4Y2KA

Reduced form of apo-golb
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
GMQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal-binding transport protein
publication title Structural Insights and the Surprisingly Low Mechanical Stability of the Au-S Bond in the Gold-Specific Protein GolB
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Metal transport
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y2kA00
2W4CA 1FESA 2QLXA 2GGPB 2HLUA 3KG1A 4EFAC 5B0BA 3FMBA 2XMMA 5A6PA 3HHLA 5B0DA 3LO3A 2IYIA 1N5TA 2BJEA 2N4DA 5B0CA 2XMVA 3KKFA 2BBEA 1AFJA 1OSDA 2XMTA 3UDCA 2K2PA 1X8DA 1CPZA 3BR8A 1VQYA 2FB0A 3TNVA 4A4JA 1TR0A 3LGNA 3HFKA 1FE0A 1Y3KA 2ASYA 2ACYA 2XMKA 3FRYA 1RJJA 2ROEA 1TL5A 2LQBA 1N5SA 2G9OA 3VTIA 3GZ7A 3HDSA 2IYGA 1Y9OA 4NPOA 1KVIA 1S6OA 3BF4A 5F0WA 2LDIA 4Q2MA 2GA7A 3CJKB 2GGPA 5B0GA 4OJHA 4Y2MA 5K9FA 1CC7A 4NL5A 2AJ0A 1U7LA 1Q53A 4YDXA 1W2IA 2CRLA 1Q8LA 3DXSX 2HQIA 1WD6A 2HFNA 2OAUA 2HLTA 3QMQA 4FNIA 2AP6A 4Y2KA 2PD1A 4ZOSA 1TZ0A 1APSA 1KQKA 4DL0C 3E8OA 1AFIA 2OFHX 2QIFA 2VH7A 3WDOA 2XMUA 3BDEA 2XMJA 2BYCA 2JDJA 2K1RB 2W4PA 2K7JA 2RILA 1YJTA 1FE4A 1OQ3A 5B0FA 2N4CA 2RU9A 5A6WA 1IUJA 1TUVA 1VQSA 3TRGA 1YRXA 1SB6A 4U9RA 4Q2LA 2FIUA 1S6UA 4OJ1A 1ULRA 2FHMA 2BJDA 3KG0A 4YEAA 3CJKA 3BN7A 1LQ9A 5T7LB 2KT2A 5B0AA 2GFFA 2EW9A 2PGCA 2QYCA 3I9ZA 4OJ3A 2KYZA 1P8GA 2RMLA 3KNGA 4HI2A 1JWWA 5B0EA 1YJRA 2W4DA 1AW0A 1X7VA 2IFXA 2LQ9A 2FTRA 1V3ZA 1YG0A 2VV5A 3IWXA 3F44A 2Q3PA 1FVQA 1OQ6A 1XBWA 2ZDOA 1TL4A 4OJGA 1R6YA 1OPZA 3MZIA 1SI9A 4HL9A 2LXFA 3HF5A 1FD8A 2OMOA 2K1RA 3HHLC 1YJVA 1Y3JA 3IWLA 3LGMA 4A48A 1KVJA 3HX9A 2AJ1A 3TOQA 1FVSA 2ZDPA 4HH0A 2L3MA 2GV1A 1URRA 2ROPA 1CC8A 2KKHA 4OIXA 4HI1A 1N5VA 1X0PA 1MWZA 2XMWA 3HHLD 5T7LA 4DN9A 2BUNA 5IXUA 3K7RA 3MCSA 1K0VA 2OD6A 3HHLB 1FEEA 1Q8BA 1YJUA 2OP5A 2HFOA 5F0UA 1GXUA 4QOTA 4DPOA 2HIQA 2K7KA 2ROGA 4FNHA 1SQEA 2RSQA 2OD4A 3BM7A 3DCAA 2OKQA 1QUPA 4A47A 3FGVA 5B08A 1JK9B 1N5QA 1Q4RA 3BGUA 5KAKA 1P6TA 2GCFA 4F67A 2OFGX 4A46A 1MWYA 1Y0HA 2GO8A 2KT3A 2N7YA 2QLWA 3QGPA 4Y2IA 4ZA1A 1GXTA 4HH1A 2AW0A 5B09A 3T9NA 3BB5A
chains in the Genus database with same CATH superfamily
3KJFB 1VQNS 2LEAA 1T94A 2WK4A 4OQJA 4OZ5A 2BMBA 3HHKA 1NEEA 3CCTA 4WKRA 3T19A 2EC0A 1NMEB 2BEFA 3CW2C 3F41A 1KVIA 4TLQA 4AL6A 4R8UA 4ZVGA 1UMJA 4DX6A 3DXSX 4Q8EA 4WK3A 2FVQA 3M6WA 3VAJA 3HCXA 1G1XA 2CZVC 4N47A 2Y1LB 3QSYB 1FJ7A 1VQSA 1NJWA 1JKHA 2F4VF 2HPUA 4OJ3A 2J9DA 5KFPA 4DZDA 3FZ2A 2DK2A 3CC7S 2GJFA 2RKIB 2J6UA 2XO7A 3K17A 4U7CA 1XQIA 3M8WA 3DLKB 1HYSA 4CM0A 1RUSA 3PYGA 4I6YA 5GVQA 4OHXA 1VQOS 2E9RX 1H74A 2HQGA 4WP3A 3I0RA 4HHJA 2IJFA 4TVAB 3R7NB 2W9BB 4YFUA 3OTOF 2BJEA 3KUGA 2OIHA 1K47A 1X4CA 4PWDA 3CO9A 1S4EA 1FJGJ 1NNDA 5KFYA 5HMZA 4QIWD 4HACB 4QW9A 1WI6A 2FLOA 2VDHA 2UXDF 5D4OA 3QMQA 4IH6A 1R0AA 4LBIA 2K1RB 2R8IA 4F0HA 1ULRA 3QRQA 3BBFA 2JLFA 5K14B 2DGUA 3FNNA 1AXQA 4P10A 2ILYA 3GQCA 5IWAF 2YX7A 1RTHA 3N6NA 4FYXB 1YBTA 2OHDA 1SC1B 2A2DA 4K59A 4J7CA 