4Y2KA

Reduced form of apo-golb
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
GMQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights and the Surprisingly Low Mechanical Stability of the Au-S Bond in the Gold-Specific Protein GolB
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Metal transport
molecule keywords Putative metal-binding transport protein
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y2kA00
2QIFA 2K7JA 3IWXA 1FE4A 2Q3PA 1S6UA 2L3MA 1CPZA 2HFNA 2VV5A 1YJTA 1FESA 3BDEA 1WD6A 2ZDPA 3BN7A 4U9RA 2KT2A 1FVSA 3HDSA 3E8OA 4EFAC 3TRGA 5B0BA 3UDCA 2LDIA 4FNIA 2OFHX 4A4JA 2RMLA 1Q8LA 2GO8A 2PD1A 2ROEA 4OIXA 3MCSA 1FVQA 1MWYA 1CC8A 1ULRA 2ROPA 1GXTA 1YRXA 5KAKA 3HHLB 5IXUA 1X0PA 4F67A 2AJ1A 1KVIA 3FGVA 4Y2KA 2HLUA 1SB6A 1SI9A 3GZ7A 5B0FA 2FTRA 2GGPA 1VQSA 3DCAA 1R6YA 2BBEA 4QOTA 1OPZA 2RILA 1FEEA 2IFXA 2XMJA 5B09A 2W4PA 5F0WA 5B0AA 4DPOA 2OD6A 1APSA 4Q2MA 2HIQA 2ZDOA 1KQKA 1AFJA 4NPOA 1FD8A 1AW0A 4HI1A 2BJEA 2IYGA 2HLTA 2QLWA 3QMQA 4OJ3A 1YJUA 1VQYA 4Y2MA 2XMTA 2OFGX 4YEAA 4ZA1A 1Q8BA 2OMOA 2RSQA 5A6PA 2LQ9A 3HF5A 1X8DA 1XBWA 5A6WA 1KVJA 1YJRA 2EW9A 2K2PA 5K9FA 5T7LB 2VH7A 2BJDA 4HH0A 1Y9OA 1CC7A 2XMVA 2BUNA 2CRLA 2ROGA 2XMWA 4OJHA 3WDOA 2ACYA 2XMKA 3BM7A 4DL0C 2FHMA 3KKFA 2KT3A 4A46A 1SQEA 2IYIA 3HX9A 1TL5A 3MZIA 3TOQA 5B08A 1GXUA 1Y3JA 4Q2LA 3KG0A 3KNGA 1TZ0A 3KG1A 1JK9B 1FE0A 4OJGA 2W4DA 1Q53A 1TUVA 4HL9A 4DN9A 1IUJA 4FNHA 2BYCA 2LXFA 1N5TA 2XMUA 4ZOSA 3DXSX 3FMBA 2N7YA 2FIUA 2RU9A 5B0GA 2FB0A 3BF4A 2ASYA 1Y0HA 4A47A 4OJ1A 2KKHA 2OD4A 2OP5A 1YJVA 1URRA 1TL4A 2N4DA 2QLXA 2QYCA 4YDXA 1AFIA 3CJKA 4A48A 3QGPA 1S6OA 2GV1A 2HFOA 3HHLC 2AP6A 3HHLA 1N5VA 1N5SA 2PGCA 2OAUA 3IWLA 2XMMA 5F0UA 2OKQA 5B0CA 5B0DA 1K0VA 2JDJA 2GGPB 2LQBA 1N5QA 3LGNA 1V3ZA 2N4CA 3FRYA 1MWZA 3T9NA 3TNVA 1Y3KA 2GA7A 3I9ZA 1QUPA 1P6TA 2AW0A 2HQIA 1W2IA 3HFKA 1TR0A 3LGMA 1X7VA 4NL5A 2W4CA 1OQ6A 4HI2A 5B0EA 1YG0A 1LQ9A 1RJJA 3K7RA 1OSDA 3LO3A 1JWWA 3HHLD 4HH1A 3BB5A 3VTIA 1Q4RA 2GFFA 2K1RA 2K1RB 1OQ3A 2GCFA 2AJ0A 1P8GA 1U7LA 2KYZA 2G9OA 3BGUA 3BR8A 3F44A 4Y2IA 3CJKB 5T7LA 2K7KA
chains in the Genus database with same CATH superfamily
1NK9A 4KC5A 3J81U 1U8WA 1FE4A 3DDKA 3ISND 2HFNA 4NRTA 2WTFA 4P2MA 3CF5Q 2RKIB 2MQOA 1Q5VA 1SJQA 1AA1B 4CO1A 1VRUB 1F5CA 3QO9B 4EFAC 3H2LA 2XQCA 2HHHF 3TX0A 2UUTA 4ANEA 4J9RA 3MCOA 2XCAA 2ERRA 1R8CA 1S1WA 1REVA 1VCTA 3CJ3A 3PYDA 4RW6A 1HNIB 2FYXA 4OIXA 4U67Q 4JI8J 2GIQA 2UV8A 4H4KA 1IQTA 4LQ3A 2NXJA 3H20A 3TUPA 5KAKA 4C3KA 2ZH2A 4E2FB 4K2XA 1ZTWA 3GIRA 3J7A1 5AE3A 3PYGA 2RU3A 2VFRA 3POTB 2YKNB 4J9UE 4CNYA 2W9AA 2FVPA 2V9KA 4MYTA 4ZPVR 3SSQA 1RAAB 1REGX 2KZMA 2O01C 1IKWA 3HJVA 3DXBA 1RADB 3GYXB 3N0VA 1SC4B 4I67A 2G2ZA 5BR8F 3GLJA 2L9DA 2ZDOA 2DR5A 2DBBA 3BH7B 5ETQA 3I56S 1AFJA 1JKHA 2ZC3A 1FFWB 4NCGA 4DPWA 3F0NA 4ZVEA 3KHHA 2QLWA 1DQAA 4NLTA 4TN2A 5HK4A 3M8SA 2AZ1A 4C3MA 5GVQA 4LR8A 4DR6J 4RR5A 5KG3A 1SJRA 2DHSA 1I1GA 3ILOA 3QJLA 4KKOA 4V19X 1X8DA 3DRRB 3SCKE 4UOCA 4FF2A 1M1HA 1LW2B 1DLOA 2FHJD 4OI1A 2V2ZA 2HNZB 3ICLA 1RT7A 2V8DA 3AA9A 1S9EB 2G0JA 2ZZTA 4OI2A 2RQCA 3GFZA 3LP0A 1TKDA 3P45B 1KLNA 3FKBA 2UUCJ 3MAHA 1SJFA 3L7PA 2R8JA 4PQUB 1YRTA 5A2QU 2HVHA 1HQEA 2IYIA 4IOBA 3H98A 1U49A 2DNKA 1URNA 4CCHA 5HROB 2B3TB 2UUAF 4R5PA 1Z2ZA 3CJ2A 2E1AA 4W4MA 4ZPCA 5GAEU 2MY8A 1U0HB 3JSYA 5J2NB 1VISA 1TK8A 5E3QA 1PKUA 1UPPA 2V2QA 1X5TA 3Q8VA 3Q86A 4N8NA 4F3QA 2FJBB 3AXMA 4CT9A 3MMAB 3CO0P 3AJ1A 3OR1A 2RJZA 4DQQA 3EGNA 4PXDA 2Z56B 4C0BA 4C7QA 2CQIA 5GAGI 3OUYB 1SKSA 4WJBA 1KHVA 2DHAA 1IM6A 4XAKA 1FXLA 4Y0FA 3CB4A 1HNZJ 3OSPA 4M94A 1RLDA 1JLCA 3C15B 2UVUA 2BRLA 5SUHA 2DR6A 5D0EA 4IQXA 2CG4A 3HSZA 3M05A 2UUBJ 1UEUA 5ADZA 3F73A 4PABA 3X1LB 1WI6A 2JDJA 4DS4A 4XPEA 2RS2A 4J90A 1S48A 4HTJA 1VQOS 4OL8A 3NS5A 3SEOA 1S6PB 3Q2SC 1HPZB 1NJZA 3TO8A 1NJXA 4RKUC 3MEEB 4NZ6A 4USIA 5DZ6A 3PKYA 2EXUA 1SIZA 2IM2A 2NZCA 2QLJB 3C16A 3LA0A 4LBIA 3BJYA 4CLPA 2QMUB 4OX6A 2V63A 3C6UA 3OHAA 1OQ6A 3TW0A 3PIPQ 5FD1A 3BEGB 1IBKF 1S6QB 2CWKA 3OTOF 2V8GA 3PJWA 1KOHA 1PJ5A 1YKWA 4X62F 4EZ9A 3NGKA 2JC0A 5HJYA 3EPIA 3VGTA 1S0NA 2FLLA 5A76A 4ED4A 4W92B 1X5OA 3Q8UA 5IM0B 3MMBA 4IFYB 2QIFA 3IGNA 1JKHB 4B9SA 1LEOA 1QTNB 1C1CB 4OX7A 2XLIA 3I5AA 4XTTA 2L3MA 4DR4J 1T95A 4HHHA 3MECA 1Z1ZA 2LA6A 3QLHA 2BRKA 4ZHRA 3OVSA 1IKWB 3JYTA 3U1MA 4CYUB 2W7AA 2I2YA 2E7VA 3MR3A 3R8YA 2BA9A 2FJAB 1RWOB 1YRUA 4ZS6A 4PRFA 4X4VA 3R5JB 1UEVA 2HPUA 3CCZA 5KFTA 1I94J 2WSEC 4M5KA 4GKKF 2DEIA 2H1YA 4TU8A 3D0IE 1SBRA 3HD1A 4F67A 1T05A 2HVDA 3NWRA 3R97A 2RUGA 3M2RA 4X66F 1SB6A 2XHWA 2OTLS 3ISNC 1EJ7L 3K2YA 2BM0A 3DHXA 2XB2D 2G0CA 4K4YA 1I6JA 3E51A 3TI0A 4OHYA 2CVIA 3K8WA 4FYXB 1OPZA 3VCDA 1NEEA 4DV7J 1JXLA 4I56A 2OPSB 1C4AA 2C3MA 2KHDA 3M30B 1RBOB 4ZJOA 2D3ZA 4JV2A 2CPHA 1S1VA 1OYEA 3Q2TC 3JTPA 2HQCA 1RTDA 2MJNA 3RJMB 4Y2MA 3AD8C 3PNIA 4FF4A 3D7SB 3T41A 4FS1A 1GTEA 1NPRA 3VZHA 1EETB 2F8HA 3PRDA 2H4YB 1FXRA 2HBRB 1R0BG 1SC1B 1ROFA 2MLXA 2VU5A 1CQMA 3GR1A 4PG7A 4A8XA 4DFMA 1MU2B 2MKCA 1S4EA 2AV5A 2BZ2A 2ZJPQ 2PDAA 3J7AN 2VONA 2HQDA 4ZIVA 5DQIA 1U0HA 3K17A 4LF5F 4GKJF 4ZN3A 3C46A 4M8LA 