1R0AB

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
total genus 103
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB03
4M94A 1RTDB 4ZMMA 1HQEA 4ZVGA 5KG5A 2XGQA 1OS5A 3V6KA 3RB4A 4LSNB 4ECRA 4YMEA 5FDLA 4J9NA 4ICLB 4I2PA 4J9PA 3BQ0A 1HPZA 4PUOB 4O4GB 1HYSA 4NLSA 4NLWA 4ZVEA 1FKOA 1TKTA 3LP1B 4NLVA 4HYKA 3G6YA 4YR2A 3KK3A 1TVRA 1WNEA 2R2SA 4IFVB 5F9LA 3FFIB 3GV5B 4IG3A 2ZKUA 4MH8A 3QO9B 4I7FA 4XPEA 2ILYA 2IJNA 5J2PB 5KFDA 2B6AB 3QLHA 2JEGA 3UR0A 5J2MB 4F50A 4JV2A 2W9CB 4ZP9A 1FK9A 3OHBA 3DI6A 4DL3A 4RUCA 3M9MB 1JKHA 4TQRA 1CSJA 2YNGA 4K50A 3DYAA 5KFOA 3DOKA 3KLEA 2VG5B 3LP2A 1MU2B 2FVRA 4KBIA 5KFMA 2E9TA 4JV1A 3KOAA 3JYTB 1N5YB 4IOBA 5KFXA 4K4VA 1C2PA 1SH2A 3H5SA 4WYLA 3BSOA 3IS9A 2FLLA 3LP0A 2QE5A 3RBDA 4O3SA 1T03B 3ITHA 5KFNA 3FFIA 1RT4A 1FK9B 4NYZA 2FJXA 3DI6B 3QIDA 4PQUA 2WOMB 5DQIA 4ECQA 3TQ1A 4H4OB 5DQGA 2FLNA 2YKNA 2W9BA 2B6AA 1LWEA 4IRKA 2FLPA 3LP2B 3LALA 2ASJA 2HNZB 3I5AA 3DLKA 2C28A 2BR0A 4FBUA 3M8PA 3KK1B 1NHUA 1D1UA 3IN5A 5L1IA 1C0UA 1RT3A 3OHAA 4ZPDA 3PW4A 3MEDB 3QZ7A 5L1KA 4QWEA 1RTIB 1QAIA 2VG7A 3KNAA 4DL6A 3BREA 1RT4B 2RF2B 1T05A 2FVPA 4R8UB 3E01A 2CJQA 1T94A 2I5JA 3OSPA 4QPXA 3LANA 1LWFB 4RNNA 5KFUA 1S4FA 2BE2B 2WB4A 4O3QA 5KG4A 5KFHA 3EPGA 3BGRA 4O4GA 1C0UB 1HYSB 1DLOA 1TKTB 1R0AB 3GIMA 5F8NA 3CO9A 1JLBB 2J6UA 2HNDA 1RTIA 2B5JB 3KLFA 4ECTA 4K4YA 3MR3A 3C6TB 1DTQB 2GIQA 1JLGB 1S9GA 3ISND 3ISNC 1TKZB 3KK2B 3PHEA 3KHHA 4IG0A 3MEDA 2R8JA 1IKYB 1IKWA 3IG1B 3PJWA 2J6SA 4ECVA 2IC3B 5F8HA 3T5LA 2R8KA 1XR7A 2JC0A 2ASDA 3KK3B 3KHLA 4KFBB 3Q8PB 4F4XA 4ECXA 2AQ4A 2BE2A 2XGPA 4RW4A 4GC7A 5J2NA 3IRXA 1EP4B 1N6QB 5C24B 1TKXA 3ICLA 4IFYA 3MECA 2OPRA 3FQLA 4K4TA 4Y2AA 3KLVA 3GIIA 5KFIA 2I5JB 3DOKB 1JLEA 5KG6A 2HNDB 5KG7A 5KFPA 3BJYA 4ECZA 1BQMA 4K4UA 4R0EA 4X2BA 1VRUB 3H2LA 3OLBA 5HP1A 1C1BA 2CKWA 3DDKA 3BGRB 4ED7A 5EWGA 3DM2A 5DG8A 5C25B 1RT7B 3I0RA 4RW7B 5I42A 3IS9B 4QWAA 2RDJA 4O3OA 2C2RA 3H5XA 3RBEA 3BSCA 3H40A 3NBPB 2UUTA 2UUWA 2HWIA 5I3UB 4J9SA 1RTHB 2BRKA 1VRTB 2OPPB 4MKBA 2C2DA 3UQSA 5HLFB 1ZTWA 2ILZA 1JLGA 4K4WA 3DRPB 3N6MA 2OPQA 2UVWA 3G6VA 1K1QA 2JEFA 1RT2A 2YNIA 3NKYA 1RYSA 4K4SA 4ED6A 1HQUA 1TL1A 2JLEA 4ZPCA 4F4YA 2OPRB 4ZP6A 1LWEB 4EO6A 3BQ1A 4IRCA 3MR5A 5KFWA 2D3UA 1S48A 3NAHA 4TYAA 3KLGB 4G1QA 5KFZA 1JLCA 1JLFA 1HPZB 4WFYA 3KHGA 3I5CA 3DM2B 2XCAA 1FKOB 4Y34A 5KFQA 4ECYA 3I0RB 4R8UA 2BRLA 3LP1A 5KT7A 2DPIA 3D28A 3GQCA 4KO0A 4ZHRA 5K14B 1NHVA 1SH3A 3OL6A 4WFXA 3G86A 2J6TA 4XO0A 4ED8A 4IR1A 4RUAA 2YKMA 4KHRA 4J9KA 1HNVB 4IDKB 4J9MA 3CVKA 5D3GA 3JSMB 1JLAB 2D41A 1R0AA 1LWCB 5J2PA 4EBEA 3DYAB 1JLBA 2IAJB 2XC9A 1RTJA 2VG5A 1S9EA 2IMWP 1MU2A 4LSLB 4NLUA 5JUMA 2AGQA 3DRRA 3V81A 5KT2A 3C6TA 1JLCB 1S1WA 1TV6B 1SH0A 4J9LA 4IQXA 1C0TA 4ZP7A 2B5JA 2C2EA 4EEYA 1LW2B 1UWBA 4EYHB 1N48A 3V6DA 1RT6A 4Y2CA 1KHWA 4F4WA 3NAIA 5F8JA 5L1LA 1S9GB 3KK2A 2D7SA 3QYYA 5C24A 5KFVA 3RB6A 5DG7A 3E51A 3KJVB 3DOLB 5C5JA 3CIZA 2ATLA 2RKIA 2JC1A 2D3ZA 4KFBA 2AWZA 5KFKA 3T5HA 4LSLA 3ITHB 5KT4A 2HNZA 1MMLA 3FQKA 5FDLB 4NZ0A 2HMIA 3V6HA 2IM1A 5KFLA 3RB0A 5D3GB 4PWDB 1S1XB 4NLRA 1JLAA 4RW9A 2YKNB 3KLHB 2W9BB 1HQEB 3CJ2A 4H4MB 2WTFA 3RAQA 2VG7B 2WRMA 4U7CA 1QUVA 4IH5A 3V6DB 3MEGA 1C1BB 2FJVA 4ZP8A 3M8PB 3NMAA 1S6PB 4PUOA 5HLFA 1RT3B 4NLXA 1JLQA 3HVTA 3QGIA 3IGVA 1LW0A 2AX1A 1TQLA 5KG3A 1C0TB 2O5DA 3HKWA 3KMQA 1TVRB 5F8LA 2W9CA 4IFVA 3EZUA 3RB3A 2VG6B 1S0NA 1FKPB 2OPQB 3C6UB 4ED2A 3FDSA 1N56A 4IKAA 2YNIB 1KLMA 4MIBA 3KLFB 3H4DA 3M8QB 4ID5A 4Q8FA 4KSEB 1W25A 5KT3A 2IJFA 1S1XA 2QV6A 1REVA 1DLOB 4M95A 4O3NA 4H54A 3UPFA 1ZETA 4IRDA 3Q8QB 1T03A 4FS1A 1Z4UA 1S0MA 3CDUA 3D5MA 3T5KA 4I2QA 4B3OA 1IKVA 4G1QB 4NRTA 2YKMB 3QZ8A 2FJWA 4G3IA 1TKZA 4PQUB 4ZVHA 3NL0A 1HMVA 4NLQA 4KV8B 3GV8B 3MTKA 4R5PB 3VQSA 5KFCA 3Q8RB 5K14A 1RT1A 3MF5A 2OPSA 5HBMA 4EBDA 1C1CA 3QIPA 3M8QA 5HP1B 3DMJB 4LQ3A 2XI3A 3H4BA 2DPJA 1S49A 4QWDA 4EYIB 3C6UA 2E9RX 3MECB 3SFGA 5HROA 4LQ9A 4DL4A 3MFHA 2C22A 4TQSA 3BSAA 3MEEB 3PW5A 2ALZA 3DRRB 2FVCA 4TN2A 1K1SA 4I2QB 4B3OB 3V81B 3TVKA 4I2PB 3KK1A 2W8KA 2FVQA 4ECSA 4DL2A 2R2RA 3QGGA 4O3RA 2AU0A 5J1EB 5F8IA 4QW8A 3DOLA 4RNHA 5EDWA 2YNHA 1J5OB 1RT2B 2V4RA 4ZVFA 3DMJA 2JEJA 4RNFA 4PWDA 4TY8A 3H5YA 1RA7A 3KLHA 1HARA 4MK8A 5F9NA 1RA6A 5DQHA 1IKXA 4WE1A 5CYQB 2R2UA 2AGOA 3OL8A 2JEIA 3MR6A 5DLGA 4NCGA 3GIKA 3KLGA 2W7OA 2GIRA 2WONB 4J9OA 1JX4A 3DLEB 2R8HA 3I0SB 5HROB 1NNDA 4IG0B 4MK9A 5DGAA 4RW8A 3KLEB 1HNIB 1U09A 4KB7A 3KLIB 5CYMA 1RAJA 2ZE2B 4KKOB 5JXSA 5F8MA 2IA6A 4ZPBA 1S0OA 1JLFB 4NLTA 4NLYA 1DTQA 2VG6A 2HNYB 3OL7A 2WOMA 5EUHA 4IFYB 5J1EA 5KFAA 3V4IA 4MFBB 3HHKA 4FS2A 5CYQA 2IBKA 1S9EB 1S1UA 1S6QB 2ZD1A 5C42B 3DLGA 4F4ZA 4GC6A 2BQ3A 4WYWA 2GC8A 4IDKA 4JUZA 1KHVA 4RNMA 3JSMA 4H4OA 3M9NB 2R2TA 1LWCA 3CDWA 1XR6A 4O4RA 5EWEA 2YNFB 1KLMB 3TAMB 2I1RA 2ZE2A 4KKOA 4LSNA 1I6JA 4YP3A 3T5JA 4ED1A 3QGHA 4ECUA 4EO8A 4DG1A 3I0SA 3H98A 2UVVA 2R8GA 4KV8A 4TXSA 1S97A 1ZTTA 1TP7A 1SV5B 1TL3A 2BANB 3GILA 4NLDA 1LWFA 3DLGB 1RT6B 4WZMA 2E9ZA 2RF2A 2UVRA 5EWFA 3QO9A 4I7FB 1XR5A 3E01B 1JKHB 4Q43A 3GIJA 