2MB0B

Solution structure of hnrnp g rrm in complex with the rna 5'-aucaaa-3'
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing/rna
molecule keywords RNA-binding motif protein, X chromosome
publication title Characterization of the RNA recognition mode of hnRNP G extends its role in SMN2 splicing regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mb0B01
2DNPA 2CQHA 1OIAA 1WHXA 2CQ0A 2OTLS 2DNRA 1JJ4A 1X4FA 1X5OA 1X5PA 1WEXA 1SJ3P 1X4EA 1SJFA 4ED5A 5JVGQ 5FJ4A 3L3CA 2DGVA 2FHOB 2XSFA 2XB2D 3SMZA 1WEZA 3G4SS 3THPA 3PIOQ 2M88A 2CPFA 1WWHA 2BOPA 3BO4A 4F25A 1KQSR 2QA4S 2X1AA 3CC2S 2I38A 4U67Q 2AYGA 1WHYA 2X1FA 4QU7A 1UW4A 2M70A 2N7CA 2E5IA 2FC8A 4W92B 2X1GA 1RKJA 2JVOA 2VONA 5CYJA 1D8ZA 1VQLS 2JRSA 2XS7A 4W90B 3SXLA 1YHQS 1S79A 3S8SA 2DHSA 1YJNS 1WG4A 2OIHA 4ERDA 4LMZA 3CCJS 1K9MT 1VQMS 5DETA 2AYMA 2DO4A 2MQNA 4TU8A 1P1TA 2AYBA 3CULA 3H2VE 2DGOA 3K0JA 2K8GA 1VBYA 2RRAA 4V19X 2JVRA 2LA6A 4BS2A 3MXHP 1ZZNA 2DITA 2GO9A 2LXUA 1PO6A 1FJEB 1SJQA 3CPWR 3SDEB 3EGZA 3ZZZA 2M7SA 2M8DB 5EN1A 2MJUA 2DB1A 1DBDA 2KRRA 2WBRA 2J0SD 3BO2A 5IM0A 1SJ4P 3CCSS 2RUGA 1XN9A 2DGXA 3LPYA 5HO4A 1NO8A 3R27A 4TLQA 2N82B 3MURP 1W2BR 4Z2XA 4PRFA 3BO3A 2DH9A 2MKCA 2N3LA 3CC4S 3PIPQ 2CPDA 1M5PC 1BY9A 3MDFA 4WFBQ 1U2FA 3TYTA 4OZ1A 3UE2A 2QFJA 2L41A 2XS5A 3NMRA 1UAWA 2DNOA 1VC5A 2KU7A 2MKSA 3U1MA 2MPUA 3CMES 5BJRA 5H1SV 2XS2A 1FO1A 4A8XA 3CD6S 3CUNA 2FY1A 3MI7X 2KN4A 1SXLA 2RVJA 3V4MA 3MD1A 1SJRA 2KRBA 3UWTA 5LJ5Y 3VAHA 1U1QA 3B4DA 2MYFA 2M2BA 1X4CA 2DNLA 2YKAA 2CPZA 4WCEQ 1X4BA 3CCMS 1B7FA 1N88A 2KVIA 2KXHA 2CPJA 5JVHQ 1YJWS 3IRWP 2GHPA 2SXLA 1IQTA 1NJIT 2B0GA 3Q2TC 2OSRA 4CH1A 5GVQA 2XNRA 2O3DA 3N9UC 4WF9Q 5D77A 5IM0B 3MOJB 2CPIA 2YH1A 1WI8A 4IOCQ 1K8AT 3CCVS 2E44A 4F26A 2KM8B 1M5VC 1VBZA 2ZJRQ 2MZRA 1F9FA 2ZJQQ 1Q7YT 1WG5A 4FXWA 2CQ2A 2CQ4A 3G8SA 4Y00A 3HHNB 2DNKA 1VQ4S 3UD4P 4Y0FA 2ZJPQ 4P6QA 2OSQA 3EGNA 4WKRA 2DNZA 3R1HA 2LCWA 5GAGU 1OO0B 2D9OA 3H2UB 1K73T 2VOPA 4TU9A 2LXIA 2U1AA 3CCUS 2ADBA 1FHTA 2DHXA 4J5OA 2LEBA 1FNXH 1VQ5S 1L3KA 2AYEA 1FXLA 2RRBA 4FXVA 1QM9A 1WF0A 3DLLQ 2CPXA 2G0CA 3UD3P 4LJMA 1DHMA 2J76E 5DDOC 3CCLS 2DIUA 3CTRA 1YIJS 2CQDA 1HA1A 1YWXA 2DNMA 2CQIA 4QQBA 1Q81T 5GAEU 2DH8A 1FT8A 4CIOA 2BZ2A 2LKZA 3P6YC 1U1PA 3G71S 1X0FA 1S72S 2F9JA 2F3JA 1U1LA 1YTYA 1H2VZ 2VOOA 2DH7A 3G96A 3BS9A 1WTBA 3FEYB 5DDRC 2DHGA 2JWNA 2MY7A 5CA5A 4TU7A 2KHCA 1AUDA 1VQPS 1VQNS 1A7GE 1YJ9S 1N54B 1X4AA 4M5DB 3NS5A 2MZQA 2U2FA 5ITHA 5LSOA 1VQ7S 1KOHA 2LMIA 3G6ES 1VQKS 2MKHA 3JB9k 2KT5A 3P49B 1VQ8S 2RU3A 5LXRA 4F02A 2RS2A 2HGNA 3TO8A 1DZ5A 1H2TZ 3NNCA 4UY8T 1JJHA 1VC6A 2AD9A 1CVJA 2MZ1A 3R1LA 2M8HA 2MZSA 4RU2A 2NZ4A 3B4MA 4YUDA 5GMKa 4WIIA 2MQPA 4LIRA 2QEXS 1ZH5A 2M0GB 2EVZA 3U1LA 2CJKA 1HL6A 2KH9A 3MUVP 2DGWA 2DGTA 3LQVA 3THTA 2X1BA 5CXTA 2L9WA 5DM7Q 2MGZA 2EK6A 1OWXA 1URNA 2KYXA 2DO0A 1YITS 5MLCV 2MQOA 4PR6A 1Q82T 3UCGA 4C0OC 3VAMA 1JJ2R 1ZZFA 1U6BA 2M4MA 1DRZA 4C4WA 3FEXB 5IFMA 2KG1A 1R8PA 1WI6A 2M9KA 2RQ4A 3CCQS 4YB1P 3CCES 2UP1A 5IQQA 2RNEA 1X5SA 1M90T 3P5TL 2N3OA 2KFYA 2DNNA 2MSSA 4IOAQ 2CQ3A 2MZJA 4EGLA 1JMTA 3J7ZT 2DISA 1X4DA 1X4HA 2PE8A 2OJ3A 1VBXA 5D78A 4PKDB 2G4BA 1RK8A 4IO9Q 2LEAA 1M5OC 4UQTA 2DK2A 2MB0B 1U1OA 3SDEA 2CQGA 2KXNB 1WHWA 2D3OR 2LYVA 2RT3A 5LJ3Y 4OZ0A 1YI2S 2OTJS 2HYIB 2MHNA 2XNQA 1WELA 2MKJA 3DXBA 3I56S 2MY8A 3RW7A 2KI2A 3OW2R 1A9NB 2ERRA 2MGZB 1WEYA 1G2EA 2RS8A 1FJCA 2FPHX 3MD3A 3ZZYA 2MMYA 1M1KT 3MUMP 3VAFA 4WFNQ 2ADCA 1KOOA 2G1DA 3D2WA 2DGUA 3UCZP 2DNGA 2HVZA 2CQPA 2E5JA 3CMAS 1HD1A 3CC7S 3Q2SC 4CH0S 4IUFA 2HGLA 4WFAQ 1X5TA 1U1NA 2DNQA 3S6EA 5DDQC 3I55S 2E5GA 1U6FA 3G9CA 3G8TA 2L08A 3US5A 1D9AA 2D9PA 2MSTA 2YTCA 5LXYA 3VAGA 3VF0B 2LA4A 2MKKA 3CF5Q 1M5KC 2HZCA 1H2UX 1VC0A 2MZTA 3EX7B 3VAJA 2MQLA 2MQQA 3S01A 4ZKAA 1PGZA 5DM6Q 5GADU 3ULHA 2E5HA 1WHVA 2K3KA 1N52B 2J8AA 2DHAA 2CQBA 1N8RT 2DNYA 3BEGB 1NU4A 2A3JA 2DGSA 3MUTP 2J0QD 1VQ6S 1HD0A 2DNHA 2CQCA 3HI9A 2JX2A 1UFWA 4CQ1A 2MKIA 2PEHA 1FJ7A 2MQMA 2DGQA 1UP1A 3CCRS 1OPIA 3VALA 1VQ9S 5GAHU 2YH0A 1KD1T 5HL7Q 3RW6A 2LQ5A 1U1RA 1X4GA 2LECA 2FC9A 1H6KX 1U1MA 3VAIA 2CPHA 2VODA 2DIVA 1VQOS 2RQCA 5LSLA 3VAKA 2EK1A 2F9DA 2MJNA 2KM8C 1WF1A 1P27B 2CPYA 2YWKA 4QPTA 5DDPC 2M52A 1KC8T 1QVFR 2MXYA 2I2YA 3S7RA 3NS6A 3CXCR 3NNHA 2V94A 1WF2A 4C7QA 2Q79A 3TP2A 2NLWA 3P3DA 1O0PA 2HGMA 4QU6A 3IWNC 2KG0A 3J7YU 1R8HA 4YOEA 3UCUP 1WG1A 2CPEA 1U1KA 1Q86T 2CQ1A 1QVGR 3NNAA 2KXFA
chains in the Genus database with same CATH superfamily
