKa 1TMJA 2KL8A 2OFGX 1GH8A 2CQHA 2LP4A 3AAWB 2BJ7A 5HO4A 2ZHOA 3DN9A 2GHPA 5F8JA 1R0AB 4HHJA 3DLEB 3HHLD 1LW2B 5EHHA 2H65B 4Q2MA 5GAEU 2HVZA 1RT4A 5HQMA 2ZZMA 4IKAA 2RD5C 1TL7A 5DO2A 2I6WA 1Q86T 4DR6J 2VFUA 1FKOB 1FK9A 1REGX 4IOCQ 2HVDA 2R7RA 2WB4A 1OY6A 2AQ4A 2YPYA 1WEYA 1VIXA 3PKMA 1UEKA 4L72B 3GIMA 3KHGA 3NGKA 2KH9A 2OPQB 1VQNS 1WELA 1UA1A 3AD8C 4K59A 3LH2S 3R5AA 4WF9Q 5A8WB 2OPPA 3B4DA 3CD6S 4ZJLA 2OPSA 3G82B 3KK1B 5HSPA 1NXIA 4DX6A 1VQKS 1VRTA 4USHA 4LR9A 3UE2A 3RB3A 4ZN1A 2BA9A 4KGZB 3PIPQ 2RRAA 1RAGB 2MKSA 1S4FA 3QGIA 4ECXA 4QWCA 5DM6Q 5ETRA 1EP4A 2VV5A 3SXLA 1NMEB 1NK4A 2BABA 1FFSB 4QYZJ 4OZ1A 2PI4A 2Y9HA 5I3PA 1B3TA 2J7UA 2H5IB 2YH0A 1Y5IB 4FYDA 3EVMA 1HHTP 5RUBA 4P72A 1X5SA 1TK8A 2B9YA 1HNVA 4XTTA 5FDLA 2ADCA 3TA2A 1MN9A 1KNZA 3QO9B 1JLQB 4K7QA 1UVLA 1DTTA 4DZDA 2J8SA 3KLGA 4MIWA 1JLEB 5HMWA 4UQGA 3FEYB 3KUGA 3LUYA 5DGAA 4U9RA 3A3NB 1OQ3A 3EDQB 1NH8A 3MURP 5LOQA 3NL0A 3HD1A 1Y0HA 3B78A 1FDBA 3TUZC 3KTQA 2ZH2A 1JB0C 3NS5A 4RUHA 3SCJE 4C11B 2Y0SD 3W66A 3NLCA 4P75A 2AV5A 2HNYA 3M2RA 2BE2B 2DHGA 4JBCA 4O3SA 2ZHAA 3HVAA 2E66A 4EZ6A 4K4YA 2W9CB 1MWYA 1GTEA 4FNHA 2L08A 3US5A 3NMRA 2BW7A 3U7JA 1ZA2B 2AMCB 1C2PA 4MH8A 2QA4S 2ASDA 4W92B 2B9XA 3DRSA 1GX5A 1FXRA 1UZHA 1C4AA 5BXIA 5LMUJ 5LL6d 1JLBB 4XDDA 2XS2A 4XAKA 1A6LA 2GGPB 3HI9A 4I69A 2IHR1 3IC1A 2UU9J 2DGVA 5ETVA 1VDHA 2J8AA 4X65F 4ANCA 2F9JA 1XBWA 1C0UA 5KFSA 4UZBA 4PRFA 3RZAA 2W2PP 2RUSA 3M32A 3J7ZT 1UMJA 3UCGA 2COLA 5HLFB 1ZH5A 5D4NA 1S4EA 1SCJB 3DNCA 1EX8A 2YY3A 2HPUA 1U2FA 1KFDA 1ZTTA 1JXVA 2DNYA 4TYAA 3GFYA 1K0TA 4CIOA 4Q44A 2R2TA 4ZS6A 4OL8A 1RKJA 4WU2A 1U24A 3JTNA 1QE1B 3MCMA 4LRFA 1FCAA 1S1TB 2KXHA 3G6YA 1DZ5A 3J7AN 3EPGA 2N4CA 1SXLA 3CDWA 3S1TA 1YSJA 3MM7B 1WWHA 1RWOB 1CSJA 2IC3A 2EK6A 2MQLA 2EKNA 3SYZA 3UW1A 4NLDA 2XZTB 2ZH6A 4M5HA 1SIWB 1FI4A 3C8YA 2H54B 1N5TA 2VG5B 1N34F 3QT8A 2CNKB 4ID8A 1RBAA 5U47A 2AGOA 3RRKA 2W7PA 4OIXA 4Y6IA 1A0OB 2WVFA 4KO0A 5KT4A 4CLSA 3SBMA 2D3ZA 1R6VA 2FB0A 2Z58B 4YS2A 2FHOB 2JRSA 1FRXA 1BLUA 4C8NA 5M2PA 3BDEA 1RT4B 3CIMA 1VJWA 3KLVA 1HNZJ 3LAMA 4JI6F 4LF8F 3PDNA 3KK2A 1VQ6S 2MQ8A 4IFVB 1WC3A 3M7VA 3TZWA 1RWPB 2DY9A 2DR6A 2UV8A 4DV5J 2WBMA 2V2VA 4DR2J 3BN4A 4H4KC 4YEAA 1TZ0A 4H4MB 4IG3A 1LXJA 2W24A 2PO4A 