3LPEA

Crystal structure of spt4/5ngn heterodimer complex from methanococcus jannaschii
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
84
Chain Sequence
AHMIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative transcription antitermination protein nusG
publication title Spt4/5 stimulates transcription elongation through the RNA polymerase clamp coiled-coil motif.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 21
structure length 84
sequence length 84
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 3lpeA00
3P8BB 3QQCD 2XHCA 3H7HB 1NPPA 2LQ8A 4ZN1A 4ZN3A 1M1HA 2EXUA 2OUGA 3EWGA 1NPRA 3LPEA 1M1GA 2K06A 1NZ8A
chains in the Genus database with same CATH superfamily
2EW9A 3MEGB 2CPYA 3DNCA 4M95A 3HHNB 1RHMB 4H4KC 2R7WA 2O1PA 2QA1A 4MK8A 2W24A 4LF1A 2HGNA 5GVQA 1RTIB 2N7CA 3OJUA 3QJJA 1NXIA 3FEYB 2OFGX 4O0IA 3G82B 1MMLA 2BKNA 1IBMF 3OL6A 1X4HA 2OGUA 2BKPA 1VS3A 3VAJA 2LCWA 5KFNA 1SC4B 4P74A 3RBZA 4WFYA 1VQ6S 3ISZA 1X5TA 3KTQA 1XMBA 1GT8A 4QCLA 2HNZB 2DIVA 4P2FA 4ED7A 1GXUA 3LP0B 3CWJA 4IG0B 3GYNA 2ZH9A 1RSCA 1RTIA 4V19J 2VQFJ 2YKAA 3ZZRA 3W62A 4Z2XA 2IRUA 1NDKA 2HBRB 1PJ6A 4RBUA 1I94J 4FF1A 1B70B 5ETOA 2RE1A 3I4HX 3KUEA 2BR0A 4C8MA 1LW2B 4DPOA 4JI1F 1ZTWA 1UFLA 2EVZA 3JAMU 1RT2B 3QPIA 4K4VA 2HNZA 4LSZB 1S6OA 4URQU 2LXUA 1SJ1A 2B9EA 2WK4A 2EEYA 2ZNZA 3LGMA 4CLTA 1KVKA 2OPQB 2XY7A 3R9LA 1HA1A 1JJCB 2FJEB 1YQHA 3U1NA 2JX2A 3TAQA 3IGVA 4WIQA 2G2ZA 2CQ2A 4ZVUB 1FE0A 3DC2A 4X65J 3PIPQ 2MZJA 1LW2A 4K8RA 3N28A 4I67A 3H5YA 2XYPB 4KQZA 1RA7A 5M2UA 1JLCA 2F8HA 4DR6J 1VHFA 3CJKB 2AYMA 4FXWA 2B9WA 1PYOB 4QR0A 3T41A 1JIHA 2E1MC 3JTOA 2KFZA 1SKRA 2APOA 2PEHA 1JJ2R 2E5HA 4OLPA 2OPQA 4DJBA 2ZH6A 3G6VA 3SDEB 2FHOB 2KZZA 3HSJA 1FF2A 4IFYA 4R5PB 4U9RA 5KFBA 1DFDA 1CJTB 1V5IB 5HVGA 4DQIA 1KWMA 3CCVS 2Z2YB 2ZJPQ 3AD9C 2BDPA 2F3JA 1UJ5A 3FBFA 4R8UB 1B7FA 2RDIA 1RAOA 2OIHA 3DMJB 2OEMA 3CJKA 3MCOA 2BJ1A 2RRNA 3Q86A 1VQSA 3HDSA 1HQ2A 3DDNA 2AEFA 4I7FB 5ETNA 2MPUA 2BANB 1PC4A 2XULA 5DM6Q 2M70A 1NSPA 4ILRA 1YJWS 3SDEA 5LMNJ 1Q82T 3H2LA 2DY9A 1CJTA 2E7XA 2E5LJ 2J7UA 4CT8A 4P71A 3QBCA 3I9V9 1NZAA 3G6ES 2M3DA 1C0UB 4R8UA 2R7TA 2R8GA 2XCPA 3OTEA 4O3QA 2XMKA 5LXYA 3DMJA 1HBMB 4RJVA 4LFBF 1FVQA 4ZVTB 3G8TA 1F2HA 2B6AA 1EKSA 2OEJA 1FJEB 1RWUA 4M63A 4I2PB 2KXFA 3BH6B 4FPRA 3C8YA 3K17A 2YVSA 4ECVA 1KTQA 1T8EA 2IRXA 4I7FA 3W64A 2H48B 2BANA 2DCLA 1R8CA 3GG0A 4DR5F 4LF4J 2W9AA 4HTIA 3DRSB 3BR8A 3M05A 3MR5A 3T19A 2JEIA 2C2DA 2MKKA 1NSKL 4JOUA 3R6LB 2HHHF 2W9CA 1WC5A 2P8IA 1N88A 2VICA 1HBMA 4KY3A 4X4UA 2KXHA 3H40A 3IFEA 2D74B 1WC4A 4PG6A 3JTPA 4I2PA 1QD1A 1FEHA 2AQ4A 3EX7B 1X31C 3DLGB 2XC9A 3QT7A 3UO0A 3QT8A 2D9OA 2VOPA 2HQDA 1JNRB 1UVNA 4DU7A 4GKJJ 2AZ3A 1VISA 1FDDA 5BYQA 3QRQA 2QLWA 3QGPA 5LMUF 3DRSA 1VIXA 5F8JA 2B3TB 5CXTA 1JK9B 5DDPC 4JI8F 1G3OA 1PYSB 4HTJA 2E9TA 2GIRA 4I1TA 2IHR1 3GQCA 3DXSX 4QYRA 2FJWA 2HQ3A 2BW7A 4XO0A 1VQPS 5EN1A 3TW0A 2V4JB 1VQ4S 3CCZA 1BWVA 2I9SA 2ACYA 4ECQA 3DLGA 2C3YA 3RUBL 1Y11A 3KFWX 5ETPA 3ENVA 2KG0A 1RWKB 1HBNB 1ZPWX 4UF4A 2V8GA 5LJ5Y 2WVBA 1YBAA 1X60A 4ECWA 3GYXB 2JLFA 2JZ5A 2EFGA 1VQ8S 4RO0A 3BSOA 2VD3A 5HQLA 1YJTA 2BRLA 1FRKA 3D2WA 1NO8A 5BYSA 4J9OA 4TQSA 1OIAA 2W2OP 3M6VA 4F36A 4ZLJA 3POTB 4F4WA 5KFLA 2QFJA 2V4JA 1FRMA 2IRYA 1RU1A 4OJ3A 3FZ2A 4NRTA 4ES3A 3DLHA 2VQFF 4X2BA 3UR3C 4DR2J 4JP8A 3T5JA 4WZQA 2E1AA 1HI8A 1I94F 3JSBA 3KK3B 3TAPA 4M5LA 1SQGA 1WACA 2KN4A 2FZCB 2ZHOA 4A4JA 4G1PA 3NY0A 1KOHA 3WC2A 3H5SA 2WHOA 1CEZA 5C25B 2KRBA 5E3AA 4JI7J 1WNEA 1DAXA 1BGXT 3HFZB 2D9PA 4TNOA 2E29A 1FO1A 3HHLD 3TX8A 5AE3A 5KFWA 2FHJA 1H38A 1NJYA 3KJFB 3J81U 2VG6B 4J9PA 1GFWB 4LF9J 1KR4A 4TN2A 3Q2SC 2HBZB 2J8AA 3H2UB 4A46A 3KK3A 3DM2B 1X4AA 3B4MA 2BQUA 2IDLA 2A6MA 2RQKA 4C0BA 3SCKE 1U25A 4X65F 2DNHA 5C25A 2BJ3A 5IT9Y 2DHHA 3W65A 2JC0A 2N82B 3ILOA 4DR6F 4ELUA 4Y65A 1ZZNA 2G1DA 4EU0A 4QOTA 2Z8QA 3RAXA 2AW0A 1FRLA 2CA9A 3LOUA 1NLKL 2JDJA 2VG6A 5IM0B 3QQCD 3NXZA 3J81Y 5FLXU 2VODA 3NOGA 4DPTA 1HNWJ 2HFSA 3K5LA 4DQRA 3DM2A 4F04B 2FLOA 1KTVA 2GGPB 2HVDA 2DGVA 2C3OA 5K5MA 2D41A 1FWKA 2H65B 1M5HA 4Y0FA 2A18A 2O67A 2XEXA 2YQ0A 2QN6B 3NGRA 1L3VA 1P9QC 2KYXA 5IM0A 1MMDA 3UNGC 3ZZYA 5LMNF 5GAEU 1OWXA 4M5GA 2MZ1A 1YJUA 3K5MA 3J81j 4NLVA 1TL1B 2E5LF 3OPKA 2GGPA 1D09B 2XSJA 2EFQA 1S6UA 2FDNA 1FJCA 1G4CA 4B9NA 1FWPA 4DCOB 1YK9A 2QZ8A 4MKYA 2IM3A 4DS5A 3QO9B 3KHHA 3SZ2A 4PXBA 3KHGA 3CDWA 3QMQA 2OH2A 2JVOA 2BKOA 4HACA 2E5JA 5DDOC 3KMSA 1NBEB 2ZITA 3PW2A 4LF4F 1MLAA 3EM1A 3MM7A 4P72A 2VOOA 5KG2A 2HGMA 3ZFVA 1SJRA 3CF5Q 2MKYA 1ZYQA 1UMJA 3CMES 1WKKA 5HMZA 2CPZA 2BOPA 1NHUA 4USVA 1FA0A 2ZH4A 3K7RA 1TKXB 1SKUB 2CPFA 1YBTA 2B43A 3CCTA 1YWXA 1YX2A 1T9YA 2YQ1A 1U0SA 2GZOA 4P75A 4GO7X 4NCBA 2KB2A 2QC3A 4ZCMA 3PR4A 1T7PA 1RT4B 2AX0A 5EUHA 3W60A 5F9NA 1NPKA 4C3KA 1RWWB 3EPIA 4CH0S 4ECUA 5K20B 5CYQA 4GKJF 4IH5A 4O44B 3HD1A 3MTJA 4DSJA 3MMAB 2HRUA 5L46A 1T05B 4WTYA 4YY3J 3PKYA 2W7OA 2UZAA 1TKXA 3GFYA 3TUIC 5I3QA 1IJEB 1QDUB 2Z58B 2DXDA 1Q7YT 2W7PA 2OMLA 1RT4A 2HVIA 1CPZA 2U1AA 2AD9A 2VUGA 1NHVA 4WP3A 1CLFA 4ZVRB 3I87A 4LF6J 3A13A 2CWKA 2IVYA 4ZPVR 4O44A 3RAQA 3MMAA 1NK9A 2DY1A 1WEZA 3VAKA 1T05A 2F4VJ 2VF3A 4USWA 5HL7Q 2EK1A 2DH7A 3NBPB 4DPUA 3WHIA 2MQMA 3AFGA 4ZCIA 3V81B 1RT7B 2CNKB 2BABA 3HX9A 4FKYA 4N77A 3KDOA 3R3TA 2DJWA 4OI3A 1RTZA 1X4GA 4K4WA 3DYAB 4KKOB 4CCHA 4DR2F 3F56A 4PXCA 3K8WA 4W4MA 1S1VB 3PFEA 4F4YA 4FZVA 1RAGB 3AAWB 1X9WA 2MB0B 3AA9A 3D28A 2HBYB 3ZZUA 5HO4A 1F0XA 2XMWA 4HDGA 4ZP9A 4AT1B 2K8GA 4X66J 4JI7F 3NBPA 4KC5A 1YTYA 1N33J 4CLWA 5EWGA 1F5AA 4B9LA 1RT7A 2HQFA 3M6WA 1F1BB 1UP1A 2JEFA 2Q66A 3OUYB 2POKA 4MT1A 1BE4A 5DO2A 4A47A 1EP4B 1J5OB 4ID5B 1F6TA 2XQCA 5C7PA 3DYAA 3CNQP 4F02A 4KKOA 4LF9F 4DX6A 1WHVA 2AEJA 1DHMA 1S1VA 2XS2A 1UJ4A 4UW2A 4D3GA 1OPIA 3UR0A 3D4JA 2RS8A 1SC3B 4USTA 4N5SA 2PI4A 2YQ3A 2CVEA 2WRMA 2EPIA 4Q7AA 2Y9HA 2EFNA 3M8WA 2BUNA 1BQXA 1YKWA 1QVGR 3M7VA 4CLYA 5C2CA 3LGHA 3I32A 2DGTA 3NWRA 3J7AN 3OUYA 2GX8A 3V4IB 3PX0A 1WJ9A 1EP4A 7AT1B 4ID5A 1NZ8A 4N41A 2B4UA 1WG4A 3M8PB 2PT0A 4WBFA 1RLDA 1VCTA 1R89A 1O51A 3V6HA 1SL0A 3MUTP 3HSDA 3LUYA 2GHPA 1HNWF 3JS9A 4K0KJ 1B0TA 2MKSA 2PFFB 4OI1A 4NRUA 4AUKA 5KT2A 2MYFA 1KVIA 4TXSA 4KH1B 3G9CA 3EJMA 3WX8A 1UVLA 1EB0A 3IAM9 3AXMA 4AL7A 3J7YU 1HLWA 2IMOA 4DU8A 3V2UC 2YNFA 4HT5A 2BJ7A 3NGSA 3V4IA 4J9SA 1TR0A 4CTAB 4NLDA 2P5VA 3M8PA 4ZVQB 4TQRA 2FGCA 3OLBA 4C0HA 1KD1T 2XLJA 1OY6A 2OPRA 3S7RA 3NMRA 1K8AT 1S6QB 2EI5A 3SV4A 5B09A 3V5RA 4ILMA 4ITSA 1OSDA 3IRWP 5JXSA 4FYVB 4I2QA 1KFDA 3FRYA 4PG5A 2ZZTA 4JI2J 2RMLA 3FEZA 2M52A 3FCWA 4DSKA 5F0WA 1FXDA 2ERRA 3OVSA 1XIQA 4L76A 2JJ4D 4O3SA 3AD7C 1NH8A 1RAEB 1H2UX 2W9BB 3U02A 5ETTA 4ZCLA 1UPMB 2AT1B 3CD7A 2CQ4A 4B02A 3S1TA 4RL1A 1S6QA 4USHA 1RYRA 2VPWB 1GMWA 4BS2A 4DXLA 3L95X 1REGX 5L1IA 5A8WB 3HT0A 3D6MB 1RBLA 2LXFA 1YZ7A 2AZ1A 1FFWB 2XSFA 3WQPA 4JV1A 2AGPA 4Y2CA 3BEGB 2DH8A 4C0OC 3VV2B 5F8NA 3BGRB 3KLIB 3AB4B 3N5BA 2VFTA 5AXNA 1UVJA 3T9ZA 1RUSA 5KG3A 3PW4A 2W9BA 5K8PA 2ILYA 2HFNA 1WTBA 2LQ8A 3EGVA 3LP1B 5D0EA 2XNRA 2NUUG 2DNMA 2AIRB 3DU5A 4J7CA 3IMQJ 4PQUB 4YY3F 3N6LA 1TK5A 4ZIWA 2DR8A 1AROP 2CZ9A 1FKAF 1XJWB 1VRUB 3SSSA 4IR1A 4MKBA 5A8WA 1GTEA 1UW4A 3MPUB 1ZZFA 1HYSB 3QIPB 1OMSA 2KFNA 4ZLPA 2WTFA 3VQSA 2XYHB 5ITHA 3CCQS 3ZC4A 3BGRA 3KLIA 2Q43A 1TZ0A 3AOBA 5F8LA 2EG1A 3DN9A 5E41A 4NWBA 1URRA 2HAFA 1IM6A 3GE9A 4LF6F 1PG5B 2WAQD 5EWFA 4WU3A 1IR1A 3I0SA 1K9MT 1N0UA 3D54A 4USKA 2F4VF 3IA0A 3I82A 1M90T 4PQUA 2RKIB 1VRUA 9RUBA 4DBQA 4OZ2A 1HYSA 3QIPA 1KS2A 3LA0A 4WXOA 3OHBA 4FBUA 1FERA 3AOAA 4O4GB 1MN9A 3IR7B 5DG9A 1RTDB 3VTIA 4MAKA 3F0NA 1LW0B 2RD5C 4F4XA 4HDHA 2KL8A 1Y9OA 4WP9A 3FEXB 4U67Q 1WF2A 5HVHA 2P9GA 1TK0A 4CNZA 4LF2A 4EBCA 1D1UA 4F0KA 5AE2A 3U1MA 4X66F 5CD4H 1N33F 2RKIA 3UD4P 2YWHA 1SC6A 3E01A 5F8IA 1U49A 2UXCJ 2H51B 5B0FA 1NJXA 3TUZC 5K8OA 5CHCB 4Y2IA 2AJ0A 3NGTA 1HBUB 2PD1A 4RLEA 1AFIA 4O4GA 2AGOA 1G6BA 3MPWA 4H4KA 2FLLA 1X7VA 2CNNB 4ZPWR 2XY5A 2M9KA 4ZA1A 4OZ5A 2ALYB 4LIRA 2W4PA 2CJKA 3L7OA 3OTCA 2QMWA 3KXDA 2LDIA 4DWIA 1PAUB 5KT4A 1VBXA 4BCAA 3QWUA 3MMBB 2AV5A 2QE5A 5BYRA 3A4TA 3HLUA 1XR5A 1WF1A 3E8OA 2JHEA 4DOZA 2FY1A 3SQGB 4MYTA 1S79A 1XEZA 3MPDA 2AP6A 1H0HB 2Q3PA 1HBUA 4LF7J 2IC3B 4DL7A 3EDRB 2P9EA 5FDLB 4K0KF 2G0CA 1S0MA 2ADCA 1VRQC 1L3TA 5LM7E 3IM9A 4P6QA 3MHYA 3UFCX 4DV2J 1REVA 4NYZA 4ZJOA 1FJ7A 1RE1B 2GAGC 4ILLA 3FK4A 4G1IA 2C2MB 5DDRC 3S6EA 3MMBA 4M5MA 1YLXA 2QFIA 1MU2B 6FDRA 1BQMB 4QJVA 3SQGA 1PBAA 3QGIA 3OSNA 1BWEA 1KSPA 2IC3A 1I3OB 3J7A1 1URNA 3GPAA 2KI2A 5FDLA 1Q95G 2GQCA 3BZQA 3GFHA 4AD6A 4CLSA 1U1QA 5KG4A 1VMBA 4D3HA 4HHHA 3KK1B 2ACMA 4QR2A 4LT6A 3TX0A 1HI0P 2E5IA 2RAQA 3BR9A 5IQ6A 5KFCA 5IXUA 5IV4A 3R2DJ 3Q8SB 4B3TJ 4JI2F 3MR6A 2HRTA 1MU2A 1NUEA 5D0RA 4Y00A 1BQMA 2LVWA 5THWA 1VLYA 4BLGA 4IOAQ 1Y5NB 1QUPA 5GAGI 3MFHA 3OSPA 1AB8A 2M8HA 4NLGA 2CNLB 4ZLLA 3OT9A 4BC7A 2OSRA 3FFIB 4MKVA 4I6AA 3MZIA 3EDQB 3AA8A 4USIA 3HJVA 4DI6A 5RUBA 4DSEA 1YDLA 4HI2A 3TUJC 3KK1A 4IDKB 3EZUA 2YKOA 4P52A 2V4RA 1HQUB 2QYGA 1JLFA 3LQVA 3DLLQ 1KQKA 3LANA 1PJ5A 2LP4A 3I0RB 3G8QA 3ZNUA 3IS9B 3NKYA 2K1RB 1V5VA 2LU1A 1YITS 3EVMA 4YB1P 3M30B 2IA6A 2NCKL 1WC1A 2XGPA 2BM1A 2QA4S 4E0DA 6AT1B 1Q1KA 2BVZA 3FFIA 5D77A 2HFOA 3R5JB 3ENWA 1WDDA 1RT6B 1UJ6A 4IDKA 2MZTA 2LEAA 2DNKA 2YPYA 3HI9A 5DQGA 3KOAA 2HSEB 2KT3A 4ED3A 1VJQA 1RWOB 1HQUA 1PBUA 4OHYA 1RWPB 4AL6A 1GK8A 4MYUA 3RB3A 3I0RA 3IS9A 4DPXA 3TEGA 2K1RA 3LAKA 1Q0NA 4NXMJ 2WZ1A 3AD8C 3E51A 5A76A 1MG7A 2VB6A 3AHPA 4DUYJ 2IMWP 4IQXA 4Z37A 2XLIA 2JFDA 3R5GA 1FNOA 2M7SA 1HQEB 3DU6A 1RT6A 3WIUA 3ZZOA 3BSCA 3GV5B 2QL5B 2OKQA 3W9HA 5IS2A 4DQPA 2B4VA 3JSRA 4QWCA 4PXEA 3L4BC 4I6YA 4ZPDA 3Q8PB 1S76D 2LQ5A 2RJZA 3P45B 2F7VA 4OFZA 3PHTA 1NMEB 1CG2A 3IM8A 3FUYA 2IPOB 2XO6A 3T1YJ 4DL6A 4V1Ak 4DV7J 4CH7A 5T14A 2UUTA 4OX9J 4RW7B 1SKWA 2W01A 3DXBA 1RHRB 2M0GB 1HQEA 2BE9B 2I5JB 1YRUA 1ZA1B 3ZZZA 1KNZA 2DNOA 4EGLA 4DV4J 4CLZA 3UDEA 4F4ZA 2GO8A 4LBHA 2DNLA 2L08A 2IFXA 2UXCF 1RADB 3ILIA 2ILZA 4RPFA 3NRBA 2NUHA 3D6HB 2J9CA 1MSWD 3AB2B 4J9UE 5BR8J 5HMWA 2Y1RI 4DX5A 2ZHAA 4RBVA 2DD8S 3MR3A 