2KT2A

Structure of nmera, the n-terminal hma domain of tn501 mercuric reductase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAIVPGTSPDALTAAVAGLGYKATLADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mercuric reductase
publication title NmerA of Tn501 mercuric ion reductase: structural modulation of the pKa values of the metal binding cysteine thiols.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 14
structure length 69
sequence length 69
ec nomenclature ec 1.16.1.1: Mercury(II) reductase.
pdb deposition date 2010-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kt2A00
1QUPA 2PD1A 2AJ1A 3TOQA 3CJKB 5IXUA 1YRXA 1N5VA 2KYZA 3BN7A 1OQ3A 1SQEA 4A4JA 4F67A 4U9RA 3BB5A 1GXTA 2LXFA 3E8OA 1LQ9A 2RU9A 2OFGX 5A6PA 4DPOA 1Y9OA 3QMQA 2W4PA 1AW0A 1VQYA 1YJUA 1KVIA 1YJRA 4Q2MA 2AW0A 3LGNA 5B0BA 1U7LA 1N5QA 2HFOA 2BUNA 2K7JA 1ULRA 2IFXA 3LGMA 1IUJA 3CJKA 1MWYA 4YEAA 1AFIA 3HHLA 1Q8LA 2N7YA 3HDSA 3BR8A 4Y2MA 5T7LB 4OJGA 1Y3KA 1N5TA 2HQIA 2KT3A 2OP5A 3UDCA 1MWZA 1YJTA 2ROPA 5B0CA 2OKQA 1FE0A 2RILA 2W4CA 3TNVA 4ZA1A 2GCFA 3BF4A 4FNIA 1XBWA 4HH1A 3HHLD 4NPOA 4EFAC 2GV1A 1Y3JA 4HI1A 2OD6A 4A46A 1FE4A 2ZDOA 3HX9A 1JK9B 1CC8A 1KQKA 5KAKA 5K9FA 1FEEA 1CC7A 2LQ9A 2KT2A 1P8GA 2ACYA 1TUVA 4OJHA 1OQ6A 2XMTA 2OFHX 2GGPB 4HI2A 2K1RB 3FRYA 5T7LA 5B0DA 1K0VA 2EW9A 3KG0A 2FTRA 2GO8A 3DXSX 4FNHA 3FMBA 2OAUA 1X7VA 1YJVA 3BGUA 4NL5A 3VTIA 1KVJA 1FVSA 2PGCA 2ROGA 2W4DA 1R6YA 3MCSA 1TR0A 4OIXA 3KNGA 1TL4A 2QLWA 3T9NA 1SI9A 3KG1A 1VQSA 4HH0A 5B0EA 5A6WA 3LO3A 2BBEA 2GA7A 4DL0C 1CPZA 1AFJA 2XMMA 1TL5A 5B08A 2XMKA 5B0AA 2ROEA 2FB0A 2K1RA 2BJEA 4Q2LA 4ZOSA 1W2IA 1N5SA 1URRA 1WD6A 2RMLA 2XMUA 2BYCA 4Y2KA 3QGPA 2KKHA 3HHLC 1Q8BA 3IWLA 1S6OA 1Q53A 1JWWA 3DCAA 4HL9A 1Q4RA 2AJ0A 1FVQA 4Y2IA 4DN9A 4QOTA 1TZ0A 1GXUA 5B0FA 2VV5A 4A48A 4A47A 3BDEA 4OJ3A 5B0GA 3IWXA 1APSA 1SB6A 1P6TA 5B09A 2AP6A 2OD4A 3HHLB 2ASYA 1YG0A 2LDIA 1Y0HA 3BM7A 2XMWA 4YDXA 2IYGA 2QLXA 2ZDPA 2HIQA 2CRLA 2QYCA 3FGVA 2N4CA 1FESA 2GFFA 2K7KA 5F0UA 2RSQA 2XMJA 3WDOA 2GGPA 3HFKA 1FD8A 5F0WA 2LQBA 1OSDA 1OPZA 3HF5A 2FHMA 2G9OA 3F44A 3TRGA 2XMVA 2OMOA 2N4DA 2HLTA 2VH7A 3GZ7A 1X0PA 2FIUA 2HLUA 4OJ1A 1X8DA 2HFNA 1S6UA 2BJDA 3MZIA 2K2PA 2L3MA 2Q3PA 1V3ZA 2IYIA 3I9ZA 3KKFA 2QIFA 2JDJA 1RJJA 3K7RA
chains in the Genus database with same CATH superfamily
1WORA 1LWFA 4AL6A 2AKWB 4JI5J 4DSFA 2F7VA 1AXQA 4RR5A 4FYVB 2QV6A 2ZHOA 4C3MA 1OWXA 1UVJA 1IKVA 4MFBB 3PYDA 1K9MT 2KVIA 1F3VA 3SCJE 2WSCC 3DHXA 4KKOA 1HNXJ 3NL0A 1IN0A 3A12A 2OEJA 2H5EA 1URNA 1LWEB 1TUWA 4QYRA 1FVSA 5CD4H 4KFBB 1EP4A 3AA8A 3MD3A 4X4OA 2EKYA 1QY7A 4XDDA 2WHOA 4DCPB 4N5SA 3WBZA 1UJ6A 1NJXA 3PW2A 1GXUA 2UVUA 3DN9A 5HP1A 2CRLA 1U1QA 1VQ6S 3UWTA 4CTAB 2NZCA 2A3JA 2NYHA 1OPZA 4X62F 4OZ1A 3K17A 4DFMA 1QD1A 3Q8VA 3D6TB 3I32A 4QQBA 3BQ1A 4DR1F 2DNHA 3I4PA 2DYAA 3MGJA 2VA2A 3C19A 4U9RA 3NGTA 5IOLA 2DJWA 1R6VA 3UR0A 3KJNB 2VHGA 1F3FA 3IM8A 3K0JA 2BX6A 3I0SB 3DLKA 3AB2B 3T1HF 3FSYA 1OPIA 5E3QA 2V2ZA 3UR3C 5LMNJ 2CNLB 1JLAB 1NH8A 1FK9B 1G7CB 2P8IA 3AXKA 5K9FA 1SV5B 4JI2F 1SH3A 2GQQA 1RAOA 5LXYA 2FHOB 3R1HA 1U2FA 3M6XA 2LFVA 3MMJA 1PG5B 4J90A 1UW9A 3BV8A 4ZJLA 2BJEA 2IAJB 2R7OA 2ZUGA 1NDCA 4CRJA 3M05A 5ADZA 2FQQB 1RISA 1FRKA 3MMAA 3MEDA 3TYTA 4LREA 1E6VA 1U45A 4NYPA 1FESA 3G71S 4ED3A 3LPEA 4IO1A 2DHGA 1RABB 5IWAJ 4DX5A 3GB0A 2JC1A 4C97A 2CQ3A 2XLIA 3R6LB 4U96A 4DN0A 6FDRA 2NS1B 4IUFA 4OLPA 2UZAA 4TLQA 5ETTA 3N6LA 5HQ8A 1YJRA 2V8VA 4PWWA 3IN5A 3NMAA 2HG4A 1UWAA 1RHMB 5HBMB 3GFXA 3VGUA 1SC4B 1BMQB 5A0YA 1V6HA 4HHJA 2ZZNA 3D54A 4U8VA 2WOMA 3N79A 1FRXA 4MH8A 1S1UA 2K1RB 3R7BB 5EN1A 5KFPA 3LA0A 4IFYB 4J9SA 2F8MA 2RDIA 1RT2B 3GG1A 2K06A 1AT1B 2DR9A 1Y5LB 2AJ4A 2YQ1A 1U1RA 1S1WA 1EHWA 3MM5A 2B6AB 4KYZA 1X4AA 1WSRA 4YDDB 3RBDA 3HD2A 2AJFE 5HROB 2QX0A 3CULA 1ZOTA 1K0TA 1HQUA 1IQZA 1SKWA 2RE1A 3I82A 1UZHA 4KRWA 1RT6B 3LAMA 2AZ1A 2EG2A 4OHXA 1HARA 4IRKA 4MK8A 2JRSA 1REGX 4DX7A 3T9ZA 2AQ4A 2BDPA 1SJFA 4JYAF 2BVZA 5J1EA 3R5GA 3ZTPA 3FMWA 5HLFA 3NCPA 4ZDNA 4U7UK 1N5YA 4J9PA 1QAYA 1SJRA 2A10A 3P45B 4I67A 2AX0A 4ZPBA 4UOHA 2DNZA 4LRFA 3RB4A 3Q8UA 1C1CB 4WBFA 3M2VA 3A13A 5F9LA 4RW4B 1N5SA 3MECA 2MQMA 4WZMA 3DMJB 3MAHA 1IBLJ 3F56A 1Q4RA 4F4AA 2C2NA 4P10A 1EB0A 2IMWP 2OPRA 1FWPA 3WDOA 5KFFA 1RWKB 4N7TA 2FY8A 4RWWA 2IC3A 2YX7A 4A8QA 4CLUA 4RO0A 4FF1A 2APOA 2HHTA 2OPQB 5AXLA 3OVBA 3H42A 3MM6B 4NCGA 1EETB 2KZZA 1TKZB 2YWGA 2PFDA 1NPRA 5IQQA 5GVQA 5A8KB 3D3BJ 3G86A 2W4CA 4IRDA 2R7RA 3W9IA 1XBWA 4FVMA 2ZD1B 3BGRA 1RQ0A 3FCHA 4KT0C 3GV8B 3KJQB 2ZOGA 3KWMA 2W9CA 1PAUB 4YB6A 1TMMA 4DR7J 2VOPA 1U26A 2MKSA 2AV5A 3T9NA 2IIHA 4KTQA 4PUOB 2XYPB 3MPDA 4HHHA 1VQKS 1DBDA 3U1LA 3FEXB 3RJMB 2Q6BA 1T03B 2YNIA 2O3DA 1HR0J 5KT5A 1I6JA 1HWKA 5CYMB 2PI4A 1RHJB 3LUYA 2KN4A 5IT9Y 3OTBA 1U25A 2DPJA 4RW9A 2K7KA 1S0NA 3W66A 1RZMA 2H4WB 4KE5A 3W62A 4CZCA 1Q7YT 4OZ0A 2F4FA 3OLBA 4ILMA 1N33J 2VG5A 4F67A 2QGFB 3CT9A 2LQ5A 2WZ1A 3KLHB 5F3ZA 3UVJA 3W5XA 4USKA 3POTB 1U7LA 2BUNA 2QA4G 2EXUA 3ILIA 4L3KA 1DHMA 2AEJA 1Q78A 3GR1A 4DL4A 2D1CA 1AUDA 2GS8A 3AA9A 5CYQB 1JK9B 1RT3A 7AT1B 4LRAA 2AZ3A 2EFVA 3PYEA 1VQNS 