2VD3A 2KT3A 2DH8A 2W2NP 3D66A 1ZOTA 2VG6A 4UQGA 5FDLB 4PWUA 5C2GA 3LAKA 4K4TA 3CDWA 3H4DA 1VQNS 2BANA 3JS9A 4TU9A 4ZK7M 2LXUA 4LVOP 4N5SA 2F63A 3FNNA 3T5HA 4DSJA 4G65A 5CAAA 1KSPA 1KLMA 3BSCA 5CHCB 2AYMA 1MG7A 5I3PA 3TEGA 2V6AA 4B17A 3BSNA 3H2VE 1CBKA 1S10A 4DN9A 2AYEA 2H48B 3TUIC 1IR0A 2KXHA 4UOGA 1S49A 5AXNA 3OLAA 1QAIA 1OIAA 3IAM9 3DN9A 4P7VA 4EK2A 2LXIA 3G8SA 2FB0A 3QYYA 3VAGA 4TQRA 2JLFA 2UXCJ 2CQ2A 2J5AA 3NMRA 5KFHA 2MLZA 4ENOA 1UFKA 4DX7A 2C28A 1WDDA 3ZTPA 4A48A 1Y5IB 3QGPA 1NO8A 2COLA 5DGBA 1WG5A 2YWWA 1NLKL 1RE1B 1WJ9A 1R43A 2XMMA 2E1RA 3OXLA 4J9SA 1K0VA 2GJFA 3H90A 3RBZA 2HYIB 2BANB 5DQHA 1VQ7S 2JFKA 2GMHA 4IRCA 1S0VA 1HNVB 4CDIA 1FJGJ 1YTYA 3MR2A 5LMUF 1U1KA 2Y3YA 5M2UA 1UVMA 1ZBTA 2WW4A 4ECSA 2DT9A 1LFWA 3N28A 3MECB 5DRKA 2FJWA 2BV3A 3MPWA 3PCOB 1HNVA 5D0RA 2IA0A 2ZOGA 4Y6IA 3H4BA 4ED8A 4P2FA 2G1HA 4DV5J 4RW8A 1RJJA 5RUBA 3M8WA 2Q79A 3DM2B 3BQ0A 2VPWB 4NLRA 2OPQB 1RTJB 3FCHA 4PZVA 1UJ5A 2NXUA 1GX6A 4ZVOB 5LT5A 3DLLQ 2G9OA 4ZLJA 3UR0A 3LP2A 1LW2A 2UXBJ 4LF1A 1WHXA 3DHWC 3KJFB 4B9VA 4JUZA 3US5A 1AUDA 3MOJB 3LP1A 5J1EA 2DR7A 5LM7E 2CADA 4YDDB 3TUZC 5KT3A 1D9FA 4EEYA 2DPJA 1IVZA 1FESA 5EUHA 3G4SS 5DDQC 5HMXA 1M1GA 4JI5F 1TL7B 4CT8A 2ALZA 2R7SA 2CQ1A 3SDEB 5ETLA 4URGA 1HL6A 5KFBA 4C11B 4XPCA 2M7SA 5KFJA 4A4JA 2ATCB 5CD4A 1ZZFA 2GS8A 2KO1A 4AD6A 2W8LA 1SH3A 3B4DA 3Q83A 1LW0B 2EPIA 3RTVA 2E7XA 5ETTA 1RT2B 2Y1LB 3A12A 3PX4A 4QW8A 1BQNB 3ZZYA 3VQTA 4LSNA 3OJUA 3AOBA 3BN4A 3PTWA 3SCIE 5H9FJ 1R6YA 3HFZB 2XLJA 4DV3F 4EYHB 5D4OA 1RAFB 4N76A 4NLPA 4FKYA 2X1GA 3LALA 3CCLS 2R7VA 1QVGR 2L9NA 1X31C 1CULA 2B5JA 4HACB 5JUMA 1FRIA 2OI2A 4PWDA 2B8PA 1AW0A 3ENAA 2J76E 3BGFA 1VRTB 4QIVA 5KT5A 1KP6A 3IBFB 1CJVB 2CPZA 3DRSB 3PJ9A 3UDLA 3EUNA 2DRAA 1B0VA 1KFDA 4WTOB 3FBBA 1ZS6A 4IOAQ 1FEHA 5G0RA 1WDTA 4YOEA 3QIDA 1ELOA 5BXIA 3RBDA 5L1KA 1RP5A 5DM7Q 4PQUA 2A2DA 2BJDA 2G13A 5JXSA 2C42A 1RT5A 1V5VA 1K8AT 1IBLF 5HAOA 1EARA 1QLNA 1RTHA 2DHGA 1NK6A 4USMA 3QSYB 4TVAB 2W1BA 5F8GA 3PV8A 1U47A 2HS4A 1TFWA 2A18A 2F65A 4RX6A 1U1QA 3UDVA 4CLYA 4PXCA 2MKSA 1KNZA 4IDKA 2HRTA 2KL8A 3L7OA 4LRBA 5KFNA 2E29A 5A8WA 4B3RJ 2Y0SD 2W2MP 3I0SA 3M6WA 4P73A 4DR2F 1IKYA 4DLEA 5CXTA 4B9MA 4ZN1A 4DCOB 3HMJG 1YDLA 1L3UA 4JOUA 3AHPA 3NY0A 3QFWA 1GNKA 4OZ1A 4RLEA 4IH5A 4O3NA 4B3OB 2VOPA 1UWBB 1K0TA 5DDOC 2GVDB 4LIWA 4JI2F 4HEA9 2LFVA 3QGHA 1NK7A 1WTBA 4JV0A 3FDSA 1HYSB 2QYGA 2YKNA 2RDDA 5BYRA 2F4FA 2GV1A 3K5LA 3M8ZA 3GWCA 4NYOA 1U2RA 3MMJA 2CQ0A 4CH1A 2BJ3A 4DR1F 3JSRA 2H5JB 2POKA 3H7HB 5A8RB 1R3NA 1C0UB 4ZVTB 1Q81T 3O6QA 1QJHA 2R8HA 4KRWA 3LP2B 3MPDA 3W60A 3FRYA 1MWZA 1GMVA 1JNZB 2ACMA 1VFJA 2JOQA 3TNVA 1LWEB 3GV7B 1JLEB 3W64A 3DGVA 1SJ3P 4I2QA 4L73A 2OEKA 5HSPA 4X64F 3LWLA 1E6VB 4LR9A 5KT2A 1UFLA 2AYBA 4J91A 4B3MJ 2B6AB 2BEFA 1OSDA 3IAS9 3NAIA 3PRVA 4IOCQ 3MTKA 3MM6B 4FYDA 2AJ2A 2KDOA 3G86A 3CPWR 1D9DA 3R2DJ 2CJBA 3KTQA 5GAHI 4ED7A 1WACA 3CCWA 5D78A 2CQ3A 4EI2A 1Q8KA 3J7YU 4O3SA 1R31A 3ENWA 4DV7F 4ED0A 3IWXA 3IG1A 4KE5A 1YBTA 2OPRA 3NS7B 2ZHAA 4WBFA 2RF2A 2KM8B 4F3OA 4CLKA 4HDGA 1H98A 3AB4B 3I4PA 2XY6A 1PYTA 1C1BB 4Q8EA 4ICLA 3W1YC 1UPMB 3DNCA 3CDUA 4X4PA 1TVRB 2DPIA 3RB6A 1F2HA 3M8PA 1FX4A 2IVFB 1S1TA 4A8WA 2QG9B 5J2QA 1FT8A 1EP4A 1RWWB 3TA0A 2OFHX 4F25A 2HBYB 4ZVPB 4Q5VA 3M1VA 2E5HA 1NCLA 4QIEA 4J7CA 4URQU 1KOOA 3CCQS 4RUCA 2HNDB 1RWMB 4F4KA 1U26A 4HTIA 5DZ7A 4JI7F 1UA1A 1Z2LA 1W2BR 3PKMA 2HW3A 4ZITA 1JLBA 5F9LA 4RW6B 4GMKA 2MQQA 1BE4A 2FY1A 3UCZP 1IKVA 3CD6S 1JNRB 2Z0GA 5IV3A 3QO9A 1RABB 4YFUA 4DUYJ 4CM2A 3H5XA 3MD1A 2MZ1A 2HQGA 2LCWA 4OI3A 2BJ8A 2RILA 3Q0AA 1IR1A 1CVJA 2X1BA 2LQJA 2PT0A 2Q6CA 4GO5X 4ZLPA 2HFVA 1RUSA 2PA8D 2F40A 4WP3A 3EPGA 1YHQS 4PG8A 2JHEA 1DJ0A 2YNGB 5U47A 3HPOA 3QT6A 2F4VJ 4DV2F 3RRHA 2WZ1A 3GCXP 1Q8BA 4O3RA 2HKEA 3J7Z5 1ZM4A 4NCGB 4ZVGA 4LFBJ 5D77A 3W5ZA 1M5SA 3HP6A 2VOOA 3HKZD 5K20B 3D67A 3KG4A 1JB0C 2EW9A 3IXQA 3TAPA 1QSLA 3GCWP 1Y5NB 3UNGC 2CAJA 1YWXA 3K8VA 4DOZA 1MMLA 3KLHA 3QJJA 4ECVA 1ZETA 2QL7B 2UVWA 3NWGA 4QWCA 1ZA2B 2FHMA 3K5PA 2QZ8A 1EHWA 1FWKA 2YWKA 3TX8A 4KFBB 2ZBQA 3M6VA 1Q0NA 2Z30B 3TJ8A 3PY8A 2UUAJ 3GQCA 2J8SA 3LP0B 3CD7A 5C24A 4L3KA 4X4NA 4LBPA 5CCMA 5J2PA 1K73T 1D0EA 1TUWA 4OYXA 3QAUA 4RNHA 1B0PA 1RXOB 1S1WB 4IH7A 3MPYA 4P2XA 3G71S 4A8YA 4F4YA 3PEJA 1ITPA 1XN9A 1XWLA 4KT0C 3IBWA 4UUWA 5K8OA 2JLGA 2UUCF 2V9WA 5IT9Y 1CJTA 2X3DA 3CJ8A 3D0HE 1HBOA 4HHJA 1FKAF 2YX1A 4UY85 1JLFA 3GFHA 4OJ1A 2V94A 3HJFA 2BKNA 4K5RA 1NB7A 1OWXA 2OD4A 3SQGB 3PO4A 1NPKA 3CJKA 3R7NB 1B99A 1UJ4A 4AL7A 3MXHP 1AFIA 4ZVUB 5DETA 4X65F 3N79A 3VVUA 1JLAA 2GQ2A 4KB7A 3NOGA 5ETPA 1T9WA 5FLXU 1TKZB 3SFGA 1DBDA 3ZTQA 1IXKA 2DHHA 2JZ5A 4EGLA 3N6NA 4P2SA 2L9WA 4QIGA 1S57A 3J7ZT 4J9KA 3W9HA 1XNRJ 1JLQA 1G1XA 3W3SA 2HNYA 4B3TF 1NM2A 2R7OA 1BQXA 1P6TA 2W01A 1RAEB 2BJ7A 4LRFA 3W2WB 1GAOA 1FCAA 1RHKB 3UDEA 4TYBA 3NRBA 2V0NA 4DZDA 2HGLA 2HHPA 3I5BA 4O23A 4DSIA 5E3CA 3K7RA 1Q79A 4DSKA 1NRKA 4NLXA 1S7HA 4X62J 4JI8F 1N33F 4QWEA 1R0AA 3BH6B 3FSXA 7FDRA 2O3DA 4U8YA 5DG9A 3OTOJ 3KK1A 2ZZMA 1D9AA 1RAIB 3F44A 2VPXB 5D8HB 4X84A 1NAQA 4K4XA 4M5GA 1LWCA 2DR8A 2NZ4A 2HFSA 1NBEB 2WVDA 