4EK2A 1TFWA 1P1LA 3BDPA 2X1FA 1JLBB 4F2RA 2AMCB 4RW7A 4UOCA 4K4SA 4WJBA 4YOEA 5JVGQ 4QU7A 4DQQA 4DFJA 2VU5A 3NGUA 4QYZK 1CC7A 2I5JA 3W7BA 4M94A 1WWHA 4QWDA 4P7TA 4GC7A 1FRXA 2YX7A 5CYMB 1S72S 4DMZA 2GJFA 4PEOA 1M5VC 3MR7A 5ETMA 4LF7F 3US5A 2GO9A 1D3WA 4RWWA 2N4CA 2WVDA 4FXVA 4OX6A 3MMJA 2NS1B 2PFDA 4M5NA 3QJLA 3BSAA 3HF5A 3AQOA 4KGMA 4NXNJ 1JLBA 1WORA 4DV2F 5FIIA 1TV6B 2HS0A 3E3XA 1VQ7S 1IBLJ 5CYMA 3AT1B 4WXWA 1BY9A 2MQ8A 3ZZPA 2JNJA 3QLHB 5KTQA 5I3UA 1UPPA 3HSGA 1U8WA 4AL5A 1X5OA 1OQ6A 3DOMB 1N0VC 4OJHA 3JQJA 1KBRA 3ITHB 4PPDA 3M1VB 1M5SA 1PAEX 4ZVSB 1SV5B 2CQDA 2EG2A 1R6YA 1VRTB 4WKYA 4OZ1A 4JV2A 2XMTA 4IOBA 3THVA 1NK5A 3G6XA 1ACMB 2IIHA 4HEA9 1M5OC 1TV6A 5F9LA 3L7PA 2UVWA 2FY8A 2P6SA 3QLHA 4DN0A 3PNIA 2QX0A 1OYEA 2FVPA 2CKWA 4B3TF 3FRZA 3CSKA 3QSYB 4FYYB 1NHKL 3DOMA 1WI8A 3ITHA 5KFEA 3PRVA 4KV8B 1GQEA 5E3QA 2K7JA 1S1WB 1SV5A 2V9KA 2JEJA 4Y6IA 1A0OB 2XWXA 3J80U 4F67A 1VRTA 4A8SA 2AWZA 1LEOA 2HZAA 2Z0GA 4U7UK 1FI4A 4NX9A 3OXLA 2A3JA 1NDLA 2ZOMA 1VQYA 2XZWA 2LFVA 1S77D 2VFUA 1RT3B 1N54B 1DZ5A 2HW3A 1QAYA 1HD1A 1U2FA 2G4BA 2FUG9 5KFFA 1VHIA 2GV1A 5C2GA 2DTJA 1PSDA 1C4AA 5E5NA 5JJBA 4P2XA 3PRDA 4IO1A 4HT7A 2XCAA 3KLGA 1ZTTA 3SQOP 4KV8A 4OLOA 2GA7A 3FJ2A 4C8OA 2V8VA 1S1WA 3DLKB 3RR8A 3AY0A 3ILLA 1I6JA 3VAIA 3CJ4A 1RT1B 3X1LB 3RU0A 4WFNQ 5HVFA 3TQEA 4EBDA 1RT3A 4A8KA 3TR5A 3F73A 2P2CB 3I96A 1R31A 4ICLB 4USJC 3OXFA 3PW0A 1DTQB 3SBMA 4G65A 3MM5B 4QPTA 2D3ZA 1SL1A 3HK2A 5KFPA 5GADU 5EHHA 4NXMF 4ECXA 1DTTB 2VJUA 1X5SA 3DLKA 4DUYF 2BW2A 3HXMA 1TELA 2JFKA 1EX8A 2DR6A 2RB7A 1RT1A 2DR7A 1BQNA 1JQGA 4C11B 5CH7B 4Y2KA 2WW4A 1VBYA 1F9FA 3PM9A 2J0QD 3R2CJ 1NU4A 3GTYX 2XI2A 4F0HA 3OL8A 1UFWA 5J2PB 4ICLA 2QTWA 4A8XA 1DTQA 3UPFA 1CJKB 4ZP7A 2EC0A 2HKEA 3MM5A 3CJQA 3OFGA 4UUWA 5JUMA 3T1HJ 2XMMA 3G6YA 3NGDA 4K5SA 1DTTA 3MR2A 3T1YF 2VONA 2DISA 4ZMMA 1G1XA 4DV7F 2AJQA 4OX9F 4C11A 3B54A 4C2MA 3LALA 3BS9A 4ANCA 2RRBA 1OSCA 1L5UA 3EVWA 2E1RA 4L75A 4DV4F 5J2PA 2V0NA 3RG6A 2PN6A 2XS7A 1W26A 5DQHA 4C4WA 1U1RA 1CJKA 2CZVC 4IRCA 1FWLA 2B56A 3GSIA 3G8SA 2BBEA 4UY85 1Q7LB 5BR8F 4IQMA 4RW4B 3ULHA 4W92B 3CE8A 3ETMA 1D9AA 3BDEA 3KWMA 3LWLA 4RZRA 4F2SA 2N4DA 2IM1A 2VG5B 3M8SA 2DT9A 1LWEB 3SXLA 1NH7A 4ZVEA 4CO1A 4Y3CA 2CQGA 1GX5A 3G96A 2Y0SD 2GVZB 4OZNA 2QV6A 5C24B 1HWUA 1QAXA 2HFZA 4C8NA 5IOLA 2XG8A 1MROB 1R43A 4QIFA 1NK6A 1TL3B 4RW4A 4OIXA 2GIQA 4WFBQ 3PIOQ 1ZAVA 4PUOA 3T9NA 4NXNF 1RISA 4QWEA 3HD2A 2VG5A 3FKBA 4F3MA 5KAKA 1SQFA 3MPVA 3EGZA 1FESA 2UVUA 1HI1A 2XGQA 1IBLF 3IBWA 1YG0A 4NLXA 4Q45A 1EARA 4UZBA 3PG9A 2GVZA 1GEHA 4LR8A 2R7QA 4WYWA 5H1SV 2RHSB 3CD0A 3PACA 2OO4A 5C24A 4KO0B 3BKTA 2VKRA 5K8MA 1MROA 5BJRA 1UZHA 1SIZA 4NA1A 1TL3A 3RBXA 2C3MA 2NSCA 1UWAA 3PZPA 1Q79A 1LV5A 1S12A 3HHEA 1ZM4A 4ZVHA 1ZBTA 3CULA 5SUHA 2R7RA 1RACB 2FLNA 2ZZMA 3IXQA 2MTLA 2OLWA 2FJXA 4FF3A 2ZH3A 2N7YA 4OYOA 2F1FA 2P6TA 3VAMA 1EJ7L 3RB4A 2YKNB 1UKUA 1V6HA 3W5ZA 1Q4RA 4KO0A 2WOMB 1HWJA 5KFRA 5B0CA 3J7Z5 3X3UA 4K4ZA 5DRKA 2Q6CA 5B0EA 4C9DA 1TL5A 3GZ7A 1AT1B 1M0SA 1LXJA 2IM0A 4DV0J 4LIWA 3O44A 5DLGA 5KT6A 5ETKA 2X1BA 1MWYA 3JXOA 4DG1B 1H73A 2EWHA 3WIVA 2IBKA 2BQRA 3GR1A 3HHLC 2VPYB 2KU7A 2UV8A 4DUTA 1WHXA 1H2VZ 4PQAA 2YKNA 4MFBB 5D4NA 2WCXA 2WOMA 2R2RA 4EI2A 1C0TA 1DLOB 2LXIA 2HWHA 2ZKUA 2R8HA 4Y28C 3BN4A 4ZLNA 4A8MP 2C2EA 1F9HA 3MCSA 4DG1A 5HSPA 2F5GA 2VC1A 1Z2LA 2ZC4A 5AXLA 3NP5A 1QSYA 2J6SA 3IC1A 3PEHA 1M1GA 3NMAA 3QJPA 1C4CA 4JV5J 1NB7A 4Q44A 2YWEA 3Q0AA 5CABA 4HR2A 1W7WA 2KTQA 1U26A 2DEIA 2H9ZA 4MFBA 5KG1A 3T6BA 2NQPA 4X4RA 4OYWA 1CC8A 1DLOA 4L6V3 1XC9A 2JC1A 3TZXA 4CM2A 3MOJB 3W1YC 2IBOA 4DX7A 3BGFA 3G87A 2MLZA 4O4RA 1IWGA 2YBVA 5HMYA 2C2KB 2J7KA 4Q8FA 2XMAA 3WZ0A 2EBEA 1RHJB 2G9OA 3W5XA 1R8HA 1APSA 4RR5A 1A6LA 3T1HF 1T9VA 3Q8QB 1SH0A 5GAEI 2D7SA 1BLUA 2LQBA 2PGCA 1FX2A 5FD1A 3VGVA 2ASLA 5DZ6A 2G0IA 2LU2A 1SC1B 1VK3A 3BF4A 2M5YA 3T5KA 4DDFA 1WHWA 3BV8A 4NLWA 4ECZA 1RCXB 1OJ4A 5D15A 1MW7A 4X4OA 2GJ2A 2JH3A 2DR5A 3RGIA 6FD1A 1IJFB 2IYGA 5ETQA 3QZ7A 3UN5A 3H98A 2CPEA 3BO2A 5KG6A 3VZHA 5C42B 5J2MB 3VHQA 2QRRA 5F8GA 8RUCA 4A8QA 4WWSA 1FDNA 3BGUA 4LVNP 3AODA 3OTBA 1VK8A 4FKXA 1IKXB 4MTPA 5E2QA 4PABA 2R7VA 1XMQJ 2GMLA 2DVIA 3V6DB 2Z57B 3I5AA 2GHWA 3GFXA 3LO3A 2XO7A 3VCDA 3CEDA 2R42A 2A2CA 2C2RA 3ISNC 2XB2D 2OEKA 2OTJS 3Q2TC 5CCMA 2F9DA 3BQ0A 3D7SB 4NMLA 2FJDB 1JJ4A 3KNAA 2HEKA 4DR7J 4CM0A 2RHQB 3KMQA 5C42A 3FSIA 4KYZA 5J2MA 1LQ9A 2F8EX 2DHSA 3D0GE 4K50A 4PCQA 1PO6A 1FD2A 3O8WA 3DDKA 1JLCB 2DGUA 4OYAA 1IKXA 3NS7B 1OY8A 4DL4A 3V6DA 2BJ9A 1RWVB 3OVAA 3TJ9A 5IWAJ 5K9FA 1DQ8A 2DEJA 2R2UA 1M1KT 2LQJA 5DETA 4B3RJ 2BZ2A 1FNMA 1M1HA 3SCIE 4PG7A 2FTRA 5GAHU 5D0GA 2BJEA 1KDNA 4IFYB 3QNWB 2CPXA 2HAIA 3CJTA 4J90A 4KFBB 5F8HA 3BM7A 3VALA 4ECRA 1NM2A 2ZUGA 5LSLA 5HN0A 4F26A 4NLYA 1TKZB 4MIAA 3FMWA 1OYDA 2LKZA 3CCES 1VLOA 4C3LA 1FFGB 4L3NA 4ED0A 3TUPA 1WTFA 3JAMY 4KGKA 4PYDA 3GIJA 3HP6A 1KHVA 3CCWA 2ZBPA 4JUZA 3CUNA 4RU2A 1YI2S 3TAMB 2VL1A 2PI5A 1S57A 1U48A 2QA4G 5HJYA 4Z7CA 1EETB 1Y4ZB 3PO5A 1FKOB 4KFBA 5D4LA 1VC0A 4CQ1A 4YN3B 4P2MA 4ECYA 1CULB 1TKZA 5I4MA 1AUDA 4DV0F 2YXLA 4ZS6A 2WBRA 1KQGB 3PHEA 1YBUA 1B99A 2CRLA 4ERDA 4FYDA 2B6AB 4E98A 1RAFB 4OYIA 3Q22A 3QZ8A 1RLCL 2X7IA 2SXLA 3TAMA 4FDFA 2PIIA 4Q43A 4IKAA 3CCJS 4J9NA 4RW6B 3W9IA 1EETA 1FKOA 4RNMA 3UNYA 4X84A 1SH2A 2HHSA 1CULA 4NEZA 3PV8A 1FD8A 4ED2A 2W9CB 2X1GA 3EYZA 2VIHA 4RNNA 1I51B 2JL9A 2F63A 3CDAA 1YRXA 2D69A 4BBYA 1X9SA 1IBKJ 1NK8A 1IQZA 4JV5F 2J9EA 4WU2A 4WPAA 2CJBA 5B0GA 4RNFA 3SFUA 4URGA 2PA3A 1KLMB 1CBKA 4Q8EA 4RW6A 3GJRB 5KFHA 3TA0A 3O2IA 2H4YB 1KONA 2VA3A 5KFGA 4B3OB 1NAQA 1U1KA 4C3MA 3KLEA 2HIQA 3DOKB 4I68A 2BMBA 3J7YI 5KFYA 4DL3A 1YZ6A 5J1EB 1IR2A 4NI2A 1Y5LB 1Y00A 2DGOA 1HD0A 5HJXA 3R7NB 4ZJLA 1AYEA 2J7WA 1IBCB 3CCSS 3ZZ0A 3M2UB 4J9LA 1KQSR 1KLMA 1FHTA 4QIVA 2HZCA 2KHDA 2V68A 2VHGA 4LRBA 3GMGA 2V4QA 3C2PA 4B3OA 1IM4A 4EFAC 2KZMA 3DOKA 1XBWA 1ZS6A 3FMBA 3L3CA 3R6GB 1UA1A 4ZITA 4IH6A 3UCUP 4NZ6A 3HHDA 2LECA 1WSVA 5J1EA 1NKBA 5KFUA 4X4VA 3LWMA 2IM2A 4ZCKA 2ASJA 1TVRB 4XAKA 3PYFA 3MOZA 3O6QA 2LA4A 3EGNA 2WSFC 4WZMA 1T0TV 1HKAA 5HQ8A 1Y10A 2GNKA 3M2UA 2Q79A 4CI0B 3S8SA 1TU0B 4OJGA 5HAOA 3TQ1A 2KYZA 1S4EA 3UDLA 2DITA 3G71S 1XMQF 3QYYA 1B64A 1TMJA 1N8RT 1RAHB 1UEVA 3RR7A 2FLPA 1RAAB 3QGGA 2RF2B 4K2JA 1XWLA 3D5MA 4IYQA 1TVRA 4MJKA 2H54B 3RB6A 2A1BA 1S1TB 3D6FB 3DI6B 1HL6A 5KFTA 1HHSA 2QO3A 4BHQA 3H8YA 4DR7F 2QSFA 2YX4A 4ANDA 3PYDA 4H4MB 4DZ6A 3CDBA 5BXIA 1FRJA 1YJ7A 1TMMA 2MQOA 1UA0A 3MF5A 5B0DA 1KC8T 2XZTB 1NPRA 5IWAF 3ETOA 5MLCV 2CQBA 1FCAA 3W66A 2NZCA 1Z2ZA 4YS2A 4PWDB 4P2SA 4B3RF 4ETZA 2GS8A 3GJQB 2RF2A 4RW9B 2MKIA 2VBWA 3C66A 4DPWA 1S1TA 3DI6A 3T6JA 3I55S 2E9RX 3R5DA 4G1QB 5LL6d 5AT1B 4XPEA 2CPJA 2HPUA 2ZUAA 2DRBA 4H4MA 3MGJA 4J5OA 3RRKA 4KR0B 3TANA 2EFOA 1FRHA 3MCMA 1K44A 1VIOA 2AHOB 1OO0B 1EZZB 4EUVA 1VDHA 2R2TA 2BACA 1HWLA 4B3SJ 5D3GB 4YFUA 2IA0A 3TRGA 5A8RB 3HMJG 3M6UA 2HNYB 3ZTOA 4TLRA 2E9ZA 4PWDA 2AJ2A 2K06A 3NNAA 5D4OA 5KFVA 4RW9A 2C2ZB 4YDXA 3H42A 5KG5A 4X4QA 1WD6A 5F3ZA 3NAIA 1DY3A 3WC0A 3UCZP 2IVMA 2UV8G 5D6GA 4CO2A 5DM7Q 2YY3A 3BO3A 4DQSA 4G1QA 4B9TA 2V67A 2XSJB 1RTHB 2DPIA 4EWTA 1AW0A 2QJ3A 2IVFB 1IUJA 1LNQA 3PTWA 4GC6A 1RWMB 2LEPA 4CT9A 3THTA 2Z2ZA 1JXEA 4HL9A 4FVCA 5D3GA 2E44A 2HQIA 4HVZA 1OPZA 5A8RA 4PKDB 4HH0A 3MM6B 2YNGA 2KVIA 2HNYA 4HACB 2HS4A 2ROPA 1B4SA 1HWKA 4K4XA 1CS4B 1ZOTA 2EFPA 4F7VA 1H72C 5HLFA 1D9FA 3MM7B 1UVIA 3PX4A 2E66A 3AOCA 5HMXA 2JSXA 2ZKTA 3HM9A 1S9FA 5FLXY 2C42A 3I5CA 3K59A 2K2PA 1ZM9A 3A8IA 4PYAA 1FNXH 3JSMA 3FNNA 2B8QA 3HO1A 1RTHA 4LFCJ 1RAJA 1U47A 3HKWA 4CWBA 5CAAA 3MEDB 5D78A 5H9EJ 4ZIVA 4ALZA 3IBCB 5B0AA 4IG3B 1ICEB 4RU9A 3MM6A 1FFSB 2XBPA 1IBKF 2YWGA 4IRDA 1CS4A 3K0JA 1X8DA 1ZM2A 5CYQB 2CJQA 5F0UA 3DCAA 3GCXP 4CO5A 4O3OA 2BM0A 2MZQA 2OSQA 2FJBB 2VPZB 2VA2A 2BE7D 5LJ3Y 5GMDA 1S6PB 1F60B 2XS5A 1WKJA 2NYHA 3PRBA 1VBKA 5AJ3J 3CTRA 3MEDA 2IDEA 3LGNA 2FC8A 4IG3A 2OPPB 3ISND 4JI3J 4KIAA 4OI2A 2KKHA 2XM3A 5I42B 3RZAA 2VKZG 1RYSA 1WOOA 3TYTA 4UOGA 3NWGA 1PYTA 2G2YA 4E2FB 2Y3YA 3D6TB 4Y2MA 1H7XA 3IWNC 3R5BA 1FKPB 1TQLA 3MMCB 4KGZB 4XDCA 1S6PA 2B9XA 1U02A 3PW5A 1U8SA 3SCLE 1TK8A 2ZM6J 2BJDA 3I5BA 3FSXA 2OPPA 1YJRA 4J37A 5EGYA 2H5EA 5FJ4A 1IKVA 2B7BB 4TU8A 1UZDA 2MDAA 1MN7A 4NA3A 3NNHA 3Q8UA 2DNZA 5I42A 1JLGB 2Y0BB 4KGVB 4LF8J 4HHJA 4KRWA 4U6PA 2HVZA 2IJRA 2EBGA 1RT5B 4DL0C 3OLAA 5A6PA 3HFKA 2FHJD 4CO3A 3P6YC 3PXGa 1D0EA 1FKPA 3MMCA 3GSDA 3Q83A 1UVKA 4C97A 2CQ0A 4WTOB 2KRRA 2B5JB 1JXLA 3GYGA 4P73A 3DGPB 4U95A 4X4TA 3AJ1A 4TY8A 2GMHA 3D67A 2VDHA 3GIIA 5KFIA 2MHEA 2FZKB 3W61A 4QQBA 2B0GA 2XMUA 2F4FA 1JLGA 4MK9A 5IQQA 1KLNA 4NYPA 1RT5A 1NNDA 3QSIA 1RAIB 1ROFA 2B4PA 3G2XA 1BMQB 1DBDA 5ETSA 2R4FA 1K1SA 4HH1A 2LA6A 3HVTB 1IR0A 3CIZA 2B5JA 2WB1D 1LWCB 3DGPA 4AXJA 4U7UD 5D8HB 4ELTA 2E1PA 3PJWA 1OS5A 2DGQA 4LRCA 2ZZNA 2C2OB 3EUNA 4ZOSA 4Q2MA 1J5EJ 5HP1B 1FDAA 3D9BA 2W7AA 1WOPA 2Z2LA 4KSEB 3H5UA 2CIMA 4HKQA 2BYCA 3M4XA 4MIWA 3EWGA 2VH7A 2UUAJ 1S9GB 2DRDA 2JOQA 2HVEA 2V63A 4KPCA 1R0CB 3TP2A 4NLSA 3MTKA 3FDSA 3UQSA 2VBZA 3HVTA 4KH0B 1QLNA 2V2VA 3A12A 2BX6A 1LWCA 4B3SF 1ULRA 4ZHRA 2YNFB 1NB2A 3NCRA 4PPZA 1MNEA 8ATCB 2RRAA 3ELHA 4L3KA 5HP1A 3OVBA 3PJ9A 1K0VA 1U2CA 2MLYA 1AFJA 2OPRB 4EZ6A 5E3PA 2RVJA 1S9GA 1HFEL 2J8SA 3M8QB 2XI3A 3BJYA 3V6KA 4OJ1A 1GNKA 4NLTA 4ED6A 3Q8RB 3R7BB 3NEKA 3OHAA 4I2QB 2YPZA 1OQ3A 3G4SS 3D68A 5M2PA 1LWFB 3K5NA 4LRAA 3MEGA 3IP0A 3A8JA 2ZH7A 4RW8B 4NZ0A 1FTRA 2FC9A 3GG1A 2DNPA 1D8YA 1ELOA 3G82A 1FXRA 4LQ9A 2GIFA 3RRHA 3M8QA 5F8MA 1H74A 2FB0A 1YJVA 2HURA 5ADZA 4LFCF 3JYTB 2NLWA 2V50A 4YMEA 3GV7B 2LQ9A 2PO4A 3U7JA 1G7CB 4IUFA 1LWFA 4ELVA 1E6VB 1YGYA 1T11A 5B0BA 2XHCA 1KHWA 2I6WA 1B7YB 3GCWP 3LP0A 2J9DE 4IG0A 4RW8A 2ZDOA 1YRTA 2L9DA 3PCOB 2M8DB 2ATCB 4Y2AA 2Q6BA 1Q8BA 2EC2A 2VASA 5HBMB 2KXNB 3EE3A 3NS5A 3HFVA 1A9NB 5K8NA 5M2RA 4O0NA 5HQMA 2GCFA 1QUVA 5ETLA 2OUGA 3HHLB 4C8KA 4HI1A 4ER8A 3Q89A 2RU9A 3JYTA 1DQAA 2CJYB 5AJ3F 3FBEA 3KNGA 2XLKA 4LR9A 5KFXA 5KFMA 4F3OA 2CFXA 2UUWA 1RT2A 2D3UA 1E6VA 1Z4UA 4JI3F 1IKYB 3MCNA 1JLAB 2DBBA 3HHKA 3SV3A 2QIFA 