4Y2KA

Reduced form of apo-golb
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
b'GMQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal-binding transport protein
publication title Structural Insights and the Surprisingly Low Mechanical Stability of the Au-S Bond in the Gold-Specific Protein GolB
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Metal transport
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y2kA00
2ZDOA 4U9RA 2XMVA 5F0UA 1FD8A 3HDSA 2K7KA 3HX9A 2HIQA 1YJTA 2N4DA 3BGUA 2HFOA 3FMBA 5B0EA 2K2PA 2RU9A 1URRA 2HQIA 2PGCA 3QGPA 4DL0C 2PD1A 3FGVA 3MCSA 1R6YA 2ACYA 1YG0A 2BJDA 1Y0HA 1Y3JA 4DN9A 5T7LB 1X0PA 2FB0A 2W4PA 4HH1A 4A46A 3K7RA 3KKFA 2FIUA 3TRGA 1Q53A 4A4JA 1FVQA 1IUJA 3BDEA 5F0WA 2KKHA 3T9NA 4Y2MA 4DPOA 3TNVA 2GA7A 5T7LA 2IYIA 2OAUA 2HLUA 2ROGA 1OSDA 1OQ3A 1OPZA 2GFFA 2LQBA 2RILA 1S6OA 2XMJA 3BB5A 3KG1A 3LO3A 1TL4A 4OJ1A 3DXSX 2AW0A 2XMMA 1GXTA 3KG0A 5B0AA 1APSA 1Y3KA 2QYCA 2OFHX 1U7LA 3MZIA 4F67A 5KAKA 4HI1A 3UDCA 2LXFA 4OIXA 1Y9OA 2ROPA 1TUVA 1YJRA 4Y2IA 3BF4A 1AFIA 2W4DA 2XMUA 3CJKB 3E8OA 2ASYA 2K1RB 2VH7A 2AJ0A 4OJHA 3HFKA 2XMWA 2L3MA 2JDJA 5B0DA 1FVSA 1FESA 2GCFA 1TR0A 2BJEA 4OJ3A 2HLTA 5K9FA 5IXUA 2OD4A 3F44A 1MWZA 2N4CA 2RMLA 3CJKA 2QLWA 2K1RA 1ULRA 2KT2A 1SB6A 1GXUA 2OMOA 1AW0A 3BR8A 2LQ9A 4Y2KA 1Q4RA 2OD6A 1P6TA 1XBWA 4HI2A 3VTIA 1MWYA 1LQ9A 1CPZA 4NPOA 1K0VA 3FRYA 3HF5A 4ZA1A 2AP6A 2N7YA 2OP5A 2ZDPA 1AFJA 5B08A 3DCAA 5B0GA 1W2IA 2RSQA 4Q2LA 1KVJA 3HHLB 1SQEA 1QUPA 1FEEA 1N5TA 2GO8A 2K7JA 1KQKA 4Q2MA 3GZ7A 4A48A 3TOQA 1S6UA 3WDOA 1N5QA 1FE4A 1TZ0A 1X7VA 4EFAC 4YEAA 1SI9A 4ZOSA 1YRXA 2KT3A 5B09A 3KNGA 2CRLA 4QOTA 3LGMA 1CC7A 3HHLA 5A6WA 1YJUA 1RJJA 1OQ6A 3BM7A 2XMTA 5A6PA 1JWWA 3HHLC 1V3ZA 2QLXA 4FNHA 4OJGA 1WD6A 2W4CA 1TL5A 1Q8LA 5B0FA 2GGPB 2HFNA 3QMQA 4HL9A 5B0BA 1FE0A 1N5SA 3I9ZA 2AJ1A 1YJVA 4YDXA 1N5VA 2QIFA 2BBEA 2EW9A 2ROEA 1KVIA 1Q8BA 1X8DA 3IWLA 3IWXA 2LDIA 3LGNA 1CC8A 2G9OA 4HH0A 1VQSA 1JK9B 3BN7A 2GGPA 4A47A 5B0CA 2OFGX 1VQYA 2FHMA 2VV5A 4FNIA 2OKQA 3HHLD 2KYZA 2BUNA 2Q3PA 4NL5A 2GV1A 2BYCA 2IFXA 2XMKA 2IYGA 1P8GA 2FTRA
chains in the Genus database with same CATH superfamily
1RU1A 4HT7A 1RXOB 5J2QB 4NXMF 1GMUA 4IRKA 3OTCA 2ZWOA 3S8SA 2E1PA 3M2UB 3DRSB 2FJAB 2HVZA 3C19A 2Z30B 4KHPF 2IM2A 3H2VE 1NU4A 4L74A 5F8JA 1U2CA 1R8HA 1KOOA 1IKWA 1B0PA 2V69A 2LMIA 3D6TB 4E8UA 3M8RA 1EP4A 4Z37A 2RMLA 5A2QY 3MHYA 4JI2F 3FBFA 3H5SA 1LK7A 4FBTA 2ZZTA 3C14B 2HHHJ 3IR6B 2IIHA 4G1QA 2P6TA 3K2YA 3MM8A 1YBTA 4NASA 5L39A 4RW7B 1VISA 2HVDA 2B8QA 3OJUA 4XTTA 3MTKA 3GB0A 4LBIA 1D09B 4WKRA 4B3RJ 1LXJA 2IBOA 1AZSA 3W9IA 3FSYA 4DCJB 3KJVA 3NKYA 3HJFA 3GIJA 4MAKA 2IA0A 2PA8D 2MZQA 2GFFA 1QJHA 4IH5A 5HLFA 1QUVA 3Q23A 4QU7A 2ZVIA 2H54B 3SFUA 2OHDA 1XR7A 2XMWA 2DHXA 4ZMMA 1IKVA 5HAOA 1U48A 3LP1B 3JXOA 3THTA 3T6JA 4X64J 3RZAA 2N7YA 3PVXA 3RR8A 4EEYA 1NBEB 3HHLB 1VYAA 1L3KA 4AQYF 4A48A 1YRXA 1IBCB 1RLDA 3IRWP 4OI2A 3K89A 4W92B 2DNNA 2VQFJ 5L1IA 3W2WB 4BDPA 2FC8A 1Q8BA 3TVYA 1D9AA 2AGQA 2MZRA 4NL5A 1SJ1A 4OI1A 3P4UB 4HACA 2RUSA 3TEHB 3RAQA 1X4FA 2J7UA 3PDNA 1V5IB 4K4WA 1SL0A 5HROB 3FEZA 2N82B 3C66A 4TNOA 2WW4A 1X5TA 4ZP9A 1OPZA 2YQ3A 2FVSA 3LAMA 3T9ZA 4EBDA 3RBXA 1VQLS 4X4PA 2CPEA 2VA3A 4OYOA 2MZSA 2LA6A 4USTA 3C6TA 4C8YA 5IXUA 1ZETA 3GIMA 4LRFA 1BGXT 4NI2A 5DGBA 1NH8A 3FMWA 4DZ6A 2W8KA 1FX2A 5EDWA 3P49B 2ATCB 1S7IA 2RT3A 2PA3A 2OPQB 3CT9A 2QMWA 1VC5A 2GHPA 2BE9B 2RU3A 4LSNA 1CC8A 3KUHA 1HHSA 3CUNA 2DR8A 4E98A 3HHEA 3MM6B 1HWJA 2UU9J 1RTDB 1F0XA 2B9YA 3NLCA 2Y1RI 2FZKB 2M0GB 1HFEL 2UXCF 1R6YA 1S7HA 4JI8J 1QTNB 1QTMA 1CQNA 2RHQB 1TTHB 4DPWA 3MR6A 2OLWA 5ETVA 2ZWPA 1SKUB 3ITHA 1MNEA 1ZTTA 3MEDA 3Q0AA 3CE8A 1FFSB 4OJ3A 1IR0A 2GX8A 2HRUA 2JEGA 4F8RA 4ES3A 1D8YA 3IFEA 2PI5A 2GIQA 1V3RA 2B4UA 3AHPA 4UOHA 4WFZA 3VTIA 2IM1A 1JKHA 5J1EB 2BEFA 3D4JA 4UUXA 4RBVA 5C24B 4DR3F 5J2PA 3K8WA 4TQRA 5KTQA 4X4SA 1U8SA 2VG7A 2I0XA 1NM2A 1WI8A 2AHOB 3O3LA 1GEHA 4PCQA 1X5PA 1KNZA 3IM9A 4OYMA 5E3AA 5B0CA 2G2ZA 1M1HA 5ITHA 1R6VA 4J9KA 1XMOJ 2W9AA 2PIIA 1RI7A 5I3PA 1DTQB 3ENQA 2DNPA 4DR4J 2PSZA 4QIVA 1WF1A 1IR1A 2ACYA 5T14A 5C7PA 2AWZA 3BGLA 4Y3CA 3OLBA 4OJ1A 1HBNB 1FFWB 4WE1B 4GKJJ 4G1IA 1B64A 3ZO7A 3CCVS 1Q81T 2KRRA 3R8YA 4WFXA 4ZVFA 4EGLA 4PUOA 2RD5C 1AFIA 1DQ8A 4K2XA 5IT4A 1G4CA 2R7UA 1R27B 3VAGA 1Z2ZA 4EZ9A 1QE1B 5A8RA 3JS9A 1J5EF 2FDNA 1NK5A 5GAEU 2MMYA 1QAIA 2ZITA 1KTQA 1LWFA 3TARA 3NBPB 2WHOA 1UJ5A 1N5SA 5HATA 3V5RA 4DN0A 1TMJA 4ER8A 4LMZA 3M2VB 2J9EA 5IC6B 1AROP 1FRLA 1Q1KA 3OTOJ 3PRDA 3CD5A 4ID8A 2XMKA 4DSLA 2HHPA 3D3CJ 3NAHA 3KDOA 3H40A 4PXDA 1T03A 3HDSA 2ZOGA 4NLQA 4OX6A 5GADI 4AD6A 3RG6A 2VFRA 2EG2A 4CLZA 2BJDA 4DV1J 5T41A 2XHCA 4ECRA 4RL1A 3PXGa 2MHEA 1RISA 1T0TV 5KFUA 4NLWA 2E5IA 1REVA 1QSLA 4LREA 3CXCR 1UEVA 4C8KA 1YQHA 3IS9A 2F9DA 2QC3A 3GCWP 2V4JA 3N4WA 2RNEA 3OFFA 4WFYA 3FNNA 4NLDA 4KY3A 1I94J 3SCJE 1DBDA 1RK8A 4DF4A 5EWEA 2QX0A 4OHZA 3J80U 2BOPA 1FJGF 1RKJA 1N5YB 3EICA 4ELTA 5HMXA 3KLFB 1ZM2A 3QIDA 2E9TA 1YJVA 5IT9U 1WC0A 5IWAJ 3L7OA 4NOHA 1NK9A 3AAWB 1TL3B 3KK3B 1NHVA 2KG0A 1JLGA 1S1XA 4BHQA 1HNXJ 1MN7A 4RWWA 