1R0AB

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
total genus 103
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB03
1N56A 1EP4A 3MEEB 4IFYB 5F9LA 4ZPDA 3BQ2A 5HBMA 3PJWA 4WE1B 4I2PA 4KFBB 4ZVEA 3BREA 2ZE2A 1EETB 1RT2A 2OPSB 5KFEA 5J1EB 3FQLA 4ECXA 2RF2A 1S1XB 1XR5A 4DEZA 3MR2A 1LW0B 1IKVB 1S1XA 2VG6B 5KFZA 4PUOA 1EETA 1RT2B 2ZE2B 4DG1A 2D7SA 5KFAA 5DLGA 5T14A 5L1LA 4J9RA 4XO0A 3V6KA 4EBEA 4KBIA 4F4YA 3KNAA 1HMVB 4NCGB 4OL8A 4ED2A 1LWEB 3BSCA 4O3QA 5KFHA 3V6DA 4RW6B 3C6TB 3PR4A 2BQUA 1HYSA 2FLLA 4IRCA 1HPZB 3MEGB 4KO0A 5I42A 4TYAA 5D3GB 4ZP8A 2XCAA 2W9AA 4ZPAA 2ALZA 5J2NB 2E9TA 3ITHB 2YNHB 5F9NA 2GIQA 1N6QB 5F8IA 2W8LA 3I0SA 4O44A 5F8GA 3OL9A 1RTDA 4H4MB 1RT1A 4Q0BB 1C1BA 4MFBB 1NHUA 1S48A 4KE5A 1LWCA 4R8UB 5KG7A 4O3RA 2W8KA 1JLQA 2AGPA 4NLWA 1S1UA 2IAJA 3PW0A 3H2LA 4PQUA 3MR3A 4KSEB 3TQ1A 2UVUA 3DDKA 3FSIA 5J2MB 1TVRB 2ASDA 1S10A 5KFLA 5KFBA 3M9NB 4NLXA 5L1IA 3HKWA 1BQNA 3DRPB 2ILYA 3DOLA 4ICLA 3DRRB 3KLGB 3V4IA 3H5YA 4WYLA 1TV6B 4EO8A 2AGOA 1J5OA 1S1TB 5KFXA 4H4OB 3KLFA 1BQMA 2UVRA 2O5DA 2FLPA 4Y2CA 3DLGB 1C1CB 4K4ZA 4RNOA 4J9QA 3LP2B 1VRTB 1QE1A 2E9RX 1JKHA 1JLBA 4RNFA 5EUHA 3PW7A 1VRTA 4Y3CA 1C0UA 4QWCA 3KLEA 1ZTWA 4KV8B 5KFNA 3CJ2A 1BQMB 4H4OA 4J9PA 2QE5A 3QGIA 1TV6A 3IRXB 1MMLA 2JC0A 1TKTA 5KFUA 3G6VA 2VA2A 2AGQA 3UPFA 3RAXA 4Q45A 4RNMA 1TQLA 3M8QB 1TVRA 4JUZA 4G3IA 4NLTA 4RZRA 1JLCB 4RUCA 4EO6A 2IC3A 2FVCA 5KFFA 4EYIB 2RKIA 2BRLA 2C22A 1S1UB 2IAJB 1IKYB 2ZD1B 5DQHA 2C2RA 2JEGA 2HAIA 4J9NA 1RTDB 4ED8A 2WRMA 1K1QA 4KKOA 3CJ5A 3BQ0A 4LQ3A 3ITHA 5F8LA 2V9WA 1IKXA 2YKMA 3GQCA 2HNZB 5D3GA 1HPZA 3OSPA 1RTIA 1RT6A 1IKWA 1MU2A 1S1VB 3C6TA 3T5HA 3CO9A 5KFKA 2FJXA 5EWFA 3CDEA 4F4XA 3TVKA 4ECRA 3FRZA 3CJ4A 1TKZA 2JEJA 4QPXA 3PW2A 4QW9A 5F8NA 4ED7A 2D3ZA 4YR0A 2DPJA 4NZ0A 1TKXB 1IKVA 3GIIA 4I2QA 4YQWA 3MFIA 5JXSA 2W9BB 5J1EA 3RB4A 2WOMA 1RAJA 4ECQA 4WE1A 3KHRA 3DMJA 4WXOA 1FKPB 2FVRA 1TKZB 3BSAA 1EP4B 4G1QB 4IFYA 5F8MA 4IDKA 5EDWA 3EPGA 3V81A 4EYHB 4K4TA 2AU0A 3ISNC 4F4ZA 3KMSA 3CVKA 3QIPA 1IKWB 3T19A 3CDWA 2W9CA 4ECZA 3HHKA 3LP0A 2FVPA 3D5MA 4ZVGA 1RT3B 1FK9B 1R0AA 3BGRB 4I7FB 4LSNA 2YKNB 5DQIA 2I5JA 4J9OA 3I5CA 1S9EB 1HQEA 2ZD1A 3QYYA 5L1KA 3ICLA 1JLGA 1HNVB 1SV5B 2AX0A 1RYRA 1S4FA 1SUQA 1UWBA 4RNHA 5KFVA 3JYTB 3MF5A 3Q8PB 4EEYA 3NAHA 4K4XA 1DTQB 5KG6A 2YNFA 4IG0A 4IG3B 3I0RA 3Q8SB 4NLUA 3UDLA 4EBCA 2IM1A 1RYSA 1TL3B 3M8QA 1RTHA 3CDUA 5C25A 4JV2A 4RUAA 4DL3A 1FKOB 5KT2A 3DM2B 3HVAA 1JLFA 4XPEA 4R5PA 4NLPA 4TN2A 4K4UA 1RT4A 4KV8A 1RDRA 2UUTA 4MKBA 4NLGA 1C0UB 4RW9A 4ECYA 2OPPB 3OL7A 4MK9A 3MEDB 3TAMA 1JKHB 4MIAA 1REVA 1QE1B 3QLHA 3IS9B 2ASLA 2R2RA 3QIDA 5C24B 5J2PB 4O4RA 2CJQA 2IMWP 5KT6A 2J6SA 4NYZA 5KFRA 2F8EX 1J5OB 2XGQA 2HMIB 4ZVHA 4RNNA 3QZ7A 3H5XA 1DTTB 2BE2B 4ID5A 3DM2A 4LQ9A 2XC9A 1BQNB 3DRPA 1S0OA 5KG0A 1U09A 2IM2A 5KG1A 5KFQA 3FFIB 3BSOA 3BSNA 3LANA 5L9XA 5J2MA 4ECTA 3OL8A 2R8GA 3T5JA 3I0RB 4WZQA 2BANB 4RW8B 3M9MB 2V4QA 1JXLA 2VG5B 4QWAA 4DL6A 1SUQB 1UWBB 3HVTA 3H4DA 1SV5A 1JLGB 5C42B 3UQSA 2R2SA 4JV0A 4R8UA 4O3SA 1S9EA 5KG5A 4H4MA 4Q0BA 4O44B 3I0SB 3DLEB 2JLEA 3E01A 3BQ1A 3NGDA 5KFJA 3RAQA 4I7FA 1S49A 2FVSA 3OL6A 2YNHA 4WFYA 5EWGA 3GV7B 5DGBA 4TQSA 2C2EA 3V6HA 3KHGA 4URGA 2ASJA 3DOKB 1RT3A 2XGPA 3MEGA 3LP0B 2R8HA 4DL2A 1HYSB 3QIPB 4NRTA 3V6DB 3SFUA 4YMEA 3V81B 1HNIB 5KFDA 4O3NA 2IBKA 4G1QA 3H4BA 1FKPA 3MECB 3C6UA 1CSJA 4ZVFA 2C28A 4B3OA 4DG1B 3T5LA 1NNDA 4ED0A 4RW4A 1TP7A 2D3UA 5KT7A 2VG6A 3RBDA 4KHMA 2RF2B 3PW5A 2R8KA 3FQKA 4RW4B 3OLAA 3RB0A 4YP3A 3GIMA 2RDIA 4KFBA 3SFGA 3MECA 4NLYA 2XI2A 5HLFB 3RB3A 4RU9A 4K4YA 2B6AA 5DLFA 1QAJA 4NLDA 4ZP6A 3HVWA 2FJVA 3N6MA 4URQU 1RA7A 3DRSA 3DYAA 5DG9A 1MU2B 1S1VA 2C2DA 3DLKB 1RTIB 4WFZA 3KK1B 2HNZA 2WONB 4ZHRB 2B43A 3Q8QB 4ED6A 2BQRA 1IKXB 2YKMB 3CJ0A 1S9FA 5HROB 3NL0A 3QGGA 5FDLA 2CKWA 1LW2B 5KFIA 1KLMB 2I1RA 2VG7A 4IOBA 3NMAA 3LAMA 4KHRA 4HKQA 5L1JA 4IRDA 5C42A 4LSLB 4ED1A 1SH0A 2RKIB 1JLAA 1QAIA 5KG4A 2WB4A 3QO9B 2BANA 4RW8A 2GIRA 1RT5A 3JSMA 4O4GA 1OS5A 2GC8A 2FVQA 4MKAA 5F8HA 1VRUB 3DI6A 1S6QA 4XPCA 3FFIA 2FJWA 4ZP7A 1XR7A 3OSNA 2YNGB 4QW8A 4TQRA 1RT7B 3D28A 3H5UA 3PJXA 4ID5B 3RB6A 3IRXA 3GYNA 1N48A 2JEFA 1T03A 5HP1B 1SH3A 5J2QB 1N5YA 4U7CA 4EBDA 3KLHB 1JX4A 3I5BA 4URSA 2WCXA 5C24A 5J2PA 3KLEB 1S1WA 4WYWA 2R8JA 1T05A 3NAIA 5DQGA 3QLHB 3IS9A 1JLBB 3NBPB 1YVFA 1REVB 4NRUA 4FS2A 3GIJA 3GV8B 3T1AA 2HNDA 2OPPA 3QGHA 4O3PA 4ECWA 3LP2A 4RW9B 2OPQB 2YNIA 2W7OA 1ZETA 1S1WB 1C1CA 5KFCA 1RTJA 1RT4B 4WXWA 4MK7A 2IJFA 4J9MA 3KLFB 1JLFB 4R5PB 5J2QA 5HP1A 2E9ZA 5CYMB 5KT5A 4IR9A 2XWYA 3KK3B 3DRRA 4GC6A 3DOLB 4ICLB 3KLGA 1FKOA 1S6PA 3V4IB 3QZ8A 3CIZA 4GC7A 2W7PA 3BR9A 4Q44A 3G6YA 1W25A 3PZPA 1RTHB 2IM0A 3PHEA 3LP1B 5KFMA 2FLNA 3JSMB 1RT5B 3KK2A 1DTQA 3QO9A 1N4LA 4K4WA 4IQXA 4KB7A 1JLAB 3PR5B 4MK8A 5DG8A 4ZMMA 5KFTA 3BJYA 4IH5A 4LSLA 1KHWA 4F50A 4K4SA 3MFHA 3H98A 1C1BB 4MFBA 4NLRA 2VG7B 4NLVA 4F4WA 1JLEB 5K14B 4MH8A 4IKAA 2YKNA 3KLIA 5I3UB 1N6QA 5FDLB 4NLQA 2R2UA 3CJ3A 4MIBA 1LWFA 4TY9A 4QWBA 3GILA 1R0AB 4M95A 5J2NA 3LAKA 