3I55S

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i55S00
2I38A 4WFNQ 1A9NB 3UCUP 4RU2A 3THPA 3CCVS 4WFBQ 3H2VE 2BOPA 3U1MA 2MSTA 4F26A 2ZJPQ 2X1FA 4IO9Q 1OIAA 5HO4A 2DHSA 3MD1A 2LXIA 1U2FA 2F9DA 2RS8A 3TP2A 1WEZA 2KH9A 2V94A 1VQ4S 1U1QA 1UAWA 1X4AA 2M4MA 2YKAA 4W90B 1SJQA 5ITHA 2VOPA 1U6BA 2MQMA 2VODA 2MQNA 4OZ0A 4ED5A 3UE2A 2E5HA 1UFWA 1HL6A 1WG1A 2FHOB 2HGMA 2CPIA 2LECA 1BY9A 2MQLA 1M5OC 3K0JA 2CPDA 3VAHA 2MGZB 1FJCA 1VQPS 1Q86T 2LXUA 1IQTA 1NO8A 2RRAA 3J7ZT 5CA5A 3N9UC 2YTCA 1X4EA 2ADBA 2L41A 2DHAA 2U2FA 4OZ1A 1D9AA 2DNQA 1A7GE 4F02A 5IFMA 1M5PC 3DXBA 3RW7A 2DH8A 2HZCA 1ZZNA 1G2EA 3CCLS 4CH0S 2KT5A 3P5TL 4TLQA 1X4CA 5DDQC 4Y0FA 4TU9A 3S01A 4C7QA 4YOEA 2OJ3A 2XSFA 2DGTA 3EGZA 3L3CA 1VQ7S 4W92B 2ZJQQ 1H2VZ 1VQ9S 5JVGQ 3B4DA 2MPUA 4A8XA 4F25A 2RQ4A 1U1LA 2MQOA 2F3JA 5IQQA 1NJIT 3R27A 2DGUA 2DNKA 3G6ES 2DISA 2CQ0A 2D3OR 1WHVA 1H2UX 2MGZA 3CTRA 5MLCV 1YITS 4WIIA 2LCWA 2MQQA 3G96A 1X5SA 5EN1A 1M1KT 1FJ7A 2LA4A 4LJMA 4WCEQ 5LXYA 1WELA 1YHQS 2L9WA 3SXLA 3SMZA 2M2BA 2KXFA 3CC7S 3VF0B 2MKIA 3VALA 2X1BA 1Q7YT 1YJWS 1U1PA 2MKSA 2F9JA 2KFYA 1KOHA 3CULA 1SJFA 1QM9A 2RRBA 2NLWA 1X5OA 4PKDB 3CPWR 3TYTA 2KHCA 2EK6A 2DNPA 4FXWA 3THTA 2YH0A 4M5DB 2CQCA 1QVFR 2ERRA 3NNCA 5JVHQ 2OSRA 1WG4A 3P6YC 4UY8T 1XN9A 5GMKa 2KRRA 2KXNB 3CC2S 4ZKAA 1FNXH 1B7FA 1HA1A 3BO3A 3EX7B 1P27B 4PR6A 2MZ1A 2DGVA 1FXLA 2MKKA 4IOCQ 2N82B 2K3KA 1VBZA 3PIPQ 3ULHA 2J0QD 3CC4S 2E5IA 2MZTA 2M8HA 2GO9A 2KG0A 2RUGA 2EVZA 4EGLA 2JVOA 3LPYA 2AYMA 2MY7A 5CYJA 1WF0A 2X1GA 5D78A 5DDPC 2CQDA 3IRWP 2CQIA 1U6FA 5LSLA 1K8AT 1R8PA 5DDRC 2D9PA 2MKCA 3JB9k 1W2BR 4QPTA 3VAMA 2DGOA 3FEXB 1SJ3P 2KM8B 1VC6A 2M0GB 1U1RA 3MUTP 2JWNA 1WHXA 2DHGA 3VAJA 1NU4A 3MOJB 5LSOA 3CXCR 1X0FA 5GVQA 1M5KC 2RNEA 2PE8A 1JJ2R 3CF5Q 2OTLS 3I55S 2DO4A 1YI2S 4UQTA 1VQKS 4WF9Q 2KVIA 2MZSA 1N8RT 3G4SS 2K8GA 3IWNC 1X4DA 2QFJA 2RVJA 3VAIA 1VQ5S 3DLLQ 2KN4A 2AYBA 2Q79A 2CQ4A 3MI7X 2FC9A 5H1SV 2XS2A 1OO0B 2FC8A 5GAEU 1JMTA 3S6EA 4BS2A 1VC5A 2MZJA 2DGWA 2CPFA 2DNMA 2DHXA 4WKRA 3CD6S 1WI8A 4V19X 2KU7A 1KQSR 1KD1T 5DDOC 5LJ5Y 2LKZA 1WTBA 3P49B 3UD3P 1ZZFA 5LXRA 1HD1A 3VAFA 3HHNB 2DNZA 1SXLA 1ZH5A 1X5PA 1WF1A 3HI9A 5IM0B 2DNLA 5DM7Q 3NNAA 3BO4A 1U1NA 2A3JA 1X4HA 1VBXA 2KM8C 2EK1A 2XB2D 1X4GA 1OPIA 2U1AA 2N7CA 2VOOA 3G8TA 3NS5A 2OSQA 2DGXA 3UCGA 2E44A 2CPHA 3TO8A 3UWTA 1S72S 1CVJA 3J7YU 1F9FA 4U67Q 1YIJS 2HYIB 1URNA 2HGLA 1X4FA 3CCRS 3BEGB 2UP1A 1SJRA 3G71S 4P6QA 2DNOA 3CUNA 4YB1P 2CQ1A 2XNQA 4FXVA 2SXLA 1VQ8S 1VQNS 1VQOS 2WBRA 2DNGA 1WG5A 5GADU 2M7SA 2N3OA 2BZ2A 3H2UB 1WF2A 2MHNA 2DITA 5HL7Q 1M5VC 5GAHU 5IM0A 2XS5A 4IUFA 2DK2A 2KG1A 2MYFA 2HVZA 3LQVA 3ZZZA 4Z2XA 3S8SA 1SJ4P 3G9CA 2DNYA 2CQ3A 4PRFA 1RK8A 1QVGR 4Y00A 2JVRA 2MY8A 2B0GA 2LQ5A 2CPZA 3VAKA 2DIVA 4CH1A 4YUDA 1K9MT 5LJ3Y 2O3DA 2MQPA 2DNRA 3CMES 3Q2SC 1P1TA 1WI6A 2MJNA 1VC0A 3Q2TC 2MJUA 4LIRA 2DB1A 2J8AA 3CCQS 1FJEB 2E5GA 3CCMS 1YJ9S 3P3DA 2G1DA 3I56S 3R1LA 3NNHA 4QQBA 2CQ2A 2CPEA 2JRSA 3EGNA 1UW4A 1AUDA 2CJKA 4J5OA 2M52A 2KI2A 4C4WA 2KXHA 3SDEB 2ZJRQ 1RKJA 2RS2A 2ADCA 2KYXA 2OTJS 1K73T 2DNNA 2M9KA 2E5JA 1YTYA 2MKJA 1KC8T 2AYGA 1KOOA 1UP1A 5D77A 3MUVP 1VQLS 3US5A 4QU6A 2QEXS 4CIOA 1FO1A 2M88A 3MURP 2MXYA 3G8SA 2D9OA 5DETA 4WFAQ 3OW2R 1N54B 2FY1A 3CCUS 2GHPA 2QA4S 1OWXA 1X5TA 1N52B 2LEAA 3ZZYA 3UCZP 1U1KA 2MB0B 3UD4P 1DHMA 4TU7A 2DGQA 1HD0A 2DH7A 5DM6Q 1DZ5A 3PIOQ 3NMRA 3D2WA 2LYVA 2LMIA 2LEBA 3MXHP 1U1MA 2CQPA 1H6KX 2DO0A 2DGSA 2M8DB 3FEYB 2AYEA 5FJ4A 2CPXA 4ERDA 1DRZA 2MZQA 3B4MA 1YWXA 2YWKA 3MUMP 2MMYA 1WEXA 1VQ6S 3CCSS 1YJNS 2G4BA 3BO2A 1D8ZA 2YH1A 1WHWA 2M70A 3SDEA 2L08A 5GAGU 1X4BA 3MDFA 5BJRA 2CPYA 1R8HA 1WHYA 2CPJA 3NS6A 2NZ4A 4TU8A 3R1HA 1FT8A 2I2YA 2XNRA 2JX2A 4CQ1A 1S79A 1DBDA 1VBYA 2OIHA 1WWHA 2DIUA 2KRBA 2N3LA 3V4MA 3VAGA 2X1AA 1Q82T 4QU7A 2VONA 2DNHA 3CCES 1N88A 3S7RA 4C0OC 1PGZA 3CMAS 3MD3A 2RT3A 2CQGA 1H2TZ 2J0SD 1FHTA 2HGNA 2G0CA 2J76E 2FPHX 2DH9A 3BS9A 2XS7A 2MZRA 1JJ4A 1JJHA 4IOAQ 4LMZA 2LA6A 5CXTA 1U1OA 1O0PA 2CQBA 2RQCA 1M90T 1PO6A 1Q81T 2AD9A 1VQMS 3RW6A 3U1LA 1WEYA 2CQHA 2PEHA 2RU3A 2MKHA 2MSSA 1L3KA 3CCJS
chains in the Genus database with same CATH superfamily
3GJSB 2FQQB 1LWXA 1T9YA 3PRDA 3WC0A 1BXNA 3UVJA 4O3RA 2UVRA 4XDCA 1XMQF 5THWA 5H9EK 3AH6A 3IGNA 3DRPA 1UAWA 4LRFA 4GO7X 4YY3F 5D4LA 1U6BA 1FESA 1VISA 3AD7C 3T41A 2V8VA 3P45B 5HMYA 4WE1B 2JDJA 3P5BP 4NMXA 3VAHA 4YMEA 2QRRA 4USVA 4DSKA 2HNDA 1AZSA 1S1TB 5LOQA 2R8GA 1TMMA 3HVTA 3P5TL 4TLQA 1VHIA 4USUA 5DDQC 5D0HA 3BSOA 1S0NA 4W92B 1VJQA 4C0HA 3B4DA 3BGLA 4B9LA 3CIZA 1FRJA 3IBWA 4ES1A 2ZBCA 1IBKJ 1OMSA 2DISA 4J9OA 1B64A 3VR1A 4ZLJA 4MYTA 4LF5F 2LA4A 3WX4A 1YHQS 1YBAA 4HACB 3VF0B 1CJKA 4M8LA 3AQPA 3GFYA 1OJ4A 4K4SA 2QT7A 3M6VA 2IC3A 3LGNA 3THTA 4M5DB 2YWWA 4ID8A 2CWXA 2NZCA 3D6FB 3EZUA 1TVRA 1GFWB 4FYYB 4PR6A 2DRBA 2MZ1A 4TYBA 5KFEA 1IKYA 3J80Y 3GILA 1NRKA 2MZTA 3GFZA 4KC5A 3R5JB 1JNRB 4QIEA 3BV8A 1RWNB 1PJ6A 2R7SA 1IQZA 1W2BR 2LQ9A 4KGMA 1OY6A 4OV6A 5EWEA 2VG5B 1F3VA 2AKWB 3IXQA 2OTLS 1H98A 3VQSA 4ZA1A 2V4RA 3ZZ0A 3PM9A 3T5JA 5CCMA 