4Y6IA

Crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
ASVVVLATAPDEATAQDLAAKVLAEKLAAAATLIPGATSLYYWEGKLEQEYVVQMILKTTVSHQQALLEALKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent-cation tolerance protein CutA
publication title Crystal structure of E.coli CutA1 E61V/C16A/C39A/C79A mutation
rcsb
source organism Escherichia coli k-12
molecule tags Metal binding protein
total genus 24
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y6iA00
1QY7A 3N5BA 4CO5A 2NUHA 4CO4A 2J9CA 2GX8A 4IYQA 4CO2A 1XK8A 4NYPA 4RLEA 1UL3A 4ZK7M 4D3GA 2O67A 2ZOMA 4CO0A 5D4OA 2JJ4D 3L7PA 1NAQA 1GNKA 4CNZA 3TA2A 1NH8A 1O51A 2V5HG 3AA9A 1PILA 3AH6A 4YB5A 3M05A 2ZFHA 4OZLA 1NH7A 3BZQA 4YB6A 2PIIA 4YB7A 1J2VA 5DRKA 2EG1A 2RD5C 4Y65A 2XZWA 3OPKA 3TA0A 3MHYA 3LF0A 2J9EA 1VHFA 1Q1KA 1OSCA 2VD3A 4C3LA 4OZNA 4C3MA 4CNYA 2GW8A 3AHPA 3NCQA 3TA1A 4OZJA 3NCPA 4RWWA 4C3KA 1H3DA 3T9ZA 2XG8A 1V3SA 4R25A 2NS1B 4WK1A 1V3RA 2GNKA 4RX6A 1O5JA 1P1LA 2O66A 4CO3A 1UKUA 1V9OA 4NYOA 1HWUA 1UMJA 4USIA 3DFEA 5L9NA 4Y6IA 4WK3A 4USJC 5D4LA 4AFFA 3GSDA 3HLUA 2E66A 4RWXA 1V6HA 5D4NA 4E98A 3O5TB 3X3UA 3CE8A 2XULA 3O8WA 2DCLA 2J9DE 3AA8A 2Z0GA 4USHA 4D3HA 2XBPA 1NZAA 2NUUG 5DS7A 2CZ4A 2EG2A 1VFJA 4CO1A 1UFLA 3NCRA 2J9DA 1KR4A 5D4PA
chains in the Genus database with same CATH superfamily
2MKJA 3MMAA 1N54B 4RBUA 1IVZA 3MEEB 4R5PB 3MAQA 3TZZA 3QPIA 2FHKA 1K47A 3T1AA 1RYRA 4DV0F 3CDUA 1FI4A 1BLUA 5K8PA 5L1KA 2R4FA 1C1BB 1R8PA 1GEHA 3K59A 1W2IA 3AHPA 4EO6A 2EFNA 2MY8A 3UR3C 5HANA 1ZBTA 3T1HJ 4ECZA 3C14A 2VJVA 2QV6A 3K17A 2OSQA 3C16A 2DISA 2DNZA 2JNJA 3NWGA 4KTQA 2BOPA 1T03B 5KT4A 3AJDA 4N8OA 3TVYA 4Q7AA 3FMWA 3AXMA 1BD6A 4HHJA 3DN9A 2UXBJ 3CGIA 3UNGC 2B6AB 5T7LA 2CFXA 1DZ5A 1HD0A 5KFLA 3ZZPA 2HGLA 2KFZA 5JJBA 2J8AA 2HWIA 4X4OA 1HWIA 3M8QA 1AXQA 4C8NA 1M1HA 4DR3F 1UPPA 4ZVEA 2W7OA 4NXMJ 1QUPA 1BWEA 4JYAJ 1S1TA 2RHQB 1VBXA 4MIWA 2X1FA 2XZWA 3T9NA 1TKTA 4RW9B 4X4RA 4CH0S 1C0TA 4MKVA 4XPEA 3N6MA 1PYOB 1S77D 3SQGB 3NKYA 3CJTA 1ZZNA 1LK5A 4JBCA 3DFEA 1FKPB 4M5JA 2G2YA 1HFEL 1HHQA 4DJBA 1X60A 2OPQB 1WORA 2BABA 1CVJA 4B3MJ 3KLIA 2QLJB 4J9LA 3Q8UA 5IWAF 4JI3F 2CJKA 1G1XA 5AJ3J 1VHIA 4IFVA 2V94A 3ZTRA 1UWBA 3MM7B 4PWWA 3RBZA 5CABA 2R7UA 2AZ1A 2HNZB 3QFHA 1SH2A 1IWAA 1KFDA 2VG7A 1VMBA 2SXLA 1ZH5A 2A1BA 2CAJA 1BE4A 1UETA 3I32A 5C2CA 2MDAA 3X1LB 3OL6A 4LSNA 3IM9A 1NMEB 2AJ1A 3Q89A 4EBDA 1DQ8A 2I38A 2GJ2A 2HQCA 4OJ3A 1R8CA 3A3OB 3CUNA 3SCJE 1HI0P 1DAXA 1IQTA 2Z2YB 2DNMA 4HACA 3Q8RB 3E2EA 3G96A 3MAAB 3CMQA 2OEKA 1UWAA 2F65A 3E01B 1CJKB 2CDRB 2FY1A 2FZKB 4HT7A 1KQKA 5HP1A 1VIXA 3HLUA 2B9XA 2JVRA 2Q79A 4ZVUB 3GV8B 2HFVA 3K8VA 4LBHA 5F8IA 3ENWA 1R0AA 3BS9A 3QRQA 3LGHA 2EK6A 4FXDA 5LL6d 2ZBRA 1RLCL 3N0VA 4OYMA 4QIEA 4G1QA 1SL1A 2XNRA 3DMJB 1RT1B 3H5XA 2EK1A 4HH0A 2X1BA 4M1KA 1YI2S 3NGUA 3MM9A 3DLBA 2WBMA 1XMQJ 5DRKA 4DR3J 4ZITA 1JXLA 3CJ3A 1X4DA 3ZNUA 2GJIA 3TAQA 4USMA 4ES2A 2M88A 3J7YU 3NCQA 4ILRA 2BJDA 3BREA 5D3GA 5CD4H 1SJ4P 1QTNB 3B54A 3FKBA 2W8KA 3CO0P 4DQIA 2RVJA 2FJBB 2XWYA 3H2LA 4XK8C 2LEAA 1NO8A 2IDEA 2QZ8A 2V8GA 4UY85 1JLBA 3HDSA 4DN0A 3M32B 2KFYA 3CC2S 1U1RA 2E44A 4IRKA 2WB4A 4UF4A 3ZTSA 4IOCQ 1Y10A 4FYXB 5KG0A 2C2KB 2I5JB 1FJGJ 1KSPA 4CO1A 2F40A 2HVIA 4NCGB 1T8EA 3GV7B 3QO9A 5IWAJ 1R0CB 4JI3J 3P4UB 1G6BA 3FEZA 2UZAA 5K9FA 2W1BA 4P2MA 1S57A 1HL6A 2EWHA 3THVA 4ETXA 2M0GB 1PAEX 2CPZA 2DNPA 3WHIA 2BOAA 1V5VA 4DV7F 2YH1A 1RXOB 3RZAA 3H5SA 2GGPA 2DGWA 4O3QA 2XMTA 4XDDA 1FEHA 3PXGa 4LREA 4OX9F 2BJ8A 3OHAA 2B5JA 1LW2A 4I6WA 1PSDA 4N76A 2AYGA 4IH7A 1WTBA 3MM8B 1GMWA 5KFKA 3GQCA 4HVZA 2AEFA 2FIUA 3CWJA 5LXRA 2WAQD 1VQ5S 4IKAA 1WEYA 1QE1A 4FS1A 2GMLA 2IYGA 1F60B 1DY3A 4WU3A 2JSXA 3DKDA 3QLHB 3DXBA 3EGNA 4FYDA 5B08A 3Q23A 1SKUB 3H0PA 2MKYA 3EXYA 3PYGA 2DNGA 2X3DA 3C15A 2MHEA 2A3JA 4BLGA 1M5VC 1BQMB 1JJCB 3OPKA 3Q86A 3G6YA 1HPZB 2MZTA 2E1PA 3JSRA 4LSZB 2D7SA 2EVZA 3D2WA 1UFWA 5BR8J 5L1JA 3U27A 1Q7YT 3EGZA 2KFNA 2X1GA 2OUGA 1RHQB 3BH7B 2H9ZA 4X4SA 4ZIWA 4CT8A 1U0SA 4CYUB 4HT5A 2UVVA 1G4CA 4LF8F 3GZ7A 1NSQA 1X4FA 2QMUB 3GP9A 5CYQA 4J9QA 1XBWA 1SJRA 1WI8A 2Y8WA 2DH9A 4LFCJ 2YKOA 2A2DA 2E7VA 4H4MB 1OYDA 3GIJA 2JFKA 3DU5A 3FBCA 1S0OA 3UO0A 2ZKUA 1WNEA 2J6TA 2HHVA 2VU5A 1DURA 3GFZA 3M2UA 4OV1A 1CPZA 3VGTA 3DI6A 2DITA 5GAGU 5DETA 5I3UA 1TTHB 4MKYA 2MPUA 4Q45A 1FTCA 4A47A 4DFPA 2PT0A 3EVMA 3V4IB 1D9DA 2HZVA 4P71A 4QBUA 3PRDA 3LF0A 3J80U 2DH8A 1RHMB 4GO5X 2LEPA 4B9UA 2VC0A 4WWSA 4KFBA 1IKYA 2H5EA 2YPYA 2HFSA 2GNKA 2CG4A 4GKJF 1YSJA 4CLUA 3DM2B 3S01A 2H65B 3TUJC 4CLFA 4OV6A 1WD6A 1X9WA 1KOHA 2B9EA 3BBCA 5H1SV 1PCAA 3DRPA 4DV7J 3D6FB 3KXDA 2LP4A 1S49A 2NQPA 4ZPCA 4F67A 2Z0GA 5KT6A 1ZETA 2G2ZA 4OX9J 2HFOA 2YWWA 3WZ0A 3MZIA 5LSOA 2M70A 2K3KA 3KDOA 4USTA 5HJYA 1RT6A 4KHRA 3KMSA 1LOUA 5K8MA 2J9CA 3EPGA 4Y2MA 4XAKA 1YRTA 4LSLA 1U2CA 4WTYA 4DMZA 1NAQA 1Z1ZA 4KQZA 4CNZA 3BSNA 1I3OB 1FK9B 4ZVPB 3A1YG 1G7CB 2B8PA 2L9WA 3QT7A 2YWKA 2K1RA 4FNIA 3OTBA 1N5SA 4YB6A 3TZYA 3MM6B 4YY3J 2BE2A 5G0RB 5E41A 4X2BA 1REVB 1WWHA 3DOLA 4LVOP 4DX6A 5ETSA 3TW0A 5J2NA 5E7OB 2EW9A 5H9FK 1HBUB 1EZZB 4DV4F 2QMWA 3M1VA 2EFVA 3TUZC 4DPYA 