2KB2A 1SJ4P 3NBPA 5CCLA 4DLGA 5F8MA 1RWPB 2M8HA 2F8MA 1GQEA 5LJ3Y 3V81A 1U4BA 2K06A 3O8WA 2HQ3A 2VV5A 2Z2ZA 5BJRA 2YPYA 3GFYA 1WD6A 1WG4A 3IMQJ 4K5SA 1DTQB 4ZP8A 1UFWA 1Q8IA 1GMWD 2RT3A 1HWKA 5DJBA 1IKXB 4WYLA 4RU2A 4YHHF 2R7QA 4FNIA 4RZRA 4FXDA 2F8EX 2RRNA 2C2MB 2MTLA 4LFAF 4PCQA 1PGZA 1GXTA 2FHOB 4R0EA 2OLWA 2AJ1A 2LLZA 1U2FA 2ABYA 2EFQA 3UD4P 5IT0A 1UP1A 1FRKA 4NXNF 2GGPA 4I7FB 2GVDA 4FPRA 2FLNA 4F2RA 4P71A 1CG2A 1R6VA 3IGVA 4G1QA 5KG1A 4IR1A 4LRDA 4WKYA 2W4PA 1APSA 4DCPB 2EWHA 1QUVA 3DOMB 4QR0A 4RU9A 3V6DB 2M5YA 2A2CA 3IR7B 3JSBA 2BJEA 4A8MP 4EZ6A 2HS0A 2ZJQQ 2VBXA 1LWXA 2HNZA 3OTEA 4K4SA 4J9PA 1VQ9S 2WVFA 1FK9B 1B3TA 3AD9C 3WBZA 2DNQA 4YB1P 4ECUA 3CMES 3KJNB 4HKQA 4QU7A 1VJWA 2LEAA 2OO4A 4IG0A 4KKOB 4P7TA 3R5DA 4RWWA 3H0PA 5HL7Q 4ATNA 3OW2R 1M5OC 5I3QA 1IKVB 3W65A 3PW2A 2YBVA 1E6VA 2BX6A 3CC4S 1M5VC 4ID5B 4LF6J 3OXGA 1N32J 1EQMA 2R2SA 1OSCA 2AD9A 2Y0BB 3CGIA 4K7QA 4NEZA 1WC3A 3W62A 3W8PA 2AQ4A 2RRBA 4TY9A 2FQQB 4NLQA 4F0HA 3EGZA 2MZSA 3GE9A 2V2VA 3TOQA 2MB0B 1OJ4A 1GXUA 4Q2LA 5J2QB 4CLUA 1WELA 5F41A 4ZVRB 3VQSA 5E41A 1HR0F 2EC0A 1FRMA 1CEZA 3HHKA 3HO1A 1M5HA 4H54A 4USTA 3EZUA 3FEYB 3HHEA 2KFYA 1Q53A 4MFBA 3FCVA 1CULB 3TUJC 3PO5A 3AAWB 2WSCC 3DOLB 2QA2A 3D1OA 4CLWA 1K9MT 3ZNUA 3NGDA 1QM9A 4DUYF 1Y00A 3G82A 3OBIA 1F9EB 2I8EA 2P9EA 3SQGA 1FFSB 2HSEB 4LSNB 3S8SA 4DR1J 3T5KA 1S6QA 2RQ4A 2A6OA 3OJSA 2A3JA 1DQ8A 1T3OA 2PGCA 2GHPA 5F0UA 1YZ6A 2BVZA 5E3RA 5L8RC 3FMWA 1OS5A 2EI5A 3OTDA 1V3ZA 3VGUA 3AJ2A 1FRLA 1IBLJ 2LU2A 3UD3P 3MPUB 2W2PP 4MAKA 3RR7A 1R0AB 1Y3KA 4ZP6A 1RT6B 3QGGA 4L75A 2AW0A 3N01A 4K2JA 4N47A 2FVSA 3M6UA 1R8PA 1H72C 3J81Y 3VALA 2J0XA 2W4CA 3QRQA 3DDIA 2Q43A 1OYDA 2YKOA 1A0OB 1MN9A 1RZMA 4FVCA 3D4JA 2V34A 4Q45A 1DRZA 4YUDA 3TVKA 1ZAXA 3R7SB 4LF8J 2V2KA 5E3AA 4ZPDA 2XMAA 3FFIA 3E01B 5AT1B 4QBUA 1CLFA 1BLUA 1F60B 1RHQB 2MQPA 3HHNB 3VGVA 2JEIA 3VAJA 3U1NA 4J9QA 3NGSA 2XS5A 4O44B 4O3OA 4C2MA 4FDFA 2CQBA 3U27A 2AU0A 4WXOA 5CD4H 1JLQB 2VJVA 2PEBA 3CTRA 3SSSA 5JMNA 4DF8A 1UTAA 4JYAF 1CQNA 2QLBB 3BPDA 4K59A 2RMLA 4JI1F 1UVJA 4LF7J 3PACA 3HXMA 5ETKA 4C0OC 3Q8RB 1U25A 2ROPA 2DYAA 5D15A 4J9LA 5D4NA 4JI0J 2ZNZA 1B70B 1M5PC 4D3HA 1RHMB 3FGVA 5F3ZA 1T9VA 2HLUA 4H4OA 1S97A 1N34J 2W25A 1RYSA 4WIQA 1RTDB 2I1RA 4C4WA 3V6HA 1TL7A 2XZWA 1RAGB 3CDEA 2BBEA 5EHHA 2DR9A 2A1BA 4KAIA 3NG8A 1U09A 3BGLA 5EWFA 4FP9A 3O3LA 2NXCA 3P5TL 2YX7A 5GAGU 1WHVA 3ZNJ1 1WKLA 1HBOB 2LVWA 5GMKa 1XC9A 1Q82T 5KFMA 4Q2MA 5L1JA 4ZP7A 3TAMB 3AT1B 4F4AA 4LMZA 5I4MA 2E9TA 4FYWB 4KV8A 2HLTA 2CQHA 3C14A 2KU7A 3TANA 4PUOA 4H4OB 4AXJA 2VBWA 1HNXJ 2YY3A 1C1BA 2JFDA 1VQ8S 1NPPA 2CJ9A 3R5BA 2D3OR 2X1FA 4NXMF 2OSQA 2KJWA 2NSBA 5A6WA 1HBUA 3IS9B 1YJRA 3AXKA 3Q8YA 5HQMA 4I6WA 4ED3A 3UN5A 1X4BA 2N3OA 4HT5A 4RNFA 2MSTA 3BBFA 4HH0A 2KG1A 2ZJRQ 1N6QA 4W90B 2XY5A 4F0KA 4GC6A 1S1XB 1DY3A 5I42A 3VAMA 3VR1A 3RZAA 2MKYA 1RB0A 2Y8YA 2YPZA 3TVZA 4GO7X 4O4RA 4AXIA 1Q78A 3KHRA 2WVEA 4WPAA 1F5AA 3THTA 4DV5F 4V1Ak 3SFUA 1JLEA 3GB0A 3TR5A 3OTBA 1SKWA 4UOFA 2HFUA 1EKRA 1YIJS 4FPIA 2ZC4A 1BMQB 4NMXA 2I5JB 2E66A 2OMLA 4Y65A 4YR2A 1BHNA 4ZOSA 4OZNA 4NMLA 3LW5C 2CNOB 2N7YA 3C6UB 1FDDA 3ETOA 2HHQA 5KG2A 4AYBD 1UCNA 4QWDA 2VFTA 1SC6A 3HVTB 1WHWA 2VKZG 5D4PA 2XI2A 2HK3A 3DI6A 4I0WA 1RAHB 2N4DA 2GJ2A 3GG0A 3FVYA 4YDXA 4B08A 2HHSA 1AZSB 1HQUB 1FX2A 2XSFA 4EO8A 4O44A 3PZPA 3PW0A 4USKA 1VC6A 1XERA 4C3LA 4RUAA 2C2RA 2VASA 3H5SA 1VYAA 2DXDA 2GQCA 2V67A 3KUHA 1RA7A 3LGNA 4F4XA 5DGAA 2C2OB 4MMOA 5LJ5Y 3OTCA 2W24A 4K8RA 5DLGA 2E5JA 4WKRA 3QPIA 3PW7A 2DIVA 4YB5A 1FO1A 2H51B 3OQ2A 3PDNA 2WK4A 4I6YA 4KQZA 3FBFA 5T41A 3T6BA 4QYZJ 3LUYA 1RTIB 1N36J 3NNHA 3VGSA 4KHPF 3GU0A 2EBGA 4M5DB 2OSRA 4JI0F 4LVNP 2KRBA 2XHCA 3MAAA 3W2VB 5HO4A 4F4WA 1NSKL 4I2QB 4BWMA 4OYMA 3HHLD 3MMBB 1RTHB 4RPFA 4ZCLA 1H7WA 3CJ5A 4KGKA 2BJ1A 2K1RA 4CI0B 2GCFA 4JYAJ 2L41A 1RK8A 3UFCX 3MM6A 1JX4A 4GKJJ 1KTQA 1WG1A 2WBRA 1FRXA 4CWBA 5CZVA 4WZMA 2CZ9A 5KOXA 3UPFA 1ZZNA 3M30A 2WW8A 1V3RA 3DRPB 3SCLE 3PFOA 1CS4A 4DF4A 4ZPAA 1YJTA 2CPXA 3BDEA 5EWGA 3CNQP 2HHVA 5A2QY 2GO9A 1DAXA 4ID5A 2BE7D 2XNQA 3E8OA 3GV8B 5B0BA 4LF8F 1OMSA 1YI2S 2ZWOA 3AODA 3IR6B 2M8DB 5FDLA 1C0UA 1SL2A 1UAWA 2XYHB 3G6VA 3UCUP 2X1AA 3M2VA 4A8SA 5HP1A 2AEJA 4DBQA 4JV5J 1X0PA 3X3UA 2CJQA 3T1YJ 3N5BA 1D8ZA 3KJQB 4Z2XA 2FDNA 2NS1B 3IS9A 3DCAA 3GILA 4FVMA 5I3UB 2XMJA 3RR8A 3EE3A 5F0WA 2BE2B 3PHEA 3CCVS 5L1LA 5AXLA 2MDAA 3PW5A 1ZA1B 3UO0A 5CA5A 1RT5B 2E7WA 2ZH7A 2DGTA 1NK0A 1IBKJ 3OHBA 2CFXA 3H42A 1MMDA 2RSQA 1HHSA 1S9GA 2AEMA 1TKTB 2QGFB 3PRBA 3NEKA 3FRZA 2M0GB 3UVJA 3R1HA 3AQOA 4IO1A 1H2UX 2J6TA 1H74A 2V4JB 2ALYB 5GADU 4BC9A 4DUZF 5D3GB 2GC8A 3BYRA 1RT3B 3FZBA 5LSLA 4UZBA 3IR5B 3RGIA 3BSOA 2BUNA 2CRLA 2YVSA 1DTQA 2DH7A 4Y28C 1J27A 2ZWPA 6AT1B 1WF2A 3KXDA 3IN5A 1S6PA 3FUYA 1S0MA 4MJKA 1X4GA 3EGVA 4DL5A 1FXDA 1QD1A 2WB4A 2VF3A 1WORA 3DRYA 4G1QB 2B4OA 3RB4A 3M7VA 5LMNF 4ELUA 3JSMB 2QX0A 1AYEA 4CTAA 2R2UA 2X7IA 4ECQA 4KIAA 1YJ7A 1RHJB 3JAMU 1BY9A 2B7CB 2YH1A 2HMIB 3MEGB 2EFVA 5KFAA 4NX9A 4CO0A 2CQCA 4DV1J 1X5PA 2DXEA 3JTOA 2N7CA 1P27B 2HGMA 3FFIB 1NKEA 1T94A 4HYKA 2FIUA 2NYHA 3M9OB 