2KT2A

Structure of nmera, the n-terminal hma domain of tn501 mercuric reductase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAIVPGTSPDALTAAVAGLGYKATLADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NmerA of Tn501 mercuric ion reductase: structural modulation of the pKa values of the metal binding cysteine thiols.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Mercuric reductase
total genus 14
structure length 69
sequence length 69
ec nomenclature ec 1.16.1.1: Mercury(II) reductase.
pdb deposition date 2010-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kt2A00
4Y2IA 1X7VA 5A6PA 2IYGA 1Y9OA 3WDOA 3MZIA 4OJHA 3HHLD 5B0CA 1TL4A 3TOQA 5T7LA 2K2PA 2ACYA 2VH7A 1Q53A 1R6YA 2QYCA 3FGVA 3VTIA 2XMJA 4YDXA 1AW0A 2K7KA 1URRA 2AP6A 1N5VA 3BN7A 1K0VA 1SQEA 2L3MA 2GFFA 2ASYA 4EFAC 1YJTA 1V3ZA 3DXSX 4OJGA 1SI9A 2G9OA 2XMKA 1X0PA 2ROGA 4ZA1A 3HFKA 2LDIA 4Y2MA 3HHLB 2PGCA 3LGNA 3MCSA 1APSA 2HIQA 1WD6A 3FMBA 5B08A 1YRXA 2K7JA 2XMUA 3IWXA 1S6OA 1Y3JA 5B0EA 3T9NA 1TUVA 1KQKA 1X8DA 4A46A 3HX9A 3LGMA 2OD4A 3QMQA 3CJKA 1CC8A 2FTRA 1VQSA 2GGPA 4YEAA 2FHMA 1TZ0A 1YG0A 2GA7A 2GO8A 2JDJA 3BB5A 5F0UA 2OD6A 2RU9A 2XMTA 3GZ7A 5B09A 2K1RA 1YJRA 1CPZA 3I9ZA 4NPOA 1MWZA 4HI1A 1MWYA 1Y0HA 3BM7A 1Y3KA 2LQBA 2AW0A 3DCAA 5KAKA 3UDCA 1N5SA 1RJJA 1YJUA 2QIFA 1AFJA 2CRLA 2BJEA 2HLTA 2BYCA 3TNVA 1OSDA 2FB0A 2W4CA 4DPOA 2W4PA 4FNIA 5T7LB 2VV5A 2RMLA 2LQ9A 3K7RA 1Q8BA 2QLXA 1P8GA 1W2IA 2XMWA 3F44A 3FRYA 2OKQA 3HHLA 1FE4A 2N4CA 4HL9A 4ZOSA 2ROEA 3KNGA 4DN9A 2OP5A 3KG0A 4A4JA 5B0DA 4HH1A 1JK9B 1GXUA 3BGUA 2GV1A 4HH0A 2KT3A 2ZDPA 2OFGX 1TL5A 1OQ6A 2HFOA 4OJ1A 2FIUA 3BF4A 1Q4RA 2ROPA 3TRGA 1N5QA 2W4DA 2BUNA 2OFHX 3HDSA 1YJVA 4NL5A 3BR8A 1FEEA 4OJ3A 2OAUA 3KKFA 2IFXA 2AJ0A 3IWLA 3QGPA 1OQ3A 1ULRA 2K1RB 1P6TA 1KVJA 3LO3A 1FVSA 3HF5A 5F0WA 4DL0C 2HLUA 2KYZA 4Q2LA 2OMOA 4QOTA 1QUPA 1VQYA 1SB6A 4A47A 2XMVA 2GGPB 2XMMA 4OIXA 1S6UA 2RILA 4HI2A 5B0AA 1CC7A 2N7YA 5B0BA 2BBEA 3BDEA 2PD1A 1GXTA 5A6WA 5IXUA 1FVQA 2KT2A 1KVIA 2BJDA 5K9FA 1U7LA 3KG1A 4Q2MA 2EW9A 2HQIA 1LQ9A 1N5TA 1OPZA 2AJ1A 2HFNA 2GCFA 2ZDOA 2IYIA 4U9RA 1IUJA 4Y2KA 1AFIA 1FE0A 2KKHA 2Q3PA 5B0FA 3CJKB 1TR0A 1Q8LA 4A48A 3E8OA 5B0GA 2QLWA 2LXFA 2N4DA 1FD8A 1FESA 2RSQA 4F67A 4FNHA 1JWWA 1XBWA 3HHLC
chains in the Genus database with same CATH superfamily
4X64F 1S4EA 4I7FA 2CXEA 5FLXU 3PIPQ 5A8KA 4U7UK 3HHLD 4JBCA 1VRQC 3WX4A 2DGSA 1W26A 3LGHA 1HHQA 5HLFB 1JLBA 5KG6A 2M8HA 1BWEA 2VH7A 3FGVA 1YQHA 2BJ3A 2YWHA 1HI1A 1J5EJ 4YY3F 1TK8A 5AT1B 2YNHB 3B4DA 1UTAA 3DRSA 5HI7A 3KHLA 4NYPA 2OI2A 2RQ4A 4DX7A 2YNIB 2X51A 4FYVB 2FZKB 2IRYA 3P8BB 4XPEA 3Q86A 2MQOA 2NQPA 4B08A 3PW2A 2EK1A 4O3SA 4LF9J 4DPUA 2IVYA 3I0RB 2RHSB 3LP1A 2J8SA 2HFZA 6FD1A 5ETTA 4F26A 2YNGA 4HHJA 3LALA 2QL5B 4XDCA 2B4PA 1VJWA 4NLTA 4FXVA 1C4CA 1DQAA 3HVTB 1Q81T 3KK2A 2RE1A 1HMVA 3CEDA 1WTFA 4AYBD 3G86A 4KO0A 4OHZA 1SXLA 2FDNA 4CP5A 3SIPB 2B9EA 3FSXA 3HM9A 1S0OA 1RWVB 4UQTA 1H74A 4PWWA 4B9SA 4IRKA 3D3BJ 4JI6J 1L3KA 3ZNUA 2FVQA 4DFJA 2QT7A 1U6FA 4Q8FA 2M0GB 5KFVA 2BRLA 3BBFA 1G1XA 2OHDA 5HATA 4KFBA 1C0TA 3K7RA 1IKXA 2MJUA 3H2VE 3HKWA 1VQ8S 3CTRA 1WG1A 2UU9J 1FE4A 3JAMU 2FJEB 3VAIA 3M7VA 1SL1A 4X4VA 4ITSA 4WBFA 3W2VA 1CJTB 3SCLE 5GMKa 1LV5A 4E0DA 2B51A 4JV5F 5FIIA 2VC0A 2EEYA 1AROP 3BPSP 3GWCA 1RTIB 3EDQB 3PDNA 2QX0A 5KFQA 1VQLS 1C2PA 1RT2B 3I5CA 2Z57B 4JI8J 2FY1A 3AOCA 3IG1B 4ECWA 5D0RA 4FF1A 2OPSA 1N5QA 2ZHAA 4CH1A 3MAAA 2DB1A 1JLCB 1Z2LA 1LEOA 1GTHA 2A2DA 2I5JB 3UWTA 1WHWA 2DXEA 1B70B 2VPYB 2O01C 3D1OA 3KUEA 4I6WA 1IKXB 2OO4A 3HHNB 1Q8IA 1C0TB 2MPUA 3W66A 1FJGJ 1HIYA 2HFUA 2IHR1 2AZ1A 5J2PA 2HSEB 2UP1A 2QJ3A 2C2MB 2DH8A 2LXIA 1MN7A 2VUGA 2QA4S 1IVZA 1NRKA 2PA8D 1S7HA 3IS9B 2RDIA 2HBQB 5KFHA 2KL8A 2P5VA 2E9ZA 4CLSA 4DEZA 4FYWB 3I5AA 1UKUA 1VQ6S 1OS5A 3JTPA 2J9EA 5F9LA 3Q8RB 4K5RA 2BQ3A 4NA1A 1LW0A 5E3RA 2R2TA 1HQUB 1Z2ZA 2J6TA 4K4SA 1CJVB 1S1VB 4N8OA 4LRAA 5AXKA 2CJXB 1RWWB 2EW9A 3UD5A 4OYMA 2W8LA 2DGWA 1F0XA 3VZIA 4KAIA 4K7QA 2BR0A 2HYIB 1IBMF 2Z8QA 3TA2A 4NLPA 1TL1A 1NPPA 3I5BA 3PNIA 4PUOA 2CQCA 5BYRA 2UXDJ 4FNHA 2XULA 1S97A 4F3QA 2MZTA 3HXMA 4RX6A 5A6PA 1R0CB 2WK4A 4WIQA 3G6YA 1X5SA 4YMEA 3RBEA 1HNWJ 4DR4F 1RTJA 2HHXA 1VIOA 2C3PA 3KLIB 5HQMA 1URNA 2FJAB 3C6UB 4JV1A 3IAS9 1T95A 5T7LA 2DR7A 2ACYA 4WFAQ 3KJVA 1R0AB 2QYCA 3OQ2A 1DFDA 4DV6J 1RT2A 2I38A 4O4RA 3MFHA 2CPIA 2HHUA 2BJ7A 1KP6A 2BKPA 2G1HA 2MKYA 3O44A 2ASYA 4NLSA 4PPZA 2JLGA 2J6UA 3LAMA 1NK4A 1NDKA 4R8UA 1IR2A 4LRCA 4LF8J 2V4JA 3Q8SB 2QMUB 4CLUA 5DETA 3KLGB 3BKUA 5D77A 2BJ9A 3CC2S 1YITS 3NNCA 3H42A 4DU8A 4NA2A 3LGNA 3NGKA 2WAQD 4NRUA 1WF2A 4JI4F 3V6DA 2WBRA 2A0FB 3FMBA 3LP2A 4OMFG 1VGYA 5E0OA 5B08A 2OPQB 3JQMA 3HULA 1O5JA 3S7RA 4B3RJ 2EKYA 1FTRA 1U25A 1Q0NA 1RT6B 1G7CB 2D41A 2X1GA 4KIAA 4NYOA 1ZZNA 2DNGA 3UN2A 2WSFC 2Z30B 3EICA 4CNZA 4QBUA 1J5OA 2XSJB 3N9UC 4RU2A 2CG8A 2AWZA 4IO1A 2PEHA 1K9MT 2HNYB 1XERA 4O0IA 2IAJB 4NPOA 2V8DA 2BJ8A 4CTAB 2BOAA 1WHXA 2DHXA 2MZSA 4CLTA 3N6MA 4I2QA 4RLEA 2WB1D 3ZNJ1 1U02A 5SUHA 3GFZA 2BJEA 5LJ3Y 5KFRA 4BS2A 1OSDA 2ERRA 3T5LA 2VV5A 1P9YA 5F8IA 1IBCB 3THVA 1YZ6A 2OKQA 