2WHOA 4URSA 3OL9A 3N6NA 1S10A 5J2MA 2OPSB 5HBMB 4XPCA 3MR2A 2WCXA 4IH6A 3FSIA 5KFYA 2EC0A 4O44A 5KFEA 5L1JA 1DTTA 4DL7A 4HKQA 3CWJA 4Q8EA 4YQWA 3HVWA 4RW9B 4RU9A 3KHRA 4QWBA 3H5UA 4URQU 3GV7B 1GX5A 1QE1B 2IC3A 3MEEA 2YNFA 3SI8A 1SV5A 5KFGA 3PR4A 3NGDA 1N5YA 1RDRA 5J2NB 4KE5A 1HNVA 4DG1B 3HVTB 4TY8B 1LW0B 2V4QA 3PZPA 3BR9A 3PVXA 3LP0B 1JLEB 1RTJB 3IGNA 5KFTA 1BQMB 4TYBA 2UVUA 4Y3CA 1EP4A 1N6QA 1FKPA 1S1WB 3PW2A 1TKXB 2AX0A 4WFZA 4Q0BB 1TV6A 3PR5B 1RTDA 3LAKA 1RT5A 1IKXB 4WE1B 1HNIA 5KFJA 3CJ4A 1RYRA 4IR9A 2BQRA 3NBPA 3KMSA 3DLKB 4J9QA 2V9WA 4DL5A 1RTHA 4ZPAA 3DRSA 2VA3A 2WONA 3T19A 5KFFA 2HNYA 1GX6A 1REVB 3CDEA 4KHMA 1RT7A 4RW7A 5I42B 4JV0A 5KG2A 3KJVA 4YR3A 1YVFA 4MFBA 4J9RA 2RKIB 3CJ3A 5KT6A 3PW7A 4MK7A 3BSNA 4RNOA 1LW2A 1UWBB 2V0NA 4KAIA 1C1CB 1S1UB 4URGA 3FRZA 2OH2A 1VRTA 2RDIA 1T05B 2HMIB 2F8EX 4K4XA 4IG3B 5J2QB 4TY9A 4WZQA 1HMVB 1S9FA 1SUQB 3CJ5A 3PJXA 1RT1B 3LAMA 5KG0A 4MKAA 1BQNB 2HWHA 2ZD1B 5C42A 5KG1A 1EETB 4NLOA 3JYTA 1T3NA 3DRSB 1S6PA 1TL1B 2XWYA 1JLQB 4Q0BA 1IKWB 1IKYA 3IG1A 4RW6B 3MFIA 1RT5B 4H4MA 3EPIA 1S1VA 3T1AA 2YNHB 1TL3B 2BANA 3TAMA 1J5OA 1JIHA 4RZRA 3V6JA 3MEGB 3CJ0A 4FBTA 4NLPA 3UDLA 4IH7A 3IRXB 5KFBA 4TLRA 4K4ZA 3OSNA 1S1TB 5KT5A 4KO0B 4ZHRB 3GYNA 2XI2A 4NLGA 4QWCA 1BQNA 4ECWA 3Q8SB 1EETA 4RW4B 4ID5B 4NCGB 4WXWA 2W7PA 5J2QA 1N4LA 2WK4A 1JXLA 4DEZA 1SUQA 2VA2A 5C25A 2IM3A 4U6PA 2XCPA 4ED0A 3BQ2A 4MIAA 4RW6A 4OL8A 2IAJA 4RW8B 1QE1A 2B43A 2IM0A 3SFUA 5DGBA 2W9AA 3KLIA 5CYMB 2W8LA 3M9OB 1IM4A 1VRUA 1D0EA 4Q45A 4ED3A 4O44B 4O3PA 4Q44A 4ICLA 5KFRA 5F8GA 1DTTB 4NRUA 3H59A 5DG9A 3DLEA 4WXOA 5T14A 5DLFA 3DRPA 4YR0A 3N6LA 3I5BA 3HVAA 4R5PA 2IM2A 5L9XA 3OLAA 2FVSA 3QLHB 5KFSA 1S1VB 3G6XA 3RAXA 5I3UA 3QIPB 1S6QA 2HAIA 1IKVB 2OPPA 4EBCA 3PW0A 2R8IA 2BQUA 1HQUB 4QW9A 2ASLA 2AGPA 1S1TA 1QAJA 3V4IB 2YNGB
chains in the Genus database with same CATH superfamily
1HQEA 4X62F 4C97A 3RB4A 2RILA 2OSRA 1RQ0A 1NKCA 4PG5A 1Q79A 1B64A 4ECRA 2UUCF 4J9NA 3CCJS 3BEGB 1NJWA 4LF5F 2CNOB 1CJTB 4PUOB 3SXLA 2L9DA 1XTZA 3VHQA 2ZH2A 4FYYB 1WORA 1AZSB 2CQDA 2ZJPQ 2CADA 2ZC3A 5B0EA 1TVRA 1QTNB 4JV5F 3MM9B 4X66F 1VIOA 2AV5A 3FFIB 4F4KA 1SC1B 3GV5B 4PXBA 3CE8A 2YVSA 1TUWA 2IJNA 1UVJA 1J5EJ 2DGTA 2C3YA 3GP9A 1CS4B 3AAWB 3MD3A 3VCDA 2JEGA 4F50A 2CQ4A 2RHQB 3M1VA 4ZP9A 4RO0A 2E1AA 1I3OB 1VI7A 5AT1B 1RHUB 4WIIA 4RUCA 4AUKA 1JKHA 5GMEA 4GRSA 2OELA 2YNGA 1S59A 3PW7A 1YJNS 4LRAA 3OFEA 3F44A 5B0AA 4ES1A 3J7YU 1A9NB 1Q7LB 4HEA9 4MKYA 4LRFA 1MU2B 2OO4A 2EPIA 3MAQA 4RBVA 3O6QA 5KFXA 3Q0AA 5CYJA 4K4VA 4PG8A 2M8DB 4DV6J 1HNZF 2SXLA 3VGVA 1RACB 3RBDA 2LVWA 2ZH1A 3LGHA 3ITHA 4DPWA 4NYZA 2FJXA 4J5OA 1RE1B 2IBOA 5D4OA 1Q86T 3SQGB 3QIDA 3UWTA 1O8BA 3G8QA 4I56A 3DHWC 3NGSA 5DQGA 2CPIA 3I31A 3MPUB 1F3VA 1X9WA 1F2GA 2FLPA 1NEEA 2CDRB 3IA0A 3LALA 4IO9Q 2ASJA 3CMES 2GFFA 4Y2KA 5ETTA 4RU2A 1UVNA 1MG7A 2YWFA 1NHUA 3M2UB 1C0UA 3FEYB 4GVBA 4CLPA 1OMSA 2XNRA 1FRIA 1FDAA 5LMUF 3WDOA 5L1KA 3QJLA 3C66A 5CH7B 2OI2A 4KYZA 2W2PP 2VG7A 3KNAA 4DL6A 4J37A 1L3KA 5HJYA 4OHXA 3THPA 1OY8A 5IXUA 4DLEA 2Y0BB 1UZHA 3CULA 1Q8KA 2ACYA 2COLA 3W60A 1T94A 2RUGA 4P6QA 2WAQD 2BXJA 4OHVA 4P2MA 3HT3A 4OZ3A 1RBLA 3OSPA 5FJ4A 2IDLA 2K7KA 2CPFA 3TNVA 1YJ9S 1S4FA 2AF6A 1D8ZA 1TL7A 2WSEC 4RKUC 2VQEF 4CLUA 4CYUA 4O4GA 1C0UB 1CG2A 3ENWA 6FDRA 4BC9A 4USKA 3Q2SC 4X4NA 1ZM3A 1JLBB 1PJ7A 2OAUA 3D9BA 2R7VA 1M5SA 4ECTA 2B7CB 1OQ3A 1Q82T 3C6TB 4M5DB 5ETOA 1DTQB 2GIQA 3ISNC 2KXHA 1FFWB 4LF2A 2EFQA 1ZM9A 1IKYB 8AT1B 3PJWA 3UI3A 4HDHA 2R8KA 3T5LA 1VISA 3BO3A 2ASDA 3KK3B 4KFBB 2MGZB 3OFHA 3Q86A 2PDAA 3IWLA 4ER8A 4G6VB 4RW4A 3J80Y 5J2NA 4GC7A 4GO7X 2D3O1 1N6QB 2EFNA 1UVKA 2M7SA 4OZ5A 4EI2A 3ICLA 1PBUA 3HKZD 2VBWA 4HHHA 2OPRA 2CPXA 3FQLA 2XYGB 3GFZA 3JXOA 4OHWA 1X60A 4Y2AA 2I5JB 2CJBA 4DMZA 2UU9F 1AFIA 5DM7Q 1I94F 1RWVB 2BW7A 4LF7J 2DH8A 1KLNA 1HR0J 4RBUA 2MQMA 1VR6A 1WD6A 1LKZA 4B3MJ 4M5DA 3DM2A 9ATCB 3TA0A 4M5IA 5C25B 1A7GE 4M5HA 1RHJB 1HBUA 2G0IA 3MI7X 2C2RA 2RH3A 3C2PA 3H5XA 1FD8A 3MCOA 3OXFA 1U0HA 2NXNA 4OV1A 1WKJA 5A8RB 1NK0A 4ES3A 4LF9J 5E7OB 4N8NA 1ZZNA 4YFUA 3SZ2A 1Q81T 4LFCJ 5GAGU 2CQBA 1ZTWA 1JLGA 4LT6A 3DRPB 4A46A 2LYVA 2UVWA 1QAYA 2DYAA 1UJ5A 1GNKA 1K1QA 1N0UA 1OSCA 2WB1D 1YRTA 4PR6A 3IXQA 4WFAQ 3LWLA 1V3SA 3FBCA 1Q8BA 2P9EA 2QN6B 3JTOA 3ENQA 4L74A 4DS5A 1RYSA 3EDQB 4U8VA 1YK9A 2XG8A 2XWXA 2YQ1A 1KSPA 4LFAJ 1C4CA 5HVGA 4DV2J 1Y4ZB 2KTQA 1GQEA 4WK3A 3CD0A 4ED5A 4ANCA 1YI2S 1V5IB 4JI0F 5B0DA 3R97A 1U8SA 1KQGB 2B3TB 2ZBRA 3BPDA 3KLGB 3NAHA 4OLPA 2B9EA 1JLCA 1CJTA 2FGCA 4J7CA 5T7LB 5KFZA 2HIQA 2Y1RI 4Y34A 5KFQA 2XB2D 4ZK7M 1BXNA 2EKYA 3VALA 4BWMA 2YWGA 4WFXA 3G86A 2J6TA 4ED8A 1DQAA 5HK4A 3QRPA 3SDEA 1PYSB 2A3JA 4WFBQ 4J9MA 3OXLA 4J9KA 5D3GA 3CCZA 3D6TB 1VLOA 2D41A 4HT5A 1R0AA 1OPZA 5IC4B 1BE4A 2GQ2A 1BWEA 3DYAB 5B0FA 2AIRB 1CS4A 3ETMA 1VS3A 1XJWB 1U4BA 4LSLB 4NLUA 1WHWA 2CWKA 1WKLA 1JLCB 3S1TA 5KT2A 3MUVP 2ZVSA 2K1RA 2KZZA 1DQ8A 1FEHA 1GXUA 2HLTA 3CCTA 3MPVA 1WF1A 1X8DA 4ZP7A 4NI2A 3PEHA 4ZA1A 1VYAA 2O67A 2B5JA 1BHNA 4DN9A 2M70A 1RWXB 3IR6B 4OJ3A 3V6DA 