1RU2A 4IOBA 2HWHA 4NLPA 3WX8A 1S1UB 1RWUA 1TKZA 4MH8A 1SH0A 4I64A 1YBTA 1U1NA 2A3JA 1T94A 1X4HA 1DY3A 2QL9B 3NS5A 3IM9A 2OSQA 4NLTA 1CVJA 3M8WA 3THVA 1PKUA 4LSNB 4ZJQA 4DR1F 3OQ2A 4BWJA 4PG8A 1NAQA 1VQ8S 2YXLA 1WG5A 2ZBIA 1N33J 3G82B 1WF2A 5KFSA 2PC6A 4IFVB 3RB4A 2B43A 4OI4A 1HBNA 1NSPA 2XEXA 3GZ7A 1C1BB 3OR2B 5C25B 1R0AA 4PUOB 1HLWA 4DR3J 2DIVA 5LJ3Y 4I68A 2QA1A 3C3LA 2MQPA 4DV6J 2XULA 3MAAB 2F65A 3CCQS 1HQ2A 1KVIA 4QWDA 4X64J 2ZEJA 4IDKB 3GV8B 5KFDA 3G2XA 2ZH3A 2CJXB 2VG6B 3UDLA 3MUVP 4RWXA 1L3SA 2UUBF 3LP1A 4ES2A 1SVDA 3JSMA 4Y34A 2AQ4A 1ZS6A 2ZH2A 1N52B 3UCZP 2DH7A 1DZ5A 3QIDA 1Q79A 2WW8A 2HBQB 1CSJA 2G2OA 5J2NA 1VRTB 3B4MA 3GR1A 2K1RB 3IC1A 4RW9B 5BYRA 3UNGC 1SQFA 4G1QA 4BLGA 1JXVA 3HVRA 4JYAJ 4K5SA 2QTWA 1VR6A 1PBAA 4TYAA 1V9OA 2XNRA 1LW2A 3TVZA 2BOAA 1S79A 1JX4A 4KO0B 2F4VF 3BN4A 3Q83A 1UEUA 3FMBA 2V8DA 3S7RA 4U8VA 4M5NA 2ZHAA 4NLGA 2B5JA 3M2VA 1D8YA 4RWWA 2BE2B 1JJ4A 5L39A 4OX8A 1U1OA 3Q8VA 1NBEB 1SKRA 2FHJA 1DLOA 1DTTA 2FLLA 4NRUA 1EKSA 4DV1J 2W4PA 2V4QA 1DJ0A 4M5KA 4GVBA 5EGYA 2FJBB 3DHWC 4O3NA 5KFTA 3DOLB 4OMFG 2KH9A 3T6JA 1UETA 4PXDA 1U1QA 3BGUA 2WHOA 3IS9A 4P73A 3KLEB 3PHTA 2KVQE 6AT1B 4ED5A 1SV5A 4CO5A 2HFSA 2Z2MA 2E9ZA 1XR5A 4LRAA 4I6AA 1RT2A 2CPIA 4M5JA 1HWUA 4OZLA 3TUPA 5AJ3F 2HNZB 2DXFA 3CEDA 1JLAB 2J9EA 3BPSP 3QATA 4ZP8A 1H7WA 2YQ1A 4QWCA 5IFMA 1M5PC 4IG0B 2DH8A 3ILJA 4ZVUB 4FBTA 1UMJA 1VBKA 4HTJA 2HBYB 4F4KA 1KR4A 6FD1A 1KTQA 1H2VZ 1VQ9S 4CH7A 5KG6A 1WC4A 1X0PA 1NJIT 1TL3B 3F0NA 3FSXA 2JFKA 1RAGB 5HP1A 4NLXA 4WPAA 3L7OA 1IJFB 3QJLA 3I0RB 5EN1A 3HT0A 3V6KA 1L3TA 4PQAA 5CD4A 2KXFA 1UA0A 2A6MA 2UUCF 3IR6B 2NSBA 2BBEA 1SJFA 1QM9A 1X5OA 1RT3A 3NCQA 1C4AA 3J81U 5HATA 3NBPB 4IRKA 1WG4A 4K50A 1XN9A 5GMKa 1S0VA 3W62A 1S6OA 1QUPA 4ZCKA 1HNXJ 3HSDA 3QZ7A 3W3SA 5HROB 3KHLA 5KFNA 5CAAA 3V81B 3KJNB 2J9DA 4UTGA 3V2UC 3LPYA 5CYJA 2X1GA 5IWAJ 4M95A 3L09A 4AXJA 4N7TA 3KK3B 1R8PA 3SSSA 2AJ4A 2BKOA 5ETQA 3SCKE 4PG5A 4FF3A 5KTQA 3OTCA 2V50A 3QRQA 3T5KA 1NM2A 1I6JA 1JJ2R 4LFBJ 3I55S 1VQ5S 2KFNA 1HYSB 4ECTA 1I94F 3MI7X 4DS4A 4QZVB 2CZVC 1NKEA 2RDIA 3RB0A 1WI8A 3OUYB 4UOHA 1IM6A 2LKZA 4ELTA 1MW7A 4FF2A 4WYWA 3ETOA 3WZ0A 3UQSA 1CC7A 4AFFA 1HW9A 3D6HB 4KHPJ 3QJJA 4J9PA 2BVZA 2K06A 3G6YA 5L8RC 1IKXB 3FCHA 1AUSL 3JQMA 2J7UA 3L9ZA 2V8PA 4DR6J 2CVIA 1VK3A 1WD6A 3H5SA 5D0GA 3T1HJ 3EXCX 1V3RA 3GCWP 2VG7B 1SC1B 4KGZB 1NK7A 5KG1A 3N79A 3DM2B 4I0WA 2W2QP 1YJUA 3QWUA 1VDHA 3NXZA 1NXIA 3DGPB 2R8HA 2AU0A 3K8VA 2EBEA 3DLJA 4YUDA 4DL5A 2DNRA 2MJNA 1M1GA 2HFVA 3ZO7A 3R5GA 3M6XA 4DX6A 3POTB 3CCMS 4D3GA 3SV4A 4LSZB 2O67A 4F0KA 5A8KA 2KI2A 1HBOB 4N77A 2M9KA 2ZVSA 1KLMA 1PILA 3EJMA 1B7YB 1HQEB 4NLDA 2EXUA 1ROFA 3OW2R 3OFGA 3E01A 5B0CA 2LEAA 3A8EA 3DNCA 5C5JA 5K14A 2HAFA 4K0KF 1TUGB 3H5YA 2CUYA 2UVWA 1KWMA 1YWXA 3MMCB 4RW6B 2OP5A 4WXWA 2BJ8A 3NWGA 4HHJA 2YPZA 1S76D 2UXBJ 2B7BB 3SQGB 2BE7D 4E8UA 2KRBA 2N3LA 5EDWA 2HK3A 3X1LB 3RJMB 4GMKA 3RGIA 3CDUA 1RCXB 1PGZA 1URRA 4DQIA 1NPKA 1HNWJ 1JB0C 4DUYF 3G6VA 2VICA 3K59A 3LP2A 1KKHA 1RGVA 1S1VB 1TV6A 2GHWA 4RR5A 1JJHA 3NEKA 3FFIA 2NYIA 1O0PA 2YKOA 3EDRB 2AD9A 4A4JA 3U1NA 4A8KA 2XY6A 1HNVA 3U02A 4L74A 2XB2D 2IA0A 3I31A 3CCVS 1CLFA 3BGRA 1ZM2A 3HJFA 3IM8A 1UWBB 2DYAA 2KJVA 2DVIA 1TKTB 3KMQA 1YZ6A 1VIXA 2RS8A 2RHQB 3QYYA 1WEZA 3KHGA 2OPPA 4X65F 1P8GA 4M5HA 1FFGB 1UZHA 2VFSA 2VODA 5A76A 2GVDB 1HL6A 3GLJA 4F04B 2HGMA 1R7IA 3DGVA 4FF4A 2RSQA 2VPXB 3WIVA 3DLHA 1LNQA 5L1KA 3MM5A 1GTHA 2BQRA 4HDGA 4RBUA 4EYHB 5E33A 4YB7A 1X4CA 3NAIA 2BJ3A 3CB4A 4QYZJ 3EGZA 4N56A 4GC6A 2MPUA 3RYLA 2AJQA 4NXNF 1RTJB 4LRCA 1KP6A 1U47A 4KTQA 1MROB 1Y7PA 2UUAJ 2C42A 1Q78A 1WHVA 1WUUA 5B0FA 1O5JA 1EQMA 2RDDA 2MGZA 1NKBA 3HHDA 1S4EA 5LXYA 4YR3A 1N5QA 3VGUA 1RWXB 1PAUB 2ZH5A 4EZ9A 2GAGC 2UV8G 4AL7A 1MWYA 2R8KA 5A6WA 3LH2S 3M2UB 2BQUA 3MTKA 4F36A 2CJBA 2KRRA 2P9GA 2GFFA 4IOCQ 1KFDA 2K3KA 2J0QD 2E5IA 3FSIA 5C42A 2ZH1A 2XMTA 3ELHA 3GU0A 1NCLA 3OLAA 2AP6A 1BQMB 2RILA 1ZBTA 4X4SA 3IRWP 4EEYA 3JB9k 2PT0A 4ATNA 2HNYA 1JLBA 2MLYA 2XHCA 3PX4A 3MOJB 2J8SA 5CHCB 4DFMA 2D74B 4JBCA 2CYYA 3UN2A 1S0MA 1APSA 3UDEA 1GK8A 5EWFA 4CT9A 1YI2S 4C8MA 3AD8C 4UQTA 1VQKS 2K8GA 2V9KA 2F63A 4E98A 2Q66A 4B9TA 4B08A 4X4OA 1HI0P 5AXMA 2VQEJ 1CJVA 1WTBA 3VAFA 2EI5A 3HLUA 5H9EJ 3K57A 1E6YB 3SCJE 2AZ3A 2DGXA 5FDLA 5KFMA 2UP1A 2PFFB 4X4QA 3HSGA 4YB1P 1S6UA 2GQ2A 2V2QA 4H4OB 2VFVA 1Y9OA 1RHRB 1BQNB 3MR2A 5KG2A 5F0UA 3GSIA 2YKMA 4DZ6A 5LMUF 3M6UA 5HL7Q 4WTYA 3MM7A 4Z2XA 3A1YG 2E1PA 3W7BA 2AMCB 3D3CJ 3MEGB 2WVBA 2LQ5A 2KZMA 3MMBB 4Q44A 2W7PA 1J5EF 5IT4A 8RUCA 2EG2A 3LPEA 1U25A 1K0VA 4Y65A 4QQBA 3W61A 4C4WA 3HKZD 4RO0A 2OTJS 3ONQA 4QIWD 4N41A 4EWTA 1KC8T 2KYZA 1NZ8A 1ITPA 1S9EB 3B82A 4EBEA 5DQIA 3MFHA 4YR0A 3LAMA 3AA8A 1T9WA 3PR4A 1XNQF 3PO5A 1UVMA 2JNJA 1DHMA 4DSEA 3UD4P 5H9FK 3DMJA 4OJGA 3EVWA 4NYZA 3Q86A 2Y1IA 1CC8A 4OZ5A 1DQAA 3MUMP 3MM8A 1VQ6S 3TA2A 2PO4A 3FUYA 2HVHA 3SDEA 5GAGU 3OTOJ 3MDFA 3OHBA 2CPJA 3ZTQA 3D1QA 1KEKA 4FVCA 3E8OA 4F4XA 3JXOA 1YZ7A 4DU7A 2HS4A 3IBFB 4J91A 3AAWB 1WACA 3M8QA 4GKKF 1UA1A 2ASDA 3DRSA 4A47A 2AW0A 3RG6A 