1QAYA 3MCMA 1EKSA 2BW2A 2ASYA 1Y0HA 3MOZA 4OHVA 4PAAA 5DS7A 1B0TA 1VQ6S 2M52A 2WAQD 2XYPB 3HZGA 3W61A 4ITSA 1RCXB 3MM8B 4F7VA 3V81B 1YITS 1HNZF 1FD2A 3PG9A 1X0FA 4TYAA 1SXLA 1SV5A 1RT4A 2AJFE 2K3IA 1HBNA 3QT7A 3WX8A 4HLBA 3ZZRA 4ECRA 4ELVA 1TV6B 3F41A 3QZ7A 3D2WA 4DV4J 1T9TA 3VAIA 1FWPA 3CC2S 4F04B 3CCSS 1RTZA 4DV1F 1IJEB 1V3SA 3T9NA 1LXJA 1HI0P 2KI2A 5EDWA 4LIRA 2HWTA 3DM2A 2AJ4A 1N4LA 2SXLA 2DD8S 5CQGA 2ZBCA 4FZVA 3MM7B 4NL5A 1S99A 1TKXA 2NXNA 3W7BA 2XO6A 3V6JA 3C66A 3P96A 4OYBA 4TY8A 2WBMA 3G6XA 3CEDA 3IO1A 4LFCJ 3SV3A 3DU5A 3RUBL 1N33J 3UWTA 2RVJA 4BLGA 3ISZA 3PX6A 4Y2IA 1RHUB 2HURA 1TMJA 1GMUA 2CNLB 2CUYA 3G82B 2FUG9 3PYFA 2VL1A 3W5YA 4ZJQA 5EGYA 3CMAS 3TZZA 1YVFA 1G3OA 2NXEA 1JLAB 4TXSA 1RWVB 2HZCA 4DL2A 4ELTA 3U02A 3MEKA 4B3TJ 5KFUA 3OFFA 3GYGA 3ZTOA 2X3GA 3OL6A 2BQ3A 1VIXA 3RG6A 4ID8A 4G3IA 2KG0A 2HFZA 1U1OA 3ETMA 1B4SA 2UXDJ 1T9UA 2GZOA 4LF2A 4Q8FA 2FJVA 4ZLLA 3BO4A 2GAHC 1AT1B 2RQKA 1FVQA 4DL4A 1C2PA 3LF0A 2OIHA 4KO0A 3TQEA 2JJ4D 3R27A 2QE5A 1BQMB 2DY9A 3MF5A 1JXEA 2NPIA 4NLYA 2IMWP 2IRYA 2D9PA 3TQ1A 2XGPA 3B78A 4DV6J 2B9XA 4WE1A 2RDIA 2V8PA 5C7PA 3W8GA 1XR7A 3GJTB 2CJYB 4NA2A 3EDQB 5C25B 3B6BA 1PIEA 3O5TB 5KFCA 1RCOB 3R1LA 1WC5A 1L5UA 4K4VA 1XMQF 2BKPA 5KFPA 2M88A 3QATA 2HGNA 4JV5F 4JI7J 4LRCA 3UVJB 4NASA 1HHTP 1KQKA 1TK0A 4NPOA 1XEZA 1MN7A 2IYGA 2J0WA 3NKYA 3QMQA 4X65J 1XJWB 2XMTA 2OFGX 2YKMB 2DCLA 3WZ0A 2ILZA 3OFGA 3TJAA 4X64J 1HI8A 4ED5A 5IWAJ 3L95X 1KR4A 3KUGA 5K9FA 1RI7A 2MQ8A 5IM0A 4UW2A 3BGRB 3LQVA 1XMBA 3I87A 2XMVA 4KH1B 2H65B 2ZITA 2ACYA 1RU1A 3H25A 2VG5A 2HS3A 1X4HA 1HQEB 1TKXB 1REVB 3TZWA 1SQGA 4OZ2A 2VDIA 3QGIA 4QZVB 3SXLA 1HW9A 4NYPA 2KXFA 4ED2A 3K5NA 1TZ0A 3DOKB 4FBTA 1CJUA 2CYYA 2PA3A 5A8KB 3EWGA 2HZAA 3RYLA 4J9MA 4DZ6A 1DFDA 4DPXA 4I69A 1WWHA 4PWWA 1TKTA 2CQ4A 2OPSA 1HFEL 1U6ZA 2V4RA 2YWFA 1NJYA 2EBEA 1V6HA 4U7CA 1S72S 4G6VB 2IPOB 1MW7A 3PIOQ 3GR0A 3ONQA 2KKHA 3EDRB 1LWEA 2QLXA 3G87A 4O3PA 4DQSA 4YQWA 2F4VF 2VQEJ 4ZVFA 2ZD1B 3KMQA 2QMXA 2PC6A 1RTJA 5LL6d 5LXYA 2OKQA 4IQMA 4JBCA 3RU0A 1KFSA 4LUBA 3KLGA 5E3PA 4C6AA 3QWUA 3WX4A 1LOUA 4ZP9A 2W9CB 3JAMY 4DQIA 3MMAA 3HSDA 1G4CA 4V19J 2HMIA 3ITHA 3PFEA 2V69A 2MYFA 1RDRA 4CTAB 1DARA 3IM9A 4ANCA 3DC2A 5HMYA 4DFKA 3PX0A 2KRRA 4DSEA 2QL5B 2HQIA 4NZ7A 2BQUA 2IRXA 3ILJA 1NB2A 3ENQA 3H2UB 3ITHB 3LGMA 2NUHA 4KJIA 2HQFA 2Q1LA 2RHQB 3GSIA 1WTFA 1KQFB 5IT4A 2HHWA 3DYAA 4D3GA 2QFIA 4WFXA 1SIWB 2MEWA 3VTIA 3CT9A 5L39A 1P1LA 2B4VA 2N3LA 3TEHB 3MEEA 4MH8A 2Z4PA 2A6MA 4OX9J 1OQ3A 2U1AA 3AB2B 1U7LA 4DEZA 2UV8G 4IH6A 5D3GA 1NZ8A 1MWQA 2DNHA 2V4JA 4A47A 2LU1A 3OV7A 4ILRA 1FF2A 2PO4A 3AOCA 3HZEA 3IFEA 3TAMA 3O2IA 4DV3J 1RT4B 5ETMA 2N82B 2DHXA 3LPEA 5AE2A 1U1MA 3HK2A 2P6TA 2IVMA 2WRMA 2LDYA 2VBYA 5DM6Q 2ZDPA 1VC5A 1RWUA 2CXEA 2KT2A 4WCEQ 3HDSA 4QCLA 1HARA 1Y5LB 1Q5YA 2EFOA 3V6DA 2GAGC 5K14B 2GO8A 4I2PB 1IR2A 1IWAA 3MR7A 3VWSA 4QW9A 3EVOA 3LH2S 1IN0A 3SI8A 2QEXS 4Q0BB 4QU6A 1R89A 2IY5B 4JI5J 2YNIB 4FN5A 4FF1A 2UU9J 2MZRA 3ZZTA 1NHVA 2GNKA 1G7CB 4Q43A 2D69A 2DNPA 4KR0B 3GSDA 2FTRA 1FJCA 3LOUA 2KFZA 4IDKB 1VK3A 2IHR1 3KFWX 5ETRA 5HLFA 1NZAA 3BGRA 1NDPA 4TLQA 3EXCX 5CH7B 1FEEA 5FIIA 4ZCIA 2BKOA 4OZ3A 1HNIA 4ZPTR 1FTRA 4X4QA 3EMTA 1RKIA 4DS5A 4KGVB 1VI7A 4MK8A 4B3RF 3VZIA 4IG3B 3GYNA 3MUVP 1DQ9A 1TL3A 2BXJA 3GIMA 3CCJS 4NLDA 3QZ8A 3K5OA 2YKMA 2R7WA 5L1IA 2BABA 4NA1A 1ZM9A 2Y1JA 5CZXA 1FNMA 4C9DA 2R7UA 3G8TA 1QY7A 5KFSA 4DWIA 3KOAA 1Y11A 4F0MA 3N5FA 2AT1B 2JEJA 4UTGA 3HULA 3R9LA 5MLCV 2VH7A 1H0HB 2YNHA 1NU4A 3UI3A 3W5XA 5KOWA 4ECXA 4Y00A 4B3SJ 3FQKA 3MFIA 3CCUS 2U2FA 2XY7A 3BM7A 3CUNA 2O5DA 4OX9F 2CPIA 3IRWP 1DLOB 1S76D 2KFNA 1Q7YT 1SPBP 4RJVA 1FKOB 1VRQC 3QIPB 5B08A 2VDHA 1Y3JA 3QNWB 4QR2A 1NSQA 1HNXF 3KNGA 2BW7A 1WC6A 3QRRA 2Y1RI 4AE5A 4PG4A 1FE0A 2HK2A 5HMWA 2UXCF 3CMQA 2CZ4A 2IBKA 1HWLA 2CDRB 2VA3A 1RT2A 2MQMA 2MKIA 4LF9J 2FD2A 1WF0A 4WK3A 2DGQA 2OPRB 1TTHB 3TP2A 4OLOA 4MKAA 3J7YI 1TAQA 5H9EK 1HNWJ 2BMBA 4MT1A 3KDOA 2O66A 3KDNA 4C11A 3KLFB 1UVKA 3ET6A 1S4FA 4KV8B 4P6QA 4USUA 4RNNA 4EBCA 1VRUA 4HT7A 1KC8T 3DLEB 2XSJA 4GRSA 4DSFA 2HZVA 1X4CA 3RBEA 4ED1A 1F1BB 4Y3CA 2PIIA 1BWVA 1VK8A 5B0DA 3IWLA 1WOOA 1PJ6A 4DFJA 3MM9A 3KLGB 4C8YA 4XK8C 4OHZA 5T14A 3AQPA 5D6GA 2UVRA 2W9BB 2DGXA 3IM8A 4O4GA 4C8MA 3RBXA 2EG1A 1PO6A 1PAEX 3GTYX 1P1TA 1RAJA 3M32A 1FKPB 4N8OA 2LEBA 3GG1A 1RT6A 5DQGA 3I4HX 4ER8A 3K0JA 4Z7YA 1FERA 2C3YA 5BYSA 5KG5A 1DURA 3QBCA 5KFWA 4N56A 2UXBF 2GIRA 2NLWA 2K3KA 1IQZA 1NK8A 2DITA 1HR0J 3S1TA 3PR5B 2MJUA 2HAIA 1CJTB 1JWWA 4KPCA 1VOMA 1L3SA 2ZH3A 2H4WB 4KHRA 1K1SA 2CZVC 3V4MA 3EX7B 5F8LA 2R7TA 3B4MA 3BBCA 4WK1A 3ENVA 5A0YA 1MSWD 2DB1A 2VFVA 1N8RT 5T7LA 3DOKA 4ERDA 3NAHA 2K7JA 3QT5A 2HHXA 5ETNA 3U1LA 1MROB 1MNEA 3CJ0A 4RW4B 1S6UA 2GHVC 4URSA 5IWAF 1XR6A 2XI3A 2C3UA 3DU6A 4DR5J 3MEDB 4CIOA 4C8ZA 3K5MA 1OY8A 4RWXA 4YB7A 2ZH4A 3BQ2A 3CCES 4C8KA 4I64A 3OR2B 2AHOB 1FKOA 3C2PA 2ATLA 2RD5C 3MTJA 3MCSA 3D6FB 2F7VA 2ZE2A 4R5PB 3RRGA 5DLFA 2GJIA 5IFMA 1FRJA 4BDPA 1UVNA 1F9HA 3FZ2A 1SVDA 2NQPA 1KVIA 4LBHA 2AWZA 2EFNA 3M2UB 4P52A 4USVA 3K89A 9ATCB 1UZHA 3G6YA 2FHJA 1VQ4S 1JLBB 2XULA 