1R0AB

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 103
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB03
3RB3A 1S1VA 1JIHA 4WYWA 1XR6A 4KBIA 3M8PA 4MFBA 3M9NB 1ZTWA 4NLQA 4HKQA 1KLMA 3H40A 4NCGA 4IG3B 2QV6A 4TN2A 2HNDA 5D3GA 1FK9A 2RKIB 2JLEA 3BQ1A 3MFIA 4WZMA 5KT7A 1RT7A 4QWAA 1IKVA 1REVB 4ED8A 2R8IA 2YNIA 3UPFA 3MECB 2R2RA 3JYTB 3GQCA 2R8HA 1QAJA 2UVRA 3QGHA 4ED6A 3D28A 1DTQB 3QIPA 3KHRA 1JLBB 5HLFB 1JLFB 1TL3B 4O44B 3QO9B 2FVPA 1S48A 5KFMA 2GIQA 3CVKA 3IGVA 5DG8A 2XCPA 3FDSA 4WFZA 3OL9A 4NLXA 4LQ9A 5KFVA 1C1BB 4KFBB 4F4YA 3PW4A 4TQSA 3V6KA 3N6NA 2HNZA 3EPGA 4NLDA 3KK3A 3OLBA 3DDKA 5F8NA 5DLFA 1HYSB 4MK8A 3QLHB 4G1QB 3KLEA 2BRKA 1Z4UA 4ZPBA 2OPRA 4TQRA 1T05B 5DG7A 2WTFA 4J9MA 1HNVB 4O3RA 1JLEB 4ZP6A 4IG0B 3M8QB 4IH6A 1RT2B 2W9BB 2OPPA 4IR9A 2VG6A 3OHAA 4IQXA 1KLMB 5KFGA 4I7FB 4Q0BB 3LAKA 4PWDB 5J2MB 2IC3A 3SI8A 1S0OA 4WZQA 3GIMA 2FVQA 1N48A 5D3GB 4IFYA 5KFOA 2AGQA 2C2EA 5JXSA 1T3NA 4EBDA 1YVFA 4KHMA 2FVSA 5CYMB 1BQNB 2YNHA 5HROB 3KNAA 2YNIB 4WYLA 1JLAA 3VQSA 2ATLA 4ED2A 3LAMA 2AX1A 1T94A 4GC7A 1MU2A 2HWHA 4NLVA 1C0UB 3N6MA 3QIPB 1UWBA 4WFXA 4WFYA 5L1IA 2FJVA 2UVUA 2WOMA 3GILA 2UUTA 1S1WA 2QE5A 3CDEA 2YKMA 1HQEB 3LALA 3MEGA 2XI2A 3QGGA 2R8KA 4K4ZA 4LSLA 3CWJA 4RW8B 3DRPA 4URQU 3G6VA 1JLGB 5KT2A 5L1LA 4J9QA 3IGNA 5KG3A 3PJXA 4H4MB 5KFXA 3OL6A 4ZVEA 1SUQB 4NLGA 4X2BA 4QWCA 4O4GA 3TAMA 1S97A 1S49A 1DLOB 5F8HA 1HARA 1IKWA 1S1XA 2AWZA 4MIBA 4YR3A 3BSCA 1RT5A 4IKAA 4ECTA 4XO0A 1RTJB 3LANA 1EETA 1RT1A 1J5OB 4NLWA 4QW8A 4Q43A 2JEGA 1HPZB 2IC3B 2R8GA 5KT4A 2RF2B 2R2UA 4DG1A 1SV5A 4FS2A 3KK1A 3CDUA 3RB6A 4NLSA 3BQ2A 3H98A 4B3OA 3C6TB 4MH8A 1FKPB 3DLGB 5J2QA 4RNNA 3KK2A 1RT6A 3SFGA 1EP4A 1HMVA 2ZD1B 3FSIA 2YNFA 1S1TB 3V4IB 5I3UA 4K50A 5EUHA 5EWFA 1IKXB 3KJVB 4IDKB 1IKYB 1VRUA 5C24B 4Y2AA 3Q8SB 4ZVFA 1C0TA 1LW0A 1RTIB 2D41A 2FVCA 3PR4A 3Q8QB 4ECXA 2JC0A 3QIDA 5KFAA 1TVRB 1D1UA 5KFKA 3MEEB 2IJNA 3IS9A 4J9NA 4ED0A 3DRSB 1LW2B 4Q8EA 1N6QA 5CYQB 3DI6A 3KLIA 5HBMB 4QPXA 2VA2A 3LP2B 4NLOA 4LSNB 2C2RA 3KLGA 3NAHA 4NYZA 3NGDA 1RT1B 3H59A 4NLTA 2W8LA 5I42A 4NLRA 4OL8A 1TV6B 1RTDA 5KG6A 2I5JB 3DYAA 3LP1A 2ZKUA 1S9EB 5F8IA 3E01B 5KFEA 4Q44A 2WCXA 1C2PA 3PZPA 3GIKA 2IM3A 2D3ZA 5KFHA 3KHLA 5KFBA 4IRKA 4KE5A 3UDLA 4F4XA 1RT6B 4MIAA 1RT3B 4NLPA 3CJ3A 5FDLB 3DOKA 5HP1B 1K1QA 4JV2A 1S9GA 3C6UB 1KHVA 4RW4A 3I0RB 4R5PB 5KFRA 4KO0A 1GX6A 4NRUA 3DRRB 2AGPA 4ECYA 1N5YA 4ZVGA 4KKOB 2B6AA 1JLQA 3LP0A 2F8EX 3CJ4A 4ZPCA 2YKNA 2XCAA 5J2NA 2IAJB 3BQ0A 2BQRA 3UQSA 3H5XA 4YQWA 3G86A 3H4BA 2OPSB 4ECSA 1S6QB 3T19A 3KLFB 5KFWA 4RW9A 1JLCA 1RT4A 4RW6A 5C42B 1N6QB 1FKOA 2RDJA 4WE1B 4ED1A 1HQUA 1S6PB 5C25B 2VG7A 1LWEA 1I6JA 4ECQA 2B5JB 3KLGB 3MFHA 5KFFA 4O3PA 3HHKA 1JKHB 3V81B 1LWCA 4NLYA 4Y34A 4NZ0A 5KG0A 3G6XA 2CJQA 4PQUB 3NBPA 3JSMB 3MR6A 3E51A 4YP3A 2BE2A 1NNDA 1IM4A 2O5DA 3MF5A 2AGOA 2HMIA 1LWFA 3V6DB 1NHUA 2YNGA 4YMEA 3IG1B 3ISNC 4QW9A 3KMSA 1JX4A 3DOLB 3CJ2A 2JEIA 1TKTA 3PW5A 2IJFA 3DLKB 5KG2A 3HKWA 1R0AA 1S1VB 1QUVA 2V0NA 3M8PB 4MFBB 5F9LA 4K4SA 4RW4B 1DTTA 3CIZA 1TKZA 4KO0B 4URGA 3I0SA 1QE1A 4NCGB 3CJ0A 2HNYA 2HNDB 4I2QA 1FK9B 1TQLA 4MK9A 3CDWA 5KT3A 3BSOA 4RNFA 4G3IA 1KHWA 5KFYA 1RT7B 4KSEB 1IKVB 4TYBA 3GIJA 4IOBA 1RDRA 3KHGA 3KHHA 4ECVA 1RA6A 5J2PA 1XR5A 2IM2A 5DGBA 3H5SA 5KFZA 3PJWA 5K14A 2VG7B 4KV8A 3KOAA 4DEZA 2FLLA 3MEDA 4I2PA 2XC9A 4IRCA 4EYIB 2W9CA 2IA6A 1TKXA 1RTHA 1SH2A 4QWDA 4MKAA 3MTKA 4ZHRA 2EC0A 5EWEA 2V4RA 2HNZB 4U7CA 1TL1A 2VG5A 3KK3B 4DL5A 5F8LA 2JEJA 2BRLA 1C1CA 2YNGB 3KLEB 3TVKA 3OL7A 2OPRB 4PUOA 2WB4A 3D5MA 3QYYA 2BANA 5DG9A 4Q8FA 3PVXA 4H4OA 2OPPB 3DM2A 5L9XA 2XGQA 1HNIA 2VG6B 2CKWA 3CO9A 3H5UA 4R8UA 3PW2A 1QE1B 5EDWA 4HYKA 2HNYB 4J9PA 2ZE2A 1GX5A 4I2QB 4IFYB 4RW7A 1D0EA 3KLVA 2OPQA 4R0EA 5F8MA 4F50A 1WNEA 4ID5A 2WHOA 3H5YA 5J1EA 3N6LA 4TY8A 2YNHB 2AQ4A 1JLAB 4J9OA 4ED7A 1MU2B 2BQ3A 3MR2A 3DMJA 4Q45A 1UWBB 3OSNA 4F4WA 3T5KA 3DLEA 3FFIA 1VRTA 5DQIA 4I2PB 2J6UA 5JUMA 4K4VA 2WOMB 5KFLA 4IFVA 1S1WB 2YKMB 1T03A 4KB7A 3MEGB 4K4WA 3QZ8A 4ZHRB 5KG4A 1JXLA 3KLHA 3PW0A 4LSLB 2ASJA 4ICLA 4EYHB 3DRPB 4J9SA 3NKYA 1U09A 3FQLA 4J9KA 1QAIA 3BSAA 4O4GB 3TAMB 2IM1A 4IH5A 3H4DA 2JEFA 4XPEA 3ITHA 1S1XB 1IKWB 5KG7A 4ZPDA 4QWEA 2IBKA 2AX0A 4DL6A 4RUAA 1RT5B 3ICLA 4J9LA 3G6YA 1EETB 4ZP7A 1S1UA 4LQ3A 2UVWA 5F8JA 4RW7B 1SV5B 4IG3A 4DG1B 3KK1B 2OPQB 4ZMMA 2RKIA 3T5JA 4IH7A 4B3OB 2W9AA 1CSJA 4EBCA 5J2QB 1REVA 3KK2B 1SH0A 3RAXA 1EP4B 1HMVB 3MECA 4K4TA 3KMQA 3OLAA 2YNFB 2DPJA 2B43A 2GC8A 1DTQA 4ZVHA 5I3UB 1JLBA 5HLFA 1JLFA 4KHRA 4M95A 4RNOA 1TL3A 4O44A 3QO9A 4RZRA 1VRUB 3BGRA 1T03B 3EPIA 1C0TB 1LW0B 4K4XA 1C1BA 4KFBA 2BR0A 3NAIA 4ECUA 3IRXA 2AU0A 3IS9B 4K4UA 1HYSA 3DI6B 3KLIB 3QLHA 2ASDA 4TXSA 1T05A 5F8GA 3HVTA 2D7SA 3RB0A 2V9WA 1HNVA 4JUZA 1JLEA 5DLGA 4IG0A 3M8QA 4EO6A 1RT2A 2W9BA 5L1JA 2FLPA 5I42B 2VA3A 1S1UB 1RTDB 1ZETA 4I7FA 4Q0BA 3DYAB 1BQMA 3LP1B 5J2MA 4PWDA 2WRMA 3BREA 2ILZA 2WONA 3OSPA 3OL8A 5CYMA 1BQNA 2R2SA 5HROA 3EZUA 5KFCA 2D3UA 4TLRA 4O3SA 5KFTA 1N56A 1N4LA 3DOKB 2ASLA 1C0UA 1S9GB 2WK4A 