1R0AB

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 103
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB03
4J9LA 3BGRB 4KO0B 3IS9B 1S1WA 1VRTB 2UVVA 5L1LA 1RYRA 3LP0B 1U09A 1JLQB 4RUCA 4MFBA 3GV8B 1LW2A 2I1RA 4NRTA 3E51A 1SV5B 5KFGA 3DRSB 3DI6B 2GIQA 4ZP6A 3DRPB 5L9XA 5DQHA 1IKXB 1HARA 2YNFB 3KMSA 1VRUA 3MEEB 2W9BB 3PW5A 2BQRA 4ZPCA 3PW4A 5J2NA 4IRDA 2XC9A 5CYMB 3ICLA 4IG3A 4TYAA 5KT4A 1RT3A 1IKYA 5HP1B 2BQUA 1RTIA 1TV6A 4RW8B 3NKYA 4ZMMA 1S1XA 3KLGB 3E01A 1HPZB 4O44B 2HWHA 1RYSA 4IG0A 4RW6B 4KHRA 3Q8PB 2ASJA 3PHEA 3V6KA 1REVB 3CVKA 2ASDA 4ZHRB 4U6PA 4Y2CA 2D41A 2OPQA 3I0RA 3QIDA 4EO6A 1S0OA 4I2PA 5KFHA 5I3UB 3CJ5A 2YNIA 3HHKA 4TN2A 3BQ2A 3SFGA 4KKOA 3RB3A 4NLTA 1TL1B 5T14A 2ILZA 4F4WA 1T94A 4NLQA 2JEIA 4ECQA 3IRXA 2AX0A 3KLHA 1RT4B 5HLFB 3CIZA 3EPIA 2I5JB 3FFIA 4LQ9A 3QIPA 2YKMA 4IFYB 5CYQA 2HNYB 3QO9B 4F4YA 2WCXA 2EC0A 4ICLA 3V81A 3CJ2A 1RT2B 4NZ0A 5KFZA 2B43A 3H2LA 2E9ZA 4QWBA 2JC0A 2J6TA 1EETA 4WYWA 4I7FA 4Q0BB 2HMIB 3BQ0A 1QAJA 3RB4A 2IM1A 2UVUA 1DTQB 3KLIA 1HQEA 1S4FA 2RDIA 4ZPDA 4DG1A 1TL3A 4Q43A 2AU0A 4NLUA 3H40A 2HNZA 3CJ3A 4WYLA 1NHVA 4ECTA 4ECYA 4ED6A 1MMLA 3I0SB 3FQKA 5KFWA 1R0AA 2E9TA 3PR5B 3LP1B 2R2RA 1RT7A 4NLGA 3H5SA 4Y34A 2C28A 1LWFB 5C25A 1JKHB 4WFXA 3IGNA 4KB7A 4DEZA 2FLLA 3JSMA 3BSCA 1IKWA 2IC3B 3I0SA 1BQMA 2RKIA 3OSNA 2BANB 5DQIA 2B5JA 1RT1A 4RUAA 4O4RA 2FVRA 4Y2AA 5EWGA 4IR9A 2WONA 1JIHA 3CJ0A 2WB4A 1RTJA 5KFRA 4I2QA 3ITHA 1UWBB 4O4GA 3UR0A 4U7CA 2IC3A 5KT7A 3M8QB 3HKWA 5F8GA 5KFMA 4TY8A 1HQUA 2C2EA 1J5OA 2YNHA 2YNGA 4O3PA 2QE5A 3V4IB 2B6AB 4URSA 3DOLA 3KK1A 1N5YB 4QW9A 4KFBB 3OL7A 3G6XA 3KHRA 4EBCA 3PW7A 1EP4B 2BRLA 4JV1A 1BQNA 4K4WA 1HNVA 3M8QA 3JYTA 3DYAB 1RTHB 2XCPA 5J2MB 3LP2B 3NAHA 4IDKA 3UDLA 5FDLB 4WFZA 3KLFA 1NHUA 3C6TB 5HROA 1DTTB 3DM2A 2B6AA 3MECA 4R8UB 4ED2A 4PQUA 5KT6A 5HBMB 4K4SA 2VG7A 1TVRB 3T1AA 5KFDA 4ECRA 4JV2A 5L1KA 1HYSA 2DPIA 4Q8FA 3BR9A 1YVFA 2YKNA 3M8PA 1IM4A 4TLRA 4RW9A 4DL2A 4K4UA 1S6PA 3MR2A 4J9PA 1JLBA 4LSNA 3G6YA 3V6JA 1S10A 2FVCA 3QZ7A 5EWFA 1FKPB 4K4XA 4YR3A 1QE1A 4RW4B 1JLAA 4B3OB 1TP7A 5KFQA 4RNHA 2IJFA 2VG5B 1TKTA 2W9AA 2AGQA 1T05A 5DLGA 4ECVA 3CO9A 4ZPBA 1S6QA 1JLEA 3DRRB 1LWCB 2J6UA 1C0UA 4RW7A 5KFOA 1S1TB 4YQWA 4ZVHA 3RB6A 4ZP7A 3C6UB 1TKXA 3V6HA 2UUTA 1SUQA 4J9SA 1S1VA 2VG5A 4NCGB 4LSLA 5F8MA 2RDJA 2XGQA 3CDEA 4EEYA 1FKOB 3KK3A 4O3RA 3MTKA 2FVQA 5KFPA 1JLFB 2ILYA 4G1QB 1FK9A 2OPRB 1TQLA 3H59A 5KFJA 3MFHA 3EPGA 3BGRA 4KO0A 3N6LA 1S9EB 3IS9A 4ECZA 1VRTA 4NCGA 4MK8A 3LP0A 2IA6A 1JLQA 3I5CA 4JUZA 4RNMA 1RT6B 4RNNA 1SV5A 1S97A 3MEDB 4ECWA 3DRSA 3DI6A 2WK4A 4FS2A 4WZQA 1GX5A 2R8KA 3DRPA 4ZVEA 3FDSA 1IKXA 2YNFA 1RTDB 2WHOA 2W9BA 3MEEA 1S9FA 3KLEB 2V0NA 4G3IA 5KG7A 3BJYA 2C22A 1GX6A 5C5JA 4ED1A 2FLPA 5CYMA 1C2PA 3GQCA 4J9OA 3QZ8A 3KHGA 5I42B 5HP1A 4RNOA 1DLOB 1LW0B 4ZVFA 2BE2B 1JXLA 1K1SA 2W8LA 1C1CB 4QPXA 5DGAA 4RW8A 1KLMB 1HNIB 3D28A 3KLGA 1HPZA 4O44A 3QGHA 1HMVB 5KFKA 4ED7A 2UUWA 1KHVA 1NNDA 4RW6A 4Q44A 4KV8B 2OPPB 1RT5B 5I42A 1ZTTA 1LW0A 1REVA 4ZHRA 5J1EB 4QWAA 4IR1A 2W9CB 2O5DA 3KOAA 2E9RX 2ALZA 1S9GB 3LALA 3M9OB 3GV5B 2UVWA 3QGIA 3IG1B 1JX4A 5I3UA 3H4DA 4EBDA 4KV8A 5L1JA 1S48A 5KFFA 5F8HA 2ZE2B 3BREA 4IKAA 3RBDA 2QV6A 4DL7A 3EZUA 2R8HA 2FJXA 1TL1A 4ECXA 2VA2A 1LWEB 4TQRA 1C0TB 1RT4A 5HLFA 1S9GA 3Q8SB 2RF2B 5EDWA 2I5JA 3H5UA 4IFYA 3OL9A 2HNYA 3QO9A 3IN5A 5J2QB 3DOKB 5F8IA 2R8IA 3OSPA 4FBUA 4ED0A 1RT2A 4XPEA 5F8LA 4EYIB 1N6QB 3QYYA 4GC7A 3GIMA 4KBIA 5EUHA 3KNAA 4Q0BA 5F9NA 2HMIA 4HKQA 3ISND 3NL0A 5KFBA 5K14B 1DTQA 5F9LA 2V9WA 4NYZA 2IAJB 2XI3A 1RA7A 4ID5B 2AQ4A 2ATLA 1OS5A 4H4MB 4URQU 3NBPB 4MKAA 2WOMB 4R5PB 3H4BA 2HNDB 4PUOB 3LP1A 3KK2B 1D1UA 5KFNA 5KT3A 4ECSA 2AGOA 5KT5A 4IH7A 4RNFA 1T3NA 1LWFA 3D5MA 4HYKA 1JKHA 4DL6A 1S1UB 3G6VA 5KFTA 3OL6A 4F50A 4IFVB 1S49A 4ID5A 4DL5A 3TVKA 4IRKA 4XO0A 2BANA 3OLBA 3CDUA 3KJVB 4R5PA 3KMQA 5JXSA 4Q8EA 5F8NA 3KLVA 4KSEB 3FRZA 1T03B 4IQXA 2D3ZA 4O3NA 2ZD1B 1UWBA 1RDRA 3CWJA 3DLKB 2W7PA 3BSNA 1XR5A 3CDWA 3N6NA 5DG8A 5KG1A 3T5HA 3DLGB 1C1BB 4J9RA 5C24B 4F4XA 4ZP8A 2AWZA 3V4IA 4NLSA 4XPCA 1N5YA 3DLEB 2AX1A 4KFBA 5DQGA 3DLKA 1EP4A 3CJ4A 4NLXA 3MR6A 1JLCB 3DYAA 1RTHA 2ASLA 5J2MA 3LP2A 3OHAA 2VG6B 4RZRA 5FDLA 2F8EX 3C6TA 1MU2B 2BRKA 4TXSA 3M9MB 1DTTA 4R8UA 1TKZB 4KE5A 5HBMA 1TVRA 3DMJB 4J9NA 4K4TA 2DPJA 3NAIA 4PWDB 1D0EA 1S0MA 4IOBA 4YP3A 4H4OB 3H5YA 4GC6A 3GIKA 5D3GB 4ZPAA 3BSOA 1W25A 1JLGB 5JUMA 2OH2A 4ZP9A 3H5XA 1FKPA 4TYBA 3QLHB 1Z4UA 3RBEA 4RW4A 4B3OA 3H98A 2CJQA 2UVRA 5C42B 3DRRA 1LWCA 3TAMB 1IKVB 1QUVA 1S1TA 4TY9A 5DGBA 3C6UA 4FBTA 4YMEA 3I5BA 1S1WB 3GYNA 5KFXA 4EBEA 1FKOA 2HAIA 3FQLA 4MFBB 3FSIA 3PJWA 3GILA 1LW2B 3NMAA 2IMWP 3GIJA 1JLFA 4LQ3A 4G1QA 2OPRA 3MR3A 4O3QA 4YR2A 1VRUB 1S9EA 5J2NB 2WRMA 4MK7A 2JC1A 2R2SA 3BQ1A 3NGDA 5KG6A 2R8JA 5DG7A 4IG3B 3T5LA 1RT6A 1RT3B 3LANA 3MEDA 1KHWA 3HVWA 1IKYB 5KFIA 1RTDA 1RTIB 1TV6B 5KFLA 3KHHA 3KLEA 1S1XB 5KFVA 3E01B 2D7SA 2XI2A 5KG3A 1ZETA 4WZMA 5F8JA 2AGPA 1S0NA 4IG0B 2JEGA 5KFSA 4KHMA 3T5JA 4DL4A 2IM0A 2R2TA 1DLOA 2GC8A 2BE2A 