1U6FA

Nmr solution structure of tcubp1, a single rbd-unit from trypanosoma cruzi
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
139
structure length
139
Chain Sequence
MSQIPLVSQYDPYGQTAQLQQLQQQQQQHIPPTQMNPEPDVLRNLMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNGFNILNKRLKVALAASGHQRPGIAGAVGDGNGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA-binding protein UBP1
publication title NMR Structural Study of TcUBP1, a Single RRM Domain Protein from Trypanosoma cruzi: Contribution of a beta Hairpin to RNA Binding
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 15
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u6fA00
5IM0B 3CCES 2LQ5A 3THTA 2DK2A 2LYVA 3U1LA 2MHNA 3CMAS 1PGZA 3BS9A 2MB0B 2CPIA 3MUTP 2CQBA 2B0GA 2DNZA 1SXLA 2MY8A 3CPWR 2DHAA 3VF0B 2MQMA 5IQQA 2MZSA 2L9WA 1NJIT 1YITS 2MKHA 1VQ9S 3UCUP 4YB1P 3G4SS 3NS6A 2DNNA 3CF5Q 2JVRA 2HGLA 4IOCQ 2K8GA 1WEXA 1U1MA 2M4MA 4PR6A 4IOAQ 1RK8A 3SXLA 2EK6A 2DISA 1F9FA 2DNOA 2RT3A 2LCWA 2ERRA 4PRFA 1PO6A 3G8SA 2RQ4A 3B4MA 3CCVS 2GHPA 5CYJA 4FXVA 2MPUA 2M2BA 1N8RT 1JJ4A 1KD1T 1N52B 1X4CA 3P49B 1X4GA 3CCQS 1X0FA 3J7YU 1X5SA 1U1QA 4WFBQ 2KFYA 1WF2A 2LEBA 1VQ8S 2MZJA 2LA6A 2FC9A 2BOPA 2O3DA 2E5IA 4WKRA 2JX2A 3IRWP 5LJ3Y 5DDOC 2J0QD 1YWXA 2MJUA 1VC5A 3U1MA 1VQOS 1BY9A 2DHGA 2MZRA 4W92B 2M8HA 2PEHA 3CUNA 4OZ1A 2D3OR 2XS5A 5HO4A 5DM6Q 1R8PA 2LXUA 4QQBA 2DGXA 2CPHA 2KT5A 1IQTA 3EGNA 2DNRA 2RRBA 2FY1A 2U1AA 2HGMA 2MKJA 2CPDA 5LSLA 1ZZNA 2X1BA 2KH9A 3CC7S 1ZH5A 3OW2R 3I56S 2MKSA 4UQTA 1WWHA 1U1NA 2DGQA 2RS8A 1YJ9S 2CQ3A 2XS7A 1DRZA 2LEAA 2KG1A 2E5GA 1SJRA 3UCGA 2QA4S 2KRBA 4CH1A 3L3CA 3P3DA 4F26A 3UCZP 1S79A 2RUGA 1WI8A 1SJ4P 2M70A 4ZKAA 2DGTA 2KXHA 1NU4A 1U6BA 2E44A 1X5PA 1A7GE 1WF0A 1KQSR 2MXYA 3ZZZA 1UFWA 1HD1A 3J7ZT 2D9OA 4C4WA 1K8AT 2VOPA 1X4DA 3MDFA 2DNHA 2KI2A 4F25A 1QVFR 2N7CA 5GVQA 3CXCR 2E5HA 5ITHA 1WEYA 5GAGU 1G2EA 3S8SA 5JVHQ 3P6YC 2CQPA 2QFJA 2CQ2A 2MY7A 1VQPS 3K0JA 2YH1A 3MD1A 1FXLA 1Q82T 3CCUS 3TYTA 2LKZA 2NZ4A 1YHQS 1X4AA 1VC6A 2V94A 2L08A 5LSOA 4WF9Q 1O0PA 1X4EA 4TU8A 2DB1A 1U1PA 2MZTA 2CQCA 2X1FA 3UWTA 2AD9A 2DHSA 4TLQA 1M1KT 2CPFA 2DIUA 2AYBA 3G9CA 2KYXA 2MKCA 2Q79A 1L3KA 4J5OA 2KG0A 1VQKS 2WBRA 1URNA 3BO4A 1YJNS 2FPHX 2BZ2A 2DNMA 1WHXA 3LQVA 2CQHA 2RQCA 1K73T 4RU2A 3CCSS 2MMYA 2U2FA 1SJFA 1WG1A 2HVZA 1M5KC 4WCEQ 1ZZFA 1YIJS 1M5VC 2XB2D 2JRSA 1FO1A 5EN1A 3MURP 2JVOA 2CPYA 2RVJA 3CCLS 1R8HA 4TU7A 4IUFA 1N54B 2VODA 2CQGA 3VAIA 4YUDA 2DNQA 3LPYA 3NMRA 3N9UC 2DITA 1U1OA 3Q2TC 2DO0A 3DXBA 4ED5A 2CPZA 4CH0S 2DGUA 2CQIA 5MLCV 1D9AA 5GAHU 2M7SA 2UP1A 2YTCA 4WFAQ 4C0OC 2AYGA 2RS2A 3PIOQ 2FC8A 2CQ0A 2KM8C 3VAMA 2JWNA 3G6ES 1VQ6S 2F9DA 3CC2S 2MYFA 1OWXA 3UD3P 1H2UX 3VAFA 1YI2S 3H2VE 1WELA 2EVZA 3H2UB 1JJ2R 1KOHA 2DNYA 2CQDA 3MI7X 5DDPC 3JB9k 2M88A 3S6EA 3UE2A 2HYIB 5GAEU 4CIOA 2CPXA 2VONA 2XS2A 3IWNC 1YTYA 2XNQA 3G71S 4QU7A 1WG5A 1B7FA 4CQ1A 3R1LA 1FJEB 1D8ZA 4V19X 2CPJA 1DBDA 2M52A 3VAJA 2J8AA 1JJHA 3MXHP 1QVGR 2G0CA 3SDEA 4TU9A 2DGSA 1SJ3P 1W2BR 3DLLQ 1A9NB 4EGLA 2OTJS 1X4BA 3RW7A 2MGZA 1OIAA 1FJCA 1VQLS 2KVIA 3G96A 3R1HA 5GMKa 2MKIA 2K3KA 3B4DA 3CCRS 2MJNA 2XNRA 3EGZA 4Y0FA 1CVJA 3NNAA 2DO4A 1K9MT 2X1AA 2HZCA 3MOJB 1UAWA 4YOEA 1NO8A 1WHWA 1X4FA 2KU7A 1HL6A 3EX7B 1YJWS 1HA1A 2QEXS 2MSSA 4C7QA 1XN9A 4WFNQ 2OJ3A 2DNKA 2GO9A 2J0SD 3VAGA 3CTRA 5IFMA 3THPA 3CCMS 3CMES 1VC0A 3BEGB 4QU6A 3G8TA 3CD6S 2KXFA 2NLWA 2DIVA 2OTLS 2LECA 4LJMA 1WTBA 3CC4S 4BS2A 4OZ0A 2SXLA 5D78A 3ULHA 3US5A 2CQ4A 1WG4A 1VBZA 1UW4A 4UY8T 1UP1A 3R27A 2I38A 2N82B 1VQNS 3HI9A 4IO9Q 1U1LA 2KHCA 1OO0B 1QM9A 2RRAA 1U2FA 2RU3A 2EK1A 4PKDB 2G4BA 2VOOA 1WHYA 3CCJS 1H2VZ 2DGWA 2M9KA 3P5TL 3NS5A 2HGNA 2ZJQQ 5LXRA 2KRRA 2MZ1A 1U1KA 3FEYB 3Q2SC 2ZJRQ 2MQLA 1SJQA 5H1SV 5DM7Q 2M0GB 2A3JA 3VAHA 1H6KX 1H2TZ 2KN4A 3SDEB 2YKAA 4F02A 1JMTA 3BO2A 5FJ4A 3BO3A 2F3JA 3D2WA 1Q81T 1S72S 2DH7A 2LMIA 5DETA 2G1DA 2MGZB 4LMZA 2DHXA 2YH0A 2YWKA 3SMZA 2DH9A 1X5TA 1M5OC 1X5OA 1M90T 2XSFA 1DHMA 5LXYA 5D77A 3S01A 5IM0A 1VBYA 1OPIA 3V4MA 5JVGQ 1AUDA 4ERDA 3UD4P 5CXTA 2OSQA 3I55S 1KC8T 4Y00A 1WEZA 2MQPA 2LA4A 2ADBA 2DNPA 3VAKA 3MUMP 2N3OA 1WHVA 2F9JA 3S7RA 2MQQA 4M5DB 3MUVP 4WIIA 2ZJPQ 4Z2XA 1FNXH 4QPTA 4LIRA 1Q7YT 1FT8A 2I2YA 5GADU 2M8DB 2AYMA 1WI6A 2D9PA 5BJRA 1P27B 3NNCA 2RNEA 2MQOA 2X1GA 5CA5A 1DZ5A 5DDRC 3MD3A 3RW6A 5HL7Q 5DDQC 2DGVA 1N88A 3PIPQ 3FEXB 4W90B 1VQ4S 2DNLA 2E5JA 1Q86T 2CJKA 1U6FA 1M5PC 1VQ5S 3TP2A 3HHNB 2DNGA 1VQMS 2L41A 1FJ7A 5LJ5Y 2DH8A 2KXNB 3CULA 2CPEA 3ZZYA 3NNHA 2CQ1A 1U1RA 2N3LA 2LXIA 1P1TA 1HD0A 2ADCA 1RKJA 4U67Q 1VQ7S 1FHTA 2MKKA 2PE8A 2DGOA 4P6QA 2J76E 1VBXA 3TO8A 2KM8B 2MZQA 3VALA 2OIHA 2AYEA 2MQNA 2MSTA 4A8XA 2FHOB 1X4HA 4FXWA 2OSRA 1KOOA 1WF1A
chains in the Genus database with same CATH superfamily