2XO6A 2BQ3A 4DZDA 4DXLA 3TARA 3M30A 2GHVC 2J76E 4DV4J 1RLDA 1PILA 3MD1A 4CO0A 2BANB 3IGVA 3VV2B 1WTFA 2BJ9A 2GZOA 1WC0A 2QYCA 3O2IA 4LVOP 4K59A 2FVCA 3QJLA 1HW8A 1RDRA 2MKHA 2C2EA 4K4SA 1SKRA 1VRTB 3PJXA 5THWA 1JLQB 1LWCB 5EWGA 2UVWA 1PIEA 2G0IA 5D0GA 2MHEA 2VC0A 3MTKA 3CMAS 1MN7A 3RB0A 3QZ8A 5E2QA 3AQOA 4ES2A 3LH2S 4CT9A 5G0RA 2AGPA 2OD6A 3SCIE 3V5RA 4ZVHA 3T41A 4PABA 3M8QA 2XMTA 2UUAJ 1W26A 4I68A 3NBPA 1JLFB 3GILA 2ZH9A 1MSWD 3D1HA 1WD6A 1YTYA 2CWXA 5J1PA 3SXLA 2YH0A 3R27A 5DGBA 3CCMS 2FHKA 2YNHB 1NDPA 3Q8QB 2EK1A 1SC6A 2VJUA 2J9DE 4FF3A 4M63A 2JL9A 1Y11A 4H4OA 2IDEA 2F1FA 2Y1LB 3L7PA 4YMEA 3BZQA 1FJGF 3D3CJ 2DH7A 2IYIA 2GQ2A 5E7OB 3CC4S 4DFJA 3GYGA 2C28A 2R7UA 2CADA 3CJRA 3KJVB 4DPOA 4BS2A 5DO2A 4C0OC 3PYFA 2KZMA 3BKUA 4OI2A 3J80Y 1H98A 3A8EA 2PFFB 2KTQA 4ED7A 1VRUB 2UP1A 1JLEB 1TL7B 2I0XA 5B0DA 4CLTA 3FKBA 1LWXA 3OUYA 2BXJA 2Z2MA 2QL5B 2W01A 3KK1A 1IR0A 4UT4A 3PZPA 3J81U 2AYBA 1XNQF 3GJTB 2DGWA 3ULHA 1Y0HA 4YDXA 8ATCB 1RAHB 5D0EA 1U6ZA 2DHHA 3CCLS 1HQEA 2PI5A 2MPUA 1NZ8A 4Q8EA 2XLJA 2MDAA 2OEMA 4NZ7A 2BJDA 3O5TB 2LU1A 5M2UA 1QUPA 2YPYA 2KRBA 3A8IA 1N5VA 2HW3A 4XPCA 1UW4A 1XR5A 3H8YA 4FKXA 1TKXA 2HRTA 3KYLA 1LK7A 4ELVA 4DUTA 2PC6A 4O4GA 2HNZA 1D1UA 3I5BA 3N01A 1BE4A 1YI2S 2MQPA 1NK4A 5BYQA 1FFGB 4UQGA 1WACA 3Q8SB 2W2NP 3TUPA 1U1PA 3C8YA 2RDDA 1AROP 5HVHA 4X4UA 4NA2A 2POKA 4N56A 1J5OB 5KFVA 3QGIA 1N0VC 2XY7A 3VQTA 4L76A 4DN9A 2MZSA 3QT5A 2H9ZA 2MEWA 3M4XA 2V4RA 2KB2A 1RAEB 3KLIB 1FT8A 1J2VA 2EC2A 3FBFA 2XMVA 5L1LA 1Z1ZA 4Q0BB 3L3CA 5E3RA 4K5RA 1IBMF 3IAM9 1NJWA 5F41A 1R27B 2ADBA 1RB0A 4F4ZA 3LGHA 4FN5A 5I4MA 3EGZA 4DJBA 4J5OA 4PXBA 2AW0A 4MK9A 4O3QA 1AFIA 3K8VA 5HMYA 1U09A 3CEDA 2FYXA 2KG0A 2E1CA 4BCAA 2MJUA 1WHYA 4ZA1A 4CH1A 2WRMA 4EMDA 3CSKA 3RRKA 2MQQA 2PSZA 3OFGA 5ITHA 1RBAA 3RG6A 3RB3A 2PN6A 4PQUB 1X7VA 2WVCA 4Y6IA 2Z58B 3MCSA 4QPXA 2JLFA 1CLFA 3KG1A 2EVZA 3KMQA 2D7SA 3BDPA 2B9XA 1UEUA 1R8PA 3OR2B 4HL9A 3NKYA 2CJBA 4GO5X 1P6TA 1YSJA 4QIFA 1FK9A 4ZPDA 1S1XB 1SV5A 4DS4A 4DFKA 3KG4A 2MQOA 2ZH4A 1UAWA 1UTAA 3UDEA 1RU2A 1HBUA 4OX8A 4OYIA 1ZAWA 4EK2A 4MMOA 2EG1A 4KQZA 1F9EB 2V2VA 1EX8A 4JI3J 1PSDA 2QJ3A 2C3UA 1TELA 1R7IA 2UXDJ 5BR8F 3ZC4A 2OKQA 1VRQC 1SJQA 1QM9A 3W5ZA 3MHYA 2ZDOA 4B17A 2VBYA 2O66A 1JJ2R 4DWIA 1AUSL 2HKEA 1NJZA 4QIEA 2OIHA 5MAOA 3WHIA 1FXDA 2WBRA 2VONA 2FZCB 2RUGA 4BWJA 2V9KA 5B0AA 2RT3A 4ZIWA 1P9QC 5D6GA 5HBMA 3D1QA 5AE1A 4WFAQ 3Q83A 4ICLA 3TVYA 1EJ7L 5FDLB 3IXQA 5DQGA 2RRBA 3N5BA 1XNRF 3PRVA 2A1BA 4R5PB 5DLGA 3HP6A 2ZH1A 2MTLA 3D0GE 5F8HA 1TQLA 4IFYA 2DNMA 4IR1A 4ZPTR 1T9YA 2HURA 1RK8A 2CG8A 3W8GA 1UVLA 4PCQA 2DO0A 2HWHA 2FZGB 2CQ0A 2QT7A 3G6VA 4JI0J 1WC1A 2V2QA 2J9DA 2VF3A 2Z57B 2B6AA 4DPUA 1PC5A 2CNOB 1YZ6A 3CC7S 4WFXA 4DUYF 3ILLA 1T95A 2XMAA 4NMXA 2XGQA 5HROA 4CLSA 4LF9F 3B8HA 4OJHA 1TUVA 1DAXA 4DV5F 3SDEB 4TLRA 3IGNA 3DYAA 3CD5A 2G2ZA 1T94A 1H3DA 3LP1B 2BBEA 2ZH7A 4B9MA 5L1KA 3W5YA 1RHUB 4OI4A 1VQ5S 2LQ8A 4HVZA 2G0JA 3DU5A 3W2VA 2ASLA 4Q44A 1QAJA 4AQYJ 2LU2A 1RSCA 4MAKA 4ZS6A 4LF7F 2E66A 1TZ0A 2YKNA 2P6TA 1APSA 1ZH5A 2RF2A 2WVBA 2ZBQA 2IYGA 4ZVQB 1TL3B 3C14B 1UFLA 4E8UA 2LQBA 2GJFA 5KFMA 4NLGA 3G6YA 2BMBA 1ACMB 4MKVA 1HNWF 4DPTA 1LFWA 4CLKA 2VPZB 4IDKB 2B9WA 4W4MA 3RRGA 1SQFA 1YBAA 5B0BA 3FJ2A 2CFXA 4W98A 1KQFB 2L41A 1MLAA 1NSAA 2ZUAA 3AH6A 1FE0A 4X4TA 3OHBA 1VQMS 4U95A 3W7BA 4JI8J 2XYHB 4C6AA 4B3SF 3KDNA 3CD6S 3RBXA 2DT9A 3MM8B 1FKPA 1Y5NB 3PO4A 1YGYA 4O4RA 1NZAA 2MXYA 1REVB 3T5HA 4ECUA 1NK8A 3CW2C 2HMIA 3WIVA 3M8ZA 4USVA 5IV4A 4I56A 3DCAA 4LBPA 4X66F 1P9YA 4O0NA 1YJ7A 1FRLA 4LR8A 2YX1A 1AA1B 5BXIA 2HGLA 3CGIA 2A18A 2VFSA 4KIAA 3ISNC 3G8QA 4LF4F 2AHOB 1OY6A 1CULA 1X9WA 1QLNA 1NBEB 5HMWA 4FPIA 3US5A 3W1YC 4Y3CA 5HI7A 4NYOA 5KFYA 5D77A 4ECWA 3QPIA 2Y0SD 2Q6CA 2GJ2A 3X1LB 1BGXT 1RTIA 2NXEA 1IBLF 1NK6A 2UUWA 3BGUA 4NXMF 2C22A 3DRPB 2B56A 5IT4A 1IBCB 2ZVIA 5IC6B 2V4JB 5A6WA 2IRXA 2QC3A 1NH7A 4CT8A 4Q43A 4HT5A 4ZVTB 4P74A 1O8BA 1CVJA 3A3OB 4OX9J 3HZGA 3V6HA 3HHLB 5HMXA 1C2PA 3UI3A 5GAEI 4PG7A 2JNJA 3HHNB 2DNNA 3PY8A 4MKBA 3LWMA 4NLPA 1TFWA 2QTWA 2YQ0A 4X65F 3PTWA 3DRRA 4ZLPA 3BSAA 3NAHA 3IR6B 2QSFA 3JTNA 4YFUA 3VAMA 1NXIA 1YBUA 4NZ0A 3BKFA 5I3UA 3H4DA 1B99A 1MWZA 2E7WA 2QA4S 1K1SA 2CPHA 1HR0F 3U27A 2DNKA 3OFEA 4UY85 2BJ3A 3JB9k 2GO8A 3PYGA 2QEXS 1TK5A 1H2UX 4LF5F 3M8RA 3LO3A 2L9NA 3FBCA 1WELA 1IVZA 1UVIA 1RXOB 4OI1A 3UN2A 2KKHA 5F8NA 2DNYA 1YKWA 2VFUA 1RT7B 1T05B 3K5LA 1YHQS 3OV7A 4DSIA 1DY3A 2YKMA 3KK3B 4EBCA 1GMWD 2QLXA 4XPEA 2XG8A 3ITHB 1LEOA 4WFNQ 6FD1A 3QGHA 5ETOA 3GZ7A 4RNMA 4YY3F 1JLFA 1SKUB 3ETOA 2KM8B 3K7RA 2HS0A 2HBZB 4EYIB 5SUHA 1IKYB 3TJ8A 1QUVA 1HBOA 4OYBA 3TEHB 3TQEA 1M5OC 3RB6A 1OIAA 1OY9A 3TQ1A 2FC8A 1VLOA 2XHCA 2H65B 5T7LB 1C0TB 1GT8A 1TV6B 2RILA 3MM7A 4B9NA 3UFCX 3CUNA 2FJXA 4BDPA 4HACB 4ES1A 1K8AT 4ECYA 1UWBA 1K0VA 4G1QA 1U2RA 2ZH8A 2HQ3A 3UNGC 1SCJB 5JUMA 1K47A 4XO0A 2GA7A 4P73A 4ZPCA 1S1TA 3S8SA 3Q86A 3KLVA 3QZ7A 4DCOB 3O3LA 4FYDA 2Q66A 3PV8A 1DTQB 1FKOB 2VV5A 4HT7A 4J9OA 3V2UC 3J80U 1DLOA 4UUWA 2OD4A 1JLBA 1AZSB 1VGYA 1B0VA 1SQGA 3ZZUA 3KK2B 1CEZA 2EFNA 3NWRA 2GVDB 2B7BB 1GNKA 2DR7A 5DDPC 2MQNA 1U4BA 2ROGA 