4Y2KA

Reduced form of apo-golb
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
GMQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal-binding transport protein
publication title Structural Insights and the Surprisingly Low Mechanical Stability of the Au-S Bond in the Gold-Specific Protein GolB
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Metal transport
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y2kA00
1TL5A 2XMUA 4QOTA 1GXUA 2GGPA 2OD4A 4Q2LA 5A6PA 3HHLB 1KVIA 1Q4RA 1YJUA 2BYCA 5T7LB 4A48A 3BM7A 2W4DA 5B0BA 4OJ3A 5B0FA 1OPZA 1S6UA 1SI9A 1OQ6A 2KT2A 4Y2IA 2AP6A 1FE0A 1YG0A 3E8OA 3MZIA 2BJDA 4YEAA 1SQEA 1Y9OA 2OFHX 3HHLA 1TUVA 2K1RA 5T7LA 2GA7A 1P6TA 1KVJA 1ULRA 2BUNA 4YDXA 4NPOA 2HLUA 4EFAC 3QGPA 2LXFA 5B0DA 2XMTA 2N7YA 1Q53A 2VV5A 1XBWA 1K0VA 2N4CA 1LQ9A 1V3ZA 2IYIA 3VTIA 1FD8A 4HI1A 1W2IA 2FB0A 2HLTA 2OFGX 3IWXA 2LQBA 3F44A 3BGUA 4A46A 1AFJA 3MCSA 1CC7A 2XMKA 2Q3PA 3K7RA 1URRA 3GZ7A 2ACYA 2K1RB 3FGVA 2KT3A 2ZDOA 2K7KA 2OP5A 2BBEA 5B0EA 1KQKA 3HF5A 3HHLD 2GV1A 3TNVA 4ZOSA 1X7VA 3I9ZA 1S6OA 2FIUA 2GFFA 2ASYA 2XMMA 5B0CA 2W4PA 1VQYA 3KKFA 1MWZA 3KNGA 2FTRA 1VQSA 5KAKA 3BF4A 4HL9A 1TZ0A 4F67A 2OMOA 4HH0A 3T9NA 2ROPA 5IXUA 1YJTA 1FEEA 3BR8A 3TRGA 2L3MA 3UDCA 3IWLA 1YJVA 4Q2MA 5A6WA 2HQIA 5B0AA 4A47A 4A4JA 5B09A 4HI2A 4HH1A 2XMWA 4NL5A 2BJEA 1FVQA 1R6YA 3BN7A 3QMQA 1U7LA 2HFOA 2QYCA 3FRYA 5K9FA 4DN9A 3BB5A 3KG0A 4OIXA 3TOQA 2RU9A 3LO3A 1YJRA 3DCAA 2N4DA 2IYGA 3KG1A 1AFIA 1P8GA 2AW0A 4DPOA 4OJHA 1JK9B 1YRXA 1N5VA 3HDSA 4OJ1A 2RMLA 1IUJA 1FE4A 2HFNA 2G9OA 2XMJA 1APSA 2GO8A 1X8DA 1FVSA 1CC8A 1MWYA 2LDIA 3DXSX 3HHLC 4U9RA 4Y2KA 1X0PA 2EW9A 1N5QA 1Q8BA 4FNHA 1TR0A 3CJKA 2W4CA 2CRLA 1CPZA 1SB6A 2AJ1A 1FESA 2OAUA 1QUPA 2IFXA 2QLXA 3WDOA 4DL0C 1GXTA 2K7JA 1WD6A 2OKQA 5F0WA 1N5TA 4Y2MA 3BDEA 3HX9A 2ZDPA 3HFKA 2KYZA 1JWWA 2JDJA 3FMBA 3LGMA 2QLWA 2HIQA 2KKHA 2LQ9A 2XMVA 2ROEA 1N5SA 1AW0A 5B0GA 2AJ0A 2FHMA 4OJGA 5B08A 1OQ3A 3CJKB 1OSDA 2GGPB 2ROGA 1RJJA 2GCFA 2PGCA 2RSQA 1TL4A 1Y0HA 1Y3KA 2VH7A 4FNIA 2K2PA 3LGNA 5F0UA 1Q8LA 2PD1A 2QIFA 1Y3JA 4ZA1A 2RILA 2OD6A
chains in the Genus database with same CATH superfamily
3UFCX 5KT4A 3TAQA 3EGWB 3BGRA 1DRZA 1D8ZA 2AX0A 4R5PA 2W8LA 2HFSA 3L95X 4RKUC 4UUXA 2CJYB 3OJSA 1NJZA 3ILJA 4V19X 3QIPB 1EETA 4YB5A 2DB1A 3H0PA 4X65F 4MYUA 3M2UA 1TAUA 2XLIA 3HVRA 4JI5F 3BSCA 1RLCL 2K7KA 3H5UA 2OMLA 1XERA 5C25A 4IG3B 1K1QA 2YKNA 4QU6A 2EPIA 3NNCA 3TA2A 3CJTA 5SZTA 4Y00A 2ZUAA 4YN3B 1R27B 4NZ7A 3R5DA 1YVFA 1YIJS 4NXNJ 3GIMA 2VFTA 2CPHA 4K4YA 2H9ZA 2MPUA 4M5NA 4F7VA 3L9ZA 2A2DA 2UUCJ 4JBCA 2KKHA 3I5AA 2LLZA 2OI2A 4NZ6A 1FFGB 1Y0HA 5C24A 4OX9F 1LW2B 2M2BA 4K59A 3OTCA 3HSZA 2J7UA 2BRLA 4CDIA 4K0KJ 3W9IA 4M5JA 1WWHA 5K20B 1NCLA 3UVJB 2HRUA 2OTJS 1AZSA 1KVKA 3KMQA 2Y1RI 1N56A 5LXYA 3G8QA 4OLOA 2CUYA 2DEIA 2XC9A 2WTFA 3FFIB 2VPYB 3KKFA 3F56A 1TV6B 4O3RA 4XPCA 2C3PA 2PA8D 2H5JB 3ZZUA 1S1UB 4DLGA 3G2XA 3PKMA 4F25A 1UWAA 2EVZA 4DV2J 2WOMA 3BJYA 3PEHA 1VYAA 4WBFA 1RHRB 4RWXA 3AA9A 4PPDA 2IM0A 2FZGB 1Q95G 3TUPA 5L9NA 3S6EA 1SUQB 1SKUB 4K4TA 4KY3A 5DO2A 4D3HA 4L72B 2LXIA 1CJKA 2X7IA 4ID5B 2R8JA 3VVUA 4LIRA 2HS4A 3AA8A 3ZZZA 2MKKA 2ZOGA 1IR0A 2YQ1A 3H4BA 1VBZA 5D77A 3D68A 3F44A 3CB4A 3M8WA 3DHWC 1PG5B 4F4XA 4DR1J 1T9WA 4DUZF 1K44A 2GMLA 3OHBA 1WF0A 3DDNA 5CYQB 4N8NA 2HS3A 2MLXA 2KI2A 2E29A 2WBMA 1U2FA 3G6YA 3KG0A 1UWBA 3HHDA 1VLYA 2QZ8A 4I2QA 3T6BA 1U4BA 1WC4A 4I56A 1RT1B 2DH7A 3MMJA 2AYBA 5L39A 1RAHB 3BDPA 2HRYA 1UCNA 2RKIA 2JWNA 1S1VB 3HVTA 3KLVA 4K5RA 2Z4PA 4QIVA 3R7SB 2QA4G 1T05A 2G1DA 5AXKA 5A8WA 1SH3A 3GTYX 3LP1B 2V0NA 3NXZA 4U7UK 1E6VA 4JYAF 4JI5J 2DGQA 4LMZA 3QFHA 1SJ4P 5D8HB 2W2PP 4RO0A 3LP2A 3FVYA 1ZPVA 3KHRA 2HNYA 3G8TA 2C2OB 5HROA 4BC7A 1VQ7S 2QV6A 4B9NA 1SIWB 4UW2A 3I96A 2MZTA 2OELA 1VQ4S 1N33J 2HGMA 1U1RA 4RW7B 1IXKA 4WWSA 3TZYA 1WJ9A 2HAFA 2P6TA 3FZ2A 1YRXA 1JLFA 2POKA 1RLDA 3FRZA 3P45B 1APSA 4CH1A 3QSIA 2H5IB 3J7YI 1KOHA 3I0SA 3EDRB 4ED1A 2Q6CA 2FLLA 4A8XA 2QLBB 3D5MA 2EFVA 3Q24A 4OX9J 1YQHA 4NLQA 2QMWA 4FVCA 1VQMS 4IUFA 3LPYA 2KJVA 2IAJA 2V94A 1Q4RA 3KJQB 3EXCX 3CF5Q 2W2QP 1NUEA 1S76D 3MZIA 2V4QA 1WG1A 2GA7A 3UN3A 4HACA 3RTVA 4X4RA 3C2PA 3HFVA 3JQJA 5K14B 3UCZP 1XMOF 5IM0A 3H90A 1S10A 1RWWB 2J7WA 3VR1A 1I94J 1WORA 2GV1A 5E0OA 2UXBJ 3CCJS 4DEZA 4K4ZA 3QT5A 3C46A 4CLKA 4J9KA 2F9JA 1L3SA 2PMWA 4Q2MA 4KGZB 2KXHA 3CJ5A 5H9EJ 2DYAA 3G86A 2MMYA 1I1GA 5KFIA 5DJBA 3JSRA 4DCPB 1S48A 4JI8J 5EX3A 3OSPA 1HWIA 2DGTA 1F3FA 3CDUA 5CYMB 1SIZA 1Y5IB 1NPKA 2FVCA 3CULA 2EG2A 1HBMB 4Q0BB 1RHQB 3CSKA 4W4MA 1S6PA 4DPTA 3N01A 2R7VA 2DCUB 4FNIA 1CULB 3CCRS 1RACB 4WZMA 2COLA 3MR7A 5KFXA 5T7LB 3MCOA 1SKRA 1ZPWX 3G8SA 1PSDA 3TI0A 2OUGA 5J2NA 3PV8A 3EM1A 3QT7A 4OV1A 1RZMA 1FNOA 1Q5YA 3QLHA 2D1CA 2VFUA 1LNQA 2FHJD 2RVJA 3BQ2A 1OIAA 2ZDOA 2Y8WA 2MGZA 4PYAA 4L73A 3MM8B 5AE3A 5F9LA 2ZH1A 2O01C 4HHJA 4P2MA 2JLGA 5D6GA 4CH7A 5ADZA 1WEXA 3CTRA 2VBXA 3FEYB 3EWGA 3TARA 2KJWA 3M6UA 3CJRA 3KHLA 1GNKA 4OLPA 1B99A 3CJ4A 1JLAA 4DV5J 1U1PA 2RHSB 3V6DB 4ELVA 4K4WA 3W9HA 1W25A 5CAAA 4JYAJ 2HKEA 3MWBA 4J9NA 4RBTA 1VI7A 1A6LA 