1CJVB 3K7RA 2YNIA 1UA1A 3MPUB 3O1LA 3HLUA 1WC0A 3UCUP 1T9XA 3BGUA 4GVBB 3MOZA 3H40A 2H1YA 2JLEA 3G8SA 2XYPB 2A2DA 3OFGA 1N8RT 4ANEA 1YBTA 2O5DA 4RUHA 3KMQA 2XO7A 1VQ8S 3LAMA 1NJZA 3JQJA 2UXBJ 4M5LA 1YWXA 4DS4A 5D8HB 3NL0A 2MZRA 4ZVQB 4F50A 1PYSB 3B6BA 2I5JA 5DM6Q 2CPHA 1S5ZA 2W4CA 2GCFA 4DR5J 3I56S 7FD1A 3Q8YA 2OAUA 4F4AA 4H54A 1NSPA 2GGPA 4B9NA 4IFYB 1R8BA 4DBQA 4DL3A 1SJ4P 1FESA 2JZ5A 1H3DA 2UUWA 5A2QY 3N5FA 3OV7A 1WNEA 2MXYA 4WIQA 3ET6B 3OTOF 5C7PA 3EVOA 1K8AT 5EWEA 2LQ9A 3C6TA 2D74B 5ETOA 5GVQA 2XY6A 2OLWA 2VZ9A 1KLNA 2OEKA 3GB0A 2FD2A 3C6UB 1X4AA 3IS9B 1LWEA 2V94A 4JV0A 4G3IA 2GZOA 1LWFA 1M1KT 2R8GA 2HS0A 4RPFA 4NLWA 2FPHX 2DNMA 1K73T 3FDSA 2FJWA 4NEZA 2MMYA 2WOMA 3DMJB 3EJMA 3L4BC 5ETRA 5DG7A 2CXEA 3OUYB 4M5JA 4JI0J 1FK9B 2P8IA 3UN3A 5D3GA 1AYEA 3V5RA 5HMZA 2DGUA 2Z56B 2BE9B 4OYOA 4C3LA 1RWWB 2VV5A 4C0OC 4O23A 1U4BA 4J9UE 1UFLA 5IC6B 5KFCA 1KFSA 1UVJA 1JWWA 3HPOA 1X8DA 1V3RA 2FVCA 1REGX 3ENVA 2PFDA 4DV5J 3H2VE 2GJIA 3TOQA 2LU2A 1ZBTA 4XAKA 4X4NA 4F0KA 1FA0A 2DCUB 2J0WA 2AZ3A 1VYAA 4Y2KA 2N4DA 2VG7B 3K57A 1S99A 3ZFVA 3I6PA 2C42A 3D7SB 4DR7F 5A8RA 4EYHB 2PDAA 1D8ZA 5AT1B 2IM1A 5LM7E 2GQ2A 1J5OB 4X4RA 5CCMA 4C8YA 2UVWA 2Z2LA 4MFBA 1W2BR 1I3OB 3M2VA 1Y00A 5IT9Y 5DLFA 1FFWB 3OR2B 2FJXA 1ZAVA 1FFGB 4CWBA 2VQEJ 4A8MP 3G87A 3JYTB 4DPWA 4DU8A 1Y5NB 1SIWB 2QSWA 3OBIA 4NZ7A 3GV5B 2Z2MA 2XI2A 2DEJA 1VBZA 4KHMA 3IAM9 2UV8A 5M2PA 4M1KA 3AHPA 4NASA 4R8UA 2RU3A 3T5HA 4NWBA 4JI7J 3M05A 3UD5A 1P9YA 4F4KA 4H4OA 3OXGA 1VRQC 3A8KA 1NKEA 2NSCA 3VZHA 4DR5F 3CWJA 2HBZB 2ZD1A 2DH7A 2G1DA 4CRJA 4QWEA 1FWLA 2XHWA 4RW9B 2XEXA 4ES1A 1Y9OA 2KZMA 2QO3A 1NK5A 3JSMB 2I9SA 1YQHA 1P1LA 2WTFA 1TL7B 1FI4A 1FT8A 2HWHA 2JC0A 5GADU 1TUWA 2JNJA 1KEKA 3VQTA 4KGZB 3M2RB 2DT9A 4KO0A 2UXCF 1RWPB 2NXCA 2RHQB 1T05B 4KR0B 3LF0A 5F8IA 1HNWF 1HWIA 4QYRA 3IBFB 4RW8B 3MMCA 4CLZA 2BBEA 4KFBB 5LJ5Y 3IG1B 2E29A 1DARA 3PW4A 2ZH7A 2MKKA 1VBXA 1YRXA 3VALA 4ED3A 4ILLA 3K8VA 5D6GA 5AJ3J 4JI0F 1F2GA 2RKIB 2YX1A 3I4HX 3T1AA 3M2UB 2DHAA 4DJBA 2L9WA 3BGLA 2MKHA 1RBLA 2WRMA 2DEIA 3TA0A 2GIFA 6AT1B 3OSPA 1WEXA 4IOAQ 4J9RA 5RUBA 5F9LA 2RQ4A 1RABB 2VASA 4RWWA 3GP9A 3OD2A 3AXKA 5J2PB 2MPUA 3MMJA 4J9MA 1C1CA 4DR3F 2HHQA 2K7JA 2KFYA 3W8PA 2R7SA 2I0XA 4YR3A 3PTWA 1DY3A 2FJDB 2HHXA 4TY8B 2JX2A 2HEKA 1IXKA 3AOAA 4KHRA 2OH2A 4PYAA 3U1NA 3TUPA 2YPZA 4OZ1A 2DR7A 3V6KA 1Y0HA 4KV8B 1IQTA 4S0MA 2XG8A 3K5OA 2VQEF 1IVZA 4I6YA 2VG5A 4PXBA 2VA2A 2XS7A 3GYGA 1JLGB 1C0UB 3D1QA 1XNRF 1DFDA 3Q89A 3L3CA 1HBMA 5ETVA 5J1EB 4C11A 4F26A 3UCZP 1NK7A 2POKA 1DTQA 4IH5A 1S1TB 3TR5A 1X5PA 3DLEA 3I87A 4P73A 1RSCA 2VOPA 4K4SA 2E5HA 3GCXP 2MY7A 1FXLA 2J9DA 1ULRA 4LF2A 1SQEA 1MROB 5T41A 1X4EA 4TU8A 2XYGB 4PCQA 1DJ0A 4OI1A 1FKOA 1XC9A 1DQ9A 4J5OA 3JXOA 2O1PA 3CW2C 2W8LA 2CZ4A 4QWCA 4RU2A 1SJFA 1WUUA 4WCEQ 1CQMA 4XIUA 3MCSA 1RTHB 5H9EK 3H5SA 1OJ4A 4EMDA 1NDPA 2J7WA 2D1CA 4I2PB 3PIOQ 4ZJOA 1FKAF 1XMOF 2ASLA 3CDBA 1M0SA 3RYLA 2KDOA 1NDCA 3KG1A 4CH7A 2KFNA 2M88A 3M8YA 3BZQA 3KLFA 1JXEA 3G71S 4DCOB 4DR4J 1AZSB 5AJ3F 2W9CA 2M5YA 3MXHP 4DHVA 3MTKA 1FTRA 5C2CA 4WXWA 3SYZA 5KFIA 1F9HA 1MW7A 5EHHA 1IBKF 4YMEA 1UAWA 4YOEA 3NLCA 1RWOB 1TL1A 1WHWA 3EX7B 4Q0BA 2RHSB 2FVRA 3FFIB 1Q79A 3JTOA 4LSNB 1S0NA 3CCMS 1FJGJ 3LGNA 5E2QA 1HNXF 2HWTA 2YVSA 3KHRA 4OZ0A 3V6DA 3S1TA 2FDNA 1NDLA 2RF2B 1U1LA 1RTJA 1VRTB 4XDCA 2WB4A 2YNFA 3I0SB 3LP0A 5IV4A 3SCKE 4FBUA 7FDRA 2VL1A 2L48A 5IV3A 4WKYA 4V19J 4U7CA 4J9OA 4DI6A 1CS4B 3HSDA 3UQSA 4HT7A 1LK7A 3D5MA 4MKVA 1CLFA 2F4VJ 1RTDA 2RU9A 3RU0A 4MK8A 2YWKA 5EX3A 3DM2A 3HO1A 2HQGA 3AB4B 2GIRA 2R8HA 4ZLLA 2MQPA 2R2TA 4O3RA 2MQQA 1RTZA 3FQKA 5J2NA 4DG1B 1YZ6A 1VR6A 1WTFA 2DY1A 4QPTA 2AGPA 3TQEA 2M8DB 1SJ1A 1WI6A 4P75A 1P27B 3GSDA 1NK8A 2Z57B 3UI3A 3UR0A 3MEEA 1Q86T 3IXQA 2ZKTA 1U6FA 4HL9A 4J7CA 4QOTA 3GG1A 3D9BA 2XY5A 3PFOA 3FZ2A 2DNGA 1S7IA 2HHSA 2V2VA 1XK8A 1IKWB 3MZIA 3BSNA 1U1RA 1XR5A 3H5UA 4U67Q 3CMQA 1NPPA 2HZVA 3DLHA 2MEWA 2DK2A 2EBEA 1LEOA 2FHJD 3OL8A 1SXLA 3CPWR 1HNVA 5IQQA 1Q53A 1YITS 3A8EA 1KN6A 5BR8J 2H54B 3IGVA 3NS6A 2C1EB 2NCKL 1IKXA 2DISA 3NGDA 1OYDA 4K7QA 3B4MA 2F4FA 5GAGI 2WSEC 1HBOB 3BGRB 1S10A 5MAOA 2FGCA 4KY3A 3NAIA 4JI8J 2V6AA 2FZCB 2GHVC 4ECYA 1BGXT 1FRIA 1S1WA 3IRWP 3MAHA 2H9ZA 2XULA 2KTQA 2G2ZA 3G2XA 3OL6A 3CO0P 2Y8WA 3GILA 4CNYA 2DGXA 3QFHA 2OPSB 3R97A 5KT4A 2RRBA 5B0DA 4CNZA 3KDOA 4R5PA 1SIZA 2XMTA 1RP5A 1YJRA 1ZTWA 1WWHA 5KFYA 1SV5B 2V4JB 4KIAA 1HQEA 3PHEA 3GE9A 2AU0A 3MF5A 3E8OA 3MAQA 4F04B 3LWMA 2YKPA 2HFVA 3FCHA 3K58A 2QA2A 5E33A 1HD1A 2KI2A 1JK9B 4ED1A 4X4SA 2GQCA 3MM7B 4QIWD 2IVFB 2BQUA 1GAOA 4N76A 1PIEA 2LKZA 3M8SA 1YK9A 5LSOA 2DXDA 3WQPA 3H25A 2DB1A 3TA1A 4CM0A 1U47A 1VRUB 1XNQF 4CO0A 3MEDA 3V4IB 1TKTB 1MN7A 2LDYA 4A48A 3IP0A 5DG8A 1ZETA 5IXUA 1HQUA 3CJ3A 2BZ2A 2GJ2A 2IJRA 2CG4A 2Y1JA 1SL0A 2R8IA 3GG0A 1XR7A 3PRBA 2J6UA 4KTQA 3LGMA 3FJ2A 1Z4UA 3RB0A 2EPIA 2VJVA 3MM8B 2C2EA 3O2IA 3I96A 3W62A 4C6AA 2JLGA 4LF6F 1N5YA 2FTRA 5J2QB 3C8YA 2CJ9A 2B8PA 1CJTB 3QIDA 2D69A 4GKKJ 3EYZA 1TKDA 3UE2A 5HSPA 1LK5A 2VONA 2ZM6J 5F8HA 4JI3F 1CSJA 4F4ZA 4F36A 2KO1A 2VICA 4DQPA 5KG7A 5K8MA 3SDEA 4RWXA 1RE1B 2Q66A 2ZBRA 3KNGA 4OMFG 4EGLA 5IS2A 2AJ4A 1GX6A 1V5IB 4OZNA 2MGZA 2IVYA 4DCJB 3M6VA 5B0BA 3PDNA 3R1HA 2HWIA 4DCPB 5CHCB 4JV1A 1NSAA 1JQGA 4QWBA 3KLEA 1KP6A 2KU7A 4DV3J 3SV3A 2V2KA 4JI6F 1R8AA 4UQGA 4M5DA 3R3TA 5IFMA 3EUNA 3KLHB 4XPEA 3DLJA 3L7OA 2NLWA 2OHDA 1I1GA 2HVIA 4JI8F 4PUOB 1LNQA 2C3PA 5D78A 2WHOA 2FY8A 1IJFB 2J0XA 3DHXA 4MKYA 3R2DJ 4X65J 