4Y6IA

Crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
ASVVVLATAPDEATAQDLAAKVLAEKLAAAATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLEALKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Divalent-cation tolerance protein CutA
publication title Crystal structure of E.coli CutA1 E61V/C16A/C39A/C79A mutation
rcsb
source organism Escherichia coli k-12
total genus 24
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y6iA00
5D4LA 2J9EA 4WK1A 1UFLA 1O5JA 1VFJA 2NS1B 2J9DA 1V9OA 1UL3A 4RWXA 3O5TB 1KR4A 4Y65A 4Y6IA 4ZK7M 3O8WA 3M05A 1P1LA 4IYQA 3T9ZA 3TA1A 4OZNA 3BZQA 4RWWA 3HLUA 5D4NA 4C3LA 3DFEA 2O67A 1QY7A 2Z0GA 2CZ4A 1XK8A 4WK3A 2ZFHA 2NUHA 4OZLA 4CO0A 1OSCA 2O66A 3NCPA 2V5HG 4OZJA 4C3KA 1PILA 2PIIA 4RX6A 4YB6A 2XULA 1UKUA 4CNYA 4CO4A 5D4OA 4NYPA 4E98A 4RLEA 2J9CA 3AH6A 5DS7A 1V6HA 4CO5A 2EG2A 3OPKA 5D4PA 1VHFA 2XBPA 4YB7A 1NZAA 1J2VA 2GX8A 3CE8A 3TA2A 2VD3A 2GNKA 1NH7A 4D3GA 2NUUG 4NYOA 2XZWA 1O51A 4CO3A 2GW8A 2ZOMA 1HWUA 2XG8A 3AHPA 1UMJA 4CNZA 3AA8A 3LF0A 3L7PA 3N5BA 3TA0A 4AFFA 1NH8A 3NCRA 4USJC 3MHYA 4R25A 1V3RA 4USHA 1NAQA 4USIA 1H3DA 2E66A 2DCLA 4C3MA 3AA9A 1GNKA 4YB5A 3NCQA 1V3SA 5DRKA 5L9NA 2EG1A 4CO2A 3X3UA 4D3HA 2J9DE 3GSDA 2RD5C 2JJ4D 1Q1KA 4CO1A
chains in the Genus database with same CATH superfamily
1PGZA 4DN0A 3OVAA 4WK1A 1TK8A 2IM0A 2FJVA 2M9KA 2MZQA 3CDAA 3GQCA 4P2SA 1R8BA 4X4QA 2G9OA 1WG4A 4Y0FA 2PIIA 3KYLA 2MKIA 1SBRA 3GILA 1KWMA 3TZZA 3J80U 4PWDB 4J90A 1WEXA 3V6DB 2F40A 4YHHJ 1YZ6A 2DISA 3BO3A 2L9DA 1B0PA 2HNZB 3HSZA 3GTYX 1IQTA 2U1AA 4JV5F 4ZA1A 4CNZA 2R2UA 3PACA 2E7VA 5D15A 4I67A 1H98A 1F9EB 1G3OA 1U2FA 4ED4A 1CLFA 4USUA 4V1Ak 1N6QA 2P6SA 1R89A 4N76A 1Q7LB 4LBPA 2GQCA 1TKZB 3GFXA 3DLEB 1RU2A 2AYBA 2R7RA 4BWJA 4CO1A 3PW5A 1BWEA 3S6EA 4XPEA 5BJRA 3LGNA 3MM8B 2ZBRA 1R43A 2IVYA 2UUCJ 2DB1A 3IXQA 1UWBA 2YNGB 4Z37A 2YWWA 2ZOFA 3TW0A 2ZUAA 2QMUB 2NUHA 3Q86A 1RHRB 8ATCB 2VJVA 2J6TA 4ZPCA 4RJVA 4CLSA 3UCZP 2H4WB 1MU2A 5KT7A 2ZWPA 2V0NA 4TKTA 1V3ZA 2WRMA 2VC1A 4FXDA 3R5CA 1GXUA 1M5SA 2MQLA 2VL1A 2HAFA 1RB0A 2IJRA 4OX9F 4QPTA 2HQCA 1CPZA 4FNHA 3AJ1A 2DITA 6FD1A 5ETMA 2FHKA 2Q3PA 3MECA 4DR3F 1SV5A 1TUGB 5FDLA 4AE5A 3D66A 1LV5A 3TOQA 4NYZA 4DV6J 4IRDA 2OP5A 3V5RA 3QSIA 3TZWA 3HP6A 1YJWS 2YKMB 3HDSA 4ECTA 3IO1A 3TWZA 5DO2A 1XNRF 4YB6A 3UI3A 2DD8S 3HFVA 4DS4A 3EZOA 3PX0A 3RAMA 4LMZA 1YRTA 4DUTA 1QAYA 5K8PA 2W9BA 1JLQB 3KMQA 3VZHA 4OIXA 3UCGA 2RHQB 2Z2LA 2AJQA 1TL3B 4RR5A 4Q2LA 3QAUA 2GHVC 2DR9A 4AQYJ 1CULB 3MI7X 3J81j 1VIXA 3GSIA 1I1GA 3H4BA 4J9NA 3TJAA 4X64J 2DR5A 1S79A 1VQOS 4TQRA 3PV8A 2OO4A 2CG4A 1RT4B 3W5XA 2OTJS 2GS8A 2FB0A 4FN5A 1FFGB 2CQ1A 5EUHA 3LP0A 1EJ7L 1V9OA 3Q23A 1WOOA 2RT3A 1NLKL 4FPRA 2V4QA 4WPAA 3IWXA 1SJRA 3ZZTA 1VJQA 5KOXA 3AOBA 3TX0A 4Y2KA 3HHLA 3Q8VA 3CDUA 5L39A 2DIUA 2O5DA 4UZCA 3PRDA 4DN9A 2XI2A 3NGDA 1FHTA 3HI9A 3V81A 4TY9A 2GVZA 1U25A 1UWAA 4FVCA 3L3CA 4NI2A 1U1OA 2UXCJ 3OSNA 4K4VA 4QQBA 2QLJB 4FYYB 3KK2B 3D68A 2M5YA 3A13A 2C28A 3R6LB 1S6QA 1EB0A 4MKBA 3HHNB 3MMJA 3EVWA 2BE7D 3D6MB 2QA4S 1ZS6A 3C66A 1GXTA 3L4BC 1M0SA 3KLEB 4QBUA 4JI4F 3WDOA 3I9V9 1XIQA 3BJYA 3UDLA 4NLYA 2OPQA 1S9GB 4RW6A 2POKA 2HGMA 4AT1B 1RT7B 3MEGA 1ROFA 3DRSA 3BH7B 4OV6A 3K89A 1TKXB 3VAMA 1HD1A 1YVFA 3GP9A 1Q79A 1U6BA 1SC3B 2J0SD 2VH7A 2UXBJ 4KV8A 1B70B 2W7PA 4RW4A 1RCOB 2G0CA 1NK5A 4ECSA 2WTFA 5G0RA 3MM9A 4DFJA 1U0HA 1VLOA 2OPPB 5KFAA 4RNMA 1JKHB 3CE8A 3OSPA 1QVFR 3GYXB 4DCPB 3PYDA 1KFDA 3I0SB 1O0PA 5DJBA 4Q45A 2Z8QA 3UD3P 1RT1B 5AE2A 2MSTA 1S59A 3LAMA 1S4FA 1RCXB 1X9WA 2Q1LA 5L9XA 4LF6F 3SMZA 2QEXS 5HLFB 1VQ5S 4LF2A 3PO5A 1XERA 3TEGA 1RHUB 2HBYB 4WFAQ 2RDIA 3SXLA 1B64A 4LIWA 5L1KA 1L3UA 4IUFA 3I9ZA 3F73A 3H5XA 3HHLC 4C8ZA 3CJTA 4ZJLA 4B9SA 2CQIA 2W7AA 4DV5F 4W98A 3NY0A 3MR5A 1M5HA 1L3VA 2QRRA 4GRSA 1WI6A 2DNHA 4UQGA 3Q0AA 1UJ5A 1L3KA 4ZCKA 2C3MA 5DLGA 1WG1A 3RRKA 4ZLPA 2XG8A 1F6TA 1AB8A 2R8IA 4MFBB 3T9NA 4B3MF 1R0BG 5I3UA 4UUXA 5L1LA 1TMMA 1HLWA 2BJ3A 1JLBB 2CJKA 5KFUA 1FXRA 2OPSB 2DCLA 1XWLA 1TTHB 1N5YB 4Y2MA 3P4UB 4F4WA 3LO3A 2DGOA 5HANA 2MZJA 2DGWA 1FF2A 1IM4A 2FVCA 3CO0P 4PG4A 4AL5A 4HYKA 4HT7A 2ASLA 3PNIA 3CJ0A 2DVIA 4X4SA 2YH1A 2FLPA 1RAOA 2C3PA 4WFXA 3BGLA 3N4WA 4ZHRA 1PYTA 3HX9A 2GO8A 5GAGU 4ZVFA 5K8OA 2XO7A 5J2NA 1FA0A 1JB0C 3IRXA 1Y3JA 2IC3B 3AJ2A 3CJ4A 2XB2D 5D4PA 2QIFA 1NJXA 1PAEX 3GB0A 5F8GA 3HVTB 2YBVA 3EXYA 3T1YF 1K9MT 4QWEA 2FJXA 1QD1A 3O6QA 3OTDA 1UEKA 2BACA 2YKAA 2HHWA 3HHKA 1C0UA 2E9RX 4F4ZA 3DOLB 3WZ0A 4B02A 3TX8A 4O3NA 1VCTA 4FYWB 1RT6A 5KT4A 1M5OC 1F2GA 4UTGA 5A6WA 1RWVB 3NGUA 2EG1A 5KFNA 3I5CA 4B3OB 5IT0A 1REGX 2GMJA 3CD7A 2RMLA 3KJVB 5J2MB 2CPJA 5CABA 2ZDPA 4O0NA 5HAOA 3UW1A 2DNNA 1KRPA 4NLUA 1AZSA 1T9TA 4KHMA 3K7RA 3ICLA 1MNEA 1RXOB 4Y00A 2D69A 2XYGB 5GMEA 3KLHB 4M5LA 5D4OA 4X4TA 2OSQA 3ETMA 3OR2B 2YNHB 2A0FB 1CJVA 4R0EA 4QWBA 3OL6A 4DV3J 3CCQS 3LQVA 4H4MA 1RE1B 4RW7B 3PVXA 5LJ3Y 3DHWC 4OX9J 1S12A 3CC7S 5KFXA 1S97A 3HD2A 2GGPB 3GWCA 1O8BA 3KLGB 3BO2A 4MJKA 2Z56B 1UEVA 5A8KB 3GLJA 2VPYB 4CCHA 2VHGA 3CC2S 1PC5A 4FYVB 2ILYA 4M5NA 2VBXA 2JEGA 4DR3J 5DQGA 4R8UB 2I5JB 2OPRB 3G71S 4DR2F 