4UOHA

Crystallographic structure of nucleoside diphosphate kinase from litopenaeus vannamei complexed with adp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
128
Chain Sequence
MVRERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure of Nucleoside Diphosphate Kinase from Pacific Shrimp (Litopenaeus Vannamei) in Binary Complexes with Purine and Pyrimidine Nucleoside Diphosphates
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Transferase
total genus 35
structure length 128
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4uohA00
4EK2A 4C6AA 1BE4A 3VVTA 5IOLA 1PKUA 3ELHA 1WKKA 4CP5A 2B8QA 4DUTA 1F6TA 3DKDA 1XQIA 1S59A 1NDCA 3ZTSA 4ENOA 5BXIA 1BHNA 1NHKL 3ENAA 3FBFA 2HVEA 3ZTQA 3PJ9A 4KPCA 1K44A 3Q83A 3VVUA 3B54A 1F3FA 2HURA 3ETMA 1NSQA 3GPAA 1MN7A 3DDIA 2HVDA 1XIQA 3Q8UA 2DXEA 1ZS6A 3EJMA 1NSPA 3EM1A 4HR2A 2CWKA 1NLKL 3EE3A 4ANEA 3B6BA 3BBBA 1KDNA 1NDKA 3EICA 1VYAA 2AZ3A 3FCWA 3VGUA 3NGSA 1MN9A 3VGTA 2DXDA 2DYAA 3FKBA 3NGUA 1NSKL 5CABA 1B4SA 4UOGA 1LWXA 3Q86A 3JS9A 3NGTA 1HIYA 1NCLA 3Q8VA 1NDLA 3BBCA 2DXFA 3EVOA 3EVWA 3Q89A 4ANCA 1EHWA 1NUEA 1NB2A 2VU5A 2ZUAA 3GP9A 4O0NA 3FC9A 3VGSA 3Q8YA 4S0MA 2NCKL 3G2XA 4WBFA 1S5ZA 3EVMA 3ZTRA 2DY9A 3EMTA 3VGVA 4F36A 4UOFA 5CAAA 3MPDA 1U8WA 1S57A 3BH7B 3ZTOA 3NGRA 3L7UA 3FBEA 3WX8A 2BEFA 4DI6A 3R9LA 5C7PA 2BX6A 1BUXA 1HHQA 1JXVA 3BBFA 1WKLA 1B99A 3FBCA 3PRVA 1NDPA 1W7WA 1WKJA 1PAEX 3BH6B 3FCVA 4DZ6A 4W98A 4ANDA 4UOHA 2B8PA 4FKYA 3ZTPA 2AZ1A 4FKXA 1NPKA 3FBBA 4F4AA 1LEOA 1UCNA 1HLWA
chains in the Genus database with same CATH superfamily
3T41A 4TKTA 1KD1T 2IM3A 2Q43A 3JSMB 2AEFA 3QLHA 3QIPB 3MAQA 4PQUA 4WTOB 1K73T 1FRHA 1UEUA 2VPXB 3IWXA 4UY85 2DISA 3OSPA 4Y65A 2ASLA 4OI1A 4RWXA 1H73A 2N4DA 2JEFA 2HLTA 2UUCJ 8ATCB 1IM6A 4Y2IA 4P7VA 2R2SA 1UFLA 4ZPAA 1QLNA 2ACYA 1Q5YA 3MUTP 1R89A 1RTJB 3IRXA 2UP1A 2D7SA 4KHPJ 1U2CA 1G1XA 4ED1A 2WTFA 4WTYA 2CJAA 3UN3A 1VDHA 4U9RA 3TA1A 4A46A 5KT3A 4ZVQB 4U6PA 1FRIA 4RO0A 2NXCA 4FKXA 3R3TA 3DCAA 2JLFA 5KFKA 2GVDA 2RAQA 1MROB 3EUNA 2ADCA 2C2RA 3C16A 3C8YA 3CO9A 4LRCA 4K4WA 2A0FB 1JLQB 3PM9A 4ID5A 1JLEB 1MMLA 2P5VA 1XR7A 5T7LB 1WI6A 4RW6B 2QFJA 3MM5A 1IUJA 3KLIA 3O2IA 4F25A 1RAIB 2A1BA 2D41A 4OYIA 3JAMY 4NLSA 3W1YC 3HJVA 1X7VA 2VG6A 3EVOA 1EQ0A 5IQ6A 2DO4A 5I3QA 4JI2J 3R2CJ 5T41A 4KAIA 3FK4A 2RILA 3TWZA 3M8QA 1FFSB 2M52A 2E29A 3FNNA 5LT5A 2NR0A 5M2RA 1VJWA 3W61A 1TUGB 4UZCA 4W98A 5K20B 3OTOJ 2HGMA 4EWTA 2R7UA 2F4FA 2L08A 5KFLA 4FS2A 3QIDA 2L3MA 3D6TB 1N4LA 3US5A 3PG9A 2MZJA 4NLOA 1O0PA 4HTJA 5B0GA 2MKJA 3CIMA 3QT7A 5IOLA 4HTIA 4CZCA 3DLKA 4FBUA 1PJ7A 4ZVPB 3H8YA 2J5AA 4DFJA 3T5KA 3M8WA 3PHEA 1MWQA 3I82A 3UVJA 4K50A 5B0CA 3KJVA 1Y3JA 3IBFB 2AGPA 2Z57B 4DFMA 1BGXT 2DBBA 4M5GA 2IA6A 1X31C 4UF4A 2C42A 3LTOA 3BF4A 4J9PA 3I9V9 3KMSA 3KMQA 4IR9A 5FJ4A 2I9SA 2CPEA 4LSNA 3CJTA 2DR6A 2GC8A 2DGSA 5HQ8A 3U02A 2OPRA 2ROEA 1CQNA 2W2MP 2QO3A 5EN1A 1R8HA 2A3JA 4RUBA 1K8AT 4KKOB 3BSNA 2VC1A 3KUHA 4TN2A 4DJBA 3TUZC 1MMDA 2YNFA 4DR4J 4WK1A 1UP1A 4LF8F 1G6BA 1IBKJ 1R8PA 4XAKA 3OR1A 3TVZA 4PQUB 3VAJA 4L74A 4ENOA 1LOUA 2OP5A 4LFBJ 2Y3YA 4Q2MA 1C0TB 2PGCA 1JQGA 4IO1A 4X4UA 5EUHA 2RU3A 4GKKJ 1T9WA 2HHHJ 4OYMA 1VQLS 3B6BA 2UXCF 4WFAQ 4X4TA 5DQHA 3MMBB 2C3UA 3GWCA 1VBKA 1CSJA 5K14B 2E44A 2FZGB 4G1PA 4TVAB 4Y00A 2W9AA 3GQCA 2YKOA 6FD1A 2ZJRQ 3G6YA 3LGHA 1FF2A 4IKAA 2K06A 4NLVA 1A7GE 2H3EB 2Q6CA 2KB2A 1S72S 5CYQA 1HWUA 4RW4B 4WP3A 3OTBA 2COLA 3ZTOA 3NGRA 3D1HA 2LU2A 3MEKA 4URSA 5KFSA 3THVA 3LA0A 4ER8A 3CJKA 2CQGA 2YX4A 2GVDB 2OLWA 1EAYC 5KTQA 2QMXA 2R7SA 1JLBB 4IFYA 1FTRA 3UE2A 3J7ZT 3C16B 2LQJA 1S1XA 4LSLB 4BC7A 4KTQA 5L9NA 1VBZA 5AE1A 3PIOQ 5F0UA 4ID5B 3UO0A 2HK2A 1FD8A 2L9NA 1S59A 3ZTSA 3MM5B 3DLGA 5K9FA 1IR1A 2NZCA 3FEXB 1GT8A 3KLIB 3PTWA 2P9EA 5DG7A 2HQDA 2NZ4A 2R2TA 3QPIA 1CS4B 2XTJP 1TK8A 1VBXA 1N54B 2AYMA 4KB7A 1RWOB 1U02A 2WSCC 5HJXA 1M5KC 3PW2A 1KFSA 1GXLA 2QEXS 1V5IB 1FVQA 1VQ5S 4G1QB 2DY1A 2HLUA 2ZE2A 2B51A 2CAJA 5LJ3Y 1JNZB 2MY7A 3MM7A 3AOBA 3L09A 2DNPA 2AJ0A 1B0PA 4ZKAA 1YJWS 2HQCA 4CLKA 2HHUA 4C48A 2K3KA 5ETQA 1KKHA 3IC1A 4N8OA 5CYMB 4DL0C 3DLKB 2FJWA 2CQ3A 2AYBA 1QY7A 4A8XA 3HVTB 3KJVB 2ZWOA 1OY9A 2ZH7A 3MR2A 4CQ1A 3VAGA 3HT3A 1JXEA 1DRZA 3FSIA 4CIOA 1F1BB 2A2DA 3GE9A 1NSQA 3RB0A 1X5SA 1FE4A 4J9MA 4B3SF 2KYXA 2CZ9A 2VFTA 2BACA 2NXUA 3EICA 4H4MA 2DTJA 1S6QA 3Q24A 1SL1A 4F50A 1HWKA 3ITHA 5DM7Q 1NDLA 2HFUA 3SI8A 1T7PA 1NUEA 1ACMB 4URGA 1QUPA 1TVRB 2YWHA 2FZKB 5LXYA 4L75A 2YNHB 5D4NA 1RT3A 3ENWA 3PW0A 2XMAA 1DLOB 4NYZA 5AXKA 5LMUF 2BRLA 4IH6A 4JBCA 1BQXA 5A76A 4OHXA 2N82B 1VQ9S 2YNFB 2BM1A 1WF1A 2HHXA 3PFEA 2G13A 3OR1B 1YX2A 2WVBA 3MTKA 3MWBA 2WOMA 1U6BA 2DNGA 3CT9A 1J2VA 4JV5J 3BGFA 4PZVA 2FVCA 1NM2A 1AFJA 2HRTA 1N36F 2BZ2A 1RQ0A 1GMUA 4M5JA 1FE0A 1N34J 2MQQA 1KWMA 3UNGC 5A2QU 2CWXA 3P6YC 2VFUA 1TL7A 1LWXA 3DRSB 4PXCA 3AJDA 3QJLA 4RPFA 4H4KA 3PX4A 2H1YA 4CO1A 5CYQB 4LR9A 2NUHA 5F9NA 5FIIA 1R27B 1I51B 2W4CA 1CQMA 2GO8A 1RYSA 1SJ3P 4C8YA 2QFIA 4LF8J 3PJXA 4ZPBA 3HHLC 4P2XA 2EPIA 4UQGA 2DD8S 2QE5A 1K0VA 5GMDA 1OPIA 4OX9J 4HH1A 2UXDJ 3DKDA 1CJUB 1HMVB 3I0RB 2JEIA 4IOAQ 2LP4A 3SQGA 3R7NB 1FVSA 3UR0A 1F3FA 4ECVA 1RHJB 5IQQA 1IBMF 3LOUA 1RAOA 4LBIA 2X1GA 3QRPA 1FKOA 2GNKA 4I6WA 3CJ0A 1C1BA 3QT6A 2VHGA 1NKEA 2AV5A 3TJ9A 1HBMB 1R0BG 3SCLE 2D9PA 4RNFA 3EVWA 3GSDA 1DFDA 3FRZA 5KFMA 5F3ZA 2W9BB 2CQIA 1RT6B 4O3RA 3GFXA 4ED7A 4U96A 4F02A 2NS1B 3FZBA 3B4DA 3H5XA 1S9GA 1NK0A 3GIRA 3PO5A 3HD1A 4X4RA 4IUFA 2JZ5A 2NQPA 1YBUA 3MMCB 1BUXA 4J90A 3BBFA 1B99A 2WAQD 3MF5A 2EI5A 4A8OA 1N52B 2BM0A 1PBUA 2FJAB 3W64A 3ZTPA 2HGLA 3BQ0A 1VK3A 3ETOA 2ZVSA 3UPFA 3N79A 4NL5A 1QSSA 3NLCA 2VDIA 1R0CB 3NOCA 5KT2A 2HVIA 3F41A 5BXIA 2GQQA 3W9HA 3SCJE 3KJNB 1SKUB 2F4VF 2HVDA 2CWKA 3CIZA 3ITHB 3TANA 3VGTA 2PT0A 3R7BB 3Q22A 3LF0A 4WFNQ 1RSCA 1X9SA 3BYPA 2HMIA 2MJNA 1VQPS 2LXIA 4I2PA 3SCKE 1T95A 1JWWA 4LF9F 4LFAF 1I6JA 2VG5A 4NZ0A 3TQEA 2RS8A 3RAMA 1XMOJ 4QCLA 3D67A 2O67A 5JVHQ 1Z2LA 3HXMA 1HHTP 3RRKA 2J6SA 2C1EB 4EI2A 3OVBA 1P1LA 2ZH5A 4ERDA 2IYGA 2VASA 2B8PA 1UWBA 4ELVA 2V4QA 3NY0A 3CD0A 3C15A 3LGNA 1YJ9S 5KFPA 2HHWA 4KY3A 3DOLA 3VAMA 1X4HA 2CPDA 3VF0B 4YN3B 2QL9B 3MI7X 4P2MA 1HKAA 4B3SJ 2XMUA 5KG3A 4NCBA 3DC2A 3QZ8A 3TEGA 1RADB 1ZH5A 1RZMA 3BREA 3HHDA 4FYVB 4MIBA 3LPEA 4OZ2A 3PVXA 2QSFA 1B0VA 4JYAF 4H4OB 4ZS6A 2UU9F 2BJ1A 2MQOA 4I64A 1FKPB 3CO0P 5GAHU 4DV2F 2V4JA 3C3LA 1S7IA 3HSDA 4DX5A 3IN5A 2FVSA 2PC6A 2FVRA 5LMUJ 2ZUGA 3AJ2A 4DR3F 5F8MA 2SXLA 3DRRB 4LR7A 4B17A 4N8NA 4TU9A 1X60A 1Q8KA 4N7TA 1GMVA 1HL6A 2HQGA 2CJ9A 2VC0A 4IFVB 4MH8A 1VMBA 4UQTA 2Q79A 2J6UA 1Q79A 5J1PA 3CW2C 1T0TV 5DQGA 3CEDA 1PKUA 6AT1B 2HFNA 4Q8FA 3LAKA 4B3OB 1Z2ZA 3NEKA 2ROGA 1U26A 1WTFA 1N36J 4X66F 2H4WB 3W2WA 1LK5A 4N56A 1NSPA 1C1BB 2D69A 4TXSA 4LRAA 3M8RA 3VGUA 4HL9A 2DYAA 3UDLA 3FUYA 2I6WA 4OZNA 3QSIA 1JJ2R 2NXEA 1VIOA 3HKWA 1IKWA 4PWDA 2BJDA 4DG1B 3OJUA 1ZETA 3GU0A 3M6VA 2CNNB 1RYRA 2RF2A 2YX1A 3S6EA 2OHDA 3HK2A 5KOWA 4ETZA 1XJWB 1WF0A 1N56A 2YH0A 2MLYA 3L7UA 2XYHB 1EQMA 5KAKA 4WFYA 4LT6A 2VJVA 3M6WA 1NKBA 3C19A 2OI2A 2BQUA 2RRNA 3K7RA 3PRDA 3BZQA 4MTPA 4KGVB 1WWHA 1RA7A 3H7HB 5HATA 4NLGA 4PYAA 2FGCA 2ALYB 3K17A 1Q0NA 3W66A 2Z4PA 5EWGA 2XULA 2HVEA 5KFDA 1Z1ZA 5A8KA 3GYXB 2UVRA 4RLEA 2HRYA 4UW2A 2QMWA 5D3GB 2Z2LA 4QQBA 5C25A 3ENQA 3MECA 1DTTB 2CNLB 2X7IA 1QAJA 4GVBA 3MTJA 3KNGA 1RT5A 1SL0A 4PG4A 3VGSA 4IOBA 1WG5A 4QU7A 4FXVA 3BR8A 4HDHA 3ET6A 4QIWD 2AW0A 2B6AB 2R7WA 4JB8B 3I5BA 3PKYA 1HBUA 1AFIA 1UKUA 1SIWB 3D0GE 2XZTB 1LWFA 4NLXA 1IR0A 3C15B 1CG2A 4RW9A 3MCOA 1S1TB 3D54A 1AUDA 3DOLB 2BBEA 2VJUA 4ZPTR 4TU8A 1RT1A 1WDDA 4HHHA 1DBDA 3R5JB 4QR1A 5B0AA 1QVGR 3OTEA 5LMNF 5A6WA 1YDLA 2F5GA 1X4EA 1PAUB 4JI6F 4W92B 2KI2A 2QA4G 1WSVA 3BJYA 4MYTA 2GGPB 5K8MA 3RRHA 1BC6A 4ES2A 1T94A 1HNXJ 4CNYA 2WVCA 3DXSX 1S1WB 3CVKA 2GS8A 1U49A 4ZCMA 3TO8A 2KFYA 1EJ7L 5GAEI 3A3NB 5IT9U 1WC6A 1P1TA 5CCLA 3MM8A 4O4RA 1KHWA 2JFDA 4FVCA 2CVEA 4B3TF 2LFVA 5K8OA 3HI9A 3MEDA 2CQCA 2OELA 5ETOA 3KHRA 4NLPA 5AXLA 3CJ2A 2M8DB 4NLTA 1RHRB 1T3OA 4DZ6A 3R5CA 1Y7PA 3BS9A 4EO6A 1ZAXA 2XGPA 1VISA 3TAPA 2VFRA 1H2UX 1DTQB 2M0GB 2IIHA 1RWXB 1KQKA 4OI6A 1KVKA 3LAMA 1HNZJ 4WK3A 3HCXA 4YP3A 3W2WB 2BOPA 2OMOA 3CWJA 3VZIA 3M8PB 4C7QA 2IDLA 2BA9A 4B08A 1NU4A 3HKZD 4JYAJ 1IKWB 3N0VA 4PPDA 2G1DA 2UU9J 3NGUA 2BMBA 2PI5A 1MSWD 1Q5VA 3EZOA 1VC0A 3M2UA 1RJJA 4ZVTB 4IG0A 3HSGA 5D0HA 2RF2B 4X84A 4ED6A 2DNNA 3U27A 2DIVA 3ZTRA 1D1UA 4LVOP 1HBNA 1UZDA 2XSJA 4Q44A 3LALA 3PJWA 1UJ5A 1KQSR 3K0JA 3GILA 3C6TA 2H5EA 5HO4A 2IBKA 4YOEA 2UV8A 1G4CA 2E5LJ 2XZDB 2MPUA 3SEOA 3K57A 3H2LA 2WVEA 1XQIA 5BYQA 3TRGA 3VV2B 5A8KB 2P2CB 1X5OA 2BW2A 2R7XA 3TX8A 1Y9OA 1RP5A 2CA9A 5ETKA 1F9EB 3DDIA 5C25B 2XCPA 1KTQA 3JTNA 2IFXA 4XK8C 3NNAA 2BDPA 4RZRA 3KHGA 2CZ4A 4QPTA 4NCAA 2YWEA 2J7UA 2IM1A 5KG7A 4C8NA 2WSEC 1H2VZ 2HHSA 1IWAA 3N6MA 4NLUA 4YY3F 1S0OA 1WD6A 2HNYA 5IV3A 5D0RA 1HBUB 4ECSA 1Q16B 4M5MA 5IWAJ 4DLEA 1DHMA 4JI1F 4X64J 2HBRB 1LWFB 1RAAB 5H1SV 2H51B 1K9MT 4RW9B 2CDRB 4M5IA 3VAKA 4DL5A 4UOHA 3GZ7A 2OSQA 1M5PC 4FKYA 3NCPA 5L1KA 4X62J 3KOAA 1LWEA 3G8QA 3OW2R 2ILYA 2FDNA 3AB2B 1XNRF 2GIQA 2HNZA 1DQ9A 4HACA 4LVNP 5CHCB 5CH7B 3PX0A 2ZH1A 4ZVUB 1VRUA 2HK3A 2GHVC 4FYWB 2PFFB 4LF5J 1XR6A 3TUJC 5HLFA 1T03A 1Q8LA 1K1SA 1VCTA 3BGUA 3J80U 3V6JA 4CLSA 4JP8A 2DGTA 1NSKL 3AAWB 3I87A 2UUWA 2V9KA 4JI7F 4U95A 4LF1A 2KT2A 1I94F 1RT2B 3NAHA 3DI6B 1SV5A 4OI3A 4ECTA 2MZSA 2YKQA 3A12A 3RR8A 4HHJA 2OJ3A 4N47A 2DIUA 4OI4A 1YRTA 1CEZA 1HQEA 2HW3A 1XMQJ 1TFWA 1WSRA 3BO2A 4CO0A 2EKYA 3WX4A 4ZIWA 2VPWB 1TK5A 1HQUB 2L48A 3G4SS 3Q23A 3JB9k 2HIQA 4OHYA 4ZPDA 5RUBA 4GO7X 4Z37A 1YRXA 2JSXA 5LMNJ 4YR2A 4XO0A 1XNQF 4JI6J 4ZN3A 4LJMA 2GFFA 4DF8A 1S9EB 1X0FA 4IRDA 1TAQA 2W25A 2BJ8A 4PG6A 3NNHA 2EC0A 5A2QY 1JXLA 2HAFA 2XB2D 1YK9A 3NMAA 3D66A 1QAYA 3K5NA 3CUNA 1BWVA 4J9UE 4JI4F 2XYGB 4PXDA 1V6HA 2ZBRA 3Q8YA 1FFWB 1HBNB 5GADU 4USTA 3HDSA 1UZHA 4ZP6A 4AD6A 3IWLA 1UW9A 3OVSA 2QC3A 2W9CA 4M5HA 4ZVEA 3QSYB 5KFBA 5IZHA 5HN0A 4DV7F 2GVZB 2QGFB 2LU1A 1FRKA 2J6TA 3D9BA 2J9DA 2C3YA 1LW0B 4TNOA 4ANDA 2KXNB 1FT8A 3F73A 2ZZMA 5D6GA 1N5YB 4CM2A 3O5TB 1YJ7A 1VOMA 1T05B 3HHLB 2D3OR 3D68A 3CJSA 4CDIA 4J9KA 3TARA 2DJWA 2R8JA 1NKCA 3OFHA 1U24A 3FSYA 2GHWA 3EJMA 2FZCB 1RAGB 3IO1A 1RTIA 3M9MB 3FCWA 3CJ5A 5D8HB 5KG0A 1TL1A 4RBVA 2OPQA 4Q8EA 2LQ9A 1RT7A 4UT4A 1JKHB 1LFPA 1U6ZA 2UZAA 3GMGA 3OL6A 2GMHA 1UA1A 2HNYB 2DNRA 1MLAA 3GONA 2R7RA 4F36A 2W01A 4YMEA 1MU2A 4GKJF 4KPYA 2AYEA 1M0SA 1W7WA 1JLAB 5JUMA 4DSJA 2CQPA 1LWEB 2C3OA 2CPJA 3MUMP 1EB0A 4HACB 1OO0B 5J1EB 1RWMB 1U0HA 2V5HG 1IQZA 2QYGA 3DOMA 1IKYA 4AQYF 