1AZSB

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
199
structure length
189
Chain Sequence
b'HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VC1
molecule tags Complex (lyase/hydrolase)
source organism Canis lupus familiaris
publication title Crystal structure of the catalytic domains of adenylyl cyclase in a complex with Gsalpha.GTPgammaS.
pubmed doi rcsb
total genus 57
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1997-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1azsB00
4OZ2A 1CJVA 4OYBA 5D0HA 4OYPA 1TL7B 4CM0A 1WC5A 4OYAA 2GVZB 4WP9A 2QV6A 5D0EA 1CJUA 4P2FA 1TL7A 4CLTA 3ET6A 3UVJA 4CLPA 4WP8A 3C14B 1WC0A 4OYIA 3R5GA 1CS4B 2GVDB 1CS4A 1Y11A 2WZ1A 4CLFA 3C16B 1CJUB 4USUA 3C16A 3G82A 4OYZA 4CLKA 1FX2A 1Y10A 4CLLA 5IV4A 4OZ3A 1YBTA 4NI2B 4CLUA 4OYWA 4USWA 4CLWA 1CULB 4WP3A 4CLSA 2GVDA 1WC3A 1YK9A 3C14A 4OYOA 4OYMA 1AB8A 1U0HB 3C15B 1WC4A 1CJVB 1CULA 1CJKB 5D15A 1CJTA 5IV3A 1YBUA 4WPAA 4CLZA 1CJTB 3MR7A 4USVA 3G82B 4CLYA 4NI2A 1U0HA 1AZSB 4USTA 4CM2A 5D0RA 4OYXA 2BW7A 1WC6A 3MAAB 3ET6B 5D0GA 1WC1A 3UVJB 3MAAA 1AZSA 2W01A 3C15A 1FX4A 1CJKA 4P2XA 2GVZA 4P2MA
chains in the Genus database with same CATH superfamily
1RKIA 2UUTA 3GG0A 1HNXJ 4OZ2A 2RF2A 1DTQB 2QG9B 2FLLA 1CQNA 1B4SA 1NPRA 2KB2A 2VFRA 1S6QB 3KK3B 1VBYA 2DR8A 2RB7A 2MQMA 1LQ9A 4JUZA 2Y9HA 2RQMA 3DRRA 1N34F 1BXNA 1IKYA 2XHCA 2R2UA 2IM2A 2BKPA 3DOMB 5C2CA 1SL1A 2GHPA 4R25A 4KYZA 3ZTPA 2L48A 4ED8A 1K0TA 1RWMB 2P9GA 2QTWA 3Q24A 2AD9A 5D0EA 1EARA 2IM1A 2OPQB 4EI2A 2U1AA 2XO6A 4P2FA 2HIQA 3LANA 1KLMB 3NS5A 1KDNA 4H4OA 3OTDA 4DV4F 4PWDA 2L08A 4KGMA 2CNLB 4EO6A 4DV7J 2FJBB 2CQBA 3BH6B 4C7QA 5KOWA 1JNRB 4WCEQ 3HP6A 1VQOS 4V19X 3CCMS 2BE2B 1O0PA 3BBFA 4NLXA 2MKIA 2DHAA 3CD5A 2FHOB 1NK0A 1N52B 5DO2A 1FJEB 2FJVA 2HBRB 5DDPC 2A1BA 4E98A 5GADU 2HHXA 4B3OB 5A8WA 3OLAA 1X60A 1MLAA 3L7UA 1ZETA 3J81Y 4OV6A 4YP3A 2JFDA 1Q8KA 5M2PA 5DGBA 2ATLA 1M5VC 3C6TA 3DLJA 1I94F 1HBNA 2NYIA 3OVBA 4C9DA 2J9CA 2OGUA 2CPZA 3J81j 1D09B 4KH1B 1L3VA 2B6AB 2W7AA 2RS2A 2FZGB 2HFOA 4LVNP 4EO8A 3D3BJ 4J5OA 4GVBB 3LO3A 1RHJB 1FJGJ 5J2NA 1SC4B 1HD0A 2OAUA 2R3VA 3M1VA 2XWXA 2VG7A 1RT1A 2H48B 2Z30B 3H98A 4KBIA 1BGXT 3R5AA 1NDLA 5KFQA 3TZWA 3TYTA 3KHLA 2RDJA 4GC6A 1LWFA 2WW8A 3JS9A 4K2XA 4OYWA 3T41A 2C3MA 3HJFA 2PD1A 4LRAA 4ZIVA 3IMQJ 2MQPA 2CQPA 2VPZB 4CT9A 3Q89A 1RK8A 5CA5A 3LPYA 4X66F 1N6QB 4Y0FA 3VAGA 5T14A 5L1KA 2DO4A 4PG5A 2UVRA 1VQ6S 2Z2ZA 1RT6A 2HHPA 2MHNA 2GO8A 2BJ8A 3MEEA 4HHHA 3SEOA 2XGQA 1U1QA 1L3KA 1C1CA 2DIUA 1RABB 1SC1B 3VZIA 2EWHA 5E3PA 4QWEA 2FLNA 5H1SV 2ZH3A 1VMBA 5CYMB 4N5SA 2B9XA 2OPSB 3QIPB 3C6UA 3FFIB 4N8NA 1SV5A 1VQ4S 1WSVA 1V3ZA 3LW5C 1A6LA 1YBUA 1PAEX 2NS1B 2OMLA 3KHHA 5CXTA 1BQNA 2AYBA 3HSDA 4OX9J 2W8KA 4F7VA 1RTIB 3NCRA 1ACMB 3Q22A 1U6FA 2FY8A 3MR7A 2FB0A 3EVOA 4V19J 4HR2A 1SH0A 3TZYA 4U8VA 1S72S 2R8IA 1BLUA 1WUUA 2IYGA 5CCLA 3GV5B 1Q7YT 2ZBIA 2DRBA 1LWEA 5HQMA 4ZPBA 3OXFA 3TEGA 5L46A 1X0PA 4TN2A 1WG4A 4FVCA 3ZNJ1 4UY85 2IM0A 2F1FA 1ZTTA 1TR0A 2KXHA 3W2WB 1FRIA 1HBOA 3WX8A 1JJHA 1FDDA 3OTBA 3GU0A 2D9PA 4J9KA 1XQIA 3MCOA 4WXOA 1FHTA 1F2GA 2IDEA 1S1VA 3HHLA 3CMES 3N6MA 1GEHA 3CJKA 4TU8A 4YB6A 1PKUA 3PFOA 3HFKA 3TJ9A 1RZMA 1WORA 1XWLA 4NCGB 2ZITA 3CJRA 2XCPA 4DL6A 3FBEA 3IFEA 3N0VA 4EBDA 4F2RA 4AL5A 1HQEA 1QDUB 3EGWB 2CQ2A 3CMQA 4OYBA 3W2VB 4YB1P 4WU3A 5D3GB 1M0SA 1Q8LA 2F5GA 3QMQA 3HJVA 3KUEA 4WU2A 4J9NA 5KT7A 2E9RX 1ZZNA 3HCXA 1GMVA 4TU7A 5EWGA 1TFWA 4LF8F 1M5KC 1VDHA 1IR0A 4BWMA 5DRKA 4WYWA 2E5JA 4HTJA 1AT1B 3F0NA 4N47A 2ILZA 2WBRA 2G0JA 4M5NA 2E1AA 4MYUA 5DZ6A 1JX4A 3H5XA 3V6HA 1TL5A 4P7TA 4I2QA 2V2ZA 3DLEA 2OD4A 3RBEA 4IH6A 4UY8T 1UETA 2XI3A 3BSOA 3SDEB 1XN9A 3D6HB 3EZ5A 1TU0B 4F0HA 1S1XA 2MGZA 1WC0A 4DUZF 1U1NA 4NEZA 3R8YA 1GXTA 4DR7F 2IY5B 3NG8A 3IG1A 4DCPB 2WCXA 1H98A 4B02A 5KFEA 5HROA 2HRTA 2CPDA 3E8OA 2JRSA 3AHPA 4B9LA 1XR7A 3DGVA 1YZ7A 5KFCA 5HVHA 4F4ZA 1RT4A 2HS0A 2RUGA 1T0TV 2H1YA 1Q95G 3DMJA 3VAHA 4EZ6A 1NH7A 1RWOB 1TQLA 2LYVA 2MSTA 2KFZA 4DL5A 3G71S 4OYZA 5HMYA 5GAEU 3DDNA 1Y10A 1N5QA 4QYRA 5KG6A 4ZDNA 1DBDA 2XMVA 4U9RA 4LR7A 2QLJB 3NLCA 1M5SA 1U02A 2R7UA 2BM1A 4CO0A 1VQLS 1REGX 2DCUB 2KN4A 3DN9A 4CLWA 1AUDA 2GA7A 1YJ9S 1N6QA 2JEGA 1HMVB 1UPPA 1B70B 4ATNA 4ZLLA 1TMJA 5LM7E 4ZITA 5J1NA 2FZKB 4F3MA 2IA0A 3AJDA 1WC3A 3JTNA 4OI0A 3K8VA 4NZ6A 2BQRA 3OQ2A 2MZRA 4NLSA 1GMWD 4OI3A 1S0MA 5KAKA 2RRNA 2AEJA 2JDJA 4X65J 1AB8A 2C2MB 3NAIA 5IT9Y 4PRFA 2OPSA 2XZTB 3QIPA 2WVDA 2FHJD 2CJYB 2FUG9 5D15A 1U1OA 2H54B 3PYGA 4X62F 1N48A 2JL9A 2RVJA 1L3SA 3H20A 3G8TA 2IVMA 4ECSA 1UEKA 3D6TB 1LK7A 1NK7A 3BKUA 4KHRA 2FVPA 3M4XA 3W9JA 3ETOA 4QBUA 2CJQA 2NXJA 1S1WA 2FTRA 3JXOA 3OTCA 3QFHA 4R0JA 4WBFA 3JAMU 3D67A 1U0HA 3Q8RB 2YTCA 4LFBF 1PSDA 3KLHB 2LQ9A 2QSWA 2NCKL 2Q6CA 4OLPA 4CM2A 2BJDA 2V69A 3K8WA 4UQGA 2OPRB 3AJ2A 5AT1B 3DI6A 1S1UA 5KT6A 4LR9A 1VC0A 2EVZA 3HO1A 3MAAB 3ET6B 3HI9A 2XI2A 5J1EB 3VGVA 3PVXA 2VG5B 4QU7A 3QGGA 1DJ0A 2XWYA 2KO1A 3NMAA 1UWBA 5F8GA 3MURP 2ZM6F 5KTQA 3BGOP 1TKXA 1HQ2A 4EU0A 4R8UB 3CXCR 2NYHA 3CNQP 1S6PA 2B4UA 1IBCB 1DQ8A 1J2VA 1F9EB 2V2VA 1JLBA 2X3GA 2YWWA 3HVAA 1XERA 1O6XA 2CQ4A 1TP7A 1C0TA 5K9FA 3UD3P 3CC4S 3PW2A 4B9TA 1BD6A 1S12A 3G2XA 3MM9A 4NLTA 3LTOA 4JI8F 1UVLA 1P6TA 2BANB 2HPUA 4ZS6A 4ZN1A 1YGYA 4N77A 2OSRA 1TUVA 5CQGA 1TL7B 4MT1A 2MSSA 3KOAA 2I38A 2EFPA 2EFQA 4MKVA 1Q5YA 5AE1A 5B0BA 3O1LA 2K3IA 4ES1A 4F36A 4DF4A 3VVUA 3WQPA 4DWIA 4S0MA 2ATCB 3M8WA 3HFVA 2VPWB 1X4BA 5IM0A 2WONA 4P9SA 3CCLS 1RTDA 3NGDA 3A13A 5LSRA 2HQ3A 1VBZA 4DCOB 1XNQF 5A8RB 3QRQA 3BDPA 1TKTA 2E29A 2HBZB 5E5NA 5CD4H 3H4DA 4J7CA 2D3ZA 3NGKA 1HWLA 5GVQA 4KO0B 5U47A 1JXEA 3AJ1A 1PC5A 5A2QU 1Y5NB 1JJCB 3HMJG 4FXVA 3TUJC 5F9LA 1NDCA 1N36F 2R8JA 3LQVA 1DLOB 2VFVA 2R2SA 3AD8C 3N6NA 3WBZA 1HYSB 3HULA 2RDDA 3H0PA 2H65B 2K7JA 3HD2A 5JVGQ 3DOLA 2AQ4A 1S76D 3A12A 1JLQB 3M2UA 2LCWA 4YN3B 3UO0A 1HNVA 1V5VA 4W98A 5HVFA 5KFRA 3JQKA 3KDNA 1XR5A 4DPOA 3B6BA 3EXCX 2SXLA 3UPFA 2PGCA 3JYTA 2Y1RI 2UVVA 2CQCA 1UVIA 2MQQA 4N8OA 3V4MA 1W2BR 4U7UD 2HVZA 1VRTA 2PMHA 4ZJLA 4OJ3A 2FGCA 1FRLA 1KC8T 2V2QA 2W4PA 4TNOA 1T9UA 5D4OA 1FJ7A 2GJIA 3R2CJ 2VC0A 2I0XA 4X4TA 1ZH5A 2HVIA 2M52A 3IGVA 2OPPB 3PFEA 3JSYA 4ES2A 3OFFA 4C0HA 3G8SA 3GILA 2CPFA 4TVAB 2CQHA 1WOOA 3CCQS 3KLVA 2D41A 2LKZA 2OP5A 1I51B 1KQGB 2DPJA 2YKMB 3RBDA 3BSAA 1VI7A 3I6PA 4KPCA 1IBLF 3R5JB 5ETSA 4ZVQB 2BJ1A 2QLBB 2J9EA 1NJWA 4X4NA 5BYRA 3ILJA 5IWAJ 1NRKA 3QYYA 2ZZNA 3MEGB 4PEOA 1F5BA 2UU9F 2DGVA 4LUBA 4WTYA 5F0WA 1PO6A 3F44A 3HM9A 1S6UA 3CCVS 4DFJA 1RYRA 2MHEA 2OHDA 3DXBA 4OV1A 2B6AA 4AFFA 4RNOA 4DL4A 3FK4A 2Y1IA 3Q8QB 3GQCA 1UCNA 2UXCJ 4X62J 1RAEB 2R2TA 1XMQJ 1BWEA 4HLBA 2VBYA 5J2NB 4TY9A 1EQ0A 4NLUA 2HZCA 2B9YA 2HWTA 2BW2A 3SIPB 5IT0A 4OIXA 1RAIB 3ZFVA 5RUBA 3G82B 1X4EA 4OZ5A 4ANDA 2VICA 2ASDA 2VOOA 4ZPVR 4OX6A 5JVHQ 4Z7CA 5EHHA 4EEYA 2AU0A 4K4ZA 4NASA 2L41A 2PC6A 1X9MA 5MAOA 3CIMA 3I55S 2ACYA 2LU1A 1UMJA 1BWVA 2GGPA 2EBEA 3CJ0A 2R7TA 2VFUA 4CZCA 2VDIA 2WK4A 1T9XA 2JVRA 2IFXA 2DCLA 3BPSP 2V8GA 2B7BB 4CRJA 4CH1A 3IM8A 3IR6B 1JK9B 1U09A 1WEXA 3K2YA 2A10A 4OZJA 4DMZA 3ITHB 2PFDA 3UNYA 3QRRA 1UL3A 2HAFA 2GHVC 2ZH6A 2DXFA 2W24A 4X65F 4RUHA 2ZWOA 1T9WA 2C42A 3UCZP 4JV5F 4Q8EA 5C24A 3LF0A 5F8HA 4ED6A 5FDLB 1QSLA 2J76E 1VLOA 1J5OA 3BYRA 2QRRA 4K2JA 3AODA 3GYXB 2IJRA 3Q8PB 1KTVA 4PXBA 4AXIA 1RI7A 2AT1B 2J7UA 3A8IA 3QT7A 4HHJA 2VQFJ 1U45A 1U48A 2FVRA 3NGRA 2BYCA 3B54A 2KRBA 2PSZA 4QYZK 1I6JA 2AGQA 3D0IE 1N5YA 3SCJE 2MB0B 2N82B 5D4PA 2IMWP 4TLRA 3DOKB 1HHTP 4LF7F 1FXRA 4F25A 1CLFA 1F60B 2KU7A 2HZAA 2K8GA 2ZNYA 2CPEA 5D4NA 5E7OB 3U02A 2DHHA 5KFHA 2G1HA 4CLTA 2HQCA 4C0OC 2O67A 5GMKa 1YJUA 1YSJA 3RU0A 1KHWA 4EUVA 3QBCA 5K8PA 1RTJA 5KFSA 4FBUA 4JV1A 4CLPA 2PE8A 1SIWB 2B8PA 2C2RA 4DX6A 2XC9A 1T03A 4FYDA 1RT6B 3FEZA 3I9ZA 4C4WA 5ITHA 4M5MA 4NRUA 3OVAA 1AYEA 5C25A 2YX4A 1N0VC 3O5TB 3M9MB 1NO8A 2HBQB 2XSFA 2C3YA 1FRJA 4USHA 4QCLA 5I3UB 2G13A 3LAKA 2R7VA 4JYAJ 2MXYA 4KB7A 2IAJA 2BJ9A 4LF9J 3KUGA 4ZMMA 4QU6A 3N28A 1CS4A 2DNPA 2NPIA 2YNHB 3GG1A 3LGHA 4ZCIA 1XNRJ 2CFXA 1HBMA 1OS5A 2GNKA 4ZPWR 3ISNC 5A6PA 2JC0A 5B0EA 4DN9A 5A76A 1VQ5S 2PMZD 2D7SA 4DR1J 2AF6A 3VF0B 2FVSA 2WB4A 4CNZA 4CLKA 2OO4A 3NAHA 2WSFC 2XMKA 3O6QA 5IV4A 3DLEB 2LDYA 3TRGA 1FRKA 3M7VA 1LKZA 2V8PA 4QIFA 2FHJA 2FHKA 2ZOMA 2PI5A 2HNYB 3TZXA 1KLMA 3CC2S 2VL1A 3GB0A 4A47A 2VQEJ 3OXLA 1HBOB 1VLYA 2V8DA 2AGPA 1RT2B 2I8EA 2GAGC 3EDQB 4YMEA 2KFYA 2DR6A 2EW9A 4KGVB 4M95A 2FJXA 1KWMA 2V50A 1W7WA 3H4BA 2F8EX 5I42B 3T6JA 1T9VA 4C98A 4UOCA 3PKMA 1YRTA 4ZPCA 8RUCA 4X4VA 4IDKB 5J2PB 4K50A 2KT2A 2ZE2A 4XDCA 2HGNA 2G0IA 2OEKA 3EGNA 5KG0A 5T7LA 3DFEA 2JOQA 4ES3A 5F3ZA 1B99A 3GIKA 1FVSA 3PEJA 4ZVHA 4DSFA 4QQBA 3NWRA 3WIVA 1TFYA 5ETVA 1NLKL 1FRXA 1NCLA 4CYUA 1UAWA 1VYAA 2BACA 1U26A 5LMUF 2PA3A 1YZ6A 1VQ8S 5K5MA 4CO2A 2MKCA 3UCUP 4DPTA 4JI1F 1TZ0A 4ZPTR 4ZVFA 1LV5A 3P49B 1CC8A 2HNZB 3LA0A 2JFKA 2BZ2A 2DGSA 3NP5A 4GKJJ 4IO9Q 1FK9A 5J1PA 1KVKA 5BR8J 2MPUA 1WC6A 4LF7J 4HH0A 5HSPA 2B8QA 2OUGA 1IJEB 3HHEA 1EP4A 3KG0A 4OX9F 2BRKA 1NK9A 1VK3A 2Q66A 1SI9A 2MTLA 1QSSA 4ZP7A 2CJBA 1DTTB 5BR8F 4PAAA 4I4BA 4WE1A 4KJIA 2OEJA 1MROB 2VDHA 4P2XA 4P71A 3UR0A 3D1OA 4XDDA 3GZ7A 4ZVPB 2C22A 3NXZA 3EM1A 4P2MA 1C1CB 2DITA 3OBIA 4USKA 3CF5Q 3MMAB 4UOHA 5I3PA 1MU2A 4K4XA 4WWSA 2V5HG 1FERA 5CYQA 3OUYB 3DRXA 4B3TJ 4PYAA 4UF4A 5D78A 1SV5B 1MG7A 3MM5A 1H6KX 2HK3A 2KM8C 4ZK7M 1BMQB 1ZPWX 2AJFE 4BBYA 1WC5A 4FNIA 3M2VB 1S1UB 1MNEA 1FA0A 3K0JA 2E66A 1ELOA 4ZPDA 5L8RC 4PG8A 3U7JA 3D54A 4P52A 3H5SA 1CJUA 2JLEA 3E01A 4M5IA 3MM7B 1SC3B 3PX0A 2Y8YA 1HLWA 2VC1A 4IYQA 2JLGA 4M5DB 2FQQB 4C0BA 3MM6A 4L73A 2B7CB 2ROEA 2JVOA 3C2PA 1JIHA 2MQLA 2QX0A 1GTHA 2X1FA 3ELHA 4NWBA 1V6HA 3GFHA 5HBMB 4N56A 3PKYA 1QAIA 1ZAWA 4ID5B 4F04B 3CW2C 3D1QA 4PPZA 1BQMB 2UXDF 3MMBA 1FWPA 1G3OA 4ED4A 2VONA 1YJWS 4PWDB 4I2PB 3TAMA 8AT1B 4ECQA 1IKVA 4QIWD 3CJKB 3OHAA 4IG0A 1CS4B 2H5EA 2YNHA 3VGTA 5B09A 2F4FA 2QL9B 1HBMB 3JQJA 3IWXA 5BJRA 5L39A 2F7VA 4J91A 1HNXF 4KH0B 3UD4P 3MOZA 4DU7A 5D4LA 1KD1T 2CPYA 3H42A 4USUA 1NNDA 4M1KA 5KG4A 4LF5J 1RWPB 2KDOA 4RR5A 4DV4J 3THPA 3CDBA 2XMAA 4LF4J 4PCQA 1OJ4A 2BV3A 4HL9A 4KGXB 1R8CA 5B0CA 3QWPA 1ZOTA 1NSAA 3GR1A 4OZLA 4TYAA 5DG8A 1IR1A 1RQ0A 3QAEA 3TJ8A 3DI6B 1NDPA 4BC9A 4OZ3A 3R7BB 1SH3A 1QTMA 4P72A 1WHVA 2DH7A 4PG4A 2LXFA 5IQQA 3VHQA 1VQKS 4B9NA 2UUAF 2MZQA 3DM2A 1EKRA 4PR6A 2NQPA 2YQ0A 