1R0AB

Crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*A*TP*GP*CP*AP*TP*CP*GP*GP*CP*GP*CP*TP*CP*GP*AP*AP*CP*A
publication title Nonnucleoside inhibitor binding affects the interactions of the fingers subdomain of human immunodeficiency virus type 1 reverse transcriptase with DNA.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 103
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1r0aB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r0aB03
1HNVA 4KE5A 2V0NA 4RW9B 3MEDB 3IRXA 2FVPA 3BQ0A 3V6HA 4MH8A 5J2NA 1XR7A 1S1WA 4TN2A 1LWFB 5KFIA 2YNGB 4KFBA 4M94A 4QPXA 4FS1A 4WZMA 1HNVB 1TV6A 1RYRA 2W9CA 4J9NA 3KLGA 5KFVA 1IKVA 4WE1B 2E9RX 2R2SA 4PWDA 1GX5A 4NLGA 3DLGA 2YNIA 5J2NB 3H4DA 3EPGA 5J1EA 3RB3A 4KFBB 3I5BA 4KB7A 3M9MB 3BQ2A 4ZP7A 4ECZA 3MFIA 1BQNA 3Q8RB 3GIKA 4ECXA 1TV6B 5DGAA 4NLOA 4NRTA 3MR2A 1TKZB 3MF5A 3SFUA 1SV5A 4K4ZA 3DLGB 4Q8FA 2YNIB 2HNYA 1RA6A 1EETA 1S6PB 5KFZA 3LAMA 1TVRA 4IG0A 1QUVA 3CJ0A 5C5JA 2AX1A 2JEJA 1DTQA 1YVFA 2IM1A 1D0EA 1BQNB 1K1SA 5KT4A 4J9KA 1RT2B 5D3GB 4TY8A 4ZHRA 3SFGA 3V81A 1C1BA 1RTJA 1IKWA 5C25A 1EETB 3OLAA 4IH5A 1JLAA 2V4RA 5I42A 4FS2A 4IG0B 3KLVA 2IM3A 5C42B 1DTQB 2OPQA 3LP0A 4TY8B 2ASJA 4ZHRB 4F4WA 3V81B 1C1BB 4I2PA 1IKWB 3DLKA 1C1CA 3BSCA 1LWEA 4PUOA 4K4YA 1JLAB 1JLFB 4DL7A 3NBPA 4QWCA 4O3NA 4LQ3A 4RW4A 1RTDA 4NLWA 3LP0B 5KFKA 5EUHA 4Q44A 4YQWA 2VG5A 1LWCA 2OPPB 3KLIA 4RW8A 1N4LA 4I2PB 4YR2A 3GIMA 5DLFA 3DLKB 4O4RA 1C1CB 4K4XA 1NNDA 2YNHA 1S6QA 4PUOB 2ILZA 3I5CA 3QZ7A 1RT1A 5KT6A 1VRTA 2HNDA 2F8EX 1C2PA 4RW4B 1RTDB 2R8IA 4J9MA 2J6SA 4U7CA 5L1JA 1JIHA 4IFVA 4WFYA 2VG5B 4YMEA 3KLIB 2XGQA 4RW8B 5C24A 3M9OB 4R8UA 4Y2CA 4QW9A 2YNHB 3KMSA 5KFAA 2B43A 4ED7A 2XGPA 3LANA 3H5YA 3HHKA 4ZP6A 1R0AA 3CJ2A 3NAIA 3DI6B 5F8GA 1DTTA 3ISNC 4NLPA 4IFVB 1RT4B 2VG7A 3KLHB 4F4ZA 3E01A 5C24B 4XPEA 1RDRA 4ECTA 5KFBA 5F8LA 2UVRA 2EC0A 3CJ4A 4NLDA 3DMJA 5KFJA 1S49A 3I0SA 2W7OA 4ECRA 4KKOB 3UDLA 1KHWA 1R0AB 4ECUA 2ZE2A 4XO0A 1ZTWA 3KMQA 3E01B 1HPZA 4K4VA 2BRKA 4B3OA 4ZVGA 2R8HA 4EBCA 3G86A 1JLBA 3GQCA 4I7FA 4K50A 4O3SA 1S0NA 1WNEA 2BQRA 2AGPA 2ZE2B 4NLYA 3PW0A 4KV8A 1S4FA 1HPZB 3KJVA 1QE1A 3DRRA 3N6LA 1LW0A 5DG8A 4ECSA 2R2TA 1JLBB 4H4OA 2R2UA 2IA6A 3KLEB 2HAIA 5F8IA 3PJWA 1HQEA 2UVVA 2C28A 3BSAA 3RBEA 4KV8B 2WTFA 5KG0A 4KO0B 5DG9A 3KJVB 3IGNA 4Y34A 4GC6A 5KFYA 5HROA 4ECVA 2DPJA 4FBTA 4YR3A 3TAMA 3GV7B 3KHHA 1KLMA 4XPCA 1IKXA 2AQ4A 1EP4B 3MEDA 2QV6A 2ASDA 3FSIA 2RDJA 2BRLA 1HQEB 3JYTA 5T14A 1HQUA 3KK1A 4F4XA 3N6MA 3KLFA 4KSEB 2GC8A 5HROB 4IH6A 3TAMB 4RUAA 3C6TA 1IKXB 1Z4UA 1KHVA 2D3ZA 1S97A 4NYZA 4WYWA 4IR9A 4Q0BA 1N5YA 3OLBA 4ECQA 4WE1A 3JYTB 1S9EA 1HQUB 3KK1B 3KLFB 2E9ZA 1SUQB 3DM2A 4TXSA 5F8NA 3H98A 3IN5A 4MFBA 4NLSA 2YKNA 1XR5A 3C6TB 4Q0BB 3IS9A 1N5YB 1TKZA 3NMAA 2R2RA 5DQHA 4J9SA 1JLEA 1S9EB 1GX6A 2VG6B 3GILA 5KFSA 1S6PA 3DM2B 1HMVA 4OL8A 4RU9A 1T3NA 1JXLA 5KFFA 4MFBB 2AWZA 3FFIA 2YKNB 1JLQA 5DG7A 3G6VA 1RT2A 5D3GA 3IS9B 5KG6A 3D28A 5HLFA 1JLEB 3HVTB 2QE5A 4DL5A 3BJYA 4NZ0A 2I5JA 1W25A 1HMVB 2D3UA 3T19A 4JV1A 4J9QA 4R5PA 3MEGB 1N48A 4ID5A 2XC9A 5C42A 3FFIB 2FVCA 1JLQB 2FJWA 3N6NA 3Q8PB 4NLUA 3RBDA 3PW2A 1RTIA 5HLFB 3CJ5A 4TY9A 5KFGA 2UVWA 2D41A 2OPRB 2B5JA 4KBIA 2I5JB 1NHUA 4J9LA 1JLFA 4ZP8A 4R5PB 4WFXA 4ID5B 1S1TA 5KFTA 2BQ3A 3NAHA 2ALZA 3CWJA 1LW2A 4IRCA 1RTIB 2OPPA 3CDEA 5KFUA 2UUWA 3IG1B 3OHBA 2B5JB 2CJQA 3BREA 2BE2B 3KNAA 4O4GA 3G6XA 3UQSA 3CDUA 4Q45A 1S1TB 4RW7A 5KG7A 4ED8A 2AX0A 1QAJA 1LW2B 2ZD1A 4ECWA 1DLOB 4O3PA 2R8JA 1JKHA 4IFYA 2WONB 4NCGA 5L9XA 5KFWA 1S1UB 4EBDA 1N56A 1S0MA 1FKPA 4QWEA 4RW6B 3E51A 4Q8EA 3ITHA 4O4GB 2W9BA 2IC3B 3M8PA 1T94A 5KFCA 3QZ8A 4RUCA 4RW7B 3FDSA 3GYNA 5KFNA 4ECYA 1T03A 3H5XA 3DI6A 4Q43A 2ZD1B 3KLHA 1RT4A 1ZTTA 1RT5B 4ED6A 1JKHB 1ZETA 4IFYB 4NCGB 2JEIA 5KT5A 3KK2B 4PQUB 5KT2A 3OHAA 1FKPB 3ITHB 4IRKA 2W9BB 5KFDA 4Y3CA 3M8PB 3TVKA 5CYMA 4O3OA 4KKOA 3PW7A 2RKIA 5DGBA 1T03B 2IMWP 5KG2A 4JV2A 2V4QA 5KT3A 1JX4A 2R8KA 4K4SA 2VA2A 1C0TA 5J2PA 2HWHA 1MMLA 1FK9B 3DYAA 1IKYA 3JSMA 3OSNA 3KHGA 5CYMB 3DRSB 3QIPA 3DDKA 1NHVA 1C0UB 2RKIB 3T5HA 2FLLA 3RAXA 3EPIA 1D1UA 1RT6A 1C0TB 3BGRA 5J2PB 2IAJB 5L1IA 3PVXA 3T1AA 3GV5B 2JEGA 3DYAB 3H40A 1IKYB 3JSMB 3MR3A 3V6KA 2JLEA 2W8LA 3KK3A 3KLEA 2BANA 3QIPB 5FDLA 3OSPA 2I1RA 1SH3A 4MK7A 4ED0A 4KO0A 1RT6B 5J2QA 2FJVA 4NLVA 2ILYA 3BGRB 2IM0A 3PW5A 3LP2B 2IJNA 4F50A 4JUZA 1HNIA 3RB6A 3FRZA 4Y2AA 3V4IA 4HYKA 1EP4A 3KK3B 3ICLA 4ZVEA 5F9LA 2BANB 5FDLB 1T05B 1TKXB 4H4MB 3QLHB 1RA7A 2WRMA 1RAJA 2HNZB 3EZUA 4QW8A 3TQ1A 2AGQA 4RNNA 1S9FA 2R8GA 1N6QB 5J2QB 1TL3A 2B6AA 4ZPAA 4J9RA 4MKAA 1HNIB 4GC7A 1S1XA 2XCAA 3V4IB 4WZQA 1UWBA 2DPIA 1TL1A 3DLEA 3T5KA 3RB4A 3GIIA 2WK4A 2GIQA 4QWAA 1RT3A 3QO9B 1JLCA 1RT7A 1SUQA 4IG3A 3H59A 1TL3B 2B6AB 4RNHA 5DQGA 3M9NB 3PZPA 1FKOA 4X2BA 1S1XB 3FQKA 4HKQA 4MIBA 3M8QB 2FLPA 1UWBB 5F8HA 2W9AA 1TL1B 3DLEB 3BR9A 3FQLA 3BSOA 4O3RA 2V9WA 4H54A 4WXWA 1RT3B 2VG6A 1JLCB 5HP1A 1J5OA 1RT7B 2OPSA 4IG3B 4O44A 1K1QA 2XI3A 4ZVHA 3PR5B 2VA3A 3QGGA 4RNMA 1FKOB 4KAIA 5HBMA 5JXSA 4YP3A 4ED2A 4WFZA 4QWBA 4IOBA 4EBEA 1I6JA 4MIAA 