2ZKUA 1XR7A 2IM3A 1C1CA 4R0EA 1KLMA 1HNIA 2OPQB 5J2PB 3I0RB 1HMVA 4I2PB 4Q45A 4MIBA 4NLPA 2YNIB 2OPPA 1RT5A 2J6SA 2FVSA 4KKOB 4J9KA 4EYHB 5J1EA 2W9CA 3V6DB 3IGVA 5J2PA 3IRXB 4IH6A 3KLHB 2V4RA 1I6JA 2C2RA 3FFIB 4K4ZA 3IG1A 3QIPB 2YKMB 5CYQB 5KG2A 5KFAA 3OHBA 4EO8A 2R8GA 4ICLB 2ZE2A 3V81B 1K1QA 4YR0A 3RAXA 3V6DA 3HVTB 1LWEA 4IRCA 1EETB 1C0TA 4I7FB 1SH2A 4ZVGA 2XCAA 2RF2A 4IH5A 1XR6A 4WXWA 5J2QA 3DOKA 3KLIB 1HQEB 3MEGB 3T5KA 3TQ1A 1RAJA 2WTFA 4DG1B 5KG4A 1TL3B 4NRUA 4URGA 2FVPA 2HNZB 3HVTA 3OL8A 1N6QA 1ZTWA 5KFUA 4KAIA 4DL3A 4WXOA 2W7OA 1R0AB 2JEFA 5K14A 4K4YA 2D3UA 1RT7B 3MEGA 2BQ3A 3I5AA 5C25B 4O3SA 2IAJA 3Q8RB 3KHLA 3JSMB 1IKWB 4WE1B 3PW2A 1BQMB 2RKIB 4QW8A 5KG5A 4NLDA 4H4MA 2B5JB 1RT1B 3NBPA 2WOMA 4RU9A 2XGPA 2HNDA 4PUOA 3KK2A 1RA6A 3UQSA 1WNEA 4J9MA 2WONB 3RAQA 4ECUA 1RTJB 3OLAA 1S1UA 4I2QB 3ITHB 1N48A 4O4GB 4ED8A 4IFVA 3GV7B 4WE1A 3KJVA 4TY8B 1HQUB 2JLEA 5KG0A 1J5OB 2YNHB 2YNGB 3PJXA 2JEJA 4K4VA 4MKBA 3SFUA 4X2BA 1T03A 1CSJA 3DOLB 3KK1B 1QAIA 1N4LA 3N6MA 3PR4A 2IBKA 2ZD1A 3PZPA 3MFIA 3UPFA 1BQNB 1HNVB 3JYTB 3GIIA 4J9QA 4K50A 3DLGA 1C1BA 2XWYA 5C24A 4IDKB 3KLFB 2W8KA 5HROB 3DM2B 3MECB 3G86A 5L1IA 4JV0A 3DLEA 4PQUB 2BR0A 2VG7B 2FJWA 3VQSA 4Y3CA 5DG9A 1HYSB 4M94A 1JLCA 3Q8QB 2YKNB 2V4QA 3M8PB 2C2DA 4RW9B 1SH3A 2OPSB 2VG6A 1S6PB 3BSAA 4H54A 3LAMA 4M95A 3DDKA 1JLBB 4MK9A 4NLWA 5KT2A 1MU2A 3M9NB 4OL8A 3PVXA 4LSNB 2HWIA 4NLOA 1TKZA 4MIAA 3DMJA 5KFCA 1QE1B 1SH0A 1JLAB 3LAKA 4ED3A 1TKTB 2R2UA 1T05B 4PWDA 2CKWA 2FLNA 2OPSA 3HVAA 4WFYA 4NLVA 3SI8A 4H4OA 1S6QB 3QGGA 1JLEB 4QWEA 5D3GA 1C0UB 4RW7B 2GIRA 1JLGA 4FS1A 3QLHA 5EWEA 1TKXB 3MR5A 2VA3A 3MF5A 1SUQB 1N56A 4QWCA 1S1VB 4LSLB 3T19A 4MH8A 4NLYA 3KK3B 5C42A 5KFYA 5DLFA 2IJNA 3PW0A 3RB0A 4TQSA 2IM2A 3TAMA 1IKVA 4O3OA 4F4ZA 5KFEA 3ISNC 4NLRA 2FJVA 1FK9B 4QWDA
chains in the Genus database with same CATH superfamily
2A6OA 2W4DA 1JLQB 2KG0A 4M8LA 2LA4A 4ZPCA 4D3GA 2XC9A 4ELUA 4LFAF 5LJ5Y 2ERRA 2RU3A 4J90A 4X65J 1URRA 1NMEB 1K8AT 4ZHRB 1SI9A 2JX2A 2OPQA 3CCZA 3QPIA 3RB3A 3C16A 4NLTA 5T14A 4F4WA 1X8DA 4LF4J 3M8RA 1YBTA 1U0HA 4UOCA 1RT4B 1MNEA 1QSLA 5IT4A 1GXUA 2ROGA 4OYAA 4FXDA 1RB0A 2LVWA 1B3TA 2QLFB 2ZVIA 3ENAA 2AMCB 4USHA 3TZYA 3LOUA 3CJ3A 5E3CA 4GKJF 2E1AA 1LK5A 2OD6A 5CZVA 4NLGA 1RT7A 4Y34A 1V6HA 4DEZA 1TMJA 4PYDA 1X9SA 1SKUB 5L9NA 1R8BA 5A8RA 4DQPA 4X4QA 4I2QA 4FYYB 3SEOA 2J7UA 3AD7C 2CXEA 4CH1A 1XNRF 5KFMA 2ZM6F 3DU5A 4O3PA 1RGVA 3BS9A 4OX9F 5HVFA 3IR5B 2GHWA 3T1AA 3BR9A 1WOSA 3K5PA 3FCVA 3DNCA 4BHQA 3QBCA 3G6YA 1S10A 1QE1A 1FF2A 2DITA 4LBIA 2R9LA 2LCWA 1UVKA 3DRRB 1OMSA 3RB6A 3GR0A 1ZH5A 1RHRB 5F8MA 3S8SA 1J2VA 2V9KA 2OSRA 2KFNA 4X4TA 4P7TA 3EDQB 2XBPA 1N32F 2NPIA 4RNNA 4DV6J 3F0NA 4TLQA 3IAS9 3SCIE 2DR8A 4MAKA 2C22A 1A6LA 5C5JA 1YK9A 3V5RA 4M5DB 5CD4H 1RHQB 4RNOA 4CP5A 2W8LA 1HNIB 4Q44A 2B4VA 2PA3A 2V4JA 2XZDB 2B0GA 1W2BR 2ALZA 1IR0A 3RBXA 2A6MA 3LALA 3GIRA 3M6VA 5ETOA 2NXUA 4FVMA 2HVHA 1YSJA 4JP8A 4I56A 5F8LA 1N6QB 2AZ3A 2X1FA 3Q86A 3M32A 2BUNA 1IBMF 3M2RA 1UETA 4JI1F 4LBHA 3DFEA 3RYLA 1OS5A 3A8EA 2AGOA 2AF6A 2OMLA 1NLKL 4RO0A 4USJC 1M5PC 3ZXWA 4WTYA 2MQNA 1Q4RA 1U25A 4ZLPA 3DLKB 5JJBA 1UVJA 2P9EA 4ZJQA 4F4XA 4NLSA 4XPCA 3OW2R 1AFIA 3W9HA 1UFKA 2F8MA 1UL3A 4TU8A 2W4CA 3K5LA 1DTTA 3ENVA 1D0EA 2MZSA 1R8CA 3CD5A 4C8NA 4OX7A 3TX0A 4B3OA 4ZKAA 4DCJB 1W2IA 1LWCA 4O23A 2R3VA 1WOOA 4FBTA 3JQMA 3M2UA 1S1WB 4MFBB 4NX9A 4ELVA 3EGWB 3A8JA 5J2NB 3G2XA 2GQ2A 3MEDA 3L7PA 2EVZA 1G6BA 2FPHX 1S1XB 2HVEA 2MQQA 1S0NA 3T5JA 1P1LA 4DL4A 3ZTRA 2VPXB 4JBCA 3CXCR 3N5BA 4I2PB 2V2QA 3F56A 4MIBA 4HLBA 1VQNS 3IRXB 1KFSA 4OZ5A 2B4OA 5KG2A 3TOQA 2JH3A 4ICLB 3JXOA 2QSWA 3EJMA 1EETB 2X51A 3IM9A 1OQ3A 5HO4A 2BXJA 3W3SA 2ZH4A 3OL8A 3VAKA 3PX6A 1RSCA 2W7OA 2PE8A 2BM1A 2QRRA 2DHAA 2D3UA 5D8HB 2MTLA 2VKRA 2XYPB 2CPHA 2HIYA 4KPCA 3ZTOA 5KG5A 3W5XA 2E7WA 2Q66A 1RTJB 2JL9A 2KHCA 2HHVA 4R0JA 4IFVA 2CPIA 5L39A 5G0RB 3DGPB 2JEJA 5L8RC 3MPDA 3SDEB 3JYTB 3SQGA 4CT8A 1K9MT 1Y11A 5C24A 4JV0A 3TEGA 2C2DA 3BSAA 4UW2A 4NEYA 5KFCA 1JLAB 3K2YA 3K8VA 2FLNA 3IO1A 4RW7B 2K3IA 2KFZA 3QLHA 2CJAA 2PFDA 4AXJA 1KQKA 3BGRB 4G1IA 4P74A 4CLYA 2J76E 4RUCA 2M0GB 5KFGA 1KN6A 1WKJA 3CSKA 2HHHJ 2DNLA 5CQGA 4P2MA 2ZH3A 2BQUA 2GVZB 3E01A 4KHRA 3PHEA 4OQJA 2PEBA 1N34F 3RGIA 2VIHA 3SBMA 3UNGC 5IC6B 5I3UB 2UZAA 4JV5J 2EC0A 1JJCB 4NZ0A 1OWXA 3H2LA 2QL5B 4Q0BB 1QAJA 3RB4A 1TUWA 4ZPDA 1S6UA 1RBLA 3W9IA 1QAXA 1RWKB 2Z2ZA 3BO2A 3P5BP 1VQYA 3JSMA 1BQMA 4O4RA 2MGZB 3AQPA 2DJWA 4ANEA 4CLZA 1OQ6A 1G4CA 2LXUA 3DRYA 4KGXB 3CCUS 2W25A 1EQ0A 3I96A 4URSA 4CO3A 3OBIA 2P2CB 1HHSA 1NHUA 3IMQJ 4PQUA 4ZVPB 1WJ9A 1S6PA 2AJ2A 1IVZA 1Q8KA 4LSNA 6FDRA 2FVCA 5IWAJ 4YR3A 4RW4B 3R1LA 1FNOA 2IJFA 4RKUC 4P72A 3W2VA 2CNKB 1YJ9S 1ZM9A 3V6HA 1SUQA 3G8QA 3EGNA 4NCGB 2FVQA 2FQQB 4ETXA 5H9EJ 1TQLA 3HHLC 4DV2J 3UN5A 2LFVA 4JUZA 4B9NA 1GX5A 3HSJA 2LEBA 4B3MJ 2CQ1A 3HJVA 1TL5A 1KKHA 2NCKL 2H5JB 4CLPA 1DLOB 1LW0B 2PDAA 1F2HA 4X4UA 2YPYA 4DLGA 1S72S 3MPVA 4QWAA 3ZZTA 1YG0A 4CM0A 2E7XA 2NR0A 2IVMA 3LH2S 2QC3A 1F3FA 1I3OB 4CO0A 3G6ES 