1U6FA

Nmr solution structure of tcubp1, a single rbd-unit from trypanosoma cruzi
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
139
structure length
139
Chain Sequence
MSQIPLVSQYDPYGQTAQLQQLQQQQQQHIPPTQMNPEPDVLRNLMVNYIPTTVDEVQLRQLFERYGPIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNGFNILNKRLKVALAASGHQRPGIAGAVGDGNGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structural Study of TcUBP1, a Single RRM Domain Protein from Trypanosoma cruzi: Contribution of a beta Hairpin to RNA Binding
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Rna binding protein
molecule keywords RNA-binding protein UBP1
total genus 15
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u6fA00
2CQGA 5GADU 2MY7A 2NZ4A 1YI2S 2VOPA 2N82B 1AUDA 2AYMA 3CMAS 2KG1A 1WI8A 2LEAA 5H1SV 1VQ6S 2MGZA 2DGSA 2E5GA 2MZTA 1N8RT 3MOJB 2MQNA 1YWXA 5DM7Q 4ERDA 3VAGA 2K3KA 2RQ4A 4WFNQ 5CA5A 2HZCA 2RVJA 3CUNA 1WHXA 1U1PA 1VBZA 3S01A 1U1NA 2MYFA 2ZJRQ 2KFYA 2X1FA 2VODA 3J7YU 3Q2TC 2RQCA 1WI6A 1WEXA 1KOOA 2DGUA 2HGMA 2DH7A 2DGXA 3IWNC 3TP2A 3VAIA 3MUTP 1M5PC 2V94A 1PO6A 1W2BR 2OTJS 2FHOB 2MZQA 4LJMA 3J7ZT 1YIJS 1HD1A 3P3DA 5CXTA 4IUFA 2BOPA 2DNHA 5GAHU 1D8ZA 2KN4A 3BO2A 1VQ9S 1U6FA 5GMKa 2L9WA 3LPYA 3EGNA 2CPIA 2QEXS 1X4EA 2D3OR 1X4AA 1WWHA 3G71S 3R1LA 1YJ9S 2PE8A 3CCSS 3CCVS 2MB0B 2O3DA 3S6EA 2RRAA 2CQDA 3CCLS 1VQKS 2CQ4A 4WF9Q 5MLCV 2CPEA 3UWTA 1YTYA 2J0QD 3BO3A 2FPHX 1QM9A 1HL6A 3CCJS 2A3JA 1H2UX 3CCMS 2M8DB 4YUDA 4YOEA 1SJFA 2DB1A 2HGLA 2CQ0A 3CCRS 2U1AA 5LJ3Y 1H2VZ 2UP1A 2KU7A 1VQOS 3CULA 2G4BA 2BZ2A 2N3LA 5FJ4A 3UD3P 2L08A 2CPJA 2M0GB 3UCUP 2MQMA 4IOCQ 2RRBA 2DGQA 3ULHA 2CQ1A 3MURP 1FO1A 4CH1A 1JMTA 5CYJA 3DXBA 1DHMA 2DNOA 5GAGU 2DNZA 2I38A 1UFWA 1FJEB 2AYGA 2D9OA 5LXRA 1VQLS 1WF0A 4W90B 1U1LA 2RUGA 2MY8A 2DNNA 1JJ4A 1VQ5S 1M5VC 1L3KA 1N52B 2KHCA 1RK8A 2XS5A 3NNCA 2XS7A 2N3OA 2LMIA 2KXNB 3TO8A 2F3JA 2DHAA 2AYEA 3CF5Q 3SDEA 1M1KT 2JX2A 5JVGQ 2DNYA 3P49B 2MPUA 1XN9A 4CH0S 2DIVA 2X1GA 2MZJA 2NLWA 2OTLS 2D9PA 2VONA 2FC9A 1N54B 1FNXH 1X5OA 2KYXA 4Y00A 1M5KC 4WFAQ 1U1OA 2DO0A 4TU8A 3ZZYA 1N88A 2JVOA 1BY9A 2RT3A 2DGOA 1Q81T 2HGNA 4F25A 3CCES 4IOAQ 2DNPA 2MJUA 3MUMP 2DIUA 1VQNS 2QFJA 1YJWS 1S72S 1SJ3P 2MMYA 1X4HA 3N9UC 4LIRA 4C0OC 2YKAA 3S8SA 3G6ES 3U1MA 2DNMA 2MZRA 2CPDA 1QVFR 3H2VE 5LSLA 5ITHA 2FC8A 3THPA 2CPFA 2F9DA 2DNLA 2L41A 5IM0A 2KH9A 1U1RA 1URNA 2M52A 2XNRA 3G8TA 3EGZA 1U6BA 2OSRA 2KRBA 3NNHA 3MD1A 3VF0B 1U1QA 2MKIA 4PRFA 5LXYA 2DGVA 1U1MA 1WG1A 3VAHA 1VQ7S 2ADBA 5DDPC 2ZJPQ 3CMES 2CPZA 1M90T 1RKJA 2MQLA 1VBXA 1K73T 5LSOA 2LEBA 2HVZA 3PIOQ 1VQMS 2M8HA 1NJIT 1DRZA 2DITA 4OZ0A 1F9FA 1P27B 2M2BA 5DDOC 3R27A 1DZ5A 1SJQA 2LCWA 2AD9A 2KG0A 1WHYA 1ZH5A 3LQVA 1VC5A 2KM8C 1UW4A 5HL7Q 2OSQA 3U1LA 2HYIB 2CPHA 2ZJQQ 2CQPA 1X4FA 4J5OA 2CQIA 2J8AA 3IRWP 3I55S 2KXFA 2YH1A 2GHPA 4W92B 3OW2R 2KM8B 4ED5A 1X5SA 1FHTA 2KVIA 4UQTA 3L3CA 2KXHA 4FXVA 1KQSR 1VC6A 2KT5A 1UP1A 2M9KA 1SJ4P 1WG4A 2LYVA 2M88A 1KD1T 1CVJA 2MSTA 2MKHA 2MQOA 2Q79A 1ZZNA 2ADCA 4QQBA 2X1BA 3CCUS 1YITS 1WHVA 2X1AA 1OPIA 2E5JA 2DH9A 3R1HA 3H2UB 2MKKA 3G8SA 2EK1A 5IQQA 2KI2A 1U1KA 1FXLA 2DNKA 1A9NB 2G1DA 2EVZA 3MXHP 4RU2A 4Z2XA 3CD6S 3RW6A 1QVGR 3VAJA 5IFMA 1X4CA 2J0SD 1Q86T 2YWKA 3V4MA 3CCQS 4PR6A 1D9AA 4A8XA 3RW7A 1OO0B 1R8HA 1WELA 3BEGB 3VAFA 3JB9k 3G9CA 1SJRA 2MSSA 1X0FA 2LECA 2OIHA 4C7QA 2XS2A 4TU9A 3CC2S 2OJ3A 2DNRA 1G2EA 1NO8A 2MGZB 2LXUA 3SXLA 2YH0A 2K8GA 4WKRA 1WF1A 3NMRA 3I56S 1IQTA 4TLQA 3G4SS 4PKDB 4WFBQ 4V19X 2DHGA 3VAMA 3HI9A 3D2WA 1WTBA 2CQ3A 2DHSA 3PIPQ 4QU6A 2LA4A 2VOOA 1X4GA 5GAEU 4TU7A 3CPWR 3P6YC 2RS2A 1H2TZ 2AYBA 4QU7A 2MKCA 1SXLA 2JRSA 2XB2D 1A7GE 1OIAA 3K0JA 2MZSA 1ZZFA 1UAWA 2DK2A 3UE2A 3UD4P 1JJHA 2F9JA 1JJ2R 4C4WA 1M5OC 4F02A 4M5DB 3NS5A 1X4DA 1B7FA 2DH8A 1DBDA 5DETA 2CQCA 1P1TA 2DHXA 2CQBA 2RS8A 1OWXA 3B4MA 4CIOA 1VQPS 3ZZZA 2QA4S 3SDEB 5HO4A 3CC7S 2CPXA 2MQQA 1KOHA 2E5IA 3VALA 1VQ8S 2WBRA 2E5HA 2EK6A 1S79A 2RNEA 2M4MA 5DDRC 4FXWA 2I2YA 5GVQA 4OZ1A 3HHNB 1WG5A 5BJRA 4Y0FA 2DNQA 2CQHA 3MUVP 1R8PA 1K9MT 2JWNA 5D78A 2MZ1A 1X4BA 4UY8T 5DM6Q 3P5TL 4WCEQ 3FEXB 1VC0A 5D77A 1PGZA 2MQPA 5IM0B 2LKZA 1VBYA 5LJ5Y 2J76E 1HA1A 3THTA 3UCGA 3S7RA 2E44A 1FT8A 2MKSA 1YJNS 3G96A 4QPTA 1WF2A 4ZKAA 4WIIA 2RU3A 2DNGA 2M70A 3SMZA 3EX7B 2DGWA 2KRRA 1H6KX 2U2FA 2MXYA 2XNQA 3Q2SC 3NS6A 2LA6A 4P6QA 2DISA 3FEYB 4LMZA 2N7CA 1Q7YT 4EGLA 1O0PA 1WHWA 4YB1P 3MI7X 1Q82T 1HD0A 1NU4A 3BS9A 1KC8T 2YTCA 4U67Q 3CC4S 3UCZP 2ERRA 3CTRA 3BO4A 1U2FA 4CQ1A 1K8AT 1WEZA 1WEYA 2G0CA 2FY1A 2CJKA 2LXIA 2MHNA 3NNAA 1X5TA 3TYTA 2SXLA 5EN1A 2PEHA 3MDFA 5JVHQ 4IO9Q 2JVRA 1VQ4S 3B4DA 1YHQS 2CPYA 1FJ7A 2GO9A 1X5PA 4F26A 2M7SA 3US5A 2DO4A 2MJNA 3CXCR 2CQ2A 3DLLQ 3MD3A 5DDQC 4BS2A 2LQ5A 3VAKA 1FJCA 2B0GA 2DGTA 2MKJA 2XSFA
chains in the Genus database with same CATH superfamily