2D1CA 3LGMA 3RU0A 4ZN3A 3P49B 1IM6A 2QFIA 1KHWA 4Y2CA 4DPOA 1S9GB 5KFVA 5C24A 3IAS9 4LR9A 4CLZA 3KJVB 2CWXA 2MKCA 2DIUA 3CIZA 3UNYA 5C5JA 3HD1A 3SCIE 1FJGF 3OQ2A 1VQ6S 1HI0P 3WIVA 2AWZA 3KUHA 1B3TA 4LSLA 3ITHB 2HQCA 1MMLA 3CW2C 3NY0A 1LWXA 2E7WA 3ZNUA 2HK3A 2R7OA 2IM1A 4WP8A 3V6HA 3PY8A 4D3HA 4RW9A 4JI2F 3KLHB 3MTJA 2LQBA 3KJQB 2UUAF 2DNKA 2QLJB 3RAQA 3EGWB 5H9EJ 4NCAA 3EE3A 1IQZA 4NA3A 4U7CA 2VD3A 2KVIA 1N32J 3V6DB 3MEGA 5CZVA 3PXGa 4DSEA 4JI5J 5LL6d 4DF4A 4B9UA 5HLFA 4GVBB 3BO4A 3HVTA 1QDUB 2R42A 1WSRA 4ZN1A 3A4TA 1LOUA 1XK8A 2A2CA 2CQIA 3MAHA 4WJBA 2PMZD 2VJUA 1RLCL 2RU9A 3D2WA 1Y11A 4IFVA 3EZUA 2GVDA 3FC9A 4OYAA 3RB3A 1VQ5S 1ACMB 1U6BA 1FKPB 2Q3PA 2CDQA 2DEIA 3N9UC 1SQEA 2GJ2A 3SSRA 2YNIB 1PSDA 2DITA 2U2FA 3UDCA 4ETXA 3KLFB 1QTMA 1KVJA 1TL7B 2VF3A 3VVTA 4F0MA 4C8KA 4Q8FA 1S0VA 1U1NA 2QV6A 3FGVA 1RAEB 3Q89A 4O3NA 5HMXA 4JI4F 1ZETA 1TMMA 4IRDA 4KJIA 4JBCA 3T1YJ 3L09A 5AXMA 4ERDA 1Z4UA 3AXMA 3CDUA 2CJKA 5BXIA 1FRLA 3DOMB 3R5BA 1X4DA 4G1QB 2AJ4A 4NRTA 4PAAA 3VWSA 4CTAB 2HKEA 1AFJA 5HVFA 1FTCA 2ATCB 4DR5F 1HMVA 4NLQA 3Q83A 1GMWA 4R5PB 2J7UA 3NP5A 4KGXB 4TU7A 3BDEA 3Q8RB 1FEEA 2LU2A 4EBDA 4EZ6A 4NA1A 4OZNA 3QIPA 1HKAA 2MKYA 3SQOP 2I2YA 5HP1B 3C16B 1EIYB 2VQFF 2YH1A 2DY9A 2XTJP 4OYMA 4DV0J 2RE1A 1RHQB 2J9EA 2EXUA 3DXSX 2KXFA 3RG6A 3P5BP 4I64A 1T7PA 2HVHA 3DRRB 2FVCA 1F3FA 1RAGB 3OTOJ 2V8GA 3DOMA 1X4AA 2B4PA 3KK1A 1KTVA 1R43A 2MSTA 5D4PA 4LF7F 4P72A 3AB2B 1W7WA 2DNZA 2GHVC 4LJMA 2E1PA 4DPYA 4EWTA 3FCWA 3OTDA 2AU0A 2C2MB 1KR4A 5L39A 3ENAA 1WG1A 1J5OB 3JS9A 1RT2B 3DN9A 3K5OA 5A8RA 5SUHA 2UXCJ 2YKPA 1JNZB 3MCNA 2CXEA 2ZEJA 1A6LA 3CUNA 4CYUB 1KQSR 2PC6A 2ZFHA 1K44A 2HRYA 1N5TA 3T6BA 3W8PA 2EFPA 5LMNF 3POTB 1IKXA 2J76E 3MM8B 5DQHA 4H4KC 1RSCA 2NQPA 2QLXA 2R2UA 4DL0C 2ZH5A 1XIQA 2AGOA 2IMOA 3MR6A 2JNJA 2PN6A 5EX3A 2GIRA 2WONB 5GMKa 2R8HA 3I0SB 2J5AA 5HROB 3D6MB 3FUYA 3DKDA 3GSIA 4MYTA 3JSBA 4DV5F 4DFKA 2HFOA 2HZAA 2CJAA 3M30A 5CYMA 3CCUS 1D8YA 1NK5A 2E1CA 5F8MA 1JXEA 3PRVA 2IA6A 1SJ1A 3P45B 3HDSA 4NLYA 2HNYB 3CC4S 4LBPA 5EUHA 2V68A 3V4IA 2HGLA 4FPIA 1N33J 3PIPQ 2HGNA 2IBKA 4CM0A 3W5XA 5K8OA 1CJUB 2FZCB 4GC6A 3DLGA 5I3QA 4OHYA 4MKVA 2MQNA 4CLLA 1G4CA 2C2ZB 4PG6A 1KHVA 3BGLA 4G65A 4RNMA 2FC9A 4V1Ak 2ZH6A 4ZVTB 2MQQA 1HBUB 4O4RA 5ETQA 5EWEA 1YTYA 1S4EA 1FKAF 1X0PA 2ZDOA 3CJRA 3RR7A 4OZ1A 3IBWA 2E44A 2GCFA 2NCKL 2BDPA 5E3AA 2EBGA 4ED1A 1KC8T 2HHHF 3PFEA 2ZZNA 4DUZJ 4EO8A 4RBTA 3WX8A 4ECUA 3H98A 4KR0B 3TZYA 2DO4A 4DX6A 2HFSA 1KOOA 4KIAA 5CAAA 4FZVA 4HHUA 4OX6A 2HGMA 1RU2A 2XULA 4X4QA 3DLLQ 2BANB 3GILA 2FUG9 3L7OA 3CDBA 1LWFA 5D0HA 2N3OA 3CCMS 2RDDA 2UUBF 3DLGB 2DH7A 4CLYA 1RZMA 3HD2A 2H1YA 3PJ9A 3QT7A 5E3PA 4TU8A 1DRZA 1FVQA 2CRLA 4RJVA 4C48A 4Q43A 3D68A 4URSA 4CRJA 2RIJA 3N6NA 1N36J 4LR7A 5G0RA 3EZ5A 1S10A 5HBMB 3KYLA 5ETMA 1YRUA 1EKSA 3MR2A 1AB8A 5KFYA 2EC0A 4O44A 1RAAB 5L1JA 4DV6F 4C3KA 4HKQA 5E3QA 3C3LA 1WKKA 1LQ9A 3O2IA 1T95A 4Q8EA 4RW9B 3UD5A 2R9LA 3H5UA 1GX5A 1QE1B 4QYRA 3SI8A 2YNFA 1RBAA 2Y3YA 4CO1A 3NGDA 1NUEA 1SJRA 2VDHA 4RL1A 1NRKA 3KFWX 4Y0FA 4FVCA 4DR2F 4KE5A 3C14A 1R8BA 3HVTB 3D1OA 3TJ8A 4TVAB 3Q24A 1DAXA 3FBFA 4CH0S 3K5PA 4ZCLA 4CM2A 3BR9A 2QMWA 3DGVA 5AE1A 4R0JA 3PVXA 5ETKA 1JWWA 3IGNA 3CCQS 1K0VA 1EZZB 2UVUA 4JOUA 2CQ3A 1FJEB 2YKAA 1NB7A 1U2FA 4PCQA 1FKPA 4CLTA 2LXFA 3PRBA 4C3MA 1WHVA 2E5HA 2JOQA 3NCRA 5K8MA 5GAHI 2NS1B 3UD4P 4UQTA 1RT5A 4WE1B 4IR9A 3LGNA 2CVEA 1RYRA 2DHSA 2LA4A 2MLYA 4USWA 2O01C 2BACA 3FKBA 4N47A 3W9HA 4J9QA 3P4UB 4DSJA 3T19A 3ILOA 2BQUA 4KHMA 4ELUA 5FLXU 4RW7A 3HULA 3UD3P 3KJVA 4CWBA 5B0GA 1O6XA 4J9RA 2F65A 3GR1A 4JI4J 4DU8A 1LW2A 2XSJA 2V0NA 4KAIA 3ILJA 1C1CB 4ZVSB 3S8SA 1S1UB 1NDCA 2RJZA 2EFGA 4URGA 2OH2A 1TU0B 3CJ8A 5K20B 4K4XA 4IG3B 2H5EA 1HMVB 1S9FA 1SUQB 4OZJA 3F0NA 2LU1A 3IFEA 4ELVA 1X4CA 5KG0A 1WOPA 2MKJA 2BOPA 1U8WA 2I9SA 1AA1B 4IOAQ 3B78A 5KG1A 2M0GB 1EETB 2L9WA 3C16A 1PCAA 3NS6A 1F1BB 2VIHA 1T3NA 1TL1B 4DV3J 3NNHA 5AXLA 1SL0A 1H7XA 1F9EB 3BPSP 2VFUA 4H4MA 2V2KA 3OR1B 3TAMA 1SQGA 4B9TA 2EG2A 2V9KA 1QSSA 3QAUA 2IA0A 3IRXB 1UWAA 4TLRA 4AQYJ 1MNEA 4ZJQA 3PNIA 5KT5A 4ZHRB 1JMTA 4DPXA 1LXNA 3W62A 2DB1A 1D3WA 1UPMB 2V8HA 1FF2A 1EETA 4RW4B 3Q8UA 2MKHA 4U7UK 3G71S 1G2EA 1PKUA 3TA1A 2W7PA 4DR3J 1JXLA 4K5RA 3O3LA 2MLZA 2XCPA 3QWUA 1D9AA 4YDXA 5G4DA 4MIAA 2UV8G 2W9AA 5DGBA 3KLIA 4OI3A 2KXNB 3DCAA 1IM4A 2CUYA 4NX9A 3M9OB 4ED3A 1XC9A 2HBQB 3ONQA 5F8GA 3K5MA 1Q5VA 1NH8A 2F3JA 3TP2A 5DLFA 3N6LA 4R5PA 2DR6A 3OLAA 1XNRJ 4JI1J 3QLHB 2F40A 2F9JA 2JL9A 3IC1A 4P7TA 4DCOB 3TZXA 4JYAF 5LSRA 2XSFA 1RKIA 3RAXA 4GKKJ 3PYDA 3QIPB 1S6QA 2HAIA 2GGPB 2J9CA 2WW8A 2VFTA 3DDNA 3RUBL 1HNWF 2R8IA 3OJSA 1B7FA 4KGZB 4QW9A 1S1TA 2X7IA 1QAJA 1LNQA 3V4IB 1YJWS 2PA8D 3T1HJ 1F9FA 2D9OA 4LF5J 3O1LA 3D3BJ 2HQIA 4MIWA 4UUXA 2ZC4A 2UUAJ 3TZZA 1XMQJ 3MMCA 2G0JA 2DTJA 3QNWB 4NLSA 1FCAA 3K7RA 1TKTA 1R31A 4DJBA 3LP1B 2YKOA 3ZZPA 2ZJRQ 1TK0A 2AMCB 2BA9A 5AXKA 5HSPA 3KK3A 4YR2A 2MMYA 4FKXA 1NJZA 3BKUA 2R2SA 2KG0A 1V3RA 3HO1A 4CP5A 4MH8A 1U1KA 2KJWA 5BR8J 4YY3J 3BB5A 3MXHP 2B6AB 2HHXA 4C6AA 