2KT2A

Structure of nmera, the n-terminal hma domain of tn501 mercuric reductase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAIVPGTSPDALTAAVAGLGYKATLADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mercuric reductase
publication title NmerA of Tn501 mercuric ion reductase: structural modulation of the pKa values of the metal binding cysteine thiols.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 14
structure length 69
sequence length 69
ec nomenclature ec 1.16.1.1: Mercury(II) reductase.
pdb deposition date 2010-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kt2A00
3HHLC 3T9NA 4ZOSA 1URRA 2FIUA 2AP6A 2FHMA 1S6UA 4Y2IA 2VV5A 2RU9A 3HHLB 2ROEA 2QLXA 5B0CA 4HL9A 4YDXA 2ACYA 3F44A 3HFKA 2GFFA 2RSQA 3MZIA 1Y3KA 2ZDPA 1KVIA 2GGPA 1S6OA 1Q53A 1KQKA 2GV1A 1Y9OA 2LQ9A 5KAKA 1OSDA 3KKFA 2W4PA 2XMKA 5K9FA 2AJ1A 2LQBA 5B0BA 2K1RA 2K7KA 3UDCA 2GCFA 2BJEA 2ASYA 2IYGA 5A6PA 3HF5A 3BN7A 1RJJA 3LO3A 3FMBA 1FVSA 1R6YA 2LXFA 1APSA 2XMVA 5B0DA 1YJVA 3LGMA 3LGNA 3TRGA 2QIFA 4Q2LA 3TOQA 1Q8LA 3IWXA 2KKHA 2CRLA 2K7JA 2IYIA 4FNHA 4OJ1A 5B0FA 4A4JA 2OD6A 3QMQA 1WD6A 4Y2MA 1OQ3A 3KNGA 5A6WA 1AW0A 1Y3JA 2OD4A 1ULRA 2W4CA 4EFAC 4A46A 4OIXA 2QYCA 4DPOA 2FTRA 2GA7A 2N7YA 2ZDOA 4HH1A 1Q4RA 3WDOA 1YG0A 1Q8BA 1QUPA 1TZ0A 2HLTA 3E8OA 2RILA 2VH7A 2XMUA 1GXUA 4Y2KA 2EW9A 3HHLD 5T7LB 3CJKB 4DL0C 2BBEA 1AFJA 2N4CA 2IFXA 1P8GA 3BGUA 2XMJA 4OJHA 4DN9A 1IUJA 2LDIA 4HH0A 3HHLA 4FNIA 2Q3PA 1TL5A 3DXSX 5B0EA 5B0GA 1W2IA 1FESA 3BB5A 2OKQA 1MWYA 1K0VA 2JDJA 2OFGX 1JWWA 3K7RA 1GXTA 3VTIA 1KVJA 2XMMA 2KT3A 1SI9A 4A47A 1CC8A 2PD1A 1FVQA 1Y0HA 2OP5A 1YJTA 3BF4A 4OJGA 3BDEA 2HLUA 4ZA1A 1XBWA 3QGPA 3GZ7A 5B08A 2W4DA 1YJRA 2HQIA 2AJ0A 1N5QA 3FGVA 1FD8A 2N4DA 1LQ9A 4OJ3A 2KT2A 1VQYA 2GGPB 2XMTA 3TNVA 1U7LA 2FB0A 1FEEA 3IWLA 3KG0A 1FE0A 1X0PA 5F0WA 1OPZA 4NPOA 1CPZA 2XMWA 2K1RB 5F0UA 1TL4A 1YRXA 3HX9A 3BR8A 4HI1A 3FRYA 4NL5A 2RMLA 4U9RA 2ROGA 3I9ZA 5B09A 1YJUA 2L3MA 3MCSA 3KG1A 1JK9B 2BYCA 5B0AA 1CC7A 1N5TA 2G9OA 1X7VA 2KYZA 1OQ6A 4QOTA 2QLWA 1SQEA 3CJKA 5T7LA 1N5VA 1AFIA 4HI2A 4F67A 2OAUA 1P6TA 1VQSA 4YEAA 2PGCA 2OFHX 1TR0A 1N5SA 2HFNA 1SB6A 2OMOA 1TUVA 2AW0A 2BUNA 4Q2MA 1V3ZA 2ROPA 1FE4A 1MWZA 3BM7A 2GO8A 1X8DA 2HFOA 2K2PA 4A48A 2BJDA 3DCAA 5IXUA 3HDSA 2HIQA
chains in the Genus database with same CATH superfamily
1RTHA 3W60A 1X0FA 3W9HA 2EVZA 2EFQA 1KQKA 1O8BA 3T1HF 3DNCA 2DXFA 3PW5A 4NCBA 2GAHC 2E7WA 4IR9A 2D9PA 4NCGA 3TZYA 2O66A 1GX5A 1Y3JA 3FUYA 4ECXA 2UXBJ 3I0SA 1RU1A 1YG0A 1RWPB 2W9AA 3MECB 4DL0C 2Z58B 2ZM6J 4CH1A 5KFSA 2XCAA 4RNFA 1UTAA 2KZMA 2JJ4D 2ZHBA 5D4OA 4NLRA 4P73A 2ZBPA 1YBUA 1RTZA 5M2PA 5KFZA 4PQUB 4IDKB 4DR5F 1CSJA 2AEMA 1ZM4A 5E2QA 4FXVA 1WC0A 2W7PA 3PR5B 2RDJA 2E5GA 2B6AB 2DO0A 2R7QA 3AAWB 3M8YA 1H0HB 1EX8A 1KBRA 2ZC4A 4KRWA 2DNMA 1VQ6S 1SB6A 4QZVB 4RNNA 4PXBA 1VBXA 2Y8WA 5J2PA 2QFIA 4U8VA 1NU4A 3VALA 3DOLB 2B9EA 2LQBA 2KZZA 2IBOA 4AQYJ 1YZ6A 2KJWA 3J81Y 4OL8A 2MQQA 3D68A 3GONA 3P96A 5HVFA 4OYOA 1TMMA 2YBVA 3C14B 4EFAC 3JYTA 4DX5A 2JVRA 1U0HB 4M63A 2QJ3A 1J5EF 3KJVA 4J9VA 2XSJB 4HH0A 3RZAA 1UPMB 1N34F 3BB5A 2ZNZA 1X5OA 4I7FB 4DL5A 2GHWA 2DNOA 4IOBA 2XS2A 2R42A 3EICA 3C66A 1PJ6A 4W4MA 1WOOA 4OYXA 4J5OA 3T5JA 2HG4A 3IG1A 4NYZA 4LIRA 3AD9C 3UI3A 3MAHA 2DGUA 4Q7AA 4P2FA 1B70B 2AW0A 2M5YA 4OYAA 4TU9A 1XNRF 4EZ6A 2V69A 1TKDA 3R5DA 1GAOA 1FRHA 2WW8A 4IR1A 1SKSA 3GFZA 1CJTB 3C6UB 3OXLA 5HMXA 1ZH5A 2GCFA 5HQ8A 1YK9A 4IYQA 1VR6A 1HL6A 1KNZA 3M2RA 2R8IA 4A4JA 1S99A 2GVDA 3SFUA 3OQ2A 1TKZA 1JB0C 4N56A 4K4ZA 2YWGA 3KK1B 2XY5A 4PUOB 1O6XA 3OJSA 2XMJA 4DN9A 2LDIA 3QBCA 4C8KA 4DCJB 1X5TA 2EWHA 4B3TF 3DRRB 3HT0A 2OSQA 3R7NB 1LFPA 1N54B 2CZ4A 1OS5A 4H54A 4R5PB 5IWAF 2Z30B 2FB0A 4XAKA 1WSRA 1WHYA 3IS9B 3AODA 3TO8A 4MKYA 5BYRA 3A3NB 4DHVA 2HHUA 2JNJA 4TQRA 3UNYA 1BGXT 2NSBA 3SQOP 1FA0A 5KFIA 2C3UA 4NZ7A 1JLFB 2DHHA 3HVTB 2C3PA 1YZ7A 1PAEX 2DJWA 4C0HA 2RQCA 2DITA 3TX8A 3UN3A 3AOAA 3H5XA 3P3DA 1Y3KA 1KVIA 2RHSB 4IDKA 4UOFA 1F5CA 1HLWA 2OPQB 2FVCA 4OYWA 4TY9A 3NAHA 2F4FA 4G1PA 4OYIA 2B6AA 3IWXA 3NLCA 1UPPA 3IBCB 1R8PA 3CD7A 3UO0A 4JV5J 2CQ3A 4RX6A 4RR5A 1V3SA 2BX6A 1XNQJ 2R7UA 4OHZA 2DRBA 3PJWA 4KQZA 4QIWD 3FK4A 2N3LA 2HBRB 3MTJA 4CDIA 4JI3J 1M1GA 4LFBJ 3DOLA 1NZAA 1VQOS 1VQLS 2DPJA 2CZVC 3AXMA 3LALA 4MIAA 3PJ9A 2UVRA 2MPUA 2LVWA 3ONQA 1WG5A 1U0HA 3OSNA 1S6PB 1H7XA 2LECA 3RAQA 2XSJA 3L7PA 4J9QA 5IQ6A 2OMOA 4Q2MA 4I7FA 2E9RX 1XWLA 4OYZA 4GMKA 3I0RB 2PEBA 3M8SA 4IO9Q 1S0VA 5K14B 1X4CA 2GV1A 5KAKA 1H98A 1K9MT 3H20A 4YB6A 5IT9U 3R2CJ 3ULHA 2R2SA 3EX7B 4HR2A 1APSA 1N33J 5CXTA 3HI9A 2MKKA 1XMQF 2GX8A 3EXYA 3MMCA 3PACA 4RO0A 1IM4A 1IWAA 3QRQA 2YY3A 1FXLA 2NZCA 2KO1A 5F8GA 3AB2B 2MTLA 1OY9A 2HRUA 4FNIA 2VDIA 1VC6A 1UETA 2JDJA 2X51A 4NMLA 1CJTA 3C6UA 4CZCA 4A8FA 3VGTA 3DRXA 1FEEA 1QY7A 2I0XA 4ZHRB 1FFGB 4RUBA 3R7BB 2QLJB 5HQMA 2MZSA 4USJC 4HLBA 4U9RA 1HQ2A 3KK1A 4PUOA 1PILA 3SYZA 3FBFA 2HAIA 3WHIA 1U24A 1WG1A 3KYLA 5J2MB 2D3O1 3DRRA 1RLDA 1S6UA 5LMUF 2AHOB 3DC2A 4ZPVR 4L3NA 4MT1A 4R5PA 1TL1B 4NA2A 3AH6A 4YMEA 3IS9A 2APOA 4OV1A 2RJZA 1U2RA 2POKA 1TL3B 2HHVA 4I68A 1SL2A 4ANEA 3W2WB 