2BM0A 2YWEA 3HHLA 5E3CA 1KLMA 1RT4A 4ZOSA 3RRKA 4DV6F 1Z1ZA 1KKHA 3RB0A 2XNRA 1R31A 2Z2LA 2MLXA 3PX6A 4DN9A 3LTOA 1Y5LB 3KG0A 2VG6B 1J5EF 4WZMA 1JK9B 3A13A 3ICLA 1IM4A 3MMCB 2E5HA 5C2CA 3O2IA 4CYUA 3CDUA 1TP7A 1T05B 2ZE2B 2G0JA 4WYWA 1RTDB 3FBBA 3SEOA 4CO0A 1NKCA 4NLDA 4DR2J 3A4TA 4BC9A 4EU0A 3OR2A 2W9AA 1ZTTA 2FIUA 5LT5A 4YOEA 3DU6A 3MM6B 3UCGA 1MMNA 4K50A 2V67A 3FSYA 4J91A 3B54A 2B8QA 1NU4A 3EVMA 2ZWPA 4OJ3A 3V6JA 4QYRA 1GH8A 4P73A 1VISA 3H7HB 2M8DB 2PE8A 3DYAB 1DTTA 2D3UA 3BREA 3JSBA 4NLOA 5LMUF 4OYWA 3D2WA 4Q2LA 4WYLA 2BQUA 4X65J 1S79A 4WF9Q 1RCXB 1HBMA 2BJ1A 4KPCA 3CULA 4C0BA 4CYUB 3MMCA 4P7VA 3D28A 4HHUA 3KLFA 5K14B 3JSYA 4KTQA 4XAKA 4LFBF 4NLUA 4PABA 3NGDA 2GGPB 5LM7E 4N77A 1UWBB 2JJ4D 2VKZG 4L73A 3SCKE 1QDUB 1UP1A 3MI7X 3PFEA 5KFFA 1M5OC 2DPJA 4G3IA 1X60A 3HJFA 1WELA 4H4MA 1X4CA 4OZ1A 3NAHA 4NLRA 4JI0F 3N79A 4RW6A 1C4AA 3ILOA 2AYMA 1FDBA 1XR7A 1LQ9A 2HFNA 2P2CB 3A1YG 3DMJB 5ETPA 1CBKA 3VQSA 1D09B 4MFBA 2PN6A 3KJQB 4IH5A 2HK2A 3IM8A 2W2QP 2Z0GA 2CDQA 3T5HA 5IS2A 1R27B 5LJ5Y 1XIQA 1SKSA 2VA2A 2B6AB 2MQPA 2ZM6J 2W8KA 1UCNA 1GNKA 1RAIB 2DXFA 4ZCLA 5I3QA 1N32F 1UA0A 2C2EA 2ACMA 2RUGA 1F2HA 2M7SA 4OJHA 5D8HB 4Y6IA 3N6NA 1QAXA 2C3MA 4ZVHA 1EKSA 3JYTA 3I31A 5KOXA 2F1FA 4ECVA 2FUG9 4DQSA 4ZPWR 3PZPA 1H98A 1QJHA 4QIFA 5IWAF 1RBAA 2NS1B 4MJKA 5DRKA 1RT5B 1PILA 5ETNA 3NCRA 4NZ7A 5HN0A 4ECSA 4KHPF 5CH7B 1VOMA 3ETMA 4WKRA 1QSSA 2DNHA 1Y10A 4XTTA 2KXNB 1PCAA 1TQLA 3UVJB 4HEA9 2OPPA 3TWZA 4EBCA 4C8LA 3AOAA 3OVAA 4O3RA 1UEKA 3DHXA 3QFHA 1LWFB 3FCVA 2R2RA 3GG1A 2NPIA 2FHOB 4JI8F 4TQSA 1P9QC 2RRNA 2YKOA 1TMJA 2DISA 1APSA 3HKZD 3JTNA 4A8SA 2P6SA 1WC4A 3CE8A 4RR5A 4JI3F 2J9CA 3RU0A 1O6XA 3F56A 5HP1B 3U7JA 2QLBB 2WB4A 1U1QA 1VRTB 2ZC4A 2XY7A 1KNZA 1UVJA 2H51B 1TUVA 2X1AA 1S1WB 3M30B 3LGMA 4OI0A 3T6JA 2FD2A 1FA0A 3R3TA 2JDJA 3FJ2A 2GO8A 4CLZA 4F02A 2UV8A 4U8VA 3RBXA 5L9NA 2K1RA 2WVDA 3MEGB 2ZJQQ 1CPZA 4KE5A 3O3LA 4HI1A 3FZBA 1TVRA 5MAOA 3UR0A 5E3QA 4O44B 1NDLA 4TYBA 4ZVQB 3LANA 2IVFB 1YIJS 2F9JA 4B3MJ 3IP0A 1MN9A 3SDEB 3F44A 2Q1LA 2V94A 3TA0A 2X1BA 1BGXT 1MU2A 4NLWA 4O0NA 4JI1F 4DR3F 4X4TA 1BXNA 1AXQA 4IOCQ 2GQCA 2PFFB 3FVYA 2YPZA 4KHMA 5U47A 1VQOS 1H38A 3F73A 2JX2A 1GXUA 2F5GA 2KM8B 3GFXA 3CXCR 1RHMB 4I64A 2L41A 3BO2A 3WZ0A 3QAUA 4RW4B 4OHVA 4TY8A 4DZ6A 3EPIA 3T5KA 1RTDA 1R43A 2RKIA 3ISNC 4OJ1A 4CZCA 4ED6A 3NOCA 3MMAB 2UVRA 2OLWA 1FKPB 2NZCA 1JXEA 1S1VA 1U1RA 2XB2D 3HDSA 3IN5A 4C98A 2G13A 1JJ2R 1RTHA 4ZHRA 2DNOA 1DQ9A 1KTQA 4S0MA 2ZH4A 1QAIA 1HNIB 1NZAA 2XBPA 1EJ7L 1SUQA 1LWFA 1ULRA 2YY3A 3IRXB 3QYYA 5D0GA 1P6TA 2DNNA 4OI6A 2FVSA 3IG1A 2B9XA 3TAQA 1QY7A 1N34F 2HHHJ 3LF0A 1MNEA 2YTCA 3R7NB 1HBMB 3H4BA 1KLMB 1RT4B 5DM7Q 1C1BB 1S72S 1SH0A 4DUYJ 3R7BB 4EI2A 4U7UD 2M3DA 4NCAA 2Q79A 4DL3A 2A10A 1A0OB 4M5DB 4ERDA 4DR7F 4OZLA 4PR6A 3UO0A 2VDIA 3J81j 3I55S 1EETA 3V81A 1FI4A 1FF2A 1SH3A 3N5BA 2ALZA 1NAQA 2G2YA 5K8PA 1KVIA 3GYXB 5AXMA 5HJYA 1OY8A 3EZUA 4N5SA 4K4ZA 2RS2A 1G2EA 2ZBCA 2AJ1A 2GCFA 4IDKB 4DSKA 1N54B 3C2PA 1LKZA 2KKHA 2PC6A 4YN3B 3GPAA 1V6HA 4X4NA 1UFKA 1UJ6A 1Q8LA 3HHKA 4QW8A 5J1NA 3UFCX 2IDLA 3S8SA 3Q8YA 1M1KT 4PG5A 4F67A 2CDRB 3VAGA 5IT9U 5A0YB 5F3ZA 4ILLA 3TUPA 1X7VA 4C0OC 4CO2A 4E8UA 1M1GA 2QE5A 3ETOA 2RQMA 1ZTWA 3CGIA 5JMNA 1NNDA 3L09A 3QJPA 4U96A 1PBAA 4PG7A 2LYVA 5K14A 3FBEA 3GIKA 3VAFA 2CPYA 1XMQJ 1V5VA 3T9ZA 1K8AT 1D0EA 2K7KA 1U8WA 2GVZA 2JNJA 1FDNA 2QG9B 1SJQA 3EGWB 1H6KX 3AXKA 1YJWS 4DV2F 2ZH9A 2C2OB 2VPXB 1V5IB 1GAOA 2HBRB 3IBFB 3M4XA 3MPWA 4FDFA 4N8NA 4OLPA 4F0MA 2DGUA 4DR2F 4DZDA 3CVKA 4QIWD 4P52A 4AFFA 3RR8A 4A8XA 1Y11A 2D69A 3Q23A 4LF5J 2XY6A 2KZMA 3HHLB 2HIYA 2PMZD 4J9LA 3T3FA 4NI2A 1IKYB 2JFDA 1D9FA 4HYKA 5KFTA 2YKMB 5DJBA 4LREA 2A1BA 4EO8A 4ECYA 1YRXA 4GKKF 1WNEA 2VQEF 3R9LA 4QZVB 1GMWA 1ROFA 1X8DA 2WVBA 4C3MA 1Q82T 2BRKA 3MF5A 4WFYA 4MKVA 4X62J 3IA0A 4RWWA 4PYAA 2BZ2A 2P9CA 4NCBA 1Q7YT 3FBFA 4HVZA 2CFXA 4AXIA 4J7CA 4M5HA 1L5UA 5LMNF 2VFVA 2AW0A 2DHGA 3QO9B 1IKVB 2K3IA 5DG8A 2MQMA 3HSGA 4P74A 2XWXA 3V2UC 1YRTA 4ZCMA 3QT8A 1C1CA 2ADBA 2N4CA 4RBUA 1S1TB 1SKRA 4ZVSB 1TELA 1FRLA 4FN5A 2PI5A 1MWQA 1MW7A 1RBOB 3G8SA 4HKQA 9ATCB 4A4JA 3RBZA 5KFGA 2QEXS 3F41A 5A8RB 1I5OB 3QGGA 1L3TA 2C3UA 2JL9A 3GFYA 1PAEX 1UPPA 3VHQA 2XO7A 2IMOA 1TL3A 3WBZA 4EMDA 5DQIA 3DLJA 2OFGX 4EZ9A 3W9IA 2KVIA 4ANCA 2EK6A 2HBZB 3KLEB 1B4SA 2HWTA 2OEMA 3D6TB 1S6PB 1Q16B 1JNZB 3MR6A 1SKWA 3ZTSA 3JSMA 4K2XA 3RB4A 1RWMB 2CAJA 3D66A 2UUWA 3ZXWA 2QTWA 2XCAA 3PM9A 4RZRA 2IFXA 4ETZA 2FPHX 2ZH8A 2KRBA 1VC0A 1PO6A 2CZ9A 4WWSA 2HQFA 5GAGI 4OYAA 2XS5A 3ZTQA 3C3LA 1TKTB 2WW4A 4PZVA 3UR3C 1KWMA 2JOQA 4MIAA 2OMOA 1TKXB 1BUXA 3PX0A 5ETKA 1VQYA 3KLHA 2XLKA 3HVRA 3UD3P 5H9FK 1SC4B 4FBUA 4BWMA 3D5MA 4R0EA 4ECQA 1GFWB 4X2BA 3T1YF 1ZAVA 3J7AN 5HMZA 2GAGC 2E66A 1RSCA 2KG0A 3MPYA 3J80U 3UNYA 2R7QA 2KM8C 4OV6A 2DCUB 2RHQB 2O66A 4JI7F 3M2VB 4IH7A 2HQIA 5DGBA 1PC4A 2ZDOA 4F3MA 2HRYA 2WOMA 4P7TA 4K4XA 4MK9A 2HAIA 2ZOFA 5DDQC 1NK5A 1NJXA 1HNZF 4KO0B 4ECTA 1KVKA 2BM1A 1NCLA 4EYHB 1JLBB 5KT4A 2X1FA 4QWEA 4DV1F 1BC6A 1XBWA 3J7YU 1Y9OA 1FKOA 2AHOB 1JLAB 3D7SB 4NXNJ 1BQMA 3OBIA 4A8QA 2HZCA 3GTYX 2KN4A 4Y0FA 