2ZJRQ

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
b'SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zjrQ00
3THPA 5GAGU 2DIUA 1WG5A 2DGVA 5GADU 1R8HA 2KXNB 3R1HA 2AD9A 1FHTA 1X4FA 4C0OC 1O0PA 1YIJS 1VC5A 4BS2A 5LJ3Y 2EVZA 3ZZZA 2CPDA 2E5GA 3VAIA 3RW6A 1F9FA 1H2TZ 3CPWR 5DDQC 3MURP 3CCRS 5D78A 2MGZB 4CQ1A 1WEYA 2YTCA 3UCUP 2RNEA 1W2BR 1KD1T 4PRFA 2J0SD 1U2FA 1VQ9S 3FEYB 2CQHA 1D9AA 1JJHA 3CCUS 2MXYA 3UCZP 2DISA 1NU4A 2MQNA 3MD1A 2AYGA 1DRZA 3LQVA 3CC7S 1UW4A 2FHOB 2DO4A 3UD3P 2MHNA 3SDEA 5DDRC 4OZ1A 2E5IA 2X1AA 2CPFA 1WF0A 2DNKA 4CIOA 1P27B 1N88A 2XB2D 2MKSA 1X5PA 3N9UC 1VBZA 5DETA 4RU2A 2LCWA 2YWKA 1N8RT 2DNOA 1U6BA 4UQTA 1YWXA 3TO8A 2N3LA 1SJ4P 2ADBA 4J5OA 1X4DA 2D9OA 3Q2SC 3MUTP 2M52A 3VAGA 2E5HA 2CQGA 2RVJA 1FJ7A 3UE2A 2CQ0A 3CC2S 2FY1A 3CULA 2CPXA 2X1GA 4TU9A 1IQTA 2JVRA 4FXVA 1DBDA 2A3JA 5IM0A 1VQNS 1OIAA 1YJWS 2KM8C 4A8XA 4F25A 2N3OA 3HHNB 1YITS 1N54B 2MMYA 4ZKAA 1QM9A 3G8TA 3B4DA 2RRAA 1H2UX 2MKIA 3MI7X 1K73T 3NS6A 3HI9A 3G8SA 1M5OC 2XS2A 5CA5A 1VQ4S 4IOAQ 3OW2R 3PIPQ 1WELA 2MYFA 2AYEA 2E5JA 3CD6S 1FO1A 1SXLA 2KU7A 2M8HA 3S8SA 2J8AA 4WIIA 1FXLA 2CQDA 3G96A 2QFJA 2KYXA 2MZJA 3ULHA 1QVGR 2RUGA 2N7CA 1U6FA 2PEHA 3NNAA 2MY8A 1A9NB 5DM7Q 1G2EA 2DGUA 2CQBA 3H2VE 4V19X 1NO8A 3BEGB 3ZZYA 2XNRA 2J0QD 3P5TL 2DNMA 3S7RA 5DDOC 4QQBA 3CF5Q 2J76E 5LXYA 2LECA 2DNHA 1KQSR 2XSFA 1X4CA 5LJ5Y 5CXTA 2MPUA 4C4WA 5FJ4A 2OTJS 2MQPA 1WHWA 1P1TA 2DNGA 5IQQA 2N82B 1URNA 2OSQA 2RQ4A 1FJEB 2AYMA 1CVJA 1SJRA 1U1PA 1WG4A 1KOOA 2U2FA 1M5KC 2MKCA 2BZ2A 2JVOA 3UCGA 5BJRA 1U1KA 2YH1A 1WI8A 1X4BA 1SJQA 4ED5A 1AUDA 1WTBA 2D9PA 2KXFA 2M7SA 4QU7A 2XS7A 2LXUA 1VQ7S 4F26A 3K0JA 3I56S 2MQMA 2DH7A 1QVFR 4PR6A 2CQIA 1WHXA 2MQQA 3P3DA 3G71S 3CCJS 4WF9Q 4YUDA 1WHVA 1WEZA 3NS5A 5DDPC 1KC8T 1U1OA 3NNCA 3BS9A 2FC9A 2MGZA 1VQ8S 1RKJA 3I55S 2SXLA 2DO0A 2DGOA 3JB9k 1HA1A 5HO4A 1VBXA 1JJ2R 2VONA 1UFWA 2EK1A 3P6YC 3U1MA 3D2WA 1X4GA 3R1LA 2DGWA 1VQMS 2OTLS 2DGXA 2CJKA 2CPZA 4Y0FA 2CPYA 1L3KA 2V94A 3PIOQ 3VAJA 1D8ZA 2CQ4A 1UP1A 3CTRA 2DNQA 2KHCA 1VC6A 4IO9Q 2M9KA 3EX7B 2KT5A 3J7YU 3CCSS 1FNXH 3TP2A 2XS5A 3CCLS 3V4MA 2MSTA 2CPJA 2HGLA 4QU6A 2F9JA 2G1DA 1SJFA 3EGNA 2K8GA 3Q2TC 3VAMA 2CQ2A 2ZJRQ 1M5PC 2RRBA 2OSRA 3IRWP 2DIVA 4P6QA 3VAKA 5DM6Q 2CQCA 2U1AA 5JVHQ 4EGLA 2PE8A 3UWTA 2KM8B 1WF2A 1WWHA 5IFMA 2GO9A 1PGZA 3THTA 2LA4A 2MSSA 1M1KT 1VQ6S 5CYJA 1U1RA 2DB1A 2ZJPQ 1OWXA 1S72S 4LMZA 2JWNA 2DNRA 2MY7A 2HGNA 2X1FA 2KVIA 2DGQA 1WF1A 2CPIA 2DHAA 3SXLA 1VC0A 2I2YA 1WI6A 5JVGQ 4W92B 2RS2A 2LXIA 1YJNS 1Q7YT 1JJ4A 1ZZFA 2FC8A 2MB0B 4LIRA 2E44A 2L41A 1DHMA 2OIHA 3CMAS 5GVQA 2L9WA 5GAHU 1H2VZ 2DITA 2MJNA 1R8PA 3VAHA 2KRRA 2DH8A 2M0GB 2HGMA 2HZCA 1DZ5A 2DH9A 1HD1A 2UP1A 3NMRA 4WFAQ 2KFYA 4IOCQ 1Q86T 3VF0B 2VODA 2LYVA 1VQKS 1FT8A 4UY8T 3SMZA 1K9MT 5LXRA 1ZZNA 1OPIA 2B0GA 2DGSA 4C7QA 1H6KX 2MQOA 1X4EA 3S01A 3FEXB 2LKZA 5GMKa 2KG1A 2Q79A 4U67Q 5D77A 3UD4P 1OO0B 4F02A 1U1QA 3MOJB 3B4MA 2JX2A 2VOPA 3EGZA 2RT3A 2MZ1A 2RQCA 1HD0A 2ADCA 1K8AT 2EK6A 3VAFA 2XNQA 3P49B 1XN9A 4Y00A 1VBYA 3G4SS 2M4MA 4CH1A 1X5TA 2M8DB 4YOEA 1HL6A 3SDEB 2ERRA 4M5DB 2X1BA 3CMES 3CCVS 2KN4A 3CXCR 2MKHA 4ERDA 2M70A 2CQ1A 2DHGA 2G0CA 3BO2A 2D3OR 1M90T 2ZJQQ 1A7GE 2YKAA 2DNPA 5LSOA 5H1SV 1X5SA 1PO6A 2DNLA 3MDFA 3S6EA 3NNHA 4WFNQ 4OZ0A 3U1LA 1U1NA 2MKJA 5LSLA 1BY9A 2FPHX 1NJIT 1JMTA 2CPHA 4QPTA 3J7ZT 5EN1A 2L08A 2K3KA 5GAEU 2DNZA 2DHSA 3BO3A 2RS8A 1U1LA 1Q82T 3VALA 4Z2XA 3IWNC 2QA4S 2I38A 2DNYA 4TLQA 1WEXA 3CCES 2KG0A 3R27A 4WFBQ 1FJCA 2DGTA 5IM0B 1N52B 1WHYA 1YHQS 1YTYA 2DK2A 3MUMP 2F9DA 2NLWA 1WG1A 3G9CA 2JRSA 2LA6A 1YJ9S 2MZTA 2NZ4A 4TU8A 5ITHA 2LEBA 4IUFA 3TYTA 2MJUA 2LQ5A 2KRBA 4CH0S 1S79A 2CPEA 2QEXS 3CCMS 1RK8A 2OJ3A 2MZSA 3US5A 1KOHA 4TU7A 1VQPS 2HYIB 4LJMA 1M5VC 2M2BA 3MUVP 1X4AA 3CUNA 2M88A 2MKKA 4WCEQ 3G6ES 2F3JA 2MZRA 1U1MA 1X0FA 2CQ3A 4WKRA 2VOOA 3LPYA 1YI2S 1X4HA 2KXHA 1ZH5A 4FXWA 5HL7Q 2MZQA 3BO4A 3DLLQ 2MQLA 2DNNA 1UAWA 1VQLS 1B7FA 4W90B 2WBRA 4YB1P 3MXHP 2LEAA 1VQ5S 1X5OA 2RU3A 3CCQS 1Q81T 3DXBA 2YH0A 3L3CA 3MD3A 2DHXA 2LMIA 2CQPA 2HVZA 2KH9A 5MLCV 2G4BA 4PKDB 3RW7A 3CC4S 2AYBA 2O3DA 2KI2A 1VQOS 1SJ3P 2BOPA 3H2UB 2GHPA
chains in the Genus database with same CATH superfamily
4P52A 1R8HA 1ZM9A 4PAAA 1CG2A 5LSRA 1X8DA 2F4VJ 1FKOB 2CPDA 1RT7A 3BBFA 1XEZA 2UXDF 3M2VB 4DR7F 1HWKA 4CP5A 4EK2A 2NR0A 3M9NB 5E3PA 1D9AA 4PWDB 1JJHA 2MXYA 2DISA 2PSZA 1JLCB 3JSMB 3ICLA 4J91A 4PG4A 3R5AA 4DZ6A 1NAQA 5K20B 1XBWA 4F2RA 4IG0B 2HVIA 4RU2A 5AJ3J 3RRKA 3JAMY 1PJ7A 2NYHA 4I2PA 3QGIA 4KE5A 4CO2A 3CCZA 2HNZA 1UPPA 4NXMF 5CYMA 4JI3F 2MMYA 4A4JA 2RIJA 1RISA 4KKOB 3MI7X 1K73T 2EPIA 2B3TB 3HK2A 4OZJA 2JH3A 2LFVA 3LF0A 1KFDA 3OLBA 3W3SA 2ZC4A 2VASA 4I6AA 2BQUA 2OO4A 5IC4B 1TKXA 2P5VA 3MM7B 2AX0A 2WK4A 2UU9J 4LT6A 4YHHF 1FFWB 5KFSA 2MPUA 1K1QA 2XZTB 4DV3F 1WHWA 4NI2A 5KT3A 3NRBA 2H5JB 1FEHA 5DZ6A 1LW0B 4K8RA 3HXMA 4ED5A 5RUBA 1UEUA 1S57A 2C2DA 1D8YA 3NWRA 2IY5B 2AZ1A 1JXVA 2H51B 4B17A 2ASLA 3K5OA 1YJUA 1FDAA 1UZDA 2MGZA 2AGQA 2OH2A 1QY7A 4B3MJ 5HO4A 3MZIA 5KFPA 4DUZF 2HFSA 2ZH2A 