2IIHA 2JSXA 4JI1F 1HW8A 5J2PB 4I1TA 1T9XA 5KFVA 4NLVA 1UTAA 2FJBB 1KN6A 1X0FA 4C3LA 3DU5A 1SB6A 2DR6A 2DRDA 2XEXA 3JQJA 2XLJA 4N56A 5KT6A 1XNRJ 4DSIA 2KHDA 3SDEA 1PIEA 4PG7A 4KGZB 2VG5A 4CYUB 4LBHA 2CPYA 4YN3B 4NLGA 4W4MA 2F4VF 1HBMB 2HQDA 4KGMA 2V8DA 3N01A 2CQHA 4NRUA 1M5KC 1WC0A 4QU7A 3TA0A 2XLKA 4NOHA 1JXEA 3BV8A 4USHA 2B5JB 2RQKA 3G9CA 1N36F 2EBGA 2OUGA 1Q0NA 2JC1A 3ULHA 2W2QP 1HIYA 5SZTA 3M8RA 2VBYA 2LQ5A 2DBBA 4F4YA 4AXIA 3PY8A 4RWWA 2KHCA 1T7PA 3DDKA 3KLIB 1U1LA 2Y8WA 4HI2A 2DHSA 2YKNA 1F1BB 2V5HG 3IGVA 3OXGA 5D0GA 3B78A 3NKYA 1RWUA 3HF5A 2RDDA 1FNOA 3I0RA 2ZVSA 1LFPA 2D41A 4V19X 4LR8A 2ZJQQ 3LPEA 4U95A 3MPUB 1Z2LA 4LF8F 2BE2A 5CCMA 4CZCA 4RW9A 4ECZA 1VJWA 2DHXA 4DV4F 2Q66A 2JRSA 1R6VA 4P2XA 4PYAA 2G2OA 4DQIA 5U47A 3A4TA 1PAUB 2QLBB 4OHZA 3AB2B 2KXHA 4O23A 2OH2A 1NSAA 3SIPB 4M94A 1U48A 1F3FA 2VKRA 5HMYA 3VR1A 3LWMA 1QDUB 2QA2A 4GC6A 5AXKA 3FVYA 4YMEA 3MCMA 1TL5A 3MMAA 3IFEA 1VISA 4O0IA 3TZYA 2QA4G 3HKZD 1PBUA 1N6QB 5BYRA 1W7WA 4ELUA 2CA9A 1Y00A 3NBPA 1HQEA 4OZLA 3BSOA 2WVEA 4UOHA 4Z2XA 5G4DA 1HWKA 3GE9A 3M2RA 1N0UA 1EARA 2AZ1A 3N28A 3KXDA 3KLVA 3QRPA 1UWBB 3K8WA 3AXKA 4OHYA 1VHFA 1RDRA 3M2UA 2B9EA 4ZP8A 4B3TJ 5F0UA 2A10A 2DEIA 1LEOA 3HVRA 2G2ZA 5DDPC 4EBCA 2WONA 1SJFA 1MU2B 3LF0A 1T03A 1Y5NB 1FRHA 2ZH6A 3BGFA 1YX2A 2WCXA 2C2ZB 1S1TA 2F9DA 1N48A 3DDNA 1X9SA 2C42A 4LF6J 3D3CJ 4IO1A 4DV0J 4M95A 1TK0A 2ZH1A 3HXMA 2DHGA 2DEJA 1FTCA 2VDHA 3DKDA 2NS1B 1Q16B 2J9DA 2MY7A 4RWXA 3B8HA 3UDEA 4IR9A 4PQAA 4F26A 1JXLA 4ECVA 5FDLB 5E33A 4E0DA 2DGTA 3JSRA 2QYGA 1NJIT 4IG0A 3GU0A 2FTRA 4JB8B 1GFWB 4DV5J 3BDPA 4M5IA 3K5PA 3EWGA 2RS8A 2LU2A 3A8KA 5CHCB 4USKA 3OT9A 2YKQA 2H48B 1SUQA 1SVDA 3PW0A 3MM6A 1SIZA 4B3MJ 4QJVA 3MD3A 2Z30B 4AL6A 3PIOQ 4A47A 1WTBA 1GQEA 4UZBA 3ONQA 3O44A 3ZZOA 3GCWP 2IM1A 4IG3B 4MK7A 3MF5A 2E7WA 3RAQA 3HO1A 2LDYA 4I4BA 5T7LA 2ABYA 2E1PA 1HW9A 2D3ZA 3QNWB 1K44A 3OXFA 2MZSA 1P8GA 2EFGA 4NA2A 5KFHA 1HMVB 5KG4A 4DPOA 5DQHA 4LRAA 2OFHX 3L95X 5D0RA 2ZC4A 3DMJA 1HHQA 3U1MA 2ASJA 3BN7A 3LP0B 2IRYA 5SUHA 4DDFA 4USVA 5DLFA 5J2QA 5AE3A 3RU0A 1JNZB 1PG5B 4X4OA 3NLCA 3AB4B 1TVRA 2OKQA 4W90B 1XR7A 2R7WA 2ZBIA 1I51B 2V34A 3HJVA 3T1YJ 2MQQA 2OMLA 3JQKA 2HPUA 4CLKA 2ZOMA 1N33F 4C4WA 1KQSR 4LRCA 1LKZA 3UN5A 3V81B 2W2OP 2GVZB 4CLTA 2XY7A 2B43A 1SQEA 2BJ9A 1OQ3A 5DETA 2HHSA 5D0EA 5DGAA 1J5OA 2V2VA 3CC4S 4MMOA 1AYEA 2ZZTA 1XTZA 2QZ8A 2QE5A 2KZZA 1VRUA 1S0MA 1RTDA 3NAIA 3JSBA 4Y28C 2XYHB 4NPOA 3H0PA 5KFRA 3R5BA 1TR0A 1S6QB 5M2UA 1HARA 3FBEA 4OZNA 4OHVA 3SCJE 2QL9B 1NDKA 2DY9A 3MPYA 1X60A 2C2MB 3R1LA 4P2MA 3D4JA 2M4MA 5H9FK 3QIPA 5A8RA 2HS4A 3RGIA 4F3OA 1NK9A 4I2QA 3UQSA 1KC8T 2OPQB 5LOQA 4RW6B 4J9MA 2FHOB 1U47A 3MEGB 1ZM9A 3DRSB 2QA1A 2JLEA 4OI2A 1ZBTA 2G1HA 4KH1B 2MZTA 2EG2A 3V4MA 2XMVA 3NAHA 3RB0A 3W66A 3DGVA 2RJZA 4KV8B 1KVKA 2J0WA 1T05A 2IDEA 4KIAA 2GNKA 1XQIA 4RW4B 4IH6A 5I3PA 4N7TA 2K3KA 4CLFA 2HQFA 2XNRA 2KYXA 5G0RB 3MM9B 4ITSA 3UNGC 4JI7F 4HT5A 5KT3A 1OQ6A 4PQUA 4ZJQA 5KAKA 2GIQA 3W8GA 2ERRA 1IJFB 3NGRA 3DLHA 3GZ7A 1RT2A 4O3RA 2HLTA 5E2QA 3H20A 3MTKA 3EGZA 1ZYQA 4ZPVR 2CPDA 4DR2J 4HACB 1NKBA 1NCLA 4JI1J 1Y3KA 2XGQA 2AX1A 4F4AA 2OELA 2B8PA 4YDDB 1UPPA 3K58A 4Y65A 2A2CA 3G8TA 5I42A 3MEEA 2O67A 3VQSA 4X4VA 4BS2A 1X5PA 1DZ5A 5CAAA 1N88A 3QQCD 1BMQB 1LWXA 4U7CA 3I31A 1C1CA 2V63A 4YB7A 1NZAA 1R8PA 2F4VJ 3TVYA 1HQUA 2FHJD 1WJ9A 2KI2A 2DH9A 5D78A 1ZPVA 2VICA 3K17A 3LANA 1TL7A 2N3OA 1VQMS 2VONA 2YPYA 5FJ4A 1WC4A 3FDSA 2PI4A 2HFZA 1KDNA 4A48A 3CJ3A 3GV7B 1FWKA 1QE1A 2HBRB 4ATNA 1N36J 2DPIA 3H2LA 3UCUP 2E5JA 4RBTA 5EDWA 2EKYA 5JVHQ 5KG1A 2M3DA 2ZM6F 2CQCA 3SFGA 1U6FA 3D6HB 4J9KA 2V8GA 3D6TB 3B82A 3L9ZA 2RKIA 2DRBA 4RNHA 2M52A 2RUGA 4GVLA 3AH6A 3H5SA 4LF8J 2V2QA 3FFIB 4LF7F 4I69A 3OHAA 1TK5A 1NZ8A 4ZHRB 4ZCIA 3F41A 2UXDF 4DLGA 3H90A 3QGIA 3M6WA 4DWIA 2EFOA 5J2NB 3IRXB 1MG7A 4JYAF 2CIMA 1S1VA 3TNVA 1BWVA 1S1UA 3EE3A 5KFCA 4DFMA 2JLGA 4WZMA 1C1BA 2CQ3A 4L3NA 2H51B 1NB7A 1VRTA 1IJEB 1C0UB 3GFHA 3TUPA 1IQZA 4JI3F 4M8LA 2FY1A 2GVDA 4AXJA 3Q8QB 2AJ2A 2D1CA 2XYPB 1RT6B 2K7JA 2Q6BA 3N9UC 2PMZD 2K06A 2P2CB 3QAEA 1NEEA 2PC6A 2LLZA 3ITHB 4DUYF 2HHUA 3HHDA 1S0NA 2CPEA 3C46A 2W9CA 1JLGA 2B3TB 3BF4A 1OY6A 5DM6Q 2JFKA 4NXMF 2QFIA 3FCHA 1AZSB 2PGCA 1X4EA 4NEYA 5KFOA 4HH0A 1M5VC 3Q8RB 3SEOA 2BUNA 4F50A 1OY8A 3PYGA 3JTNA 2E5HA 1MMLA 4BC9A 2UVVA 5HVGA 1UJ6A 4DU7A 2MKKA 1CJVB 2H5JB 5GMDA 1U45A 1H2TZ 4HTJA 4H4MB 2HZVA 1E6YA 1W26A 3HHLD 4A8FA 2ILZA 3NG8A 4LQ9A 3GSDA 2KTQA 4F04B 4HHUA 4OFZA 1SL0A 2M0GB 2MZ1A 1UVIA 1PBAA 2AGPA 2HNDA 5DGBA 3SYZA 1WF2A 2KZMA 5B0EA 1FDAA 3W2VA 5THWA 3W65A 2C2DA 3I82A 2BQRA 3JYTA 2BJ8A 1Q81T 2V8VA 4KSEB 1HL6A 5CQGA 2V6AA 1FRKA 3SCKE 4K4XA 4NLQA 4J9SA 4ZMMA 2IJNA 3C19A 4P2FA 3H40A 3CJ5A 4DFPA 2DR7A 4LFCF 2WB4A 4C11A 4DX7A 1WHVA 7FDRA 3SDEB 3FZ2A 2FLOA 2AD9A 5HJXA 5HP1A 3EXCX 2ZH2A 3J7YI 4C97A 4IFVB 3MFIA 3D6FB 3BGRA 1FNXH 1NNDA 1X4HA 3G2XA 1TUVA 2C2RA 2XGPA 5DDRC 2DH7A 3ENQA 3V4IB 4JI2F 3GR0A 2MQPA 1WI8A 1SQGA 1EKSA 2AJFE 2DHHA 5JVGQ 2IAJA 3LALA 4LT6A 4J7CA 1OO0B 3ZO7A 4C6AA 5JUMA 4C0OC 2QLFB 1LWCA 4OYMA 4RO0A 4ZVHA 4URQU 3D67A 4DL0C 