1U6FA

Nmr solution structure of tcubp1, a single rbd-unit from trypanosoma cruzi
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
139
structure length
139
Chain Sequence
MSQIPLVSQYDPYGQTAQLQQLQQQQQQHIPPTQMNPEPDVLRNLMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNGFNILNKRLKVALAASGHQRPGIAGAVGDGNGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein UBP1
publication title NMR Structural Study of TcUBP1, a Single RRM Domain Protein from Trypanosoma cruzi: Contribution of a beta Hairpin to RNA Binding
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Rna binding protein
total genus 15
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u6fA00
2MPUA 3CCSS 2AYMA 1KOHA 2QFJA 2CPDA 3NNAA 5BJRA 3NS5A 1WWHA 2KRRA 2GO9A 2N82B 4EGLA 2BOPA 1WG4A 2XS7A 1VQMS 2M9KA 2NLWA 3NNCA 2F9DA 2ZJRQ 3S7RA 2MZJA 3G8TA 1WELA 2JVOA 5ITHA 2FC9A 2XNRA 5MLCV 5JVGQ 3VAFA 3BO4A 3CCVS 4QPTA 2E5IA 1N88A 2M8DB 5DM6Q 4CQ1A 3SDEA 1KC8T 1KD1T 5GADU 3MD3A 1XN9A 2RQCA 3CCES 5D78A 2HGMA 3S6EA 4IOCQ 5DDPC 1WEZA 2FC8A 2LXUA 4WKRA 1U1PA 3THPA 3SMZA 4PKDB 3SXLA 1BY9A 3G4SS 1M5KC 5DDOC 1WI8A 1SJ3P 4W90B 1FT8A 4QU7A 2HGLA 2MZRA 2DH8A 1X4DA 1M1KT 3CC4S 2DB1A 3CCQS 2BZ2A 1S72S 1VQKS 1Q82T 2MKCA 4P6QA 1WF2A 2CQ1A 2XNQA 3SDEB 5IFMA 5LJ5Y 3G6ES 1U1OA 2QEXS 5CXTA 2DHGA 2CPYA 3I55S 1X4GA 1IQTA 1ZZNA 4V19X 2KG0A 4W92B 3J7YU 5DDQC 3CCLS 2KN4A 3JB9k 2DNQA 3CC2S 2ZJQQ 5HO4A 2L41A 2DNGA 2MB0B 4RU2A 2JVRA 3EGZA 5GAGU 1U6BA 3MUTP 1VQ6S 4F02A 2CPIA 2CQGA 3P5TL 2LEBA 2CQ4A 2CPFA 2WBRA 1U1KA 4TLQA 4OZ0A 1W2BR 1AUDA 1A7GE 1NJIT 2MKSA 2DNNA 1G2EA 2MYFA 3R27A 4WF9Q 3UCUP 2B0GA 2MJUA 2CPHA 2FHOB 3CCJS 1SXLA 1D8ZA 3H2UB 1URNA 2AYEA 3FEXB 5IM0A 2X1GA 2CQBA 1YI2S 3UWTA 2ZJPQ 1U2FA 1R8HA 2E5JA 2CQIA 4TU8A 3P49B 2KXFA 1CVJA 2Q79A 5LXRA 2DGOA 3L3CA 5FJ4A 4A8XA 1VQPS 3R1HA 2CPJA 2KVIA 2RVJA 1WF0A 1YIJS 1Q86T 2RNEA 3MOJB 2LA6A 2LEAA 2SXLA 2DNMA 3U1LA 4WFNQ 2KT5A 5GVQA 3I56S 2LXIA 2VOOA 2AYBA 5IM0B 1KOOA 4CH0S 2CPZA 3BO2A 1YJ9S 2RS8A 2LCWA 2KFYA 2DIUA 4FXVA 1OIAA 1U1LA 2OTJS 3BO3A 1M5OC 1X4CA 2UP1A 1HD0A 1UAWA 1Q81T 2PE8A 3UD4P 2DNPA 2MKKA 2LKZA 2M88A 4TU7A 4ED5A 3CCUS 3B4MA 3MUMP 1X4HA 2RS2A 1A9NB 1X0FA 2XSFA 2DH7A 1JJHA 1VQLS 2KRBA 2N7CA 4Y0FA 1WHXA 3CPWR 4C0OC 3MDFA 2MY8A 2MQPA 2D9PA 1Q7YT 3VALA 1FHTA 3J7ZT 1K8AT 1WEXA 2LECA 2DO0A 2D9OA 5EN1A 3VAJA 2RU3A 3VAKA 1RK8A 2EVZA 2MZQA 3PIOQ 2DGWA 1U1RA 3G9CA 2MQOA 4CH1A 2DGQA 3NMRA 1SJQA 4WFBQ 1X5OA 2L08A 4WIIA 1X5PA 2DH9A 2J0QD 1VC0A 2EK6A 2M7SA 2DHSA 2RT3A 4YOEA 3VAMA 1X4EA 4YUDA 3VAIA 1FJCA 4OZ1A 1RKJA 2ADCA 2ADBA 2PEHA 1UP1A 4IO9Q 3CD6S 1UW4A 1YITS 5GAEU 1HA1A 3CMES 2MKIA 2J76E 3MI7X 1FJ7A 2CQDA 2CQCA 2E5GA 3BS9A 1YJWS 5LSLA 2DGXA 2KU7A 2U1AA 2ERRA 4BS2A 2HYIB 5CA5A 1VQ4S 1PGZA 4LJMA 2VONA 3V4MA 2J8AA 1X5SA 1SJFA 3TYTA 3UCGA 5GMKa 4TU9A 3IWNC 5GAHU 2X1AA 2E44A 1VC5A 2JWNA 4ZKAA 1VQ9S 1D9AA 4WFAQ 1U1MA 2MHNA 1X4BA 3UCZP 1L3KA 1U1NA 4IOAQ 1N54B 2KH9A 1U6FA 1JMTA 3MUVP 3MXHP 3H2VE 1DHMA 1WTBA 3VAHA 2J0SD 2E5HA 2CJKA 2MKJA 2RUGA 3US5A 2RRAA 2AD9A 3P6YC 2MQLA 1JJ4A 3U1MA 3CCRS 1WG5A 3HHNB 2MSTA 2NZ4A 2CPXA 2DK2A 1S79A 1VQNS 2HZCA 3ZZYA 1WEYA 2MQNA 4FXWA 2KYXA 4QQBA 3UE2A 1UFWA 2KI2A 3G71S 1VQOS 1DBDA 2DGSA 2OIHA 5DETA 3CCMS 4WCEQ 2LYVA 2DNYA 1WHVA 2CQPA 1FXLA 1VC6A 1YHQS 4YB1P 2QA4S 2LQ5A 2MQMA 4F25A 2KG1A 1VBXA 2DNOA 1VQ5S 2YH1A 3HI9A 1WF1A 3S01A 3CUNA 2G1DA 2DHXA 2RQ4A 2X1FA 1X4AA 3VAGA 3NNHA 1WHYA 2F3JA 3Q2SC 3N9UC 2MY7A 5CYJA 2YTCA 1WG1A 1VBYA 2CQ0A 1U1QA 4U67Q 4PR6A 4ERDA 1ZH5A 2DHAA 1H6KX 2MMYA 2M70A 1SJ4P 2YWKA 3THTA 2G0CA 2VODA 5IQQA 2M0GB 2CQHA 5DDRC 3TP2A 4LMZA 2DGVA 1N8RT 1X4FA 1PO6A 3CMAS 4C4WA 3NS6A 1H2TZ 4F26A 1QVFR 1F9FA 2KM8C 1KQSR 2DNZA 3ULHA 2N3OA 3CC7S 2DGUA 2OTLS 1SJRA 1QVGR 2O3DA 1DRZA 1VBZA 1HD1A 1M5PC 2XB2D 2CQ2A 3Q2TC 1O0PA 4IUFA 2MZ1A 2YH0A 2OSRA 1DZ5A 2A3JA 1R8PA 2EK1A 3PIPQ 2MJNA 2XS5A 3G8SA 1NU4A 1M90T 3S8SA 3OW2R 4Z2XA 4CIOA 3FEYB 2YKAA 2OJ3A 4QU6A 1ZZFA 2CQ3A 1P27B 2FPHX 3P3DA 4UY8T 5LXYA 2MZSA 2HVZA 3B4DA 2DIVA 2OSQA 5DM7Q 2M8HA 3MURP 2FY1A 2KM8B 2K8GA 2M52A 2DNHA 4LIRA 1H2UX 2LA4A 2KXNB 1QM9A 2MSSA 3DXBA 1WI6A 3MD1A 2DO4A 3RW6A 5JVHQ 2MXYA 2DGTA 1FO1A 2MQQA 1FNXH 2VOPA 2MZTA 3DLLQ 1HL6A 2CPEA 3CF5Q 2V94A 2U2FA 2DNLA 1OPIA 2MGZA 1JJ2R 5HL7Q 3K0JA 4J5OA 1X5TA 2DISA 2N3LA 5D77A 1VQ7S 2DNKA 4Y00A 1WHWA 3ZZZA 2I38A 1YWXA 1K9MT 2JX2A 2HGNA 1H2VZ 1OO0B 1P1TA 2K3KA 1VQ8S 3UD3P 3RW7A 2M2BA 1M5VC 2XS2A 1YTYA 1NO8A 1K73T 1N52B 2MGZB 3TO8A 2DITA 2LMIA 1YJNS 1OWXA 2KXHA 3LPYA 2DNRA 2JRSA 2L9WA 2F9JA 4UQTA 3IRWP 3G96A 2X1BA 3BEGB 3CTRA 2GHPA 2RRBA 2M4MA 2I2YA 3CXCR 1B7FA 2KHCA 5LSOA 4PRFA 4M5DB 3EX7B 3VF0B 3EGNA 2AYGA 2MKHA 4C7QA 1FJEB 3CULA 2G4BA 3D2WA 5LJ3Y 5H1SV 2D3OR 3R1LA 3LQVA
chains in the Genus database with same CATH superfamily