2I0XA 3GSIA 4ECUA 2A6MA 4X66J 5D0EA 1N5YB 3NGTA 1L3TA 1WORA 1R0AB 1YZ7A 2R2UA 1N5TA 2CPJA 2HGLA 2YNHA 1HNWJ 3W9HA 3VAMA 3FFIA 1V5VA 4L3KA 1EQ0A 2C2NA 4ZPCA 2VFVA 2DEIA 3Q8SB 2B4PA 5F8GA 3B8HA 4L76A 2L9NA 2YX1A 5KG3A 2DB1A 4B9TA 3C6UB 4P2MA 4C2MA 1CULB 5J2PB 4CTAA 2PA8D 1FK9B 2VDIA 5IS2A 2L41A 4AYBD 4JB8B 1EX8A 2OIHA 4CT9A 3TR5A 2HQIA 4NLWA 3C6UA 3GG1A 2M0GB 3NBPA 1KEKA 1N5QA 3VF0B 2G0JA 3TAMA 1VQKS 1IBKJ 1QAXA 2W7PA 4X65J 1ZZNA 3IP0A 5A8RB 3Q8QB 1FRMA 4ER8A 3VVTA 1WC4A 4U67Q 2GNKA 1LKZA 1HD0A 4MT1A 4ECWA 1RA6A 1ZPWX 3CD7A 3BSAA 2HFUA 3KJQB 4RW9B 3I5BA 4S0MA 1CQNA 4DR5J 3M2UA 2HLTA 3BYRA 4M5DB 1KRPA 3CXCR 3OJSA 1TK5A 2OMOA 3BO2A 2O01C 4HT5A 2YWGA 2KO1A 4DSIA 2UXBJ 3H0PA 2HHXA 3J7YI 1TU0B 1RT4B 3QT8A 1TL4A 4M5DA 5LMUF 3HDSA 1XMOF 1T9TA 4NXNF 4OL8A 3NGSA 4JV1A 1WUUA 3H5XA 1QUVA 1HMVB 4UF4A 5DZ7A 2UUAJ 3NMAA 3QIPA 5C2GA 1VRTA 5EWFA 2XQCA 3AOCA 4GMKA 3JSBA 1RWMB 4ZPTR 4TU8A 4UOFA 4FYVB 2Y1IA 1GK8A 4URGA 3CCMS 3V6DB 4FXDA 4ZP9A 1RGVA 2HZAA 3EDQB 1M5VC 1S9EA 1TAUA 5HMWA 2CQ3A 2EFNA 3E01A 1B4SA 1T05B 5K9FA 3DMJB 5EDWA 3L9ZA 4QOTA 2W4PA 3N0VA 2HK3A 4YB1P 3MEKA 5HQ8A 3WIVA 5AE2A 4JI0J 3UDCA 4O23A 2O3DA 4RUAA 1JKHA 2R7OA 4MIAA 4HR2A 4KJIA 2AD9A 2OFHX 2I9SA 4DV2F 4EMDA 4BS2A 2N7YA 2Q6CA 2EVZA 1U6ZA 3RB6A 3MURP 1JLFA 1RKIA 3LGHA 1FVQA 1ZPVA 5F8LA 3A1YG 1RT1A 3QGGA 3OL7A 2WVEA 1UW4A 2FHOB 2IA6A 5F8IA 1TVRA 4DSJA 1JNRB 4CLZA 4CIOA 3QJLA 2VBZA 4G1IA 1UEVA 4LSLB 3PACA 3MCOA 3LAKA 1S0NA 4UQTA 4YN3B 3UR3C 3MM8A 3KUEA 1RWUA 4ID5A 1NJWA 2IM3A 4KV8A 2X1GA 2AKWB 1HNXF 1QD1A 4A8XA 4F25A 5HBMA 4CLKA 1QM9A 2Y8WA 1BQXA 5KFBA 2FJBB 2HK2A 1P9YA 4IOAQ 2VPYB 2KU7A 3MMAB 1EZZB 3J81U 2WHOA 3CGIA 3DOMA 3PYGA 3X3UA 3NNAA 3TOQA 2PMHA 3DC2A 1NK7A 4B3SJ 2DNMA 3SCJE 2E1MC 3D3CJ 3A8IA 3WQPA 3J7Z5 3DOLB 4DFMA 2VPXB 3UDLA 2J6SA 4NEYA 4F4ZA 1RHQB 4GRSA 1N4LA 5DQHA 2ZFHA 5D0GA 1D0EA 2ZUAA 1WTBA 4X4UA 2V5HG 2I8EA 2DH7A 4PR6A 3W2VA 4WF9Q 1HBUA 2ZNZA 4RNOA 2QL9B 3FVYA 3Q22A 3NS5A 1GXTA 1KLNA 4OMFG 1JJ2R 4KHPJ 2DGWA 1QDUB 3DRRB 4PQUA 3LP1A 2DXFA 2Z8QA 4F3MA 2V68A 4Y2MA 3HVTB 3U1NA 4DV0J 3W64A 1TZ0A 3R6LB 1DQ9A 4K59A 3HF5A 1C0UB 4RUBA 3OHBA 4JI1F 2F8HA 4GKJF 4I6YA 3TEHB 3TNVA 1M1KT 2JHEA 2CJAA 4LF6F 1NPPA 2PD1A 3H20A 2HVEA 4ECSA 1YJVA 3KKFA 1H0HB 1WF1A 1GMUA 2WONB 1S0MA 1IWGA 2EKYA 1ZAVA 4CLFA 4LIWA 4IOCQ 2WVFA 1JLAA 1HQ2A 3TUJC 5J1EA 1IKWB 1S99A 1H6KX 3AHPA 3F73A 3BDPA 1X4EA 4DV4J 5GMKa 2KVQE 1S1WA 3HSDA 3MOJB 4OYIA 4JOUA 2J9DE 2RQCA 4WPAA 4IRDA 5KFCA 4ALZA 4FS1A 1AFIA 3MCSA 2HHSA 2LQ9A 2HRTA 5HJYA 5LMNF 2B51A 1UFLA 2YKAA 3BKUA 2DNPA 4B9MA 2IJRA 4Z7CA 3MDFA 2KL8A 2ZUGA 3EE3A 1LWEB 5ETKA 4U6PA 4I56A 4AQYF 1BY9A 3W2WB 1NJIT 3QRRA 4QPTA 2RS8A 3D3BJ 4TLQA 1FJCA 2DGTA 2HIQA 1F1BB 1NZAA 4FPIA 3G9CA 5KFLA 2RF2B 2XLJA 3FSIA 3TYTA 2KRBA 1G6BA 4AFFA 1JLBB 3IBWA 1D09B 2BJ8A 1VQPS 2IMWP 2JOQA 3H42A 5LOQA 1WSVA 2MKKA 1X0FA 3K58A 1X4HA 2KXHA 1C1CA 4WFZA 2VQEF 1I5OB 8ATCB 3W66A 1VQLS 4LRFA 3R3TA 4GO5X 3EUNA 3CCQS 5JXSA 1N33J 3GIMA 3RAQA 3CC4S 2WW8A 1RTIB 2LEPA 4O3NA 4DX8H 1ZETA 1HLWA 2DIUA 1MG7A 4H4OB 3R1HA 4ED6A 1FHTA 1R43A 3GILA 4USMA 3FBEA 2PMZD 4DSLA 4N77A 1F9FA 1H2TZ 4NLRA 2XYGB 2RNEA 5DO2A 4I69A 2G2OA 2ABYA 3PR5B 3MTJA 2HS3A 3IA0A 2ZD1A 1K1SA 3TJAA 3H5YA 4C8MA 2AP6A 5DS7A 1CJVA 3FUYA 1OY6A 2CG8A 3BBBA 3Q8RB 5A8KA 2W4CA 4LFBJ 3HULA 2NS1B 3MUTP 4X4VA 1FJ7A 3KHRA 4GC6A 3BBCA 3R6GB 3SFGA 4IYQA 3OTOJ 3JTPA 2B7CB 3PFEA 4Q5VA 3FJ2A 3OR2A 1NK8A 1ZTTA 2BQRA 4GC7A 4WIIA 5D3GA 1FXLA 2KYXA 4FP9A 5L9NA 2FVSA 1S59A 2WCXA 3MR5A 2YWEA 2J6UA 4O4GB 3KG4A 2NUUG 2IM0A 4RL1A 1URRA 4OJGA 3BKFA 1H98A 2BYCA 3Q23A 3DYAB 1NKCA 2AW0A 3MFIA 5FJ4A 1M1GA 4O4GA 2MQPA 2X3DA 5IOLA 3IGNA 2OSQA 2XMVA 1PYSB 3VZIA 3FC9A 1C1BA 4MMOA 7AT1B 3ZTSA 5HATA 2KJVA 3TZZA 4F3QA 2Z30B 2J0XA 1YJRA 4UTGA 2YKPA 4I0WA 4PG5A 3M6UA 4ICLB 4YQWA 1WHVA 1U02A 1S1XB 4OV6A 2Q66A 3KK1A 3CJKB 4CLLA 3ZC4A 4HEA9 2V4RA 1FVSA 2P9CA 4B08A 2B8QA 4IFYA 3UR0A 4J90A 3T5LA 1SKUB 2R7RA 1D8ZA 1U26A 2DNQA 3M8WA 3T1HJ 5JJBA 3EX7B 4J9PA 3J81Y 2DXEA 3J7YU 4MTPA 4DR3J 2M5YA 4OX9J 1BQNB 2BJEA 1SJFA 4FKYA 1GMVA 2ZJRQ 3D1HA 2LP4A 2IBKA 4RW6A 4P6QA 2ZH8A 2C1EB 3H2LA 3BF4A 5DM6Q 4ZHRB 4A47A 4FF4A 3TA2A 1HQUA 3KLIA 1EAYC 4WE1A 2WB4A 4O0IA 1SQFA 1SC3B 3MAHA 2ZDOA 1V3SA 2ZJPQ 2BV3A 1H72C 3PRVA 3D6TB 3DI6B 1LV5A 4U9RA 1H7WA 1XNQJ 1NPRA 3C66A 1WI6A 2R7TA 2J9DA 5GVQA 2HQDA 2DITA 3T6JA 3D6HB 4A8YA 3IRXB 3MMBB 4C9DA 1FT8A 5I3QA 3EMTA 3GSDA 3I87A 1BHNA 2V9KA 2VH7A 4RKUC 5B0DA 4F02A 1KTQA 2ZZMA 4YEAA 1FNMA 1DQAA 5KAKA 3UD5A 1VBYA 3KJVB 1SC4B 1MWZA 3BPDA 3K5LA 3CCVS 2CQ1A 3W62A 2HLUA 1EETB 3A8KA 4KO0B 2W2MP 5AE1A 2PT0A 1HWUA 1TMMA 4H4MB 2FY8A 2ZBPA 4DHVA 1AFJA 5IM0B 3DN9A 4OJHA 5T7LA 1FD2A 4KO0A 2RDDA 2YNFB 3F56A 4RUCA 4ECXA 2CJXB 1RAFB 3C16A 4DR1J 3B82A 2AHOB 3ZZPA 3QJJA 2PI5A 1R0BG 1RK8A 4AXIA 2OJ3A 5KFRA 3M30A 1T3NA 3MUVP 1L3UA 5J2QA 2HWTA 5BYQA 5CABA 4M8LA 4N8OA 1U0SA 1UAWA 2Q43A 3GIRA 3DLHA 3UDEA 4PUOA 4CO3A 3D9BA 4J7CA 3DLBA 4WU3A 5KT7A 4ZOSA 3ZNJ1 2YBVA 3QQCD 1WKLA 4D3GA 5D4PA 3IG1B 2HZVA 1TAQA 1JXLA 2GW8A 4ES2A 1HI1A 1SL2A 3G6YA 