1U6FA

Nmr solution structure of tcubp1, a single rbd-unit from trypanosoma cruzi
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
139
structure length
139
Chain Sequence
b'MSQIPLVSQYDPYGQTAQLQQLQQQQQQHIPPTQMNPEPDVLRNLMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNGFNILNKRLKVALAASGHQRPGIAGAVGDGNGYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein UBP1
molecule tags Rna binding protein
source organism Trypanosoma cruzi
publication title NMR Structural Study of TcUBP1, a Single RRM Domain Protein from Trypanosoma cruzi: Contribution of a beta Hairpin to RNA Binding
pubmed doi rcsb
total genus 15
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u6fA00
4TU7A 2CJKA 3H2UB 1R8PA 4LIRA 2AYMA 2MQPA 2PE8A 2K3KA 2M9KA 3CMAS 2DNGA 2MZQA 2MZSA 3G9CA 1WHYA 2J8AA 2JRSA 2N3LA 2ZJPQ 1KC8T 3OW2R 2DB1A 1N52B 1U1RA 1G2EA 4U67Q 2CQ1A 5CYJA 2ERRA 1P1TA 1D9AA 2DGWA 3UD3P 3TO8A 4UQTA 4RU2A 3B4MA 3PIOQ 4TU8A 1QVGR 1RK8A 1F9FA 2DH7A 2KVIA 1VC6A 1JMTA 5GAGU 2RRAA 2XB2D 2L9WA 1WHXA 2MQQA 1UAWA 3VF0B 3FEXB 1VQ6S 1NJIT 3CULA 1D8ZA 1HL6A 2RUGA 3IRWP 1FJ7A 3H2VE 1R8HA 2CQGA 2K8GA 4IUFA 4TLQA 2BOPA 1U1LA 4C7QA 2RS8A 3JB9k 5IM0A 4QU7A 5D78A 1DRZA 3SDEA 5GAEU 3VALA 1VQPS 5DM6Q 1UP1A 2XSFA 3NNAA 3V4MA 3VAFA 2ADBA 2FHOB 1YTYA 2E5GA 2KXFA 3ZZYA 1M5OC 2Q79A 2M8DB 2MQOA 5GADU 1SXLA 1N88A 3VAKA 1FT8A 2M88A 2SXLA 3BEGB 2ZJQQ 2DNNA 1H2VZ 2HVZA 2N3OA 1X4CA 5GMKa 2DGUA 2FC9A 2XS5A 4QQBA 2XS2A 2KHCA 2YH0A 2YH1A 5MLCV 4FXVA 2DNLA 1WHWA 3BO2A 2KT5A 1YHQS 1QVFR 1FO1A 2N7CA 1FNXH 2DO4A 2KXNB 2DNOA 1FJEB 5DDPC 3HHNB 4C4WA 3CTRA 2MXYA 2DNYA 2MJUA 2MY8A 3CUNA 2UP1A 3EGNA 3CCJS 1X5TA 2AD9A 2O3DA 5DDRC 2KRBA 5HO4A 3VAJA 2L08A 2CQ4A 3NS5A 3CCSS 4ED5A 2XS7A 2JX2A 1OO0B 2AYGA 1U1NA 1P27B 2E5JA 3MXHP 4CH1A 1WI6A 1YJ9S 4W90B 1VQMS 4FXWA 5IM0B 3D2WA 2G4BA 2RS2A 2KU7A 1YJNS 1X4BA 4ZKAA 5LXRA 2VOOA 1H2TZ 2CPXA 2FC8A 3Q2SC 1ZZNA 5CA5A 1VC0A 3P3DA 3CMES 4PKDB 4YB1P 1WELA 1WI8A 1URNA 1WEXA 2RT3A 3CF5Q 2D9OA 2JWNA 2OIHA 2DITA 2MJNA 3NNCA 4WIIA 1U1OA 1VBYA 2HZCA 3LQVA 2EK1A 2X1FA 2MZ1A 2KG0A 5LJ5Y 4Y0FA 5DM7Q 2CQ2A 3ZZZA 2QEXS 1X4GA 2F9JA 4OZ1A 1KD1T 2DHSA 1PO6A 1K9MT 2XNQA 3G4SS 2DH9A 2MKHA 3NNHA 2RVJA 2OSRA 3S8SA 3RW6A 2CPYA 3CCVS 4CIOA 1YI2S 2RQ4A 1M5VC 2MPUA 1JJ2R 4C0OC 2CQIA 3TP2A 3B4DA 3I55S 2LMIA 2DNQA 3NS6A 1VQ7S 3CCES 3RW7A 4QU6A 1BY9A 4WKRA 2X1GA 3G96A 1N8RT 5LJ3Y 2MZTA 2RNEA 1M90T 2MGZB 2KI2A 1HD0A 2LA4A 1QM9A 4M5DB 2CPEA 1SJ4P 3BO4A 2GHPA 2PEHA 2VODA 2MMYA 2DHGA 1M1KT 5FJ4A 5LSLA 3S7RA 2CPIA 3LPYA 2CPZA 1UFWA 2MSTA 3THPA 2JVOA 2ZJRQ 2CQDA 2E5HA 2DGOA 2MHNA 2OJ3A 3DXBA 3US5A 2RU3A 1HD1A 2F9DA 3MDFA 2M4MA 2CQ0A 5D77A 1U6FA 3NMRA 2DGSA 1VBZA 1OIAA 2DNKA 4LMZA 1VQLS 1NO8A 3J7YU 1UW4A 1X5OA 1XN9A 2FPHX 3MUVP 1K8AT 1U1QA 2M52A 2RRBA 2KN4A 2MZRA 1FHTA 3U1LA 1DHMA 3CC4S 1OPIA 3N9UC 4EGLA 2OTLS 5JVGQ 2HGMA 4P6QA 3R1HA 4PRFA 5CXTA 2DNRA 1VQ8S 2QFJA 1FJCA 1WEZA 5GAHU 1IQTA 2VONA 3UWTA 4BS2A 2AYEA 3VAHA 2DO0A 1X4DA 2X1BA 1VBXA 2DIUA 1DZ5A 3BO3A 2DGVA 3P5TL 4OZ0A 2G0CA 2NLWA 3K0JA 1SJ3P 1SJRA 4CH0S 3R1LA 2OTJS 4YOEA 2MKSA 1WF0A 5EN1A 2J76E 2ADCA 3FEYB 4TU9A 1VQNS 5LSOA 1X4EA 2E5IA 5JVHQ 3MOJB 1SJQA 2M8HA 3VAGA 2DISA 3EGZA 2DHAA 3L3CA 1Q86T 2KYXA 2MKKA 4QPTA 1X5PA 2B0GA 3CC2S 3G6ES 2I2YA 2U2FA 2LA6A 1A7GE 3MI7X 1JJ4A 2LEBA 1VQ5S 1A9NB 2MGZA 2LCWA 4WCEQ 1WEYA 2MKCA 2HYIB 2DIVA 2M7SA 1KOHA 1U2FA 2CQHA 3CD6S 3G8TA 5IQQA 1U6BA 3UCUP 2NZ4A 2AYBA 1KOOA 1W2BR 3CCUS 1JJHA 2EVZA 2CQ3A 5GVQA 1ZZFA 3MUTP 2QA4S 3MD3A 4A8XA 1B7FA 3VAIA 2LKZA 1YWXA 2CPDA 2KRRA 2MQMA 3MD1A 3HI9A 3CPWR 1U1MA 1Q81T 2CQBA 2G1DA 5HL7Q 5LXYA 1U1PA 1H2UX 2DNPA 2DNZA 4PR6A 3CCQS 2LECA 3P49B 2DGTA 1NU4A 3Q2TC 2CQPA 1VQ4S 1U1KA 5ITHA 2LXIA 3CCRS 1K73T 1WG1A 2L41A 2DHXA 3CCMS 1VC5A 1X4HA 2OSQA 2CQCA 1WF2A 1VQ9S 3R27A 4J5OA 3CXCR 1SJFA 4F02A 3UE2A 2LXUA 1O0PA 2J0SD 2KXHA 3DLLQ 2KH9A 1VQKS 4V19X 4Z2XA 5BJRA 4IO9Q 1VQOS 1YIJS 1KQSR 4W92B 4WF9Q 5DDQC 1X4AA 2RQCA 1YJWS 1M5PC 1OWXA 2M0GB 3S01A 3UCZP 2MQNA 2YKAA 2FY1A 2V94A 4Y00A 2LQ5A 2MZJA 2HGNA 2MB0B 3MURP 2MKIA 2M70A 3J7ZT 3VAMA 3I56S 2EK6A 2KFYA 2DH8A 3P6YC 4WFAQ 1X0FA 4IOAQ 2VOPA 2CPFA 1WWHA 1N54B 4WFBQ 3CC7S 1PGZA 2LEAA 4ERDA 1H6KX 3IWNC 4LJMA 2YTCA 3UD4P 2DNMA 2KM8B 1X4FA 3MUMP 2MQLA 2KM8C 1CVJA 4UY8T 3U1MA 3TYTA 2JVRA 2MYFA 1WF1A 3SDEB 3THTA 1FXLA 2GO9A 1S72S 4IOCQ 1DBDA 2A3JA 1ZH5A 4WFNQ 3BS9A 1YITS 3G71S 4F25A 5IFMA 3S6EA 1WG5A 2J0QD 1RKJA 3UCGA 3CCLS 2X1AA 3ULHA 2F3JA 2YWKA 3SXLA 2MY7A 4F26A 1X5SA 2BZ2A 2CPJA 2D3OR 2WBRA 1WG4A 3EX7B 2DGXA 1AUDA 2DK2A 2MSSA 2DGQA 2CPHA 2I38A 3PIPQ 2HGLA 2KG1A 5DETA 5H1SV 1L3KA 1Q7YT 5DDOC 2MKJA 1Q82T 1M5KC 4YUDA 2E44A 2D9PA 2M2BA 1WTBA 1HA1A 4CQ1A 2LYVA 2DNHA 3SMZA 1S79A 2U1AA 3G8SA 2N82B 1WHVA 2XNRA
chains in the Genus database with same CATH superfamily