2PMWA 1YIJS 2ILYA 3RYLA 1KOOA 1MWQA 3DOMB 2OPSA 3KLEB 4JI7F 4I6WA 2BABA 4FS1A 4O44B 4J9MA 2Y1IA 3EICA 2D9PA 2VQFF 1FX2A 4UF4A 1VC5A 4ED4A 3CB4A 5CZVA 1NCLA 2LA6A 3SQOP 4RW6A 2B4VA 1C0UB 1FX4A 2DHXA 5L39A 3J81j 4WXWA 1AYEA 3LOUA 2UV8G 3FFIB 3D4JA 1T3OA 3UQSA 3S01A 3HHEA 1UA0A 2CQPA 4CYUA 2EK6A 1FO1A 1Z2LA 2FVRA 3P5BP 3DI6B 4KV8B 5M2PA 4WFBQ 3G82B 3P96A 3MMCB 3HT0A 4KGXB 4ZCMA 5CYJA 1H72C 3FBBA 1XR6A 5KFLA 1VK8A 5DM7Q 4F36A 5CD4A 3A8JA 2WONB 3LWLA 2OFGX 1Y9OA 1QVGR 2PA3A 1BWVA 1WOSA 4B02A 3OR1B 3R3TA 4JI1J 3ZNUA 2RHQB 1RAGB 3NS7B 2OTJS 3ZO7A 4LSNB 2MKIA 4TVAB 2YNGA 4Q0BA 1LXNA 1IM4A 5A2QU 2ZH5A 4YOEA 3AQPA 2BZ2A 3KNGA 1PKUA 1QSSA 2QLBB 4DV2J 3R1LA 1C1BA 1EKRA 4K2XA 3WX8A 2YTCA 2BKPA 3WC0A 1T11A 1S9GA 3ICLA 1NDLA 1Q95G 5B09A 1OY8A 5JJBA 2YH1A 4PXEA 3JAMY 2F65A 3M1VB 2JLGA 4OZLA 2DXEA 5BYSA 1F1BB 1NHKL 3KLFB 2KYZA 3HVTA 2CNNB 2ZZTA 1DJ0A 2HZVA 4Z7CA 2HVIA 4TY8B 4X4NA 1U1LA 3J7Z5 3M8SA 4DX6A 5IQ6A 3AOCA 1N5QA 2C3OA 1RT5B 2ALYB 2N7YA 4DQRA 2DNQA 5DG9A 5JVHQ 4FNIA 1RU1A 3I5AA 1HHQA 4C2MA 3J7A1 2QA1A 5A8WB 3PM9A 5KG1A 2ACYA 2OFHX 3MUVP 3EZUA 2OAUA 1OS5A 4K4UA 1IKWB 2M4MA 3TZXA 2W4DA 3NCQA 3CD7A 2ZEJA 3DRSB 1FJ7A 2VPYB 3EUNA 3Q0AA 5K8OA 1I5OB 4DR5F 4QR1A 3I56S 3DDKA 2VG7B 3CJ4A 3GMGA 1KN6A 4Y2IA 3U7JA 4LFAJ 5H9EJ 1ZM2A 4CLFA 3M2UB 2FZKB 3K5PA 3JSRA 1FD8A 2M7SA 4ZLNA 4ZCKA 3GV7B 4J9RA 3PKMA 5C42A 3FSXA 4I6YA 2KJWA 5ETNA 5AXMA 3SSRA 2XBPA 1S0OA 2O01C 2KU7A 1VISA 3GPAA 4CIOA 3BQ2A 1KFSA 2OH2A 4MT1A 1L3SA 4R5PA 1CJUB 3IG1A 2J8AA 4QWEA 3RAMA 1RTJB 3D68A 3M6UA 4URSA 2Z2YB 4CDIA 2ZE2B 3OTCA 2DNRA 1M5VC 3IC1A 3BGFA 4Y0FA 3LALA 2W7AA 1N32J 2C3PA 5D0HA 1S77D 4OIXA 2I8EA 2MLYA 3V4IB 4Z2XA 3C2PA 2LEAA 4ENOA 5LSRA 2EWHA 4NLXA 2XGPA 1Q8BA 3UNYA 3W60A 2HZAA 5U47A 2GJIA 4H4MB 2ZM6J 4DSKA 2QLJB 3U1NA 4G6VB 4NEYA 1X0FA 2MSSA 1NDKA 3BSCA 4JI3F 1B7YB 3CIZA 3OTOJ 2VQEF 1B0PA 4OLOA 1U24A 3Q22A 3E8OA 1S6QA 3MM9A 4HHUA 1E6YB 1ZBTA 4LSLA 2VFVA 4B3TF 1RKIA 1I94F 3F0NA 1RADB 3HDSA 3UDCA 1TL3A 1UETA 4EYHB 3RRHA 1H38A 3C66A 3I4HX 2DHAA 5KG0A 1CBKA 2HHWA 4OZ5A 3L7UA 4AFFA 2IJRA 2HHUA 1YRUA 5RUBA 3RTVA 2EW9A 2ZNZA 3NAIA 1JKHB 5I3PA 3VTIA 4LR7A 2FD2A 4M5GA 1TR0A 1CS4B 2HHQA 1ZZNA 1VJWA 2FJEB 2CPYA 3ILOA 2Y9HA 3NS6A 3T19A 4Z7YA 3KFWX 3DGPA 4ZVPB 2CIMA 2AJ0A 5J2NA 1XERA 5LXRA 4DV0J 3HKWA 3H59A 2C2OB 1N34J 2HYIB 3JSMA 2JVRA 4UOCA 1XTZA 4K7QA 4UZCA 3ET6B 3OW2R 2HNDA 3JS9A 3THVA 1SJ4P 4DSJA 2V4QA 4DSLA 4KJIA 2Q43A 2G1HA 5HVGA 1XMBA 2YWEA 2OUGA 5CCLA 1Q81T 3SIPB 2FGOA 2E29A 1QJHA 2I2YA 4X2BA 3BR8A 1N5TA 1H0HB 1OO0B 1X5OA 2GCFA 1HWLA 3ENVA 4DV1F 4GRSA 2DGVA 4WK1A 1BQNA 3MCMA 1KDNA 2M88A 1NM2A 3IRWP 1WEXA 1UA1A 1VYAA 1S9FA 4LF8J 1AB8A 2XMMA 3K5MA 2XMKA 3E01B 1VQ8S 4RW7A 1W2IA 2X7IA 3BR9A 4IQXA 2AYMA 4YS2A 2AYGA 1ICEB 1HNIA 4RL1A 2OTLS 1LXJA 3NOCA 1S0MA 4LFBJ 3GTYX 4IG3B 2FHJA 1R0BG 1H7WA 1VC6A 2N4DA 2QL7B 1U0HA 2DRDA 2V4JA 2WB4A 2HAIA 3G9CA 1T02A 5J2QA 1NK9A 1RWXB 3TZWA 2QG9B 4JI8F 4WE1B 4LFCF 2YKQA 4I1TA 3HHLA 4FZVA 4OJGA 2VPXB 2GHPA 1Y00A 1VHIA 2GMHA 4DR4J 1M5PC 2RUSA 5KFIA 4X84A 3R8YA 3SEOA 1RLCL 5A8RB 1N6QB 1TVRA 3NGUA 4F0KA 1HQ2A 4KB7A 1RT4A 3CJ5A 3BQ0A 4NASA 2M0GB 1PAEX 3JQJA 2ASDA 2QFIA 4UY8T 3G8TA 4CLYA 2YXLA 1SJ3P 5IS2A 3NMRA 3N6MA 1WUUA 5D8HB 1GFWB 4F26A 2J0XA 1X5PA 2XMWA 4QCLA 5AE3A 5F0WA 3CCVS 3IM9A 5KFHA 2YNFB 4DG1B 2XCPA 3MEGA 1G1XA 2CVIA 3IS9A 2WBMA 4A8YA 1H2TZ 2LQJA 2ZBPA 3KXDA 2VKRA 2YVSA 3OJUA 2UUTA 2M8HA 2H51B 4KR0B 4P72A 1T05A 4DOZA 2BR0A 4DQPA 3GV5B 3H20A 5F9NA 5B0CA 3A3NB 2AGQA 3ITHA 4HH1A 4U6PA 3C16A 4B3MF 2M5YA 2Z4PA 1X4GA 4ZITA 5EGYA 1N4LA 4ELUA 1ROFA 1SUQA 2BQRA 4NL5A 3T1YJ 2MKYA 4GVBA 4HR2A 1CJTB 2HFVA 3UD4P 1IKYA 4PG6A 2RQ4A 4ID5B 4MKYA 1DFDA 1ZA1B 2QA2A 2IY5B 1WJ9A 4GVLA 3KUGA 1NMEB 2ZKUA 3CCTA 5LM7E 4DU8A 4HACA 1IXKA 3CXCR 3D6MB 1CJKA 1QE1B 2WW8A 3JTPA 3LP0B 4P52A 2MZ1A 2V9WA 4PWDA 3MZIA 4KY3A 2W7PA 2I6WA 4ILLA 5FD1A 4IO9Q 4WKRA 3M6VA 4CCHA 1FKAF 1ELOA 4CNZA 1NJYA 4LVNP 3TA1A 1LW0B 4EO6A 5JXSA 3OFFA 4M5DB 2R7QA 1T0TV 5H9FJ 2BRLA 1RWVB 4LF1A 3D2WA 3KK2A 4CO2A 4B3OB 3HX9A 3GE9A 4V19X 3H90A 3IAS9 2JEIA 1WHVA 3R5BA 3J7YU 1UP1A 2RB7A 1RKJA 5GAHU 1TK8A 3V81A 2MSTA 4DQSA 2CUYA 2AX1A 1S10A 1V3RA 3KLEA 2HFUA 3SQGB 2E5LJ 3HJVA 2XNRA 2J9CA 1UFKA 1JNRB 2D3UA 2MGZB 3Q89A 2W9BA 5K8NA 4KH1B 2M8DB 5C24A 5H9EK 3ZTSA 3PR5B 2YQ3A 2MZJA 1FA0A 3H5YA 3FFIA 3BJYA 2BE2B 1P27B 3VALA 3RW6A 1OQ3A 3JYTA 2J5AA 1R89A 4JV2A 4ER8A 1YJUA 4IFVB 4USTA 3EX7B 4FBTA 2GVZB 3MUMP 5CCMA 1Q8LA 5LMUJ 1S12A 4KV8A 4F02A 1SXLA 2X1FA 4EUVA 5DQIA 4ZHRB 1A6LA 3DOLA 3ONQA 2LMIA 5AXKA 2BOPA 5GMEA 3GIKA 4GKJJ 4RWXA 3MCNA 2X51A 2DKOB 4CM2A 3QIDA 2CDRB 4ID8A 5LT5A 1S4EA 2B0GA 2H1YA 2B8PA 1D0EA 4JI6J 4Q2LA 3ELHA 3D1OA 2JZ5A 2UXCJ 2C2DA 2RKIA 1JJCB 2C1EB 1JJHA 2XO7A 1HIYA 4OI0A 3AB4B 4F50A 4UTGA 4F2RA 1FNMA 1KD1T 3HLUA 3CJ2A 3RR7A 5IT0A 3VGSA 4DL6A 2HFNA 4LF2A 3MPUB 2K2PA 2M9KA 3TAMB 4ECTA 3TOQA 3CJKB 2BKNA 3I6PA 2HVHA 1DQAA 4C11A 5C25B 4IG0B 1RHKB 1FDNA 2G2YA 1KSPA 2Z56B 3CWJA 1PJ6A 2LXIA 3BBBA 2F4VJ 3WX4A 5GADU 1NO8A 4ZK7M 1ZYQA 2N82B 4LF6J 2R42A 2UU9J 2FJBB 4Y65A 4QBUA 3HSGA 1NJIT 3JAMU 3Q2TC 3V6KA 2F5GA 4LMZA 