3OHAA 3GIKA 2HGNA 4NWBA 4CLLA 2WSFC 3LTOA 1AB8A 4ALZA 2UUCF 3M6UA 4WCEQ 1M1KT 2EFPA 4KGZB 4EUVA 1EQMA 4NCGA 4DF8A 2HS4A 5F3ZA 2VKRA 4B3SF 4CQ1A 1RABB 1SC1B 1S49A 3FKBA 5HQLA 3KG0A 1F9FA 2F8EX 1EZZB 4K5RA 4KSEB 1L3VA 1YRTA 3MM5B 5DG7A 1RQ0A 1K0TA 4DSKA 1S99A 1RZMA 4S0MA 1K0VA 2ERRA 4QWCA 3DYAB 2QRRA 4B9TA 1V9OA 4U7UD 2DY9A 5HVFA 1H73A 4YY3F 3DRYA 1WKKA 1SC3B 2Z2LA 4USWA 3GYGA 4FS1A 5LSLA 4X4RA 4IRDA 2RS8A 4H4KC 4B3MF 4Q0BB 3BJYA 2XS2A 3K5LA 3BGOP 3OV7A 1R0AB 4DV2J 3MCOA 4QIEA 1HMVA 1OYDA 3ET6A 2YWFA 4ANCA 1NUEA 3ZNUA 4P6QA 2J9CA 1WEYA 2OMLA 1H6KX 5J1PA 2WONA 3T9NA 4Y2MA 1Q8IA 5KFJA 2KVQE 3N5BA 2ROGA 1NKEA 1T05A 1U8WA 5D3GB 1UCNA 2DPIA 4ECTA 3N5FA 2VG5B 3CIMA 3EUNA 1MROA 4ZCMA 1XR5A 1RSCA 1Q7LB 2D7SA 3F44A 2DNKA 5RUBA 1CG2A 1J2VA 4HDHA 5KFMA 4MFBA 1P6TA 3P3DA 3M8QA 2MJUA 3R7SB 3ZTQA 1L3SA 1VDHA 3H5XA 1RHQB 3CCRS 3M7VA 4JB8B 5CD4A 5B09A 3ADAC 3KNGA 1C0TB 4O4RA 3KNAA 5G0RB 3J81U 1HNVA 1ITPA 3R97A 4JI4J 1HBMB 1SXLA 4OYBA 3QT7A 3C16A 3QFHA 4ZVGA 2BUNA 3SYZA 2OPRA 2AIRB 4X62F 1FK9A 3AJDA 4KPCA 2A2CA 3MOZA 2OH2A 4JI7F 4AT1B 3JSMB 4KGXB 1VBYA 4LQ3A 2WK4A 4U96A 1TV6B 1WHXA 3DMJB 4CYUB 3DLEA 4ZK7M 2F8HA 2MKKA 4P2FA 1JLEB 4P9SA 5D0RA 2BV3A 2HZAA 4QIGA 2EC2A 2F8MA 1NJWA 1EJ7L 2WOMA 4QBUA 2MY8A 4N41A 4X66J 5K8OA 1U1LA 1RT1B 2E9RX 4MIAA 3N01A 3W2VB 4LVNP 1WC5A 1UTAA 4PWDA 2ZVSA 4F36A 4C8ZA 1S5ZA 4PQUB 3D5MA 3LW5C 1MU2A 3GCXP 1JB0C 2OEMA 1GMWD 2CRLA 4EO6A 1GQEA 3IXQA 2EI5A 4C6AA 2VDIA 1NJXA 1RTJA 3NNHA 2F5GA 4K4TA 1KFDA 3GONA 4BS2A 4IG3B 2HFUA 1IKXB 3R5JB 5MAOA 1EHWA 4RW6B 1XEZA 2JLGA 1YIJS 2M9KA 4RUHA 1KP6A 3RB3A 2MLZA 4K50A 3TUZC 2QEXS 3I6PA 2NXUA 3EVMA 2ZNYA 5D0GA 2KKHA 1IBMF 1BQXA 3DOLA 2W01A 5E7OB 3OVBA 2OAUA 3RGIA 3MMAB 1FKPA 3Q8PB 2WVCA 4PXCA 2V8VA 2V8DA 1DQAA 1ZAWA 4I6AA 3QGHA 4DL2A 5DG8A 3RRHA 3HZGA 2CQBA 4QYRA 3UN3A 3KLEA 3QJJA 2BJ8A 3EGVA 4DSEA 5D6GA 3ZXWA 4RW4B 3PYEA 3AB4B 2W7PA 4N8OA 2ACMA 3OBIA 1D8ZA 4QPTA 1Z1ZA 3M30A 1HNZJ 4OYPA 2IRYA 3NNAA 5K8MA 3DHWC 3JSYA 4U7UK 2O67A 4CO3A 2ZH9A 4DR1J 4ZVEA 4HT5A 1DLOB 2DBBA 1NK0A 2ZC3A 3JAMU 2VL1A 4LSZB 5A8KA 2HIYA 2RKIB 5I3UA 4BCAA 2E5LJ 4DR7F 1F9EB 3KWMA 3UCZP 3MMCA 2YKMA 4PYDA 2YBVA 1UWBB 2M70A 1VBXA 1GK8A 5CCMA 4DS5A 2CJKA 2K1RB 2HK3A 5DM7Q 5ETRA 2IBKA 1KSPA 1CSJA 3IRXB 3FC9A 3EZ5A 2I5JA 3BSOA 3FQLA 4Q2MA 1LWXA 5D78A 2DGTA 3IBFB 5L1KA 3PTWA 4OZ0A 1VIOA 2FQQB 3F0NA 3CULA 3QSIA 2DISA 5GAHU 3IA0A 1UA0A 4LF2A 1NNDA 1CULA 1IKYA 2AZ3A 1VS3A 1M5VC 2ZDOA 3OT9A 2MEWA 5ETLA 4R25A 2W7OA 1B0TA 3PKMA 4ECQA 3B8HA 2KB2A 1CS4A 1FFGB 1T11A 5AJ3J 2H3EB 3CJRA 1VRTB 4FVCA 4FF3A 5IV4A 3FFIA 5FDLB 2GJIA 3JQKA 4CLUA 1TK0A 4GVBB 3G8TA 2YNIA 1Z2LA 2JWNA 3QAUA 1Y10A 1EIYB 3KK2B 1NZAA 2DY1A 4KKOB 1U1NA 4CH1A 2DYAA 2DHHA 4RWXA 5CZVA 1ULRA 3FBCA 1PCAA 2NLWA 3CCLS 1SQEA 4ZDNA 3VVTA 4QR2A 1S1TB 2Q6BA 2VU5A 2NZ4A 2CPXA 2C2KB 1RAAB 2B6AB 1T3NA 1K1SA 3QO9A 2PO4A 3NGUA 3QGGA 3NRBA 2BBEA 2MKYA 4KGMA 3LPYA 3R27A 3DGVA 4P75A 3LOUA 4WK3A 3SCIE 3KJQB 2FTRA 1Q0NA 1ZH5A 1ZZFA 5F0UA 2H51B 2LA4A 4LBHA 3HT0A 2FJDB 3Q83A 1WKJA 1URRA 2E7XA 3B4MA 3MCMA 3SV4A 2Y1IA 3Q8UA 1IKWB 1S1UA 1VLYA 3KG1A 4M5NA 4P2SA 1LKZA 4HHHA 4N56A 3RRGA 1AA1B 1PBUA 1EP4B 4OZ3A 2AZ1A 4DV0J 4WIQA 1S10A 1UEUA 3DXBA 4NMLA 2XNQA 2N4CA 1C1CA 3W8GA 2HNZA 1FNXH 2XYHB 5IT0A 4G1QB 4QW8A 3C46A 1MLAA 3MM8B 1DQ9A 2MKCA 5HVHA 3KK1A 4I2QB 1FERA 2MZTA 2R9LA 2X7IA 3CMAS 2E5HA 3SDEA 3I56S 2AYBA 3GG0A 3N9UC 4DU8A 4LBPA 3BBCA 4CLPA 3KHRA 4Q43A 3EYZA 2DNLA 1I1GA 1RWUA 3PW0A 2CPZA 2GV1A 1AZSB 1U1MA 3GYNA 1F9HA 4LF9F 1SIWB 5CZXA 2Z2ZA 1XERA 4PYAA 2ZH1A 3Q86A 2D9PA 4J9PA 2DNOA 4RW8A 3R5DA 2YPZA 2HW3A 1IKVB 2D3ZA 2G4BA 2R7VA 4DLGA 1RGVA 2HK2A 3Q8RB 4DV4F 2HSEB 2RS2A 3I5BA 3UD4P 1MG7A 3PX0A 2KRBA 5KG6A 3F73A 4IFVA 4ED6A 3TOQA 2YH1A 2LCWA 2KT3A 2R7OA 4IH6A 2NXCA 4DLEA 4JI3J 3MAAA 4OYZA 2MY7A 3Q8YA 1PAUB 4HL9A 2LDIA 2L48A 4DWIA 4HACB 1NDLA 3M8WA 4FNIA 3H0PA 3L9ZA 4FYVB 2KU7A 1RWMB 4ZVRB 4ID5A 4Y65A 1X4GA 1M1GA 3L3CA 4WWSA 2DEIA 2HFOA 3SEOA 2GC8A 4M5IA 2DRAA 2DGXA 1F5BA 1M5PC 2HRTA 4P7VA 3WX8A 1OYEA 2IMOA 5T7LA 3AXMA 5B7WA 5A76A 4ZJQA 1YJ7A 3C6TB 3V2UC 4IRCA 4NI2B 3MUTP 4DV7J 2DXDA 5KFNA 4MKYA 1X0FA 2HQCA 4LF4J 3GJSB 2KN4A 1UFKA 3G6ES 4LSNB 5L1LA 4PG8A 3M2RA 4DV6F 5B0FA 3QAEA 3M6XA 5SZTA 3ICLA 1WDDA 4I64A 4C7QA 1KVIA 1N52B 1YWXA 4HH0A 3PHEA 2G0JA 2HAIA 1VQ7S 2DNZA 2ADCA 3ZZ0A 1XIQA 2Q1LA 1N56A 3KLVA 2P6SA 3M2UA 3DRSA 4TY8A 1P9YA 1M5KC 3I0SA 1VI7A 2NCKL 3HI9A 2XY6A 3X1LB 4KT0C 2F40A 3AJ1A 4OI3A 5IQ6A 2XHWA 1QLNA 1NHUA 5LJ3Y 3ZTOA 4PQAA 5J2MA 4CLSA 4E0DA 2QA4G 2DJWA 4C9DA 3OTBA 3SZ2A 2V2VA 3PW2A 4OI0A 3UFCX 3HMJG 4JI1F 4BBYA 4KH0B 2QLBB 2OELA 2FGCA 1S9EB 4OZLA 3MI7X 5J2PB 1X9MA 1URNA 1WUUA 3BSCA 3JB9k 3HVRA 4ANDA 1FXRA 4RW7A 3NAIA 3T1HJ 2B4VA 1TAUA 2Y1LB 4G6VB 2JC0A 5CYJA 3ZTPA 5IC4B 4F4XA 4JI0F 3ZZYA 2J0SD 3PNIA 2IJRA 2VQEF 1K1QA 4P10A 3MTJA 2GGPA 7AT1B 1KD1T 4DV5F 1JLBB 3SSQA 4GKKJ 1S0MA 1EAYC 3FGVA 1RUSA 3NGSA 4LF6F 3SQGA 4PPDA 3EX7B 2KI2A 2VASA 4PUOB 3KJFB 2D69A 3KHLA 3GE9A 2ZUGA 3FUYA 2VZ9A 2UV8A 1GT8A 1KC8T 3QLHA 4DL3A 1FESA 3FEYB 1ICEB 3HJVA 2BDPA 5KFIA 1LFWA 5C25B 4NXMJ 1FEEA 