5J2MB 3FZBA 4LBIA 3TJAA 4JV2A 1FJCA 2M88A 2PD1A 1OPIA 1NHKL 4F4AA 1VBZA 1RLDA 3BV8A 3OHBA 1HWJA 3M9MB 3X1LB 2MHEA 1L3UA 1X9SA 2AYGA 1WJ9A 3L7UA 4K50A 1RBOB 3DYAA 2KHCA 4P7VA 1MROA 5KFMA 1U2RA 2POKA 4PXCA 1N36F 4QIFA 2E9TA 4IOBA 4OZ0A 4P71A 2WVFA 1C2PA 2XMUA 3OVBA 2CFXA 1AUDA 3W7BA 3H5SA 4WYLA 4JI3J 2NYIA 3IS9A 1HIYA 2GNKA 2XMJA 1IQTA 3M8WA 1H72C 4L72B 3EDRB 3GJQB 2GMHA 1U47A 1T03B 4O3SA 4LFCF 1TK5A 4N8OA 2ZOGA 5E3CA 3KG0A 1FD2A 2WOMB 3TRGA 3TQ1A 1DARA 5JMNA 5HAOA 3T1YF 2ZHBA 1BLUA 4IRKA 1NPPA 2GJIA 2V50A 2WVBA 5IOLA 4QR1A 1HBMB 3I5AA 5DDPC 2C28A 3FEZA 4FBUA 1PYTA 2DNHA 3C19A 4FP9A 1CJVB 4M5LA 4MYUA 2J0XA 1H0HB 3F41A 5ETLA 3QT8A 3OHAA 2F5GA 3AFGA 5KAKA 4ILRA 5H9FJ 3NGUA 4ZOSA 1IXKA 2W1BA 2R3VA 2DR5A 1VC0A 5HMZA 4P73A 5DRKA 5H1SV 2DRAA 2W4PA 3TQEA 4A8WA 3CC7S 1XNQJ 2L9NA 2UXCF 2CPZA 2DGQA 2Z58B 3LTOA 4GMKA 5CD4H 1K73T 1CULB 3HJFA 2ROGA 3B8HA 4E0DA 1CQNA 1BQXA 1UAWA 4DR1J 3NG8A 2OTLS 4EMDA 4ILMA 4QPXA 3LANA 4LVOP 3OTCA 1WUUA 5BYQA 1WF0A 4EU0A 1WOSA 4BHQA 4IOCQ 4C3LA 4O3QA 1GMUA 1CJVA 5KG4A 3FEXB 3BGRA 4BLGA 2KKHA 4A8OA 3EPGA 1RK8A 1DLOA 1LFWA 1RWKB 1T9UA 1FWPA 3GIMA 5GVQA 3CO9A 3KXDA 4UQGA 2J6UA 4LF4F 2Y8WA 4NI2B 3R9LA 2HNDA 2VZ9A 4CT8A 2B5JB 4DI6A 2QX0A 4NASA 3KLFA 2ZHAA 4QYZJ 1UW9A 2H65B 5L46A 1RHMB 2FTRA 1AXQA 2KYZA 4DPUA 1FFSB 1S9GA 2RRBA 3PHEA 3JB9k 4IG0A 3MEDA 4C0OC 2R8JA 3RR8A 1WC3A 5F8HA 4HT7A 1NMEB 1NZ8A 1XR7A 4X65F 1NO8A 2MYFA 1RP5A 2JLFA 2P6SA 2DVIA 3WHIA 3RGIA 2AJQA 1IUJA 3IRXA 1U1PA 1P1LA 4B9VA 4DR7J 1XEZA 2Q6BA 3BYPA 4IFYA 4DUYF 2C2OB 4K4TA 3DLJA 3W65A 5AE2A 2AYBA 2CG4A 3BJYA 5KFPA 1JLEA 1F2HA 2HNDB 2ZZTA 3DDIA 1IN0A 3V2UC 1BQMA 4ECZA 2CNNB 4R0EA 2IYGA 1VRUB 1OYDA 3KKFA 4LUBA 1UEVA 5HP1A 5E0OA 2E5JA 3OLBA 2OMOA 4ED7A 1N33F 4RW7B 1HL6A 3N01A 4Z7CA 4OX7A 2KHDA 3RBEA 3G8TA 3H40A 2HRTA 1FWLA 2UUTA 3IR5B 3M2RB 4OYOA 3QMQA 2AYMA 4P10A 1RTHB 4WK1A 4UOHA 4MKBA 2Y8YA 2OPPB 1JB0C 2QA2A 3N6MA 2LXUA 2OKQA 5GAEU 3W64A 3AXKA 1QLNA 2CZ9A 4NYPA 1PGZA 3QRQA 2MZ1A 1RT2A 2YNIA 3D0GE 2R7WA 2M3DA 4K4SA 2J8SA 2DGOA 1MLAA 4X4TA 4DUZF 1JK9B 3BO2A 1PC4A 4UOFA 2JLEA 1TL1A 3I87A 4HH0A 4BCAA 1YITS 3CNQP 2OP5A 1LWEB 3DGPB 3KG4A 5IV3A 3MM5A 3I9V9 3N4WA 2UV8A 4IRCA 3HHLB 2PI4A 4TLQA 3W2VB 4G1QA 1FDDA 4N41A 3I5CA 1H3DA 2RAQA 2JVRA 3KNGA 3I0RB 3V4MA 2BYCA 3LP1A 2H48B 3U27A 3D28A 1OY6A 3MUMP 3FSXA 3MCMA 4ZHRA 5LOQA 3OL6A 4CO5A 1F5AA 4W90B 4XO0A 2GA7A 3EICA 1G7CB 4OI1A 4ZITA 2L41A 3D66A 2YKMA 1RJJA 4TNOA 4YS2A 3CVKA 2V8DA 3HMJG 3TUZC 2RNEA 4DCJB 3M8RA 5AJ3F 1LWCB 1VCTA 4KRWA 4EBEA 2LMIA 1JLBA 5DZ6A 3W2WA 1U1RA 2VG5A 1NBEB 4ZLJA 2IMWP 2HIYA 4WTOB 2DRDA 3DRRA 2KI2A 4ZCKA 3HHLA 4E2FB 1K47A 2MPUA 5HQLA 3C6TA 5KOWA 1HBOA 2YXLA 1Y9OA 2BJ8A 1RAOA 4UOCA 1F6TA 4J9LA 4IQXA 2CAJA 1C0TA 4FNHA 3MGJA 4CCHA 4P9SA 3T1HF 3M8YA 4OI2A 4C8LA 4LRBA 2UUBJ 3KJFB 5F41A 1XQIA 3CEDA 1JQGA 1X5SA 4KGMA 1W2BR 3CCES 3RB6A 2D7SA 1HNXJ 2E5IA 4DR2J 2E7XA 1Q16B 3DOLB 1SBRA 1RWWB 3NEKA 3DFEA 3EZOA 1JJCB 3PYEA 4PABA 4USJC 2ZUAA 5KFKA 3K17A 1ZA2B 3T5HA 3VTIA 2LXIA 3OR2B 2HNZA 3PTWA 5DO2A 3MMCB 2KJVA 2KDOA 2KM8B 1KONA 4PWDB 4XK8C 1JLAA 1CC8A 1UEUA 4NE9C 1RKJA 3CJTA 1EJ7L 4LBHA 1FRMA 4F02A 2HPUA 5F3ZA 1RWPB 5FLXY 1N5VA 3I56S 4IH5A 5H9EK 2FJVA 2UXBJ 1C1BB 1R3NA 3CGIA 5IC6B 4E8UA 2EWHA 5B0CA 3ADAC 4I69A 3BR8A 2YH0A 2DR9A 3P8BB 4YOEA 3HM9A 4NLXA 3J7Z5 3NOCA 5HATA 2AX1A 5E5NA 4ED4A 2DD8S 4K2XA 5ETNA 2A0FB 3QRRA 1RU1A 1S7HA 2CJXB 3FVYA 1UL3A 2VG6B 5HVHA 5D0GA 4ID8A 1S0NA 2OPQB 3C6UB 1HQ2A 3FDSA 3ZTPA 1BUXA 1SC6A 1UZDA 3SSSA 2X51A 3HFZB 3HJVA 3CJSA 4CT9A 3I9ZA 3UCGA 3H4DA 5IT0A 1HD1A 5IQ6A 2WVEA 5IM0A 3RYLA 1VK8A 1XBWA 1S1XA 5DETA 3OUYA 1DLOB 3LWMA 2R7UA 3PKMA 1FJ7A 1T03A 2Z2MA 1GAOA 5AE3A 4FF2A 1IKVA 1YJVA 4JYAJ 3QZ8A 5LSLA 2B9WA 4ATNA 3NL0A 4ZVHA 4LFBF 1EKRA 2GO8A 1PC5A 1X9MA 3TW0A 1AUSL 3CJQA 5KFCA 2Q6CA 5K14A 2MZJA 1HWKA 1RT1A 2PE8A 3BH6B 3K8VA 2DGXA 4DS4A 5HBMA 1C1CA 1DY3A 2EEYA 2ZBIA 1NPRA 4FN5A 2OEKA 1VQ7S 3DMJB 2XBPA 3H4BA 4P2XA 5KTQA 2K1RB 3HHLC 4F3MA 3H20A 4DL4A 3I6PA 1FX4A 2M5YA 4DR3F 2YWHA 1VK3A 4LR8A 1IBMJ 2NUHA 2GS8A 1YJRA 2MJUA 4G1IA 4AT1B 3PW5A 1NKEA 1LXJA 4PKDB 3NWRA 4TN2A 1YLXA 5ETRA 4DV1J 2IIHA 3OW2R 4I2PB 1YQHA 2B7BB 1ZBTA 3I4HX 3CXCR 3PO5A 4C98A 1HHQA 2FJAB 4HH1A 4DBQA 2KH9A 3ELHA 2Q66A 5J1EB 4USMA 2C3MA 5F8IA 1UVIA 4LRCA 1FA0A 3N5FA 5EDWA 2EW9A 1Q7YT 4JI7F 3GG0A 2H54B 3BBFA 1QVFR 2W7AA 3M1VB 5FIIA 2IVFB 1DZ5A 4B3SJ 3DMJA 1IWAA 4O0NA 3JSRA 5J1PA 2GMLA 2A10A 2DNMA 1KWMA 3KLHA 5F9NA 3EX7B 1BY9A 2R7TA 1RGVA 4WE1A 5CYQB 1GFWB 1MMDA 1VGYA 2FZGB 3EVWA 3H0PA 3QT6A 4WP9A 5CCMA 3A1YG 3OL8A 1B0TA 1AT1B 3OVAA 4DFJA 1T8EA 3HSJA 3GIKA 1YZ7A 4HDGA 4J9OA 3DLEB 3BM7A 1ZYQA 3Q2TC 3PIOQ 1NNDA 4IG0B 4MK9A 4LREA 3VZHA 3GJSB 3KLEB 1U09A 3TAPA 3KLIB 3GG1A 4NXNJ 5IT9U 4A47A 3VAHA 1XERA 1LFPA 4B17A 5E2QA 1PAEX 1X5TA 3RJMB 4C8YA 2ROEA 3QSYB 4IFYB 4L75A 2VL1A 5KFAA 4MFBB 1LK7A 2HS4A 2EVZA 3HHKA 1RABB 1WDDA 5CYQA 1XMQF 1V5VA 2YPYA 3R27A 1S6QB 2Z2LA 1X31C 1X7VA 3BN7A 3V5RA 5T41A 3SSQA 3M9NB 2R2TA 2V8PA 1LWCA 1UJ6A 1UP1A 1CBKA 4C11B 4QIVA 2MY8A 