2Y1JA 4EYIB 2XS5A 3D6HB 1NK7A 5LMNJ 1DQ8A 5KT3A 4IH7A 1AW0A 4OYBA 2VOOA 3KLVA 1IWAA 1UWBA 4LF5F 5DG8A 3DLGB 1PBUA 3DLKA 2VQEJ 4USMA 3PM9A 3PFEA 4OV6A 3C6TA 1FA0A 3VAJA 1HNXF 5HBMA 4NA3A 1TVRA 1BWEA 2VFTA 3LWLA 3FEYB 4GC6A 1YJRA 4X66J 2F4VF 3CJKB 3KDOA 3GYGA 3TAMB 1U1NA 3D6MB 2J8SA 3MM6B 3UVJB 1KOOA 4DR1F 3AT1B 2BW7A 4XIUA 4I4BA 3MD3A 1ZM2A 1E6VA 2LMIA 2QX0A 2VFSA 2EI5A 2LQJA 2X1GA 1ZBTA 4JI6J 1R43A 1XC9A 1C1CA 1IBKF 1MW7A 4Q45A 3RRHA 2HS4A 2XTJP 2GVDB 1ZAXA 1GH8A 1KEKA 3KLHB 4ES1A 2C2RA 2YKMB 3GLJA 2F63A 1OO0B 1K1QA 3LW5C 2X3GA 4CLSA 1SH2A 2RF2A 3CMAS 3DRXA 3MEGB 2WW4A 2W1BA 2KXFA 1NXIA 5CAAA 2A2CA 3EWGA 1R0BG 2QLJB 2WOMA 4TVAB 4CWBA 2YX7A 4P71A 1NH8A 2Y1RI 4ECUA 2OAUA 1CC8A 3OXGA 3TVYA 4DQIA 2VKZG 4K4VA 1NPPA 2DNKA 3RU0A 1QAYA 1LXNA 1C1BA 3AXKA 4DR2F 3T41A 3GTYX 3W5ZA 2BR0A 3OD2A 3L4BC 2G4BA 3SDEA 3Q8QB 3BBBA 2GW8A 4M95A 3M9NB 4DHVA 3MM5B 4PWDA 2AYBA 5B0GA 3QGGA 4EGLA 4DXLA 4BCAA 5KFEA 1O8BA 3PIOQ 3ULHA 1JJ4A 3O5TB 4OJ1A 1TK0A 3W8GA 5B09A 2YNFB 2X1AA 3MEEB 2LKZA 2B8QA 2R4FA 2LQ9A 2K7KA 2RRBA 1TKDA 2HWHA 2Y0SD 2DIUA 3OXFA 3ZTPA 4C48A 2ASDA 5HVGA 4KY3A 4OLPA 3UO0A 2V6AA 5KFHA 4Q2LA 3CJ5A 2M5YA 3J80Y 1ROFA 3QIPA 4FNHA 5IM0B 1UZDA 2G13A 2B43A 2E9ZA 2DGQA 1X7VA 3OPKA 5K8NA 4DV0J 1S4FA 3M1VA 4CLWA 5ITHA 4I6AA 1LWFB 2B8PA 3HDSA 4ILLA 1M5SA 1RT1A 4FZVA 2BA9A 4O4GA 5KT7A 4CO5A 2JWNA 4WK3A 2CG8A 2C2EA 1J5OA 2B4PA 4I67A 2YWWA 4F2RA 2QT7A 1K44A 2M70A 1RTHB 4OI3A 5FDLB 3KLFA 4YB7A 2XY7A 1IM4A 4DL2A 4ZITA 5EWFA 3OFFA 3TUIC 2KH9A 1S1TB 2F4FA 4CRJA 4EEYA 3MTKA 3VALA 1IBLF 2VFVA 2ILYA 1GXTA 4LRDA 3UCZP 3VGTA 4NCGA 4DQSA 2YKQA 3TEHB 4AUKA 3OVBA 4Y28C 4P9SA 4HHJA 3GE9A 2CWXA 1AUDA 5HP1A 1NK6A 1JXLA 1Z2ZA 2ZUAA 2Y8WA 2ZHAA 2PMHA 4E0DA 1VC0A 3K8WA 4OYPA 1LW0A 4DWIA 2G2ZA 2E9RX 2K8GA 2M88A 5KFFA 1D9AA 3MOJB 4CLTA 4DBQA 3DHXA 3H25A 5K9FA 3CIMA 3K5MA 1D1UA 3W8PA 2ZBPA 1U8SA 2F5GA 3OR2B 1T03B 4IQXA 1TELA 2ZWPA 5E3PA 4GVBB 1PBAA 3Q89A 5FLXY 2UXBJ 2FC9A 5HMWA 3DLEB 4N41A 1EP4A 5J2MA 3PTWA 1RADB 2F8EX 3MPWA 5AXKA 4RBUA 1K0VA 2GQCA 1RK8A 3NG8A 3BH6B 4IUFA 4H4KA 4DPTA 3M8WA 3N5FA 2Q1LA 3GIKA 2HZCA 4NI2B 1P27B 2OEJA 3RBEA 3C15B 3M8YA 1D8YA 2D3O1 3ZNUA 1NK0A 4KPYA 5AT1B 1IKVB 1WHXA 2PD1A 3C6UA 3G8SA 1YJUA 3IAM9 4V1Ak 1CS4A 4MK7A 2HQ3A 2DO0A 1VBKA 2FHMA 2CFXA 5KFLA 2XI2A 3N28A 1X4EA 2FLOA 3PRVA 5KFSA 1O0PA 2GC8A 1XR7A 3HFVA 1WG5A 4Y65A 1HNWJ 4OX9J 3NCRA 4OZ0A 4DV7J 1CJUA 1Z1ZA 3PIPQ 2RD5C 1T8EA 2JNJA 2CDRB 4IRCA 2MLYA 1BE4A 1RAJA 1Q79A 4W98A 4U96A 1X5OA 1BUXA 3MMBA 5B0EA 1VCTA 1OIAA 1TK5A 3MEGA 5C25B 3O44A 3HK2A 1ACMB 2M52A 3CCES 1FD8A 1XEZA 3CUNA 1ICEB 3K58A 1MWQA 3C14A 1VQ9S 5KG0A 1I51B 2WZ1A 1FWLA 4PXBA 5IC4B 3X1LB 1HYSB 1OY6A 1SBRA 4K8RA 1TAUA 3PVXA 3NLCA 4ED3A 1XMQJ 2QLBB 3U1MA 3I31A 3QT7A 3NNHA 5K20B 7AT1B 1U26A 4FS1A 1H3DA 1RWUA 1HI1A 4NLYA 2R7SA 3RB0A 2GV1A 1HR0J 4PR6A 3GONA 1S99A 4DU7A 4KGKA 1MMDA 3L3CA 2B56A 5CYMB 5J1NA 1WI6A 4IG3A 2Z2LA 1PGZA 4EUVA 5E3QA 1TV6A 3GFYA 1EAYC 3G4SS 2ZH6A 5HN0A 3RRGA 2X7IA 4OI1A 3SV4A 4TN2A 9RUBA 1RBAA 3ISZA 2HZAA 3CCWA 4OI4A 3EPIA 2HRUA 3U27A 1FRLA 2ZEJA 8ATCB 1SL0A 4DR4F 4M1KA 1TMMA 4QQBA 1N54B 2VQFF 1TR0A 1Y3JA 4JI4F 1X60A 2XO7A 5RUBA 4DMZA 3Q2TC 1FD2A 3BBFA 3CCLS 3OFEA 3PXGa 3M30A 2K2PA 1R0AA 3ZZOA 3LP1B 3BN7A 4WFXA 1Q16B 1KD1T 2WONA 1JIHA 4ED4A 1ZA1B 4LFBF 3MAQA 3QATA 2MKSA 3M8QB 1NK9A 4G1PA 1GTHA 4DPXA 2O01C 1CBKA 1BQNA 3LP2B 4G65A 3THVA 4DPUA 3DM2A 4PQAA 3J81j 1YVFA 1H2UX 2CWKA 2XULA 1I1GA 2LDIA 1U1RA 2AGQA 2QMWA 5HAOA 1S6QA 2FZCB 4NE9C 4YQWA 2DNMA 1TKXA 1DQ9A 2OEKA 5J1PA 2C3MA 1SQEA 3O6QA 2OPRB 1QSSA 3EPGA 1X5PA 2DGXA 3N6LA 1M5KC 2HRYA 1SV5A 2WK4A 1RTDB 1IR2A 2O67A 3CCJS 2QA4G 3FKBA 1U2CA 1X4GA 4QPXA 4O44A 3H0PA 2FUG9 1JXEA 5J1EB 3HSZA 4PEOA 2RSQA 3IG1B 2HVZA 4CTAA 3POTB 4ETZA 5GADU 4RBVA 4Y00A 5BYSA 5F8IA 1VBZA 4KBIA 1HD0A 2XLKA 2F40A 5CCMA 2KFYA 1F9HA 2QSFA 5HQMA 5B0DA 4C11B 1B4SA 4B9SA 3CEDA 5FIIA 4URQU 1YI2S 3ILIA 1SCJB 1XN9A 1HNZJ 4K0KJ 1R6VA 2FC8A 5JXSA 1ZYQA 5HQ8A 3FRZA 3NCPA 5B0CA 2D3ZA 2V50A 5AE3A 4W90B 2C3OA 1LFWA 5IQQA 1N5YA 3UDVA 3CJRA 2W2QP 4KE5A 2DGOA 3WBZA 4J9NA 4ZIWA 3UD5A 1SJRA 2AJ4A 3D68A 3PEJA 4YB6A 4JI0F 3BBCA 2F8HA 3FCHA 3S7RA 5C42B 3MGJA 3PJ9A 4TY9A 1D9DA 5KFXA 2DH8A 4OZNA 1H0HB 3TAPA 2IMWP 3ENQA 2DCUB 3UE2A 2R8JA 4HI2A 5A8WA 2VDHA 2ZHOA 4IG0B 2R7TA 2IM0A 1XMBA 4OI0A 2DNQA 3CD7A 4JYAF 3NOCA 1VQPS 3O2IA 2J0WA 3RW7A 3V6DB 4LSZB 2MLZA 2GA7A 4ZPTR 4KR0B 1B99A 1FRIA 1G7CB 3G96A 2N4DA 3TX8A 1YLXA 4IH5A 2XG8A 5J2QA 1P9YA 3B6BA 2HQFA 3PDNA 1UW4A 1NCLA 2A18A 1YGYA 4ZCIA 3VAMA 2NQPA 1TL4A 1VQ5S 1HQ2A 3NBPA 1YRUA 3OTOJ 3KJNB 3UN2A 1NKEA 3PJXA 3UFCX 1WD6A 1W7WA 3I87A 3PZPA 4J9QA 2ZBQA 4IDKB 3R2CJ 1RCXB 4ZPVR 2V5HG 4WFNQ 3D3BJ 2ZJPQ 4Q7AA 4OZLA 2VG6A 2HWIA 2MZTA 1SH0A 2XY6A 1Q5YA 4ZN3A 1NK4A 1ZM3A 3CC4S 1S57A 3ZO7A 4RWXA 4ALZA 4GO7X 4LVOP 2ZC3A 2CPJA 4TQSA 2HHWA 1B0TA 1SIZA 4XK8C 3LGMA 4FF2A 1FNMA 1FHTA 3LP0B 3BB5A 3GMGA 2XSFA 3D7SB 3US5A 2UU9F 4DFMA 2XHCA 1P6TA 4LREA 2RS8A 5LSRA 2AJFE 2BJEA 4NXNF 4QCLA 4LF5J 3V6KA 4P10A 1QVFR 3FEXB 2AP6A 2QA2A 