3AY0A 3MGJA 3W3SA 2CZVC 1YHQS 2RHQB 1L3TA 1SVDA 3CD6S 5D8HB 3TQ1A 2CNOB 5E3RA 2M0GB 2HQFA 5F8MA 4K4YA 2YBVA 4WKYA 1SIZA 2IYIA 1TKDA 3NGUA 4JI6J 4JI7J 3M8RA 3RR7A 4ZHRA 1TKZB 2GC8A 3IBWA 3PRVA 4Y2IA 1DARA 4CIOA 1SQFA 4TYBA 1C4CA 4LFAJ 4OHZA 1PJ5A 1FFGB 1SC6A 1X5PA 2I5JB 1SKSA 1RWUA 3OW2R 5J2QA 1HHQA 1NHUA 3OT9A 4OFZA 4YY3F 4XO0A 2E1CA 1UVMA 3FSYA 4USJC 3THVA 1QSYA 1ICEB 5MLCV 3QT8A 5HQ8A 3R3TA 2CJAA 3ZTQA 2HAIA 3TA2A 5IS2A 1KN6A 3Q2TC 2LQBA 1VR6A 3FEYB 1WELA 3A3OB 4FNHA 4NI2A 4NMLA 5HI7A 1Q8IA 4LRBA 4CLYA 3M2RA 2V8VA 5M2UA 3CDWA 3QAUA 2X3DA 4DSEA 3F73A 1LWCA 2AZ1A 3HHDA 4LRCA 4WTOB 3H2LA 5A8RA 1C4AA 2UUCJ 1WHWA 2BW7A 3EZOA 1SXLA 4DX7A 2CUYA 4MYTA 1HHSA 1IJFB 2HFUA 3IS9B 3TOQA 4Q2LA 1L5UA 2HHSA 3Q8VA 3KMSA 2VA2A 1VIOA 1XMQF 1X8DA 3C15A 4KV8B 3VGUA 1B7YB 1I1GA 2XSJB 4F4WA 1C1BA 1LOUA 1WI8A 4A8WA 3PR5B 4LREA 2VJVA 5KFVA 1VQMS 1TL1B 4X2BA 4K4TA 5LL6d 3TP2A 3JSMA 3RRKA 4K4UA 1K0VA 1YRXA 1QY7A 2K1RB 3HZGA 5FJ4A 3L7OA 2KZMA 3CO9A 4JBCA 3DHWC 3FBBA 3MD3A 2MZTA 1FNMA 3JYTB 4DCJB 4KKOA 3B82A 4K0KJ 4EMDA 3I56S 3NOCA 4OHVA 5E3AA 3ENVA 3IWNC 2Q1LA 2ALZA 4DEZA 1MW7A 2VPXB 3FDSA 4A48A 3RBXA 3FSXA 3R27A 2AYGA 2LQJA 1HNIB 5H9FK 1GX5A 2BJ7A 4FF1A 4RBUA 1L3UA 1ULRA 2XCAA 2RSQA 1RHUB 3GJRB 3PO4A 3J7YI 1NSQA 1VRQC 3P8BB 3W64A 1O51A 1TELA 2XHWA 4TY8B 1VFJA 3MM6B 1S4EA 5D77A 4RWXA 3R97A 1T05A 3ONQA 1S6OA 2AYEA 2YKMA 1G4CA 4CP5A 5C42A 3HF5A 3ET6A 3T1AA 3AQOA 3HT3A 3GWCA 3LUYA 5F9NA 1RA7A 4DQPA 1IM4A 1IBKF 2NSBA 3BQ2A 2XM3A 1UWBB 5E0OA 4HEA9 4RW6A 2XYGB 2Y1LB 2Y1JA 3KWMA 3RRHA 3R2DJ 3AQPA 4KHMA 2DVIA 1UP1A 4KY3A 3CPWR 4WFYA 3FRZA 2BOAA 4AL7A 4F67A 2FLOA 4LIWA 1FKAF 1KFDA 4J9RA 3THTA 2WZ1A 3TVKA 1OQ3A 2YX1A 3DC2A 3RG6A 2CQGA 2DXEA 3UD5A 4ECTA 1D8ZA 3NOGA 1T3NA 5ETQA 3C46A 4MTPA 4RPFA 2HHQA 1WSRA 4ZVOB 2UUWA 1KKHA 1CG2A 1T02A 1HW8A 3SFUA 4DI6A 5ETMA 2R9LA 4UTGA 4NMXA 4YR2A 4IG3A 4ICLB 2G0CA 4LSLA 5GAHU 1JLFA 3MPDA 2G9OA 3HVTA 3AT1B 3L95X 4F8RA 1F9FA 4P6QA 1M1HA 2D1CA 4M5GA 5KFKA 3D0HE 2HQGA 2ASLA 3DRSB 3V6DB 3R5CA 1NHVA 3PW4A 1JJ4A 3R6GB 2ZC4A 2KJVA 3A1YG 4J9UE 4Q5VA 3EWGA 3I96A 2MYFA 3ITHA 3Q83A 1XMBA 3CCTA 1DLOA 1Q8BA 5F8JA 2ZBPA 1YBAA 2QZ8A 3SCLE 1RT3B 5L1LA 1AUSL 3ETMA 2VZ9A 4F3QA 3EXYA 1A0OB 2X1AA 4MFBB 3SMZA 4AE5A 2BQ3A 1FTRA 2ZH1A 4LT6A 3SFGA 1NSKL 1FFWB 3HHKA 3EGZA 2ERRA 2W2NP 3H59A 2N4CA 1Y5LB 4ERDA 1HD1A 4HKQA 3VAJA 1HWKA 1WHXA 1LW2B 1X5OA 2J7KA 4DG1B 2UXBJ 1UEVA 1VRTB 5I4MA 4PABA 5JMNA 1JLCB 1JLEB 3EMTA 1SJ4P 1F3VA 7AT1B 3MMJA 1N32F 1X9WA 1LXJA 1RT2A 1QJHA 4MMOA 3EVMA 1AA1B 3T3FA 2Y8WA 3ILIA 4KE5A 1MWYA 5D0RA 2ZM6J 1UPMB 1T3OA 4NYZA 2E44A 2VD3A 3ZZOA 3G6XA 1RAHB 4NLOA 2E7XA 1U1RA 4IDKA 5J2PA 2CQ1A 5DZ7A 2OFHX 2F9JA 1E6YB 3MZIA 4DPXA 4DL3A 4DV0J 4I67A 2G2YA 4BLGA 1D9AA 1NKEA 2R42A 3KHRA 4J9PA 2DHXA 2UUCF 4IOAQ 3K5NA 4CYUB 1T11A 3MEGA 2ZFHA 2DJWA 3MUMP 4O4GA 2GVZA 3PEHA 3L4BC 2W1BA 1R8PA 3D9BA 5LSOA 2J9DA 4IQXA 1NJYA 4N41A 2HNDA 3T19A 2W4DA 2FZCB 2AW0A 2F63A 3RAMA 3DLKA 1KQFB 3VTIA 3KDOA 4WJBA 1B64A 2G2ZA 2FLPA 1VJQA 3CUNA 2CXEA 5IOLA 2HBYB 4GMKA 3PXGa 2IC3B 2M9KA 4U67Q 4ECYA 5GMEA 4RBVA 3OJUA 3PO5A 2BR0A 2MLZA 2F4VF 3ZZTA 3Q86A 5EN1A 4NEYA 3I0RB 4YQWA 3IA0A 4X64F 1WWHA 2MZSA 1IKWA 4UUWA 3UE2A 2PIIA 4DFPA 3GMGA 4LF6F 1RT7A 3NBPB 1X4HA 3R7NB 3W5XA 2R8HA 3I82A 1YJVA 1V5IB 2IIHA 4FN5A 1QTNB 3I4PA 3AA8A 4RJVA 5HANA 3OR2B 2VU5A 2XO7A 2OJ3A 2HLTA 3CDUA 1IBMF 3N5BA 1HBNB 3BKFA 3H5UA 2DTJA 1ZM4A 3K5MA 1PIEA 4RKUC 1RTDB 2F3JA 3IR7B 3UR3C 3H40A 3CC7S 5D6GA 3MEDB 4DV6J 1TKTB 3HPOA 2FGOA 3MTKA 4A4JA 4D3GA 1Y5IB 4A46A 4PQUB 4LF5F 2DNHA 5C24B 3OTEA 2WOMB 3SYZA 3F41A 3EE3A 3PIOQ 1J5EJ 4CLFA 3Q8YA 3L3CA 1AFIA 1J5OB 1SJFA 2RRBA 2HZVA 3FUYA 4DJBA 3C16A 1FRMA 4ZVSB 1NK5A 1TK5A 4K4SA 2V0NA 3MTJA 3PYFA 4W90B 3O44A 3IR5B 4ECZA 4M5DA 3UN3A 1W25A 4QW9A 2B3TB 2UV8G 4FYXB 4DR7J 1FK9B 1RLDA 3FRYA 5KFAA 2UXDJ 3DOKA 2WTFA 4ETXA 2ZOFA 3HHLD 3MM8B 1RTZA 3AFGA 1NXIA 1FJGF 2YWHA 3K7RA 4UZBA 3SI8A 2B51A 1U8WA 1UA1A 1RHQB 3DRPB 1WEYA 9ATCB 1CULB 3C6UB 1FRHA 4JV0A 4X4UA 1KVJA 2A2DA 1NJIT 5LMNJ 1H2VZ 3LP0A 2R8GA 2W9BB 2UXBF 1OY6A 5ADZA 2W7PA 2VJUA 4ILMA 4GC7A 3M8PA 3VCDA 1IQTA 1RLCL 3VR1A 3T1HJ 1WDTA 1FXDA 1Q0NA 1WF1A 2XLKA 4JYAF 3LGMA 3TX8A 3P5TL 2AV5A 3ISND 4CO5A 4YY3J 2CIMA 2VUGA 4CT8A 1U1MA 3FZBA 3LP2B 3MR2A 3R1LA 2LA6A 3EYZA 2LVWA 4A8QA 4B3TF 3CJ8A 2CJXB 3BYPA 4PZVA 3M32A 5EX3A 4LFAF 1IQZA 1VS3A 4RW7A 1LNQA 2E1PA 3RW6A 1OYEA 4F0MA 3CEDA 1AXQA 3AA9A 2W7OA 2CNNB 2AGOA 4USTA 4LRFA 5E3CA 3D6MB 4RBTA 5FD1A 1WOPA 3KLEB 2R7SA 3QQCD 5LJ5Y 2HNYA 1E6YA 4AD6A 5LXYA 4BDPA 2B4VA 3CD0A 3F56A 3K5PA 3W61A 1U1KA 1N5TA 1RE1B 1VRUB 2RIJA 4B9MA 3QZ8A 3BN7A 4PPDA 3P96A 4O4GB 3SSQA 4H4MB 3DLHA 5D3GA 3J80U 1S10A 2VA3A 4KFBB 2E5LF 2F40A 1F2HA 3MDFA 2DGQA 4R5PB 5C5JA 4DV2F 3KLIA 2XNRA 2XB2D 4O44A 1IWAA 4UT4A 1QLNA 3OL6A 1TTHB 1Y7PA 4FYYB 5AE2A 3OLBA 3ZZ0A 4GKKJ 2QIFA 3FMBA 3MFHA 1R0AA 1HPZB 2GMJA 4ZA1A 1FESA 2OI2A 3PHTA 3GV7B 5DETA 1S9EA 2GQ2A 1NZAA 2HWHA 2V6AA 1VBKA 2HFZA 3DRRB 5D0HA 5LMUJ 4PUOA 1QVFR 4QWAA 3W1YC 1NK8A 2YWFA 4WF9Q 2AEFA 3EICA 4KAIA 3MUTP 2KFNA 3BV8A 1BUXA 2DT9A 4CTAB 4NLGA 1JLAB 4IFYA 4RU9A 5E33A 3TUPA 4L72B 3IS9A 3S01A 3GYNA 2ZH9A 1OPIA 2DGOA 2A6OA 4HVZA 2QLWA 4CCHA 4KPYA 1Z4UA 1OO0B 3H90A 4K8RA 1VBXA 1IVZA 2Z2LA 4ZP9A 4OLOA 4CWBA 4NYOA 4QR2A 4DR1F 1FDBA 3NGTA 2ZDPA 4YHHJ 1PJ6A 2DNGA 1XTZA 2F65A 1TL1A 3O8WA 3BZQA 4L6V3 2GQCA 1T95A 3HFZB 5EWEA 4ZCMA 2OTLS 4WP8A 5GADI 3M8ZA 1UFKA 1F9HA 3BREA 3ZO7A 2J7WA 2BUNA 3BGRA 3G8QA 4FF2A 6FD1A 5HLFA 2MKYA 3R5GA 4O0NA 2CWKA 4HHUA 1NK4A 1TUGB 3MAQA 3DYAA 2AHOB 2XYPB 4FYWB 4LF2A 3ZZZA 2J0SD 3MMCB 3DHXA 5K14A 2V4RA 4KHPF 4OI1A 4ECUA 4QYZJ 1WI6A 2RE1A 4NYPA 1RUSA 2EFOA 3CJQA 5KT4A 1T03B 2W2PP 3CMAS 1N5VA 3MECB 3QJJA 1S77D 1Q5VA 3CDEA 4R0EA 1FXLA 2RILA 5K8MA 1FVQA 2X1BA 2MKKA 1T05B 4KGKA 4ENOA 2B5JB 4JB8B 4DV6F 1LW0A 4CLLA 2VPYB 4ZVEA 1OIAA 2HVDA 3PJWA 3MM8A 1YLXA 2LFVA 4WIIA 3FBCA 3UDVA 1A7GE 4BC7A 1XK8A 1EB0A 3IRXB 4XPEA 3TZZA 5DG9A 5ETLA 3HVWA 1QAXA 1P9QC 4U8YA 1FF2A 2GJFA 2EBGA 1S59A 1Q81T 4C6AA 4C97A 2CJ9A 4XTTA 1TK8A 2QC3A 2HK2A 4CLSA 1RYSA 4I0WA 3M8PB 3NL0A 2O66A 1RWXB 4DF8A 4MIBA 4LQ3A 2GS8A 3ISZA 2RQKA 1S99A 2K1RA 2CVEA 3OR1A 3PRDA 1S5ZA 2CQDA 3LWMA 3NCQA 3TVZA 1U0HB 1NB2A 1UJ5A 3FKBA 2DISA 2XQCA 3RB4A 4CH7A 3NNHA 1CPZA 4I6AA 3R7SB 2H5IB 3OSNA 2YPYA 5C7PA 3BGLA 4DQRA 3E2EA 1CEZA 3HDSA 4QR1A 2W2QP 2BX6A 1TAQA 4FXDA 4RW4B 3GSDA 1CJTB 1F3FA 1HNIA 2ZVSA 1XMOJ 2K7KA 2ZE2B 1NB7A 2VG5A 5DQGA 1KRPA 3CJ5A 5L9XA 1DTQA 1R27B 5T7LB 4DSJA 3T5JA 3DRSA 3V6DA 5AXNA 5B0DA 1Y9OA 3M30A 2QMUB 2XULA 1H74A 1SJRA 3G87A 2N7CA 3IXQA 5HL7Q 3BB5A 3DOMA 2QA1A 4RW8B 5K8NA 4Q43A 3UN5A 1U2CA 2KYXA 3N5FA 4C8ZA 1X4FA 3QJLA 1O5JA 2M88A 2MKSA 5HK4A 3GTYX 2P6SA 2LEAA 2DNNA 3ENAA 4ZVTB 3OV7A 2BVZA 4JI5F 3CGIA 3KJQB 1D3WA 4QWDA 2H51B 1EHWA 4EZ9A 1R0AB 2PT0A 4FZVA 2B9EA 4QWCA 4LRDA 2EK6A 4L76A 4LSNB 3KJVB 2FJWA 2I5JA 4PUOB 2P6TA 2FIUA 1PAUB 3R5BA 2EG2A 2JHEA 2ROGA 3H25A 1C0UA 2DGXA 2YKNA 4EGLA 1R0BG 3JSRA 4FVMA 1JNZB 4ELUA 4NZ7A 3J7ZT 3VGSA 2W9AA 4URGA 4IG3B 4LSLB 1HFEL 3IAS9 2QV6A 4ZLNA 3DCAA 4B3SJ 2HHHJ 3B8HA 3PZPA 1RHKB 2OH2A 3U1MA 2M70A 5CYQB 3OUYA 1JWWA 1X4DA 2B0GA 3EPIA 1GXLA 1H7WA 4Y2MA 4JI3J 3D3CJ 1ZZFA 3GIJA 4GVBA 1DFDA 3K57A 3P4UB 2XBPA 2DNQA 4U7CA 3SSSA 3V4IB 3LP1A 4M5HA 4J9QA 2PMWA 2M2BA 4DV3J 1EIYB 2HMIA 3M6WA 4F02A 1RU2A 1C1BB 3PCOB 3HSJA 4OYIA 1N5SA 3JSBA 1VGYA 2CNKB 4AT1B 1VQ9S 4OMFG 2C3PA 1BC6A 3MR6A 1DRZA 4DSIA 1CC7A 1R43A 4UOFA 2XLIA 1NK6A 2I2YA 2HEKA 4DL2A 1X4CA 4OZNA 4P10A 1HBUA 3LPEA 3JAMY 2OPPA 3E3XA 4QOTA 3G96A 3CCES 3TAQA 4I64A 1Y3KA 1Q79A 2KKHA 3ZTRA 2OPQA 1BQMA 3QIDA 4FYVB 3TO8A 2G1DA 3DLGB 4K7QA 4F4AA 2KHCA 1VHFA 3MPUB 3PDNA 1FKOA 3D68A 4MIWA 3OSPA 4PKDB 5BYSA 5H9EJ 2AJ2A 1PCAA 3V81B 4JI0F 2UZAA 3D2WA 4B08A 3NRBA 3D28A 4NLWA 1F0XA 4DR5F 2CAJA 2I6WA 2W8LA 2XS2A 5IT9U 1RTIA 4C3MA 2RAQA 4ZOSA 4HYKA 8ATCB 4NE9C 3M9OB 3V6KA 3T9ZA 4MKBA 4KC5A 3QZ7A 2H9ZA 4DR3F 1S9GA 4CNYA 2XY7A 2W9CB 3BJYA 5A8WB 2MQOA 2VBWA 4JI3F 4DZ6A 2IJNA 1HA1A 3BM7A 4MKAA 1KTQA 1P1TA 3HD1A 3HLUA 2WOMA 3H5YA 2XZWA 1HWJA 3EX7B 4K4WA 3C8YA 3T5HA 5H9EK 4E2FB 1U49A 2KG0A 2EFVA 1K9MT 3GV8B 1ZM3A 2YQ1A 4Q8FA 1WC4A 3MPVA 3NGSA 1CJVB 2DYAA 2NXUA 3OFHA 2FDNA 3DLKB 4RUCA 4J9OA 2RS8A 4M63A 4DUZJ 4J9LA 2PFFB 4EYIB 4OQJA 4JI8J 3M8YA 2RUSA 3FNNA 3P6YC 1Q86T 1KHVA 1LFPA 2FC8A 2KHDA 2V2KA 3BGUA 3ZZPA 1AZSB 2HGLA 4PWWA 1ZA2B 3J7YU 4MAKA 3GJSB 2XS7A 1EKSA 4DR6J 5J2QB 1T9YA 2Y0BB 4X4SA 3U1NA 2HG4A 3LP0B 2CKWA 4IOCQ 1LXNA 4LJMA 5DQIA 4Y34A 4A8YA 1NH8A 2DRDA 2RJZA 5DS7A 1OQ6A 4JI4J 5KG5A 3G9CA 1RAJA 2DRAA 1RAAB 2A18A 3KJNB 4OX7A 3A8EA 4DQIA 3CCUS 3DXSX 4F50A 3MEDA 2N4DA 1PBAA 3VV2B 2BOPA 3WDOA 4G1QA 2ZUGA 3Q8SB 1TMMA 3H7HB 1FE0A 1V9OA 4JI6F 2B9WA 1RDRA 2DIVA 2WHOA 4NL5A 4EFAC 5CCMA 2KG1A 1XJWB 4PXDA 2YNGA 3AB4B 1SPBP 1YI2S 4JI5J 1IN0A 5HROB 4C2MA 2BMBA 1V3SA 1HARA 5CAAA 2J8AA 2NLWA 3TA0A 5J2MB 2KM8B 1MMLA 3PACA 2GW8A 4A8FA 3BKTA 2MLXA 2DGWA 2FVQA 3W63A 1GTEA 1EX8A 1N36J 4JI7F 1UJ6A 2ABYA 2ZHAA 3RR8A 4KKOB 3T1YF 4UW2A 2GCFA 1PC4A 2C2ZB 3BGFA 3NWGA 4FXWA 4I6YA 1Q78A 4DV1F 3MHYA 5FLXY 2EC2A 7FDRA 3KLFB 2HKEA 4NCAA 4XAKA 3ZZUA 1KOOA 2KL8A 2QMWA 3KMQA 2W2MP 2VG6A 4GVLA 4DX5A 2DR9A 2EKYA 4RX6A 4A8MP 5KFPA 5F0UA 2LXUA 1YIJS 2DPIA 3NS7B 3BPDA 4OI6A 4ZN3A 1HQEB 3QLHB 3R1HA 3PY8A 2VASA 2B56A 1HI1A 1R0CB 3KNAA 1G2EA 1CSJA 4HT5A 4OJ1A 4DOZA 2J6SA 1T9TA 1HIYA 4HI1A 1FD2A 1HBUB 2H4YB 4Z7YA 4YDXA 4ZVGA 5T41A 4HDGA 4IKAA 5A6WA 3GSIA 1F5AA 4DL0C 3LP2A 4ZJOA 3ENQA 2CPHA 5HAOA 4DUTA 2MDAA 2CQIA 2KT5A 1QVGR 4JOUA 4ZLPA 2RMLA 2EC0A 2XTJP 1N8RT 1NU4A 4X66J 2ZHBA 3IBCB 1IXKA 3UW1A 3V2UC 3W8GA 1HI8A 1U25A 3M8QA 4G1PA 3V81A 2APOA 1R8BA 1Y4ZB 4OHWA 3KKFA 1WDDA 4GRSA 4FPIA 3FSIA 2AIRB 2UP1A 4B9VA 4ED7A 1BE4A 5B08A 4U7UK 2YWGA 2VG7B 1R3NA 3MPYA 3RB3A 3G4SS 2ZUAA 5ETPA 2OFGX 1RT7B 3QPIA 5EGYA 3CCJS 1ZTWA 2E9ZA 3K89A 1FKPB 1FDAA 3OR2A 4ICLA 2WRMA 1SQGA 3AH6A 3U1LA 4DUYJ 2OLWA 4DR2F 2UVWA 2HRYA 4TXSA 5DG7A 1QE1B 1N54B 2J0QD 4DQQA 2HHTA 2GZOA 2J5AA 4Y2CA 4EK2A 5B0AA 4LF8J 4LF1A 3NKYA 2HVEA 3A4TA 1K8AT 1HPZA 1FI4A 2KRRA 2R4FA 3VQTA 2ZH8A 3LGNA 4ZKAA 2XZDB 4ILLA 1R8AA 1ZS6A 3DU6A 1NHKL 3G6VA 2F8HA 1QM9A 3JTPA 4NOHA 4K5RA 4WPAA 4CLZA 2RDIA 5HMWA 3T9NA 4YUDA 3D0GE 4CTAA 4XK8C 2AX0A 2N3LA 2HURA 2FD2A 3MOJB 3V5RA 1D8YA 1N33F 2BANA 4DV2J 3AOCA 4AYBD 2E5LJ 1UEUA 1UW4A 4GKJF 4WK1A 1SB6A 4ED5A 