2KG1A 1NRKA 5KG1A 2GAGC 4Q0BB 4R8UA 2FQQB 1FFGB 4ZJLA 5HLFB 3BQ1A 4KR0B 1V3ZA 4EYIB 4PPZA 2DNQA 1EKRA 2B3TB 2J0XA 1F5BA 3QWUA 4X4NA 4QIGA 1MN9A 4BC9A 2JVOA 3NS6A 4PABA 3SXLA 1SV5B 1AUSL 5KFTA 2BJ3A 4YR0A 3M1VA 5J2PB 2DVIA 3HSJA 3RTVA 1HQEB 4EUVA 5J2NA 4IR1A 2DGXA 2ZDPA 4C8OA 1VQMS 2MKKA 3EWGA 4RX6A 3JTOA 4HT7A 5G0RA 4QW8A 5KT5A 2YH1A 1BY9A 4DX6A 4ATNA 3DU5A 3DRPA 4DLGA 3HM9A 1VJQA 3V6DA 1SC6A 3PXGa 2NPFA 1YJVA 2IVYA 4RKUC 1J5OA 2RJZA 4OHVA 2V8GA 3I32A 5L38A 2CDQA 1Y3KA 3AOAA 5DDQC 1OS5A 2FVPA 4ZP7A 3T19A 4LRBA 1VRQC 3POTA 2HRUA 3MAAA 3KJFB 2B9XA 2DHHA 2A6MA 2HQFA 4U8VA 3PO4A 3OV7A 2R7OA 3D2WA 4QYZK 2GA7A 1G3OA 3BKUA 4EEYA 3T9ZA 3KK3B 1WORA 2OPPA 3TVKA 2K3IA 2PMZD 4KO0A 3I0SA 5C42B 2GMJA 1TMJA 1KLNA 2ZBIA 4MT1A 5KFRA 2L9WA 3C14A 2POKA 3VHQA 3OD2A 3SFUA 3R5DA 2ZWPA 1GAOA 3WX8A 2LXUA 3ADAC 4DMZA 4OYAA 4WP8A 3R1HA 2QJ3A 1SC4B 1YITS 2APOA 4ZP8A 4TU7A 2ZITA 4QWCA 2IY5B 2AX0A 4DHVA 3N28A 2K1RB 4TY8A 3E51A 1UL3A 4R5PB 2DH9A 5B09A 1M90T 3SCIE 3D28A 2MQNA 4OZLA 3UDEA 2XI2A 2OUGA 3CCQS 1UVJA 1Q4RA 1RTIB 3W3SA 3AD8C 3CD6S 2M2BA 5F41A 4ANEA 4OV1A 2VG7A 1TL1B 1NMEB 4MIAA 1BQNB 4WF9Q 2BRKA 1PO6A 5L39A 2XMVA 3M2VB 1IBLF 2ZUAA 3GFHA 2DITA 2U1AA 1MU2B 1NAQA 4ES3A 4DL3A 2OEMA 3I55S 4DS4A 2M3DA 2UVUA 2WHOA 1TKDA 2V0NA 4KQZA 5KFOA 3PR4A 5B7WA 3RAQA 2AMCB 2ZOGA 1OY8A 2MKCA 2A18A 1U0HB 5CYJA 2RKIA 3QO9A 4C6AA 2B4OA 2E7XA 3VALA 3FMBA 4R8UB 3DRXA 3FFIA 4DUTA 4C8ZA 4QWAA 3PYDA 3OXFA 1UAWA 1OJ4A 2PFDA 1EARA 2VKRA 2DNOA 4NZ6A 2MQMA 3W60A 3ZTQA 2J8SA 1AA1B 5FDLA 5J2QA 5IT4A 3E01A 4J37A 3TOQA 3IWNC 3P45B 5GMKa 2B9WA 3G8SA 1RCOB 1RDRA 5KFEA 5ETNA 2WCXA 3PX6A 4EBEA 2OKQA 1Z4UA 3DMJA 2CQDA 1FDAA 3JXOA 3MPYA 3PR5B 1M1KT 1D8YA 2HGNA 4LBPA 1F2HA 1RWWB 1DJ0A 4L3KA 5J2NB 4XDDA 2ZBPA 3UD5A 2IC3A 4NXNJ 4NEYA 5G0RB 1S12A 1EP4A 3MEEB 2HZAA 2F9JA 3RJMB 1WHXA 3LO3A 4DFPA 5F8NA 1FWKA 4PQAA 5THWA 1REVA 1Y5NB 2VDHA 2MKHA 1QJHA 4F4AA 2HWIA 1F3VA 1V5VA 3IR6B 2HFZA 2VA2A 5D4PA 2V2VA 3POTB 2M8HA 5FLXY 2CQ2A 1R8CA 3IAM9 2DNYA 1OPZA 2B4VA 1TP7A 4IO9Q 2J0WA 1UTAA 5I42A 3UCUP 3Q8UA 5KFJA 4K4ZA 4E0DA 2AZ3A 2YKAA 4W4MA 1SQGA 1PYOB 1WDTA 2VONA 2YKMA 1HIYA 2OPPB 3MFHA 4CM0A 3Q8VA 4USWA 4QR2A 2JL9A 1ZPVA 3V5RA 3IP0A 4HVZA 3DHXA 2Y8WA 5IT9Y 2Z8QA 3GP9A 3C14B 3ZZUA 3TW0A 2AU0A 1JMTA 1RABB 4DQIA 4KGXB 1KQGB 1S57A 3VAIA 2L41A 4YR3A 2RD5C 3AXMA 1D09B 1KONA 2O01C 2F8HA 2K8GA 4NYOA 2G2ZA 2QIFA 4P2FA 3BH6B 2ZKUA 4I68A 2PIIA 1U1PA 2H4YB 1JLGA 5EGYA 2XBPA 4I2QB 3DN9A 1MNEA 4CLFA 7AT1B 1Y0HA 3G71S 4ECZA 3CDBA 4EO8A 1FTCA 3DLJA 3K8WA 4KGZB 2LXFA 2OAUA 1CJKA 4C8KA 2WW8A 4WE1A 3NCQA 4DV5J 4R0EA 2OPSB 1URNA 1KLMA 2HQ3A 1NK4A 3MD1A 4DR5F 2FLLA 2RQMA 2OMLA 2HS4A 2DXFA 3H59A 3V81B 3TNVA 2XS2A 3ZZTA 3TUPA 3MMAA 3TZXA 3DLBA 1AW0A 3TJ8A 4JI3J 1WHYA 2W4DA 4LQ9A 3H5UA 4QZVB 5DG9A 1U45A 3GV5B 4ICLB 3G86A 4X65F 2VFSA 4LFCJ 3AOCA 3O3LA 3DDNA 5M2UA 2PD1A 3CTRA 2GJ2A 1M5VC 1JLFB 1I5OB 5HSPA 1CC7A 3JSMA 1NPKA 2LDYA 3FBBA 3QIPA 3OBIA 2C2NA 2DHAA 3J81U 4LR8A 1P9YA 2UUBF 4OYWA 1VRTA 2V8PA 1U8SA 2KH9A 3ICLA 3ISZA 5FDLB 2ZZNA 2JEGA 5J2MB 2J0QD 1GFWB 2YVSA 2Y9HA 2Y1RI 3OUYA 4ZDNA 1X9WA 2B4PA 2RSQA 3DMJB 2VBYA 2VL1A 3F0NA 3KTQA 3FKBA 4KFBA 4OZJA 3KLGB 4IDKB 2BKPA 4DR2J 3RW6A 4WYWA 2IC3B 1N0UA 3D0IE 4QPXA 2VIHA 3M9OB 1EP4B 3MAHA 2M5YA 3IAS9 4WXWA 2R2RA 1P8GA 1HNIA 1SL2A 2XO6A 2MB0B 4YB6A 2MKIA 3G82A 1MROA 1JK9B 3SMZA 3CMAS 1NBEB 4DS5A 4NA3A 3M7VA 3TZYA 1JLEA 1RLDA 3SFGA 3AXKA 2W2PP 4WXOA 4IOCQ 1N5TA 4YB1P 2QLJB 2C2OB 2JH3A 3BR9A 4RW6A 2O5DA 1R8AA 1NH7A 3NGDA 1HI8A 2C2KB 5IM0A 1GMWD 3NG8A 4WFXA 2K7KA 3CMQA 5HMXA 2ZD1B 1SH3A 3J80Y 1YRUA 2RH3A 1KOHA 5ETMA 3EXYA 2JNJA 1W2IA 2QSWA 2ZHBA 3JQMA 1WHVA 1N5SA 3OFFA 3DLHA 3MCNA 3BDPA 4UTGA 3G2XA 3KK2B 1NJIT 1CBKA 2MLXA 2E7VA 4EFAC 1IJFB 3HT0A 1LV5A 1PILA 3C6UA 1U2RA 3CJQA 3QRRA 3TYTA 3HSZA 2LEBA 3Q8PB 2AWZA 3CCJS 2V68A 5KOXA 2XLIA 2DGWA 4ECRA 2FJDB 1HHQA 1TL4A 1XWLA 1K1QA 4HDGA 1JLGB 3PV8A 3GIKA 1Y4ZB 5GAHI 5DDRC 2YWGA 2BXJA 1S48A 4ZITA 1H0HB 3IGVA 1N0VC 2HHPA 3MEGA 2FGOA 5CQGA 1B64A 2CFXA 1H7XA 2X1BA 1O5JA 3IRWP 1M5HA 2QN6B 3N6LA 4WE1B 1KLMB 4DV0J 2IMWP 2RQCA 7FD1A 2HBQB 3AFGA 3FSXA 2MKSA 2RS2A 3EGZA 2O1PA 4U7UK 3NBPB 1RHMB 3KXDA 4K0KF 5E41A 3BYRA 3W2VA 5C24B 2BJ9A 1FD2A 3G6ES 4HKQA 4DCOB 3HX9A 2AJ4A 3R97A 3BH7B 3V2UC 4MIWA 3ZNUA 4FF2A 1F5AA 5D4LA 3D6HB 1E6VB 1ZA2B 1SJQA 1FEHA 1YZ7A 1ULRA 1RB0A 1Q95G 3GJSB 4C8LA 4KH1B 4RNMA 3CULA 4R0JA 2PEBA 1VRTB 3AODA 1CJTA 1U1LA 1U1RA 1C0TA 1BE4A 2VA3A 3MM6B 1J5EJ 5JVGQ 5HAOA 4NXMF 4ZHRA 2CQBA 2KN4A 3A13A 4DDFA 5DGAA 3OUYB 3MMBA 4RUCA 3GLJA 3NL0A 5K14A 3HO1A 3P8BB 4KFBB 3PW5A 3EE3A 2WB4A 3DM2A 3IR7B 5E2QA 2DRDA 1NJYA 1GQEA 3ISND 4DR5J 1P9QC 2NUUG 3LP0B 4I6AA 4RW4A 4N41A 3CC4S 5D77A 3GJQB 1FWPA 1X8DA 3DYAA 2IHR1 4P72A 1GNKA 2MKYA 5LM7E 4IG3B 4X65J 1HNIB 5CAAA 4ZPWR 2ALZA 4B9LA 1HR0J 2GIFA 3FGVA 3G82B 1JLBA 2XI3A 3T1HJ 4LSLA 3OR2A 1NXIA 3IG1B 3UW1A 4QOTA 1U4BA 4NLYA 2UUBJ 4P10A 2ZOFA 2NSBA 3RB3A 4MK8A 2Y1JA 4NLRA 3HPOA 3NWGA 5IM0B 3HHEA 2IJRA 4M1KA 3M6XA 3PFOA 4HEA9 2BANB 2VBWA 4DUZF 3CDUA 5KT6A 1CS4A 3PJ9A 3ETMA 3GFZA 3SSRA 5HL7Q 1XIQA 4FYXB 2AYGA 4MKAA 1O8BA 3OFEA 2OSRA 4NOHA 2MGZB 5FD1A 4X4VA 4G1QA 1NZ8A 4ECYA 2E5JA 2W8LA 3C6UB 2N7CA 3PYGA 4OQJA 2ATCB 4WFZA 2C2MB 4G65A 2QA2A 4MMOA 1RACB 1T02A 4UZBA 2ACMA 1PSDA 1EZZB 4PAAA 5CYMA 2B5JB 1WKLA 3KG0A 5JXSA 1UEVA 1S1UB 3B78A 4ILLA 2DO0A 1H38A 3HVTA 2ZM6J 2HVZA 4FDFA 3IFEA 1E6YA 2FY8A 3RGIA 1TUWA 4EK2A 4ECXA 3MEGB 4M8LA 3U1MA 2R4FA 3LWLA 1WJ9A 4NE9C 1Y5LB 1PJ5A 2W2OP 3O6QA 2F63A 3G6XA 2V69A 3E3XA 1BXNA 3D6FB 1FX4A 1KSPA 2C2DA 2PE8A 3MCSA 3H4DA 4NA2A 3FRYA 4OJGA 1W25A 4OZ1A 4RUHA 2KL8A 1TVRA 1NH8A 2YNHA 4M5LA 1YJTA 3W2VB 1DLOA 3N5BA 3UI3A 4PKDB 2Y1LB 1YJRA 3EPGA 4Y34A 4HI1A 2RUGA 4KGKA 2QLWA 4OMFG 3AQOA 4L72B 5KFQA 2FHMA 1N33J 2GAHC 4ED8A 2G0IA 2HAIA 4A8QA 1O6XA 1H6KX 1VLOA 4XDCA 3T3FA 1HHSA 5LOQA 1CJTB 3CCUS 1Q82T 4JI5J 4DR6J 4N76A 3KHLA 4KV8B 2V94A 4CH0S 4ZHRB 4WIQA 1KS2A 2VF3A 5EX0A 5HANA 5HQMA 2RU9A 5B0BA 1D9FA 3CJ3A 3GB0A 5KFHA 2VQFF 3HLUA 4E2FB 4GC7A 3DM2B 3DRSA 4NWBA 1MN7A 4P6QA 3UDVA 4B3MF 4B9MA 1FI4A 5HQLA 1NJWA 3UDCA 1GTHA 4BHQA 1IKXB 4MAKA 2ILZA 1RBAA 3OLAA 1NDKA 5ITHA 2FLOA 2Z2YB 1HPZB 2BABA 2LKZA 4K0KJ 3T6JA 3DYAB 5A8WB 2AT1B 2B43A 1ZA1B 4PEOA 1YI2S 1NB2A 4NCGB 1NJXA 2I8EA 3UNYA 2QTWA 1FESA 3TA2A 1X4AA 2XHWA 1EIYB 4KHMA 3WBZA 2YKPA 3K58A 1NNDA 2FHKA 2W1BA 2DRAA 4Z7YA 2W4PA 2PN6A 2K2PA 3OR2B 2EFGA 4CLWA 5HVHA 2ZH4A 1ZM3A 1N8RT 3BQ2A 3ZXWA 2X3GA 4EYHB 2V2QA 2JC0A 1CJUA 3ONQA 4GMKA 1HMVA 4HH0A 2OD6A 3I0RA 2VOOA 4CH1A 5EHHA 4NXMJ 1ZBTA 3GV8B 3BN4A 4DQSA 3HMJG 2DNHA 3G9CA 3AJ1A 4W90B 3R7SB 4ED3A 3SV4A 3S01A 1HBMA 4YDDB 3OPKA 3NKYA 2B0GA 2LLZA 2DK2A 3CNQP 4PWWA 4OX8A 5IT0A 3AD9C 1U48A 3R5AA 5KFXA 2W9BA 2DH7A 1U0SA 1RT6A 4D3HA 3SIPB 3Q8QB 1N88A 1WC0A 4AE5A 3PZPA 3MMCA 4KSEB 3L7PA 3JTPA 3PIPQ 1YZ6A 4USJC 4OZ0A 2RE1A 1WKJA 3UD3P 1DY3A 4FPIA 1E6YB 1RAJA 2EK1A 1SQEA 5KT4A 2FLPA 3VCDA 1O51A 3TA0A 3TI0A 4O4GB 2Q1LA 4NLDA 4DUZJ 2O3DA 5ETSA 2QV6A 3AHPA 3KG1A 1HW8A 3FEYB 4ED4A 4TY9A 2LEPA 1UETA 3HULA 1NLKL 1U2FA 4K59A 2YKNB 4X4OA 2BE2B 3BGRB 4P75A 4FXWA 2ASJA 5HVGA 4WWSA 3QYYA 1SJFA 3E8OA 5AE3A 1SJ1A 4YQWA 2XWXA 4HHUA 3S1TA 1SJ4P 4LRDA 2GW8A 2V63A 2HQIA 1YLXA 4A8FA 2VODA 1N32F 1EETB 3CJ8A 1FDDA 3D4JA 4K2XA 1Q7YT 3T6BA 4ECQA 5LSLA 1TL5A 4CH7A 1RAHB 2QL5B 4O23A 5GADI 4HLBA 5LJ5Y 1L3VA 3AD7C 5GVQA 3NWRA 1NEEA 2E9ZA 1UVMA 3IBCB 3VR1A 1NK9A 3P5TL 4WP9A 2CJBA 1KP6A 1VHIA 4KYZA 1CC8A 1TKZB 4UUXA 3N4WA 4H4OA 3N9UC 2QLFB 1FKPA 3IS9B 1GMWA 2CNKB 2MTLA 1BWEA 1Q53A 3M9NB 3DFEA 1RTDA 3DRRA 3CDAA 2W2NP 1XN9A 2WONA 2C3MA 1K0TA 2PO4A 3CMES 3GJRB 3MPDA 3AA9A 3MGJA 3U1NA 1PBAA 4OZ5A 3GG1A 4IFVA 4QR0A 2G2OA 4J9RA 5KT7A 1L5UA 1B7YB 3VQTA 4UY8T 4ZVGA 2G9OA 4B3OA 1LW2B 3J81Y 1VC5A 1R0AB 4R25A 3KNAA 2UXCJ 3D5MA 3I5CA 4FXDA 2N4CA 4XIUA 2YNIA 3OHBA 5H9EK 4AL6A 2C2ZB 3PHTA 1T3NA 4A8KA 1U7LA 3FBFA 2X1FA 1FRLA 1CJVB 3DOKA 5F0WA 2DR7A 2J9DE 3RB4A 2E1MC 4DV1F 2FUG9 1SIZA 2BJEA 3GIJA 2FPHX 4OJHA 2JLGA 1HWJA 4DG1A 2XLJA 1VYAA 2VPZB 4EZ9A 2KM8B 3J7Z5 1MWYA 1VR6A 1FNOA 4A8MP 5D15A 1HYSB 5LL6d 1QM9A 4C0HA 1KOOA 3IM8A 3HJFA 1VQSA 2RDIA 4DPWA 4LSZB 2LYVA 3OVAA 4I1TA 4LMZA 2QT7A 2V8DA 2N7YA 2PEHA 2F65A 3EXCX 5HBMA 1HWLA 2OFGX 1S97A 3QAEA 4JI2F 2U2FA 1RU2A 4OX7A 3KUGA 1HNVB 2ZZTA 3MPWA 3FEZA 2V8HA 4PCQA 4P73A 4URQU 5KFUA 1C4CA 3EZUA 5EX3A 3LH2S 1SCJB 1UWAA 2RNEA 4DSEA 5L1LA 2FVQA 2IA0A 5D3GA 2CPIA 2HFOA 3V4IA 2FHJA 1DTTA 3PW7A 4KHRA 3OTOF 2EXUA 3BO3A 2B56A 3OTDA 4U67Q 2V34A 1FDNA 3K2YA 2MEWA 4ELUA 3ZC4A 5I3UB 4EBCA 3LP1B 2HNDA 4M5KA 4CO4A 2B6AA 2DGUA 2I2YA 1XERA 1VQ4S 4K4XA 1CPZA 4C2MA 1OWXA 1X4FA 5A6PA 3LWMA 1XEZA 3OXGA 1S1TA 2R7QA 4AUKA 1Y00A 5BR8F 3LW5C 4ZOSA 5H9FJ 1GH8A 4JI0F 2FJXA 3L9ZA 2IPOB 3DGPA 5ETRA 1VLYA 5L1IA 4QBUA 1RTHA 4X2BA 1HNWF 1FX2A 2KJWA 3ILIA 2XEXA 2BR0A 2LECA 3RBZA 3QGGA 4AXJA 3BGOP 4J9VA 1F9HA 5F8HA 2XMWA 1FK9A 1HWIA 2GGPA 1KRPA 4B9SA 1F2GA 2EK6A 1D8ZA 3H2VE 4DR4F 4QYZJ 1S1WA 1IBKF 2HHTA 4ZLJA 4UOGA 3HZEA 1RTDB 4AFFA 2HVHA 1YJNS 4I0WA 5DETA 3D0HE 4LFBF 2WONB 4H4KC 2GZOA 4K4TA 4GKKF 5ETLA 2HHHF 4DPYA 2ZDOA 3CC2S 4J9QA 1KN6A 4DXLA 2MQLA 1R7IA 3U1LA 3D7SB 3H90A 1NZAA 4DL4A 1ZM4A 1DZ5A 1DTQA 2J8AA 3MM9A 4BBYA 2CG8A 3H5YA 3P49B 4CNZA 5DRKA 4UUWA 1U47A 2EEYA 3KLHA 4KE5A 2OTLS 2YNIB 1DURA 4JV2A 2OIHA 4IRCA 3CE8A 3M8PA 1WEXA 2AIRB 1X9MA 3DOKB 2XS7A 4CYUB 4PRFA 1AB8A 3AH6A 3KUEA 2YPYA 3H0PA 3TVYA 3W65A 1N48A 1S1VB 4ES1A 2E7WA 1RHQB 4BDPA 2DR8A 1D9DA 1FJGF 5KG5A 1WOPA 2CQ4A 4MJKA 3OSNA 3Q8RB 1U1QA 3HZGA 2MDAA 3MR7A 3EGWB 4DL2A 1Y10A 2BQ3A 4CT9A 4KJIA 4RW7B 3NMRA 1FWLA 1RA6A 5ETPA 1PC4A 3MMJA 3DU6A 3QZ7A 1C1CB 2NLWA 3EVMA 1ZM2A 4RW8A 1U1NA 4F2SA 1WUUA 1V9OA 2XMKA 1IR2A 3W63A 5ETTA 2ROPA 4RNOA 5HBMB 5AXNA 5IFMA 1N6QB 4ED5A 4Y2CA 3MOJB 4WJBA 1UPPA 3M2RB 2MZTA 3FBCA 2NXNA 2ZFHA 2R7VA 3GSIA 2NYIA 1ICEB 1QE1B 5C2CA 1YTYA 1IBMJ 1X4DA 3KLEA 2J76E 1AZSB 5AT1B 4DR1F 1HFEL 2IAJA 3FJ2A 2CJXB 1Q7LB 3V4IB 2AD9A 3KJQB 3ENAA 3RZAA 4FYYB 4DV1J 2FJBB 3OL7A 1KVIA 2W7OA 4C4WA 3M8ZA 3QAUA 2CPYA 4B02A 1FRMA 2I5JA 1KHVA 1TKTA 3SYZA 3J7YU 2Y8YA 5CABA 4ZJOA 1QVFR 1FDBA 2HNDB 5CCMA 3SDEB 3MR6A 4C11B 1W2BR 3CCVS 1EKSA 4CLUA 2JRSA 2H5JB 3EPIA 3FDSA 1VQYA 2NCKL 4Y3CA 3VZHA 2X51A 3HHNB 2IRXA 2N3OA 2EKNA 3WIVA 1NJZA 3HD2A 4C97A 4JI8F 2ATLA 3ILJA 4K8RA 1QTNB 3GIMA 2H5IB 4Q7AA 4F04B 2WVFA 1QAXA 4K5RA 4Y2KA 3DGPB 1BQMB 3ISNC 4YB5A 1S79A 1RTHB 5FLXU 2F4VJ 1ZZNA 3GTYX 4NI2B 4USIA 1JIHA 4DN0A 2HPUA 1T9VA 3W5ZA 2OD4A 2A2CA 1JJHA 1FK9B 4I69A 2XGQA 3S7RA 2DGOA 3MD3A 4X4PA 1ELOA 3B8HA 5DLFA 3H42A 1VS3A 4DV3F 