4UOHA

Crystallographic structure of nucleoside diphosphate kinase from litopenaeus vannamei complexed with adp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
128
Chain Sequence
b'MVRERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure of Nucleoside Diphosphate Kinase from Pacific Shrimp (Litopenaeus Vannamei) in Binary Complexes with Purine and Pyrimidine Nucleoside Diphosphates
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Transferase
total genus 35
structure length 128
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4uohA00
2B8QA 3NGRA 3FCVA 2CWKA 3BBCA 1EHWA 5C7PA 1HHQA 4W98A 1NUEA 3NGUA 1XQIA 3BH6B 3B6BA 4HR2A 1NCLA 1MN7A 3BBFA 1WKKA 1K44A 3ELHA 3Q86A 3GP9A 1NPKA 3EVWA 4UOFA 3PRVA 4KPCA 5IOLA 2DXEA 3EE3A 3NGSA 3ZTQA 3FC9A 3ZTRA 1NSPA 3ZTSA 3FCWA 1PKUA 3VGSA 3FBCA 2B8PA 3VGVA 4C6AA 4F4AA 3DDIA 1B4SA 1NDKA 4UOHA 1W7WA 1S5ZA 4UOGA 3EICA 1LEOA 4DUTA 4ANEA 1LWXA 1KDNA 3FKBA 3G2XA 4S0MA 1S57A 3BH7B 2HVDA 3GPAA 3R9LA 3VGUA 1HIYA 3B54A 3PJ9A 4CP5A 3NGTA 1BUXA 3ZTOA 3EM1A 3EMTA 3WX8A 1NDPA 1ZS6A 3EJMA 3FBEA 3Q89A 3ZTPA 1BE4A 1NB2A 3DKDA 1XIQA 4ANCA 4FKXA 2BX6A 4DI6A 1HLWA 3VVTA 1VYAA 1NHKL 3Q83A 1JXVA 1NSQA 2HVEA 1U8WA 3JS9A 2HURA 3L7UA 4O0NA 2DXDA 2AZ3A 3VGTA 1UCNA 3ETMA 3VVUA 3Q8VA 3ENAA 3Q8UA 1WKJA 1NSKL 2ZUAA 4ENOA 3EVMA 1NLKL 1NDCA 4ANDA 2DXFA 2BEFA 2VU5A 1MN9A 3MPDA 2NCKL 3FBFA 4F36A 1NDLA 4EK2A 1S59A 1B99A 4FKYA 5BXIA 1F3FA 3BBBA 2DY9A 2DYAA 3FBBA 1BHNA 4DZ6A 3EVOA 1WKLA 1F6TA 5CABA 2AZ1A 1PAEX 3Q8YA 5CAAA 4WBFA
chains in the Genus database with same CATH superfamily
3KK3B 4JI8F 3TUIC 1RISA 1HHQA 3NEKA 2C22A 1KS2A 3W63A 3HM9A 4ECZA 5LM7E 2KB2A 1BD6A 2UVUA 3KUEA 2F9JA 4K2JA 2YX7A 5DDPC 1VQYA 4MKYA 4DU8A 2M8DB 4KYZA 3HVTB 2H4YB 1YLXA 5IWAF 1CJUA 1OY9A 1OQ6A 4O4GB 2HRYA 1D8YA 4OHWA 1RABB 5ETSA 3BGLA 3GB0A 4QW8A 2WW8A 4LF7J 2ZWOA 1GTHA 2FTRA 5A8RB 3CDAA 4ZIWA 2MQPA 4K5RA 2YXLA 3TQ1A 1N56A 3MEDA 2UXBJ 4LF4J 2A18A 3BYPA 3IMQJ 5DG7A 3M6UA 2VBXA 2G13A 2OMLA 4DLEA 1U8SA 4K2XA 1G2EA 2OELA 2IRUA 1GEHA 4USWA 4NZ7A 4DL4A 2FJAB 3J81U 5CCLA 2QSWA 3LWLA 3BKFA 2GGPA 5D0GA 1NZAA 1U1LA 4V19X 1CJKB 2MXYA 3E2EA 5L9NA 2ZZTA 2OPPB 1WKKA 4OI3A 3SQGB 4IR9A 1NPKA 4PZVA 1VGYA 1UVJA 2NPFA 1FERA 2IVYA 5KT7A 4JV1A 3DXBA 3CMAS 4RWWA 2V34A 4QPTA 3NNAA 3R2DJ 2ABYA 1U45A 1NK7A 2M3DA 4FF1A 4X4SA 5F3ZA 1NSAA 3HD2A 2YWGA 2PI5A 2FZCB 4DN0A 1C4AA 4C3MA 3LTOA 2HYIB 4DR7J 3Q8VA 4UT4A 1RA7A 4CO5A 1NU4A 3I87A 1E6YA 2YKMB 2ZD1A 3OXGA 4ZVRB 4CO3A 3S7RA 2G0JA 5LMUF 1F0XA 5K9FA 3EGVA 2KM8B 1BQMB 1SL0A 4K4YA 3JYTA 4IFVA 2IMOA 4IG3B 4DQSA 4ECVA 1LW2A 4JI7F 5KFGA 4E0DA 5A2QY 3J80U 4DR6F 1UWBA 2EFQA 2DNLA 3CJQA 1S79A 4RW9A 2ZBQA 4FP9A 5D78A 2RDDA 5D4NA 2DRBA 2FHOB 2YBVA 3GILA 2J7WA 1WSVA 1YJWS 4QIEA 3DFEA 4DV0J 1K1QA 1QAXA 1HIYA 4OL8A 1P9QC 3FQLA 5HROA 2PFDA 3OV7A 2DTJA 3R5JB 1X9MA 4OZLA 4B17A 2ZFHA 2W2PP 3CCQS 4NLRA 3TJ9A 1V9OA 2OPRB 2UVWA 4I68A 2DJWA 2LVWA 2MLZA 3M2VA 3MM6B 3A12A 4DR4J 2K3KA 5KG4A 1TELA 2AEMA 2DY9A 2EKNA 1JLEB 2UV8A 1UVLA 1NRKA 4IG0B 2JLFA 1MU2A 4HR2A 4P2SA 5GADU 3N6LA 2FZKB 2F4VF 3LPYA 5D0RA 2G1DA 1FJCA 3J81j 3G6ES 4NI2B 4I69A 4P6QA 4ZK7M 3I4HX 2VG5A 1KVIA 2V2VA 4DV3F 3IRXB 2I6WA 5IQQA 3MEGA 4OI2A 4B3SJ 5J2PB 5CXTA 4DSFA 2C2OB 1RADB 3CJ3A 4J9LA 1BGXT 2QC3A 1HPZA 2BJEA 3WC2A 3QPIA 5E41A 2HK2A 3AD9C 1U8WA 1SPBP 1UEUA 2AZ3A 1Y10A 2C2NA 2YKOA 4UZBA 4NLPA 4B3TF 1EP4A 1KFSA 2CNKB 1T94A 4OIXA 3DCAA 1NM2A 2IY5B 3EYZA 1YZ7A 4ZVQB 4KHPF 1FKOB 3MHYA 2DNOA 5HP1B 3UN3A 2HQIA 3M2RA 2BJ9A 3OL6A 3FFIB 3WZ0A 1RGVA 2E5LJ 1GMVA 2VG7B 3T5HA 1VLOA 3C8YA 1RTIA 1S9EA 3FEZA 4ZP9A 3DLLQ 2KG1A 3QJPA 1TAQA 1U6ZA 2OMOA 1KDNA 3KJFB 1E6VB 5ETQA 1J5EJ 2P5VA 4C8MA 3W7BA 3BGUA 5LSRA 3K5MA 1T02A 4CH1A 5KFUA 1FEHA 2ASYA 3QGGA 2F3JA 1EIYB 3A8JA 3K5NA 4MJKA 2V4JA 4LBHA 2AQ4A 2J6SA 1TKTB 2PIIA 2R7UA 2MQ8A 4ZVHA 1GK8A 1VI7A 3EVOA 1RUSA 2CZ4A 1H98A 1TVRA 3LP0B 1H7WA 2KRBA 2M52A 1ICEB 2N4DA 2QTWA 4BWJA 2FY8A 1RWXB 1QAJA 2JLEA 3I0SA 5DO2A 2B9EA 4QU6A 4F4AA 3MAQA 5F0WA 3PR5B 4CLYA 3UWTA 4Z37A 2AKWB 2LYVA 4KKOB 2W8KA 2LU2A 1RE1B 4NX9A 1UMJA 1SH3A 5HMYA 2D7SA 3BR9A 5IM0B 4TVAB 2RH3A 2ZITA 4FXWA 2MKYA 4YOEA 1T05B 1XIQA 4DUYF 1VQLS 3NBPA 3NMAA 5F8IA 4ZPCA 2R7QA 3GG1A 1FRKA 2QO3A 3PFEA 2NXJA 3OUYA 3R6GB 1Q8LA 3EVMA 4N76A 2GMHA 1D8ZA 5EX3A 3KFWX 1JNRB 3P3DA 3KYLA 4O3OA 2LEPA 4M8LA 3IXQA 4ZVEA 4OYIA 4DV1J 4KAIA 2DNKA 1ZBTA 4C8ZA 2ZC3A 2RF2B 5CABA 2ZVIA 4YR0A 3QLHB 1KRPA 4OZJA 1SQFA 3V4IA 2OO4A 2F1FA 3D9BA 2E1MC 1HMVB 4NASA 1QUVA 3AXKA 2A0FB 4P10A 3OTDA 2DRDA 4OYXA 2B8PA 2CDRB 4J9RA 4DCPB 1O6XA 2V50A 1FXLA 3GE9A 1P1LA 4PUOA 2C3YA 2K7KA 4H4KC 5A8KA 2CQCA 1S12A 2RUSA 2LA4A 4PKDB 4CDIA 1J5OA 2FJWA 3R1HA 5F8NA 1HR0F 4DI6A 5LT5A 3POTA 2DIVA 3PCOB 4C11B 5K8OA 3P49B 4HH1A 4PXCA 5T7LB 1XMOJ 2J0WA 4A8KA 1R3NA 3UDLA 4EZ9A 1EB0A 4MIWA 1C2PA 3EDQB 3H4DA 2CQGA 2WSFC 3A13A 3BN4A 1VQ8S 1D0EA 3QYYA 2JVOA 2XHWA 1FD8A 1HBMB 4ZS6A 1SKSA 2WVBA 4TXSA 3GTYX 4N5SA 2YWWA 2VH7A 3AB2B 4ZLLA 1Q81T 2Z2LA 1GT8A 3MGJA 3HHLA 1UKUA 3HSZA 4DV4F 3MCOA 1MWQA 2C2KB 4IQMA 3MMJA 5I3QA 2O5DA 4RUBA 4JV5J 4LBPA 2HFNA 2PC6A 4B3MJ 2HVDA 2K2PA 1CS4B 2KO1A 3OTBA 4P9SA 4R8UA 1N48A 4M5JA 3MM5B 4OQJA 4HLBA 3FCHA 1NDPA 5KFSA 1DTTA 4X4OA 4TY9A 4ZP6A 2K3IA 1SIWB 4EU0A 4DX5A 5J2NA 1XWLA 5IZHA 9ATCB 4CNYA 2UXDF 4LFCJ 3VAIA 4ZP8A 4OHYA 4M94A 2BQUA 2DK2A 4ZCKA 4Y65A 1KVJA 1K1SA 4MMOA 4ZKAA 1I5OB 3AD8C 2J0SD 3A8IA 4DX7A 1DTQB 1WACA 4X4UA 1M90T 4N56A 2ADBA 3NOGA 4AXIA 4I4BA 2EW9A 1SJFA 1P27B 5ETVA 4A8WA 1JLFB 5I3UA 4PG4A 4ICLB 4U8YA 2HHUA 4G1QB 8AT1B 1BC6A 4F0HA 1SV5A 5CYMA 3JAMY 4LFBF 4O3SA 3PYGA 3G82B 1YG0A 4OHXA 2MZTA 2E7WA 3TX8A 3MPUB 4KBIA 5HVHA 1Q5YA 2UUAF 3CJ2A 3QT6A 4DS5A 1UP1A 3TX0A 1KHVA 4OYWA 3FZ2A 1SXLA 2E9ZA 5LL6d 2DPIA 3TUZC 3VR1A 1FFWB 2KVIA 2CIMA 2WHOA 2EI5A 2G0IA 4RUAA 3W1YC 4ECWA 4WZQA 3MTJA 4WP8A 1RWVB 1JKHA 1QTMA 4ZPAA 2PGCA 5C2GA 1WKLA 1N4LA 3E01B 3DDKA 1EKSA 3CC7S 2VV5A 4WBFA 5C2CA 3LP1A 2E7VA 3NGRA 4CLPA 2F9DA 2FGOA 4KB7A 2H5EA 2W8LA 5BYSA 2GX8A 1HI0P 4CT8A 4LSNB 1KBRA 1QJHA 3D7SB 2DHSA 2DEJA 1HWIA 2QA2A 3TA1A 1B7FA 1QD1A 2DR6A 4X64J 3A3OB 3KHHA 1C1CB 2ZJPQ 4LF9F 4NXMJ 2B3TB 4UOGA 3HHKA 9RUBA 1AYEA 4H4OB 2HFOA 3GIRA 5KG5A 5HL7Q 4NCBA 3D0HE 2LECA 4LF1A 4K8RA 3HVWA 4P2MA 2VOOA 2V8DA 4DPYA 2WRMA 4O0IA 1QE1B 2B43A 1NHKL 2P2CB 2ATCB 3Q83A 2MB0B 4FXVA 4FYYB 1WC0A 3H2UB 3CD6S 1HNVB 2V0NA 4FDFA 2CQHA 2VZ9A 2FVRA 1RWOB 3DLJA 2Z56B 3DRSA 2DT9A 4PWWA 1HNIB 2HQCA 2Y3YA 2LLZA 1REVA 3OFEA 3J7A1 2IDLA 1X60A 2HHTA 5H9EJ 2CDQA 2CWKA 4XIUA 2YKQA 2E5GA 3FMWA 4HKQA 4ZJLA 4LF6J 3CJSA 5LMNJ 3QT8A 4P75A 5AXNA 4ITSA 2HLTA 2HIQA 1IBLJ 3ZZOA 3MD3A 1JLBA 1IKYB 4IYQA 5HLFA 4DWIA 2KYXA 4HYKA 1FRIA 1OPZA 3MCNA 3VGUA 2KHDA 2IC3A 2Z2MA 2ASJA 3NGTA 3CCSS 4DL5A 3PM9A 3WX8A 4DL2A 2KXNB 1ZAVA 3FQKA 3SEOA 2NZCA 2UUCJ 4DPXA 1S1XA 5KT2A 1NJXA 5G0RB 4Q0BB 3B8HA 4QIFA 2BZ2A 1N36F 1RTJB 2G2ZA 1MROA 4Q44A 2KTQA 2PFFB 4ZCMA 3CT9A 2RHQB 3JTOA 3SSRA 5DETA 1X4CA 3L7PA 1DQ8A 3QIPB 4ZIVA 1KOHA 3QJJA 3QIDA 1UZDA 2CJ9A 3FZBA 3VHQA 3OSNA 2C2ZB 5C42A 1LWEA 3SDEA 1N0UA 4MH8A 3K2YA 1LV5A 4USTA 1RHQB 2N7YA 2KL8A 1XR5A 2FHJA 3I82A 1VJQA 2FGCA 2EBEA 4JI2F 3CMES 1FWPA 5A0YA 1R7IA 4I6WA 3FCWA 3K0JA 1EETA 3EX7B 1HNZF 2IIHA 1BWVA 2MKCA 2VASA 1HW8A 5DZ7A 3THTA 3KLHA 3MOJB 3HHEA 2RU9A 2B4UA 2VQFF 2W7OA 2GQ2A 4NLUA 1FA0A 4OLOA 1S6UA 5A8WB 2COLA 3UCUP 4CLFA 3PJXA 5JVGQ 1KLNA 3ZO7A 3MUVP 2PA3A 2GCFA 3MM8B 3R5AA 1Q5VA 2HZAA 3DLGB 1N5SA 2C3OA 2WAQD 5DG8A 3CJ0A 3KDOA 2R8IA 4PWUA 2XI2A 3VAHA 4RW6B 2L9WA 2A1BA 2ACYA 2GMJA 3R6LB 5EUHA 4A4JA 4DL6A 2DNMA 2QEXS 4PG6A 3DI6A 2YQ0A 4JV0A 3OFFA 3BZQA 2KZZA 4PEOA 3BPDA 1U48A 4YB7A 2W24A 4CO4A 3BGFA 1DY3A 2I5JA 3US5A 3BYRA 4KV8B 1WG1A 3DYAB 3RRGA 2V94A 1RT2B 4OX7A 2BA9A 1RA6A 5F3TA 4KE5A 4MYUA 4DDFA 2DEIA 2C42A 1NKEA 4ZPWR 1FDNA 5D3GA 1B64A 4LSLB 4O0NA 4IH5A 1LXNA 4DV7F 2HS3A 4KC5A 4H4MA 5GAGI 5FLXU 2PEBA 3P45B 3GJRB 1Z4UA 3LGNA 4DG1B 2P9GA 3ENWA 2W01A 2BJ8A 1U0HA 2J5AA 4CCHA 1G6BA 4IRKA 3WHIA 5CYQA 1GTEA 4HI1A 3CCLS 3PX6A 2QLXA 3W8GA 2GMLA 3N01A 1VDHA 3MAHA 1OYEA 4JB8B 2GHPA 1N32F 2OTJS 4QIVA 3QJLA 4JI5F 3KK1A 3I5AA 1RKJA 3GIJA 3BDEA 2BUNA 3AHPA 1TKZB 2C2EA 2FLNA 1S57A 2HS0A 3R9LA 3PKMA 4NLYA 3X3UA 3V5RA 4LF5F 4WYLA 2JSXA 2KRRA 2H51B 4EEYA 4GO5X 4ZLPA 3CPWR 1KC8T 4RX6A 4MK7A 2AJQA 2KI2A 2JHEA 4M95A 3O5TB 3MURP 4ANDA 3C2PA 2XY6A 1RBOB 2VU5A 1IQTA 3T1HJ 1R89A 4IOCQ 1RT7A 3D5MA 3L4BC 1X4FA 2RILA 5LJ3Y 2BR0A 1YI2S 5HVFA 3DOLA 1AUDA 3RBZA 4RBUA 2DY1A 2AEJA 3UE2A 4UTGA 4YY3J 2B7CB 4PR6A 4DV5F 1XMQJ 2W9AA 5I4MA 2SXLA 3JSYA 3VF0B 5HANA 1S1WA 3LAKA 3SCIE 3KLIA 2BE7D 3I6PA 2DKOB 4QR0A 3ZTRA 3IP0A 1AB8A 3D68A 1Y4ZB 4CTAB 3W8PA 1HNWF 4DV6F 1FKPA 2HBRB 1S1TA 1B4SA 1PO6A 2WSCC 4LF8J 4MK8A 1FJEB 3CDEA 4GVBB 1CJUB 3FNNA 2CPZA 1U1QA 3SMZA 4R0EA 4ZVSB 3P96A 2BW7A 1OO0B 2FD2A 3K5OA 5DS7A 2C3MA 2BOAA 2YQ3A 1YRXA 3QO9B 4ZPTR 1N5TA 3KUHA 1JXVA 2HFSA 4KTQA 3H42A 1N34J 1VRQC 1X4AA 1LW0A 3H90A 3BSOA 5CD4H 1TUWA 2DCUB 4C48A 2Y1JA 4IDKA 1QAIA 2O67A 3NS6A 4P2XA 2QGFB 4FKYA 3UCGA 2AHOB 2ZHBA 1UFKA 2IHR1 1VQKS 2J8SA 4F7VA 3NG8A 1AZSA 4RPFA 2VBWA 4HI2A 2GGPB 4ZHRB 3M8QA 2KT2A 2XMUA 3PR4A 5BJRA 1M1KT 1SH2A 3BO3A 1GMUA 4B9NA 2UUBJ 2HHQA 2ZZMA 4DS4A 3OL7A 3R2CJ 2DGXA 3DRRA 1A6LA 1CQNA 1NK0A 3GPAA 1HHTP 1KFDA 1KVKA 2W4PA 4CP5A 1FNMA 2XO6A 1T9UA 3J7ZT 2R7SA 4KGKA 2V2QA 4O44A 1TMMA 4ETXA 2KVQE 2VQEF 3V81A 3DGVA 3TI0A 2DNYA 4PPDA 4A8FA 2MQLA 2DB1A 2RKIB 4ED5A 1NK9A 3MPWA 4O23A 5KFEA 2UXCJ 1C0UA 1FVQA 1IBCB 3BGRA 2JNJA 2NS1B 4EBDA 3TJ8A 2G4BA 3BN7A 2GAGC 3M8SA 5GVQA 1E6YB 2QMUB 4M1KA 2ZD1B 5HI7A 1SC4B 3KTQA 3GU0A 3E51A 4NCGA 4J90A 4OFZA 1RAAB 1B0TA 3RGIA 3MAAA 3CC2S 4IFVB 4TN2A 1CBKA 2V67A 4B9TA 4FVMA 1HQEA 2KXHA 3VAFA 2CJAA 4RLEA 1T9VA 2WBRA 4QIWD 1NHUA 3LA0A 2WB1D 4EI2A 2MQQA 1WG4A 3ZZRA 2JL9A 4LVNP 2DITA 3ILIA 1X4DA 5HROB 1Y3JA 1TL5A 4K4TA 4C3KA 2ROEA 2OEMA 1AFJA 2ACMA 2I9SA 4AE5A 3CIMA 1T3NA 2YNFA 2AYGA 2DHAA 2FLLA 3AT1B 4EK2A 3HFZB 4FPIA 3W2WA 3D3CJ 5KFBA 3CE8A 3IWNC 4K0KJ 4L74A 3UPFA 1WOOA 2WVCA 3QRRA 2IBKA 4ZVPB 3FRZA 3SBMA 4EUVA 4DHVA 3Q8QB 5E2QA 1VK8A 3B6BA 3PACA 2V8VA 1Y0HA 2HLUA 1T9XA 1SJRA 2VJVA 3OXFA 2FVCA 3PY8A 3M6VA 1IJFB 3MMCA 3V6JA 4C6AA 3FK4A 1T7PA 2QFIA 5HMXA 2CG8A 2IM2A 2VG5B 4LF7F 4OHZA 7FDRA 3IAS9 3MEGB 2XSJB 1UA1A 1FVSA 2YKNB 4ED8A 1L3VA 3L95X 3GV7B 4GKKJ 1N88A 1NJIT 4L73A 2RU3A 1RLCL 3PRDA 1SC3B 2UXBF 1HPZB 3QFHA 3B4DA 5KG2A 4WJBA 5DG9A 1VMBA 2MHNA 2WONA 3PRBA 2IJFA 1S4EA 4NXNJ 1S1VB 2ZH4A 1R8AA 3MWBA 4C4WA 4OV1A 3OL9A 2VFVA 1N54B 3JQKA 4KT0C 2R8HA 2M70A 3FCVA 3NWRA 2GQQA 3M2RB 2EFNA 3G4SS 1OY6A 