4UOHA

Crystallographic structure of nucleoside diphosphate kinase from litopenaeus vannamei complexed with adp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
128
Chain Sequence
MVRERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure of Nucleoside Diphosphate Kinase from Pacific Shrimp (Litopenaeus Vannamei) in Binary Complexes with Purine and Pyrimidine Nucleoside Diphosphates
pubmed doi rcsb
source organism Litopenaeus vannamei
total genus 35
structure length 128
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4uohA00
1NDKA 3EJMA 1NDLA 1MN9A 1W7WA 3FBBA 2AZ3A 3NGRA 2BX6A 1HHQA 3FBEA 1NUEA 3NGUA 4EK2A 1XQIA 3VGSA 4CP5A 3FCWA 3EM1A 1UCNA 3PRVA 4W98A 4F4AA 3Q8VA 4DZ6A 4FKXA 3VGTA 1NHKL 1NLKL 1U8WA 3B54A 4UOFA 4DUTA 4FKYA 1BHNA 4WBFA 4HR2A 3ZTSA 3NGTA 3Q89A 4KPCA 5BXIA 1VYAA 2VU5A 3ZTRA 2ZUAA 3R9LA 2CWKA 3FKBA 3ZTOA 1NPKA 4ENOA 2DY9A 5CABA 2AZ1A 3ETMA 4DI6A 1NDPA 3BBCA 3DDIA 3VVUA 1NDCA 1NSPA 2DXEA 3B6BA 2DYAA 1MN7A 2B8PA 2DXDA 1NSKL 5C7PA 1LEOA 3FBFA 1F6TA 3BH6B 3L7UA 1KDNA 4UOHA 3ZTQA 4ANCA 3Q8YA 3GPAA 2HVEA 3BBFA 3FC9A 4ANEA 1LWXA 2B8QA 3NGSA 1S5ZA 1PAEX 3DKDA 1NCLA 3VVTA 4UOGA 3FCVA 3EVWA 3VGUA 3BH7B 3EMTA 4S0MA 1JXVA 1HLWA 1NB2A 3G2XA 3Q8UA 2DXFA 1F3FA 3EVMA 1B99A 3FBCA 5IOLA 1B4SA 1WKJA 3EE3A 1BUXA 4ANDA 4C6AA 1K44A 3EICA 3GP9A 3ELHA 2BEFA 4F36A 3VGVA 1HIYA 1S59A 3BBBA 1NSQA 3WX8A 2HURA 3MPDA 1S57A 3ENAA 1ZS6A 3JS9A 4O0NA 1EHWA 2HVDA 3EVOA 3Q86A 1XIQA 3ZTPA 5CAAA 3PJ9A 1PKUA 1BE4A 1WKLA 1WKKA 2NCKL 3Q83A
chains in the Genus database with same CATH superfamily
3QATA 2CPFA 4BC9A 1SH0A 1WSVA 4Y2AA 3KUEA 4WFXA 3S7RA 2LEAA 1FKPA 2JLGA 3JSMB 4CT8A 4C11A 1VC6A 3GR0A 3QPIA 3PCOB 2HK2A 3VAHA 1RU2A 2AZ1A 4J91A 4QR1A 3DM2A 1N52B 2IM1A 1HNIB 1D09B 1S4EA 2UUCF 3CJKA 2NXJA 2BQUA 3I9V9 2AU0A 4ES2A 3ETOA 5LL6d 1KFSA 3R5AA 1Y0HA 1SJQA 4RNMA 4G1QB 3A3NB 1QVFR 1B7YB 3E8OA 3GV5B 3MD3A 2F8EX 4IFVA 4LF7J 3PR5B 3A8JA 1RT6B 2HVZA 5HP1B 4A8OA 3WX8A 2MHEA 2OEMA 3MPDA 2LDIA 2HHSA 1F5AA 1YHQS 1U0HB 2QMWA 2VPWB 2DNNA 1XEZA 2Y3YA 2CFXA 4DS5A 2CUYA 5CAAA 5F41A 4AL6A 1Q78A 1R8PA 3TA1A 1QY7A 2MZJA 4FF4A 2YX1A 1IKVA 1MG7A 1R0CB 2GIFA 5HROA 4DUZF 3DU5A 2ZOMA 2E66A 4DQRA 4K4SA 1EETA 4CLYA 3HXMA 2ZWOA 1RABB 3FKBA 4LF6J 1SC4B 1RAEB 1DJ0A 2OPRB 2WSFC 2GQ2A 4GC6A 3BJYA 2WVCA 4M5HA 3SCJE 5T14A 1D8YA 1IUJA 3CIZA 1XR6A 3Q8SB 2E7XA 3HVTB 3NGDA 4H4MA 1V3RA 3HFKA 1CEZA 3M32A 3I32A 2MKHA 4P2SA 4O3NA 4NLUA 5AE2A 4M63A 4DR4J 2I5JB 4CLUA 4F4YA 3KFWX 1XMQF 1BGXT 4QWAA 3VV2B 5K8OA 2YH0A 3NG8A 4LRFA 1RTDB 1SL0A 3W3SA 3FQKA 1VHIA 3TA2A 1XNQF 1XERA 5LT5A 3MEKA 3LP0B 2HQCA 2VHGA 2AGOA 4WE1A 1W7WA 1O51A 4RW4A 4JB8B 2RJZA 4ILMA 1HNVA 2AEJA 4DHVA 3C14A 2VG6A 4F4AA 3KK3B 3HI9A 4JI1J 3A3OB 4CI0B 3HVAA 3NY0A 1S72S 3NL0A 3AHPA 1W25A 3M30B 2VQEF 1Q8BA 3OTCA 2D1CA 4NI2B 3R5BA 3GIIA 1QSYA 1ZM9A 3GYGA 3PY8A 3HULA 4JYAJ 2YY3A 4ANCA 4J9PA 2PSZA 2R3VA 2RQCA 3H5YA 1VRTA 1GXLA 4B3TF 2ZH9A 1WG4A 4GKKJ 1WTFA 5CCLA 3CDEA 3FSYA 3UD4P 2KFYA 4LSNB 3DLLQ 2QRRA 4LIWA 2DR7A 2FLPA 4X2BA 3DLHA 3N79A 4F50A 4JI8F 2B6AB 1SV5A 3KK1A 4HTIA 3M6WA 3QT7A 3DOLB 1YK9A 4Y2MA 2IJNA 1T95A 3GZ7A 4TU8A 5EX3A 1NK4A 2ACYA 3OPKA 4HDHA 4RW6B 1TAQA 4I64A 3I9ZA 4JI7J 4P7VA 3DOKB 3OXFA 2IPOB 2PMZD 4PWDA 4KHMA 1UA0A 1RLDA 2PFFB 5EWGA 4OYIA 1Q16B 4RR5A 3CJ0A 5J1EA 3NBPB 3HHDA 4FPIA 3LF0A 2AJ2A 3X1LB 3K7RA 1UVNA 1SUQB 2HMIA 2OP5A 2H54B 4O4RA 5HATA 1CJKB 3FCHA 3TAMB 1B4SA 1BQMB 3GSIA 4P7TA 2A2CA 3D5MA 3ZZPA 3W8GA 2B4UA 5FLXU 2W4DA 3BDPA 4F3QA 1CVJA 1VS3A 4BCAA 4F3MA 2B4PA 4AT1B 3N5FA 1NM2A 1N0VC 4O44B 4I2QB 1JLEB 2ZC4A 4DR1F 1FNOA 1HWIA 2DGTA 2FVPA 2OTLS 1LK7A 2DB1A 3CT9A 3K2YA 4P2MA 5J2NA 4ZPCA 1R31A 4JI5F 2LQ5A 3MEGB 4RW7B 4X62J 3D68A 2DNLA 3POTB 3TJ8A 3QIDA 4IO9Q 3E3XA 1UWBA 1UZDA 4Q2LA 2NLWA 4RZRA 4JI0F 1AUSL 4NA3A 2C3UA 3D67A 4LRAA 1R6YA 2I8EA 1VJWA 3W5XA 2MXYA 2F1FA 4Q0BB 2ROPA 4EYIB 1FRJA 2JL9A 2MQNA 4HDGA 2WVDA 3FCVA 8AT1B 2IA0A 1WC6A 1DQAA 2ZE2B 1QVGR 2DHGA 4IH7A 4X4TA 3ZZRA 1VRUA 1NKBA 4EZ9A 2QC3A 3VF0B 3C19A 3FDSA 2CPZA 2RT3A 4URSA 4U7CA 3KG4A 4A8XA 4D3GA 3IRWP 1NK8A 3KHRA 4ZJLA 4ZKAA 2BJ8A 1WC4A 4IDKB 4R0JA 4KKOA 2M9KA 1RB0A 4OI1A 3S01A 5CD4H 2XMMA 3M1VA 1GTEA 4IQMA 4ED4A 3P5BP 5T7LA 4LFAJ 4U9RA 1JKHB 2HKEA 1RCXB 2D7SA 4CT9A 4RLEA 2FB0A 4IG3A 2C3YA 1NDPA 2FVCA 4E2FB 3D2WA 4B9SA 1QSSA 3B4MA 4LRCA 1DBDA 3AA8A 4I2PB 3LP2B 3Q2TC 3OV7A 3GFZA 5GAGU 3D6MB 4ZPAA 5LM7E 3IWLA 4RX6A 1MROB 2UU9F 5HMZA 5CH7B 1NB7A 1CG2A 3DC2A 1NPRA 2F8MA 2OUGA 2C2NA 1S57A 3LANA 4USVA 4KQZA 4PXEA 4PR6A 2IAJA 1LW0A 4K7QA 2C3PA 4R5PA 1QAJA 5DG9A 2EWHA 4KO0A 2W4CA 5GAEU 2GIRA 1BWVA 4KAIA 3N9UC 4PUOB 3LGNA 4ZP7A 3J81U 3D9BA 4OYMA 5HLFB 5KFAA 5K20B 4LFBF 1P27B 4OZ1A 1N4LA 3GJTB 1HQEA 1TKXA 5K5MA 2ABYA 2BKPA 2FDNA 1FDNA 2XNRA 2D3ZA 2XSJA 3MTKA 3SCKE 1HW8A 2ZH5A 3J7Z5 1ZAXA 3MEEA 4F0MA 3MAHA 4DCJB 1JNRB 4R8UB 1X7VA 3QLHB 2CIMA 4ZLJA 4M5GA 1S99A 3C3LA 4K0KJ 2BJ3A 2KB2A 1HLWA 4DG1A 3KOAA 1U2FA 3QO9B 2XLIA 4WZQA 1Q5VA 3CCQS 4WJBA 1DTQA 1U25A 3CC2S 4L73A 3L3CA 2E29A 2K7KA 1SB6A 3IBCB 1XNRF 1DQ9A 1X5TA 3K5OA 5THWA 2RQKA 2E9TA 4U96A 1HQUA 2V2KA 3G4SS 2Z56B 3K58A 2MSSA 3N4WA 4IFYB 2DPIA 4NRTA 2YQ3A 5LMNF 1N34J 2GS8A 2RMLA 2W25A 2ZUGA 3MMBA 3MR5A 1J5EJ 2R7UA 3GJSB 3PW0A 1NJXA 4QU7A 5FDLA 3ET6B 2YNIA 2EW9A 1FTRA 4USIA 1KR4A 2LXFA 4Q2MA 3D6HB 4DUYJ 2KRRA 3W63A 3DLBA 1GXUA 2GVDB 3IRXA 1YIJS 5DGBA 2K1RB 1NCLA 4L72B 2KRBA 1VIXA 2YWKA 4PCQA 3BO3A 3GIMA 1KRPA 1BUXA 2YPZA 3JTPA 4KT0C 1KWMA 3NRBA 2B51A 3BF4A 1SH3A 1E6YB 3D6TB 1FA0A 4OFZA 1RAIB 2BRLA 2HVDA 3C6UA 1O8BA 1O6XA 3DLGB 2WVEA 1WKLA 1GMUA 1Q81T 1H73A 2Y0SD 2VICA 5EDWA 3MHYA 1KVJA 1VDHA 1WG5A 3UE2A 5B0GA 4B9NA 1EKRA 3RBXA 1VBZA 2FHKA 3V6HA 1JJ4A 2HRUA 4KB7A 2HWHA 4QCLA 4HLBA 4CO1A 4OLOA 3UCGA 4URGA 4GVBB 3EX7B 2VASA 1FX4A 4JI4F 9RUBA 1JLGB 5MLCV 4N8OA 2DR8A 2ERRA 2BJ9A 1WF1A 4YR0A 3CGIA 4DV7J 1LWFA 2DK2A 2RKIB 3DYAA 2DXDA 1RT5A 1YJNS 2GFFA 5BYRA 4UOHA 3N6MA 3VAFA 1WI6A 2DRDA 4IRCA 2ZJRQ 4M5DB 2ZC3A 4OYWA 4USWA 3AD7C 3DLEB 2RU9A 3TX0A 3GP9A 2BEFA 4F36A 4LT6A 2LEBA 2HNYA 4MFBB 4ZIVA 2XEXA 5L1LA 4H54A 4DR7F 7FDRA 3PW4A 4AD6A 5B09A 1IKYA 2XWXA 5F8IA 1NUEA 3MM7A 3DRXA 3QJLA 3NKYA 3R5CA 4OHVA 2AQ4A 1Y9OA 1VQ8S 5G0RB 2PMWA 1A0OB 2B4OA 2WHOA 4OZ0A 1X4AA 2QLJB 2FVQA 3JSYA 1YVFA 3OXLA 3QT6A 3CCLS 2G0CA 1RT4A 4M5JA 2OIHA 2EI5A 1Y5IB 1L3TA 4KR0B 5I4MA 4X4SA 4DFKA 4DPYA 1FVQA 4KH1B 2E44A 4X66F 3C2PA 2OPQB 3DI6A 5DDRC 3OSNA 2R8GA 4RW8B 2FJAB 3V4MA 3MM8B 1EIYB 2EFPA 1YSJA 2VONA 4HHUA 2R9LA 3R5JB 2FGOA 5H9FK 3T1YF 3EVOA 4O3RA 4FP9A 5KFRA 4CLLA 1FNMA 3M9NB 2ZD1A 4B9VA 3JQJA 2MZSA 4J9KA 1KTVA 3ENVA 4RU9A 1FESA 3H4BA 2HGLA 4K2XA 2X1AA 1NHKL 4P74A 4KHPJ 1RA7A 1Q5YA 5ETVA 3QGHA 2C2EA 3MM9A 1U24A 1SQFA 5IV4A 4OV6A 4ENOA 3CMAS 1HNZJ 2V94A 3MPVA 3B4DA 4DPXA 1IQTA 5KG1A 3L7UA 1JWWA 2HHXA 1OPIA 2B5JA 3PV8A 4FS1A 1N33J 1HBMA 3FEXB 4GKJF 1RWKB 1HMVB 3HFZB 5E3CA 2J9EA 4ECTA 3EVMA 5HBMA 1S6QB 2BYCA 2HFOA 4LVOP 4C0OC 1FO1A 1T9VA 4LF1A 3MM6B 4A8FA 5CYQA 3NOCA 2WONB 2J0QD 2YNGB 4AL7A 3SFGA 3B82A 2Z0GA 1F2HA 3UI3A 2FLOA 2GVZA 1TKZB 2UUTA 7FD1A 2KH9A 3RAXA 4LF4J 4K4TA 2VG7A 3C15A 4Y65A 3O44A 1CULA 3TVKA 2CVIA 3RR8A 1ZPWX 2NR0A 3G82B 3VGTA 2DIUA 1BHNA 4EZ6A 3THTA 1TUVA 3SEOA 3AOCA 1QM9A 2DISA 1JLQA 3O8WA 3A12A 1UMJA 2QA4G 2C2DA 3SDEB 5BR8F 2JRSA 2K8GA 3T6BA 1LEOA 5D3GB 1AZSA 5A2QY 5AJ3J 2QSWA 3NNAA 4RO0A 3M2UA 4UOCA 3LOUA 3AOAA 3K5LA 2CVEA 3PFEA 3HSZA 2DNKA 3ZNJ1 1KONA 2DD8S 1WOPA 3CEDA 4IG0B 3R2DJ 4L75A 4PRFA 3F41A 4LQ9A 1RWOB 3T1AA 1WOSA 5CABA 2E5IA 1ZYQA 4HHHA 2XBPA 2F8HA 3GYNA 2X51A 1X5OA 3TP2A 4MAKA 3JYTB 4DZ6A 3BR8A 2R2RA 5KFJA 2CQBA 2V8HA 4LR8A 2JFDA 2E1AA 4J9LA 4FKYA 4DR5J 1NSAA 1VGYA 2CJ9A 2W9CB 3D0IE 1CSJA 4FNHA 1IKXA 5KFVA 3DOMA 2ASJA 3AY0A 1TL1B 4UY85 4JP8A 3LWLA 4DR4F 4DZDA 1TV6A 4CO4A 2ZBRA 3T5LA 1SIWB 3GFHA 4J9SA 5A8KB 4DEZA 4OX9J 2L3MA 4RNFA 1LWXA 1S9GB 1VRQC 3EPIA 2DJWA 1JJCB 3N01A 2JX2A 1Z4UA 1T03B 2E9ZA 5D15A 2GNKA 2RHSB 4BBYA 2MJUA 4JI1F 2XM3A 3E01A 2M70A 3MR7A 1F9FA 4OZLA 4ZHRA 1SQGA 1B0VA 1C1BA 5ETRA 2OELA 1XR5A 2A6MA 1NBEB 1F0XA 2B9WA 1WORA 2BOAA 2IFXA 4W90B 5J2QA 3IMQJ 4LF9J 1FK9B 3SSRA 2W2QP 1VK8A 4ZN3A 3MURP 3OTEA 1IBMJ 2F5GA 3I4PA 5K14B 1F9HA 1XMOJ 2ZUAA 4GKKF 1B70B 4F2RA 1FERA 4I69A 2IMWP 1S49A 1SJFA 5CCMA 1U1NA 1UVJA 5LMUJ 2G9OA 3M6VA 3RUBL 4QOTA 1JX4A 1URNA 3KJVA 2QLBB 2QGFB 1GXTA 4WU3A 1N5SA 1RWMB 2Q79A 1ZAWA 2LECA 1PC4A 2VG5A 4IRKA 2R42A 4GVLA 4G6VB 1ZZNA 1WUUA 2HFNA 2ZOFA 2CADA 2CQ0A 4IFVB 3AOBA 3BGOP 1S9FA 4NXNF 2ZDPA 3PJ9A 1ZA2B 2W7OA 2LQ8A 4ZMMA 4QJVA 3SXLA 4ELTA 2ZOGA 3OTOJ 1RDRA 1J5OB 3FCWA 4MYTA 2ZZNA 4H4OB 1C0TA 1KOOA 1FRIA 2KT5A 2HSEB 1RT2B 2AV5A 3RTVA 1P8GA 1RT7B 4ZIWA 3MR3A 4JV0A 3R9LA 3GILA 2HW3A 4C8OA 5HROB 2YWGA 1FWKA 3SV3A 4P71A 2V8GA 5KFSA 3JAMU 2KHDA 3FC9A 3FZ2A 4JI6J 1UP1A 4UF4A 4CO3A 3H0PA 2OEKA 4QIVA 6AT1B 2BRKA 2XTJP 4DQPA 2YQ1A 2QA1A 2XS7A 1B99A 5D0HA 3LGMA 2R7OA 4C6AA 1HIYA 4H4MB 1TL3B 2BVZA 3UCZP 2IJRA 3H40A 3EXCX 4U8VA 4N5SA 1NJYA 3LPYA 2JC1A 3PYEA 3TVZA 3EGVA 3KMQA 2E9RX 2HS0A 2QO3A 5GMKa 1Q8KA 2QLFB 3BSCA 4IR1A 4DL7A 3KLEA 1U1PA 3VAJA 5D4NA 4KGXB 1F5CA 4RW4B 2Q6BA 3RBEA 4ED1A 3HX9A 1R8BA 3M8RA 1W2BR 1VQOS 3C14B 2VG6B 2DY9A 1D1UA 3LAKA 4AQYF 3TUZC 4LR9A 4QYRA 1GMWD 3J81j 2AYBA 2MB0B 3GPAA 5KFBA 3IWXA 3T1HJ 3TZXA 2VFRA 3QZ8A 3VZIA 2GHPA 2M7SA 4KY3A 2GO8A 5KT3A 2N3OA 3K5NA 3V4IB 4IQXA 4DQSA 1E6VA 1S1UB 4IUFA 3DXSX 4HYKA 1VRTB 2LVWA 2ROGA 4P6QA 2H9ZA 3IS9A 1OO0B 1U4BA 3K59A 3DLKA 2OKQA 1RKIA 1NK6A 2CPXA 4KHRA 4DR3J 4ZS6A 3NGUA 2WBRA 2MQMA 3B54A 1R6VA 1S48A 3UWTA 1TTHB 2YKMA 3TR5A 3ZTSA 2LCWA 2HHHF 1CS4A 4DR2F 3I87A 1IVZA 4PG5A 2DNYA 5E3AA 1U02A 2LYVA 3TZZA 1QSLA 4I1TA 2G1DA 4WYLA 4NLOA 4NXMJ 3I96A 1DHMA 2VV5A 4EI2A 3CJSA 2CPIA 2GAGC 1Q7YT 4DV1J 4TU7A 3L7OA 1AB8A 2UXCF 3R27A 4QWBA 3CF5Q 6FDRA 3D54A 2KZMA 1IXKA 4CH0S 1HWJA 2HAFA 5IC4B 2KT3A 3TEHB 5A6PA 4AXJA 3HHKA 1NK7A 1U2CA 3CMES 4L6V3 2PGCA 1RWXB 1SKUB 1FD2A 5KT4A 5HVFA 3BO4A 2BXJA 1FDAA 2KJWA 3B6BA 4GMKA 1CJUA 3M2VA 2MMYA 5M2UA 4WK3A 1YZ6A 2M4MA 3FJ2A 5DDQC 3U1LA 1UWBB 2K2PA 2XMWA 1GH8A 2P5VA 4CLPA 2VD3A 4C8KA 1RHRB 3C16A 1DTTA 4TN2A 5HMXA 2LFVA 5DZ7A 4UUXA 3R6GB 4LQ3A 3I0RB 3LUYA 2BABA 2DO0A 2FHOB 2APOA 1HBNA 1N34F 4MKVA 2X3GA 3V6DA 4EMDA 1J5EF 1JLBA 2YNHB 1FD8A 4WK1A 3H5XA 4OYXA 3DMJA 1PKUA 4NYPA 1HBOA 1YBTA 1BWEA 1YJRA 3TQEA 1G3OA 2OPSA 5KFCA 2MKCA 4DUYF 2IDEA 1UFKA 2QL7B 2HQGA 4I4BA 4KKOB 4CTAA 4NZ7A 5J1NA 3E51A 3T3FA 2HK3A 2QMXA 3I0SA 4USKA 4P75A 2UP1A 4PEOA 2BKNA 3MECA 4E0DA 1WEXA 3GFYA 1H2VZ 1NDCA 1TL7B 4NASA 3H98A 3R1HA 5SZTA 1TKTA 4P9SA 5FD1A 3BSNA 4DL3A 