2VB6A 1VR6A 3VQTA 3A4TA 1O0PA 1CPZA 4MKYA 3IG1A 2B8PA 2BVZA 3W65A 2XGPA 1PKUA 1PSDA 2A6OA 1W2IA 2UVVA 3KK2B 3MD1A 1NDLA 2E29A 1UA1A 4LF9F 3OTDA 3I6PA 3CCWA 4DPYA 3G6VA 1P27B 1LFWA 1J27A 2HAIA 1N32F 4ZP7A 3A8EA 1S0OA 3AJ2A 2BRKA 3LP2B 3QT6A 4UW2A 2OPPA 3I4PA 2XHCA 1QTMA 4K0KF 3JYTB 4YR2A 3PCOB 1FRKA 1RWWB 2GGPA 2P2CB 3LP2A 1UKUA 3EVWA 3PIPQ 4OI3A 4ZVTB 1SIWB 4ELTA 1YDLA 4WYLA 3CCTA 4V1Ak 4A8FA 1WTFA 4USVA 5HN0A 4X64F 4PQAA 3M2RB 1ROFA 1SL0A 2ZITA 1A9NB 3MEEA 1GMWA 4O3SA 3J7A1 4O3QA 3P5TL 4CNYA 2H4YB 3T19A 2DY9A 1NDCA 3M2RA 4WFXA 2IRXA 5IQ6A 2N82B 1Z1ZA 2G1HA 1SJRA 2Q6BA 3HVAA 2BBEA 5KFEA 2DCLA 5D0RA 4DSEA 2Z2YB 4KPCA 1NK5A 3UI3A 3UN5A 5KG4A 3GR0A 4OHZA 4CRJA 4ECYA 1QVFR 2HFVA 3CJRA 1LEOA 1IBCB 5ETVA 3NKYA 2F63A 2C2MB 3CNQP 3ZFVA 4JI6J 4WK1A 2BJ3A 3EPGA 3H40A 1HA1A 3TX8A 1TQLA 1X4GA 4DL0C 4XO0A 4P2FA 1RUSA 1VQMS 5E0OA 4GVBB 3N4WA 4M5JA 4DL4A 1LWCB 2EFVA 1UP1A 1YRTA 4JI2J 3A8JA 2VQFJ 1S1VB 5KFGA 3GFYA 1DTQA 1JIHA 4K50A 3V4IA 1FCAA 3IRWP 4ENOA 2E1AA 3Q0AA 1RAGB 3NGUA 2IJNA 5CYJA 3M8QB 4G65A 2RQMA 1SH0A 1RWVB 3N5FA 3NGRA 4XPEA 3BGRA 5FDLA 3GV5B 2E7XA 3CO9A 3CMAS 4ZLLA 2BANB 1IQZA 4C11A 3HPOA 2DH9A 2LQ8A 2P8IA 2HHQA 4C98A 4DLGA 5LXRA 2HQ3A 2W2OP 1J5OA 3H8YA 2X3GA 1C0TA 1UJ6A 4ANEA 2BE9B 4EO8A 4CI0B 3Q8YA 3NCRA 2D3OR 3FZ2A 1OJ4A 2AGOA 1JX4A 2DRAA 5E3CA 3AD7C 2V6AA 2KDOA 2CNLB 3ETOA 1W25A 2V34A 3IWNC 3PRDA 2DNYA 1K44A 4I6WA 1X60A 3MWBA 1SC6A 4JP8A 4RJVA 4B3RF 4OYWA 4R8UB 4NLYA 2FLOA 1NRKA 5HJXA 4CO4A 3PEHA 3D28A 4IQMA 4RBTA 2M88A 1NJXA 4OZNA 1X0PA 1UVMA 3JSYA 3FRYA 4O44B 4R8UA 1OS5A 1PAEX 2JFKA 3T1AA 4DUYF 2VFTA 4KFBA 4WIQA 5C25A 2QA4G 3Q89A 2R7VA 4O44A 3EXCX 3R2DJ 2CQPA 2J6TA 2XO7A 2XYHB 2VG7B 4L75A 2EKNA 3ITHB 3ZTPA 2KI2A 3OLAA 3VR1A 4AQYJ 3R9LA 1S6UA 2GVDB 1SC1B 5IXUA 4KC5A 2XI2A 4K4TA 3AQOA 5D78A 4I1TA 2GVDA 1N6QA 1R0CB 1TUWA 4WZMA 2E5LJ 1OSDA 2NPFA 2CPFA 4C97A 3KLHB 4ZLNA 3J80U 4QBUA 2VQEJ 5DETA 2YWKA 3ZTRA 3ISZA 4DX6A 2PC6A 3O6QA 2D9OA 1ZOTA 4HI2A 4LF5J 2XMUA 2IAJB 5CYQB 2Z2LA 5I42B 2JC0A 3PXGa 4PPDA 4QYRA 1OIAA 2FUG9 3M4XA 2CJQA 4F04B 4QW8A 1I3OB 2XY5A 3RAXA 2NXUA 1Y0HA 4MKAA 1L3VA 4OYBA 2FZKB 3OL6A 1Y11A 2AWZA 3DGPA 2QFJA 3WBZA 1QE1B 3FCVA 4ECVA 1G2EA 1YVFA 2DGUA 3OVAA 2C2OB 5ETLA 4EI2A 3C6TB 4J9LA 2DKOB 2WVBA 4P71A 1RAJA 1S1UB 2HNDA 4P73A 2YQ1A 2YX4A 4RBVA 4A46A 3M8PB 2AYMA 1CVJA 3TZWA 2YKOA 1SQGA 4YB6A 2UUWA 3C6TA 2XEXA 1GNKA 1HI0P 4ECQA 1S1UA 1XR6A 7FDRA 1TK8A 3CJSA 4OHVA 2KXFA 1TV6B 3MR3A 1DY3A 2WOMA 1I94F 2VJUA 1VIXA 2OLWA 3M32B 4JV0A 4YUDA 1WEZA 3IO1A 2FB0A 5DDPC 2UVWA 2XBPA 4FKXA 2QLFB 4LF4J 2NSBA 3S1TA 3CSKA 3I55S 4JI8F 3SQGA 1T9UA 4FPRA 3K8WA 4JI4F 1UFWA 2EK1A 2W9CA 3DU5A 4CLUA 3ZZUA 2EFQA 1SQEA 1VC6A 4ANCA 2OI2A 1FNXH 4QWEA 4WJBA 1GX5A 2MSTA 1IKXB 3Q2TC 1M5PC 2V0NA 2HBQB 4USWA 3IGVA 1XNRJ 5HVFA 4EGLA 1FESA 2KM8B 5HI7A 4F4XA 2E1CA 4U7UD 3AA9A 2I5JA 4X62J 1Y3JA 1RU1A 4B3TF 2I2YA 3HMJG 5GMDA 1EKSA 4KRWA 1RT2A 2FC8A 1YJNS 1JJ4A 1Q7YT 3ET6B 2Y1RI 5J1PA 3OPKA 5MAOA 2MJNA 3DLEB 4I4BA 3HD2A 2BDPA 1B64A 1F3FA 1IBMF 1K9MT 1J5EF 2RRNA 1VYAA 4Q44A 2WVCA 4RW4A 3S01A 3FEXB 5F9LA 1MLAA 5KOWA 3RBDA 2ZOFA 2DR6A 4DZDA 2XNQA 3GWCA 4WKYA 5G0RA 2BEFA 2ZNYA 3K2YA 2K1RA 1XTZA 4HH0A 5H1SV 4WXWA 4NRTA 2CFXA 2BKPA 3TANA 4HACA 2OKQA 4G1PA 2ZWPA 3N01A 5A76A 4C8ZA 2HHTA 2HHWA 4J9KA 1SV5B 1YGYA 2K3KA 1Q1KA 2B4VA 4OX8A 3VALA 3FBBA 2I38A 2V4JB 5D15A 3R27A 1VRQC 3BB5A 4P75A 4A8WA 1LQ9A 5E33A 3D0IE 2CNNB 3MR7A 3IWLA 2QEXS 4QYZJ 1F0XA 3N6MA 2XWYA 2KJWA 2M2BA 2GHVC 3G6ES 4EBDA 4OYXA 1U24A 3TVKA 5IT9U 3LPYA 1RT3B 3D54A 1NSAA 2NCKL 3QO9B 1RA7A 4OLOA 5EUHA 3WIUA 1M5HA 1SVDA 2UUTA 4IKAA 4OHWA 5K14A 3RBXA 1RT3A 2HVZA 3KLEA 4KGKA 1BLUA 4PKDB 3M9MB 3TRGA 3OVSA 1R7IA 1NHKL 2K7KA 4QR1A 1SKSA 1IJFB 1WG5A 2HFOA 2VG5B 2ATCB 4X4SA 4CYUB 4MYTA 1CSJA 4LF7J 1HQEA 1WNEA 1DJ0A 1RWKB 3CPWR 1PBUA 5KFMA 2YTCA 1TKZA 3JS9A 1GQEA 2GZOA 3SI8A 4ZLJA 4CDIA 2FIUA 2HNYB 4AL7A 2MQNA 1WDTA 2PI4A 2LDYA 2PO4A 3W60A 3LQVA 5F8JA 2DNKA 3KLVA 2GIRA 2DHHA 2OFGX 1XIQA 1OSCA 4YR3A 1N8RT 3GONA 2EG2A 1VJWA 4UOCA 2C3PA 2D74B 1XMQJ 3CC2S 4JI7J 3FKBA 2A3JA 1HR0F 4O3RA 2FDNA 2FLLA 3G8SA 1TUGB 1RAAB 1VQ4S 2HS0A 2KT2A 4A48A 3L7UA 3KLGB 4DV6J 3GYXB 2E66A 4FF1A 2QLBB 4RZRA 2QL7B 4I7FB 2C3YA 4DXLA 4IFVB 5IT0A 3T5KA 1ZAXA 4L3NA 1DLOA 2DNHA 2VFRA 3R7BB 2F5GA 3W1YC 2DNGA 1NLKL 4IFVA 2RUSA 2XZWA 4NCAA 1KOOA 4BWMA 3G86A 3FMBA 2CZVC 2W2NP 1WI8A 5B0CA 3MM6A 3J80Y 4QU7A 4NE9C 1RT6A 2FJXA 1QSYA 2ACMA 3LAMA 4OZLA 3TAPA 5EHHA 3NNCA 2UV8G 1RWOB 1RKJA 1HBMB 2DTJA 3EXYA 1U0HB 2CKWA 4Q45A 1IBLF 4PG6A 4DMZA 1SCJB 2DGXA 3VTIA 2CJKA 2ZH9A 2R7WA 2M9KA 1IXKA 1U0HA 3TP2A 5EX3A 3CCLS 1QSSA 2G1DA 4WTOB 2EI5A 2MDAA 1VDHA 2ACYA 4PWWA 1U2RA 3BN4A 5KG6A 1C2PA 5JVHQ 3CW2C 4QCLA 1N36J 1S7HA 3NCPA 5IFMA 3QMQA 1TFYA 3K8VA 3THTA 3L09A 1CLFA 3ILLA 1PJ6A 2HS4A 1B0VA 2KB2A 3M8RA 2KVIA 4M5NA 4B3OA 3JAMU 5AT1B 4OQJA 1Q8KA 1WJ9A 1H2VZ 4RWXA 2HGMA 1S9GB 1LNQA 3SMZA 5HANA 3DLGA 2Q1LA 2B0GA 4U96A 4TY8B 5D6GA 4WBFA 5KFNA 3QSIA 4ZCKA 2MLXA 2BACA 3E2EA 2JFDA 5KFKA 4L73A 3EGZA 2W7AA 2XMMA 4A8QA 1UPMB 2HHHJ 