1HW8A 4ILMA 4PG4A 2ZNYA 3CC2S 4QYZK 3VGUA 1JLFA 4ZPBA 3HVTA 2E9ZA 4KC5A 1N36F 2A2CA 4J7CA 1FVQA 1Y0HA 4OJGA 3QJLA 5CYJA 4Q45A 3GIRA 4Z2XA 5KT3A 1GMVA 3A8KA 2JLFA 4CO1A 2XCPA 1S0NA 1MLAA 4I6WA 4GKKF 4DUYF 2G0JA 3O44A 3ZZOA 2H54B 4DV0J 2VZ9A 2YQ0A 3M32B 1HMVB 1JJHA 1URRA 2CQ1A 3MMBB 1UW9A 3LAKA 1FI4A 3KKFA 3KLHB 1KQSR 1M5PC 5AXMA 3HP6A 2H5EA 1WC1A 3M7VA 4ECQA 2RAQA 2MKYA 2KHCA 1S6PA 2CJQA 3VAIA 2XQCA 3ITHB 2PEHA 5KFFA 1O0PA 1PBUA 4WU3A 4NLPA 2DGSA 1NHKL 1GX6A 3PNIA 5K14A 1IKXB 1T95A 4M5JA 4USHA 3HK2A 2ZHAA 3RBZA 2W24A 2CNOB 3THTA 3SEOA 2NREA 2XS5A 2V8HA 5I3PA 3Q2SC 1AZSB 4NI2A 2VBXA 3J80U 4M5NA 4CLZA 2D3OR 1YQHA 4F67A 3GMGA 3T5LA 5DLGA 1OSCA 2BUNA 3IC1A 1AA1B 4PG6A 3BO2A 1VQ9S 4ZHRA 3MHYA 2ZKUA 2M8HA 2I6WA 4C8YA 3VR1A 2MZQA 3W2VA 3HLUA 1ZYQA 3RR8A 4CP5A 3JAMU 4NZ0A 1HA1A 2P8IA 1ULRA 3KHRA 2BKNA 4O0NA 4RWWA 5J1NA 2RILA 2DCLA 1CBKA 4FYDA 4NX9A 2HURA 3O1LA 4LIWA 2OKQA 2OEJA 1TL1A 1JWWA 3LTOA 1KVJA 2FGCA 3QWUA 1TL3A 1ZTTA 1RAHB 3BH7B 1YX2A 3W2WA 2VQEJ 4NPOA 4U7CA 4C3KA 4J9MA 4CLUA 4A8SA 1GTHA 4DX6A 1QDUB 4P2MA 1N8RT 3EPGA 1WKLA 2J9DA 1S1VB 2H51B 5KFCA 2DRAA 3CJ8A 2B8QA 2EFNA 4K4VA 1KOHA 4QYRA 1DFDA 2HIQA 2LXFA 3NKYA 3HFZB 1RT2B 5DZ7A 3JQJA 5KG3A 5K8NA 5ETNA 3G6YA 1GK8A 2IYGA 3PX6A 2Q66A 1C4CA 2MQ8A 2AYEA 2MQPA 3AY0A 5GAGU 4OIXA 2DVIA 2AWZA 3M32A 1HMVA 2HAFA 3P6YC 1FRJA 3L9ZA 3OV7A 3E8OA 1NH7A 4NWBA 4DL7A 2DEJA 3Q8VA 2BZ2A 1UVKA 1G1XA 3MMBA 2X7IA 3CDAA 2RDIA 2XMMA 3EVMA 1Z2LA 2DKOB 3KLHA 1YJTA 4AL5A 3QGPA 2E5HA 5DDRC 3IM9A 1YLXA 4Y65A 4RNHA 1YRXA 2ZEJA 3ITHA 3NMRA 3FRYA 2QA1A 3NGSA 3ZTRA 4PPZA 2F8HA 1UZHA 3UQSA 3JTOA 5C24B 4KGZB 3Q8PB 2W2PP 4X84A 4ILLA 1VLYA 4R0JA 4XO0A 1XJWB 3CB4A 1Y11A 4Y2CA 4V1Ak 1IKXA 4Y2IA 2VQFJ 1B64A 3FC9A 4LT6A 4U7UD 4OX6A 4B17A 3V6HA 2KT5A 2BJ7A 3PYEA 1AZSA 5ETTA 3CCSS 1W26A 5CD4H 1SVDA 2VJUA 1OY8A 2EKNA 4ZLNA 3UN2A 2XG8A 4TLRA 2AJFE 2FLOA 4RUCA 1HBMB 3KHHA 2IM3A 2W25A 5D15A 5K8OA 1REVB 3KMQA 3L95X 3R6LB 4B3SJ 4LF9F 1T9YA 4NASA 1U6FA 3RRKA 1CEZA 4DV2F 2JLEA 3NMAA 5IC4B 4WIIA 3I5BA 3W5YA 4IG0B 3K0JA 2GHPA 1N5SA 2CQGA 4W92B 2V9WA 3NGTA 4CTAB 4BHQA 1SIWB 2XWYA 3U02A 3CD6S 4WBFA 1DTQB 5E3PA 1RABB 1N56A 2XZTB 1HNZJ 2YX1A 3DFEA 1QSSA 3PIOQ 1S1VA 4G3IA 1RTDB 2GNKA 3FEYB 5B0EA 1RT2A 4RBVA 1FCAA 1TV6A 4R0EA 5F8IA 3J80Y 1RZMA 5I42B 2GIQA 1HNIB 3FQKA 4ZVHA 4WKRA 5U47A 1LWCA 3WIUA 2B9XA 4Q0BB 1VQ5S 3PX4A 4KKOA 1KVKA 5HP1B 4RW7B 2QX0A 1U47A 1N48A 5E33A 1JK9B 2AU0A 2MSTA 4JYAF 1VQSA 1YITS 5MLCV 2R8GA 1FE4A 3ZZUA 2IJFA 3V6DA 5C25A 9ATCB 2XTJP 3CSKA 1EZZB 1V3RA 4HTJA 2HHXA 2BMBA 3AQPA 3KLVA 4GO5X 3KWMA 2G2OA 5B0DA 4KPCA 3NEKA 5E3RA 5C24A 2DNZA 2ZZMA 4TQSA 4JI8J 2R2RA 1JNZB 1RT6B 2IM0A 2CNLB 5M2UA 3TZXA 4QR0A 1TL7B 2YWEA 1R7IA 2WVDA 2QA2A 3DRPB 4P6QA 2GS8A 3MXHP 2VG7B 1YJWS 2XI2A 1JLQB 3M9OB 5HATA 3Q0AA 1T9UA 2JFDA 2PFFB 1UFKA 1S6QA 3IRWP 1JJ4A 2HHWA 1IJEB 3M2UB 2JVOA 4QW9A 2PA3A 2ZVSA 3TEHB 4G65A 3G82B 2HFSA 4Q8FA 3M6UA 4F02A 3GJTB 3KLGB 5LL6d 1U1QA 1XR6A 2C2EA 1IJFB 2MKJA 1HNWF 1OO0B 3RR7A 2LU2A 3UWTA 4DPXA 3FBCA 2CQDA 3PYDA 1ZAWA 1REVA 1IKWB 4KV8B 1U2CA 1N32F 4PPDA 4TYAA 4RW6B 4DR1J 1VLOA 4IQXA 4R25A 4TN2A 1IBKF 1OSDA 2DHXA 3LP1B 5A8RB 4QU7A 2V4JB 4O3SA 3CD0A 2J8AA 3EE3A 2YPZA 3X1LB 5FIIA 5EUHA 4IG0A 2E44A 4MKBA 1VISA 2CVIA 5CCMA 2DPIA 1ICEB 4MK9A 3QIPA 3D6TB 4OJHA 2DR7A 3PX0A 4OZNA 4QQBA 3KLIB 1Y7PA 4J9RA 3B4MA 1NBEB 4PABA 3MPUB 1JQGA 1DTQA 1RHRB 2OO4A 4QIGA 3PFOA 3SV3A 1FE0A 2IRUA 1VRUB 4LF4F 3DOMB 3K59A 3LP2A 2E66A 3NP5A 1FJ7A 3AA8A 3KG1A 3FKBA 3QT5A 1M5HA 4OLOA 1NH8A 2ALYB 4A48A 4F8RA 4ZOSA 3BYPA 2ROEA 2ZZTA 4U8YA 3RG6A 5HN0A 2VODA 4LF6F 2DNNA 4DR2F 2EFPA 4K5SA 1X60A 4Q0BA 2U1AA 4KYZA 2ZC3A 5HP1A 4DR7F 4RW7A 2RUGA 2CFXA 3M6WA 3UCUP 5BYQA 3QFWA 3GU0A 4MK7A 2DH7A 4WPAA 4JI0F 1O5JA 3DLGB 3PRVA 1NJYA 3SBMA 5H9FJ 1BHNA 2E9TA 1Q7LB 4OHYA 2E29A 3ZFVA 4MKAA 2M7SA 1Q5VA 2K3KA 1Y10A 2VPXB 2V2QA 3FCHA 2U2FA 3PVXA 4NLYA 2WBRA 1F9EB 4M94A 2J76E 1Q5YA 2V6AA 2IY5B 4NLOA 5D4LA 2R3VA 1LFWA 4EUVA 3GLJA 1X7VA 4RUAA 1E6VB 2CYYA 1SQEA 1RT6A 4LBPA 3PG9A 1EIYB 2V68A 3DRPA 2VG7A 4P71A 1JLQA 2EBGA 1HW9A 5KFYA 5AJ3F 2CPJA 4NLQA 1PC5A 3EGWB 2PSZA 1ZM2A 4CCHA 2QV6A 1BWEA 4M5LA 5K9FA 3M2UA 3GFHA 1VK8A 3MEKA 3G82A 1IQTA 4U95A 1LW2B 2QSFA 3JS9A 3T5KA 4OV6A 8AT1B 3C15B 4RW4B 3WDOA 3IFEA 1BMQB 1GXUA 1IKWA 4KV8A 3MM5A 2NUHA 2MDAA 3OFGA 4RW6A 3Q24A 6AT1B 3OL6A 3LP1A 4HDGA 5A8RA 2PD1A 4EMDA 2V4JA 4YHHJ 4DLEA 4ERDA 5CYQB 2A6MA 4TLQA 1UA0A 3CDBA 1VFJA 4ANCA 5JUMA 1Q7YT 1TUGB 3OVBA 3E2EA 1WUUA 3KLIA 4YB5A 3VQTA 2CXEA 2A2DA 1M90T 4NLUA 3NCQA 1T3OA 3TA1A 4CLKA 2RF2B 1GFWB 5E3QA 3CJ2A 2GO9A 1VRUA 1S72S 2W1BA 3DOMA 2BJEA 1I94J 3K2YA 4M5MA 3PO5A 2UXBF 2XYHB 3SCIE 1S7HA 2W01A 3DU5A 1IWGA 4ALZA 2WSFC 5F8HA 3ZTOA 3D6HB 1TAQA 2ZM6F 2ZOFA 4B9TA 1LXJA 2OI2A 5HSPA 3D3CJ 1RXOB 2HKEA 4CWBA 2VJVA 2F4VJ 2KVQE 3UDEA 3KK3B 2D69A 2BW7A 1DURA 1R8AA 4UOCA 5K8MA 2BOPA 1VQ7S 4XPEA 3K5MA 1VBYA 1LQ9A 2KM8C 2O5DA 5FDLB 3K58A 1I1GA 5EWEA 4CO4A 4GKJJ 1RWOB 3DLGA 4NL5A 2EC0A 3AA9A 4AUKA 3SCJE 1URNA 3D0GE 5KFJA 1AFIA 4ZP8A 1P6TA 3CGIA 3UNGC 1KFSA 4ETZA 3AD8C 4JI7J 3I4PA 5KFOA 2CPHA 3NWGA 2NXUA 5E41A 3PY8A 