1Y5IB 1R6VA 4LF9J 4LFAJ 4K4UA 3L7OA 2VD3A 5E0OA 3WZ0A 1KC8T 3KLVA 1ZS6A 4GVLA 3H4BA 4NA1A 1RT2A 1L3KA 3DI6A 2MMYA 4ZVOB 2CVIA 4QIVA 5E5NA 3MZIA 2MLZA 3BBCA 4Y2AA 1YBTA 4ANCA 1ZOTA 3X3UA 5DM6Q 5EDWA 5B0EA 2R8KA 4JV5F 1KNZA 1N34F 3O8WA 1HQUA 5B0FA 3AT1B 1YKWA 5BR8J 1CULB 1TUVA 2KXHA 2HBYB 3NCRA 3MM9B 1GX5A 3CCLS 4JI0J 1RBOB 2F40A 4F4ZA 3H98A 3TAQA 1TMMA 1S49A 1JXVA 3D1OA 4F8RA 2RQ4A 3KLHB 2RUSA 1HNWJ 1VQ7S 1S4FA 1FRJA 5EWFA 1S9EA 4FZVA 1NHVA 2CNOB 2MZQA 1YGYA 4ID8A 3MDFA 3M32A 3PEHA 4DV2J 4G6VB 4USKA 4WYLA 1OIAA 5M2PA 2H48B 1D3WA 3WIUA 3QLHB 1FERA 2CZVC 4YS2A 1WNEA 4DR3J 3PYFA 4OHZA 3OFGA 4OX9F 3UCGA 1U09A 2UXDF 2YWKA 1RHKB 4RW8B 2D3ZA 3CPWR 2HHVA 3VAFA 4ECWA 2J9EA 2GVZA 2RVJA 1FRXA 4G1IA 4EMDA 3RR7A 2YTCA 4ED2A 2WZ1A 1LW0A 1Q8BA 1RI7A 4AYBD 2ZJQQ 2R7TA 1N5YA 2QMUB 3UN5A 1FNMA 2B7CB 3KLEB 3FZ2A 1RE1B 1PIEA 1T05A 3HHLA 4X66J 3IRXB 2PMWA 4L73A 1UFWA 1GTEA 4BS2A 2IAJB 3E2EA 4DV6F 2F7VA 1RWKB 5D78A 3V6HA 4F0MA 3ELHA 1VIXA 3HFZB 3NP5A 1RU1A 4USMA 2XS5A 2VH7A 3QJJA 1FJGJ 4MKBA 1F60B 1RK8A 2I5JB 1WG4A 3B54A 5D4OA 4YB7A 1ROFA 1TKTB 3MPVA 5K8PA 2Q66A 3NS7B 1JKHA 2LDIA 2MZ1A 1XBWA 2VBZA 4DSKA 1TKXA 2IYIA 3UWTA 2D3UA 4X4SA 3QRQA 1A9NB 2IJNA 2QA1A 2FB0A 2VG6B 5KFIA 3V4MA 3CSKA 1JLAA 4TYAA 3FBEA 4TQSA 3OHAA 5HK4A 3GJTB 3ZZPA 1QUVA 5C7PA 3M8QB 5J1EA 3QBCA 2ZH3A 1RCXB 4ZVFA 2KZMA 2LQBA 5C2GA 2MXYA 4DR1J 4C3KA 4Q0BA 5C5JA 3ZZ0A 3WDOA 1XMOF 2LQ8A 4K2JA 1X0PA 4DBQA 4WPAA 4C0OC 4WKRA 2C28A 4FNHA 1M1GA 4P71A 1F5CA 2G4BA 2AGQA 5F8GA 1WC1A 2X1AA 3QQCD 3THTA 4U7UD 2AX1A 4NASA 1WF2A 1YIJS 3VWSA 1VQOS 3R6LB 1U1MA 2OTJS 3FQLA 3UVJB 4FYDA 2MSSA 5J2PA 2E1CA 1REGX 2DHSA 2IRYA 4JUZA 2FJVA 3K89A 3K5PA 2XQCA 3ZFVA 2C3PA 4U8YA 2MQ8A 1RISA 4CT8A 1S10A 4JI8J 4F3MA 4DQPA 4LSNB 2AEJA 2EC2A 2WSFC 1WELA 4DPUA 4RU9A 3R6GB 2OPRB 4DU8A 2JFKA 2WB1D 2LA6A 1R3NA 2IVMA 4GO5X 3I96A 2P6TA 1AT1B 2ADBA 1FJ7A 2F3JA 1Q8IA 1MG7A 3P5BP 2GIRA 4ZK7M 2RMLA 3W9IA 2ASYA 1MWZA 1RAEB 1RT4A 3M32B 1SC3B 4DV3J 1FKAF 2H54B 2LMIA 3IXQA 3THPA 1TV6A 1TELA 2EVZA 1HD0A 1ZYQA 2HURA 2M7SA 2YPZA 4A8SA 2DNZA 2DXEA 1V3RA 1RAFB 3KK3A 2MHNA 2Z58B 1DQ8A 1F0XA 4B3TJ 5C42A 4LF6F 4L76A 4D3GA 5KG2A 5GMEA 2G1HA 3OQ2A 3WC0A 2V2ZA 2E9TA 3BO4A 5DS7A 1S77D 3EDRB 3CCMS 1G2EA 3VGVA 3MHYA 3EZ5A 5HMYA 2CIMA 2BV3A 1AROP 2VOPA 2BEFA 2KDOA 3IBWA 4OYXA 3MURP 2XO7A 2E66A 2K1RA 2YQ1A 4DQQA 2QL7B 3WQPA 1T11A 4R5PA 2RT3A 4OLPA 1JB0C 1QDUB 4QW9A 5IC4B 3CJKB 3ZNJ1 2XSFA 4M5DA 2GJIA 2XCAA 3RU0A 1BMQB 1ZZFA 4ZIVA 2QA4S 1S0MA 4YFUA 1ZTTA 2F1FA 2MY8A 4IFYB 3GCWP 1S1XB 2BE9B 1BQNA 2P9CA 8AT1B 1K47A 2DPIA 1GX6A 4LREA 1TKXB 5B0DA 3BBBA 3DLGB 1TQLA 3M2VA 2CXEA 5AXMA 3FCHA 3Q86A 4PXBA 3P4UB 2M9KA 2AF6A 3NS5A 2CYYA 4OLOA 3UN2A 2HSEB 4OYZA 2HG4A 3QNWB 4OJ1A 3KG4A 4LF4F 3DXBA 1S9FA 2DHGA 3TAMA 4C98A 3N6NA 4RBUA 3QFWA 4DR7F 4LUBA 4V19J 2GX8A 2ZE2B 2JDJA 2XG8A 1XMBA 4KC5A 4DV6J 3MM7B 4RNHA 3W8GA 3PCOB 4ZP9A 2B8QA 3PKMA 2XNQA 4K7QA 4FF3A 2KT5A 1ZM9A 1OYDA 3RG6A 4I7FA 3VVUA 2XHCA 2XM3A 2FTRA 2HZVA 4OFZA 4YY3J 3BN7A 3KFWX 2XWYA 4ALZA 2EBEA 5KFCA 1RWNB 4JI1J 2XNRA 3U7JA 1H7WA 3MPUB 3GR1A 4A48A 3EX7B 4PG8A 3MEEA 2QG9B 4H4MB 4HYKA 3GCXP 4AL5A 9RUBA 1S6QB 1FXDA 1HBOA 2BVZA 3IR5B 2RQKA 2UV8G 1FHTA 5KFWA 2KVQE 1PC5A 4O3OA 2KYZA 1XNRJ 1UA0A 4BLGA 2DGVA 1HNXF 4YDXA 1WHWA 3C2PA 3CDEA 2FJEB 1RT3B 1UVKA 3CXCR 1H74A 1XK8A 2PSZA 2DB1A 3OJSA 2DNKA 3AQPA 4BCAA 1RT4B 4WU2A 4Y6IA 1TK0A 4RU2A 4NMXA 2UVWA 1TV6B 4DSIA 4JI7J 2DRBA 3KKFA 1BHNA 1I94J 4O3NA 7FDRA 4TLQA 4DSLA 1K44A 3G87A 3ZZOA 3HVAA 3N5FA 2Z2MA 3S8SA 5AE2A 2WOMB 1KDNA 2J7KA 4QWBA 5J1NA 3BSCA 1HNZF 2UXBF 3BDEA 3J7AN 1TL7B 2OGUA 2DR9A 3G96A 3BSOA 1URRA 3HVWA 4ZCKA 1SC1B 2XMJA 2VB6A 1XNQJ 3M8YA 2HWHA 3RW7A 3W8PA 4FF1A 4ZA1A 2RDDA 4OI0A 3HF5A 4I2QA 3R5GA 1VBYA 2JVRA 2FD2A 4M5DB 5GAGU 2BKNA 2IJFA 1LQ9A 1S6OA 4USVA 2ERRA 3A8JA 4JI4J 2B9EA 1VQNS 2KRRA 3TZWA 3KHHA 3MFIA 2OPSA 4OJ3A 3NRBA 5CXTA 2ZH9A 3NXZA 3V81A 2E5LF 2RHQB 3SQGB 1UMJA 4LF6J 4Q2LA 1VQ8S 3K5MA 4K4SA 3PRBA 4DV7J 1OMSA 2XZWA 4LBHA 4YHHF 5BYSA 1U25A 1FKOB 4DCPB 4FP9A 4ICLA 2W24A 3TAMB 5DJBA 1JX4A 2P6SA 5DG8A 1JLFA 5MLCV 2BKOA 2WK4A 1P6TA 2AP6A 5LSOA 2CQHA 3ZZRA 4JOUA 3I9ZA 1Q78A 2CG4A 3DHWC 3FCVA 5E33A 3DNCA 2Z56B 1S9GB 5BYRA 2CKWA 2XYPB 1FA0A 5KFZA 3D3BJ 5J2MA 1Q86T 1C2PA 4ILMA 5CD4A 4DX7A 5IWAF 4CP5A 4GC6A 2V8VA 4X64F 4I7FB 4DPTA 4USHA 1RWPB 3KLGA 3X1LB 3KDOA 3SQOP 4IDKA 1WG1A 4X62F 3K5OA 4B9UA 1UPMB 2VICA 1SB6A 4NX9A 4O44A 3NGSA 1NB7A 4NRUA 1UJ4A 2I38A 2R8GA 2YX7A 4GKJJ 2EBGA 4YEAA 4DFKA 3KYLA 1HBOB 4LQ3A 2VPYB 1DAXA 1H2TZ 3V6KA 4NEZA 4LF4J 4DPXA 5HMWA 4LF5F 2LVWA 3QGPA 1B3TA 1LFWA 3A4TA 4F3QA 2D9OA 2HMIB 2HWTA 4DR7J 4I2PB 1PCAA 1MW7A 1OY6A 4AQYJ 2W8KA 4V1Ak 5F8JA 2VG5B 2A10A 1WOOA 3H5SA 3K8VA 4PG7A 3R2DJ 3M30A 2GJFA 2WVDA 2PA3A 2BJ7A 4QIEA 2AJFE 2NYHA 3ENVA 1UCNA 3JSRA 2WRMA 4I67A 1VC6A 1Q81T 1XMQF 3TR5A 2Z0GA 3SZ2A 1UWBB 2D3O1 2ZD1A 1LXJA 2M88A 4CLYA 2KU7A 4FNIA 2D74B 2GCFA 2P8IA 3PEJA 2KT3A 2HFVA 4IH5A 2DH8A 3IGNA 4KPCA 3RUBL 3KLFA 3H40A 2KFNA 3GG0A 1D0EA 5IS2A 1SKWA 2J7WA 1SH0A 2DR5A 5CA5A 3KK2A 1YVFA 5EWEA 3UD4P 3CD7A 3T5JA 4NRTA 4CO2A 4MYUA 2LEAA 3WC2A 1XTZA 1LWCA 3CB4A 3PDNA 2R42A 4EGLA 4ED0A 1UW4A 2ASDA 2V4JB 3OT9A 2V50A 2MJUA 1QSYA 4B3RF 5DLGA 1I3OB 3I5AA 2EG1A 1S0NA 1VI7A 4O3PA 1SBRA 1X5PA 1M1HA 4ETXA 2CUYA 1SKSA 3H25A 3SSQA 4CCHA 3IMQJ 4F3OA 1SI9A 4CTAA 2NSCA 2FC8A 2YWWA 2DCUB 5L1JA 4K5SA 5A8RA 2KO1A 4L6V3 4WIIA 1HA1A 2DEJA 1TL3A 1IM4A 2IDEA 4E98A 3NBPA 3ZZYA 2UXBJ 4I4BA 1OYEA 5C24A 4WZQA 4QWDA 5HROA 2VUGA 4WU3A 2EWHA 4DX8H 1E6VA 4PWDB 3OTCA 5IC6B 4O0IA 2F8MA 3CCZA 3D3CJ 4P7TA 5L46A 4RUAA 3M05A 4WZMA 2CJQA 2HKEA 1XR5A 2XY6A 3ULHA 4QWEA 1GK8A 2KHCA 3QGHA 3MM6A 4DN9A 3W7BA 2CQ1A 4N77A 4ZLNA 5H9EJ 3QT5A 4CRJA 1C0UA 1LNQA 4IH7A 1H3DA 2RIJA 1FCAA 4DV4F 3TZZA 1S99A 1YJUA 1IBLJ 1WC3A 2M4MA 4O44B 3LP0A 2IVFB 1L3UA 4CWBA 3BEGB 3T5HA 3TUIC 4C3MA 4YHHJ 4EBDA 4IG3A 3J7A1 2AJQA 2KJVA 3PNIA 2HYIB 1WC4A 1EHWA 2LCWA 3D6MB 4KIAA 2EG2A 3MECB 3L95X 5I4MA 3I6PA 4X4QA 2XMMA 1OQ6A 2YY3A 3LP2A 4GVBB 4F4WA 1RT5B 4HI2A 3IG1A 1U1OA 1R31A 3RBDA 2QYCA 3HVRA 4MK7A 4DUYF 4F0HA 2QRRA 3M30B 2QLBB 2AJ1A 1QAIA 3ET6B 4I56A 2BANA 2AZ1A 2CRLA 4YUDA 1H72C 2HFSA 1CLFA 3PY8A 2YNGA 1SPBP 4DL6A 2HHQA 2N3LA 3AB4B 3Q2TC 2HIYA 3KLFB 2AKWB 3JYTA 4WFBQ 1RT1B 4C3LA 2MGZA 1M5OC 2UUAF 1IQTA 2HEKA 3UR3C 2C22A 3T1YF 3IA0A 3RAXA 2HS0A 2ZJPQ 4Q45A 3TJAA 2AEMA 4EZ6A 3TP2A 1L3SA 1UVNA 1LWCB 2DPJA 3CDWA 2E5IA 2G0CA 4J7CA 3LGMA 4F4XA 2BQRA 3FC9A 4S0MA 4XPCA 1VQKS 4J9LA 1S5ZA 3NOGA 4DL7A 4FS1A 2B5JA 1C4AA 3DGVA 1DARA 4PYDA 5DZ7A 1S1UA 4PR6A 3RYLA 4E8UA 3ILLA 2B7BB 3UFCX 3EYZA 1KR4A 1FJEB 1T9TA 2FIUA 2I0XA 3T1AA 3MM8B 5KFNA 1GXUA 1V3SA 4CTAB 2IM0A 2F9DA 1SQFA 3FQKA 3MEDB 5E3PA 4MFBA 2XY5A 5A8RB 3PACA 1R6YA 4A8YA 2MZRA 5F8LA 4EU0A 4AT1B 2CPXA 4GRSA 5IXUA 1TL3B 1OQ3A 4HT5A 4K4YA 1X4CA 1NPRA 1KQFB 1IWGA 3EDQB 2EFVA 2H65B 1NSAA 4FVMA 4FN5A 4C9DA 4FF4A 1RKIA 5HROB 1FEEA 3NGTA 2ZOMA 2OO4A 4TLRA 4ZLPA 3Q89A 3RB6A 2CJYB 3M6UA 4H54A 2V2KA 3VTIA 1PJ6A 5KFVA 3M2UB 2PA8D 4IG0B 1NO8A 4B3RJ 2X3DA 1S0VA 2G2YA 3FVYA 4ZPCA 4Y28C 3JQKA 3CCRS 2XY7A 2FHJD 3BPSP 1SVDA 2RDJA 1TFYA 2MSTA 4NPOA 1TZ0A 4KV8A 3DRYA 3IM9A 5E3QA 2LA4A 4CLZA 4U7CA 2NPIA 1YBAA 2XSJB 3B82A 2D1CA 4F2RA 2UVVA 1HI0P 1C0UB 2B4UA 5KFYA 3CCWA 3EGVA 3GIIA 4PWUA 3C6TB 4CLLA 1IKXA 4ZVRB 1LXNA 1ZAWA 3Q83A 1HPZA 5LSRA 5BJRA 5A8WA 4DPOA 4HR2A 5D0GA 2WW4A 2KKHA 4NCGA 4DWIA 3O1LA 2EFQA 2O66A 2L9DA 3GR0A 2AHOB 2JX2A 3Q8SB 3CC7S 4ZPVR 3QJPA 2CQ0A 3TEHB 4N5SA 3QMQA 3DLEA 2OH2A 3LP2B 2IRUA 4PXEA 4WBFA 2ZVIA 2V4RA 3I56S 1KFDA 2FYXA 2YXLA 1VHFA 3A8IA 4NLWA 4ITSA 2GQ2A 3J7YI 4DCJB 3MR3A 1S4EA 3MCMA 5DO2A 1GEHA 2KFZA 3CJRA 1IBCB 3G6VA 2ZC4A 4ECUA 3GYNA 4ZVSB 4NXNF 4NMLA 5K8NA 2YNGB 4ZJQA 1TAUA 1VFJA 3W5YA 2KTQA 4DV4J 1A0OB 4OYOA 2BUNA 5KFFA 3JYTB 3GFYA 1F9FA 2FY1A 1RLCL 3T5LA 2QX0A 2HNZB 3A1YG 3GPAA 2JHEA 4QU6A 5I3PA 1W26A 2PMHA 1RBLA 2Y1IA 1NHUA 1X4BA 4LRFA 1VRUB 2AGOA 3F44A 4ZMMA 4ELTA 3BKFA 5F9LA 3JAMU 1T03B 2VV5A 5A0YA 5JJBA 4MKYA 2IMOA 5E3RA 2WBRA 4OX6A 1L3TA 1UEKA 3TQ1A 2GMLA 3EGNA 3DLLQ 4DUYJ 2YQ3A 2R9LA 2XMTA 4J9SA 2JWNA 4AL7A 4F4KA 4MFBB 4O4GA 2ZNZA 2JOQA 4KT0C 3QFHA 1ZPWX 1VK8A 1S6PA 1J27A 1LEOA 1HLWA 4FPRA 4CO3A 1JJ4A 4DEZA 1SKRA 4J9NA 1T8EA 4A47A 2YKNA 2BE2A 2UUAJ 5H9FK 1FXRA 3BGRA 3CGIA 1ZTWA 4JV1A 4I6YA 1ITPA 2E5GA 3T1YJ 2ZHOA 1TR0A 4PUOA 4NLQA 1I1GA 1IXKA 1SH2A 1X4GA 5KFGA 3BGLA 2J0SD 5DDOC 4JV0A 1RWVB 3JSYA 2V6AA 5L8RC 2VU5A 3LUYA 4BWMA 1A6LA 3GYGA 3HHKA 2DGQA 3EMTA 2Z30B 1EETA 4DV5F 1MMNA 2RRBA 2E9RX 1IKVA 1Y11A 3ZZZA 3C46A 4M94A 2ZC3A 3LQVA 2W9CB 2ZEJA 4JI3F 2IM2A 1AYEA 3W5XA 2YQ0A 1FJCA 2ZH2A 3CD5A 3JQJA 1HI1A 2ZBQA 2BOAA 1TKZA 1JJCB 3CF5Q 2W7AA 4LFCF 2OFHX 1NK6A 2EFOA 2ZNYA 1NHKL 3IS9A 5HVFA 1PYSB 3OL9A 4FBTA 3MOZA 2KG0A 4ILRA 3P96A 4UOCA 4DSFA 2VZ9A 4P74A 3DLEB 4RNNA 1UFKA 5U47A 4RR5A 1HQ2A 2GO9A 1B7FA 5B08A 3QT8A 2ZH6A 4IQMA 5CD4H 1T9XA 2EW9A 4DF4A 2OPQB 4LF7F 4UOFA 3W62A 1RT7B 5T14A 2KHDA 4K4VA 2VFVA 1IN0A 1R43A 2BW7A 1WI8A 4DR2F 1LW2A 4USUA 1R0AA 1BD6A 2GHPA 4L3NA 2OEKA 2MQPA 3C66A 4XPEA 3BPDA 3H2UB 4Q43A 1CJVA 2KZZA 1WTBA 1NPPA 3O44A 1WKKA 5F3TA 1NDCA 5E3AA 1WEZA 3ZO7A 4ZCLA 3H20A 2OEJA 1DQAA 3DOMB 1RHUB 1IKYB 1PYTA 2ZKTA 3MR5A 4BWJA 2MYFA 4MKVA 2Y0BB 3EM1A 3KK1A 1HYSA 3G8TA 4F26A 2Q6BA 2VKZG 4B9TA 1S6UA 3L3CA 2DXDA 4ZLLA 1KBRA 1B70B 5A0YB 3L4BC 5KG6A 5KFAA 3R5BA 1NK5A 4O0NA 2FHOB 3K5LA 1U1KA 4OIXA 1LKZA 2GQCA 1JLCA 3DDKA 3I4PA 3OL8A 4RBTA 4LIRA 4CLTA 3M1VB 4F4YA 2Q3PA 2H9ZA 1HNVA 4RWWA 4A8WA 1YQHA 1G7CB 5AJ3F 4KRWA 3PYEA 4LIWA 1S6PB 2FC9A 1SJRA 1ZAVA 2KRBA 3BV8A 3DRPB 3HP6A 4WCEQ 3V6DB 4LF2A 1H98A 1IJEB 2P9GA 1TU0B 2G0JA 8RUCA 1PG5B 2IBOA 3VVTA 1UJ6A 1YWXA 1F6TA 1CVJA 3A8KA 3BM7A 1J5OB 4IRKA 4PUOB 2YWFA 3QGIA 1X5TA 2DKOB 2R8IA 1WEYA 1PGZA 4AXIA 5DGBA 5I3UA 3LP1A 2YBVA 3VAHA 2DEIA 4A4JA 2KXFA 2V67A 3MAAB 1NCLA 3HHLD 2EFNA 3A8EA 2HZCA 3R1LA 1BLUA 1B0TA 4C8MA 2QZ8A 5IV4A 4OV6A 4P2SA 1XC9A 1QTMA 4DV0F 1U8WA 2K7JA 3RBEA 1IKVB 4O3SA 2M70A 2C2EA 1SXLA 2I1RA 4KO0B 3I0SB 1HD1A 3I4HX 2VBXA 3KWMA 3PRVA 1RWUA 2PDAA 9ATCB 2JC1A 3B4MA 3LPYA 2E1AA 5CZVA 1R8BA 5HP1A 4NZ7A 2VQEF 1FO1A 4OHWA 1QD1A 3F56A 2DNLA 4P9SA 2RB7A 5GAEU 2AJ2A 1RXOB 4DU7A 3QATA 2BE7D 1S7HA 2DHXA 1UVIA 4TY8B 5K5MA 1FNXH 1J5EF 1B4SA 3CCES 3D1QA 3JS9A 6FDRA 4PG5A 5KG4A 1FXLA 3CCSS 4ZVHA 2UUCF 3W9JA 2VG7B 2R3VA 2BYCA 4O3QA 1KTVA 2XLKA 2A6OA 4J5OA 1AXQA 1YSJA 3CJ4A 1T9UA 3KDNA 1IVZA 1SUQA 3R9LA 3I31A 2BX6A 3M4XA 5MAOA 3M8SA 1QSLA 4KHPF 1NDPA 5F8IA 2VQFJ 5SUHA 4RL1A 4CYUA 4B3MJ 4IQXA 4Z2XA 3A3PB 4MK9A 1S1VA 5HI7A 1N5VA 1HR0F 2KVIA 2NREA 2GV1A 4OL8A 1D9AA 1VGYA 3BSAA 3T1HF 1HW9A 2RKIB 4Q5VA 4KH0B 3QO9B 4Y2MA 4OI2A 5JMNA 3KK1B 3FFIB 4RW7A 1RUSA 3QWPA 4P52A 4XTTA 3HFVA 1U6FA 1C1CA 3A3OB 5J2QB 3FMWA 3E01B 3R8YA 1Q1KA 2DNMA 2CADA 2NXJA 3T9NA 4B9VA 2KM8C 3R27A 1JLCB 4LF7J 1N6QA 2XC9A 5LXRA 4CI0B 2DY9A 3M2RA 4C0BA 2DT9A 3MUVP 2ZBCA 1QE1A 2MHEA 3Q2SC 4KGMA 4DI6A 4OZ3A 1T9YA 4DQRA 2HBZB 3K59A 3N01A 3MXHP 4ZCIA 1RTJA 1NK8A 2F8EX 1AZSA 4ZN1A 3NGKA 4CO5A 3LANA 2ZHAA 5DQIA 1KEKA 3RBXA 5L9XA 3UCZP 1RKJA 5CZXA 1M5SA 3SBMA 1VQ6S 3AA8A 2R2UA 4V19X 1REVB 1WOSA 2Y0SD 4G3IA 2CPHA 2HS3A 5G4DA 1JLQA 2E1RA 1JNRB 1APSA 2ZM6F 3PW4A 4F7VA 4QJVA 3SDEA 4C11A 4J9OA 3J81j 5T7LA 1UVLA 2RRAA 5DZ6A 4M5NA 5I42B 3TX0A 2JJ4D 2QLXA 3OXLA 2LQ5A 1YG0A 3VQSA 3SV3A 3NNCA 1N5QA 2YKMB 3NAIA 2CPZA 1BQMA 4M63A 1LK7A 1EX8A 2FLNA 2J9CA 4DZDA 3OLBA 2JLEA 4NI2A 1RGVA 4TYBA 2PI4A 5E3CA 5AJ3J 5HMZA 4M95A 1NK7A 4WKYA 5HP1B 2E1PA 3BB5A 2CPFA 5D0EA 1GXTA 3JSBA 3CCTA 2B9YA 4DOZA 4F67A 1OSDA 2W7PA 2EFPA 4IYQA 4F0KA 1N33F 5ADZA 1WC5A 1HARA 4OYPA 1WACA 2CJKA 4JI5F 2ZH8A 4DR6F 2W2QP 3P3DA 2AQ4A 5SZTA 2Z2ZA 1S76D 1KVJA 5E7OB 2WBMA 1TTHB 4KBIA 4B9NA 3AY0A 5GAGI 4J91A 4RJVA 1N32J 2V9WA 5HJYA 4Y0FA 5ETVA 1CJKB 4TQRA 1CULA 4OYBA 3GV7B 2RHSB 1RTZA 3Q0AA 5DDPC 3RRGA 2JEJA 3HFKA 4QYRA 3SSSA 1SUQB 4Z7CA 3WHIA 2R8HA 4QIFA 3MMAB 3BKTA 2ABYA 3ILOA 2DCLA 1OSCA 3UQSA 1P27B 4KKOA 1PAEX 2VQEJ 1YHQS 2UUTA 4NYPA 4CLPA 2E5HA