3HVTA 5HP1B 4WXOA 1J5OB 3Q8SB 2OPSB 2RDIA 2YKMA 4O44B 5KG4A 4G3IA 2FVSA 4MKBA 3MECA 3MEGA 2JC1A 5HBMB 3NKYA 1BQMA 3V6JA 1XR6A 3BSNA 4K4TA 3T5JA 3DRPA 4DL3A 2BR0A 1S1VA 3MR5A 5KFPA 3HVWA 2YNFB 2FVRA 1IM4A 3LP1A 4TQRA 3I0RA 4G1QB 3PJXA 1HARA 2OPRA 4J9OA 2YKMB 4QWDA 2FLNA 3MECB 4IR1A 2XWYA 1CSJA 1BQMB 3MEEA 4NLQA 1S9GA 3DRPB 3IRXB 1S1VB 3QYYA 1S10A 3NL0A 5JUMA 3QGHA 3PW4A 3LP1B 3I0RB 4TYBA 4EYHB 1S1WB 4EO8A 2C2DA 3IG1A 2IBKA 2BE2A 4MK8A 1QAIA 3CVKA 2RF2A 4F4YA 3MEEB 4IRDA 1SH0A 1S9GB 2O5DA 4K4UA 4TQSA 2IJFA 2W9CB 3KLGB 1IKVB 4PWDB 1DLOA 3CJ3A 5KFXA 3OL7A 3UPFA 2WONA 4KHMA 1S1UA 1HYSA 5J1EB 3LAKA 4RW6A 3SI8A 4ZPCA 2IC3A 2RF2B 1TQLA 3MTKA 5KFEA 1VRUA 5J2MA 1SV5B 4FBUA 1RT5A 5KFQA 4DL4A 2HNYB 2C2RA 3KK2A 1HYSB 4PQUA 4RNFA 4ZPBA 3T5LA 4NLTA 5EWEA 1TVRB 2HWIA 1U09A 3HVAA 1VRUB 5J2MB 1RTJB 1TKTA 5C25B 5KG3A 3CO9A 3H4BA 4ED1A 2GIRA 1RYSA 4IH7A 2FJXA 1FK9A 2WB4A 3C6UA 5I42B 4EO6A 3DOKA 3DRSA 4ICLA 4EYIB 3RAQA 2OPQB 1C0UA 5KG1A 5EWGA 4URSA 4J9PA 3D5MA 2J6UA 2WHOA 2ASLA 1TKTB 4ZMMA 5CYQA 5KT7A 2IAJA 4IQXA 3QGIA 1LWEB 2IM2A 1S0OA 5I3UA 4IKAA 3C6UB 2ZKUA 3NBPB 4DL6A 4R0EA 5KFLA 2CKWA 3DOKB 4ICLB 4KHRA 1S48A 5KFRA 3PR4A 2FVQA 4M95A 2XCPA 1LWCB 4LQ9A 5DQIA 1TP7A 3BQ1A 4IDKA 2J6TA 5CYQB 4DG1A 3LP2A 1S6QB 4LSNA 5I3UB 2AGOA 1RT1B 2AU0A 5F8JA 5EDWA 4TYAA 1RTHA 1VRTB 2HNDB 3CDWA 5L1LA 1T05A 1TKXA 4H4MA 3QLHA 3IGVA 2JC0A 2HNZA 4URGA 2C22A 3RB0A 1N6QA 4IDKB 1OS5A 4R8UB 3PHEA 4DG1B 2WCXA 5KFOA 3KOAA 3V6DA 1JLGA 1REVA 4LSNB 3LALA 4ZP9A 5KG5A 2HMIA 1RTHB 4K4WA 3OL9A 4MK9A 4URQU 5K14A 3GV8B 1DTTB 3OL8A 2VG7B 3QO9A 2WOMA 5DLGA 3KHRA 2D7SA 3MFHA 3V6DB 3DMJB 1JLGB 1REVB 3MR6A 2HMIB 3I0SB 4ZPDA 3VQSA 3M8QA 3OL6A 3I5AA 2OH2A 2E9TA 5F9NA 5K14B 4I2QA 4TLRA 4RNOA 2UUTA 2WOMB 3H5UA 5KFHA 5EWFA 4B3OB 4U6PA 4DEZA 4ZVFA 1SH2A 3H2LA 4NLRA 3HKWA 1MU2A 3DOLA 2W7PA 3Q8QB 2UVUA 4DL2A 4I7FB 4O3QA 4NLXA 4NRUA 3ISND 4I2QB 4JV0A 5L1KA 2JEFA 3KHLA 3GIJA 4WYLA 2BQUA 1QE1B 3DRRB 4LSLA 3G6YA 5F8MA 1LW0B 1MU2B 3DOLB 4RW9A 4H4OB 4YR0A 5KFMA 3H5SA 2W8KA 2YNFA 4EEYA 3UR0A 2ATLA 3CIZA 4G1QA 1LWFA 2C2EA 3NGDA 2YNGA 4ED3A 4RZRA 4LSLB 3QIDA 1KLMB 2XI2A
chains in the Genus database with same CATH superfamily
2GO9A 5GADI 3QGPA 2E5LJ 4DR3F 4MH8A 5J2NA 3MD1A 2UUBF 3RW7A 4F67A 2O67A 2OO4A 1HBNB 3Q8RB 2OTJS 1UA1A 1XK8A 1TELA 1EETA 1DTQA 1BQNB 3ZTPA 4TY8A 3V81A 1RTJA 5C25A 1L3SA 3OLAA 3PX4A 5BR8F 5L39A 4CLUA 1FRIA 2HQGA 2KB2A 1HBOA 4USUA 1CG2A 1Y10A 4UQTA 1PYSB 3I5CA 4X65J 4Y2CA 5HJXA 4PRFA 3G4SS 2YNHB 3CJ2A 1DTTA 2BMBA 2Q1LA 3I0SA 3I9ZA 3MM5B 4KH1B 1R0AB 2BRKA 4Z7YA 2FHOB 3M6XA 4GKJF 2R8HA 2EK1A 2WBRA 2ZBIA 3GFYA 3PW0A 1HPZB 3G71S 3EDQB 3EGZA 2DGQA 2Z2LA 2IA6A 1PJ5A 3BSAA 2DRDA 2XSFA 1NXIA 2RRBA 2X7IA 3N28A 5T14A 2KL8A 2BDPA 4YY3J 4Q2LA 1Q53A 4EI2A 3SQOP 1O5JA 1S9EA 4DUYF 1NJWA 4MIWA 4TXSA 3HJVA 3B6BA 1Z1ZA 2W2NP 3EX7B 4Q0BB 3IS9A 1N5YB 2G1DA 4J9SA 3GILA 1HMVA 4CT8A 1FXLA 3GMGA 3VAGA 5HLFA 2HK3A 3PHTA 3WQPA 3MEGB 3IAS9 4ZJQA 2DTJA 4FYXB 2GMHA 5GAEU 2UVWA 2ZDPA 1GNKA 5HI7A 5KFTA 2RIJA 1RAAB 3OHBA 5ETSA 4PG7A 2GMLA 1NDKA 1MG7A 3KUHA 4NCGA 4QWEA 3ITHA 2K7KA 3ZZ0A 3VHQA 3GYNA 3DI6A 4IFYB 4PWUA 1X5PA 3AB2B 2H5JB 4MTPA 4JV2A 1JJCB 3MPDA 1IKYA 3K5LA 3T41A 2ZJRQ 3PRVA 1X4AA 3D68A 4DV7F 2AJQA 5J2PB 3K89A 1T0TV 4CO3A 3JSMB 2U2FA 3MR3A 2KG1A 2Q3PA 2HQDA 2BKPA 1FJGF 3TZXA 2HS3A 4DHVA 3TA1A 5FDLB 1B99A 2NXEA 4I6YA 1WSRA 2M8DB 1SJRA 2WSCC 4WWSA 2GQ2A 2NR0A 1CULB 4RWWA 4WZQA 2XLKA 4UQGA 1Q82T 2FGCA 3MCNA 1TL3B 1UW9A 2XZTB 3HCXA 4DOZA 1RACB 2QO3A 2JVOA 4KYZA 1CC7A 2V9WA 4FKYA 3TZZA 5HP1A 2O3DA 3CCWA 4RNMA 4YP3A 2W4DA 1I6JA 2J76E 1WUUA 4DR6F 4OYXA 3R5DA 5HBMB 4D3HA 1U1QA 2BR0A 2W01A 4OJ3A 4IR1A 1CSJA 3M8ZA 4NLQA 3KG1A 2JJ4D 3NL0A 1MN7A 3DU5A 4DPWA 2O5DA 2VQEJ 4WF9Q 2R9LA 3HI9A 2AYMA 4DWIA 1KKHA 2HHPA 1RWKB 5EWEA 2VF3A 1GMVA 1MW7A 3W5XA 2ROEA 4ED1A 4EO6A 5F41A 1RB0A 4CYUA 3DOKA 1UAWA 2EW9A 3HD2A 3R97A 2H1YA 2K06A 3TEGA 2ZKUA 4DQRA 4R0EA 1SI9A 4ICLB 1HBMA 2FVQA 4IDKA 3OFFA 2ZM6J 4WK3A 4OZ3A 3BGLA 3A3PB 5DRKA 4LF5J 3LALA 2IRXA 4NXMJ 2CG8A 4M5IA 1F9HA 1GEHA 2WOMA 4JI8F 4DV2F 2HMIB 5JVGQ 3QRQA 1NAQA 3HF5A 1JJHA 1RWPB 4DXLA 3HD1A 3TJ8A 5KFMA 1RP5A 2BYCA 1U45A 2YNGA 4N5SA 2POKA 2D3O1 1WC5A 2F40A 1VOMA 4OYIA 3CIMA 5HATA 4KFBA 3MHYA 4ILMA 5CXTA 2AEFA 5SZTA 3U7JA 1YJUA 5SUHA 2XWXA 1TKZB 3UD4P 1HQ2A 2IM1A 4PYAA 4J9KA 3ELHA 1SJ4P 1U6ZA 1GMWA 2VKZG 2QGFB 3MDFA 1DZ5A 2MXYA 4O0IA 4NCAA 3FCWA 3A8IA 1BLUA 1FNOA 3AJ1A 4DL7A 3C15A 2DNMA 4O3NA 1AZSB 3KYLA 2P8IA 3SV4A 3KLIA 3GIMA 4RW8A 1R8BA 1RXOB 4ITSA 3U02A 3JB9k 2F4FA 1X31C 3N01A 5L1JA 1FRHA 5IS2A 4QBUA 2DXFA 3RR7A 3V2UC 1KEKA 4NLPA 1GTHA 4Q2MA 2VG7A 2MQ8A 2NCKL 4ECTA 3DMJA 1VBZA 5ITHA 1LK7A 3CXCR 2MLYA 3HHNB 3MM6B 3K7RA 3W2WA 1M5SA 2VFUA 5A0YA 4F04B 3UCZP 1H2VZ 3DRRA 4UUWA 2BJ9A 1S77D 2HQ3A 2JRSA 2MMYA 3MGJA 2DR6A 4F25A 1HQEB 3SYZA 5HROB 5LSLA 4NYZA 2XYPB 1SUQB 2FIUA 4MFBA 3O2IA 4U7UK 2H5IB 3KJFB 2LKZA 3IR7B 3SXLA 3MMAA 1HNWJ 4ANDA 3AXMA 3R7BB 4D3GA 3T19A 3KUGA 2BABA 2DH8A 3JSBA 3JSYA 4I56A 3UDVA 1S6UA 4JI4J 2PI4A 7FDRA 1WJ9A 3R5JB 2BUNA 2AF6A 5L9XA 4GVBB 4P2SA 