1AFIA 3HK2A 3MPUB 3MAHA 2V8GA 3OVAA 3RB6A 4FKYA 2RMLA 1U0HA 1CEZA 4GVLA 3M7VA 4RW4B 2XS7A 3B54A 4RNMA 3EUNA 4TN2A 3R2DJ 5C7PA 2HVIA 2RQCA 2KT2A 1S6QA 4ZVSB 1VQMS 4ECRA 1FE4A 1N34J 4PQUA 3MR3A 4B3TJ 4Q7AA 1LW0B 1A9NB 3W9IA 2XCAA 1RHJB 3U1MA 2PD1A 1OIAA 5FD1A 4JV5F 2RHSB 2AEMA 4O4GB 2B56A 2FY8A 1RWWB 4KSEB 1VQ4S 3W2VA 3EXYA 1W26A 4KE5A 1W25A 1RABB 2X3DA 1ZAXA 2KKHA 3C14A 1M5OC 2N7YA 2OEMA 5BXIA 1XC9A 3CD0A 5DG8A 1NJZA 4DU8A 3FCVA 3QAEA 1NUEA 1SUQB 1G1XA 1RTHB 4DWIA 2HHQA 1JLQA 3MM9B 2ZH4A 2ZH6A 4UQGA 3MHYA 5I3PA 3CMQA 1SL1A 1FK9B 1IR1A 2BJ9A 2VASA 2CJQA 2ASJA 1F5CA 5F9LA 4LFCF 2Q3PA 5G0RB 4ZJOA 2MLXA 1WOPA 4YN3B 4BWMA 2DHHA 3SMZA 1FDAA 2MKIA 2FVPA 2CVEA 3V6DA 2P5VA 4TQSA 1RZMA 4Y2AA 2KZZA 1PBUA 2X3GA 2RF2A 2YH0A 1FNMA 3NNCA 1TMJA 3KG0A 3EPIA 5DZ6A 2HZVA 4ZKAA 5KG7A 2ZHOA 4B17A 4ZVFA 2I5JA 4EUVA 5KT3A 1XERA 2DBBA 5JJBA 5L46A 1UKUA 2MY7A 2XMWA 5KT5A 4YHHF 4HT7A 4ZPCA 2Z2ZA 1YRXA 1ZAVA 2MKCA 1XMQJ 1NDLA 3MUTP 1S0OA 4F50A 1LKZA 2K7JA 4ZLLA 1L5UA 3Q8PB 5A0YA 4F0MA 4YEAA 5DS7A 4YY3J 3BPDA 2AYBA 2Q79A 3FNNA 2FC8A 4BS2A 1M5HA 3NCRA 2AGOA 1B4SA 2XYGB 4LF7F 1IUJA 3OXFA 1WC5A 5KT7A 4NLSA 3IG1A 1FRXA 3ZZPA 4CLSA 3RBZA 3HHNB 3G87A 3ZZTA 1XMOF 1WF1A 4DI6A 1C2PA 1RA6A 4LRDA 4ECUA 4LR8A 1VGYA 1HW8A 3KHHA 4KV8B 2HZAA 3JAMU 4ELVA 1ZOTA 4IR9A 3MPYA 3PR5B 4KKOA 1SJRA 3VQTA 4ED2A 3DXSX 4RW8B 4LF5J 1FRLA 1FKOB 5I3UB 2LFVA 2HS0A 2ROGA 1NJXA 2XTJP 4OJ3A 4TXSA 1UJ4A 2QL7B 4QWEA 4F4YA 2OAUA 1FTCA 2W2MP 4NLOA 3FBFA 2YWFA 4HT5A 4U8YA 5E3RA 1IKWA 5KOWA 1HMVA 2PA3A 2VB6A 1JLCA 1KQKA 3M05A 2RAQA 2CDQA 4DG1A 4DCPB 4J5OA 1LWFA 4EO6A 3OXGA 2ADCA 3MPDA 4USJC 2DNNA 1Q1KA 1UP1A 2EFGA 2EFVA 4EBDA 3TVYA 4M5GA 5A8RA 1RWOB 3HJVA 2ZVIA 4DR7F 5DETA 1EB0A 2ZD1B 1G4CA 1HHSA 1HBMA 3K5PA 4J7CA 3NMRA 1CS4A 1KHWA 3CVKA 4UOFA 3GIMA 1U1MA 4KFBA 3CJ2A 4IG3B 1RT1A 1RHKB 7FDRA 3H42A 3TZWA 3MWBA 1XIQA 1RKIA 1RCOB 3DLKA 1MWQA 3M32A 2QLWA 5GAHI 5A8WB 1SL0A 5D3GB 2VONA 1KFSA 2NS1B 3ZTPA 1FNOA 4DR1J 1TK5A 1RYRA 4OJ1A 2H3EB 2CQGA 1LWCA 4O44A 2HW3A 4ECQA 3OTDA 3BS9A 2VBZA 3W5XA 3C15B 4DL2A 1EP4A 3LGHA 2BDPA 2BE9B 2C2OB 3NGKA 3OL9A 3T1YF 4MYUA 4KT0C 3KUGA 1WEYA 4DQQA 5L1LA 4LF9F 2B9YA 4ZPDA 4CO3A 1JQGA 3BGFA 4DR3F 3B6BA 1Q5VA 1T3NA 2KTQA 4G6VB 3KUEA 1TL1B 5B0GA 3D1OA 2OPRB 1HQUA 2F9DA 2HFZA 4CP5A 4PWDA 1W2IA 3AOBA 1EKRA 3LANA 2CNLB 2AX0A 3UI3A 3PYFA 2Z58B 2UUBJ 2KL8A 2GHVC 1FJCA 1VQPS 1IQTA 3KOAA 2B4UA 3PW4A 2EC2A 1U02A 1OY9A 3J7Z5 3DLGB 2YTCA 2IYGA 1VYAA 2OEJA 4O3PA 1RE1B 5CABA 3GG1A 1HNIA 5EX0A 1TFYA 2GA7A 2WSEC 2NYHA 4TU9A 3GQCA 2V5HG 1VI7A 4JYAF 3A3OB 1U1LA 2LVWA 2FIUA 1LWEB 1ULRA 2E7WA 2YKQA 4NYOA 3KMSA 5HVFA 2YWGA 1MU2B 3W8GA 2BW7A 2IRUA 1OY8A 4NCAA 2CRLA 1YLXA 2WTFA 2BA9A 2J0WA 5JVHQ 2D3UA 4RL1A 1AT1B 5LMNF 2IBKA 4ZP7A 1CJUB 3HDSA 3GFXA 4N76A 3KLGB 2H5IB 2KG0A 2XY7A 2E9RX 3BH7B 2HLUA 5D78A 2IJNA 5K8OA 2HVDA 2FHMA 4LT6A 1RT4B 4DQSA 4OYZA 2YNFA 2RH3A 4DSIA 3T19A 2Z56B 4ZLPA 2QFJA 2DJWA 2DCUB 3S6EA 2DGWA 1N56A 5AJ3J 4MIWA 2DHXA 2EC0A 3ET6B 4ZITA 2QLXA 1EX8A 3P8BB 1NHVA 2PA8D 2W2PP 3F56A 3H8YA 2CNNB 3EVMA 3AJ2A 2I9SA 1PAEX 1FWLA 1HD1A 3ITHB 2DNZA 2H5EA 1FDNA 3V4IA 3BO4A 4ILLA 3K5OA 1V5VA 1UPMB 3CJ8A 3D0IE 2QLJB 1QSLA 3G8TA 1K47A 4ZIVA 5E3CA 4M5MA 3J7YU 2FLNA 2ATCB 1GQEA 2OPSA 4QPXA 2HWIA 5F0WA 2SXLA 2C2DA 3VGVA 2IA6A 3IWXA 2BZ2A 3HVWA 3B8HA 4XPEA 1BWEA 2VPYB 2QX0A 3FQLA 4LF1A 4NRTA 1HWLA 2N4DA 2UUCJ 4KGXB 1DTQB 4URGA 1S1XB 1GXUA 1O8BA 5AT1B 5HBMA 4B02A 5KFFA 4CLKA 4CH1A 2KDOA 1AA1B 2AJFE 3MMAB 3AFGA 3MEEA 5ETLA 4MIAA 1IM4A 3TA0A 1V3SA 5F8NA 3RRHA 4DQRA 4NASA 3I56S 4C0BA 1KTVA 2M52A 2OI2A 2L3MA 1VQYA 2Y8WA 5I4MA 2R9LA 3G8QA 4QWBA 2AYGA 5M2UA 3R8YA 2FB0A 3BBCA 3BZQA 2V63A 5J2QB 2YKNB 4MFBB 1D3WA 7FD1A 3CCUS 1OWXA 1FXDA 1F6TA 1I94J 3HHLD 4A8QA 2AT1B 4CO2A 3PNIA 1S6PA 3RR8A 2OPQA 3RRGA 1FFWB 5C24B 3K7RA 1R8HA 3GB0A 3PXGa 1T05A 1S1WB 5GADI 4JI8F 4CNYA 1V6HA 2HRUA 3UNYA 3HHLA 2DIUA 1HBUA 1Q0NA 2X1AA 4JP8A 1R6VA 3T1HF 3UVJB 2HFNA 1FD2A 3OR1A 1LFWA 5ETVA 4WZMA 4DEZA 2KJWA 3DRPB 1D09B 3HD1A 1WNEA 4LREA 2R8JA 1C0UB 3GV7B 2J6SA 4DDFA 4DUTA 2Q6CA 3QRPA 4P2XA 1U8WA 4J9NA 3CDAA 4WFXA 3R97A 3QAUA 3VZIA 2HNDB 1AZSB 2XWXA 3G82A 4FPIA 4CTAA 3HVTB 4ILMA 1H73A 3F41A 3I9ZA 5ETKA 3LAKA 1NB2A 4L3KA 3RU0A 4FYXB 5CD4H 1UFWA 4P10A 1Q8LA 3QRRA 3D67A 1JLFA 2J6TA 4RBTA 1RWMB 2RRAA 4KBIA 1BUXA 3TRGA 1RTZA 1CJKB 2YNHA 4K0KJ 3WIUA 3TZZA 4FDFA 2IC3B 4IQXA 4U9RA 4D3HA 2AV5A 2E1RA 1H74A 5JVGQ 1TVRB 4EMDA 4IRCA 3GG0A 3BGOP 4DHVA 1IKYB 2GMLA 2GQCA 4HR2A 4FS1A 5MLCV 2MQQA 4LJMA 4J9MA 2Z2LA 5H9FJ 4RW9A 1U1PA 4X84A 4DUYJ 1R0BG 2VF3A 2CAJA 4MAKA 3TYTA 2AGPA 2KHCA 2I1RA 3RUBL 2JLGA 2OSRA 4UY8T 5F8MA 3FBEA 1YG0A 4DJBA 3BO3A 4ECWA 1FXLA 1FJGF 3NGTA 3OLBA 1HPZA 2Z30B 1VIOA 2ZKUA 1UJ5A 4TY8A 3C6UA 4EGLA 2W4CA 3R6LB 5DDPC 5K20B 3FQKA 3PY8A 1CPZA 1FRHA 3VAMA 1TKZB 1TP7A 4F2RA 1PYTA 2JWNA 3PEHA 2RKIB 2NPIA 4X65J 1BWVA 1NJYA 1RHQB 3VV2B 2HHUA 4AL5A 4ALZA 2MZSA 1TL7A 3MF5A 2WOMA 2CPFA 2LDYA 3W8PA 3CD6S 5J1EB 4V19X 2QE5A 3D54A 3LUYA 4AT1B 5IXUA 2RU9A 5KG0A 1S49A 1EQ0A 2W9AA 3CDWA 3PYGA 1SXLA 