2ZH8A 1RB0A 2VKZG 2UUWA 1FDDA 2ZUGA 4OHZA 3D0HE 3NEKA 5HVHA 1APSA 2OELA 1YJWS 4G1PA 2HNYB 2H4YB 3FGVA 2O3DA 3CCVS 2D3ZA 2BE7D 1S1VA 2HHXA 3D66A 4LBIA 1TV6B 2ZH4A 1HQUB 5KFCA 3MUVP 3HVAA 2AJ4A 4LF8J 4ZLNA 3CJ8A 2VG5B 2J9DA 2AGPA 2YWFA 2ROEA 2DGVA 1VLYA 2ZM6F 1S76D 3HVRA 4USVA 3ETOA 3FNNA 3R5JB 1FNMA 2V4RA 1SL0A 2MZQA 3LPEA 4JOUA 2HS3A 2R8IA 2YKPA 1OPIA 2DNLA 3R9LA 4UOCA 4K4VA 3MEDA 2RF2A 4YB7A 3KTQA 1FVQA 3D6TB 3AODA 4Q43A 5IC4B 1C1CB 2NLWA 2YVSA 2RQMA 3J80Y 3B8HA 3OTOF 1TKXB 3N6NA 2YNGB 1PBUA 3DYAA 2RILA 1TL1A 1NDPA 4DSKA 2XI2A 5HBMA 1EETB 3GONA 3DGPA 3KJVA 1Q95G 5LJ5Y 4DV3F 2CIMA 4MK7A 2XMMA 3VGUA 1RAHB 1UJ5A 2E7WA 3P5BP 2IAJA 4GKJJ 1FDBA 4JI1J 4DL6A 5GAHI 2B4UA 4IO1A 3N9UC 2XBPA 2HHQA 3AQOA 4WKRA 5DQHA 4XO0A 5HMWA 3MM5B 2IY5B 1RISA 2N4CA 3TAPA 4PPDA 3PFOA 4K0KF 5E0OA 3GIKA 3I56S 2LQ9A 2NYHA 2OEMA 1FHTA 2MQLA 1N5QA 1RTHA 4F0MA 1E6YB 1FT8A 4LF2A 2PC6A 3R5GA 1VQ9S 4Y2AA 5KG7A 1S1XA 4O4GB 3RTVA 1UA0A 4LQ9A 3RRKA 5I3QA 4DV6J 1NJIT 3D3BJ 5ETMA 3M9OB 3VQSA 2E9ZA 1WF0A 4F26A 2HWHA 3IMQJ 3C8YA 3DCAA 1W25A 1YJ7A 5E5NA 4EMDA 1FERA 1UCNA 4DX7A 2WHOA 3HJVA 3L7UA 4ZLLA 3EZ5A 2FJWA 2FUG9 1KRPA 1SJ3P 2OJ3A 2ATLA 1R8AA 1JJ4A 4DEZA 1D3WA 3C14B 4P75A 4CM0A 3C16B 2GO9A 1D1UA 1WC3A 4LQ3A 1GFWB 3TZXA 3D5MA 2AWZA 3ZC4A 4ZCKA 4CH7A 3O2IA 4LRDA 3HHKA 3R1HA 1H72C 4Q2LA 3FEYB 4I56A 2ZM6J 4J7CA 2RUSA 3FUYA 1R27B 1JLAA 1IR0A 1RCXB 3RR7A 1ELOA 1XIQA 2I1RA 1OQ6A 2Z58B 4U95A 4ELVA 2DO0A 3M8QB 3T9ZA 4WFAQ 2AU0A 1V3SA 3IBWA 3W5XA 4X64F 4DR2F 2RNEA 3AB4B 4HTJA 3U1LA 2ZH7A 2IIHA 2HGMA 2JLFA 3BJYA 2PSZA 4OLOA 5L9NA 4S0MA 3CDWA 2BEFA 3GSIA 1S1TB 2XWXA 2H5IB 4E98A 2DVIA 1X5TA 1LWFA 2EBEA 1HBOA 4NA2A 3KHGA 1C0TB 4O23A 1MG7A 4IUFA 2M7SA 3OFHA 4C8KA 3AOAA 1AFJA 1A0OB 2OTLS 4EU0A 4DV3J 2CQIA 3EGVA 4L74A 4MMOA 4FVCA 4CO2A 1FFGB 2DGSA 4JV0A 2CNOB 2LMIA 3KLIB 1BWVA 3J7AN 1OIAA 1R8HA 2JZ5A 4DQQA 2I8EA 4K0KJ 4IFVB 1UWBB 1Y3JA 5JVGQ 2B51A 1K0VA 4V1Ak 1UEVA 2Z8QA 5CCLA 2VG7B 5A6WA 4XDCA 3UVJA 1SV5A 4K50A 4QW8A 2VBWA 2L08A 2MKSA 3RBDA 1HMVA 2HNDA 5DQIA 3D7SB 1ZA2B 1FA0A 4LSNB 1GH8A 1MLAA 1NDLA 2B8QA 2W25A 1WHWA 2XLKA 1FWKA 1CSJA 2DIUA 3D54A 5A8WB 3DNCA 1HHTP 1RWXB 1UVLA 2RIJA 2XO7A 1S4EA 2W9BB 3HVWA 3T5LA 4HACB 2OTJS 2Z4PA 1NHVA 5HP1B 1DTQA 2E29A 2ZOFA 4RJVA 3BQ0A 2IA0A 2KKHA 4PQAA 1KVIA 2DB1A 1TL3A 1Z2ZA 4X84A 1R0AB 2EFPA 4PXCA 1YITS 3L9ZA 3LP0A 3MPUB 2KDOA 4LF5F 4F7VA 2BKPA 1SB6A 1Y00A 4G1QB 6FDRA 2FVRA 3MMJA 4P10A 1JLQA 3M6UA 1FRLA 4J9RA 1UZHA 5IC6B 3HULA 5A8RA 1AROP 4V19X 3MM9B 1FX2A 1T9TA 1F2HA 4TN2A 2KHDA 2CQGA 4UY8T 4X64J 4WKYA 1CS4A 2VOOA 4DSLA 1KOOA 1UPMB 3MEKA 3PKYA 3P5TL 5D3GB 3W66A 3G86A 1N88A 2RT3A 2LECA 1ZAWA 2OH2A 3EZUA 2K06A 5C25A 3UR0A 5ADZA 4K4XA 2HKEA 4E2FB 5IM0A 1JLBB 4ED3A 5DGBA 1YIJS 2Y0BB 3CTRA 2DNNA 3CCRS 1EJ7L 2CKWA 2V2ZA 1U8WA 3BH6B 2Q1LA 4K4WA 2KI2A 2LA4A 3JQKA 3OXLA 3HSZA 5LSLA 4DF4A 3QO9B 4PG8A 5I3PA 2DEJA 3M30A 3PTWA 4F25A 3TUIC 2HYIB 4ED0A 4DXLA 2IC3A 1FXDA 4JI6F 2W2MP 2RQ4A 4NA1A 4KPCA 4PPZA 3QT6A 5KFIA 3UFCX 3OXGA 3W64A 2HBRB 2JVOA 3AXKA 1K8AT 3DLEA 4J90A 5DJBA 3KJNB 1W26A 1U6ZA 4NEYA 4MKAA 2DGOA 2H54B 1YDLA 1N0UA 1N4LA 2A6MA 1P6TA 2B5JB 4CO0A 1LW2B 3K5NA 3M7VA 1S9FA 2MZJA 7FD1A 5C42B 2EC2A 2GV1A 3SCIE 2KJVA 1PILA 3N6LA 4ZPTR 2D9OA 3IAM9 1HBNB 2XC9A 1ZAXA 1FO1A 1U45A 4RW4B 1AW0A 3BKTA 1QE1B 4FS2A 1NCLA 4C3MA 1F6TA 4DCPB 2CJ9A 1Q8LA 2HVHA 1QSLA 2HWTA 1FDNA 4RX6A 1KBRA 3HKZD 2F4VJ 1VRTA 3H2UB 3MUTP 4DUZF 1JIHA 1SC4B 2WB1D 4MKBA 2LDIA 1AFIA 4RW7A 2ZH6A 3MCMA 3T19A 2CUYA 5F8HA 1XN9A 4KV8A 3J81j 1S12A 3HHEA 2LLZA 1N5VA 2KL8A 1VBZA 3LP1A 1Q86T 3LGNA 1C0UB 3HP6A 4MYUA 3G8TA 3DLKA 3EX7B 1P27B 5LMUF 3P8BB 3C6TA 3MPYA 2LXIA 4QIWD 3CJKA 4PZVA 5CYMB 2J8SA 2IVFB 1TMJA 2J0XA 2RD5C 4LIRA 1BHNA 4C11A 3KLEA 3FK4A 3M8YA 3MOZA 2HZAA 1RBOB 2RH3A 1TR0A 1H7WA 2B3TB 2V69A 4LF7F 4TU7A 2NYIA 3EVOA 2BRKA 2E5GA 4TNOA 4FF2A 4DLEA 1CJTA 1O5JA 4ZVQB 4L76A 3M2UB 4IQMA 4F4WA 3DI6B 2D74B 3CMES 5I3UB 1ZAVA 1C2PA 1BGXT 4C8ZA 4DS4A 4O0NA 1CULA 3PM9A 3KLGA 2XNQA 2CWKA 1JX4A 4G6VB 5J2PB 3T41A 3R3TA 1IKYB 3DHWC 3M8WA 2EFGA 4IFYB 2B4OA 4C8MA 4FF4A 4BC7A 1FRJA 5F9LA 1RWWB 2DRAA 4KPYA 4ICLA 4NYPA 2DPIA 2YXLA 2VC1A 4IR1A 4CIOA 4PRFA 2WK4A 2ZH9A 2PN6A 3UDCA 5A6PA 2RU9A 3VAJA 5KFNA 3AH6A 5IFMA 1X7VA 1TKZA 1MROA 1DFDA 2X7IA 4JUZA 2V0NA 3KJQB 4F4AA 1VJQA 1P9QC 2CPFA 2QFIA 3MR2A 2APOA 2BJ1A 2D3OR 1RT6B 1T11A 1HD1A 3RAMA 3C19A 2B4VA 3L7OA 1WC0A 4K4TA 3CW2C 3W60A 4LSLB 3EYZA 3TP2A 3TAMB 2UXDF 2Z56B 3LAMA 5KFMA 2RQKA 2BYCA 4U8VA 2BUNA 4DR5F 2QL7B 4URGA 4RUBA 4OX8A 2K1RB 2YH0A 2FVCA 3SQOP 2BJ9A 1RAEB 3AD7C 4YHHF 2CQ3A 2EPIA 1JLCA 3K5OA 3DOLB 1CQMA 4DUZJ 3D28A 4JI8F 4NPOA 3MEGB 3UCGA 2B4PA 4X4PA 1FXRA 3NGDA 3SDEA 4TLQA 1UVMA 1UA1A 2Q43A 3B6BA 4NL5A 2L48A 3ZO7A 4FPRA 4Z37A 3GTYX 2HK3A 2DBBA 2ACMA 2F9JA 3NL0A 3M8SA 4U7UD 1RDRA 3HD2A 1NBEB 2Q6BA 1BMQB 3B4DA 4RR5A 5J1NA 2H51B 1VISA 2VFTA 2R8GA 4M5DA 5HROA 5KFEA 5KG2A 3B4MA 1HLWA 5HO4A 3NAIA 3PHTA 3Q8VA 4FP9A 1N6QB 2W4PA 1RWUA 2QLXA 3VAHA 1HNVA 2G0CA 2HFZA 2QL9B 1PAUB 4L3KA 4K4UA 4B3RF 1WG4A 2ZH1A 3RGIA 3PCOB 1JLGA 3H59A 2DIVA 4LF7J 3MEDB 1XWLA 1X9MA 