3NLCA 1NSKL 3GQCA 3PM9A 3PTWA 2XSFA 3GYXB 2IDLA 2VG7A 2M88A 3K59A 2KHDA 4CTAA 4Q2MA 2L9DA 1HWLA 3GV5B 4UZCA 3CDUA 1RYSA 4K4ZA 3GV7B 3GONA 5HMWA 3ZZUA 1KQKA 4L76A 4LVOP 2DD8S 1U2CA 2BM0A 4CO0A 4QR2A 1AROP 4KGMA 1JQGA 1FRJA 1YQHA 1MWZA 4ZHRB 4M94A 4V19X 2JVRA 2D41A 3Q0AA 2M5YA 3PJWA 5KFHA 1E6VB 2GNKA 2E5LF 4UZBA 2MLYA 2RUGA 2BKOA 1JLCA 2DXFA 2NCKL 4IH7A 3MAAB 4PRFA 5F3TA 2Z4PA 2OMOA 2YQ3A 2UUAJ 3O5TB 3MCSA 3TAQA 5C25A 3NS7B 1D1UA 5BJRA 2ZWPA 3HVAA 3V4MA 3BBCA 3TW0A 2BJ1A 4LF7J 4P2FA 5HQLA 2WONA 2KKHA 4R25A 2D74B 1DTTA 3V81A 1MNEA 4C11B 2SXLA 2IJRA 1JWWA 3MEDA 4KC5A 3QLHA 1K8AT 2CNOB 1RHMB 2OUGA 1Q7YT 4OJ3A 3OFGA 2PEBA 1HQ2A 3M1VB 4OHYA 3HT0A 1RJJA 5E41A 2VOPA 5A8WA 1RAEB 2LXIA 3J7YI 2F7VA 1R6VA 4J5OA 5B08A 1MG7A 1FDBA 3V2UC 4M5IA 4IH6A 4MKYA 4U7UD 2DY1A 4P2SA 3EMTA 2DH8A 5CZXA 1C1CA 1D09B 5DLFA 1YJVA 4KJIA 4FYXB 4ZN3A 1DAXA 3EWGA 1A7GE 4B3SJ 2Y1IA 2MZQA 2ZBPA 2C3UA 3DM2A 1I94F 4TVAB 4JI6J 1KOHA 4NXNJ 2GQQA 4F3MA 2RIJA 3IM8A 4J9LA 3CW2C 1AA1B 3VHQA 2QC3A 4WK3A 1NDCA 4WTYA 1UZDA 2KFZA 4E8UA 1PAUB 2PDAA 3PFOA 3ISZA 1VC6A 3GR0A 4DL0C 4WU2A 1NPRA 2YWHA 2EVZA 4HTIA 2XZWA 1TK0A 3THTA 1XK8A 2BA9A 2DVIA 3UD5A 1CS4A 1F0XA 3KJVB 1H7WA 2JNJA 5MLCV 5K8MA 2BR0A 4Q5VA 1RUSA 4XTTA 1FXDA 3KJQB 1KLMB 3CCES 3M32A 4JBCA 4RBTA 4KRWA 1IKYA 3GILA 2R8GA 3J7ZT 4MK8A 3QZ8A 4F2SA 1VCTA 2HVDA 4RO0A 4K4UA 1S1XB 4JUZA 3G82A 1PJ6A 2E1PA 4ATNA 3TZZA 2YNGB 3ZZRA 4DV5J 2A2DA 2V2KA 4P2MA 3UVJA 2XCPA 2VG5B 3DU5A 4WFNQ 1KOOA 5HJXA 3D2WA 1MLAA 2E5JA 3TJAA 1ITPA 3Q2SC 2F4FA 1UFKA 1Y3KA 5ETSA 4ELTA 2OPQA 4DI6A 3H25A 3G8TA 2VA3A 2V9KA 4DUZJ 2KL8A 1CULA 1VC0A 2MZTA 5K14A 3EX7B 1NJWA 3FRYA 1SC3B 2Z2LA 4JV5J 4FKXA 5M2PA 1NU4A 3ITHB 1VQ6S 3HI9A 2FJEB 1UFWA 1NEEA 4DR2F 2V34A 3BV8A 2YVSA 4C3MA 3VALA 2YQ1A 2JFDA 2VF3A 3NP5A 2CADA 4U7CA 3D1HA 3VAIA 2RQCA 2MJNA 5HP1A 3IC1A 3PHTA 4NL5A 3H5XA 2EFPA 1SCJB 4MYTA 1FVQA 4LFBF 4QOTA 4N5SA 1RCOB 1FKPA 2OMLA 3ELHA 3L3CA 3HT3A 1D9FA 3K17A 4J9MA 2AGPA 2VASA 1EP4A 2J5AA 1WDTA 3OL8A 3O44A 3OJSA 3VTIA 4O3QA 2BKNA 3N6NA 3VGSA 1CC8A 2YNFB 4LMZA 1XMQJ 3C16A 2AJ1A 2R42A 4WP9A 1S1WB 1HHQA 2R7TA 2NSBA 4J9KA 2HVIA 4X64J 5IT9U 5E3RA 2HS0A 3CCSS 2X7IA 2XM3A 3AA8A 2CXEA 1QAJA 1QAYA 3D6TB 3G86A 2L9NA 2N3LA 5LMNJ 3KLHB 2V5HG 4UTGA 3EZOA 3HJVA 2CNLB 4FN5A 3J80Y 4OZ1A 3V6KA 4O3RA 3KDNA 2NS1B 5CABA 2KN4A 3B4DA 3Q8PB 3DOMA 4PUOA 2V4QA 3DU6A 5DGBA 4KGKA 4DR3F 1Y5NB 5JVHQ 4PXCA 1PSDA 4IRCA 4EFAC 5IM0B 2HNZA 4JI4J 5KG7A 1T9VA 1IBKJ 5L1KA 2MZRA 3EDRB 3G8SA 4O4GA 4P74A 4P6QA 3OJUA 5JMNA 2QMWA 2DNZA 3MPWA 5GAGU 4DSEA 3NWRA 2WVEA 4ELVA 4ZITA 1T9XA 3PW7A 3ZZOA 3WBZA 2G0CA 4CYUB 4RW6B 5LM7E 3GV8B 2GMLA 1FK9A 1FTCA 5IWAJ 2C2DA 1S1TB 3R5AA 3W3SA 4A8YA 4J37A 2VOOA 1UPMB 3BS9A 2PMHA 1NAQA 4FNIA 4USKA 5I42A 1EKSA 1SKSA 3K2YA 1X4AA 3MM8B 4BC9A 2VFVA 4I6WA 3MMJA 2J6TA 1N34F 4I56A 4I7FB 1HMVB 3SEOA 4ZOSA 4OX7A 1B0PA 2NZ4A 3OTBA 3ZFVA 1MWQA 3E3XA 3U1LA 1W7WA 2MDAA 3OBIA 3QRQA 1P9QC 3UDVA 4DSJA 2UVUA 4YR3A 4LBIA 4YB6A 3M9OB 1ZZFA 3DRSA 1U6BA 1NJZA 1R0CB 3GFZA 4R0EA 1YG0A 2RDIA 4YMEA 4YB1P 4NYZA 1UMJA 4P7TA 1IBLJ 3P5TL 1SC4B 3HPOA 1KVIA 4PG8A 4ZJLA 4DV3F 2ASJA 1JMTA 5J2MB 2Y1RI 2AX0A 2GHVC 2FVSA 2NUHA 3KUGA 4OZ0A 4DG1A 1FFWB 4JV2A 3I5AA 2XI3A 2Z56B 1HQEB 4KV8A 1FFGB 3R5BA 3JQJA 1M1KT 4ITSA 3UDCA 4RW4B 3BN4A 2YKOA 4MKBA 2HBZB 5KT2A 2HVZA 1H73A 3M7VA 5C24B 4CH0S 3RBZA 3M6XA 4AQYF 2IYIA 1BWEA 1NK4A 2L08A 1NXIA 3QZ7A 2QG9B 5C2CA 1X60A 4IG0B 1Q1KA 5AJ3J 3MR2A 2EG2A 1FA0A 1R7IA 1N52B 4QW8A 2AZ3A 1VHFA 2CQBA 2FLOA 3T1HJ 1RT4B 2BE7D 1ZA1B 2WVCA 1N36F 1HPZB 5E5NA 3NAIA 1P27B 2HAFA 1UW9A 4G65A 2VDIA 3CXCR 2BANB 3J7A1 2V94A 1T05A 4L3NA 3IWXA 4ECYA 4WK1A 5DG7A 2UXBF 1BMQB 1TP7A 3HP6A 2XMMA 1FRKA 4NLWA 3LW5C 4Q8FA 2XY5A 2W9CB 3G4SS 1VK8A 3D0GE 2FDNA 1RT3B 1TKDA 1HBMB 2AQ4A 2GJIA 2OELA 4FPIA 1K0TA 2HMIA 2Z2ZA 1Q7LB 4C3KA 4YHHF 1YHQS 4ID5B 3Q8QB 3D1OA 1Y11A 3DLHA 4ZVEA 2IVMA 1R43A 3CCJS 3DMJB 2FLNA 4B9SA 1CBKA 2RRAA 2OPSB 1CJVA 4ZPVR 4U6PA 3FCWA 4R0JA 3CPWR 2HEKA 3V6DA 2MJUA 3PRVA 2F63A 4X2BA 4DBQA 4WP3A 3POTA 3LPYA 5L1IA 5HLFB 3ZZ0A 1W2BR 3EDQB 3V6HA 2ROGA 2C2EA 1HBOA 2P2CB 2XYHB 2EC2A 2JC1A 3KG4A 3OD2A 3MCNA 2XULA 1Q16B 2DNOA 1CC7A 1H7XA 1HYSB 4OLPA 4A8XA 1R0AB 3MD1A 1S0OA 5DLGA 1T95A 4OYIA 1FE0A 5BYSA 2HHHF 2QYCA 3R2DJ 4WYWA 1YJWS 3HZGA 4NLDA 1BLUA 2HAIA 2CZ9A 1GMVA 4HACA 4LRCA 5L9NA 3M8ZA 5EWEA 5HI7A 1Y5LB 3Q22A 1OSCA 2J9DA 2K7KA 3MFIA 2CJYB 3EGNA 1E6YB 1KN6A 3R1HA 2GHWA 2DEIA 2V0NA 3FFIA 4MT1A 2RRBA 4FXVA 5IOLA 1B99A 4KE5A 2OI2A 1LWEB 3PZPA 2DNMA 3P8BB 3OR2B 2BJ8A 4J7CA 1G3OA 1UVKA 3E01A 2COLA 2HNDB 3G96A 4L6V3 3FDSA 1RTHA 1NMEB 1YJ9S 5J2PA 3A12A 1UJ5A 3W8GA 3AJ1A 2VG7B 1FKOB 4LF5J 4CTAB 2RS2A 2IC3B 3D7SB 4KYZA 2WTFA 2EBGA 1NSPA 1XJWB 4ELUA 1VLOA 3SCJE 3R1LA 4USWA 2H3EB 3DOLB 3B4MA 4IR1A 2B9XA 2W2PP 1UFLA 5GADI 2DGTA 4LRBA 4X66F 4U95A 4KHMA 2YQ0A 5DM7Q 2DTJA 2MGZA 2AMCB 2VBYA 5KFQA 1S9FA 2OEKA 3K57A 4KR0B 3PR5B 4GO5X 3NOGA 2KT2A 3WX4A 1CLFA 1T3NA 1PYTA 4C8KA 4PWUA 3BGRA 4UOFA 4ECXA 1X4DA 2RJZA 1VBXA 4C8ZA 2DRAA 4MK9A 3SDEA 4CT9A 2KXNB 4PQUB 1RAJA 1J5OB 5AXKA 3HF5A 2DJWA 2VICA 2VBWA 3UNGC 2ERRA 4NLUA 1DTTB 1NM2A 1LWCB 3NCRA 1TK5A 2QTWA 2GS8A 4GC7A 4NEZA 5HSPA 3J7Z5 2HHUA 2RRNA 3Q86A 2O66A 2OD6A 3IRXA 3HSGA 1FKAF 3M6VA 2YWFA 1NDKA 1J27A 4OJGA 4WFZA 1AT1B 4X4UA 1B64A 5A8WB 2HRUA 1H0HB 4QIGA 2WOMA 2ZZNA 1K1QA 5DM6Q 1AXQA 1T03A 4UF4A 1PIEA 1FRMA 1U45A 4AE5A 5K8PA 1OMSA 3W2WA 1TELA 2CWXA 5G0RA 2I1RA 4DCOB 4DR4J 4NLSA 3VAKA 4ED3A 1HNXJ 4XPCA 2HZVA 1TL1B 5DDPC 5ADZA 2F4VF 2NLWA 1VBKA 2JDJA 2CPEA 4IDKA 1OIAA 4ILLA 2OTLS 4OYBA 2UUCF 1SJFA 4USHA 1IKXB 3THPA 3RBDA 4G3IA 3FBCA 2BOPA 2RD5C 2F65A 1KQSR 4GVLA 3CC2S 1UW4A 1YBUA 3MR3A 2JVOA 2XWYA 4KFBB 2JRSA 