3IRXA 1HBNB 3NNAA 3KLFA 1GMUA 2R7XA 5J2PB 4NA2A 2MEWA 1PG5B 4OX9F 1PCAA 2XO6A 1R0AB 4NXNJ 1T02A 2OLWA 5KT2A 2HYIB 5HMWA 1JLAA 2I6WA 3I96A 4JI1F 5KFBA 1HKAA 2XNQA 1YJTA 3C6TA 4PG4A 2IRXA 1VQNS 5D6GA 1VQOS 1LEOA 1FD8A 3H5UA 4NCBA 1LV5A 3AQOA 4PCQA 5I3QA 2RE1A 3M6WA 4HHUA 2A10A 3QLHA 2PGCA 3K58A 2P8IA 3GJQB 5GAHU 3C16A 3PHEA 4O0NA 2P9CA 3LQVA 1FKPA 3LP1B 4PRFA 2VL1A 2FZCB 4CI0B 3JSMB 2Z4PA 1RSCA 4RNOA 5JMNA 1NKCA 5A6PA 3HHEA 5J2NB 4A8YA 2CJYB 2CA9A 2NUUG 2W8LA 2CQ2A 7AT1B 1SPBP 4G1QB 5HLFA 3NWRA 3KK1A 3QGGA 5E2QA 1IN0A 2EW9A 1LW2B 2APOA 4CIOA 1RAJA 4USWA 3EGWB 3IP0A 4O4RA 1D0EA 3ZZYA 2DGQA 3MPVA 2CJAA 5K5MA 3MXHP 1QE1A 2B5JB 3M2VB 1QDUB 1NPPA 1RT5A 2R7OA 1DQ9A 2JL9A 1D9DA 2OEKA 1C0TA 1GAOA 4Q5VA 4X66F 1RAHB 1DLOB 1DTTB 5ETMA 2P9EA 1HNZF 1FT8A 3I4HX 4WWSA 4A46A 4P7TA 4F4AA 3H7HB 2GNKA 4IH5A 2OIHA 2ZBRA 4GVBB 4F4WA 4ZHRA 4PPDA 2Q6BA 3H90A 3QMQA 2V69A 4OJHA 2HQCA 1EHWA 4JV0A 3C19A 2J0SD 2HGNA 4ZVGA 1MN9A 5K8MA 2V4JA 1T0TV 3M8PA 2MZRA 3IS9B 5DQHA 4OHXA 3DDKA 4M1KA 1D9FA 1SV5B 5LMUJ 1DQ8A 2C2NA 1RT2B 1QY7A 1KQFB 5B0AA 3ISND 4ED4A 2ZH8A 1L3KA 4OYOA 2XLIA 2X51A 4P74A 3OJUA 2BOPA 4M5LA 3GYGA 5D0EA 2QG9B 4NLQA 5L9XA 3CWJA 1J5EJ 3A12A 2OFHX 1IBLF 2R7TA 1N0UA 3DOKA 4LFAF 3QGHA 4N5SA 3TP2A 2V94A 1R8CA 1QTMA 3ZTRA 3D6MB 3GJTB 3D6TB 4W90B 3VCDA 2DKOB 2VOPA 3K2YA 1FE0A 2LECA 2GVZB 5HP1B 3IAM9 3A8KA 4JV1A 1XNQJ 1U7LA 4CLTA 5HSPA 2FZKB 4X4RA 2O66A 3N9UC 4K2JA 3BQ0A 2DHAA 2U2FA 4P75A 3ADAC 4F02A 2QZ8A 4ZCIA 1C1CA 1RT3B 4LBPA 5CYQA 3D0HE 3UR3C 4Q43A 4F25A 1N5SA 1YSJA 1F9EB 2YQ3A 2FJAB 1T7PA 1TR0A 4O23A 2V6AA 2CQ0A 1W7WA 1H2UX 3JSRA 4UZCA 4XTTA 3OHAA 4NEZA 4QW9A 1ELOA 3DRRA 2L9WA 3NGSA 4GKKJ 3VALA 1VLOA 4PYAA 2XMVA 1OQ3A 1L3UA 2MKSA 4A8MP 2AGQA 1NMEB 2H65B 4PKDB 3ZZOA 2DNPA 1T9UA 2VH7A 2IYIA 2JC1A 4DBQA 3I0SA 2MKKA 2VJVA 1SKWA 2BRLA 1QAIA 1H72C 1UVLA 1SC6A 1SB6A 3TW0A 3LF0A 2CQIA 5F8JA 4QYZK 1SH2A 4CZCA 1NEEA 3VAJA 1XR7A 4B3SJ 1CULA 4YB5A 2RDJA 2ZDPA 2BABA 4K4WA 4X4UA 4FNIA 2QA4G 2KVIA 3PW2A 2CQ4A 1MWZA 5H1SV 3T9NA 1N48A 5KFGA 1TTHB 3SFGA 5J1NA 2Y1JA 2V9WA 2JEJA 3DYAA 5DG9A 4FN5A 4UUWA 4I2QA 5EX3A 1OPIA 1J5OA 3UR0A 2W4DA 4N8NA 4JI3F 1URNA 4LFCJ 3M9OB 5KFXA 3G71S 4DV7F 5E41A 4X4NA 3UO0A 3C2PA 4ECYA 1FFSB 2H4YB 1U6ZA 2VDIA 5GADU 5A8KB 2N3OA 5J2MA 5RUBA 2L48A 4J9VA 2BMBA 3K5LA 2DITA 1KLMB 3AODA 1KONA 1Q16B 4GRSA 5IM0A 3Q8QB 1NK4A 2LEPA 4RNNA 1RK8A 3QQCD 1TU0B 2PMWA 3BM7A 3MAQA 5CZXA 3E01B 4MK9A 2F8EX 4FYWB 3EM1A 4LBIA 2O3DA 5K14B 1P1TA 1FF2A 4LIRA 1JK9B 1T9XA 3R1LA 4YHHJ 3BF4A 4O3SA 1RKJA 4WKYA 1A6LA 4IO1A 2FDNA 3DLEA 2XLJA 1BC6A 2QEXS 5HQLA 3HFKA 4P2SA 2FY1A 4J9KA 4GO5X 2WCXA 4OI0A 3PIOQ 2LYVA 4ILRA 3GTYX 5FJ4A 1IWGA 4LF7J 5T14A 2H48B 4NL5A 4MKVA 2MMYA 3SSQA 3MZIA 1TV6B 1N6QA 1DURA 1N32F 3FFIB 1JLGA 1XMOJ 3TI0A 4B9SA 1WKJA 3ILOA 2VZ9A 3D68A 1VBYA 3BGRB 2DPIA 4NZ0A 3H4DA 3NLCA 4EZ6A 2OGUA 3CMAS 2CG8A 2UZAA 2D7SA 4I69A 5U47A 2OPPB 2FPHX 2DH9A 4WU2A 3GPAA 3LWMA 3DOMA 2XMJA 1KQGB 3D0GE 4U7UK 3RW6A 1OYDA 1AW0A 2GX8A 1DARA 1Q8IA 2DEJA 1NK6A 4TY9A 2MKHA 2A2CA 1CQNA 2PMZD 2K7KA 4ZDNA 4DV5F 4I6YA 2BUNA 3MM5B 3I9V9 5CYMA 1B70B 2BANA 1H0HB 2ALYB 1NPRA 3JSYA 1KVJA 4UT4A 1RWKB 3PFEA 3J80U 2MQNA 1XWLA 1N36F 1VRUA 2MQLA 4HH0A 5IS2A 2D3ZA 3MECA 2MGZB 3ZZUA 4DR7J 4I1TA 2ADBA 2YWEA 3OVBA 3E51A 2IFXA 5E5NA 3PJXA 4H4KC 1ZZNA 2KT5A 3N0VA 1LK5A 4K4UA 3A13A 4DFJA 1D1UA 4RU9A 1PYOB 3G6ES 4C98A 2IVFB 3VZHA 4DV0F 5C42B 2QN6B 1YITS 2C3PA 1FJ7A 3FRYA 2IBOA 4B3OA 4FPRA 4ED3A 2HNYB 1JLBB 2R3VA 3QGIA 2NLWA 2IAJA 4B9NA 1UPPA 2CQCA 1PC4A 1E6VA 2ZOFA 2XG8A 4DUZF 1WC3A 3T1YJ 2D69A 2AHOB 2KXNB 3KHRA 1FNXH 3I5AA 1PYSB 2ZHBA 1RTDA 1VBZA 2L9NA 4LF9J 3N5BA 3PW7A 1MNEA 3M8ZA 5HQ8A 1CJVB 3ILLA 1RYSA 4RW7A 4K59A 4G1IA 1SH3A 1I5OB 3W63A 2D1CA 4OFZA 3DKDA 1UL3A 3TARA 2B4PA 2DR9A 2IDEA 3M2RA 1HIYA 5FDLB 2DD8S 5JUMA 2XGPA 2XBPA 2KN4A 3DLLQ 2FC9A 2XS2A 4Q2MA 4OYBA 4J9RA 1R89A 4WKRA 1FWKA 3CW2C 4DSLA 5LJ5Y 1TELA 2HQFA 3HXMA 2KFZA 1QUVA 4MK7A 3A4TA 1Y11A 2YKMB 1Z2ZA 3FBBA 3MM7B 3NGRA 3UCGA 2YNGA 1Q8BA 5HJXA 2FHJD 4NZ6A 2ZE2A 4P52A 2FVQA 1Y3JA 4ECZA 5BYQA 3NGUA 4OYWA 2BEFA 4OV1A 3W64A 2WB4A 2HS3A 3ZXWA 3HFVA 4DR5F 1SIZA 2L9DA 5LSRA 4OYPA 3VAKA 2XYHB 1XMBA 5LMNJ 3DMJB 2O1PA 2KB2A 2NXUA 1N0VC 2DB1A 1REVA 2J8AA 3OPKA 5KFJA 4LIWA 2W2NP 3MM8B 2JRSA 1AUDA 3OFEA 1RB0A 3RBDA 3SDEB 2ZJRQ 4Q8FA 2NXNA 4TVAB 4OZJA 2LQ8A 3RTVA 1FO1A 2E29A 1N5TA 4NPOA 3K5MA 1HD0A 4NI2A 2J0XA 4CLZA 4MKYA 4XO0A 1ZYQA 3M8QB 4OI1A 3FDSA 4L73A 3DRSB 4ZVRB 2LEBA 4NZ7A 1OSDA 4R5PA 1BE4A 1U0HB 1MMNA 4O0IA 4C97A 4USMA 1HHTP 5IC4B 2L08A 1VQSA 1UVJA 1S6QB 4AL6A 1T9VA 2R7RA 1R31A 4TU8A 4PQUB 1VLYA 2G0JA 1ZA1B 3Q8SB 5BYSA 1WWHA 3JYTA 3OSPA 4QU7A 2ZBQA 3CCES 1S5ZA 2WSFC 3I5BA 5IOLA 4LUBA 2ZOMA 4B3RF 3QZ8A 1H2TZ 2HKEA 3I6PA 3W2VB 5KFZA 1BHNA 3P4UB 2MKYA 3LP0A 3AB4B 3C14B 2BX6A 4FKXA 1RBOB 2Y8YA 2VDHA 4XIUA 2QO3A 4NEYA 1LQ9A 4USIA 3AB2B 4L75A 1SBRA 4PG7A 3MD1A 2QFIA 2HRTA 3FMWA 1JLQB 4O3OA 5LM7E 3U7JA 3QO9A 4J90A 2VJUA 3OTBA 2YKAA 1IR0A 1U2CA 5ITHA 3ICLA 4ETZA 1VS3A 2JOQA 2ZNZA 4DL6A 1NSAA 2JFDA 3PKYA 