3PIOQ 1YJ9S 4WE1B 1YG0A 3SI8A 2OO4A 2CZ4A 1UFLA 3FCVA 1GQEA 1RTDA 5D0RA 2DTJA 3DYAB 1TL1B 3NBPB 1RBLA 4LFAF 1ITPA 2ZH5A 5A2QU 2WSCC 2DKOB 1DQAA 4WJBA 1RT5B 5B7WA 2OD4A 3ZNJ1 2HVDA 3NG8A 1IN0A 2XEXA 4ZCIA 1RT7A 4TY9A 1GX5A 4B9SA 3IRXB 2W2QP 2XM3A 5F9NA 2KZMA 3BQ1A 2ZUAA 3BKUA 4UOHA 2CQ0A 3FBEA 2DNKA 2XS7A 1L3TA 1WHVA 2JL9A 1ZZFA 3W2WB 2XLIA 2BE9B 4KGXB 4J9PA 4M5MA 2C28A 5ETPA 1YHQS 1RTHB 1YJRA 4F4KA 4KT0C 2CDQA 4HL9A 2UXDJ 4JB8B 3MCOA 2VPZB 3KUHA 1SIZA 1RTIB 2AQ4A 2BMBA 4DR5J 3TQ1A 4AQYF 4HTIA 4AXIA 5HLFB 4YHHJ 1LK7A 4CCHA 4DUYJ 3SCKE 1EAYC 1REGX 4LF6F 4P52A 2OPPA 4IG3A 1NK4A 4DU8A 4JI8J 2XS5A 2Y1IA 4KHMA 1GNKA 4GKKJ 1QAIA 1S7IA 2RU3A 1X4BA 4PABA 1LQ9A 4J37A 2DNOA 1KLNA 1ZM3A 2V67A 2KT3A 5D0HA 3G87A 3OLBA 4DHVA 3QZ7A 1RAJA 3PKMA 3PNIA 3N5FA 4A8YA 2NSCA 4GO7X 3NP5A 1VQPS 1WSRA 4P74A 4ZVTB 5EWGA 4OI2A 1S9EA 2Z57B 1B70B 1U1KA 3DC2A 4JV1A 3UN3A 3ZZZA 1S97A 1ZTWA 5DLGA 4U8YA 5F8MA 1SPBP 1JLAB 1KC8T 3CE8A 3NGSA 1R3NA 1LWEA 4M95A 1BQXA 3V5RA 4B3RJ 1IKXB 1IKWB 5M2PA 2AW0A 5D4PA 3RW7A 3OBIA 2Y9HA 2KT2A 2IHR1 4MFBB 4KR0B 3IGNA 4TYBA 1HI8A 4DL4A 4CLYA 2HK2A 2WBRA 3CCSS 1F5BA 2W9CA 1MWZA 3F41A 3H98A 3MGJA 4LFAJ 3DLGB 3WC2A 1M5PC 2QA1A 3DRRA 2UXCF 3FRYA 2QMXA 3QQCD 4ZJLA 1RQ0A 3GMGA 7AT1B 5LOQA 2J76E 4ERDA 4JI0F 2OMLA 2MSSA 2QEXS 2BQRA 4W98A 1JLEA 3U1NA 5GAEI 3MURP 1FD2A 4U7CA 3O3LA 2COLA 4G1IA 4DZ6A 2PA3A 2CQ4A 5B0BA 1BXNA 2J9DE 3DRSA 3LALA 3DGVA 3CVKA 2LYVA 4DF8A 1Y4ZB 4UT4A 1KLMA 2V6AA 3UVJB 1O6XA 1HNWF 1JMTA 1IWGA 4ZK7M 1MU2A 1MWYA 4KRWA 1KTQA 1HMVB 2F1FA 3IO1A 4AQYJ 3QGGA 3O44A 2BJ7A 2X51A 3PR4A 3VWSA 3HMJG 2R8JA 5BYQA 2FB0A 4LF6J 1NK9A 4HH1A 9ATCB 4QIGA 4A8QA 3NS6A 3IXQA 2YKMA 3R7SB 1KVJA 3V6HA 2PI5A 3RJMB 3CCUS 2HAFA 4Y6IA 4XPCA 4ELUA 2YY3A 2CQDA 5J1EA 2V8DA 3S6EA 3ZZRA 4ECSA 1TL3B 4DL5A 1NSKL 4KHPF 3NNAA 2HHPA 5CXTA 3LTOA 2AGOA 2KG1A 2BW2A 1Q8BA 3TARA 4B3OA 3IBCB 1HYSB 3N5BA 3W9IA 2N7CA 1WC5A 3C6UB 3TR5A 1QVFR 2Q3PA 1JLQB 1MW7A 1T94A 4ZPWR 3VVTA 1UL3A 2C3UA 3D67A 1OPZA 3NLCA 4H4KC 1VCTA 4ZPAA 4TQSA 3C66A 5A8RB 3F73A 2FHJD 1S9GA 4AD6A 4CLZA 2ROGA 1CS4B 5IQ6A 3JB9k 3W9HA 3FJ2A 3C3LA 4A8SA 2BZ2A 4A46A 4OI0A 3BGLA 4BWMA 5A8KA 2EXUA 4HHHA 5BXIA 2RB7A 3GYNA 2HVEA 3I96A 1Q82T 3NCPA 4PUOA 1PYSB 4BHQA 5HI7A 2X3GA 4M5LA 4XIUA 5D78A 5IM0B 4USIA 3H40A 2BQ3A 2IYIA 4DFKA 2GVZA 1U0HA 2W8LA 3QAEA 3ENVA 2M9KA 4M5IA 1N48A 4K59A 4DFJA 3CT9A 1RABB 5KFAA 2VBZA 4ZJOA 2R7RA 2YNFA 4ES3A 3OR2A 3KK3B 1HARA 1EB0A 2Z2MA 1FCAA 5KFUA 3SFGA 3CCES 1VDHA 3PW7A 2E5LF 3QT5A 4KIAA 3B78A 3M30B 4F3OA 4W90B 1YJVA 3LPYA 3MMCB 1XMBA 4NX9A 4BWJA 2BM0A 1SIWB 2IC3B 3S7RA 4ID5A 4P6QA 2DNYA 3E51A 1QAYA 4ZP7A 5DG9A 4QU7A 2D41A 2ZBQA 2J7UA 1E6VB 3FFIA 1QSSA 1HNWJ 1NSAA 3JQMA 4BDPA 4YR2A 4YMEA 3V6JA 3Q8PB 4WPAA 2C2ZB 2NPFA 4L3NA 3I31A 3DLEB 1IR1A 2EI5A 2C2NA 3TI0A 1VQNS 1FFSB 3RW6A 1NDKA 5K5MA 4AE5A 3M2RB 2KHCA 3D0GE 1WKLA 2VASA 3HFZB 3GIIA 3FZBA 3HSDA 4DUTA 4FXVA 4DPXA 2K3IA 2BM1A 1KD1T 2IJNA 2R7VA 1X5OA 2HRTA 4EUVA 1YJNS 3U1MA 2QX0A 1LEOA 1LXJA 2W7AA 3H2VE 2OPSA 1X4HA 2E1RA 4PQUB 3IR5B 1X8DA 5EGYA 3KG4A 4EBEA 3ENQA 3T1YF 1X5PA 1B0TA 2XYHB 1VQLS 3PZPA 4RW7B 1QUVA 4DSIA 2MHNA 3LQVA 4KV8B 3HKWA 2BQUA 4Y00A 5HQLA 4EZ6A 1VHFA 2WVFA 2G4BA 3DLKB 1JXEA 2WCXA 5JMNA 1ZM9A 3AAWB 5AXLA 3G2XA 2GFFA 3C6TB 1LW0A 2KXHA 2ASDA 3GJRB 4FYVB 1AT1B 1HBMA 4RUCA 1V5IB 1TK8A 2DHAA 2ZH2A 3H90A 3GSDA 1OS5A 4ANDA 3PRBA 4C11B 4DG1A 1RHUB 4USHA 2HGNA 2XZDB 4B9VA 1ZM4A 2DEIA 3GJTB 2KM8C 3UCUP 1URNA 4FXWA 4ANCA 3VCDA 4P7TA 4DSJA 2CQBA 1XMOF 4LF4J 4B17A 3D6MB 2E5LJ 4J91A 5ETKA 5DDOC 3FDSA 2E5HA 3EICA 3PR5B 1R6YA 2B0GA 4PWDA 4ED6A 3OVSA 1N34F 3UDLA 2VD3A 2HHWA 2CJXB 3KMQA 2K7KA 1U47A 4PYDA 2ZZMA 4RNMA 1IBKF 1H3DA 2YX4A 4H4KA 1RTJA 1RADB 3R7NB 1IKVA 4JI5F 3CDEA 2YKQA 4YDDB 1VQKS 1D8YA 1U24A 4QJVA 2PO4A 3HPOA 1CEZA 2HAIA 4R8UA 4X4UA 2BANB 3R6LB 2QSFA 4C9DA 1T02A 2WOMA 2D3O1 4DU7A 2CRLA 4YDXA 1RU2A 3GYXB 1MN9A 1HA1A 3MWBA 1Y3KA 3VR1A 1AUSL 2FJAB 1TFYA 4WF9Q 2D3UA 5KFSA 5IOLA 2QT7A 2FLLA 1AZSB 4OLPA 2XGPA 2AZ3A 3CJQA 2C3MA 2WVEA 1WOSA 2MQQA 2ZNZA 2XCAA 4OIXA 1JLCB 3H20A 4ZCMA 1AB8A 1IBLF 2GC8A 3T1YJ 1FRHA 1O0PA 3VAFA 4ZHRA 4IOBA 5AJ3F 4CNYA 2ZBPA 3IG1A 5KFPA 2HHTA 3DXSX 1URRA 1PJ7A 1S4FA 2MLZA 1FWLA 1M1KT 3OW2R 5HSPA 2OD6A 3VGSA 3V81A 3ILOA 4QYZJ 4M5DB 3HHLA 2GHWA 5ETTA 1N5YA 2BJ3A 3JXOA 4NLUA 5SZTA 4NZ0A 2LQ5A 2GIQA 2XB2D 1HNIA 8AT1B 1HNVB 3CIZA 3CCMS 4O44A 2ADCA 2XHCA 2DD8S 3KLHA 2ZE2A 4A48A 4ELTA 4ED5A 2ZDOA 4O3SA 5K8OA 1WOPA 3BGUA 1NZ8A 4L73A 1I5OB 1XMOJ 4Y65A 1ZS6A 4O3OA 2CNLB 1OSCA 1RTDB 1RT3A 3C46A 2ZZTA 2PEBA 4I7FB 2AJQA 1VC0A 4DPOA 2NXUA 1DTTA 4ZPVR 5IT9Y 4GVBA 1A9NB 3SMZA 2VQFF 2B9WA 4N5SA 4CO3A 3GCWP 2CG8A 1N34J 3W63A 3H5UA 1RT7B 1S6PB 2VDHA 2YQ0A 3VAKA 4O3NA 1K0TA 1IBKJ 1YWXA 4ECUA 3CJ4A 1TAQA 1XMQF 4JI5J 1IQZA 4GRSA 2ABYA 3W8PA 1V3ZA 1KHWA 3VAMA 5HMYA 3H4BA 5DS7A 2QA2A 2DJWA 2MXYA 2FZGB 4R5PA 5KFTA 3US5A 2BVZA 3QT8A 3R2DJ 4DV2J 2ZDPA 3UQSA 1NB2A 2MQ8A 1S10A 1SQFA 2HMIB 1RI7A 1EX8A 4KKOA 2HLUA 4PXDA 3MR6A 1HQEA 2AYEA 1WC1A 1C1BA 5E3AA 2P9EA 4FBTA 2MKKA 3OTEA 2LKZA 3EZOA 3U02A 2JEFA 3ZFVA 2RS2A 4GC6A 