2F4FA 4F25A 1OPIA 1VRTB 2AJ0A 3MF5A 2HIYA 2LU2A 3PRVA 4LF9F 3IXQA 2ZH7A 1OSDA 4C0OC 2MKCA 4KV8A 3B54A 4FNIA 3MEDB 1L3VA 2ZOMA 5HROB 1VRUA 2GQ2A 2YNGB 3SV3A 4WIQA 1NKEA 4QQBA 3IRXB 4RNFA 1L3TA 1TV6A 3U02A 2PA3A 1FKAF 1JLAA 4ZCMA 1HQEA 4F02A 2HHPA 1Q78A 2W8LA 1NKCA 3IAS9 2AEJA 4LIRA 3E2EA 1S9EA 1N5QA 2V8VA 1U0SA 1EB0A 2WZ1A 1FRHA 4W4MA 4ZITA 3OVAA 2UV8G 2Y0BB 4DV6J 3RUBL 3MPUB 3DC2A 2G2OA 3RJMB 1Q5YA 4A8WA 2I5JB 8ATCB 1JK9B 1T9XA 4DX8H 5L1JA 4ZPVR 4DV7J 1NHKL 1N8RT 1R8BA 4GVBA 2RILA 1P1TA 3M9MB 3AD9C 2KM8C 1DRZA 2MJUA 4B3TF 3KLGB 5J1NA 3NAIA 1QUPA 3KJFB 1VRQC 2PIIA 2W4DA 2SXLA 4IRKA 2V6AA 5D4LA 4URGA 5F8GA 1KS2A 3KK3B 4ZIWA 1A9NB 3PYFA 2FGOA 5L46A 4ZDNA 3HJVA 2WTFA 2FLPA 1KOHA 1N52B 2ZBIA 1QLNA 4ZPTR 1RT2B 2C2EA 5FLXU 2ILYA 1TTHB 2QLJB 3DCAA 3BKUA 2B6AA 4HL9A 2DXDA 5FD1A 3H5UA 1QAYA 4K4TA 2W2OP 1R31A 2UXBJ 1KHWA 5MAOA 4Y2MA 1Q53A 2IMWP 2H51B 5GVQA 2MKYA 4DR3J 2F63A 1V9OA 3V4MA 2Y8WA 4DPUA 2NZCA 2HQIA 2VL1A 2DGOA 2GC8A 2YNFA 3M6XA 3I9ZA 4B3RJ 2YNIA 3L3CA 2CFXA 4LF2A 3OL8A 1LW0A 5T7LA 1DURA 2KU7A 2BE7D 4ZCKA 2Y1IA 4JI4J 4NXNJ 2CG8A 1D3WA 4RW4B 4PG6A 3GZ7A 1S0NA 2X7IA 4CI0B 2DNOA 5J2NB 2HNZA 4EBEA 4USUA 2G2ZA 4DV1F 2HMIA 4O4GB 1NB7A 4QU7A 3DYAA 2R4FA 3NOCA 1X8DA 1I1GA 4HHHA 1CJKB 3HSGA 2RF2A 3S7RA 1VS3A 1SH2A 2ASYA 2J6SA 3IAM9 3T6JA 4B9MA 3LP2B 4NYZA 3N0VA 4KTQA 1YJVA 1NK7A 4I7FA 4LF5J 1BQMA 2VKRA 4OYWA 1W2BR 1HHSA 3POTB 5BYQA 2UXDJ 2XWXA 2OO4A 1JKHB 4X4QA 1S9GB 3M8WA 3TJ8A 1X31C 2DR9A 1RWMB 4DSIA 1T9VA 4ES3A 1VC6A 2P8IA 1YQHA 1KQSR 1YJNS 1WKLA 2YXLA 2HVIA 3M4XA 3LOUA 3BN7A 2O3DA 3H25A 4U8VA 1O6XA 4OLPA 1ZM3A 3DLJA 2H9ZA 3MWBA 3SFGA 5A76A 3JS9A 4FKXA 4QYZK 1SBRA 4NA3A 4BS2A 3R7NB 3FCVA 2DNZA 4K4XA 2GCFA 2UUTA 4PXCA 2EFPA 4ECSA 4CO2A 3AA9A 3CJ8A 5DG8A 2DY1A 1T94A 3T1HJ 5KFJA 3QZ7A 5B08A 1HR0J 3HCXA 2G4BA 4OYXA 3I87A 3P5TL 9RUBA 3M1VB 1TKTB 4NLOA 1SVDA 2BM1A 3ZNJ1 1VHFA 5ADZA 2DITA 1ZETA 3SCIE 2RNEA 4GC7A 4BBYA 1FFGB 4J9OA 1F3VA 4LF6J 4C8ZA 2D3OR 1JX4A 3R5BA 4V1Ak 3KG4A 4PXBA 2DGWA 3K8WA 4CLZA 2OGUA 3X3UA 1N36J 2E5LJ 2CWXA 4DL7A 3IGVA 2BJ8A 5BYSA 1RB0A 1YVFA 1TVRB 3MPYA 2F8MA 3G96A 3FFIB 1NPRA 2CUYA 3Q24A 1TL5A 2YKPA 4U96A 2FTRA 2HQCA 3DOMA 3ENVA 4ZVFA 4LRCA 4JYAF 5B0AA 2P6TA 4C3KA 1AT1B 2KYXA 4OI2A 