3IBFB 1JLGB 5CXTA 4TY8A 2ZKUA 3H2UB 2OEKA 4ECUA 1T9TA 4A8WA 1D8YA 5KFDA 3BKTA 1N34J 2OH2A 2LQ5A 2OEJA 1JLCB 1T9UA 3OQ2A 3KTQA 2DKOB 2L3MA 4WP8A 4J5OA 2CZVC 1YJ9S 4CCHA 2XMWA 2QO3A 1B0VA 2KVQE 3HHEA 4DL4A 4JI4F 4Q44A 3NNAA 3SBMA 2VUGA 3G82A 5KT3A 2VG5B 3FDSA 2WONA 3AD7C 1YRTA 4KGKA 2QLWA 3UD4P 3F41A 3DFEA 2R8GA 4WTYA 2YNIB 5DG7A 2YX4A 3UDVA 4DL7A 2KFNA 1BQXA 2MYFA 1H7XA 4KAIA 2QA4S 2X51A 1Y9OA 2Y1JA 2HNZA 2YXLA 5ETKA 4H4MB 5DETA 2KO1A 4F02A 3AJ1A 4FBTA 5J1NA 4ECYA 1E6YB 3PZPA 2E1PA 4NI2B 1NK7A 4UUWA 4ZLNA 3JB9k 1F9HA 1QY7A 1FRHA 1NKEA 3G6VA 5E3PA 1NSKL 3KHHA 3V4IB 2F9DA 3TA0A 2BJEA 4A8OA 1BE4A 3HVAA 4NLXA 3KG1A 2J6SA 2Y1IA 2OPPA 4G65A 1RT7A 2VB6A 5AE2A 4CNZA 2C3MA 3M8QA 2OPSA 2Z0GA 1J5EF 2OEMA 5HVHA 1H6KX 2QT7A 1JB0C 2JNJA 2DNZA 1RSCA 4NMXA 3WBZA 1UEUA 2DHGA 1Z1ZA 2WSFC 3W7BA 3R6GB 2DNNA 3T1HF 2B43A 5F8LA 5ETPA 2CWXA 2D3UA 3CUNA 5KFEA 3KJFB 1V5IB 2DBBA 5L1IA 3CJSA 4OI2A 1RAOA 4NOHA 2FPHX 3I0RB 2YH1A 4TQSA 4LRDA 1L3TA 2V63A 3FCVA 2DO4A 2ASLA 3PYFA 2FVRA 4P10A 1M1HA 4X84A 3S8SA 3BREA 2ZH4A 1WOSA 3VGVA 2QSWA 3MPVA 4KHPF 1RAEB 2DGOA 2PDAA 3FZBA 5CHCB 3I5CA 1J5OB 3AXKA 2EI5A 4ICLA 3TJAA 1HNVB 1ZTTA 4MK8A 2GQCA 3OT9A 4ZLPA 2NLWA 1CJVB 1NMEB 2HK2A 3MTJA 5EHHA 1F5AA 3SMZA 4KHRA 3QNWB 4LQ9A 1RABB 4Y2AA 4DSFA 2HGNA 3R27A 1AA1B 2KRBA 4DV3J 1FKOB 3WIUA 2LYVA 5K8NA 3EUNA 5GAHI 4DJBA 1UVLA 5KTQA 4HTIA 4ED7A 3I31A 4ENOA 1S9FA 5M2UA 1YG0A 1IQZA 4ILRA 1OWXA 4WYWA 5KG6A 1R8BA 3W65A 2CG8A 2R2UA 1C0UA 1N54B 1PYSB 3QYYA 3BEGB 2DH8A 2JVOA 3HHLD 2CQ4A 2QA2A 2GHVC 1JNZB 1DTTB 1FXDA 3NG8A 4F50A 1EP4A 4RW6A 2XZTB 2J9DE 2H54B 2IY5B 3MPUB 1BQMB 2RF2A 3FRYA 4IKAA 2CJQA 2IVMA 4JOUA 1S0VA 1RBAA 1UJ6A 4OJHA 1GX6A 1YGYA 3ZTSA 1CLFA 4DR3F 5CA5A 3WC0A 3J81Y 2OPQB 2G1HA 4WE1A 1N0VC 3OR2A 2ZVSA 5L9XA 2JDJA 4URSA 4KJIA 2I9SA 4USKA 3M8PA 4CQ1A 4ETZA 3K89A 1WNEA 4PCQA 4LSLA 1XEZA 2HBZB 3MAHA 3DRXA 2ZH7A 2GQ2A 2IRXA 3A8JA 1DARA 4ZP9A 2FJWA 1BXNA 5DQIA 4AXJA 1CSJA 5CD4A 4YOEA 2IYIA 1RWMB 3KLEB 3V81A 3FBFA 5KFYA 3IRWP 3F73A 2NCKL 2EEYA 3MPDA 4HEA9 3I9ZA 5C2CA 2AEMA 2E7WA 4N8OA 3LOUA 1IKVA 1UPMB 4NA2A 2CQDA 3KDOA 4HL9A 1S6QB 2HEKA 4RU2A 5IOLA 5KFHA 3W2WB 3IWLA 2X1GA 1EJ7L 1NRKA 4D3GA 3HFZB 1VRTA 1J5EJ 3TEGA 3B4DA 1GAOA 3OR1B 4Q8FA 1BQNB 3GILA 4IRDA 4F0KA 2QMUB 3ILIA 1V3SA 4CLZA 1VK8A 4ZVHA 4QJVA 1UFLA 1Z2LA 2HG4A 3PCOB 5FLXU 1GMWD 5A2QU 1C2PA 3OFEA 4LREA 3HP6A 3LTOA 4UF4A 4RW8B 4DV1F 2P9CA 5L1KA 4NYPA 4C98A 4AQYJ 5KFBA 1EB0A 3ELHA 3RAXA 2XQCA 3PTWA 4ES3A 5I3QA 1HI0P 2YKAA 4FS1A 1NH8A 3AB2B 4J90A 2ZHOA 1HQUB 3R7NB 2E7XA 2CQ1A 1HWJA 5EUHA 1H73A 2M8HA 5E5NA 1YITS 2WVFA 4JV5F 2XWXA 2UU9J 4C3KA 4ZOSA 1REVA 3H5YA 2DNLA 4KHPJ 3NMRA 2VG6B 3OD2A 4XDDA 2IM2A 1FDBA 2B7CB 3EMTA 4NL5A 1S49A 4KQZA 3SV4A 1UVMA 1AFIA 4BC9A 2K3KA 4XO0A 1JJCB 3AJDA 2BA9A 1ZA1B 3SSQA 2EW9A 4FS2A 1Q8BA 1RGVA 2RQMA 1TL1A 1KEKA 2J8SA 1VC5A 3OTOF 2YKQA 1YTYA 3GPAA 1R31A 4DG1A 4QYZJ 4HT5A 5HP1A 3GCWP 5DZ6A 4ZVRB 4FYWB 4QR2A 3HSJA 2HHHF 1V9OA 1AB8A 3D0HE 2RILA 3NBPA 3C6UB 3HHLB 3DKDA 4ZITA 2JVRA 5DS7A 1HNZF 3VF0B 3C16B 4I0WA 1NHUA 5IT4A 1MLAA 2BMBA 1VJQA 1IWAA 2VODA 1VQKS 4OYBA 2NZCA 3G4SS 4BWJA 3Q8QB 1XMBA 2GNKA 2C2MB 1IBMF 4LSNA 1K9MT 3UNYA 2Q1LA 5KFJA 1RBOB 4DR6J 2DNOA 4LRAA 3Q0AA 2RS8A 4OX8A 4JV2A 1V3RA 3RU0A 1YJTA 4M5LA 1QAIA 3UDCA 2W7PA 5RUBA 2W1BA 2VQEF 4X4SA 1LW0A 1KWMA 3HHLC 3MUVP 2VBYA 2YX7A 1TKXB 4QPXA 2HK3A 4TY9A 5IV3A 3B54A 4S0MA 2V4JB 4ZHRB 5LSRA 2WVBA 3RR8A 4EBEA 3D7SB 2ZHBA 2V69A 2I1RA 4OJGA 3HKZD 3FKBA 4KV8B 1Y3KA 2LDYA 9ATCB 1WC3A 1LWCB 2GGPA 1T03A 5L1LA 2HHVA 2JFKA 1K8AT 3NMAA 2W9AA 3NAHA 2ZITA 2BE7D 4KO0B 2V50A 3NLCA 4C97A 5LMNJ 5H9EK 5KFMA 1RU1A 3MAAA 5E7OB 5JXSA 1R6VA 4M95A 4PXEA 1SV5A 5G0RB 1HQ2A 2L08A 4WK1A 2AEJA 1S0NA 4OYPA 3O3LA 2W2MP 4O44B 1S6OA 2MQPA 2Z2MA 3T9NA 1FD2A 1WF1A 1JJHA 1P1TA 4H4KC 4J91A 2QLJB 2DGUA 3IR7B 2RU9A 4LIWA 4OHVA 1IJFB 3H98A 4R8UB 2BANA 3DI6A 2J0XA 2IHR1 1URNA 2FZCB 1G2EA 1B3TA 2LMIA 4A8FA 4DV1J 4QZVB 2XMVA 3POTA 4WP9A 3I82A 2PFFB 2FHMA 5F3ZA 3VAHA 4MYTA 2BX6A 4KKOB 3MEGA 1PCAA 2Z2ZA 4JI3J 2KHDA 2IPOB 2ZNYA 1D9FA 1TUVA 4RU9A 1ULRA 3PJWA 3BGFA 4C2MA 5LOQA 2DR9A 3NGTA 3MDFA 5F3TA 2IIHA 4DHVA 1T95A 3JSMA 1CC7A 4FP9A 3H40A 1GK8A 4LR8A 2ADBA 1QSLA 4IYQA 1F6TA 4NYZA 1MN9A 1RI7A 4TKTA 4JV0A 5LXRA 5HANA 3UCUP 2GZOA 1RTDA 4DN9A 2P9EA 2ZOMA 3GU0A 3TOQA 1X4EA 3GLJA 3C6TB 2NS1B 4ZLLA 4EBCA 3BQ1A 1VFJA 1RTHA 2QX0A 2JC0A 4QIFA 4F4AA 1KQGB 1B7FA 3QO9B 3OTOJ 4I69A 1XR7A 3DOKB 1FESA 2DR5A 2EKNA 2QFJA 3FCWA 3TAPA 1HPZA 2B6AA 2I5JB 4WFNQ 1H2VZ 3TYTA 1J27A 1IKXB 2RSQA 4KB7A 4NA1A 3IN5A 1HNZJ 4TU8A 2EC0A 4JB8B 4FDFA 4B3TF 5I4MA 1FRXA 5A8KA 4OX7A 5DM6Q 4OI4A 3GB0A 2B56A 4Y2CA 5KFKA 7FD1A 2IJRA 1T11A 4IFYA 1RK8A 4J9RA 2YBVA 4EO8A 3MCSA 1KRPA 5LJ5Y 4DZ6A 1K1SA 2HPUA 3MCNA 2UP1A 2NYHA 4RPFA 5HSPA 2GFFA 3CCSS 4PUOB 2VA2A 1VBKA 4OI6A 5IC6B 4DN0A 2XCAA 3TRGA 2R8IA 4IDKA 3KLFB 2VQEJ 3ZZRA 4CZCA 3NS5A 1NM2A 2HNDA 2V5HG 3MM7A 3M6WA 5KFRA 3P49B 5IT9U 5J2PA 3OL8A 2BOAA 3BPSP 2K8GA 2BW2A 3D0IE 3BKUA 2A6OA 2F4FA 2DNYA 2R3VA 5E3CA 1C0TB 3ZC4A 1A9NB 4Y28C 3J80Y 3EPGA 4DX7A 3PX6A 1Z4UA 4ES1A 4A8MP 4QOTA 