1O5JA 1KOHA 2CPDA 5GAHI 5K8NA 3MM5A 1FK9A 2O5DA 4IRDA 3JAMY 1IKXA 4NCGB 2Q6CA 4WXOA 3TUJC 5K14A 1TL4A 3KLEB 3KDNA 1PYTA 1RWMB 1RISA 3MTJA 4X62J 2IJRA 2F4VF 3MD3A 3GJQB 5DZ7A 5D3GA 3H7HB 3JQJA 1PSDA 3NGSA 3DCAA 3KK1A 1N0UA 3OQ2A 2MZRA 3Q89A 2RRNA 2QE5A 1YJ7A 2ZH8A 2W4CA 1U1OA 4B3MF 3MEKA 2JLGA 1U0HB 3CC2S 3N79A 2VC1A 1YJVA 3EGZA 2HAIA 4L76A 3MUTP 3RG6A 2CQGA 3JYTA 4LBHA 3MM7B 4RW7B 3H25A 2VG5A 4NI2A 1U1KA 5K9FA 1TV6B 1QTMA 4IG3A 3KJNB 2B0GA 2FGCA 1AW0A 3C3LA 4I4BA 1YDLA 1ACMB 1P1LA 3MM6A 4I2PB 2N7YA 3UWTA 5C24A 3GJRB 3R1HA 2V8PA 1WF0A 3MOJB 5KFMA 2UVUA 5IT9U 3CJKA 3BO3A 3OJSA 2AV5A 2XZWA 4HDGA 4BDPA 4C0BA 5CABA 3JTOA 2QLBB 3O3LA 3RR8A 2XSFA 2HS0A 4EI2A 1Y4ZB 3BYRA 2XO7A 1UEVA 1HMVA 1WHXA 3CDAA 2BMBA 4KHPJ 5KFIA 3WX4A 2HHUA 2DO0A 3VAJA 2QL9B 1ZOTA 3VAKA 1U1RA 3NMRA 3IG1B 2AZ1A 2FJEB 3D4JA 3QPIA 4YOEA 3VAMA 2ASJA 5ETMA 3QWPA 3R7NB 5FLXU 3HJFA 2Q6BA 4IFVA 4B9TA 3QAUA 3QQCD 1EQ0A 1XMBA 3FRYA 3H40A 5I42A 2HYIB 1S77D 3MGJA 2HFOA 3Q8RB 2R8HA 1PKUA 1R0AB 2VBZA 3UDVA 4JI1F 4CLKA 2ZEJA 4PXCA 4LT6A 4L3NA 1LW2B 2HWTA 1VLYA 3M32A 5HVFA 4J9UE 5HJYA 4ZLJA 2HZCA 1JKHA 1YG0A 3KHGA 4DR6J 3UVJA 5HVGA 2ASYA 4YMEA 1SIZA 3NCRA 1FKAF 3UR0A 5EWEA 2LYVA 4ZVRB 2YWEA 3IC1A 2XY5A 4MK8A 1NPRA 3BSAA 5CYJA 2ZM6F 3RRHA 4DV7J 3BGOP 2YKPA 3PEJA 1GMVA 3Q8QB 4ES3A 2JEIA 5J1PA 5D4PA 2HQFA 3FBFA 2PEBA 4CRJA 1TUGB 2AQ4A 3MMBA 4C2MA 4IFYA 1HBOA 4HT7A 1CJTA 4IG0A 4NCAA 1HR0F 4J9VA 1EQMA 4NZ7A 2VPYB 2EK1A 5J2NB 1RWKB 1HNIA 4RW6B 3RB6A 2OPRA 3IN5A 3SCKE 3EDQB 4CLSA 3VGUA 2VPWB 4K4UA 4DV1F 3PCOB 3T9ZA 5D8HB 4WBFA 1Y0HA 1H2UX 3HDSA 1WI6A 3ET6B 3H90A 2DGTA 4WFXA 2WW8A 4OFZA 2C3MA 2WW4A 2U2FA 1FX2A 1JJ2R 4CLPA 2YKOA 1X5TA 4G1QA 1RTJB 1GT8A 1WHWA 4KSEB 1DJ0A 1VQ8S 1W25A 2YX7A 2C2ZB 3IR7B 1OMSA 2PC6A 4RJVA 4F4YA 3HK2A 1XTZA 4CLTA 3CW2C 2OI2A 1IKYB 3CCTA 3EX7B 3VF0B 1FRMA 4EYHB 2UVVA 3K89A 3C66A 4U9RA 4CLYA 4RW8B 5IT4A 3CJQA 3A1YG 2YX4A 3UDLA 2CJXB 2JSXA 3NNAA 2YBVA 4RL1A 3D0GE 4UQGA 5ETTA 2XS7A 4ECTA 2QLXA 3BKTA 3NNCA 3GONA 4A8WA 5J2MA 2CJ9A 5F8MA 5DRKA 2HNZA 5JVGQ 5DQHA 3BO4A 1B7YB 1K1QA 4JI7J 2RQCA 1CS4A 1EX8A 1C0TB 4DV3J 3BPDA 2UXCJ 3SXLA 3FZBA 4X4QA 1H72C 1SJ3P 2VBYA 1HNVB 3FKBA 1IBKJ 2DH8A 1X4DA 4LFAJ 4PG5A 4ZMMA 5F0UA 4F3OA 1SC1B 2NUUG 2QEXS 4AL7A 4DOZA 3AD8C 4K8RA 5HO4A 1UEUA 2DXFA 4OJGA 4YR3A 1DLOA 4ZPTR 2BJEA 1Q16B 4KGKA 2VJUA 3QIDA 1T3NA 3M8QA 2ZH1A 3HO1A 3I32A 5AJ3F 5L1LA 3M05A 1NJIT 2NUHA 1T3OA 1NK5A 2FD2A 5IT9Y 3AHPA 1F0XA 4YS2A 4KV8B 1CJVA 1H7WA 4GO7X 3NWGA 4ER8A 4AT1B 2IM2A 2CQIA 2VFVA 5B0EA 2QG9B 1VK8A 5BYQA 2EFVA 4S0MA 4DSIA 3PZPA 4ES1A 2QMUB 1H38A 1DTTB 1ULRA 4DJBA 5FDLA 1S1UB 3JSBA 4WK1A 2YQ1A 4A8SA 3QJJA 1RAAB 2LCWA 5I4MA 1OIAA 4B3MJ 2DNPA 2VUGA 4DL5A 1PAUB 3DKDA 3QT6A 4OX8A 1A9NB 3JSMA 2QSWA 4QPXA 3BQ0A 1JJHA 5ETRA 4LVOP 4F2SA 4MKVA 4YQWA 4MK9A 2FHKA 2HAFA 3PTWA 5D15A 5KFTA 4R25A 2YNHB 2ZE2A 1RT1B 2B56A 3GR0A 1HNXF 3DRPA 2PT0A 4H4KA 1N5SA 4ZLLA 1CULB 1UJ4A 3CD6S 2POKA 1HBMB 4RNOA 3MI7X 4DFMA 1IM6A 1BD6A 3M6VA 4BS2A 4DPWA 3I31A 2J8AA 5JUMA 4NLOA 3I4PA 2W2NP 3BGUA 3CSKA 3RYLA 3WZ0A 5KFSA 1U1NA 3KK2A 4P71A 2CJKA 2XQCA 1RQ0A 1XK8A 1SQEA 1LWCB 2ZH6A 4ZPDA 2LQ8A 4YN3B 3R3TA 1FRJA 3QO9B 2YNFA 1F2GA 3OXFA 1U4BA 3PO4A 2VG6B 2YH1A 2EC2A 3MR2A 1X9MA 2VFSA 3PRVA 2IAJB 4N41A 3MR7A 3T1HF 1ZH5A 1JLBB 2MEWA 2HG4A 4JI1J 4ECSA 2GS8A 4NEZA 1X4FA 4RU9A 2WVBA 5C25A 4OJ3A 5F8JA 2IA0A 2MZ1A 2RQKA 3P4UB 2MJNA 1KNZA 2LQJA 2LVWA 4PQUB 4CIOA 2YKAA 1EB0A 2WVFA 2BACA 5ETKA 1P27B 1TL1A 1SKSA 2HVZA 2M8HA 4K5RA 1KSPA 1A6LA 2JFDA 3MD1A 3N6NA 2E1CA 1EETB 1CPZA 2K3IA 3T41A 2MKYA 1S1XB 3T9NA 2V94A 1RAJA 1OPIA 3QRQA 4OYWA 3PW0A 3E8OA 3MPDA 3TANA 3HHLC 4Y00A 3I5AA 1TKXB 1K9MT 2XHWA 4I7FA 4LRDA 1H2VZ 1HR0J 4OI4A 4E98A 3R6GB 3A3PB 4ZCIA 4H4OB 3TEGA 1LWXA 4USWA 6FD1A 1N33J 1SL1A 2GHPA 4HTJA 2MPUA 2QFJA 4DPXA 4C11A 3AOAA 4JV5F 1WWHA 5CYQB 1SQGA 2HHSA 1GTEA 3GR1A 2IVFB 4DLEA 1S59A 3G8TA 1WJ9A 4DCPB 2BXJA 2XNRA 3ISND 4ECXA 2K7KA 4ED7A 2V63A 3CCES 2HBYB 3LGMA 3GIKA 3HSZA 4QU7A 3CCQS 2BZ2A 1PYSB 2HS3A 2XC9A 5CXTA 4PG7A 4QWAA 4M5MA 4O4GA 4P75A 1X9SA 2QA4G 2MB0B 3RBDA 4RU2A 3FEZA 1MNEA 1FTCA 2GC8A 2CPIA 3I9V9 3O44A 2WBRA 2C1EB 2DNNA 3D68A 3POTA 2XMWA 5HI7A 3NBPA 1K0TA 2FZGB 1FNMA 2CQBA 2I9SA 4LR8A 2EXUA 4B3TF 3KHRA 1PBAA 2OFGX 4X84A 2MLZA 2QYCA 4A8XA 3NL0A 2GA7A 2IDEA 3V81A 2KT3A 3EGWB 5G4DA 2HQGA 3GZ7A 1D9FA 2W4DA 2AJ4A 2BE2A 5IOLA 1X4CA 2RAQA 5C2CA 2IFXA 4DQQA 3CCUS 1YQHA 2HQIA 2XLIA 3U1NA 2YWFA 2VC0A 3N5BA 2JDJA 3OR2B 4O3PA 1T0TV 3C46A 3NMAA 5HSPA 2E5LF 1OPZA 3GFXA 3CJ8A 2VD3A 3GLJA 1SJ1A 3KLHA 2LECA 4EO8A 1SC6A 2MZQA 1RAHB 4YR0A 2J9EA 1SJQA 4B3OA 2AJ2A 1JLGA 1RT2B 3UW1A 3J81U 3L7UA 5DZ6A 2HRUA 1YITS 3VCDA 1VMBA 2AU0A 1GMWA 1HLWA 2CQDA 4CYUA 1V5IB 1DQAA 4AXJA 1N6QB 4URSA 3K57A 2NZCA 1NB7A 1S0OA 3R5CA 1JXEA 3VGSA 2GGPB 1ZM9A 5KG1A 1EIYB 1U1MA 4LF8J 1X4BA 1L3SA 2JH3A 3KHHA 1QY7A 4PQAA 1U24A 1F3FA 4HACB 3MUVP 3ETMA 2E5HA 1RTIA 3BKFA 1BQNB 1PAEX 2B51A 5A8WA 1NSPA 3CCRS 1RTDA 4Q8FA 2LLZA 1F5AA 1V3RA 4PG4A 2PFDA 1D9DA 1FX4A 3MMCA 2W1BA 1I51B 1RWUA 1APSA 3A8IA 4OL8A 3NCQA 2B4PA 2DNYA 3EPIA 1WKJA 3DLHA 4ILLA 4ZCLA 2W24A 2B5JA 3I5CA 5KFYA 3FRZA 2IA6A 3EVMA 2XSJA 4Q0BA 4MYTA 2FJDB 3NKYA 3SBMA 2MMYA 1SV5A 4USKA 2V2ZA 1OS5A 2BA9A 3IWXA 2HFZA 2DRAA 2GAGC 1NK9A 2KM8C 2EFPA 2DNZA 1IQZA 2GHVC 2O3DA 3QSIA 3TNVA 1B3TA 9ATCB 4QIEA 4YEAA 2V8DA 1KONA 1PC5A 5F8HA 1T9UA 1VGYA 3S8SA 4FF1A 1HYSB 1KLMA 4BC9A 3SEOA 4RNHA 4QU6A 1UTAA 4LQ9A 4USIA 2J7UA 3QGGA 