3IC1A 2J7KA 4KGVB 2W01A 5AJ3J 3KLFB 1RKIA 2AMCB 4F4XA 5ADZA 1URNA 5CYJA 4LJMA 2YKNB 4UUWA 1BY9A 1NKEA 1L3TA 1FE4A 4NYOA 4FKYA 1B3TA 1N33J 2IDLA 3M32A 1YITS 2FD2A 4ETXA 3VAFA 3N79A 1ZA1B 3FGVA 2LQJA 3I0RB 1X5TA 1RWMB 4KY3A 1I6JA 4H4OA 1S9EA 1GK8A 1TKTA 4I2PA 3E51A 3Q2TC 1OPZA 2BE2B 1NJZA 2XSFA 4RW9B 1FKAF 4WXWA 2QFJA 2VFUA 1S6PA 4MYTA 3DOMB 2J9DE 2MLZA 3M8ZA 4FP9A 2AJ1A 3UE2A 2PE8A 1V5VA 4ED7A 4DR4J 1D8ZA 2D74B 3R2DJ 4K5RA 2B4PA 4NLRA 5L1IA 2GMLA 1LXNA 4XDDA 1VQSA 3DXBA 3PR5B 2VU5A 1QM9A 4NCBA 1SH2A 1SH0A 1RABB 4ZCMA 5DG8A 4CH1A 1NHVA 3VHQA 3MGJA 3HKWA 1TAUA 1DBDA 3ZTSA 3NBPB 1HQEB 3IMQJ 4GC7A 4WE1B 4K2JA 5IT9Y 2BJEA 4K7QA 3M2RB 2DK2A 3CCWA 2NXNA 2JEIA 1N56A 2QV6A 2F65A 2UUWA 4KQZA 4JI7J 2H1YA 4WF9Q 4G6VB 1UETA 3HJFA 1S7HA 3W61A 1HNWF 3QO9A 3SV3A 4RUBA 2BKOA 2K1RA 3RUBL 2RU9A 4LSNA 2IRUA 2KYZA 2DNOA 1SC6A 4OYOA 3BPDA 4FXVA 4TLQA 4K0KF 3IWNC 2WONB 4Z7CA 1T03B 2HYIB 1PJ7A 2CPXA 4ECWA 1U1QA 3PFOA 1JJ4A 5KFKA 5B7WA 2X1GA 4BLGA 4B08A 1AT1B 1U1RA 4C8OA 3W5YA 4B9UA 3NS7B 2HHHF 4Q43A 2WVBA 3I32A 1PILA 1KVIA 3M6UA 1X9MA 1A0OB 3DYAB 3TARA 5KFGA 4RNNA 1BE4A 4KGXB 3EICA 5DG7A 2DNGA 1U4BA 3V6KA 2F7VA 3C3LA 4ZIWA 2MTLA 4IG0B 4ED0A 2KH9A 5JXSA 2HHVA 5F3ZA 1CC7A 1U1PA 1CJUA 2ZJRQ 4OLPA 3MPVA 3CEDA 2EC2A 2HVZA 2JH3A 2BW2A 4FYXB 2JC0A 3FSYA 3ZZPA 1IR1A 4QCLA 4M63A 1Y5IB 4L6V3 1AFIA 1JX4A 4P7TA 1OYEA 4J9PA 3MM6B 3G6ES 4M5HA 2GIFA 1RAFB 4O3QA 1NSPA 3QPIA 3B54A 4TY8A 3QBCA 3MURP 3DI6B 2LDIA 3BZQA 2PMWA 2RDJA 1FJ7A 3W9JA 2ZM6J 5ETLA 2UVRA 1UPMB 2VC0A 1B0VA 5T7LB 3L09A 1ZPWX 4ZN1A 1JLCA 1FDBA 3NS5A 4IDKA 4O44A 2DNLA 5H9EJ 1EP4A 2UVWA 2MDAA 5HN0A 4ZS6A 2DJWA 4L74A 4LF7J 3DMJB 4P6QA 4B9VA 2UXDJ 4GO7X 3W63A 3QWPA 2I38A 3B4DA 4K5SA 1WEYA 2YPZA 1RTHA 2BJ7A 3LPYA 5KFZA 4JYAJ 1WF0A 3QT7A 1TVRB 4WU3A 1LWFA 4GKKF 1NH8A 3TR5A 1B4SA 3J7AN 4ZPWR 1B7FA 1WDDA 1IBCB 5KFMA 3KNGA 3BQ0A 1RWPB 3I4HX 4K2XA 3OUYA 1IKVB 2CAJA 3DRYA 3M8PA 1RAHB 3TZXA 1GMVA 5F0WA 2DCUB 1FFSB 4JI3J 1DLOA 3KJNB 4OV1A 1NB2A 1VFJA 2DRAA 3PTWA 3PX4A 2H4YB 5E41A 1P1LA 1J5OB 4U7UD 4P9SA 3DDIA 3RAXA 1NK8A 1VRUB 5E3RA 5KFDA 3F56A 1L3SA 4BC7A 1RTDB 2IRXA 4DUYJ 4IOBA 2CJYB 1PYSB 2QYCA 3VVTA 5ETTA 2XNQA 5IM0A 1YJ9S 6FDRA 1UJ4A 4FS2A 1VBKA 4TU8A 2KO1A 4NXMJ 4J9RA 3ZZ0A 3E8OA 3DHXA 2JEFA 3QIPB 5A8RB 1SJQA 2XSJB 3WC2A 1MWZA 4UOFA 5A0YA 3LP1A 2FVSA 2XC9A 2Z2MA 4NASA 4QWCA 4ZKAA 4OHXA 3JSYA 2FZGB 4FXWA 4DG1A 1C4CA 4OI4A 3MHYA 4AUKA 1T05B 3BH6B 1FJGF 2NXCA 1NRKA 1HHTP 3LWLA 1REVA 4K4UA 3EGNA 2MLXA 4N41A 2GQ2A 3AD7C 5L9NA 1NDPA 3JS9A 2MKJA 2IM2A 3HZEA 1DQ8A 2Y8YA 5HVFA 4DL7A 2VFVA 1HR0F 4PQUB 4X65F 2I0XA 2DGSA 4WBFA 2JVRA 3QLHA 1RT2B 2HURA 2CZ9A 2X51A 2UZAA 4X84A 3T5HA 5IZHA 3RYLA 3WIVA 1KQKA 1YK9A 4EI2A 3BYPA 1NPPA 4ELTA 2ZBQA 4K59A 3BPSP 1RTJA 5I42B 5HROA 1MROB 5CZVA 3W2WB 4TLRA 1H6KX 2D9PA 2HWHA 2HRYA 4LFCJ 4UOCA 4EGLA 1WHWA 3BQ1A 4HLBA 2GIRA 1GMWD 4G3IA 1FKPA 2AYMA 1AUSL 2RF2A 4ZVEA 1C1CB 2XMTA 3BBBA 4LIRA 3NGKA 1WKJA 1VBYA 1HQUB 4EWTA 3GJQB 3M30A 1U24A 4KBIA 4LVOP 4JI2J 1TL7B 5FLXY 1MLAA 2YX1A 2UV8A 2VG6A 1Y7PA 2NLWA 2BOPA 1QE1B 3RB6A 4KR0B 3FSIA 5C42A 2OI2A 4R0JA 1HFEL 2HIQA 3RBXA 1IKWA 5K8NA 1WD6A 3KJFB 2A18A 1IBLF 3ZNUA 2IJFA 2BRLA 3K5MA 3SQOP 2XBPA 5AXLA 4GO5X 2YQ0A 4KB7A 4O4RA 4MK9A 5F8MA 2MHNA 2RKIB 2R7QA 5KT2A 2JL9A 3QIDA 2H3EB 5KFIA 1HD0A 5KTQA 4PUOB 5C5JA 4ZVUB 2HK2A 4R5PA 1NAQA 2BJDA 4F3QA 1KNZA 1FRLA 1X4BA 3TAQA 4N5SA 3GR1A 1D1UA 2VJUA 4ZVOB 3QJJA 2AW0A 2WSEC 2AYGA 4K4ZA 1S1UB 3KHRA 3ENVA 2KM8B 4PCQA 4DF8A 2W8LA 3JAMY 3H2VE 1T9VA 1SPBP 1C1BB 3CCMS 5KFFA 2MGZA 2KT2A 1F0XA 5DDQC 2HHXA 3GMGA 3BSAA 1VRTB 2NYHA 2RRBA 5DQIA 1VQKS 4FF2A 1ZTWA 2CDQA 4YR3A 4JI5F 4BDPA 2BM1A 4QU6A 5K5MA 2GVDB 3MR6A 2K7KA 2J0QD 2V69A 1Q86T 3BREA 2KXNB 1C0TB 4K4YA 3MUVP 2BOAA 1H7XA 2VODA 1JIHA 3UFCX 2CPFA 4OYAA 1QTMA 2J7WA 2R2SA 2KG0A 2W9CB 1Z1ZA 3PO4A 1JLGB 2PEBA 4OYZA 1YKWA 4DSJA 3KK1B 4WFYA 1HNWJ 1UW4A 1C4AA 3R3TA 5HJYA 3VGSA 3TAPA 2DYAA 3C2PA 2Z57B 4WP3A 5J1NA 5C25A 2L9NA 2W9AA 2HG4A 4LRBA 4JBCA 4Q5VA 4C2MA 4WXOA 5D4LA 1VYAA 4DZ6A 3HM9A 2AJ4A 4ZK7M 2OGUA 1KTQA 3PKMA 1FJCA 1E6YB 4EEYA 1FX2A 2WK4A 2HHHJ 4HTIA 2DNYA 4HDHA 3AT1B 5F41A 2HNDB 5HSPA 4ED8A 1EAYC 4ZLNA 3CCSS 1N0VC 4ZN3A 5EHHA 3W2VB 1HWJA 3BR9A 4HHHA 3UDCA 3U1LA 3MMCA 2KT5A 2C2OB 4I64A 3JYTB 3CSKA 3GIRA 1NK6A 5DM7Q 1IR0A 2UV8G 2Z2YB 3ISZA 4JI6F 4ID8A 1Y10A 1BQMA 4TQSA 3ZTPA 4RPFA 1HPZA 3ZXWA 3O1LA 5IWAF 3PYFA 4JV0A 2R42A 4DSEA 5B09A 2RNEA 1R0AA 1KKHA 1VC5A 2QL5B 1IVZA 1W2BR 4DV1F 4G1IA 1TU0B 1YLXA 4KT0C 5HP1B 2VB6A 5LXYA 1O5JA 3FJ2A 3D1QA 1FFWB 3FQKA 5CYQA 2WVDA 4MH8A 4UY8T 1RISA 4LF1A 4GVBA 2W7OA 3G6VA 1NK7A 1R7IA 2I2YA 4WFNQ 3NWRA 4IRCA 1RHKB 2IAJB 2W24A 2VPWB 2ZVIA 2BRKA 3Q8SB 2RUSA 1VQ4S 3DNCA 5BYQA 5LL6d 1FRXA 1RWOB 5D3GA 2WSCC 1LWCB 4L72B 3W62A 2VPZB 2XS7A 4DSFA 4LFAF 1IKXB 1O51A 4QZVB 2FHJA 1S48A 4GKKJ 3MFHA 1X5OA 1LW2A 3CNQP 2BANB 3KMSA 1N5VA 5KFPA 1H3DA 3X1LB 4FZVA 4DPUA 3I6PA 3C15A 3M32B 3QFWA 1D3WA 2E1RA 4I68A 3HSDA 3CIMA 3E3XA 1CC8A 1S9EB 4DR7J 1TKTB 4OZ2A 4DL4A 1WHYA 1X5SA 4NCGA 5HQMA 2CWXA 3QGHA 3HLUA 1U26A 2VA2A 2B6AB 1SXLA 1YWXA 4F0KA 1S6PB 