2GQCA 5FD1A 1FJGF 3PW2A 1JK9B 2IVYA 2JX2A 3VVUA 4DDFA 4DFMA 5HK4A 1IBLJ 1T03A 1U25A 3HSJA 4MTPA 2HQDA 2WW8A 1M5HA 2W4DA 5F0UA 1WKJA 1Q5VA 3OFFA 3AOCA 1F0XA 4DPWA 3TJ9A 2DGXA 2B6AA 3MPVA 2IRYA 3W2VB 1JXVA 2Y1LB 2LXFA 4AXJA 4UUWA 4IDKB 3KK1B 3G4SS 3DLHA 5GAEU 3I0RA 3QSYB 2KJWA 2AYMA 1Q5YA 1VRUB 2CVIA 2CJBA 5ETVA 3GYGA 2QLWA 5K14B 1FKOA 5I42B 4P73A 1S9EB 4CLWA 1SQGA 3CPWR 1Y9OA 1SKSA 3OSPA 1QLNA 2AV5A 1N32F 1RWVB 5KOXA 4ZKAA 3SQGA 2ZC4A 2C2EA 1S6QB 1U26A 5IXUA 3E3XA 1RBAA 3HCXA 1EKRA 2KU7A 1R8BA 2OPQA 1WHYA 2J0QD 1QAXA 1UMJA 1NDCA 4NA3A 1CBKA 4WFYA 3MD1A 3TVKA 2RDIA 3WQPA 1FNOA 4OJGA 3MM7A 4USKA 3X3UA 3FQLA 2VQFJ 2AT1B 3GPAA 2OPRB 3AT1B 1XR5A 4LRBA 5M2UA 1UZDA 4Z7CA 5BR8F 4GVLA 4PYAA 1JLEB 1ICEB 4ZVOB 2M8HA 4I2PA 2B7BB 2BRLA 3M9MB 4ETZA 4FZVA 1AUDA 1Y7PA 3AD9C 1ZYQA 3JAMY 4HYKA 3GG0A 3LH2S 3DRSB 4DOZA 3BDPA 3IWXA 4EEYA 1SH0A 2Z2LA 2MGZB 2VFRA 3JYTB 5E33A 4LFCF 1KLMB 1NKBA 2ASJA 2UVWA 4DI6A 2NSBA 3E01A 2QLBB 3GU0A 5CD4A 3DHXA 1KDNA 4RPFA 3THTA 4WK1A 5KFQA 3K5PA 1FRMA 3IBFB 2CQ1A 2FVQA 4P7VA 2IPOB 2FY8A 1RGVA 2G0JA 3MAHA 1H2VZ 1Y5NB 3EWGA 1VRQC 4K5RA 4OL8A 4M5NA 4J9KA 2CPHA 2VPXB 5H9EJ 3BKFA 4U9RA 1T0TV 4OX7A 2BV3A 4R0JA 4KGKA 2Z30B 5DG8A 3OUYB 4NLGA 2DR6A 3UDEA 4Q0BB 1XNRF 5J1EB 2O1PA 2YKNA 3DOKB 3TUPA 1NH8A 4ILMA 1NXIA 3OL7A 4B02A 3QATA 1LFPA 5IZHA 2EEYA 2W9AA 4DV5J 3TYTA 3EDRB 1H0HB 4Z2XA 1M90T 2R7QA 3GFYA 4OI1A 3LUYA 4OZ2A 2YWGA 3KK2B 2NXNA 2JLGA 4C0HA 1N32J 1UEKA 2KH9A 5A76A 1S1WA 2LCWA 1ZA1B 2DXEA 2GZOA 3NOGA 3HF5A 3I6PA 2ZVSA 2PI4A 5HQ8A 5LSRA 3QWUA 4KGVB 2HS4A 2I5JA 4R0EA 2E66A 2E1AA 5KG6A 4NCGA 3AQPA 1NKCA 4CRJA 5A8KB 5L39A 4YY3F 3PW0A 4NI2B 4OHWA 1DRZA 1VQMS 4OZ0A 4ZDNA 4KB7A 4LF9J 1VQOS 1N36F 2ZWOA 4PG5A 3DDIA 2I2YA 1RT2A 1EQ0A 1QSYA 4K7QA 2GVZB 4WTOB 2JFDA 3G82A 1M5KC 4ECQA 4Y2KA 3KNAA 1NUEA 1GXTA 2OEJA 3I4PA 4ZVGA 3CSKA 3T5HA 2AMCB 3BN7A 2M3DA 5KFGA 1H2UX 4NWBA 1WACA 2KRBA 4RU9A 4LT6A 4NLTA 2NS1B 4NLYA 3VHQA 4OYPA 4WFXA 1T7PA 4JV2A 3MM8A 2Y8YA 4JP8A 4I69A 4NCBA 3V2UC 1IBCB 1J27A 3FFIB 2CPXA 5D4LA 3DU6A 2MQOA 3CMAS 4ECTA 5K20B 2NZCA 2AX0A 3DDNA 1G3OA 2H48B 3ULHA 2MSTA 4KYZA 2C2OB 2XI3A 2MQMA 2V4JA 2EFQA 3W8GA 4RL1A 2JEJA 1DLOB 4EYHB 1FD8A 1MMDA 1O8BA 4ILLA 2ERRA 1KQSR 1U1LA 1RHJB 5KAKA 2R2TA 2R7TA 3ZTPA 2PA8D 4MT1A 4YR0A 2FVPA 4NMLA 3GV5B 1JLFB 5C24B 1A6LA 2F9DA 2ZNYA 2PD1A 1BQMA 4WFNQ 3QAUA 2HZCA 1BQNA 2BJEA 1HPZA 2FYXA 3KG1A 3RRHA 5K8NA 4F3MA 3KYLA 2IDLA 1S48A 1RT4B 2CQ2A 1KN6A 1JJ2R 3I5CA 4JI1F 2HVZA 1KONA 3BGRB 2CZVC 4ZN3A 4RW6A 1XNRJ 1L3UA 2MMYA 2DHHA 1G2EA 3K2YA 2R7OA 4NRUA 2VG6B 1U6BA 3V6DA 4OMFG 2HBZB 1M5OC 1MSWD 1RTZA 3RAXA 1GXLA 2ASYA 1NK8A 4AYBD 3OJUA 3JTPA 4DS5A 1EP4B 5CQGA 4H4MA 2AJ0A 3W65A 1WSVA 1NHKL 4KY3A 1HNXJ 3WDOA 3BGFA 2HIYA 4DV6F 1UJ4A 1TQLA 2IBKA 1U1MA 2KYZA 1X5SA 1LW0B 1QY7A 1XR6A 4CO4A 3H42A 5J2QA 1YK9A 2H3EB 3NWRA 5J1PA 2HBYB 3QJPA 3V4IA 5B09A 1AYEA 1N36J 3LAKA 3KG0A 5KFYA 4OJHA 3PVXA 3I0SB 4DG1B 2DNHA 3GWCA 2EKNA 1P1TA 5KFRA 4OZNA 2A18A 1XTZA 1XR7A 3DM2A 4B08A 5DZ6A 5IT4A 5D15A 3R5CA 2EKYA 4LJMA 2MZSA 3TEGA 4AT1B 2FHJA 4HDHA 2ADBA 3WC0A 3IA0A 3RUBL 1F9EB 1DQ9A 2QTWA 1AA1B 5DDQC 3IS9B 1UJ6A 2NXCA 1EIYB 4PWDB 3NGRA 3O5TB 2AP6A 2CYYA 2CQPA 3PIPQ 2XCPA 1GMVA 4OHYA 6FD1A 5HJXA 3AJ2A 3ZZUA 2CVEA 5EX0A 4WXWA 4C98A 3V4MA 1RTJB 1NSPA 4C48A 1FK9A 1IBMF 3UN2A 2HEKA 4F8RA 5GADI 3PRVA 5GAGI 3M9NB 3MECB 3M05A 4O0IA 1C4AA 2VONA 2WOMB 1HBUA 4MIAA 5F41A 4N7TA 3G8SA 4C7QA 2FLNA 3PX4A 4FKXA 2PMHA 3ITHA 1RWPB 1RAGB 3OD2A 1X0FA 1VQSA 3GIRA 2C2MB 3PW4A 1WG5A 1YQHA 2HNYA 4PXBA 2OMOA 4B9MA 1VGYA 2D1CA 1S1UA 4QWBA 3TZWA 3NOCA 1B3TA 3DLLQ 2UP1A 1TV6A 1HQUA 2F8MA 2RQCA 4TVAB 3IC1A 4OHVA 3BM7A 4ZHRB 4NOHA 2QYCA 2HRUA 2VF3A 3I87A 2JRSA 1WOOA 2J0WA 2MJNA 3EJMA 4N77A 1RWMB 1FVSA 3OFEA 4ZPDA 4K8RA 2WONB 4IQXA 1YRUA 1RA6A 2L9DA 3CCTA 2HHHF 4LBPA 3FCWA 1IUJA 3MMAB 4YQWA 4MK9A 3V81B 4E0DA 2NR0A 4ZVFA 1FE0A 1TKXA 2P2CB 2YNGA 3AB2B 3UD5A 3LP2A 3R5AA 2DXDA 3IAS9 1NB7A 3A8JA 2J9EA 3KDNA 4M63A 2V9WA 1HNIB 4NXNJ 2BKNA 4O44B 1EETA 4QOTA 2XGQA 4KGMA 3NRBA 5FLXY 2KZZA 3W62A 1QJHA 3HJFA 1HW9A 1KKHA 2LA6A 3MM5A 1FDAA 1RT3B 4A8XA 3CD5A 2D69A 4IH5A 3V6KA 2VPYB 3H8YA 4GVBB 3W5ZA 3BGOP 3F0NA 3W61A 3EUNA 4UUXA 2RRBA 3D1OA 4OYIA 5KG3A 3UW1A 3N28A 5T7LB 3BPSP 2OGUA 1B7FA 1OWXA 1RJJA 1E6YA 2KT5A 3SSRA 3I9ZA 4O4GA 1RYSA 4YB5A 4NLPA 2ZHBA 1IBMJ 4NMXA 2BR0A 3K7RA 1J2VA 3RYLA 5EHHA 4Q8EA 3G6VA 2W2PP 3O6QA 4KC5A 4K5SA 3QGHA 3OR1A 2V4QA 1WTFA 4WXOA 1U1NA 2MKCA 3DLJA 3J81Y 2HQIA 1PBAA 2LQJA 4TQRA 1TKTB 5DDPC 1UP1A 4KKOB 1YJTA 1WF1A 1HQEB 3HHDA 2MEWA 2U2FA 1ZM2A 4X65F 2GIFA 1RUSA 4PEOA 1Q16B 1FNXH 1CJVA 3P3DA 4J9NA 4NE9C 4UW2A 2KM8B 4OX6A 1I1GA 1HIYA 2LU2A 2MY7A 4P2XA 4OYXA 4EO8A 3IP0A 1S72S 2O5DA 4FF1A 2VKRA 1RP5A 2GMHA 2PFDA 5ETNA 4RNNA 1H6KX 4YUDA 1GK8A 3LWLA 2WRMA 2YKAA 1NPPA 1UFKA 1VR6A 2OKQA 3DRYA 1F2GA 4LRFA 3KUGA 3I0RB 1OY6A 2ILZA 4LF1A 2CNNB 5AT1B 2UUAF 1Q1KA 2V34A 2HHHJ 2DR5A 1FKOB 2XSFA 1Z4UA 2UUCF 4IOAQ 1OSDA 1L3SA 4CP5A 4M5HA 3MTKA 4QYZK 2G2OA 3RRGA 4ER8A 2BACA 4HHUA 1H38A 4AL5A 3RG6A 1NKEA 3QMQA 4N56A 2MB0B 5CHCB 3BR9A 2DCUB 1RA7A 1T9UA 1RK8A 