3TVYA 3M32B 3AOBA 4CI0B 3DRRB 1IKYB 3M2UA 2ZH1A 3TEHB 4DR2J 3A3OB 2DO4A 4F4AA 2CJQA 4M5KA 1HBNA 1K47A 3LGNA 3W5ZA 1RT5A 2HK2A 1SJQA 4ES2A 2KDOA 3G82B 2WBRA 1TL4A 4QWDA 1IBMF 4EBCA 2EPIA 3HVWA 1RBAA 4FBUA 3PY8A 2FYXA 1EQMA 1TMMA 3UO0A 1U48A 4WFBQ 4ZVFA 2VIHA 4DL4A 4ZVHA 4ZCLA 4K5SA 3TA1A 5SUHA 4C8LA 1S48A 3LGMA 3QIDA 4PZVA 3TA0A 3U1MA 4Z7CA 2HRTA 2RF2B 1RHJB 3IN5A 3QWPA 2KRBA 5HK4A 3JYTB 1N6QB 6FDRA 2MYFA 1XTZA 2Y3YA 3TUZC 2YKAA 1KEKA 3A1YG 1NJIT 3CE8A 5KFUA 2ZITA 2JHEA 3AOAA 5J2QB 4Y34A 5L38A 2IRUA 3O2IA 1RHUB 1S0VA 1RISA 2CQ4A 4I2PB 2EG1A 2NPFA 3MHYA 4J91A 2GMHA 4RBUA 4PABA 3JS9A 2VD3A 2ZC3A 4QPXA 4JI0J 1HR0F 3T6JA 4DQPA 1U26A 3DN9A 5HP1B 3KOAA 2J76E 2IHR1 1RABB 1R31A 2BQ3A 5D0RA 1YIJS 4LFCF 2CQIA 4QQBA 4MH8A 4G1QA 1RWOB 4CIOA 3ZNJ1 5KFTA 2QL9B 1LKZA 2JFKA 4DFMA 3FEYB 1TTHB 3RAQA 1MMDA 2KHCA 3SCKE 1EP4B 1GNKA 1PBAA 3P5BP 3WIVA 4ZDNA 3MM9A 4DL6A 2Y0SD 3JSMA 5IT4A 4NI2B 2UU9J 4LSLA 2DRBA 3TJ8A 3ENAA 2UUBF 2AZ1A 3NNCA 4HI2A 2HG4A 2ZOGA 4EBEA 2AD9A 1N5SA 2HBRB 3OFHA 2R2TA 3T5JA 4ECQA 4WIIA 2ZOFA 4LIRA 1HL6A 2FGOA 2L9WA 3GG0A 1F3FA 3MZIA 4O0IA 2OPPB 5KFGA 1LW2A 3CIZA 1RSCA 1RWVB 2E66A 2ZHAA 1YITS 1VRUB 2MQOA 5CYQA 4A4JA 2L3MA 3VAMA 4TN2A 4LREA 4G1PA 4MIBA 4ES3A 3DLGB 1JLQA 1FJGF 1Z4UA 4RZRA 1X5SA 4IFVA 2N3OA 4B02A 3JSYA 3OVAA 1WNEA 1I6JA 5F41A 4BWMA 1UETA 1HARA 3GFXA 4K4TA 1NK8A 2VPYB 5FDLA 3ZTPA 4I6YA 5JUMA 1VS3A 2OTJS 3DOMB 8ATCB 4KO0B 3DKDA 4PG7A 4E98A 4J9VA 2Q66A 2V2ZA 4M5NA 4QIWD 2XMWA 2J9DE 5D0EA 3FCVA 3CJ4A 1RAHB 4QCLA 1IKVB 3CC7S 1X5TA 2VQFJ 4O4GB 4IFYA 1U6FA 2YNIA 2P9GA 4QIFA 3RR8A 3CD0A 1MWYA 3NGKA 4F4XA 5KTQA 4LF6F 1KQGB 1S6QA 3H42A 2HFNA 2ATCB 2I9SA 5ETNA 1WHVA 2C2OB 2J8AA 5J1PA 2ASYA 1NSAA 4K50A 1YLXA 4X4OA 3GE9A 1GT8A 4DV1F 5I42B 1AYEA 2DIVA 2AEMA 5LMUF 2EK1A 2JEJA 5IT0A 1WF1A 2LXFA 3IG1B 3PACA 4DN9A 4I2QB 3MR6A 2Q79A 3TP2A 5D3GA 4L72B 3HVTA 2EKYA 4HLBA 4BCAA 2V68A 4YOEA 3OXFA 5E3AA 1ULRA 2IYGA 2G2ZA 3SI8A 1JJ4A 3RUBL 4PYDA 2QFIA 4WZQA 2ZZTA 4X62F 2CVEA 3VZHA 3PEHA 3PIOQ 4AQYJ 4JI3F 2VHGA 3DGVA 4JYAF 5IQ6A 3D28A 4NLRA 3N0VA 1HQUB 5H9EJ 2HK3A 2X1FA 4QU7A 3PXGa 4K59A 4RNOA 2P8IA 3E8OA 5AXNA 3PX6A 2BQUA 1FCAA 2X1GA 2V8GA 4M63A 1GQEA 5F8MA 1LFPA 3SXLA 2UXDF 3OL7A 1JNRB 3QNWB 1K9MT 4LSNA 5L39A 5A76A 5DETA 2K1RA 4OHXA 3CULA 3UW1A 4QWEA 2FD2A 1FRIA 3MXHP 1FEHA 2CIMA 2FGCA 3OTEA 3DOKA 3OTOF 3MMCA 2M8DB 4LFAF 2GGPB 4LR7A 4ILRA 3M4XA 4O3OA 3NRBA 5J1EA 4Z2XA 4KV8B 4OZNA 4M95A 4USIA 2UXBJ 4JI7F 3EICA 2QFJA 1RA6A 2GIRA 2R8JA 2KU7A 2IPOB 2MKSA 2CFXA 1UJ6A 3RAXA 1FF2A 2C3MA 3CVKA 4F4YA 1UTAA 2Y0BB 1VK3A 1LV5A 1X4CA 4F0MA 3J81Y 2RDJA 1JJCB 1C0TA 1HLWA 3HDSA 1V6HA 2VQEF 1DQ9A 1IQTA 2B0GA 1VOMA 3GIKA 3RR7A 2YKMA 5CAAA 5ETLA 2QLWA 2IA6A 1DQAA 2QSWA 4JV0A 3PYGA 4FXWA 4ZPWR 3DDIA 1RA7A 3CDWA 2BXJA 2LCWA 3L95X 2GQCA 3H2UB 4KT0C 4TU9A 2NR0A 3CCUS 1V5IB 3SV4A 1VIXA 1D0EA 2VU5A 3UD3P 1NLKL 1TKZA 2AF6A 1RYRA 3M8PA 2KYZA 2HQCA 1QY7A 1RXOB 4LQ9A 4H4KA 3NCQA 4MYUA 1JLBB 3JSRA 1N5YA 4RJVA 3NAHA 3C14A 2YY3A 2IRYA 3LAKA 1N5TA 2YNHB 4WXWA 1H74A 2YKQA 2BW2A 1EZZB 2EI5A 4DUTA 4ZK7M 2CNNB 5I3PA 1JJHA 4OV1A 2M8HA 1VJWA 1UKUA 2APOA 1RDRA 4ZCMA 2AIRB 3T6BA 3RBEA 2DGWA 2GMJA 1DARA 1FESA 5HAOA 1XR5A 2HVEA 2RKIA 1OWXA 1URNA 1CJKB 3W64A 3V6DB 1YRTA 1NKEA 1YKWA 1CJUA 3POTB 4DN0A 2M9KA 2B4OA 2HFZA 5IQQA 2UUAF 1M90T 3BDPA 1HBOB 3FNNA 2MZJA 4PKDB 2OHDA 2LEAA 3I82A 4DFJA 2DK2A 3NGSA 1UZHA 3LF0A 3DDKA 4P73A 5LJ3Y 3HHKA 4RW9A 3M8QB 3MOZA 4LF7F 4ZIVA 4Y6IA 1PCAA 5LL6d 3TUPA 2K2PA 3OLAA 1NK6A 1UJ4A 2WSFC 3K58A 2RS8A 1FJCA 4BDPA 1LK5A 4UOCA 4QWAA 5F3ZA 1XMOJ 2FJDB 3IGVA 5FLXU 1HHTP 3IAS9 2ZNYA 2XWXA 2R4FA 4M5GA 4O23A 1YGYA 2DR7A 2ZH4A 1U8SA 3R3TA 3W2VA 2D3ZA 2Z30B 1QDUB 2BE2A 4CO3A 1QTNB 1YJRA 1V3ZA 5B0DA 4FF2A 3C3LA 4IO1A 2G0JA 3ENQA 3EUNA 3KXDA 9ATCB 4OYMA 2H5EA 4NLXA 2A3JA 4FVMA 4MMOA 4XIUA 2JX2A 2AJQA 2C2NA 2MKIA 3E01B 3H8YA 1PYOB 4ES1A 5GAHU 3RRGA 3PYDA 2CWKA 2BW7A 4B3SF 3LP1A 2LEPA 2ZE2B 3GB0A 4KKOA 2CPYA 2GAHC 3BQ0A 4GC6A 4NXNF 3V6JA 4N77A 3A13A 3KFWX 1YZ6A 4IKAA 3E51A 1R8HA 2LFVA 3NNAA 4OX6A 3BQ2A 3OHBA 1X5OA 1TFYA 3P96A 5KG0A 3L9ZA 2DGVA 5I3QA 2XB2D 4QR1A 4WFYA 2W8LA 3DRXA 2WRMA 3PJXA 3DI6A 5RUBA 4FP9A 4ANEA 3KK2A 1VQLS 2J6UA 2R7QA 3GSDA 3OL6A 3CSKA 1NNDA 2IM2A 1WD6A 2AYMA 1P1TA 3MR7A 4RNMA 5B7WA 1OYDA 5CD4A 2WW4A 3DRPB 1WACA 3TQ1A 5HMYA 5EHHA 2GVZA 2GO9A 3SDEB 2CJ9A 1P8GA 3BO2A 1HNVA 4H4MB 3HSZA 3PKMA 1SVDA 4DV5F 4DPUA 3PIPQ 1FD2A 1MMLA 5I3UB 5KT3A 3TYTA 4NX9A 3FMBA 2WVBA 2UUCJ 3CMES 2BUNA 3IRXB 2QT7A 2WVDA 5AT1B 1OSDA 2J7KA 1T9UA 4ZPCA 1U09A 4NLOA 1KS2A 1X4BA 2W1BA 4DUZF 1N88A 5ETMA 2DHHA 3IRWP 2AJ2A 3LPEA 3PYFA 3G87A 2AW0A 5A8KA 3MOJB 2YH1A 4P2XA 3UI3A 4JI5J 3TUIC 1VRTA 1TVRA 3W2WB 4ZPTR 4CLKA 3PRBA 4KHRA 4KGZB 1OO0B 5EWFA 3H4BA 4OQJA 1TAQA 1U02A 3MTJA 3H98A 2DCLA 1C4CA 3LAMA 1IBMJ 3CCWA 4DR6J 2BOAA 5DDOC 5KFVA 2DIUA 4C8NA 4EI2A 1Q81T 1TUGB 1FT8A 2BZ2A 4DZ6A 4CNYA 1RADB 4RUCA 2FJAB 2DH7A 1TUVA 4URSA 4ECUA 3TEGA 2VL1A 3BSNA 4DS5A 3AJDA 4YEAA 3IGNA 2HW3A 2ZH6A 3OFEA 3ET6A 5ITHA 2HFUA 3OV7A 3G6YA 3QT5A 5F8NA 2LMIA 1VQ8S 1YX2A 2DPIA 3TX0A 2V8HA 