1EP4A 3PEJA 1T0TV 3R6LB 3WC0A 4R0JA 5A8KB 1S59A 2VG5B 1ZM9A 3KWMA 2UZAA 3ILIA 2GIFA 4NCGA 4USJC 5CQGA 2H4YB 3UDEA 3VVTA 3JB9k 4W92B 4MTPA 4ZVUB 2Q6CA 1REGX 2Y0SD 4C8MA 4C7QA 2OMLA 3B6BA 4UZCA 5A2QU 5IOLA 3T1HJ 3PV8A 1WJ9A 2DKOB 2V69A 2OUGA 2YVSA 4LUBA 3T41A 2W24A 3NS7B 2YNHA 3OJSA 3HZGA 3QLHA 3MECB 1O8BA 4FKYA 1LXNA 3J80Y 1ELOA 3OJUA 2W9BA 3SV4A 4WZQA 2G2ZA 5A76A 2N3OA 2EFOA 2CJKA 2OPSB 4H4KA 4QPTA 4YB6A 1S6OA 3EYZA 2VPZB 3PJ9A 3K5NA 1E6YB 3GQCA 1U6ZA 1B0PA 2E1PA 2JHEA 3I0RA 3CJKA 1EHWA 4HACA 4BCAA 1YTYA 4LJMA 4M5IA 3K89A 3BB5A 5M2RA 3H25A 3UCZP 1FJ7A 1JLQA 4CNYA 4UOCA 2RU9A 2WHOA 3H2UB 4Q43A 4GVBA 4JI2F 2CPHA 1ZAWA 2QSFA 3PACA 4P2MA 4WK3A 2YKNA 3ENWA 3SV3A 5I42A 3TEGA 3KMQA 2KFNA 1K0TA 4DR7J 5IC4B 1A6LA 3UDCA 5KFOA 2DR8A 1RJJA 4LFBJ 5KT2A 1GMWD 2AX1A 5J1PA 1ZBTA 2FB0A 1LWXA 4EO6A 1SUQB 3PRBA 3FRYA 2QLXA 2DY1A 1P8GA 1W2IA 2GC8A 3GYGA 1LWEB 3MECA 4HL9A 3JYTB 1RKIA 4OZ2A 2YH1A 4N76A 1NJZA 3K59A 5KG5A 1TFYA 5F8NA 2LCWA 4IUFA 3LUYA 3TVKA 3DGPA 2V9KA 4WIIA 4CCHA 1R8CA 2XNQA 2ZC3A 4LVNP 4TVAB 3TJ8A 1HR0F 4LF6F 5KG2A 3T1HF 1G6BA 2C42A 3KLEA 1MU2B 1P1TA 3CC4S 4FYXB 4ZN1A 1EP4B 2UV8G 3BDPA 1YDLA 3W7BA 4AQYF 3L4BC 2V9WA 4LF4F 1X9MA 3WC2A 2NSBA 5C25B 6AT1B 2A6OA 1ZM2A 3MCOA 1HYSB 1YJVA 1S1UA 4IOAQ 5HMYA 2FJBB 3LP0A 1MLAA 2OAUA 4ZPTR 3GU0A 3IWLA 3DRPA 1ZYQA 2CQ3A 1VDHA 3MUTP 2W9CB 5K20B 4OYOA 2DPIA 3NOGA 1RAFB 3IC1A 2JZ5A 2XO6A 1YSJA 4JI5J 2GO9A 1VRUB 2RJZA 2RIJA 2X3GA 4IG3B 5T41A 5CYQB 4O3QA 3T6BA 3C15B 4QOTA 1PGZA 1QUPA 3FQLA 2ZZTA 4PG4A 4QR1A 1HNZJ 1SB6A 2FQQB 5GAEI 3OL7A 3AJ1A 1X4HA 2CQ0A 3DI6A 2J0SD 2RDJA 3CD5A 1HNVA 5H9EK 1FFWB 4B3TJ 2GMHA 2DT9A 4DJBA 3X1LB 3C46A 4OZNA 4I7FB 3AOBA 2JWNA 3P4UB 4USWA 4AL6A 3G2XA 3TQEA 4ZCIA 1RISA 2X7IA 3SFGA 2KRRA 3P49B 4Y2KA 4PPDA 3ET6B 4AL5A 2HVIA 3MUVP 4OYPA 3J7A1 1AFIA 5DLGA 2V34A 4FYDA 3E8OA 1WKKA 2MQNA 2N4DA 3KXDA 1HD0A 2IPOB 4DPTA 2CNOB 2BDPA 5A8WB 3W3SA 4IRDA 1T9TA 2P9EA 3G82A 4R25A 3PW4A 3M8PB 4LVOP 3VF0B 1ZETA 3WDOA 3DNCA 2NZ4A 4IKAA 1X4GA 4PKDB 3PVXA 1PAUB 3ISZA 5D0EA 1TFWA 4GO5X 4DFMA 5H1SV 1GQEA 3L7UA 2C1EB 1R8AA 1S6QA 3KFWX 3I0SA 3D68A 4J9NA 1U1LA 3W65A 4DSJA 1N5VA 1B64A 4LRBA 4TYAA 5G0RA 4ZIVA 1RLCL 5HK4A 3ZZOA 2IA0A 3LAKA 3RG6A 1X0PA 4Q8EA 4LBIA 1IBLJ 4MYTA 2HGMA 3QATA 3GYNA 2IJFA 4J9UE 5KG7A 1CJUA 3OVBA 1T8EA 2HIQA 2MYFA 3CMQA 3G82B 4MAKA 2ZH1A 2F65A 5A8WA 3SZ2A 2G1DA 1L3VA 6FDRA 4DBQA 1SJRA 4KGKA 4P75A 4X4QA 4YB7A 5HQ8A 3QMQA 1KLNA 5GAEU 4C8KA 1UL3A 1NSKL 2EI5A 3LW5C 2FHMA 2R7UA 5F0UA 3R97A 4ZLJA 3TAPA 5BYSA 1T3OA 1M5VC 2AEFA 2XZDB 1DTTB 2XMTA 5FDLB 1CS4A 5KT5A 3VAHA 1NDPA 1TAUA 4CO4A 1D8ZA 2QMXA 5G0RB 4CT8A 2XI3A 4ATNA 5AE1A 2CPFA 2J9DA 4NCGB 2KFZA 3S6EA 2MTLA 3CC7S 1YJUA 3HVTA 3TAMB 3L7PA 1VRTA 2VU5A 2Z4PA 2DEJA 4WPAA 2W4CA 3GR0A 1TMMA 4OHWA 4RW7B 5T7LB 4LF7F 2CJBA 1XN9A 3C6UA 5J2MA 3M2RB 2XMWA 2I0XA 2QV6A 5LL6d 2CVIA 1RT3B 1U1KA 2F7VA 1PYOB 2ROEA 5DG9A 5DZ6A 2MKIA 2ZJRQ 4JB8B 2OP5A 3HFVA 3PYEA 3VAKA 1FK9A 4D3GA 1UZDA 4XPCA 1FJEB 4K4VA 4CI0B 1RQ0A 2L08A 4OV1A 4PQAA 5L1LA 2GS8A 3P45B 1TL5A 1OJ4A 1IBMJ 2AX0A 3W5ZA 2WONA 3DLEA 3J81Y 5C25A 2LA4A 1TKDA 2K06A 3HHDA 2BUNA 3PR5B 4YS2A 2AMCB 3GV7B 1SJ3P 1CLFA 4X4RA 4UZBA 5J2NB 5C2GA 1XMQF 1RA7A 2DRDA 4DOZA 2ZBRA 3BGOP 5J2MB 1U1MA 1PKUA 2K1RB 3MEGA 4ED3A 1OPIA 3MM6A 5F8MA 5F8LA 3LO3A 4UW2A 1VK3A 3A3PB 5HVGA 5BR8J 3J7Z5 1CJKA 1MROB 3KHHA 4DR6J 4KJIA 1A9NB 2HURA 2KJVA 1XMBA 2R3VA 3UVJA 5GAGU 1N56A 4X4PA 3CD7A 2O1PA 1JB0C 2D7SA 2VA3A 1JLFB 3K8WA 3DGPB 2BEFA 3NBPA 1UPMB 2V2KA 3PX4A 1TL7A 1S6UA 2CQGA 4I4BA 1NO8A 3OPKA 4ZLNA 3UD4P 3GJQB 5LSLA 1AUSL 3HLUA 3RAXA 2C22A 4LF5F 2D3OR 4IR9A 4OI3A 4OX9J 1U7LA 3KLFB 1RT7B 3K8VA 1OPZA 4IG0A 1UVKA 3MPVA 1IUJA 4KYZA 4YR3A 1D1UA 3CCZA 2Y1IA 2QLFB 4CT9A 2V5HG 4B9VA 4A48A 4G6VB 2DNRA 3NP5A 5DGAA 4F2RA 2W9CA 2DD8S 3QT7A 1FESA 1I3OB 1UVMA 4RW9A 4UUWA 4FVCA 1I6JA 2I9SA 4OZ5A 5HBMA 4DFPA 4ED1A 4DSEA 3Q2TC 4C8ZA 2J9DE 2RQCA 2BABA 1CQMA 2CYYA 1YBTA 3DI6B 3F0NA 3MWBA 1S76D 1H7WA 1HI8A 2VFRA 3FC9A 4DI6A 4ES2A 4DV7J 1RHRB 3MEEB 2F40A 1URRA 2VOPA 4X4UA 3MUMP 3CCLS 3AODA 2GFFA 2FC9A 2WBMA 2LFVA 4KRWA 5D6GA 4C9DA 3ENQA 3Q89A 3BR9A 2BKNA 1REVA 3CDBA 2R2SA 5J2NA 2HRTA 3NGSA 2OPRB 4USTA 1T94A 3S1TA 3M8SA 4ZPBA 2FVCA 4DLEA 1DURA 3UNGC 2R7OA 4J9PA 3PJXA 4ZP7A 4B3MF 5LSRA 4KSEB 3M8QB 4IFYB 4NZ0A 3W1YC 5DDRC 3TUZC 4DU7A 1RA6A 1BQXA 4USVA 3DC2A 5GAHU 1XNRJ 1LWCA 2IBOA 3W63A 4YEAA 2MKHA 3NEKA 3KHGA 1YG0A 2WOMB 1CS4B 1RTZA 3A3OB 4Y2CA 5IQ6A 3BJYA 1NDCA 3K57A 1NK9A 4LF8F 3GJRB 3NCPA 2YXLA 1SL0A 3KDOA 5L38A 5J2QA 3OUYB 2YQ3A 3EZ5A 1RT1A 3DOMB 4HLBA 2XEXA 3AA8A 2J7WA 3BM7A 3Q83A 4LF1A 4LFAJ 4DXLA 4CDIA 2N82B 4CLKA 4DWIA 5DDPC 2MY8A 2W7PA 2CKWA 2B7CB 1NJWA 1D9DA 3MM5A 3E3XA 1CULA 4U6PA 1QVGR 2J8AA 2HAFA 1HQUA 1RAOA 3ULHA 2XGPA 1U0HA 4L75A 3BQ0A 5T14A 5KG0A 2G0CA 1P1LA 3JSMB 2XLIA 4B3OB 2YH0A 1HA1A 3M1VB 3EPGA 2FJWA 3W2WA 4DR5F 5CYMA 2VBZA 3GIJA 1MG7A 2VBYA 1VJQA 2ZH5A 2J7UA 2O3DA 2R7SA 4QU7A 5GMEA 4ZVFA 3J7YI 2VG7B 5C7PA 1R0AA 1TKTA 1PIEA 4NLQA 2ZVIA 3BF4A 3VCDA 2CJ9A 1ZZFA 3GCXP 1LFWA 5HVFA 1NPRA 4WU2A 1MMLA 2M2BA 4K8RA 4L76A 2UUBF 1QLNA 3DXBA 2FJVA 