1D9DA 1GTEA 3B82A 3LALA 2ZHBA 1V5VA 4J9QA 2CJKA 3DKDA 4LIRA 2BJ8A 3BB5A 3QATA 3DMJA 2DNGA 3BBBA 5K20B 3CMAS 1WHYA 4W4MA 4A8QA 2IDEA 2XBPA 2JRSA 3T6BA 3W60A 2ZJPQ 3D54A 2K06A 1ZM9A 2G2OA 2IFXA 4OJ1A 3TUJC 3RAQA 1S7HA 1YJTA 3HZGA 4K0KF 1G2EA 3GFHA 4U67Q 2HAIA 2CQ1A 4PYAA 2YNIB 2AW0A 5CYJA 1VRTA 3I0RA 4CO1A 2XWXA 4BWJA 1F60B 3VV2B 2YWHA 2EG1A 4UQTA 4A8KA 4RU2A 4DBQA 2CDRB 2JJ4D 1K44A 4LBPA 1B64A 2DRAA 1FESA 2G2YA 3W3SA 1QVGR 1EKSA 2D7SA 1OYEA 1RK8A 2F4FA 1DTTA 2MLYA 3GG1A 4KGMA 1FRIA 4ZVSB 1JMTA 2RRAA 4MK9A 3DDIA 3RU0A 2QMWA 1WHXA 2YNGA 5CH7B 1T9XA 3MFHA 1IR0A 3FEXB 1LW0B 1UFKA 5HVFA 3V4IA 4WIQA 1WDTA 4U8YA 3SBMA 2QA4G 5LL6d 2OPPB 2HZAA 2YNFA 4Q7AA 5BYRA 1HL6A 4CLLA 2RUGA 5CQGA 3W2VA 3BZQA 5KFCA 4NMLA 1TKTA 2VBZA 2K8GA 1JLCA 3HZEA 3PNIA 1TL7A 4RNMA 3W8PA 4OX7A 2BJ7A 3H5YA 1R0AA 5E7OB 3PHTA 1I6JA 2HS3A 3IXQA 2GW8A 3FKBA 2GVZA 3M8PB 1ZTWA 4QU7A 3MAHA 4K8RA 1Y3KA 2VG6A 2E5LF 1VS3A 4CI0B 4B3TF 2VBYA 4M1KA 4RJVA 2BABA 3M2VA 2XGQA 1HBOA 5AXNA 3J81U 2GQ2A 3V4MA 3AH6A 5K8MA 1L5UA 3FMBA 2VB6A 1PYTA 2QT7A 1IQZA 2JDJA 2NXCA 3FRYA 4IO1A 2EFPA 4WYLA 2FHOB 1YTYA 2DY1A 3BH6B 1GEHA 2KXFA 3RRGA 2V68A 2JC0A 5DQGA 4Y2IA 2FHJD 2KB2A 2C42A 2ZD1B 1IKYA 2AEJA 3MM8B 4H54A 1WSVA 2LEPA 4MK7A 4U9RA 4USVA 3OTOF 1I94F 5DO2A 4LF9F 4QCLA 1XQIA 4ZIVA 2BE2A 3N28A 2HWHA 2EFOA 4C2MA 3QYYA 5LOQA 5LMUJ 2QX0A 3BEGB 1HNIB 1YBUA 4PQUB 1NHVA 2DNNA 1H2VZ 1H0HB 1PILA 1FRLA 2N7YA 2YWEA 4P73A 5A6PA 5KFDA 4X4TA 1F9EB 1FWLA 1UCNA 3GSIA 2HQIA 1VYAA 3TVZA 3I0SA 1SIWB 2WHOA 2BX6A 2YH0A 4ED1A 2YH1A 1YVFA 4JB8B 2GMLA 4KBIA 2DNLA 4KGKA 2V9WA 2P9GA 3RBZA 3MR3A 1UKUA 1JKHA 3MFIA 4JI3F 4K4SA 1ZS6A 3QQCD 1QVFR 4QYZJ 5GAEI 4X65F 3K57A 4IDKB 2HFVA 1W26A 1VBKA 1SBRA 2DNOA 2K7JA 2DD8S 3LP2B 3M2UA 3MZIA 3I9ZA 3TZXA 2KJVA 3OLBA 2ZZTA 3TW0A 3KLGA 2WB4A 2MXYA 4DR1J 4HHJA 3PKMA 2GS8A 3CJTA 3JSBA 2UP1A 1PBUA 4JOUA 1X5TA 2GZOA 4WK3A 2O3DA 1TMMA 4DPWA 3VAJA 4FF2A 4TY8A 1DTQB 2OMLA 3IP0A 1TQLA 3CCSS 4ED5A 3DM2A 1LEOA 3Q0AA 4DX7A 2ZDOA 3Q22A 2F4VJ 4Y6IA 1P27B 5F3ZA 2E5JA 1BXNA 3IM8A 1S6PA 2AKWB 1YKWA 5B09A 2DR8A 1MWZA 3U27A 4CH1A 4C3MA 1RABB 4KJIA 1WI6A 4DG1B 3WZ0A 1T05B 5E41A 3NS7B 1CS4A 1AUSL 2CZ9A 4I2QA 3FUYA 1I1GA 4ZKAA 1KVIA 1U24A 4UOFA 3C16B 3MPYA 5I42B 5LXRA 3TI0A 4IKAA 2W2OP 2IJRA 4Y65A 4DSKA 2CPXA 1BGXT 1SCJB 4ZVHA 3Q2SC 1BC6A 2HW3A 5D4OA 2EFQA 3FSIA 5ETSA 1LW2B 5FDLB 4I69A 2ZEJA 2E66A 3CMQA 4PKDB 4YB1P 1QLNA 1WELA 3AD7C 1Q7LB 2VG7A 4B08A 5B0EA 1DQAA 5F8JA 3KG4A 4WZMA 4ED7A 4BC9A 2MDAA 5E3QA 1MWQA 1EAYC 2B51A 1M5SA 3POTA 5BYQA 2MJNA 3QNWB 1MMNA 3NNCA 2GVDA 2KT3A 4ZPAA 5HP1B 4DSLA 1Q8IA 2AEMA 3IN5A 3KUEA 1E6VA 3OT9A 3KK2B 2HRUA 1WKJA 4DZDA 2E9ZA 1XK8A 4Q43A 4Z7CA 1JLAA 3N6NA 4M8LA 1VQSA 3OFEA 4Q5VA 3HHKA 1YK9A 3D66A 1KR4A 5D0GA 2PMZD 3KJVB 2GHVC 2HK3A 4UZBA 5LJ5Y 3QO9A 1JNZB 4B9SA 5CHCB 4Y0FA 3LWLA 2CG8A 1S1WA 1U0SA 5L1JA 5DM7Q 1X9MA 1X4GA 1ICEB 2QEXS 4DV3J 2KZMA 3PHEA 1Q16B 2A6MA 4FYWB 3C19A 4LSLA 4J7CA 3DU5A 3KHRA 2HHHJ 1V3ZA 5KFUA 1HNXJ 3M05A 3CJRA 1CC7A 4JI5F 2CZ4A 4B3OB 2DH9A 2MKHA 3DLGA 1ZPWX 4KHPF 1YDLA 1BWVA 3T19A 1Z4UA 2V69A 3H90A 1FI4A 1YI2S 2RQ4A 1ZPVA 2QLXA 2HPUA 2RF2A 1VK8A 4IH7A 4K4TA 4KT0C 2NZCA 3G2XA 2R7WA 1FNMA 1RWNB 3TP2A 1RAIB 1Z2LA 2VKRA 3UNGC 4PG7A 3K5OA 1AXQA 1UZDA 2BJ9A 3NGRA 4F67A 3P4UB 1V6HA 2QO3A 2GGPA 2PDAA 5KFRA 2B9WA 3EXCX 1HNIA 3BN4A 5KG5A 2OFHX 3G96A 1N8RT 4OZJA 1HNVA 4WTOB 2MGZB 3HHDA 2AMCB 1XTZA 4R5PA 2XMAA 2CPEA 1FJGF 3E3XA 3MM7A 3O8WA 1HHQA 4HHHA 3MR2A 4GKKJ 2MMYA 4RR5A 2DHGA 5KFHA 3FRZA 5LSLA 1ZA1B 1QE1B 4IDKA 5KOXA 2BW2A 2CPIA 3LPYA 3LP2A 4DX5A 4WBFA 2C2DA 1CLFA 1RT7B 2GX8A 5JMNA 2ZH4A 3I87A 2MSTA 2K1RA 8AT1B 3BPSP 1CEZA 3WHIA 2HNZB 2DGOA 4EMDA 1UTAA 1LWFB 2IM1A 3US5A 2JLGA 1C1CA 4WPAA 1DTQA 1RAGB 2XM3A 3FCWA 2ZUAA 4NLTA 2CQ0A 4TNOA 5EDWA 3RR8A 3LWMA 1FDBA 1R0BG 1U6FA 2HNDA 2RKIB 2EFVA 2X3GA 3DNCA 5B7WA 4N56A 4PWUA 1VBZA 4EO6A 4ID8A 1OSDA 3B54A 1NSKL 4DV5J 3DHXA 4DPUA 5L39A 4F4YA 1IWAA 5T7LA 4CTAB 4K4ZA 2DRDA 1IKVB 4AYBD 2HRTA 3CD5A 5C25B 4OYZA 2FHKA 2G4BA 1ZM2A 2M5YA 3DGVA 1R3NA 3H0PA 3NG8A 4CZCA 2EKYA 2F8EX 4YP3A 2XQCA 4QR1A 4RUCA 1TL3A 1TZ0A 2FLOA 2CUYA 3NLCA 2B7CB 3RRHA 3M32B 4I67A 4IG0A 3CC4S 3IRXB 1HWJA 3N9UC 2DR9A 2NR0A 3PFOA 3BREA 1TAUA 3R6LB 3THVA 3R1HA 2HGMA 4P6QA 2BMBA 1VOMA 3GR0A 5CXTA 2UVVA 4NCBA 1GNKA 2KFNA 1TR0A 2H5IB 3VGVA 1WEZA 3PG9A 3G6XA 2BOAA 1HI8A 2QFJA 3FBFA 2FJXA 3Q8QB 1FRXA 2V5HG 3FZBA 4ECTA 2J7WA 2VONA 3UWTA 1PAEX 2ALYB 3HVWA 4BS2A 1F3VA 1QJHA 1M1HA 1OQ3A 2AYEA 2O67A 3C15B 3K17A 5H9EJ 2IA0A 1S0MA 4G1IA 1FXDA 1Y0HA 3K7RA 5KG4A 4ENOA 4L72B 3T41A 2HHWA 2JNJA 3RAXA 4DU8A 1HBNA 5F8LA 1BHNA 3L95X 4LFCJ 2Z4PA 3D6MB 4YOEA 2K7KA 1REGX 1NJYA 4OHVA 4DLGA 2ZNZA 1N5VA 5L1IA 5AXLA 4LF8F 4LFCF 1S9EA 2QRRA 2PIIA 4KAIA 4TU9A 1VQNS 1ZTTA 2LLZA 2HHUA 2E5IA 4KR0B 4JI7F 3Q83A 2W9BB 4WFXA 4PAAA 3IR7B 4OV1A 1YQHA 3VWSA 3QAEA 1HWIA 3D5MA 4KE5A 3O1LA 3LGHA 3NBPB 3HFZB 4I64A 2DCUB 2CJAA 3W64A 2DHAA 1RWXB 4NLXA 1Q86T 1RT6B 2KYXA 4ZN3A 1S57A 2W4CA 1PKUA 3KJQB 4KIAA 2MKKA 4WXOA 2BJ3A 2V63A 3UR0A 3DN9A 1HBUA 1VR6A 2QC3A 3MHYA 2LA6A 1A7GE 3G6ES 4X4SA 2I2YA 2X7IA 1JJ4A 3ILOA 3PYFA 2UUAF 5DGAA 4JI8J 3FSXA 2VPYB 1W25A 3J7AN 4DX8H 3PR5B 4XDDA 4K4WA 3CJKB 4KRWA 4KGVB 4WWSA 2V67A 1KOHA 2QV6A 5F9LA 1U2FA 3CD6S 3BYRA 1CJKA 1WOOA 4ZP7A 1NK5A 3G8TA 5IQQA 2W9AA 1CQNA 2ZBPA 3IGNA 2EWHA 2IJFA 2JLFA 2P9CA 4IOBA 2AYBA 4B9UA 1S77D 3KLHB 3D6HB 3KOAA 3I0RB 2ROGA 5ETLA 2G0IA 2V4JA 3SCKE 2UU9J 1JJHA 1X0PA 