3TVKA 3KLHA 4A8SA 4E0DA 4G3IA 1S9EB 5D4NA 3ENAA 4MJKA 2YQ0A 5BR8F 2UUWA 1UL3A 3M2RB 3K5PA 1WC6A 1RT5B 3I6PA 3TZZA 4K4VA 1IBKF 1RWVB 2DHXA 4LRCA 2FIUA 2HMIB 4NA3A 3M8RA 1ZAWA 2WBRA 4FBUA 1N5YB 1KLNA 4NASA 1EQMA 2JC1A 2YWKA 2GMJA 1DAXA 4RNNA 3PW4A 3MUMP 4IR1A 1HBNB 2VQFJ 2LKZA 4RR5A 1SH2A 3L7UA 2VZ9A 2LXUA 1EIYB 1M1KT 1FJCA 4DBQA 4B9VA 3T19A 1HQEA 4N7TA 2NUUG 5KFQA 1VGYA 4X2BA 4MIAA 2IMWP 2VFSA 5A2QY 1U0HA 3M30B 1VISA 3TUZC 5F9NA 1OPZA 3HI9A 5HVFA 1CJTA 1LOUA 2UXDF 1KFDA 4IG0B 2HQCA 1S0OA 1FTCA 1IKWB 1S7HA 2HYIB 1NK6A 4DF8A 2G2OA 2BRKA 2HVIA 2IVFB 2PMHA 3BR9A 4I7FA 1RTIB 3HULA 1FWKA 3JYTA 5ETTA 2Z2LA 2CNNB 3DDIA 2MSSA 5DDRC 1R8HA 2FYXA 3P5BP 8AT1B 1FNXH 1RISA 2CDQA 3DU5A 4FZVA 1JK9B 1N5VA 2BDPA 1S99A 3DXSX 4PABA 4WFAQ 5F8MA 4XK8C 2C3OA 3MM5A 4KHMA 2QLFB 1X4DA 2C28A 1RAAB 2QJ3A 4R0JA 3RAQA 3DRPB 3GJSB 1PILA 4UT4A 1OQ3A 1M5KC 1CS4B 1VBYA 1VR6A 4CI0B 2X1AA 1FJ7A 2DO0A 2XZWA 4DOZA 1FJGF 2NR0A 3C14B 4X4OA 3UI3A 2MSTA 4R5PB 2XO6A 2XNRA 2MKHA 2VOOA 4GMKA 4BS2A 1XWLA 2C2KB 4X64F 1YSJA 4ECXA 3K0JA 2AJQA 2M88A 4QW8A 2ZE2A 4RBUA 2WK4A 5D3GA 3DRRB 2BM1A 1X5OA 4FF3A 3CJ2A 2N82B 2JEGA 1IM4A 4KPCA 5ETLA 3HKWA 3NGRA 2G0IA 2HWHA 2YKNB 2FJAB 3C3LA 2ATCB 2IJNA 5J2MB 2AMCB 4MIWA 4GKJF 4PQUA 1CVJA 1U1OA 2J0WA 1HYSA 1WKJA 2XYPB 3SQOP 1DTQA 4KFBB 3SQGA 2EBGA 1N32F 2GX8A 4WK3A 2XYGB 3HT0A 4ZPDA 4WYLA 4FKYA 2HBQB 3IC1A 2OD4A 2HQGA 3H42A 1ROFA 3A8IA 1BY9A 3RZAA 4P73A 4AFFA 4LBPA 4C8YA 2FLNA 3K5OA 4XIUA 4XDCA 5L38A 4O23A 1IBKJ 3QIPA 2W2NP 1WELA 2BQUA 2B4VA 2JJ4D 4OHYA 4YHHF 4OI3A 2AGOA 3TJ9A 1VQOS 3GR0A 1YKWA 3FC9A 2EK6A 4WU3A 1GMVA 2DNPA 3KG4A 3VAMA 4IG3A 1RHMB 1PC4A 1FHTA 4DZDA 2RMLA 1DQ8A 3NS6A 5LL6d 5KT7A 1F2GA 3PG9A 2QLXA 3SSSA 2LECA 3H8YA 3R7BB 1I3OB 3D67A 3J81j 3CJ0A 2B4PA 3NGUA 4DI6A 4JI2F 4F36A 2G2YA 4IFVB 3TR5A 3G87A 3AOCA 2W7OA 1LW2A 4OZNA 3DOMA 3CC2S 3C19A 4YFUA 4Y2IA 4B08A 3UVJA 2ZHAA 1CJKB 1GT8A 1JKHA 3IRXB 3ITHB 3V5RA 1H72C 1PJ6A 4UOCA 5DGBA 3N4WA 3HSGA 4QYZK 1GXLA 3GR1A 1F9FA 4K2XA 1YJVA 4I6YA 2FQQB 4NEYA 3BN7A 1TV6A 1YJRA 1JLEB 3DM2B 4BBYA 1YJWS 2I6WA 1S1UA 3R5AA 1MWYA 1X4HA 1QVGR 5HI7A 2IFXA 2ILZA 3T5KA 2ZDPA 3H5SA 3FMBA 2ZH6A 3EDQB 3E01B 4CO5A 2QYGA 2RKIB 1NKCA 2KFYA 4EO6A 1TKZB 3D0GE 1WKLA 2MB0B 3MM9A 4YB1P 5J1PA 1FJGJ 1UEVA 1S1WB 3TUJC 4FF2A 4CM0A 3I56S 1SI9A 4OYIA 3BBBA 4LBHA 2YKMB 4QR0A 2ZBCA 3TAMB 1EZZB 2JOQA 3AAWB 2YNHB 4F04B 4X64J 1WDDA 4AUKA 4ID5A 1X5SA 3HF5A 1W2BR 1U24A 2NSCA 2UXCF 1S1XA 2GMHA 4NLTA 4U6PA 3DLGB 3ZNUA 4HYKA 3BSAA 4J37A 3QT6A 2EXUA 1U8WA 1PC5A 2ZH9A 1S1TB 3JAMU 1NPRA 4WFYA 4O3PA 2HNYB 5CYQA 3JSYA 1N6QB 2F5GA 5KG5A 2N4DA 5HROB 5CH7B 2CIMA 4GKJJ 5E3AA 1DJ0A 1RT1A 3AB4B 1TMJA 5ETOA 2B4UA 1T0TV 2BZ2A 2R42A 2XLJA 4H4OB 3KMSA 1N32J 1LWFB 1S1VA 5IT9Y 2J8AA 2C2ZB 2ZM6J 3WIVA 1ZAVA 3NRBA 5DDPC 2Q43A 4USHA 2CA9A 4TU7A 1XNQF 1FX2A 2DR6A 5HMYA 1S9GB 2BKOA 3T3FA 2IAJB 1FT8A 3LP1A 4HI1A 4B9TA 2F65A 4EWTA 4YHHJ 2CNLB 3K7RA 1P1LA 4HACB 1LV5A 2ASYA 2MTLA 4CIOA 2DITA 2ZJQQ 1NDKA 2ASJA 4KSEB 1O6XA 3QPIA 3AXMA 4OZ1A 3D28A 1KKHA 3PRDA 1RAGB 4ED6A 2J0SD 4F4YA 2GIRA 1HA1A 1SKSA 2JZ5A 4K2JA 3G6ES 4ZPAA 2H65B 2G9OA 1C4AA 1JXVA 1XJWB 1CC8A 3IS9B 2OHDA 4RW7A 1HWUA 4HTJA 4RNOA 3KK3B 5F0WA 4JI2J 2V34A 3AJ2A 4PG8A 3W61A 3BGLA 3OFGA 4A8KA 2GCFA 3B82A 1NDPA 4USMA 2ALZA 3LALA 4Q43A 3IGVA 4QCLA 4ZK7M 2VPWB 4LRFA 3U1NA 2B9WA 3SFUA 3IMQJ 3V4MA 3T6JA 1TTHB 1AFJA 1RA7A 1CBKA 5I3UB 2RE1A 2FVSA 3TNVA 4EYIB 4ZVPB 1X5PA 2IMOA 2CAJA 1LXNA 1UVNA 1NLKL 3IP0A 1QUVA 3OTBA 3TJ8A 1CG2A 5IWAF 2RHQB 1NJIT 1FKPB 1X8DA 5DLFA 4F3QA 2CKWA 3NEKA 2RT3A 1GXTA 3UNGC 4LF9J 1X60A 3J7Z5 2ZKTA 5CYMA 1KS2A 2W9BB 1NK8A 1TL3B 3RBZA 4Q0BA 2ROGA 3CVKA 2HVEA 4ED2A 2B51A 3RRHA 4DV4F 3WC2A 2KZMA 2CWKA 4CRJA 4LF6F 1CULA 2DTJA 1FFWB 1HLWA 3PKYA 2FC8A 5T7LA 2H1YA 1P6TA 2KU7A 1OMSA 5B0DA 1NK0A 2W25A 1VHIA 3KK1A 4K4XA 2PI5A 3LPEA 1LXJA 1MWQA 4DSJA 3VQTA 3W5YA 2UXCJ 2AU0A 3PHEA 5DZ7A 3D1OA 3TWZA 2N3LA 4DV0F 2L48A 1U09A 2G13A 1RTZA 2ERRA 4M63A 5KFZA 3ICLA 1H0HB 1RCXB 3PEJA 4JI0F 3MM8A 3FBEA 2UUAJ 1X5TA 2DHSA 3SXLA 3GFHA 3BBFA 4Y34A 1WOPA 1FE4A 4M5KA 2HFZA 3PFEA 3R2CJ 3QJPA 3OL7A 1D09B 3CE8A 1Q81T 2R7WA 2NZ4A 2HVHA 3TX8A 2E44A 2I0XA 3ETOA 2B5JA 4LFAF 2RDIA 4KIAA 1D3WA 3HD1A 1RT3B 1NAQA 3WX4A 1P27B 4OZLA 4JP8A 2OD6A 4ES2A 4X62F 5CYJA 5D4PA 3FMWA 1R0BG 2NXNA 1QM9A 5LSOA 3LW5C 1PGZA 3V6DA 4GC6A 4OV6A 2LCWA 3Q8YA 3HMJG 2AJ4A 1FO1A 3AODA 3CDWA 1UMJA 4DSLA 1BWVA 1JLGA 1Q8IA 2FD2A 3KHGA 4DPYA 4HH0A 3A8KA 2WB4A 1PJ5A 5B09A 5FD1A 1N4LA 4B3MF 4DR2F 1JLCA 2RDJA 2JSXA 3SCJE 4DR5F 2M3DA 4LF7F 3OFHA 1KFSA 2YWGA 3D3CJ 2HW3A 4GKKF 2OAUA 1KP6A 4LR9A 2B9EA 5F8IA 3P6YC 1HNWF 4FVMA 4YB6A 3GFZA 3ET6B 2VG5A 3AOBA 2GHWA 4U7UD 4K4UA 3VAFA 2KXNB 4ZVGA 1EHWA 4F26A 2BE2A 5JVHQ 4U95A 1HARA 3AD8C 4RW4B 3IM9A 3PX4A 1FXLA 4WFBQ 4CO2A 1JXLA 5C5JA 2C3UA 1U6BA 4LF1A 4H4MA 1KR4A 1QE1B 2PE8A 2FZKB 1E6YA 2LQJA 4ZCKA 1ZA2B 4CTAB 1Q0NA 3TANA 4Z7YA 2YKOA 1S77D 3N6LA 4YMEA 3M9OB 3ETMA 5IWAJ 1R8AA 4CO1A 3MR5A 1WACA 2DPJA 5KT6A 4MKBA 3V4IA 2R7RA 2IA0A 5A0YB 3GJTB 4JI7F 3B6BA 4Y2KA 3OHAA 2XBPA 1N36J 1D9AA 3D66A 4ICLB 1R8PA 4GO7X 