2IJNA 4OX8A 3TVKA 2QMWA 1Z2ZA 4I6AA 1VRTB 1RU1A 4ILLA 2X51A 3DHWC 2BXJA 1U4BA 4KH1B 1VIXA 2DR5A 2GIFA 3QATA 4BHQA 1XN9A 4H54A 5CCMA 2DGOA 5D77A 3CCES 1DJ0A 1X9SA 1TL4A 5HATA 1KD1T 4QJVA 3M2UB 4G1PA 4BBYA 3MMBA 3FEYB 2M8HA 1U1OA 4FPRA 1ZA1B 1KQGB 3T19A 3WBZA 2ZBPA 3W5XA 2EC0A 4DN9A 2ZZNA 2AD9A 2VG6B 3J7AN 3HHLC 1BMQB 2W2QP 4JI3J 4KFBA 3RB6A 4YB5A 5GMEA 1TVRB 3AAWB 4OMFG 2N82B 4URQU 1VQ5S 4USIA 1C0TA 2RRAA 1JLCB 3D4JA 5KG0A 3BF4A 4U7UD 3MM7A 3RBEA 2LU1A 1SCJB 1KLMA 1LWFB 1XK8A 3GG0A 3KHGA 3CO0P 5L46A 4DV0F 1GX6A 4A8MP 5GMKa 1R0BG 2HRTA 2NR0A 1FJGJ 4Y2AA 1YKWA 2N3OA 3BO2A 5JJBA 2DHGA 1YITS 1REGX 2IDEA 2DNGA 2GFFA 1U47A 1O8BA 1Y11A 1RHKB 1QLNA 3VVUA 5D0EA 4NMXA 3BKTA 3LANA 2QG9B 3PW4A 4DR4F 1L5UA 1R0CB 4QW9A 3EUNA 2BYCA 3SXLA 4WXWA 5KFYA 1B3TA 3PZPA 3BQ1A 4CRJA 3U7JA 4K4VA 4BS2A 2UVVA 1RAHB 3EGWB 4K5SA 5AE1A 1V5IB 4NA3A 5G4DA 2JOQA 2BOPA 3M32A 4JI8J 3I0RA 1F2GA 3CEDA 4BCAA 1R8BA 3OD2A 3P4UB 1WI8A 3SFGA 1I51B 1D9DA 3PX4A 3KLGA 2HBZB 1S48A 1YDLA 5A8KB 4RWXA 4I1TA 2H54B 1UL3A 3G6YA 3DM2B 4UQGA 1FFSB 2R7WA 5K8NA 4ZCLA 3RJMB 2HHSA 4RR5A 3OFGA 4I2QB 1P9YA 1Q1KA 3C6TB 3EZUA 2HAFA 3TANA 1B0PA 1EJ7L 3VQTA 4DSJA 1EQ0A 2MKJA 1TU0B 1GXTA 4WFXA 1WTFA 4IH6A 4X4QA 2E5LF 4DCJB 2MHEA 2W2MP 2W9CA 2GJIA 2JEJA 3HZGA 3M8PB 1Q16B 3K58A 3HHLB 4DX6A 2JEFA 3UD4P 2FIUA 1S5ZA 4ZVUB 3EICA 4CLSA 4URSA 2VHGA 1J5EF 5DGBA 1P8GA 2R42A 4JI0J 5C25B 4IKAA 1GQEA 1NPRA 5AT1B 3I55S 2FJXA 1DTTB 5HAOA 1LWCB 4TQRA 4B9SA 5IT9Y 5BYRA 2L41A 1ZPVA 5J2NB 3V4MA 1U02A 1WEXA 2V8GA 4NLOA 4QWBA 1RTHB 2YPZA 1NHVA 5L8RC 4LMZA 3HO1A 5CHCB 2D41A 2BJDA 2W7AA 1BQNB 4PQUB 3CCJS 5GMDA 3M8ZA 4WF9Q 3DOMA 1FNOA 3ENVA 2CJBA 1HHSA 3HT3A 5D4PA 2VPYB 4WE1A 4I7FA 5I42B 3J7Z5 5KT5A 4UQTA 1IWAA 4WU2A 4XPCA 1FT8A 1IVZA 1SQGA 5BYQA 2FDNA 2RMLA 3BH7B 1AUSL 3KWMA 3IM8A 4IO1A 1CJTB 3C15A 3C3LA 2UZAA 1PYTA 5MLCV 3FEXB 2NUHA 2XEXA 4J9QA 2NREA 1R0AA 2J7KA 1URRA 3DRXA 1Q78A 4YMEA 5FLXY 4LVOP 2QLWA 2F65A 2IAJA 4DXLA 3B78A 2XGPA 1QTNB 1RT1A 1KN6A 4TYBA 3AY0A 1NSKL 4ENOA 5HMZA 1TMJA 3BDPA 3IA0A 3NGKA 5DJBA 3R3TA 1VBXA 2PO4A 1EX8A 2OPSB 4F36A 2E66A 4LR9A 2NYHA 1WORA 3V6DA 1SJ3P 1YJTA 2FHKA 4DBQA 3AJ1A 1PIEA 2P6TA 2O01C 3NCPA 1FTCA 3LP1B 4HACA 2AX0A 3KK3A 3EXYA 3FC9A 1Q0NA 3O3LA 5AXMA 4DFPA 3GSIA 1AFIA 4WKYA 3DDIA 5D4OA 3PEHA 1JLAA 1OWXA 5FJ4A 2QT7A 2B51A 4ZVFA 2RQMA 2OHDA 3M6WA 3FSIA 3ZTOA 4OHVA 3M8YA 3HZEA 1ZS6A 1W25A 4QWCA 2G9OA 2BX6A 4DV3J 3MCSA 1DURA 2ASDA 4N47A 4NWBA 3A4TA 1RT4A 5L1IA 5A8RA 1IKWB 1UCNA 5FD1A 3Q8UA 1XMOF 1IBMJ 2KFYA 3RBDA 4C0OC 1FRHA 2AX1A 2W4DA 2UV8G 3BM7A 2N3LA 4WXOA 1PAEX 4OZ5A 2QIFA 4C0BA 1REVB 2R7XA 3BBCA 3RB0A 2E5HA 1FJ7A 3MM9B 4ZPVR 3CJ5A 4Q43A 2AJFE 3GFXA 1M1GA 4KHPJ 2RUGA 1PYOB 4J91A 2XCPA 1CJKA 1V3RA 3VQSA 4K4WA 2ATLA 4WWSA 3KG1A 3H4BA 4ZJQA 1X4GA 1U1MA 2FC9A 5K14A 2W2OP 3SQGA 2GZOA 4LR7A 4JV5F 3E8OA 1YK9A 4B3MF 3N28A 1R8PA 3CD0A 5LXYA 1XC9A 2IJRA 3GMGA 2UP1A 1RAEB 4QIGA 2CJYB 2R4FA 3W2VA 2HNZB 2DH8A 3PHEA 1PC5A 2RD5C 2DXDA 4HT5A 2M9KA 1FK9A 4IQXA 4LFCF 1ZAWA 3TZXA 1MROB 3ET6A 3HDSA 2ASLA 3TJAA 4HHJA 2P9EA 2XCAA 4DR2F 1HD0A 1X9WA 3GONA 3PVXA 2LFVA 4A47A 4ZOSA 3BR8A 3AODA 2J0QD 2L48A 2Y1RI 3PX0A 2YKMA 1MMLA 4CI0B 1HWKA 4QYZK 4B3RF 4OYPA 5C42B 1C1BA 4C8NA 4UUWA 1I1GA 1JIHA 1T3OA 5KG3A 4IG3A 2EFVA 1JK9B 2HFVA 2ZDOA 4LF2A 4DPWA 2ZOGA 2AEFA 1NDKA 5EWEA 4DUTA 2FHJD 1EETB 1XNQJ 4S0MA 5B09A 1VQ6S 4LIWA 2DISA 2AF6A 3KLHB 3ZNUA 3FBEA 4WK1A 4CO2A 4Y3CA 4YN3B 1JQGA 3BO4A 4MFBA 4Y2MA 5BR8J 3CF5Q 3UO0A 2K06A 4BLGA 5KOXA 3IC1A 3IBFB 4DL3A 5J2QB 3KMQA 1IKVA 1OYDA 1EARA 1NDLA 1RAJA 2Z2YB 5EN1A 4ZPDA 3SSSA 1RP5A 3K17A 2I2YA 2DYAA 4DQIA 4F3OA 1RYRA 3AOAA 4HTJA 2J6TA 1R6VA 4BC9A 3A3PB 3MM6A 1FI4A 3DMJB 3TZYA 3HCXA 4DR5J 2PMHA 3N79A 4ELTA 3I9ZA 1U6BA 4FVCA 2NPIA 3WX4A 1WHXA 3DI6B 1XERA 4ED6A 4U67Q 2ZH3A 4I67A 4IG0A 4X64F 4M5IA 1KWMA 1UAWA 3TZWA 2WCXA 4X4RA 2AGPA 1UPMB 4EBEA 3TWZA 2LQBA 4DSEA 3M30B 2NXEA 5GAHU 1FXRA 1H7XA 4NI2A 3DRPB 3GIMA 1T03B 3HD1A 4WIIA 2OD6A 1Q7LB 3F73A 1Y5IB 5HBMB 3IRXA 1HKAA 2FY1A 4XAKA 4RNMA 1L3SA 4USJC 2DGWA 1V5VA 2V68A 5E3CA 4XTTA 2HHPA 1NJWA 3N5BA 4RUCA 3CIZA 5E7OB 2YVSA 3MPDA 4H4MB 4JI1J 3FMBA 1KP6A 3TAPA 2J76E 1HR0J 1VFJA 2F4FA 2VBZA 4OX9J 2HHVA 3T41A 2YNHB 1VRUA 1KTQA 1VOMA 1FKOA 1RWPB 1U2FA 2JEGA 5HP1A 5EDWA 5LMNF 1BLUA 1M5SA 5KFMA 2VG7A 1SKUB 4KJIA 2OSRA 3Q0AA 1IBLF 1R6YA 3A3NB 4ELVA 5EX0A 1I6JA 2BANB 3GR0A 4CLLA 3DU5A 4LR8A 1WJ9A 4I2PB 4DV4J 3TA0A 4ED1A 1E6VA 1VQOS 2UUCF 4JUZA 1YTYA 4RNOA 4DOZA 4M5DB 5K8MA 3JS9A 1FTRA 3FDSA 1GAOA 3HK2A 2RSQA 5MAOA 3ULHA 2DXFA 3F0NA 4U7CA 2MY7A 4FZVA 3RRKA 3RAXA 2EK6A 2AMCB 4MAKA 1VQNS 1U09A 5B0DA 3MI7X 2E7XA 1NJYA 3GQCA 3PTWA 2P9CA 4HEA9 2OI2A 4PCQA 1PYSB 3CCUS 3QMQA 3AFGA 3V2UC 3LP0A 5J1EB 1IKXB 2E5IA 4UOFA 5HJYA 3TP2A 3H98A 4GC6A 3B4MA 2MKHA 1RT6B 1S1WB 1PKUA 1UVMA 4O3RA 1G7CB 4MKBA 4V19J 1FKPB 1HFEL 5KAKA 1S1TB 2ZH5A 5F8GA 5B0EA 4IUFA 4GVLA 2YNIA 3CJKB 4A46A 1AT1B 1HYSB 1FESA 3EXCX 3ZTPA 1M0SA 1S9GB 5CA5A 3NNHA 1RXOB 2AJ2A 3L3CA 4JP8A 3I5CA 3GCXP 4EWTA 1S6PB 1JLGA 4UUXA 3K7RA 1W2IA 4HDGA 5IM0A 1CJVB 4KO0B 2ALYB 1W26A 1WEYA 1T05A 2E29A 4PXBA 4AL5A 1LW0B 2QE5A 2QRRA 2B9XA 5E3PA 1M5VC 4OZ0A 3T9NA 4IDKB 4J9VA 1VISA 4X66J 5EHHA 2HFUA 4KGZB 1ROFA 1DBDA 5F8JA 1HARA 1V3SA 3NS5A 3MECA 1UVNA 1MN7A 3HP6A 4WTYA 2MSTA 5LOQA 2UU9J 1AZSB 1WHYA 3PW5A 1X0FA 1QVFR 3GV8B 2NXUA 1NMEB 3PO5A 5KFWA 4CIOA 2OKQA 4X65J 4F67A 3FKBA 1S6QA 3MR7A 4CYUB 3T5JA 1VC5A 4F02A 3DRRB 4TNOA 1RT3B 2W9BA 2GVDA 2RE1A 2OD4A 4TQSA 1YJ9S 2AW0A 3RAQA 1YVFA 3W61A 4O44B 4AT1B 1Y9OA 3VTIA 3RW7A 1WDTA 2ZVSA 1K9MT 2KFNA 2GS8A 4B08A 3O44A 1JJHA 3HF5A 4C11A 5LXRA 2ROPA 3NGDA 4IRCA 2M5YA 5L1JA 4OZ2A 3SCJE 2G2OA 2JVRA 3NL0A 4B3OB 4WFBQ 1WF0A 3A8EA 4OYBA 2MSSA 2NSBA 4IFYA 2B8QA 2RQ4A 5CD4A 2KJVA 2AP6A 3ZZ0A 4HTIA 3UN5A 4LRAA 2VD3A 2WK4A 2DO4A 3HSGA 5HQMA 3JXOA 3NCRA 3W9JA 2HMIB 2IFXA 5HVGA 1RKIA 2R8JA 2XS5A 5K5MA 3G8SA 2BKPA 3DNCA 2HIYA 1RAOA 1G4CA 3LPEA 3HMJG 5ETLA 4LSZB 3TEGA 1T0TV 4M5KA 4F2SA 4FKXA 1CS4A 4JI6F 1VQ7S 1NSQA 3MM5A 1MG7A 4U95A 2BE9B 3VGTA 3M9OB 5DDRC 2AIRB 2B4VA 2VF3A 3D6FB 5M2UA 1VHFA 4Y0FA 1DQ9A 2MKSA 3NOCA 4IOBA 3H5YA 3IO1A 5IQ6A 1VC6A 4NYPA 1RWKB 1CULB 1RWMB 2DVIA 1N33J 1UVKA 4Z2XA 4TY8A 1FO1A 4C0HA 2VL1A 5AXKA 3OTCA 2DH9A 3IG1A 1F9EB 1RJJA 5F9LA 1TL7B 4U8VA 1PJ7A 1OPIA 3UVJA 2BJ7A 1QUPA 1JLFA 3OJSA 4ICLA 2VB6A 1JMTA 3RW6A 3ISNC 4G1QA 1MNEA 4LF8F 2K1RB 1LEOA 2XM3A 2OPQB 4LFAJ 3UNYA 2Y1IA 4DFMA 3CCRS 2LMIA 1WF2A 2RQKA 1X5TA 2AYBA 2F63A 1QVGR 4QBUA 3G82A 4B9LA 2F7VA 1SKRA 2XZWA 2VKZG 1JWWA 1T9TA 4EFAC 3G71S 1RWWB 4N8NA 1DAXA 2POKA 3L7UA 1N34F 3W9IA 2L08A 3H7HB 1SVDA 1VC0A 1BY9A 2QA4G 4Q5VA 2CQPA 3F56A 5KFDA 5JVHQ 4NE9C 2YKAA 1SQEA 4JBCA 1KHWA 2I1RA 3UCZP 1B99A 3PYDA 3CDUA 4OYOA 3CXCR 2DNHA 3C6UA 5CQGA 2IM0A 2B56A 2AZ1A 2EWHA 2GIRA 4MKVA 2EG2A 1YJNS 1UW4A 2CPXA 2LKZA 1X31C 4W98A 2RRNA 2PEHA 3MFHA 1RHMB 2Y9HA 1F2HA 2CNLB 3W65A 2FVPA 1N52B 3D66A 3OR2B 2UUBF 2QN6B 4LSNA 3IWLA 2RAQA 1FD2A 2BVZA 2FB0A 5HMWA 1WHVA 4CWBA 2LEAA 3QAUA 2CPDA 1C1CA 1RWNB 4QQBA 4AD6A 2L3MA 1KEKA 2E9RX 2YNGA 5U47A 3SYZA 4V1Ak 3C46A 2Z8QA 2H5JB 1MLAA 2QYGA 2KU7A 3D6MB 2UXCF 3PYEA 5F9NA 4P52A 4DQPA 2GA7A 5KFCA 1T11A 2R2UA 1S6OA 1SBRA 1QE1A 2QLJB 1S77D 4ETZA 1RBAA 4QWAA 3H5XA 1WELA 2U2FA 2KN4A 1ZTWA 3OW2R 2APOA 2EVZA 3QSYB 1CLFA 1UZHA 2MDAA 2XY5A 1HNIA 4FNHA 1F5BA 3G6VA 4KFBB 1FWKA 2HBYB 1K44A 2HEKA 2WVEA 4X4NA 3KOAA 1Q4RA 4OYAA 4PG8A 3HKZD 1C0TB 4M5MA 4ID5A 4DEZA 3D28A 2XYPB 3MM7B 3OJUA 4PXEA 2F5GA 4OV6A 4G6VB 2AV5A 2QX0A 2Y8WA 2V6AA 1HBUA 4Q2LA 2GVZA 2XG8A 4C8YA 1U2CA 4JI5J 4KHMA 1S7IA 1IKYA 1I94J 1WTBA 2BRLA 1UPPA 2XQCA 2EEYA 4P7VA 1LK7A 3AQOA 1YJUA 4K4UA 2FJBB 4B9UA 2OLWA 3NNCA 3QNWB 1JX4A 2AT1B 3ISND 3AD7C 4ECSA 4YHHJ 1HQUA 4Q0BA 1WI6A 3ADAC 1S0OA 4K0KF 5I3PA 1ULRA 3UDVA 3KHLA 1G1XA 4LBIA 4R5PB 2N4CA 3HFVA 4WP9A 2H1YA 5ETMA 1ZH5A 3X1LB 3DLEB 4L3NA 3M7VA 2LDYA 3QGIA 3CCMS 2VONA 4HL9A 4DFJA 3IR6B 3TR5A 1NH8A 1TL1B 4FS1A 3F41A 2W4CA 4OJGA 4PG5A 3AOBA 3GR1A 3AJ2A 4GKKF 3KLGB 2BQRA 2FZGB 3K8WA 1UETA 3ETMA 1NK4A 5KFFA 4F3QA 2YWHA 2XULA 1TK8A 4NXNF 1VQ4S 4QWEA 1BXNA 1SL1A 2XY7A 2C28A 2CVIA 3MM8A 2GHVC 3DLGA 2O66A 4FS2A 2D1CA 4GC7A 4EZ6A 4AQYJ 4A8OA 1UEKA 2A2DA 3MUMP 5E33A 2P8IA 5ETPA 1XEZA 1TUVA 1HBNB 2AGOA 4Y28C 3W5ZA 2XO7A 2OGUA 5RUBA 1UVIA 4KV8A 2ZH2A 4BWMA 3DYAA 3CCVS 1RT2A 1CPZA 3U1MA 1VCTA 2HHHJ 2BRKA 1PC4A 4USHA 3TVYA 4YB6A 1F60B 1UTAA 3ENAA 2XYHB 1S10A 1JJ4A 4DX8H 3I31A 3R1LA 3LGHA 2DBBA 2VQEJ 3QWUA 3UI3A 1PJ5A 3T9ZA 2MKKA 4UZCA 2CFXA 5KFIA 3BSNA 1F6TA 4JI3F 1VLYA 4FYVB 1IBKJ 2BMBA 2FJVA 3C14B 5HN0A 3QSIA 3IGNA 3PW7A 4NLQA 4DG1A 3ITHA 3MPYA 1T9WA 3DOMB 4WTOB 2IYGA 2HQ3A 2EC2A 4P74A 2Q66A 2LP4A 3NLCA 2J9CA 3PDNA 4I7FB 3CCWA 4B02A 4OJHA 4HHUA 3OXLA 3D0GE 5L38A 3WC0A 4CM2A 3PW0A 4U6PA 2IPOB 2HZVA 3DOKA 4QYZJ 2K7JA 2CQ0A 5M2PA 2ZKUA 3TAMB 3EGZA 1D9FA 4P7TA 3O2IA 1D09B 1HD1A 5A6PA 4LREA 1YRTA 3NRBA 1RT1B 4OI4A 2NZ4A 4DU7A 2PD1A 3IR5B 3ZXWA 2EFOA 4KR0B 4AYBD 2CXEA 3DLKA 4F4KA 2O3DA 2KM8C 3UR0A 4WU3A 2C2MB 1DLOA 4QPXA 5KFPA 2H5IB 4EO6A 3BSAA 2JJ4D 3RR8A 4M5NA 2QA1A 1T8EA 3RU0A 2XI3A 4IO9Q 3V6DB 2R8KA 5HJXA 4QR1A 1WNEA 3EZOA 4J9MA 5B7WA 4NRUA 3Q2TC 2WZ1A 1JXLA 3KJNB 1A7GE 3M1VA 3MEKA 2ZE2B 2XSFA 4O3QA 1JLQA 4NMLA 4NYOA 3K8VA 1YJRA 1IUJA 4ZLNA 4MK9A 4DPTA 1JLAB 4CTAA 1FKAF 3RRHA 3KLEB 2FHMA 3J81Y 1IR0A 2DNPA 2DNNA 5DM6Q 2XMVA 1NJZA 4F8RA 1DFDA 3W5YA 4ZP7A 4GVBA 2XB2D 2A2CA 1U24A 5DRKA 2B9YA 2L9DA 3JTPA 1N6QB 2ZHAA 3CD7A 3T1YJ 4RW7B 1RT4B 4ALZA 2UUTA 2GAHC 2XMMA 2A10A 1ZM9A 2GW8A 3QO9A 4DZDA 1XNRJ 2FJEB 3TYTA 1WWHA 2HVHA 5ETNA 1DRZA 3BBBA 1ZPWX 3CDWA 3AH6A 2NSCA 2XMTA 4L75A 1WC3A 2CPIA 3CB4A 3MD1A 2WBMA 2HZCA 3MR5A 4EMDA 2FQQB 3R5BA 4UOCA 4ECTA 2WOMA 3QT7A 1DQAA 1HNXJ 4YDDB 2JH3A 3EVWA 5CZVA 3DLHA 1UJ5A 3DC2A 2R2RA 3GYNA 2G0CA 2ZC4A 4RW8A 5B0AA 4ZHRA 1AROP 3DRYA 5H9FJ 4TKTA 4OI0A 1TR0A 3P5TL 5K14B 2VKRA 4DR3F 4JI0F 1OMSA 2Z4PA 3KK2B 2B0GA 2JEIA 3PNIA 3EMTA 1HBOA 1N5YB 3CVKA 5A76A 2HGNA 1IR1A 1LFWA 1GXLA 3MMAB 4XDCA 1HLWA 2MYFA 3J80Y 3QQCD 3W2VB 5AJ3F 1NDCA 1FK9B 1TZ0A 4YP3A 2NCKL 4IH7A 2RKIA 1F9HA 1FF2A 3FSYA 3ET6B 4XPEA 4L76A 2MLYA 3B82A 1WC6A 1HW9A 4ZDNA 4DV2J 2WSEC 4P72A 1EHWA 2I0XA 5GAEI 1KQSR 3FRYA 2WVFA 4USKA 2H48B 1C1BB 5D0HA 1VQ9S 2ADCA 2I8EA 3OR1B 3KJVA 2GQCA 4ES3A 3CMQA 3EPGA 5F8LA 3Q23A 2Q1LA 1FE0A 4C7QA 4ZCIA 2W25A 1TKXB 1F3VA 3H25A 4DSKA 1UWAA 3SCLE 5JMNA 1Y5NB 1SB6A 1U6FA 3BEGB 2MLXA 3THPA 3WQPA 2HHWA 4C3LA 5ETTA 1ELOA 1TL3A 1HQ2A 1KNZA 3I5BA 4NPOA 2FC8A 4MFBB 4YFUA 4NLGA 2RB7A 1VBZA 3ZZYA 3GZ7A 3T3FA 4RJVA 5B0CA 2LQJA 2M4MA 3Q8RB 3N4WA 