3I55S

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i55S00
2EK6A 4P6QA 4C7QA 2BZ2A 4PR6A 1F9FA 2N82B 2DNHA 2DO0A 3NMRA 1X5OA 2JRSA 2LMIA 2MZ1A 2K3KA 3D2WA 3SDEA 2YKAA 1VQLS 1K9MT 2HZCA 2SXLA 1S72S 2KG1A 3Q2SC 1U1OA 1HL6A 5GAEU 2AYMA 3R1HA 5GADU 3TP2A 2DH8A 5D77A 2I38A 3SXLA 3UD4P 5DM6Q 3G6ES 1N8RT 2QFJA 4IOAQ 2O3DA 2MQQA 2DGQA 3HI9A 2WBRA 2KM8B 2XSFA 5LSLA 1M5VC 1QM9A 1O0PA 3MI7X 4OZ0A 4WFAQ 2KHCA 4YOEA 3P6YC 2CPZA 2EVZA 1G2EA 5HO4A 3CCSS 1YTYA 1Q81T 2DHGA 2KXFA 2D3OR 1U2FA 1WEYA 5DDRC 1U6BA 1N54B 2L41A 3I56S 4UY8T 1OWXA 4PRFA 2MZTA 3UD3P 3NNCA 2KXNB 3CULA 4TU8A 2M2BA 4UQTA 2XNQA 2K8GA 2M9KA 3UCGA 4IO9Q 3K0JA 1WI6A 5CA5A 1X5SA 3MD3A 3V4MA 4YUDA 2MB0B 2EK1A 1VBYA 2JVOA 2DNPA 3L3CA 2LCWA 1VQKS 3R27A 1W2BR 2CQ3A 2KFYA 2YTCA 1X4CA 2DB1A 2BOPA 2KI2A 3FEXB 4WFBQ 2CQ1A 4F26A 3EX7B 3CCMS 2N3OA 1WHXA 1K8AT 1U1LA 2HGLA 2AYBA 4WF9Q 3NS6A 3S6EA 1OPIA 2AYGA 1RK8A 1URNA 2DGXA 2DGTA 1X4AA 2MKSA 1WF0A 3BO2A 3CCJS 2QEXS 1NU4A 3B4DA 2J76E 2F3JA 1WEZA 2OJ3A 2CPHA 5JVHQ 3MURP 3CF5Q 1VC0A 1SJRA 3JB9k 1HD1A 3P49B 1P27B 3TYTA 2DH9A 3P3DA 2ADBA 1VQ8S 2DHSA 3H2UB 2JX2A 2OTJS 1FT8A 3MD1A 2E5HA 2D9PA 1D9AA 3CCES 3NNAA 2MSSA 2PEHA 1IQTA 2CQGA 3CMAS 2DHAA 1YJWS 2M70A 2MJNA 5EN1A 2MXYA 3OW2R 1SXLA 1KOOA 1WG1A 1QVGR 5FJ4A 2HVZA 3CCQS 2F9JA 1CVJA 1PGZA 2VONA 5CYJA 1JJ4A 4QU7A 3LPYA 3MXHP 1U6FA 1XN9A 5HL7Q 1L3KA 3G71S 4RU2A 2LYVA 2CPFA 1H6KX 2YH0A 5BJRA 2DGSA 1BY9A 2HGMA 2U1AA 1M5KC 3EGNA 3BO3A 3ZZZA 2CPYA 2OIHA 4QQBA 1DBDA 2KT5A 1WELA 5LXRA 2L08A 3CCRS 1DZ5A 3CC4S 2DNQA 5DETA 2DGWA 2FC9A 2ZJRQ 1YIJS 1HD0A 3VALA 3CC7S 2KG0A 4Y0FA 2RQCA 2G1DA 3G96A 2QA4S 2M88A 2LEBA 2RS2A 3B4MA 2MQPA 1WHYA 2KXHA 1VQNS 5IQQA 3S01A 2DGOA 1YJ9S 2DNKA 2OSRA 1M5OC 2MKJA 1Q82T 1N52B 2KU7A 3RW6A 2N3LA 5D78A 4J5OA 2E44A 2LQ5A 2XB2D 4A8XA 1OIAA 2MZSA 3DXBA 2G0CA 1X5TA 3VAMA 1VQ4S 1SJ3P 2XS2A 2OSQA 2CQPA 1Q86T 3THPA 3IRWP 1M5PC 3UWTA 3U1MA 2LA4A 1R8HA 2GHPA 2MZRA 2I2YA 2KRRA 1X4DA 2KYXA 2NLWA 1H2VZ 2LA6A 1WHVA 2Q79A 1SJQA 2ZJQQ 1AUDA 1WG5A 2M0GB 1ZZFA 3CXCR 1FJCA 2M4MA 4FXVA 1WEXA 4PKDB 3CC2S 1ZZNA 4C0OC 2YH1A 1JJ2R 2N7CA 2M8HA 5DM7Q 3EGZA 2DGUA 3S8SA 3CUNA 5GAHU 1FO1A 3H2VE 4TU7A 4IOCQ 2FHOB 2XS7A 2MYFA 1X5PA 2DGVA 1HA1A 3CD6S 1DRZA 2CPDA 1WTBA 3MUMP 2CPIA 3PIOQ 1A9NB 2CQ2A 2LKZA 1FXLA 1B7FA 3P5TL 4Z2XA 5IFMA 2DNOA 1D8ZA 2MKHA 3BEGB 3MOJB 2VOPA 2HGNA 3VF0B 2LECA 1U1RA 3VAHA 2ERRA 3FEYB 1VBXA 4QU6A 3DLLQ 2RRAA 2XNRA 3BO4A 1P1TA 5ITHA 4M5DB 2YWKA 1FHTA 2NZ4A 5CXTA 3NS5A 1VQPS 2M7SA 2KH9A 4WCEQ 3SDEB 2F9DA 2CQCA 1KD1T 2MMYA 3MUVP 3UCUP 3VAGA 4C4WA 5MLCV 2MQNA 2OTLS 1VQMS 4LJMA 1KQSR 4F02A 2X1FA 4Y00A 1VBZA 1WF2A 2MZJA 2DH7A 2ZJPQ 1FNXH 2J8AA 1R8PA 2DNMA 1X4BA 5DDQC 2B0GA 3ZZYA 2GO9A 2RS8A 1UP1A 2X1GA 3VAKA 1U1MA 2DIVA 3LQVA 2VOOA 5GVQA 1VC5A 1VQ5S 2DISA 3BS9A 1K73T 2DNZA 2DNYA 5DDPC 3G8SA 1YJNS 1VQ6S 5LJ3Y 4FXWA 1U1PA 5JVGQ 2DIUA 3SMZA 1YI2S 3VAFA 2KRBA 5H1SV 3R1LA 4CQ1A 1WI8A 4CH1A 2DITA 4IUFA 2DNRA 3MUTP 2MY8A 2RVJA 4CIOA 2V94A 2A3JA 2DO4A 2FC8A 1X4EA 2MGZB 2MSTA 3J7ZT 2UP1A 1M1KT 4OZ1A 3N9UC 1YWXA 2XS5A 1YHQS 2AD9A 3HHNB 1X4GA 3CTRA 3RW7A 4TLQA 2MKIA 2J0QD 1FJ7A 1VQOS 3G9CA 2DNLA 2CPJA 1X4FA 2KN4A 4QPTA 3U1LA 2ADCA 5LXYA 1NJIT 2DNNA 4ERDA 3CCUS 1NO8A 1WHWA 4EGLA 2LEAA 4U67Q 2CPEA 3G8TA 1H2UX 2RNEA 2X1BA 4W90B 2E5IA 2MQLA 3UE2A 1VC6A 2LXIA 3G4SS 2M8DB 1UW4A 1WWHA 1KOHA 2MY7A 2MGZA 3VAJA 2CQIA 2JVRA 1FJEB 3PIPQ 1S79A 1H2TZ 5LJ5Y 3MDFA 1KC8T 1ZH5A 1N88A 1SJFA 4WIIA 1X0FA 2HYIB 2MHNA 3CPWR 2CQ4A 4ED5A 1A7GE 2MQOA 3THTA 4W92B 3UCZP 4CH0S 2X1AA 4TU9A 3Q2TC 4LIRA 2MKKA 1UFWA 2MQMA 1SJ4P 2DK2A 4ZKAA 1WG4A 2RQ4A 1JJHA 3CCLS 4WKRA 2RT3A 1U1NA 1YITS 2KVIA 3CMES 5IM0B 2JWNA 2AYEA 2CJKA 3IWNC 2MZQA 3J7YU 5IM0A 2CPXA 1OO0B 3I55S 4WFNQ 2RU3A 1X4HA 2CQHA 4YB1P 2VODA 1PO6A 2MPUA 1RKJA 2DHXA 1DHMA 2LXUA 2RUGA 2G4BA 2D9OA 3S7RA 3NNHA 4LMZA 1QVFR 1VQ9S 2M52A 2U2FA 2L9WA 3TO8A 2KM8C 2E5JA 2CQDA 2MJUA 3ULHA 1JMTA 4F25A 1U1KA 3CCVS 3US5A 2DNGA 5GAGU 1U1QA 2CQ0A 2E5GA 1WF1A 2FPHX 2RRBA 1UAWA 4BS2A 2J0SD 5LSOA 2PE8A 5DDOC 1VQ7S 1M90T 2FY1A 2MKCA 1Q7YT 5GMKa 4V19X 3VAIA 2CQBA
chains in the Genus database with same CATH superfamily
2D1CA 1R8AA 1TKZA 2VL1A 1F5AA 3GG1A 4IH6A 2W2MP 3V6DB 4N76A 3MAQA 3QBCA 3TWZA 4Q45A 3PFOA 2DNHA 2DO0A 5HLFB 2BQRA 4C8MA 3RR8A 1ZPVA 4OYIA 3NMRA 2C2MB 3W9HA 4ZCMA 3PW5A 5J2NA 4MKAA 2BYCA 2J9DA 4NLXA 3K57A 1KRPA 3D68A 4J90A 3J81j 2SXLA 1S72S 4FF3A 1YJVA 3D5MA 2AT1B 1G4CA 2ZOGA 1Q8IA 3Q2SC 4DQPA 3AQPA 4F67A 1CLFA 2IHR1 2CNKB 3OL9A 4CI0B 1XTZA 4I6WA 4ZJLA 5D0GA 4ZVQB 3D66A 4IRDA 3ENVA 2DPJA 1Q7LB 4DFPA 2RHSB 2FJAB 1APSA 3SXLA 2FJWA 3FVYA 1N5TA 1TAQA 4ED4A 3UD4P 3LGNA 4DSEA 3Q89A 4H4KA 4EYHB 3C16B 3PZPA 1N4LA 2OPQB 2UUBF 1WUUA 3T41A 2GIFA 3IR6B 3HI9A 2WBRA 4DCPB 4ZP8A 4RW8A 4USIA 4ZVPB 1QM9A 1O0PA 2OGUA 1NH7A 2ZBRA 2LQ8A 3T19A 4IFYB 3DI6B 2KHCA 3R9LA 2CPZA 3PW7A 1G2EA 1S1WB 1GX5A 3MMBB 3RZAA 4DU8A 2XC9A 1L3TA 2KXFA 4LRDA 2D3OR 1QE1B 4P2SA 1DFDA 3FK4A 1RSCA 3DCAA 1Q5YA 4RU9A 2E9TA 2XM3A 1CJVB 2A2CA 4PRFA 3GB0A 5D6GA 4FF1A 2V69A 3ILJA 