5B0BA 1LKZA 2OLWA 4Z2XA 1C0UB 4YFUA 3MZIA 1MNEA 5KG0A 3CD7A 1T9UA 1RU1A 3V2UC 2AYGA 3IFEA 3HMJG 2UVUA 1U47A 4QYZK 4CM2A 3U1NA 5KG5A 1FRMA 4QPXA 2BOPA 3RJMB 3UQSA 3UN5A 2ROEA 1F2GA 5DDPC 1X9WA 3HVWA 4WFBQ 2QZ8A 2ZITA 1UEVA 3B78A 4X4VA 2VB6A 1LWCA 5CXTA 3MEDA 1AYEA 4WFNQ 1TELA 1JLFA 3QIPA 3KJQB 3IAS9 1U0SA 5HAOA 2WVBA 2CJYB 2HHVA 1AXQA 2VQFJ 1VQ5S 3PIOQ 3FBEA 5K8PA 2H51B 2ZJQQ 2JLFA 2XCAA 3CDUA 4J9RA 5DLFA 2FZKB 2HFVA 4HVZA 3UN2A 1N88A 4YDDB 4RUCA 2NSBA 1EX8A 2VZ9A 1BMQB 1LXNA 1Q82T 2GIQA 2HRYA 5LJ3Y 4BDPA 4NYZA 3BSAA 3VVUA 4CH7A 1N56A 3JB9k 4UY8T 2WAQD 3KLFB 4PG8A 2ZNYA 3DRYA 1SVDA 2RH3A 3LALA 2QMUB 3BREA 4WXOA 3AXKA 3JSBA 3VGUA 1R8AA 2QE5A 2LU2A 4Q8FA 2XSJB 3GU0A 3M8QA 4OYAA 4A4JA 2Z2ZA 2IRYA 2W2NP 1RADB 2M52A 1YWXA 1LWEA 3H59A 3O6QA 1XR7A 1WC1A 4FPRA 3BGUA 4LR7A 3TO8A 4DG1B 2IC3B 3JS9A 2B9YA 1F60B 4ED7A 3HZGA 1U8SA 1T8EA 3HD2A 1NK5A 5KG4A 1KQKA 1DTQB 2I6WA 4FXVA 2C2RA 4TQSA 3D7SB 4NWBA 1REGX 2FZGB 2RDIA 3K8WA 4WCEQ 1DURA 4DPTA 3BB5A 3ILLA 1T9WA 1B3TA 4FF3A 2VC1A 5KG3A 2XB2D 1S0MA 1WHXA 5KFUA 5A8RA 3KUHA 3DN9A 3MMBB 1FEHA 1RT3B 3ICLA 3RG6A 3OBIA 1UJ5A 2MKIA 4CNYA 2HFUA 3DGPA 5C25A 2JDJA 2YNIB 2CQ2A 1PG5B 1NKEA 1JXVA 1R43A 1HI8A 5DG7A 2G0JA 2BANA 3MR6A 2MZQA 3M6XA 2JHEA 1RGVA 2ZH3A 4C8MA 1HNXJ 3ZNUA 1U1KA 1RTHB 3TJAA 5A0YA 1KQSR 4PG4A 3OQ2A 3FUYA 3CW2C 1M1KT 2RNEA 4TQRA 3TVYA 1HHQA 4RW9A 1TP7A 3KYLA 4ZVHA 3HPOA 1H72C 2AP6A 5IS2A 2M8DB 2NSCA 4O4GB 2XI2A 1QTNB 1A7GE 2JJ4D 2NS1B 4WU2A 4YB5A 2V9KA 2KM8B 4DV4F 1N5YB 3RW7A 2XMVA 2CG8A 2J8AA 3EWGA 2XZTB 4J9NA 2BQ3A 4EBDA 1VC0A 2B4VA 2FHJD 4EWTA 1IR1A 4XIUA 2YKAA 3QWUA 3PG9A 4QWCA 1VJQA 4AL5A 2CZ4A 3NWGA 1WJ9A 2EXUA 2L9WA 5F3TA 3PO4A 5AXNA 3EZ5A 1X8DA 3DYAB 4LF4F 8RUCA 3GJRB 3NEKA 4QIEA 3MXHP 1XWLA 1GNKA 3RB4A 1HPZA 2KL8A 1T9XA 1I1GA 3MM5B 3GG0A 3N6LA 4LBPA 3QSIA 1XN9A 3BZQA 1SKWA 1WKKA 2ZHOA 2HQ3A 4P2FA 5CA5A 1GAOA 4UUWA 2XLKA 3HCXA 2HLTA 3A1YG 2HNYB 1HHTP 4DV2J 4DXLA 1DFDA 1CJTB 4USJC 3PVXA 2CWXA 4IOAQ 1TUGB 2VOPA 2MZRA 4X84A 3W7BA 3PIPQ 4G1PA 3GMGA 2EFQA 3DRRB 2V50A 4KGVB 1RAHB 1IN0A 4UZCA 3M8PB 2RF2A 4ZVUB 3SI8A 3CCES 2N4CA 4OYOA 4IKAA 2NXUA 3MAAA 1TMJA 4DN9A 2A3JA 1GQEA 4TNOA 3IN5A 1DLOB 1OMSA 3TEGA 4FYDA 3ITHB 3ZZZA 1WTBA 4DV6F 1NO8A 3U02A 3ZO7A 4Q45A 3EVWA 2G0IA 1YRUA 2FC8A 5CZVA 3EGWB 4OL8A 3W9JA 4B3RF 1X5SA 5I42B 2ZBQA 3W2VB 4BLGA 3EDQB 2C3OA 5KFQA 4ECRA 3KLIB 1RAGB 1RTJA 4ILLA 3KNAA 1FFWB 4GC7A 4YQWA 4NLPA 5H9EK 1LFWA 2V34A 4OJ3A 3MUTP 3MMCA 4B9UA 3Q89A 2LQ9A 1Q86T 4ICLB 2HIQA 5F8NA 3FSIA 3DLJA 4PWWA 1H2TZ 1N6QA 2YNFA 4PPDA 4CM0A 5IM0B 3KK2A 3A8EA 1I94J 1ZM4A 3AD8C 4F4XA 1CQMA 3W65A 2ZNZA 1K1QA 4ZCKA 1WDTA 2OAUA 2IVYA 2K06A 4OI3A 4ECYA 1U6ZA 1TU0B 5ETKA 1S59A 2FVRA 4WFZA 3AXMA 5EHHA 3CJ5A 2Y0BB 1DY3A 1FKOB 5D4OA 2RHQB 1S1TA 3DRPA 3MTJA 1S1VA 3Q23A 4BC7A 2BR0A 4HT5A 3M05A 2GVZB 3KDOA 5LMUF 5BYSA 1RXOB 3UVJB 4P10A 3JSMA 1T9YA 4Y34A 2U1AA 1UW9A 2VU5A 3FRZA 1S6PB 2RDDA 4WYWA 3HT3A 2BA9A 3ZTOA 2IM2A 3WC0A 3ILJA 3KHHA 4DPWA 2QEXS 4NZ0A 2V4RA 1HNIA 2N7CA 3JTOA 2H1YA 4U67Q 1N5TA 4B3SJ 3THPA 5HQMA 3OFGA 4G1QA 4YY3J 2KYZA 2G4BA 1S7HA 4ZP8A 4CCHA 2EFGA 1PILA 5GAGI 1S6UA 4M5LA 1JJHA 3FBCA 5A6WA 4DV0F 2ACMA 2AJFE 1WKJA 2YBVA 2C42A 2UUBF 3GR1A 1K44A 2XCPA 2VFVA 1RT6A 5HQLA 5HP1A 1Q1KA 2XWYA 3GB0A 2BJ7A 3FGVA 2GZOA 4YDXA 3F73A 1ACMB 4ECWA 1T02A 1TVRB 1M0SA 1QE1A 1K47A 2M5YA 4ED0A 3KLGB 3OTDA 3QFWA 4LREA 7AT1B 2NXCA 1YITS 3GIRA 5GAEI 4RKUC 1IM6A 1BQNB 1OYEA 2PFDA 2DNGA 2GCFA 5KG6A 2DGXA 4V1Ak 3K5PA 2UXDJ 4DU8A 2FQQB 4PAAA 2OPRA 4C9DA 3G86A 3PW5A 4I6WA 3RRKA 1L3UA 1NAQA 3ZZ0A 2HHQA 4CLFA 5AT1B 1KOHA 2V4QA 2HVEA 4N47A 4KTQA 3HVTA 1FCAA 1FRLA 4X65J 4RUBA 1X60A 4UQTA 1N32J 4K5SA 3VALA 1OJ4A 2LXIA 3CC7S 1VK3A 4OX6A 4ZVRB 3OT9A 4CO0A 1OSCA 3CE8A 1RTDA 4TU9A 2UUWA 2YQ0A 3HSGA 1SL2A 1RCOB 5BYQA 4USMA 3LP0A 2Y1IA 4DL5A 3IC1A 5IT0A 2JEIA 2NCKL 1KHVA 3UFCX 4KJIA 4F26A 1YGYA 1X31C 2AZ3A 3E01B 1U1OA 2OFHX 2GJFA 1RBAA 4EGLA 1WEZA 4RBVA 5RUBA 1VQ6S 4M95A 4O0IA 2B3TB 1MMDA 4HTJA 3KK3A 1X4FA 3KNGA 2UV8A 3IR6B 3CJ8A 4ELUA 3L4BC 4Z7CA 3T1HF 1OYDA 1UPPA 1WC0A 3C6TA 1FHTA 4JV5J 1JIHA 4ZPDA 3M30A 3MAQA 4C3LA 2XGQA 1RHMB 1IKWB 4DSEA 4NI2A 1AUDA 2WB1D 3TX8A 3L09A 4C98A 1ZM3A 4YHHF 3QJJA 3QQCD 3NGSA 2J5AA 2Y9HA 4FBUA 1IWAA 2F4VJ 3WIUA 4K8RA 1YDLA 2GC8A 2OH2A 1P9YA 1C4AA 4LSNA 4N8NA 2RAQA 2DGUA 1M90T 2V8DA 3GTYX 2B6AA 1B7FA 2MQ8A 4WPAA 2EKYA 3DOLA 3FVYA 2CPDA 5EWFA 4ES3A 2UUCJ 4QW9A 4O3SA 4F2SA 2YPYA 2KU7A 2DGOA 2Z30B 4RW6A 1BD6A 4JBCA 5D6GA 2VKZG 2Q43A 1CJVA 4IRDA 4KPCA 4MIBA 4I0WA 3CCWA 1EZZB 3M9OB 5J2PB 3DOKA 3LWMA 3ZXWA 3ETMA 3BQ0A 4XDCA 4K5RA 5EUHA 2YVSA 1UVMA 5KFKA 3IGNA 1U45A 4MJKA 3ZZTA 2XMKA 2C22A 3NBPA 2UZAA 2KTQA 1HR0J 1Y5NB 1FJEB 2MKYA 2JSXA 1SUQA 1AROP 1CJKA 3TAMA 3AH6A 1BQMA 1M1HA 1VHFA 2OGUA 4DUZJ 3SBMA 3N5BA 5DGAA 2NXNA 4N56A 1ZS6A 2OMOA 2XZWA 4RWXA 2HBRB 4LFCF 3HKWA 1DZ5A 2A10A 3DDNA 4O44A 2V4JB 4I2QA 1JLEA 3UW1A 3Q8PB 1JMTA 4PABA 1VQLS 3K0JA 3JSRA 4ETXA 4Y00A 3PRBA 2ZBPA 1M1GA 3PDNA 2K7JA 2R7TA 4USTA 3AODA 5H9FJ 2JLEA 2AX0A 4I7FB 3MEGA 5BXIA 2DNMA 4RW7A 4DFJA 4NL5A 2LKZA 1VQMS 3KLEB 2N82B 5JMNA 1VOMA 2H4YB 1RA6A 1ZTWA 4NRUA 2YTCA 5C7PA 4PQAA 1XNQJ 2DCLA 3BKUA 2AWZA 5L39A 1NU4A 2F40A 3PX4A 4Q0BA 1PAEX 1C1CB 2DH8A 1Z1ZA 3CWJA 1TQLA 2ZE2A 5ETNA 1X0FA 2H48B 1WHWA 1RTIB 2HZVA 4NE9C 3R6LB 2CPHA 1P9QC 5CZXA 2VQEJ 3PHEA 1EJ7L 1VBYA 4DL6A 1G2EA 5EGYA 3G9CA 3M4XA 4FYXB 2PE8A 3PHTA 4F02A 3Q0AA 2BW2A 1VR6A 3OTBA 4UOFA 1FXLA 2HWIA 1H2UX 3FZBA 5KFYA 4B3TJ 2MTLA 1Y00A 1RUSA 3L9ZA 3FSXA 2V5HG 2W2MP 5MAOA 3CJ2A 2XHWA 4MK7A 4KIAA 3HHLB 4Y28C 1OY6A 3OR1B 4BWJA 2LEPA 2COLA 3M7VA 2Z2MA 1GTHA 2Q3PA 3HO1A 1KTQA 1GMWA 4I2PA 3LP2A 3H2UB 3BBFA 3H5UA 2GGPB 3VVTA 3LTOA 2VUGA 3T5JA 2J7UA 4PKDB 1ZH5A 4RBUA 5HO4A 1MROA 4NCGA 1DQ8A 3H25A 4LF8F 2MLXA 2MGZA 1FFSB 1TMMA 4KBIA 1FE0A 1BY9A 3G6XA 2C1EB 2W1BA 2VJVA 2CPEA 3NLCA 5KT2A 4LVNP 2QTWA 3CVKA 2W7AA 1JLAB 2YH1A 2CNKB 4LIRA 1R27B 2ZHAA 2BX6A 3UDCA 5DQGA 4JOUA 4Q44A 4N76A 3H4DA 3OVBA 4PUOA 1P6TA 2A2DA 2LP4A 2VBYA 3QAEA 1S1WA 3MWBA 4LF2A 1SIZA 3NMRA 5KFEA 3VAKA 3PO5A 4P73A 3KG0A 4USHA 5GADU 4M5NA 1URRA 3AD9C 5DM6Q 4R8UA 3FEYB 4OYBA 4DR1J 1HYSB 4YEAA 4OZ2A 3T9ZA 5BJRA 1CJUB 3M2VB 2V67A 5IOLA 1H74A 3NCQA 3BGLA 2MQQA 3QO9A 4TYAA 5KAKA 1IBLF 3AJDA 2CDQA 1HI1A 4JI5J 1DTTB 4FF1A 2Y8WA 3NMAA 3MGJA 3J80U 5B08A 2UVWA 2C2MB 4TY8B 2HNDA 1X0PA 1IR0A 3ONQA 4ID5B 1U1QA 4FYVB 5HMYA 2CJBA 5KFXA 2EC2A 2GHWA 3DNCA 4CP5A 1HNWF 2OD4A 4IFYA 4NPOA 2KZZA 4USUA 4FKXA 1XC9A 2HQFA 3PX6A 3CCRS 4WF9Q 1RAAB 4DUTA 1OY9A 2I1RA 1HBUB 4DF8A 4DR6F 1VLYA 4CLWA 4ER8A 3PNIA 3TARA 3ET6A 4RUHA 2LQJA 2DKOB 1ZPVA 3C66A 3VCDA 3QZ7A 3THVA 3I0SB 3HJFA 4ZCLA 2IYGA 1OQ6A 2X1BA 4QPTA 5IC6B 1UW4A 5CHCB 2K1RA 3R5GA 4ZVTB 2YKNB 2Q6CA 1X4EA 2OSRA 1NHVA 5LSLA 4HHJA 4ZVSB 4OZJA 3IG1B 1N48A 4ZK7M 5F8LA 2CPJA 3DLGA 2N4DA 3VZHA 1YG0A 2AJQA 2V9WA 3RR7A 2PI4A 4TXSA 2WRMA 3MEDB 2UUAF 4YOEA 2MYFA 1MMLA 3QIPB 2XMJA 2OSQA 3KJFB 4MIAA 3HF5A 2KXNB 2A6OA 2UU9J 2NQPA 4GVBA 4DCOB 1RP5A 2AYMA 1IJFB 1EP4A 4Q8EA 3NCRA 1JLGA 4XPCA 1B0TA 1NSKL 3D1HA 2DNPA 2RKIA 1SPBP 2VA2A 4K4UA 2M8HA 4DV3F 2W2OP 2MEWA 3M2RB 4ILRA 3U7JA 3W60A 2H4WB 2QLXA 5C24B 2J0XA 4M5DA 4DBQA 3O3LA 1KSPA 4HL9A 4V19J 4A48A 1YJVA 4FZVA 5IWAJ 2R8HA 1O5JA 2MY8A 1FWPA 2V8PA 3DLEA 1HFEL 2SXLA 4QU6A 5A2QU 2L08A 4WFYA 4LFBJ 4DPOA 4NLTA 3NOGA 1Y11A 4CYUB 2MQPA 4DFPA 1FE4A 4B9LA 4ZVOB 4ATNA 2IY5B 3QMQA 1HKAA 2NZ4A 1G4CA 2WK4A 4UT4A 1U48A 1EARA 2FJVA 4A47A 4PZVA 2LU1A 1S1XB 2KO1A 1PGZA 5HK4A 2W9BB 4FXWA 1PJ6A 3TUPA 2RS2A 4DSFA 4IR9A 2W2PP 1HD0A 5G0RA 3TA0A 3OUYB 4MKBA 2Z58B 1CBKA 4BWMA 2WCXA 4AFFA 3CTRA 3V5RA 4X4NA 6FD1A 1QTMA 1OWXA 5ETQA 3FBFA 2XMTA 3P4UB 5D0EA 1XBWA 1XNRJ 4HI2A 4RNOA 1Q4RA 3DFEA 3ZTQA 3AAWB 5A8RB 2HHPA 3BN7A 4OJ1A 5C42B 1CC8A 5E3QA 5A8WB 3J7YU 3M8YA 5LMNJ 1GFWB 1XK8A 4KH0B 2QLWA 2R7WA 3DGPB 1SJ1A 4G65A 3BBBA 1NSQA 2OPQA 2J6SA 1PCAA 3TUIC 1H98A 2EC0A 2X7IA 3MM8A 1VQPS 2LQBA 2XY6A 4L74A 1S6OA 1M5HA 3A8KA 2UVVA 2DNHA 3L95X 2LMIA 1NHUA 4GO7X 2XMUA 1F9EB 2IHR1 1YKWA 1FDBA 4Y0FA 4NYOA 3O5TB 1EKSA 2I9SA 2DVIA 1IBCB 5SUHA 4UZBA 1RT1B 2XS5A 4LUBA 3PKMA 2M2BA 1WF2A 3G71S 3Q8QB 3CCSS 5F0UA 5CYJA 3V81B 1TK5A 3DHWC 1IWGA 2B56A 3UNYA 3CCMS 4NLWA 2IBKA 1VQNS 3HM9A 2OJ3A 1HMVA 2D41A 4NLRA 3T6JA 1SJ4P 4ZLLA 1KEKA 3MMAA 3MM6A 2HQIA 1UTAA 3TRGA 2RS8A 2GHVC 2WONA 4JI4J 3HFVA 5F8JA 1L3KA 3MUVP 2HBQB 2M3DA 1REVA 4ITSA 4O23A 4IO1A 1HPZB 4C7QA 1EQMA 1T7PA 5KT7A 4ZVGA 4DSJA 3SQOP 2UV8G 3CSKA 2AF6A 3G82A 1HWKA 2IJFA 4M94A 2B9EA 2MZ1A 3PFOA 4CLZA 1LW2A 1PIEA 2XY7A 1SC6A 3R3TA 3BV8A 4ZN1A 2FHJA 5D3GA 1NJIT 2DR9A 1PAUB 2Z57B 4DR7J 1X5PA 2RF2B 3HHEA 5FJ4A 2KYXA 3TW0A 4KRWA 2ATLA 4JI2F 3TYTA 3FFIB 4CLTA 4K2JA 3P45B 5AXMA 2ILZA 1D8ZA 3JQMA 1OPZA 3R97A 2HHTA 5AE1A 4W92B 1YLXA 4ZVEA 2BKOA 4IG0A 4ED3A 1LXJA 3I56S 2XG8A 2DHXA 3MOZA 3M8WA 4OZNA 1MSWD 3RGIA 2RB7A 1KLMA 3D1QA 2HHUA 4MH8A 2RUGA 1RTJB 4CH1A 3JYTA 1ZETA 1L3SA 4DDFA 2ZVSA 4X65F 2W9CA 1RLCL 4X66J 4QZVB 2G2YA 4DX5A 1V3SA 1X4HA 4MTPA 5T41A 3UR0A 5GVQA 2RSQA 4F04B 3HD1A 4U7UK 1WD6A 2AKWB 2DY1A 3T1YJ 2E7VA 3NAHA 3S1TA 1KBRA 2AJ1A 4M1KA 1VBKA 5ETTA 3D6FB 2YX7A 4IYQA 2F7VA 4ES1A 2YWWA 1S9GA 3LP1B 2DXFA 2KXHA 2LLZA 1T03A 4HACA 1VBXA 3CJQA 3P96A 3OVSA 3CCZA 4NA1A 2WZ1A 4CZCA 1FXRA 5KFTA 2I38A 3TAQA 4DJBA 2V69A 4QYZJ 3HLUA 1N36F 1NNDA 3JXOA 4ECXA 3SV4A 1FK9A 4GKJJ 2CJQA 2OPPA 1QAIA 2F4VF 4JI3F 1QUVA 5K14A 5HVGA 5CYMB 2P6SA 2AJ0A 4O3OA 1WACA 4F8RA 4A8KA 3W9IA 4KFBA 1V9OA 2JZ5A 4WZMA 3EYZA 1DRZA 4NLQA 4B3OB 1WC5A 3OW2R 1RQ0A 1JJ2R 3CMQA 1VQ9S 4PQUB 4A8QA 2CQ3A 2DHHA 3GG1A 4IOBA 4OYZA 2EPIA 2JH3A 2R7VA 1VI7A 2J7WA 5KOXA 2D9OA 2DCUB 2CQHA 3BEGB 3ZZOA 1T3NA 3VWSA 3SQGB 3RW6A 5BR8J 3BPSP 3BSOA 1JLCB 2VL1A 3ILOA 4LF7F 3D4JA 3NS5A 4Y6IA 1J5OA 1KVIA 3CDBA 2RE1A 4H4OA 1QE1B 2FJEB 4DU7A 1TK0A 1RT2A 1HR0F 1S0NA 1YJ9S 3NCPA 4DL4A 1RT7A 3D66A 2BW7A 2FZCB 2RRAA 3FRYA 1GK8A 1S79A 3LA0A 4EYHB 2LA4A 2C28A 4NOHA 5F8HA 4YS2A 2MKSA 4ELVA 2DGSA 4UTGA 4K4YA 4LF6F 1SI9A 1NZAA 3OL7A 4OI0A 2R8JA 4P72A 1SCJB 2ZH7A 1U6FA 1TL3A 1WHVA 5JJBA 1V5VA 1WOOA 1FVSA 3IM8A 1Q8LA 4DX7A 3NS7B 2MLZA 2XNQA 5D78A 1LFPA 1KN6A 1FJCA 2LDYA 2LXUA 5L9XA 1H7WA 1RISA 2WW8A 4R0EA 1BLUA 1WEYA 2QYCA 2Y1LB 2DO4A 2HS4A 4QWEA 2E1PA 1TL5A 5AXLA 4B9TA 1K8AT 2DT9A 3HHLD 3OR2B 3T19A 3SCIE 5ETSA 2J9DA 3GQCA 3C6TB 4I68A 3OSPA 4LJMA 1WELA 1J2VA 1XTZA 2XYGB 4ERDA 2RU3A 2H5EA 5M2PA 2MPUA 5HJXA 1NB2A 3MD1A 3C46A 3KMSA 2WTFA 2B43A 2AEMA 4AYBD 3V4IA 2FJWA 4F7VA 1CPZA 3GYXB 3BKFA 1S1UA 2RVJA 4B9MA 1JQGA 3PTWA 2WW4A 1KVKA 4JYAF 1K0VA 5ADZA 4KV8B 3LW5C 2CJXB 1Y3KA 3ZTPA 3WBZA 