2K7JA 5LOQA 2D69A 4HACA 1VQOS 4OYXA 2XNQA 3BH7B 3J7YI 2HNYB 4DV1J 2UXDJ 1IQZA 2XMKA 1B7FA 3SQOP 2IM1A 1WHYA 1S79A 2C2OB 4ECTA 2ZZMA 3IGNA 4KB7A 3P49B 5A8KA 1SC1B 2B5JA 1E6YA 2IJRA 1L5UA 1YRTA 4F36A 4X65F 2HFNA 4C2MA 2DGVA 2AJ1A 5E2QA 1WACA 3KK1A 5AE1A 1CJKA 3G6XA 4BC9A 3M8QA 3NAHA 4DQQA 4DX7A 5HROA 2H5EA 3B54A 3R9LA 4ES2A 4TLRA 4KIAA 4LF4F 2HQIA 2VG5B 3PYEA 3N9UC 3H7HB 4U8VA 4ZPBA 2GQQA 4ZJOA 2WVBA 3CDEA 5GAHI 1EB0A 2KVQE 1FK9A 3H59A 1LNQA 3VGSA 1VRTA 2IBOA 1XJWB 1F2GA 2E1RA 4OZJA 2W7AA 4ZVOB 2HYIB 3VTIA 2HGLA 3OUYB 3D28A 3KLGA 4RX6A 1OYDA 2IVYA 2K06A 3FBBA 3HJFA 5ETPA 2BE9B 1YZ6A 3RBDA 1TL1A 3QNWB 1FWPA 4A8KA 1MROA 2AYEA 2YWEA 1Y00A 2L3MA 1RT2A 4XPEA 2ZH1A 4GC7A 1H38A 5K14B 2Y0BB 2RDDA 2BKNA 3NS5A 4RNFA 4DV6F 4HYKA 2IYGA 3D1HA 5KFTA 4F50A 4WTOB 4ZLNA 5F8NA 4OZ3A 1GMVA 4TU7A 4QR1A 4KFBA 3M2VA 2RQMA 4RZRA 3QWUA 3K5OA 3G82A 4CYUA 3HLUA 2DR6A 2CJQA 3BO3A 4UUXA 3J7AN 4C4WA 3VQTA 3AJ2A 4G1QA 4B3SJ 3NGDA 2NUUG 3U7JA 1VI7A 1CC7A 4FKXA 1KTVA 2YTCA 2IRUA 4N56A 2RUGA 5F8JA 1FE0A 4LT6A 4RLEA 1U4BA 1KLMA 2LEAA 5J2PB 3D0HE 4GO5X 2V8HA 4KKOB 3IGVA 3MMCB 3M7VA 4RUHA 1I6JA 4X4VA 3FFIB 4K4ZA 1VQ8S 2Z58B 3V6DA 1UEVA 1C0TA 1XR6A 4WXWA 3KJQB 1X4HA 1TL3B 3OJSA 4OYWA 3O1LA 4CH7A 3CMQA 3I5AA 3HSGA 1SC6A 1XK8A 2FD2A 4USUA 3PW2A 2C42A 2QYCA 3CCTA 2EFVA 4PUOA 2KRRA 2OFGX 2HPUA 2H4WB 3VVTA 1X0FA 2DNOA 1H98A 4BC7A 2ZH8A 4C3KA 1HQUB 3RBZA 2DT9A 1N4LA 3N6MA 1DBDA 4NCBA 1VJQA 1CJVA 1YQHA 2K1RB 2CPXA 3M4XA 2UV8G 3GJQB 1IM6A 2L9DA 1HFEL 2VASA 3QJPA 1JLGA 3HXMA 1S1VB 2A10A 1Q78A 2ADBA 1X4BA 4X84A 5L1LA 1GMWA 3CT9A 3EMTA 1RUSA 3DRSB 2W9BB 3DCAA 1M90T 5B08A 3GFZA 4FDFA 2MQPA 1Y5IB 1GK8A 1CPZA 1VBYA 1F0XA 4LIRA 1I5OB 2GHVC 3J81Y 3V81A 2XSJA 1VQLS 5AXNA 3BQ0A 1U2RA 2UVUA 3PY8A 1DTQB 3KLIA 1UA0A 3EXYA 4Q43A 2DNYA 2MHNA 3I0SB 1M5HA 2ZOMA 2HK2A 4LF8J 3TARA 5IS2A 5DDRC 5AJ3J 4KYZA 2V2KA 1VJWA 4C8YA 2HHHF 5EWGA 4BWJA 2GNKA 4UQTA 1QJHA 1NKBA 3OR1A 2QE5A 1F60B 3ZZ0A 1Q0NA 3UDLA 1KDNA 2PEHA 5CHCB 4JV2A 5GMKa 5L1KA 3M8PA 4OHYA 1X31C 3KNGA 4JV5F 1FKPB 5GMEA 2KZZA 1TP7A 1EARA 3OVSA 1TKTA 1T05A 2NZCA 3MM7B 1FDAA 3HPOA 1JLEA 2RUSA 5D0EA 4KHPJ 2VG5A 2OTJS 2AJQA 4HHHA 4KO0A 3AA8A 2L41A 4ECZA 2ZDPA 4NCAA 3I82A 3F73A 3ONQA 2WHOA 3KLEB 2EPIA 3UW1A 1MN9A 3QZ8A 1EQMA 4Y2MA 1CEZA 5I42B 4B9TA 2AIRB 3A4TA 4RW6A 2KRBA 1RT5B 1FXDA 1WSRA 4QOTA 4UOFA 3FGVA 4UUWA 2M3DA 3EICA 3W2WB 3H4DA 3BREA 2E5LJ 1LWEB 5IWAF 2PGCA 5HLFA 3AXMA 1YIJS 1NSQA 5EDWA 2CYYA 3DOKB 2QL9B 3R5JB 5HL7Q 1UA1A 2B9WA 2HMIA 4FF3A 2YKAA 2VBYA 3CDBA 3I32A 2XI3A 4DV2F 1QSYA 2B9EA 2RQCA 1NBEB 4L3KA 3WZ0A 4WP8A 4B3MF 4OFZA 3KMQA 1NPRA 1GXLA 2CADA 5U47A 3T5HA 3CO0P 2H51B 3CCRS 1SJ1A 3V4IA 3QT6A 2AX1A 1HBOA 2OEMA 4QPTA 5BYQA 3DYAA 2ASLA 2J7KA 4R8UA 2HS3A 5ETQA 4K4TA 2DO4A 4L75A 4B3TJ 4OYIA 1ULRA 3H5YA 5HSPA 2BJ1A 2FZGB 3RRKA 1FJ7A 3ILLA 2VQFJ 3OQ2A 3FK4A 4IO1A 3TA2A 1J27A 2HSEB 1WEZA 2PC6A 5LMNF 1ZOTA 3D3CJ 3L09A 3AB2B 3HHDA 4DV4J 4DS4A 3OTEA 1Q8BA 1NSAA 2VUGA 2DD8S 5KG3A 1ZETA 2KT3A 1VMBA 3NWGA 4KHMA 2AD9A 2R2TA 3IBFB 4NA1A 1SJ3P 2OPQB 2Z4PA 4PG6A 1HMVA 2VQEF 1HL6A 3C16B 2E7VA 1JNRB 2XMWA 5J2PA 1U0HB 5D78A 1H72C 1X4FA 5DDOC 3LGNA 2BE7D 4X66F 2DXEA 1VQ6S 5HJYA 1JJHA 2CQBA 1RT7B 4IO9Q 3Q8RB 2F9JA 4DJBA 1BQXA 3SYZA 1Y5LB 5A8RB 1S1UA 4C8OA 4I2QB 2DIVA 4ZVTB 5HJXA 2VH7A 4PG7A 3P5TL 3KJVA 1VK8A 4JI6F 5DS7A 2E1CA 4BLGA 2GIFA 3B8HA 1T7PA 2RNEA 3GIIA 1FX2A 4CO2A 4LR8A 1Q7YT 3M6WA 3ZZYA 1WC5A 4DR5F 4ERDA 2XS2A 4O0NA 2KTQA 3BGOP 1QE1B 4ITSA 4OHXA 2PFFB 3FVYA 4DR6J 2VV5A 3CCQS 2FGOA 5A0YA 3G71S 1RWMB 4EU0A 5LSLA 1T9WA 3ZZPA 3J80U 1RQ0A 3FEZA 1Q5VA 3M6XA 1U09A 3ZZZA 1RLDA 3JS9A 3KMSA 1N5TA 3PW5A 2DRBA 3CW2C 3KUGA 5LT5A 1YJTA 2G1HA 2GMJA 3IWLA 2V4JB 4JI8J 3D1OA 5DDPC 1TUGB 3N01A 4F26A 3I0RA 1SKRA 2ACMA 1Q95G 3BQ2A 2MKIA 3WDOA 4ECQA 2Z2YB 3MCSA 3TO8A 2AJ0A 5ETTA 4I7FA 5LMUJ 3M32B 1HQEA 3M2RB 5KOXA 4NMXA 3MAAA 5A2QY 3UCUP 3EYZA 2N3OA 1KR4A 3TZZA 3UWTA 3Q0AA 1IKWA 3I0SA 2DH7A 2GO9A 4WWSA 3Q2SC 1PAEX 2HS0A 3EGVA 3CB4A 3G9CA 3MDFA 2E66A 3R6LB 3DOLA 1T11A 5DM7Q 2V8GA 3NGUA 1DTTB 5KT6A 2VG7A 4NA2A 1VIXA 4O0IA 2C3PA 2DHSA 2DEIA 2DBBA 4B3OB 3NY0A 4QIGA 2W9AA 4DUYJ 2C3YA 4OJHA 1PYTA 2HFUA 2MKCA 2OTLS 1LWCB 2H3EB 3M2UB 4DV0F 2UUTA 2J5AA 3KK3A 3H2VE 4C0HA 3N0VA 2WVDA 3C66A 5GADI 5ETSA 3MEDB 4WZQA 1WELA 4UOGA 4ZVEA 3JSRA 3LUYA 2FYXA 2HGNA 4LF9J 4ED1A 4J9OA 3KHGA 3MUTP 2Z0GA 1T3OA 5DGAA 3IBWA 4RW8A 1HPZA 1OPIA 3QGHA 1S7IA 4E98A 1NNDA 1Y5NB 4NWBA 2QTWA 5I42A 1HI8A 1S48A 4PXCA 5F8HA 3PNIA 1RKIA 2FHKA 3H5UA 2ACYA 5FLXU 4QJVA 2R8IA 1VHIA 3GSIA 4FBUA 3JTOA 4I0WA 4DX5A 2BEFA 5DZ7A 3CCVS 1O6XA 3IR6B 1RKJA 5CABA 2BJ8A 4DI6A 4R5PB 4ECSA 3D5MA 4IFVB 3W9JA 3NWRA 1J5EJ 1SJQA 5M2UA 4MT1A 3TP2A 1IWGA 1H73A 2PN6A 3SQGB 3BR8A 5C24B 3K89A 1FERA 2W2NP 2VF3A 1ZZNA 5HMYA 5DQGA 2D1CA 1WC3A 4YB5A 2EKYA 4WIQA 2BRKA 3TZXA 3AHPA 2HBYB 2DPJA 3RG6A 3EZOA 4ZPAA 1W25A 3RJMB 3QLHB 4PPZA 3H98A 1AB8A 4CZCA 1CULA 1FRXA 3MOZA 4PKDB 2HAIA 1JXVA 2Y3YA 4FP9A 4PG8A 3KG1A 2H48B 4DSLA 1HW8A 4AL7A 1RZMA 1N5QA 3E01B 2ZH5A 2Y9HA 1NSKL 2HBRB 