4Q43A 2B8QA 3GTYX 3OTCA 4LQ9A 3BS9A 3LP1A 2VQEJ 4I2QB 3M9NB 2Y1IA 4N56A 4WKYA 2H1YA 3JTPA 5GADU 4J9NA 1WKKA 3B8HA 3UDCA 7FDRA 1KP6A 2P6TA 1Q16B 3M32B 5CCLA 1A0OB 2V9WA 1H0HB 2B4PA 1BHNA 4AYBD 2W8LA 1KSPA 1S0NA 3ENAA 1H3DA 4Y2KA 2XYGB 3MM8B 5D3GA 5D8HB 1S0VA 3G9CA 1ZM9A 4O4GB 3QAUA 4CTAB 3Q8UA 5HK4A 4ZVSB 5RUBA 5LMNF 2K3KA 5A8RB 3T1HJ 2YTCA 1MG7A 2ILZA 3JAMY 1LWFA 2QC3A 1WOOA 3PW5A 3TOQA 5IQQA 2EBEA 3RRGA 4HDGA 4CNYA 3I0SB 4XIUA 1VQKS 1AUDA 3MPDA 3TUZC 2XWYA 3PHEA 2AJQA 2E5GA 1AA1B 3TW0A 2GVZB 1SH2A 1F60B 4JI2F 1KHVA 3CJ0A 1RZMA 4S0MA 2IY5B 4WZQA 2MXYA 4C2MA 2BXJA 3MAAB 4DQSA 1GTHA 3T9ZA 2DTJA 2IPOB 3PACA 3J7A1 3EVWA 3JAMU 4K4YA 2BW2A 1V9OA 3IG1B 3IAS9 4NXMJ 1K44A 5BR8F 2UUCF 4ZCMA 1JJ2R 2KL8A 3NCRA 2VUGA 2DY9A 3BEGB 3OR2B 2EW9A 4DPYA 2QEXS 4UT4A 3W9JA 3BQ2A 4FKYA 4DV1J 2HHXA 3CDEA 1C4CA 1TL3A 2VC1A 2MY8A 2KKHA 4DR1J 2V8PA 1U6ZA 1Q8BA 3ZNUA 1YJUA 4PUOB 1X4AA 4WPAA 4RNHA 1RWUA 1TK8A 3DLJA 1RT2A 3MEEA 2HHTA 3LUYA 2MQPA 1K1QA 4ZPDA 3M9MB 1BD6A 2MTLA 4DOZA 1U25A 4CM2A 4JI5F 3C3LA 3BZQA 4B3RF 1FKPA 2GJ2A 3ILIA 2DNOA 3LGNA 2RS2A 1FF2A 1IKVB 3B6BA 3RRKA 3IM8A 4F2RA 3R5CA 4PG4A 4K4SA 4A8OA 3TANA 1NH7A 1FDBA 1GFWB 3J7AN 3OBIA 1W2IA 2HVZA 1MMNA 5J2QA 3GPAA 2CDQA 2BM1A 5BYQA 4C8NA 5EGYA 1QSYA 1UETA 4ZVHA 3DDNA 4FVMA 1FXLA 4EZ6A 2YKMB 2H4YB 1E6VA 4CO0A 2E66A 4ELVA 5IFMA 5KFTA 2R2UA 1KFSA 1U2FA 2KM8C 5A8WB 2VPWB 4DL2A 1CC8A 1VQPS 4ATNA 1UZHA 4CQ1A 4UTGA 5ETNA 1I1GA 1N36F 1EKRA 2GMJA 5KG0A 3H40A 4OX9J 1N0VC 2AKWB 2CNOB 5E3CA 1Q0NA 1RHMB 4ID5A 4K4VA 5EWGA 5MLCV 4JV0A 2AGPA 4RBUA 2VFSA 2GVDB 1RHJB 1QVGR 4LBPA 4AQYJ 2C3PA 3TUPA 2DNNA 2B4UA 1BQMB 1TV6A 4O3SA 5HVFA 1FWLA 4MK7A 2Y0SD 4ZPBA 2JEFA 4OJHA 1M1HA 5DG8A 2ZE2B 1JX4A 1UA0A 5GADI 2FY8A 1CBKA 3CIZA 1MU2A 4USJC 4K4XA 2LP4A 1RBOB 1P9QC 2JDJA 4ZIVA 4CLSA 1C1BB 3KOAA 4G1QA 2DJWA 2G1DA 4KH0B 2YY3A 4HTJA 1HIYA 2BOPA 2J0QD 1WC5A 2YNGA 3GCWP 3CF5Q 3TJAA 2BR0A 2Q79A 2WVDA 3ULHA 3MCOA 2I6WA 3EXCX 4C8OA 2CJXB 4ER8A 1VRQC 3EX7B 4JV2A 2ZH1A 4P9SA 5JVGQ 5I3UA 1AZSB 5T14A 4NLYA 5KFQA 2YKAA 4X4SA 2IMWP 3FEZA 3PVXA 2JWNA 4C8ZA 1ZA2B 4HH1A 4QJVA 3DNCA 2HVIA 3DM2A 5CHCB 5KT5A 5A8KA 3QSIA 1IWAA 2HS0A 1XR7A 4KGMA 3MM6B 1REVB 3MMJA 4Y28C 1V3SA 4RPFA 4RUHA 2GS8A 2VFVA 3JSBA 3CE8A 2AX0A 4G1IA 1VJQA 3UO0A 4HTIA 5M2PA 3BREA 1HNWJ 1KQKA 3E8OA 1NK8A 4IKAA 4EYIB 1SIZA 5KFNA 2WRMA 2CXEA 4NXNF 4YB1P 2Y0BB 4J90A 3BR9A 4B9MA 5B0EA 4YS2A 2DH9A 3GE9A 2HMIB 1SI9A 2DT9A 2QL7B 2GW8A 2XC9A 2ZC4A 3OT9A 5D77A 4M5KA 4DN9A 1MLAA 3JQMA 3C6UA 2CVIA 2BE9B 1T9WA 1LXNA 5HBMA 4NOHA 1S5ZA 1SQEA 4DI6A 3OXGA 5EWEA 4JB8B 2DRAA 1H72C 1CLFA 5LXRA 3D5MA 1YTYA 4IH5A 2N7YA 1LXJA 4MYUA 3RB3A 5GAEU 4EFAC 1C0UB 4MIAA 3LO3A 3RGIA 5ETQA 2CQ3A 3K8WA 1VBZA 2HK2A 3M2RB 1N6QB 1WORA 4TY8A 1TK0A 3UN5A 3KMQA 1U1PA 2RF2B 4ECZA 1W26A 1RBLA 2P9GA 3IM9A 2DR6A 1ZAWA 3KDOA 3OTDA 4N41A 3MMCA 2QIFA 3BPDA 2MKHA 5KT2A 2XMJA 3VGSA 3MEGB 3W66A 2BE2B 5HL7Q 3CJRA 4FZVA 4KHRA 4FYDA 2HFUA 3KNGA 1YJRA 3IWXA 1QJHA 3AHPA 1UJ4A 2OMOA 5ETTA 