2Q1LA 1T3OA 4AXIA 2BDPA 1MN9A 4XK8C 4DQIA 1WHYA 1Y10A 5KT6A 3BGFA 5HANA 5HL7Q 3VTIA 1RHKB 4DLEA 2PT0A 2IVFB 1FKPB 4H4KC 4DOZA 2D3UA 4C11B 4HKQA 3H5SA 3NGTA 2DBBA 4MIWA 1RWUA 3IBFB 3QRPA 2PD1A 5LSOA 4J5OA 3J7ZT 4XAKA 3DM2B 3CJKB 4J9MA 4DX8H 1CJVB 1VQSA 3I5CA 2I0XA 5LXRA 1RACB 4OJGA 3HHLC 4QWDA 3D0GE 1JXLA 2JFKA 4NXNJ 5KFPA 3OL6A 2GA7A 4JI7F 5LJ5Y 2ZM6J 5I3PA 4NMLA 3PX0A 2NZCA 4JV1A 1PJ5A 5DZ6A 4UQGA 2RD5C 2GMLA 2YKPA 1F1BB 3PJWA 3CIMA 1YJWS 4RPFA 3WQPA 1UPMB 1IKVB 1AA1B 2PEBA 3W9HA 3DRSA 5KTQA 3HP6A 2XI3A 2BJEA 2BM1A 1EETB 4J9VA 2ALZA 2YXLA 2ZDOA 2QT7A 3CULA 1IJEB 2ASLA 3TAPA 3HDSA 2XULA 2NYHA 1UFLA 4J7CA 1RK8A 1Z2ZA 2BZ2A 2Y8YA 5KG2A 1RI7A 3NGKA 5H9EJ 1UA1A 2NYIA 5DETA 2ZKTA 2JOQA 3FMWA 2CQDA 3MDFA 4ECQA 2MSTA 1I6JA 5EN1A 4LRBA 3Q8YA 4YMEA 3KHGA 2CQPA 2CAJA 3M32B 4FS2A 4X62F 2RIJA 1T05A 3IXQA 1APSA 2R7XA 3ZC4A 1F3VA 3I0RA 4PYAA 3RB6A 1Q8IA 1NK9A 2DNOA 4P2XA 3AQPA 2JNJA 5C5JA 3PACA 3GCXP 2HG4A 3W61A 1D3WA 2YNHA 3DCAA 3Q22A 5M2RA 4WE1B 1X4GA 2BM0A 1HNVB 5IT9Y 3WZ0A 4AQYJ 1NJWA 1S7IA 4RBTA 2CNLB 5JXSA 1S77D 4OI4A 4QR2A 2JC0A 3VHQA 1VC5A 3PEJA 2OD6A 3MCSA 4C4WA 1MW7A 4I6YA 4C8YA 4C97A 4YN3B 2MKJA 3R7BB 1R0AA 3CJ3A 2JEGA 1ZTTA 4KGKA 2EG1A 3PJXA 4TYBA 1R0BG 2EFNA 1TL7A 2HQDA 1M5VC 2V63A 4LFAF 3BM7A 4O3PA 5HMWA 2IM0A 2J9CA 3EMTA 1X4CA 1C0UA 3MF5A 3OJSA 3OHAA 3FQLA 2LA6A 5F0WA 1QD1A 2EFVA 3AT1B 1H6KX 3TI0A 5HI7A 1RBLA 1YQHA 1SV5B 2BJ1A 3KK1B 3MPYA 5LSRA 2HHHJ 4E98A 1N0UA 4KYZA 4OHYA 4NCGB 2OO4A 4X4OA 2MGZB 2WSEC 5KFZA 2QJ3A 4EBCA 2CZ9A 3UR3C 4DR2J 2ASDA 3CCJS 4C8LA 1FJGJ 2DR6A 3TNVA 3G96A 2ZBCA 2J6UA 3N6NA 3F44A 4EO8A 3BGRA 5JVHQ 2PA3A 4ZP6A 4GRSA 1VQKS 4PWDB 5J2MA 2J8SA 3PEHA 4EEYA 4DFMA 2WOMA 5IWAF 2CKWA 1KHWA 4OIXA 4CLSA 2UXCJ 5J1EB 4OHWA 4MKAA 1S1WB 3AJ2A 2Q66A 3KLFA 5L1IA 2HEKA 4ZVPB 3M9MB 2ADBA 3RZAA 4X64J 8ATCB 1NXIA 2E5GA 2R2SA 2HMIB 4NLGA 4FYWB 1GT8A 1D9FA 2DGQA 2BV3A 2DNZA 2G13A 3BYPA 9ATCB 2AHOB 3V6JA 3T41A 3EDRB 3EICA 3ELHA 3QYYA 1ZBTA 1T0TV 3H90A 4DL0C 2K3IA 2A0FB 3WDOA 3OFHA 3QRRA 3F0NA 1P1TA 2IC3A 1X4DA 4K0KF 4L76A 4YR2A 3GV7B 1NMEB 1PSDA 3W62A 5J2NB 2V2VA 3N0VA 1HI0P 1VLOA 1M5KC 2H5IB 2HNDB 4YP3A 3QWPA 1R3NA 3CO9A 3CXCR 2FJBB 2OI2A 3UO0A 5G4DA 2QV6A 3CJRA 1WC3A 3GE9A 2QL5B 5H1SV 4FF2A 1SXLA 3A3PB 1AT1B 2E5LJ 1MN7A 3AA9A 1RT3A 3BH6B 2JEJA 1YRTA 3S8SA 2CZVC 1VISA 2QFJA 1HHSA 4UOGA 2IIHA 1UJ4A 3CCUS 3GSDA 5JUMA 1VRUB 1X9MA 2ZH1A 4PXCA 4ED5A 2YX4A 3VGVA 1VIOA 3OJUA 1QLNA 1MU2A 3UPFA 2OFGX 4J37A 1RSCA 3Q86A 1RTHA 4YB6A 4HH0A 5D77A 3BDEA 3UDVA 3M1VB 2X1FA 2PC6A 2GMJA 1SJRA 2E5JA 3G6ES 4F25A 2GJ2A 3R2CJ 5T7LB 1OQ3A 1S10A 2CG4A 2F9DA 2J0SD 1WG1A 4O4GA 4Y2IA 3H20A 1H7XA 4IG3B 2NPIA 4OQJA 4NX9A 4ECSA 4DQQA 1N5YA 2UXBJ 2GO9A 4OI2A 1KQFB 3K89A 2KJVA 2XSFA 1EP4B 4ANEA 2B8QA 2N3LA 3DKDA 2AGQA 4OMFG 5IQ6A 4DV7F 4Q5VA 1WI8A 2DHAA 2JEFA 2BJDA 1DAXA 2IAJB 1LW0B 2ADCA 4R5PB 3MM5A 2I2YA 1RHJB 4KO0B 5KFWA 2XMAA 2W4PA 1KP6A 4YUDA 4MK8A 2QL9B 3G8QA 2XLJA 2ZHBA 3WIVA 2BACA 3OXGA 3OL9A 2ILYA 4IOCQ 2WB4A 1CJTA 3P5TL 4WBFA 2CRLA 4HR2A 1TFWA 1HQEB 1TKXB 1U49A 4WTOB 2H3EB 3IR5B 3HT0A 3DRRA 3U27A 3M8PA 1D9AA 3MEEB 2EVZA 3ADAC 1SKSA 5FLXY 4J9OA 1DLOA 1ZM2A 3ITHA 1YJTA 3DXBA 4TY9A 4Y2KA 3UN3A 2XYPB 3HZEA 3BH7B 1T11A 5KFDA 5DRKA 5E7OB 1RJJA 1BC6A 1BQXA 1N54B 1U1LA 5CQGA 1N8RT 4QR0A 3J80Y 4FNIA 2WVFA 2FGCA 5ETPA 3RRHA 5I42A 1HQUB 4X4QA 3OHBA 2FVSA 1TL4A 3W2VA 5A76A 5L46A 3KLIA 4XTTA 3SYZA 1SKRA 2P9CA 3CUNA 1TKDA 1R7IA 1MWQA 4EK2A 1B64A 2R7QA 1CQNA 2ZZTA 2VPZB 1OS5A 5K8NA 4ZPTR 5FDLB 5D4PA 4ZVQB 3KJNB 3SSQA 4OX7A 1HARA 3PYDA 1KNZA 3IGVA 4DI6A 4ICLA 2AX1A 2P9GA 3DU6A 3E2EA 1S97A 1A9NB 4MKYA 3PYGA 3IRXB 3RBDA 1OY8A 4QW8A 5IM0A 4KHPF 2GX8A 4DS4A 2M88A 3RAMA 4U6PA 4PPZA 3SSSA 1D0EA 2C2OB 2NREA 1Q7LB 2MHNA 3ZZUA 4RU2A 4F0HA 1HNZF 2IA6A 2D74B 3TZWA 1IM4A 1J27A 3C6UB 3UNGC 1XIQA 1FKOA 1RHUB 4EU0A 4DV4J 1N33F 2V2ZA 3MCOA 2AT1B 4F4KA 3MMAB 3FBBA 3VGSA 3IBWA 3CD6S 1AFIA 2P2CB 2DIVA 5IZHA 4AE5A 4OLPA 1REVB 1W2IA 3EPGA 2GQQA 2VA3A 3KLHA 5IFMA 2JWNA 1S9EA 3PYFA 3UVJA 4F3OA 3SCLE 5FIIA 4GO5X 3D28A 2AYEA 1CC7A 1S6PA 1LWFB 3LQVA 2IVMA 1SC3B 3I5AA 3RAQA 1RT5B 1WDDA 4LSLA 1SL1A 1RYSA 3ISZA 3D0HE 3HKZD 2J76E 2GJIA 1EQ0A 2QG9B 3GIJA 3LAMA 1LW2B 3H2LA 1L3VA 2PEHA 3G8TA 5KG7A 4ZLNA 1UEUA 4ZJOA 4ED2A 2IMOA 3OD2A 4K4ZA 3J7AN 4IH6A 3TOQA 5B0AA 3GLJA 4A46A 5F8GA 1I51B 2V2QA 4ETZA 2QA2A 5E2QA 3G6YA 3R1LA 3J81Y 2HVHA 2CNNB 4FVMA 3IAM9 1T94A 3W2WA 5AJ3F 4C3MA 3F56A 3QT8A 2CQ1A 4BHQA 1IKYB 1TVRA 4WIIA 1G1XA 3MM7B 4U8YA 1U2RA 2NXEA 2MKKA 3FNNA 4OZ5A 1UCNA 1FTCA 3KLGA 1NZ8A 4EBEA 3Q24A 1RWPB 4DWIA 3ZZYA 2L9DA 4DV6J 1YRXA 4FBTA 2DPJA 4ID8A 4WP9A 4MT1A 1BQNA 2XO7A 3WX4A 1KLMB 4NLYA 3O2IA 1C2PA 4C8NA 3QNWB 4PXDA 5I3UA 4A8WA 2HNZA 1HL6A 2V68A 4B3RJ 1GX6A 1MWZA 1RT4B 4ED8A 2CPYA 2XHCA 3OVAA 4NLVA 2BE7D 3JTNA 4DR5F 3WC2A 5GADI 1QDUB 1HA1A 4K4WA 4WFAQ 5ETMA 2RQMA 1UAWA 3K17A 3CO0P 3DI6B 3D1OA 2VBWA 3BPDA 2VFSA 1YTYA 3A13A 1N5QA 2HVIA 4RL1A 4NLXA 2H65B 4C2MA 2VJUA 4OX9F 4HACB 5DM7Q 2VFUA 2O3DA 2ZD1B 3V6KA 3EJMA 3NP5A 3QGIA 3OL8A 3DGVA 5U47A 5DS7A 1WSRA 2ZH2A 4LF5J 2BMBA 1UWAA 1GEHA 4C3KA 2X1GA 4V19X 1VQ7S 5EX0A 1R8HA 3AJ1A 2O67A 3MM9B 4N41A 4Y3CA 2BE2A 5J1PA 2MQLA 4WWSA 2R7SA 2CWKA 3MUMP 1ICEB 2A18A 2DXEA 2OPPB 1QJHA 3EGZA 3BYRA 1IKWA 2B5JB 1RKJA 2ZH8A 4LF9F 2RRBA 1HBMB 4NEZA 3HK2A 2P8IA 4DLGA 4A8YA 4NCBA 1UKUA 3VAGA 4ECVA 3CDWA 1IBMF 4ED6A 4I56A 2E7WA 4LSZB 3IWNC 5HBMB 1XMOF 2L9NA 2GMHA 2DRBA 4KFBB 4ZLPA 2EG2A 4I6AA 5CYQB 2E1CA 4OV1A 4RWWA 2FLNA 2QA4S 1V3ZA 3NNCA 2KVQE 2KN4A 1JNZB 2VG7B 3C15B 4NLDA 1CULB 3P6YC 3MOJB 1RWNB 4W98A 1S4FA 2RQ4A 2FY1A 1KFDA 2D3O1 4DV5J 2HS3A 1YI2S 4U95A 1FI4A 4O3QA 5GAHI 5HSPA 1JLQB 2ZM6F 3PW2A 3BN4A 4DV0J 3G6VA 5J2PA 1ELOA 2UUBJ 2EKNA 3PXGa 4C8ZA 3GFXA 5D0RA 3OTOF 5KFOA 1AZSB 1HD1A 5DQIA 4K50A 3H7HB 2CQGA 3TZYA 2EK6A 3M2UB 2L48A 3UDEA 5DQHA 1U0HA 1KLNA 3R5DA 4OX8A 3W64A 2HFZA 2HHWA 3A4TA 3A8IA 4EFAC 1K9MT 1ZAVA 2O66A 4C0HA 3AB2B 4TVAB 2MQOA 5DJBA 4J90A 3OLAA 4JI6F 1S0VA 2AW0A 2XZDB 4TLQA 3Q83A 3CC4S 4LRDA 5L8RC 5HVHA 2V4JA 3KTQA 2AD9A 1XQIA 2HIYA 3EM1A 4ZP9A 3PRVA 3S6EA 5K9FA 4L3NA 2C3MA 2VFTA 4WTYA 5ETLA 3W66A 4B3MJ 1Y7PA 1BXNA 1YX2A 1IKXB 3DOMB 3CCVS 4I7FA 2FHMA 3QRQA 3H42A 1SC1B 2VPXB 1TV6B 1IBKJ 2IRXA 4CLKA 4G3IA 1NEEA 3VQSA 2I5JA 1U09A 4DMZA 2FY8A 2NUUG 3L7PA 1C1CA 1V5IB 1FKAF 3QJPA 1MLAA 4ANDA 4ZVFA 2AMCB 1C4CA 2XY5A 1KC8T 4BS2A 3J7YI 2PIIA 2MLYA 4ZITA 4ZHRB 2Z8QA 2PN6A 1RTIA 1FXDA 5HN0A 4DSKA 5AXKA 4NCAA 1C1BB 1B0PA 1NJZA 1SQEA 2HYIB 2KT2A 2QX0A 5KFNA 1V6HA 4YB1P 3W8PA 5J2QB 3BKTA 1KD1T 3M6UA 4IH5A 4H4KA 1CLFA 3MPWA 3SZ2A 5B0CA 2F9JA 2CJAA 4NA2A 1NLKL 1TZ0A 4YHHJ 1Q53A 1VQ4S 2PO4A 2HGNA 4ZJQA 1U7LA 3B8HA 2FYXA 3Q8RB 4Q7AA 4KGZB 4ZPWR 1FFGB 4DR3F 3HHLA 2B8PA 3OR1A 2K3KA 2JVRA 3H8YA 3KJVB 1MWYA 5K8MA 3AB4B 1S5ZA 2EBEA 4CO2A 2HBYB 3R8YA 2GGPA 2CDRB 2VG5B 2VF3A 2QN6B 1FJGF 4PG6A 3GONA 4R25A 3G8SA 1WWHA 3UDLA 2KFNA 4O0NA 2E5HA 5IQQA 4FVCA 4MMOA 2KDOA 3NXZA 3UD3P 2FTRA 1FEEA 2N7YA 3J7A1 1VQYA 1JLAA 2BE9B 1NRKA 4NXMF 1ZA1B 4N77A 4ZA1A 4RNHA 4PYDA 1C0TB 5DLGA 1PO6A 4ECZA 1AFJA 4DV1F 1NK0A 1U8WA 3VR1A 4NLSA 3D3BJ 2WBMA 1PYOB 4X64F 2ATCB 2W8KA 3DRSB 3MFHA 1JXEA 5C2GA 3KKFA 2A1BA 3GJQB 2FC9A 2KVIA 3DDIA 3CPWR 3QBCA 1W26A 2VPYB 2FUG9 5I3QA 1DARA 5F8MA 2YKQA 4K59A 1RHQB 4LFCJ 2RILA 2DRAA 2ALYB 2ZEJA 3UD5A 1HYSA 5L1JA 3EGNA 5IV3A 3MI7X 2ZZMA 3ZFVA 1H3DA 1M5OC 2ZJPQ 2DNQA 1T05B 4WKRA 1D9DA 2HAIA 2WSCC 4NEYA 1TAUA 2R2UA 1H38A 2IDLA 4TY8A 3JQKA 2BQRA 4G1IA 3POTA 4ID5A 2QFIA 2R7RA 1YZ7A 2E5LF 1RWWB 3CCTA 3G87A 1XMQJ 2DHSA 2JVOA 4Y2CA 4LMZA 4K4XA 5D8HB 2QIFA 1S0OA 1RZMA 5B0EA 1HBUA 4JV2A 1RAJA 5F3ZA 1K73T 1UEKA 3TANA 2FLLA 4TKTA 4NMXA 2MDAA 1F6TA 3WHIA 1JB0C 1R0AB 5LXYA 1LK5A 1PYSB 2F3JA 1FDDA 2XQCA 2V8VA 1HQ2A 2YKNA 2J9DE 1E6VB 3R7SB 3FK4A 4ZDNA 4IDKA 2E1RA 1PJ7A 2B7CB 2NUHA 1ULRA 2R8IA 2DNRA 2HPUA 3IS9B 2VKRA 3DLKB 4XPEA 3TQ1A 3C8YA 4M5KA 3IG1A 3W5YA 1JKHA 1NDKA 2G2ZA 1YJUA 1RYRA 2UXBF 5E41A 2VH7A 3T5KA 4WXWA 4EO6A 3KHLA 4ECUA 4EUVA 4F0KA 2YKMB 4OJHA 4JI8J 1TFYA 4M8LA 1FJ7A 3MCNA 2PMHA 4YR3A 3CD0A 1ZZFA 1CS4B 3SIPB 4CNZA 1ROFA 5KFGA 4LF8J 1M5PC 2HRTA 1PBAA 2KKHA 5HQ8A 2VQFF 4DL2A 3BGRB 2L41A 4WIQA 4OYPA 3NNHA 4U7UD 3TWZA 5J2MB 1KDNA 1KKHA 1FF2A 3CDAA 2OEJA 2EEYA 2XYHB 3GV8B 2WOMB 3RU0A 4DSLA 3M2RA 3I82A 1IR2A 5C24A 2J6TA 3CJ4A 2ZH4A 2GQCA 3VAMA 4KE5A 2RRNA 3BS9A 1X9SA 4J9QA 2D9PA 3PZPA 3PRDA 4RUAA 3IP0A 4C48A 4OZ3A 2XC9A 5B0DA 1U1RA 4CYUA 5HLFA 3W1YC 1G6BA 3ILIA 4FXDA 4Q43A 2ZH6A 1S1XA 1RE1B 2W9BA 3TUJC 4FN5A 2QYGA 3JAMY 2O5DA 2RUSA 1VYAA 1EAYC 3OUYA 4X4RA 3QLHA 1X4BA 3T5HA 4M5MA 5CD4A 5HJYA 3KUGA 3CNQP 2KG1A 1IBLJ 1NSPA 3OFEA 3R7NB 2Z4PA 2CQ4A 2W24A 3D3CJ 1R89A 2IBOA 4XO0A 3C16B 2V6AA 2EFOA 4L3KA 4MYUA 5AE3A 4HI1A 2VDHA 3SMZA 3US5A 1FWLA 4S0MA 3I31A 5C42A 4N7TA 3NWRA 3P3DA 1HBNB 1HNWJ 5A8WA 4JI0J 1RTZA 4DSIA 2CQCA 3LPEA 1QAXA 2DEJA 3V6DB 2J0WA 1JLBB 2GW8A 3GCWP 4CO5A 2E1MC 3ENAA 4DR6J 3DMJB 1L5UA 4KC5A 4RNNA 1F5BA 3LO3A 2CQIA 2MZTA 1HBOB 3O1LA 3BQ1A 3I6PA 2C2ZB 5LOQA 4B17A 2PI5A 2OPSB 2P9EA 2AGPA 4XDDA 1MU2B 1HW9A 3VQTA 2P6TA 1FX2A 4AUKA 5DDOC 3Q8VA 1EB0A 4PG7A 4WP3A 4CTAB 2W7PA 4X4UA 5E0OA 2FIUA 1RAOA 4D3HA 1HNXF 2XGPA 1FRHA 1RT1A 3MECB 1Y5LB 2GVDA 4UW2A 2VBXA 4QQBA 1I3OB 5DO2A 1U1MA 3HJVA 4F4ZA 4LBHA 1TKTB 3V81A 1RWVB 2AJ4A 5KT5A 2DH7A 2KG0A 4DPUA 2FJDB 5D0GA 2ZKUA 1E6YA 4F4WA 1P1LA 2R4FA 3P49B 2ZVIA 2UUAJ 3IA0A 2Y1JA 5DG8A 5KFLA 3EZUA 2ZWPA 1WNEA 2J7KA 2OMLA 1LWCB 5GAHU 2V0NA 4QBUA 1JLFB 3RBZA 1SJ3P 3IO1A 1QAYA 3IM9A 1OIAA 2KXFA 4J9UE 3BO2A 4ZPVR 4DV3J 2MJNA 1YJ7A 2YKOA 2RDJA 2KM8C 2FPHX 5E3PA 2MY7A 2HZCA 5JVGQ 2F63A 1S12A 2IYIA 1TK8A 4QIWD 1Y3JA 1K1SA 2EK1A 5GMEA 3RRGA 5EWEA 1XMBA 4DV2F 4LBIA 4I67A 2DTJA 3HHNB 5GMDA 3MCMA 5C2CA 1S76D 3M8QB 3HSJA 4MFBA 5E3RA 4Z37A 1UVKA 3Q8UA 3P8BB 1F3FA 4PXBA 3FFIA 1LWEB 1FNXH 4A8MP 1Q79A 3CD5A 2Z2YB 2POKA 2HZAA 2NPFA 4F67A 1O0PA 3DHXA 4OHXA 4Z7YA 3RB3A 2GV1A 3QSYB 1OSDA 1NKCA 1NDLA 3CB4A 2QSFA 2D69A 2VC0A 4ZCIA 1U6BA 3QGPA 1LNQA 4KGMA 2HWTA 4FYYB 1A6LA 4PWUA 3BQ2A 2CYYA 3ENQA 3LH2S 1KQGB 1NPKA 4DX6A 1TUWA 3U1MA 1UVIA 1WF0A 3EZOA 1Q0NA 3BBCA 4OI6A 2AEFA 2DYAA 4WKYA 1FRXA 2BUNA 1JK9B 4CQ1A 4ZOSA 5C25B 3UCUP 3M8ZA 2VIHA 5B7WA 4RW8A 3MFIA 2CA9A 2O1PA 1UJ6A 2DH9A 3M8SA 2BANB 5L38A 1XJWB 3MMJA 5E33A 5L9NA 2R8KA 4LF5F 4HEA9 3DDKA 3LP1A 4C0BA 3RB0A 1UVLA 1KS2A 2ZBIA 1NPPA 3LGHA 5A0YB 3K8VA 4QIFA 2CXEA 2VODA 2CNOB 3Q2SC 1EHWA 4OHZA 2UVRA 1LV5A 1I94F 4P52A 4YB7A 1RBOB 2W8LA 4RW9B 4W4MA 3VAIA 5KFIA 4JUZA 1PYTA 1UZHA 4K4VA 2HBZB 2FD2A 2YWHA 2VBZA 3X3UA 2DGVA 3FEZA 1H0HB 1NH7A 2PA8D 5ETOA 3BR9A 5CYMA 4NZ6A 4CRJA 3KLHB 1S9EB 1S6QA 1HWLA 4ZCMA 1GMVA 2YWFA 2X3DA 3HSDA 4E8UA 1VFJA 2HFSA 2AIRB 2VDIA 2YNGA 1AW0A 4LSLB 1UFWA 4B3OA 1TKZA 1GX5A 2G1HA 2FJXA 3EE3A 2DITA 2D3OR 1LOUA 3ISND 3H2VE 4PQUA 2HGMA 1N5VA 2OHDA 2XS2A 2HURA 4DV5F 5F9NA 2H5JB 4B3SF 5B0FA 4HT7A 3I4HX 5ITHA 1UETA 2M0GB 5KFHA 1BE4A 2B9XA 1M5SA 2ZFHA 4YY3F 3MPUB 3W5ZA 3MR2A 3NGRA 2Z2LA 2KHCA 3SQGA 2C2KB 3W2WB 1ITPA 1JLCA 2XO6A 4ALZA 1TR0A 4M5IA 3PW7A 3SDEA 3QAUA 1FT8A 3K5MA 3GIKA 2Y1RI 2DEIA 4B02A 4DF4A 4JI2J 1QUPA 3PM9A 1R8CA 3KDNA 4FDFA 2KI2A 2DR5A 2YWEA 3EXYA 3QGGA 3MAAB 2B0GA 3RYLA 3HVRA 4DN0A 4A8SA 2OTJS 2CJKA 1YBUA 3PKYA 3OLBA 1T9TA 1Z2LA 1IQZA 3I5BA 5KFFA 5I3UB 2HNZB 1LQ9A 3G2XA 4HH1A 1SH2A 1PC5A 3NS6A 2BBEA 2F4FA 2UXDF 2DGWA 5L1KA 3QFHA 2ASYA 4ZPBA 4B3MF 3ISNC 3TJ9A 3PR4A 3FMBA 2IM3A 2F65A 1IBKF 2R2TA 2PDAA 1Y4ZB 4CWBA 1N32F 3QT5A 4TLRA 4KSEB 3KWMA 4KPYA 3AQOA 1NH8A 1TL1A 3ENWA 3CJTA 3KXDA 3MMCB 3OFFA 1MMNA 4QIGA 3KG1A 1SBRA 4CDIA 5F9LA 2GAHC 2VOOA 1Q95G 5D4LA 1I5OB 1G7CB 3EUNA 5A8KA 3I55S 4URQU 5IXUA 5E5NA 3ZTRA 1HWUA 5KFMA 5IT9U 5KOWA 4WP8A 2KFZA 1YBAA 1N6QB 2W01A 2B7BB 2YNFB 3T9NA 1RAFB 4B08A 2BE2B 1UL3A 3ULHA 1FRKA 5IT4A 3KK2B 1K0TA 1PBUA 3KLVA 3OR2A 2EBGA 2G2OA 1ZOTA 2IRUA 1VCTA 3GWCA 4DCPB 1U26A 4CIOA 1N36J 4JV5F 2HLUA 3IR7B 4X4PA 1VMBA 2W9AA 2O01C 2U2FA 4MK9A 3NAIA 3AFGA 4RJVA 3K57A 4JI3J 1S1TB 4KV8A 3DRPB 1S1VB 3SFUA 3N28A
