4UOHA

Crystallographic structure of nucleoside diphosphate kinase from litopenaeus vannamei complexed with adp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
128
Chain Sequence
MVRERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Nucleoside Diphosphate Kinase from Pacific Shrimp (Litopenaeus Vannamei) in Binary Complexes with Purine and Pyrimidine Nucleoside Diphosphates
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 35
structure length 128
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4uohA00
2BX6A 2AZ3A 3FCVA 4ANCA 3EM1A 4UOGA 3EVOA 1NPKA 4S0MA 5IOLA 2AZ1A 1B4SA 3BBBA 1UCNA 3ELHA 3VGUA 2HVEA 3Q89A 3BBCA 3GP9A 4ANEA 4ANDA 3ZTPA 1PAEX 1NB2A 1NHKL 1MN7A 3ZTQA 3L7UA 3FKBA 1NCLA 3FBBA 1F6TA 1ZS6A 3BH6B 4FKXA 3R9LA 2HURA 3ETMA 4F4AA 1JXVA 3ZTSA 3FC9A 3ZTOA 5CAAA 3JS9A 1NDKA 1NDCA 1B99A 4C6AA 4FKYA 1MN9A 3WX8A 1W7WA 4DUTA 1HHQA 1K44A 2DXFA 3EICA 3NGRA 1XQIA 3VGSA 1VYAA 3VVTA 3FBFA 3PJ9A 4UOFA 3NGUA 3MPDA 1NSQA 3VVUA 1WKKA 3EVWA 3PRVA 3DKDA 1LWXA 3EVMA 4W98A 3NGSA 3Q8UA 1BE4A 3BH7B 1WKLA 2BEFA 4ENOA 1F3FA 2VU5A 1LEOA 3NGTA 3EMTA 1EHWA 3Q8VA 1NSKL 3EE3A 4WBFA 4DI6A 3ZTRA 1BUXA 3Q8YA 3FBCA 3FCWA 4CP5A 2CWKA 3EJMA 1NDPA 3ENAA 4EK2A 2HVDA 1KDNA 1HLWA 1NLKL 2DXEA 3GPAA 2DYAA 2DY9A 3FBEA 4UOHA 2B8PA 1BHNA 3Q83A 4O0NA 1S59A 3VGVA 4KPCA 5CABA 3B6BA 4HR2A 1NDLA 1NSPA 1U8WA 1PKUA 1S5ZA 3Q86A 3VGTA 5C7PA 2ZUAA 1NUEA 4DZ6A 3B54A 4F36A 1S57A 1XIQA 3G2XA 3BBFA 5BXIA 1WKJA 2B8QA 2DXDA 1HIYA 3DDIA 2NCKL
chains in the Genus database with same CATH superfamily
4U95A 3TA0A 4B02A 4IG3B 4USUA 2WVFA 5E0OA 4DPOA 1F1BB 3DU6A 1ZPWX 2VHGA 1FF2A 3DXBA 4LREA 1JLQA 3Q23A 3PJXA 2EC2A 3HFVA 2FHJD 2W2MP 3IRWP 5DZ7A 1DQAA 2BZ2A 3CD7A 4HKQA 2KFYA 2X3DA 4DV3J 4IRCA 1RWUA 2KRRA 2B0GA 4U8VA 4ZN3A 3OTOF 2O01C 4ECTA 1Y9OA 2BM1A 4PEOA 4KBIA 1GTEA 3K58A 4DR3J 3V6DA 1UFWA 3J81U 2CNLB 3TI0A 1NZ8A 1VISA 3OBIA 3TANA 3R27A 4PYDA 4KJIA 3BN7A 3MMAA 4CO1A 3OVSA 2IA0A 3KUEA 1YJTA 1BD6A 1BQMB 4RUBA 5FD1A 2YH1A 2HPUA 3JQMA 3I96A 5BYSA 3T1HF 2W2PP 1OJ4A 3ZTOA 4MIBA 2LEAA 4CNZA 5J1EA 2P8IA 4ETZA 3OSNA 3D3BJ 4I1TA 1JLFA 1LW2A 4ED6A 1E6VB 2BE2A 4EFAC 5LMNJ 3MEDB 1SQEA 4ZITA 4JI7F 1VK8A 3GFHA 4NA2A 4RPFA 4YQWA 3CMQA 3ISNC 1WDDA 3BPDA 2HFVA 1BGXT 4ILRA 4U8YA 2AJ4A 2OHDA 4RNOA 1IQZA 4IH6A 4PPZA 5LJ3Y 1XC9A 2BQRA 3SEOA 3E8OA 4WFZA 4K4VA 2GFFA 3AA8A 3EGNA 1SKUB 2DO0A 5C25B 2HVHA 5CZVA 1X0PA 3FMWA 4A4JA 2C2ZB 9ATCB 2VOOA 3KWMA 1F9EB 1J5EJ 4IKAA 2FHJA 4QPTA 2Q43A 3KLGB 3K57A 1KP6A 1M5PC 3VR1A 2DGSA 4NZ0A 5BR8F 1N6QA 4I6WA 1RP5A 2AEJA 2GHWA 2QLXA 4WP9A 1XR5A 2MHEA 3MM7B 1FXDA 1F3FA 2BXJA 4DG1A 4FXWA 3TR5A 3ET6B 2R3VA 2WONB 3I9V9 1VLOA 3F41A 2DR5A 1FKPA 1R0BG 1RWNB 4NLQA 3FJ2A 1BUXA 3FFIA 3BSOA 3QRPA 2VC0A 4FXVA 2BOPA 3SSSA 2NUHA 2V63A 3H8YA 1D3WA 4ZPCA 2V8PA 1LW0A 2LEPA 1C4AA 3GLJA 4FP9A 3UNGC 4R5PB 3FMBA 5EWGA 3NS7B 2F9JA 3OL7A 1NEEA 2VF3A 2OI2A 1QM9A 3KJVB 2IBKA 4F4KA 2B9EA 4TYAA 2GO9A 3LUYA 4WK1A 2ZC3A 3SFGA 3NGDA 3MAAB 3UCUP 2FJXA 2Y1RI 1VJWA 4UY8T 2QO3A 2M7SA 3FSYA 5EX3A 4LF7J 2L41A 4MKYA 2OGUA 1RT5A 2MMYA 3QZ7A 2HAIA 4X66J 3O2IA 3CTRA 2XMKA 3DLGB 2BBEA 4ZHRA 2GCFA 8AT1B 3B4MA 5CABA 2ZHBA 2XY6A 3RB6A 4C9DA 3ITHB 1LWFB 2VG6A 4M5IA 3M9NB 1NSPA 2KKHA 3PX0A 1BQNB 1KEKA 1D8YA 3D0IE 3BDPA 1S9EB 4DFPA 2DVIA 2BJ3A 2CJAA 2OPQA 1GMVA 1X4BA 1B7YB 4HDHA 3TZZA 3IM8A 4ER8A 1JNZB 2ZE2A 2BDPA 3H4DA 4IR9A 2IM2A 1UJ4A 2NLWA 3SMZA 4DCOB 3PRBA 1S1VB 2EFQA 2IA6A 5BXIA 1KVJA 3PRDA 3UW1A 3LF0A 4Q43A 3SQOP 2HSEB 2ALYB 3B8HA 4NCGA 3H5YA 1H2UX 3CJQA 3I87A 4JV2A 1RACB 1S9GA 3N4WA 1FKPB 1NPRA 3O5TB 4RBVA 1GEHA 3M9OB 2KG1A 1SC4B 2I0XA 5KFEA 1B70B 5KFNA 3LWMA 1YHQS 1B4SA 4LF8J 1HR0F 4GMKA 5A0YB 2HS0A 1JLEB 1NO8A 2QE5A 3VGUA 1F9HA 3JQKA 4PQAA 1U25A 4JUZA 4DV6F 4F02A 3V6DB 2RKIB 5MLCV 2YBVA 1RTDB 1UPPA 5F8HA 1FRLA 4PAAA 4ANDA 3H2LA 1PAEX 2V2VA 4A8YA 3O8WA 2GX8A 5CA5A 3H25A 1WF1A 2ATCB 2RQKA 1RTDA 3VZHA 3ZTQA 3R2CJ 1JLCA 2YKNA 3FZBA 3M8WA 2JOQA 4LF6J 3X3UA 1ZAVA 4X4VA 5JXSA 3D4JA 2E44A 4NE9C 4DLGA 2AKWB 1NJXA 4F4AA 3OFEA 2IVMA 4URSA 4ZVEA 5B0AA 3MECA 2MZQA 3QAUA 4LT6A 5M2RA 3AY0A 3GV5B 5CYQA 1X9WA 5G4DA 4KKOB 4CH1A 1Y0HA 4Q0BA 3VZIA 5L38A 4CO4A 1UJ5A 1J2VA 2M3DA 2PGCA 4J5OA 5AXKA 2IAJB 1YVFA 2XYHB 3R6LB 4K4XA 4KE5A 2E5LF 1YZ7A 3MM8A 1S0OA 3HT0A 2XEXA 2AMCB 3QT5A 3GTYX 3N6NA 5L39A 1SL1A 1URRA 2ZVIA 2HGMA 4QR0A 2F8EX 3NGUA 1HWIA 1CULB 1HBUA 3IGNA 4LRCA 2MGZB 3TAPA 1TK8A 2J6TA 5LT5A 2W4PA 4ELUA 3IR5B 1APSA 4LF6F 2A18A 4ED0A 2U2FA 1WKKA 1C2PA 4FYVB 3DKDA 4WZQA 2X1FA 2E1AA 2Q6BA 1XR6A 4LFBJ 2D1CA 1LOUA 2CPDA 1UTAA 1CS4A 3CC4S 1RU1A 4WZMA 4A8KA 3THPA 1PJ6A 4WFXA 4RX6A 1X31C 2WVDA 3UD5A 2HHHF 4OFZA 3PIOQ 1X60A 2J7UA 1CJTB 4MIAA 2Z2ZA 5C2GA 2OH2A 4IUFA 2DT9A 1Q0NA 2VOPA 4QWBA 4DR7F 1Q8IA 2MZSA 2RRBA 3FSXA 1QY7A 2JRSA 4FF3A 1NK9A 2HHHJ 2KXNB 4ZVQB 3O3LA 5ADZA 5HSPA 3RB4A 1YIJS 2UU9J 2B7CB 3MTJA 2N7CA 4DOZA 1FHTA 4MK7A 2WVBA 3QGPA 3NLCA 3KLHB 1VI7A 4H4KA 4J9SA 3TP2A 1NXIA 1OPIA 3HLUA 4C3MA 2ILZA 3FGVA 1X4EA 1LK7A 1SC1B 4G1QA 4DXLA 4ZCMA 1Q86T 1SKWA 1D9FA 4ZP6A 1UVIA 4U7CA 3H90A 3BGOP 5AT1B 3L09A 5KG3A 2RS8A 3G6XA 2KG0A 4KFBA 2DNZA 3GE9A 4X84A 4DFMA 3HI9A 3I31A 5DGBA 2KHCA 3UD4P 4Z7YA 1Y7PA 2H9ZA 2Y0SD 3D1QA 4IO1A 3D6TB 1YITS 4FN5A 4NLSA 4O3PA 1HHTP 5KG0A 2OIHA 2XWYA 4QU7A 2OTJS 3M8ZA 1OQ3A 3PO4A 2ERRA 2DIUA 3HP6A 3CCTA 2VDIA 1S12A 1WACA 5A8WA 2FLNA 3P6YC 4PRFA 4C11A 1WOPA 1O51A 2YX1A 2GGPA 2M88A 1S57A 3GG1A 4F36A 3J81j 3OTOJ 2ADBA 2UU9F 1L3SA 1RTJB 4WXWA 2IDLA 4PG8A 2VL1A 3G4SS 3QGGA 3OL9A 5KFUA 1CC8A 2G0JA 2JEGA 2J8SA 2AWZA 3ISND 1IBMF 1FRIA 2CZ9A 1NHUA 5C42B 2HZVA 4PXCA 3FRZA 1G6BA 3IP0A 4F3OA 2HS4A 4JYAJ 1CLFA 1X4GA 3HHLD 3BBBA 3M6UA 3KHHA 2MSTA 4C8ZA 3ZFVA 3V81B 4HEA9 4NLYA 2XHWA 2ZJPQ 1H2VZ 3RJMB 3QAEA 3WX4A 2V9KA 1RSCA 1NHKL 2EBGA 2M4MA 1JLAB 1WG1A 3PR4A 2VONA 1FTRA 3FKBA 2GMHA 2G1DA 3H0PA 4F26A 3PX6A 2HQCA 2BKOA 1F6TA 2BANA 4ZOSA 5E41A 4YHHJ 2VB6A 4NLGA 2UUBF 2WW4A 3KDNA 1IKVA 1GXUA 1TELA 4DPYA 4MFBB 4NLPA 3HFKA 1ROFA 2MKYA 1C1BA 1P1TA 4MYUA 3OD2A 3R5GA 3LGMA 1YJNS 3NNHA 1QVGR 3W9JA 1H98A 2PFDA 2EFGA 1S1UB 2PO4A 2HGLA 5HI7A 1HBOB 2IJRA 1R31A 2E29A 1RT3A 1B0TA 2C3OA 2JVOA 2VC1A 5KT7A 1PC4A 1HWUA 1UKUA 5GAHU 3KHRA 4OJHA 1U2FA 3NGKA 3TZYA 5LMUF 1GNKA 1XMOF 2DR9A 2FJVA 1H0HB 1G3OA 1XBWA 2XWXA 2DNLA 3CJ3A 3D6MB 3FEZA 3NEKA 3HVTA 2FY8A 2CJ9A 4UQTA 2GIFA 4H54A 3RAMA 5K9FA 3H7HB 1U2RA 1JLGB 3HHLB 4I56A 5KFHA 4NWBA 1U1MA 4Q0BB 3JSMA 2G1HA 3OTBA 5CCMA 2I1RA 4DV2J 4LR9A 1HBMB 3KLIA 4RWWA 1N56A 4BBYA 1ZZNA 4LQ3A 3F44A 2DGQA 5KG5A 4OI0A 1HNWF 2QLFB 1TL3A 2BA9A 2HQGA 5C25A 5LSLA 1JLEA 1WNEA 3NG8A 3SQGB 3DRPB 3PM9A 1KVIA 4F4WA 2JFKA 4RUAA 2F1FA 2VU5A 2AEFA 2FC8A 1MG7A 1QSSA 4JV5F 4LIRA 1EHWA 2MLYA 3GR0A 2HMIB 2VICA 2H4WB 4WBFA 2DRBA 3T5HA 3ZTRA 5A2QU 1C1CB 4CTAA 4YR3A 4DL3A 3T19A 4NZ6A 4ETXA 2R7OA 5KG7A 3QRRA 4GO7X 3V4IA 2FGCA 3N5BA 1GTHA 2XS5A 4IOAQ 4YY3J 4NRTA 3W60A 2DGTA 1LWCA 3WC0A 3QRQA 1UVKA 1JB0C 4ED4A 1N5YA 3VAFA 3NS5A 4DV1J 3QLHA 4I2QA 5L1KA 3GG0A 2RDJA 1ICEB 3CCSS 5JVHQ 4RKUC 3CIZA 4Q5VA 1J27A 2CPXA 2WB1D 3HZEA 2HK2A 5LL6d 1M0SA 4IYQA 2QEXS 1FEEA 3ISZA 4DHVA 2AJ2A 2D3ZA 2QMWA 4O3SA 4A8QA 4H4MB 4RW4B 3VQSA 4IR1A 3MURP 1WC0A 1RBLA 1PKUA 2B3TB 3DI6A 2GA7A 3W65A 3F0NA 3BKUA 1ZM2A 3Q8QB 2DKOB 2H3EB 1JLFB 1LW2B 3KJQB 1U0HA 4WP8A 3N79A 4M5GA 2XTJP 3U7JA 3R3TA 4OZ2A 3AT1B 4OI4A 1NU4A 5CH7B 4F25A 5AJ3J 2NR0A 4DZ6A 2C42A 2OEKA 1VQSA 3G2XA 3R2DJ 4OMFG 1M1HA 3CSKA 4OJ1A 1W2IA 3M2VB 2A10A 3IBFB 4AE5A 3SBMA 2NZCA 3TNVA 4DPXA 2BX6A 3J7Z5 3FCVA 3ENQA 4H4KC 3UFCX 2NPFA 5E7OB 4ANCA 4M5MA 2HYIB 1MNEA 3HF5A 4RBTA 1Z2LA 2VFVA 1UEVA 3LO3A 3MHYA 5A76A 5FDLB 1R0AA 2V67A 2A3JA 4Q2MA 3LGNA 1N5TA 1X5PA 4RBUA 2V34A 5CCLA 4Y34A 2RUSA 3GSIA 4QIEA 4QYZJ 1CEZA 3TX0A 2Y8WA 2VPZB 2F4FA 4IFYA 2N4DA 3GP9A 2NYIA 4DV6J 2DNHA 2R7SA 4LF8F 4P71A 1O5JA 2HVZA 1Q81T 1RWWB 1VHIA 3LANA 3BM7A 4A8SA 1RBAA 3MM9B 3BV8A 5CHCB 2CYYA 2DGXA 4ICLA 3FDSA 2FVQA 4M95A 4RW9A 3TA1A 2G2YA 1C4CA 2UUTA 2W2OP 5E3AA 3CJSA 5C42A 3KLEA 2R8HA 4J9OA 4HHHA 4L74A 2WOMA 1NK6A 1KN6A 4O44A 3VALA 1HQUA 2E7XA 3FK4A 3IG1A 3W2VA 4JI8F 5E3QA 3V81A 1IM4A 5LOQA 3QFHA 4O4GB 4EBEA 4Q8FA 3JS9A 1VMBA 3IN5A 4AFFA 1T9WA 1B0PA 2HZAA 2MQLA 3CO9A 3NWGA 1U7LA 3AD9C 1Z2ZA 3T9ZA 3ZZZA 2BKNA 2LQBA 1KQFB 4X4SA 4GO5X 1IWGA 1G7CB 2FVCA 4DBQA 1NK7A 4JV1A 2QG9B 3MPUB 2DXFA 1FXLA 2R8GA 3B82A 1CJUA 1HQEB 1XQIA 2MJUA 1LWFA 2VG6B 3HSZA 4L72B 2DHXA 1N33F 3TW0A 4TU9A 1IKVB 1RB0A 4RW6B 4RNMA 2KM8C 5B09A 3NXZA 4I2PA 5KFWA 2HIQA 2J8AA 2CDRB 1NK4A 4HTJA 3M8PA 4CI0B 3G9CA 2AYEA 4ED3A 1RDRA 1RAGB 5HMWA 1H73A 4DSLA 5A8KA 3GILA 2B4PA 3UVJA 2IYIA 3T1AA 4DSKA 1HNVA 2ZH8A 4K4WA 2N82B 1TUGB 3JTNA 4M5NA 4YS2A 3QIDA 4A8WA 4ES2A 1S1XA 1RWXB 1QE1B 2JZ5A 1T02A 4WKYA 4DFJA 1OYDA 4KGKA 1S1TA 4WYLA 3HT3A 2E9ZA 2HNZA 4ECRA 5GMEA 1M1KT 1D09B 2YVSA 3PTWA 5KTQA 3NCQA 5HMZA 1UZHA 3RW7A 4DF8A 3T1YJ 2DPIA 1VIOA 4ED5A 3TO8A 4UZBA 3EXCX 5KFVA 2D41A 3UDCA 3CJKA 2ZM6J 3GIMA 4CCHA 3IG1B 3KLVA 1P1LA 2YKQA 2MZRA 4Y2KA 5KAKA 4ZCKA 2KO1A 4CLFA 3OLAA 4ZKAA 2R2UA 1TQLA 1BWVA 4F0HA 3BSCA 3OLBA 1IJFB 4P73A 4QQBA 4Z2XA 4P7VA 1HNIA 1HLWA 1GFWB 1LK5A 1OWXA 1X4FA 4OHVA 4KIAA 2UXCJ 3W7BA 1UA0A 1F5AA 3NAIA 2VJUA 4I4BA 2CA9A 5DRKA 1R8HA 2AYBA 2VKRA 2AT1B 3CB4A 2RHSB 4OI2A 2AD9A 1URNA 1JQGA 2A2DA 3M8SA 2VQEF 1L3KA 1VGYA 2AX1A 2F40A 1AZSA 3GJQB 4KKOA 1SIZA 2DR8A 3DHXA 4UW2A 2XI3A 4YB5A 3HULA 3OFHA 2H48B 3M8QA 3KK1B 1WDTA 1NJYA 1NSAA 3Q86A 2E7WA 1EJ7L 1TR0A 3CDWA 1JLGA 3MM8B 1VFJA 3R7NB 2B7BB 5D0HA 2OPSB 2I9SA 4QJVA 3CD0A 5ETLA 4U96A 4ZJOA 4DX7A 2AQ4A 5J1EB 4HL9A 1SBRA 3MMAB 3KNAA 1XIQA 4M1KA 1YTYA 2GIRA 2UVRA 2GHVC 4KO0B 1DRZA 4G6VB 1X0FA 4WKRA 5B0BA 1SQFA 3CJ8A 4ZP9A 5DDOC 3MUMP 2W9CA 1NK5A 3BR8A 5HVFA 3J7YI 2ATLA 1ZA1B 2W8KA 4RW4A 4KY3A 2C2MB 3H2UB 3CVKA 1Y4ZB 5A6PA 3R1LA 3DI6B 3RW6A 2J6UA 1QAXA 4MK9A 1RK8A 3N9UC 5LSOA 4AQYF 1PO6A 2XS7A 4FF2A 1I3OB 2Z56B 2EFPA 1DLOA 1LWEB 1HNIB 2OPRB 3CO0P 1T0TV 5ETTA 1NHVA 3D2WA 4FYDA 2OLWA 2FC9A 2LXFA 2M5YA 4JOUA 5F3TA 5DDQC 3HK2A 2B4OA 3RR7A 1P6TA 2I5JB 3CD5A 3GCXP 3HMJG 1S49A 4Y65A 3IR6B 2WTFA 2QJ3A 2ASYA 2J0WA 5LMUJ 1CSJA 1WOOA 1XN9A 4ZS6A 4ECXA 1D9DA 5F8NA 3NOCA 1TUWA 5F0WA 3KJFB 3NKYA 4YFUA 1O0PA 3MUTP 2BJDA 2P9CA 1N54B 3FFIB 4AD6A 2R2TA 2WAQD 4MKVA 2DNRA 1FX4A 1REVA 5HATA 4P75A 3W64A 1NK0A 4A8FA 1BC6A 3N5FA 3KHGA 1HKAA 2HBRB 2LKZA 3IGVA 1WSRA 4ZVHA 2R7WA 3VAGA 2KJVA 2HWHA 4J9NA 2ZEJA 4BLGA 3CF5Q 4C8KA 2GAHC 4ELVA 3I32A 2FGOA 1TFWA 2DRAA 4IRKA 1R0AB 1L3VA 5K8NA 1W25A 2MKSA 7FDRA 2A2CA 4TY8B 3SCLE 4DPTA 3PW4A 2UUAF 2I38A 3OXLA 3I4PA 4C98A 5HROA 4PWDB 