2XI3A 4DL4A 2WONA 3PVXA 3KK1A 2J6UA 3OHBA 2W9CB 4KAIA 3EZUA 5KFYA 5KT4A 1HQUB 4NLOA 4PWDB 4TY8B 3DRSB 1LWEA 2V4RA 3G6XA 4NCGA 2OPRB 4IDKB 3KJVA 4ZPCA 2B6AB 4QWEA 4ZP9A 2B5JB 4Y34A 4Q8FA 5HLFA 1S0NA 5JUMA 3DMJB 3KHLA 2WOMB 3MR6A 3G86A 3KLVA 4PUOB 5KFOA 1C0TB 3GV5B 4DL7A 4I2QB 1XR6A 1LW0A 4O3OA 3M9OB 1TKXA 3I5AA 2W9BA 4TYBA 3KMQA 2ILZA 1C0TA 2AQ4A 2OPSA 3IGVA 4B3OB 2UVWA 2RDJA 3C6UB 4I2PB 2HWHA 3MTKA 3OHAA 5HBMB 1SH2A 3NKYA 2B5JA 3MEEA 2BQ3A 2ATLA 2OPRA 3KJVB 1HNIA 1TL1A 4K4VA 2HNYB 4PWDA 2WK4A 1HQUA 4TY8A 4IR1A 1RT6B 2UVVA 1Z4UA 5KG3A 3V6JA 2DPIA 5CYQA 1K1SA 1DLOA 4IFVA 5KFGA 4YR3A 3DOKA 1S0MA 4HYKA 4X2BA 1LWFB 2UUWA 2IJNA 4FBUA 2IM3A 4KKOB 3KLIB 5I3UA 3E01B 4RW7A 3DLEA 5K14A 4JV1A 1JLEA 2VA3A 1IM4A 3T5KA 4DL5A 4J9KA 5F8JA 1S9GB 1I6JA 1S97A 1IKYA 3IG1A 3HVTB 3OLBA 2VG5A 2HWIA 4IRKA 1HARA 2IC3B 1JLCA 3KK2B 4H54A 2EC0A 2BRKA 3LP1A 3IN5A 2AX1A 1S6PB 3IGNA 2QV6A 3KK3A 3LALA 4Q8EA 1ZTTA 1TKTB 1DTTA 2BE2A 3M8PA 5CYMA 1NHVA 2ZKUA 4Y2AA 2HMIA 4Q43A 3RBEA 3KOAA 2AWZA 2JEIA 5DG7A 1T3NA 1RA6A 1RTJB 2WTFA 3EPIA 2OPQA 2YNIB 3CWJA 4NLSA 4WFXA 2HNDB 3H40A 3TAMB 3ISND 3MEDA 3NBPA 4ECSA 1T05B 4ECVA 3KHHA 3DLGA 4R0EA 1T94A 2IA6A 5C5JA 3KLHA 5KT3A 1S1TA 1N5YB 4ZPBA 1T03B 5KG2A 3M8PB 4WZMA 3SI8A 1KHVA 1RT7A 4M94A 4ECUA 5EWEA 3H5SA 2YNGA 4FS1A 2OH2A 3VQSA 5C25B 4TXSA 4J9SA 1TL3A 1QUVA 1S6QB 1VRUA 3DI6B 1D0EA 3N6LA 4U6PA 4O4GB 2BR0A 4IG3A 4IH6A 2YNFB 4IG0B 2V0NA 3Q8RB 4FBTA 4YR2A 4PQUB 4J9LA 3JYTA 5DGAA 5KFWA 3PW4A 3IG1B 2D41A 4IH7A 1HNVA 4TLRA 5KFSA 2R8IA 1JLQB 1S9GA 1LWCB 2R2TA 4ED3A 1HQEB 1WNEA 1RT1B 2I5JB 1GX5A 3N6NA 1KLMA 4RW7B 1LW2A 1JIHA 1GX6A 3UR0A 3BGRA 4LSNB 3MR5A 2WHOA 5HROA 1FK9A 4K50A 4ZHRA 2XCPA 1C2PA 1DLOB 4IFVB 4KO0B 5I42B 5CYQB 3DLKA 3GIKA 2JC1A 5KFPA 3H59A 1D1UA 4RW6A 3E51A 4QWDA 3DYAB 2J6TA 2HNYA 3FDSA 1TL1B 1HMVA
chains in the Genus database with same CATH superfamily
1N56A 3MEEB 2GIFA 5F9LA 2QGFB 1YZ6A 2QSFA 4DXLA 4WE1B 3QRRA 1PJ7A 4ZVEA 3BREA 1EETB 1RT2A 3U1MA 3RBZA 1GXLA 5KFEA 2VBXA 3FQLA 1S1XB 1U1OA 1LW0B 1KVIA 1S1XA 2VG6B 4A48A 3L3CA 2QFIA 4OZ2A 5KFZA 3RTVA 1RAHB 3IR6B 1EETA 1RT2B 2GMHA 2JHEA 3PYGA 1FI4A 3PRBA 4USHA 5DLGA 4TU7A 1XMQJ 3G9CA 4AL5A 2QC3A 3Q22A 3AA8A 4X4VA 1U48A 2ATCB 4KBIA 1S12A 4OZ5A 2KJWA 2W2OP 1R8BA 1U24A 4NCGB 2J5AA 3L9ZA 3UO0A 2LMIA 5LXRA 1U0SA 4F02A 4LT6A 3K0JA 1FRJA 3C6TB 1WTFA 5B0FA 3W60A 5EHHA 3PR4A 3R1LA 4RWWA 1OYEA 2M8HA 1NMEB 2C2KB 1I1GA 2HQFA 3I4PA 5I42A 3MPDA 4JI2F 3W9HA 2W9AA 1NB7A 4P75A 4JI0J 1XQIA 1GT8A 1A9NB 1URRA 2PMZD 1CC7A 2CQBA 3UD4P 5IM0A 5F8IA 2MPUA 4PKDB 4ZCKA 3I0SA 4O44A 2V2QA 1QDUB 1RTDA 3T9NA 3DLHA 5KFNA 2UXDJ 1ULRA 2Y0BB 2W8KA 1RAFB 2VFUA 4R25A 1N5VA 1NH8A 3D67A 1S1UA 4V19X 1OQ3A 2MKKA 2BKPA 1B70B 3HFZB 4PQUA 3MR3A 5HVGA 2XMAA 4LF7F 4DCPB 5CCLA 2FQQB 5E2QA 2XM3A 4JYAJ 3OT9A 5J2MB 4L3KA 3HHLA 5CD4H 1V9OA 1S10A 4OZ1A 1T7PA 1MN9A 1FESA 4B3SF 2E5HA 3KLGB 3V4IA 4OYPA 4DSLA 4N77A 2V67A 4ETZA 2F40A 5A8KB 1Q53A 2OLWA 2CZ4A 2DISA 5B0DA 5IT0A 1J5OA 1NSPA 2HG4A 4PWUA 4H4OB 4X4SA 3CCJS 2DY1A 4LF5F 4RKUC 4U8VA 4I68A 2D74B 2HVEA 4K4ZA 1KOOA 2VPYB 3X3UA 1VRTB 2QN6B 1NSKL 4DFJA 1QE1A 2R7SA 2NSCA 2NZCA 2FPHX 1RWUA 1VFJA 2VPWB 1Q1KA 3PW7A 2WW4A 1RHQB 1X5PA 2DGSA 7AT1B 4KV8B 2XY7A 4UY85 3B54A 3M8ZA 4KH1B 4UZBA 3NRBA 5E3QA 2VA2A 1RQ0A 3G6VA 1K44A 1WWHA 2YX7A 3G8SA 2CA9A 3UPFA 4QIWD 1FERA 4JBCA 2JL9A 3EDQB 4USTA 4YB7A 2B8PA 5K8MA 4Q45A 1TQLA 1TVRA 1F60B 1VQ5S 2BABA 1IQTA 1RSCA 2AV5A 1JLCB 3QSIA 4NLTA 2IC3A 2E1RA 2FVCA 3JSRA 1RWVB 2OKQA 4CDIA 1HWJA 2IAJB 1YK9A 1IKYB 2LKZA 1VIOA 3P96A 4OI2A 3NCQA 5E3CA 4ZOSA 1T9YA 4ED4A 1NDCA 3TA0A 4FKYA 5E33A 3TUIC 1Q0NA 3TP2A 2HAIA 1FO1A 4J9NA 2JEGA 1EB0A 1TK5A 4ED8A 2WRMA 2BDPA 3PXGa 3BQ0A 1T9UA 2UUAF 3VWSA 2DGXA 4LQ3A 2CQ4A 3R5DA 5C2CA 4GMKA 2MLXA 5RUBA 2HNZB 4LFAF 1KBRA 3OSPA 1VBKA 3SMZA 1JJCB 1RT6A 2W24A 3LO3A 1S1VB 1PJ6A 2ADCA 2L3MA 5KFKA 1WEYA 2QLXA 5EWFA 3B82A 2LA6A 2MZQA 3CJ4A 4YDDB 4L74A 1X60A 5KFWA 2JEJA 4K2XA 5CCMA 4GKJJ 4QPXA 4QW9A 2E66A 4HI2A 2ERRA 1Y3JA 1YRXA 3EJMA 4N8OA 3FBEA 4DV6J 4I1TA 4LF1A 4OZJA 1HHQA 2DXDA 2KVIA 1IKVA 2XMWA 2UV8G 2QL7B 2VJVA 5JXSA 2XHCA 2J0WA 1F5CA 1N0VC 2NXCA 2HFOA 3WIUA 1HFEL 2ZBPA 1CJTB 2P6SA 2OFGX 3GONA 2WOMA 1RAJA 4PEOA 4ECQA 1H3DA 3DGPB 1TK8A 4N56A 4ZVTB 1TKZB 3BSAA 4HHUA 1I51B 4EYHB 2CJYB 5LMNJ 3J7ZT 3CVKA 4HACB 1HBOB 3PEHA 5ADZA 5L39A 1FRLA 3BGFA 2QL5B 5IZHA 4KHPF 2FB0A 2DB1A 1YSJA 2HQGA 3D5MA 5ETQA 1RT3B 1U6ZA 3GPAA 1FK9B 4P6QA 2DTJA 2YWHA 3NOCA 3TAQA 2YKNB 1E6YB 2GVZA 2KO1A 1WKKA 2I5JA 3QMQA 3TZWA 1QSSA 4IOAQ 1FWPA 1HQEA 4FYYB 1SC4B 1TR0A 4P7TA 4Y2KA 2HVIA 3QQCD 4PR6A 1SV5B 4AD6A 4OJGA 4YB6A 4LVOP 2HQIA 2YWFA 3VF0B 4MAKA 1DTQB 1XWLA 2NXNA 4G65A 5KG6A 4DX8H 3I0RA 2HFSA 2Q79A 3UDLA 1TKDA 5L46A 2MTLA 3TOQA 2MQLA 1U1KA 3CDUA 2H65B 3AOAA 3MMAA 4JV2A 5CZXA 2BE7D 2P9GA 3DM2B 4CM0A 1PGZA 2GMLA 3SCLE 3B4MA 3HVAA 3J7YI 4XPEA 1N5TA 3JQKA 3S01A 4Q5VA 3PRDA 2CJKA 3I32A 1ELOA 4MKBA 3EZ5A 5KFYA 1Y3KA 2MLZA 3FUYA 1C0UB 3DU6A 2V2ZA 3M1VA 2OPPB 2XHWA 4DUZF 3VALA 3TAMA 3F0NA 1DY3A 4MT1A 