5KFCA 8ATCB 3AT1B 3CNQP 4ZVRB 4JV5F 1SL0A 2HHHJ 3W9IA 2FDNA 3DKDA 3VVUA 4QIGA 1HNZJ 4IR1A 2JEIA 1AUDA 2AYMA 2VFSA 1FKOB 1JLQB 2EFVA 2KVQE 4DX6A 4OX9J 2UV8G 5DG9A 2V0NA 4X84A 4X4OA 1WI8A 1Y00A 2J9DA 2E7XA 5J1EA 2HNDB 2BXJA 1KTVA 4LRFA 3MPUB 4K2XA 4NX9A 4ZPAA 1VQ6S 2VDIA 1U2CA 5K14A 3JTPA 4W98A 2VC0A 3PYGA 3MOJB 2MQNA 2V69A 4ZVHA 4EBDA 1TU0B 1RT3B 2OPPB 1R7IA 4MK8A 1TKTB 4YY3J 3F73A 3TRGA 3N01A 1DQAA 1H7XA 1X9WA 2P9EA 3HSDA 3O6QA 4XPEA 1K44A 2WW8A 2HBRB 2V2VA 4JI4J 2XMJA 4KBIA 3T1YJ 5CA5A 4DV2J 1T3OA 1S57A 3OFEA 2LFVA 2ZD1B 4HH1A 2F5GA 4CLZA 3OL8A 4EBEA 1T3NA 1UJ5A 5T7LA 1FDNA 3KNAA 1IBMJ 4F7VA 2WSEC 1S76D 3DI6A 2QN6B 2PC6A 3GG0A 3KLEA 2KFYA 1UVJA 1Y4ZB 3TQ1A 3NEKA 1QLNA 1TELA 1LXNA 3NL0A 2HWIA 4OJ3A 3Q2TC 2QX0A 2JHEA 1WI6A 2DJWA 3PO5A 2QRRA 3BSNA 3HJFA 4M63A 3VCDA 1VQYA 1AA1B 2GW8A 1OS5A 4B9LA 3WIVA 4K50A 3H4BA 2V4JA 2W8LA 2HBYB 1VRQC 2FJAB 2V8VA 2VPXB 4DV1F 4HYKA 3DN9A 1PO6A 2LQ9A 1W2BR 1FRLA 4U95A 4FS1A 2YNIB 3FFIB 4F4AA 5GADI 1SQEA 1MNEA 2MZQA 2G0JA 4LJMA 4OZ2A 1YIJS 2HMIB 1HD1A 1NAQA 3QRQA 2RQKA 4MYUA 3LW5C 2BOPA 2DNHA 3Q23A 4J9LA 2QMUB 1NH8A 1RHRB 1IN0A 3LAMA 3JYTB 4QZVB 3W3SA 2KN4A 5E5NA 4K4VA 2V4QA 3K59A 4JI8J 4LVOP 5D3GB 3LPYA 2ASLA 2EC0A 4YS2A 3IC1A 4EBCA 2BW7A 1X4AA 1ZM9A 3TOQA 3KDNA 5KG2A 3G71S 3J7AN 2MB0B 5IZHA 1APSA 1RAGB 3AH6A 4ANEA 1WOPA 4DQSA 1VHIA 5H9FK 1EETB 2HAIA 3CCLS 4ILRA 1H7WA 1OQ3A 2B9XA 2BOAA 5C7PA 5MLCV 4J9QA 3GSIA 1VJQA 1IJFB 2W2NP 2FPHX 4O23A 3UVJA 1X0PA 3ZC4A 1D1UA 1TTHB 2VFVA 3EXCX 3HHKA 2A1BA 3BR8A 2M8DB 3MAHA 2HVIA 4USMA 4OX7A 4YFUA 4YOEA 4ZLJA 1TMJA 2HGLA 1FDDA 4ZVPB 4GO5X 2CQ0A 3IRXA 3W1YC 2X3GA 3MMCA 5LJ3Y 1H2VZ 3CCRS 1D8YA 2UP1A 3GB0A 1UJ4A 3CULA 2DT9A 3DLBA 2H1YA 1GXTA 4QYRA 5D0HA 4BC7A 4TQRA 4DUZJ 2G4BA 3PW7A 1HBOB 1FD8A 2N3LA 2LEPA 3HVTB 4M95A 1FFGB 5G0RB 1SQFA 4Z37A 5ADZA 5A2QU 4IOCQ 4Z7YA 3HCXA 3ULHA 3UCUP 3KFWX 3QO9A 4DR3F 4JOUA 3KXDA 5DRKA 3DXBA 3WC2A 1RQ0A 2AX0A 1Y9OA 4JV5J 4A48A 3M30B 3Q8YA 1PKUA 1VI7A 4JUZA 2HHUA 2UUAF 2B9YA 3KUGA 3G6XA 1WF0A 2RDIA 3PHEA 3KJVB 3HXMA 2NXUA 2RUGA 2MY8A 2D3O1 2YVSA 1VGYA 4JV1A 3I5AA 2AJFE 4MTPA 2KHCA 1RK8A 2XS5A 1C1CB 2OMLA 2YKPA 4F2SA 1LWFA 3NNCA 4B3RJ 1UETA 4USHA 2H5JB 3GV7B 1H73A 2GGPB 4NZ0A 4ECXA 1S7HA 4JB8B 4KB7A 4QW8A 1UVIA 2KXNB 3KJQB 3TO8A 2YKMA 1SUQB 4K59A 4ECTA 2DHAA 3QMQA 4I2QB 2K3IA 1NKBA 2XEXA 4RX6A 4DR4F 2AYEA 2IY5B 1LWCA 3NMAA 1FNOA 2NXCA 2WSCC 3BYPA 3IXQA 3ISZA 3NCQA 4G1QB 3HMJG 3KDOA 1NCLA 4CTAA 4H4OA 2W2PP 3M2UA 4RW4B 4DMZA 1J5OB 3OR1A 2IBKA 1TKXB 2W7OA 3Q24A 4PWDB 3DRRA 4ZHRA 1ZM3A 1MWZA 5FDLB 2NYHA 5DQHA 1LW2B 4ECSA 3H98A 1MWQA 1RTJA 3MR3A 1XC9A 2KZZA 2KB2A 3TZZA 3VVTA 4I6WA 1XMQJ 2RDDA 1N54B 3PJ9A 4X66J 3HP6A 4RL1A 1S1XA 3W61A 1J5EJ 4QJVA 2PMHA 3DLKB 2QA2A 3OTDA 3Q8UA 1B0VA 4Y00A 3KLGB 5DLFA 1M5KC 4NRUA 4C6AA 1KS2A 1JLFA 3DU5A 3QJLA 1UWAA 1Q7LB 4IG3A 5A8KA 3GJTB 2X3DA 3IO1A 1OPZA 2AV5A 1BY9A 2JVOA 3MCMA 4M5MA 2E5LF 4ZVQB 2HGNA 1KKHA 3H5SA 1IBLJ 3HO1A 2EBEA 1SC4B 1XTZA 1S72S 4ICLB 4MKBA 4UOHA 2E66A 2MMYA 3MHYA 5IT4A 4JI1F 4FN5A 4Q44A 1CQNA 1EP4B 2GAGC 4LBIA 1D0EA 1MMLA 4ZVSB 2E7VA 2GNKA 3FKBA 4N5SA 2IRYA 2DNMA 3M9MB 2ZNZA 2HWHA 2XLJA 1D9FA 2HQ3A 1RT2B 4DR1J 2FC8A 2CPFA 4H54A 3V6JA 2CJBA 4MKVA 2F9DA 2ZKTA 4KFBA 5F9NA 2C2EA 4DUYF 2WCXA 1TKZA 3EYZA 4JI4F 3AXMA 3AOBA 2B43A 2O66A 2ZEJA 4PXCA 1KONA 5EWEA 1K0TA 3E2EA 3G8TA 2J7WA 3EGZA 1KVIA 3AOCA 3DXSX 3GR1A 3MEKA 2EFOA 4M1KA 1U6BA 4KGZB 1T9TA 4P73A 3TX0A 4IR9A 3MD1A 2V2QA 3DHWC 1RAFB 3NNHA 1U1QA 2HRYA 4CO3A 2DEIA 2GVDA 2OPSA 3VQSA 1WC4A 2CZ9A 2GIRA 4OHXA 2DKOB 3VAHA 4JI5J 1S48A 4R5PA 2QSWA 4U96A 1N5TA 3EUNA 3D1OA 2B4UA 2HKEA 3MEDB 4TVAB 1PIEA 3JSRA 1ZM4A 2R4FA 1C0TB 3HPOA 2RKIB 2PI4A 2CPZA 1V5IB 4F4YA 2XMVA 1RKJA 4H4KA 3G82A 2BUNA 4OYIA 3JQJA 4ATNA 2H48B 2HVZA 3JS9A 5GMEA 1K73T 2E9RX 3KOAA 4JI6J 2O1PA 1VQMS 1NJIT 4QIEA 1LK5A 3TUJC 1FKAF 3HX9A 1N0VC 2QMXA 2DITA 2VG7B 4P2MA 2JEFA 4OZ0A 1F60B 3AB4B 4LR7A 2BRKA 1P27B 1YBAA 3GTYX 3QFHA 2PMWA 2K7JA 4Q2MA 5DDOC 3R27A 4ZCLA 2ZH4A 3ISND 2E1MC 2LCWA 1LWEA 3PJXA 2AD9A 1X9SA 4JI8F 1DZ5A 4OI4A 2KG0A 3C6UA 2ZITA 3DOLB 2ALZA 2AU0A 1XR7A 1WHYA 1Z4UA 3LQVA 3M4XA 2HHWA 1FFWB 5KFRA 1S1VB 4M5KA 4DZ6A 1SJ1A 2ACYA 3RR7A 2OSQA 5HP1B 1AFIA 4L3KA 2FB0A 1ZAWA 1PAUB 3C6TB 1OY9A 2CPHA 3MM6B 4XK8C 5F0WA 3A8KA 4MIWA 4PG6A 4YHHJ 2ZJQQ 2CQIA 1UZHA 2J8AA 2KKHA 4CLFA 3IRWP 4GC7A 3HHLB 3TAPA 2HHHF 2OPQA 3W9HA 2GZOA 1Y5LB 3UR0A 3I55S 1N5QA 3FBFA 2GHPA 3G87A 3MMJA 2J8SA 3BKUA 3OW2R 4NPOA 2ZOFA 2A18A 3M2VA 2R2RA 4B08A 2F63A 3W5YA 2KVIA 2JSXA 4UQTA 5KFFA 3UDCA 4MFBB 2RDJA 3R5GA 4LFCF 4DF8A 4HHJA 4O3RA 3W5ZA 4Z7CA 4X4UA 2PSZA 3BSCA 4CO2A 1SJ4P 1FTCA 3CJTA 2QYGA 4FVCA 5LSRA 4I6AA 1S59A 2WZ1A 4LR9A 4RUBA 4DL3A 1DTTB 4EEYA 5AJ3J 5K5MA 3RYLA 1HBMA 2VB6A 2RHQB 2YNFB 3M05A 1ZZNA 3OQ2A 2KFNA 2ZVSA 1WHVA 2ZBPA 2UUAJ 2H5IB 2XC9A 3AY0A 4CNYA 4YEAA 1HQEB 1CJVA 3EVMA 3H2UB 3C15B 3N6LA 1IKWB 3WZ0A 3G8SA 2X7IA 2E9ZA 5IQQA 2CNOB 2KI2A 2OGUA 4NEYA 4DN9A 5IT0A 2G13A 2ACMA 2R8IA 5HVGA 3H25A 1A9NB 2EVZA 2R8KA 2VC1A 2W9CB 1OMSA 3D67A 4B17A 1RJJA 4MT1A 1EB0A 2E7WA 4ECQA 2QL9B 1QVGR 2MLYA 2GA7A 1AB8A 4ECUA 1Q86T 1RP5A 3CSKA 4W4MA 3V4MA 3E8OA 4A8XA 1JLBB 2XMKA 1T9UA 3R7NB 2QLJB 1OO0B 1SI9A 3BEGB 5D4NA 3RBZA 2BKOA 3M8PA 3PX6A 4A47A 4JI5F 2DBBA 1LFPA 3SQOP 1X0FA 1NB7A 1O8BA 4RW8B 2HFSA 3HVAA 3TAMB 4PG5A 2OIHA 3AA9A 6FDRA 2XZWA 2DVIA 3EVOA 2QA4G 3CO0P 5KFKA 2P6TA 2ZH8A 3A3PB 5J2NA 2J9EA 3OL9A 3GYXB 3MMBA 3SXLA 