3JQJA 2K3KA 2UXBF 3BGUA 1Y3KA 1N8RT 4PCQA 1U1OA 4DSEA 1UAWA 2ZE2A 1MMNA 4LMZA 2VBZA 1JMTA 4J9UE 4K4YA 2CQIA 3DDNA 3ZFVA 1C4AA 2ZHBA 3A3OB 3JSMB 2KZMA 1BQMB 3GFHA 4LR9A 4F8RA 3KK2A 3R5BA 4WPAA 3MMAA 4PZVA 3VZIA 2O3DA 1Q7LB 5CZXA 4ANDA 4CQ1A 1DFDA 2JLEA 4XAKA 2QO3A 2OMOA 2JLFA 3LPYA 3VVUA 4P7VA 3U1NA 3MWBA 4DUZJ 2B7BB 2MQLA 1U6FA 5EN1A 2QL7B 4PQUB 1HNWF 5DG9A 3VV2B 3L95X 4F0KA 4DV7F 1S6PB 1VDHA 5KT2A 4LSNB 3K7RA 3DMJA 5T7LA 2R2UA 3N79A 3W2VB 5K8PA 3MUMP 3FRYA 1QD1A 1SUQB 2HFOA 3J7ZT 2DYAA 3GB0A 3CC7S 2GMHA 2VPZB 3UDCA 4LIWA 1TL7A 2AEJA 2YVSA 2JLGA 1HHTP 1DURA 1VQ7S 2BQRA 3P3DA 1KTQA 1IKYA 5K8OA 2BYCA 3G87A 1WKKA 2RS2A 3EZ5A 4LF2A 4JB8B 4P52A 3QIDA 5HANA 3SFGA 5C2GA 4QIWD 1ZA2B 1WF0A 3R5DA 3CIZA 1XMQF 4A47A 2WCXA 2YWKA 4CT9A 4HL9A 1HI0P 2MKYA 2MPUA 1YRXA 2VJUA 2HNZA 1HD1A 4N8NA 1NHVA 4WYLA 4ED6A 2DH9A 1HR0F 3FQKA 5KFWA 2V34A 3HULA 3ADAC 2VDIA 2YH0A 3Q22A 1RHMB 2QYGA 2RKIA 2BABA 1HBUA 2FVRA 4NZ7A 5EHHA 3CJ0A 1UPPA 3ITHA 1UWBB 2R7XA 2YX1A 1RAEB 4TY8A 2Q6CA 2MQOA 1D9FA 4LR7A 4EBCA 3EE3A 1ZPWX 1OY8A 4L74A 2YWFA 3C6TB 1TFYA 4B17A 5HBMB 4ECRA 1TVRB 2ZWOA 1CQMA 4RW9A 4JI2F 2L48A 4B08A 3FMBA 3TRGA 2J6UA 1C0UA 4Q5VA 3ET6A 1UFWA 2VU5A 5CYJA 1TTHB 4J9SA 4V19X 2OUGA 1F5CA 2ZZTA 4HH1A 3IS9A 3RW6A 5I3QA 4MK8A 4F04B 1E6VB 3QFWA 3I5CA 4RNMA 1CG2A 1AZSA 3DRPA 4PXDA 4OMFG 5LL6d 3FDSA 4AD6A 4B9LA 1Q8LA 3D0GE 4Z7YA 1L3KA 3GQCA 3OXLA 2OGUA 1PJ7A 3DLBA 1C1CB 5AE2A 5H9FJ 1YZ7A 4LRFA 3KUHA 1CJTA 1SJFA 3GV5B 3DDIA 2DY9A 1VS3A 2Q6BA 1M0SA 2RF2B 2RAQA 4IFYA 3JSYA 4WK1A 1KVIA 4KTQA 1FJCA 2QEXS 2HVIA 3KNAA 4HKQA 4CM2A 1O5JA 2V9WA 3CC2S 1FVQA 2ZFHA 3MM8A 2IA0A 3H4BA 2WOMB 3FNNA 1PCAA 1BHNA 1VYAA 4DV3J 4R5PA 2LU2A 4ANCA 1FDDA 1C1BB 3ZNJ1 2JSXA 3PKYA 4DX8H 3SXLA 2NUHA 3CGIA 4GKKJ 3FBFA 2YH1A 3NAIA 4PWDB 1UP1A 4YP3A 1L3SA 4CNYA 3PRDA 3TJ8A 4DOZA 1T0TV 2I6WA 4L76A 1QUVA 4AE5A 1BWVA 1NKCA 4FPIA 2DRDA 1RAGB 3PJWA 3GILA 3NMAA 2ZOFA 1KRPA 3W63A 4DR3J 5IQ6A 2FJAB 1S9EA 1NJWA 2R2SA 2ATCB 1HNZF 2ZBCA 4K0KF 1RT6A 2I8EA 2O1PA 3KHHA 2VPWB 1QTNB 2IFXA 5KFVA 3PYFA 4C0OC 2J8AA 4M5GA 2DK2A 1YITS 2BE2A 3TVZA 3D6FB 2J6SA 2B3TB 3R7NB 2W9CA 3T3FA 1VC6A 4WFBQ 3QIPB 1S6OA 3WX4A 4DPWA 3I56S 4M5HA 4K5RA 5CCLA 2MSTA 2NXNA 4PRFA 3M1VB 4YEAA 1QUPA 2CPDA 3GG0A 3Q8YA 4OLOA 1WWHA 2HQCA 3TUPA 1RT1B 1T9XA 3UQSA 4F4AA 4ZVUB 4O4GB 2XMJA 1NJIT 2VJVA 1U24A 3AD9C 1J5OB 2EKNA 4FF4A 5LXRA 5BR8J 1FJGJ 3J7YU 3KLFB 2QIFA 5H9EK 1LOUA 4EK2A 1JLCA 1Q1KA 3DLHA 3GYXB 3E8OA 3IBCB 3LAKA 1FEHA 1RE1B 3SI8A 4NLVA 4H4OA 4YHHJ 5D3GA 1JNZB 1B70B 3IA0A 2VA3A 3DKDA 3LO3A 2FHJA 3D9BA 2M4MA 2IM2A 2ZC4A 4O3OA 2G2OA 1VQ4S 1IBCB 1N36J 2UVVA 1NK5A 2DNGA 2F65A 2ROPA 1RWNB 3HKZD 3GV8B 3JTNA 3GSDA 2C2MB 3IWXA 4WFAQ 2DR5A 3OTOF 1VRUA 2G2YA 1VC5A 4FPRA 4USVA 3HX9A 3FBEA 5HP1B 2VONA 3R7SB 3TW0A 2N3LA 4I68A 4MJKA 1NZ8A 2FGCA 2PT0A 2DKOB 2D41A 2OD4A 3QQCD 4M5KA 1P1TA 3QRPA 4DF4A 2ILZA 2G0CA 2AX0A 2UUCJ 4DSIA 2QLWA 2DHGA 5GAHU 3EM1A 2XEXA 3CJ2A 4A8MP 3K5NA 1X5TA 3P4UB 4EZ9A 5D77A 3H5SA 1K47A 4OJ3A 1FTRA 3C19A 2Y1IA 3EX7B 3UR0A 2KM8B 2ALYB 4KQZA 2EBEA 1WOPA 2WSEC 2B6AB 1V5IB 2V63A 3ZZRA 3KHRA 1EP4B 1HNVA 1BLUA 1RJJA 5J2MB 4RBTA 2CRLA 4Y6IA 4ATNA 1UFLA 3V6JA 1APSA 4DV1F 3MEKA 2UXDF 2FHOB 2R7WA 4ZVHA 5E5NA 3C6UB 1WSVA 1S5ZA 5L38A 4HDHA 2OFHX 1CS4B 2E5JA 3WIUA 2VC1A 2IA6A 5HI7A 1XWLA 1S97A 4LRBA 4FS2A 2A3JA 3SCJE 4G3IA 1VR6A 1GX6A 4J9VA 2NLWA 4UZBA 1HBNA 1CJUB 1RWOB 1RAAB 2IY5B 2YKOA 3GFXA 4DR5J 3Q8SB 1X9MA 2XO6A 3QO9A 1UJ5A 4QYZJ 3OV7A 3ISND 2JVOA 3MMBB 4F3MA 1UEUA 1T95A 2CZ9A 3OL6A 1T02A 2BKPA 4IRKA 3C14B 1FFGB 2LQ5A 3QJJA 3VAHA 2RIJA 3EVWA 3DGVA 2CJBA 5DM6Q 4K2JA 1X4DA 3CJ4A 2D9PA 4FNIA 3MR6A 2WVCA 1WG1A 3M9MB 3AFGA 3VAFA 1NDPA 3UD4P 4ZVSB 1I94F 4F67A 4A8SA 2RHSB 3Q83A 2COLA 1JB0C 4ELTA 1YWXA 3CD0A 4C8LA 3MUVP 1H2VZ 1FKOA 3NGSA 3HMJG 2MQMA 4IQMA 1H74A 2WRMA 2AEFA 2JC1A 2XMAA 3A8KA 4IG3B 2GFFA 1KBRA 1TV6B 2AGPA 2XNRA 4P75A 2MLXA 4KGVB 4NEZA 2NREA 4ZDNA 1FRKA 2DTJA 2J9DE 4EYHB 2UUBJ 3R1HA 3K17A 2DR9A 3HM9A 1V5VA 1MG7A 2ZITA 3MCNA 1R7IA 2H65B 4KH0B 4KH1B 1N33J 4OZ1A 1FRHA 3T5KA 3WQPA 2FVPA 4L6V3 5KFUA 1SB6A 3M30B 3BDPA 4I6YA 1R0AB 1IUJA 3WC0A 1IJFB 2IAJA 3KHLA 2VFUA 4B3SF 3HHLA 2XGPA 2VBXA 1BMQB 3RAQA 2WONB 4UY85 5D4LA 4GVLA 1QVGR 1PO6A 2AV5A 2I9SA 4TU9A 1RAFB 2CQDA 1BQNB 2RRNA 3H42A 4BS2A 3AA9A 3SIPB 1JJ2R 3DM2B 1MN7A 1H7WA 2M8DB 3ZC4A 1Y0HA 2HKEA 4X62J 4DSKA 1IN0A 2MZRA 1S6QB 1U6ZA 3P96A 5IV4A 1TKXB 1F3VA 1KSPA 1GMWD 5KFYA 2V8VA 1NAQA 3TUJC 3I55S 1LW2A 3J81U 5DO2A 2NSCA 2Z8QA 1SV5B 2HFZA 4FYXB 3WHIA 1LKZA 5D4OA 1HWUA 4I69A 3QRQA 3ICLA 2B4UA 2HRTA 4O44B 3HZEA 3T1HJ 3AJ1A 2HFSA 1BGXT 4HT7A 2OJ3A 5EX3A 4EO6A 2YNIA 1YJ7A 2X3DA 4CTAB 1PJ6A 2QFIA 4NYPA 5CYQA 2HLTA 2KKHA 5FJ4A 4QWBA 3DLLQ 4WYWA 5DJBA 2AT1B 1WG4A 4C3LA 2D74B 4J91A 2E5HA 3KTQA 3H40A 2C1EB 1B0PA 1FWKA 4M5LA 3LPEA 4HTIA 2B7CB 4YDXA 5IOLA 2P5VA 3UCGA 5D6GA 3J7Z5 3R6GB 3IP0A 2BJDA 1N5YB 3DOMA 1HWIA 4A8FA 4WFZA 4F25A 4ZCMA 3MECA 2B6AA 2NXJA 1U1KA 5KFDA 3MPUB 3WC2A 2YKNA 2BKOA 2N82B 3A8IA 4K4XA 4UOHA 1PJ5A 2HVDA 4ENOA 3AJDA 2ZH7A 