1R0AB

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
429
structure length
429
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 103
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB03
3BSAA 3MR6A 3EPGA 3KLEB 4KV8B 4NLXA 3KMSA 3LANA 4KO0B 3T1AA 1TKXA 2C22A 1HPZA 2AGPA 4MK7A 4TLRA 4ZP6A 3PVXA 2EC0A 3KHHA 5J2MB 1S9GB 1FKOB 2YNFB 2UUTA 3KK1B 5KG4A 1RT4B 1XR7A 4I2QA 2ASDA 2IC3B 4RNMA 5EWFA 5DQGA 1S49A 4ED2A 2IM3A 4NLDA 1DTQB 2J6TA 4DL2A 3DOKB 1D0EA 3H40A 4NLPA 5I3UB 5JUMA 5C24B 4NYZA 2R8GA 3NBPB 3BGRA 1JLGA 4IFYA 3V6HA 1TL3A 1TKZB 3IRXB 1RT5B 2R8JA 4ZP9A 5KFZA 1IKWB 1IKYA 3H5UA 4RNHA 1S9EA 4O44A 5KFGA 3KK3A 2E9TA 3SI8A 4EBEA 5KFTA 4ZPDA 4KFBA 2ZKUA 3LP2A 4IG3B 4URQU 2ATLA 1MMLA 3H5YA 2FVSA 2CKWA 1UWBA 2FVPA 4IRDA 3KOAA 3MEEB 3DRSB 2YKNB 3BSCA 4ED6A 1VRTA 4K4SA 4ZVGA 5DGAA 3TVKA 4KHMA 2IM1A 1T3NA 4NLQA 1HQEB 5KFEA 3BJYA 4I2PB 4ICLA 4QWCA 1FK9A 3T5KA 5HROA 4ECTA 1N4LA 3RB4A 2HNDA 4NLWA 2W9AA 4RW4B 1RYSA 4NZ0A 2C2RA 3LAKA 2R2TA 1JIHA 2JEFA 5C5JA 4XPCA 1LW0A 1EP4A 5KT5A 5J2NA 3GIJA 3VQSA 4YMEA 4XPEA 3KLEA 4Y3CA 2YKMB 2E9ZA 4KO0A 4J9RA 3FSIA 2BANB 3KK2B 1LWFA 3NL0A 4K4VA 5KT4A 2R8KA 3N6LA 4TN2A 1S0OA 4ECZA 1S9GA 1FKOA 4WZMA 3KK1A 1RT4A 3H59A 3HVWA 4RUAA 2V9WA 4QPXA 1SV5B 2IC3A 3KHRA 2D3UA 4O3OA 3FQLA 1DTQA 3DOKA 1Z4UA 5DG8A 4WE1B 4TQSA 3MEDB 2WOMA 5I3UA 3Q8RB 3OLBA 5C24A 3FRZA 4QWEA 3PR4A 1IKXB 2RF2B 1N56A 2J6SA 4QW9A 3LP0B 1RDRA 5F8GA 2F8EX 1S1XB 3OL9A 1EETB 1TKZA 3QGIA 3G6YA 2BQ3A 3MR3A 1HARA 1RT5A 4F4ZA 1ZTWA 1JLBB 1IKWA 1JLAB 4QW8A 1REVB 3UPFA 4IH7A 3GV5B 4O4GB 1LWEB 1RT7A 4IG3A 5KFJA 3OHAA 4IRKA 2RKIB 4U7CA 3CWJA 3MEEA 3DRSA 1K1SA 2YKNA 3CJ0A 4YR3A 1S1UB 4R8UB 5KFHA 5J2PB 4Q43A 4LSNB 1HYSB 5L1LA 4ECVA 1HQEA 4IOBA 4KKOB 4RW8B 4R5PB 4ZPCA 5KFYA 2OPQB 4DL7A 4ZHRB 1JXLA 2J6UA 4KHRA 1JLCB 1DLOB 5KFSA 4RU9A 4ZVHA 3BREA 4GC6A 3RBDA 4ECSA 2UVUA 5KFRA 4IDKB 2B6AB 3MFHA 1ZETA 4RNOA 4K4WA 1C0UB 1HNVB 3T5JA 4K4TA 4QWAA 2V0NA 3C6TB 2OPRB 2FLNA 1D1UA 3NMAA 2AGQA 2W7PA 3SFUA 1C1BB 2YKMA 2V4RA 3MECB 3DLEB 3KK2A 2WCXA 2XC9A 3DI6B 5KFDA 2XGPA 4TYAA 4ID5B 4DEZA 2GIQA 4EO6A 3OSPA 3I0RB 4KAIA 4Y2CA 3SFGA 1IM4A 1SV5A 1MU2A 5JXSA 3CDUA 3HVAA 1C1CB 3NGDA 4PUOB 4WE1A 1S6PB 2IAJB 2IBKA 3MEDA 4ZMMA 5HLFB 3GIMA 4K50A 4H4MB 2VA3A 1IKXA 1QAIA 2HMIB 4B3OB 3LP0A 4MIBA 2YNIB 1NNDA 1S1XA 2WB4A 2R8IA 4J9KA 1EETA 1HQUB 1S1VB 2UVWA 1JLBA 1NHVA 2AX1A 1JLAA 1SH2A 1REVA 5T14A 4FS1A 1S97A 4O4GA 1RA7A 3BQ1A 1LWEA 2BRLA 4RW9B 4LQ3A 5F8LA 1TKTB 4WXOA 2IJNA 3OHBA 1RAJA 2DPIA 5KFWA 2UVRA 2RKIA 5KFPA 3HVTB 3TAMA 4MK9A 3PR5B 2W9CA 1RT3B 2FLLA 1S1UA 4R8UA 3G6VA 5J2PA 4H54A 2ZE2B 4LSNA 1HYSA 3NAIA 3QO9B 4KKOA 4RW8A 4R5PA 4NCGA 5KG2A 1BQMB 1XR5A 2UUWA 4ZHRA 2BQRA 4NLYA 3GV7B 2IM0A 1DLOA 5HBMB 4IKAA 5HP1A 3MR5A 3QZ7A 4IDKA 1TVRB 2B6AA 4EEYA 4KB7A 2FJXA 1C0UA 1HNVA 3E01A 3CDWA 1BQNB 3DRPB 2JC1A 2BRKA 3QGHA 3C6TA 2OPRA 4ZP8A 4IFVB 1R0AB 2XWYA 2ILYA 3RAXA 1RTJB 1C1BA 4G1QB 1TQLA 3QLHB 1RT2A 1K1QA 3N6MA 4K4YA 3DLEA 2C2EA 4JV2A 3DI6A 4K4XA 5CYQB 4ID5A 1GX5A 2R8HA 4ED1A 3RBEA 2ZD1B 1C2PA 5CYMA 2WRMA 3UQSA 4EO8A 4Y2AA 3QZ8A 5F9NA 3JSMB 4DL3A 3PW4A 1C1CA 1LW2B 5DLFA 4PUOA 2CJQA 1S6PA 2IAJA 5HLFA 1TP7A 4H4MA 2B43A 3ITHB 1I6JA 1HNIB 2YNGB 3DYAB 2HMIA 4B3OA 4Q0BB 1RTDB 4KV8A 1ZTTA 2YNIA 3C6UB 1NHUA 3GV8B 3RB6A 4DL6A 5KG1A 1HQUA 1S1VA 4RNNA 4O3PA 4DG1B 1RTHB 3OL8A 2W9BB 5J2MA 2BE2B 2YNFA 5I42B 3M9OB 2C2DA 2I5JB 3KJVB 2O5DA 4WZQA 3IN5A 1TKTA 1JLEB 3KLIB 3T19A 3V6JA 4J9LA 3PW0A 4IR1A 3N6NA 4H4OB 4QWBA 1S1TB 1N5YB 3HVTA 2XI2A 1XR6A 5C25B 1RT3A 3LAMA 2FVRA 3MEGB 3DOLB 4NLOA 4O4RA 3EPIA 3NBPA 2ZE2A 4M94A 4F50A 4KE5A 3QO9A 3CJ2A 3I0SB 5J1EB 2HNZB 2W8LA 3IRXA 4JUZA 3Q8PB 4URGA 5KFAA 1RT6B 4EBDA 1IKVB 3CVKA 3RB0A 2IA6A 4IQXA 1JKHB 1TVRA 2E9RX 1TL1B 1BQNA 3DRPA 2W8KA 3JYTB 1U09A 3M8QB 3H2LA 1S10A 4PQUB 3FFIB 4IFVA 2C28A 1R0AA 3GIIA 1SUQB 4TXSA 5KFUA 3GIKA 4G1QA 3RB3A 3QLHA 4NLSA 3G6XA 3PJWA 4KBIA 3ICLA 3CDEA 1T05B 5CYQA 3CO9A 3T5LA 2VG6B 5KFIA 1S48A 1S6QB 2ZD1A 4FS2A 1HPZB 4FBUA 4I2PA 5F8IA 3DLKB 5DQHA 3JSMA 3KLGB 4WYWA 3M9NB 1LW2A 2R2SA 4ECXA 4I2QB 4RW4A 5F9LA 1W25A 2FVCA 2GIRA 2R2UA 4ZVEA 3ITHA 1HNIA 2YNGA 3DYAA 3T5HA 5KG0A 1RTDA 1TV6B 3C6UA 2BANA 3KLFB 1QAJA 4FBTA 5C42B 4NLTA 4DG1A 1RTHA 4LQ9A 4IFYB 4URSA 3DLGB 3HHKA 2W9BA 4F4YA 1TL3B 2B5JB 2BE2A 2HNYB 5I42A 5KFLA 2ASLA 2I5JA 3KJVA 4DL5A 4RNFA 4MFBB 4QWDA 3BSOA 3PW7A 2JEJA 2OH2A 4ECUA 4LSLB 3M8PB 1JLEA 3KLIA 2JC0A 4HYKA 4H4OA 1KHVA 3D5MA 1N5YA 4IR9A 4ZVFA 5C25A 4J9MA 5FDLB 4Y34A 3DOLA 2RF2A 3IG1B 1FKPB 2OPPB 2HAIA 3IGNA 3FDSA 4ECRA 4I7FB 2ILZA 2XI3A 4YR0A 2HNZA 1VRTB 2QV6A 5EWEA 4PWDB 4EBCA 1IKVA 2I1RA 5EUHA 2BR0A 4X2BA 1JKHA 4K4UA 1TL1A 4ZPBA 4ICLB 3ISND 3CJ4A 4O3QA 4YR2A 3QIPB 3JYTA 3M8QA 4PQUA 5K14B 1KLMB 3FFIA 4GC7A 4Q8EA 1SUQA 4J9NA 4NLUA 2JEGA 4J9PA 3HKWA 3OSNA 1RT1B 3CJ5A 4IH5A 1LW0B 1T05A 2VG6A 2ALZA 1S6QA 4JV1A 2OPQA 1LWFB 2VG5B 5DGBA 4NRTA 3DDKA 1S4FA 1JLCA 3DLKA 4IG0B 3M9MB 3QGGA 3KNAA 3KLGA 4ED3A 2AGOA 3PW2A 3LALA 3PZPA 4OL8A 4EYHB 2WTFA 4NLGA 4WXWA 3LP1B 5KT7A 3TQ1A 4ZP7A 