2GAHC 8RUCA 4OX6A 3POTA 1N33J 1U2FA 4CLYA 2FZKB 3HT0A 4USUA 4DV7F 3NS5A 1GT8A 1NBEB 4RNOA 4TXSA 4IFVA 2ZJRQ 2MQLA 3BR8A 1EP4A 2HK2A 4JBCA 3HVRA 3ILOA 2ZH1A 5E41A 2E5LJ 2FUG9 2AT1B 2YH0A 2AX0A 1WDTA 4PG7A 4C8MA 2JHEA 1VHIA 3MEKA 3ILJA 4EK2A 1KBRA 2WONA 1NZAA 3JS9A 2OSQA 3GPAA 2LA4A 4ZVSB 3EXCX 1NPRA 4LQ3A 3MM9B 4WIIA 1HNIA 2BJ8A 5AXNA 1Q7YT 2ZNYA 4FNHA 3U27A 2ZWOA 4C8NA 2BANB 3VHQA 2DNLA 5IQ6A 3SCIE 1F60B 2DRBA 1AROP 4LT6A 2VF3A 5T14A 3J80U 1RT1A 1TL5A 2EFOA 3ITHB 4ID5B 1OQ3A 5CQGA 1RLCL 4NXNJ 3DU6A 5D3GB 4JI4F 1HWKA 4P7VA 2HAFA 2HZAA 2JC1A 5KT6A 3SQGA 1VFJA 1ZA1B 4LSLB 2AYEA 3BN7A 5B0AA 1MWYA 3H0PA 5HLFB 2VUGA 1X9WA 3HZGA 2EI5A 2NXUA 2KB2A 3MMBA 1KVJA 3MUTP 4Z7CA 3UDLA 4IQXA 2YNGB 4CO1A 1X7VA 4UOGA 5A8RB 3Q86A 2HGLA 1RJJA 5EWGA 2H51B 4LFAF 3AT1B 2EC0A 4OI3A 1PO6A 4N8OA 2UU9F 4ZP8A 2IM2A 2M2BA 3GFZA 5F8JA 1FD8A 2AGOA 2ZM6F 5L39A 3MFHA 1D3WA 3CDAA 4R0EA 2W7PA 4OI0A 4WYLA 4WKRA 1R89A 2V0NA 2FJBB 1BY9A 2B9XA 4O3OA 4LR9A 1FNMA 1CBKA 3BR9A 2MKYA 3FBBA 8AT1B 1BQMA 1FXRA 2CAJA 3OTEA 5KT7A 4DV3F 4NA1A 1EIYB 2RS8A 3IA0A 4MIWA 2CQ3A 2LEAA 3TUZC 3AA9A 3UVJA 4P9SA 2FVSA 2IA0A 2C28A 4HR2A 5A0YA 4ED2A 3RAMA 1TQLA 4X65F 4I2QA 5FLXU 4MK9A 1C2PA 1IKVA 1X4DA 1RT5B 1N33F 2YXLA 4YS2A 1KLMA 2IRXA 4LRAA 4WTYA 4MT1A 3G86A 1WD6A 2FZGB 2EEYA 2EKYA 2AHOB 3BH7B 1YJTA 3NGSA 4OYXA 5HP1A 1FDNA 3FSIA 2MZTA 4NCBA 2UXDJ 4OX8A 2IIHA 2XI3A 2Q79A 1VQKS 1NAQA 4PG5A 2CZVC 2G2OA 4KO0B 1WHXA 5HBMA 1K1SA 4FVCA 1XJWB 3PM9A 3AXMA 1QD1A 4P74A 4QR0A 4LRBA 4ILMA 3AY0A 3R7BB 1RT6A 4TU7A 3HKZD 3P45B 3JSRA 4HYKA 2ZFHA 1XBWA 4KGXB 5DQHA 3PO5A 5KFQA 2UVVA 3ENQA 1UCNA 4NI2A 1AW0A 1PKUA 2B6AA 4W4MA 3PXGa 3TI0A 1KOHA 4LBHA 4YHHJ 3R5JB 1K0TA 3GYXB 3CJ5A 1T03A 2DRDA 4CIOA 3OL7A 3W8GA 5DO2A 4WZMA 4Q8EA 1ITPA 4O4GB 5E3PA 2L3MA 1DBDA 5A8KA 3PYDA 1HYSB 3JAMY 2DD8S 2QN6B 3TJ9A 5C25B 3MM5A 3OVAA 2ZUGA 2XYHB 1RISA 1ZS6A 3ETMA 4ZN1A 2ZITA 1RHUB 3G96A 3ENAA 2K3KA 1TU0B 2FLOA 5L1LA 1BWEA 3JQKA 4UUXA 1X4FA 2YQ1A 1HA1A 1MMDA 2MSSA 1BQNA 4EO6A 3CMES 3B82A 3M1VA 3ZO7A 2P9EA 1PCAA 4IG0B 4LBIA 3QT6A 4BS2A 4KC5A 1R3NA 2BE2A 2N82B 3T9NA 3HX9A 3D28A 4RBTA 4ZCMA 5ETQA 5KTQA 3KK2B 3H4DA 4RW7A 3FK4A 2ZC4A 3W7BA 1N6QA 3NWGA 3R5BA 4DL6A 2JOQA 3VAHA 3QT7A 1F1BB 1Q7LB 3I0RA 4LIWA 4OYIA 1KONA 3SMZA 3FBCA 1KSPA 2V2ZA 3HHEA 3NS7B 2FVPA 5IM0A 5JVGQ 1BUXA 2LQBA 4B08A 2E7XA 4DUYF 2F63A 3LW5C 4GKJF 1FKOB 5BJRA 4HHHA 1G3OA 2BKOA 1LXNA 3ZZPA 3N6LA 2DGVA 5JUMA 5E5NA 2ZH8A 1M5PC 4ZLJA 2YKMA 2DPIA 4I7FB 4MIAA 2GVDB 2IJNA 2WVEA 5B0CA 1D09B 3D67A 5HAOA 3A3NB 4F3OA 2QLXA 4BCAA 3WX8A 2C2KB 4K4YA 1OIAA 3LP1B 4DV1J 2YQ0A 4C0HA 3DFEA 4FPIA 3OFHA 1MSWD 1JB0C 3GZ7A 5CYMB 3QSYB 7AT1B 1QJHA 1QY7A 3G4SS 1B0VA 2LQJA 1YVFA 4YR2A 3MR6A 1NB7A 1Q0NA 1OY6A 3W1YC 1SKRA 2F1FA 4YHHF 5E3CA 1F9EB 1X4GA 2W2NP 2OP5A 2HIQA 3MFIA 4OYWA 2LEBA 4I6WA 3OXFA 1UA0A 3M8QA 2CIMA 1RWUA 2CNNB 1VC5A 4DF8A 4Q43A 4C98A 2KYZA 2HKEA 1A6LA 4USWA 1R8PA 2LXUA 4QQBA 2ACYA 2QE5A 3ILIA 5ETTA 4ECUA 1NMEB 2HURA 3LP2B 4C3MA 3MEGA 2XWYA 1SC3B 3KUHA 2KHDA 5LT5A 3DRPB 2BJ3A 4Q2MA 2YNFB 4LFBF 3UCGA 2WSFC 4K4UA 3KHLA 1TL4A 4OJ1A 3H5YA 5C24A 4KHPJ 1WF0A 3D66A 3W2WB 2RDJA 2ZC3A 4X62J 1RTDB 2CJXB 5LOQA 1S9FA 2RQMA 1T95A 1UWAA 2YH1A 1U6ZA 2OPRB 1BE4A 4ATNA 4WP8A 5HMYA 2ZZTA 2CNKB 2H4WB 4JV5J 3AFGA 2VG6A 1U1PA 2L9DA 1YJ7A 4NA2A 3EE3A 3G9CA 2KG0A 3T1YJ 5I3QA 1L3UA 3TZYA 1W7WA 2Q6CA 4N77A 4IDKB 4XK8C 1WG1A 2EWHA 3J81Y 3RAQA 2JEFA 2NR0A 2AV5A 2B4OA 3MR5A 4LF4J 1EKRA 4RNHA 1UJ5A 3NGUA 4O0NA 1BC6A 3OHAA 2M7SA 2XGQA 3H20A 2C2ZB 1PBAA 2YTCA 4X2BA 4JI2J 4HLBA 3ZC4A 2IC3B 2FC8A 4CCHA 4UW2A 2ZH2A 5F8NA 1GH8A 3W9HA 4ZLNA 5C42B 1H2UX 2VBXA 2GQQA 1YI2S 4ZP9A 5J1NA 4C2MA 2N7YA 1RZMA 3MI7X 3HD2A 1ZM9A 1FCAA 2E7VA 2XS2A 4ES2A 4Q2LA 4AUKA 3R1LA 4LF7F 3AQOA 3BBBA 2QA4G 1IWAA 2UUBJ 1RAOA 3CD7A 4WFYA 1JLBA 2ATLA 2W2MP 4RKUC 1AUSL 2PMWA 3QGHA 3EZUA 1BQXA 4NLYA 1CVJA 1XEZA 1YSJA 1LV5A 3DRYA 2W8KA 4QWAA 1S1WB 3ZZTA 4GMKA 4OZ5A 6FDRA 5KT3A 2H48B 4NE9C 2BRKA 3TZXA 2R4FA 3BEGB 2OPPB 3DI6B 2UUCJ 2QMWA 2B9YA 3Q22A 4ED7A 4X64F 2V8GA 1FEHA 1S9EB 1A0OB 3WC0A 2RRAA 1JKHA 2VOOA 2UUAJ 5A8WB 2XMVA 5KFWA 1FTCA 4RW6B 1N4LA 3W5XA 2XCPA 1UTAA 2M0GB 4RNNA 3M8RA 3QZ8A 4Y28C 3CJQA 1RT3B 3M6XA 1VIOA 2DHXA 1MWQA 4FBTA 1HQ2A 4DZDA 3TVZA 3VR1A 4FYXB 1OPIA 1Q78A 4K59A 2ZOGA 1R6VA 1MNEA 3GR1A 4KHPF 2F9JA 1JLAB 1AXQA 1U45A 1FRXA 3CJKB 3N6NA 3SCJE 3PZPA 4TQRA 1SC4B 1YKWA 1VJQA 4DS5A 2RIJA 3W9JA 2ZZMA 4ECQA 1HFEL 3GSIA 3NG8A 1T9VA 3UDVA 1EARA 3O3LA 2HBYB 1CC7A 3D54A 1LW2A 3Q24A 3MWBA 3HD1A 3G6YA 3EVMA 3HZEA 3A8IA 5IT0A 2M3DA 2V2QA 1HI0P 5L1IA 3D1HA 2VPXB 2PE8A 1RT2B 4CO5A 3M8PA 2ZHOA 5KT5A 1N5YB 4LF4F 3ZZOA 2H65B 1RHMB 4G1PA 1F5CA 1AFIA 2LQ5A 4KKOB 3E2EA 4UF4A 2H4YB 1C0TA 3QLHA 4RUAA 4NLGA 3ISND 4KGMA 3QT8A 4NLSA 1QAJA 1T9WA 1NJIT 3K5NA 1R8CA 1WC5A 1BD6A 4C9DA 4YDXA 1TUGB 4HACB 2GHPA 3T5JA 3AODA 5DQGA 1Q1KA 4JI5F 3W65A 3BM7A 1OSCA 1Q5YA 3MCNA 1URRA 3CD0A 2FC9A 3RUBL 1NPKA 1I6JA 1S7HA 1HBNB 2ZE2B 2UUBF 1VQOS 4RL1A 3RB6A 3CCWA 1RB0A 4DV6F 1JLQB 4EBEA 4LRDA 1GFWB 1EQMA 1F3VA 1NH8A 3UNYA 3O6QA 2PFFB 4ECXA 1ZZNA 2CJQA 2RB7A 3VGSA 3GIMA 3RAXA 3POTB 2E7WA 