1R8CA 2ZM6F 2B9WA 1VJWA 2XZDB 1IKVB 3UR3C 5E3QA 1N5QA 2HNDA 3T6BA 3AA8A 4FYXB 3DGPB 4IR1A 1Q86T 3BH6B 1URNA 1YQHA 5LSOA 1X5PA 3KG4A 4FF3A 4DR1J 4DQQA 2AJ0A 2V5HG 5K8PA 3GJTB 4I0WA 1SJ1A 1RTDB 4NEYA 3QAEA 4NEZA 2UVRA 2MZRA 5FDLB 1A0OB 2MQMA 3ILOA 2ZH6A 2MGZB 2D69A 1U7LA 1VK3A 2V2ZA 1O51A 2KFZA 2XLIA 3PIPQ 3LGMA 2X3DA 3LP2B 1FWLA 4KQZA 4RNHA 3JSMA 2J7UA 3CW2C 5KFZA 4F25A 1DZ5A 2XSJA 2YKNA 2DNQA 1Y7PA 2MPUA 4DSLA 4LT6A 2AYMA 4BDPA 3EWGA 1IBMF 1FX4A 3MEEB 4PYAA 2HWTA 2X3GA 2DR8A 3PIOQ 1FDAA 3IS9B 3OBIA 4X62J 1BWEA 1NH7A 5KG7A 1RU2A 4AUKA 1J2VA 4OLPA 3N6NA 2VA3A 6AT1B 5D15A 1S1VA 5KFTA 5IS2A 2HQDA 2QA4S 3NGUA 1PSDA 1VRUB 3QRQA 4F50A 3WIVA 3PRVA 3HSDA 3TW0A 3OLAA 4JYAF 2E1AA 4I56A 2PMZD 1GH8A 2F8HA 3W64A 4Y00A 2QL7B 4C8OA 4ZVGA 1NPPA 1VRTA 4Q45A 3MEDB 4G3IA 2B4OA 2B6AA 3BPSP 1F1BB 1TV6A 5CZXA 5KFJA 2YTCA 3JQJA 2EG1A 2AGQA 1Z1ZA 3RB3A 5IFMA 3FVYA 2R2TA 2H4WB 3O1LA 3G96A 3M2UA 1PBAA 1WOPA 2QL5B 5HQLA 2HAIA 3M8RA 2XS7A 2P6SA 5B08A 2ILZA 1BHNA 1QY7A 2VICA 4BC7A 2FPHX 2OP5A 2DR7A 4DCOB 3HI9A 3BQ0A 5DGAA 2GNKA 5C7PA 5C24A 5L9XA 2VG6A 1EKRA 1UFWA 3SIPB 4EO8A 3GP9A 1WDDA 2CUYA 5AE2A 1CSJA 3UD5A 3HVRA 2JZ5A 1X4EA 1LQ9A 3OTOJ 1RYSA 1N0VC 1JLCA 1XNQF 1LWXA 4FNIA 2LDIA 4LUBA 3ETOA 1LWFA 2QLBB 4MIAA 1ZM2A 5JXSA 2YNIB 3GYGA 2G2YA 5JUMA 1LOUA 1RK8A 2YWKA 2DPJA 1YJ7A 3VZIA 2NQPA 5BR8F 2Y8YA 3C19A 2ZJRQ 2OTLS 5F0UA 1JLGB 4PWDA 3WDOA 3NKYA 5J1PA 3JYTB 2BV3A 1RDRA 3PHTA 3UDCA 1XR6A 1LW2B 3KHRA 3MXHP 2Y0BB 1WOSA 2KZMA 3Q8YA 2XS2A 1UWBB 4FF4A 5IV3A 4DR5F 2D3OR 4MIBA 3AXMA 4RW9B 1NEEA 2DNRA 2VFUA 1NBEB 2CWXA 2HS4A 2VFSA 1FEEA 3MECB 1P1TA 4M5LA 5KFXA 3JQMA 2VOPA 4QOTA 1WSRA 4UY8T 3VGSA 5HO4A 2MZQA 4X4VA 3PJWA 1NXIA 3MUTP 1WF1A 4U96A 4CH7A 1CC7A 3OLBA 3TZZA 3KKFA 2VC1A 5E5NA 3SI8A 1RWUA 1S6QB 2VBYA 1BUXA 1EAYC 2QYCA 2YH0A 2I38A 3Q8SB 3LH2S 2W9BB 2GVDB 2KKHA 3M2VB 2LCWA 4UW2A 2IBOA 2AYEA 3DM2A 2JLGA 2PA8D 3H20A 1B7YB 4FBTA 2ERRA 2JFKA 4ECQA 4JI1F 2ZUGA 1HA1A 4NLDA 4CQ1A 1F3FA 1TTHB 5D8HB 2IRYA 1MU2B 4OX9F 4I2QA 2XTJP 3C6TA 4YB1P 3Q24A 1YSJA 1JB0C 4CH0S 3BQ2A 1SUQA 4OJ3A 1KONA 4IFYB 3OVBA 3BBFA 1HL6A 2R9LA 1U25A 3MCMA 4C2MA 1ITPA 1RT5A 2J0XA 2CQDA 5C5JA 2VODA 4ES1A 2OFGX 3BB5A 1ACMB 4DUZJ 1T95A 1L3TA 4F0KA 4F4XA 4LF4F 1SL2A 3M8PA 4XK8C 1MWZA 1X5OA 2HG4A 1F9FA 3W66A 3QGPA 1KOOA 5IT0A 3M8WA 1D3WA 1DARA 2R7RA 4DFKA 1EP4B 4KRWA 5C25A 1S0NA 4A8XA 4GKJJ 2HVEA 1YBUA 4N7TA 3AOCA 3HSJA 1LWCA 5E3AA 2VIHA 2MEWA 3I9V9 3FJ2A 3GLJA 1BQXA 1RTIB 4U9RA 3ZZUA 1S76D 1S9EB 1GMWA 1W2BR 5CAAA 1RTHA 1Q8KA 3D6HB 4TY8B 1BQNA 4PQUA 4DR2J 4USVA 1KTVA 1NKCA 1NSPA 3IG1B 2VUGA 2Y0SD 2ZDPA 3LO3A 3LAMA 3UVJB 3AA9A 1S1UA 2W1BA 2X1BA 4DR7F 2CG4A 4B3RJ 4WFAQ 5IV4A 2EPIA 1U49A 2HGMA 2MQNA 5I42A 1RAIB 3S8SA 2XHCA 4ED0A 5IT4A 4XO0A 5L1LA 1WG5A 2V4JB 7AT1B 3HULA 3N0VA 1WEZA 1CJTA 2RQCA 2M7SA 2YWFA 2LQ5A 5DDOC 1NK6A 2E1PA 5KFQA 2X7IA 2NXNA 3ILLA 3UDEA 4OYZA 3R7NB 1PCAA 4NA2A 4R0JA 3H5SA 4HDHA 4W92B 2NXCA 4X66F 2OPSA 3I0SB 3C6UB 1RCOB 2DGUA 2ZBIA 2LQ9A 2UU9F 1RZMA 3JSBA 3OFHA 4USUA 4WPAA 1IM6A 1FHTA 3D0IE 2B4PA 4F4ZA 4JI4J 2ZKTA 4X65F 3AJDA 1H2UX 2HBQB 3AQPA 3ZFVA 5L39A 4RW4A 3T1AA 4KPYA 1NK8A 1PJ6A 4ILMA 2HHXA 1Y5LB 3NBPB 1RCXB 1H3DA 1U26A 2RVJA 3OUYB 1BE4A 4ANCA 2LXIA 2W2NP 4C97A 2YNGB 4CLKA 2ZH9A 3U27A 2C1EB 1VS3A 5CH7B 4RKUC 4UF4A 5CYJA 3KLFA 3W62A 4RU2A 1IKWA 4WCEQ 3G6XA 3V4IB 4U7UK 3FBBA 3CNQP 1PAUB 3MFIA 4J9KA 4ECYA 2DRAA 1WHWA 1WD6A 2ZNYA 3HJFA 2ZOFA 4B3SF 4RUHA 2CQBA 1YWXA 3TEHB 1OY8A 3QWPA 4KPCA 3MR3A 3T6JA 4P71A 4PUOB 1CG2A 1NKBA 2DGTA 3L9ZA 2CA9A 2HNYA 1H38A 1ZOTA 3NMRA 4ZITA 4JV2A 5IWAJ 3MM9A 3GIIA 2FLPA 4ID5B 1PGZA 3GFYA 4RU9A 2DO0A 1J5OB 2JRSA 2M2BA 3V6KA 2GO8A 3POTB 4CLWA 2LA6A 1OSDA 1KQFB 4YUDA 3GCWP 1NZ8A 3QBCA 5THWA 3M9MB 3MDFA 2Q6BA 2MZ1A 1HBUB 2GVZB 2R7OA 2CJXB 5H1SV 2XMAA 3MTKA 5KG6A 4Y2CA 4OZ1A 3U1LA 3H59A 4AL7A 3C66A 2HNZA 2IVFB 2WTFA 2FUG9 3HHDA 1HQUB 3HT0A 5GAEU 2J6UA 3D3BJ 2V8PA 1MW7A 1N33F 3G9CA 4CT9A 1UEVA 1XR7A 1FDBA 2QV6A 2DH7A 2XMWA 1NUEA 2J9DE 4MYTA 1FRMA 2RDIA 3TAQA 3TNVA 5KT3A 2GJ2A 4R8UB 1U2RA 3CUNA 3VAGA 4NYZA 1EZZB 2IM3A 3M6XA 1Z2LA 1XMBA 4LFAF 2A6MA 2ZNZA 4O3PA 4ED4A 1U1NA 5GAGU 5EGYA 2CKWA 2PMWA 4X4TA 2GHWA 4WYWA 1IXKA 3D67A 3EJMA 4F2RA 4CO0A 2FYXA 2XLJA 3C16A 1DHMA 4CO1A 4QU7A 2RIJA 2RT3A 2LXFA 7FD1A 1KQKA 1FXDA 3TRGA 3BREA 3KG0A 2B5JA 3E3XA 1RB0A 1YX2A 3R7BB 4DLGA 2KYZA 3BJYA 5BXIA 2D3UA 5LMUJ 5I3UB 5J2QA 4E8UA 1SV5B 5CYMB 2Q79A 2KH9A 3MZIA 4Y34A 4ED2A 3PW2A 3R5GA 2X1GA 2RRBA 3ELHA 5IT9U 4JI7J 1YBAA 3DMJA 2CYYA 4HVZA 4L72B 1RHJB 4DR6J 2KT5A 3KUGA 5LJ5Y 2EK1A 3N9UC 3FBCA 3DU6A 2CAJA 3GWCA 5DQIA 4X84A 3G8TA 3JTNA 2JFDA 2NYIA 3RZAA 4B9MA 2VJUA 4M63A 3RUBL 2BE2A 3HX9A 4YDXA 1H74A 2V9KA 1LK5A 3PO4A 3M30A 4GO7X 1QAYA 2ZHOA 2M88A 2OAUA 4DV1F 3DRPA 1T03A 4A48A 2HW3A 2PN6A 1U1PA 5HBMA 1JKHB 3JB9k 2X1FA 4A8QA 4HT7A 1L3KA 3V6HA 3R97A 5J2MA 1H73A 1KKHA 5KFVA 2GJFA 4DZ6A 1TFYA 3FGVA 5EWFA 3VWSA 2VPWB 4HHHA 3PV8A 4WZMA 3TO8A 3VCDA 4UY85 3CCTA 3W9HA 1GNKA 1XQIA 2FJDB 1VQMS 1O0PA 4Q8FA 3J7YI 3HPOA 1UJ4A 2YNHA 3HVTA 4Z7CA 2F4VJ 3ITHB 1VR6A 3L7OA 5E0OA 1N5VA 1Y3KA 4O4GA 5HQ8A 2DGVA 4NZ0A 3TVZA 3RB4A 1WUUA 3CWJA 1AA1B 5A6WA 2OUGA 2MY8A 3DDNA 3EM1A 4NLVA 1L3UA 4ZA1A 3SSQA 2GC8A 2XZTB 3T5LA 1I94F 2BANA 3DOKB 5ADZA 4K7QA 2BACA 3KLVA 2R7VA 4I2PA 4CLTA 1S97A 3DRSB 2VFRA 4DL0C 1YHQS 4ELUA 4G1IA 2EFPA 2BEFA 4B3TJ 4YHHF 4M5DA 2CQ1A 4C8KA 4JI6J 4YR3A 3DLKB 2LXUA 2CPJA 2CNOB 2GIQA 4CLUA 1DLOB 2OPPA 2VDIA 2VPZB 4NRTA 5D4LA 2E5JA 2ZH8A 4WK3A 4AXJA 2PT0A 1JLBB 5HLFB 4OZNA 3CO9A 2V4RA 5HK4A 4CZCA 2IC3B 2WVDA 5J1EA 1IKXA 3M1VB 4ANEA 2IA0A 3QGHA 1JLQB 2KT3A 4PABA 1RT6A 1S1XB 1G3OA 3ZNJ1 5DM7Q 2F40A 3BV8A 1O5JA 2XNRA 3ZZTA 1TUGB 5KFLA 4FYDA 2OH2A 4NLTA 1LFPA 3CJKA 1C4CA 1UJ6A 1HYSA 4W90B 2OFHX 4Z7YA 1S9GA 2CJKA 1V6HA 3K57A 2CNNB 1XJWB 4ZN1A 1S6PA 1N8RT 1LWEB 3SDEB 1BQMA 4DF8A 1CJVA 4KO0A 3NWGA 4EGLA 4JOUA 4DJBA 1Q95G 2BJ1A 3OHAA 5A0YB 3CJRA 3DHXA 3DXSX 5DLFA 4MKAA 3BKUA 3RYLA 2YX4A 2JWNA 4AQYF 4CLZA 2FVQA 2WOMB 3NGSA 4TU8A 3IBWA 8ATCB 1Q79A 4O3NA 1HWUA 4ZLJA 2OJ3A 2FVSA 1M5KC 1ZAXA 4RW8B 4IRDA 3IN5A 1Q53A 4ECXA 3MPVA 3TARA 3BS9A 1EQMA 2FLOA 1V3ZA 4USMA 3Q89A 2HHHF 4CYUA 4YR2A 1HBOB 1Q8IA 2GO9A 4QWDA 4DUYJ 1RT3A 2OPRA 2Z30B 3KMSA 2HURA 4WFZA 1M5HA 1IQZA 2JDJA 3CC4S 1JLEA 1X7VA 4A8SA 3P5BP 1RLDA 2LEBA 2V2KA 5SUHA 2RJZA 2MMYA 4KHRA 4ILRA 2HK3A 2D3O1 3QZ8A 1IBKF 3NP5A 2R3VA 3HKWA 2I5JB 3U02A 1OIAA 4NXMF 4DMZA 3GFHA 4B3OA 4PAAA 2D3ZA 2HPUA 2XMJA 2C3UA 1NK5A 5KFNA 3I96A 1Q8BA 4ZMMA 1RHRB 1H2TZ 1ZETA 2OEKA 5J2PA 4KGVB 1KSPA 3KJVB 3JSRA 2HMIA 2YQ1A 4B9VA 2Q3PA 4KY3A 5D3GB 3N6MA 2RNEA 6FDRA 2BBEA 3KJQB 4OI6A 3NXZA 4FBUA 1TAUA 3SV3A 2ZOMA 3VZHA 5H9FK 4QZVB 3W60A 2MJNA 3EZ5A 1TL3B 2NLWA 4ZN3A 2VPXB 2BQ3A 1NO8A 1NB7A 3SFUA 1U0HB 4LF6F 5T41A 5CYQB 4DPOA 3TA2A 3A1YG 3FFIA 2YY3A 1A9NB 4NLXA 4AFFA 3UFCX 4M5GA 3MR2A 2HNDB 1HI8A 3KK1B 3K5PA 3Q86A 4I64A 3LUYA 1CULA 4N77A 5IOLA 4QCLA 5ITHA 2HVZA 3PG9A 3Q8PB 1KR4A 1TL7A 1ZTTA 1PBUA 4IOAQ 2WW4A 4F0MA 3GV5B 2CZVC 2HFZA 2K1RA 1X4HA 2OPQA 4OYMA 2ILYA 2HQFA 2XC9A 4ID8A 2ZBCA 3T1YF 2AJ4A 2ZH7A 1RT7B 4YS2A 1VQPS 3JSMB 2BKOA 3DOLB 1B0VA 2JC0A 5ETKA 4GMKA 2UXDJ 2ZUAA 3GFZA 1RTZA 3EGNA 5GAHI 1TKTA 3SZ2A 1CVJA 1S0MA 3D54A 3K59A 2RDJA 4KH0B 2QFJA 1XNRF 2PDAA 4F3MA 1FNXH 4PQAA 1K0TA 3R27A 3KDNA 3OL8A 1PILA 4NZ6A 4ZPBA 3HHNB 3KLIB 5SZTA 1HNXF 3L09A 1VHIA 1OS5A 2HWIA 1JJ2R 3HVAA 2X1AA 3HFKA 2PI4A 3EE3A 2AJ1A 3SV4A 4OJ1A 2CJQA 4LFBJ 4P73A 4KKOA 4LRDA 4X4PA 4PYDA 2KG0A 2G1HA 2XWYA 2V4QA 3OR2A 4RBVA 1MWYA 3HXMA 2HVIA 4WKRA 3CGIA 4TLRA 1RBLA 3EPIA 1FX2A 2A3JA 3D6TB 3H5UA 2UUAJ 1WC5A 2B6AB 1TV6B 1X0PA 4NA1A 4R25A 2JX2A 3TQEA 1TP7A 4AL6A 2WB4A 4WFYA 3RG6A 4LRCA 2MZJA 1Y00A 2Z57B 2RF2A 3QLHA 3OPKA 3H0PA 4P2FA 3T5KA 4URGA 3M8QB 1GX5A 5KT6A 4DV2F 3H2VE 4FF2A 1HMVA 4RNNA 3G8QA 5KFRA 4C98A 4J9UE 1FFGB 1S4FA 5C24B 2IM1A 2XLKA 3Q2SC 2F8MA 3MF5A 2BKNA 3ZTSA 3D1QA 1P6TA 4PG7A 1Q82T 1K8AT 3CTRA 4LF9J 5A2QU 2CQIA 4G65A 2B7BB 4ED3A 3V81B 1I3OB 4N8OA 3CJ4A 4LQ9A 4OZ3A 3QRPA 2JC1A 5KOWA 1U1KA 1C0UB 4TLQA 2EBGA 3R5CA 1S49A 3BGRB 5DQGA 2V8HA 1TK0A 2XWXA 5T7LA 4LRBA 3OVSA 3VAKA 4ED7A 4E98A 1ZA2B 1RHUB 1H72C 4NCGB 5HSPA 4PWDB 4FYWB 8RUCA 3UD3P 2H65B 1TKDA 3FBFA 1R8HA 3KXDA 5F8MA 2QSFA 3MOZA 1H0HB 2OIHA 2AWZA 3MAAB 1YBTA 1ZM3A 3O8WA 3WIUA 2CPYA 2BM1A 4Y6IA 1HBMA 3R8YA 4D3GA 1HQEB 1QSLA 4ZJOA 1X5SA 1GFWB 2E44A 2CPHA 5DLGA 1NCLA 4DR1F 5ETOA 1SJQA 4FN5A 3PEJA 1U0SA 4Y2KA 4R5PA 4K4ZA 4J9SA 3BGOP 1K47A 2C2DA 4WFNQ 1LNQA 4LIRA 3H8YA 4UOHA 3VV2B 3F44A 2ZWPA 3DLEA 4KGMA 3G2XA 1IM4A 3OTEA 2KHCA 2IMWP 2R8GA 1ZZNA 1Q7YT 2ROGA 3IGVA 3T1HF 1F5CA 3RTVA 1ZM4A 1FE4A 1JXEA 2IRXA 1NB2A 2HKEA 1TL1A 2YNFB 1UW9A 3VVTA 1VYAA 4OI1A 3ZZPA 3NY0A 3VAJA 4F4WA 3GYXB 1YZ6A 2E9TA 1F5AA 1MMNA 3W2WB 2IYIA 4YY3F 1S7HA 3UW1A 1HI1A 1NLKL 1N36J 1XMQF 3LF0A 2VC0A 4KGXB 4X62F 2QMXA 1DTQA 1QSYA 1K0VA 3GIKA 3IBCB 3ENQA 2PE8A 3AB4B 5T14A 3MMCB 3QZ7A 3P6YC 4N41A 1SUQB 3NCQA 4JI2J 1RQ0A 5J1NA 3NAIA 3I56S 4MT1A 5GADI 4QYRA 3I32A 1UA0A 3BSCA 1OQ3A 2MQOA 4RO0A 1JJCB 2VDHA 1RT5B 1AW0A 1M1HA 2XNQA 2E1RA 4K4SA 1T9YA 1HNZJ 1QM9A 1XBWA 2DGQA 3CJ8A 3OT9A 2VQFJ 1HBNA 5DZ6A 3S6EA 4YEAA 2WONB 2N7CA 4NLWA 3D1HA 4H4KA 4DR3J 3HHLD 4NOHA 1WKJA 4X2BA 4J37A 3K5LA 4LQ3A 1YJVA 1IWGA 1YGYA 2KDOA 2DR9A 2MZSA 2MJUA 3E01A 3ONQA 2CADA 3ZZZA 2J8AA 2Y1LB 3CDBA 2Z58B 5AJ3J 1QSSA 3J7YU 4Q8EA 2O1PA 2ALZA 3NS7B 2DHHA 1SI9A 1R31A 4J9OA 4PPZA 1B70B 3C14A 3ILJA 2DXEA 2GV1A 2AU0A 5B0GA 3CCZA 3ZTQA 2LQ8A 1GMWD 3OTOF 4ECRA 2NUUG 4TU7A 1AXQA 4H4OA 4XDDA 2D9PA 2IVMA 4HH0A 4A8YA 2W7PA 3P8BB 1K73T 1S1UB 3CSKA 3PKYA 2CZ9A 2DHXA 1SH0A 3B54A 3EDRB 2ZEJA 3MMBB 2CQ3A 2H9ZA 1D1UA 1APSA 4QR2A 4Y2IA 1VIOA 2OSQA 3PYFA 2Q6CA 3PXGa 4C8LA 1CEZA 1FRXA 1HNVA 3ISZA 4F26A 3QT5A 1QDUB 1XTZA 3M9NB 3G87A 2HSEB 1SIZA 5DDQC 5DQHA 3S1TA 4DV7J 3TAMA 3OSPA 2XGQA 3TUPA 3NAHA 2BW2A 5AXLA 3IM9A 2PSZA 4GRSA 2QZ8A 2H3EB 3A8KA 5AE3A 1YIJS 2RS2A 2K8GA 1FDDA 2ZBRA 3IFEA 2D9OA 3N5FA 5EWGA 1KLMB 2ZM6J 2F8EX 3VAMA 3K89A 2CVEA 4CNZA 2HGLA 1LKZA 1N32J 3CD5A 3UNGC 1S0VA 3LOUA 2XMKA 5KTQA 2HQGA 2R2SA 2OEJA 2ZH1A 1NNDA 4RNFA 4KSEB 2QJ3A 5FIIA 3ZC4A 2CPFA 5E3RA 2ZE2A 4RW4B 4D3HA 4W4MA 4K59A 4LF5J 5G0RA 1PG5B 4EYIB 2D74B 4F04B 2IA6A 1RTJA 3RR7A 2C3PA 3KLEA 3RAMA 1ZYQA 3R7SB 5IC6B 2BJ3A 2YPYA 3QFWA 3QIPA 2VFTA 1MN9A 4NL5A 1HWJA 4Q7AA 1N6QA 3U1NA 4RW7A 5B0BA 5KFKA 2XYGB 2BDPA 4LJMA 2Q43A 3KLFB 3KNAA 1TQLA 4FXDA 1J27A 3H40A 3UQSA 4ES2A 1WC4A 4DV5J 2U1AA 4C9DA 4F4YA 4DPUA 3RBXA 4LRFA 3M32B 3I0RB 1U1RA 3SQOP 1X8DA 4YQWA 3VGVA 3KNGA 1HNWJ 2RS8A 4J9NA 4DV6J 4J5OA 1H2VZ 4DUZF 2L9NA 2BABA 1X4BA 3TUJC 2HNYB 3M05A 3LALA 3VALA 3PJ9A 5K20B 2Z0GA 4JYAJ 2ZJQQ 4WP3A 4ERDA 3IRWP 1CQMA 3DKDA 3IWXA 5A8WA 1MSWD 1M5PC 4DQRA 3R5DA 3M4XA 3OHBA 2MKIA 4GKJF 3KK2A 2YH1A 4PRFA 4M5HA 2BM0A 2DCLA 3PFOA 1N5YA 4NCAA 1RACB 1RSCA 6FD1A 3MMAA 1CC8A 4ATNA 4EYHB 2EFGA 4E2FB 3GSDA 4DSIA 2R7TA 4RW6A 2YKPA 3IAM9 3FUYA 2DGSA 5F8HA 1ZZFA 4Q2MA 1WC1A 3HJVA 2W9CB 2MTLA 2M0GB 4CM0A 1JNZB 4NLSA 5KFAA 1S99A 2QLFB 5B0FA 5F41A 1RAFB 4K4XA 1SC1B 2HRUA 2DD8S 1SKWA 4J7CA 1R27B 4RBTA 2CQ4A 1W7WA 2C2RA 4I6YA 1UFLA 2RHSB 4TYAA 4ZVTB 3MR6A 3LWMA 2V69A 3OR1A 3JAMU 2DNZA 4RZRA 2V63A 3CULA 4O4RA 2CQ2A 5H9EK 1VBYA 4LSLA 3FSXA 1TKXA 3DLBA 1TFWA 2Z2ZA 3LQVA 1D9AA 3C16B 2XBPA 5L1KA 5KFHA 5D6GA 1IJEB 4J9PA 4MTPA 1RI7A 3DN9A 5LSLA 5IC4B 3S01A 4KIAA 1OJ4A 5KT4A 3D2WA 2B5JB 5KG1A 1OSCA 1S59A 4ZVOB 4K50A 2J9DA 3GJQB 2YWEA 2QL9B 4ECUA 3GJSB 1VBKA 3SCKE 1RAGB 1HWLA 4WE1B 5IXUA 4EBCA 4DF4A 2EKYA 1FRJA 3THVA 1FJGF 1TK5A 4WIQA 1FCAA 3O6QA 1FRLA 3OQ2A 3UN2A 4JI4F 3DGPA 1VQSA 1NAQA 3I4PA 3TOQA 1TKZA 4TU9A 1S9FA 3C15B 2KXFA 1H6KX 1R0AB 3ICLA 4OX6A 1GXUA 1YRUA 2VA2A 3Q22A 1MMDA 1RTDA 2IAJB 3D1OA 1M5OC 4L6V3 2E1CA 1IN0A 1SC6A 4RL1A 1R43A 3LW5C 3H2LA 2EXUA 2BE2B 5FDLA 5M2RA 2CRLA 2A6OA 4PXDA 2YX1A 2MGZA 3IR7B 1S72S 2DIUA 5ETRA 2HWHA 3LP2A 3OVAA 1SJ4P 2KJWA 2CPEA 5KFOA 3HLUA 4L3KA 1LXJA 1IR2A 4DL7A 4ER8A 2UUWA 3G86A 2V9WA 3CJTA 3MEEA 5J2MB 3W3SA 4HACB 2J9EA 3IS9A