2CRLA 5GMDA 3C46A 4WKRA 1U26A 3Q89A 1UEUA 4UZCA 4DV4J 3DLGA 2BKNA 3LGHA 4USIA 4AUKA 3UPFA 1BXNA 5HROB 4QBUA 4ZVOB 3I56S 3N0VA 1DQ9A 2OKQA 4OLPA 4OYOA 1U4BA 4CO5A 4P2SA 2VA3A 1DTQA 3BPDA 3DLEA 1FDAA 5KG1A 2DPIA 4I2PB 2ZKUA 1L3SA 1FVQA 2DHGA 1P9YA 4K2JA 2LQBA 3K57A 2QIFA 3SSSA 4JI3F 4A8MP 1TL7B 1KHWA 2LA4A 3NAIA 1DLOB 1HBNB 1FKPA 2J6TA 2VOOA 4GKKF 1F2GA 1RTHB 2ROPA 5E3AA 3RU0A 2WVCA 3MPYA 3QBCA 3MM5A 1U2RA 1NDPA 4QR0A 4WP8A 2BA9A 1OY6A 4ZOSA 4ZP6A 2WOMA 1FEHA 1I51B 1OIAA 2MZSA 2WHOA 4CO4A 3UW1A 3OVAA 2BR0A 1FX4A 1TVRB 4I6YA 2XSJB 3UD4P 3M2RB 3I4PA 1WUUA 1BQMA 4M94A 1REVA 3K58A 1HQUA 3DOKB 3R7BB 1RAOA 2QL5B 3MEEB 2LLZA 4C4WA 3TX8A 3GPAA 1HLWA 3LO3A 4OI3A 2VBZA 3NS5A 2CJXB 4S0MA 2C28A 2PI5A 1N36F 2UUBF 2Z4PA 4DR6J 3CJKA 1ZS6A 3M8QA 1B7FA 2YKNA 4USKA 1IKYB 1DJ0A 1YZ7A 5FLXU 3I9V9 3EICA 3FCVA 3B4MA 4A46A 2ZBCA 2OP5A 4NRTA 4ELUA 3DRPB 4PQUB 2QA4S 3DOMB 3KHRA 2FJVA 2NPIA 3PEHA 4EZ9A 1RTZA 3OVBA 2MQQA 2IAJB 3T6BA 2QC3A 2ZOMA 4DEZA 1AYEA 1S6QB 3BN7A 3J80U 3PKYA 5C42B 3MMAB 3G6VA 2EK6A 4CYUB 2VJVA 2BE9B 3OR2B 1RLDA 2Z57B 4FXWA 1S49A 1W7WA 4B9MA 3WHIA 4NYZA 1ELOA 1LW0A 4LFCJ 1MW7A 4OJGA 2AMCB 5ETRA 5BJRA 1B0PA 1S1UB 4Y0FA 3DFEA 3T1YF 2IM2A 1DY3A 1PJ6A 2WB1D 3CIMA 2VFTA 5LMUJ 3MUVP 2B5JB 1R8PA 1R0AB 2JWNA 4FZVA 2HVEA 1X4BA 4X65F 4AD6A 4EWTA 2GVZA 4UY8T 2ATCB 3A12A 4OZNA 4ED8A 3U1NA 2NXNA 4DSJA 1FJGF 2B56A 7AT1B 5HQLA 1Q5VA 1B7YB 3K8VA 4AE5A 1G3OA 1FT8A 3B82A 3NGSA 3SCKE 2MKSA 3D28A 1YLXA 3FCWA 2J9CA 4Q0BA 2NUUG 1WF2A 4WIIA 2AGQA 3DDKA 1YX2A 2KYZA 5AXLA 2R7TA 2HFOA 2D7SA 2WVDA 4B9NA 3AJ2A 2BJ7A 4USTA 5D15A 4C8NA 5BYSA 4KGMA 3UR3C 1GMVA 1U7LA 2D69A 2E29A 4PXEA 1P9QC 2NPFA 4LIWA 3GIKA 2KT3A 5ETSA 4K4XA 3LP2B 4AQYF 1NB2A 2YXLA 3MECA 4WXOA 2Z0GA 5DZ6A 4CYUA 1I94F 4ZCMA 5C42A 1X60A 5DG8A 4LMZA 1S6QA 1Q7YT 4EGLA 5I3QA 2UXCF 4PG8A 1F5AA 1O0PA 1WHWA 5IS2A 2IIHA 1IQZA 2EXUA 4NLSA 1YJTA 1FK9B 3AJDA 3DOMA 1NJYA 2DD8S 4PQUA 1FWLA 1HNVB 5HK4A 2HNZB 2OELA 1RWPB 3WX4A 2V6AA 5F3ZA 1WEYA 2B6AA 2NXEA 4YB6A 1R27B 2YNHB 2CYYA 4M5HA 1UWBB 2WB4A 3WQPA 3OVSA 3NNAA 2JLGA 4NASA 2PIIA 1R3NA 1KHVA 2MHEA 3HHLC 4PPZA 5B0FA 4L72B 2RF2B 5CD4H 2YQ0A 3B4DA 1YHQS 3MEEA 4LF8F 9RUBA 2CPYA 1RAJA 4WK3A 1CLFA 4OJHA 5M2PA 4C8OA 1SQGA 4HACB 3D1HA 3HD2A 2Q3PA 3KTQA 2NREA 2M7SA 2XSJA 1JLAB 2GQ2A 2VQEJ 2HHTA 5CYMB 7FDRA 4ED1A 3DLLQ 3KHLA 1RBAA 4K0KF 5F8JA 2M5YA 3EGWB 5DDQC 3RAXA 3BGRA 3K7RA 1RTHA 5E3PA 2B0GA 4CLYA 4USJC 4WE1B 4B9VA 1CBKA 3VAIA 5B0DA 4I0WA 4PG7A 2KJVA 3DYAA 3MEGA 1KQGB 3R8YA 2VOPA 4DL0C 5CCMA 2RU9A 3H40A 2JOQA 2OFGX 4K5SA 1HWUA 4Q0BB 5HROA 1YG0A 3CMAS 1GX6A 3DLGB 1EJ7L 3NBPA 2JFKA 2LEAA 3QT8A 2FHJD 4KE5A 2DR8A 1RT6A 2Z8QA 3MMBB 2DGSA 3P96A 4PYAA 3W60A 1SKWA 2AKWB 2EFGA 3IWLA 4B02A 2E5GA 1WC0A 2DCLA 2E1AA 2MZTA 3MPWA 4LBHA 1NHUA 1FEEA 5D8HB 5L9XA 1HYSB 4Y34A 3TAMA 1T7PA 2LU2A 1AW0A 4CH7A 3PACA 4DV0F 1YVFA 3W2VB 5AJ3F 3LP1B 4CT8A 4ZPBA 1NK6A 1Q0NA 3NBPB 1YQHA 2NSBA 3BBCA 3R5BA 3UFCX 2BJDA 4AXJA 1ROFA 2RQ4A 2VBXA 2EG1A 3ZZRA 3FRYA 1Q53A 3O5TB 2WTFA 3QSYB 4IRCA 1Q79A 1VK3A 1WHXA 4EYIB 1U1PA 3GP9A 1VBZA 3A8EA 4F04B 4KGXB 2VPYB 4ANDA 4J9OA 1SKRA 5KT3A 2W9CA 4DPXA 1YRXA 2QTWA 2CWXA 2FHMA 2CNLB 2KL8A 2ZE2B 4TN2A 5THWA 3J7YU 4JI2J 2FIUA 3D6MB 2RQCA 2QG9B 1FE4A 4X4QA 1HQEA 1FRIA 4NLOA 4ZLNA 5CYMA 2DH7A 4EO8A 1FA0A 2W9BA 3R6GB 3IWNC 3D1QA 5ETTA 3MUTP 2VKRA 1VIOA 1Y3JA 2V94A 2XI3A 3HSZA 4P52A 2RILA 4LT6A 3SBMA 1UEVA 2KDOA 2WVEA 3DNCA 3MM7B 2OTJS 4X4VA 1TMMA 4YDDB 5K20B 3AODA 2FHOB 2JFDA 4NXNF 2IJNA 3PKMA 5CXTA 4I67A 1YDLA 2VUGA 4ED4A 2ZVIA 4MAKA 4V1Ak 2JH3A 2D74B 2Z56B 3ZTRA 9ATCB 4OZ3A 4KR0B 2FVQA 3G8QA 1D8ZA 3OFFA 1VQ9S 1FD2A 1IUJA 1FK9A 3EGNA 4Q5VA 2D3OR 2ZH6A 1WWHA 3OTOJ 1YJ9S 4LUBA 4FF1A 2I1RA 1SH2A 5LMUF 4I56A 1RTIB 3RGIA 3KKFA 4KPYA 1FRJA 1R8BA 2KJWA 2LDYA 2RRAA 2B7BB 2CQDA 5B0BA 2Z2YB 1C1BA 4WF9Q 1S7IA 2GJFA 4C3MA 2CPEA 3GIMA 3MTJA 4DUTA 2HS3A 1YTYA 1HKAA 1NPPA 2YWWA 3HFVA 4DL7A 2J0QD 1QM9A 4KHRA 2CIMA 4KHPF 1E6VB 1IKXA 2Z2ZA 3TA1A 1SPBP 1V6HA 3NCRA 3CCJS 3SZ2A 4DQRA 3FEZA 3CCMS 2RH3A 1TV6B 1GMWD 4YUDA 2QLFB 3IM9A 1WKJA 2VFUA 1WJ9A 3CDBA 4IDKA 3EE3A 1TP7A 3GYGA 2DB1A 3D4JA 1WORA 3C6UB 4OIXA 4QWDA 4WTOB 5JUMA 2RSQA 2W7AA 1SH3A 4USUA 5KFLA 3D66A 3FSXA 4ZPWR 2XMWA 4ZLPA 4RNMA 3M6WA 2UVUA 5FD1A 3ZXWA 5KFJA 2CPJA 3MCNA 3S1TA 3T1HF 2NXJA 5LM7E 3IR6B 2GX8A 4JI3J 2Z2MA 1FO1A 3MAAB 5A6PA 4CH1A 1XMOF 5CYJA 2J6UA 4LF7F 4WYLA 3I82A 4IH7A 2B8PA 3VGVA 3NOCA 5DQIA 2AYGA 4CLUA 2B5JA 3H7HB 4FYVB 3PM9A 1R0AA 2OLWA 1VQLS 2YKOA 3FRZA 4FXDA 3JAMU 3ILIA 4HHUA 1L3KA 1M5VC 2GHVC 4DI6A 1KNZA 3QGGA 3V2UC 1CJKB 1GNKA 2QLXA 1HNWF 2GVDB 2N3OA 3RBDA 1ZTTA 4RUHA 2GJIA 2LMIA 4LREA 5CYQB 4XIUA 2DCUB 3N6MA 5AXNA 5J2MB 2YX1A 2XZDB 3KLFB 4UQGA 3QAUA 3F56A 2CNKB 1ZAXA 4M5NA 2DNYA 5K8NA 3RTVA 1YRUA 4Q8FA 1IBKF 5LMNJ 2RJZA 1MU2A 3PJWA 3KHGA 4ES1A 1RT2A 1IKYA 3TAQA 4LR8A 1UJ6A 1N5VA 2YKNB 4HDGA 3M8QB 4ZK7M 2FHKA 2OTLS 1ZA2B 2D9PA 2VZ9A 1TL1A 1R0BG 1RTDA 4GC6A 3DOKA 4J7CA 2KYXA 3NXZA 4ZMMA 2UXBF 4WTYA 1ZPVA 2CUYA 2F8HA 1S0NA 3M2RA 3T5LA 3PW5A 2RAQA 5KFGA 5CAAA 2DO0A 4TY9A 1TVRA 2J5AA 3QNWB 4Y3CA 4UOGA 2BABA 4NA1A 3JSMA 3AB2B 2DGOA 1GFWB 4ZPCA 