4Y2KA

Reduced form of apo-golb
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
GMQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Putative metal-binding transport protein
publication title Structural Insights and the Surprisingly Low Mechanical Stability of the Au-S Bond in the Gold-Specific Protein GolB
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y2kA00
1CC8A 4OJHA 5B0BA 4A4JA 3CJKB 5F0WA 4Q2MA 1YJUA 2LQ9A 3QMQA 1MWZA 3HHLC 1IUJA 4DL0C 2ACYA 5B09A 1FVQA 4YEAA 2OAUA 2GA7A 2XMKA 1Q4RA 1GXTA 1OQ3A 3IWXA 5B0DA 3LGNA 3UDCA 4HL9A 2K7KA 5A6PA 4HH1A 1URRA 2FIUA 3T9NA 1N5QA 4FNIA 2OFHX 1YRXA 3LO3A 5A6WA 4A46A 1AW0A 4DPOA 1Y3JA 2K1RA 2OD4A 3FRYA 4HI2A 4OJGA 1AFIA 1YG0A 2K7JA 3QGPA 5B0EA 5K9FA 1K0VA 2QLWA 3HHLD 2RU9A 3BGUA 2N4DA 2IYIA 2OMOA 2HQIA 4NPOA 2PGCA 1Y9OA 2AW0A 1Y3KA 3HHLA 4F67A 3BN7A 5B0CA 2GGPA 2EW9A 1FD8A 2AJ1A 2IFXA 2GCFA 3IWLA 2LDIA 2N7YA 1WD6A 2GO8A 1X7VA 2Q3PA 5T7LA 2GV1A 1TR0A 1KQKA 1X0PA 2FHMA 1S6UA 2OKQA 2VH7A 2VV5A 1Q8BA 2AP6A 2OD6A 3TNVA 3BDEA 1XBWA 4Y2KA 5KAKA 1CPZA 1TUVA 4ZOSA 3HFKA 3TOQA 1YJTA 1JWWA 2HIQA 1W2IA 1SB6A 4ZA1A 3GZ7A 1N5SA 3HDSA 3MCSA 1SI9A 4EFAC 2OP5A 1TZ0A 3HF5A 1OSDA 2QLXA 1U7LA 2W4PA 4QOTA 3CJKA 1Y0HA 1GXUA 1OPZA 2K1RB 2RMLA 2KT2A 3DCAA 5B0FA 4Q2LA 1V3ZA 2G9OA 1JK9B 2BYCA 1SQEA 2LXFA 2XMUA 4OIXA 1YJRA 2XMMA 2QYCA 2KKHA 2FTRA 2IYGA 2N4CA 2HLTA 2LQBA 3HX9A 3I9ZA 2PD1A 4Y2MA 5B0GA 1CC7A 1Q8LA 3BB5A 3KNGA 3MZIA 4YDXA 2XMVA 1Q53A 3LGMA 5T7LB 1TL4A 1P8GA 1QUPA 1FE0A 1YJVA 2HFNA 2QIFA 2XMJA 5IXUA 2K2PA 1RJJA 2XMWA 5B08A 4NL5A 1P6TA 1TL5A 2OFGX 3FMBA 2CRLA 1VQSA 3F44A 2ZDPA 1VQYA 1KVIA 1MWYA 2JDJA 4OJ1A 1KVJA 2GFFA 1R6YA 3VTIA 4A48A 2HLUA 2ASYA 3DXSX 2ZDOA 3BM7A 2ROPA 2ROEA 2ROGA 4HI1A 1S6OA 4DN9A 2XMTA 3KG1A 3TRGA 1APSA 1N5TA 1ULRA 2W4DA 2W4CA 3HHLB 3K7RA 4U9RA 2BJEA 2GGPB 1LQ9A 3KKFA 2BUNA 4FNHA 1X8DA 1OQ6A 2RSQA 2RILA 2AJ0A 4HH0A 1FESA 3KG0A 1FVSA 1N5VA 2BBEA 2KYZA 5B0AA 1FE4A 2BJDA 3BR8A 2KT3A 3FGVA 3WDOA 4A47A 2FB0A 1FEEA 1AFJA 2L3MA 3E8OA 5F0UA 3BF4A 4OJ3A 2HFOA 4Y2IA
chains in the Genus database with same CATH superfamily
4ECTA 3A3PB 3UDVA 3JB9k 4EK2A 3OVSA 1ZA2B 2L9NA 3VR1A 1WOSA 1VHFA 1UZHA 4Q8EA 4DZ6A 4X66F 2D74B 4CNZA 2LA4A 1N4LA 1DBDA 3IC1A 4WU3A 5KG1A 4KC5A 4JV5F 2NUUG 3QRQA 1J5EJ 2OMLA 1WOOA 1IWGA 2HQFA 2AQ4A 1PILA 3M8PB 4R8UB 5DGBA 1FXRA 3N5FA 5LSOA 2KG0A 2M7SA 3IG1A 4X4RA 1GH8A 4XPCA 3CB4A 4ZP6A 2OPPA 2BZ2A 5DO2A 2EBGA 1YITS 3LAKA 3OLBA 3TI0A 2HGMA 5AJ3F 4JB8B 1QUPA 3QZ8A 4Z2XA 4LF8J 5AXLA 2K2PA 3MOJB 4B9TA 3QAEA 4X62F 2DGXA 1YZ7A 1R6YA 2OTJS 4UT4A 2V4RA 2VFSA 3TW0A 4U9RA 2QSWA 3QSYB 2HHWA 3M2VB 3KMSA 3HLUA 2DRAA 3BGLA 1LKZA 2KZZA 3CJSA 4F0HA 2Y8YA 1LFPA 2DIUA 2V9KA 4A4JA 1BWVA 4IOAQ 2AJ2A 1KOOA 1H6KX 1FF2A 2E1CA 2BOPA 4O0NA 4DV5F 4ZVPB 2D3O1 2WONA 4X4TA 2K1RA 2ZZTA 4M94A 4NLSA 2MZ1A 2M4MA 1C0UB 1RABB 4OI6A 4GO7X 2LDIA 3MPWA 2QMXA 4IG3B 1SJ1A 3C14B 1LEOA 3R5GA 2Y1IA 2R2UA 3W65A 1IJEB 5DM7Q 2HYIB 1A0OB 2IPOB 5EN1A 3CO0P 3R5DA 3W9JA 4WP3A 2FLLA 1S79A 1Y10A 3OW2R 3R5CA 3DDIA 3PNIA 3M6VA 4NL5A 2AD9A 1WC5A 3LW5C 3M2RA 2OPSB 3DN9A 2YKNB 4ZCLA 1N5TA 4LRCA 2WOMB 3DI6B 2RILA 5DJBA 5DM6Q 3TA1A 3I82A 3D7SB 4QJVA 1EIYB 1HYSA 2VPXB 5E3RA 3LAMA 3HCXA 2J7WA 2PA8D 3PZPA 3HMJG 5KOXA 1VQPS 1L3SA 1GNKA 3THTA 3NGDA 5DDOC 1IQTA 5D3GA 2Q43A 4OZLA 5ETRA 2WSCC 1N36J 4Y6IA 4WE1B 3HHLD 4DUTA 1F2HA 1WEYA 4YP3A 2OMOA 4Y2CA 2IM0A 3OXLA 2AW0A 1RGVA 3DRRA 4PWWA 2C3UA 4JI2J 2VV5A 2FLOA 4ZLNA 3OUYA 3VVTA 3IA0A 2DRDA 5I3PA 4K4TA 2VHGA 4FXWA 1O0PA 4JI5J 4W92B 1NH8A 2CYYA 3CVKA 3E01B 4HACA 5KFVA 2LVWA 1MLAA 1DLOB 1GMUA 1T9YA 3L3CA 4USVA 2CDQA 1U45A 2PFDA 2DXEA 5GAHI 1JLQB 3DLKB 3M8SA 2BEFA 4FKXA 1HR0J 7FD1A 3RB4A 4A48A 2JVOA 4LF8F 2GVZB 3ILJA 4H4OA 4Y2AA 1FHTA 3Q8QB 2VFTA 1X8DA 1VYAA 5F9NA 3HVAA 4OZJA 1ZM9A 2DNRA 1WI8A 4LR8A 3ZTSA 2UUCJ 1RBAA 1JJ4A 4P9SA 1D1UA 3BQ1A 2H5IB 5GVQA 4F4WA 2ZE2B 1GXTA 3IN5A 2YQ1A 2FIUA 3C15A 3IMQJ 4N77A 1YRXA 3HT0A 2F5GA 5E2QA 5DGAA 1JJCB 1Y7PA 5DG7A 4DPXA 2W01A 2J7UA 1BGXT 4F7VA 3DLGB 4GRSA 2J0QD 3BDEA 2BJ3A 4USTA 4MKYA 1SB6A 3KDNA 3SQOP 1FERA 1SI9A 1NDLA 2VU5A 1FTCA 3HZEA 4NLXA 2GMJA 1B3TA 2MKKA 3VAHA 5J2QA 1ITPA 4B9UA 3KNGA 2VOPA 4UOGA 3TEGA 4OHZA 2R7OA 3QT6A 4L73A 2Y1JA 3C3LA 1PG5B 3DXSX 4DL5A 1HBMA 1IKVA 4W90B 1E6VB 4DV4J 3O3LA 3AJ1A 1S4FA 5CCMA 1R8HA 4CO3A 2PN6A 3I4PA 1NDKA 3AAWB 1S4EA 3CEDA 3AXMA 4LUBA 1BQMB 4O3NA 3KDOA 1K8AT 3KYLA 2MHNA 2WCXA 1LFWA 4NRTA 5B0DA 4AQYJ 5KTQA 3LALA 3CJ4A 1Y3JA 4K0KF 4RBUA 3FBEA 5A0YA 2KI2A 1TU0B 1NK4A 3MCNA 1NZAA 1JLGB 2Y8WA 5D4NA 1N36F 2D69A 3DLBA 2HQGA 3MXHP 3N6MA 1QVGR 4OI3A 1QUVA 4RW8B 5ETTA 4JI2F 5C42B 2NPIA 4RNOA 3JAMY 3ZC4A 3B6BA 2E9RX 1C2PA 2OELA 4JI5F 5KG5A 2IDEA 4O44B 1FD2A 2W9CA 2UV8G 2XNRA 1RB0A 2ZC3A 2C2RA 1VQYA 2GC8A 3O8WA 3K7RA 1XERA 5CYJA 3NS5A 1WF2A 1R8BA 4F4ZA 3LQVA 2BBEA 2JEGA 1AFJA 2FHJD 4A8QA 2FVCA 1LW0A 5HAOA 4UOHA 5D0EA 1Q5YA 3ISND 1FRKA 3R1HA 1VLYA 4QQBA 1IR0A 4M5NA 1WJ9A 5M2UA 2AYGA 3AODA 2XNQA 1UP1A 1RAIB 1HBOB 1X5TA 4I2QB 3CUNA 2FJEB 2AEFA 2IC3A 3S8SA 5J1EB 2OSRA 2OP5A 3GPAA 1ZH5A 4CO4A 4J37A 4ECVA 4LSLA 