4KHPJ 3QWPA 4HHHA 5IWAJ 3H5XA 1UW4A 1T05A 7FD1A 4JP8A 2VIHA 1BE4A 3HPOA 2FLLA 2CQDA 1S12A 5H9FJ 1Q86T 2NXEA 4CLWA 1R7IA 4DG1B 1HNXF 2YKQA 4ED5A 1WKLA 3W2VB 3C6TB 2LEAA 4ELTA 2DNQA 4Y2AA 3SYZA 1RE1B 2KJWA 3G96A 1E6YA 3BBCA 1R0BG 5DO2A 1KRPA 1RUSA 1TKZB 2W2OP 1F1BB 4LSNB 3NL0A 2IA6A 2XMVA 2KXHA 3D9BA 3QT5A 3V6DB 2RILA 1LWCB 3CO0P 4HTIA 3D0IE 1RXOB 4ALZA 3MCNA 1CQNA 4KPYA 1RP5A 4UQGA 4CTAA 2E5LJ 3TR5A 1YWXA 4NLXA 1F5BA 2GHPA 4A8FA 3Q8UA 4W98A 1FXRA 1NB2A 1RCOB 1LW2B 2DNYA 2G2OA 3I87A 2D74B 4Z7YA 1Q5YA 2VB6A 1FX4A 3BH7B 1HARA 3BH6B 3FK4A 4ZP9A 3V4MA 5CZVA 3WQPA 4TY8B 5LOQA 4LF6J 1TR0A 2B7BB 4I56A 4ES1A 1OSCA 3PHEA 4CRJA 1NEEA 4TLRA 1DARA 3AH6A 4DG1A 1FD8A 4IYQA 5J2PB 4J9RA 4RPFA 2LQ8A 4NLYA 4F8RA 2EFGA 4WCEQ 4Y2IA 5AE2A 2E9TA 3MFIA 2MZJA 4M5KA 1QE1A 2LLZA 2RF2B 3PW0A 1N4LA 4IQXA 4ZP8A 2AF6A 5EX3A 1N36F 3H5SA 2CWKA 4KGZB 5C42B 2NXCA 2MKCA 4YB1P 1WEZA 1FJCA 2VODA 2DEIA 2IRUA 1R8HA 4O4GA 1RHQB 3N5FA 5L39A 1YJTA 1SI9A 4QWCA 4IO9Q 1LW2A 2F8EX 3AJDA 2H65B 1TUGB 3BBBA 4E2FB 5CAAA 4P71A 2YNIA 3NLCA 4ZA1A 3DRPB 2R7WA 2JEFA 1JJ4A 1BQMB 2UVVA 1EKRA 1F9HA 2GVZB 3DRRA 4URSA 3RZAA 1S77D 4LFAF 2R2UA 2H5JB 3CCQS 1JQGA 2UUTA 3M2VA 2C2RA 2AYEA 3M8QA 4IFYA 4WP3A 3MXHP 2K7JA 2XMUA 3HJVA 1NK7A 8AT1B 4ZJLA 3T9NA 4A8KA 4JI7J 2CNNB 5DLFA 1QE1B 2RF2A 1H2UX 3ZFVA 4ETXA 4A8OA 5EWEA 4NWBA 4FZVA 3R8YA 2HFVA 1XNQJ 4UUXA 1FO1A 1FTCA 3P6YC 1FWLA 1FXDA 1F3VA 4M5JA 5B09A 1SH2A 3B4MA 4C97A 3OFGA 5D3GA 3ITHA 4NLVA 2Y9HA 2ZBQA 4LT6A 1TKXA 1UFWA 2V8HA 1Y3KA 3N0VA 5KAKA 3R5CA 1VQKS 3KK3B 4ED7A 3TUJC 1QTNB 1S1WA 1XQIA 3EZOA 3KLVA 4MKBA 5HROA 3MM5B 1SQFA 2W4PA 2APOA 1FRJA 4CLYA 4I67A 4ANDA 1X4FA 2GMJA 3BV8A 4H54A 4NXNF 1EX8A 4F25A 4I6YA 3CNQP 2DRBA 1FFSB 3M8RA 2ATCB 2OGUA 3GONA 2E5IA 2DR6A 2AIRB 2VBWA 2FYXA 3GCWP 3DN9A 3IR6B 3P5TL 3D6HB 4WK1A 5EWGA 1N48A 4DR6F 3L3CA 1ZAXA 2R42A 2RDDA 3PRDA 4OYXA 3CCMS 1OMSA 2E29A 2UXBF 3D3CJ 1LXJA 2B5JA 3DOLB 3EXYA 3IBCB 2COLA 1P27B 5HP1A 5JVGQ 3I0SB 1GEHA 4FXWA 4NE9C 3JAMY 5C42A 3MHYA 4IFVB 5CA5A 1UVLA 2YKMA 3AHPA 4F4ZA 3NRBA 3GV8B 3G87A 3HHEA 4PQUA 4QIVA 1OIAA 1NH7A 5BYQA 2BE7D 3KK1B 3RRHA 2HVDA 2BE2A 4WXWA 3CWJA 3AFGA 3BQ2A 4GRSA 1DTQA 3MM8B 1TL1B 2B4OA 4I6AA 2HBYB 4Z7CA 4PUOB 1RADB 2WONB 3DLEB 4R5PA 3NCQA 2AJ4A 2HLUA 2JSXA 3SXLA 1RDRA 2SXLA 3OD2A 4N56A 2VG5A 4QQBA 4IDKA 2ATLA 1F2GA 1HMVB 2ZVSA 2YWWA 5L1KA 1YBAA 4J9SA 4KH0B 1G3OA 2LQ5A 4EEYA 3NS6A 1RI7A 2XMMA 1IBLF 3CB4A 5KFJA 2DGTA 7FDRA 3IAM9 3MOZA 1VI7A 4WTYA 5DQGA 4ECUA 4HT7A 2VDHA 3M2RA 4DHVA 4L6V3 4MH8A 3R7SB 1KEKA 3QZ8A 3Q2SC 4QWAA 3PY8A 1H3DA 3AB4B 1UMJA 3AD8C 3BGFA 3TAMA 4D3HA 2NUUG 1SC6A 2MKSA 2Y1RI 4HR2A 2L9NA 3O6QA 4RNHA 2AU0A 2Y8WA 3W9HA 4R5PB 2MDAA 5IV4A 2RSQA 3LA0A 5JUMA 4KGVB 3H4DA 1N0UA 3FEZA 5F0WA 4AQYJ 2DITA 1XK8A 3MZIA 2F3JA 4I69A 4ID5B 1JXVA 1RBLA 3UCUP 1IBKF 3MURP 3DRXA 1GMUA 2QA1A 2LXUA 2JVOA 2HQDA 1VCTA 2EWHA 3VTIA 1AB8A 1LNQA 5KFNA 1S9EA 1N34J 2HHHF 3KUGA 4EFAC 2BQRA 2I2YA 1Y7PA 3DXSX 4O3OA 3UW1A 2DNKA 3CUNA 4LF2A 2YWKA 4OZ0A 4LRFA 3PRVA 4B3TF 2CVEA 5E41A 1HNIA 2KZZA 1X0FA 1HWIA 3QAEA 3TQ1A 3P5BP 3V6HA 2GQQA 2LU1A 4V19X 5KT3A 5KFXA 3PIOQ 1RWOB 2Y1LB 1AZSB 3N01A 2MLYA 3HSDA 1FKAF 4WXOA 2Z2MA 2OPQA 1QAYA 3IWXA 3NWRA 1CVJA 2QL9B 3AD9C 1VBXA 4X62F 1JLFA 1ZA1B 3TX0A 1H2VZ 3RBDA 1HWJA 5I3UB 2CQ2A 2DO0A 5HMXA 2BW2A 1TL7B 2QSWA 1JLEB 3D4JA 3PYFA 1SJFA 5ETVA 1I51B 1FXLA 1IJEB 1S5ZA 2HS0A 1YJRA 2PMHA 2R8JA 4K4WA 3C15A 1DHMA 1NXIA 2WZ1A 2GJFA 2J0WA 2VFSA 1K1SA 1XR6A 3CO9A 2DHAA 2BYCA 3MD3A 2B9YA 1HNVB 2PO4A 3DYAA 5LXRA 3KMSA 2B3TB 2JFKA 1VBZA 3KOAA 2LVWA 3EJMA 1WC5A 1AZSA 2D1CA 3EM1A 2D3ZA 4NEZA 4MKYA 2VONA 4CH7A 3SSRA 1RT1B 1KTVA 2CQBA 3KNGA 1QD1A 1T7PA 5D78A 3DLKB 3W61A 2ZH6A 4B9NA 4KGMA 1VYAA 4ZPAA 1JLEA 2V68A 1F5AA 4LF9F 3US5A 2R4FA 5K8MA 1KHWA 3LP0B 1CJKB 1MROA 2DXDA 2RAQA 4UOHA 3B82A 4NXMJ 3OXLA 4QR2A 2IMWP 4GC7A 2E5GA 4IQMA 1FRXA 4X4OA 1FX2A 3DDIA 3ZZRA 5EDWA 2BOPA 3LPEA 1CEZA 2KXFA 3ZZYA 4DDFA 3KKFA 2AJ0A 1REVB 3C66A 3D1HA 4G65A 1IJFB 4LR7A 3QIPB 2IM0A 1ZA2B 1KQGB 4K0KJ 1TAQA 2HK3A 1KN6A 4DL0C 4TLQA 4DV7F 1U1OA 1U0SA 4UT4A 1KBRA 4PRFA 2YKNB 3ZZ0A 5I42B 3ZTOA 2HWHA 4K4YA 3ZTRA 4P72A 4QYZJ 3MOJB 1KOOA 2XSJA 3ELHA 1RWNB 3M8YA 3OFFA 2DH7A 3SI8A 4EBDA 3MMJA 2EXUA 1B7YB 2O67A 4HI2A 1PJ7A 1K44A 4MK7A 4C8YA 3BGLA 3AAWB 3A3NB 1LWEA 4U95A 1FCAA 2CADA 3EGVA 3P3DA 2HFSA 5K9FA 3RRGA 2C2ZB 3FFIA 4CIOA 2IYIA 4M94A 4O3PA 3LH2S 2ZH3A 2UUAF 4JV2A 2BACA 3M32A 2DCLA 3U1MA 4C11B 4DN0A 5CCMA 3KLGA 4DV4J 3DLLQ 3MEKA 1QUVA 3NY0A 1RABB 1HQ2A 3PEHA 3T1AA 3GJSB 3TVZA 3B78A 4F7VA 4URGA 3QGIA 4RL1A 2X3DA 5MLCV 2DNPA 3H5YA 3QBCA 4LF4J 1RT6A 1U2CA 3Q8QB 2IIHA 2CPDA 4M5DA 2JC1A 5E7OB 2CJAA 2K2PA 1TUWA 2DGQA 1F5CA 8ATCB 1LK5A 1R6YA 4RKUC 4CH0S 4HDGA 4EYIB 1AW0A 5BR8F 2FHJD 2MGZA 4ZJQA 3TA1A 1VRUA 2K3KA 4LR8A 1WDDA 1UAWA 2RNEA 2WSEC 1FFGB 1W25A 3CJQA 3K5OA 3MDFA 3PXGa 3FFIB 3SSSA 2JEJA 1FK9B 2IM3A 2XSFA 3G8TA 5GAHI 3CJ3A 2XS2A 3DU5A 2NXUA 4DL7A 4EWTA 3C16A 3J7ZT 2DO4A 2LDIA 2RQKA 4MK8A 3OXGA 2PGCA 4OI1A 4LQ3A 1KQSR 5IV3A 3AT1B 3KUHA 5GADU 1N5YA 1EAYC 3R2CJ 2Q43A 1Q8KA 4MT1A 3JSRA 3MM7B 1JLGA 4W90B 1XEZA 1XR5A 