chains in the Genus database with same CATH topology
2B8QA 3NGRA 3FCVA 2CWKA 3BBCA 1EHWA 5C7PA 1HHQA 4W98A 1NUEA 3NGUA 1XQIA 3BH6B 3B6BA 4HR2A 1NCLA 1MN7A 3BBFA 1WKKA 1K44A 3ELHA 3Q86A 3GP9A 1NPKA 3EVWA 4UOFA 3PRVA 4KPCA 5IOLA 2DXEA 3EE3A 3NGSA 3ZTQA 3FC9A 3ZTRA 1NSPA 3ZTSA 3FCWA 1PKUA 3VGSA 3FBCA 2B8PA 3VGVA 4C6AA 4F4AA 3DDIA 1B4SA 1NDKA 4UOHA 1W7WA 1S5ZA 4UOGA 3EICA 1LEOA 4DUTA 4ANEA 1LWXA 1KDNA 3FKBA 3G2XA 4S0MA 1S57A 3BH7B 2HVDA 3GPAA 3R9LA 3VGUA 1HIYA 3B54A 3PJ9A 4CP5A 3NGTA 1BUXA 3ZTOA 3EM1A 3EMTA 3WX8A 1NDPA 1ZS6A 3EJMA 3FBEA 3Q89A 3ZTPA 1BE4A 1NB2A 3DKDA 1XIQA 4ANCA 4FKXA 2BX6A 4DI6A 1HLWA 3VVTA 1VYAA 1NHKL 3Q83A 1JXVA 1NSQA 2HVEA 1U8WA 3JS9A 2HURA 3L7UA 4O0NA 2DXDA 2AZ3A 3VGTA 1UCNA 3ETMA 3VVUA 3Q8VA 3ENAA 3Q8UA 1WKJA 1NSKL 2ZUAA 4ENOA 3EVMA 1NLKL 1NDCA 4ANDA 2DXFA 2BEFA 2VU5A 1MN9A 3MPDA 2NCKL 3FBFA 4F36A 1NDLA 4EK2A 1S59A 1B99A 4FKYA 5BXIA 1F3FA 3BBBA 2DY9A 2DYAA 3FBBA 1BHNA 4DZ6A 3EVOA 1WKLA 1F6TA 5CABA 2AZ1A 1PAEX 3Q8YA 5CAAA 4WBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8Q A;  3NGR A;  3FCV A;  2CWK A;  3BBC A;  1EHW A;  5C7P A;  1HHQ A;  4W98 A;  1NUE A;  3NGU A;  1XQI A;  3BH6 B;  3B6B A;  4HR2 A;  1NCL A;  1MN7 A;  3BBF A;  1WKK A;  1K44 A;  3ELH A;  3Q86 A;  3GP9 A;  1NPK A;  3EVW A;  4UOF A;  3PRV A;  4KPC A;  5IOL A;  2DXE A;  3EE3 A;  3NGS A;  3ZTQ A;  3FC9 A;  3ZTR A;  1NSP A;  3ZTS A;  3FCW A;  1PKU A;  3VGS A;  3FBC A;  2B8P A;  3VGV A;  4C6A A;  4F4A A;  3DDI A;  1B4S A;  1NDK A;  4UOH A;  1W7W A;  1S5Z A;  4UOG A;  3EIC A;  1LEO A;  4DUT A;  4ANE A;  1LWX A;  1KDN A;  3FKB A;  3G2X A;  4S0M A;  1S57 A;  3BH7 B;  2HVD A;  3GPA A;  3R9L A;  3VGU A;  1HIY A;  3B54 A;  3PJ9 A;  4CP5 A;  3NGT A;  1BUX A;  3ZTO A;  3EM1 A;  3EMT A;  3WX8 A;  1NDP A;  1ZS6 A;  3EJM A;  3FBE A;  3Q89 A;  3ZTP A;  1BE4 A;  1NB2 A;  3DKD A;  1XIQ A;  4ANC A;  4FKX A;  2BX6 A;  4DI6 A;  1HLW A;  3VVT A;  1VYA A;  1NHK L;  3Q83 A;  1JXV A;  1NSQ A;  2HVE A;  1U8W A;  3JS9 A;  2HUR A;  3L7U A;  4O0N A;  2DXD A;  2AZ3 A;  3VGT A;  1UCN A;  3ETM A;  3VVU A;  3Q8V A;  3ENA A;  3Q8U A;  1WKJ A;  1NSK L;  2ZUA A;  4ENO A;  3EVM A;  1NLK L;  1NDC A;  4AND A;  2DXF A;  2BEF A;  2VU5 A;  1MN9 A;  3MPD A;  2NCK L;  3FBF A;  4F36 A;  1NDL A;  4EK2 A;  1S59 A;  1B99 A;  4FKY A;  5BXI A;  1F3F A;  3BBB A;  2DY9 A;  2DYA A;  3FBB A;  1BHN A;  4DZ6 A;  3EVO A;  1WKL A;  1F6T A;  5CAB A;  2AZ1 A;  1PAE X;  3Q8Y A;  5CAA A;  4WBF A; 
#chains in the Genus database with same CATH topology
 3KK3 B;  4JI8 F;  3TUI C;  1RIS A;  1HHQ A;  3NEK A;  2C22 A;  1KS2 A;  3W63 A;  3HM9 A;  4ECZ A;  5LM7 E;  2KB2 A;  1BD6 A;  2UVU A;  3KUE A;  2F9J A;  4K2J A;  2YX7 A;  5DDP C;  1VQY A;  4MKY A;  4DU8 A;  2M8D B;  4KYZ A;  3HVT B;  2H4Y B;  1YLX A;  5IWA F;  1CJU A;  1OY9 A;  1OQ6 A;  4O4G B;  2HRY A;  1D8Y A;  4OHW A;  1RAB B;  5ETS A;  3BGL A;  3GB0 A;  4QW8 A;  2WW8 A;  4LF7 J;  2ZWO A;  1GTH A;  2FTR A;  5A8R B;  3CDA A;  4ZIW A;  2MQP A;  4K5R A;  2YXL A;  3TQ1 A;  1N56 A;  3MED A;  2UXB J;  4LF4 J;  2A18 A;  3BYP A;  3IMQ J;  5DG7 A;  3M6U A;  2VBX A;  2G13 A;  2OML A;  4DLE A;  1U8S A;  4K2X A;  1G2E A;  2OEL A;  2IRU A;  1GEH A;  4USW A;  4NZ7 A;  4DL4 A;  2FJA B;  3J81 U;  5CCL A;  2QSW A;  3LWL A;  3BKF A;  2GGP A;  5D0G A;  1NZA A;  1U1L A;  4V19 X;  1CJK B;  2MXY A;  3E2E A;  5L9N A;  2ZZT A;  2OPP B;  1WKK A;  4OI3 A;  3SQG B;  4IR9 A;  1NPK A;  4PZV A;  1VGY A;  1UVJ A;  2NPF A;  1FER A;  2IVY A;  5KT7 A;  4JV1 A;  3DXB A;  3CMA S;  4RWW A;  2V34 A;  4QPT A;  3NNA A;  3R2D J;  2ABY A;  1U45 A;  1NK7 A;  2M3D A;  4FF1 A;  4X4S A;  5F3Z A;  1NSA A;  3HD2 A;  2YWG A;  2PI5 A;  2FZC B;  4DN0 A;  1C4A A;  4C3M A;  3LTO A;  2HYI B;  4DR7 J;  3Q8V A;  4UT4 A;  1RA7 A;  4CO5 A;  1NU4 A;  3I87 A;  1E6Y A;  2YKM B;  2ZD1 A;  3OXG A;  4ZVR B;  4CO3 A;  3S7R A;  2G0J A;  5LMU F;  1F0X A;  5K9F A;  3EGV A;  2KM8 B;  1BQM B;  1SL0 A;  4K4Y A;  3JYT A;  4IFV A;  2IMO A;  4IG3 B;  4DQS A;  4ECV A;  1LW2 A;  4JI7 F;  5KFG A;  4E0D A;  5A2Q Y;  3J80 U;  4DR6 F;  1UWB A;  2EFQ A;  2DNL A;  3CJQ A;  1S79 A;  4RW9 A;  2ZBQ A;  4FP9 A;  5D78 A;  2RDD A;  5D4N A;  2DRB A;  2FHO B;  2YBV A;  3GIL A;  2J7W A;  1WSV A;  1YJW S;  4QIE A;  3DFE A;  4DV0 J;  1K1Q A;  1QAX A;  1HIY A;  4OL8 A;  1P9Q C;  3FQL A;  5HRO A;  2PFD A;  3OV7 A;  2DTJ A;  3R5J B;  1X9M A;  4OZL A;  4B17 A;  2ZFH A;  2W2P P;  3CCQ S;  4NLR A;  3TJ9 A;  1V9O A;  2OPR B;  2UVW A;  4I68 A;  2DJW A;  2LVW A;  2MLZ A;  3M2V A;  3MM6 B;  3A12 A;  4DR4 J;  2K3K A;  5KG4 A;  1TEL A;  2AEM A;  2DY9 A;  2EKN A;  1JLE B;  2UV8 A;  1UVL A;  1NRK A;  4IG0 B;  2JLF A;  1MU2 A;  4HR2 A;  4P2S A;  5GAD U;  3N6L A;  2FZK B;  2F4V F;  3LPY A;  5D0R A;  2G1D A;  1FJC A;  3J81 j;  3G6E S;  4NI2 B;  4I69 A;  4P6Q A;  4ZK7 M;  3I4H X;  2VG5 A;  1KVI A;  2V2V A;  4DV3 F;  3IRX B;  2I6W A;  5IQQ A;  3MEG A;  4OI2 A;  4B3S J;  5J2P B;  5CXT A;  4DSF A;  2C2O B;  1RAD B;  3CJ3 A;  4J9L A;  1BGX T;  2QC3 A;  1HPZ A;  2BJE A;  3WC2 A;  3QPI A;  5E41 A;  2HK2 A;  3AD9 C;  1U8W A;  1SPB P;  1UEU A;  2AZ3 A;  1Y10 A;  2C2N A;  2YKO A;  4UZB A;  4NLP A;  4B3T F;  1EP4 A;  1KFS A;  2CNK B;  1T94 A;  4OIX A;  3DCA A;  1NM2 A;  2IY5 B;  3EYZ A;  1YZ7 A;  4ZVQ B;  4KHP F;  1FKO B;  3MHY A;  2DNO A;  5HP1 B;  3UN3 A;  2HQI A;  3M2R A;  2BJ9 A;  3OL6 A;  3FFI B;  3WZ0 A;  1RGV A;  2E5L J;  1GMV A;  2VG7 B;  3T5H A;  1VLO A;  3C8Y A;  1RTI A;  1S9E A;  3FEZ A;  4ZP9 A;  3DLL Q;  2KG1 A;  3QJP A;  1TAQ A;  1U6Z A;  2OMO A;  1KDN A;  3KJF B;  1E6V B;  5ETQ A;  1J5E J;  2P5V A;  4C8M A;  3W7B A;  3BGU A;  5LSR A;  3K5M A;  1T02 A;  4CH1 A;  5KFU A;  1FEH A;  2ASY A;  3QGG A;  2F3J A;  1EIY B;  3A8J A;  3K5N A;  4MJK A;  2V4J A;  4LBH A;  2AQ4 A;  2J6S A;  1TKT B;  2PII A;  2R7U A;  2MQ8 A;  4ZVH A;  1GK8 A;  1VI7 A;  3EVO A;  1RUS A;  2CZ4 A;  1H98 A;  1TVR A;  3LP0 B;  1H7W A;  2KRB A;  2M52 A;  1ICE B;  2N4D A;  2QTW A;  4BWJ A;  2FY8 A;  1RWX B;  1QAJ A;  2JLE A;  3I0S A;  5DO2 A;  2B9E A;  4QU6 A;  4F4A A;  3MAQ A;  5F0W A;  3PR5 B;  4CLY A;  3UWT A;  4Z37 A;  2AKW B;  2LYV A;  4KKO B;  2W8K A;  2LU2 A;  1RE1 B;  4NX9 A;  1UMJ A;  1SH3 A;  5HMY A;  2D7S A;  3BR9 A;  5IM0 B;  4TVA B;  2RH3 A;  2ZIT A;  4FXW A;  2MKY A;  4YOE A;  1T05 B;  1XIQ A;  4DUY F;  1VQL S;  3NBP A;  3NMA A;  5F8I A;  4ZPC A;  2R7Q A;  3GG1 A;  1FRK A;  2QO3 A;  3PFE A;  2NXJ A;  3OUY A;  3R6G B;  1Q8L A;  3EVM A;  4N76 A;  2GMH A;  1D8Z A;  5EX3 A;  3KFW X;  1JNR B;  3P3D A;  3KYL A;  4O3O A;  2LEP A;  4M8L A;  3IXQ A;  4ZVE A;  4OYI A;  4DV1 J;  4KAI A;  2DNK A;  1ZBT A;  4C8Z A;  2ZC3 A;  2RF2 B;  5CAB A;  2ZVI A;  4YR0 A;  3QLH B;  1KRP A;  4OZJ A;  1SQF A;  3V4I A;  2OO4 A;  2F1F A;  3D9B A;  2E1M C;  1HMV B;  4NAS A;  1QUV A;  3AXK A;  2A0F B;  4P10 A;  3OTD A;  2DRD A;  4OYX A;  2B8P A;  2CDR B;  4J9R A;  4DCP B;  1O6X A;  2V50 A;  1FXL A;  3GE9 A;  1P1L A;  4PUO A;  2C3Y A;  2K7K A;  4H4K C;  5A8K A;  2CQC A;  1S12 A;  2RUS A;  2LA4 A;  4PKD B;  4CDI A;  1J5O A;  2FJW A;  3R1H A;  5F8N A;  1HR0 F;  4DI6 A;  5LT5 A;  3POT A;  2DIV A;  3PCO B;  4C11 B;  5K8O A;  3P49 B;  4HH1 A;  4PXC A;  5T7L B;  1XMO J;  2J0W A;  4A8K A;  1R3N A;  3UDL A;  4EZ9 A;  1EB0 A;  4MIW A;  1C2P A;  3EDQ B;  3H4D A;  2CQG A;  2WSF C;  3A13 A;  3BN4 A;  1VQ8 S;  1D0E A;  3QYY A;  2JVO A;  2XHW A;  1FD8 A;  1HBM B;  4ZS6 A;  1SKS A;  2WVB A;  4TXS A;  3GTY X;  4N5S A;  2YWW A;  2VH7 A;  3AB2 B;  4ZLL A;  1Q81 T;  2Z2L A;  1GT8 A;  3MGJ A;  3HHL A;  1UKU A;  3HSZ A;  4DV4 F;  3MCO A;  1MWQ A;  2C2K B;  4IQM A;  3MMJ A;  5I3Q A;  2O5D A;  4RUB A;  4JV5 J;  4LBP A;  2HFN A;  2PC6 A;  4B3M J;  2HVD A;  2K2P A;  1CS4 B;  2KO1 A;  3OTB A;  4P9S A;  4R8U A;  1N48 A;  4M5J A;  3MM5 B;  4OQJ A;  4HLB A;  3FCH A;  1NDP A;  5KFS A;  1DTT A;  4X4O A;  4TY9 A;  4ZP6 A;  2K3I A;  1SIW B;  4EU0 A;  4DX5 A;  5J2N A;  1XWL A;  5IZH A;  9ATC B;  4CNY A;  2UXD F;  4LFC J;  3VAI A;  4ZP8 A;  4OHY A;  4M94 A;  2BQU A;  2DK2 A;  4ZCK A;  4Y65 A;  1KVJ A;  1K1S A;  4MMO A;  4ZKA A;  1I5O B;  3AD8 C;  2J0S D;  3A8I A;  4DX7 A;  1DTQ B;  1WAC A;  4X4U A;  1M90 T;  4N56 A;  2ADB A;  3NOG A;  4AXI A;  4I4B A;  2EW9 A;  1SJF A;  1P27 B;  5ETV A;  4A8W A;  1JLF B;  5I3U A;  4PG4 A;  4ICL B;  4U8Y A;  2HHU A;  4G1Q B;  8AT1 B;  1BC6 A;  4F0H A;  1SV5 A;  5CYM A;  3JAM Y;  4LFB F;  4O3S A;  3PYG A;  3G82 B;  1YG0 A;  4OHX A;  2MZT A;  2E7W A;  3TX8 A;  3MPU B;  4KBI A;  5HVH A;  1Q5Y A;  2UUA F;  3CJ2 A;  3QT6 A;  4DS5 A;  1UP1 A;  3TX0 A;  1KHV A;  4OYW A;  3FZ2 A;  1SXL A;  2E9Z A;  5LL6 d;  2DPI A;  3TUZ C;  3VR1 A;  1FFW B;  2KVI A;  2CIM A;  2WHO A;  2EI5 A;  2G0I A;  4RUA A;  3W1Y C;  4ECW A;  4WZQ A;  3MTJ A;  4WP8 A;  1RWV B;  1JKH A;  1QTM A;  4ZPA A;  2PGC A;  5C2G A;  1WKL A;  1N4L A;  3E01 B;  3DDK A;  1EKS A;  3CC7 S;  2VV5 A;  4WBF A;  5C2C A;  3LP1 A;  2E7V A;  3NGR A;  4CLP A;  2F9D A;  2FGO A;  4KB7 A;  2H5E