4K4YA 4TY9A 1S0NA 3IN5A 5KG1A 4GC6A 4RUCA 1S9FA 4IR1A 5DGAA 3V6HA 3BGRB 3OHBA 2J6SA 1N5YB 4URSA 4ZP8A 2B6AB 1JLQB 3LP0B 1HQEA 1XR7A 3NL0A 2YKNB 3GV8B 5J2NB 2W8KA 1OS5A 3IRXB 4DL3A 3MR3A 4RW8A 2FVRA 2DPIA 1JLGA 4O3OA 4RW9B 1JLCB 1RT4B 4RW6B 2R8JA 5DQGA 1FKOB 4H4MA 1HQUB 2IM0A 1SUQA 4O4RA 1LWEB 3HVTB 4FBTA 1DLOA 4EBEA 3T5HA 4MK7A 3RB4A 4FBUA 4TYAA 2C2DA 2E9RX 3GV5B 1NHVA 1S10A 1LWCB 1RTJA 1J5OA 3PHEA 3NBPB 5KT5A 1BQMB 1HPZA 5KFQA 2BE2B 2RF2A 4RNHA 2HMIB 1LWFB 3QGIA 2WONB 2ILYA 3PR5B 4M94A 1TKTB 3C6TA 1FKPA 3GYNA 3M9MB 2E9ZA 3TQ1A 3DLGA 3HVAA 1R0AB 1TP7A 2GIRA 2XI3A 3I5AA 3MR5A 2ZD1A 4QWBA 5KFIA 1DTTB 1S1TA 1TKZB 3V4IA 5KFSA 2ALZA 3I0SB 1IKXA 3KJVA 4IDKA 1IKYA 5C24A 3FRZA 3I5BA 4KAIA 2W7OA 3H2LA 1W25A 2XWYA 1RTIA 4NRTA 1TVRA 1RYSA 3HVWA 3MEEA 1RYRA 4IRDA 2W7PA 2RDIA 3Q8PB 3DRSA 5J2PB 1LW2A 5CYQA 2FJWA 5HBMA 3V6JA 5K14B 3LP2A 4KV8B 3GIIA 3MEDB 2BQUA 4ECZA 4DL2A 2HAIA 4LSNA 2JC1A 2W9CB 3PW7A 1TKXB 1RTHB 3Q8RB 5KFNA 1RA7A 5KFPA 1TV6A 2I1RA 5KG5A 3T1AA 4RU9A 2IMWP 1TL1B 2I5JA 2VG5B 1SH3A 1S9EA 4NLUA 3E01A 4F4ZA 3RAQA 1C1CB 4WXWA 2UVVA 5C5JA 2E9TA 4EEYA 4PUOB 4WXOA 4O3NA 4YR0A 3I5CA 5KFUA 2BANB 1K1SA 1RT3A 4JV0A 5FDLA 4H4OB 4XPCA 3DM2B 5HP1A 2HWIA 1HNIB 3CJ5A 4H54A 4R8UB 2J6TA 3C6UA 3I0RA 4R5PA 2UUWA 4MKBA 4RNMA 2ZE2B 3RBDA 3M9OB 3DRRA 1MMLA 4FS1A 5F9NA 4KKOA 4ZPAA 4ID5B 3NMAA 5J1EB 4Y3CA 2IAJA 5EWGA 3QZ7A 2XGPA 4TY8B 5L1KA 2C22A 2OPSA 1S6QA 4J9RA 3KLFA 3SFUA 4Y2CA 3JYTA 4YR2A 5C42A 4WE1A 3DMJB 3RBEA 1S6PA 5C25A 3DLEB 3FFIB 1VRTB 5DQHA 4DL7A 2B5JA 2OH2A 2C28A 1S4FA 4O3QA 1RAJA 4IFVB 5KFJA 2FLNA 2V4QA 1JKHA 5KT6A 4EO8A 3V81A 3KLHB 3BSNA 4ED3A 4ICLB 3BJYA 4PQUA 3JSMA 4U6PA 3ISND 4ZP9A 3UR0A 3FQKA 4ECWA 3T5LA 3BR9A 2R2TA 3V6DA 5T14A 4G1QA 3IG1A 4JV1A 3DOLA 4DL4A 1S0MA 4ECRA 3GV7B 3DLKA 3ITHB 2FJXA 5KFDA 1ZTTA
chains in the Genus database with same CATH superfamily
2HHHF 2UXCF 1UPMB 5HVHA 2C42A 1BQXA 3AY0A 4X4QA 4FYWB 5KT7A 4DPXA 4M5JA 3CPWR 3SCKE 2X51A 3V6KA 4I6YA 1U26A 3MM8B 4DR4J 3KK3A 1YBUA 4FYYB 4P2FA 3T3FA 1Z4UA 4TQRA 4RKUC 3DU6A 2SXLA 5CABA 4IR9A 3MUMP 1S0OA 1H7WA 4KHPF 2AZ1A 3GJQB 4ZPWR 2QFIA 3Q2TC 1C0UB 1YWXA 1KQSR 4LF5J 3GILA 3T41A 2UUTA 3CDEA 3LALA 4E2FB 4A8MP 2QT7A 3JSBA 2NUHA 4EWTA 1S97A 4OJGA 2QL7B 1NZ8A 2RRAA 1MNEA 2V4JA 5B0AA 4CLKA 3VAKA 5K20B 4C0BA 1RT6A 2H5JB 3SFGA 2RT3A 4ZCMA 5EUHA 4Q2LA 3ELHA 3L7UA 1X5PA 4JV5F 5KFKA 1H3DA 1Z1ZA 1ZH5A 2RUGA 2GJIA 3C3LA 2F8MA 2CA9A 2W8LA 2IA6A 2MGZB 5DZ7A 1FXLA 2NXEA 1RWVB 1NB7A 1F0XA 4X4OA 3A1YG 2IY5B 5THWA 2P9GA 2ZH8A 3H4BA 3KLFB 4CM2A 4A8XA 1HQUA 1CEZA 3KLGB 3MFHA 2HK2A 2CPXA 4AXIA 2CJQA 4CO0A 5HK4A 1NHUA 3KMSA 4YMEA 3H2UB 4FXVA 3P4UB 3PW5A 3A12A 2G4BA 2UV8A 3SMZA 3K2YA 4UZBA 1S5ZA 1E6YA 5J1NA 4FKYA 3BR8A 4G3IA 2CNKB 1RDRA 3GFHA 5DGBA 2VOOA 2GHVC 5K14A 4W98A 3H20A 3MURP 2W9CA 1TKXA 2MQNA 2FZKB 1GMVA 1FTCA 5F8LA 3CC4S 2BRLA 3KDNA 1QDUB 3TQEA 5HMXA 3IC1A 3PVXA 2OPPB 2CKWA 4HYKA 1GX5A 1IBMF 3HO1A 2VV5A 2WHOA 5J1EA 1MW7A 1AYEA 3PX0A 2UV8G 3AB4B 4Q45A 3CD7A 3FFIA 4I2PB 1VR6A 1S1WB 4C3LA 4AD6A 5KG4A 3KLHA 2RB7A 1FFGB 1HHSA 1NDCA 4DR3F 3ITHA 2MLZA 4NXNJ 2V68A 1REGX 4P7TA 1QAYA 2CWKA 3I9V9 4KGMA 2CDRB 2MQ8A 5B0CA 3KK2B 1EP4B 1NM2A 3OV7A 3OT9A 2BYCA 2ZVIA 1T3OA 4PRFA 1RWNB 3THTA 3CC7S 3HVTA 5T7LB 5F3ZA 4UZCA 1HW9A 1MMDA 3I55S 3HJFA 5ETSA 1C0UA 1S0NA 1Y5LB 2KT5A 3CCES 4PYAA 3MR3A 4DSJA 1P9YA 4Z7CA 2R8JA 4KH0B 1LWEB 2QZ8A 3PG9A 1QY7A 1UEUA 1LWCB 1UAWA 1VK3A 1FEEA 3LGMA 3CIMA 4X62F 4PCQA 2HPUA 1V3ZA 3UCZP 3KJFB 1WG5A 5LMUJ 4ZITA 5K8NA 4F02A 2VC1A 2QLJB 4BC9A 3J7Z5 1EQMA 3TUJC 2CJXB 1NK0A 3DU5A 1NK8A 1RTHB 3QQCD 2UXBJ 1KEKA 1VQKS 1H2UX 2MGZA 3JTOA 3I5CA 3EDQB 4PAAA 1L3TA 3NGKA 3TVYA 2MHEA 4RNMA 4NEYA 3CW2C 5EWGA 1RHQB 3KLFA 4Y2CA 2ZOGA 1KOOA 4IFVB 1OY6A 1P9QC 4P9SA 4U6PA 1O8BA 3NGUA 4GMKA 2QMWA 3HJVA 3KNGA 4ECRA 1JIHA 2C2ZB 1R8PA 3P5TL 3FZBA 3H40A 2DXDA 3CJSA 2XBPA 4CLWA 4K0KJ 2GMHA 4DX7A 3UDCA 1PBAA 2IDLA 3QGHA 5L38A 4UTGA 4ED6A 1JLBB 2K7KA 4OJ3A 1CVJA 1M1HA 4ED4A 4UF4A 4TQSA 3N6NA 1M1GA 3MPYA 3DDKA 5DLFA 1FVQA 2V94A 5BXIA 4IH6A 2OPPA 2Q6CA 2AJ1A 2EKYA 2XMJA 4CM0A 3T6BA 3JSYA 1RAIB 2FVQA 3ENVA 1T3NA 3QWUA 2VDIA 2FVSA 4CLTA 4PZVA 1IQTA 2HWHA 3GMGA 3M32B 1T8EA 3QSIA 1S1WA 3OXFA 2E7XA 2E66A 1S77D 2LFVA 4FZVA 5L1LA 2FGCA 1VFJA 4WPAA 2HWTA 1H98A 6FD1A 4Q43A 1Q1KA 2EC2A 2RF2B 1ELOA 1W7WA 4K2JA 4X4SA 2VFVA 5B0DA 3KK2A 3TEHB 1EP4A 5B0GA 3LPEA 4M5MA 1ITPA 1RTIB 2HQ3A 2EFGA 2IRXA 5GVQA 1NAQA 4F04B 3HD2A 2E5JA 1S59A 1T9XA 3QWPA 5F8IA 4C2MA 3SIPB 1TKDA 4DS4A 2D3ZA 1ZBTA 2A2DA 3MI7X 3BO3A 1SKRA 1S99A 3D0GE 3EGWB 4HACB 1K1QA 3AOCA 4DCOB 4IO9Q 4DN9A 2CXEA 4KO0A 4C8ZA 4ZVGA 3CJ4A 2MXYA 2CIMA 3BQ0A 4JBCA 3QJJA 3CCLS 4RBUA 1UA1A 1X4FA 2G1DA 1LWEA 2DNYA 4N5SA 4U7UD 1IQZA 1LWCA 3JSMB 1NK7A 4JI6J 2I2YA 3ZTSA 1QUVA 2V0NA 4MFBB 1NK9A 4JI7J 3BSOA 3FC9A 4LMZA 1K47A 4EYIB 1RTHA 1WTBA 4QOTA 2HNZB 1LXNA 1X0PA 1A7GE 3QYYA 5DG9A 5HO4A 2F8HA 3CC2S 4WP9A 1WEZA 3PXGa 2VPYB 4I2QB 4K5SA 3CDBA 2LEAA 2XO7A 2DHAA 4ED7A 3MR2A 1V3RA 4LF9J 4MYTA 2VPWB 2RDDA 4IFVA 3AOAA 1GMWD 