3MMCB 4OYOA 2VF3A 5JMNA 1LWEA 2CQHA 1YBUA 3T5LA 5HQMA 5L1JA 2HS0A 4ZA1A 2DNGA 4A8YA 5CQGA 3MFHA 5E33A 2YQ3A 5JVGQ 3TQEA 1FKAF 4YDXA 3AQOA 1HR0F 1MNEA 5ITHA 3MEKA 1FX4A 2XMKA 1RKJA 4PWDB 2KN4A 2ZWPA 3I0RA 1HNXF 4JI0J 2GVDB 3V6HA 2UVVA 2WB1D 5D4OA 3H2VE 2UUBF 3GIJA 4UY8T 5LMUJ 4MK9A 4RW6B 2D3ZA 5BYSA 1B0PA 1U2RA 5AXLA 3JAMY 2MQQA 3FSXA 1S97A 4EYHB 2DNRA 3IR6B 4MIBA 4X66F 1IJEB 3WDOA 4LFAJ 1YHQS 1HNVA 3M8SA 2HZVA 1AT1B 3H5XA 1CJVA 1U1LA 2R2SA 5T41A 1WC1A 2ZBPA 1KLMA 2FJXA 4HVZA 1FKOA 2YTCA 1SC6A 2CQBA 4P2XA 1HFEL 3F0NA 3M8PB 3A3NB 2H5EA 2BJDA 3LP0B 4FYYB 2Q6BA 3W5ZA 5KT2A 2KVIA 1VBXA 3G96A 4LSLB 1FRLA 2MQNA 3MUTP 2IC3A 1OY9A 3CCWA 3IAS9 4UTGA 5FDLB 3QZ8A 1M5VC 1SL1A 3V81B 2UUTA 3O6QA 3S7RA 3ZTPA 1C1BB 4KE5A 5KAKA 1GH8A 4DR2J 4LT6A 3NCPA 1DTTA 4DR5J 1EARA 3PRVA 4RUBA 4USTA 1KBRA 4GKKJ 4NCBA 1R0CB 1BQMA 5IFMA 4LF5J 3W9JA 5HVGA 4JV1A 5I42B 2ACMA 2H4WB 1BC6A 3NP5A 2Y3YA 2WW4A 2OPQA 3P96A 1D1UA 3L4BC 5HJYA 2RIJA 1UVIA 1L5UA 3M6VA 3S01A 2R2RA 3PYEA 1XNRF 4C3MA 3KLIB 2WVCA 5HBMB 5GVQA 3CPWR 3E8OA 5C42B 1KTQA 2RRNA 1VIOA 1UW9A 4C8LA 1FEHA 4UZBA 2F40A 3KLEA 2V2ZA 3DMJB 4TVAB 5B0CA 2WCXA 2D41A 1JQGA 2FTRA 1VQ5S 3PJ9A 4O3QA 4BWMA 3FSIA 4X4UA 1F2HA 4L76A 1SC3B 4OHXA 3CDBA 2MQLA 4OIXA 3W2WA 3NWGA 2MZQA 2B7BB 4E98A 2ZVIA 1HNIB 1R0AB 2M9KA 3GIIA 3A12A 3BYPA 2OPRB 3P5TL 3SDEB 3OR1A 1BQNA 4X65J 1NSPA 1TU0B 1EQ0A 5B08A 4NLVA 1ZM2A 3QGGA 3T41A 4DG1B 3ZXWA 4OI1A 4RW8A 3OW2R 4U67Q 3G9CA 3OUYA 4HDGA 1OY8A 1S4EA 4OZ5A 2MZ1A 2KT2A 1HR0J 2MKIA 1X31C 3IA0A 3GJRB 1F60B 3QGIA 3J81U 2D3OR 4DV7F 1FI4A 4PXBA 3OJUA 3ZTQA 5HO4A 3T9ZA 3SCLE 1GEHA 4GRSA 1X0FA 2MDAA 2UUBJ 5IXUA 3THPA 2KG0A 1TFYA 3MR2A 4P2SA 4ZN1A 3D3BJ 2XS7A 2AYMA 2VG6A 2DY1A 2A6MA 4ERDA 1RT6B 4F8RA 4X66J 2DJWA 3W60A 4OZ2A 1Y11A 2EFGA 3K17A 1CEZA 1BHNA 1U47A 2YH0A 3QJLA 2JLEA 4IQXA 3US5A 4ZP6A 3R2DJ 4J9UE 3EZ5A 5CABA 2FLOA 2AGPA 1T8EA 4ZCMA 3EYZA 1WTBA 1HMVB 3GP9A 3M8ZA 2DXFA 2C2NA 3SCIE 2XMAA 3ZTOA 5K8OA 3K2YA 3C6UA 2OFHX 3HHLA 4DR7F 3HZGA 3C16A 2F3JA 5KG3A 4ED3A 3GG0A 3SFGA 4DPWA 2IBOA 2XSJB 1B4SA 4I2PA 4PG4A 1KQKA 3DRYA 1KQFB 1S57A 4ETXA 3KJVB 5KFGA 4ED4A 1DURA 3DXBA 3GFXA 2E9RX 4F4ZA 5T14A 4ECWA 5B0AA 1L3VA 1SL0A 2BJ3A 4DQSA 1H38A 3IO1A 2B4OA 5A76A 3MPWA 2E1MC 4K5SA 3PW0A 4BDPA 2X3DA 2VDIA 3R5GA 1S72S 3HX9A 2JEFA 3W63A 1TKXA 2V4JA 3UWTA 4ZHRA 2WW8A 3CMQA 4H4KA 4V19J 1Q82T 1Q8LA 1O51A 3POTB 4KV8A 1G6BA 2HFVA 4DUZJ 3FJ2A 1AYEA 1VJWA 1FRIA 1LWCA 4I68A 1HKAA 2XMTA 1RBLA 4KO0A 3GV7B 3M9MB 4ZVOB 2VPZB 3KLGB 4C7QA 5HLFB 2Z57B 1XR5A 4L3KA 2KXFA 5G0RA 1Q7LB 3RYLA 4O44A 2P6SA 2E7VA 3EVOA 1VS3A 2CJXB 2XNQA 2Y1LB 4IH5A 2I38A 3NY0A 5D4LA 1I6JA 4Y65A 4ZLJA 3CDAA 1Q1KA 2AJFE 1AUSL 1TVRB 4L75A 5EWEA 4PXDA 3NOGA 4MAKA 3CCES 2H4YB 2VU5A 3WHIA 2J76E 5B0GA 2QRRA 2ZZTA 2DGXA 3M2VB 2K2PA 1HPZB 2B6AB 4MKYA 1KVIA 1YJUA 1VC6A 4QWEA 4KKOA 4CO4A 4KR0B 2FY1A 1FE0A 3TX0A 4NPOA 1D9DA 4DV7J 1IVZA 1OYDA 3H20A 1TKTB 2FB0A 3R9LA 3BGUA 1JJ2R 1YI2S 2VG7B 3MR6A 2BQ3A 2Q66A 5KG0A 3PFOA 1KDNA 3KNGA 3Q8PB 2ZEJA 3DU6A 4MK7A 2MLYA 2N3OA 1X4AA 3JTNA 3LAKA 1SPBP 2XSFA 2KH9A 2KL8A 3RUBL 1HBOB 3MECA 3C6TA 1WC5A 3KUHA 4N77A 3GYNA 2QN6B 4G1QB 3RB6A 1Q7YT 3D6FB 5U47A 2P5VA 1XMOJ 2NPFA 5J2PB 5JJBA 1WEZA 2VH7A 3A3OB 1ELOA 2A10A 2WVDA 3AHPA 2I5JA 5EGYA 2W2OP 3EPIA 4F4KA 1IKXA 1YBTA 2RQ4A 4LQ3A 4DR7J 2CQCA 1QAXA 4KH0B 4LF8F 3GSDA 3MEDB 5CZXA 4P75A 2V2QA 4QU7A 4WXOA 2HQDA 2EKYA 2E1CA 1W2IA 3KK2B 2XI3A 1MMNA 3VAGA 1RWUA 1NO8A 1KD1T 2EC2A 2I2YA 3OBIA 3FEZA 5KT5A 4PUOA 2E5GA 4ANEA 4LVNP 4NCGA 3H7HB 4NE9C 3BYRA 2NXUA 5GAGU 2HHWA 2RUGA 3ADAC 4OJ1A 4YDDB 2ZBRA 4FXWA 1N5QA 4FNHA 3CJKA 4C0OC 1DFDA 3X3UA 1RT2B 2VIHA 1WD6A 2BVZA 2NREA 3M32A 3WQPA 1JWWA 3FUYA 1C4CA 2R7QA 4J9QA 1QVFR 3MPYA 4DL2A 2ZD1B 1ZM9A 4WZQA 1TL5A 4G6VB 2XMUA 5IQ6A 3NNHA 5EX0A 1B0TA 2V2VA 3EICA 4C8OA 2R9LA 1VOMA 4KGMA 5HMWA 4M8LA 1QD1A 1S9EA 5D78A 1RDRA 1U0HB 1WOOA 3VTIA 3RBEA 2BKNA 4GC7A 1OYEA 3MAQA 2LFVA 2YNGB 2NXCA 4HHHA 1ZYQA 3M2RA 1X7VA 2KRRA 4DL6A 3C15B 2VA3A 4YUDA 1NBEB 4I7FB 1RWOB 2AGQA 4Z37A 2HAIA 1U25A 1VQLS 4PAAA 1N5YA 1NB2A 1RYRA 3ISZA 2I8EA 2VC1A 2UV8G 3MMAB 1YLXA 3PW7A 2V8HA 4R0EA 4GVBB 3CMES 2IRYA 1K47A 4RW9B 2J6TA 1QAYA 2X1FA 4AL6A 2AJ0A 2J9EA 4OYAA 3J7A1 3MM5B 3H25A 4ZVTB 3QATA 1JLBA 2GS8A 5LT5A 2L41A 5B0FA 1C1CB 4ECRA 3TUIC 4O0NA 2K1RA 1UZHA 1UA1A 3M30A 1AROP 2D74B 1KNZA 3Q8SB 4ZIVA 4IG0A 5L46A 4RX6A 1Y10A 4JI4J 1SC1B 3MF5A 3NKYA 4DPXA 1BD6A 3EE3A 3NL0A 2G2ZA 1RTIA 3TA1A 2EG1A 2E9TA 3J80U 2DCLA 1M5OC 1FK9B 1VQ9S 1U6FA 3AD9C 4TQRA 3GONA 1QTMA 1SB6A 2C3YA 5AE1A 2ROEA 1OSDA 2PMZD 5LJ3Y 4PQUB 3LGNA 3DRPA 2M0GB 3U7JA 1U1QA 1CS4A 2CQ3A 1DTQB 2C1EB 3SQGB 3DNCA 4ED8A 1LK5A 1FTRA 4UOGA 2RNEA 3CWJA 3D1HA 4K7QA 1S0MA 3QGPA 2N7YA 1HL6A 4OYMA 1FD8A 3VGUA 3C14A 2W24A 2XS5A 5D0RA 4HHUA 3UDEA 3MM6B 4IO9Q 2OJ3A 5E2QA 3UW1A 4DLEA 1IBLF 3ENVA 3H59A 4NRTA 2NXEA 3HT3A 4P9SA 2JFDA 2HVDA 1SJQA 1VQ8S 3DRRA 2RDDA 2MZJA 3W64A 3SEOA 4DSEA 3T1HJ 2E5LF 3OTEA 3N5BA 1FERA 4PG5A 5J2MA 3DOLB 4K8RA 1TELA 4Z2XA 4IRCA 1UTAA 3KUGA 4OZJA 4N41A 2BXJA 4P71A 2CXEA 4B02A 4WFZA 4O4RA 1N33F 2DXDA 5IT0A 4KFBA 