3A3OB 4YDXA 1SIWB 1DURA 2PGCA 5E3RA 2C2OB 3D0IE 2KT5A 4DQSA 1LXNA 1NDPA 2CJQA 2H9ZA 3HKZD 3JS9A 2N4CA 2IMWP 2DHXA 2MZ1A 1NBEB 2F8EX 4EZ9A 4LF9J 4RNNA 5A6PA 2KFYA 2FJDB 6FDRA 3CJRA 1UZDA 3DM2A 2VBWA 2H5EA 2MZTA 3HSJA 3JAMY 5HQLA 1KD1T 1Z2LA 2GVDB 4DWIA 1EHWA 4ED5A 2XY6A 2HW3A 3D1HA 5KFQA 2G0JA 2DNMA 3BGOP 3W2VB 3EZOA 1E6VA 2DNHA 4C6AA 1H2UX 2R8GA 3I0RB 2ZUGA 1HHSA 1MWZA 2D9OA 1JXLA 4L6V3 3VAKA 5HMYA 3T1HJ 3EICA 4RLEA 1SV5A 4CO1A 1JLGB 1CJUB 3UQSA 1G4CA 4JV0A 4LF7J 4O3SA 4O44B 3I0SB 2W2QP 3HSDA 1NM2A 2OMLA 3M2VA 5D4PA 1PJ5A 3LOUA 2E1CA 2C3OA 2ASJA 1LWXA 1A7GE 4FBUA 3RW7A 2VQEF 1RT3A 4QR2A 1Q5YA 5BYRA 4AYBD 3NOGA 1WJ9A 3T1YJ 2W4DA 1Q79A 4QOTA 3VGUA 2VDHA 3CCTA 4CO5A 3BDPA 2VJUA 1B64A 2QIFA 1QJHA 5KFDA 1HNIB 1B0VA 3SSSA 2KDOA 2GJFA 4G1QA 2CZ9A 3M32B 3CCZA 4AUKA 4PG8A 1U45A 4JOUA 2GV1A 1FKPA 3H4BA 3MECB 3PYDA 4ZVFA 2QL9B 3E2EA 2M4MA 1NNDA 3R1HA 1X5OA 1NZ8A 1Q8BA 1TP7A 1X0PA 1S7HA 1XIQA 2FHJA 2ZHOA 1FD2A 1FTCA 1NJYA 5T7LA 1UJ6A 2RF2B 2R8KA 1J2VA 3FQKA 5KAKA 3OLAA 5D4OA 3RB0A 1DQ9A 3KUHA 4YP3A 2CUYA 1RAOA 3EDRB 4YB5A 3SFGA 4KYZA 3TQEA 3CJQA 4LRAA 4C2MA 1MSWD 3VV2B 5DLFA 2HHHF 3DYAA 4UW2A 2EW9A 3HVRA 4A47A 2C2DA 4MKYA 1NK7A 2BKNA 2XNRA 2UUAJ 4NA3A 4FNIA 3TANA 2ROPA 2G1HA 4WFZA 4H4KC 4DV1J 2EI5A 3PO4A 2YKMB 3CJ0A 3GWCA 3QGGA 4X62J 2CKWA 4E2FB 3HJVA 4WK1A 1KLMB 3ILJA 3L09A 5K9FA 5KFIA 1L3SA 2VONA 1GMUA 5EGYA 2I38A 1RP5A 2EK6A 4HKQA 4BWMA 2JDJA 5B7WA 5C42A 4LSLB 3CF5Q 2DK2A 2AZ3A 4DV1F 1FEHA 3IM8A 2LXFA 1REGX 4OHYA 1KR4A 1NDKA 3MPVA 1IBLJ 2KYXA 2GC8A 2MKJA 4MKAA 2NPFA 2HWTA 2NPIA 2DHAA 1BGXT 4GVLA 4AXIA 4LJMA 1ZOTA 3FEXB 3R5GA 1N52B 1VHFA 5G4DA 1Q95G 1WD6A 4TQRA 3H5UA 4N8NA 4DMZA 4ID5B 2EBGA 2JZ5A 3R8YA 1S79A 3PEJA 5F41A 3RB6A 1T03A 1UW9A 1R0CB 2H5IB 3D6TB 3THPA 4DOZA 4F25A 5AJ3J 5SUHA 3EM1A 2JNJA 3MCSA 3I56S 4EBDA 2Y1JA 2W25A 2XEXA 2WCXA 2KFZA 5J2PA 2VH7A 1S1WA 3PFOA 2JRSA 3TEHB 3QLHB 1JLBB 1N48A 4X64J 4ZLNA 4FS2A 3F44A 3GV8B 3BB5A 3T1AA 2HNDA 2AJ1A 2YNIA 1HD0A 1RWKB 4CLTA 2W7OA 3Q24A 2R7TA 1U6FA 5DRKA 1WC6A 1WI6A 2IPOB 5HN0A 2UXBJ 1WUUA 1JLFB 2DNOA 5HP1A 3W2WA 2Z2ZA 2QX0A 2F4VJ 2XWYA 3GLJA 3MAHA 2X1FA 3MAQA 3K17A 4A4JA 1FKOA 1S6PA 3QZ8A 4JYAF 5A6WA 2HHVA 3PDNA 2RDDA 3PZPA 1RTHB 3ILOA 5MLCV 3LP1B 1CBKA 2F4FA 1O51A 2MQOA 2FLNA 2VOOA 2Y1LB 1RT5B 2RAQA 1HQ2A 3KK2A 1N4LA 1HLWA 2DGUA 3NCRA 1Q4RA 4K4WA 4JI1J 4OYIA 1YJNS 1Q8LA 2GFFA 1FF2A 2CFXA 2Z56B 4J90A 4M1KA 4G1PA 1LV5A 3KG4A 1UW4A 4ZVPB 4K4SA 3ZTRA 3CCRS 3CW2C 3CIMA 3CJKB 1GMWD 4MFBA 1IBKJ 3NMRA 3HLUA 2DHGA 3FC9A 5K14B 2YKAA 2R2UA 4MIBA 3R7NB 3HFVA 4NEZA 3VGSA 5GAEI 8ATCB 3HK2A 2MKHA 2XI3A 3AH6A 3P3DA 4PG4A 3G2XA 1I3OB 2KXFA 3PVXA 1NK0A 3OHBA 4DR7F 3CMAS 3ULHA 3TAPA 1OSCA 1B3TA 4KAIA 5JVGQ 2XYGB 2XY5A 3TNVA 4U67Q 1VC5A 1LWEA 4F67A 1UPMB 1X4HA 2OPRB 4ZPCA 1M5SA 3GYGA 3L7OA 3QATA 3QT7A 2B5JB 2DH9A 1LFWA 3H2VE 4ZP9A 1X4EA 3GR0A 3KKFA 3MAAA 1PIEA 2OEJA 1WDDA 2K7KA 3KLVA 2FLOA 2VC1A 1XR6A 2HBRB 2IFXA 3PFEA 1TKXA 2E44A 2R7QA 3K5PA 4CIOA 2AQ4A 1HHTP 3EXYA 2PSZA 3T9ZA 3ZNJ1 3BGUA 2HWHA 3NKYA 2YKPA 4C4WA 3M32A 1FD8A 2ATLA 1HNIA 1TL1A 5F0UA 2B9XA 2HHSA 2M70A 3FZBA 2L9WA 2WK4A 2YXLA 2EBEA 4TY8A 3MEKA 1XC9A 2UP1A 1JJHA 2VBZA 3V6JA 2HHTA 4K0KJ 3HI9A 1Q7LB 3GFYA 5D0RA 1MWQA 1N0UA 3GTYX 4PPZA 3ISZA 1S0MA 1PAUB 1F2HA 3R6GB 4X2BA 1FE4A 1UPPA 3M2VB 1QAXA 3IXQA 2PFFB 3E01B 1IXKA 1T95A 3VHQA 3OXFA 3C8YA 3C14B 2RUGA 3N01A 2C3MA 4J9KA 3SSQA 1S9GB 2RE1A 2YBVA 3MM9B 2QA4G 1NK4A 1N32F 2F1FA 1OMSA 4OJ3A 1IUJA 2FTRA 4L3NA 2VPZB 4H54A 1TL4A 2EFNA 4PZVA 1UMJA 2SXLA 1JXEA 1LFPA 2AX1A 3IGNA 4OZ0A 4YFUA 1FWLA 3I9ZA 3LALA 1FRXA 1ZTTA 3Q89A 1X4AA 4Q8EA 1W2IA 1KQFB 2W4PA 4E0DA 3F41A 4EWTA 5E7OB 5D6GA 2JEIA 3N5FA 2IHR1 3NLCA 5DG7A 3U1NA 2HKEA 2OPQA 4DV6F 4FDFA 4OX9F 2HHUA 2XZDB 3MWBA 2FDNA 4FYWB 3VVTA 4RUHA 1F9FA 6FD1A 5CD4A 4ECSA 4CLSA 4XDDA 3Q0AA 5L38A 3KLHA 4ZS6A 2N82B 5ETNA 3J7AN 3TWZA 3AFGA 4C48A 2HHPA 3SI8A 1KHVA 4G1IA 2DITA 1RT7A 4ECUA 1RBLA 2RHSB 2NSBA 2M88A 3ETMA 4P2FA 3NS7B 4F0HA 4TXSA 1R6VA 4WBFA 1RCOB 1QUVA 2YQ1A 3UNGC 4F0KA 1D0EA 4WFBQ 3OUYA 1LEOA 4O4GB 1XNQJ 1R27B 2V0NA 4C0BA 1TFYA 3HSGA 3OR1B 3Q8RB 4FBTA 1QLNA 3ETOA 4J9LA 1XMBA 3JYTA 5DGAA 1YJWS 3OW2R 1Y0HA 3HDSA 2K7JA 3HF5A 1FJGF 2D41A 4NPOA 3MXHP 4HL9A 3D6HB 1JLQB 2R2TA 1V3SA 1HQEB 1UKUA 5E5NA 2ZKTA 2I5JB 2MY7A 5A2QU 3N6NA 3JAMU 2OO4A 2OEMA 4CYUB 3O3LA 4LSNB 1XERA 5KTQA 4NI2B 2QLFB 4OHVA 1QD1A 1FK9A 4ZHRA 1C2PA 4IFVB 3UW1A 3ENQA 1D09B 4JI5F 2GQCA 2MB0B 3N5BA 5KFPA 4DX6A 3H59A 4F7VA 1D1UA 4RW6A 2P9CA 1ZS6A 3IAS9 2G2ZA 4YB1P 3PIPQ 2J6TA 1YJ9S 1HMVA 3S6EA 3QRPA 1QAYA 1RWOB 1YJ7A 3SEOA 2MKCA 1KVKA 5HBMA 1IJEB 3PJWA 4YUDA 2ADBA 4I2PA 3NGTA 4NYPA 2Z8QA 2BM0A 1HBNB 2V69A 2OPSB 1N5SA 4QQBA 5J1EB 1FNXH 4DEZA 2F63A 2OI2A 1XMOJ 2B9EA 3M2UA 3EGNA 4B3RF 5HI7A 4WF9Q 2DH8A 2ZE2B 4DG1A 2D7SA 5T14A 4K5SA 3MMBA 4B9MA 1IJFB 2BJDA 3NGSA 3FKBA 4P2MA 4WPAA 3JXOA 4EBEA 3V6KA 1R7IA 4CCHA 3KNAA 4ZCMA 4ES2A 1KS2A 3TX8A 4OI6A 2UZAA 4X65J 3FBBA 4RW6B 4LF2A 2KL8A 4ZDNA 1HYSA 1VDHA 1SQGA 2EFQA 3VVUA 4UQTA 3PCOB 4KPCA 5HAOA 1HPZB 