2HHHJ 3BBFA 3HP6A 2Y1IA 4HH1A 1EX8A 4G65A 2Q3PA 3OLAA 2B43A 1UFWA 1DLOB 1GQEA 2BQ3A 5K14A 1WEYA 1G2EA 4I56A 4BWMA 5LMUF 2KJVA 3Q8PB 2CQ2A 1VQPS 1CJKA 2F8MA 2YKNA 3TYTA 1PJ6A 1YHQS 1VC6A 3BSCA 3RR7A 2OGUA 2DYAA 3LUYA 3A8JA 2P2CB 1SUQA 2ATCB 3FCWA 4X4PA 1QE1A 4QW9A 1VIXA 2AQ4A 2RQCA 4EBDA 1R43A 1CQNA 2XB2D 1RU2A 1FO1A 2DXEA 1HNZF 5HROB 3I82A 1UPMB 2B5JA 3MR2A 3CCLS 1RT1B 4IUFA 4DOZA 1VS3A 1WC6A 1VLOA 3NMRA 4FS1A 3H5XA 2DO0A 4HI1A 4ENOA 2BW2A 1NRKA 2CQIA 4DR2J 3CE8A 1NKCA 4L76A 4DDFA 3VAMA 2JWNA 2CDQA 3QIPA 5E0OA 5G0RB 2DR5A 4IG3B 4ICLA 1KVKA 4NA3A 3HT3A 1HPZA 3S6EA 1SB6A 4FYVB 2FYXA 1CG2A 4X66J 4BLGA 4I67A 5D0RA 3EWGA 3VWSA 2B3TB 2W4DA 2J9CA 5DG9A 1QUVA 4QYZK 5KG6A 2NXJA 4U8VA 4DN0A 2OFHX 1QAYA 4B3TF 4LF8F 3QRQA 2MJNA 2KT2A 4RUCA 3ETOA 4EZ9A 5E7OB 2EFPA 2HVHA 1RAAB 5I42A 3LOUA 4URGA 4PQUA 3KJVA 1S9GB 3CO9A 5L9NA 2Y8YA 1RT4A 5T7LB 1NM2A 3OR1B 4DFKA 4TYBA 4TY9A 4USJC 4PKDB 4AQYF 2CA9A 2XTJP 3M6WA 1M5SA 3WIUA 3EICA 1U25A 3KXDA 3D6FB 2KN4A 3D2WA 4BHQA 5JJBA 1NJXA 2LMIA 5DETA 5HVHA 5KFXA 3QBCA 4NLVA 3BN4A 1LWCB 3AOCA 1ZOTA 2C2DA 2G9OA 3PJXA 1UWBB 1B70B 4YDDB 5KFJA 4G1IA 1XR6A 4ZK7M 2R7VA 3EM1A 2XMKA 4NLUA 3PRDA 1RHJB 3CSKA 4F67A 3O8WA 1N88A 4WE1B 2YNHA 3AA8A 4P2FA 1CPZA 3HHNB 5THWA 5HQMA 4B3OA 4ED8A 1VI7A 3IFEA 3DDIA 2HW3A 2L41A 4CLKA 4L6V3 1SCJB 4NLRA 2HHWA 5I3PA 2B4PA 5B0EA 2ZUAA 2WZ1A 2MSTA 5B0GA 4UT4A 3B54A 3W2VA 3HF5A 1WF1A 3BQ0A 4E2FB 4NI2B 4P2XA 4L3NA 3THTA 2B6AB 3BS9A 2XCAA 3DHWC 1NKBA 2ILYA 4DR2F 3KUEA 5A6WA 4DWIA 2NUHA 3D3BJ 2BVZA 1SQFA 1Y5LB 3GFXA 1DTTA 2JVRA 3SFGA 3EGVA 3FSXA 1T9TA 3T5KA 4A8OA 3FKBA 3W5ZA 2LCWA 4DV4J 2ERRA 3CCVS 1FE4A 3QZ7A 1Y3KA 1JJ4A 1N52B 3P49B 4WP3A 4ETZA 1U1QA 1JLCA 4DN9A 5KFSA 1TR0A 2NPFA 2MZJA 1HI1A 5DGAA 2JL9A 4O44A 3J81j 2WB1D 4I4BA 1H38A 4W92B 2RSQA 5FDLB 3KKFA 3M30A 4NOHA 4M8LA 3KLIA 2HFNA 3PFEA 2IRUA 3EGNA 2DNRA 1JNZB 1JLEB 3PYFA 5L9XA 2DBBA 3RBZA 4EEYA 1ZH5A 1JLFB 1U1NA 4OYPA 3W63A 2DGQA 2FJAB 2LXFA 1ZAWA 2QA4S 2KRBA 3CDUA 2XLJA 2P6TA 1N6QB 1C1BA 4OI6A 5J2MA 2Q1LA 3N79A 1WKJA 3ZZZA 2DKOB 4MKAA 1QVFR 1VHFA 1MLAA 3CXCR 1ZPVA 5ITHA 4N41A 3DLGB 2WAQD 1QLNA 2H5IB 2UV8G 1WC3A 2ZWPA 4OQJA 3DOMB 2D41A 4ZS6A 2OELA 2EKNA 3PYEA 4PWDA 3P5BP 9ATCB 2AYBA 3NOGA 1LW0A 3OTBA 3PKYA 4J9KA 4LBPA 2HBRB 1UVIA 1JNRB 2ASDA 3BF4A 1RACB 4LF5J 1YGYA 3IRXB 1SKSA 5EN1A 1E6VB 4ZVRB 3NBPA 3VAIA 1H0HB 4DMZA 1MU2B 3QT5A 1T94A 2HNZB 2WK4A 1KQFB 2V8HA 4H4MA 2AYGA 1E6YA 1FRMA 3V81A 2FJVA 3TAMA 3CJ2A 2YBVA 2A0FB 5IT4A 2LP4A 4Z37A 4OJHA 1I94J 1RBOB 2ABYA 3HM9A 1IM6A 2VDIA 5F0UA 5DZ7A 5GAEU 4IO1A 1NK0A 5L38A 1HR0F 3THVA 1NHKL 1RHQB 1TVRA 2Q6BA 2G0CA 4EBCA 2HQ3A 1UJ4A 4RO0A 3TA2A 1A9NB 2OTJS 3SEOA 4M5KA 3CEDA 3AB2B 2F8HA 3B4DA 1S1XA 4Y0FA 1UVMA 3C16A 1Z2ZA 1FXDA 4IYQA 2DRAA 3UR3C 3WBZA 4DV4F 5GADI 2GO9A 2EFQA 1WKLA 3T1HF 1KHVA 2VFTA 1RTIB 2BE7D 5KFGA 1HMVB 4CO2A 3CC4S 3D0GE 3DRXA 3PACA 1TL3A 3ULHA 1TKXB 2HHVA 4JYAF 2IDLA 1VQNS 1WHYA 1N34F 3Q8QB 1HBUA 3W5YA 4TQSA 3G6XA 1U1KA 3J7AN 5ETMA 3PV8A 4NCGB 2XGPA 3CJTA 3HKWA 3AH6A 4HDGA 4ZVUB 4N56A 4C8KA 1RYRA 2KL8A 3Q83A 2GIQA 4A8SA 4ZJQA 5D77A 1CJVA 1B4SA 5HQ8A 3DYAB 3L7PA 1WHVA 1GK8A 1S1VA 3H98A 3WHIA 1VOMA 4GVBA 3RRGA 3AAWB 2AYMA 3NNCA 1UW9A 1VDHA 4W90B 1Z1ZA 2CFXA 1U0SA 1OPZA 1R0AB 4AL5A 2J9EA 1IUJA 3TP2A 3E3XA 4K5RA 2HHTA 5ETKA 1FJ7A 2DH8A 1N36F 3KK3B 4ANCA 1HWLA 2OPQB 4ZVTB 3TO8A 3H59A 3OHBA 4NYZA 2V67A 3RRKA 3CCES 1I5OB 5EX0A 1RWVB 2AKWB 2ZZNA 5HANA 2B0GA 2MY8A 3AD9C 3K5LA 5IZHA 4ZPCA 4YB1P 4IFYA 1S6PB 2Q43A 3CF5Q 3IWLA 5KFDA 1I94F 2OEJA 3BJYA 3BQ2A 1RK8A 4BBYA 4N5SA 3ET6A 3AJDA 1N32J 3ICLA 1VJWA 3NKYA 3TEGA 4J9PA 4K0KF 4ECWA 3G8QA 1CEZA 3CCQS 1X0FA 4DUTA 3A1YG 4UOHA 3PKMA 1ACMB 4OZJA 3KLGB 1MG7A 1FEEA 4R0JA 2W2OP 4CLWA 2K7KA 2O3DA 2E5IA 2O01C 1ZTTA 3C6UA 4JV2A 3IS9A 2R7QA 1S0OA 3R6LB 4LFCF 3HMJG 4B3MJ 2XHCA 1S0MA 1TV6B 5DGBA 1HWJA 2RMLA 4LREA 3DRRB 2MKJA 4TLRA 4Q8FA 4CTAB 4D3GA 3DMJA 3HHLD 3MAAB 1DRZA 1GX5A 1K44A 2G2YA 3OUYA 4IR1A 1FK9A 3OVBA 2M70A 1NU4A 4HKQA 3LPEA 4BWJA 1FE0A 3I9V9 3J7ZT 3R5GA 2JEJA 2GMLA 4C4WA 2BXJA 2NQPA 4O3QA 3DCAA 2H5EA 3EPGA 3K5MA 1FKPB 4ALZA 4RZRA 3N6MA 3PHTA 4LVNP 2IFXA 4ZDNA 2ACMA 3LANA 5D15A 4YY3J 2J6SA 2VG7A 3KHGA 2HQFA 3BV8A 2IHR1 4LRFA 3LQVA 3D6HB 1J5OA 2UXBF 4IRCA 4WPAA 4HTIA 1M5VC 4YB7A 2LVWA 3J80Y 2R7OA 2K3IA 4PABA 1MMLA 2RVJA 1LW2B 1I51B 2CQGA 2YX7A 4FPRA 1EJ7L 5D4PA 3QPIA 3Q2TC 4KPYA 1SH0A 4NLXA 3JYTA 4R25A 2UP1A 3TARA 4DX6A 3KWMA 2DTJA 2K1RB 4P71A 3MTJA 2QL5B 3VAFA 2PO4A 4ZHRB 3FCVA 4TNOA 2IYGA 2NPIA 4USHA 2HYIB 5L1JA 2GVZA 1WC4A 3KG4A 3ZNUA 2BM1A 2R2SA 1S1UA 4M5IA 4USVA 4NX9A 2OUGA 1G6BA 3MHYA 4TU9A 1SJ3P 3R5DA 1IBMJ 3FMBA 2IAJB 1B7YB 3QRRA 2ROEA 1Y10A 4GO7X 1JXLA 4RW9A 4I0WA 4GC7A 4ZPVR 3GYNA 1U0HB 3OTDA 5B09A 2DCLA 1H73A 3OJUA 1NO8A 5HVGA 3T5LA 3JSMA 1HL6A 2GNKA 1S4FA 1XTZA 4C7QA 3CTRA 3OFFA 4O3PA 4OHYA 2KT3A 1N32F 1TKZB 1TL7A 2HFSA 3G8TA 1R0CB 1QAXA 1CJUB 1NZ8A 2VPZB 3M2RA 4RNMA 1T05A 1YBUA 1UEUA 4RW8A 2CRLA 2LDIA 1YRTA 2JDJA 1RWXB 4DV5F 3K2YA 5FLXY 1TK5A 5IOLA 3IG1A 3PW2A 1EB0A 3BO2A 1O5JA 1F5BA 4DL2A 5D0HA 5K14B 2GV1A 2C2NA 3TZZA 4OYZA 1IR0A 1LKZA 1IKYB 3S01A 1TELA 