1RUSA 2L9NA 3R3TA 3IG1B 2E1RA 1VQPS 2GAGC 4C0BA 3CCVS 1H3DA 2VV5A 1YJNS 3DOMB 3C66A 2CPFA 3DRSB 4FN5A 3BO4A 4NX9A 4F0MA 3H2LA 3DGPA 4J9MA 5K5MA 3R1HA 4QBUA 2J7KA 1JKHB 1FEEA 2ADCA 4OI0A 4USVA 3N5FA 2IDEA 2BKPA 4TU9A 1TAQA 2DRDA 3QAEA 1I94F 2XG8A 5GADU 2AWZA 4L3NA 3GV8B 5J1EB 1UEKA 3J7AN 2UXBF 3PYGA 1TL7A 4P2FA 1U1MA 1NB7A 3BDEA 4RUAA 2P9GA 2Y8YA 1NNDA 3PHTA 1FDDA 4URQU 2KG1A 3O44A 3CCMS 4IFVA 4JI8F 2RRAA 5E41A 2DEJA 1WF2A 2DRAA 3ZZOA 4KGXB 4URGA 4ZJQA 1JMTA 2EFNA 3HJVA 3K59A 3MM9B 5BYQA 4U7CA 2XB2D 2CVIA 4M5DB 1FA0A 2V9WA 2DT9A 3FEXB 1UP1A 4DFJA 4A46A 4LFBF 1RQ0A 2ACYA 4DR3J 2GW8A 4X4TA 2XMMA 8ATCB 1R7IA 2W9CB 4ZPTR 2KHCA 4E8UA 2FJEB 1DHMA 3IRXA 4I6AA 5KG7A 1HI1A 3ITHA 2QC3A 4QR1A 4PXCA 2QMXA 2W01A 4DDFA 3LWLA 1S1XB 4FF4A 1FVQA 4PEOA 2FLPA 4HLBA 4IOBA 4CYUB 2LEBA 2AD9A 3QJJA 3KWMA 4ZPBA 1JLEA 4DL5A 3DM2A 3DDKA 4DCOB 2BOPA 4FPRA 1LFWA 2X3GA 3WX8A 3M1VB 3N0VA 3FCHA 5KOWA 2XM3A 1OPIA 4DS4A 1N8RT 1WHVA 3E01A 4KPYA 1XMQF 1YWXA 2Y9HA 3QAUA 5AXMA 3ZFVA 5EDWA 1TKZA 2ZC4A 2HRTA 3GYGA 5CCLA 1S1WA 2GHPA 2HLUA 3UR3C 1SBRA 2YKMA 1PKUA 5DQGA 3TAMA 5J2QB 2B9XA 2VC0A 3VCDA 2YNHA 1IBLJ 3PJXA 2BBEA 5B0EA 4C11B 4PPZA 4DV5F 3QWPA 3O5TB 4V1Ak 1GFWB 3NOCA 1MN7A 3D6MB 4O4GB 3AFGA 1P9QC 3DLGA 4QPTA 4HH1A 4ZS6A 1CQNA 4C8NA 3KDNA 1S1TA 2E5LJ 1X4FA 4ECSA 3BGOP 4H54A 3PO5A 4B3OB 1N6QA 1L3UA 6FD1A 1N34F 3RRGA 3MI7X 4ZIWA 1NK5A 3QT8A 2AZ1A 2CQIA 1WDTA 7FDRA 2BQRA 1NEEA 4Q8EA 2F1FA 3I9V9 2DIVA 3RW6A 2F4VF 1NU4A 4H4OA 1LWFA 2ZNZA 4JV5J 4LR7A 4DUYF 3R5BA 2DVIA 4EU0A 1EKRA 4OYXA 2N7CA 4B9LA 1H7WA 3RBDA 2F8HA 2OLWA 1S9GA 5KG4A 5K8PA 1NDLA 3GZ7A 3V2UC 3OVBA 2UVRA 1DLOB 2AKWB 3EGVA 3GIKA 4OYWA 1SL2A 3C8YA 1KQSR 3ENWA 5KFFA 3ZZYA 2XO7A 4EUVA 4QIGA 2XY6A 1M90T 3TEHB 3CJ8A 5CD4H 1IQTA 2HHHJ 2QL7B 2VJVA 5KFLA 4NLUA 3HXMA 1IKYB 3HLUA 1FVSA 5IQQA 4ZCLA 1RP5A 4KYZA 3S1TA 3IS9A 2H51B 5KFUA 3KK3A 1FJEB 2WHOA 3TO8A 2O67A 1IBMJ 4AXIA 2OSQA 4NLYA 1SQGA 2FJVA 1Y3JA 1R8CA 3Q8RB 5A6PA 3NS7B 4Y3CA 1EKSA 4WXWA 4OHZA 2IVYA 2CJKA 2RU3A 2IDLA 4LFBJ 4DFPA 2J9DA 4J9LA 2GJFA 3R97A 1SQFA 1FWLA 2Z8QA 4AT1B 2P2CB 2VPXB 5I3UA 1UJ5A 4LJMA 3KK1B 5F8JA 1MROA 2VHGA 3IFEA 3QFWA 2RB7A 3RB0A 1TP7A 1P9YA 2VL1A 4CLWA 3SI8A 1F3VA 2V8GA 2A3JA 1JLQB 3KNAA 4FYDA 1O8BA 3I5BA 2CPEA 2A0FB 2E5JA 4X4PA 2BV3A 2M5YA 3BBCA 2D9OA 2C2EA 2LDIA 4KBIA 4Q7AA 1XIQA 1VRUB 2HHSA 1Y5LB 1FKPA 3PIOQ 1SJ3P 3G71S 1RADB 1H2UX 3B78A 1XMQJ 1N88A 2W9BA 1TL3A 2RD5C 2B5JB 3QBCA 4ZVUB 1NSAA 2Y0SD 4PYDA 5SUHA 2J5AA 2CPXA 1ZTWA 1FRMA 3GCXP 5HQ8A 3GV5B 1WG5A 3RBXA 2H3EB 3EVMA 3W2VB 3DYAA 1HBUB 4QYRA 4DV3F 4W98A 4DF4A 4XAKA 3B4MA 4M5GA 4MTPA 3GYXB 2BE9B 2J9CA 3MR3A 3K5LA 1CJUB 3MOJB 2OMOA 4N76A 5L8RC 2HBRB 1RTJB 4O3OA 4PRFA 5M2RA 1U8SA 2MQ8A 2L9DA 2V6AA 2AHOB 2M7SA 1X4BA 3HCXA 4I6WA 1KOOA 4WCEQ 3MMBB 3OFFA 2GVZB 3OXGA 2XI2A 3VZHA 1ZS6A 3BSNA 4ZKAA 2DK2A 3DN9A 3W8PA 3WZ0A 2DGSA 4UZCA 1EX8A 2F4VJ 5HMXA 5KFSA 5GAEU 2FVQA 2W7AA 1OJ4A 4X4QA 1B64A 2IJFA 4DUYJ 3TZWA 2QIFA 1RT4A 4CO0A 3T5JA 1RT3A 4YQWA 3DLHA 2IBKA 2AP6A 4IH7A 3O1LA 3CC7S 2BE2B 4MFBB 4KRWA 4ELUA 3DLEA 4RNFA 1YZ7A 2YNFA 4ID8A 5CZVA 4OX6A 1HHTP 1Q79A 5JUMA 2VASA 2WVEA 3Q8UA 1RE1B 1S79A 4QWBA 1MU2B 2YWHA 3JS9A 5A6WA 1UW4A 3D4JA 3MHYA 5A8RB 3QWUA 4G1PA 3T1YF 1U02A 3MEEA 2DNKA 3DLKB 3QIDA 3HDSA 1I5OB 3UDLA 5K8MA 1X0PA 2EFPA 4B3TJ 3BN4A 1PAUB 1IN0A 1M5HA 4F0HA 4EZ6A 2YWWA 4DU7A 4M5HA 1VCTA 4C6AA 4YY3F 2HFUA 1AW0A 3R8YA 1NZAA 2DHHA 4N5SA 3BGRB 3CD6S 4NLPA 3ET6A 1GXUA 2IRUA 1EETB 2KT5A 2DNQA 4QIWD 1NJYA 1LWEB 3T5HA 2CNKB 2XY7A 1FRJA 4FYXB 3R5JB 2ZJRQ 3M2UB 1H2TZ 4RW4A 1HIYA 3IAM9 1G3OA 1V6HA 3BS9A 5MAOA 1MW7A 1VMBA 4AQYF 1XTZA 3VVTA 2HGLA 2OP5A 5C25B 4NLDA 2W4PA 1QE1A 5F8GA 2FVPA 2CPZA 1TZ0A 1YDLA 4CTAA 4FPIA 1HHQA 2G4BA 2H48B 1KN6A 3UN2A 4XPEA 5FJ4A 3RB4A 4F4WA 3JSBA 2O66A 5C7PA 2IA6A 3CMAS 2PT0A 2UU9F 3D1QA 1L3KA 3UE2A 4ZPCA 5A0YA 2JL9A 1X9MA 3L3CA 5BR8J 3MCMA 3EJMA 2OIHA 5C24B 2PN6A 2QEXS 5KFPA 1B7YB 4ECQA 1BLUA 3QSYB 2CQ2A 2MHNA 2C2DA 2QA1A 2EK1A 2CJAA 3MMCA 1AZSB 4RJVA 3PO4A 3LWMA 1OQ6A 3W8GA 1NHVA 3ONQA 3GQCA 1KLMB 3GG1A 4RWWA 2R7XA 2V67A 3BKFA 4NLGA 3IM8A 1FXRA 4DV6F 2XS2A 2U2FA 4PG7A 3I32A 5ETSA 1K0TA 2UV8A 3E2EA 1VQYA 3GJQB 3Q8VA 4PWDA 1U2CA 1VQSA 5ETVA 2IC3B 3FQKA 4B9SA 3UO0A 2R2TA 4ITSA 4WTOB 3NGKA 1UFKA 3M05A 2B0GA 5ETNA 1YJ7A 4QW9A 1DQ9A 2GVDA 1CQMA 1SJFA 1U26A 4NCAA 2WOMB 3KFWX 4E2FB 4Q5VA 2LA6A 3OVSA 3PX0A 4DR6F 2ABYA 2CRLA 3ENQA 1ZH5A 3VGSA 2UXDJ 2RH3A 2JLFA 2HZAA 1A7GE 3IR5B 4KT0C 4DQQA 3HJFA 3ZZTA 2BEFA 4DQPA 5E3QA 4O3SA 3HHKA 3ZNJ1 4IR9A 5F0UA 1MMLA 3H4DA 4F2SA 4J9VA 4YEAA 3EGNA 4ELTA 3SIPB 4X4NA 2ILYA 3FFIA 4ANDA 3LP0A 2FJDB 5THWA 4J9SA 2NYIA 5DDQC 1HW8A 2XGPA 4DPUA 2VKRA 2KT3A 1U45A 2Z30B 1HHSA 2DPIA 4C8KA 3EXYA 3HK2A 4P72A 2NXJA 5FDLA 1UWBB 5LMNF 4I2QB 3OLBA 3T1YJ 1C1BA 1PYTA 4ZCIA 1SKWA 1FDAA 4P7VA 3JQMA 4C48A 3CXCR 1U1KA 3FQLA 4YR0A 1DQAA 3U1MA 4MKAA 1MSWD 2HFNA 3BZQA 4UOHA 3SSRA 1R3NA 4U8YA 3BQ0A 4YY3J 1QUPA 3HVTB 2FHKA 2R7UA 4Y2MA 3GFYA 1T05B 1SUQA 5DG9A 2V2KA 5I42A 2HBYB 4LBIA 5A8WB 1WSVA 2F7VA 1TQLA 4YB7A 1OSCA 4OQJA 1RJJA 1KHVA 2LU2A 3FBBA 4KH1B 5H1SV 