3MM5B 2J0WA 1PBAA 3DRSA 1Y5IB 3DRYA 1JLFB 2MJUA 4XDCA 3FNNA 3MUMP 1VQNS 4M5JA 1D3WA 1V9OA 5HN0A 1C4CA 3VZIA 4NLUA 1S1XB 3N9UC 4DS5A 3EGVA 2YKAA 2R8JA 2E1RA 3RRGA 3PNIA 4J9PA 3G6ES 3LGNA 3N6NA 1UKUA 5F8LA 1PG5B 3U1MA 1DTQB 2MZRA 3DLHA 4YY3F 5FDLA 2DXDA 5HBMA 3MFIA 2CPDA 2E1PA 2ZZTA 3DRRB 3H2VE 5KFZA 3PEJA 3AD9C 3BR9A 3THPA 3OR1B 3HFKA 4RW4A 4H4OB 1J5OA 2E1CA 2L9NA 5F8IA 1TK0A 4W90B 5IM0A 4OLOA 5J2NB 2ZWOA 2ILYA 2XNRA 5EUHA 2HLUA 1NZ8A 4O0IA 5I3UB 3OHBA 2G1HA 2ZWPA 5B0CA 3OUYB 1HHQA 2YKMB 2YPZA 3OLBA 3RB0A 1U47A 4RW8A 2CKWA 2GJ2A 3VF0B 3RR8A 2V63A 2JNJA 2GIFA 2MKIA 3ZZPA 2DGVA 2C2ZB 3D5MA 4ID8A 1YJVA 2FJDB 2V8GA 1JLBA 4FYXB 4NLTA 1WNEA 1VHFA 2NZCA 3BKTA 4FNIA 4CLPA 4NZ6A 1RWVB 1Z1ZA 4ES3A 3KJVA 2VH7A 4OX9F 4DU8A 4B3OA 1U8WA 4WIQA 1KVKA 3CMES 1SVDA 1NDKA 1V5VA 1WC3A 3C3LA 3VHQA 3SIPB 2W4DA 1ULRA 4LSZB 3Q22A 5KT6A 4C9DA 1PSDA 5K8MA 3KK2B 4OL8A 2G0IA 3C66A 4ECYA 1T11A 1YJRA 3OFHA 4CCHA 1MMNA 1DAXA 3C15A 3SSRA 4PABA 4Q45A 1P1LA 1F9FA 3L7UA 2FLNA 3B78A 4MJKA 4NYOA 5T41A 3PXGa 4C48A 2HZVA 2ROEA 1XMOJ 3TEGA 4FYDA 1UMJA 3V6DB 4NOHA 3NWGA 4EZ6A 2XMUA 5HLFA 1DTTA 2K2PA 4P10A 2F4FA 4DZDA 1QAJA 1VC5A 4OMFG 2Q6BA 1NSAA 3A8IA 3H59A 1RAEB 3SQGB 3CIZA 5HL7Q 4DV7F 3OL7A 4O3NA 1T95A 3UVJB 4NLDA 3ZO7A 1L5UA 1RHMB 1SBRA 1CSJA 1HWLA 1PBUA 3M6XA 1VMBA 4ZP7A 1NZAA 4KHPJ 4ZVGA 5AXKA 2KXFA 5DZ7A 1R8CA 1GMUA 1HARA 5KOXA 4OYZA 4ED5A 2I6WA 1FHTA 3ETOA 5EHHA 3L7OA 1NDLA 1Z2ZA 4G3IA 2K06A 3CCWA 3C6TA 3DMJA 2YWGA 4FXVA 5IOLA 4U7UK 3B54A 1KQSR 1OYDA 2OUGA 2KT5A 3QLHB 4NLRA 2EKNA 3A3NB 4RJVA 4TXSA 3CJSA 4Y65A 3J7A1 4JYAF 2LYVA 1DFDA 1Q8KA 2OH2A 1Q8LA 2F8EX 3EXYA 2QFIA 3FFIA 4DL4A 5HJXA 3F44A 3ILLA 3TANA 2MQOA 4ECZA 1SKSA 4OI0A 4QQBA 3J81U 1CQMA 2V4JB 1PAEX 2X1BA 3NLCA 1HIYA 3CCUS 2IPOB 2XGQA 2X1AA 3HDSA 1OPIA 1H3DA 2DH9A 2E5JA 3R1HA 3L09A 2HBQB 2HQGA 4GO7X 4BLGA 2EK1A 3AHPA 2ZC4A 3TI0A 1JNRB 3WIUA 1KLNA 3PTWA 1NK5A 3MXHP 1QSLA 6FD1A 1PILA 1NHKL 2HFZA 2VBYA 3UDEA 3CD6S 2W4PA 3TQEA 1S0OA 2PA3A 1S12A 3TNVA 3BQ1A 2YWFA 3BGOP 2N7YA 3MEDA 1X4CA 2MLXA 2C2KB 2WRMA 1UFLA 1OYEA 2OO4A 2H54B 2YWEA 3I6PA 1GK8A 3PYDA 4R5PB 2H4YB 3CCQS 1BWEA 3L4BC 1R8HA 1WELA 3VAFA 1R31A 4WBFA 1Q8IA 1SJRA 3AD8C 3JB9k 4L76A 5KT7A 2R7QA 1XNQJ 2MSSA 4HKQA 1I94J 1BGXT 3TZYA 3GILA 2H9ZA 5IV3A 4FPIA 2FLOA 1TUWA 4OFZA 5K14B 4K4WA 2GCFA 1L3VA 1U25A 2CZVC 3X1LB 2DYAA 2UZAA 1TKZB 1G2EA 2Y9HA 2IRUA 1OSCA 5J1EB 1B0TA 4GKJF 2WVBA 1FWPA 3QYYA 1JXEA 2D3UA 3VGSA 3NMRA 2OEKA 3ELHA 1IQTA 3N4WA 1RU2A 3DMJB 2XHWA 4PKDB 4CT9A 1JX4A 1BWVA 4V19X 3VV2B 4DFKA 2AHOB 2C1EB 1VLOA 2Z2LA 5DO2A 3W66A 3HI9A 1EP4A 3PHTA 4GMKA 4I64A 4LBPA 1N5SA 1PYTA 4DBQA 3GV8B 1CULB 3GSDA 3PY8A 4ELVA 1B3TA 2ZDOA 2CA9A 1IR0A 1X4GA 1SC3B 2ILZA 2POKA 2V8DA 3NGRA 2FVPA 3NY0A 1SXLA 2JRSA 2ZC3A 2CNNB 1Y10A 5IXUA 5T14A 2R2UA 3K0JA 1ZZFA 4IG3B 3D54A 1AFJA 2GV1A 3BYRA 1U45A 3M9NB 5D0GA 3SQGA 1TR0A 3BSAA 3CGIA 5KFPA 3PW4A 4X4RA 3LWLA 5HLFB 4I4BA 2V67A 3I87A 1RTJB 2ASYA 3V6DA 5KFEA 4Q7AA 1U24A 5H9EK 2KZMA 1Y3KA 2A2DA 1BQNA 2DEJA 2P9CA 2UXBJ 1DBDA 4KO0A 4ZHRB 3FVYA 5KOWA 1TKXA 4F67A 4J9RA 3BDPA 4EK2A 1R43A 2ZFHA 4CIOA 4N41A 1LEOA 4G1QA 1PC5A 3ZZZA 3EZ5A 3SV4A 5HO4A 1OY8A 3UN2A 3FQLA 4YMEA 3KK2A 3JSBA 4ILMA 2FJWA 1KOHA 1VQ8S 3O3LA 3T1AA 1RT1A 2BMBA 4MKAA 1RA6A 5SZTA 2AZ3A 2ASDA 3R2DJ 5KG4A 2E5HA 6AT1B 2E9TA 1S79A 5I42B 5LT5A 2X51A 4EU0A 1RZMA 5DDRC 1LWFB 3UNGC 3UQSA 2XCAA 3OSNA 3POTA 1MROA 3ILJA 3POTB 2I2YA 3CJRA 3P4UB 1WG5A 1FDBA 1Y5NB 3BH7B 2DNQA 3FQKA 3RRHA 2CQHA 1NHVA 4ED7A 1IXKA 3F41A 1UA1A 3M30A 4HL9A 4LF9J 1RAAB 4RKUC 3GV5B 2FJXA 2VJUA 3P45B 4UOFA 1TUGB 3W9JA 2XULA 2YY3A 5I3UA 2P9GA 1VC0A 1G7CB 4FP9A 4RNHA 2HK2A 2ZH7A 4DV7J 5D77A 4JI2F 3NGKA 4HDHA 5IM0B 4DPYA 5G0RA 2LKZA 4URQU 4N76A 3U02A 3LOUA 2J76E 4Y2MA 1VBYA 1WD6A 1HA1A 3THTA 3CD7A 1UW9A 4OI1A 3S7RA 4P2FA 4WFXA 1C2PA 1RCXB 1NJWA 4J91A 2UVVA 4QPTA 4DSKA 2RU3A 3KMSA 1RGVA 2DNGA 4DCPB 1XNRJ 2VKZG 3SMZA 1S1WB 2HRUA 3BM7A 2VG5A 3C14B 5B08A 1S6PB 1T9WA 3EX7B 2R2SA 2XGPA 4LFBJ 2UUCJ 3D6HB 3A4TA 2MXYA 2HSEB 2Y1RI 5HMYA 1SC6A 1TK5A 4K4ZA 3DRSB 3QQCD 2F65A 3PW0A 3JSMB 2FVSA 3R5AA 2BEFA 3NS6A 1XNQF 2LA6A 2DR5A 2P2CB 3AA8A 3K89A 2DISA 1WDDA 4P6QA 3Q8PB 3PG9A 2WBMA 3N5FA 4LF7J 1JLGA 3RRKA 2N7CA 3KHHA 2Y0SD 5ETNA 2CFXA 2A0FB 3MPVA 3HLUA 4ZPDA 1HD0A 1NU4A 4RO0A 3MPDA 1R6VA 2GMLA 4RW9A 1QSYA 1TL1B 3QGPA 5I4MA 3TJAA 3CC4S 3P6YC 3UCZP 4E2FB 2ERRA 2P6SA 3G6YA 2VPWB 4CQ1A 5M2RA 2G0CA 3UO0A 1MN7A 2AGOA 3NCPA 4URGA 1KWMA 3D6FB 3RAQA 3ILOA 4Y6IA 4C8YA 1MU2B 2CWKA 2V9WA 3K8WA 4CRJA 3M7VA 5EN1A 2PEHA 3MOZA 1T94A 2JVRA 1NDCA 3BH6B 3IWXA 5K9FA 4A8SA 2YNIA 1RDRA 5KFVA 1GMWA 3CW2C 3OPKA 1HW8A 1VS3A 3WX8A 3KLFA 1Q5YA 5IC6B 4B3TF 2HW3A 1U09A 1PYOB 1X5PA 1VIXA 1FJ7A 2EFPA 4F0HA 1C0UB 4N56A 4ED6A 4ETZA 3ITHB 4A4JA 3QIPB 4HTJA 8AT1B 2A2CA 4BHQA 2VF3A 1XERA 2LQ5A 1W2IA 5CH7B 1F5CA 1GAOA 2PGCA 4AL5A 2RE1A 2ZHBA 3CJ2A 2CDQA 4CO1A 5D6GA 3KYLA 1KP6A 3Q8SB 5CZVA 2DGTA 2QLWA 4KC5A 5DLGA 1QAIA 2BE2A 5L1IA 4P7TA 3DI6B 3O8WA 4PXDA 4U6PA 3THVA 1D9DA 1ZPWX 5H1SV 2XBPA 1N48A 4DWIA 2NZ4A 2MY7A 4DR2J 4PUOA 1IBCB 3IGVA 3AAWB 2FD2A 2XI2A 1V3SA 2E5LJ 1YBTA 2ZOGA 4IFVA 