3CDAA 4KH1B 5KG6A 3G82B 4NI2B 4NLVA 5GMDA 1S9EA 4AUKA 4L76A 1OS5A 2HGNA 3Q2TC 1FRXA 2JWNA 2B43A 1HNVB 3S01A 1LWEA 2MKKA 3IWXA 2RJZA 3WIVA 2QA4G 2W4CA 3HX9A 5DLFA 1L3UA 2G0CA 2GVZA 3DLGA 1DZ5A 5D15A 4AXJA 3OT9A 2HHTA 1RXOB 3NGTA 4RW6A 3Q8RB 4FS1A 1P9YA 1NKBA 3W9IA 4FVMA 2JEIA 3R6GB 1FD2A 1JLBB 2OPQB 2XO7A 4CH0S 1IBMJ 3FCWA 4ECWA 4DV7F 1M90T 3LH2S 4GC6A 2GO8A 3EJMA 3MM6A 2F8MA 3OFFA 4IDKB 1NDPA 1N32F 1TMJA 3AQOA 2HNDB 3RRKA 3MUVP 3C46A 3O44A 5HBMB 2BMBA 3P3DA 3T5LA 3C6UB 4XPCA 1VRTB 2RQCA 1KFDA 1RTIB 2JH3A 1C0UB 1BHNA 1F5BA 1FRJA 1KBRA 4DPWA 2POKA 3CCJS 2R2SA 1MWQA 3CMES 3I5BA 1Y10A 2J6SA 2IYGA 3AA9A 2JHEA 2H54B 2WB4A 3UPFA 4F7VA 4K0KF 2HLUA 2CNKB 2UVVA 4O3RA 1G2EA 3IM9A 2VPXB 2UXDJ 4CO2A 1NMEB 2FUG9 3LTOA 4H4MA 4IOCQ 1T9XA 1WD6A 3P96A 4OQJA 4WTYA 3BR9A 5A8KB 2GVDB 1RTZA 4OYOA 3J7A1 3DLKA 4ID8A 3DMJA 1U0HB 2CFXA 1S6PA 1HIYA 2X51A 2QLJB 2ZKUA 2XO6A 4OYZA 4OL8A 4TQRA 1SVDA 2D3OR 3GQCA 4A8MP 1JJ2R 4ES3A 2F9DA 3DNCA 3SSQA 1U2CA 2UXBF 3NCPA 3W8PA 1N5VA 2MLXA 3K7RA 5KFFA 4P2XA 4QW9A 4DV0J 5M2UA 2V68A 2Z2LA 1ZAXA 1HNXF 1RT6A 3GWCA 4MH8A 1U4BA 3BYPA 4LFBF 5KT4A 2KJWA 3DLJA 3MEGB 4FYXB 4JBCA 3BZQA 3CCQS 2D9PA 2Y8YA 4ZLLA 2MQQA 1XNQJ 4B3RJ 1FNXH 3TQEA 1JIHA 1RT7A 1WUUA 2NXCA 3R7BB 2DH8A 5B08A 1ACMB 2XY7A 1CULA 4P2MA 2HRUA 4YB7A 1U02A 3W61A 3TJ9A 3QSYB 4PG6A 4ITSA 3D9BA 4U6PA 2ROPA 1X4AA 2FLLA 1TK0A 1SC3B 1FCAA 2OPPB 3DDKA 4EGLA 5F3ZA 3GIJA 3A4TA 1HYSB 2DNOA 4PZVA 5A6WA 2DGOA 5KFIA 1VBZA 1T03A 2H1YA 3G6YA 4LFCF 5EN1A 1TKXA 4DQSA 3AJ2A 1RGVA 3HXMA 1RT1A 2L9DA 1YJ7A 3UN5A 5HMYA 5KFMA 2NUUG 3IAM9 4HH0A 4C2MA 1K8AT 3UO0A 1RAAB 3BSNA 5BJRA 2YWKA 3D66A 3VTIA 1FVSA 4CYUB 4F3QA 3Q8PB 1GXLA 4O4GA 2NREA 2KYZA 2ZNYA 2JSXA 2LQ5A 2OUGA 2GW8A 2WK4A 5DQHA 2AGQA 1HNZJ 4F8RA 1S1WB 2F4VF 4NPOA 2ZH7A 1JKHB 1Y11A 3DGPA 4RL1A 3QWPA 1N48A 4J9VA 3W2WB 2C2EA 2OP5A 3RBXA 2XG8A 3BDEA 5E3RA 1UVMA 3EX7B 3NNAA 3N01A 5B0EA 4JI0J 1T3OA 2Y3YA 3NAHA 4K4YA 3J7ZT 2CZVC 1FWLA 1V6HA 4NLDA 1GK8A 4BHQA 2VQFF 2B6AB 3EZ5A 3AB4B 4DUZJ 1HNXJ 3UVJB 4PYAA 1WKLA 2GMJA 2X1GA 3K5NA 3DHWC 1BY9A 4DG1B 1FERA 4DL2A 3AODA 2FQQB 3A8EA 4P52A 1SI9A 4DR1J 2VH7A 4B9MA 3IO1A 1QE1A 1X5TA 1FTCA 1UZDA 2H5JB 5ETRA 3Q8VA 1NSKL 3EE3A 3MFIA 2W7OA 2VJVA 1VQLS 2UUAJ 4ZIVA 1FDAA 2FJEB 2UXCF 3CWJA 3TRGA 4KHRA 3AOAA 1VRUB 3FBCA 3RB3A 1SB6A 3G82A 5D8HB 2VZ9A 3N6LA 1S0VA 1LW0B 3HD2A 4ZCLA 2E1RA 3ENAA 1NBEB 1R27B 2Y0BB 4MKBA 1WWHA 5AXNA 2IVYA 3KLGA 2GAGC 4N76A 3ZZ0A 5IV3A 2QTWA 3ONQA 3QSIA 1RE1B 2XI2A 4DV4F 1XMBA 4LBIA 4WP3A 1RTIA 5B0FA 3CCRS 4YB6A 2R7TA 4OYBA 1Q8KA 4QYRA 2MKIA 1OO0B 2RDIA 2EK6A 2UXDF 2M70A 3NMRA 4K0KJ 4LMZA 3V2UC 3DN9A 3WZ0A 2C1EB 5D0EA 2GIQA 3CJ2A 4DV4J 1R89A 1T95A 2EG2A 3PFEA 3HZGA 3MM6B 4RWXA 4C97A 4PXBA 2Z30B 4EI2A 1C1BB 4ZVGA 3W66A 2ZZNA 2W2NP 3MR6A 2W2QP 3TUJC 3SSRA 5K8MA 3MOJB 2HQDA 3AFGA 3KJVA 1MU2B 2JEJA 4OHYA 2YXLA 2UV8G 3QJLA 4X2BA 2YKMA 5DDRC 1SPBP 1YGYA 2HBYB 2DNGA 2ASLA 3HKWA 2DHHA 2KRBA 5D77A 3CCUS 5EUHA 5J2MA 2XM3A 2GVZB 4DEZA 2YNGA 1UEKA 2L3MA 1YJ9S 1RISA 3UDVA 3G8TA 1RAEB 3PG9A 4I69A 4OJ3A 7AT1B 2XMMA 2AHOB 1HBOA 1NPKA 4ZVPB 2PMZD 1GXTA 5K5MA 4EO8A 4XPEA 3FSIA 4DR2F 1KFSA 1F2GA 2N4CA 2CUYA 5IZHA 1JLBA 1RHJB 3I56S 2E66A 4QYZK 1WORA 1YG0A 1KLMB 1WJ9A 2DGVA 2M0GB 1HBMA 3KLIB 3A3PB 3LOUA 2XMAA 4CH7A 2FJBB 1EQ0A 2UUCF 5DGAA 1LXJA 1ZAWA 1Y3KA 3GR1A 3GCWP 3KUHA 4X4TA 2W25A 4N56A 1MMDA 2K1RB 5F8JA 3RYLA 3DC2A 5ETQA 3T9NA 1S7IA 4YR0A 3A3NB 4K4TA 2WVCA 2HEKA 5KFLA 4JV0A 1VDHA 4G1PA 3K5MA 3EPIA 1ELOA 1HYSA 3G8SA 2G2ZA 2J7KA 5HL7Q 1IQTA 1FRMA 2OD6A 3M7VA 2WBRA 5I42A 2OEMA 2EWHA 2XMTA 3V6JA 3C14B 1T9YA 3SCIE 1O8BA 1PBUA 4F4XA 1LWCB 4C6AA 2DR7A 1JWWA 2YNIB 4DL4A 2PI4A 3KDOA 5D0RA 1IXKA 2GJFA 2K3IA 3EICA 3PJWA 2EFVA 1Q78A 2E5JA 4MK8A 2Z2MA 1C1CA 2HQFA 4CTAB 3LPEA 4JI8J 3R5JB 1VC6A 2CPIA 3R8YA 1AA1B 3GFYA 5CZXA 2M52A 1HARA 1OY8A 4OZNA 4DL7A 3X1LB 4LF7F 2HHQA 3MI7X 4ZLNA 1HMVB 2G2OA 2IJFA 4L73A 4NLWA 1GT8A 2CZ4A 3E51A 3WC2A 1FJGF 1IN0A 2RAQA 3OR1B 4KQZA 4ZDNA 1VIXA 4LRDA 1IKYA 2BVZA 2CQBA 2BRKA 2VG5B 5LXRA 5E5NA 4ED8A 4LF4J 4AQYJ 1BWEA 2IAJA 1J5OB 1UJ6A 2NSCA 4M5LA 2ZJRQ 1EP4A 2DEJA 2XMVA 1QUVA 4JI3F 2MHNA 2V0NA 2D69A 2B4VA 2PFFB 1JXLA 3EXYA 4HACB 4ZPDA 1A7GE 1GMWA 1Q8BA 3EMTA 2CXEA 2RILA 2VASA 4P10A 5KT6A 1VQ4S 2F5GA 3PFOA 2LLZA 1SH2A 2W7PA 3AD8C 4CLSA 4B3MJ 4P9SA 4Y00A 2FLOA 2RRNA 2Y1LB 4NLRA 2J7WA 4RO0A 3S6EA 4FS2A 1T94A 1MWYA 1DURA 5FDLA 2PSZA 3RB0A 2BJ8A 2OJ3A 3ILLA 2K7JA 2MXYA 1YJWS 2LDYA 1EAYC 2OD4A 2QC3A 4B17A 1HL6A 2YPZA 3R5BA 1QAIA 1KWMA 1PILA 2W01A 2R8IA 2AGOA 3M32A 5HMXA 4GVBB 3C6UA 4ICLB 1U48A 1Q7YT 4KPCA 4OYAA 4ZMMA 2ZJQQ 2C22A 1U1PA 1FNOA 5KFGA 2R7UA 4LSZB 2ALZA 2DGWA 2P2CB 2HVIA 4C8MA 2QX0A 3U27A 2O1PA 4FXDA 3MMJA 5J2NA 5E3CA 2AF6A 2RUGA 4M94A 4NCBA 5IT0A 5ITHA 4MMOA 2QA1A 1WHWA 3W5YA 3B54A 3CCES 2O3DA 5KG1A 4C8OA 4X64J 3EDRB 4USMA 2JLFA 3KG0A 1ZPVA 4CWBA 4O23A 1U1OA 4JI5J 4K5RA 1F3VA 1B0VA 1N5SA 1T9VA 1PIEA 4DCPB 3PACA 3MFHA 2OKQA 4CLTA 4TU8A 1IR1A 4QBUA 3PKYA 1KKHA 1U1KA 4NL5A 2CQ0A 3CDUA 4OYWA 2ILYA 5BR8J 3CMAS 3JTPA 1T7PA 4NXNF 2V50A 1WHYA 3V6HA 3M8PB 1WHVA 4FZVA 2HVEA 4B9SA 1S77D 1M5OC 3BBCA 2CPHA 1RKIA 4C11B 1U45A 1WC5A 3JXOA 2WVEA 4LSNB 2RF2A 4DN9A 3NL0A 2E5GA 1MN7A 1S1TB 1BMQB 2ZBRA 4IQMA 4ZP7A 3IC1A 3IWLA 3TVZA 2PMHA 3W8GA 3MAQA 3DYAB 2NYHA 4UOCA 2MEWA 2EI5A 2LA4A 2RIJA 4LSLB 4J9MA 3LP0B 3HPOA 4MTPA 2KXFA 2ROGA 1S0NA 4ZPAA 1YQHA 1WHXA 2HBQB 5CD4A 2FDNA 2LDIA 1VHFA 1VK3A 3GONA 2MB0B 1NPPA 1VRTA 3D67A 3HD1A 3I0RB 5KFZA 4IO9Q 2IRXA 3M4XA 1TKZB 3P4UB 1B99A 3M30B 5T7LB 5KFAA 3JQJA 2J9CA 3U1LA 4FKYA 3LP1B 3WX8A 5DQGA 3PIPQ 4DV5J 1WTBA 1RABB 3BKTA 4MKAA 3P5BP 1H2TZ 4E98A 1UVNA 2V2QA 2PN6A 2OFHX 2DNKA 5T41A 1VYAA 3TAMB 4ZVFA 2HHSA 1VR6A 4U7UD 4BC9A 3LAMA 1CBKA 3HHLA 3ENVA 2HFSA 2GJ2A 1E6YA 1TTHB 2BV3A 3CDBA 1S6OA 2CJXB 4O4RA 4OYMA 4XK8C 5D3GB 4YUDA 4YN3B 2FIUA 2IHR1 4LFAJ 3OPKA 5EGYA 3CCWA 1GX5A 4W98A 3ZZRA 3OHBA 1N32J 1AYEA 2PIIA 2VV5A 5B0CA 4ZJQA 4YR2A 1PSDA 4R25A 4WWSA 4DX6A 1UWBB 4KO0A 4QWAA 4NA1A 5G0RA 3RR8A 1EB0A 1N34J 2O67A 3DLBA 3EZOA 1U0SA 3CE8A 3Q8SB 4DR2J 3DU5A 3LP0A 1WI6A 4BCAA 5B0DA 2WW8A 1SH0A 1CJTA 2BYCA 2ZHOA 3OR1A 3DOKA 2DGUA 1JJHA 4N7TA 2PI5A 3SCJE 2F65A 2M8DB 3LPYA 3I82A 4X4OA 4QIGA 1S76D 1RT7B 2HLTA 4C48A 2H5IB 2BRLA 2Z4PA 4O3QA 3THTA 4OIXA 4WE1A 5IS2A 3GIIA 3HM9A 4IG3A 4PUOB 4QCLA 1P9QC 1Z4UA 1CJVA 2RHQB 4OZJA 1UAWA 4OLOA 4BWJA 2XNQA 5C5JA 1U09A 4JP8A 3C66A 2EW9A 5KFKA 3M2UA 2JJ4D 3LA0A 4E8UA 1IKWA 2UVUA 2KB2A 3MPYA 1RT1B 4G65A 4I0WA 4Y3CA 1U8WA 1SXLA 2JC0A 1RHUB 1FD8A 2FZGB 1TU0B 3BGUA 3DRSB 4AL6A 1X9SA 3MM5A 5CYMB 5KFYA 1SV5A 3D0GE 4B3TF 2GZOA 1VQ6S 2JEFA 1RAJA 3MAHA 2WZ1A 1U1NA 1K1QA 1RTHA 3UR3C 1YJUA 2W1BA 3DFEA 4HI1A 2B8QA 2EG1A 2BOAA 2ZM6F 3HVRA 4GVBA 2C3PA 2GJIA 2QL5B 4Y2MA 1J5OA 1ITPA 1GH8A 2KT2A 2LQJA 3MEDA 2ZBIA 3OL6A 2CRLA 3GSDA 4B3OB 4ED1A 2E9RX 1K0VA 4MFBA 2O5DA 1RTJA 1FESA 3TA2A 4UOGA 3J80U 1KSPA 3BYRA 3RU0A 2AZ1A 4M5HA 4L3NA 4W90B 2RD5C 3W5ZA 2IM1A 3DRXA 3DRRA 4A46A 1ZTWA 2KDOA 3MMCA 3V6KA 3K89A 4OHZA 2LECA 4RLEA 5DG7A 3P5TL 1MSWD 2VQFJ 1QAYA 4BWMA 5KG4A 5AE3A 5RUBA 3OFGA 1QTNB 4X62F 2R7QA 3LALA 3QBCA 5KFTA 2XULA 4IRDA 1Q53A 4E2FB 1N33J 4M5DA 3MMBB 1ULRA 1FK9A 4P6QA 5K14A 1S0MA 2DCLA 4CLYA 1KR4A 3MCNA 1RCXB 2COLA 1DTTA 1RHQB 2WHOA 2IM0A 1PC5A 3GB0A 3W2VB 2G4BA 2KFZA 1S9FA 3R1HA 2DB1A 1M5SA 1XMOJ 2IC3B 2YQ1A 1FRKA 3FQLA 4IFYB 3JAMY 2MPUA 1LV5A 2XLIA 1RT2B 1D1UA 2HHVA 3M30A 4IDKA 2ACMA 1NM2A 1RTHB 5D4NA 2AV5A 2E5LJ 4ILLA 1V3RA 2XGQA 3PY8A 2ACYA 5DQIA 4B9TA 4A8XA 3NMAA 3SIPB 1RWPB 4GKJF 2V94A 1JLAA 3UE2A 1VQ5S 1FNMA 1HQEA 3UWTA 4DR5J 3T41A 1QD1A 4R0JA 1UL3A 5EWEA 4LUBA 3PEJA 4LSLA 4ZVOB 3VVTA 4BC7A 4CLKA 3KLEB 2YKPA 2DK2A 1KRPA 3GU0A 4V19X 1Y5NB 1KVKA 4ZA1A 1MW7A 4XTTA 2EK1A 4ZPBA 5I4MA 1BXNA 2CNNB 3K5PA 2C2OB 1ZETA 2IJNA 3PW7A 1RHKB 3K8WA 4YB1P 1EIYB 5KOWA 1KNZA 3FNNA 3ZZYA 4CLLA 5HQLA 1WEXA 3RBEA 1N52B 3RRGA 2RU9A 4I6YA 3J7YU 3EGVA 4JI0F 3MR5A 2R8KA 5K8OA 4JYAF 1FJCA 1UWBA 1S1VA 4NMXA 4ECYA 3AXMA 1IBLJ 1KS2A 3DLKB 1YJRA 2J9DA 1ZM4A 5DG9A 2LU1A 2EXUA 3NY0A 3GFXA 1IBCB 3US5A 5CXTA 4N41A 2CQ4A 5KFXA 3TWZA 4NASA 5J2PB 4Q44A 1PGZA 2DPJA 3Q8YA 4LF5F 1H3DA 3IS9B 5AE1A 5F8GA 2CWKA 4ZLPA 3BGRA 3BQ0A 4DR5F 1SKSA 3BSAA 1NRKA 3IXQA 3QATA 4FYWB 4LRAA 3U1MA 1PG5B 4A47A 4AT1B 2V9WA 4DSJA 5L1IA 4UTGA 1VQMS 4O3NA 3POTB 1UETA 1IWAA 1TL3B 1WSVA 3I0SA 1U6BA 1IUJA 2MKJA 2XSFA 3MCMA 4ZVRB 4K50A 2R42A 4WFYA 3GPAA 2UV8A 3L9ZA 2DYAA 2CDQA 4UOHA 3H40A 4B3SF 2BR0A 2IMWP 2FD2A 4Y28C 4ES1A 5GAEU 5F0UA 2DH9A 2U1AA 3HKZD 5BYQA 2HMIA 3TUIC 1IKWB 3KK2B 1D9AA 1F60B 3LP2B 5KFOA 2A6OA 1TUVA 5A0YA 5I3QA 2DNNA 5HP1A 4OI6A 1RWKB 2IRYA 3M8QB 4ATNA 2FTRA 2YTCA 3VGTA 5C7PA 1BLUA 2NXEA 3L95X 4ZCIA 1IR2A 1I51B 3SCKE 2CPEA 2CG8A 1F2HA 1Q8LA 4WIIA 1FDBA 6FD1A 4K4UA 4RW8B 4KPYA 5J2NB 4CRJA 4DUYF 4ZPWR 3BGLA 3CUNA 4QWCA 2KXHA 1L3TA 2HQIA 4DR7J 4C3KA 2X3GA 2ZH6A 4DV7J 5F8MA 2CQPA 2KYXA 2HRTA 2QIFA 4QR2A 5J2QA 1VC0A 5E33A 2VBWA 3A3OB 4TYBA 4NLXA 3BGRB 4WFNQ 4CLPA 2LFVA 1R6YA 2LQ9A 2QL7B 1OIAA 1UCNA 2P6SA 1NNDA 2V8VA 4ID5B 1HI1A 4K2XA 1TP7A 5HANA 1EP4B 5LM7E 4R8UA 2HQ3A 3BPSP 4EMDA 1UWAA 3OHAA 1H38A 2YQ3A 2R8JA 1Y3JA 2BE7D 3A12A 2XLJA 3AXKA 1K0TA 5GAEI 3UNYA 4A8OA 1V9OA 4RW7B 3OXGA 2EFOA 1NAQA 3D68A 4WFBQ 3VAKA 1AUSL 2HS3A 2QGFB 3NRBA 1GMWD 3LP2A 4Q2LA 5CYJA 4LRFA 3OXFA 3BO2A 3VAJA 4PKDB 4DCJB 1A9NB 2VD3A 1DTTB 1IBKF 1S9GB 3GFZA 1VRUA 2VODA 2VDHA 1N4LA 4OX8A 1SIWB 1WOSA 2L48A 2HKEA 4B3SJ 1FI4A 3D3CJ 3AJDA 3EZUA 3PHTA 2BW2A 4V19J 3GV8B 2VFSA 1LFPA 8RUCA 1IBKJ 1IKXA 3KK3A 2I5JA 2BUNA 1R8AA 2J9DE 4U67Q 4DL6A 3S8SA 3D6HB 4DX8H 4GKKF 4LFCJ 2CG4A 3KNGA 5HJYA 4YHHF 3K59A 3LW5C 4LF5J 1FK9B 5K14B 5GADU 2BABA 1RADB 1YBAA 2KZMA 3AOBA 4IFVA 2LYVA 2AJFE 4HT5A 3MD1A 4WK3A 4NLUA 1NSQA 4KGZB 2MKCA 3E2EA 1N5QA 2EKYA 3GIRA 1RWMB 3ULHA 3T5JA 2HFUA 1XNQF 4EU0A 2OEJA 2ZBPA 5ETVA 1NH7A 1SJQA 3CULA 4UUWA 1LWXA 2Z8QA 2ZC4A 4ED2A 3OVAA 2LQ8A 1SJ3P 3M6WA 1I94J 2F3JA 1XR7A 1HR0J 2MLZA 3CNQP 1V3SA 2DO4A 2V4RA 2GQQA 2ZH1A 3DRRB 1JLCB 1K47A 2YKNB 2KHDA 3MTKA 1OQ6A 1X4CA 4ENOA 1KTQA 3M1VB 1R3NA 3VF0B 1UPMB 1S1XB 3L4BC 4PG7A 4PR6A 3GYNA 4RU9A 4EBCA 1VQ7S 3HJFA 1IM6A 3DDNA 3ZZTA 2GV1A 1UVLA 2J76E 4B9UA 2KVIA 2YNGB 5DG8A 4USVA 2PMWA 3FCHA 1RHMB 4KTQA 2QLWA 3M6XA 5D6GA 1DJ0A 3DRYA 1H7XA 1ZZFA 3KK1A 4DUZF 2K8GA 5H9FJ 5SZTA 1S4FA 2MZJA 3R5DA 4ILMA 1HBUB 2MGZA 2V5HG 2ZUGA 4JI4F 4FYYB 1TV6A 4TQSA 1PYOB 3FUYA 1JNRB 2YWEA 2E1CA 5IT9Y 1KLMA 3MGJA 1TKTB 3NWRA 2DXEA 4QWEA 7FD1A 4AL5A 3UN2A 4HTIA 1DARA 4WE1B 5M2PA 2ZZMA 1FJ7A 3L7PA 4ZPTR 4RZRA 2RT3A 3BEGB 3B78A 2JFDA 3CJ4A 