5DQHA 1KQKA 3OFGA 2GHVC 1LWFB 4JUZA 3W2WA 5AE2A 2BJ7A 1OJ4A 4Q8FA 2J9DE 3FBEA 4KHPJ 1S0NA 3QNWB 2VPZB 4MIWA 3DM2A 1CJKB 2K8GA 2HQDA 3A8JA 2MHNA 2V8HA 4B9NA 4RNMA 3CDAA 4ES2A 1X4EA 5HROA 1T03B 1LWCA 2Z56B 3ZZRA 1DAXA 4J9VA 1BQNA 2IVFB 1HNIA 2MSSA 5F8NA 2GW8A 4OYIA 2DR5A 3AOAA 1U1QA 2HFVA 4JI2J 4DI6A 1W2BR 4QWAA 4F50A 5IFMA 2NSBA 1FRMA 1M0SA 2A6OA 2QSFA 4D3HA 3IS9B 1U1KA 4G1PA 3PJXA 2BA9A 5KG0A 1P27B 5EX0A 4X4TA 3BKTA 4HTJA 1NDCA 4EYIB 3R5GA 1F2HA 2XWXA 3DDIA 3O1LA 2A18A 4UZBA 1IQZA 2DH8A 2J7KA 2GNKA 4J9MA 2HURA 2OPQA 3TO8A 2F65A 2ABYA 2C1EB 4HYKA 4OHWA 2A3JA 2LQJA 1HIYA 4QWEA 3POTB 1NK4A 2MQQA 2JEIA 4ZPWR 3R3TA 2NYHA 2NZCA 3QYYA 1U24A 2Q6CA 3N6LA 3AD8C 3NOGA 3EVWA 1NXIA 3V6DA 1JLGB 1S1XB 2H4YB 3IC1A 4FYDA 5KFRA 3NNCA 2IAJA 3RRKA 3R5BA 1QDUB 3QFWA 4HI2A 3VWSA 2HIQA 3CNQP 2QA1A 4NCGB 2KFZA 3UN5A 1WF0A 5DM6Q 3OSPA 4AQYJ 2GQCA 3OW2R 1RWPB 2CPHA 4KGKA 3FJ2A 2GVDA 2FC9A 3HULA 3UDLA 2MZ1A 2J6SA 4FKXA 1Y9OA 4IYQA 3ILJA 2HLTA 2UVWA 3L7UA 1IR2A 4B9LA 2LQ9A 1CJUB 4TXSA 2NPFA 2BQUA 2QMUB 1S6PA 3T1YF 4K5SA 1E6YA 4WFBQ 1DARA 2FJEB 1JXEA 3Q8VA 1X7VA 1VK3A 3ENWA 4ED1A 2FVPA 2DCUB 1A9NB 2AV5A 4JYAF 4F3MA 3HD2A 5KT4A 1DTQA 4PXEA 5IM0A 5DO2A 3C15B 2FJWA 2QGFB 2KHDA 4IG0A 2DGQA 2BYCA 1P8GA 1UW9A 2IJFA 2W2OP 3ET6B 3MM7A 4O3SA 1WEZA 2PD1A 3VHQA 3W61A 4DPYA 2DNMA 1IXKA 4BC9A 5CYMA 1T05B 4XPCA 2CG8A 2F7VA 4CNYA 1X4CA 4A8SA 1U4BA 2LXIA 4ITSA 3P5BP 2BMBA 2VB6A 2FVRA 3DLHA 3KLHA 2ASYA 1NEEA 3HFKA 4MFBB 3ILLA 5KFKA 3M8QB 4KJIA 3I5CA 4AYBD 4ILRA 2VBWA 2DH9A 2UXCJ 3BBFA 1WKLA 5ADZA 1B3TA 3SV3A 4DX8H 3U1NA 4X4OA 1ZBTA 4JI5F 1OQ6A 1HBUA 4KBIA 5DQGA 2XMTA 1HNVB 2KM8C 5E33A 2QLXA 5HL7Q 5EHHA 3JSBA 8RUCA 3SFGA 3UW1A 1NJIT 4H4OA 2HZVA 3O8WA 1UJ4A 5KFDA 4NA1A 1NK8A 1FK9B 3MOJB 2N7CA 4F7VA 4GO7X 5LSOA 2J9DA 2ZBIA 2DH7A 3W9HA 3WC2A 2LLZA 4NMXA 4PRFA 4O3PA 3DLEB 5ETTA 5LMUF 3FCWA 2O5DA 4DR3J 2KFYA 3CO9A 4UOGA 1P9QC 3H2UB 2M52A 3TA2A 1VCTA 4RPFA 3G82A 1UMJA 5B0AA 2YY3A 1VLOA 4ES1A 3ISNC 2WOMB 4Y2IA 1YHQS 1C0UA 1U25A 4PWDB 4XO0A 4W98A 5J1NA 4PG4A 1JJ2R 3GSIA 2YTCA 3CCJS 1PG5B 2CADA 3NL0A 3MD3A 2AP6A 1MU2B 4RW9B 4J9UE 2IC3A 3SSSA 3KLFA 1SJQA 2Y0SD 3LWLA 3THVA 1X31C 1XQIA 2J8AA 3MEEB 1KOHA 1TL3A 2BABA 3VAMA 3NEKA 2GVZA 1NSPA 3PM9A 4PG6A 1TKDA 3NGDA 5KFHA 1DRZA 2X1BA 2HGLA 3BN7A 5ETQA 1KEKA 1LWEA 5I42A 2CQPA 3LPEA 3PJ9A 1IBLF 1NAQA 1GH8A 2ALYB 3CF5Q 3H7HB 5ETNA 3LAKA 4J9OA 2BANA 1BE4A 3R5CA 2ZKUA 1FWLA 4URQU 3FSIA 4CH7A 3DOLB 3TAMB 1J5EJ 3K5NA 4NXNF 1TUGB 3UR3C 3M9OB 4ZPDA 1FKPB 1O51A 5IV3A 5JVGQ 3JQMA 2HLUA 4RU2A 2B9EA 2HHWA 3R6LB 2C28A 1K44A 5A0YB 1JNRB 1WORA 1TL1B 4Y00A 1KQFB 3KLEB 1T9WA 4WXOA 4RKUC 1D0EA 3A3PB 4DBQA 3TX8A 2A6MA 2EK6A 2DK2A 1W2IA 3BR9A 3KDNA 4JOUA 1QUPA 5KFOA 3H25A 1F1BB 3L95X 5HP1A 3WDOA 3G8SA 1CC7A 4PXBA 2AT1B 5C5JA 2X1AA 2W2QP 3MPWA 1HHTP 2R7XA 3PW4A 3D67A 4LFCF 2ROEA 2ZZMA 2I1RA 1S79A 4Y28C 4Y6IA 1AYEA 5KFSA 1T94A 5A8KB 3QIPA 2WBMA 1PO6A 2DGUA 5I3UB 1SJFA 1JQGA 1BC6A 3QPIA 2IDEA 2YKMB 3DGPA 3PEHA 2RHSB 2WB1D 1SKWA 2V4RA 4WPAA 1FJGJ 4ZPVR 2IRUA 2W1BA 2V4QA 3LO3A 2LQBA 4IO9Q 1YJ9S 2HKEA 2R2TA 1FT8A 4K0KF 1GXTA 3BO2A 3GJQB 2EKNA 2VJUA 2BQRA 2JDJA 4LFAF 2HQ3A 1FWKA 5K14B 4CIOA 3NCPA 2I5JB 5AE3A 1NH7A 1H2TZ 1H72C 3LQVA 5J2NB 2UUCJ 4KPYA 4BC7A 3B78A 4B3SJ 4PPZA 4QR0A 3HHLC 1RT7A 2GAGC 2XEXA 4MYTA 2HBYB 1FE0A 3NGKA 2Y8WA 1X9SA 4CO1A 1IKYB 3MECA 5D4PA 4OHXA 1SL1A 1FDAA 3FCVA 3HHDA 4QIFA 4ZVOB 3TX0A 2QL7B 4A8WA 3PRVA 2K7KA 1CS4B 3BGUA 2K2PA 4N76A 1T02A 5KG3A 1JLEA 3CJ5A 2ASLA 3FFIB 4YB1P 2XO6A 5L38A 4ATNA 1S0OA 2DGOA 3R6GB 2MGZA 4YY3J 2YQ1A 3TNVA 1ZTWA 5HMZA 3N6MA 1WC4A 4I68A 3W2VA 3CMQA 3OJSA 3C8YA 4B3MJ 2E66A 3QJPA 1NJZA 4DQPA 2V94A 2VFVA 4IQMA 2R7WA 1S12A 3A4TA 1N5TA 5CXTA 2YKPA 4CLKA 4AUKA 3GU0A 3BKFA 4RUBA 4OHYA 4ECSA 5THWA 6FD1A 1B99A 3QO9B 1NB7A 1YJUA 4WYLA 4ZN1A 2EWHA 4RW6A 4IKAA 5CYQB 4J9NA 2QIFA 5E3QA 5C2GA 4G65A 3T5LA 2HEKA 5L1JA 4Z2XA 1VRUB 1OY8A 1S0VA 3BGRA 2QJ3A 2V68A 5C2CA 1OS5A 3E3XA 4LRDA 3MCSA 1YG0A 3ULHA 2MJNA 4FXDA 3T5HA 1RWVB 5G4DA 4ZKAA 3MEKA 3JTPA 4DX7A 3J81j 3RB6A 1OIAA 4U7CA 1C1CB 2QFIA 2HNZB 3I4HX 4X4UA 1LW2A 3VAKA 3HHKA 4TU7A 1UJ6A 2C42A 3IGVA 4EYHB 2UUBF 4F04B 3KK1B 4X62J 1JLFB 4JV5F 2ZFHA 2G0CA 2FY1A 4JI7J 2BRKA 3IAS9 1S76D 1BQMA 1SJ3P 4M5HA 2HG4A 2L08A 3HKWA 1F60B 4ZPAA 3Q8QB 4FF4A 3UD5A 2LXUA 3OXGA 4NYZA 2ZEJA 1KHVA 5IS2A 1QSSA 4YB7A 1XMQF 2VD3A 4L3NA 1FDNA 2VJVA 5F9LA 2AQ4A 1BLUA 3C3LA 3RW7A 5AT1B 4DOZA 4I7FA 3QGPA 1RP5A 2DR6A 2O1PA 4RW8B 3PZPA 2PMZD 3CDUA 4MT1A 1F3FA 4MTPA 1G1XA 5DDRC 4HI1A 4D3GA 3QWUA 2X1GA 1FD2A 1ZAXA 2JOQA 1R8CA 4F26A 2Y0BB 4X84A 2WVEA 5CABA 2R8JA 2OMOA 2GMLA 2I8EA 4Y2KA 3BQ1A 2M8DB 1SJRA 1WTBA 4IFVB 5KFZA 3CJ0A 3A8EA 1JJCB 3CCSS 1PC4A 3AT1B 3D7SB 2F9JA 3PR5B 2XZTB 1R89A 1IBMJ 3HKZD 2P5VA 1REGX 2ZD1A 2CG4A 4AL7A 3BQ2A 4MK7A 2EKYA 2R7TA 2SXLA 1TL7B 3RAXA 4DV1F 3IWLA 4ID5B 2GJFA 3CDBA 5CQGA 5BYSA 4ZVPB 3W1YC 2VPWB 1JLAA 4U9RA 4RUAA 3OTDA 2Z58B 3T41A 1FXLA 1S72S 5KFBA 4L3KA 5T7LB 2E1AA 4LQ9A 3A3NB 2JZ5A 4F2RA 2R7QA 3MGJA 4KKOA 3CVKA 4NLTA 1H38A 3VZHA 4TU8A 2J6UA 4X4NA 2PEBA 2O3DA 4A8FA 5B0DA 4FF2A 4GO5X 