4OZ5A 2V2QA 1CJUA 3N4WA 4I6YA 3CD6S 2GIRA 2CQCA 3MCNA 1XK8A 2DXFA 2F4VF 1Q8KA 1VLOA 2VICA 1WEZA 3BO3A 4NLSA 2M5YA 4EYIB 1NJZA 3OLAA 1YVFA 1VK8A 4E8UA 3G6ES 2F4FA 2JOQA 2KO1A 1Q79A 2C2DA 1T3OA 4B9LA 3GE9A 1TL5A 1MN7A 3T5JA 1TK0A 2LDYA 2V68A 3L09A 4N47A 4I2PB 5T14A 1SUQA 2AYBA 4GC7A 1JKHA 2VA3A 1ROFA 3M8ZA 5CZXA 5AXMA 4NLXA 4QCLA 3NAHA 3Q24A 4AFFA 2VJUA 2E7XA 5A8WA 4ED2A 4DV0J 2W9BA 2KRRA 2DR8A 2DO4A 2ZZNA 4RW8A 4X65J 4D3HA 1UW9A 2UV8G 3T3FA 3WX4A 2KB2A 2AEJA 3LW5C 4ANEA 3ZTQA 3ZXWA 4QWDA 3JS9A 3OTDA 1S0VA 1JNZB 4IO9Q 2O01C 4U67Q 4JV5F 2RS8A 4F4XA 3W9JA 1FJEB 1UTAA 5EN1A 4L6V3 4F2RA 2AF6A 5KFZA 1U09A 3PACA 5F8NA 4X4VA 1WDTA 3RU0A 2KTQA 4TU9A 1JJHA 2IM0A 3I55S 3UNYA 4R25A 1SC6A 2QIFA 3FZ2A 4IRCA 2UUAJ 4C4WA 2YKNB 3LANA 4WK3A 2FPHX 3GILA 1VIOA 2GCFA 2GGPB 2UUCJ 3FMBA 2AEMA 1ACMB 2ILYA 1XJWB 1N52B 4Q44A 4LR7A 1HHSA 2DHGA 4U7UK 2VFVA 4OFZA 1T05A 4CLTA 3JQJA 3ADAC 2Y0SD 4YP3A 1S1WB 1R7IA 4PR6A 3KKFA 2W2OP 5EDWA 4O3PA 1EARA 3K5MA 3BQ2A 5L8RC 2JJ4D 2N82B 3N79A 1SCJB 3FSIA 1T95A 3HHLD 1MMNA 3BSCA 2VA2A 3W7BA 2YPZA 2R8HA 1SJ1A 3MD3A 2RMLA 8ATCB 1VS3A 1ZOTA 4Z7YA 4DPUA 1GXUA 3KHLA 1FWPA 2QJ3A 3C15B 3D6HB 1QAJA 2D9PA 2DGUA 2I0XA 1RT2B 3A13A 4K2JA 4QWCA 2UU9F 5C5JA 1TKDA 5F8GA 5THWA 4H54A 3G82B 3CO9A 2VB6A 3ETMA 2G0IA 2KXNB 2JLEA 2UUTA 3MPDA 2YNIA 4FYYB 1ZPWX 2Y1JA 2OIHA 3BO2A 4N41A 3BBFA 1TAUA 2HQGA 1KWMA 4JI2F 2HQFA 2AX1A 3PJ9A 4QQBA 2A6OA 3TO8A 3RBEA 3CCWA 4CZCA 3CJ5A 1S5ZA 3ELHA 3MPWA 3TANA 4OYBA 5C42A 5CYQB 1H7XA 4WBFA 1ZPVA 4G65A 1HBNA 3PHEA 4RW4A 1I94F 4Q8FA 2B56A 2V5HG 3MDFA 3K58A 4DL3A 3LGMA 2E1CA 3FSXA 2V4JB 3RB6A 1PYTA 4W4MA 4NASA 4JV5J 5KFVA 3T6JA 2MQNA 2VFUA 3R2CJ 3HZGA 1YKWA 2FJDB 3HK2A 2ATCB 3MCSA 2NREA 2ZJRQ 2NXEA 5A0YA 5H9EK 1V9OA 3KUEA 4HR2A 3H4DA 4I68A 1BQNB 2ZOGA 4FN5A 3TX8A 3SV3A 3Q8YA 4KFBB 4WCEQ 3CC4S 1HKAA 1C0UA 4CLKA 2N3LA 3R5DA 2ZWPA 3OXFA 2AGQA 3KHHA 5SUHA 4C0BA 4RW6B 3DRPB 5FJ4A 3IM8A 2GO8A 3V6DB 5ETLA 5T41A 1U2FA 1LV5A 4IYQA 1KNZA 1H2TZ 4DX5A 5CYMA 4A8OA 2PMZD 2ZOMA 1FESA 4CT9A 2V63A 2YBVA 3MR3A 3VF0B 1NK6A 3NMRA 2CPDA 5GADU 2HHUA 2QLFB 4OJ1A 1OO0B 2VDIA 5KG4A 3IRWP 2AD9A 2ZJQQ 4OYWA 5J2QB 3IGVA 3JSYA 2BE2B 1UVNA 4DUYF 3TWZA 3A3PB 1JWWA 1FFWB 4J9SA 1WG1A 3GLJA 4LRAA 5J2NB 4GKKF 4UOFA 5J2PA 5HMXA 4DL7A 1L3VA 2F8EX 3M1VB 2UU9J 4IFYA 2ZHAA 4DN9A 1YBTA 1X0PA 5AE2A 1OQ3A 5GAHU 4MK8A 2A0FB 1NM2A 2HG4A 2QGFB 2LFVA 1S1VB 2NCKL 3QBCA 2IJFA 2L3MA 1MNEA 3JTOA 1K9MT 4QZVB 2VZ9A 4JI2J 1NRKA 5EUHA 2NXJA 3HX9A 1Y11A 1F3FA 2IM2A 2PEHA 3IR6B 4DL0C 3C2PA 3SYZA 4PG4A 3VTIA 4CTAA 2FLPA 3PEHA 2VHGA 2Q66A 2XY6A 2R2UA 3TAMA 1I94J 1SL2A 2CPYA 1WJ9A 2RF2B 2POKA 5F3TA 3UDVA 3ZZ0A 3QNWB 4I1TA 4ED7A 1SXLA 4J9VA 2NZ4A 1SQEA 1DBDA 1SH3A 4JI4F 5KFOA 2BBEA 4ZIVA 2EFOA 1X4EA 4O4RA 4A4JA 3SEOA 1RAFB 4RNOA 3IWNC 1R0BG 3MEGA 4M5KA 3THPA 4NLQA 2R7SA 2R8KA 1EHWA 2RHSB 4YOEA 5HBMB 3K5LA 3EPIA 3Q22A 3DGPB 3HFKA 1WEXA 3KJVB 3CEDA 3ITHB 1NEEA 2K7JA 2FHOB 1R31A 5AE1A 4I2QA 5GMDA 1PJ5A 2IAJB 4F4ZA 4RO0A 5DQGA 1S1UB 1I6JA 4DR7F 1KQFB 4RLEA 3QRRA 3QIPA 2VBXA 3EDQB 1B0PA 1N56A 4L72B 2DNQA 4ID8A 4ZCLA 3Q2TC 2RUGA 1J5EF 1N6QA 4WU2A 4P2FA 3BV8A 4UZBA 4X4NA 2FGOA 5J2MA 2MLYA 3R8YA 4C3LA 5KOWA 2LQBA 5HL7Q 5KFFA 3KOAA 5GVQA 3PW5A 1TUWA 5DM7Q 2VBYA 4ECWA 2EBGA 1S1XB 3E8OA 2ACYA 2FTRA 1TMMA 2HQ3A 2ZKTA 3LWMA 2WSFC 3HT3A 2VOPA 4WE1A 4AL7A 4ATNA 3M4XA 3LP2B 2DK2A 3NBPA 2HFUA 3PJXA 4URSA 1QD1A 2DT9A 2HHSA 4USWA 3TQEA 1OMSA 1NJYA 1RT5A 4Y0FA 2JC0A 1GAOA 3FQKA 3A4TA 3RB3A 2Q6CA 1U8SA 2E9TA 4YR3A 4TY8A 4I64A 3OVBA 1LXNA 3IRXA 5ITHA 1Q0NA 4F50A 3SSSA 2OHDA 4YFUA 3GB0A 1W7WA 3TVZA 3BN4A 1RKJA 2AKWB 4BS2A 3W2WA 1Y5LB 1JNRB 1VQ4S 3TX0A 4B3SF 1GX6A 4RNFA 5MAOA 3ZTOA 4DQPA 4Y2CA 2BKOA 2GVDA 3PG9A 1J5OA 2GQQA 4QWAA 2KVQE 3IFEA 3QYYA 2P9CA 2DPJA 3CF5Q 4ZVHA 1K1QA 5HQMA 3ET6A 2ZEJA 1RTIA 2HPUA 3PX0A 3FCHA 4DZDA 3FBBA 3HO1A 1V6HA 5HLFA 4Y28C 3LA0A 4RBVA 2FJXA 4JI4J 2P8IA 3OR1B 4ZMMA 2DYAA 2FC9A 5E3QA 3QGIA 4A8KA 2ZD1A 1NZAA 4Q5VA 4G3IA 1LWFB 1YBUA 5ETQA 1HBOB 3OTCA 4TLRA 1P9YA 3I5BA 3M2VA 5CA5A 4DV4J 1FRKA 1T9XA 4IG0A 4KSEB 4WP9A 1BY9A 4ECVA 1FJ7A 3POTA 1B4SA 4K2XA 5F8LA 1CJVB 3PJWA 3TA2A 4V19J 3KHRA 5KT2A 3AA9A 4PXEA 4OI3A 4DR7J 4K4YA 2UVRA 4OHXA 2XYGB 1F5AA 3HI9A 4ZLJA 1N33F 4P72A 2GW8A 1TL7A 1SKRA 1LFWA 2XMUA 1NPRA 3RBXA 1J5EJ 3OQ2A 4CH1A 1V3RA 1GT8A 1WI6A 3CULA 2GS8A 2HSEB 4NLDA 4Y2IA 1WC6A 4F04B 2R3VA 2MLXA 1SJFA 1IKXA 1IKWA 2DNRA 5D4NA 1SV5B 4WYLA 3HM9A 4ZJQA 2HRYA 2B7CB 3QGPA 2HNDB 1B0VA 1T9VA 4MFBA 2UVUA 4LRCA 3OTOJ 5DGAA 1EKSA 1KR4A 1VBYA 2M8DB 1YJUA 1RE1B 2G1DA 1DJ0A 3FC9A 4QIVA 3DLGA 2O67A 1YX2A 4DR1F 1QDUB 2YNHA 5CAAA 2Y3YA 3CJSA 3IR7B 1VJWA 3K8WA 1DTQB 2R2SA 1LNQA 1CJUB 2JEGA 2XY7A 1OY9A 1WUUA 2M4MA 3A8EA 5FDLA 4KBIA 2W24A 2FGCA 2ZBCA 5CYJA 2F3JA 5B0FA 3QZ8A 1TU0B 3M8PA 1WF2A 2JC1A 2MKHA 4B3SJ 5ETRA 3LP0B 1A7GE 4WYWA 4C0OC 1YLXA 3HVTA 3KWMA 2GA7A 4RWXA 1RLDA 4HEA9 4WFZA 4NRTA 4ZVSB 4LFBF 3A12A 4H4OA 2R9LA 2J7WA 3MI7X 1TL4A 3CCQS 2HURA 4UTGA 2XY5A 2OLWA 4QU6A 2A10A 3BR8A 1SUQB 4P9SA 1JKHB 2RRNA 1RWOB 1M0SA 2J6UA 3TEHB 1Y5IB 2IMOA 2IRUA 5C25B 2AJ2A 3RB0A 5AE3A 3BSOA 