4WJBA 2RU3A 3IWNC 4QU6A 1SH3A 3OUYB 3I0RA 1PJ7A 2CIMA 3G87A 4WXOA 2AP6A 4CQ1A 3DOLA 5HLFA 1NJZA 5D78A 2XS2A 3D1HA 4DMZA 4X4UA 3KLFB 4F2RA 1FT8A 2HFZA 2VBYA 5HN0A 3KOAA 3W62A 5EDWA 3C8YA 2BJ1A 3E3XA 3L7OA 3C14A 4OX9F 2YNHA 2Z0GA 1WKJA 1SV5B 2CADA 3DDIA 1QVFR 1DAXA 5AXLA 5JUMA 3VAMA 1VBXA 2SXLA 2FB0A 3CPWR 3FVYA 1AW0A 1ZBTA 3EM1A 3HHEA 4KGXB 3HHKA 2JC1A 2ZDPA 2Y1JA 5L1JA 4FPIA 3IFEA 5FIIA 5IQQA 5L46A 4M8LA 1HHSA 3NBPA 1T3NA 3ZZUA 3T1YF 3QYYA 4ID5A 3QMQA 1KTVA 2M9KA 1FX2A 1HMVA 1TL1B 2QLBB 4X4PA 3Q89A 4DU8A 2XCPA 4CLUA 1REVB 5J2PA 2UVWA 1UVJA 1TFYA 4KB7A 2YQ0A 4D3HA 1UEUA 4DU7A 1IKYB 2BKPA 2CQCA 2H51B 2VG5A 4K7QA 4RNHA 5ETNA 1DTQA 4B3TJ 4UQGA 4LFAF 4USJC 3MMCB 4MJKA 3MR3A 2J0QD 1HPZA 1R8CA 3L7UA 5B0GA 2GGPB 1NCLA 3G86A 3DXSX 5ETSA 3BH6B 3R9LA 4J9QA 2R2RA 1L5UA 4W92B 1W26A 4UY85 3P8BB 5EX0A 4FF1A 2B9XA 2HNYB 3FC9A 4J9PA 2FJWA 4QWDA 2QA4S 3A1YG 1AFIA 1QAJA 1NDCA 3DRPA 2M2BA 3GJRB 4KC5A 1U1LA 4P2FA 3QIPA 1PAUB 2IBOA 2X7IA 4Y2CA 3LGHA 3M2UB 4AYBD 1HW8A 1FWKA 3ADAC 4CO0A 3Q0AA 2MDAA 4RW7A 3PW2A 1SJFA 2N3LA 1YK9A 2J0XA 2CKWA 4QOTA 4EZ6A 1YWXA 4UF4A 2DNMA 3EUNA 4E0DA 4NXMJ 1DY3A 3VGSA 3TUPA 4RW8A 1XEZA 4JB8B 2VFTA 4ZLJA 4DSFA 1JKHA 4OLPA 1SUQA 5H1SV 4K2JA 3GV7B 1XMQF 4TNOA 2DD8S 3PYGA 2VG7B 4HT7A 3W5XA 3J7AN 1RT4B 3C3LA 2Y9HA 2G13A 2KT3A 3PRVA 4TY8A 5D4OA 1PJ5A 1F5CA 2DNYA 3ENWA 2AJ1A 3E01B 5F8IA 1S10A 2YX7A 1P27B 3CCZA 1RBOB 1TZ0A 4CYUA 2H4YB 2OTLS 4C8YA 2UUBJ 2GQCA 3ZXWA 3BH7B 2NXNA 3MZIA 3H5XA 4C0OC 1MLAA 2BANB 4FDFA 4ZVTB 4DFKA 2AIRB 2JVRA 1KHVA 2RMLA 4N77A 4NEYA 1RT3B 4DF4A 2CPFA 1FJGJ 1KOOA 4URQU 3V4MA 4ZHRB 3BN4A 1PYTA 4LR7A 2OO4A 3W9HA 1CJKA 1KQKA 1HWLA 2KFNA 1OYEA 1TL7B 2E1MC 2A6MA 5KT5A 3MOZA 4XIUA 4NXMF 3AH6A 5F41A 4O0IA 2V2ZA 1HWJA 1KQGB 2LVWA 2Q6CA 4LR8A 1KDNA 4DQIA 1RT5B 3PDNA 2B6AA 2YWFA 3ETOA 4OYIA 2DR6A 5KT3A 2E9TA 5DETA 3HO1A 1A6LA 3TVYA 2DNPA 3CJ0A 4DSEA 4NCGB 3K5LA 1P8GA 3Q83A 5KT2A 2RSQA 3BREA 3KG1A 3CIMA 3I0SB 2P6TA 2WONA 3VGVA 3RBZA 4CO3A 3KMSA 2DCUB 3SV3A 3CJ5A 3DYAA 3RAXA 1IVZA 2YNFB 4OZ5A 3UCGA 1OSCA 1VOMA 4HR2A 4N8NA 4W4MA 2HHXA 3T3FA 3DOLB 5HLFB 5DJBA 3TZXA 1N36J 1S5ZA 4O44B 2RF2B 1NZAA 1QLNA 3ICLA 4FVCA 2D7SA 4DLEA 5HP1B 2RKIA 2MSSA 5A8RA 1VQ8S 1FFWB 1RU2A 2V6AA 1SJ4P 1JX4A 1TKZA 5T7LA 1VBYA 2YNHB 1DBDA 2W4DA 1V5VA 5IV4A 2F7VA 3CEDA 2CJBA 2AZ3A 4KYZA 2R7RA 4NYZA 1BQMA 3M05A 4RUHA 1T11A 4X62J 3BQ1A 1R6VA 1G1XA 3ILOA 4S0MA 1HWKA 4KSEB 4TVAB 1X8DA 2J0SD 5KFPA 2CQIA 3U02A 3PXGa 4CO5A 4DQRA 3AOCA 1NH8A 1CJUB 4ANEA 2ZWPA 2DITA 3A13A 1B3TA 2PDAA 5AJ3F 1HNWJ 2OELA 5MAOA 2VBXA 3HFZB 3MEGA 4OV1A 3R97A 1UFLA 1Q5YA 1VBKA 5GAGU 2NXJA 3CCMS 3CCLS 2XGPA 2WCXA 3D0HE 3FBBA 1FKOB 1PCAA 2PD1A 2ZOMA 3IBWA 4XAKA 4MYTA 1ZH5A 3GJSB 2E1PA 1XMQJ 2DNQA 5D3GA 1TVRA 2BACA 2XSJB 3ETMA 3KUGA 4GC7A 1VQPS 3MXHP 2CAJA 4DV5F 2I2YA 3EDQB 3BKFA 2HHWA 4TXSA 3R7SB 5CAAA 3L3CA 3TQ1A 3JB9k 4LIWA 5AE2A 1RKJA 3K0JA 2MYFA 3VAIA 2ZDOA 5KFDA 2IMOA 1K9MT 1X5SA 2PEHA 4USHA 1CS4B 2HHPA 4DR4J 2BW7A 2IIHA 5J1PA 2R9LA 1K44A 1EKRA 1FE0A 1NJWA 1R7IA 4OHWA 2XHCA 1CJVB 1F9FA 1RWOB 4OYXA 3PJ9A 2EKNA 3VWSA 3ZZPA 4KAIA 9RUBA 5IWAJ 5HVHA 2PA3A 2QYCA 2ROEA 3MM9A 4DJBA 2ZHAA 4K4ZA 1Q4RA 3TJAA 1TL5A 2GQ2A 5H9EK 3RTVA 4GVLA 1SKRA 2Z57B 4OI3A 1N5YB 3WBZA 2OSQA 2VA3A 1N88A 4DR3F 4PUOA 2E5IA 3I6PA 3TOQA 4ECSA 2MZTA 4KV8B 4B08A 1HQUB 4PWWA 3VQTA 3OTDA 2YNIA 4OZ1A 4M5KA 5CYMA 1TL1A 1X5OA 4CLZA 4JI2F 3SDEA 2V2KA 3IRXA 6AT1B 3F73A 1LEOA 2ZKTA 2B5JA 4NX9A 1NKEA 1DQ8A 2AX0A 4KGMA 2KZZA 1DHMA 2WSCC 4J91A 5FLXU 3G6VA 3EPGA 3OVBA 3PYFA 4R8UB 2YWWA 3SFUA 1FE4A 2QL9B 2XB2D 3M2RB 3EWGA 2FJAB 2Q1LA 3NS6A 4OI1A 5IM0B 4XO0A 4TLQA 1VQOS 2CQ1A 2JLEA 4CM0A 4FF4A 1QUPA 1SQGA 4Y2AA 3SZ2A 4Y2IA 4LBHA 4OX9J 1Q79A 2ZE2B 4C0HA 3PO5A 1SCJB 2ZITA 3UDEA 5F9NA 2MY8A 4B3OA 2H65B 3DOMA 3MEEB 4YDDB 1KD1T 4ERDA 4PQUA 8ATCB 4NYPA 4QIWD 4TKTA 5U47A 4CM2A 4WIQA 5J2MB 2ZH3A 4O0NA 3OR2A 4V1Ak 5IT4A 2C2RA 3DGVA 1RYRA 1S59A 1CVJA 3CJTA 1FXRA 2P9GA 1YLXA 4M5DB 3I9ZA 5I3PA 1YKWA 1NDLA 2FVPA 2K06A 1U8SA 1IJEB 3H4BA 3PNIA 3H20A 1ZA2B 3QT8A 3PW0A 2FVRA 2WSFC 2LA6A 4B9VA 3BGFA 3PX4A 4BS2A 3QQCD 1NK8A 3DCAA 1EKSA 3RBDA 2ZUAA 3CW2C 3KKFA 2VG7A 1IKXB 2BJ9A 3HVWA 2FY1A 2R7XA 3PVXA 4B9NA 1WEZA 2HIYA 2IC3A 3C6TB 3PYDA 5HVGA 3BBFA 3KHLA 3HVAA 4JI4J 3I55S 3R5CA 4NA3A 1VLYA 2EFNA 2EC0A 1Z1ZA 1QTMA 4CDIA 2ZOFA 4JI1F 4X4RA 3HSDA 1Q7LB 3B4DA 3TZWA 2UUWA 3FEXB 1RUSA 5CD4H 4X4QA 5FJ4A 3BF4A 2BQ3A 2HW3A 2VFUA 3EVOA 4NLOA 3D1OA 3IA0A 5IM0A 1HQ2A 5IOLA 2R7VA 3JYTA 3QJJA 4OX6A 1AZSB 4DR1F 3H98A 4PWDA 5GVQA 2B56A 4ECVA 3QO9A 4C0BA 1MU2A 4Q7AA 1RA7A 2FPHX 5C2CA 4Y0FA 2D3O1 1IR0A 4P72A 4OYPA 3DOMB 2ZH4A 4DV3F 4J37A 1TAQA 1YZ6A 5IWAF 1AFJA 3D5MA 2EBEA 4HLBA 4I6AA 3D7SB 3G8QA 1FFSB 4L75A 1HBNB 4ALZA 2DHSA 1DFDA 3I5CA 4J9RA 2FZKB 3HVTB 2QSWA 1VJQA 2LXIA 1MROA 4EYHB 5BYRA 3C15B 1HPZB 3QGIA 2HURA 4RNNA 3NNCA 3ZTSA 4FNHA 3MECB 5EWFA 3D6FB 2FHOB 3JSMB 2P9EA 4I7FB 1LKZA 3KFWX 1NDKA 4J9UE 4F0KA 1KOHA 2HK3A 3AJ1A 4NRUA 2XMWA 4K5SA 1EETB 1WI8A 4WTOB 1M1GA 3C6TA 1MWZA 4HI2A 1MN9A 4IG0A 3M8RA 2Y1IA 4FBUA 4DUTA 2H5EA 2MQOA 4YOEA 2Q79A 5HO4A 2W9BA 2V8HA 3OTCA 3NGRA 2WSEC 2VPWB 1WG5A 2WRMA 4DZDA 5F8LA 3OUYA 5L9NA 1XERA 1M5KC 3Q22A 2O66A 1VS3A 4AL7A 4QR1A 3WIUA 4PCQA 1RAHB 2UUCJ 2HNDA 2MZ1A 2HBZB 2HHUA 1CQNA 1HFEL 1AT1B 2CPYA 2LU2A 3I4HX 1WEYA 3JYTB 5ETOA 2CNOB 4DSIA 1IBLF 2MKHA 3VVUA 3SQGA 1X7VA 4XDDA 4EYIB 1K73T 4KV8A 1R43A 3QT7A 3KLHA 2B51A 2LP4A 3IAS9 4C8NA 2ZD1A 1Q82T 1VQYA 2DTJA 4WYWA 1I6JA 5E3PA 3IRXB 2GVDA 4N8OA 5KFCA 3M32B 3BO3A 2HWTA 3PV8A 4IH7A 1REGX 3TUZC 3FQKA 4WFAQ 2XYPB 4JI5F 1UW9A 2ASDA 2QRRA 1HA1A 1FKOA 2A0FB 3CT9A 5HAOA 4CP5A 5LSRA 4JI3J 2MJNA 1YX2A 2YY3A 3AB2B 4OZ3A 4H4OB 2AJ0A 2GS8A 5ETMA 4EK2A 5HROB 3MR2A 1RT6B 1DTQB 1X9MA 1HI0P 3P49B 4GKJJ 1RJJA 4IG0B 4QIVA 2AGPA 2YKOA 1N36F 2APOA 2PEBA 1TKDA 1KONA 2HAFA 2DRDA 3P45B 3W63A 4TY9A 2DY9A 5KG2A 4PQUB 3ZNJ1 3VV2B 4C3LA 5B7WA 4CLWA 1QSYA 1HW9A 4ZP8A 2CJKA 5IXUA 4Y6IA 2F8HA 3VCDA 3B6BA 1FRHA 4X65F 3LWLA 1S97A 3C16B 3M2RA 5EHHA 1JMTA 3UN3A 1VC5A 1OMSA 3H2VE 2HZCA 3BB5A 3TAQA 2OFGX 2AU0A 1FO1A 3MM5B 4DR4F 2YNFA 4YDXA 3MF5A 1S7HA 2RQMA 1FEHA 1CPZA 2B9YA 1SJRA 4WCEQ 3PR5B 3CDEA 1M5VC 4PG4A 4R5PA 4LRBA 1H72C 3MM7A 3RGIA 1HD0A 1RCOB 4L3KA 1YRTA 2ZH9A 4JI7J 1TAUA 4UUXA 3KK3B 2QFJA 1T03B 1Q5VA 1RI7A 2XNRA 2DH7A 3A8JA 5DZ6A 3IMQJ 3RZAA 4DX5A 4ZIWA 1C0TB 2RNEA 5JMNA 1WTFA 3DRSA 3IR7B 3OQ2A 2KM8B 4J9KA 3FRYA 4NMLA 3WQPA 3OJUA 4JI6J 4H4OA 5AXMA 1XNRJ 2GC8A 2K2PA 3EGWB 1CQMA 4DUYJ 4J90A 3TX8A 1H74A 3T5KA 2LEBA 3ZNUA 3PHEA 1OPZA 4I68A 3QO9B 4YMEA 2L9NA 2XC9A 4DPUA 4LJMA 1J5EF 3M2VA 4HHUA 2ZH2A 1RAOA 1LQ9A 2CJYB 4U9RA 1YBUA 3A8KA 3M8YA 4RNFA 2YX4A 2XZTB 3HCXA 4LF9J 1TL7A 4F50A 3RRHA 5KFQA 4RJVA 4FKXA 3TAMA 4A48A 2XCAA 1RQ0A 4OZLA 4Z7CA 4I67A 2IRUA 3N6MA 3OR2B 4QZVB 1JXVA 4PXDA 4CT8A 4P74A 1VQNS 1FFGB 5LJ5Y 1ZTTA 3AAWB 5KFSA 1UP1A 3BO4A 3ZO7A 2FVSA 1RT2A 1EETA 2BJ7A 3PZPA 4WPAA 3NOGA 4MIWA 1UMJA 5IC6B 3UCZP 2ZBQA 4DQPA 2D74B 2L08A 1UW4A 1UFKA 4MAKA 3GMGA 1QJHA 4XDCA 1U26A 3GJTB 6FDRA 3FBFA 4IH5A 4USKA 2P5VA 2DY1A 4ECZA 4DQQA 1EQMA 1AROP 2CQDA 1X4HA 1FDDA 2IVFB 3DOKB 1N34F 2NXUA 2KI2A 1GAOA 2L9WA 5A8RB 1CC7A 1S48A 3EVWA 2OPPA 3HHNB 3MCOA 4DR6F 3TEHB 3PKMA 1E6YB 4K4SA 5DM7Q 2W9BB 2B9WA 3TVKA 4TLRA 3QNWB 2HFOA 1RYSA 3D28A 5IC4B 2HG4A 2NZ4A 5J1NA 1DQ9A 2Q3PA 5E2QA 1S6QA 4KHPJ 3SI8A 2NPIA 3V5RA 4DI6A 4PG5A 3G71S 2UXBJ 3CJRA 2EVZA 4C8LA 2MY7A 3M9MB 1FDNA 4NZ7A 4HH1A 3W1YC 2CQ2A 4DDFA 3V4IB 4M63A 1RWVB 4LF4F 4K8RA 4G3IA 3J80Y 1V3ZA 5HK4A 5THWA 1NLKL 4OZ0A 1S1WA 4ZJLA 3GIKA 2ADCA 1JK9B 1EX8A 2IFXA 5DS7A 3H59A 2G9OA 3FBEA 3QGHA 5G0RB 5SUHA 4NOHA 2GMLA 2HWIA 2W9CB 1TVRB 2W24A 3DGPB 3HSJA 2R4FA 4DN0A 2JLGA 4PABA 2F4VJ 2B4UA 3W2WA 3KK2A 3S7RA 2HRYA 2BE9B 5L8RC 1S4EA 2K1RA 4DL0C 4AXIA 3IS9A 4C7QA 4X65J 3VAHA 1HNZF 2LCWA 3JSRA 3QWUA 3K5OA 4KHMA 1LFWA 2BM0A 2GNKA 2HNYA 2VBZA 5FLXY 3DLLQ 3MEKA 3FEYB 3MCSA 1DLOB 2OPRA 3WDOA 4X4NA 2AYGA 1YRXA 1WC6A 5KFJA 5I42B 2LMIA 5I3UB 1B7FA 1U6ZA 4DWIA 4FBTA 4Q45A 2QV6A 2CQHA 2W9AA 4G1QB 2ZD1B 4URGA 1U49A 3MWBA 4NCAA 2DJWA 1S6QB 2J9EA 2NSBA 3MMBA 2CVEA 2EEYA 4RW9B 1R0CB 1RAIB 5HJXA 4D3GA 3OL8A 4LF1A 4JI1J 1SUQB 1RT4A 4Q8EA 1NJIT 3TARA 5C24A 1EARA 1RHRB 4QPXA 2XMJA 4RUCA 1I94F 2OPSA 3E01A 5A2QY 2NQPA 2YKAA 2QYGA 2B5JB 3R5AA 2ZFHA 2IPOB 1NB2A 5KOXA 2F63A 2YPYA 1D0EA 3QT6A 2C3MA 1GMUA 2YKMB 4OV6A 1K1SA 1SJ1A 1TMMA 5DLGA 4DL5A 3UD3P 1ZS6A 4KH0B 1U1QA 1V5IB 3UQSA 1C0TA 1N0VC 1YBTA 3K17A 1FA0A 4J7CA 1YJVA 2XZDB 2DEIA 3F56A 3K8VA 4FPRA 1U47A 3KJNB 1FWPA 1NKCA 1TL4A 1E6VA 2BE2B 3ITHA 5LXYA 3C16A 2Z58B 3C15A 4UZCA 2AYMA 2MTLA 2YWGA 3QFWA 2QSFA 4M5JA 5LMNF 4EEYA 3C2PA 3CXCR 1RLCL 2KU7A 1HHQA 4O3OA 4F3MA 4ZK7M 1OY6A 3O6QA 3G6ES 4ELTA 2XQCA 1R8BA 4OJGA 2J5AA 2CJQA 4OHXA 4U7UK 2RRAA 1QDUB 4ZPVR 1YSJA 2X1BA 3PEHA 4HVZA 4PXEA 4USIA 2C2DA 1GQEA 4IFVB 2KTQA 3Q2SC 4CIOA 2CPZA 4WU3A 3O1LA 1ZYQA 4EWTA 1S72S 2CQ3A 3HDSA 1WF0A 2FYXA 1ZOTA 4R0EA 3EVMA 2ASJA 1FKAF 2AW0A 1QSLA 5HBMA 5KFRA 4NEZA 3CCVS 2UP1A 3T6BA 3Q8UA 1XJWB 2XBPA 3D54A 1BE4A 3H42A 3HSGA 1KQSR 3LAKA 3OSPA 2MQNA 2V4JB 3UR0A 1Q95G 2D3UA 1C0UA 2FHMA 2KN4A 1WELA 1YDLA 4L6V3 5IFMA 2C2NA 4KHPF 4G1IA 2IY5B 3QZ8A 3Q24A 4BDPA 4NXNJ 3DLEA 2UZAA 4LQ9A 4QIFA 3MPVA 1YI2S 2G0IA 1MMLA 1ZM3A 2QFIA 4P7TA 2V8GA 1KC8T 2V69A 5K8PA 2YH0A 3KG4A 1CG2A 1OY9A 2I8EA 1PBAA 2HVDA 4LF2A 4TU7A 4DR6J 5HQ8A 4F0MA 1WC3A 5HQMA 3DM2B 4X64F 2YWHA 3PYEA 2VKZG 2W8LA 4LBPA 4YP3A 4NYOA 1TKTA 3H5SA 1WC1A 2ABYA 2KH9A 2C3UA 1MROB 2N7YA 5L1LA 1HD1A 2CPJA 5GAHI 1Y00A 4EZ9A 3QPIA 4I7FA 3MDFA 3EYZA 3CC7S 3BS9A 3W3SA 1Y5IB 1JJCB 2JNJA 2XSJA 3CGIA 2ZBCA 1FJEB 2QA2A 3HHDA 2XZWA 3ZC4A 3KYLA 1AUDA 2MQMA 2K7KA 1S99A 2PT0A 3POTA 2DHAA 4PPDA 4C4WA 5GAGI 2LXUA 4IOBA 4N5SA 4CNYA 4OX7A 2E7VA 4HACA 4HYKA 3MD3A 2GHPA 1JXEA 2DXDA 1T9TA 1NUEA 1I1GA 4WU2A 3C19A 3GYGA 2CWXA 2OSRA 4TN2A 1ZM9A 3OTEA 2RB7A 2ZVSA 3QLHB 5D4LA 5KFBA 1JLQB 2VFRA 1A0OB 1F0XA 2PC6A 5DO2A 1WC4A 2C2KB 4DS4A 3S1TA 3N0VA 4ECUA 3U1NA 5ETKA 3OJSA 1VQ9S 1WF2A 3FZ2A 1AXQA 1S79A 3LP1A 3ELHA 2IDEA 5JJBA 5ETPA 2ZWOA 5J2QB 2FZCB 2C28A 1D8ZA 5GMKa 5JVGQ 2XLKA 3QJPA 2RQ4A 2V8DA 4LVOP 1Q16B 3ZTPA 2PA8D 4JI6F 3GYXB 1LXNA 2ZZTA 3K2YA 4I2QB 4UT4A 1XNRF 1HI8A 5DM6Q 1S6PB 3GZ7A 3BQ2A 1H6KX 3SDEB 4DV0F 1Q1KA 4DV2F 2VA2A 4B9LA 4ZVSB 3SXLA 2M8HA 2FJDB 2JL9A 3ILJA 3JAMU 2XYGB 4USWA 2X1AA 5CYQB 4MT1A 2NS1B 4LVNP 3G96A 1T9UA 5H9EJ 1NB7A 4KFBB 2I6WA 4F2SA 1XWLA 2D9OA 4FNIA 1T05B 1XTZA 3A8IA 3AD7C 3JSBA 2ZH5A 1SL0A 1R8PA 3HHLC 4NI2A 2DHGA 4WF9Q 3KXDA 3JSYA 5GADI 3TJ8A 5D4PA 3THVA 3QIPB 5D0GA 2QT7A 1W7WA 3N28A 2VUGA 1XK8A 5CQGA 4HDGA 4USTA 2KVQE 4YY3F 1N6QB 4EUVA 1T8EA 3MEEA 3J81Y 1SL2A 4CT9A 2EPIA 2W7AA 4KT0C 3EGZA 1S6UA 5L9XA 2VQEJ 1BQNA 2ZNZA 3ET6A 5I3UA 4K59A 4X66F 4UOFA 3NCRA 1PYSB 2OMLA 2OAUA 2RDDA 2XMUA 3I5AA 3MPDA 2PE8A 1EZZB 2QMUB 2IM3A 2QMXA 3OV7A 4RU2A 4N47A 3T6JA 4F04B 4JV5J 1TKXB 2MQ8A 4CZCA 3OW2R 2RS2A 2WOMB 2DBBA 4LSNA 1X4DA 1GX6A 2BQUA 3WHIA 4HHJA 3LQVA 1TV6B 1G4CA 3H5UA 3ZZOA 1BQXA 3VHQA 4F67A 3NGSA 2WBMA 1UA1A 2MQPA 3RUBL 5C24B 4QW8A 1MMNA 5DDPC 4PWUA 3RG6A 2FHKA 2RVJA 1B64A 2BEFA 1O6XA 2C3YA 2V4JA 4P2SA 2A1BA 3M6VA 3CC2S 3AQPA 1FVQA 3DLEB 2AEMA 3UDLA 2DISA 5K20B 2K3KA 1CJKB 1Y5LB 1M5HA 3BJYA 3M1VA 1T05A 5F9LA 2N3OA 3RAQA 4GKKJ 4JI2J 4KRWA 4ED7A 2FLPA 3TYTA 3MPWA 1OSDA 3TEGA 3SYZA 4EBDA 3ILIA 2Z2YB 3AHPA 4ECQA 4EO6A 1JJ4A 2JDJA 1RZMA 3IBCB 3PCOB 4J9LA 1KLNA 1S1UA 3CD6S 4GRSA 3MAAA 4RR5A 2RH3A 5IT9U 1WG4A 2BJEA 2DIVA 1U6FA 2ZOGA 3KMQA 3MR7A 1YRUA 2B8PA 2CQGA 2CVIA 3KTQA 1I5OB 4KGVB 3SV4A 4F4ZA 1TK5A 4I2PB 2Q66A 1RA6A 2QN6B 4I64A 2JX2A 2VPYB 4KR0B 2HFNA 1VRQC 3HJVA 4NLTA 4ZN1A 1HBNA 1VCTA 5T14A 1RAFB 2VIHA 5A8WB 5IQ6A 3NBPB 4DS5A 3NP5A 4LF9F 3PW5A 2V4QA 2OMOA 4IQXA 2KL8A 2XY5A 3CJKB 2RE1A 1W2BR 1U1RA 1KHWA 4F4YA 5H9FK 1U24A 3DM2A 4Z37A 4DV1F 4B3RF 2QZ8A 4YEAA 1VQKS 1LNQA 1SC6A 2HNZB 1AB8A 3JTOA 3UI3A 2AJQA 1RLDA 2E5HA 1H7WA 1N0UA 1N8RT 3T1HJ 3DMJB 2KT5A 4ZVUB 3KLFA 4B3MF 2NCKL 3DLHA