3T3FA 4RWXA 3OXGA 5CYJA 1U45A 3D1QA 3P49B 1AZSB 1SIWB 5HBMA 4O3RA 1WG5A 1SI9A 3LW5C 4ZP6A 2ADBA 2J9DA 3I0SB 2ZWOA 3ZTSA 1Y7PA 2VC0A 3HHLA 3P4UB 4TVAB 1TL4A 2G0JA 2J0SD 1YHQS 1Q16B 3MM8B 1S1XB 1ZA2B 3UD3P 1F3FA 2R8IA 2CG4A 1JJHA 3GILA 2ZM6F 2NYIA 2ZD1B 5F41A 2J0WA 1KEKA 1IKYA 3N6NA 3QT5A 1JLAA 3MPYA 5IFMA 4OYPA 2UP1A 1W2IA 4LJMA 2UVRA 4N8OA 4DL2A 1AZSA 4N7TA 4LF8F 1K0TA 5KFZA 4CYUB 4CRJA 3QAEA 3M6XA 4MMOA 1FDBA 3OR2B 2WBMA 5A2QU 1N56A 4R5PA 1Q5YA 3P5BP 1HWIA 3IWLA 2DXEA 1NSAA 1R8AA 2OI2A 1IVZA 3MM8A 1S1XA 2RUSA 2YX1A 3SYZA 4C7QA 3E01B 1B0PA 3WX4A 2J76E 2ZD1A 3QFHA 3TJAA 3UDVA 3K5OA 3GIRA 1NEEA 3GONA 3VGSA 1AA1B 3CDEA 2EXUA 3DOLB 2O3DA 2V8HA 2ZH5A 1S0NA 2RSQA 5H9FK 4USUA 4N8NA 3CDUA 4CYUA 2C3PA 5LSOA 3JTNA 3OR2A 2DNYA 4KJIA 5A2QY 3MXHP 1LXNA 4PXDA 3TARA 2A6OA 4KHRA 2XNQA 5CD4A 1N5TA 3BBCA 4NEYA 5H9FJ 1C0UA 3R27A 4C8LA 3V6JA 2DH9A 1GMVA 3BGOP 4JYAJ 4TU7A 2QA2A 2DGWA 1J5EF 2BE2B 4OZ0A 3FSYA 2N3OA 4DR3J 3DOLA 2HHQA 3UN3A 2AF6A 1NJZA 5GADI 4DSIA 1WEXA 3OV7A 4FPIA 2UUAF 3I31A 3MECB 2CJ9A 1BXNA 2GMJA 3PY8A 5DLFA 1DARA 2VBYA 1REVB 2V8DA 3C6UB 1TUVA 1PKUA 1R0AB 1TFYA 3DRPB 1N32J 1CJUB 4OYBA 3IR5B 3LP2B 2NXNA 2MY8A 5KOWA 5JVHQ 4CLLA 4PG4A 2CQ1A 3R8YA 4OV1A 2BE2A 3KG4A 3M8YA 4K5RA 3Q24A 3ZZTA 3DRYA 2A10A 4ID8A 1Q5VA 4HLBA 2E7WA 2PEBA 3M2RB 5J1NA 3MECA 3GJSB 5KFKA 3H5XA 1L3SA 3C6UA 5T7LB 1R0AA 3DRPA 1CJUA 4ETXA 1S7HA 2LLZA 3LP2A 5L39A 3C46A 4ZVFA 3BREA 3DLJA 2AKWB 2K3KA 2HRYA 3AXKA 2R7SA 5HANA 1GMWD 1FXLA 1RWXB 1F9EB 3OFFA 1CQMA 2H1YA 1SQEA 2H5IB 3T1AA 4J9RA 3F41A 2V94A 3OTOJ 3ILJA 4LF5J 1BD6A 3KHRA 1N5YB 3M2RA 1HBNA 3EGWB 3SSQA 1LK5A 4OHZA 2CUYA 2W4CA 5IT9U 2QSWA 3MAAB 4GKKJ 5T7LA 1YVFA 3DKDA 1JLFB 3VR1A 1UWBB 5AE1A 2HK2A 1WELA 4DLGA 1VQ5S 1HHQA 4AXIA 3TO8A 4NZ7A 1HR0J 3IAS9 2DIUA 1ZPVA 3POTA 2UXBJ 2MY7A 4OI0A 2AEMA 1WI6A 4B9UA 1VQLS 1U4BA 1WC3A 1TL7B 4ZN1A 5KFAA 1N5YA 1A7GE 3KLFB 1MWZA 1IKWB 2BV3A 4OHWA 5DJBA 3K2YA 3MAAA 4M5IA 1F3VA 1V3SA 2MSTA 1C1CB 4NYOA 2GC8A 2CQHA 3B6BA 2FJAB 4ECSA 4OZ3A 1UWBA 4FP9A 1NSQA 1FRIA 4WIIA 1XTZA 5EX0A 1T3NA 5L1JA 2QMXA 9ATCB 4YB6A 3DDIA 4Q0BB 3DHWC 2GHVC 2C2NA 4OHXA 1YJ9S 1Y5IB 2ROEA 3TVKA 4F8RA 3OJSA 2L3MA 5L9XA 1TL7A 3KLFA 2GJIA 1LOUA 4ZDNA 1IKWA 2V2KA 4A8OA 2RQ4A 1U7LA 2F40A 2OP5A 1KP6A 3D1OA 4WK1A 4ZPAA 1HMVB 1C1CA 5K14B 4Y34A 1YIJS 2W2QP 4ZK7M 5KT7A 4YDDB 4V19X 3CD6S 4DFPA 1U0HB 2FZGB 5C5JA 4KAIA 2ALZA 2JVRA 2J0XA 2P9CA 2D3OR 3FZBA 4RUHA 1VGYA 4EO6A 3U1LA 4A8FA 4Q0BA 3W63A 1LWXA 4WCEQ 1HNIB 4AFFA 3DRXA 2YNIB 2YTCA 4IH7A 1RJJA 2DYAA 1NDPA 3ZNJ1 2DNQA 3KJNB 2UVVA 3PKMA 3SI8A 1NKEA 4TKTA 4FYXB 1WUUA 4F4KA 1HMVA 4LBPA 3W5YA 4XDDA 5K14A 3OR1B 3B8HA 2O01C 3VAGA 1PCAA 4KHMA 2W4DA 4RBTA 2IY5B 2C22A 1RCOB 2CQIA 2ZDPA 4J9KA 3K89A 1XK8A 1U0HA 3QWPA 5DS7A 5I3PA 4J9MA 5KFOA 5ETRA 3OL7A 4ES1A 2HZVA 1FEEA 1PC5A 2Y1LB 4J91A 2WB4A 2QLFB 4K4UA 1HIYA 1HNIA 3GFZA 5SZTA 2FQQB 4PZVA 4DUZJ 2YNIA 3CJSA 2X3DA 2FGOA 4G3IA 4DSLA 7FD1A 4CIOA 1V3ZA 1H7WA 1RDRA 1RHQB 4Z7YA 1TL1A 1O5JA 3BGLA 4I6WA 1VC6A 2ATLA 3L7UA 1NKCA 3OR1A 4X4NA 1KKHA 2JRSA 5LT5A 1XNRJ 1U1NA 4ZVGA 2MKCA 2AYBA 4JYAF 2B4OA 3QO9A 3BYRA 3CC4S 4CP5A 4YQWA 2AYGA 1CVJA 3PYGA 4QW9A 4DR3F 2NZ4A 3UW1A 3VGUA 3H25A 1V9OA 2I38A 2HQCA 1RABB 2VPXB 4L72B 1GXTA 1RGVA 3GU0A 4JBCA 4FF2A 4QZVB 2YWKA 2RS2A 1FE4A 1N32F 5I3UB 4URSA 3OBIA 2VQEJ 4QIEA 2ZJQQ 1NK0A 3W2VB 4LUBA 1UETA 3TWZA 1B3TA 1X9MA 1RB0A 4P9SA 4ZVOB 3ZTQA 2LDYA 2X1AA 1X0PA 4ZPTR 2MQQA 1T94A 3ENAA 4OYXA 5U47A 1R8PA 1SL2A 2HK3A 5CQGA 3NNCA 2L41A 1X4FA 2DPJA 5E3RA 3CJRA 3HCXA 2OD4A 4L74A 4C8YA 2ZH1A 1Q8LA 3UVJB 3DLEB 3B4DA 3HZGA 3TZZA 4KT0C 4ZKAA 4K59A 2KH9A 2H5JB 2GFFA 3BSNA 3CC2S 3GWCA 3SEOA 4M1KA 5KG0A 3W2VA 1PILA 3R5CA 3NCPA 1RXOB 2DO0A 1QJHA 2DCUB 1T03B 3OTOF 3C14B 2FVCA 2Z30B 4LF5F 1SBRA 4DCJB 1XR7A 2R8JA 2ASDA 4X62J 2XY6A 5J1PA 4GKKF 2MZRA 1QTNB 4LQ3A 3UVJA 3DLEA 2E5GA 5IT4A 1U1PA 2MJUA 3I9ZA 2UUBJ 1WC0A 4ATNA 2V5HG 4J9VA 3V81A 2FHKA 3BKUA 1HR0F 4EYIB 4KB7A 3KLGB 3W8GA 5HROB 2UXBF 2CXEA 3KUGA 5L38A 3R1LA 2WVFA 1T03A 1KFSA 3CJ0A 4YR0A 3C14A 4N56A 1S7IA 3PR5B 3HPOA 3AH6A 4FNIA 2DK2A 2PMHA 1ZM3A 4QPXA 1T9XA 2COLA 1RQ0A 5L9NA 3CPWR 1JKHB 3DHXA 4PAAA 3U27A 5GAHI 2KM8C 3FBCA 2QL9B 4RX6A 2XMJA 3W9JA 4IOCQ 3BN7A 1U1MA 5HROA 2PC6A 4ED8A 2NSBA 1J5OA 1ZETA 4XTTA 4UOFA 3VAHA 3O1LA 3J80Y 1BQNB 2QLJB 2OTLS 1KOOA 3HSZA 2RUGA 2DNNA 2I8EA 4UZCA 2KT2A 1CJVB 5LSRA 1YJNS 2RILA 2MGZB 1F5BA 2HHWA 3LTOA 1B0VA 1Q8IA 1JKHA 1N5SA 2ABYA 3VQTA 3H20A 2FVSA 4ZVPB 4UOHA 4NLQA 2HHVA 1NPPA 1C2PA 3KK2B 2NREA 3RW7A 2HS3A 4KTQA 3UI3A 3C16B 2NR0A 3EXCX 2ZBRA 3RYLA 2KT5A 2HHXA 1SCJB 3G86A 4TYBA 4YP3A 4BDPA 4WFAQ 3EICA 4X64J 1HNXJ 3EPGA 3R1HA 1CJVA 1UEUA 1GX6A 1S1UB 2MGZA 1Q81T 2IJFA 5D0HA 3H7HB 2PA8D 2YWFA 5B7WA 1T95A 1VC5A 2DHGA 3BQ2A 4ZPBA 3HJFA 5DGAA 1TAUA 4A8YA 3LH2S 4R25A 3KK2A 5A8KB 1EIYB 4DCPB 1R6VA 4CLUA 3KG1A 4CTAA 1FT8A 4HHUA 3C16A 2JWNA 3F44A 4DHVA 2V8PA 4NOHA 4NASA 4DUZF 3UWTA 4YUDA 1MWQA 4DSFA 3QIDA 3O5TB 5L8RC 2B7CB 1I5OB 1S1UA 1G2EA 3C6TB 3LPYA 1X4BA 4DFKA 1XNRF 1R0BG 3A8EA 4BC9A 1M5PC 5IT0A 3H4DA 3EVOA 4I64A 2O5DA 3FQKA 1N34J 3NAHA 1QTMA 1RI7A 5A8KA 1N5QA 4I56A 2CQCA 1FVSA 1RTJB 1VQKS 4PUOB 4LMZA 4FF4A 4YEAA 4TLQA 2ZH8A 3QT6A 1RHKB 1K1QA 4K7QA 4NMXA 2MKJA 1TKTB 1BC6A 2M2BA 2B51A 2MQLA 3M8ZA 3C6TA 3MD1A 1WDTA 3JSYA 2AU0A 1TUGB 3FGVA 1R27B 2X3GA 3M32B 3M9MB 1VJWA 2F9JA 2VQEF 3OL9A 4O3NA 2HLUA 2ZC3A 5G0RB 1W25A 2MJNA 2IAJB 3TVYA 2X51A 1CSJA 2ZNYA 1RTJA 4YB7A 2UU9J 2W8LA 3OFEA 5E7OB 3UN2A 3P5TL 1SXLA 2MKHA 5HK4A 2FPHX 1TKTA 3LP1A 3TJ8A 1C1BB 2RNEA 2JEGA 1ZAWA 5CZVA 3RW6A 4QWAA 4OX7A 3RTVA 4QBUA 2DR9A 3C15B 1QAIA 3M32A 1AXQA 1J27A 2F8MA 4QIWD 4QWBA 2CVIA 5G0RA 4JI5J 2QYCA 3CC7S 1S49A 3TA1A 3UE2A 1F5CA 3QATA 3ICLA 2ZJRQ 2J6TA 1N4LA 2IAJA 3A3OB 2HMIB 2HYIB 3A1YG 3DLBA 1U6ZA 2V9WA 1S10A 4DR4J 5IC4B 2KO1A 1UVMA 1N36J 2O66A 4RUBA 4KHPJ 2DNRA 4X62F 3L09A 2HQGA 3RBEA 5CCLA 4K2XA 3D1HA 3D0IE 1C1BA 1VFJA 2DHXA 1SPBP 2UUBF 2WVEA 3AJDA 4O23A 2R7UA 3C15A 1HHTP 2MZSA 2YKPA 4DL5A 2KDOA 1C0TB 3O3LA 3QRPA 1S4FA 2V2QA 1WC6A 4DN9A 1KRPA 3DRRB 2HMIA 3BBBA 1RTDA 4F50A 1WHYA 2Z4PA 3D0HE 2GAHC 3VVUA 3KHLA 2HHPA 4ECTA 1LW0A 4CO4A 1X4EA 2QG9B 5EX3A 1QVFR 2W2NP 5E3CA 3M2VB 1S5ZA 3C3LA 1SKSA 4L73A 4B9VA 4GMKA 4WFXA 3W8PA 2Z2MA 1MMNA 3N9UC 3M8RA 4LRDA 4DF8A 4ED5A 2YH1A 1UTAA 2V2ZA 1CQNA 1P1TA 2GVDB 2OD6A 4EBEA 2HG4A 1UAWA 4FYWB 4OYMA 4WKRA 2OPSB 2PMWA 2U2FA 1SH3A 1XMOJ 1Q86T 3DRRA 1RK8A 2HNDB 4MKAA 4OX8A 1O6XA 3NCQA 4P7VA 3M2VA 2B9YA 2MXYA 1JLQB 4KE5A 2IYIA 3M9OB 3RAMA 3OQ2A 4I0WA 4R0JA 1P27B 4I4BA 3WDOA 1S0VA 2NPIA 4ANEA 3A3PB 1BHNA 3L9ZA 1OY9A 3CO9A 1TAQA 2GVDA 1ZAXA 4DLEA 2OPSA 2LEBA 2PMZD 4P10A 2HNDA 1R3NA 3A3NB 3TOQA 4F3QA 4X64F 1W2BR 1HNXF 3FC9A 2ZH2A 3KYLA 2EK6A 1RZMA 4DEZA 4MH8A 1JLQA 2GQQA 4EO8A 2EKYA 1T9UA 1U6FA 3I56S 2E1CA 3PEJA 2HBQB 3GV8B 3UDCA 2L9NA 4Q2LA 3RRGA 1K73T 1S99A 2KFYA 3PVXA 4M5JA 4B3MJ 1P6TA 2WVCA 4RNHA 1BUXA 2RH3A 3UD5A 4UY8T 4MIBA 2IJNA 1GH8A 3N0VA 4W98A 3ENQA 2W1BA 3LPEA 5EWEA 5G4DA 3CCLS 1RWNB 3FVYA 4CLFA 4DV6J 2ZE2B 4LVOP 3NOCA 1LFPA 2WSCC 2W2PP 2DB1A 3I6PA 4NLPA 3NG8A 1S59A 4WE1B 3IN5A 3CW2C 1N34F 3QRRA 2EFVA 3KLHB 2DGSA 4OZLA 2NPFA 3BO4A 1XQIA 2XYGB 1P9YA 3PYEA 2JLGA 3KUHA 4NLRA 5EDWA 4LR7A 1JB0C 2G13A 1T02A 3SCJE 5ETVA 3Q8YA 5GMEA 2AJFE 2DRAA 5F3TA 1O8BA 3ET6B 2XTJP 2ZOGA 2J5AA 1VYAA 4B9SA 5IV3A 1FX4A 4JI6J 4RUAA 3IG1B 2ZE2A 4ZJQA 2ROGA 3JQKA 2OFHX 2YH0A 4H4OB 5D4PA 2OJ3A 5HATA 1GMUA 4WE1A 2R2SA 3KLHA 3P8BB 3CJ2A 3CIMA 3M30A 2UXDJ 1Q8KA 4EZ9A 2KVQE 2UU9F 2DHAA 4B17A 2XMVA 5A0YB 5KFJA 4PR6A 4YR3A 1WG1A 1RP5A 3ET6A 3H2VE 4QR1A 3EZ5A 3CXCR 2BRKA 1U09A 4FNHA 3RB0A 3QAUA 5E33A 1L3KA 1V3RA 3IG1A 3VWSA 3K58A 4AE5A 1KQFB 3FQLA 5AXKA 2I2YA 1Q53A 4H4OA 3FCVA 4CLPA 1H98A 3NL0A 2MLXA 4CZCA 3NLCA 3N6MA 1D8ZA 4JI5F 3EZOA 3PFOA 3TA2A 4YHHJ 2Y1IA 2DNGA 4IRKA 1GAOA 1QM9A 4FS1A 4WP8A 3TZYA 2ZBIA 3J7ZT 4UQTA 5A0YA 1WSRA 4DR4F 2YNHB 1F2GA 1PIEA 2Q1LA 2W25A 1RKJA 1N36F 4NA2A 4DV5J 4KHPF 4W90B 2NXJA 5DG7A 2XZDB 1SJ3P 2FYXA 3BPDA 4ED1A 3PO4A 3MFIA 2AJ1A 3C19A 1VQNS 1VQMS 1N52B 2OHDA 3VZIA 1RKIA 3K57A 3PX6A 3S01A 2V34A 4YR2A 2KG1A 4OI4A 2WSEC 2VBXA 2RIJA 5KFSA 1LKZA 2MSSA 3UCGA 2RU3A 4TYAA 3MAHA 2VFVA 8AT1B 3AQPA 2FVQA 3GR0A 3SMZA 3P96A 2ZBQA 4PG8A 2CNOB 4ES2A 1FTCA 2AYEA 2YNHA 2FJVA 2MQNA 4FXDA 4DV1J 1SVDA 4UT4A 4USMA 3HVWA 2ZWPA 5KOXA 4N47A 1EQMA 1EAYC 1N5VA 4FBTA 4JI0J 2G2OA 3TI0A 4DX8H 2D3O1 1Q78A 5J2QB 4DR1J 3D66A 1S0OA 4JI4J 2HWTA 2BA9A 5DDQC 2AX1A 1D9DA 3MURP 2CZ4A 4HYKA 4C98A 2V6AA 4XK8C 3KLEB 3GP9A 2VJVA 1HARA 2NXCA 4QYZJ 1XMOF 1HW8A 3CCUS 2GQ2A 5L1KA 4X4PA 1YSJA 2G1HA 5KT3A 2I1RA 3BB5A 5LXRA 3N01A 4FS2A 2CPDA 1VI7A 2CQPA 3M9NB 2C1EB 2AGQA 4NI2B 4OYZA 3MAQA 1HNZJ 1DQ9A 1J2VA 1X0FA 5A6WA 2LMIA 5J2QA 2L9WA 2M88A 2Y1JA 2R8KA 5HI7A 2H4WB 1IN0A 4LSNB 4WYLA 4F0MA 3BPSP 3TVZA 2RDDA 3ADAC 1SJQA 4GVLA 2Z56B 4UQGA 3ONQA 4OV6A 1T3OA 3A8KA 1XR6A 3GIKA 1UW9A 2UUCJ 3MM9B 4CO0A 5GMKa 1JWWA 1N6QB 2W2MP 4CDIA 1U1LA 4EYHB 1QAJA 2C3UA 1Y0HA 4PWWA 1PGZA 3OTDA 2J6UA 1JX4A 5IZHA 3CB4A 1Z1ZA 2WW8A 4WF9Q 4LSNA 3BQ1A 2BJ8A 4NCGB 2HLTA 3TNVA 2MQPA 3VAFA 3LF0A 2HIYA 4O3PA 4B3MF 3M1VA 4LRFA 1WEYA 1S97A 3D3BJ 4DZDA 2FHMA 2Y8YA 2CPHA 1DJ0A 3MM9A 4A48A 4QIGA 3MD3A 1N6QA 4H54A 2WONB 4DV6F 3V4MA 5J2NB 2BXJA 3IWXA 2QLBB 2BEFA 2A2DA 1IQTA 1JXVA 4LFAJ 1T9TA 5T41A 1NCLA 5KG7A 3N5FA 1X4DA 1U24A 4ENOA 4NCGA 3HKZD 4U7CA 1N48A 4DV3J 3EXYA 2VFSA 4C8ZA 2QGFB 5LOQA 4X4SA 4UUXA 3KJQB 3SIPB 1U6BA 3R5AA 1XNQJ 1NK4A 1IXKA 3QGHA 2WONA 4JI6F 4RUCA 2NXEA 4QW8A 5J2NA 3K8VA 3OW2R 4OZJA 2CPIA 3T5HA 2Y8WA 5CZXA 1TKDA 1KVJA 1UCNA 4G6VB 3AJ2A 4DF4A 3HT3A 3MWBA 1NJIT 4RKUC 2UXDF 2DGXA 3PJXA 3KDNA 2V69A 2F65A 1VR6A 2ZOFA 2OAUA 3CVKA 3BBFA 1RHUB 4A8WA 5DG8A 4AQYJ 1SUQB 4F25A 3E2EA 1EKRA 2VV5A 1VQ9S 4NPOA 3I4PA 2MMYA 5MAOA 3QFWA 2JLEA 3HZEA 3W3SA 4DFMA 1UEKA 4K4YA 1L3UA 4ZN3A 4FVMA 4LREA 2QEXS 3SSRA 4LSLB 2L48A 1FJGJ 2CAJA 3Q23A 3ZXWA 3N79A 4YHHF 5B08A 2CDQA 4N76A 4YB5A 4RNOA 1RU2A 3TEHB 2HHUA 4UTGA 1TUWA 1UFKA 4NLUA 2PSZA 3KLVA 2VZ9A 1QY7A 4DV5F 5DQIA 