5T14A 3KUHA 3KLFA 3HMJG 4PAAA 1RTDB 2QLWA 4Y2AA 2IJNA 2U2FA 1IKXB 4DR3J 1B70B 1S97A 1L3VA 1S6PB 2QL9B 4RNOA 3SMZA 2RQMA 4QPTA 2Y3YA 3DDNA 2B4PA 3NRBA 4PG8A 4F3OA 3V6DB 1FWLA 1NKEA 3GJRB 4WPAA 3QATA 1Q86T 1GTEA 4PG4A 3R7NB 1IKWA 4FF4A 1S5ZA 3PVXA 4G1PA 3JTOA 4ED8A 2B8QA 3OT9A 2EBEA 2JFKA 1Q7LB 1RUSA 3N6NA 1PO6A 4NCBA 2KXHA 3BYRA 4NI2B 3AOAA 3GJQB 5EDWA 4ANCA 1MU2B 1S1VB 4K0KF 2VG6B 1I3OB 3OQ2A 2GNKA 3LP2B 2CZVC 3EGNA 4I7FB 3L95X 4QWCA 3QAEA 1UVKA 3VGTA 3MMBA 2DK2A 3Q2SC 2WK4A 4AL5A 3HVAA 3I0RB 2QE5A 3GP9A 4F4YA 2H3EB 2NR0A 4Y2CA 1YLXA 2HNYB 4WU2A 5IV3A 1VQ4S 1TL1B 2FJAB 2V6AA 3C6UA 4R0EA 3VR1A 3IRXA 3OLAA 3G8SA 2IMOA 1TKTB 1RA6A 2B5JB 2IM0A 3PNIA 3FEZA 2VL1A 1RTHB 1Y10A 1QAIA 3MR3A 2E9TA 3H5UA 1NHVA 3MR5A 1HPZB 3T5KA 2FIUA 2XLKA 1M5SA 2HFSA 1TP7A 3GFHA 1J5EJ 3FBEA 3DLJA 3DOKA 4NX9A 3MAAB 3Q23A 3FUYA 2NYIA 4H4MA 1JXVA 5LSLA 3GSDA 3CTRA 2HWIA 4YEAA 1LW2B 4RW8A 1F0XA 3PW0A 1DZ5A 4WP9A 3BBCA 2KL8A 3SV3A 4RZRA 4OHZA 2IPOB 2KFYA 2I38A 3ZZYA 2KT2A 4DHVA 1S48A 2GGPB 2XZDB 4NYZA 4X62J 1RBLA 2GIFA 2MY7A 3C15A 1R0AB 1R43A 2OGUA 2LVWA 3PG9A 2XY6A 1JLGA 3MPYA 3CCJS 3VAHA 2E5GA 5F8GA 4NLYA 4FYWB 3ENWA 3JSBA 1JWWA 2UVVA 2I9SA 3BREA 4PXCA 2BACA 1J27A 2QRRA 1SB6A 2HHVA 1JLCB 4RPFA 2E9ZA 4RBUA 1IM6A 1G6BA 1KQGB 4ZIVA 2CJAA 1LWFB 3KLGA 1JX4A 4CO3A 1HL6A 3OVSA 2H4YB 3G87A 4JI2J 2Y0BB 1CS4A 3HO1A 4OJ1A 1GH8A 1IKVB 1F5BA 4PEOA 1GX6A 2UUCJ 2KXFA 2LA4A 1MMLA 4KKOB 2DO4A 3CIMA 1VJQA 1HMVA 3HSZA 2HEKA 1D9FA 4KHPJ 3N0VA 2PMZD 5AJ3F 4RKUC 5IM0A 2OPPB 4ZVOB 4EBEA 1EP4B 2EPIA 4JV5F 3VWSA 2IHR1 4QWBA 4W92B 2MQLA 5HK4A 3K59A 2I5JA 5M2RA 4P9SA 2CQ4A 5HP1B 3A1YG 1S57A 4I2QB 5ETVA 4DR6F 1RT1A 3DKDA 3OTOF 1DQ8A 4OMFG 4DV3F 3OL6A 4X64J 4EWTA 3HHKA 1VLYA 1Y4ZB 4ED1A 4ZVGA 2DGOA 4LR9A 4LQ9A 3TJ9A 4CO4A 4IH5A 3IA0A 1XMOF 2OMOA 4DV7F 5I42A 3E01A 3M9OB 2R8KA 3EXCX 3C6TA 2V63A 3DLKB 1ZPWX 1HD1A 2BM1A 1HWJA 4WFZA 1X4CA 1UL3A 4X4QA 4IH6A 4RUBA 1HI8A 2ZNYA 4IG3A 2EI5A 5H9FK 1YQHA 1R31A 4NPOA 4HI1A 1JMTA 4GC6A 3TJAA 3QO9A 3R97A 2PDAA 3L9ZA 2FLOA 4KH0B 1HWUA 2R8IA 3KG0A 1U0SA 4DV0F 2VJVA 3GU0A 3NGDA 4DL0C 1PCAA 4DLGA 3MMAB 1VBZA 4F0MA 4ZOSA 4WP8A 1V3SA 1E6VB 1HW9A 3RZAA 1RWUA 1CJVB 1K44A 5MLCV 4HEA9 4JYAJ 2HQCA 3FZ2A 1Y5IB 4C48A 4OHVA 3IMQJ 2YWKA 3P49B 1NNDA 3FCVA 4IH7A 1DTTA 4I2PA 2KHCA 1OSCA 2P9GA 2F9JA 4BC9A 4YB1P 4A8SA 1KHVA 2H54B 2VICA 2VBXA 2AJ1A 3TX8A 3MTJA 4B9UA 2HPUA 5LOQA 5DLFA 5H1SV 1S9EA 1TAQA 4M5NA 4WIQA 4JOUA 2W8LA 2PIIA 2XZWA 3CJ3A 5DZ6A 2WOMB 3FQKA 2FJVA 3PX0A 1VI7A 4GMKA 5FLXU 2OLWA 2KI2A 4M5MA 3NNCA 3UDVA 5DRKA 3JSYA 5E3CA 2DGSA 2EEYA 4AD6A 3JQMA 3RAQA 1O6XA 2IVYA 1FTCA 1S1WB 4FS2A 3AJ2A 3MM5B 2QN6B 4FXVA 2RMLA 4KO0A 1L3UA 2A6OA 4OQJA 1HNVA 1X9SA 3GCWP 4OX6A 1HQUB 2HVZA 4USJC 3GFYA 3CMQA 1W2BR 2BE7D 4WXOA 2ASJA 2ZJRQ 5ETMA 3G4SS 1ZETA 4ID5A 1GXTA 3DM2A 5J1EB 4MKAA 4DR4F 3H7HB 4DLEA 3CDAA 2RNEA 4I0WA 4C8KA 2UXBF 3UN5A 1N5YB 1YBTA 2KT3A 2EFQA 1GMUA 2XSJA 2DNPA 1CC7A 3LP0A 2CNKB 4K4WA 4NLOA 9RUBA 1IJEB 1OQ6A 1PBAA 2HBRB 5B7WA 1XR7A 4J9KA 3MCOA 5KFSA 3MECB 3VZIA 2EFPA 1O51A 1S4FA 1N36J 4YHHF 2LECA 2WCXA 5T41A 2FVQA 2FB0A 4TQSA 1G2EA 4HTIA 2OPRB 3ZXWA 2J7KA 1VFJA 4NLVA 1D3WA 1PYSB 1FERA 4L75A 3GYXB 1EARA 2DNLA 2IC3B 2NXCA 2HHPA 4TN2A 2B9YA 1PC4A 2XMJA 1S72S 3NXZA 4QIGA 3CNQP 1KKHA 4P7TA 2G1DA 4AE5A 4NCGB 2PD1A 3QLHA 4CWBA 2PEHA 4DL5A 3EVMA 3R5AA 1BQMA 1FTRA 1VIXA 5LL6d 3TUZC 2ZBIA 3OL9A 5ETQA 2SXLA 5F8JA 2HQFA 3UE2A 2W9CB 4LUBA 4WWSA 3ZTOA 3EGVA 2RDJA 3QIPB 4U7CA 3DLBA 5G4DA 4PXDA 2DNOA 4A8WA 4CLLA 4PZVA 3W8PA 1NPKA 4KAIA 2BE2A 2YNIB 5DDQC 1Q0NA 3M32A 1X4FA 4DQQA 2UVRA 1KOHA 2W25A 3VVUA 2OSQA 5CHCB 4RW9B 4ECXA 1T9UA 3E2EA 3UCZP 2JEJA 3IO1A 4ZHRA 3KNAA 4OJ3A 2J6UA 2LDIA 1YX2A 2BOAA 2VG5B 3O1LA 3NNHA 3M2RA 2E5HA 1ZTWA 2GC8A 1V5IB 3RUBL 3D6HB 4Q5VA 1JXEA 4A8MP 3K5NA 2B7CB 1EKSA 4ZJOA 6AT1B 2C2MB 3IBFB 2VBZA 1VMBA 2K7JA 1FNXH 1XQIA 1T9XA 2CZ4A 4NXNF 4X4PA 3SFGA 4UZBA 4ZCIA 3FK4A 1HLWA 3OPKA 3TAMA 3HVWA 1M1KT 3M30B 4JI4F 5KFCA 2R2RA 1FJGJ 3LW5C 1WF1A 4IG0A 1VDHA 4HDHA 4J7CA 1UPPA 4U8YA 3QSIA 3KHGA 4IKAA 4YR0A 2GQCA 3NEKA 3DLGB 4QR0A 3CCRS 3OXFA 3TA0A 2D3OR 3NGRA 5DM6Q 4MIBA 1RAFB 4AUKA 4QU7A 2XS7A 3EM1A 1M90T 3BH7B 2ZKTA 3ZZTA 2N4CA 2HS4A 5D4PA 3GR0A 3CDWA 3DGVA 4FXWA 1F9HA 4TNOA 1O0PA 4PRFA 2W2PP 1NKCA 4JBCA 2VASA 5G0RB 1XNQJ 3ZFVA 1F6TA 4DEZA 3HSDA 4EZ9A 3M8QB 3VQSA 1KLNA 3RAXA 4K4VA 2V50A 3R6GB 3CDUA 3R5CA 4MFBA 4I64A 1YJWS 4JI6F 2W24A 4DUZF 4FNHA 4ATNA 3W64A 5L1JA 2P5VA 3FCWA 4C8ZA 4E0DA 4DS5A 3UD5A 3DNCA 1LWEA 4ZPAA 3VHQA 1H6KX 2V5HG 2VFTA 2NPFA 1SIWB 1XEZA 1Y7PA 1S1VA 3MXHP 2DNGA 4KFBA 1YK9A 4E2FB 3LP2A 2E1AA 4H4OB 3HJFA 1IR1A 5CZXA 2ASYA 1PBUA 2HIQA 1HHTP 1L5UA 2RHSB 2VZ9A 1UEKA 4Z37A 1T7PA 1LK5A 1RYRA 2JFDA 3HT3A 4J91A 4CTAA 1RJJA 4QWAA 4TKTA 4ZLLA 5HMZA 3L7OA 3CCUS 2KDOA 2B9EA 2XYGB 3Q24A 1R8HA 1PJ5A 1HWIA 1R8CA 1RTHA 2HBYB 1NKBA 4DR3F 2HFZA 4M5KA 1F5AA 3W63A 4USHA 1CC8A 3WC2A 1XJWB 3OUYB 1HPZA 2DD8S 3KK1B 1P8GA 2VD3A 3I0SA 3H0PA 4TU9A 1GAOA 3SCLE 1RI7A 3B6BA 1JLAA 1RGVA 4JI5F 3MOJB 1LNQA 7FD1A 1IBMJ 1CPZA 3MAAA 4K8RA 2MKKA 1KONA 3KHLA 4N47A 2W9AA 4WCEQ 2H5IB 4NLWA 2ADCA 