chains in the Genus database with same CATH topology
1NDKA 3EJMA 1NDLA 1MN9A 1W7WA 3FBBA 2AZ3A 3NGRA 2BX6A 1HHQA 3FBEA 1NUEA 3NGUA 4EK2A 1XQIA 3VGSA 4CP5A 3FCWA 3EM1A 1UCNA 3PRVA 4W98A 4F4AA 3Q8VA 4DZ6A 4FKXA 3VGTA 1NHKL 1NLKL 1U8WA 3B54A 4UOFA 4DUTA 4FKYA 1BHNA 4WBFA 4HR2A 3ZTSA 3NGTA 3Q89A 4KPCA 5BXIA 1VYAA 2VU5A 3ZTRA 2ZUAA 3R9LA 2CWKA 3FKBA 3ZTOA 1NPKA 4ENOA 2DY9A 5CABA 2AZ1A 3ETMA 4DI6A 1NDPA 3BBCA 3DDIA 3VVUA 1NDCA 1NSPA 2DXEA 3B6BA 2DYAA 1MN7A 2B8PA 2DXDA 1NSKL 5C7PA 1LEOA 3FBFA 1F6TA 3BH6B 3L7UA 1KDNA 4UOHA 3ZTQA 4ANCA 3Q8YA 3GPAA 2HVEA 3BBFA 3FC9A 4ANEA 1LWXA 2B8QA 3NGSA 1S5ZA 1PAEX 3DKDA 1NCLA 3VVTA 4UOGA 3FCVA 3EVWA 3VGUA 3BH7B 3EMTA 4S0MA 1JXVA 1HLWA 1NB2A 3G2XA 3Q8UA 2DXFA 1F3FA 3EVMA 1B99A 3FBCA 5IOLA 1B4SA 1WKJA 3EE3A 1BUXA 4ANDA 4C6AA 1K44A 3EICA 3GP9A 3ELHA 2BEFA 4F36A 3VGVA 1HIYA 1S59A 3BBBA 1NSQA 3WX8A 2HURA 3MPDA 1S57A 3ENAA 1ZS6A 3JS9A 4O0NA 1EHWA 2HVDA 3EVOA 3Q86A 1XIQA 3ZTPA 5CAAA 3PJ9A 1PKUA 1BE4A 1WKLA 1WKKA 2NCKL 3Q83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDK A;  3EJM A;  1NDL A;  1MN9 A;  1W7W A;  3FBB A;  2AZ3 A;  3NGR A;  2BX6 A;  1HHQ A;  3FBE A;  1NUE A;  3NGU A;  4EK2 A;  1XQI A;  3VGS A;  4CP5 A;  3FCW A;  3EM1 A;  1UCN A;  3PRV A;  4W98 A;  4F4A A;  3Q8V A;  4DZ6 A;  4FKX A;  3VGT A;  1NHK L;  1NLK L;  1U8W A;  3B54 A;  4UOF A;  4DUT A;  4FKY A;  1BHN A;  4WBF A;  4HR2 A;  3ZTS A;  3NGT A;  3Q89 A;  4KPC A;  5BXI A;  1VYA A;  2VU5 A;  3ZTR A;  2ZUA A;  3R9L A;  2CWK A;  3FKB A;  3ZTO A;  1NPK A;  4ENO A;  2DY9 A;  5CAB A;  2AZ1 A;  3ETM A;  4DI6 A;  1NDP A;  3BBC A;  3DDI A;  3VVU A;  1NDC A;  1NSP A;  2DXE A;  3B6B A;  2DYA A;  1MN7 A;  2B8P A;  2DXD A;  1NSK L;  5C7P A;  1LEO A;  3FBF A;  1F6T A;  3BH6 B;  3L7U A;  1KDN A;  4UOH A;  3ZTQ A;  4ANC A;  3Q8Y A;  3GPA A;  2HVE A;  3BBF A;  3FC9 A;  4ANE A;  1LWX A;  2B8Q A;  3NGS A;  1S5Z A;  1PAE X;  3DKD A;  1NCL A;  3VVT A;  4UOG A;  3FCV A;  3EVW A;  3VGU A;  3BH7 B;  3EMT A;  4S0M A;  1JXV A;  1HLW A;  1NB2 A;  3G2X A;  3Q8U A;  2DXF A;  1F3F A;  3EVM A;  1B99 A;  3FBC A;  5IOL A;  1B4S A;  1WKJ A;  3EE3 A;  1BUX A;  4AND A;  4C6A A;  1K44 A;  3EIC A;  3GP9 A;  3ELH A;  2BEF A;  4F36 A;  3VGV A;  1HIY A;  1S59 A;  3BBB A;  1NSQ A;  3WX8 A;  2HUR A;  3MPD A;  1S57 A;  3ENA A;  1ZS6 A;  3JS9 A;  4O0N A;  1EHW A;  2HVD A;  3EVO A;  3Q86 A;  1XIQ A;  3ZTP A;  5CAA A;  3PJ9 A;  1PKU A;  1BE4 A;  1WKL A;  1WKK A;  2NCK L;  3Q83 A; 
#chains in the Genus database with same CATH topology
 3QAT A;  2CPF A;  4BC9 A;  1SH0 A;  1WSV A;  4Y2A A;  3KUE A;  4WFX A;  3S7R A;  2LEA A;  1FKP A;  2JLG A;  3JSM B;  4CT8 A;  4C11 A;  1VC6 A;  3GR0 A;  3QPI A;  3PCO B;  2HK2 A;  3VAH A;  1RU2 A;  2AZ1 A;  4J91 A;  4QR1 A;  3DM2 A;  1N52 B;  2IM1 A;  1HNI B;  1D09 B;  1S4E A;  2UUC F;  3CJK A;  2NXJ A;  2BQU A;  3I9V 9;  2AU0 A;  4ES2 A;  3ETO A;  5LL6 d;  1KFS A;  3R5A A;  1Y0H A;  1SJQ A;  4RNM A;  4G1Q B;  3A3N B;  1QVF R;  1B7Y B;  3E8O A;  3GV5 B;  3MD3 A;  2F8E X;  4IFV A;  4LF7 J;  3PR5 B;  3A8J A;  1RT6 B;  2HVZ A;  5HP1 B;  4A8O A;  3WX8 A;  2MHE A;  2OEM A;  3MPD A;  2LDI A;  2HHS A;  1F5A A;  1YHQ S;  1U0H B;  2QMW A;  2VPW B;  2DNN A;  1XEZ A;  2Y3Y A;  2CFX A;  4DS5 A;  2CUY A;  5CAA A;  5F41 A;  4AL6 A;  1Q78 A;  1R8P A;  3TA1 A;  1QY7 A;  2MZJ A;  4FF4 A;  2YX1 A;  1IKV A;  1MG7 A;  1R0C B;  2GIF A;  5HRO A;  4DUZ F;  3DU5 A;  2ZOM A;  2E66 A;  4DQR A;  4K4S A;  1EET A;  4CLY A;  3HXM A;  2ZWO A;  1RAB B;  3FKB A;  4LF6 J;  1SC4 B;  1RAE B;  1DJ0 A;  2OPR B;  2WSF C;  2GQ2 A;  4GC6 A;  3BJY A;  2WVC A;  4M5H A;  3SCJ E;  5T14 A;  1D8Y A;  1IUJ A;  3CIZ A;  1XR6 A;  3Q8S B;  2E7X A;  3HVT B;  3NGD A;  4H4M A;  1V3R A;  3HFK A;  1CEZ A;  3M32 A;  3I32 A;  2MKH A;  4P2S A;  4O3N A;  4NLU A;  5AE2 A;  4M63 A;  4DR4 J;  2I5J B;  4CLU A;  4F4Y A;  3KFW X;  1XMQ F;  1BGX T;  4QWA A;  3VV2 B;  5K8O A;  2YH0 A;  3NG8 A;  4LRF A;  1RTD B;  1SL0 A;  3W3S A;  3FQK A;  1VHI A;  3TA2 A;  1XNQ F;  1XER A;  5LT5 A;  3MEK A;  3LP0 B;  2HQC A;  2VHG A;  2AGO A;  4WE1 A;  1W7W A;  1O51 A;  4RW4 A;  4JB8 B;  2RJZ A;  4ILM A;  1HNV A;  2AEJ A;  4DHV A;  3C14 A;  2VG6 A;  4F4A A;  3KK3 B;  3HI9 A;  4JI1 J;  3A3O B;  4CI0 B;  3HVA A;  3NY0 A;  1S72 S;  3NL0 A;  3AHP A;  1W25 A;  3M30 B;  2VQE F;  1Q8B A;  3OTC A;  2D1C A;  4NI2 B;  3R5B A;  3GII A;  1QSY A;  1ZM9 A;  3GYG A;  3PY8 A;  3HUL A;  4JYA J;  2YY3 A;  4ANC A;  4J9P A;  2PSZ A;  2R3V A;  2RQC A;  3H5Y A;  1VRT A;  1GXL A;  4B3T F;  2ZH9 A;  1WG4 A;  4GKK J;  1WTF A;  5CCL A;  3CDE A;  3FSY A;  3UD4 P;  2KFY A;  4LSN B;  3DLL Q;  2QRR A;  4LIW A;  2DR7 A;  2FLP A;  4X2B A;  3DLH A;  3N79 A;  4F50 A;  4JI8 F;  2B6A B;  1SV5 A;  3KK1 A;  4HTI A;  3M6W A;  3QT7 A;  3DOL B;  1YK9 A;  4Y2M A;  2IJN A;  1T95 A;  3GZ7 A;  4TU8 A;  5EX3 A;  1NK4 A;  2ACY A;  3OPK A;  4HDH A;  4RW6 B;  1TAQ A;  4I64 A;  3I9Z A;  4JI7 J;  4P7V A;  3DOK B;  3OXF A;  2IPO B;  2PMZ D;  4PWD A;  4KHM A;  1UA0 A;  1RLD A;  2PFF B;  5EWG A;  4OYI A;  1Q16 B;  4RR5 A;  3CJ0 A;  5J1E A;  3NBP B;  3HHD A;  4FPI A;  3LF0 A;  2AJ2 A;  3X1L B;  3K7R A;  1UVN A;  1SUQ B;  2HMI A;  2OP5 A;  2H54 B;  4O4R A;  5HAT A;  1CJK B;  3FCH A;  3TAM B;  1B4S A;  1BQM B;  3GSI A;  4P7T A;  2A2C A;  3D5M A;  3ZZP A;  3W8G A;  2B4U A;  5FLX U;  2W4D A;  3BDP A;  4F3Q A;  1CVJ A;  1VS3 A;  4BCA A;  4F3M A;  2B4P A;  4AT1 B;  3N5F A;  1NM2 A;  1N0V C;  4O44 B;  4I2Q B;  1JLE B;  2ZC4 A;  4DR1 F;  1FNO A;  1HWI A;  2DGT A;  2FVP A;  2OTL S;  1LK7 A;  2DB1 A;  3CT9 A;  3K2Y A;  4P2M A;  5J2N A;  4ZPC A;  1R31 A;  4JI5 F;  2LQ5 A;  3MEG B;  4RW7 B;  4X62 J;  3D68 A;  2DNL A;  3POT B;  3TJ8 A;  3QID A;  4IO9 Q;  3E3X A;  1UWB A;  1UZD A;  4Q2L A;  2NLW A;  4RZR A;  4JI0 F;  1AUS L;  4NA3 A;  2C3U A;  3D67 A;  4LRA A;  1R6Y A;  2I8E A;  1VJW A;  3W5X A;  2MXY A;  2F1F A;  4Q0B B;  2ROP A;  4EYI B;  1FRJ A;  2JL9 A;  2MQN A;  4HDG A;  2WVD A;  3FCV A;  8AT1 B;  2IA0 A;  1WC6 A;  1DQA A;  2ZE2 B;  1QVG R;  2DHG A;  4IH7 A;  4X4T A;  3ZZR A;  1VRU A;  1NKB A;  4EZ9 A;  2QC3 A;  3VF0 B;  3C19 A;  3FDS A;  2CPZ A;  2RT3 A;  4URS A;  4U7C A;  3KG4 A;  4A8X A;  4D3G A;  3IRW P;  1NK8 A;  3KHR A;  4ZJL A;  4ZKA A;  2BJ8 A;  1WC4 A;  4IDK B;  4R0J A;  4KKO A;  2M9K A;  1RB0 A;  4OI1 A;  3S01 A;  5CD4 H;  2XMM A;  3M1V A;  1GTE A;  4IQM A;  4ED4 A;  3P5B P;  5T7L A;  4LFA J;  4U9R A;  1JKH B;  2HKE A;  1RCX B;  2D7S A;  4CT9 A;  4RLE A;  2FB0 A;  4IG3 A;  2C3Y A;  1NDP A;  2FVC A;  4E2F B;  3D2W A;  4B9S A;  1QSS A;  3B4M A;  4LRC A;  1DBD A;  3AA8 A;  4I2P B;  3LP2 B;  3Q2T C;  3OV7 A;  3GFZ A;  5GAG U;  3D6M B;  4ZPA A;  5LM7 E;  3IWL A;  4RX6 A;  1MRO B;  2UU9 F;  5HMZ A;  5CH7 B;  1NB7 A;  1CG2 A;  3DC2 A;  1NPR A;  2F8M A;  2OUG A;  2C2N A;  1S57 A;  3LAN A;  4USV A;  4KQZ A;  4PXE A;  4PR6 A;  2IAJ A;  1LW0 A;  4K7Q A;  2C3P A;  4R5P A;  1QAJ A;  5DG9 A;  2EWH A;  4KO0 A;  2W4C A;  5GAE U;  2GIR A;  1BWV A;  4KAI A;  3N9U C;  4PUO B;  3LGN A;  4ZP7 A;  3J81 U;  3D9B A;  4OYM A;  5HLF B;  5KFA A;  5K20 B;  4LFB F;  1P27 B;  4OZ1 A;  1N4L A;  3GJT B;  1HQE A;  1TKX A;  5K5M A;  2ABY A;  2BKP A;  2FDN A;  1FDN A;  2XNR A;  2D3Z A;  2XSJ A;  3MTK A;  3SCK E;  1HW8 A;  2ZH5 A;  3J7Z 5;  1ZAX A;  3MEE A;  4F0M A;  3MAH A;  4DCJ B;  1JNR B;  4R8U B;  1X7V A;  3QLH B;  2CIM A;  4ZLJ A;  4M5G A;  1S99 A;  3C3L A;  4K0K J;  2BJ3 A;  2KB2 A;  1HLW A;  4DG1 A;  3KOA A;  1U2F A;  3QO9 B;  2XLI A;  4WZQ A;  1Q5V A;  3CCQ S;  4WJB A;  1DTQ A;  1U25 A;  3CC2 S;  4L73 A;  3L3C A;  2E29 A;  2K7K A;  1SB6 A;  3IBC B;  1XNR F;  1DQ9 A;  1X5T A;  3K5O A;  5THW A;  2RQK A;  2E9T A;  4U96 A;  1HQU A;  2V2K A;  3G4S S;  2Z56 B;  3K58 A;  2MSS A;  3N4W A;  4IFY B;  2DPI A;  4NRT A;  2YQ3 A;  5LMN F;  1N34 J;  2GS8 A;  2RML A;  2W25 A;  2ZUG A;  3MMB A;  3MR5 A;  1J5E J;  2R7U A;  3GJS B;  3PW0 A;  1NJX A;  4QU7 A;  5FDL A;  3ET6 B;  2YNI A;  2EW9 A;  1FTR A;  4USI A;  1KR4 A;  2LXF A;  4Q2M A;  3D6H B;  4DUY J;  2KRR A;  3W63 A;  3DLB A;  1GXU A;  2GVD B;  3IRX A;  1YIJ S;  5DGB A;  2K1R B;  1NCL A;  4L72 B;  2KRB A;  1VIX A;  2YWK A;  4PCQ A;  3BO3 A;  3GIM A;  1KRP A;  1BUX A;  2YPZ A;  3JTP A;  4KT0 C;  1KWM A;  3NRB A;  2B51 A;  3BF4 A;  1SH3 A;  1E6Y B;  3D6T B;  1FA0 A;  4OFZ A;  1RAI B;  2BRL A;  2HVD A;  3C6U A;  1O8B A;  1O6X A;  3DLG B;  2WVE A;  1WKL A;  1GMU A;  1Q81 T;  1H73 A;  2Y0S D;  2VIC A;  5EDW A;  3MHY A;  1KVJ A;  1VDH A;  1WG5 A;  3UE2 A;  5B0G A;  4B9N A;  1EKR A;  3RBX A;  1VBZ A;  2FHK A;  3V6H A;  1JJ4 A;  2HRU A;  4KB7 A;  2HWH A;  4QCL A;  4HLB A;  4CO1 A;  4OLO A;  3UCG A;  4URG A;  4GVB B;  3EX7 B;  2VAS A;  1FX4 A;  4JI4 F;  9RUB A;  1JLG B;  5MLC V;  4N8O A;  2DR8 A;  2ERR A;  2BJ9 A;  1WF1 A;  4YR0 A;  3CGI A;  4DV7 J;  1LWF A;  2DK2 A;  2RKI B;  3DYA A;  2DXD A;  1RT5 A;  1YJN S;  2GFF A;  5BYR A;  4UOH A;  3N6M A;  3VAF A;  1WI6 A;  2DRD A;  4IRC A;  2ZJR Q;  4M5D B;  2ZC3 A;  