1HMVA 1YGYA 2DRDA 3C3LA 3TYTA 5KFKA 4QOTA 1H73A 5F8HA 1U45A 1PYOB 3ILLA 3T1HJ 5HI7A 1F0XA 2RS8A 3GONA 5H9EJ 2LQ5A 3CCTA 3CWJA 3A3PB 4ETZA 3AY0A 1JQGA 2B9EA 2P5VA 3B8HA 3NBPB 1MMNA 2HHTA 2D3O1 2JVRA 3NLCA 2F1FA 5KFZA 5C5JA 1UVLA 1TVRA 4X4UA 1QAXA 1VQYA 2JSXA 2YKPA 1PC5A 3TA1A 3W9JA 3D3CJ 4DPYA 2H5EA 3MDFA 1SKRA 3QAEA 5J2PB 4HHUA 5GAEI 1VQMS 3DOLA 1N52B 2B43A 2RB7A 4CO2A 3BKTA 5K8PA 5HVFA 3TAQA 2FLOA 1HQ2A 1XBWA 3B82A 3ZZZA 4CZCA 1NJWA 1KEKA 2R8GA 1EETA 1VBZA 2YH0A 4LF6F 1YJ9S 2XTJP 1N32F 2PE8A 1N0UA 4AL6A 4NLVA 3M8PB 1TFYA 5K5MA 3SSRA 1P9QC 3HM9A 2D3UA 1Q16B 1ZAWA 4WFYA 4WP8A 5IV4A 3I82A 1VMBA 2ASDA 2IM1A 1FNOA 4LFCF 2WONA 3FEZA 3R5AA 2DGOA 3GIKA 2DGSA 2DNMA 2LMIA 1P9YA 3GJSB 3C6TB 2IIHA 5LOQA 3TZXA 1L3VA 3KG1A 4PG6A 2W4DA 7FD1A 3MR5A 1RT1A 4HL9A 2AGQA 1HWUA 4QPTA 2BYCA 4CLFA 4TY8B 4BBYA 5ETOA 2Q6BA 2CDQA 2RKIA 2KHCA 4DDFA 2YXLA 5M2PA 4WYWA 5KFFA 3GIIA 3IRXA 1FK9A 2F9DA 2YTCA 5GAHU 3PR4A 1F9FA 1FI4A 1ZAVA 5HQ8A 3C16B 5E33A 2RE1A 3D0GE 3F56A 3EICA 3EVMA 1URRA 4WU3A 2UP1A 4G1PA 5CYQB 4RW7B 4NLUA 5D4LA 1Q86T 1SQFA 1W25A 2AP6A 2B51A 1ZM3A 1AUSL 1N5SA 2C2DA 2ZE2B 3HVWA 3FEXB 5A8RA 3ZO7A 2WB1D 3J81j 1PILA 2R2RA 5CABA 1V9OA 3OR2A 3QQCD 3KK3A 4IRDA 3OL7A 5F3TA 4J5OA 4CH7A 3CVKA 1XR5A 3G96A 5HBMB 3CD0A 4JI3F 2B4UA 4IYQA 2CPFA 4ICLB 3UQSA 1N48A 4DV6F 2FVQA 1VDHA 2G1DA 2ZBRA 4P72A 3ADAC 4ZKAA 1HI1A 1VBYA 2FVRA 5CYMA 1R27B 4LSZB 1H38A 4LFAJ 4C98A 1O5JA 2GHWA 1X9WA 2JWNA 1KKHA 1NDKA 2WHOA 3TARA 2ADCA 1WKJA 3CULA 1RGVA 3A8JA 2RAQA 4M5NA 2KYZA 4RW7A 2AMCB 1PSDA 3KHGA 2RQMA 3AH6A 2WCXA 3I0RB 4NI2A 4DJBA 4DQRA 4WFBQ 2B6AA 2LP4A 1BUXA 2QSWA 2YKAA 1UVIA 4DR4F 4YY3J 2FC8A 1R8HA 2D9OA 2XWXA 3LTOA 5KFOA 1XNRF 5A8KA 4IO9Q 3BN7A 1TL3B 2MZJA 3M32B 2KT5A 1PYSB 1ZTTA 3EVWA 3HHDA 4DR3J 3P6YC 2QT7A 2RUSA 4CM0A 2KYXA 2YQ3A 3DOMA 2V68A 2PD1A 1CSJA 3FC9A 2OPPB 3P8BB 4YB6A 2W2OP 1TQLA 2EG2A 3A8EA 3C6TA 5G0RB 3ZC4A 5KG6A 2MKKA 2OH2A 1B64A 3OR1B 2RNEA 1VQPS 1WC1A 1KHWA 5F8IA 5KFLA 3CCRS 3SBMA 4MFBB 4CLZA 4F50A 1WC4A 4N41A 5H9FK 5B0FA 1NMEB 2VC0A 2PI5A 3A1YG 3TA2A 4A8FA 1RWNB 5IC6B 3KLFA 3VAKA 4HR2A 4EMDA 2Z58B 3T1YF 1YSJA 1WC0A 2E44A 3CDBA 1K44A 4ZVQB 1UW9A 2FY8A 2E5LJ 1BC6A 2AX1A 5L9NA 1JIHA 1YBUA 3BYPA 5IQQA 5SZTA 4E0DA 2VODA 4OJ3A 4YEAA 5EX0A 3NL0A 1VGYA 1BQNA 2KVIA 2OHDA 2HHHJ 4CLSA 4GVLA 3OVAA 1N5YA 5A6PA 2DRBA 3BKFA 2RIJA 4OYPA 1U24A 2DISA 4MKVA 2R42A 5C2CA 3RW6A 1JLGA 1Q1KA 4NZ0A 3ULHA 1LWCB 1TP7A 3ZXWA 1FNXH 3R2CJ 4GVBA 2LEPA 3I32A 4E98A 1CC7A 3JTNA 4P74A 4K50A 4CNZA 4JI4J 2XS7A 4EUVA 1RHRB 1JJ2R 3KKFA 1I3OB 4H4MA 2RDJA 2AYGA 1UZDA 1MLAA 4BHQA 2XS2A 3U7JA 4LFBF 4I4BA 3MZIA 4LQ9A 1AROP 2P9GA 3MCNA 1NK5A 1N88A 1PCAA 1TK5A 1OY6A 4MK7A 4X2BA 2FJXA 3H8YA 1T02A 1UA0A 2L48A 1HWIA 2V5HG 4WIIA 2VIHA 2F9JA 4OJGA 2JEGA 4C0HA 4LF4J 1S79A 2F3JA 1S1TB 1KQGB 4OI4A 5FLXY 2NSCA 2QRRA 4FNHA 2HG4A 2OPQA 2QA4G 1RACB 3MEDA 4AUKA 3ET6B 2EEYA 4M5DA 4DUZJ 1WF1A 1LV5A 1ICEB 5HMZA 4EO6A 4RW4A 2W7PA 4QIWD 2E5IA 2VKRA 3LAMA 1N54B 2XZTB 3C19A 2MZTA 2BR0A 1IKYB 2RH3A 4TNOA 2KJVA 3HHLC 4NE9C 3OLBA 4NLGA 1N5VA 2FJDB 3TWZA 5GADI 3Q24A 4ECTA 5B0CA 4JI2J 4U6PA 3VAFA 4FXVA 4K4UA 2ILYA 2NUUG 4KGMA 4DR3F 3HI9A 3M8QA 2ZH1A 3OFEA 1B7FA 2FHKA 4Y34A 5D0HA 4CO4A 4LJMA 2H5IB 4OZJA 2GA7A 1SH0A 2VHGA 2B8QA 2DJWA 3M8QB 2ZZNA 3VHQA 2E5GA 1SV5B 1QTMA 1RBLA 2JL9A 2Z57B 1CJKB 1X7VA 1TU0B 5KFDA 4KFBA 4ZCMA 1YG0A 3TVYA 4NA3A 1SUQB 1YBAA 1YX2A 2J7KA 3WHIA 1XTZA 5IZHA 2VG5B 4HH1A 3BB5A 4XIUA 1HW8A 3QT8A 2XLKA 4K0KJ 3GP9A 3QFHA 1T9XA 1X4DA 2HVIA 4WZQA 2RU9A 3DRSA 1P8GA 3G9CA 4PG5A 5B09A 2EKNA 1TKZA 3MHYA 4DMZA 4O3QA 1IM4A 4PWDB 2C2ZB 1FWLA 1O0PA 4N77A 4K4ZA 3R6LB 2BOPA 3DLGB 3T1HF 2BE2A 3N4WA 2R7XA 3UE2A 3A4TA 3V4IA 1QAJA 2MSSA 5HVHA 3OFHA 4WWSA 1S1XA 5I42B 2YNGA 1X60A 3NOCA 3RRKA 2QN6B 2L08A 1VQLS 3TRGA 1HHQA 2DIUA 3QSIA 3CD5A 3UW1A 2MHNA 4F3MA 3GPAA 3LWMA 2R8IA 1Q8LA 1WUUA 4RBTA 8RUCA 2JX2A 3M9MB 1FRHA 1MU2A 1LXNA 1CC8A 2VG7A 3P3DA 3VF0B 1LW0A 1J2VA 1SKUB 3DGPA 1U6BA 1QVFR 4USJC 2XM3A 4KHPJ 2G0IA 2ZUGA 1ACMB 4RBVA 1C0TB 3ZTSA 1D09B 1N34F 1RLCL 2KVQE 4NYZA 2KM8C 1IBMJ 1UETA 4ECYA 3UN2A 3CCMS 1BXNA 3CSKA 3CJQA 1S7IA 1RKJA 1KTVA 1S1UA 4PYDA 5E2QA 3KHLA 3OSNA 2CJXB 4NLOA 3UNYA 4F36A 2IJNA 5AE1A 1TELA 1NDCA 1PG5B 1PBAA 2HWIA 3WIUA 3Q8QB 1QE1A 3DRXA 2ZNYA 4ZHRB 2MMYA 1T05B 4IG3A 4RNMA 2QSFA 4L76A 4OHWA 3UN3A 4AQYF 2WVCA 3RW7A 1U0SA 2VG7B 1ZYQA 3BBBA 5GMDA 4KPYA 3W2VA 3P4UB 2H54B 4ZJLA 1U02A 3KLIB 2Z2YB 3MI7X 3BREA 4RBUA 5A8WB 1RWXB 4LF9F 1KVKA 1HKAA 3M2VB 4CYUA 5HP1B 2XMKA 2I0XA 2RHSB 5KT6A 4C97A 2PMWA 3JQKA 5AXKA 4A46A 2R2TA 3B54A 2CJKA 1U1LA 2MLYA 1U48A 2CKWA 2XWYA 4LREA 4TKTA 1VQKS 1R8BA 2XO7A 1W26A 2XBPA 1HMVB 1WKKA 3H5YA 2HEKA 3W63A 3NCPA 2Y9HA 4USWA 3M2UA 1K47A 1TUVA 2LYVA 1IKXA 2HBZB 3PXGa 4DX6A 4DSLA 1BWEA 2Y8WA 1S1VB 3P49B 3BSAA 3HT0A 4EWTA 4OYOA 2HNDA 2BM1A 5AXMA 3PW4A 4ECWA 1VJQA 4M5LA 3MM8A 5IQ6A 3IWNC 2DO0A 3MUTP 4NCBA 3FSYA 3V5RA 3MUMP 1XMOJ 2OP5A 2FLPA 1C0TA 2W2QP 1XNQJ 3SZ2A 2CNNB 3IC1A 4CP5A 3BDPA 3HHLA 3D6MB 3GMGA 3DLKB 3M9NB 1T7PA 1CJUB 4M5MA 2B7BB 3VAHA 1S12A 1TMMA 3NGRA 5HBMA 4WFAQ 2N4CA 