1P6TA 2BEFA 2GIFA 3NKYA 2Z8QA 1F60B 3IR7B 3P96A 4O4GB 3TAMB 1TK0A 1RADB 1RQ0A 3BZQA 4CLSA 2H48B 4USHA 1SV5B 3LUYA 3S6EA 3KJQB 5DM7Q 5J2QB 2X1AA 4YDXA 3SQOP 1JLBA 4F2RA 3Q89A 1F9EB 4DR2F 5F8GA 3EGVA 1VLYA 2FLPA 1SJFA 1DQ8A 2J9CA 2VA3A 1RTDB 3MPDA 1BQMA 4CLUA 5H9EK 4K59A 2HGLA 1HD0A 1N56A 1B4SA 1XIQA 4GKJF 4TY9A 3M32A 1NLKL 3HZEA 4GC6A 3BGRB 2IYIA 4DUYJ 1VMBA 3D1OA 1WKJA 1CQNA 2CPJA 1S10A 2EPIA 5IV3A 2R7XA 4NL5A 2RF2A 3QAUA 5FJ4A 1P8GA 5IWAF 4DX5A 1YHQS 1NK4A 5IM0B 2E44A 3I0SB 3VALA 3J80U 4KAIA 3H2LA 3N0VA 1RTIA 3I82A 4P6QA 4PKDB 4DZ6A 4KV8B 1IN0A 2KVQE 5CCMA 4C0OC 3OUYB 3TI0A 1H72C 3R6GB 3L09A 4OLPA 3JB9k 1SH3A 2WBRA 2VPXB 1SXLA 2XLJA 5C5JA 1TUWA 4B9VA 3TANA 4OZ0A 4HACA 3UD4P 2H1YA 3LTOA 4FS1A 3QZ7A 2HFOA 4IOAQ 3WHIA 4ED5A 4YR2A 2YX7A 3GLJA 3NNHA 1U2CA 5KT6A 4EO8A 3JSMA 4P52A 2R2TA 3M8WA 1FJGF 1UFKA 4ZLLA 4JI0F 2X1FA 2CWXA 4MFBA 1ROFA 3EGNA 1U49A 2AYGA 4EZ9A 2OEKA 3VAIA 2XQCA 4A8YA 1REVB 3JYTB 2V8HA 1EIYB 5HLFB 3BN4A 2DEJA 3ISZA 1M5OC 3UN3A 1XBWA 2YPYA 2HNZA 1WF2A 2DHHA 2HKEA 4DR1F 2KG1A 3ENAA 2GVZA 5CHCB 5KFGA 2ZITA 3LAKA 2CZ4A 1NPPA 2F7VA 4DX6A 1X9SA 1SJ3P 3N6MA 4CLZA 2DHXA 4DCJB 4URQU 4QR1A 4I6WA 3EICA 4O4GA 3TAMA 2UU9J 3H90A 4DSLA 4WIIA 4YR3A 4OYMA 1U1RA 4ES3A 1SV5A 2PN6A 3CCRS 5J2QA 4RNNA 4P72A 4ILRA 5KTQA 1Y3KA 4LFAF 1D1UA 1L3KA 3D3BJ 4QR2A 3PEJA 3DRSB 1XERA 2FD2A 5CYQB 4QPXA 3EUNA 2D3OR 2R3VA 3NEKA 3H59A 4NLRA 1RTDA 1HWIA 1N5VA 1Q8LA 3P8BB 3O6QA 4ZIVA 2DTJA 5FDLB 5HATA 2CAJA 5ETKA 4JV2A 2PC6A 3C6UB 3KUEA 1T9WA 3GWCA 4OYBA 4GKKF 3VCDA 1OJ4A 1X5OA 3UQSA 4YQWA 2OPSB 3T19A 1NDKA 2RHSB 1S6PB 4WU3A 2BJEA 2HFUA 5KG0A 3M05A 4HH0A 2JLGA 2XMWA 4TU9A 1YLXA 3VGUA 2YNGA 4ZVSB 3MTJA 5KG2A 5IM0A 1H0HB 4ANCA 3I0SA 5BR8F 1DHMA 5ETPA 2HNYA 1LNQA 2MDAA 4PEOA 2ZC4A 3KHHA 1EARA 2XLIA 4KV8A 4ELUA 3CD5A 3OUYA 2AT1B 2OSRA 3TVKA 1NJWA 3THVA 4NASA 2WB4A 3D5MA 2KFYA 3HKZD 5CD4H 1B7YB 4X66F 2HVIA 1U47A 2UXDJ 2H51B 2AQ4A 4ANDA 5LMNJ 4F4WA 2IA0A 1Q8KA 5F0WA 2ZBCA 1OMSA 1T03A 2LXIA 1HHTP 2DISA 1K73T 2IBKA 5A6WA 1TR0A 3R1HA 4RUAA 5H9FJ 2UVWA 3Q8UA 3M6VA 4EBCA 1REVA 2F3JA 2KRRA 2IDEA 1RU1A 4B3SJ 2C3OA 5HLFA 3IRXA 4N47A 3DI6B 3SQGB 4Z7YA 3RB0A 2V9WA 4G1IA 4JUZA 4AQYF 2BW7A 2O67A 3CJ8A 1S1UB 1ZETA 3T6JA 3BGOP 4PWUA 4ERDA 5CD4A 3KUHA 3EZUA 1FFSB 1YJWS 2MZQA 1Q16B 1YTYA 2XZWA 2FHOB 2YWEA 4CO2A 3N79A 3AAWB 2YXLA 4DQSA 2QA2A 1T9YA 1IBLF 3NMRA 4RNHA 3MPVA 1FVSA 1AT1B 4M94A 1TFYA 1TP7A 3OJUA 2HFSA 4TKTA 1VQ8S 1TKZB 2MQOA 4ATNA 4OQJA 2VICA 2R7WA 5LXRA 1RYRA 3ILJA 2ZWPA 4FN5A 3DRSA 2FB0A 2CPFA 1KVKA 5CYQA 2FJWA 3V6JA 4DL2A 1RUSA 4OX6A 4DV1J 4EUVA 1RA7A 1YQHA 2LLZA 2UVVA 1TL5A 4JV0A 5FDLA 4LBPA 4YUDA 2LVWA 3C6UA 2ZVSA 1HFEL 1V3SA 4I1TA 4DV4J 1JJHA 2OPSA 2P9CA 1S6PA 2F1FA 1M90T 2J7KA 5LL6d 1G2EA 4FVMA 4ZCLA 2QYCA 4DV0F 3T5LA 2NPIA 4WTOB 3M9NB 1ZTWA 4NLQA 1QJHA 3EVOA 1KWMA 3E8OA 1NKBA 5JJBA 4O44B 3WBZA 4M5IA 1Y9OA 2C2MB 4F4YA 2DGSA 1U6FA 2RRBA 2B7CB 2POKA 3M8QB 4M1KA 2ZUAA 4IQXA 1ICEB 2ZEJA 4O0IA 3DHWC 2MLXA 4RUBA 1ZS6A 2GFFA 2ZFHA 1NJIT 5DJBA 2X3DA 2XY6A 2F63A 3B4MA 1FRIA 2ZDOA 1F2GA 1LK7A 3TVZA 1S49A 4DJBA 2ZOFA 1T0TV 2M8DB 2CQ4A 2XM3A 2IC3B 3IWNC 3CDUA 2OELA 2YWWA 3R1LA 2C2KB 4GO5X 4CLPA 2KT3A 3OXLA 1RCOB 3IXQA 3FSIA 2FPHX 3M2VB 5CH7B 1IKXB 1NXIA 1SCJB 3QIDA 2GHPA 3W9JA 3DI6A 2CVEA 3SQGA 2H4YB 2WW4A 1GFWB 1SQFA 2I5JB 2ZKUA 1EAYC 1WC3A 1TL4A 3KHLA 4KE5A 1SB6A 3MR7A 4NRUA 1JQGA 4A8SA 4ZPCA 3GFXA 3ZZYA 1S7IA 4EFAC 4NA2A 3GIRA 3HHKA 4C4WA 2VQEF 1WHVA 4JI1F 3ISNC 3AHPA 4QW9A 4Q7AA 5JVGQ 2HHQA 1FRJA 3A3OB 1S12A 1AUSL 1TZ0A 3QBCA 1H6KX 2VONA 1TKZA 4URGA 4QPTA 3UW1A 1VJWA 5KFYA 1OYDA 2AIRB 2IVFB 3KOAA 1RZMA 5LSOA 1MWZA 3HSZA 1RHKB 2EC0A 1Y11A 1IBCB 3G8SA 2RQCA 3OL7A 2HGMA 2OTLS 3AA9A 4DUTA 4E98A 2RS8A 2NXUA 3W8PA 5EN1A 5GAEU 1MWQA 3K7RA 4J9OA 1HA1A 1NSKL 3F41A 2J6UA 4K4VA 5JUMA 3PW0A 4KH1B 3C46A 3RBXA 5AXMA 4USWA 4XPEA 3Q0AA 5E3PA 4DL6A 1RT5B 4DZDA 5A0YB 3BF4A 1FERA 1SH0A 5A6PA 5K8PA 4O44A 1F9HA 1QSYA 2BX6A 2DNNA 2PD1A 5CYJA 4PG4A 2ZBRA 4TXSA 4F3OA 3IWXA 1YI2S 3UWTA 3M8QA 2DITA 4X65J 3M6WA 4DFPA 1VC5A 3H2VE 4ZVQB 2HRYA 3R5AA 2E5IA 1Q0NA 3GB0A 4QBUA 3MWBA 2KM8B 2RRNA 1RISA 1KP6A 4HHJA 1RT4B 3HHEA 1FKOB 1KBRA 3W2WB 1R89A 1X9MA 4FBUA 1YG0A 4UW2A 4GVLA 3O3LA 3J7A1 2Y1LB 2ROPA 4Y2KA 2E1PA 2BXJA 5KFSA 2ALZA 3M2VA 3AODA 1IKXA 5AJ3F 2W2NP 2XYPB 2DO0A 3ZZOA 1AUDA 1CQMA 2UP1A 2I1RA 2I5JA 2DCUB 4WXWA 3US5A 4RBTA 1WDTA 5FLXU 1VQSA 3RBDA 1Q7YT 5F9NA 1RJJA 3CJQA 1I1GA 1VRTB 2N7CA 2ZJQQ 2YX4A 4HTJA 2CPHA 4USTA 2LA6A 4FXDA 4ECWA 4DPOA 1DBDA 4LR9A 2IMOA 5KFDA 1S0VA 1YKWA 4HKQA 1PJ5A 1VIOA 2FZCB 3WX4A 1FXRA 3I87A 4CIOA 2BABA 2WVFA 5LSLA 3KHRA 4AE5A 1M5HA 1S48A 3HI9A 2PMZD 3RR8A 1Q53A 1HYSB 4QIGA 1SC1B 3CJTA 1FDNA 5DG7A 1M5PC 3FZ2A 4WTYA 1RT2B 2F4VJ 1KFDA 1ZZFA 3FUYA 1HNWF 3U1MA 2XSFA 3QGPA 2C2EA 4TLQA 3DNCA 4KHMA 4ED2A 2AX1A 4QU7A 2YWKA 1P27B 4TU7A 2A2CA 2UVUA 1NO8A 4ITSA 3WC0A 3GG1A 2R8KA 1O6XA 2Z2YB 4I67A 4ZJQA 5EX0A 2PIIA 5JVHQ 4YDDB 1NJZA 2W2QP 4LBHA 1PYOB 1RT5A 4NE9C 3HHDA 1RTJB 1RT1A 4P7VA 2XO6A 1S7HA 5A0YA 3I6PA 1FI4A 3DXSX 