2ASJA 5HATA 1AUDA 3DRSB 2DNPA 5DS7A 3M2UA 2GJFA 1YZ7A 2QYCA 4A8KA 2YWFA 3MCOA 4LR7A 4D3HA 3QGGA 1JX4A 3RGIA 5DDQC 3EMTA 2WVDA 5J2PA 4XO0A 4G1QB 1U09A 4MMOA 3W64A 1Z2LA 4TY8A 2QL7B 3DXSX 1GMWA 1RKJA 1YRUA 2ZH4A 1FHTA 5K5MA 4P6QA 5HK4A 3DOKB 4UY85 1REVB 5CYQB 4WXOA 5HMWA 4JI7F 4KV8A 1FRKA 4RU9A 4F2SA 3BBCA 2MZSA 2ZVIA 3TANA 4DSJA 1JLGA 1Q8LA 1C0UA 2QT7A 3QO9B 3ZTSA 5J1EA 5F0WA 1EHWA 3F56A 3H7HB 5JMNA 3OPKA 3H90A 3DOLA 2E1MC 5AXLA 1FVSA 3X1LB 3G82B 4ID8A 2WVFA 3NCQA 2HMIB 3ZXWA 3QAUA 2WW4A 2CNOB 2MJUA 3IM8A 1TAUA 1MROA 5I42B 3GQCA 3PR5B 2XSJB 2CPDA 4YP3A 2OEMA 3LAKA 5KG4A 3VGUA 1OY8A 2RJZA 1RTHA 4KE5A 2IA6A 3E01B 3AQPA 3BPDA 4ZLPA 3RBEA 1WOSA 2E44A 3F73A 3HJFA 1PBUA 1NLKL 3ELHA 1HKAA 3VQSA 3QJJA 4DFMA 3PW5A 2V8VA 5KFKA 4ZOSA 4O0IA 3IWXA 2QFJA 5IWAJ 1PC5A 4Y2AA 2NZ4A 3EGWB 1LFWA 2QZ8A 4QW8A 2CQCA 4FF1A 2AX1A 1OMSA 2DHSA 3M32B 1AZSA 1OS5A 4ZVPB 2Z2ZA 2AJQA 3ZZ0A 2BM0A 1BWVA 2HVZA 2RAQA 1M5KC 2N4CA 1ZZFA 2C2OB 4CYUB 1QDUB 3D6TB 5GMDA 1QAIA 4UOFA 3OSNA 2VPWB 4P72A 1RAIB 1SL1A 4CH0S 5GAHU 3FFIA 2AWZA 1HHQA 3PW0A 4LSNA 4YB6A 2CJAA 3UD3P 4LF9J 5A6PA 4M5HA 1XWLA 3EXYA 1ELOA 1TTHB 2RF2A 4BDPA 2W1BA 4LVOP 3JB9k 1VRTA 2CPXA 3IWNC 2XNQA 3MPDA 2FLLA 1RT7B 3I32A 4Q7AA 4K8RA 2M52A 4B17A 1CS4A 3HJVA 2NUUG 2ZOMA 1IBLJ 4AXIA 4OX9J 1FDDA 4F4XA 4GO5X 1U26A 4WTOB 4IH7A 2HVEA 2DY9A 3FBEA 2VH7A 1YJWS 2GFFA 1NUEA 2QEXS 4WFNQ 1RU1A 3CVKA 2Z8QA 4FVMA 1V3SA 2B9EA 1UP1A 2XMJA 2Z58B 3NAHA 4FKXA 4J90A 5KFMA 2NZCA 1CULB 4ECTA 3Q8UA 4CLSA 1SH3A 1NJWA 1T11A 1IKWA 1ICEB 4FS2A 4CI0B 3A3PB 3UN5A 3V6HA 3PR4A 2W9BB 4LMZA 3FNNA 2XSFA 4QJVA 4DR4F 4UTGA 4ES3A 2V8DA 4DSFA 2N3OA 1KTVA 1N48A 4L72B 4DPOA 4Z2XA 4PWDB 4NMLA 2RNEA 4DR6J 5CA5A 2XC9A 5IWAF 2EBGA 3RZAA 4DLGA 4N47A 1HBOA 1H7XA 1GXUA 3BGRA 2ASYA 3A12A 2E9ZA 1FJGF 4YFUA 4DU7A 4ELVA 4CLFA 2PD1A 3CGIA 3OT9A 2I6WA 1F3FA 2VKRA 3BDEA 4ZVHA 3R2CJ 4CM2A 2I8EA 1X4HA 2COLA 2DGTA 4FXWA 2OPSA 4PXEA 4K4TA 2B4UA 4QR2A 2CPIA 3KFWX 2CQBA 3VF0B 4QPXA 3OTOJ 1SV5A 2V4JA 3NXZA 2JSXA 4FDFA 3GJTB 2F4VF 5H9FJ 3ENWA 1WKKA 2OMLA 2YKOA 5M2RA 1TZ0A 2M4MA 4PR6A 2LQ8A 4U7UD 1K47A 2BEFA 2B7CB 3AOBA 2QIFA 2BJ1A 2AMCB 1X5SA 4ELTA 1M1HA 4IQMA 3GFYA 2Y0BB 3CB4A 5EDWA 3C16B 2YX4A 2Z0GA 2DHGA 1AT1B 2BJ7A 1RWNB 1RA6A 2A2CA 3CUNA 1VRUA 3U7JA 1G1XA 3MMAB 1TKTA 3V4IA 1P9QC 2YNIB 2BQRA 2XBPA 3M8WA 2LFVA 5I3UA 2FQQB 1PYOB 3C15A 5IC4B 4UUWA 2KG1A 2W7OA 4CH1A 2BJDA 1S79A 1T0TV 4ZKAA 2XM3A 4B9TA 2NYIA 4B3RJ 3MM8A 3MDFA 1TK0A 4NLQA 3KJQB 2DHHA 4DR7J 5BR8F 5J2QA 5JVHQ 2ZVSA 4MJKA 2CQPA 1WOPA 3P8BB 3BYRA 2K2PA 4CT8A 1CJTA 4A46A 2YWEA 3TRGA 1S1VB 4KGKA 3SCLE 4HHJA 3IBWA 2YWHA 2I5JB 2V63A 4TLQA 2CPFA 2DIUA 1RCOB 3ILLA 3FRYA 3CJSA 2P5VA 1ZYQA 1UFKA 1Y7PA 4DQIA 4USMA 2CG8A 4XTTA 2GGPB 2JVOA 1X9SA 4USTA 4DR6F 4PXCA 3IR5B 2MQ8A 3DXBA 4ED5A 3BQ1A 2VU5A 3SSRA 1D0EA 1NH7A 3C6TB 4DFPA 2G0JA 2DPJA 2CQ0A 3KLHA 2BJ9A 1SKUB 4J9NA 3TX8A 3OLBA 2R2RA 2MYFA 3RG6A 4PUOA 4P52A 1Q8BA 2HQIA 3H2UB 4ED6A 1EZZB 2CQDA 1LWEB 1LWFB 1YTYA 2OD4A 5F8MA 2R7RA 2ZH9A 5HJYA 5I4MA 4DFJA 3NEKA 2ZBIA 3VAJA 4P10A 2QMUB 3QQCD 2DGSA 2WOMB 3A3OB 2BYCA 1B0PA 4AYBD 3N0VA 1NB2A 4MH8A 3NP5A 2XLKA 2MKIA 2ZBPA 3KOAA 3WX4A 2PEBA 2PI5A 4OHVA 2UXCJ 4ZMMA 3OVSA 4YR0A 4RNFA 4H4KC 1HNWJ 3GTYX 3MM9A 4Y6IA 2G1HA 4QU6A 2ILZA 5KG1A 2DIVA 1UZHA 2OTLS 4ZPDA 1WTBA 3TNVA 4QBUA 4KJIA 2BANA 2D3UA 1UW4A 5BYQA 3CT9A 1OO0B 3SSQA 2G4BA 3NY0A 2VC1A 5EWFA 1H2VZ 1N5TA 2FHMA 3ITHA 4ID5A 4P7TA 4DL4A 1DQ8A 2RILA 5DM7Q 3BH6B 1H2TZ 5ETLA 4DQSA 2F5GA 1YDLA 5FJ4A 4GKKF 4MFBB 3M2VB 4DL7A 1S72S 5DQIA 1Q16B 4LSLA 3OQ2A 5HLFA 3I9ZA 3NCPA 3UD4P 4Y00A 2BDPA 4DSLA 2PA8D 2GX8A 4B3RF 3S7RA 1UL3A 2JFDA 2YNGA 3GU0A 4DR3J 1VGYA 1Y3JA 2D9PA 2K06A 4Z7YA 1NXIA 2VQFJ 9RUBA 1RBAA 5HL7Q 2B56A 2CJKA 4ZVGA 2VBWA 4R8UB 1ZM2A 4RJVA 1FWPA 3LO3A 3QWPA 4H4OB 1T3NA 2X7IA 2HHUA 4X4OA 1S57A 1PILA 2ZD1B 1Q5VA 4F8RA 1XNRJ 2KM8B 2MZQA 2YKQA 4DX7A 2N7CA 2DXFA 2LYVA 2YPYA 1SC6A 2VFVA 2V9KA 3Q8SB 2MQMA 5KFUA 1U48A 4DSIA 3LTOA 2GVZB 1EETA 2E5LF 1S1UB 1Y5IB 5CCLA 5KFBA 1FX4A 2EK6A 2IDEA 3L7UA 4PRFA 1UPPA 4WK3A 1DQAA 1RT5A 2WCXA 1AA1B 2X3GA 3J7YU 1UMJA 3MMCB 1GXLA 4WFBQ 4AE5A 1NSQA 4NLDA 1FX2A 3MCMA 1F0XA 3HSZA 2DR8A 4MYUA 2D3OR 2XS5A 5HO4A 4QYZJ 4WFXA 2BKPA 3J7A1 4K4VA 4NXNF 4KPCA 2X1BA 2KH9A 1R0BG 1BXNA 3D68A 2B8QA 2X3DA 2JLFA 2A6MA 1XMOJ 2PIIA 3GJSB 3P3DA 3EVWA 3J7Z5 3DN9A 3DGVA 3VZIA 4DR1J 1TMJA 1PJ7A 1C1CB 4FZVA 3IR6B 1V5VA 4LF1A 2ALZA 2L08A 1UEKA 3TVKA 4O4GA 4HEA9 1IBKJ 2BKNA 3PYGA 1HYSA 3HHLA 2W2PP 2VG5B 5KT2A 2B9WA 5C25A 3MURP 1HNXJ 3PY8A 2W4PA 3G6VA 1HBMB 4C11B 1DTQB 2V9WA 2VD3A 3Q8RB 2VQFF 3DLEB 3D0IE 3JTNA 1D9AA 1PSDA 4WZQA 4WFAQ 2HLTA 4B3SJ 4Y34A 4XPCA 4DPXA 4IG0A 1JJ2R 5CZXA 2WBMA 5L46A 2QFIA 5CH7B 5E3RA 5DDPC 2FLNA 4Y2IA 4IOBA 3UN2A 4F4WA 3LALA 3KK2A 2NXEA 1FJEB 2PA3A 3DOLB 3QSIA 1ZM4A 2IMWP 3BB5A 2UXDF 4ZCIA 1VQLS 2XNRA 2XZTB 2DO4A 4MYTA 3MOJB 1IQZA 5K8NA 2C3UA 3ZZRA 3R7SB 1TMMA 4ZVOB 2V34A 2V4RA 2C2RA 2CVEA 3UDCA 2E66A 2XMUA 2SXLA 4HT5A 2AEMA 2I38A 4Y2MA 3CDEA 3KLFB 3CCTA 2DGWA 8ATCB 2Z4PA 4I7FA 1GNKA 2GVDA 1L5UA 3NGKA 2E1PA 3PX4A 5HMXA 3FRZA 2W9CB 4M94A 5H1SV 2CNLB 4NRTA 2G13A 