4OYW A;  4USW A;  3AD7 C;  3DLE B;  2RU9 A;  3TX0 A;  3GP9 A;  2BEF A;  4F36 A;  4LT6 A;  2LEB A;  2HNY A;  4MFB B;  4ZIV A;  2XEX A;  5L1L A;  4H54 A;  4DR7 F;  7FDR A;  3PW4 A;  4AD6 A;  5B09 A;  1IKY A;  2XWX A;  5F8I A;  1NUE A;  3MM7 A;  3DRX A;  3QJL A;  3NKY A;  3R5C A;  4OHV A;  2AQ4 A;  1Y9O A;  1VQ8 S;  5G0R B;  2PMW A;  1A0O B;  2B4O A;  2WHO A;  4OZ0 A;  1X4A A;  2QLJ B;  2FVQ A;  3JSY A;  1YVF A;  3OXL A;  3QT6 A;  3CCL S;  2G0C A;  1RT4 A;  4M5J A;  2OIH A;  2EI5 A;  1Y5I B;  1L3T A;  4KR0 B;  5I4M A;  4X4S A;  4DFK A;  4DPY A;  1FVQ A;  4KH1 B;  2E44 A;  4X66 F;  3C2P A;  2OPQ B;  3DI6 A;  5DDR C;  3OSN A;  2R8G A;  4RW8 B;  2FJA B;  3V4M A;  3MM8 B;  1EIY B;  2EFP A;  1YSJ A;  2VON A;  4HHU A;  2R9L A;  3R5J B;  2FGO A;  5H9F K;  3T1Y F;  3EVO A;  4O3R A;  4FP9 A;  5KFR A;  4CLL A;  1FNM A;  3M9N B;  2ZD1 A;  4B9V A;  3JQJ A;  2MZS A;  4J9K A;  1KTV A;  3ENV A;  4RU9 A;  1FES A;  3H4B A;  2HGL A;  4K2X A;  2X1A A;  1NHK L;  4P74 A;  4KHP J;  1RA7 A;  1Q5Y A;  5ETV A;  3QGH A;  2C2E A;  3MM9 A;  1U24 A;  1SQF A;  5IV4 A;  4OV6 A;  4ENO A;  3CMA S;  1HNZ J;  2V94 A;  3MPV A;  3B4D A;  4DPX A;  1IQT A;  5KG1 A;  3L7U A;  1JWW A;  2HHX A;  1OPI A;  2B5J A;  3PV8 A;  4FS1 A;  1N33 J;  1HBM A;  3FEX B;  4GKJ F;  1RWK B;  1HMV B;  3HFZ B;  5E3C A;  2J9E A;  4ECT A;  3EVM A;  5HBM A;  1S6Q B;  2BYC A;  2HFO A;  4LVO P;  4C0O C;  1FO1 A;  1T9V A;  4LF1 A;  3MM6 B;  4A8F A;  5CYQ A;  3NOC A;  2WON B;  2J0Q D;  2YNG B;  4AL7 A;  3SFG A;  3B82 A;  2Z0G A;  1F2H A;  3UI3 A;  2FLO A;  2GVZ A;  1TKZ B;  2UUT A;  7FD1 A;  2KH9 A;  3RAX A;  4LF4 J;  4K4T A;  2VG7 A;  3C15 A;  4Y65 A;  3O44 A;  1CUL A;  3TVK A;  2CVI A;  3RR8 A;  1ZPW X;  2NR0 A;  3G82 B;  3VGT A;  2DIU A;  1BHN A;  4EZ6 A;  3THT A;  1TUV A;  3SEO A;  3AOC A;  1QM9 A;  2DIS A;  1JLQ A;  3O8W A;  3A12 A;  1UMJ A;  2QA4 G;  2C2D A;  3SDE B;  5BR8 F;  2JRS A;  2K8G A;  3T6B A;  1LEO A;  5D3G B;  1AZS A;  5A2Q Y;  5AJ3 J;  2QSW A;  3NNA A;  4RO0 A;  3M2U A;  4UOC A;  3LOU A;  3AOA A;  3K5L A;  2CVE A;  3PFE A;  3HSZ A;  2DNK A;  3ZNJ 1;  1KON A;  2DD8 S;  1WOP A;  3CED A;  4IG0 B;  3R2D J;  4L75 A;  4PRF A;  3F41 A;  4LQ9 A;  1RWO B;  3T1A A;  1WOS A;  5CAB A;  2E5I A;  1ZYQ A;  4HHH A;  2XBP A;  2F8H A;  3GYN A;  2X51 A;  1X5O A;  3TP2 A;  4MAK A;  3JYT B;  4DZ6 A;  3BR8 A;  2R2R A;  5KFJ A;  2CQB A;  2V8H A;  4LR8 A;  2JFD A;  2E1A A;  4J9L A;  4FKY A;  4DR5 J;  1NSA A;  1VGY A;  2CJ9 A;  2W9C B;  3D0I E;  1CSJ A;  4FNH A;  1IKX A;  5KFV A;  3DOM A;  2ASJ A;  3AY0 A;  1TL1 B;  4UY8 5;  4JP8 A;  3LWL A;  4DR4 F;  4DZD A;  1TV6 A;  4CO4 A;  2ZBR A;  3T5L A;  1SIW B;  3GFH A;  4J9S A;  5A8K B;  4DEZ A;  4OX9 J;  2L3M A;  4RNF A;  1LWX A;  1S9G B;  1VRQ C;  3EPI A;  2DJW A;  1JJC B;  3N01 A;  2JX2 A;  1Z4U A;  1T03 B;  2E9Z A;  5D15 A;  2GNK A;  2RHS B;  4BBY A;  2MJU A;  4JI1 F;  2XM3 A;  3E01 A;  2M70 A;  3MR7 A;  1F9F A;  4OZL A;  4ZHR A;  1SQG A;  1B0V A;  1C1B A;  5ETR A;  2OEL A;  1XR5 A;  2A6M A;  1NBE B;  1F0X A;  2B9W A;  1WOR A;  2BOA A;  2IFX A;  4W90 B;  5J2Q A;  3IMQ J;  4LF9 J;  1FK9 B;  3SSR A;  2W2Q P;  1VK8 A;  4ZN3 A;  3MUR P;  3OTE A;  1IBM J;  2F5G A;  3I4P A;  5K14 B;  1F9H A;  1XMO J;  2ZUA A;  4GKK F;  1B70 B;  4F2R A;  1FER A;  4I69 A;  2IMW P;  1S49 A;  1SJF A;  5CCM A;  1U1N A;  1UVJ A;  5LMU J;  2G9O A;  3M6V A;  3RUB L;  4QOT A;  1JX4 A;  1URN A;  3KJV A;  2QLB B;  2QGF B;  1GXT A;  4WU3 A;  1N5S A;  1RWM B;  2Q79 A;  1ZAW A;  2LEC A;  1PC4 A;  2VG5 A;  4IRK A;  2R42 A;  4GVL A;  4G6V B;  1ZZN A;  1WUU A;  2HFN A;  2ZOF A;  2CAD A;  2CQ0 A;  4IFV B;  3AOB A;  3BGO P;  1S9F A;  4NXN F;  2ZDP A;  3PJ9 A;  1ZA2 B;  2W7O A;  2LQ8 A;  4ZMM A;  4QJV A;  3SXL A;  4ELT A;  2ZOG A;  3OTO J;  1RDR A;  1J5O B;  3FCW A;  4MYT A;  2ZZN A;  4H4O B;  1C0T A;  1KOO A;  1FRI A;  2KT5 A;  2HSE B;  1RT2 B;  2AV5 A;  3RTV A;  1P8G A;  1RT7 B;  4ZIW A;  3MR3 A;  4JV0 A;  3R9L A;  3GIL A;  2HW3 A;  4C8O A;  5HRO B;  2YWG A;  1FWK A;  3SV3 A;  4P71 A;  2V8G A;  5KFS A;  3JAM U;  2KHD A;  3FC9 A;  3FZ2 A;  4JI6 J;  1UP1 A;  4UF4 A;  4CO3 A;  3H0P A;  2OEK A;  4QIV A;  6AT1 B;  2BRK A;  2XTJ P;  4DQP A;  2YQ1 A;  2QA1 A;  2XS7 A;  1B99 A;  5D0H A;  3LGM A;  2R7O A;  4C6A A;  1HIY A;  4H4M B;  1TL3 B;  2BVZ A;  3UCZ P;  2IJR A;  3H40 A;  3EXC X;  4U8V A;  4N5S A;  1NJY A;  3LPY A;  2JC1 A;  3PYE A;  3TVZ A;  3EGV A;  3KMQ A;  2E9R X;  2HS0 A;  2QO3 A;  5GMK a;  1Q8K A;  2QLF B;  3BSC A;  4IR1 A;  4DL7 A;  3KLE A;  1U1P A;  3VAJ A;  5D4N A;  4KGX B;  1F5C A;  4RW4 B;  2Q6B A;  3RBE A;  4ED1 A;  3HX9 A;  1R8B A;  3M8R A;  1W2B R;  1VQO S;  3C14 B;  2VG6 B;  2DY9 A;  1D1U A;  3LAK A;  4AQY F;  3TUZ C;  4LR9 A;  4QYR A;  1GMW D;  3J81 j;  2AYB A;  2MB0 B;  3GPA A;  5KFB A;  3IWX A;  3T1H J;  3TZX A;  2VFR A;  3QZ8 A;  3VZI A;  2GHP A;  2M7S A;  4KY3 A;  2GO8 A;  5KT3 A;  2N3O A;  3K5N A;  3V4I B;  4IQX A;  4DQS A;  1E6V A;  1S1U B;  4IUF A;  3DXS X;  4HYK A;  1VRT B;  2LVW A;  2ROG A;  4P6Q A;  2H9Z A;  3IS9 A;  1OO0 B;  1U4B A;  3K59 A;  3DLK A;  2OKQ A;  1RKI A;  1NK6 A;  2CPX A;  4KHR A;  4DR3 J;  4ZS6 A;  3NGU A;  2WBR A;  2MQM A;  3B54 A;  1R6V A;  1S48 A;  3UWT A;  1TTH B;  2YKM A;  3TR5 A;  3ZTS A;  2LCW A;  2HHH F;  1CS4 A;  4DR2 F;  3I87 A;  1IVZ A;  4PG5 A;  2DNY A;  5E3A A;  1U02 A;  2LYV A;  3TZZ A;  1QSL A;  4I1T A;  2G1D A;  4WYL A;  4NLO A;  4NXM J;  3I96 A;  1DHM A;  2VV5 A;  4EI2 A;  3CJS A;  2CPI A;  2GAG C;  1Q7Y T;  4DV1 J;  4TU7 A;  3L7O A;  1AB8 A;  2UXC F;  3R27 A;  4QWB A;  3CF5 Q;  6FDR A;  3D54 A;  2KZM A;  1IXK A;  4CH0 S;  1HWJ A;  2HAF A;  5IC4 B;  2KT3 A;  3TEH B;  5A6P A;  4AXJ A;  3HHK A;  1NK7 A;  1U2C A;  3CME S;  4L6V 3;  2PGC A;  1RWX B;  1SKU B;  1FD2 A;  5KT4 A;  5HVF A;  3BO4 A;  2BXJ A;  1FDA A;  2KJW A;  3B6B A;  4GMK A;  1CJU A;  3M2V A;  2MMY A;  5M2U A;  4WK3 A;  1YZ6 A;  2M4M A;  3FJ2 A;  5DDQ C;  3U1L A;  1UWB B;  2K2P A;  2XMW A;  1GH8 A;  2P5V A;  4CLP A;  2VD3 A;  4C8K A;  1RHR B;  3C16 A;  1DTT A;  4TN2 A;  5HMX A;  2LFV A;  5DZ7 A;  4UUX A;  3R6G B;  4LQ3 A;  3I0R B;  3LUY A;  2BAB A;  2DO0 A;  2FHO B;  2APO A;  1HBN A;  1N34 F;  4MKV A;  2X3G A;  3V6D A;  4EMD A;  1J5E F;  1JLB A;  2YNH B;  1FD8 A;  4WK1 A;  3H5X A;  4OYX A;  3DMJ A;  1PKU A;  4NYP A;  1HBO A;  1YBT A;  1BWE A;  1YJR A;  3TQE A;  1G3O A;  2OPS A;  5KFC A;  2MKC A;  4DUY F;  2IDE A;  1UFK A;  2QL7 B;  2HQG A;  4I4B A;  4KKO B;  4CTA A;  4NZ7 A;  5J1N A;  3E51 A;  3T3F A;  2HK3 A;  2QMX A;  3I0S A;  4USK A;  4P75 A;  2UP1 A;  4PEO A;  2BKN A;  3MEC A;  4E0D A;  1WEX A;  3GFY A;  1H2V Z;  1NDC A;  1TL7 B;  4NAS A;  3H98 A;  3R1H A;  5SZT A;  1TKT A;  4P9S A;  5FD1 A;  3BSN A;  4DL3 A;  5B0B A;  1LKZ A;  2OLW A;  4Z2X A;  1C0U B;  4YFU A;  3MZI A;  1MNE A;  5KG0 A;  3CD7 A;  1T9U A;  1RU1 A;  3V2U C;  2AYG A;  3IFE A;  3HMJ G;  2UVU A;  1U47 A;  4QYZ K;  4CM2 A;  3U1N A;  5KG5 A;  1FRM A;  4QPX A;  2BOP A;  3RJM B;  3UQS A;  3UN5 A;  2ROE A;  1F2G A;  5DDP C;  1X9W A;  3HVW A;  4WFB Q;  2QZ8 A;  2ZIT A;  1UEV A;  3B78 A;  4X4V A;  2VB6 A;  1LWC A;  5CXT A;  3MED A;  1AYE A;  4WFN Q;  1TEL A;  1JLF A;  3QIP A;  3KJQ B;  3IAS 9;  1U0S A;  5HAO A;  2WVB A;  2CJY B;  2HHV A;  1AXQ A;  2VQF J;  1VQ5 S;  3PIO Q;  3FBE A;  5K8P A;  2H51 B;  2ZJQ Q;  2JLF A;  2XCA A;  3CDU A;  4J9R A;  5DLF A;  2FZK B;  2HFV A;  4HVZ A;  3UN2 A;  1N88 A;  4YDD B;  4RUC A;  2NSB A;  1EX8 A;  2VZ9 A;  1BMQ B;  1LXN A;  1Q82 T;  2GIQ A;  2HRY A;  5LJ3 Y;  4BDP A;  4NYZ A;  3BSA A;  3VVU A;  4CH7 A;  1N56 A;  3JB9 k;  4UY8 T;  2WAQ D;  3KLF B;  4PG8 A;  2ZNY A;  3DRY A;  1SVD A;  2RH3 A;  3LAL A;  2QMU B;  3BRE A;  4WXO A;  3AXK A;  3JSB A;  3VGU A;  1R8A A;  2QE5 A;  2LU2 A;  4Q8F A;  2XSJ B;  3GU0 A;  3M8Q A;  4OYA A;  4A4J A;  2Z2Z A;  2IRY A;  2W2N P;  1RAD B;  2M52 A;  1YWX A;  1LWE A;  3H59 A;  3O6Q A;  1XR7 A;  1WC1 A;  4FPR A;  3BGU A;  4LR7 A;  3TO8 A;  4DG1 B;  2IC3 B;  3JS9 A;  2B9Y A;  1F60 B;  4ED7 A;  3HZG A;  1U8S A;  1T8E A;  3HD2 A;  1NK5 A;  5KG4 A;  1KQK A;  1DTQ B;  2I6W A;  4FXV A;  2C2R A;  4TQS A;  3D7S B;  4NWB A;  1REG X;  2FZG B;  2RDI A;  3K8W A;  4WCE Q;  1DUR A;  4DPT A;  3BB5 A;  3ILL A;  1T9W A;  1B3T A;  4FF3 A;  2VC1 A;  5KG3 A;  2XB2 D;  1S0M A;  1WHX A;  5KFU A;  5A8R A;  3KUH A;  3DN9 A;  3MMB B;  1FEH A;  1RT3 B;  3ICL A;  3RG6 A;  3OBI A;  1UJ5 A;  2MKI A;  4CNY A;  2HFU A;  3DGP A;  5C25 A;  2JDJ A;  2YNI B;  2CQ2 A;  1PG5 B;  1NKE A;  1JXV A;  1R43 A;  1HI8 A;  5DG7 A;  2G0J A;  2BAN A;  3MR6 A;  2MZQ A;  3M6X A;  2JHE A;  1RGV A;  2ZH3 A;  4C8M A;  1HNX J;  3ZNU A;  1U1K A;  1RTH B;  3TJA A;  5A0Y A;  1KQS R;  4PG4 A;  3OQ2 A;  3FUY A;  3CW2 C;  1M1K T;  2RNE A;  4TQR A;  3TVY A;  1HHQ A;  4RW9 A;  1TP7 A;  3KYL A;  4ZVH A;  3HPO A;  1H72 C;  2AP6 A;  5IS2 A;  2M8D B;  2NSC A;  4O4G B;  2XI2 A;  1QTN B;  1A7G E;  2JJ4 D;  2NS1 B;  4WU2 A;  4YB5 A;  2V9K A;  2KM8 B;  4DV4 F;  1N5Y B;  3RW7 A;  2XMV A;  2CG8 A;  2J8A A;  3EWG A;  2XZT B;  4J9N A;  2BQ3 A;  4EBD A;  1VC0 A;  2B4V A;  2FHJ D;  4EWT A;  1IR1 A;  4XIU A;  2YKA A;  3QWU A;  3PG9 A;  4QWC A;  1VJQ A;  4AL5 A;  2CZ4 A;  3NWG A;  1WJ9 A;  2EXU A;  2L9W A;  5F3T A;  3PO4 A;  5AXN A;  3EZ5 A;  1X8D A;  3DYA B;  4LF4 F;  8RUC A;  3GJR B;  3NEK A;  4QIE A;  3MXH P;  1XWL A;  1GNK A;  3RB4 A;  1HPZ A;  2KL8 A;  1T9X A;  1I1G A;  3MM5 B;  3GG0 A;  3N6L A;  4LBP A;  3QSI A;  1XN9 A;  3BZQ A;  1SKW A;  1WKK A;  2ZHO A;  2HQ3 A;  4P2F A;  5CA5 A;  1GAO A;  4UUW A;  2XLK A;  3HCX A;  2HLT A;  3A1Y G;  2HNY B;  1HHT P;  4DV2 J;  4DXL A;  1DFD A;  1CJT B;  4USJ C;  3PVX A;  2CWX A;  4IOA Q;  1TUG B;  2VOP A;  2MZR A;  4X84 A;  3W7B A;  3PIP Q;  4G1P A;  3GMG A;  2EFQ A;  3DRR B;  2V50 A;  4KGV B;  1RAH B;  1IN0 A;  4UZC A;  3M8P B;  2RF2 A;  4ZVU B;  3SI8 A;  3CCE S;  2N4C A;  4OYO A;  4IKA A;  2NXU A;  3MAA A;  1TMJ A;  4DN9 A;  2A3J A;  1GQE A;  4TNO A;  3IN5 A;  1DLO B;  1OMS A;  3TEG A;  4FYD A;  3ITH B;  3ZZZ A;  1WTB A;  4DV6 F;  1NO8 A;  3U02 A;  3ZO7 A;  4Q45 A;  3EVW A;  2G0I A;  1YRU A;  2FC8 A;  5CZV A;  3EGW B;  4OL8 A;  3W9J A;  4B3R F;  1X5S A;  5I42 B;  2ZBQ A;  3W2V B;  4BLG A;  3EDQ B;  2C3O A;  5KFQ A;  4ECR A;  3KLI B;  1RAG B;  1RTJ A;  4ILL A;  3KNA A;  1FFW B;  4GC7 A;  4YQW A;  4NLP A;  5H9E K;  1LFW A;  2V34 A;  4OJ3 