1LKZA 2C2EA 1Z2ZA 2DRBA 4YR3A 5G0RA 3DGPA 3G6XA 2RNEA 3HD1A 5HMXA 1OJ4A 2VBZA 1CJVB 4NLSA 4NCBA 1P1LA 3H4BA 2XZTB 1FRXA 4OZNA 4QPTA 4J9MA 1NDKA 3NKYA 4AD6A 3FRYA 3UVJA 4IG3B 3WC0A 3VQTA 3EVMA 2HVEA 3VCDA 1SJ4P 1HPZB 4CT9A 3O5TB 5HQMA 2IHR1 4GVLA 3RRHA 4KV8A 2HQDA 1TL7B 1RU2A 2HBYB 4USVA 2MQLA 3K89A 4B3SF 1EP4B 5KT6A 1VC6A 5LSRA 3VGTA 3RAMA 2RDDA 3P5TL 2FJBB 1OPZA 1HQUA 2FJEB 2EVZA 5ETMA 2P8IA 5LJ3Y 5FLXU 1L3VA 1RU1A 2R42A 3EPIA 5D0EA 3N6MA 5F0UA 1JJ4A 3KK1A 3CDAA 5IC4B 3TI0A 3N79A 1D8ZA 5KAKA 3MM7B 4LREA 1XERA 3GV8B 8ATCB 2W4CA 6FD1A 2EK1A 4DV4J 3G8TA 2VA2A 1JLAA 1F1BB 3R9LA 1ZZNA 3PFEA 3KLEA 1EQ0A 2LU2A 1DRZA 1UJ6A 1N4LA 3HFKA 1SVDA 3HDSA 5CYJA 3BF4A 4DCOB 2G2YA 1KFDA 4J9KA 4IQMA 1FFWB 3PZPA 3PDNA 2OO4A 1N8RT 4P6QA 4OZ0A 1UKUA 1RBAA 2CPXA 2EPIA 2EEYA 5FIIA 3SSSA 2X3GA 6FDRA 4J9LA 2HNYB 2KRRA 4PXBA 1RLDA 2CPDA 4PXDA 1Q1KA 2W4DA 5L1IA 2IC3B 1JLBB 3X1LB 4NRTA 4ZPTR 2YNHA 3IBFB 4UOGA 3M7VA 3RYLA 3QGIA 2HW3A 4PQUB 2PC6A 3T6BA 4M5DB 4CYUA 1EZZB 4ZKAA 4QWAA 2IDEA 1HWKA 4RR5A 1Q78A 3EMTA 4DPOA 2XLKA 3CC2S 2IIHA 1GX5A 3MM9A 1D9AA 1U09A 3MR3A 2GO8A 4NYOA 3D4JA 2ZH2A 3O6QA 3V6JA 3K8VA 1Q8IA 1FJGF 1TKZB 4KY3A 3QT5A 3SFGA 1O0PA 2QN6B 4JYAJ 5DQIA 5D0HA 2RQMA 2B5JB 1FRKA 5KFUA 1WC1A 2W24A 3DRRA 3H42A 2KG1A 1R8PA 4DR3J 5D0RA 5GAEI 1FI4A 3D1HA 2R7QA 3TZWA 4LFCJ 4H4MB 2WSEC 4Y34A 1RA7A 4C98A 2F5GA 3H5YA 4N7TA 3QLHB 4RLEA 4OZLA 4DR6J 1RACB 5IQ6A 1QAXA 1SV5B 3HSJA 5KTQA 3HKWA 1B70B 4OX6A 3TRGA 2VG5B 2FLLA 1ZOTA 1RTJA 2HHHJ 3M8SA 4TKTA 3HVTB 3F44A 2YKPA 1C0TA 1HHQA 1IWGA 4JI3J 1N54B 3HT3A 2C2OB 4FKXA 3C66A 3M30A 1F0XA 1MWZA 3PW7A 1XC9A 3AB4B 3MCSA 5G0RB 3T5KA 3H20A 2KFYA 1YLXA 2M0GB 1SJ3P 4LIWA 1VQ9S 3Q23A 2J7UA 1OS5A 5DZ7A 1HWIA 5I3QA 1HNXF 5C24B 4ZIWA 2D9PA 3M2VB 4OYXA 4ZVFA 3HO1A 4FN5A 4N5SA 1VC5A 2WW8A 1J5OA 1HR0F 4H4OA 2GQQA 2RDJA 4NEZA 2DNMA 1PSDA 4J9PA 1H7WA 2CRLA 3QQCD 1HA1A 3NGUA 4FVCA 3QWPA 4LJMA 3P96A 2WVFA 2VH7A 2LLZA 3OJUA 1CS4A 2HRTA 2KVQE 2KZZA 1TUVA 1NJIT 1UVMA 4WE1B 4OHWA 1JLEB 3D0IE 3I9ZA 2Z2YB 4QCLA 4NCGB 3V6DA 5IV3A 1H2VZ 3GP9A 1QE1B 1F9HA 2E5JA 5BJRA 2MB0B 5LMUJ 2CJBA 2ZHBA 3FK4A 4U6PA 3LAMA 3Q8RB 4UF4A 4KGKA 4MKVA 1BC6A 1URNA 2GCFA 3SI8A 2Y1JA 3VAGA 2DO0A 1L5UA 2A1BA 4PG6A 1GMUA 2P6SA 1ZH5A 2MLZA 4ZP6A 2B3TB 2AT1B 3QGGA 1SL1A 1UZDA 2ZZMA 1NJXA 2KTQA 4B3OB 2MZQA 2LEPA 2VPXB 2DXDA 4PZVA 3VV2B 3G96A 4OYBA 4RUBA 3OUYA 1YQHA 4LR7A 2FYXA 4NXMF 1HFEL 2L48A 3VR1A 2CJ9A 4P7VA 4KPYA 3F56A 4C11B 1AFIA 3KYLA 3PR5B 4ED2A 1NDLA 3CTRA 2I5JA 5LXYA 2YH1A 2ZZNA 4X66J 5AXLA 4DFJA 4BC9A 1UVIA 3QJPA 3DOLB 4DPUA 1R0BG 2IRXA 3P6YC 4DR1F 2RAQA 3PYDA 4XO0A 2L3MA 2N3OA 3SV4A 4HI1A 1RHRB 1VQ7S 3KXDA 3P4UB 1GH8A 1CJKB 4DXLA 3S8SA 1F3FA 2OD4A 2BV3A 1OSCA 2Z57B 4DUTA 5HVGA 1LWCA 4X4RA 3H2UB 3FC9A 5GMKa 3KG1A 5DZ6A 4DV0J 4TXSA 3TZXA 1HBNB 3HI9A 3FQLA 3K5OA 2RE1A 3BGLA 4ETZA 4Q0BB 1Q8KA 1I51B 5DGBA 2ZHOA 2IJRA 5H1SV 1VHFA 4K2XA 1S72S 1EHWA 3KLGA 2DEIA 2CPJA 4ZJLA 2FD2A 1TKDA 1UW4A 2OEKA 3M1VA 1TUWA 2F8EX 2B7BB 