1Q81T 2QL9B 3KDNA 5KFPA 4RW4A 4LQ9A 3HDSA 5KG3A 3IC1A 3FVYA 3LP1A 3V4MA 3IGNA 1TL1B 2ADBA 3VAKA 4DR1F 4OIXA 4NCAA 4Q0BB 2RQKA 1GTHA 2FHKA 2CWKA 3RR8A 3RBXA 5CYMA 4KYZA 2R7TA 2CDRB 1NK9A 1RI7A 1PYTA 2VFSA 2HFZA 4MTPA 2R7UA 2X1GA 3V6DB 1RDRA 4BC7A 4A8FA 3R5CA 1RTJB 3R9LA 2I1RA 2ZH5A 4ECRA 4FP9A 2IMOA 4EU0A 3GWCA 3LP0B 1NNDA 1QSLA 1KVIA 4KGVB 1NSKL 2A10A 4Q44A 3HVAA 1IBCB 1VQMS 2R3VA 2DVIA 2KXNB 2AEJA 4OJGA 2N3LA 2IPOB 1P1TA 1X9MA 1N5VA 2XWXA 3CNQP 2DGOA 3K8WA 2IYIA 3ZTRA 4I68A 3DM2B 4ETXA 3BSAA 3MPYA 3QNWB 3LP2A 3GR0A 1Q8IA 2C22A 3Q8VA 4L75A 2GAGC 5J2NB 4TYAA 4X4VA 3M6UA 4MAKA 3DRPA 4HI2A 2ZHBA 3GONA 1UVLA 4B3SF 2MDAA 2K8GA 3MEEB 1F9FA 4DL5A 2B7BB 3W2WA 1OYEA 2CWXA 2P9GA 1B3TA 4ED0A 4AD6A 1XNQJ 1YBAA 2KZZA 2KKHA 3M4XA 4J9QA 2QMXA 1S97A 2ZBQA 3OTCA 2LA6A 4WYWA 2OPRA 2E1RA 3UO0A 1HW8A 2J0QD 5H9FK 2FIUA 4AFFA 2LU1A 5AXKA 3U1MA 4ZA1A 3IM9A 3ZTPA 1RAJA 3A4TA 2EXUA 4B9MA 3TZWA 4M5MA 2HGMA 3I31A 5J1PA 3LWLA 2XLIA 3QYYA 1S6UA 3OW2R 2MKSA 1HNVB 4IDKA 2J7KA 3GV8B 4ZJLA 4OV6A 3LGHA 4LF6J 4V1Ak 2E5GA 1SI9A 2J5AA 1WSRA 4RBUA 1IKXB 2O66A 3DU5A 1IM4A 4DV1F 1WI8A 2AGQA 4K4WA 2FVQA 2GW8A 4P2MA 4PG6A 3N28A 3C66A 4F3QA 1L3SA 2IC3A 2QV6A 4JI3J 5C42A 1N5QA 1U2RA 1L3TA 4G6VB 1FERA 3D6MB 3K0JA 1HWUA 2QYGA 5BYSA 3TVYA 2RH3A 5BYRA 3SSSA 1OSDA 2EW9A 1UJ6A 3CJ4A 4U95A 4PQAA 2BABA 4R5PB 1XQIA 2PT0A 3TAQA 2U2FA 4JI6J 1HQEB 3EPIA 4F0MA 4ZN3A 2CJBA 2YY3A 1S76D 1N56A 2XMWA 3P4UB 5KFZA 4FN5A 2Y1RI 4PAAA 2DITA 3PCOB 3R7NB 3TUJC 1GMWD 3K17A 4DV7J 4ECVA 3BKUA 2OPPA 3DI6A 2R8KA 4F0HA 1WELA 3MM6A 2VC0A 1TFYA 1P6TA 1S9EA 4E0DA 4X62F 2BRLA 4WWSA 3O5TB 5A8WA 5KOWA 3MEDB 2YWWA 4RW6A 1HQUB 3IO1A 1JJHA 3D1OA 5HQLA 2GHWA 2HNYA 2KJWA 3KHHA 4KRWA 4JV5F 1RT3A 3VGVA 4OX7A 5AXMA 1NCLA 5KFEA 3T1YF 4KQZA 4MK7A 2BACA 2HNDA 4X4UA 4OV1A 2V69A 1JLAA 2DNKA 4UZBA 3CJKA 1RADB 4JI4J 3US5A 4UY8T 1RAHB 1KKHA 2ZEJA 5E3AA 5I3UB 3C15B 2P6SA 4JI2F 3N01A 2VJUA 4DX8H 3P5TL 4C97A 2ZJQQ 4FNIA 2KRRA 4Q45A 3C3LA 3F0NA 1SJQA 5BXIA 1AB8A 3B78A 4HTJA 3SDEB 1FDAA 1OY9A 1S48A 2XZDB 5A2QU 4USIA 2GC8A 1RT2A 1GTEA 2MGZB 2DH9A 1X5TA 3BKFA 5A76A 5LXYA 4MIBA 1VBYA 4LFAJ 4KKOA 4ZP7A 2IVMA 1RAGB 3KLEB 5ETPA 2UU9J 2NS1B 1J2VA 4M5DB 3MUVP 4IR9A 1M5HA 2IBKA 5F8LA 2GO8A 4OJ3A 4TKTA 4HH0A 3RJMB 1KHWA 2A1BA 2EC2A 3TX0A 4PZVA 1XIQA 3BKTA 1PAUB 3PIPQ 5CD4A 4HACA 1RXOB 2UUCF 3AJ1A 4RUBA 3PW7A 4IFVB 3AD8C 4IRDA 1EP4B 4ZIVA 2CYYA 3ZZYA 1K0VA 4ZPTR 4WK1A 2R9LA 3QJLA 4JI1J 1HD0A 1HBNA 2IM0A 4JOUA 2ZE2A 2J76E 1JLQA 4A8XA 2UUAF 2FHOB 4QIGA 1XMQJ 1KOOA 2LEPA 2WONB 3K59A 3BYPA 3CMAS 1PGZA 2LLZA 3SIPB 2PI4A 5KG0A 4PG8A 1HNIB 4DEZA 5SZTA 1JIHA 1RLDA 1T9YA 3AJ2A 3T6JA 1S12A 1KRPA 3T6BA 2VBZA 1U1MA 5HVFA 1F5AA 4TN2A 4YEAA 4USKA 1DLOA 3UW1A 1UETA 1KD1T 2QGFB 4U96A 5SUHA 5IT9U 2HLUA 3PG9A 2AIRB 1WF2A 1JXVA 2J9DE 4XDDA 3KUGA 3BSOA 3SQGB 3ZZUA 4Y3CA 1ZM3A 3C19A 3ZNJ1 3MMBB 1HHTP 2R2UA 1CC8A 1T8EA 3CJ8A 3V2UC 1VBKA 3HXMA 5K20B 5D0EA 1QTNB 4U7UK 5HROA 1N5SA 2QSFA 1T7PA 4L74A 1QTMA 3CD5A 4I1TA 3PJ9A 2F7VA 3T3FA 4HVZA 4LUBA 5K9FA 2BR0A 1WJ9A 3BGOP 1FRHA 4QIEA 3VCDA 5GAGU 4ITSA 3S8SA 5K8PA 5G0RA 3P6YC 1X31C 4IG3A 5GAEI 1VQYA 3GCWP 2W24A 3A13A 3HVTA 1BLUA 3DLBA 3SV4A 3OL9A 1BQMB 1U7LA 2MTLA 3AD7C 5B7WA 2JRSA 5D4LA 1V6HA 3UVJB 3BREA 4L73A 2WSCC 4PXDA 1C4CA 5F8GA 2ZOFA 5A0YB 4M5NA 1U1OA 2CPZA 3I5CA 5MLCV 4I2QB 1IKVB 2OMOA 3UPFA 2Y1LB 2KM8C 2HHHF 4IKAA 1KLMB 4M95A 1S9GA 1RGVA 5LMNJ 5T7LA 2EVZA 3JSBA 1RWKB 3OR1A 2ZNZA 5HP1B 4JI1F 1EETB 3BGFA 5KFRA 2UVRA 3DGPA 5KFOA 1XMQF 2F8EX 5E3QA 2J8AA 4Y65A 2PMZD 1TFWA 5HBMB 1SH2A 4DUYJ 1QVGR 2AP6A 1RUSA 3PEJA 4OHZA 4GKJJ 3RBDA 3RW7A 1RT6B 2KVIA 3QFWA 2A6OA 5GMKa 4FF2A 4OYBA 3DDKA 3WIVA 1LWCA 1PJ5A 3PJWA 2X1AA 1UWBA 2QLFB 4CO4A 2B51A 5HJXA 4K2XA 1FF2A 2J0SD 3ISZA 3THPA 2VFRA 3CD6S 2KXFA 4NLTA 4CLUA 4HDHA 3UDEA 3I5BA 3GLJA 4NXMJ 1SPBP 1KWMA 2KFZA 1WG4A 1GMUA 4A47A 1R6YA 4WE1A 1LFPA 4NRUA 1T03B 2EK1A 2C3OA 3N4WA 3SI8A 3KK1A 3O44A 4OYAA 1SC1B 1T3OA 1UEVA 5A8KB 2CZ9A 2BJEA 4AL7A 1WSVA 4DSEA 2AJ0A 2MLYA 1G4CA 1X0PA 3BO3A 3MM5B 3Q0AA 1S0VA 4OL8A 4X66F 3FZBA 1HARA 2BA9A 2D3ZA 2OFGX 3W66A 2HAIA 1WACA 3M9MB 1D1UA 1BQNB 4DV2J 3KJFB 3M1VB 4CZCA 1LWXA 1KR4A 3NGTA 3KJNB 3HFZB 3TUIC 3NRBA 1H98A 2D3O1 4FYDA 1DZ5A 3HCXA 2HVDA 4F4YA 2BE2B 4KAIA 3HHLB 1S6QA 2R8JA 1TK8A 3MR7A 1RHKB 2RDIA 2Z2YB 1H7WA 4RW7B 2W25A 2IM3A 3KYLA 1DAXA 5AE1A 3I5AA 3I0RB 4LFBJ 4A4JA 2HBQB 2OIHA 2AJ1A 5FDLA 4UZCA 2OSRA 1F6TA 5IM0B 3GIIA 2IBOA 3QWUA 1JLEA 3W60A 2MB0B 5HI7A 1U49A 5GMEA 1JLFA 4RLEA 4U9RA 4J9VA 4QR1A 1VQ9S 3PRVA 3MGJA 4FKYA 1HI8A 3T41A 1RCXB 4IOCQ 2HHPA 2HFUA 2V50A 4TVAB 3SXLA 3ZTOA 1KQGB 5LMNF 2DNOA 2WVBA 3QAEA 4I64A 1BHNA 2AF6A 2YKMB 3DLGA 2VHGA 3BPSP 5DDOC 3DOMA 5CABA 1IR2A 3HHDA 4PG4A 4OYMA 4NMXA 2QLJB 1RQ0A 4RR5A 4K2JA 3LH2S 2QLBB 3SBMA 1T02A 5KFLA 3ISNC 4J37A 5LSLA 4LRCA 1YJ9S 4GVLA 3MR3A 2GMJA 3IRXA 3CJ0A 3L95X 1E6VA 2L9NA 4FF3A 3T19A 4OLPA 3C14A 2XZWA 4IRKA 1U2CA 2JEGA 2KXHA 4NXMF 1MU2A 2HNZA 1J5EJ 1P8GA 1PG5B 5M2UA 3K89A 1L3VA 4E8UA 5DJBA 3VGTA 3FBFA 3H2LA 1R27B 4LF7J 4RW4B 2NYHA 3M8QB 2IJFA 1IN0A 4W98A 2EG1A 1O0PA 4OLOA 3JQMA 3UWTA 4NZ0A 4WFZA 1UZDA 1L3KA 