4ZJLA 2DO4A 2UUTA 1E6VA 1SL0A 4LMZA 3FZBA 4TXSA 3EZ5A 1Q8BA 4USUA 2VH7A 1FTRA 1Q95G 3TA2A 7FDRA 4PXDA 1VBKA 2IMWP 2CPFA 1X5SA 4X2BA 2HQCA 5L1KA 3D5MA 4DUTA 1HHTP 5KG2A 3W64A 3E51A 4DG1A 3MR5A 3LPEA 3NS6A 1H2UX 3N79A 3U7JA 1LW2A 1U7LA 4K0KJ 3HHNB 3CO0P 1QLNA 4LREA 1RDRA 1C0TB 5K8PA 4YP3A 2V50A 3C15A 2V4QA 4RW4A 1NKBA 3HVRA 1HQUB 2W9BB 2GZOA 2FJEB 4L75A 3ZTQA 3R6GB 4DS4A 1UWBB 4LF5F 3MCOA 2V2ZA 1MWZA 2XBPA 1CJKA 2IPOB 5CH7B 3AFGA 2CZ9A 1NPPA 1PGZA 2YWKA 5KFHA 5CYQA 3H25A 4WXWA 2NCKL 4FS2A 3B6BA 1Z4UA 4NLDA 3TANA 5T14A 2FC8A 1RB0A 3EXCX 1FDAA 4KH0B 5KFPA 2V94A 1M5VC 1PAUB 3RRHA 4CNZA 4QPXA 3P49B 4NEYA 4DR4J 4DV5J 3SIPB 4CT8A 2XMAA 4X4NA 2B7CB 4K7QA 4F3MA 4DEZA 4LR9A 5EX3A 3FMWA 5DDQC 2DNLA 5KFDA 2W8LA 4BWMA 3T5HA 4BC9A 5EGYA 1K0VA 2O3DA 1NK0A 2RF2A 2R7WA 1KS2A 2L9WA 3UDVA 3GYNA 3I5CA 4UZBA 2NZ4A 3G9CA 3A4TA 1I6JA 4USMA 2RQKA 5IQQA 1OQ6A 3R2DJ 4I2PB 1ZM3A 5EHHA 4K4XA 3EGVA 3IXQA 3KK3A 1VQNS 2DNYA 2XI3A 2B4OA 3K5LA 4X4RA 1XERA 2ERRA 1NJIT 4NA1A 2NXNA 2IVMA 4LBIA 2Y3YA 3RYLA 4D3HA 1B4SA 1RWWB 2DGQA 8RUCA 4B02A 5FDLA 2HHTA 2V4RA 4YR3A 1S9GB 1PJ5A 4DJBA 2LXIA 1UA1A 3FJ2A 4IFYB 2MSSA 4ZLLA 1WF2A 4M5GA 4NLSA 2CADA 2Q6BA 1Q4RA 4JI3F 4LFBF 2DRDA 5T7LB 2UXCJ 4DV6J 3G6XA 2AZ3A 1JLAB 3I96A 5D3GB 6FD1A 3UD3P 4Q5VA 3QT6A 1N52B 2MQNA 3KDOA 3MF5A 1KQFB 2WZ1A 3LW5C 1VC0A 2GJFA 2F65A 1A0OB 2OIHA 1RTJB 3SSSA 2YWHA 1RADB 4UY8T 2G1DA 1XIQA 2AJ4A 2FHJD 4FVCA 4JI6F 3IBFB 2JSXA 4CO2A 2CVEA 3ENVA 2XHCA 5KG5A 1UEUA 4QOTA 2EFVA 4Y2AA 1HWIA 4L6V3 1RCXB 2MZRA 4YFUA 1IQZA 1NK8A 2WONB 3VAMA 2IJNA 1VQ8S 4YOEA 2VG5B 4PQAA 4TVAB 5DM6Q 3DLLQ 2YXLA 5GVQA 2V8VA 3Q23A 2DR5A 2V63A 3GG0A 2WHOA 1YVFA 4YR2A 2KDOA 2K7KA 2UUCF 2JLGA 3MM9B 3CJ0A 4RBUA 3FNNA 5KFBA 3MEGB 3TOQA 1HQUA 1GEHA 2I2YA 1AW0A 1ZAXA 2HMIB 2N7YA 4WCEQ 1UWBA 2RRAA 1SIZA 1P9YA 3B8HA 3VGVA 2GMHA 1JXEA 5I4MA 4FF1A 2HGLA 1CVJA 3CVKA 3PEJA 2E1PA 1SPBP 6FDRA 4JBCA 2ZH9A 3QLHB 4OHWA 2DHAA 4P7VA 3QT7A 2KT2A 5ETSA 1UEKA 2QFJA 1FXDA 1WTFA 3OLBA 2MLXA 1D8ZA 2ZE2A 1N5TA 2PO4A 3CJ3A 5KT7A 3EPIA 2B9WA 1VC5A 3UE2A 2QA4S 4ZVEA 3BQ2A 4WP3A 4OI6A 4G1QA 5EDWA 3ENQA 3W5XA 2FVSA 3OTDA 5ADZA 3NOGA 1X4AA 4LFCJ 2W4PA 3CJ4A 3MMAB 2HHPA 3GR1A 3MR7A 4FF4A 4I2PA 1U45A 3AB4B 4DCPB 4F4XA 4IFVB 3N01A 1R3NA 2QMUB 2X1FA 1U6BA 4ZS6A 1RSCA 2VPYB 3CJQA 4NYOA 4DPWA 4ZVSB 1FO1A 1K73T 3EWGA 2QMWA 3SQGB 4CLSA 1FRKA 1G3OA 3G8TA 1YJ7A 2AJQA 2O67A 5GAEI 1GXLA 4F3QA 1S9GA 2GGPB 2ZH4A 5ETPA 4CO0A 2V0NA 4DV0F 3VZHA 4IFYA 4ZIVA 5J1PA 4QR1A 2Y0BB 1NZ8A 3PHEA 3EM1A 5T7LA 4N5SA 1RLCL 4W90B 1JLAA 3NAIA 5D3GA 1GMWA 2IVFB 5D8HB 4C48A 3BGOP 2QMXA 3I4HX 1FJEB 2DB1A 3UW1A 4DQPA 1L3UA 1AYEA 1I5OB 5J1EB 2MGZB 1WACA 5GAGI 4HYKA 4J9SA 5GAHU 1CJVA 3CMQA 3D2WA 5B0FA 3ENAA 5BR8J 1SH2A 2WONA 1HARA 1X4GA 2XGQA 1UVNA 1Q8KA 2VG5A 1AFJA 2E7VA 1G7CB 2OEKA 3BV8A 2ZWOA 4QYZJ 4ZA1A 1HI1A 2HPUA 3SZ2A 1J5OB 3VZIA 2HGMA 2UUBJ 5D0RA 1HQEB 4ED8A 1MROB 2JEIA 2FUG9 2MJUA 2HMIA 2MYFA 4ECYA 5B09A 5C7PA 1UVJA 1EAYC 2HWIA 4DSFA 2NUUG 1T11A 2OFHX 1PSDA 3T19A 1FFWB 4KAIA 3HKWA 1TKXB 3V5RA 4CNYA 4DL2A 1X4DA 2J7WA 3FMBA 4PKDB 4OZLA 4ANDA 3PW0A 4WYLA 2ILYA 4CI0B 3TP2A 2J6UA 4BCAA 2N4CA 1RAEB 2LXUA 1U1MA 4LFAF 4IRDA 1LWXA 3T1HJ 4BLGA 2HFVA 3T9ZA 3W61A 1NSQA 3BBFA 3MMAA 2AX0A 1YJRA 2UV8A 2IA6A 3ZZRA 3CCUS 4V19J 3DLKA 2GMJA 2V8GA 4IFVA 2PDAA 2BQRA 4QU6A 2K3IA 4ZDNA 2CWXA 2HNYB 2KFNA 4ZJQA 1XK8A 1T7PA 1RHUB 4DUZF 2IDLA 5L8RC 3KLFB 3BH6B 3SQGA 1DTTB 5KFLA 5EWFA 5G0RB 3OHBA 1HWKA 1M1HA 1T0TV 4MJKA 5C2GA 3V6JA 3HHLB 4DS5A 3TJAA 5KT6A 1MMNA 3HFKA 4C11B 2GGPA 1U25A 2ZH3A 2BA9A 3I6PA 3R3TA 4EO6A 4TU7A 3D28A 3OXFA 2HZCA 5A8WB 3GV8B 3SSRA 1N5YB 4LRAA 4C98A 2IDEA 4AFFA 2FJVA 4HKQA 2ATCB 2Y1RI 1TP7A 4I56A 2HQDA 3M4XA 3RAMA 5J1EA 3N6MA 2O1PA 4JOUA 2OP5A 5DQHA 2RVJA 3TYTA 1UMJA 2XM3A 1QJHA 3NGDA 3HO1A 3H4DA 3NGRA 4WWSA 4PXEA 4LF2A 1J5EJ 1DJ0A 2M8DB 1YIJS 1SBRA 5DQGA 2BE2B 5DM7Q 3I82A 1RBAA 3GG1A 3TUPA 3LOUA 5KFAA 1XEZA 3FFIB 1J5OA 1KHWA 3D6MB 3ILIA 2PT0A 4WFNQ 2Z2LA 1HQEA 4E0DA 3CWJA 3HPOA 3QWPA 3OXGA 3J81U 3D67A 3QSYB 4B9NA 3DI6B 4RU2A 2CQ2A 1D09B 5DDOC 2XMUA 4B3SF 2VFSA 1P8GA 2FDNA 4XDDA 1YRUA 1TKXA 3C8YA 2MJNA 2IVYA 1RWUA 2AIRB 2P6SA 2KU7A 1NKCA 7AT1B 2V5HG 3FGVA 4ZPDA 3CULA 4ZIWA 3TAQA 1BLUA 2Z57B 2VPWB 3PZPA 5B7WA 1JLBB 3IM8A 3NCRA 3HJFA 4J9LA 2X1AA 5C42B 2H65B 4HI2A 3OVSA 4P7TA 2B4PA 4NA3A 1B0VA 1P9QC 2OSRA 4J90A 4J9KA 1FKOB 2AZ1A 2FHJA 4ER8A 3GTYX 1PYSB 4P75A 3QFHA 2KTQA 2O01C 4AD6A 5ITHA 2HNYA 1NDLA 2VOOA 3KNGA 2OD4A 1NB7A 1FFSB 1TTHB 3OL7A 3EJMA 1ZBTA 2K8GA 3KLFA 1DTTA 5G0RA 4BDPA 5D4NA 5AT1B 2QZ8A 1RYSA 1T9XA 2NXJA 3HHLA 2Q3PA 1GNKA 2F8MA 3ZZTA 4B3OB 1VIOA 4K4WA 4C11A 3VVTA 4A47A 1JMTA 4B9MA 3BDEA 1TAUA 2BM1A 1UVIA 1YJNS 3BO4A 2W2QP 2YKPA 1U1OA 2YX4A 1F2GA 5A8WA 3ICLA 1N5YA 3NGKA 4F0MA 4BS2A 4CM2A 3GIIA 1N5VA 2CJYB 2JEGA 1L3TA 3H90A 2E5IA 2CQHA 5F41A 4FP9A 3W63A 3DCAA 2QLBB 1RKIA 2V34A 4C3LA 1SC6A 2ACYA 3DGVA 3NNCA 1U1NA 4RU9A 2BQ3A 1WOPA 4JI8F 3IN5A 2I38A 4FXDA 2BE2A 2KKHA 1NEEA 3EUNA 3UDLA 4JI4J 4KSEB 1RHJB 1IBMJ 2UV8G 5SZTA 3ELHA 5B0GA 3P45B 3Q22A 3Q8SB 4TY8B 3M2VB 3OLAA 1S10A 4M5HA 1LK5A 2LEBA 2JOQA 4O23A 