1WC6A 4ED1A 1NK0A 1WSVA 3FUYA 4DV3F 1IR2A 3IR5B 5CH7B 2ZD1A 1UVLA 5F9LA 2ZZMA 2B4UA 3GPAA 2ACYA 4BHQA 1IBMF 2OJ3A 4M1KA 2H5IB 5E3QA 2CG8A 2M8HA 2EBEA 4OJ3A 1R31A 3I87A 5E3AA 3C16A 1JLAB 3OXLA 1X0PA 4MIWA 3W60A 2W1BA 1FJGJ 4MKVA 5KG6A 3R97A 3NOCA 1KS2A 2MJNA 1TKZA 4PABA 5KFYA 1HNIA 3BBCA 3N6LA 1WG5A 1VOMA 1AFJA 3DM2A 1HR0J 2NR0A 4X65J 3UD4P 3IBWA 3QO9B 2C2KB 1NDLA 4NLPA 4LSNB 3QYYA 4NRTA 3PG9A 2CNNB 2QLXA 4M5KA 5MLCV 1RTIA 1RYRA 3W64A 2D7SA 3WC0A 4ID5A 5J1EB 3RW6A 3H8YA 2HRTA 5LXRA 4F0MA 4CLZA 3FCVA 1T3NA 1UAWA 2AF6A 2F3JA 3GV5B 4ECYA 3ZC4A 5IQQA 4FPIA 2B51A 1UMJA 4ED5A 1RT3B 2J76E 3DRXA 4P71A 1J5EF 4IFYB 2FVPA 4R25A 1M90T 5B0GA 3IBCB 3LOUA 4CP5A 3GG0A 2X3DA 4C3MA 3TUZC 2PI5A 3HK2A 3NCQA 1VQLS 1K8AT 5ETVA 1URRA 2HVEA 3QGGA 1QTNB 2D3O1 4WTOB 3OLAA 2P9GA 2F4FA 2CDRB 2ZBPA 3EX7B 3QJPA 2LVWA 3BN4A 4ERDA 2PD1A 2YKMA 5B08A 2EEYA 4K4WA 1Q95G 5DZ7A 3K5NA 2ZHAA 5DZ6A 5F9NA 3A3OB 4HDGA 2DT9A 2AEFA 1IBLJ 3UDVA 3IGNA 3RRHA 1OWXA 4IH5A 1GTEA 3U02A 2V8PA 4YS2A 4FF4A 4AL7A 2JVOA 1Z2ZA 2HHPA 4RBUA 1CG2A 1TL3A 2CJAA 4LFBF 4ES3A 3NGTA 5D8HB 1LNQA 1JLCB 4F2RA 3ADAC 4IDKB 4O44B 2ZJPQ 3IS9A 2XWXA 1JNRB 2E9TA 3I56S 4ANEA 3NMRA 1N52B 4TN2A 4IH7A 2FGOA 4I6AA 3CXCR 4CLYA 3UVJA 5DRKA 1RTHB 1HBOB 4A8WA 3BBFA 1ACMB 2ZH9A 2G4BA 2HIYA 4A8OA 3I96A 1ZM3A 1LWFB 4LF5F 2X3GA 3AOCA 3PHTA 5LSLA 3LTOA 4WFZA 4IYQA 5B0DA 2MPUA 3DOKB 1UEUA 1P9YA 3JXOA 4NL5A 1HYSB 4LF9F 1CS4A 3RJMB 2Z2ZA 3M8PB 2JZ5A 2OD6A 4JI5J 4B3TF 3PIPQ 1DLOB 2JOQA 2GO9A 5HMWA 1SJ4P 4A8XA 4NYPA 3GJRB 3THPA 4ZPTR 2ZE2A 2AEJA 1V6HA 2IBOA 3D1HA 3DU6A 3QT6A 1N5QA 5B0CA 1ULRA 5ETNA 1YQHA 4DV0F 1QAIA 2ROGA 3KG4A 3CD5A 4ZLLA 4NA1A 1MW7A 5IM0B 3AA8A 4I6WA 2NPFA 2AGQA 1T9WA 1Q8LA 3VVUA 2I9SA 1U0SA 2IPOB 3PJWA 4H54A 3VWSA 1YJVA 3G6YA 5A0YB 3LP1B 1V3SA 4OZ5A 1VQ8S 1Q4RA 3KLEA 3A3PB 2H65B 2FVRA 3I5BA 4DV7F 2MYFA 4DG1B 1JK9B 5CCLA 3GV8B 1T9YA 2HHQA 1LFWA 5KFWA 5D4NA 1CSJA 2PN6A 1REVB 2MMYA 2KT3A 5KG2A 5E5NA 3H59A 2VQEF 3EZUA 1FXDA 2ACMA 2PFDA 3D2WA 3QLHB 4KO0A 1HNZJ 2Q6CA 2OPPA 2ZNYA 1D9DA 1H2UX 4QIGA 3ISND 1HI8A 4ZITA 3HPOA 4TNOA 2P9EA 1VMBA 3FBBA 3TQ1A 1U7LA 2LQ8A 4JI6J 2LU1A 1RTJB 5HROB 5LSOA 4B9NA 3CULA 3A3NB 3UPFA 4AFFA 5LMNF 2X7IA 5CD4H 1RWKB 4ZPBA 5IWAJ 4X66F 3TJ8A 3A8EA 4IOCQ 3FSXA 3OTEA 4F36A 4M5GA 5HLFA 2J7UA 1XJWB 2XLIA 3M8QA 2HVIA 1FKPB 4DV1J 1Y11A 2RF2B 3C6UA 1SH3A 4Q8EA 4JV2A 2JLFA 1SC1B 2L41A 3OVBA 4PWWA 1EQMA 4F25A 3CB4A 3GYGA 4ALZA 2VFTA 4NLTA 3BYRA 3KOAA 1F60B 3DC2A 3OTBA 4U8YA 2AU0A 5D77A 1UCNA 1SL2A 2PO4A 3MEDA 1T8EA 4DPYA 2HBZB 2VG6B 1TKDA 1NXIA 3OFHA 1S4EA 2DNKA 2DKOB 1TV6A 5C42B 2EK6A 3G8QA 4LFAJ 1G4CA 1RLDA 3OBIA 4IOAQ 2RIJA 2HK3A 1FRJA 3UNYA 2HWTA 3SSSA 5I4MA 2UUAF 2E9ZA 3VAHA 1RWXB 2FGCA 2IVMA 1OSDA 2FHMA 2M8DB 3AD9C 1N5YA 1WOSA 1G7CB 2EFVA 3FMWA 2FZCB 2RHSB 3DRRB 3IR6B 4CWBA 2QTWA 1KFSA 3T6BA 4R5PB 1KLMA 1Q8IA 1WEZA 3E01A 4URGA 2FQQB 4Q0BA 2Z0GA 1WSRA 2Y9HA 4KFBB 4RW8A 5HMXA 4DX8H 4WFBQ 2HFVA 2C3YA 3F44A 1RSCA 4OX8A 4BBYA 3FQLA 5HMZA 3KG1A 1IBMJ 2MGZB 3EZ5A 1TFWA 2OAUA 4DSLA 4TYBA 3OR1A 3HZGA 3KUEA 1RBOB 4PEOA 5KG7A 1G2EA 1Q78A 3UO0A 3KJQB 2UP1A 3F0NA 3T1HF 4I7FA 1NJWA 3SSQA 3VV2B 2XS5A 4EYHB 2PDAA 4RU9A 1QSYA 2F8MA 4DXLA 3DOLA 1TL1A 2BABA 2CQPA 3EVOA 2G0JA 4ILLA 2IBKA 1Y9OA 4PZVA 2LA4A 3R2CJ 4U8VA 3MM5A 4XK8C 4OJHA 3HULA 3WQPA 2J6UA 1EX8A 4DCJB 3E2EA 3KJVA 1UVKA 5T14A 3CDBA 3ET6A 1B0TA 2IA0A 2ZC3A 4LF4F 2BQUA 3OTCA 3BR8A 4J37A 1CJTA 3UN2A 1HNXF 3M1VA 5HO4A 3J7YU 5C25B 1YJRA 4XIUA 3DN9A 1BUXA 2LKZA 3VGVA 3FKBA 3KNAA 2QSWA 4PXDA 1S0OA 5IT9U 1KBRA 3IG1B 2YWEA 3JTPA 3OR2A 1IM6A 2WAQD 2U2FA 2DNRA 1DRZA 3PHEA 1ZTTA 1DJ0A 4CQ1A 5L1JA 3T5KA 3GYNA 2RB7A 3D54A 1J5EJ 3M6VA 1JXVA 3TRGA 3RR8A 1UVMA 1U49A 3H2UB 4O3PA 3MMCB 1TMJA 2ZH8A 2DGQA 3RG6A 4E2FB 2I5JA 2OPRA 4X62F 4CLUA 2FJAB 5IXUA 2BX6A 5AE1A 4B3RF 2BKPA 2LXUA 2X1BA 1HPZB 4TXSA 2NSCA 3DFEA 2EWHA 3DLGA 3NNCA 3Q83A 1SKRA 1CJKA 2PA3A 2N3LA 2W2MP 2O66A 4U7UK 1TAQA 3W7BA 1RUSA 4LREA 4KRWA 3EUNA 1YGYA 2AHOB 3V6JA 3NOGA 2RAQA 4PAAA 5CYQB 2AP6A 4X4UA 4U67Q 3GJSB 2W4DA 2HHTA 3GIIA 1YJNS 2DGVA 3CWJA 3PJXA 1LK5A 2VOPA 3BS9A 1S99A 4NXNF 2N82B 4LFBJ 1Q8KA 2HMIA 2J6SA 1GMWA 5D3GB 2ZH3A 1D0EA 3FCWA 1YIJS 2RU3A 5HATA 2MLYA 2NPIA 3BSCA 4ANDA 3TANA 2Z4PA 2JJ4D 1YDLA 4LF5J 3CJ8A 4IQXA 2W2NP 1LW2B 5E3PA 1X7VA 2QO3A 1M1HA 3IM9A 4LF9J 3C15B 3ZZRA 2C1EB 4OI0A 3CW2C 2ROEA 3KHLA 1RZMA 2CJXB 4U6PA 1FI4A 7FD1A 1XBWA 4NCGB 4RUAA 3D28A 1X4AA 1DHMA 2FY8A 1BHNA 2JDJA 2KVQE 2JNJA 5EGYA 1UVNA 3PR4A 2F5GA 1ZZFA 1RHMB 3R5DA 3CCUS 3HHEA 2ZD1B 2BV3A 4RNOA 3MCOA 3ILLA 1UZDA 2QG9B 2CVIA 2CJ9A 1HWLA 4YR0A 1NM2A 4XDCA 2K3IA 1SKWA 4PPDA 3MECB 1ICEB 1E6VA 4H4KC 5HI7A 1SV5B 3C16B 5F8LA 4DMZA 1JLFA 4DLEA 1KQFB 4DV7J 5GAEU 3BGOP 4FKXA 4EZ6A 1IKYA 4NWBA 3RBEA 1PYOB 1NU4A 3PYEA 2RILA 3J7A1 2FYXA 1XK8A 4ZVGA 4ZLJA 1HNIB 4MK8A 3DM2B 1B99A 1VLYA 2VQEJ 1RAGB 3CCRS 2EFPA 4RZRA 3US5A 2R8HA 1K47A 2XMMA 4QW9A 4F02A 1C2PA 1X8DA 4RLEA 3IAS9 2W9BB 4NA3A 4YB1P 4A8KA 2GFFA 1RTIB 2LFVA 2XY5A 2LCWA 4ID5B 4ETZA 3BB5A 4ED2A 3RTVA 2O01C 2KRRA 5LMNJ 4HR2A 5IT4A 2W4PA 4X66J 3OFGA 4LRFA 4DL3A 3VAKA 9RUBA 1U8SA 