1XR6A 3TJ9A 1IVZA 3LO3A 2W24A 3MM6A 3M32A 3TAMB 2RUSA 3PO4A 3AHPA 2B9XA 4YP3A 1TMJA 2L08A 4EGLA 2VQFJ 3T5JA 3LPYA 4KY3A 2OD4A 4DQQA 3H2UB 5ADZA 2VB6A 4DG1A 3DXBA 4UW2A 5D0RA 1HWIA 4DUTA 2UVVA 1URNA 1S97A 4ZPVR 2QSFA 3W66A 2AD9A 1SV5B 1TL3A 2V4JA 2CQGA 2RT3A 2E9ZA 1WOOA 2RRAA 3M2VB 2KYXA 2QG9B 1U02A 1YJ7A 2W2OP 1XR5A 3W61A 3GIJA 3R7NB 4ZKAA 3K59A 4B02A 5HN0A 2GVZA 3R5AA 5J2MA 3QPIA 2C2KB 3IR7B 4OV6A 3W8GA 1KFSA 2IRYA 4IH6A 4K0KF 4EFAC 1RB0A 1X4HA 4A8YA 4JI3F 3AJ2A 2BBEA 1OO0B 3HVWA 3I96A 4J91A 1G1XA 4AXJA 1K8AT 4XDCA 4URQU 1HBNA 2CNKB 4WU3A 2DT9A 3MEEA 2RSQA 1SV5A 3FNNA 1HLWA 1VLYA 1M5OC 4MT1A 1KD1T 2C2NA 4D3GA 4V19J 1UPPA 5J2NB 2HS3A 3BS9A 3A3OB 3NNCA 1WEZA 4OZ2A 2V4QA 3R2DJ 2F8MA 2X1GA 4OYBA 2R7RA 3A8JA 2KT5A 4MTPA 5KFTA 4QU6A 3G6ES 2U1AA 4TYBA 1S6UA 2RS8A 1EP4A 2ZUGA 3HVRA 4X4UA 5IT9Y 1OQ6A 2OGUA 2AX0A 1LV5A 2A18A 2RU3A 1RTDA 3T9ZA 3J81j 3LAKA 2MZRA 1ZZFA 1SB6A 2P9CA 1WDTA 3CJ4A 1HBMA 5KFJA 4KPCA 2JRSA 2F1FA 2X3DA 4CIOA 1FE0A 1UKUA 4FYVB 3UCZP 1NPKA 2HNYA 2YQ0A 4JV0A 3UN2A 5LMNJ 1RT7A 1NCLA 1WC6A 2FHJD 2RQ4A 2V63A 3UO0A 4FYDA 1YVFA 1NM2A 2NSBA 3CJ3A 1QUPA 3AY0A 5KT6A 2YQ3A 4MK7A 4DU7A 2DNGA 4PQAA 1UWBB 1XWLA 4JI6F 3EYZA 4WKRA 2LDYA 5JVHQ 1CJUA 3BBBA 1VRTA 4EK2A 2I38A 2J0SD 3P6YC 3BGOP 2V67A 5J2QB 4NEZA 4WZQA 4EUVA 3MDFA 3U1NA 2DGSA 1RT1B 2I6WA 1VQNS 3PEJA 3GFHA 2ZDPA 4MKAA 2XY7A 2AEFA 3MM7B 2HWHA 2ZD1B 5C42A 3HF5A 2AKWB 4QQBA 3TOQA 4DSKA 1WELA 1VQLS 4X64F 2HHWA 2RD5C 3R5DA 4Q0BA 1CQMA 4WTYA 2KL8A 3N28A 4QR0A 3G8SA 3RRHA 1IKWB 3IG1A 4RW6B 2FJDB 3ZC4A 4AYBD 4QYZK 3EPIA 1S1VA 3T1AA 2BANA 5DS7A 2WVDA 3LOUA 1JIHA 1KVKA 3T9NA 4M63A 4RZRA 3EXYA 4LIRA 3G96A 2ZH8A 2ZOMA 2QT7A 3CJ0A 3VR1A 5KFBA 5HMYA 2BKOA 2FD2A 3ET6A 2PGCA 2IVYA 3HLUA 3HT0A 4RR5A 2P8IA 4KGKA 5A0YB 2FY1A 4MMOA 1WG4A 3PYGA 3ZZTA 2HHHJ 2K7JA 2XI2A 4QWCA 1QSLA 3M6XA 3MM7A 2D69A 2MKSA 1SJFA 3PG9A 2EI5A 4WXWA 2DNNA 1Q8IA 2WK4A 3AD8C 2YWKA 1NU4A 2IM3A 4ED0A 4Y00A 1OWXA 3T6JA 4RW6A 2DR8A 2IAJA 4RW8B 1QE1A 2B43A 2HLUA 1WEYA 2YKQA 4JV1A 2LQ8A 1VRUA 1D0EA 1JNRB 5LJ3Y 1VC6A 2MQLA 4NWBA 4O3PA 3VGUA 4Q44A 3CPWR 1UA0A 4M5KA 5IT4A 3IBCB 4NRUA 5T14A 3DLEA 5B7WA 3GU0A 4XIUA 5GAEI 4NOHA 4I6WA 3HVAA 5KFSA 2ABYA 2NREA 3GONA 3M2RA 1WI8A 3TEHB 1V6HA 2OPPA 4EBCA 3VQTA 4OZLA 5B08A 3PW0A 2BX6A 3H90A 1HQUB 1Q53A 2PSZA 3AOBA 3PFOA 3K58A 2GAHC 2AGPA 2YNGB 4M94A 4ZMMA 3R5JB 4HI2A 2VPXB 4ZVGA 5KG5A 3J7AN 2XGQA 3V6KA 3JSYA 4ZLPA 1C4AA 2F8HA 1SJQA 1VQYA 2GHPA 4J9UE 4LF6J 1AROP 2H4WB 5FDLA 4YMEA 2BJ1A 4CNYA 4DV4J 4I2PA 2V34A 3OD2A 1HPZA 4NLWA 1HYSA 4BBYA 3BQ0A 4J9PA 1VQ8S 3B4MA 2E5LF 3UDVA 2F63A 3IRWP 4C11A 2V6AA 1TUGB 1H74A 3MR7A 4NLVA 4KH0B 1PILA 2DH9A 3G6YA 1SJ4P 2IRUA 2BJ3A 2IRXA 1X4FA 1WNEA 5DDOC 4IFVB 4YY3F 2XY5A 4FNIA 2XEXA 4PPZA 1VMBA 1ZA1B 4ETZA 2R7XA 4IG3A 2QYCA 1R6VA 2IDEA 3QO9B 2ILYA 2MZQA 2NLWA 2XYPB 1Y5NB 2IJRA 3K57A 2KT2A 5J2PB 4B3MF 4F2SA 2VODA 2V2QA 5LM7E 1VJQA 3NOGA 3UN3A 2ADCA 3UR0A 2J0QD 2V4JB 1ULRA 5L9NA 1FJGJ 4QIEA 4A8KA 4C7QA 2H51B 5D0EA 1FK9A 3MMAB 1W2IA 5GMDA 3GB0A 3DI6A 4ZJLA 4DL3A 2Z4PA 3D1HA 3GPAA 4LRDA 4TQRA 2G9OA 4F3OA 5KFOA 3VAJA 3DOKA 2CQHA 3KLEA 2VG5B 2DNYA 1I94J 3LP2A 4DF8A 2FVRA 3Q22A 4LIWA 4OYZA 3IM8A 3JYTB 1N5YB 4FF1A 4DOZA 1HBOB 4P2SA 4V19X 4AL5A 1ZM4A 2LQ5A 1VQPS 2MY7A 1R8CA 2QMXA 3F56A 3J7YI 1LK5A 2MDAA 2W2QP 1HBNB 1FDBA 3L95X 3MCSA 3LP0A 4KH1B 2QE5A 4ZJOA 4I6YA 2G1HA 4KC5A 1VC5A 4DV7F 1M5PC 3SV4A 2CZVC 3MMJA 3VAIA 3FFIA 1RT4A 1FK9B 1Y00A 4FPRA 3TYTA 4K5SA 3DI6B 2ZZMA 4ZCIA 4PQUA 2MHNA 5L8RC 5DQIA 4ECQA 2YKNA 2W9BA 1UETA 1Y5LB 1LWEA 4F36A 5A76A 2HZVA 4C4WA 3MM5B 5L38A 3FMBA 3LP2B 2QA4S 2NXCA 1L3SA 2HNZB 2DRBA 1PJ5A 4I4BA 3KK1B 2HS0A 3TX0A 2MQ8A 2QO3A 2JLGA 1O51A 5EGYA 3DNCA 4F26A 5A8WA 4YB1P 3QZ7A 1RTIB 1QAIA 1XMOF 1FESA 1NJXA 2ZM6J 3J7A1 2DK2A 3NGRA 3NXZA 1MWYA 2QTWA 4DFMA 4CLWA 2BVZA 1RT4B 3QGPA 4F25A 1T05A 2JHEA 3VAFA 1M5KC 1HNWJ 2BJEA 3M2VA 5D4LA 3SBMA 1QD1A 3O5TB 4R8UB 1UFKA 4LFAF 1Q4RA 2CJQA 2AJFE 2Z30B 1E6VB 4ZPWR 4F04B 4LFBJ 4JV5J 2I5JA 1VQ9S 3MM8A 3EM1A 2K06A 1IJFB 1U45A 3OFGA 3W5YA 4RNNA 2QFJA 1FERA 2BE2B 4I6AA 3S01A 1M1KT 4JI0J 3TR5A 5KFHA 3TWZA 5CXTA 2GAGC 1LEOA 2IHR1 2XYHB 3G87A 1B7YB 2NYHA 4TU9A 3OJUA 1TKTB 3RW7A 2E1MC 2KRRA 1L3TA 2C1EB 1RTIA 1DQ9A 1KNZA 2HEKA 2J9DE 2YX1A 3MR3A 4ZVPB 5IM0B 2PMWA 3M2UA 4X4SA 1JLGB 4IO1A 3KHHA 2MXYA 1TKZB 1U48A 1IKWA 3IG1B 2J6SA 3RBZA 2E29A 2IC3B 1QAXA 4MJKA 3ILLA 2JC0A 2QYGA 1OSDA 2ZWOA 5M2RA 3KHLA 3Q8PB 2FPHX 4F4XA 3IP0A 3OR2A 4ECXA 2BE2A 2AEJA 4OYPA 2I8EA 3R1HA 1EP4B 2LA6A 4CNZA 4OX9J 2ROPA 3EJMA 4OX8A 3MECA 2FZKB 2Z0GA 2Z57B 3MWBA 5ETPA 5K5MA 1MROB 5KFIA 3KLVA 2GW8A 5KG7A 1YRXA 1AYEA 3HZEA 5M2UA 4LF8F 3M6UA 4K4UA 2B8QA 3H2LA 1HHSA 3CCVS 2PA3A 1C1BA 2CKWA 3DDKA 3GIRA 2Z56B 1TK8A 3ULHA 2XY6A 3QWPA 1R27B 5BJRA 5EWGA 1SL1A 4Y2MA 1RT7B 1ZPWX 2XZWA 4QWAA 3IS9B 2RDJA 4A8MP 4EZ9A 4NXMJ 1B4SA 4AL7A 4ZPTR 3NBPB 1HHTP 4NXMF 4JI5F 4NXNF 1VRTB 2WZ1A 3UQSA 2ILZA 2QRRA 3CT9A 5LMUJ 4K4WA 4PG7A 2OPQA 2XS7A 1XNRF 5C2CA 2F9DA 2A2DA 4X4OA 5G0RB 3MD1A 2JEFA 4OMFG 4FF4A 3W5ZA 2F4VF 