4Y6IA

Crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
ASVVVLATAPDEATAQDLAAKVLAEKLAAAATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLEALKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent-cation tolerance protein CutA
publication title Crystal structure of E.coli CutA1 E61V/C16A/C39A/C79A mutation
rcsb
source organism Escherichia coli k-12
molecule tags Metal binding protein
total genus 24
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y6iA00
1PILA 5D4PA 2J9DA 4OZJA 2NUUG 2J9CA 3NCRA 4Y6IA 3BZQA 4CO5A 2VD3A 4Y65A 3TA1A 2GX8A 4OZLA 1NH7A 2J9EA 3N5BA 1NH8A 4YB5A 4WK1A 1OSCA 5D4LA 5D4NA 4E98A 3O5TB 4CO4A 4RX6A 3AHPA 3LF0A 1J2VA 2NS1B 1HWUA 3M05A 3AH6A 2ZFHA 3NCPA 4CO2A 3CE8A 4CO0A 3AA9A 4RLEA 2E66A 1VHFA 3NCQA 4C3MA 3DFEA 2Z0GA 4YB6A 4WK3A 4CO3A 4RWWA 1GNKA 4AFFA 5D4OA 4C3LA 3MHYA 2XULA 4NYOA 2O67A 4R25A 2XZWA 3GSDA 2EG1A 4OZNA 4C3KA 1V6HA 1UL3A 4NYPA 1H3DA 1UKUA 2JJ4D 1O5JA 4D3GA 2XG8A 4D3HA 1NZAA 2O66A 2EG2A 4USJC 1VFJA 5L9NA 1V3SA 1V3RA 2NUHA 4USHA 3O8WA 1QY7A 5DS7A 1Q1KA 2DCLA 4CO1A 4RWXA 1XK8A 1UFLA 3X3UA 4YB7A 2XBPA 5DRKA 1UMJA 1O51A 2RD5C 2V5HG 3T9ZA 2GW8A 2GNKA 1V9OA 3HLUA 4CNZA 2ZOMA 4USIA 2J9DE 3L7PA 2PIIA 4CNYA 1KR4A 3TA0A 4ZK7M 3AA8A 3OPKA 2CZ4A 3TA2A 1P1LA 1NAQA 4IYQA
chains in the Genus database with same CATH superfamily
1TL7A 2DR6A 5D0GA 4IO9Q 4OZLA 4K7QA 3ITHB 2W2MP 4DR1J 3EGZA 5D4NA 2ZVIA 1HMVB 1CS4B 2HNZB 1FX4A 2CPDA 2BQRA 1FK9B 3P5TL 2QV6A 4HHJA 4ES2A 1KDNA 3MM5A 4DSEA 1NPKA 4ICLA 3SQOP 3CJKA 2EFOA 3AJ1A 2A6OA 2R7UA 1WEZA 4A4JA 4W90B 3PW0A 3FFIA 2KI2A 1RI7A 2HHHJ 3UN5A 3HVWA 2V2KA 3CMES 4FXWA 3UD3P 5FDLA 1TKDA 1TK0A 1U1LA 1WELA 2LQJA 3KFWX 1UVIA 2ADBA 4NLGA 5KFKA 3SSQA 3HLUA 3BF4A 2OIHA 2O1PA 2ZJRQ 2HK3A 3G2XA 3RB0A 4DG1A 1N0UA 3Q83A 1IBCB 2RS8A 2ZBQA 3DLHA 4KHMA 3G8TA 3DI6B 2C3UA 3NCRA 6FDRA 2X1GA 1SXLA 4DL5A 4NLPA 3QJJA 3HM9A 2PEBA 4WK1A 4ZPAA 4ECTA 2KXHA 1RZMA 4J9KA 3HXMA 2P6SA 4PG8A 2AGPA 2W8LA 4M1KA 3WDOA 1NUEA 1S12A 1RT7B 4IRDA 2MJNA 3PFOA 3L9ZA 4RWWA 1KFDA 4YHHF 1FNXH 1IBLJ 3BREA 2E9RX 2VDHA 4DR2F 1VRQC 3MXHP 1XNQJ 1UVKA 4WFAQ 2CPJA 4AD6A 2UUBJ 2BM1A 2CA9A 3I0RB 1RHRB 4ED1A 4DV6F 3RAQA 4OZ2A 3QT6A 4C8ZA 3I56S 3ENQA 1FRIA 1RT4B 5IT0A 1U09A 2C3MA 3TZZA 2YNIA 3TVZA 3H2LA 2V4JA 3PRDA 5GAHU 2IY5B 2W7PA 2V34A 3HULA 2BANA 3KG1A 3W63A 1ZH5A 1HFEL 2V94A 3NGKA 5F3TA 1DARA 2CQ3A 1X5TA 3J7A1 1S9FA 2P8IA 2B4UA 4J90A 5CAAA 2L9WA 3UNYA 2X1BA 4PG5A 5ETKA 4ZPBA 1U48A 4TNOA 2FZGB 4Q45A 1D1UA 2OPQB 4QPTA 4Q0BA 4PXDA 2PO4A 4JI8J 4ETXA 1TVRA 1VDHA 3PRBA 4F4AA 4BS2A 1SV5A 2OFHX 1PGZA 2HFZA 4R0EA 1LK7A 2M9KA 4ZKAA 3AB4B 3TANA 1F9FA 4TN2A 2VBXA 1LWFA 1RT6A 2HVEA 4NLYA 1IBKJ 1X4GA 5DM6Q 4FF4A 5KT5A 3A8JA 2D9PA 3O2IA 4Q44A 3W9JA 1RWVB 4NA2A 4A8SA 1ZAWA 2NXCA 3I87A 3QIDA 1XMOF 1VQ9S 1RKIA 2GV1A 5GADU 2AU0A 2FDNA 2BE2B 3J81U 1S0VA 1BUXA 2AJQA 3OBIA 1WOPA 3W7BA 4RNNA 1N88A 1HWLA 3CMAS 4KPYA 2GZOA 3ONQA 2ZBIA 1M1KT 2ZH3A 1WOOA 1VQKS 5DLFA 1X0FA 3ZZRA 2V68A 2QA4G 4NX9A 4EEYA 1S72S 3ENAA 5LSOA 1A0OB 4ER8A 4C8YA 4BC9A 1FJ7A 3SSSA 3CD7A 3X3UA 2HHVA 3WC2A 1FWPA 4IG0B 5EUHA 2MSSA 3ETMA 4PYAA 1U45A 3ISNC 5KT2A 1NJIT 1N5SA 4JI0F 1F5AA 4NCAA 2UUTA 2EC2A 2G2YA 1UEUA 3D3CJ 4YR0A 2CPIA 1C4CA 1WOSA 2GGPB 3LANA 2MY7A 4CT8A 1WF2A 4N5SA 1YTYA 2D69A 5F8NA 2H1YA 4DV1J 1JNRB 2YH1A 3R2DJ 4ZN1A 3LH2S 1B70B 1S1XB 4XO0A 1S1UA 4QQBA 3HZGA 1WTFA 1HQUB 3MAAB 4DV4F 2PFFB 4JB8B 2XB2D 1R0AB 1G2EA 4DV0J 2R9LA 4R25A 4Q2MA 3UVJA 3TUPA 3FMBA 2RQCA 4MYTA 3OW2R 5ETPA 4LF9F 2ZUGA 4JI3F 3NAHA 1YRUA 5C42A 4DF8A 2K8GA 1U8WA 1B3TA 4ECWA 2CPXA 3CDWA 3BR8A 1X7VA 1WDTA 1MG7A 3MD1A 4CO1A 4M5KA 1O6XA 3EGVA 4L6V3 4KQZA 4WPAA 1RISA 4B3OB 1JLCA 5CYMA 1TKXB 2E44A 4U96A 4DR3F 1IM4A 3C19A 1RWNB 3RBEA 3M30A 4RKUC 5LOQA 5C24A 4M5MA 1BY9A 4LFAJ 4OX8A 1SUQB 2JEFA 3R1LA 3RR8A 1R6YA 3V81A 2YX1A 4OZ0A 1YGYA 2FVPA 4F7VA 1E6VA 4OV1A 5E3CA 2E5GA 3UDVA 3WX8A 1K8AT 3MTJA 4I1TA 3N79A 2I6WA 1CJKA 1UZHA 2JVRA 3RAMA 2MKJA 3PX6A 4KH1B 4CTAA 4C11B 4UW2A 3D66A 4EZ9A 5IT9U 2IC3A 4MFBA 1FRLA 4ZJQA 2MQ8A 2RRBA 2EBGA 2BJEA 2KL8A 5HAOA 3TUZC 4WWSA 1T05A 2UUAF 1JXLA 5IM0B 4LIRA 1OO0B 4L3KA 1BLUA 2IM3A 2IYIA 3GV7B 1GX6A 3L7UA 4O3OA 1VBZA 3RUBL 2BM0A 1AFJA 1DTTB 2D74B 3NGSA 1YITS 4K4YA 2GA7A 4CP5A 2NSBA 3C6TA 3BKTA 3OTOF 3CCUS 1K44A 3HT0A 2VUGA 2LEAA 2CJYB 3FKBA 2BX6A 2VD3A 3D68A 1EHWA 3QO9B 4PR6A 1B99A 3KK3B 2FGCA 3KHLA 2PMHA 1TL1B 4LF8F 1YSJA 2CG4A 3GQCA 4HDGA 3LP1B 4DLEA 4DG1B 4WKRA 2MMYA 3E3XA 3SDEA 4G1PA 2CWKA 2DITA 5AXMA 1LKZA 3TYTA 1WKLA 3HF5A 3M2UA 2IMWP 1U26A 1VI7A 4PABA 2RKIB 3T1YF 4L3NA 3N0VA 5IOLA 1CULA 2QSWA 5LMUF 2ZM6J 2QEXS 1B64A 3DYAA 4E0DA 1S59A 3W3SA 1R8CA 1RTIB 4KRWA 3JQKA 2CVEA 1U7LA 3H20A 2CPHA 3PEJA 4JP8A 8RUCA 1RT5B 2F3JA 4IFYA 4HI1A 1NJZA 2HBQB 1WC1A 2HS4A 4ZVQB 3CJSA 4LR9A 1CLFA 4UQTA 2WVCA 2VBWA 3QGHA 5KG7A 4DL0C 2J7KA 4JV5J 2MHNA 3B6BA 1KVJA 2WVDA 3FQKA 4DPTA 3W5XA 3LP0B 3H2UB 3VVUA 3NS5A 1VOMA 2R7VA 2ASDA 3IAM9 4ZS6A 2XM3A 1DFDA 3OTCA 4LIWA 2HBRB 1JJ2R 3Q2TC 4P2FA 2KHDA 4ZVFA 4QW9A 5LMNJ 1XR7A 4MIAA 3M2VB 1VS3A 2XLJA 2COLA 2O66A 4X66J 3JTNA 2R7OA 3JQMA 