2GS8A 1K8AT 4WK3A 2XZDB 3P49B 3K89A 1BQMB 3KK3A 4CH1A 1E6VB 2RILA 3NCQA 2FGOA 1UFKA 4ERDA 2KN4A 2M70A 2AQ4A 4NYOA 3OV7A 1SKRA 4OZ5A 5J2NA 2YY3A 1H73A 4QR2A 2OEMA 4NX9A 3P45B 3NOGA 2QSWA 2QL5B 3SSRA 2DHSA 1Q82T 4Z2XA 2J8SA 1DTTB 5FIIA 4DV1J 4FVMA 2XWXA 1S1TB 1IWAA 4YY3J 3BM7A 1RI7A 4C8NA 1NK9A 3KMQA 1SIZA 3TQEA 1DTTA 1KLMB 3OHAA 4CH0S 2CPEA 3EPIA 5F8HA 2A10A 3IBCB 4U7CA 3PDNA 3DU6A 4LJMA 4NPOA 4DL3A 6FDRA 1G3OA 1KLMA 1CJKB 4WKRA 1NDPA 4DI6A 2OD6A 4DLEA 3GR1A 2DNNA 3DLKA 4RW7B 2VDHA 2NYIA 1NUEA 1O51A 2J9EA 1X5OA 2RU3A 2AX1A 4X4QA 4PG7A 3DM2B 4FYDA 4K4UA 2IHR1 3QLHA 1RHUB 3V81A 2M3DA 3MMCB 4Y65A 3CWJA 1JLQA 2KXNB 1NZ8A 4DSKA 4CNZA 3KOAA 1CJTA 1TL5A 2D1CA 2YWHA 2Z57B 3AAWB 1KD1T 2L48A 1RXOB 1U2FA 2GX8A 3LOUA 1FTRA 4Q0BB 3MEDB 4RO0A 1S6QB 2HMIB 3OL9A 2XO6A 2B5JA 1F5BA 4FYYB 1JB0C 3UO0A 1HPZA 3GIIA 1DQ8A 3MEDA 3DHXA 2QYGA 1YX2A 1HNIA 1EIYB 1VRUB 5IT9Y 2QFIA 3MPVA 2M52A 4HHUA 1RSCA 2E5HA 2RVJA 1RCXB 2FY1A 4WXOA 1IQTA 3DRSB 1B99A 1TL1A 1M5SA 5IWAF 3HHNB 4ZA1A 4F0KA 1TKDA 2RSQA 3G8TA 1H2UX 1BC6A 1S4EA 2Y3YA 2C28A 2BQ3A 5B0EA 1P6TA 1RTJA 1OY8A 3DRSA 1H38A 2V69A 5JUMA 3FCWA 2YQ0A 1VLOA 4UZCA 1U6FA 4OYAA 3HCXA 4U8VA 2MY8A 4NYZA 5DM7Q 3CT9A 3H2VE 1BE4A 1NO8A 1S6PB 3D6MB 3MTKA 5DDOC 4XDCA 1Q95G 2J76E 4KGZB 1KQSR 4DN0A 5LJ5Y 5CXTA 5HMZA 2OTJS 4RNHA 5IQQA 2EC0A 3M05A 3BQ1A 1RTHA 4O3OA 3W5YA 2OHDA 4KAIA 2MKCA 5FD1A 4C3KA 3W5XA 5BJRA 4WZQA 1YLXA 2UUBJ 2LDIA 1V6HA 4ELUA 5IT4A 1AUDA 2ZH5A 4LFCF 2ZH6A 5ADZA 4RBUA 1N5SA 3G71S 2V63A 1YJ7A 3L95X 2YNIA 3NEKA 4A8OA 4MAKA 4FYWB 4RNNA 3EGVA 1TFWA 1TR0A 4URSA 1R27B 2ZEJA 1XC9A 3ILOA 3U1MA 2YKNA 2OTLS 1YRXA 2V94A 2IDLA 3Q8UA 1JLGB 1AA1B 4DV5J 1T03A 1RHRB 2ILYA 5F0WA 3H90A 2V8VA 5JMNA 4LFAF 1NPKA 4EUVA 4G3IA 3MPDA 4DG1A 3GU0A 4DL5A 4LRDA 3ZXWA 3KLFB 1R8BA 2ZKUA 2MSSA 4N76A 2E1PA 3C19A 2QC3A 4YP3A 3BGFA 3M6WA 2UUCJ 1TUVA 2AJFE 2VFSA 1FX4A 1WC5A 3NLCA 2DCUB 5K8MA 3LP0B 5IZHA 2P9EA 4LSNB 4W92B 2RS2A 4CLWA 3KLFA 2E1RA 1RTZA 4C8OA 5THWA 4QIFA 1QSLA 4EO6A 4NCGB 4LF8F 5GAGI 1DZ5A 3LP0A 3PX4A 1HD1A 4ZVRB 5DG9A 4WFAQ 1T03B 2ZH3A 2W9BA 2Y1LB 1Y5LB 3Q8PB 4X4OA 1PYTA 4NCGA 2CADA 4WP9A 4X4NA 3TZXA 1OQ6A 2Q79A 1HNZF 4X4RA 3DRPA 2B7BB 1U1QA 4N7TA 2VOPA 5L1LA 3BYPA 5CD4A 2RHQB 1R8CA 2GIQA 3G4SS 5AXNA 2DRDA 2WSCC 3CMES 2C3MA 1JQGA 2DHGA 1RZMA 3UFCX 2AJ0A 5LSOA 1PCAA 1X5SA 2QMUB 3OL8A 4JYAF 3BGOP 4HTJA 1LW2A 4Y34A 4I2PB 1JMTA 3JQKA 2JNJA 2HNZB 4RNMA 5CYMB 2Z2MA 2VKZG 4NLXA 1YG0A 1YJ9S 1NHVA 2ZOGA 1S6OA 3A3NB 1KVJA 4ZPWR 3D68A 2RDIA 3G87A 5J1NA 5DLGA 2PFDA 4Z7YA 4DR2F 1TKXB 4WCEQ 2MZRA 1RQ0A 2OPQB 2VG6A 1XJWB 3GFZA 3UVJB 1GXUA 2HBYB 3TW0A 1LWFA 4NI2B 2CDQA 2AEJA 2ZH7A 2OPQA 5E3AA 3RZAA 2XGQA 5KFAA 4K2JA 3ENVA 3PJWA 4TQRA 1YRUA 3UVJA 4YB7A 3RW7A 2ZBCA 2AYBA 1T95A 1SJ3P 3T41A 3RB3A 3H2UB 4IDKA 1TL3B 2AGPA 3OR1B 5C42A 2VHGA 2ZE2A 3Q24A 1YKWA 2DGVA 3GJRB 5C24B 1IR2A 2CUYA 1NB7A 1QJHA 4OI1A 1Q78A 4DR4F 1WDDA 3CCRS 2HBRB 4IQXA 1KQFB 2MGZB 4CQ1A 1TL3A 3OR1A 4J9RA 3C46A 2UXCJ 3TX0A 3FEYB 5C24A 1SUQA 2CQHA 1LFPA 2A0FB 3CC7S 1NJYA 2MHNA 2QG9B 2O1PA 2FYXA 1IR0A 4QW9A 2R42A 2CDRB 4E8UA 1NSKL 2YNHB 1X5PA 3MM5A 3FFIB 2F4VF 1YWXA 3R2CJ 5F3TA 2GQQA 3VAGA 2XC9A 5KFTA 5B0BA 1H3DA 4F2SA 1QTNB 1AZSA 1N54B 4R5PA 1RTDA 1UJ5A 2AEMA 3W61A 4CTAB 2J7KA 2NXEA 4CM2A 5AJ3F 4NLVA 2B6AA 2V2KA 2CJBA 4LVOP 4TYBA 3SV4A 2PEHA 3GMGA 4HHHA 3MMJA 1S48A 2I6WA 4DPOA 3NBPB 4KGVB 4RW8A 3BEGB 3POTB 4W98A 4MIWA 3QRQA 2J0QD 1CS4A 3TAMB 4OJ3A 4QQBA 1GXLA 5EWEA 3T9ZA 2ZM6J 3N6LA 1URNA 2RQ4A 4TYAA 5GADI 3POTA 1B70B 1QUPA 1L3SA 2CVIA 3UPFA 4P7VA 2ROEA 2YVSA 3H5UA 5E3RA 2OAUA 3ETMA 3FQKA 3M2UB 3JQJA 2UU9F 4ED4A 4F0HA 2XMKA 4KY3A 2ZH1A 3JB9k 9ATCB 4L6V3 4NRUA 1RYSA 2B43A 4J9SA 2CPZA 2CPYA 5L46A 3QIPB 3MEGA 4A8MP 2VV5A 1VRTB 3H98A 4YDDB 5DJBA 5J2MA 2XS5A 4Q2MA 1S49A 5D8HB 3GJTB 2OSRA 5FLXY 5LM7E 3GV7B 4NLPA 1CJUA 4B3MF 1PC5A 1S9EB 1K0TA 2HAFA 3E01B 4DCPB 4X66F 1FERA 2HKEA 1JXEA 4M5LA 2IRUA 4LMZA 3U02A 3OTEA 4F50A 2HPUA 4ZVOB 3KUHA 2X1FA 3NWGA 2DGQA 1FXRA 4FVCA 1Y4ZB 1HIYA 2HEKA 2R2SA 3HVRA 1HNWF 4LIRA 2AZ3A 2MQ8A 1RBLA 4JI5J 1VLYA 4MFBA 4K2XA 5EWGA 4DL6A 2L9DA 3EZUA 2XCPA 1JKHB 2IM1A 3NMRA 2OD4A 3BDEA 2FTRA 4UY8T 1HWJA 2ALYB 2Z2ZA 1ZM4A 4ZIVA 4LRCA 2DGSA 1E6YA 5I3UA 3CE8A 1QAYA 1JLFB 3RYLA 3UD4P 2HW3A 5HQLA 3OFEA 2OGUA 3ONQA 2ADCA 1RT1B 2ZVSA 3MAAB 1QAJA 4DN9A 2IA0A 2M8DB 2X1BA 1TVRB 1OPZA 2G0CA 4PABA 1F2GA 2IPOB 3SV3A 1PIEA 4X65F 3OXGA 1B0TA 2DR8A 3MAAA 3KNGA 4JV5J 3G6XA 3MM8B 1NKEA 4DV7J 2DPIA 4ID5B 1NSQA 2XULA 3OQ2A 2GVZA 3KUGA 1U1LA 2QA4S 2VBXA 4KV8B 1XR5A 4C0HA 3UDVA 1O8BA 1N52B 1VIOA 5HBMB 3WHIA 3TJ8A 2GMJA 2RJZA 2LA6A 1FRLA 2ZBIA 1P9QC 1ULRA 2UXBF 3GFXA 3G8QA 1X9SA 3DOMB 3US5A 2EEYA 4KB7A 2FZCB 3BH6B 2DD8S 3AY0A 3SZ2A 1APSA 2VOOA 4Q2LA 1Y3KA 3AA8A 3LPEA 2CRLA 4NASA 1EQMA 5F9NA 4H54A 2WVDA 3CDWA 1B7FA 3K5MA 3ZZ0A 2YH0A 4NWBA 3DFEA 1LOUA 4GVLA 2YKQA 3IR7B 3O1LA 2HFNA 3M1VA 2NXJA 3SIPB 4M5GA 3W2VB 3MAQA 4ETXA 1HBUB 3QWUA 2FJVA 3VAIA 2QE5A 4NLUA 4I64A 5DDQC 2B56A 3N79A 4QJVA 4ATNA 3SBMA 3G82B 4JI0F 1FTCA 4H4KC 4OHXA 2ZBQA 3D1QA 2HQCA 