1JLFB 1VRUB 2IM2A 3OL6A 3DRRB 3NKYA 5KFBA 5KFFA 4MK8A 1TV6A 2WOMB 3MECA 3PJXA 5KG5A 2FLPA 3KLFA 1N6QB 4NLRA 3KHGA 3BQ0A 2XCPA 5C42A 3UR0A 5KFVA 2JLEA 3DLGA 3I0RA 2B5JA 2HNYA 3QIDA 5F8HA 2BQUA 4MFBA 3I5AA 5L1KA 5F8JA 1JX4A 4LSLA 3M8PA 3V6DB 4J9OA 4O3RA 5KT2A 2OPSB 4HKQA 4NLVA 1LWCB 1RT7B 3KLHB 4YP3A 2HWHA 1S1WB 3MF5A 4JV0A 5FDLA 2FVQA 1S0NA 3IG1A 1C0TB 1GX6A 4J9QA 1FKPA 2OPPA 4RUCA 4F4WA 1J5OB 3NAHA 4I7FA 3CJ3A 3MFIA 3DM2B 1DTTB 1QE1B 3I5CA 4WYLA 2WK4A 3GQCA 1JLQB 4PWDA 4TY8B 5DQIA 1OS5A 5D3GB 5L1IA 3OLAA 5DG9A 4F4XA 4RW9A 3KMQA 1HMVB 3QIPA 3ISNC 3MR2A 3IS9B 3H98A 2D7SA 4O3SA 5K14A 1KLMA 3MTKA 2V4QA 2UVVA 4G3IA 2XCAA 4ED0A 2YNHB 4WFXA 1RT1A 3QYYA 2IJFA 2VA2A 4RW7B 4MIAA 2JEIA 3V81B 4ZPAA 2VG7B 3KHLA 3Q8QB 1S9FA 1BQMA 5KFQA 2VG5A 3H5XA 1T03B 2AU0A 3E51A 4IG0A 5HBMA 4MH8A 5KFOA 5L9XA 2ASJA 2WONB 2W7OA 1MU2B 3LP1A 2FJWA 3DMJB 1JLFA 2D3ZA 1VRUA 4Q44A 4RW6B 3DRRA 1RTJA 1RTIB 5J2QB 5KFNA 5EWGA 4TYBA 1SH3A 5F8MA 1N6QA 3V4IB 1WNEA 4Q45A 3FQKA 4RZRA 4ECWA 3OL7A 1TKXB 4MKAA 2GC8A 2D41A 3IGVA 4ED7A 1RYRA 3H4DA 1T94A 3PHEA 5KFMA 3V6DA 4O3NA 2OPSA 3GYNA 4ECQA 3G86A 1RA6A 4TY9A 1LWCA 3KLHA 3I5BA 4IH6A 1S1WA 1N48A 3CIZA 2HWIA 1C0TA 1CSJA 1SH0A 5KG6A 4XO0A 4Q0BA 1J5OA 1KHWA 3TAMB 3GILA 2W9CB 3DM2A 3RAQA 1DTTA 1QE1A 3UDLA 2FJVA 1JLQA 3Q8SB 4M95A 2R2RA 4TY8A 3BGRB 1JLGB 3PW5A 5D3GA 2AWZA 4MKBA 4NCGB 4WFYA 2WHOA 1HMVA 5KT3A 2RDJA 1IKYB 5EDWA 1S9EB 4O44B 3KLVA 3IS9A 5HP1B 3EZUA 3V6KA 4NRUA 3KK3B 2IMWP 4IRCA 1S1TA 1QUVA 1YVFA 5KFXA 3E01B 4KFBB 2QE5A 4WFZA 3LP2B 2YNHA 5KG7A 3MEGA 4KSEB 3BQ2A 4RW7A 4R0EA 3V81A 5KFKA 2VG7A 1UWBB 3D28A 4K4ZA 2AX0A 5F8NA 3I0SA 1RT2B 5J1EA 5KG3A 1S0MA 2DPJA 1T03A 4Q8FA 1RT6A 3BSNA 4ECYA 2WONA 5CYMB 2AQ4A 1FK9B 5L1JA 5DG7A 5HROB 4DL4A 5KFCA 4TQRA 3DMJA 2HNDB 3BR9A 5KT6A 4U6PA 4YQWA 2RDIA 4RW6A 5J2QA 1RTIA 4EYIB 5DLGA 4J9SA 4ED8A 3H5SA 2XGQA 3H4BA 1EP4B 3V4IA 5J2NB
chains in the Genus database with same CATH superfamily
1RAHB 5IM0A 4KV8B 3SCIE 3NEKA 3HHLD 3NXZA 2G1HA 5CXTA 4RNMA 2B7CB 2QFJA 4A48A 1UJ6A 5JUMA 2OFGX 2ACMA 4RNHA 2B9XA 3SIPB 3IMQJ 4JYAF 4ZVSB 1KWMA 2PC6A 4K4SA 1VRTA 5F3ZA 5LSRA 1AFIA 4ICLA 4NYOA 1FK9A 2ZVIA 5J2NA 1GH8A 1RHMB 3DRXA 1S0OA 4QPTA 3I82A 2DJWA 4OYOA 4OI1A 1WF1A 4WE1B 2VKRA 3Q8RB 3HF5A 4QIEA 1QSLA 1OYEA 3GV5B 5IT4A 2RSQA 1GMWA 1BHNA 4IRKA 1DQ9A 3I87A 2ALYB 3DRSA 4LBHA 4ED4A 1YJUA 2HBRB 4IOBA 1FO1A 5KFYA 4ZHRB 4GMKA 3MUVP 4ZCKA 3ULHA 3X3UA 2OPRB 3PO4A 2J0SD 2DGQA 3FNNA 2Q79A 3DI6B 2X1GA 4TYAA 4ID5B 3BYPA 3SYZA 1HBOB 2IAJB 2HQFA 2HHUA 1KTQA 2DNMA 2MKHA 3MMCA 2QG9B 1JLBA 1RSCA 2GHWA 5IQ6A 1SH2A 4FS1A 4OJ1A 3FCHA 2Q6BA 3RRKA 2RB7A 3W8PA 2IJNA 1RWMB 1QTMA 5CAAA 3R8YA 1DFDA 1N5SA 2CXEA 3MXHP 5J2PA 4GRSA 2HFNA 1S7IA 1UL3A 2NUUG 4KB7A 1BQNB 4G1IA 4DF8A 5ETQA 5A76A 1XMOF 4K4XA 3RR7A 1IQZA 2JRSA 3UVJB 3Q0AA 4DL3A 3IR5B 1HBMA 3LGMA 4LUBA 2NREA 5HLFA 3SSQA 2B43A 3DYAB 1VC5A 2VODA 4CM0A 1S1VA 1FDBA 2O5DA 2FYXA 2XBPA 1FRHA 1TKTA 1N5YB 2VQEJ 4NLOA 4O4RA 1SQGA 4KE5A 3QO9A 3CJ2A 3R7SB 2Y9HA 1M90T 3WBZA 2F40A 3W61A 2KG0A 1URNA 2QYCA 5D6GA 1KS2A 3ICLA 4NXNF 1TL5A 1U8SA 4OZ2A 1PSDA 4QU7A 4A8YA 1T9TA 2CVIA 2GIRA 4Y65A 1W2BR 1HNIA 5IC4B 3CF5Q 1GMWD 4FBTA 1HNZF 4F4YA 1RABB 1FI4A 4MFBB 5DDPC 3D5MA 3PEHA 1HBUB 3DOLA 2R7QA 2LEPA 3LTOA 2ILZA 2WB1D 4PWDB 1QLNA 1Y9OA 1DQ8A 5K14B 2PMWA 1RHJB 4ZITA 4DQRA 1LW0B 3EGNA 2F4VF 1SJ4P 3DLKA 2AJ2A 3M9MB 4FDFA 4ED3A 2QEXS 3CC4S 1VR6A 3OR1B 3LP1B 4E98A 4QR2A 3C2PA 3LH2S 3HCXA 2V2VA 1T9YA 3GCWP 2P6SA 4A47A 3RRGA 3HK2A 4LSLA 2DBBA 1LWCB 5FDLA 3IAM9 1FNOA 2OPPA 4DSFA 1QE1B 2K06A 5C7PA 4UQTA 3DN9A 4WFXA 3N9UC 3Q8QB 5DRKA 1U6BA 3TP2A 3QT5A 9ATCB 1T02A 2Y8WA 2L9NA 4CO5A 4JI3J 4TYBA 2AEFA 1RAAB 1YJRA 2KDOA 4X4VA 2GC8A 1GTEA 1FNXH 2NQPA 2KFYA 5KFMA 4O3NA 1DJ0A 3PJ9A 3FCVA 3TX8A 2HVIA 2KHDA 4IH6A 3MCMA 2C2MB 4ZPTR 4FXDA 2HQGA 1HMVA 1OSDA 5HP1B 1WF0A 1VLOA 3CMES 4R0EA 3MPWA 2DNOA 3JSBA 5KOWA 1FWPA 1RZMA 3BSNA 1RKJA 2VPZB 4P2SA 3ZTOA 2HNDB 3V5RA 1YJVA 3VALA 1X0PA 3KYLA 4OLPA 3LANA 3MCSA 2J7UA 1PJ7A 1AUDA 3GB0A 1VC0A 2AEMA 2V2KA 3B4MA 4NZ7A 3H40A 3OFFA 2VZ9A 2ZDOA 4HH0A 4OJ3A 4DV3J 5KAKA 1UVNA 1IKYA 1I94F 5KFGA 3WQPA 4DV0J 2NYHA 3UN2A 1RBOB 1ZM3A 2GHVC 1X4FA 4LT6A 4DPYA 2BEFA 2OMLA 2IM1A 1T3NA 1O5JA 2AV5A 4GO7X 4ECTA 3J7ZT 4NA2A 3G96A 3VAJA 4X4TA 3GIJA 4X62F 4YMEA 2YKMB 4OJHA 4WK3A 1YRTA 4K4VA 4ANDA 4DV4F 3FQLA 1VQLS 1DTQA 4C0OC 1D3WA 3R3TA 2J6SA 1S1XB 3MR3A 3GIRA 3HP6A 1JLAB 5D4NA 3OTOF 4DFMA 1X4HA 4U67Q 1WD6A 3CB4A 2XLJA 3OVAA 2HIYA 4ALZA 2DR8A 3C66A 1PKUA 1HYSB 4KHRA 2I6WA 1JJ4A 3BREA 3J81j 2Q66A 4Y6IA 1SC1B 3O1LA 3HSZA 2YY3A 4UOHA 4KH0B 2KL8A 5GAGU 1S72S 4LR8A 4DEZA 1B7YB 2GIQA 1N54B 4C0HA 3TAPA 1EX8A 4KPCA 3R97A 2WZ1A 2WB4A 1EETA 2XEXA 4CO4A 2OEKA 4RW9B 2NLWA 3TAMA 2HFZA 3UR3C 4K0KF 1WI8A 3UI3A 3G6VA 4H54A 4LSNA 2BBEA 5KOXA 3ELHA 3GV7B 3CDWA 2EW9A 4LREA 5THWA 1R0AB 3HPOA 3P8BB 4Y00A 5DM7Q 4JV2A 1HL6A 3EXYA 2CYYA 3QAUA 1TELA 2V8VA 1KOOA 4Y0FA 4MJKA 3VZIA 1WOPA 2DGWA 1RCXB 1XMQF 2YNFA 1IUJA 1VFJA 3K17A 3MMBA 3T19A 1XQIA 2MQOA 5B0BA 2MEWA 2EWHA 4JI0F 2JL9A 