4CLKA 2MLZA 4RUAA 3K8WA 1UL3A 5DQGA 4ED8A 4WYWA 1REVA 1Y5NB 2B5JA 2XS7A 3MEGB 4YR2A 5D77A 4USMA 3VAMA 1LOUA 1RAHB 1YBTA 3TZXA 1JLCA 3WHIA 1ZM4A 1HQEB 1GMWD 3OR2A 1FKOB 2ZDPA 1FDAA 1UEVA 5CQGA 2J6UA 1DAXA 4DFKA 4DMZA 2R7UA 2BUNA 3D66A 4MMOA 1SJ3P 1RKIA 5KFRA 1RT3A 3D6FB 4CLPA 4WXOA 1VC5A 1WELA 2PC6A 4KKOA 1DZ5A 3FC9A 2EI5A 3VGTA 3CJRA 3KUHA 5ETVA 1GTHA 4M5DA 5CXTA 3K89A 2H65B 4ICLA 3HHDA 3BKUA 1EKSA 3BBFA 2KJWA 1DQAA 2F4VJ 2J8SA 3WIVA 2UVRA 1T03B 1CJTB 3OL6A 2BKPA 2CJAA 3HXMA 1HNIA 1MU2B 3QGIA 4PYAA 4E98A 4FPIA 4O0IA 4X65J 5KFUA 2EKYA 3UCGA 2EEYA 2IDLA 1UFKA 3C6TA 2J9CA 1S97A 3L4BC 4ZCIA 3FMBA 4NASA 3U1MA 5L46A 1KR4A 5E3AA 1IKWB 1TL7A 3AJDA 1YKWA 2AJ0A 5BJRA 3PJ9A 4IR1A 2IIHA 3I0SB 1KBRA 2IM2A 1U6ZA 3FZBA 3A4TA 2V94A 3M2UA 1FJEB 2HNZB 4DV0J 1RK8A 4LF4F 2DB1A 3HO1A 3JAMU 4IRCA 1VQKS 3PKMA 2G2OA 2GQQA 4MT1A 2IVMA 2G1HA 3K57A 2CJKA 3V6KA 2HVEA 3EJMA 2BW2A 4YY3J 1JLEB 1KLMB 1JLFA 4EBCA 2BMBA 4PWUA 3HKZD 1SL2A 3RUBL 3GLJA 2XMVA 3R5AA 3L7UA 1T9WA 2YNHB 3FSXA 1GEHA 1X4FA 3NL0A 4OI4A 4Q5VA 2UXCF 2Z2ZA 2PIIA 3BH7B 2ROPA 2KFZA 3TRGA 3I4HX 4QWCA 1GTEA 1XR6A 4F25A 4DCJB 3IR6B 1UVNA 1HNVA 1TAUA 1S6PA 2V4JB 4DPYA 3FMWA 1CJUB 3BGFA 3OVBA 1RT5A 3NWGA 4IDKB 1VQ7S 1WC1A 2QL9B 1NAQA 2MGZB 2HNYB 2L08A 1PAEX 3OFGA 4LFAF 5HSPA 3PRBA 3TZWA 4YN3B 1TMJA 1KD1T 2EG1A 2Z58B 4LVOP 1PJ7A 1F60B 2GMHA 4U96A 1P1LA 2X3DA 4MKAA 1NK9A 4OIXA 3SCLE 1PAUB 1FK9A 4PYDA 4OI2A 3X3UA 4X65F 2AZ1A 4ETXA 2FJVA 5KFDA 4ZHRB 2DGUA 4RJVA 3W1YC 2V67A 2R8KA 3W61A 5A8RA 1D8YA 1JLAA 3D28A 1NO8A 2HEKA 2ZOMA 5KFJA 1CC8A 4UTGA 4RW7A 2HW3A 1U1KA 3MM6B 3R8YA 3R7BB 3PX4A 3R6GB 4I68A 3BQ0A 4FKYA 2RHQB 3KHHA 2OD4A 5IT4A 4QYRA 3P4UB 2LU1A 2V8VA 2G1DA 4PR6A 2PGCA 3M05A 2IHR1 2WW4A 4DV0F 2RF2B 4U67Q 2EVZA 1FKAF 3EE3A 1T02A 4PAAA 2E5LJ 3BPDA 1FT8A 2CQBA 2ZJPQ 2O66A 4LR7A 4ZVFA 4DFPA 3MM7A 1LWFA 4DCPB 4NCGB 4CRJA 3B54A 1RHUB 4CTAB 3BSCA 1RA7A 4AL7A 5L39A 3PW5A 5I3UB 4LMZA 4OZNA 2HSEB 3LP0B 4YHHJ 5FLXY 3GYXB 1IQZA 3H42A 4OJ1A 2UV8A 2RS2A 4NXNJ 3AJ2A 2D1CA 1KP6A 1AT1B 2GVDA 4DX5A 4U6PA 1RYSA 4JI8J 5E5NA 3KLHA 2G2ZA 2KDOA 4QIFA 3B4MA 5F0WA 3GWCA 3IFEA 1L3VA 4C9DA 4C7QA 2HQ3A 3DRSB 1UVJA 2KM8B 5F3ZA 1RT7A 4Q43A 1RWOB 4DV7J 1VC0A 2BJ7A 4P7TA 4FS2A 4C0BA 1HMVA 2QG9B 3IBCB 1TFWA 4ZIVA 3E2EA 9RUBA 3KLGB 5AT1B 4KGMA 4K4UA 3CIMA 3R2DJ 3RR8A 1MROB 3QO9B 2JFDA 2QMWA 3A3OB 3ZXWA 4PQUB 3BR9A 5SUHA 2ERRA 3AA8A 2XLIA 3EGWB 1JXLA 2NQPA 1TL4A 4KV8A 2QIFA 2QYGA 4KFBA 5IM0B 3TQ1A 3KJQB 5KG2A 1Q82T 3PM9A 3R6LB 4CM2A 1H74A 2Z30B 4BDPA 1T05A 4URSA 2Z2MA 3AH6A 3KLFA 4FXVA 3TUJC 1HWIA 1SH3A 1I5OB 4RL1A 2DK2A 5KT4A 3J7ZT 2ILYA 2CQ1A 2AYBA 1F3VA 3PTWA 3HHLC 2LYVA 2RUGA 4LR9A 3UDCA 2XS2A 3C2PA 1RTDB 2AGOA 4K4XA 3DU6A 1W25A 2PDAA 4C8ZA 5G0RA 4DPTA 1CVJA 5B0CA 4M5MA 4FZVA 4B9MA 2D9PA 4ES1A 3TNVA 4C4WA 1R0AB 2CQ4A 3EM1A 2Q1LA 4XPEA 2KU7A 2XY5A 3TAMB 2DY1A 3OV7A 5KG6A 4JI4J 2HHTA 3EXYA 2DNQA 4Q2LA 2E5LF 1HD0A 3NNHA 2E1AA 1RXOB 3W7BA 1D3WA 4IO1A 4DI6A 4YS2A 4WIQA 3PEHA 2QX0A 2XEXA 4IFYA 1JQGA 4QBUA 2CA9A 3Q8RB 3MD1A 2K3KA 3W2VB 4DN9A 4UOFA 4YHHF 3I96A 5LOQA 2FY8A 1S12A 2KYZA 3UQSA 3V5RA 1RAOA 4QIWD 4J9RA 1TKXA 3NXZA 4MIAA 3PHEA 1MWZA 4WJBA 3UN3A 4JI8F 2DPIA 1TV6A 2OAUA 3H90A 3D3CJ 5HK4A 3H4DA 4WP8A 3VQSA 1IBMJ 5GMKa 1DQ9A 2CJBA 3QQCD 4Q8FA 1F2GA 2W9BB 3T1AA 1Q8IA 1PYSB 3MFIA 3TP2A 1KLNA 3MD3A 4NZ6A 3PXGa 2XM3A 4NZ7A 5D0HA 4DV7F 4RX6A 4ZN1A 1L3TA 2DCLA 4XO0A 3GV5B 2E29A 1YJ7A 2CQ2A 1ZOTA 4RW9A 1ZZFA 4P72A 4L6V3 3PW7A 4P71A 1RDRA 2V68A 4Y65A 4C97A 3GCXP 2IRUA 3H7HB 2YH1A 3U1LA 3VAKA 3ILIA 2GIFA 1BY9A 1RAJA 2CVIA 2M88A 1SL1A 3FGVA 1HWJA 3D6HB 1TVRA 2DNMA 4DL3A 4DQQA 4TQRA 1PSDA 3HI9A 4WWSA 2QA2A 4MYUA 2ZH1A 4RLEA 2NPFA 1ROFA 3THVA 5K14A 3I5BA 3ZZOA 4PXDA 1TP7A 2E1PA 1Q78A 5GMDA 1RT1B 3DGVA 4GVLA 2WB1D 1Y3KA 4I7FB 2B8PA 3PVXA 4Z7CA 1WG4A 2WVBA 1GXLA 2BDPA 3P96A 3VAIA 1CPZA 1U2FA 2GAGC 1S1VB 4JYAF 2HBYB 4C2MA 2WONB 2K1RB 3ONQA 2FTRA 3NRBA 4TU9A 3CDWA 5A8WA 2ZOGA 5IT9U 1NSQA 1U49A 1WHVA 1GK8A 2ZHAA 2YNGA 3K17A 1ZZNA 2HFZA 3FCHA 3MMAA 3G6YA 2VA3A 4RR5A 3N6LA 3D68A 2WZ1A 3NEKA 2RAQA 2ZH4A 4N56A 3ISNC 1R89A 2H51B 2QSFA 1K1QA 5F8MA 1AUSL 2R8HA 3GJSB 4F4YA 4DG1A 4B9VA 4FBTA 4X64J 3VHQA 5A8KB 3TVKA 4O3QA 1C4CA 2EFPA 1IM4A 5KFXA 4DQSA 3L7OA 4ECZA 3WX8A 2HBQB 4URQU 3NGKA 4J5OA 5DG9A 4O4RA 4HT7A 1XWLA 2NR0A 2XTJP 4F3QA 1IBMF 1NCLA 1W26A 4DX6A 4B9LA 1Q8BA 5KAKA 2AU0A 1H98A 2OI2A 4NZ0A 1DTTA 4DU7A 3Q8VA 1WDDA 4PG8A 1Y0HA 4FF4A 1RWMB 1FJCA 3MM8B 2PD1A 3MR5A 2DXDA 3KG4A 5KFPA 2ATCB 2CNNB 3TARA 1U26A 3OUYB 3H25A 1U2CA 5H9EJ 3RBZA 2A6OA 2F8EX 2DY9A 3M8PA 4LSNB 2CAJA 2ZUGA 2A10A 5M2PA 2AJ4A 4ZLPA 3PR4A 2ZHOA 4FN5A 1RWXB 2H3EB 4DR1J 1RSCA 3PW0A 3G82B 4E0DA 4ED0A 4YEAA 4UUWA 2EC0A 4OI1A 4NLWA 3DNCA 2NXUA 4J9UE 4OJGA 4OYWA 2HQIA 2LA6A 3CMES 2XY7A 2HHUA 2ZBQA 1XC9A 4B3SJ 1FTRA 2WVEA 3M2VA 4NLOA 3DGPB 2BE7D 1RLDA 1KQKA 4J9MA 2HBRB 4DR4J 3FDSA 4ZITA 3C15B 1P9QC 3MR6A 1N5SA 3CCQS 2VF3A 5HATA 2QA1A 2LLZA 3NGTA 1R7IA 4JI0J 1HPZA 3BSNA 3AD8C 1NBEB 3TZZA 1FCAA 5DG8A 4MFBB 1MW7A 5F8HA 1NDPA 2ZM6F 4M5GA 2UUWA 5LSRA 1UVKA 1N8RT 1NPKA 2RIJA 4QU7A 