5DM7Q 4WFZA 3CJ2A 4ECRA 4A47A 1DQ9A 4IO9Q 2MJNA 3CUNA 3MFHA 3TA0A 2YTCA 3IR7B 1TKDA 5AJ3F 2IJFA 5IFMA 3OXLA 1N48A 3CDAA 3KLIA 2FUG9 4MT1A 2L9WA 2BXJA 3HHLB 4AYBD 4ZJOA 4CT8A 1D0EA 3UPFA 3IM8A 1AB8A 2BZ2A 3RB6A 1H0HB 2VH7A 3PX0A 3MPVA 3BGRB 3BF4A 3DMJA 4OHVA 2R2RA 2K3KA 2XMVA 3W5YA 3MDFA 2CNNB 1KN6A 2G13A 1EIYB 4PQUA 1RTJA 2DVIA 2M9KA 1S1WA 1E6YB 4OHZA 3VAGA 2W8KA 1WI6A 5K20B 2PEBA 1GNKA 3UWTA 3IA0A 1IBKJ 2RDDA 2K1RB 4NCGB 4UZCA 2VBXA 1JLCA 4DPWA 1TAQA 4R5PB 4WFAQ 3PVXA 1TUGB 4GVBB 3LALA 1IKWA 2EK1A 5D0GA 2MSTA 2XB2D 3FGVA 3ETOA 3EYZA 4X64J 4C0HA 3A8EA 3BH6B 2HGMA 5KFNA 3W2WB 3MAQA 4DV0J 1BWEA 3B6BA 3MFIA 4OJGA 3HVTA 1D8ZA 4CO3A 1LQ9A 1VC5A 2IPOB 3I9V9 4ED1A 4ZJQA 4FS2A 1FJGF 4NLSA 3M2UB 3CCVS 2Y8YA 4RWWA 4AD6A 2HBZB 4J9NA 1YJTA 2FZGB 3I32A 2MB0B 2IM2A 1BWVA 2OJ3A 3DRRA 4GKKJ 1NPPA 1HQ2A 4ES2A 1X4AA 2CQDA 2GIQA 3OUYB 3TYTA 4MK8A 2FIUA 3G71S 2K2PA 3QMQA 2XLJA 5LMNF 2JJ4D 2P6SA 2J9CA 2X1BA 2HS0A 4F4AA 4JI7J 1PCAA 1F6TA 3P49B 1WHXA 3CCRS 3WZ0A 3HSZA 2AD9A 4GKJJ 1NK9A 4KBIA 2KDOA 2JHEA 4YR2A 4NMLA 2VA3A 3I56S 4F2SA 3DGVA 4CLFA 4K4ZA 3L7UA 3I0RA 3ZZYA 3DDNA 2YNHB 3OVBA 3P96A 3T9NA 3K2YA 1IKXB 2C22A 1WC4A 4R8UB 4TU9A 5HP1A 4WFYA 2VONA 3W9IA 2ZHBA 3DYAB 1YX2A 2QRRA 4UOCA 4EYIB 3CNQP 4ZHRA 2RF2B 3K5LA 4ECZA 3QT7A 4AUKA 4G3IA 1L3UA 3MEEA 5CQGA 4U7UK 2HK3A 2DK2A 3D3BJ 4KGMA 3E8OA 2OMLA 1NPKA 1CC8A 4DG1B 3R3TA 1LFWA 3JB9k 1RT3B 1P9YA 1YJRA 2WAQD 2MLYA 4FYVB 4ZVRB 2HQ3A 1HBUB 1LFPA 2OTLS 3CE8A 1WF1A 4OI1A 4WK3A 3PRBA 1WOPA 1BQXA 3BH7B 1IN0A 2YWHA 3QNWB 2XY5A 3C16B 1HQUA 2YKOA 2CQBA 4K2JA 2R2UA 2Z2ZA 2YWKA 1MU2A 1ZM2A 2A3JA 2FHMA 2OPRA 4ZKAA 4C4WA 3H4BA 4X4UA 4ETZA 4L3NA 3HLUA 3HF5A 3PYEA 1PYTA 1MNEA 4QR2A 3D5MA 5IT9U 3JAMU 1YZ7A 3OL6A 3AOBA 2EC2A 2LQ9A 4F4ZA 3V5RA 4CM0A 3QRRA 4X4TA 5B0DA 5A8RB 1GTHA 2JDJA 1TKZA 1N33J 4J9RA 1H7XA 2WBRA 1PC5A 1VQ7S 3EE3A 5IV4A 1UPPA 3VGVA 3FRZA 4C8OA 2PN6A 3PEHA 1QAJA 4OYPA 1R43A 5ETPA 4TLQA 3NGTA 3UVJA 4ED6A 2ZNYA 2BQUA 2JL9A 5A0YB 1IR0A 1H72C 1X4FA 2ZWPA 4CNZA 2CJYB 2ZJQQ 4DR6F 3IR6B 1FKPA 4OV6A 3P3DA 1Y3JA 4WE1B 2RAQA 1JLFB 2BX6A 4DR1J 1JQGA 3CD7A 2Y1RI 3IGNA 5F41A 3LPYA 4DWIA 2EC0A 1YKWA 2B9EA 2XM3A 2WRMA 1FRJA 1RAOA 3PX4A 4RL1A 4P52A 1NH7A 2HHHJ 3Q8VA 4P2XA 3FK4A 2MZQA 