4NLWA 3OSPA 2R7XA 2O5DA 4NYPA 3EPGA 2DY9A 3G2XA 3TARA 1RAHB 1F3FA 2MGZA 5J2QB 3ZZ0A 1RYSA 2LQJA 3C8YA 4IRKA 2C2RA 1RT3A 4QIWD 2CG4A 3R2CJ 4QYZJ 2G2OA 3OLAA 4ECRA 4OI2A 5A0YB 2AEJA 3OXGA 3SFGA 4IDKB 4DR4J 2ZBRA 5DM7Q 1IWGA 5CD4A 1SH0A 3BJYA 2ZUGA 5HJYA 4OHWA 3TVYA 1HR0F 3BBBA 1IKXB 1E6VA 4CWBA 4K7QA 4HTIA 1NXIA 3VAGA 4ERDA 2JZ5A 2RD5C 3QLHA 1UEKA 2RMLA 4C98A 1FKOA 3JQMA 3TWZA 1NSKL 2RVJA 3TZXA 1N33F 3M32B 4A8WA 4LQ3A 3NKYA 4B3MJ 2XZTB 3ONQA 4O4GA 3QATA 3S01A 1BE4A 3MCSA 3HHDA 4MIAA 1KN6A 1CJTB 2MYFA 2V34A 1RTIA 2JL9A 2G2ZA 5L9NA 3GR0A 1W26A 5KG5A 4DFMA 4DR7J 2G9OA 3FK4A 4UZBA 1O5JA 1TQLA 3IM8A 1N6QB 2GFFA 4ETXA 2H4WB 1KOOA 3GFYA 3FZ2A 2HFUA 4DX5A 4F4ZA 2R7SA 4DPUA 3M8RA 3CT9A 4RW7B 3NOGA 4ZS6A 3K5LA 3RB6A 1UVKA 2C42A 4ZVFA 5KFBA 1K0VA 4KT0C 3KLVA 3BDEA 3BF4A 3M8ZA 1M5PC 4DQIA 1F9EB 4E98A 3J81j 3FDSA 4LFAF 5BYRA 5DS7A 2IDEA 3T9ZA 3J7ZT 1T03A 5F8NA 4JYAJ 3P3DA 1QDUB 3CCTA 1N34F 4ZPVR 3ZNJ1 4IUFA 1FERA 1KLMA 3RBXA 2EBGA 4RWWA 4ZJOA 3UNYA 2EWHA 3EMTA 4LF2A 3L9ZA 3PFOA 4NLXA 3U27A 4EUVA 1JIHA 4DR1F 3WBZA 4U9RA 4IO1A 4QIFA 2NS1B 4P72A 2CPIA 1SB6A 3GQCA 2AZ1A 2LU1A 4C97A 5A76A 2BM0A 2PE8A 3CCSS 2MTLA 3R1LA 3LGMA 3I96A 3NGUA 3IG1B 3TUIC 4USVA 4X65J 1VQKS 4B3OB 2HVHA 3FCHA 4OYBA 3UWTA 2J6SA 4O0NA 1TFWA 1VFJA 2V4RA 2GIQA 2R7RA 1VCTA 1FCAA 4WFZA 3BO3A 5E3RA 3RZAA 4HR2A 2ABYA 3LP1A 4FDFA 1H2UX 5IV4A 4YP3A 1NH7A 2AF6A 3L7PA 3CCES 2Y8YA 1RE1B 3ENQA 1SJFA 3D68A 3K5PA 1HWJA 2PMZD 1HYSA 1L3UA 3OUYA 1UCNA 2H65B 2U1AA 4KTQA 2KU7A 3IBFB 2W2MP 3R7SB 1NM2A 1VQOS 1XNRF 5BR8J 5HMZA 1TL5A 4WP9A 5EX3A 2ZH5A 1IKVA 4YR3A 1ZTWA 3CDEA 5HVFA 5F8HA 1RT4B 2L08A 2UUBJ 3EDQB 2MQMA 4OJ1A 4TNOA 3QJJA 5HBMB 3DDIA 4NLQA 2CQ1A 3W64A 5B09A 4HEA9 4LSNB 4P74A 1HBUB 3KLHB 3UDVA 3F0NA 1QJHA 4QOTA 1DHMA 2IHR1 4OHYA 1FTRA 3DYAB 3MEGB 2XYHB 2I38A 1UFKA 2DNZA 4UTGA 4BWMA 2D9OA 3MAQA 3H0PA 1FJEB 4KJIA 3H4DA 4CLLA 2IVFB 1U1LA 3PZPA 1V3ZA 1CS4B 4WE1A 1VQ5S 3LA0A 3SCIE 4X4TA 3J7YI 1BLUA 1N52B 4KGKA 1T05B 3QGHA 2FTRA 4ZIWA 4M5GA 3MM9B 2BJ3A 2HG4A 2O01C 2V50A 2XS7A 1FRMA 4F4KA 3IBWA 3W2WA 2F3JA 4IFYA 4HACA 5CQGA 4N8NA 5EWFA 1MMDA 3K5OA 3SCLE 1LOUA 4K4UA 3CF5Q 1XBWA 3BREA 3FZBA 3LF0A 1M1KT 4HT7A 1RTDB 2RF2A 1K1SA 5JVGQ 4LF4F 1QUPA 1R6YA 2D1CA 2EFQA 1FE0A 4IOBA 4DL6A 2MPUA 1XN9A 2AEMA 2X1GA 1T8EA 5L8RC 2MZJA 1TKDA 1JKHB 2B6AB 2C3MA 1Z2LA 4I69A 4K5RA 4WU2A 5KFHA 4MKYA 3GMGA 4LVNP 4RNOA 3HF5A 1U0HB 1Y7PA 2HNZA 2IC3A 1HNVA 2VV5A 4M5DA 3Q86A 4RBVA 1KQFB 2ZH9A 1FNXH 1X5OA 2KFZA 5J1NA 4PWUA 3R3TA 4OZ5A 2HS4A 5I3PA 4YQWA 2CJAA 3I0RB 2IVMA 4WFAQ 5J2MA 3ET6B 5CYQA 1TUVA 2OPRA 3IGNA 1HI0P 3HHEA 4WFYA 3MECB 1N88A 4WP3A 4G1PA 3ZZYA 1CJKA 4DV3J 1F2HA 1JQGA 4I7FB 3VGUA 2PEBA 5B0EA 4F25A 1VQSA 4IOAQ 2DNPA 2XG8A 5C5JA 1K47A 1NK9A 2QFJA 3SSQA 1Q78A 5LOQA 1SJ3P 4PYDA 1WOSA 3TW0A 1X4HA 2IYIA 1NJZA 5J2PA 3NGDA 2BJ9A 2R7WA 1RBLA 1RT7B 1HI1A 3KK3A 4N47A 4J9SA 4X4SA 4NL5A 4DFJA 4OV1A 4ITSA 2IMOA 2G2YA 5FLXY 4IG0A 3MAAA 2IDLA 4L74A 1S9FA 2HPUA 3IAM9 5C24A 3PO4A 4DQPA 2DPJA 1QVFR 3PRBA 2B7CB 4DX8H 1RADB 3IA0A 3HKWA 2AIRB 1URRA 5D4PA 1UL3A 3J81Y 2DNLA 3QSIA 4ZCKA 4AFFA 1S9EB 4MIBA 4YN3B 2KH9A 1U1RA 1URNA 2M52A 2HS0A 2OAUA 4CLWA 3TZWA 2GVZB 3MF5A 3R5DA 5IWAJ 3QJPA 1U02A 3R6LB 1G1XA 2HURA 5EGYA 3ISNC 2C3PA 5D4OA 1RB0A 1AZSA 3K17A 3D9BA 3LP0B 5HMWA 3I5CA 1TV6A 1EAYC 1PJ5A 1S1UA 3BN4A 3HT3A 1UPMB 1VQ7S 2YBVA 5KFQA 3N28A 4UF4A 4IRDA 3CEDA 3OR2A 4MK7A 4YB7A 2FVRA 4ZVUB 1NK7A 1C1BB 2W2OP 3T19A 2IMWP 2AJ2A 3MMAA 3Q83A 1M90T 4A8FA 1VRTB 4R0EA 2DRDA 2MQLA 2BJEA 3I31A 2C3UA 1VBXA 2IAJA 1KR4A 4F3MA 3EM1A 3PX0A 2AP6A 3DRPA 3BPSP 3IBCB 2ZBIA 1PJ7A 3M1VB 3ENWA 4OYPA 1SC1B 2Z58B 2KHDA 3FJ2A 1U8SA 3I9ZA 4HT5A 3T1HJ 4FBTA 2M2BA 1WKKA 1BUXA 4JI0J 4FF3A 3QPIA 3CJKB 1SJQA 4JBCA 3HD1A 2F7VA 3IAS9 5JJBA 2YQ1A 1GTEA 4WU3A 1A6LA 4YDXA 1FX2A 5KT5A 4AXIA 4MK9A 2XCPA 3OTOF 3MM7A 1SV5B 3CB4A 4ZCIA 2XLIA 1BQMB 1FJGJ 1UW4A 1DURA 4FF2A 5U47A 3WC0A 5L46A 2W9BB 4DJBA 2WW4A 4FYYB 3U1LA 4NE9C 3MR2A 2HYIB 2CQPA 1X4FA 1FXRA 2B51A 2FYXA 2ZDPA 4J5OA 5ETLA 5HAOA 3W62A 4NMLA 5L1KA 4B3TJ 4ES2A 1EKRA 1C4AA 4WYWA 4H4MA 4F4XA 4DR2F 4BWJA 3CDAA 4BC9A 1XJWB 2ZE2A 1DLOA 1HBNA 5FIIA 1RWMB 1TL7A 4DV2F 2YH1A 5H9EJ 1KFSA 4NLGA 1RHUB 3MTKA 4O3SA 1DARA 3CJ8A 1GXLA 5KTQA 1X5SA 1RWXB 3E51A 4J9VA 4C3KA 4DQQA 2IA6A 3DLEB 3L3CA 5L1LA 1H98A 3GIRA 3OXFA 4WPAA 4DR7F 3QGIA 4OI6A 3AJ1A 1FRXA 1PCAA 2M9KA 1S9GA 1WG4A 1N34J 3GZ7A 2V8HA 5L1JA 1GXUA 2HIYA 3M8SA 2FQQB 3W2VA 2A6MA 2B8QA 3PYEA 1KD1T 1X9MA 1XMBA 2MKHA 5CCLA 3KLIA 1H74A 3OTCA 5F8GA 3LUYA 2DY1A 3FGVA 2YQ3A 4DV6J 2AGPA 1KRPA 1G6BA 4RW6B 4OX6A 3TVKA 3EVWA 3PFEA 2VBWA 1NUEA 4B3SF 4HHHA 1REGX 1RT6B 2QSFA 1R0CB 2A10A 3HZEA 4KAIA 4DX7A 2R8HA 4B3MF 1JB0C 2Q43A 5KFSA 4EYHB 4DPTA 4JV2A 5G4DA 2N4CA 2YNGB 4O3OA 3ZFVA 1U1KA 3OV7A 3BB5A 2JLEA 1FXLA 5A6WA 1UPPA 4DV0J 2GMJA 2G1DA 3HVWA 2ZZMA 1M0SA 3O1LA 3KG0A 3N5BA 2PA8D 4O3QA 5FJ4A 2K1RB 1WKLA 2IJRA 4ZJQA 1NPRA 3BSOA 3VAJA 5IFMA 2J0SD 1SL2A 2UU9J 3BGRB 2OD6A 2GAHC 4KH0B 1IKWA 1P6TA 1WSVA 5KT2A 1IBMF 3R5CA 1CJVB 3LAKA 2BW2A 4TYAA 3IS9B 2YWHA 3PCOB 2V5HG 5MAOA 1JLAA 2RUSA 2ZHOA 3Q8VA 3E3XA 1H0HB 4DSEA 2YNFA 5C2GA 