4IG3A 2YKOA 2DR6A 3UI3A 1XJWB 3KG1A 3CD0A 3C14A 3K5PA 4WPAA 2GW8A 2KG1A 3KHGA 1RTJA 2H4YB 1AB8A 3ELHA 2NZ4A 3W60A 2XWXA 2F7VA 3O1LA 3HSZA 2OPSA 3CO9A 4FF3A 4MKVA 1M1HA 1VJQA 4X64F 2R3VA 3OFHA 4OHXA 2YKNA 3H98A 4P2MA 2JFKA 3FFIB 1T7PA 2EFNA 4F67A 2HHVA 2JSXA 3DI6A 2RH3A 2POKA 1M90T 3QRRA 1WWHA 3TYTA 2OD6A 1IKYB 1XBWA 4PQAA 3JTPA 1S1WB 2QV6A 3DOKB 3FCVA 2HIQA 3MEKA 4FF2A 4FVMA 5D0RA 4UZBA 2KTQA 3K58A 1T95A 3A8IA 5HN0A 5KFCA 2CQPA 1O51A 1XR5A 4YMEA 1S1TB 4NOHA 4HVZA 2IRYA 2J9EA 4OX6A 3J7Z5 1IWAA 2IMOA 1U6BA 4DR5J 2JL9A 1U1NA 4WE1A 2QLJB 1F9EB 3MFHA 4RNNA 1WKJA 2CJ9A 3FBBA 4ED1A 4C3KA 2LU2A 2V4QA 3E01A 4HTIA 2KZMA 3GYNA 1DLOA 4JI6F 5ETSA 3UPFA 3T5JA 2CQGA 4IRKA 3GV8B 4DU8A 1RU1A 1NK7A 3FQLA 3DLKA 4Z37A 3QIPB 2QRRA 5L9XA 3ZNUA 2AF6A 5KFYA 2GVZA 4RW4B 2WRMA 3Q8SB 4N41A 1LW0B 1ACMB 2IFXA 1I3OB 4YUDA 3ENQA 5U47A 3VGVA 1K1SA 4B3SF 4OLOA 3GIIA 3OTCA 1W7WA 4HDHA 2ZE2A 3V6DB 4DR4F 2D3OR 4F2SA 5DLGA 3LOUA 3HSGA 3FRZA 2BV3A 4HTJA 3H2VE 3DDNA 2MMYA 3D5MA 3CIZA 2OFGX 3DLGA 4JI0F 3IR5B 2QT7A 2ZDOA 2DHSA 1PYOB 2RT3A 5JVHQ 2B5JB 1KHVA 4HR2A 2P5VA 4OJHA 2JH3A 3GIJA 5IS2A 2C3YA 2Y3YA 3HVTB 3IGNA 3IWXA 1F9FA 1S77D 4AL6A 2VD3A 1N5QA 4FNIA 3D9BA 1X9MA 4LIRA 1TUGB 4D3HA 2JNJA 3N79A 1K0VA 5HMZA 2VC1A 5JMNA 1OJ4A 3WBZA 1E6VA 2DYAA 3V2UC 5L1JA 1X0PA 4PWDB 3OR1B 1RU2A 3O5TB 3OTDA 4F2RA 2IA0A 1BQMA 3NBPB 2QE5A 2BRLA 1S9EB 1G1XA 4Z7YA 4ED4A 2V0NA 3I9V9 4RU2A 1LWCB 1WC0A 2EK1A 2MDAA 4DSKA 5IWAJ 2MXYA 1HHTP 2Y1RI 4UY85 1Q8LA 3MZIA 2UVWA 2EKNA 2C28A 4FP9A 4IH6A 1NJYA 4RUBA 3ZZPA 1HNIB 3P6YC 4JV0A 3LGHA 2YPZA 2RDDA 2DCUB 2KXHA 2JHEA 3G4SS 1FNOA 4YB6A 3TJ8A 1EKRA 1Z2LA 2COLA 4RW8A 4DPUA 2B3TB 5C42A 4OMFG 4KGXB 1KOHA 4ECWA 1M5PC 5DDPC 4O44A 5HANA 5BYRA 4WZMA 2FVSA 3GV7B 2ZBCA 2WK4A 2Z57B 1KFDA 5CYQB 1TL7B 5KT5A 2GHWA 2R7QA 2HHXA 1UWBB 1U6FA 1URNA 3I55S 1TK5A 3MR2A 1V5VA 1FX4A 4UUXA 4NYZA 1LWXA 1ZTWA 3OJUA 2P9GA 5CAAA 4G1QA 4E8UA 4PCQA 3SSRA 4ETZA 5KG3A 5EWEA 4M8LA 3T6JA 3MDFA 1Q79A 1T9VA 2LEPA 1IBCB 1S1UB 4QPTA 2ZH3A 1FJGF 4PXEA 4DOZA 4ES3A 3HZGA 3PY8A 1FKPB 1HBOA 2W8KA 4I2QA 2FJDB 1QDUB 1FJ7A 4OL8A 5GAEU 2RDIA 4OHWA 4NCAA 2ACMA 2VPWB 2PSZA 5DS7A 1NHVA 4ZPTR 5HL7Q 1FWLA 3CC4S 2VQFJ 5GADI 1XR7A 3N9UC 2XY6A 2KRBA 2R42A 3LANA 2MSSA 5E3CA 1KVKA 3MEGA 1FVQA 3LH2S 2KRRA 2D41A 5LXYA 2E7XA 3AHPA 1FKOA 4MYTA 1AZSA 3CCES 5KFKA 3N4WA 2UUBJ 4X4VA 4M5HA 4QWDA 2LEAA 2YQ3A 4OZ2A 2CPYA 3CW2C 1WC3A 2BE2B 2HZCA 4C6AA 2IVFB 3TJAA 1Q7YT 4MIWA 4F36A 5L8RC 4QOTA 4IUFA 1UA0A 2NLWA 1SH0A 2G13A 5KFQA 2Y1LB 4HYKA 1C1BB 1FDBA 2CQIA 3N01A 4B3MF 1CS4B 2FJAB 3RBDA 3AOAA 5EX0A 3MR3A 3ZO7A 2P6TA 4C8NA 5HQLA 3K5NA 1T03A 4DLGA 2BKNA 3FSIA 5C7PA 4JOUA 1MU2A 2FVPA 1FK9B 4QWAA 4X4QA 3DYAB 3WDOA 1G3OA 2J9DA 3KWMA 2QN6B 1Z2ZA 3W64A 4DR7J 4JV1A 2HS0A 4L76A 1V6HA 2ZH6A 1N34J 3D67A 2UVUA 1FRIA 1RE1B 3FRYA 1BMQB 2AV5A 4EMDA 2CJXB 5JVGQ 4NPOA 1IKWA 2DH7A 5HI7A 2O3DA 4OYMA 1I51B 5K8PA 2JEJA 1WI6A 2CG8A 4A8FA 4DSFA 4WP9A 1W2IA 3I0SA 2QFIA 3R97A 2AGPA 3T1YF 1DHMA 2NSCA 2HNZA 4KO0B 2EWHA 3UE2A 1Q53A 2VA2A 3NCQA 3HPOA 1HFEL 2ZNZA 3T5HA 4AD6A 1T94A 1KNZA 1Y4ZB 4P2SA 1MWQA 2OJ3A 3Q22A 4EGLA 3F73A 4DEZA 2AIRB 4DQRA 2CPJA 3BPSP 4PG6A 3CMQA 1KS2A 1UPMB 3DRYA 4XDCA 1VBXA 4EBEA 5CHCB 3UDLA 1JLEA 2ZH2A 4ED5A 2VQFF 1TKTB 2I38A 2VONA 1E6YA 3JXOA 2R8GA 1OIAA 3PIOQ 1UWAA 3LP1B 2HS3A 1VRTB 1SC1B 3GFYA 4PG4A 3U02A 3DDKA 5DZ6A 4USUA 1FRLA 4PPZA 3SI8A 2ASJA 2DISA 3FNNA 3SV3A 1VRUB 1CJUA 3DOMA 2KT5A 5LJ3Y 1S59A 4RNFA 4IDKA 4DF4A 2E7WA 4OYXA 3MHYA 1TL1B 3GMGA 2HNYA 3ITHB 1TK8A 3ZZ0A 2NS1B 2F9DA 3PJWA 3CJTA 1SKWA 3WC0A 2AX1A 4CDIA 1FFSB 2X1BA 1QVFR 2J9DE 2CZ9A 3KKFA 4PRFA 3M7VA 5C5JA 2FD2A 3I5CA 1CBKA 4KV8B 3U7JA 1RAFB 3HM9A 3EWGA 2PMWA 4P2FA 2BR0A 4DL0C 5EWFA 2YWGA 5C24B 1S48A 5E3PA 1H7WA 1QJHA 1AYEA 2DHHA 3LA0A 4DR7F 3KLFB 4R25A 4ZHRA 5K9FA 1FRHA 4GO5X 3PR5B 3DLEB 5D4PA 1N34F 3TUZC 3EDRB 3PO4A 4MJKA 2B9XA 4Q0BB 2VH7A 2XBPA 3VAFA 2F63A 1RWUA 1U0HB 1UKUA 4N76A 4RPFA 2MQPA 4EFAC 3T41A 3OTOJ 1OYDA 4BCAA 2DNLA 3MM6A 4B3RJ 3NOCA 1M5KC 5L9NA 1H2VZ 3CDUA 4O3OA 1DY3A 2CUYA 5GAHU 3WIUA 1G6BA 3OL8A 2M5YA 3MM5B 7AT1B 2JLEA 4DUYJ 2RF2A 2H1YA 3M8ZA 4ZLJA 2FQQB 4KAIA 1U25A 1ZS6A 1VBYA 4TY8B 1QAIA 1WNEA 3CE8A 2VODA 4F50A 2LKZA 4NCGA 1RAAB 3PACA 3QFWA 4N7TA 4CTAA 3VGSA 2E5JA 4A8MP 3TZYA 3LP0A 2Y0BB 1LV5A 3R5JB 3PDNA 4NI2B 4HLBA 3RR7A 4DSIA 3T1HJ 1TKXB 5ETOA 4IR9A 4RWWA 4QR0A 2XZDB 1U09A 3PRDA 4TN2A 2PE8A 3DRSA 3SDEB 3C46A 2XGPA 2XYGB 2HPUA 2HQDA 4OZ3A 5IXUA 4IYQA 5HQ8A 3CC2S 3QT8A 3HHKA 4JI3F 1DARA 3VTIA 2CJYB 2HLUA 4BS2A 2J6TA 4Q7AA 4D3GA 3CDBA 1D9DA 4K50A 4I6WA 2NZCA 1I94F 4ZKAA 3KLGA 2RQ4A 2FHOB 2BX6A 3QO9A 1FFWB 2N3OA 1S0MA 4OJ3A 1VGYA 4W98A 1N6QB 4PQUA 4P73A 4ZVHA 4F4XA 3BBBA 5IM0A 4OI0A 1YLXA 4A46A 1RT2A 2IM1A 4CNYA 4UF4A 4KPYA 2K7JA 2G0JA 1HNWJ 3CULA 2H9ZA 2QL5B 3IWLA 2GO8A 3KJNB 4LBIA 1QAYA 4KHRA 2RDJA 3OD2A 2N3LA 2HAFA 5E33A 1SC6A 3UD5A 3SZ2A 2CQDA 2N4CA 4A8XA 1WC6A 2BRKA 4DLEA 1ELOA 3HP6A 3KFWX 4DV2J 1WEZA 4B3RF 2CNKB 2B9WA 1TAQA 4K4ZA 3HHNB 2GFFA 4ECYA 3B82A 2B4OA 3NWRA 1R0AA 4ZJOA 3TAMA 3HSDA 1V9OA 2ZD1B 4DZDA 3Q2SC 1I1GA 