3JSYA 7FDRA 2YQ1A 3G2XA 1IBMF 3JQKA 2E9TA 2MKIA 3ISZA 1A7GE 2W2MP 1FTCA 3HVRA 4F26A 3Q2SC 3OR2A 1CS4B 5KFOA 2J7WA 3Q0AA 3VQTA 1S1XA 3PW4A 3MMAB 3MM6A 3H40A 2DNQA 1UVJA 1FD2A 5ETNA 4WIIA 3HSJA 4N76A 2E1CA 2MGZA 4NYOA 4ZLNA 1MROA 2DR5A 4ECTA 2V34A 2HGNA 2FYXA 4JV5J 5IS2A 3FCHA 1KRPA 1EHWA 2BDPA 3T19A 3W63A 4ELVA 1RWWB 2XYPB 3GSDA 4OJ1A 2CQ4A 3CCUS 2CQGA 4ZIVA 1NHVA 2CJBA 5KFFA 4ILLA 2YWGA 1RZMA 2V2KA 2V8GA 1HD1A 2CXEA 3DRYA 3ILLA 1MWQA 3MTKA 4YFUA 4HEA9 1S1VB 4RUAA 2EBGA 1SI9A 3DGPB 3N4WA 4P74A 1NHUA 1KLMA 2DKOB 4J91A 3PIOQ 2QFJA 4AFFA 2EFQA 3GJQB 5DLGA 1QTMA 1M5SA 3HULA 4NWBA 5E3RA 2IJRA 1ZZFA 4UF4A 1P8GA 2VDHA 2WONB 3AODA 2YBVA 1ROFA 3NRBA 2HGLA 4EBCA 3D1HA 4IR9A 4PCQA 3IRWP 5K8PA 1SIZA 1U1MA 2XO6A 1DAXA 4TY8A 3DRRB 4F04B 2LA4A 5BJRA 4KSEB 2ZKUA 2ALYB 4ZVHA 1WDDA 1VIOA 2O66A 2GMJA 3AH6A 3UI3A 1W2IA 4URQU 3R9LA 1V5IB 2OH2A 1YHQS 4PG4A 2LDIA 2XS5A 2HRYA 2PFFB 3NXZA 1FVQA 4DUTA 1K73T 4X4NA 3LWMA 2UUBJ 5CYQA 1F1BB 1FDDA 5L9NA 3ZFVA 2LYVA 3DOKB 5H9FK 2QT7A 2WHOA 4ECWA 1AZSB 5D78A 1GXTA 4Y34A 1EQ0A 4MFBB 2B4UA 2F3JA 2G9OA 2ATLA 2FGCA 2XBPA 1F9EB 4DSFA 3GPAA 3HVWA 2PEHA 3W3SA 1T9YA 3MM5A 3RU0A 2WOMB 3I4PA 5D0RA 3BKFA 2JLGA 2BJ1A 1UW9A 1CVJA 3P45B 2I9SA 1D9AA 3AXKA 1RADB 2EKYA 1S59A 3CC7S 4ZPDA 1S7IA 1HNWJ 4R0JA 1YBTA 3M8YA 3CO0P 2M8HA 3Q8QB 1OMSA 4PAAA 3NBPA 2CVEA 1YJUA 2B3TB 2L41A 2ACYA 2MLZA 2YKNB 2O01C 1FNOA 1N6QB 3RAXA 3PZPA 4WKRA 2DEJA 2IVFB 2R7TA 1PIEA 3H42A 4OX9F 1BQNA 3RAQA 1RUSA 2A10A 2QSFA 3J7A1 3M8ZA 1PAEX 2OEKA 2PGCA 1YGYA 3IG1B 3QIPA 4RNNA 4M1KA 3HZGA 1N5YB 3GR1A 2UXCJ 3GP9A 1HQUB 2QMXA 4PYDA 2B51A 2Y1JA 4EEYA 2E1RA 1U25A 3MPDA 4A4JA 2J0QD 4P7TA 1RAIB 3DM2B 4RW7B 3D0GE 3VR1A 5DDRC 2MQPA 3M6WA 4IG0B 2HVEA 3PXGa 3D6MB 1M5HA 3IBCB 1WHWA 1UFKA 3V2UC 3M2VB 3NMAA 4OYOA 2KVIA 3H8YA 4OZNA 2QL7B 4KH0B 3IO1A 3KDNA 3ZTQA 4YB5A 3EGZA 3N79A 2BVZA 2ZJRQ 5FLXY 1RYSA 3ET6B 1SL2A 1LNQA 2V67A 2N4DA 1SJQA 2D9OA 4LMZA 4Y00A 2NZ4A 4ES1A 5KFLA 4Q8FA 2BBEA 3M8QA 1OWXA 4ANDA 2V9WA 2DB1A 3Q2TC 4DR4F 4FXWA 2KTQA 1FRLA 2WSCC 1RISA 2ZD1A 5HVHA 1TAUA 3J7YU 3PW0A 3FQKA 3PRDA 2DH9A 4ZVQB 1U26A 3WX4A 3C66A 4DV5F 3CDBA 4DR2F 3U27A 3BSCA 2VB6A 3DRPB 3V4IA 1Q82T 3P4UB 4OYMA 3HX9A 4ECQA 1Y4ZB 2C2NA 3JYTA 3TUJC 1Q16B 1NSQA 4W90B 