2VOPA 2PD1A 1U6ZA 1JNRB 1XR6A 3FNNA 2YKPA 4A48A 1RWXB 1E6VB 4OL8A 2AJ2A 1GTHA 2FJBB 3KLIA 4GVLA 2DR8A 3VZIA 3VAKA 5HBMA 2WZ1A 3G6XA 3ULHA 5KG2A 3OUYB 2ZH8A 2M52A 3LP2B 2ZJPQ 4TLQA 5C42A 4IO1A 3KOAA 1ZZNA 1TMMA 2BJ9A 1BWEA 5HATA 2Q79A 2R7TA 5F41A 2ZFHA 4JI3F 3FBCA 3T1AA 5G4DA 2FUG9 3DMJA 2KYXA 2V8DA 2UVWA 2HQIA 4Q45A 4P52A 4O0IA 1JLFB 3A8EA 4EEYA 4DPOA 3I0SB 4AE5A 1NKBA 3NCQA 4ATNA 5IZHA 2NPIA 1GX5A 4DFMA 3UCGA 1M0SA 3OXFA 3MOZA 2X1BA 4DX6A 1HNIA 3N6MA 4EZ9A 3BV8A 1R0AA 2KYZA 4B9MA 5BJRA 2O5DA 1T7PA 2OPRA 3JQKA 5GMEA 2E5HA 3SDEA 2F8MA 3OSNA 4NLWA 3CJ3A 3RGIA 2DISA 2HHQA 5CCMA 2MHEA 2ZZNA 1QSYA 4C3LA 2VJUA 3K5MA 1S59A 3L09A 5IM0B 2SXLA 4DV6J 1RB0A 2XTJP 4J7CA 2NUHA 4CLUA 3IWXA 2J0QD 3QQCD 2JHEA 1D0EA 1X4CA 2PC6A 4ZJOA 1NH7A 4ZJLA 2HWIA 4DQIA 4I2PB 1SVDA 2E66A 4WF9Q 4USIA 5DLGA 2YPZA 5HAOA 1J2VA 4F3OA 4CLFA 4NWBA 2FC9A 4NMLA 1AXQA 3D54A 4J9PA 2LEPA 1TK5A 3OV7A 1T3OA 5HL7Q 1S6PB 1PYOB 4P7TA 2HHPA 1RT6A 2KM8B 3Q83A 5HQLA 2QL5B 3EGZA 3CC4S 1HW9A 3LGMA 2MXYA 3NAIA 1MMDA 3EZUA 1WHXA 4CLLA 4USJC 3Q86A 3ILOA 4U96A 3W1YC 3U1LA 5LSLA 4PZVA 3NGDA 2AQ4A 1HI8A 3FSYA 5J2NB 5K14A 3K8WA 1GMUA 2MQOA 1SXLA 3QLHB 1NK9A 1HMVA 1K73T 1QLNA 3HM9A 4EFAC 2CQ0A 1WHWA 3CGIA 1QDUB 2MGZB 3CCLS 4LFCF 2QE5A 1FNMA 2DXEA 2XSJA 2XULA 3V6KA 4MT1A 1MWZA 5GAGI 2M8DB 4HDHA 4DS5A 2KM8C 4RZRA 5BYRA 3U27A 1LKZA 2C2RA 2DH9A 2GJ2A 2Z2YB 3KJVA 1T02A 4DU8A 3R1LA 2MY7A 3ILLA 4ECZA 3EVWA 2IYGA 1Q16B 3DLBA 1M5PC 4WIQA 3PW2A 1Z2ZA 1HBMA 4M94A 1OY6A 3VQSA 1QTNB 2M70A 2UZAA 3SYZA 2ZZMA 2LQ8A 2EFQA 1O5JA 1SH0A 2J6UA 1FF2A 3BO2A 1W7WA 2E5IA 1YK9A 3LANA 1JLAB 5H9FJ 3CDEA 2IM3A 2CJBA 4WPAA 1N48A 4PWUA 2WRMA 3OXLA 4Y6IA 3BM7A 2VQFF 4DX8H 3M6XA 1UETA 3DLLQ 2DGVA 2YY3A 4RNHA 2ZWOA 4TY8B 4PQAA 1K0VA 1LQ9A 5GMDA 1BUXA 2MKSA 1NK4A 3FGVA 3O2IA 3KLGA 1NHKL 5HLFA 2E9ZA 1RU2A 2GIQA 1S5ZA 2VICA 4DQRA 1BMQB 3W62A 3K58A 3HPOA 2HFOA 2V8VA 2BJ7A 2AW0A 2A1BA 3G82B 1RHJB 2WONB 4DXLA 2HHXA 3R5CA 3CCUS 5BXIA 2XMJA 3CD7A 1IBCB 1XNQJ 2CNOB 2W4CA 1XC9A 4QWAA 2Z56B 2K7JA 1TVRA 1UA0A 1ZETA 4AD6A 1DY3A 3MECB 1NZ8A 3J7YU 1H74A 2ZOFA 3JTPA 3DC2A 4FF1A 3PW5A 2NQPA 1TUWA 4IQMA 3PYDA 1SC4B 1G4CA 1UVKA 3M2VA 4ZMMA 2HNZB 1Q78A 3Q2SC 4CWBA 2R8KA 2IM1A 2HQFA 4A8QA 5LM7E 3ISND 1UAWA 5EWFA 2HLTA 5DRKA 1M1GA 1TKTA 4QIEA 2M4MA 2PEHA 2ASDA 1JXEA 2HHTA 4OFZA 5AT1B 2BJ8A 4KC5A 5HMZA 4USWA 2VG7A 1IR2A 3TVYA 2WSCC 1Q86T 1RKIA 1WTFA 1Q8KA 3OL9A 3ZO7A 4A4JA 5DM7Q 2OPPB 3E3XA 3AY0A 1RT7B 3BB5A 4JI1F 3CO0P 1ZAXA 3M8QB 2HQ3A 2OPSB 2ZH3A 4YS2A 4CT9A 4NCGB 4TYBA 1GQEA 3CJQA 1ZM4A 2VFVA 4AYBD 4ED5A 1HBOA 2YNIA 4B3SF 3HFKA 2KZZA 3Q89A 4WP3A 3I4HX 3EX7B 4NXMF 3CJKB 4G1QA 2PIIA 3PDNA 4DMZA 3M32B 4YP3A 2R7SA 1V5VA 2BABA 1S6UA 2XY5A 4NI2A 3HZEA 3J7ZT 3W3SA 4BCAA 4USUA 3M8YA 1T9XA 4CLYA 1HD1A 4LFCJ 5EWGA 2N4CA 2ZC3A 1RHKB 3MEDA 4CLTA 4GO5X 2RQCA 2GIFA 2XWYA 3ZTRA 3KK2A 4CM2A 2GO9A 2MZSA 4P6QA 1XQIA 3I4PA 1LFPA 2D7SA 4HI2A 4WKYA 2FGCA 5M2PA 5HJXA 3B8HA 4OZ0A 4N56A 2B8QA 1UJ4A 4DV4J 2R4FA 2XZDB 1F5BA 3A1YG 4LF6J 1YBAA 1IUJA 3UR0A 1YRUA 1ACMB 7AT1B 1F1BB 1LK7A 1HWKA 2FHJA 4EI2A 1QAJA 2HHUA 2LQ9A 4B17A 1RT2A 1KSPA 3UPFA 4KGVB 4DV0J 4PKDB 2LEAA 3A4TA 2ZD1A 3A3PB 4BLGA 1RWPB 2AYGA 1C0UB 1U0SA 1JLBB 4CLSA 4C0HA 5D0HA 4UOFA 2CZ9A 3HSDA 3QRRA 3LUYA 5FLXY 4AL7A 1NSQA 2K1RB 1EP4B 1UZDA 1MG7A 5MLCV 1WEYA 1WC0A 2RF2B 2YNGA 1J5OA 4L74A 3C15A 2L9WA 5GADI 3GIRA 2D9PA 3QMQA 2PEBA 1U7LA 2A18A 3THTA 1HWLA 3I55S 4WE1B 4YR2A 1F5CA 5F8NA 3OR2B 4X62J 2O1PA 2AT1B 3PXGa 1RXOB 4M5IA 4YR3A 2CDRB 2P8IA 3MMAA 2LA4A 1ZBTA 2WAQD 4ZP7A 4GVBA 4X4VA 3O8WA 1U48A 1PAEX 4ZPVR 3CNQP 4RW9A 3P3DA 4RUCA 4Q2LA 4CH0S 2BYCA 5E3RA 2HVZA 4DSIA 2U1AA 3SZ2A 1C1CA 4B3MJ 2KFZA 4HKQA 4U8VA 3GE9A 2DY9A 2XGQA 1O0PA 2Q3PA 4LF7J 4DSKA 1IKVB 2D3O1 4PWWA 2GJIA 2VONA 2BR0A 4G1IA 9RUBA 3SCKE 3VWSA 2AYEA 2XYHB 4JI1J 3ISNC 1HNWJ 2AZ3A 5B7WA 1VRTB 2F8EX 4W92B 4XTTA 4QQBA 3QRQA 1SCJB 1ICEB 1FK9A 1YX2A 2K3IA 2V68A 2JEJA 1B70B 1ITPA 4U9RA 3W5XA 4QWDA 4B3SJ 3Q2TC 4I4BA 3IBWA 2OKQA 3UD5A 4NXMJ 2ZH5A 4CO3A 3CD5A 4TYAA 1ZZFA 1LEOA 2KB2A 2CPJA 2A2CA 2MZRA 3SV3A 6AT1B 2VFRA 3FK4A 4B9UA 2GAHC 3OLAA 3M7VA 1QJHA 1UFWA 3VALA 5FIIA 1XBWA 2MKYA 4ILLA 2QG9B 3MFIA 1REVB 3LQVA 1S6QA 1RWKB 2ZM6F 2PA3A 4MKVA 4JI7J 2DNMA 4J9OA 3K8VA 4C4WA 2QL9B 4JI6F 2ROPA 3MM6A 2OGUA 3BR8A 2RRBA 3HVWA 3DGPB 2MY8A 2UVUA 4O3NA 3V6JA 1PBAA 1KONA 2BJ1A 4BHQA 4TXSA 1VLOA 2QGFB 5KFWA 1TL1B 2RUSA 4C8MA 1R89A 1VQNS 1KC8T 3RR7A 2AJ1A 5HP1B 1X9SA 2YVSA 3PY8A 3ZZPA 4ANCA 1N5TA 4CT8A 2HIQA 2OO4A 3DOLA 1TL7B 3NBPB 4RLEA 4ZP8A 3EZOA 1T9YA 2NSBA 4IRKA 3PR4A 2GQQA 1HNXJ 3IWNC 1HQUA 2ALYB 2DNHA 5ETMA 4WU2A 1RAIB 1SQEA 1VDHA 3IG1A 2W8KA 3TW0A 4LSNB 3M9NB 5GAHU 2D69A 5HN0A 3BSOA 2B9YA 2FY8A 3CW2C 2DR7A 1URRA 4RUHA 3DHXA 3MGJA 2FHOB 2BW7A 3DRSA 2VDHA 3VGTA 1REGX 4N47A 4IOCQ 5ETRA 3X1LB 3PM9A 4M5MA 1WUUA 1LW0B 5K9FA 3GWCA 2E1AA 2DIUA 2Z58B 5IC4B 3NGSA 2CADA 3D6TB 2EWHA 1SJ1A 1FFSB 3DGVA 5KFNA 1CPZA 5J1EA 4NLOA 3AT1B 4IOAQ 4ZN3A 1JX4A 4WFXA 1XN9A 2GGPB 1TK8A 5ETQA 2OSRA 3CCTA 1T03B 4DCJB 3BO3A 3W66A 4FXVA 3MXHP 2MKCA 4ECVA 3OPKA 2MLZA 3MAAB 1S4FA 4LF9F 