4AUKA 4WP9A 2OPRB 4LF4F 1JLFA 4CH0S 3CCUS 1QAYA 3RBXA 2FLPA 3AOBA 2BVZA 3KJVA 3UCUP 4MYTA 2HVDA 1FX4A 1JXEA 4ZA1A 3T6JA 4OV1A 3GJRB 3N5BA 4C0BA 4PXEA 2OMLA 4DV3F 3MHYA 4H4KC 3M8PA 3EXYA 1RHQB 2L08A 1C4AA 1S1UB 2LQBA 2UUAF 1KDNA 3L95X 4LRFA 4YOEA 3FSIA 3PTWA 2WAQD 3KTQA 2PIIA 4FYWB 3TR5A 2KRBA 3G6ES 4DUZF 1IM4A 4KH1B 3ONQA 2UXBJ 2PA3A 2PEHA 3UCGA 2BYCA 2CQ0A 1U45A 2ZVIA 1CS4B 5B0FA 1RWNB 4JV5J 4DBQA 2MKYA 3TEHB 3AA8A 2CJAA 3IGVA 1PIEA 1X4FA 4DV6J 4Q45A 1RTIB 1TVRB 3CDUA 2Y3YA 2W2PP 1X0FA 2OSQA 1YBAA 4HH0A 2GV1A 4CNZA 3CCLS 4UUWA 1O5JA 4K4TA 4LF8J 1AROP 4J9SA 2APOA 3V4IA 1N32F 3ZZTA 4D3HA 4EI2A 3POTA 1N5QA 3AAWB 1M5KC 3C6TA 2YNIB 3FVYA 5CZVA 4KQZA 1KOHA 2C2DA 2GJIA 1UW9A 4B02A 3KKFA 1U24A 3GU0A 3N9UC 4P2XA 1IM6A 2YWEA 1Y3KA 3M6UA 2XG8A 2VQFJ 3HSZA 2BOAA 4F50A 4ED6A 2VG7A 2XI3A 1U02A 4HR2A 2AYMA 4CLZA 2AEFA 2VG6A 2CQ1A 3MCNA 4RW9B 3UNYA 3CJSA 1T9XA 4N77A 3RW7A 1YGYA 4YR0A 2IAJB 2V8HA 1IKYB 4F3MA 4YB7A 1UA1A 2KDOA 5CYQB 2D74B 1Y4ZB 2YNFA 2X3DA 3GFZA 2XNRA 2DHSA 4I64A 3OW2R 2EFNA 4NEYA 5CZXA 4AXJA 1RAOA 3IGNA 4B9VA 2EKNA 3H2LA 5HATA 1ZS6A 3DLGB 4YHHJ 2LXIA 4ICLA 5KG6A 1YVFA 5KFAA 3SQGA 2BQUA 1RAFB 1KD1T 3DMJA 4KO0B 2E1RA 4CZCA 3ET6A 4DX5A 1T3NA 1RT5A 3RAQA 3NXZA 2G0JA 4A8KA 4U67Q 2B7CB 3TAPA 1ZAXA 3HSGA 3CSKA 2QL9B 2QMXA 3CIMA 3R5DA 1RT1B 1N5YB 2W8KA 3NCPA 4LRBA 4ZP9A 2ACMA 1N33F 4G3IA 3BGFA 5F9LA 5GMDA 8RUCA 2XYHB 2IA6A 4LF9J 3BGOP 1VQ8S 2RVJA 5CYMA 3PO4A 2CPEA 3ILLA 5F8LA 4B9SA 8AT1B 3D3BJ 3SCIE 4CO5A 2H5EA 3R5GA 4LFBF 3GIKA 1U1RA 3DKDA 2HNZA 4DWIA 1TQLA 3CGIA 1IBLJ 2HURA 1X5SA 4ZVTB 5L1JA 1PILA 4KIAA 2DGXA 2VOPA 4QIFA 3PEHA 2DRDA 1ZYQA 4LF7J 4WYLA 4I6AA 4OHZA 4A47A 2H54B 1P9YA 3UDVA 4EMDA 1YZ7A 5C25B 2EFQA 1X4HA 2Z2MA 1SJQA 3OXFA 1GXTA 3VVTA 3F73A 1K0TA 1RT7A 2J0XA 4KHMA 3UWTA 4OYPA 2OTJS 2R8GA 1NXIA 3DRPB 1MROB 1D09B 3ZZYA 2RRBA 3SQOP 2V4JB 4CP5A 2A10A 4LF5J 3UE2A 2V34A 4UY8T 3PKMA 3A8KA 2B9XA 4YB6A 1RP5A 2F7VA 1U1QA 4ECRA 1U47A 2HSEB 2BJ9A 5B0AA 2X51A 2MHEA 1JWWA 2V94A 2VZ9A 5K8NA 3PJWA 2N82B 1YRUA 2N3LA 4EYHB 1SJFA 1RT3A 1LW2B 4X4UA 2RQCA 3OVBA 4E0DA 5D4NA 4CLFA 3H98A 3TUIC 1MNEA 1VCTA 4UOHA 2JVRA 1RWXB 2IBKA 1JLGB 4DL6A 1ZM2A 4DV5F 3POTB 4ID8A 3DOMB 5HMYA 3W2VB 5L1KA 2YQ3A 3AT1B 3PV8A 4B3TJ 1KTVA 3BGRB 4A4JA 3LP0A 2CPHA 5FDLA 3ENVA 4I7FB 1S6PA 1HW9A 3M8QB 4IFYA 4DPWA 4CLTA 1RWKB 1IBKF 2HFNA 2B4VA 2F40A 1TKXA 1S1VB 1LW0A 5CABA 2Z2ZA 2LU1A 1T03B 4TY9A 2CZ4A 3GR1A 2GHPA 2W7OA 3H5UA 4Q2LA 4ZHRB 4MIBA 4RNFA 1DQ9A 2MQOA 3M6XA 4KBIA 3KHRA 3LA0A 2MKIA 4M63A 2W2MP 2ZUAA 3QZ7A 4DUYF 3VGVA 1T8EA 4ICLB 1ZM3A 2DCUB 1HNVB 4WYWA 4J9VA 3MPYA 5U47A 1V5VA 4IDKA 4R5PB 1G7CB 1LWEB 3GONA 5KFKA 1Q4RA 5DDPC 2CQIA 1SUQB 2FPHX 2YH0A 2DEJA 2OLWA 1IVZA 3MM5B 1RT5B 3BB5A 3MFIA 2R4FA 3FMBA 3F0NA 1RTZA 2HGNA 2GZOA 3I5BA 1SBRA 5J1EA 1S1TA 3IC1A 4ENOA 5CCMA 3HFVA 4IRDA 4LFCF 2NXNA 2YKNA 2R8KA 1SL2A 5J2PA 2VPZB 4JI4F 2LA4A 2HVHA 3PG9A 5JVHQ 2UVUA 3DLLQ 1C2PA 1WELA 5I42A 1S59A 4GKJJ 1T9VA 2CYYA 4ZVOB 3MUMP 3HMJG 