2RDDA 4R5PB 2P5VA 5ETTA 5GVQA 5L9NA 3EPGA 2QA4S 4DFPA 1TL1A 3MR6A 2IM0A 1S6OA 4B17A 4FYVB 4EBDA 2LKZA 2WSFC 5IWAF 2HFUA 2UUCJ 2JH3A 2CPDA 1I3OB 1I5OB 3MD1A 3CPWR 5G0RB 1Q81T 4USIA 3CDUA 5HMYA 1N32J 2IIHA 2G1DA 2C3OA 4MTPA 2V2QA 5LXYA 3SV4A 2CKWA 2J9DE 1IKWB 2V4RA 1UW9A 4NZ7A 3CCQS 2ILYA 5EHHA 4Z7YA 2DGTA 3OLAA 2JFDA 3Q8UA 3Q2TC 3MPUB 1HHTP 3Q86A 2D3ZA 2B8QA 4R8UB 1U1KA 1RAEB 3GIRA 1RGVA 4LRDA 4Q2LA 1RTHA 1YJ7A 1FJ7A 4O4RA 3KUHA 2J0WA 2Q66A 1RSCA 1NK6A 5HANA 3HD2A 2XULA 4RU9A 2L41A 2QZ8A 2BR0A 1WKKA 1NB2A 3OBIA 4WZQA 3V6HA 3J7Z5 1BD6A 3TARA 2YWWA 4M63A 5HMXA 4XAKA 3Q23A 5KFOA 2H3EB 4X66J 3W9JA 5L38A 3CXCR 1EQ0A 5E3AA 3L09A 4O44B 4UF4A 4URQU 1JNRB 4O0NA 3R9LA 4RW9A 3WIVA 3EYZA 3OQ2A 4PUOB 3DLLQ 2W4PA 3PX6A 4LSZB 4FP9A 2KH9A 4TKTA 4GKJF 2ZNYA 2LP4A 2UV8G 1RACB 5ETVA 1WUUA 5BJRA 3TUZC 4IO9Q 5A8KB 1YIJS 1KQSR 1S6UA 5KT7A 2UV8A 3OR2B 4EFAC 4R0EA 4C8ZA 4FN5A 3T1HF 2AQ4A 1HQUA 3DI6A 1F5AA 4MKAA 1V9OA 3BJYA 3NCRA 3TWZA 1HYSB 3TZZA 4DPTA 3MR7A 2ZH8A 2MQNA 2CJXB 3BGRA 5JJBA 5K8NA 2NREA 2HGNA 2R8KA 2B5JA 2M70A 4CO4A 5M2PA 3GV8B 2ZBRA 2WVBA 4MAKA 1QD1A 1FX2A 1QAXA 2EK6A 4YS2A 1F5CA 3I56S 4DV3F 3P6YC 3JAMY 3MTJA 5H9EK 4Y28C 2QIFA 2HIQA 4DWIA 4NRUA 4WFBQ 1S97A 3CC7S 3ONQA 4MKYA 1OSCA 4PWWA 2LEAA 2I1RA 5DQHA 1PGZA 4LBHA 2V8HA 1S1TB 5IV3A 4K4XA 4YY3J 1T7PA 3KHHA 3JXOA 4L6V3 4RNNA 1GMWD 1FDAA 2VBWA 1JLGA 4A46A 3V6JA 3UD4P 3QBCA 4Y3CA 1AYEA 3MUMP 4FKXA 4IRDA 3EZUA 1MROB 4ALZA 4F7VA 2HQDA 2DXDA 1HARA 1NNDA 2NPIA 2XSJA 4N7TA 3VTIA 3OTDA 4DHVA 5HMWA 2YNHB 4ZITA 2QL7B 5JUMA 3Q8SB 1N36F 5C7PA 6FDRA 4OYBA 5C42B 2ASJA 1GX5A 2CFXA 2EFNA 2QSFA 2VFSA 1FD8A 2FZGB 1EP4B 2OD4A 3MTKA 2XLIA 1NJZA 4AL5A 1QAYA 2E1AA 4ELVA 3C16A 5D0RA 2R8JA 4WKYA 1RTIB 2CXEA 3F0NA 3SDEB 5BYSA 4Q45A 4OX9F 3GONA 5CCLA 3BDPA 4DR5F 1RTJB 2V8VA 2R7QA 1CJKB 3DGPA 2R2RA 3SYZA 1FXLA 4KKOA 3AB2B 5IT9U 4KTQA 4NLGA 2D41A 5F8IA 1R43A 4ICLA 2Y0SD 4IOCQ 2ZKTA 3D3BJ 2A1BA 3BS9A 2BYCA 4LVNP 1B3TA 3N5BA 5IFMA 2V6AA 2FQQB 1WG5A 4CO2A 1F0XA 3M2RB 3C6TA 3MM9A 1G7CB 1NZAA 2Q6BA 2X1AA 2F3JA 2MY7A 4F26A 2F4VF 2CPJA 2WBRA 2EG2A 2QE5A 2O5DA 3EX7B 4PWDB 3K8VA 1SKUB 2VZ9A 5KG7A 1N36J 5FD1A 4DR3J 1BQNB 3SSRA 4B3MF 4BDPA 2UXDJ 2HEKA 2PFFB 3N5FA 5IT0A 5KFWA 2UUBF 2OPSA 4M5LA 5CZVA 3D6FB 3HVTB 3D7SB 3QO9B 5CCMA 4D3HA 4ED0A 3AD9C 4X65J 1FKPA 2I0XA 1KN6A 3JYTA 1NRKA 3G6YA 4NLSA 4RW8A 2LFVA 2HKEA 3DDKA 2CVEA 4RBTA 3H4BA 2E44A 3Q8RB 2XTJP 3H8YA 2IYGA 3RGIA 2D9PA 1SVDA 2M2BA 2PFDA 4HH1A 4MFBB 5KFGA 1WTBA 2DRBA 2HZVA 2Q3PA 1Z1ZA 5IT4A 1S76D 2GC8A 4MMOA 4LF6F 4U7UD 4ZLLA 5LMUF 1NJWA 2DPJA 1UVNA 3WQPA 1BE4A 1ZM4A 2OFGX 2GMHA 2OEKA 2VG5B 1TMJA 2AWZA 1IVZA 1JLFA 3KLEB 3PRBA 3UDLA 2K3KA 2NS1B 3PX0A 3G9CA 2MZQA 3QLHA 1UETA 3VGUA 4OQJA 2J8AA 4M5HA 2PI4A 4M5DA 5KFYA 2J9EA 1RDRA 3BN7A 1KC8T 1N52B 2KHDA 2A6OA 2VDHA 4CYUA 3W9HA 1HNVB 2C1EB 1CJUA 4B3RJ 2UVWA 2RHSB 1RT4A 2OEJA 5F41A 4XPCA 3KK3A 5ETRA 1S9GA 1LK5A 1ZETA 3ZFVA 1U7LA 2AZ1A 1KQFB 3PIOQ 3IS9B 1NKBA 4TU8A 2QLJB 2RQKA 3DRRA 1U09A 3IWLA 2CIMA 1U26A 2KVIA 5KFPA 1VC6A 5I3PA 5GAGU 3OL7A 1EIYB 2XGPA 2HRYA 3PY8A 1VQ6S 3VF0B 1NJIT 3AJ2A 2HLTA 2HLUA 1SQEA 3DLEB 1KTQA 3CULA 2XY7A 1K73T 5C2CA 2J7KA 3PEHA 4Q2MA 4ZVPB 3MEGB 1FERA 1NDCA 2ZITA 3DYAA 3MCNA 3MECA 3M6UA 1R8HA 5KFEA 4ECUA 3T5KA 4TLQA 1U48A 1NAQA 4C6AA 2BOPA 2FLLA 3QGIA 5KFZA 3D4JA 4LFBF 1AFIA 5D78A 2O66A 1R31A 1DRZA 4C97A 3SSSA 4DF8A 1N33J 1LKZA 1E6YB 2DR6A 5IV4A 5G4DA 1XMQF 1D0EA 3D1OA 2KL8A 1M0SA 4KQZA 4QWEA 2F65A 2B8PA 1R0CB 1C4CA 4AD6A 1C2PA 3CCZA 2XY6A 3NGDA 3LP0A 2FGOA 1FRMA 2E5GA 4DZ6A 3W5ZA 3V6DA 5D4PA 1M5OC 1WC6A 3BQ2A 3A3PB 1VGYA 3CIMA 3GB0A 1NK0A 2M8DB 4KKOB 4XTTA 1BUXA 3UDEA 1S1XB 3FQLA 4AXJA 3VZHA 1YRTA 4TVAB 4Q0BA 3JSYA 1FT8A 3N79A 5C24B 1Y9OA 2HNYA 3ZNUA 4QIWD 2A18A 5A8WA 2HVZA 4O23A 2ZHAA 3GV7B 3C3LA 2EBGA 3HT0A 2QL9B 2XHWA 3H2LA 4PYDA 3EWGA 1ZAXA 2X51A 5CD4H 3A4TA 3RYLA 4LF7F 4G65A 3KWMA 3IBFB 4IFYB 3T1AA 3J81j 2HSEB 1SH0A 1N48A 9ATCB 2MTLA 4F3MA 3BO2A 3PW0A 1YHQS 2QLBB 4K4UA 4NA2A 1FO1A 3EPIA 2DO4A 3G87A 3Q24A 3KK1A 2JC1A 5KFLA 4E8UA 4LF7J 3GE9A 3VHQA 5BR8F 2Z57B 2H9ZA 3D28A 1SC3B 5F0WA 2IAJA 4F04B 2W9BA 3CCJS 3RG6A 5DDRC 4DMZA 2UUWA 2L08A 3P45B 3VZIA 5KFSA 4PXDA 3TUIC 2G13A 3NBPA 4K4VA 5FLXU 4A8WA 4YHHJ 3KG0A 3C2PA 2ZC3A 4URGA 3I4HX 4CLYA 3MXHP 2B4OA 2VASA 1ZM3A 1QAJA 2FJVA 2FVCA 2P6SA 4ZVGA 2AJ4A 2HFZA 1FKOB 4W90B 1D3WA 1TKZA 2GIRA 2RIJA 3DOMA 2D1CA 2QLFB 4RBUA 5IM0B 4ED4A 1YJNS 3LPEA 3TQEA 2BDPA 3GZ7A 5IC6B 1S49A 2DTJA 3E8OA 5D6GA 4U95A 5KFTA 3FBEA 2W7AA 3LGNA 4UW2A 1C1BB 4M5KA 3TR5A 5F8MA 4ID5B 3OL8A 3RB6A 5J1EB 2IHR1 1X9WA 1FCAA 4LFBJ 3P3DA 3WIUA 3HJVA 3CMES 1PJ5A 2ZE2B 2BM1A 4WE1A 5HLFA 2OAUA 1S1UB 3JQJA 2HVDA 4PXEA 3VR1A 3RB4A 1Q4RA 1B4SA 5DG9A 3V81A 2RT3A 2R7XA 4H4OB 1U8SA 2D9OA 4IG3B 2JWNA 1YLXA 2PGCA 3PACA 3R5DA 1KBRA 4A8OA 2QLWA 3IG1B 4LRBA 1RP5A 3A8EA 1U1OA 4ZOSA 4QWCA 3M30B 1JLAB 4ITSA 1VRUA 2HZCA 3KDOA 4TN2A 3LQVA 4LR7A 2EK1A 4WP3A 3RAMA 4DUZJ 4ECYA 1IKXB 5KFQA 5I3UB 2MZ1A 4CM0A 2KG0A 2Q43A 2RSQA 2OPRB 3M8ZA 2GFFA 4QYRA 1G6BA 2XMUA 3MF5A 1FWPA 3BH7B 1VQYA 4X62F 2F9JA 3EDQB 4KFBB 1KD1T 1WJ9A 2DHSA 4H4MA 2AZ3A 1PO6A 