2YWGA 1G2EA 2M3DA 1FFGB 3KJVB 1WSVA 2FZKB 1S77D 3CDAA 3CJRA 3ZTRA 1QUPA 3RB3A 4UY8T 1W2IA 3EGWB 3I6PA 3BPSP 3D6HB 2OEMA 3IA0A 3NGTA 4X4OA 4AQYJ 1PAUB 3R6GB 3I31A 2LECA 2C22A 1FJ7A 2CG8A 4OI6A 1R7IA 9RUBA 2OGUA 2W9CA 4A8KA 2QA1A 4PKDB 4DX5A 2ZVIA 1Q4RA 3BV8A 3HVTA 3BGUA 1QE1B 3GFXA 1S5ZA 2AJ0A 3BR8A 2IC3B 3MM5A 3D9BA 4PXBA 3LP1B 5B0AA 3CJKB 5J1EB 3AOAA 2K7KA 1VBXA 2QMWA 1C4CA 4JV1A 2CIMA 2HVZA 3S01A 4BS2A 4UF4A 3MM9B 4CO3A 2ZFHA 5KT4A 4IR9A 2Q3PA 2ZEJA 4LRAA 4FS2A 2ASLA 2IC3A 3MM5B 5KFEA 2I5JA 2CPYA 1CPZA 5LMUJ 3P5BP 2CPEA 3R3TA 3QRPA 1Q7LB 3G8QA 1ZM2A 2XSJB 3T3FA 1VRTA 4U9RA 4DFPA 3OVBA 5C25A 4OLPA 2VPYB 1QDUB 2YQ0A 1UWBA 3NP5A 2FGOA 5GMEA 4AL5A 1IJFB 4LF7F 1RTIA 1BQMA 2OELA 3MMCB 5HANA 3BR9A 4C8NA 2LQ8A 4IG0B 1ULRA 2A10A 3QWPA 5C24B 2ZKTA 1O51A 3DGPB 4Q7AA 4YP3A 1D1UA 2FGCA 3CW2C 3ILIA 4LSLA 3M4XA 2ZHOA 3W66A 2J6UA 2BJ9A 2BQRA 1XMOF 2VG6B 3POTA 4NRUA 2H3EB 3I0SB 2G2YA 1FA0A 4EYIB 2YWEA 2IFXA 2DEJA 2HIYA 1KN6A 3D54A 3LANA 4ZCKA 5HN0A 2HIQA 4XDDA 2PEHA 1NH7A 1JJCB 1FD8A 3DDNA 3MEGA 3E01A 3ELHA 4DHVA 3M8YA 5JVHQ 1UW4A 2EK6A 2PMZD 2OTJS 2ZKUA 3DFEA 3MWBA 3TZYA 4ES3A 1GFWB 3V2UC 2BACA 3FQLA 5ETSA 2ZH5A 4ED6A 1RBAA 4JP8A 4WP9A 4MYUA 5KFQA 4NEYA 4B9TA 1KVJA 1WOSA 4LF5J 4H4MB 3T5LA 1H3DA 3GIJA 2J6SA 3RAXA 2FPHX 2C2EA 1J5OA 1NHUA 1NSAA 1S9EA 3NMAA 4MKYA 3THVA 2B5JB 4HACA 1QSYA 1VLOA 1H2TZ 5KFRA 2AIRB 2DNOA 5F9NA 2QO3A 3O1LA 1F5BA 3HX9A 4UUXA 2ZBPA 2DO4A 2DXFA 4AT1B 5KTQA 5H1SV 4DCJB 2QC3A 4OYAA 4PEOA 4CLTA 2Z2LA 3KJVA 5IT9U 5KFVA 1N5YB 1LK5A 2EFPA 2EK1A 3A13A 4Y2AA 4JI6F 4KBIA 3SMZA 3V4IB 1DTTA 5J2MB 2JC1A 3C15A 1IUJA 3KWMA 2IVYA 2CPJA 1R8AA 3NS6A 4L72B 4BWJA 4ZPBA 4Z7CA 3K59A 3T5JA 2QTWA 4QIFA 1LNQA 2UUWA 1IBMF 3OUYA 1ZPWX 2RF2B 5K14A 2ADBA 5HVGA 2IDLA 1NJIT 2UU9F 4X66J 4E8UA 4U8VA 1X9MA 3DI6B 1TL4A 1WOPA 2B56A 3A3OB 5HATA 3UCGA 4KGZB 1TAUA 1EQ0A 1RQ0A 1UMJA 1I94F 2DGUA 2OAUA 4X4SA 2XCPA 1VLYA 2EKYA 3L09A 1GT8A 3NCQA 2D74B 1F6TA 3I5CA 4BCAA 2LQBA 1YJWS 3S7RA 2DCUB 2M9KA 4PYAA 1HLWA 5MAOA 1GH8A 2W8KA 2HBQB 1U2CA 3FK4A 4NLWA 3I9ZA 2P8IA 3HD2A 4KO0B 2I38A 5DDPC 1J5EF 4LF4F 1WEXA 5AJ3J 2CQPA 3DYAB 1JLFB 3HFKA 3L7UA 4WFNQ 2DNGA 4W98A 1ZPVA 5B0EA 1KQSR 4F8RA 4DPUA 4TU7A 1HBMB 3KLEA 2VA2A 1E6YB 2NYIA 4A8OA 4DQPA 4GKKJ 1K1QA 4C48A 1RT1B 2LA4A 2GFFA 2K1RB 4WTYA 1EIYB 1O8BA 1T9YA 3MPVA 4YHHJ 1T03B 3KLIA 3DLGA 4JI4F 2HWHA 2I6WA 1H6KX 1NXIA 1B7YB 2IRUA 1SCJB 1HD0A 1U8SA 4DL7A 2AX0A 3MAAB 4FKXA 2MZQA 2WSFC 8AT1B 3WQPA 1EX8A 2ZD1A 3EM1A 3DMJB 1WSRA 1PJ7A 1HA1A 2WOMB 4N7TA 1JJHA 3C14B 1UWAA 1BGXT 1Q95G 3EZOA 1FDAA 2JH3A 1DTTB 5KG7A 4R8UA 4ANDA 2LDIA 3KLHB 2QFJA 3SYZA 2C2NA 4I1TA 3RAMA 1UKUA 1I5OB 3BQ1A 2JEFA 5KFYA 5EN1A 2UUBF 2KTQA 4L6V3 1LWFB 1MWYA 3OXFA 5J1PA 2E5LF 2XYGB 4OFZA 5JVGQ 4EBDA 1JXVA 3HHLB 5IXUA 3M8RA 3RAQA 3D3BJ 5KG0A 1XQIA 2KXNB 3NCRA 4PPZA 3SIPB 4OYZA 3CXCR 2R8KA 4YY3F 4QPXA 1TL1A 3ZZ0A 4RUHA 2DTJA 1RT3A 2XG8A 2O67A 3FCWA 1X9SA 3N6MA 4OZ5A 2C3OA 4RW9B 1VR6A 2VBZA 3J80Y 4DPOA 3FBEA 2G2OA 2ZHBA 2C1EB 1WEYA 4WFZA 1SL0A 3NXZA 3I55S 2O1PA 2HVEA 4GC7A 2LKZA 1KWMA 1AXQA 2ZBIA 2QA4S 1A9NB 3K58A 1OPIA 4CO5A 4PR6A 3KNAA 1NKBA 1RSCA 2CA9A 2R7RA 2OEJA 2CNKB 3HF5A 3KUEA 4HDHA 2DNZA 2F5GA 5AJ3F 1JJ4A 2GIFA 1N0VC 2WONB 1J5EJ 3DLBA 1NUEA 4UT4A 1HIYA 3M1VB 2KH9A 3QJPA 1WHYA 1HYSA 5I3UA 3W2WA 1LFPA 3D6TB 3WIVA 3KLVA 5BYQA 2IA6A 3A8IA 4OJHA 3WDOA 4DL0C 2IAJA 2VQFF 5HROA 1N6QB 1YJNS 3ZZOA 4RW9A 2MHEA 2OJ3A 2JVOA 2D1CA 3KG0A 2J9CA 1Y7PA 4FXWA 3D1QA 4JB8B 4UZCA 5LSOA 2FZGB 1JK9B 4EU0A 4A8QA 4WE1B 4GVBB 1T03A 2AGPA 4PUOB 2IBOA 1U1RA 2VQFJ 4ZMMA 1GEHA 3OT9A 2MQLA 3THPA 5BR8J 3R7BB 2UXDF 1VS3A 3SCJE 2A0FB 1LWFA 2AJQA 3FSIA 5B0GA 3BF4A 1YLXA 1VBKA 4KH0B 1S9FA 4C8OA 5E5NA 5DDRC 1A7GE 5LMNJ 4IUFA 1YJVA 2WVBA 4DR6F 3D68A 3HSGA 2QYCA 3BS9A 2B9WA 2M2BA 4DI6A 2QL9B 5IOLA 4IFVA 3PM9A 4CH0S 5HQLA 4X4TA 4QYRA 1ZH5A 1C1CA 3DKDA 4ZDNA 4BC7A 2IM3A 2DK2A 4I7FA 2E1CA 2GGPB 1X5SA 3WC2A 1WI8A 4QYZK 3KK3B 4RO0A 3SQOP 3EJMA 4M5HA 1LK7A 3UR3C 4ZLNA 3MAQA 4EBEA 1NDLA 1PBUA 2Q66A 1N56A 1Y10A 4JI6J 2G4BA 1VQ5S 4IFVB 2GX8A 2PFFB 3Q8SB 1BD6A 2EFGA 1HBUB 1UL3A 3LO3A 4DV2J 1U1PA 4OZ0A 2E9ZA 1IBCB 3DLKA 1EAYC 2GVZB 1RT7B 1X4EA 3R5GA 4B02A 3N6LA 3OPKA 2FC9A 2IJFA 4DPTA 3Q23A 4DL6A 3DRRA 3CJ4A 3QIPA 2ZH9A 1CJKA 4JI3J 2DNLA 1D8YA 1XK8A 2KN4A 3PJXA 4OMFG 4YMEA 2AEFA 1FTCA 3LPYA 5M2RA 4DV4F 1W7WA 1J5OB 4OV1A 4KY3A 4NOHA 3PYEA 5CYMB 1FHTA 4ZVHA 2YNHB 1HWJA 1XIQA 1KLMB 6FD1A 5JJBA 2Y1IA 4ILMA 2QV6A 1EB0A 1F3VA 2J7UA 2EC2A 3H40A 2ZM6J 2IAJB 3L4BC 1YRXA 4MK9A 4Z37A 2GMJA 3H5UA 4UQTA 4Y2KA 2BDPA 1SI9A 2EVZA 4NLSA 2MY7A 3DLEA 4DL3A 4ZIWA 5L46A 1RYRA 2CQDA 2CQGA 4R0JA 1YQHA 4FYVB 3ZFVA 3O44A 2MKHA 4MIWA 4PPDA 4MIBA 4ES2A 4M1KA 2MXYA 2ZVSA 1AB8A 2J0SD 3TJ9A 3CC7S 4HI1A 4X4RA 4K4WA 1I51B 1YJUA 5DG7A 1OO0B 4MIAA 4LR7A 1G6BA 4ZA1A 3A3NB 5IC4B 4QWBA 1KONA 2OMOA 4B3MF 4LSLB 2IM0A 4F4ZA 4IKAA 4M63A 2LQ9A 1N36F 3HKWA 2H9ZA 5K8NA 5C42B 1NSPA 2RRAA 3NNCA 1S1UB 1NNDA 3CIZA 3ZZPA 1SL1A 5KT7A 2DKOB 4M5JA 2PMHA 4XDCA 2J9EA 1Y9OA 2FJEB 3IBCB 4USHA 3D28A 5L9XA 2GVZA 5J1NA 3KK1B 4DR7J 2XMWA 3HFVA 4L74A 3CIMA 