1SPBP 2OEMA 1NSAA 2Z2ZA 2ZBPA 1KVIA 2GO9A 2BJ9A 3GCXP 5HL7Q 1HQUA 5CD4A 4ZPCA 4HI1A 2H9ZA 4UT4A 2FIUA 2GQQA 2OPRB 1HA1A 3ETOA 4RWXA 4ZP6A 3NGKA 4M1KA 1SIZA 4EO6A 1EAYC 3BQ1A 3ZTQA 3RAMA 5BYRA 1FNOA 1RWNB 1T0TV 4PXDA 1R7IA 3GFYA 2D3UA 2K3KA 1VQ4S 4DSIA 4PXEA 2XZTB 1JLFA 1HPZB 3EGZA 3DM2B 1CULA 2JFDA 2XCAA 3TAQA 3LQVA 4L6V3 1NK9A 1RWUA 2BRLA 4HLBA 3GJRB 2JEIA 4UTGA 5EHHA 4YN3B 5K14B 1NHVA 2OUGA 3AA9A 3QFWA 1U0HB 3MPYA 1T3OA 2HURA 1OYEA 5A6PA 3PYFA 5GADI 3IO1A 4IR1A 3WIUA 3R5CA 2N82B 4RUAA 1JJ4A 3HSZA 4KHRA 3TUIC 1PO6A 2UXDJ 3VVUA 2M9KA 3JSMB 5J2PA 4ZDNA 1KTQA 2DHAA 2IAJB 4AD6A 2XC9A 3IBFB 3K89A 1CJKA 5LT5A 2L3MA 3MUTP 3LUYA 1V9OA 1H2VZ 5JUMA 2AGQA 1CVJA 2XNQA 3MMAA 1VQOS 2JJ4D 4B3TF 1G6BA 1T9VA 4P75A 2BE9B 5A8KB 4OJ1A 2PFFB 5A6WA 2HZCA 3J80U 2B9YA 3C46A 1FTRA 2GX8A 1NZAA 1LW2B 2XSJB 3H8YA 4X66J 2H4YB 5HQ8A 2C2EA 1N48A 1RT6A 1URRA 2G2YA 2GVDB 2RQKA 3NAIA 1TFWA 4AL6A 5L1LA 3KK2A 1WSVA 5F8JA 1VQKS 5DG7A 3E51A 4A4JA 2DHXA 2VFVA 7FD1A 3N79A 2RKIA 2JC1A 2LP4A 4LF9F 2CYYA 1ZAWA 4HL9A 3UNGC 4IYQA 2NZCA 1VOMA 4C0BA 1BD6A 5FDLB 2CZ4A 3H7HB 2FB0A 4ILLA 4CLFA 5D3GB 2HK2A 3MMBA 4NLRA 2YKNB 2W9BB 2LDIA 4X65J 1HQEB 2W01A 4H4MB 3OR1A 2WTFA 2WRMA 1T11A 1SC4B 1QUVA 1IJEB 1EX8A 2YX7A 2LEBA 1SI9A 4ZP8A 3BGFA 1S6PB 4PUOA 4FXVA 3M05A 4N5SA 1JLQA 5DDQC 1T9XA 1LW0A 2QLBB 2ZH9A 5KG3A 3PACA 4AQYF 2O5DA 1AW0A 3FBBA 3BGUA 2VHGA 1TVRB 2BE7D 1X5OA 4P74A 5F8LA 1Q95G 3E3XA 2ZM6F 3M4XA 1QVGR 3CJKA 3K8WA 2XMMA 3ZZRA 4UOGA 1NH7A 2VASA 4DV2F 1JJ2R 3DLBA 4OI6A 1N56A 4IKAA 1FXRA 2XMVA 4CI0B 3B54A 3CSKA 4NPOA 3M8QB 2FHOB 1M1HA 3VGSA 2W25A 4ID5A 2XMTA 5JVGQ 1IBLJ 1H98A 2VC1A 1FXDA 3GMGA 4QZVB 3QFHA 4M5NA 3UPFA 2Z8QA 1B0PA 4M95A 4F0HA 2PO4A 2LFVA 4CZCA 4F0KA 2MZTA 1X0FA 3ZTSA 1S0OA 3Q8QB 2VDIA 4WF9Q 2HBZB 4PZVA 4I67A 1MN7A 1S0MA 1YKWA 2OTJS 2MEWA 3AT1B 3D5MA 2GGPA 2RMLA 4C8MA 3HHDA 2YKMB 2V2ZA 1H6KX 1RCXB 4PG4A 2DXEA 3J7ZT 1HNZJ 4G3IA 1TKZA 4PQUB 4WPAA 4KV8B 2HVDA 3L9ZA 3GV8B 3W9IA 1VRQC 3VQSA 3PDNA 3DHXA 4UY8T 4KHPF 3NGTA 1EQ0A 4U9RA 3POTA 4QIWD 1U2CA 3MOJB 3H42A 1XMOJ 2JVOA 1TL5A 2A6OA 3M8QA 3HHEA 3R7SB 3AOAA 4LQ3A 1GK8A 2XI3A 3GYXB 5KFWA 1S49A 2O3DA 3R7BB 4QWDA 1KOHA 2DGUA 3MECB 3HHLD 5HROA 4LQ9A 3SFGA 3W9JA 2C22A 4TQSA 3LW5C 2ADBA 5HO4A 3OPKA 4U96A 2XLJA 3MEEB 4HHJA 4K8RA 3TA2A 2UP1A 2B4OA 4DCPB 1RI7A 4RX6A 1YJTA 3NCQA 3V81B 1B70B 3UVJB 5AJ3J 3S7RA 3R3TA 2W8KA 1VBXA 4C8OA 1PYOB 1I1GA 4L73A 4O3RA 4U95A 4UZBA 1Y10A 5DJBA 3M8SA 3DOLA 2ZH7A 2BABA 3UE2A 4RNHA 1NSKL 2HBRB 1ZAVA 1KRPA 4WP3A 3JAMU 2V4RA 1U49A 4ZVFA 4ELTA 1EARA 1H73A 2FLOA 2AHOB 1L5UA 3KJNB 2DIVA 2VFSA 2YWEA 4PWDA 4TY8A 1XMBA 4RNFA 1TL4A 2YX4A 5CCLA 4MK8A 3WC2A 2KZMA 2CPDA 3F73A 1RA6A 4Q5VA 1HR0F 2VFRA 2XLKA 2J9DA 2HVIA 2O1PA 5DDRC 3LF0A 2W7OA 1H7WA 2B4UA 2CQCA 4QIGA 2RS2A 1JX4A 2VBXA 4DPTA 3MOZA 3HI9A 4OX9F 2KN4A 5DGAA 4RW8A 2NXUA 4LMZA 4QCLA 1HNIB 1H2TZ 3A8EA 2ZE2B 4KKOB 1WWHA 3TEGA 5IWAJ 3B82A 2FHJA 2P5VA 2DCUB 1JLFB 4ZPBA 2VPZB 3AOCA 1DTQA 2VG6A 1BWVA 3D0IE 2AJ2A 4QR2A 5LJ5Y 1YHQS 2WOMA 1U1OA 1WG5A 3BYRA 5BR8F 2QA4G 2FGOA 1VHFA 2YY3A 3FBEA 3TANA 5K8PA 1S9EB 1K9MT 1N5SA 2ZD1A 5C42B 1GMVA 2PMHA 3MEKA 2P9GA 4L76A 5D6GA 3O44A 2CIMA 2GC8A 3CD7A 4F4ZA 2BJ7A 1HI1A 1NDPA 4JUZA 2XLIA 3JSMA 1QY7A 3QSIA 4H4OA 3NWGA 4P52A 2A6MA 5I3PA 1I51B 4K7QA 4WKYA 1EHWA 2MTLA 4DZDA 3BF4A 1SKRA 2YNFB 1KLMB 2HHTA 2I1RA 1DFDA 2ZE2A 4KKOA 1I6JA 2J7WA 3RW6A 1GTHA 2CQ2A 3DU5A 2DNLA 3Q23A 3QGHA 1RHRB 3CCSS 4PYAA 1XNQF 2Z2YB 3C14B 3ET6B 3I0SA 3IWXA 2R8GA 2OMLA 1IBKJ 1ZTTA 1BGXT 5DZ7A 1TP7A 4DV1F 1U24A 1S79A 2BW2A 2UZAA 1S57A 2GJFA 3QQCD 1IBKF 2ZOFA 1RT6B 5C7PA 1NJYA 2RF2A 3S6EA 4WZMA 3IAM9 3GJTB 3KUEA 3QO9A 3KWMA 3E01B 3RRKA 3CD6S 2WHOA 4DZ6A 1NB2A 2VC0A 2ASYA 3QATA 2MZSA 2OPSB 3PCOB 2G13A 5JJBA 3BKTA 2WCXA 1T9YA 1FFGB 1S7IA 5KFEA 1KKHA 1RHKB 2G0CA 4DL7A 3DC2A 3MMBB 3H25A 3T3FA 1S72S 1FI4A 1JXVA 3EXCX 1ZM2A 4YQWA 3KHRA 2HW3A 3EGNA 4HACA 5IV4A 1D09B 3GSDA 1PG5B 1APSA 1GXTA 3W1YC 2EG1A 4KT0C 3PR4A 4BDPA 3PX0A 1H2UX 1N5YA 5K8NA 1RDRA 4DV0F 1VBYA 2MQPA 3ZTRA 4B9NA 1RAFB 4ZVQB 2E66A 1LW0B 1Y3JA 1KQFB 1Y0HA 3A3PB 4NZ7A 3LP0B 2Q79A 3PZPA 3PRDA 4A48A 1JLEB 1U1MA 4BS2A 4BWJA 1M1GA 3KDNA 1BQMB 2CG8A 2CPEA 4L3KA 1SKSA 5D15A 4WCEQ 2H3EB 1O0PA 3SDEB 3K2YA 1F5BA 3Q8VA 1NDKA 3CJKB 2RQCA 2CPHA 3PW2A 1TKXB 2ZNZA 4WFZA 4R25A 3PR5B 2NXEA 2N4DA 3DU6A 1R0CB 1NK4A 3GIIA 4B3SF 4N76A 3L3CA 4XAKA 2BQRA 2V9WA 1GH8A 4DL5A 1RTHA 1RADB 1ZPVA 1M90T 3HXMA 3DRSA 3E8OA 4Q7AA 4DN0A 1MSWD 1X4GA 5KFFA 1GX6A 1IR0A 1Z2ZA 5I42B 2EK1A 5KG2A 3X3UA 2DBBA 3UN5A 5A8WB 1UVLA 4MFBA 1AZSA 1J27A 2RKIB 2IFXA 2RQMA 4ZVUB 5BYSA 2LCWA 2NZ4A 1F9HA 4U8YA 3G82A 1YG0A 3FRZA 1ZOTA 3CCWA 1T05B 3EWGA 2F8EX 2J7KA 1P9YA 4RPFA 4DR7F 3CJ5A 4B9LA 3PJXA 1T9TA 3MPWA 3U7JA 3LAMA 4Q2LA 2WW4A 2JZ5A 3MURP 3CCLS 2NSCA 1YIJS 1SKWA 2HHUA 2B4VA 2H5JB 2MJNA 3JYTA 3DRSB 2XHCA 1S6PA 1HFEL 3M6VA 4Y65A 1JLQB 1RWMB 2ACMA 3CD5A 5IZHA 4ALZA 3MFIA 1RT5B 1UJ4A 2DNPA 2XM3A 2YNHB 1TL3B 4USVA 3MEGB 5CA5A 2ZH4A 2PEHA 1D9FA 4FBTA 2EC2A 3UDLA 4K4ZA 1HWLA 1O5JA 3OSNA 