3MOJB 3MEGA 5D77A 2UP1A 2GZOA 1V3SA 3T5LA 3HFKA 3K8VA 3ZO7A 4JV0A 3CCTA 3E01B 2HAIA 1M1GA 4N7TA 4N77A 1T7PA 5KFHA 3OPKA 3W64A 3PJWA 4QIEA 4URSA 1ZTWA 1R0CB 3ISND 5L1LA 5K5MA 4NYPA 4F3OA 1FXDA 4M5NA 3MCSA 4FYYB 2A2DA 3LGNA 2OP5A 1P27B 3CCSS 3C14A 3GYNA 3KLEA 1YBUA 1Z2LA 4KB7A 5FIIA 4DV6F 4V19X 3OFEA 4CRJA 3QQCD 1HWUA 1QY7A 3TW0A 2P9EA 4ZP9A 3BEGB 1WJ9A 5KOXA 2K8GA 1RCXB 4DV7F 3I4HX 3V6JA 3OSPA 1N34J 5K9FA 2ERRA 1TL3A 1R0BG 1F9HA 4PEOA 2VFVA 2XTJP 1AW0A 1VQ4S 4QJVA 2CJAA 4A48A 4QOTA 4FVMA 4LFBJ 2IRXA 1S0VA 3DI6B 3ZC4A 4YMEA 4OHYA 4LVNP 2J9DE 5H9EJ 2BRKA 4J7CA 3DHXA 3QATA 4YY3F 4A8SA 2OLWA 4B3MF 1Y10A 3K58A 4KE5A 1IJFB 3ZTPA 5LJ3Y 2XULA 1EAYC 2EWHA 4DR5F 2UUWA 3HHEA 3LWLA 2RU3A 4PPZA 1SJ4P 3T5HA 4I68A 2DEIA 3GONA 5KFZA 4FXDA 4TU8A 5IT0A 2F4VJ 4X84A 3W9JA 4ID5A 2P9CA 4J9SA 2M8DB 2ZKTA 4Q45A 3IWXA 2C3PA 2R7SA 2WCXA 1C1CA 4B3RF 2BKNA 5KOWA 4QIVA 1H38A 1UFLA 2W9BA 3TJ9A 2JC0A 2ZE2B 1AXQA 4Z2XA 4K5RA 1K44A 4OV1A 2XWYA 4HTIA 5KFTA 2E9ZA 3VAHA 4OHXA 1CEZA 3NS7B 3UNGC 1RHUB 5KG6A 1LWFB 2MZSA 2MQOA 4MMOA 3HHLC 2VFRA 4W98A 3IMQJ 1KQFB 2K06A 4NLQA 4M63A 2BKOA 1RT1B 2B0GA 1RAJA 5E3PA 4NXMF 2AU0A 1NAQA 1GAOA 4NI2A 4UUWA 1HBOB 2ZFHA 2ZBPA 3BGUA 4BDPA 1SKUB 2MQNA 3QLHA 4M5JA 2IA6A 1EJ7L 2PE8A 2CJXB 2YKQA 4PWDB 4G1QA 2E1PA 2FVRA 1VISA 1NM2A 4B3TJ 1NBEB 1Z4UA 3R1HA 1D09B 1MMNA 4RX6A 5DDOC 1S48A 4CO1A 2DHSA 3L7PA 2R8GA 4M5DA 2WVDA 2RUGA 4DLGA 1B0PA 2IDEA 1U1PA 3FEXB 4QIGA 3HFZB 3MMBA 3B8HA 4X62F 1S10A 1FTRA 1NCLA 2CPZA 1VGYA 1N0UA 2YQ3A 1Q5VA 1U8SA 1X4DA 5J2QA 3HHDA 1RAAB 2MKHA 4AQYJ 1PJ6A 4DFKA 4WZMA 1HI1A 5KFGA 5C42A 5EWEA 1NU4A 2VPWB 1VBXA 4K4VA 2ZBRA 3T1HF 1XR7A 1ZYQA 3VGUA 1S97A 1U8WA 4RU2A 4KJIA 4MIAA 3PW5A 3IS9A 1N5SA 1JIHA 2LEAA 2ZUGA 2RIJA 4LRBA 2VC0A 2RMLA 1HIYA 2QL9B 4B3OA 2DH7A 2HAFA 4YN3B 2QL5B 4LF6F 4OZ5A 5E5NA 3OTBA 3RW6A 2RVJA 3QJPA 1X9SA 2EFOA 5THWA 1SC1B 3O5TB 3BJYA 1N36F 4NZ0A 2LQ5A 2VBWA 5IQ6A 4I6YA 2B5JA 4CLPA 4FZVA 3RTVA 2XMUA 2M70A 3MMCA 4F4YA 5AT1B 4NLGA 2XSJA 1U09A 3EZUA 4HH0A 3R27A 4I2PB 2K3IA 2Q1LA 4M5LA 4IH6A 4TLRA 1T3OA 3NGRA 3BYRA 2QLXA 4M8LA 4X4OA 5HAOA 5L9XA 2V4QA 2E29A 3KHLA 1WUUA 3ELHA 2LEPA 3MOZA 2E7XA 4JP8A 1KTVA 2DGUA 1SC6A 1S1UA 3I5CA 1Q8KA 3V81A 4UTGA 1JNRB 3C15B 4RW6A 3C6UA 