3DOLA 3B4DA 3Q8VA 5AXNA 3UD5A 3PJWA 3M8RA 2W2OP 4GC6A 4EU0A 5DGAA 1RUSA 3IM9A 5IV4A 3T1HJ 4OHVA 1RT6A 4XTTA 4ECQA 3DMJA 1F6TA 1LFWA 3MEEB 2BABA 1V6HA 2DXDA 1U47A 4K4WA 3OVSA 1JJCB 2HGNA 3AD9C 3EZUA 4UTGA 2HZAA 4Q45A 4KQZA 3D1HA 4P7VA 5K20B 1S7HA 4O44A 1U8SA 1SL0A 2IHR1 4MTPA 3IP0A 5EGYA 2L9WA 3G82B 3LAKA 4PAAA 2RB7A 2B6AA 4RBUA 2WTFA 3EGNA 4C7QA 4OLPA 1TVRA 4AUKA 4LF5F 3CCSS 3VZHA 2Z30B 3OLBA 1WG4A 1WC4A 2NLWA 4QYZK 5SZTA 5B08A 2OPQA 2DD8S 4CDIA 2FJWA 4KT0C 5KTQA 4CQ1A 3BZQA 1HQUB 3S6EA 1RZMA 4PWDB 3QJLA 4B9MA 2BE9B 2J0XA 4PKDB 5J2PA 2CJBA 1NJYA 1NDPA 1VQKS 4LQ3A 2OGUA 2HMIA 4DZ6A 3NY0A 2KN4A 2R8GA 4ZPBA 1K47A 3D0IE 3BR9A 3JQMA 2Y9HA 4FBUA 2CNLB 1VIXA 4DR1F 1IKWA 1FVSA 2A6MA 2UUAF 2CUYA 4LIWA 2OPPA 4OZ0A 4P52A 3KJVB 2KDOA 1TMMA 1URNA 3MPWA 4B3RF 1B99A 3FEXB 3CEDA 1IM4A 3BR8A 3OHAA 3HD2A 2O01C 2VU5A 5GADI 2SXLA 3KUGA 1ZM3A 2CJAA 3HFZB 2G2ZA 4CO5A 4Z37A 4M5IA 2ZWOA 4MFBB 3FK4A 2QL7B 1RT3B 2CWXA 2PDAA 1UJ5A 3CB4A 3KLEA 1NJXA 2PE8A 2ZHAA 4MYUA 2MKKA 3MM9B 5IC6B 1WOOA 3R7BB 3J81Y 1RLCL 5B0CA 3DOMA 2BJ8A 4DR5J 1IXKA 3AB4B 3UI3A 4C3LA 2B9YA 2RU3A 3PIOQ 4U95A 3CMQA 2FVRA 2I0XA 1U0HA 2QLWA 3OXGA 1YX2A 4B3TJ 2EFNA 4F2RA 5AXKA 1X4EA 3C6TA 2K1RB 3HZEA 1J5OB 2B3TB 5KG6A 4DS4A 1RKJA 1GH8A 4KKOB 3MM7A 3MZIA 4RW7A 2DVIA 1IR1A 1TV6A 2BEFA 2DGXA 5CA5A 4LJMA 3V6JA 3DN9A 4JV2A 4U7UK 1X60A 2X7IA 1RHQB 1YJUA 2B9WA 3GG0A 1CLFA 3OSPA 1EHWA 4WFAQ 2J9DA 1RAGB 1U6FA 3BYPA 3RU0A 1JMTA 1FFGB 1M5HA 2JL9A 3M8PA 2Z2ZA 4P2SA 4FVMA 3P6YC 1MWZA 3WC2A 2CPXA 1QSSA 4O3SA 3EYZA 4FF4A 1PJ6A 3B78A 4C8LA 4IH7A 3M8ZA 1XERA 1UA1A 2BE7D 5L9XA 3H5UA 4CM2A 4WCEQ 4OHXA 3TEHB 1E6VB 2E9RX 3C16A 3UN5A 2G1DA 3NNHA 1GTHA 3IG1A 3Q2SC 2MY7A 2B4OA 4NLVA 1XNQF 3P5BP 1L3UA 3EUNA 2D41A 1Q95G 1KHVA 2YWKA 4UUXA 3RAMA 2QO3A 4QIFA 1PO6A 4A8MP 1KQSR 1BGXT 2K7JA 2CDQA 2H5IB 1G1XA 4ECWA 2FUG9 1S1VA 4ZVUB 4DX8H 2VFTA 1R0AA 3MTKA 2V0NA 1ZZFA 3I6PA 2UXDJ 5KFFA 2IM0A 3L4BC 1LW2A 2KM8B 1NUEA 4LIRA 3V6DB 4KPYA 4LF2A 5HBMB 5B0FA 2AGQA 3RBZA 1Y5NB 1JWWA 5HL7Q 5F8IA 3FVYA 2N3LA 1UFKA 1TP7A 1QJHA 2RJZA 1NDKA 1YTYA 4TYBA 3M30A 2ZD1B 4MKYA 1MU2B 1FKOB 4UF4A 3IRWP 1LW0A 4Y3CA 5DGBA 4KPCA 3LUYA 4GKKJ 3CJ3A 3BGRB 2VQFF 3LP0B 1UWAA 1RT4B 3W2WB 1UL3A 3E01B 2QA1A 3IAS9 4OLOA 3A8KA 3MEGB 4HKQA 1J27A 2HFNA 4RW6A 1CJUA 2A10A 4DSJA 3FCHA 1IN0A 3FSYA 1WELA 4U96A 2JVOA 3K5NA 3D6MB 1S7IA 1XN9A 3CD5A 3LP2B 3GE9A 3ITHB 3CDWA 4BWJA 1N56A 3HM9A 4C8YA 2CQ1A 3GCWP 5GMDA 4NLUA 3UQSA 2FHJA 3IXQA 3NGRA 3B82A 3J7YU 3DGPA 2ZBRA 4Y2KA 3NAIA 1RWVB 3DM2A 3D7SB 4LF5J 3OVBA 2CADA 4M5KA 1KFSA 4F4AA 1U49A 3G86A 2RU9A 3DYAB 5HP1B 1U2RA 2LEBA 1W2BR 2R8IA 2GIQA 1SC4B 1LWFB 2BW2A 1IKYA 2MJUA 3CCJS 3H2UB 3JSYA 3MCOA 7FDRA 4ECVA 1HHTP 2HHVA 2N4DA 3HVTB 4DR7F 4TU8A 4AXIA 3PV8A 3P49B 1UETA 2CWKA 1KP6A 4DFPA 2DNMA 3U1LA 2APOA 1RHMB 1TL5A 1UAWA 4CT8A 4C97A 3HHDA 5HLFB 1M0SA 2E1AA 4ZJQA 1JNZB 1SQFA 1C0TA 1X4HA 5EX3A 4A47A 4YDDB 4NL5A 3QZ7A 2N7CA 2PMHA 2EBGA 4DR1J 2NREA 2UUAJ 3T5KA 1HNVA 3C2PA 4MKBA 2D9PA 3CJRA 1U09A 3V6HA 1WEXA 2D9OA 5EN1A 4P74A 1RK8A 2DGWA 2KKHA 2DGQA 5KFHA 4L72B 4B3RJ 3DLJA 2V8GA 4OZLA 2Q1LA 1C1CA 4J9RA 3G6VA 2GX8A 2Z2MA 4IH6A 2RT3A 3CJ0A 3UDCA 2X51A 1WTFA 1VLOA 3CMES 2C2DA 2GQCA 1FKPB 5KG4A 4X4SA 2CA9A 3E3XA 1RWWB 3OXLA 4R5PB 2R4FA 3BB5A 2V34A 4LF4F 2Z4PA 4OYIA 2HIQA 1NKCA 1FRIA 1NNDA 3KWMA 2EC0A 1MSWD 4CI0B 2YQ3A 1RHRB 2EKNA 3TZXA 2OUGA 2R7XA 4ITSA 1YJTA 3R2DJ 4OIXA 2M3DA 2K2PA 4MIAA 3G71S 4LBIA 1Q8IA 4WP8A 3CJ5A 3CCMS 3ZZPA 4L6V3 1HQ2A 4URGA 2LQ5A 4RW4B 2VKRA 1I3OB 4NASA 1T7PA 1EAYC 4B9VA 1WG1A 2JC1A 2VICA 1RT1A 2HHHF 5T7LA 3PW5A 3EDRB 2DPJA 5B0AA 3SV3A 1CJKB 1RCOB 1NB2A 4X4RA 1H6KX 4OYMA 1I5OB 5ETPA 1CULA 5CHCB 2E7WA 5D0EA 1N8RT 3UPFA 5E3CA 1HBMA 4F26A 3AD7C 3W5YA 5A76A 2DGUA 2OTLS 3Q8YA 1YRXA 3BSOA 5KFPA 2E9TA 2IIHA 1S9FA 2DR5A 3KUEA 4TYAA 4ECUA 4ZCKA 1WD6A 4USUA 2HNYB 3ILOA 3WQPA 3KTQA 3U02A 2OO4A 2OSQA 4Z7CA 2K8GA 2W9BA 4B9NA 5EHHA 2Z2YB 4WK3A 4NLTA 5KFJA 1XNQJ 3IR5B 3TUPA 3W65A 2BDPA 3QO9A 3H2LA 4PXEA 4DUZF 1RA6A 2RSQA 2GMJA 1NPKA 2VG6A 2I38A 5D4LA 1MWYA 3LOUA 2IAJA 1RB0A 1ELOA 5KFRA 4QYZJ 2LMIA 3LPYA 4NMLA 3SQOP 1JLBA 3G96A 3LGNA 2OD6A 3CT9A 3TQ1A 1FFWB 1S1TB 3KG4A 3VTIA 2RDJA 2AYGA 4OX6A 5K8PA 3Q22A 3GILA 3AT1B 2XHCA 3K8VA 1NSQA 3AJ2A 2YKMB 2N82B 4IYQA 5AE1A 4PQUA 2HBRB 1Y10A 2MZJA 5AE2A 1OY6A 4ECYA 4TY8B 3W9JA 3TAQA 4DN9A 3CCVS 4J9KA 4OX9F 2XMTA 4OZ3A 3M4XA 1Q8LA 1OY9A 1HWLA 1Q5YA 2B4VA 3I9ZA 1EETA 1REVB 3LW5C 4KAIA 3KHLA 3C6UB 3TJAA 1S1XA 3O6QA 3R6LB 4XDDA 3R5DA 5BXIA 4NYPA 4R0JA 5A2QU 4DR3F 3I55S 1CSJA 2XM3A 2E1MC 1TKXA 1XEZA 1NAQA 3CCLS 1CC7A 2BM0A 2ZJQQ 1P8GA 3AQOA 1S6QA 3OLAA 2JVRA 1FDAA 3LTOA 1IJEB 3DXSX 4H4OA 4DCOB 1TKZA 5LM7E 3HT0A 1G2EA 2IRYA 2H1YA 2EFOA 1D8ZA 3AXMA 1VBKA 3T5HA 2OKQA 3QT8A 5JMNA 2Y0BB 1VQPS 5CYQA 3CJSA 3BN4A 1JB0C 1YKWA 2AJ0A 2VFUA 5C2GA 1XC9A 3GB0A 4B17A 1UCNA 4KE5A 3QFWA 5F9LA 4ZCMA 2WONB 3PFOA 1VQYA 2HK3A 3B4MA 3BDPA 4X66F 2P2CB 3IWLA 4HI1A 2RHQB 4K50A 4YR2A 1RGVA 1K8AT 2KYZA 3QT7A 4LFCF 5HQLA 2NCKL 3DNCA 4YB7A 5M2PA 1GXUA 1EP4A 4R8UB 3G9CA 1M5SA 3M9MB 3RGIA 1SPBP 2YX1A 3D66A 2KB2A 4DR7J 2VA2A 2V50A 2BW7A 2RKIB 