1SV5B 5HK4A 1M5SA 1IWGA 1FDNA 2JX2A 4M5DA 1VQ6S 1RWNB 3P4UB 3NCRA 2AX1A 4LUBA 5KFCA 1G1XA 3HHNB 1ZM3A 3BF4A 4F67A 2OTLS 1VC0A 1VK3A 4P74A 1PBUA 2ATLA 2W9CA 4AL5A 1R6YA 3RG6A 2DRBA 5KFAA 2HSEB 2BANB 3DI6B 3MD3A 2AF6A 1QSSA 1XNRJ 4FXDA 4QWCA 4CYUA 4PG6A 1S7IA 4ZVQB 3HD2A 2G0CA 5DDOC 1WHYA 3D9BA 1NXIA 3E51A 5AJ3F 2K06A 3MEGB 4C8ZA 2UUAF 2MKJA 5KG1A 1WI8A 1KHWA 3M1VA 4ZDNA 2XLKA 2GC8A 3PRBA 4DX5A 2BACA 1HD0A 3VV2B 4IH6A 2RS2A 3Q22A 1TFWA 4OHWA 5DQHA 2BM0A 1ZOTA 4DL3A 4DUTA 3JSMB 1VIXA 3D6HB 1Y00A 1WSRA 1U49A 2OFGX 4ZVSB 3BPDA 4CLPA 1U1NA 1T94A 3TZXA 2LP4A 1UKUA 4JI6J 5I3PA 1GMWA 4EBDA 5J2QA 2RQKA 3UQSA 2PI4A 4C11A 1RTDB 4NZ0A 2ZUGA 2PO4A 5H9FK 2QTWA 4R8UA 2QFIA 3Q23A 1YZ6A 2C22A 2APOA 2F63A 2QYCA 1RTHB 1W26A 6FDRA 4WIIA 2CVEA 4O4GA 5D0GA 2CPYA 1WKKA 1SJRA 1OS5A 2DGWA 4NLSA 3TVZA 5GAEI 2CQGA 2WSEC 2XHWA 3N79A 5KFVA 4B3OA 3ZZ0A 4LF2A 4ZPWR 3N28A 1TKDA 2V9KA 2JH3A 2PGCA 3CEDA 3LH2S 2AIRB 4NEZA 4JUZA 1RYSA 3MTKA 5D0EA 3KYLA 5A8KB 3PIPQ 2CFXA 4EGLA 2EBEA 2YWEA 1FCAA 3AH6A 5B0BA 3CIZA 2PSZA 4IFYB 2MEWA 1TK0A 3N9UC 2BUNA 3CD0A 3BH7B 1Q53A 4MH8A 4LF4F 3VAIA 2LVWA 1Y7PA 2HURA 3HO1A 2YX1A 1WG4A 4RNMA 4L6V3 3K57A 3KXDA 1EAYC 2G0JA 4MMOA 3LA0A 1FRKA 3AQPA 4IDKB 1DLOA 2V4RA 1DBDA 1F9EB 3BH6B 2XEXA 3LF0A 3M4XA 2KTQA 1UVJA 4ILMA 2HNDB 4F2RA 3QO9A 2JEIA 2VBWA 2CZ4A 2HZCA 3MM7B 1MROB 3DOKA 5EN1A 2YWFA 4W90B 4NRUA 3UN5A 1TR0A 3PVXA 1NJWA 3CIMA 3CCQS 2MJNA 5C2GA 1IKYA 4HR2A 1H98A 3PACA 4B3RF 2AEFA 4FYVB 3KLHB 4NLRA 1TL4A 2R7OA 3JXOA 2VD3A 5KOXA 1NDCA 4K4SA 4CNYA 4PR6A 3QZ7A 2W4DA 4OJ3A 2YPYA 3RB3A 2ZBIA 4DR4F 3MURP 1N36F 3U02A 2RJZA 2CQPA 3OVAA 1NJXA 4Z7CA 3A13A 1T3NA 4OZ3A 3AOAA 3D2WA 2LQBA 3CCZA 2AV5A 1PJ7A 3DYAB 3KLFA 3GSIA 5IS2A 2ZBQA 2CPIA 4ECTA 4DWIA 2ZH2A 5DG8A 4ALZA 5GMKa 4Y0FA 4LVOP 1RCOB 4TLRA 2HWTA 1A0OB 3PNIA 1JLQA 1NPPA 4TN2A 1G7CB 1C0TA 3VAJA 4NXNF 4F3MA 4DL0C 5AJ3J 3RJMB 4ZVFA 2B3TB 1HQEB 5F8HA 1VRUA 1PIEA 4TNOA 2UUCF 1PO6A 1Q5VA 3IGNA 1KTVA 5LMUF 5KFTA 1VHFA 1CJTB 2EFOA 2CPDA 1LWXA 3R6LB 3GMGA 2PFDA 2RAQA 4K0KF 1RT5A 1RT4B 3IBCB 3TQ1A 2HMIA 1JIHA 4ED0A 1V3ZA 2HIYA 1TUGB 4FKXA 4CP5A 1S12A 3JYTB 2QSFA 2O3DA 4OMFG 3W2VA 4UY85 2FGOA 2R8HA 1HBUA 1N0UA 2C42A 3RAMA 3KUEA 3VHQA 3DLEB 3DLJA 3CO9A 3OL6A 5D15A 4C9DA 2VBZA 3QGHA 2YNFB 1VRQC 4EK2A 1OO0B 2B8PA 1X9WA 4RBVA 2FDNA 4EMDA 3QRPA 2DD8S 1CJUA 4WJBA 1RAFB 1RTJA 2CJ9A 1HBNA 4I64A 3LO3A 1AUDA 3DCAA 1WI6A 1P8GA 1FWPA 2CG4A 4I1TA 4ER8A 3JTOA 4WKRA 1R43A 1DZ5A 3MMBA 3PR5B 1F0XA 2GVZA 2KDOA 4DV2F 4UQGA 4DFKA 3MEEB 1IR1A 4HT7A 2XCPA 1N5SA 3TP2A 1I51B 3RRKA 3LGHA 1RHUB 1IKWA 2CYYA 4LF5F 4K50A 4LF4J 8RUCA 2XHCA 1KVJA 3P8BB 1X4GA 2LXFA 2MQMA 2ZE2B 2VKZG 4MFBA 5D3GB 3K5NA 1Y4ZB 2MJUA 4ZVEA 5DGAA 1XK8A 1T9VA 4I67A 2V8PA 3CT9A 4DR1F 2JRSA 4A47A 3UD3P 4NYOA 4LRBA 3THVA 1MU2A 2Y0BB 1JJ4A 1Y5NB 1RAJA 5A8RA 1RA6A 3KJNB 3I87A 2GO8A 3IXQA 4KTQA 3OTDA 1HYSB 4LF8J 3DLKA 4OYZA 2DHAA 3MD1A 5IV4A 3L7OA 3NWRA 4B3RJ 3RW7A 1GTEA 4LSZB 3L7PA 4M1KA 4R25A 5AXNA 1UPPA 1N52B 2LU1A 1IM6A 5KFOA 1BGXT 3N6NA 4RL1A 4UQTA 3LAMA 4DR4J
chains in the Genus database with same CATH topology
3UFCX 1U6ZA 5KT4A 3POTB 4QOTA 3TVKA 3TAQA 3EGWB 3KLHA 1JNRB 1XR6A 3FNNA 3BGRA 4A8SA 4KV8A 1G6BA 1D8ZA 2AX0A 2YKPA 4A48A 4R5PA 1DRZA 4E0DA 3FJ2A 4G3IA 1S9EB 2W8LA 1E6VB 3L95X 4RKUC 5D4NA 4OL8A 1VJWA 4UUXA 1GTHA 3OJSA 1NJZA 1FRIA 1LWCA 4MJKA 4I68A 2FJBB 3KLIA 2DR8A 4V19X 3QIPB 5BR8F 1EETA 3VZIA 3VAKA 5HBMA 4YB5A 3G6XA 2DB1A 2UUWA 3ULHA 4X65F 5KG2A 1UL3A 2XMTA 3OUYB 2ZH8A 2M52A 3LP2B 4MYUA 3M2UA 4KO0A 2ZJPQ 1TAUA 4TLQA 3GV7B 3M2RB 5C42A 4IO1A 2XLIA 3HVRA 3K5PA 3M9MB 3KOAA 4JI5F 1RT5B 2VPZB 3KLGB 3I6PA 4C7QA 1ZZNA 4K4VA 3BSCA 5HLFB 1IBKF 1XR5A 2DHXA 2K7KA 3H5UA 2KXFA 5G0RA 1BWEA 2FIUA 2HMIB 2Q79A 2R7TA 4NA3A 5F41A 2ZFHA 3M8RA 1Q7LB 4JI3F 3RYLA 2OMLA 3T1AA 1XERA 1ZAWA 5G4DA 4O44A 2P6SA 2FUG9 5C25A 2WBRA 4IG3B 1K1QA 2YKNA 3DMJA 4QU6A 1VS3A 2EPIA 2KYXA 2V8DA 2UVWA 4FBUA 1N5YB 3NNCA 3TA2A 2XNQA 2HQIA 5SZTA 4Q45A 4Y00A 4O0IA 4IH5A 1KLNA 1JLFB 2I38A 5D4LA 1R27B 3A8EA 4NZ7A 1I6JA 2JC1A 4EEYA 2YWKA 4Y65A 2GMJA 1DAXA 3CDAA 1Q1KA 3R5DA 4DPOA 3I0SB 4AE5A 2AJFE 1NKBA 3NCQA 4ATNA 1YVFA 1YIJS 5IZHA 3GIMA 2VFTA 4RNNA 2NPIA 1GX5A 3PW4A 4DFMA 1TVRB 3UCGA 3MUMP 4IR1A 1M0SA 1HBNB 3OXFA 3MOZA 2X1BA 2LKZA 5EWEA 2CPHA 4PXDA 1SH2A 4K4YA 4MAKA 2H9ZA 2MPUA 1HNIA 3N6MA 4EZ9A 3CCES 1R0AA 2VZ9A 2LXUA 2A2DA 2KYZA 4JBCA 2KKHA 4B9MA 1M1KT 1FJCA 5BJRA 2J76E 3I5AA 2LLZA 2O5DA 5B0GA 4DBQA 1T7PA 4NZ6A 4B9VA 2QRRA 2OPRA 2DGXA 2E5HA 3SDEA 3T19A 2F8MA 3OSNA 1Y0HA 3M2VB 5C24A 4OX9F 2K2PA 1LW2B 1HQEA 2M2BA 4K59A 3OTCA 4NLWA 2NUUG 3CJ3A 5KFQA 1VGYA 4X2BA 4MIAA 2J7UA 2DISA 2IMWP 2HHQA 2BRLA 1HPZB 2B6AB 5CCMA 2MHEA 1QSYA 2VFSA 1YJUA 1WWHA 4C3LA 5A2QY 1VC6A 4MKYA 2ZZNA 4QWEA 3M30B 3K5MA 3TUZC 5F9NA 1OPZA 3HI9A 2HRUA 4KKOA 4KR0B 4CO4A 2OTJS 2FY1A 1FE0A 3KMQA 1LOUA 2Y1RI 3L09A 1N56A 5LXYA 2UXDF 3G8QA 5IM0B 1KFDA 4IG0B 2SXLA 4NPOA 1D9DA 1S0OA 1FTCA 1IKWB 1S7HA 2HYIB 4OLOA 1NK6A 4DF8A 2NUHA 1TKTB 3H20A 2BRKA 2FB0A 3IWXA 2J0QD 3BGUA 1JJ2R 2HVIA 2XC9A 2JHEA 2IVFB 1D0EA 2PMHA 1X4CA 3BR9A 4I7FA 2WTFA 