4J9UE 3PDNA 1NK5A 2FTRA 2XO7A 4OZ1A 3H40A 4HHHA 3V6DB 1LXNA 4I67A 1U8SA 2RF2B 2Z8QA 4F3OA 3L3CA 4S0MA 2RJZA 4A8FA 3LGMA 2I5JB 1V3ZA 3DU6A 2WVDA 2Z57B 4JI8J 3IR5B 2HWTA 4ZN3A 2HK2A 1X5SA 4M63A 2LLZA 1S12A 4MKAA 2NXEA 2R7WA 2HHHF 1TKXA 4AQYF 1Z1ZA 1WDTA 3C46A 4CLPA 2RRBA 5A0YB 3LWLA 3BSNA 4DN0A 4DV2F 2XGQA 3MFIA 2PIIA 1GT8A 3CC2S 1GX6A 1X9SA 3Q89A 5CQGA 5T7LA 1U4BA 5HANA 2FVSA 2PN6A 3SQOP 4PYDA 2Q43A 3IG1B 4IR1A 3CD5A 5DDRC 2JEIA 1SJ3P 5DO2A 3CJKA 5IV4A 3WBZA 2M5YA 1BGXT 3QNWB 3KTQA 3R2CJ 1M5KC 3IBCB 1R8AA 1XNRF 2QSFA 4KKOB 2MQ8A 3ISZA 1UEVA 5BR8F 2QSWA 3HM9A 4H4KA 2E5LF 4F2SA 3W9HA 4ZVPB 5ETSA 3ENVA 5DDOC 2H1YA 2F5GA 3HX9A 2LU2A 4OI3A 2NUHA 3HI9A 5I42A 5DLFA 2XSJA 2QJ3A 3RAXA 4WTOB 4ICLA 5G4DA 2CNOB 3CCTA 3NKYA 1X60A 1ZM4A 1KLNA 1IKWB 1HMVB 3CUNA 1ZTWA 1JLCB 2CQ1A 2BYCA 3TAMA 1ACMB 2WBRA 4DG1B 1PJ7A 2P6TA 2DR5A 1LWFB 3CDEA 4OYXA 3D66A 3CJQA 4WIQA 3CT9A 4DR2F 3CO0P 5LT5A 2DK2A 2HVZA 4DFKA 3G9CA 5A8RB 3BBBA 1QVGR 2E7VA 2JVRA 1KS2A 3KLHA 4OLOA 2HURA 2FJXA 3RAQA 2XYPB 1HBMB 3BYRA 1FJGJ 1CS4B 1Q8KA 3AA9A 1B99A 4KFBB 4JI5F 3CE8A 4DV4F 4Q2LA 3KXDA 1RT1B 2UVUA 1UW4A 3DI6A 4KRWA 3I32A 1F1BB 4C11A 4ED6A 4LR9A 3FZBA 4OZNA 3H2LA 3DLKB 4ZVTB 1NSQA 1S9FA 2AJ1A 4R8UB 5HMXA 2R7UA 3UPFA 3M32B 4KH1B 1EARA 5B0DA 3D2WA 3CD7A 1H6KX 2FZGB 2CPXA 3MR5A 1HI1A 1DRZA 2R7VA 1S77D 1TK8A 3CJ4A 2ALZA 1EP4B 1UTAA 2WZ1A 3W66A 1P6TA 2GJ2A 2XZTB 4HEA9 2AEJA 2DXDA 1NDCA 1CJTA 5IT9Y 4OX9J 4HKQA 3V4MA 2RIJA 4CRJA 5K9FA 2FLPA 4JI1J 3HULA 1HQUB 1U49A 3KLIA 5IT9U 4MMOA 4PWDB 4RKUC 2WW4A 3MEDA 3AJ1A 2IY5B 3OT9A 1M90T 1PO6A 1FI4A 4K4YA 2PEHA 2ZUGA 4A8SA 5CH7B 3ZZRA 1JXEA 4PZVA 2CFXA 3NCPA 1RT7A 2R8IA 1HNIB 1Z2LA 3KJQB 2XZDB 3PX6A 4ZVEA 4AUKA 2IJFA 2FJDB 3MPWA 2OH2A 2M4MA 4QYRA 2MQMA 4JI7F 1XK8A 1RHMB 3GJRB 2K3IA 3R6GB 4DV3F 2ZM6F 4C48A 5D0RA 1GMVA 4HYKA 3R5BA 2GC8A 2P6SA 4RUHA 1G2EA 1EAYC 3GWCA 2W25A 1J2VA 1U09A 1IKVA 4Y0FA 1EETA 2DGTA 2C3OA 2C2RA 2A1BA 1Q53A 4X66J 3ENWA 3ZTSA 3R27A 1HNZJ 5IC6B 2QIFA 3EVOA 6FDRA 3FKBA 3CJ3A 1WELA 3Q8YA 3TX8A 1HWKA 3LW5C 4ZP9A 1IWAA 1ZAWA 1KOHA 3QFHA 1UVIA 4ECXA 4FXWA 2YNFB 1S4FA 4EO8A 2V67A 3QSIA 2VV5A 2A18A 3HHKA 2JC0A 2WAQD 4OHVA 3EX7B 2GGPA 2DGVA 3LO3A 2W8KA 1O6XA 1RUSA 1YRTA 3DC2A 2ZBPA 3CC4S 4DSJA 4FNHA 2EVZA 2JVOA 1JWWA 5DG7A 2QA2A 4YDXA 4QIVA 4QW8A 4MT1A 4LF8F 3BKFA 1IBLJ 4LFAJ 3WC2A 3V4IB 2KM8B 1C0UA 3PACA 4R0EA 2FGOA 4I7FA 2R2RA 2PE8A 2MLZA 4QIFA 4WF9Q 3O5TB 4NLVA 1N5VA 2OPSB 2VU5A 3SCIE 3UDVA 3QIPA 4ID5A 3GP9A 4OIXA 1KD1T 3P49B 3M8YA 5LXRA 4DLGA 1X9WA 1UZDA 3AD9C 3TZXA 2M3DA 4U7UD 3T5HA 5HBMB 1X4GA 2VOOA 4IYQA 2IRYA 2YPYA 3ILIA 1S72S 1F9FA 1YIJS 3CCRS 1X4FA 4G3IA 2PMHA 4LR7A 3MEEB 2V2ZA 2LP4A 4YR2A 4LF4F 2GAHC 2QLBB 4CYUA 2DXEA 3FCWA 2W9BA 4ZVHA 3CO9A 2GS8A 1FRIA 1R8BA 5KG4A 3WDOA 3I4PA 3FC9A 3V6JA 3QT5A 2CADA 1M5VC 3KYLA 2MYFA 2HQGA 4DL0C 4J9QA 3DU5A 3M30A 3TUZC 2BV3A 1NB7A 2WONA 2CPZA 3K89A 4G65A 4IQMA 2F1FA 3CCZA 1KBRA 3A8IA 1K44A 5DGBA 2MJUA 4OQJA 3PW5A 4WP3A 4I2PA 2G1DA 4DSFA 3D7SB 4NWBA 2CPEA 1S6PB 4X2BA 2N4CA 2OPQB 2KYXA 2V8HA 2V2VA 1IBMF 3ZNJ1 3O44A 2O01C 4HDHA 1T05B 4B3SF 2WRMA 3BKTA 3MURP 1NK8A 3HHLB 3OD2A 1YBUA 1HBUB 1T8EA 3OR1B 2VQFF 4FS2A 4ERDA 4ANEA 2MZQA 2YNIA 4DX8H 3BSAA 2E1CA 3UFCX 3QBCA 1T3OA 4JOUA 2OD4A 3BB5A 1FEHA 2RKIA 2G4BA 2C3UA 4CM0A 2ZNYA 2M70A 3D28A 2HHXA 2VC0A 4DFPA 2K2PA 3WHIA 1FRMA 1NH8A 2OMOA 3MMJA 1KSPA 3Q0AA 3HD2A 5J1EA 4JI3J 3BR8A 4DV7J 3MD3A 4CTAB 5EHHA 4JI6F 1L3VA 4JB8B 2ZKTA 1JKHA 1JJCB 3IFEA 4AE5A 3T1AA 4ITSA 3ETMA 2H4WB 1V5IB 4LMZA 5J2PA 5FLXY 5KG3A 4PPZA 4Z7YA 2IHR1 4ECSA 5DRKA 1UFKA 4PABA 3CCJS 1REGX 2BM1A 3HCXA 1JLFB 4Z7CA 5FIIA 3UCUP 3PJWA 3THPA 4NOHA 2G0IA 4B3MF 1RAFB 1NK0A 4F26A 5FLXU 3OJSA 4KPCA 4NA3A 1Q4RA 2YNHB 3AOCA 4CM2A 1RBAA 3M1VA 4EYIB 2DHSA 2EFOA 2R2UA 1C4CA 4H4MA 2IM0A 1Y5NB 1EZZB 4CCHA 2BXJA 2VFUA 4DPOA 2E5HA 1S9GA 4R0JA 3GFHA 3GONA 1HARA 5F41A 2CPDA 1VK8A 3IMQJ 1YX2A 3SCLE 1FERA 1Z4UA 4RLEA 5F9NA 3J7ZT 1IVZA 2HFUA 3PRVA 5CA5A 3KLVA 3GE9A 5KFYA 3CCLS 4CH0S 4OI2A 2IVMA 3TQEA 4WXOA 3KJVA 2W9CA 1N32J 2DT9A 1Y00A 2ZJQQ 5E7OB 5DQGA 2R42A 3KWMA 4JV2A 1OSCA 3Q22A 2ZH7A 1FCAA 3EPGA 2OKQA 1HPZB 3R5AA 3CTRA 4TY8B 4IRDA 3C6UB 9RUBA 4IH7A 4B9VA 1RTIA 3EZOA 2GIQA 3J7AN 2GV1A 4B9MA 2X1BA 4UUXA 5KFOA 1YJWS 4C2MA 4WJBA 4CLYA 3JTPA 4NCGA 2R2TA 1YQHA 5HVHA 4WU3A 2XMKA 5ETTA 1WORA 4IFYA 3P6YC 2G2ZA 5F3ZA 3K8WA 1B7FA 1TL7B 1P27B 4DPYA 2YY3A 2OO4A 2QYCA 2WOMB 3ULHA 3W5YA 3TUJC 4CDIA 2RUGA 2YKPA 1GEHA 1UFLA 4F3QA 3IO1A 4DV5J 3LALA 3EZ5A 1M5SA 5HMZA 3IRXB 3FEXB 3KLFB 3QPIA 1WHXA 4YQWA 3VTIA 5LSOA 4CLUA 1K0TA 2FJVA 3OV7A 5GAGI 3GIJA 2X7IA 2LQBA 3MOZA 1N36J 3N6MA 1QLNA 2DY9A 2MZJA 3NOGA 2Y1LB 2QMXA 1QD1A 3C6TB 2ILZA 2GIFA 2VA2A 1TL5A 1TKDA 2CWKA 2UXDF 1J27A 2QC3A 5KAKA 4Q0BA 5AXNA 3QLHB 1S59A 3NGDA 1X5PA 3C16B 5DM7Q 3MM6A 4QCLA 1FKPB 1IBCB 2ZFHA 2CZ4A 4RNFA 3CJ5A 3G86A 3T3FA 2CXEA 2GVZA 2BJ1A 2B3TB 3UWTA 3J81Y 4L6V3 4U67Q 3SZ2A 2G9OA 4DV0J 2HQDA 4Y6IA 4P6QA 3QGPA 4LBHA 3CIMA 3AXKA 4ZK7M 1VHFA 2DNGA 4W4MA 2M7SA 1GNKA 2O5DA 4F0HA 3H2UB 5HLFB 2HHWA 