1FFSB 1KLNA 3GIKA 3POTB 5M2UA 1XBWA 1TKTA 1QDUB 3A8IA 2EBEA 4K4XA 4ZN3A 1U1MA 3RBXA 2MQMA 1PJ5A 1U1RA 3EYZA 3NOGA 4ZHRB 2JFKA 3U02A 1FVQA 1X60A 5IV4A 4LVOP 1U47A 1FJGJ 2YNFB 2XHWA 1BE4A 3UI3A 1LXJA 3R7BB 2DD8S 1L3UA 1XTZA 1T8EA 1YJ7A 2IRXA 4S0MA 1RABB 4PQUB 2UXBF 3NGUA 4CO0A 1G6BA 2VHGA 2M52A 5DZ7A 2B9WA 3R6GB 1VBYA 1YJ9S 3N28A 1GNKA 1VC6A 2BV3A 1IUJA 4KV8B 1H3DA 3PIPQ 4ES3A 3Q86A 2DGOA 2EK1A 2P9CA 3QFWA 3NNHA 2GVZA 1BMQB 3ELHA 1SC6A 3D6MB 4FDFA 2XSJB 3K2YA 2G2ZA 3Q89A 2W9BB 4IDKA 1OPIA 1G1XA 2IIHA 3FNNA 4M5HA 3PHEA 3US5A 1LWEA 4WTOB 4R8UB 5KFPA 2FLLA 2BJ7A 4GC7A 3Q8VA 2XCAA 2HSEB 4JOUA 2HFNA 3B78A 3JAMY 3KDOA 2V4RA 2LDIA 4OFZA 3M9OB 2QLJB 4CLYA 3SMZA 4ED6A 4DV7J 3KLHA 5HVGA 5F8IA 2R7WA 3HKWA 3SQGA 3V6DB 1W7WA 3EVMA 3HT3A 2G4BA 4UOFA 5F0WA 4FVMA 5IQ6A 2GCFA 4QR2A 3WIUA 4CRJA 5A8KB 2YKNB 1V6HA 3GU0A 1GTEA 3A1YG 1RHMB 2CQ0A 3BGLA 2F65A 2FGOA 3CJ4A 2XQCA 2Z57B 5C2CA 5ETLA 4F4XA 1FT8A 4BLGA 2Y8YA 1F60B 1HBMB 3FGVA 2ZH1A 2QO3A 4K0KJ 3U1NA 1XR5A 3KK2A 3MCOA 1JJHA 5ETRA 2YVSA 1PILA 1TMMA 2PI5A 1DQ9A 4M5DA 1FERA 3QATA 5IS2A 2BYCA 1ZZFA 5DDPC 4A8XA 2B3TB 1WG5A 5EWEA 1RTDB 2DKOB 1NK5A 9RUBA 2LU1A 1RCOB 1YX2A 4WZQA 3D6FB 3RAXA 3MM7B 4WXWA 1LWCB 1BQNA 2GAGC 2CZ9A 1K1QA 4L76A 4RW9A 5EWFA 4TY8B 2ROPA 4P7VA 1V3ZA 2XZWA 5ITHA 1FKAF 1RAJA 2GHWA 4DR4F 3KKFA 3EGWB 1SC3B 5CD4H 4C98A 4QOTA 5KG5A 2XI3A 1MWQA 3PACA 1VFJA 2GC8A 5L9NA 5KFQA 1NSQA 2DNPA 1M1HA 1P6TA 1FE0A 1L3VA 4F4KA 3CJTA 2IC3B 1HNZJ 1T02A 2RU9A 3CTRA 2PEHA 2CADA 5J2MB 3KHRA 4Z7YA 2EWHA 2XYPB 4U8YA 1RWWB 1KFSA 1RT2B 2XYHB 3ADAC 2RJZA 4ECSA 2QIFA 4TYAA 1WACA 1RTJA 2R8IA 5F8MA 3BN7A 3UD5A 2Z8QA 4LFCJ 1APSA 1MU2A 1DAXA 3MMAA 5CYQB 4NWBA 4ECRA 4JI7F 4DL7A 3AY0A 1MROA 2XYGB 2ZH6A 3MM9B 1RU2A 3CE8A 1H6KX 1UFWA 3ET6A 4KC5A 1R8AA 2FY1A 4O0NA 1RAFB 4UY85 4Y00A 1SH3A 1RWMB 5E33A 2WAQD 3G82A 4WP3A 2FD2A 2WB1D 2VBYA 3P8BB 4RW8A 4N8OA 1T7PA 1F9EB 2HQFA 2A0FB 4X4RA 2F4VJ 3EUNA 4ZPWR 3M2UB 3GTYX 4KPCA 4QWCA 2VFVA 2GNKA 2SXLA 4IH7A 3CMQA 2KO1A 4B9TA 1IWAA 4LR7A 3OVAA 2DNLA 3GYXB 2RS2A 1K0TA 1IKWB 1TL4A 4ZCKA 2QLXA 5E3QA 2KZMA 2E5LF 4CLWA 3TW0A 4EU0A 5HVFA 4QR1A 2RRAA 1NLKL 2FVCA 4B9UA 3C14B 1N36F 3WZ0A 3DLBA 3ZZ0A 4IFYB 1BQMA 1HNWF 4P71A 4ECUA 1MWYA 1M0SA 3LWMA 2Z58B 1NDLA 2R7RA 3V2UC 2E1PA 2HHPA 3DOKB 3PG9A 3GCWP 2OSQA 4FBTA 1FEEA 2MY8A 2J5AA 1SJFA 5GAHI 3KWMA 2ZHBA 3I5CA 4KGXB 2DR9A 1HR0F 1JLAA 4KKOA 3AJDA 3ZZZA 3BEGB 1KSPA 4GVBA 4RWXA 1EARA 3GR0A 4KO0B 1VQ6S 3VF0B 3CIZA 1I94J 4RBVA 1Q79A 3DC2A 5H9EK 2FB0A 2PA8D 1JKHA 3TA0A 1H38A 1NDKA 4X4SA 2G1HA 4OHXA 4O3PA 1LQ9A 2IJNA 3ZC4A 2L48A 4PXBA 2J9EA 3NMAA 2UXDJ 3LPEA 1TV6B 1LW2A 2B5JA 4M94A 5B0FA 4CH1A 5KFFA 5CA5A 1VQMS 4DL3A 2KM8C 2FHKA 1IWGA 1UVMA 4Q8FA 3CVKA 2GS8A 1TUGB 4UF4A 2F63A 4OV6A 2WVFA 5T7LA 3AXMA 2QA2A 1ULRA 4X65J 3DKDA 2LQ5A 2OPSB 1CJUA 3OV7A 1Q8KA 3Q8SB 3OVSA 2QN6B 4I6AA 3QFHA 4QPXA 1V3SA 3GCXP 3MMBA 4BWMA 1FD8A 3DOLB 3KLGB 2I8EA 5GADI 2CPZA 4I2QA 4NZ7A 2EKYA 2M8HA 1RT1B 3QSYB 2BE7D 4F4WA 4PUOB 3VCDA 1F5CA 2LP4A 3TA2A 1TKZA 5I42A 2IM0A 3SFGA 4K5SA 1OMSA 4OI0A 1WG1A 4OX6A 3D1QA 4IH6A 3CD6S 4NCGB 1X9WA 2FHJA 3IG1B 3S01A 2JSXA 1FXRA 2CUYA 2PD1A 2MQQA 4HL9A 5DDQC 1S1WB 1QUVA 3TQEA 4LF7J 1R6VA 1YJVA 2N4DA 3AA9A 3KLFA 1OYDA 3D67A 1B7YB 4OYWA 4P2XA 3QQCD 1NPPA 2EFGA 2YNGA 1CJTA 1B0VA 1RGVA 3EZOA 2Q79A 2WHOA 1O5JA 3IC1A 4JI4F 2RRNA 2XNRA 3H59A 1RAEB 4F0MA 2R8HA 1FRHA 4ED5A 3P6YC 4XAKA 1YJWS 3J81Y 1SQEA 5K8NA 4DR5J 2W9CA 2MQNA 1PCAA 1WHWA 4WFBQ 1YZ6A 1KR4A 7FDRA 3CD0A 4NXMJ 4RU2A 4GKKJ 2C42A 2ZH9A 2ERRA 1C0TA 4ECVA 4C0HA 4ENOA 1WC6A 4B3MF 3TEGA 4YB5A 1U49A 5HMYA 3D0IE 3M32A 2XO7A 1SKRA 3VV2B 3QZ7A 1AZSB 2YWEA 3Q8PB 1RQ0A 4X84A 3AH6A 1ZM4A 2NQPA 3VAFA 3BPSP 4JYAJ 2Z0GA 2IRYA 1J5OB 2M3DA 3CIMA 4FF1A 5A8RA 3FZ2A 4V19J 3THVA 2DJWA 1FKPB 2QYGA 5H1SV 3I96A 4ED4A 3BDPA 1FHTA 3PFEA 2M4MA 5IT4A 1EP4B 1EQ0A 2ZWPA 2GAHC 3QWUA 2CJKA 3EWGA 2VU5A 8AT1B 6FD1A 3NEKA 2E7WA 2HQIA 4HH1A 3CDAA 5IWAF 5DRKA 4YY3F 4LJMA 4C48A 3BBBA 2ZE2B 2WK4A 1RBLA 5L1KA 1KTVA 1S49A 2G0JA 4JI1F 1P1LA 2CNNB 3A12A 4OYPA 3KUEA 4I7FA 1F2HA 4JBCA 1HQEA 2YKQA 3I4PA 4DR7F 3WC0A 1I6JA 4YB1P 3R8YA 3KDNA 1KTQA 5IXUA 1SJQA 1RXOB 1Q53A 2HMIA 3PX0A 3RR7A 3ISZA 3NCQA 2F9DA 1SL2A 1N6QB 2ZBRA 4KJIA 2NCKL 2CQGA 1HBUA 1KLMA 4F25A 4HLBA 4NYPA 4J9VA 3H4BA 3OR2A 1ZTTA 4X4PA 1UVLA 2DRDA 1FA0A 5CYJA 2YKMA 1BHNA 4RW7A 1N5VA 1LV5A 3F0NA 2JC0A 5EX0A 4LUBA 1KQFB 2P9EA 1RWPB 2ZH5A 3DCAA 2V2QA 1SJ4P 1NJYA 1XNRF 5LJ3Y 1XIQA 1W2IA 2GQ2A 4H4MB 4AXIA 2FLNA 1U0SA 1XC9A 1NDPA 5THWA 2RMLA 1DBDA 4J9NA 4U6PA 3ZZYA 1F2GA 3D5MA 4DQIA 2VG6A 1Q81T 2V2VA 1TQLA 2JZ5A 2X51A 1S6QA 2MB0B 4IRCA 3QBCA 4HEA9 2Y1RI 2QFJA 3ISND 4AUKA 1Q5VA 2K7JA 1S79A 4YHHJ 4ZVHA 2XNQA 1Y10A 2ZKTA 2HW3A 4DCJB 1ITPA 2R8JA 1FRMA 5A8WB 4B9SA 2XMWA 2D41A 1L3TA 2WOMA 3W9IA 1Q7YT 3BH6B 3GB0A 4MT1A 3KNGA 3OL6A 2LFVA 1GH8A 4DV6J 3VGSA 4MIWA 1KVIA 4I0WA 2QMWA 2N7CA 3KMQA 2DIVA 2XEXA 4EBDA 2RD5C 2CQIA 3SXLA 3IBFB 3BV8A 2RIJA 2AW0A 2ZJQQ 1FO1A 1JLEB 4BHQA 2DGQA 1S7HA 1DJ0A 2NR0A 2RDIA 1SQFA 2P2CB 4JI2F 4GVBB 2VFUA 4PPDA 4WFZA 2FVQA 1PBAA 4WTYA 3H5UA 2R42A 4CYUA 2QC3A 