3PNIA 1LK5A 2AJ2A 3MPWA 4ZP8A 4NXNF 2DNZA 3BH6B 4ATNA 2DNQA 3ITHB 1WF1A 5F9NA 4M63A 3RBXA 1TL7A 3KDOA 2WVDA 2W8LA 2HFZA 3OL9A 2HBYB 5DM7Q 4QIEA 1RT1A 2CQIA 1C1BA 3MM5A 3G96A 4DF8A 2BOPA 3A4TA 1D9FA 2RH3A 1HBUA 2AGPA 1NDLA 1WHVA 3HX9A 2XS2A 2LXUA 3DFEA 3H2LA 1LXJA 1R8PA 4MKVA 4P10A 3IBWA 3W5ZA 3BBFA 2N4DA 3UD5A 1U1PA 2G4BA 4HH1A 3S7RA 1TZ0A 2QTWA 4GO5X 2J7KA 5KFLA 5KFBA 2DKOB 5ETRA 1U0HA 3AJ1A 4DHVA 5L1IA 3HKWA 3DRPB 2V4JB 2ILYA 4ICLA 2F65A 2ZUAA 4NWBA 4CLWA 4DR1J 2HZCA 4UZCA 4WYLA 5IQ6A 5BR8J 4EO8A 1QVFR 2FYXA 3QBCA 2J8SA 4DV2F 2CQCA 3EE3A 3PG9A 5KFXA 3KLFA 1BQMA 2H48B 4N47A 1X4CA 2O5DA 3M6WA 4DV0J 2UVRA 2FGOA 3DLGB 4Y2CA 3RAMA 1CQMA 4RNOA 2HAFA 5DDPC 2AYGA 3LP2B 1KNZA 2OIHA 4HR2A 1N36J 2XMUA 2E9RX 5EUHA 1WOOA 9ATCB 1VRTA 2KH9A 4Y3CA 4LR7A 3HMJG 1ZTWA 1U8SA 3NNAA 3HPOA 4WJBA 4KJIA 1NXIA 4M8LA 2P9EA 3CJ2A 4DQIA 1HNWF 4H4OA 3J7A1 2F8MA 2QE5A 3H2UB 3QGIA 3N9UC 2AT1B 3D9BA 4DPYA 4WKRA 2I9SA 5M2RA 3VCDA 5FD1A 1K73T 4B9VA 4HH0A 4I56A 4OHWA 4HDHA 3RAXA 4USMA 4HEA9 3G71S 3BBCA 2UXCJ 2N3OA 1HWIA 4WTYA 3DC2A 3V2UC 4AQYJ 4ILLA 2Z0GA 1FEEA 3ZZTA 4YEAA 1YBUA 2RKIA 1NCLA 1SC3B 3R5AA 2C22A 4B08A 1S1UB 3UFCX 3G87A 1RTZA 5A2QY 3B6BA 3X1LB 2ZD1B 2NR0A 1F3FA 2LEPA 2RJZA 1FFGB 4YS2A 4I4BA 4B3MJ 1OY9A 2Q3PA 4YOEA 2BBEA 3CJSA 3CJ5A 1AA1B 2P6TA 4KGVB 4M5JA 4QJVA 5F8LA 1NK8A 3FRYA 1IBCB 1IKXA 1SJQA 3GR1A 4LIRA 5D3GA 1GK8A 1KFDA 3LF0A 2RT3A 1RTIA 3PJ9A 3HO1A 1G6BA 2BV3A 2CNLB 2IYIA 4JI3J 5HQ8A 1MU2A 1QVGR 3CO9A 2FHMA 3KUGA 1ZM2A 2RQKA 4ECRA 2CJBA 3PW2A 5F8NA 4ED7A 3I31A 2NUUG 2HBZB 3D68A 5G0RB 2WB1D 3M8YA 2DO4A 2DPJA 1CVJA 3A8IA 1SIZA 2G0IA 3QAUA 1TKXB 4NZ0A 1BE4A 4LF4J 2HGLA 2Z4PA 2CNNB 4Y2IA 3MR7A 3TW0A 3WX4A 5BXIA 4EI2A 1SQFA 3IWXA 1TUVA 4WE1A 3KHRA 4WXOA 5E3PA 4D3HA 1U6BA 2FVRA 5AXMA 4IFYA 2XZTB 1IM6A 1NJZA 4F4ZA 2HFNA 2UUBF 3KMSA 2ALYB 4DR2F 1H72C 5A8RB 1IKWB 1HD1A 4USUA 2MQPA 2W9CA 3EGVA 3VZIA 2COLA 3HHKA 3EVMA 4ZVGA 4JI7F 4B02A 2XQCA 4ALZA 1KDNA 2PMHA 4DQQA 1AROP 2HFUA 3FK4A 4RO0A 4I7FB 3FGVA 3DHWC 5DQIA 1YGYA 4CLUA 1SJFA 2L9DA 3UCUP 2MKYA 1S9EB 1EAYC 1VS3A 3C16A 2ZD1A 3CCQS 5L1KA 4KPYA 4Z7CA 1P1LA 3CDAA 1RYRA 2OTJS 3ZC4A 1SUQA 1UWBA 4EEYA 3OQ2A 2UU9J 3NAHA 4CLZA 4K4XA 2YNFA 1RYSA 4IG3B 3J80Y 4EBCA 4NLUA 2FHJD 4NCBA 2PT0A 2CWKA 5HQMA 1HNZJ 3M8QA 3JQJA 3OXLA 3M6UA 3V4MA 2JH3A 1FKOB 4C3KA 1VK3A 1XNQF 3MPYA 2MZJA 2FZGB 3D1QA 3S1TA 3DOMA 4TN2A 5DZ7A 3T6BA 3VAIA 2CJXB 3WIVA 4K59A 2HEKA 2BA9A 3UCGA 1FJ7A 2J0SD 1AUSL 4MK9A 2DIUA 1JKHB 1BC6A 4MIAA 3QLHA 2Y3YA 3H25A 1T9XA 1K0TA 1Y4ZB 4JV5J 3B8HA 2R7OA 5KT6A 2J6SA 2ZZNA 3DOMB 1FKAF 4JI3F 1ZBTA 4OX9J 2HMIB 1R8CA 3C19A 4ZVHA 3H5XA 1BXNA 1DTTB 3PRVA 4N76A 2MHNA 2KG0A 1VHIA 2DJWA 1BQNB 3HULA 5DJBA 2M7SA 1NU4A 1U09A 1FVSA 1KQSR 3QJPA 3R6LB 4X4QA 2Y1IA 2C3UA 2K1RA 4U7UD 3BO3A 3OL8A 3T5JA 2NXJA 2CPXA 1R8AA 1YBTA 2AKWB 4M5KA 5A0YB 3T1YF 2UXDF 1NPRA 2JFKA 2RHQB 4QWAA 1R31A 1PYTA 4CH7A 4C8ZA 3HVTA 1S72S 4DN9A 3ZTQA 1WG4A 4O0NA 2R2SA 1HBUB 2FIUA 3GP9A 4CO2A 1RB0A 2E5IA 2YQ3A 1VK8A 4J91A 1OIAA 4R8UA 3BDEA 4H4MA 4Q0BA 4AQYF 2Y8YA 4HTIA 4I7FA 4JI2J 2FVSA 1HIYA 2YNHA 2AW0A 2DGWA 1RAGB 2N7YA 3FCHA 2MGZA 3GV7B 3V6HA 3GIRA 4DPUA 5DS7A 1G3OA 2V9KA 1LQ9A 2CG8A 2KT2A 3CJTA 3FVYA 3LP0B 4RBTA 4UTGA 2M52A 1F5AA 5DZ6A 5HMXA 1YIJS 1UVJA 4WP3A 1FX2A 1YRUA 3RZAA 1R89A 5A8RA 2C2ZB 2ZJQQ 2KTQA 2OD6A 3K7RA 1HNWJ 3ZZPA 3V81B 2I8EA 1HL6A 4O3NA 4CO0A 1XJWB 2ZOGA 3MPUB 1IN0A 3Q2SC 4ANCA 3K58A 1VQNS 2BMBA 1VBXA 2ZBCA 4UOHA 3IP0A 2E5LJ 1CSJA 2LQ8A 3T5LA 4DG1B 4KGZB 3R7BB 4RW4A 2D3UA 1HA1A 2E7VA 5CAAA 2PI5A 1PC5A 2XSFA 1CLFA 5BYSA 2G2OA 1T9TA 5F0WA 2CADA 1FFWB 1UAWA 3ENWA 3ELHA 4PAAA 1S6UA 1JNRB 1DAXA 4KFBA 2RDIA 3GIMA 3A1YG 2CXEA 2O66A 3MECA 4CNZA 1WC4A 1VLOA 2VIHA 5HLFB 4A8KA 4JI6J 3D3BJ 1TMJA 3DRXA 4RU9A 1U1QA 3D3CJ 2A10A 4ZP6A 3POTA 2E5LF 3R9LA 5D0EA 1U2FA 2IIHA 4OLPA 1PYOB 2M8DB 3KK1B 4F26A 2WONB 4ZHRB 2A18A 1NK5A 2HRYA 2KM8B 3THVA 2XLJA 1S9FA 1NK6A 3NL0A 5HVFA 3JTNA 4DV7F 2QMWA 4I6WA 1LW2B 4P72A 2XSJA 1HBMA 3HM9A 2DO0A 2I1RA 2VG7A 4IOBA 1U02A 2VUGA 3LAMA 4KHRA 1CJUA 2B51A 1UFKA 2DRDA 1TMMA 5LJ5Y 4ZJQA 2MHEA 1SH0A 1Q7YT 2RKIB 5E0OA 5A76A 1QAIA 5KG4A 2WB4A 5B08A 3OR1A 4O4GA 2HFVA 2FVQA 2AYMA 2O3DA 5JJBA 1VRUB 3DI6A 1Q5VA 3OFFA 3PIOQ 3M8RA 5A8WA 2C42A 2JWNA 4UUXA 3UDVA 2VQFJ 3OSNA 2EVZA 1ROFA 2CQPA 3TX0A 4NXNJ 3D6MB 2IY5B 3IRXA 4DLEA 2JEFA 3M6XA 2F7VA 4LREA 5J2QB 1N5YA 1Q16B 2M2BA 1X0FA 3UWTA 2DXFA 2K06A 1F2GA 1HWLA 2R8JA 4USVA 2OAUA 3O2IA 5DQGA 2AF6A 3IS9A 1K47A 4B9UA 3EGWB 2CRLA 2OPPA 4GKJF 4RW9B 2OPQB 2B3TB 4HTJA 1T9WA 4WXWA 2HZVA 1EQMA 2FC8A 4X84A 4YN3B 1XMOF 4F2RA 4W90B 3G82B 2E9ZA 2RQMA 2GW8A 4JI5J 5KT5A 1NPPA 2LEAA 5GAHI 2ZH1A 4DPXA 3CXCR 3DOLB 2HLUA 2W4CA 3KXDA 4FP9A 4KH0B 2KI2A 3LWLA 2W7PA 1CC8A 5IV4A 4Q44A 3US5A 3G6YA 3OFGA 2KZMA 3UE2A 2IM0A 1ICEB 2Y9HA 5D78A 3OJUA 1S57A 2HBQB 3HCXA 5KFMA 3BO2A 3R5CA 3DKDA 1SL1A 2VICA 1NZAA 2XMKA 2KYZA 5CZVA 2HVHA 3HD2A 4GVBB 3BPSP 4IQXA 1FNOA 3TRGA 1JLAB 2HQDA 3PR5B 3CB4A 2AYEA 5KFTA 4I67A 3BJYA 2HHWA 1KHWA 1Y5NB 3ILLA 3AXKA 5AXLA 1XBWA 