4K0KF 3NNCA 4UUWA 2R7UA 2KXNB 2I5JA 4TU8A 1NK0A 1D9DA 4WU2A 3RBDA 2HHHF 4C0HA 4B9LA 3KLFA 4X4VA 2M9KA 1HPZB 4MTPA 3SEOA 2UXCJ 2BV3A 2M3DA 2HHWA 2AJ2A 3AODA 4L6V3 2XY7A 1I6JA 2CG8A 4Q2MA 2MB0B 1TU0B 2OKQA 3G2XA 1Q5VA 3MM8A 4ZN1A 3PR5B 1VBYA 3PO5A 1F3VA 3FUYA 2BE9B 3A4TA 3L3CA 1EP4B 3NGDA 4OHVA 4DQRA 5IT0A 4DCJB 1NK5A 3D3CJ 1VQKS 4DZ6A 1ACMB 3DFEA 3HHKA 5F41A 4ER8A 4JI5J 2WHOA 5AJ3F 4MAKA 4WE1A 4OHWA 4A8QA 1NMEB 2GCFA 2KFYA 2VICA 4ELTA 2HZAA 2YTCA 2N4CA 3DMJB 2OPRB 3M1VA 4K5RA 2XO6A 3W8PA 1FRLA 2BOPA 3HD1A 1JLEA 4DR2F 3AOBA 2FJVA 1JXVA 4YQWA 3TQEA 4DL2A 3BH6B 3H7HB 3HSDA 5HQLA 1I94F 4DSKA 2NUUG 3TW0A 1FXRA 2J7WA 2AYBA 2JL9A 2DY1A 2A6OA 1RHRB 1Q95G 3NS6A 4Y2IA 1X9WA 2VD3A 2CA9A 3CJ2A 3PYFA 3SQOP 3D7SB 4AYBD 2WSCC 2DGXA 1UMJA 4KPCA 1CBKA 5IXUA 1HYSA 3M8RA 4P2MA 2DGTA 1X4AA 3H0PA 1JLGA 1UKUA 4KO0B 1LKZA 2GIQA 3MCNA 3OR2B 5JUMA 3CCJS 1NU4A 4P2XA 2W9CB 4A8SA 1HNIB 3B4DA 2J76E 3D9BA 1T3OA 2EBEA 3F0NA 4EU0A 2OJ3A 1T9YA 1F9HA 4X66F 4O4GB 5IV3A 4M63A 2AHOB 3JAMY 1VC0A 4DV5J 2V2KA 3P49B 4NA1A 1U6ZA 4AE5A 3CJ5A 4UUXA 5J2PB 5GMEA 4Z7YA 2ADBA 1HPZA 2AJ0A 1U8WA 2EC2A 1Y3KA 4URSA 1RAHB 3RGIA 3VZIA 3FCWA 1HIYA 2OTJS 1P9YA 5G0RA 3BPSP 1I94J 4IH7A 4ZVSB 2F4FA 3R5JB 4U6PA 1S9GA 4LF4J 5KG0A 2HFOA 2PEHA 1FRHA 1SQEA 2CQGA 4O3NA 3CMAS 4QR0A 3CVKA 4DV3J 2QYCA 4OYZA 3DOKA 1R31A 2GQCA 3POTB 1LK7A 1T0TV 2MKYA 3C15A 2O66A 3D54A 3MMJA 4H4KC 3SFGA 4A8WA 1J5OB 4QYRA 1AW0A 4ZN3A 2DR5A 3G87A 4PG7A 5FJ4A 3KK1B 1YZ7A 4WP8A 4JV2A 4NEYA 1C0UA 2VONA 4OYWA 1UVIA 2P8IA 3LPYA 1JLCA 4P74A 5KFXA 1W25A 3G71S 2VFVA 2L3MA 2E1MC 1ZOTA 4ZVEA 1REVA 2YH0A 2EI5A 3LGMA 5BJRA 5HQMA 1ZETA 1PYOB 1ZM4A 1RA7A 2XGQA 3QZ7A 3EGNA 1ELOA 1VFJA 4RW4A 4F50A 1FTRA 1H0HB 2NYHA 2EXUA 4FNHA 4FPRA 4RW9A 4X4QA 3KOAA 5H9FK 3ZZZA 4ES2A 2H9ZA 1UJ5A 2ZNYA 2F8MA 4QQBA 1U0SA 4Y65A 5KFRA 1FX2A 5LXRA 4RNMA 1U4BA 1JKHB 3FC9A 5BYQA 3WIVA 1CULB 2L08A 2GO8A 2B8QA 2I0XA 2QLWA 1DZ5A 2UU9F 1KVJA 3CC4S 4RW6B 2DNQA 2XZDB 3PX4A 2DGWA 3GWCA 1NZAA 4B3TJ 3KUEA 4DR6F 4NLGA 4DV0F 3NCPA 4RBVA 4RKUC 1VJWA 1HD0A 2IBOA 4KIAA 5JMNA 3VALA 2E1PA 2IDEA 1PIEA 3B82A 4RX6A 1C4CA 3TANA 1XNRJ 4JYAF 1KN6A 4Y0FA 2E66A 2M88A 2RS2A 3DLHA 2YXLA 2L9NA 2W4DA 3HULA 1PKUA 3Q8RB 1NEEA 4DMZA 4F0KA 2BJ8A 1XMQJ 2AX0A 5E3QA 2ZNZA 4DX6A 1OY8A 2CKWA 2FJBB 3S01A 4ZPAA 2K7JA 5EWGA 2BKOA 2DNKA 5K5MA 2H51B 3FZBA 3LTOA 2ZHAA 5DG7A 2P9CA 1EETB 2MKJA 2ZE2B 3GONA 3ISNC 3Q8QB 1RISA 3FMBA 2V63A 1AB8A 1KR4A 4OX7A 3ZTRA 3KJFB 2K06A 1SPBP 4DV6F 4KHRA 1GTEA 4TKTA 2N3LA 2QLJB 3HF5A 2C3PA 2B7BB 2CYYA 2XB2D 2VH7A 3FMWA 1VISA 4A8XA 3PO4A 4USWA 2W4PA 3BSAA 2Z2LA 4OZ2A 1S97A 3D1QA 1X5TA 4DEZA 4LF5F 3PR4A 1G6BA 2HWTA 3E01A 5ETRA 2YY3A 4Z37A 2C2NA 2G2OA 3Q22A 1HKAA 1S6QA 4YB5A 5C24A 4JI0J 3THPA 4CO5A 1JX4A 3EZUA 1RGVA 3D6TB 2B9XA 3PJ9A 4HI2A 5D4LA 2OEKA 1RBAA 2GHPA 4ZP9A 2GW8A 3OPKA 2R9LA 3Q24A 1N32J 3ZFVA 4CT8A 2I2YA 1CJTB 1I5OB 4WFZA 1RBLA 1DJ0A 2R2UA 1FDDA 4AL7A 2Q79A 2WZ1A 3PW0A 3ZZTA 2FHMA 5CZXA 3V6KA 4JV1A 1RLCL 1RTZA 1SKWA 1YGYA 4ZMMA 2UV8A 5KFVA 1VK3A 1PYSB 3BN4A 3C15B 2Z56B 4DV6J 5A8RB 3OSNA 3K5PA 5CYQB 4MKYA 3H90A 1HQUA 5E2QA 4CLZA 3RAXA 4TVAB 1IJEB 2Z4PA 4MYUA 1W2IA 3QT8A 3CDUA 3EGZA 2CNOB 3K5NA 2XYPB 2DGUA 1YSJA 2R7OA 2GJIA 3DU5A 3GG0A 1BXNA 3K17A 2PMZD 3TOQA 5BYSA 1PILA 4O44B 5THWA 4M1KA 3CCWA 4L75A 3PW2A 3JQJA 3W2VA 1TFWA 4DFJA 2BANB 4B9VA 1FO1A 5KT3A 1PJ7A 3M05A 3K8VA 4J9MA 1DARA 1HA1A 5L1LA 4KJIA 2H4YB 1FE0A 3GZ7A 3GV8B 1NBEB 4OLPA 4J9KA 4ECRA 3Q86A 1RTHA 2CNNB 1FD2A 2HHXA 2LKZA 3QJPA 3H2LA 2UUWA 4ZPVR 4CNYA 1FXLA 1B7FA 2O67A 2DRDA 2V2QA 4Z2XA 2MKHA 4DCOB 4O3QA 1DTQB 1NRKA 3X3UA 1TK0A 2HGNA 3VF0B 2LECA 1KLNA 3NXZA 1M5SA 2WK4A 1ZPWX 2J6UA 3EGVA 3MFHA 3FEYB 4WPAA 4HLBA 4QU6A 3MTJA 2UVRA 1FVSA 1UETA 3AAWB 3F41A 3BO4A 3EM1A 2VU5A 5ITHA 4M5DB 3M8YA 3MHYA 1HW8A 3UR3C 1MN7A 3MEDA 1VQPS 1SL1A 4FF4A 3MM5B 2DCUB 3B6BA 4G6VB 2IVMA 4PAAA 4WCEQ 5EWEA 3M4XA 4RPFA 2F9DA 3AA9A 3VCDA 3DHXA 1RYSA 2GJFA 2IM2A 3OTBA 3H5SA 3FSIA 2QA4G 4Q2LA 3M1VB 3DMJA 1FA0A 1RT5A 1UWBA 5KFWA 3GV7B 4DR5J 4JI4J 1R8CA 2APOA 4IG0B 1RHJB 4C4WA 3MAAB 1P8GA 2JLEA 2J5AA 3WX4A 2UVUA 1AUSL 1FKAF 4B3RJ 4FYDA 1TKTB 3QO9A 3IP0A 4IYQA 2MZJA 2DH7A 4GMKA 4QW8A 1G7CB 2BVZA 5KT7A 4JYAJ 2B0GA 2R7QA 2F8HA 2KL8A 3ZZ0A 4LSNA 2W7PA 2RS8A 3DM2B 3PYGA 1HW9A 1UP1A 2K1RB 4ZIWA 4CLLA 4RNOA 3OFEA 1NPKA 2Y1IA 1U1MA 2DIVA 4ETZA 2GFFA 3GILA 4NWBA 5LOQA 3RU0A 3IN5A 1R3NA 2VOOA 1TAUA 5ETSA 3QMQA 1IM6A 3DDIA 5GVQA 1FKOA 2DISA 1B4SA 3A13A 1ZAWA 3BS9A 1YVFA 3GJTB 3WHIA 4C8YA 1IKYB 3DHWC 3GFYA 4OFZA 2HK3A 1RLDA 3D0GE 2V67A 3QSIA 2QT7A 2NXCA 1YJ7A 3DOKB 1VQ6S 1S4FA 5HROA 1U47A 4DQSA 2ZZNA 4CO0A 2AW0A 4PG5A 1YI2S 4HHHA 4NI2B 3Q0AA 3VAFA 1IWGA 2QYGA 3UI3A 2XZWA 5ETKA 5G0RB 4L73A 1H98A 1ZAXA 1WI8A 1F9EB 2BJ3A 3EDQB 2BJDA 1S0NA 1SI9A 2DITA 2DNRA 3MUTP 1HMVB 3E3XA 4NXMJ 5ETQA 4ZLPA 1LXNA 2W25A 4WZMA 4QYZK 3R8YA 1RTJB 5LT5A 2A3JA 1R0AB 2B4VA 4NMLA 3C66A 4ZPWR 2J7UA 1XR6A 2B4OA 1HI8A 1X4EA 2FJEB 2KYZA 3DOMA 1IKVA 3I87A 5EGYA 3HKZD 4NLYA 3LANA 3J7ZT 2E5LJ 1M1KT 3HM9A 1N33F 2RILA 2YWEA 1YWXA 