3NCPA 1XNRJ 4NLVA 3GYGA 4OZNA 1C0TA 1P9YA 3VGTA 3QAUA 3AJDA 3MMJA 3C46A 3R3TA 5C5JA 4JV5F 2DXFA 1BLUA 2QG9B 4L3NA 2RVJA 3ITHB 2OSRA 3W65A 1K47A 1B0VA 1CULA 4OI4A 5K14A 4KO0A 2FTRA 3MAQA 3TEGA 4CIOA 2RDJA 1YSJA 3PYGA 4RUBA 5KG3A 1V3RA 1FX4A 5B0DA 1SL0A 3CGIA 3BV8A 1TK5A 3QSIA 2YKNB 1J2VA 1FK9B 2VF3A 3MMCA 3QIDA 4DV0J 1JJ2R 4LF6J 2E1MC 2ZKUA 3NMAA 3KLFB 3A12A 3R5CA 2M3DA 1KVKA 4JV1A 2V2ZA 3OFFA 2V0NA 4OI6A 2EEYA 3BM7A 5D4LA 1N5YA 5DGBA 3WDOA 1XNQJ 2R4FA 1S1XA 4JI2F 3ZO7A 2YXLA 5ETNA 3SCJE 4F3QA 2AJQA 4K5RA 2JSXA 2ZBQA 3RW7A 4QU6A 4ZPVR 3OR2A 1LWCA 3N01A 1F1BB 2X1GA 5GMDA 3OUYB 2V8GA 4NE9C 2PN6A 1Q78A 3DLKB 4P74A 1M90T 2RNEA 2YNIA 5K9FA 1XERA 1Y5NB 2RJZA 3GFXA 4P2FA 1RAJA 4MKVA 4DEZA 3D0GE 4I2PB 2ZWOA 4FZVA 3UD5A 3RR7A 1RISA 2UUBJ 2PEHA 1DTTB 3S1TA 4LRAA 1RXOB 4DR3F 1ELOA 3MMBB 3V2UC 4GMKA 3HHLB 1JXEA 2IVYA 2AT1B 2XI3A 1YBTA 3CNQP 3IAS9 5KTQA 3ZC4A 3THPA 4X4QA 1N6QB 1YRUA 1U6ZA 4HDHA 4OIXA 2CQDA 2MHNA 3NWRA 2ZJRQ 4NLPA 4UOHA 3DXBA 2RU3A 3MDFA 1MN9A 4NLRA 4A47A 3FK4A 1SKSA 1CG2A 4P75A 4O3OA 4DR7J 3NMRA 4KHMA 2DGSA 3M8RA 2XLKA 4LMZA 4KGZB 1NHKL 1BQMB 4ZLJA 3M1VB 1WTFA 2CDQA 2KT2A 1FRJA 1NM2A 4DR7F 1SC6A 2QFIA 5JXSA 4J37A 4DL6A 1EARA 2FPHX 2C22A 3DOMB 2RUSA 1U1QA 1QY7A 3W66A 2FVSA 3KKFA 1HHSA 2KN4A 3JQKA 5F8HA 1XIQA 3QSYB 2OHDA 2OO4A 1RU1A 4HKQA 3AOCA 2B9YA 4OHYA 1OPIA 1B0PA 1HFEL 2F8HA 4AT1B 3LAMA 2OTLS 1PJ7A 2R7VA 5J2MB 4PRFA 2DT9A 4NI2B 3R7NB 4EBEA 1CSJA 1BMQB 5KT4A 2J6SA 1IBCB 3GMGA 4PQUA 4RKUC 1EETA 3ZTQA 3A8JA 4LIWA 2YQ1A 4LQ3A 1IKYB 1RT3B 4NPOA 3N6MA 4RO0A 3MOZA 3ISND 3K58A 1DLOA 4CO0A 1T8EA 1RB0A 3V6KA 2BE2B 3H59A 4O3NA 5B0FA 1VBXA 2DIUA 1ZYQA 1DZ5A 4B9VA 1GX6A 4M95A 3SSQA 5AT1B 4OZ0A 4K59A 1SUQB 1IXKA 2E7VA 4LUBA 3ZZ0A 5E3PA 1SJ3P 1NKCA 1F2GA 2VJVA 3AODA 2V8PA 4Q8EA 4WXWA 5KFXA 1HMVA 4CH0S 3CDAA 4IRCA 2MKSA 1WF0A 2EW9A 2H1YA 1X7VA 1S9EB 2XHCA 1HLWA 5HK4A 2ADCA 2QJ3A 7AT1B 2JEGA 3FEYB 4DV0F 1SJ4P 2X3DA 1X4EA 5HROB 1Y5IB 3HHLD 7FDRA 2RB7A 1H98A 3IBCB 4K5SA 4ZP8A 4DV4J 2UXCF 2BW7A 3T9ZA 4M94A 3IO1A 2ZDPA 2R2UA 4O3RA 4GKJJ 3KJFB 4NZ0A 3G6VA 2D74B 3PXGa 3M8YA 3OHAA 4QPTA 1X5PA 2NUHA 2GQCA 3DCAA 3G82B 3MM8A 1XNRF 3KMQA 2BE9B 1S12A 4DPOA 2HBQB 2HHPA 3QRRA 2LEBA 2HURA 3QT7A 4C11A 5A76A 4X62J 4QWDA 3ADAC 1SL1A 1XC9A 4F4KA 4EZ6A 1TFWA 4ZVRB 4K0KJ 3F56A 2WVDA 3UVJA 2VQEF 3GIMA 2HYIB 2VV5A 1O5JA 2DIVA 1VRQC 2M7SA 2RAQA 3L7PA 1TL4A 4PXBA 2WBMA 2CQHA 2JLEA 3BDEA 1EX8A 4RWXA 5EWFA 4XPEA 2IRXA 1XR5A 4M5JA 2QTWA 4USKA 4CYUB 3DLKA 4N77A 3UCUP 1H72C 1IR1A 1D8YA 1XR6A 4DSJA 3IR5B 2XY5A 2V4JB 1PYSB 3M6WA 4I6YA 4Q44A 1YJRA 2AJ0A 3JTNA 3PCOB 5CYMB 2IRUA 1UA1A 1WSRA 2ZFHA 4A8XA 3CCWA 2Y3YA 2HVEA 2B56A 3G86A 1N32F 1E6VB 2VC1A 1YWXA 2DYAA 4M5IA 1Q5YA 1BQXA 2R7UA 2KRRA 2MQMA 1S9FA 4JI4J 4DR4F 2NYIA 2EI5A 4P71A 1PIEA 1RWOB 1U1MA 4OI0A 3Q8YA 3CW2C 2CQBA 4XIUA 2BRLA 3QRPA 1H2UX 2NXUA 1QUVA 2F40A 3MPDA 4ZA1A 2BACA 1DY3A 4PR6A 4LT6A 4ZCIA 2PC6A 1GMUA 1FXRA 1NU4A 3GIIA 4MT1A 3RZAA 4BHQA 4LF5F 3CCRS 1S99A 1RBAA 3NAIA 4KPCA 2C2RA 2WAQD 2ZH3A 2BRKA 2BVZA 3DLGB 2DHXA 5I42A 2OPQB 3AHPA 1VCTA 3GLJA 5B0GA 1WF2A 3R27A 4NASA 3I6PA 1AZSB 1TVRB 3DRXA 2UUAJ 1SJFA 4F02A 2ROPA 4I56A 2R2TA 4DL4A 3UE2A 3V6DB 2IBOA 1O0PA 4LR9A 4LF4J 3GJSB 4AUKA 1TK0A 1JXLA 3BSNA 2DPIA 2QL5B 3MWBA 5FIIA 4ZP6A 4Z2XA 5K5MA 5E2QA 3SQGB 5T41A 2QSWA 1WKLA 2RF2B 3HM9A 2VD3A 5D4NA 3KHLA 1RU2A 5HP1A 4WF9Q 5H9FK 4O3PA 2XZWA 1UJ4A 1YJWS 1ZBTA 4OFZA 4CLFA 1TUGB 2M0GB 5CYQA 2YKAA 2VPZB 5I3QA 3SQOP 3HSZA 1AW0A 2H4WB 2Y0BB 1XMBA 1TELA 1SH3A 3D6TB 4JV0A 2MKIA 2W9CA 3VAMA 2NUUG 3W1YC 3OJUA 1QE1A 5C2GA 2DH8A 1VRTB 4FYDA 4NXNJ 2IY5B 4IOAQ 2VOPA 2CPFA 4MYUA 3FNNA 4DR4J 3LP1B 1AROP 1N54B 2Y1RI 3MM7B 3OXLA 2V2KA 3D3CJ 4ERDA 1OY6A 1H6KX 1LWFA 4AFFA 3LA0A 3JTPA 3HSGA 3LF0A 3BF4A 4C98A 2KM8B 3ZNJ1 5D3GB 3HVAA 1X4FA 3ZTSA 1TKXA 1J5OB 2DEIA 4G1QA 3X1LB 1TKDA 1N5TA 4J91A 4DCJB 3MPWA 3X3UA 5AJ3J 2CJBA 1YJUA 2W25A 5HQ8A 1KSPA 3R97A 4IR9A 2R42A 2HBZB 4P10A 5T7LB 1GMVA 4RPFA 3W2VB 2F1FA 1IKVA 1WC4A 4KV8A 2VQFF 2BKPA 2ZH6A 2XMTA 3CIZA 3E01A 4R0JA 3ZTPA 4ILRA 2VDIA 1FDNA 2MYFA 3HKWA 2RKIA 5E33A 4BBYA 2XMMA 4L76A 2VG6B 1JLQA 4NCGB 4ILLA 4FF4A 4CTAA 1NUEA 4DDFA 3W2WB 1TUVA 5J1EA 3GV5B 3HKZD 1RHQB 1Q0NA 1NPKA 2HQ3A 3OSPA 1S72S 4JP8A 3HHEA 4B9TA 1WC5A 3MMAA 2GO8A 1FDDA 4DR2J 3G71S 2KYZA 3S6EA 2AU0A 1H74A 4HLBA 1G1XA 3V81B 2FZCB 3HT3A 4DQSA 3CDBA 4K2JA 3V5RA 2Q1LA 4J9RA 1MLAA 3CO0P 1DJ0A 3I31A 4HT5A 3ULHA 4YR3A 2NSBA 1RT1A 4ES1A 2YWGA 2JL9A 4OV6A 4DQIA 3LUYA 2HBYB 1MW7A 2B6AB 2DK2A 2MSSA 2VPWB 2DGQA 3GYXB 1MMLA 2CPHA 3M30A 1KFSA 1T9VA 1VISA 3DOLB 2OPSB 4L74A 3AT1B 4GKKF 3VGSA 3HVTA 2FIUA 3F44A 1KQKA 4RL1A 1FJGJ 3IM9A 5DETA 4AQYF 2Z58B 2OKQA 4IFVB 4RW6A 1FRHA 3PV8A 4ATNA 2CWKA 5H1SV 1XWLA 4HHUA 3C14B 1RBLA 3AXMA 4OYMA 1Q53A 2GIQA 4FBTA 5DDOC 1L3UA 1Q82T 2EFGA 2OMOA 1SQGA 2YQ3A 3FSYA 3R6GB 4FKYA 3CVKA 4OYIA 4C8MA 1XMOJ 4NXMJ 1T03B 3DC2A 5RUBA 2ZC4A 4MFBA 1PBAA 2I9SA 1O6XA 1CULB 2LYVA 4DV7F 1GAOA 1TV6A 3ZZUA 4OX8A 2UXBF 2DNHA 1S79A 2AJ2A 2FUG9 4W98A 1TVRA 2BANB 1X60A 4QR2A 5A0YA 1WHVA 3H25A 4FNHA 3K59A 1AFJA 3EE3A 3QT5A 4NL5A 2FJWA 2AHOB 1DURA 1KP6A 2AEFA 