A;  2W8L A;  5BYS A;  2GX8 A;  1HI0 P;  4CT8 A;  4LSN B;  1KBR A;  1QJH A;  3D7S B;  2DHS A;  2DEJ A;  1HWI A;  2QA2 A;  3TA1 A;  1B7F A;  1QD1 A;  2DR6 A;  4X64 J;  3A3O B;  3KHH A;  1C1C B;  2ZJP Q;  4LF9 F;  4NXM J;  2B3T B;  4UOG A;  3HHK A;  9RUB A;  1AYE A;  4H4O B;  2HFO A;  3GIR A;  5KG5 A;  5HL7 Q;  4NCB A;  3D0H E;  2LEC A;  4LF1 A;  4K8R A;  3HVW A;  4P2M A;  2VOO A;  2V8D A;  4DPY A;  2WRM A;  4O0I A;  1QE1 B;  2B43 A;  1NHK L;  2P2C B;  2ATC B;  3Q83 A;  2MB0 B;  4FXV A;  4FYY B;  1WC0 A;  3H2U B;  3CD6 S;  1HNV B;  2V0N A;  4FDF A;  2CQH A;  2VZ9 A;  2FVR A;  1RWO B;  3DLJ A;  2Z56 B;  3DRS A;  2DT9 A;  4PWW A;  1HNI B;  2HQC A;  2Y3Y A;  2LLZ A;  1REV A;  3OFE A;  3J7A 1;  2IDL A;  1X60 A;  2HHT A;  5H9E J;  2CDQ A;  2CWK A;  4XIU A;  2YKQ A;  2E5G A;  3FMW A;  4HKQ A;  4ZJL A;  4LF6 J;  3CJS A;  5LMN J;  3QT8 A;  4P75 A;  5AXN A;  4ITS A;  2HLT A;  2HIQ A;  1IBL J;  3ZZO A;  3MD3 A;  1JLB A;  1IKY B;  4IYQ A;  5HLF A;  4DWI A;  2KYX A;  4HYK A;  1FRI A;  1OPZ A;  3MCN A;  3VGU A;  2KHD A;  2IC3 A;  2Z2M A;  2ASJ A;  3NGT A;  3CCS S;  4DL5 A;  3PM9 A;  3WX8 A;  4DL2 A;  2KXN B;  1ZAV A;  3FQK A;  3SEO A;  2NZC A;  2UUC J;  4DPX A;  1S1X A;  5KT2 A;  1NJX A;  5G0R B;  4Q0B B;  3B8H A;  4QIF A;  2BZ2 A;  1N36 F;  1RTJ B;  2G2Z A;  1MRO A;  4Q44 A;  2KTQ A;  2PFF B;  4ZCM A;  3CT9 A;  2RHQ B;  3JTO A;  3SSR A;  5DET A;  1X4C A;  3L7P A;  1DQ8 A;  3QIP B;  4ZIV A;  1KOH A;  3QJJ A;  3QID A;  1UZD A;  2CJ9 A;  3FZB A;  3VHQ A;  3OSN A;  2C2Z B;  5C42 A;  1LWE A;  3SDE A;  1N0U A;  4MH8 A;  3K2Y A;  1LV5 A;  4UST A;  1RHQ B;  2N7Y A;  2KL8 A;  1XR5 A;  2FHJ A;  3I82 A;  1VJQ A;  2FGC A;  2EBE A;  4JI2 F;  3CME S;  1FWP A;  5A0Y A;  1R7I A;  4I6W A;  3FCW A;  3K0J A;  1EET A;  3EX7 B;  1HNZ F;  2IIH A;  1BWV A;  2MKC A;  2VAS A;  1HW8 A;  5DZ7 A;  3THT A;  3KLH A;  3MOJ B;  3HHE A;  2RU9 A;  2B4U A;  2VQF F;  2W7O A;  2GQ2 A;  4NLU A;  1FA0 A;  4OLO A;  1S6U A;  5A8W B;  2COL A;  3UCU P;  4CLF A;  3PJX A;  5JVG Q;  1KLN A;  3ZO7 A;  3MUV P;  2PA3 A;  2GCF A;  3MM8 B;  3R5A A;  1Q5V A;  2HZA A;  3DLG B;  1N5S A;  2C3O A;  2WAQ D;  5DG8 A;  3CJ0 A;  3KDO A;  2R8I A;  4PWU A;  2XI2 A;  3VAH A;  4RW6 B;  2L9W A;  2A1B A;  2ACY A;  2GMJ A;  3R6L B;  5EUH A;  4A4J A;  4DL6 A;  2DNM A;  2QEX S;  4PG6 A;  3DI6 A;  2YQ0 A;  4JV0 A;  3OFF A;  3BZQ A;  2KZZ A;  4PEO A;  3BPD A;  1U48 A;  4YB7 A;  2W24 A;  4CO4 A;  3BGF A;  1DY3 A;  2I5J A;  3US5 A;  3BYR A;  4KV8 B;  1WG1 A;  3DYA B;  3RRG A;  2V94 A;  1RT2 B;  4OX7 A;  2BA9 A;  1RA6 A;  5F3T A;  4KE5 A;  4MYU A;  4DDF A;  2DEI A;  2C42 A;  1NKE A;  4ZPW R;  1FDN A;  5D3G A;  1B64 A;  4LSL B;  4O0N A;  4IH5 A;  1LXN A;  4DV7 F;  2HS3 A;  4KC5 A;  4H4M A;  5GAG I;  5FLX U;  2PEB A;  3P45 B;  3GJR B;  1Z4U A;  3LGN A;  4DG1 B;  2P9G A;  3ENW A;  2W01 A;  2BJ8 A;  1U0H A;  2J5A A;  4CCH A;  1G6B A;  4IRK A;  3WHI A;  5CYQ A;  1GTE A;  4HI1 A;  3CCL S;  3PX6 A;  2QLX A;  3W8G A;  2GML A;  3N01 A;  1VDH A;  3MAH A;  1OYE A;  4JB8 B;  2GHP A;  1N32 F;  2OTJ S;  4QIV A;  3QJL A;  4JI5 F;  3KK1 A;  3I5A A;  1RKJ A;  3GIJ A;  3BDE A;  2BUN A;  3AHP A;  1TKZ B;  2C2E A;  2FLN A;  1S57 A;  2HS0 A;  3R9L A;  3PKM A;  4NLY A;  3X3U A;  3V5R A;  4LF5 F;  4WYL A;  2JSX A;  2KRR A;  2H51 B;  4EEY A;  4GO5 X;  4ZLP A;  3CPW R;  1KC8 T;  4RX6 A;  4MK7 A;  2AJQ A;  2KI2 A;  2JHE A;  4M95 A;  3O5T B;  3MUR P;  4AND A;  3C2P A;  2XY6 A;  1RBO B;  2VU5 A;  1IQT A;  3T1H J;  1R89 A;  4IOC Q;  1RT7 A;  3D5M A;  3L4B C;  1X4F A;  2RIL A;  5LJ3 Y;  2BR0 A;  1YI2 S;  5HVF A;  3DOL A;  1AUD A;  3RBZ A;  4RBU A;  2DY1 A;  2AEJ A;  3UE2 A;  4UTG A;  4YY3 J;  2B7C B;  4PR6 A;  4DV5 F;  1XMQ J;  2W9A A;  5I4M A;  2SXL A;  3JSY A;  3VF0 B;  5HAN A;  1S1W A;  3LAK A;  3SCI E;  3KLI A;  2BE7 D;  3I6P A;  2DKO B;  4QR0 A;  3ZTR A;  3IP0 A;  1AB8 A;  3D68 A;  1Y4Z B;  4CTA B;  3W8P A;  1HNW F;  4DV6 F;  1FKP A;  2HBR B;  1S1T A;  1B4S A;  1PO6 A;  2WSC C;  4LF8 J;  4MK8 A;  1FJE B;  3CDE A;  4GVB B;  1CJU B;  3FNN A;  2CPZ A;  1U1Q A;  3SMZ A;  4R0E A;  4ZVS B;  3P96 A;  2BW7 A;  1OO0 B;  2FD2 A;  3K5O A;  5DS7 A;  2C3M A;  2BOA A;  2YQ3 A;  1YRX A;  3QO9 B;  4ZPT R;  1N5T A;  3KUH A;  1JXV A;  2HFS A;  4KTQ A;  3H42 A;  1N34 J;  1VRQ C;  1X4A A;  1LW0 A;  3H90 A;  3BSO A;  5CD4 H;  1TUW A;  2DCU B;  4C48 A;  2Y1J A;  4IDK A;  1QAI A;  2O67 A;  3NS6 A;  4P2X A;  2QGF B;  4FKY A;  3UCG A;  2AHO B;  2ZHB A;  1UFK A;  2IHR 1;  1VQK S;  2J8S A;  4F7V A;  3NG8 A;  1AZS A;  4RPF A;  2VBW A;  4HI2 A;  2GGP B;  4ZHR B;  3M8Q A;  2KT2 A;  2XMU A;  3PR4 A;  5BJR A;  1M1K T;  1SH2 A;  3BO3 A;  1GMU A;  4B9N A;  2UUB J;  2HHQ A;  2ZZM A;  4DS4 A;  3OL7 A;  3R2C J;  2DGX A;  3DRR A;  1A6L A;  1CQN A;  1NK0 A;  3GPA A;  1HHT P;  1KFD A;  1KVK A;  2W4P A;  4CP5 A;  1FNM A;  2XO6 A;  1T9U A;  3J7Z T;  2R7S A;  4KGK A;  2V2Q A;  4O44 A;  1TMM A;  4ETX A;  2KVQ E;  2VQE F;  3V81 A;  3DGV A;  3TI0 A;  2DNY A;  4PPD A;  4A8F A;  2MQL A;  2DB1 A;  2RKI B;  4ED5 A;  1NK9 A;  3MPW A;  4O23 A;  5KFE A;  2UXC J;  1C0U A;  1FVQ A;  1IBC B;  3BGR A;  2JNJ A;  2NS1 B;  4EBD A;  3TJ8 A;  2G4B A;  3BN7 A;  2GAG C;  3M8S A;  5GVQ A;  1E6Y B;  2QMU B;  4M1K A;  2ZD1 B;  5HI7 A;  1SC4 B;  3KTQ A;  3GU0 A;  3E51 A;  4NCG A;  4J90 A;  4OFZ A;  1RAA B;  1B0T A;  3RGI A;  3MAA A;  3CC2 S;  4IFV B;  4TN2 A;  1CBK A;  2V67 A;  4B9T A;  4FVM A;  1HQE A;  2KXH A;  3VAF A;  2CJA A;  4RLE A;  1T9V A;  2WBR A;  4QIW D;  1NHU A;  3LA0 A;  2WB1 D;  4EI2 A;  2MQQ A;  1WG4 A;  3ZZR A;  2JL9 A;  4LVN P;  2DIT A;  3ILI A;  1X4D A;  5HRO B;  1Y3J A;  1TL5 A;  4K4T A;  4C3K A;  2ROE A;  2OEM A;  1AFJ A;  2ACM A;  2I9S A;  4AE5 A;  3CIM A;  1T3N A;  2YNF A;  2AYG A;  2DHA A;  2FLL A;  3AT1 B;  4EK2 A;  3HFZ B;  4FPI A;  3W2W A;  3D3C J;  5KFB A;  3CE8 A;  3IWN C;  4K0K J;  4L74 A;  3UPF A;  1WOO A;  2WVC A;  3QRR A;  2IBK A;  4ZVP B;  3FRZ A;  3SBM A;  4EUV A;  4DHV A;  3Q8Q B;  5E2Q A;  1VK8 A;  3B6B A;  3PAC A;  2V8V A;  1Y0H A;  2HLU A;  1T9X A;  1SJR A;  2VJV A;  3OXF A;  2FVC A;  3PY8 A;  3M6V A;  1IJF B;  3MMC A;  3V6J A;  4C6A A;  3FK4 A;  1T7P A;  2QFI A;  5HMX A;  2CG8 A;  2IM2 A;  2VG5 B;  4LF7 F;  4OHZ A;  7FDR A;  3IAS 9;  3MEG B;  2XSJ B;  1UA1 A;  1FVS A;  2YKN B;  4ED8 A;  1L3V A;  3L95 X;  3GV7 B;  4GKK J;  1N88 A;  1NJI T;  4L73 A;  2RU3 A;  1RLC L;  3PRD A;  1SC3 B;  2UXB F;  1HPZ B;  3QFH A;  3B4D A;  5KG2 A;  4WJB A;  5DG9 A;  1VMB A;  2MHN A;  2WON A;  3PRB A;  2IJF A;  1S4E A;  4NXN J;  1S1V B;  2ZH4 A;  1R8A A;  3MWB A;  4C4W A;  4OV1 A;  3OL9 A;  2VFV A;  1N54 B;  3JQK A;  4KT0 C;  2R8H A;  2M70 A;  3FCV A;  3NWR A;  2GQQ A;  3M2R B;  2EFN A;  3G4S S;  1OY6 A;  2IJN A;  4OX8 A;  3TVK A;  2QMW A;  1Z2Z A;  4I6A A;  1VRT B;  1RU1 A;  4ILL A;  2X51 A;  3DHW C;  2BXJ A;  1U4B A;  4KH1 B;  1VIX A;  2DR5 A;  2GIF A;  3QAT A;  4BHQ A;  1XN9 A;  4H54 A;  5CCM A;  2DGO A;  5D77 A;  3CCE S;  1DJ0 A;  1X9S A;  1TL4 A;  5HAT A;  1KD1 T;  4QJV A;  3M2U B;  4G1P A;  4BBY A;  3MMB A;  3FEY B;  2M8H A;  1U1O A;  4FPR A;  1ZA1 B;  1KQG B;  3T19 A;  3WBZ A;  2ZBP A;  3W5X A;  2EC0 A;  4DN9 A;  2ZZN A;  2AD9 A;  2VG6 B;  3J7A N;  3HHL C;  1BMQ B;  2W2Q P;  4JI3 J;  4KFB A;  3RB6 A;  4YB5 A;  5GME A;  1TVR B;  3AAW B;  4OMF G;  2N82 B;  4URQ U;  1VQ5 S;  4USI A;  1C0T A;  2RRA A;  1JLC B;  3D4J A;  5KG0 A;  3BF4 A;  4U7U D;  3MM7 A;  3RBE A;  2LU1 A;  1SCJ B;  1KLM A;  1LWF B;  1XK8 A;  3GG0 A;  3KHG A;  3CO0 P;  5L46 A;  4DV0 F;  1GX6 A;  4A8M P;  5GMK a;  1R0B G;  2HRT A;  2NR0 A;  1FJG J;  4Y2A A;  1YKW A;  2N3O A;  3BO2 A;  5JJB A;  2DHG A;  1YIT S;  1REG X;  2IDE A;  2DNG A;  2GFF A;  1U47 A;  1O8B A;  1Y11 A;  1RHK B;  1QLN A;  3VVU A;  5D0E A;  4NMX A;  3BKT A;  3LAN A;  2QG9 B;  3PW4 A;  4DR4 F;  1L5U A;  1R0C B;  4QW9 A;  3EUN A;  2BYC A;  3SXL A;  4WXW A;  5KFY A;  1B3T A;  3PZP A;  3BQ1 A;  4CRJ A;  3U7J A;  4K4V A;  4BS2 A;  2UVV A;  1RAH B;  3EGW B;  4K5S A;  5AE1 A;  1V5I B;  4NA3 A;  5G4D A;  2JOQ A;  2BOP A;  3M32 A;  4JI8 J;  3I0R A;  1F2G A;  3CED A;  4BCA A;  1R8B A;  3OD2 A;  3P4U B;  1WI8 A;  3SFG A;  1I51 B;  1D9D A;  3PX4 A;  3KLG A;  2HBZ B;  1S48 A;  1YDL A;  5A8K B;  4RWX A;  4I1T A;  2H54 B;  1UL3 A;  3G6Y A;  3DM2 B;  4UQG A;  1FFS B;  2R7W A;  5K8N A;  4ZCL A;  3RJM B;  2HHS A;  4RR5 A;  3OFG A;  4I2Q B;  1P9Y A;  1Q1K A;  3C6T B;  3EZU A;  2HAF A;  3TAN A;  1B0P A;  1EJ7 L;  3VQT A;  4DSJ A;  1EQ0 A;  2MKJ A;  1TU0 B;  1GXT A;  4WFX A;  1WTF A;  4IH6 A;  4X4Q A;  2E5L F;  4DCJ B;  2MHE A;  2W2M P;  2W9C A;  2GJI A;  2JEJ A;  3HZG A;  3M8P B;  1Q16 B;  3K58 A;  3HHL B;  4DX6 A;  2JEF A;  3UD4 P;  2FIU A;  1S5Z A;  4ZVU B;  3EIC A;  4CLS A;  4URS A;  2VHG A;  1J5E F;  5DGB A;  1P8G A;  2R42 A;  4JI0 J;  5C25 B;  4IKA A;  1GQE A;  1NPR A;  5AT1 B;  3I55 S;  2FJX A;  1DTT B;  5HAO A;  1LWC B;  4TQR A;  4B9S A;  5IT9 Y;  5BYR A;  2L41 A;  1ZPV A;  5J2N B;  3V4M A;  1U02 A;  1WEX A;  2V8G A;  4NLO A;  4QWB A;  1RTH B;  2YPZ A;  1NHV A;  5L8R C;  4LMZ A;  3HO1 A;  5CHC B;  2D41 A;  2BJD A;  2W7A A;  1BQN B;  4PQU B;  3CCJ S;  5GMD A;  3M8Z A;  4WF9 Q;  3DOM A;  1FNO A;  3ENV A;  2CJB A;  1HHS A;  3HT3 A;  5D4P A;  2VPY B;  4WE1 A;  4I7F A;  5I42 B;  3J7Z 5;  5KT5 A;  4UQT A;  1IWA A;  4WU2 A;  4XPC A;  1FT8 A;  1IVZ A;  1SQG A;  5BYQ A;  2FDN A;  2RML A;  3BH7 B;  1AUS L;  3KWM A;  3IM8 A;  4IO1 A;  1CJT B;  3C15 A;  3C3L A;  2UZA A;  1PYT A;  5MLC V;  3FEX B;  2NUH A;  2XEX A;  4J9Q A;  2NRE A;  1R0A A;  2J7K A;  1URR A;  3DRX A;  1Q78 A;  4YME A;  5FLX Y;  4LVO P;  2QLW A;  2F65 A;  2IAJ A;  4DXL A;  3B78 A;  2XGP A;  1QTN B;  1RT1 A;  1KN6 A;  4TYB A;  3AY0 A;  1NSK L;  4ENO A;  5HMZ A;  1TMJ A;  3BDP A;  3IA0 A;  3NGK A;  5DJB A;  3R3T A;  1VBX A;  2PO4 A;  1EX8 A;  2OPS B;  4F36 A;  2E66 A;  4LR9 A;  2NYH A;  1WOR A;  3V6D A;  1SJ3 P;  1YJT A;  2FHK A;  4DBQ A;  3AJ1 A;  1PIE A;  2P6T A;  2O01 C;  3NCP A;  1FTC A;  3LP1 B;  4HAC A;  2AX0 A;  3KK3 A;  3EXY A;  3FC9 A;  1Q0N A;  3O3L A;  5AXM A;  4DFP A;  3GSI A;  1AFI A;  4WKY A;  3DDI A;  5D4O A;  3PEH A;  1JLA A;  1OWX A;  5FJ4 A;  2QT7 A;  2B51 A;  4ZVF A;  2RQM A;  2OHD A;  3M6W A;  3FSI A;  3ZTO A;  4OHV A;  3M8Y A;  3HZE A;  1ZS6 A;  1W25 A;  4QWC A;  2G9O A;  2BX6 A;  4DV3 J;  3MCS A;  1DUR A;  2ASD A;  4N47 A;  4NWB