1IBLF 1QTMA 1VQSA 1NKEA 4F4YA 1T02A 1G1XA 3FJ2A 1WF0A 3C14A 1ZA2B 2G2YA 2ZWPA 4HDGA 1JLEB 2BYCA 4NLRA 4ZA1A 2XSJB 4F4WA 2YKNA 3KLIA 5I3UB 1TUGB 1N6QA 2YX1A 3BYRA 4NLQA 1T0TV 4TY9A 1LWFA 4X4PA 3GILA 3OTOJ 3K5NA 4DR2J 7FDRA 4DX7A 2WONA 2IRYA 3KK1A 1FA0A 2ZVSA 4NX9A 2J6UA 4A8WA 2AEMA 2B0GA 1WTBA 4RX6A 4CLFA 2O67A 4GRSA 3J7Z5 2FJAB 2FD2A 4QZVB 1HQUB 2E1PA 4PWDB 1KTQA 2FJEB 4HACA 1N54B 1FRMA 3G6XA 4LF8J 5HMWA 1RWWB 4IDKB 1HW8A 2B6AB 4Q8FA 1F1BB 1RAIB 5HLFA 5BJRA 3RRHA 3UDEA 2HIQA 1MWYA 2WOMB 3MR6A 2F8HA 3G86A 3KHLA 1PG5B 4ELUA 3KMQA 2QLBB 5CA5A 3FEZA 3OXGA 4DZ6A 2OPSA 2CNKB 2ZITA 3EUNA 3IGVA 4RPFA 4DS4A 2IYGA 3T6JA 3UN3A 4ER8A 1AUDA 3C6UB 2ZDOA 3R5JB 3MAAB 5HBMB 3UI3A 2B5JA 2BQ3A 1GQEA 2KT3A 5CH7B 1FNMA 3W3SA 1UP1A 3WC0A 3K57A 2GGPA 2XG8A 1LK7A 2XTJP 1WACA 4OZNA 3PX0A 2UVVA 2ZZMA 2XWXA 2ZC3A 5CYQA 3CEDA 4U96A 4IFVA 4YR3A 2MSTA 2QA2A 4O0IA 3AB2B 4B3MF 2HHQA 2CG4A 2P5VA 1BLUA 1DHMA 2MJNA 3AD8C 2IA0A 5IS2A 2IM3A 4JV1A 3M05A 4DU7A 3DLEA 1YJVA 2VQEJ 1BQXA 2VA3A 3T5KA 4I69A 4DL5A 3BO4A 3AQPA 5DDQC 1SKWA 5F8JA 1I6JA 2L41A 2KG1A 1PILA 4DR3J 1NEEA 3IG1A 3HVTB 2HLTA 3SSRA 1PSDA 4C7QA 3IC1A 3OLBA 3RBDA 2HWIA 3AXMA 3O6QA 2IC3B 3G8TA 1L5UA 1N88A 5U47A 3KK2B 4QCLA 4JP8A 2ASYA 2GAGC 2BRKA 2F5GA 4WCEQ 3LP1A 3D2WA 4BHQA 1U47A 3CMES 2R7UA 3JQMA 1FCAA 4QU6A 4QIGA 1KC8T 2MYFA 2UXCF 2R7XA 3ZTPA 2DY9A 3GCWP 1XMQF 4XTTA 3VQTA 2BE2A 4BCAA 3CD6S 3KOAA 3W2WB 1NKCA 2HMIA 2B4VA 2G1DA 1VC0A 3UVJA 2HRTA 1ZYQA 2WTFA 4OI3A 1M5KC 4P74A 3A3PB 4ILRA 4WFXA 4LRFA 1VQYA 3H40A 4WFAQ 3ISND 3MEDA 3K2YA 3MCMA 3WQPA 4B17A 3BYPA 5H9FK 1T05B 3LGHA 4ECVA 4FF3A 1T94A 3BM7A 3KJFB 3ZNUA 1RWMB 2AD9A 1U1RA 4DUZJ 2N3LA 2VC0A 2DD8S 3OTDA 3UNYA 4RBUA 4PYDA 5KG2A 4DLGA 2FY1A 3IWNC 3TUJC 4ITSA 4WZMA 4M94A 5K20B 2YPYA 3H5SA 2YKQA 5EWEA 2GX8A 4EZ6A 3VQSA 2W2PP 2LP4A 1CULA 3D54A 2O01C 3HSZA 4J9SA 1TL3A 2LCWA 2D1CA 1S6QB 2EXUA 3P4UB 4CI0B 3N6LA 4CM2A 2HQCA 3K8WA 2BR0A 3L7PA 4IG3A 4ZIWA 2YNFB 3LPEA 4Y65A 2E29A 5B0GA 4DR7J 2L48A 2W01A 3FZ2A 3PW4A 2EKNA 1WKLA 2HZAA 4TLRA 5KFSA 2LVWA 2YWKA 2VPXB 4I0WA 3UN5A 4NA2A 2QEXS 2HK2A 1WNEA 1VBYA 1ZAWA 2JVRA 2ZH8A 4DV4F 4RW7B 1X7VA 1RJJA 1GX6A 2NLWA 3BGRA 3LH2S 3UR0A 1T3OA 2HVZA 3GG0A 5HROA 1UEVA 2WBMA 4DSFA 5GAGI 2R4FA 1L3KA 2IJRA 5IOLA 2QO3A 2YH0A 2BW2A 1X4BA 2AJ0A 2JC1A 2MLYA 2XS5A 4F0MA 1SQEA 2HNYA 2D3OR 1TL1B 2A1BA 2LXIA 4IFYB 3CCUS 4L76A 3K59A 3PY8A 2J9DA 1K8AT 3MMCB 4OYBA 3I96A 2W2NP 4HLBA 4UOFA 2PC6A 4ECXA 5EX0A 2RF2A 1XR5A 2GO8A 3MR2A 5F3TA 3QNWB 4BS2A 1RHMB 3B78A 2IDEA 2MY8A 4PUOA 3MI7X 5KFAA 1U2CA 3DLBA 2M3DA 2PIIA 3G4SS 4N5SA 4TLQA 3D4JA 1U25A 4DCOB 4IO9Q 1UVMA 2KHCA 4LFAJ 3OVSA 2WSCC 1LWEB 3BSCA 4O3QA 2BQUA 3V6DA 2ZM6F 1FRKA 4NXMF 1J27A 2HGNA 2Q43A 1JNZB 2XMMA 1JB0C 3PKMA 2G9OA 3MEGB 1QM9A 1T11A 5D3GB 2ALZA 2Z30B 2XCAA 2X3GA 3NWGA 4FVMA 2BKOA 4ZPAA 1OQ6A 1PBUA 1NO8A 3ENAA 3KNGA 5K8PA 2KXNB 2E9TA 3MGJA 2GIQA 2Y8WA 1WC0A 4OJ1A 3C66A 1UVNA 2ZBRA 3C15B 3MM6B 5F8GA 4X4OA 1AT1B 2ZJRQ 1U1LA 4MFBB 1S48A 1DZ5A 5KG7A 4LMZA 1CPZA 4PG6A 1FHTA 2V2VA 5HJYA 4UOCA 3MM7B 3MM8A 3UD3P 3PW0A 3QFWA 2WVCA 1VQLS 4JI7J 3MUMP 1D8YA 1S5ZA 3RJMB 2UVUA 2C1EB 2GJ2A 3OTBA 3DDKA 3FSIA 4K5RA 3HHEA 2AEFA 4XDCA 4PWWA 1DBDA 4UT4A 2OP5A 2HURA 3H5YA 1J5EF 4ZPVR 2DNRA 3FMWA 4UF4A 5L9NA 1SCJB 2Q66A 3R2DJ 5LM7E 1YX2A 4DF4A 3A8JA 3BKUA 1SKUB 4ID8A 4QIVA 2AGOA 1Q86T 2EC2A 2LQ9A 4FPRA 1CS4B 3L7UA 1WF2A 3PX6A 4C3MA 1FWKA 4Q43A 1C1CB 2A2CA 2GA7A 5M2PA 4J9QA 2RMLA 1TUWA 3SV4A 5CXTA 1N8RT 4OJHA 1VQ6S 5H9EJ 1N33F 1BY9A 1JLBA 1UVKA 4RNFA 1C0UA 4PCQA 1RBAA 4KGKA 4QWCA 3KLEA 4CLPA 1X4DA 2JLGA 4OYWA 4BDPA 2QMXA 1VCTA 1BQMB 2CJAA 3UVJB 4J9PA 3MOZA 3IR7B 4F3MA 3G6ES 1DQAA 1FJEB 1TV6A 4LIWA 1MMLA 5KFUA 3C2PA 4ETXA 5LMUJ 2AGQA 4DQPA 4LF5J 2ZJPQ 3TARA 3RYLA 5ETMA 1U0HB 1YITS 4TU8A 2WSEC 3MMAB 4RNMA 2GZOA 1VQ7S 1UVIA 2PEHA 2HGMA 1CJVA 3J80U 4JUZA 1D9AA 1UCNA 4G3IA 4EYIB 1UVLA 3TUZC 2VQFF 1M5OC 4YY3F 3BN7A 3CUNA 2B4PA 4EK2A 3WZ0A 5AE3A 3M6VA 1D8ZA 4LF6F 2X3DA 1WSRA 5DQHA 2V34A 3WDOA 4ZKAA 1M0SA 1KFSA 1SB6A 2KRRA 2VU5A 1KLNA 4NXMJ 2HHXA 1E6YA 3E3XA 5MAOA 4WWSA 4CO3A 2AMCB 4CTAB 3ITHA 2YH1A 2V9WA 3FEYB 1XNRJ 2YKMA 2H3EB 4LSZB 1CG2A 5HJXA 1HPZA 2M9KA 4DV7J 1X4FA 2X1BA 3Q8VA 4ZJLA 3QSYB 2Q6BA 1YJTA 1YJRA 3KG1A 3U1LA 4F04B 3T5HA 4F4XA 3LGNA 3TVKA 3UDCA 4ILMA 3FRZA 4K0KF 3RR7A 4CO4A 3UCZP 1SL0A 1TKZA 2UUCF 4UY8T 3MMBB 4Y00A 2D3ZA 2GS8A 1AZSB 1ZPWX 3FBCA 4YR0A 2XO6A 1QTNB 1FXRA 2YQ0A 2QLWA 1H7WA 2X1GA 5HMZA 4DV0F 3GIIA 4DS5A 2HIYA 4PXEA 1N34J 4I2QA 4F3QA 4YQWA 2J0XA 3KJNB 5J1EA 1YG0A 2W9BB 1X8DA 4DV2J 3RB4A 3WC2A 4DSKA 3PYFA 3JSYA 4QYZJ 1RISA 1VIXA 2CZVC 2FZKB 2YWWA 3DMJA 5D0GA 1FKPB 3FMBA 2DEJA 3QGPA 5F8MA 1EP4B 4G1QB 3EPGA 2NQPA 4IDKA 4DI6A 4K4TA 3ISNC 2CAJA 1H2TZ 4CLLA 3CULA 1K9MT 5LSLA 2HS4A 2MZRA 1GH8A 2OHDA 3HHDA 3M8WA 5E3AA 1VBZA 3O44A 2BEFA 2FVPA 1F6TA 3SQGA 2AJQA 5EX3A 2DGTA 2IVYA 1IBMF 2FY8A 4LSNA 2AJFE 2ZH7A 3QT8A 2EEYA 5IC4B 2H51B 3K5OA 2FHKA 4J9OA 4F2SA 1LNQA 1RE1B 2OEKA 2H54B 3QYYA 4FVCA 1Z1ZA 3MUTP 1JLGA 1HNVB 2AX0A 2RILA 1FT8A 3NCPA 4LR8A 