3W9HA 1CJUA 3MEDA 2MSSA 3BSAA 4J37A 1VS3A 2ZZTA 2C2NA 3K59A 3K5LA 2CA9A 4DFPA 3MFHA 4NLDA 2VPYB 3FCHA 1SL0A 4W4MA 2X1AA 4CIOA 1R27B 2ROGA 2OKQA 3LP2B 2F65A 1YKWA 3WBZA 3JS9A 1VYAA 3W8PA 1IBMF 2L41A 2KO1A 1X9MA 1KRPA 2HLUA 2CQ2A 2V2ZA 2QMUB 3BQ0A 1RGVA 2FHOB 5SZTA 2FB0A 3I4HX 3CULA 3FFIB 3W63A 2POKA 1Q82T 3RB4A 4Z7YA 2MQQA 5K9FA 1CC7A 2BKOA 1SQGA 4CO3A 1S1XB 4QR0A 2AWZA 4JI6F 2V6AA 4DR5J 3ILJA 3AA9A 3DRSB 4WXWA 4NX9A 4PABA 1S7HA 3THVA 1OO0B 3IRXA 2WBRA 3AXKA 2E5HA 2E7XA 1SQFA 3QNWB 2AGOA 1FERA 3CMAS 5J2NA 4QWCA 2XS5A 3BO3A 2EWHA 2IMOA 4U96A 2XZDB 5KT3A 3QT6A 1U26A 1FKAF 3UCZP 5B08A 5L46A 2DNLA 3DLEA 3N5FA 2GGPB 3VALA 2UU9F 1YJWS 3KLIB 1UVLA 2V2KA 4RW6A 2LEBA 2CWKA 3CCES 4CH1A 1SH0A 4RW4A 2PI4A 1SJRA 5AXNA 4ZPWR 1U1LA 2YPYA 4EZ9A 3E51A 2ZUGA 1U1MA 3GWCA 4IG0B 1XMQJ 3AD8C 3M2UB 1LK7A 1VBYA 1MWQA 4NA2A 2G0IA 5L8RC 1U8SA 2DHHA 2H51B 1XNRJ 1UFWA 2EXUA 4BBYA 1T05B 1VRTA 4L6V3 3IN5A 5B7WA 3U1NA 3M8RA 4EBEA 4GKKJ 1NKBA 3FSXA 1H2TZ 3CCWA 3ZTRA 5HN0A 4Z7CA 3G82B 4RNNA 3GR0A 1XMBA 2DNRA 2KHDA 3OTBA 2RQ4A 1VRUA 2DNGA 2V9KA 4RNOA 3TAMB 2WBMA 1CQMA 5E3RA 4DFMA 1AT1B 1UVNA 2GC8A 1NK4A 4OZ1A 3ISZA 3DI6B 2C2RA 2XNQA 3EICA 1S77D 3PR4A 3ZTSA 3HPOA 2J6TA 1RT6B 2E44A 4LSLB 1WF0A 3SIPB 4QPXA 1H7XA 2R7WA 3OV7A 3KLFB 3M9OB 1BQNA 1UWBA 5HVHA 3LAKA 5C42A 4PR6A 5KFSA 4QU6A 1OYDA 3W5XA 2V8GA 2M88A 5DDQC 5IC6B 4P74A 3QRRA 5IV4A 3BSCA 5HLFA 1S57A 4F3QA 3SSQA 3RTVA 3CNQP 2V50A 1KQGB 1DLOA 4JV1A 3TO8A 2J8AA 2LDYA 4E8UA 5DRKA 3NRBA 1K1SA 2IRYA 1PYTA 2ZD1A 4ZLJA 5T7LA 3OLBA 4GO7X 3ZTQA 1NRKA 2XQCA 1RWWB 4NI2A 3T1AA 4ZN1A 4KHPF 2ZKTA 1W2BR 3BO4A 2D41A 3ITHA 4IRKA 4KR0B 2FQQB 4O44B 3GIMA 1S4FA 3BYPA 2F8MA 1NO8A 3I5CA 2W9AA 4RW8B 5HROA 3G6VA 1OPIA 1TTHB 2ACYA 1UFKA 2DCLA 3MI7X 3Q83A 4MAKA 1RXOB 4ZVUB 1V5IB 1RWVB 3LF0A 4DR2F 2BX6A 2AIRB 3W1YC 2PI5A 3OR1A 1FKOB 3W5ZA 1JLCB 3D0HE 2FDNA 4LSNB 5A0YB 3D28A 1F5BA 4RJVA 4P73A 3FRZA 2XLJA 3J7Z5 3H5SA 4C97A 2ZOGA 4F4WA 2R7XA 2XMAA 4NE9C 3A4TA 4OMFG 5KG4A 1FD8A 1RWPB 2DISA 2YQ0A 4ZVEA 2NXJA 2M7SA 3JYTB 3AJ1A 4AL5A 3K7RA 3W61A 1HBMA 2BKNA 2UV8A 2XZWA 3VAFA 1TU0B 4KKOB 3R6LB 1VIOA 2QLWA 2NXUA 3TZZA 2YWFA 1RKIA 1Q5YA 3MD1A 1WF1A 4ZLNA 4QIEA 2GHVC 1TUGB 1TP7A 2CIMA 3B4MA 2XLIA 4DF4A 1VDHA 1RHKB 4ZPCA 2NS1B 4RW7B 1U49A 3R27A 3PXGa 2WOMA 4XDCA 2OFHX 3CWJA 4O3QA 5DDRC 2HK3A 2HHWA 2AGQA 4QYRA 3HVAA 2B6AB 2OPSA 4LFAF 2I0XA 1HNZJ 4K4ZA 2J6SA 3LW5C 3QFWA 2G2ZA 2W7PA 2IFXA 2ZBCA 2PEBA 1MN9A 4P2FA 4DL5A 1NK6A 4OI0A 1R3NA 3CD5A 2PMZD 1U0HA 2CQDA 3QRPA 4DR4J 4NZ0A 1FRMA 2GAHC 4I67A 3IRWP 1GMWA 4NLQA 3C14B 1F9EB 1WHXA 2AYEA 3T5JA 2LECA 3N0VA 3SDEB 2IVMA 2ZOMA 4MK9A 3QGPA 2PN6A 2FZKB 2AHOB 4H54A 2LQ8A 3D54A 1VQYA 5AXKA 2I2YA 3J81Y 2IDLA 4JBCA 4V19J 3QIPB 2D1CA 3NOCA 3DOKA 3BN4A 3UPFA 2E7VA 2LQJA 2W9CA 1WHYA 1U1KA 3CJKA 4LRAA 5IT0A 3IWNC 3RZAA 4DS4A 4KJIA 3VAIA 1KEKA 1NHVA 1FDDA 4PWUA 1G3OA 1O51A 5HAOA 1VBKA 3IMQJ 4DCJB 3TZYA 3HK2A 1UWAA 3J81U 1PG5B 3KK3B 4G65A 4X62F 5AJ3F 4DL7A 1FT8A 5JUMA 1GXUA 