3LAMA 3AHPA 3CJRA 1N36J 4F50A 4C6AA 4RUBA 1Y3KA 2KT5A 1WC6A 4EBDA 4DFPA 2UXBJ 1JKHB 1JXVA 4DQIA 1XERA 4HLBA 4DX7A 3T5LA 3T6JA 5KFIA 3NLCA 5GVQA 2ZOGA 3CMAS 3S01A 2YNGA 2B3TB 4DR4J 3C6UA 5IC6B 3MPDA 1F9EB 4LQ9A 4IFYB 2VFSA 2ASLA 2JEJA 1UETA 1FXLA 2VQFJ 3L4BC 4H4OA 3AB4B 1FVSA 2E5GA 2DR9A 4B08A 2F4FA 4L72B 2CADA 3W2WA 3T9NA 1TL1A 4ZPBA 3CJ4A 2R7RA 1NJWA 4OMFG 4DI6A 1OY8A 4F04B 4GKKJ 4NWBA 2LU1A 1ZA2B 1TFWA 4V19J 4OZ1A 4DV1J 2OD4A 3MM6A 3DDIA 3KLFA 1IR2A 3UO0A 5C42A 3K2YA 1MROA 2FTRA 2M8DB 2GW8A 1Y5NB 2Y3YA 3U1LA 3C16A 3KUHA 3DDNA 1H6KX 3RW7A 4P9SA 2VD3A 2WK4A 1FTCA 4CO0A 5DG9A 2E1AA 1QUPA 3FC9A 5E2QA 2VDHA 3MR2A 2OP5A 2YH0A 2MKYA 3SDEA 5GADU 2MZJA 3MTJA 5LM7E 2J8SA 2W7OA 2QMWA 1LXJA 3DMJB 2FY8A 2M5YA 4RW6B 5BYRA 3N01A 4HEA9 1WC3A 4RZRA 1ZA1B 5HVFA 2N4DA 4I6YA 3V6DA 1FRXA 2PMZD 2OPSA 3FVYA 4TY9A 2XMKA 2FLOA 2RUGA 2NPIA 3PYFA 2R2RA 2A0FB 1HNWJ 4DCOB 4X4OA 4NRUA 3LP2B 4YN3B 4DV2J 3A1YG 2PD1A 4Q8FA 2V8PA 1VRQC 4ECYA 3UD3P 4N8OA 2HKEA 2V5HG 4EYIB 3SSSA 3LWLA 1UAWA 4TLRA 1TMMA 3C15B 5KG4A 1W26A 1RT4B 4I2QA 2ASDA 1S49A 4JBCA 3THTA 4CQ1A 3NBPB 1TL3A 4USMA 4X66J 1VBXA 3MUTP 1TL7B 1MMLA 2H5JB 2FHKA 2EK6A 2RAQA 4USHA 2YKNB 4Y2KA 1H7XA 5KFEA 3HD2A 1RCOB 3T5KA 3CSKA 2AJ1A 1EP4A 3KLEA 1FE4A 3MM7B 1LK7A 3N6LA 2KTQA 2YX4A 3R2DJ 2IC3A 1JQGA 3B6BA 5C24A 1N56A 2ZM6F 3LP0B 4AL7A 2BQ3A 3G6YA 4F4ZA 4NA1A 1NCLA 1VQKS 2NCKL 3GTYX 2A6OA 5KFHA 4J5OA 1YZ6A 4N5SA 2J6UA 2VDIA 1JLCB 3SQOP 4EFAC 5IT0A 3T5JA 3RUBL 2R3VA 2RE1A 2AGQA 3S7RA 2V4RA 2XGPA 3D6MB 3A8IA 1IM4A 2FJEB 1OIAA 4DU7A 4ZMMA 2VA3A 4WU2A 4LFAJ 2HHTA 1HQUB 4YOEA 3M7VA 4CH0S 2QSWA 2WSEC 1U1PA 2HSEB 3B4DA 3PFEA 2RKIA 5KFPA 2QLXA 1S1UA 3CPWR 2PDAA 1WF2A 4X65J 3CXCR 4RW8A 4R5PA 4HI2A 1P8GA 1NH8A 4AXJA 1RWWB 1BWEA 2B6AA 4OQJA 2KJWA 4DX8H 3KKFA 2VQEF 4OYXA 4FF3A 4M5GA 3DNCA 2E7XA 3DLLQ 3PX4A 2BE7D 3DXBA 3T1HF 8RUCA 3WZ0A 5AE2A 2KYXA 3V6JA 4IR1A 3BDPA 2W1BA 2DXEA 5C25B 3F56A 2DIUA 3ILOA 2XSJB 1JXEA 4L6V3 3JQMA 4YB6A 3LO3A 2H3EB 2W8KA 4UUWA 1E6VB 3CCTA 1DZ5A 4ZOSA 4OV1A 2BM0A 2KXFA 3JSMA 1R31A 3RYLA 2G1DA 2QLFB 3RJMB 3AAWB 2HRYA 4I67A 1UEKA 2NS1B 1YITS 3PYEA 5G0RA 3H2UB 4U96A 5HK4A 4EWTA 2BE2A 2ZOMA 1KHVA 2IYGA 1NLKL 7AT1B 4OYIA 2V4JA 4I7FB 4U8VA 5DO2A 3MM5A 4EBCA 3NNAA 2QO3A 2GS8A 3W64A 4K4UA 3PRVA 2OAUA 1RLCL 4CLKA 1VYAA 1LWFB 1FJEB 2NXUA 2RD5C 3RBZA 2GV1A 1HKAA 4NLGA 2ZJRQ 1F5BA 1NMEB 2GIFA 3MECA 4XDDA 1NK8A 5L38A 5M2UA 1I1GA 4DLEA 1U1OA 1F2GA 2NPFA 3KDOA 1S1WB 1FKPA 4JI3F 3DM2B 3UNGC 4DN0A 2HG4A 3HSGA 3ISNC 2AJ4A 2D7SA 1D9DA 3UDCA 1Q5YA 2JEIA 4KRWA 2EFOA 1RAEB 4AYBD 4NI2B 4TNOA 5J2QB 4DV6J 5H9FK 1N6QA 1IJFB 1HWJA 2ZBCA 4C0BA 1TKXB 1MW7A 2KT2A 3D9BA 3MM8A 1SH0A 1SI9A 1K47A 1FFSB 4TY8A 1NJXA 1M1KT 2V68A 3IA0A 1N33J 4LRDA 4KFBB 1RWKB 3OXGA 4LRBA 4ER8A 3I0SA 1S0MA 3D54A 3TUZC 3J80Y 5AXLA 3W2VA 2CJAA 2C1EB 3J7YI 3FBEA 3BSAA 2Q3PA 3O6QA 4YY3J 4NLXA 2MZRA 2ZH9A 4ZP6A 4RL1A 4UZCA 1C4AA 3CC7S 1XJWB 3B54A 1PCAA 1RAOA 2V6AA 3NGRA 2KM8C 2HQCA 1WKLA 5SUHA 3IRXB 1FESA 3SI8A 1RWNB 4B3TJ 4LF8J 1D09B 1X4DA 4NLQA 4YB7A 5L9NA 3TO8A 3RB4A 3CULA 3NG8A 4RW4B 2PI5A 4LF6F 2OI2A 1VQSA 5C5JA 4DU8A 3MR7A 4TN2A 3MWBA 4I4BA 4DR7J 5A6WA 4CM2A 3FEYB 4B3RJ 3FSXA 1PC5A 3H7HB 1TAUA 4QW8A 1IBKJ 3JXOA 2LQJA 3S8SA 4KGXB 3IWNC 4PWWA 4DL7A 4GC6A 1HNVB 4E0DA 4EZ6A 4WTYA 2ZBQA 3HHNB 3SFUA 4ELTA 2RMLA 4KAIA 1UTAA 3DLBA 1SV5A 1RB0A 2CQIA 5BYSA 2AMCB 2M4MA 2R7TA 1X4AA 1U48A 1VBYA 1NHVA 4P75A 4DV7F 4C8OA 4DQQA 1LWEA 1EB0A 3MZIA 3VTIA 2XY5A 2FLLA 5ITHA 5J1NA 3H0PA 1SC4B 4KKOA 5AE1A 3GYXB 2ERRA 2RNEA 3M1VB 3OTDA 3C6TA 3S6EA 4PXBA 3EUNA 4K4YA 1KTVA 1NH7A 2DHSA 1N36F 4DUYJ 1NAQA 1UCNA 3CDAA 2MLXA 3QZ8A 2UXBF 3ZZPA 4OI3A 4CYUA 1I6JA 4GKJJ 3ILLA 1RWXB 4RNNA 4QU6A 4ZS6A 2I5JB 3JAMY 2RILA 5DJBA 4DR4F 1WC5A 2EFPA 4ZDNA 3Q8PB 2W01A 1AT1B 1UPPA 2NXCA 5H1SV 1R7IA 3BH6B 5FLXY 4F0HA 2VQFF 3AB2B 4L76A 3PJWA 1GTHA 2ZBPA 1R6VA 3Q89A 4RX6A 3L09A 5LL6d 3UN3A 1B0PA 5IT9Y 2DGTA 3T5HA 3HDSA 3MAHA 4C3LA 1YJTA 3HFVA 4ELVA 2HGLA 5J1PA 2WVFA 4OZLA 1CULB 4C11B 4DV5J 3KLIA 2JC0A 2MKCA 2ZDPA 4J9MA 4DV1F 1SVDA 2XI3A 1WC4A 3MUMP 1EHWA 3PKMA 2OEJA 2DEIA 4A8MP 3OW2R 4O3QA 4M5HA 3OQ2A 3VVUA 2HYIB 1T05A 3Q86A 5IV4A 1O51A 1X9SA 2W4DA 5DGBA 3KLGA 2R4FA 3W8GA 4WU3A 1J2VA 3PDNA 4Y2MA 5D8HB 1BGXT 3KG4A 4ZVUB 3OL6A 1AROP 2V8DA 3BN4A 2V9KA 2ZHBA 3UR0A 4EZ9A 2IMOA 2VBWA 3I56S 1K0TA 2ZJPQ 4USTA 3NAHA 3OTCA 3DHXA 2YWKA 3OLAA 1FRJA 3E8OA 1CLFA 1CS4B 2DTJA 2GQ2A 4LRFA 5D0EA 3TOQA 1DURA 3SMZA 3RTVA 5CYJA 5HBMA 1HNWF 2WONB 2CQPA 3MOJB 4A8WA 4FVCA 2UP1A 1GXTA 4R25A 2XMUA 3FQKA 4Q45A 2GVDB 5A6PA 2Y1IA 3CIZA 2VU5A 4ZKAA 1YG0A 3T1YJ 4XTTA 2Y0BB 2VB6A 1OY6A 4NCGB 5CD4H 3FRYA 3V6KA 3GR0A 3A8KA 5ETVA 5M2RA 1VQMS 1TKDA 4CDIA 3VAIA 2DPJA 2ZBIA 2NUHA 2DITA 2Q43A 1NXIA 5DG7A 4DL4A 5KFCA 3W5ZA 4OHYA 4ED8A 3E3XA 3W66A 1F0XA 1HWLA 4X4NA 2RUSA 2UUTA 3DGPA 1LFPA 2H1YA 5DQGA 3H25A 4NLDA 1N5TA 2BKPA 5CZVA 1NKBA 1TKZB 2ATCB 4MTPA 2VOPA 4QZVB 3C14B 4CNYA 5C2CA 4JI2J 3PYGA 2LVWA 1RHUB 4KHMA 2R7OA 4HDHA 3G8TA 3HI9A 3NCPA 1UA0A 4Y28C 5HROA 2DK2A 4HT5A 4HHHA 4PYDA 