chains in the Genus database with same CATH topology
2BX6A 2AZ3A 3FCVA 4ANCA 3EM1A 4UOGA 3EVOA 1NPKA 4S0MA 5IOLA 2AZ1A 1B4SA 3BBBA 1UCNA 3ELHA 3VGUA 2HVEA 3Q89A 3BBCA 3GP9A 4ANEA 4ANDA 3ZTPA 1PAEX 1NB2A 1NHKL 1MN7A 3ZTQA 3L7UA 3FKBA 1NCLA 3FBBA 1F6TA 1ZS6A 3BH6B 4FKXA 3R9LA 2HURA 3ETMA 4F4AA 1JXVA 3ZTSA 3FC9A 3ZTOA 5CAAA 3JS9A 1NDKA 1NDCA 1B99A 4C6AA 4FKYA 1MN9A 3WX8A 1W7WA 4DUTA 1HHQA 1K44A 2DXFA 3EICA 3NGRA 1XQIA 3VGSA 1VYAA 3VVTA 3FBFA 3PJ9A 4UOFA 3NGUA 3MPDA 1NSQA 3VVUA 1WKKA 3EVWA 3PRVA 3DKDA 1LWXA 3EVMA 4W98A 3NGSA 3Q8UA 1BE4A 3BH7B 1WKLA 2BEFA 4ENOA 1F3FA 2VU5A 1LEOA 3NGTA 3EMTA 1EHWA 3Q8VA 1NSKL 3EE3A 4WBFA 4DI6A 3ZTRA 1BUXA 3Q8YA 3FBCA 3FCWA 4CP5A 2CWKA 3EJMA 1NDPA 3ENAA 4EK2A 2HVDA 1KDNA 1HLWA 1NLKL 2DXEA 3GPAA 2DYAA 2DY9A 3FBEA 4UOHA 2B8PA 1BHNA 3Q83A 4O0NA 1S59A 3VGVA 4KPCA 5CABA 3B6BA 4HR2A 1NDLA 1NSPA 1U8WA 1PKUA 1S5ZA 3Q86A 3VGTA 5C7PA 2ZUAA 1NUEA 4DZ6A 3B54A 4F36A 1S57A 1XIQA 3G2XA 3BBFA 5BXIA 1WKJA 2B8QA 2DXDA 1HIYA 3DDIA 2NCKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BX6 A;  2AZ3 A;  3FCV A;  4ANC A;  3EM1 A;  4UOG A;  3EVO A;  1NPK A;  4S0M A;  5IOL A;  2AZ1 A;  1B4S A;  3BBB A;  1UCN A;  3ELH A;  3VGU A;  2HVE A;  3Q89 A;  3BBC A;  3GP9 A;  4ANE A;  4AND A;  3ZTP A;  1PAE X;  1NB2 A;  1NHK L;  1MN7 A;  3ZTQ A;  3L7U A;  3FKB A;  1NCL A;  3FBB A;  1F6T A;  1ZS6 A;  3BH6 B;  4FKX A;  3R9L A;  2HUR A;  3ETM A;  4F4A A;  1JXV A;  3ZTS A;  3FC9 A;  3ZTO A;  5CAA A;  3JS9 A;  1NDK A;  1NDC A;  1B99 A;  4C6A A;  4FKY A;  1MN9 A;  3WX8 A;  1W7W A;  4DUT A;  1HHQ A;  1K44 A;  2DXF A;  3EIC A;  3NGR A;  1XQI A;  3VGS A;  1VYA A;  3VVT A;  3FBF A;  3PJ9 A;  4UOF A;  3NGU A;  3MPD A;  1NSQ A;  3VVU A;  1WKK A;  3EVW A;  3PRV A;  3DKD A;  1LWX A;  3EVM A;  4W98 A;  3NGS A;  3Q8U A;  1BE4 A;  3BH7 B;  1WKL A;  2BEF A;  4ENO A;  1F3F A;  2VU5 A;  1LEO A;  3NGT A;  3EMT A;  1EHW A;  3Q8V A;  1NSK L;  3EE3 A;  4WBF A;  4DI6 A;  3ZTR A;  1BUX A;  3Q8Y A;  3FBC A;  3FCW A;  4CP5 A;  2CWK A;  3EJM A;  1NDP A;  3ENA A;  4EK2 A;  2HVD A;  1KDN A;  1HLW A;  1NLK L;  2DXE A;  3GPA A;  2DYA A;  2DY9 A;  3FBE A;  4UOH A;  2B8P A;  1BHN A;  3Q83 A;  4O0N A;  1S59 A;  3VGV A;  4KPC A;  5CAB A;  3B6B A;  4HR2 A;  1NDL A;  1NSP A;  1U8W A;  1PKU A;  1S5Z A;  3Q86 A;  3VGT A;  5C7P A;  2ZUA A;  1NUE A;  4DZ6 A;  3B54 A;  4F36 A;  1S57 A;  1XIQ A;  3G2X A;  3BBF A;  5BXI A;  1WKJ A;  2B8Q A;  2DXD A;  1HIY A;  3DDI A;  2NCK L; 
#chains in the Genus database with same CATH topology
 4U95 A;  3TA0 A;  4B02 A;  4IG3 B;  4USU A;  2WVF A;  5E0O A;  4DPO A;  1F1B B;  3DU6 A;  1ZPW X;  2VHG A;  1FF2 A;  3DXB A;  4LRE A;  1JLQ A;  3Q23 A;  3PJX A;  2EC2 A;  3HFV A;  2FHJ D;  2W2M P;  3IRW P;  5DZ7 A;  1DQA A;  2BZ2 A;  3CD7 A;  4HKQ A;  2KFY A;  2X3D A;  4DV3 J;  4IRC A;  1RWU A;  2KRR A;  2B0G A;  4U8V A;  4ZN3 A;  3OTO F;  2O01 C;  4ECT A;  1Y9O A;  2BM1 A;  4PEO A;  4KBI A;  1GTE A;  3K58 A;  4DR3 J;  3V6D A;  1UFW A;  3J81 U;  2CNL B;  3TI0 A;  1NZ8 A;  1VIS A;  3OBI A;  3TAN A;  3R27 A;  4PYD A;  4KJI A;  3BN7 A;  3MMA A;  4CO1 A;  3OVS A;  2IA0 A;  3KUE A;  1YJT A;  1BD6 A;  1BQM B;  4RUB A;  5FD1 A;  2YH1 A;  2HPU A;  3JQM A;  3I96 A;  5BYS A;  3T1H F;  2W2P P;  1OJ4 A;  3ZTO A;  4MIB A;  2LEA A;  4CNZ A;  5J1E A;  2P8I A;  4ETZ A;  3OSN A;  3D3B J;  4I1T A;  1JLF A;  1LW2 A;  4ED6 A;  1E6V B;  2BE2 A;  4EFA C;  5LMN J;  3MED B;  1SQE A;  4ZIT A;  4JI7 F;  1VK8 A;  3GFH A;  4NA2 A;  4RPF A;  4YQW A;  3CMQ A;  3ISN C;  1WDD A;  3BPD A;  2HFV A;  1BGX T;  4ILR A;  4U8Y A;  2AJ4 A;  2OHD A;  4RNO A;  1IQZ A;  4IH6 A;  4PPZ A;  5LJ3 Y;  1XC9 A;  2BQR A;  3SEO A;  3E8O A;  4WFZ A;  4K4V A;  2GFF A;  3AA8 A;  3EGN A;  1SKU B;  2DO0 A;  5C25 B;  2HVH A;  5CZV A;  1X0P A;  3FMW A;  4A4J A;  2C2Z B;  9ATC B;  2VOO A;  3KWM A;  1F9E B;  1J5E J;  4IKA A;  2FHJ A;  4QPT A;  2Q43 A;  3KLG B;  3K57 A;  1KP6 A;  1M5P C;  3VR1 A;  2DGS A;  4NZ0 A;  5BR8 F;  1N6Q A;  4I6W A;  1RP5 A;  2AEJ A;  2GHW A;  2QLX A;  4WP9 A;  1XR5 A;  2MHE A;  3MM7 B;  1FXD A;  1F3F A;  2BXJ A;  4DG1 A;  4FXW A;  3TR5 A;  3ET6 B;  2R3V A;  2WON B;  3I9V 9;  1VLO A;  3F41 A;  2DR5 A;  1FKP A;  1R0B G;  1RWN B;  4NLQ A;  3FJ2 A;  1BUX A;  3FFI A;  3BSO A;  3QRP A;  2VC0 A;  4FXV A;  2BOP A;  3SSS A;  2NUH A;  2V63 A;  3H8Y A;  1D3W A;  4ZPC A;  2V8P A;  1LW0 A;  2LEP A;  1C4A A;  3GLJ A;  4FP9 A;  3UNG C;  4R5P B;  3FMB A;  5EWG A;  3NS7 B;  2F9J A;  3OL7 A;  1NEE A;  2VF3 A;  2OI2 A;  1QM9 A;  3KJV B;  2IBK A;  4F4K A;  2B9E A;  4TYA A;  2GO9 A;  3LUY A;  4WK1 A;  2ZC3 A;  3SFG A;  3NGD A;  3MAA B;  3UCU P;  2FJX A;  2Y1R I;  1VJW A;  4UY8 T;  2QO3 A;  2M7S A;  3FSY A;  5EX3 A;  4LF7 J;  2L41 A;  4MKY A;  2OGU A;  1RT5 A;  2MMY A;  3QZ7 A;  2HAI A;  4X66 J;  3O2I A;  3CTR A;  2XMK A;  3DLG B;  2BBE A;  4ZHR A;  2GCF A;  8AT1 B;  3B4M A;  5CAB A;  2ZHB A;  2XY6 A;  3RB6 A;  4C9D A;  3ITH B;  1LWF B;  2VG6 A;  4M5I A;  3M9N B;  1NSP A;  2KKH A;  3PX0 A;  1BQN B;  1KEK A;  1D8Y A;  3D0I E;  3BDP A;  1S9E B;  4DFP A;  2DVI A;  2BJ3 A;  2CJA A;  2OPQ A;  1GMV A;  1X4B A;  1B7Y B;  4HDH A;  3TZZ A;  3IM8 A;  4ER8 A;  1JNZ B;  2ZE2 A;  2BDP A;  3H4D A;  4IR9 A;  2IM2 A;  1UJ4 A;  2NLW A;  3SMZ A;  4DCO B;  3PRB A;  1S1V B;  2EFQ A;  2IA6 A;  5BXI A;  1KVJ A;  3PRD A;  3UW1 A;  3LF0 A;  4Q43 A;  3SQO P;  2HSE B;  2ALY B;  3B8H A;  4NCG A;  3H5Y A;  1H2U X;  3CJQ A;  3I87 A;  4JV2 A;  1RAC B;  1S9G A;  3N4W A;  1FKP B;  1NPR A;  3O5T B;  4RBV A;  1GEH A;  3M9O B;  2KG1 A;  1SC4 B;  2I0X A;  5KFE A;  1B70 B;  5KFN A;  3LWM A;  1YHQ S;  1B4S A;  4LF8 J;  1HR0 F;  4GMK A;  5A0Y B;  2HS0 A;  1JLE B;  1NO8 A;  2QE5 A;  3VGU A;  1F9H A;  3JQK A;  4PQA A;  1U25 A;  4JUZ A;  4DV6 F;  4F02 A;  3V6D B;  2RKI B;  5MLC V;  2YBV A;  1RTD B;  1UPP A;  5F8H A;  1FRL A;  4PAA A;  4AND A;  3H2L A;  1PAE X;  2V2V A;  4A8Y A;  3O8W A;  2GX8 A;  5CA5 A;  3H25 A;  1WF1 A;  2ATC B;  2RQK A;  1RTD A;  3VZH A;  3ZTQ A;  3R2C J;  1JLC A;  2YKN A;  3FZB A;  3M8W A;  2JOQ A;  4LF6 J;  3X3U A;  1ZAV A;  4X4V A;  5JXS A;  3D4J A;  2E44 A;  4NE9 C;  4DLG A;  2AKW B;  1NJX A;  4F4A A;  3OFE A;  2IVM A;  4URS A;  4ZVE A;  5B0A A;  3MEC A;  2MZQ A;  3QAU A;  4LT6 A;  5M2R A;  3AY0 A;  3GV5 B;  5CYQ A;  1X9W A;  5G4D A;  4KKO B;  4CH1 A;  1Y0H A;  4Q0B A;  3VZI A;  5L38 A;  4CO4 A;  1UJ5 A;  1J2V A;  2M3D A;  2PGC A;  4J5O A;  5AXK A;  2IAJ B;  1YVF A;  2XYH B;  3R6L B;  4K4X A;  4KE5 A;  2E5L F;  1YZ7 A;  3MM8 A;  1S0O A;  3HT0 A;  2XEX A;  2AMC B;  3QT5 A;  3GTY X;  3N6N A;  5L39 A;  1SL1 A;  1URR A;  2ZVI A;  2HGM A;  4QR0 A;  2F8E X;  3NGU A;  1HWI A;  1CUL B;  1HBU A;  3IGN A;  4LRC A;  2MGZ B;  3TAP A;  1TK8 A;  2J6T A;  5LT5 A;  2W4P A;  4ELU A;  3IR5 B;  1APS A;  4LF6 F;  2A18 A;  4ED0 A;  2U2F A;  1WKK A;  1C2P A;  4FYV B;  3DKD A;  4WZQ A;  2X1F A;  2E1A A;  2Q6B A;  1XR6 A;  4LFB J;  2D1C A;  1LOU A;  2CPD A;  1UTA A;  1CS4 A;  3CC4 S;  1RU1 A;  4WZM A;  4A8K A;  3THP A;  1PJ6 A;  4WFX A;  4RX6 A;  1X31 C;  2WVD A;  3UD5 A;  2HHH F;  4OFZ A;  3PIO Q;  1X60 A;  2J7U A;  1CJT B;  4MIA A;  2Z2Z A;  5C2G A;  2OH2 A;  4IUF A;  2DT9 A;  1Q0N A;  2VOP A;  4QWB A;  4DR7 F;  1Q8I A;  2MZS A;  2RRB A;  3FSX A;  1QY7 A;  2JRS A;  4FF3 A;  1NK9 A;  2HHH J;  2KXN B;  4ZVQ B;  3O3L A;  5ADZ A;  5HSP A;  3RB4 A;  1YIJ S;  2UU9 J;  2B7C B;  3MTJ A;  2N7C A;  4DOZ A;  1FHT A;  4MK7 A;  2WVB A;  3QGP A;  3NLC A;  3KLH B;  1VI7 A;  4H4K A;  4J9S A;  3TP2 A;  1NXI A;  1OPI A;  3HLU A;  4C3M A;  2ILZ A;  3FGV A;  1X4E A;  1LK7 A;  1SC1 B;  4G1Q A;  4DXL A;  4ZCM A;  1Q86 T;  1SKW A;  1D9F A;  4ZP6 A;  1UVI A;  4U7C A;  3H90 A;  3BGO P;  5AT1 B;  3L09 A;  5KG3 A;  2RS8 A;  3G6X A;  2KG0 A;  4KFB A;  2DNZ A;  3GE9 A;  4X84 A;  4DFM A;  3HI9 A;  3I31 A;  5DGB A;  2KHC A;  3UD4 P;  4Z7Y A;  1Y7P A;  2H9Z A;  2Y0S D;  3D1Q A;  4IO1 A;  3D6T B;  1YIT S;  4FN5 A;  4NLS A;  4O3P A;  1HHT P;  5KG0 A;  2OIH A;  2XWY A;  4QU7 A;  2OTJ S;  3M8Z A;  1OQ3 A;  3PO4 A;  2ERR A;  2DIU A;  3HP6 A;  3CCT A;  2VDI A;  1S12 A;  1WAC A;  5A8W A;  2FLN A;  3P6Y C;  4PRF A;  4C11 A;  1WOP A;  1O51 A;  2YX1 A;  2GGP A;  2M88 A;  1S57 A;  3GG1 A;  4F36 A;  3J81 j;  3OTO J;  2ADB A;  2UU9 F;  1L3S A;  1RTJ B;  4WXW A;  2IDL A;  4PG8 A;  2VL1 A;  3G4S S;  3QGG A;  3OL9 A;  5KFU A;  1CC8 A;  2G0J A;  2JEG A;  2J8S A;  2AWZ A;  3ISN D;  1IBM F;  1FRI A;  2CZ9 A;  1NHU A;  5C42 B;  2HZV A;  4PXC A;  3FRZ A;  1G6B A;  3IP0 A;  4F3O A;  2HS4 A;  4JYA J;  1CLF A;  1X4G A;  3HHL D;  3BBB A;  3M6U A;  3KHH A;  2MST A;  4C8Z A;  3ZFV A;  3V81 B;  4HEA 9;  4NLY A;  2XHW A;  2ZJP Q;  1H2V Z;  3RJM B;  3QAE A;  3WX4 A;  2V9K A;  1RSC A;  1NHK L;  2EBG A;  2M4M A;  1JLA B;  1WG1 A;  3PR4 A;  2VON A;  1FTR A;  3FKB A;  2GMH A;  2G1D A;  3H0P A;  4F26 A;  3PX6 A;  2HQC A;  2BKO A;  1F6T A;  2BAN A;  4ZOS A;  5E41 A;  4YHH J;  2VB6 A;  4NLG A;  2UUB F;  2WW4 A;  3KDN A;  1IKV A;  1GXU A;  1TEL A;  