3KK1B 4ZCLA 5L1JA 1AYEA 3VHQA 2AIRB 4LF6F 3IN5A 2UXCF 1JLEA 4XDDA 2RD5C 4DUZJ 2IM1A 1N5YA 4P71A 2CIMA 4Y2IA 4GKJF 2QMUB 2HBZB 3R7SB 1HWIA 1QE1B 3FZ2A 3NNHA 3BJYA 4KB7A 3DHXA 2FYXA 5B08A 1RT5B 5HAOA 4ZVQB 1WKLA 5GAEI 2KXHA 4WZQA 1C0TB 2RS2A 4OL8A 5D77A 2EFQA 4OHWA 4OHYA 2EKNA 3MCMA 2QV6A 4P9SA 2PI4A 3CDBA 4TU7A 4ZHRB 4RUCA 1YGYA 2LMIA 3TUIC 4QJVA 3KFWX 2JEGA 2UU9F 4QR0A 2H9ZA 2V4JB 5AXLA 3M8PB 4NLRA 3CCSS 4ANCA 4USKA 2HHSA 1WHYA 3R1HA 2W1BA 2JX2A 1RAIB 5F8LA 4QWAA 3DFEA 1QAYA 2B6AA 2NXJA 2BJ7A 3VAGA 4I4BA 4K4TA 2AF6A 3DOKB 2E1MC 2HIYA 4EU0A 1RT6A 4F3MA 3UW1A 3L7PA 2NR0A 2XLKA 1F2HA 3I82A 1Q81T 1T03A 4EBCA 3U1LA 1KHVA 4PAAA 4DR5J 3JQJA 3ZTOA 5CZVA 1U48A 4PG6A 1TK0A 2WVFA 2DPJA 4UOCA 1SIWB 4J9LA 3SYZA 2HFOA 4MJKA 4LSLA 3W2WA 2PEBA 1C1CB 1P9YA 4WP8A 3KK2A 2V0NA 2FJWA 3AT1B 4G1PA 1X4AA 4FXDA 2XI2A 2VA3A 5CYQB 4C3MA 2OUGA 1QAJA 2AWZA 1NSKL 3R5DA 4URQU 2IM3A 4RUBA 1X8DA 4ZP6A 3K0JA 3V6HA 1QSSA 4ZOSA 2HVEA 4C3LA 1H38A 2LXUA 3TVKA 1VMBA 3DRRB 1F5AA 3NY0A 3DXBA 2HG4A 2HZCA 3PVXA 3FBCA 5HVGA 3UDCA 1CBKA 4CLLA 3S01A 1GX5A 4KR0B 2OJ3A 3J7A1 5A2QY 2ZOGA 2EWHA 2RQMA 4H54A 4WE1A 3I0SB 3GIIA 2F3JA 5IQQA 1I1GA 4C6AA 4UF4A 4DPXA 2FD2A 1ZPVA 4OX7A 4KGVB 3N28A 3BBFA 5A2QU 2B9EA 3SXLA 4DXLA 4YB6A 3WQPA 4UW2A 5HN0A 3SI8A 4B3RJ 1S1TA 2J9CA 4ZPWR 2OD6A 2EK6A 3DDNA 3JS9A 1CULB 4RBVA 4DMZA 5KFRA 1HA1A 2B9XA 4KY3A 3PIPQ 2M8HA 3FEZA 2HMIB 3NL0A 4K7QA 2CG4A 5E3QA 4HACA 1FEEA 2JHEA 3DYAB 2D9PA 2VC1A 5SUHA 1P1LA 4ELUA 1NU4A 3DRYA 3I5CA 4I2QB 4M5DA 2F4FA 2XMUA 1SL2A 1G7CB 3CNQP 2ZC4A 1FVQA 3W5ZA 1J5OB 4Y2KA 3DDIA 1CQMA 1N8RT 4YS2A 5KFPA 1X4DA 4OHZA 3KDOA 4WBFA 3EGVA 1KQSR 4C9DA 5J2MB 3FRZA 3TX0A 3FGVA 2A0FB 2GMJA 1ZH5A 4ZPVR 3X3UA 1RXOB 5IM0B 1NDPA 2VG5A 2ZZMA 3QJPA 3KG4A 4U7CA 2LXFA 1QTNB 3HKWA 3IA0A 1TZ0A 2PSZA 2HHTA 2HQIA 2CJ9A 4OLPA 2R7QA 4DR4F 1S1UA 3TEHB 1RDRA 2HHHJ 2QL5B 4AQYJ 2C3YA 4DCJB 3DLEB 1SKSA 3S8SA 4ED7A 2AJ2A 3TEGA 4DV2J 2GCFA 2HBRB 3HVAA 4C8KA 5T41A 5KFKA 2MDAA 4KH0B 4LSNA 3CMES 3Q2SC 3HSJA 2H54B 1YJ9S 5AE1A 5C2GA 1YRUA 4AYBD 3TJ9A 2LU1A 1N6QB 1XQIA 1F2GA 1FWPA 4DPUA 4IFVA 2E5JA 1JLGB 2MKJA 4BBYA 5EUHA 2YVSA 5CCLA 1GH8A 1RISA 1C1BA 1VQLS 4NLWA 3SV3A 4JI0F 3OR2A 5KT4A 5C25A 2M88A 4PUOA 1U1KA 1X5TA 2MB0B 2HEKA 1XNRJ 4F8RA 2XM3A 2HSEB 1S57A 5BR8J 3MAAA 2E5LJ 2DO0A 2DGSA 3FEYB 2NCKL 1RQ0A 2YWKA 3TR5A 4DL3A 4TLRA 3BQ1A 1H3DA 4IDKA 4V1Ak 4J37A 1WEXA 3HO1A 3DOMB 3QT8A 1WHWA 1BQXA 2DR6A 1NHKL 3AJDA 3OL8A 2VG6A 4ZS6A 2I2YA 2F8HA 1JIHA 2XMAA 3H20A 5B7WA 3HSZA 3CJRA 1B0PA 3HMJG 2ZUAA 4CO1A 1A0OB 5M2PA 5CYMB 2BANB 2RT3A 2GQQA 1VRTA 3BDPA 4ED0A 2A2DA 4ZIWA 2K1RA 3EE3A 1VRQC 1UEKA 2CQBA 4LQ9A 3C8YA 4LRBA 4DR2J 1P9QC 1VRUB 1XTZA 2B4VA 2MSSA 2CPYA 2V68A 1MSWD 3MECB 1CG2A 3KKFA 2POKA 2ZDOA 5KFQA 3H2VE 4KO0A 3PEJA 2UVVA 2ZJPQ 2NSCA 3L95X 4JI5J 1U2FA 2CZ9A 1M0SA 4DV4J 2J6UA 1TFWA 2BE2A 2BW2A 2ZZNA 2VUGA 4F4ZA 1UCNA 1EIYB 4Y3CA 1BY9A 3OL6A 2YX4A 4JI4F 2ROPA 3CJSA 1QAXA 1X4EA 4B3OB 3O6QA 3J7YI 3TZYA 1WDDA 2DNQA 1A7GE 2GJIA 4ZVOB 3AHPA 3DOLA 1Y5LB 3RB3A 4NMLA 5D4OA 5IZHA 2IAJB 4N8OA 1HR0F 2C3MA 4NXMF 2HAIA 1E6VB 3KLEA 4C8OA 4A8XA 4K4ZA 2DNKA 1RTDB 2D3OR 2GMHA 3PKMA 2HNZA 3G96A 2NPFA 2BM0A 3BSCA 3OBIA 4RW7B 3IGVA 2Q1LA 4LVNP 3L7UA 3NG8A 4ECVA 1OQ6A 2F9JA 4IG0A 3GSDA 1F5BA 1Y10A 2HHVA 3H59A 1QVFR 4FF1A 4DLEA 4DPTA 1SCJB 4CLFA 3M2RB 2MHEA 4Q8EA 2VBYA 2HHPA 1TL3A 4I56A 2OFGX 2C22A 4EFAC 1PSDA 3I0RA 3Q23A 4RZRA 3FJ2A 1SC3B 4UOGA 1WTFA 3OSNA 1NK9A 3M8RA 4N47A 1FXRA 3M9NB 4L76A 2ASLA 1BLUA 1U1RA 5D15A 3BYPA 2JLEA 2YX7A 3CXCR 2UUTA 1X0FA 3NBPA 4JI7J 2YNGB 5KFWA 1ZM3A 1FTRA 2RVJA 5DZ7A 5HROA 1OO0B 5GAEU 1JMTA 4TNOA 3V81A 4DV3J 2ZE2B 4X62F 2ZM6J 2KU7A 3H4BA 1XR6A 2EFPA 2ZC3A 4NYPA 1B0TA 5HQMA 3KK3A 2JH3A 4ENOA 3EWGA 1OS5A 4ZCMA 2DTJA 1S48A 2F7VA 2KT3A 1I51B 3BKUA 4HI2A 3E3XA 2KM8C 2N7CA 2U1AA 1AROP 4BDPA 2E44A 3TO8A 2ZWOA 2IM2A 5E0OA 1HYSA 1BMQB 3M9MB 2MTLA 1REVB 4JI2F 4FXVA 1VFJA 3OUYA 1R27B 1WC0A 3H98A 1LK7A 2MHNA 4NLUA 4BC7A 1IJEB 5B09A 2QGFB 3W9JA 4ZLNA 4P7VA 2XCPA 1IKXA 2B8QA 1AB8A 4NI2B 3KG1A 3KNGA 5GMDA 2XQCA 3FVYA 1GXLA 4DPWA 4DX7A 2E5GA 4R5PB 4WK1A 3R7NB 2VG7A 4KPYA 2CJKA 2RRNA 3DM2A 4LF8J 2ZWPA 4U6PA 3M8SA 1Q5YA 5J1PA 2W7OA 4PEOA 2H5JB 2JEFA 1NNDA 3DGPA 4QU6A 3QT6A 4FYDA 2PFDA 2D9OA 4WFAQ 1F60B 2QA4S 1VOMA 1T95A 3JYTB 2ACMA 3O3LA 5DM6Q 3VVUA 3JAMY 3HZGA 4FYVB 3POTA 2IIHA 2IVYA 3Q8RB 4Z37A 2CKWA 1RJJA 3BO2A 2YH1A 2KO1A 1U26A 1HBOA 3HT3A 3NRBA 5HK4A 5BJRA 1SI9A 2W2OP 1DFDA 3LP0B 3O2IA 1IBKF 1HQEA 2E7XA 2RQKA 4CQ1A 2CDRB 2XC9A 5F3TA 4X4PA 3HHLC 2BRKA 1YVFA 5KG5A 2DY1A 4C0OC 4B9UA 3GCXP 1NHUA 3KDNA 2B51A 4LF4J 3GIRA 4PWWA 3MMCA 3QO9B 4OZ3A 2OELA 4QIGA 4RW6A 3T9ZA 3C66A 4IOAQ 2IJRA 3H25A 4ZMMA 3OVSA 1FDBA 3H0PA 1KRPA 1Y5IB 3SQGA 3MTJA 4WFBQ 1S7IA 5IV3A 4KGKA 3PTWA 4TKTA 4QR1A 4RUAA 2HQ3A 2LXIA 3RRKA 2B7CB 1S1VA 4KAIA 1SJQA 2HLTA 1IBMJ 3W1YC 5F8IA 4OZ0A 5ETOA 2ZITA 1U24A 3D3BJ 3TAQA 2VBWA 1RU1A 4EI2A 2BJEA 2DEIA 2GZOA 1NO8A 2NXCA 1UWBA 2BR0A 2L41A 3A8JA 1TKTA 1TKXB 2VQFJ 2IMWP 3W60A 1RP5A 2F40A 1K1SA 1R0CB 5KFLA 4C7QA 1MLAA 