4LFBJ 1RT2B 2W9CA 2OI2A 4DU7A 4FPIA 5HQ8A 2COLA 3ZZPA 2AD9A 1NK6A 4JI7J 2IPOB 3RW7A 1U02A 4TLQA 4C48A 2MKIA 4UQGA 1X8DA 4AL5A 2Z58B 4O3PA 5L39A 2KN4A 1B70B 4A8YA 1RHMB 4Q43A 2ADCA 2DNNA 3MEGB 1FNMA 1Q81T 2NYIA 3B8HA 2YWWA 1M1HA 3HLUA 3CCUS 2IRXA 2X3DA 3NGRA 5K8OA 5MAOA 1NSQA 1M0SA 1F3FA 2YNHB 2ZH7A 2X1BA 1N5YA 1NDKA 1RB0A 2MLYA 1GMUA 1PC4A 3HZGA 4MIWA 3RRKA 1NHVA 2JEGA 1IQZA 1R0AA 3C6TA 4PUOA 4JV5F 4A8MP 3UE2A 4R5PA 1F1BB 1VC6A 1JIHA 1HNWJ 1UWAA 2LXIA 3FBFA 1NK7A 1WOSA 5HATA 2ZM6F 1UW4A 4PQUA 2FVSA 4LFCF 1AXQA 5KFGA 2MGZA 3TJAA 3VAJA 1RI7A 1TFYA 1DAXA 3GFXA 4GKKF 2YBVA 3IRXB 5DJBA 1F2HA 2RIJA 2ROEA 3MCMA 4J7CA 3FGVA 1LXJA 3CJ4A 3R7BB 1OSDA 4IKAA 2R7XA 1NDLA 4NRUA 4ZCLA 2NZCA 3GIIA 3BKUA 3MDFA 3M8WA 2JOQA 2UXDF 3MECA 2OMLA 3MZIA 2ILZA 4DV2F 3SV4A 3FBCA 4MJKA 4A8FA 1N88A 2R3VA 5J2MB 1X0FA 2ASYA 2JDJA 1Q1KA 3H59A 3MM7A 5K8MA 4JI3J 2MHNA 4C97A 1UVJA 3SQGB 1S1WA 3THTA 1G1XA 3FFIA 1JLBB 4NA3A 3UCZP 2X1AA 3SYZA 2AGQA 4MFBB 3ONQA 3SSRA 2PDAA 4TU9A 3EZ5A 4D3HA 2MKKA 3GU0A 2BJ7A 4NLSA 1UFWA 5JXSA 5B0FA 5KG4A 3O1LA 4ZKAA 3Q8PB 4FXDA 3N5BA 1WG4A 4J9QA 1JJHA 3H42A 4G1IA 1FDNA 2RT3A 4P75A 1UZDA 2JWNA 2AYEA 4LQ3A 3KDOA 3PVXA 2L9DA 5GAEI 2MZQA 1FF2A 1GEHA 1TVRA 5C42A 2OPPA 1NJXA 2CPXA 1UJ4A 2UV8G 2F63A 2R7VA 1GQEA 3C6TB 2YNFB 3QZ8A 1C1BB 4DS5A 4YB1P 4CH7A 1MLAA 2VODA 5T7LB 3L7PA 5KFJA 2R2SA 2C3OA 2WONB 4MIBA 1AYEA 3HHLD 2NXJA 2RUGA 3G82A 5IZHA 4RWWA 3RAQA 3CD0A 1FCAA 1HLWA 4YR3A 4YEAA 2C2OB 3S7RA 2BEFA 2BKPA 3ZXWA 9RUBA 5A6PA 5HVGA 5KFEA 1GXTA 4EZ9A 2Z2YB 2RMLA 2FQQB 2L9WA 1C0TA 3JTPA 4NA2A 3TO8A 5KFBA 2WOMB 2GX8A 3DC2A 5C2CA 2O1PA 3W9IA 1V5IB 3J7YI 4WYWA 4LF9F 1JMTA 1RT2A 4U95A 1FERA 3RRGA 1FRKA 4KV8B 1IWAA 1VJQA 3DLEB 5B0CA 4EBCA 1T11A 1UA1A 3CCVS 1IKXB 2Y1JA 3ILIA 2E5GA 2CQ0A 3RAMA 4A4JA 4X65F 2BA9A 2I9SA 4BS2A 1Y7PA 5LSOA 2XMMA 3AJDA 1VQ7S 2XTJP 1PJ5A 5AJ3J 1RTJA 3JQKA 2YX4A 4DJBA 5HMXA 1IBLJ 2UUBJ 1TK5A 4G3IA 1YJTA 2JHEA 3QRPA 4QWEA 2HFSA 1T95A 1JWWA 4JP8A 2KTQA 1R27B 4P6QA 3NAIA 3E8OA 4OZLA 5KFAA 2BZ2A 3O6QA 3N4WA 4C7QA 4F0MA 4I56A 1YRUA 7AT1B 3BQ2A 1NJWA 3W1YC 2N82B 5IT9U 3I6PA 3AXMA 3G6YA 2KJVA 4NI2A 1X5OA 5HI7A 2B3TB 5F9LA 2MZ1A 3C3LA 4HYKA 3D2WA 1QAXA 1SB6A 4ZA1A 3SDEA 4JI2J 3P4UB 2W01A 1VLOA 3PG9A 2HZCA 4B02A 4CDIA 1U8SA 4F0HA 2KG1A 2F7VA 4DZDA 3G6XA 2C22A 1CEZA 3SIPB 4A8OA 2RDJA 2QIFA 3BH7B 1HL6A 1SUQB 3BGRB 1U48A 1N36J 2AYMA 5ETPA 1GX6A 1NKBA 3R1HA 1Q16B 2OO4A 3TZZA 2ALYB 3HFKA 3TP2A 1PYTA 1WDDA 2Q1LA 1HWIA 1FRIA 4IFVA 3MR2A 4WJBA 2FVPA 2QL5B 2XQCA 1WDTA 4RWXA 4OMFG 2AJFE 5KAKA 1QAIA 3HVTA 1Z2ZA 4J9RA 1N8RT 2QFJA 3TUPA 3PTWA 2ILYA 4ZVGA 2MQQA 3JQMA 2WVEA 4LQ9A 1IBMJ 2C3MA 2VHGA 1T9WA 3SCLE 4TQRA 3JYTA 1DURA 5CQGA 5LMNJ 3BPDA 1IR0A 4OZ0A 4OHYA 1NB2A 4KB7A 1RAAB 3W62A 3NL0A 1EKSA 3CEDA 2EVZA 3E51A 1TV6A 3F44A 4H54A 1UVLA 4R0JA 3P6YC 4OJ3A 4FS2A 3M2RA 4NZ0A 2HHTA 5KFTA 4N56A 4L74A 1RT5B 2XCAA 2AJ1A 2GNKA 2WVDA 3LA0A 5KG5A 2CJBA 3I56S 2BACA 1FWLA 4OX8A 3UO0A 3AB2B 3MM6B 3KG4A 1FKPA 5CYQA 1IUJA 5I4MA 3DRSB 2K8GA 3I4HX 2F4VF 3UCGA 5KFYA 3HFZB 3MF5A 5KFPA 1V3SA 2HBYB 5CA5A 2V4QA 3MD3A 4M5DA 5D0HA 3V4MA 5K20B 2XLIA 2MTLA 1S1XA 3DOLB 3M6UA 4KGKA 2KDOA 3CE8A 2PA3A 2HFUA 2DNPA 5B0GA 2LQBA 3OLBA 3NS7B 4C8LA 4PEOA 1HWLA 5EX3A 1DTQA 4USMA 4DL4A 1NHKL 3NGKA 1BQNB 1GTHA 1LWEB 2JFKA 3H4BA 1W2BR 1LK5A 2XHCA 1T3NA 2YWFA 5DZ7A 4OI1A 2DB1A 3BDEA 4TYAA 4NLUA 4DX5A 1CULA 1TL1A 3FEXB 3JS9A 5HANA 2CQ1A 4WFBQ 3BR9A 1MSWD 1GMVA 2UUCJ 4PYDA 1O6XA 3E01B 2JLGA 1RWPB 1RT6B 4AQYJ 4JI3F 3OUYA 1N33J 4QIVA 1U1LA 4EK2A 2HVEA 3TAMB 1T7PA 2W7AA 1F5BA 1SV5B 2H65B 2C3YA 2HBQB 2YQ0A 1GK8A 1OPIA 3I32A 3M2UB 4R25A 4WFYA 5J1EA 2AYGA 1UWBB 1URNA 5DZ6A 2PGCA 3TAPA 3DN9A 5M2PA 3Q23A 1WF0A 2RF2A 2EW9A 4JI1F 4WKYA 1CQNA 2R2TA 4QIFA 1RAJA 1VR6A 2FHKA 1WEZA 2VFSA 2HNYA 2CPHA 1TTHB 2AMCB 3MEDB 5JVHQ 2ZH9A 3VVUA 4IOBA 4ID5A 4KY3A 2J6TA 2MDAA 3LWLA 4K50A 1PBUA 2PFFB 2V34A 1Q8KA 5D0RA 1HD1A 1T94A 1VBKA 3SFUA 3AT1B 3QGHA 3K5OA 2JEJA 1HWUA 4USHA 1EAYC 3JXOA 1P27B 3TYTA 4C3MA 3LO3A 1QD1A 2BKNA 1VIXA 1VQ8S 4ETXA 1S76D 3OR1A 3NGSA 2DHSA 2VKRA 3PJXA 3MMCB 4C98A 3DDKA 2LEPA 1U24A 3PKYA 2VIHA 1S0MA 2XWYA 2XSJB 5KFNA 1RT4B 4RL1A 1S6QB 1MU2B 3R97A 3NNAA 2IAJB 4FF2A 2QMXA 2UUTA 2G2ZA 5KT6A 1LW2A 4CP5A 2GAGC 4USJC 2GQ2A 2YKNB 5HSPA 1XQIA 3QGIA 5KOXA 3HXMA 4LIWA 2B7CB 4DQIA 5JJBA 2RU9A 1URRA 1EQMA 2MJNA 4O44A 4UW2A 2MXYA 3KYLA 4DV1J 4DLGA 1XMBA 2OPSB 4LRFA 2IAJA 3ETOA 4CLSA 1WJ9A 1X60A 2J8SA 5EDWA 1CVJA 4WBFA 4GO5X 1NKEA 1RAGB 2OAUA 4OYAA 1BWVA 3MXHP 1U6FA 1XN9A 2NSBA 2NSCA 3MEKA 4U7UK 5HL7Q 2W2PP 1RT7A 2Z2ZA 2LYVA 5ETLA 3MPWA 2VG7B 4M5JA 5KG1A 3KFWX 3K5LA 4UZCA 4FBUA 1H6KX 3LOUA 5KG6A 4RUCA 1BY9A 3BR8A 1MROB 4P73A 2NPIA 1SIZA 4M5KA 4N41A 1PSDA 4FVCA 4ID5B 2ZBPA 4MK9A 1UL3A 4N5SA 4QPXA 4WXOA 3QAUA 1J5OA 2ZBQA 2POKA 1PAEX 2GMJA 3M9OB 1WELA 3I5CA 4LSNB 2NQPA 1S9FA 4X4TA 4B3TF 1KBRA 1LWCB 3KLVA 4NEZA 2W9BA 4B9TA 4PG6A 3CCRS 1N34J 4Y2MA 3FCHA 3M2UA 1VQYA 1H7XA 2FC9A 4RJVA 3OTDA 2ZJRQ 4U7CA 2RKIA 3BBFA 1NK9A 1SL2A 1HNXJ 5I3QA 5KFZA 1EP4A 4CZCA 2E9RX 5J2PA 