4OYXA 4G3IA 4DLGA 2I9SA 1B0VA 2UV8A 2XMTA 2R7WA 2CJKA 1N0UA 3LALA 2ZD1B 4IFVB 4QPXA 4RZRA 2JJ4D 2RT3A 3FEXB 1MU2B 1WC1A 2PO4A 4NA1A 3UQSA 3UVJB 2ZH2A 2HFVA 1T94A 1RXOB 1TVRB 2NREA 1S57A 2W01A 3QT6A 1D1UA 1JXLA 3MM5B 4DXLA 4OJGA 3UN2A 2FC9A 2BKOA 3AOBA 2BDPA 3SQGA 1HNWJ 3OL9A 2KXFA 3EDRB 1PYSB 1B7FA 2AYMA 3EJMA 3CB4A 3J7Z5 2ADBA 4A8XA 5CZXA 5H9FJ 3S7RA 3GFZA 3MR3A 4NXNF 3CT9A 4PXEA 4W92B 1H38A 2YNGB 4CO1A 4A8SA 1X31C 3GIRA 2M8DB 4MK8A 2E7WA 3E51A 4NCGA 4WXWA 4KHPJ 4NXMF 1PYOB 5J2MA 2D3UA 4JI2F 2R7XA 2CA9A 3PW0A 2ASJA 3W7BA 4OYAA 4JV2A 2GVZB 3KG4A 2DBBA 3SBMA 4RW8A 2JX2A 1OPZA 2FPHX 2C2NA 2Z2MA 2ZEJA 2WAQD 3WZ0A 1LW0B 3N4WA 3ULHA 2M3DA 4WP9A 4ZPAA 2VKZG 3RW7A 1RB0A 2HNDB 5HBMA 5J1EA 4X4QA 4DX8H 1LWXA 2FJDB 4MK7A 2A6MA 5G0RA 1RCXB 1H2UX 2YKAA 3KLFA 2HQIA 1S9FA 4J37A 1PBUA 2UVUA 3OPKA 1EETB 2M7SA 2Z57B 5LOQA 2YKPA 4KGZB 2GIQA 4O3QA 2HS3A 3WC0A 1AFJA 4RU2A 2KJWA 3SCKE 5KFJA 1XNRF 4LBIA 2B4PA 4Q7AA 1U24A 2IM3A 1XBWA 4P73A 4ALZA 1RWNB 4CO3A 3TVYA 9RUBA 1U1PA 1M5PC 3M05A 3I0RA 4K4VA 1PGZA 1NAQA 3L09A 2DEJA 1WKKA 2ZHOA 3MWBA 1RHRB 3OR1B 4EBCA 4ELVA 1OSDA 1VQYA 1Q4RA 3CCZA 1C0UB 3GONA 3KLIB 5A8KB 3OJSA 3AXMA 1ZM9A 3B78A 1OY9A 2JSXA 1B0PA 5ETRA 1Y11A 2ASYA 2XG8A 1NEEA 1RGVA 1RWKB 1UZDA 2KVIA 2M5YA 1UTAA 2P2CB 3A8JA 3HSZA 3JQMA 4HTIA 4ZCLA 3FCHA 3QFWA 2QFIA 5LT5A 2Z4PA 5KT3A 1WKLA 3C66A 5KFLA 2ZH5A 5FLXU 2BEFA 1HNWF 1VCTA 2DNOA 5E2QA 3M30B 5LJ3Y 2VB6A 4PQUA 1GAOA 3DGPA 3KK1A 2XY5A 3PM9A 4KO0A 3J7A1 5EWFA 1G6BA 1KS2A 1RU1A 1JMTA 1SKWA 4K59A 4LFCJ 1HYSA 5CYJA 2Z2YB 3CCWA 4EYHB 4JI2J 3VAMA 4DPYA 4ZJQA 3ZTSA 5GAHI 4ECRA 1WOSA 1HNVB 2CZ4A 4J90A 2YQ3A 2YNIA 3CVKA 2V63A 2HS4A 3T6BA 5HJYA 5DM6Q 1FWLA 2K2PA 4OYOA 1TV6A 4FDFA 1J27A 1U8SA 2GO9A 4JI1J 1M1KT 4JV5J 4IRKA 3IM9A 3M9NB 3DRYA 3MF5A 5HP1B 4OHYA 4MK9A 3CO0P 1KQSR 2VFSA 3DYAB 4F2SA 1CULA 3WHIA 2DKOB 1F5CA 1LEOA 2CWXA 1WKJA 2MJNA 2GMHA 2JEFA 4FBTA 4FS1A 1FFSB 4B3RF 4RW9B 4NLDA 1FEEA 4O4RA 1DURA 3UCGA 4ED1A 4NLVA 1H2TZ 1X0FA 1NJXA 4B3MF 4DUYF 2B5JA 1GMWA 1NKBA 2ZC3A 2HHWA 2D74B 3ADAC 2IVYA 5KOXA 4IFVA 2ZD1A 4DFMA 4X64J 1N33J 2YXLA 1NZ8A 1EP4B 2OPRA 2DY1A 2XNQA 3MPWA 5KFIA 3UDLA 1BQXA 1KOHA 4X84A 1MWQA 3MAAA 2OTJS 2J8SA 3N6LA 1AW0A 2J0XA 1WG5A 3V6JA 1JLGB 2QMXA 2D69A 2HMIB 1MROA 2BBEA 2ROPA 3QGPA 4RUAA 3OTOJ 1FX4A 2NUUG 4PG7A 1OY8A 3A8KA 4PXCA 1JKHB 1GK8A 4CQ1A 3OHBA 2HLUA 3PW5A 1N32J 1RTJB 2C1EB 5CD4A 1XEZA 4OZ0A 3SV3A 1UA0A 4F4YA 2MZ1A 4PWUA 4ER8A 3TUIC 3ILOA 3POTB 1J5EF 2N7YA 4Z2XA 5IWAF 3N01A 2BE7D 3WX4A 1RKJA 3QWUA 4DS5A 1IBLJ 3CIZA 4DHVA 3AOAA 2YVSA 3I5CA 4M5KA 3J7AN 3KK2B 3VAFA 4DV0F 2DH8A 1WJ9A 3G6YA 2DD8S 2RD5C 3MCMA 3ZXWA 1X5TA 4RNMA 2DR5A 2UU9J 1YQHA 4USMA 1EZZB 1XR6A 4DSKA 2FYXA 1VK8A 3GLJA 3BN4A 5IT4A 1QUPA 3KG1A 3UI3A 2DNKA 1X7VA 1S9GB 1YWXA 1YVFA 4LBPA 2WBMA 5AXKA 3MCNA 3GIIA 4DV7F 3T5LA 1QUVA 3KNGA 4B17A 1JLAA 3S8SA 3FZ2A 3D7SB 2L9WA 3G6ES 3SV4A 2FVCA 2F4VJ 4IOBA 2YNFA 3PX6A 3GYGA 2CRLA 3RJMB 2NSCA 3BF4A 1VC5A 3ZZRA 2RH3A 2VQFF 4ILRA 4YDDB 1R6VA 3M2UB 4PYDA 2GVDB 1RP5A 3AD9C 5B0FA 1JLFB 2Z58B 4C8MA 2BXJA 2PEHA 1H73A 1KQKA 3IN5A 2LDIA 4AQYF 4A8KA 3EZUA 2QL7B 1GX6A 2DB1A 2OSQA 3QNWB 7FD1A 1ZPVA 4O3RA 4LMZA 1F6TA 3BBCA 3QATA 3BQ1A 3DU5A 4Y65A 4FKXA 3MI7X 2FJAB 2W4CA 4Y3CA 3N9UC 1RJJA 4QIVA 2ZJRQ 2MZJA 2ZNZA 3I0SA 1K44A 1FNOA 1NMEB 2LLZA 2VG6B 1RT4B 4C8YA 1RWWB 1PILA 3KUHA 4LSZB 1PG5B 4ITSA 1KBRA 5ETOA 3OL7A 3ILLA 2GIFA 5KFDA 4ECVA 4I7FB 3TR5A 3W5YA 3NMRA 2JWNA 4YR3A 2O1PA 1ZBTA 5F3TA 4C3KA 1YTYA 1HWUA 2XEXA 3CWJA 2RNEA 1NKCA 3BR8A 1UWAA 1YK9A 1V3RA 3CDAA 3I32A 2POKA 3RAQA 4AQYJ 3IRXA 3HKWA 2IRUA 4PQAA 2KT3A 1DHMA 2DEIA 3P3DA 1JLCA 2YH0A 1U1LA 1RAGB 2X7IA 1SL0A 1HMVA 4I1TA 4BHQA 1CJKB 2A3JA 5GAGI 2C28A 1JXVA 5EDWA 3TAPA 1KNZA 3TW0A 5IV3A 2AJQA 4P75A 4K0KF 1P9YA 2IDLA 3KLGA 2PI4A 1NSPA 2MJUA 2V9KA 4F26A 1O8BA 2QEXS 4M5JA 3S6EA 1UZHA 3FC9A 3RUBL 3M2RB 5L1IA 4JI4F 3QRPA 1QAYA 2AZ3A 2C3UA 3FCWA 2PN6A 2V9WA 1S48A 3RTVA 1UFLA 2RRAA 4DR6F 5L9NA 2EI5A 1Q1KA 3EUNA 3M8SA 3QO9A 4NX9A 2ZKUA 3MR5A 3K59A 4WKRA 4LFBJ 3BH7B 4DSLA 3M2VA 1IKXB 3IAM9 3CD7A 4L75A 2WW4A 3S1TA 1S1WB 2CPXA 3R6LB 2QN6B 3PV8A 4MJKA 2HSEB 2LMIA 4BCAA 1JKHA 3Q8UA 4UOGA 1WEZA 2GJ2A 3QLHA 1SBRA 2HHVA 2C2EA 2ZBRA 2BQUA 1IKYB 5KG3A 3CJ3A 2AMCB 3CCRS 3NNAA 2VV5A 3PG9A 3HT0A 5AXMA 2ALYB 6FDRA 3US5A 3OXGA 4OI4A 5C2GA 1CJVA 1Q16B 2QFJA 1GMUA 4J9SA 2RU3A 5FDLA 2EEYA 1IKWB 1KR4A 3RZAA 2AP6A 3OFEA 1U6BA 3D66A 4YB7A 1N56A 2J6TA 1FJCA 1SJ1A 1H0HB 1OWXA 3CJSA 2NXCA 3HZEA 4ZIWA 5KFWA 1VQNS 1YX2A 4TY8A 2XGPA 1IBKJ 3AB2B 2LXIA 4DV3F 4IRCA 3QJPA 2LP4A 3PYDA 2C3OA 1REVB 3CJ2A 1TL7A 2HVHA 1MN9A 2A2CA 4YFUA 4Z37A 1E6VA 1VQSA 2C2DA 1WG1A 2IPOB 5CH7B 5DJBA 1IWGA 1MMNA 1SH2A 4DZDA 1XNQJ 3B4MA 2EK1A 3C6TB 4O0IA 3MXHP 5FIIA 3SQOP 3C14B 3HSGA 2ZJPQ 2IMOA 1QE1A 3DM2B 1M1GA 3J80Y 1FCAA 4WFBQ 3TANA 2MKHA 3L9ZA 5KFFA 4U95A 1YITS 3UFCX 3V4IA 2VKRA 2ZBCA 3VAKA 2EG1A 4XPCA 2IAJB 2AEMA 1Q82T 1P27B 2DHSA 5A0YA 2GMLA 4Y2AA 1CJUB 2HRUA 5A2QY 1D9DA 2OIHA 2ZVIA 3LOUA 5K20B 1QD1A 3BS9A 2RQCA 1S0VA 1JLQA 3VVTA 1WD6A 2FHMA 2V4JA 5G4DA 1RCOB 2QJ3A 1Y3JA 2E1MC 3FJ2A 5KFTA 4LFCF 3AD7C 2WVFA 3KJFB 4OJHA 3X3UA 5IC4B 1TAUA 1T8EA 2NZCA 4NI2B 4CLUA 4ID5A 3QSYB 4USWA 1Y00A 3GCXP 4RUBA 3MMBB 5F41A 4ELTA 1CVJA 2KZZA 3AXKA 1HW9A 4ETZA 3OVSA 2QA2A 1SCJB 1IKVB 4KIAA 5LXRA 4FF3A 4Q2MA 5I3QA 1Z1ZA 3OFGA 6AT1B 5HQLA 2QLXA 1OMSA 1R89A 3FQLA 4FPRA 4ED0A 4TLQA 2ZH7A 4DDFA 4Q45A 4HDHA 2Y3YA 2JZ5A 2CG8A 1SJQA 2KXNB 3D4JA 3BSCA 4O23A 3O3LA 2O01C 4ANCA 3TI0A 3C15B 2N3OA 4L74A 4QIEA 2XSJA 1S6QA 3KLGB 3FCVA 1DQ9A 2MQ8A 3ICLA 3VWSA 1APSA 3DGPB 3KK1B 2WVBA 4DR4J 1C2PA 1S0OA 1DZ5A 2H3EB 5SUHA 1U47A 3R9LA 3QGHA 4USVA 4B9SA 1FEHA 5KFZA 1M5HA 1S4FA 3WIUA 4IUFA 3KTQA 3VQSA 2BA9A 3EGVA 2CQ3A 2V8HA 2BJEA 5KFXA 5G0RB 4FP9A 4BS2A 3OTOF 3PW7A 1WTBA 1H7XA 2YNIB 3B4DA 3FGVA 3I5BA 2VH7A 3W60A 4NLYA 5KT5A 1XMOF 3EPGA 1M90T 2OMOA 4X4PA 4QZVB 5D0GA 2NPFA 4TQRA 2AX1A 1H3DA 1BY9A 1HWIA 4AL6A 2GAHC 4QWBA 1KLNA 1AZSA 4E0DA 3H8YA 4YOEA 1FKPA 2QYCA 2XMWA 1HKAA 4NXMJ 2F9DA 3MEKA 3VAIA 4LF4F 4YB5A 1JB0C 1RADB 2L9NA 3M6UA 3VALA 3EVWA 1K1QA 1VOMA 4B3MJ 2RQ4A 4GKKF 1X4AA 4I68A 4RW9A 5KFMA 4KRWA 2FY1A 3CSKA 4RW6B 3D1HA 3HHNB 3BBBA 1OYDA 4MKYA 4ZVRB 5L1JA 1URNA 5KFUA 1U2RA 4CM0A 2YKOA 1YJRA 4P2SA 2CVIA 1MWZA 2AKWB 4I2QB 3DDKA 3K58A 5DLFA 1NBEB 3CJ4A 3DDIA 4Y2KA 3UWTA 4C8NA 3DLBA 1RT1B 4QPTA 4Q0BB 2C2OB 2PDAA 3E01B 2JEIA 1GT8A 5JXSA 4YHHF 2UUBF 2Y0SD 4AXJA 4ED3A 3NEKA 3LAMA 2JNJA 1ZYQA 1PJ7A 3R5DA 5KT2A 4Y00A 2YY3A 2DO0A 3UVJA 3TA1A 2CYYA 3HVTB 1Q7LB 1RT5A 5SZTA 4UZCA 4DFKA 4IR1A 2RKIB 3MEEB 2VF3A 5AJ3J 2R2RA 1KVIA 3ZNUA 2RU9A 1HQUB 5HP1A 5HVGA 3SQGB 4CI0B 2V68A 3TNVA 3LH2S 1S49A 5CYMA 3DNCA 1WACA 4YR0A 4J9VA 5KG7A 5IC6B 3HXMA 1RHMB 2PA8D 1S7HA 5GMDA 2L3MA 3T1HF 2OKQA 4CDIA 1QAJA 4IG0B 4E8UA 4MIAA 3GPAA 4I56A 4UQTA 1U6ZA 2QYGA 2KH9A 3C16B 2EFGA 5KG1A 5LMNF 5C25B 3KFWX 4Q44A 5EUHA 3RYLA 4O3PA 3GR0A 4LF9F 4FKYA 2MEWA 2YX7A 1NDKA 3D6FB 5M2RA 3PJXA 5C42B 2BRLA 2VQEF 4O3SA 1ZM2A 5DGAA 1GQEA 4Y28C 2WSCC 4DN0A 4C3LA 4XIUA 1S79A 1R31A 4DG1A 4WZMA 3L7PA 1TL4A 1MN7A 4H4OB 4NA3A 4RNFA 1N34J 3BO3A 3HVRA 4ZVUB 1UW9A 4H4KA 3CCSS 1EETA 2GIRA 4ZLJA 1I94J 3MD1A 3IP0A 3M8QB 4C48A 1XC9A 4M94A 5LSLA 4MH8A 3I9V9 2JH3A 3BSNA 1SL2A 1RBOB 4QIGA 2UUBJ 3O2IA 1RBLA 2GVDA 4DLEA 4RW4A 1VIXA 4TU9A 2VHGA 3GJQB 2E5HA 3GJTB 1KEKA 4OYMA 2R8KA 3IO1A 4B3OA 4FS2A 4X4OA 1HL6A 1RBAA 1TKZA 1BHNA 1W2IA 3POTA 5A8KA 3T5KA 2C2KB 3NS6A 4C11A 3CJTA 2HGMA 4IH5A 4D3HA 3BQ0A 2D3O1 2X51A 2ILYA 2E5GA 1YJTA 2ZWPA 3KK2A 2NXNA 2OELA 4RW7B 4ECXA 1IBMJ 3DLLQ 4WIQA 4I69A 2CDRB 4B9UA 1UFWA 3PNIA 2YWEA 4ZP6A 5KFYA 3FVYA 4NXNJ 1ROFA 1UJ4A 3CTRA 3QSIA 4LF6J 2AJ4A 2BE9B 2GX8A 2WB1D 2YWKA 3M1VB 1M5OC 2E9TA 1WF0A 2VODA 4BWJA 1S6PB 3RAXA 2B4OA 2YKQA 1JLBB 1Z2LA 2F8MA 1TL3A 4IO1A 2LEBA 2V4QA 4WK3A 1AROP 1VHIA 5CZVA 1WNEA 5HMXA 4NZ0A 3KJVA 3SDEA 4H54A 3U27A 2HNZA 2WVCA 3X1LB 5DDRC 2MGZB 2P9CA 4ED2A 1N4LA 3GFXA 3OL8A 2O3DA 1CJKA 2NXEA 3NBPA 3HK2A 2DHGA 3IG1B 4KV8A 4O44B 4F3OA 1TV6B 3PRBA 1FWKA 3AAWB 2QO3A 3RBZA 2DGUA 3M6VA 2BE2A 2CDQA 2LEPA 4YEAA 1K73T 1YKWA 5KG2A 2Z56B 3N79A 3PHEA 4DR2J 3ZTOA 3GP9A 3NCPA 1TVRA 1Y0HA 5B0GA 2R7RA 2JC1A 1JLEA 5F8IA 3DMJB 4DU8A 1FD8A 2HYIB 4WE1B 2IBOA 3RGIA 1RWVB 2U2FA 1FE4A 3ENWA 3HKZD 1U7LA 3BR9A 5CHCB 5DQHA 4IFYB 4Y6IA 4ZP8A 1ZA1B 2DR7A 2J0WA 1IKXA 4USIA 4HI2A 4CH0S 1P8GA 3TEHB 3W66A 4ECWA 5BXIA 1UVJA 4OZ1A 5AJ3F 4NLQA 1RACB 4DPWA 1IR2A 5KFNA 2EPIA 3I0SB 4M5LA 4I6WA 2K06A 5GAGU 1SKRA 4RLEA 1EJ7L 1LWEB 1HR0J 4LVOP 3PX4A 4EWTA 3QT5A 3W9IA 5JUMA 3WC2A 2Z0GA 2CZ9A 1RT5B 3W8PA 2IRXA 3H2UB 5EX0A 4DQSA 1D0EA 2VBXA 2WVEA 4F0KA 2COLA 5IQ6A 4OL8A 2QE5A 4C8KA 3MM7A 3SZ2A 4LQ9A 1CBKA 4WYLA 1S1VB 3HHLB 2UXCF 1FKOB 2EFNA 3CE8A 5ETNA 2DNRA 3GE9A 3LWLA 1UKUA 1YJ7A 2JLFA 2V94A 4N7TA 2W9BA 3W65A 2BJ3A 3P45B 2IC3A 1RAOA 2V34A 3A3PB 5HMZA 4KSEB 2DK2A 2GV1A 4ID8A 3PR4A 4RWWA 5AXLA 2H4WB 4I2PA 3TAMB 3W9HA 4FF4A 4ZCKA 3I87A 3FFIA 4DV1J 4F4XA 4DR3J 1S0NA 4IH7A 3T1YJ 3GFYA 3PIPQ 1FTCA 1W26A 2X1GA 5ETTA 1IUJA 2GQQA 2KYZA 1SUQB 3IBFB 2DNZA 2WSEC 1RAFB 1RSCA 4NA2A 5THWA 3UNGC 4WZQA 5HN0A 1YBTA 2PEBA 2OEMA 1VC6A 5DDOC 1TK0A 2NR0A 5ETKA 4NLPA 3W62A 5IFMA 5IZHA 1K1SA 2KVQE 2QLFB 1HNZF 1G7CB 1S97A 1F1BB 1URRA 2ZKTA 4KR0B 4WP3A 1JJ2R 5K8OA 2DNYA 3KLEA 1FNXH 2YPZA 1S1XB 2HQDA 3IWLA 4LBHA 3BO4A 2NZ4A 2R7OA 1CQMA 1IM6A 5IXUA 2CG4A 4DR4F 1H72C 3TX0A 2MLYA 4O3OA 1VRUA 4KQZA 2HHUA 1SQEA 3PYEA 4LR8A 2MY7A 2V4JB 1CJTA 3TJAA 4G1IA 2VIHA 1S7IA 2Q79A 4RL1A 4U6PA 4J9MA 2BM0A 2ZZTA 2BKNA 4WFAQ 4ZHRB 1RTHB 1HI0P 3QGIA 4WFZA 1X5SA 2G2OA 1LFWA 2J6UA 3M6XA 1ITPA 2W25A 3W2VA 4YS2A 5DLGA 2WONB 2EKNA 1RA6A 4JP8A 1Z2ZA 3SXLA 3UDEA 1B3TA 3MCSA 3VZHA 5KFGA 2ZJQQ 3IC1A 4EBEA 1REVA 3BDEA 1TL3B 1S1TA 4HACB 4DL7A 3CULA 2V67A 4RO0A 4QW8A 3ZC4A 3HHLC 2HHHF 2VOPA 4DBQA 2ACMA 4RNHA 4X4RA 1SKUB 5KFOA 1DY3A 1MMDA 1GFWB 4I7FA 2XMMA 1NPPA 2CADA 2L9DA 3TARA 4KT0C 4RNNA 1KONA 4WFXA 1X9SA 2RHSB 1EQMA 2XYHB 4QJVA 1LWCB 4ANEA 1KP6A 1LK5A 3DOLB 1UVNA 1WF2A 3FBFA 2Q6BA 2QL5B 1K47A 2E7VA 4HH1A 4LSNA 4CO4A 2HFNA 2AWZA 5GAEI 1NM2A 2ZZMA 4UUXA 3C19A 2ZH4A 4DS4A 3BGRB 1JLGA 3Q23A 4NPOA 3KYLA 5HLFB 1YJNS 3K5LA 1GNKA 5A0YB 2YKNB 1R6YA 2RF2B 4OYPA 5KFBA 1VQPS 1D9FA 2QGFB 4C8OA 1HNZJ 4DV5J 4NCBA 2LQ5A 3KK3A 3MAHA 4K5SA 3SCIE 3MMCA 3IGNA 5K14B 5B7WA 3JSMB 2LU2A 4F4KA 2P8IA 1VISA 2XMJA 