3TA0A 4AL5A 4LSLA 4KGZB 2RDJA 2ABYA 5B0BA 1WHWA 4LF8F 2UV8A 5F0WA 2YXLA 5AJ3F 1AXQA 3O3LA 3DI6A 4ZCLA 3W1YC 1RWXB 1IKXA 3GJRB 5A8WB 2V0NA 2IRYA 3D1QA 3KWMA 2XMMA 3JAMY 2HGMA 1K1SA 2QZ8A 4K5SA 5CA5A 2LECA 5AXLA 4ED7A 2VL1A 3TWZA 1KHVA 3GCXP 2HHTA 1REVA 2ZJQQ 2XWXA 3NGTA 2GX8A 2KXHA 3M9OB 4EBDA 2VBWA 4IKAA 1Z2LA 5DDQC 4TQRA 2QJ3A 2I5JA 3D4JA 5IFMA 5J2QB 3OSPA 2JFDA 3T1YJ 3X3UA 2CZ4A 2D9OA 3L7UA 3DHWC 4KHPF 1EKRA 4Y2KA 1Q53A 3SSRA 2BACA 5HK4A 3QFHA 4RR5A 3NBPB 4AXIA 5KT5A 1JKHA 3FZ2A 1RHUB 2FDNA 1FTCA 2BANA 1BXNA 3EDRB 2CQPA 1HKAA 2R42A 4NYOA 4DV5F 1UVMA 3BPSP 1RDRA 3VZHA 3AY0A 2N4CA 2F3JA 2G1DA 2VG6B 2OIHA 1M1KT 1KVJA 4LF7J 3TYTA 1WDDA 1SL1A 2UXCJ 1Q8IA 2E5LF 4MYUA 1WF2A 3H5XA 2W2PP 4QBUA 4A48A 3W7BA 2MYFA 3BYPA 2QLXA 1KOHA 2ZNYA 2B51A 4GMKA 2GGPA 3FSIA 3AQOA 3TANA 2HIQA 1JLFA 4U8YA 2O66A 3MR3A 4O3QA 4PAAA 4AQYJ 3SZ2A 1P9QC 3C2PA 4P6QA 1SIWB 3QSIA 2CNOB 2JEGA 1R8AA 4QZVB 1YJWS 2DY1A 1NK8A 1DARA 2KI2A 2J0SD 3CJ8A 4XDCA 5JVGQ 2OPPA 1TUVA 2KG1A 2RRAA 4HACB 4IH6A 4A8XA 4B3TF 2VZ9A 3VGVA 4YR0A 2LLZA 1YBUA 5BXIA 2ASYA 4JI2J 3UN3A 2WVFA 4WIIA 2WTFA 3THTA 2CVEA 2BQ3A 5A8KB 4H4MA 2B5JB 1KQFB 1E6YB 3TNVA 2HNDA 1WNEA 1JWWA 4DV4F 2DVIA 1N48A 2Q43A 4MKBA 3SFUA 4X2BA 3KK1B 1CJKB 2ZD1A 2FJEB 4FYVB 3BDEA 2MKKA 2B9XA 2W8KA 5HROB 4F7VA 1PYOB 3JSBA 2P9GA 4NMLA 1MU2A 1TKZA 1SPBP 1ZAWA 4MKVA 1B0VA 3HVAA 3P45B 2GIRA 4HI1A 5EWEA 3T19A 2IJNA 4F4ZA 3R3TA 2R7QA 1FK9B 4M5NA 1F9FA 3D0IE 1VRTB 1EHWA 1RU2A 4OX8A 4NRTA 1NSPA 1LWXA 1RT3A 1M1HA 3I9V9 1RTIA 1NEEA 4ZMMA 3KLGB 1UVLA 5A2QU 2WSCC 4DZ6A 3Q8PB 4W92B 3R2DJ 4Y2CA 2IMOA 1S0OA 5E3AA 1AFJA 1TL1B 3CCSS 3BKFA 1RAIB 4PYAA 2KL8A 1MROB 2LA6A 1FRMA 2HQGA 1RT2B 5KFZA 1ITPA 2BJ7A 4DR6F 2FTRA 4ZPWR 5MAOA 4DG1A 1NRKA 2HWTA 1VOMA 1MMLA 4NPOA 1KC8T 3R7BB 2C28A 1SQGA 1GTEA 2N7CA 4X4PA 2R7UA 3OSNA 3QAUA 5MLCV 2L9NA 3PO4A 3CCMS 3MM9A 2VFRA 1NU4A 3PRBA 4USTA 5F8GA 4DF8A 2YNHA 2YNGA 1UWAA 4KFBB 4JI8F 3M2VB 4DR7J 1S7HA 2RH3A 4FVCA 2XYHB 1MSWD 4YN3B 3G82B 2CIMA 3MR2A 1JLBA 2E1MC 1EJ7L 2H9ZA 3FZBA 1LK7A 3QT8A 4CYUB 4RNHA 4B9VA 4QIVA 5E3RA 5LMUF 1SKWA 4DL0C 4FXWA 3IXQA 1ZM4A 4G1QB 3QMQA 2HBZB 1DZ5A 1JLQA 2FY8A 1GT8A 1X5SA 5A6WA 2CJ9A 5A76A 2RJZA 4OJGA 1KLMB 3R8YA 3K0JA 3B4MA 4ZHRA 2CNLB 2O5DA 5EX0A 2UVWA 3OFGA 2MMYA 1ZS6A 4CIOA 2FJXA 3NOGA 1BC6A 1C0TB 1RT4A 4ZLLA 2P6TA 4DUYF 2HBQB 3M8SA 5ETLA 2PIIA 2XYGB 3OFHA 2W4PA 1Q86T 2GO8A 3SV3A 2L9WA 4PUOB 2A0FB 3AB4B 4WP3A 5KFNA 2I38A 4OYMA 5K8MA 2DGTA 3A3NB 4LF9F 1D09B 5B0FA 2DB1A 1G3OA 3FUYA 1XR5A 1CJVB 5KG1A 2J0QD 1YKWA 1RISA 2XMVA 2CAJA 3VAGA 4LF6J 3BKUA 4OV1A 4F02A 4U7UK 1DRZA 1KONA 4CO1A 3VF0B 3W62A 1JLGB 3BGFA 1VQKS 2EFQA 4KRWA 1VFJA 3DRRA 1DAXA 4Y2IA 4YMEA 4CLLA 4QIEA 3FQLA 2ZBRA 2IRXA 2JDJA 1J5EF 2DCLA 2B9YA 5D4PA 3NXZA 5A6PA 1U6BA 4M5DA 2LEPA 3HZGA 4CCHA 4JI5J 3NCQA 1HNIA 1LXJA 2IIHA 2CQ4A 5GMDA 1KQSR 1QM9A 2EFNA 1WC0A 4MTPA 3SCKE 3D2WA 3V81B 2XSJB 2ZZNA 1T9VA 1RU1A 2MSSA 3PFOA 2MZQA 3KLIB 1UVNA 1N6QA 1ZTWA 2V67A 3TR5A 5D4NA 2HHQA 2NSBA 4N7TA 1U7LA 4RU9A 2CDQA 1M1GA 5F41A 3GV7B 2R7OA 2L08A 4F0MA 2GMLA 2CNNB 3OR1B 4C0BA 4C9DA 3UPFA 1N5VA 2BVZA 4UQGA 3RAMA 1U02A 1XIQA 3OTCA 3M8PB 1SH3A 4EI2A 5B7WA 3I6PA 5LM7E 4WU2A 2XM3A 3GCWP 1TKTB 1T05B 2WBMA 4ID8A 1S76D 1JLEB 1GNKA 5HMZA 2HZVA 3KKFA 2RILA 1HW9A 4WCEQ 4NLRA 5HQLA 4QWDA 4KO0B 1S1WA 4PXEA 4LBPA 4MFBA 1NO8A 1WTBA 5L9XA 1HARA 5GAGI 5J2NA 3HHEA 2KM8C 1GEHA 2OKQA 3D54A 4QR2A 1FE4A 1YTYA 1FJEB 3WIVA 1UJ6A 2NXEA 1VISA 1XNQF 4PG5A 1S1XA 4J7CA 4P2XA 2C3UA 3R5CA 4DUZF 4RW6B 2CUYA 1V3RA 2GAGC 3E3XA 4C8ZA 1SVDA 2DGUA 3HCXA 2XS7A 4PWWA 2E5GA 1FXLA 4I2PA 4H4KC 1RI7A 4MIWA 3IRXA 5HLFB 3EGZA 4LQ9A 1XMOJ 1WEYA 4ICLA 5THWA 1PAUB 4FYDA 2IHR1 1EETA 2HMIB 4CDIA 1I94J 4I1TA 2RDIA 4NLUA 2E9TA 4F3QA 2R2RA 1LFPA 3FC9A 3KXDA 2C2KB 4RUAA 1JQGA 3KG0A 4IR9A 2VHGA 1RTJA 5KFRA 2BZ2A 2YWGA 5G0RA 3O8WA 4RUBA 1UMJA 3DGPA 2RVJA 4G6VB 3TA1A 3V4IB 3PKMA 1HBOB 2CQGA 4K4WA 3JYTA 3DYAB 2ZH2A 4TNOA 4ZCKA 4R8UB 5F3TA 4K4SA 2F7VA 2APOA 3GG1A 4K4UA 3HI9A 1UW9A 1WC6A 2HQDA 3SMZA 5LXYA 1PC5A 2QMXA 1JLAA 1FXRA 2KJWA 4M5JA 3G8TA 4RW7A 5KFOA 5ETNA 3BEGB 1VLYA 4DN9A 4DX6A 3BGRA 3C8YA 5IT9Y 3T6BA 3AD8C 2X1BA 2DGSA 1HHQA 4DFKA 2R8KA 4FYWB 3C46A 3BJYA 2DNZA 3TJ9A 3NS6A 2J9DA 2GVZA 1HMVB 1U1MA 1GFWB 3RR7A 1ZTTA 5D0GA 3H2UB 3MCOA 2EG1A 3KUEA 3HD2A 1S9GB 5I3UA 2YQ3A 2MB0B 1FKAF 1S4EA 2QV6A 2R8HA 5ETKA 3NGRA 5CD4A 3QYYA 3GIMA 2XMUA 4Q0BA 5KFBA 1FDBA 2V8DA 1RA7A 2AQ4A 1HWLA 4U7UD 1AROP 2FIUA 4MKAA 1PC4A 3MTJA 1S1UB 4DL5A 1S49A 1ZAVA 1IXKA 1FFSB 8AT1B 3KJVB 2E5IA 1R31A 3F41A 2MGZA 2OSQA 3M8ZA 2MZ1A 4X64F 1RAOA 2YBVA 4NXMJ 4DQRA 4NLXA 4A8QA 2GJ2A 2KT2A 6FD1A 1A0OB 2QMUB 2CPYA 2PO4A 3UD3P 3PG9A 3MI7X 1K0TA 3BSOA 3R97A 2EFGA 2CG4A 2MHEA 4TYBA 4RW4A 4M5IA 4B3RJ 1KLNA 2CZVC 4DUTA 4ZIVA 5A0YB 2ZVSA 2AYMA 2M2BA 1DHMA 2J9EA 2G9OA 2W01A 4EBEA 4LQ3A 1WUUA 2EC2A 5DG7A 4DV3F 3LANA 2R7RA 3HVWA 4WZMA 2ROEA 1DLOA 1X0PA 1K73T 2QN6B 3I0RB 4JI3J 1FESA 4GKKF 4N5SA 4USIA 2WBRA 2V4RA 3NP5A 2UUAJ 2DHHA 3HVTB 1G1XA 1B64A 4I7FB 2AW0A 5G4DA 1HQEB 3TQ1A 