chains in the Genus database with same CATH topology
4EK2A 4C6AA 1BE4A 3VVTA 5IOLA 1PKUA 3ELHA 1WKKA 4CP5A 2B8QA 4DUTA 1F6TA 3DKDA 1XQIA 1S59A 1NDCA 3ZTSA 4ENOA 5BXIA 1BHNA 1NHKL 3ENAA 3FBFA 2HVEA 3ZTQA 3PJ9A 4KPCA 1K44A 3Q83A 3VVUA 3B54A 1F3FA 2HURA 3ETMA 1NSQA 3GPAA 1MN7A 3DDIA 2HVDA 1XIQA 3Q8UA 2DXEA 1ZS6A 3EJMA 1NSPA 3EM1A 4HR2A 2CWKA 1NLKL 3EE3A 4ANEA 3B6BA 3BBBA 1KDNA 1NDKA 3EICA 1VYAA 2AZ3A 3FCWA 3VGUA 3NGSA 1MN9A 3VGTA 2DXDA 2DYAA 3FKBA 3NGUA 1NSKL 5CABA 1B4SA 4UOGA 1LWXA 3Q86A 3JS9A 3NGTA 1HIYA 1NCLA 3Q8VA 1NDLA 3BBCA 2DXFA 3EVOA 3EVWA 3Q89A 4ANCA 1EHWA 1NUEA 1NB2A 2VU5A 2ZUAA 3GP9A 4O0NA 3FC9A 3VGSA 3Q8YA 4S0MA 2NCKL 3G2XA 4WBFA 1S5ZA 3EVMA 3ZTRA 2DY9A 3EMTA 3VGVA 4F36A 4UOFA 5CAAA 3MPDA 1U8WA 1S57A 3BH7B 3ZTOA 3NGRA 3L7UA 3FBEA 3WX8A 2BEFA 4DI6A 3R9LA 5C7PA 2BX6A 1BUXA 1HHQA 1JXVA 3BBFA 1WKLA 1B99A 3FBCA 3PRVA 1NDPA 1W7WA 1WKJA 1PAEX 3BH6B 3FCVA 4DZ6A 4W98A 4ANDA 4UOHA 2B8PA 4FKYA 3ZTPA 2AZ1A 4FKXA 1NPKA 3FBBA 4F4AA 1LEOA 1UCNA 1HLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EK2 A;  4C6A A;  1BE4 A;  3VVT A;  5IOL A;  1PKU A;  3ELH A;  1WKK A;  4CP5 A;  2B8Q A;  4DUT A;  1F6T A;  3DKD A;  1XQI A;  1S59 A;  1NDC A;  3ZTS A;  4ENO A;  5BXI A;  1BHN A;  1NHK L;  3ENA A;  3FBF A;  2HVE A;  3ZTQ A;  3PJ9 A;  4KPC A;  1K44 A;  3Q83 A;  3VVU A;  3B54 A;  1F3F A;  2HUR A;  3ETM A;  1NSQ A;  3GPA A;  1MN7 A;  3DDI A;  2HVD A;  1XIQ A;  3Q8U A;  2DXE A;  1ZS6 A;  3EJM A;  1NSP A;  3EM1 A;  4HR2 A;  2CWK A;  1NLK L;  3EE3 A;  4ANE A;  3B6B A;  3BBB A;  1KDN A;  1NDK A;  3EIC A;  1VYA A;  2AZ3 A;  3FCW A;  3VGU A;  3NGS A;  1MN9 A;  3VGT A;  2DXD A;  2DYA A;  3FKB A;  3NGU A;  1NSK L;  5CAB A;  1B4S A;  4UOG A;  1LWX A;  3Q86 A;  3JS9 A;  3NGT A;  1HIY A;  1NCL A;  3Q8V A;  1NDL A;  3BBC A;  2DXF A;  3EVO A;  3EVW A;  3Q89 A;  4ANC A;  1EHW A;  1NUE A;  1NB2 A;  2VU5 A;  2ZUA A;  3GP9 A;  4O0N A;  3FC9 A;  3VGS A;  3Q8Y A;  4S0M A;  2NCK L;  3G2X A;  4WBF A;  1S5Z A;  3EVM A;  3ZTR A;  2DY9 A;  3EMT A;  3VGV A;  4F36 A;  4UOF A;  5CAA A;  3MPD A;  1U8W A;  1S57 A;  3BH7 B;  3ZTO A;  3NGR A;  3L7U A;  3FBE A;  3WX8 A;  2BEF A;  4DI6 A;  3R9L A;  5C7P A;  2BX6 A;  1BUX A;  1HHQ A;  1JXV A;  3BBF A;  1WKL A;  1B99 A;  3FBC A;  3PRV A;  1NDP A;  1W7W A;  1WKJ A;  1PAE X;  3BH6 B;  3FCV A;  4DZ6 A;  4W98 A;  4AND A;  4UOH A;  2B8P A;  4FKY A;  3ZTP A;  2AZ1 A;  4FKX A;  1NPK A;  3FBB A;  4F4A A;  1LEO A;  1UCN A;  1HLW A; 
#chains in the Genus database with same CATH topology
 3T41 A;  4TKT A;  1KD1 T;  2IM3 A;  2Q43 A;  3JSM B;  2AEF A;  3QLH A;  3QIP B;  3MAQ A;  4PQU A;  4WTO B;  1K73 T;  1FRH A;  1UEU A;  2VPX B;  3IWX A;  4UY8 5;  2DIS A;  3OSP A;  4Y65 A;  2ASL A;  4OI1 A;  4RWX A;  1H73 A;  2N4D A;  2JEF A;  2HLT A;  2UUC J;  8ATC B;  1IM6 A;  4Y2I A;  4P7V A;  2R2S A;  1UFL A;  4ZPA A;  1QLN A;  2ACY A;  1Q5Y A;  3MUT P;  1R89 A;  1RTJ B;  3IRX A;  2UP1 A;  2D7S A;  4KHP J;  1U2C A;  1G1X A;  4ED1 A;  2WTF A;  4WTY A;  2CJA A;  3UN3 A;  1VDH A;  4U9R A;  3TA1 A;  4A46 A;  5KT3 A;  4ZVQ B;  4U6P A;  1FRI A;  4RO0 A;  2NXC A;  4FKX A;  3R3T A;  3DCA A;  2JLF A;  5KFK A;  2GVD A;  2RAQ A;  1MRO B;  3EUN A;  2ADC A;  2C2R A;  3C16 A;  3C8Y A;  3CO9 A;  4LRC A;  4K4W A;  2A0F B;  1JLQ B;  3PM9 A;  4ID5 A;  1JLE B;  1MML A;  2P5V A;  1XR7 A;  5T7L B;  1WI6 A;  4RW6 B;  2QFJ A;  3MM5 A;  1IUJ A;  3KLI A;  3O2I A;  4F25 A;  1RAI B;  2A1B A;  2D41 A;  4OYI A;  3JAM Y;  4NLS A;  3W1Y C;  3HJV A;  1X7V A;  2VG6 A;  3EVO A;  1EQ0 A;  5IQ6 A;  2DO4 A;  5I3Q A;  4JI2 J;  3R2C J;  5T41 A;  4KAI A;  3FK4 A;  2RIL A;  3TWZ A;  3M8Q A;  1FFS B;  2M52 A;  2E29 A;  3FNN A;  5LT5 A;  2NR0 A;  5M2R A;  1VJW A;  3W61 A;  1TUG B;  4UZC A;  4W98 A;  5K20 B;  3OTO J;  2HGM A;  4EWT A;  2R7U A;  2F4F A;  2L08 A;  5KFL A;  4FS2 A;  3QID A;  2L3M A;  3D6T B;  1N4L A;  3US5 A;  3PG9 A;  2MZJ A;  4NLO A;  1O0P A;  4HTJ A;  5B0G A;  2MKJ A;  3CIM A;  3QT7 A;  5IOL A;  4HTI A;  4CZC A;  3DLK A;  4FBU A;  1PJ7 A;  4ZVP B;  3H8Y A;  2J5A A;  4DFJ A;  3T5K A;  3M8W A;  3PHE A;  1MWQ A;  3I82 A;  3UVJ A;  4K50 A;  5B0C A;  3KJV A;  1Y3J A;  3IBF B;  2AGP A;  2Z57 B;  4DFM A;  1BGX T;  2DBB A;  4M5G A;  2IA6 A;  1X31 C;  4UF4 A;  2C42 A;  3LTO A;  3BF4 A;  4J9P A;  3I9V 9;  3KMS A;  3KMQ A;  4IR9 A;  5FJ4 A;  2I9S A;  2CPE A;  4LSN A;  3CJT A;  2DR6 A;  2GC8 A;  2DGS A;  5HQ8 A;  3U02 A;  2OPR A;  2ROE A;  1CQN A;  2W2M P;  2QO3 A;  5EN1 A;  1R8H A;  2A3J A;  4RUB A;  1K8A T;  4KKO B;  3BSN A;  2VC1 A;  3KUH A;  4TN2 A;  4DJB A;  3TUZ C;  1MMD A;  2YNF A;  4DR4 J;  4WK1 A;  1UP1 A;  4LF8 F;  1G6B A;  1IBK J;  1R8P A;  4XAK A;  3OR1 A;  3TVZ A;  4PQU B;  3VAJ A;  4L74 A;  4ENO A;  1LOU A;  2OP5 A;  4LFB J;  2Y3Y A;  4Q2M A;  1C0T B;  2PGC A;  1JQG A;  4IO1 A;  4X4U A;  5EUH A;  2RU3 A;  4GKK J;  1T9W A;  2HHH J;  4OYM A;  1VQL S;  3B6B A;  2UXC F;  4WFA Q;  4X4T A;  5DQH A;  3MMB B;  2C3U A;  3GWC A;  1VBK A;  1CSJ A;  5K14 B;  2E44 A;  2FZG B;  4G1P A;  4TVA B;  4Y00 A;  2W9A A;  3GQC A;  2YKO A;  6FD1 A;  2ZJR Q;  3G6Y A;  3LGH A;  1FF2 A;  4IKA A;  2K06 A;  4NLV A;  1A7G E;  2H3E B;  2Q6C A;  2KB2 A;  1S72 S;  5CYQ A;  1HWU A;  4RW4 B;  4WP3 A;  3OTB A;  2COL A;  3ZTO A;  3NGR A;  3D1H A;  2LU2 A;  3MEK A;  4URS A;  5KFS A;  3THV A;  3LA0 A;  4ER8 A;  3CJK A;  2CQG A;  2YX4 A;  2GVD B;  2OLW A;  1EAY C;  5KTQ A;  2QMX A;  2R7S A;  1JLB B;  4IFY A;  1FTR A;  3UE2 A;  3J7Z T;  3C16 B;  2LQJ A;  1S1X A;  4LSL B;  4BC7 A;  4KTQ A;  5L9N A;  1VBZ A;  5AE1 A;  3PIO Q;  5F0U A;  4ID5 B;  3UO0 A;  2HK2 A;  1FD8 A;  2L9N A;  1S59 A;  3ZTS A;  3MM5 B;  3DLG A;  5K9F A;  1IR1 A;  2NZC A;  3FEX B;  1GT8 A;  3KLI B;  3PTW A;  2P9E A;  5DG7 A;  2HQD A;  2NZ4 A;  2R2T A;  3QPI A;  1CS4 B;  2XTJ P;  1TK8 A;  1VBX A;  1N54 B;  2AYM A;  4KB7 A;  1RWO B;  1U02 A;  2WSC C;  5HJX A;  1M5K C;  3PW2 A;  1KFS A;  1GXL A;  2QEX S;  1V5I B;  1FVQ A;  1VQ5 S;  4G1Q B;  2DY1 A;  2HLU A;  2ZE2 A;  2B51 A;  2CAJ A;  5LJ3 Y;  1JNZ B;  2MY7 A;  3MM7 A;  3AOB A;  3L09 A;  2DNP A;  2AJ0 A;  1B0P A;  4ZKA A;  1YJW S;  2HQC A;  4CLK A;  2HHU A;  4C48 A;  2K3K A;  5ETQ A;  1KKH A;  3IC1 A;  4N8O A;  5CYM B;  4DL0 C;  3DLK B;  2FJW A;  2CQ3 A;  2AYB A;  1QY7 A;  4A8X A;  3HVT B;  3KJV B;  2ZWO A;  1OY9 A;  2ZH7 A;  3MR2 A;  4CQ1 A;  3VAG A;  3HT3 A;  1JXE A;  1DRZ A;  3FSI A;  4CIO A;  1F1B B;  2A2D A;  3GE9 A;  1NSQ A;  3RB0 A;  1X5S A;  1FE4 A;  4J9M A;  4B3S F;  2KYX A;  2CZ9 A;  2VFT A;  2BAC A;  2NXU A;  3EIC A;  4H4M A;  2DTJ A;  1S6Q A;  3Q24 A;  1SL1 A;  4F50 A;  1HWK A;  3ITH A;  5DM7 Q;  1NDL A;  2HFU A;  3SI8 A;  1T7P A;  1NUE A;  1ACM B;  4URG A;  1QUP A;  1TVR B;  2YWH A;  2FZK B;  5LXY A;  4L75 A;  2YNH B;  5D4N A;  1RT3 A;  3ENW A;  3PW0 A;  2XMA A;  1DLO B;  4NYZ A;  5AXK A;  5LMU F;  2BRL A;  4IH6 A;  4JBC A;  1BQX A;  5A76 A;  4OHX A;  2N82 B;  1VQ9 S;  2YNF B;  2BM1 A;  1WF1 A;  2HHX A;  3PFE A;  2G13 A;  3OR1 B;  1YX2 A;  2WVB A;  3MTK A;  3MWB A;  2WOM A;  1U6B A;  2DNG A;  3CT9 A;  1J2V A;  4JV5 J;  3BGF A;  4PZV A;  2FVC A;  1NM2 A;  1AFJ A;  2HRT A;  1N36 F;  2BZ2 A;  1RQ0 A;  1GMU A;  4M5J A;  1FE0 A;  1N34 J;  2MQQ A;  1KWM A;  3UNG C;  5A2Q U;  2CWX A;  3P6Y C;  2VFU A;  1TL7 A;  1LWX A;  3DRS B;  4PXC A;  3AJD A;  3QJL A;  4RPF A;  4H4K A;  3PX4 A;  2H1Y A;  4CO1 A;  5CYQ B;  4LR9 A;  2NUH A;  5F9N A;  5FII A;  1R27 B;  1I51 B;  2W4C A;  1CQM A;  2GO8 A;  1RYS A;  1SJ3 P;  4C8Y A;  2QFI A;  4LF8 J;  3PJX A;  4ZPB A;  3HHL C;  4P2X A;  2EPI A;  4UQG A;  2DD8 S;  2QE5 A;  1K0V A;  5GMD A;  1OPI A;  4OX9 J;  4HH1 A;  2UXD J;  3DKD A;  1CJU B;  1HMV B;  3I0R B;  2JEI A;  4IOA Q;  2LP4 A;  3SQG A;  3R7N B;  1FVS A;  3UR0 A;  1F3F A;  4ECV A;  1RHJ B;  5IQQ A;  1IBM F;  3LOU A;  1RAO A;  4LBI A;  2X1G A;  3QRP A;  1FKO A;  2GNK A;  4I6W A;  3CJ0 A;  1C1B A;  3QT6 A;  2VHG A;  1NKE A;  2AV5 A;  3TJ9 A;  1HBM B;  1R0B G;  3SCL E;  2D9P A;  4RNF A;  3EVW A;  3GSD A;  1DFD A;  3FRZ A;  5KFM A;  5F3Z A;  2W9B B;  2CQI A;  1RT6 B;  4O3R A;  3GFX A;  4ED7 A;  4U96 A;  4F02 A;  2NS1 B;  3FZB A;  3B4D A;  3H5X A;  1S9G A;  1NK0 A;  3GIR A;  3PO5 A;  3HD1 A;  4X4R A;  4IUF A;  2JZ5 A;  2NQP A;  1YBU A;  3MMC B;  1BUX A;  4J90 A;  3BBF A;  1B99 A;  2WAQ D;  3MF5 A;  2EI5 A;  4A8O A;  1N52 B;  2BM0 A;  1PBU A;  2FJA B;  3W64 A;  3ZTP A;  2HGL A;  3BQ0 A;  1VK3 A;  3ETO A;  2ZVS A;  3UPF A;  3N79 A;  4NL5 A;  1QSS A;  3NLC A;  2VDI A;  1R0C B;  3NOC A;  5KT2 A;  2HVI A;  3F41 A;  5BXI A;  2GQQ A;  3W9H A;  3SCJ E;  3KJN B;  1SKU B;  2F4V F;  2HVD A;  2CWK A;  3CIZ A;  3ITH B;  3TAN A;  3VGT A;  2PT0 A;  3R7B B;  3Q22 A;  3LF0 A;  4WFN Q;  1RSC A;  1X9S A;  3BYP A;  2HMI A;  2MJN A;  1VQP S;  2LXI A;  4I2P A;  3SCK E;  1T95 A;  1JWW A;  4LF9 F;  4LFA F;  1I6J A;  2VG5 A;  4NZ0 A;  3TQE A;  2RS8 A;  3RAM A;  1XMO J;  4QCL A;  3D67 A;  2O67 A;  5JVH Q;  1Z2L A;  3HXM A;  1HHT P;  3RRK A;  2J6S A;  2C1E