1S6PA 4FYWB 5KTQA 1HNIA 4Q0BB 1RA6A 4HACA 4FPRA 1RA7A 3D6FB 4IOBA 2HG4A 3C14B 2DNMA 3EGWB 3V6HA 1B4SA 2Q66A 4XK8C 4RR5A 1UA0A 2CZVC 2VU5A 1O8BA 1IBKF 1URNA 5I42B 2NYHA 1NK5A 2BKPA 1UL3A 3G8SA 5IT9Y 3JAMY 2XZWA 4RW8A 1FRMA 3O2IA 1LK7A 2F7VA 3AFGA 2RKIA 3GG0A 4DUYJ 1TK5A 2DNKA 2LEBA 2FZCB 4IQMA 3U1NA 4DN9A 4I2QB 1U0HA 3GWCA 2CPEA 3QSYB 2VG6A 3D4JA 1HWJA 3H5SA 1R0AA 3RRHA 3DLEA 2M5YA 1LW2A 2VF3A 2DGTA 1VHIA 4GKKF 3CCMS 1DTQB 1FF2A 1XWLA 3IWNC 3KLHB 1FKOA 2VJUA 1UAWA 3MCOA 1WKJA 1YDLA 4KT0C 2AT1B 5HMXA 2NREA 1F5CA 1UWBA 1YJ9S 4JYAJ 3TAPA 4JI7F 4PXDA 3ZZ0A 2DIVA 3QT5A 2OPQA 2Y1LB 4GKJF 3OTCA 4MYTA 3G6VA 2EVZA 2LQ8A 4USTA 5D15A 5KG7A 4J9QA 3KJQB 5AJ3J 5EGYA 5F9LA 3LP1B 2ACMA 4F3MA 3G82A 3FBBA 4X4VA 3KK1A 2LECA 4Q7AA 2HBRB 3BDPA 2JC1A 2C42A 4ZP8A 4OLOA 4IOAQ 4OZ2A 1XC9A 3P5BP 4P73A 2CQPA 1TR0A 2E1AA 2PC6A 1REVB 1Y9OA 4QR0A 5D0EA 5F8HA 1GK8A 1RTHB 1NSAA 1Y7PA 3LAKA 2JEIA 1EKRA 4Q5VA 4AL6A 3TANA 2QYGA 3THVA 3TA1A 5I3UB 3DHWC 2UVWA 3CCJS 5DETA 4R25A 3NGDA 3R5GA 2GQCA 2GJFA 4UOFA 2GJIA 5KG3A 1RTIB 1WNEA 3CT9A 2UUCF 2XSFA 3JQMA 1XN9A 2CPFA 1NRKA 4JB8B 1KVJA 4KKOB 4AT1B 1ZAVA 3J7Z5 4DZ6A 1ZA1B 2IFXA 1RWKB 2XNRA 3LO3A 4ECVA 2B7CB 3TEGA 3G86A 3QAEA 4DFJA 2BOPA 2V4JB 4J9UE 3HO1A 8RUCA 2OTJS 1H73A 2QLFB 3QO9A 1JLQA 1WC6A 3HXMA 2IBKA 3KMQA 1EETB 1TFWA 5J2PB 3AD7C 4C7QA 3C3LA 2BW2A 4BC7A 5IOLA 3IN5A 5L38A 1FJGJ 1I94F 2FD2A 2IAJB 1YK9A 1VQMS 1CJTB 3SCKE 4RW9B 3FBEA 3VALA 2PI5A 1SH3A 3W8GA 4LRAA 5T41A 4IUFA 4C11A 2MPUA 2RH3A 2NXNA 2MZRA 2CPJA 2A6OA 3ULHA 2KFYA 2B4PA 5LMNJ 4Z7CA 2KT5A 3P6YC 3NNCA 2WVBA 3ZZPA 2NPIA 2M52A 4ZVTB 2W9CA 2JEJA 3NY0A 2RSQA 3LTOA 5KFBA 4FP9A 4WFXA 4DPXA 1Z2ZA 4ALZA 4DL6A 2MTLA 1SV5B 1E6VB 4DR7F 3D6TB 1RCOB 3PY8A 3GJTB 5H9EK 5L8RC 2ROPA 3BYPA 5D0HA 4DR1F 2XSJB 1S0MA 1JLBA 4IO1A 4DQRA 2VG7A 1S6QB 5C25B 2GGPA 4C3LA 2V8PA 2HHHF 2IBOA 2XI3A 4JOUA 3D9BA 3OJSA 4O3RA 4B08A 3TQEA 4DL3A 3T3FA 2DISA 5JXSA 3OFGA 4A8FA 1UEUA 3S6EA 3ILOA 3LP0B 5HLFA
chains in the Genus database with same CATH topology