1HW8A 2WVBA 3OL9A 4RW8B 3T6BA 3J7Z5 1Y0HA 3CJ2A 5AXKA 3ILJA 1P8GA 3BF4A 2DRBA 4LUBA 5DO2A 4WZMA 1BUXA 1GMUA 2GMJA 1L3KA 4KJIA 5L9XA 3GIMA 4C6AA 2WTFA 4ALZA 4TYAA 2CPJA 3KNGA 4YEAA 4RBTA 3NNHA 3L4BC 1P1LA 4LF4F 5LT5A 4ED1A 3MR7A 4C2MA 3MUMP 1N33J 4OZ3A 4FPIA 2JWNA 2RE1A 5D8HB 1TFWA 3WBZA 2XULA 1HYSA 2LU1A 1M1GA 5B0CA 2IM3A 3C6UA 4WP3A 3FBFA 1IJFB 2IM1A 4B9TA 1D0EA 4TXSA 3PFEA 3PV8A 2C3PA 5KT5A 2XSJA 1NJXA 3KLFA 3MFIA 3NS7B 4DR2J 3EE3A 1F1BB 2KN4A 2RDJA 3HHLC 1RKIA 4FDFA 3W1YC 3I4HX 4NZ6A 4J9MA 4MJKA 4LMZA 2OSRA 5KFBA 4ECYA 1T05B 4ITSA 4DR1J 3JTNA 5C2GA 5IV3A 5DM6Q 1X4GA 1YZ7A 3UI3A 2YX7A 4HI1A 4M94A 2ROPA 3UD3P 2X1AA 4TU8A 1MMLA 2V8HA 5MLCV 1U1OA 4KE5A 4RU2A 2W01A 2IVMA 4OQJA 3HHNB 3MXHP 4ZN1A 5U47A 2R42A 3KK3A 3VZHA 1VBKA 1IM4A 3A8KA 1VRTB 4GMKA 3I9V9 2JH3A 2VPWB 3MFHA 5E2QA 2W4CA 3MMCA 1KP6A 4CLPA 3O1LA 3ISND 1H73A 1RAAB 1ULRA 1TUGB 2QO3A 1E6VA 3LP1B 1Q81T 3OV7A 4CLLA 1XNQF 2XQCA 1S6UA 3ZZOA 4LFBJ 4EK2A 4J9UE 2HS0A 4Y3CA 3Q83A 4KO0A 2YNIB 2MKIA 5KFDA 4NLRA 2V9KA 2PIIA 3HT0A 3CJKB 4YB1P 1PKUA 3M2RA 2R7XA 1F9FA 4PAAA 2ZC3A 4K4SA 4JI7F 3VAGA 3BDEA 2VUGA 1XQIA 4C3KA 1U02A 3KLEB 2Y1RI 4F36A 1SI9A 3G6XA 1NLKL 4HI2A 4WIIA 2C1EB 1CJTB 1TZ0A 1IR2A 2FZCB 3ZZTA 4PQUA 3S1TA 4DL2A 1K73T 3GG1A 4EZ9A 2WZ1A 1RZMA 4I0WA 3L95X 4KH1B 4QYRA 1FXLA 3GJQB 1CULB 3KLGB 2K8GA 4LF5J 5A0YB 3N01A 4OI4A 3AFGA 4YS2A 2GAHC 2BXJA 3WIVA 2IA6A 4X66F 2RAQA 3JSMA 5IT9U 1NNDA 1HQ2A 2YX1A 4ICLB 3GR1A 4MYTA 4FVMA 1SKWA 1CLFA 2ZFHA 3M6XA 3UPFA 2RKIA 1R6VA 2QC3A 3OL8A 4DR4F 2CZ9A 2OFHX 2LQ8A 4CQ1A 1TKZB 1MROB 5D6GA 4EGLA 3P6YC 2UV8A 3R6GB 4DV2F 4RNHA 4C97A 1U2RA 1JB0C 2XTJP 5L38A 2DR9A 3SZ2A 3QSIA 5DLFA 2E9RX 5KT3A 3R7BB 1WHXA 4DCJB 2LXUA 3DOMA 3SBMA 5B0DA 1PIEA 4ZP8A 5B0GA 3TNVA 5F0WA 4X4TA 3L3CA 1UVKA 2F8HA 3PO4A 2PE8A 4YN3B 1QVGR 2G13A 3SDEB 4DSEA 8RUCA 4BBYA 2CPEA 5HN0A 4JI6J 3MMBA 2P9GA 1WKKA 3U7JA 4FF3A 1WC4A 4RUAA 1XNQJ 2XO6A 4BC9A 3QRPA 2GHPA 1S6OA 3G8QA 4ZA1A 3PEJA 4OYZA 5HROB 2OFGX 5L1IA 2BANA 4C8OA 1TVRA 4USUA 5DZ7A 1YGYA 4LR9A 4JI7J 2FC8A 2N7YA 2P6SA 4CTAB 1HR0F 4QIFA 5IS2A 2V8PA 3Q8SB 1HWLA 1VOMA 1RHKB 1DHMA 4X4QA 1JLGB 1TUVA 4ZP9A 4QR2A 4QPXA 1LWXA 1AZSA 1F3VA 4NYOA 4HDGA 2M52A 1WELA 1B7YB 2OP5A 1N5TA 3M8RA 1LWCA 4Y34A 3BBBA 2XMWA 2FJEB 2ALZA 1FRIA 4U96A 3IN5A 4OZLA 3BB5A 3PX6A 4RUHA 2ZVIA 1KTVA 4MIBA 5IV4A 4X66J 4IRDA 3T5KA 4I2QB 2M2BA 2K2PA 5CH7B 3CNQP 1RACB 1S0NA 2C2RA 2P5VA 1D9FA 4MH8A 3H7HB 2HLTA 2MZ1A 4N8NA 3QIPB 5LMUJ 1UAWA 2CWXA 3ICLA 2FQQB 4J9OA 4DR4J 3GFHA 4M5GA 5E3PA 3BO4A 4USJC 4ZPBA 3MEEA 4DX8H 4WFBQ 3RR8A 5J2MB 1NK7A 3NS5A 3CD7A 2HFNA 5HAOA 3BSAA 4Q2MA 3JAMU 2RSQA 1U1PA 4ES1A 4CDIA 3FRZA 4AUKA 3PYDA 4PCQA 5KFXA 2VQEF 5E3CA 5L46A 3AY0A 3FSYA 2QA4S 1GTHA 4DR6F 2OPPB 4IG3B 3EXCX 1L5UA 4I7FA 1RWKB 3NGTA 3LO3A 3K0JA 5LM7E 2RJZA 4F2SA 3I82A 3I5AA 2F7VA 4I4BA 1K44A 1S6PA 4TY8B 1T9WA 2IMWP 1SC3B 3B82A 4DCOB 1RU1A 1IJEB 3MF5A 1NK5A 1Q53A 4ZS6A 4DWIA 4URQU 4QWEA 4ZLPA 5CCMA 3A3NB 2CQHA 2B43A 2AHOB 4CM2A 4F4YA 2AIRB 4ZP6A 1X31C 4DV5F 4B3TF 3UE2A 3D3CJ 1VK3A 2DGQA 2GVDB 3ZZYA 1J5OB 2HMIA 3PY8A 4RW9A 2FJVA 1LWEB 1FTRA 4CWBA 1R89A 1HR0J 4IH6A 2GX8A 5D77A 4A8MP 3ET6B 5D0EA 1B64A 5D4OA 3A8IA 1FKPA 4X62F 3BZQA 3BYRA 2HIQA 1NJWA 2ZD1B 4EWTA 3TJAA 4QR1A 3RB4A 3OVAA 5B0EA 4LF9F 1D8ZA 2W9CB 2KVIA 1GMWD 3M2VB 2CNKB 3DRRB 3M6VA 2XG8A 2QFJA 5GMKa 4IG0B 2HNZA 4I67A 2BW7A 3PO5A 3W2VA 3POTB 1YBAA 4UQTA 1Q4RA 4L75A 3KK1A 2VFSA 4IDKA 2JHEA 1U48A 1OJ4A 4PKDB 1N0VC 1QTMA 2XMKA 1VRUA 3MR5A 2NPIA 5F3ZA 3W3SA 3OFGA 4ECXA 5K14A 3FEXB 5I42A 1TL7B 2OAUA 4RZRA 2MJUA 3NGKA 3CDAA 3SV4A 2IFXA 1HWKA 2CADA 3OSNA 4KGZB 3HXMA 3CJRA 3ENAA 4F02A 5LXYA 1KVKA 2FLOA 3TOQA 4HLBA 1VQ6S 3MAAA 1S6QA 1CJKA 2ALYB 4QR0A 1MU2B 3R5BA 2ZJPQ 3VZIA 2ZITA 4RKUC 3CB4A 1HNZF 2F5GA 5A2QY 1UVIA 2WVDA 1NPKA 1VC5A 1RHRB 5EWFA 2VQEJ 4NLOA 1NK0A 2C42A 2IBOA 4C8LA 4DR6J 1IM6A 1PG5B 1U4BA 1F5CA 3GR0A 4DSFA 5HMZA 1PO6A 4U6PA 1UKUA 3UN5A 4NLWA 2YKMB 5EX3A 2XS2A 2OPRA 2YNHB 3DMJA 3OHBA 1CC8A 3SIPB 3W5YA 9RUBA 2BDPA 1RT1A 2ZH3A 3MOJB 3DDKA 5LMNF 5RUBA 1JQGA 2JDJA 1LKZA 1U1QA 5B0AA 5FDLB 2MTLA 1NHUA 1FKAF 1UW4A 3M8PB 1CG2A 4CO5A 2OI2A 4B3TJ 3JSBA 1KQGB 3HVTB 3UCZP 4B3OB 3PYEA 4M8LA 1U6FA 5JUMA 2MGZA 3Q8QB 3JYTA 2CPIA 1FF2A 4O3RA 3LOUA 4F0KA 2FDNA 1KEKA 2G1HA 3M32A 2QRRA 1S79A 1RWNB 2J5AA 1U7LA 4H4OB 2DRDA 1NU4A 3MHYA 3J7ZT 2DY9A 1HNXF 1S9GB 3CCJS 2YTCA 2VIHA 1D9AA 3TA1A 5BYSA 4X62J 1PJ6A 1XEZA 3DRXA 3AJ1A 2R7WA 4B9NA 4LIWA 2PMWA 2QE5A 1I51B 4PUOB 4ED8A 4DBQA 1ZTTA 1VI7A 1IXKA 3AA8A 1U0HB 2B9YA 3OUYA 5M2RA 2NUUG 3NMAA 3S8SA 4Q0BA 4ECRA 3ONQA 4WIQA 3WIUA 2GJFA 3DOKA 1HI1A 2PGCA 1QM9A 2YNFB 4OZ1A 3OR2B 4KH0B 4ENOA 5C7PA 2MQPA 3D1HA 1OYEA 1FE4A 1R43A 2J0SD 5G4DA 3J7YI 3Q0AA 3H5YA 3P96A 3NXZA 2QSWA 3KK2A 1NH7A 2F63A 4QPTA 1UEUA 2FVSA 3VV2B 2KXFA 2YWEA 2YWHA 2QYGA 4ID5B 5LJ3Y 3KFWX 2AJFE 2XSJB 4OI6A 4A8WA 3CCLS 2H1YA 2E1MC 2LVWA 2FHMA 3KLFB 1H98A 4AL6A 3BYPA 2WVCA 3Q2SC 3MTJA 4ZOSA 5IQQA 1HNZJ 3BEGB 1M5SA 5ETOA 2BX6A 3QLHA 2ZHOA 1FEEA 2QA4G 3KLVA 4W92B 1X4AA 4NI2A 3NNCA 2YQ1A 4MAKA 5IT0A 3GCXP 2XHWA 3P49B 4DQRA 2CXEA 2GHVC 