4FYXB 5ETVA 1PYTA 3T3FA 3FVYA 5CZXA 3VV2B 3HSGA 1TK0A 4X65J 1XMQJ 2G4BA 2YKQA 3D4JA 3DI6A 1HWUA 5JJBA 1SC3B 5GADU 1IBLJ 3I87A 5F3ZA 1K1SA 1SJFA 2MY8A 4DSKA 1RWVB 1FKAF 3EZOA 3U1MA 1FRIA 4NOHA 2ZITA 4PXCA 2BKPA 2LMIA 3NRBA 3OFHA 4X4SA 4DR1F 3KDNA 4WFXA 5F9NA 2HS3A 1NHUA 2BRLA 2Y1LB 4NZ6A 4LR8A 5KT5A 3R8YA 3EZUA 4LSNB 2VBWA 2C2KB 1FNXH 5L1JA 3TW0A 4OFZA 3VQSA 3UDCA 1JLBA 1RJJA 3LO3A 1FVSA 4FVMA 2HRYA 5D0EA 4H4MB 4O3RA 5C42A 3CCZA 3EVWA 2ZBRA 1J27A 1AT1B 1QM9A 2ABYA 1RHMB 2FLLA 5LMUJ 4ELTA 4DFKA 5LT5A 3L4BC 1ZZFA 4DU8A 3MURP 2MLYA 5D0GA 2MMYA 2FGOA 3MUMP 3DRYA 4JI1F 1NK9A 2J9CA 2N3OA 3KHLA 3J7YU 4B08A 2HNZB 2MQOA 4MYTA 2AKWB 3OBIA 4EU0A 3RJMB 2RMLA 1RWNB 2COLA 1S49A 3MDFA 3RBEA 2OAUA 3IP0A 1K47A 1V6HA 4B3OA 1BXNA 3DKDA 1N36J 2EI5A 1S1WB 2WCXA 3H7HB 2W8KA 4ES3A 2GIFA 4LF8F 4DUYJ 3BEGB 3A8IA 2ZH7A 2F8EX 1NLKL 2HRTA 2QE5A 4QCLA 4X4PA 4RPFA 3HVWA 4NLTA 4NLXA 3IA0A 1JXVA 3W65A 4HH1A 2PFDA 1UJ5A 4O0IA 4IQMA 2MB0B 4JV1A 2GC8A 3H8YA 3RRGA 4RW9B 3ZXWA 1PJ7A 4F2SA 2HBZB 4F4WA 4EBDA 2Z56B 2KJVA 3D66A 3HM9A 1VRTA 4GVBB 2ZH8A 4FF2A 1X4BA 4FPRA 2VKRA 1LKZA 2HVDA 2Y9HA 5HBMB 4KHPJ 2M0GB 4DOZA 1VDHA 3WZ0A 2ZJPQ 2K2PA 4TY8A 3M2VA 1KRPA 5L1IA 1Q16B 2ZOMA 4I6AA 5J2NB 1ZETA 5KFXA 1FF2A 1LNQA 4M5DB 2FD2A 3OL8A 2OD6A 5A6WA 3ILJA 1WEYA 4M5IA 3MUVP 3A8JA 1TZ0A 1QUPA 2P5VA 2WVEA 1FWPA 1TELA 2A0FB 1HNXF 2QYGA 2KI2A 3HD1A 5DG7A 4LSNA 1Y5LB 3CEDA 3DOKB 4WFBQ 3PDNA 1BE4A 4P52A 1I3OB 2JRSA 2XHWA 3MECA 4YY3J 3HHEA 3KJNB 3QO9B 5LOQA 4H4MA 3EDRB 4OI4A 4JI2J 3AJ2A 2HS4A 3QJJA 1NK7A 2DNPA 2L3MA 2B4VA 1VBZA 3GE9A 2CWKA 4PQUA 3OT9A 4OYPA 2ZKTA 4KGMA 3MWBA 4WZMA 4ECUA 2ASJA 2E5LJ 2BV3A 5A2QY 2HNZA 3NCPA 2QRRA 1G6BA 5HVGA 4FS1A 1P1LA 2ZH2A 1ZA1B 2BRKA 5HANA 3AJDA 1SL1A 3BN7A 4NXNJ 4AE5A 1SJ4P 1UKUA 2F4VF 2UUWA 1WI6A 1VQMS 2ZDOA 3ZZPA 1IR0A 4QIVA 4I2QB 4Y2KA 1S1WA 1KHVA 3C14A 4KGVB 4DX8H 5BJRA 1OYDA 3OJUA 1SI9A 1WORA 2HVEA 2PI5A 1CULB 4GKJF 2VD3A 3G2XA 5DRKA 2RQ4A 2M52A 4WTYA 2RS8A 2QG9B 3GJQB 1XC9A 3A8EA 1YSJA 3H2VE 2AQ4A 1NXIA 3AXKA 4B3RF 3JSMB 3MPDA 2DY9A 2HHHF 3OTCA 5ETKA 1BUXA 1NM2A 3K8WA 3CJ5A 1R0BG 1NK4A 4RW9A 4JB8B 1LWEB 3TVKA 2OTLS 2GFFA 1D1UA 1JJ2R 1CQNA 5KFMA 3BR9A 4Q8EA 3JQMA 3CIMA 2AEFA 4GVBA 1UP1A 4DV7J 4WZQA 4A8XA 3ADAC 4C4WA 1DRZA 5LSRA 4IG3B 3T1YF 1SJ3P 2CUYA 3CCJS 1JLCB 2J9EA 4URQU 2E1MC 2FVPA 2ZVIA 5HBMA 2ALZA 4ZVGA 3BGRB 2GQQA 3PXGa 4UQTA 4XDCA 3I55S 2X3DA 2F5GA 5DDPC 2W7AA 5ETRA 3TUIC 4DXLA 2M88A 4K0KF 4G1IA 5J2NA 1HHSA 4M5DA 2FPHX 3OHAA 1IKYB 1Q1KA 3C3LA 3QSIA 1WC6A 3MCMA 2ZJQQ 1WKJA 5J2QB 3K57A 5CHCB 2DD8S 1QE1B 3V6KA 1W7WA 3DOKA 2Q6CA 2ROPA 3MD1A 5L9XA 1R0AB 4LF9J 4RWXA 5LSOA 2Y0SD 3HZGA 3ZNJ1 3QO9A 2Z0GA 3P8BB 2VU5A 2VA3A 2OPPB 2WK4A 4DR4F 4DV5F 1MSWD 5F9LA 1NPRA 3CCES 2XULA 2IYIA 4A8MP 2OPQA 2R7SA 2F40A 3W8PA 4NLWA 1WWHA 1RT5B 1WHVA 3SCKE 1QSYA 1C1BB 3UCZP 2LKZA 3RW6A 3N5FA 1RUSA 3DDIA 5KOWA 1CS4B 1TL5A 2OFGX 1H72C 5AE3A 4OZ0A 2XNRA 3NNAA 1RT3B 1KTQA 2CPIA 2GQCA 3K5OA 1TKTB 3CJTA 4L76A 4ZP7A 2YPYA 4FYVB 4I2QA 1NDCA 5IV3A 2ZUAA 4X66F 1D9DA 4ETXA 2YVSA 4KHRA 3O6QA 2EKYA 4LSLB 4IOAQ 1CULA 1RAJA 2PC6A 2CJXB 2CNKB 1X9WA 2ZH5A 1SCJB 1PKUA 2UP1A 3JSMA 3I0RA 2YNFB 3RW7A 1S0OA 5F8NA 4JYAJ 1PBAA 4ZPCA 2UXCF 3JTNA 3M30B 4M95A 3MEEB 1VJWA 4N7TA 1AROP 3GPAA 3KNAA 1F9FA 3NBPB 3HD2A 1LWEA 1K1QA 1RU2A 4DMZA 1QVFR 4F04B 3PHTA 4QPTA 1WEXA 3PKYA 1ZAVA 2YKAA 4WXOA 4IG3A 5D77A 1JLCA 2P9GA 4N47A 4ECRA 3MPWA 3BGRA 1T9WA 1G4CA 1RACB 4L72B 2LEAA 2KFZA 3T6BA 4PEOA 4IOCQ 1Q79A 4A8OA 3W62A 4MAKA 4DN0A 1IKVB 3CXCR 5GAHI 2CIMA 1B7FA 3D3BJ 2FHMA 3GYXB 4A8WA 3Q2TC 3FEZA 2R8JA 1Y9OA 4B3MF 5J2MA 1R43A 1QTMA 3VF0B 4YR0A 3BPDA 3VGSA 5DO2A 2BKOA 4J9UE 4J9NA 4PG8A 3GIKA 2B8PA 1N4LA 3BBCA 2C28A 2R7TA 1WTBA 3QZ8A 4JI5J 1SV5B 2KG0A 1R0AA 2BBEA 2VA2A 4F0HA 1IBKJ 1CG2A 4CH0S 3OR2B 3MR6A 3H42A 3AHPA 3R1LA 2YTCA 2DGWA 2OPPA 3SV4A 3KUEA 4PG7A 4DSJA 4C8LA 1W2BR 2LCWA 1WDTA 3CCRS 3KUGA 2M4MA 1N0VC 3F41A 2FJDB 1RT5A 1D9FA 2D74B 5EWGA 2QSWA 2RDDA 3GCWP 1C1BA 2WSEC 2HK3A 5AE2A 2NR0A 3N28A 3OR1B 2PGCA 1SC1B 5LSLA 5GMEA 4WF9Q 4QR2A 4LFCF 2JC1A 5I3QA 1RT3A 1TKTA 4F7VA 4DWIA 2LQ9A 2L9DA 4ZCKA 4A8YA 2KRRA 1R6YA 2R8HA 1YJVA 3GIMA 1RAOA 3ISND 4FF3A 3T6JA 3DDKA 3LF0A 4USWA 2QO3A 2AJ2A 3BGLA 2RE1A 1DQ8A 4ED4A 3KXDA 4LF6J 1ZM9A 2MKCA 3QT8A 5HMWA 3B78A 2B5JB 1FWLA 1FWKA 4WYWA 3TJ9A 2NXEA 3DMJB 2YNFA 3M9NB 1WHXA 2IIHA 3NNHA 1PYOB 4AXIA 3LANA 2V8DA 2B9YA 3M30A 4H4KC 3MEEA 2GQ2A 1RAFB 2G9OA 2HGNA 1L5UA 3NBPA 2IRYA 3UR3C 1FX4A 3PV8A 3O3LA 3PTWA 3RU0A 1UEVA 5H9EK 2XO6A 1BQXA 3DRSB 4CLYA 1Z1ZA 1R31A 3HFVA 3P4UB 2OMLA 4U67Q 4DSIA 4WFZA 3MFHA 2HW3A 2GHVC 3M6VA 3G96A 1C0UB 5THWA 3C19A 5F8JA 3GB0A 2DNHA 1U48A 1IKVA 1RE1B 4IUFA 2IFXA 5HMZA 3NS7B 5AXLA 4CQ1A 3S01A 3BGFA 2QN6B 3N4WA 5KT2A 2XGPA 3D6FB 3G4SS 1KTVA 4WP9A 1NSKL 3OTOJ 1KDNA 2LU1A 2UXDF 2EK1A 2XS7A 2ROGA 1NK6A 3QYYA 2BJ3A 5L39A 2C3OA 4OI2A 4UUXA 1KFDA 2HFNA 1ZA2B 4EWTA 4I67A 3HCXA 2VUGA 3OR2A 2V8PA 2YKMB 5A0YB 3TARA 4MIBA 2AD9A 3K5NA 3QZ7A 3QAUA 3L7OA 3DXBA 1HI0P 4OLPA 2VOPA 2WW4A 4CO3A 4Y34A 4X62J 1HKAA 1KLNA 4E98A 2KRBA 3VAJA 1OJ4A 1S7IA 3R1HA 2NYHA 3R9LA 3W5ZA 3OR1A 