1S1TB 1R89A 3OXGA 3PV8A 4UUWA 1FRKA 4KO0B 1FNXH 2LECA 2VPYB 3W2WB 2QC3A 1DURA 2MSSA 1UCNA 2F4VJ 3LH2S 3OBIA 4ID5B 4NCGB 1RCOB 2ZBCA 1KDNA 2HSEB 1N4LA 1SUQA 2F4FA 4UF4A 4U6PA 3U02A 1QSYA 3BQ2A 3BSNA 5RUBA 3T41A 1PIEA 2G2ZA 4PEOA 4NYOA 4OYXA 1CC7A 2KM8C 4Q45A 2BM0A 3O8WA 1VJWA 4ICLA 1DTTB 4LVNP 3H59A 2PFDA 2VQEJ 1FHTA 5CQGA 3I5BA 1FNMA 4O23A 4CO4A 2ZH3A 2IM2A 1E6VA 1WHYA 3LPEA 2FVSA 1M5VC 1H38A 3G6XA 1N52B 2LEAA 3WC0A 1NKBA 4LF4J 4Z7YA 2Y1IA 1Y7PA 1S77D 4GVLA 4YHHF 1ELOA 1U7LA 3VV2B 2BKNA 4USIA 4UZCA 2Y1JA 3NRBA 2ASLA 3G9CA 4DR6J 2QZ8A 2ALZA 4YHHJ 2HHVA 4OJGA 1RTDB 3UR3C 3WBZA 4CH7A 1NAQA 2PI5A 4GKJJ 4DV4F 1U6ZA 1OS5A 2C3PA 2CJYB 2QGFB 5CZXA 2OIHA 4LSNB 1J2VA 3SCJE 4ICLB 2AJ0A 3FJ2A 3UVJA 3KG1A 4YB6A 4ZVEA 4O4GB 2EK6A 3JTNA 5AXNA 4KGVB 1FKOA 2LLZA 3BKFA 1NSPA 3TVYA 1L3VA 2ZNYA 3PX6A 3US5A 4CDIA 5DM6Q 3PX4A 4CLSA 2PT0A 4HYKA 2E7VA 3EUNA 3FCVA 3HFKA 1U0SA 1IR1A 2BM1A 4PPDA 5SZTA 4DR1F 2WBRA 5F9LA 1YGYA 4HTJA 3UDEA 3THTA 2MQOA 1NDLA 1TZ0A 4N56A 5D8HB 2GZOA 2ZKUA 4I7FA 1FWKA 4XPEA 1P6TA 2DNQA 3MHYA 4ES2A 1U25A 5KFDA 3LA0A 3QLHA 5HANA 5GAGI 2W9CB 4DLGA 4ZVOB 5IWAF 4LF1A 2A1BA 3IM9A 4DSLA 2BKPA 1FVSA 4DX8H 4E98A 2XS5A 2G4BA 1CSJA 1K0TA 4JI6J 3TVZA 2NR0A 2OEJA 4JI8F 2ZITA 2RB7A 3UW1A 4KBIA 5K9FA 1PAUB 3SCKE 4L3NA 1NJIT 3KOAA 3H2VE 4I68A 3VZIA 4DV5J 3D0HE 1UMJA 4N7TA 1SH2A 4ZIWA 1UFWA 3BSOA 3I4PA 2FLLA 1REGX 2W2NP 4HACB 4DXLA 3CCRS 3D6FB 3OTEA 2VICA 3M30B 2G2OA 4KHPJ 4KTQA 4FF3A 3KUGA 3VGTA 2CPYA 2CPJA 2VKZG 2CNLB 2H5IB 2LQJA 5MAOA 3PKYA 2QL7B 1X4BA 2GV1A 1WHXA 4JI1F 4H4OB 2FLNA 4Y2IA 2DHHA 2B6AA 4NA2A 2XZDB 1VIXA 2VOOA 1IBMF 2PEBA 7AT1B 3DLKA 2BR0A 3J81U 2XMAA 4A8QA 1S76D 3M8PA 3IN5A 1UVMA 1D1UA 3PW4A 1IBLF 2KFNA 1RT3A 2HQDA 4ZPDA 2DXFA 4OYIA 3C15B 2M52A 1NLKL 3MEDB 3UFCX 1RAHB 3THVA 2GIFA 3SCLE 3DRYA 4J9VA 4QWEA 5F0UA 4NCBA 4OJHA 2IVMA 1ICEB 4DDFA 2C3OA 3FMWA 5ITHA 2ZJQQ 1S5ZA 4GKKF 3OFFA 3BREA 5B0BA 4DSFA 2RF2B 2FVPA 2PIIA 4PYDA 2KG1A 3TUPA 3ZZOA 1F60B 3E01A 3SMZA 4XDDA 3OT9A 5I4MA 1ZH5A 2JDJA 2GQCA 1T9WA 1LWFB 1GTEA 1KBRA 3D4JA 5KFUA 2WB4A 4AFFA 4P2FA 4CO2A 2IY5B 1ZS6A 2KB2A 3EGVA 2I0XA 1HYSB 2FDNA 3I32A 5D4NA 5EX0A 3HP6A 1R0AB 8RUCA 2LEPA 3D54A 3CMAS 5F8NA 1SIWB 3BZQA 3BN4A 4ZCMA 2DNOA 4B08A 1UA1A 2M4MA 2JSXA 1P8GA 4RUBA 4B3TJ 2HHQA 4TKTA 1WTFA 4K4YA 3GFXA 4IQMA 5GADU 2N3LA 2BV3A 3ISND 3KK2B 1YSJA 1WACA 1HW8A 2F7VA 4Z37A 4C8NA 2W2MP 1VBKA 4ECVA 4LF6F 7FDRA 2AQ4A 3MM9A 4A8XA 2XGPA 4HR2A 2B51A 5C24B 1OJ4A 1TKXA 2DHGA 4RWWA 5HJXA 3R8YA 3RBXA 3SYZA 3W3SA 1DHMA 1MW7A 3DGPA 1SC3B 3NS5A 3DOKB 2BJDA 5J1NA 5KG6A 3WQPA 3B6BA 3P5TL 5CHCB 4X2BA 3AJDA 3D1QA 2EKNA 2HFZA 3BGRB 2OSQA 4C9DA 1IWGA 1TTHB 1SL2A 5DG8A 5I42A 3I0RA 1JJHA 3R5GA 4JP8A 3CF5Q 2DPIA 4O3OA 2AYEA 2MLXA 3PHTA 1Q0NA 2CQ1A 3BSCA 2X1BA 3ZO7A 1KFDA 2QJ3A 2WBMA 5M2PA 2UUWA 2HWIA 5I3UB 4J9SA 4FXDA 2BRKA 3MZIA 2C2DA 4USUA 2R7QA 5HLFB 1U26A 2IPOB 2OD6A 2DCLA 3L7PA 1PBAA 1FXLA 3MAAB 3G4SS 2WSCC 4Y6IA 3G6VA 1B0VA 1FX2A 2Y0SD 4X4VA 3NKYA 2YWWA 3ZZ0A 4BC7A 3A8IA 1FRJA 1YWXA 2DY1A 3ZNJ1 2WSFC 2YTCA 4H4KA 4X4PA 1GEHA 6AT1B 4ED6A 1FT8A 3VAKA 4F4YA 5E3RA 4F7VA 4OIXA 3B4DA 4DV7J 4DR6F 4F2RA 3R1LA 2WVCA 2DKOB 4F8RA 2VUGA 3HFVA 1NK7A 4GKJF 1X5PA 1ITPA 2LQ9A 4RLEA 3MR5A 1S48A 4TYAA 3KHGA 4WFYA 2R4FA 4DQIA 1NXIA 4ANEA 1FKOB 2J0WA 6FD1A 3RRGA 3MPDA 2ALYB 4R8UA 3M8ZA 5KT7A 3GQCA 2VKRA 4LSZB 4KO0A 4M5GA 5GAHU 1SH3A 1WC4A 2HRUA 2KVQE 4DX5A 2KFZA 1KP6A 2UXDF 1CLFA 1OIAA 1R8AA 2ZVIA 2HYIB 3NCPA 1TKDA 4RUHA 1ZAXA 4CTAA 1YBUA 3FK4A 1HNVB 4IDKB 1GT8A 1P9QC 1JLAB 5B09A 4X62J 4C8ZA 2FYXA 4M5MA 3QT5A 1QJHA 1SKUB 3GYGA 1RTJA 1J5EF 1S6OA 2UUCJ 1S9EA 1MWZA 1MU2A 2RHSB 3DRXA 3NS7B 3PM9A 2P2CB 4CO3A 2FY8A 3RZAA 3K5NA 2KFYA 3V81A 4B9SA 3R6LB 3BDPA 1N88A 1S1WA 5U47A 1TAQA 1TV6B 1HW9A 1SH0A 3CDAA 3AJ1A 2NPFA 4QJVA 2QMUB 2OFHX 3CTRA 4EEYA 1UWBA 3A3NB 4EYHB 3N5BA 2DNRA 2Y9HA 1VDHA 3HSGA 4U67Q 4F4WA 3QYYA 4YB7A 2AZ3A 3P3DA 1T02A 2ATLA 2FHMA 2D3ZA 1M0SA 3JQJA 4ANDA 4OLOA 2UU9J 2X1FA 4KFBA 2MGZA 3ENVA 5KT4A 2OLWA 3FQKA 3AB4B 3RB0A 4NZ0A 2HMIA 5KFLA 1MWQA 3VF0B 3CIMA 1S1XB 4DHVA 3OUYB 3A12A 1UW4A 2EFVA 2ZWPA 4QOTA 1RTZA 3CJ2A 2APOA 1KEKA 1WC5A 1YBTA 2QLWA 2W4CA 4J90A 2VG7B 2HBYB 1Z1ZA 3BH7B 2GMJA 3OVSA 2HFUA 3JTPA 3IWNC 4O0IA 2DR7A 3GWCA 4B9MA 4JI7J 3M8PB 5A2QY 3NMAA 1RT3B 1P27B 3QGIA 4LF8J 3C15A 3IGVA 5THWA 4C2MA 1TQLA 2HWTA 3GCWP 1C0TB 5KOXA 2N7CA 3D3CJ 3HKWA 1KN6A 3KMQA 1FRHA 1S12A 2Q1LA 2CQPA 2IYIA 3U1MA 2W9CA 1UEKA 1WEXA 4W4MA 2AT1B 1Q8LA 2HQGA 4W92B 4ED2A 4F3QA 9RUBA 4Z2XA 2AP6A 4NMXA 4DV3F 2DJWA 3NMRA 4W98A 2OHDA 1KLMA 2FQQB 4MIBA 3WX4A 4N77A 4DR4F 3CMQA 5CABA 3GR0A 4OI4A 3R6GB 4YDDB 4KSEB 1R0BG 1W25A 1F5CA 5KT3A 2AJ1A 2IJFA 1REVA 1EB0A 3JQKA 5LXYA 4H54A 4NMLA 2EFOA 2VBYA 3L4BC 1R8HA 2ZKTA 2CQ0A 4FVMA 1PJ6A 4USTA 2L48A 2N4CA 1TELA 4FS1A 2DXDA 3HCXA 3W63A 3AD7C 2DGVA 2X1AA 1G3OA 1RWOB 4I2QA 4B3OA 2HQ3A 4OYWA 4USHA 3T5KA 3TI0A 5T7LA 2FJWA 4K0KJ 3ZFVA 2E1RA 3MTKA 2KO1A 3HK2A 1FRXA 3ZXWA 1DBDA 2C3UA 3MF5A 2OPSA 4ZVRB 2HQFA 2DPJA 3R2CJ 4ITSA 4EYIB 2E9RX 3C6UA 4I0WA 