3NY0A 5A8KA 1EKRA 1JKHB 2OMLA 4IRKA 2W9BB 2KH9A 1HWIA 2R7UA 5DGBA 1FT8A 2JZ5A 5KG2A 1DRZA 3M1VA 5LMUJ 3CF5Q 4HDHA 2HK2A 4TU8A 2WVCA 3HFVA 1F3FA 5K8OA 2B7CB 3SIPB 1HD1A 4UOCA 3AH6A 2F65A 5M2UA 2CQBA 2GVDB 2J0SD 2I38A 2D74B 1HNIA 4Y2AA 4HYKA 3EUNA 2WRMA 2AGQA 3EJMA 4QR2A 2B4PA 1U2FA 5AJ3F 2BKOA 4CCHA 2OD4A 4CTAB 1JLCA 4DR1J 3NWRA 3H59A 4CNYA 3C14B 3M8QB 3FQLA 3BSOA 1IBKJ 2GX8A 3BPSP 1RU1A 4WKRA 4WP8A 3CJRA 4BC7A 2ALYB 3Q8SB 1HR0J 1IM6A 4PG4A 3FMWA 1CJUB 1TK0A 1FEEA 4KJIA 2FVRA 5T41A 3MECB 3ENVA 1TL5A 3X1LB 4M5NA 1JB0C 3CE8A 4TYBA 2BEFA 4BWMA 2C3PA 4DV1F 1S9GB 2FGOA 2HW3A 4L3NA 4LRBA 4JI2J 2WONA 1TU0B 4C4WA 2JFDA 2C3YA 1SKWA 2CNKB 5E2QA 2BVZA 2RQKA 3I55S 3A8KA 2GHWA 4EGLA 2IM2A 4IKAA 3SBMA 3NBPB 4ELTA 2CKWA 1TUWA 3IWNC 3RAMA 1L3VA 2W2MP 2JL9A 5A6PA 2R4FA 3F41A 2XG8A 1CJVA 1WC4A 2EI5A 3K5MA 1FRJA 1Y5LB 2WB1D 1RBLA 4DEZA 1NZ8A 4I7FB 4ZN1A 3I9V9 4LRFA 4XIUA 4J5OA 4C3MA 1QE1B 4P52A 4HHJA 3GR1A 2YWFA 5HAOA 4YR0A 3P96A 1R31A 3PACA 4LSLB 5A76A 4OFZA 2DR7A 2YWGA 2HURA 4DUZJ 1MROA 4WZMA 4DV3F 2G0JA 1FF2A 4NLGA 3D3CJ 5HMZA 2KZZA 1V3ZA 3MFIA 3MR2A 3VWSA 2A2DA 1UVIA 4LBPA 2XLJA 2JEJA 3N4WA 4LFAJ 1YZ6A 5KOWA 2AJ4A 2HYIB 3AT1B 4PXCA 5C42B 4FNIA 2OUGA 3GSDA 4I2PA 1RK8A 3BSCA 5IFMA 1HI0P 2PC6A 2V68A 4YHHF 3SQGA 3OTEA 4PUOB 3FKBA 2HNDA 3CJKA 1RE1B 5ETVA 4WU3A 4C3LA 5B0EA 2FC9A 2H65B 1Z2ZA 2LU1A 3Q83A 1RT4B 2IJRA 4ZLJA 2AEJA 2OMOA 3NGSA 1N88A 2CQPA 4NASA 3KMQA 4BDPA 4FF2A 1VQ6S 4ZVGA 5AXKA 2DBBA 1B4SA 4K50A 1WNEA 1WEZA 1WG5A 4U96A 2ZZNA 3R5AA 3KDOA 2ERRA 4ECSA 1JLBB 5F8IA 3POTA 5HL7Q 5ETTA 2E1CA 3KJVB 3R5BA 1UZHA 3CEDA 4X64J 4WYWA 4Y6IA 3OLBA 1M5PC 3MR7A 1HQUB 3KLFB 1MSWD 3HT3A 2MDAA 4LF1A 4C8LA 4JI3J 3I6PA 2EFVA 2B8PA 1HW9A 1Q5VA 2LP4A 4M5KA 1ELOA 1LFWA 4NZ0A 2QX0A 3OVBA 2XY6A 4ID5A 1S57A 4OI0A 3GG0A 2HG4A 4NLUA 2LA6A 2OPRB 2BV3A 1ZPVA 3K2YA 1LW2A 2QLWA 1FXRA 2Z56B 5IC6B 4DN0A 4USMA 2CPHA 3ZC4A 1S4EA 1WKJA 3U1MA 1HNZJ 3J7ZT 4AL7A 1DLOB 3MM8A 2DNYA 2ZWOA 3M8PA 2E5LF 2DNZA 3LTOA 5ETRA 4X62F 4QIWD 4Y3CA 3SDEB 5CYMA 4W90B 3UDCA 2COLA 3OJUA 3J7YU 2EFNA 1D3WA 3KHGA 2YBVA 3J7AN 1OPIA 4A8WA 4ES3A 4MMOA 3BGRA 2VBWA 3IBFB 3GV5B 4FXWA 3M2UA 3PCOB 1DQ9A 3R2DJ 1WORA 2K1RA 4G1PA 2CAJA 2BANB 1TKXB 4H4MB 2ZDOA 1EZZB 1YRTA 1KWMA 3D6TB 1LK5A 2W1BA 3QQCD 3UE2A 3FQKA 3TOQA 4UY85 4X65F 4ID8A 1R8PA 2ZEJA 1K1QA 3UD5A 1F6TA 3D1OA 1RADB 3IMQJ 3QGGA 3MM9B 2ZJQQ 4MIAA 1J5OB 2RNEA 2MQNA 3BSNA 3VZHA 1FD8A 5AT1B 5B7WA 1G2EA 1FDDA 2DKOB 5HVHA 2QFIA 2XWYA 3RBXA 2Q43A 5CCLA 1T8EA 3DFEA 4PCQA 2LXIA 3BO2A 3MEEB 1JMTA 3M2VB 2XS5A 1YJ7A 2RQMA 2D9PA 3O5TB 2HBZB 1SV5B 4QR1A 4FBUA 2VFSA 2EEYA 4YY3F 1AROP 3S01A 2IYGA 3SZ2A 5CAAA 3QFWA 3PIOQ 3UVJB 5M2RA 4KR0B 4M5DB 2W4CA 3WBZA 3IR5B 5KT7A 3AXKA 3QGIA 1LWEB 5HQMA 4CM2A 1PC4A 3C66A 4M95A 2LQ8A 3WX8A 5A8WB 1F1BB 3AAWB 1RTHA 4DG1B 4LSNB 3ZZYA 1Q95G 3M2RB 2L41A 2E5JA 3VQSA 4WIIA 2XULA 5K14B 4LRAA 4UOGA 2ADBA 1VDHA 3EWGA 3R2CJ 5AE2A 3S6EA 2MKSA 2ACMA 2YQ0A 3WIVA 2M70A 4ZVOB 3KFWX 5F8MA 4I64A 1SJFA 2XNRA 3H5SA 1AUSL 2ATLA 4FPRA 3NGDA 1I3OB 4QU7A 4DQPA 3OR2A 1EB0A 3K5OA 5EX3A 4A8XA 4Z7CA 3SSQA 1GX5A 2RD5C 5J2NB 3EPGA 3WHIA 2HFSA 2AT1B 3GIKA 2IRYA 5KFZA 3NNCA 1URRA 4A8KA 1D0EA 3ZZTA 3TZWA 1C1BA 1EETB 5F0WA 4L73A 1U1RA 1DTQB 2ZOGA 4C8MA 4TY8B 3V81B 2FY8A 1NK0A 1SC1B 5EUHA 3B4DA 3W66A 1RT1A 5L9NA 4YMEA 4IFVA 4OHZA 5IM0A 4ED7A 2C2KB 3HHLD 3C2PA 2EFOA 4F4ZA 3ZTOA 3LO3A 2HFNA 2EC0A 1KFSA 1N36J 1ZTWA 1Y3KA 3IWLA 3VCDA 5E3QA 1SKRA 3ISZA 2IYIA 4FPIA 4DPTA 3FBCA 1NRKA 3MM7B 3HT0A 3Q0AA 5GMDA 2CQ3A 4DU7A 3M30A 2BE9B 3TW0A 1BD6A 3SSRA 1S0VA 1ZA2B 2OLWA 2OELA 1Z4UA 3PFEA 1N54B 2DNOA 4WE1A 3FJ2A 2ZM6F 3MI7X 1FJEB 1ZH5A 3IN5A 2MZJA 1S9EB 4LF5F 4ZLPA 2GIFA 5KFFA 1Q7LB 4NXMF 2AWZA 3K58A 3IS9B 5D0GA 1X4DA 1HMVB 4J9QA 1U1NA 1NSQA 3RBDA 5HLFB 1GXUA 1JLFA 2X1AA 1U1PA 5DJBA 4FF3A 4DX8H 1TZ0A 2YH1A 3CDEA 1NPKA 4X4QA 3VAMA 3TVZA 3W63A 1ZAXA 2KFZA 1S0MA 2CQHA 4RUCA 1RUSA 1NSPA 4ED6A 4NCGB 2U1AA 1SL1A 1X0PA 2NXJA 3ITHB 2RKIA 1VQPS 2I8EA 2Y8WA 2VA2A 1C0TA 1FK9B 5LSRA 2JX2A 1RAIB 2BM1A 3IWXA 2ADCA 2JEGA 1IKYB 2W8LA 5H9EJ 2QLFB 3VAIA 1FCAA 4JUZA 5F9LA 1QLNA 1S9FA 2B6AA 4OYBA 2O66A 4DX5A 1D09B 2UUCJ 2MTLA 5I3QA 3D0HE 1WEXA 3UCGA 1HBUA 3M9NB 2RMLA 2F9JA 5F8HA 4IO9Q 3W5YA 2XI3A 5EN1A 2W7AA 2V2QA 4DSIA 2NXUA 2YVSA 2ACYA 2FZGB 4ED2A 1Y11A 2V8VA 3NGKA 4HT5A 5HP1B 3PYGA 4MKBA 4M5HA 5GAGU 1R8AA 3I0RA 4UF4A 4M8LA 4G1QB 3DKDA 2FTRA 2NZ4A 4P2FA 2IBKA 4O0NA 4NYPA 4K4UA 3FSXA 3MCOA 4OX8A 2ATCB 5THWA 3CJ3A 1PBUA 2CZ9A 3LAKA 3GYXB 1TQLA 1FX4A 3BM7A 2KHDA 4LVOP 3TVYA 1OYEA 3OFHA 3H4BA 2HWTA 2Y1IA 4DR2J 2H4WB 4OYAA 2IAJA 1S0OA 2OSQA 2Z8QA 1HNWF 4CYUB 3DOKB 3A3NB 1U24A 3TRGA 5HQLA 2J6TA 1JXVA 2XQCA 4WFBQ 2VJVA 1UPPA 1B70B 1HBMB 3QLHA 2HNZA 1JQGA 4IDKB 2WCXA 4ZP9A 4JI4F 4UTGA 2RILA 2EK6A 2QSWA 4WK1A 3KHRA 1KOHA 3MFHA 4P72A 2CPXA 4OJ1A 1R0BG 4EK2A 2WOMB 2B3TB 2QIFA 2W4PA 4ZCIA 1HW8A 4NLRA 1MU2A 4DL0C 3TAQA 3MEKA 1X4BA 2KJWA 3N9UC 1LW0B 4RW9A 4DZ6A 1BXNA 4L74A 2XEXA 3CIZA 2HZCA 4ED3A 3ET6A 5LMUF 3BH7B 4NA1A 2YNGB 4OI2A 4FS1A 2HHQA 2K3IA 2W9CA 1IKVA 4PWDA 3DLGA 5J1EA 1VYAA 4KFBB 