1H2TZ 3ILJA 3MEGB 1S5ZA 1SH2A 1KVKA 2QA1A 1NB7A 2HS4A 4B08A 5KFXA 2MZSA 1SKWA 3M2UB 2CJKA 4QYZJ 1TAUA 4FKYA 2HWTA 1XMQF 3QO9B 3R6GB 2ZHBA 2UUTA 3AHPA 1PYSB 4ZMMA 2H65B 1YVFA 4MTPA 3I32A 2HSEB 2PFDA 3FEXB 4LFCJ 2OPRB 2UP1A 5M2RA 5LMNF 1S6OA 4ZA1A 4TY9A 5E7OB 4DQRA 3T41A 5H9EK 4P75A 3AB2B 1HWJA 3CJTA 1IVZA 2C1EB 4AYBD 3V4IA 3QFWA 1HWKA 3C2PA 2I6WA 2B9YA 3GWCA 5C42A 4UOHA 4K7QA 4AFFA 2HQGA 3GFHA 1G2EA 2UUBJ 4LT6A 1HW9A 3K89A 3MUMP 3KHGA 4DSFA 2PT0A 1ACMB 4NXMJ 1MN9A 1VFJA 4JI4F 4F67A 1IBKF 3E2EA 3CMAS 3KNGA 4Q2LA 3N6LA 1SL1A 3I6PA 3PKYA 4USVA 4ZIWA 2DNQA 3EGWB 2EXUA 2FY8A 4NRTA 2W7OA 3G9CA 3GJSB 3OSNA 4OI3A 3VAGA 1T9WA 1YJ7A 2MKKA 2JSXA 5D6GA 3OXLA 4IOBA 1LW0A 1SB6A 1QSYA 5B0CA 1WC3A 3W63A 2BABA 1L3TA 3PW0A 4G1QB 3J80U 5H9FJ 2ZH3A 2CG8A 5IWAF 3R5JB 3MAQA 1Q53A 2ZM6J 2O01C 1NH7A 2CG4A 1RHRB 1U1RA 4PWWA 2W4PA 1U1MA 3KHLA 2VODA 4QPTA 2GX8A 2HWIA 3IBCB 4ZVQB 3CJKB 2VB6A 3HHLC 1IR0A 3J7YU 1WDDA 2CQ1A 2KXFA 2ZC4A 5IC6B 2DNPA 4ZCKA 2CQ0A 3A8IA 2DY9A 2HHPA 4B9LA 3UPFA 2H5IB 3DLEA 2LLZA 4M5DA 4FYDA 5KFWA 2R7VA 5HROA 2IJFA 1Z2LA 1B3TA 4F25A 1LW2B 2X1AA 4ED8A 1TL3A 1FE4A 1RT2A 3QT6A 4WIQA 4PAAA 1SIWB 2V69A 3TAMB 2DHSA 1RT6B 3T1AA 2G1HA 1IBLF 3BR8A 4P9SA 3DC2A 3K0JA 2K8GA 1X9WA 3HSJA 2XLJA 3BM7A 1S4FA 1ZZNA 5FDLB 5LMUJ 1DBDA 2J0SD 4PG4A 2AJ0A 2J8SA 3WHIA 4ZJOA 2OEMA 1R0BG 1DY3A 4CO4A 4LR9A 1RAGB 4LF9F 3MWBA 4FS2A 1KNZA 3HFVA 4FXDA 4CO5A 2MPUA 1RAOA 4OYAA 4X62J 1FO1A 3GLJA 2J7UA 4UT4A 1IQZA 4DR1J 2LQBA 4X4TA 4X4NA 1N48A 2IJNA 4WCEQ 4ANDA 5KFPA 1RZMA 3U7JA 2GHPA 5DQGA 5ETQA 2XNRA 3H5YA 4CDIA 1EHWA 1S6QB 1JXLA 1WI8A 2UXDJ 1R3NA 3PYEA 4F26A 3CDAA 3K5LA 2AHOB 1FRHA 5KFSA 2OGUA 2BE9B 3BGUA 4ECSA 3QQCD 3T1HF 5DO2A 3GMGA 2ROEA 4K4XA 1FHTA 2J9CA 1RGVA 1W26A 1LWFA 3PX0A 4HDGA 4X4RA 1DHMA 2P6SA 5D3GB 1GMWA 2V6AA 2W2NP 3NBPA 3HVTB 4A46A 3NGTA 1N0UA 4DLGA 1U1PA 3G71S 1YTYA 2KO1A 2FUG9 2AEJA 3IMQJ 4CO1A 5HN0A 5K9FA 5DDRC 1RWXB 4CM0A 3X1LB 1FDDA 4DSIA 4Y65A 4PYAA 4NOHA 3AD7C 3FZBA 2VQEJ 4DMZA 3LO3A 3EYZA 2Q6BA 1N33J 1BC6A 2VPZB 4I67A 1SPBP 4O3PA 4CM2A 2ZVIA 3ZNUA 2IAJA 3BB5A 2M0GB 2KH9A 3MUVP 4J9SA 4TNOA 4NPOA 3GR1A 4ED1A 3FZ2A 4NEYA 1RTJB 3Q8RB 3DOKB 1PKUA 1FERA 1IR1A 4Q8EA 2XMTA 4TY8B 4PR6A 3CDEA 3HHLD 4C48A 1H98A 5C7PA 3MFHA 3OR1B 4PWDA 5J1EB 2DXEA 2GJ2A 4ZPBA 2FZCB 2F8MA 4IG3A 3SQGB 2MSSA 1FXRA 3OUYA 4LF8F 4V19J 3QATA 4E2FB 4LRFA 1Q0NA 5G4DA 2EFGA 1GXUA 2FB0A 3JTNA 3W8PA 3TR5A 1S76D 2CA9A 3QBCA 2JEGA 1WEYA 3PW5A 1OS5A 2ILZA 3A8EA 1S1UB 4A8KA 2ZBQA 4LSZB 3RG6A 5FLXY 3PFEA 4K2JA 3MM5A 2KFNA 3CCZA 4ZLNA 3DGPA 4PXBA 5E3PA 1QD1A 1IWAA 2RUSA 4M5MA 5HANA 4F50A 2LU2A 1FTRA 4K0KF 3BJYA 4CCHA 4TQRA 1ZOTA 3KJNB 1Q4RA 4ZVOB 2VG6A 3H40A 1TKZB 3MPUB 1H38A 2J0QD 1KP6A 4KQZA 1UP1A 1QAXA 1N5YB 3C14B 4NMXA 1CPZA 1M5HA 2FJXA 2XHCA 2M52A 2ZBIA 4MAKA 2I2YA 4LF5F 3M8SA 4TXSA 2W9BB 3Q8YA 3UCUP 1U1KA 2XMJA 3C46A 1HNIB 3FUYA 2CQHA 1E6VA 1S49A 3L7UA 5AE3A 3ENVA 2WW8A 5KG3A 4DPOA 3BO4A 2H9ZA 4KBIA 3GJRB 1FNMA 3ZXWA 5KFFA 2FC8A 1RKJA 2OLWA 1CJUB 3HM9A 1KFSA 3H5SA 5CYJA 4A47A 1BWVA 3CJ0A 2XS7A 3AJ2A 4C0HA 1DFDA 2MLZA 2H4YB 2BYCA 5IC4B 2A10A 2B7CB 5D0HA 2DT9A 1LQ9A 4NE9C 4ZP8A 3BH7B 4C11A 1EETB 2JH3A 3VZIA 4RW9B 4NLGA 2PA8D 1QJHA 2EFOA 3OT9A 3KLIB 2W25A 4X4QA 4QYZK 5A8RA 1ZPVA 2JEIA 2HS3A 1MU2A 3CD5A 2CPDA 1M5PC 2HHVA 1VQSA 5B0FA 3UE2A 2J9EA 3QYYA 1BQXA 1BXNA 3TZXA 4DCJB 2Q43A 3PO5A 3ILIA 3UN2A 2CKWA 3RB6A 2W7AA 1SJRA 5A6PA 1QUVA 2FJBB 5L46A 4IR9A 2ZD1A 3TARA 3IAM9 3F73A 2CPZA 1WORA 2WK4A 3LWLA 2CPJA 3FBBA 1SV5B 2QA2A 5D77A 2KB2A 4ZVGA 5A2QU 2A6MA 4ZPDA 2ZJRQ 1DLOA 3HHNB 2FVQA 1B4SA 4OI2A 1O5JA 2PI5A 3NY0A 3LWMA 2HFVA 1FRLA 5ETTA 1LOUA 5J1NA 1XERA 4LBHA 1XNRJ 1AUSL 2DHXA 4NYPA 1HBUB 4DR4F 7FDRA 4CWBA 2HVHA 3G8QA 4CLYA 3T3FA 1HNXF 2HQFA 2QL7B 1ZBTA 1HA1A 1Y0HA 2BJ7A 1Q79A 1O8BA 2GAGC 1X0FA 1U1LA 4B9MA 4DU7A 5HQMA 2FJVA 2CJBA 5CA5A 2RU9A 1VQNS 4HL9A 4A48A 4J90A 4HHJA 3EVMA 5F8JA 1JK9B 3TI0A 5H9FK 3MMAB 3PV8A 3W66A 3T1YJ 3LP0B 3N01A 1TKTB 1REVA 3HD1A 3T9ZA 2XO7A 3B6BA 5D0GA 2BV3A 3W65A 3KUEA 5E3CA 3ISNC 2NREA 2FZGB 3KLFA 3DDNA 3HFZB 3U02A 4YS2A 5F8HA 4RW7B 4USTA 4NA3A 2YNGA 2ZKTA 2EK6A 4Q0BA 2IM3A 2HHQA 3R5DA 2LDYA 4C0OC 3I0SB 1VQYA 4ZP6A 1HNVB 1F9HA 2LP4A 2PC6A 4U8VA 1ZM4A 3UDLA 4CH7A 3CCQS 1NZAA 4YDXA 4KGVB 3VGVA 2NSCA 2IVYA 3EXYA 4IOAQ 2JOQA 2HPUA 1CEZA 2PE8A 3R2CJ 1RK8A 3DYAA 4RPFA 4HKQA 2LYVA 1YI2S 3GZ7A 3DHXA 5E33A 4RLEA 3V5RA 3TZWA 3BSCA 4GMKA 3EPGA 4EUVA 5A8KB 1X9MA 2RB7A 6AT1B 1GAOA 2WVFA 1C1BB 1LEOA 5KOXA 4IUFA 1TVRB 1S99A 2LQJA 1YBTA 1LNQA 1U7LA 2AU0A 3LH2S 3N5BA 2HIQA 3AXKA 3US5A 3CJ2A 4WWSA 3MPDA 4JI0F 3CF5Q 1FDNA 2B6AA 2K3IA 1NBEB 4FYYB 1TV6A 3FCHA 3ULHA 2E5HA 1UPPA 3NGRA 5KFLA 4UUWA 1C4AA 2DNHA 3MMBB 2VV5A 1PJ5A 3CMQA 1QUPA 4NCGA 4DR5F 1VQ9S 2BVZA 3MECB 4OMFG 3ZTOA 1KD1T 1AZSB 4F4ZA 1U0SA 3KHRA 4D3GA 5LSLA 3ET6B 3QAUA 3TZYA 2YWKA 5K20B 3LUYA 2QGFB 2IBOA 2UU9F 3D1QA 2YNFA 3FK4A 1JX4A 3WZ0A 1NDLA 3KLEA 4RWWA 2B4VA 1IUJA 1FX2A 4PCQA 3GIRA 1S0NA 3AD8C 1JLAA 5EUHA 3AQOA 5EX0A 1NDPA 4TYAA 2VFTA 2R7SA 1RCXB 1Y7PA 5T7LB 4RUBA 3KLHA 4HHUA 4KIAA 3I0RB 2C28A 2CAJA 1Y4ZB 