2DNGA 3BEGB 4J9KA 1ZYQA 4F3MA 3B8HA 4KJIA 1IUJA 3Q8UA 2KXNB 2XI3A 4G1PA 2DH8A 3TR5A 3WQPA 1XQIA 2QGFB 2KH9A 4OHVA 5EHHA 1ZA1B 2DITA 3BYRA 2QLWA 4WBFA 1H2TZ 2WVCA 4QYZK 3HD1A 2KYXA 4DG1B 3A8JA 2DNOA 3FKBA 4ZOSA 3T19A 2RNEA 1SVDA 2FGOA 3MCSA 1NK6A 4J9NA 1N48A 4LF6F 3DLJA 5AXMA 4Q45A 4CM0A 3CDEA 2XCAA 2JWNA 3I87A 2MZSA 1MMNA 4YB5A 3OL9A 2W9BA 1TL5A 5HLFB 1DTTB 1SIWB 4J9SA 3QJPA 3CJ8A 4UZCA 3AA9A 1T9UA 2CQ3A 3LP2B 4LF9F 3OLAA 5HMWA 4PABA 2FZCB 4ZVTB 4NEYA 5CABA 5KFTA 2IY5B 3BKFA 1NB2A 4AFFA 2CZVC 4IO9Q 2RB7A 1SCJB 1S1XA 2Q79A 1Q4RA 3ZZUA 2IA6A 4JI7F 3CCJS 1CULB 4CI0B 5HBMB 1RHQB 3GJRB 4DUZJ 1X4DA 1VK8A 2AJ1A 2OEMA 2K8GA 2AP6A 4UQGA 3W66A 1DFDA 1SC3B 1SXLA 2QLXA 5D6GA 1UPPA 4TLQA 4LFCJ 2LXFA 2XMUA 2QEXS 3CF5Q 4DR6F 4GVBB 4LQ3A 2E9TA 1N0VC 1P6TA 1RT1A 3UCZP 3RB6A 4I7FA 4DV2F 2HS4A 3Q8PB 1DTQA 2A18A 4C8OA 1FESA 2BXJA 1S1VA 1N0UA 1HPZB 1NUEA 3IAS9 3D1OA 1LWEA 5F0UA 2M8DB 2QLFB 2C2OB 4RBTA 2LQ9A 1O5JA 1F5BA 4LRBA 2D3UA 1QTNB 2K3IA 2RKIB 3T9NA 1HW8A 4HI2A 1YJWS 2G0IA 3CCMS 2EC2A 1RTJB 2ZH8A 4DV3J 3JQJA 1WKLA 2YQ0A 4G3IA 2UU9F 2AGQA 2HVHA 1F5CA 1LXJA 1TUVA 3FBFA 3S01A 3ULHA 4A8OA 3MMCA 2ZUAA 2BACA 4CWBA 3WZ0A 5A8KA 2XZTB 3FEZA 2QYCA 4FYXB 2IYGA 5H9FK 1EJ7L 1KKHA 2DGOA 4K59A 2H48B 3NAIA 1K47A 4JUZA 2VL1A 4KH0B 2AX0A 3ZFVA 5EWGA 1UVIA 5CCLA 1EP4B 3GSIA 2YNIB 2J0SD 4ANEA 3QZ7A 1CG2A 3BZQA 1BD6A 2I2YA 4DQPA 2HMIB 4USJC 3GFZA 4NRUA 2CQ0A 1SV5B 3MM8A 4C8LA 4TY9A 1TTHB 8RUCA 5HMYA 1PBUA 2ASLA 1WTFA 2UUTA 3KK3B 3LWLA 2B43A 1J5EF 1SKSA 4QR2A 3J81j 3C8YA 4PXCA 2LQ8A 1VIXA 4LSNA 1YBUA 5HVHA 5G4DA 2OEKA 3IR7B 3PW2A 1F6TA 3TA0A 3G82A 1SUQB 3ZZTA 1XNRJ 2M2BA 1SQEA 1ZBTA 1RHRB 2XHWA 2ALZA 1X4HA 1N54B 2XGQA 4N5SA 3KLVA 3EGZA 3BSAA 4LFCF 4AL5A 1J5OA 1HQ2A 3GTYX 4DXLA 3DGPA 4HHUA 4EWTA 3KHLA 3JS9A 4PZVA 2HFSA 1XMBA 3OHAA 1R6VA 3PYGA 2FGCA 3RBEA 1OY8A 1FEEA 2A0FB 1Q1KA 2X1GA 4LIWA 2B7CB 2LECA 4OYIA 3UCUP 2DR5A 3NOGA 2MKIA 1YJUA 3NLCA 4M5KA 4GKJJ 2XHCA 4MH8A 2HGNA 3J7YI 3V81B 1HARA 4MFBA 1RWWB 1RLCL 3VVUA 1FRJA 5F3TA 3EVOA 3KUGA 3BO4A 4M5LA 2B4UA 1Y9OA 2V34A 3C16A 2FZGB 3Q2TC 2ZH7A 3CTRA 3CCZA 2PI5A 3TOQA 1RT4B 5K5MA 4ZIWA 3M6UA 3P3DA 4M95A 4C11B 1YJNS 4URGA 1GQEA 4Y2MA 5D15A 4OQJA 2MLYA 1WHWA 3RB0A 3FFIA 4ZLLA 3M32B 2F3JA 1N32J 1IKYA 2CFXA 3MPDA 1S1WA 3DOKA 1PC5A 2RRNA 1RWKB 1DJ0A 5LT5A 1RHJB 3H5XA 1T9XA 1YBAA 4WIIA 5HQMA 4FYDA 3PYEA 2I0XA 1S1TA 4PPDA 2IMWP 5F41A 3MPUB 1NRKA 3G8TA 3N28A 1YG0A 2MZJA 5JUMA 1HI0P 2DGTA 3P5TL 1RTHB 2QZ8A 2BANB 3PIPQ 1MG7A 1NXIA 4DN0A 1XMQJ 2FHMA 1GAOA 4ELUA 2DR9A 3ETOA 2B0GA 2WVDA 4DFMA 4O3RA 2KT2A 4EZ6A 3QIPA 1H3DA 1HR0F 4ES2A 4G1QB 4RW4A 5B08A 2BJ1A 3BGRA 4WFBQ 2E5HA 3EUNA 2UUCF 3I0RB 4M63A 1S9GB 1ULRA 4KSEB 1O6XA 3NMRA 4CZCA 1OWXA 5J2PB 4X4UA 2AJFE 2Q6BA 3V6DA 2D3ZA 3CJKB 1JXVA 3W9IA 4FXDA 3VGUA 4C8YA 2IM3A 2I1RA 2K7KA 4HH1A 1ZAVA 4BC9A 1R31A 3G87A 2N82B 2DO4A 4GKJF 4QIVA 5KT6A 4GMKA 3D0HE 2ZEJA 3DRPA 3H0PA 3QJJA 1UJ4A 1RQ0A 2XYPB 5IC6B 1OY9A 2MJUA 5IOLA 2HFVA 3QGHA 5KFGA 3FEXB 5I42B 3AB4B 1VQNS 4ZP7A 1AZSB 4CP5A 2R8JA 3HVTA 4KTQA 2JC0A 3NNAA 2YBVA 2J6SA 3W5ZA 1F0XA 3L09A 4A8SA 1P8GA 4ELTA 4DX8H 5D4LA 1VCTA 4CO5A 5B7WA 1YVFA 3T3FA 1X4AA 2XMWA 2IJFA 4ERDA 4ANCA 2F9JA 5T14A 4DV4F 4LFBJ 1RHKB 3TUIC 4PWDA 3OR1A 1ZPWX 1JLBA 1PCAA 2B6AB 3QYYA 2W8LA 5FDLA 3RG6A 4KBIA 5ETKA 2ZKTA 3NBPA 3ILOA 4JI1J 4FVCA 5HJXA 3MPYA 2R9LA 1S9EA 4AQYF 2IBKA 1LWCA 3QLHB 5B0BA 4OZ0A 3DHWC 3O2IA 3TA2A 4B3OB 3MOZA 1H73A 2VPZB 1UA1A 4C3MA 2HRUA 4KHPJ 2BJ8A 4ZPVR 1WSVA 2MKHA 2ZITA 3L9ZA 2QA4S 3R5BA 1S76D 3QBCA 2KFNA 4H54A 1OSDA 1XMQF 1DURA 3OFEA 2C1EB 2JOQA 1RT6B 2UZAA 4C48A 2EBEA 2E1RA 5CYQA 4I1TA 1M1KT 1UWBA 2XLKA 2FZKB 1IXKA 2Z4PA 3MEDA 5IV4A 1JB0C 2GJIA 5F8IA 1X4BA 2W1BA 3DM2A 4U95A 1MWYA 4M5JA 2CPDA 5CYMB 2IAJB 1U8WA 3CNQP 3BQ2A 2MJNA 1UTAA 1YGYA 4X4NA 2X51A 1BQNB 4ZCKA 3J80Y 3VCDA 3D2WA 3SMZA 2MQOA 1S1UA 1TKDA 4ZPCA 1TK0A 1U1OA 4QYZJ 4MTPA 1CQMA 1SJRA 2VQEJ 4ED7A 2LCWA 1FKPA 3LGNA 5KFEA 1OYEA 4H4KA 4FYYB 3VV2B 3WC2A 4DFJA 1IBKJ 2W2QP 2KHDA 4USKA 4DR2J 4C8KA 4YFUA 3CMAS 4MAKA 3DU5A 1E6YB 3W8PA 4O3SA 1YZ6A 3ENAA 4NLQA 2R7VA 1T9TA 3HF5A 1EQMA 4CH1A 5B0FA 2XLJA 2V69A 5JJBA 1S0OA 3EXCX 2VJUA 2O01C 4DWIA 2OH2A 4OX7A 3UN5A 4GKKJ 4ZVOB 2ZVIA 2V2KA 3MUVP 2FLPA 1KWMA 2CG4A 4RUHA 4KB7A 2JDJA 3DOMB 3W3SA 2BE2A 4ED3A 2YTCA 1KHWA 2WBMA 3RRHA 1D9FA 4ECQA 3ET6B 5EUHA 2V6AA 2H4WB 1V3RA 2W2PP 1C4AA 3CWJA 1HI8A 2JEIA 2RQKA 1C1BA 3S1TA 3QRPA 4EYIB 4JI1F 1CS4A 1KQGB 1NSAA 5KG0A 4WFAQ 2F4VF 3ISZA 2E5GA 4ILMA 4PG5A 1IR1A 1U0SA 3RAQA 5HP1B 2X3GA 2PMHA 2YX4A 1G2EA 3BGUA 1TELA 2N4DA 2MYFA 1FA0A 2RU3A 4OX9J 1H2UX 1FXDA 2M70A 3SFUA 4J9PA 1NZ8A 3P8BB 3DYAA 5HVFA 4F3OA 1B4SA 2NXNA 1KDNA 2HVDA 2V8HA 4Y2KA 2ZZMA 1SIZA 4JV5J 2OUGA 3Q89A 4CT8A 2BVZA 3C19A 2MKJA 3EZOA 2HVZA 1GXUA 4OLPA 1ZAWA 4OX8A 1NJIT 2F1FA 4KGZB 2GMLA 3MURP 1QSLA 4X2BA 2RRBA 3W9HA 1R8AA 5AJ3J 2OLWA 5GAGI 4IG0B 2YNFB 1T8EA 2HWIA 4X62J 3QFHA 3UNYA 1N5VA 1RTIA 2ZBIA 2ZOFA 2FJWA 2YWWA 2KL8A 4KO0A 1F9HA 1NK5A 3KLIA 3K8VA 5EDWA 2XMKA 5KFOA 5KFNA 1NSPA 1QLNA 3R3TA 5L1LA 2R7RA 5AE3A 2VQEF 3JTOA 3CC7S 2RD5C 4DV5J 