A;  3A4T A;  1RT4 A;  5L1I A;  5A8R A;  1IKW B;  1UCN A;  5FD1 A;  3Q8U A;  1XMO F;  1IBM J;  2KFY A;  3RBD A;  4C0O C;  1FRH A;  2AX1 A;  2W4D A;  2UV8 G;  3BM7 A;  2N3L A;  4WXO A;  1PAE X;  4OZ5 A;  2QIF A;  4C0B A;  1REV B;  2R7X A;  3BBC A;  3RB0 A;  2E5H A;  1FJ7 A;  3MM9 B;  4ZPV R;  3CJ5 A;  4Q43 A;  2AJF E;  3GFX A;  1M1G A;  4KHP J;  2RUG A;  1PYO B;  4J91 A;  2XCP A;  1CJK A;  1V3R A;  3VQS A;  4K4W A;  2ATL A;  4WWS A;  3KG1 A;  3H4B A;  4ZJQ A;  1X4G A;  1U1M A;  2FC9 A;  5K14 A;  2W2O P;  3SQG A;  2GZO A;  4LR7 A;  4JV5 F;  3E8O A;  1YK9 A;  4B3M F;  3N28 A;  1R8P A;  3CD0 A;  5LXY A;  1XC9 A;  2IJR A;  3GMG A;  2UP1 A;  1RAE B;  4QIG A;  2CJY B;  2R4F A;  3W2V A;  2HNZ B;  2DH8 A;  3PHE A;  1PC5 A;  2RD5 C;  2DXD A;  4HT5 A;  2M9K A;  1FK9 A;  4IQX A;  4LFC F;  1ZAW A;  3TZX A;  1MRO B;  3ET6 A;  3HDS A;  2ASL A;  3TJA A;  4HHJ A;  2P9E A;  2XCA A;  4DR2 F;  1HD0 A;  1X9W A;  3GON A;  3PVX A;  2LFV A;  4A47 A;  4ZOS A;  3BR8 A;  3AOD A;  2J0Q D;  2L48 A;  2Y1R I;  3PX0 A;  2YKM A;  1MML A;  4CI0 B;  1HWK A;  4QYZ K;  4B3R F;  4OYP A;  5C42 B;  1C1B A;  4C8N A;  4UUW A;  1I1G A;  1JIH A;  1T3O A;  5KG3 A;  4IG3 A;  2EFV A;  1JK9 B;  2HFV A;  2ZDO A;  4LF2 A;  4DPW A;  2ZOG A;  2AEF A;  1NDK A;  5EWE A;  4DUT A;  2FHJ D;  1EET B;  1XNQ J;  4S0M A;  5B09 A;  1VQ6 S;  4LIW A;  2DIS A;  2AF6 A;  3KLH B;  3ZNU A;  3FBE A;  4WK1 A;  4CO2 A;  4Y3C A;  4YN3 B;  1JQG A;  3BO4 A;  4MFB A;  4Y2M A;  5BR8 J;  3CF5 Q;  3UO0 A;  2K06 A;  4BLG A;  5KOX A;  3IC1 A;  3IBF B;  4DL3 A;  5J2Q B;  3KMQ A;  1IKV A;  1OYD A;  1EAR A;  1NDL A;  1RAJ A;  2Z2Y B;  5EN1 A;  4ZPD A;  3SSS A;  1RP5 A;  3K17 A;  2I2Y A;  2DYA A;  4DQI A;  4F3O A;  1RYR A;  3AOA A;  4HTJ A;  2J6T A;  1R6V A;  4BC9 A;  3A3P B;  3MM6 A;  1FI4 A;  3DMJ B;  3TZY A;  3HCX A;  4DR5 J;  2PMH A;  3N79 A;  4ELT A;  3I9Z A;  1U6B A;  4FVC A;  2NPI A;  3WX4 A;  1WHX A;  3DI6 B;  1XER A;  4ED6 A;  4U67 Q;  2ZH3 A;  4I67 A;  4IG0 A;  4X64 F;  4M5I A;  1KWM A;  1UAW A;  3TZW A;  2WCX A;  4X4R A;  2AGP A;  1UPM B;  4EBE A;  3TWZ A;  2LQB A;  4DSE A;  3M30 B;  2NXE A;  5GAH U;  1FXR A;  1H7X A;  4NI2 A;  3DRP B;  3GIM A;  1T03 B;  3HD1 A;  4WII A;  2OD6 A;  1Q7L B;  3F73 A;  1Y5I B;  5HBM B;  3IRX A;  1HKA A;  2FY1 A;  4XAK A;  4RNM A;  1L3S A;  4USJ C;  2DGW A;  1V5V A;  2V68 A;  5E3C A;  4XTT A;  2HHP A;  1NJW A;  3N5B A;  4RUC A;  3CIZ A;  5E7O B;  2YVS A;  3MPD A;  4H4M B;  4JI1 J;  3FMB A;  1KP6 A;  3TAP A;  2J76 E;  1HR0 J;  1VFJ A;  2F4F A;  2VBZ A;  4OX9 J;  2HHV A;  3T41 A;  2YNH B;  1VRU A;  1KTQ A;  1VOM A;  1FKO A;  1RWP B;  1U2F A;  2JEG A;  5HP1 A;  5EDW A;  5LMN F;  1BLU A;  1M5S A;  5KFM A;  2VG7 A;  1SKU B;  4KJI A;  2OSR A;  3Q0A A;  1IBL F;  1R6Y A;  3A3N B;  4ELV A;  5EX0 A;  1I6J A;  2BAN B;  3GR0 A;  4CLL A;  3DU5 A;  4LR8 A;  1WJ9 A;  4I2P B;  4DV4 J;  3TA0 A;  4ED1 A;  1E6V A;  1VQO S;  2UUC F;  4JUZ A;  1YTY A;  4RNO A;  4DOZ A;  4M5D B;  5K8M A;  3JS9 A;  1FTR A;  3FDS A;  1GAO A;  3HK2 A;  2RSQ A;  5MAO A;  3ULH A;  2DXF A;  3F0N A;  4U7C A;  2MY7 A;  4FZV A;  3RRK A;  3RAX A;  2EK6 A;  2AMC B;  4MAK A;  1VQN S;  1U09 A;  5B0D A;  3MI7 X;  2E7X A;  1NJY A;  3GQC A;  3PTW A;  2P9C A;  4HEA 9;  2OI2 A;  4PCQ A;  1PYS B;  3CCU S;  3QMQ A;  3AFG A;  3V2U C;  3LP0 A;  5J1E B;  1IKX B;  2E5I A;  4UOF A;  5HJY A;  3TP2 A;  3H98 A;  4GC6 A;  3B4M A;  2MKH A;  1RT6 B;  1S1W B;  1PKU A;  1UVM A;  4O3R A;  1G7C B;  4MKB A;  4V19 J;  1FKP B;  1HFE L;  5KAK A;  1S1T B;  2ZH5 A;  5F8G A;  5B0E A;  4IUF A;  4GVL A;  2YNI A;  3CJK B;  4A46 A;  1AT1 B;  1HYS B;  1FES A;  3EXC X;  3ZTP A;  1M0S A;  1S9G B;  5CA5 A;  3NNH A;  1RXO B;  2AJ2 A;  3L3C A;  4JP8 A;  3I5C A;  3GCX P;  4EWT A;  1S6P B;  1JLG A;  4UUX A;  3K7R A;  1W2I A;  4HDG A;  5IM0 A;  1CJV B;  4KO0 B;  2ALY B;  1W26 A;  1WEY A;  1T05 A;  2E29 A;  4PXB A;  4AL5 A;  1LW0 B;  2QE5 A;  2QRR A;  2B9X A;  5E3P A;  1M5V C;  4OZ0 A;  3T9N A;  4IDK B;  4J9V A;  1VIS A;  4X66 J;  5EHH A;  2HFU A;  4KGZ B;  1ROF A;  1DBD A;  5F8J A;  1HAR A;  1V3S A;  3NS5 A;  3MEC A;  1UVN A;  1MN7 A;  3HP6 A;  4WTY A;  2MST A;  5LOQ A;  2UU9 J;  1AZS B;  1WHY A;  3PW5 A;  1X0F A;  1QVF R;  3GV8 B;  2NXU A;  1NME B;  3PO5 A;  5KFW A;  4CIO A;  2OKQ A;  4X65 J;  4F67 A;  3FKB A;  1S6Q A;  3MR7 A;  4CYU B;  3T5J A;  1VC5 A;  4F02 A;  3DRR B;  4TNO A;  1RT3 B;  2W9B A;  2GVD A;  2RE1 A;  2OD4 A;  4TQS A;  1YJ9 S;  2AW0 A;  3RAQ A;  1YVF A;  3W61 A;  4O44 B;  4AT1 B;  1Y9O A;  3VTI A;  3RW7 A;  1WDT A;  2ZVS A;  1K9M T;  2KFN A;  2GS8 A;  4B08 A;  3O44 A;  1JJH A;  3HF5 A;  4C11 A;  5LXR A;  2ROP A;  3NGD A;  4IRC A;  2M5Y A;  5L1J A;  4OZ2 A;  3SCJ E;  2G2O A;  2JVR A;  3NL0 A;  4B3O B;  4WFB Q;  1WF0 A;  3A8E A;  4OYB A;  2MSS A;  2NSB A;  4IFY A;  2B8Q A;  2RQ4 A;  5CD4 A;  2KJV A;  2AP6 A;  3ZZ0 A;  4HTI A;  3UN5 A;  4LRA A;  2VD3 A;  2WK4 A;  2DO4 A;  3HSG A;  5HQM A;  3JXO A;  3NCR A;  3W9J A;  2HMI B;  2IFX A;  5HVG A;  1RKI A;  2R8J A;  2XS5 A;  5K5M A;  3G8S A;  2BKP A;  3DNC A;  2HIY A;  1RAO A;  1G4C A;  3LPE A;  3HMJ G;  5ETL A;  4LSZ B;  3TEG A;  1T0T V;  4M5K A;  4F2S A;  4FKX A;  1CS4 A;  4JI6 F;  1VQ7 S;  1NSQ A;  3MM5 A;  1MG7 A;  4U95 A;  2BE9 B;  3VGT A;  3M9O B;  5DDR C;  2AIR B;  2B4V A;  2VF3 A;  3D6F B;  5M2U A;  1VHF A;  4Y0F A;  1DQ9 A;  2MKS A;  3NOC A;  4IOB A;  3H5Y A;  3IO1 A;  5IQ6 A;  1VC6 A;  4NYP A;  1RWK B;  1CUL B;  1RWM B;  2DVI A;  1N33 J;  1UVK A;  4Z2X A;  4TY8 A;  1FO1 A;  4C0H A;  2VL1 A;  5AXK A;  3OTC A;  2DH9 A;  3IG1 A;  1F9E B;  1RJJ A;  5F9L A;  1TL7 B;  4U8V A;  1PJ7 A;  1OPI A;  3UVJ A;  2BJ7 A;  1QUP A;  1JLF A;  3OJS A;  4ICL A;  2VB6 A;  1JMT A;  3RW6 A;  3ISN C;  4G1Q A;  1MNE A;  4LF8 F;  2K1R B;  1LEO A;  2XM3 A;  2OPQ B;  4LFA J;  3UNY A;  2Y1I A;  4DFM A;  3CCR S;  2LMI A;  1WF2 A;  2RQK A;  1X5T A;  2AYB A;  2F63 A;  1QVG R;  4QBU A;  3G82 A;  4B9L A;  2F7V A;  1SKR A;  2XZW A;  2VKZ G;  1JWW A;  1T9T A;  4EFA C;  3G71 S;  1RWW B;  4N8N A;  1DAX A;  2POK A;  3L7U A;  1N34 F;  3W9I A;  2L08 A;  3H7H B;  1SVD A;  1VC0 A;  1BY9 A;  2QA4 G;  4Q5V A;  2CQP A;  3F56 A;  5KFD A;  5JVH Q;  4NE9 C;  2YKA A;  1SQE A;  4JBC A;  1KHW A;  2I1R A;  3UCZ P;  1B99 A;  3PYD A;  3CDU A;  4OYO A;  3CXC R;  2DNH A;  3C6U A;  5CQG A;  2IM0 A;  2B56 A;  2AZ1 A;  2EWH A;  2GIR A;  4MKV A;  2EG2 A;  1YJN S;  1UW4 A;  2CPX A;  2LKZ A;  1X31 C;  4W98 A;  2RRN A;  2PEH A;  3MFH A;  1RHM B;  2Y9H A;  1F2H A;  2CNL B;  3W65 A;  2FVP A;  1N52 B;  3D66 A;  3OR2 B;  2UUB F;  2QN6 B;  4LSN A;  3IWL A;  2RAQ A;  1FD2 A;  2BVZ A;  2FB0 A;  5HMW A;  1WHV A;  4CWB A;  2LEA A;  3QAU A;  2CPD A;  1C1C A;  1RWN B;  4QQB A;  4AD6 A;  2L3M A;  1KEK A;  2E9R X;  2YNG A;  5U47 A;  3SYZ A;  4V1A k;  3C46 A;  2Z8Q A;  2H5J B;  1MLA A;  2QYG A;  2KU7 A;  3D6M B;  2UXC F;  3PYE A;  5F9N A;  4P52 A;  4DQP A;  2GA7 A;  5KFC A;  1T11 A;  2R2U A;  1S6O A;  1SBR A;  1QE1 A;  2QLJ B;  1S77 D;  4ETZ A;  1RBA A;  4QWA A;  3H5X A;  1WEL A;  2U2F A;  2KN4 A;  1ZTW A;  3OW2 R;  2APO A;  2EVZ A;  3QSY B;  1CLF A;  1UZH A;  2MDA A;  2XY5 A;  1HNI A;  4FNH A;  1F5B A;  3G6V A;  4KFB B;  1FWK A;  2HBY B;  1K44 A;  2HEK A;  2WVE A;  4X4N A;  3KOA A;  1Q4R A;  4OYA A;  4PG8 A;  3HKZ D;  1C0T B;  4M5M A;  4ID5 A;  4DEZ A;  3D28 A;  2XYP B;  3MM7 B;  3OJU A;  4PXE A;  2F5G A;  4OV6 A;  4G6V B;  2AV5 A;  2QX0 A;  2Y8W A;  2V6A A;  1HBU A;  4Q2L A;  2GVZ A;  2XG8 A;  4C8Y A;  1U2C A;  4JI5 J;  4KHM A;  1S7I A;  1IKY A;  1I94 J;  1WTB A;  2BRL A;  1UPP A;  2XQC A;  2EEY A;  4P7V A;  1LK7 A;  3AQO A;  1YJU A;  4K4U A;  2FJB B;  4B9U A;  2OLW A;  3NNC A;  3QNW B;  1JX4 A;  2AT1 B;  3ISN D;  3AD7 C;  4ECS A;  4YHH J;  1HQU A;  4Q0B A;  1WI6 A;  3ADA C;  1S0O A;  4K0K F;  5I3P A;  1ULR A;  3UDV A;  3KHL A;  1G1X A;  4LBI A;  4R5P B;  2N4C A;  3HFV A;  4WP9 A;  2H1Y A;  5ETM A;  1ZH5 A;  3X1L B;  3DLE B;  4L3N A;  3M7V A;  2LDY A;  3QGI A;  3CCM S;  2VON A;  4HL9 A;  4DFJ A;  3IR6 B;  3TR5 A;  1NH8 A;  1TL1 B;  4FS1 A;  3F41 A;  2W4C A;  4OJG A;  4PG5 A;  3AOB A;  3GR1 A;  3AJ2 A;  4GKK F;  3KLG B;  2BQR A;  2FZG B;  3K8W A;  1UET A;  3ETM A;  1NK4 A;  5KFF A;  4F3Q A;  2YWH A;  2XUL A;  1TK8 A;  4NXN F;  1VQ4 S;  4QWE A;  1BXN A;  1SL1 A;  2XY7 A;  2C28 A;  2CVI A;  3MM8 A;  2GHV C;  3DLG A;  2O66 A;  4FS2 A;  2D1C A;  4GC7 A;  4EZ6 A;  4AQY J;  4A8O A;  1UEK A;  2A2D A;  3MUM P;  5E33 A;  2P8I A;  5ETP A;  1XEZ A;  1TUV A;  1HBN B;  2AGO A;  4Y28 C;  3W5Z A;  2XO7 A;  2OGU A;  5RUB A;  1UVI A;  4KV8 A;  2ZH2 A;  4BWM A;  3DYA A;  3CCV S;  1RT2 A;  1CPZ A;  3U1M A;  1VCT A;  2HHH J;  2BRK A;  1PC4 A;  4USH A;  3TVY A;  4YB6 A;  1F60 B;  1UTA A;  3ENA A;  2XYH B;  1S10 A;  1JJ4 A;  4DX8 H;  3I31 A;  3R1L A;  3LGH A;  2DBB A;  2VQE J;  3QWU A;  3UI3 A;  1PJ5 A;  3T9Z A;  2MKK A;  4UZC A;  2CFX A;  5KFI A;  3BSN A;  1F6T A;  4JI3 F;  1VLY A;  4FYV B;  1IBK J;  2BMB A;  2FJV A;  3C14 B;  5HN0 A;  3QSI A;  3IGN A;  3PW7 A;  4NLQ A;  4DG1 A;  3ITH A;  3MPY A;  1T9W A;  3DOM B;  4WTO B;  2IYG A;  2HQ3 A;  2EC2 A;  4P74 A;  2Q66 A;  2LP4 A;  3NLC A;  2J9C A;  3PDN A;  4I7F B;  3CCW A;  4B02 A;  4OJH A;  4HHU A;  3OXL A;  3D0G E;  5L38 A;  3WC0 A;  4CM2 A;  3PW0 A;  4U6P A;  2IPO B;  2HZV A;  3DOK A;  4QYZ J;  2K7J A;  2CQ0 A;  5M2P A;  2ZKU A;  3TAM B;  3EGZ A;  1D9F A;  4P7T A;  3O2I A;  1D09 B;  1HD1 A;  5A6P A;  4LRE A;  1YRT A;  3NRB A;  1RT1 B;  4OI4 A;  2NZ4 A;  4DU7 A;  2PD1 A;  3IR5 B;  3ZXW A;  2EFO A;  4KR0 B;  4AYB D;  2CXE A;  3DLK A;  4F4K A;  2O3D A;  2KM8 C;  3UR0 A;  4WU3 A;  2C2M B;  1DLO A;  4QPX A;  5KFP A;  2H5I B;  4EO6 A;  3BSA A;  2JJ4 D;  3RR8 A;  4M5N A;  2QA1 A;  1T8E A;  3RU0 A;  2XI3 A;  4IO9 Q;  3V6D B;  2R8K A;  5HJX A;  4QR1 A;  1WNE A;  3EZO A;  4J9M A;  5B7W A;  4NRU A;  3Q2T C;  2WZ1 A;  1JXL A;  3KJN B;  1A7G E;  3M1V A;  3MEK A;  2ZE2 B;  2XSF A;  4O3Q A;  1JLQ A;  4NML A;  4NYO A;  3K8V A;  1YJR A;  1IUJ A;  4ZLN A;  4MK9 A;  4DPT A;  1JLA B;  4CTA A;  1FKA F;  3RRH A;  3KLE B;  2FHM A;  3J81 Y;  1IR0 A;  2DNP A;  2DNN A;  5DM6 Q;  2XMV A;  1NJZ A;  4F8R A;  1DFD A;  3W5Y A;  4ZP7 A;  4GVB A;  2XB2 D;  2A2C A;  1U24 A;  5DRK A;  2B9Y A;  2L9D A;  3JTP A;  1N6Q B;  2ZHA A;  3CD7 A;  3T1Y J;  4RW7 B;  1RT4 B;  4ALZ A;  2UUT A;  2GAH C;  2XMM A;  2A10 A;  1ZM9 A;  