1TAQA 3MECA 4R5PB 4WFAQ 3PVXA 1O0PA 2RRNA 3LALA 1HL6A 1IKWA 2EK1A 2HFNA 2AJQA 3MUVP 2MSTA 2XB2D 4Y0FA 1FRIA 2RE1A 2B4VA 2FC8A 3ETOA 3FGVA 3V81B 2UVVA 4GMKA 1UJ6A 1F5AA 3T9ZA 3MM8A 2E5GA 1VMBA 3EYZA 4C0HA 3A8EA 4NX9A 2HGMA 3T5KA 5BYRA 5KFNA 4I4BA 2YH1A 3W2WB 1HR0F 1ZM9A 2ZE2A 2FLLA 3MAQA 4ED3A 3UQSA 1BWEA 5EX0A 3AHPA 2I0XA 3N01A 4O4RA 3MFIA 1HYSB 4JV5F 2OPPB 1N32F 3QYYA 4OX8A 5EX3A 2DCUB 4OJGA 2OPSB 1QE1A 1Q8IA 3AQOA 3HVTA 5F8LA 2YX4A 1S1TA 1FDAA 1D8ZA 1YRUA 3M8QB 4I6WA 4USIA 5KFUA 1B64A 3TVYA 4CO3A 2W7AA 2CPXA 2CQ3A 3TRGA 5AE1A 5K8MA 1HPZA 2KHDA 1LQ9A 4QW8A 1VC5A 3DDKA 4KRWA 1DFDA 3I9V9 4ED1A 4MK7A 4ICLA 5CYMB 4FS2A 1FJGF 4IRCA 4PQAA 5BR8F 4LFAF 4NLSA 1LWFA 3M2UB 1BGXT 5KT5A 3CJ3A 2CRLA 2D9PA 3MAHA 3NWGA 3AJ1A 5D6GA 3CCVS 2ZD1B 2KKHA 5B0CA 4RWWA 2JVOA 1K0VA 4TXSA 4J9NA 3H5XA 4K4UA 1KVIA 1YJTA 3GMGA 4LSLB 4A8XA 1JWWA 4DDFA 3I32A 5F8MA 5EN1A 3DLKB 2E5LF 2YKAA 3T1YF 2MB0B 2IM2A 5F0WA 1YI2S 2CJKA 2OJ3A 4YOEA 3DRRA 1RT1A 4F50A 2I2YA 1EP4B 2CPHA 2A18A 3LW5C 1R8AA 2L9NA 4X4RA 4O44A 4DFMA 4HI1A 3BQ1A 2KN4A 3FMBA 5HQ8A 5LJ5Y 4C9DA 4CNYA 3V4IB 1ZOTA 3RRGA 3MUTP 1VLYA 4ES2A 4IRDA 3KWMA 1XMOF 1X4AA 2CQDA 2FJAB 2GIQA 2VG5A 3TYTA 1HBOA 4MK8A 2FIUA 3OUYB 1C1BB 3G71S 2K2PA 2VFTA 3QMQA 2XLJA 2GQQA 4WXOA 4ZA1A 5LMNF 4DSKA 2WK4A 2JJ4D 5B09A 2P6SA 2XY6A 2FHJD 3QGPA 2J9CA 2X1BA 1S6UA 2HS0A 4PWDA 4QU6A 3THTA 4QWBA 4DL0C 2X1AA 3JYTB 2VKZG 1W25A 2A2CA 3W2VB 5CH7B 4CTAB 3ZZZA 1VC0A 1XNQF 1G1XA 1HFEL 1RT7A 3D0IE 1WHXA 5HMYA 3CCRS 3KG0A 3WZ0A 3P49B 4QWAA 3MZIA 3MEGB 2AD9A 4O23A 3MXHP 3K5OA 1NK9A 3TX8A 4KBIA 2KDOA 4ZMMA 1HNVB 1G3OA 2JHEA 4YR2A 4PPDA 4C2MA 4NMLA 5FDLB 5C24A 2VA3A 2VG6B 3FEZA 3I56S 3BSOA 3PFEA 2R8IA 1FVSA 2NXUA 1QSYA 2HYIB 4TY9A 4F2SA 3HKZD 4K4ZA 4ZPCA 2BANB 1OIAA 4QWDA 3S8SA 2Z4PA 1CG2A 1ULRA 5IZHA 2RU9A 1Q7YT 3OR1A 4N56A 4DL5A 3BQ2A 3I0RA 1XK8A 2M4MA 4ZP6A 2X51A 3ZZYA 2Q3PA 3JSMA 2NSCA 3DDNA 2V8DA 3QPIA 2YNHB 1DTTB 3VQSA 1UFWA 5CZVA 2DO4A 3OVBA 3P96A 3G6XA 2HHXA 2IM0A 4D3GA 5KFAA 2GMHA 3K2YA 3T9NA 1IKXB 2C22A 4JI0F 2WSFC 3DU5A 2YVSA 3E3XA 4IFVA 3HHNB 2R7OA 4R8UB 4TU9A 2E5IA 5HP1A 4WFYA 2PSZA 2VONA 2K7JA 3DU6A 4O3PA 2ZHBA 3DYAB 2YWFA 2Q6BA 2RQMA 4NLUA 2QRRA 4C8MA 4UOCA 1UWBB 3CCWA 4EYIB 4QIFA 4ZHRA 2CJQA 2RF2B 3KLEB 1VQPS 1KR4A 3K5LA 4ECZA 1OPZA 2HHQA 4AUKA 4G3IA 5DJBA 1L3UA 2VPXB 3MEEA 4E8UA 2FHKA 1JXLA 3ENQA 5CQGA 4U7UK 2KM8B 3LANA 4RNMA 4H4MA 1HARA 2UUBF 1HD0A 4Q43A 2DK2A 4KGMA 1NK8A 4DSLA 1FESA 1KTQA 3E8OA 