3ISNC 1PC4A 5KTQA 5H9FJ 2DCLA 2UXCJ 5E3RA 1W2BR 4WP8A 2MZRA 2L9NA 4KAIA 2DH7A 4I6AA 1VFJA 3QFWA 4J5OA 2CJAA 5KFHA 3HZEA 4JI0J 3TJ8A 2NUHA 1T9YA 2GAGC 5DDRC 2BA9A 5LMNJ 3PDNA 3RAQA 3G71S 1VQYA 4DV1F 2OPSB 2C3YA 5KG5A 4IR9A 1TK5A 3P45B 4CYUA 4DPTA 3D68A 2A2CA 4K4ZA 2I9SA 4PG6A 2EG1A 1Q78A 7FDRA 1SJQA 3QIDA 3VAIA 1VQ7S 2VH7A 2L41A 4EBCA 4FKYA 3D9BA 2RRAA 2DGTA 5EWEA 5KFWA 4OYAA 2V2VA 1DARA 3HFVA 2DHSA 4KO0B 5KT7A 2KG0A 1EQMA 2WW4A 1C4CA 3SXLA 1DLOA 1CC7A 4PWUA 3KJFB 1HWJA 1HBMB 4OYOA 3GFXA 2C22A 3UD4P 3UWTA 1KHVA 2YQ3A 1WDDA 3VQTA 3R97A 2EG2A 1JLFA 4FYWB 5C24A 4NXNF 2PFFB 2XMVA 1VQ8S 3ILLA 4UOGA 5D0GA 2UUBF 4FNHA 1RSCA 2DHXA 2C3OA 2E5JA 3CCZA 3BPDA 2W7PA 4NEZA 4D3GA 1BC6A 3CD0A 5KFJA 5CZVA 1RT4A 3CDBA 3G9CA 2J7KA 4NCAA 1B99A 1VC6A 3BGRA 3H25A 3AD8C 1O51A 2H5JB 3R1LA 1U49A 3K57A 1FRXA 4KHPJ 2KYXA 2VG6A 2R2RA 5FLXU 1Q8IA 2QL5B 1S7HA 3ISZA 2IRXA 5KG1A 1F9HA 3TRGA 3CJ0A 4ED4A 2Z2ZA 1RAIB 4RWWA 1UVJA 3CXCR 6AT1B 5DG7A 4XTTA 1EP4A 3JSMB 2O66A 1HWUA 2MYFA 2XYPB 4NYZA 1CQNA 1Z2LA 1X9SA 3K89A 2DY1A 1YRXA 3SFUA 2RKIB 3IWLA 5JVHQ 4DLGA 2U1AA 1IKVB 2EC0A 3O8WA 4HKQA 2I6WA 3FVYA 1MWQA 2V8VA 1K1SA 1S0MA 3SSQA 3MM6A 3HD1A 5G0RA 1REVA 4EFAC 2V50A 2FD2A 2V2KA 3NCRA 4R8UB 4QW9A 2JEIA 3WX8A 5HVGA 2DR7A 5HATA 3PYFA 1VYAA 1S59A 3I0SA 1FX4A 1T3NA 2QG9B 2H4WB 1PC5A 3J81U 3R27A 2XZTB 3L7PA 2WSEC 1GTEA 3DOMB 4NZ7A 3CIMA 3ILIA 4CLSA 3T1HF 2ZBIA 1XC9A 2LEBA 1YTYA 2XMAA 4A8FA 1Q7LB 4DV1J 4FBUA 2CA9A 2CJYB 2W2NP 1H74A 2VG5A 3F56A 1FJCA 3IS9A 5GMEA 1KFSA 2RDDA 4DQSA 2UXBF 2CJQA 5AXNA 3VGVA 3IG1B 3MMBB 4LR8A 5I4MA 1RAOA 3OJSA 4F0HA 2G9OA 2XMJA 3QJLA 2VODA 3OT9A 3F44A 2N4DA 3QJJA 1N8RT 4BCAA 1C1CA 4NXMF 5F8JA 2VV5A 1TELA 3CC7S 3GJSB 3HHLB 2VL1A 4CI0B 2J6SA 4JYAF 1N5YB 3J7A1 3NY0A 2GQ2A 3QWPA 1TVRB 3MECA 1KS2A 3EVWA 1OY8A 4P2SA 2E5IA 5BYRA 3M6WA 2N3OA 2HW3A 3D1QA 2UUBJ 3HSGA 2P6TA 1YZ6A 3KLHB 2ASLA 2ZE2B 4NLVA 3EGWB 5JXSA 4F3QA 4C8YA 3TA0A 3D0IE 2QN6B 4WZQA 1RCOB 1XERA 2HBQB 4EI2A 3EMTA 3EM1A 1SVDA 4LVNP 4OZJA 4B3MF 2PDAA 1S99A 1LWCB 1SC1B 5BJRA 1DTTB 4ZVRB 2IJRA 5HVFA 1SBRA 3D4JA 3VALA 3AOBA 3SCLE 4PG7A 1PGZA 4UZCA 1X4CA 4UQGA 2WONA 2XLJA 5FIIA 5L1LA 4TKTA 1TP7A 1D09B
chains in the Genus database with same CATH topology
1VBYA 2M8DB 2MKJA 1YJUA 4BC7A 1FRJA 2I2YA 2G1DA 5F9LA 1RT2A 2DRAA 3MMAA 4KPYA 1N54B 4RBUA 1DJ0A 4ICLA 4NYPA 1QSYA 2DPIA 4QIVA 3DLGA 2O67A 2VC1A 4IR1A 4CIOA 4DR1F 4PRFA 2JFDA 3MEEB 4R5PB 2WK4A 3MAQA 2ZH9A 1M5KC 4ECQA 2PN6A 3UDCA 5A6PA 3QPIA 4Y2KA 3KNAA 2YNHA 1GXTA 2FHKA 2RU9A 3VAJA 5KFNA 3AH6A 5IFMA 3T1AA 1RYRA 1X7VA 4DV0F 3CDUA 3IR7B 1TKZA 1VJWA 1MROA 1BLUA 5K8PA 3I4PA 1DFDA 4ZVGA 3K8WA 3CSKA 1DTQB 4JUZA 2R2SA 3T5HA 2V0NA 5L1KA 2R4FA 1P9QC 2CPFA 3BN7A 1C1BB 1R8PA 2M3DA 5KFGA 2APOA 1H2UX 4NWBA 3MR2A 2JEGA 2XY7A 2D3OR 1RT6B 1WACA 2M4MA 3K59A 1HD1A 2KRBA 3RAMA 1W2IA 3AHPA 4EO6A 4RU9A 2EFNA 3A8EA 5FDLA 2MY8A 4KBIA 3UR3C 2W24A 2FGCA 4LT6A 2B4VA 4NLTA 1ZBTA 3L7OA 4K4TA 2ZBCA 5CYJA 2F3JA 5B0FA 4ECZA 3QZ8A 3M8PA 2NS1B 4LSLB 2QV6A 4NLYA 1WF2A 2JC1A 3EYZA 3TP2A 2OSQA 4WFXA 3TAMB 2UXDF 1T7PA 4JV2A 2MKHA 2DISA 3MM8A 3LAMA 2DNZA 5KFMA 2RQKA 4I69A 3LP0B 4NCBA 3NWGA 2BYCA 1A7GE 2BUNA 3V2UC 4DR5F 4WYWA 4C0OC 4KTQA 3FFIB 2CPXA 2BOPA 3HVTA 5D4LA 3DU6A 3KWMA 1T03B 2MQOA 4URGA 4OX8A 3CMAS 2K1RB 2YH0A 5KT4A 2FVCA 2GA7A 4ECTA 4RWXA 4N8OA 2AX0A 4HEA9 3TVYA 4YHHF 2CQ3A 2EPIA 1JLCA 4WFZA 3DDNA 4Q7AA 3FMWA 3K5OA 1G3OA 3ULHA 1BD6A 2MSTA 4HHJA 3DOLB 3DN9A 1CQMA 2XI3A 2MQMA 2V4JA 3D28A 4NRTA 2EFQA 3CGIA 4JI8F 3UNGC 4LFBF 2B6AB 5T7LA 4NPOA 3MEGB 4H4OA 2R9LA 3UCGA 2JEJA 1DLOB 2CFXA 4EYHB 1DZ5A 1FD8A 1HD0A 1MMDA 2B4PA 4X4PA 1O8BA 2J7WA 3MI7X 1FXRA 4ILLA 1TL4A 5KFLA 3CCQS 2ERRA 1KQSR 3ZZPA 3NGDA 3SDEA 4TLQA 2XY5A 1U1LA 1UVMA 2OLWA 5KAKA 1UA1A 2HGLA 2R2TA 4QU6A 2KFZA 2R7TA 2A10A 5JJBA 2J8AA 2PA8D 2HWIA 3BR8A 4YR0A 1SUQB 4X4OA 2FVPA 4NMLA 1JKHB 2Q43A 4NL5A 2L48A 3GV5B 1HWIA 2RRNA 3M8QA 1AXQA 4FPRA 4C8NA 4DR3F 1M0SA 1JLFB 5C24B 1A6LA 2F9DA 2ZNYA 4ZVEA 4Z37A 2PD1A 2J6UA 1BQMA 2DBBA 4WFNQ 1Y5IB 3QAUA 2IMOA 2HZCA 2IRUA 2F9JA 1BQNA 2BJEA 5C25B 1HPZA 3KG1A 3RRHA 2W7OA 3RB0A 1QUPA 3NL0A 3M8SA 5K8NA 1RDRA 1BWEA 4F3MA 5AE3A 3KYLA 3BSOA 1HW8A 3OL9A 1S1TA 1S48A 2Q6BA 1RT4B 2CQ2A 4RW8B 3T6BA 3J7Z5 1Y0HA 1KN6A 3CJ2A 3B4DA 5AXKA 1VBXA 1JJ2R 4MIWA 2X1FA 3I5CA 5J1NA 4JI1F 2HVZA 2XZWA 1KONA 3T9NA 3BGRB 1P8GA 3BF4A 2CZVC 1TKTA 4RW6A 2VFTA 4RW9B 1L3UA 2DRBA 4LUBA 2MMYA 4M5DA 5DO2A 5KFEA 5KG2A 3B4MA 4X4RA 5HROA 4CH0S 5HO4A 3NAIA 1C0TA 4FP9A 4WZMA 1G2EA 4XPEA 2GMJA 3K2YA 2R7OA 4NRUA 1L3KA 3N6MA 4KJIA 5L9XA 1N6QB 3GIMA 2W4PA 2VG6B 3SQGB 1S77D 1U6BA 1RWUA 3V6DA 2QLXA 2WTFA 4ALZA 4TYAA 2CPJA 3KNGA 3VAHA 4YEAA 4RBTA 1HNVA 3NKYA 4OMFG 3NNHA 1ZZNA 1P1LA 4LF4F 2G0CA 2HFZA 5LT5A 1M5OC 4ED1A 1LK5A 4C2MA 4JBCA 3DFEA 1FKPB 1MSWD 3RAXA 4K4UA 1GXLA 3MUMP 4B3RF 2ASYA 1HFEL 1WG4A 2ZH1A 4DJBA 2JWNA 2OPQB 1NK8A 2RE1A 1JLGA 3H59A 2DIVA 4AYBD 3OJUA 3MEDB 2BABA 3JTPA 4DS5A 1EP4B 1XWLA 5CQGA 1CVJA 5D8HB 3KLIA 1TFWA 1X9MA 4H4MA 2AJ0A 3WBZA 2XULA 4J9LA 1HYSA 3PIOQ 2LU1A 5IWAF 5B0CA 4JI3F 2IM3A 3C6UA 2CJKA 1IJFB 1YJ9S 