3QGGA 1HQEB 1W25A 5B0GA 1BD6A 5SZTA 1HNXF 1RACB 4K2JA 2Y1JA 2IAJA 2JX2A 4K4XA 1IJFB 3UCUP 2GGPA 5ETSA 4K4TA 1WI8A 4PYAA 4TYBA 1RHRB 4A8OA 3W3SA 1TKXB 3TEGA 3ZTQA 2DR8A 4O4GB 5K20B 5KFGA 3MEEB 1HYSB 3VVTA 3I55S 3B4DA 1U6BA 4XIUA 2N3LA 4DBQA 1D09B 4ES3A 1O5JA 3B78A 4XTTA 1M1HA 4X4SA 4M95A 4A8KA 2DPIA 2JVOA 2YKPA 2VOOA 1DRZA 1NU4A 4ZJQA 3H40A 5KFJA 4QIVA 3P3DA 4QW8A 1KVJA 1WF0A 2WVEA 1TL4A 4KBIA 3OXGA 2W8KA 2DIUA 1WC6A 2ROEA 2K1RA 2AEMA 4L72B 3TX0A 1GK8A 2KG1A 3ETMA 3TW0A 4QOTA 2VB6A 5BR8J 1RT2A 1FHTA 4A47A 4WF9Q 1YJNS 2DY9A 4YB7A 1J5EF 5LMNF 2GO9A 2OPPA 3A3PB 4HKQA 2HGMA 2Q3PA 2DEIA 3CPWR 3GJSB 1MNEA 2GHWA 4I2QA 5L9NA 2OI2A 4ZVUB 2K3KA 3D6FB 1BY9A 4ZVRB 4NWBA 1RT6A 2DISA 4R25A 3TAPA 1FI4A 1NAQA 1ZA2B 1XNRJ 1P1TA 1LFPA 5IWAF 2V0NA 2CVEA 1HBMB 2RVJA 1CG2A 3PACA 5KTQA 4DV6J 3FQLA 2MYFA 1ZTTA 3GFZA 2OMLA 4M5LA 4C3LA 2P9EA 5D15A 5DG7A 1C1CA 2WAQD 2D3O1 1DARA 3IWXA 2UUCF 4RW4A 1IWAA 3W2WB 3Q8YA 4DUYJ 3DMJA 1HBUB 2R9LA 3E51A 2FUG9 2HGNA 1TMJA 4NA1A 1KFDA 4KHPF 4LF9J 4ECRA 4QWDA 4CNYA 4DV5J 2R4FA 4AXIA 2XY5A 3WZ0A 2KT5A 1XC9A 5A6PA 3OXLA 5J1NA 3VZHA 3CJ8A 1CJVA 5CAAA 4K50A 2OPQA 4LF7J 2XEXA 2YY3A 1FXLA 1XWLA 3M8WA 4MYUA 3MM6A 2CYYA 1EETA 1TKZA 1Q5VA 1WI6A 3P8BB 5A8KA 4P2XA 1HBNB 4M5HA 4E98A 2FTRA 4GO7X 3PFOA 1YRTA 3M9NB 4ANDA 2ZD1A 3PX6A 2B43A 1KEKA 4ICLB 4MK7A 4X64F 1HNWJ 3EVOA 3EDRB 1R0CB 1U8WA 4PUOA 1WDDA 2E1PA 1I1GA 5DETA 4FF2A 4QZVB 1RWWB 2ZOFA 1T03A 2DGQA 3PIPQ 5CYMA 2RJZA 2DTJA 4B3SJ 4F04B 3QAUA 1IBKJ 2IM2A 1TKDA 3PR4A 3QQCD 5IT9U 2IRYA 3QMQA 3HFZB 1S99A 5AT1B 1HHSA 3K89A 1WEYA 2NUHA 2A2CA 1KR4A 3EMTA 4ZN3A 3MR6A 1UZDA 1PYTA 4X66J 2CJYB 3KLHA 3POTA 2A2DA 3DYAB 4FDFA 5KFXA 3CO0P 1FEHA 3T5LA 5AE2A 4JUZA 2CZ9A 1XK8A 3W2VB 2JOQA 5CYQA 3H5XA 4KGKA 3P4UB 4HH0A 5C2GA 4LF4J 4H4KA 2LEBA 2YKNB 1ZS6A 2OELA 2RF2B 3H98A 4M8LA 1FVQA 1GEHA 2V68A 4ILRA 2JH3A 3K8WA 3M8PB 3J7YI 2BANA 5GAHI 5HSPA 4HDGA 1NK0A 3F44A 3TRGA 5F8MA 4DR7F 3UDLA 2DGTA 4NXMJ 2XNQA 3HSJA 3GCXP 3TNVA 3B54A 2CQCA 4CLWA 2XHWA 2F3JA 2VU5A 1WSVA 1VRTA 4J9UE 2CPIA 1JLQA 1LWCA 4O0IA 2GAGC 1FKPB 4ITSA 4OZNA 3NLCA 2GV1A 2XSFA 3PFEA 4LRBA 1KQKA 1FF2A 5KOWA 2HMIB 3MDFA 2HS3A 5ETKA 4MYTA 1N33F 4X65J 3M6WA 2COLA 3N5FA 2Y1RI 2HRUA 4BWMA 3OL7A 3WQPA 1D9DA 3PJWA 1WHWA 3IWLA 4DF4A 3D67A 4QJVA 3I5CA 2Q1LA 1X4HA 3QIPA 1YITS 1BUXA 4BC7A 4CI0B 1ZZFA 4NLDA 1CULB 2ZFHA 1SPBP 3SZ2A 3DLLQ 1KQSR 2YNHA 1X0PA 2IBKA 2E5IA 2XB2D 1NRKA 3UN3A 3TZYA 5CQGA 4LF5J 1L3KA 2RD5C 4H54A 5ETPA 3CF5Q 1T3NA 3CJTA 2NPIA 4DV4F 4NOHA 3GIJA 3W65A 1QDUB 4ED0A 1N36F 1UPMB 1RTIB 5CA5A 2FLLA 3KJVA 4C8NA 3N9UC 2BM0A 3FDSA 3HFVA 4DI6A 4YN3B 1FFSB 4NZ6A 1Z4UA 2L9DA 3PHTA 4HI2A 1PYOB 5KFRA 5C2CA 1VRUA 4YY3J 3DLHA 2D74B 1IR2A 3EJMA 1JLEA 1TL7A 2R8GA 4JV1A 3J7AN 4TU8A 5CXTA 4RUCA 4WKYA 4F4KA 5GADI 2ATCB 2H48B 3FRZA 2R2UA 2HHHJ 1MG7A 5GAGI 3GLJA 2VODA 3CJ0A 3DRRB 2L9WA 3LAKA 1OSDA 4NRTA 2ERRA 3DXBA 2UUAF 3HF5A 5HJXA 1X31C 5HO4A 2ILZA 4WTOB 1NSPA 4C8YA 2C42A 9ATCB 5LJ3Y 3CJQA 2LKZA 5I3UB 3AJDA 2WVDA 3BGLA 2RRAA 3DLGA 2AU0A 1RAAB 4PQAA 3EGWB 4OYPA 4QYZJ 2IFXA 2ZC3A 1RWMB 4W90B 5KFOA 2FJWA 2VBWA 2CAJA 4RBTA 1N0UA 3CDEA 2MLXA 4LBHA 1SVDA 1KLMB 4S0MA 4OV6A 3AOBA 2FVPA 1DURA 1UFWA 5EUHA 1N8RT 2YKMB 4FVCA 1QSYA 4JI7J 2PE8A 3PIOQ 2HAFA 1T8EA 1J5OA 3EPIA 1M5HA 1WKJA 1UVMA 3PDNA 2VQFJ 2FLNA 2NLWA 2HIYA 1CQNA 1LOUA 1HBOB 3TI0A 3DU6A 2C2ZB 3KLIA 5DS7A 3TAQA 2J7UA 2XM3A 2QLFB 3DC2A 3MM7B 4DX8H 4J9VA 1WC4A 2AJ2A 2Y8YA 3O8WA 4O23A 3BH6B 3B4MA 4WZQA 2R7VA 5GMDA 1Y3KA 1UWBB 4ZKAA 4G1QB 3D0IE 4RJVA 4DQIA 4HYKA 1WHXA 2P9CA 1S1TB 4F25A 3DXSX 2G4BA 4RNFA 1MMNA 1VQSA 5DGAA 4CH0S 4PPDA 3N28A 1DLOB 5L9XA 1N88A 1JLBB 4PQUA 4WTYA 4YP3A 4C3KA 3G96A 3CC2S 3KJFB 3IBWA 1U1NA 2DRBA 2ATLA 1L3TA 2JC0A 1RAIB 2HQDA 1VK3A 4OYXA 2IVMA 3CE8A 1NEEA 3M9MB 3OR2A 3NGKA 2OPSB 3S6EA 1S1XA 1VC0A 3NOGA 1LQ9A 3SYZA 2NXJA 2CQ1A 1VQYA 3CCES 4GKKJ 3CO9A 2ZITA 1FRMA 2ZJQQ 3VAGA 4RW6B 4OYOA 2KVQE 2GMLA 3MFIA 4WFYA 2AMCB 1C4CA 4RBVA 4EI2A 1Q5YA 4X4RA 1MMDA 3DHWC 3H2VE 4UW2A 1S76D 4CYUB 1R8AA 1X5SA 1FJCA 3TA2A 2DY1A 3F41A 3VF0B 3MEEA 1HYSA 1FFWB 1WG4A 2NSBA 1GTHA 3OFHA 5KFWA 3KTQA 1WDTA 2HK3A 2CQ2A 5D78A 1RTZA 2V67A 1I51B 4C98A 5FDLA 2XS5A 2V8PA 2X1GA 2HBQB 3TANA 5K8MA 4WP3A 4EGLA 4O3NA 4ZCLA 4AT1B 3ZZ0A 2CA9A 4OX7A 1U02A 3ZZOA 5D4NA 4DR5J 5A2QY 2RAQA 2MY8A 4MIWA 4F0HA 2YNGB 3BSOA 2VKZG 3H25A 3HXMA 3OVAA 1FRIA 2KJVA 1Y3JA 3EDQB 3CMES 2MZQA 1F9FA 3VGVA 1C1BB 2MZRA 3Q8PB 1JJ4A 5J2PB 2Z2ZA 4DL7A 1S9GB 3IWNC 5KG7A 3D66A 1T9VA 4N8NA 3M7VA 3MAQA 4B3RJ 3SDEA 2DIVA 1SH2A 3N4WA 2UXDF 4G65A 3LP1A 2Y8WA 1Q8IA 3PRBA 1RHQB 1TTHB 3AFGA 3FGVA 2OHDA 2PA8D 2RIJA 3T1AA 4F7VA 3HVTB 1HBMA 4FYYB 2ZBRA 2BJ1A 1U1MA 2M3DA 2AF6A 4Y00A 1R8BA 2V8GA 4N8OA 3LQVA 2FHJD 3MEKA 4BHQA 1VQPS 4WK3A 4N41A 3C14A 3PJ9A 4NLRA 3GQCA 2GAHC 1NLKL 2GW8A 3QRPA 1SL2A 1OYEA 2HFOA 1WTBA 4OFZA 3KHRA 2F8HA 3W2WA 2J7WA 4DPYA 4IDKA 4USUA 4Y2MA 5C5JA 4C8OA 3HHLD 2G0CA 3TUJC 3FEYB 4O3OA 5KFBA 5GMKa 1SKSA 3PXGa 4QR2A 3GIMA 2XC9A 2YWWA 2I1RA 1WG5A 2VQEJ 4CM0A 4M5JA 4ECSA 1AFJA 4OI3A 1HNZJ 1SH0A 2LDYA 3QFHA 4P2MA 2DR6A 2IA0A 3K5OA 3MM8A 4NRUA 4JI0F 2LP4A 2FY1A 