2KKHA 4ENOA 4A8QA 3U27A 4RNHA 3DLJA 3JYTB 3MF5A 4PG7A 5KFVA 3UN2A 1IWGA 2XULA 3WBZA 5GADI 3Q8PB 3O1LA 4P2SA 4KTQA 4KHPJ 3Q8SB 3VAHA 1VISA 2IM1A 1Y7PA 2L08A 2YTCA 4YY3J 3OUYB 5B0BA 2IMOA 2WVBA 5C25A 3D66A 3H0PA 4Y2MA 2DNYA 1GMVA 3BR8A 2QSWA 4NZ6A 2DRAA 3K5LA 1V6HA 4X4NA 5HK4A 4R5PA 2CPZA 4NLPA 4WIIA 3M4XA 4DUYF 4K4UA 4X65F 3ENVA 1S76D 5DO2A 5LMUF 4KV8A 2RRNA 2MQQA 1XK8A 4PXBA 4RW9A 3MDFA 2M5YA 3OL7A 1B7YB 2APOA 3GFZA 4NMLA 1REVA 2BX6A 2ZH9A 3ZXWA 1QE1B 3IS9B 2CPEA 4WIQA 1EZZB 2R2RA 1NHKL 1Y5IB 5C24B 3OPKA 4O4RA 4U9RA 4E98A 2ASLA 2QYGA 3GYXB 1CS4A 4NL5A 2WZ1A 2OTLS 2VHGA 1YZ7A 1J5OB 1IR1A 4NA1A 3QZ7A 1UL3A 3N4WA 4RL1A 2ABYA 2A3JA 2CPHA 2DNLA 4LQ9A 5K8OA 2IVFB 5CABA 4TU9A 3GB0A 4OI1A 1CQNA 2R7RA 4ZK7M 1MMNA 5AJ3F 1P9QC 3PX4A 2AYBA 2IM2A 3BBBA 5JMNA 3FFIB 3M2RA 1JMTA 1KN6A 1P1TA 3HHLB 5J2MA 3IFEA 3P45B 4M5IA 2VFVA 1RAEB 4NMXA 2BANB 4RW8B 3M9MB 4AXJA 2KN4A 2V8GA 4ES1A 4DL0C 3EXCX 4DL6A 2BJ1A 9RUBA 3BH7B 4YHHF 1JJ4A 1NSAA 3KWMA 3AHPA 1NPKA 4ZJOA 1HKAA 3W9IA 1T8EA 2CWXA 5LOQA 3LTOA 5KG5A 2ZHBA 2GVZB 2JLEA 3E01A 1UZHA 3CD0A 2QJ3A 1RHJB 3DU5A 1S49A 4KGMA 5D15A 5KFJA 4WFYA 5EWGA 3RAQA 4RUBA 1B0PA 3PM9A 5GMKa 3KHGA 4URGA 2J8AA 2AIRB 2DT9A 2XGPA 3MEGA 2WAQD 3OVAA 5LJ3Y 2R8HA 2GCFA 4DL2A 3FDSA 3KG0A 4C8OA 1P9YA 1VRQC 3V6DB 3SFUA 3QFHA 5IV3A 1GAOA 1GXUA 1KOHA 3GMGA 2BVZA 4UOGA 2E7WA 2KJVA 2XO7A 3BZQA 1C4CA 2GNKA 1QSYA 2XB2D 4MIWA 3FBFA 2E5GA 1OY8A 2RD5C 3GSIA 3LA0A 1OWXA 2K3IA 4DX5A 2BE9B 1KEKA 3T3FA 2DNKA 5KT7A 2VG6A 1RLDA 2BJ9A 4M5NA 2GHVC 4P71A 1EJ7L 4FXVA 4N7TA 4PABA 4CZCA 3PW5A 2UUCJ 4RW4B 1GNKA 1VQPS 2MEWA 3MMCA 4M5DA 3NGRA 4I6YA 4C0HA 5IFMA 6AT1B 5IT4A 4ZVRB 2FZCB 4ZIVA 2RQCA 4C11A 1QAJA 4NLDA 2A6OA 2WVEA 3HVWA 3LPYA 2FJVA 3N6MA 4QYZK 3DRSA 1TFWA 5FLXU 3U02A 1S1VA 1VQMS 4Q2LA 2UV8A 4ZLJA 2Z57B 2IBOA 1IR0A 2QG9B 2EFVA 3ET6A 4CRJA 1SPBP 2HNZA 2V8PA 5DETA 2B43A 1GEHA 2MMYA 1H38A 1RADB 5HROB 4CTAA 1NSQA 2RB7A 4KRWA 5FDLA 1KVJA 4NLGA 3FNNA 2LA4A 1EKRA 1R0BG 3NMAA 1RUSA 3LGMA 3M8SA 3PKYA 1P27B 1TTHB 5L1JA 1SL2A 4IRDA 3ZTOA 4ED1A 1AB8A 4PG5A 2Q1LA 1NUEA 1ZM9A 5J1NA 4L73A 2MSSA 2DR7A 4ELVA 2FUG9 2GIRA 3H42A 1RT5A 1YDLA 5F8HA 4GO7X 3MMJA 2CJ9A 1CJVB 1MMDA 2QZ8A 2PO4A 1HWKA 1S6QA 3GU0A 2B4UA 5AE1A 1NJIT 2XYHB 4HHJA 2JOQA 4ZP7A 4DDFA 4F4KA 3W5YA 4LFCJ 1RHUB 2RRBA 4QW8A 5HL7Q 3BKFA 3D28A 1JK9B 1XN9A 3GYNA 3N28A 5HP1B 1SH3A 3D0GE 5ETPA 3TR5A 3IBCB 1V3RA 2MQMA 2YWGA 4RWXA 1VLYA 3PYEA 4U7CA 4NEYA 1R3NA 4URSA 4X4TA 3W61A 1KWMA 3CC2S 3KLEB 3DLLQ 3SQOP 2W7AA 1T05A 1RGVA 1BD6A 5B0EA 4J9VA 4NRUA 2I2YA 7FD1A 3QGHA 1ZETA 4L75A 3TZYA 3VAGA 1S1WB 1C1CA 5KFCA 1RTJA 1RT4B 2CIMA 2QYCA 2IJFA 3IBFB 2WW8A 4MK7A 5K5MA 3KYLA 4DR4J 3VZHA 2ACMA 4IR9A 3QPIA 2YPZA 1RABB 3KLGA 3V4IB 4NOHA 3NGUA 4U95A 3CIZA 4GC7A 3BR9A 5H9EK 1W25A 2DR9A 1ZM3A 4BC7A 2RUSA 3PHEA 1YQHA 4EMDA 3OTEA 3W7BA 1YKWA 1H6KX 4C98A 1S99A 1SKRA 4LR9A 2ZH6A 2V50A 2V2KA 4KB7A 1R6YA 2LEBA 4OYOA 1RCXB 4MK8A 4ZMMA 4ES3A 5AXKA 3MM8B 3Q2TC 1RHKB 3DDNA 2A0FB 4LSLA 5B0CA 4P52A 1DQ8A 1JQGA 2VKRA 2MDAA 2JX2A 3N79A 2DCUB 3H98A 3W9JA 2Z2MA 3MFHA 3NP5A 4NLVA 3E8OA 1DJ0A 4MH8A 3AAWB 4IKAA 5DDRC 2EG2A 2DH7A 2OSQA 3ZZRA 5FDLB 5IM0B 1UFWA 3CJ3A 5E41A 3K5MA 3T41A 1R0AB 3CGIA 4ZLLA 3LAKA 1HNXF 1XEZA 2ROGA 2W9CB 3TJAA 4DFMA 4NLOA 4E8UA 3ILIA 3DRSB 4K7QA 3CCES 5C2GA 4NZ7A 4K8RA 4NCGA 1VQ9S 4OV1A 2QT7A 1RU2A 4Y34A 1APSA 4DPWA 1S0NA 3ONQA 5JUMA 2XZWA 4FF1A 2ZH2A 4DQRA 2AHOB 2F4VF 1DARA 2K2PA 1SBRA 1SKSA 4PUOB 1C0TB 4OHXA 5ETKA 3GV5B 4I6AA 2UXBF 5T7LB 1LW0A 3I82A 2RIJA 3M9OB 3TA1A 3TYTA 4TYBA 3IRWP 2ILZA 3R97A 1DRZA 4XK8C 2B7CB 3SCIE 4ANEA 2B9WA 3MCOA 3BV8A 4DFKA 2DR8A 2UVWA 2BJ3A 2RNEA 1SH2A 3EGZA 3RG6A 1U4BA 3MEEA 4QR0A 5FLXY 3P5BP 3KJVB 1U2RA 2VB6A 2KVQE 2ZC4A 4KT0C 3RGIA 2HNYB 4M5MA 3OFHA 1HNXJ 4PWDA 4X66J 1HQUA 2ZNZA 3NY0A 1SJRA 2GHPA 3HZGA 4O23A 2ACYA 1H74A 1Z4UA 2LU2A 5KG3A 1NKBA 3EVWA 5KFGA 4DR6F 1YLXA 2XBPA 1MW7A 1FRIA 2GQQA 4KQZA 1LWFB 3ZO7A 2DHHA 5D4LA 8AT1B 1VJWA 2DRBA 4ZPTR 4KKOB 1UJ4A 3KLIB 5I3UA 4RW7A 5D0HA 3SCJE 4CLYA 1JLEA 1MLAA 2BUNA 1IM4A 2PA8D 2RU9A 4USIA 5HANA 2N7CA 3W8PA 3OTOF 1S77D 2DCLA 3CCSS 1AFIA 3DHXA 1B0TA 1UA0A 5IT9U 1V3ZA 1GXTA 2I0XA 1N5QA 4IRKA 1ZA1B 2BACA 2MKSA 2JJ4D 1IR2A 2EC0A 4UQGA 1YWXA 3M7VA 3W2VA 1C4AA 4HVZA 4USKA 4Y6IA 1CULB 2EWHA 2GVDA 2IRXA 2P2CB 2QV6A 3KK3A 4CNYA 2XS7A 1TKTB 1KQGB 4QR1A 2VOPA 1IWAA 3RBEA 5CYMA 1F9HA 1WC3A 2ZKUA 2RS2A 3JB9k 2AWZA 1EQ0A 1ZPVA 3PACA 1RA6A 5B0AA 5CHCB 2BJ7A 3HHLC 4U7UK 3JTPA 3EPIA 2OD4A 2PDAA 1SC6A 2LQBA 4FYVB 2U2FA 4C8LA 1YTYA 3EWGA 3TAMB 1MNEA 3NBPA 2PA3A 3W63A 1X9MA 3W65A 3KHHA 3DLGA 1F0XA 3BEGB 4KC5A 4R0EA 3A3NB 2IA6A 5C5JA 1UWAA 4HHHA 5KT3A 4LF4F 4FXWA 1H2VZ 1S1TA 1N5YB 5LXYA 1FE0A 4FPIA 3M8PB 1G7CB 5ETOA 3TEGA 1KKHA 2V8DA 3TVZA 3VR1A 5JVHQ 1I5OB 4OZLA 2YNGA 2DNNA 5C25B 2XMTA 5A8WB 5GMEA 4A46A 3DXSX 1VRUA 3DI6B 2GJIA 4U6PA 1FDAA 4AT1B 4D3GA 1WHWA 2KU7A 4IH6A 3A8EA 3OR2B 3FCVA 4YR2A 3HD1A 3KUEA 5LSRA 1L3UA 4Y0FA 3IG1B 3CSKA 3O8WA 5GAGU 3RW6A 1HNVA 1ACMB 2R8IA 1RZMA 1GTEA 2NXUA 1LWCB 4ED3A 1X9SA 