2HNDB 2MKJA 3W5ZA 2EFQA 1KONA 2ILYA 5KOXA 1Q4RA 4ZVHA 5KFYA 3W9JA 1VGYA 1RWOB 4FYYB 4OV1A 2B6AA 4RX6A 4Y34A 3M2RB 1FE4A 2HVIA 2A0FB 3MAHA 4CDIA 4FN5A 4DR7J 2QL9B 2NXJA 2MXYA 4FYXB 4OJGA 2M88A 2WB4A 3Q8SB 3HXMA 1H0HB 2QO3A 3UE2A 3IWXA 2G9OA 5KG7A 3N6NA 2CUYA 4OZ5A 4TY8B 5HBMA 2MLXA 1UVMA 2RAQA 1J5OA 3I0SB 1KN6A 1ZPWX 9ATCB 4YP3A 2NUHA 3JTNA 3M6WA 2BOAA 3NWGA 3W5YA 3TZWA 5LMNF 1Y0HA 2F4FA 2E1CA 3MR7A 5J2MB 2UV8G 4EWTA 2Y1JA 1RWKB 2CVEA 4ZPBA 3AH6A 2ADBA 4C0OC 1WEXA 1N36F 4RNOA 2RIJA 4NLGA 1FVSA 3CCES 4I2QA 1PYOB 4M5LA 2XO7A 2XWYA 4NPOA 5CA5A 3OR1B 5B0GA 2W2MP 4Q2LA 1ZAVA 1HA1A 1SVDA 2UXDF 4M1KA 1NSQA 4LF7F 2AYEA 3ZC4A 2RVJA 5E5NA 1HLWA 2FPHX 2GGPB 2HFNA 2XSJA 2EBEA 3K59A 1KS2A 2YWKA 3OFHA 4B3OA 5GAHI 2JEFA 3KOAA 1N6QB 1YJTA 1HW9A 4R0EA 2Q43A 3MD1A 3Q2TC 3SQGB 4USUA 4WFAQ 4ILLA 2AU0A 5M2UA 3QLHB 3WQPA 4ERDA 1A0OB 3PR4A 2ROPA 3M1VB 3BO3A 5DDPC 4JV0A 2LP4A 3LA0A 2DXEA 1VC0A 1HWKA 1PJ7A 5JXSA 4DJBA 1RHJB 4KGVB 5LXYA 4RBUA 4MJKA 2FY8A 1L3TA 3W3SA 4MKBA 3G4SS 5F41A 4USKA 3I0RB 3MF5A 2BW7A 1U0SA 3DM2B 2OPPB 2KXHA 2CQ1A 3VVUA 2AEMA 2H48B 4L76A 2K06A 2YNFA 3NG8A 3WIVA 4WK1A 1LWCB 3FDSA 4F02A 1OSCA 1U0HA 1BQNB 1W25A 2RQ4A 1VQSA 1A7GE 1HNIB 3WHIA 3UN2A 2BM1A 4YB5A 2DO0A 2X3DA 4I2PB 4U95A 5ETSA 2PFFB 2CJQA 2BKNA 1JLCA 1HR0F 4FP9A 4N7TA 2QA4S 1RHRB 5M2PA 4DN9A 2VG6A 2HHQA 4OQJA 1QAXA 1UZDA 1W7WA 2DIUA 2Q79A 1WC1A 2CWXA 3V81A 1XMBA 5C42B 1WELA 4C98A 1RWNB 3PHTA 3W5XA 2OD4A 4NA3A 1T9TA 2UXBF 1TKZA 1RHKB 1DTTA 4YUDA 3IBWA 4F0MA 4DSJA 4LF9J 3OUYB 1KLNA 2QZ8A 3DLGB 4WBFA 2IM3A 1TFYA 4ETXA 1R8PA 1XNQJ 5HQMA 2IM0A 3V6DB 4TY9A 1ZM4A 4GRSA 1UEKA 2IAJB 2D41A 3W62A 1YBUA 5DS7A 1FA0A 2ZBQA 2JH3A 1RT6A 2BW2A 2IFXA 2OJ3A 4DUYF 2R7RA 2E5JA 1RHUB 5GAGI 4DV4J 1PILA 2ZH2A 5KG5A 1R43A 2D3UA 3W60A 1NSKL 1SKSA 1XJWB 2NYIA 2ZUAA 1VQMS 2GVDB 3BPDA 2XMJA 2FVCA 2OFHX 1S9EA 2A1BA 1WHVA 3TZXA 1S1WB 5A8WA 2GCFA 1HARA 1MWQA 4J9QA 3HM9A 1S6PB 3Q22A 2ZJPQ 1E6YB 2VFUA 2AYGA 4ZLNA 1B4SA 1BWEA 4P52A 1B7FA 2VC0A 2VA2A 3GWCA 2ATLA 1Q86T 4LRAA 3FZ2A 1WWHA 3SIPB 1N5QA 2VBXA 3I82A 1TMMA 4GMKA 5F9NA 4B9VA 5IM0B 2KJWA 3MPDA 3TW0A 2AX1A 2OTJS 1JLBA 2D1CA 3PFEA 2H5EA 4ED7A 4W90B 1YBAA 4IG0B 5AXLA 3BQ0A 3OD2A 4MK9A 3MM7B 1M5SA 3UDVA 2HHUA 4DSFA 3CD7A 1S4EA 2CA9A 2N4DA 5CYMB 2MTLA 1Q8KA 1FO1A 2R7SA 3EWGA 4FF1A 5BXIA 2XLIA 5A2QU 3TJAA 4C0BA 4F3QA 2DXFA 2CQIA 4URSA 3KLHB 1U02A 2AW0A 2QFJA 4DV6J 1WOPA 1H2UX 4CTAA 2RRBA 2AJ0A 1GXLA 3CC7S 2D3O1 2BJEA 4YR2A 5C25A 4C8LA 3M9MB 2P9EA 4XK8C 2POKA 2Z2YB 3SSRA 4QCLA 2M2BA 1XWLA 2HVHA 1CJKA 1HBUB 2DPJA 4FXVA 5F8IA 3BH7B 2MQNA 4H4OB 3QGIA 1JWWA 4NZ0A 2FHKA 3DRPA 3VGVA 2HBRB 3RU0A 3B4DA 2WBRA 2XI2A 3DOMB 4WYWA 2ASDA 3CGIA 5HVGA 1RT3B 1TP7A 1ZM9A 3IWNC 1N8RT 4V19J 4JI1J 1DURA 4UQTA 1RCOB 2RQKA 1HQ2A 1RBOB 1WJ9A 2WVBA 3IG1B 2GS8A 3G82B 4CT8A 2GA7A 4NLXA 2L9DA 1N34F 3IBCB 1BUXA 5CAAA 3GSDA 3DXSX 2RQMA 4JI0J 1JMTA 1C0UB 2LXFA 2OEJA 5JMNA 3DC2A 3CD0A 4MIBA 2VQEJ 5KFPA 4C8NA 4X65F 2GIRA 4OZJA 3HO1A 2CQ2A 2XS7A 2RRNA 1EKRA 2IC3B 3POTA 2XQCA 4IR1A 1K9MT 1MW7A 2CPIA 2ZDPA 2DO4A 3NMAA 3ZTRA 2PMWA 3HCXA 2JSXA 3MPUB 1EETA 2X1FA 3H90A 4LF6J 2GVZB 3GFXA 2W25A 2CQGA 4DR5F 5HI7A 1FRHA 1FEHA 3GFYA 4KFBB 1LWEB 2QL5B 3QATA 5I42B 4GC7A 4ED5A 4DPXA 1FTCA 4KC5A 1NLKL 2BANB 1KDNA 2A10A 2QV6A 4NZ7A 2WVFA 3TR5A 3PO4A 3M6VA 2EG1A 5ETKA 1Q7YT 4O0NA 2PGCA 2HZCA 3GYXB 4M8LA 4DFKA 1RAEB 2QTWA 2R8HA 3K8VA 4KB7A 3GPAA 4OX9F 3HK2A 3HVAA 5E3CA 2BE7D 1VQOS 3CC4S 4FXWA 2HHSA 4UW2A 2QYCA 1QAJA 8ATCB 1CJUA 2Z4PA 4W4MA 4WXWA 1D1UA 3SMZA 3D3BJ 2W7AA 3EGZA 4JV1A 2DRDA 5HP1B 2BXJA 3QT5A 2LQ5A 3DLKA 2LU2A 2ZNZA 4N5SA 2K3IA 2KXFA 3FCHA 2HNYA 1U6ZA 5FLXU 4KO0A 3C15A 2E44A 3LH2S 1U47A 1HI8A 1N88A 4HKQA 3VAHA 1HYSA 5D4LA 2CQ3A 1K47A 4DSIA 3DLBA 4OL8A 3QIPB 3R2CJ 5HO4A 4XAKA 4L72B 5M2RA 2C2RA 3TAPA 1U1PA 2EBGA 3DGPB 1UW4A 2F4VF 4ED0A 4QYZJ 3BB5A 4LR7A 2KVIA 4LF5F 1SUQA 3KLIA 2XLKA 2R3VA 1AUDA 3G2XA 2LEPA 1O6XA 3CJKA 2DNYA 1UFLA 1CBKA 2CJXB 3PKYA 2H5IB 5DDOC 2HHXA 1JJ4A 2HBZB 2WRMA 4ENOA 5KFCA 1RT7B 4YEAA 2V5HG 1UAWA 3CDWA 3MECB 2E7WA 3TI0A 5D4OA 1GX5A 3D1QA 4U6PA 2GZOA 3JSRA 2GAHC 3W7BA 2RU9A 3PACA 4A8YA 3T1YJ 2MGZB 3A8KA 1VC6A 3FVYA 3P45B 4B9UA 3OFEA 3AB2B 4OMFG 2GIFA 4PG5A 4ZN3A 1NRKA 3H2LA 1APSA 4LR8A 1PJ5A 4JYAJ 4UZCA 1Y00A 2XB2D 4RW9A 1NCLA 3VGTA 1O0PA 3M9NB 2XCPA 4C3MA 3MEEA 1UVLA 3K57A 3PV8A 1AUSL 3K0JA 1V5VA 2LECA 2OEKA 2ASJA 3R2DJ 1RAFB 3K5OA 2B8PA 2DHAA 2XY7A 3DLJA 2XZWA 2RUGA 3BGRB 4DU7A 3TAMA 4QWDA 4FPRA 2KZZA 2H1YA 4P2XA 3N28A 3OR2A 1H3DA 1GNKA 3V6HA 4CO2A 3CJTA 4QWBA 3BYRA 3UD3P 1Y3JA 1R31A 1S59A 4TKTA 1NPKA 5A0YA 2CZ4A 4OX7A 4EBEA 1TL1A 3CEDA 4IQXA 4JI5J 4B17A 3QZ8A 4C0HA 1LW2B 2XC9A 2VBYA 4ECVA 3GIIA 5HJYA 3BEGB 2MQLA 3I31A 3GTYX 2QMXA 1PBAA 2JX2A 1TR0A 1U6FA 3UVJA 4ECXA 2MKHA 2CZVC 2DEJA 2YKNA 1BQMB 3I4PA 4DS4A 4FVMA 5LMUJ 5LM7E 2IPOB 2BE2B 2CPJA 1QM9A 3MMBB 1N54B 5HK4A 4FS2A 3BSAA 1VK8A 3HVWA 2C2ZB 1IWGA 2ZE2A 4YFUA 2C22A 1N33F 1PSDA 3GJTB 2E5GA 3BKUA 3T6BA 3KLGA 2KYZA 1RU2A 2MB0B 4I7FB 1I3OB 5KOWA 4QQBA 5B0EA 2LFVA 2OIHA 3SCLE 2AD9A 1NK6A 2P2CB 2QSWA 4OV6A 4A46A 5H9EJ 2CDQA 2W2PP 