2VQFF 4CT9A 1SL1A 4B9UA 1YRXA 2IVMA 2OMLA 3ITHA 3N6MA 1R8CA 1CC8A 2GMLA 4M94A 1G6BA 2MSSA 4MK9A 3CCES 4CH1A 1Q8LA 1D9DA 4DG1B 4EO8A 1H2UX 2FLOA 3R3TA 2HZCA 1LFWA 2HNYB 3JB9k 3AJ2A 1XNRF 3OV7A 3M2RB 2VPYB 1RT3B 2X1GA 5CCLA 2ZDOA 1YJRA 2WAQD 2DRBA 4OI4A 4XPCA 1TL3B 2ABYA 4C3MA 2MXYA 5IXUA 4Y3CA 3CULA 2DR7A 1UETA 2HQ3A 2B43A 1HBUB 2F9DA 4X64F 3CEDA 1LFPA 3PEJA 2MHNA 2OTLS 3CE8A 4KC5A 3K7RA 3JTPA 2APOA 1WF1A 4BWJA 4DHVA 3MEDA 4R0EA 1QJHA 2PA8D 1KHVA 4OI1A 5HROA 5D3GB 4WK3A 3IWLA 4DV0F 2YNGA 3PRBA 1K8AT 4YDXA 2KI2A 1BQXA 1O51A 1IN0A 2M88A 5GAGI 2YWHA 4OI3A 3IRXA 4HVZA 2XY5A 2CG4A 1HBNA 2KZMA 1HQUA 2YKOA 4ECUA 5ITHA 1GT8A 2CQBA 3H2LA 3NCPA 3AB4B 2DNHA 3TVZA 4OX7A 1KC8T 3DRSB 2R2UA 3T5JA 2RS2A 3DFEA 2YWKA 3SDEB 1MU2A 1ZM2A 3NAHA 2A3JA 3MUMP 2FHMA 1U1QA 1HNWF 2OPRA 4F67A 4ZKAA 1P1LA 1APSA 4C4WA 3PACA 3H4BA 4K5SA 2E7WA 4X4UA 1K1QA 1KQGB 4YUDA 2CYYA 3BSNA 2XCAA 3BQ0A 3M8SA 4I2PA 4ETZA 2J6UA 4L3NA 4ECYA 3HLUA 3HF5A 4NZ7A 1MNEA 2DIUA 4QR2A 3UFCX 4DFPA 3ONQA 3PFOA 3D5MA 5KFMA 3OL6A 1U6ZA 4ZVEA 2D3UA 4C8KA 2LQ9A 3SQGA 1HMVA 3V5RA 4F4ZA 4DS4A 2GFFA 3BZQA 4L6V3 2HFZA 4H4OB 4KIAA 1AROP 2GA7A 4X4TA 2W7OA 5B0DA 1RDRA 3W7BA 5A8RB 3OJUA 2ZH3A 1GTHA 5DDQC 2MZ1A 3KNAA 2JDJA 1TKZA 2I5JA 4J9RA 2BQRA 1T8EA 1H7XA 1M0SA 2IM3A 2YKMA 4BWMA 2WBRA 1KONA 3O8WA 3CJ5A 1PC5A 4I56A 1B0VA 3MTJA 2VC1A 4LSNB 1VQ7S 1O5JA 4F3QA 2UXCF 1C0UB 2YX7A 3U1MA 3PV8A 1X4HA 2BR0A 1NJYA 2MKKA 1TL1A 5J1EA 1ZBTA 3FRZA 3THPA 4C8OA 3MM9A 2PN6A 1T03A 3M32B 5EWGA 4ID5B 4IH5A 3M9NB 1R6YA 2A1BA 3PEHA 4DSJA 1QAJA 2V5HG 1R43A 2ZH9A 1VQOS 2YX1A 2GW8A 5KFEA 4TLQA 4H54A 4DS5A 3ZZTA 1XERA 1D9FA 1X0PA 4PUOB 4N47A 1C1CB 4Q0BA 4ED6A 2E44A 2ZNYA 5B0FA 4ZCLA 5AE3A 5A8WA 2BQUA 2KXNB 2JL9A 2W9BB 5A0YB 1RTDA 2DTJA 2R7WA 3OFFA 1IR0A 1N56A 2NYIA 1X4FA 4CNZA 2EG1A 3GIKA 3PX6A 4NRTA 5MLCV 3M30B 4IH7A 2ZJQQ 4DR6F 1UVIA 3PHEA 3KK3A 2LXIA 3H4DA 3IR6B 1FKPA 5GADI 2BQ3A 2C3MA 5KG4A 1OO0B 3P3DA 1GXUA 2NS1B 4ERDA 1Y3JA 4WE1B 4ZOSA 2DR8A 2OIHA 4AXJA 1JLFB 5I42A 3BO3A 3CGIA 2UVUA 1XEZA 1T3NA 3CD7A 2Y1RI 3IGNA 2ZOFA 3LPYA 5F41A 4CCHA 4DWIA 2EC0A 2XS7A 1H6KX 1XR6A 1LWCA 4EO6A 2WRMA 3BGFA 4HI2A 2M3DA 5GAGU 1FRJA 4FXVA 2QA4G 5JVHQ 3PX4A 1Z1ZA 3B4MA 1RT2A 4QZVB 3EX7B 3SCLE 1IKVB 1NH7A