4DPY A;  4MFB B;  4NLP A;  3HFK A;  1ROF A;  2MKY A;  1C1B A;  1P1T A;  4MYU A;  3OD2 A;  3R5G A;  3LGM A;  1YJN S;  3NNH A;  1QVG R;  3W9J A;  1H98 A;  2PFD A;  2EFG A;  1S1U B;  2PO4 A;  2HGL A;  5HI7 A;  1HBO B;  2IJR A;  1R31 A;  2E29 A;  1RT3 A;  1B0T A;  2C3O A;  2JVO A;  2VC1 A;  5KT7 A;  1PC4 A;  1HWU A;  1UKU A;  5GAH U;  3KHR A;  4OJH A;  1U2F A;  3NGK A;  3TZY A;  5LMU F;  1GNK A;  1XMO F;  2DR9 A;  2FJV A;  1H0H B;  1G3O A;  1XBW A;  2XWX A;  2DNL A;  3CJ3 A;  3D6M B;  3FEZ A;  3NEK A;  3HVT A;  2FY8 A;  2CJ9 A;  4UQT A;  2GIF A;  4H54 A;  3RAM A;  5K9F A;  3H7H B;  1U2R A;  1JLG B;  3HHL B;  4I56 A;  5KFH A;  4NWB A;  1U1M A;  4Q0B B;  3JSM A;  2G1H A;  3OTB A;  5CCM A;  2I1R A;  4DV2 J;  4LR9 A;  1HBM B;  3KLI A;  4RWW A;  1N56 A;  4BBY A;  1ZZN A;  4LQ3 A;  3F44 A;  2DGQ A;  5KG5 A;  4OI0 A;  1HNW F;  2QLF B;  1TL3 A;  2BA9 A;  2HQG A;  5C25 A;  5LSL A;  1JLE A;  1WNE A;  3NG8 A;  3SQG B;  3DRP B;  3PM9 A;  1KVI A;  4F4W A;  2JFK A;  4RUA A;  2F1F A;  2VU5 A;  2AEF A;  2FC8 A;  1MG7 A;  1QSS A;  4JV5 F;  4LIR A;  1EHW A;  2MLY A;  3GR0 A;  2HMI B;  2VIC A;  2H4W B;  4WBF A;  2DRB A;  3T5H A;  3ZTR A;  5A2Q U;  1C1C B;  4CTA A;  4YR3 A;  4DL3 A;  3T19 A;  4NZ6 A;  4ETX A;  2R7O A;  5KG7 A;  3QRR A;  4GO7 X;  3V4I A;  2FGC A;  3N5B A;  1GTH A;  2XS5 A;  4IOA Q;  4YY3 J;  4NRT A;  3W60 A;  2DGT A;  1LWC A;  3WC0 A;  3QRQ A;  1UVK A;  1JB0 C;  4ED4 A;  1N5Y A;  3VAF A;  3NS5 A;  4DV1 J;  3QLH A;  4I2Q A;  5L1K A;  3GG0 A;  2RDJ A;  1ICE B;  3CCS S;  5JVH Q;  4RKU C;  3CIZ A;  4Q5V A;  1J27 A;  2CPX A;  2WB1 D;  3HZE A;  2HK2 A;  5LL6 d;  1M0S A;  4IYQ A;  2QEX S;  1FEE A;  3ISZ A;  4DHV A;  2AJ2 A;  2D3Z A;  2QMW A;  4O3S A;  4A8Q A;  4H4M B;  4RW4 B;  3VQS A;  4IR1 A;  3MUR P;  1WC0 A;  1RBL A;  1PKU A;  2B3T B;  3DI6 A;  2GA7 A;  3W65 A;  3F0N A;  3BKU A;  1ZM2 A;  3Q8Q B;  2DKO B;  2H3E B;  1JLF B;  1LW2 B;  3KJQ B;  1U0H A;  4WP8 A;  3N79 A;  4M5G A;  2XTJ P;  3U7J A;  3R3T A;  4OZ2 A;  3AT1 B;  4OI4 A;  1NU4 A;  5CH7 B;  4F25 A;  5AJ3 J;  2NR0 A;  4DZ6 A;  2C42 A;  2OEK A;  1VQS A;  3G2X A;  3R2D J;  4OMF G;  1M1H A;  3CSK A;  4OJ1 A;  1W2I A;  3M2V B;  2A10 A;  3IBF B;  4AE5 A;  3SBM A;  2NZC A;  3TNV A;  4DPX A;  2BX6 A;  3J7Z 5;  3FCV A;  3ENQ A;  4H4K C;  3UFC X;  2NPF A;  5E7O B;  4ANC A;  4M5M A;  2HYI B;  1MNE A;  3HF5 A;  4RBT A;  1Z2L A;  2VFV A;  1UEV A;  3LO3 A;  3MHY A;  5A76 A;  5FDL B;  1R0A A;  2V67 A;  2A3J A;  4Q2M A;  3LGN A;  1N5T A;  1X5P A;  4RBU A;  2V34 A;  5CCL A;  4Y34 A;  2RUS A;  3GSI A;  4QIE A;  4QYZ J;  1CEZ A;  3TX0 A;  2Y8W A;  2VPZ B;  2F4F A;  4IFY A;  2N4D A;  3GP9 A;  2NYI A;  4DV6 J;  2DNH A;  2R7S A;  4LF8 F;  4P71 A;  1O5J A;  2HVZ A;  1Q81 T;  1RWW B;  1VHI A;  3LAN A;  3BM7 A;  4A8S A;  1RBA A;  3MM9 B;  3BV8 A;  5CHC B;  2CYY A;  2DGX A;  4ICL A;  3FDS A;  2FVQ A;  4M95 A;  4RW9 A;  3TA1 A;  2G2Y A;  1C4C A;  2UUT A;  2W2O P;  5E3A A;  3CJS A;  5C42 A;  3KLE A;  2R8H A;  4J9O A;  4HHH A;  4L74 A;  2WOM A;  1NK6 A;  1KN6 A;  4O44 A;  3VAL A;  1HQU A;  2E7X A;  3FK4 A;  3IG1 A;  3W2V A;  4JI8 F;  5E3Q A;  3V81 A;  1IM4 A;  5LOQ A;  3QFH A;  4O4G B;  4EBE A;  4Q8F A;  3JS9 A;  1VMB A;  3IN5 A;  4AFF A;  1T9W A;  1B0P A;  2HZA A;  2MQL A;  3CO9 A;  3NWG A;  1U7L A;  3AD9 C;  1Z2Z A;  3T9Z A;  3ZZZ A;  2BKN A;  2LQB A;  1KQF B;  4X4S A;  4GO5 X;  1IWG A;  1G7C B;  2FVC A;  4DBQ A;  1NK7 A;  4JV1 A;  2QG9 B;  3MPU B;  2DXF A;  1FXL A;  2R8G A;  3B82 A;  1CJU A;  1HQE B;  1XQI A;  2MJU A;  1LWF A;  2VG6 B;  3HSZ A;  4L72 B;  2DHX A;  1N33 F;  3TW0 A;  4TU9 A;  1IKV B;  1RB0 A;  4RW6 B;  4RNM A;  2KM8 C;  5B09 A;  3NXZ A;  4I2P A;  5KFW A;  2HIQ A;  2J8A A;  2CDR B;  1NK4 A;  4HTJ A;  3M8P A;  4CI0 B;  3G9C A;  2AYE A;  4ED3 A;  1RDR A;  1RAG B;  5HMW A;  1H73 A;  4DSL A;  5A8K A;  3GIL A;  2B4P A;  3UVJ A;  2IYI A;  3T1A A;  4DSK A;  1HNV A;  2ZH8 A;  4K4W A;  2N82 B;  1TUG B;  3JTN A;  4M5N A;  4YS2 A;  3QID A;  4A8W A;  4ES2 A;  1S1X A;  1RWX B;  1QE1 B;  2JZ5 A;  1T02 A;  4WKY A;  4DFJ A;  1OYD A;  4KGK A;  1S1T A;  4WYL A;  3HT3 A;  2E9Z A;  2HNZ A;  4ECR A;  5GME A;  1M1K T;  1D09 B;  2YVS A;  3PTW A;  5KTQ A;  3NCQ A;  5HMZ A;  1UZH A;  3RW7 A;  4DF8 A;  3T1Y J;  2DPI A;  1VIO A;  4ED5 A;  3TO8 A;  4UZB A;  3EXC X;  5KFV A;  2D41 A;  3UDC A;  3CJK A;  2ZM6 J;  3GIM A;  4CCH A;  3IG1 B;  3KLV A;  1P1L A;  2YKQ A;  2MZR A;  4Y2K A;  5KAK A;  4ZCK A;  2KO1 A;  4CLF A;  3OLA A;  4ZKA A;  2R2U A;  1TQL A;  1BWV A;  4F0H A;  3BSC A;  3OLB A;  1IJF B;  4P73 A;  4QQB A;  4Z2X A;  4P7V A;  1HNI A;  1HLW A;  1GFW B;  1LK5 A;  1OWX A;  1X4F A;  4OHV A;  4KIA A;  2UXC J;  3W7B A;  1UA0 A;  1F5A A;  3NAI A;  2VJU A;  4I4B A;  2CA9 A;  5DRK A;  1R8H A;  2AYB A;  2VKR A;  2AT1 B;  3CB4 A;  2RHS B;  4OI2 A;  2AD9 A;  1URN A;  1JQG A;  2A2D A;  3M8S A;  2VQE F;  1L3K A;  1VGY A;  2AX1 A;  2F40 A;  1AZS A;  3GJQ B;  4KKO A;  1SIZ A;  2DR8 A;  3DHX A;  4UW2 A;  2XI3 A;  4YB5 A;  3HUL A;  3OFH A;  2H48 B;  3M8Q A;  3KK1 B;  1WDT A;  1NJY A;  1NSA A;  3Q86 A;  2E7W A;  1EJ7 L;  1TR0 A;  3CDW A;  1JLG A;  3MM8 B;  1VFJ A;  3R7N B;  2B7B B;  5D0H A;  2OPS B;  2I9S A;  4QJV A;  3CD0 A;  5ETL A;  4U96 A;  4ZJO A;  4DX7 A;  2AQ4 A;  5J1E B;  4HL9 A;  1SBR A;  3MMA B;  3KNA A;  1XIQ A;  4M1K A;  1YTY A;  2GIR A;  2UVR A;  2GHV C;  4KO0 B;  1DRZ A;  4G6V B;  1X0F A;  4WKR A;  5B0B A;  1SQF A;  3CJ8 A;  4ZP9 A;  5DDO C;  3MUM P;  2W9C A;  1NK5 A;  3BR8 A;  5HVF A;  3J7Y I;  2ATL A;  1ZA1 B;  2W8K A;  4RW4 A;  4KY3 A;  2C2M B;  3H2U B;  3CVK A;  1Y4Z B;  5A6P A;  3R1L A;  3DI6 B;  3RW6 A;  2J6U A;  1QAX A;  4MK9 A;  1RK8 A;  3N9U C;  5LSO A;  4AQY F;  1PO6 A;  2XS7 A;  4FF2 A;  1I3O B;  2Z56 B;  2EFP A;  1DLO A;  1LWE B;  1HNI B;  2OPR B;  3CO0 P;  1T0T V;  5ETT A;  1NHV A;  3D2W A;  4FYD A;  2OLW A;  2FC9 A;  2LXF A;  2M5Y A;  4JOU A;  5F3T A;  5DDQ C;  3HK2 A;  2B4O A;  3RR7 A;  1P6T A;  2I5J B;  3CD5 A;  3GCX P;  3HMJ G;  1S49 A;  4Y65 A;  3IR6 B;  2WTF A;  2QJ3 A;  2ASY A;  2J0W A;  5LMU J;  1CSJ A;  1WOO A;  1XN9 A;  4ZS6 A;  4ECX A;  1D9D A;  5F8N A;  3NOC A;  1TUW A;  5F0W A;  3KJF B;  3NKY A;  4YFU A;  1O0P A;  3MUT P;  2BJD A;  2P9C A;  1N54 B;  3FFI B;  4AD6 A;  2R2T A;  2WAQ D;  4MKV A;  2DNR A;  1FX4 A;  1REV A;  5HAT A;  4P75 A;  3W64 A;  1NK0 A;  4A8F A;  1BC6 A;  3N5F A;  3KHG A;  1HKA A;  2HBR B;  2LKZ A;  3IGV A;  1WSR A;  4ZVH A;  2R7W A;  3VAG A;  2KJV A;  2HWH A;  4J9N A;  2ZEJ A;  4BLG A;  3CF5 Q;  4C8K A;  2GAH C;  4ELV A;  3I32 A;  2FGO A;  1TFW A;  2DRA A;  4IRK A;  1R0A B;  1L3V A;  5K8N A;  1W25 A;  2MKS A;  7FDR A;  2A2C A;  4TY8 B;  3SCL E;  4DPT A;  3PW4 A;  2UUA F;  2I38 A;  3OXL A;  3I4P A;  4C98 A;  5HRO A;  4PWD B;  3CDA A;  4KH1 B;  5KG6 A;  3G82 B;  4NI2 B;  4NLV A;  5GMD A;  1S9E A;  4AUK A;  4L76 A;  1OS5 A;  2HGN A;  3Q2T C;  1FRX A;  2JWN A;  2B43 A;  1HNV B;  3S01 A;  1LWE A;  2MKK A;  3IWX A;  2RJZ A;  3WIV A;  2QA4 G;  2W4C A;  3HX9 A;  5DLF A;  1L3U A;  2G0C A;  2GVZ A;  3DLG A;  1DZ5 A;  5D15 A;  4AXJ A;  3OT9 A;  2HHT A;  1RXO B;  3NGT A;  4RW6 A;  3Q8R B;  4FS1 A;  1P9Y A;  1NKB A;  3W9I A;  4FVM A;  2JEI A;  3R6G B;  1FD2 A;  1JLB B;  2OPQ B;  2XO7 A;  4CH0 S;  1IBM J;  3FCW A;  4ECW A;  4DV7 F;  1M90 T;  3LH2 S;  4GC6 A;  2GO8 A;  3EJM A;  3MM6 A;  2F8M A;  3OFF A;  4IDK B;  1NDP A;  1N32 F;  1TMJ A;  3AQO A;  2HND B;  3RRK A;  3MUV P;  3C46 A;  3O44 A;  5HBM B;  2BMB A;  3P3D A;  3T5L A;  3C6U B;  4XPC A;  1VRT B;  2RQC A;  1KFD A;  1RTI B;  2JH3 A;  1C0U B;  1BHN A;  1F5B A;  1FRJ A;  1KBR A;  4DPW A;  2POK A;  3CCJ S;  2R2S A;  1MWQ A;  3CME S;  3I5B A;  1Y10 A;  2J6S A;  2IYG A;  3AA9 A;  2JHE A;  2H54 B;  2WB4 A;  3UPF A;  4F7V A;  4K0K F;  2HLU A;  2CNK B;  2UVV A;  4O3R A;  1G2E A;  3IM9 A;  2VPX B;  2UXD J;  4CO2 A;  1NME B;  2FUG 9;  3LTO A;  4H4M A;  4IOC Q;  1T9X A;  1WD6 A;  3P96 A;  4OQJ A;  4WTY A;  3BR9 A;  5A8K B;  2GVD B;  1RTZ A;  4OYO A;  3J7A 1;  3DLK A;  4ID8 A;  3DMJ A;  1U0H B;  2CFX A;  1S6P A;  1HIY A;  2X51 A;  2QLJ B;  2ZKU A;  2XO6 A;  4OYZ A;  4OL8 A;  4TQR A;  1SVD A;  2D3O R;  3GQC A;  4A8M P;  1JJ2 R;  4ES3 A;  2F9D A;  3DNC A;  3SSQ A;  1U2C A;  2UXB F;  3NCP A;  3W8P A;  1N5V A;  2MLX A;  3K7R A;  5KFF A;  4P2X A;  4QW9 A;  4DV0 J;  5M2U A;  2V68 A;  2Z2L A;  1ZAX A;  1HNX F;  1RT6 A;  3GWC A;  4MH8 A;  1U4B A;  3BYP A;  4LFB F;  5KT4 A;  2KJW A;  3DLJ A;  3MEG B;  4FYX B;  4JBC A;  3BZQ A;  3CCQ S;  2D9P A;  2Y8Y A;  4ZLL A;  2MQQ A;  1XNQ J;  4B3R J;  1FNX H;  3TQE A;  1JIH A;  1RT7 A;  1WUU A;  2NXC A;  3R7B B;  2DH8 A;  5B08 A;  1ACM B;  2XY7 A;  1CUL A;  4P2M A;  2HRU A;  4YB7 A;  1U02 A;  3W61 A;  3TJ9 A;  3QSY B;  4PG6 A;  4ITS A;  3D9B A;  4U6P A;  2ROP A;  1X4A A;  2FLL A;  1TK0 A;  1SC3 B;  1FCA A;  2OPP B;  3DDK A;  4EGL A;  5F3Z A;  3GIJ A;  3A4T A;  1HYS B;  2DNO A;  4PZV A;  5A6W A;  2DGO A;  5KFI A;  1VBZ A;  1T03 A;  2H1Y A;  3G6Y A;  4LFC F;  5EN1 A;  1TKX A;  4DQS A;  3AJ2 A;  1RGV A;  3HXM A;  1RT1 A;  2L9D A;  1YJ7 A;  3UN5 A;  5HMY A;  5KFM A;  2NUU G;  3IAM 9;  4HH0 A;  4C2M A;  1K8A T;  3UO0 A;  1RAA B;  3BSN A;  5BJR A;  2YWK A;  3D66 A;  3VTI A;  1FVS A;  4CYU B;  4F3Q A;  3Q8P B;  1GXL A;  4O4G A;  2NRE A;  2KYZ A;  2ZNY A;  2JSX A;  2LQ5 A;  2OUG A;  2GW8 A;  2WK4 A;  5DQH A;  2AGQ A;  1HNZ J;  4F8R A;  1S1W B;  2F4V F;  4NPO A;  2ZH7 A;  1JKH B;  1Y11 A;  3DGP A;  4RL1 A;  3QWP A;  1N48 A;  4J9V A;  3W2W B;  2C2E A;  2OP5 A;  3RBX A;  2XG8 A;  3BDE A;  5E3R A;  1UVM A;  3EX7 B;  3NNA A;  3N01 A;  5B0E A;  4JI0 J;  1T3O A;  2Y3Y A;  3NAH A;  4K4Y A;  3J7Z T;  2CZV C;  1FWL A;  1V6H A;  4NLD A;  1GK8 A;  4BHQ A;  2VQF F;  2B6A B;  3EZ5 A;  3AB4 B;  4DUZ J;  1HNX J;  3UVJ B;  4PYA A;  1WKL A;  2GMJ A;  2X1G A;  3K5N A;  3DHW C;  1BY9 A;  4DG1 B;  1FER A;  4DL2 A;  3AOD A;  2FQQ B;  3A8E A;  4P52 A;  1SI9 A;  4DR1 J;  2VH7 A;  4B9M A;  3IO1 A;  1QE1 A;  1X5T A;  1FTC A;  1UZD A;  2H5J B;  5ETR A;  3Q8V A;  1NSK L;  3EE3 A;  3MFI A;  2W7O A;  2VJV A;  1VQL S;  2UUA J;  4ZIV A;  1FDA A;  2FJE B;  2UXC F;  3CWJ A;  3TRG A;  4KHR A;  3AOA A;  1VRU B;  3FBC A;  3RB3 A;  1SB6 A;  3G82 A;  5D8H B;  2VZ9 A;  3N6L A;  1S0V A;  1LW0 B;  3HD2 A;  4ZCL A;  2E1R A;  3ENA A;  1NBE B;  1R27 B;  2Y0B B;  4MKB A;  1WWH A;  5AXN A;  2IVY A;  3KLG A;  