3LGHA 3QJLA 1Q16B 2G1HA 2B4OA 2XSFA 4EO8A 5K14A 5LT5A 2NPIA 1WF2A 4M5DB 3G71S 3E8OA 5E0OA 4DG1B 3GJRB 2PN6A 3A1YG 5J2NA 1FNMA 1IBLJ 4ZCKA 2CJYB 3LWMA 2AGPA 2YX1A 1WTFA 1ZOTA 5KFQA 1KBRA 1RTHA 5DJBA 2GQ2A 3TP2A 2YKOA 4NXNJ 2ZD1B 1TFWA 4CWBA 2V8PA 3ETMA 1DHMA 4LIWA 2FLLA 1HI1A 4MMOA 1DJ0A 4RNNA 2XULA 1X5OA 4H4KA 1CEZA 4XDCA 1S6QA 2VC1A 4JI6F 4A8QA 1JLAB 2ZHAA 3QZ7A 3GV8B 3AD9C 4IFYA 4PKDB 5DLGA 3G6YA 1VQNS 3KMSA 3C2PA 4I69A 2CPFA 4DL0C 1T3OA 4FDFA 2M7SA 3CD6S 3V4MA 5LSRA 1TVRB 4FZVA 3GIRA 3BDEA 4DUZF 1TU0B 3VCDA 2YQ0A 3BZQA 1SH0A 1VJWA 2V6AA 1X4AA 5KFTA 1S48A 4LFCJ 1FJEB 3MMJA 2I2YA 4CLTA 4B02A 3H4DA 2FUG9 4YB6A 1FDDA 2MZJA 1IJFB 2R2RA 1UWAA 1Q79A 1WC3A 2HWIA 3J7YI 2QE5A 3TAQA 2OP5A 1Z4UA 2HYIB 2ZHOA 2YNHA 5CYQA 3BDPA 3R7BB 2G0IA 4TN2A 2W9BA 4FBUA 3MWBA 4FNHA 1VRUA 3QMQA 4K0KJ 5HBMB 4YDXA 4USVA 2IY5B 1J5OB 2ZC4A 2C3YA 5AXNA 1ZS6A 4DR6J 1UETA 1C2PA 3D6FB 3OXLA 4LFAJ 3J80Y 1QVGR 1CVJA 4F0KA 2XYGB 3QRQA 1U6BA 4TLRA 1XNRF 5IT9Y 4DCPB 1CJVB 5IQQA 4C11A 5HJXA 4HEA9 3EDRB 2KT5A 4KV8B 3HD1A 4PEOA 1E6VB 2I38A 1G6BA 1SH2A 2XZDB 2IVMA 1HW8A 2NUUG 1JLFA 4F3OA 2R8GA 1Q5VA 3L09A 1MWZA 2I6WA 3QWPA 2E7VA 1FRIA 4HLBA 1NKBA 5EX3A 5KT7A 4DV3F 4ZA1A 1OY9A 1C1BA 2YNGA 4TLQA 1VHFA 3MR5A 3ZZOA 4EK2A 1BMQB 1HNWF 4L75A 1KLMA 3M32A 2A2DA 2XSJB 4QU6A 3SCKE 1EARA 3VGUA 2YX4A 2IVYA 4NLSA 2UVVA 1AT1B 4B3OB 1LK5A 3F56A 1U2RA 4J91A 3MAQA 3ZFVA 3U1MA 5D0EA 1WACA 1G2EA 1I5OB 3HX9A 5HN0A 1BXNA 4DQQA 4ZP7A 2CJBA 5DZ7A 5AXMA 4RLEA 3K17A 1PGZA 1VRQC 2FIUA 5KFLA 4A4JA 1KQSR 4K4VA 4K4SA 2CNOB 1WG4A 2RRAA 5FLXY 3HSZA 2OO4A 2M8HA 3FZBA 4KIAA 1M90T 1S9GA 2ZH4A 1HQUB 4F0HA 5JVHQ 1GTHA 2V2QA 4OZ1A 3MM9A 1UVKA 4TYAA 4R5PA 4NLOA 3CCZA 3D68A 2V9WA 2ZOFA 3D0GE 4ECZA 2CQ4A 1AXQA 4O4GA 1TL7A 4ZLLA 1L5UA 1T9UA 2YNFB 3Q24A 4WP8A 3GFZA 2CKWA 1FHTA 3KXDA 1U0HB 2CQCA 3ISZA 2DR7A 3QBCA 5D15A 2M5YA 3EJMA 1JLCB 1HQEB 1Y7PA 2B4PA 3CB4A 2OPSB 4HHJA 3LP0B 2UUBJ 1HWLA 7FD1A 3AXKA 2VG6B 4JV5J 2BRLA 2WCXA 2DB1A 2LVWA 3J81Y 2UVRA 2CYYA 4OHVA 2AEFA 5BR8F 2CQ0A 2G13A 3V81B 5F0WA 3UNGC 4DFPA 2EFVA 3I5AA 2ZM6F 2D74B 2KZMA 4MH8A 3BSNA 4NRUA 2HNDA 2FJBB 1T9XA 3MZIA 2JC1A 1YVFA 1ELOA 1TUVA 1TKZB 1DTTB 1RAOA 1XMQJ 1BWVA 5L9NA 2WAQD 4BWJA 1LQ9A 1Q95G 3SQOP 1O5JA 5KFVA 2UUAF 5K5MA 4QOTA 1VQ5S 1R0BG 4QIWD 1MMDA 2YX7A 2CPYA 4HHUA 1W26A 2XY5A 3AODA 2HQGA 1N32F 1RT6B 3T1AA 3VV2B 1LW0A 5JJBA 1K73T 3FBBA 4U67Q 1JNZB 2E1RA 2LEAA 2PE8A 4NA2A 1SQGA 4DCOB 1XTZA 2PT0A 4UTGA 4YHHF 2IMWP 2HRYA 1NDPA 4YS2A 4UT4A 1YDLA 5D77A 1IUJA 2L41A 3CTRA 1OPIA 1B7YB 3RTVA 5A8WB 1KFSA 2MQMA 1H2VZ 2ZH3A 1U26A 2XMUA 4IOCQ 2XTJP 2HFSA 3OR1A 1RT4A 4UUWA 4H4MB 2UP1A 2DGVA 4PAAA 3GFHA 3WC0A 2KH9A 1WOOA 1CPZA 4C3LA 3NOCA 2R42A 3J7AN 1Y4ZB 3VAFA 2KG1A 4ILMA 2DVIA 3P5TL 2CXEA 3VQTA 1S6UA 1X4BA 4X4QA 2HMIA 1VIXA 4LRBA 1QVFR 3S01A 1TELA 4IO1A 2V8GA 4NLPA 1LOUA 3IO1A 2WSCC 2RF2A 2DNHA 4CP5A 1N6QA 4CLWA 1D9DA 1JK9B 4DR2F 3V6KA 3US5A 5GMDA 1HHQA 3KJNB 3LP2A 3RB0A 1YTYA 3R7NB 1C4CA 1FWPA 4NYOA 1OY6A 4IH7A 3EVOA 4MKAA 1QY7A 4WJBA 4M5JA 1Y5NB 3M1VA 1DZ5A 4CTAB 1F5CA 4UOFA 3I87A 2ZKTA 3JAMY 1SIZA 1RADB 2YKQA 4WU3A 1NHKL 3BF4A 2KJVA 3PX6A 4I1TA 3E2EA 1RYSA 2DHGA 1YI2S 1VQ8S 2MDAA 3PW5A 3I0RA 1PC5A 2MYFA 3F41A 1Y5IB 3ISND 3KG4A 2VPYB 2OPPA 3PIOQ 2RJZA 2D9OA 1ACMB 2YH0A 4Y2CA 5LMNJ 1ZYQA 3T3FA 2NQPA 3V4IA 3EGWB 3DRPB 2MKSA 2AKWB 2W4CA 4P71A 2W9CB 3MXHP 3DN9A 4I2PA 1RYRA 4QPXA 3GQCA 2VIHA 4U8YA 1N36J 4EI2A 3JYTA 1TKTA 2C2NA 1T95A 5BYQA 4ZPTR 4LUBA 4X4VA 2BX6A 1CJTB 3FMBA 4ETZA 4P73A 4YDDB 5C42A 4U8VA 1IBKF 1HBOA 2O01C 3MPVA 3TVKA 2UXDJ 3EMTA 2D3OR 3GV7B 5D0HA 4LF7J 4Q8EA 1TKXA 1HPZB 4DL4A 1YJRA 4NLYA 2VH7A 3ZZZA 2L3MA 4OZ2A 1H98A 3OUYA 2VFSA 3DLGA 3BYPA 2G2OA 1SC6A 4LF8F 5KT6A 1WC6A 1EETB 1UP1A 2ZBPA 3DCAA 4LRCA 3PW7A 2PC6A 1KKHA 3PY8A 3MEGA 2C3OA 3D1HA 4EFAC 1OO0B 4ZOSA 3WBZA 3PYDA 2ILZA 3GP9A 2CWKA 3ZZTA 2CNLB 5EWFA 2JFKA 4KQZA 2DITA 1X8DA 1VQYA 3KYLA 3ENAA 3AQPA 3D54A 5HMWA 2OUGA 2HFZA 3CSKA 4ICLA 4KHMA 4C2MA 1JLQA 2JEJA 4R8UA 2J0QD 3G96A 1VQKS 3D6HB 4WU2A 2F63A 1S1WA 4DPOA 4KYZA 2G2YA 2QLJB 5E41A 2Y8YA 1Y3KA 3T5KA 1HWIA 2HAFA 3UNYA 9RUBA 3N79A 1UZHA 5L46A 2EEYA 2B0GA 1R7IA 2XG8A 1FKOB 4J9SA 3DRRA 2W8LA 2K3KA 4L73A 2KT2A 4EBCA 4C8MA 4ANEA 3DLKB 4RU9A 1HR0J 2R2SA 3TEGA 2HNYB 4KO0B 1WNEA 4LFBF 3KUEA 1HYSB 5A6WA 2DD8S 2WZ1A 4XIUA 3W65A 1U2FA 2N3OA 1Q8LA 4R0JA 2UZAA 5HSPA 5KT5A 3OSNA 1J27A 3O2IA 3M4XA 2DKOB 3HHLD 4MYUA 3MURP 4AXIA 4FPIA 1HD0A 2UXBJ 4KE5A 1R3NA 1FD8A 1WOSA 5FD1A 2YWWA 3H59A 1H7WA 2FGOA 3QT6A 1RAGB 2IJNA 3CJ3A 4ED3A 1SUQB 3KLIB 3OL6A 1UFWA 2B7CB 2JVOA 3K5PA 4L6V3 1IJEB 2ZBRA 1JXVA 3FEXB 2AGOA 5KAKA 4OIXA 1YK9A 4NE9C 3CJKB 1RT2B 8AT1B 4TYBA 1S4FA 2FLNA 4DUYJ 3E01A 4I0WA 3FRYA 2EVZA 3QT8A 4DQSA 5IOLA 4K2JA 1S1VA 7FDRA 1QD1A 2XM3A 3L4BC 3DOMA 3CCQS 1LNQA 4CLFA 5KG1A 1TK8A 1RT3A 2ZOMA 2FHJD 1V3SA 4B3TF 1VOMA 2B51A 4WP9A 2Y3YA 4QW9A 3HSDA 3IGNA 4NZ6A 2LYVA 2XCAA 2VONA 4J37A 4DPUA 5U47A 5KFGA 2YWHA 2IYGA 3D6MB 3IG1A 5H9FJ 4F2SA 3E51A 2YPYA 2Y9HA 4ZLPA 2MSTA 2E1MC 1VQ4S 3BV8A 4Z7CA 2V2KA 4IDKB 1YKWA 3MR3A 3JQJA 4N77A 4O44B 4DQRA 3AJ2A 4RJVA 