4DSEA 3UVJA 1FD8A 1K0TA 4KGKA 5CD4A 2O1PA 1IBKF 4MK7A 1HBUB 4K4SA 4YY3F 2I6WA 2G4BA 2CKWA 1S5ZA 1RKJA 1TKTA 4P52A 4G1IA 1GX5A 1Y5LB 2ZVSA 1N88A 4J9QA 2JJ4D 4DDFA 1N5YA 1GT8A 2VC0A 3J80U 4JV2A 5E7OB 3LP1A 5F8JA 1VRTA 5CZVA 3RGIA 3A3NB 1R27B 1YRTA 2J0WA 3QWPA 4GKKF 1VISA 2VG5B 2AKWB 2BM0A 5IT0A 2DHXA 1XMOJ 1NJWA 2VG6A 4NLGA 3K0JA 1VRUA 1K9MT 5KFWA 2APOA 1Q8KA 2OHDA 1HWUA 1NDCA 1NJXA 5KFAA 1EB0A 2HK3A 1TL1A 8ATCB 4GC6A 2GIRA 1SJQA 3ITHA 2BW7A 3MR7A 4ENOA 2OPQA 1ICEB 3PJXA 5AE2A 4DL6A 3KTQA 4TQSA 4IOCQ 3CGIA 4N8OA 4RBVA 5C25B 2N7YA 1CJVB 4UOCA 2PEBA 1S57A 1U2RA 3D6MB 4OX9F 3NGUA 4XDDA 3BBCA 3L95X 1RT2B 4EO6A 3M1VB 1X9WA 5C24A 1P1TA 4ZVSB 3UD3P 1LW2B 1IM6A 1R8CA 4LRAA 3LUYA 2A2CA 1S0NA 3FQKA 1T3OA 4LF7J 3G2XA 2HBZB 3DLEA 2KN4A 3D54A 4L3KA 1UW4A 4Q0BA 1OO0B 2ROEA 4ZN3A 3HHLB 3SYZA 2MKCA 1U0HA 2F8MA 4NCBA 2HRYA 3I5AA 4WK3A 1NK8A 6AT1B 3BKTA 3PV8A 1Q81T 3BSOA 2XI2A 1C1CB 4LF5J 1H7XA 4S0MA 2WTFA 2VUGA 1QD1A 3CPWR 1SQGA 3MM5A 3M9MB 1AFIA 2F65A 1M1GA 2J76E 4GC7A 5BXIA 1BWEA 1F3FA 2XO7A 3OT9A 3A1YG 4PUOB 4HHHA 4J9VA 4F04B 2V9WA 4HDGA 4TY8A 4I56A 1TR0A 1NEEA 3CD6S 4AT1B 1BUXA 1HNZJ 2I5JB 5C2CA 1FWPA 2HZAA 3PO5A 2HWHA 5KG4A 3CJ3A 4LT6A 1HWKA 3RB3A 4NXNF 4WFNQ 1AXQA 1LNQA 4NI2A 4F4KA 1XN9A 4AXIA 4RW6A 2NYHA 4F0KA 1S6OA 3J7AN 1MNEA 3FBCA 2I8EA 1TL3A 3BF4A 5A2QY 5F8NA 1JNZB 1XMOF 4B17A 4HEA9 2ZWOA 3SDEA 1CJKB 4P75A 2EPIA 3W2WB 4LSZB 1B7YB 1FX2A 3R9LA 2GA7A 3MAAB 2GQ2A 4DS5A 4DHVA 5FLXU 3M6XA 3OTBA 2RJZA 2XQCA 2FDNA 2QA4G 3NG8A 2PFFB 4K0KJ 3H5UA 2JX2A 1S1XB 2ILZA 4L74A 1N6QA 4CO1A 3JQMA 5J2NB 3KLEB 2VICA 2LQ5A 4YOEA 3DRXA 3NCPA 1RAEB 3TEHB 1HQUB 1N33J 5C2GA 1VQ6S 2B51A 2CPEA 5I4MA 2W2NP 3OHBA 2C42A 4P7VA 5AXKA 1Q86T 2L41A 4B3TJ 1NH7A 3GJTB 4LBHA 1FI4A 3IRXB 4ILLA 3MI7X 4LF7F 2N7CA 3K2YA 3DOLB 4FNHA 1SBRA 3KG0A 1U24A 4X4OA 3CXCR 1NHUA 2EFQA 3EGVA 2MB0B 4Q2MA 3GG0A 2YKMA 2G2YA 1J27A 4WKYA 3SSQA 3IBWA 4LF5F 1DTQB 1AW0A 1U8SA 2V2QA 1YX2A 3ENWA 3PW4A 3EZUA 1LWEB 2DT9A 4K8RA 5J1PA 2CQHA 2P2CB 1TUWA 4JI4F 2ZD1A 4MIBA 2HZVA 1HKAA 1S6UA 2E5IA 3KMQA 3QSIA 3QGGA 4CYUA 2Z8QA 1RWVB 4BWMA 3CCLS 1TFYA 3G8SA 1F5AA 4I0WA 2RMLA 1FO1A 1HNZF 1YSJA 2LQBA 3OFFA 3K5MA 1XTZA 2DD8S 1VK3A 6FD1A 1X4EA 2A2DA 4BHQA 1EETB 3W62A 3RJMB 3MMCB 4QW8A 2HURA 2NCKL 3R7SB 1APSA 2M8HA 3PFOA 2GGPB 1UZDA 5FD1A 4F8RA 5GADU 2MY7A 1UEUA 4FDFA 2HAIA 1QE1B 3IGVA 2Y9HA 1TMMA 1RP5A 4O4GB 2AZ3A 5HLFA 4ZVEA 2OTLS 4C8MA 1B99A 3LP2A 3BGOP 2GIQA 2CWKA 4G6VB 5KFBA 2XZWA 3ZTPA 5A76A 1U4BA 2DNHA 3HFKA 5L1KA 1YDLA 2EFGA 1D8ZA 1WOPA 2V2ZA 1PJ5A 1FWKA 2AHOB 4YR0A 3W63A 3I9ZA 3HX9A 2HHPA 4NLTA 1CULA 2OPRA 3BB5A 3D0GE 5A2QU 4OYZA 5HBMA 1OPIA 3OL7A 1B7FA 1N33F 3MMBB 1X5SA 5IV3A 3MECB 4BC7A 1H38A 5KOWA 3P5BP 3V4MA 1MMDA 1S99A 2W4DA 4CLZA 4H4MB 4B3TF 5DZ7A 2AT1B 1UAWA 1WHYA 3HT3A 1L5UA 1J5OB 2GX8A 2WSFC 4U7CA 5CH7B 1LK5A 4IH7A 4GVBA 3KK1B 1JX4A 4IOBA 4P10A 2U1AA 3LTOA 3K59A 1S7IA 2MQLA 2BE9B 2ZFHA 1UFWA 3K5OA 5B0EA 4DBQA 3M8RA 4OYOA 1QSYA 4ZVGA 3TAPA 1U02A 4LF4J 1VDHA 1L3UA 2E1MC 2VKRA 3QWUA 4AXJA 3SV4A 4WF9Q 4FS1A 3C6UB 1S6QB 2FJXA 1KC8T 4CLUA 2RKIA 2XB2D 3OXFA 3E3XA 3C16B 5K20B 1PBAA 1R3NA 3POTB 1KSPA 2HHQA 2CNLB 4TU8A 2RQCA 2BM1A 1JMTA 1JXEA 2RRAA 2ROGA 4TYBA 4NLDA 3F56A 2W4CA 4N8NA 4CH0S 2B56A 3V6JA 2UXCJ 3HK2A 3G96A 3RRGA 2WVFA 4KPCA 2XWYA 2X1AA 4DV6J 3T5KA 4L75A 3GG1A 1HHSA 5KFFA 1XIQA 4HL9A 4I2PB 1IR2A 4CLLA 3LO3A 4FYVB 4I67A 1D9AA 3F0NA 1ZM3A 1EP4A 2E9ZA 3DKDA 2UXDJ 2YNIA 2C2DA 4J9OA 5F8GA 2GAHC 4LFAJ 3N5BA 2HMIA 4ZPDA 2XCPA 4MKBA 3PKYA 3NCRA 1SV5A 3SCIE 4U7UD 1U7LA 3PHTA 2DR8A 3KK3A 5HROB 1SC4B 3WX4A 1HBNB 2WB4A 5ETNA 2OGUA 3JSRA 3LGMA 3GFHA 1PJ6A 2YKAA 3F41A 3M8WA 1KRPA 4ZCMA 3TWZA 4HI1A 4TXSA 4QIGA 3JSBA 3UN2A 1HHQA 3OVAA 4DR1F 5THWA 1ZPVA 5DQHA 1SUQA 5E41A 4WYLA 4B9NA 4ZPAA 1H72C 3BGRB 4K2JA 2VFRA 2ACYA 1QSSA 3DMJB 2VOOA 1SJ4P 3M8YA 1DRZA 2ZZNA 3QT5A 5CD4H 3AD7C 3KK2B 2W2OP 3KJVB 2XSJB 3GQCA 1X4CA 5H9EK 2CPFA 4R5PB 3NMAA 4WXWA 1X60A 3MM9B 2AWZA 3RBXA 5LMNJ 5F9LA 3ILLA 1VFJA 1I6JA 4XIUA 1U1LA 2DGVA 1JIHA 1RISA 4NLPA 2R2TA 3MAHA 3V81A 1WEXA 3DRPB 4K4WA 4F0MA 3SSSA 1SKRA 1BE4A 4IFVB 3CCVS 3BO3A 3GP9A 2ASYA 1IKXA 4L72B 2EFVA 1RT4A 3C66A 5ITHA 1NKEA 3OBIA 3S7RA 3OSNA 1NKCA 4KGVB 4C11A 1UCNA 4NE9C 4I4BA 3GFXA 2HIYA 3M8QA 1JLBB 4DV6F 2R7SA 4F4AA 1QTMA 5FDLB 4ID5B 3M32A 3QGPA 2P9EA 2VZ9A 2V63A 2P9CA 1T11A 2FC8A 2YVSA 3M30B 1WD6A 2Q3PA 5T7LA 4EUVA 4OV6A 2VG7B 1R8PA 2UXDF 1NB7A 2KJVA 3I56S 2DEIA 3U27A 4DF8A 4DR5F 2EK6A 3BH6B 1RYRA 1FDDA 2QC3A 1W2BR 3EDQB 4TYAA 3V4IA 4OV1A 4CO2A 2DR7A 2BQRA 4J90A 2AEMA 1RTHA 2BANA 2MZRA 5CA5A 4TVAB 5CZXA 3IBFB 3G9CA 2CPIA 2PO4A 4FBUA 4IH5A 3DXBA 3IXQA 1LK7A 3PG9A 4RNMA 3MEDB 4NXMJ 3AD9C 1CLFA 3DM2B 1HL6A 1HD1A 2JLGA 1Q7LB 2W25A 1VS3A 2FUG9 3CCSS 2OIHA 1FRMA 2LP4A 2LEBA 3SQGA 1VQ5S 2B4PA 4FF1A 1MN7A 3FUYA 5GMEA 2CWXA 1WF1A 1S10A 3I0RA 3Q83A 1S9GA 2XYHB 3DLHA 4IQXA 2L9DA 5J2PA 3PX6A 2PT0A 3OXGA 3JYTB 1YRUA 3L7PA 3H4BA 4ZA1A 2CPHA 4BLGA 3CJKA 5LMNF 3O44A 1JK9B 3G8QA 1S9FA 1REGX 1U1RA 1V5IB 4K2XA 1CC7A 1PGZA 1Y00A 4EZ9A 1UW9A 4TNOA 4OZ5A 4CCHA 4FYWB 1IN0A 2B4VA 3V6HA 