2C3OA 3BDEA 5AE1A 1NKBA 2RILA 1D3WA 4Y2AA 4NZ7A 3I9V9 3G2XA 3T19A 4CO2A 1RWWB 3EJMA 4NLVA 1S6UA 4B9TA 3I4PA 5F0UA 4HH0A 3QT8A 5IM0A 3C6TB 2HRYA 5MAOA 5C42B 3BKFA 1Q8KA 3UN5A 4FS1A 1KBRA 3ISND 3RRKA 3TANA 2G2OA 3CC4S 1BY9A 3C19A 1L3VA 3WIUA 1SQGA 3CIMA 2L41A 3K5PA 5F9NA 5AXMA 4WXOA 1M0SA 3WC2A 1SXLA 3FJ2A 2VQFF 3U27A 2HHWA 4CYUA 3QGPA 1KHWA 3TA2A 3W9HA 1TK8A 4IRKA 1F60B 1LFWA 3RU0A 4LF1A 2VPWB 3MAHA 2DR8A 3C66A 4MIAA 2R7OA 3TUJC 4OYOA 4DWIA 4RNHA 1WG5A 3MM8A 3BGFA 1SI9A 2C42A 4H4OA 3UD4P 2W4CA 3HHLB 1GXTA 5KAKA 2D9OA 1K73T 5CZVA 3QIPB 5B0EA 5A6WA 1YDLA 3CCTA 4OI0A 3DXSX 8RUCA 4I7FA 2F40A 1HMVA 1O51A 1KTVA 3NWGA 5HVGA 3CTRA 3QGGA 4USJC 4F7VA 3DLKB 1SH0A 3DCAA 4LF9J 1F1BB 1GX5A 4ZVPB 1SJ1A 1NK9A 1PBUA 3DRYA 2JWNA 2VC1A 2H5JB 4MIWA 3DLEB 4M5DB 2XSJA 5D4PA 5HROB 4URQU 4X65J 1K1SA 4A8MP 3HVRA 5E2QA 3I4HX 1RT2B 5J2MA 1HI8A 5KFCA 2VPXB 2WHOA 3BPDA 2GIFA 2QE5A 5F9LA 1VLYA 1ZH5A 1S9GA 1TQLA 3KLGA 2PD1A 4B3TF 2MHEA 1HQEA 2XMUA 4ZP9A 1LXJA 4PPDA 2YWGA 1Y3JA 3CJ5A 1Q82T 3OTCA 3UCGA 3KMSA 5GAHI 1CJTA 2V4JB 3OQ2A 4C4WA 1WC1A 4RW4A 3GPAA 4JB8B 1R8PA 1WI6A 2BACA 1Q5YA 3TNVA 3RB0A 3BSAA 3ZZTA 5K8OA 2WB1D 4X84A 3JQKA 4EGLA 4WKYA 2LDIA 2EKNA 2RE1A 2G4BA 4C0BA 3Q8SB 1RTIA 2KJVA 4IG0A 5KFAA 4EEYA 2XNQA 1OQ3A 1WELA 4IH5A 1J2VA 4EYHB 4U96A 1KKHA 1TMJA 3ZC4A 3VWSA 4ZPAA 3D68A 2IFXA 2ZVSA 4Y28C 2DGUA 5EX3A 4N41A 3W1YC 1RTDB 2HGLA 3R8YA 1J5EJ 3S6EA 3I55S 2E5GA 4DSKA 2AJFE 3BBBA 2ASDA 2BANA 2UXCJ 1F2GA 3K5OA 3VAJA 2MQLA 3K5NA 1TL7B 2JLFA 5CHCB 2V8VA 1ZYQA 1EJ7L 3DLJA 4JI8F 1I51B 3NBPB 2CQCA 1BQMA 4LF8J 3MM7A 2R7XA 1RT3A 2CNKB 1HBMA 2V8PA 3W60A 1FD8A 5KT4A 1TFWA 1D9DA 1T7PA 3EPIA 3R7NB 3J81U 5K5MA 4YY3J 4ID5A 1WF2A 4O0NA 1P9YA 3P3DA 5K8NA 4OYZA 3DMJA 1V3SA 3GSIA 1F6TA 5KFJA 2OPSA 1R8BA 1ZETA 3KWMA 1VRQC 4JI2J 2VJUA 4EO6A 2IAJB 3HSDA 2AT1B 4CLPA 2I5JB 3SMZA 3PW2A 2C2RA 2B5JB 3GIJA 3NXZA 3IM9A 1PAEX 5HLFA 2C2KB 1IBCB 4K0KJ 2GA7A 1FVSA 2D7SA 2N7CA 2E5IA 3ETMA 3CJQA 2GV1A 4LF4J 2AGQA 2KT3A 4B3RJ 1HYSA 1S79A 2YKNB 1QE1B 3SSSA 2ACMA 5KG1A 1R0AA 3IA0A 3R5GA 1ROFA 4IG3B 4NLTA 4TLRA 1VQMS 3OUYB 2H54B 3QFHA 3MEKA 2DITA 4YP3A 3G6XA 2CVIA 3QJLA 2DB1A 4ED2A 2ZH8A 5KFIA 2AJ4A 1YRUA 3LP2A 2V4RA 2HURA 2W01A 3MDFA 3LA0A 3KK3A 1RWMB 4LF2A 4OJ1A 2HBQB 3NMRA 1HWUA 4Y2MA 1XMOF 3Q23A 1ZS6A 1T8EA 3RZAA 3CUNA 3LTOA 1L5UA 3DGPB 3VAHA 3OHAA 3OFFA 4KAIA 4DV4J 1VGYA 1LWEA 3KK1A 1IN0A 1BQNA 4HR2A 2AV5A 4MKVA 2OSRA 2BX6A 2HNDA 1JLCB 4M5LA 2VG6B 1XMBA 5A2QY 2JC0A 1PILA 4M1KA 4Q45A 2B8QA 2CQ2A 1FKOA 3I5BA 3CJRA 1S12A 5C25B 2IC3A 3AOCA 1L3KA 3CGIA 1JLEA 1WF0A 3DLLQ 4DZDA 4EO8A 5DG9A 2WONB 3DOLA 4FF3A 2R2SA 1U0HA 3V81B 5GAEU 3M2VA 3P6YC 1FWPA 3K8VA 3KTQA 5KFMA 1S72S 3MEDB 1IM4A 3QLHB 5KFNA 1R89A 1WTFA 2J0WA 3ADAC 4P71A 3FGVA 3X3UA 2ZKUA 2U2FA 3OPKA 4P52A 2RU3A 1SQEA 2D69A 3HMJG 2R2RA 4XPEA 3A4TA 2ZH2A 3RBXA 2B4PA 2EBEA 2MZ1A 1DTQA 1VISA 3GCXP 4C8OA 4I0WA 1WUUA 3SSRA 1MW7A 2MQPA 4PQUA 2QEXS 1J5OA 2OH2A 1IR2A 1JKHA 3P45B 2X51A 1C1CB 3HJFA 4CT8A 1WC0A 3JTPA 3HULA 2KYXA 2XGPA 1LWCA 1RKIA 1HI0P 1AW0A 2UUWA 1JJ2R 2PMZD 4DV0J 3DM2B 3OLBA 3R97A 1C0UA 1UL3A 2RQ4A 5A8RB 1NJYA 1TU0B 1MU2B 2ZUGA 3UFCX 3N5FA 3FQKA 1B0TA 1NHUA 3DLBA 2CQ3A 2OJ3A 2ZBCA 1YZ7A 3SQOP 4OX9J 4RKUC 4PEOA 2MB0B 1Z1ZA 2EEYA 3D6HB 2JEFA 2ZD1B 3OW2R 3AB4B 1CS4B 3QPIA 1WC4A 4BBYA 2IA0A 3BBFA 2JLEA 4UOGA 3PW4A 3BH6B 2E1MC 3BYPA 1N0VC 3M6WA 4GKKJ 4B9UA 2DNGA 4JI5F 3DNCA 2AP6A 1DLOB 5C2GA 1WKLA 5ETOA 4KH1B 2HFSA 2J7WA 3NKYA 1TL1A 3H7HB 1U2RA 3QJPA 5LXYA 3A8JA 1VR6A 2GZOA 1H2UX 1XR7A 1U47A 3IWLA 3KUHA 2MQQA 2W9AA 4ICLA 2QYGA 4ZKAA 1PGZA 2ZOMA 4QJVA 4DR6F 2JJ4D 1PC4A 2NXEA 3UVJB 1IKXA 4I68A 4L3KA 2DGQA 3GP9A 5KFBA 1UVNA 2RHQB 4USMA 1I5OB 2O1PA 2F5GA 1VQOS 1KTQA 4OYXA 4EK2A 2OPQB 3UDEA 4ANCA 4KFBA 1NK0A 2MXYA 3WQPA 4C7QA 1CULB 3FBFA 3DRRA 1NCLA 2HGMA 1REVB 3C8YA 5K14B 4FDFA 3QGIA 1WHXA 3KLFB 1KQFB 2DNRA 1B0VA 1X4FA 4CNZA 3VVTA 2WB4A 1WEXA 4WE1A 2DEJA 1SJ3P 1XBWA 4ED5A 2FHOB 3H20A 3M30A 3N4WA 2Y1LB 4ZVSB 4Q0BB 1FWKA 3JAMY 1RT1A 3AY0A 4RW8A 2M70A 2BKPA 2NZCA 2IY5B 3RAMA 5KFEA 3S8SA 3KNAA 3TVKA 3O1LA 2RF2A 4ECTA 4ERDA 4IQMA 3H2VE 3JYTA 1N6QA 1U49A 1FKPB 2V50A 4L73A 4USUA 1VBYA 4DR5J 4BS2A 3DYAB 5J2NA 1IXKA 3FVYA 1NK5A 5DS7A 5HBMA 1WSVA 4CLLA 2GO8A 4M5JA 3AXMA 5HVFA 4OHZA 5J2QA 1K0VA 2C3YA 2N82B 4O4RA 2HIYA 2GVDA 4N7TA 2MKCA 2A18A 4GVBA 3OVBA 4I2PA 5F8LA 3BPSP 3I87A 4N47A 4NYOA 1HNZF 5ETPA 1UAWA 2WSCC 4NXMF 1JXEA 2XLKA 1ZPWX 4K8RA 2R7RA 5LOQA 2E1RA 4N76A 2BEFA 1U1QA 3C16B 2POKA 2E9ZA 3WC0A 4BHQA 2DNLA 4U8YA 3IBFB 2ZDPA 1PG5B 2O3DA 3N9UC 3SV3A 4WF9Q 5HATA 2B6AB 4YR0A 3CB4A 1TV6B 2UVRA 4BWJA 3M8RA 5LT5A 2P9EA 1T02A 4DUYJ 2DNKA 3IFEA 3MPYA 4NI2A 5ETKA 2BRLA 4NCGB 3F0NA 2ZM6F 1IM6A 1G6BA 1FNXH 2AYEA 4DL7A 5E3QA 1QM9A 3JTOA 4PUOB 1S6PA 3I5CA 2R7UA 3P4UB 1YWXA 3KLEB 3BGOP 1HNWF 1RHKB 2VBXA 2QO3A 3F44A 2HNZB 1ZA2B 2OPPA 2DR5A 1NJXA 4K4YA 1JLAB 5BR8J 4TU7A 4DPTA 2FHJA 2FLPA 5B0AA 5C5JA 1VRUA 3NS5A 3QGHA 5LSOA 4R5PA 1KVJA 1VQKS 2X3GA 4LQ3A 4AD6A 2KT5A 3DLGA 1RHQB 3TO8A 4C97A 4O44A 1WC6A 2AKWB 3C6UA 4A8SA 2YX1A 1CVJA 2HHSA 3B8HA 3AT1B 5GMKa 