4JI7J 4URGA 2VICA 4WF9Q 2WVEA 4K2XA 3MAAB 2JEFA 2DNNA 4N76A 2GS8A 2OP5A 4O3SA 4DR3F 2PMWA 3LWMA 1IKWB 2ZNZA 1L3VA 2JRSA 4FN5A 2KN4A 4LFAJ 4ED8A 2J0XA 2ZJRQ 3CJTA 3DOLB 1QAIA 2MKHA 3OT9A 3NEKA 3DLGA 1BY9A 2CQ3A 2P8IA 1YJNS 2HW3A 2VG7B 1WDTA 5EGYA 3A1YG 1IJEB 1N0UA 2OPSB 5M2RA 4R25A 5DETA 1H2TZ 4MIAA 4J5OA 2FHJD 4LJMA 5BJRA 3MR5A 5ETMA 4MH8A 3CJKA 3KK3B 3TAMA 7FD1A 2CPFA 2FJVA 2DXFA 3MM6A 3UVJA 5F3ZA 4GKJJ 1AUSL 3TUZC 1V3SA 4LRAA 3UI3A 5B0AA 4EWTA 3PEHA 3DXBA 4TYAA 1SJ4P 3T9NA 4RW8B 1XNRJ 2ZM6J 4YY3F 1HPZB 1AYEA 1UJ4A 5DZ6A 2Z30B 5BR8F 2EK1A 4DV5J 1EIYB 1FJGF 4RL1A 1F5AA 1O51A 2BJ9A 1TAQA 1N0VC 1U2FA 3HHKA 5BYRA 2GVDA 3T6JA 4NLQA 3KLHA 2YKMA 3MR7A 2RB7A 4YHHF 2JC0A 5JMNA 2IVFB 1W26A 4DZDA 1LEOA 2CQ2A 3CMES 1N36F 1N32J 3A13A 4OZ2A 2IPOB 3GJTB 4Y2AA 5L46A 2DRAA 3MD1A 3AAWB 3ENWA 4QW9A 2KT5A 3OL7A 2YPZA 2HAFA 1VHFA 2HURA 3HT0A 3AOCA 1B7YB 1YDLA 2UUCF 3MM5A 2DR7A 4ECVA 5ETVA 1HLWA 1CULB 1D8ZA 3PX0A 1IBMJ 3B78A 4JI1J 3CULA 4OIXA 3D66A 4OI6A 2YNFA 3MEEA 5E33A 2NYHA 3PV8A 2RT3A 1NJYA 4AL6A 2UUWA 4KV8B 2CPEA 4ZA1A 4BBYA 2ZE2B 3THPA 1KQGB 1S9GA 5IM0A 1MWYA 1GMUA 5I4MA 5F9NA 3Q8VA 2V69A 4C6AA 1NDCA 1WF1A 4LRCA 2XHWA 4KJIA 3W65A 4ID5B 1N56A 3KK2B 4D3HA 3MMAB 1LWFA 3AODA 3W64A 3TVKA 4LVNP 4CO4A 2LP4A 4HEA9 1DJ0A 4E2FB 5HATA 3CDWA 3N6NA 2POKA 3D67A 3QSYB 2AWZA 4NL5A 2XQCA 2MZJA 3JQKA 3MPYA 3H8YA 2HHXA 1RTHA 5FDLA 4TXSA 4PG4A 4DLEA 3DMJB 1RWPB 5T7LB 2RMLA 4B9UA 1S0MA 2Y8YA 5JUMA 2EFOA 5D0RA 1UVIA 1S1TA 1TL7B 5D15A 3HVRA 2ZH9A 3SSQA 3Q23A 3GIJA 2BMBA 1U49A 1NB7A 1IKYB 4CNZA 5KFIA 4U95A 3IFEA 5SZTA 2F9DA 4WKRA 2BX6A 4YB1P 1UKUA 1RHKB 4DPOA 3ZTQA 5KFAA 3OHBA 3RAXA 2GHPA 4ZVGA 4X4SA 5KG4A 2YX4A 2XY5A 2HNZB 3HVTA 3HHLD 1HWKA 4ZLJA 4KC5A 2RKIB 1RACB 4KT0C 3NGKA 1HBUB 4PABA 2GCFA 3OLAA 3OJUA 1FRJA 3ITHB 3OR2A 2FZKB 5SUHA 3UR3C 4TY8B 4DDFA 2FB0A 1URNA 1T03A 2IBKA 3PR4A 2HFVA 5GAEU 4GVBA 3QT5A 3TAQA 4K50A 2XWYA 2W2OP 5L1IA 1N34J 3DLEA 1VBXA 4Y3CA 4RW9B 9ATCB 3DXSX 4NLWA 2N7YA 2UUBF 1SXLA 4NLOA 3R27A 3IC1A 4QU6A 2OPSA 4KGMA 2Q79A 1SKSA 5FD1A 1C0UB 1N33F 4NI2A 1FNXH 3ET6B 1X4CA 3C15A 4ZJLA 4C97A 2MDAA 4LFCF 2KYXA 1IKVA 3ISNC 3OTBA 4J9LA 1NHKL 2YKPA 3IS9B 1D3WA 4WU3A 2JVRA 2AYGA 2QG9B 2GJFA 2GIQA 4OI2A 1AZSB 3DRPB 3F44A 3QAEA 1NM2A 2M7SA 5H1SV 3DC2A 4HVZA 1RYSA 1CJTB 1RABB 2PA8D 4GRSA 1UZHA 4DCPB 4ZVRB 3PYDA 4U6PA 2XZTB 2ZUGA 4L73A 1VK3A 5E41A 2C2ZB 4U9RA 1T94A 2JEIA 4X62F 4IFYB 3PYGA 1T9TA 2W2MP 4QIFA 3HP6A 3HFZB 1YJVA 4ECYA 2RE1A 3MM8B 3PR5B 3WX8A 3BPDA 4ZS6A 5C25A 3DLJA 2IC3B 1KFDA 4A4JA 1VQSA 1R0CB 2WB4A 3KJFB 4U7CA 3NNAA 3HKWA 3T9ZA 2YY3A 2J9CA 3T1HF 4CLKA 4F0HA 3PW7A 2VOPA 4N47A 1U0SA 1SC4B 4MMOA 4ED2A 2DPIA 1HYSA 1RHJB 3JAMU 3FSYA 5KFQA 1R3NA 1Q81T 1R27B 1NUEA 1RWWB 3B4DA 2AZ1A 3FBCA 3N4WA 3I4HX 2VD3A 2H4YB 4UY8T 2JJ4D 2FJBB 1YBAA 3IM8A 4LF1A 1S9EB 2H1YA 2XZWA 2CQHA 2XLJA 3E2EA 1IR1A 1RT6B 3V2UC 3P6YC 4ECWA 4Z7CA 1RTZA 4HHUA 2V68A 1XTZA 2JZ5A 1RP5A 3QGPA 5CYMA 7FDRA 2YQ0A 3ZZUA 2BE2B 4MYTA 4K7QA 1RXOB 5KFKA 4YDDB 1EX8A 2V8PA 2CPZA 1X9WA 2H5IB 2W9CB 2CQ0A 3KOAA 4RPFA 3QGIA 1HNXJ 4KV8A 3MMJA 3DU6A 1M5VC 2CQCA 1G2EA 2JOQA 1HWJA 3I4PA 1MWZA 3HO1A 3IRWP 2F4VJ 4ED0A 4V19J 2W24A 1OJ4A 4HH0A 2LQ8A 4NYZA 4ILRA 1VGYA 4DR1J 4OHWA 3LP1A 2U2FA 3SCLE 2XB2D 4DU8A 4ID5A 4QYRA 3OLBA 3CDUA 3I9ZA 1KVKA 1CVJA 3AOBA 3CWJA 1RAHB 4J9RA 3GR1A 5LJ3Y 4B02A 1XNQJ 1IBKJ 1JLCB 3LP2A 2GJIA 3OHAA 2Z56B 4IOCQ 4XDDA 4BDPA 1RWVB 1SQFA 4RWWA 4H4OB 5D3GB 3HFKA 1FFWB 2C2NA 2WSFC 1Z4UA 3T1YF 2IYIA 3EUNA 2NXCA 3W61A 4Z37A 2OPRA 1AA1B 1VRUB 1NJXA 2AHOB 1H6KX 5E7OB 4AT1B 1RTDA 5T41A 2D7SA 1FO1A 1R89A 3QRRA 4M5MA 1DQAA 2A2DA 1N88A 4DR2J 1P8GA 3CD6S 3CNQP 1TU0B 2FVSA 4AFFA 1T9UA 5J1EA 4B9MA 4LF7F 1WC4A 3IG1A 4C98A 2UXCF 2LDYA 4M63A 4EO8A 1TK8A 3POTA 1OYEA 1KWMA 1Y9OA 3A3PB 2KJVA 3GWCA 1RCOB 1GQEA 2BJ3A 4C11A 4WE1B 3S01A 4QW8A 4ER8A 1RA6A 4AQYF 3MAHA 4USKA 3GU0A 1HNVB 1NZAA 3OTDA 4L3NA 1PYSB 3G86A 3W5YA 3VQSA 5HMXA 4C8MA 5K5MA 2KO1A 2DNPA 3H90A 2PI5A 4P2SA 3MZIA 4QWEA 2M8HA 4QU7A 5KTQA 3MF5A 5H9FK 5C42A 5DLFA 4WJBA 4DPYA 2BOAA 2MY7A 2I1RA 2G0IA 5KT4A 3NS7B 2LXFA 3H20A 2BOPA 2LYVA 4IG0A 1S77D 3MHYA 1N52B 3CVKA 1F5BA 4F2SA 2LQBA 1HBNB 3ZTSA 4X64J 2MJNA 2KYZA 2RQKA 1XBWA 1TFWA 4P73A 2OO4A 2HLUA 3QO9B 2KXNB 2KVIA 2HK3A 3RZAA 1AT1B 1HA1A 3R5GA 2MXYA 4C8KA 2AU0A 2DGWA 1IBLJ 2P6SA 2E29A 4FXVA 4HTJA 4YS2A 3UDEA 3NRBA 5DQIA 4UZCA 2IC3A 3VAIA 3FSXA 4NASA 3AH6A 2BRLA 4A8YA 2XCPA 3BYRA 4IDKA 5DRKA 1ZPVA 2MKJA 3LQVA 3D6TB 1L3TA 3BF4A 4E8UA 4Q8FA 4AYBD 4J9PA 1NDKA 1CQNA 3QZ7A 2EG2A 3OVAA 5KOWA 3CO9A 4UT4A 3ILOA 4U67Q 4ZP7A 2DNRA 3VGUA 1U1PA 1U48A 2XGQA 1FKOB 1KP6A 4O3RA 5KFPA 2ZDOA 3MFHA 4CLUA 3LP0A 2DISA 2EEYA 3DN9A 4EMDA 1S9FA 1U8WA 2FLPA 3RTVA 3K59A 4OX6A 1NB2A 1FCAA 4ZVFA 1WI8A 3KDNA 1RLCL 2BV3A 5IV3A 1M5OC 4DR7F 2PMZD 4EZ6A 4IR1A 1S59A 1JX4A 2NPFA 3CF5Q 4DL7A 1Q82T 2VA2A 4ECXA 1XERA 1U1LA 2HNYA 4BWMA 2ADCA 2EBGA 3R5AA 2OELA 1QY7A 4ED5A 2EFPA 3NL0A 1EZZB 3HF5A 1LV5A 2Q3PA 5F9LA 1OPZA 1BD6A 2IAJB 3UNYA 2ATLA 1GAOA 5ETRA 3HHLB 1FX4A 2UP1A 1T3NA 