4R8UA 4DZDA 2ZH9A 2GVDA 1LXJA 1RLDA 1XBWA 2EBGA 3O8WA 4OYIA 5T7LB 4WIIA 3BQ2A 2LCWA 3VGSA 1EJ7L 4WCEQ 2G1HA 1N33F 5ETPA 1HFEL 1DAXA 3AOAA 4JI6J 3F44A 2KFYA 4MTPA 3CULA 3CJKB 4DL4A 3CPWR 3NMAA 3HZEA 1X31C 4NLYA 5D4PA 4IKAA 4K2XA 1B3TA 1Q95G 3R5CA 1M1HA 4A48A 2C2EA 2VKZG 4USTA 4WYLA 1RTJA 2LQJA 4L3NA 2JSXA 1MROA 4DV6F 3GIKA 5F8HA 4FVMA 2Y1RI 2GO9A 4X64F 2AJ0A 4B3MJ 2AYMA 1ZETA 4OZ2A 1RADB 3EYZA 2FLOA 1WC1A 2CQDA 3PCOB 1UJ6A 4CLWA 1VC6A 2M0GB 5I42B 3UN3A 2XSJB 3M2UA 4HVZA 5GVQA 2BQ3A 1YKWA 4ICLB 1UVKA 3RZAA 4OX6A 3GYXB 3TAPA 2ROEA 3TAMB 1UWAA 4K4VA 4KHMA 1G6BA 1BQMA 3T6BA 5C2CA 1ZZFA 2XMMA 1OYEA 2DRDA 3LP2B 2W7AA 2VBXA 2OMLA 5KT6A 2FVRA 2EK1A 2ILYA 3OFFA 2V2KA 4A8WA 4NX9A 3FSYA 3KLHB 4RPFA 2FVCA 1HNVB 3SEOA 2XY5A 2F4VJ 2I0XA 2DNOA 2J5AA 3MR7A 4BC9A 4WFZA 4F67A 3DI6B 4C11B 3D9BA 2W24A 1ICEB 2J7WA 2KG1A 3NAHA 1SJ4P 2DNYA 4DV1F 4HL9A 1E6YA 1RLCL 4ZN1A 4CO0A 2B0GA 1Y0HA 3LOUA 3KNAA 1WKKA 1VC0A 3Q2TC 1FJEB 1I3OB 3FK4A 4AXIA 2WBMA 3ZNUA 3D5MA 1X7VA 4H4OA 1RAAB 4KIAA 1BQNA 1TUVA 4A8OA 1K73T 1YTYA 1T9TA 2IDLA 2Y3YA 2C28A 3CJ0A 1JNZB 5D4NA 2B4OA 1CJTB 2HPUA 3MEGA 2GHPA 1R43A 3PFOA 3AY0A 2Z0GA 3MMBA 1N4LA 1S10A 2W01A 2CQPA 4URSA 3MCOA 4UZBA 5KFHA 3HP6A 3KLIB 3T5LA 1YK9A 4HTIA 2UXDJ 3K5NA 1SJ1A 3R9LA 3MEDB 3OFHA 5B0BA 2Y0SD 4XK8C 1S9EA 3S1TA 3PW0A 4U95A 1B0VA 2UUWA 1R3NA 4CNZA 5AE2A 4P72A 1FA0A 3N5FA 1RT7B 3NS7B 2FUG9 3W65A 1SQGA 2ACYA 3RR7A 1FHTA 2J76E 2NQPA 3AXMA 5AXKA 5L9NA 3TANA 3CCWA 2V34A 1WSRA 2P2CB 5B0EA 2LA6A 4JUZA 4TQRA 5L38A 1YJRA 4CT8A 1HNXF 2DR7A 9ATCB 4LF6J 2UXCJ 2I38A 4WFNQ 1TL4A 1Y3KA 4DN9A 4K5RA 4GKJJ 3IAS9 2MSTA 2YBVA 2ATLA 5IWAF 1YJ7A 4IO9Q 4QR2A 5HO4A 1F0XA 4ETXA 4RW4A 1IKVB 1EETB 3LTOA 2WSCC 4C8ZA 4ZJLA 2PDAA 4LFBF 2VIHA 3UE2A 1RHUB 3ISNC 2FHOB 4XPCA 1LW0A 1Q86T 4EK2A 4YDDB 3MCSA 4QOTA 4DX5A 1U45A 4O4GA 3RW7A 4J9SA 3MGJA 2UU9J 4KHPF 4YOEA 3TA1A 2G13A 4AD6A 3EICA 3DRXA 1RA7A 3HF5A 2RQ4A 2MQOA 1O51A 2GGPB 2JZ5A 3N01A 2YQ0A 4DR6F 3R7BB 4PXBA 3MR6A 3LA0A 4WFYA 1KVKA 1M1KT 4P2FA 3CC7S 1RWPB 1SUQA 1Q7YT 1RTHA 1AXQA 5E3AA 3MM9A 1HI8A 5LL6d 2ERRA 3BR9A 4I7FB 1FK9A 2JJ4D 2R4FA 3DCAA 3QSYB 3PYDA 1R6YA 3VWSA 4HLBA 5G0RA 2A6OA 1NZAA 4FP9A 3QIPB 4ID5B 4ANDA 3EMTA 4Y2MA 4PXEA 4YP3A 1MMDA 1TAUA 5LSLA 2FGCA 1Y4ZB 3BDEA 3R3TA 5ETRA 2BKPA 2Y9HA 5EWGA 1H7XA 3PO4A 2WB1D 2H51B 2VFTA 1PJ5A 1NDKA 2BACA 3G4SS 3O1LA 3VAIA 1VC5A 2DNMA 3JTNA 1WOOA 3JTOA 4C8LA 1K1QA 4CYUB 3TQ1A 2XZWA 3B78A 3GR0A 2W9BB 4ER8A 2GIRA 3G6XA 3ZC4A 2AX1A 3UD3P 3CSKA 1HWJA 3ENAA 1YDLA 5SZTA 2UXBF 4CWBA 3M30B 1UW9A 2WONB 1GTEA 4ES3A 4OYMA 3OXLA 3N4WA 2EPIA 2BKNA 2XI3A 1F9HA 1SQEA 5L1IA 1HNWF 1LFPA 1MN7A 4I2PB 1Q7LB 4P2MA 2FHKA 5KFAA 1VCTA 3VGTA 4IUFA 4USHA 4M5IA 2IPOB 2CQ3A 1AFJA 3N6LA 5KFIA 4KV8A 2MY8A 4BHQA 3BH6B 1K9MT 4Y2CA 1KN6A 2RUSA 2QYGA 2YNIB 3JQKA 2BJDA 3GMGA 4L72B 4RW8A 3BREA 5DGAA 1FKOA 5I3UA 4HH1A 5AE3A 5K8PA 3RBEA 3I87A 2PI5A 1ZPWX 4NE9C 1MG7A 2ABYA 1KOOA 3US5A 3D1HA 1ZTTA 2MXYA 3G8SA 1NJWA 3H5XA 3Q24A 1GMWD 4NA1A 2YX1A 4M94A 1PIEA 2XWYA 4K8RA 2E9TA 2M8DB 2I8EA 1RWVB 1JKHB 3HFZB 3CJTA 2HRYA 2NREA 4F7VA 2FJEB 3OL7A 4PXCA 4C8NA 2NZ4A 4LVOP 1GMWA 2UUAF 2E1AA 2ZD1A 1NH7A 1U2RA 2QMWA 5GMEA 1N88A 3M1VB 1LOUA 3SSRA 1FVSA 4Y28C 4IG3A 2G0CA 3PV8A 2C2ZB 4DR4J 4H4MB 1RBLA 3DLBA 4KJIA 1S9GB 1QJHA 4YFUA 1U0SA 4DF4A 3IWNC 2AEFA 4RU2A 2COLA 1S97A 3SIPB 1RAEB 5A8WA 5D3GA 2UV8A 4Q45A 2X1FA 4ED1A 4R25A 3QFWA 2GJFA 3KJVB 3C15A 4MK8A 4LQ3A 2W9CB 4DL7A 2D3O1 3OTEA 4C8YA 1WG1A 5HI7A 2VHGA 3KUHA 4JI0J 1ZM9A 4KQZA 1WOSA 2VQEF 4ZPAA 1RTIB 3IWLA 3K17A 5KOXA 1TL1A 2R2SA 1D9AA 2OPRA 4NCGB 5D8HB 2E66A 2XSFA 1YJVA 5E3PA 1VQ7S 1FRKA 3ZFVA 1JXLA 4IFYB 1BD6A 5MAOA 2B8PA 2DGUA 4KHRA 4RNHA 1MMLA 4BCAA 2OHDA 1VJWA 1TAQA 5IT0A 3TWZA 3PYEA 4CO4A 3DLGA 2M2BA 3A3PB 3P96A 4K4XA 2WK4A 3SFUA 2HIQA 5M2RA 2WVEA 1XJWB 4MIBA 3IR7B 4IH6A 2VPZB 2AZ1A 4UY85 3PZPA 1OPZA 1UVNA 2G2YA 3JSBA 1LWEA 2N82B 3QWPA 1FX2A 1ZA2B 1WJ9A 3GV5B 2XHWA 1TUWA 1MU2A 1WF0A 1RAOA 4E2FB 4FBUA 4Q0BB 1U6FA 3PG9A 1SC4B 5KFCA 1K8AT 1SKUB 2IMOA 1QSYA 1KNZA 2LDIA 3CGIA 4QPTA 4DOZA 2DGOA 3MM6B 4DQPA 2DHGA 3V5RA 2Z2YB 3SBMA 2RNEA 3CF5Q 4RX6A 3PRBA 2DO4A 5DJBA 4RJVA 2DR8A 1CJUA 3KLGA 4JI4J 3F73A 1HHQA 4WP9A 3U27A 4ZPTR 3GYNA 1LWCB 2ASYA 3NP5A 4O44B 3OTOF 3EDQB 1RT4A 3TJ8A 2DNLA 3QT7A 5ADZA 1HR0J 2C2MB 1VBXA 2JLFA 4NXMJ 1JLEB 5F8GA 3TOQA 8ATCB 3BN7A 3MEKA 2CPHA 1N5YB 3UD5A 2J7KA 3PX0A 5KFUA 5K8NA 2VD3A 2VKRA 2HGLA 3J81j 3BEGB 1S99A 3HPOA 1IXKA 3ET6A 1X9MA 4U96A 3ENQA 3TJAA 1FKAF 2CNKB 3ITHA 3E2EA 3RBXA 3D4JA 2XS5A 4WK3A 1N34F 1F3FA 3ZZZA 4ED8A 4B3TF 3KJFB 4Y00A 4W98A 5DLGA 3NOCA 1XEZA 2Y0BB 3RAMA 4OI6A 1WI6A 1RI7A 2EEYA 4LF2A 3UN5A 5JXSA 4JV5J 1FDDA 4I6WA 3P3DA 3MCNA 4ZPBA 1NLKL 8AT1B 3TNVA 4QBUA 3VVTA 4O3QA 3EGNA 5KFVA 2YWHA 1T11A 2VPWB 4E0DA 4HI1A 4V19J 4X4VA 1DTQA 4XAKA 4DCOB 2F8MA 1S1XA 4KYZA 3M4XA 2DRAA 3Q8UA 3DN9A 4MKBA 1GXTA 1N54B 1KDNA 2B6AB 2B9WA 2HMIA 2C1EB 2DCLA 3MMAA 2ZZTA 2AYEA 4X62J 1RT6B 4OYAA 4PWUA 2C2KB 2VFRA 1TQLA 2GW8A 4GC7A 1YJNS 2D41A 1D8ZA 2WVCA 1X4BA 1T03B 1PC5A 3NS6A 5IQ6A 4DS5A 3A3NB 5J2QA 1DBDA 1FX4A 2YKNA 4MFBA 1WC6A 1RACB 1Q82T 2DNHA 2EG1A 1WSVA 4LSLB 3N6NA 4JI2J 2RB7A 3W2WB 5HJYA 3KK2B 1IR2A 2GO8A 1S7HA 4X4TA 5CXTA 2KHDA 5ETNA 3L4BC 5C24A 4C3KA 4FZVA 3PJ9A 2QLFB 2J9DE 2EFNA 2EKYA 2CQHA 1S1WA 4DF8A 1G3OA 2RU3A