2GNKA 4QIWD 2H3EB 3DRSA 1HHQA 3M8SA 1FJ7A 2H48B 1VQ4S 3NGUA 4CCHA 4ZVSB 1X5SA 2RH3A 4JI3F 4CO3A 1BE4A 4ED6A 2V6AA 3ZTPA 2P8IA 2HHQA 4ZKAA 4CH7A 4PEOA 4KH1B 4WP9A 5MAOA 3Q8SB 1FTRA 3BDEA 3K59A 1UJ6A 1HI8A 3GP9A 3TAPA 3TX0A 2WSCC 4L3KA 2V9WA 5GMEA 2C2EA 4DU7A 4ZN1A 5T41A 1QUPA 3MECB 3PYFA 2KI2A 4B9LA 3WHIA 3OR2A 1U7LA 4ZITA 1VC6A 4YB1P 1TQLA 2DHHA 3QWUA 1FNOA 2DNOA 1VBXA 2VPZB 1NXIA 3PW2A 2W9CB 2EFQA 1GXTA 4LF4J 4X65J 5CD4A 3TA2A 1FXRA 4EMDA 2BQUA 1RT2A 1PCAA 1AROP 4TVAB 2V69A 3CD7A 3THTA 2M0GB 1NLKL 4ZHRB 5KFBA 2FVPA 1RBAA 1S99A 5A0YB 1R6VA 4HT5A 5DQIA 5DJBA 4NEYA 2D74B 1AFJA 4IQMA 2G0JA 5K8MA 5CQGA 1CC8A 3GWCA 4JV1A 2GGPA 3K5PA 2XS5A 1NU4A 4KGZB 4RWWA 3P3DA 4HACA 1GXLA 1OJ4A 1U25A 2D3O1 3HKZD 3SZ2A 1JK9B 1RHUB 2C42A 1BQNA 3F0NA 1T8EA 1NZAA 3DXBA 4A8YA 2L9NA 3QGIA 4F0MA 4OHWA 2VOPA 3VVTA 2BJ9A 2JFKA 1TMJA 2QMWA 2DISA 2F63A 3DRXA 3R5BA 4DCJB 3TVYA 2AKWB 1JLEB 4LR9A 3UN3A 1OO0B 1WORA 3OFFA 1VFJA 2D1CA 2IDLA 1WC5A 2PFFB 3DLBA 2MGZB 3KLIB 1C2PA 4KGXB 4FF2A 4ZP8A 1HI1A 3KNGA 5KAKA 1JLQA 2RRBA 5K5MA 4GKJF 3M8YA 3G8QA 4MAKA 5IQ6A 3MFIA 2O66A 2QRRA 4FP9A 1KR4A 3SSSA 2DEIA 4CT9A 4J7CA 4K2XA 5BJRA 4PABA 4DDFA 3OT9A 4XPCA 5DLGA 4F0KA 2R9LA 1T9XA 1H7XA 4DV5J 5A2QY 4DX5A 2GCFA 2ZBPA 4DUZJ 3SDEA 3MM5B 1PILA 1HI0P 1KTVA 3MEDB 2GVDB 1W7WA 4OYAA 1NH7A 3HP6A 1FFSB 3W9IA 1F3VA 4DR2F 3MEEA 3TR5A 5IFMA 3G6ES 1DQ8A 2W25A 1TELA 3KYLA 3JSRA 4W92B 3OVAA 2P9GA 4YDXA 2PSZA 3GFYA 2IJFA 1JLCB 2RIJA 2CNKB 4F02A 1Q0NA 3ZZOA 2UUBF 1I6JA 3G82A 5LT5A 3FMWA 3UN2A 3Q0AA 1ZBTA 3UO0A 2ILYA 1SXLA 3MF5A 1TR0A 4OX9J 4OX7A 4F8RA 4X4NA 1ZTTA 2Q79A 2VG5B 2V2KA 4DL4A 4YY3J 2R8KA 2ZUGA 1RAOA 3UR3C 2VOOA 3M9NB 4HH0A 1XR6A 1YJ9S 3OHBA 4FXVA 1U6ZA 1VR6A 4PUOA 2Q66A 1QD1A 4G3IA 1T9TA 4TU7A 4M5HA 3D1OA 3OFGA 3R9LA 1HQUA 5CZVA 2MLXA 4Q8EA 3FCVA 1NK7A 2GQ2A 3GJTB 1FERA 1VS3A 1NJWA 2MY8A 1SUQA 1Q7YT 4ILMA 1FHTA 3DOKA 3M2VA 3BH7B 4IDKB 4H4KC 4FYWB 3C14A 3QBCA 2UUCF 3GYGA 4G1IA 2D3ZA 1AB8A 3PX6A 2CZ4A 3G2XA 4MK7A 4QBUA 3V4IB 1PJ7A 1HPZB 1ICEB 1O6XA 5LSLA 2IRXA 1B4SA 3J80U 2JEJA 5LMNJ 2ZH9A 2GJFA 4K5SA 4RNNA 4D3HA 3PO5A 4IFVB 3SI8A 2DR9A 2OAUA 4X66J 2JJ4D 1FE0A 1RTZA 2LQ9A 2G1HA 1N54B 4MKAA 5JJBA 4CP5A 4KFBA 3H2VE 2OEMA 5C42B 4LFCJ 1RT3A 2MQLA 1RAEB 1GAOA 1JLFA 3I4HX 4DLGA 4FBTA 3MM9A 3DGVA 2KZMA 2ZH5A 4NCBA 3V6KA 1VJQA 2VFRA 2DTJA 4QWEA 1AT1B 1DAXA 2AP6A 3PKYA 3PDNA 1JKHB 1NK8A 2B9EA 4KRWA 3UVJB 1OQ6A 3N9UC 1LWEB 2YTCA 3A3NB 2IC3B 5HN0A 3VQTA 4ERDA 5B0DA 1UVKA 1TL7B 1SH2A 2G0CA 4W4MA 2K1RA 3NS6A 4FYYB 4UZBA 1QVGR 1VBZA 3NP5A 3SFUA 4ZVEA 4DFKA 3SFGA 2EI5A 2EPIA 1CEZA 4NA3A 5ETVA 3NXZA 3MMBB 3OW2R 1CJTB 4CNYA 3QRPA 2HNDA 4OZ2A 2FY1A 3QGPA 2UV8G 1VHFA 3JTNA 4C8MA 2CNOB 2LA4A 2OP5A 3HSDA 2KXNB 1HNIB 4FS1A 5KFEA 2OPRB 3D0HE 1T03B 2V4JB 5CD4H 2XLKA 1NHVA 3K0JA 2VZ9A 2XI2A 1VI7A 3TWZA 3PR5B 2DNKA 2HQ3A 9RUBA 1HBNB 1S9EA 2FDNA 4C8OA 3QLHB 1BMQB 2HVHA 4LRFA 3T3FA 1YJNS 1B64A 5H9FK 4G1QB 5J2QB 4PPZA 1T94A 3GTYX 4HLBA 4X4UA 5LL6d 4AL5A 4PWUA 3EE3A 1NRKA 5LJ3Y 4N8OA 4QYRA 1YK9A 4IRKA 5G0RB 4YB6A 4DG1B 4O4RA 1UVIA 1WNEA 2QTWA 4ELTA 1Y3KA 3K2YA 4H4MB 1KKHA 1R31A 3BQ2A 1KQGB 2FC9A 2R7TA 2DT9A 2OMLA 3MAAA 1VQSA 4TY9A 3TVKA 1KQFB 5GADU 1U02A 2KT2A 3FMBA 2CIMA 2HGMA 4ED0A 3W63A 5LOQA 4DSEA 3PRDA 1RWOB 2ZFHA 1RP5A 2XMMA 1NH8A 5HBMA 2HGLA 1AYEA 2XCAA 2ZKUA 3M8WA 1WF2A 3DDKA 5LJ5Y 3MCMA 1ZAWA 3OTDA 3ENQA 3QT5A 4J90A 3JB9k 4F4KA 1FD2A 3F73A 3D5MA 2L41A 2MDAA 4EBEA 4O3RA 2A18A 4IO1A 3KLFB 2A2DA 2ZD1A 3VR1A 2N4CA 1Y5IB 2YWGA 1MU2A 3WC0A 2JZ5A 1A7GE 4WWSA 2QSFA 4DI6A 4NRTA 2YPYA 2AYEA 2FVQA 1TTHB 1DLOB 2HVDA 2ZVSA 2EEYA 3M8QB 1QE1B 1RT4A 2C2MB 2QMXA 4DHVA 2IJNA 4OYOA 1RU2A 2XO6A 3RBEA 3W2WA 1D1UA 3E01A 4F7VA 8ATCB 2WB1D 1GQEA 4DV2F 3DLGA 2KT5A 2LXIA 4USVA 1HKAA 1SC3B 3DU6A 1GMWD 1FE4A 2RS8A 5F8LA 3DHXA 3TOQA 1XNRF 2ZBCA 2E1PA 3BM7A 4RLEA 3UD4P 1BWEA 2LKZA 2HLTA 2ZVIA 4DV4F 1BWVA 3I87A 4ZJOA 3T1YF 2V67A 3QAEA 2IM3A 2AEJA 2DH7A 3ITHA 2C2OB 1UEKA 2R7VA 2V8HA 3KUHA 3J80Y 2MQOA 2I6WA 1RTHB 3LANA 2IBKA 2GFFA 1TK0A 1SI9A 2ADBA 2PEHA 5HP1A 3DYAA 2CRLA 2ZBIA 4IO9Q 3EZOA 3NWRA 2F8MA 5F8GA 3L95X 2ZE2B 2HWIA 2BUNA 2U1AA 1LWFA 2ERRA 5CZXA 3TYTA 3UCGA 3ELHA 3DRRB 3HVTA 3IWNC 4DV6F 3D6FB 1ITPA 4OZ5A 2KZZA 1K1SA 2PD1A 1FCAA 1RAFB 3K17A 1TKTB 2OPSB 4WZQA 4FYDA 4DQRA 3GQCA 4XO0A 1WG5A 3N28A 2UUCJ 4ZA1A 1TZ0A 4QQBA 3UE2A 2VG7A 1LEOA 3KK2B 3R97A 1S49A 4C8KA 2DGSA 1Q7LB 4NXNF 4RUBA 4C9DA 2G2OA 4ED8A 2E7VA 3CUNA 5I3QA 2RQ4A 4NLWA 5BR8F 2X1FA 2O67A 3VAGA 1MLAA 1REGX 1IVZA 3QMQA 1UVJA 1V3ZA 1RYRA 2LQBA 2YNFB 8RUCA 3HJVA 1B0TA 1JLAA 3MR5A 3OTCA 1RYSA 4JB8B 1TFWA 4MT1A 1NJZA 3E2EA 1H2TZ 1FKPA 3M9OB 3ULHA 3CC7S 4R5PA 4HL9A 1NBEB 2GQQA 4DN0A 1TK5A 1O0PA 2R7QA 3UDEA 1IUJA 5I3UB 2P5VA 4BHQA 2R2RA 5E3QA 1Y11A 4JI5F 2BOAA 5KOXA 4UY8T 2QC3A 4I2QB 1FWLA 2DKOB 4DSKA 4TXSA 3F44A 4ZN3A 2DNHA 4DWIA 3D1QA 1UA0A 3GSIA 2NXUA 3EXCX 4DMZA 2MXYA 2GIRA 2NYHA 5KFQA 2BJ7A 1TL1B 3CF5Q 1DQ9A 2DNLA 4P9SA 5KFDA 3CGIA 4GVBA 2FHMA 4Q44A 4KB7A 3LAMA 3ZZZA 4OJ1A 4CTAB 5ETSA 3J7AN 2BJDA 4HHHA 1NO8A 5U47A 2VL1A 2GV1A 1OWXA 3AQPA 4OI2A 2KXHA 2F4VJ 1HFEL 1CJKA 4UQTA 2CDRB 3MMAB 2MTLA 1MROA 