2WBMA 2M70A 4YUDA 1WORA 3MR2A 4D3HA 4FVMA 2MSSA 2PA8D 2VF3A 1TQLA 4J9VA 2R8JA 5GVQA 4CH0S 2R2RA 4N77A 2ASYA 4UOGA 3BEGB 2B56A 5AJ3F 2LEAA 4ES2A 1WC1A 2CQ2A 1EKRA 4YFUA 4B3SF 5M2PA 3LH2S 2QLWA 3HHLB 4C3KA 1GEHA 2CQBA 3HSGA 9ATCB 3IM8A 3Q22A 1RT5A 3IR7B 3FBFA 2IFXA 4CO5A 4Y34A 3W1YC 2FJEB 3RB4A 1VBZA 4USWA 3CJQA 4G65A 2XHWA 2BE9B 1KHVA 1IN0A 1AROP 4DR6F 3OFEA 4NI2B 1H72C 1QJHA 2R7XA 2ZEJA 4LR7A 1QSSA 3SCLE 2UUAJ 4B9MA 2AYEA 3ENAA 5FLXU 4A46A 2GJFA 1N32F 2H9ZA 4DR4F 1UA0A 1VQ7S 1N34F 2KFYA 2MJUA 3J81Y 1SCJB 4IG3A 1OYDA 3AA9A 3DGPA 2E1AA 1KVJA 3IS9B 1JJ2R 2MZRA 5JJBA 3B6BA 5KFSA 1HKAA 3EDQB 2WVCA 1F5CA 3T19A 3TA1A 4A8QA 3NGSA 3BDEA 3TAMA 2O3DA 2NREA 1CVJA 3K5LA 2XHCA 1HMVA 2R7OA 3UVJB 2JHEA 4NX9A 2DO4A 4WK3A 4W92B 2LEBA 2GJIA 3GCXP 3QRRA 2HW3A 3IRWP 4PR6A 5JMNA 3MM7A 2GV1A 4P52A 4NCAA 4OI3A 2MKYA 4S0MA 1WF1A 1XNQF 1CS4B 5LM7E 1JWWA 5K8MA 2KDOA 1U0HB 5BR8F 3BM7A 3M2VA 2YWGA 3T1HJ 2FDNA 3IA0A 3S8SA 2KJVA 2C2NA 4LUBA 2ZE2B 1APSA 5A2QU 1S57A 2RQMA 1H38A 3JAMU 2ZHOA 2WSFC 2RH3A 3M8SA 3UD5A 1N5SA 2YQ1A 4KAIA 2V2ZA 1AUDA 1Q8BA 2KKHA 1ZAVA 2G1DA 3MAAA 1S6OA 1RADB 2RD5C 1NDCA 4J9LA 2QC3A 1VHIA 4Y2IA 3M9MB 5CXTA 4LF4J 1F3VA 3MAHA 3M05A 1XR5A 3BKUA 3PFEA 4FBUA 1HNXJ 1ELOA 4EMDA 3SQGA 5M2RA 2HNYA 1S6UA 4LQ3A 1MN9A 2CXEA 4ZVPB 4WJBA 1X4FA 3W9IA 3TYTA 2E29A 3MUMP 1JJCB 4DPWA 4X2BA 2LECA 1Q7YT 2R7SA 1NJYA 4EBDA 5ITHA 4MKAA 2B9XA 2ZWOA 1M1KT 2VIHA 4ED6A 4FS1A 1FK9A 2XZDB 2EFQA 4KO0B 3PW2A 4C8KA 3FEYB 4K50A 5I3UB 2EFNA 2V9WA 4C0HA 1V3RA 1U1NA 2LP4A 1HI0P 2W4CA 2FIUA 1UP1A 4X62J 2JFDA 3R6GB 3D0GE 4HACA 5IOLA 5E3CA 4A8SA 2ALZA 3K2YA 3PRBA 3QWUA 4B3RJ 2IVFB 4QYZK 2UU9F 1K0VA 4CIOA 3NS6A 3U27A 4PPZA 3L7UA 3M8QB 5EWEA 3C6UB 2XI3A 2ZUGA 1U1MA 2SXLA 4KHPF 2A6OA 3JQMA 3NNAA 2AKWB 1GT8A 1JLEA 2P6TA 5ETKA 1ZOTA 4UQTA 2XMWA 1RQ0A 2VDIA 2ZKUA 2V4JA 4NXNJ 1YRXA 3MEDB 1H7WA 2B7BB 3OV7A 4ZVTB 5B0AA 1X4GA 4CT9A 1DTTA 2PT0A 4GKJF 2KB2A 3RZAA 3G4SS 1TV6B 2E5LF 3CCES 3C8YA 2YXLA 5BYSA 5ETPA 5IV4A 3CCZA 4Y2AA 3P5BP 2YWFA 5F8HA 1G1XA 2A6MA 4RBVA 2KL8A 1UFLA 1YBTA 3FBCA 3GIKA 2AEMA 4Q44A 3M9NB 1D9FA 2J0XA 3VCDA 3GIMA 4LVNP 1X31C 3DXSX 2P9CA 4FF3A 4KJIA 2Y0SD 1VQNS 2XULA 4HVZA 4PXBA 4WTYA 1KLMB 3IP0A 3E01B 1D8YA 2XO6A 3CD6S 2M88A 3U7JA 5DS7A 3SV4A 4Q0BB 3OVSA 2ALYB 1RK8A 3FFIA 4RW8B 4BCAA 3HT0A 2MB0B 2C3UA 4DR1F 2K2PA 5HK4A 3J7ZT 3VTIA 3FZBA 2RSQA 2P5VA 3EGWB 1S0VA 2OTLS 2XMKA 3OR1B 3CJSA 2KVIA 4ZPAA 1RP5A 2VFSA 3PW4A 4JV5J 1GAOA 1FE0A 4I7FB 2N7CA 4IQMA 5HBMA 4F0HA 4UT4A 1TL1B 4ZP9A 2A2DA 1Y4ZB 2HBQB 3RB3A 1XMBA 3MM5B 1W25A 2B7CB 2YX4A 3MPDA 2CZ4A 4FNIA 3MDFA 4DPTA 2EW9A 1F2HA 1SKUB 1FXLA 2RQCA 3ITHA 4NMXA 3ET6B 5H9EK 2BDPA 3OW2R 2CYYA 3A8JA 4QR0A 1L5UA 4YDXA 2VG5B 3H42A 3R1HA 1RYSA 1CJTB 3M1VB 1MMNA 3HT3A 2YKPA 2MQMA 4YY3F 4KH0B 1FVQA 2RS2A 1BC6A 2EI5A 2WOMA 3G96A 5KOWA 3K59A 4KKOA 2L9WA 2PFFB 2HS3A 1S1WA 3IWLA 4ICLA 5I3QA 5KFLA 3V2UC 1GNKA 3NRBA 4P73A 2KFNA 3ILIA 2KG1A 1PC4A 2F1FA 2VG7A 1WWHA 1SQFA 3CPWR 1EETA 2AT1B 3U1NA 1VC6A 2DIVA 3IBFB 3KG0A 4B3SJ 2HWIA 3NXZA 2LMIA 1HQ2A 4NEZA 3Q2SC 1NK4A 2G13A 2JX2A 2DTJA 2GA7A 1S9FA 2C3OA 4ZPDA 3W9HA 2HKEA 3DLGB 1JQGA 1CJKB 1OJ4A 3ILOA 4YEAA 2VQFF 4FDFA 1OMSA 4DR6J 1J27A 3VGTA 3LAKA 1RAIB 2HVHA 3VAJA 4QPXA 2WZ1A 2HAIA 2GHWA 3N5BA 4PG8A 1EZZB 3JSMA 1N32J 4IFVA 5CD4A 3CF5Q 1N34J 4CRJA 3I5AA 4USIA 5K9FA 3K57A 2UVUA 1AXQA 2AWZA 3V4IA 2HMIB 1R3NA 1DY3A 2M7SA 2DXFA 4MTPA 1HHSA 4Y2CA 3MMAB 1YJUA 3BSNA 3DLLQ 2CQGA 1GXLA 3FC9A 3MAQA 2LQ9A 2D3OR 5MAOA 2OLWA 4ER8A 4WP8A 4DFKA 2J5AA 5IFMA 5BXIA 2OHDA 4CO4A 1GH8A 1FNMA 1EIYB 4B17A 4UY85 3KLFA 2HS0A 3DLKA 5KG5A 4DU8A 4TVAB 1XNQJ 3QT8A 4U96A 2J8SA 5BR8J 1FD8A 3M2UB 2BJ1A 4F2SA 2VD3A 3BKTA 4DQRA 2H54B 3D7SB 4CO3A 5K20B 3KUHA 3C14A 1RBAA 2I8EA 2V4RA 2H5EA 1EHWA 4NLWA 1TL4A 5L38A 1S1TB 2CJQA 5LT5A 1PJ5A 3S7RA 3JB9k 2AIRB 4I6YA 5HL7Q 3JTOA 2DGUA 2GAGC 2V2KA 1P6TA 3DOMA 3D3BJ 1T3OA 2DHAA 4NLDA 1R8AA 2EPIA 2AQ4A 2IMOA 3ZZUA 4URSA 2LXIA 2OEJA 1T9UA 3EGVA 3QATA 1E6VB 3AFGA 3P5TL 1T94A 2GHPA 2ZNZA 1JLFB 3H7HB 4JI4J 3MMBA 1RWWB 1NSKL 2CNLB 2F63A 5EWGA 3QRQA 4G1QA 4DHVA 5GAEI 2W25A 3DRPA 5KG0A 4J9QA 1T11A 1IKYB 2Y1RI 3RRGA 2ADBA 4CT8A 2CADA 2Y1IA 2LA6A 2WVFA 3BGUA 4WE1A 1KSPA 3G6XA 1Q5YA 4WZQA 3H4DA 1SUQB 4CTAA 3FRZA 2XTJP 1MMDA 3QGPA 1VK3A 5E7OB 1FDNA 5A8WA 2VBWA 4OYWA 2WW8A 4KYZA 2OEMA 1VR6A 5C24A 2YTCA 3PCOB 2UUTA 3R8YA 1VK8A 3MXHP 4B9LA 4RUCA 4PXEA 1RTZA 4CM0A 2OD4A 1RKJA 1XN9A 5B0BA 3SBMA 3ELHA 2IM3A 4ECUA 4QIEA 2UU9J 3OD2A 2D3UA 1FT8A 1KR4A 2C2EA 3RBZA 3G86A 3D0IE 1MWYA 5IV3A 1FESA 4JOUA 2B9YA 2Q43A 3T41A 1S1XA 1S10A 4USTA 1Y5LB 4DJBA 1KTVA 4KHPJ 4DX6A 1YSJA 1O6XA 3DYAA 5CYMA 3H5YA 5J2QB 2MHEA 4M5DA 3R5AA 1HBUA 4QOTA 2R7TA 4J91A 2R8GA 4ENOA 3PRVA 4DI6A 4C0BA 4DBQA 3R5GA 4A8MP 1HA1A 4KGKA 1WDTA 2L08A 1U09A 2R2TA 2UUBF 4X4PA 2HZAA 3W8PA 3AHPA 3J80Y 3SFUA 4F67A 3CO9A 4GKJJ 1RT5B 4P10A 2IMWP 5LSRA 3Q8YA 3CTRA 2E5LJ 4DR7F 1FDDA 2L48A 3P8BB 2CFXA 2HQGA 2CPIA 3FK4A 1DURA 5GADU 3NEKA 4K8RA 2E7XA 5LMUF 2HRUA 2VUGA 3TO8A 3DI6A 2VKZG 2NZ4A 1WHXA 3BQ2A 1BQNA 1LW0A 1WOPA 5EX3A 2FPHX 2PEHA 1DQAA 2CJBA 3ETOA 