2YH0A 1Q0NA 4KJIA 1T94A 2CQ4A 3VVUA 3HT3A 1B99A 5K20B 3N9UC 2W7OA 1HD1A 1CLFA 4ICLB 5GMKa 2NPFA 4JP8A 2JZ5A 3TZZA 4ELUA 2HVIA 4M1KA 2BYCA 4ED7A 1V5VA 2BEFA 1P27B 5HQLA 1E6YB 1KWMA 1X8DA 2B5JA 3LWLA 3HHKA 3ENWA 2XEXA 2RSQA 2QL5B 1O51A 3DMJA 1WNEA 4FYWB 2H4YB 4ZN1A 4K8RA 2CDQA 4QW8A 2H5JB 1F1BB 1RAGB 2YNHB 3FBEA 4N76A 2EG2A 3PYFA 4KE5A 1YI2S 5IZHA 1VRQC 2XZDB 2HHQA 2IAJB 4Q43A 2E7XA 4PYAA 2FHOB 3DRSA 3VCDA 2NYIA 5CAAA 1KC8T 2KT3A 2QL7B 3RGIA 1HBMA 4IRKA 3GYGA 3KOAA 2I9SA 4H4OB 4RBTA 3FBBA 2D7SA 1U1KA 4RUHA 3DLJA 2YH1A 1C0UA 3U1NA 4N8OA 3MAAB 3DLHA 4BWJA 2C42A 2N7CA 1T9TA 2KYZA 4YDDB 2IBKA 4WJBA 1EQ0A 5CD4A 2OLWA 5D78A 3TI0A 2C2ZB 2QTWA 1X4FA 4C9DA 1A7GE 5DLFA 4MIWA 2F9DA 2KN4A 1ZS6A 1EHWA 2HVZA 1LOUA 3WIVA 3C16B 4DV1F 3MMCB 1KQGB 2ZH1A 4LRBA 4CTAA 2RT3A 1U8SA 2NLWA 3IGNA 2UUAF 1YBAA 2B43A 2PMWA 4LF5J 4DPOA 3BKFA 4K5RA 2DNQA 3IR6B 2HLTA 2VL1A 1T9VA 2YKMA 5A0YA 4GRSA 4U96A 3W9JA 5GADI 1UWAA 2CG4A 1RISA 3UR0A 1VQPS 2FZCB 2FVRA 3E01B 1GXTA 1NUEA 3ETOA 2DBBA 1RTDA 1N5QA 1QTNB 5CYMB 3S8SA 2KM8B 5F0WA 4Z7CA 2J0QD 3PW4A 5I42A 1KEKA 2CA9A 1HNIA 3GV7B 3H5SA 3SDEB 4USTA 4MFBB 1HWLA 2J0XA 3I31A 1TK5A 1VS3A 3OTEA 4DZDA 4DBQA 1GMUA 1C2PA 2AP6A 2VG6B 4QWEA 3HKZD 4ICLA 4LF7F 1R6VA 1TU0B 4NXMF 2RD5C 5JXSA 2FZGB 4HVZA 4ED1A 5IM0B 4C7QA 3G86A 4PWDB 2DH8A 1FK9B 2NSCA 4RW8B 2BVZA 2XMVA 2WSCC 2RHQB 4PR6A 3HSJA 4F4ZA 3J81j 3CIZA 4M8LA 1M5SA 2H1YA 2LQ5A 1E6YA 3SCLE 1NJWA 1F9HA 2XB2D 3J7YI 1HR0J 2G0IA 1NO8A 4DR3F 2N82B 4UZCA 2C3MA 2IMOA 2FVQA 3BN4A 1IR2A 3HHDA 2YQ3A 3Q83A 3K5PA 1GQEA 2HLUA 1RAIB 1IR1A 1TL7A 3UPFA 4X64J 2YNHA 1BQMB 1MWQA 3KMSA 2MZTA 3G8QA 4XPCA 3C2PA 3GILA 3CCQS 2D1CA 3M8WA 5FLXY 4F3OA 4O3NA 4S0MA 4QIFA 1AB8A 4ZN3A 2IAJA 4USKA 3FCVA 2LFVA 5ETOA 1CQMA 4ZK7M 2MQMA 5KG1A 5IXUA 2FJBB 1Q86T 3ISZA 4O3OA 3KLGA 2MKIA 2PMHA 4O3QA 1KP6A 1X9SA 1RT1B 4H4OA 4JI6J 4K4TA 3MAAA 2ASYA 2HQGA 3KFWX 3JTPA 4ECTA 2RUSA 1FERA 2B3TB 2VFVA 4JI4F 1T02A 4OI3A 4Q2LA 2J6TA 1IBMF 1U6ZA 1TFWA 4DV4J 4RLEA 4PWUA 2HS0A 2ZBCA 5KFNA 4O4GB 2Q1LA 4X65F 3C16A 2UUCJ 2JFKA 2I8EA 1IBLF 3D9BA 2HSEB 4NI2B 4NYPA 2AJ0A 2DY1A 2P9EA 2XY6A 2HZVA 4OHXA 5DQIA 3GQCA 3CDEA 1S0MA 3IAS9 1UW4A 2KL8A 3HSDA 2QC3A 1DY3A 1HHQA 1U8WA 4ZVFA 2CPYA 3ISNC 2NPIA 2BDPA 2DEIA 2GO8A 3E01A 3CD5A 2M70A 1S9EB 2QLXA 1WHWA 4CM0A 2XYGB 4ZCIA 4YDXA 1YGYA 1YKWA 3W2VB 3DN9A 5HI7A 4LRCA 5CYMA 1TVRB 3V81B 2ZZNA 3ZTSA 2LLZA 2QL9B 2RRNA 4LUBA 5DG8A 4AYBD 1NHVA 3MM6B 2XZWA 3CNQP 4AXJA 3SDEA 3WBZA 4MFBA 4ES1A 4B9VA 4Y6IA 4MK8A 2BE7D 3MEDB 4PZVA 2EW9A 1WI8A 2VG6A 3MGJA 4ECVA 4ID5B 2HYIB 4ILRA 2OPRB 1JJCB 4FXWA 2OH2A 5IM0A 2BJ8A 1AUDA 2ASDA 1MU2B 2ILZA 4PWDA 2FC9A 2DGOA 1FK9A 4RW8A 3CMAS 3KG0A 1FJGJ 4DQQA 1S97A 2BR0A 5E3AA 3KHGA 3A3OB 2C2DA 5DS7A 4AQYF 1SJQA 2LDYA 2P6TA 3HXMA 5LM7E 5KFEA 2BXJA 4WK1A 3ZNUA 4RKUC 1PCAA 3EYZA 5IOLA 4X4QA 1ELOA 2VPZB 1YWXA 4IH6A 4KR0B 2VONA 5CQGA 5AXKA 4F4YA 2PA8D 1BQMA 3PW7A 2CKWA 3GR0A 2XMKA 2F9JA 2FY8A 4ECWA 2B0GA 5HJYA 3X3UA 3CE8A 1N6QB 4IO1A 4FBTA 2CQ0A 1NCLA 3NXZA 5KTQA 3OSPA 5KG7A 2FTRA 4DQRA 3GFYA 4PWWA 1JLEB 1VOMA 1RT1A 4EBEA 3A3PB 4FKXA 3BSNA 1J2VA 4U6PA 2MKSA 2AEJA 3LGHA 1RWXB 1JNRB 4ED0A 2M9KA 4OJ3A 1VQYA 4CLLA 3Q89A 2KVIA 4KHPF 2VIHA 4QWDA 3IR5B 4DI6A 2BE9B 1ACMB 2CNNB 4K2XA 4C0BA 2R7VA 2V2VA 3MPVA 1WKKA 1XMOJ 3FZ2A 4O4GA 3BM7A 1BQNB 1QVGR 2X1GA 2VB6A 3F44A 1SJ1A 2VHGA 3ILOA 2C3YA 2MZ1A 2G2ZA 2W2OP 3PJXA 2WRMA 2J8SA 1M5OC 2AGOA 2DNGA 3A13A 1MNEA 4UY85 3TRGA 4OX9J 3US5A 4IKAA 4XK8C 2H5IB 4FDFA 4FZVA 3Q8YA 4DQIA 5HL7Q 1S12A 1DLOB 5IC6B 3IBWA 4YY3F 1S9EA 3BSOA 1JXLA 3MUTP 3O2IA 3H4BA 4RNOA 3VWSA 1Q78A 1TVRA 1ZPWX 4XTTA 3V81A 2BOAA 3H5UA 3TX0A 1L3SA 1BY9A 4JI2F 4ENOA 1XBWA 2Z2ZA 4DFMA 2F63A 5DZ6A 3MM6A 4D3GA 3DM2B 1OPZA 3OL9A 4J9OA 3MEDA 2FYXA 4LFAJ 4C97A 2VKZG 3CUNA 3BJYA 4OZ3A 2E5LF 4ID5A 2OPRA 3R97A 1WC4A 2Z8QA 1D0EA 4JV5F 2RB7A 2ACMA 3QATA 1XNQF 1MU2A 4NXNF 3U1LA 1DBDA 2DR8A 4OHVA 2MXYA 4NMXA 2ZDPA 1LWFB 3QGHA 4CT9A 4DSLA 1S4EA 5GAEU 5IT9Y 3H2UB 3W8GA 4P74A 1B0TA 3CJSA 1RHQB 4DUZJ 4NRUA 4NLGA 3P5BP 1TV6B 3CCLS 2DIUA 2HQ3A 1HIYA 4OQJA 3ILLA 1NDKA 1LWCB 1D8YA 1IBCB 1OPIA 4ZVOB 4KKOB 3OVAA 1A9NB 1U09A 3G71S 1LK7A 1H2TZ 1N88A 1N6QA 3MD3A 1C1CB 2XMTA 3JQKA 1EB0A 3FCWA 4UW2A 3MTKA 2K1RB 1L3VA 5A8KB 2VASA 2UVWA 2DGVA 1JLGB 2R7OA 4J9PA 1N33F 3V6DB 5C25B 4DV3J 2WOMB 1SUQB 3MAQA 1JLEA 3CT9A 4EO8A 1M1KT 1C0TA 1EQMA 3LAMA 3WC2A 4DV7F 2W9BA 3TQEA 4DL3A 3IAM9 5D0HA 3CCTA 3IGVA 2FJAB 1SKWA 3BPSP 3E3XA 3LQVA 1WF1A 2XWXA 1F0XA 1WJ9A 1RTIB 1NKEA 5CABA 2R8KA 1H74A 1HI8A 3DU6A 3VAHA 1KN6A 3F0NA 2HEKA 2HFUA 2DXDA 2LEPA 1NPKA 1BQNA 1ZZNA 3H40A 4DLGA 3KG4A 4N77A 2UU9J 3BGUA 5F8LA 2FQQB 4BC7A 3LPYA 4DU7A 4QWAA 4FBUA 3KK2B 1S6QB 5BYSA 1VQKS 1I51B 3D54A 5HO4A 5HK4A 4JV0A 1FDBA 1KR4A 5B08A 4CLPA 1RYRA 4URSA 4GC6A 1W25A 3ZTPA 3BQ0A 2Y1IA 1YTYA 3W9IA 2MQLA 2OHDA 5D6GA 3HMJG 1WEZA 1TFYA 5H1SV 3CCVS 1HBUB 1DLOA 4QIEA 1HPZB 2V9KA 3VAKA 3AOBA 4EK2A 1NB2A 2KB2A 5KFUA 3DDNA 3GCXP 2I5JB 2HNDB 3DM2A 3BS9A 3AOCA 3HULA 3QIPB 2JC0A 3C6TB 4N8NA 2EG1A 2CQIA 2OPSB 1SKRA 3ET6B 3BQ1A 3M1VB 2HHSA 5E0OA 2BW2A 4YN3B 1LWFA 2L9NA 2DGTA 2P2CB 