4PQUB 3LP1B 2AYGA 4EYIB 2DO4A 4OZ1A 1WF0A 3G82A 4MKBA 4LQ3A 1PAUB 4P72A 3QJPA 2MKSA 2FHJD 3NS7B 2K3IA 1Y00A 2QLXA 4USTA 1MNEA 1LK5A 1VOMA 2IBOA 4ED8A 1KKHA 3QAEA 1DBDA 2VC1A 4DR6F 4CZCA 4K7QA 1O5JA 3B4DA 3IC1A 2AJ4A 4ZMMA 4KYZA 3H7HB 2CQDA 4W4MA 4C8KA 4JUZA 4GKKJ 2DXDA 2CQBA 4Y3CA 4V19X 2BMBA 3UNYA 3QZ7A 3ZZYA 4O4RA 2RAQA 1JLAB 5T41A 2G13A 3CF5Q 3SQOP 4DU7A 1WOOA 2CWKA 3AOBA 3DOKB 5J1EB 4LF1A 2C22A 1UMJA 3HKWA 2HURA 4FBTA 1T02A 1H7XA 3KFWX 1S1WB 4PPZA 3DOKA 1FDNA 2D7SA 2YNGA 1UA0A 4WU2A 1TTHB 3D0HE 4ZVEA 3K0JA 2GC8A 2OPRA 3QT5A 4B3SF 1RT5A 2R9LA 1HKAA 2OUGA 2E9TA 3DRYA 1S97A 3R1LA 4PXCA 2NXCA 3CTRA 3GIJA 4MK7A 1AXQA 3BKTA 3V4MA 3N5BA 2F9JA 3BH7B 5H9EJ 4BHQA 2BE2B 5HMYA 4AE5A 3T1YJ 2DEJA 2B9XA 1VCTA 1REGX 3IFEA 4KHPF 2B9YA 5KTQA 2BE2A 5L1KA 3BR8A 5LL6d 1KHVA 1N34J 1C1CB 2KHDA 4M5MA 4DQQA 2JWNA 4M5IA 1UVKA 2WAQD 3PX0A 3B54A 5BXIA 3T5JA 4DV0F 3HLUA 4OYPA 2G2ZA 1HBNA 2JLEA 1ZZFA 5ETPA 1T9XA 3CIZA 5CHCB 1C4AA 3H4BA 1F6TA 2D3O1 3V6KA 1R8PA 3VAHA 2KRRA 2QSFA 2HZCA 1T9WA 6AT1B 3HFKA 4CO0A 4NL5A 1Q86T 3D67A 3M6XA 4ZVUB 3WX8A 4EZ9A 4LUBA 2VIHA 5DGAA 3JSRA 3ZZRA 3WZ0A 2JZ5A 3QWPA 4OYZA 4DFJA 4HTIA 4DFPA 1F9EB 3B4MA 4USUA 3E8OA 5B0FA 4Y00A 2ZD1B 2Z4PA 2G2YA 2C2RA 1FFSB 2AT1B 2MKHA 1Q53A 2V50A 4LQ9A 1CJVB 2C3UA 3HHEA 2R2RA 4J9VA 1K47A 2MHEA 4H4KA 4DV4F 2FPHX 4IH5A 5A8KB 2CPHA 4CLYA 2ZZTA 4EYHB 2WB1D 4KBIA 1PYOB 1HHQA 2H65B 2POKA 2W25A 3MUMP 2NLWA 1V3RA 3OR2B 2IJFA 4CLTA 1MMLA 4FDFA 2DPJA 4N8NA 3E3XA 3LW5C 5D3GB 4ZP6A 2MZSA 5C2CA 3TJ9A 4FF3A 1HNZJ 3AT1B 3B78A 3IXQA 4ANDA 1RLCL 5HK4A 1HNVB 1ZBTA 4FXWA 1YBAA 2UXDJ 4DR7J 3DLJA 1C1BB 1HNVA 2AMCB 2GIFA 1N56A 1UVLA 2ROGA 1Q8BA 1MN9A 4TLRA 3D5MA 4I68A 4CT8A 3PVXA 5BYRA 3V5RA 2YKMB 4UUWA 1Q0NA 1VFJA 5GADU 4XIUA 3RB0A 4NMLA 1SBRA 3ZZZA 2OEKA 3KK1B 3N28A 2YKMA 1ICEB 3HO1A 4PYDA 3JQMA 5A2QY 4MH8A 3VGSA 3WDOA 4NXMJ 1N33F 3NGKA 4IFYB 4Y2IA 2AJ2A 4JI3J 2QYCA 5KFHA 1XMBA 2FVQA 1L5UA 1YZ6A 2Q3PA 3SDEA 2E5IA 2J0WA 4OZ2A 2XB2D 2COLA 1VBZA 2WSEC 3O3LA 2FJWA 1WC6A 1PG5B 1KDNA 4RW6B 2W2PP 1AW0A 1X4DA 1HQUB 3KLIB 3ZTQA 4WE1B 2CPXA 1BMQB 4YHHJ 3PNIA 3HHDA 3HSGA 4XDDA 4FN5A 4QZVB 1ACMB 3PRBA 1HBOB 4DV3J 3TI0A 2MKIA 4IRCA 4HKQA 1FO1A 4JBCA 1Q5YA 4J9UE 3G96A 1HBOA 3LUYA 2C2EA 2IVYA 3C15A 3BGLA 4LFBF 3FBFA 5A8WA 3ELHA 1UWBA 5HP1B 3S7RA 1G4CA 4TN2A 2IC3B 3SCKE 2I1RA 1RDRA 3OTOF 3UW1A 1U49A 1KQGB 1Q16B 2CNOB 5KFJA 1FJEB 1UWAA 4DUZJ 2YWFA 3TA1A 5HP1A 1M5KC 3RR7A 1UEKA 2IC3A 4PZVA 1SJQA 4EU0A 5B08A 4ED1A 2LU2A 2MQMA 1RBOB 2JC1A 1FKOA 2IMOA 1S4FA 5B09A 4A8KA 4DJBA 1VHFA 1VQ8S 3M2VA 3D2WA 1JWWA 4PWDA 2XLKA 3IWXA 3ZZOA 1JLCA 4F4AA 3JSMA 3LA0A 3ZZTA 4MK9A 2CQ4A 2CZ9A 2KHCA 5T7LB 2R3VA 1LXNA 4ZP8A 2KT5A 4DF8A 3DCAA 4IG0A 3EGWB 2ASJA 2XM3A 3C16B 4EEYA 2RRBA 1RLDA 2GAHC 3AH6A 3ZTOA 1FWPA 3M30B 2GMHA 4DUTA 3TQ1A 2AJ1A 1SKWA 3OJUA 3OD2A 5J2QB 2GO9A 5L1IA 1F9HA 1KN6A 1RE1B 4Q7AA 4NLOA 1FI4A 4ED7A 2CG4A 5H9EK 4KKOA 1T3OA 2DNRA 2MTLA 5KG1A 1V9OA 1TP7A 3T1HF 4PUOB 4DR3F 1PILA 3P96A 4OX9F 2EFGA 2LXIA 4MIBA 4OI6A 1KS2A 3EZOA 2EBGA 3PHEA 3MOZA 4ED3A 3MM7A 3GV8B 4NLGA 1FJGF 3KHLA 3PJ9A 3DDKA 1FF2A 2GV1A 2X7IA 2XLIA 2ZHBA 2VA3A 3BSOA 4J37A 1UVNA 2FGCA 3VGTA 5LMUJ 1XMOJ 4LR7A 5DQIA 4FBUA 4NXNJ 1XNQF 2Y9HA 2EFPA 1OO0B 4PG8A 2JX2A 2ZWOA 2JEFA 2QO3A 2HHVA 1LW0A 5KT6A 3KMSA 3MPUB 4EBEA 8AT1B 3VAFA 2FJDB 3SEOA 2KYZA 1Z4UA 7FD1A 1M90T 4YDXA 1PO6A 2DRBA 4Q8EA 2CXEA 1TK0A 3NNHA 3TA0A 3AD8C 4J9MA 4K4SA 1KWMA 2BRLA 3KWMA 3RJMB 3BO3A 2OPPB 1WEXA 1EKRA 3GTYX 1N5YA 1R0AA 2Z56B 3H59A 2GGPB 3I32A 3I0RB 4OZ3A 3NG8A 1VGYA 1VISA 2ZDPA 3EM1A 1S0VA 2AU0A 3W9IA 1FRHA 1PJ5A 3HFVA 3K59A 4IO1A 1HFEL 4TU7A 4FNIA 3I0RA 4KR0B 3EZ5A 3MEEB 4LSZB 2D69A 5KT4A 2ZKTA 4PXDA 4DV2J 3L7OA 4W90B 2W4DA 3ISNC 1CULA 5J2PA 2HSEB 1FK9A 4AXJA 3DXBA 3EJMA 3NY0A 4ILRA 2LMIA 2BW2A 2KH9A 4DR1F 4ETZA 4ZN1A 3D6FB 1RABB 4EWTA 2PEBA 4L72B 2A2DA 4ECRA 5A8RA 1RWPB 3TEGA 1VC5A 2F8EX 4DEZA 3IAS9 3P4UB 5F8NA 1GT8A 4XTTA 2VC0A 1WEYA 3PX6A 5HQMA 1VQ9S 4DX7A 1HNXJ 1WKKA 1U2CA 3L4BC 3QFHA 3UCZP 1NU4A 4RW9A 4ZCLA 2DYAA 2X1AA 4E98A 3R5BA 1N88A 4R0JA 3HD1A 4NLDA 1DTQB 3V4IB 4RNFA 2FHMA 3TO8A 1RT4A 2O5DA 2PA3A 4B9NA 3VHQA 1W26A 3KDOA 3CULA 2IVFB 1HMVA 4IH6A 1VQNS 5HVGA 4ES1A 1ZS6A 1BD6A 3PYFA 3F0NA 4M95A 2AIRB 4QWDA 3HI9A 1RAHB 2B9EA 3HSZA 3BGRB 5FDLB 2EWHA 2E5JA 2PFFB 3QRPA 3KHHA 4HDHA 3V6DA 1ZTWA 2RUGA 4C11B 4LBIA 2XNRA 2C2KB 1T05A 1SB6A 4G6VB 3DMJA 5LXYA 4NZ7A 3QNWB 1J5OB 5AXMA 3RGIA 2ASYA 5LT5A 2R4FA 1C0TB 2BZ2A 4WP8A 4QWAA 2RE1A 1D1UA 4USHA 1D9FA 2XCAA 2YH1A 5CH7B 3RR8A 3W9JA 4IG3B 3TWZA 5D0HA 5CZXA 2DVIA 2CQIA 2W1BA 3FEZA 4IG3A 4QPXA 4JI1J 4DR6J 1U1OA 2FC9A 1W7WA 2R7XA 4YMEA 2FLPA 4GKJJ 3K5PA 2HVHA 1FDBA 3IR6B 1FRIA 4YFUA 2ZC3A 2ILZA 3CJ3A 3D4JA 4LF6J 3HT3A 3UN2A 3RB4A 2FQQB 1ITPA 1F5AA 1WD6A 4LSLA 4DFKA 1RWNB 4JI6F 3CJ2A 1RAOA 2WZ1A 1XK8A 2JEJA 1WF2A 4TKTA 1PGZA 3AB4B 1FRXA 1N0VC 2QMWA 5ETSA 2MY7A 4KFBB 2FJEB 3GQCA 1JNZB 2VZ9A 3UNGC 5C25B 2BJ9A 2LQJA 4JI2F 3SXLA 2VQFF 5CD4H 4ZPBA 3MMAA 5B0AA 2RD5C 1DHMA 3PO5A 2MLZA 5KG7A 3KDNA 2AJQA 2DH8A 2JJ4D 5LMNJ 2UP1A 