2JEJA 1G1XA 2IHR1 3G86A 4DR5J 3K5OA 3P5BP 4L3KA 3KLHA 1FDNA 3I31A 5E41A 2P9EA 3QO9B 2CPIA 1YG0A 2QA4S 2B43A 3GIMA 1YDLA 2BABA 1U2FA 2M4MA 2VFTA 4H4MA 4M8LA 5I3UA 1KSPA 2HWIA 1DAXA 2NUHA 4R5PA 3C3LA 5F8NA 2E5IA 3I5AA 3MFIA 4OX8A 3GCWP 2AJ1A 2P5VA 3JTOA 3RRGA 1NPKA 2H5JB 2MKJA 3BEGB 2VBZA 3FMWA 1S9EB 1TKXB 2AJ0A 4IQMA 3JB9k 4JI0J 1WHYA 2ZOGA 3D5MA 5HO4A 4DV5F 2ZDOA 2LECA 1C0TB 1I5OB 3MM9B 1VJWA 4NRTA 2IVFB 2W2OP 2YNFB 3DLGA 3Q2SC 3KXDA 2J9DE 4Q0BA 1JQGA 5AE3A 4TQSA 4NLRA 4G65A 4QR0A 2YH1A 3G82A 4KTQA 2KTQA 1HR0F 4O3NA 4URSA 1FT8A 1OSCA 4W4MA 1SUQA 1FX2A 1R8HA 2LQ8A 3NY0A 1FO1A 4URQU 2XY6A 1KFSA 4C8LA 2Q43A 2R7QA 5I42A 3Q0AA 1EAYC 1ZAXA 4L3NA 3SSRA 2DXDA 5IM0B 1U4BA 3PJ9A 1X4GA 2GFFA 3DKDA 2MQNA 2GGPB 2W9CA 1NJZA 3TUZC 1E6VB 5F8LA 2IRYA 3TWZA 2IBKA 1LWFB 2I1RA 3K17A 1ZAVA 2EXUA 2MMYA 3DRPA 3I4HX 5HJXA 4IRDA 1U0SA 2DNLA 2O5DA 3OD2A 4GO7X 4P74A 4WFNQ 5L38A 4TKTA 3C14A 4OI2A 2DH9A 2QT7A 3UDCA 3BO2A 1DQAA 5DM7Q 1SJ3P 2FJEB 1GXUA 2QA4G 4B3SF 4H4KC 4U96A 3H2VE 3MECA 3A3NB 3MUVP 4G6VB 2Q3PA 4P7VA 2K3KA 1R7IA 1RISA 4R8UA 5JJBA 2IA6A 2XS5A 1P1LA 4GO5X 2Z8QA 2QSFA 1PYTA 1RTHA 4PG6A 5BYQA 1A9NB 5DDQC 3RB0A 1BQNB 5CABA 3KHGA 1N5YB 2DY9A 3M32B 1YRUA 4DPUA 2HW3A 3TQEA 1RT3A 4V1Ak 2GHWA 4LIRA 1MSWD 2E1RA 2D9OA 1N88A 1DTTA 1S1TB 2HIYA 4HACA 2ZBQA 4MFBA 5E3QA 3PTWA 3FQKA 4OHXA 3IRWP 1Q53A 2KI2A 4AUKA 2XLJA 2UUAJ 1LW2A 2A0FB 3HX9A 3MMAA 1VQ7S 4B3RJ 3RB6A 4HT7A 3ZZYA 2M8HA 1GH8A 4A8OA 3J81U 1WTFA 3W2WA 1B0TA 1UVKA 2RKIA 2MY8A 2OD6A 5HATA 2XMUA 2ADCA 4IR9A 4N76A 2G4BA 1TUWA 4C11B 1HQUA 3NNCA 1T7PA 3W5ZA 4G1QB 2D3OR 2IJFA 1I3OB 1NUEA 2CPJA 2HFSA 3LP1B 2CQ0A 2DGTA 4KFBA 2LA4A 2DNMA 1XIQA
chains in the Genus database with same CATH topology
4OZ2A 1CJVA 4OYBA 5D0HA 4OYPA 1TL7B 4CM0A 1WC5A 4OYAA 2GVZB 4WP9A 2QV6A 5D0EA 1CJUA 4P2FA 1TL7A 4CLTA 3ET6A 3UVJA 4CLPA 4WP8A 3C14B 1WC0A 4OYIA 3R5GA 1CS4B 2GVDB 1CS4A 1Y11A 2WZ1A 4CLFA 3C16B 1CJUB 4USUA 3C16A 3G82A 4OYZA 4CLKA 1FX2A 1Y10A 4CLLA 5IV4A 4OZ3A 1YBTA 4NI2B 4CLUA 4OYWA 4USWA 4CLWA 1CULB 4WP3A 4CLSA 2GVDA 1WC3A 1YK9A 3C14A 4OYOA 4OYMA 1AB8A 1U0HB 3C15B 1WC4A 1CJVB 1CULA 1CJKB 5D15A 1CJTA 5IV3A 1YBUA 4WPAA 4CLZA 1CJTB 3MR7A 4USVA 3G82B 4CLYA 4NI2A 1U0HA 1AZSB 4USTA 4CM2A 5D0RA 4OYXA 2BW7A 1WC6A 3MAAB 3ET6B 5D0GA 1WC1A 3UVJB 3MAAA 1AZSA 2W01A 3C15A 1FX4A 1CJKA 4P2XA 2GVZA 4P2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZ2 A;  1CJV A;  4OYB A;  5D0H A;  4OYP A;  1TL7 B;  4CM0 A;  1WC5 A;  4OYA A;  2GVZ B;  4WP9 A;  2QV6 A;  5D0E A;  1CJU A;  4P2F A;  1TL7 A;  4CLT A;  3ET6 A;  3UVJ A;  4CLP A;  4WP8 A;  3C14 B;  1WC0 A;  4OYI A;  3R5G A;  1CS4 B;  2GVD B;  1CS4 A;  1Y11 A;  2WZ1 A;  4CLF A;  3C16 B;  1CJU B;  4USU A;  3C16 A;  3G82 A;  4OYZ A;  4CLK A;  1FX2 A;  1Y10 A;  4CLL A;  5IV4 A;  4OZ3 A;  1YBT A;  4NI2 B;  4CLU A;  4OYW A;  4USW A;  4CLW A;  1CUL B;  4WP3 A;  4CLS A;  2GVD A;  1WC3 A;  1YK9 A;  3C14 A;  4OYO A;  4OYM A;  1AB8 A;  1U0H B;  3C15 B;  1WC4 A;  1CJV B;  1CUL A;  1CJK B;  5D15 A;  1CJT A;  5IV3 A;  1YBU A;  4WPA A;  4CLZ A;  1CJT B;  3MR7 A;  4USV A;  3G82 B;  4CLY A;  4NI2 A;  1U0H A;  1AZS B;  4UST A;  4CM2 A;  5D0R A;  4OYX A;  2BW7 A;  1WC6 A;  3MAA B;  3ET6 B;  5D0G A;  1WC1 A;  3UVJ B;  3MAA A;  1AZS A;  2W01 A;  3C15 A;  1FX4 A;  1CJK A;  4P2X A;  2GVZ A;  4P2M A; 
#chains in the Genus database with same CATH topology
 1RKI A;  2UUT A;  3GG0 A;  1HNX J;  4OZ2 A;  2RF2 A;  1DTQ B;  2QG9 B;  2FLL A;  1CQN A;  1B4S A;  1NPR A;  2KB2 A;  2VFR A;  1S6Q B;  3KK3 B;  1VBY A;  2DR8 A;  2RB7 A;  2MQM A;  1LQ9 A;  4JUZ A;  2Y9H A;  2RQM A;  3DRR A;  1N34 F;  1BXN A;  1IKY A;  2XHC A;  2R2U A;  2IM2 A;  2BKP A;  3DOM B;  5C2C A;  1SL1 A;  2GHP A;  4R25 A;  4KYZ A;  3ZTP A;  2L48 A;  4ED8 A;  1K0T A;  1RWM B;  2P9G A;  2QTW A;  3Q24 A;  2AD9 A;  5D0E A;  1EAR A;  2IM1 A;  2OPQ B;  4EI2 A;  2U1A A;  2XO6 A;  4P2F A;  2HIQ A;  3LAN A;  1KLM B;  3NS5 A;  1KDN A;  4H4O A;  3OTD A;  4DV4 F;  4PWD A;  2L08 A;  4KGM A;  2CNL B;  4EO6 A;  4DV7 J;  2FJB B;  2CQB A;  3BH6 B;  4C7Q A;  5KOW A;  1JNR B;  4WCE Q;  3HP6 A;  1VQO S;  4V19 X;  3CCM S;  2BE2 B;  1O0P A;  3BBF A;  4NLX A;  2MKI A;  2DHA A;  3CD5 A;  2FHO B;  1NK0 A;  1N52 B;  5DO2 A;  1FJE B;  2FJV A;  2HBR B;  5DDP C;  2A1B A;  4E98 A;  5GAD U;  2HHX A;  4B3O B;  5A8W A;  3OLA A;  1X60 A;  1MLA A;  3L7U A;  1ZET A;  3J81 Y;  4OV6 A;  4YP3 A;  2JFD A;  1Q8K A;  5M2P A;  5DGB A;  2ATL A;  1M5V C;  3C6T A;  3DLJ A;  1I94 F;  1HBN A;  2NYI A;  3OVB A;  4C9D A;  2J9C A;  2OGU A;  2CPZ A;  3J81 j;  1D09 B;  4KH1 B;  1L3V A;  2B6A B;  2W7A A;  2RS2 A;  2FZG B;  2HFO A;  4LVN P;  4EO8 A;  3D3B J;  4J5O A;  4GVB B;  3LO3 A;  1RHJ B;  1FJG J;  5J2N A;  1SC4 B;  1HD0 A;  2OAU A;  2R3V A;  3M1V A;  2XWX A;  2VG7 A;  1RT1 A;  2H48 B;  2Z30 B;  3H98 A;  4KBI A;  1BGX T;  3R5A A;  1NDL A;  5KFQ A;  3TZW A;  3TYT A;  3KHL A;  2RDJ A;  4GC6 A;  1LWF A;  2WW8 A;  3JS9 A;  4K2X A;  4OYW A;  3T41 A;  2C3M A;  3HJF A;  2PD1 A;  4LRA A;  4ZIV A;  3IMQ J;  2MQP A;  2CQP A;  2VPZ B;  4CT9 A;  3Q89 A;  1RK8 A;  5CA5 A;  3LPY A;  4X66 F;  1N6Q B;  4Y0F A;  3VAG A;  5T14 A;  5L1K A;  2DO4 A;  4PG5 A;  2UVR A;  1VQ6 S;  2Z2Z A;  1RT6 A;  2HHP A;  2MHN A;  2GO8 A;  2BJ8 A;  3MEE A;  4HHH A;  3SEO A;  2XGQ A;  1U1Q A;  1L3K A;  1C1C A;  2DIU A;  1RAB B;  1SC1 B;  3VZI A;  2EWH A;  5E3P A;  4QWE A;  2FLN A;  5H1S V;  2ZH3 A;  1VMB A;  5CYM B;  4N5S A;  2B9X A;  2OPS B;  3QIP B;  3C6U A;  3FFI B;  4N8N A;  1SV5 A;  1VQ4 S;  1WSV A;  1V3Z A;  3LW5 C;  1A6L A;  1YBU A;  1PAE X;  2NS1 B;  2OML A;  3KHH A;  5CXT A;  1BQN A;  2AYB A;  3HSD A;  4OX9 J;  2W8K A;  4F7V A;  1RTI B;  3NCR A;  1ACM B;  3Q22 A;  1U6F A;  2FY8 A;  3MR7 A;  2FB0 A;  3EVO A;  4V19 J;  4HR2 A;  1SH0 A;  3TZY A;  4U8V A;  1S72 S;  2R8I A;  1BLU A;  1WUU A;  2IYG A;  5CCL A;  3GV5 B;  1Q7Y T;  2ZBI A;  2DRB A;  1LWE A;  5HQM A;  4ZPB A;  3OXF A;  3TEG A;  5L46 A;  1X0P A;  4TN2 A;  1WG4 A;  4FVC A;  3ZNJ 1;  4UY8 5;  2IM0 A;  2F1F A;  1ZTT A;  1TR0 A;  2KXH A;  3W2W B;  1FRI A;  1HBO A;  3WX8 A;  1JJH A;  1FDD A;  3OTB A;  3GU0 A;  2D9P A;  4J9K A;  1XQI A;  3MCO A;  4WXO A;  1FHT A;  1F2G A;  2IDE A;  1S1V A;  3HHL A;  3CME S;  3N6M A;  1GEH A;  3CJK A;  4TU8 A;  4YB6 A;  1PKU A;  3PFO A;  3HFK A;  3TJ9 A;  1RZM A;  1WOR A;  1XWL A;  4NCG B;  2ZIT A;  3CJR A;  2XCP A;  4DL6 A;  3FBE A;  3IFE A;  3N0V A;  4EBD A;  4F2R A;  4AL5 A;  1HQE A;  1QDU B;  3EGW B;  2CQ2 A;  3CMQ A;  4OYB A;  3W2V B;  4YB1 P;  4WU3 A;  5D3G B;  1M0S A;  1Q8L A;  2F5G A;  3QMQ A;  3HJV A;  3KUE A;  4WU2 A;  4J9N A;  5KT7 A;  2E9R X;  1ZZN A;  3HCX A;  1GMV A;  4TU7 A;  5EWG A;  1TFW A;  4LF8 F;  1M5K C;  1VDH A;  1IR0 A;  4BWM A;  5DRK A;  4WYW A;  2E5J A;  4HTJ A;  1AT1 B;  3F0N A;  4N47 A;  2ILZ A;  2WBR A;  2G0J A;  4M5N A;  2E1A A;  4MYU A;  5DZ6 A;  1JX4 A;  3H5X A;  3V6H A;  1TL5 A;  4P7T A;  4I2Q A;  2V2Z A;  3DLE A;  2OD4 A;  3RBE A;  4IH6 A;  4UY8 T;  1UET A;  2XI3 A;  3BSO A;  3SDE B;  1XN9 A;  3D6H B;  3EZ5 A;  1TU0 B;  4F0H A;  1S1X A;  2MGZ A;  1WC0 A;  4DUZ F;  1U1N A;  4NEZ A;  3R8Y A;  1GXT A;  4DR7 F;  2IY5 B;  3NG8 A;  3IG1 A;  4DCP B;  2WCX A;  1H98 A;  4B02 A;  5KFE A;  5HRO A;  2HRT A;  2CPD A;  3E8O A;  2JRS A;  3AHP A;  4B9L A;  1XR7 A;  3DGV A;  1YZ7 A;  5KFC A;  5HVH A;  4F4Z A;  1RT4 A;  2HS0 A;  2RUG A;  1T0T V;  2H1Y A;  1Q95 G;  3DMJ A;  3VAH A;  4EZ6 A;  1NH7 A;  1RWO B;  1TQL A;  2LYV A;  2MST A;  2KFZ A;  4DL5 A;  3G71 S;  4OYZ A;  5HMY A;  5GAE U;  3DDN A;  1Y10 A;  1N5Q A;  4QYR A;  5KG6 A;  4ZDN A;  1DBD A;  2XMV A;  4U9R A;  4LR7 A;  2QLJ B;  3NLC A;  1M5S A;  1U02 A;  2R7U A;  2BM1 A;  4CO0 A;  1VQL S;  1REG X;  2DCU B;  2KN4 A;  3DN9 A;  4CLW A;  1AUD A;  2GA7 A;  1YJ9 S;  1N6Q A;  2JEG A;  1HMV B;  1UPP A;  1B70 B;  4ATN A;  4ZLL A;  1TMJ A;  5LM7 E;  4ZIT A;  5J1N A;  2FZK B;  4F3M A;  2IA0 A;  3AJD A;  1WC3 A;  3JTN A;  4OI0 A;  3K8V A;  4NZ6 A;  2BQR A;  3OQ2 A;  2MZR A;  4NLS A;  1GMW D;  4OI3 A;  1S0M A;  5KAK A;  2RRN A;  2AEJ A;  2JDJ A;  4X65 J;  1AB8 A;  2C2M B;  3NAI A;  5IT9 Y;  4PRF A;  2OPS A;  2XZT B;  3QIP A;  2WVD A;  2FHJ D;  2CJY B;  2FUG 9;  5D15 A;  1U1O A;  2H54 B;  3PYG A;  4X62 F;  1N48 A;  2JL9 A;  2RVJ A;  1L3S A;  3H20 A;  3G8T A;  2IVM A;  4ECS A;  1UEK A;  3D6T B;  1LK7 A;  1NK7 A;  3BKU A;  4KHR A;  2FVP A;  3M4X A;  3W9J A;  3ETO A;  4QBU A;  2CJQ A;  2NXJ A;  1S1W A;  2FTR A;  3JXO A;  3OTC A;  3QFH A;  4R0J A;  4WBF A;  3JAM U;  3D67 A;  1U0H A;  3Q8R B;  2YTC A;  4LFB F;  1PSD A;  3KLH B;  2LQ9 A;  2QSW A;  2NCK L;  2Q6C A;  4OLP A;  4CM2 A;  2BJD A;  2V69 A;  3K8W A;  4UQG A;  2OPR B;  3AJ2 A;  5AT1 B;  3DI6 A;  1S1U A;  5KT6 A;  4LR9 A;  1VC0 A;  2EVZ A;  3HO1 A;  3MAA B;  3ET6 B;  3HI9 A;  2XI2 A;  5J1E B;  3VGV A;  3PVX A;  2VG5 B;  4QU7 A;  3QGG A;  1DJ0 A;  2XWY A;  2KO1 A;  3NMA A;  1UWB A;  5F8G A;  3MUR P;  2ZM6 F;  5KTQ A;  3BGO P;  1TKX A;  1HQ2 A;  4EU0 A;  4R8U B;  3CXC R;  2NYH A;  3CNQ P;  1S6P A;  2B4U A;  1IBC B;  1DQ8 A;  1J2V A;  1F9E B;  2V2V A;  1JLB A;  2X3G A;  2YWW A;  3HVA A;  1XER A;  1O6X A;  2CQ4 A;  1TP7 A;  1C0T A;  5K9F A;  3UD3 P;  3CC4 S;  3PW2 A;  4B9T A;  1BD6 A;  1S12 A;  3G2X A;  3MM9 A;  4NLT A;  3LTO A;  4JI8 F;  1UVL A;  1P6T A;  2BAN B;  2HPU A;  4ZS6 A;  4ZN1 A;  1YGY A;  4N77 A;  2OSR A;  1TUV A;  5CQG A;  1TL7 B;  4MT1 A;  2MSS A;  3KOA A;  2I38 A;  2EFP A;  2EFQ A;  4MKV A;  1Q5Y A;  5AE1 A;  5B0B A;  3O1L A;  2K3I A;  4ES1 A;  4F36 A;  4DF4 A;  3VVU A;  3WQP A;  4DWI A;  4S0M A;  2ATC B;  3M8W A;  3HFV A;  2VPW B;  1X4B A;  5IM0 A;  2WON A;  4P9S A;  3CCL S;  1RTD A;  3NGD A;  3A13 A;  5LSR A;  2HQ3 A;  1VBZ A;  4DCO B;  1XNQ F;  5A8R B;  3QRQ A;  3BDP A;  1TKT A;  2E29 A;  2HBZ B;  5E5N A;  5CD4 H;  3H4D A;  4J7C A;  2D3Z A;  3NGK A;  1HWL A;  5GVQ A;  4KO0 B;  5U47 A;  1JXE A;  3AJ1 A;  1PC5 A;  5A2Q U;  1Y5N B;  1JJC B;  3HMJ G;  4FXV A;  3TUJ C;  5F9L A;  1NDC A;  1N36 F;  2R8J A;  3LQV A;  1DLO B;  2VFV A;  2R2S A;  3AD8 C;  3N6N A;  3WBZ A;  1HYS B;  3HUL A;  2RDD A;  3H0P A;  2H65 B;  2K7J A;  3HD2 A;  5JVG Q;  3DOL A;  2AQ4 A;  1S76 D;  3A12 A;  