4B3MJ 3T5KA 1FK9B 2G2YA 2PFFB 1NHKL 4KO0A 3FMWA 1Q78A 2C3PA 5THWA 4DR7J 1URRA 2EC0A 1SIZA 4ZLLA 2JLGA 4K4WA 2M4MA 1CSJA 1NSQA 3I9ZA 1XNQF 1C2PA 5HJYA 1IKVA 2ZBRA 1TKXA 6FD1A 1APSA 2DISA 1H3DA 3N28A 3ZTRA 4AXIA 4Q44A 4P10A 4F04B 3M2RA 1SQFA 2GJFA 2HYIB 4DR1F 4FPRA 4DPXA 2E7WA 1W25A 4DV7J 2FHMA 4N8OA 1DQ8A 3PJ9A 4UW2A 1BUXA 1F3VA 1S1VA 1V5VA 3IR7B 4DL3A 3VAFA 1WKKA 3BKUA 2G1DA 3DRSB 4RWXA 2VH7A 1HKAA 3UCZP 4LUBA 4H4OB 3SCIE 2Y8WA 2MKYA 4B3TJ 2A2CA 3IG1A 1FI4A 1ZM3A 5KT6A 1CQMA 4I2QA 4DFPA 2LA4A 2XCAA 3IS9A 4NLYA 5AE2A 2OAUA 4DG1B 1HW8A 2NXCA 3RJMB 4J9PA 3B54A 1N4LA 1N32J 2DHAA 3TWZA 3D54A 2YXLA 4LBPA 1EX8A 2ZWOA 2XBPA 4CQ1A 4DS4A 1FJ7A 3QSYB 1OPIA 2LQ5A 1HQUA 1TL5A 1UVJA 2XSJB 1S97A 4A8QA 3GJQB 3MTKA 1QVFR 2ZUAA 1GEHA 1WOOA 2ZDOA 4B3OA 3KDOA 4QIEA 2PGCA 1KFDA 3RYLA 4P72A 1UWBA 3MM6A 4C8YA 2R8HA 4DPWA 1MROA 1N33F 4DFKA 1XIQA 1X5PA 4EZ9A 3L09A 5JVGQ 1X0PA 1S9GB 2GC8A 2GGPA 3L7PA 1OY9A 5D4LA 3KLGB 1HFEL 3GU0A 1KRPA 4YB7A 4P7VA 1Y9OA 2B3TB 4F0HA 4HDHA 4OJHA 4EYIB 1CJTB 1T9YA 3D3CJ 1LK7A 2E9TA 1D8ZA 4NLQA 4AT1B 2MTLA 3RRHA 1WG4A 4JI8J 1YSJA 1RBOB 1T05B 2R8IA 2LQ8A 3KG1A 1SBRA 2UVVA 4TU8A 2AYBA 3CWJA 3TOQA 3UNYA 1RU2A 2DR9A 1U25A 2Z0GA 1RTIB 3ZZZA 5A0YA 2MEWA 2NPIA 4Z7YA 1SJ4P 4QYRA 1XN9A 1F5BA 3HX9A 3B82A 1NO8A 1NKCA 1RWPB 2YX7A 4RBVA 2FHJD 4H4KC 2O5DA 2Z57B 4QW9A 5I4MA 1KHVA 4IYQA 2YKPA 2HMIB 4NZ6A 2B43A 4TKTA 5H1SV 3CD6S 4NASA 5LJ5Y 1EARA 2I0XA 2N4CA 3M9MB 1CJVB 4MJKA 2N4DA 2QLXA 4RU9A 2Y1JA 4DLEA 2PA3A 3HKWA 5GVQA 1B7YB 2VJVA 4Y3CA 1JLBA 2EWHA 3BYRA 1RT7A 4WU3A 4JI1J 3CO9A 1BQMB 2YNHA 3CDBA 3MM7B 4Y00A 2DBBA 4Y0FA 4WKRA 2F1FA 2LEBA 1ZM2A 4OX8A 4ZVTB 1JNZB 3ILOA 4K2XA 2HQDA 2R3VA 1RACB 3F56A 3BGLA 1HIYA 3FSIA 3MPVA 5E0OA 2FLLA 4WTOB 4HACB 2WBMA 2MY7A 4ER8A 3MEEA 4NCBA 1CJKA 1AUDA 1IJEB 2A0FB 4URGA 4JV1A 4KHPJ 1YJTA 3ILLA 3ZZPA 1SC6A 3Q83A 1IJFB 3IR5B 1ZAWA 4HT5A 2HLTA 5AXLA 3FFIB 4J9NA 1JXVA 3VQSA 3W5YA 3CJSA 2FZKB 3HK2A 2QLBB 2DXDA 4DSLA 3SCLE 1S59A 2BJ9A 4S0MA 4AL7A 3CNQP 3M8QA 2X1BA 1VYAA 2NXUA 4OZ5A 2XMKA 2L48A 1RTHB 2W2OP 1JLFA 1RWUA 1ELOA 3HLUA 5IZHA 1S57A 2DO0A 3KKFA 3PNIA 5J2PB 1L3SA 3TJ9A 3EE3A 3M8WA 3LP2B 5IFMA 3PG9A 2BDPA 4A8FA 1XQIA 2HQIA 4DCPB 1UVIA 3GJTB 2RNEA 3KK3B 2XG8A 3RB4A 2W2QP 3MF5A 1X4HA 3GIIA 4Q43A 1Q5VA 4UQTA 2E5LJ 2F8HA 2IBKA 1QSSA 2G13A 1GXLA 2I8EA 2XHWA 1RTZA 2GIQA 3IP0A 3RW7A 1LWXA 2KI2A 1A9NB 3D67A 2MGZB 3KK1B 3EGVA 1VHIA 2WSEC 1BQNB 4OZ2A 5DG8A 4DF4A 3CT9A 1IKWA 5GAGI 4DQSA 2QL5B 2WZ1A 1TUWA 1FFSB 4ED6A 3BGRB 4FZVA 2QIFA 2ZE2A 3R5CA 4I6AA 4NZ0A 2BJDA 3BREA 2BMBA 4WZMA 4RR5A 3SFGA 2CJXB 1XNRF 4G6VB 4DV2F 1JLEB 4GKJF 2K3KA 1U24A 2IVFB 1U0HB 4OZLA 2V2QA 3M2VB 3L4BC 5D4OA 2FJWA 3BN7A 3BSOA 3TAPA 4YB5A 1GH8A 2OKQA 2KM8C 5HMZA 1WKJA 2BBEA 3NNHA 1HI1A 3T1YF 2ASLA 3EZUA 4EBDA 1S9EA 2CDRB 2WOMB 2BRKA 1R8CA 3DRPA 2C2MB 1DTQB 3K7RA 1YK9A 1U8WA 1T03B 4RL1A 4DV6F 1X4EA 2M3DA 3JSBA 2IM1A 3Q8UA 3ZTSA 1RWNB 1JKHB 1I94J 2ABYA 4H4MA 3IXQA 1JB0C 5G0RB 3ENWA 1WHYA 5I3UA 1WC5A 3RTVA 3HCXA 2PN6A 1C0UB 5L8RC 4DQIA 4TQSA 5IV4A 1MMNA 3N6MA 2UZAA 5KOWA 4IDKB 4DDFA 4DU8A 3PCOB 4OFZA 5KFOA 4YQWA 2FVPA 4GO7X 4Y2IA 4LIWA 4PQAA 4DF8A 2KRRA 4CLUA 3VR1A 5EGYA 2W7PA 2HQ3A 2HZAA 1K44A 2HHXA 1WOPA 2DH9A 3FSXA 3QAEA 3Q24A 1Q95G 1D8YA 3GYGA 2VKZG 2JZ5A 1GFWB 2DR6A 1CG2A 4NA2A 1OY6A 2CDQA 3UWTA 2XC9A 2M2BA 3FSYA 1HBNB 2FTRA 1RT5B 4N56A 2KZZA 2KXHA 4OHWA 1NZ8A 4ICLB 4YN3B 4YDDB 1OPZA 3UQSA 4QBUA 2GFFA 4Q7AA 3CCVS 3W9JA 1M5VC 3BQ1A 3B78A 4C3LA 1QSLA 5CCMA 5D15A 2CZVC 4ECZA 1VQ4S 3ICLA 1F5AA 2OSQA 1JLGA 3A8KA 4RNFA 2ADBA 2ATLA 3Q89A 3MEGA 1VMBA 3NMAA 4R8UA 2RHSB 4LJMA 2UVWA 1RE1B 4PXDA 1BE4A 4MFBA 2CZ4A 4U9RA 1HNZJ 2A1BA 1IWGA 3TQEA 3T5HA 2H1YA 3QO9A 4YR2A 3A3PB 2XLIA 1FX4A 4WE1B 1VQPS 1A0OB 4D3HA 3LANA 1T3OA 2HNYA 2D3O1 1VQ7S 3M30B 5IT9Y 2VFRA 1G4CA 5SZTA 2OPRA 1RT1B 5LXRA 4LFBJ 3W9IA 1M1GA 5KFYA 1X9SA 1DZ5A 1R27B 4RW8B 4RX6A 5KG4A 3SSQA 2VC0A 3PR4A 2ZH9A 2QV6A 1L3UA 3IO1A 4CZCA 3VV2B 5F8IA 4AL5A 1EQ0A 1X31C 5J2NB 4I64A 2PMWA 5HBMB 1X8DA 4OI1A 2KJWA 3MM9B 3JSMB 4LSLB 4XO0A 3H0PA 2GVDB 5D4NA 2UV8A 4N8NA 4GVBB 5KG5A 4KGXB 1HNWJ 2E29A 2Y9HA 4F2RA 3FKBA 3BF4A 2AGOA 1U1OA 4I4BA 2KZMA 3QWUA 4B9NA 4OIXA 2P6TA 4ETZA 1RLCL 3FC9A 4XDDA 1NHVA 2FPHX 3MD3A 2MMYA 5CYQB 1UA1A 3M9NB 4OL8A 2MQ8A 3PVXA 4K5RA 4CRJA 5D8HB 5CYMA 1JLQB 3NGUA 4ETXA 3RGIA 2Q3PA 4IFVB 1U1NA 2G9OA 2XI2A 2Z58B 1GTEA 5JJBA 3DFEA 4DR3J 2MLXA 3CJKA 1D9AA 2QA4G 2ZHOA 1I3OB 2RAQA 4V1Ak 2B9WA 4ID8A 2HZCA 3MGJA 3M6UA 4NMLA 2QZ8A 1XNQJ 1NH8A 1S6PB 4ZVUB 3BEGB 3MUTP 1HD0A 5KT7A 3D6FB 3JQMA 2OO4A 3H4DA 4DXLA 4B9VA 1AFIA 3CCRS 4DX8H 2C22A 5HL7Q 2B9EA 1P6TA 1U6ZA 3SFUA 2BM1A 4R5PB 3HKZD 4IFYB 2YNIB 2E7VA 1FEEA 1EB0A 4ECWA 3TAMA 3S7RA 2QMXA 1RWKB 1RT6A 5KFZA 1O0PA 1FRXA 2GW8A 4X65F 5FD1A 4DL2A 4O44B 3IWNC 3O8WA 3C6UB 1QVGR 5EDWA 2KVQE 4EZ6A 4KTQA 4O3SA 1U4BA 4ECRA 2BJEA 3FQLA 4FYWB 3VGUA 5HVHA 3CO0P 5M2UA 5U47A 1WWHA 4DHVA 4B17A 2QA4S 2ILYA 1N34J 3FRZA 4U67Q 1KR4A 3WDOA 5L9XA 4ED7A 2FIUA 5GMEA 1YJNS 4YFUA 1TKXB 4ZN1A 2DGOA 1BGXT 5GAEI 3ZTQA 3EVWA 1PO6A 1FJEB 3M2RB 2R8KA 2R2UA 3EGZA 