3LP0B 4TYBA 4NCAA 3LP2A 2ZOFA 3CC7S 1RCXB 4YHHJ 1H72C 2F8EX 1TL1B 3MM8B 1QJHA 1KKHA 3VTIA 3OVBA 3T5KA 2KXHA 1KWMA 3CDBA 5A6WA 1VQNS 1FWPA 2QN6B 3JTNA 4TQSA 2NCKL 1EETA 2DGOA 4DG1A 3WIUA 3KLFB 3T3FA 1XMOJ 1EQ0A 1NXIA 3GTYX 3O44A 2ZD1B 4XDCA 3OR2A 4KRWA 4KO0A 2J9CA 3L7UA 1HNVA 5B0AA 4KKOA 3UDVA 3F56A 4DPOA 3EJMA 1ICEB 4ZCIA 2Z8QA 1LWCA 3RW6A 4WK1A 3PYDA 3UDLA 2E44A 2LQ5A 1YKWA 2VPYB 3J7Z5 4JI7F 1OIAA 3X1LB 2MZSA 2RAQA 3MMBA 5KFSA 4P10A 1XNRF 1BQMB 2VF3A 3QLHB 2G0CA 1DQ9A 1TKXA 3DRSA 3VAMA 1SJ3P 2IFXA 3DRRA 5A76A 4HHUA 3D6FB 3OL6A 5D3GB 3MCSA 1GAOA 3IRWP 1M5PC 3UWTA 2UUAJ 1M1GA 7FDRA 4RLEA 3BJYA 1R8HA 2VDHA 3B78A 3M2RB 3C16A 1CG2A 1RT7B 4LRBA 3PRDA 1TVRB 4X62J 3BN7A 5K8NA 4I6YA 4X4UA 1NK8A 2KYXA 3GIKA 1CS4B 3HX9A 4H4OB 1GNKA 4P71A 1H2VZ 4URQU 1S0VA 5A2QY 4GKJJ 2DXDA 4C0BA 1S57A 1XMOF 3LUYA 3T1AA 3JYTB 2AU0A 2XZTB 4AXIA 3HVRA 2GAHC 2LQJA 5K14B 3PCOB 4MFBA 2HBZB 4FYWB 2B5JA 2BW7A 1HNIA 5IOLA 1QAYA 2V50A 4FXVA 3ZTPA 2HHVA 1J27A 5C5JA 4B9UA 1IKWB 4M5HA 2XMUA 4C0OC 3TZXA 1KS2A 3KLGB 1HBOB 1SIWB 3QT5A 3KNGA 2UXBF 3DNCA 1DQ8A 2H5EA 5KFLA 2HQCA 3IR5B 4DN9A 4CLTA 4ELVA 3DRRB 2HFZA 2YKOA 4NE9C 3HSZA 1TKZB 1G3OA 1BQMA 3AD7C 3QLHA 4CLWA 2ZH8A 2FHOB 1X5PA 5E0OA 5AE2A 4X62F 1OMSA 4NXMF 2YQ3A 2C42A 3MUMP 5F0WA 2CQ2A 2IC3B 1NNDA 1NPPA 1RHQB 2D3O1 2DNOA 1D8ZA 3HSGA 4MIAA 1D09B 3MOJB 1SQGA 2VOPA 1HI0P 3H40A 4EI2A 3C2PA 1B99A 4R5PB 3VAHA 1U1RA 2WSFC 3BGUA 4IH5A 3BSNA 2XNRA 1LW0B 1P1TA 2OD4A 3QSYB 2GQQA 2QFIA 1HHSA 2YWKA 4CRJA 4Q0BA 2KKHA 2GJ2A 2HKEA 2M7SA 3I31A 2KH9A 2IM3A 1NZ8A 3UFCX 3MEGA 2PI4A 4ECXA 5A2QU 2DVIA 4DSLA 4QOTA 3TX8A 1JLGB 3CIZA 3MUVP 2W9BB 1RT3A 4KGMA 1KNZA 2IRYA 1NSPA 1CSJA 3BKFA 3BZQA 3MR3A 4PWWA 2C2RA 2DR7A 3V2UC 4F7VA 2HHUA 2ZUGA 4RNFA 5BR8J 4WTOB 4DX8H 2ZHBA 1BQNA 2E1AA 3AY0A 4CM2A 3QRRA 4WP3A 4JV5J 3KLIB 3PRBA 2OTLS 1VQMS 4LJMA 3KK3B 1KQSR 4F02A 4Y00A 1VBZA 5L38A 1CC7A 3PY8A 4V19J 4OX9J 4QWBA 4ANDA 2AV5A 1R8PA 2HS3A 1H7WA 1MROA 3GR0A 5KG3A 3ZZYA 1HR0J 5A8WB 1Q8LA 4F3MA 1LV5A 4DF8A 2OD6A 2VB6A 4CTAB 4USUA 2Z57B 1J5EF 4WE1B 3H5UA 5AXLA 4OI0A 3VAKA 1VYAA 2JEIA 1R8BA 2ZBCA 3EXCX 2FZGB 3LQVA 4R8UB 2X7IA 5GAHI 3OVSA 1S6UA 2Q6CA 1FNOA 1YRXA 3MPVA 3W3SA 2PT0A 3HHEA 3TAQA 1KVKA 1VC5A 1X31C 3MCOA 4OZNA 4J9PA 2DRBA 1K73T 2CRLA 2P6SA 5FDLB 3IG1A 2HIQA 4TLRA 3G8QA 4H4MB 5DDPC 2JFDA 1VHIA 1CC8A 1JLBA 3G8SA 2NXEA 3SQGA 4DL6A 2G0IA 4C8NA 2I5JB 3SMZA 3DRPB 4PPZA 2EG1A 1Z4UA 4OZJA 3DYAB 3T1YF 4D3GA 1MMDA 4UOHA 3B54A 4CO4A 4EBDA 3TA1A 2ZZTA 4YS2A 2J0WA 2R7WA 1HI1A 5B08A 2WVCA 4IRKA 4OI2A 2Y0BB 5HMZA 3PDNA 3JTOA 4CIOA 4DUYJ 4QR1A 2ACMA 2FC8A 2K2PA 2RB7A 4HT7A 3MAHA 1TUVA 2KT3A 4OYBA 4FYXB 2MSTA 2MGZB 2EFGA 1MWYA 3BSOA 3GYGA 2OH2A 1AROP 2WVFA 4LFCJ 1LFWA 3SV3A 2IIHA 4HVZA 2P9EA 5KG7A 6FD1A 2DEJA 3ZO7A 2ABYA 2VPWB 2AEMA 2MQ8A 2QRRA 5DG8A 1U7LA 4QWAA 3CTRA 1RJJA 2D3ZA 1YJRA 1WC4A 2DNLA 2EPIA 2W2OP 1KQFB 4FZVA 4A8KA 1NB7A 2CJAA 3LGHA 4EUVA 3MOZA 4FVMA 4LF8J 2IBKA 3GR1A 1NJIT 1XNQF 3LAKA 5L1JA 4O3RA 4ERDA 4MK8A 1IVZA 1NO8A 3I0RB 4A48A 1VK8A 2B43A 4I67A 2YNIB 2YWGA 4U67Q 3R5BA 3MR6A 1D0EA 4X4NA 1H2UX 5J2NB 1QAJA 3DRXA 4OYXA 2LU2A 3KJQB 1MN9A 3ZNJ1 1PCAA 1N5QA 3EICA 5KFMA 5KFKA 4ITSA 1IM4A 2E5IA 5CD4H 1UA0A 3R7SB 1JLAB 1AA1B 1GFWB 2GVZA 2GC8A 3SCJE 4ES3A 4Q5VA 2CWKA 3GIJA 2UZAA 2EFVA 4CO2A 5B0DA 2M8DB 4ILMA 1RWKB 4PYAA 3BDPA 1T9UA 3I82A 3IWXA 5L8RC 4NLOA 1F5CA 3MTKA 3GLJA 1DLOB 1YX2A 1SQFA 2FGCA 2JVRA 4U9RA 1FJEB 3EVWA 3KDNA 2H48B 4MK7A 1H2TZ 1HWJA 4Y28C 3K59A 3I0RA 3RBEA 1FXDA 3FJ2A 4JI8J 1YK9A 4LF4F 1VMBA 2VQFF 2Q43A 4Q8EA 3V4IA 2CVIA 2JSXA 5T7LA 4WZQA 3MFIA 2Y0SD 2AZ3A 2XLJA 3CJRA 1ZH5A 4PWDB 4I1TA 4WIIA 2YPYA 4LF5J 1I51B 4KH0B 3ENWA 2R2RA 2OPPB 4KC5A 1A7GE 3JSMA 2KZMA 1TV6B 5A8RA 1RWVB 4CH0S 3AA8A 3KMSA 1XERA 2XMVA 3GV5B 4KHMA 1BWEA 1MNEA 1CJUB 2MQMA 3FBBA 4M5LA 2ZFHA 3ELHA 4DPXA 1UVNA 2IYGA 4YDXA 2WCXA 4M5IA 4WKRA 2QX0A 3EDRB 4ID8A 5IS2A 3KK3A 1YITS 2Y8WA 3PRVA 5IM0B 2H1YA 1CJTA 3KJVB 2PN6A 4EEYA 4DS4A 2H5IB 1JLAA 2VPZB 4KT0C 5D4PA 2EWHA 2N4DA 3BKTA 4O0IA 4R0EA 1OO0B 2AZ1A 1Y3JA 3OQ2A 5J2MA 1X4HA 4LF7J 2LVWA 1SUQA 3BGRA 1HBMB 4FKXA 5CZVA 5C24B 1PO6A 1QSYA 2MPUA 1R0CB 4X4OA 2DHXA 2V8HA 3HK2A 4QYZJ 2G4BA 1RTIA 2WB1D 2D9OA 3A8JA 3EGWB 2ZUAA 4DPWA 3JSMB 3OT9A 1WD6A 3R7NB 5J1PA 4DFMA 4YDDB 2HMIB 4ES1A 4LMZA 2U2FA 4IG0A 4K2XA 4NL5A 5M2RA 2KM8C 2H5JB 1SJ1A 4UTGA 1RT1A 1RHUB 4O23A 3ULHA 4B08A 5DQGA 4ILRA 1N36F 3IC1A 1REGX 3NRBA 2V6AA 3FSYA 4MYTA 5D0EA 1WC6A 3EPGA 2DNGA 1WTFA 2GVDB 3TJ8A 5H9EK 3HP6A 1WF1A 1U1QA 2RRBA 1UAWA 3ENAA 4PUOB 2R7SA 3VWSA 3OJSA 1Q4RA 5DDOC 2JJ4D 4J37A 3VQSA 1SC4B 1QSLA 4O3SA 2FY1A 2V8GA 4E8UA 2A6MA 3VHQA 1Q7YT 1QDUB 5GMKa 2HNZA 1JNRB 3HHDA 3L09A 4UOFA 4HDHA 4ZP7A 4WU3A 3TR5A 3FQLA 1E6VA 1WOPA 2V5HG 3UW1A 1XWLA 3BYPA 1H38A 1TR0A 3AXKA 3IA0A 3QQCD 5HJYA 4X64F 3TA2A 4ZPCA 1KTVA 3AB4B 3H5YA 3I0SA 4J91A 5E5NA 3TVKA 4CCHA 3E2EA 2IY5B 1E6YB 1Y4ZB 3PHEA 3QFHA 2YKAA 4KPYA 5EHHA 1VQLS 2ASDA 2R8GA 1K9MT 5CD4A 4H4MA 1FRMA 4F3OA 4KAIA 3CO0P 3JSBA 3WX8A 5DGAA 1U1OA 3IG1B 4ILLA 2FD2A 4QIWD 5GAEU 3QIDA 