4PYDA 2RRNA 4JI8F 2R7VA 3DGPB 4OQJA 2MY8A 3M7VA 2OEKA 1YTYA 2CVEA 3KTQA 5KG3A 2RQ4A 1ZH5A 2IYGA 4I2QB 4P74A 2YX7A 2DNPA 4DOZA 3TAMB 4Q2MA 1KP6A 4ZCLA 3CJKA 4JUZA 1FTRA 2HGNA 2YNFA 4KTQA 1F9FA 4ZIVA 5RUBA 3TA2A 1HNVA 4DR1J 2NUUG 3CDEA 2BZ2A 4QW8A 5ETQA 5C7PA 1W2IA 3MM7B 3EJMA 4UF4A 3NMAA 1KOOA 2DNZA 1CQNA 4QIFA 1H73A 2IY5B 4KPYA 3ZTRA 1CQMA 2OIHA 3M2VB 4TU9A 3V6HA 1B7YB 2ZOGA 2XCPA 3ZTQA 4DZDA 1F5AA 4OHWA 4PKDB 4F8RA 3ZNJ1 1IKVA 4EUVA 3TUJC 2GMHA 2ADCA 3P6YC 3LUYA 1N5TA 2VBZA 5AXNA 3CMQA 2HEKA 1UL3A 3HSJA 3O8WA 2YKOA 4QIVA 1R8CA 3MEEB 5D6GA 2NXJA 2MKHA 3G82A 4OZ3A 1I94F 2ZFHA 2BEFA 3MAAB 2KFZA 3CD0A 2WHOA 1ZAWA 2F8HA 2E44A 4DR5F 4ZP7A 2ZH7A 1Q53A 2N7YA 1N4LA 1JMTA 3MZIA 3SQGB 4OYXA 4YY3J 2DY1A 5DG9A 1K73T 2HNYB 1J2VA 3A8IA 1GX5A 2XSJA 2CPHA 3CCTA 3DLBA 4ZVSB 4ECXA 4C8MA 4MYUA 4GMKA 2GW8A 1VS3A 3UWTA 2ASDA 2E1CA 5EX0A 1XMQF 4PRFA 4IRKA 1WACA 4ZDNA 4M5JA 1WC3A 3KK3A 3P49B 2MQNA 5KFQA 2MQ8A 2E66A 4NE9C 3C6TA 2FVQA 4NLSA 1FK9B 5HVHA 3T3FA 2J8AA 3R7NB 3MCNA 4MAKA 5IC6B 1P9QC 4YQWA 2CPZA 1U6ZA 3OQ2A 3D1OA 4KPCA 2IHR1 1RAJA 1FEEA 3RW7A 4DCOB 4EO8A 2EK1A 5GMKa 1S77D 2QMXA 5KT5A 2G0IA 2XMUA 1VQYA 4XPCA 4OJGA 1UKUA 2V8HA 4C98A 1MROA 1SJ1A 2NCKL 4OZ0A 4L76A 1FX4A 3W2WA 2VQFJ 1YJ7A 3LP2A 4HL9A 1R6YA 1F9HA 5FD1A 4RUHA 3IAM9 2V67A 1JLEB 1KD1T 4NLOA 1RAAB 1S1VB 4OL8A 2WW4A 3Q8PB 1T95A 3EM1A 4ES1A 5DDOC 1IXKA 2V4JB 4LSLA 2FUG9 6AT1B 3MPWA 1WKLA 4QWAA 4A4JA 1LWEA 1NUEA 3POTA 1DTTB 2HLUA 4NZ0A 1N8RT 2WB1D 4ECRA 4PG5A 4WIIA 2DGXA 1RA6A 2BA9A 2PSZA 4PXCA 1RJJA 3OLBA 1XMOF 2XQCA 2NXEA 3KHGA 3R7BB 3CCLS 1GTHA 1PSDA 3SI8A 1RAEB 4E8UA 2C22A 4MT1A 3N5FA 3WX8A 2B4OA 4XO0A 3OHBA 3EDRB 3EPIA 2RVJA 4NZ6A 2R3VA 3OTOF 3H25A 2XWYA 1RHQB 2XZWA 2BBEA 3UR3C 2QL7B 4IR1A 2RRAA 1A9NB 3CJRA 3NL0A 1PO6A 4PUOA 3OJUA 1X4DA 1HBNA 3L7PA 4O3SA 2Q79A 1IBKF 4HHJA 3D5MA 3TJ9A 3P45B 1TELA 2LXFA 4DV4J 1BQXA 2N4DA 5GAGI 3DLJA 2KXFA 3CIZA 2VASA 1MWQA 1H74A 2B4VA 1FRIA 1IUJA 4JI0F 2A3JA 1FCAA 4FF1A 1LK7A 1DQ9A 4KC5A 5K14A 4CLWA 1CEZA 2R7UA 3PEHA 1ZM4A 1FKOA 2YNIA 4UW2A 4PG6A 1HNZF 3NP5A 1A6LA 3AOAA 2XMAA 2E5IA 5HBMB 2HVDA 4N8OA 1ZM2A 1OSCA 3NCPA 3MOJB 3ENWA 1H2VZ 1FVSA 3QFHA 1KEKA 4MKYA 1YBAA 2WBRA 4EYIB 3KFWX 2VOOA 1AA1B 5H1SV 3G87A 2ZKTA 4JV1A 2V9KA 3BKFA 1C0TA 3PEJA 1ZA2B 4XTTA 1HWUA 4C11B 5KFTA 1AW0A 2CWKA 3D0HE 4I0WA 3KK1A 2LYVA 2DNQA 1T0TV 4EZ9A 2HQIA 5KFJA 2ROPA 5GAHU 2JEJA 4HKQA 2VA3A 2WOMB 3BGRB 1NHUA 4J9UE 1SI9A 4WYWA 4CO2A 2VV5A 4WU2A 2AV5A 4KKOB 3VGUA 4J5OA 4JP8A 1S1WB 5FIIA 2Y1LB 4ICLB 5AXMA 4F3MA 1S7IA 1NMEB 2L3MA 1BGXT 5A76A 4DQSA 1YHQS 4NZ7A 5H9FJ 2QGFB 2VG7B 1Z4UA 1I3OB 3RR7A 1BXNA 2R4FA 4TYAA 1EETB 2KRBA 3T1AA 2VFRA 7AT1B 1QAJA 4RNFA 2EC0A 2UUBJ 2I1RA 1NH7A 3OL8A 1ZZNA 3VF0B 4OI1A 4O4GA 1V5IB 3N6MA 2YVSA 2F9JA 2GAHC 4CDIA 4ELVA 2ATLA 1DTQA 2XY6A 4H4OB 3EMTA 3NCRA 3PZPA 4I2PB 5D0HA 4OX6A 1I5OB 4V19J 4DUZF 1K0TA 2BW7A 1TP7A 2NXUA 1GMUA 3QT5A 4F7VA 3FRYA 1UZHA 2CNKB 3HMJG 2KM8C 1Q1KA 5LMUJ 1LOUA 3JSMB 1NPRA 2V50A 2OSRA 3R5JB 4ZJOA 1YG0A 3R7SB 4Y6IA 4PWDA 1S72S 2CKWA 3V6DA 4JI8J 5IC4B 1NKCA 2MKCA 4FBTA 4WWSA 4C9DA 3TEHB 4LRDA 4CO0A 3CT9A 4OZJA 2HNZA 4CNYA 3O3LA 3OFFA 2ZZNA 3S1TA 4DL2A 4Z7YA 2CZVC 2DO0A 1P1TA 1NSQA 1IKXA 2BM0A 3VZIA 3LW5C 4OX7A 4L3KA 2HQ3A 3J81U 3ZTOA 4DV2F 3PM9A 5EWFA 4C48A 3DLEA 1FJEB 3DLKB 1N54B 3TQEA 2BANA 2V68A 4ZVRB 1U02A 3MM8A 1T02A 4O3OA 3PW7A 1IWGA 2K1RB 2YNGA 4M5MA 2LQBA 3SCIE 2FLNA 1P27B 2Z58B 3C14B 4EU0A 3O2IA 2MEWA 1NBEB 3B4MA 2DXDA 1PJ6A 2K8GA 4MIBA 2B6AA 2RE1A 4OYBA 2APOA 1I94J 1FO1A 2COLA 1YI2S 3R9LA 2FJDB 4DR5J 4L73A 4QYZJ 3GJTB 3THTA 5T41A 3BO4A 3ZFVA 1R8HA 3CCVS 3AJDA 1YRUA 8RUCA 4BWMA 3MMBB 2ZH5A 2QJ3A 4G1QB 4D3GA 3HFZB 1CJUB 3DRPB 1JLAA 2ZH4A 3M9OB 4P7VA 1K1QA 3G8SA 1RLCL 3L7OA 1XMQJ 4XAKA 2IA6A 3AXMA 2P8IA 3M6XA 4J9OA 3T6JA 3MR3A 3GG1A 3AY0A 1U2RA 4YB5A 4CTAB 4DPXA 2XMJA 1EQ0A 2XZTB 1R27B 2FC9A 5B0FA 3X3UA 4YOEA 1QAXA 2ZBCA 1FERA 5A8WB 2HZCA 3P96A 3A1YG 4TY8B 1UVJA 5EN1A 4C8LA 3CCJS 3HVAA 3ILJA 5C24B 1JLQA 1IWAA 3VALA 1UFWA 1U1KA 4USMA 2CQ4A 1UFKA 2EVZA 5J1EA 2ZITA 3K5OA 3OL9A 1CULA 5ETOA 2G2YA 1EP4B 1NHKL 1LQ9A 3LGMA 1FWLA 4Q7AA 1S1XB 3M8WA 1QUVA 4RKUC 4CLPA 5IQ6A 2YWKA 1FD2A 1S5ZA 5HQ8A 1RT4A 1RACB 4K4SA 4KHRA 1S49A 5CYMB 3KDNA 1RT3A 3TVZA 4M5DB 1YZ7A 1HBUB 2GZOA 4IFYA 4C8YA 5E0OA 2HGLA 3Q24A 4DF4A 3MR7A 4ANCA 2HFOA 5HQLA 3OUYB 2CQ0A 4QR1A 2GJ2A 3THVA 3AQOA 1FWPA 4RU2A 4DS5A 1WKKA 3T9ZA 1XMOJ 2KU7A 3ISNC 3UN3A 3VQTA 1KHWA 1WELA 1YJTA 3Q89A 5GADI 4AYBD 5ETSA 2V94A 1VGYA 1H0HB 3VAIA 4CI0B 1K1SA 3H5UA 1DARA 4P72A 1BQNB 1LW0B 3KK2A 2J9CA 3DCAA 2CRLA 1KONA 2DH8A 4C8NA 4N8NA 1VBXA 4YHHF 2O1PA 1NO8A 3M4XA 5CA5A 3OTOJ 2HSEB 3OL7A 4G1PA 3MD1A 8AT1B 2E5GA 2GC8A 1RA7A 5LJ5Y 2QX0A 3TVKA 3CJKB 1RU1A 1SL1A 4DQPA 3KKFA 3FNNA 1IBKJ 2HFNA 1SC4B 2YNFB 1S9GA 3HVWA 2GCFA 4K4TA 4A8YA 2VZ9A 1RT7A 2X1FA 1HNVB 3AD8C 1TKXA 3GONA 3SSRA 1HWIA 1HBOA 5KFEA 3CGIA 4DL5A 4WKRA 4JI0J 4NMLA 4I56A 2J9EA 4LSZB 5F3TA 3FMBA 3DOKA 1TFYA 3ZZYA 5CZXA 3A12A 2UUCF 1HYSA 2AZ3A 2CUYA 1S76D 1JKHA 2YQ3A 2Y1JA 4WYLA 4WP9A 3HCXA 3N0VA 3IN5A 3I0SA 3MEKA 4EBEA 5C2GA 1RT1A 