2GAG C;  4N76 A;  3ZZ0 A;  5IV3 A;  2QTW A;  3ONQ A;  3QSI A;  1RE1 B;  2XI2 A;  4DV4 F;  1XMB A;  4LBI A;  4WP3 A;  1RTI A;  5B0F A;  3CCR S;  4YB6 A;  2R7T A;  4OYB A;  1Q8K A;  4QYR A;  2MKI A;  1OO0 B;  2RDI A;  2EK6 A;  2UXD F;  2M70 A;  3NMR A;  4K0K J;  4LMZ A;  3V2U C;  3DN9 A;  3WZ0 A;  2C1E B;  5D0E A;  2GIQ A;  3CJ2 A;  4DV4 J;  1R89 A;  1T95 A;  2EG2 A;  3PFE A;  3HZG A;  3MM6 B;  4RWX A;  4C97 A;  4PXB A;  2Z30 B;  4EI2 A;  1C1B B;  4ZVG A;  3W66 A;  2ZZN A;  2W2N P;  3MR6 A;  2W2Q P;  3TUJ C;  3SSR A;  5K8M A;  3MOJ B;  2HQD A;  3AFG A;  3KJV A;  1MU2 B;  2JEJ A;  4OHY A;  2YXL A;  2UV8 G;  3QJL A;  4X2B A;  2YKM A;  5DDR C;  1SPB P;  1YGY A;  2HBY B;  2DNG A;  2ASL A;  3HKW A;  2DHH A;  2KRB A;  5D77 A;  3CCU S;  5EUH A;  5J2M A;  2XM3 A;  2GVZ B;  4DEZ A;  2YNG A;  1UEK A;  2L3M A;  1YJ9 S;  1RIS A;  3UDV A;  3G8T A;  1RAE B;  3PG9 A;  4I69 A;  4OJ3 A;  7AT1 B;  2XMM A;  2AHO B;  1HBO A;  1NPK A;  4ZVP B;  2PMZ D;  1GXT A;  5K5M A;  4EO8 A;  4XPE A;  3FSI A;  4DR2 F;  1KFS A;  1F2G A;  2N4C A;  2CUY A;  5IZH A;  1JLB A;  1RHJ B;  3I56 S;  2E66 A;  4QYZ K;  1WOR A;  1YG0 A;  1KLM B;  1WJ9 A;  2DGV A;  2M0G B;  1HBM A;  3KLI B;  3A3P B;  3LOU A;  2XMA A;  4CH7 A;  2FJB B;  1EQ0 A;  2UUC F;  5DGA A;  1LXJ A;  1ZAW A;  1Y3K A;  3GR1 A;  3GCW P;  3KUH A;  4X4T A;  2W25 A;  4N56 A;  1MMD A;  2K1R B;  5F8J A;  3RYL A;  3DC2 A;  5ETQ A;  3T9N A;  1S7I A;  4YR0 A;  3A3N B;  4K4T A;  2WVC A;  2HEK A;  5KFL A;  4JV0 A;  1VDH A;  4G1P A;  3K5M A;  3EPI A;  1ELO A;  1HYS A;  3G8S A;  2G2Z A;  2J7K A;  5HL7 Q;  1IQT A;  1FRM A;  2OD6 A;  3M7V A;  2WBR A;  5I42 A;  2OEM A;  2EWH A;  2XMT A;  3V6J A;  3C14 B;  1T9Y A;  3SCI E;  1O8B A;  1PBU A;  4F4X A;  1LWC B;  4C6A A;  2DR7 A;  1JWW A;  2YNI B;  4DL4 A;  2PI4 A;  3KDO A;  5D0R A;  1IXK A;  2GJF A;  2K3I A;  3EIC A;  3PJW A;  2EFV A;  1Q78 A;  2E5J A;  4MK8 A;  2Z2M A;  1C1C A;  2HQF A;  4CTA B;  3LPE A;  4JI8 J;  3R5J B;  1VC6 A;  2CPI A;  3R8Y A;  1AA1 B;  3GFY A;  5CZX A;  2M52 A;  1HAR A;  1OY8 A;  4OZN A;  4DL7 A;  3X1L B;  4LF7 F;  2HHQ A;  3MI7 X;  4ZLN A;  1HMV B;  2G2O A;  2IJF A;  4L73 A;  4NLW A;  1GT8 A;  2CZ4 A;  3E51 A;  3WC2 A;  1FJG F;  1IN0 A;  2RAQ A;  3OR1 B;  4KQZ A;  4ZDN A;  1VIX A;  4LRD A;  1IKY A;  2BVZ A;  2CQB A;  2BRK A;  2VG5 B;  5LXR A;  5E5N A;  4ED8 A;  4LF4 J;  4AQY J;  1BWE A;  2IAJ A;  1J5O B;  1UJ6 A;  2NSC A;  4M5L A;  2ZJR Q;  1EP4 A;  2DEJ A;  2XMV A;  1QUV A;  4JI3 F;  2MHN A;  2V0N A;  2D69 A;  2B4V A;  2PFF B;  1JXL A;  3EXY A;  4HAC B;  4ZPD A;  1A7G E;  1GMW A;  1Q8B A;  3EMT A;  2CXE A;  2RIL A;  2VAS A;  4P10 A;  5KT6 A;  1VQ4 S;  2F5G A;  3PFO A;  2LLZ A;  1SH2 A;  2W7P A;  3AD8 C;  4CLS A;  4B3M J;  4P9S A;  4Y00 A;  2FLO A;  2RRN A;  2Y1L B;  4NLR A;  2J7W A;  4RO0 A;  3S6E A;  4FS2 A;  1T94 A;  1MWY A;  1DUR A;  5FDL A;  2PSZ A;  3RB0 A;  2BJ8 A;  2OJ3 A;  3ILL A;  2K7J A;  2MXY A;  1YJW S;  2LDY A;  1EAY C;  2OD4 A;  2QC3 A;  4B17 A;  1HL6 A;  2YPZ A;  3R5B A;  1QAI A;  1KWM A;  1PIL A;  2W01 A;  2R8I A;  2AGO A;  3M32 A;  5HMX A;  4GVB B;  3C6U A;  4ICL B;  1U48 A;  1Q7Y T;  4KPC A;  4OYA A;  4ZMM A;  2ZJQ Q;  2C22 A;  1U1P A;  1FNO A;  5KFG A;  2R7U A;  4LSZ B;  2ALZ A;  2DGW A;  2P2C B;  2HVI A;  4C8M A;  2QX0 A;  3U27 A;  2O1P A;  4FXD A;  3MMJ A;  5J2N A;  5E3C A;  2AF6 A;  2RUG A;  4M94 A;  4NCB A;  5IT0 A;  5ITH A;  4MMO A;  2QA1 A;  1WHW A;  3W5Y A;  3B54 A;  3CCE S;  2O3D A;  5KG1 A;  4C8O A;  4X64 J;  3EDR B;  4USM A;  2JLF A;  3KG0 A;  1ZPV A;  4CWB A;  4O23 A;  1U1O A;  4JI5 J;  4K5R A;  1F3V A;  1B0V A;  1N5S A;  1T9V A;  1PIE A;  4DCP B;  3PAC A;  3MFH A;  2OKQ A;  4CLT A;  4TU8 A;  1IR1 A;  4QBU A;  3PKY A;  1KKH A;  1U1K A;  4NL5 A;  2CQ0 A;  3CDU A;  4OYW A;  2ILY A;  5BR8 J;  3CMA S;  3JTP A;  1T7P A;  4NXN F;  2V50 A;  1WHY A;  3V6H A;  3M8P B;  1WHV A;  4FZV A;  2HVE A;  4B9S A;  1S77 D;  1M5O C;  3BBC A;  2CPH A;  1RKI A;  4C11 B;  1U45 A;  1WC5 A;  3JXO A;  2WVE A;  4LSN B;  2RF2 A;  4DN9 A;  3NL0 A;  2E5G A;  1MN7 A;  1S1T B;  1BMQ B;  2ZBR A;  4IQM A;  4ZP7 A;  3IC1 A;  3IWL A;  3TVZ A;  2PMH A;  3W8G A;  3MAQ A;  3DYA B;  2NYH A;  4UOC A;  2MEW A;  2EI5 A;  2LA4 A;  2RIJ A;  4LSL B;  4J9M A;  3LP0 B;  3HPO A;  4MTP A;  2KXF A;  2ROG A;  1S0N A;  4ZPA A;  1YQH A;  1WHX A;  2HBQ B;  5CD4 A;  2FDN A;  2LDI A;  1VHF A;  1VK3 A;  3GON A;  2MB0 B;  1NPP A;  1VRT A;  3D67 A;  3HD1 A;  3I0R B;  5KFZ A;  4IO9 Q;  2IRX A;  3M4X A;  1TKZ B;  3P4U B;  1B99 A;  3M30 B;  5T7L B;  5KFA A;  3JQJ A;  2J9C A;  3U1L A;  4FKY A;  3LP1 B;  3WX8 A;  5DQG A;  3PIP Q;  4DV5 J;  1WTB A;  1RAB B;  3BKT A;  4MKA A;  3P5B P;  1H2T Z;  4E98 A;  1UVN A;  2V2Q A;  2PN6 A;  2OFH X;  2DNK A;  5T41 A;  1VYA A;  3TAM B;  4ZVF A;  2HHS A;  1VR6 A;  4U7U D;  4BC9 A;  3LAM A;  1CBK A;  3HHL A;  3ENV A;  2HFS A;  2GJ2 A;  1E6Y A;  1TTH B;  2BV3 A;  3CDB A;  1S6O A;  2CJX B;  4O4R A;  4OYM A;  4XK8 C;  5D3G B;  4YUD A;  4YN3 B;  2FIU A;  2IHR 1;  4LFA J;  3OPK A;  5EGY A;  3CCW A;  1GX5 A;  4W98 A;  3ZZR A;  3OHB A;  1N32 J;  1AYE A;  2PII A;  2VV5 A;  5B0C A;  4ZJQ A;  4YR2 A;  1PSD A;  4R25 A;  4WWS A;  4DX6 A;  1UWB B;  4KO0 A;  4QWA A;  4NA1 A;  5G0R A;  3RR8 A;  1EB0 A;  1N34 J;  2O67 A;  3DLB A;  3EZO A;  1U0S A;  3CE8 A;  3Q8S B;  4DR2 J;  3DU5 A;  3LP0 A;  1WI6 A;  4BCA A;  5B0D A;  2WW8 A;  1SH0 A;  1CJT A;  2BYC A;  2ZHO A;  3OR1 A;  3DOK A;  2DGU A;  1JJH A;  4N7T A;  2PI5 A;  3SCJ E;  2F65 A;  2M8D B;  3LPY A;  3I82 A;  4X4O A;  4QIG A;  1S76 D;  1RT7 B;  2HLT A;  4C48 A;  2H5I B;  2BRL A;  2Z4P A;  4O3Q A;  3THT A;  4OIX A;  4WE1 A;  5IS2 A;  3GII A;  3HM9 A;  4IG3 A;  4PUO B;  4QCL A;  1P9Q C;  1Z4U A;  1CJV A;  2RHQ B;  4OZJ A;  1UAW A;  4OLO A;  4BWJ A;  2XNQ A;  5C5J A;  1U09 A;  4JP8 A;  3C66 A;  2EW9 A;  5KFK A;  3M2U A;  2JJ4 D;  3LA0 A;  4E8U A;  1IKW A;  2UVU A;  2KB2 A;  3MPY A;  1RT1 B;  4G65 A;  4I0W A;  4Y3C A;  1U8W A;  1SXL A;  2JC0 A;  1RHU B;  1FD8 A;  2FZG B;  1TU0 B;  3BGU A;  3DRS B;  4AL6 A;  1X9S A;  3MM5 A;  5CYM B;  5KFY A;  1SV5 A;  3D0G E;  4B3T F;  2GZO A;  1VQ6 S;  2JEF A;  1RAJ A;  3MAH A;  2WZ1 A;  1U1N A;  1K1Q A;  1RTH A;  3UR3 C;  1YJU A;  2W1B A;  3DFE A;  4HI1 A;  2B8Q A;  2EG1 A;  2BOA A;  2ZM6 F;  3HVR A;  4GVB A;  2C3P A;  2GJI A;  2QL5 B;  4Y2M A;  1J5O A;  1ITP A;  1GH8 A;  2KT2 A;  2LQJ A;  3MED A;  2ZBI A;  3OL6 A;  2CRL A;  3GSD A;  4B3O B;  4ED1 A;  2E9R X;  1K0V A;  4MFB A;  2O5D A;  1RTJ A;  1FES A;  3TA2 A;  4UOG A;  3J80 U;  1KSP A;  3BYR A;  3RU0 A;  2AZ1 A;  4M5H A;  4L3N A;  4W90 B;  2RD5 C;  3W5Z A;  2IM1 A;  3DRX A;  3DRR A;  4A46 A;  1ZTW A;  2KDO A;  3MMC A;  3V6K A;  3K89 A;  4OHZ A;  2LEC A;  4RLE A;  5DG7 A;  3P5T L;  1MSW D;  2VQF J;  1QAY A;  4BWM A;  5KG4 A;  5AE3 A;  5RUB A;  3OFG A;  1QTN B;  4X62 F;  2R7Q A;  3LAL A;  3QBC A;  5KFT A;  2XUL A;  4IRD A;  1Q53 A;  4E2F B;  1N33 J;  4M5D A;  3MMB B;  1ULR A;  1FK9 A;  4P6Q A;  5K14 A;  1S0M A;  2DCL A;  4CLY A;  1KR4 A;  3MCN A;  1RCX B;  2COL A;  1DTT A;  1RHQ B;  2WHO A;  2IM0 A;  1PC5 A;  3GB0 A;  3W2V B;  2G4B A;  2KFZ A;  1S9F A;  3R1H A;  2DB1 A;  1M5S A;  1XMO J;  2IC3 B;  2YQ1 A;  1FRK A;  3FQL A;  4IFY B;  3JAM Y;  2MPU A;  1LV5 A;  2XLI A;  1RT2 B;  1D1U A;  2HHV A;  3M30 A;  4IDK A;  2ACM A;  1NM2 A;  1RTH B;  5D4N A;  2AV5 A;  2E5L J;  4ILL A;  1V3R A;  2XGQ A;  3PY8 A;  2ACY A;  5DQI A;  4B9T A;  4A8X A;  3NMA A;  3SIP B;  1RWP B;  4GKJ F;  2V94 A;  1JLA A;  3UE2 A;  1VQ5 S;  1FNM A;  1HQE A;  3UWT A;  4DR5 J;  3T41 A;  1QD1 A;  4R0J A;  1UL3 A;  5EWE A;  4LUB A;  3PEJ A;  4LSL A;  4ZVO B;  3VVT A;  4BC7 A;  4CLK A;  3KLE B;  2YKP A;  2DK2 A;  1KRP A;  3GU0 A;  4V19 X;  1Y5N B;  1KVK A;  4ZA1 A;  1MW7 A;  4XTT A;  2EK1 A;  4ZPB A;  5I4M A;  1BXN A;  2CNN B;  3K5P A;  2C2O B;  1ZET A;  2IJN A;  3PW7 A;  1RHK B;  3K8W A;  4YB1 P;  1EIY B;  5KOW A;  1KNZ A;  3FNN A;  3ZZY A;  4CLL A;  5HQL A;  1WEX A;  3RBE A;  1N52 B;  3RRG A;  2RU9 A;  4I6Y A;  3J7Y U;  3EGV A;  4JI0 F;  3MR5 A;  2R8K A;  5K8O A;  4JYA F;  1FJC A;  1UWB A;  1S1V A;  4NMX A;  4ECY A;  3AXM A;  1IBL J;  1KS2 A;  3DLK B;  1YJR A;  2J9D A;  1ZM4 A;  5DG9 A;  2LU1 A;  2EXU A;  3NY0 A;  3GFX A;  1IBC B;  3US5 A;  5CXT A;  4N41 A;  2CQ4 A;  5KFX A;  3TWZ A;  4NAS A;  5J2P B;  4Q44 A;  1PGZ A;  2DPJ A;  3Q8Y A;  4LF5 F;  1H3D A;  3IS9 B;  5AE1 A;  5F8G A;  2CWK A;  4ZLP A;  3BGR A;  3BQ0 A;  4DR5 F;  1SKS A;  3BSA A;  1NRK A;  3IXQ A;  3QAT A;  4FYW B;  4LRA A;  3U1M A;  1PG5 B;  4A47 A;  4AT1 B;  2V9W A;  4DSJ A;  5L1I A;  4UTG A;  1VQM S;  4O3N A;  3POT B;  1UET A;  1IWA A;  1TL3 B;  1WSV A;  3I0S A;  1U6B A;  1IUJ A;  2MKJ A;  2XSF A;  3MCM A;  4ZVR B;  4K50 A;  2R42 A;  4WFY A;  3GPA A;  2UV8 A;  3L9Z A;  2DYA A;  2CDQ A;  4UOH A;  3H40 A;  4B3S F;  2BR0 A;  2IMW P;  2FD2 A;  4Y28 C;  4ES1 A;  5GAE U;  5F0U A;  2DH9 A;  2U1A A;  3HKZ D;  5BYQ A;  2HMI A;  3TUI C;  1IKW B;  3KK2 B;  1D9A A;  1F60 B;  3LP2 B;  5KFO A;  2A6O A;  1TUV A;  5A0Y A;  5I3Q A;  2DNN A;  5HP1 A;  4OI6 A;  1RWK B;  2IRY A;  3M8Q B;  4ATN A;  2FTR A;  2YTC A;  3VGT A;  5C7P A;  1BLU A;  2NXE A;  3L95 X;  4ZCI A;  1IR2 A;  1I51 B;  3SCK E;  2CPE A;  2CG8 A;  1F2H A;  1Q8L A;  4WII A;  1FDB A;  6FD1 A;  4K4U A;  4RW8 B;  4KPY A;  5J2N B;  4CRJ A;  4DUY F;  4ZPW R;  3BGL A;  3CUN A;  4QWC A;  2KXH A;  1L3T A;  2HQI A;  4DR7 J;  4C3K A;  2X3G A;  2ZH6 A;  4DV7 J;  5F8M A;  2CQP A;  2KYX A;  2HRT A;  2QIF A;  4QR2 A;  5J2Q A;  1VC0 A;  5E33 A;  2VBW A;  3A3O B;  4TYB A;  4NLX A;  3BGR B;  4WFN Q;  4CLP A;  2LFV A;  1R6Y A;  2LQ9 A;  2QL7 B;  1OIA A;  1UCN A;  2P6S A;  1NND A;  2V8V A;  4ID5 B;  1HI1 A;  4K2X A;  1TP7 A;  5HAN A;  1EP4 B;  5LM7 E;  4R8U A;  2HQ3 A;  3BPS P;  4EMD A;  1UWA A;  3OHA A;  1H38 A;  2YQ3 A;  2R8J A;  1Y3J A;  2BE7 D;  3A12 A;  2XLJ A;  3AXK A;  1K0T A;  5GAE I;  3UNY A;  4A8O A;  1V9O A;  4RW7 B;  3OXG A;  2EFO A;  1NAQ A;  3D68 A;  4WFB Q;  3VAK A;  1AUS L;  2HS3 A;  2QGF B;  3NRB A;  1GMW D;  3LP2 A;  4Q2L A;  5CYJ A;  4LRF A;  3OXF A;  3BO2 A;  3VAJ A;  4PKD B;  4DCJ B;  1A9N B;  2VD3 A;  1DTT B;  1IBK F;  1S9G B;  3GFZ A;  1VRU A;  2VOD A;  2VDH A;  1N4L A;  4OX8 A;  1SIW B;  1WOS A;  2L48 A;  2HKE A;  4B3S J;  1FI4 A;  3D3C J;  3AJD A;  3EZU A;  3PHT A;  2BW2 A;  4V19 J;  3GV8 B;  