2ZKUA 3GLJA 4CLUA 4C8MA 1QUPA 4YDDB 4ANEA 1H73A 3UFCX 3DHWC 5E5NA 1LNQA 2J8SA 4QBUA 2L9NA 1OY9A 1U6FA 2WVCA 2UXCF 4EWTA 4ED8A 4FBTA 2D69A 3OL6A 1IKXA 4DSJA 3EM1A 2PO4A 3GYXB 2R7UA 3OL9A 3W7BA 4JOUA 1EAYC 1BWEA 2HHPA 4OI3A 2QL5B 1LV5A 1PYSB 4BLGA 5B0GA 3MTKA 2OI2A 4HDHA 4Q8FA 2WCXA 3QFHA 5DM6Q 3KUHA 3MECA 5HP1A 1A9NB 2QSWA 5IT4A 2VC0A 2VF3A 4DF8A 2O66A 3KWMA 3NBPB 1F6TA 1R8CA 4ED4A 2MZRA 2Q66A 3AY0A 4RUAA 4ZVQB 4ALZA 2I9SA 2LVWA 1S6QB 2VFUA 1VFJA 2XMWA 3CCRS 3C16A 1OY8A 3KMSA 2R7VA 1L3SA 3DCAA 2X1FA 2XSJA 3N01A 4ZJOA 2HNDA 1RTDA 3B54A 1B4SA 4RZRA 3MUVP 4JI0F 4AXIA 1W7WA 4PG8A 2COLA 2WONA 2YQ1A 5G4DA 2DNQA 2QA4G 3A3PB 2ROEA 3ZZ0A 4LF6F 3MR5A 2Y8YA 3D68A 3CXCR 4P52A 4KT0C 2W7AA 3E01A 2O3DA 4NL5A 4DLEA 4RX6A 1Q8LA 1M5PC 4L3KA 4BC7A 3JSMB 2QA2A 2V4QA 2AMCB 2NPFA 3C46A 1OQ3A 3A3NB 1YRXA 2A0FB 2XSFA 2WVBA 4V1Ak 4F3OA 1HBUB 3SYZA 2ASLA 3O44A 5AE3A 2E1MC 1B7YB 3W3SA 3BSNA 3NGTA 3C2PA 1WC6A 4Q7AA 3U02A 2BANB 2H3EB 4B08A 3FMWA 1KN6A 1HMVB 4C8YA 4ELTA 3OVSA 2HBZB 5GAGU 3MD3A 3DYAB 2PFFB 2VA3A 2E1AA 1DTQA 4IFVA 1FK9A 1GNKA 1GQEA 1RHUB 4I2PB 1SPBP 1M1GA 4RL1A 2DNHA 3OFEA 5F9NA 3KHHA 3D7SB 1FCAA 2ZM6J 4QYZK 4GVBB 2ERRA 2XEXA 1BQXA 3E2EA 2DBBA 4A8XA 1UEKA 4ZJQA 1T0TV 1UP1A 2KT5A 5C5JA 4YY3F 3R5AA 2DXFA 4O3OA 3SCKE 4YEAA 3TP2A 4DU7A 3N4WA 4WU2A 4ANCA 4R0EA 4Q5VA 1V3RA 5J1NA 3MMBA 4USTA 1KVKA 1W25A 1TKTB 1KVJA 3TQEA 4X4TA 4UZCA 4WFNQ 1X4GA 2DR7A 3U1MA 2K3IA 3AD7C 3RUBL 4J9RA 1CG2A 4NLPA 5D78A 3K5PA 1UPPA 3NWRA 4FNHA 3ILOA 4UOCA 3RBZA 3AQOA 2F4VJ 3CPWR 3I32A 1KQSR 1XNQF 2MQ8A 1F5AA 2OH2A 3GFXA 3KLHB 2RRNA 2FHJA 3HHLA 2IM0A 5EDWA 2R9LA 4K0KJ 3R5JB 1BY9A 4RUCA 2ZC3A 1Y00A 2QGFB 4PKDB 2R2TA 5GMEA 2HHSA 3EWGA 5FD1A 5F8JA 3VZIA 3MMAA 1HD1A 2MPUA 1I94F 1C1CB 1HQEB 3KK2A 3AH6A 1HBOA 3PYFA 2X1BA 2M4MA 3JTOA 1NAQA 3FBFA 2OPQB 1X5OA 1B0TA 5HSPA 2B0GA 3A13A 3GMGA 1KLMB 2DPJA 4MT1A 4X4OA 5KFWA 2UXDJ 1EKSA 3GYGA 2CJQA 1DARA 1L3TA 1EQMA 4USHA 5BXIA 3VQSA 2HHUA 1VHIA 4N8OA 2HIQA 2KYXA 3KJNB 5ITHA 3CVKA 3G86A 1WEYA 3D6HB 2Z56B 4QIVA 3T9NA 3CCSS 1LEOA 3HJVA 1NZAA 4FDFA 4R8UB 3IA0A 2HFSA 5IWAJ 2XGQA 4E98A 1IBCB 4TU9A 1HD0A 4ECVA 1NDCA 1S9GA 3PX0A 2UUBF 1JKHB 1S1WA 1HNIA 4IR9A 2XS2A 4EEYA 4A8YA 1XNRF 4DL0C 2DR5A 1KLNA 1UTAA 2FVSA 1DTTA 1BMQB 2N4CA 3IR6B 1S9EA 1SB6A 1HYSB 3MXHP 3EGWB 4YUDA 2ZDOA 3MZIA 4FF4A 2HQCA 5DQHA 4OX8A 5DETA 3I0RB 3NNAA 1IKWA 2G13A 1J2VA 3V81A 2EKYA 4PWDB 5E7OB 1CJTA 4KC5A 1XMOF 2DHAA 5LMNJ 2ZWOA 3D6MB 3GJTB 4DV2J 1RT4A 1S99A 1PC4A 1YWXA 4NWBA 4I69A 2VKRA 1S79A 3P8BB 1CULA 5HMWA 3DGVA 4QZVB 1R0AB 4K7QA 2AV5A 5IT9Y 5GAGI 5CA5A 3QAEA 2LDIA 4WU3A 4ECWA 4Y2MA 2AJ0A 3DHXA 1WG5A 4O23A 4JI2J 1WUUA 3HZGA 4DCPB 1YJTA 4KFBA 2PMWA 4WF9Q 2PT0A 3CJ2A 1RTHB 3KUEA 2LQ5A 1BWVA 3QO9A 1D9FA 1G2EA 1S97A 3VAKA 4NLUA 3HULA 1NB7A 1NJYA 3RG6A 3EZ5A 2F9JA 3LP1B 2KN4A 2UUCJ 2C3MA 5EUHA 5IT9U 3ZZUA 5IS2A 3W2WA 1Q86T 2PE8A 5ETKA 2MHNA 1GMVA 3CUNA 4XPEA 2Y8WA 1KQFB 3G4SS 2DVIA 3UDEA 4YR2A 4M5JA 2HGLA 4IQXA 5D3GB 1Y10A 2XMKA 