4F2RA 4LR9A 2YWHA 1OO0B 3SFUA 2A18A 1G6BA 2ZHBA 3FRYA 1QVGR 4DFPA 1K1SA 3M4XA 4DR1F 2AYBA 4LF4J 2Y1RI 3QAUA 1S7HA 2YXLA 2IM3A 3KG4A 1IBKF 3OXLA 1AW0A 3BGFA 4FZVA 4RW4A 3D9BA 2M0GB 2YPYA 4ENOA 1HR0F 2DHXA 2DHHA 4YR2A 3PRDA 1FD2A 4OHVA 3OD2A 3C15B 5KT6A 2RUGA 4CT9A 2CQCA 3KLIB 2SXLA 4RW8B 1HIYA 1WHXA 5A2QY 3C19A 3QNWB 1Y5IB 5KFAA 1AFIA 3HSDA 3HHEA 4QIGA 2DCLA 2YH0A 3E01A 2BJ3A 4JP8A 1RHQB 2CQ0A 1H72C 4JI2F 5BYSA 2KXFA 1KN6A 4K4VA 4NL5A 3IAM9 2DGWA 1VC5A 3W3SA 4J7CA 4KV8A 1GQEA 1KQGB 4OX6A 2QL7B 1KP6A 2C28A 4N56A 1ULRA 5A0YB 5KG0A 4WU2A 4OV1A 4M5GA 1EP4B 2ASDA 3FSIA 2L3MA 2CPZA 3KK1A 4LFBJ 1BC6A 1VC0A 3BBBA 2E66A 2HFVA 1KHVA 3FEXB 3PTWA 3QT6A 3MMBA 3HSJA 2NZCA 1PJ7A 1JLEA 1WACA 2VG6B 3P49B 1U6FA 4WFNQ 3DHWC 4MFBB 1X4GA 3GTYX 3CDAA 2J0XA 2I5JA 3MMAB 3TR5A 2V8GA 2B5JA 2RE1A 1IJFB 1U1MA 2ALZA 5ADZA 2LECA 4ZOSA 2RHSB 1S72S 3IBWA 3L7OA 3S7RA 1MNEA 4Q8EA 3E51A 1D9FA 2GV1A 3QZ8A 3RRKA 3GYGA 2XYGB 1VBKA 4DUZF 4PQUB 4USTA 2DNPA 4OJHA 5DDOC 3SMZA 8AT1B 3FNNA 1FFGB 4PXEA 2M88A 4LFAF 3KLEA 2GW8A 3DLHA 1SKUB 1VJQA 3V4IA 3VR1A 4QW8A 1U1KA 1HNIB 2E7WA 2B0GA 4K8RA 2DPIA 1IR1A 2WK4A 4UZCA 1PJ6A 5D78A 1RWMB 4GKKJ 4O3RA 4H54A 1JLCB 1ZM3A 1F9EB 2GCFA 1WI6A 3MOJB 2IVYA 2QSFA 4A4JA 4OYWA 3DRPA 4TQRA 1S12A 1TMMA 4J9OA 1IBCB 4OLOA 3ILLA 4ZS6A 2XSJA 2C2DA 3JSRA 3CVKA 1NH7A 1UTAA 3OUYB 1U2CA 4NEZA 2FJEB 4FYDA 5D6GA 1S1UA 4ER8A 1F2GA 5D0EA 2IC3A 3W65A 3ETOA 1RT5A 2CZ4A 2HNYB 1UEVA 4DCJB 1YX2A 4NLTA 3IM9A 4PQAA 4X64F 1HI1A 3JXOA 2KO1A 5LOQA 4RLEA 2AP6A 2GVZB 3DRSA 2F4VJ 4URSA 3ILIA 3I82A 4WTOB 2B7BB 3L95X 4PWWA 1F60B 1HWLA 3G82A 1F5CA 2EVZA 1LWCB 4B9LA 1V5VA 2BJDA 2AGOA 5F8JA 4EWTA 4HI2A 3BN7A 1KQFB 1LQ9A 2Q79A 1JLGA 2DGOA 3OL8A 1T9TA 4ZK7M 3OJSA 3BF4A 1VQOS 3I5AA 1HNZF 4XTTA 4ZPWR 3M05A 3GSIA 2IRUA 3OXGA 2V6AA 4DL2A 3TA0A 3GIJA 2QYGA 2C3UA 3HHLA 3OVAA 3QIDA 2V63A 4QOTA 3GU0A 5FIIA 5EX0A 4I1TA 3US5A 2IVFB 5C2GA 2GO8A 2WVDA 1Q81T 4KB7A 2GAHC 1TAUA 4B9SA 2A6MA 1H73A 4OX7A 2CQ2A 2V67A 3BDPA 1GTEA 4ZKAA 5LXYA 4OYMA 2DNKA 4FP9A 5F3ZA 1VIXA 3V4MA 3ETMA 4LQ3A 1RLDA 3M8SA 2WSFC 4I2PB 1UMJA 2E1AA 1NNDA 1A0OB 1VRTA 1VQYA 4J9MA 4M1KA 1RAFB 1EQ0A 3CJKB 3NAIA 5D4OA 5BYQA 2VASA 1KHWA 2MZQA 3I32A 1C4CA 2VU5A 5IOLA 2ZITA 1O0PA 2R2UA 2BACA 1YTYA 2HAIA 4ELUA 2DXEA 5DG9A 1UKUA 4P75A 3DU6A 1KLMA 1T02A 3D66A 3POTB 5GAEI 4DLGA 5BYRA 3G6ES 2KRBA 1QY7A 2R7QA 1S7IA 2VD3A 5F8NA 2CVIA 5D4NA 4NLSA 3VGSA 4RU9A 1JXLA 3Q8UA 3T6JA 1JLQA 5DG7A 3KXDA 2LCWA 5J1NA 2KYXA 4OZLA 4B17A 5IT0A 4K2XA 2EWHA 2XC9A 3D1QA 2FJWA 4QJVA 3VGUA 4ID5B 4TNOA 5H9EK 1X5SA 1O8BA 2NS1B 2CJQA 2GQCA 1LW2B 4O3PA 5KFWA 4RW6B 1U8WA 2FYXA 2UXCJ 3H5XA 1IWAA 1MWYA 3KLHA 1ZTTA 1CJTA 1YQHA 1OIAA 3MM8B 2X1GA 3M8RA 2RDDA 2V8HA 1T9YA 3M8PB 4X4TA 2V4QA 2R8KA 1N5SA 3F56A 3DYAA 4CO5A 1XC9A 5CYMB 3T5HA 2IFXA 3EPIA 2ZNYA 1XNQJ 4H4KA 3KK3A 4DV6J 3M32A 3OSPA 2PDAA 2AJFE 2FJVA 3BGRB 2IM0A 4F50A 1E6YA 2KG0A 4OZ5A 2QMWA 2G1HA 1N6QB 2K1RB 4ZPAA 1F2HA 4ZLLA 4MKAA 1S1XA 5FD1A 1WOPA 2NXNA 4MKVA 2VPXB 5H9FJ 1U02A 2LDIA 3BR9A 2BA9A 4FYYB 4USVA 4O44A 3IP0A 2KXNB 4IOBA 4EBEA 4JI5J 3AOBA 4ATNA 5LJ3Y 1XBWA 3I87A 3MR5A 1N36F 1ZS6A 4DQIA 4CNZA 3ZTRA 3PO4A 1FHTA 1KQSR 1S1WB 3IG1A 4WP3A 4MK8A 2Y3YA 4K0KJ 2OIHA 4RBTA 4DFMA 2IJFA 5DZ7A 3ZFVA 4M5JA 5KFXA 1PYTA 4A8FA 2PMZD 2EBGA 4R25A 5EGYA 1VRUA 4B9MA 5L38A 3OT9A 2EG2A 1B0TA 3M8YA 3O6QA 2P2CB 4EYIB 4QYRA 1SIWB 2IDLA 5I3UA 1JJ4A 4B02A 3NGTA 1S48A 2BJ7A 3J80Y 3A4TA 1PKUA 3NOGA 3LP2A 2ZHAA 4F3QA 4FDFA 2HGNA 2IMOA 3HSGA 2K3KA 5L1LA 1A6LA 3VTIA 2ZVSA 2ZH1A 2YPZA 3ILOA 1RTHB 2Y1LB 1NKCA 4QIEA 1VI7A 3MAAA 5K5MA 3OL6A 2OH2A 1CLFA 4DFKA 4U6PA 1SH2A 2G0CA 2UVUA 1XQIA 3PO5A 4NRUA 1WKKA 2E5HA 2Y0SD 4WYLA 4EZ6A 1D9AA 3T1HJ 2MJUA 1QD1A 4H4OB 1FDBA 5M2PA 4WPAA 4EEYA 4CP5A 3O8WA 1LWFA 1XNRJ 1H38A 1EKSA 1EIYB 4GO5X 3BQ0A 4TKTA 2XS2A 2HGMA 3MXHP 3KLGA 4LJMA 2E5IA 3OR2B 3Q2SC 3G9CA 2HEKA 4ILRA 4ZVPB 2DJWA 4OHXA 4JOUA 3LAMA 2UUCF 3W5ZA 1RT2B 2UU9J 3PJ9A 4ZPVR 2EFGA 2A6OA 5K20B 1RWWB 3KLVA 1M5KC 2OPQA 1G3OA 3CO0P 1PAEX 1C1BB 1Q5YA 4LRDA 3MAQA 1RWUA 3K8VA 3MOZA 4DX7A 1TK5A 1UVLA 5IT4A 3BO3A 2V2ZA 2OPPB 5DLFA 1C2PA 2R8IA 2AJ0A 1WSVA 2N7YA 5C24A 2XGPA 5ETKA 3QT7A 2IDEA 4DSEA 4IFVB 3PKMA 5IM0B 5KFBA 4V1Ak 4AE5A 3JTPA 1WHVA 1IWGA 2J8SA 3UDLA 4XO0A 5D15A 1MMNA 4P10A 1RKJA 1XEZA 1TMJA 1CVJA 2XMKA 4EBCA 3QPIA 4CLKA 1VJWA 4ZDNA 1NB7A 2VOOA 4BCAA 3J81j 1F0XA 3RBEA 4ECVA 4DV4J 4YR3A 4DR2F 1T3OA 2MSTA 3JYTA 4F4XA 2CPIA 3M30B 2MB0B 1LNQA 1SJQA 1U0SA 1TUGB 3DM2A 4LR7A 4B3RJ 1Q86T 5HN0A 2PA3A 2WW4A 2XTJP 2R2RA 3GG1A 1GX6A 1NJYA 5D0RA 3OTOJ 5DETA 1XN9A 4CO0A 2H9ZA 3BJYA 2IHR1 1HD0A 1RTIA 2CXEA 2NUHA 2CUYA 4WFXA 1HHTP 1IBMJ 4PG5A 1XIQA 3IR6B 4DV5J 2BE2B 4OLPA 4OZ2A 2HRYA 4ED8A 2QA2A 4CLLA 4EBDA 3IFEA 3W62A 1U0HB 2KRRA 2DT9A 1ZETA 2LXUA 3RRHA 1UVMA 1BUXA 4QYZK 5KFDA 2MGZA 1UP1A 2MY8A 2HBQB 1SQEA 2FD2A 2HWHA 2J7WA 2F3JA 2RKIB 1C0TB 4V19J 3T1AA 3GJSB 3VAJA 1SH3A 4C0HA 2I9SA 4LF4F 2HVIA 4OV6A 2BW7A 4ZVEA 6FDRA 1M0SA 1X4CA 2CPDA 3DLEA 4X84A 4IG3A 2B6AB 4DSKA 3LQVA 3H2UB 1UJ5A 1HBUB 2OPSA 3EZOA 3KDNA 3MMCA 3ENAA 1X8DA 2KI2A 5I4MA 2QMUB 4G3IA 2E1MC 3MCSA 2MLZA 3MEGA 3CCZA 3VVUA 3LP1A 1UW4A 4EUVA 5L8RC 4NXNJ 2V5HG 4KPCA 3LA0A 3RYLA 3CC2S 1XWLA 2HRTA 1V5IB 4C6AA 1R3NA 3I0RB 1P8GA 2FHKA 2VH7A 1MN9A 4PPZA 4Y0FA 4DR4J 4DUTA 3GFZA 2LXFA 2CNLB 2BJ1A 4L75A 2GA7A 1PBAA 2UXDJ 1HNXJ 3LF0A 5B08A 1MLAA 4K2JA 4LFBF 1LXNA 4P2MA 3PG9A 3Q22A 1YGYA 1U09A 4YN3B 1U4BA 2WB4A 1IN0A 3UD3P 1H74A 5CYQA 2ZOFA 2J0WA 2MLXA 4NOHA 3JQMA 3AFGA 4AQYJ 3QJPA 3BQ1A 5DQIA 1Q79A 5IWAJ 3SCLE 2EBEA 2OI2A 3ENWA 2ROGA 1WKLA 5CZXA 2DRBA 4L76A 2UUBJ 3BO4A 1QAXA 2DGUA 1FWKA 4E0DA 4YDXA 3RB0A 1R6YA 3FZBA 2YX4A 3JTOA 3HLUA 3TZYA 4C11A 3H20A 2DIUA 1FRXA 3UWTA 4ZPDA 2K8GA 1Q1KA 4BHQA 3QMQA 4ANCA 4PXBA 3HKWA 5IQ6A 3Q8QB 4O3QA 4I67A 1YIJS 2YKAA 1MU2B 1I1GA 3PNIA 2ZH4A 2DYAA 4C98A 3CC4S 3CJ8A 3O1LA 2V0NA 4RW9B 1R8HA 3AA8A 1BGXT 3NCQA 1R0CB 2HLTA 1Y9OA 3S8SA 2H48B 3N0VA 2KXHA 5KFVA 1U1LA 3RR8A 4NRTA 3ZXWA 3DLGB 4Q8FA 2ZC4A 4PPDA 1S6PB 2DGVA 3PKYA 2LVWA 3D0IE 1FE0A 3W1YC 8RUCA 1U1OA 4ED4A 1GFWB 4GKKF 3AOAA 2ASJA 3MPWA 4F4WA 2B51A 4F3OA 1C1CA 1YJVA 2OP5A 2Y0BB 4K4YA 1M1HA 2CQ4A 2KHCA 2MHNA 2M52A 1RTDA 5KFKA 3NLCA 1N4LA 2PD1A 4O4RA 3DXSX 2BX6A 4RW4B 1JIHA 4WFYA 4JB8B 1R6VA 3KMSA 3VV2B 3BS9A 2B43A 2YWWA 3LANA 3HHKA 4I69A 4C3KA 5FLXU 4JI7J 1KRPA 3CCES 1RDRA 2UVRA 1FE4A 1VHFA 2XMTA 2ZBCA 1VBYA 4AL6A 2NYIA 3E01B 5B0BA 2NXCA 3G2XA 4DSFA 4DJBA 4NLYA 3WC0A 3HSZA 3N6LA 1WTFA 3I4PA 4F7VA 2CVEA 2UV8G 2EKNA 1GAOA 4KV8B 2DPJA 1SIZA 2F4VF 1E6VB 2NSBA 4IH6A 2QMXA 5E3PA 1RHRB 3KG0A 1BE4A 2J5AA 2DGXA 3KK1B 2AJ2A 2R3VA 4OI1A 2YKNA 1TKZA 3MMBB 3IBCB 1RGVA 3IXQA 4ZVRB 4N41A 1JLEB 4NA2A 3HVTB 4DSJA 4JV1A 1NMEB 1VQ7S 3J7YI 2MY7A 2I5JB 1NHUA 1AZSA 1N0VC 3D6FB 1RQ0A 3CWJA 4IRCA 2UXBJ 3GJQB 2B5JB 2EG1A 3THVA 3HM9A 5HQ8A 1Q8BA 2YQ3A 1WDTA 4FKXA 2C3MA 1KS2A 4F4AA 2PT0A 2VBYA 4NI2B 5E3AA 4PXDA 1JX4A 1GXLA 4X66J 4UOFA 2RT3A 5JJBA 2CQ1A 1C0UB 1JXEA 1QVFR 4HTIA 4RKUC 5B0DA 2VFTA 3BKUA 5L1IA 5J1PA 3W9JA 3QT8A 1NUEA 1RBAA 2MKKA 3IM8A 5J2QA 3CTRA 4LF7J 2B9XA 4I0WA 4J9RA 2XNQA 2XCAA 1YDLA 3V4IB 3AQPA 3EGNA 4ZIVA 2QL5B 4K5RA 1SUQA 3PZPA 1Q8KA 1ZAVA 5A6WA 2Z58B 4AXIA 3DDIA 3K59A 4OX9J 3Q8VA 4WFZA 2YKMA 4EFAC 4IYQA 4K4TA 1JJ2R 2HQCA 4DDFA 3HVWA 4P71A 2JWNA 1VBXA 2D9OA 4HHUA 3DRPB 5IV3A 1K73T 3OQ2A 1RWXB 1IVZA 3CD7A 1SPBP 1R89A 1B0VA 2XSJB 1HYSA 2X3DA 3CPWR 1NDCA 4FVCA 1NSAA 5CQGA 3AD7C 3GE9A 4F2SA 1TVRB 4DQQA 4LRCA 3LWLA 4CZCA 3PXGa 1CBKA 2DEJA 5I42B 1VQ8S 2AKWB 3PIPQ 3P45B 2ASLA 4PG6A 4F0HA 4WIQA 3RBZA 3FMBA 1SJ3P 2GVDA 3BN4A 1S6QB 3BKTA 3G82B 3VVTA 1YKWA 4R8UB 3PHEA 3PYFA 3KOAA 3V6DA 2RUSA 2WZ1A 2C1EB 2CQDA 4CTAA 4URQU 3GV8B 1YJRA 5B0AA 3R7NB 1JLGB 4KGMA 1KQKA 3M8QA 1IR2A 1X60A 3FCVA 2J8AA 1WF0A 4ZVFA 2OEJA 1N34J 1T9XA 2UXCF 3PYDA 2HIYA 2JEFA 4L3KA 4HHHA 5E33A 2ZH5A 4R0JA 4NYOA 4OHYA 1FESA 4RO0A 1HNVA 1LFPA 3GB0A 3HHLB 1XNQF 4IOAQ 3W2VB 3LWMA 4U67Q 1S99A 4DV6F 4F02A 2DR5A 4WTYA 4OYPA 4ZLNA 5KTQA 3FSYA 2HAFA 2XM3A 4CH1A 4NLOA 1FI4A 1RHKB 2WVEA 3CJ0A 2ZJPQ 3NGRA 1YJWS 2K7JA 5D3GB 1TTHB 1BWVA 2ZH6A 3VAHA 3WZ0A 1W7WA 3LP0A 1RJJA 2DCUB 3NBPA 2QT7A 2D69A 4JI5F 1NJXA 1FA0A 3L7PA 3CMQA 4KGXB 2CJ9A 5F8GA 2JSXA 1MWZA 4K0KF 1T95A 3NS7B 2ROPA 3HKZD 3HZGA 5E5NA 3OR1A 2MZSA 2XLIA 1FTRA 3GQCA 2FJAB 4I7FA 1PGZA 4LMZA 2Z2MA 2H3EB 1YWXA 2L9WA 1QE1A 1Q0NA 2FLOA 2ZH7A 2KT3A 1K0TA 3OFGA 1X5TA 2LYVA 2VHGA 2QLBB 2A1BA 4RBUA 4GVLA 3NP5A 2CNOB 3OFEA 2X3GA 1CQMA 4LREA 1BWEA 3UN3A 4KSEB 2E44A 4W4MA 1GXTA 2AYGA 1S97A 2KKHA 4ECQA 3HVRA 1SKSA 2F5GA 1OQ6A 2CYYA 1FRKA 1IJEB 3H98A 2KJVA 2LEBA 1IR0A 1KOOA 3E8OA 2RQ4A 1XMQJ 2MPUA 2W25A 5LMNJ 1UFLA 4X4NA 5C42A 1JLQB 3N6NA 2DNNA 3E2EA 1SL2A 1PILA 3RG6A 5KFGA 2M8HA 1QTMA 1P1LA 2OFHX 1N33F 5IC4B 2UUWA 2E29A 2O1PA 1ZM2A 3T1HF 3FVYA 4Q45A 2QJ3A 5KG7A 1XERA 1XNRF 1T94A 1ZBTA 1M5OC 1R7IA 3GJRB 1RT4A 3KK2B 4RX6A 2VKRA 2G2ZA 2ZUAA 1CJTB 1REGX 4I68A 4DZDA 3DDKA 2FLLA 1Y5NB 1D1UA 1F3VA 4OHWA 5HSPA 3DYAB 3CMAS 2UU9F 3EICA 3DHXA 1SC4B 1N32J 5GAGI 3KK3B 4LFCJ 4DV1J 3M32B 2DGTA 1T05B 2R8GA 3DLJA 3M6VA 5CHCB 1Y00A 1WG1A 1TL1A 3FCHA 3QO9B 1H0HB 1RT7A 2DHAA 2XMJA 5A2QU 3P5BP 1S1XB 4HKQA 2ABYA 4ZJLA 2RS2A 2RB7A 4KAIA 4YB5A 4KH0B 1RTZA 3K17A 1NSKL 4O44B 2G4BA 2EFQA 3V6JA 3BB5A 4U9RA 2YNFB 2G9OA 3PJXA 2OPRA 3NCRA 3ZZUA 2CJXB 2J9EA 4JV5J 3IRXB 2PN6A 1NM2A 3JQKA 3FBFA 1NK9A 4P73A 3KWMA 4F4YA 5F0UA 1DLOA 4DV4F 1SB6A 1YJ9S 5J2MA 2BKNA 5CD4A 1HWKA 2HWIA 3SDEA 2DH9A 2KFYA 5IQQA 1T9UA 1VRUB 4HTJA 4B3RF 3LOUA 2FJXA 1RU2A 3C6UA 4B3SJ 1APSA 3AB4B 1NU4A 5ETLA 4YOEA 4OYOA 4MJKA 2DR8A 2XY7A 4QIFA 3OTCA 2UZAA 3OTOF 3ZZOA 1RAGB 4DL6A 3PEHA 2V34A 1TP7A 1VR6A 2BJ8A 4C8YA 2CPYA 5I3UB 2AU0A 1TKXA 4H4MA 4BC9A 1HKAA 2V50A 4G65A 2HHTA 3FEYB 3L9ZA 3T9ZA 1IBMF 2CJYB 5IT9Y 4DV5F 3CCLS 1U26A 2VJUA 3QRPA 3MAAB 3H5UA 4B3OB 1VQ5S 1RSCA 3JQJA 2GHVC 2N3LA 4JV0A 1XMBA 2QFJA 2NUUG 1JK9B 3WX4A 4QU6A 2C2EA 4B9VA 3MEDB 1T9WA 2P5VA 4ES1A 1XR7A 2CQIA 2R7WA 5KFIA 1LWFB 1ZA1B 1VC6A 2E9RX 3M2VA 2A3JA 1FRLA 1UL3A 1SV5A 3P4UB 5K8MA 1RA6A 1G4CA 3MZIA 4PEOA 4FXVA 4IG0A 2MYFA 5C5JA 3PYEA 3CCSS 3NGUA 3SFGA 1FERA 3UN2A 1LV5A 4C8KA 4M5DA 3BEGB 1LWEA 3RU0A 3IO1A 1SQFA 2F1FA 5IV4A 