2D9OA 2KFNA 2V94A 1REVA 2QMUB 5A76A 5F8LA 4B3TJ 1I94J 5C42B 4A48A 4DZ6A 3BDEA 2ZHAA 3MPVA 3BKTA 4F4WA 2P6SA 1HBNA 2KH9A 1BHNA 1DQ9A 5KT6A 1QTNB 1V9OA 4ED5A 3AODA 3BEGB 1EQ0A 1ZPVA 2HHSA 1FD2A 2IBOA 3IG1B 2NXNA 3QRRA 2EBGA 4AQYF 4DV6F 1WF2A 3IBCB 4NLTA 4P2FA 5KT2A 3NY0A 2C2KB 2LQ9A 4A8XA 3BO4A 2V8HA 4X4VA 1B64A 3WIUA 4J9LA 2DITA 1XIQA 2Z2LA 3NCRA 4V1Ak 4ZPVR 4KGMA 4WJBA 3RW7A 2ZC4A 3L4BC 2BYCA 3IP0A 3DRPA 1YJ9S 3RBZA 3D9BA 1FDBA 1M0SA 1X4BA 5JMNA 3OSNA 2X3GA 5HL7Q 3VAIA 2FPHX 5E0OA 4DV1J 4N76A 1RBOB 1F5CA 4NMLA 4R8UB 1S6QB 3MM9B 5IZHA 2HLUA 4KGZB 2F63A 1S6UA 4LSLB 4FKYA 1YRXA 1VQLS 4ED2A 5DQHA 1X5TA 1HKAA 4IRCA 2J6TA 2F9DA 4DFPA 1VOMA 4IOBA 2ZZMA 4QYZK 3M8PA 3HI9A 4PKDB 1RWPB 2ZVSA 2ACMA 1KNZA 1R3NA 4D3HA 1H73A 2RQCA 3DGPB 2BJ7A 4ZP6A 2O67A 4OI6A 5J2NB 3SV4A 1N56A 1TL5A 4YR3A 2AGOA 1TFYA 4K5SA 2W2QP 3JSMB 4UOFA 1IBKF 4LFCJ 4EEYA 2HNDB 4UOGA 2BA9A 5K5MA 2NQPA 2WTFA 3G2XA 5KT7A 1RT7A 2QO3A 2HZCA 4DDFA 2A6MA 3KK3A 2HWTA 1X9MA 1Q82T 3QT6A 3AAWB 4M1KA 4QW9A 1TK0A 2W1BA 3QT8A 4OZ3A 1FCAA 4OX9F 5KFZA 4KHMA 1XMQJ 1BQNB 2OP5A 1YJTA 1QVFR 1HI0P 2QSWA 3C46A 3ISZA 4JV0A 4WYLA 4KHRA 5T7LA 1C0TA 4RW7B 1TV6A 2GX8A 2QZ8A 5HANA 1UKUA 2LCWA 5J2MB 3IFEA 3HVRA 4ZPWR 1G3OA 1HA1A 1HNIB 2R7XA 1YZ7A 4MIAA 4PG5A 4F2SA 2R8HA 3W9HA 4DPXA 4C9DA 4PPZA 1QSLA 1U0HB 3FSIA 2R7TA 4TY9A 1WC5A 3QJPA 7FDRA 3HK2A 5KG5A 2VPWB 2LLZA 3H5SA 4B3MJ 5J2QB 1DTQA 1FKOA 3TO8A 3GONA 2FGCA 2F40A 5LSOA 2H5JB 1AZSA 1Q79A 1JXLA 1KBRA 3UO0A 3DLEB 2R8JA 1V3ZA 4U7UD 3R9LA 3BN7A 4A4JA 1WEZA 2W2MP 4KPYA 4C0BA 4C8MA 3MWBA 2GVDA 3CJSA 3K2YA 1A0OB 2XWYA 3UCGA 5KFAA 3S7RA 1TVRB 3DOMA 2M70A 2V2KA 2UUBJ 1X4EA 1RCXB 3A8KA 3EXYA 5KAKA 1RT4B 2B51A 4DR2J 1H2VZ 1FDAA 3KOAA 1X60A 4O44A 5DDRC 3NP5A 2DCUB 1SL1A 5B0EA 4HTJA 1C0UA 3W9JA 3OTEA 3MR2A 4Y2KA 4V19J 3H2UB 5D0RA 5HQMA 4OYZA 1V5VA 1S0VA 1HFEL 5B0FA 3QYYA 4RU9A 3MEGB 3QT7A 3IS9B 4OHWA 1HI1A 4BBYA 3IR7B 1KLMA 4NEZA 3EPGA 3VCDA 3DI6A 1GQEA 1KTVA 2AJQA 1C4AA 3GWCA 5EX0A 5IXUA 2HVDA 1MROB 3G82A 4TYAA 4U67Q 3MMCA 2N7CA 4CLPA 4ECVA 3FZBA 3C16B 1ZM4A 4EBDA 4YB5A 3MF5A 2NZ4A 3ZNJ1 2WONA 1UVNA 4Y34A 2BJ8A 1SUQB 4GVBB 3BBFA 1FE4A 4B9LA 3OR1A 5KG4A 2ZOMA 1K73T 2GIQA 1PGZA 3RGIA 4MJKA 3SSSA 8AT1B 2DB1A 2CQDA 2EC0A 2J9EA 3LF0A 2K3IA 2KHDA 4G1IA 2HHHF 4L74A 2MQ8A 4NLSA 2J0SD 1YDLA 5KFEA 1VS3A 4LSNA 1VQOS 2X1BA 3H4BA 4OHYA 1CJKB 4C0HA 2F8EX 4ZVFA 2HK2A 4NLQA 2XULA 4PWDB 4DPWA 4YR2A 2B4OA 2C2RA 5KFKA 2DGXA 2IJFA 3O44A 2Q79A 2MZTA 3PX4A 4L73A 3I9ZA 4Q8FA 3M1VA 3AY0A 2LYVA 2NSCA 4OL8A 1EIYB 3PW7A 4Q2MA 3BYPA 2E1MC 2ZWOA 1SBRA 1IUJA 3Q8RB 1X4DA 1NSKL 4TY8A 1JIHA 4C8LA 1KWMA 3HD1A 3V81B 1GX5A 3IR5B 5L1IA 3ILJA 2E7XA 2ZWPA 1CQMA 3ZZRA 2YWHA 1RT5A 3BSNA 1VCTA 2R2SA 3EWGA 3PCOB 2HRYA 2CQIA 4I6AA 4P6QA 1SI9A 5A8WA 2CQGA 2ZBCA 2JSXA 2R2TA 2W9BB 2CG4A 1URRA 4OYWA 2EFOA 5KT3A 2LEPA 2GIRA 1GMWA 4JI1F 3DRSA 5C24B 3OL8A 5D3GB 2J6SA 1MN9A 2NUUG 2VG7A 2JHEA 3JYTB 3V4MA 3AHPA 4ECZA 1SIZA 2O1PA 2GMJA 1UMJA 3M2UA 4DV2F 1BC6A 1VBXA 4OYMA 1P1LA 1ZM3A 3JXOA 4XDCA 5CABA 4KGVB 3DOLB 4ALZA 1IWGA 1Z2ZA 4H4KC 4OZJA 1RA7A 1TUGB 2XTJP 8RUCA 4O3RA 4L3NA 4F8RA 4UUXA 1YVFA 4A8FA 4O3PA 5IC4B 1CJUA 3EZOA 3B82A 1RTJA 1NPPA 2RKIB 2E7VA 1NUEA 2ZE2A 1BXNA 1QAXA 5B08A 4TU7A 4ZMMA 4NA3A 1SC3B 1S7HA 3G6XA 2HVEA 2U1AA 3R2CJ 3V4IA 4O3SA 2ZH3A 2CWKA 2BRKA 4K0KJ 3CCQS 2AP6A 2FLPA 3VAKA 1YG0A 4UQTA 2ZDPA 1WOPA 4F3MA 4ZLJA 5J2PA 3PW5A 4C11B 4GKKF 2Z30B 1UCNA 4QU6A 1H7XA 5KFDA 2AEFA 3MURP 1U49A 4B08A 1N52B 2VUGA 3QNWB 4F3QA 2OO4A 4DU7A 5KFQA 1AW0A 1D9AA 5KFNA 1YWXA 3THTA 1MWYA 4LFAF 3V6JA 2CJQA 2YKAA 4DR1J 2DRAA 3AD8C 4TXSA 1E6YA 1OMSA 5K14B 4LT6A 2NREA 4OYAA 3TZZA 4PR6A 4B9TA 4ETZA 3HHDA 2Z8QA 4USIA 2E44A 3C3LA 2PGCA 2BV3A 2AIRB 4KSEB 2DH9A 1VIOA 2JEFA 3T1HJ 3MI7X 1JB0C 1UJ4A 2EFGA 2R7SA 2DGUA 3NS5A 1JKHA 3BS9A 2V69A 1S6OA 5DZ7A 3U02A 4OZ2A 3BPDA 5L8RC 5D4OA 4USWA 1U1KA 4CP5A 2J0WA 2BE9B 2G2OA 3FNNA 4ANEA 3HFKA 4MTPA 4FXDA 1N32F 4N77A 3I9V9 2NXUA 5E5NA 3GSIA 3R5DA 3LTOA 1A7GE 3ET6A 3R5JB 4XAKA 3TR5A 3OBIA 3HM9A 2A0FB 2JJ4D 3GIIA 3AT1B 4OV1A 2ZM6F 2IRUA 2CJXB 2YX4A 2HQIA 3MMBB 3EZ5A 3MUTP 4CO5A 1WWHA 4B3RF 2HSEB 2WB1D 2V34A 1RP5A 2WSEC 1PJ7A 2MMYA 3QWPA 1U48A 3DRYA 3HCXA 4BLGA 4RU2A 4DMZA 1KVKA 3NG8A 3C6UB 3KMSA 3OD2A 3ADAC 2XS2A 2VFRA 3IRXB 5E33A 3CCZA 1MW7A 3VAFA 1RWOB 3D28A 5L38A 1EAYC 3LANA 5EWFA 5AJ3J 3LPYA 2VDHA 3ENQA 1VR6A 1B4SA 4P7VA 3DOKB 1T9TA 1WNEA 5FJ4A 1W7WA 4JV5J 3MR7A 4WU3A 3RBEA 2QIFA 4RLEA 5KOXA 3BB5A 2CPZA 4RW8B 5JVGQ 4K4YA 4LIRA 2NCKL 3KUEA 2FC9A 2R3VA 2XQCA 3VAJA 1NB2A 5DJBA 1T9WA 2BKOA 4IOAQ 3ZZPA 4DR6J 3P5TL 2C3YA 2CPJA 4RX6A 2O5DA 5KG2A 3O6QA 1ZAVA 2ROPA 4DV3J 4CQ1A 4WE1A 1N34F 1HNZF 5KFTA 3C15B 1GMVA 4R8UA 1N48A 3MEDB 3BPSP 1JLGB 3MOZA 5HAOA 2QMWA 3NGSA 1YJVA 3T6BA 4RUHA 2DCLA 2FDNA 1XMOJ 4CO1A 5HATA 4DV7J 1B3TA 2RRNA 5A8RA 1N6QA 5EX3A 2FVSA 2RQKA 3L09A 1S49A 3UW1A 2OJ3A 2KRRA 5E3AA 1Q53A 3KLGB 3X3UA 3HZEA 2ABYA 3ENAA 3THPA 4M94A 2YPZA 2K8GA 3OJSA 1WKKA 2IM3A 2GFFA 2AD9A 2DR5A 3D5MA 2PMHA 5A0YB 4IR9A 2DXDA 1Q1KA 2FHMA 5C7PA 3SSQA 1U6FA 2VH7A 1HMVB 4LSZB 2AWZA 1S1UB 2L3MA 1G4CA 4RNNA 2JDJA 2XI2A 