2W8KA 3RTVA 2X3GA 4K8RA 3N6NA 1JLFB 4O3OA 1FFSB 3GSIA 4L72B 5GADU 4ED6A 1EKRA 2DH8A 2ASLA 4M5MA 4P7VA 4EFAC 4Y3CA 1RBOB 1EX8A 3W64A 3JSRA 3GFZA 5DM6Q 3G6ES 4HTJA 1LFPA 3KHLA 1OYEA 4IOAQ 1P6TA 1BE4A 5IT9Y 3VGUA 2ZWPA 3IS9B 3M7VA 2ZKTA 2CXEA 2QSWA 2DGQA 1EHWA 2WSEC 1FE4A 2XSFA 5LSLA 4OYPA 1TUWA 1RYRA 5CH7B 2E7VA 3OV7A 1B0VA 2RDIA 2VUGA 1JLQA 1UPPA 3KLIA 3N0VA 4PWUA 4DR4J 1TQLA 1VRTA 3CCSS 1HARA 4ZVOB 1WC0A 6AT1B 2DHGA 3POTA 5HVFA 4P9SA 1HBNA 3SCKE 2R42A 3M8PA 4AUKA 1U2FA 1FD8A 3BV8A 5E3RA 4BHQA 4ZOSA 5DDRC 3G6VA 4J9NA 4DR3J 4NLRA 2XHWA 4OJGA 2JC1A 4LT6A 3DYAA 1HWKA 3UD3P 5F8MA 4OZ3A 4ELUA 4B3SF 3U02A 3CJ0A 4JI6F 3NGTA 2XEXA 4ECUA 3RB0A 5H9EJ 5DO2A 2HNDA 1FJGF 4F3QA 1RU1A 2QG9B 4UQTA 4DN0A 5KFDA 2QV6A 3LWMA 2K1RA 3W60A 3K0JA 1WI6A 5K14A 5D15A 4DSJA 1X5SA 1YQHA 2V9KA 1IXKA 2E7XA 5AXKA 1AZSA 2EK1A 5FDLA 4YUDA 3TVZA 3DDNA 2AP6A 2VFTA 3SZ2A 1CS4A 3M9MB 3DLBA 3CWJA 4KFBB 2LCWA 4NLDA 2BJ1A 4ECSA 2RKIB 3R27A 2OUGA 3GFHA 3ET6A 4ZVHA 1SC3B 1TL5A 3ZZRA 2PFDA 4Q7AA 3ISZA 2CNLB 2ZEJA 2OFGX 2AJ4A 5A8WA 2F40A 1N6QA 2XI3A 4FBTA 2KI2A 1FDBA 2ZDOA 2HQFA 2W1BA 4F26A 2XMAA 5KG2A 3EX7B 3CCMS 4HEA9 1WHXA 1SH2A 1K8AT 4NPOA 2BE2B 3MMAA 3M9NB 2HQDA 1EARA 2CIMA 4I68A 1IN0A 1NH8A 1KQKA 2HGLA 3TI0A 1SL0A 1YBUA 2JLFA 1ZM3A 2IA0A 3J81Y 3BYRA 3GIMA 3S6EA 1S5ZA 1WOOA 1KONA 4ECWA 1U0HA 2HURA 3UN2A 3FDSA 1RK8A 2FYXA 3V6JA 1XC9A 2B9WA 1Y5LB 3D3BJ 3BO2A 2D3UA 1FI4A 1S0OA 4W4MA 3MPDA 4OLOA 3CJTA 2QEXS 2ZHOA 2B5JB 1YBTA 2B6AB 2F3JA 4LREA 4F4KA 2HLTA 1Z2LA 3BQ0A 5SUHA 4NOHA 5GMDA 3HCXA 4LR9A 8ATCB 2R4FA 3HPOA 2G13A 3OFGA 4ZK7M 3M6XA 4HI1A 1SJRA 4P7TA 3JB9k 4E98A 3CB4A 4KE5A 2XY6A 1VDHA 1UEKA 4WYLA 2XMKA 4ANCA 5AT1B 2BANA 2DH9A 3AD8C 2HZVA 4V1Ak 4UY85 1JLCB 1HFEL 3JSYA 4F4AA 4RNHA 1OSCA 2JX2A 3DLGB 4K2JA 4DPUA 5LMUJ 4B3MF 1FT8A 4NYZA 3MD1A 1C0UB 3GIRA 2ROGA 2ZZMA 2D9PA 1WSVA 4QBUA 5D3GA 3CCES 3BGFA 2GA7A 2DYAA 3UPFA 1LNQA 2R8IA 1IQTA 5E7OB 3KLEB 2UXDJ 3OR1B 4KQZA 3LAMA 4DV7J 4ZDNA 1VLYA 2CUYA 4G1QA 2M70A 3CT9A 5EN1A 5IWAF 4N47A 2W7OA 1C4AA 1OY9A 1XBWA 1WG1A 1QVGR 1JK9B 5B0BA 3CCQS 4DL5A 4ZPDA 4RUHA 2UXCF 1HNVB 2LQ9A 3I5AA 2V2VA 3PEHA 3K58A 3PW4A 4HKQA 4QU7A 2VG7A 1BHNA 3QJLA 4GRSA 1L3KA 3KUGA 3PNIA 4RU2A 4P72A 2CPFA 1HR0F 4AFFA 4OI4A 3R5AA 3THVA 1QTMA 2EFNA 2ZVIA 4MKBA 4ZP6A 3RBZA 2HGMA 2A2DA 4HACA 4LFBF 1IBKF 4ZPTR 4XTTA 5HMWA 2U1AA 1M5KC 1SVDA 4UOCA 2EKNA 1RWWB 4N77A 5F0UA 2FHJA 1S99A 1WACA 4YB7A 1VS3A 3N01A 3OUYB 1KEKA 2R7RA 2AGOA 2NREA 5CAAA 1F2GA 1ZM9A 3HSJA 1BUXA 3ZTOA 3HVWA 1MWZA 4DUZF 4ECQA 3RRHA 2L48A 3QIPA 3TZWA 1XR7A 1KSPA 3TA0A 3J7A1 1XIQA 5IC6B 4C11B 1N5VA 5DETA 1D3WA 5IWAJ 5F8GA 4YN3B 1N5SA 1E6VB 3MM5A 5FLXY 1C2PA 1T8EA 2DR9A 2AGPA 3SI8A 2E9ZA 3M30A 1ROFA 4LF9J 2KG0A 2BRLA 2FLNA 4JI6J 4LBPA 2G1DA 1XR5A 1R0BG 3M6VA 3OXLA 3RJMB 5C2GA 2MQPA 3EPIA 1D8YA 1GMWA 1WHYA 2OLWA 4LSZB 4NYPA 3A8IA 5IQQA 2RDDA 6FDRA 3CCTA 4GKJF 3HHLB 3AOCA 1B3TA 1YLXA 1BLUA 3RB4A 1YTYA 2WW4A 3A3NB 1YJ9S 1IBKJ 1T9TA 4I69A 3J80U 2E5LF 4B9SA 4M5GA 4USKA 3UVJA 1Y11A 1DQAA 2IJRA 2KU7A 4RW6A 2YX1A 5J2QB 4OI6A 4ZVFA 3LF0A 2AF6A 2HLUA 1OJ4A 5D78A 4IG3B 3T9NA 5KT2A 2HMIA 4KTQA 4ENOA 2HHQA 4NASA 3PV8A 1YZ6A 1DTTA 2MLZA 1RAFB 3DXBA 4RW9B 2CZ9A 4OJ1A 3TUZC 4YR0A 1VQ4S 4IQXA 3VGVA 2F65A 2OSQA 2PO4A 2R7TA 1NSKL 2RE1A 4IDKA 2I6WA 1VGYA 1RT4A 4DX7A 1VHFA 3NLCA 4AT1B 4ZIVA 1XNQJ 2YNGA 3U1MA 2A10A 4B3RF 4DL3A 3D0IE 2ALZA 3ICLA 4FDFA 2IDLA 4GVLA 2KRRA 4PXBA 5EWFA 1RACB 1X4DA 4IFVB 3W2WB 3W5XA 1XJWB 4QIEA 1RAIB 4YOEA 4QCLA 2CADA 2Z0GA 1MWQA 4JI5F 1SJQA 4LVNP 4KHPF 1AUDA 4Y34A 2M5YA 1WG5A 3M8SA 2OPQA 3R2CJ 3KNAA 3MM9A 3BGLA 2A1BA 2GMLA 3RG6A 2FB0A 5LMNF 3LH2S 4LRAA 2M4MA 3CXCR 2K3IA 4DPTA 1ZZNA 1RP5A 1FJCA 2ASJA 1RTDA 5I42B 1NM2A 2AKWB 2YH1A 3PEJA 2M8HA 1CJKB 1XEZA 2N7CA 5HROB 1JJ2R 4I2PB 2WB4A 3ENQA 3OXGA 3S8SA 4C8ZA 5DQIA 3TEHB 4RNNA 5HN0A 2RH3A 1DTTB 3CO9A 1SH3A 3CUNA 3OD2A 4Y2KA 4JUZA 3OSPA 2HW3A 4PCQA 2B4PA 2IM0A 1RT6A 1E6YA 2LU1A 4XPCA 4DF4A 2HHHJ 5BR8F 1X9SA 3O2IA 1FEEA 2ZC3A 3OTCA 4PXEA 2CPDA 2BMBA 3KK2A 1WTBA 1DLOA 3CD6S 4DR6J 2CFXA 1JXEA 2CPIA 3MWBA 4F04B 4GC6A 2GIRA 2LDYA 4FNIA 3KTQA 2F4VJ 1A9NB 2QMWA 4ZJOA 4K59A 4OX9F 3DLEA 3VVTA 2B6AA 2VFUA 3BEGB 5I3UA 4OYMA 1S77D 1C1CA 3GJQB 4XPEA 1S1VB 2XI2A 2GVZB 1XMQF 2ERRA 4C8KA 2VBZA 3D6MB 3PJWA 1VBXA 3DLLQ 2RRAA 4FYYB 2ACYA 2QLBB 3H8YA 2FIUA 4ZLLA 4K4YA 2VQEF 2D69A 1FHTA 2E1RA 3GP9A 2KFNA 3NS5A 2V8VA 3T5LA 2OFHX 1FKPB 3SDEB 4I64A 2CQCA 2WONA 1S4EA 2PC6A 1KD1T 2RF2B 2V4RA 1F60B 4DV4F 4LSLB 3UCUP 1C1BA 3VAGA 4QWCA 1TL4A 3IGNA 1S9EB 2NR0A 4ED2A 4EWTA 2MQNA 1T9VA 1HHQA 3TAMA 2DXEA 5ADZA 1K1SA 3ZC4A 2RQKA 3M8QB 4JI1J 3PX0A 3FEZA 1KDNA 1T05A 1WF2A 1S1TB 4FP9A 2J8AA 2BXJA 3P5BP 2O5DA 1X4BA 4N8OA 2GMHA 5DDQC 4M5NA 2GO9A 2J0SD 2XMWA 4X66J 4J9OA 4OV1A 3T6BA 1NDCA 5AE1A 4X4SA 4DUYF 2KVQE 2V2ZA 1KLMA 2VZ9A 1OPZA 2VBYA 1UVMA 2HNDB 4PG4A 1RXOB 4DV5F 3NKYA 2ZOMA 3MM7B 2DY9A 1JNZB 3UNGC 1W7WA 5ETMA 2FY8A 4BCAA 2ATLA 4K4SA 4ZVRB 3RYLA 2DNZA 2YKMA 3N79A 4CWBA 4K4ZA 2DNYA 2HVDA 1UCNA 4I2QB 2X51A 4OQJA 1HBUA 4TY8A 5SZTA 