2VFS A;  1LFP A;  8RUC A;  1IBK J;  1IKX A;  3KK3 A;  2I5J A;  2BUN A;  1R8A A;  2J9D E;  4U67 Q;  4DL6 A;  3S8S A;  3D6H B;  4DX8 H;  4GKK F;  4LFC J;  2CG4 A;  3KNG A;  5HJY A;  4YHH F;  3K59 A;  3LW5 C;  4LF5 J;  1FK9 B;  5K14 B;  5GAD U;  2BAB A;  1RAD B;  1YBA A;  2KZM A;  3AOB A;  4IFV A;  2LYV A;  2AJF E;  4HT5 A;  3MD1 A;  4WK3 A;  4NLU A;  1NSQ A;  4KGZ B;  2MKC A;  3E2E A;  1N5Q A;  2EKY A;  3GIR A;  1RWM B;  3ULH A;  3T5J A;  2HFU A;  1XNQ F;  4EU0 A;  2OEJ A;  2ZBP A;  5ETV A;  1NH7 A;  1SJQ A;  3CUL A;  4UUW A;  1LWX A;  2Z8Q A;  2ZC4 A;  4ED2 A;  3OVA A;  2LQ8 A;  1SJ3 P;  3M6W A;  1I94 J;  2F3J A;  1XR7 A;  1HR0 J;  2MLZ A;  3CNQ P;  1V3S A;  2DO4 A;  2V4R A;  2GQQ A;  2ZH1 A;  3DRR B;  1JLC B;  1K47 A;  2YKN B;  2KHD A;  3MTK A;  1OQ6 A;  1X4C A;  4ENO A;  1KTQ A;  3M1V B;  1R3N A;  3VF0 B;  1UPM B;  1S1X B;  3L4B C;  4PG7 A;  4PR6 A;  3GYN A;  4RU9 A;  4EBC A;  1VQ7 S;  3HJF A;  1IM6 A;  3DDN A;  3ZZT A;  2GV1 A;  1UVL A;  2J76 E;  4B9U A;  2KVI A;  2YNG B;  5DG8 A;  4USV A;  2PMW A;  3FCH A;  1RHM B;  4KTQ A;  2QLW A;  3M6X A;  5D6G A;  1DJ0 A;  3DRY A;  1H7X A;  1ZZF A;  3KK1 A;  4DUZ F;  2K8G A;  5H9F J;  5SZT A;  1S4F A;  2MZJ A;  3R5D A;  4ILM A;  1HBU B;  2MGZ A;  2V5H G;  2ZUG A;  4JI4 F;  4FYY B;  1TV6 A;  4TQS A;  1PYO B;  3FUY A;  1JNR B;  2YWE A;  2E1C A;  5IT9 Y;  1KLM A;  3MGJ A;  1TKT B;  3NWR A;  2DXE A;  4QWE A;  7FD1 A;  4AL5 A;  3UN2 A;  4HTI A;  1DAR A;  4WE1 B;  5M2P A;  2ZZM A;  1FJ7 A;  3L7P A;  4ZPT R;  4RZR A;  2RT3 A;  3BEG B;  3B78 A;  2JFD A;  3CJ4 A;  4WJB A;  2RU3 A;  3IWN C;  4QU6 A;  1SH3 A;  3OUY B;  3I0R A;  1PJ7 A;  2CIM A;  3G87 A;  4WXO A;  2AP6 A;  4CQ1 A;  3DOL A;  5HLF A;  1NJZ A;  5D78 A;  2XS2 A;  3D1H A;  4DMZ A;  4X4U A;  3KLF B;  4F2R A;  1FT8 A;  2HFZ A;  2VBY A;  5HN0 A;  3KOA A;  3W62 A;  5EDW A;  3C8Y A;  2BJ1 A;  3E3X A;  3L7O A;  3C14 A;  4OX9 F;  2YNH A;  2Z0G A;  1WKJ A;  1SV5 B;  2CAD A;  3DDI A;  1QVF R;  1DAX A;  5AXL A;  5JUM A;  3VAM A;  1VBX A;  2SXL A;  2FB0 A;  3CPW R;  3FVY A;  1AW0 A;  1ZBT A;  3EM1 A;  3HHE A;  4KGX B;  3HHK A;  2JC1 A;  2ZDP A;  2Y1J A;  5L1J A;  4FPI A;  3IFE A;  5FII A;  5IQQ A;  5L46 A;  4M8L A;  1HHS A;  3NBP A;  1T3N A;  3ZZU A;  3T1Y F;  3QYY A;  4ID5 A;  3QMQ A;  1KTV A;  2M9K A;  1FX2 A;  1HMV A;  1TL1 B;  2QLB B;  4X4P A;  3Q89 A;  4DU8 A;  2XCP A;  4CLU A;  1REV B;  5J2P A;  2UVW A;  1UVJ A;  1TFY A;  4KB7 A;  2YQ0 A;  4D3H A;  1UEU A;  4DU7 A;  1IKY B;  2BKP A;  2CQC A;  2H51 B;  2VG5 A;  4K7Q A;  4RNH A;  5ETN A;  1DTQ A;  4B3T J;  4UQG A;  4LFA F;  4USJ C;  3MMC B;  4MJK A;  3MR3 A;  2J0Q D;  1HPZ A;  1R8C A;  3L7U A;  5B0G A;  2GGP B;  1NCL A;  3G86 A;  3DXS X;  5ETS A;  3BH6 B;  3R9L A;  4J9Q A;  2R2R A;  1L5U A;  4W92 B;  1W26 A;  4UY8 5;  3P8B B;  5EX0 A;  4FF1 A;  2B9X A;  2HNY B;  3FC9 A;  4J9P A;  2FJW A;  4QWD A;  2QA4 S;  3A1Y G;  1AFI A;  1QAJ A;  1NDC A;  3DRP A;  2M2B A;  3GJR B;  4KC5 A;  1U1L A;  4P2F A;  3QIP A;  1PAU B;  2IBO A;  2X7I A;  4Y2C A;  3LGH A;  3M2U B;  4AYB D;  1HW8 A;  1FWK A;  3ADA C;  4CO0 A;  3Q0A A;  2MDA A;  4RW7 A;  3PW2 A;  1SJF A;  2N3L A;  1YK9 A;  2J0X A;  2CKW A;  4QOT A;  4EZ6 A;  1YWX A;  4UF4 A;  2DNM A;  3EUN A;  4E0D A;  4NXM J;  1DY3 A;  3VGS A;  3TUP A;  4RW8 A;  1XEZ A;  4JB8 B;  2VFT A;  4ZLJ A;  4DSF A;  1JKH A;  4OLP A;  1SUQ A;  5H1S V;  4K2J A;  3GV7 B;  1XMQ F;  4TNO A;  2DD8 S;  3PYG A;  2VG7 B;  4HT7 A;  3W5X A;  3J7A N;  1RT4 B;  3C3L A;  2Y9H A;  2G13 A;  2KT3 A;  3PRV A;  4TY8 A;  5D4O A;  1PJ5 A;  1F5C A;  2DNY A;  3ENW A;  2AJ1 A;  3E01 B;  5F8I A;  1S10 A;  2YX7 A;  1P27 B;  3CCZ A;  1RBO B;  1TZ0 A;  4CYU A;  2H4Y B;  2OTL S;  4C8Y A;  2UUB J;  2GQC A;  3ZXW A;  3BH7 B;  2NXN A;  3MZI A;  3H5X A;  4C0O C;  1MLA A;  2BAN B;  4FDF A;  4ZVT B;  4DFK A;  2AIR B;  2JVR A;  1KHV A;  2RML A;  4N77 A;  4NEY A;  1RT3 B;  4DF4 A;  2CPF A;  1FJG J;  1KOO A;  4URQ U;  3V4M A;  4ZHR B;  3BN4 A;  1PYT A;  4LR7 A;  2OO4 A;  3W9H A;  1CJK A;  1KQK A;  1HWL A;  2KFN A;  1OYE A;  1TL7 B;  2E1M C;  2A6M A;  5KT5 A;  3MOZ A;  4XIU A;  4NXM F;  3AH6 A;  5F41 A;  4O0I A;  2V2Z A;  1HWJ A;  1KQG B;  2LVW A;  2Q6C A;  4LR8 A;  1KDN A;  4DQI A;  1RT5 B;  3PDN A;  2B6A A;  2YWF A;  3ETO A;  4OYI A;  2DR6 A;  5KT3 A;  2E9T A;  5DET A;  3HO1 A;  1A6L A;  3TVY A;  2DNP A;  3CJ0 A;  4DSE A;  4NCG B;  3K5L A;  1P8G A;  3Q83 A;  5KT2 A;  2RSQ A;  3BRE A;  3KG1 A;  3CIM A;  3I0S B;  2P6T A;  2WON A;  3VGV A;  3RBZ A;  4CO3 A;  3KMS A;  2DCU B;  3SV3 A;  3CJ5 A;  3DYA A;  3RAX A;  1IVZ A;  2YNF B;  4OZ5 A;  3UCG A;  1OSC A;  1VOM A;  4HR2 A;  4N8N A;  4W4M A;  2HHX A;  3T3F A;  3DOL B;  5HLF B;  5DJB A;  3TZX A;  1N36 J;  1S5Z A;  4O44 B;  2RF2 B;  1NZA A;  1QLN A;  3ICL A;  4FVC A;  2D7S A;  4DLE A;  5HP1 B;  2RKI A;  2MSS A;  5A8R A;  1VQ8 S;  1FFW B;  1RU2 A;  2V6A A;  1SJ4 P;  1JX4 A;  1TKZ A;  5T7L A;  1VBY A;  2YNH B;  1DBD A;  2W4D A;  1V5V A;  5IV4 A;  2F7V A;  3CED A;  2CJB A;  2AZ3 A;  4KYZ A;  2R7R A;  4NYZ A;  1BQM A;  3M05 A;  4RUH A;  1T11 A;  4X62 J;  3BQ1 A;  1R6V A;  1G1X A;  3ILO A;  4S0M A;  1HWK A;  4KSE B;  4TVA B;  1X8D A;  2J0S D;  5KFP A;  2CQI A;  3U02 A;  3PXG a;  4CO5 A;  4DQR A;  3AOC A;  1NH8 A;  1CJU B;  4ANE A;  2ZWP A;  2DIT A;  3A13 A;  1B3T A;  2PDA A;  5AJ3 F;  1HNW J;  2OEL A;  5MAO A;  2VBX A;  3HFZ B;  3MEG A;  4OV1 A;  3R97 A;  1UFL A;  1Q5Y A;  1VBK A;  5GAG U;  2NXJ A;  3CCM S;  3CCL S;  2XGP A;  2WCX A;  3D0H E;  3FBB A;  1FKO B;  1PCA A;  2PD1 A;  2ZOM A;  3IBW A;  4XAK A;  4MYT A;  1ZH5 A;  3GJS B;  2E1P A;  1XMQ J;  2DNQ A;  5D3G A;  1TVR A;  2BAC A;  2XSJ B;  3ETM A;  3KUG A;  4GC7 A;  1VQP S;  3MXH P;  2CAJ A;  4DV5 F;  2I2Y A;  3EDQ B;  3BKF A;  2HHW A;  4TXS A;  3R7S B;  5CAA A;  3L3C A;  3TQ1 A;  3JB9 k;  4LIW A;  5AE2 A;  1RKJ A;  3K0J A;  2MYF A;  3VAI A;  2ZDO A;  5KFD A;  2IMO A;  1K9M T;  1X5S A;  2PEH A;  4USH A;  1CS4 B;  2HHP A;  4DR4 J;  2BW7 A;  2IIH A;  5J1P A;  2R9L A;  1K44 A;  1EKR A;  1FE0 A;  1NJW A;  1R7I A;  4OHW A;  2XHC A;  1CJV B;  1F9F A;  1RWO B;  4OYX A;  3PJ9 A;  2EKN A;  3VWS A;  3ZZP A;  4KAI A;  9RUB A;  5IWA J;  5HVH A;  2PA3 A;  2QYC A;  2ROE A;  3MM9 A;  4DJB A;  2ZHA A;  4K4Z A;  1Q4R A;  3TJA A;  1TL5 A;  2GQ2 A;  5H9E K;  3RTV A;  4GVL A;  1SKR A;  2Z57 B;  4OI3 A;  1N5Y B;  3WBZ A;  2OSQ A;  2VA3 A;  1N88 A;  4DR3 F;  4PUO A;  2E5I A;  3I6P A;  3TOQ A;  4ECS A;  2MZT A;  4KV8 B;  4B08 A;  1HQU B;  4PWW A;  3VQT A;  3OTD A;  2YNI A;  4OZ1 A;  4M5K A;  5CYM A;  1TL1 A;  1X5O A;  4CLZ A;  4JI2 F;  3SDE A;  2V2K A;  3IRX A;  6AT1 B;  3F73 A;  1LEO A;  2ZKT A;  2B5J A;  4NX9 A;  1NKE A;  1DQ8 A;  2AX0 A;  4KGM A;  2KZZ A;  1DHM A;  2WSC C;  4J91 A;  5FLX U;  3G6V A;  3EPG A;  3OVB A;  3PYF A;  4R8U B;  2YWW A;  3SFU A;  1FE4 A;  2QL9 B;  2XB2 D;  3M2R B;  3EWG A;  2FJA B;  2Q1L A;  3NS6 A;  4OI1 A;  5IM0 B;  4XO0 A;  4TLQ A;  1VQO S;  2CQ1 A;  2JLE A;  4CM0 A;  4FF4 A;  1QUP A;  1SQG A;  4Y2A A;  3SZ2 A;  4Y2I A;  4LBH A;  4OX9 J;  1Q79 A;  2ZE2 B;  4C0H A;  3PO5 A;  1SCJ B;  2ZIT A;  3UDE A;  5F9N A;  2MY8 A;  4B3O A;  2H65 B;  3DOM A;  3MEE B;  4YDD B;  1KD1 T;  4ERD A;  4PQU A;  8ATC B;  4NYP A;  4QIW D;  4TKT A;  5U47 A;  4CM2 A;  4WIQ A;  5J2M B;  2ZH3 A;  4O0N A;  3OR2 A;  4V1A k;  5IT4 A;  2C2R A;  3DGV A;  1RYR A;  1S59 A;  1CVJ A;  3CJT A;  1FXR A;  2P9G A;  1YLX A;  4M5D B;  3I9Z A;  5I3P A;  1YKW A;  1NDL A;  2FVP A;  2K06 A;  1U8S A;  1IJE B;  3H4B A;  3PNI A;  3H20 A;  1ZA2 B;  3QT8 A;  3PW0 A;  2FVR A;  2WSF C;  2LA6 A;  4B9V A;  3BGF A;  3PX4 A;  4BS2 A;  3QQC D;  1NK8 A;  3DCA A;  1EKS A;  3RBD A;  2ZUA A;  3CW2 C;  3KKF A;  2VG7 A;  1IKX B;  2BJ9 A;  3HVW A;  2FY1 A;  2R7X A;  3PVX A;  4B9N A;  1WEZ A;  2HIY A;  2IC3 A;  3C6T B;  3PYD A;  5HVG A;  3BBF A;  3KHL A;  3HVA A;  4JI4 J;  3I55 S;  3R5C A;  4NA3 A;  1VLY A;  2EFN A;  2EC0 A;  1Z1Z A;  1QTM A;  4CDI A;  2ZOF A;  4JI1 F;  4X4R A;  3HSD A;  1Q7L B;  3B4D A;  3TZW A;  2UUW A;  3FEX B;  1RUS A;  5CD4 H;  4X4Q A;  5FJ4 A;  3BF4 A;  2BQ3 A;  2HW3 A;  2VFU A;  3EVO A;  4NLO A;  3D1O A;  3IA0 A;  5IM0 A;  1HQ2 A;  5IOL A;  2R7V A;  3JYT A;  3QJJ A;  4OX6 A;  1AZS B;  4DR1 F;  3H98 A;  4PWD A;  5GVQ A;  2B56 A;  4ECV A;  3QO9 A;  4C0B A;  1MU2 A;  4Q7A A;  1RA7 A;  2FPH X;  5C2C A;  4Y0F A;  2D3O 1;  1IR0 A;  4P72 A;  4OYP A;  3DOM B;  2ZH4 A;  4DV3 F;  4J37 A;  1TAQ A;  1YZ6 A;  5IWA F;  1AFJ A;  3D5M A;  2EBE A;  4HLB A;  4I6A A;  3D7S B;  3G8Q A;  1FFS B;  4L75 A;  1HBN B;  4ALZ A;  2DHS A;  1DFD A;  3I5C A;  4J9R A;  2FZK B;  3HVT B;  2QSW A;  1VJQ A;  2LXI A;  1MRO A;  4EYH B;  5BYR A;  3C15 B;  1HPZ B;  3QGI A;  2HUR A;  4RNN A;  3NNC A;  3ZTS A;  4FNH A;  3MEC B;  5EWF A;  3D6F B;  2FHO B;  3JSM B;  2P9E A;  4I7F B;  1LKZ A;  3KFW X;  1NDK A;  4J9U E;  4F0K A;  1KOH A;  2HK3 A;  3AJ1 A;  4NRU A;  2XMW A;  4K5S A;  1EET B;  1WI8 A;  4WTO B;  1M1G A;  3C6T A;  1MWZ A;  4HI2 A;  1MN9 A;  4IG0 A;  3M8R A;  2Y1I A;  4FBU A;  4DUT A;  2H5E A;  2MQO A;  4YOE A;  2Q79 A;  5HO4 A;  2W9B A;  2V8H A;  3OTC A;  3NGR A;  2WSE C;  2VPW B;  1WG5 A;  2WRM A;  4DZD A;  5F8L A;  3OUY A;  5L9N A;  1XER A;  1M5K C;  3Q22 A;  2O66 A;  1VS3 A;  4AL7 A;  4QR1 A;  3WIU A;  4PCQ A;  1RAH B;  2UUC J;  2HND A;  2MZ1 A;  2HBZ B;  2HHU A;  1CQN A;  1HFE L;  1AT1 B;  2CPY A;  2LU2 A;  3I4H X;  1WEY A;  3JYT B;  5ETO A;  2CNO B;  4DSI A;  1IBL F;  2MKH A;  3VVU A;  3SQG A;  1X7V A;  4XDD A;  4EYI B;  1K73 T;  4KV8 A;  1R43 A;  3QT7 A;  3KLH A;  2B51 A;  2LP4 A;  3IAS 9;  4C8N A;  2ZD1 A;  1Q82 T;  1VQY A;  2DTJ A;  4WYW A;  1I6J A;  5E3P A;  3IRX B;  2GVD A;  4N8O A;  5KFC A;  3M32 B;  3BO3 A;  2HWT A;  3PV8 A;  4IH7 A;  1REG X;  3TUZ C;  3FQK A;  4WFA Q;  2XYP B;  4JI5 F;  1UW9 A;  2ASD A;  2QRR A;  1HA1 A;  1FKO A;  2A0F B;  3CT9 A;  5HAO A;  4CP5 A;  5LSR A;  4JI3 J;  2MJN A;  1YX2 A;  2YY3 A;  3AB2 B;  4OZ3 A;  4H4O B;  2AJ0 A;  2GS8 A;  5ETM A;  4EK2 A;  5HRO B;  3MR2 A;  1RT6 B;  1DTQ B;  1X9M A;  1HI0 P;  3P49 B;  4GKJ J;  1RJJ A;  4IG0 B;  4QIV A;  2AGP A;  2YKO A;  1N36 F;  2APO A;  2PEB A;  1TKD A;  1KON A;  2HAF A;  2DRD A;  3P45 B;  3W63 A;  4TY9 A;  2DY9 A;  5KG2 A;  4PQU B;  3ZNJ 1;  3VV2 B;  4C3L A;  5B7W A;  4CLW A;  1QSY A;  1HW9 A;  4ZP8 A;  2CJK A;  5IXU A;  4Y6I A;  2F8H A;  3VCD A;  