2E9RX 5KFXA 4RUBA 2B9YA 3M2RB 4O4GB 2W9BA 3S6EA 5D0GA 3V6KA 3G2XA 2NPFA 4R8UB 5CYJA 4QWAA 1M1KT 2VICA 2VB6A 2XZDB 4F02A 2YKQA 2J0QD 4ZPWR 1TUGB 1JMTA 1H2VZ 4DN0A 4OQJA 3BGOP 4TQSA 4OX8A 3KK2A 2AGOA 2XGQA 2LXFA 2IMOA 1N5TA 3MGJA 3Q89A 1MROA 3CE8A 4WU2A 4WF9Q 3DXSX 2JLEA 2YQ1A 3AA8A 3FMBA 1F2GA 2VFUA 4ALZA 4ECZA 3FBCA 3NNAA 2R4FA 4I6AA 4B3OA 1D3WA 1DZ5A 3DLJA 2ZUAA 5A0YB 4QQBA 5IS2A 3BO3A 8ATCB 1RAOA 3BO2A 4DR2J 3PHTA 5HLFB 4M95A 2CVEA 4IFYA 3T19A 1LKZA 4H4KC 4CRJA 2MGZB 3MFHA 1QSSA 4NCAA 5FJ4A 2CWXA 2D7SA 4KGXB 1CS4B 1XNQF 2YNIA 4J37A 4P10A 3MM7A 2VJUA 5LSRA 3AD7C 3JQMA 2OPPA 3M6XA 3OL8A 5E0OA 1FJEB 1N5QA 4CQ1A 2VPZB 1F3FA 3H59A 4L3NA 4YN3B 4YR0A 2R3VA 4DR5F 2DY1A 3GV5B 1XMQJ 2PN6A 4F2SA 1TV6A 2J7WA 1X4AA 2UZAA 1T3NA 4NXMJ 1HPZA 2JNJA 1TR0A 4J9VA 2M4MA 3I9V9 2BOAA 4O0NA 4S0MA 4DU8A 5KFIA 4OZLA 3MURP 4KYZA 4YS2A 3T9ZA 2DGVA 1EP4B 1GX5A 2FZCB 4QR1A 4P9SA 1O6XA 2E1PA 2HAFA 1OY9A 4Q44A 4DV0F 4U7UD 2VFSA 2NCKL 3N9UC 2ASJA 1X4FA 5LXRA 2J8AA 3HCXA 3KYLA 2XNRA 3VV2B 4RL1A 4F26A 2XC9A 1NHKL 2GQQA 2B0GA 5E7OB 3DLHA 4DR7F 4OYWA 4OI0A 2K8GA 2KZZA 3IG1B 4FF3A 4MTPA 1VC0A 4UOHA 3E2EA 1GTHA 1L3KA 2DH9A 3PEHA 5L38A 2PFDA 3SV4A 3FJ2A 2X51A 3JSMA 3A8KA 3D5MA 1YK9A 3LGHA 2YNFA 1FVSA 2P2CB 2QJ3A 1KS2A 1UJ6A 1RWKB 3UDCA 1DHMA 1A6LA 3CJSA 2J9DA 3ZZUA 4ETXA 4IRKA 5THWA 5J2NA 1H7XA 2ROEA 3EXYA 3CJTA 2Z8QA 3HVAA 2C2KB 2IJRA 4R25A 4J9NA 4DV0J 2C3PA 4Q0BA 1KRPA 1VHIA 3J80U 4DG1B 5EWEA 1TL1B 4M5IA 4QJVA 4B9NA 4U7UK 3GZ7A 1KD1T 1R0CB 2R9LA 4LT6A 3AFGA 2M70A 3CO9A 2NREA 1VQSA 3JB9k 1NKCA 1HNWF 2ZOFA 4DG1A 3G6ES 1FJGF 2HRUA 2ZOMA 3EYZA 1S9GB 3IRXB 2VUGA 2XEXA 3T1AA 4B9LA 1JLGB 1S59A 1WEZA 4AFFA 1CJVA 2OD6A 2BE9B 5C42A 1WNEA 4XO0A 4OV6A 4J9OA 4U96A 5DO2A 3NGUA 2MGZA 1V5IB 3HSJA 5F8JA 2VC1A 3EZ5A 1FDNA 2GMLA 4KSEB 1T8EA 2FVCA 3KMSA 3HVRA 3DMJA 4I68A 1RA6A 4DX8H 4WXWA 3T6JA 1M90T 3JXOA 4Y2CA 1PC4A 2HHUA 2Z2MA 2AKWB 1RU2A 3C8YA 4RW8B 2IDEA 2K2PA 3D1HA 3IP0A 5T7LB 4DUTA 2PI4A 7AT1B 2NR0A 2AZ3A 5B7WA 4RNOA 1NK4A 2OUGA 4OHXA 3W9IA 2ROGA 4G1IA 6FDRA 2WOMA 4B3SF 5K8MA 2DNRA 4U95A 4HVZA 2CPDA 3QLHB 1YZ7A 2CJAA 2DNNA 4FYYB 3MMCA 4TLRA 3JYTB 4FBUA 1SQEA 4ILLA 4ES1A 2J9DE 1KDNA 1TL5A 3I96A 2JRSA 2VQEF 2DVIA 1L3TA 1T0TV 3GJQB 1GXLA 1GK8A 1IWGA 3UD5A 3K57A 1U1NA 3PVXA 1U6FA 5G4DA 1GMWA 3R5CA 4CLLA 3DRPA 4O0IA 1SJ1A 3L3CA 3Q22A 1HBMA 1Z4UA 2P9CA 2XMUA 3OD2A 3KLEB 1KBRA 2DGWA 5DG8A 2HRYA 3E3XA 5HJXA 1EZZB 5KG4A 2V8VA 3I0RA 2APOA 4NI2B 4PXEA 2YNFB 2V4QA 3RB0A 4OYIA 5KFGA 1S6OA 2YWHA 2W7OA 1NH8A 1VHFA 2E1MC 2HFOA 3MD3A 2V8HA 2AF6A 4PQAA 4YR3A 1HBNB 4JI1J 2P6SA 2ZH6A 1SC3B 1T11A 1UEKA 3MR6A 4C8LA 1Y4ZB 2B4PA 3Q8PB 3KK2B 2UVVA 5F8NA 3AJDA 1VIOA 2MQNA 2PSZA 1JLCB 1M5KC 2QLFB 3GJRB 2MPUA 5EX3A 1HD1A 2HNYB 4NXNJ 3L9ZA 1RISA 1FDBA 1SUQA 2V50A 4I2PA 3WC0A 1SH2A 2I9SA 3JQJA 2VZ9A 3BKUA 4HI2A 4KHMA 1LQ9A 1AZSA 1HQUA 4P75A 3SDEA 2GW8A 3HT3A 2ZM6F 2ZH8A 5J2MA 2YX4A 2DNYA 3VVTA 4ZVSB 4DU7A 1FKPA 4MKBA 3OL9A 1M0SA 2MKJA 1S0OA 4K0KF 5ITHA 3BZQA 4B9UA 5CYQA 3HLUA 5ETVA 4KTQA 4NWBA 4DXLA 1E6YA 2D41A
chains in the Genus database with same CATH topology
1NK9A 4KC5A 1FE4A 3DDKA 3ISND 2HFNA 4NRTA 2WTFA 3CF5Q 2RKIB 2MQOA 1SJQA 4CO1A 1VRUB 1F5CA 3QO9B 4EFAC 3H2LA 2HHHF 2UUTA 4J9RA 2XCAA 2ERRA 1R8CA 1S1WA 1REVA 3CJ3A 4RW6A 1HNIB 4OIXA 4U67Q 1IQTA 2GIQA 2UV8A 4H4KA 4LQ3A 3H20A 5KAKA 4C3KA 2ZH2A 1ZTWA 4K2XA 3J7A1 5AE3A 2VFRA 3POTB 2YKNB 4CNYA 2W9AA 2FVPA 2V9KA 4MYTA 4ZPVR 3SSQA 2KZMA 2O01C 1IKWA 3DXBA 3N0VA 3GYXB 4I67A 5BR8F 2L9DA 2ZDOA 2DR5A 2DBBA 1AFJA 3I56S 1JKHA 2ZC3A 4NCGA 3KHHA 2QLWA 1DQAA 4NLTA 4TN2A 3M8SA 4C3MA 5GVQA 5KG3A 1SJRA 2DHSA 1I1GA 3QJLA 4KKOA 4V19X 1X8DA 3DRRB 3SCKE 4UOCA 4FF2A 1LW2B 1DLOA 2FHJD 4OI1A 2HNZB 3ICLA 1RT7A 2V8DA 3AA9A 1S9EB 2RQCA 4OI2A 1KLNA 3GFZA 3LP0A 1TKDA 2R8JA 4PQUB 3MAHA 1SJFA 3L7PA 1YRTA 2HVHA 1HQEA 2IYIA 4IOBA 3H98A 1U49A 2DNKA 1URNA 4CCHA 5HROB 2B3TB 2UUAF 4R5PA 1Z2ZA 3CJ2A 2E1AA 5GAEU 4ZPCA 2MY8A 3JSYA 5J2NB 1TK8A 5E3QA 4F3QA 1X5TA 4N8NA 2FJBB 4CT9A 3MMAB 3AJ1A 3OR1A 2RJZA 4DQQA 3EGNA 4PXDA 4C7QA 4C0BA 2CQIA 5GAGI 3OUYB 1SKSA 4WJBA 1KHVA 2DHAA 4XAKA 1FXLA 4Y0FA 3CB4A 3OSPA 4M94A 1JLCA 2UVUA 2BRLA 5SUHA 4IQXA 2CG4A 3M05A 1UEUA 5ADZA 3F73A 3X1LB 1WI6A 2JDJA 4DS4A 4XPEA 2RS2A 1S48A 4HTJA 1VQOS 4OL8A 3NS5A 3SEOA 1S6PB 3Q2SC 1HPZB 1NJZA 3TO8A 1NJXA 4RKUC 3MEEB 4NZ6A 4USIA 3PKYA 1SIZA 2IM2A 3BJYA 4OX6A 3C6UA 3OHAA 1OQ6A 3TW0A 3PIPQ 5FD1A 3BEGB 1IBKF 1S6QB 3OTOF 2V8GA 3PJWA 1KOHA 4EZ9A 4X62F 3NGKA 2JC0A 3EPIA 1S0NA 2FLLA 4W92B 1X5OA 5IM0B 3MMBA 4IFYB 2QIFA 3IGNA 1JKHB 4B9SA 1C1CB 4OX7A 2XLIA 3I5AA 2L3MA 1T95A 3MECA 1Z1ZA 2LA6A 3QLHA 2BRKA 4ZHRA 3OVSA 1IKWB 3JYTA 3U1MA 2W7AA 2I2YA 3MR3A 2BA9A 2FJAB 1YRUA 4ZS6A 4PRFA 4X4VA 1UEVA 2HPUA 3CCZA 5KFTA 2WSEC 4GKKF 4TU8A 3D0IE 1SBRA 1T05A 4F67A 4X66F 2RUGA 3M2RA 1SB6A 2XHWA 2OTLS 3ISNC 3K2YA 2BM0A 3DHXA 2XB2D 2G0CA 4K4YA 1I6JA 3E51A 3TI0A 4OHYA 2CVIA 3K8WA 3VCDA 1OPZA 1NEEA 1JXLA 4I56A 2OPSB 1C4AA 2C3MA 2KHDA 3M30B 2D3ZA 4JV2A 2CPHA 1S1VA 3Q2TC 3JTPA 1RTDA 4FF4A 2MJNA 4Y2MA 3PNIA 4FS1A 1GTEA 3VZHA 1EETB 2F8HA 3PRDA 1FXRA 1ROFA 