4UOGA 2AYBA 2VHGA 3A3NB 2XTJP 1NPKA 4NL5A 4XPEA 5GAHI 2YPYA 1EQ0A 2XMWA 4WP3A 5E3AA 1U49A 2DGOA 4PXCA 1HWIA 4QPXA 3DOKA 5DG8A 4TQSA 2DR5A 5I3UA 2FJBB 1IKXB 2RF2B 2R42A 4WFNQ 4N77A 1NSQA 4TU7A 3MEEA 4ECVA 4QOTA 3AJ1A 3CD7A 2AP6A 3HHDA 1B99A 4IDKB 3R5CA 3NMAA 4DLGA 4UZBA 3KK2A 4Y2CA 4DSIA 3NGDA 4H4MB 3R5AA 1RU2A 1P6TA 4MIBA 4J9KA 3Q8YA 4RLEA 1HBNA 2LQ9A 1TAQA 1X7VA 4O4GA 1X9WA 3W9JA 2MMYA 2BW2A 2VUGA 1LFWA 4B9VA 1NJYA 4NCBA 2CFXA 4A8SA 4IKAA 2HFSA 3ENVA 4EK2A 4AQYJ 1LOUA 2N82B 4IFVB 2HAFA 2XWYA 4UY85 2PGCA 4PG7A 3I6PA 2C2EA 3AY0A 4LF7J 1C1CA 3THPA 3HO1A 1NZAA 3ITHB 4Q0BB 4KV8A 1BY9A 3MPYA 1X5PA 1ZAXA 3M9OB 3KJVB 4F36A 5E3CA 3TA0A 3MEGB 5CCLA 3HHLB 2HNZB 1F3VA 3CNQP 2HHXA 1TVRA 1IBLF 2QL7B 3RGIA 1ZH5A 3DGVA 3POTB 1S77D 2K3KA 1CJTA 2D74B 3BPDA 3WX4A 4OX8A 2B9YA 4EI2A 1U47A 3IBFB 1JK9B 2PMHA 5IXUA 2W9BA 1W2IA 2MGZA 4DL5A 2OH2A 4RNFA 3BSOA 1XTZA 2F1FA 2QT7A 4X4QA 4M63A 3WIUA 3TWZA 1FCAA 2I1RA 1VQ7S 2DYAA 1FHTA 3Q22A 4LF4J 3M8QA 3BBCA 4PQUA 1KLMB 4NLUA 4IH5A 3W60A 1RU1A 2NSBA 1PJ6A 3HFKA 2YQ0A 1HHSA 1FXRA 4YUDA 2YQ3A 1VRUB 2JVRA 3DRRB 1Z2ZA 2LECA 1OSCA 4BCAA 3IWXA 5L1KA 5LMUJ 3M8PA 3D6FB 1FJ7A 2EXUA 1H74A 4DV6F 3HT3A 3HLUA 3OJSA 2I8EA 4F26A 3THVA 4UQGA 2ASYA 3EM1A 3QIPA 1IWGA 3M2RA 2HHSA 4WJBA 3SQGB 5ADZA 1KVKA 4A8FA 3BYRA 4CH7A 4IUFA 1F2HA 2MQ8A 5IM0B 5ETPA 1Q8BA 1QDUB 1G2EA 4LVOP 3UVJA 1VC6A 3K7RA 1AB8A 1MMDA 1T94A 1R3NA 1GK8A 3LPYA 4TVAB 2M52A 4P2FA 2E5JA 1JLQA 5T7LA 1FD8A 3OR2A 4AFFA 2QZ8A 4A8OA 4CLLA 3IS9A 2LQ5A 1QUVA 1AA1B 3PNIA 3E01B 2HZAA 1I5OB 2CQHA 3BQ2A 1RT2B 5E3QA 2DNPA 3JS9A 2GMJA 1FK9B 3NNCA 3N0VA 1YIJS 2BOPA 1MMNA 1A6LA 4QJVA 3O44A 5J2NB 5E3PA 4LF8F 3BGLA 2C3MA 1HWKA 3DKDA 5CH7B 2M88A 4ED2A 3MI7X 3VGUA 1HI1A 1HI0P 1F3FA 1KEKA 4O44A 2E9TA 5ETNA 3H5YA 1UWBA 4IRDA 3DRSB 4CWBA 4B3RF 5DGAA 1S4EA 1VJQA 2WW4A 3VR1A 3BN7A 5D4LA 1IBKF 4GVBA 3IM9A 2JX2A 5B08A 1LW0A 2H5EA 1VIXA 2EC2A 2IYIA 3MCOA 4F0MA 1MN7A 1N5QA 3H59A 5I3PA 1XMOJ 2WVEA 1S57A 4RBVA 2CUYA 2PSZA 2F8EX 4AL5A 2M2BA 1RT5A 5BYQA 1JLBB 4PG8A 5B09A 1M0SA 1QM9A 1WG5A 2FZCB 3CO0P 1G6BA 2I9SA 4DJBA 1GT8A 1JMTA 5J2PB 2OPQB 1BLUA 1VI7A 4ZVHA 2UVUA 4K4TA 1SIWB 2PFDA 2V67A 4FXVA 4PEOA 3TUJC 3FKBA 2EI5A 2OSQA 1Y7PA 5HLFB 4P73A 4NXNJ 5MAOA 4AL6A 1S59A 1VCTA 2NXEA 1S1VB 2PEHA 1HR0J 3N4WA 1S97A 2CNOB 1KKHA 1TKTB 5KFWA 1WORA 4L75A 5AJ3F 1KVJA 5EHHA 2Z2LA 4KT0C 4GKJF 3QO9B 3CJKB 1L3VA 2F63A 1SXLA 1FRIA 1VIOA 5HP1A 2DHGA 2F65A 2BRKA 2ILYA 1RUSA 2GQCA 1K1QA 2HHVA 2NXJA 3ENQA 1IVZA 1S6PA 1Q16B 2VV5A 1YHQS 1HNIB 2J0QD 1IBMF 2F4VJ 3DRYA 2VICA 4HL9A 4QIGA 1WACA 2CNKB 3DOLB 2XG8A 2Z4PA 1U2CA 1RAGB 1PC4A 3NNHA 4WKRA 4LJMA 2KJVA 5LSOA 3RG6A 2V8HA 4IQXA 3WC2A 2OEMA 3DRPA 4PQAA 3E2EA 5KFUA 4C2MA 3LQVA 3AQOA 5CYQA 2CPJA 1KQGB 2KKHA 1UWAA 5HO4A 5F8IA 3DLKB 3M9NB 3Q2SC 3FBBA 3PX6A 3GWCA 1YKWA 4AXIA 1VQNS 3KG0A 3PRBA 4JI1F 1IXKA 1KFSA 1TMJA 3KUEA 4LSLB 3OXLA 5LMNF 4IR9A 3L9ZA 1NDKA 5FDLB 2IVFB 4CLPA 2OPPB 3IGNA 2YQ1A 1IKVA 2BR0A 3UDVA 3MD3A 4QCLA 2RH3A 2LXFA 1KQSR 1EKRA 1T95A 2HS3A 2YTCA 3ET6A 3KNAA 2ZEJA 3J7YU 3VCDA 4K2XA 2CA9A 2DNQA 3M30A 4BC7A 3M32B 4YP3A 5BR8J 4DSEA 5A8WB 3GMGA 2WBMA 4RW9A 1HMVB 1DQAA 5K20B 3NMRA 2DY1A 4ED5A 2VA2A 1YK9A 5KTQA 3T1YF 1A9NB 1I94J 5KFOA 1RWOB 2FJWA 1JLFA 4H4KC 4KYZA 5F8MA 1WKJA 2DNZA 2G9OA 3J80U 4X4RA 4CLWA 4M5JA 1OQ6A 1OY9A 3EE3A 4KJIA 4PXEA 2BJ3A 3NCRA 2FUG9 4X62J 1J5OA 1H2VZ 2W9CB 3ILIA 5CCMA 2IRXA 1ZZNA 2CZVC 5KT3A 1IKYB 3VWSA 5EDWA 3PO5A 3CJTA 4DV4J 1YVFA 1NJZA 3NWGA 1KNZA 4RW7A 6AT1B 2F9DA 5KFKA 3PTWA 1ROFA 2BJ1A 3OTOJ 4YFUA 3NP5A 1U26A 4JI2F 1FEEA 3D6TB 1PG5B 4Q7AA 5HQLA 2MQMA 1Z1ZA 2F8HA 2EBEA 1U4BA 4ZLLA 4OLOA 2RVJA 1DTQB 1QJHA 4N7TA 1D0EA 4F4KA 3W63A 4IFYA 2VFTA 1HWUA 2BZ2A 2KT3A 2HIQA 4PG6A 4M5MA 4LRAA 2Y1RI 3ZZUA 2V2ZA 4I0WA 4EBEA 1XMBA 2NR0A 2FVSA 3TAQA 2J0XA 2Z30B 1WUUA 2W9AA 2R2TA 4K0KJ 2UUAF 4DUTA 2E66A 2BANB 2FDNA 2KFZA 3AH6A 3LF0A 4B3MJ 4USJC 5A8RA 3MPUB 5F8GA 4EGLA 1EETB 1QAYA 1IKWA 5LXYA 1YGYA 1X5SA 4ZVRB 3OHAA 4NEYA 5DDOC 1ACMB 5HMZA 4HT7A 3VQTA 2MZ1A 1UKUA 4LSNB 3FJ2A 1UJ4A 1XMQJ 3R27A 1NPRA 5D0RA 3OFGA 4JI0J 1ZAVA 1FRMA 1U1LA 3D4JA 4MYUA 4EO6A 3J81U 4DZ6A 3JTNA 2D1CA 2J9EA 2ZH7A 2O1PA 2DT9A 4AQYF 3GIMA 4QIFA 2R8IA 2AX1A 2JZ5A 3HZEA 1REVA 4LF7F 4LQ3A 3MMBB 1KLNA 3CDBA 4WXOA 2CPDA 1J5EF 3JTOA 1M5KC 4F02A 2NZ4A 1WOSA 5K8OA 3JAMU 1NB2A 1TK0A 1CJKA 3W9IA 3ZTRA 4YEAA 4F25A 1U0HA 4DPOA 4Z7YA 3DLEA 4RU2A 1RHQB 1FX2A 2QL9B 5F9NA 1DBDA 5H9EJ 5GMKa 5LJ5Y 3UD5A 3TX0A 5SZTA 2HMIA 2YNGB 1YBAA 2CJBA 3C6UB 3P96A 4DL6A 2G4BA 3RAMA 2DGVA 1KRPA 2H5IB 1IQTA 4J91A 5IT9U 3MGJA 2RQKA 2HRTA 1WG1A 2AEJA 2HLTA 4H4OB 2OKQA 5AXMA 2FVRA 2DH7A 4LBIA 3NBPA 5J1EB 4URGA 5KFAA 1RT6B 3W2WB 2D69A 3RB0A 1SBRA 1TL1B 3IXQA 4N56A 1V3ZA 5F0WA 4E8UA 1T7PA 2XULA 1R43A 2K1RA 1V3SA 1DY3A 2YWGA 1PIEA 4FF4A 5IS2A 3MM6B 3KLFB 4FZVA 5C42B 4CLSA 4DG1A 4A8KA 1MROB 1HD0A 1YDLA 3C16B 5E0OA 1AZSB 1TUGB 1KQFB 4DQSA 2CPIA 1H2TZ 1NSKL 5LMUF 1LV5A 4LF9F 1UEVA 3OV7A 3AA9A 4FPRA 1V3RA 2FC8A 2CDRB 1UZHA 5HAOA 3SDEB 1JLCA 3QFWA 4P74A 4OL8A 2A1BA 1UVJA 5KT7A 