5KFUA 4AL7A 4LF8F 1RE1B 4J37A 1U8SA 2YNFA 5IM0B 3E3XA 5BJRA 4DG1A 2R7WA 3I31A 3RU0A 5E41A 3QWUA 5HN0A 3P6YC 4JP8A 3PEHA 1WOOA 1ZM9A 2CQHA 4LFBF 2VC1A 2RU3A 2OEKA 3PO5A 3AJ1A 2I5JB 1FXRA 1KS2A 2PO4A 3FMBA 1M5KC 2ZHBA 2BQUA 3SBMA 4AYBD 3SFUA 3QRQA 1RT1B 4ERDA 3TVKA 4NLUA 3TWZA 5ETLA 1OYDA 4FBUA 1RYSA 3S1TA 1CJTA 5KG6A 4EO8A 2DVIA 4J9NA 3EVWA 2MKCA 4K4ZA 1HD0A 2IM1A 3BGOP 4LRDA 1CSJA 5I42B 2CJ9A 5HLFB 1BWEA 1VBKA 3A4TA 1OJ4A 3RR8A 1FDDA 1WKLA 2G9OA 3C6TB 5J2MA 2C3MA 4C4WA 4ECQA 1KTQA 4IQMA 2V8DA 1SQEA 3D0HE 1RWNB 1QE1A 3SCKE 3T6JA 2LXFA 3HPOA 3M2VB 4ETXA 2DEJA 1KP6A 3TUIC 1B7FA 3QO9B 1TU0B 5AXNA 1NHUA 4DL2A 1S59A 4WYWA 4ELTA 1LW0A 4TQRA 2XCAA 2D41A 4M5DA 3SI8A 3D7SB 4PYDA 2KFZA 2CJKA 3DLEA 2RS2A 5IFMA 2IDLA 1R6YA 4B3OA 2BEFA 1Q16B 2D69A 2QFJA 2XWXA 4ZVEA 1UJ5A 2CKWA 3SQGA 1DTTB 4I2PB 2UXBJ 3AD7C 5EHHA 2E9RX 1EZZB 1SL0A 1VQ9S 1SJ1A 1D8ZA 2ZH2A 4L6V3 4LQ3A 3BGRB 2MGZA 1KHWA 4DCJB 2VA3A 4D3GA 2HLTA 3T1YF 3FC9A 1S9EB 2JLEA 5FLXY 2UV8A 1XMQF 4RNHA 4YHHJ 4ZVSB 2DH8A 1WC3A 3GYNA 3EYZA 2E1RA 4C7QA 4LIWA 2CPXA 2VIHA 3W61A 1D8YA 4RUAA 1ULRA 5L46A 4J9QA 3ZTRA 2J8SA 2ZJPQ 3UPFA 2CQBA 2FJDB 3PW4A 2W2OP 4IFVA 3KHHA 2CPFA 4B9SA 3AXMA 4FP9A 2GVZA 1FEEA 4R0JA 1NSQA 3UD3P 4P2SA 3BO3A 4CLZA 3CCWA 1TAUA 3K58A 1MROA 2YKOA 2QYGA 4KO0B 2HHXA 2N3OA 4IYQA 1HNVB 2J0QD 1F60B 4EZ6A 3UVJB 2WSFC 4URGA 4JB8B 2JWNA 1NB7A 5ETRA 2Z0GA 4NE9C 5F0UA 2RSQA 3OTDA 2AYEA 2CPDA 3DM2B 4YQWA 1NK7A 5LJ5Y 2B4UA 1RT3B 1FRJA 1IQTA 3CD0A 2E5LF 1KRPA 2KXNB 3F73A 4KPCA 2UUBF 2RU9A 3K57A 4KC5A 2W4PA 2M52A 4B9VA 1KVIA 4DR2F 2XSJB 3CCSS 2X1AA 3LGMA 4WIIA 3CJKA 5HVFA 1JNZB 3AD9C 3OSPA 2ZH6A 5C25A 3TP2A 2CPEA 3HKZD 4FYXB 2DBBA 4M5IA 5DG8A 3BF4A 3TVZA 4A46A 1GXLA 4DF8A 2BW7A 2MLZA 2MKJA 3I96A 3M8YA 5GAEU 1F2GA 2YWFA 5KT4A 2D3ZA 3QJJA 5BYRA 2MJNA 2LXUA 3T3FA 3H2LA 1FNOA 3HULA 4GC7A 4URQU 2KO1A 1KC8T 2XZTB 3BN4A 3QGPA 3ISND 4ZP8A 1RTDA 5LMUF 2CXEA 3R7SB 1IKXA 1S6PA 5F8IA 1N54B 1ZAXA 5K8PA 2IVFB 4NXNJ 3BM7A 5FIIA 4ED6A 3QLHB 3PHEA 5EWEA 3FVYA 1B0TA 2M2BA 4G3IA 4GKJF 3PKYA 1BQMB 1A9NB 2ALZA 3V6DA 2RH3A 4P71A 4PWUA 1BLUA 3DDIA 4JI4J 3QFWA 4YUDA 1SC1B 2L48A 3NBPB 1U2CA 3OHAA 1RAJA 2UXCF 3LGNA 3BO2A 5D3GA 1JQGA 4HLBA 4DL3A 3CDBA 4ZP9A 4NI2A 1H74A 4Q45A 4I4BA 3M32B 4F4XA 1MU2A 5KG3A 1EQMA 2VG6A 3FRYA 4Q7AA 1VBYA 3NNAA 3GIRA 2QMXA 2RS8A 4I7FA 1FJEB 1Q8KA 2MHNA 4AXJA 3GG0A 3I87A 2EKNA 5D4LA 2XMUA 3EE3A 1F2HA 3HHLC 3M2RB 2WVFA 2F4VF 1U47A 2YBVA 2AT1B 1VQ7S 3I0RA 1LKZA 4LF6F 1UEVA 3KDOA 2UU9F 4NCAA 2E5JA 1RCOB 2CDQA 2HNYA 5HJYA 4P75A 4Y28C 1TL1A 3PRDA 1ITPA 1VHFA 1QTMA 2DXFA 4DUZJ 1X8DA 1TKTA 4ZN1A 2B5JA 1BQXA 3MFHA 3U1MA 3J81Y 4I69A 1U1OA 1XN9A 2PEBA 2JEGA 2PT0A 1FWKA 2W7OA 2KYXA 4LBIA 1NK5A 4LRCA 2IA6A 5E3PA 2BW2A 3QBCA 4EU0A 3QSYB 5HQLA 3DFEA 4EFAC 2L08A 2VDIA 5CH7B 2WW4A 2XI3A 1FRHA 1LW2A 3DRXA 4QIWD 4FPRA 5I3QA 1S79A 3G6ES 2X3DA 5F3TA 1S7IA 4ZP7A 3T5JA 2OSRA 2G13A 3CVKA 3J7ZT 5GAGU 3JQKA 1R0AA 3R2DJ 3ZZZA 4IOCQ 1M1GA 1LV5A 2MB0B 3PEJA 2P2CB 4XK8C 5K14A 4USMA 2HQGA 2DHSA 1WG1A 1K1QA 5DDOC 2KM8C 2HNZB 4DSEA 4CH7A 2B3TB 3NWGA 1JLCA 3MPWA 3KKFA 4LJMA
chains in the Genus database with same CATH topology
1YIJS 1LWFA 4AL6A 3G4SS 3BEGB 2ILYA 4DSFA 4ID5A 1ZETA 3RYLA 1GXTA 3DM2A 2F7VA 1AXQA 1ZPVA 5J1EB 1KOOA 4MKAA 2OPSA 3KLEB 2HHSA 1FD2A 2IBOA 2QV6A 4DR4F 2ZHOA 3IG1B 4C3MA 1OWXA 1UVJA 1IKVA 2EBGA 4MFBB 4DLEA 4AQYF 4JI7F 3CDAA 2RNEA 4I0WA 4C8KA 1K9MT 4I6WA 2BABA 2UXBF 2KVIA 1N5YB 3SCJE 4FS1A 4DV6F 2WSCC 1WF2A 3DHXA 2KT3A 2EFQA 4KKOA 4O44B 4J9MA 2Y1IA 4NLTA 3NL0A 1IN0A 2D9PA 2VQFF 5KT2A 2XSJA 1VC5A 3CB4A 5CZVA 2LA6A 2DNPA 1CC7A 2LQ9A 3LP0A 4A8XA 2H5EA 3BO4A 2V8HA 4NLOA 4K4WA 1URNA 4X4VA 1B64A 4RW6A 1LWEB 2B4VA 1IJEB 1C0UB 1OQ6A 4J9LA 5B7WA 2DHXA 1XR7A 4J9KA 4QYRA 5KFSA 5L39A 3MECB 2DITA 3VZIA 2EFPA 1O51A 1S4FA 4WXWA 1FVSA 4YHHF 2Z2LA 3NCRA 5CD4H 4KFBB 3LOUA 2LECA 4ZPVR 2UV8G 4KGMA 1EP4A 3AA8A 3FFIB 2WCXA 4WJBA 5T41A 3RW7A 2FVQA 2ZC4A 2FB0A 1T3OA 3MD3A 4TQSA 3UQSA 1G2EA 4X4OA 4HTIA 2EKYA 2BYCA 1QY7A 2OPRB 3S01A 3DRPA 3HHEA 4XDDA 2WHOA 1YJ9S 2CQPA 1UA0A 2J7KA 4N5SA 2EK6A 1VFJA 4NLVA 3WBZA 1D3WA 1FO1A 1UJ6A 1NJXA 1FERA 1Z2LA 3PW2A 2FVRA 1GXUA 3GYXB 2UVUA 1FDBA 1M0SA 1X4BA 3DN9A 2DNLA 2IC3B 3OSNA 2HHPA 4TN2A 2X3GA 3DI6B 5HL7Q 3VAIA 5HP1A 2FPHX 4KV8B 5M2PA 2CRLA 1U1QA 1VQ6S 3UWTA 4CTAB 5E0OA 2B9YA 1PC4A 2XMJA 1S72S 2A3JA 4N76A 4WFBQ 4QIGA 1F5CA 4NMLA 1OPZA 4R8UB 1S6QB 4OZ1A 4X62F 4DFMA 3P96A 3MM9B 5IZHA 3MMCB 2HLUA 4ZCMA 4P7TA 1S6UA 2G1DA 3I32A 4QQBA 4AE5A 5CYJA 3BQ1A 4LSLB 4DR1F 4NCGB 2DNHA 3I4PA 2PD1A 3QLHA 1XR6A 3MGJA 5KFLA 1YRXA 2VA2A 1VK8A 2PEHA 5DM7Q 4DL5A 4U9RA 2WONB 1VQLS 4ED2A 3LWLA 2OFGX 1BQMA 3R5AA 1FTRA 1VIXA 1Y9OA 1QVGR 2PA3A 2DJWA 5LL6d 5DQHA 3UR0A 4B02A 3TUZC 3OR1B 1X5TA 2ZBIA 3R3TA 4IRCA 3OL9A 2J6TA 2F9DA 2SXLA 4DFPA 3K0JA 5F8JA 1VOMA 3I0SB 4IOBA 3UE2A 2W9CB 3DLKA 3AB2B 3T1HF 3FSYA 1OPIA 5E3QA 2ZZMA 3M8PA 3HI9A 4LUBA 4PKDB 3UR3C 1JLAB 2OTJS 2RDJA 3QIPB 4U7CA 2ZVSA 1NH8A 3DLBA 1FK9B 1G7CB 5K9FA 5G4DA 4PXDA 1SV5B 4LSNB 2MKIA 1KNZA 2DNOA 4JI2F 1SH3A 2YNGA 1R3NA 4A8WA 2GQQA 5LXYA 4D3HA 4Q0BA 1LXNA 2FHOB 4KAIA 