3V4IB 2VHGA 3KJVB 5C24B 4N41A 2FVCA 3Q8QB 1V6HA 2D41A 3D6HB 1Y5IB 3OQ2A 1N6QA 2ADBA 4PWWA 1NHKL 1R27B 4MIWA 4M5LA 3R2DJ 1TV6B 1JXEA 2LU1A 4AL5A 2BM1A 3A3NB 1B64A 2RILA 4FKXA 1LK5A 2VD3A 4UOFA 4LRDA 1R3NA 4MIAA 3D0IE 4LBIA 3LW5C 3DRRB 2XMTA 2KYZA 1RT4A 1FKOA 3W2WA 2IRUA 2VG7A 2DBBA 2MQLA 4DS5A 1ZM4A 3HFVA 3K89A 4PG5A 2AGOA 1N32J 1LWXA 4DV2F 2XS7A 3PNIA 3ZZRA 4ZLPA 1S1VB 3K8WA 3R5BA 2LECA 5GAEI 3ILOA 3QJPA 3DC2A 2HNDB 5KT3A 3CDWA 4RNFA 3UD3P 5E33A 1IJEB 3CCMS 4ECVA 2KO1A 1QAXA 1XMOJ 2ZZNA 3AFGA 1KOHA 2JL9A 2IHR1 2B56A 2JZ5A 3SBMA 4NA3A 2FHJA 3PYDA 1FDAA 1K8AT 4NZ6A 1WI6A 2OPQA 3JQMA 4R0EA 2DGOA 4KC5A 2HVEA 2W01A 1SKSA 1VRTA 4J90A 2LEBA 5KFLA 4B3TF 1RWPB 2E7VA 2YWHA 1KRPA 1RACB 2IM1A 2DNGA 4QJVA 3AD7C 3R5DA 1UL3A 3JTNA 2VQFJ 3GZ7A 1D9AA 3CD0A 2DNMA 3AH6A 2CRLA 1VOMA 1SJQA 3Q2SC 1VRUB 4USMA 4RJVA 4K4XA 2ZBPA 4FF4A 1FE4A 3IS9B 2DRDA 3K5OA 3DOMA 1UWAA 4FYVB 1HYSA 3G4SS 1X4BA 1JWWA 1RT2A 4JI5J 1F6TA 3LP1B 3BREA 3DGPB 2V9KA 2E5LF 3GCXP 2OP5A 2CPYA 4F8RA 1N4LA 3PRVA 3T1YJ 4K8RA 3V6HA 2YKNB 3EMTA 2GAGC 3MZIA 4O3OA 5DQGA 3M6UA 3CCUS 1YZ7A 4KGKA 4HDHA 4ETZA 4FBTA 3TX0A 2C2DA 2ACMA 5J1PA 1WUUA 1RTJA 1Y3JA 2WONB 4L74A 5IT9Y 4XIUA 1Y7PA 4JI8J 1R0AB 1WOOA 2XI3A 4HHHA 3V4IA 4B3RF 3KJVA 5C24A 1LXJA 1W25A 4IRDA 4DSKA 1XN9A 2Z30B 3MDFA 1N5QA 3OW2R 1UVLA 1SPBP 3JQKA 1TV6A 3WIVA 3HSJA 1C1CB 3OFGA 3HMJG 2ALYB 4PXEA 2DXEA 7FD1A 2NS1B 4XPCA 4AUKA 4JI3F 4NXMF 3DRRA 4ZKAA 1RB0A 1R31A 2LA4A 1BY9A 3SFUA 4LFBJ 2K3IA 5D0GA 1VQOS 4O3QA 2NXCA 5IC6B 4J9UE 3BJYA 4OYOA 2GA7A 3EE3A 4QU6A 2WVEA 2QA1A 1XMBA 2KG0A 1S1VA 2RU9A 3MMAB 3OTOF 3W9IA 3G2XA 2HNDA 1KDNA 3RRHA 1N34J 2RNEA 4LF7F 3CCTA 4TVAB 4B3MJ 1TL3B 1F2HA 2LDYA 1XQIA 3BDEA 3OL9A 5KFVA 4YHHJ 4JI4J 3GYXB 3QLHB 4ZPBA 4D3GA 3HCXA 3HVRA 3I32A 4S0MA 2PFFB 5L9NA 3SI8A 1IM6A 4QYRA 5KFOA 3U27A 2I6WA 3SCIE 2YNIB 5EGYA 3N4WA 1HW8A 3QIPB 2CG4A 3G82B 1HQEB 1TMMA 3RBZA 2C3UA 2DNOA 3QT6A 5C2GA 2YQ3A 5MLCV 2M8HA 3DLHA 4CNYA 3B4DA 2VB6A 2CJKA 1HNZF 1VGYA 2DO4A 3AJDA 3BB5A 2GHWA 4FS2A 3DGVA 3H98A 2GS8A 3C6TB 2HYIB 3DLGB 3PO4A 1VRUA 2X3GA 4DLEA 5KFAA 1Q79A 5K8MA 1SKUB 3IS9A 1GXTA 1LW2B 1O5JA 2HK3A 2NZCA 4NLTA 3LP1A 3DGPA 5KFEA 1U8WA 1IBKF 1WG4A 2VIHA 4LRAA 5F41A 4LF6J 2JFKA 1H73A 1Q95G 2HQCA 2F8EX 4DR7F 2YKNA 2UUCF 3CCJS 3G86A 1NH7A 2B5JB 3F0NA 2HRTA 4CO3A 1R43A 1N36F 4PQUB 3TUZC 3MR6A 1P1LA 2MQQA 3SXLA 3HKWA 1R0AA 2VFSA 1QE1A 3I56S 4DPWA 1FK9B 2VJVA 1WD6A 4M8LA 2RAQA 4LSZB 4LF1A 3T9ZA 3QT5A 1WTFA 3AXMA 2JFDA 4CNZA 5HSPA 4L3KA 3DRYA 2WW8A 3NRBA 1C1CA 3TR5A 2Q43A 4W90B 3CCZA 3IAM9 2UUBF 2W24A 3L3CA 3CO9A 4CRJA 5A76A 1UW9A 2R7OA 2B9EA 1A6LA 4FXWA 3HULA 1WNEA 5F8MA 3O2IA 3MEKA 3CCSS 1SI9A 4ELVA 3ZTPA 2CQ1A 3R97A 1HKAA 3ZTQA 1QAIA 1FJCA 1SIZA 3H4DA 5CZVA 4KPCA 1S1XB 1ZAWA 3MMAA 2CPDA 1XNQF 4BWMA 2W9AA 2RU3A 2EK1A 1VC0A 2YNFB 3PX4A 1CJTB 4RNOA 1TL3A 1DY3A 1KD1T 5U47A 3MD1A 2QC3A 2QL5B 4WKYA 2KT2A 1VQNS 2QRRA 4L75A 2AV5A 1VQLS 3QLHA 2X1BA 5E5NA 2D7SA 2GW8A 6AT1B 3U1NA 3GCWP 3W7BA 3OTEA 1IXKA 5KFCA 4RPFA 4QCLA 3C66A 2R7RA 2G2ZA 1YJUA 1HQEA 2XMKA 3MCNA 2N3OA 1MMNA 2AP6A 2G0IA 1N33F 3W5XA 1T11A 2ZH1A 3C6TA 3DLGA 3VQTA 3SZ2A 3D6MB 4GVBB 4XAKA 1UVNA 2CQ3A 3PHTA 2YVSA 3ETMA 1DJ0A 1LW2A 2Z2ZA 3E3XA 2N3LA 2D9OA 3MEDB 5IQ6A 1WKLA 3AQOA 4WK1A 4QIWD 5KG5A 2HVDA 3KXDA 3PIOQ 2D74B 2E9TA 3MMBB 2HHHJ 1J2VA 2UXCJ 4H54A 4R8UB 2FYXA 4F0HA 2UUWA 1UZDA 2H65B 3HSDA 1HQ2A 3M9OB 1UW4A 4HI1A 2P6SA 2MZSA 1ZAVA 4A47A 5A2QU 4TY8B 1U0HB 3ENQA 5M2PA 4DN0A 5DQHA 2B5JA 3RG6A 1L3VA 4PQUA 3AJ1A 4G1QA 4DL4A 4DV3F 1NMEB 5F8HA 4WYWA 2PEHA 1WJ9A 1KLMA 2Y1IA 4F67A 2OMLA 1FK9A 4ZK7M 4V1Ak 4KHPJ 3KDOA 3M2RA 4LUBA 2P9EA 4QWAA 3SV3A 2R8IA 1GQEA 4C3MA 3W66A 4JI2F 3NOGA 2MZRA 4M5DB 5KFMA 3JAMY 3FDSA 4WFZA 1SL0A 3TYTA 3OLBA 1Z2LA 4I4BA 2JRSA 2AJ0A 2VFUA 3NGRA 2JWNA 2WTFA 4BC7A 2FJAB 3A3PB 2HS3A 2HBYB 3TP2A 1K44A 1OY8A 1BQNB 3B78A 1CC7A 2PO4A 3TJ8A 1WHYA 3HT3A 1RBLA 4JV5J 4DUZF 4C7QA 2BJ8A 5KG3A 3ZFVA 2QA4G 1VBZA 4RBVA 1HBMB 1S1XA 2Q79A 4MIBA 4DF8A 1FF2A 2YTCA 3D66A 1IR0A 3BQ2A 4C8NA 4ZVOB 4WBFA 3K5NA 1SJ1A 2ZD1B 3QRPA 4LFCF 2YNFA 1CJTA 5ETTA 4ZVFA 2H4WB 2KFZA 1TVRB 2O1PA 2VFRA 4LSNB 4OHZA 1CPZA 4RLEA 4OYWA 5IC4B 1RK8A 1RT6B 1U4BA 2V8PA 1H2VZ 1HHQA 5G0RA 2N4DA 2XCAA 3LWLA 1RHRB 2W4DA 2MZTA 4ZS6A 4DL7A 3VR1A 1FWPA 5C42B 2ADCA 2CNOB 1OWXA 4NLYA 4NZ0A 2DGTA 3A8EA 3E51A 3T9NA 3I31A 3AA8A 4EZ6A 4O23A 4MKVA 4GVBA 1IBMJ 3I9ZA 3DHXA 4LR8A 2XSJB 3VAHA 1XR5A 5IV4A 4DEZA 3MEDA 1OPZA 3NP5A 4ZHRA 5EWEA 5SZTA 1HBUB 2JEJA 3MMBA 4DR3J 5E3AA 1FJ7A 3ET6A 2ZUGA 3J81Y 2X7IA 4R8UA 4PPZA 4IFYB 2XY5A 1U6BA 4TY8A 2PT0A 2ZNYA 2ZNZA 3OSNA 3Q24A 1SJRA 2VL1A 4KB7A 2W1BA 4UUXA 2AD9A 2J0XA 2MZJA 4KIAA 4X4NA 3WC2A 2Z2MA 1Q8BA 2QLBB 4ALZA 2HIYA 1EETB 3X3UA 5HL7Q 1E6VB 3EXCX 4DG1B 4ZMMA 3LPYA 2G1HA 1M0SA 5C2CA 1YX2A 4FDFA 4Q5VA 3I4HX 4M5DA 2K1RB 1LW0B 1KQGB 2BR0A 1NK5A 4ECUA 4OI6A 5LXYA 2HFVA 3VTIA 1W2BR 3PKYA 4WJBA 4DHVA 3CEDA 1HIYA 4YS2A 1U02A 4X62J 3W5ZA 2B9YA 1L3UA 1BQNA 3PRDA 3K0JA 5K8OA 2AJ2A 3GV8B 2FVRA 4DQQA 3M6XA 1ZPWX 3HVTB 4QZVB 4OV6A 2DIVA 