1LKZA 2G13A 1U7LA 5J1PA 1RT1B 2B56A 1GX5A 1H0HB 2E7XA 1LW2A 2DNGA 2L9NA 3MR5A 3NS6A 2WHOA 3IWLA 3A8KA 3RUBL 1Y5LB 1A0OB 2EFOA 4WU2A 2J0QD 4FKXA 1DLOB 1YJUA 3SQGB 4KO0B 2VODA 5CYQB 3D6FB 3DLKA 3ZZUA 2W1BA 5ETLA 2RQ4A 2GQ2A 2LLZA 5AXNA 1FXLA 2NZ4A 2LDYA 2ZHAA 3POTB 4F50A 1AXQA 1EP4A 3BQ2A 3DN9A 4ZPDA 1VQOS 1B99A 1WI8A 1NH7A 3DGPA 3R27A 3P8BB 4J5OA 4KFBB 3EX7B 3KTQA 1CJTA 4DSIA 2ZE2A 2H5JB 1VGYA 2W2MP 1RAAB 1R43A 4JI6F 1ZAXA 1UJ5A 1F5BA 1IKVB 1X31C 2DEIA 3OD2A 4LBPA 5LSOA 1Q82T 3CC7S 2Z58B 4TVAB 3SYZA 1WC5A 1IQZA 1HBNA 1RLCL 1RWXB 2HVDA 4OYXA 3N0VA 4NE9C 1M1GA 3UR3C 4XO0A 5L1LA 4J9RA 4LF8F 3BF4A 3RRGA 4FXDA 4C97A 2K3KA 3EVOA 4ZPWR 1ZZFA 1HMVB 2RU3A 4ZVSB 4OL8A 3IO1A 2D9PA 4ED2A 3GZ7A 4DPTA 3HFKA 5KFHA 2NCKL 2H4WB 4ANDA 2ZWOA 3CPWR 2FLLA 5BYQA 4IRCA 4OIXA 4OYMA 2B9YA 4CP5A 4DCJB 1F9EB 2J76E 4KO0A 1TAQA 4TYAA 1FFSB 3C46A 3VAFA 5J2NB 4B9SA 2POKA 2YNHB 2MGZB 1N6QB 2E1AA 2J7WA 3AB4B 2VF3A 3IM9A 4CYUA 1Q81T 5B09A 2QA4S 4P2XA 2QMUB 4H4MB 4Q0BB 2MQ8A 5IT9Y 1NHUA 4KE5A 3HHLD 1LWCA 1RXOB 1RU1A 4R8UB 4O3RA 1JLQA 1WHXA 2GO9A 4NLWA 4H4KA 1S0VA 2IAJA 1EARA 1NLKL 4IYQA 5D77A 2DIVA 3A12A 4LRBA 4OMFG 4KSEB 4K2JA 4GVBA 4C0OC 2ZH5A 3TQ1A 2OSRA 4OX8A 2VFTA 4GKKJ 2R42A 2ZM6J 1TVRB 2JVOA 4FZVA 2ASDA 3M9NB 4ZCLA 2BW7A 4NLXA 3MUVP 1BQNA 5FJ4A 3DOLA 1FDNA 3DRRB 4A8FA 4JI4F 1YHQS 3CCLS 3DRYA 1HW9A 1BMQB 1TV6B 2JSXA 2CVEA 1ITPA 1AFJA 4C8NA 1S1TB 2F3JA 1Y9OA 2MQNA 3DGVA 4IQMA 2R7WA 1M90T 5ETSA 2FLPA 1AW0A 2CQ3A 3W8GA 4MJKA 4DV5J 2XYPB 3ZZ0A 4QBUA 4AL6A 1JKHA 2ZZTA 4MTPA 1OY6A 4LFBJ 3DXBA 2KB2A 3HHNB 3Q86A 2R3VA 5K8NA 4N41A 1VYAA 3SIPB 1OSDA 1KONA 2CQ0A 2LDIA 4M5HA 3VGTA 2FJBB 4QIFA 3HZEA 5ETVA 2QLJB 3A13A 4MMOA 5HSPA 3IRXB 3AQOA 2JC0A 1TKTA 4CT8A 4WTOB 2XLKA 5A8KA 3BPDA 2C3YA 4FYDA 1YI2S 3OVBA 3GFHA 2IRUA 1EX8A 3CCVS 3M8QB 1PAEX 3GJRB 1U1NA 4JI4J 5AE2A 5T41A 1CEZA 4RZRA 4RUCA 4EO6A 5KFFA 3HXMA 2QFJA 2BRLA 1HNZF 3V5RA 3EYZA 4AFFA 1RACB 2Z2YB 1BWEA 4IOCQ 2C2RA 2UU9F 1WOSA 1OYDA 3AA9A 3SCKE 3H7HB 1RTDB 4Z37A 5IWAJ 4L72B 1HBMB 3CNQP 1K1QA 4TNOA 4KKOA 2MJUA 4F8RA 1HWUA 3F56A 4OLOA 2WSFC 3K89A 3MD1A 4R0JA 2J7UA 3MCNA 2VL1A 3GQCA 1FJGJ 3NS5A 1I94F 1HR0F 3S8SA 2ZH3A 2HYIB 4B9LA 1IKWA 2B8QA 3W62A 3C6TA 1NK9A 3AD9C 3TUPA 2FJXA 1PKUA 1PYSB 1RKIA 3BS9A 3CDEA 2H4YB 4OV6A 4C8MA 5C7PA 5GAHU 1N34F 2UUBJ 2CQ2A 1V5VA 3M30A 4P9SA 4DR5F 2HHHJ 1O6XA 1O5JA 1ZH5A 4B9NA 3MFIA 1FTRA 3NNHA 3VAJA 5G0RA 2LQJA 3M30B 3IR5B 3OV7A 2OFHX 1SJ1A 4USWA 3AOBA 4OYZA 5EDWA 5SZTA 4C8YA 4LFCF 3AT1B 2HSEB 2OELA 3IMQJ 3V81A 4EU0A 2CDRB 4S0MA 2AU0A 4JI8J 5L8RC 2NS1B 3QIPA 3B4DA 3VGVA 2AZ1A 3T19A 3CDWA 3ZFVA 3QAEA 1KQKA 4ECZA 3LP0A 3ADAC 1TK0A 2EK1A 1WC1A 3ZZZA 2X1AA 1R0AA 2ZOMA 4JV5F 1OO0B 2JFDA 1Y11A 2PMWA 3BGRB 2Y0SD 4PPDA 1HI8A 5M2UA 2OMOA 2DHSA 2VBYA 4ZVOB 1VQ4S 3MOJB 1JWWA 4BLGA 3I5CA 2ZDPA 3CJKA 3NG8A 4WU3A 3ICLA 1SJ3P 1CJKB 3O5TB 4ZVUB 2CYYA 1S4FA 2ZOFA 2YVSA 4DJBA 2YY3A 4IG0A 3QT6A 4OI4A 4P73A 4ZLPA 2AEJA 1H7XA 1U8WA 1TL3B 4Q2MA 1RTHA 4CWBA 3FSXA 4JI8F 2H1YA 1WG1A 3U7JA 1P6TA 4RUAA 3J81Y 4DV3F 4DL3A 2CQHA 1D9DA 5KT2A 3J81j 3PV8A 2KHDA 3DDIA 3L4BC 3TZXA 4V1Ak 3THTA 5ITHA 1JLFA 1WEXA 1VJQA 1RT4A 1RDRA 2UUTA 3RU0A 2CVIA 5KT4A 2KRBA 5HO4A 4AL7A 4BC9A 1ZM4A 4ECYA 4AE5A 3QWPA 1WG5A 3MEDB 4DR5J 2DYAA 2C3PA 4DFPA 3MD3A 1DFDA 3CE8A 1N33J 4ZITA 3J7YU 3QIDA 4C11B 5J2PB 4ZN3A 1KSPA 4NYZA 1J5EJ 5KFRA 1N36F 2EFPA 5FIIA 1H98A 2XGQA 3ZZOA 1FDDA 2BE2B 1TL5A 1M1HA 4ID5A 2PD1A 4KR0B 1I94J 4PRFA 2BJEA 4J7CA 2R9LA 2XC9A 2HQ3A 3DRPA 1O8BA 2V4JA 3HT0A 3NWRA 4ZN1A 1S0OA 5KG0A 4U8YA 4WFNQ 3J81U 5KG1A 2MXYA 3BSOA 5I3PA 1ZAVA 3LANA 3OFEA 5L9XA 3BSNA 1VI7A 4ECTA 4LRDA 4EUVA 2DR5A 2LYVA 3R2CJ 4WZQA 3GFXA 2V4QA 3P5TL 3HT3A 2VG5B 2V6AA 3GG1A 1HR0J 1SUQB 1UWBB 1MROA 2DXEA 2Q6CA 3D0HE 3H4DA 1CJKA 4OI0A 5C42B 1SVDA 3DCAA 4RBVA 3R7SB 2A6MA 2ROEA 3CT9A 1S9EA 4ZVQB 1KP6A 4DPOA 4QPTA 3DLEB 1RWNB 1AYEA 1ZZNA 3BQ1A 4JB8B 3NGDA 2VZ9A 3OL6A 1RKJA 5IQQA 2C2EA 5DGBA 4TQSA 1PBAA 3AY0A 3DOKB 4IUFA 1Q8KA 1SJ4P 3F73A 5H1SV 3LWMA 2VASA 2IDLA 1P8GA 1HYSB 3QIPB 2GGPB 3IA0A 1Q78A 4NRTA 2DGOA 4DR6J 3K8VA 2EKYA 4M5GA 4YMEA 2F9JA 3WHIA 4DSEA 1M5VC 2HRUA 3ZZYA 2IBKA 4A8YA 3GJQB 4B9TA 3DNCA 4Y28C 4DUTA 3OJSA 2IVMA 2RRAA 1VQ8S 3C6UA 3CD7A 3CMQA 5GAEU 5LMNF 2C28A 4B3OA 2BJ8A 1GTHA 4M5DB 5I3QA 4DV5F 3SBMA 4ED0A 4OQJA 4A8XA 4F36A 2A2DA 3KFWX 1MN7A 1X5TA 4KHMA 4LBHA 3GJSB 4WK3A 4F4AA 5CYJA 3LUYA 4EFAC 1S7IA 2CNOB 2MKIA 2VD3A 4B3RJ 2OGUA 5LT5A 1UEKA 3CD5A 2LQ5A 4DZDA 4NLYA 2XI2A 3RB3A 2CPDA 4K4YA 2B6AA 1W26A 2CPYA 3GCXP 3NEKA 1FXDA 2EFGA 4URQU 1YBAA 2MZSA 1RA7A 3FSYA 5DG9A 2Y1RI 1MU2B 1V5IB 1OPIA 1Y10A 3H20A 3QJJA 3OTCA 4KGXB 3DLKB 1RTIB 5GADU 3MURP 1WEZA 4OHZA 3Q8QB 1O0PA 2BQRA 4ED6A 1HI0P 1IKXB 1S4EA 4BBYA 3H90A 1EIYB 2LU1A 2V68A 4OX6A 3Q23A 2PI4A 1KRPA 1IVZA 4HI1A 2FGCA 4LBIA 2X51A 2HS3A 3D1OA 3SDEB 1IBMJ 3TI0A 1U1MA 2O1PA 4DSJA 4ELTA 1TELA 5ETTA 4EGLA 1JLAA 3QRQA 3HJFA 5THWA 2CDQA 3QO9B 4OZ3A 2BANA 4RW8A 4PQAA 3H8YA 3JSMA 1OS5A 2D3O1 1S6OA 1X9WA 1E6VB 4XPCA 2KXHA 3GE9A 2BOAA 3FFIA 1TU0B 3GSDA 