3KHRA 2RUSA 1A7GE 1YHQS 1QM9A 2DGQA 3GSDA 4HH0A 2IRXA 5I42A 3VF0B 2BJDA 3MEEB 3OTEA 3DHXA 2ABYA 4A8KA 3CSKA 1Q16B 1EHWA 1LXNA 2HNDA 2FC9A 3IO1A 2VPYB 3MUTP 4CLFA 3M9NB 2QJ3A 4ELVA 3A8EA 3KXDA 2B6AA 6FDRA 4DL7A 3GE9A 5HJYA 4WTOB 2KM8C 1D09B 1X0FA 3UD4P 1TQLA 3QLHA 4K4VA 2JRSA 5IWAF 4CH7A 4B3OA 3CCTA 2VFUA 3FCWA 4ZMMA 2BABA 2J8AA 3PYFA 3I6PA 1BHNA 3G86A 2WHOA 5FIIA 5LSLA 1N56A 1RJJA 2ADCA 1M5VC 2B8QA 1KONA 2PMZD 4NYOA 2JEFA 4XK8C 3TUPA 2KT3A 3MWBA 1RT6A 2ZH9A 3SBMA 4J9LA 2NXCA 4EU0A 3N0VA 1U1PA 1KTVA 4NA1A 4ZVRB 4LQ9A 2BJ9A 3TX0A 4I6YA 1GX6A 5KFLA 5KT2A 5EX3A 4NXMF 5D4OA 2OFHX 3G6ES 1S72S 3IM9A 4QCLA 5IT9Y 2FYXA 5CYMA 1CSJA 1RTIB 3B78A 2IAJA 1KN6A 4R0EA 4CLSA 3BN7A 4DR3J 3GIRA 4AE5A 4WK1A 2Z56B 3KLIB 5K8OA 1BQNA 2BQ3A 2DRBA 4U8VA 1G7CB 3LWMA 5J2MB 1NU4A 4I64A 4RWXA 4LRDA 1MMLA 3ZTRA 3K5LA 4JYAJ 3UVJB 4BBYA 2W2MP 3KJFB 2AJQA 1VQLS 1EX8A 1Y11A 1C0TB 3Q0AA 2V8DA 1S7HA 2W7OA 2QLBB 3RW6A 1KVIA 3EYZA 3LPEA 3NNCA 3R1LA 3ZTQA 4B02A 2V5HG 3ZNJ1 3PFEA 1N5YB 4C0OC 2AYMA 3QATA 1A9NB 3AFGA 3QJLA 3JTNA 2OO4A 2C3PA 1NM2A 3D1HA 1WKKA 3VALA 4M5IA 2UUBF 3J81Y 5BR8J 1P27B 5IC4B 2MHEA 3H2LA 1NPPA 2VG6B 4QW9A 5A6WA 4TU7A 5DLFA 2AYEA 2E44A 1FFGB 2AMCB 4ZP8A 3ET6A 4NLRA 1JKHB 2V50A 3T6BA 4ZVQB 2G0CA 2OPQB 2J7KA 1RADB 4WU2A 5MAOA 1MN9A 5KG7A 2D7SA 3NP5A 3ENVA 4NMLA 4V19X 1Y5IB 4WFXA 3RYLA 1VBZA 5HP1A 3A13A 2ADBA 1Q5VA 3VAGA 1VQ8S 1B70B 3FSYA 1JJHA 3I32A 2MQQA 1VQMS 3R7NB 3EICA 4Y3CA 1UVLA 2C3MA 1HLWA 2EG2A 4PXBA 3IG1B 3JSMA 2EFOA 4LBPA 2OPPB 3GCWP 3KOAA 1U48A 4IG0A 1HI1A 1H0HB 2RU9A 4UY8T 2C2KB 2GJFA 3Q23A 4NEZA 2IYIA 2YNFA 3O6QA 1NHKL 3H40A 4KIAA 1YTYA 4AYBD 3ZTOA 2W7PA 1Z1ZA 3QNWB 3QAUA 4DR3F 3N6NA 3ICLA 3ZZYA 4OYBA 1NSKL 4EO8A 4NLUA 4X4SA 2CXEA 1RACB 1WG1A 2HLTA 1VI7A 2LXUA 5DETA 4ED6A 1FE0A 4X84A 3U1NA 3MTKA 3HJVA 3TX8A 1VIOA 2H5JB 4U7UK 2A1BA 5LXRA 2WAQD 4DV1J 1BC6A 1HIYA 5L38A 1HBUA 1WUUA 4WZQA 2YX7A 2ZM6J 2KHCA 2CPXA 1SQFA 2BKOA 1TKZA 1S0VA 2LXIA 2DJWA 4RW6B 4P6QA 2GJ2A 3J7YU 1OQ3A 2GNKA 3JQKA 2WBRA 3TQEA 2CQCA 5JXSA 1TL3B 3IWNC 5BR8F 2VG5A 3IS9A 4B9SA 3PCOB 2P8IA 3CD7A 2Q6CA 4RKUC 3M2RB 4WKRA 1U47A 4LRFA 1RTZA 3HHEA 5I3QA 2FPHX 2DNKA 1X7VA 1RZMA 2OSQA 5HMXA 1VLOA 1T0TV 1HYSB 2DGWA 4NMXA 4HKQA 4OZ1A 1X4GA 2R7WA 4KYZA 1YJVA 4ALZA 3CJ5A 3G6VA 1A6LA 2AEJA 5D3GB 4ECSA 2CADA 3QIDA 5C25A 2LDYA 3J81U 1CJVA 3AQPA 2VBYA 1OMSA 1RCXB 1B0PA 4P2XA 1JJ2R 3DRRB 3MMJA 3M1VA 2DHGA 1LW2A 2RQMA 2YH0A 4BWJA 2Z2YB 2JC1A 2MQMA 4N47A 4HHJA 4HACB 4YB1P 4JI6J 4R8UA 2SXLA 4QWEA 3D4JA 1NPRA 3QT7A 3H20A 2GQCA 2KFYA 3EMTA 3HHLA 2YKMB 3OTOF 4H4OB 4RUCA 1IVZA 4MK9A 3EVMA 1OSCA 1NMEB 3EZ5A 1C1CA 2E7VA 4LREA 3HDSA 1PKUA 1OPZA 2R4FA 4NLVA 4CLWA 1RA6A 1XK8A 2UUAJ 4Y00A 3TANA 1S49A 3RRKA 2GO9A 2DXFA 4DUYF 2GS8A 3ZZRA 1GFWB 4WFYA 5DRKA 3S6EA 5ETLA 4CYUB 4PUOA 3SCKE 3MUMP 1EQ0A 4DSLA 1KVJA 2HHHJ 2ZC4A 3HJFA 5IQ6A 3TVYA 2KVIA 3CDAA 2A3JA 2I5JA 1WTBA 3GONA 4USWA 4DV1F 3SFGA 3H59A 2ZHBA 2FB0A 2C2ZB 2CVEA 1XNQJ 3UR3C 1C0UA 2KXFA 3AB2B 3DFEA 2FJBB 1V3SA 5J2QB 3HSJA 3CCUS 3VZIA 3T1HF 4ANDA 1VOMA 3FJ2A 3RTVA 5E3QA 1RBOB 2C2EA 2MPUA 4J91A 2DH9A 2MKSA 2YKQA 2ZBRA 1HBMB 4CO0A 3HKWA 1IKVB 3CJ2A 3PRVA 5AE1A 1UJ6A 5SZTA 5ETQA 5DQIA 1CJKA 3W2WA 2CNOB 2MY8A 3MAAA 3RAXA 4F26A 2WOMA 3HFVA 3HFZB 1YIJS 2LQJA 2HGLA 3D3BJ 2H5EA 5BYQA 4HT5A 5K8NA 2R2RA 1VQSA 3GIKA 3NKYA 2MQ8A 1EAYC 3NS6A 5A0YB 1NLKL 3BO2A 2ALYB 2WW8A 2BJEA 3M9OB 3I31A 1SJFA 1OQ6A 2RSQA 3KLEA 5J2NA 2OPRB 1P9YA 4LF2A 5DDQC 2F4FA 3A8KA 3H5SA 1FNXH 2VKZG 1RHMB 1HQUA 4P74A 2V2VA 1YI2S 1UETA 8AT1B 5B09A 3CJ0A 4Q44A 4DL2A 4KRWA 1HNWF 1PO6A 4U8YA 2BA9A 3M4XA 2HK2A 5IZHA 3X1LB 2VIHA 2IBOA 2V8PA 3A12A 4WCEQ 3IM8A 3IRXA 4TKTA 2DKOB 2W9CB 2P6SA 2NREA 3OPKA 3DOLA 2KB2A 4YQWA 1WORA 2W9AA 1JLQA 4WFZA 1WC4A 2KVQE 2C2NA 3DC2A 2FVRA 2MZTA 5LJ5Y 3GJQB 4E2FB 4YB7A 2YWFA 2G9OA 1M0SA 2HFUA 2M0GB 3GILA 1KEKA 2D9OA 2UUAF 2JLFA 1FJGJ 2MQNA 2VB6A 3W5XA 2VBWA 4ED2A 1U1MA 2Q66A 4I6AA 4DPWA 3BM7A 3RU0A 1YK9A 2WSEC 4IRDA 2IC3B 2HHHF 3OSPA 4OHYA 3R27A 3BR8A 3MPVA 2O5DA 2L3MA 1VBKA 4TLRA 2FHJA 7FDRA 2YKPA 3OJSA 4C3LA 2HWTA 2NUHA 4LSLB 1D0EA 1XNQF 4CIOA 2J5AA 2XS5A 1REVB 1EETA 2VBXA 1MSWD 2QO3A 1JLCB 5BYSA 3OR2B 2GGPA 3GR0A 4NWBA 3TJ9A 2GV1A 4AUKA 2M9KA 1PYTA 3AQOA 4NLYA 1YJTA 1QE1A 2L48A 4EI2A 1TZ0A 4MK8A 5K8MA 1RT3B 4V19J 1FNMA 2IVYA 1BQXA 1V3ZA 3T9ZA 1R0BG 2DNYA 4ZPWR 3DLLQ 4O4GA 1YJRA 2HVIA 4M1KA 3HVRA 4KKOB 2W7AA 3D0IE 2ZJRQ 4Y28C 1RWPB 4CT9A 1VJWA 4M5DB 4ICLB 3FK4A 1GMWA 4B3MJ 4ZVUB 1X31C 3AOBA 2CPZA 2BQUA 4ER8A 5D0GA 4UW2A 1VRQC 3QPIA 1HA1A 3E8OA 1JLGA 2ZNYA 2VASA 2YPYA 3NY0A 3P45B 3BDPA 2J0XA 4DX7A 1URRA 3UO0A 1K44A 4DUZF 3MMBA 3MECA 4YDDB 3C6TB 3VAJA 3G71S 4EEYA 3UFCX 3US5A 1VMBA 1WF0A 4H4MA 2GCFA 1VQOS 1FXLA 3IAM9 3MCOA 4ID8A 1YWXA 3DCAA 4DSJA 2I9SA 3PYDA 3BYPA 2GZOA 3KK1A 4JP8A 3OQ2A 4YDXA 3TAQA 3T1YJ 3BS9A 3M2UB 2XMJA 1BXNA 1AROP 4K5RA 5KFHA 2L9WA 5IFMA 4A8YA 5GAGU 1NJZA 1QY7A 4W4MA 1RCOB 2Z2LA 3C6UA 1S6QA 4H4KC 4A47A 4KHMA 5D78A 4DV3F 1IKXB 5J1EA 3POTA 1JLFB 5A6PA 1RWNB 2FY1A 3CJQA 3UDEA 2JVRA 2MEWA 3AT1B 1SL0A 2EW9A 1HW9A 4IQMA 2RS8A 1J2VA 3B4DA 