4EBEA 1HBMA 4XDCA 5A2QY 3GV5B 1NHVA 5HANA 5BJRA 5KAKA 2LMIA 1TU0B 3RUBL 1TKTB 2E9ZA 4LVOP 3FEXB 2ZD1A 3IR5B 2OJ3A 4C48A 2HAFA 3D0HE 1TVRA 1I94F 2MEWA 3L7PA 3SSSA 3Q8PB 4C8YA 2ZHOA 4P2SA 2UUAF 1UJ5A 3ZZ0A 4LSNA 3W60A 1CJKB 5E0OA 4DV5F 4DR6F 2QN6B 1UVJA 1N8RT 2L9NA 3CT9A 3BEGB 2DY9A 3R27A 3D7SB 2RUSA 2ZE2B 5H1SV 2VODA 3CULA 3DDNA 2D3O1 2XGPA 3TAPA 3UDVA 4J9RA 5C42A 1QD1A 2XB2D 2OH2A 1YGYA 3IM9A 1FDDA 2MKHA 1RAJA 4CH1A 2IPOB 3W65A 4ZP9A 3V2UC 4DBQA 3EM1A 4OHWA 3BR9A 4PYDA 1I51B 1VISA 3HHLC 3PFOA 4IG3B 4AFFA 5D3GA 2AEJA 3W1YC 2OKQA 3MFIA 4FNIA 2XSJA 4G1PA 3MECB 4KRWA 3X1LB 1LFPA 1DTQB 2L41A 4KYZA 4RL1A 3IGVA 2JVOA 4OYXA 1FO1A 3BN7A 2P8IA 1HBUA 1GTHA 2BRKA 1EQ0A 1V5VA 3ZTOA 1VBYA 2Z57B 1GNKA 4IFYA 2H9ZA 2JLFA 4P73A 3FJ2A 5HROB 1GXLA 2FC8A 1T94A 3R7SB 3BDPA 1UMJA 4K4ZA 2F40A 4FYXB 3IGNA 3I96A 3OL6A 5KFXA 1SUQB 3RU0A 1EETA 2ZOMA 1E6VA 4DG1A 2NQPA 2C2OB 3UO0A 3TW0A 2Z0GA 5FD1A 1F9FA 2K1RA 3Q8SB 2VPZB 2JVRA 1LW0A 2JC0A 4OLOA 2DGVA 2FC9A 1CJVB 3W63A 2VA2A 5HBMB 3K57A 5KG6A 2FJBB 4J9VA 2NSCA 3PZPA 3GIKA 1VIXA 3A4TA 3NGSA 3SDEB 4Z2XA 3M8RA 5KFBA 2ZZTA 2M7SA 2NR0A 3AQPA 4DPYA 3S1TA 3FGVA 2F65A 1DFDA 4OZ3A 1HI1A 1N52B 2BA9A 3H8YA 4U96A 4DSIA 3IMQJ 3O44A 1S6UA 5LM7E 4OZ5A 2Q1LA 5M2UA 5KFFA 2LQJA 2B8PA 3MM5B 2F9DA 3AB2B 1NNDA 1X4AA 1M1KT 1TKTA 2L9WA 1L5UA 3CJRA 4X64F 1P1TA 5F9LA 2KHCA 2GCFA 1BWEA 4KO0B 3AJ2A 1GXUA 4C0HA 4ZVUB 4IOBA 3T1HF 1YZ6A 3HT0A 1CJKA 1U1MA 2Y8WA 1AROP 2FLOA 2M88A 3K8VA 1L3SA 2V5HG 1BE4A 2PMWA 1VLOA 3G96A 2XMUA 1PC5A 3OR2A 5L9XA 2HW3A 2AEFA 3PW2A 5DDPC 3UCGA 2ZE2A 3G71S 4RW7A 4M5NA 3H5YA 3N6LA 2M3DA 4CTAB 1ZA2B 3M8YA 3IA0A 3G9CA 2WOMB 3JS9A 4K4WA 4DR2J 4A8FA 3FKBA 1NSAA 1IWAA 2GMJA 4J9SA 1U09A 3NOCA 3C14B 5HMYA 2N4CA 2DIUA 2RH3A 4GO7X 4J9LA 8AT1B 4IG3A 1QVGR 4B3OB 1U2RA 1M5KC 4DF4A 1X31C 3MECA 2V2ZA 4K4TA 4Y2IA 4GKJJ 1Y00A 1WSRA 3NGTA 1FE0A 1DTQA 3ILLA 2LQ8A 1KTQA 3KLIB 4RR5A 4H4KC 3ZZTA 2MKKA 3CMAS 5ETNA 4LF8F 5GMEA 1TL7B 1WC5A 2ILZA 5IWAJ 2HHSA 2G0JA 2J7WA 2RIJA 5HROA 1GAOA 2ASLA 1N5YB 4ZP8A 3W5YA 2Y3YA 2DR9A 4MJKA 2XG8A 1SUQA 4X4TA 2FQQB 4MK7A 2LCWA 1BQMB 3PYGA 1F3VA 4HLBA 4CCHA 2DNZA 2DT9A 1X9WA 3MPWA 5HQLA 2XWYA 2W25A 1TAUA 3HVWA 1CJVA 2DEIA 2ZH2A 1XNRF 5HBMA 2A6OA 3W61A 1W2IA 3GJRB 4GRSA 3PW7A 2DR5A 3UN2A 2V34A 4F4ZA 1FJGJ 3ENWA 3SDEA 1JMTA 4JI0J 4B9NA 3CJ5A 1RAEB 5K5MA 3BH7B 4OHXA 4MKBA 3NS7B 3OFEA 2WVCA 1VI7A 4CO4A 4Y2MA 1HD1A 3SSRA 2Y1RI 3ADAC 2K8GA 4ZDNA 3MM5A 4ED3A 1F1BB 1EB0A 5F3TA 4DR1J 2I38A 2GGPB 3N28A 3RB3A 3Q8VA 1T02A 3LO3A 2FZGB 3KTQA 3ZTRA 3K5LA 1NPRA 3UPFA 3VWSA 5I3PA 1YDLA 2AMCB 3PKMA 3QMQA 3W9HA 5I3QA 3OTBA 3R3TA 1JLEB 4ZP6A 3TX8A 2LKZA 5BYRA 2MQMA 1U1QA 4CTAA 4OX9F 3A8JA 3MAQA 2WOMA 4LFAJ 1R6YA 3CWJA 5AXLA 3C14A 3P5BP 2GVZB 5AXNA 4ECTA 3NLCA 2MY7A 2JEGA 1UPPA 2OMOA 5KT4A 3M30B 4B3OA 3GG0A 3BO4A 2XNQA 1FT8A 1S57A 2M9KA 4GKKJ 4ECXA 1WEXA 3MEEB 1O51A 3PYFA 4DWIA 1V5IB 3ZNJ1 3KLIA 5K9FA 3LP2B 3EVMA 3M4XA 2U1AA 4DPTA 3ZC4A 1TL7A 2BJ3A 3UDLA 4NLPA 4P2XA 1RT3B 4ZVTB 3ULHA 4I69A 5BR8J 4RW4A 5IOLA 5KFRA 2FDNA 1N5YA 2KHDA 4WFAQ 2M5YA 1IJFB 4ECSA 3R7NB 5C25B 4NYPA 4AL7A 4Y34A 3F73A 4ETXA 3V6DB 2KH9A 4FF1A 3CO0P 4X66J 1UA0A 2J9DA 5HJXA 4DV7F 3MM7B 3R5CA 3SEOA 4TYBA 1RA6A 2ZKTA 1FFWB 3P45B 4I56A 2ROEA 3PO5A 4TU8A 5HMZA 5AT1B 2YKQA 2ZHBA 2R9LA 2CVIA 3UDEA 2YNGB 1YJ7A 3EXYA 3E2EA 1RAFB 4CLYA 1J27A 2ZH9A 2HNYB 1LFWA 2RHQB 3KWMA 2AYMA 5GAHI 3MCOA 2VBYA 2F9JA 2MLYA 2EI5A 2PA8D 1CG2A 4YFUA 1FTRA 1X7VA 3VAFA 2ASJA 1WC0A 3IP0A 2GGPA 3BSAA 2ZM6F 1NK6A 1RBOB 2XHWA 4AQYJ 1IKWB 1XK8A 3FNNA 4CH0S 4DI6A 1C4CA 3CNQP 1SL1A 1BLUA 3GR1A 2JNJA 4CDIA 4IYQA 4PG6A 1HMVB 2KU7A 1T03B 2AYBA 3JXOA 5IXUA 4HVZA 8ATCB 1PJ7A 2HHXA 1JLEA 3MMCA 5I42B 1IBLJ 2HSEB 4NWBA 3DYAB 1RHJB 3DRXA 3W3SA 5E3QA 2R2SA 5JMNA 2MY8A 2WB1D 2W2MP 3PCOB 1XR7A 2W8KA 3IRXB 3IBWA 3VVUA 4UOGA 1GT8A 2QLWA 2VDHA 2HG4A 2E9RX 1WWHA 3R5GA 2BBEA 1EKSA 2J9EA 4OFZA 3M30A 2YBVA 1Q78A 4F25A 1G4CA 5F0UA 1WI8A 2W7OA 2DGWA 1LV5A 3MEEA 2W7PA 3OD2A 1FA0A 3LP2A 3GIIA 4N76A 1XMQF 4PR6A 4DV0J 1YBAA 3HP6A 4NLUA 1WSVA 3RAQA 3MXHP 4O3NA 1RT3A 2DR6A 2BJ1A 3LA0A 2HWIA 4ID5B 1WEYA 1FJEB 2J0WA 3CCVS 3OFFA 5C25A 3EWGA 2A1BA 3WDOA 3CUNA 4DU8A 3V6DA 2J5AA 1NJYA 2V67A 5LJ3Y 1S0MA 4F7VA 4YY3F 1PCAA 5ETMA 3UN5A 4UY8T 3MM7A 1DQAA 2DNHA 3C15B 1B0PA 1QAJA 2ZZMA 3D28A 1JLFB 4PXDA 3SYZA 2LP4A 3MCSA 4B9UA 1C1BB 2VBXA 1ZPVA 3BKFA 2DH7A 4R0JA 2QX0A 3VHQA 1HNVB 3AXKA 4C3KA 3L95X 4LR7A 4NI2B 4LF4F 1N48A 1Q82T 1JB0C 5JXSA 2WAQD 1QTNB 3K17A 2ATLA 4NLVA 2QFJA 5L1IA 1AFJA 1Q81T 4X4RA 1JK9B 4H4MB 1IKWA 2CQPA 3LANA 2MPUA 1F5BA 1RABB 2R7SA 3RRKA 3RB6A 4JB8B 4XDDA 2JX2A 4MMOA 4X4VA 4B9MA 3RW6A 4KJIA 1HMVA 2AJ4A 1B0TA 1PILA 2MSTA 3UVJB 3B6BA 4J9NA 1WDDA 2QA4S 1N54B 4C8MA 2KYXA 2W2OP 2VQEJ 3RRGA 3NGDA 3TAQA 2G2OA 5I42A 1B99A 4AYBD 3DYAA 2J0QD 3E01B 4JI1J 4OI2A 2IM3A 2WSEC 5ETLA 4C8KA 3MM9B 4F4XA 3CJ3A 2NSBA 2WVDA 4OYAA 3PYEA 4LT6A 3A8IA 2AGPA 4OX8A 4JP8A 4CH7A 3H5XA 2CZ9A 2EG2A 3MHYA 3J80Y 3FBEA 4DR5F 3U1LA 1B7FA 4X84A 1JKHB 2B4OA 2IJFA 3QJLA 3MOZA 3N9UC 3FBCA 2RVJA 