2GO8A 3IN5A 4X64J 1TZ0A 2CVIA 2DNRA 1L3TA 1NO8A 4A8QA 1QTNB 1XR5A 2GC8A 3GJQB 1MLAA 2GHWA 2YH0A 3QZ8A 4NCAA 3V4IB 2Y1JA 4ECWA 4O44A 4QPXA 2JEGA 1UWBA 2ZH1A 2YNHA 4XO0A 4CO0A 4LF6F 4J9UE 4MFBA 3NWRA 3NS7B 1WACA 4NCBA 4NXMJ 3OT9A 2XYPB 4N7TA 4FPRA 2QMWA 4CI0B 4XTTA 2DHSA 4B3RF 1NBEB 4QU6A 4LF8J 4NCGA 4DR3J 2BQRA 1N32F 5GAEU 1ACMB 3NGTA 3E01B 3CPWR 1OJ4A 4WWSA 4DS4A 2RS2A 3AFGA 2AYBA 1CJUA 2MKCA 4ED3A 2VQEF 3LP2A 3JAMY 1A7GE 3MM6A 4UW2A 3I32A 5IC4B 5KFUA 1NRKA 1HMVA 3QT7A 4KH1B 2UV8A 4LRBA 1TAQA 1UAWA 3AD7C 4DG1B 2DK2A 1HNXJ 2MQ8A 2W7PA 3MFHA 2FLPA 1HQ2A 1S1VA 1JJHA 2XWXA 2XMTA 4DUYJ 4RZRA 1NJXA 3R9LA 4GVBA 5BXIA 3Q8QB 4HVZA 4P9SA 2AWZA 4F02A 2BJ1A 4KPCA 2QT7A 4Y28C 1MN9A 3O44A 3FMBA 4RUCA 4DL2A 1LWEB 4WXWA 3VZHA 3ENVA 2DH8A 2HNYB 5ETOA 1HNZF 1EIYB 4K4TA 1J5EF 2R8GA 2VG6B 1BHNA 3LH2S 3JQKA 3JTOA 4M5IA 1BMQB 5F8MA 1FI4A 1UA0A 1P1TA 2DHXA 1N0UA 2KTQA 2VG7A 3SFUA 2VHGA 4DFPA 4X2BA 4Y2KA 1IBKJ 4ECVA 1Q1KA 1VDHA 2W9AA 3SDEB 2I8EA 3NP5A 3CJ5A 1B64A 2CPXA 3UDLA 2VD3A 1FNMA 2E5IA 2AJ4A 1RACB 3G82B 3OBIA 2RKIA 4X66F 1U48A 1C0TA 2C2NA 2COLA 1KEKA 3D0GE 1F3VA 3TR5A 2M4MA 3TJ9A 1SKUB 1RBOB 1LW0B 2R3VA 5GVQA 1ZYQA 5RUBA 5DJBA 4UY85 4Y2AA 4Q8EA 4DV3F 1F1BB 3T3FA 3KK1B 5HATA 2L3MA 1Q8BA 3H42A 3PYFA 3H5UA 5F0UA 3V81A 4L3NA 5D78A 1HNIA 2DXEA 4ZJLA 2MZ1A 4TYBA 3PR4A 3MM8A 1N5YB 2IBOA 1ZH5A 1FFSB 5DM6Q 4WCEQ 3FEXB 3CO9A 1HNWJ 3CCZA 2MQPA 1PGZA 5IWAF 4U7CA 4TY8A 4KFBB 3NG8A 1NSQA 3W7BA 4C2MA 4F50A 2OD4A 4J9KA 5ETPA 3UCGA 1TK8A 1T0TV 2VL1A 5KFWA 4CM0A 2XY7A 2F4VF 1NKCA 3L95X 5AE2A 3OJUA 4ALZA 2ZM6J 1HNIB 4ZKAA 4DV1J 1N5YA 3V81B 4JI7J 3HHLD 4ZVEA 4GVLA 1HQUB 4BBYA 1REVB 1RABB 2DGWA 2KT2A 2KRRA 4XAKA 1ZM2A 2U2FA 2UUTA 3DCAA 3DM2A 3T9NA 3KK1A 1X31C 4LF5J 1XR6A 1WC6A 2OHDA 5AE1A 5ETMA 2EI5A 3EPIA 4RBTA 3D7SB 1S0VA 5B7WA 3Q2SC 2CZ4A 2WOMB 4G65A 3ZTQA 5HQ8A 2I5JB 5CHCB 3FEYB 4WKYA 1XIQA 3TEHB 1RWKB 3QWUA 1FKPB 3KLGA 4DSLA 1B4SA 3DLKA 4EMDA 4X64F 2HHPA 2V68A 1VBKA 4JI0F 4E8UA 3BS9A 5KFIA 5A2QY 2L9DA 2YTCA 5KG0A 4U67Q 1S1TB 4CLSA 1S97A 4I2PA 3CTRA 2EC2A 3A1YG 1T9VA 3JTNA 1U2FA 2H5EA 3BO4A 1LW2A 1K8AT 3MR5A 2FY1A 2QJ3A 4TLRA 3KUHA 1S10A 2MHNA 2PD1A 4PCQA 4XDDA 2HBZB 5L38A 1X5TA 3TYTA 2BQ3A 1HHTP 2BKPA 2EKYA 3QWPA 2SXLA 2DTJA 4OV6A 3V5RA 4CTAB 4F3QA 3BQ0A 1VQ4S 5AXMA 3DDNA 3GG1A 3KJNB 4RNFA 1WSRA 4YR0A 3QZ7A 4LF4J 4I2QA 5JMNA 5HMXA 3GFHA 1SUQA 1TL3A 5CZXA 1ZOTA 4DG1A 4F26A 5K8OA 4C8KA 3TA2A 2UXDJ 4GRSA 2L48A 1Q16B 2F40A 2IFXA 2GGPA 2MJNA 2F1FA 3CXCR 2CJ9A 2ZNYA 3ZTOA 3M8PB 2CAJA 1YJ7A 4B9TA 3BV8A 3OXLA 2EEYA 1C1CA 1SIZA 3GU0A 2CXEA 5A8RB 1AT1B 3HZGA 1FJCA 1XWLA 3E01A 2JJ4D 3CWJA 1RA7A 4RWXA 3ZZTA 3ZTSA 1GQEA 5DQGA 4X4PA 1M1GA 4HLBA 2VICA 4F8RA 4HI2A 2W25A 4OYWA 2WONA 3MWBA 1B70B 1JLCA 2BYCA 2CQGA 3T6JA 4PXBA 5GADU 3A3OB 3V6KA 1YI2S 2HHQA 1JLEB 3ENAA 1AROP 2YKQA 3KG1A 2N82B 5KFXA 1S4EA 1M5SA 4P2XA 4D3HA 2ALYB 4IH6A 4O44B 4PAAA 2KG1A 2CG8A 1IBLF 3CD5A 3CDUA 4DV5F 2XY6A 1ZETA 1S6OA 3I0SB 4CM2A 4ZPTR 5HVHA 4NWBA 4OZLA 2D41A 1YBUA 3MMCB 1N8RT 3ETMA 3IRXB 4OX8A 1HBMB 3GCXP 1DQ8A 4QYZK 1YWXA 5EX0A 3G86A 4YB5A 2AW0A 3I0SA 2MDAA 1O6XA 1FESA 2W4CA 3IS9A 3QIDA 3MCOA 1M5HA 3D3CJ 3K2YA 1EHWA 1SL1A 2RQMA 3PRDA 2K3KA 4ZDNA 2BJ8A 2BX6A 2CDRB 2OFHX 2WK4A 2HZCA 4KQZA 5GAGU 5K8PA 4WFNQ 2FLLA 4Q43A 1JLEA 1UVMA 1S6UA 2FJBB 3MR7A 1K1QA 2K1RA 5E2QA 3CUNA 4U7UD 2PO4A 3KNGA 1EETA 1KFDA 3GONA 5EWGA 1JLCB 2HQDA 1U1NA 2WONB 1NSPA 3GFXA 2C2OB 1HI8A 2HLTA 2UUWA 3M2VB 4X62J 3AQPA 2ZJRQ 1IM4A 4C0HA 2VIHA 2X1FA 5J1PA 2VODA 4F0MA 1VR6A 2OPQB 3HHLA 3T41A 5D3GA 1RHJB 1WEXA 1RAIB 2DR6A 5A8RA 4ED2A 4Y2IA 4P71A 2DGUA 4A8YA 2PT0A 2HGMA 4B9SA 2FGOA 2VPZB 2PN6A 2J0XA 4EO6A 4ED0A 2HAFA 2OEMA 4AYBD 1LNQA 5HP1A 2F4VJ 2DGXA 4RW6A 1TL3B 5DGAA 1ZA1B 3TP2A 2HK3A 3FMWA 5E7OB 3W65A 2C22A 1RUSA 1HHSA 2PFFB 4UT4A 3UI3A 2Y0BB 3CVKA 2M3DA 4JI1J 2NCKL 2IM0A 3DOLA 4NXMF 3B8HA 4NEZA 2XO6A 1IVZA 1RISA 2IM1A 1VOMA 1X7VA 4QWEA 1FXDA 3MZIA 1WC1A 5GAHU 2UVRA 2RIJA 3BO2A 3HKZD 4C8MA 1D09B 1U6FA 1EQMA 1S1TA 2H3EB 5GMKa 2L9WA 4TKTA 3D6TB 2XO7A 3K5MA 2QEXS 1RCOB 3VQTA 1X4EA 4EFAC 3K5NA 4RUAA 3C2PA 3ZZUA 2UXCJ 1LWXA 4LF6J 1JXLA 3CCVS 1LXJA 2YPYA 2O3DA 4H4MB 2B9EA 3S6EA 2N4DA 1HFEL 5F9LA 3UN5A 3Q0AA 2I5JA 4LF1A 2VQFF 1ICEB 3PR5B 2CQ4A 3LWMA 3HSJA 3QRPA 4DL5A 2Y1LB 3ICLA 4PEOA 1J27A 2R9LA 1QTMA 4PZVA 4N77A 4N8OA 1HL6A 1NEEA 3DM2B 2A3JA 2OPSB 2MKYA 1SV5A 1FVSA 3HT0A 1TKTA 4KHMA 4L6V3 2FY8A 4PPDA 5E33A 4DV4F 4NLYA 4HH0A 3EWGA 4DR5J 3FC9A 3O2IA 3GIJA 1SCJB 1XQIA 4QWCA 4DPOA 4KSEB 4ZN1A 2BZ2A 4ANCA 3H8YA 5C2CA 3UD3P 4TY8B 4UUXA 4X4NA 1O51A 2M0GB 4XPCA 1NMEB 2RRBA 2DGQA 4ELTA 3MURP 4KY3A 4RPFA 1JMTA 4ER8A 3RB4A 3MM8B 2EG2A 3CE8A 4QR1A 1Y0HA 4F36A 1IWAA 1YZ6A 2DNOA 2CVEA 3R97A 2NR0A 2ATLA 1UFWA 2VA2A 4QCLA 4L73A 1F9HA 4I68A 5ETQA 5LXRA 2BVZA 4ID5B 3SEOA 3IR5B 4ICLA 5GAEI 1YSJA 1JJ4A 1RHKB 2DNNA 5LL6d 1VYAA 4NXNJ 1RWOB 3MR6A 1QUVA 3H5XA 2B4VA 2KO1A 4NLPA 4CLKA 2I0XA 3QAEA 1MSWD 2DHHA 5A8KB 1KVJA 1N32J 3IMQJ 3LP0A 2IRXA 1AZSB 3CMQA 2HHSA 4R25A 4NA2A 4ZIVA 1NK8A 1JK9B 3SDEA 2JX2A 1JWWA 4MYTA 4FKXA 4PUOB 3I5BA 2ZM6F 3P49B 4CH0S 4JI7F 1VK8A 2DIVA 2BACA 2VG6A 4OYMA 