4CLWA 2RQMA 2W24A 3TX8A 4X4SA 9RUBA 2IMWP 3MURP 1KONA 1NPPA 4J9OA 4C98A 4HT7A 1S1VB 4DV3J 5KG6A 1U2FA 2PI4A 1RAFB 1SUQA 1VC5A 2XS2A 4K4VA 2EW9A 2GQ2A 1Y5IB 3KJFB 4LSNB 3I31A 2K1RB 1J5EF 4OZ3A 4M8LA 3GCWP 4FVCA 1B7FA 4BLGA 2G0IA 3PO4A 5EWGA 2UXCF 3IS9B 3G6VA 3CJ3A 3MMCB 4X4PA 4ENOA 2IDEA 4CH1A 2NQPA 2VBZA 3ETOA 4ZLJA 2B8PA 3PEJA 5KG2A 4CLFA 3W61A 4RNNA 1SL0A 1RP5A 2IM0A 2ZJQQ 4OLOA 4LR8A 1M5SA 4AXJA 2B4UA 2ZJPQ 3AH6A 3M05A 4F36A 2PIIA 2OEJA 3UN3A 1FXLA 3HHEA 1X7VA 3JXOA 3KHHA 3CCLS 1C0TB 4RUAA 2CQDA 4YY3F 4B3OB 1V9OA 1S10A 2EFQA 1UWBB 3MM6B 2YKMB 1MROB 1RTJA 4F3OA 1N36J 4DL5A 4JI2F 4TY8A 1T0TV 1H72C 4DX7A 3ONQA 5IXUA 2XTJP 2HBYB 3BKTA 3RB3A 3OR1A 2ZNZA 3HXMA 3PDNA 3C15A 1NPKA 3SQGA 4BC7A 4UY8T 4I1TA 4LF4F 4CLZA 2ZEJA 2XO6A 4IQXA 4B3RF 1RLDA 3M8PB 4DX5A 2XYPB 3F41A 2XGQA 4K4SA 3DHWC 4DX6A 2VZ9A 4OI6A 2H48B 7FD1A 1ZM9A 4AUKA 4ED4A 2K7JA 5A0YB 1XEZA 1S1UA 3K8WA 2WAQD 1S7HA 4YHHJ 1ZTWA 1FNOA 1N56A 5BXIA 2RH3A 4KPCA 5BYQA 2NYIA 2AWZA 4ZHRA 1SL2A 3QT7A 1CQNA 3U1NA 2IRXA 3HHDA 1RI7A 2YPZA 4ECVA 1WHWA 2D3OR 4DEZA 4FYVB 1EKRA 2MHNA 3I56S 1PC5A 2YPYA 3MAAA 2V67A 4DV4F 1RU1A 2RKIB 5IV3A 1TZ0A 3BZQA 5DGAA 3N79A 2RSQA 5CH7B 3HFKA 2ADCA 2V8DA 4CLTA 3EVOA 1YRXA 1RAIB 4LVNP 1RT7B 3J81j 1EAYC 2YBVA 2BJ3A 1S4EA 5DQHA 1OQ6A 2R9LA 2HHHJ 4XK8C 4ZLPA 2D9PA 5HQ8A 1DURA 1GMWD 2NUUG 4F0KA 2W9BA 1M5KC 2NXNA 2H51B 4HEA9 1PJ7A 1HNIA 3THVA 4F3QA 3GG1A 3W62A 2FHKA 2HWHA 4NRUA 2PEHA 3BR9A 2XY7A 3M1VA 3D0IE 3MEEB 4EWTA 1X4GA 2FC9A 2W2MP 1DJ0A 4ILMA 3W2VB 4J9QA 2BE2B 4ZP7A 3NS6A 4HYKA 2DRDA 1O6XA 2DKOB 2EFNA 5T41A 1UEVA 4DOZA 1KWMA 2LQ9A 1HHSA 2QRRA 1EETA 1WEZA 2Z8QA 3H59A 2J6SA 2VUGA 3KLIA 4OI4A 3SIPB 3CD7A 1JLFB 3OSPA 1T9TA 1KDNA 2QMUB 3EXCX 2AYGA 4DV2J 5KFRA 4GKJJ 4W92B 3LP1B 1R8AA 4DV0F 4KKOB 2IMOA 1XR6A 2OD4A 2XEXA 4X66J 2MQNA 2A6OA 3OVSA 2LA6A 4J9RA 3NOCA 1MN7A 2YWEA 4OX9F 1UWAA 3KJVA 1SV5A 5L1LA 5EN1A 4FNHA 4KSEB 3GIMA 4E0DA 1RQ0A 2DGXA 3KMQA 5HO4A 1KLMA 1UVLA 4TLQA 3M8YA 1VIOA 3OTDA 2W8KA 5GMDA 2V9WA 2ALYB 3SBMA 3AD9C 3DI6B 3TRGA 1S7IA 3SYZA 1IKWB 1I1GA 3I96A 2XS5A 4L74A 3KK2B 1N5VA 4DV6J 4GKKF 2B7BB 2LVWA 5B09A 1OJ4A 2B51A 1GMUA 1S1XA 3MI7X 2FY1A 1HBUA 2KTQA 4JI6F 3CCMS 2FVCA 1F2HA 2GVZB 2KVIA 1G7CB 4QZVB 1ZAXA 4WBFA 1MSWD 2VG5A 2CPIA 3PX4A 4FF1A 4XDCA 4UQGA 2E44A 2KM8B 4ZCIA 1Q8LA 2FVRA 2VA2A 4M5HA 3MMAA 3O3LA 3LP0A 2U1AA 1TKTA 1AB8A 1VQ5S 3AODA 4KPYA 1FWLA 2CPXA 2DYAA 4W98A 3D66A 3VVUA 1BD6A 4QWCA 2X3DA 3ITHA 1S9EB 1YJUA 4RW7A 5FIIA 2F3JA 4OHVA 1H2VZ 1WTBA 2DHGA 2IIHA 1Y00A 1ZAVA 1N54B 5DJBA 1VRTB 3I0SA 3NEKA 3QRPA 4ZVRB 2F4VJ 2D3UA 3G6ES 2Z2YB 3PRDA 2MKHA 2ZZMA 1LXNA 3K5MA 1OY8A 2HGNA 2RDDA 4OYPA 1XC9A 1WSRA 4FBTA 4EU0A 1RAAB 4LRAA 1F5CA 4EMDA 1G1XA 2OP5A 2WCXA 2E7XA 3AA9A 4OZJA 4YUDA 4WJBA 3KLVA 3D4JA 1QLNA 4G1IA 3LQVA 3OXGA 3A3NB 4A8WA 7AT1B 2XY6A 1UEUA 2JL9A 4FF4A 4C6AA 1UEKA 2XYGB 4JV5F 2QX0A 1GTHA 1GX6A 1C1BA 2N7YA 3D6MB 1VDHA 2KFYA 5KFKA 3PHEA 4Z37A 4L75A 5D78A 1RBLA 4NWBA 4CP5A 1S1WA 3HO1A 2CYYA 3IBWA 3O6QA 3AFGA 1W2IA 2Q1LA 4PG5A 1ZTTA 4NCAA 3IR6B 2MY8A 5CQGA 3JAMU 3LGHA 2XMAA 5CCLA 1YBAA 2YX4A 1R6YA 3MMBA 3ZZYA 3H2LA 2ZH5A 3W5XA 1P1LA 4MK7A 2OFGX 3MECA 2CQPA 1AZSA 4WYLA 1JIHA 4WFAQ 2PSZA 4F4WA 3LOUA 4X4VA 5DZ6A 4DUYF 3W7BA 1UA0A 1JLGB 3GTYX 1T94A 1OYEA 3UR0A 2Z2MA 4HTJA 5F0WA 4ED0A 2EFVA 3S01A 3V4IB 4R8UB 2P9CA 1Q8BA 5GADU 3Q8VA 2DNYA 4MFBB 2E1CA 2XMVA 2QLJB 1NK7A 1Z2ZA 2HKEA 2QN6B 4Y2KA 2MQMA 3WX8A 5T7LA 3EZ5A 4DPYA 3R6LB 4ALZA 3LALA 1HR0J 2YH0A 5BR8F 2P5VA 3I0RA 1H6KX 4X64F 2HNYB 2F9DA 2XZDB 4JOUA 4XAKA 1KC8T 4RW6A 3MR5A 5HMXA 3ZO7A 2ROPA 1S1TA 1VJQA 2HLUA 4QIVA 2KG0A 3T5LA 1LW0B 3VGTA 3D5MA 2QLFB 4HH1A 4HVZA 3MCMA 5FJ4A 1EIYB 4B3MF 5F8GA 2F8EX 3C6TA 2CPFA 5KFDA 1M1HA 2UV8G 2I38A 4DR7F 1WJ9A 4RUHA 2VONA 3AAWB 3KG0A 4W90B 2OIHA 4U7UK 2R7WA 5ETRA 3NCPA 1A6LA 4H54A 1GK8A 2LXUA 5KT5A 2M7SA 3R7BB 4OV6A 1ICEB 4F8RA 1NRKA 4DV7F 3R27A 4WFXA 3BO3A 1FJGJ 2Y8YA 4LRDA 2ZH7A 4Y2CA 2XZTB 1TL3B 2RMLA 2CRLA 3NL0A 2HFOA 3HHLA 3QIPA 1SH3A 5CYMB 2RVJA 2VDHA 3TVZA 4GRSA 1TR0A 1FDAA 4C8MA 4OYWA 3DLKA 3NGDA 3GYNA 1SKUB 3Q2TC 1UCNA 1S77D 8AT1B 5DZ7A 2GCFA 5L1JA 4IOCQ 1N32F 1N5QA 1VBZA 5C24A 1F9FA 4PG6A 2PO4A 2XQCA 5BYRA 4WPAA 4LF6J 4ZJQA 2J0XA 3QMQA 4TYBA 2K06A 4I69A 1WOSA 3L7OA 4IRDA 2VKRA 4NLPA 2LKZA 2F9JA 2V2VA 3KYLA 2ZFHA 4QWBA 1VI7A 1KLNA 1F9EB 4DV1J 1RT4A 2O67A 3CEDA 1SC1B 3VQTA 1RB0A 1HPZA 2V63A 3FEZA 2V4JA 3JB9k 3P49B 4O3NA 4F02A 5ETVA 1LWFB 1Y10A 3QRRA 2DCUB 5LSRA 4RU2A 4PXEA 4WP8A 4CLSA 1QAIA 2E9RX 5JXSA 5IS2A 2VFSA 4J9UE 2W9CA 3H90A 2CUYA 2HHTA 4JI3J 3NG8A 1AFJA 4C9DA 5CXTA 4JYAJ 3QSIA 1UVMA 2C2ZB 2AEFA 3HD2A 5DRKA 2DPJA 4JP8A 4UY85 3D9BA 5AJ3F 1DRZA 2KG1A 2FQQB 3T9NA 4F4KA 1RTDA 3D0HE 2OFHX 4NA1A 2DNNA 3CJ8A 3J7AN 1BHNA 1SUQB 4IO9Q 1M5OC 3OTOJ 2NXJA 4C2MA 4DJBA 4LFAJ 2CQGA 2ALZA 2NYHA 2RT3A 4KY3A 5B0GA 1TL7A 1B70B 2VFUA 1NUEA 2Q6CA 2MKJA 3DXBA 5CD4H 3S1TA 4DQQA 4PPZA 5B0BA 4AL6A 3GFYA 2E1AA 4KH0B 4JI7J 3HZEA 4HI1A 2QJ3A 3R9LA 5T14A 4PWDB 5DQIA 2W4DA 3H5UA 1S0MA 3EM1A 2RQKA 1HD1A 2D1CA 4UUXA 4JI1F 4KB7A 5DDQC 4HHHA 2H4WB 2AX1A 3MCOA 2MSTA 2YTCA 3VF0B 4W4MA 3AQPA 1HWIA 3UR3C 2BQRA 1V3RA 2B56A 1Q8IA 1NB2A 2ACYA 1XWLA 3FBEA 1N8RT 2DGSA 1REGX 2QSFA 2I5JA 2YWWA 2B5JA 4A8OA 4MKAA 3SZ2A 4ZS6A 2LU1A 1E6YA 3RW6A 2LECA 1QTMA 3OL9A 3QJJA 3MM5B 2CPHA 4KHPF 1SKRA 1T11A 3D3BJ 3VCDA 2YKNA 1QE1A 3R7SB 1KSPA 3C15B 4QR0A 2CJAA 3OR2A 4QU6A 1WG1A 1Q86T