2GW8 A;  3QO9 A;  4DZD A;  1XNR J;  2FJE B;  3TYT A;  1WWH A;  2HVH A;  5ETN A;  1DRZ A;  3BBB A;  1ZPW X;  3CDW A;  3AH6 A;  2NSC A;  2XMT A;  4L75 A;  1WC3 A;  2CPI A;  3CB4 A;  3MD1 A;  2WBM A;  2HZC A;  3MR5 A;  4EMD A;  2FQQ B;  3R5B A;  4UOC A;  4ECT A;  2WOM A;  3QT7 A;  1DQA A;  1HNX J;  4YDD B;  2JH3 A;  3EVW A;  5CZV A;  3DLH A;  1UJ5 A;  3DC2 A;  2R2R A;  3GYN A;  2G0C A;  2ZC4 A;  4RW8 A;  5B0A A;  4ZHR A;  1ARO P;  3DRY A;  5H9F J;  4TKT A;  4OI0 A;  1TR0 A;  3P5T L;  5K14 B;  2VKR A;  4DR3 F;  4JI0 F;  1OMS A;  2Z4P A;  3KK2 B;  2B0G A;  2JEI A;  3PNI A;  3EMT A;  1HBO A;  1N5Y B;  3CVK A;  5A76 A;  2HGN A;  1IR1 A;  1LFW A;  1GXL A;  3MMA B;  4XDC A;  1HLW A;  2MYF A;  3J80 Y;  3QQC D;  3W2V B;  5AJ3 F;  1NDC A;  1FK9 B;  1TZ0 A;  4YP3 A;  2NCK L;  4IH7 A;  2RKI A;  1F9H A;  1FF2 A;  3FSY A;  3ET6 B;  4XPE A;  4L76 A;  2MLY A;  3B82 A;  1WC6 A;  1HW9 A;  4ZDN A;  4DV2 J;  2WSE C;  4P72 A;  1EHW A;  2I0X A;  5GAE I;  1KQS R;  3FRY A;  2WVF A;  4USK A;  2H48 B;  1C1B B;  5D0H A;  1VQ9 S;  2ADC A;  2I8E A;  3OR1 B;  3KJV A;  2GQC A;  4ES3 A;  3CMQ A;  3EPG A;  5F8L A;  3Q23 A;  2Q1L A;  1FE0 A;  4C7Q A;  4ZCI A;  2W25 A;  1TKX B;  1F3V A;  3H25 A;  4DSK A;  1UWA A;  3SCL E;  5JMN A;  1Y5N B;  1SB6 A;  1U6F A;  3BEG B;  2MLX A;  3THP A;  3WQP A;  2HHW A;  4C3L A;  5ETT A;  1ELO A;  1TL3 A;  1HQ2 A;  1KNZ A;  3I5B A;  4NPO A;  2FC8 A;  4MFB B;  4YFU A;  4NLG A;  2RB7 A;  1VBZ A;  3ZZY A;  3GZ7 A;  3T3F A;  4RJV A;  5B0C A;  2LQJ A;  2M4M A;  3Q8R B;  3N4W A;  1R8C A;  2ZM6 F;  2B9W A;  1VJW A;  2XZD B;  1IKV B;  3UR3 C;  5E3Q A;  1N5Q A;  2HND A;  3T6B A;  3AA8 A;  4FYX B;  3DGP B;  4IR1 A;  1Q86 T;  3BH6 B;  1URN A;  1YQH A;  5LSO A;  1X5P A;  3KG4 A;  4FF3 A;  4DR1 J;  4DQQ A;  2AJ0 A;  2V5H G;  5K8P A;  3GJT B;  4I0W A;  1SJ1 A;  1RTD B;  4NEY A;  3QAE A;  4NEZ A;  2UVR A;  2MZR A;  5FDL B;  1A0O B;  2MQM A;  3ILO A;  2ZH6 A;  2MGZ B;  2D69 A;  1U7L A;  1VK3 A;  2V2Z A;  1O51 A;  2KFZ A;  2XLI A;  3PIP Q;  3LGM A;  2X3D A;  3LP2 B;  1FWL A;  4KQZ A;  4RNH A;  3JSM A;  2J7U A;  3CW2 C;  5KFZ A;  4F25 A;  1DZ5 A;  2XSJ A;  2YKN A;  2DNQ A;  1Y7P A;  2MPU A;  4DSL A;  4LT6 A;  2AYM A;  4BDP A;  3EWG A;  1IBM F;  1FX4 A;  3MEE B;  4PYA A;  2HWT A;  2X3G A;  2DR8 A;  3PIO Q;  1FDA A;  3IS9 B;  3OBI A;  4X62 J;  1BWE A;  1NH7 A;  5KG7 A;  1RU2 A;  4AUK A;  1J2V A;  4OLP A;  3N6N A;  2VA3 A;  6AT1 B;  5D15 A;  1S1V A;  5KFT A;  5IS2 A;  2HQD A;  2QA4 S;  3NGU A;  1PSD A;  1VRU B;  3QRQ A;  4F50 A;  3WIV A;  3PRV A;  3HSD A;  3TW0 A;  3OLA A;  4JYA F;  2E1A A;  4I56 A;  2PMZ D;  1GH8 A;  2F8H A;  3W64 A;  4Y00 A;  2QL7 B;  4C8O A;  4ZVG A;  1NPP A;  1VRT A;  4Q45 A;  3MED B;  4G3I A;  2B4O A;  2B6A A;  3BPS P;  1F1B B;  1TV6 A;  5CZX A;  5KFJ A;  2YTC A;  3JQJ A;  2EG1 A;  2AGQ A;  1Z1Z A;  3RB3 A;  5IFM A;  3FVY A;  2R2T A;  2H4W B;  3O1L A;  3G96 A;  3M2U A;  1PBA A;  1WOP A;  2QL5 B;  5HQL A;  2HAI A;  3M8R A;  2XS7 A;  2P6S A;  5B08 A;  2ILZ A;  1BHN A;  1QY7 A;  2VIC A;  4BC7 A;  2FPH X;  2OP5 A;  2DR7 A;  4DCO B;  3HI9 A;  3BQ0 A;  5DGA A;  2GNK A;  5C7P A;  5C24 A;  5L9X A;  2VG6 A;  1EKR A;  1UFW A;  3SIP B;  4EO8 A;  3GP9 A;  1WDD A;  2CUY A;  5AE2 A;  1CSJ A;  3UD5 A;  3HVR A;  2JZ5 A;  1X4E A;  1LQ9 A;  3OTO J;  1RYS A;  1N0V C;  1JLC A;  1XNQ F;  1LWX A;  4FNI A;  2LDI A;  4LUB A;  3ETO A;  1LWF A;  2QLB B;  4MIA A;  1ZM2 A;  5JXS A;  2YNI B;  3GYG A;  2G2Y A;  5JUM A;  1LOU A;  1RK8 A;  2YWK A;  2DPJ A;  1YJ7 A;  3VZI A;  2NQP A;  5BR8 F;  2Y8Y A;  3C19 A;  2ZJR Q;  2OTL S;  5F0U A;  1JLG B;  4PWD A;  3WDO A;  3NKY A;  5J1P A;  3JYT B;  2BV3 A;  1RDR A;  3PHT A;  3UDC A;  1XR6 A;  1LW2 B;  3KHR A;  3MXH P;  2Y0B B;  1WOS A;  2KZM A;  3Q8Y A;  2XS2 A;  1UWB B;  4FF4 A;  5IV3 A;  4DR5 F;  2D3O R;  4MIB A;  3AXM A;  4RW9 B;  1NEE A;  2DNR A;  2VFU A;  1NBE B;  2CWX A;  2HS4 A;  2VFS A;  1FEE A;  3MEC B;  1P1T A;  4M5L A;  5KFX A;  3JQM A;  2VOP A;  4QOT A;  1WSR A;  4UY8 T;  3VGS A;  5HO4 A;  2MZQ A;  4X4V A;  3PJW A;  1NXI A;  3MUT P;  1WF1 A;  4U96 A;  4CH7 A;  1CC7 A;  3OLB A;  3TZZ A;  3KKF A;  2VC1 A;  5E5N A;  3SI8 A;  1RWU A;  1S6Q B;  2VBY A;  1BUX A;  1EAY C;  2QYC A;  2YH0 A;  2I38 A;  3Q8S B;  3LH2 S;  2W9B B;  2GVD B;  2KKH A;  3M2V B;  2LCW A;  4UW2 A;  2IBO A;  2AYE A;  3DM2 A;  2JLG A;  2PA8 D;  3H20 A;  1B7Y B;  4FBT A;  2ERR A;  2JFK A;  4ECQ A;  4JI1 F;  2ZUG A;  1HA1 A;  4NLD A;  4CQ1 A;  1F3F A;  1TTH B;  5D8H B;  2IRY A;  1MU2 B;  4OX9 F;  4I2Q A;  2XTJ P;  3C6T A;  4YB1 P;  3Q24 A;  1YSJ A;  1JB0 C;  4CH0 S;  3BQ2 A;  1SUQ A;  4OJ3 A;  1KON A;  4IFY B;  3OVB A;  3BBF A;  1HL6 A;  2R9L A;  1U25 A;  3MCM A;  4C2M A;  1ITP A;  1RT5 A;  2J0X A;  2CQD A;  5C5J A;  2VOD A;  4ES1 A;  2OFG X;  3BB5 A;  1ACM B;  4DUZ J;  1T95 A;  1L3T A;  4F0K A;  4F4X A;  4LF4 F;  1SL2 A;  3M8P A;  4XK8 C;  1MWZ A;  1X5O A;  2HG4 A;  1F9F A;  3W66 A;  3QGP A;  1KOO A;  5IT0 A;  3M8W A;  1D3W A;  1DAR A;  2R7R A;  4DFK A;  1EP4 B;  4KRW A;  5C25 A;  1S0N A;  4A8X A;  4GKJ J;  2HVE A;  1YBU A;  4N7T A;  3AOC A;  3HSJ A;  1LWC A;  5E3A A;  2VIH A;  2MEW A;  3I9V 9;  3FJ2 A;  3GLJ A;  1BQX A;  1RTI B;  4U9R A;  3ZZU A;  1S76 D;  1S9E B;  1GMW A;  1W2B R;  5CAA A;  1RTH A;  1Q8K A;  3D6H B;  4TY8 B;  1BQN A;  4PQU A;  4DR2 J;  4USV A;  1KTV A;  1NKC A;  1NSP A;  3IG1 B;  2VUG A;  2Y0S D;  2ZDP A;  3LO3 A;  3LAM A;  3UVJ B;  3AA9 A;  1S1U A;  2W1B A;  2X1B A;  4DR7 F;  2CG4 A;  4B3R J;  4WFA Q;  5IV4 A;  2EPI A;  1U49 A;  2HGM A;  2MQN A;  5I42 A;  1RAI B;  3S8S A;  2XHC A;  4ED0 A;  5IT4 A;  4XO0 A;  5L1L A;  1WG5 A;  2V4J B;  7AT1 B;  3HUL A;  3N0V A;  1WEZ A;  1CJT A;  2RQC A;  2M7S A;  2YWF A;  2LQ5 A;  5DDO C;  1NK6 A;  2E1P A;  5KFQ A;  2X7I A;  2NXN A;  3ILL A;  3UDE A;  4OYZ A;  3R7N B;  1PCA A;  4NA2 A;  4R0J A;  3H5S A;  4HDH A;  4W92 B;  2NXC A;  4X66 F;  2OPS A;  3I0S B;  3C6U B;  1RCO B;  2DGU A;  2ZBI A;  2LQ9 A;  2UU9 F;  1RZM A;  3JSB A;  3OFH A;  4USU A;  4WPA A;  1IM6 A;  1FHT A;  3D0I E;  2B4P A;  4F4Z A;  4JI4 J;  2ZKT A;  4X65 F;  3AJD A;  1H2U X;  2HBQ B;  3AQP A;  3ZFV A;  5L39 A;  4RW4 A;  3T1A A;  4KPY A;  1NK8 A;  1PJ6 A;  4ILM A;  2HHX A;  1Y5L B;  3NBP B;  1RCX B;  1H3D A;  1U26 A;  2RVJ A;  3OUY B;  1BE4 A;  4ANC A;  2LXI A;  2W2N P;  4C97 A;  2YNG B;  4CLK A;  2ZH9 A;  3U27 A;  2C1E B;  1VS3 A;  5CH7 B;  4RKU C;  4UF4 A;  5CYJ A;  3KLF A;  3W62 A;  4RU2 A;  1IKW A;  4WCE Q;  3G6X A;  3V4I B;  4U7U K;  3FBB A;  3CNQ P;  1PAU B;  3MFI A;  4J9K A;  4ECY A;  2DRA A;  1WHW A;  1WD6 A;  2ZNY A;  3HJF A;  2ZOF A;  4B3S F;  4RUH A;  2CQB A;  1YWX A;  3TEH B;  1OY8 A;  3QWP A;  4KPC A;  3MR3 A;  3T6J A;  4P71 A;  4PUO B;  1CG2 A;  1NKB A;  2DGT A;  3L9Z A;  2CA9 A;  2HNY A;  1H38 A;  1ZOT A;  3NMR A;  4ZIT A;  4JV2 A;  5IWA J;  3MM9 A;  3GII A;  2FLP A;  4ID5 B;  1PGZ A;  3GFY A;  4RU9 A;  2DO0 A;  1J5O B;  2JRS A;  2M2B A;  3V6K A;  2GO8 A;  3POT B;  4CLW A;  2LA6 A;  1OSD A;  1KQF B;  4YUD A;  3GCW P;  1NZ8 A;  3QBC A;  5THW A;  3M9M B;  3MDF A;  2Q6B A;  2MZ1 A;  1HBU B;  2GVZ B;  2R7O A;  2CJX B;  5H1S V;  2XMA A;  3MTK A;  5KG6 A;  4Y2C A;  4OZ1 A;  3U1L A;  3H59 A;  4AL7 A;  3C66 A;  2HNZ A;  2IVF B;  2WTF A;  2FUG 9;  3HHD A;  1HQU B;  3HT0 A;  5GAE U;  2J6U A;  3D3B J;  2V8P A;  1MW7 A;  1N33 F;  3G9C A;  4CT9 A;  1UEV A;  1XR7 A;  1FDB A;  2QV6 A;  2DH7 A;  2XMW A;  1NUE A;  2J9D E;  4MYT A;  1FRM A;  2RDI A;  3TAQ A;  3TNV A;  5KT3 A;  2GJ2 A;  4R8U B;  1U2R A;  3CUN A;  3VAG A;  4NYZ A;  1EZZ B;  2IM3 A;  3M6X A;  1Z2L A;  1XMB A;  4LFA F;  2A6M A;  2ZNZ A;  4O3P A;  4ED4 A;  1U1N A;  5GAG U;  5EGY A;  2CKW A;  2PMW A;  4X4T A;  2GHW A;  4WYW A;  1IXK A;  3D67 A;  3EJM A;  4F2R A;  4CO0 A;  2FYX A;  2XLJ A;  3C16 A;  1DHM A;  4CO1 A;  4QU7 A;  2RIJ A;  2RT3 A;  2LXF A;  7FD1 A;  1KQK A;  1FXD A;  3TRG A;  3BRE A;  3KG0 A;  2B5J A;  3E3X A;  1RB0 A;  1YX2 A;  3R7B B;  4DLG A;  2KYZ A;  3BJY A;  5BXI A;  2D3U A;  5LMU J;  5I3U B;  5J2Q A;  4E8U A;  1SV5 B;  5CYM B;  2Q79 A;  2KH9 A;  3MZI A;  4Y34 A;  4ED2 A;  3PW2 A;  3R5G A;  2X1G A;  2RRB A;  3ELH A;  5IT9 U;  4JI7 J;  1YBA A;  3DMJ A;  2CYY A;  4HVZ A;  4L72 B;  1RHJ B;  4DR6 J;  2KT5 A;  3KUG A;  5LJ5 Y;  2EK1 A;  3N9U C;  3FBC A;  3DU6 A;  2CAJ A;  3GWC A;  5DQI A;  4X84 A;  3G8T A;  3JTN A;  2JFD A;  2NYI A;  3RZA A;  4B9M A;  2VJU A;  4M63 A;  3RUB L;  2BE2 A;  3HX9 A;  4YDX A;  1H74 A;  2V9K A;  1LK5 A;  3PO4 A;  3M30 A;  4GO7 X;  1QAY A;  2ZHO A;  2M88 A;  2OAU A;  4DV1 F;  3DRP A;  1T03 A;  4A48 A;  2HW3 A;  2PN6 A;  1U1P A;  5HBM A;  1JKH B;  3JB9 k;  2X1F A;  4A8Q A;  4HT7 A;  1L3K A;  3V6H A;  3R97 A;  5J2M A;  1H73 A;  1KKH A;  5KFV A;  2GJF A;  4DZ6 A;  1TFY A;  3FGV A;  5EWF A;  3VWS A;  2VPW B;  4HHH A;  3PV8 A;  4WZM A;  3TO8 A;  3VCD A;  4UY8 5;  3CCT A;  3W9H A;  1GNK A;  1XQI A;  2FJD B;  1VQM S;  1O0P A;  4Q8F A;  3J7Y I;  3HPO A;  1UJ4 A;  2YNH A;  3HVT A;  4Z7C A;  2F4V J;  3ITH B;  1VR6 A;  3L7O A;  5E0O A;  1N5V A;  1Y3K A;  4O4G A;  5HQ8 A;  2DGV A;  4NZ0 A;  3TVZ A;  3RB4 A;  1WUU A;  3CWJ A;  1AA1 B;  5A6W A;  2OUG A;  2MY8 A;  3DDN A;  3EM1 A;  4NLV A;  1L3U A;  4ZA1 A;  3SSQ A;  2GC8 A;  2XZT B;  3T5L A;  1I94 F;  2BAN A;  3DOK B;  5ADZ A;  4K7Q A;  2BAC A;  3KLV A;  2R7V A;  4I2P A;  4CLT A;  1S97 A;  3DRS B;  2VFR A;  4DL0 C;  1YHQ S;  4ELU A;  4G1I A;  2EFP A;  2BEF A;  4B3T J;  4YHH F;  4M5D A;  2CQ1 A;  4C8K A;  4JI6 J;  4YR3 A;  3DLK B;  2LXU A;  2CPJ A;  2CNO B;  2GIQ A;  4CLU A;  1DLO B;  2OPP A;  2VDI A;  2VPZ B;  4NRT A;  5D4L A;  2E5J A;  2ZH8 A;  4WK3 A;  4AXJ A;  2PT0 A;  1JLB B;  5HLF B;  4OZN A;  3CO9 A;  2V4R A;  5HK4 A;  4CZC A;  2IC3 B;  2WVD A;  5J1E A;  1IKX A;  3M1V B;  4ANE A;  2IA0 A;  3QGH A;  1JLQ B;  2KT3 A;  4PAB A;  1RT6 A;  1S1X B;  1G3O A;  3ZNJ 1;  5DM7 Q;  2F40 A;  3BV8 A;  1O5J A;  2XNR A;  3ZZT A;  1TUG B;  5KFL A;  4FYD A;  2OH2 A;  4NLT A;  1LFP A;  3CJK A;  1C4C A;  1UJ6 A;  1HYS A;  4W90 B;  2OFH X;  4Z7Y A;  1S9G A;  2CJK A;  1V6H A;  3K57 A;  2CNN B;  1XJW B;  4ZN1 A;  1S6P A;  1N8R T;  1LWE B;  3SDE B;  1BQM A;  4DF8 A;  1CJV A;  4KO0 A;  3NWG A;  4EGL A;  4JOU A;  4DJB A;  1Q95 G;  2BJ1 A;  3OHA A;  5A0Y B;  3CJR A;  3DHX A;  3DXS X;  5DLF A;  4MKA A;  3BKU A;  3RYL A;  2YX4 A;  2JWN A;  4AQY F;  4CLZ A;  2FVQ A;  2WOM B;  3NGS A;  4TU8 A;  3IBW A;  8ATC B;  1Q79 A;  4O3N A;  1HWU A;  4ZLJ A;  2OJ3 A;  2FVS A;  1M5K C;  1ZAX A;  4RW8 B;  4IRD A;  3IN5 A;  1Q53 A;  4ECX A;  3MPV A;  3TAR A;  3BS9 A;  1EQM A;  2FLO A;  1V3Z A;  4USM A;  3Q89 A;  2HHH F;  4CYU A;  4YR2 A;  1HBO B;  1Q8I A;  2GO9 A;  4QWD A;  4DUY J;  1RT3 A;  2OPR A;  2Z30 B;  3KMS A;  2HUR A;  4WFZ A;  1M5H A;  1IQZ A;  2JDJ A;  3CC4 S;  1JLE A;  1X7V A;  4A8S A;  3P5B P;  1RLD A;  2LEB A;  2V2K A;  5SUH A;  2RJZ A;  2MMY A;  4KHR A;  4ILR A;  2HK3 A;  2D3O 1;  3QZ8 A;  1IBK F;  3NP5 A;  2R3V A;  3HKW A;  2I5J B;  3U02 A;  1OIA A;  4NXM F;  4DMZ A;  3GFH A;  4B3O A;  4PAA A;  2D3Z A;  2HPU A;  2XMJ A;  2C3U A;  1NK5 A;  5KFN A;  3I96 A;  1Q8B A;  4ZMM A;  1RHR B;  1H2T Z;  1ZET A;  2OEK A;  5J2P A;  4KGV B;  1KSP A;  3KJV B;  3JSR A;  2HMI A;  2YQ1 A;  4B9V A;  2Q3P A;  4KY3 A;  5D3G B;  3N6M A;  2RNE A;  6FDR A;  2BBE A;  3KJQ B;  4OI6 A;  3NXZ A;  4FBU A;  1TAU A;  3SV3 A;  2ZOM A;  3VZH A;  5H9F K;  4QZV B;  3W60 A;  2MJN A;  3EZ5 A;  1TL3 B;  2NLW A;  4ZN3 A;  2VPX B;  2BQ3 A;  1NO8 A;  1NB7 A;  3SFU A;  1U0H B;  4LF6 F;  5T41 A;  5CYQ B;  4DPO A;  3TA2 A;  3A1Y G;  3FFI A;  2YY3 A;  1A9N B;  4NLX A;  4AFF A;  3UFC X;  4M5G A;  3MR2 A;  2HND B;  1HI8 A;  3KK1 B;  3K5P A;  3Q86 A;  4I64 A;  3LUY A;  1CUL A;  4N77 A;  5IOL A;  4QCL A;  5ITH A;  2HVZ A;  3PG9 A;  3Q8P B;  1KR4 A;  1TL7 A;  1ZTT A;  1PBU A;  4IOA Q;  2WW4 A;  4F0M A;  3GV5 B;  2CZV C;  2HFZ A;  2K1R A;  1X4H A;  2OPQ A;  4OYM A;  2ILY A;  2HQF A;  2XC9 A;  4ID8 A;  2ZBC A;  3T1Y F;  2AJ4 A;  2ZH7 A;  1RT7 B;  4YS2 A;  1VQP S;  3JSM B;  2BKO A;  3DOL B;  1B0V A;  2JC0 A;  5ETK A;  4GMK A;  2UXD J;  2ZUA A;  3GFZ A;  1RTZ A;  3EGN A;  5GAH I;  1TKT A;  3SZ2 A;  1CVJ A;  1S0M A;  3D54 A;  3K59 A;  2RDJ A;  4KH0 B;  2QFJ A;  1XNR F;  2PDA A;  4F3M A;  1FNX H;  4PQA A;  1K0T A;  3R27 A;  3KDN A;  3OL8 A;  1PIL A;  4NZ6 A;  4ZPB A;  3HHN B;  3KLI B;  5SZT A;  1HNX F;  3L09 A;  1VHI A;  1OS5 A;  2HWI A;  1JJ2 R;  3HVA A;  2X1A A;  3HFK A;  2PI4 A;  3EE3 A;  2AJ1 A;  3SV4 A;  4OJ1 A;  2CJQ A;  4LFB J;  4P73 A;  4KKO A;  4LRD A;  4X4P A;  4PYD A;  2KG0 A;  2G1H A;  2XWY A;  2V4Q A;  3OR2 A;  4RBV A;  1MWY A;  3HXM A;  2HVI A;  4WKR A;  3CGI A;  4TLR A;  1RBL A;  3EPI A;  1FX2 A;  2A3J A;  3D6T B;  3H5U A;  2UUA J;  1WC5 A;  2B6A B;  1TV6 B;  1X0P A;  4NA1 A;  4R25 A;  2JX2 A;  3TQE A;  1TP7 A;  4AL6 A;  2WB4 A;  4WFY A;  3RG6 A;  4LRC A;  2MZJ A;  1Y00 A;  2Z57 B;  2RF2 A;  3QLH A;  3OPK A;  3H0P A;  4P2F A;  3T5K A;  4URG A;  3M8Q B;  1GX5 A;  5KT6 A;  4DV2 F;  3H2V E;  4FF2 A;  1HMV A;  4RNN A;  3G8Q A;  5KFR A;  4C98 A;  4J9U E;  1FFG B;  1S4F A;  5C24 B;  2IM1 A;  2XLK A;  3Q2S C;  2F8M A;  3MF5 A;  2BKN A;  3ZTS A;  3D1Q A;  1P6T A;  4PG7 A;  1Q82 T;  1K8A T;  3CTR A;  4LF9 J;  5A2Q U;  2CQI A;  4G65 A;  2B7B B;  4ED3 A;  3V81 B;  1I3O B;  4N8O A;  3CJ4 A;  4LQ9 A;  4OZ3 A;  3QRP A;  2JC1 A;  5KOW A;  1U1K A;  1C0U B;  4TLQ A;  2EBG A;  3R5C A;  1S49 A;  3BGR B;  5DQG A;  2V8H A;  1TK0 A;  2XWX A;  5T7L A;  4LRB A;  3OVS A;  3VAK A;  4ED7 A;  4E98 A;  1ZA2 B;  1RHU B;  1H72 C;  4NCG B;  5HSP A;  4PWD B;  4FYW B;  8RUC A;  3UD3 P;  2H65 B;  1TKD A;  3FBF A;  1R8H A;  3KXD A;  5F8M A;  2QSF A;  3MOZ A;  1H0H B;  2OIH A;  2AWZ A;  3MAA B;  1YBT A;  1ZM3 A;  3O8W A;  3WIU A;  2CPY A;  2BM1 A;  4Y6I A;  1HBM A;  3R8Y A;  4D3G A;  1HQE B;  1QSL A;  4ZJO A;  1X5S A;  1GFW B;  2E44 A;  2CPH A;  5DLG A;  1NCL A;  4DR1 F;  5ETO A;  1SJQ A;  4FN5 A;  3PEJ A;  1U0S A;  4Y2K A;  4R5P A;  4K4Z A;  4J9S A;  3BGO P;  1K47 A;  2C2D A;  4WFN Q;  1LNQ A;  4LIR A;  3H8Y A;  4UOH A;  3VV2 B;  3F44 A;  2ZWP A;  3DLE A;  4KGM A;  3G2X A;  1IM4 A;  3OTE A;  2KHC A;  2IMW P;  2R8G A;  1ZZN A;  1Q7Y T;  2ROG A;  3IGV A;  3T1H F;  1F5C A;  3RTV A;  1ZM4 A;  1FE4 A;  1JXE A;  2IRX A;  1NB2 A;  2HKE A;  1TL1 A;  2YNF B;  1UW9 A;  3VVT A;  1VYA A;  4OI1 A;  3ZZP A;  3NY0 A;  3VAJ A;  4F4W A;  3GYX B;  1YZ6 A;  2E9T A;  1F5A A;  1MMN A;  3W2W B;  2IYI A;  4YY3 F;  1S7H A;  3UW1 A;  1HI1 A;  1NLK L;  1N36 J;  1XMQ F;  3LF0 A;  2VC0 A;  4KGX B;  4X62 F;  2QMX A;  1DTQ A;  1QSY A;  1K0V A;  3GIK A;  3IBC B;  3ENQ A;  2PE8 A;  3AB4 B;  5T14 A;  3MMC B;  3QZ7 A;  3P6Y C;  4N41 A;  1SUQ B;  3NCQ A;  4JI2 J;  1RQ0 A;  5J1N A;  3NAI A;  3I56 S;  4MT1 A;  5GAD I;  4QYR A;  3I32 A;  1UA0 A;  3BSC A;  1OQ3 A;  2MQO A;  4RO0 A;  1JJC B;  2VDH A;  1RT5 B;  1AW0 A;  1M1H A;  2XNQ A;  2E1R A;  4K4S A;  1T9Y A;  1HNZ J;  1QM9 A;  1XBW A;  2DGQ A;  3CJ8 A;  3OT9 A;  2VQF J;  1HBN A;  5DZ6 A;  3S6E A;  4YEA A;  2WON B;  2N7C A;  4NLW A;  3D1H A;  4H4K A;  4DR3 J;  3HHL D;  4NOH A;  1WKJ A;  4X2B A;  4J37 A;  3K5L A;  4LQ3 A;  1YJV A;  1IWG A;  1YGY A;  2KDO A;  2DR9 A;  2MZS A;  2MJU A;  3E01 A;  3ONQ A;  2CAD A;  3ZZZ A;  2J8A A;  2Y1L B;  3CDB A;  2Z58 B;  5AJ3 J;  1QSS A;  3J7Y U;  4Q8E A;  2O1P A;  2ALZ A;  3NS7 B;  2DHH A;  1SI9 A;  1R31 A;  4J9O A;  4PPZ A;  1B70 B;  3C14 A;  3ILJ A;  2DXE A;  2GV1 A;  2AU0 A;  5B0G A;  3CCZ A;  3ZTQ A;  2LQ8 A;  1GMW D;  3OTO F;  4ECR A;  2NUU G;  4TU7 A;  1AXQ A;  4H4O A;  4XDD A;  2D9P A;  2IVM A;  4HH0 A;  4A8Y A;  2W7P A;  3P8B B;  1K73 T;  1S1U B;  3CSK A;  3PKY A;  2CZ9 A;  2DHX A;  1SH0 A;  3B54 A;  3EDR B;  2ZEJ A;  3MMB B;  2CQ3 A;  2H9Z A;  1D1U A;  1APS A;  4QR2 A;  4Y2I A;  1VIO A;  2OSQ A;  3PYF A;  2Q6C A;  3PXG a;  4C8L A;  1CEZ A;  1FRX A;  1HNV A;  3ISZ A;  4F26 A;  3QT5 A;  1QDU B;  1XTZ A;  3M9N B;  3G87 A;  2HSE B;  1SIZ A;  5DDQ C;  5DQH A;  3S1T A;  4DV7 J;  3TAM A;  3OSP A;  2XGQ A;  3TUP A;  3NAH A;  2BW2 A;  5AXL A;  3IM9 A;  2PSZ A;  4GRS A;  2QZ8 A;  2H3E B;  3A8K A;  5AE3 A;  1YIJ S;  2RS2 A;  2K8G A;  1FDD A;  2ZBR A;  3IFE A;  2D9O A;  3N5F A;  5EWG A;  1KLM B;  2ZM6 J;  2F8E X;  3VAM A;  3K89 A;  2CVE A;  4CNZ A;  2HGL A;  1LKZ A;  1N32 J;  3CD5 A;  3UNG C;  1S0V A;  3LOU A;  2XMK A;  5KTQ A;  2HQG A;  2R2S A;  2OEJ A;  2ZH1 A;  1NND A;  4RNF A;  4KSE B;  2QJ3 A;  5FII A;  3ZC4 A;  2CPF A;  5E3R A;  2ZE2 A;  4RW4 B;  4D3H A;  4W4M A;  4K59 A;  4LF5 J;  5G0R A;  1PG5 B;  4EYI B;  2D74 B;  4F04 B;  2IA6 A;  1RTJ A;  3RR7 A;  2C3P A;  3KLE A;  3RAM A;  1ZYQ A;  3R7S B;  5IC6 B;  2BJ3 A;  2YPY A;  3QFW A;  3QIP A;  2VFT A;  1MN9 A;  4NL5 A;  1HWJ A;  4Q7A A;  1N6Q A;  3U1N A;  4RW7 A;  5B0B A;  5KFK A;  2XYG B;  2BDP A;  4LJM A;  2Q43 A;  3KLF B;  3KNA A;  1TQL A;  4FXD A;  1J27 A;  3H40 A;  3UQS A;  4ES2 A;  1WC4 A;  4DV5 J;  2U1A A;  4C9D A;  4F4Y A;  4DPU A;  3RBX A;  4LRF A;  3M32 B;  3I0R B;  1U1R A;  3SQO P;  1X8D A;  4YQW A;  3VGV A;  3KNG A;  1HNW J;  2RS8 A;  4J9N A;  4DV6 J;  4J5O A;  1H2V Z;  4DUZ F;  2L9N A;  2BAB A;  1X4B A;  3TUJ C;  2HNY B;  3M05 A;  3LAL A;  3VAL A;  3PJ9 A;  5K20 B;  2Z0G A;  4JYA J;  2ZJQ Q;  4WP3 A;  4ERD A;  3IRW P;  1CQM A;  3DKD A;  3IWX A;  5A8W A;  1MSW D;  1M5P C;  4DQR A;  3R5D A;  3M4X A;  3OHB A;  2MKI A;  4GKJ F;  3KK2 A;  2YH1 A;  4PRF A;  4M5H A;  2BM0 A;  2DCL A;  3PFO A;  1N5Y A;  4NCA A;  1RAC B;  1RSC A;  6FD1 A;  3MMA A;  1CC8 A;  4ATN A;  4EYH B;  2EFG A;  4E2F B;  3GSD A;  4DSI A;  2R7T A;  4RW6 A;  2YKP A;  3IAM 9;  3FUY A;  2DGS A;  5F8H A;  1ZZF A;  4Q2M A;  1WC1 A;  3HJV A;  2W9C B;  2MTL A;  2M0G B;  4CM0 A;  1JNZ B;  4NLS A;  5KFA A;  1S99 A;  2QLF B;  5B0F A;  5F41 A;  1RAF B;  4K4X A;  1SC1 B;  2HRU A;  2DD8 S;  1SKW A;  4J7C A;  1R27 B;  4RBT A;  2CQ4 A;  1W7W A;  2C2R A;  4I6Y A;  1UFL A;  2RHS B;  4TYA A;  4ZVT B;  3MR6 A;  3LWM A;  2V69 A;  3OR1 A;  3JAM U;  2DNZ A;  4RZR A;  2V63 A;  3CUL A;  4O4R A;  2CQ2 A;  5H9E K;  1VBY A;  4LSL A;  3FSX A;  1TKX A;  3DLB A;  1TFW A;  2Z2Z A;  3LQV A;  1D9A A;  3C16 B;  2XBP A;  5L1K A;  5KFH A;  5D6G A;  1IJE B;  4J9P A;  4MTP A;  1RI7 A;  3DN9 A;  5LSL A;  5IC4 B;  3S01 A;  4KIA A;  1OJ4 A;  5KT4 A;  3D2W A;  2B5J B;  5KG1 A;  1OSC A;  1S59 A;  4ZVO B;  4K50 A;  2J9D A;  3GJQ B;  2YWE A;  2QL9 B;  4ECU A;  3GJS B;  1VBK A;  3SCK E;  1RAG B;  1HWL A;  4WE1 B;  5IXU A;  4EBC A;  4DF4 A;  2EKY A;  1FRJ A;  3THV A;  1FJG F;  1TK5 A;  4WIQ A;  1FCA A;  3O6Q A;  1FRL A;  3OQ2 A;  3UN2 A;  4JI4 F;  3DGP A;  1VQS A;  1NAQ A;  3I4P A;  3TOQ A;  1TKZ A;  4TU9 A;  1S9F A;  3C15 B;  2KXF A;  1H6K X;  1R0A B;  3ICL A;  4OX6 A;  1GXU A;  1YRU A;  2VA2 A;  3Q22 A;  1MMD A;  1RTD A;  2IAJ B;  3D1O A;  1M5O C;  4L6V 3;  2E1C A;  1IN0 A;  1SC6 A;  4RL1 A;  1R43 A;  3LW5 C;  3H2L A;  2EXU A;  2BE2 B;  5FDL A;  5M2R A;  2CRL A;  2A6O A;  4PXD A;  2YX1 A;  2MGZ A;  3IR7 B;  1S72 S;  2DIU A;  5ETR A;  2HWH A;  3LP2 A;  3OVA A;  1SJ4 P;  2KJW A;  2CPE A;  5KFO A;  3HLU A;  4L3K A;  1LXJ A;  1IR2 A;  4DL7 A;  4ER8 A;  2UUW A;  3G86 A;  2V9W A;  3CJT A;  3MEE A;  5J2M B;  3W3S A;  4HAC B;  2J9E A;  3IS9 A; 
#chains in the Genus database with same CATH homology
 2B8Q A;  3NGR A;  3FCV A;  2CWK A;  3BBC A;  1EHW A;  5C7P A;  1HHQ A;  4W98 A;  1NUE A;  3NGU A;  1XQI A;  3BH6 B;  3B6B A;  4HR2 A;  1NCL A;  1MN7 A;  3BBF A;  1WKK A;  1K44 A;  3ELH A;  3Q86 A;  3GP9 A;  1NPK A;  3EVW A;  4UOF A;  3PRV A;  4KPC A;  5IOL A;  2DXE A;  3EE3 A;  3NGS A;  3ZTQ A;  3FC9 A;  3ZTR A;  1NSP A;  3ZTS A;  3FCW A;  1PKU A;  3VGS A;  3FBC A;  2B8P A;  3VGV A;  4C6A A;  4F4A A;  3DDI A;  1B4S A;  1NDK A;  4UOH A;  1W7W A;  1S5Z A;  4UOG A;  3EIC A;  1LEO A;  4DUT A;  4ANE A;  1LWX A;  1KDN A;  3FKB A;  3G2X A;  4S0M A;  1S57 A;  3BH7 B;  2HVD A;  3GPA A;  3R9L A;  3VGU A;  1HIY A;  3B54 A;  3PJ9 A;  4CP5 A;  3NGT A;  1BUX A;  3ZTO A;  3EM1 A;  3EMT A;  3WX8 A;  1NDP A;  1ZS6 A;  3EJM A;  3FBE A;  3Q89 A;  3ZTP A;  1BE4 A;  1NB2 A;  3DKD A;  1XIQ A;  4ANC A;  4FKX A;  2BX6 A;  4DI6 A;  1HLW A;  3VVT A;  1VYA A;  1NHK L;  3Q83 A;  1JXV A;  1NSQ A;  2HVE A;  1U8W A;  3JS9 A;  2HUR A;  3L7U A;  4O0N A;  2DXD A;  2AZ3 A;  3VGT A;  1UCN A;  3ETM A;  3VVU A;  3Q8V A;  3ENA A;  3Q8U A;  1WKJ A;  1NSK L;  2ZUA A;  4ENO A;  3EVM A;  1NLK L;  1NDC A;  4AND A;  2DXF A;  2BEF A;  2VU5 A;  1MN9 A;  3MPD A;  2NCK L;  3FBF A;  4F36 A;  1NDL A;  4EK2 A;  1S59 A;  1B99 A;  4FKY A;  5BXI A;  1F3F A;  3BBB A;  2DY9 A;  2DYA A;  3FBB A;  1BHN A;  4DZ6 A;  3EVO A;  1WKL A;  1F6T A;  5CAB A;  2AZ1 A;  1PAE X;  3Q8Y A;  5CAA A;  4WBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...