A;  3MUT P;  3MMC A;  4B9U A;  3Q89 A;  2LQ9 A;  1Q86 T;  4ICL B;  2HIQ A;  5F8N A;  3FSI A;  3DLJ A;  4PWW A;  1H2T Z;  1N6Q A;  2YNF A;  4PPD A;  4CM0 A;  5IM0 B;  3KK2 A;  3A8E A;  1I94 J;  1ZM4 A;  3AD8 C;  4F4X A;  1CQM A;  3W65 A;  2ZNZ A;  1K1Q A;  4ZCK A;  1WDT A;  2OAU A;  2IVY A;  2K06 A;  4OI3 A;  4ECY A;  1U6Z A;  1TU0 B;  5ETK A;  1S59 A;  2FVR A;  4WFZ A;  3AXM A;  5EHH A;  3CJ5 A;  2Y0B B;  1DY3 A;  1FKO B;  5D4O A;  2RHQ B;  1S1T A;  3DRP A;  3MTJ A;  1S1V A;  3Q23 A;  4BC7 A;  2BR0 A;  4HT5 A;  3M05 A;  2GVZ B;  3KDO A;  5LMU F;  5BYS A;  1RXO B;  3UVJ B;  4P10 A;  3JSM A;  1T9Y A;  4Y34 A;  2U1A A;  1UW9 A;  2VU5 A;  3FRZ A;  1S6P B;  2RDD A;  4WYW A;  3HT3 A;  2BA9 A;  3ZTO A;  2IM2 A;  3WC0 A;  3ILJ A;  3KHH A;  4DPW A;  2QEX S;  4NZ0 A;  2V4R A;  1HNI A;  2N7C A;  3JTO A;  2H1Y A;  4U67 Q;  1N5T A;  4B3S J;  3THP A;  5HQM A;  3OFG A;  4G1Q A;  4YY3 J;  2KYZ A;  2G4B A;  1S7H A;  4ZP8 A;  4CCH A;  2EFG A;  1PIL A;  5GAG I;  1S6U A;  4M5L A;  1JJH A;  3FBC A;  5A6W A;  4DV0 F;  2ACM A;  2AJF E;  1WKJ A;  2YBV A;  2C42 A;  2UUB F;  3GR1 A;  1K44 A;  2XCP A;  2VFV A;  1RT6 A;  5HQL A;  5HP1 A;  1Q1K A;  2XWY A;  3GB0 A;  2BJ7 A;  3FGV A;  2GZO A;  4YDX A;  3F73 A;  1ACM B;  4ECW A;  1T02 A;  1TVR B;  1M0S A;  1QE1 A;  1K47 A;  2M5Y A;  4ED0 A;  3KLG B;  3OTD A;  3QFW A;  4LRE A;  7AT1 B;  2NXC A;  1YIT S;  3GIR A;  5GAE I;  4RKU C;  1IM6 A;  1BQN B;  1OYE A;  2PFD A;  2DNG A;  2GCF A;  5KG6 A;  2DGX A;  4V1A k;  3K5P A;  2UXD J;  4DU8 A;  2FQQ B;  4PAA A;  2OPR A;  4C9D A;  3G86 A;  3PW5 A;  4I6W A;  3RRK A;  1L3U A;  1NAQ A;  3ZZ0 A;  2HHQ A;  4CLF A;  5AT1 B;  1KOH A;  2V4Q A;  2HVE A;  4N47 A;  4KTQ A;  3HVT A;  1FCA A;  1FRL A;  4X65 J;  4RUB A;  1X60 A;  4UQT A;  1N32 J;  4K5S A;  3VAL A;  1OJ4 A;  2LXI A;  3CC7 S;  1VK3 A;  4OX6 A;  4ZVR B;  3OT9 A;  4CO0 A;  1OSC A;  3CE8 A;  1RTD A;  4TU9 A;  2UUW A;  2YQ0 A;  3HSG A;  1SL2 A;  1RCO B;  5BYQ A;  4USM A;  3LP0 A;  2Y1I A;  4DL5 A;  3IC1 A;  5IT0 A;  2JEI A;  2NCK L;  1KHV A;  3UFC X;  4KJI A;  4F26 A;  1YGY A;  1X31 C;  2AZ3 A;  3E01 B;  1U1O A;  2OFH X;  2GJF A;  1RBA A;  4EGL A;  1WEZ A;  4RBV A;  5RUB A;  1VQ6 S;  4M95 A;  4O0I A;  2B3T B;  1MMD A;  4HTJ A;  3KK3 A;  1X4F A;  3KNG A;  2UV8 A;  3IR6 B;  3CJ8 A;  4ELU A;  3L4B C;  4Z7C A;  3T1H F;  1OYD A;  1UPP A;  1WC0 A;  3C6T A;  1FHT A;  4JV5 J;  1JIH A;  4ZPD A;  3M30 A;  3MAQ A;  4C3L A;  2XGQ A;  1RHM B;  1IKW B;  4DSE A;  4NI2 A;  1AUD A;  2WB1 D;  3TX8 A;  3L09 A;  4C98 A;  1ZM3 A;  4YHH F;  3QJJ A;  3QQC D;  3NGS A;  2J5A A;  2Y9H A;  4FBU A;  1IWA A;  2F4V J;  3WIU A;  4K8R A;  1YDL A;  2GC8 A;  2OH2 A;  1P9Y A;  1C4A A;  4LSN A;  4N8N A;  2RAQ A;  2DGU A;  1M90 T;  2V8D A;  3GTY X;  2B6A A;  1B7F A;  2MQ8 A;  4WPA A;  2EKY A;  3DOL A;  3FVY A;  2CPD A;  5EWF A;  4ES3 A;  2UUC J;  4QW9 A;  4O3S A;  4F2S A;  2YPY A;  2KU7 A;  2DGO A;  2Z30 B;  4RW6 A;  1BD6 A;  4JBC A;  5D6G A;  2VKZ G;  2Q43 A;  1CJV A;  4IRD A;  4KPC A;  4MIB A;  4I0W A;  3CCW A;  1EZZ B;  3M9O B;  5J2P B;  3DOK A;  3LWM A;  3ZXW A;  3ETM A;  3BQ0 A;  4XDC A;  4K5R A;  5EUH A;  2YVS A;  1UVM A;  5KFK A;  3IGN A;  1U45 A;  4MJK A;  3ZZT A;  2XMK A;  2C22 A;  3NBP A;  2UZA A;  2KTQ A;  1HR0 J;  1Y5N B;  1FJE B;  2MKY A;  2JSX A;  1SUQ A;  1ARO P;  1CJK A;  3TAM A;  3AH6 A;  1BQM A;  1M1H A;  1VHF A;  2OGU A;  4DUZ J;  3SBM A;  3N5B A;  5DGA A;  2NXN A;  4N56 A;  1ZS6 A;  2OMO A;  2XZW A;  4RWX A;  2HBR B;  4LFC F;  3HKW A;  1DZ5 A;  2A10 A;  3DDN A;  4O44 A;  2V4J B;  4I2Q A;  1JLE A;  3UW1 A;  3Q8P B;  1JMT A;  4PAB A;  1VQL S;  3K0J A;  3JSR A;  4ETX A;  4Y00 A;  3PRB A;  2ZBP A;  1M1G A;  3PDN A;  2K7J A;  2R7T A;  4UST A;  3AOD A;  5H9F J;  2JLE A;  2AX0 A;  4I7F B;  3MEG A;  5BXI A;  2DNM A;  4RW7 A;  4DFJ A;  4NL5 A;  2LKZ A;  1VQM S;  3KLE B;  2N82 B;  5JMN A;  1VOM A;  2H4Y B;  1RA6 A;  1ZTW A;  4NRU A;  2YTC A;  5C7P A;  4PQA A;  1XNQ J;  2DCL A;  3BKU A;  2AWZ A;  5L39 A;  1NU4 A;  2F40 A;  3PX4 A;  4Q0B A;  1PAE X;  1C1C B;  2DH8 A;  1Z1Z A;  3CWJ A;  1TQL A;  2ZE2 A;  5ETN A;  1X0F A;  2H48 B;  1WHW A;  1RTI B;  2HZV A;  4NE9 C;  3R6L B;  2CPH A;  1P9Q C;  5CZX A;  2VQE J;  3PHE A;  1EJ7 L;  1VBY A;  4DL6 A;  1G2E A;  5EGY A;  3G9C A;  3M4X A;  4FYX B;  2PE8 A;  3PHT A;  4F02 A;  3Q0A A;  2BW2 A;  1VR6 A;  3OTB A;  4UOF A;  1FXL A;  2HWI A;  1H2U X;  3FZB A;  5KFY A;  4B3T J;  2MTL A;  1Y00 A;  1RUS A;  3L9Z A;  3FSX A;  2V5H G;  2W2M P;  5MAO A;  3CJ2 A;  2XHW A;  4MK7 A;  4KIA A;  3HHL B;  4Y28 C;  1OY6 A;  3OR1 B;  4BWJ A;  2LEP A;  2COL A;  3M7V A;  2Z2M A;  1GTH A;  2Q3P A;  3HO1 A;  1KTQ A;  1GMW A;  4I2P A;  3LP2 A;  3H2U B;  3BBF A;  3H5U A;  2GGP B;  3VVT A;  3LTO A;  2VUG A;  3T5J A;  2J7U A;  4PKD B;  1ZH5 A;  4RBU A;  5HO4 A;  1MRO A;  4NCG A;  1DQ8 A;  3H25 A;  4LF8 F;  2MLX A;  2MGZ A;  1FFS B;  1TMM A;  4KBI A;  1FE0 A;  1BY9 A;  3G6X A;  2C1E B;  2W1B A;  2VJV A;  2CPE A;  3NLC A;  5KT2 A;  4LVN P;  2QTW A;  3CVK A;  2W7A A;  1JLA B;  2YH1 A;  2CNK B;  4LIR A;  1R27 B;  2ZHA A;  2BX6 A;  3UDC A;  5DQG A;  4JOU A;  4Q44 A;  4N76 A;  3H4D A;  3OVB A;  4PUO A;  1P6T A;  2A2D A;  2LP4 A;  2VBY A;  3QAE A;  1S1W A;  3MWB A;  4LF2 A;  1SIZ A;  3NMR A;  5KFE A;  3VAK A;  3PO5 A;  4P73 A;  3KG0 A;  4USH A;  5GAD U;  4M5N A;  1URR A;  3AD9 C;  5DM6 Q;  4R8U A;  3FEY B;  4OYB A;  4DR1 J;  1HYS B;  4YEA A;  4OZ2 A;  3T9Z A;  5BJR A;  1CJU B;  3M2V B;  2V67 A;  5IOL A;  1H74 A;  3NCQ A;  3BGL A;  2MQQ A;  3QO9 A;  4TYA A;  5KAK A;  1IBL F;  3AJD A;  2CDQ A;  1HI1 A;  4JI5 J;  1DTT B;  4FF1 A;  2Y8W A;  3NMA A;  3MGJ A;  3J80 U;  5B08 A;  2UVW A;  2C2M B;  4TY8 B;  2HND A;  1X0P A;  1IR0 A;  3ONQ A;  4ID5 B;  1U1Q A;  4FYV B;  5HMY A;  2CJB A;  5KFX A;  2EC2 A;  2GHW A;  3DNC A;  4CP5 A;  1HNW F;  2OD4 A;  4IFY A;  4NPO A;  2KZZ A;  4USU A;  4FKX A;  1XC9 A;  2HQF A;  3PX6 A;  3CCR S;  4WF9 Q;  1RAA B;  4DUT A;  1OY9 A;  2I1R A;  1HBU B;  4DF8 A;  4DR6 F;  1VLY A;  4CLW A;  4ER8 A;  3PNI A;  3TAR A;  3ET6 A;  4RUH A;  2LQJ A;  2DKO B;  1ZPV A;  3C66 A;  3VCD A;  3QZ7 A;  3THV A;  3I0S B;  3HJF A;  4ZCL A;  2IYG A;  1OQ6 A;  2X1B A;  4QPT A;  5IC6 B;  1UW4 A;  5CHC B;  2K1R A;  3R5G A;  4ZVT B;  2YKN B;  2Q6C A;  1X4E A;  2OSR A;  1NHV A;  5LSL A;  4HHJ A;  4ZVS B;  4OZJ A;  3IG1 B;  1N48 A;  4ZK7 M;  5F8L A;  2CPJ A;  3DLG A;  2N4D A;  3VZH A;  1YG0 A;  2AJQ A;  2V9W A;  3RR7 A;  2PI4 A;  4TXS A;  2WRM A;  3MED B;  2UUA F;  4YOE A;  2MYF A;  1MML A;  3QIP B;  2XMJ A;  2OSQ A;  3KJF B;  4MIA A;  3HF5 A;  2KXN B;  2A6O A;  2UU9 J;  2NQP A;  4GVB A;  4DCO B;  1RP5 A;  2AYM A;  1IJF B;  1EP4 A;  4Q8E A;  3NCR A;  1JLG A;  4XPC A;  1B0T A;  1NSK L;  3D1H A;  2DNP A;  2RKI A;  1SPB P;  2VA2 A;  4K4U A;  2M8H A;  4DV3 F;  2W2O P;  2MEW A;  3M2R B;  4ILR A;  3U7J A;  3W60 A;  2H4W B;  2QLX A;  5C24 B;  2J0X A;  4M5D A;  4DBQ A;  3O3L A;  1KSP A;  4HL9 A;  4V19 J;  4A48 A;  1YJV A;  4FZV A;  5IWA J;  2R8H A;  1O5J A;  2MY8 A;  1FWP A;  2V8P A;  3DLE A;  1HFE L;  2SXL A;  4QU6 A;  5A2Q U;  2L08 A;  4WFY A;  4LFB J;  4DPO A;  4NLT A;  3NOG A;  1Y11 A;  4CYU B;  2MQP A;  4DFP A;  1FE4 A;  4B9L A;  4ZVO B;  4ATN A;  2IY5 B;  3QMQ A;  1HKA A;  2NZ4 A;  1G4C A;  2WK4 A;  4UT4 A;  1U48 A;  1EAR A;  2FJV A;  4A47 A;  4PZV A;  2LU1 A;  1S1X B;  2KO1 A;  1PGZ A;  5HK4 A;  2W9B B;  4FXW A;  1PJ6 A;  3TUP A;  2RS2 A;  4DSF A;  4IR9 A;  2W2P P;  1HD0 A;  5G0R A;  3TA0 A;  3OUY B;  4MKB A;  2Z58 B;  1CBK A;  4BWM A;  2WCX A;  4AFF A;  3CTR A;  3V5R A;  4X4N A;  6FD1 A;  1QTM A;  1OWX A;  5ETQ A;  3FBF A;  2XMT A;  3P4U B;  5D0E A;  1XBW A;  1XNR J;  4HI2 A;  4RNO A;  1Q4R A;  3DFE A;  3ZTQ A;  3AAW B;  5A8R B;  2HHP A;  3BN7 A;  4OJ1 A;  5C42 B;  1CC8 A;  5E3Q A;  5A8W B;  3J7Y U;  3M8Y A;  5LMN J;  1GFW B;  1XK8 A;  4KH0 B;  2QLW A;  2R7W A;  3DGP B;  1SJ1 A;  4G65 A;  3BBB A;  1NSQ A;  2OPQ A;  2J6S A;  1PCA A;  3TUI C;  1H98 A;  2EC0 A;  2X7I A;  3MM8 A;  1VQP S;  2LQB A;  2XY6 A;  4L74 A;  1S6O A;  1M5H A;  3A8K A;  2UVV A;  2DNH A;  3L95 X;  2LMI A;  1NHU A;  4GO7 X;  2XMU A;  1F9E B;  2IHR 1;  1YKW A;  1FDB A;  4Y0F A;  4NYO A;  3O5T B;  1EKS A;  2I9S A;  2DVI A;  1IBC B;  5SUH A;  4UZB A;  1RT1 B;  2XS5 A;  4LUB A;  3PKM A;  2M2B A;  1WF2 A;  3G71 S;  3Q8Q B;  3CCS S;  5F0U A;  5CYJ A;  3V81 B;  1TK5 A;  3DHW C;  1IWG A;  2B56 A;  3UNY A;  3CCM S;  4NLW A;  2IBK A;  1VQN S;  3HM9 A;  2OJ3 A;  1HMV A;  2D41 A;  4NLR A;  3T6J A;  1SJ4 P;  4ZLL A;  1KEK A;  3MMA A;  3MM6 A;  2HQI A;  1UTA A;  3TRG A;  2RS8 A;  2GHV C;  2WON A;  4JI4 J;  3HFV A;  5F8J A;  1L3K A;  3MUV P;  2HBQ B;  2M3D A;  1REV A;  4ITS A;  4O23 A;  4IO1 A;  1HPZ B;  4C7Q A;  1EQM A;  1T7P A;  5KT7 A;  4ZVG A;  4DSJ A;  3SQO P;  2UV8 G;  3CSK A;  2AF6 A;  3G82 A;  1HWK A;  2IJF A;  4M94 A;  2B9E A;  2MZ1 A;  3PFO A;  4CLZ A;  1LW2 A;  1PIE A;  2XY7 A;  1SC6 A;  3R3T A;  3BV8 A;  4ZN1 A;  2FHJ A;  5D3G A;  1NJI T;  2DR9 A;  1PAU B;  2Z57 B;  4DR7 J;  1X5P A;  2RF2 B;  3HHE A;  5FJ4 A;  2KYX A;  3TW0 A;  4KRW A;  2ATL A;  4JI2 F;  3TYT A;  3FFI B;  4CLT A;  4K2J A;  3P45 B;  5AXM A;  2ILZ A;  1D8Z A;  3JQM A;  1OPZ A;  3R97 A;  2HHT A;  5AE1 A;  4W92 B;  1YLX A;  4ZVE A;  2BKO A;  4IG0 A;  4ED3 A;  1LXJ A;  3I56 S;  2XG8 A;  2DHX A;  3MOZ A;  3M8W A;  4OZN A;  1MSW D;  3RGI A;  2RB7 A;  1KLM A;  3D1Q A;  2HHU A;  4MH8 A;  2RUG A;  1RTJ B;  4CH1 A;  3JYT A;  1ZET A;  1L3S A;  4DDF A;  2ZVS A;  4X65 F;  2W9C A;  1RLC L;  4X66 J;  4QZV B;  2G2Y A;  4DX5 A;  1V3S A;  1X4H A;  4MTP A;  5T41 A;  3UR0 A;  5GVQ A;  2RSQ A;  4F04 B;  3HD1 A;  4U7U K;  1WD6 A;  2AKW B;  2DY1 A;  3T1Y J;  2E7V A;  3NAH A;  3S1T A;  1KBR A;  2AJ1 A;  4M1K A;  1VBK A;  5ETT A;  3D6F B;  2YX7 A;  4IYQ A;  2F7V A;  4ES1 A;  2YWW A;  1S9G A;  3LP1 B;  2DXF A;  2KXH A;  2LLZ A;  1T03 A;  4HAC A;  1VBX A;  3CJQ A;  3P96 A;  3OVS A;  3CCZ A;  4NA1 A;  2WZ1 A;  4CZC A;  1FXR A;  5KFT A;  2I38 A;  3TAQ A;  4DJB A;  2V69 A;  4QYZ J;  3HLU A;  1N36 F;  1NND A;  3JXO A;  4ECX A;  3SV4 A;  1FK9 A;  4GKJ J;  2CJQ A;  2OPP A;  1QAI A;  2F4V F;  4JI3 F;  1QUV A;  5K14 A;  5HVG A;  5CYM B;  2P6S A;  2AJ0 A;  4O3O A;  1WAC A;  4F8R A;  4A8K A;  3W9I A;  4KFB A;  1V9O A;  2JZ5 A;  4WZM A;  3EYZ A;  1DRZ A;  4NLQ A;  4B3O B;  1WC5 A;  3OW2 R;  1RQ0 