5JMNA 4JBCA 3EVMA 2G13A 5A8WA 2J6SA 5HJYA 4NXNF 4ZVSB 3CB4A 4NCBA 4HDGA 1H2UX 1FVQA 3H42A 2VC0A 3DOMB 5CCMA 5C24B 4HVZA 4K5SA 4NLDA 4DR4F 2ZBRA 4YFUA 2P9GA 5ETMA 4KKOB 2ZE2A 4QQBA 1NK7A 2HLUA 4ZITA 2UXDF 4ZVTB 1HNXF 2YX1A 4A8MP 4ZA1A 4X4PA 4O3SA 2BQRA 1PO6A 2NQPA 2PSZA 1FFSB 1NHKL 1FKAF 4DR7J 1NK4A 1YRXA 2R2TA 1UWAA 3GR0A 7FD1A 2X1FA 1YRUA 3P8BB 4KO0B 1R27B 5JVHQ 4XPCA 2VDHA 1IKXA 3AY0A 2N3OA 4NWBA 2RDJA 1XTZA 2HS4A 3HZEA 2GGPA 3U1LA 2L48A 4AQYF 5IWAF 3JYTB 1UVNA 4C7QA 2E9ZA 1NLKL 4X62J 1JNZB 1PCAA 4PKDB 4GO7X 1OWXA 3DM2B 5LXRA 3CNQP 2QZ8A 3OBIA 3MWBA 2MKJA 4N7TA 5AE1A 5E0OA 4CI0B 1RISA 2RHQB 2DO0A 3CCJS 4YUDA 3CCRS 4DPXA 3G8TA 2J0QD 4RUHA 2Z57B 3TA2A 4DS5A 3ZO7A 1A9NB 1VQSA 2LA4A 1Q8IA 5FLXY 5C2CA 1RTIB 5DM7Q 3THPA 2CZVC 3CSKA 3BREA 3KNAA 1SJ1A 3UQSA 3CDUA 2VC1A 2AX0A 2ZD1A 3ULHA 5F3TA 3JS9A 5KFCA 3I31A 5E3CA 1D8YA 5CZVA 3UN5A 4M63A 3C16A 3TUZC 3DRXA 3GCXP 3C46A 4PYDA 5KT3A 1D9DA 4Y2IA 1MMLA 2MGZB 1ZM9A 3RAXA 3MM7A 3H7HB 4NEYA 3H40A 3V6KA 4ED5A 2PFFB 2BZ2A 4YB1P 1RZMA 1FO1A 2HIQA 2LDYA 2H54B 4L72B 5BJRA 2RS8A 3K8WA 4P2XA 4FYWB 1KR4A 4ZCMA 1CJKA 4HH0A 4RPFA 1Q4RA 2G0IA 1FKOA 1KDNA 4W98A 1U47A 3DLEB 1F5BA 3E3XA 2YX7A 3PEJA 1UJ4A 2ZBPA 4IG3B 4OI6A 1OY6A 3VAKA 2I0XA 3QFHA 1Q16B 2ZZMA 4JI7F 2OKQA 2B4VA 4OZ0A 2OPSB 2IA0A 1NPPA 3MMCB 1S1VA 2CJAA 4GMKA 2CDRB 1X5OA 2VUGA 2V94A 3JAMU 4P74A 3TJ9A 3GFXA 2UUAJ 4YS2A 2ZOMA 5GVQA 3LP1B 2CFXA 2JLGA 1S6OA 3MPUB 4DBQA 2VDIA 3CC7S 3Q2TC 2XO7A 1TKDA 3J7A1 5CABA 2NLWA 3NNAA 4KHMA 3R8YA 1ZM4A 1Y4ZB 3SCJE 2MJNA 3R3TA 1WF2A 5GMEA 4DL4A 2ZHOA 2OEKA 1S76D 1RTJB 5C25B 2GIRA 1FK9A 1RWOB 4YDDB 3BGUA 2ZH2A 5EWGA 3D5MA 2WHOA 1VFJA 1BQXA 1AYEA 1PAUB 2VQFJ 1FXDA 3P5TL 3NWGA 1HBOB 4HI1A 3R5GA 5CYQB 2ZKTA 4TYAA 1C4AA 3IGVA 3A12A 3EVWA 1G1XA 3BV8A 2VIHA 1REVA 3MAHA 2VQEF 4N77A 1I94J 1DTTB 2UXBF 4KHPJ 2CG4A 1HHQA 3I0SB 2EFPA 4C11B 3S1TA 4I2QA 2MZRA 4Q5VA 3LGHA 4DF8A 4DLEA 3DOLA 2W7PA 1NDPA 1HWJA 1VLOA 1KBRA 2JHEA 1OY8A 2DISA 1K47A 2GJIA 1YITS 1VQ9S 3BBCA 4G1QA 2GS8A 4X66F 1AFJA 4PAAA 3BGOP 4TN2A 1YBTA 5T7LA 1OYDA 1TV6A 1RYRA 1D8ZA 4DV0J 2CWXA 2HGLA 4LF7F 1FX2A 5DGAA 2DHSA 4Z2XA 2KU7A 4QZVB 1DQ8A 3C8YA 3HP6A 1WF1A 1VQ4S 1AXQA 3NCPA 3TX8A 3HHLC 2QTWA 3DLKA 2AIRB 1KVJA 3PV8A 3AOCA 4OX9F 2C3OA 1NJIT 1C1CB 4KC5A 2W2OP 2F8EX 1RTDB 3KTQA 2HVZA 5RUBA 3LUYA 2XMVA 4K7QA 4X4RA 3DI6B 4O23A 4WJBA 5F8LA 1UPMB 4ELVA 4PABA 2M5YA 4OZ1A 5D77A 4ALZA 1DBDA 1PIEA 2HRUA 2LQBA 2VL1A 3TYTA 3EDRB 1OSCA 1LW0A 3Q24A 3DRYA 3I4HX 3CJQA 4Y34A 4NE9C 2CADA 2WBMA 3D3BJ 4CDIA 3J80U 2HQIA 4XAKA 2XHWA 2KVIA 1IXKA 5FJ4A 3R1HA 3EGVA 2MKIA 3U27A 1BY9A 3H2VE 5ETQA 4MT1A 2FJBB 2DNRA 4GRSA 1FDAA 4OL8A 1VLYA 2MQLA 4LF8J 2YKNB 3G6VA 1SL0A 3FC9A 1W25A 4R5PA 2FVCA 4G1IA 1BHNA 3BDEA 1OQ3A 2YWEA 3GZ7A 2PE8A 1N34F 4LF9J 4J9LA 1X9MA 4ZP8A 1H7WA 1LXJA 1S1TA 3EGWB 5KFUA 1IUJA 2QYCA 1J5EJ 2HFUA 1EARA 1VQKS 1QAJA 2R8JA 4M5MA 2ZH8A 1XMOJ 4J90A 6FD1A 1CEZA 3HO1A 1UETA 1L3TA 1ICEB 2Z2YB 3FEZA 2XZDB 3ENQA 3GJTB 1M1GA 1NEEA 2E7VA 1NHVA 2QLXA 1A7GE 3PVXA 4C2MA 2JLEA 4CLPA 3G8SA 4TU9A 4ED0A 4ZPTR 1FDNA 3RB6A 1EP4A 3ICLA 3EZUA 1Q7YT 3TQ1A 4RNNA 5J2QB 3R6LB 2V69A 3KNGA 4I6WA 3GIIA 1V6HA 1SC3B 1RBOB 2VG6A 1RCXB 4NZ7A 3C3LA 3CD6S 2FUG9 4Y2KA 2QLJB 4H4KC 2GZOA 3NKYA 1BQMA 3M7VA 3T5JA 5KFPA 4X4UA 2YKMB 4QWDA 2B9EA 3W9IA 3LW5C 2EXUA 4KGVB 5JUMA 3QGHA 2LQ5A 1VQLS 1K8AT 2HZAA 3CMES 2C2MB 2J7KA 1KSPA 2DNLA 4FN5A 4LF2A 4TQSA 3SCIE 2GAGC 2VOPA 4OI3A 1HI8A 4F4KA 1HYSB 4PQUA 2AW0A 2AHOB 3F0NA 1QUPA 3RTVA 1DAXA 1HFEL 1BMQB 3J81U 3CCQS 1VK3A 3RAQA 1RWNB 5EHHA 3AODA 1XMQF 4DR5J 2J9DE 5LMNF 2WW8A 1CPZA 1O6XA 4LQ9A 4YB6A 3NS5A 2LFVA 5EDWA 3CDWA 1VMBA 1X4HA 2JOQA 3GCWP 3TARA 1G7CB 2VG7B 5DLGA 3V6DB 3DMJB 1H3DA 1LOUA 3UO0A 2OFGX 1FJ7A 3TJAA 4DQSA 3W2WB 2V8PA 3KHLA 2BQUA 3DRRB 1WWHA 1IBLJ 3AHPA 4RZRA 4KE5A 4OJGA 2QN6B 2MSSA 3PM9A 1RAEB 4USIA 3GIRA 1VIOA 1HNVB 3OUYA 9RUBA 4DFJA 2YNIA 3MUMP 3H4DA 3CJTA 1EAYC 3RB3A 5D0HA 3I5BA 1N32F 3M8WA 4ZP7A 4LFCF 4JYAJ 2NPIA 2HNYA 1U7LA 4RU2A 5B09A 4ZHRA 2AZ1A 2W24A 4FS2A 4OMFG 2GVZA 4UUXA 5GADU 2HHHJ 3D6HB 2HHVA 2JNJA 3LP0B 4J37A 1LWCA 1VHIA 1V3RA 1RAOA 2V2KA 3TP2A 4U7CA 3GLJA 4J9VA 1TUVA 2XGQA 1MMDA 4TLQA 3CCTA 2N7CA 4JV5F 3H5YA 3TX0A 4ZP6A 5A8KB 3X3UA 3MPYA 1NK8A 3CJ4A 1VGYA 4LT6A 4ZCKA 1OMSA 3M1VB 4KGKA 1UEKA 3UDEA 5CD4H 4B3TJ 3OR1B 3GONA 3HX9A 2WTFA 4GC6A 4CM0A 3AJ2A 4B3SF 3TAMA 2DY9A 3A13A 4DPYA 5E3RA 4CH0S 1FTCA 3C6TA 5CA5A 2CIMA 2FQQB 2HSEB 1NKEA 1B0PA 1U48A 2M4MA 4J9UE 2I2YA 4Z37A 5GAHI 3IA0A 3A3OB 3MMJA 3EYZA 2GNKA 2DXDA 2MQQA 3CJ5A 4TY9A 1YBAA 4LF6J 2I6WA 3ZNUA 4AUKA 3NAHA 2LMIA 3CULA 3NXZA 4AD6A 3HMJG 3HFKA 3K5PA 2N82B 3G6XA 4RW7A 2F8HA 1UVJA 4YEAA 2R7OA 2WONB 3R9LA 1FKPA 1YSJA 2K2PA 3NOCA 4Q43A 5G4DA 5MAOA 2LEPA 3OHAA 4KRWA 4F8RA 4O3OA 4K4SA 4JI3F 3D6MB 3L3CA 1WC1A 3B54A 3CJSA 1RT6A 3THTA 2VBZA 3GWCA 1EJ7L 4NLVA 2GJ2A 3LPYA 3FRZA 3ADAC 2XS7A 2OJ3A 4TU7A 3T1YJ 2V4JA 5L46A 1N52B 8ATCB 1S5ZA 1UWBA 2LU2A 5ETOA 3RB4A 1CJVB 1RT3A 1JNRB 4P6QA 2VB6A 3L4BC 5B0GA 4E98A 4CLSA 4MKYA 1TL1B 3O44A 4WXWA 1KONA 4IQMA 1RT7B 4ZVHA 4OYZA 1B3TA 5D4PA 