1UL3A 2YNGB 2HFUA 3RJMB 4CNYA 1SB6A 5DZ7A 1JNZB 4MK7A 1PJ7A 1SUQA 4S0MA 1RA6A 2DO4A 1E6YB 4JV0A 2CYYA 5HLFB 5KT5A 2E7VA 4QU6A 1HNVB 1T9WA 2N3LA 3TZWA 3CO0P 3GB0A 1VBZA 1HPZB 2HWIA 2OMOA 4NLOA 3IRXB 1IBMJ 3MEKA 4BWJA 5DGBA 2ASYA 1O0PA 3IO1A 3BKFA 3JSMB 2ZHBA 4LSLA 1AUSL 3KJVB 3KG0A 2M4MA 4Q5VA 1X5PA 3ZTPA 2YKMB 2BOAA 3CCRS 2CJXB 4DV1F 1QSLA 3R97A 3H59A 1X4CA 2D1CA 1NRKA 2MEWA 3CD5A 3CJ5A 1LFWA 4JI0F 2LYVA 1E6YA 2RT3A 4M5HA 5AXMA 4DR1F 3BYPA 5H9EK 4JI4F 1HNVA 1HPZA 1U1OA 3IRXA 3MI7X 5KFQA 3GIMA 1FK9B 1VOMA 2PE8A 1NK7A 5GAGU 3GLJA 3HVAA 2CJAA 2KJVA 1SJ4P 1GTHA 2YKQA 3KJVA 4JI1J 2ZFHA 4XPCA 1WF0A 2KJWA 3HVRA 2YKMA 1DRZA 4M5KA 3R7SB 1ITPA 4OQJA 2EKNA 2ZBCA 3IBFB 3Q8VA 4ZP8A 2HVHA 1R7IA 2CQ3A 4EEYA 2AJ4A 1H3DA 1LWEA 1HNZF 2QL7B 4B9MA 4C48A 3W2WB 2A0FB 4IR9A 3FBBA 1SJFA 1JMTA 2QMUB 2R9LA 4KGXB 3VVTA 4KBIA 3IR6B 1QSSA 1KN6A 1DURA 2QT7A 2FD2A 1FK9A 4OMFG 3HULA 4LBIA 4U8VA 2QLXA 4R0EA 4DPYA 3H4BA 2I0XA 1IWAA 3N4WA 3DGVA 2KM8B 2ZVIA 4I69A 1R8BA 2UUCF 2PDAA 3MDFA 4U8YA 4EMDA 1IKVB 1H6KX 4OI6A 2K3IA 3LAMA 3KKFA 3B82A 3GJTB 2DKOB 4IFVB 3W2WA 2HGLA 1H2TZ 4IO9Q 1K47A 3D3CJ 5KFDA 1RBAA 4B08A 2FIUA 3MUVP 2RDJA 1S9EB 4TU9A 4OHVA 3WBZA 2ZVSA 2K7KA 2CWXA 4E8UA 2CG8A 1LK7A 2VG7B 1JLEB 3FCHA 2OELA 4TY8B 4C6AA 2RQCA 1Y3JA 3PW7A 2BQ3A 1ZH5A 1HBOB 4ZPCA 3NGKA 1NJWA 1P8GA 2R7XA 4WK3A 3SFGA 2R3VA 1I1GA 4IFVA 3MUMP 1NDCA 2HFVA 3CCMS 4AYBD 4LFAF 2ZEJA 2GW8A 1WKLA 2W8KA 2MHNA 4F4AA 4M8LA 5IC6B 1TP7A 3VGTA 1S9EA 4PWUA 3ZO7A 4DS4A 3T5LA 3VF0B 1XN9A 4DV3F 4ED4A 3JB9k 3EMTA 4GO5X 2VDIA 4J9QA 4PRFA 3MEEB 1EHWA 2VG7A 2VFRA 2KHCA 3CT9A 1JLEA 4FN5A 1XERA 3OFHA 2HHTA 1EQ0A 1WOSA 4LFBJ 1HBOA 3THPA 3CMAS 1XNQF 3CJ3A 1QE1B 2H3EB 3BH7B 4K4TA 5E0OA 3H90A 4NE9C 2R7OA 4NCAA 1GXLA 2XWYA 4GVBB 4JB8B 3CMQA 2XHWA 4TY9A 4WFZA 4KPYA 4M5DB 4DR5J 7FDRA 2RQMA 3CGIA 1HW9A 3JQMA 4CH1A 1S48A 4OL8A 3CJ8A 1Y3KA 3ZTRA 2CADA 3MEEA 4GRSA 4ZHRB 3B78A 4U96A 5L1LA 3PDNA 2HHHJ 4AQYF 3IGNA 2CDRB 3NS6A 1M5KC 1QE1A 4NL5A 1U2RA 2B8PA 5JMNA 1RBOB 1TTHB 4GVBA 3K5PA 1VQOS 2DXFA 3H0PA 4XIUA 4M5DA 2FVRA 4CLKA 1FJGF 3P3DA 5CA5A 5LMUJ 4BWMA 3OD2A 2NXUA 2YWWA 3DFEA 2C28A 3RBDA 4JI8J
chains in the Genus database with same CATH topology
3P8BB 3QQCD 2XHCA 3H7HB 1NPPA 2LQ8A 4ZN1A 4ZN3A 1M1HA 2EXUA 2OUGA 3EWGA 1NPRA 3LPEA 1M1GA 2K06A 1NZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8B B;  3QQC D;  2XHC A;  3H7H B;  1NPP A;  2LQ8 A;  4ZN1 A;  4ZN3 A;  1M1H A;  2EXU A;  2OUG A;  3EWG A;  1NPR A;  3LPE A;  1M1G A;  2K06 A;  1NZ8 A; 
#chains in the Genus database with same CATH topology
 2EW9 A;  3MEG B;  2CPY A;  3DNC A;  4M95 A;  3HHN B;  1RHM B;  4H4K C;  2R7W A;  2O1P A;  2QA1 A;  4MK8 A;  2W24 A;  4LF1 A;  2HGN A;  5GVQ A;  1RTI B;  2N7C A;  3OJU A;  3QJJ A;  1NXI A;  3FEY B;  2OFG X;  4O0I A;  3G82 B;  1MML A;  2BKN A;  1IBM F;  3OL6 A;  1X4H A;  2OGU A;  2BKP A;  1VS3 A;  3VAJ A;  2LCW A;  5KFN A;  1SC4 B;  4P74 A;  3RBZ A;  4WFY A;  1VQ6 S;  3ISZ A;  1X5T A;  3KTQ A;  1XMB A;  1GT8 A;  4QCL A;  2HNZ B;  2DIV A;  4P2F A;  4ED7 A;  1GXU A;  3LP0 B;  3CWJ A;  4IG0 B;  3GYN A;  2ZH9 A;  1RSC A;  1RTI A;  4V19 J;  2VQF J;  2YKA A;  3ZZR A;  3W62 A;  4Z2X A;  2IRU A;  1NDK A;  2HBR B;  1PJ6 A;  4RBU A;  1I94 J;  4FF1 A;  1B70 B;  5ETO A;  2RE1 A;  3I4H X;  3KUE A;  2BR0 A;  4C8M A;  1LW2 B;  4DPO A;  4JI1 F;  1ZTW A;  1UFL A;  2EVZ A;  3JAM U;  1RT2 B;  3QPI A;  4K4V A;  2HNZ A;  4LSZ B;  1S6O A;  4URQ U;  2LXU A;  1SJ1 A;  2B9E A;  2WK4 A;  2EEY A;  2ZNZ A;  3LGM A;  4CLT A;  1KVK A;  2OPQ B;  2XY7 A;  3R9L A;  1HA1 A;  1JJC B;  2FJE B;  1YQH A;  3U1N A;  2JX2 A;  3TAQ A;  3IGV A;  4WIQ A;  2G2Z A;  2CQ2 A;  4ZVU B;  1FE0 A;  3DC2 A;  4X65 J;  3PIP Q;  2MZJ A;  1LW2 A;  4K8R A;  3N28 A;  4I67 A;  3H5Y A;  2XYP B;  4KQZ A;  1RA7 A;  5M2U A;  1JLC A;  2F8H A;  4DR6 J;  1VHF A;  3CJK B;  2AYM A;  4FXW A;  2B9W A;  1PYO B;  4QR0 A;  3T41 A;  1JIH A;  2E1M C;  3JTO A;  2KFZ A;  1SKR A;  2APO A;  2PEH A;  1JJ2 R;  2E5H A;  4OLP A;  2OPQ A;  4DJB A;  2ZH6 A;  3G6V A;  3SDE B;  2FHO B;  2KZZ A;  3HSJ A;  1FF2 A;  4IFY A;  4R5P B;  4U9R A;  5KFB A;  1DFD A;  1CJT B;  1V5I B;  5HVG A;  4DQI A;  1KWM A;  3CCV S;  2Z2Y B;  2ZJP Q;  3AD9 C;  2BDP A;  2F3J A;  1UJ5 A;  3FBF A;  4R8U B;  1B7F A;  2RDI A;  1RAO A;  2OIH A;  3DMJ B;  2OEM A;  3CJK A;  3MCO A;  2BJ1 A;  2RRN A;  3Q86 A;  1VQS A;  3HDS A;  1HQ2 A;  3DDN A;  2AEF A;  4I7F B;  5ETN A;  2MPU A;  2BAN B;  1PC4 A;  2XUL A;  5DM6 Q;  2M70 A;  1NSP A;  4ILR A;  1YJW S;  3SDE A;  5LMN J;  1Q82 T;  3H2L A;  2DY9 A;  1CJT A;  2E7X A;  2E5L J;  2J7U A;  4CT8 A;  4P71 A;  3QBC A;  3I9V 9;  1NZA A;  3G6E S;  2M3D A;  1C0U B;  4R8U A;  2R7T A;  2R8G A;  2XCP A;  3OTE A;  4O3Q A;  2XMK A;  5LXY A;  3DMJ A;  1HBM B;  4RJV A;  4LFB F;  1FVQ A;  4ZVT B;  3G8T A;  1F2H A;  2B6A A;  1EKS A;  2OEJ A;  1FJE B;  1RWU A;  4M63 A;  4I2P B;  2KXF A;  3BH6 B;  4FPR A;  3C8Y A;  3K17 A;  2YVS A;  4ECV A;  1KTQ A;  1T8E A;  2IRX A;  4I7F A;  3W64 A;  2H48 B;  2BAN A;  2DCL A;  1R8C A;  3GG0 A;  4DR5 F;  4LF4 J;  2W9A A;  4HTI A;  3DRS B;  3BR8 A;  3M05 A;  3MR5 A;  3T19 A;  2JEI A;  2C2D A;  2MKK A;  1NSK L;  4JOU A;  3R6L B;  2HHH F;  2W9C A;  1WC5 A;  2P8I A;  1N88 A;  2VIC A;  1HBM A;  4KY3 A;  4X4U A;  2KXH A;  3H40 A;  3IFE A;  2D74 B;  1WC4 A;  4PG6 A;  3JTP A;  4I2P A;  1QD1 A;  1FEH A;  2AQ4 A;  3EX7 B;  1X31 C;  3DLG B;  2XC9 A;  3QT7 A;  3UO0 A;  3QT8 A;  2D9O A;  2VOP A;  2HQD A;  1JNR B;  1UVN A;  4DU7 A;  4GKJ J;  2AZ3 A;  1VIS A;  1FDD A;  5BYQ A;  3QRQ A;  2QLW A;  3QGP A;  5LMU F;  3DRS A;  1VIX A;  5F8J A;  2B3T B;  5CXT A;  1JK9 B;  5DDP C;  4JI8 F;  1G3O A;  1PYS B;  4HTJ A;  2E9T A;  2GIR A;  4I1T A;  2IHR 1;  3GQC A;  3DXS X;  4QYR A;  2FJW A;  2HQ3 A;  2BW7 A;  4XO0 A;  1VQP S;  5EN1 A;  3TW0 A;  2V4J B;  1VQ4 S;  3CCZ A;  1BWV A;  2I9S A;  2ACY A;  4ECQ A;  3DLG A;  2C3Y A;  3RUB L;  1Y11 A;  3KFW X;  5ETP A;  3ENV A;  2KG0 A;  1RWK B;  1HBN B;  1ZPW X;  4UF4 A;  2V8G A;  5LJ5 Y;  2WVB A;  1YBA A;  1X60 A;  4ECW A;  3GYX B;  2JLF A;  2JZ5 A;  2EFG A;  1VQ8 S;  4RO0 A;  3BSO A;  2VD3 A;  5HQL A;  1YJT A;  2BRL A;  1FRK A;  3D2W A;  1NO8 A;  5BYS A;  4J9O A;  4TQS A;  1OIA A;  2W2O P;  3M6V A;  4F36 A;  4ZLJ A;  3POT B;  4F4W A;  5KFL A;  2QFJ A;  2V4J A;  1FRM A;  2IRY A;  1RU1 A;  4OJ3 A;  3FZ2 A;  4NRT A;  4ES3 A;  3DLH A;  2VQF F;  4X2B A;  3UR3 C;  4DR2 J;  4JP8 A;  3T5J A;  4WZQ A;  2E1A A;  1HI8 A;  1I94 F;  3JSB A;  3KK3 B;  3TAP A;  4M5L A;  1SQG A;  1WAC A;  2KN4 A;  2FZC B;  2ZHO A;  4A4J A;  4G1P A;  3NY0 A;  1KOH A;  3WC2 A;  3H5S A;  2WHO A;  1CEZ A;  5C25 B;  2KRB A;  5E3A A;  4JI7 J;  1WNE A;  1DAX A;  1BGX T;  3HFZ B;  2D9P A;  4TNO A;  2E29 A;  1FO1 A;  3HHL D;  3TX8 A;  5AE3 A;  5KFW A;  2FHJ A;  1H38 A;  1NJY A;  3KJF B;  3J81 U;  2VG6 B;  4J9P A;  1GFW B;  4LF9 J;  1KR4 A;  4TN2 A;  3Q2S C;  2HBZ B;  2J8A A;  3H2U B;  4A46 A;  3KK3 A;  3DM2 B;  1X4A A;  3B4M A;  2BQU A;  2IDL A;  2A6M A;  2RQK A;  4C0B A;  3SCK E;  1U25 A;  4X65 F;  2DNH A;  5C25 A;  2BJ3 A;  5IT9 Y;  2DHH A;  3W65 A;  2JC0 A;  2N82 B;  3ILO A;  4DR6 F;  4ELU A;  4Y65 A;  1ZZN A;  2G1D A;  4EU0 A;  4QOT A;  2Z8Q A;  3RAX A;  2AW0 A;  1FRL A;  2CA9 A;  3LOU A;  1NLK L;  2JDJ A;  2VG6 A;  5IM0 B;  3QQC D;  3NXZ A;  3J81 Y;  5FLX U;  2VOD A;  3NOG A;  4DPT A;  1HNW J;  2HFS A;  3K5L A;  4DQR A;  3DM2 A;  4F04 B;  2FLO A;  1KTV A;  2GGP B;  2HVD A;  2DGV A;  2C3O A;  5K5M A;  2D41 A;  1FWK A;  2H65 B;  1M5H A;  4Y0F A;  2A18 A;  2O67 A;  2XEX A;  2YQ0 A;  2QN6 B;  3NGR A;  1L3V A;  1P9Q C;  2KYX A;  5IM0 A;  1MMD A;  3UNG C;  3ZZY A;  5LMN F;  5GAE U;  1OWX A;  4M5G A;  2MZ1 A;  1YJU A;  3K5M A;  3J81 j;  4NLV A;  1TL1 B;  2E5L F;  3OPK A;  2GGP A;  1D09 B;  2XSJ A;  2EFQ A;  1S6U A;  2FDN A;  1FJC A;  1G4C A;  4B9N A;  1FWP A;  4DCO B;  1YK9 A;  2QZ8 A;  4MKY A;  2IM3 A;  4DS5 A;  3QO9 B;  3KHH A;  3SZ2 A;  4PXB A;  3KHG A;  3CDW A;  3QMQ A;  2OH2 A;  2JVO A;  2BKO A;  4HAC A;  2E5J A;  5DDO C;  3KMS A;  1NBE B;  2ZIT A;  3PW2 A;  4LF4 F;  1MLA A;  3EM1 A;  3MM7 A;  4P72 A;  2VOO A;  5KG2 A;  2HGM A;  3ZFV A;  1SJR A;  3CF5 Q;  2MKY A;  1ZYQ A;  1UMJ A;  3CME S;  1WKK A;  5HMZ A;  2CPZ A;  2BOP A;  1NHU A;  4USV A;  1FA0 A;  2ZH4 A;  3K7R A;  1TKX B;  1SKU B;  2CPF A;  1YBT A;  2B43 A;  3CCT A;  1YWX A;  1YX2 A;  1T9Y A;  2YQ1 A;  1U0S A;  2GZO A;  4P75 A;  4GO7 X;  4NCB A;  2KB2 A;  2QC3 A;  4ZCM A;  3PR4 A;  1T7P A;  1RT4 B;  2AX0 A;  5EUH A;  3W60 A;  5F9N A;  1NPK A;  4C3K A;  1RWW B;  3EPI A;  4CH0 S;  4ECU A;  5K20 B;  5CYQ A;  4GKJ F;  4IH5 A;  4O44 B;  3HD1 A;  3MTJ A;  4DSJ A;  3MMA B;  2HRU A;  5L46 A;  1T05 B;  4WTY A;  4YY3 J;  3PKY A;  2W7O A;  2UZA A;  1TKX A;  3GFY A;  3TUI C;  5I3Q A;  1IJE B;  1QDU B;  2Z58 B;  2DXD A;  1Q7Y T;  2W7P A;  2OML A;  1RT4 A;  2HVI A;  1CPZ A;  2U1A A;  2AD9 A;  2VUG A;  1NHV A;  4WP3 A;  1CLF A;  4ZVR B;  3I87 A;  4LF6 J;  3A13 A;  2CWK A;  2IVY A;  4ZPV R;  4O44 A;  3RAQ A;  3MMA A;  1NK9 A;  2DY1 A;  1WEZ A;  3VAK A;  1T05 A;  2F4V J;  2VF3 A;  4USW A;  5HL7 Q;  2EK1 A;  2DH7 A;  3NBP B;  4DPU A;  3WHI A;  2MQM A;  3AFG A;  4ZCI A;  3V81 B;  1RT7 B;  2CNK B;  2BAB A;  3HX9 A;  4FKY A;  4N77 A;  3KDO A;  3R3T A;  2DJW A;  4OI3 A;  1RTZ A;  1X4G A;  4K4W A;  3DYA B;  4KKO B;  4CCH A;  4DR2 F;  3F56 A;  4PXC A;  3K8W A;  4W4M A;  1S1V B;  3PFE A;  4F4Y A;  4FZV A;  1RAG B;  3AAW B;  1X9W A;  2MB0 B;  3AA9 A;  3D28 A;  2HBY B;  3ZZU A;  5HO4 A;  1F0X A;  2XMW A;  4HDG A;  4ZP9 A;  4AT1 B;  2K8G A;  4X66 J;  4JI7 F;  3NBP A;  4KC5 A;  1YTY A;  1N33 J;  4CLW A;  5EWG A;  1F5A A;  4B9L A;  1RT7 A;  2HQF A;  3M6W A;  1F1B B;  1UP1 A;  2JEF A;  2Q66 A;  3OUY B;  2POK A;  4MT1 A;  1BE4 A;  5DO2 A;  4A47 A;  1EP4 B;  1J5O B;  4ID5 B;  1F6T A;  2XQC A;  5C7P A;  3DYA A;  3CNQ P;  4F02 A;  