3TQ1A 2M70A 2B8PA 4HDGA 3RBXA 5KFBA 2RT3A 2WOMB 4M1KA 2N7YA 2O01C 3KG1A 3V6DB 2OPSB 5A0YA 2HHPA 4NLVA 1RT7B 3EICA 2XYHB 3GG0A 4WF9Q 4F4WA 2F3JA 2ZZTA 2FGCA 3IM8A 2VJUA 4K7QA 3D7SB 3RU0A 1U1MA 3NCQA 3QPIA 1OO0B 2CVEA 3W62A 4YB1P 2VIHA 2LA6A 2DD8S 3KHLA 1DAXA 1S9FA 2ZH4A 2AJFE 1VJWA 4NA3A 3GR1A 4QBUA 3GJRB 3EZOA 5EWGA 2B56A 4C48A 2OTJS 4U7UK 1BWVA 4I56A 3MAAA 3OVBA 3TZYA 4IOCQ 4RPFA 2JVOA 1F1BB 3IWLA 1NM2A 4DR6F 4BDPA 3VAHA 4XO0A 3SXLA 3C3LA 2CWKA 2XYPB 2FJVA 3WIVA 5D15A 2K3IA 2BDPA 4NXMF 2PA3A 3GFHA 5DS7A 1SQEA 2HFOA 3TVZA 2QE5A 3V81A 3CCUS 2OTLS 2ZM6J 4UF4A 4YQWA 2ZC4A 2A10A 3H5SA 4FXWA 3R7NB 1EP4B 1E6VA 3EPGA 4RWWA 3KLEB 2XY7A 4MK7A 5HN0A 2AIRB 3ONQA 1KSPA 2MB0B 2PN6A 2IC3B 4F2SA 2BYCA 1WTFA 5C24B 2DRDA 1FWKA 5D77A 1H98A 1R8CA 3P45B 3KK3A 4FVMA 1RLDA 2G0IA 2L41A 2W2NP 4P7TA 3VAKA 2YWHA 2OELA 2DH8A 3GE9A 4NCAA 5CA5A 4FYXB 1NKCA 2MLYA 2IBOA 2CQDA 4A8XA 4XPCA 3MOZA 3VGVA 2B4VA 1LWFA 1UEUA 2FC9A 1S9GA 3HVWA 2XHWA 4A4JA 2GGPA 1U24A 4CLUA 3OLBA 3HULA 3TVYA 5LOQA 3PR4A 4DSLA 1RDRA 5ETTA 2XLIA 1HARA 2P6TA 3UD4P 1GMUA 3T1HJ 3Q83A 3CW2C 2ZC3A 4O0NA 2RKIB 3EWGA 4YR3A 1S1UB 2MLZA 1NDLA 4RW8B 4R5PB 3ZZ0A 1HR0F 3NWRA 4OHVA 2OUGA 2W4PA 2B6AB 4RNOA 2LQ8A 4QIVA 2B4OA 2W7PA 1KQKA 1H2UX 2VC1A 3I0RB 3K8VA 1G3OA 4RO0A 3ZFVA 1WC1A 4DR1J 4GVLA 1L3KA 1SC3B 3PACA 2UUBF 3CT9A 2BJEA 2DR7A 4MK9A 2EFGA 4DBQA 4R8UA 5BJRA 1DLOA 3MR5A 4EEYA 2FJXA 5D0HA 3PG9A 3QGHA 3VAMA 1C1BA 3L7OA 1LEOA 4R0JA 4DX5A 1KONA 1WEYA 3RBEA 1CJVA 2HURA 3JSMB 4JI7J 4TU9A 4PUOA 1VQYA 3JTPA 4NEZA 2KRRA 4B3OA 1N34F 3BBFA 3RB6A 2V2QA 1VS3A 5G0RB 4ZJQA 2BE2B 3LA0A 5K9FA 3HVTA 1NK0A 2AYEA 1NRKA 2V4JB 2ZE2A 1VISA 3IRXA 2L9DA 1H7WA 1U09A 3TANA 1WI6A 2IJRA 4TXSA 4G1QA 2J76E 2P9CA 3CDEA 4RW4A 1X31C 2BABA 4JB8B 2MQPA 2W4CA 4DPXA 3LUYA 2N3OA 5B0AA 3AT1B 2GAHC 4L3NA 3K59A 1FKPB 2HAIA 2VPWB 2EPIA 1B70B 2CG8A 3R6LB 5EUHA 2IRUA 4ENOA 4V19X 3ISND 3FFIA 2EG2A 1UW4A 2BMBA 3M6UA 2ALZA 2DNRA 1FRKA 2AYMA 2ROPA 5BR8F 5B0FA 4OIXA 5D4PA 2NYIA 2AW0A 4DXLA 2VBXA 2FY1A 1VQ6S 5HMWA 1TV6A 5KG5A 2FLPA 1N6QB 4NLRA 3G8QA 5KFVA 2XMVA 2UXCJ 2FHJA 2RQCA 3ISZA 5KT2A 3D67A 4B3SJ 1S0NA 4P52A 3M8YA 1GX6A 2ZHOA 1TR0A 4WYLA 4TY8B 3R6GB 1OS5A 4RKUC 2H48B 3M8ZA 4ES3A 5IZHA 2Z2ZA 2Z2YB 2A6MA 2OMOA 4V1Ak 5IQQA 4MH8A 3ZNUA 2RHQB 1UVLA 3EVWA 4OHZA 2DRAA 4WTOB 1RA6A 1S6OA 2BE9B 4LF6J 1C0TA 3I4PA 4JOUA 5D3GA 2FJAB 2P9GA 1SJRA 1SJFA 2CPXA 5EN1A 2ZVSA 5T41A 4KSEB 2XS5A 4ELUA 1RP5A 5E7OB 2FZKB 5KG3A 2MZSA 3FK4A 2XB2D 3R9LA 4LIRA 3MR6A 1L5UA 1RI7A 2XMJA 1TTHB 2IHR1 2EC0A 1RTZA 3OFEA 2XMMA 3QRRA 2QMUB 3J7Z5 2QLJB 4NLPA 3M8WA 1JLGA 3P49B 1CVJA 2P9EA 1X4CA 2DXFA 2RRAA 4B3MF 3QJLA 4RWXA 3WDOA 4Z2XA 3BS9A 3MM9A 2FVPA 3G6ES 3EJMA 4DV7J 4I2PB 2FHJD 2GJ2A 3W5XA 4WKYA 5BXIA 2IRYA 1YJ9S 2E9ZA 3M2VA 2R8KA 3AD8C 3NGUA 4B9UA 1FKOA 3KK1A 5DETA 1SV5B 1F5CA 2BJDA 3D1QA 4EMDA 1EZZB 3CD5A 3Q8VA 1ZTWA 3AQPA 4GO5X 4CO2A 1LWEB 3CCJS 1U1QA 4KQZA 4IG3A 3P3DA 3EGVA 2XNQA 1K1SA 1HHTP 4DQPA 4F4AA 4F3QA 3BKUA 1HQEA 1Y00A 4KKOB 2CPEA 3K8WA 2BA9A 5A8KB 5HJXA 3C6TB 4M5DB 3Q2TC 1NBEB 2YKOA 3W1YC 4K2JA 2JNJA 1HLWA 1PBUA 2ZNYA 3CDUA 4C8NA 2LDIA 4NMXA 3UWTA 4CYUB 2YBVA 3JQJA 3U1MA 3NGSA 5HJYA 4ZN1A 4PWUA 2UVWA 2OHDA 2AD9A 1PGZA 4ZIWA 2HGMA 1S99A 1WJ9A 2CPHA 1QD1A 4ANCA 1X4BA 4NCGA 4ERDA 2UUWA 1ICEB 2G2ZA 1VQOS 3CCZA 1C0UA 3CCES 1X8DA 1BE4A 2MQQA 1Q1KA 3SV3A 3QQCD 1R0BG 5H9FJ 2R8HA 5GADI 2KZZA 3O8WA 1F9FA 4PABA 3VF0B 2PA8D 2BV3A 4PPDA 1TP7A 2XMAA 2CJ9A 1CPZA 1NHUA 3K58A 3TUPA 4O3PA 2DEJA 3N79A 3KUGA 4OYWA 5E33A 4CT9A 3KLIB 3PW0A 2XI2A 3M8SA 1RGVA 4WCEQ 2HLUA 4C9DA 4LF5F 1WEZA 2ZUAA 2DCLA 4JI6J 4I6AA 5GAEI 1U2FA 3H2LA 2EBGA 1AUSL 2QN6B 4OHWA 2Z58B 4IO1A 1T05B 5B0CA 3MHYA 1RKIA 1HPZB 3GFZA 1GQEA 3KLGB 2R2SA 1IR1A 2R2UA 4ZVEA 1RTDA 3P4UB 2E29A 1RTHA 5I42A 3B82A 1M1HA 4XDCA 1JLEA 3ZZRA 1FD2A 2XZTB 5HQ8A 2RF2A 5DZ6A 3L7PA 3HJFA 3MEKA 2I38A 4HACA 2DHHA 1Q86T 3JYTA 2B4UA 2VC0A 4J9PA 3DHWC 1WSVA 2UU9J 1Q8LA 1YBUA 2EFQA 4CIOA 3EMTA 3QGGA 1KP6A 4WXWA 2LEBA 2QFIA 2MSTA 4C7QA 3W5YA 4MK8A 2Q6CA 3OD2A 2JLEA 2B5JA 2HNYA 5F8HA 3ADAC 3U1NA 2KH9A 4N47A 2MYFA 2CQ1A 2BM1A 2J9CA 4RUCA 1VK8A 3BDEA 4DR2F 4F4XA 2CPFA 4W4MA 2E5IA 2V4QA 1T8EA 3GG1A 1RT1A 1HNXJ 2I2YA 4JI4F 4HI1A 4CTAA 3PXGa 3EGWB 5E5NA 4IG0A 2EFNA 2H4YB 1HQ2A 1XNRF 2ASJA 1AXQA 1MU2B 4X4SA 2FHOB 1Y4ZB 2V50A 1WNEA 3KDNA 3LGHA 2DCUB 3PKYA 1XWLA 1FRLA 4Q0BA 4DZDA 1CQMA 2CPYA 1SL1A 4M95A 3A4TA 3PW5A 4C8KA 4WFYA 1Q95G 1Q5VA 3UDEA 1UFWA 3KLVA 1FDDA 1MN9A 2H4WB 4WFZA 1UFLA 3MEGA 1E6YA 2FB0A 2E1MC 1T03A 1KN6A 4PCQA 4TU8A 3CEDA 4WBFA 5HROB 1FVQA 4DOZA 4U6PA 1RTIA 4I68A 1PAEX 2DHAA 2D9PA 3MF5A 3KMSA 4WP9A 2AGPA 2BACA 4BBYA 1U0SA 3NGTA 5J2MB 2IM3A 3DOKB 1R6YA 5I3UB 3AA8A 1T9WA 3JQKA 3GYGA 3MEEB 3M05A 4ZLNA 1V5IB 4C97A 3TVKA 1JJCB 3QWPA 4NLWA 1RYSA 1XNQJ 3G82A 1YLXA 2XMTA 2XSFA 4HHUA 2E1CA 1Q7LB 3KK2B 3NL0A 3G8SA 3I96A 2EFVA 1N0UA 2PFFB 4EU0A 3FCWA 4FYYB 2GO9A 3R5GA 4QW9A 3JSYA 1EIYB 3QSYB 3QGIA 3VHQA 1HBNB 2QMXA 4O4GB 1NSAA 4PZVA 4FP9A 2CQGA 4DR1F 2WAQD 3NRBA 1V9OA 3UE2A 3BKFA 3D0HE 5KFSA 2DISA 