3CXCR 2NPFA 3SIPB 2JEGA 2OEKA 3NGDA 2AF6A 1EKSA 2ZWPA 4M5GA 3GU0A 2F40A 5E0OA 5THWA 4DQPA 5E2QA 3RAXA 1T05B 4HDHA 4P2MA 2KFZA 3KNAA 2DY1A 3R2CJ 2HNYA 5FLXY 3I96A 1M1GA 3FBEA 1LK5A 4QPTA 5DM6Q 2AZ3A 3DHWC 5D78A 5E5NA 1MN7A 4XIUA 1WEZA 3U27A 4NLSA 3X3UA 4ENOA 1M1KT 4LRBA 1S0NA 3WIUA 1X4GA 1BQMB 1ZZNA 4Y28C 2FLOA 3M2RB 3ZNUA 2H4YB 3JS9A 3PW4A 2R7UA 2KVQE 3EWGA 2MKSA 3MFHA 4DSLA 3VQSA 3MM8B 4O4GB 4NMXA 2MYFA 4I6WA 1S1TA 1S0VA 3UCUP 3CWJA 2BJ1A 5IM0A 3BBBA 4CLFA 3FQLA 2CZ9A 3W5XA 2YKMA 3QNWB 3D67A 3ENWA 3POTB 4HVZA 3KFWX 1HW8A 1ZTWA 2YY3A 3KMSA 1VHIA 5F8NA 4TY8A 2XGPA 2IVYA 2KJVA 3V81B 4HI2A 4C3MA 1REVA 1X0FA 4BC7A 4J9OA 4EUVA 4YHHF 3AJDA 1RE1B 4NWBA 5F0WA 4WFBQ 2L08A 5CCMA 1FDDA 1UWBA 4ID5A 4N56A 1H0HB 1ZAVA 4TN2A 3VAIA 1FJCA 3KLHB 3JXOA 1UP1A 4DV2J 1N0VC 5GAEU 2MKIA 1X31C 4FVCA 3BS9A 2ROGA 4Y2CA 4C48A 3PKMA 1PGZA 3V4MA 1Z1ZA 1RAIB 1HIYA 1TFYA 3KMQA 4DV4J 4JYAF 4OV6A 3T1YJ 2ZM6J 2OD4A 3LP1B 3DRYA 2NXJA 1HNZF 2V2VA 1KBRA 1ZA2B 2AX1A 4NYZA 4GRSA 4TNOA 4ED2A 2JHEA 3M1VA 3HHNB 2DK2A 1N34F 1UPMB 1S6UA 5DS7A 2H5EA 4UY85 5HMWA 2FLLA 1RTIB 3VGTA 4ED3A 3DDIA 2P6TA 1RTDB 1P9QC 2EG2A 3HF5A 3NGKA 1WF1A 3MMCB 2YWWA 3LPEA 2XBPA 4DV1J 4DQSA 5J1NA 1U1QA 4DV6J 3KLVA 4OYPA 1QAXA 1YJRA 4AL6A 2XY7A 2M70A 5IQQA 1RU1A 4ZOSA 2RKIA 2YWHA 2B5JB 2DCLA 3PRBA 3TAMB 3TX8A 4J9SA 3I0SB 4PYDA 4DR6F 1M5PC 2XB2D 2VIHA 1SV5B 3SSRA 2OSRA 5I3PA 5L46A 2GHWA 2L3MA 4FF3A 8AT1B 2Z58B 2XMJA 5KG7A 2CVEA 2LDYA 2UXBF 4OQJA 4KC5A 3Q86A 1RHJB 2FPHX 1L3TA 4NXNJ 1XQIA 3R8YA 2ZH7A 5DM7Q 4LSZB 1FI4A 3K58A 3W64A 2Z2LA 2YNGB 5H9FJ 3GPAA 1TAQA 4PPDA 5BR8J 3FBCA 1JXVA 3A4TA 2DO4A 5KFVA 1JXLA 3KK3A 2MZTA 4MIWA 3HSGA 3MECA 3O5TB 2F8HA 2IVMA 2G13A 3DI6A 4ZP6A 4QWDA 2ALYB 2ZITA 4I6AA 4NLYA 1KQKA 5B7WA 2I1RA 3ISNC 1BUXA 1SBRA 4TKTA 3HULA 1LKZA 1JQGA 1NEEA 1FEEA 2W9CA 3GCXP 4J9MA 4AQYF 1LFPA 3BSCA 5KFLA 2JRSA 5KFOA 1SH0A 2M4MA 2C22A 5KOWA 2NXNA 4JI5J 2UU9F 3Q8PB 1Y3JA 5LSOA 4M5DB 5A0YA 3LF0A 1FJEB 2FHJD 3LWMA 1RACB 3EZ5A 3IS9B 1ZETA 2XMUA 2CG4A 3QJPA 1S9GB 4QJVA 5E7OB 4IRCA 4KR0B 5SUHA 5IV3A 3GIJA 2J6SA 2M9KA 5E33A 1E6YA 2W4PA 3GSDA 1TVRB 3KXDA 1XR5A 1AFIA 1AZSB 1W2IA 3VV2B 5HROB 5AJ3J 4K4ZA 3G6YA 1PG5B 2M8DB 1OQ3A 1KC8T 4ZS6A 3F56A 4G65A 4ZVFA 2ASDA 1U1PA 3THPA 3N01A 4WZMA 3DDNA 4EBDA 4WFZA 2OPQB 4HYKA 3OPKA 3CC4S 3TUIC 2CYYA 3NAHA 3QSYB 2EKYA 1FD8A 2NSBA 1IQTA 1PBUA 2KG0A 4QW9A 3F41A 3HFVA 4CM0A 4USMA 3ZZRA 3BJYA 2VH7A 4ZPVR 1VQ6S 4C3KA 4Y2IA 2H5JB 2UZAA 3P5TL 1RWNB 2IMWP 2RQMA 5KT3A 3ADAC 2CPHA 2X1GA 5CAAA 3N6LA 4J91A 4UOGA 1HNXJ 2VJVA 1UKUA 2I5JB 4L73A 1U1LA 4NZ6A 4QR1A 3ZTQA 1MMDA 2HVEA 1Q5VA 2EW9A 1FVQA 2YKNA 3MEDA 1WKLA 3KDOA 2GVDA 2AMCB 4NOHA 1KN6A 4U7CA 2B7BB 4F3QA 4QZVB 5GAGI 1V5VA 3BKUA 3SCLE 4FYVB 3A13A 2ZH2A 3NCPA 3FBBA 3LGHA 4PWWA 2EK6A 1V3SA 5A6WA 4I56A 3DOMB 1JLCA 1RSCA 2C3UA 1NDLA 1HA1A 1Q8KA 1AUSL 4OI3A 4OYZA 3AOBA 3C6TB 1NK4A 1T02A 3R5AA 2E44A 1VC5A 5HMZA 5E3RA 4I0WA 1D09B 1DHMA 2ACYA 5KT4A 4YHHJ 4UOHA 5ETLA 1X8DA 2PN6A 4USTA 1HQEA 3U1MA 2JNJA 3PACA 5D0RA 4RW9B 4R0EA 4FXWA 2BRLA 3M8PB 4X2BA 1VQOS 2ZH4A 5KFGA 2WVCA 5KT2A 4DQIA 4B3SF 2YVSA 4PXDA 4IDKA 1WHYA 3J7YI 2FJXA 1OSDA 3HHLB 1VBYA 2CQ0A 5EUHA 1FF2A 1HBUA 2DHAA 1Y9OA 4JYAJ 1S97A 3TQEA 2BQ3A 3PJXA 2WSEC 4C8NA 3C16B 2CQHA 4LMZA 5CYMB 1HNZJ 4KJIA 1PC4A 3CMAS 3V4IA 1C1BB 3O8WA 2N3OA 1HPZA 2GMHA 3Q8UA 7AT1B 3OFHA 4IKAA 4N77A 4X64F 1DTQB 2IY5B 5DG9A 1N34J 2RUSA 4I69A 4I67A 4M94A 5A8RB 4U8YA 3K5OA 2CQ3A 5LXYA 2MZSA 2DIVA 1S1VB 4AYBD 2B8PA 3MURP 4LFBF 5C42A 2M52A 2WSFC 4LF6F 2W01A 4QR2A 1YVFA 3AAWB 2PMZD 5M2RA 2HRTA 2HLUA 3TZWA 3FGVA 4JV5J 4F04B 5HMYA 2RHSB 1XR7A 1SKWA 1X0PA 1GK8A 4Q7AA 1ZS6A 2FY8A 1N52B 1LWEA 4WJBA 1IJFB 3I5BA 2IC3A 2LXFA 3CO9A 3D28A 1TL7A 2F9JA 2AJFE 3H98A 2X1BA 3OUYB 2UXBJ 3MPVA 5DO2A 2I2YA 2QT7A 2VQEF 1IBLF 3TZYA 2W9AA 1MW7A 4M8LA 3C19A 2XWYA 1IKVB 4NCGA 3M30B 4I6YA 3PYGA 1NKEA 2ZDPA 4AFFA 2C2NA 3TRGA 2RDDA 2GO9A 1LW0B 1Q78A 2HFVA 2RF2B 4NA2A 2R2SA 3FZ2A 4ELVA 2HS4A 5BYRA 1WC0A 5HANA 1MN9A 2ZNYA 4M63A 4QWBA 4A4JA 1CQMA 1U26A 3QGHA 1G6BA 2KL8A 1N33F 4WU2A 4AQYJ 1CJUB 2IBOA 4N7TA 1RT5B 4WKRA 4DR4F 1RABB 3MHYA 1T03A 1WI8A 4FS2A 1FT8A 4QWCA 3KJQB 1N5VA 1CG2A 2V4JA 1Q82T 3MWBA 1RBOB 4YB5A 3IFEA 2UU9J 2Y0SD 5KT7A 1Z2LA 4LBPA 1F9HA 4M1KA 1SVDA 4DV0F 1HBNA 2GVZB 3QLHA 2FLPA 3FJ2A 2CG8A 1G7CB 3EICA 1VDHA 1OY8A 4I2PA 2HBZB 2D7SA 5J2QA 1Z2ZA 4CO0A 3I0RB 4K59A 3DGPB 3IR6B 2E5LJ 1FWPA 3DM2B 3CIMA 4A8OA 3PJ9A 3EGVA 3WBZA 5G0RA 4DG1A 2KVIA 2RNEA 1WKKA 4WFNQ 5GVQA 1DY3A 3FQKA 4DL0C 2CPZA 3BO2A 4P72A 4H4MA 4DPOA 2OTJS 1M5OC 2UP1A 3W8PA 1RJJA 2ZDOA 1RI7A 1EARA 1S1WB 3CJ4A 4ELUA 3MUMP 4NLXA 2RS2A 5L9NA 3RZAA 1UFLA 4K4VA 4X4PA 4J9LA 2V8VA 4KO0B 6FDRA 1GMUA 2W7PA 1KDNA 3IRXB 1XIQA 3CJ2A 3HMJG 3RB4A 4EK2A 4IR9A 1B0VA 1VC0A 3LA0A 2WAQD 3SV4A 4I64A 5KFAA 5E41A 3KLFA 3THVA 4BLGA 3MAQA 1N32F 4IR1A 2J76E 4KIAA 2XY6A 1YJWS 1C1CB 1BLUA 1FRHA 4EYIB 1SJFA 2FVCA 1WSVA 3GIIA 2Z0GA 3OV7A 5GAHU 4A46A 1VRQC 3CD0A 3NG8A 1QE1A 2JWNA 3W7BA 1LK7A 2H54B 3TJ9A 4WIQA 3CDUA 2HVIA 1ZA1B 3AB2B 3DC2A 2CFXA 4OMFG 4RPFA 1ZM2A 4PYAA 3OR1B 1WEYA 4K4TA 2KYXA 1M1HA 1PIEA 4O0NA 3TI0A 