3BH7B 3GFZA 4OJGA 5B0EA 3H5XA 3RGIA 1S97A 2ADCA 2V2ZA 4ELTA 3MPVA 4B3SF 1UWBB 3BSAA 4K4UA 3EZUA 3CPWR 2H5JB 3MECB 5G0RB 2HK2A 2JJ4D 4NPOA 2EKNA 3BGOP 4KSEB 1JB0C 2ZITA 4ID8A 1JLGA 3PJXA 5B7WA 4RW6A 1FKOA 1JLFB 4CLUA 3OTDA 4J37A 1EIYB 1LEOA 2G2OA 3W64A 4HH0A 1HQ2A 3M8WA 4Y28C 1N48A 2J9DE 5H9FJ 3P45B 2RF2A 2QLFB 4ID5A 4DV2F 2CVIA 1NAQA 4HR2A 2BE9B 2J6UA 1NPRA 4NMXA 4A46A 4Y65A 2ILYA 4DQRA 1XMOJ 4OYAA 1VQSA 1RLDA 2H54B 1WJ9A 3CGIA 1LNQA 2FY8A 2Z2ZA 2YWGA 2BKNA 1UAWA 5KFUA 2FHOB 4FYYB 3G8SA 2YTCA 4OX9F 2UUCJ 2HVHA 1VQ7S 2HNYA 1DTQA 1V5IB 5KFHA 5B0DA 1JIHA 3A13A 2B6AB 4DF4A 2UV8G 2GIFA 4FF3A 5CCLA 4IO1A 2Q6CA 5L8RC 5C5JA 1VRTB 3IN5A 2AF6A 1TK5A 2FLOA 3OVBA 3TARA 3OTBA 3OXGA 3KG0A 3RRHA 2VG5B 4J7CA 4F02A 5I3UB 2L3MA 1C1CA 5DGAA 2FHMA 2HPUA 3KLIA 1QE1A 2C2OB 1OSDA 1TTHB 1FTRA 3AQOA 3W2WA 5HO4A 4DUYF 4ZVTB 3FBBA 1YWXA 4NEYA 1IBMF 4K50A 1UJ6A 2MQLA 2YNGB 4Q2LA 4F8RA 5J1EB 1MN7A 1GT8A 1EETA 3UPFA 1H0HB 2XS5A 1T3NA 2KFZA 1VR6A 2E5JA 4JI0J 1RADB 3DOMA 2XS2A 3VAHA 2Y1JA 1QD1A 4C6AA 5HLFA 4ZP8A 1F5BA 3QMQA 4DV5F 5LSRA 2I5JA 4V19X 4CM2A 1N34F 3ZXWA 3W5YA 1N56A 5DDRC 2JL9A 2CYYA 3R5BA 4IFVA 4NZ0A 5KFEA 2RNEA 4A8WA 9ATCB 3BS9A 4AQYF 1VQPS 3PM9A 4CO3A 3HJFA 2RVJA 3R5GA 1FI4A 4OZNA 4LF9J 3QPIA 4M95A 4JI3J 4MK7A 4HT5A 1RDRA 3TUIC 1EX8A 1SVDA 2G13A 1I51B 5HMXA 4CQ1A 2CDQA 2CJXB 4NI2B 5F9LA 3RYLA 1O51A 2HGNA 1HBNB 2E1CA 1IJEB 1CG2A 2DGSA 3D0GE 4DR3J 1FWKA 3I9V9 4PYDA 2F5GA 4ZK7M 1AUSL 2Z2YB 5KG4A 3NBPA 2ALZA 3DLLQ 5IZHA 2J0XA 4LRDA 3EJMA 2NUUG 5J2NA 1FJCA 2L08A 3H40A 1NH7A 2VZ9A 5HMWA 3ILIA 4OLPA 3Q22A 5DG9A 3OXLA 3UCUP 1N33F 3CT9A 4F04B 2ZH2A 3O6QA 1OPZA 4WE1B 4J9MA 4WXOA 2IA6A 3ETOA 4C8LA 3HVTB 1N32J 4AFFA 4O3NA 4QZVB 1SI9A 1UCNA 4FXDA 3GIMA 1T9TA 4Q43A 3ITHA 2B0GA 2OSRA 2ZVSA 3CCZA 5GAEI 4USJC 1HMVA 1CS4A 1V3RA 2HNZA 1P27B 4EYHB 3BO4A 2LYVA 1FK9A 2C2RA 5AXNA 4P2SA 5LXRA 2HZCA 1RKJA 2JLFA 3CDUA 4E2FB 4CCHA 2DNQA 4P7TA 1JLBB 4USWA 1ZTWA 3ZNJ1 5JJBA 4OHZA 1HNIB 5JVGQ 2HVDA 5J1NA 1ZM9A 4N41A 2YKOA 1O0PA 4HVZA 3P4UB 2BQUA 3MPYA 2ZJPQ 4RNOA 1S6PB 3HDSA 4LF5J 1ICEB 4PXCA 4F4ZA 4LF8J 2FVSA 2KFNA 2YH0A 2BVZA 1ZA1B 4NOHA 5IC4B 3F56A 1WWHA 1WI8A 2CQPA 3K8VA 3R27A 4UT4A 3DNCA 1AA1B 4DPXA 1UVJA 3C6UA 2CQ2A 3BQ2A 4EZ6A 3N5FA 3IGNA 3J81j 3FSIA 5SZTA 3MHYA 1YQHA 1EZZB 3DI6A 4CI0B 4NASA 5C7PA 2E7XA 1C1BB 3E8OA 3R97A 3T1YJ 3VZIA 3PYEA 2MYFA 5LMUJ 1QUPA 2I0XA 4TLQA 3QRQA 2CKWA 2UU9F 2KYXA 4B02A 2ZOFA 4ZLPA 1RT7A 1IBLF 4M5NA 4TU7A 1RE1B 1V9OA 4DSJA 3K5NA 3M2RB 1NSAA 4DPYA 1VHIA 5HQ8A 1LOUA 2UUBF 1NNDA 4LBHA 2XMVA 1FRJA 3FCWA 3OQ2A 4IYQA 4UY8T 4XPEA 1GMVA 5K8PA 1GK8A 2VKRA 3W60A 4AT1B 3I0RA 5KFGA 3MR7A 1NHKL 4JI6F 5KG0A 3OUYB 4RW4B 1SPBP 3PDNA 1REVB 2EVZA 1RT4A 4RUAA 2YPZA 2VG7A 1PSDA 4ZVSB 3PW7A 2DO4A 4OZ3A 2VB6A 3KK1B 4RR5A 1FFWB 1MNEA 1BWEA 1P1TA 2P6TA 2O67A 2HQCA 3NS7B 5CZXA 1FVSA 4CYUB 1TMJA 4NRTA 2BJDA 2ZNYA 1S99A 1S9GB 1NBEB 5I3PA 4ZVOB 3IGVA 1XMQF 1NK4A 2AT1B 2PSZA 4A8YA 4LMZA 4CT9A 2XBPA 2RU3A 3TP2A 5LJ5Y 4PRFA 2WZ1A 1QAIA 1BGXT 2OPQA 2MQOA 4ZIWA 4OI6A 1X4FA 4P6QA 4ED0A 1T9YA 2B8PA 3UDEA 5K14B 1EB0A 3GFXA 1W2BR 3D3BJ 2LA6A 2IHR1 2I38A 4CO4A 3MDFA 2DO0A 2YX4A 2E7VA 3VAIA 3JAMU 2LEPA 2DXFA 3QRRA 1CJVB 3K5OA 3FCHA 4YR3A 1WNEA 3NXZA 2LU2A 4PWDB 5LSLA 1FRXA 2W7OA 1S1VB 2EFPA 4I64A 3RBDA 3NS6A 3RRKA 5DQGA 2BE2A 4FS1A 5H9FK 5L1JA 2HNDB 3M8QB 1HYSB 1Y00A 3FBFA 4DUZF 2EFNA 2OLWA 1ZM3A 4OYIA 1H2UX 3QAEA 3FEZA 4OHVA 4DU7A 2WBMA 2R7XA 3G87A 4DS4A 1Y9OA 2KFYA 2OPRB 1RACB 3VAJA 4RUBA 2LVWA 1Y11A 2HURA 4DPOA 4Z37A 2R7TA 3D0HE 4IG0A 1TR0A 1X31C 5D6GA 2H48B 4C8KA 1WKKA 2D3OR 2J7WA 2ZHOA 4C3LA 5D4OA 2VPZB 4QIFA 3I82A 2VFRA 1SCJB 1PJ7A 2BEFA 3EPGA 4KB7A 3RRGA 5ETQA 2H4WB 1LW0B 3QGPA 4N56A 3CCTA 1S1XA 5AT1B 1DLOB 4TY9A 1MN9A 1Z2LA 1HQUA 3MAAA 2N82B 3CJQA 2FHJD 4RBUA 1R0AA 1VYAA 3MPDA 2C2KB 1Q8IA 2HAIA 3ENWA 3PR5B 2AYBA 4ALZA 3VAGA 3GYGA 1G3OA 2FZKB 1E6YB 2CRLA 2WONB 1M5SA 1WKJA 1RU1A 3BSCA 3LAKA 2DHAA 3MCNA 4B3OA 3G71S 2BKOA 3QT5A 1TKXA 3D4JA 1MSWD 2BZ2A 4ZJLA 3KOAA 3HMJG 2W2NP 2JRSA 3BBCA 1XMBA 5D3GB 4QJVA 1PAUB 1SUQA 3CCJS 1R0CB 1TU0B 2ABYA 5KTQA 1PG5B 4DR4J 3CSKA 4X4TA 1IR2A 5E3RA 2XI2A 4C9DA 4LFBF 4UUWA 1FRKA 1C0UB 3BYRA 3GIJA 4ETZA 2OEJA 3NY0A 2VASA 3IAS9 2JH3A 4O4GB 4C11A 4TKTA 4DN9A 5K8OA 3BJYA 3CC4S 1KWMA 3UW1A 2B51A 4FPIA 1WEXA 3FK4A 5IM0A 1NB2A 1VIXA 4HYKA 2GO9A 1HWIA 4ZLJA 2JWNA 3U1MA 5HANA 1X0PA 3H2VE 2Q3PA 2JHEA 2FPHX 3UQSA 1S9EB 4FYXB 2GMHA 2KT5A 4USVA 2DIUA 4RUCA 4JI7J 3TQ1A 1DTTA 3K58A 1KKHA 1YBTA 3R7SB 4X4NA 2V9KA 4RO0A 2VQFF 1K9MT 4BCAA 4F0KA 3CO9A 2FC8A 3J7ZT 3VR1A 3FRYA 1NB7A 2PE8A 3DXSX 2M88A 1WHVA 2FTRA 1VQ8S 2GQQA 2JEGA 3QO9A 4M5LA 3KK3A 2OAUA 4GKJJ 1TL1A 1NHUA 4K4VA 3JSBA 4DL4A 2OUGA 3NG8A 3LP1A 1LK5A 3C6UB 4NE9C 4OJHA 4C7QA 1IKXB 4H4KC 1KN6A 3SIPB 3M9MB 2ZM6F 4CNYA 3LP2B 2DNKA 1URNA 1R31A 2RKIA 5AXKA 2QL7B 3MEKA 4MKAA 5HJXA 2MKCA 4NL5A 2YBVA 1T9XA 1QSYA 1RTIA 2QTWA 2UVRA 5ETVA 2AX1A 1ZZNA 4F0HA 1RT5A 1NU4A 4GO7X 3KJNB 2EFQA 5A0YB 1JJCB 2RHQB 2Q43A 2J6TA 1I1GA 2XGPA 1WC0A 1UKUA 3PEHA 1S5ZA 1T3OA 1HPZB 3I55S 2VG7B 2AMCB 2IBKA 3DGVA 5HP1B 3C66A 2GMJA 3LP0A 