3HD1A 4D3GA 5U47A 3DU5A 1NKEA 4FYVB 3CCWA 1DARA 3BBBA 4LVNP 4ZLJA 3NOCA 1IBLJ 5K8NA 1QAXA 1C1CB 1K44A 2J8AA 3MEDA 3GONA 1QAIA 1NK9A 4LR9A 4FF1A 2W7AA 4UUXA 3BQ1A 4UT4A 3WHIA 5F8LA 4OHXA 2R9LA 4JI7F 5CD4A 1RAJA 2UVRA 1KOHA 3PR5B 4KHPF 4DHVA 4ID8A 2XS2A 1BQMB 4ZVPB 4ZVOB 1TVRB 3E01A 2LU2A 4ETXA 2K8GA 3RAXA 5FIIA 2ZHAA 1RT2A 2YH1A 1UP1A 3C8YA 5B0GA 2M0GB 2ZH5A 1CJTB 5K8PA 1ULRA 2V8GA 5I3QA 1CJUB 3DCAA 5B7WA 3EDQB 3A3OB 2VKZG 3VGSA 2YNIA 1T9VA 2W9BB 2MGZB 3IN5A 1J27A 2KVQE 4J9LA 2E5HA 1S1TB 2LEAA 1RT3A 3EPIA 3W7BA 3CMQA 4BHQA 2CNNB 4YHHJ 3CVKA 2PEBA 3M8QB 2KRBA 4PQUB 2C28A 5CZXA 2DKOB 3QLHA 2HPUA 1WG4A 2ZD1A 2V69A 5F9LA 3ZTQA 2RQ4A 2COLA 2XYGB 4URSA 1FTRA 3PW7A 3M8PB 3HSDA 3KWMA 4ES1A 2HVEA 4JI8F 4YR0A 1Q4RA 4OV6A 5EWEA 2LP4A 2UXCF 5IFMA 4K59A 2OFHX 2XNRA 2C42A 3QIPB 3M2RB 4DSKA 1SUQA 2JEGA 4B3SF 3HKWA 3OSNA 4FPIA 3R5DA 2VG6A 1S6QA 3TEHB 2OPQA 2NXNA 2V63A 2HFUA 3PW2A 4LFBJ 4G6VB 2RS8A 4P6QA 1H3DA 4KIAA 4WP8A 5D78A 3PJXA 3KHGA 1JJHA 3DLGA 4B9LA 1LXNA 1JX4A 4OX6A 3IG1A 1JLQB 5T7LB 4LFCF 3OR2B 5L1IA 1N88A 3TYTA 3IS9B 4YS2A 4O3SA 2UVVA 1U1KA 2H65B 1SKWA 1Q8IA 4ZPAA 1OMSA 3CJKA 2VG5A 2AU0A 2YKQA 2VFUA 1D9FA 3QJPA 2Y1JA 2D41A 3EZ5A 4TKTA 5JJBA 1Q78A 3KLHA 3D3BJ 3TA2A 2HWIA 1YJWS 3KNGA 4BWMA 2RDJA 2DNLA 4O44B 2YNHA 2FGOA 4XK8C 2VG7A 1UWBB 3BH7B 4QYRA 4CLZA 5CYMB 4ANEA 3F73A 4GVBB 5DLGA 2E5LF 3H4BA 3BO4A 2JSXA 4IQMA 3SEOA 2C22A 1L3TA 1SJQA 1FDAA 2G13A 4NYZA 1Y5LB 8AT1B 1Q81T 4FNIA 3C19A 1RT5B 4BS2A 2GVZB 3J81Y 4ZPDA 4URQU 3CC2S 4DFJA 4QR1A 1YTYA 1RBAA 2MZTA 4ED6A 1TFYA 1PYSB 5HVHA 3IBWA 4ZA1A 4O0IA 4J37A 3HMJG 3AXMA 4NZ0A 5AJ3J 3VQSA 4Y3CA 4KO0A 3DOMA 4ZCIA 3PCOB 1ZAWA 2ZITA 4L73A 4F0KA 2PIIA 4F7VA 2Q1LA 2Y1LB 4QWEA 2HHHJ 2YX7A 3AOAA 4K8RA 3V2UC 2U2FA 5H9EK 4DR3J 3UPFA 3FEZA 4WFAQ 1XEZA 3M32A 3OUYA 2KO1A 2LLZA 1LWXA 1IBMJ 2HHWA 1XBWA 1EAYC 5A8WA 3CCLS 4RU9A 2EKNA 2LDYA 3GSIA 1WOOA 3GCXP 3DLHA 3SFGA 3UCGA 5E3RA 4DS5A 1S6PB 4K50A 1U6ZA 3FMBA 3OPKA 3SZ2A 3P6YC 1R8BA 4F2RA 4NZ6A 4H4KA 2HZVA 1KBRA 5L46A 3H90A 2W9CA 1P1TA 4JI1J 2IM0A 5E41A 2M7SA 1IJEB 5LMNJ 2HK3A 3DRPB 1H38A 2RU9A 2VJVA 2F8MA 1RTJB 4QYZJ 1HFEL 5CYQB 5L39A 2FPHX 2WSCC 1YX2A 1C2PA 2BW7A 3UQSA 2J9DE 3GZ7A 3G9CA 1ZBTA 2VH7A 4JI6F 1O0PA 2CJQA 4Z37A 3CUNA 1NK4A 3GV8B 3N5FA 1VHFA 1VQ8S 3MD1A 2POKA 1VQ5S 2C2DA 2DXDA 1NDPA 3DXSX 4QIWD 4P2XA 4MKVA 5AXKA 1IBCB 4JUZA 1IKVB 3US5A 1WHVA 1NPPA 5JVGQ 5EX3A 3GIKA 3CJSA 3RB3A 2ZH2A 1GAOA 3FEXB 3DU6A 3ET6B 4OZNA 1LW2A 1ZOTA 4NYPA 1W25A 3UN5A 3O2IA 5B0EA 3ZTPA 3T9ZA 2BANA 3KTQA 2UV8A 2M9KA 2UU9F 4J9UE 4B9SA 2X3GA 4F8RA 2GCFA 3M30B 2HS0A 1R8AA 4ZIVA 1VK3A 2MSSA 1NUEA 3CD6S 3FDSA 4DPTA 3QWUA 1EKSA 2XZDB 4RJVA 5IOLA 2UXDF 2NZCA 4ETZA 2CJKA 1TZ0A 3LALA 4N8NA 3PZPA 3GJTB 1JLFB 1FDNA 2IM2A 1UVKA 3D0GE 4DS4A 1HNXF 2XCPA 3UCZP 1NSPA 5DM6Q 5A2QU 3OXFA 2B9EA 2EEYA 4M5NA 4LMZA 1VOMA 3P5BP 2GJIA 3R7BB 3EX7B 4NX9A 1J5OB 3MFIA 2G0JA 1PAUB 3PFOA 2EKYA 2R7XA 3MAQA 4G3IA 3M2UB 4RW7B 4P10A 5ETRA 1SKUB 5ETLA 2MY7A 4OI4A 2XY6A 1JWWA 4OZ5A 3U02A 4CLYA 2L48A 4DSJA 4U7UD 5KFNA 1R8HA 2HRUA 4ECWA 1M5SA 4MKAA 2GNKA 1XK8A 3B8HA 4ECQA 5ETOA 3IBCB 3I5BA 1CSJA 2UUAJ 1KHWA 3RAQA 1DTTA 1U1NA 3K5LA 1OQ3A 2FZGB 4MKBA 2WHOA 4PXDA 2MJNA 5J1EA 1RBLA 3QSIA 1RT6A 1FFWB 4ATNA 1RHRB 2QTWA 3QAEA 4C8LA 3V4IA 1KFDA 2YXLA 2XS7A 3U27A 3KJFB 4ES2A 3I4HX 3CIMA 1U25A 3KHHA 1U6FA 1G7CB 2XLKA 1QSSA 3HSJA 4IOAQ 3ZZTA 1NK6A 1RISA 3L3CA 5A8RB 4U8YA 3HXMA 1XNQF 1SKSA 3BGRA 4WK1A 3NOGA 1IKWB 1S9EA 1A7GE 4PYAA 1AZSA 3MMAA 5GMEA 2CKWA 3KOAA 3O3LA 1B4SA 2ZH3A 2K7JA 3BO3A 4QWCA 2GHPA 1N4LA 1SC6A 1J5EJ 2QC3A 2C2RA 4OFZA 1SJ3P 1FA0A 2FQQB 3FSIA 2H54B 3ZZYA 3HHLC 4OI6A 2B51A 1MWYA 4RUAA 2LMIA 1ZM4A 2MKIA 4O3OA 1BQXA 2WOMA 4OX9F 1Y11A 1Z2LA 3OTEA 1RJJA 1B3TA 3T6BA 1REVB 1FEHA 2VBYA 1RT7A 3R5BA 2G2OA 1WHYA 4ILLA 4U7CA 3V4MA 5D0GA 5FD1A 2B4PA 1CJKB 3NS5A 5GAEU 5KFRA 4ZK7M 4K4WA 4QWAA 1U0HB 3VGTA 1PO6A 3DLEB 2XC9A 1YRXA 4B02A 4CI0B 4WE1A 3IC1A 2HMIB 2YPZA 1U8WA 4CT8A 4YDDB 2KVIA 3NAIA 3OT9A 2RQMA 4ZHRA 1N5VA 1YJ7A 3IAS9 1X5OA 1GXUA 4WPAA 2OPRA 4C3MA 2VF3A 3DI6A 1S79A 5LT5A 4ID5A 2MKKA 1SJ1A 4ED1A 2WRMA 1NO8A 4YHHF 1HBOA 2K1RB 4LF9J 5DLFA 2IAJA 2KZMA 4ZVQB 1RAIB 3BJYA 1WDDA 4DUZJ 2LA4A 1FKAF 4BLGA 4DG1B 5LJ3Y 3RW6A 2ZNZA 2V34A 2PE8A 4EUVA 4FKYA 3J7A1 4QWBA 4MMOA 4MT1A 3A8JA 4CRJA 4DDFA 1HD1A 3M6VA 2JWNA 2W24A 1BQNA 3GIIA 2QA1A 3G6XA 2VPYB 3DLJA 1M5VC 4UOCA 4FS2A 4CP5A 4S0MA 2B0GA 2DR6A 2BX6A 1TL4A 3HJVA 1YSJA 1VQ9S 4XIUA 3DYAA 2QLBB 1M5OC 4DMZA 3UFCX 5HMYA 1LQ9A 2JJ4D 5KFLA 1X9MA 2U1AA 4LFBF 9RUBA 5A0YB 1OJ4A 1N5YA 3VAGA 2RS2A 4B9NA 3QRQA 2VL1A 1EARA 3PM9A 4OI0A 1VRTB 1NK5A 4USIA 1NDCA 4ICLB 4USUA 4HTJA 4DR6J 1SQFA 2YX1A 3D66A 4ZN3A 1N52B 4CLFA 4F67A 4NXMJ 3KJNB 4NRTA 3DDKA 3K89A 2WTFA 2CQ3A 4LIWA 2WSFC 3L95X 2HVZA 3MAAB 1N0VC 6FD1A 3I0RA 4MFBA 5HMXA 5F8JA 3BM7A 1ZZFA 4J9OA 4RBTA 1RXOB 1HBUA 2FVQA 2J5AA 2C2NA 4J9QA 3RZAA 3CJ3A 3K5OA 3I5CA 3GQCA 4Y2IA 3FSYA 2QRRA 4PWDA 5ETKA 1CQNA 1WC0A 2MDAA 2L9WA 2YKPA 5K14A 3BZQA 2ZFHA 4LR7A 3V81B 2LQBA 2MKSA 1CBKA 3CCQS 2PO4A 