3TP2A 1D09B 3OPKA 3TUIC 3LA0A 3FEZA 2DXEA 3G82B 4ZOSA 3K8VA 1RHJB 1MN7A 3H98A 1VC0A 4IO9Q 4ECQA 2ZDOA 2MXYA 2BR0A 3PDNA 1VDHA 3WBZA 5C2CA 3PX6A 3CUNA 3CMAS 2YWHA 2A1BA 4CLLA 5L8RC 3M30B 1WC5A 4OLOA 1YBUA 1R0CB 4DV6F 3WX4A 3AQPA 3FEXB 4AD6A 3KK3B 3O5TB 1VQ6S 2QSFA 3NWGA 2BKNA 3C6TB 1QY7A 3QJLA 3HD1A 1ZAXA 4DSKA 4EK2A 1CBKA 4OMFG 1IKWB 1WNEA 2IYIA 1UA1A 3MUTP 4E98A 5KFBA 3EPGA 1FEHA 4MFBA 1ZETA 4YR2A 5ETRA 1JLBA 2I6WA 4QWDA 2OPSA 4B9TA 3MWBA 5F8IA 1FRMA 2KJWA 1OS5A 2AGOA 4AQYF 3W3SA 3UR0A 2XM3A 4PWUA 1BD6A 4ILRA 2EXUA 4WKYA 4X64F 3PJ9A 4DUZJ 3LP2B 1XEZA 3T5JA 2KN4A 3VAGA 2GQQA 3RBDA 2MKSA 4Y3CA 3EYZA 4Q8FA 2N4CA 1XC9A 1G6BA 4LSLB 4EFAC 2IC3A 3WHIA 1VQPS 1LWEB 2NQPA 3POTB 4OI6A 1PCAA 3HVTA 2W8KA 4OJ1A 4DL6A 1PKUA 2QT7A 4LBIA 2FC8A 5L46A 3ZZZA 3AAWB 1DAXA 4LR9A 2X1AA 2LEPA 3KUGA 2HFUA 2AJ0A 4KE5A 2OFGX 1VQ9S 4HEA9 1U8WA 4DQQA 1U2CA 4DV2J 4TU7A 3OJSA 1KLNA 1LXJA 2UXCF 5F8NA 4B3OA 1QUPA 1ITPA 2D9OA 1VIOA 3M8YA 3K0JA 3MCSA 5J2MA 3CJ2A 3HFKA 4YP3A 4WIQA 2FZKB 2QN6B 4ED3A 4WCEQ 2DR8A 3GIJA 3PXGa 4X4RA 1SJ3P 5IS2A 2BXJA 2R9LA 1HBNB 3DRRA 1UW9A 3S01A 2F8EX 1TUWA 1SIWB 3KLHA 1M1GA 3W5ZA 4QIWD 1QVGR 2YNHA 1X4CA 1MSWD 4KFBA 2PMHA 3GFZA 2UXBF 3EVMA 5A2QY 3I4PA 4N47A 4RW7A 3MTJA 4ILMA 4ZP6A 3QZ7A 1RI7A 4U9RA 1RGVA 2GGPA 1OY9A 1WUUA 1JJHA 3KLGA 2FLLA 5K14B 1VI7A 2NSBA 1FKOB 2YNIB 5A8KA 2GX8A 4NLXA 2CQDA 4C7QA 3CVKA 1RBLA 4R8UA 4H4KA 2Y3YA 1KOHA 5F8JA 2M2BA 2R8KA 2YH0A 3MOZA 1Q82T 5J2PA 1BQMB 2JWNA 2MQOA 2XCAA 3PKYA 2XS2A 2HFSA 2YY3A 3Q8UA 3J7Z5 1OIAA 1HI1A 1NPKA 4CM2A 1R0AB 3KDOA 3KWMA 3QSYB 1WTFA 2ZHBA 2NYIA 4FYDA 3QMQA 1VRQC 3T5LA 2BMBA 3N6NA 3R27A 3D9BA 5GAHI 1Y0HA 4P75A 4CYUA 5AT1B 2B9WA 2BQ3A 4L75A 4OZ1A 1QSLA 4K0KJ 1A7GE 4GVBB 3KHHA 1HBMA 2BYCA 4RX6A 4ZVQB 3IG1A 3LGHA 4F4KA 4RL1A 2B8QA 4HI1A 4IKAA 4HH1A 1BLUA 1GX6A 5J1PA 3TI0A 4QYRA 2ATCB 2DPJA 1F5BA 4DX5A 2BVZA 3WIUA 2B5JA 2NZCA 1M5PC 3P3DA 2DNMA 2QMWA 4MIAA 3NNHA 1DFDA 2W2PP 1KQGB 3I55S 1RWNB 1D9AA 3CDWA 2B0GA 1SKSA 2OMOA 1TZ0A 4OYIA 4USJC 2VPXB 4QR2A 2CNOB 4CH7A 2AX0A 3SZ2A 1QLNA 2FJWA 3QZ8A 3AODA 1Q5VA 3GFYA 4EO6A 3KLIA 2EKNA 5A6PA 4X4NA 4O4GB 4OYPA 1XR6A 1OPIA 4DEZA 2E1MC 1DTQB 2Y0BB 3CMES
chains in the Genus database with same CATH topology
1C0UB 5B0BA 1PGZA 4DV7F 3GFHA 4DN0A 4WK1A 1IQZA 2IM3A 2MYFA 4DG1B 1JK9B 3OVAA 4ECUA 1TK8A 4JI3F 4M8LA 5CCLA 2IM0A 3GV8B 4QIEA 2FJVA 2M9KA 2FY1A 4AXJA 2D3UA 1FT8A 1KR4A 2MZQA 2C2EA 2HHQA 3G86A 1LFWA 3CDAA 3D0IE 1MWYA 2D1CA 5KFWA 3Q8QB 4P2SA 3GQCA 1R8BA 4X4QA 1RT6B 2K7JA 1FESA 2Q6BA 5D4NA 2G9OA 4JOUA 1WG4A 1CSJA 2B9YA 2Q43A 2PN6A 1REVB 3N9UC 1S1XA 2MMYA 2PMZD 4Y0FA 2KT3A 1S10A 3QAEA 1NEEA 5KG2A 1Y5LB 4DJBA 2PC6A 5E5NA 2LLZA 1KTVA 2PIIA 3H59A 1YSJA 3KYLA 3ITHB 2MKIA 3EZUA 2VQEF 1SBRA 1FXDA 3DYAA 3GILA 4DUYF 5CYMA 2HHUA 3D2WA 3H5YA 5J2QB 4PWDB 3HHDA 2MHEA 1S0NA 4M5DA 3QLHB 2CPEA 4KO0A 3C46A 3R5AA 2W9CA 1HBUA 1JLGA 1WEXA 2B3TB 3V6DB 4QOTA 2F40A 2R7TA 3BF4A 2R8GA 2Q6CA 2OPPA 2ZNYA 1D9DA 1H2UX 4C0BA 4DBQA 4QIGA 5DM6Q 2JFKA 4NXMF 3FCHA 3ISND 2PGCA 4A8MP 1HI8A 1X4EA 2DISA 3BO3A 2L9DA 3HPOA 1HA1A 4TNOA 4KGKA 2P9EA 2L08A 5KFOA 1B0PA 1U09A 2R2TA 2UUBF 2HNZB 4HH0A 1M5VC 3Q8RB 1VMBA 4X4PA 3SEOA 1IQTA 2BUNA 3TQ1A 2U1AA 1U7LA 4F50A 3AHPA 4JV5F 3J80Y 3SFUA 2LU1A 4F67A 4ZA1A 3JTNA 1RTJB 3CO9A 2E5HA 4CNZA 5HROB 1MMLA 1RT5B 4BC9A 5LSOA 3PACA 2R2UA 2UVVA 2IMWP 1UJ6A 4B9NA 3CULA 5LSRA 2MKKA 3UPFA 4AFFA 3CTRA 5LMNF 5CD4H 4I67A 1U45A 1H2TZ 4HTJA 4DR7F 1H98A 4ZPBA 1G3OA 4X66F 3A8EA 4IOCQ 1U2FA 4H4MB 1FDDA 3FSXA 3OTEA 2L48A 2CFXA 1E6YA 3HHLD 1CLFA 5HLFA 1N6QA 2J7UA 2P6SA 1R89A 4N76A 4A8FA 1Q7LB 2CPIA 2ILZA 2GQCA 1TKZB 3GFXA 2XLIA 1DURA 3DLEB 3M8QA 5GADU 3NG8A 2HVIA 2AYBA 1FKPB 4LQ9A 3GSDA 2R7RA 2RF2B 2KTQA 4BWJA 3C6UA 4CO1A 1SH3A 4Q8EA 2E7XA 5LMUF 3PW5A 4JV2A 1BWEA 4OFZA 2HRUA 2JLFA 3S6EA 1SL0A 2VUGA 2M0GB 4XPEA 2MZ1A 1UVIA 3TO8A 5BJRA 3DI6A 3LGNA 2HNDA 3MM8B 2VKZG 2L41A 2AGPA 2NZ4A 1WHXA 3BQ2A 5DGBA 3OVBA 1R43A 2IVYA 1BQNA 1LW0A 4F25A 5EX3A 2FPHX 3CB4A 3SYZA 2DB1A 4ALZA 1WF2A 3IXQA 1UWBA 2YNGB 2PEHA 2VFTA 1DQAA 5B0EA 4Z37A 2CJBA 3ETOA 1FDAA 2RRNA 4NLTA 4JI8F 2R7VA 2ZOFA 3W2VA 4OQJA 5THWA 3TW0A 3KOAA 1F60B 3DC2A 2MY8A 1YTYA 3OTBA 2CVEA 3KTQA 2NUHA 2AU0A 5D77A 2C2DA 3I82A 5KG3A 2BQRA 1SL2A 2PO4A 3MEDA 2RQ4A 3JYTA 2J6TA 1ZH5A 2IYGA 4I2QB 1T8EA 4ZPCA 1Q81T 2YX7A 2DNPA 2V8VA 4DOZA 2VG6B 1TKDA 4KSEB 3UCZP 1HL6A 5CQGA 1FRKA 3SCKE 3TAMB 4K4XA 4Q2MA 1MU2A 5KT7A 2V0NA 3OFHA 4ZCLA 4NLQA 3CJKA 4J9SA 4JUZA 2DNKA 4ZMMA 4TKTA 2IJNA 1TV6A 1FTRA 5C42B 2HGNA 2YNFA 4KTQA 1F9FA 2EK6A 1V3ZA 2WRMA 2VC1A 3G8QA 3H40A 3CJ5A 4FXDA 3R5CA 3TA2A 1GXUA 1M5SA 4DFPA 1HNVA 2MQLA 2VL1A 2NUUG 3CDEA 2DR7A 2BZ2A 4LFCF 3OBIA 4QW8A 4IOAQ 2RIJA 2WB4A 4C11A 4OX9F 1WHVA 1FRJA 4QPTA 7FDRA 3SDEB 1W2IA 3MM7B 1CPZA 3FZ2A 2HWTA 3SSSA 2FLOA 4FNHA 2AD9A 5I4MA 2UUAF 1KOOA 2DNZA 3AJ1A 2E9ZA 1CQNA 5HP1A 3NMAA 2DITA 3EXCX 2ZH2A 4QIFA 3J7YI 3VAHA 4C97A 6FD1A 2FGCA 2IVMA 4KPYA 2FHKA 2Q3PA 4IFVB 1OSDA 1CQMA 3MFIA 2OIHA 3MECA 3M2VB 3BGRA 4TU9A 3V6HA 2ZOGA 2XCPA 4DR3F 1F5AA 2FHMA 4OHWA 1FNXH 1NNDA 1X4HA 1N5YA 2M8DB 1TUVA 1SV5A 