1YHQS 2E7XA 5FIIA 2QJ3A 2OHDA 3HI9A 3W2VB 4O23A 5DLFA 3Q83A 2FQQB 5J1EB 3RR7A 4LF8F 1RTHA 3FUYA 3HX9A 2PA3A 4G6VB 5DDRC 1SCJB 2R2TA 5J2NA 4YP3A 4C4WA 3X1LB 3D6HB 3CJTA 4P2FA 5T7LB 3HT3A 3IBFB 1K44A 3DLKB 4DUYF 1ZYQA 3FSXA 1GNKA 5AXMA 3LWLA 3DRRA 2F8EX 3T1AA 3ET6A 3A8EA 3VZIA 5F3ZA 2OJ3A 1S6PB 2G0IA 2R7SA 2VASA 1TKTA 4B3SJ 1NKBA 2OPSA 1F60B 3N0VA 4ZDNA 4LSLB 2B9XA 3D6TB 2VF3A 1RTJA 2HBQB 5JVHQ 4J37A 4NLPA 1NM2A 2MQ8A 2CPEA 1RA7A 1HHSA 2VBXA 2PA8D 1LOUA 2W9BB 2JLEA 2OFHX 5D0GA 2VBWA 1VQ7S 1SKUB 4LRAA 1WOSA 4LR7A 3PYDA 1TAUA 4KBIA 2M2BA 1M5VC 1WDDA 4X64J 4RW8A 5B0GA 2XMKA 4NA1A 2DRBA 3GV7B 5KFWA 2F7VA 1VK3A 2YKQA 2X3GA 2NXEA 2BKPA 2MKHA 2I8EA 2VA3A 1XBWA 2H51B 5IT0A 4LFBJ 2C2KB 3LQVA 3M2UB 1GX5A 4LF6J 1T11A 1MMLA 2BOPA 2ZOFA 1YLXA 5I3UA 4V1Ak 2ABYA 2ZJRQ 3BGLA 2BYCA 4I2QA 2V9KA 4NLRA 3VAFA 2ROPA 1BQXA 3HHLD 4ZIVA 1KD1T 5KG3A 1ZM4A 1IBMF 2AHOB 7FD1A 5DDPC 2V5HG 2BRKA 2QV6A 1M5KC 5DDOC 1N5YB 1FDNA 2IM1A 4ICLB 3QYYA 4O0IA 4P6QA 3PY8A 1XMQF 2VQEJ 4DPTA 1IBLJ 2NPIA 4DX7A 2DHGA 2XYPB 2UVWA 4FKXA 4CTAA 3CIZA 4KV8A 4LSNB 2CXEA 1PYOB 4X4TA 1U6BA 1HNWF 4C8ZA 4I68A 2CKWA 1D3WA 1R6YA 3MMAA 2UVRA 1DTTA 3R27A 4DF4A 1S1UA 1S6QB 3PG9A 5F9NA 2FGOA 1TKDA 4NLGA 1YI2S 1U2FA 4I1TA 4A8QA 1NSAA 1TKZB 2VPXB 2DGOA 4CO1A 3DU5A 2HHTA 4DR4J 3P45B 3Q23A 4DL6A 4ZVHA 1YIJS 1ZPWX 1T05A 2W7OA 1UZHA 3NOCA 4CH0S 1TL3B 2F5GA 3HFKA 3HHEA 2K06A 1Q81T 1YZ7A 3M6UA 4ETZA 4DV0J 3H42A 4M5NA 2XEXA 4KHRA 3UNGC 2YNHA 4NRUA 4P73A 5KFUA 4KTQA 3EJMA 2COLA 4A8FA 1EKRA 2XULA 1NK0A 4L75A 3H5YA 4CO4A 2MQPA 4Y65A 3J7ZT 3W8GA 1YGYA 2A2CA 2WZ1A 3P96A 4WE1B 1VRTB 1BQMA 1KEKA 1X5OA 3OL6A 6AT1B 4WU3A 1X5PA 2GIFA 3M2RA 3D3CJ 4YUDA 4PXBA 4ZVTB 2Z56B 4F4XA 1P9YA 2Q3PA 1GFWB 1EP4B 3AFGA 5L8RC 5KT6A 3SQGB 3MM8A 2ZBQA 4GMKA 3QIPB 5T14A 5GMKa 1J2VA 4OZNA 2UUTA 1KVIA 3DRSB 3ETOA 4M5LA 1LWCA 1WSRA 1ROFA 2QLFB 4DR5F 3V5RA 3UCZP 4HHJA 1U48A 1RT7B 1VRUB 1R7IA 4UUWA 1A0OB 2B7CB 2CAJA 3VAHA 4ZP7A 4AD6A 4ATNA 2MKJA 2RUGA 3RBXA 3ZTOA 2RRAA 2AD9A 2BANB 1SB6A 3O2IA 2JOQA 2RDIA 2J0WA 1S79A 3IM8A 4DFJA 4N47A 2AGOA 5KFNA 3W61A 2NR0A 2ACMA 4FN5A 1N32J 1FXLA 1WHVA 2CQPA 4H54A 1R0BG 4EFAC 4UOFA 2IRUA 2C3YA 1VQ5S 3K5MA 3MAHA 2Z57B 3AY0A 2AW0A 4ZIWA 3ZO7A 3ENVA 3CNQP 1RWPB 3JQKA 4FDFA 4M5JA 1SJ4P 3RJMB 2BKOA 2DGVA 2VV5A 2CVIA 2VHGA 3AJ1A 1QVFR 1F9FA 1R0CB 4F4ZA 3DLEB 3HCXA 1DRZA 4BBYA 3W60A 3HVAA 1GX6A 4ECRA 5D4OA 3NEKA 4IUFA 3ZTRA 4Q43A 2BM1A 3PIPQ 2QN6B 3BPSP 2NQPA 1TK8A 1M90T 1C0UB 1VCTA 4V19J 3LP1A 2PI5A 4U6PA 3GMGA 1KS2A 3KG0A 3ZXWA 2VB6A 2A6OA 3H5SA 3OL8A 5CH7B 3H5XA 4C6AA 2MSSA 2YNIB 2MQQA 2VQFJ 4IQXA 1HL6A 4UW2A 3GJSB 1MWQA 1V9OA 2J7KA 3S1TA 1LXJA 3AOCA 1NCLA 5D77A 4TQRA 3BSNA 1YWXA 3K5LA 3FDSA 4DUYJ 4DEZA 3PFEA 1K73T 2FZCB 3HSJA 4ZPWR 2UXDF 1H98A 2BV3A 3CTRA 2KHDA 4PRFA 3TAMA 4LRCA 1RKIA 3I0SA 3ICLA 1L5UA 2KJWA 4RO0A 1JLQB 2AYMA 4WP3A 4NZ0A 2KRRA 4XK8C 4EGLA 4JI4F 3ISZA 2GZOA 3C15B 5KG2A 2DRDA 5ETQA 3T19A 4JI2F 4BCAA 3N5FA 5ITHA 1N88A 4JI6F 2YNGA 2HHWA 3IBCB 5HK4A 1DURA 4OI1A 2FC8A 3EVOA 3BBCA 1S72S 4GKKF 2Y1RI 4ILRA 1KWMA 3SDEB 3KLGB 3EM1A 2LFVA 1HWUA 2KTQA 2FJVA 2WB4A 2B43A 3HZGA 3CVKA 2WK4A 1OYDA 1WC1A 1HW9A 3J7Z5 4DPYA 2CQ4A 1AUDA 2DY9A 2HIYA 2RMLA 1R89A 5RUBA 2EWHA 4Y34A 4Y2AA 2GW8A 4M5DA 3RTVA 2UV8A 3HVWA 5L38A 1KHWA 3HD1A 3IS9A 2HHXA 1VOMA 3VGVA 3ONQA 1S9GA 1IBMJ 2J9DE 2Y8YA 1R8AA 2DYAA 3W5ZA 2XYHB 1Q86T 2LA6A 2LEAA 2ZHBA 2Y1LB 3PX0A 1FRLA 4ZPAA 4IH5A 2D3UA 5M2UA 2AYBA 1KOOA 1XMQJ 1AZSA 1N5QA 4Q2MA 5HROA 3ILJA 2WBMA 2E9ZA 2QX0A 1BHNA 4ED5A 1QAYA 3FFIB 4EZ6A 1NSKL 3TARA 4RUCA 2NYIA 1HNWJ 3ILLA 5DG8A 1QDUB 4XDCA 3CPWR 4XAKA 4PUOB 2RILA 1K0VA 3RB0A 2EVZA 2ALZA 3D3BJ 4WIIA 4RUAA 2M7SA 1N6QA 2DHSA 1UW9A 1SUQB 2HSEB 3DOKB 2BX6A 1QAIA 1PJ5A 3M2VB 1UW4A 2HURA 3C14B 2WOMB 1N36F 2OMOA 4CLZA 4CLLA 3PR4A 3WIVA 1WOPA 1P6TA 1YBUA 4J9PA 2R7WA 4F3MA 4AE5A 3O1LA 1NMEB 4B9SA 1VIOA 1FESA 1T9YA 1R43A 3OBIA 2HHHJ 2HRYA 4JP8A 5EWGA 1RWXB 1F5BA 1OYEA 2I5JA 1D8YA 1Q53A 2V68A 2ZOMA 3EVWA 1RCXB 3KG1A 2W8LA 5L1KA 1R27B 1ZAXA 4ZK7M 5IXUA 1DFDA 2EFGA 5KT5A 4OJHA 4NYOA 2FJBB 4KFBB 2FVSA 1MMNA 1MG7A 5IS2A 4K0KF 2OIHA 5DETA 4PCQA 1R3NA 3SCIE 2HZVA 1IR0A 3CDEA 2AEMA 2QA4S 3IGVA 1JLFB 4EZ9A 5IZHA 4K4SA 3PYEA 1X4AA 4UT4A 2F3JA 1LNQA 3NOGA 3M7VA 2L9DA 3ZC4A 1U0SA 3MPYA 2AT1B 4IOBA 2VODA 3ENAA 2NS1B 2GJIA 2ZZTA 1KLNA 3OL9A 4N5SA 5A8KB 1HYSA 2R8JA 4NX9A 2AJ1A 2FB0A 4MJKA 1HD1A 2HW3A 3EXYA 2Y8WA 2CQ2A 4CZCA 2YH0A 3ZTSA 2PO4A 1FK9B 2QGFB 3G8SA 2ZZMA 2QIFA 3TJ8A 3FEYB 2DBBA 1IKXB 1X9WA 4URQU 3IBWA 3PW7A 1EJ7L 4NE9C 5K14B 1IR2A 4WTOB 2C3OA 4FPIA 3G87A 1J5EF 1QM9A 5D3GB 1LXNA 5DQGA 3AODA 4RW9A 1FNXH 4U8VA 2IMOA 3KK1B 3DLLQ 2RD5C 2HNDB 5ETOA 1EZZB 2FJAB 4QIVA 4J5OA 2V2QA 3KJFB 4RWXA 2PI4A 2DR6A 2P6SA 4WYWA 1JNRB 1DARA 2DCUB 3RW7A 1X7VA 2B4UA 2JLFA 4RKUC 3TW0A 3HHLA 3TO8A 1T9WA 4ZLNA 1FWKA 3JYTB 3GIRA 4NI2B 2G2YA 3EMTA 5HATA 1XWLA 4IG3B 5CYMA 1S9EB 3HPOA 2R7RA 4OHZA 4LF7F 3FC9A 4KGVB 2DR8A 3TVZA 1C1BA 4JI8F 4HEA9 1QSLA 3MM6B 2D3OR 5C24B 4DR3J 1S12A 1I1GA 3D9BA 1TUWA 1DTQA 5L39A 4ES2A 2ZZNA 3NS5A 4ID8A 5C5JA 5A8RA 4D3GA 4PWDA 2F9DA 3N6MA 3S7RA 1WACA 4NPOA 3CJKB 5MLCV 