4NA2A 1HQEA 3M8QB 2GHPA 4K5SA 5DDRC 2CJQA 2RVJA 1VC6A 2FVQA 1OS5A 1HNVB 3AOCA 1S6PB 2XMMA 4I2PA 2QFJA 2YWKA 1RT5B 5T7LB 5ETPA 3SCJE 4XAKA 5FJ4A 3GU0A 4O23A 2XSFA 2R2SA 1LQ9A 1ZM2A 3V4IB 4PEOA 1YQHA 1FVSA 4ZDNA 3ADAC 4QPXA 2HFOA 5HROA 1RUSA 3MGJA 1UMJA 3CD5A 1NK0A 2C3OA 4DCOB 1HBNA 2W24A 1CJTA 3EGNA 2DHAA 4KY3A 3RW7A 4ZS6A 2E66A 4LF1A 4DPOA 1F1BB 3AY0A 2X1FA 2R7XA 1WHXA 1WG5A 2RHSB 2NSBA 3KNAA 1NNDA 4RU9A 2CZ4A 2NYIA 4ECXA 1XNRF 1HNXJ 2JZ5A 5A8RB 3GZ7A 1JLAB 3SQGB 2M3DA 4ZPBA 1SH2A 3DMJA 4KE5A 2HG4A 3KK2A 3UW1A 2EXUA 2HKEA 4RW7B 3KJVA 2XSJA 4K7QA 5J1NA 4LJMA 3J7A1 2HFNA 3NGRA 3GB0A 4R5PA 3MM9A 1ZAXA 3FZ2A 2R7TA 4A8WA 2LMIA 4RNHA 2YX1A 2ATLA 3TVZA 4Y0FA 4J7CA 2UVVA 5F8LA 3PEJA 1FE4A 1GMVA 3MM7B 3D1QA 4IFVA 1LWFB 2HQCA 9ATCB 3SEOA 4DQIA 1IJFB 5LMUJ 4JBCA 1UJ5A 4XTTA 1KLMA 3MF5A 4LVNP 3T5LA 3G6XA 2XULA 2BOAA 3CCRS 3PX0A 1SPBP 1Z4UA 2YNHA 1ZETA 1JWWA 2HNDB 4NX9A 2GVDB 2CIMA 2W4PA 3P49B 2NXEA 1FRXA 5LM7E 3UWTA 4OYAA 4X4PA 1R0CB 1WACA 3KLHB 4KQZA 4V1Ak 2KO1A 1M5SA 3HD2A 4ID5A 1RI7A 1N32F 1M5OC 3CCWA 2V4JA 2CRLA 1RT7B 2ZKUA 2OEJA 1K73T 3M30A 4Y34A 5LL6d 2VG7A 2VBZA 1FEHA 4JI3J 5E0OA 5D8HB 3VWSA 2MGZA 1XEZA 1HMVB 2DNNA 4L3NA 2DVIA 1I94J 3EPGA 3EPIA 2VJVA 3H8YA 2PA3A 2V8GA 5IQQA 3QMQA 4NYPA 3IRWP 5ETMA 2YY3A 5HVGA 5KFMA 3HULA 5KT7A 3THPA 2B7BB 2R8IA 2ZWPA 4KFBB 1N52B 1O8BA 5KT3A 1RAGB 2Z0GA 1OY6A 4B08A 4FPRA 1T05B 1SKUB 3D6TB 1KFSA 2MSTA 4OFZA 4QZVB 4CQ1A 2FLNA 2IJNA 1HNXF 1Q0NA 4NA3A 1QAXA 4C0HA 5MLCV 2HHSA 2KKHA 2MLXA 2DPJA 4RO0A 3W8GA 1UFLA 1RBLA 3HVWA 3R2CJ 4CLYA 1X5OA 1IBLJ 2PEHA 2HRTA 1B0TA 2DGSA 4OYPA 5G0RB 4G65A 1CEZA 3JYTA 4R0JA 3VZHA 2UXBJ 1VR6A 5M2RA 2K06A 1B0VA 4ZP9A 4IKAA 4KT0C 1L3KA 2RE1A 4C98A 5ADZA 2GHVC 1G4CA 2C22A 2MTLA 1NKBA 2YWHA 1EARA 2ZBPA 3GIMA 4IFYB 4QIEA 3SXLA 3SIPB 5LMUF 2DNZA 3E51A 2ZH5A 2FHKA 3ZZZA 1JNRB 2X7IA 2OKQA 3MEEA 5I3UA 3ETMA 4ILRA 3Q86A 3LPYA 2BYCA 2M52A 2XMAA 2XC9A 1HWLA 3NS7B 4KR0B 1KTQA 2B9EA 1TV6B 4LFBF 2VDIA 2QMUB 4LF6J 3RAMA 1WDTA 1VQ4S 4ECRA 3UNGC 2UP1A 1KQSR 1X5PA 2XMTA 3MCMA 5AXNA 1VQ9S 3CT9A 2DO0A 3Q8YA 4WTYA 5B0AA 5H1SV 4LF9J 3UR0A 2MZQA 2PI4A 5T41A 4EYHB 4KHPF 1U1QA 5EGYA 3BV8A 4X66J 4RW9B 4UQTA 4O3PA 1AUDA 4PKDB 3W5YA 1MROA 1ZTTA 4DL4A 1WSRA 2XO6A 1M5HA 3GYGA 2Y0SD 2MKYA 2QL7B 3H2UB 4USHA 4JI7J 2H54B 4ZJLA 4USIA 3JSMB 4PG7A 3NGSA 1PC4A 3NAHA 4EBDA 3EVWA 3TO8A 4QR1A 2YXLA 2ASDA 1TVRB 1BLUA 2O67A 1KQFB 4RZRA 2IJRA 3MAQA 4ATNA 2DBBA 2NXJA 4DR6J 3RZAA 5GAEI 4DS4A 5K14B 2U2FA 4F02A 4K4YA 1IBLF 4QWBA 4QU6A 1UEKA 2ZJQQ 5RUBA 4I69A 1RTDA 3BJYA 1CQNA 1EZZB 4ZJQA 2DNPA 1YJ9S 1QAJA 1B64A 2YWEA 1X9SA 3JSYA 2C2MB 5J2MA 4Y2IA 2UXBF 3M6WA 2VDHA 2F8HA 1VHIA 2LFVA 2VFVA 5H9FJ 1Q95G 3H5YA 5L1IA 3FEYB 1C0TA 3MTJA 4DR2F 4ECUA 5A8WB 3AXKA 1AA1B 1PIEA 5KFZA 1TKZB 5KFIA 2YNGB 3FVYA 3MMAB 3GR1A 2DTJA 4ZK7M 2A6MA 4DJBA 4YR3A 5HO4A 2UU9J 3BN4A 3EX7B 3W2VA 3IP0A 3IS9B 4KH1B 3LF0A 4CLTA 5B0GA 2B9YA 2DIVA 3Q24A 2CDRB 2QTWA 3BREA 2DEJA 1FDNA 2XG8A 3F44A 1DQ8A 1JKHA 1T3NA 3KUEA 5KFSA 1UVMA 3VQTA 2F40A 1R43A 4ITSA
chains in the Genus database with same CATH topology
2ZH9A 4ECTA 4J9LA 2D3ZA 4EU0A 3CJKB 3JB9k 2NZ4A 3N0VA 1U1PA 3OVSA 4FXDA 2L9NA 3VR1A 1KTVA 1VHFA 4NA1A 4C8YA 4LQ9A 2IM3A 4Q8EA 2XWXA 2F7VA 2I1RA 3O1LA 4I6YA 1GX6A 2K7KA 4HH1A 1ZAVA 5KFLA 5KT2A 5EX3A 4NXMF 5D4OA 4BC9A 2OFHX 1R31A 3G6ES 2OPSA 1S72S 3CO9A 4FF3A 4QCLA 2N82B 5IT9Y 4X66F 2D74B 2DO4A 5CYMA 1CSJA 4X64F 4GKJF 4CNZA 4QIVA 2LA4A 1RTIB 1N4LA 3OFHA 3B78A 1DBDA 2IAJA 3IC1A 4OHXA 4WU3A 5KT6A 1KN6A 2YKNA 4R0EA 4GMKA 3D0HE 3H98A 5KG1A 3DRPA 2JFKA 3FFIB 1T7PA 2EFNA 4KC5A 4F67A 2JSXA 3BN7A 4JV5F 2NUUG 2HHVA 3QJJA 3DI6A 2RH3A 1UJ4A 2POKA 1M90T 4AE5A 1RQ0A 4WK1A 2OMLA 1WWHA 3KLIB 3TYTA 2AQ4A 2MJUA 2OD6A 1IKYB 1BQNA 5K8OA 1XBWA 4PQAA 3JTPA 2BQ3A 1S1WB 2QV6A 3DOKB 3MEKA 1PILA 2HIQA 3M8PB 3QGHA 5KFGA 4R8UB 5DGBA 1FXRA 4FF2A 2DRBA 3N5FA 5LSOA 4FVMA 3FEXB 2M7SA 5I42B 3AB4B 3IG1A 2KG0A 4ZP7A 3K58A 1VQNS 2KTQA 1T95A 4X4RA 1G7CB 2R8JA 5HN0A 3HVTA 1GH8A 3LWMA 4KTQA 5KFCA 2CQPA 5J2MB 4XPCA 3CB4A 1O51A 1XR5A 2JC0A 4YMEA 4ZP6A 2OPPA 3NNAA 2BZ2A 5DO2A 1NU4A 2EBGA 1S1TB 4I64A 4NOHA 4RWXA 4HVZA 2IRYA 1YITS 3LAKA 1MMLA 3K5LA 2J9EA 2J6SA 4BBYA 4OX6A 1F0XA 3J7Z5 3OLBA 2IMOA 2HGMA 3L09A 3TI0A 1U6BA 5AJ3F 2JL9A 1U1NA 4A8SA 1P8GA 1QUPA 4ELTA 3QZ8A 1VQLS 4Z2XA 2AJQA 4DX8H 5D4LA 5AXLA 4CO5A 4WE1A 5B7WA 1YVFA 2K2PA 3T3FA 3MOJB 1X4AA 2XMWA 4B9TA 1C0TB 3Q0AA 2V8DA 1S7HA 2IJFA 3QAEA 2W7OA 4ERDA 3MFHA 3RW6A 4RNNA 4X62F 2F9JA 2DGXA 1KVIA 2CJ9A 5T14A 4DV4F 1R6YA 3EYZA 2OTJS 3TUIC 2V4RA 3NNCA 3R1LA 2VFSA 4PWDA 3OR1A 3TW0A 4ED1A 1ZPWX 4B02A 2V5HG 1JLBA 4U9RA 2B6AB 2QSWA 3QYYA 4C3KA 2HHWA 3PFEA 2LU2A 2W8LA 3M2VB 5FDLA 3KMSA 4C0OC 4KBIA 1N5YB 2AYMA 2V4QA 2ZKTA 3NBPA 1A9NB 3HLUA 4FVCA 2DRAA 3E01A 3BGLA 1LKZA 3MPYA 2R9LA 3JTNA 1S9EA 3QJLA 2OO4A 4HTIA 4AQYF 2KZZA 2IBKA 2KZMA 1LWCA 3GYNA 1DLOA 3QLHB 4JI6F 5B0BA 3UPFA 2C3PA 1LFPA 4OZ0A 2DIUA 3T5JA 2CQGA 2V9KA 4A4JA 3GV8B 4IRKA 3DHWC 4IOAQ 1NK7A 3O2IA 3TA2A 3D1HA 4B3OB 3FQLA 3VALA 3MOZA 2UUBF 3DLKA 2VPZB 3J81Y 1KOOA 1H6KX 1P27B 4Z37A 1UA1A 