1VFJA 5DLFA 3QQCD 1RLCL 1PAEX 2JLFA 4A8MP 2XLJA 1SV5A 5L9XA 2NSCA 1UPMB 2PDAA 2AYMA 2V50A 3FSXA 1RTIA 4DX6A 1WG1A 3G9CA 2GMJA 1H7XA 1B0VA 3HP6A 4OYWA 3OVAA 2H9ZA 1PYSB 5DRKA 3QRRA 1YSJA 1T9YA 3W66A 4KFBA 3THPA 3DDNA 2EPIA 2P9GA 2EXUA 1WD6A 4UY85 2RDIA 1YZ6A 4JV2A 2HS3A 1JX4A 4KHRA 4G3IA 4DEZA 2KTQA 2LKZA 1ZA1B 3OR2B 3U02A 1TQLA 4IR9A 1SKRA 2XMVA 1RBAA 1KR4A 2CNNB 1KRPA 2HHHF 2UUWA 4UY8T 3DI6A 3AOCA 1U1RA 4NRTA 4WTYA 4PZVA 4RNHA 3TANA 2EFGA 4AFFA 2XNRA 1XN9A 2CJAA 3OPKA 4QYZK 3UVJB 2FLPA 2J0XA 5F8HA 2HQFA 2YKNB 1VQ6S 2C2EA 4WFNQ 1GXUA 1S97A 1KWMA 4N47A 4B3RF 2KL8A 2DRBA 3UCUP 2IHR1 5GAEI 4LR9A 2JJ4D 5ETMA 4P74A 2X51A 3NS5A 3B6BA 4WZQA 1RT5B 3GZ7A 4LSLA 2ZE2B 3LUYA 4OYXA 2VKZG 1V3ZA 1N34J 3D28A 6FDRA 1TL5A 3TUJC 3M8PA 3KLGB 3GV5B 3FQKA 1GFWB 3NCRA 3O44A 3H98A 3TA0A 1RKIA 4X65J 4X64F 3TQEA 4F25A 3VR1A 4WZMA 2XGQA 3W63A 3DU5A 4ELVA 1IN0A 4TQSA 4DR5J 2VQFF 2JNJA 3T5JA 2FHOB 4J7CA 4ZVTB 1PYTA 5F8LA 3HFVA 2RDDA 1RTHB 4PWWA 4Z7YA 2DNGA 1RHMB 2V2ZA 4C8OA 3HVTA 2GO8A 1X4HA 1P1LA 1LV5A 4A8XA 4PR6A 3BM7A 4OX9J 1TK5A 1S6QB 2AJ1A 4IFYB 3PJWA 3QRPA 4YQWA 4NCAA 1SPBP 1FDBA 5I3QA 2IA6A 2DGSA 2AJ2A 1M5OC 4M5KA 4N8NA 5F8MA 1S57A 3BREA 1RDRA 5HMYA 3DKDA 2C3PA 5GAGU 2KO1A 1SJ4P 5LJ5Y 4C97A 3IN5A 1FI4A 3Q89A 2PI4A 2PMHA 3ZZPA 2B5JA 3KJVB 1S9FA 3ZZUA 2RQCA 2E9ZA 3HZEA 4OJHA 1XNQF 4TVAB 5HANA 4CM0A 2UU9F 5D8HB 2JVRA 4NLUA 5HLFB 1FTRA 2YNHB 4RO0A 2RH3A 2WVDA 3J7Z5 2B9WA 4JI8F 2F4VJ 2W9BB 2ZH8A 5DQIA 1Q82T 3TYTA 1YJWS 4DMZA 2ZHBA 4CM2A 4LF5J 3NXZA 3SXLA 1N5VA 3PEJA 1OMSA 3J7ZT 2LQ8A 1PIEA 3EE3A 1L3UA 4O3OA 2J8SA 2OKQA 2JLEA 4P2MA 4ZHRA 3G86A 1RA6A 3C6UA 2OI2A 2CIMA 3RBEA 4C11B 3DOKA 3MFIA 2PEHA 1YLXA 3DRXA 2L9WA 1VJQA 1RBLA 5H9EK 4URGA 1YX2A 1S6OA 2FYXA 2VICA 3GLJA 1FX4A 2KFNA 4C3KA 3KMQA 4EMDA 4UOCA 1TUWA 4USJC 2WSEC 1XMOF 2BE2A 1C1BB 1M5HA 2YNGB 3MMBA 2YWEA 5KFEA 3G8QA 4ECWA 4RBTA 5FIIA 1NMEB 4DR4F 1HWUA 4Q45A 4GVLA 2VBZA 1KLMB 2Z57B 4B9SA 1D3WA 3M32B 1X5SA 4CO0A 3PFOA 1O8BA 1RAJA 3GMGA 4GKJF 4USMA 1SL2A 3UDEA 4LT6A 4BWMA 3VF0B 4PWUA 2B7BB 2DTJA 3ONQA 5ETPA 4Q44A 1NB2A 2B56A 1NK7A 4K8RA 4DDFA 5GADU 5DZ6A 2J5AA 4HTIA 3VALA 4YOEA 2W24A 1VBKA 1F6TA 2J0WA 3I32A 4K4ZA 3K5MA 4K4YA 2IDLA 3PG9A 3VZIA 1Q53A 4M5DA 5J2QA 4OYAA 3HHNB 4ZIWA 1OWXA 2MLYA 3OTEA 4DG1A 3H20A 1S9GB 1TL4A 3H4BA 4IUFA 4DQIA 4O23A 4LJMA 3PIPQ 3RYLA 1PJ6A 3MM9B 4R5PB 4C48A 3D66A 3OTOF 4O0IA 1MMNA 1YRUA 3ITHB 5KFWA 3H8YA 3EXYA 3MEDB 2EFOA 4O4GB 4DPTA 3OHBA 3HSJA 4DL5A 4A8KA 1JKHB 3C14A 2C2DA 2R8IA 2GHWA 4FKYA 2VG7B 5L8RC 4CH0S 5DETA 4AE5A 4GC6A 1KQGB 4P7TA 1R8BA 1TVRA 1JJHA 1I94F 4LIRA 3TUIC 3PX4A 2V9KA 1LXNA 2XMAA 1WHWA 4DFJA 1B70B 2KXNB 1XC9A 4RR5A 3PYGA 3CCMS 3OVSA 5DGAA 2VPXB 1I6JA 3AQOA 3Q2SC 4YMEA 5IWAF 5ETOA 1N33J 3TQ1A 5KT2A 1HNXF 3DNCA 1NO8A 4M95A 3NCQA 2VODA 3LP1A 2FJXA 3ILOA 1AFJA 3CWJA 5B08A 1ZPVA 5E3PA 4YR0A 3IR5B 5E2QA 3HHLA 3CCWA 3LF0A 4JP8A 4MK8A 5A8RB 1GMWA 2DHSA 3EZOA 2UUTA 1IM4A 4QZVB 3DDKA 2CJ9A 1LW0B 1IQTA 1UVJA 4ZVUB 3BN4A 3R1HA 3D9BA 2VV5A 3OL9A 1CJVA 2BJ9A 1RAHB 2EFNA 1RE1B 3ZNJ1 3KTQA 1BY9A 2DR9A 4KV8A 3MPYA 1E6VA 2OSRA 2FB0A 4WTOB 3BO4A 3GR0A 2BZ2A 1Q78A 5CH7B 5DG9A 2KHCA 3UR0A 1KVKA 4ECUA 1VHIA 5LXRA 1RT4B 1F2GA 3GR1A 3BH6B 3EDQB 1FRJA 2B43A 3I9V9 2VOPA 4JI6J 2B3TB 1QAYA 1REVB 1HKAA 1WSRA 4DV2F 3PO5A 2V4JB 2M4MA 2FHJA 2KYXA 1UPPA 1IWAA 1DFDA 1GTEA 2HMIB 4Y0FA 5EUHA 2HBQB 3B82A 3RJMB 2XGPA 4DUZJ 4F4AA 4WIIA 1D9FA 2DIVA 4M63A 4WP3A 2RF2B 2KDOA 5B0BA 3I9ZA 2ALZA 3LP2B 3G6XA 3EPGA 2Q3PA 4V19X 2BM0A 1RB0A 3T19A 3HFZB 5CHCB 2BKOA 1YJNS 3MM6A 1MMLA 2P9CA 1RTDA 3CJ4A 3DLLQ 3MUVP 3O6QA 2I9SA 3MR2A 1FRXA 3TVZA 3TRGA 1UVIA 1WSVA 1HQUA 3BBBA 1NDKA 1NSAA 2CQHA 2V67A 5GMKa 2QA2A 4F67A 3NGTA 4JI4F 1SCJB 2R4FA 4Y2AA 3KHGA 3DU6A 3RBZA 5KG2A 3CO0P 1LEOA 3LANA 3HF5A 1ZM3A 1PKUA 3U27A 6AT1B 3V4IB 4RZRA 1KVJA 3CJSA 5J1EA 1N4LA 1XNRJ 4NX9A 5KFAA 4E2FB 5C24A 2J6TA 3UPFA 1Y5LB 3V6JA 3M8ZA 4I67A 2CPDA 1HQEA 1MSWD 3JYTB 1TKTB 2OPSA 3LP0A 3I96A 3VAIA 2OGUA 3RB4A 3LALA 1EX8A 4X66F 5CCLA 3H5UA 3G6VA 2JRSA 2ZZNA 2C2OB 4DV3J 1HBOB 3RR7A 2WTFA 4ELUA 3EPIA 2HWTA 1NPRA 4M5MA 4I56A 1EKSA 1UKUA 1HNWJ 2DT9A 2BR0A 1TKXB 4B08A 1HMVB 2AEJA 1FKAF 1HD1A 3TWZA 4XPEA 5KFXA 2WONB 1HBNA 4WE1A 1F3VA 2W2NP 1VBZA 1Q5YA 3EZUA 3G87A 3A3OB 4CO5A 4USIA 4B9MA 1S77D 3MUMP 3NY0A 3UWTA 2N3LA 2QLWA 2BACA 2QYGA 2GO9A 4I6YA 1XBWA 3ENVA 3MEGB 1MROB 1NPPA 2BQ3A 2LU1A 3CMES 2CFXA 4OZNA 2GQQA 3OL8A 1QE1A 4MKVA 2Z2MA 3NP5A 2IRXA 3HPOA 4ZPCA 3X3UA 2MQPA 3UI3A 4AXJA 2FJVA 3NBPA 4DFMA 3MCNA 4LF1A 2HVEA 2BJ3A 4ICLB 3K58A 4YR3A 3P8BB 1JLQB 3M2VA 3AY0A 4R8UB 5LOQA 1JIHA 3ETOA 3W64A 2V63A 3C16B 4USHA 4O3NA 2OPRB 4HH1A 1BD6A 3HLUA 1HNZF 3H5YA 4H4MA 5HQ8A 3TJ8A 4DX5A 2YVSA 2RDJA 3DRRB 2ZJQQ 4DR1F 1X9WA 1BHNA 4ZIVA 3J7A1 5K9FA 4ED2A 2MPUA 5DDQC 4K59A 2CZ9A 1T8EA 1U1OA 4TU9A 1X60A 1FJCA 3I55S 1V6HA 2E5LF 5BR8J 4ED8A 3DHXA 4I6WA 2ZM6J 2AX0A 2EC0A 4J5OA 4ZVQB 2AMCB 2XI3A 1UA1A 1N5YA 1P1TA 2C2MB 1NJYA 3W8PA 4DUTA 4ED4A 1RTJB 2WW8A 3KK3A 4DHVA 1XR6A 4DXLA 4CI0B 3NWRA 2HQIA 2PFDA 3OXFA 4KTQA 2MKIA 2P8IA 1X0PA 2W4PA 2NXEA 2R8KA 2UUAJ 3IP0A 