4ZVPB 1Q81T 3LP2B 4TNOA 2PMZD 2VICA 1NDPA 2N4DA 3B82A 4C3MA 1ZTWA 1RA7A 1X0PA 4ATNA 5F0UA 4IH7A 2G0CA 1R89A 1G2EA 3NGUA 1RTJA 3HJVA 2OTJS 3FEXB 3H0PA 3MOJB 5BXIA 4B9UA 1EP4B 4ZPTR 1XN9A 1VI7A 4DR6J 3KUHA 4M5KA 2BJDA 1GTEA 1YJ9S 4DZ6A 1HYSB 2A3JA 2UVUA 3T41A 1C1CA 4P9SA 2ADCA 3D1QA 4OZJA 1DZ5A 2K1RA 1NJXA 4I0WA 5A8KA 4URGA 2WVFA 3AT1B 3CF5Q 4DQSA 2CG8A 3RAXA 3KJFB 1JLGA 3LGMA 2KXFA 1EETB 2BQUA 5GMDA 3JAMY 4FNHA 2D41A 2M3DA 1SUQA 2WOMA 3R5AA 2OUGA 2HWTA 2GA7A 3MM9A 3HSZA 2MEWA 3MEGA 1DQ9A 2F3JA 3IRXB 3JSRA 3BF4A 1HFEL 5K5MA 1F3VA 2HQIA 4DL6A 2KXHA 1RTIA 4B9SA 4J37A 2HK2A 3G87A 3MI7X 3QLHA 4Q44A 2PIIA 4ZP6A 5DETA 2MY7A 2AX1A 3MR3A 4O3PA 2QEXS 4ZVTB 5JVGQ 3KK2A 2IM2A 1UFLA 1AXQA 3PO4A 4ZVRB 4KTQA 4ZPAA 1NMEB 5LMNJ 1JX4A 4HT7A 4ED5A 2BABA 4WP8A 4P10A 3QIDA 2Z4PA 3ZZ0A 1X4EA 4DPUA 1LV5A 2R9LA 1RKJA 3WX4A 3K17A 2GVZB 2KXNB 1WC3A 4F26A 2FHKA 3OD2A 2DR6A 4JI5F 3MM5B 1HBUA 4UTGA 1HPZA 3M8QB 2VQEF 2J0WA 4ZITA 1Z2ZA 4R8UB 3I56S 4EEYA 2NXCA 3PIPQ 2KG1A 2MHEA 4E8UA 3RBDA 1HNVB 4I69A 4QJVA 4KHMA 2I5JA 2HNDA 1CC8A 2EK6A 3OUYB 1RI7A 4C0OC 2DNKA 5LJ5Y 1H6KX 1U1LA 2OGUA 3I32A 3UD4P 1IN0A 1EJ7L 4DPYA 5M2RA 3C6TA 1S79A 5KFRA 5LXRA 3CTRA 2KYXA 3LP0B 4TKTA 2OPSA 3HX9A 1DARA 3ET6A 4DR5J 3QAEA 3M1VA 5L1LA 4C8OA 5I3UB 2DTJA 2KH9A 7FD1A 3CDWA 2E1AA 4N41A 5KFGA 1REGX 2X1BA 1VCTA 1UVLA 3FDSA 3HDSA 3OTBA 3T9NA 4JI1J 4U7UK 4OZ2A 2C2OB 2YNGB 4WTOB 4ZCLA 2R7RA 1EKRA 1TK8A 5ETMA 5KFKA 2D3UA 4XIUA 1RHKB 1XR7A 3MOZA 2JEFA 1Q8IA 4OZ5A 4X4OA 1T05B 3F56A 2GAGC 2MGZA 2D3ZA 2K7JA 4OJ1A 2Y1JA 4HT5A 4I6YA 1EP4A 1NSAA 5MAOA 1A6LA 2GJIA 3AD7C 3VHQA 4OYMA 1LEOA 2QT7A 2H48B 3ETMA 5HROB 4ED3A 1HYSA 1FESA 2Z2YB 1S5ZA 4LF8J 1R8HA 3VTIA 5KFVA 2HBQB 1N34J 4EI2A 2VQFF 3G8SA 4HHHA 1EETA 4ZCMA 2XMWA 4QWCA 3HZEA 2EFGA 3I9ZA 4OI0A 4ZKAA 1MMLA 5JMNA 2RRBA 2DHGA 4Y28C 3SSQA 1MROA 3PRBA 3D0HE 4AT1B 3IRXA 3PEHA 2HFOA 1HWJA 4PRFA 3OFEA 2HBYB 3GSIA 1VK3A 3RB3A 1XNRJ 1WSVA 2D9OA 2B4UA 1QAJA 2JHEA 4C6AA 4X4TA 2AV5A 3TVZA 4DPTA 1RK8A 1FKPB 3THPA 3CC7S 2CPXA 2VF3A 1T8EA 4EGLA 1WD6A 1FNOA 4GVLA 2QYCA 2CQPA 4ELVA 4USVA 4AL6A 1UZDA 3N0VA 4UUWA 2AGPA 1T3NA 1S4FA 4DG1B 3DXSX 5AE1A 4UT4A 3HVAA 1NJZA 3M6XA 3K7RA 1U0SA 3CPWR 1BC6A 3OTOF 2GVZA 3GZ7A 4B3TJ 3CCWA 3ZZZA 4C2MA 5LJ3Y 3M8QA 3R5BA 1QAIA 3G6VA 5IWAJ 5AXNA 4EZ9A 3MFIA 2XLIA 4R8UA 1CJKB 1HNZF 1HNXJ 3TR5A 2HVHA 1GMWD 4KY3A 2FZKB 1FRXA 3UN5A 1RWKB 1K44A 1HNVA 3TJ8A 1FEHA 4I4BA 1MMDA 2CQBA 1Y00A 3OUYA 3TA0A 5L9NA 1OIAA 2DHSA 4X62F 3CO9A 4LVNP 3D7SB 3OFFA 2LA6A 1SJRA 3LP0A 1PG5B 4A8QA 1SXLA 2AGQA 1H7WA 5A6PA 3C46A 5IT4A 9RUBA 1GH8A 3D1HA 5HJXA 5H9EJ 1QSLA 2I1RA 3PRDA 1FX2A 3SI8A 3O8WA 5I3UA 4Z7YA 2HZAA 2DT9A 1H38A 3QRPA 3L09A 3KLEB 4OZ1A 1RT7B 2YNGA 2B7BB 4JUZA 4RNMA 2VFUA 1U1RA 1T05A 4MTPA 2CPEA 4B9LA 1RGVA 2WB4A 1VHFA 2EC2A 4C8ZA 1RQ0A 4KBIA 1TL4A 2AYGA 4F0KA 5LXYA 2WVCA 4HTIA 5A76A 1K0TA 5HLFB 1TR0A 5HROA 1BWVA 2M2BA 1S1TB 4DSEA 1UAWA 1QAYA 1UL3A 5FJ4A 2DISA 3UCGA 2VFTA 2J5AA 3EGZA 2YWWA 5A2QU 4OX7A 4B3RJ 3PW2A 3O5TB 3HF5A 3VAGA 1S59A 2HHHJ 3FFIA 2ZBQA 1Q8LA 5IFMA 5DG9A 1FNMA 3V4MA 4EYHB 2EEYA 2BACA 2BANB 2AYBA 4O4RA 3DLBA 2OEMA 2ZJRQ 3IMQJ 4TYBA 2CQCA 1VHIA 2VBZA 4L74A 4LQ3A 2RU3A 3W3SA 3GIJA 3T1YJ 1IM6A 4LBHA 1FKPA 3L7UA 1CPZA 3Q8RB 4DFJA 1S9FA 1TUWA 5ETQA 2B51A 1RWMB 1X9MA 2GJ2A 1UJ6A 1P1TA 3DGPB 5G4DA 2EBEA 4P72A 4WKYA 3CW2C 2HFZA 2R7XA 1ITPA 1EKSA 1WC5A 3L3CA 5B0BA 2JX2A 1FKOA 2XLKA 3RB4A 2LQJA 1PIEA 3UD5A 1QD1A 5KOXA 2L48A 4GO7X 1VGYA 4P2XA 4F36A 3H98A 4HHUA 4EBCA 4CRJA 2YKNB 3QGIA 4LSZB 3B54A 3OW2R 2RS2A 4RZRA 2ASLA 1TMJA 1Y5IB 5CCLA 2IC3B 2GIRA 1F60B 1MW7A 1H73A 2BJ9A 5FD1A 4PAAA 2ZE2B 2V2KA 3POTB 4FN5A 3H2LA 1NNDA 3IWLA 3OPKA 4NEZA 2ATLA 4LRFA 4LQ9A 3KJQB 2XLJA 1SC4B 2CJKA 5HMYA 2PI4A 2LQ8A 2XNQA 3QJPA 4G1QB 1WF0A 3TUJC 3AJ1A 3QPIA 2LYVA 3KLEA 3TUZC 1YBTA 4GKKJ 1RT7A 1NSPA 1V3ZA 2CAJA 3NY0A 1RP5A 2J7UA 3G6ES 2C2NA 4WE1B 4C8MA 2W2MP 2L08A 1U26A 2A10A 1VJQA 3R27A 2QA4G 4CO5A 4F4AA 2WTFA 1HR0F 4X66J 2ZOGA 2C22A 4ECZA 5HLFA 2WVBA 1S1TA 2UZAA 5KFQA 3CJKB 2G2YA 3MMJA 5KG6A 4KO0B 2A6OA 3TAMB 3GV5B 1HBNB 4X64F 5DJBA 3N6LA 4GC7A 2W4DA 1TQLA 4ZPWR 2MKHA 5E3CA 4Z37A 3CMES 1F6TA 4OMFG 3S1TA 2BANA 1HBOB 3NOCA 4F4KA 3W66A 1S77D 2F1FA 3M8RA 3R5GA 1Y5NB 5EN1A 4FYYB 4L73A 1CJVB 2XYPB 4LVOP 3EDQB 5C5JA 4ED2A 2Y8YA 4ZVQB 2IA0A 3JSYA 3K8VA 3JXOA 3BSCA 4DV4F 3S6EA 4YHHF 4DL4A 3D0IE 1KD1T 4UOGA 4X4VA 2ZD1B 4F2RA 3Q86A 4A46A 4KFBB 1LXNA 3DGPA 1U4BA 2YX7A 3BKUA 3HHLD 4FKYA 4JV2A 3NL0A 2RIJA 1DQAA 4J91A 1DAXA 1MWYA 2J7KA 3THVA 4B3MJ 3PR4A 3RTVA 3R7SB 1ROFA 2W9CB 4QWBA 2W2NP 3FSXA 5C2CA 3Q8QB 3I9V9 5ETLA 1X5PA 4YB7A 1FTCA 3BSAA 3FSYA 2SXLA 1FRMA 1I94F 1YJUA 3J7A1 2YKNA 2AMCB 3EVOA 4MKVA 1LW0B 1S1XB 2IC3A 4LF1A 5T41A 3DLEB 4MH8A 4RJVA 1S48A 8ATCB 3FSIA 4L3KA 1GT8A 2MHNA 2J6SA 3DYAB 4ZMMA 2VFRA 3POTA 2QLFB 2IJRA 1S6OA 1OMSA 3M8ZA 4CIOA 3H5YA 4I64A 4PCQA 1RA6A 1VYAA 2EPIA 3ZC4A 2A1BA 4QBUA 2C2RA 3AQOA 5CA5A 2P9CA 2W4CA 2PE8A 1BD6A 4K59A 1B3TA 1CJUB 1WG4A 3N6NA 1V5IB 3PYGA 3QGGA 2G13A 1R8BA 3IWNC 1Q82T 1WELA 1FRLA 1K8AT 1OY6A 3I5AA 4WE1A 4LRDA 4X4UA 3DLKB 3JB9k 1FJGF 1IXKA 4JI7F 2L41A 