4IQXA 1KSPA 5C24B 4PWDA 1WOOA 2HNYA 4FNHA 5IT9U 2NLWA 2WVFA 4LF5F 2AJQA 1LK7A 2AEFA 4G1IA 4C11A 4K0KJ 2W24A 3M2UB 2VONA 1GTHA 1RT7A 1WTFA 2FC9A 1YJUA 4RU9A 2CJQA 4U8VA 4X62F 1LWCB 4GVBB 4OYXA 1UVNA 2J7KA 2C2MB 4HI1A 4OHZA 5IQ6A 2GQQA 5KFNA 1G4CA 3OJSA 1U1OA 4GKJJ 4Y2CA 4TU8A 4URSA 3DHXA 1HMVB 4KRWA 2IVYA 1I5OB 4NZ7A 1HWIA 4B3SJ 4I7FA 3VR1A 2RT3A 3DGVA 1Q81T 2DRBA 2R42A 1IJEB 1CJUB 4LFBF 3ET6A 2HFVA 2B9WA 2DIUA 2DXFA 4C3LA 3FBCA 4NCGB 1YJWS 1NK0A 2HIQA 4QW9A 4LIRA 4C0OC 4AQYJ 4GKKJ 2ZH3A 4QIVA 3S8SA 2IC3B 1U0HA 3TVZA 4J37A 3EJMA 3ZTPA 2ZH2A 4C8ZA 1QY7A 1JKHA 3QO9B 4V19J 2XTJP 3BBFA 1NPKA 5LSLA 5ITHA 1RT5B 4LF9F 3HVTA 1HR0J 3V4IA 4QWBA 1NNDA 1HBOA 2L41A 2ZHAA 2UXDF 3QFWA 3PW2A 5KFAA 2MEWA 1N56A 2FUG9 3UN3A 1MG7A 1S4FA 3DLJA 2NYIA 5A8WA 2OI2A 2QE5A 4UUWA 4IFYB 2OSRA 3AQOA 3W2WB 2KRBA 3H2LA 4TQSA 1F0XA 3N79A 2QZ8A 2HHXA 2YX4A 3JXOA 5D0EA 1RSCA 4AL6A 3MM9A 5LXYA 4PRFA 1U1MA 1WG1A 4NI2B 2LP4A 3ADAC 3DRXA 3JSYA 1VRUA 2PFDA 5KFDA 2ADBA 2AQ4A 1JJCB 4WZQA 4I1TA 2IM3A 5DDPC 2ZJPQ 3PIOQ 1TFYA 3P8BB 4FKYA 5B0AA 4P7VA 4DPWA 4YR2A 5HANA 1PC4A 5LSOA 4K8RA 4LQ9A 4J9NA 2LEBA 4RLEA 3RBEA 2Q66A 2HHVA 2ZZNA 4L75A 1WDTA 1F6TA 2HFNA 1T9YA 2M8HA 4OYAA 2YNGA 5E0OA 3C16A 3UD5A 3VGTA 1RHQB 1DRZA 4G6VB 2JC0A 2FZGB 2Y3YA 4IYQA 1UZDA 3JYTA 3GE9A 3QT6A 5DGBA 1IKVB 3A8JA 1HW9A 2DR9A 3DGPB 3NRBA 5KG6A 1QE1B 4A8OA 1VJWA 3EZOA 2HMIA 1LV5A 3KLIB 3CJ3A 1N33J 2YX7A 4BCAA 2BANB 2QLBB 2W1BA 3HM9A 4K4YA 2QO3A 4ZP9A 4DLEA 2KM8C 1KQKA 1YGYA 3GCWP 5KG7A 2P5VA 1S9GB 4KKOA 4EI2A 4RNNA 1N36J 2A6OA 4DR6F 2B4PA 3BQ2A 5ETVA 3D0HE 3KJFB 5B0GA 2JEJA 2LQ8A 2NSCA 3IG1A 4DXLA 1S0MA 3CD0A 2VFRA 4ZVTB 3D3BJ 4W92B 5M2UA 2R7UA 1SIWB 1XEZA 2XQCA 3KLEB 2KM8B 2C3YA 3X3UA 2UUCF 4IQMA 2LXFA 1EQ0A 5T7LB 1S77D 3CJQA 2J9DE 5SUHA 1YKWA 2KXHA 2ZD1A 2W2QP 4KGVB 4NMXA 5KFTA 1VC6A 1KLMB 1UP1A 4K4SA 1IM6A 2QGFB 3M6VA 4JP8A 1NK4A 3QRRA 4B9UA 2C2DA 1XMQF 2M88A 1T03B 3FUYA 4NA3A 1CVJA 2MSTA 4C8LA 1GX5A 2ZBQA 2D3ZA 4IKAA 1CEZA 2FJEB 2OPPA 3T5HA 3GYNA 4H4KC 2FZKB 4LRDA 1MWYA 2Q79A 1E6YB 2RHSB 3CDWA 3U7JA 2XY5A 2RB7A 8RUCA 2ADCA 3GFZA 1GH8A 1YITS 2BRLA 1GEHA 2HNDA 3OFGA 4F4WA 3PRVA 1RWUA 3GWCA 2MKKA 1TAUA 3LALA 3M1VA 2W8KA 3QT5A 1M1HA 1JNZB 4ZA1A 2ROGA 3OHAA 2R2TA 4FS2A 1JLQA 5KT4A 4RBUA 1N6QA 5AT1B 2IA0A 1RXOB 2B3TB 2DNKA 2OEJA 2QYCA 5D4LA 3T5KA 2VDHA 4CDIA 4PQAA 4F2RA 1CJTA 3HULA 1U6ZA 1VRTA 4DHVA 3D0IE 4AT1B 2HEKA 4Z2XA 2Y1IA 4RU2A 4O4GB 4QR2A 1EZZB 1KTQA 2RRNA 1S5ZA 3BZQA 4DCOB 1H38A 3M32A 2APOA 1U0SA 2FGCA 5JXSA 3J80Y 5E3QA 2XLKA 2YWKA 3FSYA 2AJ0A 1D9AA 4PR6A 3EDRB 1RLCL 4ILLA 3RW7A 3TUPA 5C25B 1YK9A 3IFEA 4CNZA 2EW9A 2XMAA 3GIIA 7FD1A 2FZCB 1UTAA 4DUZF 2LECA 2QL7B 2Y8WA 1HPZB 3OTBA 1V3RA 4KYZA 2K7KA 5A0YA 4C7QA 5CABA 4FF4A 2XS2A 2XMMA 1E6YA 1VLYA 3TUZC 2V9KA 4ZN3A 3HJVA 4TU9A 3CC2S 4WJBA 2OJ3A 4UOCA 5IT9Y 1S9EA 3V6HA 1AUSL 5EDWA 4LSLA 2LXUA 4DOZA 3MGJA 2MGZB 5J2QA 2K8GA 1EARA 2QA1A 3LTOA 1WF1A 2GMHA 3GJRB 3H20A 2ASJA 4E0DA 4IFVB 1B99A 4DV5J 3P5BP 4FVMA 1RI7A 3HSGA 2JLFA 4TLQA 2HZAA 4R8UA 4IG0B 3TA0A 3G4SS 1UVLA 5KFYA 1TL4A 4WFBQ 4DSIA 2FVCA 2W01A 2JDJA 1H72C 3M8YA 4C0BA 1RU1A 4ZLLA 3KK3B 3D2WA 3VAMA 4J9MA 2CQ3A 5E41A 5J2PB 3SV3A 1WTBA 1ZBTA 2BE2B 4M8LA 3PIPQ 4PWWA 5F41A 3ZNUA 3SI8A 5F3TA 1RWNB 4TU7A 1ITPA 5DG7A 1VISA 1H2TZ 2HQCA 2GS8A 4QU7A 2XWYA 2ZUAA 3I4HX 1FWKA 3KUEA 4KV8A 2XYGB 4DDFA 5GAGI 2XB2D 3QIPA 2LDIA 1QD1A 5H9FJ 3ITHA 2OPRB 3PX4A 4AL7A 3SYZA 1C0UA 5HQMA 1U49A 3UE2A 3I0RA 4KKOB 3IR7B 4J90A 5LMNF 2F9JA 4MH8A 1JJ2R 4DR5F 1I3OB 4DLGA 3ZZOA 2GQCA 2I9SA 2BANA 2V2ZA 3DU6A 4FYWB 1BQXA 1X8DA 4D3GA 1M5OC 4OHVA 4M5DB 1X4DA 1F5BA 1N4LA 1QE1A 3DGPA 1R8AA 3DC2A 3W5XA 3VTIA 2F8MA 4ZITA 4DF4A 4F0KA 4FBUA 2EFNA 1Y11A 1EKSA 4Q2LA 5DETA 1CG2A 2AX1A 2CQCA 3J7Z5 1VQPS 2CQBA 2LVWA 1OWXA 2RS8A 3TJ8A 2XHCA 3C16B 2OMOA 3HVRA 4RW9B 4MMOA 5BR8F 3CC7S 5BYQA 2BE7D 5HSPA 3C19A 2PDAA 2IYGA 4BDPA 3VALA 2AJ1A 1JLGB 2WBRA 4R0JA 1OSDA 3B6BA 2HQIA 2DR7A 1GT8A 2C3OA 1QAYA 3G9CA 3RJMB 4DU7A 2RNEA 1OQ6A 1S99A 1ZAVA 4JI6F 1VRUB 4O4RA 1T05A 4OZ1A 3HHNB 3CJ0A 4NI2A 3FBEA 1CS4A 3FBBA 5ETKA 1EX8A 3T5JA 1XK8A 1S6PA 2NUHA 3LANA 2VG5B 4PG4A 3OL6A 1S1WA 2O67A 3C14A 4LRAA 4ZP8A 2V2KA 2AT1B 2R7OA 4DV6F 1T02A 1K9MT 3SCJE 1I6JA 1LKZA 2MLZA 2R7VA 5A8WB 2WAQD 5KFOA 4DN0A 1HBUA 2CJYB 2Q6CA 3P5TL 4LSNA 3KLHA 2HRTA 1CC8A 3EZUA 1A0OB 3M8WA 3HK2A 3BGFA 1RT4A 1W25A 3W63A 5LJ5Y 4P75A 1RT5A 1NKEA 1R89A 4LRCA 2E44A 5KAKA 2HQFA 1FF2A 4A8KA 1YJNS 1IR2A 3OTEA 3G96A 2HWTA 2BV3A 2Z30B 3OD2A 4IH5A 4O3PA 5AE3A 3VWSA 3H5YA 3CJ4A 4ENOA 1NLKL 3RG6A 2M70A 2JC1A 2H51B 3NAHA 4M5LA 3PVXA 1HWKA 4LFAJ 3RUBL 3RW6A 4WZMA 1CC7A 1H6KX 3GLJA 3BGUA 1CPZA 3W8PA 5HI7A 1MROB 1I1GA 2XNQA 3BGLA 3H90A 1J2VA 2QV6A 2V8PA 4CZCA 4DSFA 1P8GA 4KV8B 5I42A 2CADA 1T9XA 2J7UA 4U8YA 2DRAA 3GJSB 1RT1B 2Q1LA 4DCJB 2P8IA 2BM1A 5L39A 4YB1P 3MI7X 1Q82T 1QSSA 3KMQA 1BD6A 1IR1A 5D0RA 1KC8T 3IP0A 4CLTA 1RKIA 2VQFJ 2IJFA 3RAMA 4C11B 3HFZB 2EPIA 1WEZA 4OQJA 3W8GA 1WC5A 2HVDA 4CP5A 4KO0B 2BQUA 4R8UB 2CJKA 2LXIA 3PDNA 1BQNB 1RYRA 1Q95G 2BBEA 2FHJA 3LPEA 3RB3A 4LSLB 2B4OA 1YRTA 3KG4A 2WSFC 3KWMA 1KBRA 3MDFA 4WK1A 5KG3A 5JVHQ 3AXKA 4IO9Q 3PV8A 4YHHF 1AXQA 5E3CA 1JXVA 4NLVA 1BC6A 2XM3A 2GO9A 5KFMA 1Q4RA 3M9OB 2UVWA 1KDNA 4KIAA 1HPZA 4USWA 1QAXA 2VASA 2BDPA 2NQPA 3US5A 1LQ9A 1RWWB 2DO4A 3AOAA 3BKFA 3R5JB 2CQ2A 4RR5A 4RW7A 3M6UA 3WDOA 3Q8RB 3FSIA 1FRHA 2UU9F 1LFWA 5C25A 3MD3A 4BS2A 4JV0A 1FRKA 5GAHI 4QWAA 3VAKA 1HNXF 3A13A 4OZJA 1PYSB 2MKJA 2VU5A 2XSFA 4F3OA 4ID5A 1CULA