4KKO A;  4LF9 F;  4DX6 A;  1WHV A;  2AEJ A;  1DHM A;  1S1V A;  2XS2 A;  1UJ4 A;  4UW2 A;  4D3G A;  1OPI A;  3UR0 A;  3D4J A;  2RS8 A;  1SC3 B;  4UST A;  4N5S A;  2PI4 A;  2YQ3 A;  2CVE A;  2WRM A;  2EPI A;  4Q7A A;  2Y9H A;  2EFN A;  3M8W A;  2BUN A;  1BQX A;  1YKW A;  1QVG R;  3M7V A;  4CLY A;  5C2C A;  3LGH A;  3I32 A;  2DGT A;  3NWR A;  3J7A N;  3OUY A;  2GX8 A;  3V4I B;  3PX0 A;  1WJ9 A;  1EP4 A;  7AT1 B;  4ID5 A;  1NZ8 A;  4N41 A;  2B4U A;  1WG4 A;  3M8P B;  2PT0 A;  4WBF A;  1RLD A;  1VCT A;  1R89 A;  1O51 A;  3V6H A;  1SL0 A;  3MUT P;  3HSD A;  3LUY A;  2GHP A;  1HNW F;  3JS9 A;  4K0K J;  1B0T A;  2MKS A;  2PFF B;  4OI1 A;  4NRU A;  4AUK A;  5KT2 A;  2MYF A;  1KVI A;  4TXS A;  4KH1 B;  3G9C A;  3EJM A;  3WX8 A;  1UVL A;  1EB0 A;  3IAM 9;  3AXM A;  4AL7 A;  3J7Y U;  1HLW A;  2IMO A;  4DU8 A;  3V2U C;  2YNF A;  4HT5 A;  2BJ7 A;  3NGS A;  3V4I A;  4J9S A;  1TR0 A;  4CTA B;  4NLD A;  2P5V A;  3M8P A;  4ZVQ B;  4TQR A;  2FGC A;  3OLB A;  4C0H A;  1KD1 T;  2XLJ A;  1OY6 A;  2OPR A;  3S7R A;  3NMR A;  1K8A T;  1S6Q B;  2EI5 A;  3SV4 A;  5B09 A;  3V5R A;  4ILM A;  4ITS A;  1OSD A;  3IRW P;  5JXS A;  4FYV B;  4I2Q A;  1KFD A;  3FRY A;  4PG5 A;  2ZZT A;  4JI2 J;  2RML A;  3FEZ A;  2M52 A;  3FCW A;  4DSK A;  5F0W A;  1FXD A;  2ERR A;  3OVS A;  1XIQ A;  4L76 A;  2JJ4 D;  4O3S A;  3AD7 C;  1NH8 A;  1RAE B;  1H2U X;  2W9B B;  3U02 A;  5ETT A;  4ZCL A;  1UPM B;  2AT1 B;  3CD7 A;  2CQ4 A;  4B02 A;  3S1T A;  4RL1 A;  1S6Q A;  4USH A;  1RYR A;  2VPW B;  1GMW A;  4BS2 A;  4DXL A;  3L95 X;  1REG X;  5L1I A;  5A8W B;  3HT0 A;  3D6M B;  1RBL A;  2LXF A;  1YZ7 A;  2AZ1 A;  1FFW B;  2XSF A;  3WQP A;  4JV1 A;  2AGP A;  4Y2C A;  3BEG B;  2DH8 A;  4C0O C;  3VV2 B;  5F8N A;  3BGR B;  3KLI B;  3AB4 B;  3N5B A;  2VFT A;  5AXN A;  1UVJ A;  3T9Z A;  1RUS A;  5KG3 A;  3PW4 A;  2W9B A;  5K8P A;  2ILY A;  2HFN A;  1WTB A;  2LQ8 A;  3EGV A;  3LP1 B;  5D0E A;  2XNR A;  2NUU G;  2DNM A;  2AIR B;  3DU5 A;  4J7C A;  3IMQ J;  4PQU B;  4YY3 F;  3N6L A;  1TK5 A;  4ZIW A;  2DR8 A;  1ARO P;  2CZ9 A;  1FKA F;  1XJW B;  1VRU B;  3SSS A;  4IR1 A;  4MKB A;  5A8W A;  1GTE A;  1UW4 A;  3MPU B;  1ZZF A;  1HYS B;  3QIP B;  1OMS A;  2KFN A;  4ZLP A;  2WTF A;  3VQS A;  2XYH B;  5ITH A;  3CCQ S;  3ZC4 A;  3BGR A;  3KLI A;  2Q43 A;  1TZ0 A;  3AOB A;  5F8L A;  2EG1 A;  3DN9 A;  5E41 A;  4NWB A;  1URR A;  2HAF A;  1IM6 A;  3GE9 A;  4LF6 F;  1PG5 B;  2WAQ D;  5EWF A;  4WU3 A;  1IR1 A;  3I0S A;  1K9M T;  1N0U A;  3D54 A;  4USK A;  2F4V F;  3IA0 A;  3I82 A;  1M90 T;  4PQU A;  2RKI B;  1VRU A;  9RUB A;  4DBQ A;  4OZ2 A;  1HYS A;  3QIP A;  1KS2 A;  3LA0 A;  4WXO A;  3OHB A;  4FBU A;  1FER A;  3AOA A;  4O4G B;  1MN9 A;  3IR7 B;  5DG9 A;  1RTD B;  3VTI A;  4MAK A;  3F0N A;  1LW0 B;  2RD5 C;  4F4X A;  4HDH A;  2KL8 A;  1Y9O A;  4WP9 A;  3FEX B;  4U67 Q;  1WF2 A;  5HVH A;  2P9G A;  1TK0 A;  4CNZ A;  4LF2 A;  4EBC A;  1D1U A;  4F0K A;  5AE2 A;  3U1M A;  4X66 F;  5CD4 H;  1N33 F;  2RKI A;  3UD4 P;  2YWH A;  1SC6 A;  3E01 A;  5F8I A;  1U49 A;  2UXC J;  2H51 B;  5B0F A;  1NJX A;  3TUZ C;  5K8O A;  5CHC B;  4Y2I A;  2AJ0 A;  3NGT A;  1HBU B;  2PD1 A;  4RLE A;  1AFI A;  4O4G A;  2AGO A;  1G6B A;  3MPW A;  4H4K A;  2FLL A;  1X7V A;  2CNN B;  4ZPW R;  2XY5 A;  2M9K A;  4ZA1 A;  4OZ5 A;  2ALY B;  4LIR A;  2W4P A;  2CJK A;  3L7O A;  3OTC A;  2QMW A;  3KXD A;  2LDI A;  4DWI A;  1PAU B;  5KT4 A;  1VBX A;  4BCA A;  3QWU A;  3MMB B;  2AV5 A;  2QE5 A;  5BYR A;  3A4T A;  3HLU A;  1XR5 A;  1WF1 A;  3E8O A;  2JHE A;  4DOZ A;  2FY1 A;  3SQG B;  4MYT A;  1S79 A;  1XEZ A;  3MPD A;  2AP6 A;  1H0H B;  2Q3P A;  1HBU A;  4LF7 J;  2IC3 B;  4DL7 A;  3EDR B;  2P9E A;  5FDL B;  4K0K F;  2G0C A;  1S0M A;  2ADC A;  1VRQ C;  1L3T A;  5LM7 E;  3IM9 A;  4P6Q A;  3MHY A;  3UFC X;  4DV2 J;  1REV A;  4NYZ A;  4ZJO A;  1FJ7 A;  1RE1 B;  2GAG C;  4ILL A;  3FK4 A;  4G1I A;  2C2M B;  5DDR C;  3S6E A;  3MMB A;  4M5M A;  1YLX A;  2QFI A;  1MU2 B;  6FDR A;  1BQM B;  4QJV A;  3SQG A;  1PBA A;  3QGI A;  3OSN A;  1BWE A;  1KSP A;  2IC3 A;  1I3O B;  3J7A 1;  1URN A;  3GPA A;  2KI2 A;  5FDL A;  1Q95 G;  2GQC A;  3BZQ A;  3GFH A;  4AD6 A;  4CLS A;  1U1Q A;  5KG4 A;  1VMB A;  4D3H A;  4HHH A;  3KK1 B;  2ACM A;  4QR2 A;  4LT6 A;  3TX0 A;  1HI0 P;  2E5I A;  2RAQ A;  3BR9 A;  5IQ6 A;  5KFC A;  5IXU A;  5IV4 A;  3R2D J;  3Q8S B;  4B3T J;  4JI2 F;  3MR6 A;  2HRT A;  1MU2 A;  1NUE A;  5D0R A;  4Y00 A;  1BQM A;  2LVW A;  5THW A;  1VLY A;  4BLG A;  4IOA Q;  1Y5N B;  1QUP A;  5GAG I;  3MFH A;  3OSP A;  1AB8 A;  2M8H A;  4NLG A;  2CNL B;  4ZLL A;  3OT9 A;  4BC7 A;  2OSR A;  3FFI B;  4MKV A;  4I6A A;  3MZI A;  3EDQ B;  3AA8 A;  4USI A;  3HJV A;  4DI6 A;  5RUB A;  4DSE A;  1YDL A;  4HI2 A;  3TUJ C;  3KK1 A;  4IDK B;  3EZU A;  2YKO A;  4P52 A;  2V4R A;  1HQU B;  2QYG A;  1JLF A;  3LQV A;  3DLL Q;  1KQK A;  3LAN A;  1PJ5 A;  2LP4 A;  3I0R B;  3G8Q A;  3ZNU A;  3IS9 B;  3NKY A;  2K1R B;  1V5V A;  2LU1 A;  1YIT S;  3EVM A;  4YB1 P;  3M30 B;  2IA6 A;  2NCK L;  1WC1 A;  2XGP A;  2BM1 A;  2QA4 S;  4E0D A;  6AT1 B;  1Q1K A;  2BVZ A;  3FFI A;  5D77 A;  2HFO A;  3R5J B;  3ENW A;  1WDD A;  1RT6 B;  1UJ6 A;  4IDK A;  2MZT A;  2LEA A;  2DNK A;  2YPY A;  3HI9 A;  5DQG A;  3KOA A;  2HSE B;  2KT3 A;  4ED3 A;  1VJQ A;  1RWO B;  1HQU A;  1PBU A;  4OHY A;  1RWP B;  4AL6 A;  1GK8 A;  4MYU A;  3RB3 A;  3I0R A;  3IS9 A;  4DPX A;  3TEG A;  2K1R A;  3LAK A;  1Q0N A;  4NXM J;  2WZ1 A;  3AD8 C;  3E51 A;  5A76 A;  1MG7 A;  2VB6 A;  3AHP A;  4DUY J;  2IMW P;  4IQX A;  4Z37 A;  2XLI A;  2JFD A;  3R5G A;  1FNO A;  2M7S A;  1HQE B;  3DU6 A;  1RT6 A;  3WIU A;  3ZZO A;  3BSC A;  3GV5 B;  2QL5 B;  2OKQ A;  3W9H A;  5IS2 A;  4DQP A;  2B4V A;  3JSR A;  4QWC A;  4PXE A;  3L4B C;  4I6Y A;  4ZPD A;  3Q8P B;  1S76 D;  2LQ5 A;  2RJZ A;  3P45 B;  2F7V A;  4OFZ A;  3PHT A;  1NME B;  1CG2 A;  3IM8 A;  3FUY A;  2IPO B;  2XO6 A;  3T1Y J;  4DL6 A;  4V1A k;  4DV7 J;  4CH7 A;  5T14 A;  2UUT A;  4OX9 J;  4RW7 B;  1SKW A;  2W01 A;  3DXB A;  1RHR B;  2M0G B;  1HQE A;  2BE9 B;  2I5J B;  1YRU A;  1ZA1 B;  3ZZZ A;  1KNZ A;  2DNO A;  4EGL A;  4DV4 J;  4CLZ A;  3UDE A;  4F4Z A;  2GO8 A;  4LBH A;  2DNL A;  2L08 A;  2IFX A;  2UXC F;  1RAD B;  3ILI A;  2ILZ A;  4RPF A;  3NRB A;  2NUH A;  3D6H B;  2J9C A;  1MSW D;  3AB2 B;  4J9U E;  5BR8 J;  5HMW A;  2Y1R I;  4DX5 A;  2ZHA A;  4RBV A;  2DD8 S;  3MR3 A;  4EK2 A;  1TFW A;  1P1L A;  3BDP A;  2X1F A;  1JLB B;  4F2R A;  2AMC B;  4RW7 A;  4UOC A;  4K4S A;  4WJB A;  4YOE A;  5JVG Q;  4QU7 A;  4DQQ A;  4DFJ A;  2VU5 A;  3NGU A;  4QYZ K;  1CC7 A;  2I5J A;  3W7B A;  4M94 A;  1WWH A;  4QWD A;  4P7T A;  4GC7 A;  1FRX A;  2YX7 A;  5CYM B;  1S72 S;  4DMZ A;  2GJF A;  4PEO A;  1M5V C;  3MR7 A;  5ETM A;  4LF7 F;  3US5 A;  2GO9 A;  1D3W A;  4RWW A;  2N4C A;  2WVD A;  4FXV A;  4OX6 A;  3MMJ A;  2NS1 B;  2PFD A;  4M5N A;  3QJL A;  3BSA A;  3HF5 A;  3AQO A;  4KGM A;  4NXN J;  1JLB A;  1WOR A;  4DV2 F;  5FII A;  1TV6 B;  2HS0 A;  3E3X A;  1VQ7 S;  1IBL J;  5CYM A;  3AT1 B;  4WXW A;  1BY9 A;  2MQ8 A;  3ZZP A;  2JNJ A;  3QLH B;  5KTQ A;  5I3U A;  1UPP A;  3HSG A;  1U8W A;  4AL5 A;  1X5O A;  1OQ6 A;  3DOM B;  1N0V C;  4OJH A;  3JQJ A;  1KBR A;  3ITH B;  4PPD A;  3M1V B;  1M5S A;  1PAE X;  4ZVS B;  1SV5 B;  2CQD A;  2EG2 A;  1R6Y A;  1VRT B;  4WKY A;  4OZ1 A;  4JV2 A;  2XMT A;  4IOB A;  3THV A;  1NK5 A;  3G6X A;  1ACM B;  2IIH A;  4HEA 9;  1M5O C;  1TV6 A;  5F9L A;  3L7P A;  2UVW A;  2FY8 A;  2P6S A;  3QLH A;  4DN0 A;  3PNI A;  2QX0 A;  1OYE A;  2FVP A;  2CKW A;  4B3T F;  3FRZ A;  3CSK A;  3QSY B;  4FYY B;  1NHK L;  3DOM A;  1WI8 A;  3ITH A;  5KFE A;  3PRV A;  4KV8 B;  1GQE A;  5E3Q A;  2K7J A;  1S1W B;  1SV5 A;  2V9K A;  2JEJ A;  4Y6I A;  1A0O B;  2XWX A;  3J80 U;  4F67 A;  1VRT A;  4A8S A;  2AWZ A;  1LEO A;  2HZA A;  2Z0G A;  4U7U K;  1FI4 A;  4NX9 A;  3OXL A;  2A3J A;  1NDL A;  2ZOM A;  1VQY A;  2XZW A;  2LFV A;  1S77 D;  2VFU A;  1RT3 B;  1N54 B;  1DZ5 A;  2HW3 A;  1QAY A;  1HD1 A;  1U2F A;  2G4B A;  2FUG 9;  5KFF A;  1VHI A;  2GV1 A;  5C2G A;  2DTJ A;  1PSD A;  1C4A A;  5E5N A;  5JJB A;  4P2X A;  3PRD A;  4IO1 A;  4HT7 A;  2XCA A;  3KLG A;  1ZTT A;  3SQO P;  4KV8 A;  4OLO A;  2GA7 A;  3FJ2 A;  4C8O A;  2V8V A;  1S1W A;  3DLK B;  3RR8 A;  3AY0 A;  3ILL A;  1I6J A;  3VAI A;  3CJ4 A;  1RT1 B;  3X1L B;  3RU0 A;  4WFN Q;  5HVF A;  3TQE A;  4EBD A;  1RT3 A;  4A8K A;  3TR5 A;  3F73 A;  2P2C B;  3I96 A;  1R31 A;  4ICL B;  4USJ C;  3OXF A;  3PW0 A;  1DTQ B;  3SBM A;  4G65 A;  3MM5 B;  4QPT A;  2D3Z A;  1SL1 A;  3HK2 A;  5KFP A;  5GAD U;  5EHH A;  4NXM F;  4ECX A;  1DTT B;  2VJU A;  1X5S A;  3DLK A;  4DUY F;  2BW2 A;  3HXM A;  1TEL A;  2JFK A;  1EX8 A;  2DR6 A;  2RB7 A;  1RT1 A;  2DR7 A;  1BQN A;  1JQG A;  4C11 B;  5CH7 B;  4Y2K A;  2WW4 A;  1VBY A;  1F9F A;  3PM9 A;  2J0Q D;  3R2C J;  1NU4 A;  3GTY X;  2XI2 A;  4F0H A;  3OL8 A;  1UFW A;  5J2P B;  4ICL A;  2QTW A;  4A8X A;  1DTQ A;  3UPF A;  1CJK B;  4ZP7 A;  2EC0 A;  2HKE A;  3MM5 A;  3CJQ A;  3OFG A;  4UUW A;  5JUM A;  3T1H J;  2XMM A;  3G6Y A;  3NGD A;  4K5S A;  1DTT A;  3MR2 A;  3T1Y F;  2VON A;  2DIS A;  4ZMM A;  1G1X A;  4DV7 F;  2AJQ A;  4OX9 F;  4C11 A;  3B54 A;  4C2M A;  3LAL A;  3BS9 A;  4ANC A;  2RRB A;  1OSC A;  1L5U A;  3EVW A;  2E1R A;  4L75 A;  4DV4 F;  5J2P A;  2V0N A;  3RG6 A;  2PN6 A;  2XS7 A;  1W26 A;  5DQH A;  4C4W A;  1U1R A;  1CJK A;  2CZV C;  4IRC A;  1FWL A;  2B56 A;  3GSI A;  3G8S A;  2BBE A;  4UY8 5;  1Q7L B;  5BR8 F;  4IQM A;  4RW4 B;  3ULH A;  4W92 B;  3CE8 A;  3ETM A;  1D9A A;  3BDE A;  3KWM A;  3LWL A;  4RZR A;  4F2S A;  2N4D A;  2IM1 A;  2VG5 B;  3M8S A;  2DT9 A;  1LWE B;  3SXL A;  1NH7 A;  4ZVE A;  4CO1 A;  4Y3C A;  2CQG A;  1GX5 A;  3G96 A;  2Y0S D;  2GVZ B;  4OZN A;  2QV6 A;  5C24 B;  1HWU A;  1QAX A;  2HFZ A;  4C8N A;  5IOL A;  2XG8 A;  1MRO B;  