2IM1A 1RBOB 1P8GA 1ZA2B 1TZ0A 3OR1B 3THPA 1Q5YA 5DQHA 3RG6A 1UWAA 2J0WA 4X66F 1D8YA 2YPYA 1R27B 2N3LA 2CZ4A 1RT3B 2HIYA 2OEMA 3M2VA 2BBEA 4ATNA 5DZ6A 5C2GA 1IKVB 2XZTB 3F73A 3POTA 4J91A 1NMEB 4W4MA 5HROB 3H90A 5D0EA 4JI5F 1JNZB 4X64F 1FJGF 3FZBA 4QIGA 2MDAA 2A3JA 1WF1A 3NGTA 4ZHRA 2H51B 5HVHA 4WZMA 5EWGA 2XLKA 3FQLA 3GFYA 3IFEA 4URQU 2MKYA 3KTQA 2ZZTA 2YNFA 3MM8B 4LSNB 4LF4J 3M8YA 1U1OA 2HHQA 5F8GA 2CWXA 2HS3A 4H4KA 3TX8A 3QAUA 3DLGB 2UVWA 4OZ1A 1T95A 4FYWB 2FJBB 2FVRA 4PQUA 1XK8A 1UFLA 4HTIA 1VJWA 3I5AA 2RDDA 1I5OB 1JXVA 1M5OC 2ZWOA 3PO4A 4KV8A 5FD1A 3DGPB 3BN4A 5BYSA 2HYIB 1T03A 2FQQB 4OHWA 3S1TA 4NLRA 2WCXA 1DY3A 2OD6A 2RB7A 1SH2A 2XSJA 2W9AA 3HI9A 2W9BA 5L1IA 3MEEA 3LF0A 4H54A 3M05A 3KJVB 5JMNA 3OT9A 4UUXA 5E5NA 1WSRA 3HHLB 2F4FA 4U67Q 1NXIA 4R8UA 5C25B 3IXQA 2RE1A 1CQNA 4Y2CA 2CQCA 5ETMA 1NM2A 2HVZA 1SC1B 4LR8A 2DGUA 4F2SA 2OMLA 2GMLA 4JI4J 2CQHA 4AYBD 3N4WA 3D1HA 3TI0A 2UUWA 3DMJB 4PG7A 3V6DA 3QNWB 1WG4A 3B8HA 7AT1B 3N6LA 1Q82T 1CBKA 3A3OB 4Y2AA 3BKFA 3UN3A 3HSDA 1RWUA 5A8KA 2ZDPA 5KFWA 2YKNA 2U1AA 1HHQA 3I31A 2KZZA 4NMLA 4CLSA 5DM7Q 3CXCR 4Z7CA 2HHWA 3K5PA 3SEOA 2NLWA 3C8YA 2APOA 4B3MJ 4ZVPB 3DU6A 4K0KF 2ZD1A 2CAJA 3M6XA 4EI2A 2IBOA 1KONA 5E7OB 2E9TA 5HJYA 1RBAA 1HBMA 1YI2S 1IR1A 2DHXA 2IVFB 1T94A 1QTNB 3H8YA 1R89A 4F4YA 3KUHA 1RTDA 2XG8A 4B9VA 5KFTA 3H5YA 3OFHA 4H4OB 1KQSR 2IMOA 1X5PA 3MM7A 2HHSA 2F8HA 4Z2XA 4DZDA 3THTA 1LWCA 4ZOSA 5IWAJ 2DY9A 4YB7A 1YJTA 4YY3J 4TY8A 3HSGA 4C2MA 3EX7B 3L09A 3TAQA 4DS5A 4JI1J 3BO2A 3DRPA 3TOQA 1HNZF 4X4OA 2GFFA 3R2CJ 2F7VA 2RAQA 2J0QD 1YLXA 2FJEB 1XJWB 2ZNZA 2HWIA 5J2MA 2DGWA 2BW7A 2XY7A 1S76D 5E3PA 1MMLA 1RT2A 3R9LA 4ZPDA 4DZ6A 3IO1A 3PTWA 1WSVA 2DVIA 2VQEF 2MKSA 1VLOA 1JLQB 5AJ3F 2AYMA 3PYDA 1L5UA 3ZO7A 3LO3A 5CYQA 2HFUA 4J9LA 2O3DA 2GIRA 3FMWA 1VBXA 2HFOA 3MM9A 3TVYA 1LFPA 1OS5A 3FBCA 4KHRA 3WHIA 2MXYA 4QWDA 3OHAA 2KG0A 4IG3A 2HVIA 2HRYA 3GYNA 3RW7A 1XNRJ 1Z4UA 2V63A 4DDFA 1YIJS 1R7IA 4Y34A 4ED2A 4KGKA 2DR8A 2XS7A 2LXFA 5KFJA 2DTJA 3R5JB 4P2MA 4DI6A 4ES1A 3GJQB 4DR6J 1OY9A 3KLEA 3IWXA 3HPOA 4ZP6A 3V4MA 3H25A 2XCPA 3C2PA 3NKYA 2W2PP 1IKWA 5GVQA 2EPIA 4FP9A 3ZZOA 2H3EB 1T9UA 3JSMB 2BKPA 1RA7A 2V69A 3C14A 4DX5A 1FXLA 2LMIA 3HJVA 3AXKA 3QJPA 1TELA 3SI8A 5H9EJ 3VALA 2IDLA 4U7UK 2XWXA 4OYOA 1Q7LB 4DX6A 3DOKA 2YWWA 5KFNA 4CDIA 3L3CA 3TZWA 5CCMA 2DNOA 4JI2J 1I94F 2U2FA 1SL0A 3V4IB 5KT4A 5D77A 2XMMA 3OFEA 3E2EA 4MYUA 4KO0A 2BW2A 3D9BA 1KOOA 5J1PA 1VC5A 2X7IA 4ZP9A 4RX6A 5CZVA 3IRXB 1U4BA 3M8SA 3I0SB 4IOBA 2GJ2A 1RTHB 2HQGA 2IVMA 2MPUA 3TNVA 5AE2A 3R7NB 3AB2B 4NYZA 1VQLS 4C3KA 3NNCA 3OFFA 1DQAA 1TV6A 1DHMA 3O3LA 3TJ8A 2B43A 1JJ4A 5HBMB 4GC6A 2KJWA 2JEIA 3IBWA 1HI1A 2IFXA 3CO0P 1P9YA 1F3VA 4RBTA 4PG6A 3QSIA 3VWSA 1OQ3A 5LM7E 3VQSA 3IA0A 3BGRB 2XMAA 1EQMA 1RWKB 3K0JA 1SC4B 1RYSA 2OPSA 3SYZA 4C4WA 2OEKA 2A1BA 3GG0A 2YNHB 3HX9A 3BZQA 1PBUA 1U1QA 2GHVC 3RBZA 1TFWA 3DOLA 3KLGA 3W65A 4DX7A 4E8UA 2GVDB 4OX7A 4C0OC 3DU5A 1RT1A 4JV1A 2IAJB 1SKUB 4DPWA 4I4BA 1QM9A 4PUOA 5KFYA 1T03B 3ZZUA 3KYLA 3Q0AA 1KC8T 2VV5A 2C3OA 4IH5A 3DM2A 3NGDA 2YQ0A 5M2PA 5KFAA 1RSCA 1O8BA 4C8NA 3JYTB 3V6HA 3RB3A 4NCGA 3R5AA 2VONA 4B9LA 1SIZA 3IG1A 3MEEB 1UPMB 4LF7F 2OI2A 3LGNA 2X3GA 1S1WA 1SIWB 2HHTA 4URSA 3MFHA 4GVLA 4DUYJ 3M4XA 1IBMJ 3DDKA 3I9ZA 4Y2MA 2CXEA 4DX8H 1XWLA 1QAXA 2HFVA 3OL8A 4X4UA 2MZQA 5L9XA 2CQDA 1B7FA 3W62A 3W9HA 4DR5F 3DRSB 4DV5J 4RL1A 3RZAA 2CPEA 3RJMB 2LKZA 1U1KA 2AJFE 1N34J 3NAIA 1S6OA 4NXMF 3EVOA 4J9OA 4U7CA 2XTJP 1JK9B 2QMXA 3EDRB 1FDBA 3TJAA 1GTHA 4U95A 4MK9A 4AQYJ 1FFGB 4YB6A 1S6UA 3MEDB 1HNVB 2OPPB 1QSSA 3AJ2A 4ECYA 2D3ZA 2ZD1B 5AE1A 2EG1A 3M7VA 2B56A 1X5OA 3DLEB 3NMRA 3TZXA 2P5VA 4JUZA 1OQ6A 4CLTA 1QSLA 5DQIA 4FF2A 4OYMA 1AZSA 3G8QA 1N4LA 1S0MA 5DS7A 5KFCA 4YR2A 3MM6B 1VQ4S 3MFIA 2CNKB 3LWLA 2GW8A 1J5OA 1X4DA 3KHHA 3SZ2A 1SJ1A 2V9WA 4ELVA 1FKPA 3CJ2A 3J7YU 2WVEA 3AT1B 3QIPB 5AXLA 1EP4A 2R7QA 2NZCA 2ASLA 4Y6IA 3L7OA 5E3AA 3D28A 3N5BA 1QAJA 1AW0A 2ATCB 5U47A 3GG1A 3MURP 4PZVA 4PAAA 1N33J 1RA6A 2BR0A 3CD5A 2HEKA 3MOZA 2ZE2A 3DRPB 1Y5IB 1MW7A 2DNMA 2HZAA 3W2VB 2H9ZA 4TU8A 2AEJA 4ZLLA 1BWVA 5CQGA 4BDPA 1WC3A 2J7UA 4QR0A 3M8ZA 2LXIA 3VVTA 4NLQA 1ZAXA 2KH9A 3F44A 1S1TA 4QU6A 1X4EA 2LXUA 3ZTRA 2W8KA 3FDSA 3Q23A 4TXSA 4J9RA 2VH7A 1N6QA 5GAEU 4DUTA 3VAMA 3PCOB 5DLGA 3L95X 3JXOA 1YK9A 3R3TA 1N5YB 2QRRA 3CCWA 3FC9A 3M1VB 3NL0A 4NXNJ 4LF6F 1RB0A 1EAYC 4RNMA 4K2XA 4QWEA 1WHYA 3T5JA 1F0XA 1NH8A 4IG3B 3EPIA 4IR9A 4KYZA 3S7RA 4OHYA 1RYRA 3VZHA 2Y1LB 2R8KA 4O23A 1YBUA 2IM2A 2M2BA 1X9SA 3DRRB 4ILMA 2O5DA 2K1RB 3BGFA 3G6XA 1W26A 2HS0A 4H4MA 4GRSA 2B9XA 4RNHA 2FIUA 1HBOB 1M1GA 2NYIA 2Q66A 3MGJA 2DPIA 2X1FA 3HVAA 3BR9A 4N7TA 3KLEB 3I32A 5LXYA 1IN0A 4ZCLA 2UU9J 5BR8J 4ANEA 4Y3CA 3MMCB 2CJAA 2N3OA 3OSNA 1DRZA 1UA0A 2V5HG 4TYBA 3AFGA 1HW8A 2A10A 5K20B 1U25A 3C16A 3MCMA 4LRBA 4WF9Q 4I67A 1IKYB 3IS9B 4ZVUB 3RB4A 5A8WA 2KJVA 4WCEQ 2MHEA 1A9NB 4OL8A 3MEGB 1NRKA 1U8SA 3TZYA 1ACMB 3CJRA 4Y2KA 2NREA 3Q24A 4DEZA 2CQ4A 4JI6J 2V8GA 4EMDA 2C28A 5EGYA 1VRUB 4HI2A 2G1DA 4YP3A 3IMQJ 2ZZMA 1JLEA 1FTCA 4QU7A 4DFKA 4O44B 1N5TA 3PZPA 2RT3A 4B3RF 