3MCMA 4DS5A 1HBMB 4DL6A 3VR1A 4XO0A 4Q8EA 4KSEB 5F0UA 2OHDA 3PHTA 4RU2A 6AT1B 2CJKA 2Z2MA 1SL2A 4ZP8A 3Q8UA 4X4OA 4YY3J 2EXUA 1NPKA 1F6TA 2V2VA 5C7PA 4WP9A 2ZBIA 4WKYA 3K57A 2DXDA 4DCOB 4IOBA 2VB6A 2FJDB 2KU7A 2OH2A 4UTGA 4ZP9A 2KB2A 2BW2A 4UF4A 3I5BA 3GYNA 1LW2B 3MURP 3BV8A 3LTOA 2CA9A 4YR2A 4ZK7M 2Y1LB 4I6WA 3T5LA 3S6EA 3VHQA 4NZ6A 3CJQA 1V3ZA 2XLIA 2IM3A 4ES3A 4LF6F 3OUYA 1S0VA 1RBOB 4DFJA 4P2FA 3W60A 2YNIB 2DNHA 4J9KA 1KS2A 2E44A 1R8HA 5CYQB 4OYZA 4IOAQ 3JB9k 2R8GA 3B82A 5C2CA 1FI4A 2JHEA 2XCAA 2M9KA 1A9NB 4EFAC 1WEXA 4C7QA 4NRUA 5GAGU 3KG4A 4KAIA 2FY1A 4DL3A 1U1QA 4WXOA 4DSFA 2D3OR 5K14A 3IR7B 1REGX 3M05A 3W66A 2NZ4A 3LF0A 1NJZA 3HT3A 2A1BA 1PSDA 4J9MA 2V94A 4WE1A 2ZOGA 2MEWA 2EW9A 1CSJA 1NDLA 1XQIA 3QJLA 3DOMB 4JI5F 1WTFA 3TI0A 3MECB 3HSDA 2FJWA 2KDOA 4YFUA 4M94A 3GJSB 2YKNB 1Y10A 3CTRA 4MK9A 1WKLA 4OL8A 4F3OA 1IQTA 3NMRA 2CKWA 2AEMA 4DR4J 3GPAA 4J37A 4OHVA 2RU9A 5GVQA 3BN4A 2PI4A 2U1AA 1Y4ZB 4JI4J 4QWCA 4DFPA 4LSLB 3ELHA 2GZOA 4ZN1A 2DEJA 2GAHC 3BKTA 1RYRA 1PIEA 3E51A 3DI6B 4ZP6A 2Z57B 1VIOA 1WHVA 1UTAA 1IKXB 5DQHA 3KFWX 3PW4A 4RJVA 1T9YA 4IRDA 4W4MA 3P8BB 1R6YA 5IXUA 4A8WA 4LFBJ 4QYZK 2VPYB 3L9ZA 2RHQB 3NKYA 3IWNC 2VODA 4K59A 2YWHA 5CH7B 1Y7PA 3PACA 2ASJA 2HG4A 1CLFA 1REVB 2HHPA 2CJXB 4KKOA 4Q2MA 1MLAA 3MMCA 2I5JB 3FFIA 4F4YA 3L7OA 3RUBL 2J6TA 3TZWA 3PX4A 3PO5A 1TL3A 2LXIA 4Y0FA 3EVMA 3BGLA 1PKUA 3FJ2A 1ELOA 5ADZA 1JKHB 2BM0A 2FLLA 3BSCA 2WAQD 2BANB 3TJAA 5JVHQ 3EXCX 2HEKA 1YHQS 4CH0S 1HQUA 4S0MA 4JV1A 5IT9U 2ZKTA 2WB1D 4X4NA 5IT0A 2QFJA 2RQ4A 1VLOA 4LUBA 2EWHA 2K1RA 3LA0A 5I3PA 1XMOF 3CJSA 1DY3A 3MXHP 5DLGA 3BM7A 1JK9B 3J7A1 4I64A 4ILMA 1S1VA 2GGPB 4F4KA 5AXMA 1N5SA 1FT8A 1JLFB 5KFJA 1OSDA 2OI2A 1EKSA 3AOAA 3DRSA 3CPWR 2W9BA 2WW8A 1PILA 1UPMB 2SXLA 5KG7A 1C2PA 2QGFB 3HHNB 3QWPA 1SC3B 4JOUA 2E1PA 5E0OA 5KAKA 2OPPB 4OYOA 3VCDA 2P9CA 4YUDA 2I0XA 3A12A 5L1JA 3EZUA 2KHDA 4ZOSA 5HVHA 3OL9A 4WBFA 3EVOA 4NOHA 3IN5A 4JI0J 4USWA 1ZZFA 1L3UA 2J7WA 3SSSA 2I2YA 5EUHA 3CE8A 5D0HA 2CVIA 1DTQA 2NS1B 2HHSA 3S1TA 1F1BB 4LFCJ 4XTTA 2EK6A 4H4MB 4ZVQB 1YX2A 3U02A 2HNDB 4CI0B 4TKTA 3G6VA 1PG5B 4C3MA 5CXTA 1X4AA 3VWSA 1HBMA 2G0JA 2HHUA 4O3NA 2ZD1B 3BSNA 2W7PA 3ETOA 4HR2A 5M2PA 4JYAJ 2PSZA 2QA1A 4PWUA 4CLFA 1OSCA 4A46A 2R7VA 4MKYA 3TQEA 1MU2B 1UCNA 1TKZB 4L72B 4FF1A 4N8OA 4QR0A 1OY9A 4IYQA 2F1FA 1H7XA 1QLNA 1FKPA 4DSJA 2YQ1A 3NNCA 3MM7A 2UVRA 1UEKA 5IZHA 1VQMS 2LU1A 5DGBA 3BZQA 4HDGA 3FCWA 1HIYA 3GP9A 2MQ8A 1F9EB 3JTPA 1U45A 3BQ1A 5KG6A 3FMWA 1RT3B 1KHWA 1FVSA 2V2ZA 1RTIB 3KLEA 1VRQC 8RUCA 2NYIA 2ZKUA 4R0EA 3ETMA 3BO4A 4NXMF 2MY8A 2JFKA 2XMTA 1S12A 4NLPA 1RT5A 4X4RA 2OLWA 3W2WA 3V4MA 2DHXA 2MJUA 5GAEI 1LQ9A 1LWEA 1NH7A 1U47A 4B3RF 3Q24A 3DOKA 1A7GE 4DN0A 4Z2XA 4DG1B 3M6UA 3LGHA 4PPDA 1V9OA 3CDAA 2IDLA 3KYLA 1FEEA 4NLDA 2CJYB 3MM9B 2UU9J 4HT5A 1WC1A 2BBEA 1KNZA 2QA4S 2YNHB 2YNGB 1QDUB 1R8PA 1QTMA 2AKWB 3MFIA 2IDEA 5LSOA 4NXNJ 3PCOB 4JI3F 2H54B 4A8OA 2V4QA 4H54A 3LAMA 3DDKA 1JLBB 3GZ7A 3ILJA 4N77A 3U1LA 2UUAF 2BDPA 4FKYA 4WFYA 3C3LA 2VC0A 4OHZA 4JI7F 1FDNA 4YOEA 3RR8A 1TZ0A 1WORA 3PW0A 1C4CA 3HD1A
chains in the Genus database with same CATH topology
3MM6A 4XK8C 5F3ZA 3LGMA 2UVVA 4FF2A 1FNMA 1FHTA 3LP0B 2DNGA 2W4DA 1NK5A 1JLQB 3TUZC 2ROPA 3BB5A 3HKZD 2KG0A 3GV8B 3GMGA 2XSFA 1V3SA 3JTNA 3GSDA 3UI3A 5B0AA 3IWXA 4EWTA 3PEHA 4WFAQ 2DR5A 3US5A 3OTOF 1VRUA 4M8LA 2UU9F 3DXBA 4DFMA 2LA4A 4ZPCA 4D3GA 2XC9A 4ELUA 4LFAF 5LJ5Y 4TYAA 1P6TA 4FPRA 1SJ4P 1VC5A 3HX9A 3T9NA 5HP1B 2ERRA 2RU3A 2VONA 4RW8B 2RS8A 3TW0A 4YY3F 1HPZB 1URRA 2N3LA 1UJ4A 4I68A 2AJFE 5LSRA 2BJEA 4MJKA 5BR8F 2EK1A 4NXNF 1K8AT 4QCLA 2FGCA 1FJGF 3V6KA 1QVFR 4ZHRB 1SI9A 2PT0A 3FEXB 2JX2A 2AP6A 1F5AA 2D41A 2OD4A 2OPQA 1O51A 2QA2A 2K7JA 1TAQA 1P1TA 1N0VC 3CCZA 1U2FA 3HHKA 3QPIA 3RB3A 5BYRA 4DF4A 4NLTA 5T14A 2ILZA 1X8DA 3T6JA 4F4WA 1VQOS 4NLQA 2G0CA 3M8RA 2AX0A 3KLHA 1RT4B 4UOCA 2XNQA 4DSIA 1MNEA 2QLWA 1QSLA 2YKMA 2DHGA 5GAHU 3J7YI 2HNYB 5IT4A 2XEXA 1GXUA 2ROGA 2RB7A 4YHHF 3CJ2A 4FXDA 1IQZA 2XMKA 2JC0A 2LVWA 1B7FA 4A8MP 2IM1A 1WHYA 4USHA 3K5NA 3LOUA 1S79A 3CJ3A 2IVFB 5E3CA 4ECTA 2CQ2A 1X5TA 4GKJF 2E1AA 3CMES 1LK5A 2OD6A 5CZVA 1N36F 4EZ9A 5D77A 4NLGA 1RT7A 2ZZMA 3H5SA 4Y34A 1V6HA 3IGNA 4KB7A 4OJ3A 4DEZA 1FTRA 3P49B 5A8KA 2Y1IA 2B5JA 1X9SA 1E6YA 3EX7B 4Y2AA 5L9NA 1R8BA 1L5UA 5A8RA 4DQPA 4X4QA 4I2QA 2DRAA 3MD1A 1YRTA 3UR0A 2KM8B 3AAWB 3SEOA 2J7UA 4KQZA 4X65F 2EBEA 2HFNA 2WSEC 4C2MA 5KFMA 2DGVA 4CH1A 3DU5A 3ENWA 2ZM6F 2AJ1A 5E2QA 1WACA 1RGVA 4O3PA 2B6AB 4QW9A 3KK1A 2KT5A 5AE1A 3G6XA 3BS9A 3OL7A 4OX9F 3ZZRA 4BC9A 3KHRA 1EP4B 3IR5B 1HNVA 1BLUA 3M8QA 1RJJA 1VHFA 5J2MB 3NAHA 4DQQA 4RBTA 5HROA 2GHWA 2CRLA 3T1AA 2H5EA 4Y6IA 4ES2A 3BR9A 3K5PA 4TLRA 4KIAA 4LF4F 4ATNA 2HQIA 1UFLA 3DNCA 2UUCF 4BHQA 3G6YA 3V6JA 1S10A 1APSA 1QE1A 1FF2A 4DV1F 3MEKA 2VG5B 2DITA 3MM5A 2DR7A 2UXDF 2R9LA 3N9UC 4ECVA 2LCWA 2GQQA 4ZPBA 1UVKA 2FHOB 3DRRB 2R7WA 1D8ZA 4ZVHA 3RB6A 3GR0A 5E5NA 3C6UB 1ZH5A 3PX0A 5F8MA 3CDEA 3B78A 3S8SA 5GAHI 1J2VA 5L38A 4HDHA 2V9KA 1FK9A 3H59A 2OSRA