chains in the Genus database with same CATH topology
1R8CA 3DRPA 1DTQB 1S0NA 3K7RA 2IYGA 3SI8A 1JJ4A 3NLCA 1T03B 4WZQA 1JLAA 3GQCA 4DV6F 5EUHA 1X4EA 4X62F 2CVEA 3PM9A 2M3DA 3AQOA 5EX0A 3VZHA 2XSFA 2IM1A 3JSBA 3GYXB 4TYAA 1JKHB 2VFTA 2R7SA 3PEHA 2VG7A 3PIOQ 2M88A 2ABYA 4H4MA 3IXQA 1Y7PA 3K59A 5T7LB 2KHDA 4JI3F 4CTAA 1JB0C 4JYAF 5IQ6A 3D28A 3KLHA 4NLRA 3N0VA 4Q2MA 2L9DA 1HWLA 3GV5B 4KIAA 1HQUB 5G0RB 4K4ZA 3CDUA 3I0RB 3ENWA 5H9EJ 3GV7B 1WHYA 2C28A 1RYSA 5I3UA 3PXGa 2X1FA 4QU7A 4K59A 4RNOA 3E8OA 5AXNA 1Y4ZB 3PX6A 2BQUA 1FCAA 3RTVA 2X1GA 3ZZUA 2PN6A 5HMWA 2V8GA 4M63A 2C3OA 3BDEA 1GQEA 1KQKA 5AE1A 5F8MA 1NKBA 2RILA 1C0UB 1LFPA 4LVOP 2DD8S 5L8RC 1D3WA 3SXLA 4DQIA 4Y2AA 2UXDF 2BM0A 4CO0A 4NZ7A 4TQSA 3I9V9 4QR2A 1MMNA 3N6MA 3OL7A 3T19A 4CO2A 1JNRB 1AROP 1K9MT 4LSNA 5L39A 2UZAA 5DETA 2K1RA 4KGMA 4OHXA 3CULA 1FRJA 3UW1A 1YQHA 4QWEA 1MWZA 2FD2A 4ZHRB 4M94A 4NLVA 1S6UA 5KOWA 1FRIA 4IDKB 2JVRA 2D41A 4DDFA 4V19X 4OFZA 5KFOA 4YQWA 3Q0AA 3MXHP 2M5YA 3PJWA 1FEHA 2CIMA 2FGCA 3OTEA 2FVPA 4B9TA 3I4PA 3DOKA 4GO7X 5KFHA 4Y2IA 3OTOF 1E6VB 2GNKA 3MMCA 4LIWA 2E5LF 4PQAA 2M8DB 4DF8A 4LFAF 2KRRA 2GGPB 5F0UA 3VR1A 4HH0A 5IM0A 4ILRA 5EGYA 3M4XA 2RUGA 4O3OA 3C6TB 1JLCA 2HRYA 3NRBA 5MAOA 5C42B 2W7PA 2HQ3A 4IH7A 4PRFA 5J1EA 5F3TA 2HHXA 4Z2XA 2Z4PA 2OMOA 4KV8B 4FS1A 2YQ3A 2DH9A 4OZNA 3ISND 3RRKA 3TANA 3O5TB 4M95A 3FSXA 3QAEA 3CC4S 4USIA 3Q24A 1BY9A 1D8YA 3MCSA 4JI7F 1L3VA 2QFJA 1RA6A 3CIMA 2GIRA 2L41A 2R8JA 3TAQA 3K5PA 5C25A 2KU7A 2JZ5A 2VKZG 2MKSA 2CFXA 5F9NA 1UJ6A 3RAXA 1D1UA 1FF2A 5BJRA 2C3MA 1CG2A 5AXMA 4WXOA 3CVKA 4NA2A 1M0SA 2CDQA 3HVAA 4F4YA 3WC2A 1SXLA 3FJ2A 3V4MA 3TW0A 3UWTA 2VQFF 3U27A 2HHWA 1VK3A 2XC9A 2M2BA 1LV5A 3QGPA 1X4CA 3FSYA 3J81Y 1KHWA 2WONA 3TA2A 1HBNB 2KKHA 2RDJA 2FTRA 4R25A 1C0TA 1RT5B 1TK8A 4IRKA 2D74B 4N56A 2KZZA 1DTTA 2KXHA 3HDSA 4OHWA 1F60B 3V81A 1V6HA 1MNEA 1LFWA 4C11B 3RU0A 1DQ9A 2VQEF 2SXLA 1IQTA 2B0GA 2VPWB 1JWWA 3MAHA 2DR8A 4ICLB 3MEDA 3C66A 1VOMA 4MIAA 4YDDB 1OPZA 3UQSA 4QBUA 3GIKA 3RR7A 4KC5A 2R7OA 2YKMA 3QLHA 3TUJC 1K8AT 2GFFA 4Q7AA 3CCVS 4DWIA 4RNHA 2QLWA 1M5VC 3BQ1A 2IA6A 3B78A 4C3LA 1DQAA 2QSWA 5CCMA 1WG5A 4OJ3A 1Q7YT 4JV0A 1QSLA 3OFGA 2CZVC 4FXWA 3MM8A 3BGFA 1SI9A 4ZPWR 4ECZA 2C42A 1VQ4S 1RA7A 4H4OA 3UD4P 2W4CA 3CDWA 3ICLA 3HHLB 3M1VB 1F5AA 2BXJA 2OSQA 4OHYA 1JLGA 1GXTA 2LCWA 3L95X 1RJJA 2GQCA 2D9OA 3H2UB 4KT0C 5A8WA 5CZVA 5KAKA 5E41A 3QIPB 5B0EA 2LXIA 4TU9A 4RNFA 3CCUS 5A6WA 3J7YI 2NR0A 2F7VA 2ADBA 4J5OA 2ATLA 5B08A 3CCTA 4OI0A 3MEGA 3DXSX 1VMBA 4I7FA 3NMAA 1FDBA 2F40A 3SV4A 3V2UC 1HMVA 1VIXA 4R8UA 1D0EA 3UD3P 4IH6A 1O51A 4LJMA 4MKYA 1KTVA 3NWGA 2UVWA 1TKZA 3CTRA 2AF6A 4PXDA 1RYRA 3M8PA 3QGGA 4P2SA 4MFBA 2CZ4A 4USJC 3DLKB 2KYZA 1SH0A 2DH8A 3DCAA 1QY7A 5CZXA 4U9RA 4LQ9A 1GX5A 2A1BA 1C1CA 4H4KA 5DLFA 1SJ1A 3T5HA 3NCQA 4MYUA 1NK9A 3QO9A 3DRYA 4YR2A 1YJVA 2JWNA 4KJIA 2VC1A 2XLIA 1JLBB 1DAXA 3JSRA 1N5YA 4WE1B 1VQPS 1A7GE 3NAHA 4MIWA 2YY3A 3DLEB 2Y1IA 2IRYA 3LAKA 4D3HA 3LANA 4M5DB 1N5TA 2YNHB 2MZQA 4WXWA 1T3OA 2C3UA 2HNYA 3DM2A 1VQ7S 2XSJA 3M30B 5D4PA 5IT9Y 1I94F 2VFRA 1KOHA 5HROB 2GQQA 2YKQA 5SZTA 2OPRA 4URQU 4F3MA 2RIJA 1RT1B 2BW2A 5LXRA 1K1SA 4J9LA 2EI5A 4A8MP 5KFYA 4WK3A 1X9SA 4ZK7M 4WTYA 1DZ5A 1R27B 4RW8B 4RX6A 5E2QA 3I4HX 3HVRA 2KFZA 5I3PA 1RT2B 4E8UA 2PDAA 5J2MA 1JJHA 3PFOA 4OV1A 3ISZA 1HI8A 5KG4A 3GR0A 1VC6A 2M8HA 5KFCA 2VPXB 2WHOA 3SSQA 1VJWA 1UKUA 2APOA 2QE5A 2VC0A 4DL0C 5F9LA 1RDRA 4WU2A 3PR4A 2YWHA 1VLYA 1ZH5A 1S9GA 2ZH9A 2EVZA 4HTIA 2XZWA 4ZCMA 1TQLA 3T6BA 3RBEA 2QV6A 1TK0A 2DGWA 1L3UA 3KLGA 2GMJA 3THTA 1XK8A 2BA9A 1DARA 1FESA 3IO1A 2PD1A 2DVIA 4CZCA 4B3TF 1XR5A 2MHEA 1HQEA 2XMUA 5F8IA 4AL5A 2RKIA 1LXJA 4ZP9A 5J2NB 1F0XA 1OWXA 1URNA 3KJVB 1H7WA 4PPDA 4I64A 3V6DB 5HBMB 1YRTA 2YWGA 1Y3JA 5MLCV 3CJ5A 5K8MA 1X8DA 2BR0A 3OTCA 1Q82T 3UCGA 4Q5VA 3KMSA 1NKEA 4OI1A 5GAHI 2V4JB 2KJWA 3MM9B 3OQ2A 4C4WA 1FXDA 4RW4A 3POTB 3JSMB 4DN0A 1KLMB 1R8PA 1WI6A 2M9KA 2BACA 4LSLB 4XO0A 3CCES 3M32A 3TNVA 2B4OA 2UV8A 4N8NA 5D4NA 3RB0A 4JBCA 3BSAA 4RBTA 3ZZTA 2HFZA 4KRWA 2WB1D 5K8OA 5IQQA 2UUAF 5KG5A 1IKYA 1M90T 4X84A 3BDPA 1HBOB 3GILA 2R8GA 2E29A 3FNNA 4EGLA 2MZJA 3J7ZT 4F2RA 4MK8A 4WKYA 2LDIA 3QZ8A 3BF4A 4PKDB 2RE1A 4F2SA 2G4BA 2LEAA 3I82A 2AGOA 4C0BA 4DFJA 2DK2A 3Q8SB 1U1OA 1RTIA 2KJVA 4I4BA 4K4UA 2KZMA 3LF0A 1S1XB 3DDKA 4JUZA 4IG0A 5KFAA 5LJ3Y 3HHKA 3QWUA 4EEYA 4RW9A 4ATNA 2XNQA 1OQ3A 3M8QB 1WELA 4IH5A 1J2VA 3MOZA 4EYHB 2YNGB 4OIXA 4B9NA 4LF7F 2P6TA 3ZZRA 4Y6IA 5LL6d 4ETZA 2A2DA 2K2PA 2V2KA 3OLAA 1NK6A 1UJ4A 2WSFC 3K58A 2RS8A 4XDDA 1FJCA 1NHVA 2FPHX 1LK5A 3MD3A 4BDPA 2MMYA 4UOCA 2XCPA 5CYQB 1UA1A 3ZC4A 4QWAA 3M9NB 3VWSA 2VG5B 3DU5A 4WFNQ 5F3ZA 1KOOA 4ZPAA 4OL8A 3D2WA 2FJDB 2IFXA 2ZVSA 3IGVA 4Y28C 3PVXA 1HHTP 3IAS9 2DGUA 2ZNYA 2XWXA