1T11A 2DRAA 4DQQA 4I2PA 2MEWA 3C3LA 4ZJOA 3GJRB 3CW2C 5HATA 2HIQA 4IOCQ 4DSKA 1XMQJ 2VODA 1FDNA 2ZC4A 2DCLA 1UWBA 1Q4RA 5IQQA 2D3O1 1V5VA 1G4CA 3HSJA 2QA1A 3F41A 5KG1A 3M6UA 3BGUA 1WC4A 3W8GA 1MMNA 3MECA 5G0RA 5KFZA 4W92B 1RWXB 2ZBPA 1FESA 4OZJA 3PNIA 5KFVA 1RTZA 4CLKA 2A6MA 5B09A 2OJ3A 2I1RA 3GWCA 4WYWA 1JLFA 5E2QA 2MLXA 2VF3A 5KFMA 4NLXA 3S6EA 2WW4A 4KFBB 1HD0A 2BXJA 2BRKA 1FXDA 3KMSA 2HLTA 2L9DA 3A4TA 3EXCX 5SUHA 1J5EJ 1VGYA 4HTJA 5GMEA 2ZBCA 2JNJA 4R5PB 4K4TA 3ILOA 1FD2A 1EKRA 4M5JA 5FIIA 5D0RA 1KNZA 1RCXB 1F3FA 2C2DA 1CVJA 2UUCF 1D8ZA 4P73A 3LALA 3CC2S 2OMOA 1SH0A 5B0CA 4DV3F 4KIAA 2EXUA 3K57A 3B4DA 3JS9A 5K8MA 3DM2B 4N47A 3ZZPA 1IQTA 3MF5A 4DUZJ 3G96A 1WDDA 1TL3B 3GJTB 1YDLA 1Z2ZA 4G3IA 2B6AA 3L7PA 2QFIA 3GV8B 4C8OA 2AD9A 1OYEA 1VRTA 3GIRA 2DYAA 2VG5A 1ZS6A 5I3UA 2GX8A 4MH8A 1NCLA 2ASYA 4ITSA 4B3TF 2ZDOA 2JEJA 3CDBA 1YHQS 2W4DA 4DLGA 2F8EX 5J1EA 4DBQA 2ZH7A 2OHDA 1AUDA 1H98A 2YKAA 1GQEA 1HNXF 1CQMA 4OJ1A 1F9HA 3IWLA 5MAOA 1QLNA 3MI7X 1YVFA 2N4CA 2DNNA 5J2QB 4C97A 1X5SA 3CCLS 4YOEA 4USTA 3GPAA 1VCTA 4YQWA 2VC0A 4I68A 4FVCA 2K3KA 3MZIA 3QLHB 4KHPF 4OMFG 5KFIA 5A2QU 2WBRA 3PR4A 1T9WA 2XC9A 2JVOA 2NXNA 3MCSA 2RQMA 3T5LA 7FD1A 1FCAA 3I5BA 3OJUA 3G4SS 1KQGB 4UZBA 1UA1A 2VJUA 4Q7AA 5J2PB 3HFVA 1NJXA 1KVKA 1RAAB 1S48A 4HHHA 4ZDNA 1IJFB 3NOCA 4PPZA 5KFSA 3H98A 4NI2A 4WFYA 3C15B 2RQKA 2FJWA 5K5MA 1HBNA 2I9SA 5KG6A 2ZH4A 1H7XA 2K7KA 4ELUA 2BUNA 1G7CB 5IFMA 4HACB 1KOHA 2V67A 4NCBA 5KFDA 2RH3A 3OFGA 4IOAQ 2XGQA 1AYEA 3FBEA 2KXNB 1QAYA 2KRRA 3FRZA 4PG4A 3DLKB 3T6BA 1REGX 4FKXA 4LFBJ 1TL7B 2QJ3A 1N32F 1KS2A 3P3DA 3FUYA 1GX5A 4WE1A 4ILRA 4WBFA 3G9CA 2BRLA 1N54B 2BDPA 3M8PA 5A76A 3Q8RB 3HVTA 4RNFA 2DK2A 4BC7A 1R8HA 4QBUA 5E0OA 1ZETA 2A18A 2VFSA 4WJBA 2KT2A 3BPDA 1S1TB 3TRGA 3MM5B 2VA3A 3ZNUA 4ICLB 2MZRA 3CJKB 5T14A 3EICA 1OIAA 1VK8A 3FFIB 4QIVA 3J80U 5KT6A 3W61A 5D78A 5GMKa 3MR5A 1D9AA 4WP9A 3G6ES 5HN0A 2WSFC 4LT6A 4DXLA 5FDLB 4MAKA 3NCPA 2VQFJ 1JLBA 1FDDA 3TO8A 1FX2A 2L9NA 4YMEA 2IRUA 1HNIA 2C3PA 5JVHQ 4KGZB 4LF5F 1HARA 2Y1IA 4O3RA 1Y5NB 3MPUB 2ROEA 2RQ4A 1F1BB 1RAOA 4KY3A 4L73A 3PVXA 3NLCA 2UZAA 3IM8A 2PMZD 1S6PA 4LF1A 4D3GA 2XMJA 4PQAA 1HA1A 1YG0A 5LT5A 1CSJA 1T9VA 2G0IA 4N77A 2W2QP 1U2FA 3AQPA 3HO1A 1Q16B 4RJVA 4KGVB 4U9RA 2MKIA 4FZVA 4LBPA 4CH7A 5KAKA 4KE5A 2CNLB 1C1BA 1QTMA 1JXEA 4OIXA 2ASJA 4ZPCA 2QA4S 4RZRA 2VC1A 2Z30B 2F40A 2HHXA 3JSRA 2AGQA 4LQ9A 2LQ9A 3HHNB 1UJ4A 3C16B 4AE5A 2HLUA 4DR2J 3M2RA 3VGTA 4A8MP 4NA3A 2ZEJA 2PI4A 3T41A 5HI7A 2DHHA 3H4DA 4DHVA 2RUGA 2EC0A 2DPJA 2W2OP 4YDXA 3TR5A 4X62F 2C2MB 2AV5A 2RDJA 2YNIB 1VJQA 3KJFB 2AYEA 2V4JB 1D09B 2BANB 3OUYA 4RW4A 2DXDA 1QY7A 1REVA 4JV0A 2HBZB 4DSFA 1PAEX 3KK1A 1GFWB 4I2PB 3T1HF 1NK6A 4ANCA 2PT0A 1RHQB 2AJ4A 4U8VA 1UETA 3U27A 3B54A 2J8AA 1NK9A 1FWLA 1S9GA 3O1LA 2J9CA 1RHKB 3H0PA 3OXFA 5AE3A 5DDOC 2VPYB 4Q0BB 4NA1A 1TUVA 2DR5A 1TVRB 1SV5B 3OLBA 4JI5J 4TQSA 2QG9B 2UXCF 3UDCA 3LTOA 2ZFHA 2ZKUA 4X64J 3HCXA 4ZA1A 1LWFB 1A6LA 1RT6B 2DHGA 3T6JA 1Q78A 1WF0A 4NYOA 3OTEA 1NK0A 4NLVA 1YRTA 4F50A 5K14A 5L39A 4D3HA 2EW9A 4C0BA 2NXJA 4OI2A 4CLZA 2QL5B 3R5DA 2HBYB 3LW5C 3M6VA 4CLFA 3OD2A 2AX0A 3NNAA 2D9OA 4EFAC 5GAGU 1CJVA 5D8HB 3RW6A 1YJNS 1PIEA 4TU9A 2POKA 3WIVA 4PWDA 4UTGA 3VTIA 3MUVP 1S1VA 1R8PA 5E41A 4AL6A 4ZVEA 4CO5A 2HNDA 1EKSA 3MTKA 3M8QA 1HYSA 3AOBA 1DURA 2EI5A 4L74A 3MUTP 1FE4A 3CJ5A 3LA0A 5BXIA 4PXEA 4PWUA 3MPWA 4MTPA 1VISA 4P75A 2NXUA 5I4MA 2FUG9 1X9MA 1WD6A 4EK2A 1UL3A 1HI0P 4DQPA 3ZFVA 4ZITA 2DCUB 2OPRA 3DRYA 2DXEA 4HHUA 4P9SA 5G4DA 2MQPA 1B0TA 1VIOA 2NPFA 4A8KA 3JTPA 1UTAA 2NZ4A 3PIOQ 3UDLA 1HLWA 1S1UB 3CCMS 3UNGC 4RU9A 2CDRB 4GO5X 3FEYB 2EEYA 2AGOA 1LW0A 2B4PA 4F67A 3UVJB 4MJKA 4IR1A 2IVYA 2QGFB 2AJ1A 2DY1A 4DV4J 2Z56B 5C42B 2BJ9A 1DLOA 4K4ZA 4HKQA 4QYZJ 5HQMA 4KH0B 3AHPA 2HRUA 1P9QC 3VQTA 4MKBA 3AAWB 4RLEA 4KTQA 1JLCB 4LBIA 2VA2A 5CYMB 2HWTA 2G0CA 3M30B 2DH8A 3J7YI 2JC1A 5C24B 1VQNS 1Y3JA 1E6YA 2WONA 2XHCA 2PDAA 1ZM2A 4XTTA 5FLXU 1VC0A 2UP1A 3BDEA 4ZLNA 3V81B 1CC8A 1SQGA 3QGIA 2V8VA 5FJ4A 5EX3A 3DRXA 1E6VB 5D3GA 3DHWC 2FC9A 1EJ7L 2BACA 3UCZP 5IV3A 1CJKB 2K06A 3I4HX 1RHUB 3K17A 4CTAB 4G1IA 1U6FA 4MFBB 2HQ3A 1BC6A 2B7CB 2B4OA 1C0UA 2MLYA 1T05B 5BYRA 3BSOA 1UP1A 3M8PB 2MZ1A 4DR1F 2CQBA 1YZ7A 4O4GA 4ECXA 2YQ3A 2QT7A 5CXTA 2UUAJ 3NWGA 1K0VA 5DETA 3CEDA 3HFZB 1RAIB 2OTLS 2A2CA 5KFOA 2VQEJ 1JMTA 3Q2SC 3T9NA 5AJ3J 1BQXA 3ZTOA 1YKWA 3C6TB 4IRKA 5B0AA 3SV3A 2FJDB 2CIMA 2VOPA 2CZVC 1S9EA 1AB8A 2H4YB 2HHHF 2WSCC 4ERDA 1HHSA 3SSRA 2IDEA 3OTOJ 2VJVA 3D6HB 4DFMA 2OFGX 3QJLA 2LA4A 3AOAA 2PGCA 4GKJF 3SDEB 1ZAVA 3VGUA 1SB6A 1ZYQA 4WIIA 3HZEA 3K7RA 4AL7A 2OGUA 3CC7S 2HGMA 2M8DB 3RU0A 3UCGA 1CC7A 3CCRS 2R3VA 4F2RA 2CJ9A 4K4SA 1CULB 1S57A 2DH9A 2OKQA 2QLBB 2C1EB 3DYAB 3AD9C 1IKXA 1GMWA 1HD1A 3LP2A 3K5LA 4ILLA 1SKWA 3GJSB 3GFHA 2RHSB 2I2YA 2XZDB 3E01A 3LQVA 2NYHA 2BJ1A 3IR5B 3SBMA 4G6VB 2EFVA 4FNIA 4MKYA 3GZ7A 3BQ1A 4LSLA 1NJWA 1XNQF 4J9QA 4J9UE 2P9GA 1X4CA 4O3SA 2AJ0A 1RLCL 4DCPB 2CQ1A 2ROGA 3PRVA 4B9NA 2YQ1A 3CNQP 4NRUA 3EGNA 5A0YA 3UD4P 1Y7PA 2YWKA 5BYQA 1JQGA 3HHLC 4P10A 3SCKE 2NPIA 1HPZA 3LGMA 