B;  4EI2 A;  3OVB A;  1P1L A;  2ZH5 A;  4ERD A;  2IYG A;  2VAS A;  2B8P A;  1UWB A;  4ELV A;  2V4Q A;  3NY0 A;  3CD0 A;  3C15 A;  3LGN A;  1YJ9 S;  5KFP A;  2HHW A;  4KY3 A;  3DOL A;  3VAM A;  1X4H A;  2CPD A;  3VF0 B;  4YN3 B;  2QL9 B;  3MI7 X;  4P2M A;  1HKA A;  4B3S J;  2XMU A;  5KG3 A;  4NCB A;  3DC2 A;  3QZ8 A;  3TEG A;  1RAD B;  1ZH5 A;  1RZM A;  3BRE A;  3HHD A;  4FYV B;  4MIB A;  3LPE A;  4OZ2 A;  3PVX A;  2QSF A;  1B0V A;  4JYA F;  4H4O B;  4ZS6 A;  2UU9 F;  2BJ1 A;  2MQO A;  4I64 A;  1FKP B;  3CO0 P;  5GAH U;  4DV2 F;  2V4J A;  3C3L A;  1S7I A;  3HSD A;  4DX5 A;  3IN5 A;  2FVS A;  2PC6 A;  2FVR A;  5LMU J;  2ZUG A;  3AJ2 A;  4DR3 F;  5F8M A;  2SXL A;  3DRR B;  4LR7 A;  4B17 A;  4N8N A;  4TU9 A;  1X60 A;  1Q8K A;  4N7T A;  1GMV A;  1HL6 A;  2HQG A;  2CJ9 A;  2VC0 A;  4IFV B;  4MH8 A;  1VMB A;  4UQT A;  2Q79 A;  2J6U A;  1Q79 A;  5J1P A;  3CW2 C;  1T0T V;  5DQG A;  3CED A;  1PKU A;  6AT1 B;  2HFN A;  4Q8F A;  3LAK A;  4B3O B;  1Z2Z A;  3NEK A;  2ROG A;  1U26 A;  1WTF A;  1N36 J;  4X66 F;  2H4W B;  3W2W A;  1LK5 A;  4N56 A;  1NSP A;  1C1B B;  2D69 A;  4TXS A;  4LRA A;  3M8R A;  3VGU A;  4HL9 A;  2DYA A;  3UDL A;  3FUY A;  2I6W A;  4OZN A;  3QSI A;  1JJ2 R;  2NXE A;  1VIO A;  3HKW A;  1IKW A;  4PWD A;  2BJD A;  4DG1 B;  3OJU A;  1ZET A;  3GU0 A;  3M6V A;  2CNN B;  1RYR A;  2RF2 A;  2YX1 A;  3S6E A;  2OHD A;  3HK2 A;  5KOW A;  4ETZ A;  1XJW B;  1WF0 A;  1N56 A;  2YH0 A;  2MLY A;  3L7U A;  2XYH B;  1EQM A;  5KAK A;  4WFY A;  4LT6 A;  2VJV A;  3M6W A;  1NKB A;  3C19 A;  2OI2 A;  2BQU A;  2RRN A;  3K7R A;  3PRD A;  3BZQ A;  4MTP A;  4KGV B;  1WWH A;  1RA7 A;  3H7H B;  5HAT A;  4NLG A;  4PYA A;  2FGC A;  2ALY B;  3K17 A;  1Q0N A;  3W66 A;  2Z4P A;  5EWG A;  2XUL A;  2HVE A;  5KFD A;  1Z1Z A;  5A8K A;  3GYX B;  2UVR A;  4RLE A;  2HRY A;  4UW2 A;  2QMW A;  5D3G B;  2Z2L A;  4QQB A;  5C25 A;  3ENQ A;  3MEC A;  1DTT B;  2CNL B;  2X7I A;  1QAJ A;  4GVB A;  3MTJ A;  3KNG A;  1RT5 A;  1SL0 A;  4PG4 A;  3VGS A;  4IOB A;  1WG5 A;  4QU7 A;  4FXV A;  3BR8 A;  4HDH A;  3ET6 A;  4QIW D;  2AW0 A;  2B6A B;  2R7W A;  4JB8 B;  3I5B A;  3PKY A;  1HBU A;  1AFI A;  1UKU A;  1SIW B;  3D0G E;  2XZT B;  1LWF A;  4NLX A;  1IR0 A;  3C15 B;  1CG2 A;  4RW9 A;  3MCO A;  1S1T B;  3D54 A;  1AUD A;  3DOL B;  2BBE A;  2VJU A;  4ZPT R;  4TU8 A;  1RT1 A;  1WDD A;  4HHH A;  1DBD A;  3R5J B;  4QR1 A;  5B0A A;  1QVG R;  3OTE A;  5LMN F;  5A6W A;  1YDL A;  2F5G A;  1X4E A;  1PAU B;  4JI6 F;  4W92 B;  2KI2 A;  2QA4 G;  1WSV A;  3BJY A;  4MYT A;  2GGP B;  5K8M A;  3RRH A;  1BC6 A;  4ES2 A;  1T94 A;  1HNX J;  4CNY A;  2WVC A;  3DXS X;  1S1W B;  3CVK A;  2GS8 A;  1U49 A;  4ZCM A;  3TO8 A;  2KFY A;  1EJ7 L;  5GAE I;  3A3N B;  5IT9 U;  1WC6 A;  1P1T A;  5CCL A;  3MM8 A;  4O4R A;  1KHW A;  2JFD A;  4FVC A;  2CVE A;  4B3T F;  2LFV A;  5K8O A;  3HI9 A;  3MED A;  2CQC A;  2OEL A;  5ETO A;  3KHR A;  4NLP A;  5AXL A;  3CJ2 A;  2M8D B;  4NLT A;  1RHR B;  1T3O A;  4DZ6 A;  3R5C A;  1Y7P A;  3BS9 A;  4EO6 A;  1ZAX A;  2XGP A;  1VIS A;  3TAP A;  2VFR A;  1H2U X;  1DTQ B;  2M0G B;  2IIH A;  1RWX B;  1KQK A;  4OI6 A;  1KVK A;  3LAM A;  1HNZ J;  4WK3 A;  3HCX A;  4YP3 A;  3W2W B;  2BOP A;  2OMO A;  3CWJ A;  3VZI A;  3M8P B;  4C7Q A;  2IDL A;  2BA9 A;  4B08 A;  1NU4 A;  3HKZ D;  4JYA J;  1IKW B;  3N0V A;  4PPD A;  2G1D A;  2UU9 J;  3NGU A;  2BMB A;  2PI5 A;  1MSW D;  1Q5V A;  3EZO A;  1VC0 A;  3M2U A;  1RJJ A;  4ZVT B;  4IG0 A;  3HSG A;  5D0H A;  2RF2 B;  4X84 A;  4ED6 A;  2DNN A;  3U27 A;  2DIV A;  3ZTR A;  1D1U A;  4LVO P;  1HBN A;  1UZD A;  2XSJ A;  4Q44 A;  3LAL A;  3PJW A;  1UJ5 A;  1KQS R;  3K0J A;  3GIL A;  3C6T A;  2H5E A;  5HO4 A;  2IBK A;  4YOE A;  2UV8 A;  1G4C A;  2E5L J;  2XZD B;  2MPU A;  3SEO A;  3K57 A;  3H2L A;  2WVE A;  1XQI A;  5BYQ A;  3TRG A;  3VV2 B;  5A8K B;  2P2C B;  1X5O A;  2BW2 A;  2R7X A;  3TX8 A;  1Y9O A;  1RP5 A;  2CA9 A;  5ETK A;  1F9E B;  3DDI A;  5C25 B;  2XCP A;  1KTQ A;  3JTN A;  2IFX A;  4XK8 C;  3NNA A;  2BDP A;  4RZR A;  3KHG A;  2CZ4 A;  4QPT A;  4NCA A;  2YWE A;  2J7U A;  2IM1 A;  5KG7 A;  4C8N A;  2WSE C;  1H2V Z;  2HHS A;  1IWA A;  3N6M A;  4NLU A;  4YY3 F;  1S0O A;  1WD6 A;  2HNY A;  5IV3 A;  5D0R A;  1HBU B;  4ECS A;  1Q16 B;  4M5M A;  5IWA J;  4DLE A;  1DHM A;  4JI1 F;  4X64 J;  2HBR B;  1LWF B;  1RAA B;  5H1S V;  2H51 B;  1K9M T;  4RW9 B;  2CDR B;  4M5I A;  3VAK A;  4DL5 A;  4UOH A;  3GZ7 A;  2OSQ A;  1M5P C;  4FKY A;  3NCP A;  5L1K A;  4X62 J;  3KOA A;  1LWE A;  3G8Q A;  3OW2 R;  2ILY A;  2FDN A;  3AB2 B;  1XNR F;  2GIQ A;  2HNZ A;  1DQ9 A;  4HAC A;  4LVN P;  5CHC B;  5CH7 B;  3PX0 A;  2ZH1 A;  4ZVU B;  1VRU A;  2HK3 A;  2GHV C;  4FYW B;  2PFF B;  4LF5 J;  1XR6 A;  3TUJ C;  5HLF A;  1T03 A;  1Q8L A;  1K1S A;  1VCT A;  3BGU A;  3J80 U;  3V6J A;  4CLS A;  4JP8 A;  2DGT A;  1NSK L;  3AAW B;  3I87 A;  2UUW A;  2V9K A;  4JI7 F;  4U95 A;  4LF1 A;  2KT2 A;  1I94 F;  1RT2 B;  3NAH A;  3DI6 B;  1SV5 A;  4OI3 A;  4ECT A;  2MZS A;  2YKQ A;  3A12 A;  3RR8 A;  4HHJ A;  2OJ3 A;  4N47 A;  2DIU A;  4OI4 A;  1YRT A;  1CEZ A;  1HQE A;  2HW3 A;  1XMQ J;  1TFW A;  1WSR A;  3BO2 A;  4CO0 A;  2EKY A;  3WX4 A;  4ZIW A;  2VPW B;  1TK5 A;  1HQU B;  2L48 A;  3G4S S;  3Q23 A;  3JB9 k;  2HIQ A;  4OHY A;  4ZPD A;  5RUB A;  4GO7 X;  4Z37 A;  1YRX A;  2JSX A;  5LMN J;  4YR2 A;  4XO0 A;  1XNQ F;  4JI6 J;  4ZN3 A;  4LJM A;  2GFF A;  4DF8 A;  1S9E B;  1X0F A;  4IRD A;  1TAQ A;  2W25 A;  2BJ8 A;  4PG6 A;  3NNH A;  2EC0 A;  5A2Q Y;  1JXL A;  2HAF A;  2XB2 D;  1YK9 A;  3NMA A;  3D66 A;  1QAY A;  3K5N A;  3CUN A;  1BWV A;  4J9U E;  4JI4 F;  2XYG B;  4PXD A;  1V6H A;  2ZBR A;  3Q8Y A;  1FFW B;  1HBN B;  5GAD U;  4UST A;  3HDS A;  1UZH A;  4ZP6 A;  4AD6 A;  3IWL A;  1UW9 A;  3OVS A;  2QC3 A;  2W9C A;  4M5H A;  4ZVE A;  3QSY B;  5KFB A;  5IZH A;  5HN0 A;  4DV7 F;  2GVZ B;  2QGF B;  2LU1 A;  1FRK A;  2J6T A;  3D9B A;  2J9D A;  2C3Y A;  1LW0 B;  4TNO A;  4AND A;  2KXN B;  1FT8 A;  3F73 A;  2ZZM A;  5D6G A;  1N5Y B;  4CM2 A;  3O5T B;  1YJ7 A;  1VOM A;  1T05 B;  3HHL B;  2D3O R;  3D68 A;  3CJS A;  4CDI A;  4J9K A;  3TAR A;  2DJW A;  2R8J A;  1NKC A;  3OFH A;  1U24 A;  3FSY A;  2GHW A;  3EJM A;  2FZC B;  1RAG B;  3IO1 A;  1RTI A;  3M9M B;  3FCW A;  3CJ5 A;  5D8H B;  5KG0 A;  1TL1 A;  4RBV A;  2OPQ A;  4Q8E A;  2LQ9 A;  1RT7 A;  4UT4 A;  1JKH B;  1LFP A;  1U6Z A;  2UZA A;  3GMG A;  3OL6 A;  2GMH A;  1UA1 A;  2HNY B;  2DNR A;  1MLA A;  3GON A;  2R7R A;  4F36 A;  2W01 A;  4YME A;  1MU2 A;  4GKJ F;  4KPY A;  2AYE A;  1M0S A;  1W7W A;  1JLA B;  5JUM A;  4DSJ A;  2CQP A;  1LWE B;  2C3O A;  2CPJ A;  3MUM P;  1EB0 A;  4HAC B;  1OO0 B;  5J1E B;  1RWM B;  1U0H A;  2V5H G;  1IQZ A;  2QYG A;  3DOM A;  1IKY A;  4AQY F;  2KG1 A;  1NRK A;  5KG1 A;  2GAG C;  4Q0B B;  4R8U A;  2FQQ B;  1FFG B;  4ZJL A;  5HLF B;  3BQ1 A;  4KR0 B;  1V3Z A;  4EYI B;  4PPZ A;  2DNQ A;  1EKR A;  2B3T B;  2J0X A;  1F5B A;  3QWU A;  4X4N A;  4QIG A;  1MN9 A;  4BC9 A;  2JVO A;  3NS6 A;  4PAB A;  3SXL A;  1SV5 B;  1AUS L;  5KFT A;  2BJ3 A;  4YR0 A;  3M1V A;  5J2P B;  2DVI A;  3HSJ A;  3RTV A;  1HQE B;  4EUV A;  5J2N A;  4IR1 A;  2DGX A;  2ZDP A;  4C8O A;  1VQM S;  2MKK A;  3EWG A;  4RX6 A;  3JTO A;  4HT7 A;  5G0R A;  4QW8 A;  5KT5 A;  2YH1 A;  1BY9 A;  4DX6 A;  4ATN A;  3DU5 A;  3DRP A;  4DLG A;  3HM9 A;  1VJQ A;  3V6D A;  1SC6 A;  3PXG a;  2NPF A;  1YJV A;  2IVY A;  4RKU C;  1J5O A;  2RJZ A;  4OHV A;  2V8G A;  3I32 A;  5L38 A;  2CDQ A;  1Y3K A;  3AOA A;  5DDQ C;  1OS5 A;  2FVP A;  4ZP7 A;  3T19 A;  4LRB A;  1VRQ C;  3POT A;  2HRU A;  3MAA A;  3KJF B;  2B9X A;  2DHH A;  2A6M A;  2HQF A;  4U8V A;  3PO4 A;  3OV7 A;  2R7O A;  3D2W A;  4QYZ K;  2GA7 A;  1G3O A;  3BKU A;  4EEY A;  3T9Z A;  3KK3 B;  1WOR A;  2OPP A;  3TVK A;  2K3I A;  2PMZ D;  4KO0 A;  3I0S A;  5C42 B;  2GMJ A;  1TMJ A;  1KLN A;  2ZBI A;  4MT1 A;  5KFR A;  2L9W A;  3C14 A;  2POK A;  3VHQ A;  3OD2 A;  3SFU A;  3R5D A;  2ZWP A;  1GAO A;  3WX8 A;  2LXU A;  3ADA C;  4DMZ A;  4OYA A;  4WP8 A;  3R1H A;  2QJ3 A;  1SC4 B;  1YIT S;  2APO A;  4ZP8 A;  4TU7 A;  2ZIT A;  4QWC A;  2IY5 B;  2AX0 A;  4DHV A;  3N28 A;  2K1R B;  4TY8 A;  3E51 A;  1UL3 A;  4R5P B;  2DH9 A;  5B09 A;  1M90 T;  3SCI E;  3D28 A;  2MQN A;  4OZL A;  3UDE A;  2XI2 A;  2OUG A;  3CCQ S;  1UVJ A;  1Q4R A;  1RTI B;  3W3S A;  3AD8 C;  3CD6 S;  2M2B A;  5F41 A;  4ANE A;  4OV1 A;  2VG7 A;  1TL1 B;  1NME B;  4MIA A;  1BQN B;  4WF9 Q;  2BRK A;  1PO6 A;  5L39 A;  2XMV A;  3M2V B;  1IBL F;  2ZUA A;  3GFH A;  2DIT A;  2U1A A;  1MU2 B;  1NAQ A;  4ES3 A;  4DL3 A;  2OEM A;  3I55 S;  4DS4 A;  2M3D A;  2UVU A;  2WHO A;  1TKD A;  2V0N A;  4KQZ A;  5KFO A;  3PR4 A;  5B7W A;  3RAQ A;  2AMC B;  2ZOG A;  1OY8 A;  2MKC A;  2A18 A;  1U0H B;  5CYJ A;  2RKI A;  3QO9 A;  4C6A A;  2B4O A;  2E7X A;  3VAL A;  3FMB A;  4R8U B;  3DRX A;  3FFI A;  4DUT A;  4C8Z A;  4QWA A;  3PYD A;  3OXF A;  1UAW A;  1OJ4 A;  2PFD A;  1EAR A;  2VKR A;  2DNO A;  4NZ6 A;  2MQM A;  3W60 A;  3ZTQ A;  2J8S A;  1AA1 B;  5FDL A;  5J2Q A;  5IT4 A;  3E01 A;  4J37 A;  3TOQ A;  3IWN C;  3P45 B;  5GMK a;  2B9W A;  3G8S A;  1RCO B;  1RDR A;  5KFE A;  5ETN A;  2WCX A;  3PX6 A;  4EBE A;  2OKQ A;  1Z4U A;  3DMJ A;  2CQD A;  1FDA A;  3JXO A;  3MPY A;  3PR5 B;  1M1K T;  1D8Y A;  2HGN A;  4LBP A;  1F2H A;  1RWW B;  1DJ0 A;  4L3K A;  5J2N B;  4XDD A;  2ZBP A;  3UD5 A;  2IC3 A;  4NXN J;  4NEY A;  5G0R B;  1S12 A;  1EP4 A;  3MEE B;  2HZA A;  2F9J A;  3RJM B;  1WHX A;  3LO3 A;  4DFP A;  5F8N A;  1FWK A;  4PQA A;  5THW A;  1REV A;  1Y5N B;  2VDH A;  2MKH A;  1QJH A;  4F4A A;  2HWI A;  1F3V A;  1V5V A;  3IR6 B;  2HFZ A;  2VA2 A;  5D4P A;  2V2V A;  3POT B;  2M8H A;  5FLX Y;  2CQ2 A;  1R8C A;  3IAM 9;  2DNY A;  1OPZ A;  2B4V A;  1TP7 A;  4IO9 Q;  2J0W A;  1UTA A;  5I42 A;  3UCU P;  3Q8U A;  5KFJ A;  4K4Z A;  4E0D A;  2AZ3 A;  2YKA A;  4W4M A;  1SQG A;  1PYO B;  1WDT A;  2VON A;  2YKM A;  1HIY A;  2OPP B;  3MFH A;  4CM0 A;  3Q8V A;  4USW A;  4QR2 A;  2JL9 A;  1ZPV A;  3V5R A;  3IP0 A;  4HVZ A;  3DHX A;  2Y8W A;  5IT9 Y;  2Z8Q A;  3GP9 A;  3C14 B;  3ZZU A;  3TW0 A;  2AU0 A;  1JMT A;  1RAB B;  4DQI A;  4KGX B;  1KQG B;  1S57 A;  3VAI A;  2L41 A;  4YR3 A;  2RD5 C;  3AXM A;  1D09 B;  1KON A;  2O01 C;  2F8H A;  2K8G A;  4NYO A;  2G2Z A;  2QIF A;  4P2F A;  3BH6 B;  2ZKU A;  4I68 A;  2PII A;  1U1P A;  2H4Y B;  1JLG A;  5EGY A;  