5DGBA 3DI6A 1WC5A 4J9VA 1UEUA 5JVGQ 1U1PA 4K0KJ 3CD7A 3KG1A 3IRXA 5DQHA 1KFDA 2RUSA 1S9GB 3AOAA 4LRCA 4ZCKA 4KSEB 4NYOA 4ZPBA 4CQ1A 5L1KA 4DV0J 2GGPB 3ITHA 3W61A 1U26A 2Q6BA 1L3VA 3C6UA 2VC1A 1UEVA 1P1LA 1OYDA 1ZM2A 4LUBA 1K1QA 1TUGB 4K4XA 4R8UA 2ZH6A 1N48A 4IUFA 2FLOA 3WZ0A 4BC9A 3HVAA 2RVJA 2ZH4A 3T5HA 4CTAA 4URGA 4C3LA 1JLFA 2E1CA 3ZNUA 1N5YB 3K5MA 2PD1A 3G86A 2UP1A 1FFGB 3FCVA 1V9OA 1K0VA 5KFFA 3N28A 2QTWA 2Y1RI 3W9JA 1BGXT 2P2CB 2QA1A 1YHQS 5ETVA 1FESA 4Y6IA 2JH3A 3U1NA 2XS5A 4I7FB 3VQTA 5DG9A 1S6PA 3FZ2A 4DUTA 2YVSA 2HAIA 3QGPA 4XIUA 2DR8A 2J0QD 2WOMA 4LFAF 3HHNB 2J7KA 1VQOS 3PYEA 1C0TB 2IYIA 1OQ6A 4EZ6A 3G9CA 2CPJA 5KFUA 4J9SA 1WKJA 2BM0A 1GXUA 3DLKA 3IFEA 1OY6A 1S48A 2Y1LB 3IAM9 4O4RA 4A46A 4GO7X 5RUBA 4DL7A 3NBPB 3RB3A 1R7IA 3OFHA 5HBMB 3EYZA 4CYUB 1EZZB 3FBEA 3RB6A 1WHWA 1Z1ZA 2C28A 1HQEA 1MMNA 1VI7A 2B4UA 4EGLA 3G8TA 2UU9J 4B3OB 4Q0BB 1IKVB 2RNEA 2J9EA 4WWSA 3TNVA 4W90B 3CDEA 5DLGA 3SSQA 3EMTA 1TK8A 5KFOA 1Y9OA 2MQLA 2MEWA 3KG0A 2GV1A 5C42B 4PQUB 3VGSA 3TQ1A 1LEOA 1S7HA 1QUPA 5B7WA 3PHTA 4DSIA 1WWHA 2BM1A 5CYMA 1WNEA 4UF4A 3KLHB 1KOHA 2MY7A 5BXIA 3H5XA 1SC1B 1RADB 1AZSB 2BW2A 2CQIA 3SBMA 5KFIA 3FNNA 1QLNA 2IJNA 2YNHA 3PIPQ 1RE1B 1S79A 2V4JA 4LBHA 5IT4A 4LF7F 1RCOB 1BC6A 3FFIB 4LFAJ 1U49A 3R6GB 2FTRA 1S1UA 1RTIB 4C6AA 2RD5C 3TZYA 1YBAA 2V0NA 2IRUA 2HEKA 1TELA 1HQ2A 2QL7B 2G1HA 2QGFB 3D1OA 5D4NA 4JI2F 1CJVA 2KJWA 4AQYF 1KC8T 4P2FA 2HAFA 3AH6A 3UD5A 2KZZA 3KLGA 2HYIB 4K4UA 4KBIA 3DRPA 3H25A 4LVOP 3CPWR 5HP1B 4YY3F 3J7AN 5C25B 1LWFA 4WTYA 1VRTB 1EIYB 1L3UA 3NOGA 2UUAF 4ZJQA 3DM2A 4ECYA 2IMOA 1NAQA 2HBRB 3CDAA 3FQKA 4KGZB 1YJUA 4PZVA 3TX0A 5KOWA 3J81U 3D67A 2DK2A 3HT3A 1NPRA 1SJ4P 3MEEA 4LF1A 3UQSA 3CCLS 4IO1A 2WRMA 5CYMB 4CLUA 3M8QA 3IR7B 1IBMF 3CMES 1H74A 2CZ4A 4F2RA 1ZS6A 5HK4A 5F8LA 2CJKA 4IR9A 3BF4A 2WAQD 4ICLB 1TMMA 3EUNA 2XWXA 4UT4A 3PFEA 5KT4A 3I55S 2NS1B 3IBCB 1A6LA 4PQAA 3U7JA 3ZZOA 2ZH1A 2HQ3A 4K4TA 2QMUB 3TUJC 1KFSA 3R2DJ 5KTQA 2R8JA 1RKJA 2HFVA 1FDAA 2H54B 3BREA 1TL7A 1N0VC 1FK9B 2JC0A 1PJ6A 2XCPA 5C25A 4DQQA 1QVFR 2JEFA 3CGIA 1JB0C 3WC2A 3NP5A 3OFFA 3C8YA 1RWOB 2E5JA 3QWUA 1PBAA 2G0JA 2FDNA 1NJYA 5ETNA 4X2BA 1C1CB 2ZVSA 2Y3YA 2BABA 4C8OA 1V5VA 4YHHF 1KVIA 4F25A 1Y0HA 3L4BC 1KLMB 4M8LA 1ZBTA 4RW7B 3OTOJ 3US5A 3W63A 1RKIA 2C2KB 1Q53A 2V8DA 2FPHX 1FEHA 1JQGA 1LOUA 1QTNB 1RTHB 4F4WA 4DR7J 3Q8SB 2ZWOA 2NUHA 2PE8A 1S10A 2GVDA 1ULRA 2YNIA 3KLHA 1M90T 2XLKA 1AFIA 2VV5A 1Q79A 1KP6A 3QO9B 1HNZF 2AIRB 2KHDA 3NG8A 3VAIA 2CQBA 2EK6A 2N7YA 5B0EA 4GKKJ 1Y10A 2ZITA 3I9V9 3MPYA 3K89A 4PR6A 2UUCF 4I2PA 1RA6A 1F9FA 1GMWD 1S59A 2CZVC 4FKYA 4LF2A 4IRCA 4RUBA 3ZTSA 3IO1A 4LSLA 2LMIA 2JRSA 1WKKA 4L76A 2XO7A 3L7OA 2GS8A 1SKUB 2K3KA 1XK8A 1BMQB 4DV2J 3I96A 3WQPA 5HBMA 2LLZA 5CHCB 4DR5F 8RUCA 1N32F 2H3EB 3J80Y 3TEGA 1HNXF 2VJVA 4UOGA 3GPAA 5D77A 4Q8FA 1S6PB 2I38A 3BB5A 1FFWB 2EBGA 3KJNB 3QYYA 1S1VA 3GJRB 4ZHRB 3UR0A 2VA3A 2C2ZB 2IVFB 2W24A 3KJVA 2YX7A 4YR2A 2FVQA 4M94A 3IBWA 4GVBB 2O3DA 2IJFA 1TL3B 1FVQA 3BSCA 1AT1B 2XGPA 2QE5A 1NUEA 4HDGA 4USVA 4DL0C 1S6OA 5D8HB 2KM8B 2YKQA 1S1TA 1WORA 3O5TB 4MH8A 1M5VC 3PKMA 2C2EA 3MI7X 2OEMA 1TKTA 3ETMA 3UDEA 4WFAQ 5LMUF 3HMJG 2JNJA 4RR5A 5FD1A 3OHAA 5HO4A 2FZKB 2UXBJ 1U45A 4WFXA 2YKNA 3DU6A 2XY5A 3MAAA 1X7VA 3W2VB 5ETOA 2Z30B 5IQ6A 4DR1F 2BE7D 5KFQA 1L3SA 2IA6A 1WEYA 4B9NA 1U6BA 1N54B 2L41A 4ED0A 1Y5NB 4PXCA 1OWXA 3VGTA 4UY8T 2BRKA 2MZTA 2RQMA 4CNZA 4OJHA 5LM7E 3LP1B 3GJSB 1QSSA 4RO0A 3CULA 3MMCA 4PABA 2DTJA 3RUBL 2FVCA 1ZTWA 1VRQC 1RWNB 2EEYA 2M2BA 4KYZA 2XNQA 3MPUB 4CM0A 4OX6A 5CABA 1HBUB 4TY8B 3WC0A 4NLVA 4IO9Q 1W26A 3MM9B 1IBCB 2EFOA 2I1RA 4I4BA 5H9FJ 3W65A 2HHSA 1R89A 4TN2A 2W2QP 2YKMB 3NCRA 2JVOA 2BQUA 1O8BA 2VQFJ 2OHDA 1FKOB 3M30B 1V3ZA 1P9QC 4PXDA 2RRNA 3C19A 3JAMU 2Q66A 3NCQA 2PMHA 1JXLA 1YDLA 2CQ3A 2VASA 1BQXA 2QZ8A 3OBIA 2ZC4A 1VQSA 2HRTA 8AT1B 4S0MA 1X4CA 3GYXB 3PACA 2HSEB 4UZBA 2YNGB 4NZ7A 2QO3A 3QIPB 3SCIE 4IDKB 1FRXA 4NZ6A 4DR1J 5DLFA 3LP0A 4DUZJ 1TZ0A 2N3OA 5K9FA 3T1HF 2IMWP 3A1YG 4ZVTB 2J0XA 5AXNA 2CJ9A 1RWMB 4WF9Q 3TVYA 4JI4F 1ZTTA 1ITPA 5B09A 3LPEA 4ECZA 3GE9A 2A0FB 4PG8A 1LW0A 3L9ZA 4HACB 4CT9A 4DBQA 5I42A 1UW9A 3DGPA 4U8YA 2MKSA 3D1HA 1U2CA 3T6JA 5F9NA 3R5CA 2QJ3A 2YWHA 3SSSA 4OI3A 2YPZA 1GXLA 4KGVB 3W8GA 2OEJA 1TMJA 1B0PA 2HG4A 4U96A 4HHJA 2HRUA 3MURP 1KTQA 4O0NA 3CF5Q 3M8ZA 4NLTA 4E0DA 1HNWF 1LQ9A 2QA2A 1RZMA 3CJ8A 4NRTA 2BX6A 2PI5A 4QR2A 4ALZA 3HO1A 1FX4A 3K8WA 3M2VB 1J2VA 3IM9A 4LF6J 4XAKA 3OL7A 3GCXP 2EFQA 3P3DA 1EJ7L 4NCGA 3L95X 4KH1B 4OHZA 3QRQA 3EZOA 2VQEJ 1UVKA 3H2UB 2EFPA 5IC4B 3QT6A 4HR2A 3V6HA 1RAOA 2KT2A 3FSXA 2PEBA 2W4CA 3S1TA 1HBOA 2EG2A 2E5HA 4JI8F 4Q44A 1FJGJ 1D9AA 2VKZG 1FJ7A 3DLGA 2MSSA 1IKWA 4NLWA 2DXFA 2VFRA 3D6HB 3HT0A 1JKHA 2DHAA 4ED1A 1O51A 2FJDB 4DV4J 3KKFA 2MLXA 5F3ZA 1YJWS 4LBIA 3QWPA 2A18A 1SC6A 2V68A 5ETTA 4P52A 3AFGA 1LW2B 4FS1A 2AJQA 2OELA 3OW2R 1SXLA 1KOOA 3QT7A 3CNQP 4WIQA 2CWXA 2VBXA 3OJUA 2HVZA 2F9JA 4BDPA 1PGZA 5CYJA 2ZE2A 2FZCB 1JJ4A 4DSFA 2WVBA 3HHLA 1NCLA 4L3KA 1IBLF 4ZHRA 3M2VA 1UZHA 4BWMA 