3HHEA 5HP1A 4NLWA 2WVBA 4OI3A 1K47A 3TX0A 2W01A 3DN9A 4E98A 3OR1A 1XN9A 3Q8QB 1R0BG 4JV2A 4LREA 1B0PA 3I6PA 1HWKA 1TKTB 2MZJA 2B4VA 4XPCA 3PKMA 2K3IA 1C2PA 4L72B 1RT3A 4ED7A 3KJQB 2AIRB 2CNOB 4AL5A 2WSEC 2E29A 1IKVA 3TWZA 1NKEA 4WFNQ 2AP6A 2J6SA 4JI8F 2C2ZB 4P72A 2LECA 5HROA 3TEHB 3KNAA 3CULA 4DL2A 2VFTA 2LEBA 4O4RA 1WHXA 3PKYA 2VKZG 1UJ5A 4LF4F 4BWJA 4CNZA 4EBEA 1UFKA 2IA0A 4OZ5A 2PIIA 2ZH8A 3CWJA 2DBBA 2DNYA 2JOQA 1IBKF 1RUSA 2CPYA 3MM8A 2JLGA 2YY3A 4LSNA 3MR2A 5L46A 1KQKA 1FNMA 2GO8A 3CUNA 4N8NA 3DLGA 2UXBJ 4U7UD 2QZ8A 1KRPA 1KHWA 2LQBA 1U1NA 1FNOA 2ZUAA 2BMBA 1OSCA 1S10A 3EE3A 3MWBA 1Y3KA 3HP6A 2GVZB 1UW4A 2C22A 1RAHB 1VBKA 3AD7C 2X1AA 1PC5A 3CJ0A 1K73T 1X4HA 3CCVS 3DGPA 4ZVRB 3ILLA 4IDKB 3GIIA 1CEZA 4P52A 3IWNC 2GIQA 1LWEB 4DFJA 3SCIE 2DEJA 2Y3YA 2QLWA 3MUMP 2QX0A 3P96A 1M90T 2DH7A 4ED3A 1RWOB 1X4AA 5ETOA 2GQCA 3KJVA 1BXNA 3HHLA 4QIEA 2JLEA 2RILA 4LRAA 5C25A 2KRBA 3PJWA 3KLHB 5HQLA 1M5VC 3L4BC 3GILA 3PYGA 3SQGB 2MKKA 4K2JA 1B4SA 1C4AA 3EZ5A 3QT8A 5B0BA 3ENVA 1TAQA 4LSZB 3A3PB 5F8HA 1UZDA 3MOJB 3DMJA 1H2TZ 1IXKA 3HSZA 2HGLA 5D4LA 4NEZA 4DV1F 3BO3A 4ECQA 4C8MA 2LLZA 1SBRA 3FVYA 4DMZA 2W24A 3CCQS 1TP7A 5HMZA 1OY6A 4G1QA 4ANDA 4A8OA 3H42A 4DV0F 3QT7A 2H5EA 3EDQB 3WBZA 2DB1A 1D0EA 3RB6A 5KOWA 3KK2B 2PMWA 4CH0S 2KU7A 2B9YA 3QGGA 3IR7B 1CPZA 5L38A 4M5DB 3U7JA 3KUGA 3R5CA 3ILJA 5HL7Q 2J0SD 3VHQA 3IBCB 4KR0B 1U6ZA 2CJQA 2O01C 3NWRA 2Z2LA 4M63A 3HD1A 4WU3A 1BQNB 4I56A 1R8BA 3OJSA 3AA8A 3UR0A 1NO8A 4LFAF 4RW9B 4QYZK 3P5BP 2E1RA 2K2PA 4DJBA 3D6TB 3PW5A 2ACYA 4H4OA 1XR6A 2MTLA 3J7Z5 4YUDA 1PJ6A 3K59A 4YFUA 1XEZA 3B82A 1GXTA 4LQ3A 1MWZA 5A2QY 2XSFA 1YBAA 2QSFA 2CJBA 4F3QA 2DNHA 5DO2A 3DDNA 1Y4ZB 4ZIVA 1X8DA 2YXLA 2MSTA 3VGVA 1RTJB 1FJEB 3LUYA 1M5KC 2KXFA 1UEVA 1MU2B 4QWBA 1KHVA 3MMAB 3HFKA 2RSQA 1UMJA 5DGBA 3C46A 1JLQA 1MROB 1D9FA 3PXGa 3GONA 4DCOB 4DL6A 1H73A 3ET6B 2DNGA 3OPKA 4LVNP 5BJRA 1S77D 4LF6J 3W8PA 2ATLA 4K4WA 4W98A 3PJ9A 1XERA 2FYXA 1NKBA 3G82B 3QYYA 1Z1ZA 1K1SA 4RW8B 3A8KA 5KT3A 4UOCA 5IT9Y 4ZVGA 1WORA 1VQ5S 1J2VA 1U2RA 2NS1B 4G65A 4USMA 5F8JA 3UE2A 2D3UA 4FYDA 3PO5A 2C2EA 2PA3A 2Z4PA 4YN3B 1PC4A 4CIOA 3CF5Q 2ILZA 4J9SA 3B4MA 4K5RA 5KOXA 3HVRA 4DR6F 3LAMA 1NK8A 2DRBA 2JFDA 4B17A 4IUFA 3EM1A 1TUWA 2NXEA 4Q8EA 2NUHA 2B8QA 2FJAB 3J80Y 5HK4A 1Q1KA 3TVKA 4KAIA 3E01B 4B08A 3M6WA 3D2WA 2E5LJ 4EO8A 4WP8A 3DHXA 2VL1A 4FYVB 1GMUA 2Y0SD 2ZOMA 3LGHA 1BQMB 4LSLB 4A8QA 3W5ZA 3LPYA 1N36J 3T5KA 3JSMA 1GAOA 1HNWJ 3RTVA 3V6JA 4ZMMA 3D7SB 3SCLE 5KFXA 3WX4A 4JV5F 2J76E 3MAHA 3VAKA 3O5TB 1JLAB 4KKOB 4FXVA 5EHHA 2BOPA 4PEOA 3GLJA 1HR0J 2PN6A 2HRTA 2KHCA 3PYFA 3QZ8A 2QYCA 1LWXA 1U0HA 1S7IA 1JKHB 4B3RJ 4XIUA 3GP9A 3V4IA 5LMNF 4QW8A 3QRPA 2CPFA 4GMKA 4HDHA 4YS2A 2R4FA 3BB5A 6AT1B 3IRXA 3FSYA 1LW2B 2B5JB 3I0SA 5B0GA 1RTHA 4I6WA 2BOAA 5KFRA 2FLPA 4IQXA 1J27A 2CG8A 4LRCA 2VOOA 2F9JA 2HAFA 2ZOGA 2UVUA 3LOUA 2QE5A 2W25A 5IC6B 5HBMA 5T7LB 4KGMA 5KT7A 2F8MA 2LQ8A 1RAGB 1CJUB 2HKEA 1Y0HA 2PC6A 3W66A 2KG1A 2HWHA 5CD4A 3IM9A 3W1YC 3MMBB 3EVWA 2VICA 4Y0FA 5GAGI 2Y8WA 3BGRA 3TUJC 4CO2A 4I2QB 2Z2MA 5D15A 1HHTP 1NDCA 3UFCX 3GR1A 3R1HA 1HIYA 2YNHA 1M5HA 2R2SA 3CCES 2IYGA 3FCVA 4EGLA 4QWAA 5ADZA 1VLYA 2A2DA 3OSPA 3G86A 1NKCA 5L1LA 2GVDA 1TKZB 3TAMA 2M0GB 5I42B 3KXDA 1YJRA 5KFBA 3SV4A 4FN5A 4TLRA 4URGA 4DV3J 1M5PC 2IAJA 1PO6A 2BABA 2E1AA 3ULHA 1NSKL 3V5RA 3WQPA 3A3NB 1U24A 1N5QA 1U2CA 1ELOA 3EXYA 3MMJA 4CLLA 2MLZA 3JYTA 1U6BA 3N6NA 3KLFB 4BBYA 5JUMA 3HHKA 2AHOB 1UVNA 2XY6A 4FS2A 3N6MA 2E1MC 1CJTB 4DU8A 5M2RA 4FBUA 4B3TJ 2OO4A 3JQJA 3UO0A 1F6TA 4RUHA 1LFWA 4EO6A 4DV7F 3JB9k 2KT3A 3T5HA 2YWHA 3BKUA 4ZP7A 1HWUA 1RJJA 2XY5A 3M8RA 1IQZA 1SL1A 4A48A 4XK8C 1HNXJ 2V8HA 4EYIB 1VK3A 5T41A 2W9CB 3J7AN 2V0NA 2QL9B 5DG7A 1HKAA 3T19A 2Y9HA 5I3QA 4P74A 1SJRA 5LL6d 3DRSA 3SFUA 2F1FA 4CLPA 2HHUA 4M5IA 1C0TB 3Q8YA 4KHPJ 2KM8B 1R43A 1S4EA 3ZTPA 4G1QB 2GHPA 4O0IA 1ROFA 3NP5A 3MR6A 2IJRA 3M32B 2MGZA 3OL9A 2YX7A 1KP6A 2ZZNA 4I6YA 4USIA 2W7AA 2VPWB 1H72C 3MEDA 1HNVA 2OPPA 2JX2A 5A6PA 3DLEA 5A8RB 2J8SA 8ATCB 2KVIA 3NGRA 3TA1A 1FEHA 4DSIA 2WB4A 3K89A 3MM6A 1OY8A 2JDJA 4HT7A 3KLVA 2OD4A 2XO6A 4FKYA 4X4VA 3HHDA 4CZCA 2E66A 4WYLA 3D54A 4R0JA 3QIPA 4OI4A 3MAQA 1DQ8A 2XULA 2D7SA 4M5GA 2MZSA 1HW9A 3CDEA 4DFPA 2R2UA 4FNHA 2CFXA 3KG4A 1GXUA 5A6WA 2RUSA 4TQRA 4I7FB 1HQEB 4OLOA 2FJVA 1S0OA 5F0UA 1VMBA 3W2VA 4YEAA 1UEKA 2KKHA 2DHSA 4Y2IA 3ZTSA 4DR7J 1TAUA 1I3OB 4CWBA 2HMIB 1R3NA 1KD1T 1ZPWX 2AEFA 4ZPVR 3G6VA 2XMUA 5B08A 2J9DA 4LFCF 1HBUB 1KLMB 1Q0NA 3A8EA 2MZTA 3TJ9A 5GMDA 1T0TV 4UOHA 1U02A 2XLIA 4PCQA 3OR2B 1L3SA 5FLXY 2KTQA 4OYXA 3GE9A 2XMKA 4NXNF 1UPPA 2YKMB 3S8SA 4RW7B 4F3OA 2OH2A 3D1OA 4KBIA 1Y5LB 1N5YA 5KG3A 3N9UC 4C3MA 3M1VA 4ZPTR 2MJUA 2DGXA 1Q95G 2AZ1A 2XWYA 5ETSA 3GSDA 3DXBA 4NZ6A 2BJ3A 1GEHA 1PKUA 4USUA 3U1LA 5EDWA 2LDYA 2AYGA 1LXNA 2Y0BB 4NLTA 3PW2A 2X3DA 2EG2A 5KG2A 4YDDB 4WFXA 3V6KA 1MMDA 2DNZA 2R7SA 2NSCA 2F4VF 3BQ0A 2AKWB 5K9FA 3IP0A 4LRFA 3DRRA 2K1RA 3R6LB 1XQIA 2VG6B 4L75A 4PWWA 5ETNA 3T9ZA 3ICLA 1IR0A 1AFIA 4J5OA 2AWZA 1HBOA 1WTBA 1S6QB 2ZHAA 4F3MA 5D0HA 4B9MA 4USKA 3BM7A 4IKAA 5BR8F 