4KH1B 3GIKA 3PW7A 2BABA 1T0TV 3DOLA 5KFUA 2KG1A 4J9NA 5D77A 1NK0A 1N6QB 4TQSA 3MHYA 1BXNA 3R7SB 1NH8A 1R3NA 2M4MA 3HX9A 3CEDA 4ZPAA 2W8KA 4DSFA 5SZTA 2LVWA 3S6EA 2BUNA 5DG7A 3KNAA 3Q8VA 4OZ0A 5LSLA 3AJDA 5ETOA 5HAOA 4E2FB 3UN3A 1O6XA 1RJJA 3DRRA 3KJFB 3EYZA 1P8GA 2KG0A 4PYAA 1Z2LA 1NM2A 3HVTA 1KHWA 3PTWA 2JRSA 1RADB 4LREA 1T94A 3GE9A 2NZ4A 3O44A 1C0UA 3CIMA 1RWXB 1WOSA 3QAUA 2DT9A 3DGPB 1TELA 1FKPB 1GFWB 4I67A 3WX4A 1X4AA 3U7JA 1R8AA 1D9DA 3MPYA 5GAHI 2BJ1A 1YI2S 3CDBA 3GJSB 1YBTA 3FCHA 1FKPA 2ZHAA 2HNDB 4DPWA 3GP9A 2QV6A 2BM1A 3MD3A 2WONA 4Y2AA 2WRMA 1BWEA 3CJ8A 4ECZA 1ZM2A 4FYXB 1N0UA 3AFGA 3D0GE 2XSJB 2WOMB 4AT1B 3PZPA 1IVZA 1S7IA 1IKWA 4C0OC 4X4TA 4ZIWA 4NZ6A 1TKTB 4Z37A 2PIIA 3I96A 2XSJA 4ZJLA 4Q43A 2EBEA 3SQGB 4DU8A 2HQGA 4P9SA 2B4UA 2W9CB 2BJ7A 4UT4A 1MSWD 3CCUS 1TKTA 4YB5A 4BC7A 3HJFA 4NYPA 1DRZA 3M8YA 1VI7A 2IIHA 4U95A 3UD3P 2VA2A 2GFFA 4ZVFA 2V4QA 3IN5A 2R8IA 1LWEA 4OLPA 2R7SA 5IC6B 3W2WA 1RHMB 1NMEB 2CQGA 2FVPA 2ZZNA 2E5LF 2DR5A 2G9OA 3NGDA 2UZAA 3ZO7A 3MPWA 2EW9A 2JSXA 1UTAA 2GAGC 2I5JB 3AOAA 2RF2A 2QGFB 3OW2R 2FD2A 2V9WA 3CD6S 1R89A 3R97A 4USKA 2J8AA 1RT2B 1JLBA 3IBFB 1F2HA 1KR4A 2WW4A 1S10A 3ULHA 3IM8A 5HMXA 3GB0A 4OI0A 3HSJA 3GZ7A 5HVHA 3V6JA 2F7VA 4LF5F 4TNOA 3NP5A 2VBWA 3D1OA 2LECA 2R7UA 1D3WA 2J5AA 4C4WA 3RBEA 1P1TA 4MYUA 4RW4B 1FWKA 1A0OB 2U2FA 3QPIA 1JK9B 1U1KA 2QTWA 4F4KA 4OFZA 1GX6A 4M1KA 1X4BA 1RTIA 3R7NB 2V2ZA 3LWMA 1MU2B 1FKAF 3CJQA 2XS7A 5G0RB 4H4OA 2K1RB 1UZHA 2H48B 4OJ1A 1MU2A 1X9MA 3BS9A 4HACB 4U8YA 2DO0A 2DGOA 2H1YA 3CDAA 2HHUA 2PN6A 4KH0B 5KG2A 2ZHOA 3A12A 5E2QA 2EFOA 5F41A 5AE3A 4CM0A 3VQSA 4DS4A 4P2SA 2ALZA 3NAHA 3EGNA 2K8GA 3A13A 4DWIA 2VF3A 3NOCA 4DQSA 2CQCA 4LF4F 4ITSA 1U09A 4KHRA 4G1QB 3UWTA 1WWHA 3VGUA 4BWJA 4ZN3A 5F3ZA 1HW9A 1GTHA 3FRZA 3GYGA 5M2RA 1IR1A 2WSFC 1QLNA 2ROPA 2CJ9A 2QN6B 4HLBA 3FMWA 4G1QA 2NPIA 4MK8A 2VL1A 4K4ZA 5K14B 4EBCA 1FE0A 5KFXA 1S5ZA 3KLEB 2L9WA 1WC0A 5CQGA 2V2QA 3R8YA 2CIMA 2APOA 1AROP 3AD9C 1XNRF 2FZGB 2N4DA 1KP6A 5E41A 4UQGA 3BN7A 3C8YA 3MF5A 1K0VA 1DURA 3DYAA 3SCLE 3JTNA 1HQEB 3KG0A 5AXLA 4DOZA 4FF2A 4X62F 1TKZB 3HHKA 3GPAA 4KTQA 4UOGA 2HQFA 4HT7A 3W7BA 2XMAA 3FK4A 2DR9A 3OXLA 1X5TA 1HW8A 2XMWA 3BV8A 1NNDA 2GA7A 1F5CA 4ICLA 4IR9A 5L9XA 1S1XA 2A18A 5KG0A 3CJKA 1IN0A 6FD1A 1U1NA 1SJ1A 3TARA 1NJZA 2IM2A 4F7VA 1I51B 1RB0A 3G2XA 4LBHA 1JLEB 5F0UA 3J7ZT 2L08A 5KFWA 2BA9A 2DR7A 4V19J 5KFDA 4LBPA 4NMXA 2DJWA 3AXKA 1YK9A 1A6LA 2D3ZA 3I9V9 3W63A 4DPXA 3R5CA 1JLEA 5DLFA 1BQNA 3MM9B 1FJGJ 4M5KA 4HYKA 4ZHRA 4QWBA 4BC9A 3MM9A 1RYRA 5L1JA 4F67A 4ZJQA 1SPBP 1RAIB 3IM9A 3HVWA 1CC7A 4DQIA 3DHWC 1DLOB 2KZMA 1TL7B 3HT0A 2QZ8A 3DI6A 4D3HA 4OI2A 1QAIA 4PCQA 3L3CA 4MJKA 1TL7A 5ETRA 2F40A 3PR4A 4LF9J 3MM6B 3PY8A 3IRXA 3MMBA 3TUPA 4CLPA 1RT6B 3RRHA 2H5IB 2K2PA 2VKRA 1MWQA 1N32J 2UV8A 3ENAA 1GMWD 2GHWA 4LVNP 1X4FA 1B7YB 5LJ3Y 1M0SA 3O8WA 2HG4A 2C3OA 2J0SD 4F0MA 2IVMA 1Y5NB 2Z58B 4K0KJ 2Y8YA 4AD6A 3KJVA 1FNOA 1MN7A 2J7WA 2EC2A 1YSJA 3W8PA 5K8PA 3DXSX 4RLEA 4K4XA 4DL2A 1EETA 5KFVA 2XHWA 1NKBA 4X64J 4LF7F 2B9WA 3TZYA 4R25A 5E3QA 1WOPA 4H4MA 3UE2A 1KNZA 1FRJA 2JVRA 1RBAA 5IM0A 3FZBA 3RRGA 3OSPA 4ZKAA 2YNFA 3GLJA 4UZBA 4CWBA 3ILIA 3CD0A 3N6NA 4B3OB 1WELA 2AYEA 2PDAA 3SFUA 2BR0A 2MZJA 3PG9A 2QLJB 4LF2A 1VMBA 1U45A 4CCHA 1XMQF 2JL9A 4B02A 4JI7F 2F1FA 4ZLPA 3EVMA 1UW9A 3DLGB 3K17A 3T6BA 2CAJA 2O66A 1X9WA 4HH1A 1V3ZA 1KFSA 1WG4A 3VV2B 1EHWA 4N5SA 2BXJA 3LANA 2QRRA 4DV6F 2AV5A 3KXDA 4QWCA 1KBRA 1DARA 2D9PA 3PKYA 4KGMA 3QSYB 2M7SA 1UETA 3RUBL 2UVRA 4E0DA 3VZHA 3KK3B 1NK4A 2V2VA 5T14A 1KQKA 4IH7A 1RP5A 4O0NA 3KYLA 2R2TA 4C8LA 4ED0A 5J2NB 2CA9A 1KC8T 3HHLC 4NLTA 3PW5A 5A0YB 5KFIA 5KFYA 4Y2CA 3KK2A 1U25A 3PIOQ 3HP6A 2DBBA 4NOHA 4YR0A 4DX5A 4NLQA 4OI4A 5A0YA 4HI1A 3W8GA 5ETTA 3CCSS 5F8MA 2Y0BB 4ZJOA 3OSNA 5K5MA 2CQ2A 4OIXA 1JJCB 4Y2KA 2P6TA 2PGCA 1Q79A 3GYNA 3JYTA 2FLNA 1C4CA 2NQPA 2LQBA 1U1RA 3RG6A 4ZVSB 4N47A 4NA1A 3DLKB 2HGNA 2HIYA 3PKMA 2CPIA 4RX6A 1T9YA 3GG0A 3M9OB 4X2BA 1AB8A 5GAHU 2BKNA 5ETNA 3QLHB 1HWLA 2E7WA 4R0EA 4M94A 3V81B 4DF4A 2RB7A 4P2XA 1N36F 1JLQB 4C7QA 4WFYA 3NAIA 2WTFA 3E51A 1CJTB 2RQKA 4NEZA 2JDJA 3FDSA 5KFFA 3GCWP 4IOBA 1VK8A 1HHSA 1Y7PA 3EVOA 2RT3A 1OMSA 3KTQA 2MZ1A 2XTJP 2N4CA 4XK8C 3ISND 4BDPA 4GO7X 1GAOA 3QT7A 1HL6A 2B5JB 4ELVA 2ZJQQ 4B3RJ 1BGXT 1HPZB 2KKHA 4ZVQB 1FD8A 3I5CA 3U1LA 4ZVGA 1HNIB 4N41A 2JLGA 4FZVA 2JLFA 4M5HA 2KZZA 2GCFA 2OEJA 4GVBA 3RBZA 3CCES 1LWCA 2HHHF 4DUYJ 1TL1B 3PV8A 1S1VA 1YBUA 1IKVB 3EDRB 5ITHA 2LEBA 2LQ5A 1RTJB 4ZVPB 3RAMA 1IKVA 5C5JA 3CUNA 2F3JA 2XY7A 4ZK7M 1Y9OA 3M8QA 4DV1F 5KFOA 1NB2A 1IUJA 1IKYB 2WBRA 3MXHP 3ENQA 3VGVA 4YY3F 1VQ5S 5FLXU 4F8RA 3FQLA 1RTHB 5I4MA 1MMDA 4USIA 2BANA 3AQPA 1IKYA 3FGVA 2FHKA 5ETQA 1WACA 4PXBA 2YNIB 1R6YA 2QLWA 2GJIA 3UCUP 3DGVA 4P74A 3H5SA 2YKNB 3HHLB 2F8MA 2DY1A 1DAXA 2E9ZA 2H54B 2XMTA 5GAEI 5DDRC 3T3FA 4KGXB 4DQRA 3SYZA 3HHLA 2LU1A 3N9UC 2W01A 1FX2A 3MGJA 1U6BA 1FFGB 4EFAC 2ADBA 2JEGA 4DG1B 4XPCA 3Q2SC 4UY85 2P9GA 1RAEB 3AXMA 1NDKA 5BYSA 2KM8C 2HFZA 2NUHA 2RRAA 3LWLA 5I3PA 3NS6A 2R8GA 