5FDLA 2C2RA 4PKDB 4F8RA 2XGPA 1G7CB 5DDRC 1IKVA 2EFVA 3FMWA 2DH7A 3ENQA 4AE5A 3V4IB 4EUVA 4JI2F 3GR0A 3TOQA 3TUJC 1LV5A 2GMHA 2ADCA 3P6YC 3LUYA 2MQPA 4NYZA 1WI8A 1N5TA 3DRRB 2VBZA 3IR6B 5AXNA 4IRDA 1KFSA 2OP5A 2AJFE 3T6BA 1UL3A 4R5PB 3V5RA 3O8WA 5JVGQ 2IAJA 1KLMA 2YKOA 1Q8IA 3LALA 4QIVA 1WEZA 3E01A 1R8CA 4LT6A 4URGA 1OO0B 3HP6A 3MEEB 1YJWS 2YKMB 5D6GA 4Q0BA 2Z0GA 2MKHA 3HDSA 4ECTA 3IO1A 1I94F 4KFBB 2ZFHA 5JUMA 4C0OC 4RW8A 1LWCA 5HMXA 3CD0A 2KFZA 4DX8H 4WFBQ 2WHOA 5DO2A 2C3YA 1ZAWA 3F44A 1XNRF 4OX8A 4YB6A 4BBYA 4ZVHA 3UI3A 2F8HA 2DD8S 2E44A 4URQU 4DL0C 4DR5F 4ZP7A 4DS4A 3IC1A 2J7KA 2ZH7A 3PX0A 3RAMA 1Q53A 4LMZA 1YRTA 2N7YA 3FQLA 1N4LA 1QAYA 5K8PA 5HMZA 1JMTA 3KG1A 2MGZB 3EZ5A 1TFWA 3KLFB 2W9BA 3MZIA 2OAUA 1JLQB 3SQGB 4DSLA 1RKIA 4TYBA 4F4XA 3KMQA 5ADZA 3VZHA 3OR1A 4OIXA 5DG9A 1K73T 3HZGA 2HNYB 5KG7A 1J2VA 1URNA 5CYJA 1G2EA 4LJMA 1GX5A 2XSJA 2CPHA 2YKNB 3CCTA 4UUWA 4ECXA 3DLBA 1Q78A 3UCGA 4C8MA 1BY9A 1NKEA 2UP1A 1L3TA 2Z2LA 4MYUA 1FE4A 4NYOA 3T1HF 4GMKA 2AJQA 1TL3B 4Q2LA 3M32A 2GW8A 3QAUA 2GHVC 4I7FA 1YITS 2DR9A 1VS3A 1NJWA 2FD2A 3SSQA 3UWTA 4ETXA 3N79A 3VAFA 3FGVA 2XS5A 3MI7X 2ASDA 2E1CA 2LQJA 2PDAA 4RU9A 4EYHB 1QSYA 3I0RB 2F8MA 1X5TA 5EX0A 1I6JA 1VIXA 3DOLA 1TL1A 4H4OA 2BABA 2CQPA 1XMQF 4PRFA 1I1GA 4IRKA 1S9EA 1WACA 3H4BA 4J9NA 1TKTA 4I2PA 4ZDNA 4ILLA 3E51A 3Q2TC 3KK3A 3P49B 2DR5A 1OPZA 2BE2B 1Y9OA 1NJZA 2XSFA 2IBKA 2LA4A 2MQNA 4RW9B 3MM5A 1S79A 4XK8C 1VQOS 1FKAF 4WXWA 4TQRA 4OJHA 3PV8A 2OO4A 5KFQA 2E66A 2CG4A 1RT4B 2OTJS 2QFJA 2FB0A 3C6TA 2FVQA 4NLSA 2VFUA 2J6UA 1S6PA 1FK9B 4FN5A 2CQ1A 4MYTA 3T3FA 2J8AA 2J9DE 5EUHA 3E2EA 3KJVA 3LP0A 4MAKA 1UVKA 4FP9A 5T14A 2AJ1A 3CDBA 3UE2A 1P9QC 2PE8A 1B0TA 4YQWA 1V9OA 3Q23A 4ED7A 1D8ZA 2IA0A 2D74B 2CPZA 2ZC3A 1U6ZA 2B4PA 4K5RA 4NLRA 3OQ2A 5L1IA 3D1OA 2BQUA 4LF4F 2IHR1 2RT3A 4FPRA 2GMLA 1RAJA 2V4QA 1FEEA 3RW7A 3OTCA 3BR8A 4J37A 3IWXA 1SJRA 4EO8A 1HNXF 2EK1A 3M1VA 5HO4A 3ZZTA 5GMKa 1S77D 1LXNA 5KOXA 4XDDA 3J7YU 2QMXA 5C25B 1YJRA 1VQSA 4XIUA 3DN9A 3DXBA 3HHLA 4Y2KA 5KT5A 3PR5B 2XMUA 2LKZA 3CDUA 5L39A 2DIUA 3KNAA 2O5DA 1QM9A 2QSWA 1VQYA 3PRDA 4PXDA 4XPCA 4OJGA 1S0OA 4NCBA 4DN9A 1SH2A 1SH0A 1UKUA 2XI2A 4ZCMA 3IG1B 5DG8A 2V8HA 4CH1A 3NGDA 4C98A 1FHTA 1NHVA 2YWEA 3HI9A 1MROA 3JTPA 3OR2A 3V81A 4TY9A 3MGJA 1SJ1A 4OZ0A 3HKWA 2WAQD 1TAUA 1DBDA 2U2FA 3NBPB 3W2WA 1HQEB 1U25A 2DNRA 1DRZA 3PHEA 4FVCA 3L3CA 4GC7A 4WE1B 1ZTTA 1DJ0A 4CQ1A 5IT9Y 2BJEA 3LP2A 1U1OA 3M2RB 5L1JA 2DK2A 4HL9A 3OSNA 3CCWA 3GYNA 3T5KA 1R6YA 2RB7A 5FD1A 4RUHA 1N56A 2JEIA 3IAM9 4K4VA 2QV6A 4QQBA 1JLEB 3D54A 2UUWA 4KQZA 1KD1T 3M6VA 3TRGA 3KK2B 4NLOA 4WF9Q 3RR8A 1S1VB 4G6VB 1UVMA 4OL8A 2M5YA 1UETA 3Q8PB 1T95A 3HJFA 1S7HA 4ES1A 2C28A 1U49A 1HNWF 5DDOC 1IXKA 1S6QA 2V4JB 3QO9A 3SV3A 4MKBA 4LSLA 2FUG9 3HHNB 3MMJA 3H2UB 2K1RA 3MPWA 4O3PA 3MMCB 2RU9A 4LSNA 2IRUA 4QWAA 2KYZA 2ZH8A 4A4JA 2DGQA 2DNOA 1SC6A 1LWEA 2I5JA 2OPRA 4X62F 2QA4S 4FXVA 4TLQA 2FJAB 3C66A 1GXTA 4K0KF 3POTA 3IWNC 1DTTB 2WONB 2HLUA 5IXUA 1M0SA 3KLEB 4QBUA 1T03B 4JI4F 2HYIB 3WDOA 3I9V9 3BJYA 3UDLA 5AE1A 4B3RF 2CPXA 4NLYA 4NZ0A 2OPQA 1N8RT 2WB1D 2LXUA 4ECRA 4ECWA 1S9GB 3PFOA 4PG5A 4RW6A 2DGXA 2POKA 1HPZB 2HGMA 1RA6A 2NSCA 2X1BA 4TXSA 5KFKA 1RT7B 3MEGA 1ROFA 2BA9A 3DRSA 2PSZA 4PXCA 5B7WA 1RJJA 3OLBA 2X1GA 1XMOF 3VAMA 1TKXB 1HD1A 1YVFA 1Q79A 3DFEA 4B08A 1U1RA 2EWHA 3DLGA 1U6BA 4C8OA 3NNCA 2J0SD 1SKRA 2VH7A 3KHGA 2PA3A 4KV8A 3CCLS 4B9UA 2N3LA 2W7PA 2HHHF 2O66A 4Q43A 1GTHA 1PSDA 3I32A 4RW4A 4U7UK 1PILA 1TAQA 3W7BA 3SI8A 4E8UA 1KVIA 3M6UA 2C22A 1X9MA 2G0CA 1NK5A 4KRWA 3EUNA 3DYAB 1YGYA 3TARA 5KFGA 3V6JA 4ECSA 4RNNA 3N5FA 5G0RA 2WTFA 3MM9A 5CYQB 5DG7A 2DNGA 1U4BA 3V6KA 2AP6A 2B4OA 4XO0A 4DFJA 4X4UA 2F7VA 3OHBA 4U67Q 3EPIA 2W4DA 2HHTA 3C3LA 3GIIA 2OPPB 2RVJA 4NZ6A 5KFAA 4RNMA 2DGVA 1YJNS 3CWJA 3PJXA 1LK5A 2VOPA 1JKHB 4IG0B 3OTOF 3BS9A 3H25A 3CE8A 3OSPA 2XWYA 4ED0A 2KH9A 5JXSA 1S99A 4NXNF 2HHVA 5F3ZA 2N82B 2XZWA 1QVFR 1CC7A 1U1PA 2BBEA 3UR3C 3GYXB 2ZJRQ 4OLPA 4IR1A 2RRAA 1A9NB 2HMIA 2J6SA 3NL0A 1PO6A 1KFDA 3MPVA 3I0SB 4PUOA 3OJUA 1O0PA 3CEDA 5DJBA 1X4DA 1HBNA 2HVZA 2JH3A 2BW2A 3L7PA 4Q45A 2Z8QA 3UD3P 4O3SA 1RT1B 5AE2A 2JC0A 2MSTA 2Q79A 3FSYA 3ZZPA 1IBKF 3LAMA 4QCLA 1S4FA 4HHJA 4M63A 5D3GB 3D5MA 1Y5IB 2ZH3A 4L6V3 1D0EA 1AFIA 1X9WA 2LXFA 2Q1LA 5L9XA 1YIJS 1BQXA 2N4DA 1JX4A 5GAGI 3DLJA 4P7TA 2RU3A 3SMZA 4LF6F 2KXFA 3CIZA 4J9PA 2QEXS 5HLFB 1VQ5S 3PO5A 1XERA 2NPIA 3BSCA 2VASA 3TANA 3MM6B 2Z4PA 2JJ4D 2B4VA 1FRIA 1IUJA 4JI0F 3G6ES 4O3QA 2A3JA 4IQXA 1LW2B 3QPIA 1FCAA 4TY8A 5E3PA 4FF1A 1X7VA 4WFAQ 2RDIA 3MURP 1LK7A 1DQ9A 3SXLA 3DI6B 4KC5A 1B64A 5K14A 2LDIA 4LIWA 5L1KA 1CEZA 1L3UA 2QO3A 3BZQA 2R7UA 4IUFA 3I9ZA 3PEHA 1ZM4A 3F73A 2RDJA 1FKOA 2YNIA 4UW2A 3ZZRA 4OI0A 3H5XA 1FJ7A 4PG6A 1HNZF 3NP5A 1A6LA 2ROEA 3HHLC 2E5IA 2UVRA 4C8ZA 5HBMB 4N8OA 2VC0A 1ZM2A 1B0VA 3KHLA 1OSCA 4B9SA 2CQIA 3NCPA 2W7AA 4U6PA 5T7LB 3MOJB 3ENWA 1H2VZ 7FD1A 1XBWA 1FVSA 4DV5F 3L09A 1ZPWX 4NCGB 1JLCA 1FDBA 1KEKA 3NS5A 4RUAA 3D28A 4IDKA 4O44A 2DNLA 3MR5A 1EP4A 1M5HA 5H9EJ 1YBAA 1X4AA 1L3VA 2WBRA 2UVWA 2MDAA 2QRRA 1DHMA 5HN0A