5L46A 3K0JA 1XMOF 3QO9A 1HBOA 2ASJA 4ID5A 4RW4A 2ZE2A 3M6VA 3ET6A 3N6LA 3CCVS 2QA4G 4XK8C 2HNZA 3QRPA 4E98A 4JV5J 3UQSA 2KG1A 1MWZA 3MPUB 2OELA 4X66F 1F60B 1RT3A 2EVZA 2JEGA 4Q0BA 3QZ7A 4GO7X 4RO0A 4PWUA 2P9GA 3H59A 3MM9A 3TNVA 2W7AA 3KJFB 4DPOA 3POTA 1NBEB 1WC3A 4Q5VA 5H9EJ 3EVWA 3OTEA 2NREA 3LP2B 3GIMA 1X5TA 3W64A 1U4BA 3LP1B 1HYSA 3CDEA 1SV5B 2XCPA 5ADZA 1SC3B 5E2QA 5B0DA 1JJCB 1VQPS 4YQWA 2EFNA 2H9ZA 1FJGF 4Q7AA 2XZTB 3OTOF 4QU6A 2GV1A 1J5OB 1X5PA 3TZYA 1N52B 2KT3A 3I9V9 3SMZA 1K47A 4M63A 5I3UA 4LQ9A 4OHYA 2DHSA 2XHWA 1S1XB 2YBVA 5G4DA 5KFLA 4FVMA 3U27A 4V1Ak 5KG1A 1BQNB 4CO5A 3MAAB 2R9LA 2HMIB 4MKAA 5CYJA 3M6XA 1CG2A 2OFHX 3FCHA 4WP9A 4C48A 3PJWA 2KH9A 4I2QB 5HBMB 2B0GA 1NB7A 2ZD1A 2H48B 3TX8A 4ZMMA 5IZHA 3CCSS 2OEJA 2GJ2A 4DPWA 2EFPA 4RNMA 4M1KA 3BSNA 3DDKA 1V3RA 4LSLB 1JNRB 1BD6A 2U2FA 4OX8A 2IY5B 4K59A 2YWFA 2HS3A 3BYRA 5KT7A 3IS9A 4C2MA 5AE3A 3M8ZA 4J9QA 3OL6A 2LDYA 4QJVA 5A8RA 1UJ4A 2BANB 4GKJJ 1T9XA 4M5LA 1ZM4A 4OIXA 1UETA 3O1LA 2DBBA 4N41A 3OR1B 4NMXA 3MMBA 1PC5A 2LECA 3V81B 3ITHB 2XHCA 2M9KA 2F4FA 5KFUA 5L9XA 1VFJA 2IAJA 2DIUA 2DYAA 3EWGA 4DCJB 1IN0A 2LMIA 3FZ2A 5KG3A 1N5TA 3V6KA 1N88A 4NA3A 1XNQF 1FRHA 2VG7A 4Q0BB 3DKDA 4G1PA 2Q3PA 3R1LA 1FNOA 1S49A 4L72B 4I0WA 1RWUA 2J0XA 2QLWA 2AZ3A 2LXFA 1VC6A 1NKBA 1OWXA 4LBHA 5KTQA 3EVOA 1A7GE 4J5OA 1IXKA 3DHWC 4Y34A 5HJXA 2NPFA 4DUTA 1SV5A 3THTA 2PI4A 2IYGA 3PCOB 2CJYB 2KTQA 4FP9A 3PTWA 2EFVA 2KFYA 4UF4A 1KSPA 3R2DJ 3TZXA 3L9ZA 2Z2ZA 5KG4A 3HVAA 3OW2R 2D3O1 3M6WA 4J37A 3AD7C 4JI5F 3IR5B 4L3KA 2V2VA 3GILA 4USHA 2AP6A 4GKJF 1F3FA 1KONA 4YDDB 2HWIA 2L3MA 4AT1B 4PXCA 1SBRA 3FCWA 1EB0A 3QNWB 4PXBA 4DQPA 2XWYA 5CYMB 4FF3A 2CWXA 2ROGA 5D4NA 1T3NA 4WU3A 3DDNA 2POKA 2RRBA 3DGVA 2HGLA 4Y2MA 1VBKA 2BX6A 3HFZB 2FLPA 2CZ4A 2AD9A 2EC0A 1WD6A 4EBEA 2H3EB 1JLGB 2UXCJ 5IC6B 2W01A 1H7XA 2BXJA 2V2ZA 3AJ2A 2F8HA 3BKFA 3O8WA 2MZ1A 2W7OA 1YKWA 3QWUA 4ELUA 5BXIA 1AUDA 2OD4A 2DGOA 2KT5A 2OPRA 3AA9A 5IT9Y 1VQSA 4DPYA 2HNYA 3TUIC 1PYTA 2Z2YB 3U02A 1N32J 3NGTA 4YR2A 2QC3A 3HT3A 1RK8A 3I9ZA 4AXJA 5CD4A 3MD1A 3KJNB 3W9JA 3C6TA 4DV5J 3HCXA 2MGZB 2Y8YA 1ACMB 2FGCA 2I5JA 1N5SA 2OEKA 4ILRA 4WFZA 3G6VA 1AFJA 1EQ0A 1M5HA 4ZIWA 4FNIA 1SJ1A 2CQPA 3IRXA 2L9WA 2RMLA 4O23A 5EHHA 3EX7B 1KR4A 4OX9F 4FS2A 2Y1JA 3IWNC 1PSDA 3QLHB 4K5SA 2W9BB 1FWPA 3W5YA 2R7TA 4AD6A 3S01A 2QLJB 2J7KA 2JLEA 1HPZB 2PIIA 1SQGA 1WUUA 1UVNA 3BYPA 2VF3A 2BW7A 3ADAC 3HSJA 3M05A 4ZLPA 2NCKL 1RB0A 2FJDB 2B8PA 2DR5A 2CPXA 2CPZA 2KYXA 3VQTA 3CDAA 1X9SA 3GMGA 4KKOB 2XLJA 1TL3B 2M70A 5HSPA 3DLGA 2XC9A 3WX8A 3ZTPA 1UEVA 1U26A 2RVJA 2ZOMA 3TW0A 4ENOA 2MXYA 5ETOA 3CCWA 2VQFF 2YNGB 4J9MA 1RACB 2AJFE 1U1PA 5DS7A 2R8KA 2NYIA 1YJ9S 3CCUS 5SZTA 2E5JA 3BR8A 4LIRA 2AV5A 3ILJA 1NSPA 3UDVA 3DRYA 3FMWA 1OQ3A 3ILLA 4DS4A 3MAQA 4YB5A 3ZZUA 1R6VA 1X4EA 3CJ2A 2WVCA 2MQLA 2CPEA 2ZEJA 1GK8A 2QA2A 1RAAB 4FYYB 4O4GB 4P2XA 5D4OA 3KHRA 1RLDA 3RTVA 3PO5A 2YX7A 1YK9A 3MEEA 4JI2J 1N33J 4J9OA 1RWKB 4DL2A 4JI0J 3HO1A 4P9SA 2NYHA 4F4WA 1CULB 3FEXB 2ZZMA 3G8QA 2NR0A 2M5YA 3M9MB 1RAEB 3I32A 1N0VC 2N7YA 3JQJA 5F8JA 1Q5VA 4DFKA 3DRRB 2OJ3A 4KT0C 1XMOJ 4TXSA 1NMEB 4X4SA 2VZ9A 5F3TA 1QAJA 5JXSA 4Q2MA 2DNZA 2W2PP 2YQ1A 5J1EA 2AJQA 1HNXJ 5IXUA 1G4CA 5DDOC 3BKTA 5KFPA 3GLJA 2ZBPA 3CMAS 2VQEJ 4LMZA 2XMAA 1DAXA 1SIZA 3RGIA 2HHVA 2NXJA 1CJVA 3QSYB 1U1NA 2VQFJ 3CPWR 1RWPB 2UUCF 3I96A 1U2FA 3RJMB 4CQ1A 4F0HA 1UWAA 2E9RX 3H2LA 3QJLA 1FRMA 2HEKA 4MMOA 2BANA 2QN6B 2QZ8A 2V63A 4ZLLA 5C5JA 1T03A 3R5DA 1GTEA 4FF4A 2XMJA 4YDXA 1CJUB 2KVQE 3R6GB 4DR5J 5KFYA 4FXDA 1SQEA 3I4PA 1VIXA 3QQCD 4NEYA 7AT1B 1NSAA 4RW9B 2XM3A 3TZWA 3G71S 1R3NA 1VQ7S 3UE2A 2FGOA 4DV1J 4B3OA 5KFMA 3E01B 2C3YA 4C8OA 4B17A 5LSOA 3OHAA 1VQ4S 4CO1A 2CQIA 4UY85 1HKAA 1NUEA 4XIUA 3IGVA 4JUZA 1V9OA 5IFMA 1X31C 2H5IB 1S9FA 2LU2A 2ILZA 2HGNA 3MPDA 5DM6Q 3W8GA 4F4AA 1KQKA 4XDDA 5KFIA 1FEHA 1HWLA 4C3LA 5L8RC 3M6UA 1VS3A 4A46A 2JC0A 1RHJB 5D4PA 1FNMA 5JJBA 5DQHA 2AGQA 2AGOA 1CC8A 4DLGA 2FTRA 5KFZA 2HHWA 2CQ4A 1KHVA 4NMLA 1WHVA 4P2FA 4DV0F 2OD6A 3M1VA 1JLQB 5KFDA 3K58A 4C11A 1CJTA 1FRKA 1WG5A 4OQJA 5E3AA 4CO3A 2R7VA 2LQBA 3DCAA 4F04B 5K8NA 1WTBA 2MY7A 2A6MA 1HBNB 1JMTA 2HLTA 2LP4A 1PYSB 2L9DA 4FKXA 4IG0B 3VGVA 1EZZB 5IQQA 1VLYA 4DL5A 3RB6A 2J0QD 3QRQA 4J9VA 4ZVOB 5M2PA 3UPFA 2PA3A 3KNAA 2AQ4A 1VC5A 1RHKB 5J2QB 4RUHA 3ENAA 1VHIA 4RNOA 3LWLA 3RB3A 4WE1A 4R8UB 5IM0A 1NZ8A 2DNLA 2ZWOA 3CCRS 5ETSA 5KFCA 1FRIA 4ICLA 4FS1A 1T9WA 2K8GA 1SKUB 1VLOA 4NASA 3OTCA 1M5SA 4URQU 1FKPA 1O51A 3BGRA 3CW2C 3ENVA 4B02A 1KOHA 2E1MC 1HNWF 4DR4J 1HBNA 2BA9A 2GQ2A 2DTJA 4NL5A 3SCIE 1RTHB 4KBIA 4ZHRB 3BS9A 1WHYA 1VQMS 2PDAA 3EMTA 4ECRA 1U8SA 3KG4A 4ZVGA 1T9VA 1WOOA 3A12A 3TP2A 2G4BA 1N36J 3HK2A 2XY5A 1KVJA 2PSZA 4OYZA 4H4OB 4KR0B 5F9NA 3RW7A 5AXNA 5I4MA 3BZQA 5LMNJ 2V2QA 3DRSB 1S0MA 5CYQA 1HL6A 3AY0A 4IG3A 4DX8H 1PJ6A 1R8BA 1X4BA 4L3NA 4M5GA 4N7TA 3AXMA 4DV4F 1IQZA 4JYAJ 2EBEA 5B0BA 4TQRA 4TU8A 1EARA 2IM1A 1OY9A 3I6PA 4PXEA 1VQ9S 4LFCF 1VQNS 3BDEA 3WIVA 2OSQA 1GXTA 5JVHQ 2GIQA 1FVQA 2UU9F 2HQCA 2V6AA 1YI2S 2BJDA 1WG4A 3THPA 2YKPA 3OVSA 2M4MA 2MHEA 4DCOB 3GIRA 1IQTA 2D9PA 2DNMA 