2DGSA 2J6SA 5AE3A 5KT5A 2YKPA 1ZYQA 3IMQJ 2HK2A 3KK1A 2C2DA 4BBYA 4C2MA 3BO3A 3O8WA 4OL8A 3EXYA 5GAGI 1TKXB 2BR0A 3QPIA 2AX1A 4G1QB 1SCJB 3MMAB 2CPYA 5L46A 2OIHA 4YB6A 9ATCB 1DBDA 1EB0A 1PC5A 2H4WB 2KT5A 3GCWP 3IXQA 1KQGB 2WBMA 4KGXB 5A0YA 3KLEA 4DR2J 3WDOA 4C11A 2VDIA 4MKVA 1U25A 2AEFA 3V81A 4KKOB 3A3PB 1T02A 5FIIA 2ZD1A 4DOZA 1V3RA 1CQMA 2HS0A 1H73A 3TUIC 3T1YJ 4EYIB 3PX6A 2E29A 2ZBIA 5IV4A 4KFBA 2CJXB 4RW4B 4U8VA 1YIJS 1IJFB 3M6WA 5J1NA 4F2SA 4IG3A 1NJZA 2LDIA 3FKBA 2HIYA 1RAEB 3ILLA 3OL8A 3G96A 2RQCA 4YP3A 3B4MA 2WTFA 2QA4S 1BD6A 2LEBA 5J2QA 3LP2B 3P45B 1VCTA 3I9ZA 1IKXA 2CG4A 2K7KA 5L9NA 4X65J 4RZRA 1TP7A 2ZH3A 1F0XA 4GC7A 2OSRA 1NDPA 2CJYB 2O01C 2HQIA 4JOUA 3A12A 2XYHB 2VJUA 1Q82T 3Q8VA 5E3CA 3WBZA 3NWGA 1N52B 4KR0B 3V81B 1NK4A 5EX0A 5F8IA 2G2YA 2Z2MA 2NXNA 1S1XB 3OHBA 1A0OB 1QUVA 1U0HB 1QE1A 4J5OA 3M8PB 1UFKA 3ZZUA 3OLAA 3CIMA 2ROPA 3NWRA 4X64J 3NAHA 1JLQB 3NY0A 3K7RA 1TKDA 2HWHA 3G82B 3MGJA 4OHXA 5E3AA 2XS2A 3DXSX 3MM6A 1OS5A 4QJVA 1JLEB 2CQPA 4G65A 4LR8A 1Q86T 4NLPA 3Q8UA 3CJQA 1N6QB 4NXNJ 5U47A 1CPZA 2B56A 2LA4A 4HL9A 2YQ1A 4XDDA 5DS7A 3UNYA 3VV2B 2QSFA 2MZRA 1D9FA 3W7BA 5D4OA 4I6AA 4ICLA 4ANEA 4C9DA 4TNOA 2PMWA 3QAEA 4TY9A 5A8KB 2B8PA 4DLEA 2NLWA 1H3DA 1IR2A 3FRYA 1R6VA 4WP9A 2BBEA 4BC7A 2ZH5A 1J5EJ 2LA6A 1WHVA 4K4WA 3HJVA 4CLYA 5F8JA 1M5HA 4Y2CA 2R8HA 2ZJQQ 4H4OA 4O4GA 4YFUA 3T5JA 1D1UA 1REVB 3D0HE 5A8KA 2JZ5A 4PPDA 1JJCB 4QIGA 2M0GB 1SKSA 1ZZFA 3N6MA 3NEKA 2FGOA 4YMEA 1WEXA 4PKDB 2CAJA 4OV6A 4RBUA 3CC2S 1FTCA 2AEJA 5HP1A 4FYVB 1NHUA 5BYRA 1KHVA 3I5BA 2XSJA 2QL9B 4CO3A 5DM7Q 4M95A 1HYSB 2G9OA 2DEIA 3CD5A 3MR5A 3IM8A 3D4JA 3MECB 1U09A 4AXJA 3R5GA 3PXGa 1HBNB 5I3PA 4FN5A 3HHLC 3VR1A 5GAHU 2XMJA 4NXNF 3H2VE 4TU7A 3A8EA 4IOCQ 2XS7A 2MYFA 2PA8D 2V4JB 2DGVA 4RBTA 3KUHA 4F4ZA 4ED8A 1M5OC 1DRZA 3EVMA 4RW8B 3TJ9A 5CCMA 2XYGB 3PIOQ 2I8EA 3NOCA 3CJSA 2P9GA 4CO1A 3ET6B 3P5TL 5IFMA 4DG1B 4Z7CA 2C3UA 2BUNA 1SBRA 2HVIA 2D7SA 2RSQA 2AQ4A 3D28A 3GQCA 2Y9HA 4U7UD 4QZVB 3R3TA 3F73A 1RDRA 1ZA2B 5J1EB 2DKOB 3C14B 4IR1A 2NZ4A 2FJXA 3C46A 3T9ZA 3U27A 5CXTA 2EKYA 4CYUA 1MW7A 1PG5B 2CDRB 3CDWA 3HFVA 2FHJD 3NBPA 2XULA 1GT8A 3DLKB 1AFJA 3AJ2A 4DV3F 2D74B 2MHEA 2MMYA 2HRYA 4RUAA 3QFWA 1VOMA 3TRGA 1R43A 2GZOA 3UN5A 3W66A 2KFZA 5A0YB 4DI6A 5MLCV 3HKWA 4A47A 5KFHA 4I7FA 1Y5IB 3LALA 4XK8C 3BGOP 4JI0F 1FWKA 1WKLA 2BE2A 2J9DE 2AWZA 2X1FA 2KO1A 3H20A 2RHQB 3I4PA 3CJKA 1RHKB 2ZJPQ 1FNXH 2DNMA 1T9XA 3OTOF 2OPRA 3PM9A 1Q78A 3IS9A 2UVWA 2C1EB 2BDPA 4DDFA 3BBCA 2X1GA 5T41A 2GHVC 4MMOA 5HVHA 5HAOA 3BM7A 1HMVA 2D41A 4BLGA 1LWXA 4L3NA 3HDSA 4EO8A 2NXUA 3OXFA 1PAUB 3C6UB 4F36A 4EBEA 2XG8A 4ZS6A 1GH8A 4PWDA 2GGPA 3ITHB 5LL6d 3R6LB 4ED3A 1SKRA 1VQ5S 4JB8B 2OPSA 4QWDA 2VBWA 2DPIA 1UPMB 2BOAA 3CMQA 3DGVA 2W8LA 3K2YA 4J9LA 1YJNS 5LJ3Y 1LWFB 1RQ0A 4FXWA 5E3PA 2EC0A 4B3SJ 3I0SB 1Q0NA 2DIUA 4LF6F 2VPXB 1MU2A 4YY3J 3VZHA 1IKYA 2E7WA 1KHWA 2KRBA 2W2NP 1VRUA 2QLXA 5H1SV 1N0UA 3HZEA 4XO0A 3R1LA 2DR6A 2VA2A 4DV1F 1TL3A 2Q3PA 3N6LA 3V6DA 4K4VA 2DJWA 4CH1A 3A8KA 4W98A 4NCGB 5F8HA 4F8RA 1S1UB 2OP5A 1OQ3A 2XBPA 2MY8A 2HFNA 4N8NA 2BQ3A 3KHGA 2CDQA 4IFYA 3BBBA 2V94A 2DO4A 2GHWA 1NLKL 3QGGA 2QLFB 2V9WA 2DD8S 3KMQA 2VG6A 5HLFA 2HPUA 3H98A 5L9XA 4CLKA 2ZH2A 4ED7A 4OZ1A 2HNYB 1R6YA 3EWGA 3N9UC 3RBXA 3BQ1A 3DKDA 4OZ5A 2DRAA 3M32A 3EVOA 2QC3A 5AXMA 1U2RA 2P5VA 1X4GA 3DGPB 4B17A 2FUG9 1S9EA 3AQOA 3CJ3A 4E2FB 5HMYA 4X4PA 3H4DA 4DR4F 1WC3A 4CLPA 3NMAA 1X4FA 1K44A 1SV5A 2VG5A 3AJ1A 3DLJA 4QPTA 3OVAA 3M32B 3U1LA 5HJXA 1SH0A 5LSRA 5LXYA 4USTA 3UDCA 4K7QA 3IWLA 3KHRA 2FLLA 2IVYA 2LEAA 2B9EA 3A3OB 2CPEA 1HBMA 4Y2AA 1B64A 3EE3A 4ZLJA 1X9MA 3RR7A 3KWMA 2KB2A 1NSAA 4HT5A 3QNWB 1HHTP 4MT1A 2R8KA 4DXLA 4DPYA 4NLQA 1RWXB 4NX9A 4AD6A 1IR1A 2HHPA 1LWEA 3MR7A 5EUHA 1RUSA 4KV8A 1N56A 3P8BB 1MMLA 3OTEA 5I3UB 3G4SS 2HNZB 2FLPA 2HQGA 2ZDPA 2ATCB 3ILOA 2DCLA 2PSZA 5M2UA 3W5ZA 1X0PA 4NMXA 3HD2A 4JBCA 4EMDA 3DOLA 5DRKA 1VRUB 3DOMB 2LFVA 3CW2C 3GYNA 1Q8BA 1CJUA 4WK3A 3KK2B 1T03A 4OIXA 1MG7A 2F1FA 3Q83A 4DHVA 3CCZA 4HTIA 5KFCA 7FD1A 1I3OB 3W5YA 1FK9A 1TL7B 2P6TA 5LJ5Y 2HVHA 3O3LA 4X4RA 2B9YA 4HH0A 3LP1A 1RT1B 3T1HJ 4KHPJ 2DT9A 4I0WA 5L1IA 1CJKA 1SJFA 2YNFA 1UFLA 1RTDB 3V4IB 4B9MA 3AHPA 3ZTQA 1RABB 4G1PA 1HQUB 2CQ4A 4ED5A 2LP4A 2V8PA 3NGUA 2MQOA 2PIIA 4BWJA 2CJQA 2RJZA 1B7YB 4W92B 4ATNA 4F4XA 3IBFB 4I2QA 4OYOA 2ZKUA 4LIRA 3MEEB 3Q2TC 5FLXU 2VG6B 1RU2A 4WXWA 2UVVA 1DY3A 1S49A 1F6TA 2RQ4A 1ZA1B 3CSKA 1UJ6A 1YG0A 1QY7A 2WW8A 4IQMA 4CLFA 2W9AA 4GVBA 1U1NA 1NKCA 3W2WA 4AL6A 4ECVA 2KVIA 3HVTB 4DR7F 1B0TA 1ZAVA 3IWNC 1S7IA 3ADAC 5G4DA 3J7YU 5IM0A 4LR7A 2Y8YA 4B3OA 2IM1A 4WFNQ 2LXFA 5GADI 2RU3A 1K47A 1RT3B 2BJ9A 1Y00A 2CQHA 5F3TA 1HNZJ 5F8NA 5E33A 3TARA 3UN3A 1T05B 1DHMA 2LXUA 3P96A 4B3MJ 1K0TA 4J9UE 4DR3F 1WC1A 1UTAA 2HS4A 1FRJA 4ECTA 1N34F 4DWIA 3NNHA 2HWIA 2VC0A 5C7PA 2OMOA 2VG5B 2M52A 1VQ9S 3C14A 2BJEA 4HH1A 4LF8F 4DV7F 5CCLA 2CQDA 2MJUA 2B51A 4TXSA 3GMGA 3UVJB 4JV0A 4EO6A 4ZVUB 4N7TA 5E41A 3LW5C 1U1KA 4ZITA 5T14A 3KHHA 3QJJA 3DRYA 3FRZA 1I1GA 1V6HA 2IC3A 4QW9A 5GAGU 2NPFA 2CVEA 4C3KA 4X84A 4DFKA 3IAS9 3KXDA 3Q8YA 1T03B 1L5UA 2DBBA 2FVRA 2DHHA 1VIOA 2XMTA 1WSRA 1YRTA 3V5RA 4NCBA 1S12A 3CJKB 1RWUA 4ZLNA 2ZM6J 3AD9C 2F5GA 1HQEB 3R5DA 2MKCA 5K8PA 4F4YA 3HJFA 4RW7A 1O5JA 3QATA 4K5SA 3N5FA 4V19X 3IGVA 3ISND 3GSDA