chains in the Genus database with same CATH topology
5KFCA 4JV5F 1SL0A 2FDNA 4QIGA 2JEIA 4IR1A 1AUDA 2AYMA 2VFSA 1FKOB 1JLQB 2EFVA 2UV8G 5DG9A 2V0NA 4X84A 4X4OA 1WI8A 1Y00A 2J9DA 2E7XA 5J1EA 2HNDB 2BXJA 1KTVA 5H1SV 4K2XA 4NX9A 4ZPAA 1VQ6S 5K14A 3JTPA 2VC0A 3MOJB 2MQNA 4ZVHA 4EBDA 2OPPB 1RT3B 1R7IA 4MK8A 1TKTB 3F73A 3TRGA 3N01A 1DQAA 1H7XA 1X9WA 2P9EA 3O6QA 4XPEA 2WW8A 2XMJA 4KBIA 5CA5A 1T3OA 3OFEA 2ZD1B 4HH1A 4EBEA 3OL8A 1T3NA 1UJ5A 5T7LA 1FDNA 3KNAA 2WSEC 1S76D 3DI6A 2PC6A 3GG0A 3KLEA 2KFYA 1UVJA 1Y4ZB 1QLNA 1LXNA 2HWIA 4OJ3A 3Q2TC 2JHEA 1WI6A 2DJWA 3PO5A 2QRRA 3BSNA 3HJFA 4M63A 3VCDA 1VQYA 2GW8A 1OS5A 4B9LA 4K50A 3H4BA 2V4JA 2W8LA 2VPXB 2FJAB 2V8VA 4DV1F 4HYKA 3DN9A 1PO6A 2LQ9A 1W2BR 1FRLA 4FS1A 2YNIB 3FFIB 5GADI 1SQEA 1MNEA 2MZQA 4LJMA 1YIJS 2HMIB 1HD1A 1NAQA 2RQKA 4MYUA 3LW5C 2BOPA 2DNHA 3Q23A 4J9LA 1NH8A 3LAMA 1IN0A 3JYTB 4QZVB 3W3SA 2KN4A 5E5NA 4K4VA 2V4QA 3K59A 4LVOP 5D3GB 3LPYA 2ASLA 2EC0A 3IC1A 4EBCA 1X4AA 1ZM9A 3TOQA 5KG2A 3G71S 2MB0B 5IZHA 1APSA 3AH6A 4DQSA 1EETB 2HAIA 3CCLS 4ILRA 1H7WA 1OQ3A 2B9XA 5MLCV 4J9QA 1IJFB 2FPHX 4O23A 3ZC4A 1X0PA 1D1UA 2VFVA 3EXCX 3HHKA 3BR8A 2A1BA 2M8DB 3MAHA 4OX7A 4YFUA 4YOEA 2HGLA 1FDDA 4GO5X 2CQ0A 3IRXA 3CCRS 2X3GA 3MMCA 5LJ3Y 1H2VZ 1D8YA 2UP1A 3CULA 3GB0A 1UJ4A 2DT9A 3DLBA 4QYRA 1GXTA 4TQRA 4BC7A 2G4BA 3PW7A 1HBOB 1FD8A 2N3LA 2LEPA 3HVTB 4M95A 5G0RB 4Z37A 5ADZA 3UCUP 4IOCQ 3ULHA 3KFWX 3QO9A 4DR3F 4JOUA 5DRKA 3WC2A 3DXBA 1RQ0A 2AX0A 1Y9OA 4A48A 3M30B 4JUZA 1VI7A 2HHUA 2UUAF 2B9YA 3G6XA 1QSSA 1WF0A 2RDIA 3PHEA 3KJVB 3HXMA 2NXUA 2RUGA 2MY8A 2YVSA 1VGYA 4JV1A 3I5AA 2AJFE 4MTPA 2KHCA 1RK8A 2XS5A 1C1CB 2OMLA 2YKPA 4F2SA 1LWFA 3NNCA 1UETA 4USHA 3GV7B 2GGPB 4NZ0A 4ECXA 1S7HA 4KB7A 4QW8A 1UVIA 2KXNB 3TO8A 2YKMA 1SUQB 4K59A 4ECTA 2DHAA 3QMQA 4I2QB 2K3IA 1NKBA 2XEXA 4RX6A 4DR4F 2AYEA 1LWCA 3NMAA 1FNOA 2WSCC 3HMJG 3IXQA 3ISZA 3NCQA 4G1QB 4CTAA 4H4OA 1J5OB 3M2UA 4RW4B 4DMZA 2IBKA 3OR1A 1TKXB 2W7OA 3Q24A 4PWDB 3DRRA 4ZHRA 1ZM3A 1MWZA 5FDLB 5DQHA 1LW2B 4ECSA 3H98A 1RTJA 3MR3A 2KZZA 1XC9A 2KB2A 4I6WA 1N54B 3HP6A 1S1XA 4QJVA 2PMHA 3DLKB 2QA2A 3OTDA 1B0VA 4Y00A 3KLGB 5DLFA 1M5KC 4NRUA 1KS2A 1JLFA 3DU5A 3QJLA 4IG3A 1Q7LB 4RNNA 5A8KA 3IO1A 1OPZA 2AV5A 1BY9A 2JVOA 2E5LF 2HGNA 3H5SA 3HO1A 2EBEA 1XTZA 1S72S 4ICLB 4MKBA 2E66A 2MMYA 3MHYA 5IT4A 4JI1F 4FN5A 4Q44A 1CQNA 1EP4B 1D0EA 1MMLA 2GNKA 4N5SA 2IRYA 2DNMA 3M9MB 2ZNZA 2HWHA 2XLJA 1D9FA 2HQ3A 1RT2B 2FC8A 2CPFA 4H54A 3V6JA 2CJBA 2F9DA 2ZKTA 4KFBA 5F9NA 2C2EA 4DUYF 2WCXA 1TKZA 3EYZA 4JI4F 2B43A 2O66A 5EWEA 4PXCA 1KONA 1K0TA 3E2EA 3G8TA 2J7WA 3EGZA 1KVIA 3DXSX 3GR1A 3MEKA 2EFOA 4M1KA 1U6BA 3NNHA 4IR9A 3MD1A 3DHWC 1U1QA 2HRYA 4CO3A 2OPSA 3VQSA 2GIRA 4OHXA 3VAHA 1S48A 4R5PA 2QSWA 1N5TA 3EUNA 3D1OA 2B4UA 3MEDB 3JSRA 1ZM4A 2R4FA 1C0TB 3HPOA 2RKIB 2PI4A 2CPZA 4F4YA 2XMVA 1RKJA 4H4KA 2BUNA 4ATNA 1K73T 2HVZA 2E9RX 3KOAA 2O1PA 1VQMS 1NJIT 4QIEA 1LK5A 3TUJC 1FKAF 3HX9A 1N0VC 2QMXA 2DITA 2VG7B 2JEFA 4OZ0A 1F60B 3AB4B 2BRKA 1P27B 1YBAA 2K7JA 4Q2MA 5DDOC 3R27A 4ZCLA 2ZH4A 3ISND 2E1MC 2LCWA 1LWEA 3PJXA 2AD9A 1X9SA 4JI8F 1DZ5A 4OI4A 2KG0A 3C6UA 2ZITA 3DOLB 2ALZA 2AU0A 1XR7A 1WHYA 1Z4UA 3LQVA 3M4XA 2HHWA 5KFRA 1S1VB 3RR7A 1SJ1A 2ACYA 2OSQA 5HP1B 1AFIA 2FB0A 1ZAWA 3C6TB 2CPHA 3MM6B 4XK8C 5F0WA 2ZJQQ 4PG6A 4MIWA 2CQIA 2J8AA 2KKHA 3IRWP 3TAPA 4GC7A 3HHLB 2HHHF 2OPQA 3UR0A 1Y5LB 3I55S 1N5QA 2GHPA 3MMJA 3OW2R 4NPOA 2ZOFA 2A18A 3M2VA 2R2RA 4B08A 2KVIA 2JSXA 4UQTA 5KFFA 3UDCA 4MFBB 2RDJA 4DF8A 4HHJA 4O3RA 4X4UA 2PSZA 3BSCA 4CO2A 1SJ4P 1FTCA 4FVCA 5LSRA 4I6AA 4DL3A 4EEYA 1DTTB 5K5MA 3RYLA 1HBMA 2VB6A 2YNFB 3M05A 1ZZNA 3OQ2A 2KFNA 2ZVSA 1WHVA 2XC9A 3AY0A 4CNYA 4YEAA 1HQEB 3H2UB 3WZ0A 3N6LA 1IKWB 3G8SA 2E9ZA 5IQQA 5IT0A 2KI2A 4DN9A 2R8IA 2G13A 3H25A 1A9NB 2EVZA 2R8KA 2VC1A 2W9CB 4B17A 1RJJA 4ECQA 2E7WA 1QVGR 4ECUA 2GA7A 1Q86T 1RP5A 3CSKA 3V4MA 3E8OA 4A8XA 1JLBB 2XMKA 5D4NA 1OO0B 1SI9A 3BEGB 3M8PA 3PX6A 4A47A 2DBBA 1LFPA 1X0FA 1NB7A 1O8BA 4RW8B 2OIHA 3HVAA 3TAMB 4PG5A 3AA9A 6FDRA 2XZWA 2DVIA 2QA4G 5KFKA 2P6TA 2ZH8A 5J2NA 2J9EA 3OL9A 3GYXB 3MMBA 3SXLA 2CRLA 3C46A 4WKRA 1U26A 1UEUA 2C2DA 3DLGA 3UPFA 4USIA 4AUKA 3I56S 3TQ1A 1CEZA 5HROB 4QBUA 3N0VA 1DQ9A 2OKQA 4OLPA 2VA3A 1U4BA 4CO5A 4P2SA 1DTQA 3DLEA 1FDAA 5KG1A 2DPIA 4I2PB 2ZKUA 1L3SA 1FVQA 2DHGA 2LQBA 3K57A 2QIFA 3SSSA 4JI3F 4A8MP 1KHWA 2LA4A 3NAIA 1DLOB 1HBNB 1FKPA 2J6TA 2VOOA 4GKKF 1F2GA 1RTHB 2ROPA 5E3AA 3RU0A 3MPYA 3MM5A 1U2RA 4QR0A 2BA9A 4ZP6A 4ZOSA 2WOMA 1FEHA 1OIAA 2MZSA 2WHOA 4CO4A 3UW1A 3OVAA 2BR0A 1TVRB 4I6YA 2XSJB 3UD4P 3M2RB 3I4PA 1BQMA 4M94A 1REVA 3K58A 1HQUA 3DOKB 4C4WA 3MEEB 2LLZA 3TX8A 4OI3A 3LO3A 2VBZA 3NS5A 2PI5A 1N36F 2UUBF 2Z4PA 3CJKA 1B7FA 3M8QA 2YKNA 1IKYB 1DJ0A 3I9V9 3B4MA 4A46A 2ZBCA 2OP5A 4NRTA 4ELUA 3DRPB