4ZVUB 2DGXA 3VAFA 2BJ1A 3TAPA 1NAQA 3BR8A 4YB1P 3H59A 4PG5A 3CJKA 4G6VB 4YEAA 4KO0A 3TAMA 1TUVA 1HBNA 2HWHA 2Z2MA 1NRKA 4KB7A 1MN7A 1V9OA 2FIUA 2PN6A 2RNEA 5D4PA 1F5BA 4YQWA 2RU9A 5B0CA 4HL9A 1U2FA 3RB0A 1DHMA 1RCOB 5CZVA 4ID8A 2AJ1A 3NS5A 2E1CA 1S1UB 1IVZA 1VQ4S 4DF8A 1R8CA 1F5AA 2DCUB 2QIFA 3LWMA 1HBOA 4DX7A 2DYAA 1OQ3A 4Y00A 3KTQA 2CJ9A 2GMLA 3MM7B 5EX0A 4KH1B 3EGNA 3B4DA 3CC4S 2XY7A 4KIAA 4WFAQ 1W2IA 4PYDA 5KT4A 3U27A 4FPIA 1B7YB 5KFWA 2E5JA 5IV4A 4CYUB 2YWFA 4KGXB 5HAOA 3V4IB 1YHQS 3TNVA 4WK3A 2JEJA 3WX8A 2AF6A 2ZD1A 4WU2A 4KFBA 1XMOF 3IR7B 3MCSA 3GFXA 1SQGA 1UVMA 2QLWA 5E7OB 4F25A 4DV2J 3D1OA 4ZLJA 2G1HA 4K4UA 3DHWC 1FHTA 1XR5A 2FLPA 1U1PA 5RUBA 5KFTA 2F7VA 4UQGA 2W9CA 3CDUA 1MN9A 1RBOB 4OX9F 2UXDJ 2DXEA 2EXUA 5DGBA 4KT0C 3UFCX 2ZWPA 1JIHA 3EMTA 2GW8A 4DCOB 2LP4A 4OI1A 2RQMA 1LW0A 1S1XA 4V19X 3PM9A 2QGFB 2RKIB 3DLEA 5F3TA 1OWXA 4LJMA 1F2HA 3DYAA 5F8MA 1KSPA 2C2MB 2XC9A 1L3KA 2YQ1A 3GJRB 3A12A 5KG4A 3GP9A 3SXLA 4O44B 1UFWA 1XMBA 2EFOA 4TU8A 1RAAB 4AL7A 3W1YC 4DDFA 1CJUA 3M8PB 1T03B 4ES2A 4LR7A 2DK2A 3TVYA 4HACB 1YRTA 3DHXA 4IH5A 4WIQA 3JSBA 5JVHQ 3LUYA 3N5BA 1QAXA 2YKOA 2E1RA 1SH3A 2NQPA 1FD2A 2WBMA 4DV6F 1S76D 4RL1A 4DFPA 1Y4ZB 4CLFA 1RT4B 1KLMB 4YUDA 4IRCA 2VC1A 2FLNA 1PC4A 2CPDA 3QMQA 5KG0A 3LA0A 1N0UA 2JL9A 2J0SD 1JKHB 1NK5A 2YNIB 5L38A 4CLTA 3J7Z5 3RB6A 1B0PA 1WOSA 1VIXA 3J7AN 3K89A 2JH3A 2FJWA 2WAQD 1S1UA 4A8KA 4KGKA 4NE9C 2V67A 2ZHOA 2OJ3A 4DV3F 4K4YA 3NWRA 1SKUB 3GJSB 3MPYA 1H3DA 3MM7A 2ADBA 1CC7A 3UVJB 1IKYA 2H9ZA 1VMBA 4USIA 1R0CB 2FJXA 3NG8A 4UOHA 2Q43A 4W98A 4HDHA 3WQPA 2IHR1 4ZP9A 3BBBA 1R27B 5J2QA 2RH3A 3PKMA 2ZH6A 1SH0A 2KHDA 2MLZA 4CYUA 3MR2A 1QE1A 4NRTA 1HNWJ 2K06A 4OYBA 2VDHA 3V4IA 3R5JB 2XSFA 1N32J 5IS2A 2ZBIA 1MG7A 2VBYA 5H9FK 2WB1D 1U49A 1SQFA 1AUSL 2CRLA 2UU9F 2JWNA 1FDDA 3MM8B 1U02A 2AT1B 2J9DE 1PO6A 3RBXA 1IUJA 1KOOA 3FRZA 1FDNA 2LA4A 4DV1J 4P2SA 2IRXA 2Q79A 1RTHB 3BZQA 3BREA 1F3FA 1CS4A 3J7ZT 2UUAJ 5L46A 5SUHA 1RBLA 4WFYA 1OYEA 2OELA 3A1YG 2ZFHA 2RKIA 3TWZA 3BKTA 1ZOTA 4NCGB 2R2TA 1FJCA 3LH2S 4LF4J 4Y3CA 3SFGA 2BM0A 5HVHA 3I0SB 3PCOB 4NCAA 2IM1A 4ED6A 2ZUGA 3GWCA 4K2JA 2DIVA 3TQ1A 1Q53A 4O44A 3TEGA 3RUBL 1WDDA 3BDPA 4LSLA 2HIYA 2DNRA 4DR2J 4H4KA 3Q8UA 3M8PA 1T03A 1EARA 4Y2MA 2FY1A 4DR7J 4HACA 3FQLA 4E2FB 2R2UA 2CDRB 3M05A 4JI0J 2DH9A 4LF7J 1KONA 4YS2A 4NXMJ 1FT8A 5DGAA 4K50A 4KPYA 1RT4A 2R4FA 5J2PB 1KLMA 3CJRA 1FD8A 2AYMA 1XQIA 4CH7A 4DF4A 3PFEA 2H3EB 1QUVA 3ZZYA 4HI1A 2H4WB 3SMZA 3T1AA 4DR6F 1JKHA 5B0AA 2YNIA 4DR3J 3F73A 1X31C 3GSDA 3BYRA 4CLWA 3JYTB 3CCMS 5BR8F 2A18A 3BO3A 3P5TL 1S57A 1H2VZ 3KJVB 3HHLC 2VV5A 3V2UC 3M9MB 1M5KC 4F50A 2DR9A 3MZIA 1M0SA 4NLVA 1FXRA 1UCNA 4MMOA 4ZLPA 1D9AA 4C8NA 2B56A 5AJ3J 2KFYA 4HHJA 3QQCD 3IO1A 1ZPVA 1UJ4A 2UUBF 3LGNA 3UVJA 4EYIB 3QNWB 5E5NA 3S7RA 3TZWA 3ZO7A 1KKHA 4OX8A 1X4HA 2X3GA 3R5CA 2C1EB 2CJAA 3IG1B 4MYUA 4K4SA 4ITSA 1YDLA 2UVVA 2VC0A 1HD0A 2CPZA 4ZJOA 1VRTB 1SV5A 1D3WA 2CJBA 4I1TA 1XTZA 4UF4A 2XO7A 3MM8A 3WC0A 3QRRA 2HQFA 5FLXU 2MZJA 3M2RB 4Y0FA 4HEA9 4ECSA 2GVDB 5IT0A 5LMNF 1TKZB 2NS1B 3MCNA 4BBYA 1C4AA 3W7BA
chains in the Genus database with same CATH topology
1GTEA 4RWXA 3I4PA 1YJ9S 1RTHA 1X0FA 5LSOA 2Y0SD 1HYSB 2A3JA 3HZGA 2UVUA 2EVZA 2EFQA 1C1CA 1KQKA 5KFOA 2ADCA 1O8BA 3T1HF 3QO9A 2CPHA 3NWGA 3D1QA 4OZJA 3DNCA 2NXUA 2Z0GA 1DZ5A 2K1RA 5E41A 3PW5A 4I0WA 1NJXA 2VA3A 4NCBA 5A8KA 4URGA 2OPPB 2WK4A 3PY8A 3CF5Q 2E7WA 2DO4A 4DQSA 4IR9A 2D9PA 2UUTA 4DR4F 4DV5F 4NCGA 3RAXA 1MSWD 1JLGA 5F9LA 3LGMA 2KXFA 1EETB 2BQUA 1E6VA 1SL0A 3CCES 2XULA 4FNHA 2IYIA 3JAMY 4A8MP 2OPQA 4LMZA 2O66A 2D41A 2R7SA 1GX5A 3FZBA 2M3DA 1SUQA 1Y3JA 2WOMA 2F40A 3R5AA 4TXSA 4ECXA 4NLWA 1WWHA 2HWTA 2GA7A 3EZ5A 1RT5B 1WHVA 3I0SA 3MM9A 1YG0A 1Q8BA 2W9AA 3SCKE 1QSYA 2VH7A 1FTRA 3MECB 4DL0C 1C1BB 3UCZP 2LKZA 3MEGA 3N5FA 3RW6A 1DQ9A 4CH1A 2F3JA 5KOWA 1TL5A 5KFSA 3TA2A 3IRXB 2XCAA 7FDRA 4PXDA 2IMWP 2CPFA 1X5SA 2OFGX 4RNFA 2KZMA 2JJ4D 2ZHBA 4X2BA 3JSRA 5D4OA 3BF4A 5AE3A 5L1KA 4OZ0A 3D5MA 4NLRA 2XNRA 1HFEL 1HHTP 3NNAA 5K5MA 5KG2A 1RT3B 1KTQA 2HQIA 2CPIA 2GQCA 3E51A 4DG1A 3MR5A 4DL6A 3NS6A 1H2UX 2KXHA 3K5OA 1RTIA 1TKTB 3N79A 3U7JA 5KFZA 5M2PA 1LW2A 1U7LA 4PQUB 4IDKB 4B9SA 4DR5F 4J37A 1CSJA 3HHNB 4ZP7A 1ZM4A 5E2QA 1QLNA 4FXVA 3MI7X 3QLHA 4Q44A 2W7PA 1RDRA 3PR5B 1C0TB 5K8PA 2RDJA 4YP3A 2V4QA 2E5GA 2PIIA 4RW4A 1NKBA 2B6AB 4ZP6A 2DO0A 2R7QA 3HVRA 5DETA 3AAWB 4I2QA 2MY7A 1HQUB 1H0HB 2AX1A 2ZC4A 2W9BB 4KRWA 3MR3A 2FJEB 4X66F 1D9DA 4O3PA 2QEXS 2DNMA 4DS4A 1VQ6S 1SB6A 1UWBB 2YVSA 4ETXA 4LF5F 4KHRA 5JVGQ 3KK2A 2IM2A 3O6QA 1UFLA 2EKYA 1MWZA 1AXQA 4QZVB 3PO4A 2XBPA 4KTQA 4ZPAA 4RNNA 4LSLB 5CH7B 4PXBA 1VBXA 4IOAQ 1RAJA 5J2PA 1JX4A 4HT7A 1PGZA 4ED5A 2YWKA 2BABA 2PC6A 1NU4A 3VALA 3DOLB 3QIDA 5KFHA 5CYQA 2Z4PA 3ZZ0A 1X9WA 1X4EA 2ZH5A 3H25A 4WXWA 2LQBA 1LV5A 2R9LA 1RKJA 2KZZA 3WX4A 4FS2A 1Z4UA 2IBOA 2UP1A 4NLDA 3TANA 2KJWA 5T14A 3J81Y 2KXNB 3JSMA 2FC8A 4OL8A 4F26A 2MQQA 2FHKA 1FDAA 3EXCX 3I0RA 3P96A 5KFPA 4JI5F 2YNFB 3RW7A 1S0OA 5F8NA 2V94A 1M5VC 3MM5B 1HBUA 4ZPCA 3RRHA 2UXCF 3JTNA 1HPZA 3M8QB 2VQEF 4CNZA 4EFAC 3JYTA 3M30B 4M95A 