3MDFA 4UTGA 2DNHA 4ILRA 1URRA 1Q8KA 3OR1A 2QJ3A 3LP1A 4FNHA 5IWAJ 2IVYA 1GNKA 3BB5A 2C3YA 3NS7B 3MMCB 4ED7A 4E2FB 3IRWP 4PG5A 3GYNA 3P5TL 3G86A 1LWCA 1Y0HA 3BKTA 1QE1A 4ZVTB 1L3UA 1EJ7L 3KK3B 4ZCLA 2QIFA 1I3OB 2BKOA 4K4ZA 5F8NA 4B9MA 2MJUA 2DIVA 2LXIA 2MY8A 1LKZA 1HBMB 2RDIA 2RHSB 1UFKA 1VDHA 1MSWD 1S9GB 3M4XA 1TK5A 2C2OB 2GGPB 4DL2A 4L74A 1TU0B 2A18A 2HS4A 5KFZA 3H5UA 1FXDA 2XO6A 3R1HA 3AFGA 2MQNA 2HHHF 1UMJA 4ZVGA 2UUBJ 2KXHA 1L3SA 2IVMA 4OI2A 4CO1A 4CCHA 3R2CJ 1JNRB 3R5JB 4DR3F 2HNDA 2XM3A 3BO2A 1ZYQA 3TJ9A 3CJ8A 4M5IA 3QGPA 1P9YA 2X3DA 2VFVA 2OGUA 3O5TB 4LBPA 3PIPQ 2D3UA 1LNQA 2AYGA 3QT7A 1AYEA 4TLQA 3MURP 1X5TA 2QL5B 5HATA 4LRCA 2MZQA 2K2PA 2C3UA 5KFJA 2VBZA 1N34J 2ZUGA 3FGVA 5ETMA 2B8QA 4R8UB 5L1LA 2GFFA 4ZPCA 1FX4A 1DLOB 3OBIA 1REGX 1MWZA 1C1BB 2YKMA 4M5KA 2F7VA 3KXDA 1IWAA 4DV3F 3OSPA 2RDDA 2ZBRA 4M8LA 1CJVB 3H20A 4DV0F 4G1PA 3FUYA 3D0IE 4PUOB 2IBKA 1TUVA 5EGYA 1TK8A 4B3OB 2N7CA 1NNDA 1S1XA 1JLAA 2QA4S 3F44A 5F3TA 3HVTB 1WDTA 5C2GA 2ZE2B 1HYSA 5KG2A 2RRBA 2DGSA 5DZ7A 4DR5J 3KJQB 4L3KA 3D2WA 4J90A 2KM8B 2GX8A 2OD6A 2LYVA 4G1QB 3N6MA 3UNYA 2XQCA 4A8QA 3BGFA 1VHIA 2J0WA 1FF2A 3FZ2A 2HWTA 4KGKA 2KG1A 2BJ8A 3EXCX 5HVGA 1R8PA 2L3MA 2QLWA 1T9XA 2CQ4A 1XN9A 2DNNA 2HW3A 4AD6A 3IO1A 4DFKA 1YZ7A 2R7WA 4DWIA 2E9RX 3AODA 2XWXA 3FFIB 1R0AA 5HSPA 2E7WA 2GJFA 4I2PA 2CJYB 4OYMA 3HHEA 4WYWA 4FYWB 4ECXA 4DL0C 2Z8QA 2D9OA 1K73T 1TV6B 1KC8T 4N76A 4NLTA 3HHKA 3PV8A 4P2MA 1RWUA 5EX0A 5HQMA 5FJ4A 3HFZB 2JH3A 1UZDA 1JKHA 4PRFA 3A8EA 2YWWA 2UZAA 1V6HA 4LF2A 4Q8EA 4J9NA 1P1LA 3PEJA 4P71A 1HW9A 5A8KA 4EYHB 2JOQA 2CRLA 3TR5A 4M5DA 3NKYA 5KFFA 2J9DA 7FD1A 3TI0A 3CCVS 3T3FA 2X1BA 3CD0A 4HKQA 4DCPB 1C0TB 2IDEA 3M8RA 5D4OA 4NOHA 5D3GB 3W3SA 2CQ2A 3KMQA 4PPZA 1ZPVA 4RBUA 2GZOA 3QYYA 4W98A 3E51A 2D3OR 2APOA 3IFEA 1U02A 2KB2A 1C4CA 3SV4A 1QY7A 1SH3A 3MMJA 4N41A 3OL7A 1M5HA 1VBZA 1F6TA 2KFNA 1S76D 4DX6A 3ENAA 2HHQA 1N48A 4DF4A 1ZM9A 1NU4A 1U45A 3TAMB 2FIUA 3Q8SB 4GKKF 1JLGB 4K5SA 2W2OP 1WKKA 3SBMA 3FMWA 3EZUA 4X64J 4JV5J 2VONA 2DNGA 3ZXWA 3TJ8A 3MM9B 1VQ4S 3G2XA 5RUBA 1K0VA 1FERA 3TZWA 4TQRA 3DMJA 5KT6A 2AF6A 4RW6A 3AD9C 1HA1A 1HPZA 3M2VB 1FKOB 2YNFB 3KK1B 1RADB 1ZS6A 1P9QC 1UJ5A 1SPBP 1FE0A 5M2PA 2HQ3A 3V6HA 2CJXB 3QT6A 2X51A 5KFTA 1JNZB 3LP2A 4IG3B 3AOCA 2ATLA 1FNMA 3CCSS 2BJ7A 5HANA 1HQEB 1IR0A 2DB1A 4K5RA 3TW0A 2KN4A 4I64A 4RUHA 1H72C 2C3OA 2KYZA 2X1AA 3EVMA 1D8ZA 5KT5A 3H42A 4J9RA 1VGYA 2JLGA 4WWSA 3C15A 2ADCA 2EVZA 1RACB 1RT4A 1S6UA 2V9WA 4PKDB 4HR2A 2L08A 3Q23A 3TQEA 4DV2F 3UCUP 3OL9A 3ETOA 3PIOQ 3TUIC 1RQ0A 2C3PA 1TL7A 5JMNA 4C8YA 2GQQA 4W92B 2CAJA 3D1HA 4FF2A 2YKNA 4OJGA 1M5PC 4J9VA 2N3LA 1C0UB 4IYQA 2V0NA 2FLNA 1D1UA 3MM7A 1O6XA 5KFDA 4LF5J 3QBCA 4USVA 3J7AN 1SIZA 1MU2A 4X66F 2UUCJ 3G4SS 4MKYA 1DHMA 2HBQB 1V5VA 2J7KA 3LP0A 1S5ZA 5AXNA 2HBYB 1Q0NA 2QX0A 1I51B 1X4EA 2O3DA 2OSRA 1T11A 2P5VA 4KH1B 4DUZF 2W2PP 2WW8A 1XR5A 3CE8A 2YWEA 3QZ7A 4A46A 4KC5A 2MXYA 4WIQA 2JC1A 1NEEA 4HH1A 2ROEA 3QFHA 4C98A 1KR4A 1B0TA 4PG4A 1PYOB 3T41A 2HZCA 2YWFA 1QVGR 1UPMB 2CQBA 4W90B 4FYDA 1RTDB 1HQUA 3PY8A 1RTHB 5J2MA 5I42B 2Z56B 4UW2A 1RWVB 1AFJA 3TZZA 1JLEB 3N6NA 4UY8T 1XR6A 3Q24A 2MKJA 4P72A 4HACB 3CJQA 2W25A 2ZOFA 2IA6A 3QT8A 3QJJA 3JYTB 1S10A 3ZC4A 2HEKA 5GAHU 4LFAF 4DR2J 3K57A 4FBUA 3HM9A 4I2QB 2RJZA 1VBKA 1NJIT 3TARA 4JI4J 2BVZA 1QAJA 2PI4A 3X1LB 4YDXA 4X65F 3K0JA 1TL3B 2B5JB 2HNYB 1XNRJ 5LSLA 2IFXA 1UW9A 4OYBA 4ZVFA 2DGXA 5C25A 4CNZA 3AD7C 1WWHA 4ECRA 2XSJA 1BXNA 2CNLB 1A0OB 2LFVA 4X2BA 4X4PA 1X60A 2SXLA 1N32J 3C46A 4GC7A 1ZM2A 1RT1B 3CJ5A 5CHCB 3N5BA 1IM6A 4MIWA 5I4MA 4JV1A 3F41A 4CTAB 1S4FA 4IG0B 4CLTA 3BF4A 2CG4A 1UVMA 1AW0A 4ZP7A 4ZPVR 1YQHA 3BQ0A 2EG1A 1FJCA 2BXJA 2GMLA 3A3PB 1PYTA 2HK2A 5MLCV 3CCRS 5IWAF 4I7FA 4PAAA 1RHKB 2LKZA 3GP9A 5DQIA 2IY5B 1SKRA 5K5MA 5DDQC 1NK7A 1BMQB 1N8RT 4ED0A 1E6YB 3JB9k 1BQMA 3H5XA 2OIHA 1T03B 1FJGJ 3N28A 1GMVA 2IDLA 3TZXA 1RTIB 3WX8A 1T0TV 2J7WA 1HW8A 2ACYA 2H9ZA 3PHEA 1CJUA 1S1WA 3GILA 3MPVA 3DM2A 3UDLA 4MYTA 4JI5J 1R27B 2DNYA 1S1TA 5KFXA 5AE3A 5KG7A 1WHXA 2HBZB 3GFXA 5JVHQ 3D28A 2AX0A 4I6WA 2V94A 2AQ4A 4NI2A 3W65A 1PJ5A 3GJSB 5J2QA 2WVBA 3G82B 2XGQA 1Y10A 7FDRA 4FKXA 3T1AA 1TKXA 1S7HA 3LOUA 2HQDA 2CPZA 1BD6A 5EWFA 2J6TA 4IO9Q 2R8GA 2DY9A 2UV8G 4NMLA 2R8JA 4ZP9A 1QSYA 4KGVB 1CG2A 4KFBA 2ZKUA 1M1GA 4UOFA 2P2CB 1Q79A 3ILJA 1HHQA 3IR6B 5IV3A 2RIJA 4YB5A 1WTBA 3BGOP 2CZ9A 1B0VA 2JFKA 3NS6A 2NSCA 1NB7A 2HFVA 2O66A 3LAKA 4KHPJ 3K5PA 5KT4A 4OYPA 4WZMA 4LSZB 2B9WA 1N33F 4M5LA 5F0UA 3KHRA 4QYZK 4I1TA 4JYAJ 1Z4UA 3MEDB 2ZWOA 5LXRA 3GSDA 3FRZA 1D9AA 2VASA 1RK8A 2M8HA 3MM5B 4CO3A 2KXNB 2EK1A 4MAKA 1K8AT 4X4UA 3CJ0A 3VAFA 4YY3F 1YI2S 1JXLA 4AE5A 1PBAA 3RBDA 2ADBA 3D6HB 2JDJA 1H73A 1QVFR 2AKWB 1CEZA 3MECB 2WCXA 2YVSA 8ATCB 2ZH1A 1CC8A 4DR5F 3NGKA 1MG7A 1OPZA 3HVAA 4WIIA 1W7WA 2IA0A 2QGFB 4B9TA 1T3OA 3FBFA 4B3TF 3QRPA 1S0VA 2YNIB 4XAKA 4BC9A 1BC6A 2ZZNA 1VLYA 2KHCA 3HT0A 1ELOA 1RA7A 2BRLA 2W2QP 2MTLA 2DPIA 1FT8A 1RT3B 4NLYA 3HX9A 5HI7A 2LCWA 1X0FA 4DR7F 1HNVA 4ZP8A 4JI8J 2IPOB 1TQLA 3QLHB 2DO0A 