2XS2A 5CA5A 2MYFA 3WC0A 1KVKA 2M8HA 1HWIA 3IR5B 5B0GA 2V8DA 2F65A 3F41A 5KFZA 1I94J 2CNKB 5E5NA 3CD5A 2W9BB 1LXJA 4BCAA 4Y6IA 1X4CA 1KVIA 4JI8J 2CYYA 3KHGA 4NA2A 4JI4J 3DRPB 1F60B 2VG7A 2YXLA 3ITHA 2RDJA 3CJ4A 3DNCA 4N56A 2LXUA 1VQ7S 4F26A 1ZA1B 4OV1A 2IYGA 3CCJS 2HRUA 3NL0A 1Q8LA 3U27A 1REVB 3PW4A 1LW2B 2SXLA 1VBXA 3DRXA 1FXDA 2C2ZB 1CEZA 4URQU 4AL6A 1B3TA 4Y0FA 2ZH4A 1L3KA 1REVA 2UUBF 1R31A 2PMWA 3VAJA 4X84A 4B9UA 4DPUA 2OMLA 2LLZA 2Z0GA 4B3TJ 3KLHA 3ENWA 5CZVA 2BOAA 3BQ0A 3QFWA 1S9FA 1ZM3A 4ED2A 2R8KA 4NA3A 4KQZA 2DIVA 3VAKA 1EARA 4C48A 3PJXA 3DKDA 3R5GA 4DDFA 5BR8F 1MW7A 2IAJA 5CYQA 3HJVA 1R6VA 5I42A 1IBMJ 3GFHA 5K8NA 2VG6B 1MMNA 1J5EJ 4DS5A 1VQ6S 1X7VA 3QATA 1S72S 2W2QP 1LWFB 2DHAA 3QYYA 5G4DA 1Q4RA 4DV5F 4FS2A 2G0IA 2OPSB 2JEIA 2E44A 3HM9A 4IRKA 1AT1B 2XI3A 1QE1A 1U47A 3CJ5A 4OHYA 2VFUA 2GJFA 2KFNA 3K5NA 2OPSA 4IDKB 2BM0A 2LYVA 5C42B 4WYWA 1XR7A 1LWXA 2ZE2B 4DCOB 1RHKB 4I2QB 4CO5A 4F36A 2QMXA 3AJ1A 1GH8A 1EB0A 2UUCF 5KT2A 2MQOA 1FDDA 3M8PA 1KTVA 2BJDA 3FNNA 1BUXA 1S12A 2ZVIA 4I2QA 1SUQB 5A6WA 1TV6A 4ZDNA 2EK6A 4ILLA 3TUZC 4C0BA 3M32A 2K06A 2GO8A 1A7GE 1XWLA 2DNLA 4KPYA 4WFNQ 3MM5B 2MKJA 1OYEA 5U47A 3FBCA 2DNZA 2V8HA 4DBQA 1HHTP 4WFBQ 5IV4A 1AZSB 4WP3A 1YHQS 1VQSA 2KT3A 4R5PB 2XMJA 5EX0A 1RTDB 4FNHA 1XERA 4HL9A 4C6AA 1IKXA 3RU0A 1FEEA 2QIFA 4ZCIA 5D4OA 2B6AB 3OTCA 1V5IB 2YPZA 3HFZB 4L74A 1GTEA 4RW8B 4PXEA 2ZBRA 4CO1A 1WC3A 1ZH5A 1CS4B 1LK7A 1UJ4A 2MQLA 2KFZA 3X1LB 3MCNA 2LEAA 4J9QA 2DHXA 4HDGA 3PHTA 3ET6A 3BSCA 3JXOA 3ADAC 4NZ0A 3DLEA 4B9VA 5DGBA 1RHJB 1VQOS 1CC8A 3A3OB 1NXIA 1WC1A 3TVZA 3P5BP 1XQIA 3D7SB 5CCMA 3JTOA 3EICA 2E5GA 3BSNA 5ETMA 4X4PA 4PRFA 3Q86A 1DFDA 1T11A 2VBYA 1HR0J 3R5DA 3CMQA 1MROB 1G7CB 5CCLA 2X51A 3MEGB 4NLSA 3T5HA 4TY9A 2ZOMA 1RACB 3RTVA 2V8PA 5J2MB 2HWIA 4B9SA 4C3MA 1MROA 4ZCMA 2LCWA 3MCMA 2DNOA 2N3LA 4J5OA 1CBKA 2IDEA 4A8SA 1SV5A 1CJUB 2MLYA 2UXCF 2CQ0A 3OFGA 1VHIA 4RWWA 2V4JA 1YJWS 3PW2A 5H9FJ 3UQSA 1VQYA 4LRBA 4RR5A 1SL1A 4O3PA 3CDEA 1UL3A 3QIDA 1Q8IA 1AUSL 2H4WB 3SCIE 1N5VA 5L38A 4MFBB 1X31C 2O67A 4XAKA 1RCOB 4RU9A 4KT0C 5GMEA 3D66A 5AXKA 3QO9A 2A2CA 3W5ZA 2XSFA 3OFFA 1E6YB 5I3UB 2VICA 1ZYQA 5SUHA 3GJQB 1CQMA 3Q83A 3CB4A 2JVOA 1IBLJ 5D4LA 3ILJA 2W7OA 1KSPA 3CJTA 4LR8A 3OT9A 4K5RA 3BGUA 1KONA 3P8BB 2OELA 2VG5A 3MR2A 2HVDA 4P10A 2R8JA 3QGHA 1WHXA 4CYUA 3P3DA 3TAQA 4F4WA 2J7UA 4KSEB 4YS2A 3KJNB 3I31A 2ZM6F 3DDNA 4TVAB 2VONA 3P6YC 2GVZB 2HNYA 1IBKF 3OXFA 1NHUA 4J9OA 1NBEB 4IO9Q 3WC2A 4KIAA 5A6PA 3K57A 3M8ZA 4QU6A 4QIVA 5A2QU 4ZPVR 1SH3A 4DR5F 4LRAA 3V2UC 4UOHA 3LALA 2NXNA 1U4BA 2BX6A 2VUGA 1U48A 1P1LA 2LA4A 4BBYA 2RMLA 3IMQJ 4CLSA 3M8SA 1MWYA 1VC0A 3SSQA 5L8RC 3KLGA 2BE7D 2RU9A 2MB0B 1U8SA 4I7FA 3PM9A 2UUAF 2BW7A 1M1HA 4OX7A 3M1VB 3HKZD 4TXSA 4CH7A 1IM6A 1OPIA 1PBAA 2D41A 4ID8A 2YPYA 2V67A 2C42A 2LKZA 3DDIA 4PWUA 5HLFB 3LO3A 3NXZA 4F4YA 4AL5A 3C14B 4JI5F 1XN9A 3PO4A 5DG8A 2GMLA 3MECB 2ERRA 2L3MA 5HLFA 3CJ0A 3F44A 2ASDA 3IS9B 1YQHA 3C14A 1HBMA 3MECA 1VBKA 1EP4B 3CDUA 3BQ2A 5EN1A 5GAEU 3IS9A 2NREA 3OBIA 1VK3A 1TMJA 3MFHA 1RU2A 2D3UA 1EP4A 2DK2A 3LH2S 2ATLA 2F9DA 1B0PA 4WWSA 3PW0A 4IUFA 2MEWA 1NSPA 4OYMA 1S76D 4NCBA 5D4NA 4ILMA 4LR9A 4UUXA 4MKVA 1G1XA 4JV5F 2HYIB 1KOHA 4DV7F 1HARA 1Z2ZA 2RKIB 1UCNA 1VS3A 3FSXA 1OYDA 5DRKA 3PEJA 1IM4A 2IFXA 3BO4A 5DQGA 4AUKA 4K4YA 3I5AA 4C8YA 2RKIA 1U7LA 3O5TB 3THVA 1FWLA 4ZPDA 3M7VA 2LXFA 2HRYA 3BJYA 1T9VA 2YNGB 1S9GA 1VJQA 3EWGA 5CAAA 3THPA 5GAGU 1IJEB 1T7PA 2OPRB 5K8OA 1UVIA 4HHJA 3QZ8A 5HROB 1YIJS 1S77D 1BWVA 4TY8A 5EGYA 1RT5B 2E9RX 3RW6A 1NK6A 3AODA 1W2BR 3IAM9 2KTQA 2BKOA 4PEOA 3C3LA 1OY9A 5HROA 1Y5IB 3J81j 3A3PB 4USJC 4ES3A 5IWAJ 1BQMA 3O2IA 1E6VA 2CVEA 2XY6A 1HI8A 2CZ4A 3H25A 1NH7A 2WBMA 3GCXP 2Y1JA 1SJ4P 3I0SB 2HBZB 4ZITA 3ZNUA 2FVCA 2P6SA 2YQ3A 4TU9A 2YWWA 4FXVA 2B4OA 2R7QA 3HHLD 2N3OA 3H4DA 1YITS 3I0SA 1S1TA 2K7JA 1HYSB 1M5OC 1OQ3A 3C2PA 3LGNA 1SXLA 3S8SA 1HBNB 2IYIA 1QVGR 2N7CA 1HYSA 3BR9A 3BZQA 4LFCJ 3HZGA 3PYDA 1CJKA 4QYZK 5H9FK 3LTOA 3OTBA 1I6JA 3R5JB 4RW7A 4DL7A 1FE4A 2J9CA 2H5EA 3T9NA 3DM2A 1U1PA 2V8GA 4K4WA 3M6VA 3UCGA 1F3VA 4K5SA 1J2VA 4DQPA 4OX6A 3MMCA 2NSCA 3I56S 4GKKF 2HWHA 2FHJA 2H3EB 3PYEA 2MQQA 2IRYA 4LFAJ 2QJ3A 1GEHA 2VD3A 4BLGA 1NEEA 1WSRA 4RPFA 4Q0BA 4F3OA 5HSPA 5E7OB 1S6QA 2HMIA 2AEFA 2QT7A 5KG5A 1UVJA 4ECTA 3I82A 3SSSA 5KOXA 3AB2B 4LF8J 2Y0SD 1VRUA 3VCDA 2RH3A 2U1AA 2H9ZA 2XG8A 2PE8A 4QIEA 4QIWD 1U8WA 3TUIC 2W8LA 2QA1A 1OWXA 1H74A 2FVRA 5KFQA 4ZVHA 4IR1A 9RUBA 3CVKA 4ZS6A 5JVGQ 4M63A 2VPZB 2GQCA 3OFHA 3T1YF 2F4FA 2YX7A 2W9AA 3VWSA 4WTYA 1I1GA 1YJTA 2CJYB 5M2PA 2GJ2A 2VPWB 4U7UK 4HVZA 5M2UA 1S6PA 3K7RA 1Y10A 2KFYA 4KHMA 2VODA 3MR6A 4JYAJ 1ELOA 3OVBA 4K4VA 5KT5A 1N34F 3BREA 1AYEA 4QIGA 4Y28C 4YOEA 5BR8J 3SDEB 4OYOA 2VU5A 2CWXA 1N48A 3VVUA 1FA0A 3CO0P 3I4HX 1ZAWA 2OP5A 2QX0A 2GQ2A 3I9ZA 4DR2J 1SH2A 2RHSB 2QA2A 3QGPA 4QR0A 3L7PA 3QBCA 3J7AN 1WHYA 1YTYA 1JLGA 2EXUA 1WG1A 2W24A 1Q7LB 2HHPA 4JV2A 2VJVA 1PC4A 2MZTA 4EZ6A 1EJ7L 5L39A 2MJUA 2A1BA 1S79A 3HZEA 3BPSP 1WKJA 2NZCA 3PFOA 3FSYA 2AF6A 2MKYA 3C15B 2UVUA 1ZA2B 1SI9A 1U1MA 3LGMA 4DPTA 5A8WB 1UWBB 5HL7Q 2MZQA 5IV3A 3OUYB 4C3LA 3DLLQ 4DCJB 4Q8FA 3B6BA 4DR4J 1Q5VA 2R8HA 3KG1A 5C7PA 5B7WA 1T8EA 4B9LA 4LSNA 1Q81T 2XYPB 2E7VA 1NCLA 4P7TA 4RUHA 3OUYA 5MLCV 2G4BA 8RUCA 2EG1A 3V6HA 2FJAB 1RT7B 3TVYA 2BOPA 2GHPA