1FF2A 3QIPB 2E1CA 2QRRA 2MHEA 3H2LA 2BOPA 4C3MA 2HRUA 4QW9A 2VG6B 4DV5F 5L9XA 4ZPVR 5A6WA 2WONA 4X4TA 2K1RA 4TU7A 2AF6A 5DLFA 5KFYA 4M94A 2MKHA 2AYEA 4NLSA 2ZITA 4RW4B 2QA4S 3R5BA 2WRMA 2E44A 2MZ1A 2M4MA 1C0UB 1S76D 3Q8SB 4OI6A 4N41A 4ZP8A 1LW0B 4GO7X 2IFXA 2LDIA 4NLRA 4YUDA 3MPWA 1JKHB 2QMXA 4IG3B 1SJ1A 3T6BA 2G0CA 2OPQB 2J7KA 3ENQA 5U47A 2Y1IA 1K1SA 2KFNA 4H54A 4B3SF 2R2UA 4OLOA 1OSDA 3GIIA 1XMQF 1DURA 1IJEB 3OFEA 5DM7Q 3OTCA 4WU2A 2HYIB 4HDHA 2JOQA 5MAOA 2ZE2A 1RT6B 3V6DB 4DR4F 2D3OR 2UZAA 4F2SA 5DLGA 3LOUA 5EN1A 2EBEA 5KG7A 2E1RA 3R5DA 2D7SA 3NP5A 5CYQA 3ENVA 3FRZA 4I1TA 2FLLA 1M1KT 4NMLA 4V19X 1Y5IB 1S79A 4WFXA 3RYLA 1VBZA 3OW2R 1UWBA 2BV3A 3R5CA 4HTJA 5HP1A 2XLKA 3H2VE 3DDNA 3PNIA 2ADBA 1IXKA 2MMYA 2Z4PA 3MEDA 3D5MA 1JB0C 3M6VA 4NL5A 2GJIA 3CIZA 5F8IA 1X4BA 2AD9A 2OFGX 3LW5C 3M2RA 3VAGA 3DLGA 1VQ8S 2OPSB 3DM2A 4JI0F 1MWYA 2CPDA 3IR5B 3FSYA 5CYMB 2QT7A 2ZDOA 2IAJB 1JJHA 3I32A 3DN9A 2YKNB 2DHSA 4ZCLA 1N5TA 2RT3A 3BQ2A 2MQQA 5JVHQ 2MJNA 1VQMS 2WOMB 3DI6B 2RILA 5DJBA 1YGYA 5DM6Q 2X51A 3TA1A 4X4NA 2B5JB 3I82A 4QJVA 1BQNB 4ZCKA 3J80Y 1KHVA 2VPXB 1HYSA 3VCDA 4Y3CA 1UVLA 2C3MA 5E3RA 3D2WA 2EG2A 3LAMA 3SMZA 2MQOA 1S1UA 2P5VA 1TKDA 4OJHA 2JH3A 2J7WA 3GIJA 1NK0A 4ZPCA 2PA8D 1TK0A 3PZPA 4PXBA 1U1OA 4QYZJ 4MTPA 3IG1B 5IS2A 2C3YA 3JSMA 1CQMA 2EFOA 3HVTB 3IGNA 1SJRA 3HMJG 4ED7A 5KOXA 1VQPS 2LCWA 1FKPA 1F9FA 3IWXA 1GNKA 1L3SA 3LGNA 2OPPB 5KFEA 1S77D 4AL6A 2VD3A 3THTA 3NGDA 5DDOC 1N5QA 4FNIA 1IQTA 4H4KA 5D3GA 2Q43A 1X9MA 4LIRA 4OZLA 2WSCC 3KOAA 3WC2A 1U48A 4Y6IA 4D3HA 4IG0A 4DFJA 1HI1A 3N79A 1K0VA 1H0HB 4WE1B 3HHLD 1WEYA 2RU9A 4UY8T 5HMZA 2VC1A 4YP3A 2KHDA 3Q23A 2IYIA 2YNFA 2OMOA 2IM0A 3O6QA 3OXLA 2AW0A 4Y2CA 3WBZA 1E6VA 4C8KA 3H40A 3V2UC 4KIAA 4YFUA 1YTYA 1RGVA 3DRRA 4AYBD 3CMAS 5L1JA 2W7PA 1Z1ZA 1X0PA 2C3UA 3OR1B 2VV5A 4PWDB 3O5TB 4MAKA 2FLOA 3OTDA 3OUYA 3IA0A 4F2RA 3DU5A 1E6YB 5I3PA 3QAUA 4K4TA 4DR3F 4O3SA 3N6NA 2IA0A 4FXWA 1O0PA 3ICLA 4NLQA 4W92B 1NH8A 3HF5A 2R7VA 3ZZYA 2CYYA 1BQMA 3CVKA 3NBPB 4CH1A 2QE5A 5B0FA 3E01B 2BRLA 5KFVA 2LVWA 1S9EB 4EO8A 4NLUA 4X4SA 2XLJA 1G1XA 2V0NA 1WG1A 3I9V9 4RU2A 5JJBA 1LWCB 1DLOB 1S0OA 3EXCX 2EK1A 2O01C 2HLTA 1VI7A 2LXUA 2MDAA 4DSKA 3L3CA 4DWIA 2MXYA 4OX7A 2Y1RI 1HHTP 2OH2A 1Q8LA 4UY85 3MZIA 2CDQA 2UVWA 5DETA 1U45A 2C28A 4FP9A 5GAHI 2V2KA 4IH6A 1FE0A 1JLQB 3DLKB 4X84A 3U1NA 4ED6A 3MTKA 3MUVP 3M8SA 3TX8A 1NJYA 2FLPA 1VIOA 3ZZPA 2CG4A 1HNIB 3P6YC 4JV0A 4U7UK 7FD1A 2A1BA 4RUHA 4KB7A 5LXRA 3RB4A 2JDJA 2WAQD 4A48A 3W3SA 2JVOA 1BC6A 2BE2A 2DCUB 4ED3A 2KXHA 4LF8F 2JHEA 4H4OA 5L38A 4Y2AA 3G4SS 2YTCA 1FHTA 1HBUA 1KHWA 3Q8QB 2VFTA 2WBMA 3RRHA 1D9FA 4WZQA 2YX7A 1FNOA 1X8DA 4ECQA 4YB6A 2KHCA 5EUHA 5F9NA 3HVAA 4OZJA 2DNRA 1ZM9A 1Z2LA 2COLA 4RW8A 1WI8A 1V3RA 2B3TB 2CPXA 1C4AA 3CWJA 5C42A 4OMFG 1JJ4A 1HI8A 2JEIA 1KOHA 1TKZA 1D1UA 4ECWA 2RQKA 1C1BA 3S1TA 1S0VA 2LXIA 3BQ1A 5GVQA 1M5PC 5DDPC 4O44A 2DJWA 4F4WA 4EYIB 4JI1F 4RW6B 2ZE2B 5BYRA 4WZMA 4P6QA 2FVSA 3GV7B 2ZBCA 2GJ2A 3J7YU 1GXTA 1OQ3A 2GNKA 3IN5A 2WK4A 2WBRA 1KFDA 1KQGB 5CYQB 2FIUA 4N77A 5KG0A 5KT5A 4WFAQ 2F4VF 3ISZA 2E5GA 1YRXA 2CQCA 4PG5A 2GHWA 5E2QA 5DGAA 4ILMA 2R7QA 2HHXA 1UWBB 1Y7PA 5JXSA 1U6FA 5DG7A 2X3GA 5HP1B 2PMHA 3RAQA 1TL3B 2J7UA 2YX4A 1BGXT 3IWNC 5BR8F 2VG5A 1G2EA 3IS9A 3BGUA 4B9SA 1URNA 2N4DA 3I55S 3CD7A 1TK5A 2MYFA 1FA0A 2Q6CA 4RKUC 2RU3A 3MR2A 3M2RB 4WKRA 3DLGB 1H2UX 1FXDA 1U47A 4UUXA 2M70A 3HHEA 4NYZA 3SFUA 5I3QA 2FPHX 4J9PA 2DNKA 1ZTWA 1X7VA 3OJUA 2P9GA 3DYAA 4G1QA 4F3OA 2J0QD 3BDEA 2OSQA 2V8HA 4Y2KA 2ZZMA 4E8UA 1SIZA 5HMXA 4MKYA 4PCQA 3SSRA 4ETZA 5KG3A 1SB6A 5EWEA 4CT8A 2BVZA 4M8LA 3T6JA 2MKJA 1FERA 1SI9A 2HVZA 3MDFA 1Q79A 1GXUA 4OLPA 1HYSB 1FTCA 1ZAWA 3HZEA 4NLXA 4OX8A 2GMJA 2LEPA 2ZH3A 1S1UB 4QPTA 2DGWA 1FJGF 2MKKA 1NJIT 4PXEA 4DOZA 4ES3A 3VAHA 5J2QA 4OZ1A 3HZGA 4HKQA 4B9UA 3KNGA 1X4GA 2F1FA 2VOPA 2R7WA 3PY8A 1YJVA 1FKPB 4ALZA 2GMLA 3CJ5A 3G6VA 1A6LA 3MURP 1HBOA 2W8KA 1QSLA 4I2QA 4X2BA 2FJDB 2RRBA 4OHZA 5D3GB 4ECSA 2R7OA 1FJ7A 4OL8A 5GAEU 2RDIA 4OHWA 2Y1JA 1R8AA 3QIDA 3C3LA 5C25A 4NCAA 2OLWA 5GAGI 4IG0B 2VPWB 2PSZA 2LDYA 5DS7A 3DXSX 4DL5A 1HBMA 1NHVA 1IKVA 4W90B 3AQPA 2YNFB 2VBYA 4ZPTR 5HL7Q 1T8EA 2HWIA 1E6VB 1B0PA 3CC4S 3O3LA 1JJ2R 5GADI 3AJ1A 1S4FA 3DRRB 3MMJA 1R8HA 5CCMA 1XR7A 3M1VA 1N5VA 1RTIA 2ZBIA 4CO3A 2ZOFA 2PN6A 3I4PA 2DHGA 3AAWB 2FJWA 1LW2A 2RQMA 3CEDA 2KRBA 3N9UC 2XY6A 2YH0A 3LANA 4LUBA 4BWJA 1BQMB 2JC1A 2MQMA 4KO0A 4O3NA 4N47A 1NK5A 2MSSA 3KLIA 5E3CA 4HHJA 3KYLA 1K8AT 2MHNA 3MEGA 1FVQA 2WCXA 1LFWA 3K8VA 5EDWA 3LH2S 2XMKA 2KRRA 4NRTA 5B0DA 4YB1P 5KFOA 5KFNA 2D41A 5LXYA 1QLNA 4R8UA 2E7XA 3AHPA 2SXLA 5KTQA 4QWEA 3R3TA 3LALA 5L1LA 1FKOA 2R7RA 3CJ4A 5AE3A 4MYTA 1Y3JA 3CCES 4K0KF 5KFKA 2VQEF 3JTOA 4RBUA 3N4WA 3CC7S 5A0YA 4X4VA 2KI2A 2RD5C 1NK4A 3H20A 4QWDA 2GQCA 1NZAA 2KFYA 3HHLA 1JLGB 2LEAA 4DSEA 2YQ3A 2CPYA 1FD8A 1K0TA 4KGKA 2O1PA 5D4NA 1N36F 2YKMB 2BE2B 3DLBA 3OTOF 3MXHP 3N6MA 2HZCA 1IBKF 4H4OB 4MK7A 4RUCA 4MK9A 1HBUB 4K4SA 1OSCA 2IVFB 1QVGR 4YY3F 2G4BA 1Q7YT 4MIWA 3EZ5A 2CKWA 1C1CA 3HDSA 4OI3A 5L8RC 1TKTA 1RKJA 4QOTA 4IUFA