4JI1J 4XDDA 4QWBA 3QWPA 5KG4A 3NRBA 1QAYA 2CNNB 4FYVB 2B4UA 2PO4A 1T11A 3TO8A 4DI6A 3QYYA 2WAQD 2IBOA 4E8UA 4DR7F 2Y1JA 2KM8B 2RF2A 1MROB 2PIIA 3UPFA 4RW6A 2Z30B 3MTKA 4JI0J 4N76A 5HVGA 4ZPBA 4Y65A 5J2MB 3P6YC 2HQFA 1YJNS 2AYEA 1N5QA 1H7XA 5A8RA 2J6UA 4RL1A 4ZMMA 4F0KA 4DF4A 3C6UB 2DIVA 3KUEA 2PEHA 3QATA 2XYHB 1H98A 1R43A 3SQGB 2MQMA 2HNDB 1V9OA 2JC0A 4URGA 1N6QA 5KFOA 3CCUS 3A8JA 1H2TZ 1NPRA 4IOCQ 1LEOA 3UW1A 3N79A 3NS6A 1SBRA 4JI6J 2F7VA 2IPOB 3MUVP 3JAMY 5KFHA 5EWFA 1N8RT 4RBVA 3ISND 4KQZA 2VODA 3DC2A 3CUNA 2J7UA 1U49A 2R7TA 2X51A 2OSRA 1VQNS 1VCTA 1S1WA 4M94A 2VPZB 1NO8A 1HL6A 4B3MJ 2DNHA 5K9FA 2GHPA 4ZCLA 3MF5A 5HMXA 1QUVA 2AX1A 4LUBA 2EC2A 1IKWA 1JLAA 5U47A 4IG0B 1FJCA 2FHJD 2IIHA 3I96A 1SVDA 2Z2ZA 5LM7E 3R7SB 2AD9A 4PG8A 1RHUB 2VG5A 3MURP 2ZH3A 3QJLA 4C9DA 3NMRA 3WIUA 2H5EA 4KGZB 1YBUA 4QW9A 4ZVQB 1EQMA 2UUAF 4LBIA 3ISNC 4LIRA 4XPEA 2KYZA 3PFOA 1S49A 2R7SA 2R7RA 5HVFA 1RI7A 2ZBQA 2QRRA 4USWA 1S0NA 2AGPA 3OTBA 2ZE2B 2YY3A 4F0MA 1W2IA 3LGNA 3P3DA 1O51A 2GQQA 3M2UB 2DGSA 4H4OA 1DARA 4ZJOA 3VZIA 3PJWA 5DZ6A 3ILJA 1W26A 3BH6B 2XMUA 3SSSA 4RWXA 2NREA 4X4VA 2QV6A 2BOPA 3N6MA 2GC8A 2VQFF 3BR8A 5E7OB 5CYJA 1SCJB 4QCLA 2CRLA 1IKXB 4FXDA 4IR9A 5AXNA 2NPFA 2GGPB 4Y00A 1XR5A 2HFOA 3G8QA 1B7FA 3TUJC 1VISA 2Q6BA 3NEKA 1T3NA 4HACA 5DM6Q 5HK4A 3FFIA 1I94F 3GPAA 1RT2A 9ATCB 1TAQA 2JLFA 3DGPA 4KHPF 2D3UA 1T7PA 4A8YA 1KC8T 1HLWA 2QC3A 2RH3A 2BOAA 2CPJA 1WEYA 2OPPA 1F5AA 4O4GA 1IQZA 1X4EA 3OW2R 4ECWA 4CLWA 3PRBA 3BPDA 1T03A 2ZD1B 3JTNA 4PR6A 1N5TA 3Q89A 1TL7A 1YI2S 3OVSA 2GFFA 2DH7A 2Z0GA 2ZUGA 4DV0F 3C16B 2W2QP 4F3MA 4Y28C 3QIPA 3D7SB 2HBRB 7AT1B 2N4DA 2XB2D 4FF1A 4U8VA 4LR8A 2I1RA 1NJZA 4TVAB 3PW5A 2CWKA 2E5GA 2XO6A 2IY5B 2HS0A 1RAJA 4LBHA 2EKYA 4NPOA 2P9CA 2GIQA 3LH2S 2KT5A 4RNHA 1CJKB 1JWWA 4FNHA 4UT4A 1N5VA 5KAKA 4X4OA 2VA3A 3L09A 1FKOB 4N47A 2YWKA 3EE3A 5G0RA 1HA1A 2YTCA 2RDIA 2VPYB 2OD6A 1X9WA 1IM4A 4USJC 3QT5A 3UCUP 5DDQC 1S1VB 2HPUA 1VQMS 4W92B 1KD1T 2BE2A 1QAIA 3GFHA 4KIAA 1FEHA 2VICA 2MKHA 2VFVA 2CA9A 4DSLA 2VV5A 4KY3A 2KTQA 3SV3A 1TFWA 1U0HA 1CS4A 1NK6A 2C2RA 4RNFA 3KJQB 2P9EA 3UNYA 1GT8A 5B0CA 4KTQA 3HFZB 3PY8A 3D2WA 3I56S 2RQCA 1TKTA 3CO9A 1ZOTA 2QL9B 4UZBA 3H90A 3T6BA 4AXJA 1P1TA 1B64A 4LF8F 1TK8A 1ITPA 3LGMA 1SQGA 2DEIA 1I51B 2DRAA 5DO2A 1OY9A 1RT1B 4QPTA 2VFRA 2ZWPA 2VPWB 1ZZNA 4LF9F 3OPKA 5H1SV 1WDDA 4DCOB 1Z2LA 1J5EF 1WOSA 2C2NA 3D0GE 4FVMA 1REVB 3OTDA 1KFDA 1U25A 1NK5A 3ZZZA 1XMOF 3MUTP 2DITA 2GMJA 2CPEA 1L3KA 4M5LA 4I2QB 4V19X 1CQNA 3G6YA 3DOLB 4J91A 3PDNA 2ZC3A 4B9NA 3NNHA 2BM0A 1OPZA 4P9SA 3V6HA 2X1BA 2JFKA 2FZKB 4PZVA 1HBNA 3AD8C 4WE1B 2R2SA 1RAHB 3J81Y 3TNVA 1VRQC 3M9MB 1RCOB 1BQNA 5T7LB 1TV6B 4ZN3A 4XK8C 1CC8A 1YVFA 5KT4A 4A8QA 1ACMB 3UFCX 2MEWA 2V4RA 3W8GA 2OGUA 3KJNB 1NH8A 1NB2A 3H25A 3CDBA 1VS3A 4HL9A 1JLFB 4RJVA 2FPHX 4F26A 4Q44A 2MZ1A 4HH1A 2QEXS 3DLKB 3WDOA 5GAHU 2YNHA 2HKEA 3ZZRA 6AT1B 4IO1A 5BXIA 4Y2MA 2YKOA 2LQJA 3MM5A 1R0AA 3AQOA 1ZAWA 3KKFA 4YB7A 2KDOA 4ECUA 3DDNA 2W2PP 4L6V3 1HPZA 1AA1B 1WELA 2LQ9A 1S4FA 2V8DA 4S0MA 5K8PA 4XDCA 4CWBA 4P7TA 3KHHA 2AQ4A 2BRLA 4DR5F 4B9UA 1FFWB 3DGVA 2QA4S 4DPUA 2D3ZA 4QIVA 4Q0BA 1N5YA 2XHCA 3EXYA 5IT9U 2A2CA 5AXMA 1S6PA 3HPOA 3AD9C 4I6AA 1QSYA 3GP9A 3DCAA 1N48A 3PW2A 3B4MA 2FHMA 5IZHA 2D41A 3HK2A 4R5PB 2Y8YA 3R1LA 2E1RA 4F36A 3J7Z5 1IBLF 2B9YA 1S1TB 4IFYA 1PSDA 1N56A 1P6TA 5DDRC 4AT1B 1RHMB 2F63A 3K57A 3FDSA 5KFNA 2XZWA 1U6BA 5KT5A 5KT2A 2MQPA 2V2VA 2XMAA 3WC2A 5J2PA 1ZYQA 2AJ1A 3JSMA 3TWZA 4JYAF 1KLNA 3K5NA 4DR3J 2XY5A 2IAJB 3CCMS 1FRMA 2PMHA 4DU8A 5FDLA 3T9NA 4K59A 2FJDB 1CULA 2HFZA 2M9KA 1ZZFA 2HHHF 3QLHB 2HNZB 1E6VA 2M3DA 1ZPWX 1TL3A 4GC7A 5HO4A 3T5KA 3ZTSA 2AMCB 2DHGA 2L9NA 5DQGA 2HHWA 4X2BA 5BR8J 1S59A 2MKCA 2W9AA 5CH7B 4ZIWA 2YKPA 5HBMA 4DS4A 1WHWA 4A47A 3HVTA 4DL3A 3OXFA 3MTJA 3BZQA 3ET6B 3M6UA 2WSEC 1BQMB 3PW4A 4B3TF 4KT0C 4EO8A 2LEAA 3TUPA 1I5OB 1SH0A 2W9CB 1IKVB 4ILLA 2R7XA 4PWDB 3OL7A 5J1EB 3TAPA 4GKJJ 3EMTA 1HHSA 5KFEA 3RRGA 3EZ5A 4CRJA 5KOXA 1EX8A 3T5LA 4NA3A 3TQEA 3F44A 4NI2A 3RUBL 4A8SA 4ICLA 1C0UA 5KG1A 4J9PA 1K0VA 3RZAA 4DN9A 2KM8C 5KFLA 2ZFHA 3TEHB 1WOOA 3BYPA 4DUYJ 2M7SA 4NMLA 1RABB 2R42A 4LF6F 1DFDA 3HHDA 2HMIA 2BJEA 3OL9A 3ZTQA 2FHJA 2H51B 1YLXA 1UEUA 1NDLA 2D7SA 3VAFA 3MR6A 1KNZA 5F9NA 4RNOA 2UUTA 4QYZJ 4UOHA 2B8QA 2HHSA 4C8OA 3SCKE 5L1KA 1YJTA 2D1CA 3H8YA 2DNGA 4CIOA 3UR0A 3AJDA 1WG4A 4RUBA 3DXBA 4LVNP 4QPXA 2FY1A 2CDQA 3EVOA 3TI0A 3SEOA 2PA8D 1U8SA 2V9KA 1IQTA 3T1YF 2YNIB 4DV7J 1TVRA 4BLGA 2JH3A 2KZMA 2VONA 1FJGJ 4CH7A 5I42A 3QSYB 1UVKA 4ZHRB 1TL4A 4JI1F 4NLWA 1PYOB 3BYRA 1AUDA 1S6QA 1FWLA 4AL5A 2ASYA 1RLCL 1L3UA 4R8UA 4CO1A 3BKFA 5H9FK 4QR0A 4DR6J 5KFJA 2W7OA 2FZCB 2RRAA 3MM6A 1TFYA 2WVBA 3OV7A 4ZVUB 3G86A 2NSCA 4JI0F 3D54A 3TANA 2M2BA 4USKA 2G2YA 3DN9A 5DG8A 3KLEB 1HQEA 3D1HA 3MCMA 2UVVA 4Q7AA 3IGNA 5HROA 3RW6A 3GV7B 1V3SA 1DY3A 3W64A 4C97A 3HXMA 3W2VA 3TAMB 1T9VA 3RJMB 1FNMA 4UY8T 3TUIC 4WBFA 3C6TB 2PFDA 4CQ1A 5KFSA 4MAKA 1YG0A 2AEMA 2B4OA 3U1NA 5D3GA 3HULA 2BW2A 5K8NA 5KG6A 3D28A 2NYHA 1KVKA 2QE5A 2KFNA 1R8CA 3FGVA 4JI6F 1N0UA 