2FJWA 3M2RB 4IO1A 4PXDA 4X62F 4NYOA 1XR7A 2V8VA 1B4SA 2YNGB 1SC1B 3KJQB 4X4RA 5EN1A 1RT7B 2M0GB 2VFSA 3IAM9 3PJXA 4WP9A 4WP8A 4Z2XA 1TAUA 3BN4A 3P49B 3MTJA 1UA1A 2ZBIA 3G82A 5LL6d 3KLHB 1JX4A 3I5BA 4CT9A 3FCWA 5C24A 4WYWA 5KOWA 2RVJA 3NAIA 1FJCA 3I55S 4F3OA 3NBPB 1YVFA 2YKOA 1REVB 3I4HX 3SV3A 3GIJA 3I6PA 1HI1A 4O3PA 4ECWA 3LP2A 3M1VB 2DR6A 3Q8UA 5GVQA 3W64A 4DN0A 2AJ4A 4A8OA 4B3TF 1PO6A 1FVQA 4J9MA 2PE8A 3QT5A 4UUWA 3KLFB 1RI7A 2X7IA 4DR1F 4KY3A 4R5PB 5J2QA 4OYAA 1LOUA 5CYMB 2PFDA 3AOCA 2FC9A 1Z2ZA 3CO0P 4QYRA 3KK3B 3RRKA 3DRRA 2E5JA 4ICLB 1UTAA 1WHYA 2GHWA 4GC6A 4OX7A 3Q83A 4C3LA 1GFWB 2DGQA 2RSQA 1WELA 2LECA 3I87A 4B3SJ 3JSMB 4DR3F 4LVNP 4PYAA 1W2BR 1DTQA 3QO9A 4G6VB 4DV3J 4W92B 2NYHA 5DG8A 2ZH4A 1UETA 4MYUA 4PXCA 5HATA 3NNCA 4IH5A 1XNRF 3BKTA 3SDEA 3SXLA 1C1BB 1D3WA 3MM5B 4CLKA 3AODA 2VG7B 1WKJA 1N32J 1URNA 1TL7B 4QWBA 3TVYA 1VR6A 2FHOB 4M95A 1VOMA 3QWUA 1WDTA 5J2NA 3JTOA 4DL4A 1BWVA 3TZZA 3T1HF 2HPUA 4C9DA 2ZVIA 2CPJA 2DGVA 8RUCA 2R7VA 1HBOA 3EZUA 1Y00A 2V8HA 2Z2LA 4TY8B 4JI0F 2V4RA 4C8KA 5D4NA 1NB2A 3KJVA 4QWEA 3C3LA 4LRCA 2KM8C 3DMJB 1RBOB 3AJ2A 3AJDA 2LFVA 1JXVA 5CQGA 3I9V9 5KFOA 3M2UB 4DL7A 4NASA 4I2QB 3AD7C 3CTRA 5IC6B 4O3OA 3I5AA 1U26A 3PTWA 3OBIA 2W9BA 4LF9F 4B3TJ 1C0TA 4CH0S 1XTZA 2RS8A 4FF4A 3R3TA 4B3OB 1FDBA 1AZSA 2VDIA 3CJ8A 2RDJA 4I2PB 4MYTA 3MTKA 3OHAA 3VAMA 4RU2A 4M5LA 2OJ3A 1B7FA 2I6WA 5DM6Q 1PC4A 2OPRA 4J9UE 1RHRB 3QJLA 4K4VA 3P6YC 4IR1A 1RT6B 1R8HA 2V5HG 4DU8A 2DPIA 2NUHA 1K1SA 2ZBQA 4BWJA 3TA2A 1DLOA 3DOKA 2YWEA 3LW5C 2BM1A 3MZIA 4HYKA 4NI2A 1OJ4A 2J9EA 2UUWA 2IJNA 2XMVA 2NXEA 2ZNYA 4XAKA 3GJTB 3PHTA 3SZ2A 2CQGA 2QA1A 5K14A 4YHHJ 1FRHA 2ZEJA 1L3TA 2DVIA 4CH1A 3CDBA 2CQDA 3W1YC 2K8GA 1WSVA 5H9FJ 1S97A 1IKYA 3CCWA 1MROB 5IWAF 2U1AA 4HT7A 5GMDA 2EPIA 4V19J 2VG5A 1IBKF 1HARA 4Z7YA 5A0YA 3OR2A 2NREA 1UFLA 1JLCA 1FX4A 3PO5A 1EKSA 3NGKA 1H73A 4WKYA 4LF6J 4X66F 3L95X 4A8SA 3Q8YA 5BR8F 2K1RB 1VMBA 1QSLA 3CC4S 3IN5A 5I4MA 3NXZA 2KZZA 2P8IA 4JI1F 1S6PB 2C2NA 2XLIA 2QRRA 2V63A 1NJWA 3KDNA 3R5BA 2XMJA 1DTTA 2CPIA 3M8PA 1NHVA 3EMTA 4Y2AA 1RK8A 2F9DA 2OUGA 2PN6A 2ZFHA 4KIAA 4RJVA 2G0CA 2WBRA 3WX8A 1T3NA 3ZTSA 2DNPA 1VC6A 4LFBF 1RTJB 3W66A 4A8MP 2YNIB 4LUBA 3CWJA 4NLSA 1M5PC 4FN5A 2HNDB 1BUXA 4RR5A 2BZ2A 3RR8A 3D7SB 5HVHA 4DUYJ 4QU7A 1F3VA 1QUPA 1WORA 2AP6A 4Q7AA 3TO8A 5DDOC 3HP6A 2J9DE 2DBBA 2GMJA 2HS0A 4X64F 4HT5A 1G2EA 1BHNA 4ZPBA 1T03B 2GAHC 2NYIA 4NCAA 2WVFA 1M5HA 3G8QA 5AT1B 4FF2A 1PCAA 4FS1A 2J9CA 3W5XA 4GKKF 3CCMS 2OH2A 4P7VA 2CPFA 2XNQA 4J37A 4W4MA 2B4OA 1YRTA 1GMWA 4TKTA 3TJ9A 4ZCIA 2CQ1A 1K0VA 4ERDA 2YX4A 1SXLA 1QY7A 1S59A 1RWPB 3VTIA 4DV4J 1UEUA 4IG0B 1NRKA 4USJC 5KOXA 4FYXB 4PQUB 3JSBA 3TJ8A 1X4GA 4FNHA 4I64A 1A6LA 2D69A 2JLFA 3LQVA 3MHYA 3BGLA 3MM7A 2VKZG 4IH7A 2V94A 5F3ZA 1VQKS 4X4UA 1S9GA 3MM9A 1U49A 5IXUA 3C16B 2VFRA 1NAQA 4XIUA 1MG7A 1KLMA 3C15A 3MM6A 1M1KT 1JIHA 2E1MC 2KFNA 4DBQA 1SI9A 4OFZA 4W98A 4K50A 2XCPA 5I42B 2B7BB 3ET6B 1NJXA 5D8HB 1OPZA 1X5SA 1Q8IA 3GIKA 1T9VA 1JJ2R 2BXJA 2EG1A 2PEBA 1L3VA 3E51A 2C2MB 2VV5A 4QWDA 3DYAB 4DR4F 4CQ1A 1KTVA 1W7WA 2HK3A 1WOPA
chains in the Genus database with same CATH topology
1N56A 3MEEB 5F9LA 2QSFA 4WE1B 4ZVEA 3BREA 1EETB 1RT2A 3U1MA 5KFEA 1GXLA 2VBXA 3FQLA 1S1XB 1U1OA 1LW0B 1KVIA 1S1XA 2VG6B 4A48A 3L3CA 3RTVA 5KFZA 3IR6B 1EETA 1RT2B 2GMHA 2JHEA 4USHA 4TU7A 3PRBA 5DLGA 3G9CA 4AL5A 4X4VA 3Q22A 3AA8A 1U48A 4KBIA 4OZ5A 4F4YA 2KJWA 1R8BA 1U24A 4NCGB 2J5AA 5LXRA 2LMIA 4F02A 4LT6A 3K0JA 1FRJA 3C6TB 1WTFA 5B0FA 5EHHA 3PR4A 3R1LA 4RWWA 2M8HA 4JI2F 1I1GA 3I4PA 2W9AA 5I42A 1NB7A 1A9NB 1GT8A 1URRA 2PMZD 1CC7A 2CQBA 3UD4P 5IM0A 5F8IA 2MPUA 4PKDB 4ZCKA 3I0SA 4O44A 3T9NA 3DLHA 1RTDA 5KFNA 1ULRA 2W8KA 2VFUA 4R25A 1N5VA 1NH8A 1S1UA 4V19X 1OQ3A 2MKKA 4PQUA 3MR3A 4LF7F 5CCLA 5E2QA 5J2MB 3HHLA 5CD4H 1V9OA 1S10A 4OZ1A 1T7PA 1FESA 4B3SF 2E5HA 3KLGB 3V4IA 4DSLA 4N77A 4ETZA 5A8KB 2F40A 1Q53A 2OLWA 2CZ4A 2DISA 5B0DA 5IT0A 1J5OA 4PWUA 2HG4A 4X4SA 4H4OB 3CCJS 4LF5F 4RKUC 4I68A 2D74B 4K4ZA 1KOOA 2VPYB 3X3UA 1VRTB 2R7SA 4DFJA 1QE1A 2NSCA 2FPHX 1RWUA 1VFJA 2VPWB 1Q1KA 3PW7A 1X5PA 2DGSA 2XY7A 4KV8B 4UY85 3NRBA 5E3QA 2VA2A 1RQ0A 3G6VA 1WWHA 2YX7A 3G8SA 3UPFA 4QIWD 1FERA 4JBCA 2JL9A 4YB7A 4Q45A 5K8MA 1TQLA 1TVRA 1F60B 1VQ5S 2BABA 1IQTA 2AV5A 4NLTA 1JLCB 2IC3A 2E1RA 2FVCA 3JSRA 2OKQA 1HWJA 2IAJB 3P96A 1IKYB 2LKZA 1VIOA 4OI2A 5E3CA 3NCQA 4ZOSA 3TA0A 3OVBA 5E33A 3TUIC 3TP2A 2JEGA 2HAIA 1FO1A 4J9NA 1TK5A 4ED8A 2WRMA 2BDPA 3PXGa 3BQ0A 2UUAF 3VWSA 2DGXA 4LQ3A 2CQ4A 3R5DA 4GMKA 2HNZB 4LFAF 3OSPA 3SMZA 1RT6A 2W24A 3LO3A 1S1VB 2ADCA 2L3MA 5KFKA 1WEYA 2QLXA 5EWFA 3B82A 2LA6A 2MZQA 3CJ4A 4YDDB 5KFWA 2JEJA 4K2XA 5CCMA 4QPXA 4QW9A 2E66A 4HI2A 2ERRA 1Y3JA 1YRXA 4N8OA 4I1TA 4OZJA 2KVIA 1IKVA 2XMWA 2UV8G 5JXSA 2J0WA 1F5CA 1N0VC 2HFOA 1HFEL 2P6SA 2OFGX 2WOMA 1RAJA 4ECQA 1H3DA 1TK8A 4N56A 1TKZB 3BSAA 4EYHB 3J7ZT 3CVKA 1HBOB 3PEHA 5ADZA 5L39A 1FRLA 3BGFA 5IZHA 4KHPF 2FB0A 2DB1A 1YSJA 3D5MA 1RT3B 1U6ZA 1FK9B 4P6QA 2DTJA 2YWHA 3TAQA 2YKNB 1E6YB 2KO1A 2I5JA 3QMQA