1JLQ B;  3M2U A;  2LCW A;  4YN3 B;  3UO0 A;  1HNV A;  1V5V A;  4W98 A;  5HVF A;  5KFR A;  3JQK A;  3KDN A;  1XR5 A;  4DPO A;  3B6B A;  3EXC X;  2SXL A;  3UPF A;  2PGC A;  3JYT A;  2Y1R I;  2UVV A;  2CQC A;  1UVI A;  2MQQ A;  4N8O A;  3V4M A;  1W2B R;  4U7U D;  2HVZ A;  1VRT A;  2PMH A;  4ZJL A;  4OJ3 A;  2FGC A;  1FRL A;  1KC8 T;  2V2Q A;  2W4P A;  4TNO A;  1T9U A;  5D4O A;  1FJ7 A;  2GJI A;  3R2C J;  2VC0 A;  2I0X A;  4X4T A;  1ZH5 A;  2HVI A;  2M52 A;  3IGV A;  2OPP B;  3PFE A;  3JSY A;  4ES2 A;  3OFF A;  4C0H A;  3G8S A;  3GIL A;  2CPF A;  4TVA B;  2CQH A;  1WOO A;  3CCQ S;  3KLV A;  2D41 A;  2LKZ A;  2OP5 A;  1I51 B;  1KQG B;  2DPJ A;  2YKM B;  3RBD A;  3BSA A;  1VI7 A;  3I6P A;  4KPC A;  1IBL F;  3R5J B;  5ETS A;  4ZVQ B;  2BJ1 A;  2QLB B;  2J9E A;  1NJW A;  4X4N A;  5BYR A;  3ILJ A;  5IWA J;  1NRK A;  3QYY A;  2ZZN A;  3MEG B;  4PEO A;  1F5B A;  2UU9 F;  2DGV A;  4LUB A;  4WTY A;  5F0W A;  1PO6 A;  3F44 A;  3HM9 A;  1S6U A;  3CCV S;  4DFJ A;  1RYR A;  2MHE A;  2OHD A;  3DXB A;  4OV1 A;  2B6A A;  4AFF A;  4RNO A;  4DL4 A;  3FK4 A;  2Y1I A;  3Q8Q B;  3GQC A;  1UCN A;  2UXC J;  4X62 J;  1RAE B;  2R2T A;  1XMQ J;  1BWE A;  4HLB A;  2VBY A;  5J2N B;  4TY9 A;  1EQ0 A;  4NLU A;  2HZC A;  2B9Y A;  2HWT A;  2BW2 A;  3SIP B;  5IT0 A;  4OIX A;  1RAI B;  3ZFV A;  5RUB A;  3G82 B;  1X4E A;  4OZ5 A;  4AND A;  2VIC A;  2ASD A;  2VOO A;  4ZPV R;  4OX6 A;  5JVH Q;  4Z7C A;  5EHH A;  4EEY A;  2AU0 A;  4K4Z A;  4NAS A;  2L41 A;  2PC6 A;  1X9M A;  5MAO A;  3CIM A;  3I55 S;  2ACY A;  2LU1 A;  1UMJ A;  1BWV A;  2GGP A;  2EBE A;  3CJ0 A;  2R7T A;  2VFU A;  4CZC A;  2VDI A;  2WK4 A;  1T9X A;  2JVR A;  2IFX A;  2DCL A;  3BPS P;  2V8G A;  2B7B B;  4CRJ A;  4CH1 A;  3IM8 A;  3IR6 B;  1JK9 B;  1U09 A;  1WEX A;  3K2Y A;  2A10 A;  4OZJ A;  4DMZ A;  3ITH B;  2PFD A;  3UNY A;  3QRR A;  1UL3 A;  2HAF A;  2GHV C;  2ZH6 A;  2DXF A;  2W24 A;  4X65 F;  4RUH A;  2ZWO A;  1T9W A;  2C42 A;  3UCZ P;  4JV5 F;  4Q8E A;  5C24 A;  3LF0 A;  5F8H A;  4ED6 A;  5FDL B;  1QSL A;  2J76 E;  1VLO A;  1J5O A;  3BYR A;  2QRR A;  4K2J A;  3AOD A;  3GYX B;  2IJR A;  3Q8P B;  1KTV A;  4PXB A;  4AXI A;  1RI7 A;  2AT1 B;  2J7U A;  3A8I A;  3QT7 A;  4HHJ A;  2VQF J;  1U45 A;  1U48 A;  2FVR A;  3NGR A;  2BYC A;  3B54 A;  2KRB A;  2PSZ A;  4QYZ K;  1I6J A;  2AGQ A;  3D0I E;  1N5Y A;  3SCJ E;  2MB0 B;  2N82 B;  5D4P A;  2IMW P;  4TLR A;  3DOK B;  1HHT P;  4LF7 F;  1FXR A;  4F25 A;  1CLF A;  1F60 B;  2KU7 A;  2HZA A;  2K8G A;  2ZNY A;  2CPE A;  5D4N A;  5E7O B;  3U02 A;  2DHH A;  5KFH A;  2G1H A;  4CLT A;  2HQC A;  4C0O C;  2O67 A;  5GMK a;  1YJU A;  1YSJ A;  3RU0 A;  1KHW A;  4EUV A;  3QBC A;  5K8P A;  1RTJ A;  5KFS A;  4FBU A;  4JV1 A;  4CLP A;  2PE8 A;  1SIW B;  2B8P A;  2C2R A;  4DX6 A;  2XC9 A;  1T03 A;  4FYD A;  1RT6 B;  3FEZ A;  3I9Z A;  4C4W A;  5ITH A;  4M5M A;  4NRU A;  3OVA A;  1AYE A;  5C25 A;  2YX4 A;  1N0V C;  3O5T B;  3M9M B;  1NO8 A;  2HBQ B;  2XSF A;  2C3Y A;  1FRJ A;  4USH A;  4QCL A;  5I3U B;  2G13 A;  3LAK A;  2R7V A;  4JYA J;  2MXY A;  4KB7 A;  2IAJ A;  2BJ9 A;  4LF9 J;  3KUG A;  4ZMM A;  4QU6 A;  3N28 A;  1CS4 A;  2DNP A;  2NPI A;  2YNH B;  3GG1 A;  3LGH A;  4ZCI A;  1XNR J;  2CFX A;  1HBM A;  1OS5 A;  2GNK A;  4ZPW R;  3ISN C;  5A6P A;  2JC0 A;  5B0E A;  4DN9 A;  5A76 A;  1VQ5 S;  2PMZ D;  2D7S A;  4DR1 J;  2AF6 A;  3VF0 B;  2FVS A;  2WB4 A;  4CNZ A;  4CLK A;  2OO4 A;  3NAH A;  2WSF C;  2XMK A;  3O6Q A;  5IV4 A;  3DLE B;  2LDY A;  3TRG A;  1FRK A;  3M7V A;  1LKZ A;  2V8P A;  4QIF A;  2FHJ A;  2FHK A;  2ZOM A;  2PI5 A;  2HNY B;  3TZX A;  1KLM A;  3CC2 S;  2VL1 A;  3GB0 A;  4A47 A;  2VQE J;  3OXL A;  1HBO B;  1VLY A;  2V8D A;  2AGP A;  1RT2 B;  2I8E A;  2GAG C;  3EDQ B;  4YME A;  2KFY A;  2DR6 A;  2EW9 A;  4KGV B;  4M95 A;  2FJX A;  1KWM A;  2V50 A;  1W7W A;  3H4B A;  2F8E X;  5I42 B;  3T6J A;  1T9V A;  4C98 A;  4UOC A;  3PKM A;  1YRT A;  4ZPC A;  8RUC A;  4X4V A;  4IDK B;  5J2P B;  4K50 A;  2KT2 A;  2ZE2 A;  4XDC A;  2HGN A;  2G0I A;  2OEK A;  3EGN A;  5KG0 A;  5T7L A;  3DFE A;  2JOQ A;  4ES3 A;  5F3Z A;  1B99 A;  3GIK A;  1FVS A;  3PEJ A;  4ZVH A;  4DSF A;  4QQB A;  3NWR A;  3WIV A;  1TFY A;  5ETV A;  1NLK L;  1FRX A;  1NCL A;  4CYU A;  1UAW A;  1VYA A;  2BAC A;  1U26 A;  5LMU F;  2PA3 A;  1YZ6 A;  1VQ8 S;  5K5M A;  4CO2 A;  2MKC A;  3UCU P;  4DPT A;  4JI1 F;  1TZ0 A;  4ZPT R;  4ZVF A;  1LV5 A;  3P49 B;  1CC8 A;  2HNZ B;  3LA0 A;  2JFK A;  2BZ2 A;  2DGS A;  3NP5 A;  4GKJ J;  4IO9 Q;  1FK9 A;  5J1P A;  1KVK A;  5BR8 J;  2MPU A;  1WC6 A;  4LF7 J;  4HH0 A;  5HSP A;  2B8Q A;  2OUG A;  1IJE B;  3HHE A;  1EP4 A;  3KG0 A;  4OX9 F;  2BRK A;  1NK9 A;  1VK3 A;  2Q66 A;  1SI9 A;  2MTL A;  1QSS A;  4ZP7 A;  2CJB A;  1DTT B;  5BR8 F;  4PAA A;  4I4B A;  4WE1 A;  4KJI A;  2OEJ A;  1MRO B;  2VDH A;  4P2X A;  4P71 A;  3UR0 A;  3D1O A;  4XDD A;  3GZ7 A;  4ZVP B;  2C22 A;  3NXZ A;  3EM1 A;  4P2M A;  1C1C B;  2DIT A;  3OBI A;  4USK A;  3CF5 Q;  3MMA B;  4UOH A;  5I3P A;  1MU2 A;  4K4X A;  4WWS A;  2V5H G;  1FER A;  5CYQ A;  3OUY B;  3DRX A;  4B3T J;  4PYA A;  4UF4 A;  5D78 A;  1SV5 B;  1MG7 A;  3MM5 A;  1H6K X;  2HK3 A;  2KM8 C;  4ZK7 M;  1BMQ B;  1ZPW X;  2AJF E;  4BBY A;  1WC5 A;  4FNI A;  3M2V B;  1S1U B;  1MNE A;  1FA0 A;  3K0J A;  2E66 A;  1ELO A;  4ZPD A;  5L8R C;  4PG8 A;  3U7J A;  3D54 A;  4P52 A;  3H5S A;  1CJU A;  2JLE A;  3E01 A;  4M5I A;  3MM7 B;  1SC3 B;  3PX0 A;  2Y8Y A;  1HLW A;  2VC1 A;  4IYQ A;  2JLG A;  4M5D B;  2FQQ B;  4C0B A;  3MM6 A;  4L73 A;  2B7C B;  2ROE A;  2JVO A;  3C2P A;  1JIH A;  2MQL A;  2QX0 A;  1GTH A;  2X1F A;  3ELH A;  4NWB A;  1V6H A;  3GFH A;  5HBM B;  4N56 A;  3PKY A;  1QAI A;  1ZAW A;  4ID5 B;  4F04 B;  3CW2 C;  3D1Q A;  4PPZ A;  1BQM B;  2UXD F;  3MMB A;  1FWP A;  1G3O A;  4ED4 A;  2VON A;  1YJW S;  4PWD B;  4I2P B;  3TAM A;  8AT1 B;  4ECQ A;  1IKV A;  4QIW D;  3CJK B;  3OHA A;  4IG0 A;  1CS4 B;  2H5E A;  2YNH A;  3VGT A;  5B09 A;  2F4F A;  2QL9 B;  1HBM B;  3JQJ A;  3IWX A;  5BJR A;  5L39 A;  2F7V A;  4J91 A;  1HNX F;  4KH0 B;  3UD4 P;  3MOZ A;  4DU7 A;  5D4L A;  1KD1 T;  2CPY A;  3H42 A;  4USU A;  1NND A;  4M1K A;  5KG4 A;  4LF5 J;  1RWP B;  2KDO A;  4RR5 A;  4DV4 J;  3THP A;  3CDB A;  2XMA A;  4LF4 J;  4PCQ A;  1OJ4 A;  2BV3 A;  4HL9 A;  4KGX B;  1R8C A;  5B0C A;  3QWP A;  1ZOT A;  1NSA A;  3GR1 A;  4OZL A;  4TYA A;  5DG8 A;  1IR1 A;  1RQ0 A;  3QAE A;  3TJ8 A;  3DI6 B;  1NDP A;  4BC9 A;  4OZ3 A;  3R7B B;  1SH3 A;  1QTM A;  4P72 A;  1WHV A;  2DH7 A;  4PG4 A;  2LXF A;  5IQQ A;  3VHQ A;  1VQK S;  4B9N A;  2UUA F;  2MZQ A;  3DM2 A;  1EKR A;  4PR6 A;  2NQP A;  2YQ0 A;  3AY0 A;  3MGJ A;  3W3S A;  2CZV C;  1YHQ S;  2RHQ B;  1L3T A;  1SVD A;  3CD6 S;  5D8H B;  3TQ1 A;  2CNO B;  5E3R A;  2M0G B;  2HQF A;  5F8M A;  4K4Y A;  2YBV A;  4WKY A;  1SIZ A;  2IYI A;  1TKD A;  3NGU A;  4JI6 J;  4JI7 J;  3M8R A;  3RR7 A;  4ZHR A;  1TKZ B;  2GC8 A;  3IBW A;  3PRV A;  4Y2I A;  1DAR A;  4CIO A;  1SQF A;  4TYB A;  1C4C A;  4LFA J;  4OHZ A;  1PJ5 A;  1FFG B;  1SC6 A;  1X5P A;  2I5J B;  1SKS A;  1RWU A;  3OW2 R;  5J2Q A;  1HHQ A;  1NHU A;  3OT9 A;  4OFZ A;  4YY3 F;  4XO0 A;  2E1C A;  1UVM A;  3FSY A;  4USJ C;  3THV A;  1QSY A;  1ICE B;  5MLC V;  3QT8 A;  5HQ8 A;  3R3T A;  2CJA A;  3ZTQ A;  2HAI A;  3TA2 A;  5IS2 A;  1KN6 A;  3Q2T C;  2LQB A;  1VR6 A;  3FEY B;  1WEL A;  3A3O B;  4FNH A;  4NI2 A;  4NML A;  5HI7 A;  1Q8I A;  4LRB A;  4CLY A;  3M2R A;  2V8V A;  5M2U A;  3CDW A;  3QAU A;  2X3D A;  4DSE A;  3F73 A;  1LWC A;  2AZ1 A;  3HHD A;  4LRC A;  4WTO B;  3H2L A;  5A8R A;  1C4A A;  2UUC J;  1WHW A;  2BW7 A;  3EZO A;  1SXL A;  4DX7 A;  2CUY A;  4MYT A;  1HHS A;  1IJF B;  2HFU A;  3IS9 B;  3TOQ A;  4Q2L A;  1L5U A;  2HHS A;  3Q8V A;  3KMS A;  2VA2 A;  1VIO A;  1XMQ F;  1X8D A;  3C15 A;  4KV8 B;  3VGU A;  1B7Y B;  1I1G A;  2XSJ B;  4F4W A;  1C1B A;  1LOU A;  1WI8 A;  4A8W A;  3PR5 B;  4LRE A;  2VJV A;  5KFV A;  1VQM S;  1TL1 B;  4X2B A;  4K4T A;  5LL6 d;  3TP2 A;  3JSM A;  3RRK A;  4K4U A;  1K0V A;  1YRX A;  1QY7 A;  2K1R B;  3HZG A;  5FJ4 A;  3L7O A;  2KZM A;  3CO9 A;  4JBC A;  3DHW C;  3FBB A;  3MD3 A;  2MZT A;  1FNM A;  3JYT B;  4DCJ B;  4KKO A;  3B82 A;  4K0K J;  4EMD A;  3I56 S;  3NOC A;  4OHV A;  5E3A A;  3ENV A;  3IWN C;  2Q1L A;  2ALZ A;  4DEZ A;  1MW7 A;  2VPX B;  3FDS A;  4A48 A;  3RBX A;  3FSX A;  3R27 A;  2AYG A;  2LQJ A;  1HNI B;  5H9F K;  1GX5 A;  2BJ7 A;  4FF1 A;  4RBU A;  1L3U A;  1ULR A;  2XCA A;  2RSQ A;  1RHU B;  3GJR B;  3PO4 A;  3J7Y I;  1NSQ A;  1VRQ C;  3P8B B;  3W64 A;  1O51 A;  1TEL A;  2XHW A;  4TY8 B;  1VFJ A;  3MM6 B;  1S4E A;  5D77 A;  4RWX A;  3R97 A;  1T05 A;  3ONQ A;  1S6O A;  2AYE A;  2YKM A;  1G4C A;  4CP5 A;  5C42 A;  3HF5 A;  3ET6 A;  3T1A A;  3AQO A;  3HT3 A;  3GWC A;  3LUY A;  5F9N A;  1RA7 A;  4DQP A;  1IM4 A;  1IBK F;  2NSB A;  3BQ2 A;  2XM3 A;  1UWB B;  5E0O A;  4HEA 9;  4RW6 A;  2XYG B;  2Y1L B;  2Y1J A;  3KWM A;  3RRH A;  3R2D J;  3AQP A;  4KHM A;  2DVI A;  1UP1 A;  4KY3 A;  3CPW R;  4WFY A;  3FRZ A;  2BOA A;  4AL7 A;  4F67 A;  2FLO A;  4LIW A;  1FKA F;  1KFD A;  4J9R A;  3THT A;  2WZ1 A;  3TVK A;  1OQ3 A;  2YX1 A;  3DC2 A;  3RG6 A;  2CQG A;  2DXE A;  3UD5 A;  4ECT A;  1D8Z A;  3NOG A;  1T3N A;  5ETQ A;  3C46 A;  4MTP A;  4RPF A;  2HHQ A;  1WSR A;  4ZVO B;  2UUW A;  1KKH A;  1CG2 A;  1T02 A;  1HW8 A;  3SFU A;  4DI6 A;  5ETM A;  2R9L A;  4UTG A;  4NMX A;  4YR2 A;  4IG3 A;  4ICL B;  2G0C A;  4LSL A;  5GAH U;  1JLF A;  3MPD A;  2G9O A;  3HVT A;  3AT1 B;  3L95 X;  4F8R A;  1F9F A;  4P6Q A;  1M1H A;  2D1C A;  4M5G A;  5KFK A;  3D0H E;  2HQG A;  2ASL A;  3DRS B;  3V6D B;  3R5C A;  1NHV A;  3PW4 A;  1JJ4 A;  3R6G B;  2ZC4 A;  2KJV A;  3A1Y G;  4J9U E;  4Q5V A;  3EWG A;  3I96 A;  2MYF A;  3ITH A;  3Q83 A;  1XMB A;  3CCT A;  1DLO A;  1Q8B A;  5F8J A;  2ZBP A;  1YBA A;  2QZ8 A;  3SCL E;  1RT3 B;  5L1L A;  1AUS L;  3ETM A;  2VZ9 A;  4F3Q A;  3EXY A;  1A0O B;  2X1A A;  4MFB B;  3SMZ A;  4AE5 A;  2BQ3 A;  1FTR A;  2ZH1 A;  4LT6 A;  3SFG A;  1NSK L;  1FFW B;  3HHK A;  3EGZ A;  2ERR A;  2W2N P;  3H59 A;  2N4C A;  1Y5L B;  4ERD A;  1HD1 A;  4HKQ A;  3VAJ A;  1HWK A;  1WHX A;  1LW2 B;  