3HDSA 4EMDA 3IC1A 3UI3A 2R7VA 1HWUA 2BQ3A 4GVBA 4DPOA 3CW2C 4JI8J 4DV2J 4NX9A 2RU3A 1W2BR 1M1KT 3FBBA 1JKHA 3IRWP 1S1UB 2W9BA 2IC3B 2RAQA 2AV5A 5I3PA 4RW7B 3VF0B 4WKYA 3R6GB 1RT5B 1GK8A 1FKPB 2APOA 3L7UA 1NZAA 3G96A 3PW7A 2E1PA 3QSIA 4B3MF 3QWUA 5LL6d 2DB1A 4WP9A 4IUFA 2J9CA 3DRSB 5MLCV 2YQ1A 5D4LA 4EU0A 1QM9A 1RT6B 2ILYA 2CJKA 3B8HA 2AZ3A 2FB0A 1RA7A 2DVIA 3B82A 1RHJB 3W8PA 2HVHA 2E7XA 3C14A 3FBEA 4QWAA 2V4JB 1NCLA 3RGIA 4CLTA 4MIBA 2FLPA 1UWBB 2MHEA 2UV8A 2DO4A 2C2OB 1RT3B 3W60A 1WD6A 1CJUA 5JXSA 3NG8A 1WTBA 2DK2A 2MKYA 4WXOA 2FVSA 4MYUA 3MECA 2JC1A 5AXLA 2BBEA 1Q78A 3DLLQ 4BBYA 1KTQA 1B7YB 2FC8A 1S9GA 1OJ4A 4HT7A 2HZVA 3VALA 1P9YA 4B9TA 2ZH9A 4ES2A 4EYHB 2BE7D 2PEBA 4IRDA 4NZ6A 4USHA 3N5FA 5LJ5Y 2RF2B 2ZVIA 1P27B 5HMWA 3KK2A 1QDUB 3QBCA 1EHWA 1UFKA 4IH7A 2D3OR 2DR9A 2PGCA 4B08A 4NMXA 4RR5A 1P9QC 3QAEA 2OAUA 2WVFA 4C0OC 4CLFA 2XBPA 5A8RB 2HHXA 3PR4A 1VRTB 4AYBD 4ANEA 1T05A 2N4CA 2C22A 1YK9A 3D4JA 4K4WA 1RKIA 4MK9A 1FVSA 1LKZA 3QO9A 3W9HA 2E9TA 2A0FB 5D8HB 3H2LA 4KPYA 3V5RA 1M5VC 1WC6A 4BS2A 1OSDA 2IVMA 2RJZA 3QRRA 4LSLA 4UW2A 1DQAA 2W8KA 2YNFA 2XMWA 4C48A 3W7BA 1KLMB 3FK4A 3IRXA 2YKQA 2FVPA 2RVJA 1NKBA 4MYTA 4G6VB 3DLBA 4J9NA 4P7VA 1KVIA 2BXJA 4ETZA 4HR2A 3BQ2A 1Y3JA 2CQGA 4ECZA 2PI5A 4ECXA 1X4FA 2B56A 4K4ZA 4OZNA 3CCVS 1K44A 4U95A 4IH5A 1Q8LA 3H0PA 3MD3A 2Q66A 3Q86A 2OTLS 1IKWB 4PUOA 1JLAB 1J27A 4QWCA 5AJ3J 2DNQA 4U7UD 3BBFA 4YQWA 2PMWA 5DS7A 1XJWB 4K4XA 4U8YA 1NBEB 2ILZA 5ETNA 4WCEQ 3QZ7A 3AA9A 3M9OB 2VG5B 4C8ZA 3FUYA 3D67A 3ZZPA 3KLHB 2P6SA 4ECRA 3LPEA 3DNCA 1WI8A 3EM1A 4CO4A 4OQJA 2OHDA 4B3OA 2ZNZA 5HANA 1JLBA 1WC0A 1DJ0A 3KJVA 4WFAQ 3R5CA 1SC6A 1WHYA 2F8MA 1N33J 2RRNA 1FNXH 5KFYA 3EXCX 4FBTA 1PG5B 1E6YB 4A48A 3MEDA 1GMWD 1HQUA 3KLFA 5IXUA 2HVEA 4RUAA 1TR0A 3MPVA 2UP1A 1DURA 4BWJA 2FDNA 2KT2A 4DMZA 1X0FA 3Q23A 3PX6A 4LSZB 3NMAA 5DQHA 3CT9A 4CLZA 1PC5A 4LIWA 2KVQE 4ETXA 4DL5A 3K0JA 2MQOA 4HACB 2Q6CA 3FFIB 4A46A 2Y9HA 5B0FA 3Q8PB 2MZTA 2JVRA 1X9SA 4KBIA 3DGPB 3W61A 1AT1B 2B9WA 1M90T 1FWPA 3IG1B 2A10A 1QJHA 4CO2A 3A8EA 1M5HA 1L5UA 5C7PA 2QA1A 2QA4G 4O4GB 4N8NA 3N5BA 4ECYA 3DOMA 2JEIA 3ZNJ1 2VZ9A 3TVKA 4A8OA 1UCNA 4KKOA 2XMMA 1T03B 4X4SA 2IMWP 2L08A 4OI4A 1TL7B 3OSNA 4ERDA 2ZZTA 1GH8A 2HBYB 2KN4A 4EZ9A 2O01C 1QSSA 1URNA 2BANA 3QIPB 3VQTA 4MK7A 4DV3J 4KO0A 1K9MT 3LP2B 2IJNA 1ROFA 2QG9B 1UZDA 1WC3A 1UA0A 4I4BA 4N8OA 1MWQA 5GMKa 4OZJA 2HHUA 1GMUA 3MM9A 1YZ7A 2C2ZB 1S79A 2OEMA 1J5OA 3PR5B 3R27A 2GJFA 1U2RA 3T3FA 4YHHJ 3Q8YA 5G0RB 1XR6A 3A1YG 1VK8A 3FZ2A 2FLNA 1HARA 2HVDA 3O3LA 2CJBA 3MEEA 5AE3A 1DHMA 1S10A 2LLZA 4AFFA 3KLGB 3CGIA 4E2FB 3SI8A 4ZPCA 1RWVB 5KFQA 1CS4B 1H6KX 3UVJA 4DX6A 3HVAA 1SXLA 2L9DA 5KG3A 1RYSA 2C42A 1UJ6A 1UFWA 2OPQB 5LSOA 3VGTA 1AB8A 3QJJA 2DY1A 1TKTB 2F9DA 4IQXA 1LWXA 4KHRA 5KFRA 2EPIA 2XCPA 3HJFA 4DG1A 1KTVA 4LSNA 3UR3C 5ETPA 4DCPB 2J9DA 3M2RA 1QTNB 1X7VA 3UNGC 4OIXA 1QSLA 1OS5A 4HLBA 3ONQA 5KG5A 1F9FA 3G87A 1YHQS 5K14A 4FF4A 5HMYA 2DD8S 3B78A 3PX0A 2RSQA 4TLRA 2JDJA 3F73A 2RU9A 4C8NA 5DDPC 4C0BA 1J2VA 4NLXA 5E41A 3M6WA 1Y7PA 2G2OA 2P6TA 3CD0A 4HEA9 2VBXA 2H4YB 4CLYA 3CD5A 2Z4PA 5LT5A 1Y0HA 2CPFA 3VGVA 2XI2A
chains in the Genus database with same CATH topology
2GO9A 1HNVA 1LFPA 3GB0A 5GADI 2J7UA 3QGPA 3CUNA 1U49A 4NA1A 3HHLB 2R7TA 2X51A 4DR3F 2OSRA 1VQNS 4MH8A 5J2NA 1XNQF 1S1WA 3MD1A 2YNGB 4IOAQ 4M94A 4OI2A 3W2VB 3LWMA 4U67Q 2VPZB 1NO8A 4FS1A 2UUBF 2HHQA 1S99A 4DV6F 4F02A 2K3IA 3RW7A 2W9CA 2DR5A 1IKVA 1HL6A 4PWDA 3DLGA 4WTYA 4F67A 2O67A 2OO4A 5J1EA 4KFBB 2DNHA 5K9FA 2GHPA 5KTQA 4F2RA 1HBNB 3FSYA 2YWHA 1OO0B 3Q8RB 4ZCLA 4CH1A 4NLOA 3MF5A 3SFUA 2OTJS 5HMXA 1UA1A 1XK8A 2A18A 1EETA 1G6BA 2ZHBA 1QUVA 3CJ0A 3FRYA 2AX1A 2ZJPQ 1DTQA 4DFPA 1QVGR 1BQNB 1K1SA 1YJWS 4LUBA 2K7JA 5D3GB 3M4XA 4TY8A 4DR1F 3V81A 1RTJA 5C25A 1IKWA 1L3SA 3OLAA 3PX4A 1JLAA 2AYBA 2Y1RI 5U47A 3QAUA 1S7HA 4IG0B 5BR8F 2IM3A 3KG4A 3WZ0A 2ZH6A 3VAHA 1FJCA 2FHJD 3LP0A 5L39A 1IBKF 3OXLA 3I96A 1RJJA 1FRIA 1AW0A 2DCUB 3BGFA 4FZVA 2KB2A 3NBPA 1HBOA 1CG2A 4RW4A 2QT7A 2AD9A 2M0GB 4PG8A 4JI5F 1NJXA 2VG5A 4UQTA 2DHXA 3MURP 1HR0F 4YR2A 3PRDA 1FD2A 4OHVA 2ZH3A 3I5CA 3QJLA 5KT6A 2RUGA 4C9DA 4CT9A 1FA0A 3NMRA 3L7PA 2H5EA 2CQCA 3KLIB 2SXLA 4RW8B 1WHXA 4Y2CA 4QW9A 4PRFA 3G4SS 5A2QY 2YNHB 1Y5IB 2UUAF 5KFAA 1AFIA 3HHEA 4QIGA 2DCLA 2CJ9A 3CJ2A 5F8GA 1DTTA 3ISNC 2YH0A 4LIRA 3E01A 4XPEA 2KYZA 2JSXA 3PFOA 1MWZA 4K0KF 2Q1LA 1T95A 1S49A 3I0SA 3I9ZA 3MM5B 2R7SA 2R7RA 1R0AB 2ROPA 3HKZD 3HZGA 2CQ0A 1RI7A 4JI2F 5BYSA 2KXFA 1KN6A 5E5NA 3OR1A 4K4VA 2BRKA 4NL5A 2QRRA 2FHOB 3M6XA 4GKJF 2MZSA 3IAM9 2R8HA 2EK1A 2DGWA 2XLIA 1FTRA 3GQCA 2FJAB 4I7FA 2WBRA 1VC5A 1PGZA 1S0NA 3W3SA 4LMZA 2Z2MA 2AGPA 2ZBIA 2ZE2B 3OTBA 2YY3A 3GFYA 3PW0A 4KV8A 1HPZB 1GQEA 1W2IA 1YWXA 1KQGB 2L9WA 1O51A 3LGNA 3P3DA 3G71S 1QE1A 2GQQA 4OX6A 2FLOA 2ZH7A 2DGQA 3M2UB 2Z2LA 2DGSA 3EGZA 2IA6A 4H4OA 1DARA 2KT3A 1K0TA 3OFGA 1X5TA 3VZIA 3PJWA 2LYVA 2C28A 3BSAA 4N56A 1ULRA 5A0YB 5KG0A 4WU2A 2A1BA 2XMUA 4RBUA 3SSSA 2XSFA 4OV1A 4RWXA 2NREA 3NP5A 2RRBA 3OFEA 4X4VA 1EP4B 2QV6A 2X3GA 2ASDA 3FSIA 2L3MA 1CQMA 3N28A