4LBPA 5B7WA 1DRZA 2ZJPQ 2B5JB 2CQ1A 3DOLA 3NGUA 2IJRA 2OIHA 3VAMA 3P96A 4H4OA 1WDTA 4HDHA 5C24A 2FZGB 4BC7A 4B9MA 3O5TB 2C2DA 2MZRA 4PEOA 2ILYA 3M8WA 5HAOA 2EPIA 5HQLA 2RRAA 2YKAA 2HPUA 4B9UA 1S9EB 4G1QA 1BMQB 4HT5A 3KK1A 4UY8T 3TJ9A 2FY8A 2MZQA 3M8PA 3NS5A 1KC8T 5B0CA 2KHCA 4U7CA 4EUVA 1QTMA 1HW8A 1WEYA 2EG2A 3EXCX 3NGRA 4DQRA 2VOOA 3SQGB 3OL8A 1Q53A 1U49A 2MEWA 1S10A 4FBTA 3MEDB 4EZ6A 1D9AA 3M32B 3PG9A 1IM6A 3GFHA 2Z56B 4O3NA 3VV2B 1WKJA 2G9OA 1RTIA 3GG0A 4UTGA 4J9KA 1KFSA 1HBUA 2FLOA 4DR1F 2J6SA 3ZC4A 1RU2A 2RH3A 4YUDA 5C24B 5HMWA 5HL7Q 4ZDNA 3OLBA 3W5XA 3FUYA 2R8IA 2UXBJ 2CZVC 3AQPA 3W8PA 3K5MA 3A8IA 1WOSA 1U24A 2J76E 2RT3A 3IBWA 1S99A 1NHVA 3BQ1A 3CJSA 4I68A 1KFDA 4TN2A 3G6XA 4I2PA 2HNDA 2JH3A 2QO3A 5B0EA 4YY3J 5HROB 2QFIA 2YNFA 4ZPCA 4ZN3A 2AT1B 4TY9A 3GE9A 2WVFA 3UN3A 3R27A 3MR5A 3TARA 4IRCA 2D9OA 1M5PC 1ZS6A 1U6BA 2UUAJ 4QCLA 1S0NA 4YR0A 3NMRA 3CJ8A 3QIPA 4CM0A 5M2UA 1M0SA 2HHTA 2VJUA 4WKYA 2XQCA 4QIEA 4B9LA 4DUYF 1Y0HA 2FHKA 2HHSA 5F41A 5A2QY 3FDSA 4JV0A 1S1UB 3IGNA 1W7WA 3L95X 4Z2XA 5ITHA 1XWLA 2BKOA 3MM7A 5F8GA 3KJVB 4RW7A 2IBKA 3NMAA 3FSIA 2ALYB 2XYGB 4WFBQ 1L3SA 1YX2A 2ZKTA 1EIYB 3OR2B 1ICEB 4ZVRB 4WTOB 2V8PA 4PG8A 2HW3A 1HLWA 2ZUGA 5D0HA 4RJVA 2DGXA 2HVZA 3TVYA 2HQ3A 2H4WB 1C0UB 2LA6A 3MTKA 4ZKAA 5KFSA 4ED0A 4N47A 3K5LA 4HH1A 2VPWB 4RW8A 3E2EA 4DR1J 2VFUA 2NUHA 4ED4A 1DTQB 2OPPB 3MM8A 4HH0A 2NXNA 4ICLB 4B9TA 3LPYA 1ZH5A 1OY6A 1ZM3A 2CQHA 3IO1A 3CT9A 2ZH2A 4F4YA 1JXLA 3SQGA 2LEPA 2ROPA 3PYDA 4X64J 2MB0B 1WC1A 3BGRB 2UVWA 2DGVA 1T9YA 1YJ7A 2CIMA 1HWKA 3EDRB 4HTJA 4DUZF 1TK5A 3FNNA 4NOHA 4JI4J 1RTJB 2B43A 3W60A 1N6QA 3JXOA 1ZPWX 4JI1J 3HD2A 4FPIA 1OYDA 4RNNA 4CM2A 1N8RT 1FDDA 1QM9A 1ZOTA 3HI9A 2FJXA 1FVSA 2FVRA 1JKHA 5CD4H 5E33A 3VGSA 1M90T 2XGQA 2PFDA 2HVEA 3CD0A 4UOFA 3LOUA 4DV0J 2ASLA 4YHHF 4UOGA 4BDPA 3SCJE 2WVEA 1SJ4P 2RD5C 4M95A 3NG8A 2V0NA 4KFBB 2ZM6F 3KDNA 2CNLB 4LSZB 1RGVA 2BE2B 2KI2A 4HACB 5B0AA 2IDEA 5FJ4A 2QRRA 5EN1A 2Y0BB 2VJVA 3NXZA 1R8PA 4GKKJ 4PWDA 2KT2A 1T02A 1Z4UA 3PW7A 1RWXB 4JI3J 3PHTA 1S6PA 1Y5IB 4OYIA 3VR1A 1NK6A 3MR2A 1VQ5S 1AYEA 4C0HA 4ECXA 1NHUA 3ONQA 2E1CA 1S48A 1S1XA 4ZP6A 1OYEA 1K73T 2AEJA 2DVIA 2KDOA 2VHGA 1JIHA 2HRUA 5EUHA 3V5RA 4H4KC 1WSRA 2PMWA 3N4WA 1JKHB 5B0GA 3K2YA 1V3SA 4FPRA 4DX5A 3D0HE 2QYGA 3I4HX 4ELVA 3HHLC 1F9EB 1O0PA 2ZHBA 5GMDA 2ZD1B 3CCJS 1JLAA 5KT6A 3PFOA 2ASDA 3VAJA 2WTFA 2F4VF 2RUSA 2ZNZA 1B0TA 1U45A 4PAAA 1SC1B 2V4JB 4RNFA 2UUBJ 2IM2A 4ZPDA 3DLGB 3NKYA 4B3SJ 2RKIB 2C2KB 4GC6A 2B9WA 4ZPVR 3BN7A 4BWJA 4YHHJ 2ABYA 2Q66A 4U8YA 4EGLA 2VC1A 3OSNA 1AT1B 1V3ZA 4OJGA 4F3OA 1KQFB 5AJ3F 1J27A 2CNKB 4KHRA 4Y65A 2E1RA 4C6AA 1U47A 4DQIA 4NX9A 3CJ4A 5HANA 4ZK7M 1TK0A 1IWGA 4ZJOA 4X66J 1M1HA 3MR7A 3RW6A 2V4RA 2A3JA 3QSIA 4QPXA 4I2PB 3T5JA 3K5PA 4OYBA 4DQQA 1Y3JA 3CDWA 3OLAA 2E5LF 3NAIA 2KB2A 2ZKUA 4OLOA 2YQ0A 4CWBA 5FLXY 3HX9A 1FKOB 4NRTA 2VFTA 2W25A 4GVBB 2GAHC 1BY9A 4LSLA 2ZOGA 3NNHA 5ETQA 4Q45A 3CMES 4Y3CA 3V4IA 3H90A 1HPZA 1IR0A 3B8HA 2YX1A 4PWDB 1UW9A 4M5MA 3VGUA 2IJNA 3G4SS 1BLUA 2C2NA 1WACA 1H0HB 1YGYA 3EGNA 1DLOA 4GVLA 3DLHA 2IC3A 3T1YJ 1FD2A 4B3SF 3DM2B 4KB7A 1PG5B 2MSTA 4ER8A 1XNRF 2BVZA 2J5AA 1UZHA 3MMBB 4RBTA 2L48A 2YPYA 3JTOA 3OR1A 1TTHB 1JLCA 2B4VA 2OH2A 1HHTP 5A0YA 4TU9A 4IR1A 3L7OA 1VK8A 3PO4A 4KC5A 2VASA 5RUBA 3W2WB 1FHTA 4PCQA 4MIWA 4BHQA 3CD6S 1CSJA 1X5OA 2CJQA 2NLWA 3A8EA 3CIZA 1YVFA 5GVQA 3TZZA 3HMJG 3D1QA 2RS8A 2AGPA 1WC0A 1QSLA 1NK8A 4DSLA 1NH8A 1X4DA 1C1CB 2GX8A 4IOBA 3ZO7A 4AE5A 4DF8A 1QSYA 3TRGA 1RAJA 1N33F 3Q24A 1H72C 5E3PA 4CLFA 1I94J 1LK7A 2F9DA 3A8KA 1IKYA 3GP9A 2R7RA 5ETMA 2MLZA 3MCMA 1N6QB 4DV3J 1B0VA 3SQOP 4K4UA 1FNXH 3DM2A 4X84A 5KFEA 1BWVA 2VKRA 4TKTA 1B99A 4RBVA 1HQEA 3OFHA 2OTJS 2I6WA 2HMIA 2F4VJ 1Q95G 2HNZB 4Y28C 3LWMA 1X9WA 8RUCA 4C4WA 1VR6A 4ANEA 3IXQA 5EGYA 3OTOJ 1ZPVA 3D6MB 3N28A 3QJJA 4BBYA 3CIMA 1K1QA 4OZ3A 3RR7A 5D4LA 2R8GA 1WEXA 3QGHA 3RYLA 2EKNA 3KK2B 2GVDB 1RAGB 3HT0A 4RW8B 2M52A 3EGZA 4RW6B 3POTB 1IR1A 3PYGA 4C3KA 1LFPA 2ZNYA 3HZEA 1YRUA 3MM9B 1RZMA 3QT6A 4WP8A 1S0VA 3IFEA 4ED2A 3H20A 3M9NB 2PD1A 1D3WA 5CZXA 1Q1KA 2GHVC 2ZBIA 3DFEA 4F2SA 3D67A 1F6TA 3HP6A 5L1JA 3V4IB 4K0KF 2AYGA 3KG1A 4A8YA 2GIRA 1IWAA 3KLHB 1B7FA 5F8HA 3HSZA 1E6VA 1JJHA 1KS2A 4DL4A 4P10A 5B0FA 1MMDA 2XYHB 4USMA 1DQ8A 1HBOB 3IM9A 3OTBA 4WE1B 4M8LA 5IM0B 3M2UA 3BEGB 5K5MA 2VD3A 2MJNA 5AJ3J 2GNKA 2HVHA 4A8WA 3D0GE 3FQKA 4U67Q 4XO0A 3CSKA 3PKMA 2EG1A 1GXLA 2MQ8A 3FEYB 2YX4A 3D6FB 3HD1A 1UA1A 3FKBA 4ZS6A 3TJAA 1GMVA 1TL4A 4M5NA 4DV3F 2B4UA 4QYZK 2KO1A 5KFKA 4ZCKA 3I56S 3BSAA 4NI2B 2FC8A 1C1BA 2Y3YA 2ZHOA 1NHKL 3A8JA 4USIA 4CLPA 3DOMA 5FD1A 3WIUA 1HI0P 1I1GA 4ZVEA 3OUYA 1SIWB 2UXDF 4OI4A 4AL7A 4ILMA 4MYUA 4NZ6A 4USKA 3U1LA 3VWSA 2VG6A 4PG6A 2H5EA 3HFKA 3CJ5A 4RUAA 1RU1A 1YZ7A 2W1BA 1U0HB 5DG7A 3MCSA 2GW8A 2HHPA 2MMYA 3R5BA 4RUBA 3Q8PB 1W2BR 2R7XA 2QFJA 3MMAA 4CLLA 1TKZA 2C3OA 3AQOA 1IKVA 4LSNA 3X3UA 2DIVA 4MIBA 5CABA 3H40A 4BLGA 4DX6A 1X4AA 2VBXA 2ZITA 2GHWA 2EC2A 1HW9A 1Y00A 3C16B 3NBPB 4F4KA 4QR0A 2W2MP 4TU7A 3NNAA 4V19J 5FDLA 2B6AA 1NLKL 4I1TA 4ED8A 2C28A 5GADI 1U09A 1MWYA 4X65F 5KFAA 