1R8PA 2C2MB 3H2UB 3MEDA 4CCHA 2PE8A 2JEIA 4ZN1A 2HVIA 2MZSA 1IBLJ 5IT9Y 4URSA 4YN3B 1HBUB 5F8NA 2N3LA 4JI5J 3PKYA 5AXKA 3OW2R 4B3MJ 2DB1A 1U1RA 5F9NA 1HNXF 2W2PP 2NCKL 1YZ6A 3MAAA 3TUPA 4CWBA 2HQGA 2WSEC 1F9HA 4I7FA 4ZVTB 4L3KA 2ERRA 2WRMA 2QMXA 1HBNB 2Q6CA 3KK3B 4K4YA 1RWUA 2DGWA 3UD3P 3TO8A 3UQSA 2DR7A 4V1Ak 2AJFE 3H7HB 5M2UA 3GJRB 4YB5A 3KLGB 2ALZA 4JI2J 3SIPB 2FD2A 4DI6A 1LWEB 3BKFA 1FVQA 1NDKA 1QSYA 1YGYA 2DH7A 3Q8VA 5KFJA 4AL7A 1UA0A 1L3SA 4DSIA 2VBXA 2XB2D 2MQQA 3LP1A 3QIPB 3DM2B 1UAWA 3UNYA 4DR5J 1TL1B 4JYAJ 3DLJA 1D8ZA 2HBRB 4PABA 1SL2A 1FEHA 1DQ8A 1R8CA 2ILZA 4ETXA 5D15A 3KK2A 2Y8YA 3H2VE 4UUXA 3DFEA 4IUFA 4CP5A 5KFAA 3TA1A 2ROEA 3NGTA 1R8AA 3JB9k 4BLGA 2W2QP 4QIVA 1DAXA 4KC5A 2F5GA 4DJBA 2VFRA 3O44A 3W61A 2CA9A 2OD6A 1S1VB 4BCAA 4ES3A 4B3SJ 1RT2B 4ZIWA 1VFJA 3AJ1A 5GAEU 3VALA 3LW5C 4JYAF 5DM6Q 1H3DA 2HG4A 4IQXA 3E01B 2H48B 4RW4A 2W8LA 3VAFA 1Y5LB 2XNRA 1Y7PA 3CDEA 3UN5A 4YY3F 4NYZA 1JLQB 2QMUB 4NCGA 2OI2A 4B3OA 1HWUA 4M5NA 4PUOA 1U8WA 3BSOA 4LVOP 1UPMB 2KDOA 1EQMA 4HACA 2KKHA 1VMBA 3H5SA 5GAGI 1FKAF 4F8RA 3LANA 1NKEA 3POTB 1SXLA 5HI7A 4QWAA 4PXCA 4HT7A 1N88A 3EGWB 3ETMA 4OZ5A 2M88A 3VAKA 2SXLA 2ZJQQ 4H4KC 3T5HA 3A1YG 4N8NA 2N3OA 1X4CA 4FPRA 5GMKa 2DGUA 3PFEA 3DLHA 2XS5A 3JS9A 4ECSA 4U8VA 2KHCA 2EBEA 1L3VA 2XS2A 4IFYA 4FXVA 5LMNJ 3ELHA 1WHWA 5KFKA 2W4DA 2KT5A 3OHBA 3HLUA 2HHTA 2D3UA 4OZLA 4PPZA 2HFSA 3QZ7A 4TQRA 2KXNB 3OVBA 1FJEB 1P1LA 4TY9A 1NH7A 1TUWA 4C4WA 1EB0A 4EEYA 3U7JA 7FD1A 1HIYA 2POKA 4IFVA 4RW6B 2AX0A 2MJUA 3K89A 2B5JB 4N8OA 3DDNA 3IAM9 2ZH7A 3CUNA 3EGNA 1RJJA 2IMWP 4X66F 2FZKB 2RHQB 4P72A 4KH0B 2KRBA 5ETPA 5HO4A 3HJFA 3G8QA 3HO1A 2CQ4A 2BQUA 2XS7A 4ELUA 3ZTOA 4LRFA 1OO0B 1U1NA 3LO3A 1T9WA 2XSJB 3KFWX 5CZXA 2HMIB 3NGSA 1TL5A 3OR1A 4AQYJ 2G9OA 3PO4A 3OTOJ 3G82A 3MEKA 1ZAVA 5HVHA 1H38A 1JJCB 1YJ9S 3OXFA 1RA6A 4RZRA 4P2MA 1QAIA 3MR5A 4C11B 4FF1A 1JWWA 5E0OA 2RS2A 1SIZA 1F6TA 3CJ5A 3R5AA 3EVMA 2W7PA 3GU0A 1RWPB 1A6LA 3PTWA 5CAAA 5KT2A 3GFYA 2XCAA 1H2TZ 3HP6A 1UVLA 2WVCA 2FC8A 4I6AA 5C42A 3W5XA 5L46A 2E5LJ 3E51A 1LXJA 3FQKA 3OTBA 4ZPWR 1VC0A 3CEDA 4B9LA 1P9QC 4J9UE 5IWAJ 2WVEA 1LWXA 4J9NA 5ETQA 4DR2F 2UUCF 3LH2S 5KT5A 2XCPA 2RQMA 1Q95G 4IG0B 4ZPCA 2NQPA 3DHWC 1OY8A 3A3OB 2BEFA 4QW9A 2V4QA 1C0UB 3DGPB 9RUBA 3GIJA 3CF5Q 3MEEA 3FJ2A 1O51A 1WOSA 2K1RB 3IG1A 1IBKJ 2OIHA 3C8YA 5U47A 5KT6A 3L9ZA 1PYOB 2IMOA 4UUWA 4I0WA 2XG8A 4OJGA 1UVKA 5F8GA 4WIIA 1JLBB 4C8YA 1VBYA 1JLGB 1LV5A 3DRSA 2RILA 3GFZA 4Y2AA 3C6TB 2X1FA 1XBWA 3I0SB 2HHQA 2K2PA 3LGMA 2BQRA 3NCQA 2ZOFA 2OPRA 3KLVA 3CE8A 3TX8A 4ZS6A 2ABYA 3BSCA 3K5PA 3ZZZA 4OZ1A 2C2EA 2C2NA 3FDSA 2HHXA 5DS7A 4NLDA 4WP8A 1K9MT 2PA8D 4A8SA 3UW1A 3N0VA 2XNQA 5D0EA 1YZ7A 3G4SS 3BQ1A 2UVUA 2R8IA 1J27A 2UXDF 3D1HA 2YX7A 2QGFB 1K1SA 2HK2A 4DPXA 1MG7A 1X8DA 3S8SA 2YKMB 3GSDA 4ZVUB 1NSPA 3CCVS 2E7WA 4P2XA 1M5VC 5THWA 4CDIA 4NXNF 2YKNA 1VIXA 4JI7J 4Y2KA 3SZ2A 4UTGA 1VLYA 2CQIA 2LQBA 4C0OC 2P8IA 2APOA 3B4DA 3UO0A 4ZHRA 2I5JA 3T3FA 1NEEA 2AGOA 1Y4ZB 1RE1B 2VFUA 1W2IA 1T05A 3L7OA 3NS6A 4J9MA 1CS4B 1URNA 4WKRA 4O4GA 3NKYA 4I2QB 4JI6F 3IR6B 4IR1A 4LREA 2B4VA 1R6VA 3FEZA 4YDDB 4KPYA 2MZTA 2KTQA 4DS5A 2KI2A 1HD0A 1SJ1A 2LA4A 1QM9A 3QT6A 3TAMA 3M8WA 3HCXA 2QN6B 3MPVA 2HWIA 5J2QA 1MWYA 1S9GB 3DLBA 4M5DB 4EK2A 2C2KB 1UWBB 2BJDA 3N4WA 2G2ZA 2B7BB 4GVBB 1SC4B 1IJEB 2V2VA 4LF2A 2W9CB 4UQGA 2GHPA 4NWBA 4DUTA 3BO4A 2VODA 2KFZA 1K1QA 3R5JB 3UDCA 1M1KT 4ZCMA 2RMLA 3QFHA 3BBFA 1T95A 2GJ2A 4A4JA 2W24A 5EWEA 1VJWA 2GJIA 2CPZA 4I68A 2GAGC 4PEOA 1TU0B 1UFWA 3HSDA 4HVZA 5AE1A 5K8OA 1Z2ZA 2J7UA 1XEZA 1TTHB 1UJ5A 3KLIB 4C8NA 2JVOA 4OLOA 5HATA 4FNIA 4QBUA 4ZCKA 5IXUA 2M4MA 1CJVA 1RHJB 5D77A 2VA2A 2ZZMA 2WB1D 1XJWB 4KGXB 4OHWA 1IR2A 1IKWA 3GILA 4KV8B 3FFIB 1NJXA 4A8FA 2HHVA 1NO8A 1APSA 2BXJA 2OLWA 1UW4A 1RHUB 3GCXP 1XN9A 2P9EA 4JUZA 4NYOA 3MUVP 1K8AT 4LSLB 3MCSA 3W62A 2HQCA 2EC2A 1S59A 1IBMJ 5AE2A 3JSMA 4JI4F 2ZH2A 1T11A 3BKUA 4ZPBA 3OFHA 1KHWA 2MZRA 2FHJA 4KHRA 2Z56B 1VDHA 5DQIA 1FHTA 5IQ6A 3J80Y 1DHMA 1NDPA 1WOPA 4J9OA 4F3OA 1IWGA 5J2MA 3PJXA 1HPZA 4OYAA 3NP5A 4ZJLA 3NEKA 3EZ5A 1SV5B 1UEVA 3K5NA 4DV2F 2ZH9A 3W9IA 1LNQA 1S4FA 4RW9B 3ISZA 4P7TA 1N0VC 4QWBA 4ZLPA 1KHVA 1S6QA 2IC3A 4L73A 2UVRA 2DO0A 3MEEB 3TRGA 2VQEJ 3T9NA 4ED2A 2Z2LA 2CJYB 2J8SA 2QA2A 3BO3A 2ASDA 4ES2A 2ZM6F 1LK7A 1S1WB 2G0CA 4ED6A 1ACMB 1HI1A 3DI6B 1GT8A 2WTFA 2FVPA 4ECQA 2RU9A 2XMJA 3DOLA 4GC7A 1HMVB 3KNGA 5HQMA 1C4AA 2CJ9A 2IPOB 3VVUA 3R1LA 1JLEA 4C3LA 1JX4A 2OTJS 4P7VA 4X4NA 5EN1A 1U0HB 4N41A 3OTEA 1QUPA 2J76E 3AAWB 5SUHA 3F73A 4V19J 1FRKA 3K2YA 1TK8A 1T3OA 3J7A1 4DQQA 1SQFA 2QYGA 3W5YA 1BWEA 4J90A 3MOJB 2AV5A 3H5XA 1Y10A 2UXCJ 4OYPA 2M8HA 4A8YA 1RT7A 2P6TA 4HL9A 4RNOA 2DISA 4KHPJ 3LP0B 3FCVA 5IOLA 5KFFA 2OPPA 4UZCA 1OQ6A 5KFNA 1HNZJ 1TV6B 3UN2A 2L48A 4DX6A 3CC2S 4FF3A 1MU2B 2U2FA 3MI7X 4ZP9A 4DFKA 5J2PB 4C8OA 1NBEB 1EHWA 1WDDA 2WW4A 5J1PA 1URRA 2W8KA 1RYRA 1WORA 5A8WB 1HWLA 2YQ0A 2MGZA 3OVAA 4K7QA 4WCEQ 4X4PA 1WEYA 4RUHA 1NK9A 1SKWA 1T0TV 3DMJB 3SFGA 1X31C 4YMEA 1YG0A 1HI0P 2R7SA 5GMEA 3IFEA 5A2QY 1UVJA 1IBMF 1QTMA 1LOUA 1SPBP 3TEHB 1S1UA 1T02A 2ZHOA 1KOOA 2C3UA 5EX0A 