3GR1A 1CQMA 4DFMA 4PG7A 4A8XA 1MU2B 2MKCA 2AV5A 2BZ2A 2ZJPQ 2PDAA 2VONA 5DQIA 4LF5F 4GKJF 4M8LA 2VD3A 2KT3A 2DH8A 1ZOTA 2VG6A 4UQGA 5FDLB 4PWUA 3LAKA 4K4TA 3CDWA 1VQNS 2BANA 4TU9A 4ZK7M 2LXUA 4LVOP 4N5SA 3T5HA 3FNNA 4DSJA 1KSPA 1KLMA 3BSCA 5CHCB 2AYMA 5I3PA 4B17A 3BSNA 3H2VE 1S10A 4DN9A 2AYEA 3TUIC 1IR0A 2KXHA 3OLAA 1S49A 5AXNA 1QAIA 1OIAA 3IAM9 3DN9A 4P7VA 3G8SA 2LXIA 2FB0A 3QYYA 3VAGA 4TQRA 2JLFA 2CQ2A 2J5AA 3NMRA 5KFHA 2C28A 4A48A 1Y5IB 3QGPA 1NO8A 2COLA 5DGBA 1WG5A 1K0VA 1R43A 2XMMA 2E1RA 3OXLA 4J9SA 2HYIB 2BANB 5DQHA 1VQ7S 2JFKA 2GMHA 4IRCA 1S0VA 1HNVB 1YTYA 3MR2A 5LMUF 1U1KA 5M2UA 1UVMA 1ZBTA 4ECSA 2DT9A 1LFWA 3N28A 3MECB 5DRKA 2FJWA 2BV3A 3MPWA 1HNVA 2IA0A 2ZOGA 4Y6IA 3H4BA 4RW8A 1RJJA 2Q79A 3DM2B 3BQ0A 2VPWB 4NLRA 2OPQB 1RTJB 3FCHA 1UJ5A 2NXUA 1GX6A 3DLLQ 5LT5A 2G9OA 3UR0A 3LP2A 1LW2A 1WHXA 3DHWC 4B9VA 4JUZA 3US5A 1AUDA 3MOJB 3LP1A 5J1EA 2DR7A 5KT3A 4YDDB 3TUZC 1D9FA 4EEYA 2DPJA 1FESA 5EUHA 3G4SS 5DDQC 5HMXA 4JI5F 4CT8A 2R7SA 2CQ1A 3SDEB 4URGA 5KFBA 1HL6A 4Q8FA 4C11B 5IT9Y 2M7SA 5KFJA 4A4JA 1ZZFA 2KO1A 2W8LA 1SH3A 3B4DA 1LW0B 2EPIA 3RTVA 2E7XA 1RT2B 3PX4A 4QW8A 1BQNB 3ZZYA 3VQTA 4LSNA 3OJUA 3BN4A 3SCIE 5H9FJ 1R6YA 2XLJA 4DV3F 4EYHB 5D4OA 4NLPA 2X1GA 3LALA 3CCLS 1QVGR 2L9NA 2B5JA 5JUMA 1FRIA 1AW0A 4PWDA 2J76E 3BGFA 1VRTB 4QIVA 5KT5A 2CPZA 3DRSB 3UDLA 3EUNA 2DRAA 1B0VA 1KFDA 4IOAQ 1FEHA 5G0RA 4YOEA 3QIDA 1ELOA 3RBDA 5L1KA 1RP5A 5DM7Q 4PQUA 2A2DA 2BJDA 2G13A 5JXSA 2C42A 1RT5A 1K8AT 1IBLF 1QLNA 1RTHA 2DHGA 1NK6A 5F8GA 3PV8A 1U47A 1TFWA 2HS4A 2A18A 1U1QA 4RX6A 1KNZA 4PXCA 2MKSA 4IDKA 3L7OA 5KFNA 2E29A 5A8WA 2Y0SD 3I0SA 3M6WA 4DR2F 1IKYA 4DLEA 5CXTA 4B9MA 3HMJG 1L3UA 4JOUA 3AHPA 4RLEA 4OZ1A 1GNKA 4B3OB 2VOPA 4IH5A 4O3NA 1UWBB 1K0TA 5DDOC 4LIWA 4JI2F 4HEA9 3QGHA 1NK7A 1WTBA 4JV0A 3FDSA 2YKNA 5BYRA 2GV1A 3K5LA 3GWCA 4NYOA 1U2RA 3MMJA 2CQ0A 4CH1A 4DR1F 3JSRA 2POKA 5A8RB 1R3NA 1C0UB 1Q81T 3O6QA 1QJHA 2R8HA 4KRWA 3LP2B 3FRYA 1MWZA 1JNZB 1VFJA 2JOQA 3TNVA 1LWEB 3GV7B 1JLEB 1SJ3P 4I2QA 4X64F 3LWLA 1E6VB 5KT2A 1UFLA 2AYBA 2B6AB 1OSDA 3IAS9 3NAIA 4IOCQ 3MTKA 3MM6B 4FYDA 2KDOA 3G86A 3CPWR 1D9DA 2CJBA 3KTQA 5GAHI 4ED7A 1WACA 3CCWA 5D78A 2CQ3A 3J7YU 4O3SA 1R31A 3ENWA 4DV7F 4ED0A 3IWXA 3IG1A 4KE5A 2OPRA 2ZHAA 2KM8B 2RF2A 4F3OA 4HDGA 1H98A 3AB4B 3I4PA 2XY6A 1C1BB 4Q8EA 4ICLA 3DNCA 3CDUA 4X4PA 1TVRB 2DPIA 3RB6A 3M8PA 2IVFB 1BWEA 1S1TA 4A8WA 5J2QA 1FT8A 1EP4A 3TA0A 4F25A 2OFHX 1HYSB 2RU3A 4Q5VA 3CCQS 3M1VA 2E5HA 4QIEA 4URQU 1KOOA 4RUCA 2HNDB 4F4KA 1U26A 4HTIA 3PKMA 4JI7F 1UA1A 1Z2LA 1W2BR 2HW3A 1JLBA 5F9LA 4RW6B 4GMKA 2MQQA 2FY1A 3UCZP 1IKVA 3CD6S 1JNRB 2Z0GA 3QO9A 4YFUA 3H5XA 3MD1A 2MZ1A 2LCWA 4OI3A 2RILA 3Q0AA 1CVJA 2X1BA 2LQJA 2PT0A 2Q6CA 4GO5X 4ZLPA 2PA8D 2F40A 1YHQS 3EPGA 4PG8A 2JHEA 1DJ0A 2YNGB 5U47A 3HPOA 4DV2F 3RRHA 1Q8BA 4O3RA 3J7Z5 1ZM4A 4NCGB 4ZVGA 5D77A 3HP6A 1M5SA 2VOOA 3HKZD 3KG4A 1JB0C 2EW9A 3IXQA 3TAPA 1QSLA 1Y5NB 3UNGC 1YWXA 3K8VA 4DOZA 1MMLA 3KLHA 3QJJA 4ECVA 1ZETA 2UVWA 3NWGA 4QWCA 2FHMA 3K5PA 2QZ8A 2YWKA 3TX8A 4KFBB 3M6VA 3PY8A 3GQCA 3LP0B 5C24A 3CD7A 5F8JA 4X4NA 5CCMA 5J2PA 1K73T 1D0EA 5LXRA 4W90B 3QAUA 4RNHA 1B0PA 1S1WB 4IH7A 3G71S 3MPYA 4A8YA 4F4YA 3PEJA 1XN9A 1XWLA 4KT0C 3IBWA 4UUWA 5K8OA 2JLGA 2UUCF 2V9WA 3D0HE 1HBOA 4HHJA 1FKAF 2YX1A 4UY85 1JLFA 3GFHA 4OJ1A 2V94A 3HJFA 4K5RA 1NB7A 1OWXA 2OD4A 3SQGB 3PO4A 3MXHP 3CJKA 4AL7A 1UJ4A 1AFIA 5DETA 4X65F 3N79A 1JLAA 2GQ2A 4KB7A 1TKZB 3SFGA 1DBDA 1IXKA 2JZ5A 3J7ZT 4EGLA 3N6NA 4P2SA 2L9WA 4QIGA 4J9KA 1G1XA 1JLQA 3W3SA 2HNYA 4B3TF 2R7OA 1BQXA 1P6TA 3W2WB 1GAOA 1FCAA 3KJVA 4TYBA 3NRBA 2V0NA 2HGLA 2HHPA 3I5BA 4O23A 4DSIA 5E3CA 3K7RA 1Q79A 4DSKA 1NRKA 4NLXA 1S7HA 4JI8F 1N33F 4QWEA 1R0AA 7FDRA 3FSXA 2O3DA 5DG9A 3KK1A 5D8HB 2ZZMA 1D9AA 3F44A 2VPXB 4X84A 1NAQA 4K4XA 1LWCA 2DR8A 2NZ4A 2KB2A 1SJ4P 3NBPA 5CCLA 4DLGA 5F8MA 2M8HA 2F8MA 1GQEA 5LJ3Y 3V81A 1U4BA 3O8WA 2HQ3A 2VV5A 5BJRA 4K5SA 3GFYA 1WD6A 1WG4A 4ZP8A 1DTQB 1UFWA 1Q8IA 5DJBA 2RT3A 1HWKA 1IKXB 4WYLA 4RU2A 4YHHF 2R7QA 4FNIA 4RZRA 4FXDA 2F8EX 2RRNA 4LFAF 4PCQA 1PGZA 1GXTA 2FHOB 4R0EA 2OLWA 2AJ1A 2LLZA 1U2FA 2ABYA 2EFQA 3UD4P 5IT0A 1UP1A 1FRKA 4NXNF 2GGPA 4I7FB 4FPRA 2FLNA 4F2RA 1CG2A 3IGVA 4G1QA 4IR1A 5KG1A 4WKYA 2W4PA 1APSA 2EWHA 1QUVA 4QR0A 4RU9A 3V6DB 2M5YA 2A2CA 3IR7B 3JSBA 2BJEA 4EZ6A 2HS0A 2ZJQQ 2VBXA 2HNZA 3OTEA 4K4SA 4J9PA 1VQ9S 1FK9B 3WBZA 2DNQA 4YB1P 4ECUA 3CMES 4HKQA 4QU7A 1VJWA 2LEAA 2OO4A 4IG0A 4KKOB 4P7TA 3R5DA 4RWWA 5HL7Q 3OW2R 4ATNA 1M5OC 5I3QA 1IKVB 3PW2A 1E6VA 3CC4S 1M5VC 4ID5B 3OXGA 2R2SA 1OSCA 2AD9A 3CGIA 2AQ4A 2RRBA 4TY9A 3EGZA 4NLQA 2MZSA 3GE9A 3TOQA 2MB0B 1GXUA 4Q2LA 5J2QB 1WELA 5F41A 1HR0F 3VQSA 5E41A 2EC0A 1FRMA 1CEZA 3HHKA 3HO1A 1M5HA 4H54A 3EZUA 3FEYB 3HHEA 2KFYA 1Q53A 4MFBA 3TUJC 3PO5A 3AAWB 2WSCC 3DOLB 2QA2A 3D1OA 1K9MT 3NGDA 1QM9A 4DUYF 1Y00A 3OBIA 2I8EA 2P9EA 3SQGA 4LSNB 3S8SA 3T5KA 1S6QA 2RQ4A 3OJSA 2A3JA 1DQ8A 1T3OA 2PGCA 2GHPA 5F0UA 2BVZA 5E3RA 5L8RC 3FMWA 1OS5A 2EI5A 3OTDA 1V3ZA 3AJ2A 1FRLA 2LU2A 3UD3P 4MAKA 3RR7A 1R0AB 1Y3KA 4ZP6A 1RT6B 3QGGA 2AW0A 3N01A 4N47A 2FVSA 3M6UA 1R8PA 3J81Y 3VALA