1X5O A;  2J7K A;  4DG1 B;  2UXB J;  1UEV A;  1VRT B;  5I4M A;  4PAB A;  5JMN A;  1JLC B;  1JLE B;  3EMT A;  1SJ4 P;  1F3V A;  7AT1 B;  3MMJ A;  1N32 F;  1X9W A;  1LXJ A;  1RT2 A;  1QJH A;  4MMO A;  3EVM A;  1AA1 B;  3T3F A;  2Y8W A;  3ILI A;  4KE5 A;  1MWY A;  5D0R A;  2ZM6 J;  1UPM B;  1T3O A;  4NYZ A;  2E44 A;  2VD3 A;  3ZZO A;  3G6X A;  1RAH B;  4NLO A;  2E7X A;  1U1R A;  4IDK A;  5J2P A;  2CQ1 A;  5DZ7 A;  2OFH X;  2F9J A;  1E6Y B;  3MZI A;  4DPX A;  4DL3 A;  4DV0 J;  4I67 A;  2G2Y A;  4BLG A;  1D9A A;  1NKE A;  2R42 A;  3KHR A;  4J9P A;  2DHX A;  2UUC F;  4IOA Q;  3K5N A;  4CYU B;  1T11 A;  3MEG A;  2ZFH A;  2DJW A;  3MUM P;  4O4G A;  2GVZ A;  3PEH A;  3L4B C;  2W1B A;  1R8P A;  3D9B A;  5LSO A;  2J9D A;  4IQX A;  1NJY A;  4N41 A;  2HND A;  3T19 A;  2W4D A;  2FZC B;  2AW0 A;  2F63 A;  3RAM A;  3DLK A;  1KQF B;  3VTI A;  3KDO A;  4WJB A;  1B64 A;  2G2Z A;  2FLP A;  1VJQ A;  3CUN A;  2CXE A;  5IOL A;  2HBY B;  4GMK A;  3PXG a;  2IC3 B;  2M9K A;  4U67 Q;  4ECY A;  5GME A;  4RBV A;  3OJU A;  3PO5 A;  2BR0 A;  2MLZ A;  2F4V F;  3ZZT A;  3Q86 A;  5EN1 A;  4NEY A;  3I0R B;  4YQW A;  3IA0 A;  4X64 F;  1WWH A;  2MZS A;  1IKW A;  4UUW A;  3UE2 A;  2PII A;  4DFP A;  3GMG A;  4LF6 F;  1RT7 A;  3NBP B;  1X4H A;  3R7N B;  3W5X A;  2R8H A;  3I82 A;  1YJV A;  1V5I B;  2IIH A;  4FN5 A;  1QTN B;  3I4P A;  3AA8 A;  4RJV A;  5HAN A;  3OR2 B;  2VU5 A;  2XO7 A;  2OJ3 A;  2HLT A;  3CDU A;  1IBM F;  3N5B A;  1HBN B;  3BKF A;  3H5U A;  2DTJ A;  1ZM4 A;  3K5M A;  1PIE A;  4RKU C;  1RTD B;  2F3J A;  3IR7 B;  3UR3 C;  3H40 A;  3CC7 S;  5D6G A;  3MED B;  4DV6 J;  1TKT B;  3HPO A;  2FGO A;  3MTK A;  4A4J A;  4D3G A;  1Y5I B;  4A46 A;  4PQU B;  4LF5 F;  2DNH A;  5C24 B;  3OTE A;  2WOM B;  3SYZ A;  3F41 A;  3EE3 A;  3PIO Q;  1J5E J;  4CLF A;  3Q8Y A;  3L3C A;  1AFI A;  1J5O B;  1SJF A;  2RRB A;  2HZV A;  3FUY A;  4DJB A;  3C16 A;  1FRM A;  4ZVS B;  1NK5 A;  1TK5 A;  4K4S A;  2V0N A;  3MTJ A;  3PYF A;  4W90 B;  3O44 A;  3IR5 B;  4ECZ A;  4M5D A;  3UN3 A;  1W25 A;  4QW9 A;  2B3T B;  2UV8 G;  4FYX B;  4DR7 J;  1FK9 B;  1RLD A;  3FRY A;  5KFA A;  2UXD J;  3DOK A;  2WTF A;  4ETX A;  2ZOF A;  3HHL D;  3MM8 B;  1RTZ A;  3AFG A;  1NXI A;  1FJG F;  2YWH A;  3K7R A;  4UZB A;  3SI8 A;  2B51 A;  1U8W A;  1UA1 A;  1RHQ B;  3DRP B;  1WEY A;  9ATC B;  1CUL B;  3C6U B;  1FRH A;  4JV0 A;  4X4U A;  1KVJ A;  2A2D A;  1NJI T;  5LMN J;  1H2V Z;  3LP0 A;  2R8G A;  2W9B B;  2UXB F;  1OY6 A;  5ADZ A;  2W7P A;  2VJU A;  4ILM A;  4GC7 A;  3M8P A;  3VCD A;  1IQT A;  1RLC L;  3VR1 A;  3T1H J;  1WDT A;  1FXD A;  1Q0N A;  1WF1 A;  2XLK A;  4JYA F;  3LGM A;  3TX8 A;  3P5T L;  2AV5 A;  3ISN D;  4CO5 A;  4YY3 J;  2CIM A;  2VUG A;  4CT8 A;  1U1M A;  3FZB A;  3LP2 B;  3MR2 A;  3R1L A;  2LA6 A;  3EYZ A;  2LVW A;  4A8Q A;  4B3T F;  3CJ8 A;  2CJX B;  3BYP A;  4PZV A;  3M32 A;  5EX3 A;  4LFA F;  1IQZ A;  1VS3 A;  4RW7 A;  1LNQ A;  2E1P A;  3RW6 A;  1OYE A;  4F0M A;  3CED A;  1AXQ A;  3AA9 A;  2W7O A;  2CNN B;  2AGO A;  4UST A;  4LRF A;  5E3C A;  3D6M B;  4RBT A;  5FD1 A;  1WOP A;  3KLE B;  2R7S A;  3QQC D;  5LJ5 Y;  2HNY A;  1E6Y A;  4AD6 A;  5LXY A;  4BDP A;  2B4V A;  3CD0 A;  3F56 A;  3K5P A;  3W61 A;  1U1K A;  1N5T A;  1RE1 B;  1VRU B;  2RIJ A;  4B9M A;  3QZ8 A;  3BN7 A;  4PPD A;  3P96 A;  4O4G B;  3SSQ A;  4H4M B;  3DLH A;  5D3G A;  3J80 U;  1S10 A;  2VA3 A;  4KFB B;  2E5L F;  2F40 A;  1F2H A;  3MDF A;  2DGQ A;  4R5P B;  5C5J A;  4DV2 F;  3KLI A;  2XNR A;  2XB2 D;  4O44 A;  1IWA A;  4UT4 A;  1QLN A;  3OL6 A;  1TTH B;  1Y7P A;  4FYY B;  5AE2 A;  3OLB A;  3ZZ0 A;  4GKK J;  2QIF A;  3FMB A;  3MFH A;  1R0A A;  1HPZ B;  2GMJ A;  4ZA1 A;  1FES A;  2OI2 A;  3PHT A;  3GV7 B;  5DET A;  1S9E A;  2GQ2 A;  1NZA A;  2HWH A;  2V6A A;  1VBK A;  2HFZ A;  3DRR B;  5D0H A;  5LMU J;  4PUO A;  1QVF R;  4QWA A;  3W1Y C;  1NK8 A;  2YWF A;  4WF9 Q;  2AEF A;  3EIC A;  4KAI A;  3MUT P;  2KFN A;  3BV8 A;  1BUX A;  2DT9 A;  4CTA B;  4NLG A;  1JLA B;  4IFY A;  4RU9 A;  5E33 A;  3TUP A;  4L72 B;  3IS9 A;  3S01 A;  3GYN A;  2ZH9 A;  1OPI A;  2DGO A;  2A6O A;  4HVZ A;  2QLW A;  4CCH A;  4KPY A;  1Z4U A;  1OO0 B;  3H90 A;  4K8R A;  1VBX A;  1IVZ A;  2Z2L A;  4ZP9 A;  4OLO A;  4CWB A;  4NYO A;  4QR2 A;  4DR1 F;  1FDB A;  3NGT A;  2ZDP A;  4YHH J;  1PJ6 A;  2DNG A;  1XTZ A;  2F65 A;  1TL1 A;  3O8W A;  3BZQ A;  4L6V 3;  2GQC A;  1T95 A;  3HFZ B;  5EWE A;  4ZCM A;  2OTL S;  4WP8 A;  5GAD I;  3M8Z A;  1UFK A;  1F9H A;  3BRE A;  3ZO7 A;  2J7W A;  2BUN A;  3BGR A;  3G8Q A;  4FF2 A;  6FD1 A;  5HLF A;  2MKY A;  3R5G A;  4O0N A;  2CWK A;  4HHU A;  1NK4 A;  1TUG B;  3MAQ A;  3DYA A;  2AHO B;  2XYP B;  4FYW B;  4LF2 A;  3ZZZ A;  2J0S D;  3MMC B;  3DHX A;  5K14 A;  2V4R A;  4KHP F;  4OI1 A;  4ECU A;  4QYZ J;  1WI6 A;  2RE1 A;  4NYP A;  1RUS A;  2EFO A;  3CJQ A;  5KT4 A;  1T03 B;  2W2P P;  3CMA S;  1N5V A;  3MEC B;  3QJJ A;  1S77 D;  1Q5V A;  3CDE A;  4R0E A;  1FXL A;  2RIL A;  5K8M A;  1FVQ A;  2X1B A;  2MKK A;  1T05 B;  4KGK A;  4ENO A;  2B5J B;  4JB8 B;  4DV6 F;  1LW0 A;  4CLL A;  2VPY B;  4ZVE A;  1OIA A;  2HVD A;  3PJW A;  3MM8 A;  1YLX A;  2LFV A;  4WII A;  3FBC A;  3UDV A;  1A7G E;  4BC7 A;  1XK8 A;  1EB0 A;  3IRX B;  4XPE A;  3TZZ A;  5DG9 A;  5ETL A;  3HVW A;  1QAX A;  1P9Q C;  4U8Y A;  1FF2 A;  2GJF A;  2EBG A;  1S59 A;  1Q81 T;  4C6A A;  4C97 A;  2CJ9 A;  4XTT A;  1TK8 A;  2QC3 A;  2HK2 A;  4CLS A;  1RYS A;  4I0W A;  3M8P B;  3NL0 A;  2O66 A;  1RWX B;  4DF8 A;  4MIB A;  4LQ3 A;  2GS8 A;  3ISZ A;  2RQK A;  1S99 A;  2K1R A;  2CVE A;  3OR1 A;  3PRD A;  1S5Z A;  2CQD A;  3LWM A;  3NCQ A;  3TVZ A;  1U0H B;  1NB2 A;  1UJ5 A;  3FKB A;  2DIS A;  2XQC A;  3RB4 A;  4CH7 A;  3NNH A;  1CPZ A;  4I6A A;  3R7S B;  2H5I B;  3OSN A;  2YPY A;  5C7P A;  3BGL A;  4DQR A;  3E2E A;  1CEZ A;  3HDS A;  4QR1 A;  2W2Q P;  2BX6 A;  1TAQ A;  4FXD A;  4RW4 B;  3GSD A;  1CJT B;  1F3F A;  1HNI A;  2ZVS A;  1XMO J;  2K7K A;  2ZE2 B;  1NB7 A;  2VG5 A;  5DQG A;  1KRP A;  3CJ5 A;  5L9X A;  1DTQ A;  1R27 B;  5T7L B;  4DSJ A;  3T5J A;  3DRS A;  3V6D A;  5AXN A;  5B0D A;  1Y9O A;  3M30 A;  2QMU B;  2XUL A;  1H74 A;  1SJR A;  3G87 A;  2N7C A;  3IXQ A;  5HL7 Q;  3BB5 A;  3DOM A;  2QA1 A;  4RW8 B;  5K8N A;  4Q43 A;  3UN5 A;  1U2C A;  2KYX A;  3N5F A;  4C8Z A;  1X4F A;  3QJL A;  1O5J A;  2M88 A;  2MKS A;  5HK4 A;  3GTY X;  2P6S A;  2LEA A;  2DNN A;  3ENA A;  4ZVT B;  3OV7 A;  2BVZ A;  4JI5 F;  3CGI A;  3KJQ B;  1D3W A;  4QWD A;  2H51 B;  1EHW A;  4EZ9 A;  1R0A B;  2PT0 A;  4FZV A;  2B9E A;  4QWC A;  4LRD A;  2EK6 A;  4L76 A;  4LSN B;  3KJV B;  2FJW A;  2I5J A;  4PUO B;  2P6T A;  2FIU A;  1PAU B;  3R5B A;  2EG2 A;  2JHE A;  2ROG A;  3H25 A;  1C0U A;  2DGX A;  2YKN A;  4EGL A;  1R0B G;  3JSR A;  4FVM A;  1JNZ B;  4ELU A;  4NZ7 A;  3J7Z T;  3VGS A;  2W9A A;  4URG A;  4IG3 B;  4LSL B;  1HFE L;  3IAS 9;  2QV6 A;  4ZLN A;  3DCA A;  4B3S J;  2HHH J;  3B8H A;  3PZP A;  1RHK B;  2OH2 A;  3U1M A;  2M70 A;  5CYQ B;  3OUY A;  1JWW A;  1X4D A;  2B0G A;  3EPI A;  1GXL A;  1H7W A;  4Y2M A;  4JI3 J;  3D3C J;  1ZZF A;  3GIJ A;  4GVB A;  1DFD A;  3K57 A;  3P4U B;  2XBP A;  2DNQ A;  4U7C A;  3SSS A;  3V4I B;  3LP1 A;  4M5H A;  4J9Q A;  2PMW A;  2M2B A;  4DV3 J;  1EIY B;  2HMI A;  3M6W A;  4F02 A;  1RU2 A;  1C1B B;  3PCO B;  3HSJ A;  4OYI A;  1N5S A;  3JSB A;  1VGY A;  2CNK B;  4AT1 B;  1VQ9 S;  4OMF G;  2C3P A;  1BC6 A;  3MR6 A;  1DRZ A;  4DSI A;  1CC7 A;  1R43 A;  4UOF A;  2XLI A;  1NK6 A;  2I2Y A;  2HEK A;  4DL2 A;  1X4C A;  4OZN A;  4P10 A;  1HBU A;  3LPE A;  3JAM Y;  2OPP A;  3E3X A;  4QOT A;  3G96 A;  3CCE S;  3TAQ A;  4I64 A;  1Y3K A;  1Q79 A;  2KKH A;  3ZTR A;  2OPQ A;  1BQM A;  3QID A;  4FYV B;  3TO8 A;  2G1D A;  3DLG B;  4K7Q A;  4F4A A;  2KHC A;  1VHF A;  3MPU B;  3PDN A;  1FKO A;  3D68 A;  4MIW A;  3OSP A;  4PKD B;  5BYS A;  5H9E J;  2AJ2 A;  1PCA A;  3V81 B;  4JI0 F;  2UZA A;  3D2W A;  4B08 A;  3NRB A;  3D28 A;  4NLW A;  1F0X A;  4DR5 F;  2CAJ A;  2I6W A;  2W8L A;  2XS2 A;  5IT9 U;  1RTI A;  4C3M A;  2RAQ A;  4ZOS A;  4HYK A;  8ATC B;  4NE9 C;  3M9O B;  3V6K A;  3T9Z A;  4MKB A;  4KC5 A;  3QZ7 A;  2H9Z A;  4DR3 F;  1S9G A;  4CNY A;  2XY7 A;  2W9C B;  3BJY A;  5A8W B;  2MQO A;  2VBW A;  4JI3 F;  4DZ6 A;  2IJN A;  1HA1 A;  3BM7 A;  4MKA A;  1KTQ A;  1P1T A;  3HD1 A;  3HLU A;  2WOM A;  3H5Y A;  2XZW A;  1HWJ A;  3EX7 B;  4K4W A;  3C8Y A;  3T5H A;  5H9E K;  4E2F B;  1U49 A;  2KG0 A;  2EFV A;  1K9M T;  3GV8 B;  1ZM3 A;  2YQ1 A;  4Q8F A;  1WC4 A;  3MPV A;  3NGS A;  1CJV B;  2DYA A;  2NXU A;  3OFH A;  2FDN A;  3DLK B;  4RUC A;  4J9O A;  2RS8 A;  4M63 A;  4DUZ J;  4J9L A;  2PFF B;  4EYI B;  4OQJ A;  4JI8 J;  3M8Y A;  2RUS A;  3FNN A;  3P6Y C;  1Q86 T;  1KHV A;  1LFP A;  2FC8 A;  2KHD A;  2V2K A;  3BGU A;  3ZZP A;  1AZS B;  2HGL A;  4PWW A;  1ZA2 B;  3J7Y U;  4MAK A;  3GJS B;  2XS7 A;  1EKS A;  4DR6 J;  5J2Q B;  1T9Y A;  2Y0B B;  4X4S A;  3U1N A;  2HG4 A;  3LP0 B;  2CKW A;  4IOC Q;  1LXN A;  4LJM A;  5DQI A;  4Y34 A;  4A8Y A;  1NH8 A;  2DRD A;  2RJZ A;  5DS7 A;  1OQ6 A;  4JI4 J;  5KG5 A;  3G9C A;  1RAJ A;  2DRA A;  1RAA B;  2A18 A;  3KJN B;  4OX7 A;  3A8E A;  4DQI A;  3CCU S;  3DXS X;  4F50 A;  3MED A;  2N4D A;  1PBA A;  3VV2 B;  2BOP A;  3WDO A;  4G1Q A;  2ZUG A;  3Q8S B;  1TMM A;  3H7H B;  1FE0 A;  1V9O A;  4JI6 F;  2B9W A;  1RDR A;  2DIV A;  2WHO A;  4NL5 A;  4EFA C;  5CCM A;  2KG1 A;  1XJW B;  4PXD A;  2YNG A;  3AB4 B;  1SPB P;  1YI2 S;  4JI5 J;  1IN0 A;  5HRO B;  4C2M A;  2BMB A;  1V3S A;  1HAR A;  5CAA A;  2J8A A;  2NLW A;  3TA0 A;  5J2M B;  2KM8 B;  1MML A;  3PAC A;  2GW8 A;  4A8F A;  3BKT A;  2MLX A;  2DGW A;  2FVQ A;  3W63 A;  1GTE A;  1EX8 A;  1N36 J;  4JI7 F;  1UJ6 A;  2ABY A;  2ZHA A;  3RR8 A;  4KKO B;  3T1Y F;  4UW2 A;  2GCF A;  1PC4 A;  2C2Z B;  3BGF A;  3NWG A;  4FXW A;  4I6Y A;  1Q78 A;  4DV1 F;  3MHY A;  5FLX Y;  2EC2 A;  7FDR A;  3KLF B;  2HKE A;  4NCA A;  4XAK A;  3ZZU A;  1KOO A;  2KL8 A;  2QMW A;  3KMQ A;  2W2M P;  2VG6 A;  4GVL A;  4DX5 A;  2DR9 A;  2EKY A;  4RX6 A;  4A8M P;  5KFP A;  5F0U A;  2LXU A;  1YIJ S;  2DPI A;  3NS7 B;  3BPD A;  4OI6 A;  4ZN3 A;  1HQE B;  3QLH B;  3R1H A;  3PY8 A;  2VAS