1R43 A;  4QIF A;  1NK6 A;  1TL3 B;  4RW4 A;  4OIX A;  2GIQ A;  4WFB Q;  3PIO Q;  1ZAV A;  4PUO A;  3T9N A;  4NXN F;  1RIS A;  4QWE A;  3HD2 A;  2VG5 A;  3FKB A;  4F3M A;  5KAK A;  1SQF A;  3MPV A;  3EGZ A;  1FES A;  2UVU A;  1HI1 A;  2XGQ A;  1IBL F;  3IBW A;  1YG0 A;  4NLX A;  4Q45 A;  1EAR A;  4UZB A;  3PG9 A;  2GVZ A;  1GEH A;  4LR8 A;  2R7Q A;  4WYW A;  5H1S V;  2RHS B;  3CD0 A;  3PAC A;  2OO4 A;  5C24 A;  4KO0 B;  3BKT A;  2VKR A;  5K8M A;  1MRO A;  5BJR A;  1UZH A;  1SIZ A;  4NA1 A;  1TL3 A;  3RBX A;  2C3M A;  2NSC A;  1UWA A;  3PZP A;  1Q79 A;  1LV5 A;  1S12 A;  3HHE A;  1ZM4 A;  4ZVH A;  1ZBT A;  3CUL A;  5SUH A;  2R7R A;  1RAC B;  2FLN A;  2ZZM A;  3IXQ A;  2MTL A;  2OLW A;  2FJX A;  4FF3 A;  2ZH3 A;  2N7Y A;  4OYO A;  2F1F A;  2P6T A;  3VAM A;  1EJ7 L;  3RB4 A;  2YKN B;  1UKU A;  1V6H A;  3W5Z A;  1Q4R A;  4KO0 A;  2WOM B;  1HWJ A;  5KFR A;  5B0C A;  3J7Z 5;  3X3U A;  4K4Z A;  5DRK A;  2Q6C A;  5B0E A;  4C9D A;  1TL5 A;  3GZ7 A;  1AT1 B;  1M0S A;  1LXJ A;  2IM0 A;  4DV0 J;  4LIW A;  3O44 A;  5DLG A;  5KT6 A;  5ETK A;  2X1B A;  1MWY A;  3JXO A;  4DG1 B;  1H73 A;  2EWH A;  3WIV A;  2IBK A;  2BQR A;  3GR1 A;  3HHL C;  2VPY B;  2KU7 A;  2UV8 A;  4DUT A;  1WHX A;  1H2V Z;  4PQA A;  2YKN A;  4MFB B;  5D4N A;  2WCX A;  2WOM A;  2R2R A;  4EI2 A;  1C0T A;  1DLO B;  2LXI A;  2HWH A;  2ZKU A;  2R8H A;  4Y28 C;  3BN4 A;  4ZLN A;  4A8M P;  2C2E A;  1F9H A;  3MCS A;  4DG1 A;  5HSP A;  2F5G A;  2VC1 A;  1Z2L A;  2ZC4 A;  5AXL A;  3NP5 A;  1QSY A;  2J6S A;  3IC1 A;  3PEH A;  1M1G A;  3NMA A;  3QJP A;  1C4C A;  4JV5 J;  1NB7 A;  4Q44 A;  2YWE A;  3Q0A A;  5CAB A;  4HR2 A;  1W7W A;  2KTQ A;  1U26 A;  2DEI A;  2H9Z A;  4MFB A;  5KG1 A;  3T6B A;  2NQP A;  4X4R A;  4OYW A;  1CC8 A;  1DLO A;  4L6V 3;  1XC9 A;  2JC1 A;  3TZX A;  4CM2 A;  3MOJ B;  3W1Y C;  2IBO A;  4DX7 A;  3BGF A;  3G87 A;  2MLZ A;  4O4R A;  1IWG A;  2YBV A;  5HMY A;  2C2K B;  2J7K A;  4Q8F A;  2XMA A;  3WZ0 A;  2EBE A;  1RHJ B;  2G9O A;  3W5X A;  1R8H A;  1APS A;  4RR5 A;  1A6L A;  3T1H F;  1T9V A;  3Q8Q B;  1SH0 A;  5GAE I;  2D7S A;  1BLU A;  2LQB A;  2PGC A;  1FX2 A;  5FD1 A;  3VGV A;  2ASL A;  5DZ6 A;  2G0I A;  2LU2 A;  1SC1 B;  1VK3 A;  3BF4 A;  2M5Y A;  3T5K A;  4DDF A;  1WHW A;  3BV8 A;  4NLW A;  4ECZ A;  1RCX B;  1OJ4 A;  5D15 A;  1MW7 A;  4X4O A;  2GJ2 A;  2JH3 A;  2DR5 A;  3RGI A;  6FD1 A;  1IJF B;  2IYG A;  5ETQ A;  3QZ7 A;  3UN5 A;  3H98 A;  2CPE A;  3BO2 A;  5KG6 A;  3VZH A;  5C42 B;  5J2M B;  3VHQ A;  2QRR A;  5F8G A;  8RUC A;  4A8Q A;  4WWS A;  1FDN A;  3BGU A;  4LVN P;  3AOD A;  3OTB A;  1VK8 A;  4FKX A;  1IKX B;  4MTP A;  5E2Q A;  4PAB A;  2R7V A;  1XMQ J;  2GML A;  2DVI A;  3V6D B;  2Z57 B;  3I5A A;  2GHW A;  3GFX A;  3LO3 A;  2XO7 A;  3VCD A;  3CED A;  2R42 A;  2A2C A;  2C2R A;  3ISN C;  2XB2 D;  2OEK A;  2OTJ S;  3Q2T C;  5CCM A;  2F9D A;  3BQ0 A;  3D7S B;  4NML A;  2FJD B;  1JJ4 A;  3KNA A;  2HEK A;  4DR7 J;  4CM0 A;  2RHQ B;  3KMQ A;  5C42 A;  3FSI A;  4KYZ A;  5J2M A;  1LQ9 A;  2F8E X;  2DHS A;  3D0G E;  4K50 A;  4PCQ A;  1PO6 A;  1FD2 A;  3O8W A;  3DDK A;  1JLC B;  2DGU A;  4OYA A;  1IKX A;  3NS7 B;  1OY8 A;  4DL4 A;  3V6D A;  2BJ9 A;  1RWV B;  3OVA A;  3TJ9 A;  5IWA J;  5K9F A;  1DQ8 A;  2DEJ A;  2R2U A;  1M1K T;  2LQJ A;  5DET A;  4B3R J;  2BZ2 A;  1FNM A;  1M1H A;  3SCI E;  4PG7 A;  2FTR A;  5GAH U;  5D0G A;  2BJE A;  1KDN A;  4IFY B;  3QNW B;  2CPX A;  2HAI A;  3CJT A;  4J90 A;  4KFB B;  5F8H A;  3BM7 A;  3VAL A;  4ECR A;  1NM2 A;  2ZUG A;  5LSL A;  5HN0 A;  4F26 A;  4NLY A;  1TKZ B;  4MIA A;  3FMW A;  1OYD A;  2LKZ A;  3CCE S;  1VLO A;  4C3L A;  1FFG B;  4L3N A;  4ED0 A;  3TUP A;  1WTF A;  3JAM Y;  4KGK A;  4PYD A;  3GIJ A;  3HP6 A;  1KHV A;  3CCW A;  2ZBP A;  4JUZ A;  3CUN A;  4RU2 A;  1YI2 S;  3TAM B;  2VL1 A;  2PI5 A;  1S57 A;  1U48 A;  2QA4 G;  5HJY A;  4Z7C A;  1EET B;  1Y4Z B;  3PO5 A;  1FKO B;  4KFB A;  5D4L A;  1VC0 A;  4CQ1 A;  4YN3 B;  4P2M A;  4ECY A;  1CUL B;  1TKZ A;  5I4M A;  1AUD A;  4DV0 F;  2YXL A;  4ZS6 A;  2WBR A;  1KQG B;  3PHE A;  1YBU A;  1B99 A;  2CRL A;  4ERD A;  4FYD A;  2B6A B;  4E98 A;  1RAF B;  4OYI A;  3Q22 A;  3QZ8 A;  1RLC L;  2X7I A;  2SXL A;  3TAM A;  4FDF A;  2PII A;  4Q43 A;  4IKA A;  3CCJ S;  4J9N A;  4RW6 B;  3W9I A;  1EET A;  1FKO A;  4RNM A;  3UNY A;  4X84 A;  1SH2 A;  2HHS A;  1CUL A;  4NEZ A;  3PV8 A;  1FD8 A;  4ED2 A;  2W9C B;  2X1G A;  3EYZ A;  2VIH A;  4RNN A;  1I51 B;  2JL9 A;  2F63 A;  3CDA A;  1YRX A;  2D69 A;  4BBY A;  1X9S A;  1IBK J;  1NK8 A;  1IQZ A;  4JV5 F;  2J9E A;  4WU2 A;  4WPA A;  2CJB A;  5B0G A;  4RNF A;  3SFU A;  4URG A;  2PA3 A;  1KLM B;  1CBK A;  4Q8E A;  4RW6 A;  3GJR B;  5KFH A;  3TA0 A;  3O2I A;  2H4Y B;  1KON A;  2VA3 A;  5KFG A;  4B3O B;  1NAQ A;  1U1K A;  4C3M A;  3KLE A;  2HIQ A;  3DOK B;  4I68 A;  2BMB A;  3J7Y I;  5KFY A;  4DL3 A;  1YZ6 A;  5J1E B;  1IR2 A;  4NI2 A;  1Y5L B;  1Y00 A;  2DGO A;  1HD0 A;  5HJX A;  3R7N B;  4ZJL A;  1AYE A;  2J7W A;  1IBC B;  3CCS S;  3ZZ0 A;  3M2U B;  4J9L A;  1KQS R;  1KLM A;  1FHT A;  4QIV A;  2HZC A;  2KHD A;  2V68 A;  2VHG A;  4LRB A;  3GMG A;  2V4Q A;  3C2P A;  4B3O A;  1IM4 A;  4EFA C;  2KZM A;  3DOK A;  1XBW A;  1ZS6 A;  3FMB A;  3L3C A;  3R6G B;  1UA1 A;  4ZIT A;  4IH6 A;  3UCU P;  4NZ6 A;  3HHD A;  2LEC A;  1WSV A;  5J1E A;  1NKB A;  5KFU A;  4X4V A;  3LWM A;  2IM2 A;  4ZCK A;  2ASJ A;  1TVR B;  4XAK A;  3PYF A;  3MOZ A;  3O6Q A;  2LA4 A;  3EGN A;  2WSF C;  4WZM A;  1T0T V;  1HKA A;  5HQ8 A;  1Y10 A;  2GNK A;  3M2U A;  2Q79 A;  4CI0 B;  3S8S A;  1TU0 B;  4OJG A;  5HAO A;  3TQ1 A;  2KYZ A;  1S4E A;  3UDL A;  2DIT A;  3G71 S;  1XMQ F;  3QYY A;  1B64 A;  1TMJ A;  1N8R T;  1RAH B;  1UEV A;  3RR7 A;  2FLP A;  1RAA B;  3QGG A;  2RF2 B;  4K2J A;  1XWL A;  3D5M A;  4IYQ A;  1TVR A;  4MJK A;  2H54 B;  3RB6 A;  2A1B A;  1S1T B;  3D6F B;  3DI6 B;  1HL6 A;  5KFT A;  1HHS A;  2QO3 A;  4BHQ A;  3H8Y A;  4DR7 F;  2QSF A;  2YX4 A;  4AND A;  3PYD A;  4H4M B;  4DZ6 A;  3CDB A;  5BXI A;  1FRJ A;  1YJ7 A;  1TMM A;  2MQO A;  1UA0 A;  3MF5 A;  5B0D A;  1KC8 T;  2XZT B;  1NPR A;  5IWA F;  3ETO A;  5MLC V;  2CQB A;  1FCA A;  3W66 A;  2NZC A;  1Z2Z A;  4YS2 A;  4PWD B;  4P2S A;  4B3R F;  4ETZ A;  2GS8 A;  3GJQ B;  2RF2 A;  4RW9 B;  2MKI A;  2VBW A;  3C66 A;  4DPW A;  1S1T A;  3DI6 A;  3T6J A;  3I55 S;  2E9R X;  3R5D A;  4G1Q B;  5LL6 d;  5AT1 B;  4XPE A;  2CPJ A;  2HPU A;  2ZUA A;  2DRB A;  4H4M A;  3MGJ A;  4J5O A;  3RRK A;  4KR0 B;  3TAN A;  2EFO A;  1FRH A;  3MCM A;  1K44 A;  1VIO A;  2AHO B;  1OO0 B;  1EZZ B;  4EUV A;  1VDH A;  2R2T A;  2BAC A;  1HWL A;  4B3S J;  5D3G B;  4YFU A;  2IA0 A;  3TRG A;  5A8R B;  3HMJ G;  3M6U A;  2HNY B;  3ZTO A;  4TLR A;  2E9Z A;  4PWD A;  2AJ2 A;  2K06 A;  3NNA A;  5D4O A;  5KFV A;  4RW9 A;  2C2Z B;  4YDX A;  3H42 A;  5KG5 A;  4X4Q A;  1WD6 A;  5F3Z A;  3NAI A;  1DY3 A;  3WC0 A;  3UCZ P;  2IVM A;  2UV8 G;  5D6G A;  4CO2 A;  5DM7 Q;  2YY3 A;  3BO3 A;  4DQS A;  4G1Q A;  4B9T A;  2V67 A;  2XSJ B;  1RTH B;  2DPI A;  4EWT A;  1AW0 A;  2QJ3 A;  2IVF B;  1IUJ A;  1LNQ A;  3PTW A;  4GC6 A;  1RWM B;  2LEP A;  4CT9 A;  3THT A;  2Z2Z A;  1JXE A;  4HL9 A;  4FVC A;  5D3G A;  2E44 A;  2HQI A;  4HVZ A;  1OPZ A;  5A8R A;  4PKD B;  4HH0 A;  3MM6 B;  2YNG A;  2KVI A;  2HNY A;  4HAC B;  2HS4 A;  2ROP A;  1B4S A;  1HWK A;  4K4X A;  1CS4 B;  1ZOT A;  2EFP A;  4F7V A;  1H72 C;  5HLF A;  1D9F A;  3MM7 B;  1UVI A;  3PX4 A;  2E66 A;  3AOC A;  5HMX A;  2JSX A;  2ZKT A;  3HM9 A;  1S9F A;  5FLX Y;  2C42 A;  3I5C A;  3K59 A;  2K2P A;  1ZM9 A;  3A8I A;  4PYA A;  1FNX H;  3JSM A;  3FNN A;  2B8Q A;  3HO1 A;  1RTH A;  4LFC J;  1RAJ A;  1U47 A;  3HKW A;  4CWB A;  5CAA A;  3MED B;  5D78 A;  5H9E J;  4ZIV A;  4ALZ A;  3IBC B;  5B0A A;  4IG3 B;  1ICE B;  4RU9 A;  3MM6 A;  1FFS B;  2XBP A;  1IBK F;  2YWG A;  4IRD A;  1CS4 A;  3K0J A;  1X8D A;  1ZM2 A;  5CYQ B;  2CJQ A;  5F0U A;  3DCA A;  3GCX P;  4CO5 A;  4O3O A;  2BM0 A;  2MZQ A;  2OSQ A;  2FJB B;  2VPZ B;  2VA2 A;  2BE7 D;  5LJ3 Y;  5GMD A;  1S6P B;  1F60 B;  2XS5 A;  1WKJ A;  2NYH A;  3PRB A;  1VBK A;  5AJ3 J;  3CTR A;  3MED A;  2IDE A;  3LGN A;  2FC8 A;  4IG3 A;  2OPP B;  3ISN D;  4JI3 J;  4KIA A;  4OI2 A;  2KKH A;  2XM3 A;  5I42 B;  3RZA A;  2VKZ G;  1RYS A;  1WOO A;  3TYT A;  4UOG A;  3NWG A;  1PYT A;  2G2Y A;  4E2F B;  2Y3Y A;  3D6T B;  4Y2M A;  1H7X A;  3IWN C;  3R5B A;  1FKP B;  1TQL A;  3MMC B;  4KGZ B;  4XDC A;  1S6P A;  2B9X A;  1U02 A;  3PW5 A;  1U8S A;  3SCL E;  1TK8 A;  2ZM6 J;  2BJD A;  3I5B A;  3FSX A;  2OPP A;  1YJR A;  4J37 A;  5EGY A;  2H5E A;  5FJ4 A;  1IKV A;  2B7B B;  4TU8 A;  1UZD A;  2MDA A;  1MN7 A;  4NA3 A;  3NNH A;  3Q8U A;  2DNZ A;  5I42 A;  1JLG B;  2Y0B B;  4KGV B;  4LF8 J;  4HHJ A;  4KRW A;  4U6P A;  2HVZ A;  2IJR A;  2EBG A;  1RT5 B;  4DL0 C;  3OLA A;  5A6P A;  3HFK A;  2FHJ D;  4CO3 A;  3P6Y C;  3PXG a;  1D0E A;  1FKP A;  3MMC A;  3GSD A;  3Q83 A;  1UVK A;  4C97 A;  2CQ0 A;  4WTO B;  2KRR A;  2B5J B;  1JXL A;  3GYG A;  4P73 A;  3DGP B;  4U95 A;  4X4T A;  3AJ1 A;  4TY8 A;  2GMH A;  3D67 A;  2VDH A;  3GII A;  5KFI A;  2MHE A;  2FZK B;  3W61 A;  4QQB A;  2B0G A;  2XMU A;  2F4F A;  1JLG A;  4MK9 A;  5IQQ A;  1KLN A;  4NYP A;  1RT5 A;  1NND A;  3QSI A;  1RAI B;  1ROF A;  2B4P A;  3G2X A;  1BMQ B;  1DBD A;  5ETS A;  2R4F A;  1K1S A;  4HH1 A;  2LA6 A;  3HVT B;  1IR0 A;  3CIZ A;  2B5J A;  2WB1 D;  1LWC B;  3DGP A;  4AXJ A;  4U7U D;  5D8H B;  4ELT A;  2E1P A;  3PJW A;  1OS5 A;  2DGQ A;  4LRC A;  2ZZN A;  2C2O B;  3EUN A;  4ZOS A;  4Q2M A;  1J5E J;  5HP1 B;  1FDA A;  3D9B A;  2W7A A;  1WOP A;  2Z2L A;  4KSE B;  3H5U A;  2CIM A;  4HKQ A;  2BYC A;  3M4X A;  4MIW A;  3EWG A;  2VH7 A;  2UUA J;  1S9G B;  2DRD A;  2JOQ A;  2HVE A;  2V63 A;  4KPC A;  1R0C B;  3TP2 A;  4NLS A;  3MTK A;  3FDS A;  3UQS A;  2VBZ A;  3HVT A;  4KH0 B;  1QLN A;  2V2V