3TJAA 3TNVA 4OYWA 5HMZA 5LM7E 4NCAA 1GFWB 3CCUS 1RTJA 1NMEB 1ZZFA 4DF4A 5DZ6A 3V4IB 1U25A 2E1RA 1B7FA 3CWJA 2Z2ZA 3VAIA 1DQ9A 3RB3A 1S1TA 4WYWA 5HLFB 2D3O1 1NB7A 5J2NB 2RH3A 1QDUB 1C1CB 3H5UA 1JLCB 3HI9A 5DRKA 1HQEB 4H4OA 1MROA 4U7CA 2F63A 3KLIA 1KLMB 2C2OB 4QIFA 5HL7Q 2FDNA 2DNPA 3KMSA 1K0VA 5E3CA 4B02A 2LECA 3C66A 3P49B 4NRTA 1QTNB 1KTVA 5DLFA 3GP9A 4CLPA 2VIHA 1V3SA 1BQNA 1T9YA 4ECWA 1VQ4S 1CJVB 2ZZNA 3WC0A 5ITHA 1Q8KA 5HQLA 1FKOA 4PZVA 1EP4A 2LXIA 1SC1B 2N4DA 4ELTA 1HBMA 3AOAA 3C6UB 3QWPA 2BBEA 2H65B 2GVZB 4AE5A 4ANDA 1TL3B 1WG1A 2OPQA 3FCHA 4G3IA 3TJ8A 4FS1A 1M5HA 3BR9A 1FKPB 3NGUA 4XO0A 2W2MP 3M2VB 2XZDB 3R5BA 3NOGA 2OSQA 2YWFA 4KO0B 5A8RA 2LU1A 5DG8A 3JYTB 2XI2A 1OPZA 5M2RA 4JI6J 3JSMB 1FTRA 2LDIA 4LF1A 4DUYJ 2CNOB 2XLJA 4ER8A 3UN3A 1FTCA 1CQMA 3SV3A 2CRLA 3NRBA 4DR1F 2J0SD 3RBEA 3M2RA 5K14B 1VQKS 4V19X 4N47A 3HMJG 1VQOS 3H98A 2Y1LB 3AQPA 4FXDA 4O0IA 2QYCA 2VH7A 4JI3J 2HFNA 2OELA 2MKYA 1JKHB 2WZ1A 3SEOA 4C48A 1UEUA 2EKNA 1R7IA 1X4AA 5IS2A 3FZ2A 4CH7A 2RQCA 2C28A 3PRVA 5DJBA 1N5YB 4DS4A 4ZVEA 1OWXA 1NZ8A 2DCLA 4WFYA 2LQJA 3M2UB 3PR4A 4DFJA 3UCZP 2FY1A 2V94A 3CJSA 3D68A 5HBMA 4Y00A 3NXZA 2MZJA 4HYKA 2MB0B 3WBZA 3J7ZT 2C3YA 1KONA 3KHGA 5LSRA 4FYYB 3MMBA 2KFYA 4KFBA 4DN9A 3T1YJ 2OUGA 4ZPTR 2XMVA 4H4MB 2OP5A 1X0FA 1U02A 4LF9J 1I94J 1WWHA 1U0HA 2N4CA 2PI5A 2ASYA 1N6QA 3M8QB 2AX1A 2R7TA 1RT6A 5F0UA 1JXVA 3DRRB 4LJMA 2D69A 2YTCA 4U7UK 1NHUA 4FVMA 2ASLA 4DL3A 1U45A 1P6TA 4H4KA 2DNMA 2LXFA 2RRNA 3MGJA 4X64F 2MQLA 2BM0A 1CJTA 2J6UA 3J81Y 2E9TA 1MNEA 2Z0GA 1IBKF 2H51B 3MMCB 1RAOA 3EJMA 4B3TJ 1M1GA 1R6YA 1YBAA 4CNZA 1B7YB 1Y00A 2BE7D 2E7XA 3D9BA 3M6VA 3MEGA 3O2IA 3OXGA 5DLGA 2ZH1A 4E0DA 3AQOA 2BA9A 2YBVA 2YX1A 4Z37A 4DUZF 1CPZA 3KUGA 2VJUA 1RTHB 3CJQA 3EM1A 1REVB 1LW2A 5ADZA 3OUYA 3VCDA 3TVKA 4AXIA 1KNZA 4EUVA 2ZWPA 2HQFA 4NOHA 2P2CB 4NX9A 3THTA 3E2EA 4DN0A 1KLNA 4CT8A 2GO9A 4CT9A 3AY0A 4QPXA 2FHMA 2E1PA 2VPXB 3H40A 2CNLB 2GIFA 3KTQA 3CJ2A 5EX3A 4RNFA 2IA6A 5FDLA 2A0FB 3MCMA 3NL0A 1YITS 1EETB 2VHGA 2H5EA 4QYZK 1GXUA 2BKNA 2FLNA 4CLKA 2VG7B 1GH8A 3VQSA 3H42A 6FD1A 2J0QD 2ATCB 5L8RC 4HTJA 4EYHB 6AT1B 4USTA 1P8GA 3ETOA 1RWVB 1F3FA 2W1BA 2HMIA 5B0CA 2D3OR 5AE3A 4UY85 3BKTA 1WG4A 1NK4A 3CJ4A 1JLBA 1Y3JA 2B6AA 2MLXA 1AUDA 3DRSB 3CJ0A 4LSNB 4E2FB 1HQEA 1ZOTA 2I38A 4YR0A 2R8HA 2HGLA 4NLYA 1ULRA 4OLPA 4CLTA 2KG1A 1LXNA 5BXIA 2V9KA 2VFVA 2YX4A 1BQMA 1WC3A 5FLXY 5T14A 4X2BA 4OMFG 1Q7YT 4LFAJ 5KT3A 3BYPA 3MM5B 3HDSA 4ANCA 5I4MA 4ECVA 5LMNF 4MKBA 1M5KC 4OL8A 4YB6A 4DSFA 5E3RA 4FS2A 2VA3A 2GCFA 4HDGA 2ZH5A 4C8KA 3WC2A 1U2RA 3RRKA 2YKMA 4CQ1A 3PRDA 1XMQJ 2WW8A 3UR3C 5A8RB 4PQAA 3BR8A 4N5SA 2BANA 2U1AA 3QFWA 3W7BA 2N82B 1RWWB 4OJHA 4CO5A 2DR5A 1HNWJ 1NLKL 3HFVA 4QJVA 3CT9A 2DXEA 4TU7A 2E29A 3N6LA 3P8BB 4QZVB 3ZZOA 3LAKA 1HQUB 2IVFB 1OY9A 2AYMA 3R8YA 3W63A 4ZHRB 2M9KA 3CD0A 5LT5A 2MQPA 4DFMA 5EWGA 4R25A 1Q79A 4NYPA 4RW7B 4WFZA 2PMWA 2WSCC 3CB4A 1HW8A 2BKOA 3BSAA 2ACMA 4C3KA 1IM4A 1O8BA 3MAAB 3ZXWA 2I8EA 5ETMA 1SUQA 2FJAB 4FBUA 1KEKA 3R5GA 4GRSA 4CLZA 1P1TA 3OFGA 3IRXA 3I5AA 2AGPA 1D9AA 3A13A 4OHXA 5CABA 4IRKA 3EICA 4JBCA 4QIEA 3I5CA 4LQ9A 3B4MA 5HBMB 4B3SF 3R7SB 4BWMA 3PM9A 2O01C 1NSQA 3D0IE 3MCOA 3ZTRA 4EWTA 3UPFA 3R2DJ 2AF6A 2L9DA 2BJEA 1F9FA 1SI9A 2BUNA 2MEWA 2W2NP 3AB4B 3NOCA 3OJSA 4DV6J 2L9WA 3QIPA 3KNAA 4DL5A 1J5EJ 2YNGB 1LQ9A 2ZBCA 4YR2A 5CYMA 5KG1A 4DV1F 5D0HA 2WONA 3PW7A 2WK4A 4RBVA 4ZVOB 4EBCA 2ATLA 4MJKA 3JAMU 2W01A 1N33F 1FF2A 3QJLA 5KG0A 3IRWP 1RAFB 3RTVA 4TYAA 2CQGA 2OH2A 1TKTB 2CAJA 1U1LA 1IN0A 1CJTB 1TL7B 2RS8A 3LOUA 1RT5B 4C7QA 1TKZB 1UVMA 2PT0A 4WU2A 2KO1A 5IM0A 1WD6A 3M8PA 4I6WA 3OTCA 1JB0C 4UOGA 3FFIA 2Z2MA 1GXTA 2I6WA 3SDEA 3KJNB 3UVJB 4EU0A 1VQPS 1FFGB 1T9UA 2F7VA 4YQWA 1UP1A 5C25A 1HBOB 3T5LA 2UUTA 2XSFA 1OMSA 3BGUA 3NNAA 1VJQA 3NAHA 3ET6B 4Y2MA 1S5ZA 3UDVA 3LTOA 1HR0F 2ADBA 2G0JA 3DXSX 1JIHA 1H7XA 4QOTA 1DARA 1FNOA 3ZZYA 3M7VA 1GMWA 3TANA 1IBLF 1ZAWA 1FEEA 3PJ9A 2Q79A 2ZD1A 2XMWA 1UFLA 3BGOP 3EZOA 3MM9B 4DXLA 1H73A 1B70B 1KFDA 3VVTA 2MQOA 3IC1A 1JK9B 2J5AA 5GADU 2R3VA 1AZSA 2IJNA 1SV5A 2AIRB 4DR6J 4B3RF 2UXBJ 3GJQB 1FD2A 4MIBA 1N5SA 4PWDA 2HWTA 1OJ4A 2OGUA 4DV7J 1RZMA 1S6QB 5KFMA 2FC9A 5CYQB 4QQBA 4ED8A 1MSWD 4O3SA 5MLCV 4GC6A 3WX8A 1XMOF 4NXMF 3U02A 3JSRA 1YRXA 2V34A 2V50A 1N5QA 4PG4A 1PC5A 4HI2A 5IZHA 1IQTA 1EJ7L 1RWKB 5DG7A 2E1CA 4Y34A 2A2CA 4RW8B 1RT4B 5ETKA 4PPDA 2N7CA 1FNXH 5DDPC 3KDNA 3HHNB 5EGYA 3TZWA 3CTRA 4X4VA 2DNYA 3DRYA 4KB7A 2B43A 1JQGA 2MY8A 3PW2A 4ECZA 2AD9A 3EGVA 3IBWA 1J5OA 3MM5A 3NS5A 2DJWA 4TY8B 2JX2A 5A2QU 4DR6F 4NLQA 2AYGA 2JOQA 2VICA 1FK9A 3IA0A 1WC1A 3A8KA 4YDXA 3OD2A 2IBKA 2FJDB 1EZZB 2V8DA 4GO7X 3P96A 3CJKA 4TQSA 1TFYA 3QLHB 3DYAB 2VU5A 3MECB 4A48A 4P52A 1NK8A 5D3GA 1RAAB 2DHHA 4G1QB 1VQMS 3WX4A 1LWCB 1RTZA 2IRYA 2XYHB 4FXWA 2L9NA 1FFSB 2KU7A 1X4BA 3IMQJ 3D2WA 4J9VA 3CO9A 1S0NA 4WTYA 5KFBA 4N76A 3OL6A 3M9OB 1G3OA 2UZAA 3M1VA 2CNKB 3W2WA 2VOOA 2BV3A 4USHA 3GCWP 4B9MA 2Z2YB 2NXEA 4DPYA 5B08A 1SB6A 4I2PA 5CA5A 2CYYA 3MMAB 1ZZNA 1U47A 1L3TA 3L7UA 3NY0A 4IH6A 2AGQA 2IM3A 3HULA 2LU2A 3PDNA 1WI8A 2VQFJ 4DLEA 3KLHA 3HHLA 1WEXA 1VI7A 