A;  1JJ2 R;  3CMQ A;  1VQ9 S;  4PQU B;  4A8Q A;  2CQ3 A;  2DHH A;  3GG1 A;  4IOB A;  4OYZ A;  2EPI A;  2JH3 A;  2R7V A;  1VI7 A;  2J7W A;  5KOX A;  2D9O A;  2DCU B;  2CQH A;  3BEG B;  3ZZO A;  1T3N A;  3VWS A;  3SQG B;  3RW6 A;  5BR8 J;  3BPS P;  3BSO A;  1JLC B;  2VL1 A;  3ILO A;  4LF7 F;  3D4J A;  3NS5 A;  4Y6I A;  1J5O A;  1KVI A;  3CDB A;  2RE1 A;  4H4O A;  1QE1 B;  2FJE B;  4DU7 A;  1TK0 A;  1RT2 A;  1HR0 F;  1S0N A;  1YJ9 S;  3NCP A;  4DL4 A;  1RT7 A;  3D66 A;  2BW7 A;  2FZC B;  2RRA A;  3FRY A;  1GK8 A;  1S79 A;  3LA0 A;  4EYH B;  2LA4 A;  2C28 A;  4NOH A;  5F8H A;  4YS2 A;  2MKS A;  4ELV A;  2DGS A;  4UTG A;  4K4Y A;  4LF6 F;  1SI9 A;  1NZA A;  3OL7 A;  4OI0 A;  2R8J A;  4P72 A;  1SCJ B;  2ZH7 A;  1U6F A;  1TL3 A;  1WHV A;  5JJB A;  1V5V A;  1WOO A;  1FVS A;  3IM8 A;  1Q8L A;  4DX7 A;  3NS7 B;  2MLZ A;  2XNQ A;  5D78 A;  1LFP A;  1KN6 A;  1FJC A;  2LDY A;  2LXU A;  5L9X A;  1H7W A;  1RIS A;  2WW8 A;  4R0E A;  1BLU A;  1WEY A;  2QYC A;  2Y1L B;  2DO4 A;  2HS4 A;  4QWE A;  2E1P A;  1TL5 A;  5AXL A;  4B9T A;  1K8A T;  2DT9 A;  3HHL D;  3OR2 B;  3T19 A;  3SCI E;  5ETS A;  2J9D A;  3GQC A;  3C6T B;  4I68 A;  3OSP A;  4LJM A;  1WEL A;  1J2V A;  1XTZ A;  2XYG B;  4ERD A;  2RU3 A;  2H5E A;  5M2P A;  2MPU A;  5HJX A;  1NB2 A;  3MD1 A;  3C46 A;  3KMS A;  2WTF A;  2B43 A;  2AEM A;  4AYB D;  3V4I A;  2FJW A;  4F7V A;  1CPZ A;  3GYX B;  3BKF A;  1S1U A;  2RVJ A;  4B9M A;  1JQG A;  3PTW A;  2WW4 A;  1KVK A;  4JYA F;  1K0V A;  5ADZ A;  4KV8 B;  3LW5 C;  2CJX B;  1Y3K A;  3ZTP A;  3WBZ A;  2Q1L A;  1T3O A;  4AXI A;  2BDP A;  1MN9 A;  4XK8 C;  4DQI A;  1WHY A;  1Y10 A;  5KT6 A;  3BGF A;  5HAN A;  5HL7 Q;  3VTI A;  1RHK B;  4DLE A;  2PT0 A;  2IVF B;  1FKP B;  4H4K C;  4DOZ A;  2D3U A;  4C11 B;  4HKQ A;  3H5S A;  3NGT A;  2DBB A;  4MIW A;  1RWU A;  3IBF B;  3QRP A;  2PD1 A;  5LSO A;  4J5O A;  3J7Z T;  4XAK A;  3DM2 B;  3CJK B;  4J9M A;  4DX8 H;  1CJV B;  1VQS A;  3I5C A;  2I0X A;  5LXR A;  1RAC B;  4OJG A;  3HHL C;  4QWD A;  3D0G E;  1JXL A;  2JFK A;  4NXN J;  5KFP A;  3OL6 A;  2GA7 A;  4JI7 F;  5LJ5 Y;  2ZM6 J;  5I3P A;  4NML A;  3PX0 A;  2NZC A;  4JV1 A;  1PJ5 A;  5DZ6 A;  4UQG A;  2RD5 C;  2GML A;  2YKP A;  1F1B B;  3PJW A;  3CIM A;  1YJW S;  4RPF A;  3WQP A;  1UPM B;  1IKV B;  1AA1 B;  2PEB A;  3W9H A;  3DRS A;  5KTQ A;  3HP6 A;  2XI3 A;  2BJE A;  2BM1 A;  1EET B;  4J9V A;  2ALZ A;  2YXL A;  2ZDO A;  2QT7 A;  3CUL A;  1IJE B;  2ASL A;  3TAP A;  3HDS A;  2XUL A;  2NYH A;  1UFL A;  4J7C A;  1RK8 A;  1Z2Z A;  2BZ2 A;  2Y8Y A;  5KG2 A;  1RI7 A;  3NGK A;  5H9E J;  1UA1 A;  2NYI A;  5DET A;  2ZKT A;  2JOQ A;  3FMW A;  2CQD A;  3MDF A;  4ECQ A;  2MST A;  1I6J A;  5EN1 A;  4LRB A;  3Q8Y A;  4YME A;  3KHG A;  2CQP A;  2CAJ A;  3M32 B;  4FS2 A;  4X62 F;  2RIJ A;  1T05 A;  3IXQ A;  1APS A;  2R7X A;  3ZC4 A;  1F3V A;  3I0R A;  4PYA A;  3RB6 A;  1Q8I A;  1NK9 A;  2DNO A;  4P2X A;  3AQP A;  2JNJ A;  5C5J A;  3PAC A;  3GCX P;  2HG4 A;  3W61 A;  1D3W A;  2YNH A;  3DCA A;  3Q22 A;  5M2R A;  4WE1 B;  1X4G A;  2BM0 A;  1HNV B;  5IT9 Y;  3WZ0 A;  4AQY J;  1NJW A;  1S7I A;  4RBT A;  2CNL B;  5JXS A;  1S77 D;  4OI4 A;  4QR2 A;  2JC0 A;  3VHQ A;  1VC5 A;  3PEJ A;  2OD6 A;  3MCS A;  4C4W A;  1MW7 A;  4I6Y A;  4C8Y A;  4C97 A;  4YN3 B;  2MKJ A;  3R7B B;  1R0A A;  3CJ3 A;  2JEG A;  1ZTT A;  4KGK A;  2EG1 A;  3PJX A;  4TYB A;  1R0B G;  2EFN A;  1TL7 A;  2HQD A;  1M5V C;  2V63 A;  4LFA F;  3BM7 A;  4O3P A;  5HMW A;  2IM0 A;  2J9C A;  3EMT A;  1X4C A;  1C0U A;  3MF5 A;  3OJS A;  3OHA A;  3FQL A;  2LA6 A;  5F0W A;  1QD1 A;  2EFV A;  3AT1 B;  1H6K X;  3TI0 A;  5HI7 A;  1RBL A;  1YQH A;  1SV5 B;  2BJ1 A;  3KK1 B;  3MPY A;  5LSR A;  2HHH J;  4E98 A;  1N0U A;  4KYZ A;  4OHY A;  4NCG B;  2OO4 A;  4X4O A;  2MGZ B;  2WSE C;  5KFZ A;  2QJ3 A;  4EBC A;  2CZ9 A;  3UR3 C;  4DR2 J;  2ASD A;  3CCJ S;  4C8L A;  1FJG J;  2DR6 A;  3TNV A;  3G96 A;  2ZBC A;  2J6U A;  3N6N A;  3F44 A;  4EO8 A;  3BGR A;  5JVH Q;  2PA3 A;  4ZP6 A;  4GRS A;  1VQK S;  4PWD B;  5J2M A;  2J8S A;  3PEH A;  4EEY A;  4DFM A;  2WOM A;  5IWA F;  2CKW A;  1KHW A;  4OIX A;  4CLS A;  2UXC J;  5J1E B;  4OHW A;  4MKA A;  1S1W B;  3AJ2 A;  2Q66 A;  3KLF A;  5L1I A;  2HEK A;  4ZVP B;  3M9M B;  2ADB A;  3RZA A;  4X64 J;  8ATC B;  1NXI A;  2E5G A;  2R2S A;  2HMI B;  4NLG A;  4FYW B;  1GT8 A;  1D9F A;  2DGQ A;  2BV3 A;  2DNZ A;  2G13 A;  3BYP A;  9ATC B;  2AHO B;  3V6J A;  3T41 A;  3EDR B;  3EIC A;  3ELH A;  3QYY A;  1ZBT A;  1T0T V;  3H90 A;  4DL0 C;  2K3I A;  2A0F B;  3WDO A;  3OFH A;  3QRR A;  3F0N A;  1P1T A;  2IC3 A;  1X4D A;  4K0K F;  4L76 A;  4YR2 A;  3GV7 B;  1NME B;  1PSD A;  3W62 A;  5J2N B;  2V2V A;  3N0V A;  1HI0 P;  1VLO A;  1M5K C;  2H5I B;  2HND B;  4YP3 A;  3QWP A;  1R3N A;  3CO9 A;  3CXC R;  2FJB B;  2OI2 A;  3UO0 A;  5G4D A;  2QV6 A;  3CJR A;  1WC3 A;  3GE9 A;  2QL5 B;  5H1S V;  4FF2 A;  1SXL A;  3A3P B;  1AT1 B;  2E5L J;  1MN7 A;  3AA9 A;  1RT3 A;  3BH6 B;  2JEJ A;  1YRT A;  3S8S A;  2CZV C;  1VIS A;  2QFJ A;  1HHS A;  4UOG A;  2IIH A;  1UJ4 A;  3CCU S;  3GSD A;  5JUM A;  1VRU B;  1X9M A;  2ZH1 A;  4PXC A;  4ED5 A;  2YX4 A;  3VGV A;  1VIO A;  3OJU A;  1QLN A;  1MU2 A;  3UPF A;  2OFG X;  4J37 A;  1RSC A;  3Q86 A;  1RTH A;  4YB6 A;  4HH0 A;  5D77 A;  3BDE A;  3UDV A;  3M1V B;  2X1F A;  2PC6 A;  2GMJ A;  1SJR A;  2E5J A;  3G6E S;  4F25 A;  2GJ2 A;  3R2C J;  5T7L B;  1OQ3 A;  1S10 A;  2CG4 A;  2F9D A;  2J0S D;  1WG1 A;  4O4G A;  4Y2I A;  3H20 A;  1H7X A;  4IG3 B;  2NPI A;  4OQJ A;  4NX9 A;  4ECS A;  4DQQ A;  1N5Y A;  2UXB J;  2GO9 A;  4OI2 A;  1KQF B;  3K89 A;  2KJV A;  2XSF A;  1EP4 B;  4ANE A;  2B8Q A;  2N3L A;  3DKD A;  2AGQ A;  4OMF G;  5IQ6 A;  4DV7 F;  4Q5V A;  1WI8 A;  2DHA A;  2JEF A;  2BJD A;  1DAX A;  2IAJ B;  1LW0 B;  2ADC A;  4R5P B;  3MM5 A;  2I2Y A;  1RHJ B;  4KO0 B;  5KFW A;  2XMA A;  2W4P A;  1KP6 A;  4YUD A;  4MK8 A;  2QL9 B;  3G8Q A;  2XLJ A;  2ZHB A;  3WIV A;  2BAC A;  3OXG A;  3OL9 A;  2ILY A;  4IOC Q;  2WB4 A;  1CJT A;  3P5T L;  4WBF A;  2CRL A;  4HR2 A;  1TFW A;  1HQE B;  1TKX B;  1U49 A;  4WTO B;  2H3E B;  3IR5 B;  3HT0 A;  3DRR A;  3U27 A;  3M8P A;  1D9A A;  3MEE B;  2EVZ A;  3ADA C;  1SKS A;  5FLX Y;  4J9O A;  1DLO A;  1ZM2 A;  3ITH A;  1YJT A;  3DXB A;  4TY9 A;  4Y2K A;  3UN3 A;  2XYP B;  3HZE A;  3BH7 B;  1T11 A;  5KFD A;  5DRK A;  5E7O B;  1RJJ A;  1BC6 A;  1BQX A;  1N54 B;  1U1L A;  5CQG A;  1N8R T;  4QR0 A;  3J80 Y;  4FNI A;  2WVF A;  2FGC A;  5ETP A;  3RRH A;  5I42 A;  1HQU B;  4X4Q A;  3OHB A;  2FVS A;  1TL4 A;  3W2V A;  5A76 A;  5L46 A;  3KLI A;  4XTT A;  3SYZ A;  1SKR A;  2P9C A;  3CUN A;  1TKD A;  1R7I A;  1MWQ A;  4EK2 A;  1B64 A;  2R7Q A;  1CQN A;  2ZZT A;  2VPZ B;  1OS5 A;  5K8N A;  4ZPT R;  5FDL B;  5D4P A;  4ZVQ B;  3KJN B;  3SSQ A;  4OX7 A;  1HAR A;  3PYD A;  1KNZ A;  3IGV A;  4DI6 A;  4ICL A;  2AX1 A;  2P9G A;  3DU6 A;  3E2E A;  1S97 A;  1A9N B;  4MKY A;  3PYG A;  3IRX B;  3RBD A;  1OY8 A;  4QW8 A;  5IM0 A;  4KHP F;  2GX8 A;  4DS4 A;  2M88 A;  3RAM A;  4U6P A;  4PPZ A;  3SSS A;  1D0E A;  2C2O B;  2NRE A;  1Q7L B;  2MHN A;  3ZZU A;  4RU2 A;  4F0H A;  1HNZ F;  2IA6 A;  2D74 B;  3TZW A;  1IM4 A;  1J27 A;  3C6U B;  3UNG C;  1XIQ A;  1FKO A;  1RHU B;  4EU0 A;  4DV4 J;  1N33 F;  2V2Z A;  3MCO A;  2AT1 B;  4F4K A;  3MMA B;  3FBB A;  3VGS A;  3IBW A;  3CD6 S;  1AFI A;  2P2C B;  2DIV A;  5IZH A;  4AE5 A;  4OLP A;  1REV B;  1W2I A;  3EPG A;  2GQQ A;  2VA3 A;  3KLH A;  5IFM A;  2JWN A;  1S9E A;  3PYF A;  3UVJ A;  4F3O A;  3SCL E;  5FII A;  4GO5 X;  3D28 A;  2AYE A;  1CC7 A;  1S6P A;  1LWF B;  3LQV A;  2IVM A;  1SC3 B;  3I5A A;  3RAQ A;  1RT5 B;  1WDD A;  4LSL A;  1SL1 A;  1RYS A;  3ISZ A;  3D0H E;  3HKZ D;  2J76 E;  2GJI A;  1EQ0 A;  2QG9 B;  3GIJ A;  3LAM A;  1LW2 B;  3H2L A;  1L3V A;  2PEH A;  3G8T A;  5KG7 A;  4ZLN A;  1UEU A;  4ZJO A;  4ED2 A;  2IMO A;  3OD2 A;  4K4Z A;  3J7A N;  4IH6 A;  3TOQ A;  5B0A A;  3GLJ A;  4A46 A;  5F8G A;  1I51 B;  2V2Q A;  4ETZ A;  2QA2 A;  5E2Q A;  3G6Y A;  3R1L A;  3J81 Y;  2HVH A;  2CNN B;  4FVM A;  3IAM 9;  1T94 A;  3W2W A;  5AJ3 F;  4C3M A;  3F56 A;  3QT8 A;  2CQ1 A;  4BHQ A;  1IKY B;  1TVR A;  4WII A;  1G1X A;  3MM7 B;  4U8Y A;  1U2R A;  2NXE A;  2MKK A;  3FNN A;  4OZ5 A;  1UCN A;  1FTC A;  3KLG A;  1NZ8 A;  4EBE A;  3Q24 A;  1RWP B;  4DWI A;  3ZZY A;  2L9D A;  4DV6 J;  1YRX A;  4FBT A;  2DPJ A;  4ID8 A;  4WP9 A;  4MT1 A;  1BQN A;  2XO7 A;  3WX4 A;  1KLM B;  4NLY A;  3O2I A;  1C2P A;  4C8N A;  3QNW B;  4PXD A;  5I3U A;  4A8W A;  2HNZ A;  1HL6 A;  2V68 A;  4B3R J;  1GX6 A;  1MWZ A;  1RT4 B;  4ED8 A;  2CPY A;  2XHC A;  3OVA A;  4NLV A;  2BE7 D;  3JTN A;  4DR5 F;  3WC2 A;  5GAD I;  1QDU B;  1HA1 A;  4K4W A;  4WFA Q;  5ETM A;  2RQM A;  1UAW A;  3K17 A;  3CO0 P;  3DI6 B;  3D1O A;  2VBW A;  3BPD A;  2VFS A;  1YTY A;  3A13 A;  1N5Q A;  2HVI A;  4RL1 A;  4NLX A;  2H65 B;  4C2M A;  2VJU A;  4OX9 F;  4HAC B;  5DM7 Q;  2VFU A;  2O3D A;  2ZD1 B;  3V6K A;  3EJM A;  3NP5 A;  3QGI A;  3OL8 A;  3DGV A;  5U47 A;  5DS7 A;  1WSR A;  2ZH2 A;  4LF5 J;  2BMB A;  1UWA A;  1GEH A;  4C3K A;  2X1G A;  4V19 X;  1VQ7 S;  5EX0 A;  1R8H A;  3AJ1 A;  2O67 A;  3MM9 B;  4N41 A;  4Y3C A;  2BE2 A;  5J1P A;  2MQL A;  4WWS A;  2R7S A;  2CWK A;  3MUM P;  1ICE B;  2A18 A;  2DXE A;  2OPP B;  1QJH A;  3EGZ A;  3BYR A;  1IKW A;  2B5J B;  1RKJ A;  2ZH8 A;  4LF9 F;  2RRB A;  1HBM B;  4NEZ A;  3HK2 A;  2P8I A;  4DLG A;  4A8Y A;  4NCB A;  1UKU A;  3VAG A;  4ECV A;  3CDW A;  1IBM F;  4ED6 A;  4I56 A;  2E7W A;  4LSZ B;  3IWN C;  5HBM B;  1XMO F;  2L9N A;  2GMH A;  2DRB A;  4KFB B;  4ZLP A;  2EG2 A;  4I6A A;  5CYQ B;  2E1C A;  4OV1 A;  4RWW A;  2FLN A;  2QA4 S;  1V3Z A;  3NNC A;  2KVQ E;  2KN4 A;  1JNZ B;  2VG7 B;  3C15 B;  4NLD A;  1CUL B;  3P6Y C;  3MOJ B;  1RWN B;  4W98 A;  1S4F A;  2RQ4 A;  2FY1 A;  1KFD A;  2D3O 1;  4DV5 J;  2HS3 A;  1YI2 S;  4U95 A;  1FI4 A;  4O3Q A;  5GAH I;  5HSP A;  1JLQ B;  2ZM6 F;  3PW2 A;  3BN4 A;  4DV0 J;  3G6V A;  5J2P A;  1ELO A;  2UUB J;  2EKN A;  3PXG a;  4C8Z A;  3GFX A;  5D0R A;  3OTO F;  5KFO A;  1AZS B;  1HD1 A;  5DQI A;  4K50 A;  3H7H B;  2CQG A;  3TZY A;  2EK6 A;  3M2U B;  2L48 A;  3UDE A;  5DQH A;  1U0H A;  1KLN A;  3R5D A;  4OX8 A;  3W64 A;  2HFZ A;  2HHW A;  3A4T A;  3A8I A;  4EFA C;  1K9M T;  1ZAV A;  2O66 A;  4C0H A;  3AB2 B;  4TVA B;  2MQO A;  5DJB A;  4J90 A;  3OLA A;  4JI6 