2XBP A;  4I2Q B;  3DN9 A;  1MNE A;  4CLF A;  7AT1 B;  1Y0H A;  3G71 S;  4ECZ A;  3CDB A;  4EO8 A;  1FTC A;  3DLJ A;  3K8W A;  4KGZ B;  2LXF A;  2OAU A;  1CJK A;  4C8K A;  2WW8 A;  4WE1 A;  3NCQ A;  4DV5 J;  4R0E A;  2OPS B;  1URN A;  1KLM A;  2HQ3 A;  1NK4 A;  3MD1 A;  4DR5 F;  2FLL A;  2RQM A;  2OML A;  2HS4 A;  2DXF A;  3H59 A;  3V81 B;  3TNV A;  2XS2 A;  3ZZT A;  3TUP A;  3MMA A;  3TZX A;  3DLB A;  1AW0 A;  3TJ8 A;  4JI3 J;  1WHY A;  2W4D A;  4LQ9 A;  3H5U A;  4QZV B;  5DG9 A;  1U45 A;  3GV5 B;  4ICL B;  3G86 A;  4X65 F;  2VFS A;  4LFC J;  3AOC A;  3O3L A;  3DDN A;  5M2U A;  2PD1 A;  3CTR A;  2GJ2 A;  1M5V C;  1JLF B;  1I5O B;  5HSP A;  1CC7 A;  3JSM A;  1NPK A;  2LDY A;  3FBB A;  3QIP A;  3OBI A;  2C2N A;  2DHA A;  3J81 U;  4LR8 A;  1P9Y A;  2UUB F;  4OYW A;  1VRT A;  2V8P A;  1U8S A;  2KH9 A;  3ICL A;  3ISZ A;  5FDL B;  2ZZN A;  2JEG A;  5J2M B;  2J0Q D;  1GFW B;  2YVS A;  2Y9H A;  2Y1R I;  3OUY A;  4ZDN A;  1X9W A;  2B4P A;  2RSQ A;  3DMJ B;  2VBY A;  2VL1 A;  3F0N A;  3KTQ A;  3FKB A;  4KFB A;  4OZJ A;  3KLG B;  4IDK B;  2BKP A;  4DR2 J;  3RW6 A;  4WYW A;  2IC3 B;  1N0U A;  3D0I E;  4QPX A;  2VIH A;  3M9O B;  1EP4 B;  3MAH A;  2M5Y A;  3IAS 9;  4WXW A;  2R2R A;  1P8G A;  1HNI A;  1SL2 A;  2XO6 A;  2MB0 B;  4YB6 A;  2MKI A;  3G82 A;  1MRO A;  1JK9 B;  3SMZ A;  3CMA S;  1NBE B;  4DS5 A;  4NA3 A;  3M7V A;  3TZY A;  1JLE A;  1RLD A;  3SFG A;  3AXK A;  2W2P P;  4WXO A;  4IOC Q;  1N5T A;  4YB1 P;  2QLJ B;  2C2O B;  2JH3 A;  3BR9 A;  4RW6 A;  2O5D A;  1R8A A;  1NH7 A;  3NGD A;  1HI8 A;  2C2K B;  5IM0 A;  1GMW D;  3NG8 A;  4WFX A;  2K7K A;  3CMQ A;  5HMX A;  2ZD1 B;  1SH3 A;  3J80 Y;  1YRU A;  2RH3 A;  1KOH A;  5ETM A;  3EXY A;  2JNJ A;  1W2I A;  2QSW A;  2ZHB A;  3JQM A;  1WHV A;  1N5S A;  3OFF A;  3DLH A;  3MCN A;  3BDP A;  4UTG A;  3G2X A;  3KK2 B;  1NJI T;  1CBK A;  2MLX A;  2E7V A;  4EFA C;  1IJF B;  3HT0 A;  1LV5 A;  1PIL A;  3C6U A;  1U2R A;  3CJQ A;  3QRR A;  3TYT A;  3HSZ A;  2LEB A;  3Q8P B;  2AWZ A;  3CCJ S;  2V68 A;  5KOX A;  2XLI A;  2DGW A;  4ECR A;  2FJD B;  1HHQ A;  1TL4 A;  1XWL A;  1K1Q A;  4HDG A;  1JLG B;  3PV8 A;  3GIK A;  1Y4Z B;  5GAH I;  5DDR C;  2YWG A;  2BXJ A;  1S48 A;  4ZIT A;  1H0H B;  3IGV A;  1N0V C;  2HHP A;  3MEG A;  2FGO A;  5CQG A;  1B64 A;  2CFX A;  1H7X A;  2X1B A;  1O5J A;  3IRW P;  1M5H A;  2QN6 B;  3N6L A;  4WE1 B;  1KLM B;  4DV0 J;  2IMW P;  2RQC A;  7FD1 A;  2HBQ B;  3AFG A;  3FSX A;  2MKS A;  2RS2 A;  3EGZ A;  2O1P A;  4U7U K;  3NBP B;  1RHM B;  3KXD A;  4K0K F;  5E41 A;  3BYR A;  3W2V A;  5C24 B;  2BJ9 A;  1FD2 A;  3G6E S;  4HKQ A;  4DCO B;  3HX9 A;  2AJ4 A;  3R97 A;  3BH7 B;  3V2U C;  4MIW A;  3ZNU A;  4FF2 A;  1F5A A;  5D4L A;  3D6H B;  1E6V B;  1ZA2 B;  1SJQ A;  1FEH A;  1YZ7 A;  1ULR A;  1RB0 A;  1Q95 G;  3GJS B;  4C8L A;  4KH1 B;  4RNM A;  3CUL A;  4R0J A;  2PEB A;  1VRT B;  3AOD A;  1CJT A;  1U1L A;  1U1R A;  1C0T A;  1BE4 A;  2VA3 A;  3MM6 B;  1J5E J;  5JVG Q;  5HAO A;  4NXM F;  4ZHR A;  2CQB A;  2KN4 A;  3A13 A;  4DDF A;  5DGA A;  3OUY B;  3MMB A;  4RUC A;  3GLJ A;  3NL0 A;  5K14 A;  3HO1 A;  3P8B B;  4KFB B;  3PW5 A;  3EE3 A;  2WB4 A;  3DM2 A;  3IR7 B;  5E2Q A;  2DRD A;  1NJY A;  1GQE A;  3ISN D;  4DR5 J;  1P9Q C;  2NUU G;  3LP0 B;  4I6A A;  4RW4 A;  4N41 A;  3CC4 S;  5D77 A;  3GJQ B;  1FWP A;  1X8D A;  3DYA A;  2IHR 1;  4P72 A;  1GNK A;  2MKY A;  5LM7 E;  4IG3 B;  4X65 J;  1HNI B;  5CAA A;  4ZPW R;  2ALZ A;  4B9L A;  1HR0 J;  2GIF A;  3FGV A;  3G82 B;  1JLB A;  2XI3 A;  3T1H J;  4LSL A;  3OR2 A;  1NXI A;  3IG1 B;  3UW1 A;  4QOT A;  1U4B A;  4NLY A;  2UUB J;  4P10 A;  2ZOF A;  2NSB A;  3RB3 A;  4MK8 A;  2Y1J A;  4NLR A;  3HPO A;  3NWG A;  5IM0 B;  3HHE A;  2IJR A;  4M1K A;  3M6X A;  3PFO A;  4HEA 9;  2BAN B;  2VBW A;  4DUZ F;  3CDU A;  5KT6 A;  1CS4 A;  3PJ9 A;  3ETM A;  3GFZ A;  3SSR A;  5HL7 Q;  1XIQ A;  4FYX B;  2AYG A;  4MKA A;  1O8B A;  3OFE A;  2OSR A;  4NOH A;  2MGZ B;  5FD1 A;  4X4V A;  4G1Q A;  1NZ8 A;  4ECY A;  2E5J A;  2W8L A;  3C6U B;  2N7C A;  3PYG A;  4OQJ A;  2ATC B;  4WFZ A;  2C2M B;  4G65 A;  2QA2 A;  4MMO A;  1RAC B;  1T02 A;  4UZB A;  2ACM A;  1PSD A;  1EZZ B;  4PAA A;  5CYM A;  2B5J B;  1WKL A;  3KG0 A;  5JXS A;  1UEV A;  1S1U B;  3B78 A;  4ILL A;  2DO0 A;  1H38 A;  3HVT A;  2ZM6 J;  2HVZ A;  4FDF A;  3IFE A;  1E6Y A;  2FY8 A;  3RGI A;  1TUW A;  4EK2 A;  4ECX A;  3MEG B;  4M8L A;  3U1M A;  2R4F A;  3LWL A;  1WJ9 A;  4NE9 C;  1Y5L B;  1PJ5 A;  2W2O P;  3O6Q A;  2F63 A;  3G6X A;  2V69 A;  3E3X A;  1BXN A;  3D6F B;  1FX4 A;  1KSP A;  2C2D A;  2PE8 A;  3MCS A;  3H4D A;  4NA2 A;  3FRY A;  4OJG A;  1W25 A;  4OZ1 A;  4RUH A;  2KL8 A;  1TVR A;  1NH8 A;  2YNH A;  4M5L A;  1YJT A;  3W2V B;  1DLO A;  3N5B A;  3UI3 A;  4PKD B;  2Y1L B;  1YJR A;  3EPG A;  4Y34 A;  4HI1 A;  2RUG A;  4KGK A;  2QLW A;  4OMF G;  3AQO A;  4L72 B;  5KFQ A;  2FHM A;  1N33 J;  2GAH C;  4ED8 A;  2G0I A;  2HAI A;  4A8Q A;  1O6X A;  1H6K X;  1VLO A;  4XDC A;  3T3F A;  1HHS A;  5LOQ A;  1CJT B;  3CCU S;  1Q82 T;  4JI5 J;  4DR6 J;  4N76 A;  3KHL A;  4KV8 B;  2V94 A;  4CH0 S;  4ZHR B;  4WIQ A;  1KS2 A;  2VF3 A;  5EX0 A;  5HAN A;  5HQM A;  2RU9 A;  5B0B A;  1D9F A;  3CJ3 A;  3GB0 A;  5KFH A;  2VQF F;  3HLU A;  4E2F B;  4GC7 A;  3DM2 B;  3DRS A;  4NWB A;  1MN7 A;  4P6Q A;  3UDV A;  4B3M F;  4B9M A;  1FI4 A;  5HQL A;  1NJW A;  3UDC A;  1GTH A;  4BHQ A;  1IKX B;  4MAK A;  2ILZ A;  1RBA A;  3OLA A;  1NDK A;  5ITH A;  2FLO A;  2Z2Y B;  1HPZ B;  2BAB A;  2LKZ A;  4K0K J;  3T6J A;  3DYA B;  5A8W B;  2AT1 B;  2B43 A;  1ZA1 B;  4PEO A;  1YI2 S;  1NB2 A;  4NCG B;  1NJX A;  2I8E A;  3UNY A;  2QTW A;  1FES A;  3TA2 A;  1X4A A;  2XHW A;  1EIY B;  4KHM A;  3WBZ A;  2YKP A;  3K58 A;  1NND A;  2FHK A;  2W1B A;  2DRA A;  4Z7Y A;  2W4P A;  2PN6 A;  2K2P A;  3OR2 B;  2EFG A;  4CLW A;  5HVH A;  2ZH4 A;  1ZM3 A;  1N8R T;  3BQ2 A;  3ZXW A;  2X3G A;  4EYH B;  2V2Q A;  2JC0 A;  1CJU A;  3ONQ A;  4GMK A;  1HMV A;  4HH0 A;  2OD6 A;  3I0R A;  2VOO A;  4CH1 A;  5EHH A;  4NXM J;  1ZBT A;  3GV8 B;  3BN4 A;  4DQS A;  3HMJ G;  2DNH A;  3G9C A;  3AJ1 A;  4W90 B;  3R7S B;  4ED3 A;  3SV4 A;  3S01 A;  1HBM A;  4YDD B;  3OPK A;  3NKY A;  2B0G A;  2LLZ A;  2DK2 A;  3CNQ P;  4PWW A;  4OX8 A;  5IT0 A;  3AD9 C;  1U48 A;  3R5A A;  5KFX A;  2W9B A;  2DH7 A;  1U0S A;  1RT6 A;  4D3H A;  3SIP B;  3Q8Q B;  1N88 A;  1WC0 A;  4AE5 A;  3PZP A;  3MMC A;  4KSE B;  3L7P A;  3JTP A;  3PIP Q;  1YZ6 A;  4USJ C;  4OZ0 A;  2RE1 A;  1WKJ A;  3UD3 P;  1DY3 A;  4FPI A;  1E6Y B;  1RAJ A;  2EK1 A;  1SQE A;  5KT4 A;  2FLP A;  3VCD A;  1O51 A;  3TA0 A;  3TI0 A;  4O4G B;  2Q1L A;  4NLD A;  4DUZ J;  2O3D A;  5ETS A;  2QV6 A;  3AHP A;  3KG1 A;  1HW8 A;  3FEY B;  4ED4 A;  4TY9 A;  2LEP A;  1UET A;  3HUL A;  1NLK L;  1U2F A;  4K59 A;  2YKN B;  4X4O A;  2BE2 B;  3BGR B;  4P75 A;  4FXW A;  2ASJ A;  5HVG A;  4WWS A;  3QYY A;  1SJF A;  3E8O A;  5AE3 A;  1SJ1 A;  4YQW A;  2XWX A;  4HHU A;  3S1T A;  1SJ4 P;  4LRD A;  2GW8 A;  2V63 A;  2HQI A;  1YLX A;  4A8F A;  2VOD A;  1N32 F;  1EET B;  3CJ8 A;  1FDD A;  3D4J A;  4K2X A;  1Q7Y T;  3T6B A;  4ECQ A;  5LSL A;  1TL5 A;  4CH7 A;  1RAH B;  2QL5 B;  4O23 A;  5GAD I;  4HLB A;  5LJ5 Y;  1L3V A;  3AD7 C;  5GVQ A;  3NWR A;  1NEE A;  2E9Z A;  1UVM A;  3IBC B;  3VR1 A;  1NK9 A;  3P5T L;  4WP9 A;  2CJB A;  1KP6 A;  1VHI A;  4KYZ A;  1CC8 A;  1TKZ B;  4UUX A;  3N4W A;  4H4O A;  3N9U C;  2QLF B;  1FKP A;  3IS9 B;  1GMW A;  2CNK B;  2MTL A;  1BWE A;  1Q53 A;  3M9N B;  3DFE A;  1RTD A;  3DRR A;  3CDA A;  2W2N P;  1XN9 A;  2WON A;  2C3M A;  1K0T A;  2PO4 A;  3CME S;  3GJR B;  3MPD A;  3AA9 A;  3MGJ A;  3U1N A;  1PBA A;  4OZ5 A;  3GG1 A;  4IFV A;  4QR0 A;  2G2O A;  4J9R A;  5KT7 A;  1L5U A;  1B7Y B;  3VQT A;  4UY8 T;  4ZVG A;  2G9O A;  4B3O A;  1LW2 B;  3J81 Y;  1VC5 A;  1R0A B;  4R25 A;  3KNA A;  2UXC J;  3D5M A;  3I5C A;  4FXD A;  2N4C A;  4XIU A;  2YNI A;  3OHB A;  5H9E K;  4AL6 A;  2C2Z B;  3PHT A;  1T3N A;  4A8K A;  1U7L A;  3FBF A;  2X1F A;  1FRL A;  1CJV B;  3DOK A;  5F0W A;  2DR7 A;  2J9D E;  3RB4 A;  2E1M C;  4DV1 F;  2FUG 9;  1SIZ A;  2BJE A;  3GIJ A;  2FPH X;  4OJH A;  2JLG A;  1HWJ A;  4DG1 A;  2XLJ A;  1VYA A;  2VPZ B;  4EZ9 A;  2KM8 B;  3J7Z 5;  1MWY A;  1VR6 A;  1FNO A;  4A8M P;  5D15 A;  1HYS B;  5LL6 d;  1QM9 A;  4C0H A;  1KOO A;  3IM8 A;  3HJF A;  1VQS A;  2RDI A;  4DPW A;  4LSZ B;  2LYV A;  3OVA A;  4I1T A;  4LMZ A;  2QT7 A;  2V8D A;  2N7Y A;  2PEH A;  2F65 A;  3EXC X;  5HBM A;  1HWL A;  2OFG X;  1S97 A;  3QAE A;  4JI2 F;  2U2F A;  1RU2 A;  4OX7 A;  3KUG A;  1HNV B;  2ZZT A;  3MPW A;  3FEZ A;  2V8H A;  4PCQ A;  4P73 A;  4URQ U;  5KFU A;  1C4C A;  3EZU A;  5EX3 A;  3LH2 S;  1SCJ B;  1UWA A;  2RNE A;  4DSE A;  5L1L A;  2FVQ A;  2IA0 A;  5D3G A;  2CPI A;  2HFO A;  3V4I A;  2FHJ A;  1DTT A;  3PW7 A;  4KHR A;  3OTO F;  2EXU A;  3BO3 A;  2B56 A;  3OTD A;  4U67 Q;  2V34 A;  1FDN A;  3K2Y A;  2MEW A;  4ELU A;  3ZC4 A;  5I3U B;  4EBC A;  3LP1 B;  2HND A;  4M5K A;  4CO4 A;  2B6A A;  2DGU A;  2I2Y A;  1XER A;  1VQ4 S;  4K4X A;  1CPZ A;  4C2M A;  1OWX A;  1X4F A;  5A6P A;  3LWM A;  1XEZ A;  3OXG A;  1S1T A;  2R7Q A;  4AUK A;  1Y00 A;  5BR8 F;  3LW5 C;  4ZOS A;  5H9F J;  1GH8 A;  4JI0 F;  2FJX A;  3L9Z A;  2IPO B;  3DGP A;  5ETR A;  1VLY A;  5L1I A;  4QBU A;  1RTH A;  4X2B A;  1HNW F;  1FX2 A;  2KJW A;  3ILI A;  2XEX A;  2BR0 A;  2LEC A;  3RBZ A;  3QGG A;  4AXJ A;  3BGO P;  4J9V A;  1F9H A;  5F8H A;  2XMW A;  1FK9 A;  1HWI A;  2GGP A;  1KRP A;  4B9S A;  1F2G A;  2EK6 A;  1D8Z A;  3H2V E;  4DR4 F;  4QYZ J;  1S1W A;  1IBK F;  2HHT A;  4ZLJ A;  4UOG A;  3HZE A;  1RTD B;  4AFF A;  2HVH A;  1YJN S;  4I0W A;  5DET A;  3D0H E;  4LFB F;  2WON B;  4H4K C;  2GZO A;  4K4T A;  4GKK F;  5ETL A;  2HHH F;  4DPY A;  2ZDO A;  3CC2 S;  4J9Q A;  1KN6 A;  4DXL A;  2MQL A;  1R7I A;  3U1L A;  3D7S B;  3H90 A;  1NZA A;  4DL4 A;  1ZM4 A;  1DZ5 A;  1DTQ A;  2J8A A;  3MM9 A;  4BBY A;  2CG8 A;  3H5Y A;  3P49 B;  4CNZ A;  5DRK A;  4UUW A;  1U47 A;  2EEY A;  3KLH A;  4KE5 A;  2OTL S;  2YNI B;  1DUR A;  4JV2 A;  2OIH A;  4IRC A;  3CE8 A;  3M8P A;  1WEX A;  2AIR B;  1X9M A;  3DOK B;  2XS7 A;  4CYU B;  4PRF A;  1AB8 A;  3AH6 A;  3KUE A;  2YPY A;  3H0P A;  3TVY A;  3W65 A;  1N48 A;  1S1V B;  4ES1 A;  2E7W A;  1RHQ B;  4BDP A;  2DR8 A;  1D9D A;  1FJG F;  5KG5 A;  1WOP A;  2CQ4 A;  4MJK A;  3OSN A;  3Q8R B;  