4RO0A 1X4EA 5K8MA 1BXNA 4B17A 2J0WA 1YRTA 4MMOA 3C15A 2HQIA 1WG4A 5DQGA 4URSA 2CQPA 3TA0A 4MKYA 4C0HA 3BQ1A 1LWFB 1DHMA 6AT1B 2VJVA 2RU9A 4JI5J 2JSXA 2DH7A 1RI7A 2H65B 4CRJA 1V6HA 4M95A 1YG0A 1Q95G 5EX3A 3LWLA 1UVJA 2LXFA 4NYZA 4L74A 1JLQA 4ZCIA 4C8LA 2JH3A 4URQU 3HFZB 1N34F 5DGAA 3ZTPA 3QBCA 4UOFA 2Y1RI 1FWKA 2RD5C 3GSDA 3PW4A 3KDNA 3GFYA 3GIJA 4FPIA 5A6PA 4U8YA 1K8AT 2EG2A 1TL1A 4HHHA 4IYQA 2MMYA 2QMWA 2E5LF 5KFGA 3H59A 4MFBA 1N36J 2RDIA 2IYGA 3I5AA 4OI4A 2DNZA 2GA7A 1PGZA 4K5SA 1U7LA 5IM0A 3UW1A 1RQ0A 2MYFA 4TQSA 3BDEA 2MGZA 5JJBA 1TL3B 2B4OA 1Q79A 3S7RA 2OUGA 2Z8QA 3PX4A 1H2UX 1KTQA 5A76A 2E1PA 3UI3A 2HRYA 2RU3A 4PG5A 4DN0A 3HHLC 3UR0A 2AJ4A 2NZCA 2V69A 5F3ZA 2VU5A 1RT2B 3MEEB 5ETOA 3FBCA 3SSRA 1NU4A 2HFZA 4WTYA 1KR4A 4DG1A 1FKPB 3JTNA 3FGVA 2ZHAA 1WTBA 1EJ7L 1J5EF 4TYBA 3RBEA 7AT1B 1EETA 2M8DB 3H4DA 3A8EA 5J2QB 5KFEA 2K2PA 4CO2A 2ZVSA 3TVKA 3DRXA 4B3MF 3NAIA 1E6VB 2CPYA 4F04B 1A7GE 4OHVA 4NCAA 3QYYA 2M8HA 2PMHA 3AD9C 1KBRA 4BWMA 3GIIA 2IRUA 2OJ3A 2WSFC 5MAOA 4OYMA 2C22A 1IUJA 4U9RA 2RQKA 1FFSB 1GMWD 3SZ2A 3HT0A 5A2QY 1QTMA 4D3GA 3NMRA 2YX4A 4X4VA 1MW7A 1GT8A 4OX7A 3DFEA 3NCQA 1M5SA 4EU0A 5KFXA 3MDFA 3K58A 4ID5B 5EX0A 2K06A 3P5BP 2CNNB 1LK5A 1WC0A 3ISNC 2OP5A 2RKIA 4J5OA 2HWIA 5HANA 4P72A 2EFGA 4NXNJ 4KRWA 3D6FB 3H8YA 1CSJA 4FF1A 2DIVA 1TV6B 3DLKA 2HZAA 4DPTA 1U2RA 4JI8F 1P1TA 2DGSA 3OHAA 1MU2B 5A2QU 1JB0C 4X65J 4LBHA 1UPMB 4G1QB 2UV8G 1WEZA 2ADCA 5F0WA 2W9BA 2NQPA 2OAUA 2YNGB 3MPWA 4O0NA 1G4CA 2QFIA 1QD1A 2R7RA 4HACA 1RYSA 4M5HA 4OJ1A 1ZETA 5I3UB 3ELHA 2CDRB 2Z30B 4NLGA 4FP9A 2M52A 2K1RA 2QLBB 3GILA 1GK8A 5LT5A 4ZMMA 4DR7J 4F4YA 2YWKA 5K14A 3DM2B 2BUNA 5A8KB 1HWLA 3CDBA 2QFJA 4I6WA 4GC7A 1GAOA 2MQNA 2QV6A 2WSCC 1NUEA 3CJ3A 2P5VA 5KFBA 3R2CJ 5DS7A 4LRCA 3RW6A 1WNEA 1I5OB 4HT5A 1DJ0A 5KG1A 2A6OA 1T95A 1U2CA 4H4KA 2AD9A 4I2QA 4PEOA 2DHXA 3U27A 5KG3A 2D3UA 4KB7A 4ECXA 3NGKA 2VBWA 3H0PA 3M32A 1ZA1B 5K5MA 4O4RA 3KHLA 4M1KA 3U1LA 4YMEA 1RYRA 2FHMA 1RAHB 2QG9B 3C6UB 2NPIA 3ZNJ1 5HBMB 3G2XA 3MPVA 2V5HG 3MM8A 4M5NA 2IVYA 1Y3JA 2FJWA 1IJFB 3GYNA 1Z4UA 4ZS6A 3A8IA 4O4GA 5EN1A 4CTAA 1ELOA 5A8RA 2HGMA 4LRDA 3M8ZA 2XI2A 3BDPA 1NB2A 1JNZB 2ABYA 4B3SJ 2DIUA 2WZ1A 1IJEB 1B64A 3LPYA 1F9FA 4KAIA 4TY8B 2AYBA 2ZBRA 4O3RA 1ITPA 1M1KT 1WC3A 2XMMA 3K57A 3MMCB 3NEKA 2GVZA 3A8JA 4X2BA 1TK5A 1EX8A 5KT4A 4OLOA 2C2ZB 1TELA 2KJWA 4QIGA 2HFVA 1WD6A 3D6TB 3WX8A 4OL8A 3H90A 1XR5A 3MAAA 2DB1A 3TJ8A 5D4PA 2LKZA 2DGOA 3BH7B 1LQ9A 3DGPB 2CQHA 3IG1A 1V3ZA 1VJWA 3TARA 2VQEF 4QW8A 2JNJA 1PJ5A 1TAQA 1LFWA 2HBRB 2ZJPQ 1X0PA 3OR2A 2CNLB 3S6EA 2BJ7A 1FTRA 4K5RA 2D3ZA 2DXEA 3FSYA 3UVJB 4K4UA 2MLYA 4TYAA 4Y2IA 2XHWA 4OYWA 4K0KF 4NZ6A 4PUOA 1N5TA 2KZMA 3D66A 1VQ4S 1FA0A 3SBMA 2JEIA 5DG9A 2WVEA 2DD8S 4KV8B 4I4BA 2NUUG 3T1HF 4OZ3A 2RHQB 2VONA 3M6VA 1VQMS 2R3VA 2GHWA 2D3O1 1FNXH 2B43A 1HQUB 2W4PA 2P9EA 1IKVA 3PNIA 4RWXA 4DV7J 1SJ1A 2RJZA 2Y9HA 3NAHA 4HI2A 3KK1B 3N6LA 4I68A 2FJDB 4QYZJ 3CMES 2QLFB 1R8BA 1MN7A 1R0CB 2GAGC 3BBBA 2FGCA 