A;  2B56 A;  1HI1 A;  1R0C B;  3KNA A;  1G2E A;  1CSJ A;  4HT5 A;  4OJ1 A;  4DOZ A;  2J6S A;  1T9T A;  1HIY A;  4HI1 A;  1FD2 A;  1HBU B;  2H4Y B;  4Z7Y A;  4YDX A;  4ZVG A;  5T41 A;  4HDG A;  4IKA A;  5A6W A;  3GSI A;  1F5A A;  4DL0 C;  3LP2 A;  4ZJO A;  3ENQ A;  2CPH A;  5HAO A;  4DUT A;  2MDA A;  2CQI A;  2KT5 A;  1QVG R;  4JOU A;  4ZLP A;  2RML A;  2EC0 A;  2XTJ P;  1N8R T;  1NU4 A;  4X66 J;  2ZHB A;  3IBC B;  1IXK A;  3UW1 A;  3V2U C;  3W8G A;  1HI8 A;  1U25 A;  3M8Q A;  4G1P A;  3V81 A;  2APO A;  1R8B A;  1Y4Z B;  4OHW A;  3KKF A;  1WDD A;  4GRS A;  4FPI A;  3FSI A;  2AIR B;  2UP1 A;  4B9V A;  4ED7 A;  1BE4 A;  5B08 A;  4U7U K;  2YWG A;  2VG7 B;  1R3N A;  3MPY A;  3RB3 A;  3G4S S;  2ZUA A;  5ETP A;  2OFG X;  1RT7 B;  3QPI A;  5EGY A;  3CCJ S;  1ZTW A;  2E9Z A;  3K89 A;  1FKP B;  1FDA A;  3OR2 A;  4ICL A;  2WRM A;  1SQG A;  3AH6 A;  3U1L A;  4DUY J;  2OLW A;  4DR2 F;  2UVW A;  2HRY A;  4TXS A;  5DG7 A;  1QE1 B;  1N54 B;  2J0Q D;  4DQQ A;  2HHT A;  2GZO A;  2J5A A;  4Y2C A;  4EK2 A;  5B0A A;  4LF8 J;  4LF1 A;  3NKY A;  2HVE A;  3A4T A;  1K8A T;  1HPZ A;  1FI4 A;  2KRR A;  2R4F A;  3VQT A;  2ZH8 A;  3LGN A;  4ZKA A;  2XZD B;  4ILL A;  1R8A A;  1ZS6 A;  3DU6 A;  1NHK L;  3G6V A;  2F8H A;  1QM9 A;  3JTP A;  4NOH A;  4K5R A;  4WPA A;  4CLZ A;  2RDI A;  5HMW A;  3T9N A;  4YUD A;  3D0G E;  4CTA A;  4XK8 C;  2AX0 A;  2N3L A;  2HUR A;  2FD2 A;  3MOJ B;  3V5R A;  1D8Y A;  1N33 F;  2BAN A;  4DV2 J;  3AOC A;  4AYB D;  2E5L J;  1UEU A;  1UW4 A;  4GKJ F;  4WK1 A;  1SB6 A;  4ED5 A;  4OYX A;  4G3I A;  4DLG A;  2I9S A;  1B0V A;  2UV8 A;  2XMT A;  2R7W A;  2CJK A;  1N0U A;  3LAL A;  2ZD1 B;  4IFV B;  4QPX A;  4RZR A;  2JJ4 D;  2RT3 A;  3FEX B;  1MU2 B;  1WC1 A;  2PO4 A;  4NA1 A;  3UQS A;  3UVJ B;  2ZH2 A;  2HFV A;  1T94 A;  1RXO B;  1TVR B;  2NRE A;  1S57 A;  2W01 A;  3QT6 A;  1D1U A;  1JXL A;  3MM5 B;  4DXL A;  4OJG A;  3UN2 A;  2FC9 A;  2BKO A;  3AOB A;  2BDP A;  3SQG A;  1HNW J;  3OL9 A;  2KXF A;  3EDR B;  1PYS B;  1B7F A;  2AYM A;  3EJM A;  3CB4 A;  3J7Z 5;  2ADB A;  4A8X A;  5CZX A;  5H9F J;  3S7R A;  3GFZ A;  3MR3 A;  4NXN F;  3CT9 A;  4PXE A;  4W92 B;  1H38 A;  2YNG B;  4CO1 A;  4A8S A;  1X31 C;  3GIR A;  2M8D B;  4MK8 A;  2E7W A;  3E51 A;  4NCG A;  4WXW A;  4KHP J;  4NXM F;  1PYO B;  5J2M A;  2D3U A;  4JI2 F;  2R7X A;  2CA9 A;  3PW0 A;  2ASJ A;  3W7B A;  4OYA A;  4JV2 A;  2GVZ B;  3KG4 A;  2DBB A;  3SBM A;  4RW8 A;  2JX2 A;  1OPZ A;  2FPH X;  2C2N A;  2Z2M A;  2ZEJ A;  2WAQ D;  3WZ0 A;  1LW0 B;  3N4W A;  3ULH A;  2M3D A;  4WP9 A;  4ZPA A;  2VKZ G;  3RW7 A;  1RB0 A;  2HND B;  5HBM A;  5J1E A;  4X4Q A;  4DX8 H;  1LWX A;  2FJD B;  4MK7 A;  2A6M A;  5G0R A;  1RCX B;  1H2U X;  2YKA A;  3KLF A;  2HQI A;  1S9F A;  4J37 A;  1PBU A;  2UVU A;  3OPK A;  1EET B;  2M7S A;  2Z57 B;  5LOQ A;  2YKP A;  4KGZ B;  2GIQ A;  4O3Q A;  2HS3 A;  3WC0 A;  1AFJ A;  4RU2 A;  2KJW A;  3SCK E;  5KFJ A;  1XNR F;  4LBI A;  2B4P A;  4Q7A A;  1U24 A;  2IM3 A;  1XBW A;  4P73 A;  4ALZ A;  1RWN B;  4CO3 A;  3TVY A;  9RUB A;  1U1P A;  1M5P C;  3M05 A;  3I0R A;  4K4V A;  1PGZ A;  1NAQ A;  3L09 A;  2DEJ A;  1WKK A;  2ZHO A;  3MWB A;  1RHR B;  3OR1 B;  4EBC A;  4ELV A;  1OSD A;  1VQY A;  1Q4R A;  3CCZ A;  1C0U B;  3GON A;  3KLI B;  5A8K B;  3OJS A;  3AXM A;  1ZM9 A;  3B78 A;  1OY9 A;  2JSX A;  1B0P A;  5ETR A;  1Y11 A;  2ASY A;  2XG8 A;  1NEE A;  1RGV A;  1RWK B;  1UZD A;  2KVI A;  2M5Y A;  1UTA A;  2P2C B;  3A8J A;  3HSZ A;  3JQM A;  4HTI A;  4ZCL A;  3FCH A;  3QFW A;  2QFI A;  5LT5 A;  2Z4P A;  5KT3 A;  1WKL A;  3C66 A;  5KFL A;  2ZH5 A;  5FLX U;  2BEF A;  1HNW F;  1VCT A;  2DNO A;  5E2Q A;  3M30 B;  5LJ3 Y;  2VB6 A;  4PQU A;  1GAO A;  3DGP A;  3KK1 A;  2XY5 A;  3PM9 A;  4KO0 A;  3J7A 1;  5EWF A;  1G6B A;  1KS2 A;  1RU1 A;  1JMT A;  1SKW A;  4K59 A;  4LFC J;  1HYS A;  5CYJ A;  2Z2Y B;  3CCW A;  4EYH B;  4JI2 J;  3VAM A;  4DPY A;  4ZJQ A;  3ZTS A;  5GAH I;  4ECR A;  1WOS A;  1HNV B;  2CZ4 A;  4J90 A;  2YQ3 A;  2YNI A;  3CVK A;  2V63 A;  2HS4 A;  3T6B A;  5HJY A;  5DM6 Q;  1FWL A;  2K2P A;  4OYO A;  1TV6 A;  4FDF A;  1J27 A;  1U8S A;  2GO9 A;  4JI1 J;  1M1K T;  4JV5 J;  4IRK A;  3IM9 A;  3M9N B;  3DRY A;  3MF5 A;  5HP1 B;  4OHY A;  4MK9 A;  3CO0 P;  1KQS R;  2VFS A;  3DYA B;  4F2S A;  1CUL A;  3WHI A;  2DKO B;  1F5C A;  1LEO A;  2CWX A;  1WKJ A;  2MJN A;  2GMH A;  2JEF A;  4FBT A;  4FS1 A;  1FFS B;  4B3R F;  4RW9 B;  4NLD A;  1FEE A;  4O4R A;  1DUR A;  3UCG A;  4ED1 A;  4NLV A;  1H2T Z;  1X0F A;  1NJX A;  4B3M F;  4DUY F;  2B5J A;  1GMW A;  1NKB A;  2ZC3 A;  2HHW A;  2D74 B;  3ADA C;  2IVY A;  5KOX A;  4IFV A;  2ZD1 A;  4DFM A;  4X64 J;  1N33 J;  2YXL A;  1NZ8 A;  1EP4 B;  2OPR A;  2DY1 A;  2XNQ A;  3MPW A;  5KFI A;  3UDL A;  1BQX A;  1KOH A;  4X84 A;  1MWQ A;  3MAA A;  2OTJ S;  2J8S A;  3N6L A;  1AW0 A;  2J0X A;  1WG5 A;  3V6J A;  1JLG B;  2QMX A;  2D69 A;  2HMI B;  1MRO A;  2BBE A;  2ROP A;  3QGP A;  4RUA A;  3OTO J;  1FX4 A;  2NUU G;  4PG7 A;  1OY8 A;  3A8K A;  4PXC A;  1JKH B;  1GK8 A;  4CQ1 A;  3OHB A;  2HLU A;  3PW5 A;  1N32 J;  1RTJ B;  2C1E B;  5CD4 A;  1XEZ A;  4OZ0 A;  3SV3 A;  1UA0 A;  4F4Y A;  2MZ1 A;  4PWU A;  4ER8 A;  3TUI C;  3ILO A;  3POT B;  1J5E F;  2N7Y A;  4Z2X A;  5IWA F;  3N01 A;  2BE7 D;  3WX4 A;  1RKJ A;  3QWU A;  4DS5 A;  1IBL J;  3CIZ A;  4DHV A;  3AOA A;  2YVS A;  3I5C A;  4M5K A;  3J7A N;  3KK2 B;  3VAF A;  4DV0 F;  2DH8 A;  1WJ9 A;  3G6Y A;  2DD8 S;  2RD5 C;  3MCM A;  3ZXW A;  1X5T A;  4RNM A;  2DR5 A;  2UU9 J;  1YQH A;  4USM A;  1EZZ B;  1XR6 A;  4DSK A;  2FYX A;  1VK8 A;  3GLJ A;  3BN4 A;  5IT4 A;  1QUP A;  3KG1 A;  3UI3 A;  2DNK A;  1X7V A;  1S9G B;  1YWX A;  1YVF A;  4LBP A;  2WBM A;  5AXK A;  3MCN A;  3GII A;  4DV7 F;  3T5L A;  1QUV A;  3KNG A;  4B17 A;  1JLA A;  3S8S A;  3FZ2 A;  3D7S B;  2L9W A;  3G6E S;  3SV4 A;  2FVC A;  2F4V J;  4IOB A;  2YNF A;  3PX6 A;  3GYG A;  2CRL A;  3RJM B;  2NSC A;  3BF4 A;  1VC5 A;  3ZZR A;  2RH3 A;  2VQF F;  4ILR A;  4YDD B;  1R6V A;  3M2U B;  4PYD A;  2GVD B;  1RP5 A;  3AD9 C;  5B0F A;  1JLF B;  2Z58 B;  4C8M A;  2BXJ A;  2PEH A;  1H73 A;  1KQK A;  3IN5 A;  2LDI A;  4AQY F;  4A8K A;  3EZU A;  2QL7 B;  1GX6 A;  2DB1 A;  2OSQ A;  3QNW B;  7FD1 A;  1ZPV A;  4O3R A;  4LMZ A;  1F6T A;  3BBC A;  3QAT A;  3BQ1 A;  3DU5 A;  4Y65 A;  4FKX A;  3MI7 X;  2FJA B;  2W4C A;  4Y3C A;  3N9U C;  1RJJ A;  4QIV A;  2ZJR Q;  2MZJ A;  2ZNZ A;  3I0S A;  1K44 A;  1FNO A;  1NME B;  2LLZ A;  2VG6 B;  1RT4 B;  4C8Y A;  1RWW B;  1PIL A;  3KUH A;  4LSZ B;  1PG5 B;  4ITS A;  1KBR A;  5ETO A;  3OL7 A;  3ILL A;  2GIF A;  5KFD A;  4ECV A;  4I7F B;  3TR5 A;  3W5Y A;  3NMR A;  2JWN A;  4YR3 A;  2O1P A;  1ZBT A;  5F3T A;  4C3K A;  1YTY A;  1HWU A;  2XEX A;  3CWJ A;  2RNE A;  1NKC A;  3BR8 A;  1UWA A;  1YK9 A;  1V3R A;  3CDA A;  3I32 A;  2POK A;  3RAQ A;  4AQY J;  3IRX A;  3HKW A;  2IRU A;  4PQA A;  2KT3 A;  1DHM A;  2DEI A;  3P3D A;  1JLC A;  2YH0 A;  1U1L A;  1RAG B;  2X7I A;  1SL0 A;  1HMV A;  4I1T A;  4BHQ A;  1CJK B;  2A3J A;  5GAG I;  2C28 A;  1JXV A;  5EDW A;  3TAP A;  1KNZ A;  3TW0 A;  5IV3 A;  2AJQ A;  4P75 A;  4K0K F;  1P9Y A;  2IDL A;  3KLG A;  2PI4 A;  1NSP A;  2MJU A;  2V9K A;  4F26 A;  1O8B A;  2QEX S;  4M5J A;  3S6E A;  1UZH A;  3FC9 A;  3RUB L;  3M2R B;  5L1I A;  4JI4 F;  3QRP A;  1QAY A;  2AZ3 A;  2C3U A;  3FCW A;  2PN6 A;  2V9W A;  1S48 A;  3RTV A;  1UFL A;  2RRA A;  4DR6 F;  5L9N A;  2EI5 A;  1Q1K A;  3EUN A;  3M8S A;  3QO9 A;  4NX9 A;  2ZKU A;  3MR5 A;  3K59 A;  4WKR A;  4LFB J;  3BH7 B;  4DSL A;  3M2V A;  1IKX B;  3IAM 9;  3CD7 A;  4L75 A;  2WW4 A;  3S1T A;  1S1W B;  2CPX A;  3R6L B;  2QN6 B;  3PV8 A;  4MJK A;  2HSE B;  2LMI A;  4BCA A;  1JKH A;  3Q8U A;  4UOG A;  1WEZ A;  2GJ2 A;  3QLH A;  1SBR A;  2HHV A;  2C2E A;  2ZBR A;  2BQU A;  1IKY B;  5KG3 A;  3CJ3 A;  2AMC B;  3CCR S;  3NNA A;  2VV5 A;  3PG9 A;  3HT0 A;  5AXM A;  2ALY B;  6FDR A;  3US5 A;  3OXG A;  4OI4 A;  5C2G A;  1CJV A;  1Q16 B;  2QFJ A;  1GMU A;  4J9S A;  2RU3 A;  5FDL A;  2EEY A;  1IKW B;  1KR4 A;  3RZA A;  2AP6 A;  3OFE A;  1U6B A;  3D66 A;  4YB7 A;  1N56 A;  2J6T A;  1FJC A;  1SJ1 A;  1H0H B;  1OWX A;  3CJS A;  2NXC A;  3HZE A;  4ZIW A;  5KFW A;  1VQN S;  1YX2 A;  4TY8 A;  2XGP A;  1IBK J;  3AB2 B;  2LXI A;  4DV3 F;  4IRC A;  3QJP A;  2LP4 A;  3PYD A;  2C3O A;  1REV B;  3CJ2 A;  1TL7 A;  2HVH A;  1MN9 A;  2A2C A;  4YFU A;  4Z37 A;  1E6V A;  1VQS A;  2C2D A;  1WG1 A;  2IPO B;  5CH7 B;  5DJB A;  1IWG A;  1MMN A;  1SH2 A;  4DZD A;  1XNQ J;  3B4M A;  2EK1 A;  3C6T B;  4O0I A;  3MXH P;  5FII A;  3SQO P;  3C14 B;  3HSG A;  2ZJP Q;  2IMO A;  1QE1 A;  3DM2 B;  1M1G A;  3J80 Y;  1FCA A;  4WFB Q;  3TAN A;  2MKH A;  3L9Z A;  5KFF A;  4U95 A;  1YIT S;  3UFC X;  3V4I A;  2VKR A;  2ZBC A;  3VAK A;  2EG1 A;  4XPC A;  2IAJ B;  2AEM A;  1Q82 T;  1P27 B;  2DHS A;  5A0Y A;  2GML A;  4Y2A A;  1CJU B;  2HRU A;  5A2Q Y;  1D9D A;  2OIH A;  2ZVI A;  3LOU A;  5K20 B;  1QD1 A;  3BS9 A;  2RQC A;  1S0V A;  1JLQ A;  3VVT A;  1WD6 A;  2FHM A;  2V4J A;  5G4D A;  1RCO B;  2QJ3 A;  1Y3J A;  2E1M C;  3FJ2 A;  5KFT A;  4LFC F;  3AD7 C;  2WVF A;  3KJF B;  4OJH A;  3X3U A;  5IC4 B;  1TAU A;  1T8E A;  2NZC A;  4NI2 B;  4CLU A;  4ID5 A;  3QSY B;  4USW A;  1Y00 A;  3GCX P;  4RUB A;  3MMB B;  5F41 A;  4ELT A;  1CVJ A;  2KZZ A;  3AXK A;  1HW9 A;  4ETZ A;  3OVS A;  2QA2 A;  1SCJ B;  1IKV B;  4KIA A;  5LXR A;  4FF3 A;  4Q2M A;  5I3Q A;  1Z1Z A;  3OFG A;  6AT1 B;  5HQL A;  2QLX A;  1OMS A;  1R89 A;  3FQL A;  4FPR A;  4ED0 A;  4TLQ A;  2ZH7 A;  4DDF A;  4Q45 A;  4HDH A;  2Y3Y A;  2JZ5 A;  2CG8 A;  1SJQ A;  2KXN B;  3D4J A;  3BSC A;  4O23 A;  3O3L A;  2O01 C;  4ANC A;  3TI0 A;  3C15 B;  2N3O A;  4L74 A;  4QIE A;  2XSJ A;  1S6Q A;  3KLG B;  3FCV A;  1DQ9 A;  2MQ8 A;  3ICL A;  3VWS A;  1APS A;  3DGP B;  3KK1 B;  2WVB A;  4DR4 J;  1C2P A;  1S0O A;  1DZ5 A;  2H3E B;  5SUH A;  1U47 A;  3R9L A;  3QGH A;  4USV A;  4B9S A;  1FEH A;  5KFZ A;  1M5H A;  1S4F A;  3WIU A;  4IUF A;  3KTQ A;  3VQS A;  2BA9 A;  3EGV A;  2CQ3 A;  2V8H A;  2BJE A;  5KFX A;  5G0R B;  4FP9 A;  4BS2 A;  3OTO F;  3PW7 A;  1WTB A;  1H7X A;  2YNI B;  3B4D A;  3FGV A;  3I5B A;  2VH7 