2PFDA 2H65B 2YWFA 4UOGA 4WKYA 1BD6A 2V8DA 2BJ8A 2HG4A 3MMCA 2WOMB 1IM6A 4MMOA 3T1AA 1WUUA 4DOZA 2W1BA 1S4FA 4EUVA 2V4QA 2W4PA 3N01A 1VQYA 3AD8C 3DFEA 4OYBA 2UVVA 1IKYA 3IS9A 4A8FA 1AT1B 2KYZA 4WK3A 4QYRA 3CJ3A 1D3WA 3P49B 1OWXA 3UN2A 3MEGA 4X62J 3HKZD 2OP5A 4N76A 1N52B 4NLUA 3TAPA 1IVZA 1WEYA 3IR6B 2L41A 1FF2A 1HI8A 4DN0A 4UQGA 2VDIA 3O8WA 1VRUA 2W4CA 1UW9A 4F36A 1DZ5A 2V8PA 1WC5A 1OJ4A 3FJ2A 2QMUB 3OHBA 1QJHA 1U0HB 3JTOA 3Q8UA 3K5MA 4O44A 2DNRA 1A7GE 1HL6A 4MIBA 2EK6A 4MK8A 3T1HJ 1GMWD 2FZCB 2M5YA 4NLOA 2B9EA 1N8RT 2HQDA 4DPUA 4Q5VA 3FEXB 1H74A 4FPRA 3UR3C 4DWIA 3OLAA 1H7WA 3GMGA 1YRXA 4K59A 4OJ3A 1U1PA 4B3SJ 2GJFA 1D9DA 2UXDF 1S0NA 3UWTA 4ED8A 4LF2A 2IPOB 2ZC3A 1KEKA 2V6AA 2Q6BA 1AROP 3ZTQA 4J9PA 1VQOS 2UXCJ 1JLGB 4RW6B 1GXLA 4ECZA 1FKOB 4ZCMA 1TK8A 3MR3A 1VHFA 3O44A 4TVAB 3PY8A 3QWPA 1QVGR 1Q86T 2R2TA 4ZCIA 4UZCA 2RF2B 4ID5B 2AEMA 4X65F 2DGTA 1J5EF 4RPFA 4DQSA 1YJUA 1FDAA 4KFBA 4AXJA 2AZ3A 1NK7A 4DV2J 1SKSA 3DDIA 2WW8A 4M8LA 1MLAA 2ACMA 2E5IA 1ZBTA 1RP5A 2KVQE 3H7HB 5EN1A 2G9OA 4R5PA 1HWJA 3GV5B 2M7SA 5F41A 3TAMB 2HNYB 5JXSA 1DTQB 5KFLA 4V1Ak 2FJXA 5D4PA 1NEEA 3AOCA 4QCLA 4OX9J 5DG8A 1URRA 3JSYA 3G6YA 2E9ZA 5DJBA 4EBCA 5ETTA 2DEIA 3M9NB 2E5HA 4CM0A 2DT9A 1TL3A 1KBRA 1C1CB 4OQJA 3BBFA 4XDCA 3HD2A 3KLIB 1QE1B 2UV8A 2WTFA 1X4BA 2D1CA 3W2WB 5CHCB 2HFSA 2DR7A 1EETB 2VBZA 4NLDA 1RK8A 2B7BB 1SJ3P 1ZOTA 3PW4A 5CABA 2DISA 4MKVA 1NZAA 3DOMB 1N0VC 4IQMA 2DGVA 5HLFB 4USHA 3T3FA 3X1LB 4PKDB 2YKPA 5RUBA 1NZ8A 2GGPA 2I5JB 4NLSA 2N7YA 2BA9A 5CH7B 4A47A 5J2QA 4IFVB 1JX4A 2WRMA 4X2BA 3CB4A 2KB2A 2KN4A 4WU2A 4KT0C 3FSXA 2R2RA 4GKKF 3PV8A 1L3KA 1QVFR 1NSPA 3HK2A 3QLHA 2MGZB 3MD3A 3E51A 4F26A 4EWTA 2XMTA 1PYSB 3DLJA 4OYZA 3GSIA 2V50A 1ZPVA 2C3YA 1TL5A 1PYTA 4OI1A 5F3ZA 1Q8LA 4DSLA 3ZZTA 4JYAF 3PX4A 2ALYB 2MKHA 3HHLD 3K8WA 4I69A 3PHTA 4O3QA 1W25A 1WI6A 4XDDA 3NRBA 5J2PA 2LCWA 3BSNA 1RHJB 5F9NA 4QIWD 3H5SA 3IRWP 2AQ4A 1H2VZ 2VPXB 5MLCV 3NBPB 2H5IB 3AODA 4X4QA 3CCSS 5F8LA 2M70A 1AXQA 2Q1LA 3C15A 2C2NA 2GJIA 3EMTA 5J2NB 1PYOB 1Q8BA 3KHGA 5HSPA 2R8GA 4HACA 4WIQA 3SCJE 1JWWA 1NHVA 2BQ3A 1TFYA 2HZVA 2IJFA 3BYPA 2KDOA 2OTJS 3CJ8A 4K8RA 3OL7A 2OELA 2VIHA 2AJ2A 3DLKA
chains in the Genus database with same CATH topology
3TOQA 1HNZF 2B7CB 4X4OA 2GFFA 2B4OA 2F7VA 4I7FA 1C0UA 2J0QD 2FJEB 4JBCA 1HQEA 4IO9Q 1T05B 4OZLA 2YKQA 3ITHB 5BYRA 3BSOA 3I4PA 1UP1A 3M8PB 2ZNZA 2MZ1A 4DR1F 4DR7F 2CQBA 3WC0A 3EGZA 1I6JA 2HWIA 4YB1P 5D4NA 5J2MA 4O4GA 2DGWA 4ECXA 2XY7A 1HMVB 1S76D 2YQ3A 2QT7A 1KTQA 5CXTA 2HNZB 5E3PA 1MMLA 3NWGA 5IXUA 1K0VA 5DETA 1SJQA 2CPDA 1Q53A 1RT2A 3CEDA 2BQRA 1FK9B 4ZPDA 3P5TL 2OTLS 2HMIA 3PX0A 3RR7A 3ISZA 2A2CA 3IO1A 3NCQA 2F9DA 2QV6A 1SL2A 1N6QB 5KFOA 4KJIA 2DVIA 2CQGA 2VQEF 1JMTA 2MKSA 1JLQB 3Q2SC 4HHJA 3T9NA 4ES2A 5AJ3F 1BQXA 2AYMA 3MM5A 4DSEA 3C6TB 4ICLA 1HBUA 1KLMA 3CJKA 4IRKA 5B0AA 2EFOA 3AJ1A 4F25A 4HLBA 2R7UA 1WEZA 3SV3A 2FJDB 4A4JA 2CIMA 4NYPA 1L5UA 2VOPA 4W90B 2CZVC 3H4BA 3FFIA 3PW0A 1S9EA 2KI2A 1RI7A 2HHHF 3LO3A 3OR2A 2WSCC 3HVWA 5CYQA 2V2KA 1ZTTA 3CMES 4ERDA 1HHSA 4X4PA 1UVLA 3SSRA 4J9LA 1FA0A 2O3DA 4FXWA 5CYJA 2YKMA 2GIRA 3FMWA 3UD3P 5FDLA 1VBXA 4RW7A 1TKDA 1N5VA 2HFOA 3MM9A 1LV5A 3TVYA 1LFPA 1U1LA 1TK0A 1WELA 2JC0A 1OS5A 2LQJA 4LUBA 5EX0A 4KHRA 2OFGX 1KQFB 3KFWX 4DFMA 2LA4A 1UVIA 3QJLA 2PGCA 2P9EA 2ADBA 2MXYA 4QWDA 3OHAA 2KG0A 4NLGA 5KFKA 4IG3A 3SSQA 2ZH5A 2HVIA 2HRYA 3DCAA 3HLUA 3GYNA 1SJ4P 3RW7A 1NJYA 1XNRF 3BF4A 5LJ3Y 4GKJF 2OIHA 2O1PA 3SDEB 2ZJRQ 1Z4UA 1ZAVA 1W2IA 3RB0A 4DDFA 4DG1A 1N0UA 1SB6A 1ZYQA 2GQ2A 4H4MB 2RS8A 4AXIA 2FLNA 4WIIA 3DLHA 3HZEA 3K7RA 4AL7A 1XC9A 3CC7S 2HGMA 4KHMA 3G8TA 3RU0A 3DI6B 2M8DB 1YIJS 1R7IA 2C3UA 3NCRA 3UCGA 6FDRA 1CC7A 2X1GA 5THWA 3CCRS 1SXLA 4DL5A 4NLPA 4Y34A 2RMLA 1DBDA 4ED2A 4J9NA 3QJJA 4KGKA 4U6PA 3HM9A 3ZZYA 4F2RA 4ECTA 4WK1A 2CJ9A 4ZPAA 2KXHA 1F2GA 3D5MA 4J9KA 3HXMA 2DR8A 2XS7A 4K4SA 2DH9A 4DQIA 2P6SA 2OKQA 2LXFA 2VG6A 4PG8A 2AGPA 5KFJA 3DYAB 2W8LA 2DTJA 1Q81T 4M1KA 1IKXA 3WDOA 1HD1A 4ES1A 1TQLA 2JZ5A 2BDPA 2X51A 1RT7B 3LP2A 1S6QA 3K5LA 2MJNA 2MB0B 4IRDA 4IRCA 3PFOA 3KLEA 4HEA9 3IWXA 1SKWA 3HPOA 4ZP6A 3V4MA 3H25A 2Y1RI 2XCPA 3C2PA 3GFHA 2QFJA 3ISND 3NKYA 4AUKA 2I2YA 4RWWA 1IKWA 1KFDA 3E01A 2K7JA 1S79A 4YHHF 3LQVA 5GVQA 4ZVHA 2XNQA 3IR5B 1FNXH 2ZKTA 2HW3A 2EPIA 3BREA 4G6VB 4FP9A 3ZZOA 2E9RX 2EFVA 4DR2F 4FNIA 2R8JA 4MKYA 1FRMA 3GZ7A 5A8WB 3MXHP 3BQ1A 4B9SA 2XMWA 4LSLA 2D41A 3JSMB 1NJWA 1L3TA 1XNQF 2WOMA 1RA7A 1UVKA 4WFAQ 1Q7YT 2CPJA 4J9QA 3GB0A 3KNGA 2P9GA 3OL6A 1X4CA 4O3SA 1FXLA 2AJ0A 2CQ1A 2LMIA 1GH8A 2BM1A 3I0RB 2ROGA 4ED1A 4DV6F 4MIWA 3RAQA 4B9NA 3QJPA 4NRUA 1KVIA 4I0WA 3SI8A 4C8ZA 5H9EJ 3VALA 2QMWA 2N7CA 4U7UK 3KMQA 2DIVA 2XEXA 4EBDA 2RD5C 3I56S 2XWXA 3EGNA 3ENQA 5A0YA 2CQIA 1Q7LB 3SXLA 1FRIA 1RT4B 5IT0A 1U09A 3UD4P 2RIJA 1Y7PA 3DOKA 2AW0A 2C3MA 2YWKA 2ZJQQ 5BYQA 1FO1A 5KFNA 1JLEB 3L3CA 4BHQA 2DGQA 3HHLC 3SCKE 5CCMA 2YNIA 1S7HA 3TVZA 3H2LA 2NPIA 2V4JA 3PRDA 1DJ0A 2NR0A 2RDIA 5GAHU 1HPZA 3LGMA 2W7PA 2DNOA 4JI2F 3HHEA 2BANA 3KG1A 2VFUA 4PPDA 4WFZA 1I94F 2U2FA 2FVQA 1ZH5A 5HP1A 1SL0A 3V4IB 5KT4A 4NLWA 