4LREA 2NYHA 4F0KA 4J91A 3CIZA 2YWGA 1J5EF 4F4KA 3CCWA 3RZAA 4JYAF 1TQLA 4WFNQ 1KHWA 3QFWA 2L9DA 1HBNB 2MTLA 3D4JA 3TJ9A 3QPIA 3BBCA 4IRCA 3FMBA 5BYQA 2V4RA 1G6BA 4NCAA 1EZZB 4F26A 2WSFC 4EK2A 4YB7A 4EU0A 2E29A 2EFQA 1R0CB 4ID5A 3NCPA 1HLWA 2H5EA 2IBOA 1MROB 3GSIA 5A8WA 3S7RA 3ZZZA 4LSLB 1DQ9A 1HNXF 3GE9A 1TAQA 1U0SA 5KG7A 4CT9A 2FUG9 1KKHA 1CSJA 1I3OB 3C15A 1SQEA 1ZOTA 4LF2A 2VASA 1JLFA 2G9OA 1Q8IA 1UEKA 1C1BA 2CADA 2MKIA 2RJZA 1HWLA 1VS3A 2DNRA 1HNVA 2V8GA 2EXUA 5LJ5Y 4NI2A 2CQ2A 2COLA 3KKFA 3OTDA 5E7OB 1RLCL 4TLRA 4OHVA 1NB2A 4IR1A 1XWLA 4YN3B 4OX7A 5AJ3J 2B6AB 1JLQB 2QLXA 1ZAXA 1JLCB 2RS2A 1CJUB 4H4MA 2NPFA 2DCLA 5HVGA 2HLUA 3BH6B 2XHCA 3RB4A 3BGFA 4ILMA 2R7VA 1YITS 5KFQA 4PG8A 1LWFB 5E3RA 5D0RA 2OAUA 4OJ1A 1UP1A 2GIRA 1PSDA 3TEGA 3TO8A 3UVJA 2CPIA 1HR0F 4WP3A 1MG7A 2YY3A 3LQVA 2A6MA 1Q7LB 5CXTA 5KFPA 2IMWP 3H25A 3E01A 3CB4A 2Q6BA 3FVYA 4HI2A 2GZOA 3MM9A 4WXOA 4YR0A 3BYRA 3Q22A 2DRBA 1FESA 1NDLA 5CZXA 3DM2B 2AEMA 2E1MC 2AZ3A 2HZCA 1XTZA 2QGFB 4WWSA 2OEJA 1UFLA 4DL0C 4DFKA 1S4FA 2FLNA 5EX3A 1S79A 2HZVA 1JKHA 4C8OA 3BSNA 3MM8A 2M2BA 2DD8S 3PACA 4G65A 2Q3PA 3FK4A 3L4BC 2PI4A 2E1CA 1NDPA 4IQMA 1XR6A 4DV6F 1HNWJ 4LJMA 2JLEA 3D1QA 3BQ1A 2K7JA 3W2VB 1OIAA 2R8HA 1N5TA 1HBNA 3GJSB 2ZH5A 3QO9B 2GIQA 2NYIA 4NLXA 3OJSA 1K0VA 1LQ9A 3AD8C 4J9MA 5LT5A 1N88A 3BBFA 3RAMA 2R4FA 2L08A 4Q0BB 3H42A 1H38A 3NY0A 3KNAA 3O1LA 4GC7A 4LRCA 1MROA 4WFXA 2HHTA 3FCHA 3D1HA 2QE5A 1TELA 2XI2A 1JNRB 4LSLA 3TARA 3V5RA 4J9QA 4DR4F 1RHMB 2HHPA 4X2BA 1H2TZ 4P2MA 2KDOA 3SV4A 4UT4A 2RMLA 4QW8A 4FPRA 1HPZB 1DZ5A 1BC6A 1IVZA 3PJ9A 1FKPB 3VV2B 2XMVA 4QIFA 2FGOA 2H54B 4LF5F 1IKYB 1GMUA 2DYAA 3EVWA 4DFJA 3TJAA 3M7VA 3KLGA 2QMXA 4ZIWA 4DOZA 2YQ1A 1RT1B 1U1LA 2KTQA 1QLNA 4Q44A 4DV2J 5E3CA 4DMZA 5HP1B 3I0RB 2ZJPQ 5D78A 2B6AA 1JLQA 1S6OA 2OGUA 2O3DA 1N6QB 1JLCA 1CJUA 4NYOA 3CJKB 6FDRA 5T41A 2QG9B 1LWFA 1JX4A 5DO2A 1SC4B 1FXDA 1X4HA 3MPUB 4PQAA 2OFHX 3GSDA 3M8PB 4K4SA 4M5HA 4YEAA 3QNWB 2OLWA 1IKVB 1AZSB 4K2XA 4HT5A 1RBAA 3H5SA 3PJWA 2VG7B 5KOXA 4I2PA 3R6LB 4B3TJ 4N7TA 4DL5A 3OVAA 1XC9A 2OPRB 3HFKA 3U7JA 1YRTA 2MKSA 1AA1B 3DM2A 2XGQA 4ENOA 4C97A 1D09B 3SCLE 3O5TB 1VYAA 2BZ2A 4KY3A 1JLAB 1PBUA 2BMBA 4P75A 3TZXA 2GNKA 1U1PA 4X4PA 3B82A 1WC6A 1R0BG 3AOBA 3FQLA 1HWKA 4IH5A 5CA5A 1TUGB 3S01A 3UD5A 5T7LA 2AX0A 3O8WA 4B9SA 3CCQS 2RD5C 4A8WA 1PIEA 2OPQB 2E5LJ 3FSXA 3W2VA 1FRXA 2WSCC 2HQGA 2DPJA 5I3UB 1EHWA 3QO9A 4L76A 5B7WA 1C0TB 3C2PA 1VK8A 3LGNA 2BVZA 1FNMA 2C3PA 2CQHA 1WC4A 3CMQA 1M5SA 3M8SA 4NXNF 1HL6A 2XS2A 2V2VA 4Q0BA 5KOWA 3BKUA 4OI0A 1X5TA 1NH8A 2DJWA 2C3YA 1NCLA 4B3RJ 2WK4A 1YJVA 1H7XA 5AE2A 2EFPA 3DOMB 2G13A 2HHUA 3CDAA 1UVMA 3JQJA 3IR6B 4K7QA 1VQ6S 5DRKA 3T5HA 4TYAA 5C7PA 4DQIA 3PHEA 4F3QA 1HPZA 2BE2B 1AB8A 4U8VA 2D9PA 4NZ7A 1FKPA 3M9MB 5D15A 1FRKA 3MOJB 4JI3J 3MR5A 4NXMJ 4P10A 5L39A 3JTPA 1IKYA 4RU2A 3PTWA 4NEZA 2QO3A 3HZGA 2LU2A 1N0VC 4OI4A 2BQUA 3CGIA 1SVDA 3H0PA 2XTJP 4UOHA 4HEA9 5CQGA 1AXQA 4RU9A 1TL1B 4W92B 4PUOB 5KFUA 4OZ1A 4KT0C 1CC8A 1K0TA 5HP1A 1HNIB 4ZA1A 3OTOJ 1DURA 2YH1A 3I0RA 9ATCB 3HSGA 1KS2A 5LMUF 3LH2S 2KKHA 4ZPAA 4I6AA 1UEVA 2CPEA 4LF7J 2NXJA 2AJQA 3NS6A 3KJNB 5KFJA 2VBWA 2BKOA 4HH1A 3CJKA 4MT1A 2UXBF 2KN4A 4E8UA 3PRBA 2DY1A 3M8PA 3FRYA 1PKUA 5AE1A 4P74A 2DRAA 3SSQA 4WZMA 3TRGA 1IKVA 1AZSA 4ED8A 4C8LA 1SJ4P 1ULRA 5DG8A 2OI2A 4KFBB 1VQPS 3EPGA 4QYZJ 2MKCA 4ZPTR 3GU0A 2OPRA 2OD6A 3D67A 1HNZJ 4F0MA 3OHAA 1VBKA 3GTYX 1RKJA 1PC4A 4PWDB 5HI7A 3IO1A 4K0KF 1UZHA 1JLAA 3LAMA 2CQBA 2IFXA 2U2FA 2EKNA 4WFYA 3Q86A 3UFCX 3RJMB 3PJXA 4NLGA 3GJTB 2ZJRQ 2GQ2A 2LXFA 1U1OA 3RR7A 2R2UA 1IBKJ 4PXCA 3WQPA 2YKOA 1MN7A 3CMES 3DXBA 5I3UA 1HI8A 1VQ4S 2I9SA 4DR7J 4E0DA 1C0TA 2UUCJ 3IM8A 2PE8A 1CBKA 2VOPA 2FIUA 4Q8EA 3D54A 2NREA 1AFIA 2O66A 2C2RA 1N36J 3F56A 4OL8A 4LRFA 2WCXA 2KZZA 1FDBA 3A8KA 1WHWA 2KXHA 4KKOB 3DDIA 1S6QB 2N82B 3FCVA 5KFWA 2RDJA 4MTPA 4WCEQ 2V6AA 4ZJOA 3V81B 4F4AA 3NXZA 1RSCA 2BE2A 1IM4A 1IR2A 3CJ2A 1SBRA 5ETVA 2UUBJ 1VC6A 4WF9Q 1WELA 3PIPQ 2Z58B 4I2QA 2UZAA 4OJHA 3GIJA 3FEYB 1VHIA 5FLXY 2YPZA 2QMUB 1B3TA 1SH2A 2IYGA 3PM9A 3OTCA 1TL1A 3QAEA 1WF0A 4PUOA 1LKZA 4JI6F 1BUXA 1H74A 1HNIA 2HIQA 5I4MA 1QE1B 4ES2A 1VBXA 2XS5A 4J9PA 1XNQJ 4JI7F 3QRRA 2NUUG 2XLKA 1MU2B 1OSCA 2R42A 1RE1B 1UVKA 5IT4A 1UKUA 5IZHA 3SCJE 2YKMB 2DR7A 2DHGA 2LQ5A 1R6VA 2JEFA 2ZHAA 3LGHA 2OEMA 4WFBQ 4C6AA 3KG4A 4NA1A 3G6YA 4HTIA 4LQ3A 2KXFA 5F8JA 3TWZA 3KK1B 1SIWB 3RAXA 1S72S 2JH3A 2CNLB 4LF9F 2NZ4A 3BGRA 2CJAA 3NNAA 4KFBA 3BPDA 2V2KA 1Y0HA 2MKJA 2N7YA 1N33J 2AF6A 4PWDA 2KL8A 2QYGA 1YBTA 3KG1A 2JJ4D 2EK6A 2AKWB 3AD9C 4FF3A 4RUCA 1SC3B 1R8BA 1OQ3A 3LP0B 4ZLJA 2ASYA 3NCQA 5J2NB 2V2QA 2VFTA 4DL3A 2XMAA 2DPIA 5HVFA 4YB1P 3QT8A 3UNYA 2HBRB 5ETOA 3RW7A 3BV8A 1WORA 1C4AA 1WG1A 3TQ1A 5BYSA 1G7CB 5KFIA 4RWXA 1DTTB 2PI5A 1NSQA 3I5BA 1BMQB 4M63A 3FRZA 4L6V3 4YB5A 4N8OA 4OZLA 4DUYF 4F36A 3U02A 3G6ES 4OI3A 2XEXA 4DV3J 2EFOA 1TTHB 1QSLA 3THPA 4H4OB 1I5OB 4KKOA 3NMAA 3PFEA 1JJ4A 2OUGA 1S6QA 1WC1A 3JYTA 4JI2J 3DLEB 3FEZA 2C28A 1RWXB 2DXFA 2V8DA 2CFXA 4DDFA 