A;  3W60 A;  4NLY A;  5KT5 A;  1XMO F;  3EPG A;  1M90 T;  2OMO A;  4X4P A;  4QZV B;  5D0G A;  2NPF A;  4TQR A;  2AX1 A;  1H3D A;  1BY9 A;  1HWI A;  4AL6 A;  2GAH C;  4QWB A;  1KLN A;  1AZS A;  4E0D A;  3H8Y A;  4YOE A;  1FKP A;  2QYC A;  2XMW A;  1HKA A;  4NXM J;  2F9D A;  3MEK A;  3VAI A;  4LF4 F;  4YB5 A;  1JB0 C;  1RAD B;  2L9N A;  3M6U A;  3VAL A;  3EVW A;  1K1Q A;  1VOM A;  4B3M J;  2RQ4 A;  4GKK F;  1X4A A;  4I68 A;  4RW9 A;  5KFM A;  4KRW A;  2FY1 A;  3CSK A;  4RW6 B;  3D1H A;  3HHN B;  3BBB A;  1OYD A;  4MKY A;  4ZVR B;  5L1J A;  1URN A;  5KFU A;  1U2R A;  4CM0 A;  2YKO A;  1YJR A;  4P2S A;  2CVI A;  1MWZ A;  2AKW B;  4I2Q B;  3DDK A;  3K58 A;  5DLF A;  1NBE B;  3CJ4 A;  3DDI A;  4Y2K A;  3UWT A;  4C8N A;  3DLB A;  1RT1 B;  4QPT A;  4Q0B B;  2C2O B;  2PDA A;  3E01 B;  2JEI A;  1GT8 A;  5JXS A;  4YHH F;  2UUB F;  2Y0S D;  4AXJ A;  4ED3 A;  3NEK A;  3LAM A;  2JNJ A;  1ZYQ A;  1PJ7 A;  3R5D A;  5KT2 A;  4Y00 A;  2YY3 A;  2DO0 A;  3UVJ A;  3TA1 A;  2CYY A;  3HVT B;  1Q7L B;  1RT5 A;  5SZT A;  4UZC A;  4DFK A;  4IR1 A;  2RKI B;  3MEE B;  2VF3 A;  5AJ3 J;  2R2R A;  1KVI A;  3ZNU A;  2RU9 A;  1HQU B;  5HP1 A;  5HVG A;  3SQG B;  4CI0 B;  2V68 A;  3TNV A;  3LH2 S;  1S49 A;  5CYM A;  3DNC A;  1WAC A;  4YR0 A;  4J9V A;  5KG7 A;  5IC6 B;  3HXM A;  1RHM B;  2PA8 D;  1S7H A;  5GMD A;  2L3M A;  3T1H F;  2OKQ A;  4CDI A;  1QAJ A;  4IG0 B;  4E8U A;  4MIA A;  3GPA A;  4I56 A;  4UQT A;  1U6Z A;  2QYG A;  2KH9 A;  3C16 B;  2EFG A;  5KG1 A;  5LMN F;  5C25 B;  3KFW X;  4Q44 A;  5EUH A;  3RYL A;  4O3P A;  3GR0 A;  4LF9 F;  4FKY A;  2MEW A;  2YX7 A;  1NDK A;  3D6F B;  5M2R A;  3PJX A;  5C42 B;  2BRL A;  2VQE F;  4O3S A;  1ZM2 A;  5DGA A;  1GQE A;  4Y28 C;  2WSC C;  4DN0 A;  4C3L A;  4XIU A;  1S79 A;  1R31 A;  4DG1 A;  4WZM A;  3L7P A;  1TL4 A;  1MN7 A;  4H4O B;  4NA3 A;  4RNF A;  1N34 J;  3BO3 A;  3HVR A;  4ZVU B;  1UW9 A;  4H4K A;  3CCS S;  1EET A;  2GIR A;  4ZLJ A;  1I94 J;  3MD1 A;  3IP0 A;  3M8Q B;  4C48 A;  1XC9 A;  4M94 A;  5LSL A;  4MH8 A;  3I9V 9;  2JH3 A;  3BSN A;  1SL2 A;  1RBO B;  4QIG A;  2UUB J;  3O2I A;  1RBL A;  2GVD A;  4DLE A;  4RW4 A;  1VIX A;  4TU9 A;  2VHG A;  3GJQ B;  2E5H A;  3GJT B;  1KEK A;  4OYM A;  2R8K A;  3IO1 A;  4B3O A;  4FS2 A;  4X4O A;  1HL6 A;  1RBA A;  1TKZ A;  1BHN A;  1W2I A;  3POT A;  5A8K A;  3T5K A;  2C2K B;  3NS6 A;  4C11 A;  3CJT A;  2HGM A;  4IH5 A;  4D3H A;  3BQ0 A;  2D3O 1;  2X51 A;  2ILY A;  2E5G A;  1YJT A;  2ZWP A;  3KK2 A;  2NXN A;  2OEL A;  4RW7 B;  4ECX A;  1IBM J;  3DLL Q;  4WIQ A;  4I69 A;  2CDR B;  4B9U A;  1UFW A;  3PNI A;  2YWE A;  4ZP6 A;  5KFY A;  3FVY A;  4NXN J;  1ROF A;  1UJ4 A;  3CTR A;  3QSI A;  4LF6 J;  2AJ4 A;  2BE9 B;  2GX8 A;  2WB1 D;  2YWK A;  3M1V B;  1M5O C;  2E9T A;  1WF0 A;  2VOD A;  4BWJ A;  1S6P B;  3RAX A;  2B4O A;  2YKQ A;  1JLB B;  1Z2L A;  2F8M A;  1TL3 A;  4IO1 A;  2LEB A;  2V4Q A;  4WK3 A;  1ARO P;  1VHI A;  5CZV A;  1WNE A;  5HMX A;  4NZ0 A;  3KJV A;  3SDE A;  4H54 A;  3U27 A;  2HNZ A;  2WVC A;  3X1L B;  5DDR C;  2MGZ B;  2P9C A;  4ED2 A;  1N4L A;  3GFX A;  3OL8 A;  2O3D A;  1CJK A;  2NXE A;  3NBP A;  3HK2 A;  2DHG A;  3IG1 B;  4KV8 A;  4O44 B;  4F3O A;  1TV6 B;  3PRB A;  1FWK A;  3AAW B;  2QO3 A;  3RBZ A;  2DGU A;  3M6V A;  2BE2 A;  2CDQ A;  2LEP A;  4YEA A;  1K73 T;  1YKW A;  5KG2 A;  2Z56 B;  3N79 A;  3PHE A;  4DR2 J;  3ZTO A;  3GP9 A;  3NCP A;  1TVR A;  1Y0H A;  5B0G A;  2R7R A;  2JC1 A;  1JLE A;  5F8I A;  3DMJ B;  4DU8 A;  1FD8 A;  2HYI B;  4WE1 B;  2IBO A;  3RGI A;  1RWV B;  2U2F A;  1FE4 A;  3ENW A;  3HKZ D;  1U7L A;  3BR9 A;  5CHC B;  5DQH A;  4IFY B;  4Y6I A;  4ZP8 A;  1ZA1 B;  2DR7 A;  2J0W A;  1IKX A;  4USI A;  4HI2 A;  4CH0 S;  1P8G A;  3TEH B;  3W66 A;  4ECW A;  5BXI A;  1UVJ A;  4OZ1 A;  5AJ3 F;  4NLQ A;  1RAC B;  4DPW A;  1IR2 A;  5KFN A;  2EPI A;  3I0S B;  4M5L A;  4I6W A;  2K06 A;  5GAG U;  1SKR A;  4RLE A;  1EJ7 L;  1LWE B;  1HR0 J;  4LVO P;  3PX4 A;  4EWT A;  3QT5 A;  3W9I A;  5JUM A;  3WC2 A;  2Z0G A;  2CZ9 A;  1RT5 B;  3W8P A;  2IRX A;  3H2U B;  5EX0 A;  4DQS A;  1D0E A;  2VBX A;  2WVE A;  4F0K A;  2COL A;  5IQ6 A;  4OL8 A;  2QE5 A;  4C8K A;  3MM7 A;  3SZ2 A;  4LQ9 A;  1CBK A;  4WYL A;  1S1V B;  3HHL B;  2UXC F;  1FKO B;  2EFN A;  3CE8 A;  5ETN A;  2DNR A;  3GE9 A;  3LWL A;  1UKU A;  1YJ7 A;  2JLF A;  2V94 A;  4N7T A;  2W9B A;  3W65 A;  2BJ3 A;  3P45 B;  2IC3 A;  1RAO A;  2V34 A;  3A3P B;  5HMZ A;  4KSE B;  2DK2 A;  2GV1 A;  4ID8 A;  3PR4 A;  4RWW A;  5AXL A;  2H4W B;  4I2P A;  3TAM B;  3W9H A;  4FF4 A;  4ZCK A;  3I87 A;  3FFI A;  4DV1 J;  4F4X A;  4DR3 J;  1S0N A;  4IH7 A;  3T1Y J;  3GFY A;  3PIP Q;  1FTC A;  1W26 A;  2X1G A;  5ETT A;  1IUJ A;  2GQQ A;  2KYZ A;  1SUQ B;  3IBF B;  2DNZ A;  2WSE C;  1RAF B;  1RSC A;  4NA2 A;  5THW A;  3UNG C;  4WZQ A;  5HN0 A;  1YBT A;  2PEB A;  2OEM A;  1VC6 A;  5DDO C;  1TK0 A;  2NR0 A;  5ETK A;  4NLP A;  3W62 A;  5IFM A;  5IZH A;  1K1S A;  2KVQ E;  2QLF B;  1HNZ F;  1G7C B;  1S97 A;  1F1B B;  1URR A;  2ZKT A;  4KR0 B;  4WP3 A;  1JJ2 R;  5K8O A;  2DNY A;  3KLE A;  1FNX H;  2YPZ A;  1S1X B;  2HQD A;  3IWL A;  4LBH A;  3BO4 A;  2NZ4 A;  2R7O A;  1CQM A;  1IM6 A;  5IXU A;  2CG4 A;  4DR4 F;  1H72 C;  3TX0 A;  2MLY A;  4O3O A;  1VRU A;  4KQZ A;  2HHU A;  1SQE A;  3PYE A;  4LR8 A;  2MY7 A;  2V4J B;  1CJT A;  3TJA A;  4G1I A;  2VIH A;  1S7I A;  2Q79 A;  4RL1 A;  4U6P A;  4J9M A;  2BM0 A;  2ZZT A;  2BKN A;  4WFA Q;  4ZHR B;  1RTH B;  1HI0 P;  3QGI A;  4WFZ A;  1X5S A;  2G2O A;  1LFW A;  2J6U A;  3M6X A;  1ITP A;  2W25 A;  3W2V A;  4YS2 A;  5DLG A;  2WON B;  2EKN A;  1RA6 A;  4JP8 A;  1Z2Z A;  3SXL A;  3UDE A;  1B3T A;  3MCS A;  3VZH A;  5KFG A;  2ZJQ Q;  3IC1 A;  4EBE A;  1REV A;  3BDE A;  1TL3 B;  1S1T A;  4HAC B;  4DL7 A;  3CUL A;  2V67 A;  4RO0 A;  4QW8 A;  3ZC4 A;  3HHL C;  2HHH F;  2VOP A;  4DBQ A;  2ACM A;  4RNH A;  4X4R A;  1SKU B;  5KFO A;  1DY3 A;  1MMD A;  1GFW B;  4I7F A;  2XMM A;  1NPP A;  2CAD A;  2L9D A;  3TAR A;  4KT0 C;  4RNN A;  1KON A;  4WFX A;  1X9S A;  2RHS B;  1EQM A;  2XYH B;  4QJV A;  1LWC B;  4ANE A;  1KP6 A;  1LK5 A;  3DOL B;  1UVN A;  1WF2 A;  3FBF A;  2Q6B A;  2QL5 B;  1K47 A;  2E7V A;  4HH1 A;  4LSN A;  4CO4 A;  2HFN A;  2AWZ A;  5GAE I;  1NM2 A;  2ZZM A;  4UUX A;  3C19 A;  2ZH4 A;  4DS4 A;  3BGR B;  1JLG A;  3Q23 A;  4NPO A;  3KYL A;  5HLF B;  1YJN S;  3K5L A;  1GNK A;  5A0Y B;  2YKN B;  1R6Y A;  2RF2 B;  4OYP A;  5KFB A;  1VQP S;  1D9F A;  2QGF B;  4C8O A;  1HNZ J;  4DV5 J;  4NCB A;  2LQ5 A;  3KK3 A;  3MAH A;  4K5S A;  3SCI E;  3MMC A;  3IGN A;  5K14 B;  5B7W A;  3JSM B;  2LU2 A;  4F4K A;  2P8I A;  1VIS A;  2XMJ A;  2JEJ A;  1G1X A;  2IHR 1;  3G86 A;  4DR5 J;  3K5O A;  3P5B P;  4L3K A;  3KLH A;  1FDN A;  3I31 A;  5E41 A;  2P9E A;  3QO9 B;  2CPI A;  1YG0 A;  2QA4 S;  2B43 A;  3GIM A;  1YDL A;  2BAB A;  1U2F A;  2M4M A;  2VFT A;  4H4M A;  4M8L A;  5I3U A;  1KSP A;  2HWI A;  1DAX A;  2NUH A;  4R5P A;  3C3L A;  5F8N A;  2E5I A;  3I5A A;  3MFI A;  4OX8 A;  3GCW P;  2AJ1 A;  2P5V A;  3JTO A;  3RRG A;  1NPK A;  2H5J B;  2MKJ A;  3BEG B;  2VBZ A;  3FMW A;  1S9E B;  1TKX B;  2AJ0 A;  4IQM A;  3JB9 k;  4JI0 J;  1WHY A;  2ZOG A;  3D5M A;  5HO4 A;  4DV5 F;  2ZDO A;  2LEC A;  1C0T B;  1I5O B;  3MM9 B;  1VJW A;  4NRT A;  2IVF B;  2W2O P;  2YNF B;  3DLG A;  3Q2S C;  3KXD A;  2J9D E;  4Q0B A;  1JQG A;  5AE3 A;  4TQS A;  4NLR A;  4G65 A;  4QR0 A;  2YH1 A;  3G82 A;  4KTQ A;  2KTQ A;  1HR0 F;  4O3N A;  4URS A;  1FT8 A;  1OSC A;  4W4M A;  1SUQ A;  1FX2 A;  1R8H A;  2LQ8 A;  3NY0 A;  1FO1 A;  4URQ U;  2XY6 A;  1KFS A;  4C8L A;  2Q43 A;  2R7Q A;  5I42 A;  3Q0A A;  1EAY C;  1ZAX A;  4L3N A;  3SSR A;  2DXD A;  5IM0 B;  1U4B A;  3PJ9 A;  1X4G A;  2GFF A;  3DKD A;  2MQN A;  2GGP B;  2W9C A;  1NJZ A;  3TUZ C;  1E6V B;  5F8L A;  2IRY A;  3TWZ A;  2IBK A;  1LWF B;  2I1R A;  3K17 A;  1ZAV A;  2EXU A;  2MMY A;  3DRP A;  3I4H X;  5HJX A;  4IRD A;  1U0S A;  2DNL A;  2O5D A;  3OD2 A;  4GO7 X;  4P74 A;  4WFN Q;  5L38 A;  4TKT A;  3C14 A;  4OI2 A;  2DH9 A;  2QT7 A;  3UDC A;  3BO2 A;  1DQA A;  5DM7 Q;  1SJ3 P;  2FJE B;  1GXU A;  2QA4 G;  4B3S F;  4H4K C;  4U96 A;  3H2V E;  3MEC A;  3A3N B;  3MUV P;  4G6V B;  2Q3P A;  4P7V A;  2K3K A;  1R7I A;  1RIS A;  4R8U A;  5JJB A;  2IA6 A;  2XS5 A;  1P1L A;  4GO5 X;  2Z8Q A;  2QSF A;  1PYT A;  1RTH A;  4PG6 A;  5BYQ A;  1A9N B;  5DDQ C;  3RB0 A;  1BQN B;  5CAB A;  3KHG A;  1N5Y B;  2DY9 A;  3M32 B;  1YRU A;  4DPU A;  2HW3 A;  3TQE A;  1RT3 A;  4V1A k;  2GHW A;  4LIR A;  1MSW D;  2E1R A;  2D9O A;  1N88 A;  1DTT A;  1S1T B;  2HIY A;  4HAC A;  2ZBQ A;  4MFB A;  5E3Q A;  3PTW A;  3FQK A;  4OHX A;  3IRW P;  1Q53 A;  2KI2 A;  4AUK A;  2XLJ A;  2UUA J;  1LW2 A;  2A0F B;  3HX9 A;  3MMA A;  1VQ7 S;  4B3R J;  3RB6 A;  4HT7 A;  3ZZY A;  2M8H A;  1GH8 A;  4A8O A;  3J81 U;  1WTF A;  3W2W A;  1B0T A;  1UVK A;  2RKI A;  2MY8 A;  2OD6 A;  5HAT A;  2XMU A;  2ADC A;  4IR9 A;  4N76 A;  2G4B A;  1TUW A;  4C11 B;  1HQU A;  3NNC A;  1T7P A;  3W5Z A;  4G1Q B;  2D3O R;  2IJF A;  1I3O B;  1NUE A;  2CPJ A;  2HFS A;  3LP1 B;  2CQ0 A;  2DGT A;  4KFB A;  2LA4 A;  2DNM A;  1XIQ A; 
#chains in the Genus database with same CATH homology
 4OZ2 A;  1CJV A;  4OYB A;  5D0H A;  4OYP A;  1TL7 B;  4CM0 A;  1WC5 A;  4OYA A;  2GVZ B;  4WP9 A;  2QV6 A;  5D0E A;  1CJU A;  4P2F A;  1TL7 A;  4CLT A;  3ET6 A;  3UVJ A;  4CLP A;  4WP8 A;  3C14 B;  1WC0 A;  4OYI A;  3R5G A;  1CS4 B;  2GVD B;  1CS4 A;  1Y11 A;  2WZ1 A;  4CLF A;  3C16 B;  1CJU B;  4USU A;  3C16 A;  3G82 A;  4OYZ A;  4CLK A;  1FX2 A;  1Y10 A;  4CLL A;  5IV4 A;  4OZ3 A;  1YBT A;  4NI2 B;  4CLU A;  4OYW A;  4USW A;  4CLW A;  1CUL B;  4WP3 A;  4CLS A;  2GVD A;  1WC3 A;  1YK9 A;  3C14 A;  4OYO A;  4OYM A;  1AB8 A;  1U0H B;  3C15 B;  1WC4 A;  1CJV B;  1CUL A;  1CJK B;  5D15 A;  1CJT A;  5IV3 A;  1YBU A;  4WPA A;  4CLZ A;  1CJT B;  3MR7 A;  4USV A;  3G82 B;  4CLY A;  4NI2 A;  1U0H A;  1AZS B;  4UST A;  4CM2 A;  5D0R A;  4OYX A;  2BW7 A;  1WC6 A;  3MAA B;  3ET6 B;  5D0G A;  1WC1 A;  3UVJ B;  3MAA A;  1AZS A;  2W01 A;  3C15 A;  1FX4 A;  1CJK A;  4P2X A;  2GVZ A;  4P2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...