3B6B A;  1FRH A;  4X65 F;  3LWL A;  1S97 A;  3C16 B;  3M2R A;  5EHH A;  1JMT A;  3UN3 A;  1VC5 A;  1OMS A;  3H2V E;  2HZC A;  3BB5 A;  3TAQ A;  2OFG X;  2AU0 A;  1FO1 A;  3MM5 B;  4DR4 F;  2YNF A;  4YDX A;  3MF5 A;  1S7H A;  2RQM A;  1FEH A;  1CPZ A;  2B9Y A;  1SJR A;  4WCE Q;  3PR5 B;  3CDE A;  1M5V C;  4PG4 A;  4R5P A;  4LRB A;  1H72 C;  3MM7 A;  3RGI A;  1HD0 A;  1RCO B;  4L3K A;  1YRT A;  2ZH9 A;  4JI7 J;  1TAU A;  4UUX A;  3KK3 B;  2QFJ A;  1T03 B;  1Q5V A;  1RI7 A;  2XNR A;  2DH7 A;  3A8J A;  5DZ6 A;  3IMQ J;  3RZA A;  4DX5 A;  4ZIW A;  1C0T B;  2RNE A;  5JMN A;  1WTF A;  3DRS A;  3IR7 B;  3OQ2 A;  2KM8 B;  4J9K A;  3FRY A;  4NML A;  3WQP A;  3OJU A;  4JI6 J;  4H4O A;  5AXM A;  1XNR J;  2GC8 A;  2K2P A;  3EGW B;  1CQM A;  4DUY J;  4J90 A;  3TX8 A;  1H74 A;  3T5K A;  2LEB A;  3ZNU A;  3PHE A;  1OPZ A;  4I68 A;  3QO9 B;  4YME A;  2L9N A;  2XC9 A;  4DPU A;  4LJM A;  1J5E F;  3M2V A;  4HHU A;  2ZH2 A;  1RAO A;  1LQ9 A;  2CJY B;  4U9R A;  1YBU A;  3A8K A;  3M8Y A;  4RNF A;  2YX4 A;  2XZT B;  3HCX A;  4LF9 J;  1TL7 A;  4F50 A;  3RRH A;  5KFQ A;  4RJV A;  4FKX A;  3TAM A;  4A48 A;  2XCA A;  1RQ0 A;  4OZL A;  4Z7C A;  4I67 A;  2IRU A;  3N6M A;  3OR2 B;  4QZV B;  1JXV A;  4PXD A;  4CT8 A;  4P74 A;  1VQN S;  1FFG B;  5LJ5 Y;  1ZTT A;  3AAW B;  5KFS A;  1UP1 A;  3BO4 A;  3ZO7 A;  2FVS A;  1RT2 A;  1EET A;  2BJ7 A;  3PZP A;  4WPA A;  3NOG A;  4MIW A;  1UMJ A;  5IC6 B;  3UCZ P;  2ZBQ A;  4DQP A;  2D74 B;  2L08 A;  1UW4 A;  1UFK A;  4MAK A;  3GMG A;  1QJH A;  4XDC A;  1U26 A;  3GJT B;  6FDR A;  3FBF A;  4IH5 A;  4USK A;  2P5V A;  2DY1 A;  4ECZ A;  4DQQ A;  1EQM A;  1ARO P;  2CQD A;  1X4H A;  1FDD A;  2IVF B;  3DOK B;  1N34 F;  2NXU A;  2KI2 A;  1GAO A;  2L9W A;  5A8R B;  1CC7 A;  1S48 A;  3EVW A;  2OPP A;  3HHN B;  3MCO A;  4DR6 F;  3TEH B;  3PKM A;  1E6Y B;  4K4S A;  5DM7 Q;  2W9B B;  2B9W A;  3TVK A;  4TLR A;  3QNW B;  2HFO A;  1RYS A;  3D28 A;  5IC4 B;  2HG4 A;  2NZ4 A;  5J1N A;  1DQ9 A;  2Q3P A;  5E2Q A;  1S6Q A;  4KHP J;  3SI8 A;  2NPI A;  3V5R A;  4DI6 A;  4PG5 A;  3G71 S;  2UXB J;  3CJR A;  2EVZ A;  4C8L A;  2MY7 A;  3M9M B;  1FDN A;  4NZ7 A;  4HH1 A;  3W1Y C;  2CQ2 A;  4DDF A;  3V4I B;  4M63 A;  1RWV B;  4LF4 F;  4K8R A;  4G3I A;  3J80 Y;  1V3Z A;  5HK4 A;  5THW A;  1NLK L;  4OZ0 A;  1S1W A;  4ZJL A;  3GIK A;  2ADC A;  1JK9 B;  1EX8 A;  2IFX A;  5DS7 A;  3H59 A;  2G9O A;  3FBE A;  3QGH A;  5G0R B;  5SUH A;  4NOH A;  2GML A;  2HWI A;  2W9C B;  1TVR B;  2W24 A;  3DGP B;  3HSJ A;  2R4F A;  4DN0 A;  2JLG A;  4PAB A;  2F4V J;  2B4U A;  3W2W A;  3KK2 A;  3S7R A;  2HRY A;  2BE9 B;  5L8R C;  1S4E A;  2K1R A;  4DL0 C;  4AXI A;  3IS9 A;  4C7Q A;  4X65 J;  3VAH A;  1HNZ F;  2LCW A;  3JSR A;  3QWU A;  3K5O A;  4KHM A;  1LFW A;  2BM0 A;  2GNK A;  2HNY A;  2VBZ A;  5FLX Y;  3DLL Q;  3MEK A;  3FEY B;  3MCS A;  1DLO B;  2OPR A;  3WDO A;  4X4N A;  2AYG A;  1YRX A;  1WC6 A;  5KFJ A;  5I42 B;  2LMI A;  5I3U B;  1B7F A;  1U6Z A;  4DWI A;  4FBT A;  4Q45 A;  2QV6 A;  2CQH A;  2W9A A;  4G1Q B;  2ZD1 B;  4URG A;  1U49 A;  3MWB A;  4NCA A;  2DJW A;  1S6Q B;  2J9E A;  2NSB A;  3MMB A;  2CVE A;  2EEY A;  4RW9 B;  1R0C B;  1RAI B;  5HJX A;  4D3G A;  3OL8 A;  4LF1 A;  4JI1 J;  1SUQ B;  1RT4 A;  4Q8E A;  1NJI T;  3TAR A;  5C24 A;  1EAR A;  1RHR B;  4QPX A;  2XMJ A;  4RUC A;  1I94 F;  2OPS A;  3E01 A;  5A2Q Y;  2NQP A;  2YKA A;  2QYG A;  2B5J B;  3R5A A;  2ZFH A;  2IPO B;  1NB2 A;  5KOX A;  2F63 A;  2YPY A;  1D0E A;  3QT6 A;  2C3M A;  1GMU A;  2YKM B;  4OV6 A;  1K1S A;  1SJ1 A;  1TMM A;  5DLG A;  4DL5 A;  3UD3 P;  1ZS6 A;  4KH0 B;  1U1Q A;  1V5I B;  3UQS A;  1C0T A;  1N0V C;  1YBT A;  3K17 A;  1FA0 A;  4J7C A;  1YJV A;  2XZD B;  2DEI A;  3F56 A;  3K8V A;  4FPR A;  1U47 A;  3KJN B;  1FWP A;  1NKC A;  1TL4 A;  1E6V A;  2BE2 B;  3ITH A;  5LXY A;  3C16 A;  2Z58 B;  3C15 A;  4UZC A;  2AYM A;  2MTL A;  2YWG A;  3QFW A;  2QSF A;  4M5J A;  5LMN F;  4EEY A;  3C2P A;  3CXC R;  1RLC L;  2KU7 A;  1HHQ A;  4O3O A;  4F3M A;  4ZK7 M;  1OY6 A;  3O6Q A;  3G6E S;  4ELT A;  2XQC A;  1R8B A;  4OJG A;  2J5A A;  2CJQ A;  4OHX A;  4U7U K;  2RRA A;  1QDU B;  4ZPV R;  1YSJ A;  2X1B A;  3PEH A;  4HVZ A;  4PXE A;  4USI A;  2C2D A;  1GQE A;  4IFV B;  2KTQ A;  3Q2S C;  4CIO A;  2CPZ A;  4WU3 A;  3O1L A;  1ZYQ A;  4EWT A;  1S72 S;  2CQ3 A;  3HDS A;  1WF0 A;  2FYX A;  1ZOT A;  4R0E A;  3EVM A;  2ASJ A;  1FKA F;  2AW0 A;  1QSL A;  5HBM A;  5KFR A;  4NEZ A;  3CCV S;  2UP1 A;  3T6B A;  3Q8U A;  1XJW B;  2XBP A;  3D54 A;  1BE4 A;  3H42 A;  3HSG A;  1KQS R;  3LAK A;  3OSP A;  2MQN A;  2V4J B;  3UR0 A;  1Q95 G;  2D3U A;  1C0U A;  2FHM A;  2KN4 A;  1WEL A;  1YDL A;  4L6V 3;  5IFM A;  2C2N A;  4KHP F;  4G1I A;  2IY5 B;  3QZ8 A;  3Q24 A;  4BDP A;  4NXN J;  3DLE A;  2UZA A;  4LQ9 A;  4QIF A;  3MPV A;  1YI2 S;  2G0I A;  1MML A;  1ZM3 A;  2QFI A;  4P7T A;  2V8G A;  1KC8 T;  2V69 A;  5K8P A;  2YH0 A;  3KG4 A;  1CG2 A;  1OY9 A;  2I8E A;  1PBA A;  2HVD A;  4LF2 A;  4TU7 A;  4DR6 J;  5HQ8 A;  4F0M A;  1WC3 A;  5HQM A;  3DM2 B;  4X64 F;  2YWH A;  3PYE A;  2VKZ G;  2W8L A;  4LBP A;  4YP3 A;  4NYO A;  1TKT A;  3H5S A;  1WC1 A;  2ABY A;  2KH9 A;  2C3U A;  1MRO B;  2N7Y A;  5L1L A;  1HD1 A;  2CPJ A;  5GAH I;  1Y00 A;  4EZ9 A;  3QPI A;  4I7F A;  3MDF A;  3EYZ A;  3CC7 S;  3BS9 A;  3W3S A;  1Y5I B;  1JJC B;  2JNJ A;  2XSJ A;  3CGI A;  2ZBC A;  1FJE B;  2QA2 A;  3HHD A;  2XZW A;  3ZC4 A;  3KYL A;  1AUD A;  2MQM A;  2K7K A;  1S99 A;  2PT0 A;  3POT A;  2DHA A;  4PPD A;  4C4W A;  5GAG I;  2LXU A;  4IOB A;  4N5S A;  4CNY A;  4OX7 A;  2E7V A;  4HAC A;  4HYK A;  3MD3 A;  2GHP A;  1JXE A;  2DXD A;  1T9T A;  1NUE A;  1I1G A;  4WU2 A;  3C19 A;  3GYG A;  2CWX A;  2OSR A;  4TN2 A;  1ZM9 A;  3OTE A;  2RB7 A;  2ZVS A;  3QLH B;  5D4L A;  5KFB A;  1JLQ B;  2VFR A;  1A0O B;  1F0X A;  2PC6 A;  5DO2 A;  1WC4 A;  2C2K B;  4DS4 A;  3S1T A;  3N0V A;  4ECU A;  3U1N A;  5ETK A;  3OJS A;  1VQ9 S;  1WF2 A;  3FZ2 A;  1AXQ A;  1S79 A;  3LP1 A;  3ELH A;  2IDE A;  5JJB A;  5ETP A;  2ZWO A;  5J2Q B;  2FZC B;  2C28 A;  1D8Z A;  5GMK a;  5JVG Q;  2XLK A;  3QJP A;  2RQ4 A;  2V8D A;  4LVO P;  1Q16 B;  3ZTP A;  2PA8 D;  4JI6 F;  3GYX B;  1LXN A;  2ZZT A;  3K2Y A;  4I2Q B;  4UT4 A;  1XNR F;  1HI8 A;  5DM6 Q;  1S6P B;  3GZ7 A;  3BQ2 A;  1H6K X;  3SDE B;  4DV0 F;  1Q1K A;  4DV2 F;  2VA2 A;  4B9L A;  4ZVS B;  3SXL A;  2M8H A;  2FJD B;  2JL9 A;  3ILJ A;  3JAM U;  2XYG B;  4USW A;  2X1A A;  5CYQ B;  4MT1 A;  2NS1 B;  4LVN P;  3G96 A;  1T9U A;  5H9E J;  1NB7 A;  4KFB B;  2I6W A;  4F2S A;  1XWL A;  2D9O A;  4FNI A;  1T05 B;  1XTZ A;  3A8I A;  3AD7 C;  3JSB A;  2ZH5 A;  1SL0 A;  1R8P A;  3HHL C;  4NI2 A;  2DHG A;  4WF9 Q;  3KXD A;  3JSY A;  5GAD I;  3TJ8 A;  5D4P A;  3THV A;  3QIP B;  5D0G A;  2QT7 A;  1W7W A;  3N28 A;  2VUG A;  1XK8 A;  5CQG A;  4HDG A;  4UST A;  2KVQ E;  4YY3 F;  1N6Q B;  4EUV A;  1T8E A;  3MEE A;  3J81 Y;  1SL2 A;  4CT9 A;  2EPI A;  2W7A A;  4KT0 C;  3EGZ A;  1S6U A;  5L9X A;  2VQE J;  1BQN A;  2ZNZ A;  3ET6 A;  5I3U A;  4K59 A;  4X66 F;  4UOF A;  3NCR A;  1PYS B;  2OML A;  2OAU A;  2RDD A;  2XMU A;  3I5A A;  3MPD A;  2PE8 A;  1EZZ B;  2QMU B;  2IM3 A;  2QMX A;  3OV7 A;  4RU2 A;  4N47 A;  3T6J A;  4F04 B;  4JV5 J;  1TKX B;  2MQ8 A;  4CZC A;  3OW2 R;  2RS2 A;  2WOM B;  2DBB A;  4LSN A;  1X4D A;  1GX6 A;  2BQU A;  3WHI A;  4HHJ A;  3LQV A;  1TV6 B;  1G4C A;  3H5U A;  3ZZO A;  1BQX A;  3VHQ A;  4F67 A;  3NGS A;  2WBM A;  1UA1 A;  2MQP A;  3RUB L;  5C24 B;  4QW8 A;  1MMN A;  5DDP C;  4PWU A;  3RG6 A;  2FHK A;  2RVJ A;  1B64 A;  2BEF A;  1O6X A;  2C3Y A;  2V4J A;  4P2S A;  2A1B A;  3M6V A;  3CC2 S;  3AQP A;  1FVQ A;  3DLE B;  2AEM A;  3UDL A;  2DIS A;  5K20 B;  2K3K A;  1CJK B;  1Y5L B;  1M5H A;  3BJY A;  3M1V A;  1T05 A;  5F9L A;  2N3O A;  3RAQ A;  4GKK J;  4JI2 J;  4KRW A;  4ED7 A;  2FLP A;  3TYT A;  3MPW A;  1OSD A;  3TEG A;  3SYZ A;  4EBD A;  3ILI A;  2Z2Y B;  3AHP A;  4ECQ A;  4EO6 A;  1JJ4 A;  2JDJ A;  1RZM A;  3IBC B;  3PCO B;  4J9L A;  1KLN A;  1S1U A;  3CD6 S;  4GRS A;  3MAA A;  4RR5 A;  2RH3 A;  5IT9 U;  1WG4 A;  2BJE A;  2DIV A;  1U6F A;  2ZOG A;  3KMQ A;  3MR7 A;  1YRU A;  2B8P A;  2CQG A;  2CVI A;  3KTQ A;  1I5O B;  4KGV B;  3SV4 A;  4F4Z A;  1TK5 A;  4I2P B;  2Q66 A;  1RA6 A;  2QN6 B;  4I64 A;  2JX2 A;  2VPY B;  4KR0 B;  2HFN A;  1VRQ C;  3HJV A;  4NLT A;  4ZN1 A;  1HBN A;  1VCT A;  5T14 A;  1RAF B;  2VIH A;  5A8W B;  5IQ6 A;  3NBP B;  4DS5 A;  3NP5 A;  4LF9 F;  3PW5 A;  2V4Q A;  2OMO A;  4IQX A;  2KL8 A;  2XY5 A;  3CJK B;  2RE1 A;  1W2B R;  1U1R A;  1KHW A;  4F4Y A;  5H9F K;  1U24 A;  3DM2 A;  4Z37 A;  4DV1 F;  4B3R F;  2QZ8 A;  4YEA A;  1VQK S;  1LNQ A;  1SC6 A;  2HNZ B;  1AB8 A;  3JTO A;  3UI3 A;  2AJQ A;  1RLD A;  2E5H A;  1H7W A;  1N0U A;  1N8R T;  3T1H J;  3DMJ B;  2KT5 A;  4ZVU B;  3KLF A;  4B3M F;  2NCK L;  3DLH A; 
#chains in the Genus database with same CATH homology
 2BX6 A;  2AZ3 A;  3FCV A;  4ANC A;  3EM1 A;  4UOG A;  3EVO A;  1NPK A;  4S0M A;  5IOL A;  2AZ1 A;  1B4S A;  3BBB A;  1UCN A;  3ELH A;  3VGU A;  2HVE A;  3Q89 A;  3BBC A;  3GP9 A;  4ANE A;  4AND A;  3ZTP A;  1PAE X;  1NB2 A;  1NHK L;  1MN7 A;  3ZTQ A;  3L7U A;  3FKB A;  1NCL A;  3FBB A;  1F6T A;  1ZS6 A;  3BH6 B;  4FKX A;  3R9L A;  2HUR A;  3ETM A;  4F4A A;  1JXV A;  3ZTS A;  3FC9 A;  3ZTO A;  5CAA A;  3JS9 A;  1NDK A;  1NDC A;  1B99 A;  4C6A A;  4FKY A;  1MN9 A;  3WX8 A;  1W7W A;  4DUT A;  1HHQ A;  1K44 A;  2DXF A;  3EIC A;  3NGR A;  1XQI A;  3VGS A;  1VYA A;  3VVT A;  3FBF A;  3PJ9 A;  4UOF A;  3NGU A;  3MPD A;  1NSQ A;  3VVU A;  1WKK A;  3EVW A;  3PRV A;  3DKD A;  1LWX A;  3EVM A;  4W98 A;  3NGS A;  3Q8U A;  1BE4 A;  3BH7 B;  1WKL A;  2BEF A;  4ENO A;  1F3F A;  2VU5 A;  1LEO A;  3NGT A;  3EMT A;  1EHW A;  3Q8V A;  1NSK L;  3EE3 A;  4WBF A;  4DI6 A;  3ZTR A;  1BUX A;  3Q8Y A;  3FBC A;  3FCW A;  4CP5 A;  2CWK A;  3EJM A;  1NDP A;  3ENA A;  4EK2 A;  2HVD A;  1KDN A;  1HLW A;  1NLK L;  2DXE A;  3GPA A;  2DYA A;  2DY9 A;  3FBE A;  4UOH A;  2B8P A;  1BHN A;  3Q83 A;  4O0N A;  1S59 A;  3VGV A;  4KPC A;  5CAB A;  3B6B A;  4HR2 A;  1NDL A;  1NSP A;  1U8W A;  1PKU A;  1S5Z A;  3Q86 A;  3VGT A;  5C7P A;  2ZUA A;  1NUE A;  4DZ6 A;  3B54 A;  4F36 A;  1S57 A;  1XIQ A;  3G2X A;  3BBF A;  5BXI A;  1WKJ A;  2B8Q A;  2DXD A;  1HIY A;  3DDI A;  2NCK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...