1U1Q A;  3HZG A;  2MDA A;  3MR7 A;  3EGW B;  4DL2 A;  1Y10 A;  2BQ3 A;  4CT9 A;  4KJI A;  4RW7 B;  3NMR A;  1FWL A;  1RA6 A;  5ETP A;  1PC4 A;  3MMJ A;  3DU6 A;  3QZ7 A;  1C1C B;  2NLW A;  3EVM A;  1ZM2 A;  4RW8 A;  1U1N A;  4F2S A;  1WUU A;  1V9O A;  2XMK A;  1IR2 A;  3W63 A;  5ETT A;  2ROP A;  4RNO A;  5HBM B;  5AXN A;  5IFM A;  1N6Q B;  4ED5 A;  4Y2C A;  3MOJ B;  4WJB A;  1UPP A;  3M2R B;  2MZT A;  3FBC A;  2NXN A;  2ZFH A;  2R7V A;  3GSI A;  2NYI A;  1ICE B;  1QE1 B;  5C2C A;  1YTY A;  1IBM J;  1X4D A;  3KLE A;  2J76 E;  1AZS B;  5AT1 B;  4DR1 F;  1HFE L;  2IAJ A;  3FJ2 A;  2CJX B;  1Q7L B;  3V4I B;  2AD9 A;  3KJQ B;  3ENA A;  3RZA A;  4FYY B;  4DV1 J;  2FJB B;  3OL7 A;  1KVI A;  2W7O A;  4C4W A;  3M8Z A;  3QAU A;  2CPY A;  4B02 A;  1FRM A;  2I5J A;  1KHV A;  1TKT A;  3SYZ A;  3J7Y U;  2Y8Y A;  5CAB A;  4ZJO A;  1QVF R;  1FDB A;  2HND B;  5CCM A;  3SDE B;  3MR6 A;  4C11 B;  1W2B R;  3CCV S;  1EKS A;  4CLU A;  2JRS A;  2H5J B;  3EPI A;  3FDS A;  1VQY A;  2NCK L;  4Y3C A;  3VZH A;  2X51 A;  3HHN B;  2IRX A;  2N3O A;  2EKN A;  3WIV A;  1NJZ A;  3HD2 A;  4C97 A;  4JI8 F;  2ATL A;  3ILJ A;  4K8R A;  1QTN B;  3GIM A;  2H5I B;  4Q7A A;  4F04 B;  2WVF A;  1QAX A;  4K5R A;  4Y2K A;  3DGP B;  1BQM B;  3ISN C;  4YB5 A;  1S79 A;  1RTH B;  5FLX U;  2F4V J;  1ZZN A;  3GTY X;  4NI2 B;  4USI A;  1JIH A;  4DN0 A;  2HPU A;  1T9V A;  3W5Z A;  2OD4 A;  2A2C A;  1JJH A;  1FK9 B;  4I69 A;  2XGQ A;  3S7R A;  2DGO A;  3MD3 A;  4X4P A;  1ELO A;  3B8H A;  5DLF A;  3H42 A;  1VS3 A;  4DV3 F;  1Y5I B;  1R6V A;  4LF9 J;  4LFA J;  4K4U A;  3L7O A;  2VD3 A;  5E0O A;  3WZ0 A;  1KC8 T;  3KLV A;  1ZS6 A;  4GVL A;  3H4B A;  4NA1 A;  1RT2 A;  1L3K A;  3DI6 A;  2MMY A;  4ZVO B;  2CVI A;  4QIV A;  5E5N A;  3MZI A;  2MLZ A;  3BBC A;  4Y2A A;  1YBT A;  4ANC A;  1ZOT A;  3X3U A;  5DM6 Q;  5EDW A;  5B0E A;  2R8K A;  4JV5 F;  1KNZ A;  1N34 F;  3O8W A;  1HQU A;  5B0F A;  3AT1 B;  1YKW A;  5BR8 J;  1CUL B;  1TUV A;  2KXH A;  2HBY B;  3NCR A;  3MM9 B;  1GX5 A;  3CCL S;  4JI0 J;  1RBO B;  2F40 A;  4F4Z A;  3H98 A;  3TAQ A;  1TMM A;  1S49 A;  1JXV A;  3D1O A;  4F8R A;  2RQ4 A;  3KLH B;  2RUS A;  1HNW J;  1VQ7 S;  1S4F A;  1FRJ A;  5EWF A;  1S9E A;  4FZV A;  1NHV A;  2CNO B;  2MZQ A;  1YGY A;  4ID8 A;  3MDF A;  3M32 A;  3PEH A;  4DV2 J;  4G6V B;  4USK A;  4WYL A;  1OIA A;  5M2P A;  2H48 B;  1D3W A;  3WIU A;  3QLH B;  1FER A;  2CZV C;  4YS2 A;  1WNE A;  4DR3 J;  3PYF A;  4OHZ A;  3OFG A;  4OX9 F;  3UCG A;  1U09 A;  2UXD F;  2YWK A;  1RHK B;  4RW8 B;  2D3Z A;  3CPW R;  2HHV A;  3VAF A;  4ECW A;  2J9E A;  2GVZ A;  2RVJ A;  1FRX A;  4G1I A;  4EMD A;  3RR7 A;  2YTC A;  4ED2 A;  2WZ1 A;  1LW0 A;  1Q8B A;  1RI7 A;  4AYB D;  2ZJQ Q;  2R7T A;  1N5Y A;  2QMU B;  3UN5 A;  1FNM A;  2B7C B;  3KLE B;  3FZ2 A;  1RE1 B;  1PIE A;  1T05 A;  3HHL A;  4X66 J;  3IRX B;  2PMW A;  4L73 A;  1UFW A;  1GTE A;  4BS2 A;  2IAJ B;  3E2E A;  4DV6 F;  2F7V A;  1RWK B;  5D78 A;  3V6H A;  4F0M A;  3ELH A;  1VIX A;  3HFZ B;  3NP5 A;  1RU1 A;  4USM A;  2XS5 A;  2VH7 A;  3QJJ A;  1FJG J;  4MKB A;  1F60 B;  1RK8 A;  2I5J B;  1WG4 A;  3B54 A;  5D4O A;  4YB7 A;  1ROF A;  1TKT B;  3MPV A;  5K8P A;  2Q66 A;  3NS7 B;  1JKH A;  2LDI A;  2MZ1 A;  1XBW A;  2VBZ A;  4DSK A;  1TKX A;  2IYI A;  3UWT A;  2D3U A;  4X4S A;  3QRQ A;  1A9N B;  2IJN A;  2QA1 A;  2FB0 A;  2VG6 B;  5KFI A;  3V4M A;  3CSK A;  1JLA A;  4TYA A;  3FBE A;  4TQS A;  3OHA A;  5HK4 A;  3GJT B;  3ZZP A;  1QUV A;  5C7P A;  3M8Q B;  5J1E A;  3QBC A;  2ZH3 A;  1RCX B;  4ZVF A;  2KZM A;  2LQB A;  5C2G A;  2MXY A;  4DR1 J;  4C3K A;  4Q0B A;  5C5J A;  3ZZ0 A;  3WDO A;  1XMO F;  2LQ8 A;  4K2J A;  1X0P A;  4DBQ A;  4WPA A;  4C0O C;  4WKR A;  2C28 A;  4FNH A;  1M1G A;  4P71 A;  1F5C A;  2G4B A;  2AGQ A;  5F8G A;  1WC1 A;  2X1A A;  3QQC D;  3THT A;  4U7U D;  2AX1 A;  4NAS A;  1WF2 A;  1YIJ S;  3VWS A;  1VQO S;  3R6L B;  1U1M A;  2OTJ S;  3FQL A;  3UVJ B;  4FYD A;  2MSS A;  5J2P A;  2E1C A;  1REG X;  2DHS A;  2IRY A;  4JUZ A;  2FJV A;  3K89 A;  3K5P A;  2XQC A;  3ZFV A;  2C3P A;  4U8Y A;  2MQ8 A;  1RIS A;  4CT8 A;  1S10 A;  4JI8 J;  4F3M A;  4DQP A;  4LSN B;  2AEJ A;  2EC2 A;  2WSF C;  1WEL A;  4DPU A;  4RU9 A;  3R6G B;  2OPR B;  4DU8 A;  2JFK A;  2WB1 D;  2LA6 A;  1R3N A;  2IVM A;  4GO5 X;  3I96 A;  2P6T A;  1AT1 B;  2ADB A;  1FJ7 A;  2F3J A;  1Q8I A;  1MG7 A;  3P5B P;  2GIR A;  4ZK7 M;  2RML A;  3W9I A;  2ASY A;  1MWZ A;  1RAE B;  1RT4 A;  3M32 B;  1SC3 B;  4DV3 J;  1FKA F;  2H54 B;  2LMI A;  3IXQ A;  3THP A;  1TV6 A;  1TEL A;  2EVZ A;  1HD0 A;  1ZYQ A;  2HUR A;  2M7S A;  2YPZ A;  4A8S A;  2DNZ A;  2DXE A;  1V3R A;  1RAF B;  3KK3 A;  2MHN A;  2Z58 B;  1DQ8 A;  1F0X A;  4B3T J;  5C42 A;  4LF6 F;  4L76 A;  4D3G A;  5KG2 A;  5GME A;  2G1H A;  3OQ2 A;  3WC0 A;  2V2Z A;  2E9T A;  3BO4 A;  5DS7 A;  1S77 D;  3EDR B;  3CCM S;  1G2E A;  3VGV A;  3MHY A;  3EZ5 A;  5HMY A;  2CIM A;  2BV3 A;  1ARO P;  2VOP A;  2BEF A;  2KDO A;  3IBW A;  4OYX A;  3MUR P;  2XO7 A;  2E66 A;  2K1R A;  2YQ1 A;  4DQQ A;  2QL7 B;  3WQP A;  1T11 A;  4R5P A;  2RT3 A;  4OLP A;  1JB0 C;  1QDU B;  4QW9 A;  5IC4 B;  3CJK B;  3ZNJ 1;  2XSF A;  4M5D A;  2GJI A;  2XCA A;  3RU0 A;  1BMQ B;  1ZZF A;  4ZIV A;  2QA4 S;  1S0M A;  4YFU A;  1ZTT A;  2F1F A;  2MY8 A;  4IFY B;  3GCW P;  1S1X B;  2BE9 B;  1BQN A;  2P9C A;  8AT1 B;  1K47 A;  2DPI A;  1GX6 A;  4LRE A;  1TKX B;  5B0D A;  3BBB A;  3DLG B;  1TQL A;  3M2V A;  2CXE A;  5AXM A;  3FCH A;  3Q86 A;  4PXB A;  3P4U B;  2M9K A;  2AF6 A;  3NS5 A;  2CYY A;  4OLO A;  3UN2 A;  2HSE B;  4OYZ A;  2HG4 A;  3QNW B;  4OJ1 A;  3KG4 A;  4LF4 F;  3DXB A;  1S9F A;  2DHG A;  3TAM A;  4C98 A;  3N6N A;  4RBU A;  3QFW A;  4DR7 F;  4LUB A;  4V19 J;  2GX8 A;  2ZE2 B;  2JDJ A;  2XG8 A;  1XMB A;  4KC5 A;  4DV6 J;  3MM7 B;  4RNH A;  3W8G A;  3PCO B;  4ZP9 A;  2B8Q A;  3PKM A;  2XNQ A;  4K7Q A;  4FF3 A;  2KT5 A;  1ZM9 A;  1OYD A;  3RG6 A;  4I7F A;  3VVU A;  2XHC A;  2XM3 A;  2FTR A;  2HZV A;  4OFZ A;  4YY3 J;  3BN7 A;  3KFW X;  2XWY A;  4ALZ A;  2EBE A;  5KFC A;  1RWN B;  4JI1 J;  2XNR A;  3U7J A;  1H7W A;  3MPU B;  3GR1 A;  4A48 A;  3EX7 B;  4PG8 A;  3MEE A;  2QG9 B;  4H4M B;  4HYK A;  3GCX P;  4AL5 A;  9RUB A;  1S6Q B;  1FXD A;  1HBO A;  2BVZ A;  3IR5 B;  2RQK A;  2UV8 G;  1FHT A;  5KFW A;  2KVQ E;  1PC5 A;  4O3O A;  2KYZ A;  1XNR J;  1UA0 A;  4BLG A;  2DGV A;  1HNX F;  4YDX A;  1WHW A;  3C2P A;  3CDE A;  2FJE B;  1RT3 B;  1UVK A;  3CXC R;  1H74 A;  1XK8 A;  2PSZ A;  2DB1 A;  3OJS A;  2DNK A;  3AQP A;  4BCA A;  1RT4 B;  4WU2 A;  4Y6I A;  1TK0 A;  4RU2 A;  4NMX A;  2UVW A;  1TV6 B;  4DSI A;  4JI7 J;  2DRB A;  3KKF A;  1BHN A;  1I94 J;  4O3N A;  7FDR A;  4TLQ A;  4DSL A;  1K44 A;  3G87 A;  3ZZO A;  3HVA A;  3N5F A;  2Z2M A;  3S8S A;  5AE2 A;  2WOM B;  1KDN A;  2J7K A;  4QWB A;  5J1N A;  3BSC A;  1HNZ F;  2UXB F;  3BDE A;  3J7A N;  1TL7 B;  2OGU A;  2DR9 A;  3G96 A;  3BSO A;  1URR A;  3HVW A;  4ZCK A;  1SC1 B;  2XMJ A;  2VB6 A;  1XNQ J;  3M8Y A;  2HWH A;  3RW7 A;  3W8P A;  4FF1 A;  4ZA1 A;  2RDD A;  4OI0 A;  3HF5 A;  4I2Q A;  3R5G A;  1VBY A;  2JVR A;  2FD2 A;  4M5D B;  5GAG U;  2BKN A;  2IJF A;  1LQ9 A;  1S6O A;  4USV A;  2ERR A;  3A8J A;  4JI4 J;  2B9E A;  1VQN S;  2KRR A;  3TZW A;  3KHH A;  3MFI A;  2OPS A;  4OJ3 A;  3NRB A;  5CXT A;  2ZH9 A;  3NXZ A;  3V81 A;  2E5L F;  2RHQ B;  3SQG B;  1UMJ A;  4LF6 J;  4Q2L A;  1VQ8 S;  3K5M A;  4K4S A;  3PRB A;  4DV7 J;  1OMS A;  2XZW A;  4LBH A;  4YHH F;  5BYS A;  1U25 A;  1FKO B;  4DCP B;  4FP9 A;  4ICL A;  2W24 A;  3TAM B;  5DJB A;  1JX4 A;  2P6S A;  5DG8 A;  1JLF A;  5MLC V;  2BKO A;  2WK4 A;  1P6T A;  2AP6 A;  5LSO A;  2CQH A;  3ZZR A;  4JOU A;  3I9Z A;  1Q78 A;  2CG4 A;  3DHW C;  3FCV A;  5E33 A;  3DNC A;  2Z56 B;  1S9G B;  5BYR A;  2CKW A;  2XYP B;  1FA0 A;  5KFZ A;  3D3B J;  5J2M A;  1Q86 T;  1C2P A;  4ILM A;  5CD4 A;  4DX7 A;  5IWA F;  4CP5 A;  4GC6 A;  2V8V A;  4X64 F;  4I7F B;  4DPT A;  4USH A;  1RWP B;  3KLG A;  3X1L B;  3KDO A;  3SQO P;  4IDK A;  1WG1 A;  4X62 F;  3K5O A;  4B9U A;  1UPM B;  2VIC A;  1SB6 A;  4NX9 A;  4O44 A;  3NGS A;  1NB7 A;  4NRU A;  1UJ4 A;  2I38 A;  2R8G A;  2YX7 A;  4GKJ J;  2EBG A;  4YEA A;  4DFK A;  3KYL A;  1HBO B;  4LQ3 A;  2VPY B;  1DAX A;  1H2T Z;  3V6K A;  4NEZ A;  4LF4 J;  4DPX A;  5HMW A;  4LF5 F;  2LVW A;  3QGP A;  1B3T A;  1LFW A;  3A4T A;  4F3Q A;  2D9O A;  2HMI B;  2HWT A;  4DR7 J;  4I2P B;  1PCA A;  1MW7 A;  1OY6 A;  4AQY J;  2W8K A;  4V1A k;  5F8J A;  2VG5 B;  2A10 A;  1WOO A;  3H5S A;  3K8V A;  4PG7 A;  3R2D J;  3M30 A;  2GJF A;  2WVD A;  2PA3 A;  2BJ7 A;  4QIE A;  2AJF E;  2NYH A;  3ENV A;  1UCN A;  3JSR A;  2WRM A;  4I67 A;  1VC6 A;  1Q81 T;  1XMQ F;  3TR5 A;  2Z0G A;  3SZ2 A;  1UWB B;  2D3O 1;  2ZD1 A;  1LXJ A;  2M88 A;  4CLY A;  2KU7 A;  4FNI A;  2D74 B;  2GCF A;  2P8I A;  3PEJ A;  2KT3 A;  2HFV A;  4IH5 A;  2DH8 A;  3IGN A;  4KPC A;  3RUB L;  3KLF A;  3H40 A;  2KFN A;  3GG0 A;  1D0E A;  5IS2 A;  1SKW A;  2J7W A;  1SH0 A;  2DR5 A;  5CA5 A;  3KK2 A;  1YVF A;  5EWE A;  3UD4 P;  3CD7 A;  3T5J A;  4NRT A;  4CO2 A;  4MYU A;  2LEA A;  3WC2 A;  1XTZ A;  1LWC A;  3CB4 A;  3PDN A;  2R42 A;  4EGL A;  4ED0 A;  1UW4 A;  2ASD A;  2V4J B;  3OT9 A;  2V50 A;  2MJU A;  1QSY A;  4B3R F;  5DLG A;  1I3O B;  3I5A A;  2EG1 A;  1S0N A;  1VI7 A;  4O3P A;  1SBR A;  1X5P A;  1M1H A;  4ETX A;  2CUY A;  1SKS A;  3H25 A;  3SSQ A;  4CCH A;  3IMQ J;  4F3O A;  1SI9 A;  4CTA A;  2NSC A;  2FC8 A;  2YWW A;  2DCU B;  5L1J A;  4K5S A;  5A8R A;  2KO1 A;  4L6V 3;  4WII A;  1HA1 A;  2DEJ A;  1TL3 A;  1IM4 A;  2IDE A;  4E98 A;  3NBP A;  3ZZY A;  2UXB J;  4I4B A;  1OYE A;  5C24 A;  4WZQ A;  4QWD A;  5HRO A;  2VUG A;  4WU3 A;  2EWH A;  4DX8 H;  1E6V A;  4PWD B;  3OTC A;  5IC6 B;  4O0I A;  2F8M A;  3CCZ A;  3D3C J;  4P7T A;  5L46 A;  4RUA A;  3M05 A;  4WZM A;  2CJQ A;  2HKE A;  1XR5 A;  2XY6 A;  3ULH A;  4QWE A;  1GK8 A;  2KHC A;  3QGH A;  3MM6 A;  4DN9 A;  3W7B A;  2CQ1 A;  4N77 A;  4ZLN A;  5H9E J;  3QT5 A;  4CRJ A;  1C0U A;  1LNQ A;  4IH7 A;  1H3D A;  2RIJ A;  1FCA A;  4DV4 F;  3TZZ A;  1S99 A;  1YJU A;  1IBL J;  1WC3 A;  2M4M A;  4O44 B;  3LP0 A;  2IVF B;  1L3U A;  4CWB A;  3BEG B;  3T5H A;  3TUI C;  4C3M A;  4YHH J;  4EBD A;  4IG3 A;  3J7A 1;  2AJQ A;  2KJV A;  3PNI A;  2HYI B;  1WC4 A;  1EHW A;  2LCW A;  3D6M B;  4KIA A;  2EG2 A;  3MEC B;  3L95 X;  5I4M A;  3I6P A;  4X4Q