1YI2S 1RTIB 2VG7B 3MR6A 2PC6A 2BQ3A 2Q66A 5KG0A 3FFIB 3PFOA 3JYTA 1NH7A 2VPYB 3KKFA 3F56A 2Z2LA 2HWIA 3KNGA 3Q8PB 4DQIA 4I2PB 2MSSA 3DU6A 1TV6B 5DDRC 4MK7A 4O3RA 2N3OA 2E66A 1R8HA 4XPCA 1X4AA 2C3PA 2PA8D 4WF9Q 3JTNA 4USIA 3ZZUA 5DLGA 1S1UB 1J2VA 3LAKA 4F3OA 4NWBA 4DLGA 2XSFA 2FC9A 1FNXH 3PKMA 1RISA 2CDQA 4F25A 4NMLA 3DU5A 1AXQA 2KH9A 3D54A 4J9PA 2LEPA 4FZVA 1TK5A 1JK9B 3OV7A 1N5VA 2EVZA 2BDPA 2WOMA 1S99A 1HBOB 1T3OA 3DXSX 3MECA 3C6TA 3BJYA 5HL7Q 3PEHA 1S6PB 4P7TA 4XK8C 5F8MA 4WFAQ 2HHPA 1RT6A 2C3OA 3MM5A 2KM8B 4N77A 4KHMA 1X4DA 2C28A 3EGZA 3CC4S 3GYNA 4R0JA 4G1QB 1HW9A 3RAQA 3RB6A 3LGMA 1Q7YT 3DRPB 5U47A 2MXYA 2P5VA 1PILA 3NAIA 2NPFA 1MMDA 3EZUA 1OQ3A 5J2PB 5JJBA 1WHXA 3AA9A 4RWXA 4PPDA 1WEZA 2IM0A 1M5KC 2VH7A 1ELOA 2A10A 4USJC 1VBYA 3AHPA 2I5JA 5EGYA 3U1LA 5LSLA 5L9NA 3S6EA 4CI0B 1SUQB 4K4TA 3NGDA 3EPIA 2AQ4A 4F4KA 1IKXA 2X1AA 1HI8A 2RQ4A 3FSYA 5J2NB 2DO0A 4LQ3A 1FJ7A 2XZWA 5K14A 3K8WA 2CQCA 1QAXA 2MQOA 4LF8F 5DO2A 4D3HA 4DOZA 4L72B 1FJGF 1SXLA 2LXIA 3GSDA 3MEDB 3QLHB 1NK9A 4ID5B 1HMVA 1K73T 5CZXA 2R8JA 2NR0A 4LIRA 2HS4A 3AA8A 1QLNA 3ZZZA 4X4OA 3HM9A 2MKKA 3UI3A 2CQ0A 4EFAC 2MSTA 4R5PB 2ZOGA 1KVIA 1IR0A 2XNRA 4QU7A 1WHWA 2MKHA 4WXOA 2VOOA 3CGIA 3H4BA 2EKYA 1VBZA 1W2IA 2E1CA 4GMKA 3KK2B 5D77A 3F44A 2MGZB 4BS2A 3CB4A 2XI3A 3CCLS 1MMNA 4LFCF 1XWLA 3VAGA 3DHWC 2QE5A 1FNMA 4X64F 1YSJA 1RWUA 4ECXA 3K0JA 1NO8A 2AJQA 1KD1T 2M88A 2XSJA 4QW8A 2XULA 4F4XA 2ZE2A 2I2YA 4RBUA 2WK4A 3V6KA 3OBIA 4DUZF 5D3GA 3FEZA 1MWZA 5GAGI 5KT5A 3DRRB 2GMLA 2BM1A 3OHBA 2M8DB 4HDHA 1WF0A 3DDNA 2KM8C 5CYQB 4DS5A 4N8NA 4RZRA 5BYRA 2HS3A 1X5OA 4A8MP 3CJ2A 4PUOA 4FF3A 2E5GA 3U27A 1LKZA 2N82B 2KI2A 2C2RA 2DH9A 2JEGA 2GJ2A 2E29A 1IM4A 4LVNP 3KJVA 2WBMA 3HKWA 4NCGA 1T02A 1U2FA 3R1LA 2MY7A 3G6YA 2NXUA 3KG0A 5GAGU 2HHWA 4ECZA 2RUGA 1UWBA 2HWHA 2IYGA 1Q16B 1VLYA 2QZ8A 3HHDA 4I2QA 3T6BA 1U4BA 2YKNB 3DLBA 1M5PC 3PW2A 1Z2ZA 4I56A 1HBMA 1RT1B 2FJAB 3C3LA 4M94A 2IJNA 2DH7A 5J2MB 4OJ1A 3VQSA 3MMJA 4YDDB 2AYBA 2M70A 2UZAA 3SYZA 4FXWA 2ZZMA 5L39A 2EFQA 1N5QA 1O5JA 4FNHA 4MIWA 3CJKA 3BDPA 4C0OC 1DFDA 2HRYA 2RKIA 4GKJF 4PQUA 3X3UA 1SH0A 2JWNA 1RT2B 1WD6A 2BVZA 1CVJA 2NREA 1S1VB 2J6UA 1FF2A 3BO2A 2E5IA 1U1OA 3M32A 3LANA 1JWWA 2J0WA 1HYSA 1C4CA 1JLAB 2R7QA 3HVTA 5H9FJ 3CDEA 2IM3A 4J9QA 1QVFR 1DTQA 4KFBB 3SQGA 2EBGA 3MPYA 4K5RA 3KLVA 2CJBA 4DL2A 2ZD1B 2Z4PA 4QIVA 2QA4G 1ZM9A 1N32F 2GX8A 1T05A 2G1DA 4WK3A 1N48A 4PWUA 2WRMA 4ZPDA 5AXKA 3OXLA 4WYLA 5A8WA 4WZQA 1TL5A 4G6VB 4Y6IA 2XMUA 5IQ6A 3IC1A 2OD4A 3NNHA 1ROFA 5EX0A 3BM7A 1BY9A 3RZAA 1B0TA 1SH3A 2VQFF 4DX8H 4C8OA 3M6XA 3LP1B 1UETA 4AFFA 2R9LA 3DLLQ 2DGVA 1VOMA 2V0NA 2YY3A 4KGMA 5HMWA 4C8YA 2FLNA 4M8LA 1S9EA 3K5OA 4RNHA 4U7UK 1E6VA 4XIUA 4JYAF 4TY8B 5D78A 1RDRA 4PQAA 4XDCA 2DGQA 4LMZA 1K0VA 5L38A 1LQ9A 4O23A 3VTIA 3RBEA 1SJ4P 3QIPA 2MKSA 1WELA 2BQUA 5D8HB 1NK4A 2B4VA 2JJ4D 4GC7A 3FGVA 3LP2A 4OHYA 3FVYA 3MAQA 2YNGB 1ZYQA 3M2RA 1ZPVA 1X7VA 4YHHF 2KRRA 4DL6A 3O2IA 3KHRA 4OI3A 2HNYA 3G8TA 2AGOA 1VQOS 3KLGA 3GR0A 2VA3A 4YUDA 5HLFA 2E9ZA 2EK6A 2GIQA 4WU3A 5HROA 4I7FB 4BC7A 1VQ7S 4DQRA 2QV6A 4B9NA 2DNPA 2AGQA 1SIWB 3KG4A 4Z37A 2HAIA 4UW2A 3I96A 1U25A 3VAMA 1VQLS 2MZTA 4IG3A 2HFOA 3HPOA 3K58A 1VQ4S 2V8VA 1N5YA 1PC4A 2HGMA 1U1RA 4RW7B 1IXKA 1FHTA 2AW0A 2A1BA 2P6TA 3FZ2A 1RYRA 1YRXA 3ISZA 1JLFA 2POKA 2VC1A 2I8EA 3FRZA 2WONB 2RMLA 2HHXA 3R5CA 1DQ8A 3NS6A 2XMJA 3CCUS 1APSA 3CD7A 4CH1A 2UV8G 3J7YI 1KOHA 3MMAB 3I0SA 5LL6d 2W4CA 3PW7A 1XC9A 2V8HA 5KT7A 1F2GA 4ED1A 4QWAA 2Q6CA 4R0EA 2FLLA 2QLXA 4A8XA 3SSSA 3D5MA 2LECA 2K7JA 3H8YA 3CMES 2IRYA 2EFVA 1TVRA 3Q24A 1UA0A 1ZETA 4RW9B 2J6TA 1QAYA 3CJ0A 2B4PA 3MECB 2X1FA 4AL6A 4JI2F 1YQHA 2AJ0A 2J9EA 4NLQA 3J7A1 3J7YU 2QMWA 4IFVB 4FVCA 3MM5B 2ZOFA 1VQMS 3H25A 4IUFA 3JTPA 3DC2A 3TR5A 4FF1A 3LPYA 3PW5A 2NQPA 4IQMA 2KJVA 1JLBA 2IAJA 2V94A 1Q4RA 1UVKA 3EXCX 3M2VA 4ZMMA 5LT5A 2L41A 2HNZB 2W7OA 1LW2A 3CF5Q 4OZNA 3DOMA 5B0FA 1C1CB 3CC2S 1Q78A 3Q2SC 4ECRA 2R8KA 4YFUA 2IM1A 4A8QA 4Y2IA 1S76D 3MZIA 3TUIC 2V4QA 3ISND 2K1RA 1WG1A 2GA7A 1UAWA 4B08A 3M30A 1UA1A 5EWFA 1AROP 2D74B 3RTVA 4X4RA 3C2PA 1KNZA 5K14B 3UCZP 1XMOF 3Q8SB 2HLTA 5IM0A 4IG0A 1S10A 2ZHAA 3VR1A 2J7WA 4RX6A 1GT8A 5DRKA 1JKHA 1TKTA 3IRXB 2GV1A 5E0OA 3ITHB 4QIEA 2M4MA 2PEHA 3V5RA 1JXEA 2ASDA 3MF5A 3NKYA 2HHTA 3CCJS 1BD6A 4OFZA 3NL0A 4KC5A 4DEZA 4K4ZA 4UOCA 5HMZA 1RTIA 2VG7A 3TVYA 5DGBA 3N4WA 2WSCC 1Q86T 1RKIA 3C46A 4J9KA 1WTFA 1GXLA 2F9JA 3GR1A 3TA1A 3OL9A 1F9FA 4K2XA 2EG1A 1L3SA 2E9TA 1YJVA 4I6YA 4Q2MA 2DCLA 4A4JA 5DM7Q 2KXHA 2OPPB 1M5OC 3CJ5A 3E3XA 3BN7A 5H9EJ 3G86A 1FK9B 2MMYA 3AY0A 1VQ9S 1TV6A 1RT7B 1I1GA 5KFIA 3BB5A 5DJBA 4JI1F 1U6FA 1YJRA 1ZAXA 3JSRA 1JLEB 3DM2B 3M8QB 2HQ3A 2OPSB 4BBYA 2ZH3A 1S48A 4TQRA 1YJWS 1S1UA 4CT9A 3R5AA 5EX3A 3OSPA 1HWIA 2DGTA 4NCGB 1QTMA 1MWYA 4TYBA 1X4HA 1GQEA 3CDUA 5CYMB 1QVGR 1SB6A 5HI7A 1ZM4A 1SIZA 2IFXA 2ILZA 1Y5IB 2VFVA 4AYBD 4ED5A 2FVCA 3T5KA 3CULA 2EG2A 1HBMB 1HBOA 2C3YA 2YNIA 4Q0BB 2ZDPA 3HFKA 3H5SA 4B3SF 2KZZA 3CSKA 3FMBA 5AE1A 1S6PA 2ROEA 3I4HX 3N01A 2ZH6A 3EX7B 3E01B 4CO5A 4NXMF 2R7VA 3CJKB 1OSDA 2PMZD 2DCUB