3IGNA 3V2UC 3OD2A 2ZOGA 4IOCQ 3MR3A 4CLUA 2EBEA 2LU2A 3G4SS 4W90B 1HMVB 4N8NA 4DSFA 4ZVQB 3PVXA 1RXOB 4ZVGA 4ZPCA 3MAAB 2H65B 2XNQA 5E3AA 4JV0A 4JBCA 5EX0A 4QOTA 3KJVA 4Q2LA 3H20A 2WHOA 4J9NA 2AIRB 4P10A 5GAGU 3R5GA 4FNHA 5AT1B 4JI4J 1S0MA 3BF4A 4FKYA 2CPFA 4KYZA 3OUYA 2V4RA 3MR6A 2HEKA 4JI2J 2QA2A 3FSIA 5I42B 4OI6A 2JEFA 5KFCA 3K8WA 4A48A 5IWAF 1IKVA 4MFBA 4JI6J 3PHTA 4W98A 3PHEA 4JUZA 2MHEA 2V4QA 3QFHA 2CPJA 1YSJA 5KFXA 1U45A 2RF2A 1D0EA 5HQMA 2F65A 2NXCA 1I94F 2ILZA 3M32B 4RNFA 2C3PA 2H9ZA 3L9ZA 3MMJA 3DLGB 3H0PA 1RT5A 4JI3J 3SYZA 3VHQA 4TLRA 2ROEA 4XPEA 2Z8QA 3MDFA 2HKEA 1J5OA 3RUBL 3J81j 4KKOA 4CH1A 2ZNZA 2FYXA 4KHMA 2EG1A 1Q4RA 3KOAA 1G4CA 2GVZA 1Y00A 5LMUF 4RBVA 2ADCA 4OYBA 4GC7A 2AEFA 2FIUA 4IFYB 1HBOB 1HWJA 2NSCA 3I0RA 2FLNA 4PG8A 2E5GA 2CQCA 4IG0B 5E3PA 1TU0B 2KU7A 1AXQA 3ZZUA 3B6BA 5H9EK 4TU9A 4NLDA 4P7TA 4YFUA 1VQ9S 4IOAQ 3NLCA 2KH9A 3MXHP 1HWKA 2J0SD 4F67A 4RNMA 2CJQA 5HJXA 3LH2S 5K8OA 1FRKA 1JJ4A 1E6VA 2NZ4A 1FDBA 1SH3A 1S1WA 2BR0A 3J7A1 2MQNA 2OH2A 1SKRA 4WFYA 1DBDA 4OHYA 4QCLA 4KO0A 4UOCA 1N36J 1B70B 5KFZA 2MQMA 2KG1A 2WRMA 3IRXA 1UMJA 2DHXA 3PX4A 2MLYA 2IYIA 2VG7B 3GFHA 4U67Q 2Q43A 2W7AA 5CCLA 3RRGA 2YPZA 4QW8A 2ZHOA 5ADZA 3T5JA 2VKZG 2LEPA 1JLAB 4K2JA 2E29A 4E8UA 4DPUA 3UFCX 1DZ5A 2A3JA 2BBEA 3V6DA 1H73A 2DPIA 2G9OA 4Z2XA 3T6JA 1L3VA 1WC3A 4K0KJ 1S6OA 3GG1A 5J2MB 4JI0F 4HTIA 1O51A 5KFKA 3TZZA 2HNZB 4X65F 3MCNA 2OLWA 4GKJJ 4GVLA 3IO1A 2W2PP 1CS4B 2LU1A 4EO6A 4G1PA 4DZDA 3OR1A 4L74A 2W2QP 4O3QA 4DL7A 1FKOA 2BQRA 1KFDA 5F3TA 1U2CA 2ZKTA 3W2VA 2J6TA 2K3KA 2BJ3A 4K4XA 3UD3P 2IYGA 5J1EA 1NHKL 3BGRA 2DITA 3PXGa 2DNRA 3LP0A 4GVBB 1SL2A 2LP4A 1Q79A 3C8YA 5AE3A 2W8KA 3MEGA 2XZDB 4HH1A 5GAEI 2HQCA 3BH6B 1CJVB 2A0FB 3B8HA 4DR2J 2G4BA 3K7RA 2QYGA 1J5EJ 3DLKA 3R1LA 1MROB 1S76D 3CDBA 4P2XA 2JC0A 4QR0A 5FDLB 1VQMS 3PNIA 1S57A 3LP2A 2H4WB 1S6PA 3ZZ0A 1YRUA 2UUBJ 4F0HA 2J7WA 5ETNA 4ANCA 3OTEA 3WX8A 2M5YA 4E2FB 4ZLPA 2R7OA 3KKFA 4LSLA 3JSMB 2RE1A 5L1JA 1UZDA 2QFIA 3SMZA 4U7UD 4MIBA 1S48A 2LDIA 1F2HA 4QIGA 2VDIA 4LF7J 4V19X 4GO5X 5LSRA 4JI8J 5DDQC 2DR7A 3CO0P 3AH6A 4DL2A 1RDRA 3DRPB 3AXKA 1UVMA 2DNGA 3W3SA 4MMOA 3OSNA 3VVUA 1KVJA 4DV5F 1W26A 3GIMA 1T9VA 3OTOF 1YBTA 2CZVC 2XZTB 1OSCA 2FHOB 1T95A 1FJGF 5F41A 4OI0A 3W9HA 4NXMF 2ZJPQ 1R8HA 2E5JA 4DBQA 2GMLA 1UPPA 1CVJA 4CNZA 3M2UA 2YQ0A 5FJ4A 3AA9A 1TUVA 4F36A 2RVJA 1RADB 1FXDA 5HLFA 3I56S 3L7OA 5IM0B 1H3DA 3L09A 5D6GA 3H4DA 2KFYA 3GYNA 1HD0A 5HMXA 1WUUA 2HK2A 2M88A 3GV8B 2OEJA 2UUWA 5IC4B 1CBKA 2KRBA 4ZJLA 2X3DA 4Y0FA 4CWBA 3CE8A 1N5YA 2PGCA 2J5AA 4ICLA 3R5JB 4WTYA 4B08A 1FEHA 5IWAJ 4E0DA 4KGMA 4YY3F 4Z7YA 2DH9A 2J0QD 1VISA 4LSNA 1C4AA 2XYGB 4OZ1A 2FZKB 1XMOF 3L7PA 1URRA 2HQDA 4Q5VA 3BREA 4OV1A 3T6BA 2BVZA 5C25B 3BBFA 1UWBB 4ID5B 1I94J 2PIIA 5A6PA 2VONA 4ETXA 4F50A 3H4BA 4K4YA 2ZUAA 2WCXA 2B8QA 5KG5A 1D9AA 1QSYA 4A8KA 4HR2A 1L3KA 2WVEA 4RR5A 1WTBA 4M95A 4ZP9A 4C98A 2PMWA 1TL3A 1NPPA 3RB3A 2MSTA 2KO1A 4RW4A 1VQNS 3ZZYA 3E51A 4ECZA 5LMUJ 3TUZC 1NZ8A 5LMNF 3HHKA 1ZPVA 1JX4A 3M1VB 4F25A 3GFZA 3S01A 3QATA 4I7FB 2QZ8A 4WE1A 2XTJP 1VRTA 3OJUA 2XCPA 4DF8A 1YBAA 3RAQA 1H74A 2ASLA 5HAOA 1C4CA 3TP2A 3RRKA 3ZFVA 1N5TA 2R3VA 4DUTA 3SQGA 1GEHA 4DL3A 3W1YC 2F4FA 3QIPA 3OL7A 2XMAA 4C11B 1R8PA 5HVHA 1XJWB 4Y6IA 4USJC 2E1RA 1RT7A 1VRUA 4LF9F 2W2MP 3OFEA 1WDTA 3W66A 5L1IA 3HVRA 1IWGA 3LALA 4KH0B 3SCJE 4X4OA 3QRRA 2ZC4A 2BANA 2HFSA 4DS5A 3B54A 2AJQA 2HPUA 3RW6A 1AA1B 4EWTA 3OTBA 2R2UA 3SSQA 1QLNA 1RBLA 2GO8A 2F1FA 1HARA 3R7SB 4O3OA 4ALZA 3MOZA 1CQNA 3GV5B 2XI3A 4X62F 4EEYA 3D54A 3KK3B 1P1TA 4B02A 3CCWA 3DI6B 2XS2A 1VJWA 1S10A 3HXMA 4LF1A 4LREA 4WKYA 2KHCA 4JI0J 3IAM9 3NBPB 2D69A 2XWXA 3DLEA 3WDOA 1S4EA 1B7FA 4MH8A 2HFUA 3AA8A 1C0UA 3PEHA 5BYSA 3ILIA 4UZCA 3C6UA 2Y1IA 3GYXB 4F4WA 2BE2B 3BV8A 5D4NA 3VWSA 2E5IA 5B0BA 1LV5A 2YNIA 4DXLA 1E6YB 2P9EA 2AWZA 2LXUA 3G6XA 2AGPA 1BY9A 3JAMU 1IBCB 2DB1A 4USHA 2MKCA 1QUVA 2DEJA 1VYAA 4KY3A 5EDWA 2CPYA 4B3OB 3LO3A 1JIHA 1JLGB 2DNQA 3TA0A 4FXDA 3FNNA 1XNRJ 4RX6A 1UVNA 4BWMA 2WVDA 1YZ6A 4TLQA 3DFEA 4KHPF 4FNIA 4DU8A 4CYUB 2C2RA 4WF9Q 2Y3YA 1KVKA 1IWAA 1KRPA 4J9QA 3NS7B 4PZVA 5HQ8A 2Y1JA 3H59A 2KXFA 5LXRA 2ATLA 2C28A 3L3CA 4CO2A 2WONA 4WXWA 1HWIA 2QLJB 2DJWA 3C15A 4PG6A 4RBTA 2IPOB 2ZH3A 2QL5B 5A8WB 2DIUA 3UNYA 3MCSA 4RUHA 1WC6A 3MPUB 4TQSA 2E66A 4R8UA 4B9UA 1G3OA 1VQLS 2HHPA 3P8BB 1Y7PA 2A1BA 1Q1KA 3BN7A 4JOUA 4C0OC 4ZVOB 5H9EJ 3OTOJ 3VALA 4HHUA 2L48A 2DXEA 2GAHC 4LUBA 5D0HA 3KLGA 2YKNB 1FJGJ 5FD1A 2J6UA 1B0PA 2XSJB 4NXMJ 4Q0BB 3EPGA 1R8CA 3T5LA 4ED4A 3FCWA 2VDHA 2XGQA 4EBCA 4ANDA 4ANEA 3A8JA 1LQ9A 2ATCB 4O3NA 1NK6A 1F1BB 3M6WA 4LVNP 4ED1A 3JTPA 4DV7F 2YXLA 2X1AA 3A12A 3I82A 1FA0A 3IMQJ 4RZRA 1RLDA 2MHNA 2XLJA 1KLMB 3ZZTA 3TA1A 1SIWB 2CJYB 1S4FA 3DOLB 3Q24A 4C0HA 1S5ZA 3US5A 5EWFA 5DG7A 4ZVPB 2XMVA 5AXLA 3N4WA 1RHKB 1RT6B 1UFWA 4OYXA 3FFIA 3DMJB 1XMOJ 1YRTA 1HQEB 4ZHRA 1F5CA 1F9EB 1Y5LB 4O44B 4DX6A 3A3OB 5KG0A 4PR6A 1NHUA 3BGFA 2P9CA 3QZ8A 3M6XA 2B6AB 4WPAA 4K7QA 2WOMA 2BKNA 1SJRA 2OELA 1HBUB 4FPRA 3CCZA 3Q2TC 3W62A 2KFNA 2GJ2A 2J8SA 4X4VA 3HKWA 1UVLA 1BC6A 5B09A 1Z4UA 1NDCA 3PM9A 4WYLA 3HLUA 1O8BA 4Y2MA 4N76A 4CLWA 2ZC3A 1FO1A 1JLEA 4FZVA 5J2PB 4NLQA 1QTNB 2MGZA 3IA0A 3KLIA 2FTRA 1FRXA 2HMIB 2HWHA 3NRBA 1N48A 3BQ1A 2CNNB 3U7JA 1QAJA 4FYXB 2JX2A 4JI7F 3ZNJ1 4DV3F 2UXCF 1Q8BA 2J9CA 1IKWB 1IBKF 2OPPB 2AX0A 1R8BA 5JXSA 4LFAF 3BEGB 2R42A 3NGTA 4LF9J 3H8YA 2O1PA 5A8KA 1N4LA 4OZJA 3CULA 3D2WA 1U8WA 5C7PA 1KTQA 2XG8A 5H1SV 1BXNA