1Y4ZB 1JX4A 2KHDA 3K17A 4WJBA 2QIFA 2JLFA 4JYAF 1RT7A 4LFCJ 4JOUA 2IC3B 3Q0AA 3TO8A 2LQJA 3QRRA 1BQNA 1R89A 3W62A 2E1AA 4DSFA 2ZUAA 1NPKA 1RAHB 3I82A 3J81U 4O44A 1ITPA 4P6QA 4NLGA 3R5JB 4DV2J 4DS5A 4QIGA 5HO4A 3E01A 1WC6A 1TV6A 4A8MP 2V8GA 1VMBA 3GR1A 4ECZA 2DH9A 1RKJA 1L3UA 1DBDA 2ZDPA 3RUBL 5CCLA 3VALA 5CXTA 3IMQJ 4MFBB 4AUKA 2CG4A 2FHJA 2HFOA 2N7CA 4K4TA 1Q78A 3MEDA 3CF5Q 2IVMA 5EWFA 5ETLA 2DR9A 4YP3A 3CJTA 3JQKA 1WOPA 3BSOA 2W4DA 3KTQA 1FDAA 5E5NA 3C14A 3KLIA 4F36A 2MHNA 2FLNA 2DHHA 1IKWA 2HZAA 4ZITA 1DY3A 1NKEA 3QGPA 2DJWA 1OO0B 2EFQA 3BO4A 5DZ7A 3CJRA 3HF5A 4WFXA 2AKWB 3BPDA 3GV5B 4DMZA 2KYZA 4NYZA 3NWGA 1QVFR 1TVRB 1T9UA 2AEMA 4YFUA 5K8OA 2YNFB 2NSCA 3FBCA 4JI6F 3G6ES 4LRDA 5HLFA 5J1EB 3SDEA 3TI0A 2QL7B 1HFEL 3DOKA 4P2SA 3VZHA 3BO3A 2R8HA 1SPBP 1UFLA 1N5YB 3CJ0A 4EK2A 3OL9A 1BHNA 2UUCJ 3H98A 1KDNA 1S9GB 3HVWA 5CHCB 5A6WA 3C14B 4C8NA 3PW5A 3Q22A 1WSVA 4B3RF 5LMUJ 1WWHA 4DCPB 3H0PA 2M88A 3CCES 5IT4A 4KV8A 3OHBA 5KFWA 2CUYA 1FE0A 1VBYA 2WRMA 2JEIA 2U1AA 4K2JA 3M30A 3Q8VA 4KKOA 4ZVPB 2H1YA 2O5DA 4L74A 3EUNA 3UN5A 4OX7A 1B3TA 2VICA 1MSWD 1GT8A 1Q79A 1JWWA 5KOWA 3R5AA 1NJYA 1VHFA 4FF2A 3FRZA 1FERA 1M5KC 1SVDA 2ZZNA 1S57A 9RUBA 1H2TZ 3DOKB 2OTLS 3U1NA 3TOQA 3M9OB 3LQVA 4KQZA 3KK3A 2VL1A 1PBUA 2QGFB 4IFVA 1WI8A 3MR3A 1NK0A 2B56A 2LEBA 4OFZA 2KU7A 3CCTA 1UJ5A 3D54A 1KD1T 1K0VA 4F0KA 2FZCB 4KV8B 4DR3J 5D3GB 2PEBA 3RAMA 2XMKA 3OXFA 1DZ5A 2QMWA 4F4XA 5BJRA 1HR0J 2XYPB 2XS7A 2JRSA 3R5GA 2HS4A 4OX6A 3ZZTA 4F50A 2ZH7A 2MSSA 1E6VB 4RWXA 5D15A 5ETRA 1EETB 2DRAA 3GSDA 2OSRA 4KY3A 1T11A 3SSQA 3OT9A 1NJIT 1EQMA 2AJ2A 3T19A 4ZVTB 1RYSA 2XTJP 2Z58B 1GX5A 3DLBA 2E44A 2EBGA 3GJTB 1WF0A 2HQGA 5AXLA 4TNOA 2GGPA 2RB7A 2WSCC 3UDLA 1TZ0A 1WORA 2GA7A 3KYLA 2MKJA 2GJIA 1XC9A 3GZ7A 3OV7A 1C0UA 2A2CA 3VVUA 3MGJA 3IR7B 1S9GA 4KH1B 1YJNS 2XI2A 1S4FA 2V50A 4USUA 4Z37A 3SFUA 3DMJA 4PQUB 1UWBA 2CRLA 2H54B 3RAQA 2BMBA 1T03B 5THWA 3C19A 4WFNQ 3JS9A 2DK2A 2LQ9A 2Q6BA 1Q8BA 1Q7LB 4H4MB 4LIWA 3MTJA 5I3PA 2MQQA 1UVIA 1XTZA 4DUZJ 4OI2A 4OL8A 1YBUA 5L1IA 4GMKA 2WCXA 2AYBA 4W4MA 1HBUB 1U2RA 4ES3A 2WW8A 1YHQS 1U48A 2F8MA 2V4QA 2P8IA 2GVDA 4QW9A 1GX6A 3DLKA 2UVUA 2N3LA 3BGUA 3ZZZA 1D8YA 1RYRA 3H8YA 2RU3A 4DPXA 3QIDA 2CPJA 2HG4A 2IRXA 3ZZPA 1OQ6A 1S6QB 1RT5A 2P6TA 5EX0A 2HNDB 2DY9A 1LOUA 4ID8A 1Q4RA 4LF7J 1WI6A 3G9CA 3QFWA 4Q44A 2UXCF 4PXDA 1H73A 1UEUA 3ISND 1IKWB 2I1RA 2JVRA 3PR4A 4G1QB 4IH6A 3GIIA 2CA9A 1FEEA 3GSIA 3OTDA 1IBKJ 3TYTA 3WHIA 3C8YA 2MKKA 2BV3A 2HKEA 1TU0B 4OHXA 3UI3A 3M2UB 1RHUB 4DL6A 2FVPA 3E51A 3TANA 1F9FA 1AA1B 1HD1A 1SL2A 4J90A 2HZVA 3BN4A 4DF4A 3OFEA 3GB0A 4NXMF 4DSIA 4DV5F 2E7XA 1HHSA 1TV6B 2BE9B 1HWUA 4A47A 2GMLA 1HQEB 2ADCA 2F63A 1DLOB 3H5UA 2V8VA 1CC7A 4OZJA 3OSPA 1S1TA 2BBEA 1LW0B 2E7WA 2PT0A 1Y5NB 2W2NP 1YLXA 3AB2B 1J2VA 1FT8A 4QWBA 5HVHA 2XG8A 4RUCA 1FWKA 4RU9A 1NM2A 2HHQA 1PJ5A 1SCJB 2E7VA 2LKZA 4KGXB 4U9RA 3SBMA 3VGTA 5LXYA 3PKYA 1NSQA 2A18A 5IT0A 4QWDA 3BSCA 2I8EA 4Y00A 3CJKB 5KFBA 1DJ0A 1S7IA 1XJWB 2G0IA 2ZFHA 4G1IA 3TEHB 3EE3A 3MAHA 2GZOA 3QPIA 4LR9A 2YWGA 3IRWP 1I94F 2XZWA 4PYDA 3R1HA 1WF1A
chains in the Genus database with same CATH topology
4X64F 3PIPQ 4I7FA 5A8KA 4U7UK 3HHLD 4JBCA 3WX4A 2DGSA 5HLFB 1JLBA 5KG6A 2M8HA 1BWEA 2VH7A 3FGVA 1YQHA 2YWHA 1HI1A 4YY3F 1TK8A 2YNHB 3B4DA 3DRSA 5HI7A 3KHLA 4NYPA 2RQ4A 2YNIB 2X51A 2IRYA 4XPEA 2MQOA 2NQPA 4B08A 3PW2A 2EK1A 4O3SA 2IVYA 3I0RB 3LP1A 2HFZA 6FD1A 4F26A 2YNGA 4HHJA 3LALA 4XDCA 2B4PA 1VJWA 4NLTA 4FXVA 1C4CA 1DQAA 3HVTB 1Q81T 3KK2A 2RE1A 1HMVA 3CEDA 1WTFA 4AYBD 3G86A 4KO0A 4OHZA 1SXLA 2FDNA 3FSXA 3HM9A 1S0OA 4UQTA 4B9SA 4IRKA 1L3KA 2FVQA 2QT7A 1U6FA 4Q8FA 2M0GB 5KFVA 2BRLA 1G1XA 4KFBA 1C0TA 3K7RA 1IKXA 2MJUA 3H2VE 3HKWA 1VQ8S 3CTRA 1WG1A 1FE4A 2FJEB 3VAIA 1SL1A 4X4VA 4ITSA 3W2VA 5GMKa 3SCLE 4E0DA 2B51A 4JV5F 5FIIA 2VC0A 3GWCA 1AROP 1RTIB 3PDNA 5KFQA 1VQLS 1C2PA 1RT2B 3I5CA 2FY1A 3IG1B 4ECWA 4FF1A 2OPSA 1N5QA 2ZHAA 4CH1A 2DB1A 1JLCB 1Z2LA 1GTHA 2A2DA 2I5JB 3UWTA 1WHWA 2VPYB 2O01C 3D1OA 4I6WA 1IKXB 2OO4A 3HHNB 1Q8IA 1C0TB 2MPUA 2IHR1 5J2PA 2UP1A 2DH8A 2LXIA 2VUGA 2QA4S 1NRKA 2PA8D 1S7HA 3IS9B 2RDIA 5KFHA 2P5VA 2E9ZA 4DEZA 3I5AA 1UKUA 1VQ6S 1OS5A 3JTPA 2J9EA 5F9LA 3Q8RB 4K5RA 2BQ3A 4NA1A 1LW0A 5E3RA 2R2TA 1HQUB 1Z2ZA 2J6TA 4K4SA 1S1VB 4N8OA 5AXKA 2EW9A 2W8LA 2DGWA 1F0XA 3VZIA 4KAIA 2HYIB 2BR0A 1IBMF 2Z8QA 3TA2A 4NLPA 1TL1A 3I5BA 3PNIA 4PUOA 2CQCA 5BYRA 4FNHA 2XULA 1S97A 4F3QA 2MZTA 3HXMA 4RX6A 5A6PA 2WK4A 3G6YA 1X5SA 4YMEA 3RBEA 4DR4F 2HHXA 1RTJA 1VIOA 2C3PA 3KLIB 1URNA 2FJAB 3C6UB 4JV1A 3IAS9 1T95A 5T7LA 2DR7A 2ACYA 4WFAQ 3KJVA 1R0AB 2QYCA 3OQ2A 1DFDA 1RT2A 2I38A 4O4RA 3MFHA 2CPIA 2HHUA 3O44A 2JLGA 4NLSA 2J6UA 4PPZA 2ASYA 3LAMA 1NK4A 4R8UA 2V4JA 3Q8SB 5DETA 3KLGB 5D77A 3CC2S 3NNCA 1YITS 4NA2A 3LGNA 3NGKA 2WAQD 4NRUA 1WF2A 4JI4F 3V6DA 2WBRA 3LP2A 3FMBA 4OMFG 1VGYA 5E0OA 5B08A 2OPQB 1O5JA 3S7RA 1FTRA 1U25A 2D41A 2EKYA 1RT6B 1G7CB 2X1GA 4KIAA 4NYOA 2DNGA 2WSFC 4QBUA 4CNZA 1J5OA 2XSJB 3N9UC 4RU2A 2AWZA 4IO1A 2PEHA 1K9MT 2HNYB 1XERA 4O0IA 2IAJB 4NPOA 2V8DA 4CTAB 1WHXA 2MZSA 2DHXA 3N6MA 4I2QA 4RLEA 2WB1D 5LJ3Y 5SUHA 