chains in the Genus database with same CATH topology
1RT6B 3RRHA 2K2PA 2VKRA 2XLKA 1R8HA 2UV8A 3W2VB 1ZM9A 3MAQA 2GHWA 4LVNP 4ETXA 1X4FA 1HBUB 1CG2A 5LSRA 1X8DA 5LJ3Y 5IXUA 1FKOB 4KC5A 2XI2A 3QWUA 2FJVA 2CPDA 3VAIA 2QE5A 1RT7A 4NLUA 4K4TA 4I64A 3AQOA 5DDQC 5D78A 1M0SA 1XEZA 4I1TA 3O8WA 2B56A 2HG4A 1N6QA 3N79A 2UXDF 3M2VB 4DR7F 1HWKA 2C3OA 2J0SD 4QJVA 4ATNA 4WZMA 2IVMA 2NR0A 3M9NB 1Y5NB 4JI0F 1FTCA 4H4KC 5E3PA 1D9AA 4PWDB 1JJHA 4OHXA 3D1QA 2MXYA 2DISA 2PSZA 1JLCB 1OSDA 4PQUB 3JSMB 3LP1B 3ICLA 2AYGA 3KJVA 4PG4A 4EYIB 1FNOA 2DO4A 2J7WA 2NPFA 1YSJA 5K8PA 4OZ1A 3DXSX 2CPFA 4C97A 3R5AA 1WF0A 4MKBA 4RLEA 3KLHB 4K4XA 4LQ3A 1NAQA 1XBWA 4F2RA 2MKSA 3QJPA 2FHJD 4DL2A 1EETA 4QBUA 4IG0B 2HVIA 5KFVA 2XHWA 2YWKA 5DETA 1NKBA 4RU2A 3RRKA 3ISZA 2K3IA 1Y00A 4LF7F 2PC6A 3JAMY 3O6QA 2B9WA 2QLXA 2D9OA 4I2PA 1MNEA 3QGIA 4KE5A 4CO2A 4R25A 5E3QA 3CCZA 1LK5A 2HNZA 1VOMA 2IBOA 1ZOTA 4H4MA 3UE2A 4HI2A 4ED8A 2XMUA 2IAJB 1KNZA 5CYQB 2Z2LA 1FRJA 3QAEA 5I42B 2JC0A 2JVRA 3PXGa 4NXMF 1DBDA 5IM0A 2VC1A 3FZBA 4PPDA 4QYRA 1OIAA 5CYMA 3RRGA 4JI3F 2FUG9 3M4XA 4DR6F 4CZCA 2CJQA 3OSPA 2MMYA 4A4JA 4ZKAA 2RIJA 1O5JA 4QW8A 2XY5A 3RAXA 1RISA 3B4DA 2NXUA 3IC1A 4KKOB 2YNFA 3MI7X 1Y0HA 2AJ4A 1K73T 4MKAA 2EPIA 1L3VA 4ZMMA 2B3TB 3CD0A 4OZJA 3HK2A 3N6NA 2JH3A 4B3OB 1WELA 3LF0A 2AYEA 1KFDA 3OL6A 3OLBA 3W3SA 2ZC4A 2PDAA 3SFUA 2AWZA 2VASA 2BR0A 2CQDA 3DGPA 2QFJA 2MZJA 3WBZA 1QE1B 3M1VA 4I6AA 4C8KA 4ECVA 2BQUA 2OO4A 1TKXA 4JUZA 1G2EA 1VMBA 1YVFA 2DGUA 2CQBA 4Y3CA 4V19X 3QZ7A 2P5VA 3MM7B 1U45A 2AX0A 3OVAA 2WK4A 3ZZYA 2JL9A 4O4RA 4B02A 1XMQF 4CCHA 4JI7F 2F1FA 1JLAB 4LT6A 5T41A 2G13A 4YHHF 3C6TB 4ZLPA 4J9LA 3CF5Q 3DOKB 5J1EB 1RAJA 5KFSA 3DLGB 1S1UB 2C22A 2MPUA 2HNDA 3T6BA 1K1QA 1UMJA 2O66A 3HKWA 4DV3F 1WHWA 1X9WA 4HH1A 1V3ZA 5KT3A 2YX4A 1KFSA 3NRBA 4FBTA 4RBVA 4A46A 3M8PB 2AYMA 1CVJA 1WG4A 1T02A 2YKOA 1H7XA 3KFWX 4N5SA 4YB6A 1S1WB 2BXJA 2UUWA 3C6TA 2XEXA 3LANA 2QRRA 4DV6F 1GNKA 1HI0P 2AV5A 4PPZA 3DOKA 1FEHA 4ECQA 1FDNA 1S1UA 2D7SA 1LW0B 4QWCA 1XR6A 1DARA 7FDRA 3HXMA 1TK8A 2YNGA 1UA0A 4ED5A 2D9PA 4OHVA 3PKYA 2KXFA 4KGMA 1TV6B 4WU2A 2M7SA 1UETA 2UVRA 3MR3A 4E0DA 1UEUA 2C2DA 3VZHA 3D0HE 4ZVEA 3KK3B 2WOMA 1D8YA 3K0JA 2GC8A 1I94F 1NK4A 2OPRA 5T14A 1VIXA 2OLWA 3M32B 4B3SF 1KQKA 4IH7A 1RP5A 3KYLA 2R2TA 4C8LA 4JV0A 4YUDA 4ED0A 1WEZA 3IO1A 2FB0A 4B17A 2ASLA 5DDPC 2UVWA 2XBPA 1RT5A 5J2NB 3K5OA 1YJUA 1FDAA 2R9LA 1KC8T 3HHLC 2E9TA 2MGZA 4NLTA 2NSBA 2AGQA 3S1TA 2OH2A 3CSKA 3I55S 4JI8F 3DRYA 3PW5A 1QY7A 5A0YB 5HO4A 3SQGA 5KFIA 3MZIA 4FPRA 3K8WA 1S97A 4JI4F 1UFWA 2EK1A 5KFPA 4DUZF 2ZH2A 3R1LA 5KFYA 2W9CA 4PXCA 2I0XA 4ECUA 3DU5A 4Y2CA 3KK2A 1U25A 3PIOQ 3ZZUA 1N5YB 3HP6A 2DBBA 4NOHA 4YR0A 1L3TA 3CTRA 3GIJA 2EFQA 4NLQA 4OI4A 1SQEA 4HI1A 4MK7A 5A0YA 1R0AB 1VC6A 2R2UA 1AXQA 3CCSS 5F8MA 1N5TA 1FNXH 4QWEA 4WJBA 1GX5A 3V4MA 2MSTA 2CPJA 2HGLA 2YNHA 3N5BA 5K5MA 1IKXB 2F9JA 3OSNA 5H9EJ 4BHQA 3Q2TC 2BE2B 5HMYA 3VAMA 2CQ2A 1M5PC 4OIXA 4AE5A 3FFIA 2V0NA 3IGVA 4Y2KA 2P6TA 2B9XA 4ZPCA 2VFVA 3IFEA 2PGCA 3Q8SB 1Q79A 4EGLA 3GYNA 2B4PA 5F8GA 1FESA 3B8HA 4KHPF 2B9YA 5KTQA 2KM8B 3JYTA 2FLNA 2L9NA 2BE2A 2YX1A 1C4CA 5L1KA 5HI7A 2NQPA 2LQBA 3BR8A 5KG3A 5LL6d 1U1RA 2DB1A 4F4XA 1KHVA 1C1CB 2KHDA 2E1CA 4DQQA 2JWNA 4N47A 4NA1A 4B9TA 1UVKA 2WAQD 3C6UB 3AA9A 3DLKB 2HGNA 2I5JA 1Y3JA 3PX0A 3T5JA 4B3TF 4C2MA 4DV0F 2CPIA 4RX6A 3PKMA 5J2PB 4KJIA 3GG0A 2I2YA 3HMJG 3HLUA 2PA8D 4CTAA 1FK9B 3M9OB 1HBNA 2JLEA 4KRWA 1RT2A 1ZZFA 2FC8A 5IS2A 2L41A 1YJNS 1Q7YT 3CIZA 1JJ4A 4AYBD 2Y1RI 4X2BA 5J1PA 3OPKA 4CT9A 5CHCB 2OIHA 5MAOA 5GAHU 1C4AA 3TR5A 3H4BA 2HQIA 2MJNA 3DLEB 1R8PA 3C6UA 4NLWA 3VAHA 3V6KA 4I4BA 2KRRA 3GG1A 3QLHB 1HWLA 2M0GB 2QSFA 3NBPA 2E7WA 4R0EA 2BDPA 3V81B 4M94A 2HZCA 4DF4A 2RB7A 3HFKA 4CO0A 4NL5A 1KEKA 1N5QA 1Q86T 1B64A 3VF0B 1N36F 3TAMA 1VQKS 1IBMF 1QAXA 1JLQB 3M6XA 1K9MT 2W7PA 1J5EF 2RRNA 1ZZNA 5A8RB 3Q8QB 1FRMA 4EZ9A 4LUBA 4C7QA 4Q44A 5DGAA 4WFYA 3JSRA 3NAIA 2WTFA 4RW4A 3E51A 3S01A 2RQKA 3FEXB 3ZZRA 5F9LA 4U67Q 2JDJA 5KOWA 3WZ0A 2JZ5A 3QWPA 3FDSA 4DFJA 4HTIA 4DFPA 5KFFA 2GNKA 2ZOFA 3B4MA 3RBDA 4IOBA 1VK8A 1HHSA 1Y7PA 2RT3A 3KTQA 2MZ1A 1LKZA 3E8OA 1HD0A 4ECWA 1RA6A 5B0FA 1ZPWX 2N4CA 4XK8C 3CD7A 2XNQA 3BSAA 3ISND 3GWCA 4BDPA 4WKYA 4RW9B 4Y00A 5G0RA 3I5BA 4GO7X 2ZD1B 2Z4PA 1CQNA 1GAOA 3M2UA 2C2RA 1HL6A 2HLTA 2ZNYA 2B5JB 4M5DB 3K2YA 1KRPA 3CXCR 2MKHA 3OJSA 1TK5A 1Q53A 2OMOA 4LQ9A 2K1RA 3BO2A 2ZJQQ 4ELVA 2O01C 4HT5A 1XTZA 1BGXT 2C3UA 2YWGA 4HH0A 5H1SV 4WXWA 1HPZB 2KO1A 2KKHA 3HHEA 4NRTA 2CFXA 2R2RA 4DSIA 3TANA 1FD8A 3I5CA 3U1LA 2OKQA 4G1PA 3J7YI 3N01A 4ZVGA 2HHXA 1HNIB 2MHEA 1RT4B 4C8ZA 1TL4A 4M5DA 2HHTA 2HHWA 4H4KA 4DV4F 2JLGA 5LMUF 3HDSA 2FPHX 1XMOF 4IH5A 5A8KB 4FZVA 4N41A 4NXNF 2JLFA 1SV5B 4J9KA 1YGYA 2CPHA 4OL8A 2K3KA 4JV1A 1Q1KA 2KZZA 2B4VA