A;  2XMM A;  1OQ6 A;  2YY3 A;  3LP2 A;  4GVB B;  4F4W A;  1RT5 B;  4HI2 A;  3IG1 A;  1U1O A;  1R31 A;  3RBD A;  2QYC A;  3HVR A;  4MK7 A;  4DUY F;  4F0H A;  2QRR A;  3M30 B;  2QLB B;  2AJ1 A;  1QAI A;  3ET6 B;  4I56 A;  2BAN A;  2AZ1 A;  2CRL A;  4YUD A;  1H72 C;  2HFS A;  1CLF A;  3PY8 A;  2YNG A;  1SPB P;  4DL6 A;  2HHQ A;  2N3L A;  3AB4 B;  3Q2T C;  2HIY A;  3KLF B;  2AKW B;  3JYT A;  4WFB Q;  1RT1 B;  4C3L A;  2MGZ A;  1M5O C;  2UUA F;  1IQT A;  2HEK A;  3UR3 C;  2C22 A;  3T1Y F;  3IA0 A;  3RAX A;  2HS0 A;  2ZJP Q;  4Q45 A;  3TJA A;  2AEM A;  4EZ6 A;  3TP2 A;  1L3S A;  1UVN A;  1LWC B;  2DPJ A;  3CDW A;  2E5I A;  2G0C A;  4J7C A;  3LGM A;  4F4X A;  2BQR A;  3FC9 A;  4S0M A;  4XPC A;  1VQK S;  4J9L A;  1S5Z A;  3NOG A;  4DL7 A;  4FS1 A;  2B5J A;  1C4A A;  3DGV A;  1DAR A;  4PYD A;  5DZ7 A;  1S1U A;  4PR6 A;  3RYL A;  4E8U A;  3ILL A;  2B7B B;  3UFC X;  3EYZ A;  1KR4 A;  1FJE B;  1T9T A;  2FIU A;  2I0X A;  3T1A A;  3MM8 B;  5KFN A;  1GXU A;  1V3S A;  4CTA B;  2IM0 A;  2F9D A;  1SQF A;  3FQK A;  3MED B;  5E3P A;  4MFB A;  2XY5 A;  5A8R B;  3PAC A;  1R6Y A;  4A8Y A;  2MZR A;  5F8L A;  4EU0 A;  4AT1 B;  2CPX A;  4GRS A;  5IXU A;  1TL3 B;  1OQ3 A;  4HT5 A;  4K4Y A;  1X4C A;  1NPR A;  1KQF B;  1IWG A;  3EDQ B;  2EFV A;  2H65 B;  1NSA A;  4FVM A;  4FN5 A;  4C9D A;  4FF4 A;  1RKI A;  5HRO B;  1FEE A;  3NGT A;  2ZOM A;  2OO4 A;  4TLR A;  4ZLP A;  3Q89 A;  3RB6 A;  2CJY B;  3M6U A;  4H54 A;  2V2K A;  3VTI A;  1PJ6 A;  5KFV A;  3M2U B;  2PA8 D;  4IG0 B;  1NO8 A;  4B3R J;  2X3D A;  1S0V A;  2G2Y A;  3FVY A;  4ZPC A;  4Y28 C;  3JQK A;  3CCR S;  2XY7 A;  2FHJ D;  3BPS P;  1SVD A;  2RDJ A;  1TFY A;  2MST A;  4NPO A;  1TZ0 A;  4KV8 A;  3DRY A;  3IM9 A;  5E3Q A;  2LA4 A;  4CLZ A;  4U7C A;  2NPI A;  1YBA A;  2XSJ B;  3B82 A;  2D1C A;  4F2R A;  2UVV A;  1HI0 P;  1C0U B;  2B4U A;  5KFY A;  3CCW A;  3EGV A;  3GII A;  4PWU A;  3C6T B;  4CLL A;  1IKX A;  4ZVR B;  1LXN A;  1ZAW A;  3Q83 A;  1HPZ A;  5LSR A;  5BJR A;  5A8W A;  4DPO A;  4HR2 A;  5D0G A;  2WW4 A;  2KKH A;  4NCG A;  4DWI A;  3O1L A;  2EFQ A;  2O66 A;  2L9D A;  3GR0 A;  2AHO B;  2JX2 A;  3Q8S B;  3CC7 S;  4ZPV R;  3QJP A;  2CQ0 A;  3TEH B;  4N5S A;  3QMQ A;  3DLE A;  2OH2 A;  3LP2 B;  2IRU A;  4PXE A;  4WBF A;  2ZVI A;  2V4R A;  3I56 S;  1KFD A;  2FYX A;  2YXL A;  1VHF A;  3A8I A;  4NLW A;  4ITS A;  2GQ2 A;  3J7Y I;  4DCJ B;  3MR3 A;  1S4E A;  3MCM A;  5DO2 A;  1GEH A;  2KFZ A;  3CJR A;  1IBC B;  3G6V A;  2ZC4 A;  4ECU A;  3GYN A;  4ZVS B;  4NXN F;  4NML A;  5K8N A;  2YNG B;  4ZJQ A;  1TAU A;  1VFJ A;  3W5Y A;  2KTQ A;  4DV4 J;  1A0O B;  4OYO A;  2BUN A;  5KFF A;  3JYT B;  3GFY A;  1F9F A;  2FY1 A;  1RLC L;  3T5L A;  2QX0 A;  2HNZ B;  3A1Y G;  3GPA A;  2JHE A;  4QU6 A;  5I3P A;  1W26 A;  2PMH A;  1RBL A;  2Y1I A;  1NHU A;  1X4B A;  4LRF A;  1VRU B;  2AGO A;  3F44 A;  4ZMM A;  4ELT A;  3BKF A;  5F9L A;  3JAM U;  1T03 B;  2VV5 A;  5A0Y A;  5JJB A;  4MKY A;  2IMO A;  5E3R A;  2WBR A;  4OX6 A;  1L3T A;  1UEK A;  3TQ1 A;  2GML A;  3EGN A;  3DLL Q;  4DUY J;  2YQ3 A;  2R9L A;  2XMT A;  4J9S A;  2JWN A;  4AL7 A;  4F4K A;  4MFB B;  4O4G A;  2ZNZ A;  2JOQ A;  4KT0 C;  3QFH A;  1ZPW X;  1VK8 A;  1S6P A;  1J27 A;  1LEO A;  1HLW A;  4FPR A;  4CO3 A;  1JJ4 A;  4DEZ A;  1SKR A;  4J9N A;  1T8E A;  4A47 A;  2YKN A;  2BE2 A;  2UUA J;  5H9F K;  1FXR A;  3BGR A;  3CGI A;  1ZTW A;  4JV1 A;  4I6Y A;  1ITP A;  2E5G A;  3T1Y J;  2ZHO A;  1TR0 A;  4PUO A;  4NLQ A;  1I1G A;  1IXK A;  1SH2 A;  1X4G A;  5KFG A;  3BGL A;  2J0S D;  5DDO C;  4JV0 A;  1RWV B;  3JSY A;  2V6A A;  5L8R C;  2VU5 A;  3LUY A;  4BWM A;  1A6L A;  3GYG A;  3HHK A;  2DGQ A;  3EMT A;  2Z30 B;  1EET A;  4DV5 F;  1MMN A;  2RRB A;  2E9R X;  1IKV A;  1Y11 A;  3ZZZ A;  3C46 A;  4M94 A;  2ZC3 A;  3LQV A;  2W9C B;  2ZEJ A;  4JI3 F;  2IM2 A;  1AYE A;  3W5X A;  2YQ0 A;  1FJC A;  2ZH2 A;  3CD5 A;  3JQJ A;  1HI1 A;  2ZBQ A;  2BOA A;  1TKZ A;  1JJC B;  3CF5 Q;  2W7A A;  4LFC F;  2OFH X;  1NK6 A;  2EFO A;  2ZNY A;  1NHK L;  3IS9 A;  5HVF A;  1PYS B;  3OL9 A;  4FBT A;  3MOZ A;  2KG0 A;  4ILR A;  3P96 A;  4UOC A;  4DSF A;  2VZ9 A;  4P74 A;  3DLE B;  4RNN A;  1UFK A;  5U47 A;  4RR5 A;  1HQ2 A;  2GO9 A;  1B7F A;  5B08 A;  3QT8 A;  2ZH6 A;  4IQM A;  5CD4 H;  1T9X A;  2EW9 A;  4DF4 A;  2OPQ B;  4LF7 F;  4UOF A;  3W62 A;  1RT7 B;  5T14 A;  2KHD A;  4K4V A;  2VFV A;  1IN0 A;  1R43 A;  2BW7 A;  1WI8 A;  4DR2 F;  1LW2 A;  4USU A;  1R0A A;  1BD6 A;  2GHP A;  4L3N A;  2OEK A;  2MQP A;  3C66 A;  4XPE A;  3BPD A;  3H2U B;  4Q43 A;  1CJV A;  2KZZ A;  1WTB A;  1NPP A;  3O44 A;  1WKK A;  5F3T A;  1NDC A;  5E3A A;  1WEZ A;  3ZO7 A;  4ZCL A;  3H20 A;  2OEJ A;  1DQA A;  3DOM B;  1RHU B;  1IKY B;  1PYT A;  2ZKT A;  3MR5 A;  4BWJ A;  2MYF A;  4MKV A;  2Y0B B;  3EM1 A;  3KK1 A;  1HYS A;  3G8T A;  4F26 A;  2Q6B A;  2VKZ G;  4B9T A;  1S6U A;  3L3C A;  2DXD A;  4ZLL A;  1KBR A;  1B70 B;  5A0Y B;  3L4B C;  5KG6 A;  5KFA A;  3R5B A;  1NK5 A;  4O0N A;  2FHO B;  3K5L A;  1U1K A;  4OIX A;  1LKZ A;  2GQC A;  1JLC A;  3DDK A;  3I4P A;  3OL8 A;  4RBT A;  4LIR A;  4CLT A;  3M1V B;  4F4Y A;  2Q3P A;  2H9Z A;  1HNV A;  4RWW A;  4A8W A;  1YQH A;  1G7C B;  5AJ3 F;  4KRW A;  3PYE A;  4LIW A;  1S6P B;  2FC9 A;  1SJR A;  1ZAV A;  2KRB A;  3BV8 A;  3DRP B;  3HP6 A;  4WCE Q;  3V6D B;  4LF2 A;  1H98 A;  1IJE B;  2P9G A;  1TU0 B;  2G0J A;  8RUC A;  1PG5 B;  2IBO A;  3VVT A;  1UJ6 A;  1YWX A;  1F6T A;  1CVJ A;  3A8K A;  3BM7 A;  1J5O B;  4IRK A;  4PUO B;  2YWF A;  3QGI A;  1X5T A;  2DKO B;  2R8I A;  1WEY A;  1PGZ A;  4AXI A;  5DGB A;  5I3U A;  3LP1 A;  2YBV A;  3VAH A;  2DEI A;  4A4J A;  2KXF A;  2V67 A;  3MAA B;  1NCL A;  3HHL D;  2EFN A;  3A8E A;  2HZC A;  3R1L A;  1BLU A;  1B0T A;  4C8M A;  2QZ8 A;  5IV4 A;  4OV6 A;  4P2S A;  1XC9 A;  1QTM A;  4DV0 F;  1U8W A;  2K7J A;  3RBE A;  1IKV B;  4O3S A;  2M70 A;  2C2E A;  1SXL A;  2I1R A;  4KO0 B;  3I0S B;  1HD1 A;  3I4H X;  2VBX A;  3KWM A;  3PRV A;  1RWU A;  2PDA A;  9ATC B;  2JC1 A;  3B4M A;  3LPY A;  2E1A A;  5CZV A;  1R8B A;  5HP1 A;  4NZ7 A;  2VQE F;  1FO1 A;  4OHW A;  1QD1 A;  3F56 A;  2DNL A;  4P9S A;  2RB7 A;  5GAE U;  2AJ2 A;  1RXO B;  4DU7 A;  3QAT A;  2BE7 D;  1S7H A;  2DHX A;  1UVI A;  4TY8 B;  5K5M A;  1FNX H;  1J5E F;  1B4S A;  3CCE S;  3D1Q A;  3JS9 A;  6FDR A;  4PG5 A;  5KG4 A;  1FXL A;  3CCS S;  4ZVH A;  2UUC F;  3W9J A;  2VG7 B;  2R3V A;  2BYC A;  4O3Q A;  1KTV A;  2XLK A;  2A6O A;  4J5O A;  1AXQ A;  1YSJ A;  3CJ4 A;  1T9U A;  3KDN A;  1IVZ A;  1SUQ A;  3R9L A;  3I31 A;  2BX6 A;  3M4X A;  5MAO A;  3M8S A;  1QSL A;  4KHP F;  1NDP A;  5F8I A;  2VQF J;  5SUH A;  4RL1 A;  4CYU A;  4B3M J;  4IQX A;  4Z2X A;  3A3P B;  4MK9 A;  1S1V A;  5HI7 A;  1N5V A;  1HR0 F;  2KVI A;  2NRE A;  2GV1 A;  4OL8 A;  1D9A A;  1VGY A;  3BSA A;  3T1H F;  1HW9 A;  2RKI B;  4Q5V A;  4KH0 B;  3QO9 B;  4Y2M A;  4OI2 A;  5JMN A;  3KK1 B;  3FFI B;  4RW7 A;  1RUS A;  3QWP A;  4P52 A;  4XTT A;  3HFV A;  1U6F A;  1C1C A;  3A3O B;  5J2Q B;  3FMW A;  3E01 B;  3R8Y A;  1Q1K A;  2DNM A;  2CAD A;  2NXJ A;  3T9N A;  4B9V A;  2KM8 C;  3R27 A;  1JLC B;  4LF7 J;  1N6Q A;  2XC9 A;  5LXR A;  4CI0 B;  2DY9 A;  3M2R A;  4C0B A;  2DT9 A;  3MUV P;  2ZBC A;  1QE1 A;  2MHE A;  3Q2S C;  4KGM A;  4DI6 A;  4OZ3 A;  1T9Y A;  4DQR A;  2HBZ B;  3K59 A;  3N01 A;  3MXH P;  4ZCI A;  1RTJ A;  1NK8 A;  2F8E X;  1AZS A;  4ZN1 A;  3NGK A;  4CO5 A;  3LAN A;  2ZHA A;  5DQI A;  1KEK A;  3RBX A;  5L9X A;  3UCZ P;  1RKJ A;  5CZX A;  1M5S A;  3SBM A;  1VQ6 S;  3AA8 A;  2R2U A;  4V19 X;  1REV B;  1WOS A;  2Y0S D;  4G3I A;  2CPH A;  2HS3 A;  5G4D A;  1JLQ A;  2E1R A;  1JNR B;  1APS A;  2ZM6 F;  3PW4 A;  4F7V A;  4QJV A;  3SDE A;  4C11 A;  4J9O A;  3J81 j;  5T7L A;  1UVL A;  2RRA A;  5DZ6 A;  4M5N A;  5I42 B;  3TX0 A;  2JJ4 D;  2QLX A;  3OXL A;  2LQ5 A;  1YG0 A;  3VQS A;  3SV3 A;  3NNC A;  1N5Q A;  2YKM B;  3NAI A;  2CPZ A;  1BQM A;  4M63 A;  1LK7 A;  1EX8 A;  2FLN A;  2J9C A;  4DZD A;  3OLB A;  2JLE A;  4NI2 A;  1RGV A;  4TYB A;  2PI4 A;  5E3C A;  5AJ3 J;  5HMZ A;  4M95 A;  1NK7 A;  4WKY A;  5HP1 B;  2E1P A;  3BB5 A;  2CPF A;  5D0E A;  1GXT A;  3JSB A;  3CCT A;  2B9Y A;  4DOZ A;  4F67 A;  1OSD A;  2W7P A;  2EFP A;  4IYQ A;  4F0K A;  1N33 F;  5ADZ A;  1WC5 A;  1HAR A;  4OYP A;  1WAC A;  2CJK A;  4JI5 F;  2ZH8 A;  4DR6 F;  2W2Q P;  3P3D A;  2AQ4 A;  5SZT A;  2Z2Z A;  1S76 D;  1KVJ A;  5E7O B;  2WBM A;  1TTH B;  4KBI A;  4B9N A;  3AY0 A;  5GAG I;  4J91 A;  4RJV A;  1N32 J;  2V9W A;  5HJY A;  4Y0F A;  5ETV A;  1CJK B;  4TQR A;  1CUL A;  4OYB A;  3GV7 B;  2RHS B;  1RTZ A;  3Q0A A;  5DDP C;  3RRG A;  2JEJ A;  3HFK A;  4QYR A;  3SSS A;  1SUQ B;  4Z7C A;  3WHI A;  2R8H A;  4QIF A;  3MMA B;  3BKT A;  2ABY A;  3ILO A;  2DCL A;  1OSC A;  3UQS A;  1P27 B;  4KKO A;  1PAE X;  2VQE J;  1YHQ S;  2UUT A;  4NYP A;  4CLP A;  2E5H A; 
#chains in the Genus database with same CATH homology
 4EK2 A;  4C6A A;  1BE4 A;  3VVT A;  5IOL A;  1PKU A;  3ELH A;  1WKK A;  4CP5 A;  2B8Q A;  4DUT A;  1F6T A;  3DKD A;  1XQI A;  1S59 A;  1NDC A;  3ZTS A;  4ENO A;  5BXI A;  1BHN A;  1NHK L;  3ENA A;  3FBF A;  2HVE A;  3ZTQ A;  3PJ9 A;  4KPC A;  1K44 A;  3Q83 A;  3VVU A;  3B54 A;  1F3F A;  2HUR A;  3ETM A;  1NSQ A;  3GPA A;  1MN7 A;  3DDI A;  2HVD A;  1XIQ A;  3Q8U A;  2DXE A;  1ZS6 A;  3EJM A;  1NSP A;  3EM1 A;  4HR2 A;  2CWK A;  1NLK L;  3EE3 A;  4ANE A;  3B6B A;  3BBB A;  1KDN A;  1NDK A;  3EIC A;  1VYA A;  2AZ3 A;  3FCW A;  3VGU A;  3NGS A;  1MN9 A;  3VGT A;  2DXD A;  2DYA A;  3FKB A;  3NGU A;  1NSK L;  5CAB A;  1B4S A;  4UOG A;  1LWX A;  3Q86 A;  3JS9 A;  3NGT A;  1HIY A;  1NCL A;  3Q8V A;  1NDL A;  3BBC A;  2DXF A;  3EVO A;  3EVW A;  3Q89 A;  4ANC A;  1EHW A;  1NUE A;  1NB2 A;  2VU5 A;  2ZUA A;  3GP9 A;  4O0N A;  3FC9 A;  3VGS A;  3Q8Y A;  4S0M A;  2NCK L;  3G2X A;  4WBF A;  1S5Z A;  3EVM A;  3ZTR A;  2DY9 A;  3EMT A;  3VGV A;  4F36 A;  4UOF A;  5CAA A;  3MPD A;  1U8W A;  1S57 A;  3BH7 B;  3ZTO A;  3NGR A;  3L7U A;  3FBE A;  3WX8 A;  2BEF A;  4DI6 A;  3R9L A;  5C7P A;  2BX6 A;  1BUX A;  1HHQ A;  1JXV A;  3BBF A;  1WKL A;  1B99 A;  3FBC A;  3PRV A;  1NDP A;  1W7W A;  1WKJ A;  1PAE X;  3BH6 B;  3FCV A;  4DZ6 A;  4W98 A;  4AND A;  4UOH A;  2B8P A;  4FKY A;  3ZTP A;  2AZ1 A;  4FKX A;  1NPK A;  3FBB A;  4F4A A;  1LEO A;  1UCN A;  1HLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...