2CUYA 5FD1A 1URNA 3MEGB 2CQHA 3VVUA 3CCSS 4N7TA 4AT1B 1S49A 1UVKA 3DLKA 4DV2F 3NMAA 3HHKA 1R8HA 3OJSA 3FUYA 2HS4A 4YUDA 2PC6A 2QLWA 1WDDA 5AE3A 4X64J 1PAEX 1FRLA 5C24B 2E1CA 3ADAC 3TWZA 3VTIA 3DKDA 3DNCA 5D4NA 4M5GA 3MECA 1W26A 3G6ES 1RTIA 1HMVA 1O8BA 4ECSA 3R8YA 1TKXA 4ECZA 2HS3A 1FFSB 2VG6B 3JTPA 2E9TA 4QU7A 2BOAA 2EG2A 1N0UA 5B08A 2UVUA 2F40A 2CPJA 3CIZA 5ADZA 2MLZA 4PPZA 3QRPA 3NGRA 4K4XA 4NCGA 4KB7A 4WBFA 3EZOA 4J91A 1ZPWX 1H72C 3HK2A 4ELUA 2RE1A 5F3TA 1UKUA 2R7WA 3EGZA 2AJFE 1K9MT 2HZCA 2ZKUA 3N5BA 2ZH6A 1APSA 3DYAA 4PWWA 5FIIA 4LF5F 2LECA 4OZLA 4LJMA 2BUNA 3SFUA 5CZVA 2CQ4A 2VPYB 4U8YA 1X60A 2D7SA 1ROFA 4IO9Q 1R0AA 2M9KA 3TQ1A 1FD2A 2HGNA 3KG0A 4ZPWR 1G7CB 3KK3A 2XY7A 2O67A 2YKAA 2FB0A 1KTQA 1JMTA 2VFUA 1JLBB 2OPQA 2Y0SD 1V3ZA 4OZ2A 3H4BA 2VIHA 1X5OA 1M90T 1DHMA 3I55S 2W9AA 4L3KA 4QCLA 3ONQA 3GV7B 5EUHA 1J5EF 1HIYA 1QSSA 2OD6A 4JI5J 1NHUA 4EZ6A 2I2YA 2C2MB 2ZBCA 1S6PA 1D8YA 2NXNA 4X4TA 2V4QA 5KFVA 3MD3A 3TJ8A 3M9OB 3FEXB 2E5JA 5C5JA 4DV6J 3GJRB 1JKHB 4I6AA 2DR6A 1VQ5S 2ZH3A 1Q8KA 2HFOA 4C8OA 1VMBA 2HSEB 4C48A 3M8ZA 3KLGA 2MHEA 4J9LA 1O51A 3CULA 3NNHA 4H4KA 5KAKA 4DLEA 2CVIA 1SKWA 1XMBA 4DX5A 2MQNA 1NEEA 1EAYC 3TEHB 5D0GA 1TV6A 3CJRA 2WW8A 2HRUA 2BMBA 3RB4A 2B4VA 3DRRA 5AE2A 3MM6B 2YWGA 4CTAA 2DNZA 4PWUA 4KH0B 2RDDA 5DLGA 4RBVA 3MAAA 4B9LA 4K4ZA 5LMUJ 2DNNA 3FSYA 4OI2A 2RT3A 2AJ2A 4ZCKA 4DQQA 2HNYB 2JH3A 3EDQB 3F44A 4FF4A 4Y2CA 1X4CA 4WJBA 4OZ3A 3OR2A 2QG9B 4GC6A 4KT0C 1FKPA 4KBIA 2HNDB 4C8LA 2E1AA 4I69A 3C46A 2M8HA 1HNZJ 2PEHA 3M8PB 3W61A 2KT5A 2R7XA 1C0TB 3QLHB 3CC7S 4UQTA 4DF4A 4QZVB 5ETNA 1UVNA 3WZ0A 3GMGA 1HW9A 1SJRA 1KS2A 2H5JB 1PC4A 1RYSA 2V8PA 5GAHI 3GIKA 2G0IA 4BC9A 1U6BA 2EFVA 2PN6A 1A7GE 3D4JA 3E51A 1KQSR 2CJYB 1D9FA 3R5AA 2QC3A 2DNHA 3EDRB 2VB6A 2K1RA 1LXJA 3DDNA 1WOOA 6FD1A 4B9VA 2QA1A 4CT9A 3B8HA 4LSZB 4ZHRA 3MD1A 1Q82T 3CCUS 1HLWA 2R42A 5CAAA 2AEFA 5DZ6A 3HSJA 4ZCLA 1O6XA 3BDPA 1B64A 4B3TJ 3TAPA 4LF8J 2KYXA 3MPVA 2WBRA 3BO4A 4NLOA 4NZ6A 4C0BA 2IAJA 1U24A 2JFKA 3IAS9 4B3MF 2CPYA 2HPUA 4CLLA 4CDIA 1U0HA 4KFBA 1IR1A 3GJQB 2OO4A 2HRTA 5DRKA 4B9SA 2VDHA 1S6OA 3W3SA 4AQYJ 1TKZA 5F41A 3PVXA 1VQ6S 4KSEB 3CC2S 2H3EB 1CJUA 2FHJA 1CJKB 2RKIA 2YKNB 2CADA 4ANDA 3FEZA 2WVCA 1VLYA 4DPTA 3UNGC 1XERA 3QJPA 3F41A 4X84A 1WG5A 1SUQB 3NCRA 2UUTA 1QE1B 4QWDA 3WDOA 1VISA 4AL6A 2X51A 4UOCA 5EGYA 3PX0A 1YG0A 2IY5B 4YY3F 4JB8B 1X4BA 4CLTA 2B5JB 2QJ3A 4OHWA 2QTWA 3CCRS 1IKYA 3NNAA 2EFNA 3DRSA 4YB5A 4CP5A 3KNAA 1TAQA 5KFHA 1VC0A 3QIPB 2J6TA 4ZP6A 1OQ6A 1F2HA 1KQKA 2AW0A 1GXTA 1Y11A 4ICLB 3ZTQA 4F7VA 3LA0A 3R27A 1IWGA 1MWZA 3V6JA 1HPZB 1B0TA 2VBYA 3HI9A 2KHCA 1QM9A 4OI4A 4KH1B 4EUVA 4AXJA 1WC1A 3W9IA 1H74A 4G1QA 4PYDA 4QIFA 4DPYA 1SBRA 3JSYA 3FEYB 3Q2SC 4JP8A 1S1TA 2A3JA 4ZIWA 4CO3A 1HHSA 2KVQE 1R7IA 3IR7B 4GRSA 3T9ZA 3DOKA 1REVA 5CYQA 1NJYA 2BV3A 1M5OC 4PEOA 4K50A 1VQSA 3HVWA 2V5HG 4FXDA 4ED4A 3Q23A 3KLVA 4ERDA 4RX6A 5CXTA 4DV0J 2FGOA 1WEZA 3MUMP 2Z30B 1IBMF 3PEHA 4PQUB 1YLXA 1T9UA 3QO9A 1RAEB 4ZPBA 3KJVB 4ZITA 1FWKA 1N0VC 3HVTB 3HFKA 1GEHA 3RB3A 1RT4B 4ZVFA 3FQLA 4U6PA 3G82A 5LSRA 3WC2A 3CCZA 4F3MA 4CLPA 1VK8A 2HMIA 2GMHA 4DPUA 3GIJA 3P96A 1KDNA 4FYWB 2CQ1A 3I4PA 4I2PA 2ADCA 1NK4A 1W25A 3U02A 2HQCA 3NWRA 4DUZJ 4EO8A 4NYOA 1K1QA 1FDBA 3U1LA 2BW7A 2XSJA 2MHNA 2NSBA 4O4RA 4ER8A 2C3YA 1MMNA 4WU3A 4MKBA 1EKSA 5G4DA 2XQCA 3E01A 4K5SA 4A8WA 3DGPB 1RKIA 4NYPA 5KOXA 1VCTA 2J7UA 2YNHB 3SZ2A 5CYJA 4FXVA 3JAMU 1FVQA 4DL0C 1RAFB 5U47A 4B3OB 3GFHA 1KNZA 4ILRA 3KMSA 3PO4A 2HIYA 1J27A 2BOPA 4QIVA 5LJ3Y 5KG5A 4NPOA 2J8SA 1DURA 2ALYB 3OXLA 4O3NA 5F9NA 3M32A 3W2VB 3QGIA 1QSYA 4OHXA 2P9CA 2FY1A 2U1AA 4EI2A 4LR8A 2OI2A 4E98A 3QMQA 2DJWA 4NL5A 1JJCB 5HN0A 1YX2A 2ROPA 3I0SA 4CYUA 5JXSA 1AFJA 3KK1B 4DQRA 1DTTB 3NOCA 1RWMB 2RUGA 3QGPA 2EFGA 5F3ZA 1RHRB 2D9OA 3IN5A 2VKZG 4F25A 1FRJA 1HR0J 4EWTA 3CDWA 1JLCB 4M63A 5H9EJ 2DR9A 2C3MA 2OKQA 4O44B 2FJEB 4WF9Q 1SL2A 5KG2A 2YQ3A 1Q4RA 1VK3A 4A8QA 4DG1A 2X1FA 3OFEA 1Y4ZB 5L8RC 2AD9A 3M30B 2HQDA 3KLIB 2ZDPA 1RT7A 4WU2A 2MKCA 5B0FA 1SVDA 3K5PA 2ROGA 4HHUA 1YJNS 5ETSA 3VVTA 1S77D 1GMVA 4DV0F 4URSA 3HHLC 3TJAA 1EQ0A 1YIJS 1S6QB 3T1HJ 4ZPAA 3C2PA 1FNOA 2VODA 1N54B 4F2RA 1R31A 2DNQA 3LPYA 1C1BB 1WORA 3N9UC 5J2MB 1U8WA 4JYAJ 2IRYA 1S59A 3L09A 2PSZA 2QRRA 3SQOP 3X3UA 2XO6A 2RS2A 1N34J 4DSKA 3L9ZA 3MPWA 1TP7A 2V68A 2F9DA 1OWXA 4J9SA 4YQWA 5KFNA 2PMHA 1W2IA 2AZ1A 1NDKA 3HFVA 4O3SA 2HK3A 2DNYA 3M9NB 1S4EA 2F65A 5KFFA 4B9UA 4YN3B 4DXLA 1CULA 1B7FA 4DUZF 4CQ1A 1LW0B 2W01A 4V19X 1Q95G 1KFDA 3IBCB 4N8NA 2RD5C 3DLLQ 4A8YA 1MN9A 2W9BA 3HSGA 4IH6A 5C2GA 2ZHAA 1YJVA 1FJCA 3VV2B 4C8ZA 3NBPB 3QATA 1RA7A 2JJ4D 4FYYB 2FLPA 1M1GA 1NHVA 3FC9A 3RTVA 1U8SA 1XN9A 4H4MB 2OJ3A 4DZ6A 1E6YB 3M7VA 3VAGA 3V81B 3TAMB 4P2SA 2GA7A 4B02A 3FGVA 2QX0A 4Q5VA 1V9OA 3PX6A 2RRNA 3TW0A 5LL6d 1N36J 2XMAA 2GS8A 3CCJS 2Y9HA 1U02A 3R6GB 3D0HE 5LXRA 1LOUA 3C14B 2MZ1A 4LF9F 1BMQB 1TVRB 5CD4H 1H6KX 4F02A 4NEYA 2F3JA 1LQ9A 4NLPA 2PGCA 1IJEB 4URQU 1TUVA 2CKWA 2JEIA 3CIMA 1C4AA 3MM7A 5L1KA 1S1XB 5KFTA 2HRYA 1KC8T 5K8OA 3PNIA 2RUSA 2HG4A 4JUZA 3DC2A 2ZDOA 3IMQJ 4K0KJ 3RRHA 2ZJPQ 1IBLF 1FNXH 4LIRA 3FMWA 4OX9F 3UFCX 2MQOA 1TL3B 2BX6A 5DDRC 1NK6A 3RW6A 2E9RX 1ZA2B 2W7AA 3EZ5A 1VQ4S 4C3KA 4LFCJ 3KTQA 5KFAA 3J7YI 1B99A 4EYIB 5D4OA 1SQGA 3DLKB 4X4QA 3J81U 1D9DA 2Y3YA 1HBUB 3GIRA 3H42A 2MLXA 1ZAXA 1QUPA 2APOA 4ZVEA 2A18A 2VA3A 2NREA 2CPEA 2XMMA 2UZAA 2LXIA 3HULA 1VQ7S 1YJUA 4WP9A 3H8YA 4OFZA 2W2QP 3MECB 4PPDA 3D3CJ 4EFAC 3MMAA