2RQCA 3R1HA 1IM4A 1U2FA 2BE2A 2YNIB 2ZH5A 4YOEA 3AQPA 3M6XA 5DDQC 2BZ2A 3KNGA 4ZP6A 2O67A 4OI6A 5J2NB 1QSSA 3M32A 3SV4A 1X4FA 4DQQA 3MMJA 1N56A 3R1LA 2UVRA 1TL5A 1C1BA 1KOHA 4K2XA 2BJEA 2YTCA 2IAJB 2W25A 4YR3A 2AGOA 1TFYA 2OSQA 4K5SA 5CHCB 3WC0A 4RW9B 2R7OA 3JSMB 2ZUGA 4ECXA 1IBKF 3E2EA 1S9GA 3UCZP 3ICLA 3M05A 3IO1A 2JEJA 5ADZA 4ZHRA 1RISA 4EEYA 1FRKA 2HNDB 3MMAA 3KNAA 4OJ3A 2J6UA 5B09A 3MEDA 2BA9A 2LDIA 5JJBA 3TYTA 2YH1A 4PXEA 3JAMY 1E6VA 5K5MA 2VG5B 3O1LA 4NYPA 1FESA 3G71S 4ED3A 1U45A 3NNHA 2WTFA 3M2RA 3M1VB 2NQPA 5KT7A 1RT7A 2E5HA 1ZTWA 2JLGA 2QO3A 2GC8A 2HZCA 4OZLA 4IO1A 2DHGA 4DDFA 3GB0A 5BYSA 4Q5VA 1U1MA 2JC1A 4C97A 2CQ3A 2XLIA 3KK3A 1JXEA 2HWTA 4DN0A 6FDRA 4A8MP 2NS1B 3K5NA 2B7CB 1X9MA 4IUFA 3KLFB 1Q82T 2KYZA 3HVTA 4OLPA 3AAWB 2UZAA 1DJ0A 4TLQA 2HVIA 3N6LA 4TY8B 4X4NA 1U1LA 5HQ8A 3J7Z5 4M1KA 3M8SA 1YJRA 2V8VA 5IQ6A 2VBZA 4QW9A 1TK0A 3IN5A 1VMBA 3NMAA 1N5QA 2HG4A 2K7JA 2C3OA 1FNXH 1FCAA 1RT5B 4OX9F 5KFZA 2N7YA 5HBMB 4KHMA 4DQRA 1BQNB 2DNQA 3GFXA 5DG9A 5JVHQ 2OP5A 1YJTA 2CZ4A 1HI0P 2QSWA 1QVFR 4NXNF 3C46A 3ISZA 4X4PA 3SFGA 4JV0A 4FNIA 3I5AA 5A0YA 1V6HA 4C2MA 4HHJA 2ZZNA 3J7A1 2QA1A 5A8WB 3D54A 4WYLA 4KHRA 3PM9A 5KG1A 2WOMA 4ZCIA 3N79A 1FRXA 2ACYA 4MH8A 2OFHX 5T7LA 1S1UA 2K1RB 3EZUA 3OPKA 1C0TA 3TAMA 3MUVP 5EN1A 3HVWA 1TV6A 4RW7B 5KFPA 1M1KT 2GX8A 2QZ8A 2OAUA 1OS5A 1UKUA 2LCWA 4K4UA 1IKWB 3M30B 2M4MA 4IFYB 5J2MB 5KFCA 2R2RA 2W4DA 3IFEA 3LW5C 3HVRA 4J9SA 2F8MA 4ZPWR 3NCQA 1WF1A 1G3OA 3CD7A 4IG0A 3DRSB 1HA1A 4HDHA 1FJ7A 2RDIA 1RT2B 2VPYB 3EUNA 3GG1A 1HNIB 3Q0AA 2R7XA 5K8OA 3KHGA 4IKAA 4YR0A 2GQCA 2DR9A 4DR5F 4QR1A 3I56S 1Y5LB 3DLGB 3DDKA 2VG7B 4MIAA 3CJ4A 3GMGA 4QR0A 2AJ4A 3CCRS 4PG5A 1KN6A 1U1RA 3OXFA 3TA0A 4F2SA 2R8HA 2D3OR 4Y2IA 3U7JA 4MIBA 5DM6Q 1S1WA 4AUKA 4QU7A 2XS7A 3MM5A 4C9DA 4PPZA 2B6AB 1M90T 1QSLA 1X4AA 3FSIA 5H9EJ 2R7TA 2ZKTA 1ZM2A 4TY9A 3ZZTA 2N4CA 2HS4A 3M2UB 5D4PA 7FDRA 3HK2A 5KG5A 3QJPA 3K5PA 3JSRA 1FD8A 3GR0A 2M7SA 2VPWB 2LLZA 3H5SA 3CDWA 4YDDB 3RBDA 4FXWA 4ZCKA 3GV7B 4J9RA 3PKMA 5J2QB 1DTQA 1FKOA 5C42A 3FSXA 3TO8A 2AJFE 4I6YA 5HROB 2KJWA 2FGCA 2F40A 3SSRA 5AXMA 5LSOA 2XBPA 1Q79A 4TNOA 1JXLA 3CULA 1ZOTA 1K0TA 1HQUA 3DLEB 2R8JA 1V3ZA 1S0OA 1IQZA 1SKWA 2RE1A 3I82A 1O0PA 2O01C 4PRFA 3BN7A 4A4JA 2KU7A 4KRWA 1WEZA 1RT6B 4KPYA 3LAMA 4C0BA 1NKCA 4C8MA 3MWBA 2EG2A 4CIOA 3BQ2A 1KFSA 4JBCA 4OHXA 2VASA 5G0RB 1HARA 4IRKA 2OH2A 4MK8A 2JRSA 3K2YA 3ZFVA 1L3SA 2AQ4A 3T9ZA 2BDPA 1SJFA 2XWYA 4DEZA 3UCGA 4JYAF 4EZ9A 5KFAA 3M8QB 3VQSA 1KLNA 2BVZA 5J1EA 3RAXA 3S7RA 4R5PA 4K4VA 1TVRB 3DOMA 3FMWA 5HLFA 3CDUA 3IG1A 2M70A 3NCPA 2V2KA 3R5CA 2J8AA 4QWEA 3RAMA 1RTJB 4MFBA 4I64A 1YJWS 4JI6F 1X4EA 3M6UA 4ZDNA 4URSA 3EXYA 5KAKA 1RT4B 2B51A 2W24A 2ZE2B 3OTCA 2DNRA 4U7UK 1N5YA 4J9PA 1QAYA 1H2VZ 4JI4F 1FDAA 1M5VC 1SJRA 3IC1A 3KOAA 3BGFA 4Y0FA 2A10A 4O44A 3LALA 4DUZF 2W7AA 4FNHA 5DDRC 4I67A 3NP5A 4ATNA 2C3PA 2AX0A 4ZPBA 2DCUB 1SL1A 5L1JA 1S77D 2DNZA 2P5VA 3RB4A 4OIXA 2I8EA 4C8ZA 1C1CB 5B0EA 4E0DA 3V4IB 4DS5A 3DNCA 3M2VA 4HTJA 1LWEA 4Z2XA 4ZPAA 1C0UA 3C2PA 2LEAA 5F9LA 4RW4B 5LSRA 3OTEA 1N5SA 2EWHA 3MR2A 1H6KX 3MECA 2MQMA 4Y2KA 2V5HG 2VFTA 3DMJB 4WZMA 4NLXA 2XGPA 1Q8BA 1SIWB 1XEZA 3MAHA 1Y7PA 2NPFA 4V19J 3H2UB 1S1VA 3MXHP 2DNGA 4KFBA 3F56A 1Q4RA 1S0VA 3LP2A 5U47A 1HFEL 2GJIA 5B0FA 2E1AA 4H4MB 4H4OB 3HJFA 3QYYA 4RU9A 4DSKA 3MEGB 3U1NA 5CZXA 2ASYA 3IS9B 2IMWP 4OHWA 2OPRA 1HI1A 2HIQA 1HHTP 4G6VB 4BBYA 3WDOA 5KFFA 3IR7B 1X0FA 1KLMA 3EPGA 1L5UA 2MSSA 3BSCA 4JI3F 2VZ9A 4RWWA 4Z37A 1T7PA 3VCDA 1LK5A 2IC3A 1RYRA 3DI6A 1GQEA 1KTVA 2JFDA 3CIZA 3HT3A 2AJQA 2YX7A 4A8QA 2VQEF 1C4AA 1B0PA 4OLOA 4CTAA 2APOA 1U24A 3GWCA 4FF1A 1RJJA 4QWAA 2HHTA 2OPQB 5EX0A 5IXUA 4TKTA 1MROB 3Q22A 3E8OA 1S6QA 5HMZA 4TYAA 4U67Q 3L7OA 3MM9A 3MMCA 2N7CA 3CCUS 5AXLA 3OVBA 4ECVA 1E6YB 3FZBA 1ZBTA 3MM6B 4LSLA 4EBDA 1ZM4A 4NCGA 1EETB 2VFVA 1TKZB 2YWGA 4YB5A 2KZZA 4B3TF 2KDOA 1RKIA 1I94F 3MF5A 2NZ4A 5IQQA 3Q24A 1R8HA 3HDSA 2WONA 5GVQA 5A8KB 1UVNA 1HWIA 4Y34A 3UDCA 1TL3A 1UETA 1R8CA 3G86A 4EYHB 2W4CA 4IRDA 1RTHA 1SUQB 3RRHA 2R7RA 1NKBA 4DR3F 2HFZA 1XBWA 1H38A 4FVMA 3C66A 2ZD1B 3BGRA 3I4HX 1F5AA 1FE4A 1RQ0A 3FCHA 4KT0C 4USHA 1CC8A 2DHAA 3OR1A 3GV8B 5KG4A 3WC2A 3OUYB 1HPZA 5KG0A 2ZOMA 2DD8S 2HHWA 2GIQA 4OZ5A 4AFFA 3KK1B 1P8GA 1PGZA 4MJKA 1K73T 2VD3A 2ZOGA 3KWMA 3SSSA 3I0SA 2HHUA 1YRUA 2W9CA 3RTVA 2EW9A 2ZNZA 2DB1A 3NAIA 2CQDA 4TU9A 2EC0A 2J9EA 3LF0A 1JKHB 1GAOA 2K3IA 2KHDA 4G1IA 4YB6A 5I3PA 3SCLE 3VTIA 1RI7A 2FD2A 2HHHF 2VOPA 1U26A 2MKSA 1JLAA 4NLSA 2J0SD 1TR0A 2AV5A 5KFEA 3T9NA 1RGVA 4JI5F 3MOJB 2HHQA 1VS3A 4KTQA 7FD1A 1ZZNA 1VJWA 4LSNA 4PUOB 1CPZA 2FJEB 2CPYA 1VQOS 2X1BA 3H4BA 3NS6A 3T19A 1VQKS 1DBDA 3U1LA 3FEXB 2Q6BA 3KFWX 2MKKA 1KONA 1T03B 3KHLA 2YNIA 3DGPA 2O3DA 4N47A 2W9AA 5KT5A 4OHYA 2CIMA 4WCEQ 1I6JA 1HWKA 4NLWA 5CYMB 2PI4A 2ADCA 2AJ0A 3QGGA 5J2NA 1XERA 1HQEB 4C0HA 2F8EX 1W25A 4ZVFA 5LXRA 4NLQA 3LUYA 5B0GA 1BD6A 2KN4A 5SZTA 1HNXF 5IT9Y 3OTBA 2Y1JA 2IAJA 1U25A 3HKWA 3H59A 2XULA 2JX2A 4PWDB 4K4XA 2DPJA 2HYIB 1IJFB 2K7KA 4RW9A 3JSMA 1S0NA 3UCUP 2JVRA 4KE5A 2GGPA 4CZCA 4UOCA 4K4TA 1Q7YT 4YR2A 1WI8A 1XTZA