chains in the Genus database with same CATH topology
2D1CA 1R8AA 1TKZA 2VL1A 1F5AA 3GG1A 4IH6A 3V6DB 4N76A 3MAQA 4Q45A 3PFOA 2DNHA 2DO0A 5HLFB 2BQRA 4C8MA 3RR8A 1ZPVA 3NMRA 3PW5A 4ZCMA 5J2NA 4MKAA 2BYCA 2J9DA 4NLXA 1KRPA 1S72S 2SXLA 1YJVA 3D5MA 2ZOGA 3Q2SC 1Q8IA 3AQPA 4F67A 1CLFA 2IHR1 3OL9A 4CI0B 1XTZA 4I6WA 3ENVA 2DPJA 1Q7LB 4DFPA 1APSA 2FJAB 3SXLA 2FJWA 3FVYA 1N5TA 1TAQA 3UD4P 3LGNA 4DSEA 4H4KA 4EYHB 3PZPA 1N4LA 2OPQB 2UUBF 3IR6B 3HI9A 2WBRA 4ZP8A 4RW8A 4USIA 1QM9A 1O0PA 1NH7A 3T19A 4IFYB 3DI6B 2KHCA 2CPZA 3PW7A 1G2EA 1S1WB 1GX5A 3MMBB 3RZAA 2XC9A 1L3TA 2KXFA 2D3OR 1QE1B 4P2SA 1DFDA 3DCAA 4RU9A 2E9TA 2A2CA 4PRFA 3GB0A 5D6GA 4FF1A 4K0KF 3NNCA 4UUWA 2R7UA 2KXNB 2I5JA 4TU8A 1NK0A 1D9DA 4WU2A 3RBDA 2HHHF 4C0HA 4B9LA 3KLFA 4X4VA 2M9KA 1HPZB 4MTPA 3SEOA 2BV3A 2M3DA 2HHWA 1I6JA 2XY7A 4L6V3 4Q2MA 2MB0B 2OKQA 3PR5B 3MM8A 1VBYA 3PO5A 3L3CA 1EP4B 3NGDA 4OHVA 4DQRA 5IT0A 1NK5A 1VQKS 3DFEA 3HHKA 5F41A 2WHOA 5AJ3F 4MAKA 4WE1A 4OHWA 4A8QA 2GCFA 2KFYA 4ELTA 2YTCA 3DMJB 2N4CA 3M1VA 2OPRB 4K5RA 1FRLA 2BOPA 1JLEA 4DR2F 2FJVA 4YQWA 4DL2A 4DSKA 1I94F 2NUUG 3TW0A 1FXRA 2J7WA 2AYBA 2JL9A 1X9WA 3NS6A 4Y2IA 2VD3A 3CJ2A 4AYBD 2WSCC 2DGXA 1UMJA 1HYSA 5IXUA 3M8RA 2DGTA 1X4AA 1JLGA 1UKUA 4KO0B 1LKZA 2GIQA 3OR2B 3CCJS 5JUMA 1NU4A 4A8SA 2W9CB 1HNIB 3B4DA 2J76E 1T3OA 2EBEA 4EU0A 2OJ3A 4X66F 4O4GB 4M63A 3JAMY 1VC0A 2V2KA 3P49B 4NA1A 1U6ZA 4AE5A 3CJ5A 4UUXA 5J2PB 2ADBA 1HPZA 2AJ0A 1Y3KA 4URSA 3VZIA 2OTJS 5G0RA 4IH7A 4U6PA 1S9GA 5KG0A 2HFOA 2PEHA 1FRHA 1SQEA 2CQGA 4O3NA 3CMAS 4QR0A 3CVKA 2QYCA 3DOKA 1R31A 2GQCA 3POTB 1LK7A 3MMJA 4H4KC 3SFGA 3D54A 2O66A 3K57A 4A8WA 1J5OB 4QYRA 1AW0A 2DR5A 4PG7A 5FJ4A 3KK1B 4JV2A 1C0UA 2VONA 1UVIA 3LPYA 1JLCA 5KFXA 1W25A 3G71S 2VFVA 2L3MA 2E1MC 1ZOTA 4ZVEA 1REVA 2YH0A 2EI5A 3LGMA 5BJRA 1ZETA 1ZM4A 1RA7A 2XGQA 3QZ7A 3EGNA 1ELOA 1VFJA 4RW4A 4F50A 1FTRA 1H0HB 4FNHA 4RW9A 4X4QA 4FPRA 3KOAA 3ZZZA 4ES2A 2H9ZA 1UJ5A 2ZNYA 2F8MA 4QQBA 4Y65A 5KFRA 1U4BA 5LXRA 4RNMA 1JKHB 5BYQA 2L08A 2GO8A 2I0XA 2QLWA 1DZ5A 2UU9F 1KVJA 3CC4S 4RW6B 2DNQA 3PX4A 2DGWA 3GWCA 1NZAA 4DR6F 4NLGA 4DV0F 3NCPA 4RBVA 4RKUC 1VJWA 1HD0A 2IBOA 4KIAA 3VALA 4DL7A 4RX6A 1KN6A 3B82A 1C4CA 3TANA 4Y0FA 2E66A 2M88A 2RS2A 3DLHA 2L9NA 2W4DA 3Q8RB 1NEEA 4DMZA 2AX0A 5E3QA 2ZNZA 2CKWA 2FJBB 3S01A 4ZPAA 2K7JA 5EWGA 2DNKA 5K5MA 3FZBA 2ZHAA 5DG7A 3TAQA 1M5OC 2P9CA 1EETB 2MKJA 2ZE2B 3ISNC 3Q8QB 1RISA 3FMBA 1KR4A 4OX7A 4DV6F 4KHRA 1GTEA 4TKTA 2N3LA 3HF5A 2C3PA 2B7BB 2CYYA 2XB2D 2VH7A 3FMWA 4A8XA 3PO4A 2W4PA 3BSAA 2Z2LA 1S97A 3D1QA 1X5TA 4DEZA 4LF5F 3PR4A 1G6BA 2HWTA 3E01A 4Z37A 2YY3A 3Q22A 5C24A 1S6QA 4YB5A 3THPA 4CO5A 1JX4A 3EZUA 1RGVA 5D4LA 2B9XA 4HI2A 4ZP9A 2DPIA 1XNRF 2GHPA 2R9LA 2GW8A 3OPKA 3Q24A 3ZFVA 4CT8A 2I2YA 4WFZA 1DJ0A 2R2UA 1FDDA 4AL7A 2Q79A 3PW0A 3ZZTA 2FHMA 5CZXA 3V6KA 4JV1A 1SKWA 1YGYA 4ZMMA 2UV8A 5KFVA 1VK3A 3BN4A 5A8RB 3OSNA 3K5PA 5CYQB 4MKYA 5E2QA 1HQUA 3RAXA 1IJEB 2Z4PA 4MYUA 1W2IA 3CDUA 3EGZA 3K5NA 3DU5A 2DGUA 1YSJA 2R7OA 2GJIA 3GG0A 2PMZD 3TOQA 5BYSA 1TK5A 1PILA 4O44B 5THWA 4M1KA 3CCWA 3PW2A 1TFWA 3W2VA 4JYAF 4DFJA 2BANB 4B9VA 1FO1A 5KT3A 3M05A 3K8VA 4J9MA 1DARA 1HA1A 5L1LA 4KJIA 1FE0A 3GZ7A 3GV8B 4OLPA 4J9KA 4ECRA 1RTHA 2HHXA 1FD2A 2LKZA 3QJPA 3H2LA 2UUWA 4ZPVR 4CNYA 1FXLA 1B7FA 2O67A 4Z2XA 2MKHA 4O3QA 1DTQB 1NRKA 3X3UA 1TK0A 2HGNA 3VF0B 2LECA 1KLNA 1M5SA 2WK4A 1ZPWX 2J6UA 3MFHA 3FEYB 4HLBA 4QU6A 3MTJA 2UVRA 1FVSA 1UETA 3AAWB 3F41A 3BO4A 5ITHA 4M5DB 3UR3C 3MHYA 1HW8A 3MEDA 1VQPS 1SL1A 4FF4A 3MM5B 2DCUB 4G6VB 2IVMA 4WCEQ 5EWEA 3M4XA 2F9DA 3AA9A 3VCDA 3DHXA 1RYSA 2IM2A 3OTBA 3H5SA 3FSIA 2QA4G 4Q2LA 3M1VB 3DMJA 1FA0A 1RT5A 1UWBA 5KFWA 3GV7B 4C4WA 1R8CA 2APOA 4IG0B 1P8GA 2JLEA 2J5AA 3WX4A 2UVUA 1FKAF 4FYDA 1TKTB 3QO9A 4IYQA 2MZJA 2DH7A 4GMKA 4QW8A 1G7CB 2BVZA 5KT7A 2B0GA 2R7QA 2F8HA 3ZZ0A 4LSNA 2W7PA 2RS8A 3DM2B 1HW9A 1UP1A 2K1RB 4RNOA 3OFEA 2Y1IA 1U1MA 2DIVA 4ETZA 2GFFA 3GILA 4NWBA 3RU0A 3IN5A 1R3NA 2VOOA 1TAUA 3QMQA 5GVQA 1FKOA 2DISA 1ZAWA 3BS9A 1YVFA 4C8YA 1IKYB 3DHWC 3GFYA 4OFZA 3D0GE 2QT7A 1VQ6S 3DOKB 2ZZNA 1S4FA 1U47A 4DQSA 4CO0A 2AW0A 4PG5A 1YI2S 3Q0AA 3VAFA 3UI3A 2XZWA 5G0RB 1H98A 1ZAXA 1WI8A 1S0NA 2BJDA 1SI9A 2DITA 2DNRA 3MUTP 1HMVB 3E3XA 4ZLPA 1LXNA 2W25A 4WZMA 1RTJB 5LT5A 2A3JA 1R0AB 2B4VA 4NMLA 3C66A 4ZPWR 2FJEB 1XR6A 2B4OA 2KYZA 1HI8A 1X4EA 2J7UA 3DOMA 1IKVA 3I87A 5EGYA 3HKZD 4NLYA 3LANA 3J7ZT 1M1KT 3HM9A 2RILA 2YWEA 1YWXA 1RT2B 2W9CA 5HQ8A 2COLA 3ZZPA 2AD9A 1NK6A 3RW7A 4TLQA 2MKIA 4UQGA 1X8DA 4AL5A 4O3PA 5L39A 2KN4A 4A8YA 4Q43A 2ADCA 2DNNA 3MEGB 1FNMA 2NYIA 3B8HA 3CCUS 3HLUA 2IRXA 5MAOA 5K8OA 2ZH7A 1M0SA 2YNHB 1N5YA 2X1BA 3HZGA 4MIWA 1PC4A 4JV5F 3RRKA 4PUOA 1NHVA 2JEGA 1IQZA 1R0AA 3C6TA 4A8MP 3UE2A 4R5PA 1VC6A 1JIHA 2LXIA 1NK7A 2ZM6F 4PQUA 1UW4A 2FVSA 4LFCF 1AXQA