A;  3A12 A;  2BX6 A;  1LWC A;  4B3S F;  1ULR A;  4ZHR A;  2YNF B;  1NB2 A;  3NCR A;  4PPZ A;  1MNE A;  8ATC B;  2RRA A;  3ELH A;  4L3K A;  5HP1 A;  3OVB A;  3PJ9 A;  1K0V A;  1U2C A;  2MLY A;  1AFJ A;  2OPR B;  4EZ6 A;  5E3P A;  2RVJ A;  1S9G A;  1HFE L;  2J8S A;  3M8Q B;  2XI3 A;  3BJY A;  3V6K A;  4OJ1 A;  1GNK A;  4NLT A;  4ED6 A;  3Q8R B;  3R7B B;  3NEK A;  3OHA A;  4I2Q B;  2YPZ A;  1OQ3 A;  3G4S S;  3D68 A;  5M2P A;  1LWF B;  3K5N A;  4LRA A;  3MEG A;  3IP0 A;  3A8J A;  2ZH7 A;  4RW8 B;  4NZ0 A;  1FTR A;  2FC9 A;  3GG1 A;  2DNP A;  1D8Y A;  1ELO A;  3G82 A;  1FXR A;  4LQ9 A;  2GIF A;  3RRH A;  3M8Q A;  5F8M A;  1H74 A;  2FB0 A;  1YJV A;  2HUR A;  5ADZ A;  4LFC F;  3JYT B;  2NLW A;  2V50 A;  4YME A;  3GV7 B;  2LQ9 A;  2PO4 A;  3U7J A;  1G7C B;  4IUF A;  1LWF A;  4ELV A;  1E6V B;  1YGY A;  1T11 A;  5B0B A;  2XHC A;  1KHW A;  2I6W A;  1B7Y B;  3GCW P;  3LP0 A;  2J9D E;  4IG0 A;  4RW8 A;  2ZDO A;  1YRT A;  2L9D A;  3PCO B;  2M8D B;  2ATC B;  4Y2A A;  2Q6B A;  1Q8B A;  2EC2 A;  2VAS A;  5HBM B;  2KXN B;  3EE3 A;  3NS5 A;  3HFV A;  1A9N B;  5K8N A;  5M2R A;  4O0N A;  5HQM A;  2GCF A;  1QUV A;  5ETL A;  2OUG A;  3HHL B;  4C8K A;  4HI1 A;  4ER8 A;  3Q89 A;  2RU9 A;  3JYT A;  1DQA A;  2CJY B;  5AJ3 F;  3FBE A;  3KNG A;  2XLK A;  4LR9 A;  5KFX A;  5KFM A;  4F3O A;  2CFX A;  2UUW A;  1RT2 A;  2D3U A;  1E6V A;  1Z4U A;  4JI3 F;  1IKY B;  3MCN A;  1JLA B;  2DBB A;  3HHK A;  3SV3 A;  2QIF A;  3T3F A;  4RWX A;  3OXG A;  5CYJ A;  1U45 A;  3D1Q A;  3P49 B;  1AZS B;  1SIW B;  5HBM A;  4O3R A;  1WG5 A;  1SI9 A;  3LW5 C;  4ZP6 A;  2ADB A;  2J9D A;  3I0S B;  2ZWO A;  3ZTS A;  1Y7P A;  2VC0 A;  3HHL A;  3P4U B;  4TVA B;  1TL4 A;  2G0J A;  2J0S D;  1YHQ S;  1Q16 B;  3MM8 B;  1S1X B;  1ZA2 B;  3UD3 P;  1F3F A;  2R8I A;  2CG4 A;  1JJH A;  3GIL A;  2ZM6 F;  2NYI A;  2ZD1 B;  5F41 A;  2J0W A;  1KEK A;  1IKY A;  3N6N A;  3QT5 A;  1JLA A;  3MPY A;  5IFM A;  4OYP A;  2UP1 A;  1W2I A;  4LJM A;  2UVR A;  4N8O A;  4DL2 A;  1AZS A;  4N7T A;  4LF8 F;  1K0T A;  5KFZ A;  4CYU B;  4CRJ A;  3QAE A;  3M6X A;  4MMO A;  1FDB A;  3OR2 B;  2WBM A;  5A2Q U;  1N56 A;  4R5P A;  1Q5Y A;  3P5B P;  1HWI A;  3IWL A;  2DXE A;  1NSA A;  1R8A A;  2OI2 A;  1IVZ A;  3MM8 A;  1S1X A;  2RUS A;  2YX1 A;  3SYZ A;  4C7Q A;  3E01 B;  1B0P A;  3WX4 A;  2J76 E;  2ZD1 A;  3QFH A;  3TJA A;  3UDV A;  3K5O A;  3GIR A;  1NEE A;  3GON A;  3VGS A;  1AA1 B;  3CDE A;  2EXU A;  3DOL B;  2O3D A;  2V8H A;  2ZH5 A;  1S0N A;  2RSQ A;  5H9F K;  4USU A;  4N8N A;  3CDU A;  4CYU A;  2C3P A;  5LSO A;  3JTN A;  3OR2 A;  2DNY A;  4KJI A;  5A2Q Y;  3MXH P;  1LXN A;  4PXD A;  3TAR A;  2A6O A;  4KHR A;  2XNQ A;  5CD4 A;  1N5T A;  3BBC A;  4NEY A;  5H9F J;  1C0U A;  3R27 A;  4C8L A;  3V6J A;  2DH9 A;  1GMV A;  3BGO P;  4JYA J;  4TU7 A;  2QA2 A;  2DGW A;  1J5E F;  2BE2 B;  4OZ0 A;  3FSY A;  2N3O A;  4DR3 J;  3DOL A;  2HHQ A;  3UN3 A;  2AF6 A;  1NJZ A;  5GAD I;  4DSI A;  1WEX A;  3OV7 A;  4FPI A;  2UUA F;  3I31 A;  3MEC B;  2CJ9 A;  1BXN A;  2GMJ A;  3PY8 A;  5DLF A;  1DAR A;  2VBY A;  1REV B;  2V8D A;  3C6U B;  1TUV A;  1PKU A;  1R0A B;  1TFY A;  3DRP B;  1N32 J;  1CJU B;  4OYB A;  3IR5 B;  3LP2 B;  2NXN A;  2MY8 A;  5KOW A;  5JVH Q;  4CLL A;  4PG4 A;  2CQ1 A;  3R8Y A;  4OV1 A;  2BE2 A;  3KG4 A;  3M8Y A;  4K5R A;  3Q24 A;  3ZZT A;  3DRY A;  2A10 A;  4ID8 A;  1Q5V A;  4HLB A;  2E7W A;  2PEB A;  3M2R B;  5J1N A;  3MEC A;  3GJS B;  5KFK A;  3H5X A;  1L3S A;  3C6U A;  5T7L B;  1R0A A;  3DRP A;  1CJU A;  4ETX A;  1S7H A;  2LLZ A;  3LP2 A;  5L39 A;  3C46 A;  4ZVF A;  3BRE A;  3DLJ A;  2AKW B;  2K3K A;  2HRY A;  3AXK A;  2R7S A;  5HAN A;  1GMW D;  1FXL A;  1RWX B;  1F9E B;  3OFF A;  1CQM A;  2H1Y A;  1SQE A;  2H5I B;  3T1A A;  4J9R A;  3F41 A;  2V94 A;  3OTO J;  3ILJ A;  4LF5 J;  1BD6 A;  3KHR A;  1N5Y B;  3M2R A;  1HBN A;  3EGW B;  3SSQ A;  1LK5 A;  4OHZ A;  2CUY A;  2W4C A;  5IT9 U;  2QSW A;  3MAA B;  4GKK J;  5T7L A;  1YVF A;  3DKD A;  1JLF B;  3VR1 A;  1UWB B;  5AE1 A;  2HK2 A;  1WEL A;  4DLG A;  1VQ5 S;  1HHQ A;  4AXI A;  3TO8 A;  4NZ7 A;  1HR0 J;  3IAS 9;  2DIU A;  1ZPV A;  3POT A;  2UXB J;  2MY7 A;  4OI0 A;  2AEM A;  1WI6 A;  4B9U A;  1VQL S;  1U4B A;  1WC3 A;  1TL7 B;  4ZN1 A;  5KFA A;  1N5Y A;  1A7G E;  3KLF B;  1MWZ A;  1IKW B;  2BV3 A;  4OHW A;  5DJB A;  3K2Y A;  3MAA A;  4M5I A;  1F3V A;  1V3S A;  2MST A;  1C1C B;  4NYO A;  2GC8 A;  2CQH A;  3B6B A;  2FJA B;  4ECS A;  4OZ3 A;  1UWB A;  4FP9 A;  1NSQ A;  1FRI A;  4WII A;  1XTZ A;  5EX0 A;  1T3N A;  5L1J A;  2QMX A;  9ATC B;  4YB6 A;  3DDI A;  4Q0B B;  3DHW C;  2GHV C;  2C2N A;  4OHX A;  1YJ9 S;  1Y5I B;  2ROE A;  3TVK A;  4F8R A;  3OJS A;  2L3M A;  5L9X A;  1TL7 A;  3KLF A;  2GJI A;  1LOU A;  4ZDN A;  1IKW A;  2V2K A;  4A8O A;  2RQ4 A;  1U7L A;  2F40 A;  2OP5 A;  1KP6 A;  3D1O A;  4WK1 A;  4ZPA A;  1HMV B;  1C1C A;  5K14 B;  4Y34 A;  1YIJ S;  2W2Q P;  4ZK7 M;  5KT7 A;  4YDD B;  4V19 X;  3CD6 S;  4DFP A;  1U0H B;  2FZG B;  5C5J A;  4KAI A;  2ALZ A;  2JVR A;  2J0X A;  2P9C A;  2D3O R;  3FZB A;  4RUH A;  1VGY A;  4EO6 A;  3U1L A;  4A8F A;  4Q0B A;  3W63 A;  1LWX A;  4WCE Q;  1HNI B;  4AFF A;  3DRX A;  2YNI B;  2YTC A;  4IH7 A;  1RJJ A;  2DYA A;  1NDP A;  3ZNJ 1;  2DNQ A;  3KJN B;  2UVV A;  3PKM A;  3SI8 A;  1NKE A;  4TKT A;  4FYX B;  1WUU A;  4F4K A;  1HMV A;  4LBP A;  3W5Y A;  4XDD A;  5K14 A;  3OR1 B;  3B8H A;  2O01 C;  3VAG A;  1PCA A;  4KHM A;  2W4D A;  4RBT A;  2IY5 B;  2C22 A;  1RCO B;  2CQI A;  2ZDP A;  4J9K A;  3K89 A;  1XK8 A;  1U0H A;  3QWP A;  5DS7 A;  5I3P A;  4J9M A;  5KFO A;  5ETR A;  3OL7 A;  4ES1 A;  2HZV A;  1FEE A;  1PC5 A;  2Y1L B;  4J91 A;  2WB4 A;  2QLF B;  4K4U A;  1HIY A;  1HNI A;  3GFZ A;  5SZT A;  2FQQ B;  4PZV A;  4DUZ J;  2YNI A;  3CJS A;  2X3D A;  2FGO A;  4G3I A;  4DSL A;  7FD1 A;  4CIO A;  1V3Z A;  1H7W A;  1RDR A;  1RHQ B;  4Z7Y A;  1TL1 A;  1O5J A;  3BGL A;  4I6W A;  1VC6 A;  2ATL A;  3L7U A;  1NKC A;  3OR1 A;  4X4N A;  1KKH A;  2JRS A;  5LT5 A;  1XNR J;  1U1N A;  4ZVG A;  2MKC A;  2AYB A;  4JYA F;  2B4O A;  3QO9 A;  3BYR A;  3CC4 S;  4CP5 A;  4YQW A;  2AYG A;  1CVJ A;  3PYG A;  4QW9 A;  4DR3 F;  2NZ4 A;  3UW1 A;  3VGU A;  3H25 A;  1V9O A;  2I38 A;  2HQC A;  1RAB B;  2VPX B;  4L72 B;  1GXT A;  1RGV A;  3GU0 A;  4JBC A;  4FF2 A;  4QZV B;  2YWK A;  2RS2 A;  1FE4 A;  1N32 F;  5I3U B;  4URS A;  3OBI A;  2VQE J;  4QIE A;  2ZJQ Q;  1NK0 A;  3W2V B;  4LUB A;  1UET A;  3TWZ A;  1B3T A;  1X9M A;  1RB0 A;  4P9S A;  4ZVO B;  3ZTQ A;  2LDY A;  2X1A A;  1X0P A;  4ZPT R;  2MQQ A;  1T94 A;  3ENA A;  4OYX A;  5U47 A;  1R8P A;  1SL2 A;  2HK3 A;  5CQG A;  3NNC A;  2L41 A;  1X4F A;  2DPJ A;  5E3R A;  3CJR A;  3HCX A;  2OD4 A;  4L74 A;  4C8Y A;  2ZH1 A;  1Q8L A;  3UVJ B;  3DLE B;  3B4D A;  3HZG A;  3TZZ A;  4KT0 C;  4ZKA A;  4K59 A;  2KH9 A;  2H5J B;  2GFF A;  3BSN A;  3CC2 S;  3GWC A;  3SEO A;  4M1K A;  5KG0 A;  3W2V A;  1PIL A;  3R5C A;  3NCP A;  1RXO B;  2DO0 A;  1QJH A;  2DCU B;  1T03 B;  3OTO F;  3C14 B;  2FVC A;  2Z30 B;  4LF5 F;  1SBR A;  4DCJ B;  1XR7 A;  2R8J A;  2ASD A;  4X62 J;  2XY6 A;  5J1P A;  4GKK F;  2MZR A;  1QTN B;  4LQ3 A;  3UVJ A;  3DLE A;  2E5G A;  5IT4 A;  1U1P A;  2MJU A;  3I9Z A;  2UUB J;  1WC0 A;  4ATN A;  2V5H G;  4J9V A;  3V81 A;  2FHK A;  3BKU A;  1HR0 F;  4EYI B;  4KB7 A;  3KLG B;  3W8G A;  5HRO B;  2UXB F;  2CXE A;  3KUG A;  5L38 A;  3R1L A;  2WVF A;  1T03 A;  1KFS A;  3CJ0 A;  4YR0 A;  3C14 A;  4N56 A;  1S7I A;  3PR5 B;  3HPO A;  3AH6 A;  4FNI A;  2DK2 A;  2PMH A;  1ZM3 A;  4QPX A;  1T9X A;  2COL A;  1RQ0 A;  5L9N A;  3CPW R;  1JKH B;  3DHX A;  4PAA A;  3U27 A;  5GAH I;  2KM8 C;  3FBC A;  2QL9 B;  4RX6 A;  2XMJ A;  3W9J A;  4IOC Q;  3BN7 A;  1U1M A;  5HRO A;  2PC6 A;  4ED8 A;  2NSB A;  1J5O A;  1ZET A;  4XTT A;  4UOF A;  3VAH A;  3O1L A;  3J80 Y;  1BQN B;  2QLJ B;  2OTL S;  1KOO A;  3HSZ A;  2RUG A;  2DNN A;  2I8E A;  4UZC A;  2KT2 A;  1CJV B;  5LSR A;  1YJN S;  2RIL A;  2MGZ B;  1F5B A;  2HHW A;  3LTO A;  1B0V A;  1Q8I A;  1JKH A;  1N5S A;  2ABY A;  3VQT A;  3H20 A;  2FVS A;  4ZVP B;  4UOH A;  4NLQ A;  2HHV A;  1NPP A;  1C2P A;  3KK2 B;  2NRE A;  3RW7 A;  2HS3 A;  4KTQ A;  3UI3 A;  3C16 B;  2NR0 A;  3EXC X;  2ZBR A;  3RYL A;  2KT5 A;  2HHX A;  1SCJ B;  3G86 A;  4TYB A;  4YP3 A;  4BDP A;  4WFA Q;  3EIC A;  4X64 J;  1HNX J;  3EPG A;  3R1H A;  1CJV A;  1UEU A;  1GX6 A;  1S1U B;  2MGZ A;  1Q81 T;  2IJF A;  5D0H A;  3H7H B;  2PA8 D;  2YWF A;  5B7W A;  1T95 A;  1VC5 A;  2DHG A;  3BQ2 A;  4ZPB A;  3HJF A;  5DGA A;  1TAU A;  4A8Y A;  3LH2 S;  4R25 A;  3KK2 A;  5A8K B;  1EIY B;  4DCP B;  1R6V A;  4CLU A;  3KG1 A;  4CTA A;  1FT8 A;  4HHU A;  3C16 A;  2JWN A;  3F44 A;  4DHV A;  2V8P A;  4NOH A;  4NAS A;  4DUZ F;  3UWT A;  4YUD A;  1MWQ A;  4DSF A;  3QID A;  3O5T B;  5L8R C;  2B7C B;  1I5O B;  1S1U A;  1G2E A;  3C6T B;  3LPY A;  1X4B A;  4DFK A;  1XNR F;  1R0B G;  3A8E A;  4BC9 A;  1M5P C;  5IT0 A;  3H4D A;  3EVO A;  4I64 A;  2O5D A;  3FQK A;  1N34 J;  3NAH A;  1QTM A;  1RI7 A;  5A8K A;  1N5Q A;  4I56 A;  2CQC A;  1FVS A;  1RTJ B;  1VQK S;  4PUO B;  4LMZ A;  4FF4 A;  4YEA A;  4TLQ A;  2ZH8 A;  3QT6 A;  1RHK B;  1K1Q A;  4K7Q A;  4NMX A;  2MKJ A;  1TKT B;  1BC6 A;  2M2B A;  2B51 A;  2MQL A;  3M8Z A;  3C6T A;  3MD1 A;  1WDT A;  3JSY A;  2AU0 A;  1TUG B;  3FGV A;  1R27 B;  2X3G A;  3M32 B;  3M9M B;  1VJW A;  2F9J A;  2VQE F;  3OL9 A;  4O3N A;  2HLU A;  2ZC3 A;  5G0R B;  1W25 A;  2MJN A;  2IAJ B;  3TVY A;  2X51 A;  1CSJ A;  2ZNY A;  1RTJ A;  4YB7 A;  2UU9 J;  2W8L A;  3OFE A;  5E7O B;  3UN2 A;  3P5T L;  1SXL A;  2MKH A;  5HK4 A;  2FPH X;  1TKT A;  3LP1 A;  3TJ8 A;  1C1B B;  2RNE A;  2JEG A;  1ZAW A;  5CZV A;  3RW6 A;  4QWA A;  4OX7 A;  3RTV A;  4QBU A;  2DR9 A;  3C15 B;  1QAI A;  3M32 A;  1AXQ A;  1J27 A;  2F8M A;  4QIW D;  4QWB A;  2CVI A;  5G0R A;  4JI5 J;  2QYC A;  3CC7 