5D77A 5IFMA 1WC0A 1IBCB 1VHIA 3TUJC 1Q78A 3A8KA 5A8KA 5IS2A 3OV7A 1BMQB 3ZZZA 1EQMA 3MFHA 2E5LJ 3BSAA 1NK8A 1KS2A 4ZIVA 3TZWA 1K1SA 4I2QB 4B3OB 4DL2A 3TVKA 3K0JA 3GLJA 2CA9A 2FVQA 2XMWA 3CC2S 4ECSA 3E2EA 2R2RA 2YPZA 3I82A 3QGGA 3OTOF 2AW0A 4MAKA 3HPOA 4DQRA 2ZHOA 4QW8A 1DJ0A 1WC1A 2VV5A 2YNHA 1N54B 3BBCA 4G1PA 4WWSA 3K5LA 2QL9B 1U1QA 1FE4A 2RRNA 5F3TA 2JEJA 4WU2A 3FCHA 5HQMA 4DUYJ 1VQMS 2FHKA 4K2JA 3H5YA 1RXOB 3KDOA 3MAAA 1RA7A 2EBEA 2B0GA 1HARA 1SQFA 2HVZA 3D6HB 3NLCA 1RAIB 4FXWA 1P1TA 2AEMA 3M32B 1N8RT 5HMWA 1U1LA 4JI8J 2XO6A 5FD1A 1HNXF 5DLGA 4NCGA 4PWUA 3KLGA 2RVJA 3VAGA 4C0HA 2BUNA 2KRBA 4ECYA 4A8SA 3TX8A 2R7SA 5H9FK 4KB7A 4CQ1A 1RAJA 2HFVA 5JXSA 1VQSA 3G82B 1ROFA 2NUUG 1FO1A 2K8GA 1R8PA 4NLTA 4NZ6A 1GXLA 4WBFA 3OL7A 4KPYA 2KU7A 2D3OR 4B3RF 1TAUA 4PWWA 3TO8A 5J1EA 4X64J 2BOAA 1OY9A 2NPIA 4OQJA 5IQQA 4B3RJ 4S0MA 2G1DA 4K59A 4FS2A 2FJBB 1S1UA 1RISA 2BQ3A 1CEZA 2O66A 4WYWA 4IDKA 2HG4A 2M8HA 2V2VA 4NEYA 3CDWA 3FZ2A 2HFNA 3ZTOA 2VONA 1N0VC 2MB0B 4LSNA 3IMQJ 1N5QA 4FDFA 4ENOA 2XQCA 3DLHA 2ZBQA 2XS2A 2DEJA 2D74B 4FYWB 2OJ3A 2BZ2A 3KTQA 4DR5J 4KV8A 4ZS6A 2E5GA 4TXSA 3WZ0A 3J81Y 2K3IA 4X4RA 2JFKA 1Y5IB 4NLDA 1WTBA 3QBCA 5LXRA 3AQOA 2AZ1A 4QBUA 2VH7A 2UVRA 5EWFA 1FDNA 4I7FB 3AQPA 2HAFA 1JKHB 1Y3KA 2HHPA 3OL9A 2JWNA 4F67A 3SEOA 3AODA 4XPCA 1Z2LA 1M5HA 2N7YA 2XHWA 3ZZUA 3P96A 3FSIA 3CO0P 1DTTA 1XN9A 3CWJA 2DISA 1WI6A 2M2BA 2QLFB 4RU9A 2BMBA 4CH1A 4QWBA 1I5OB 4UY85 3D7SB 2V8VA 5LSOA 3HZGA 3GV7B 2IC3A 4DX7A 3MM6B 1N34F 4DQPA 3Q8YA 4IUFA 5KFGA 4YB5A 4WFNQ 2HVEA 1NSQA 4M5JA 2D9PA 4FYXB 4HVZA 2V5HG 5E33A 3G2XA 3W2VA 1N34J 1N32F 1HNVA 4DG1B 2BEFA 1F0XA 3EVMA 3SQGA 3I55S 4DWIA 5EN1A 4TY8B 3TARA 2W4DA 1R6YA 8ATCB 1RTJB 3VAMA 3SV3A 1MMNA 3QJPA 5ETVA 4Y3CA 1N6QA 1S1WB 3RTVA 5HI7A 4Q0BB 1TV6A 2VOPA 1W26A 2GVZB 3GZ7A 1KQKA 1TUVA 1SVDA 1IKXB 2B56A 1HNIA 1V3ZA 1Q1KA 3FRYA 3NBPA 3KMSA 3DLKB 3ILIA 2P6TA 4PRFA 4ZPAA 4DR4J 1HI8A 4WIQA 2VA3A 2WONA 5C2GA 1TR0A 2NXJA 3CDEA 1REVB 3HSDA 4I1TA 4YR3A 1IR2A 2ERRA 3HHNB 1SXLA 2DO0A 2VU5A 4CO0A 4M8LA 4YEAA 2CJ9A 2LKZA 2FJEB 4RNOA 3A13A 2K2PA 4OI0A 1S99A 1WF2A 4AE5A 3N0VA 4KQZA 1HWUA 2QL5B 1B99A 2RDIA 2HMIB 4XTTA 4TY9A 2HHSA 4JB8B 1SCJB 5E41A 3ISZA 4Y28C 4QPTA 4DQSA 2QSWA 1BQNB 1MN9A 1X4EA 2MKKA 4NLOA 4JI2J 2JH3A 4YUDA 3D67A 2QIFA 2XWYA 1U6FA 2V69A 3AD9C 2CVIA 2VBZA 2XMKA 1IKYA 4GO5X 4CLKA 4ZLLA 2UXBF 3JQMA 1YJUA 1CPZA 3GTYX 1J5OA 1YBAA 3QAEA 3V6JA 3QJJA 1E6YA 1UFLA 3M7VA 4OFZA 1YZ6A 2OFGX 3EVOA 2QA1A 2C42A 2Y1LB 4IH7A 4NLPA 2DGWA 4OHZA 5A2QU 3FSYA 1QM9A 2FC8A 2VJVA 1Q5YA 1NK6A 3GYNA 1CJKB 4NLGA 1BQNA 4ECWA 4X84A 3Q8SB 1SJ3P 1TFYA 4A8FA 3EMTA 5J2QA 1D9DA 1VFJA 4HTIA 5ETSA 3GE9A 5C25A 4DEZA 3OTBA 2J8AA 5MLCV 4DFPA 2VA2A 2JX2A 3CB4A 4OL8A 4Q2MA 3SIPB 1YDLA 2IM0A 2X3GA 3SFUA 2W8LA 2B8PA 5CYMB 5L1IA 1GMWD 1RUSA 1E6YB 4O44B 5KFRA 2GHWA 2VPWB 5DG9A 4WXOA 4U7UD 2MKIA 3DRPA 4YR0A 4QU7A 3C8YA 4AXIA 3AH6A 1HD0A 2V94A 5L9XA 1S1VB 3HX9A 4ZLNA 2YBVA 1YX2A 3M6WA 5I3UA 5D78A 1A0OB 3ZZYA 1IKVB 1BC6A 3U1LA 2KT3A 2QEXS 1UTAA 5F0WA 3NNAA 4NL5A 5A0YA 3AA8A 3UCUP 4FKYA 3JAMY 2Q43A 5KFNA 2XO7A
chains in the Genus database with same CATH topology
1HQEA 4X62F 4C97A 3RB4A 2RILA 2OSRA 1RQ0A 1NKCA 4PG5A 1Q79A 1B64A 4ECRA 2UUCF 4J9NA 3CCJS 3BEGB 1NJWA 4LF5F 4PUOB 3SXLA 2L9DA 1XTZA 2ZH2A 2CQDA 2ZJPQ 2ZC3A 5B0EA 1TVRA 4JV5F 3MM9B 4X66F 1VIOA 2AV5A 3FFIB 4F4KA 3GV5B 4PXBA 3CE8A 2YVSA 2IJNA 1UVJA 2DGTA 2C3YA 3MD3A 2JEGA 3AAWB 3VCDA 4F50A 2CQ4A 3M1VA 4ZP9A 2E1AA 1VI7A 4RUCA 4WIIA 4AUKA 1JKHA 1YJNS 2YNGA 5B0AA 3OFEA 3F44A 4ES1A 3J7YU 1A9NB 1Q7LB 4HEA9 4MKYA 1MU2B 2OO4A 2EPIA 3MAQA 4RBVA 3O6QA 5KFXA 3Q0AA 5CYJA 4K4VA 4PG8A 2M8DB 1HNZF 2SXLA 3RBDA 2LVWA 2ZH1A 3ITHA 4NYZA 2FJXA 4J5OA 2IBOA 5D4OA 1Q86T 3SQGB 3QIDA 3UWTA 1O8BA 3G8QA 4I56A 3DHWC 5DQGA 2CPIA 3I31A 1X9WA 1F2GA 2FLPA 1NEEA 3IA0A 3LALA 4IO9Q 2ASJA 3CMES 2GFFA 4Y2KA 4RU2A 1UVNA 2YWFA 1NHUA 3M2UB 1C0UA 3FEYB 2XNRA 1FRIA 1FDAA 5LMUF 3WDOA 5L1KA 3QJLA 3C66A 5CH7B 2VG7A 3KNAA 4DL6A 4J37A 1L3KA 4OHXA 3THPA 5IXUA 4DLEA 3CULA 2ACYA 2COLA 1T94A 2RUGA 4P6QA 2WAQD 2BXJA 4OHVA 3HT3A 3OSPA 5FJ4A 2K7KA 2CPFA 3TNVA 1YJ9S 1S4FA 2AF6A 1D8ZA 2WSEC 4RKUC 2VQEF 4O4GA 1C0UB 1CG2A 3ENWA 6FDRA 4BC9A 4X4NA 3Q2SC 1ZM3A 1JLBB 2OAUA 2R7VA 1M5SA 4ECTA 2B7CB 1OQ3A 1Q82T 3C6TB 4M5DB 1DTQB 2GIQA 3ISNC 2KXHA 2EFQA 1ZM9A 1IKYB 3PJWA 3UI3A 4HDHA 2R8KA 3T5LA 3BO3A 2ASDA 3KK3B 4KFBB 2MGZB 3OFHA 2PDAA 3IWLA 4G6VB 4RW4A 3J80Y 5J2NA 4GC7A 4GO7X 1N6QB 2EFNA 1UVKA 2M7SA 4OZ5A 4ELTA 3ICLA 3HKZD 2VBWA 2OPRA 2CPXA 3FQLA 3GFZA 3U7JA 4Y2AA 4OHWA 4DMZA 2UU9F 2I5JB 2CJBA 1AFIA 5DM7Q 1I94F 2DH8A 1KLNA 4RBUA 2MQMA 1WD6A 1LKZA 4M5DA 3DM2A 3TA0A 5C25B 1A7GE 1HBUA 3MI7X 2C2RA 2RH3A 3C2PA 3H5XA 1FD8A 3OXFA 5A8RB 4OV1A 4ES3A 5E7OB 4N8NA 1ZZNA 4YFUA 3SZ2A 1Q81T 5GAGU 2CQBA 1ZTWA 1JLGA 4LT6A 3DRPB 4A46A 2LYVA 2UVWA 1QAYA 4DV3F 1UJ5A 1GNKA 1K1QA 1N0UA 1OSCA 2WB1D 1YRTA 4PR6A 3IXQA 4WFAQ 3LWLA 1V3SA 1Q8BA 2P9EA 3JTOA 1RYSA 3ENQA 4DS5A 2XG8A 2XWXA 1KSPA 1C4CA 1Y4ZB 2KTQA 1GQEA 4WK3A 3CD0A 4ED5A