3V81A 4ICLB 3ISND 1U24A 1EJ7L 3HD1A 2B4UA 3GV7B 2AYEA 1U2FA 2KJVA 5DDQC 4BCAA 3IBCB 4G6VB 5HQ8A 4ZVRB 5HJYA 2ZH4A 5D4OA 2HFNA 2XCPA 4LVNP 4DUZJ 2NLWA 4Q2MA 1T9TA 1FD2A 4NLDA 2K06A 3EDRB 1AW0A 1UTAA 4N8NA 4G1QB 1T05B 3DKDA 1KN6A 1QSSA 5A8KB 2QJ3A 1FNOA 3K59A 1KLMB 1TFWA 3D68A 2CJBA 2DNPA 3M2RB 5DZ6A 3PX6A 2D1CA 3DN9A 2FY1A 4LFCJ 1MU2A 3OVBA 2HFZA 3BBBA 2YKMA 3UNGC 2W2PP 3QGGA 4RW8B 1DAXA 3N01A 5KT2A 3ETOA 1YIJS 3VZIA 2BOAA 4B08A 1ACMB 3HHLB 2GO9A 4L72B 2A0FB 3BSCA 4XO0A 4DSEA 1NEEA 3KK1A 5ITHA 3D3CJ 2E1RA 2DKOB 2Y0BB 3VGSA 1CLFA 1N0UA 4A8KA 9RUBA 3PR4A 5HMWA 1N5SA 2R7UA 1X60A 4YB6A 5IT0A 2UU9F 4O0NA 4FYDA 4DSFA 4L73A 3B8HA 3PV8A 3Q8YA 1RAHB 2H3EB 1KHVA 2D69A 2YX1A 2ZDPA 4K5RA 3LP0A 5J2NA 2IAJB 3IWLA 3FBFA 4WE1B 2ZWOA 3DLJA 2GQQA 3TOQA 2BJ9A 2O5DA 2JEIA 2CZVC 3DLKB 1KSPA 2OO4A 1DTTA 5G0RB 4AT1B 2EFNA 2DGXA 5DETA 5D0HA 3KHGA 4NMLA 5KFZA 2HQFA 2B3TB 2XC9A 1LEOA 2C3MA 4UQGA 1TK5A 1FHTA 3CTRA 1O0PA 1RWUA 2ABYA 2LQ9A 4Y28C 3TNVA 4Q8FA 4H4OA 2VG6B 4CWBA 5EDWA 2G0CA 2KFNA 1CULB 5DDRC 2BV3A 3R5JB 3BPSP 2IRYA 1RLDA 1NKCA 2BQ3A 2CG8A 3DLEA 5DQIA 4ZHRB 2HURA 4ICLA 3DRPB 2BKPA 3OXGA 2YWFA 1VDHA 5LSRA 1PYTA 5GMDA 3J7ZT 2NCKL 4QWEA 1PO6A 3ET6B 4ZPDA 3EYZA 4FF2A 2DB1A 3QATA 4QIEA 1S1UA 3D9BA 1YJRA 4IH7A 2UXDF 4ZN3A 3BS9A 3KMQA 2CQCA 2B43A 5LMNF 4M95A 2IIHA 3GP9A 3B54A 3IBFB 3DCAA 2AU0A 1HBOB 4K4UA 2ASDA 1T05A 5D6GA 2J8AA 5A8KA 4EO6A 2CYYA 2PA3A 4BS2A 2E5GA 4N56A 3DOKB 4K4YA 4B3SF 3I4PA 2B4VA 2IVMA 4Z37A 4OZJA 1NJXA 3NL0A 2XZTB 4Y65A 1I94J 4RW8A 2L3MA 3IRWP 2UUAJ 1HWJA 5IQQA 4O4RA 4DCPB 3HHLA 1KQFB 4DV5J 4DR6J 1NSPA 2APOA 4U8YA 3PR5B 1Y5NB 2KB2A 4CP5A 4I0WA 1YSJA 4USKA 4DXLA 1TK8A 1JJCB 5G4DA 2PMHA 2VG5B 4CYUB 1FEHA 4R25A 3PEHA 4BBYA 4USIA 4HR2A 3HFZB 2BANB 3K5MA 2FJDB 4C11B 4KGVB 3WZ0A 3HLUA 2K2PA 1G3OA 3KUGA 2IAJA 1B0VA 1VRQC 3MAAB 4WE1A 3GFZA 2Y9HA 2KJWA 4KR0B 1SKWA 3ZO7A 2V4QA 4DV1F 1OY9A 2A10A 3NS5A 4B17A 2B0GA 5ETQA 5DDOC 4HL9A 3DLKA 1S76D 1VQ5S 1RU2A 3LF0A 2FJEB 2RKIB 4C98A 3JSRA 4DV4F 1KONA 4ZN1A 3KFWX 2RE1A 4DQPA 3KYLA 3R7BB 4JOUA 4ZCKA 3FBBA 3MAHA 1T9VA 1RWOB 3CF5Q 2WBMA 2G2YA 3VF0B 4IG0B 2MHNA 2EWHA 3GPAA 3J81j 2VG6A 4I7FB 2I0XA 5J2MB 2IC3A 3MCMA 4WZQA 3GIMA 1CULA 1KR4A 5D3GB 2QSFA 4EBDA 5CYMB 2RQKA 1G1XA 1KNZA 5E2QA 3MMJA 1FX4A 2CUYA 1RGVA 2VUGA 1F3FA 1VJQA 3DRPA 1NPKA 1YRUA 3BKTA 4IKAA 4AL6A 2HS0A 3KG0A 4W4MA 1T9UA 4NLSA 2IVYA 3VVTA 3UE2A 4NMXA 4K50A 5EWFA 3TUIC 4IDKB 3NWRA 1RWMB 1V9OA 2MZ1A 2OFGX 1HBOA 5ETRA 3G8TA 2GJ2A 5IT9U 2KI2A 4LIWA 3BGLA 2OSQA 2I8EA 3NAHA 4UY85 4B9LA 1EKRA 1RWWB 4IO1A 1URRA 2X1GA 4WIQA 2GX8A 4X64J 1FRLA 3DOKA 3OVSA 3FCWA 2ERRA 1WOPA 4OI1A 4A8QA 4ECYA 3TA2A 1JJ2R 2RSQA 3T1HJ 4ED1A 2ACYA 1I6JA 2B7BB 5ADZA 3RTVA 4O3PA 3UCUP 2GAHC 1W26A 1GK8A 3AT1B 3F44A 1QTMA 3C8YA 4M5KA 4NCGB 4LIRA 3VGVA 2DK2A 4KSEB 4H4KA 1D8ZA 2IM2A 1UCNA 3LOUA 2HQDA 3TA1A 4QWDA 2Z2LA 2O01C 2VZ9A 2VG5A 4UQTA 4CYUA 3C19A 3HHNB 2BACA 3POTB 3EZOA 2BANA 2CQDA 4C11A 1QUPA 3KLVA 4HT7A 4D3HA 2YNHB 1VQMS 3MAAA 3TZYA 4F3MA 2EBEA 2V50A 1UWBB 2HZAA 4J7CA 1NRKA 1TMJA 4Y6IA 1NKEA 3OFHA 4U67Q 4EYHB 4NPOA 1U25A 2DR8A 1RXOB 4WU2A 2EBGA 3M2UB 1RI7A 2DNLA 4V19X 4CI0B 3OR2B 4LF8J 5GMKa 5LOQA 3ICLA 4OZNA 2GV1A 4RW7B 2ZH6A 2RKIA 3T5JA 2CPZA 2WVBA 4C9DA 1X8DA 3BYPA 3OLAA 1OSDA 4ZVHA 3FSYA 4RZRA 7FDRA 3J7AN 1D8YA 4QIVA 3DLLQ 5DLGA 5B08A 3G87A 4IG0A 1RCXB 1UVIA 4QYZK 4XTTA 4ELTA 1YK9A 4I7FA 2WRMA 5J2MA 1VQYA 3MUVP 4IOCQ 3P49B 5CYMA 2D3UA 5KFTA 1RKIA 2ZC3A 3IN5A 4DLGA 1FRHA 2KVIA 3DLBA 5GAGU 4RW9B 1XNRJ 4RW6B 2EG1A 2BE9B 2V63A 1MSWD 4X65F 3NBPB 5KT5A 2W4CA 4RWWA 1BXNA 2HMIB 1RTZA 7AT1B 4ZVPB 2IJRA 3GYNA 3HVAA 1VHFA 4QWBA 1KVJA 2AHOB 4ZPVR 2GO8A 2DNKA 4IDKA 2Y1JA 2FHKA 2RDIA 4UOCA 4L3NA 4WP8A 1CS4B 1ZM3A 1EX8A 1XJWB 4ECZA 2QL9B 4ER8A 5KFNA 2B9WA 4WK3A 3T1AA 3ZZUA 1K1SA 1MMLA 3CD6S 4Y3CA 3VZHA 2EVZA 4ES1A 1NBEB 2F5GA 3RBEA 3A13A 2Y8YA 4KTQA 4JV1A 4J37A 1YRXA 2FHJD 1T7PA 4KBIA 2J7UA 2KRBA 4NCGA 2B8QA 3IFEA 4TN2A 2GQCA 4OX9J 1BGXT 2UVRA 2R2RA 3H7HB 3GQCA 3GR0A 2HEKA 2FVPA 2HLTA 3P3DA 1KC8T 4IUFA 2ATCB 2CQ0A 5F8NA 3POTA 4OV1A 2W9BB 5L46A 3CXCR 1U1NA 2HHWA 2P2CB 2AGQA 2E5HA 3BM7A 1YVFA 2YNHA 4WYLA 2WZ1A 1RHUB 2XYHB 1UWBA 2Y0SD 1T95A 5D8HB 2FTRA 4DU7A 1X4DA 3VGTA 4ZVEA 3M2UA 1U45A 4QWCA 4MYUA 1DLOB 4RO0A 2J8SA 2AWZA 2BJDA 2F4VF 4EMDA 3FMWA 1IR1A 2LDIA 4MH8A 2CJ9A 2F4FA 1R8AA 1S1TB 3VAMA 4Y2AA 3HK2A 5D77A 1U1KA 3DFEA 1WF1A 5CCLA 3N5BA 4NLOA 2MQPA 4B9TA 5B0FA 1X0FA 2HQIA 2CQGA 2A3JA 2QSWA 1Y10A 1S9EB 1C2PA 3W62A 5KFHA 2C2NA 3TZZA 3C16B 5GAHU 2PFDA 1GX6A 4DV7J 3NG8A 3VAJA 4NOHA 4RX6A 4RW9A 4RW6A 4Y00A 1X5SA 2OHDA 3D6FB 1TUVA 3IAS9 3MGJA 3G6XA 3EJMA 4BHQA 3NBPA 5RUBA 4I64A 3J7YU 2HMIA 2HVZA 3GYGA 3IG1B 3DOLB 3PDNA 4KQZA 3QSYB 5HQMA 2MKYA 4RW4B 4WKRA 4EI2A 1BD6A 1NU4A 3M8ZA 3M1VB 4NCBA 4AXJA 2JOQA 3TZWA 1RT7B 1PYSB 2OIHA 1FNXH 1CS4A 1RWKB 1UETA 2FLLA 2VU5A 2BUNA 3NCRA 3MUTP 3MTKA 1FKAF 4U7CA 1DRZA 3KLEB 1N32F 4LRBA 2ZM6J 1Y4ZB 1DARA 1BHNA 3UR3C 3H5UA 4ANEA 4F50A 3JAMU 2DNQA 3W8GA 4KGXB 2R7QA 5H9FK 4F2SA 3QFHA 3MD3A 1XMOF 