1SH2A 1UEKA 4XK8C 1S48A 4OI3A 4WU3A 2A2DA 4F2RA 1I51B 4J9LA 2LDYA 3DLEA 2DITA 5AJ3F 4DV1J 4NI2A 1N34J 1UMJA 4TLRA 4OX9J 3I4PA 4DU7A 2B4UA 1RWMB 4FPIA 3SFUA 2C2ZB 1ZA2B 4YFUA 5J2NA 3T6JA 3RBDA 5K8PA 1J5EF 1D9FA 3OL9A 4DV6F 4ZCLA 3QPIA 4GO5X 3ILIA 1RUSA 4CLSA 5G0RA 1G4CA 1GXLA 4JI0F 2ZVIA 1RT1B 2XEXA 2R7OA 2ZOMA 3FBCA 2YKPA 3I5BA 4NLUA 1U2CA 1FFWB 3KJVA 3TX0A 3CJ3A 1E6YA 1XR7A 2CQ2A 2HFOA 3C14A 3KXDA 3OPKA 2WOMB 4E98A 3H4DA 3IWXA 4ECRA 3BBCA 2FJBB 4K2XA 4R8UA 1RT5A 4ANEA 3GTYX 2CWXA 2FJEB 3A8IA 1T03A 4K50A 3EUNA 4J9SA 4C0HA 5B0AA 5ETOA 2KJWA 4UOCA 4KY3A 3NNHA 4ZJQA 2PEBA 2YKQA 3UI3A 4OI1A 5KFIA 2FLPA 3RW6A 2CPYA 4OYXA 4G6VB 4ZJOA 3ET6A 3W8GA 5KOWA 2H54B 3GQCA 1NDLA 4EZ9A 5F3TA 2Y8WA 2MPUA 1W7WA 2ACYA 4RNHA 3TOQA 5C24A 3MEDB 2O1PA 5GAHI 2JZ5A 2YNHA 3AOBA 3TVYA 2J0XA 3ZZRA 1X9SA 3I55S 4LF4F 2LMIA 4YEAA 2DNQA 1DLOB 1VQ7S 2VKZG 3CCES 2ZOGA 4M5GA 3BGRB 1BY9A 4O4GB 2GGPB 5A0YB 2HHSA 3TAQA 5A8KA 1RQ0A 1KDNA 4IH5A 4I7FB 3B6BA 1UPPA 3O3LA 5LJ3Y 3T1HJ 4TXSA 1RTIA 1UZHA 3PYDA 1AB8A 2WVFA 3ILJA 1QSLA 1C1BA 3I82A 3TJ9A 3AA9A 1QSSA 5HVGA 2PMHA 3O5TB 1RYSA 1UWBA 3KK1B 2R2SA 2QA1A 4X84A 3Q89A 3D67A 1VLOA 3QGHA 3D1QA 3MM6B 4LF5J 1Q8LA 3BGLA 5KG2A 5FJ4A 3QJPA 3S7RA 3PX4A 4F4WA 4JI1F 4QR0A 1R8BA 1RHKB 4CLUA 4U6PA 1KVJA 2H5JB 2XC9A 1NH8A 4F0KA 4IG3A 1Y11A 1HQ2A 2VL1A 3GWCA 3M8QA 2W7OA 2IVMA 1GQEA 1NXIA 1VHIA 4DCOB 2E5HA 2YNFB 2OJ3A 4DL7A 1S0OA 1HD1A 4UT4A 2MQ8A 2F9DA 4F50A 5GADI 3AA8A 1HWKA 1R0AB 4S0MA 2RE1A 2JHEA 1IKXA 2AP6A 2YPZA 1OIAA 4DOZA 2DNKA 1N4LA 2KVQE 4QIGA 1VQLS 2YVSA 3J7YU 3TAPA 2GV1A 4RWWA 3J7YI 4ETZA 3PJWA 2MLZA 1X5OA 1PCAA 4P2SA 2YKOA 4CM2A 4ICLB 4HI1A 4F4XA 2FY8A 2M52A 2RRBA 4MYTA 2FGCA 1U4BA 3GG0A 4FYXB 1LFWA 4F4ZA 3U1LA 2DBBA 8ATCB 2F8MA 2JEFA 1KKHA 3OVSA 2PSZA 4EGLA 5L1KA 4JI1J 2C3PA 3HD1A 5JVGQ 3CJ8A 2UU9F 2B9XA 2B9EA 2DNRA 2FYXA 3AD8C 2XYGB 4I4BA 2BQ3A 1VQ8S 1FJCA 3EXYA 4USJC 5GAHU 3I32A 1D09B 4X64J 1Q8BA 1JLFB 3KLEA 1FWKA 2XMKA 3BGFA 3HF5A 4KSEB 4MIWA 4DCPB 1K0TA 3SCIE 3AFGA 3B8HA 4OI2A 1EKRA 3VAHA 1IUJA 3ENWA 1T9TA 1X4DA 1YJVA 1T94A 2X1BA 1UL3A 1MMDA 1RADB 4DV4F 1S4EA 2DGVA 3P5TL 4QW8A 1CJUB 2NLWA 3K0JA 4JI8F 2VC0A 1OS5A 3T1YF 4HR2A 3PW5A 5E5NA 1SJRA 5L9XA 3R7BB 1RAHB 4B9NA 4CO3A 1RHMB 2B4PA 4O3QA 4NZ6A 1N0UA 4WK1A 4I1TA 3M4XA 2NYHA 4FDFA 2Y1JA 5LSOA 3O6QA 3QGGA 4CNYA 1AT1B 2GA7A 1NSAA 2VUGA 3P5BP 5JVHQ 4NLWA 1KRPA 1SJQA 1TAQA 4U96A 3VAGA 3A3NB 4ZVFA 1VK3A 3U1NA 3SI8A 3EGZA 2VFTA 1IJFB 3D0HE 4ZMMA 3CSKA 3HX9A 3L3CA 3CD7A 1HW9A 1VIOA 4G1PA 4M5MA 3OSNA 4LF8J 1ROFA 1R27B 1S6PB 1Q5VA 2B0GA 5A6WA 1MU2A 4F36A 2R7RA 2PD1A 1TKXB 5IC4B 4USMA 4YB7A 3DRPB 5J2PA 5J1NA 2ZVSA 4DUYF 1KWMA 2AJ1A 4USUA 2YPYA 1VQ5S 2VG5A 2LCWA 2COLA 4EO8A 2FVQA 3EMTA 2HVHA 2MKCA 4NEYA 2GHWA 4JI0J 4ILMA 4RW7A 4PCQA 1PG5B 4X4UA 4J9PA 4ECXA 3HXMA 4OHZA 2GQQA 1FVSA 4DQPA 1U6BA 1B99A 3FGVA 4PG8A 4D3GA 2NZ4A 2EPIA 2Z30B 3RJMB 3FVYA 4X4OA 5B0BA 5HAOA 5CD4A 4C9DA 1H7WA 1W2BR 1OYDA 2XZTB 2CADA 2EVZA 2CQ3A 3MUTP 3R2CJ 4C8LA 2IYIA 4LRCA 3MD3A 2DEJA 3MM6A 4ZK7M 4NA1A 3IS9A 2CJQA 2GVDB 1DFDA 1SKRA 1V5IB 1YX2A 2LQ9A 3ZZPA 4MH8A 4NMXA 2LQ8A 1IM6A 1RT3A 3BQ0A 3IGVA 1C0UA 3DOKA 4F0HA 1KLMA 1FA0A 2BJ1A 3JTOA 3J80U 2WONB 2HIYA 3M9NB 1U1PA 2DNZA 4P9SA 4DV5F 3BPDA 3RB0A 1S0VA 3OR1B 4WJBA 5HSPA 4F4AA 3GIKA 2CQPA 1FE4A 3PEJA 1KS2A 2J9DA 1RTDB 3QRQA 5MAOA 2ZBIA 1UVIA 3HSJA 3QGPA 1HBMB 2Z8QA 3C6UA 4HTIA 4NA3A 2J9CA 1VHFA 1WC0A 2XWYA 3ENVA 5KAKA 4JV2A 5SZTA 4MK8A 3CCMS 1VC5A 2IAJB 1X4HA 3B78A 4EI2A 2CQCA 3K8WA 1VQ9S 1RCOB 1PC4A 1F5BA 4LBIA 4J5OA 4Q8FA 4Q0BB 2FVRA 3K5MA 2CZVC 2KZZA 3PO5A 4X4RA 4A8MP 4NEZA 2XO6A 4O44A 3QZ8A 2LXUA 3CDWA 2XO7A 1XNQF 1F2HA 4DSEA 2KXHA 1HNZF 3T5JA 4DL2A 2IM2A 1PAUB 3EVOA 3NWGA 4W92B 3HVRA 3I9V9 3PYEA 4AL6A 4OZ3A 4XDCA 2EC0A 3HHLC 1WNEA 4F2SA 1PSDA 5DDQC 3TAMB 2HNYB 4CRJA 5J2QB 4MIAA 2CNNB 4EYIB 4ID5A 1M5PC 3TA2A 1KQGB 1HYSA 4ZPDA 3S01A 4J9KA 4OYOA 3PW4A 4JV5J 2LQ5A 1T3NA 3MURP 2RDIA 2ZE2A 5HJYA 3QJJA 5H9FJ 1D1UA 1RLCL 2DVIA 5HROA 1CBKA 5L1LA 4WFAQ 1GTHA 3NGKA 4USWA 3ENAA 2ZM6J 2CVIA 4NLOA 1UWAA 5EUHA 3ISNC 1LW0A 4RLEA 1B0TA 1GK8A 4GVBA 4ZLNA 3KYLA 4LR8A 3TA0A 3IWNC 1S10A 4WP9A 2HNZA 4OJ3A 2JEJA 2HHHF 2J6TA 4FVCA 3K5LA 1HR0J 1VRUB 1PJ6A 1RLDA 4OX6A 2C3MA 4DV2J 2FB0A 3F41A 3GR1A 4TYBA 1RCXB 2KM8C 2HNDB 2L3MA 3AXKA 2Y9HA 3FBBA 3SCLE 4HH0A 3HPOA 1N34F 1CVJA 2MHEA 2I5JB 2GJFA 2HS4A 3JQMA 3Q8PB 2ZUGA 1R89A 3U1MA 1NK7A 4UY8T 3TYTA 2E9RX 1Q1KA 1A9NB 3DRPA 1REVA 2JVRA 1NPRA 3FMWA 3GJTB 3L4BC 2HAFA 2A10A 1WF1A 3VQTA 4WE1B 3RUBL 2GAHC 2YY3A 3ZZTA 2HS0A 1U49A 2Y1IA 1RT2A 3EVWA 4DL0C 2PA3A 1RBOB 3CCTA 2RD5C 3M32A 1RA7A 1NCLA 2NXNA 4IQMA 2K3IA 2GNKA 4KYZA 3H20A 4RW4B 4ED3A 1RHRB 2EXUA 3EDRB 3QMQA 5KG6A 3TQ1A 1DBDA 2A3JA 3ICLA 1ZH5A 4RX6A 2NPFA 4WFNQ 4RUAA 4DQRA 1FE0A 1LWEA 3PZPA 2R9LA 3FC9A 2G1HA 4F25A 3KLFA 1A0OB 2NXJA 2CG4A 3QWUA 1RKJA 2DY9A 3RBXA 3UCGA 2B3TB 3CCLS 3C15A 2OEMA 4YHHF 2YWKA 1HPZB 4KH1B 5AXMA 3SXLA 4PG5A 3SQGA 1X5SA 2BZ2A 4C0BA 3TZYA 1TP7A 3DU6A 3UFCX 4CLWA 1MN7A 4ZVQB 5HN0A 2DGXA 4LSNA 5KFVA 2JFKA 2H4YB 2IC3B 3DOKB 5BR8J 5DZ7A 3PIPQ 3M6XA 3ENQA 3M9MB 5I3UA 1S1VA 4Y2CA 4ZDNA 2LVWA 4BC7A 1N56A 4HEA9 4IYQA 1L3KA 2WOMA 3HK2A 1RTDA 1RI7A 3GPAA 1S7IA 4L75A 2DKOB 3OV7A 1HNWF 2PO4A 2GMJA 2MKJA 1HKAA 4PG6A 1JLEB 1RKIA 2IDLA 3KG1A 3QT8A 3ILLA 2XYPB 5HJXA 1C0TB 4F0MA 1AA1B 4YUDA 3M8SA 8RUCA 1WACA 1LFPA 5D8HB 1ITPA 2NSCA 3GYNA 1CC8A 1HA1A 4OZ2A 3PVXA 3ITHA 4GVLA 4HACB 4DG1A 1UJ6A 3SMZA 3HFKA 3I96A 3G8SA 2R8GA 4LFAF 1NPPA 2WCXA