3GFZA 2BJEA 4BS2A 5KFRA 1OSDA 2ERRA 3T5LA 2VV5A 5F8IA 3THVA 3HHLA 2YWEA 2BM0A 2OKQA 5E3CA 1KLMA 1RT4A 4ZOSA 3RRKA 4DV6F 1Z1ZA 3RB0A 2XNRA 1R31A 2Z2LA 3PX6A 4WZMA 4DN9A 1Y5LB 3KG0A 2VG6B 1J5EF 1JK9B 3ICLA 1IM4A 3MMCB 2E5HA 3O2IA 3CDUA 1TP7A 1T05B 2ZE2B 4WYWA 1RTDB 3SEOA 4CO0A 1NKCA 4NLDA 4BC9A 4EU0A 3OR2A 2W9AA 1ZTTA 2FIUA 5LT5A 4YOEA 3DU6A 3MM6B 3UCGA 1MMNA 4K50A 3FSYA 1NU4A 4OJ3A 3V6JA 1GH8A 4QYRA 2M8DB 2PE8A 3DYAB 1DTTA 2D3UA 3BREA 3JSBA 4NLOA 5LMUF 3D2WA 4Q2LA 4WYLA 2BQUA 1S79A 4WF9Q 1HBMA 3CULA 4C0BA 3MMCA 4P7VA 3D28A 3KLFA 5K14B 3JSYA 4KTQA 4XAKA 4LFBF 4NLUA 3NGDA 2GGPB 4N77A 1UWBB 2JJ4D 2VKZG 3SCKE 3PFEA 1UP1A 3MI7X 5KFFA 1M5OC 2DPJA 4G3IA 3HJFA 1WELA 4H4MA 1X4CA 4OZ1A 3NAHA 4NLRA 4JI0F 3N79A 4RW6A 1C4AA 2AYMA 1FDBA 1XR7A 1LQ9A 2HFNA 3A1YG 3DMJB 4DQSA 4MFBA 2PN6A 4IH5A 3T5HA 2Z0GA 2CDQA 5IS2A 1R27B 5LJ5Y 1SKSA 2VA2A 2B6AB 2MQPA 2W8KA 1GNKA 4ZCLA 5I3QA 1N32F 1UA0A 2C2EA 2RUGA 2M7SA 4OJHA 5D8HB 4Y6IA 3N6NA 1QAXA 2C3MA 4ZVHA 3JYTA 4ECVA 3I31A 5KOXA 2F1FA 3PZPA 2FUG9 4ZPWR 1H98A 1QJHA 4QIFA 5IWAF 2NS1B 5DRKA 4MJKA 4KHPF 1RT5B 1PILA 2JEIA 3NCRA 4NZ7A 5HN0A 4ECSA 4WKRA 5CH7B 1VOMA 1QSSA 2DNHA 2KXNB 1TQLA 4HEA9 2OPPA 4EBCA 4C8LA 4O3RA 3OVAA 3DHXA 1LWFB 2R2RA 3GG1A 2NPIA 2FHOB 4JI8F 4TQSA 1P9QC 2RRNA 2YKOA 2DISA 1APSA 3HKZD 3JTNA 4A8SA 2P6SA 3CE8A 4JI3F 2J9CA 3RU0A 3F56A 3U7JA 2WB4A 1UVJA 1U1QA 1VRTB 2ZC4A 2XY7A 1KNZA 1TUVA 2X1AA 1S1WB 3M30B 3LGMA 4OI0A 3T6JA 2FD2A 1FA0A 3R3TA 2JDJA 3FJ2A 2GO8A 4F02A 2UV8A 5L9NA 1CPZA 2K1RA 3MEGB 2ZJQQ 4KE5A 3O3LA 4HI1A 3FZBA 1TVRA 5MAOA 3UR0A 5E3QA 4O44B 4TYBA 3LANA 2IVFB 1YIJS 2F9JA 3SDEB 3F44A 2Q1LA 2V94A 3TA0A 2X1BA 1BGXT 1MU2A 4NLWA 4JI1F 4DR3F 4X4TA 4IOCQ 1AXQA 2GQCA 2PFFB 3FVYA 4KHMA 5U47A 1VQOS 1H38A 3F73A 1GXUA 2JX2A 2KM8B 3GFXA 3CXCR 4I64A 3BO2A 2L41A 3WZ0A 3QAUA 4RW4B 4OHVA 4TY8A 3EPIA 3T5KA 1RTDA 1R43A 2RKIA 3ISNC 4OJ1A 4CZCA 4ED6A 3MMAB 2UVRA 2OLWA 1FKPB 1JXEA 1S1VA 1U1RA 2XB2D 3HDSA 3IN5A 4C98A 2G13A 1JJ2R 1RTHA 4ZHRA 2DNOA 1DQ9A 1KTQA 2ZH4A 1QAIA 1HNIB 1NZAA 2XBPA 3IRXB 1SUQA 1LWFA 1ULRA 2YY3A 3QYYA 2FVSA 1P6TA 2DNNA 4OI6A 3IG1A 2B9XA 3TAQA 1QY7A 1N34F 3LF0A 1MNEA 2YTCA 1HBMB 3H4BA 1KLMB 1RT4B 5DM7Q 1C1BB 1S72S 1SH0A 2M3DA 4NCAA 2Q79A 4DL3A 2A10A 4ERDA 4M5DB 4DR7F 4OZLA 4PR6A 3I55S 1EETA 3V81A 1SH3A 1FF2A 3N5BA 2ALZA 1NAQA 5K8PA 1KVIA 3GYXB 5AXMA 3EZUA 4N5SA 4K4ZA 2RS2A 1G2EA 2ZBCA 2AJ1A 2GCFA 4IDKB 4DSKA 1N54B 3C2PA 1LKZA 2KKHA 2PC6A 4X4NA 1V6HA 1UJ6A 3HHKA 1Q8LA 4QW8A 5J1NA 3UFCX 3S8SA 1M1KT 4PG5A 4F67A 3VAGA 5A0YB 5F3ZA 4ILLA 1X7VA 4C0OC 4CO2A 4E8UA 2QE5A 3ETOA 2RQMA 1ZTWA 3CGIA 1NNDA 3L09A 3QJPA 4PG7A 2LYVA 5K14A 3GIKA 3VAFA 2CPYA 3T9ZA 1K8AT 1D0EA 2K7KA 1FDNA 1SJQA 3EGWB 1H6KX 1YJWS 4DV2F 2ZH9A 2VPXB 3M4XA 3MPWA 1GAOA 4OLPA 3SI8A 4N8NA 4DR2F 2DGUA 3CVKA 4QIWD 4AFFA 3RR8A 4A8XA 3Q23A 2KZMA 2XY6A 3HHLB 2PMZD 4J9LA 3T3FA 1IKYB 2JFDA 1D9FA 4HYKA 5KFTA 2YKMB 5DJBA 2A1BA 4EO8A 4ECYA 1YRXA 4GKKF 1WNEA 4QZVB 1ROFA 1X8DA 4C3MA 1Q82T 2BRKA 3MF5A 4WFYA 3IA0A 4RWWA 2BZ2A 2P9CA 4NCBA 1Q7YT 4HVZA 4AXIA 2CFXA 1L5UA 5LMNF 2VFVA 2AW0A 2DHGA 3QO9B 1IKVB 2K3IA 5DG8A 2MQMA 2XWXA 3V2UC 1YRTA 4ZCMA 1C1CA 2ADBA 2N4CA 4RBUA 1S1TB 1SKRA 1FRLA 4FN5A 2PI5A 1MW7A 3G8SA 4HKQA 2QEXS 4A4JA 5KFGA 3F41A 5A8RB 1L3TA 3QGGA 2C3UA 2JL9A 3GFYA 2XO7A 2IMOA 1TL3A 3WBZA 5DQIA 3DLJA 2OFGX 4EZ9A 2KVIA 2EK6A 2HWTA 1S6PB 1Q16B 1JNZB 3MR6A 1SKWA 3JSMA 4K2XA 3RB4A 2UUWA 2XCAA 3PM9A 4RZRA 2IFXA 4ETZA 2FPHX 2ZH8A 2KRBA 1VC0A 1PO6A 2XS5A 5GAGI 3C3LA 1TKTB 3UR3C 2JOQA 4MIAA 2OMOA 1TKXB 3PX0A 1VQYA 3KLHA 2XLKA 3HVRA 3UD3P 4FBUA 4BWMA 3D5MA 4R0EA 4ECQA 4X2BA 3T1YF 1ZAVA 5HMZA 2E66A 2KG0A 3MPYA 2R7QA 2KM8C 2DCUB 2O66A 4JI7F 3M2VB 4IH7A 2HQIA 5DGBA 1PC4A 2ZDOA 4F3MA 2HRYA 2WOMA 4P7TA 4K4XA 4MK9A 2HAIA 2ZOFA 5DDQC 1NK5A 1NJXA 1HNZF 4KO0B 4ECTA 2BM1A 4EYHB 1JLBB 5KT4A 2X1FA 4QWEA 4DV1F 1BC6A 1XBWA 3J7YU 1Y9OA 1FKOA 1JLAB 1BQMA 3OBIA 4A8QA 2HZCA 2KN4A 4Y0FA 1EP4A 3PEJA 3WC0A 4R0JA 5A8KB 2VG5B 3KWMA 1ZM9A 4NCGA 2UZAA 4USJC 5CQGA 3JB9k 4W92B 4MTPA 2Q6CA 2Y0SD 4C8MA 4C7QA 2OMLA 3PV8A 1U1KA 2YVSA 4LUBA 2W24A 3OJSA 2YNHA 3HZGA 3QLHA 3MECB 1O8BA 3J80Y 1LXNA 3OJUA 1ELOA 2W9BA 3SV4A 4WZQA 2N3OA 2EFOA 2CJKA 2OPSB 4H4KA 4QPTA 4YB6A 1S6OA 3EYZA 2VPZB 3K5NA 1E6YB 3GQCA 1U6ZA 1B0PA 2JHEA 3I0RA 4BCAA 3CJKA 1YTYA 4LJMA 5M2RA 1FJ7A 3BB5A 3H25A 3UCZP 1JLQA 4CNYA 4UOCA 2RU9A 2WHOA 3H2UB 4Q43A 4JI2F 2CPHA 1ZAWA 2QSFA 3PACA 4WK3A 2YKNA 3ENWA 3SV3A 5I42A 2KFNA 3KMQA 1K0TA 2DR8A 1A6LA 3UDCA 5KFOA 1RJJA 5KT2A 2AX1A 5J1PA 1ZBTA 2FB0A 4EO6A 1SUQB 3PRBA 3FRYA 2QLXA 1P8GA 1W2IA 3JYTB 2GC8A 3MECA 1LWEB 4HL9A 1RKIA 2YH1A 4N76A 1NJZA 3K59A 5KG5A 1TFYA 5F8NA 2LCWA 4IUFA 3LUYA 3TVKA 3DGPA 2V9KA 4WIIA 4CCHA 1R8CA 2XNQA 2ZC3A 4LVNP 1HR0F 4LF6F 5KG2A 3T1HF 1G6BA 2C42A 3KLEA 1MU2B 1P1TA 3CC4S 1EP4B 2UV8G 3BDPA 3W7BA 4AQYF 2V9WA 4LF4F 1X9MA 3WC2A 2NSBA 5C25B 1ZM2A 1HYSB 1YJVA 1S1UA 4IOAQ 5HMYA 2FJBB 3LP0A 2OAUA 4ZPTR 3IWLA 3DRPA 1ZYQA 2CQ3A 3MUTP 2W9CB 2DPIA 3IC1A 2JZ5A 1YSJA 2GO9A 1VRUB 2RJZA 2RIJA 2X3GA 4IG3B 5T41A 5CYQB 4O3QA 3T6BA 1PGZA 4QOTA 1QUPA 3FQLA 4PG4A 4QR1A 1SB6A 3OL7A