4QPXA 3MEEB 1VJWA 3P49B 2JVRA 1AROP 2J0WA 1Z2ZA 4M63A 4CT8A 4R8UB 4X4NA 1J5EF 2B7CB 3I56S 4EEYA 3KJVA 4F3MA 4DEZA 3KNAA 1F9FA 5EX3A 3FMWA 5DDQC 3NBPB 2DNLA 3PIPQ 5KFDA 1LWEA 2KG1A 1K1QA 2XSJB 4BWMA 2W8LA 4HH0A 3RZAA 1N34F 2MHEA 4BC9A 3T5HA 4DMZA 4E8UA 3BB5A 1QVFR 5EGYA 3RBDA 2ZNZA 1K0VA 1HNVB 1X5OA 2O3DA 4I69A 4I7FB 1NK0A 2RF2A 4QJVA 4DL5A 2GHWA 4KHMA 2DNOA 2I5JA 2HNDA 4QPTA 2R7WA 1CC8A 1WEXA 4IOBA 2EK6A 1KS2A 3OUYB 2XS2A 3PKYA 1RI7A 1ZAVA 4C0OC 2YKAA 2DNKA 5LJ5Y 2L9WA 3GYNA 1H6KX 1U1LA 4WXOA 3I32A 3C66A 3I5CA 4IG3A 3UD4P 1IN0A 2NZ4A 5M2RA 3C6TA 5D77A 1JLCA 1S79A 5KFRA 3G9CA 5LXRA 3CTRA 2P9GA 2KYXA 4N47A 3LP0B 4TKTA 1I6JA 2OPSA 3HX9A 4ECRA 3MPWA 1DARA 3BGRA 4J5OA 3T5JA 2HG4A 2RQKA 3IG1A 4L72B 5IQQA 2LEAA 4NYZA 2KFZA 3QAEA 3M1VA 4LIRA 1OQ6A 5L1LA 3T6BA 4IOCQ 4I2PB 1Q79A 3UI3A 1ZM3A 4A8OA 4C8OA 3MAHA 5EHHA 4K4XA 5I3UB 2DGUA 2DTJA 4Q7AA 2KH9A 7FD1A 3IXQA 3CDWA 2E1AA 3KK3A 4MAKA 4DN0A 1IKVB 2AW0A 4N41A 1VQNS 2M5YA 5GAHI 3CXCR 2DNYA 2XI3A 5KFGA 4TU9A 2X1BA 1XNRF 1UVLA 2CIMA 2B4OA 3FDSA 4EZ6A 1B7FA 3HDSA 3K5LA 3OTBA 3T9NA 4X4RA 1XERA 2FHMA 2ERRA 3R5DA 3GYXB 1TKDA 1NJIT 4U7UK 4NA1A 4A8WA 1GAOA 2IVMA 1FRHA 2YNGB 2WW8A 4IR1A 3Q2TC 4ZCLA 3FEZA 2R7RA 3RYLA 4D3HA 2R8JA 1TK8A 1SKSA 5KFKA 2D3UA 1Y9OA 4XIUA 2DGQA 1XR7A 4B3MF 4B02A 5J2MA 3GFZA 5FDLA 3C6UB 3OXLA 2HHTA 1R43A 1QTMA 3MOZA 2JEFA 3VF0B 4YR0A 1Q8IA 4OZ5A 2GCFA 5HMXA 4X4OA 1T05B 1ZH5A 3F56A 5HQ8A 2V4RA 4IYQA 5DO2A 4YR3A 1S9GB 2MGZA 1HL6A 4J9NA 4PG8A 4DJBA 2LXIA 1UA1A 1KNZA 3GIKA 3M2RA 2D3ZA 2K7JA 3FJ2A 2R8IA 4OJ1A 4A4JA 4IFYB 1S99A 2MSSA 3SFUA 2Y1JA 3OQ2A 4HT5A 2C28A 1TKZA 1WF2A 1N4LA 1JB0C 4I6YA 4NLSA 4N56A 2R7TA 4K4ZA 1EP4A 2YWGA 2Q6BA 1WTBA 3QZ8A 3KK1B 5MAOA 1Q4RA 4JI3F 2XY5A 1A6LA 1SV5B 2KG0A 4PUOB 1R0AA 4LFBF 5T7LB 3OJSA 2BBEA 2GJIA 2XMJA 4DN9A 3G6XA 2VA2A 2QT7A 2LDIA 4C8KA 1JLAB 5HROB 4ED3A 1HYSA 1FESA 1X5TA 3I96A 5D3GB 6FD1A 2EWHA 4B3TF 1CG2A 3UD3P 4Q5VA 4CH0S 1R8HA 3DRRB 3OR2B 3VTIA 3MR6A 5KFVA 3AHPA 2OSQA 3R1LA 2YTCA 1N52B 2MQNA 3MF5A 1LFPA 1N54B 1KQFB 2CZ4A 1OS5A 3LW5C 1VC0A 2DGWA 2VQFF 4H54A 4R5PB 2OPPA 2OIHA 3G8SA 3SV4A 1RTJB 5IWAF 4PG7A 4DSJA 3SSSA 2FB0A 4C8LA 4XAKA 1EETA 1W2BR 2LCWA 4ZCMA 2YWHA 3CCRS 1WHYA 2M4MA 4UY8T 3IS9B 2XMWA 2G1DA 2AJ4A 1N0VC 4QWCA 3HZEA 2FHJD 4FVCA 4JI6F 3TO8A 2EFGA 3F41A 2FJDB 2JSXA 4CO2A 2CVEA 3ENVA 3I9ZA 1RT5A 1D9FA 5KG5A 4MKYA 2D74B 5EWGA 1UEUA 4QOTA 4OI0A 2QSWA 4Y2AA 2EFVA 5BYRA 4ZKAA 1HWIA 1MMLA 2RRBA 1C1BA 2DHGA 2WSEC 4L6V3 4Y28C 4DHVA 2HHUA 5AE2A 3SSQA 2NR0A 4TQRA 2MZRA 3N28A 1MROA 3OR1B 2PGCA 5LSLA 1BGXT 2NSBA 1IQZA 3D0HE 2WONB 3IRXA 3PRBA 4YFUA 1NK8A 3VAMA 1FA0A 4WF9Q 5KFIA 2C3UA 2IJNA 3PEHA 2HFOA 1HWJA 4QR2A 1VQ8S 4LFCF 4NZ7A 4YOEA 2VG5B 1JLFB 4PQAA 3HVTB 2C3PA 2JC1A 5I3QA 4PRFA 5DM6Q 2DJWA 5GVQA 3DLLQ 4C0HA 2RQCA 2V8VA 3OFEA 2DITA 1RT3A 3TX8A 3Q23A 2DR5A 3H5XA 3P3DA 3GG0A 1Y3KA 1TKTA 2WHOA 1KVIA 1VK3A 3RB3A 4IDKA 4DWIA 2LQ9A 1F5CA 2L9DA 2OPQB 2D9OA 2FVCA 1YVFA 2B4UA 2KDOA 4ZCKA 4YR2A 1QAJA 4TY9A 2JHEA 4A8YA 2K7KA 4X4TA 2UUCF 2AV5A 2JLGA 3NAHA 2KRRA 3TVZA 3MM9B 3CJ0A 4RBUA 1RK8A 4G1PA 1R6YA 1FKPB 3THPA 2R8HA 3CC7S 2B6AA 3FNNA 5KFBA 1YJVA 3MEGB 2CPXA 3TOQA 3IWXA 3NLCA 3GIMA 1HQUA 1T8EA 4EGLA 1WD6A 3ISND 4FF3A 3T6JA 2I2YA 1AW0A 1FNOA 1R8PA 3DDKA 1ZAXA 2QYCA 3CD7A 2CQPA 2HMIB 2N7YA 4ELVA 4WCEQ 1UWBA 4AL6A 3LF0A 2CQ3A 3N0VA 4RX6A 2RRAA 2QO3A 1SIZA 1V3SA 4UUWA 2AGPA 1T3NA 3B8HA 3BGLA 2GMHA 1JXEA 1S4FA 5I4MA 2R7UA 4OHZA 2RE1A 1DQ8A 4FF1A 2HGLA 2DRBA 4DG1B 3PJWA 1ZM9A 2MKCA 3DXSX 4KQZA 5AE1A 1CVJA 4QIWD 3HVAA 3CVKA 1NJZA 3PEJA 3M6XA 2N3LA 3MTJA 5HMWA 3B78A 6FDRA 2B5JB 3K7RA 3DOLA 3CPWR 4JBCA 2ZH9A 1BC6A 3QLHB 4OHWA 3OTOF 1NZAA 3GZ7A 1VQOS 2DHAA 1VQLS 4P7VA 4WYWA 2DPJA 2CZVC 2KT2A 3DMJB 3CCWA 2YNFA 2QFJA 3LALA 4MIAA 1FXDA 3ZZZA 1WTFA 3M9NB 3OLBA 4C2MA 1D8ZA 2UVRA 2MPUA 1WHXA 2LVWA 3NNHA 5LJ3Y 3M8QA 3ONQA 3LANA 3R5BA 2V8DA 2B9YA 2ZE2A 3M30A 4H4KC 1WG5A 4AXIA 3G6VA 1QAIA 3MEEA 2GQ2A 5AXNA 4EZ9A 3MFIA 2XLIA 4R8UA 3OSNA 1N5TA 2G9OA 2HGNA 1HNZF 1S6PB 1H7XA 2PO4A 3CJ3A 1L5UA 3NBPA 3TR5A 2LECA 3RAQA 5KT7A 2IRYA 2XSJA 2HVHA 3L7PA 3UR3C 3EPIA 2B9WA 4J9QA 1FRXA 1VC5A 3UE2A 5IQ6A 2OMOA 3PV8A 4Q2MA 2QA4S 4ZVEA 3BQ2A 1HNVA 4I7FA 2E9RX 4OI6A 4G1QA 3O3LA 5EDWA 1XWLA 1FEHA 3ENQA 4I4BA 1MMDA 2CQBA 1Y00A 4GMKA 3OUYA 3RU0A 3TA0A 1UEVA 1OIAA 5L9NA 2DHSA 1BQXA 3I0RB 3CO9A 3DRSB 4LVNP 4X62F 3OTDA 2FVSA 3M8SA 4IO9Q 1Z1ZA 5ADZA 1S0VA 1R31A 5K14B 1X4CA 2GV1A 5KAKA 1X4AA 2OMLA 3OFFA 4U67Q 2W4PA 1H98A 4DSIA 3CJ4A 3H20A 1K9MT 2LA6A 4WFZA 1SJRA 4YB6A 3MMAB 3MFHA 2HW3A 3LP0A 3ULHA 4A8QA 1SXLA 2HHPA 2AGQA 1H7WA 2GHVC 5A6PA 3C46A 3GR1A 3M6VA 5IT4A 2R2SA 3EX7B 3D1HA 3G96A 1APSA 1GH8A 5H9EJ 4FF4A 5CXTA 3HI9A 1C0UB 1QSLA 2I1RA 5THWA 4I2PA 3PRDA 3SI8A 1U45A 5F8JA 2MKKA 3GB0A 2GX8A 3EXYA 3O8WA 1XMQF 3MMCA 3PACA 5I3UA 1IM4A 3AB4B 2DNHA 1U48A 4F4XA 4IFVB 1IKVA 3N01A 1R3NA 2YY3A 2DT9A 1FXLA 1H38A 3L09A 2KO1A 2X1FA 1U6BA 4ZS6A 2VPYB 5F8GA 3KLEB 4IUFA 3AB2B 2IFXA 2HRUA 4NYOA 5HMZA 1FO1A 4FNIA 1VC6A 1K73T 4OZ1A 1RT7B 2QMWA 5AXLA 4CQ1A 2YNGA 1UETA 2B7BB 3S01A 2JDJA 4JUZA 3SQGB 2X51A 4RNMA 3BGFA 2VFUA 4N