2V0NA 1RAIB 1OSDA 2XMMA 3A12A 3UQSA 2NR0A 3UDCA 3CCTA 2HPUA 3MFHA 1N32J 1N0VC 1RACB 1SBRA 3TUPA 2HHVA 2LEBA 3E01B 3VAJA 1HI0P 4NEYA 2L9NA 4K7QA 4NEZA 3ZTSA 3BR8A 1HL6A 1S1VB 3MM5A 3IMQJ 5E3RA 3BGFA 3J7YU 4YHHJ 2W9CA 2FD2A 5AJ3F 3DYAA 1XK8A 1VR6A 3JTOA 5A6PA 4HR2A 4XDDA 4DZDA 2QLFB 4RUCA 2VDHA 2NS1B 2VHGA 1CJTA 4A47A 1FRKA 4KRWA 3M30B 3AA8A 4FYWB 4OFZA 4Q0BA 1UVNA 1R0AA 3A8IA 3RBDA 2LDYA 3MDFA 2U1AA 4ZP8A 1HPZA 5IZHA 1QSYA 1FVQA 2ZH5A 1SV5B 2IYIA 4DV5J 2COLA 3B54A 3OQ2A 3UO0A 2RILA 3GILA 2DNRA 4DL6A 5SUHA 4CCHA 5CD4H 3U7JA 1RTIB 1U7LA 4QJVA 5D3GA 1R0CB 5KG4A 2JL9A 4JBCA 5GMEA 5EWGA 3WIUA 5AXKA 4DR2J 1NKCA 3MMCB 4ZCLA 3TA1A 2QN6B 3BPSP 2VG5A 4HDGA 3RW6A 5K8NA 1H74A 2OD6A 3SBMA 1G7CB 4F4YA 1A6LA 4UF4A 1IVZA 4DR6F 4V1Ak 2XYPB 1ROFA 3VGSA 3LGMA 4C4WA 4KAIA 4NYPA 1U09A 4Q7AA 1C0TA 3D1OA 3AA9A 4F4KA 3KFWX 4DV0F 1JXLA 1GAOA 5G0RA 4CT9A 2Q66A 4ZS6A 1SC4B 3D0IE 1HBMA 2AJFE 1R8AA 4A8OA 1SH3A 3DI6B 3OL7A 5AE1A 2QG9B 1CULB 3U1LA 4AL5A 2XS5A 1T7PA 3AFGA 4AL6A 3JSMA 2CNKB 3BS9A 1TV6A 3CW2C 3DMJA 2G1DA 4CYUA 1FKOA 2FZGB 2JFDA 2NREA 2OTLS 3KUGA 3CPWR 1IM6A 2M3DA 2AJ4A 2APOA 1VQPS 3H42A 1MN9A 2AJQA 4M5GA 4K4UA 1EB0A 4F4ZA 3CC2S 2Z8QA 1WI6A 2YNIB 2NXNA 4NLVA 2QT7A 5FJ4A 3S6EA 2RE1A 4LSLB 3CDEA 1RT1A 3EM1A 4HVZA 4WKYA 4H54A 4NLRA 1IBKJ 3M8PB 4PQUA 1RJJA 2YWGA 2J76E 1GX6A 3TJ9A 2V34A 3NMRA 3FK4A 4QR1A 3EGNA 3S7RA 4ZJOA 1FCAA 4YN3B 2DNQA 3M8YA 2CVIA 2H5JB 4I4BA 2X3GA 5KT3A 3WX4A 2MQ8A 5LL6d 3M8SA 3O5TB 2Z0GA 4IG3A 4BLGA 1IKXA 4ZP6A 5F8GA 2HS0A 1FNOA 2C3MA 3TZYA 4LF8J 2AF6A 3PRBA 1RWXB 5H9FK 1F5AA 3K7RA 2ZJRQ 4DL7A 3D2WA 1RT2A 4JI3F 2CQDA 5K8PA 3HSGA 4O3RA 1OQ3A 3ELHA 2BKPA 1WG5A 2ZBCA 3UCGA 1N48A 3CJ2A 2DCLA 2GJ2A 3MMAA 4WF9Q 4ZCIA 1S1UB 3AD7C 3HVTB 4ZVSB 2CAJA 2HWHA 5H1SV 4CZCA 1VMBA 3EXCX 1UL3A 1U49A 2HGMA 1FXDA 5EGYA 2C3UA 4CO4A 1ZA2B 2K7JA 3DFEA 4RW4A 1SI9A 3M05A 3QSYB 3ILIA 2VUGA 1N0UA 1X4DA 4OLPA 4OLOA 3SDEB 2YKAA 1YGYA 2EW9A 3CCUS 4CNZA 1C4AA 4J90A 4LVOP 2FZCB 4DV7F 3WZ0A 1ZZNA 2RB7A 3LGNA 4IDKA 4ZITA 4O44A 1KHWA 4IOBA 4EZ6A 1DLOA 1K8AT 4LF4F 3RAMA 2CDRB 4OX8A 2GMHA 2MQOA 3PCOB 2F3JA 2B5JB 2F1FA 2FVQA 2J7WA 4LFBJ 2RKIA 4UQGA 4KH1B 5GVQA 3AOBA 4J9LA 3L7PA 1LFPA 4J9RA 2YXLA 4PG7A 2W4DA 2B9XA 1FF2A 1UWBA 4P72A 3TZZA 2K1RA 1SB6A 2JHEA 4CRJA 1AW0A 3CJ8A 3A13A 3R5AA 3R1LA 3S1TA 2H4WB 2VFTA 3GG1A 1CLFA 4OI6A 2RSQA 2KM8B 2BJ1A 3NS6A 3IRXA 2ZH7A 1FJ7A 3NS7B 4F4WA 3RUBL 3R9LA 4CLYA 4NCBA 3CJQA 3FRZA 4X2BA 2VOOA 1U45A 2ZH6A 1GMVA 5BJRA 2H65B 1VQ9S 5I4MA 3MAAB 4ZHRB 3P96A 3C6UB 5BYRA 5KFFA 1RWWB 3DOKB 4OI4A 2FLOA 3SI8A 2E29A 3T1HF 5K20B 1EQ0A 2R2UA 1G3OA 3KKFA 3PYFA 3VQSA 2U2FA 1YZ7A 4ECYA 1DY3A 4KR0B 1I51B 1RCXB 1VRTA 3D0HE 4ZJLA 3OLAA 5FDLA 4B3TJ 4PABA 4RNFA 4GVBA 2BVZA 3IM8A 4IOAQ 3KK2A 1RT5A 2EK1A 1MWYA 3KHHA 1CQMA 4GKKF 3NGRA 5JUMA 1TAQA 1YITS 3IR7B 1TZ0A 1NZ8A 1Y11A 3CIZA 4EU0A 1WHYA 3N0VA 2HHTA 4O3QA 3IAM9 3P6YC 1S1TA 2UVUA 2VF3A 5D4NA 1SQFA 1T9VA 1WDTA 1KTVA 1RTZA 2XBPA 5EN1A 2OFGX 2DGWA 2O66A 2FHMA 5F3TA 2OSQA 4K4XA 1RA7A 3HT3A 4M94A 4Q5VA 4ZLJA 5MLCV
chains in the Genus database with same CATH topology
1SKRA 1DURA 3SSQA 2XMVA 4UQTA 1KR4A 1KRPA 1S0MA 2HHHF 2UUWA 4HT7A 5J2QB 2RQKA 4NXMF 3FGVA 4UY8T 4IRKA 3OTCA 3DI6A 3S8SA 3IG1B 4LF6F 1U1RA 3M2UB 3DRSB 4NRTA 2FJAB 2HVZA 3SQGA 4PPDA 4WTYA 3EX7B 4RNHA 4KHPF 3TANA 4CT8A 2EFGA 2KI2A 2GA7A 4AFFA 2IM2A 2VASA 4NLXA 2L9DA 1N34F 4PUOB 3H2VE 2XNRA 1XN9A 3GSDA 1NU4A 2CJAA 3DXSX 5F8JA 2RQMA 3KHLA 3GE9A 3OPKA 1R8HA 2ZUGA 1JMTA 1KOOA 1IKWA 2VZ9A 1C0UB 1B0PA 2LXFA 2FLPA 2J0XA 2UV8A 3DC2A 1GT8A 1KC8T 3CD0A 4MIBA 5KFPA 2LMIA 5F8HA 3QLHA 4DL3A 1FESA 4E8UA 2YKNB 4C8NA 3FEYB 3M8RA 4X65F 1EP4A 4Z37A 2GIRA 2RMLA 4OZJA 1VQ6S 2C2EA 5A2QY 3HO1A 2CQ2A 4WFNQ 1GXUA 1S97A 2XS7A 4N47A 2RRNA 2IC3B 3POTA 3MHYA 4B3RF 4IR1A 1K9MT 1MW7A 2BDPA 2DRBA 4JI2F 3UCUP 2CPIA 2IHR1 2ZDPA 3H5SA 5KFIA 1LK7A 4FBTA 2DO4A 5GAEI 1LFWA 3NMAA 3IR6B 2JJ4D 5C25B 4G1QA 2P6TA 2X51A 1FEEA 3NS5A 1KQKA 2JSXA 3OFGA 5DQHA 4WZQA 2GHVC 1RT5B 3GZ7A 1LWFB 1EETA 2X1FA 4JUZA 3K2YA 3MM8A 3W2WA 4LSLA 5AE2A 3GFXA 4Q8FA 2J9DE 2W25A 2CQGA 2ZE2B 5L39A 3LUYA 4DR5F 1S0NA 2VKZG 1V3ZA 2VPZB 3D28A 4MIWA 5HI7A 1FRHA 4RW7B 6FDRA 1TL5A 3DM2A 2K8GA 3TUJC 1FEHA 3GFYA 3M8PA 4KFBB 3KLGB 1LWEB 2MHNA 5I42B 4GC7A 4ED5A 3OJUA 3GV5B 2V8HA 3FQKA 4B9NA 3NCRA 3O44A 4RNMA 3MTKA 3CDAA 3GB0A 3H98A 4ES2A 3TA0A 1FTCA 1X4EA 1RKIA 4KC5A 5HROA 1T03B 1LWCA 2BANB 3ZZRA 1DAXA 2IVFB 1BQNA 4X64F 2A10A 1HNIA 2QV6A 4NZ7A 3TR5A 2MSSA 5F8NA 3PO4A 4WKRA 3M6VA 2EG1A 2GW8A 1LXJA 2IBOA 2DR5A 4F25A 1U1QA 1Q7YT 3FSYA 1W2BR 2PGCA 3KJVA 3VR1A 3NKYA 3HJFA 4QWAA 4F50A 5IFMA 4WZMA 2NSBA 3GIJA 2HZCA 4MAKA 3GYXB 4M8LA 4DFKA 1FRMA 2IA0A 2XGQA 2PA8D 2R8HA 3K8VA 4KB7A 3DU5A 2MZQA 4ELVA 4OX9F 1M0SA 3HK2A 2QSFA 4D3HA 1IN0A 3HVAA 3IS9B 5E3CA 1VQOS 3CC4S 1U1KA 2GFFA 4G1PA 4TQSA 1QJHA 3PJXA 2BA9A 5KG0A 4FXWA 2HHSA 1P27B 5EX0A 4X4TA 2VQFF 4UW2A 2QYCA 1QAJA 4HTJA 4IH5A 5HLFA 1QUVA 3Q23A 4EYIB 2Z4PA 3T5JA 4QU7A 3SFUA 2FHOB 1XR7A 2XMWA 4WXWA 1D1UA 2DHXA 2XWXA 4ZMMA 1IKVA 3SMZA 3O1LA 2A18A 1IQZA 3LP1B 1U48A 5F8LA 2DH8A 3THTA 