S;  1S49 A;  3TA1 A;  3UE2 A;  1F5C A;  3QAT A;  3ICL A;  2ZJR Q;  2J6T A;  1N4L A;  2IAJ A;  3A3O B;  2HMI B;  2HYI B;  3A1Y G;  3DLB A;  1U6Z A;  2V9W A;  1S10 A;  4DR4 J;  5IC4 B;  2KO1 A;  1UVM A;  1N36 J;  2O66 A;  4RUB A;  4KHP J;  2DNR A;  4X62 F;  3L09 A;  2HQG A;  3RBE A;  5CCL A;  4K2X A;  3D1H A;  3D0I E;  1C1B A;  1VFJ A;  2DHX A;  1SPB P;  2UUB F;  2WVE A;  3AJD A;  4O23 A;  2R7U A;  3C15 A;  1HHT P;  2MZS A;  2YKP A;  4DL5 A;  2KDO A;  1C0T B;  3O3L A;  3QRP A;  1S4F A;  2V2Q A;  1WC6 A;  4DN9 A;  1KRP A;  3DRR B;  2HMI A;  3BBB A;  1RTD A;  4F50 A;  1WHY A;  2Z4P A;  3D0H E;  2GAH C;  3VVU A;  3KHL A;  2HHP A;  4ECT A;  1LW0 A;  4CO4 A;  1X4E A;  2QG9 B;  5EX3 A;  1QVF R;  2W2N P;  5E3C A;  3M2V B;  1S5Z A;  3C3L A;  1SKS A;  4L73 A;  4B9V A;  4GMK A;  4WFX A;  3W8P A;  2Z2M A;  1MMN A;  3N9U C;  3M8R A;  4LRD A;  4DF8 A;  4ED5 A;  2YH1 A;  1UTA A;  2V2Z A;  1CQN A;  1P1T A;  2GVD B;  2OD6 A;  4EBE A;  2HG4 A;  1UAW A;  4FYW B;  4OYM A;  4WKR A;  2OPS B;  2PMW A;  2U2F A;  1SH3 A;  1XMO J;  1Q86 T;  3DRR A;  1RK8 A;  2HND B;  4MKA A;  4OX8 A;  1O6X A;  3NCQ A;  4P7V A;  3M2V A;  2B9Y A;  2MXY A;  1JLQ B;  4KE5 A;  2IYI A;  3M9O B;  3RAM A;  3OQ2 A;  4I0W A;  4R0J A;  1P27 B;  4I4B A;  3WDO A;  1S0V A;  2NPI A;  4ANE A;  3A3P B;  1BHN A;  3L9Z A;  1OY9 A;  3CO9 A;  1TAQ A;  2GVD A;  1ZAX A;  4DLE A;  2OPS A;  2LEB A;  2PMZ D;  4P10 A;  2HND A;  1R3N A;  3A3N B;  3TOQ A;  4F3Q A;  4X64 F;  1W2B R;  1HNX F;  3FC9 A;  2ZH2 A;  3KYL A;  2EK6 A;  1RZM A;  4DEZ A;  4MH8 A;  1JLQ A;  2GQQ A;  4EO8 A;  2EKY A;  1T9U A;  1U6F A;  3I56 S;  2E1C A;  3PEJ A;  2HBQ B;  3GV8 B;  3UDC A;  2L9N A;  4Q2L A;  3RRG A;  1K73 T;  1S99 A;  2KFY A;  3PVX A;  4M5J A;  4B3M J;  1P6T A;  2WVC A;  4RNH A;  1BUX A;  2RH3 A;  3UD5 A;  4UY8 T;  4MIB A;  2IJN A;  1GH8 A;  3N0V A;  4W98 A;  3ENQ A;  2W1B A;  3LPE A;  5EWE A;  5G4D A;  3CCL S;  1RWN B;  3FVY A;  4CLF A;  4DV6 J;  2ZE2 B;  4LVO P;  3NOC A;  1LFP A;  2WSC C;  2W2P P;  2DB1 A;  3I6P A;  4NLP A;  3NG8 A;  1S59 A;  4WE1 B;  3IN5 A;  3CW2 C;  1N34 F;  3QRR A;  2EFV A;  3KLH B;  2DGS A;  4OZL A;  2NPF A;  3BO4 A;  1XQI A;  2XYG B;  1P9Y A;  3PYE A;  2JLG A;  3KUH A;  4NLR A;  5EDW A;  4LR7 A;  1JB0 C;  2G13 A;  1T02 A;  3SCJ E;  5ETV A;  3Q8Y A;  5GME A;  2AJF E;  2DRA A;  5F3T A;  1O8B A;  3ET6 B;  2XTJ P;  2ZOG A;  2J5A A;  1VYA A;  4B9S A;  5IV3 A;  1FX4 A;  4JI6 J;  4RUA A;  3IG1 B;  2ZE2 A;  4ZJQ A;  2ROG A;  3JQK A;  2OFH X;  2YH0 A;  4H4O B;  5D4P A;  2OJ3 A;  5HAT A;  1GMU A;  4WE1 A;  2R2S A;  3KLH A;  3P8B B;  3CJ2 A;  3CIM A;  3M30 A;  2UXD J;  1Q8K A;  4EZ9 A;  2KVQ E;  2UU9 F;  2DHA A;  4B17 A;  2XMV A;  5A0Y B;  5KFJ A;  4PR6 A;  4YR3 A;  1WG1 A;  1RP5 A;  3ET6 A;  3H2V E;  4QR1 A;  3EZ5 A;  3CXC R;  2BRK A;  1U09 A;  4FNH A;  3RB0 A;  3QAU A;  5E33 A;  1L3K A;  1V3R A;  3IG1 A;  3VWS A;  3K58 A;  4AE5 A;  1KQF B;  3FQL A;  5AXK A;  2I2Y A;  1Q53 A;  4H4O A;  3FCV A;  4CLP A;  1H98 A;  3NL0 A;  2MLX A;  4CZC A;  3NLC A;  3N6M A;  1D8Z A;  4JI5 F;  3EZO A;  3PFO A;  3TA2 A;  4YHH J;  2Y1I A;  2DNG A;  4IRK A;  1GAO A;  1QM9 A;  4FS1 A;  4WP8 A;  3TZY A;  2ZBI A;  3J7Z T;  4UQT A;  5A0Y A;  1WSR A;  4DR4 F;  2YNH B;  1F2G A;  1PIE A;  2Q1L A;  2W25 A;  1RKJ A;  1N36 F;  4NA2 A;  4DV5 J;  4KHP F;  4W90 B;  2NXJ A;  5DG7 A;  2XZD B;  1SJ3 P;  2FYX A;  3BPD A;  4ED1 A;  3PO4 A;  3MFI A;  2AJ1 A;  3C19 A;  1VQN S;  1VQM S;  1N52 B;  2OHD A;  3VZI A;  1RKI A;  3K57 A;  3PX6 A;  3S01 A;  2V34 A;  4YR2 A;  2KG1 A;  4OI4 A;  2WSE C;  2VBX A;  2RIJ A;  5KFS A;  1LKZ A;  2MSS A;  3UCG A;  2RU3 A;  4TYA A;  3MAH A;  2VFV A;  8AT1 B;  3AQP A;  2FVQ A;  3GR0 A;  3SMZ A;  3P96 A;  2ZBQ A;  4PG8 A;  2CNO B;  4ES2 A;  1FTC A;  2AYE A;  2YNH A;  2FJV A;  2MQN A;  4FXD A;  4DV1 J;  1SVD A;  4UT4 A;  4USM A;  3HVW A;  2ZWP A;  5KOX A;  4N47 A;  1EQM A;  1EAY C;  1N5V A;  4FBT A;  4JI0 J;  2G2O A;  3TI0 A;  4DX8 H;  2D3O 1;  1Q78 A;  5J2Q B;  4DR1 J;  3D66 A;  1S0O A;  4JI4 J;  2HWT A;  2BA9 A;  5DDQ C;  2AX1 A;  1D9D A;  3MUR P;  2CZ4 A;  4HYK A;  4C98 A;  2V6A A;  4XK8 C;  3KLE B;  3GP9 A;  2VJV A;  1HAR A;  2NXC A;  4QYZ J;  1XMO F;  1HW8 A;  3CCU S;  2GQ2 A;  5L1K A;  4X4P A;  1YSJ A;  2G1H A;  5KT3 A;  2I1R A;  3BB5 A;  5LXR A;  3N01 A;  4FS2 A;  2CPD A;  1VI7 A;  2CQP A;  3M9N B;  2C1E B;  2AGQ A;  4NI2 B;  4OYZ A;  3MAQ A;  1HNZ J;  1DQ9 A;  1J2V A;  1X0F A;  5A6W A;  2LMI A;  5J2Q A;  2L9W A;  2M88 A;  2Y1J A;  2R8K A;  5HI7 A;  2H4W B;  1IN0 A;  4LSN B;  4WYL A;  4F0M A;  3BPS P;  3TVZ A;  2RDD A;  3ADA C;  1SJQ A;  4GVL A;  2Z56 B;  4UQG A;  3ONQ A;  4OV6 A;  1T3O A;  3A8K A;  1XR6 A;  3GIK A;  1UW9 A;  2UUC J;  3MM9 B;  4CO0 A;  5GMK a;  1JWW A;  1N6Q B;  2W2M P;  4CDI A;  1U1L A;  4EYH B;  1QAJ A;  2C3U A;  1Y0H A;  4PWW A;  1PGZ A;  3OTD A;  2J6U A;  1JX4 A;  5IZH A;  3CB4 A;  1Z1Z A;  2WW8 A;  4WF9 Q;  4LSN A;  3BQ1 A;  2BJ8 A;  4NCG B;  2HLT A;  3TNV A;  2MQP A;  3VAF A;  3LF0 A;  2HIY A;  4O3P A;  4B3M F;  3M1V A;  4LRF A;  1WEY A;  1S97 A;  3D3B J;  4DZD A;  2FHM A;  2Y8Y A;  2CPH A;  1DJ0 A;  3MM9 A;  4A48 A;  4QIG A;  3MD3 A;  1N6Q A;  4H54 A;  2WON B;  4DV6 F;  3V4M A;  5J2N B;  2BXJ A;  3IWX A;  2QLB B;  2BEF A;  2A2D A;  1IQT A;  1JXV A;  4LFA J;  1T9T A;  5T41 A;  1NCL A;  5KG7 A;  3N5F A;  1X4D A;  1U24 A;  4ENO A;  4NCG A;  3HKZ D;  4U7C A;  1N48 A;  4DV3 J;  3EXY A;  2VFS A;  4C8Z A;  2QGF B;  5LOQ A;  4X4S A;  4UUX A;  3KJQ B;  3SIP B;  1U6B A;  3R5A A;  1XNQ J;  1NK4 A;  1IXK A;  3QGH A;  2WON A;  4JI6 F;  4RUC A;  2NXE A;  4QW8 A;  5J2N A;  3K8V A;  3OW2 R;  4OZJ A;  2CPI A;  3T5H A;  2Y8W A;  5CZX A;  1TKD A;  1KVJ A;  1UCN A;  4G6V B;  3AJ2 A;  4DF4 A;  3HT3 A;  3MWB A;  1NJI T;  4RKU C;  2UXD F;  2DGX A;  3PJX A;  3KDN A;  2V69 A;  2F65 A;  1VR6 A;  2ZOF A;  2OAU A;  3CVK A;  3BBF A;  1RHU B;  4A8W A;  5DG8 A;  4AQY J;  1SUQ B;  4F25 A;  3E2E A;  1EKR A;  2VV5 A;  1VQ9 S;  4NPO A;  3I4P A;  2MMY A;  5MAO A;  3QFW A;  2JLE A;  3HZE A;  3W3S A;  4DFM A;  1UEK A;  4K4Y A;  1L3U A;  4ZN3 A;  4FVM A;  4LRE A;  2QEX S;  3SSR A;  4LSL B;  2L48 A;  1FJG J;  2CAJ A;  3Q23 A;  3ZXW A;  3N79 A;  4YHH F;  5B08 A;  2CDQ A;  4N76 A;  4YB5 A;  4RNO A;  1RU2 A;  3TEH B;  2HHU A;  4UTG A;  1TUW A;  1UFK A;  4NLU A;  2PSZ A;  3KLV A;  2VZ9 A;  1QY7 A;  4DV5 F;  5DQI A;  1UL3 A;  2YNG B;  2HFU A;  3RJM B;  4CNY A;  1SB6 A;  5DZ7 A;  1JNZ B;  4MK7 A;  1PJ7 A;  1SUQ A;  4S0M A;  1RA6 A;  2DO4 A;  1E6Y B;  4JV0 A;  2CYY A;  5HLF B;  5KT5 A;  2E7V A;  4QU6 A;  1HNV B;  1T9W A;  2N3L A;  3TZW A;  3CO0 P;  3GB0 A;  1VBZ A;  1HPZ B;  2HWI A;  2OMO A;  4NLO A;  3IRX B;  1IBM J;  3MEK A;  4BWJ A;  5DGB A;  2ASY A;  1O0P A;  3IO1 A;  3BKF A;  3JSM B;  2ZHB A;  4LSL A;  1AUS L;  3KJV B;  3KG0 A;  2M4M A;  4Q5V A;  1X5P A;  3ZTP A;  2YKM B;  2BOA A;  3CCR S;  2CJX B;  4DV1 F;  1QSL A;  3R97 A;  3H59 A;  1X4C A;  2D1C A;  1NRK A;  2MEW A;  3CD5 A;  3CJ5 A;  1LFW A;  4JI0 F;  2LYV A;  1E6Y A;  2RT3 A;  4M5H A;  5AXM A;  4DR1 F;  3BYP A;  5H9E K;  4JI4 F;  1HNV A;  1HPZ A;  1U1O A;  3IRX A;  3MI7 X;  5KFQ A;  3GIM A;  1FK9 B;  1VOM A;  2PE8 A;  1NK7 A;  5GAG U;  3GLJ A;  3HVA A;  2CJA A;  2KJV A;  1SJ4 P;  1GTH A;  2YKQ A;  3KJV A;  4JI1 J;  2ZFH A;  4XPC A;  1WF0 A;  2KJW A;  3HVR A;  2YKM A;  1DRZ A;  4M5K A;  3R7S B;  1ITP A;  4OQJ A;  2EKN A;  2ZBC A;  3IBF B;  3Q8V A;  4ZP8 A;  2HVH A;  1R7I A;  2CQ3 A;  4EEY A;  2AJ4 A;  1H3D A;  1LWE A;  1HNZ F;  2QL7 B;  4B9M A;  4C48 A;  3W2W B;  2A0F B;  4IR9 A;  3FBB A;  1SJF A;  1JMT A;  2QMU B;  2R9L A;  4KGX B;  3VVT A;  4KBI A;  3IR6 B;  1QSS A;  1KN6 A;  1DUR A;  2QT7 A;  2FD2 A;  1FK9 A;  4OMF G;  3HUL A;  4LBI A;  4U8V A;  2QLX A;  4R0E A;  4DPY A;  3H4B A;  2I0X A;  1IWA A;  3N4W A;  3DGV A;  2KM8 B;  2ZVI A;  4I69 A;  1R8B A;  2UUC F;  2PDA A;  3MDF A;  4U8Y A;  4EMD A;  1IKV B;  1H6K X;  4OI6 A;  2K3I A;  3LAM A;  3KKF A;  3B82 A;  3GJT B;  2DKO B;  4IFV B;  3W2W A;  2HGL A;  1H2T Z;  4IO9 Q;  1K47 A;  3D3C J;  5KFD A;  1RBA A;  4B08 A;  2FIU A;  3MUV P;  2RDJ A;  1S9E B;  4TU9 A;  4OHV A;  3WBZ A;  2ZVS A;  2K7K A;  2CWX A;  4E8U A;  2CG8 A;  1LK7 A;  2VG7 B;  1JLE B;  3FCH A;  2OEL A;  4TY8 B;  4C6A A;  2RQC A;  1Y3J A;  3PW7 A;  2BQ3 A;  1ZH5 A;  1HBO B;  4ZPC A;  3NGK A;  1NJW A;  1P8G A;  2R7X A;  4WK3 A;  3SFG A;  2R3V A;  1I1G A;  4IFV A;  3MUM P;  1NDC A;  2HFV A;  3CCM S;  4AYB D;  4LFA F;  2ZEJ A;  2GW8 A;  1WKL A;  2W8K A;  2MHN A;  4F4A A;  4M8L A;  5IC6 B;  1TP7 A;  3VGT A;  1S9E A;  4PWU A;  3ZO7 A;  4DS4 A;  3T5L A;  3VF0 B;  1XN9 A;  4DV3 F;  4ED4 A;  3JB9 k;  3EMT A;  4GO5 X;  2VDI A;  4J9Q A;  4PRF A;  3MEE B;  1EHW A;  2VG7 A;  2VFR A;  2KHC A;  3CT9 A;  1JLE A;  4FN5 A;  1XER A;  3OFH A;  2HHT A;  1EQ0 A;  1WOS A;  4LFB J;  1HBO A;  3THP A;  3CMA S;  1XNQ F;  3CJ3 A;  1QE1 B;  2H3E B;  3BH7 B;  4K4T A;  5E0O A;  3H90 A;  4NE9 C;  2R7O A;  4NCA A;  1GXL A;  2XWY A;  4GVB B;  4JB8 B;  3CMQ A;  2XHW A;  4TY9 A;  4WFZ A;  4KPY A;  4M5D B;  4DR5 J;  7FDR A;  2RQM A;  3CGI A;  1HW9 A;  3JQM A;  4CH1 A;  1S48 A;  4OL8 A;  3CJ8 A;  1Y3K A;  3ZTR A;  2CAD A;  3MEE A;  4GRS A;  4ZHR B;  3B78 A;  4U96 A;  5L1L A;  3PDN A;  2HHH J;  4AQY F;  3IGN A;  2CDR B;  3NS6 A;  1M5K C;  1QE1 A;  4NL5 A;  1U2R A;  2B8P A;  5JMN A;  1RBO B;  1TTH B;  4GVB A;  3K5P A;  1VQO S;  2DXF A;  3H0P A;  4XIU A;  4M5D A;  2FVR A;  4CLK A;  1FJG F;  3P3D A;  5CA5 A;  5LMU J;  4BWM A;  3OD2 A;  2NXU A;  2YWW A;  3DFE A;  2C28 A;  3RBD A;  4JI8 J; 
#chains in the Genus database with same CATH homology
 3P8B B;  3QQC D;  2XHC A;  3H7H B;  1NPP A;  2LQ8 A;  4ZN1 A;  4ZN3 A;  1M1H A;  2EXU A;  2OUG A;  3EWG A;  1NPR A;  3LPE A;  1M1G A;  2K06 A;  1NZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...