chains in the Genus database with same CATH topology
2F40A 1L5UA 2KJWA 5E0OA 5THWA 1O5JA 3W2WB 1JLQB 2AYMA 1KOHA 5E2QA 4DQPA 1UL3A 3E01B 2QA1A 2CPDA 3RAXA 3IAS9 5GAHI 4OLOA 5K8NA 3MM5A 4NZ0A 2KRRA 1FK9A 2O5DA 4XK8C 4EGLA 3MEGB 3ISZA 4JI4F 4HKQA 4IRDA 3JAMY 1T05B 4HDHA 2HFNA 4RW6A 2A10A 5KG2A 4DSJA 2KFZA 3KNAA 3FCHA 1IKXA 1IN0A 4JI2F 3T19A 4BCAA 3FSYA 2HNYA 1WELA 4NCGB 2JVOA 2Q6CA 5FLXY 3N5FA 4WXOA 5ITHA 3K5NA 3I96A 3TUJC 5K14A 1LK5A 1TL4A 3KLEB 4QPTA 1RISA 1N88A 3MTJA 4JI6F 2YNGA 5DM6Q 2HHWA 3DHWC 2F4VF 3MD3A 1XN9A 5D78A 3CD5A 5E5NA 3LP2B 4XIUA 5D3GA 1DURA 4OI1A 1WEZA 2FC8A 3GE9A 1PSDA 3ITHB 3CDWA 3U27A 4NLSA 3X3UA 3DCAA 3KK1A 1N0UA 4BWJA 3OQ2A 2MZRA 1M1KT 1N56A 1S72S 3HM9A 4GKKF 2RRNA 2Y1RI 2QE5A 4ILRA 4C8YA 2ZH8A 2CQ1A 1S0NA 3SDEB 2W4CA 1U1OA 4NLUA 4B3MF 3UQSA 2FHJA 1X4GA 3IXQA 3MEKA 1BQMB 3KLGB 1ZZNA 1HWUA 3B82A 2KTQA 3J7YU 4Y28C 2JLGA 3DGPA 2FLOA 2FJVA 4Y2KA 3CC2S 2WB4A 3NAIA 3N79A 3M2RB 3DM2A 2B43A 1YJVA 2VC1A 3HZGA 3CVKA 3EGZA 3OVBA 2HAIA 1KFSA 1U49A 2WK4A 3G86A 1HW9A 3MUTP 3PW4A 2R7UA 2RU9A 3DYAB 3J7Z5 2CQGA 3JYTA 5HP1B 3MM7B 1U2RA 4RW7B 3H25A 2LEBA 2CQ4A 2VG5A 1U1KA 1W2BR 1AUDA 2R8IA 2RMLA 5K9FA 1TV6B 2MKSA 2GIQA 3MFHA 1R89A 3VQSA 4DSLA 3MM8B 4O4GB 1QTMA 2EWHA 2MYFA 1LWFB 4I6WA 2BW2A 1S1TA 4IG3A 4Y34A 1S0VA 3UCUP 1IKYA 2B0GA 2GW8A 2MJUA 3CWJA 2FGCA 4M5DA 4Y2AA 3CCJS 3H2UB 3RTVA 3JSYA 3C3LA 2UV8A 1AW0A 3HVWA 4I4BA 5L38A 5IM0A 7FDRA 4ECVA 1HHTP 2HHVA 1P1LA 2N4DA 3MM6A 3HVTB 2N7YA 4I2PB 3UWTA 1KHWA 3IS9A 4DR7F 2HHXA 5C24A 4AXIA 4TU8A 1VOMA 3PV8A 3P49B 3FQLA 3ONQA 1S9GA 1UETA 2J9DE 3R1HA 1R8AA 1WF0A 2YKMA 1Q86T 4DFPA 3ENWA 3MOJB 2LA6A 2LEAA 3POTB 2ZHBA 3PX0A 4HVZA 2DNMA 3U1LA 1FRLA 4ZPAA 4IH5A 2APOA 5KFMA 2D3UA 3KFWX 5M2UA 2AYBA 2UVUA 1HW8A 1KOOA 1ZTWA 1N5QA 4Q2MA 2YY3A 1TL5A 3KMSA 5HROA 3CJKA 3BO3A 3OJSA 5F8NA 2AV5A 1UAWA 4TY8A 2XGPA 2XZWA 4HDGA 2WBMA 4CT8A 4BDPA 2IVYA 4C0BA 2E9ZA 4C97A 3JTOA 2KJVA 3HHDA 4ED5A 1QAYA 5HLFB 1M0SA 3V81B 2E1AA 4HI2A 3FFIB 1JNZB 3O3LA 4EZ6A 1C0TA 3RR8A 4C3MA 1X4HA 1REVA 5EX3A 1X0FA 3TARA 4BC7A 2XSFA 4A47A 4YDDB 2HS0A 4J9OA 4NL5A 4EUVA 4RUCA 3QZ7A 1Y4ZB 2NYIA 2N7CA 2PMHA 2EBGA 2XO7A 2NREA 5DG8A 1UEVA 1HMVA 1WHXA 3CDAA 4XDCA 3CPWR 3T5KA 1HNVA 3C2PA 4MKBA 2D9PA 5KFIA 4XAKA 4PUOB 4YHHF 1U09A 2RILA 3WX4A 1WEXA 3V6HA 2HHUA 1K0VA 2DO0A 2D9OA 5EN1A 3VAJA 1ZOTA 3VAKA 3RB0A 1RK8A 2EVZA 2DGWA 2KKHA 2ALZA 1U1RA 2DGQA 4NWBA 3NMRA 5KFHA 4L72B 3IG1B 5F0WA 4WFBQ 2L08A 5CCMA 3DLJA 1FDDA 2V8GA 4WIIA 4OZLA 2Q1LA 1C1CA 2FJEB 1UWBA 3QPIA 4RUAA 2M7SA 4ID5A 2DHSA 3G6VA 4J9RA 1N6QA 4N56A 2GX8A 2Z2MA 4IH6A 1H0HB 1SUQB 1ZAVA 2RT3A 4TN2A 3VAMA 4YOEA 3CJ0A 3VAIA 3DOKB 1FJCA 3UDCA 2ASJA 1QAIA 3KLHB 2X51A 3QWPA 1WTFA 3M2VB 1UP1A 3HJFA 1UW4A 2Q6BA 1N0VC 4IFVA 5GAEU 3CMES 2C2DA 2MKIA 2GQCA 4B9TA 3QAUA 2WOMB 1N36F 2OMOA 4FVCA 1FKPB 5KG4A 4X4SA 3PR4A 3BS9A 2ROGA 3E3XA 1XMBA 4Y2CA 3FRYA 3H40A 3OXLA 4R5PB 5I42A 2HYIB 2R4FA 3BB5A 1P6TA 4DQIA 3PKMA 1PGZA 1S77D 4J9PA 3MGJA 4F3MA 2HFOA 2R7WA 3V4MA 4LF4F 2Z4PA 1Z1ZA 4AE5A 3Q8RB 3O1LA 2R8HA 2HIQA 4B9SA 1VIOA 1NKCA 1TFYA 1FESA 3KMQA 4JYAF 1FRIA 1NNDA 3KWMA 1R43A 2OD4A 3LP1B 1R0AB 2VBZA 3OBIA 4JI1F 3DRYA 4PXCA 2EC0A 2HRYA 1MSWD 1HNZF 5EWGA 4CI0B 1F5BA 2I5JA 4LT6A 1D8YA 1Q53A 4L3NA 2ZOMA 1LW2B 2HWTA 2YQ3A 3KG1A 2W8LA 5L1KA 1R27B 2AX1A 4NYZA 1VLYA 1ZAXA 4ZK7M 5IXUA 2R7XA 3M32A 4ITSA 4TNOA 1YJTA 4ED2A 1DFDA 2JHEA 2EFGA 3M1VA 3HHNB 5KT5A 2DK2A 4OJHA 4OIXA 1N34F 2HZCA 2M3DA 4NYOA 1S6UA 1JKHA 1YG0A 2FJBB 3KHGA 2ASYA 4KFBB 4YMEA 1SIZA 2K2PA 3NCRA 5DS7A 1FKAF 4MIAA 2H5EA 2FVSA 3G71S 1MMNA 4UY85 5HMWA 1Q8IA 5IS2A 2FLLA 4K0KF 1RTIB 3CJ5A 3UR0A 5DETA 4PCQA 3CCMS 2OIHA 1R3NA 3ZZPA 3SCIE 5EWEA 1IR0A 2LYVA 2YWEA 3IC1A 4L6V3 4ED3A 3CDEA 2XY5A 2P6TA 1RTDB 4URGA 1P9QC 2LQ5A 4MK8A 3IGVA 2EG2A 3HF5A 2QA4S 1JLFB 3NGKA 4RW4B 1WF1A 5IZHA 4EZ9A 3MMCB 4K4SA 2VKRA 1X4AA 2XBPA 2F3JA 4DQSA 1T7PA 5J1NA 3BSAA 5CYJA 2ZM6F 3RRHA 4B9VA 1WG1A 2JC1A 1RT1A 1U1QA 2HHHF 5T7LA 3PW5A 3KLVA 2DPJA 5B0AA 3SV3A 2L9DA 4X4RA 1QAXA 2YKPA 1YJRA 3PEJA 3ZC4A 4AL6A 2XY7A 1H6KX 2M70A 3Q8QB 3MPYA 4ES3A 4IOBA 2VODA 5IQQA 2JEIA 5J1PA 4ZOSA 5CHCB 2RKIA 2NS1B 2GJIA 5D4PA 2E7WA 2YWHA 1N8RT 1KLNA 2B5JB 2DCLA 3PRBA 3UPFA 5E3CA 3OL9A 4N5SA 2AQ4A 1HBMA 3TAMB 4F26A 3MMBA 5A8KB 4C2MA 1HYSA 4IFYA 2R8JA 1HBOA 3TX8A 4NX9A 4HT7A 2AJ1A 2DGUA 2FB0A 4IG0A 2OTLS 4MJKA 4J9SA 3I0SB 4NCAA 1HR0F 1HD1A 4DR6F 2HW3A 3EXYA 1YRXA 1M5PC 2XB2D 3BSOA 5KFPA 2CQ2A 2E9TA 4CZCA 1SV5B 4NZ7A 3SSRA 2YH0A 2OSRA 2PO4A 5I3PA 2VPYB 2GHWA 2EK1A 1S9FA 2L3MA 1FK9B 5J2NB 4FF3A 2XMJA 2DR5A 3G8SA 5KG7A 2ZZMA 1HNIA 2QIFA 4RW6B 2CVEA 3RB6A 4TYAA 3FEYB 4ECUA 2LDYA 2OPRA 2DBBA 4ZCKA 3IN5A 2UXBF 3SCKE 4OQJA 1IKXB 4KC5A 1X9WA 1WD6A 2HNYB 4URQU 3IBWA 2FPHX 2VPWB 4K4UA 4DV1F 3PW7A 1L3TA