1RTHB 2J7KA 2GNKA 4J9MA 3T6JA 2DNGA 2OPQA 3TO8A 2W7AA 4C8OA 3EGZA 4JV1A 3HVTA 3RZAA 2N7YA 3PVXA 2ABYA 3RR8A 5HP1B 4EEYA 2BXJA 4HYKA 2LQ5A 4OHWA 2A3JA 3DLKA 2LU2A 3HHLB 2ZNZA 4N5SA 2K3IA 2GO8A 1X4HA 2LQJA 1L3KA 4QWEA 4AQYF 1P1LA 4A48A 2KXFA 3POTB 1NK4A 2MQQA 1YRXA 2JEIA 3FCHA 4ZPWR 3R3TA 2HNYA 1U6ZA 1LV5A 3QYYA 4KO0A 4A8XA 1U24A 4PR6A 3BM7A 2Q6CA 1TK5A 2E44A 3LH2S 1S6QB 3N6LA 3IRWP 1U47A 1HI8A 4OI2A 4W92B 1N88A 4HKQA 2DNNA 3VAHA 1HYSA 2AJ1A 5L1IA 5D4LA 3W2WB 2CQ3A 4IFYB 4BDPA 3V6DA 3PJWA 1JLGB 2FC8A 4DSIA 1Q8BA 1S1XB 3TVYA 3IC1A 4FYDA 5KFRA 3DLBA 3NNCA 4OL8A 3QIPB 4YQWA 2IAJA 3RRKA 1D9AA 2AGQA 2MZRA 5HO4A 4NCAA 3R5BA 1FDBA 5I3QA 2IA6A 2DGSA 4NL5A 4XAKA 1SJ1A 4OI1A 4L72B 5M2RA 4HI2A 1M5OC 4N8NA 3VWSA 3RAQA 5F8MA 3BREA 1X4FA 2HIQA 1RDRA 2J7UA 5HMYA 2C2RA 2QA1A 3TAPA 3PDNA 1U1PA 2EBGA 2C3PA 4NCGB 5GAGU 4K4WA 1SL0A 2KFZA 2KO1A 5HROB 1SJ4P 1UW4A 5LJ5Y 2F4VF 3FEZA 4C97A 1WF0A 5DM6Q 3IN5A 3OSPA 2N82B 4ED0A 3C66A 4TNOA 2GQCA 2PI4A 2PMHA 3OW2R 1X5TA 3ZZPA 2B5JA 2CPHA 4QYZJ 4ZP9A 4KGKA 3FJ2A 1OPZA 3BB5A 3KJVB 2YQ3A 2FVSA 1S9FA 2FC9A 2KVIA 4LF5F 1SUQA 3ZZUA 3KLIA 3LAMA 3UDLA 3T9ZA 2MZ1A 2XLKA 2J6SA 2RQCA 2E9ZA 4EBDA 1Y9OA 1VQLS 3HZEA 4X4PA 4IYQA 2CPEA 2VA3A 2MZSA 2LA6A 4OJHA 3C6TA 1AUDA 4C8YA 2HLTA 1XNQF 5IXUA 2LEPA 2UVWA 1ZETA 3GIMA 2UU9F 3CJKA 5D8HB 2JVRA 2DNYA 4NLUA 4B9LA 1BGXT 2LQ9A 5HLFB 1UFLA 1FTRA 2YNHB 4TXSA 2NPFA 2BQUA 3PKYA 2RH3A 5DGBA 5DDOC 3J7Z5 2HHXA 1S6PA 3T1YF 1NH8A 4K5SA 1JJ4A 1E6YA 3FMWA 4WFBQ 2B9WA 2W8KA 1DARA 2FJEB 5EDWA 3P49B 4JI8F 1JXEA 2W9BB 2ZH8A 2WRMA 2RT3A 1X7VA 5KFCA 1RT7B 4YEAA 5DQIA 2PA3A 2OPQB 3CT9A 2V5HG 3TYTA 1Q82T 1YJWS 1VK3A 2QMWA 1VC5A 4DMZA 2GHPA 3ENWA 4ED1A 1UAWA 2ZHBA 2FVPA 2DCUB 1A9NB 2RU3A 2AV5A 4JYAF 4LSNA 3CDWA 3MECB 4F3MA 2E7WA 3SXLA 5KT4A 3TI0A 1N5VA 3PEJA 1DTQA 4PXEA 5D4OA 5IM0A 1GX5A 3J7ZT 5DO2A 3D1QA 1CC8A 4U6PA 1HHSA 1L3UA 4O3OA 3CUNA 2FJWA 2OKQA 2DR8A 4E98A 2KHDA 3HHEA 3MM6B 4IG0A 2DGQA 1HWJA 2BYCA 3JSRA 1P8GA 2IJFA 2JLEA 3MM7A 1RTDB 1F0XA 4ZHRA 3G86A 1RA6A 3W7BA 4O3SA 3C6UA 2B9YA 2CIMA 3NLCA 2Y1RI 2M0GB 1WEZA 2RU9A 3PACA 1HFEL 4C11B 3DOKA 3RBEA 2UXCF 2PD1A 4A8YA 1R6YA 3MFIA 2PEHA 2MGZB 2DNMA 1S7HA 1VC6A 1IXKA 4BC9A 3FVYA 5CYMA 1QTMA 4B9UA 1CQNA 2L9WA 3DRXA 3OFEA 1T05B 3AB2B 4XPCA 2F7VA 4CNYA 4A8SA 1X4CA 4OMFG 4URGA 4PG5A 3MR6A 1U4BA 2LXIA 2OLWA 4ITSA 1S6OA 1NRKA 2VB6A 3H2LA 1APSA 3ITHA 1MNEA 2FVRA 3DLHA 1Y00A 2XB2D 3KLHA 3MEDA 3Q0AA 2ASYA 1ZTTA 2KFNA 3CE8A 1NEEA 3HFKA 4C3KA 3KMQA 4MFBB 4UOCA 4OJ3A 1IR0A 4RW9A 2GX8A 2HRUA 4USJC 2JEGA 4F8RA 4ES3A 1D8YA 2WSEC 3IFEA 2PI5A 2GIQA 5KFKA 3M8QB 1O0PA 1XMOF 1V3RA 4KJIA 2B4UA 2BE2A 3AHPA 3I5CA 1C1BB 1M5HA 2YNGB 4AYBD 3MMBA 2YWEA 4WFZA 5KFEA 3G8QA 3M9NB 4ILRA 3VTIA 2IM1A 1JKHA 4C3MA 3MEEA 4RBTA 5J1EB 5FIIA 2XCPA 4ECWA 1UVLA 3K57A 4DR4F 1HWUA 4UUXA 2VBWA 4RBVA 5C24B 4Q45A 2DH9A 2VBZA 1KLMB 4B9SA 3PV8A 4DR3F 5J2PA 1D3WA 3M32B 1X5SA 3K8WA 5ADZA 4TQRA 4CO0A 3SV3A 3PFOA 3K0JA 5KTQA 1O8BA 4X4SA 4DX8H 1U8SA 3U1NA 2VG7A 2I0XA 4X4OA 2LECA 1ZBTA 4JI5F 1WI8A 1RAJA 3GMGA 1OQ6A 1HBUA 4KBIA 5DQGA 2XMTA 2ASJA 1HNVB 3O3LA 2KM8C 5E33A 4PCQA 2QLXA 5HL7Q 4GKJF 1SL2A 3K5OA 4LT6A 5EHHA 1X5PA 3JSBA 4BWMA 3VF0B 2DHAA 3SFGA 3UW1A 2XY7A 1KNZA 1NJIT 4H4OA 3DLJA 4PWUA 2XZWA 1UJ4A 2B7BB 3O8WA 2DTJA 3ONQA 4Q44A 5E3AA 5B0CA 4NA1A 5KFDA 2B56A 1FK9B 1NK8A 3MOJB 2RUGA 2N7CA 4DDFA 5GADU 1NK7A 3BGRB 2J5AA 5ITHA 4GO7X 3TAMA 5LSOA 2J9DA 2ZBIA 4J9KA 2DH7A 4HTIA 4QWDA 2W9AA 4FPRA 3WC2A 2PIIA 1RI7A 2LLZA 2KZZA 5I3PA 1DTQB 3VALA 3N28A 3ENQA 1H3DA 1GNKA 3OR2A 3V6HA 4YOEA 4PRFA 2W24A 4O3PA 4CO2A 2DNPA 3DLEB 2PSZA 2J0WA 1WF1A 3I32A 4QIVA 4QWBA 3K5MA 4K4YA 4K4ZA 5LMUF 2ACYA 3UD3P 5T14A 1Y3JA 1R31A 2O5DA 4TKTA 3VZIA 2KFYA 5A0YA 2CZ4A 3CO9A 1Q53A 2AWZA 1P9QC 4OX7A 4M5DA 5J2QA 3H2UB 3BGLA 4Y3CA 4EBEA 1TL1A 3HHNB 1OWXA 3OTEA 2M52A 3TA2A 3OLBA 3CEDA 4IQXA 4DG1A 3H20A 4OJ1A 1HBNB 1S9GB 4B17A 1TL4A 3H4BA 4WE1B 3QZ8A 4G1IA 4IUFA 1B64A 4C0HA 1UMJA 5B0AA 3CCVS 4DQIA 1LW2B 2YY3A 4ES1A 1Q81T 2KRRA 2XC9A 4O23A 4LJMA 4WFXA 2VBYA 4ZVFA 4EGLA 3PIPQ 4ECVA 4PUOA 3ISNC 3RYLA 3GIIA 2RD5C 2WOMB 3BEGB 2MQLA 4Y2IA 1YHQS 3I31A 1AFIA 2QMXA 1DQ8A 3MM9B 4R5PB 4K2XA 2JX2A 1TR0A 1U6FA 5IT4A 2R7UA 3OTOF 1C0UA 4O0IA 4ECXA 1R27B 1U25A 1MMNA 4PWDB 3VAGA 4XO0A 1YRUA 1Z2ZA 2MKHA 3ITHB 5J1NA 2CZVC 5KFWA 4PG4A 2YKNA 1BQMB 3H8YA 1JJ2R 4EZ9A 1QE1B 2YTCA 3EXYA 3I4PA 3CCJS 3MEDB 3NL0A 3MD3A 2AP6A 1MU2B 2EFOA 4O4GB 5A8RA 4RW9B 3OHBA 2IC3A 3SSSA 3KLFA 1SJQA 2Y0SD 4DS4A 4FVMA 4DL5A 1J5EF 2FDNA 3LWLA 3THVA 4A8KA 1NK5A 2BE2B 2CPJA 1QM9A 3MMBB 5GAEU 1N54B 1JKHB 2J8AA 3MEEB 2MMYA 2C2DA 1KOHA 1QAIA 2ZITA 1KTQA 1TL3A 1LWFA 2BABA 3VAMA 3TARA 3NBPB 4FS2A 3BSAA 2R8IA 1VK8A 2GHWA 3HVWA 3PM9A 2WHOA 1UJ5A 1N5SA 2ZE2A 4YFUA 4PG6A 2C22A 1TKDA 1N33F 3V5RA 3NGDA 4DN0A 1PSDA 5KFHA 2E5GA 2VG7B 5L8RC 1DRZA 3T6BA 4CH0S 5DETA 3M2VB 2X1BA 4LMZA 2J9EA 2HGLA 3BN7A 1AROP 1FRLA 1Q1KA 1LWEA 4AE5A 1KQGB 4P7TA 2CQPA 1KEKA 3KLGA 4GC6A 2KYZA 5I42A 1IBLF 1NAQA 3PRDA 2MB0B 3CD5A 4ID8A 2XMKA 4I7FB 1R8BA 4DSLA 1GH8A 1TVRA 2HHPA 3CF5Q 3NAHA 3H40A 4PXDA 1JJHA 5KOWA 1I94F 3LAK