chains in the Genus database with same CATH topology
2LEPA 2WONB 3K7RA 2YNIA 3K59A 1FRKA 3CMAS 4C0HA 1PGZA 3DFEA 4RU9A 1UA1A 2LLZA 3OFHA 2PI4A 4F2SA 2MZSA 5KG0A 3TANA 3O1LA 1HNIB 3HLUA 4PG8A 1JB0C 3GZ7A 5CYMB 4DSJA 1MSWD 1JLGA 4DEZA 3UCUP 1Q8LA 1C0UA 2QT7A 3QO9B 1QJHA 1QY7A 5SZTA 3BGUA 3G4SS 1JIHA 3AJ2A 3MOZA 3H40A 1B0VA 3T6JA 5J1EA 1KRPA 5F0WA 3F56A 3T6BA 2VBZA 1U1MA 2LQJA 3OPKA 3DOLA 1YVFA 4YR2A 3MR6A 1NB7A 2JLEA 2E1MC 5AXLA 1F5AA 4TN2A 4YEAA 1FVSA 3G8SA 1SKRA 2F1FA 3X1LB 1DLOA 4YHHF 3UW1A 2A2DA 3OFGA 4ID8A 1N8RT 5E3CA 1UETA 1KD1T 1X4GA 5SUHA 2O5DA 4RUHA 3KMQA 2OP5A 2HIQA 2HLUA 2XO7A 3MFIA 3NCQA 1WF2A 4I6WA 3OXFA 2J9DE 2LEBA 3LAMA 1VQ8S 2HMIB 1NJZA 1UA0A 3M8QA 2CIMA 1RWUA 3QAUA 4XDDA 3BSOA 1YWXA 2MJUA 4DS4A 3SQGB 1VC5A 1TAUA 1MROA 4DF8A 4Q43A 4C98A 2KYZA 5D8HB 3ZZUA 3NL0A 1A6LA 2MZRA 5I42B 4Y3CA 1ZM3A 4F50A 5DM6Q 2I5JA 1R8PA 2LXUA 4QQBA 2ACYA 2QE5A 2CPHA 3GQCA 3PR5B 4ECUA 2XSJB 3MMBB 4C3MA 3LP2B 2CPDA 2W4CA 2XWYA 3MEGA 4YP3A 2GCFA 1HHTP 3LAKA 5KG4A 3I56S 2R2UA 1CC8A 1T8EA 7FD1A 3V2UC 2KHDA 3HXMA 2RJZA 5LT5A 3DRPB 1RTHA 2OAUA 4Q2MA 2YNFB 4LFBF 4H54A 4U7UK 2GGPA 3UCGA 2WSFC 4B9NA 4K4UA 4KE5A 4IFYB 5HROA 1N5SA 2QSFA 1T7PA 1R8BA 3KHLA 1QTMA 2IA6A 3E01B 3AQPA 4DBQA 3CD5A 4I1TA 4DL3A 1TL4A 1SJ4P 4OJ1A 4ZLPA 1FESA 3H5YA 3RBEA 2JZ5A 5C24A 1H3DA 2E44A 2UUWA 5A2QY 3F73A 1WF0A 3N5FA 3OV7A 3HJFA 1WNEA 2MXYA 3W2WB 2F7VA 2RDJA 3T3FA 3OTOF 4HVZA 2ZC3A 5EWEA 1K8AT 2LQ9A 4LUBA 5K9FA 3VQSA 3C6TA 4DFMA 2D74B 2BR0A 5GVQA 1RTDB 3PW5A 1FRHA 2V8VA 2XY6A 5KFKA 4QIEA 3VCDA 2OLWA 2VZ9A 1KLNA 5GAGU 4ITSA 3S8SA 5K8PA 4ZOSA 4O0IA 1S9FA 5G0RA 3P6YC 3IWXA 2RQMA 4IG3A 2QFJA 1T95A 5GAEI 2YH1A 1U6ZA 1PC5A 2OPRB 4ATNA 3GB0A 1VQYA 4Y2AA 2FD2A 2NZ4A 3C6UB 5HMYA 1X4AA 3IS9B 1LWEA 3EGWB 2V94A 1LFWA 4JV0A 4G3IA 2VG6A 1U1PA 2QZ8A 4QW8A 2CQCA 2L9DA 4FF1A 2W24A 2AX1A 1LWFA 2DHSA 4NA2A 1M1KT 2R8GA 3M32B 3HVTA 3G9CA 2KG0A 1BLUA 2HS0A 3DLBA 3SV4A 4NLWA 3OL9A 1OS5A 5I3QA 2FPHX 2DNMA 1BQMB 2AJQA 1K73T 1L3UA 3ZZ0A 3FDSA 2Q6CA 2BM0A 4N77A 2FJWA 4IDKB 1U7LA 2MMYA 4XK8C 1WG1A 2HVZA 2EWHA 1M5KC 3J81Y 2N4CA 2WOMA 1ZZFA 5B7WA 2JRSA 3RAQA 2JEFA 2NR0A 3DMJB 5D4LA 2AV5A 2B4OA 3MR5A 1V6HA 5DG7A 1QAIA 3BREA 3OUYB 2WSCC 4RNHA 1UJ5A 4PXDA 3OSNA 1FK9B 2VPWB 1C4CA 5F8GA 5D3GA 2ZOFA 5A0YB 1U1OA 3V5RA 5HMZA 2CPZA 4CH0S 2DGUA 1SL1A 3I5CA 5MLCV 1BC6A 4I2QB 4C3LA 5GAHU 3OHAA 2M7SA 2XGQA 3H20A 1IKVB 2VV5A 2OMOA 2YTCA 4X2BA 3FFIA 4C0OC 4O23A 1U4BA 4HLBA 2AWZA 3PW0A 3ZC4A 2IC3B 1UFLA 2FC8A 4LSNA 3UPFA 5KFCA 1KFSA 2HHHF 2KM8C 1UVJA 4CCHA 4IKAA 1JWWA 1KLMB 4UW2A 2ZH2A 4YB6A 3HPOA 1X8DA 4M95A 1V3RA 5F8NA 1GH8A 2CJAA 1S9GA 2FVCA 5C42B 3UD3P 1H2UX 1RGVA 3ENVA 2VBXA 2GQQA 1YI2S 3H2VE 2GJIA 5A6PA 4ZP9A 5T7LA 2EVZA 3TOQA 5J1NA 2LU2A 1XWLA 3JSBA 4C2MA 3OR1A 1ZBTA 2N7YA 2ZNZA 3EXYA 1ELOA 4XAKA 3MI7X 2RF2A 4BDPA 4LVOP 3JB9k 4X4NA 1FA0A 1VRTA 1ZM9A 2DCUB 2J0WA 5HP1B 4JI1F 1FCAA 2CPXA 4Y2KA 1EETB 2XS2A 2N4DA 3IWNC 2XNQA 4ES2A 2VG7B 3K57A 1S99A 4Q2LA 3I6PA 3ZFVA 2C42A 1RT7B 4AUKA 2FLLA 5A8RA 3BGFA 4EYHB 5KFRA 3R1LA 4DR7F 3I32A 2UVRA 4LF7F 2PDAA 3DGPA 1D8ZA 4Q7AA 3AQOA 5KFOA 2IM1A 1XMQF 2F8EX 2M52A 5E3QA 2QA4G 2J8AA 2GQ2A 4Y65A 2PMZD 1TFWA 5HBMB 1SH2A 1QVGR 4B17A 4X4RA 2AP6A 1J5OB 5CCMA 3CD7A 4C8YA 4WFYA 2UVWA 2NUUG 2Z2LA 2ZOMA 1JLBA 4MFBA 1W2BR 2ATLA 3M2VA 3PEJA 4OHZA 1Y00A 4AXIA 5IT9Y 5DLFA 3RBDA 3RW7A 1OIAA 4RKUC 1FDDA 1RT6B 2KVIA 3OR2B 4F4XA 2FJXA 5GMKa 4GO5X 4FF2A 3QGHA 1U26A 3DDKA 1BQXA 1ZAVA 3EZUA 4NLYA 1LWCA 1CVJA 4IH7A 1XEZA 3PJWA 1YSJA 2X1AA 1LV5A 3DRYA 1UWBA 4CO4A 4A8MP 2W8KA 4QWAA 1S1WB 3JYTB 2VH7A 1YJWS 2B51A 2GFFA 3ZZTA 4GMKA 4K2XA 2QEXS 4OZ5A 6FDRA 1FF2A 4WFNQ 5KT3A 2J0SD 3ISZA 1Y5NB 2BRKA 3CVKA 3THPA 2R4FA 3BEGB 1SIWB 2QSWA 2VFRA 2KXFA 3OBIA 4NLTA 4NZ7A 3CD6S 3GV5B 2OPPB 3DI6B 4HDHA 2Z8QA 3I5BA 2Z2MA 2XI2A 4FVMA 2QMWA 1V3SA 2KFZA 1VBZA 1WG4A 2B9YA 3Q22A 4ED7A 1UP1A 2XMJA 3NAHA 4KHMA 4A47A 3IAM9 4X64F 2V8GA 1R6YA 4WE1A 1FEHA 1LFPA 2UV8A 5M2PA 4M1KA 1S9EB 4NRUA 1T03B 3AHPA 3WC0A 2RRAA 5KFMA 4R8UA 2RU3A 2EK1A 1JKHA 2VOOA 2C3OA 3N4WA 3T5HA 4ECTA 5A8WB 3SI8A 2XMVA 3KK1A 5KFWA 4NWBA 3M05A 1FTCA 4RW6B 3O44A 4F4KA 1SH3A 1T3OA 1NJWA 4H4OA 1N4LA 1UEVA 3OXGA 5A8KB 1IKWA 2XCPA 2BJEA 4FS2A 4AL7A 4CI0B 4DSEA 2AJ0A 2M0GB 4RNNA 3M8RA 1NKEA 3QZ8A 4Y28C 2NSCA 3VZHA 1X0PA 4DR5F 3BO3A 3CWJA 3V6HA 3MM5B 2ZD1A 1RT3B 3Q0AA 2DH7A 3M6XA 1VIOA 3PR4A 2G1DA 2W9BB 4QWEA 4LMZA 2DHXA 1S0VA 4OL8A 2XHWA 3FNNA 4RW9B 2XEXA 4FBTA 4X66F 3TVZA 2XSFA 4QJVA 3VR1A 4ES1A 4DR4F 1OPIA 1Q78A 4K59A 2ZOGA 3FZBA 1HARA 2OFGX 2BA9A 2D3ZA 1Y9OA 1MNEA 2V8DA 4ES3A 2KZMA 2HAIA 2QO3A 1WACA 3M9MB 3GR1A 3JSMB 1NK5A 1D1UA 4KHPF 4DSFA 2N3OA 2F9JA 1JLAB 1YQHA 1KTVA 1AXQA 2I9SA 1N48A 1BQNB 1U45A 1FRXA 4L72B 4DPOA 1P1LA 4Z2XA 2WTFA 3CJKB 3N6NA 3M1VB