3MEGB 1YJTA 1PAEX 3QZ8A 1X4GA 2KM8C 1JXLA 2HBQB 2XMMA 3ZZPA 2YKPA 1OO0B 4J9KA 4CO5A 2BW2A 2XY7A 4V19J 4BLGA 4ZP7A 4M5GA 3ZXWA 2VF3A 1GEHA 2YKAA 1Q4RA 2XZDB 1OQ6A 1WHXA 2GC8A 2K3KA 4KHRA 3HM9A 1VCTA 4MKYA 5GAGI 3R8YA 1HWUA 4YOEA 1OPIA 4OYIA 2Q66A 1SQGA 3PY8A 2HS4A 1FD8A 2W9BA 3VAGA 4ZJLA 2VQFF 3D2WA 2WONA 3OL8A 2DVIA 1U7LA 4QQBA 1S9GB 2DGQA 5KG1A 1APSA 4NX9A 2EEYA 1X4EA 3OHBA 2J6SA 3EX7B 3OPKA 1WOSA 2GJFA 1GMWA 1OS5A 5A8RB 2B51A 1Z2ZA 4U95A 4BDPA 1ZA1B 2BJ7A 1RAAB 1FX2A 3MMCB 1DLOA 1XMQJ 3BGUA 3CE8A 2A18A 4JI5F 1VQ9S 3EZ5A 1IUJA 4FPIA 2V69A 1HI0P 1XEZA 3WX8A 1S1TA 3UI3A 1BWVA 3T1YF 1A9NB 2GVDB 2XWXA 4NRTA 1RYSA 1YJ9S 5J2PB 1M5VC 5IS2A 2W4PA 2XULA 1KLNA 3Q8RB 2Z4PA 2QIFA 3MM6B 2VBZA 4PXBA 1S9EA 1D9DA 5GADU 3C16A 2J76E 4JI8F 1A0OB 4YY3J 2J6TA 1PJ6A 2MMYA 4HDGA 2M4MA 5L1KA 2LQBA 3NWGA 3ZNUA 3DMJB 3HPOA 3TUPA 2KZMA 2YQ0A 2B9XA 5D4NA 2RQ4A 3J81U 2NXNA 4CLFA 3IG1A 3DOLA 3S8SA 1PGZA 3R2CJ 1RP5A 2B4PA 3K58A 4LF4J 2DH9A 4BWJA 2QV6A 3W64A 5CAAA 4X4UA 3M1VA 4OMFG 2BKNA 5L8RC 1RT7A 4OYZA 2YNIA 1FWKA 4LFBF 3QIPA 1ZZNA 3CVKA 2JSXA 2M52A 2MSSA 3G82A 4LQ9A 2LXUA 3PW4A 4A4JA 2C1EB 2L48A 3NNCA 3Q83A 4MK8A 1JXVA 3KLEA 5H9EJ 4O3RA 1VQ7S 2PEBA 4FP9A 1FRMA 2HRUA 4OHYA 1GH8A 1N34F 3VQSA 4OZ2A 4ID8A 4A46A 2FJVA 3OR1B 4B3MF 3D6TB 1K9MT 4DFMA 3MEGA 4PABA 5D4LA 2ZBIA 3G6VA 1JLGB 4YHHF 4JI4F 1LOUA 3L7OA 2M0GB 4UUWA 4RUHA 2FHMA 2ROGA 1HARA 1FCAA 2XYGB 2MYFA 1R8CA 2LEPA 1J5OB 4NLWA 5D0EA 2R8GA 1QM9A 4J5OA 4USVA 3WIUA 3Q23A 3HDSA 3V4MA 5DS7A 1IWGA 3GONA 2RQMA 1X4CA 2P6TA 1SC6A 2IJNA 2JHEA 4ED0A 3P6YC 4OIXA 4DR5J 2M70A 4NYZA 2AW0A 3J7YI 4DQRA 2CQIA 3EGZA 4IRKA 2BE7D 4U9RA 1WKKA 1S9GA 8RUCA 1J5EJ 4R5PB 4JYAJ 3G8QA 2BQRA 1MN9A 1Q5YA 1QVFR 5A8RA 2Z56B 2CNNB 4ECQA 1D9FA 1F5CA 5D4PA 4ILLA 1RAGB 4YP3A 1S4EA 3MF5A 5HAOA 1UFWA 2J9DE 3K5PA 5E41A 1NZAA 2E1AA 5B09A 2VKZG 4USUA 3CJ0A 4LF6F 4MK9A 4CQ1A 2GVDA 5HN0A 3GFYA 2DGUA 1UJ4A 2YH0A 5J2PA 1U8SA 2HHVA 4EGLA 2DHSA 1KQKA 1GTEA 4P71A 4MKAA 2HVHA 4MAKA 1HNXJ 1OYEA 3MM6A 3KK3B 2VH7A 2R7TA 2MJUA 1KVIA 1F5AA 2JDJA 3QT7A 5MAOA 2DH8A 4TNOA 1KFSA 1D0EA 1U6ZA 5B0BA 2H5IB 1NUEA 2ZH3A 2BOPA 1U48A 2BDPA 3DMJA 1FWLA 3T5KA 1WACA 2KXNB 4ZOSA 4HHUA 2FY8A 4KPYA 2E7WA 5IFMA 2PDAA 5EHHA 3HHLD 1Q86T 4A8OA 2V4JB 1UJ6A 4Y0FA 1RAOA 4FNHA 1ZYQA 1R8HA 3TA0A 2P5VA 5A8WB 3EPIA 4USJC 3RGIA 3NAIA 1SL2A 3HX9A 3L9ZA 5L1JA 2MJNA 4CZCA 3ILIA 2XNRA 2HGNA 4ZCIA 4FVCA 3OSPA 4O3SA 2J0SD 2V8VA 4CT8A 3HXMA 1S9FA 4PPDA 5DGAA 1MWYA 2MB0B 3OR1A 5B0EA 4URSA 1B70B 2VKRA 3CSKA 1JNZB 1HR0J 2OTJS 1JLGA 3OBIA 2ZBQA 1HQUB 1MLAA 2IM0A 2EFVA 1D3WA 4A48A 1J5OA 2HBZB 1YJNS 4DX8H 4KGZB 1ZM9A 5GADI 3QGIA 2ILYA 5AXKA 2OD4A 4N77A 1ZM2A 3ONQA 4OYPA 3I5AA 4PG7A 2PSZA 1R7IA 1E6YB 2VC0A 2QEXS 2EW9A 2CDQA 4XK8C 2CJYB 1U0HA 2PGCA 2W7AA 1Q5VA 3R9LA 5DM6Q 5K14B 4U7UK 2HAIA 2LYVA 5SUHA 2JC1A 3HF5A 2W9CB 1TKXB 1KTVA 5AE3A 3BO2A 4I68A 4EEYA 2VJUA 1PG5B 2AJFE 4DV6J 4R5PA 1URNA 4B02A 1PAUB 5J1EB 2QLFB 2C22A 2QTWA 4CO1A 4ZLNA 5FIIA 3QRQA 2BM0A 3RYLA 3FFIB 2ZH7A 3N5FA 4QR0A 4CLLA 3KLHB 3UR0A 3FQKA 5M2RA 5T14A 3ITHB 2FJXA 3LWMA 4DPUA 2GMLA 1ZTTA
chains in the Genus database with same CATH topology
3RB3A 1S0VA 2HHHF 1U2FA 2UXCF 4HKQA 1T02A 2KJVA 3LO3A 5DDQC 3KTQA 1VIOA 2C42A 1BQXA 3WX4A 3AY0A 4X4QA 4BCAA 1FXRA 3I87A 4G6VB 3K5LA 5HQ8A 5KT7A 4CIOA 2BABA 3UPFA 2ZH4A 5D4OA 3VWSA 5I3PA 5LSLA 3KHRA 4AE5A 1M5HA 1S48A 2HFNA 3CPWR 2XCPA 4LVNP 2NLWA 3SCKE 2X51A 4Q2MA 4I6YA 3HI9A 3V6KA 1U26A 3PKMA 4NLDA 1FD2A 3MM8B 2PMZD 3QMQA 3RR8A 3KK3A 1AW0A 1Q53A 4N8NA 1HYSB 4QIGA 4G1QB 5I3QA 1Z4UA 3OTBA 3T3FA 1FDNA 4TQRA 1T05B 1KN6A 5DG7A 3R3TA 1QSSA 1M5PC 4RKUC 3FZ2A 1JLEB 4WTYA 5A8KB 4ZP6A 1RT2B 3TX8A 1FNOA 1KFDA 1ZZFA 2SXLA 3DU6A 3K59A 4IR9A 3MUMP 1KLMB 1S0OA 1HNWF 3U1MA 1TFWA 1H7WA 2XSFA 2CJBA 2DNPA 2LKZA 3QGPA 3M2RB 5BYRA 2C2EA 2MQMA 4TLQA 3PX6A 1U1QA 3DNCA 4KHMA 2D1CA 4KHPF 3DN9A 4ZPWR 4CTAA 2AX1A 4ED2A 4OX9F 2FY1A 4QU7A 1MU2A 3Q2TC 2YWKA 1C0UB 3OVBA 2HFZA 1YWXA 1P27B 4TU7A 1KQSR 2A2CA 3MAQA 2UVUA 1NO8A 2WOMA 3GILA 4ITSA 2UUTA 3CDEA 2YKMA 3UNGC 3WC0A 3LALA 3GG1A 3QGGA 2R8KA 1R6YA 3CWJA 5AXLA 4RW8B 1DAXA 3N01A 5KT2A 3ETOA 4I67A 4A8MP 1YIJS 2QT7A 3VZIA 5EX0A 2PIIA 3JSBA 5JVHQ 2NUHA 4EWTA 4YDDB 1NJZA 4B08A 1S97A 3HHLB 2GO9A 4L72B 4OJGA 3BSCA 1RT5A 5AXNA 4ECTA 3NLCA 4XO0A 1RTJB 2MY7A 1RT1A 3HHDA 2RRAA 2JEGA 1MNEA 2OMOA 2V4JA 4P7VA 5KT4A 5B0AA 4DSEA 3M30B 1NEEA 3KK1A 3VAKA 5ITHA 4B3OA 1S7HA 2E1RA 5A0YA 4C0BA 3GG0A 1RT6A 2XNQA 3I6PA 3BO4A 3SFGA 2RT3A 1FT8A 3DXSX 4ZCMA 1CLFA 3V4IB 1N0UA 4A8KA 5EUHA 3KJVB 5C24B 4Q2LA 4N41A 2M9KA 1X5PA 2FVCA 3Q8QB 1V6HA 2D41A 3PR4A 4ECXA 1WEXA 4JV5F 5HMWA 5KFKA 3MEEB 1N5SA 1O51A 1Y5IB 1H3DA 3OQ2A 1Z1ZA 1ZH5A 4DWIA 1N6QA 2ADBA 3KLIA 2RUGA 5K9FA 3LP2B 2R7UA 2GJIA 4YB6A 1R27B 3C3LA 4MIWA 2F8MA 5IT0A 2UU9F 3M4XA 2U1AA 2W8LA 1TV6B 1JXEA 2LU1A 3ZC4A 2BM1A 4AL5A 4FYDA 2IA6A 1B64A 2MGZB 4DSFA 2RILA 1LK5A 2VD3A 3B8HA 3PV8A 1R3NA 3UDLA 1FXLA 4MIAA 4NLPA 1RT3B 3ULHA 1NB7A 1F0XA 1KHVA 4I69A 4RW4A 5KFRA 2YX1A 2ZDPA 3D0IE 2FDNA 3DRRB 3LW5C