1HFEL 2V94A 4OI3A 5D77A 3NGKA 2XMMA 4WTYA 5F3TA 3H5UA 3OFEA 1DARA 3E2EA 4MYUA 4KO0A 2BW2A 3DN9A 1KOOA 4E98A 5J1PA 3GFZA 1VC5A 4OJGA 3OR1A 5B0EA 4ZP9A 2CQ3A 3H5XA 4RX6A 1XN9A 3Q8QB 5CZVA 1S97A 4JV2A 1X5TA 3J7A1 3IRXB 1B0PA 1U4BA 1S9FA 3I6PA 1HWKA 1TKTB 2B4UA 2MZJA 2ADCA 2B4VA 4ELTA 3MPVA 3M8SA 4XPCA 3I0SB 3PKMA 2K3IA 4IOBA 1C2PA 1UWBB 4B3SF 2GJ2A 4L72B 1RTHB 1RT3A 4ED7A 2L9WA 4AL5A 2X1BA 2IVMA 2MPUA 2WSEC 3BSAA 4PG5A 3TNVA 4ZPBA 4K4UA 5AE2A 2E29A 1IKVA 3EZUA 3CPWR 1U48A 4TNOA 3AB2B 4Q45A 4NYZA 1NKEA 3MECB 5G0RB 1D1UA 1VQLS 4C3KA 3NNCA 4WFNQ 2OPQB 3OFFA 2JJ4D 4NPOA 4QPTA 4Q0BA 1DQAA 2AP6A 1TV6A 2J6SA 4PXDA 2PO4A 4JI8F 4ETXA 1DHMA 3O3LA 2LECA 5HROA 1TVRA 3PRBA 4KSEB 4BS2A 2B43A 1JB0C 1SV5A 2ZITA 2OFHX 1JJ4A 4ID8A 5HBMB 1JLGA 1PGZA 2HFZA 4GC6A 4R0EA 3PJXA 5B7WA 2KJWA 1LK7A 2M9KA 4RW6A 4ZKAA 3KNAA 2JEIA 3AB4B 1FKOA 1JLFB 3TANA 3CULA 3OTDA 4J37A 4DL2A 3IBWA 1HI1A 2IFXA 2VFTA 2LEBA 1F9FA 4TN2A 4O4RA 2VBXA 1LWFA 1WHXA 2VKZG 3PKYA 1RT6A 4RBTA 1UJ5A 4PG6A 4HH0A 4LF4F 3VWSA 4NLYA 4BWJA 1OQ3A 4Y28C 4CNZA 4EBEA 1N48A 2IA0A 4OZ5A 2J9DE 5H9FJ 3VQSA 3IA0A 2PIIA 3BGRB 2ZH8A 3CWJA 2DBBA 2DNYA 2JOQA 2RF2A 4ID5A 1X4GA 5DM6Q 3BO2A 4DV2F 1IBKF 4FF4A 2CVIA 3K0JA 5KT5A 1RYSA 2CPYA 3MM8A 2JLGA 2D9PA 2OPSA 2YY3A 3O2IA 4LSNA 4Q44A 3SYZA 4C4WA 3MR2A 1NAQA 2A1BA 3GG0A 2YNHB 2J6UA 3HX9A 4NA2A 1KQKA 4A8SA 1FNMA 1ZAWA 2GO8A 3BZQA 3CUNA 4A46A 4N8NA 3DLGA 2ILYA 4Y65A 2QZ8A 3I87A 1U1QA 1KRPA 3QIDA 4DQRA 1KHWA 2LQBA 1U1NA 2GHVC 1XMOF 1TFWA 3DOLA 3KLGA 1FNOA 4E8UA 1VQ9S 1VQSA 1OSCA 1RKIA 2GV1A 5GADU 1S10A 4OX7A 4C0OC 2AU0A 3CGIA 2FDNA 3MWBA 3DU5A 2BE2B 1Y3KA 2YWGA 3HP6A 1S0VA 1UW4A 2C22A 1UAWA 2AJQA 3OBIA 2X1AA 1RT1A 5KFUA 2FHOB 4JV1A 2IAJB 3G8SA 1PC5A 3W7BA 4I4BA 1QM9A 2YTCA 4OX9F 4RNNA 3CJ0A 4PUOA 5KFYA 1K73T 2HVHA 1T03B 1VQ7S 3ZZUA 3KYLA 2HNYA 3Q0AA 1N88A 1X4HA 3CCVS 3DGPA 1KC8T 1HWLA 2VV5A 4IDKB 3GIIA 1DTQA 2C3OA 4IH5A 3DM2A 3CMAS 5KFHA 1CEZA 4KPYA 3NGDA 5B0DA 3ONQA 5M2PA 3IWNC 1JIHA 5KFAA 2B6AB 4DF4A 2GIQA 2UV8G 1O8BA 2ZBIA 1LWEB 4C8NA 3JYTB 3V6HA 4DFJA 5CCLA 3RB3A 4FF3A 4NCGA 3R5AA 4IO1A 3SCIE 2VONA 1M1KT 4B9LA 2Q6CA 5L8RC 2ZH3A 1SIZA 1VQKS 3IG1A 5C5JA 5DLFA 3MEEB 2QLWA 1VRTB 3ZZRA 3IN5A 1X0FA 4LF7F 2AF6A 2QA4G 1TK5A 3LGNA 2FLOA 3OVBA 3MUMP 3TARA 3OTBA 3P96A 3OXGA 3KG0A 4NX9A 1M90T 4EEYA 2DH7A 2X3GA 1S72S 4ED3A 2VG5B 3RRHA 5LSOA 4F02A 1X4AA 5I3UB 2L3MA 1C1CA 1S1WA 5DGAA 2FHMA 2HPUA 4C8YA 2GQCA 1QE1A 1SIWB 3KLIA 4URSA 4BC9A 3MFHA 3KJVA 2HHTA 1OSDA 1FTRA 3AQOA 1FJ7A 3SSSA 3HHLA 3W2WA 5HO4A 4DUYF 3CD7A 3M4XA 1YWXA 3X3UA 4QIEA 1IBMF 4K50A 2JLEA 1UJ6A 2RILA 5C25A 2KRBA 2MQLA 3DDKA 2HHVA 3WC2A 2YNGB 3PJWA 4Q2LA 3I9ZA 3KLHB 5J1EB 4F8RA 1M5VC 1GT8A 1EETA 3UPFA 3GILA 4Y2MA 3SQGB 4IG0B 2MKKA 5EUHA 2MSSA 1H0HB 2XS5A 1C4AA 4DX8H 1U45A 3EZ5A 3ISNC 5B0BA 1T3NA 1XWLA 2KFZA 1QAXA 5KT2A 3OL8A 2E5JA 1NJIT 4X4UA 1N5SA 2MZQA 3ENVA 4JI0F 1TAQA 2CQDA 1F5AA 5L9XA 1B7FA 3DOMA 2UUTA 4NCAA 2XS2A 3VAHA 2Y1JA 5F8HA 1UEUA 4YR0A 5HLFA 2CPIA 3DMJA 1C4CA 4ZP8A 3MOJB 4DR5F 2GGPB 3LANA 2MY7A 1F5BA 1H2TZ 4CT8A 1WF2A 1IXKA 3DRSB 4N5SA 1YTYA 5F8NA 3QMQA 4DV5F 5LSRA 2HGLA 3RZAA 5D4LA 2CPEA 4DV1F 3BO3A 1JNRB 2I5JA 2LKZA 2YH1A 1U1KA 4V19X 2AJFE 1N34F 3NAIA 4ECQA 4C8MA 2LLZA 1S6OA 3LH2S 1N56A 4NXMF 1SBRA 3FVYA 1S1XB 4DMZA 5DDRC 4U7CA 4XO0A 2JL9A 1S1UA 2CYYA 3R5BA 4J9OA 1JK9B 2QMXA 4QQBA 4IFVA 4NZ0A 1FDBA 5KFEA 2W24A 1GTHA 3HZGA 3CCQS 1WTFA 1HQUB 4DV4F 2RNEA 1TP7A 4A8WA 2PFFB 5HMZA 3BS9A 4G1QA 4MK9A 4AQYF 1VQPS 3PM9A 4YB6A 4A8OA 4CO3A 2XB2D 3HJFA 1R0AB 1G2EA 2RVJA 4DV0F 1S6UA 2H5EA 3WBZA 3MEDB 1HNVB 2OPPB 4Q2MA 4R25A 2R9LA 2DB1A 3AJ2A 1D0EA 4ECYA 1QSSA 2D3ZA 3FMBA 2RQCA 4MYTA 3RB6A 2ZD1B 5AE1A 5KOWA 2EG1A 3KK2B 3OW2R 4OZNA 4LF9F 2B56A 1X5OA 3QPIA 2ZUGA 4M95A 3DLEB 4JI3F 3NAHA 1YRUA 4CH0S 3NMRA 4MK7A 2KU7A 2P5VA 4HT5A 2B9YA 4JUZA 5C42A 1OQ6A 1RDRA 3QGGA 4DF8A 3IR7B 2K8GA 3TUIC 5DQIA 1QSLA 4FF2A 1CPZA 5L38A 4M5DB 4ECWA 2CPXA 3CDWA 3U7JA 3BR8A 3G8QA 1N4LA 2G13A 1S0MA 1X7VA 5DS7A 3R5CA 5HMXA 4CQ1A 3MD1A 5KFCA 5HL7Q 4YR2A 4CO1A 2CDQA 3MM6B 2J0SD 1VQ4S 5F9LA 3MFIA 3RYLA 4L6V3 4KQZA 3LWLA 1O51A 4KR0B 2HGNA 1U6ZA 2CJQA 2O01C 2GW8A 1J5OA 1HBNB 1RISA 1X4DA 1JLCA 4B3OB 2E1CA 1IJEB 3KHHA 5CYMA 1CG2A 1TKXB 2E44A 2DGSA 2Z2LA 3SZ2A 1SJ1A 4M63A 3D0GE 4DR3F 1IM4A 3RBEA 2V9WA 3I9V9 3M30A 4WU3A 4ELVA 1BQNB 1FKPA 4I56A 4RKUC 1R8BA 4ZK7M 3OJSA 3AA8A 3CJ2A 5KG4A 3J7YU 3UR0A 5C24A 3QIPB 1BY9A 1NO8A 3NBPA 4LFAF 4OX8A 4RW9B 2ALZA 5AXLA 1SUQB 2E1RA 1EP4A 2K2PA 2R7QA 4DJBA 3PW5A 3DLLQ 5IZHA 2ACYA 2J0XA 2ASLA 2JEFA 2NUUG 4Y6IA 5J2NA 1FJCA 3R1LA 4H4OA 1XR6A 2L08A 3L7OA 5E3AA 3H40A 3J7Z5 3RR8A 1NH7A 2VZ9A 1R6YA 3D28A 3N5BA 4YUDA 2YX1A 3V81A 3K59A 4OZ0A 1YGYA 5HMWA 1QAJA 2FVPA 1AW0A 4YFUA 4OLPA 5U47A 3Q22A 3GG1A 1XEZA 3B82A 5DG9A 1E6VA 1GXTA 3MURP 4OV1A 3OXLA 3UCUP 5E3CA 2E5GA 4LQ3A 1MWZA 5A2QY 1N33F 1RA6A 2BR0A 2XSFA 3CD5A 3CT9A 1K8AT 3MOZA 3MTJA 4I1TA 3N79A 2ZE2A 2ZH2A 2JVRA 3DRPB 3O6QA 1Y5IB 3RAMA 2MKJA 1OPZA 1YBAA 3PX6A 1MW7A 2DNMA 4WE1B 2QSFA 4J9MA 2CJBA 3W2VB 2H9ZA 4C11B 4WXOA 4CTAA 4TU8A 2IA6A 4UW2A 3ETOA 4F3QA 4C8LA 3HVTB