F;  1S0V A;  2AW0 A;  2XZD B;  4TLQ A;  3Q83 A;  3CC4 S;  4LRD A;  5L8R C;  5HVH A;  2V4J A;  3KTQ A;  2AD9 A;  1XQI A;  2HIY A;  3EM1 A;  4ZP9 A;  3PRV A;  3S6E A;  5K9F A;  4L3N A;  2C3M A;  2VFT A;  4WTY A;  5ETL A;  3W66 A;  4B3M J;  1Y7P A;  1BXN A;  1YX2 A;  1IKX B;  3DOM B;  3CCV S;  4I7F A;  2FHM A;  3QRQ A;  3H42 A;  1SC1 B;  2VPX B;  1TV6 B;  1IBK J;  2IRX A;  4CLK A;  4G3I A;  1NEE A;  3VQS A;  2I5J A;  1U09 A;  4DMZ A;  2FY8 A;  2NUU G;  3L7P A;  1C1C A;  1V5I B;  1FKA F;  3QJP A;  1MLA A;  4AND A;  4ZVF A;  2AMC B;  1C4C A;  2XY5 A;  1KC8 T;  4BS2 A;  3J7Y I;  2PII A;  2MLY A;  4ZIT A;  4ZHR B;  2Z8Q A;  2PN6 A;  1RTI A;  1FXD A;  5HN0 A;  4DSK A;  5AXK A;  4NCA A;  1C1B B;  1B0P A;  1NJZ A;  1SQE A;  2HYI B;  2KT2 A;  2QX0 A;  5KFN A;  1V6H A;  4YB1 P;  3W8P A;  5J2Q B;  3BKT A;  1KD1 T;  3M6U A;  4IH5 A;  4H4K A;  1CLF A;  3MPW A;  3SZ2 A;  5B0C A;  2F9J A;  2CJA A;  4NA2 A;  1NLK L;  1TZ0 A;  4YHH J;  1Q53 A;  1VQ4 S;  2PO4 A;  2HGN A;  4ZJQ A;  1U7L A;  3B8H A;  2FYX A;  3Q8R B;  4Q7A A;  4KGZ B;  4ZPW R;  1FFG B;  4DR3 F;  3HHL A;  2B8P A;  3OR1 A;  2K3K A;  2JVR A;  3H8Y A;  3KJV B;  1MWY A;  5K8M A;  3AB4 B;  1S5Z A;  2EBE A;  4CO2 A;  2HBY B;  3R8Y A;  2GGP A;  2CDR B;  2VG5 B;  2VF3 A;  2QN6 B;  1FJG F;  4PG6 A;  3GON A;  4R25 A;  3G8S A;  1WWH A;  3UDL A;  2KFN A;  4O0N A;  2E5H A;  5IQQ A;  4FVC A;  4MMO A;  2KDO A;  3NXZ A;  3UD3 P;  2FTR A;  1FEE A;  2N7Y A;  3J7A 1;  1VQY A;  1JLA A;  2BE9 B;  1NRK A;  4NXM F;  1ZA1 B;  4N77 A;  4ZA1 A;  4RNH A;  4PYD A;  1C0T B;  5DLG A;  1PO6 A;  4ECZ A;  1AFJ A;  4DV1 F;  1NK0 A;  1U8W A;  3VR1 A;  4NLS A;  3D3B J;  2WBM A;  1PYO B;  4X64 F;  2ATC B;  2W8K A;  3DRS B;  3MFH A;  1JXE A;  5C2G A;  3KKF A;  2A1B A;  3GJQ B;  2FC9 A;  2KVI A;  3DDI A;  3CPW R;  3QBC A;  1W26 A;  2VPY B;  2FUG 9;  5I3Q A;  1DAR A;  5F8M A;  2YKQ A;  4K59 A;  1RHQ B;  4LFC J;  2RIL A;  2DRA A;  2ALY B;  2ZEJ A;  3UD5 A;  1HYS A;  5L1J A;  3EGN A;  5IV3 A;  3MI7 X;  2ZZM A;  3ZFV A;  1H3D A;  1M5O C;  2ZJP Q;  2DNQ A;  1T05 B;  4WKR A;  1D9D A;  2HAI A;  2WSC C;  4NEY A;  1TAU A;  2R2U A;  1H38 A;  2IDL A;  4TY8 A;  3JQK A;  2BQR A;  4G1I A;  3POT A;  4ID5 A;  2QFI A;  2R7R A;  1YZ7 A;  2E5L F;  1RWW B;  3CCT A;  3G87 A;  1XMQ J;  2DHS A;  2JVO A;  4Y2C A;  4LMZ A;  4K4X A;  5D8H B;  2QIF A;  1S0O A;  1RZM A;  5B0E A;  1HBU A;  4JV2 A;  1RAJ A;  5F3Z A;  1K73 T;  1UEK A;  3TAN A;  2FLL A;  4TKT A;  4NMX A;  2MDA A;  1F6T A;  3WHI A;  1JB0 C;  1R0A B;  5LXY A;  1LK5 A;  1PYS B;  2F3J A;  1FDD A;  2XQC A;  2V8V A;  1HQ2 A;  2YKN A;  2J9D E;  1E6V B;  3R7S B;  3FK4 A;  4ZDN A;  4IDK A;  2E1R A;  1PJ7 A;  2B7C B;  2NUH A;  1ULR A;  2R8I A;  2DNR A;  2HPU A;  3IS9 B;  2VKR A;  3DLK B;  4XPE A;  3TQ1 A;  3C8Y A;  4M5K A;  3IG1 A;  3W5Y A;  1JKH A;  1NDK A;  2G2Z A;  1YJU A;  1RYR A;  2UXB F;  5E41 A;  2VH7 A;  3T5K A;  4WXW A;  4EO6 A;  3KHL A;  4ECU A;  4EUV A;  4F0K A;  2YKM B;  4OJH A;  4JI8 J;  1TFY A;  4M8L A;  1FJ7 A;  3MCN A;  2PMH A;  4YR3 A;  3CD0 A;  1ZZF A;  1CS4 B;  3SIP B;  4CNZ A;  1ROF A;  5KFG A;  4LF8 J;  1M5P C;  2HRT A;  1PBA A;  2KKH A;  5HQ8 A;  2VQF F;  4DL2 A;  3BGR B;  2L41 A;  4WIQ A;  4OYP A;  3NNH A;  4U7U D;  3TWZ A;  5J2M B;  1KDN A;  1KKH A;  1FF2 A;  3CDA A;  2OEJ A;  2EEY A;  2XYH B;  3GV8 B;  2WOM B;  3RU0 A;  4DSL A;  3M2R A;  3I82 A;  1IR2 A;  5C24 A;  2J6T A;  3CJ4 A;  2ZH4 A;  2GQC A;  3VAM A;  4KE5 A;  2RRN A;  3BS9 A;  1X9S A;  4J9Q A;  2D9P A;  3PZP A;  3PRD A;  4RUA A;  3IP0 A;  4C48 A;  4OZ3 A;  2XC9 A;  5B0D A;  1U1R A;  4CYU A;  5HLF A;  3W1Y C;  1G6B A;  3ILI A;  4FXD A;  4Q43 A;  2ZH6 A;  1S1X A;  1RE1 B;  2W9B A;  3TUJ C;  4FN5 A;  2QYG A;  3JAM Y;  2O5D A;  2RUS A;  1VYA A;  1EAY C;  3OUY A;  4X4R A;  3QLH A;  1X4B A;  3T5H A;  4M5M A;  5CD4 A;  5HJY A;  3KUG A;  3CNQ P;  2KG1 A;  1IBL J;  1NSP A;  3OFE A;  3R7N B;  2Z4P A;  2CQ4 A;  2W24 A;  3D3C J;  1R89 A;  2IBO A;  4XO0 A;  3C16 B;  2V6A A;  2EFO A;  4L3K A;  4MYU A;  5AE3 A;  4HI1 A;  2VDH A;  3SMZ A;  3US5 A;  1FWL A;  4S0M A;  3I31 A;  5C42 A;  4N7T A;  3NWR A;  3P3D A;  1HBN B;  1HNW J;  5A8W A;  4JI0 J;  1RTZ A;  4DSI A;  2CQC A;  3LPE A;  1QAX A;  2DEJ A;  3V6D B;  2J0W A;  1JLB B;  2GW8 A;  3GCW P;  4CO5 A;  2E1M C;  3ENA A;  4DR6 J;  3DMJ B;  1L5U A;  4KC5 A;  4RNN A;  1F5B A;  3LO3 A;  2CQI A;  2MZT A;  1HBO B;  3O1L A;  3BQ1 A;  3I6P A;  2C2Z B;  5LOQ A;  4B17 A;  2PI5 A;  2OPS B;  2P9E A;  2AGP A;  4XDD A;  1MU2 B;  1HW9 A;  3VQT A;  2P6T A;  1FX2 A;  4AUK A;  5DDO C;  3Q8V A;  1EB0 A;  4PG7 A;  4WP3 A;  4CTA B;  2W7P A;  4X4U A;  5E0O A;  2FIU A;  1RAO A;  4D3H A;  1HNX F;  2XGP A;  1FRH A;  1RT1 A;  3MEC B;  1Y5L B;  2GVD A;  4UW2 A;  2VBX A;  4QQB A;  1I3O B;  5DO2 A;  1U1M A;  3HJV A;  4F4Z A;  4LBH A;  1TKT B;  3V81 A;  1RWV B;  2AJ4 A;  5KT5 A;  2DH7 A;  2KG0 A;  4DPU A;  2FJD B;  5D0G A;  2ZKU A;  1E6Y A;  4F4W A;  1P1L A;  2R4F A;  3P49 B;  2ZVI A;  2UUA J;  3IA0 A;  2Y1J A;  5DG8 A;  5KFL A;  3EZU A;  2ZWP A;  1WNE A;  2J7K A;  2OML A;  1LWC B;  5GAH U;  2V0N A;  4QBU A;  1JLF B;  3RBZ A;  1SJ3 P;  3IO1 A;  1QAY A;  3IM9 A;  1OIA A;  2KXF A;  4J9U E;  3BO2 A;  4ZPV R;  4DV3 J;  2MJN A;  1YJ7 A;  2YKO A;  2RDJ A;  2KM8 C;  2FPH X;  5E3P A;  2MY7 A;  2HZC A;  5JVG Q;  2F63 A;  1S12 A;  2IYI A;  1TK8 A;  4QIW D;  1Y3J A;  1K1S A;  2EK1 A;  5GME A;  3RRG A;  5EWE A;  1XMB A;  4DV2 F;  4LBI A;  4I67 A;  2DTJ A;  3HHN B;  5GMD A;  3MCM A;  5C2C A;  1S76 D;  3M8Q B;  3HSJ A;  4MFB A;  5E3R A;  4Z37 A;  1UVK A;  3Q8U A;  3P8B B;  1F3F A;  4PXB A;  3FFI A;  1LWE B;  1FNX H;  4A8M P;  1Q79 A;  3CD5 A;  2Z2Y B;  2POK A;  2HZA A;  2NPF A;  4F67 A;  1O0P A;  3DHX A;  4OHX A;  4Z7Y A;  3RB3 A;  2GV1 A;  3QSY B;  1OSD A;  1NKC A;  1NDL A;  3CB4 A;  2QSF A;  2D69 A;  2VC0 A;  4ZCI A;  1U6B A;  3QGP A;  1LNQ A;  4KGM A;  2HWT A;  4FYY B;  1A6L A;  4PWU A;  3BQ2 A;  2CYY A;  3ENQ A;  3LH2 S;  1KQG B;  1NPK A;  4DX6 A;  1TUW A;  3U1M A;  1UVI A;  1WF0 A;  3EZO A;  1Q0N A;  3BBC A;  4OI6 A;  2AEF A;  2DYA A;  4WKY A;  1FRX A;  2BUN A;  1JK9 B;  4CQ1 A;  4ZOS A;  5C25 B;  3UCU P;  3M8Z A;  2VIH A;  5B7W A;  4RW8 A;  3MFI A;  2CA9 A;  2O1P A;  1UJ6 A;  2DH9 A;  3M8S A;  2BAN B;  5L38 A;  1XJW B;  3MMJ A;  5E33 A;  5L9N A;  2R8K A;  4LF5 F;  4HEA 9;  3DDK A;  3LP1 A;  4C0B A;  3RB0 A;  1UVL A;  1KS2 A;  2ZBI A;  1NPP A;  3LGH A;  5A0Y B;  3K8V A;  4QIF A;  2CXE A;  2VOD A;  2CNO B;  3Q2S C;  1EHW A;  4OHZ A;  2UVR A;  1LV5 A;  1I94 F;  4P52 A;  4YB7 A;  1RBO B;  2W8L A;  4RW9 B;  4W4M A;  3VAI A;  5KFI A;  4JUZ A;  1PYT A;  1UZH A;  4K4V A;  2HBZ B;  2FD2 A;  2YWH A;  2VBZ A;  3X3U A;  2DGV A;  3FEZ A;  1H0H B;  1NH7 A;  2PA8 D;  5ETO A;  3BR9 A;  5CYM A;  4NZ6 A;  4CRJ A;  3KLH B;  1S9E B;  1S6Q A;  1HWL A;  4ZCM A;  1GMV A;  2YWF A;  2X3D A;  3HSD A;  4E8U A;  1VFJ A;  2HFS A;  2AIR B;  2VDI A;  2YNG A;  1AW0 A;  4LSL B;  1UFW A;  4B3O A;  1TKZ A;  1GX5 A;  2G1H A;  2FJX A;  3EE3 A;  2DIT A;  2D3O R;  1LOU A;  3ISN D;  3H2V E;  4PQU A;  2HGM A;  1N5V A;  2OHD A;  2XS2 A;  2HUR A;  4DV5 F;  5F9N A;  2H5J B;  4B3S F;  5B0F A;  4HT7 A;  3I4H X;  5ITH A;  1UET A;  2M0G B;  5KFH A;  1BE4 A;  2B9X A;  1M5S A;  2ZFH A;  4YY3 F;  3MPU B;  3W5Z A;  3MR2 A;  3NGR A;  2Z2L A;  2KHC A;  3SQG A;  2C2K B;  3W2W B;  1ITP A;  1JLC A;  2XO6 A;  4ALZ A;  1TR0 A;  4M5I A;  3PW7 A;  3SDE A;  3QAU A;  1FT8 A;  3K5M A;  3GIK A;  2Y1R I;  2DEI A;  4B02 A;  4DF4 A;  4JI2 J;  1QUP A;  3PM9 A;  1R8C A;  3KDN A;  4FDF A;  2KI2 A;  2DR5 A;  2YWE A;  3EXY A;  3QGG A;  3MAA B;  2B0G A;  3RYL A;  3HVR A;  4DN0 A;  4A8S A;  2OTJ S;  2CJK A;  1YBU A;  3PKY A;  3OLB A;  1T9T A;  1Z2L A;  1IQZ A;  3I5B A;  5KFF A;  5I3U B;  2HNZ B;  1LQ9 A;  3G2X A;  4HH1 A;  1SH2 A;  1PC5 A;  3NS6 A;  2BBE A;  2F4F A;  2UXD F;  2DGW A;  5L1K A;  3QFH A;  2ASY A;  4ZPB A;  4B3M F;  3ISN C;  3TJ9 A;  3PR4 A;  3FMB A;  2IM3 A;  2F65 A;  1IBK F;  2R2T A;  2PDA A;  1Y4Z B;  4CWB A;  1N32 F;  3QT5 A;  4TLR A;  4KSE B;  3KWM A;  4KPY A;  3AQO A;  1NH8 A;  1TL1 A;  3ENW A;  3CJT A;  3KXD A;  3MMC B;  3OFF A;  1MMN A;  4QIG A;  3KG1 A;  1SBR A;  4CDI A;  5F9L A;  2GAH C;  2VOO A;  1Q95 G;  5D4L A;  1I5O B;  1G7C B;  3EUN A;  5A8K A;  3I55 S;  4URQ U;  5IXU A;  5E5N A;  3ZTR A;  1HWU A;  5KFM A;  5IT9 U;  5KOW A;  4WP8 A;  2KFZ A;  1YBA A;  1N6Q B;  2W01 A;  2B7B B;  2YNF B;  3T9N A;  1RAF B;  4B08 A;  2BE2 B;  1UL3 A;  3ULH A;  1FRK A;  5IT4 A;  3KK2 B;  1K0T A;  1PBU A;  3KLV A;  3OR2 A;  2EBG A;  2G2O A;  1ZOT A;  2IRU A;  1VCT A;  3GWC A;  4DCP B;  1U26 A;  4CIO A;  1N36 J;  4JV5 F;  2HLU A;  3IR7 B;  4X4P A;  1VMB A;  2W9A A;  2O01 C;  2U2F A;  4MK9 A;  3NAI A;  3AFG A;  4RJV A;  3K57 A;  4JI3 J;  1S1T B;  4KV8 A;  3DRP B;  1S1V B;  3SFU A;  3N28 A; 
#chains in the Genus database with same CATH homology
 1NDK A;  3EJM A;  1NDL A;  1MN9 A;  1W7W A;  3FBB A;  2AZ3 A;  3NGR A;  2BX6 A;  1HHQ A;  3FBE A;  1NUE A;  3NGU A;  4EK2 A;  1XQI A;  3VGS A;  4CP5 A;  3FCW A;  3EM1 A;  1UCN A;  3PRV A;  4W98 A;  4F4A A;  3Q8V A;  4DZ6 A;  4FKX A;  3VGT A;  1NHK L;  1NLK L;  1U8W A;  3B54 A;  4UOF A;  4DUT A;  4FKY A;  1BHN A;  4WBF A;  4HR2 A;  3ZTS A;  3NGT A;  3Q89 A;  4KPC A;  5BXI A;  1VYA A;  2VU5 A;  3ZTR A;  2ZUA A;  3R9L A;  2CWK A;  3FKB A;  3ZTO A;  1NPK A;  4ENO A;  2DY9 A;  5CAB A;  2AZ1 A;  3ETM A;  4DI6 A;  1NDP A;  3BBC A;  3DDI A;  3VVU A;  1NDC A;  1NSP A;  2DXE A;  3B6B A;  2DYA A;  1MN7 A;  2B8P A;  2DXD A;  1NSK L;  5C7P A;  1LEO A;  3FBF A;  1F6T A;  3BH6 B;  3L7U A;  1KDN A;  4UOH A;  3ZTQ A;  4ANC A;  3Q8Y A;  3GPA A;  2HVE A;  3BBF A;  3FC9 A;  4ANE A;  1LWX A;  2B8Q A;  3NGS A;  1S5Z A;  1PAE X;  3DKD A;  1NCL A;  3VVT A;  4UOG A;  3FCV A;  3EVW A;  3VGU A;  3BH7 B;  3EMT A;  4S0M A;  1JXV A;  1HLW A;  1NB2 A;  3G2X A;  3Q8U A;  2DXF A;  1F3F A;  3EVM A;  1B99 A;  3FBC A;  5IOL A;  1B4S A;  1WKJ A;  3EE3 A;  1BUX A;  4AND A;  4C6A A;  1K44 A;  3EIC A;  3GP9 A;  3ELH A;  2BEF A;  4F36 A;  3VGV A;  1HIY A;  1S59 A;  3BBB A;  1NSQ A;  3WX8 A;  2HUR A;  3MPD A;  1S57 A;  3ENA A;  1ZS6 A;  3JS9 A;  4O0N A;  1EHW A;  2HVD A;  3EVO A;  3Q86 A;  1XIQ A;  3ZTP A;  5CAA A;  3PJ9 A;  1PKU A;  1BE4 A;  1WKL A;  1WKK A;  2NCK L;  3Q83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...