chains in the Genus database with same CATH topology
1D9DA 1GTEA 3B82A 3LALA 2ZHBA 2CJKA 4LIRA 3BB5A 3DMJA 2DNGA 3CMAS 1WHYA 4A8QA 2XBPA 2JRSA 3T6BA 2ZJPQ 3D54A 1ZM9A 2IFXA 4OJ1A 3TUJC 3RAQA 1S7HA 1YJTA 3HZGA 1G2EA 3GFHA 4U67Q 2HAIA 2CQ1A 2YNIB 2AW0A 5CYJA 1VRTA 3I0RA 4CO1A 2XWXA 4BWJA 1F60B 2YWHA 2EG1A 4UQTA 4A8KA 4RU2A 4DBQA 2JJ4D 2DRAA 1FESA 3W3SA 1QVGR 2D7SA 1RK8A 3GG1A 1DTTA 4KGMA 1FRIA 1JMTA 2RRAA 4MK9A 3RU0A 2QMWA 1WHXA 2YNGA 5CH7B 3MFHA 1IR0A 3FEXB 1LW0B 3V4IA 2QA4G 5LL6d 2OPPB 4Q7AA 2YNFA 5BYRA 1HL6A 2RUGA 5CQGA 3W2VA 3BZQA 5KFCA 4NMLA 1TKTA 2VBZA 2K8GA 1JLCA 3HZEA 3PNIA 4RNMA 1R0AA 4OX7A 3H5YA 5E7OB 1I6JA 2HS3A 3IXQA 2GW8A 3M8PB 1ZTWA 4QU7A 3MAHA 1Y3KA 2VG6A 2E5LF 1VS3A 4CI0B 4B3TF 2VBYA 4M1KA 2BABA 3M2VA 2XGQA 1HBOA 5AXNA 2GQ2A 3V4MA 3AH6A 5K8MA 1L5UA 3FMBA 2VB6A 2QT7A 1IQZA 2JDJA 3FRYA 4IO1A 2EFPA 4WYLA 2FHOB 1YTYA 2KXFA 3RRGA 2JC0A 5DQGA 4Y2IA 2FHJD 2KB2A 2C42A 2ZD1B 1IKYA 3MM8B 4U9RA 4H54A 2LEPA 4MK7A 3OTOF 1I94F 4N41A 4LF9F 5DO2A 4QCLA 2BE2A 3N28A 2HWHA 2EFOA 4C2MA 3QYYA 3BEGB 1HNIB 4PQUB 1NHVA 2DNNA 1H2VZ 1H0HB 1PILA 1FRLA 2N7YA 2YWEA 5A6PA 5KFDA 4X4TA 2HQIA 3TVZA 3I0SA 1SIWB 2WHOA 4ED1A 2YH0A 2YH1A 1YVFA 4KBIA 2GMLA 2DNLA 4KGKA 2V9WA 2P9GA 3MR3A 1UKUA 1JKHA 3MFIA 4JI3F 4K4SA 1QVFR 5GAEI 4X65F 3K57A 4IDKB 1SBRA 2DNOA 2K7JA 2DD8S 3LP2B 3M2UA 3MZIA 3I9ZA 3OLBA 2KJVA 3PKMA 3TW0A 3KLGA 2WB4A 2MXYA 4HHJA 3JSBA 2UP1A 4JOUA 1X5TA 4WK3A 2O3DA 3VAJA 4FF2A 4TY8A 1DTQB 2OMLA 3CCSS 1TQLA 4ED5A 3DM2A 3Q0AA 3Q22A 2ZDOA 4Y6IA 1P27B 5F3ZA 2E5JA 1S6PA 5B09A 2DR8A 1MWZA 3U27A 4CH1A 4C3MA 4KJIA 1WI6A 4DG1B 3WZ0A 1T05B 5E41A 4I2QA 1I1GA 4ZKAA 1KVIA 1U24A 3TI0A 3MPYA 5I42B 5LXRA 4IKAA 4Y65A 4DSKA 2CPXA 1BGXT 4ZVHA 3Q2SC 2HW3A 5D4OA 2EFQA 3FSIA 5FDLB 1LW2B 4I69A 2E66A 4PKDB 4YB1P 1QLNA 1WELA 1Q7LB 2VG7A 4B08A 5B0EA 1DQAA 5F8JA 3KG4A 4WZMA 4ED7A 4BC9A 2MDAA 5E3QA 2B51A 3POTA 1M5SA 5BYQA 2MJNA 1MMNA 3NNCA 2KT3A 4ZPAA 5HP1B 4DSLA 1Q8IA 3IN5A 1E6VA 3KK2B 2HRUA 2E9ZA 1XK8A 4Q43A 1JLAA 3N6NA 4M8LA 1VQSA 3OFEA 4Q5VA 3HHKA 2PMZD 1KR4A 3KJVB 2GHVC 5LJ5Y 3QO9A 1JNZB 4B9SA 5CHCB 4Y0FA 3LWLA 5L1JA 1S1WA 5DM7Q 1X9MA 2QEXS 1X4GA 2KZMA 3PHEA 1Q16B 4LSLA 3DU5A 3KHRA 1V3ZA 5KFUA 3M05A 1CC7A 4JI5F 2CZ4A 4B3OB 2DH9A 2MKHA 3DLGA 1ZPWX 4KHPF 3T19A 1Z4UA 1YI2S 2RQ4A 1ZPVA 2QLXA 2HPUA 2RF2A 1VK8A 4IH7A 4K4TA 4KT0C 2R7WA 1FNMA 3TP2A 1Z2LA 2VKRA 3UNGC 4PG7A 3K5OA 1AXQA 4F67A 1V6HA 2QO3A 2GGPA 2PDAA 5KFRA 2B9WA 3EXCX 1HNIA 3BN4A 5KG5A 2OFHX 3G96A 1N8RT 4OZJA 1HNVA 2MGZB 3HHDA 1XTZA 4R5PA 2CPEA 1FJGF 3E3XA 3MM7A 3O8WA 3MR2A 2MMYA 2DHGA 5KFHA 3FRZA 5LSLA 1QE1B 4IDKA 5KOXA 2BW2A 2CPIA 3LPYA 3LP2A 1CLFA 2C2DA 1RT7B 2GX8A 2ZH4A 3I87A 2MSTA 2K1RA 1CEZA 2HNZB 2DGOA 1LWFB 2IM1A 3US5A 2JLGA 1C1CA 1DTQA 4NLTA 2CQ0A 4TNOA 5EDWA 3RR8A 3LWMA 1FDBA 1U6FA 2HNDA 2RKIB 2EFVA 5B7WA 2X3GA 3DNCA 4N56A 1VBZA 4PWUA 4EO6A 4ID8A 1OSDA 4K4ZA 3DHXA 5L39A 4F4YA 4CTAB 5T7LA 4AYBD 1IKVB 5C25B 3CD5A 2FHKA 1ZM2A 2M5YA 1R3NA 4CZCA 3NG8A 2EKYA 2F8EX 4YP3A 4QR1A 4RUCA 1TL3A 1TZ0A 2FLOA 3NLCA 2B7CB 3RRHA 3M32B 4I67A 4IG0A 3CC4S 3IRXB 1HWJA 3N9UC 2DR9A 2NR0A 3PFOA 3BREA 1TAUA 3THVA 3R1HA 2HGMA 4P6QA 2UVVA 1VOMA 3GR0A 5CXTA 4NCBA 2KFNA 1GNKA 1TR0A 2QFJA 3G6XA 1WEZA 2FJXA 1HI8A 4O3SA 3Q8QB 1FRXA 2V5HG 3FZBA 4ECTA 2J7WA 2VONA 3UWTA 4BS2A 1IQTA 3HVWA 1QJHA 2AYEA 1OQ3A 2O67A 5H9EJ 2IA0A 1S0MA 4G1IA 1FXDA 1Y0HA 3K7RA 5KG4A 4L72B 2HHWA 3RAXA 1HBNA 5F8LA 3L95X 2Z4PA 4YOEA 2K7KA 1NJYA 4OHVA 4DLGA 2ZNZA 1N5VA 5AXLA 4LF8F 4LFCF 1S9EA 2QRRA 2PIIA 4KAIA 4TU9A 1VQNS 1ZTTA 2LLZA 2E5IA 4KR0B 4JI7F 2W9BB 4WFXA 3IR7B 4OV1A 1YQHA 3VWSA 3QAEA 1HWIA 3D5MA 4KE5A 3O1LA 3NBPB 4I64A 2DCUB 2CJAA 2DHAA 4NLXA 1Q86T 1RT6B 2KYXA 2W4CA 4KIAA 2MKKA 4WXOA 3UR0A 3DN9A 1HBUA 3MHYA 3G6ES 2I2YA 2LA6A 1A7GE 4X4SA 1JJ4A 2UUAF 5DGAA 3FSXA 2VPYB 1W25A 4DX8H 3PR5B 4XDDA 4K4WA 3CJKB 4KRWA 1KOHA 2QV6A 5F9LA 1U2FA 3CD6S 4ZP7A 1NK5A 3G8TA 5IQQA 2W9AA 1CQNA 3IGNA 4IOBA 2EWHA 2IJFA 2JLFA 2P9CA 2AYBA 4B9UA 1S77D 3KLHB 3KOAA 3I0RB 2ROGA 2V4JA 3SCKE 1JJHA 1X0PA 4R5PB 5L9NA 2P5VA 5GVQA 3EPGA 2QA4S 4DFPA 1TL1A 3MR6A 2IM0A 1S6OA 4B17A 4EBDA 2LKZA 2WSFC 5IWAF 2JH3A 2CPDA 3MD1A 3CPWR 5G0RB 1Q81T 4USIA 3CDUA 5HMYA 2G1DA 2C3OA 4MTPA 3SV4A 5LXYA 2CKWA 2J9DE 1IKWB 2V4RA 4NZ7A 3CCQS 2ILYA 5EHHA 3OLAA 2DGTA 2JFDA 3Q2TC 1HHTP 2D3ZA 4R8UB 1U1KA 1RGVA 4Q2LA 1RTHA 4O4RA 2J0WA 2Q66A 1NK6A 2XULA 4RU9A 2L41A 2QZ8A 2BR0A 3OBIA 4WZQA 3V6HA 3J7Z5 1BD6A 3TARA 4M63A 5HMXA 4XAKA 3Q23A 5KFOA 5L38A 3CXCR 5E3AA 3L09A 4O44B 4URQU 1JNRB 3EYZA 4PUOB 4RW9A 3OQ2A 3DLLQ 2W4PA 3PX6A 4FP9A 2KH9A 4TKTA 4GKJF 2ZNYA 2UV8G 5BJRA 3TUZC 4IO9Q 1YIJS 1KQSR 4CCHA 5A8KB 1S6UA 5KT7A 2UV8A 3OR2B 4EFAC 4R0EA 4C8ZA 4FN5A 3T1HF 2AQ4A 1HQUA 3DI6A 1F5AA 4MKAA 1V9OA 3BJYA 3NCRA 1HYSB 2ZH8A