3CTRA 4G65A 1GX5A 2ZD1B 1D8YA 5CYMA 4F3OA 5L8RC 3PW4A 4PR6A 1G1XA 5CQGA 4ZJOA 3PRDA 4O23A 2AGOA 3MM8B 2QA4G 2A3JA 4NE9C 2XHCA 5KG1A 3CCMS 4WZQA 2X1FA 1TUWA 3DC2A 4X84A 3A13A 4M94A 3BPSP 3H8YA 2HGNA 3I0SB 2M3DA 1U1RA 1ZPWX 3EDRB 2F9JA 3M1VA 2GVZA 3W2VB 2R7UA 1ITPA 1SUQB 2E1PA 5A2QY 3OJUA 3CO9A 4BWJA 2VG6B 3PHTA 5GAGI 1S6QB 4LFCJ 2MQLA 4KGZB 3VVTA 1MWQA 5KG0A 3EYZA 3DLGB 2I5JA 4U9RA 4ECUA 1RE1B 1B7FA 2WVCA 4HYKA 3SSRA 2FJDB 3IG1B 1YBTA 2BKNA 1H0HB 1R89A 2QV6A 4DUYF 4C4WA 2Z57B 4YR2A 3M6XA 4D3HA 1HNZJ 3VZHA 5HL7Q 2VG5B 4ILMA 2HQIA 4AT1B 4HHJA 2XO7A 3OFHA 2Y0SD 3QIDA 4KY3A 2BQUA 1RWPB 1HI8A 1CULA 1XIQA 4ITSA 4C11A 1KDNA 3QNWB 4O3RA 2Z2MA 2VFRA 3KLHB 2JHEA 4JV0A 2E5LJ 4Q2LA 2JFDA 1YWXA 3EGZA 2X7IA 1Q53A 2ZKTA 4HTIA 3ETMA 5F41A 2Y8YA 3SCKE 3H98A 5GMDA 3MTKA 4P7VA 1Q82T 2XCAA 3D3CJ 2YNHB 4LF1A 1MNEA 2IJFA 4OZ0A 2VG7B 3R1LA 4ZLPA 5KFQA 5L9XA 1B64A 2ZWPA 3F0NA 3W9HA 4DV5F 4DN9A 4X64F 2D3ZA 4JV5F 1RTJA 1X4GA 3IGVA 1RYRA 3H4DA 4DPWA 3B78A 1UVIA 2WVDA 5KG6A 2IIHA 3AJ2A 2KI2A 2AHOB 1VMBA 2XZWA 1QTNB 3H2VE 3AJDA 2HVDA 5DDRC 1CS4A 1KD1T 1WHWA 1U2RA 2GA7A 1WEXA 4ZCMA 3RR8A 2AT1B 2WONA 3S1TA 1NZ8A 1UA1A 3HKZD 2R7VA 1YJNS 1WELA 4KO0B 3DOMB 3PVXA 3NY0A 1XR7A 2GVDA 1RAFB 2CZ4A 4OZ3A 1HIYA 4DCJB 1OYDA 4KGMA 3OVSA 1SCJB 4Z7CA 1P27B 2FHMA 3ZNJ1 3IP0A 3OUYB 2E44A 2BOAA 3BSCA 2C2ZB 1Y3JA 2FD2A 3DFEA 3KFWX 4I69A 3TA1A 2JEFA 1JIHA 4NASA 2DO4A 1EQMA 5G4DA 2QSFA 4ECZA 1LK5A 4OYAA 3HVRA 2E1RA 3GLJA 5AT1B 3SCJE 4QR0A 1TKZA 3VV2B 3EVOA 4IH7A 2VOOA 3C14A 2E7VA 2UUCF 3CWJA 3LGNA 4Q43A 3BR8A 1VQPS 1GEHA 3QMQA 4Q5VA 4ECSA 4KR0B 3MFHA 1ZETA 2D3O1 3M2UA 4CH1A 3ZO7A 2CQCA 2G2YA 2A2CA 5JXSA 1K9MT 1IKXA 4ZJLA 2DNKA 2P8IA 3LWMA 3JSRA 2C2KB 5T14A 5K8MA 1BUXA 4FN5A 3OHBA 3BEGB 2QA2A 3ZZOA 2CDQA 2BQRA 1SL0A 4J7CA 1FWLA 5HBMB 4IDKA 3D1OA 1F9HA 1FFGB 2CWXA 3G87A 2GMHA 2WBRA 2AJQA 1JJ2R 4EO8A 4KPYA 4Y2AA 3CGIA 3FBCA 3AXKA 1LW2B 3K5NA 4NPOA 4H4MA 3ENWA 2GAGC 1ZTTA 1APSA 2UXDJ 3Q8UA 1SL2A 2F5GA 4WFBQ 3OL8A 3RRHA 3AOBA 1OWXA 1KVIA 2Z0GA 1JB0C 3L7UA 3LPEA 1MLAA 2W8LA 2HVHA 2B7BB 4USKA 2GO8A 4RR5A 1F60B 3LW5C 4IFVA 2OJ3A 4QQBA 4NLSA 4KBIA 2K7KA 1S48A 4JP8A 4DPUA 1PILA 1G4CA 5DQHA 3I32A 1N32F 3DGPB 2FVCA 2ZH8A 2ROGA 3HZGA 3ITHA 2O67A 2QYGA 4HVZA 2R7SA 3TRGA 3D68A 3KJVA 4QWDA 2RU3A 2DGUA 3U7JA 3GJQB 4Y34A 3PYDA 4USWA 3I55S 3HHLA 2OO4A 2HNZA 1NHKL 2ZZMA 5B0DA 1GFWB 1YRUA 2AJ0A 2DHXA 4AUKA 1SB6A 4ZPWR 2N4CA 2YKAA 5CABA 1WSRA 3POTA 2JLFA 3K5MA 2OLWA 3TEGA 2LXUA 2AZ1A 4B17A 4C8MA 2DRBA 5FLXU 1S12A 2BUNA 1FJGF 3I5AA 4OZJA 2AZ3A 3WC0A 3A12A 2HWHA 2KU7A 3TJAA 1CC7A 4F3MA 3SCLE 1DTTB 3FZBA 3IR7B 2RRNA 1KLMA 1Y5IB 1OPIA 2CIMA 4MIAA 1U7LA 3BV8A 2MPUA 4JI5F 1R0CB 4OYZA 2G0CA 2H51B 3G71S 1VRUA 4Q44A 3DRRA 3V4IB 4OX7A 2ZJQQ 3MCNA 1F5AA 2DH9A 3TNVA 3BGUA 4Q2MA 3GFYA 2VPXB 3ZZZA 2PT0A 1IN0A 5ETSA 4C8ZA 4LF4F 2ZH6A 1GXLA 2I0XA 2BJ9A 1XC9A 3UW1A 4U95A 3BGRB 3QATA 1DRZA 2AWZA 2MHNA 3GPAA 4KTQA 2ABYA 1Q7YT 1S9EB 4C3KA 2IMWP 4IRCA 3SQGA 2CQ0A 3MMAB 4OX9J 2W2MP 3PX0A 3I9V9 2A2DA 2DVIA 3I31A 2MHEA 3ZTSA 4CZCA 5L1JA 3I9ZA 1T9UA 3BR9A 1O8BA 6FDRA 4J9SA 3M6WA 3GU0A 3OTBA
chains in the Genus database with same CATH topology
3E3XA 5IM0A 3MR6A 4KV8B 1L5UA 1RI7A 2XMJA 1MSWD 3SCIE 1F0XA 1HWLA 2IHR1 2EC0A 3HHLD 3OFEA 4X4NA 1S9GB 2XMMA 3M4XA 2UUTA 5CXTA 4RNMA 2B7CB 3DGPA 1LFPA 2QFJA 1TK5A 4A48A 5DQGA 3H25A 1UJ6A 4NLDA 2GGPB 3J7Z5 4DL2A 4NLPA 5JUMA 1N5TA 1JLGA 5CZVA 1NKBA 1TKZB 3P49B 4MTPA 2VOPA 2OFGX 1CVJA 2A18A 2HS4A 4QZVB 5KFZA 2P9EA 3H5UA 4RNHA 1X4CA 2B9XA 2RRAA 4B3MF 3QJLA 1FXDA 4RWXA 3WDOA 4CNYA 4Z2XA 3BS9A 3MM9A 4JYAF 3R1HA 2FVPA 3G6ES 2LVWA 2MQNA 2PC6A 2HHHF 4K4SA 1VRTA 1UMJA 4ZVGA 4KHMA 2KXHA 1L3SA 2IVMA 4OI2A 4CO1A 2R7OA 4HDHA 5F3ZA 5LSRA 4CCHA 1JNRB 3G8TA 3HI9A 4I2PB 3NCPA 1AFIA 2FHJD 4ICLA 4NYOA 1FK9A 1UA0A 4Y28C 5HROA 2DK2A 4HT5A 2GJ2A 4DR3F 2HNDA 4WKYA 3BO2A 2IRYA 2AYBA 1YJ9S 1ZYQA 4NL5A 5J2NA 1GH8A 4XPEA 5GAHI 2E9ZA 3QGPA 3DRXA 3M2VA 2R8KA 1S0OA 2VFVA 2XMWA 5E3AA 1U49A 3O5TB 4B9UA 1FKOA 4QPTA 3KK1A 3I82A 2DGOA 4PXCA 5DETA 1HWIA 4QPXA 1SV5B 2DJWA 3PIPQ 1F5CA 2D3UA 2BJDA 3D1QA 4OI1A 3DOKA 1WF1A 5DG8A 4WE1B 4TQSA 2VKRA 2DR5A 3Q8RB 5I3UA 2FJBB 2AYGA 1IKXB 2RF2B 3HF5A 4QIEA 3CD5A 4TLQA 3MURP 4WFNQ 1QSLA 1ZTWA 1X5TA 3AQPA 4GO5X 4N77A 4CO2A 3GV5B 5IT4A 1LWEB 3CCJS 1U1QA 2MZQA 4TU7A 2K2PA 4KQZA 2RSQA 4IG3A 2C3UA 5KFJA 3P3DA 2VBZA 4IRKA 2XNQA 1DQ9A 2ZUGA 3FGVA 3I87A 3MEEA 3DRSA 1K1SA 1HHTP 4R8UB 4DQPA 1YJUA 5L1LA 4F3QA 4ECVA 1HQEA 1Y00A 4IOBA 1FO1A 4KKOB 2CPEA 2GFFA 4ZPCA 5KFYA 4QOTA 4ZHRB 4GMKA 3AJ1A 3K8WA 1DLOB 3MUVP 3CD7A 4ZCKA 2AP6A 2BA9A 3ULHA 3HHDA 3X3UA 5A8KB 4IDKB 3GQCA 3R5CA 3C6TB 2OPRB 4M5DB 3Q2TC 3OBIA 3NMAA 3PO4A 1MWZA 1C1BB 2J0SD 2YKMA 2DGQA 4DLGA 3FNNA 3KK2A 2Q79A 2F7VA 3DI6B 2X1GA 2YKOA 4ID5B 4TYAA 4DV3F 3OSPA 4Y2CA 4M8LA 4DSIA 2ZNYA 3H20A 3CDUA 4DV0F 3SYZA 4C8NA 4G1PA 3NGDA 1HBOB 3D0IE 4PUOB 2IAJB 2IBKA 1TUVA 2LDIA 3UWTA 5EGYA 1TK8A 4H4MB 3R5AA 2HHUA 1P6TA 4B3OB 2N7CA 3U1MA 4MIBA 4J9KA 1NNDA 1S1XA 1KTQA 4RLEA 2DNMA 2MKHA 3MMCA 4PWUA 1HBNA 2UVWA