chains in the Genus database with same CATH topology
4ZPDA 3MECB 1MSWD 1CG2A 4CO3A 3KKFA 3BGFA 4DR3F 2POKA 2ZDOA 5KFQA 3H2VE 4XIUA 1T3NA 2QO3A 4G6VB 2KTQA 4KO0A 1LQ9A 3PEJA 2UVVA 4USIA 3AB2B 2ZJPQ 1SBRA 3PRDA 1TL1B 3WC0A 2NSCA 5B0GA 3D1OA 4PG7A 4O3RA 3MD1A 3L95X 2OPRB 2UVRA 1U2FA 4XDCA 1HQUA 2F9DA 2HFZA 1XMQF 1M0SA 3FMWA 5THWA 1JLQB 3AH6A 4O3OA 3U7JA 3IGNA 3DRPA 3QO9A 2J6UA 1UAWA 1TFWA 4PWDA 2BE2A 2BW2A 1W2IA 2ZZNA 3OTBA 2YKAA 4GO7X 4YY3F 3LANA 1IR0A 5ITHA 2VUGA 5D4LA 2AX0A 1U6BA 3ICLA 1FESA 4ETZA 2V8VA 3UI3A 5HMYA 4WE1B 4F4ZA 1VS3A 2JOQA 2JDJA 2ZNZA 4Y3CA 4DL6A 1BY9A 2JFDA 3VAHA 4YMEA 3PKYA 2GHVC 3OL6A 1VQPS 1FJCA 2YX4A 4JI4F 2QRRA 1IQTA 2ROPA 3KOAA 3PDNA 1QAXA 1NK5A 2B4UA 3PW4A 2FTRA 3J7Z5 3DLGB 2YTCA 1X4EA 4B3OB 2IYGA 3O6QA 4DSKA 2XO7A 3J7YI 2HNDA 4O3PA 4OZ1A 3H40A 3GG1A 3V6DB 2DNQA 1A7GE 1LXNA 1S1TB 1HNIA 2GJIA 3HVTA 5EX0A 2R8GA 1TFYA 2GA7A 3AHPA 2WSEC 3DOLA 4I67A 1Y5LB 3P5TL 4TLQA 3RB3A 4NMLA 5D4OA 5IZHA 2IAJB 1U8SA 4N8OA 5DDQC 4TU9A 2RF2B 3GQCA 1HR0F 2Z8QA 4F3OA 2C3MA 4NXMF 3L3CA 2V5HG 1VI7A 2HAIA 3BSOA 1S0NA 1E6VB 4W92B 3KLEA 4C8OA 4JYAF 4C0HA 3B4DA 2RJZA 3BGLA 4B9LA 3CIZA 4A8FA 4A8XA 1FRJA 3IBWA 4K4ZA 1U1LA 4ES1A 3LGMA 2LVWA 2I5JB 2ZBCA 1V3ZA 2DNKA 2DISA 3DU6A 4J9OA 2FIUA 1B64A 1LWEB 3VR1A 2D3OR 1RTDB 1ULRA 2E7WA 3IR5B 4MYTA 2YKQA 2HWTA 2GMHA 3PKMA 4NYOA 3KMSA 2HNZA 2YWGA 4LF5F 3G96A 1X5SA 2LA4A 2NPFA 3WX4A 1MU2B 2BM0A 3BSCA 4M63A 1YBAA 1YHQS 3OBIA 2LLZA 4RW7B 3VF0B 3IGVA 4MKAA 2Q1LA 4M8LA 3AQPA 4LVNP 2R7WA 2HHHF 3GFYA 1TKXA 3NG8A 4AQYF 4ECVA 1Z1ZA 4K4SA 1OQ6A 2F9JA 2IRUA 4IG0A 3C46A 2QT7A 3M6VA 2IC3A 2RRBA 3GSDA 1F5BA 4NCAA 2CRLA 3LGNA 5A0YB 2HHVA 3THTA 3LWLA 3H59A 4M5DB 2WTFA 1QVFR 4FF1A 4ID8A 3BSNA 4DLEA 4DN0A 2BA9A 4DV2F 2XGQA 3EZUA 2J0WA 5JVHQ 3MFIA 2PIIA 4Q8EA 1TVRA 2MHEA 1GT8A 3M2RB 3CC2S 2VBYA 2D3UA 2HHPA 4PR6A 2DRBA 2MZ1A 5LMNF 2IBKA 1GX6A 1TL3A 1X9SA 4TYBA 4ZP7A 1IKYA 5KFEA 4I56A 2OFGX 2C22A 3HDSA 3GFXA 3J80Y 4N76A 3GILA 3KLGB 5CQGA 1NRKA 5T7LA 4EFAC 1U4BA 2MZTA 1PSDA 2KG0A 2XY7A 3GFZA 2FVSA 4KC5A 3I0RA 2PN6A 3Q23A 1JNRB 4RZRA 3FJ2A 4QIEA 2E9RX 1WTFA 3OSNA 2Q43A 3IG1B 1NK9A 3M8RA 4IR1A 2HLUA 5D78A 2IJNA 2R7SA 3CD5A 4N47A 1FXRA 5K8OA 1IQZA 2FHMA 5DDRC 3M9NB 1W2BR 2ASLA 4LT6A 2JEIA 2LQ9A 1RT4B 1SJ3P 5DO2A 1BLUA 1U1RA 3CJKA 4KGMA 4DQSA 5EWEA 3WBZA 2VG5B 2M5YA 1BGXT 2JLEA 2YNFA 2YX7A 3CXCR 2UUTA 2RH3A 1X0FA 4DSIA 3T19A 3NBPA 3KTQA 1M5KC 3IXQA 2OTLS 2YNGB 4ZLPA 1H98A 5KFWA 3VQSA 1ZM3A 4ZA1A 1R8AA 2V4RA 2QFJA 1FTRA 2RVJA 1XNRF 3ZZ0A 2QSFA 3PM9A 4KKOB 2DJWA 5HROA 3ISZA 1OO0B 1UEVA 2DCUB 3T5JA 5GAEU 5BR8F 1JMTA 2QSWA 4TNOA 3S6EA 4H4KA 3HM9A 3V81A 2E5LF 2DGWA 5CCMA 1N56A 2ZE2B 4X62F 4MIWA 2DHXA 4F2SA 2EC0A 4IOBA 2HWHA 4NLPA 2KU7A 3H4BA 2QLXA 3ENVA 5DDOC 1XR6A 1NHVA 2PA8D 3HX9A 3F56A 3H8YA 1S1UB 2EFPA 2ZC3A 4NYPA 1B0TA 3AJ2A 2I9SA 1RWUA 2LU2A 3KK3A 1HD1A 3ITHB 2JH3A 4OI3A 2DNZA 2H5EA 1FDNA 1OS5A 4ZCMA 1TKZA 2DTJA 2NUHA 3V4IA 3HI9A 1S48A 1SH0A 2F7VA 4MH8A 4I64A 2KT3A 3BO4A 4ILLA 5I42A 1U1NA 3K5OA 2A3JA 1T94A 1X4HA 4HI2A 3D0IE 3E3XA 5DLFA 1QSLA 2XSJA 2KM8C 2N7CA 2U1AA 1AROP 3NS5A 3G8TA 3RAXA 4BDPA 2OSQA 2E44A 4ICLA 4NLTA 5G4DA 3TO8A 1CVJA 5E3CA 3CCTA 3THVA 2IM2A 4LSNB 3J7YU 2FLNA 3NKYA 5E0OA 1HYSA 3M9MB 1GQEA 1ZM4A 2OPSA 4DR1F 1KLNA 1IKWB 1REVB 1HMVB 3CUNA 1ZTWA 3OQ2A 4QPXA 1JLCB 2HWIA 4JI2F 2CQ1A 1VFJA 4FXVA 5F0WA 2SXLA 4BWJA 4PG8A 2C2DA 1NAQA 2BYCA 2IA6A 3TAMA 3OUYA 1VQ8S 2WBRA 1R27B 1WG5A 2P6TA 2ZBIA 4DG1B 3IWXA 3H98A 2DR5A 1LK7A 1LWFB 2BZ2A 3B8HA 3CDEA 3HVWA 4XPEA 1BWEA 2VPYB 1WF2A 3FQLA 5KFSA 2PC6A 4NRTA 4IFVB 1HWLA 2MHNA 3RB4A 2N4DA 4NLUA 2B43A 4BC7A 1DTQB 4OI4A 4URGA 3CT9A 1S1XB 1HBNA 1IJEB 2XEXA 3GZ7A 5B09A 4DR2F 5LT5A 2DK2A 1C1BB 2HVZA 4DFKA 3G9CA 1GXUA 1O8BA 3OR2B 5A8RB 5C25B 1QVGR 5HBMA 4P7VA 2XCPA 2JVRA 4B02A 1IKXA 1KS2A 1R0AA 3KLHA 4PUOB 4OLOA 5KFFA 2FJXA 2DIVA 4CH1A 3RAQA 1HBMB 2KDOA 5LJ3Y 2AJFE 3KG1A 2QA1A 4I68A 3C3LA 3KNGA 3MMAB 2MQPA 3AA9A 2XULA 3FVYA 1GXLA 3MEEA 4KFBB 4MIAA 1IM4A 3TA0A 1V3SA 3CCQS 5F8NA 4JI5F 1KVIA 2E5GA 3CE8A 4DQRA 3RRHA 4R5PB 4WK1A 4KPYA 2VG7A 4QWDA 3I56S 4DV4F 4Q2LA 1RT1B 4C0BA 2UVUA 1KTVA 4IDKB 1UW4A 2CJKA 3DI6A 3GV8B 2M52A 4KRWA 3I32A 2RRNA 3DM2A 5KFDA 4C11A 2L3MA 1VQYA 4ED6A 4U6PA 2ZH3A 3M8SA 5I4MA 2R9LA 5J1PA 2W7OA 3G8QA 4QWBA 2AYGA 2VG6B 2JEFA 3FZBA 4OZNA 5M2UA 3H2LA 3DLKB 2FB0A 3UDLA 3MUVP 1NNDA 3DGPA 4RWXA 1L3SA 2UUBF 4QU6A 3LP1A 4FYDA 3BZQA 4ES2A 3JSMA 5J2QB 4Y34A 2AJ1A 1S9FA 2YKNB 4R8UB 2D9OA 4WFAQ 1F60B 4MFBB 5HMXA 2AQ4A 1D3WA 2R7UA 7FD1A 3CCUS 2QA4S 2ZH2A 1OWXA 3UPFA 1N52B 3M32B 3UCZP 1VOMA 1T95A 3JYTB 1FXDA 3O3LA 2DH7A 5DM6Q 1DZ5A 3HHLD 1Q79A 3QIDA 5B0DA 3D2WA 2WW8A 3CD7A 1CSJA 1H6KX 3JAMY 3HZGA 2CPXA 4A8QA 3MR5A 1HI1A 5J2NA 1VRTB 1DRZA 3POTA 2R7VA 1S77D 3B4MA 3GR1A 2IVYA 3Q8RB 4CO2A