4WE1B 2IM1A 1YG0A 1G1XA 4B9TA 4IFVA 3SI8A 1D0EA 3WDOA 4TXSA 3BGFA 2OO4A 4DV6F 2V94A 3PFEA 3PV8A 2C3PA 2CZ4A 1UJ4A 5KT5A 1UWBA 3MM7B 1TQLA 1UFLA 1GQEA 2IBKA 2R7UA 1RTDA 1U1MA 2KYZA 1X5SA 2DTJA 3DYAB 2HNZB 2XSJA 1LW0B 1TL1B 1QY7A 1XR6A 3NBPB 1SH2A 4CO4A 4LFAF 1NJXA 3KLFA 5J2QA 1KFDA 2VG7A 3MFIA 2ZH5A 2WSCC 1VMBA 2SXLA 5J1PA 3QJPA 1DQAA 4WJBA 1RT5B 2KN4A 5B7WA 3V4IA 1ZH5A 2A1BA 2OD4A 3HHLC 2RDJA 5B09A 1RKIA 3I4HX 1UETA 3LAKA 3NG8A 4NZ6A 3I32A 3KG0A 1IN0A 2XEXA 4ZCIA 5KFYA 1RT7A 4OJHA 4J9MA 3PVXA 4MJKA 4LMZA 2MDAA 3X1LB 4TY9A 3I0SB 2OSRA 1GX5A 4DG1B 2DNHA 3OL6A 5KFBA 4LSNA 4B9SA 3GWCA 3IRXB 4ECYA 1P1TA 1T05B 4ITSA 5F9NA 2KZMA 3BQ1A 2AJ1A 2CQ0A 3JTNA 4EBDA 2DNKA 5KFRA 4OZNA 1X4GA 1DQ8A 5DM6Q 2A18A 1XTZA 2I38A 1L3TA 2XS7A 1WHVA 2GJ2A 4OJ3A 3UI3A 1R8CA 2JL9A 1XR7A 2ROPA 2YX7A 3DM2A 4HI1A 4B08A 2X1AA 3CUNA 3UD3P 4M94A 1ZZFA 5IT4A 4TU8A 1MMLA 3SCJE 2V8HA 3W2WB 3R5CA 2EKYA 4LJMA 2MZSA 5MLCV 1HI0P 2FHJA 1U1OA 1DAXA 4HDHA 4KE5A 1IQTA 4RU2A 2ADBA 2DNMA 3Q8RB 3WC0A 3E2EA 2IVMA 3G96A 3IA0A 4OQJA 2XLIA 3HHNB 3E01B 2FY1A 3MXHP 1DQ9A 5U47A 4HT7A 1KQKA 5HP1A 3KK3A 3VZHA 1VIXA 3HLUA 4J9PA 2C28A 2B9XA 5DDQC 1IM4A 2JVRA 2Q79A 1UJ6A 3IS9B 1YHQS 1RTHB 3GV8B 1VRTB 4PWDB 1YJRA 3O5TB 4GMKA 3I9V9 4KT0C 4F4KA 2AP6A 2CYYA 2CDQA 3K8VA 2CQPA 4HL9A 2JH3A 2VPWB 3PIPQ 2VPZB 2XCPA 3MFHA 5F8IA 5E2QA 1SIZA 4OHYA 6FD1A 1RTIB 2W4CA 2AQ4A 3ENWA 3MMCA 1R0AA 3BS9A 3O1LA 3ISND 3TQ1A 3AJ2A 4AQYF 3ZZUA 4HTIA 4AXIA 2CVEA 5EX0A 4WXWA 2EK6A 4C98A 3V4MA 5HLFB 4FXDA 5LL6d 1ULRA 1RTJB 1LK7A 1FK9A 1IBMF 3N0VA 4CCHA 2QO3A 3SCKE 1E6VA 3LP1B 1Q81T 4F8RA 4LF6F 4QIEA 2OPPA 3OV7A 4IG3A 5GADI 1XNQF 1NK4A 1S6UA 4G1QA 2XS5A 3ZZOA 1SL1A 2XNRA 3DMJB 2Y1IA 2HS0A 4KHMA 4Y3CA 1GNKA 1RT1B 4KO0A 3H5XA 5GAGI 1QAIA 2EK1A 2RU3A 3M9NB 2YNIB 2MKIA 4HH0A 2X1BA 1X4BA 3MECB 4M1KA 3M05A 1LQ9A 5KFDA 4J37A 2DNOA 4O0IA 1C4AA 1ZM3A 1YI2S 2KT3A 1KLNA 4NLRA 2VONA 2V9KA 2PIIA 2WOMB 3MM9A 3OLBA 3DLBA 3CJKB 2WBMA 4DHVA 1HBUA 5DRKA 4YB1P 4MIAA 5F41A 3QZ7A 1RAJA 1X4DA 3CJ3A 1JXLA 3PKMA 3M2RA 3PNIA 3G8SA 4C7QA 2FLNA 3N5FA 2R7XA 2GJIA 1F9FA 4A8YA 3PX4A 3TAQA 2PMHA 3ITHA 2M88A 2NSCA 4ES2A 1X0FA 3J7YU 3NCQA 2ZC3A 4ILRA 1VQSA 4GO7X 4K4SA 4JI7F 3NP5A 2BJDA 3BREA 3BDEA 3VAGA 2VUGA 3PW4A 5D3GA 4C3KA 5CD4H 1VQPS 1WG5A 1SJ4P 3KLEB 2Y1RI 1YQHA 2HNYA 4PXBA 2OMOA 4B9MA 2W8KA 1VGYA 5EWGA 2R8GA 4OI2A 1S9EA 1S1UA 2D1CA 4DQIA 2RVJA 4QWBA 1SI9A 2FJBB 2XWYA 3H2LA 3G6XA 4XK8C 2LEAA 4HI2A 1U1KA 1NO8A 3DC2A 3DLLQ 4JV1A 4WIIA 3ZZZA 2UP1A 1TV6A 2QZ8A 1S97A 1HQUA 2V8GA 4UY85 2F8MA 1ZTWA 1JLBA 3HDSA 5DLGA 4DN0A 2RQCA 3M32B 5F8MA 2KFYA 3CC2S 3IC1A 1U1RA 1TZ0A 2E44A 4IRKA 4OHVA 1JLAB 1KC8T 2WB4A 3CE8A 3BM7A 4ZHRB 4NOHA 4IOCQ 3ZZTA 1R3NA 4PQUA 1LWEA 3S1TA 2QYCA 4M95A 1BQXA 3V5RA 2HRUA 4DL2A 5KG0A 1K73T 3GG1A 4EZ9A 2I5JB 1KSPA 3I87A 1IKXB 2JRSA 1IKWB 5M2PA 4I0WA 4CO1A 2J0WA 3L95X 2AW0A 2MJNA 4QYRA 1FXLA 2F40A 2HVIA 4N77A 4NCGB 5D4PA 1FVSA 3KLGB 2K8GA 3OFEA 3RW7A 3OBIA 5A0YB 1T8EA 3N01A 4OI4A 3GV7B 2KT2A 3QO9A 4ZPDA 2WONB 2BXJA 4IQXA 2IHR1 1YRUA 1RA6A 2IA6A 4MFBB 4KR0B 4X66F 3JSMA 3IGNA 4TYBA 1HI8A 4DL4A 2L9DA 3CCTA 2HHHF 1G6BA 3FEZA 1IUJA 1NNDA 3MMAB 2YX1A 4YQWA 2WBRA 4ICLB 3GR1A 2UZAA 4MK9A 4MYTA 1F5BA 5K9FA 3CCSS 4FVMA 3V81B 1SKWA 4E0DA 2NR0A 2W9CA 1CLFA 4ZVFA 1MWZA 3F41A 3H98A 3MGJA 2ZFHA 3DLGB 3M6XA 3UPFA 3WC2A 1FE0A 2QA1A 1M5PC 1TKXA 2RKIA 3DRRA 2UXCF 3OL8A 2YNGA 3FRYA 3AB2B 4DR4F 2QMXA 3LP2A 3R5AA 1HL6A 2EWHA 3IAS9 3THVA 1NB7A 4ETXA 2J9EA 2M0GB 2OFHX 4M63A 2V9WA 1HNIB 2CPZA 1RQ0A 2DNPA 3GMGA 4CQ1A 4O44B 1TKZB 1MROB 5D6GA 4DV7F 1EETA 4EGLA 2J76E 2YH1A 4ERDA 3RZAA 4JI0F 3P6YC 2OMLA 3H5SA 2GGPA 2UV8A 4QOTA 2MSSA 2XGQA 4DV2F 4RNHA 4C97A 1U2RA 2DGWA 4O3QA 2QEXS 2BQRA 3U1NA 1JB0C 1JLEA 2XMTA 5GAEI 4XDDA 4KGMA 1FEHA 3NRBA 3PXGa 3MURP 5L38A 5FLXY 4OX9F 3OHAA 2DR9A 1FD2A 3SZ2A 2KZZA 2B5JA 1LW2A 4I6WA 5DLFA 2E9RX 1PSDA 5KT3A 4N76A 2AYGA 4IH7A 4U7CA 1WTBA 1WHXA 1QJHA 2LXUA 3DOMA 3O3LA 2COLA 4G1IA 3HJFA 3MM8B 1HW9A 2LA6A 2CQ4A 2PA3A 1FDAA 3MM5A 5KFKA 5B0BA 3GQCA 2J9DE 4HVZA 1RT3B 4A8XA 2FIUA 3CD5A 3DRSA 3CWJA 5B0DA 3LALA 5LXRA 4ZP8A 5B0GA 2WAQD 3TNVA 1VQ5S 5F0WA 3CVKA 4IH5A 4IKAA 4X4TA 3V6KA 2LYVA 1WEYA 1QE1A 2VPYB 3H8YA 3L3CA 4FS1A 4DF8A 1Y4ZB 1KLMA 1UVKA 2GMLA 2IYGA 3EUNA 4UUXA 2RRBA 1HNWF 2F8HA 3D1OA 3PO4A 1F60B 1JMTA 4WU3A 2JSXA 5KG3A 3QLHB 3UW1A 3N28A 5T7LB 3DXBA 2PE8A 1QVGR 3EGNA 4ZK7M 5B08A 4FYDA 1MU2A 1B7FA 1MWYA 1OWXA 4KRWA 1RJJA 1KTQA 1HMVB 2F1FA 1E6YA 2KT5A 2G13A 3IO1A 3SDEB 3SSRA 3I9ZA 4DSEA 3QGGA 3Q23A 4O4GA 2CPEA 4BBYA 5HN0A 3O44A 3MMBA 2X51A 3EXYA 3PR4A 2DNGA 2P9GA 2MHEA 4YB5A 1RYSA 2A3JA 3VWSA 4NLPA 2ZHBA 3HMJG 2R8JA 3U7JA 2BR0A 3K7RA 2FB0A 5BYQA 1M5VC 4FF3A 4RUAA 1J2VA 1BQMB 3RYLA 4BC9A 3OPKA 5EHHA 1NK9A 4Q8EA 2GHPA 3G6YA 4HH1A 1HPZB 3G6VA 2MZTA 3O6QA 4KC5A 4K5SA 4QIGA 3QGHA 1S6OA 3G8QA 3JSRA 3OR1A 2V4QA 3NS6A 4A8QA 1WTFA 4WXOA 3IXQA 2D7SA 2EVZA 2YKMA 3D2WA 1U1NA 1UFWA 2MKCA 1KVJA 3DLJA 3V6HA 3J81Y 2PI5A 5L1JA 3U27A 2HQIA 1Q7YT 3EGZA 2LQJA 4TQRA 4ZA1A 3CCUS 1TKTB 3PEJA 5DDPC 2KFNA 1UP1A 2X1GA 4KKOB 5HROB 2OFGX 1YJTA 1WF1A 5L1IA 2BANA