3NGSA 3NOGA 2FHJD 3HP6A 4ZP8A 2YKMA 3HHLD 1KOOA 5LSOA 1DY3A 1JLAB 2CPZA 4IR1A 4UQTA 2XCAA 3KLEB 1H38A 4NYPA 4G1PA 5C2GA 2DY1A 5A8WA 3AJDA 4FF2A 3H7HB 4AT1B 3CCVS 4L73A 1JIHA 4I0WA 4WCEQ 4C0OC 5D15A 2VBXA 2OEMA 5E3AA 1FE0A 2W1BA 2CKWA 2JC0A 2YXLA 4DV1F 1VBXA 5JXSA 2GVDA 4OFZA 2VL1A 1GX6A 2BABA 2QE5A 4N8NA 1HNXJ 4F4ZA 4OI6A 1FRIA 2YNHB 5EHHA 3D67A 1G6BA 1BQMA 1NSAA 4QWDA 1JXLA 3KG0A 1U0SA 4DHVA 3Q8VA 4CYUB 2ZE2A 4DJBA 1XJWB 1NZ8A 5D4LA 1HR0J 1QAIA 2A2CA 2MZJA 1YZ6A 2KXHA 3NMAA 3MM9B 1C1BA 2BA9A 4KSEB 3L7PA 1T02A 3NY0A 2J76E 1T3OA 1FJCA 2R8HA 1R6VA 1KONA 4P75A 2ZH5A 2KI2A 4DV2F 3ISND 4ECQA 4FS2A 3LWMA 3DRRB 3L09A 3EUNA 1X9WA 2Q6BA 2JLGA 1HLWA 3MR6A 1LFPA 4WZMA 4DS5A 3U7JA 2QLXA 1AZSA 2IYIA 1O8BA 1L3UA 1SC3B 1B0VA 3PM9A 1PJ6A 3V2UC 2G9OA 4BHQA 1KWMA 2HAIA 2WB1D 1RTJB 2I1RA 1BE4A 2DH8A 3JQJA 2EK6A 5L38A 1VK8A 1XIQA 3MM6A 4WXOA 1REVA 1C0TB 2ZH6A 2HWHA 2GIQA 2X1GA 1YJNS 3OFHA 1U48A 3W60A 3IS9A 2EC2A 3M30B 4OX9F 4WFXA 3OSNA 1XTZA 1NK9A 4FPRA 2LXUA 4DL4A 3OJSA 2B8PA 2QX0A 3I6PA 1WDDA 4A48A 1NHUA 2ATLA 2ZDPA 4AQYF 3PIOQ 2XY5A 3IR5B 5CAAA 1TMMA 3Q22A 4GC6A 1VMBA 3VVUA 2HMIA 4WWSA 2CADA 4ETXA 3IAM9 1J5OB 4H4OB 2J9DE 2RIJA 3TUJC 4RNMA 3E3XA 4PWWA 4DX7A 2MKJA 2F63A 2ZFHA 1O6XA 2ASYA 3BKUA 4DDFA 1XWLA 2V8VA 2DGVA 3RU0A 1S6OA 2VICA 3KJQB 1C0UA 3MGJA 1Q53A 4YDXA 1SKUB 2HZVA 3V6DB 4DSFA 3HVRA 3M2RA 1N6QA 4GO5X 4NLOA 4O0IA 1L3KA 2J9CA 1QVFR 5JMNA 4L3NA 3RAXA 2RF2A 2C3UA 3A1YG 1X7VA 1U1NA 2CJKA 2H48B 2Z58B 2VD3A 3QPIA 3MEGA 4RBVA 2BE2A 4CWBA 2Z4PA 5E0OA 2ASDA 3KG4A 3IXQA 2RT3A 3I87A 4BCAA 1LWXA 1SC4B 3OUYB 2KT3A 2UVWA 3G6YA 1HNWF 5D6GA 4LF4J 1T7PA 3CJQA 5CXTA 1FD2A 1GTEA 2FLNA 4X4NA 1CJVA 2W2OP 1EARA 2N7CA 3GZ7A 2I5JB 3X3UA 4DQRA 3V6HA 2BW7A 4TLRA 3TWZA 2MEWA 2JC1A 4DU8A 4RWWA 2JL9A 4IG3A 4DV3J 5A6WA 1ZTTA 4A8MP 2BACA 4RU2A 1AW0A 3FEYB 2UUAJ 1HPZA 1D9DA 3CB4A 1R7IA 1JQGA 1K9MT 1TL7A 4DUZJ 1LWCB 3K2YA 4C3KA 1K73T 2M70A 1DQ8A 2AQ4A 4R25A 4C7QA 1KKHA 3OHBA 2FVCA 1EP4A 4ECYA 4NMLA 2HAFA 2VB6A 1RE1B 4USMA 3UNGC 2XS7A 2M9KA 4ED1A 4PYAA 2EI5A 1Y0HA 1IR1A 3HVWA 2W01A 4ZP7A 1AYEA 3HXMA 2NR0A 2J9EA 2C3OA 4WP8A 2JLEA 3KLGB 2O5DA 3AFGA 3O1LA 5KFZA 5KFRA 5DDOC 4USKA 1N32J 3MM7A 3RJMB 3VTIA 1KC8T 3M1VB 2CUYA 1TZ0A 4NRUA 4OZJA 2BQRA 5HQLA 1WHWA 3I82A 2RB7A 1NCLA 1SKSA 2V2VA 1JLFB 3LPEA 1XK8A 4YN3B 2RS8A 3IS9B 1WKLA 2I8EA 2QYCA 3OFFA 2CPFA 3PY8A 5KFJA 1R8HA 2X7IA 3QIDA 2VV5A 1AUSL 3KJVB 3WIVA 4M8LA 4NMXA 4CLLA 4PPDA 1RISA 3RB0A 4ZN3A 4F4XA 2MZ1A 3GJQB 1UJ5A 4CT8A 3W65A 2HNYA 3TYTA 4Y2AA 3DLBA 3L9ZA 2IC3A 1JLBA 1ZZFA 3NS7B 3TAQA 3M8PB 5E41A 1WACA 3J80Y 1D0EA 2QYGA 2Q43A 1HI8A 4ZCKA 4KYZA 1PO6A 4PQUA 2R7TA 4X65F 4M5DA 5LL6d 1NH8A 2C28A 3MURP 3JB9k 5ETLA 1AFJA 3VAHA 2ZJQQ 1NPKA 1QDUB 1X31C 3VHQA 3CJTA 3LANA 3LGHA 4F7VA 1RABB 2EBGA 4PCQA 1TKZA 3EPGA 1VLOA 2MJNA 2KB2A 4UW2A 4FNIA 3TJ9A 3DU6A 3FCWA 3R1HA 3TVZA 4QU7A 2B5JA 1B7FA 1PAUB 3J80U 2PGCA 4H4MA 3V4IB 2UUTA 4M5LA 3QLHA 4TN2A 1N33J 3D9BA 2C1EB 4DFKA 4DR7F 3D1OA 5GAHU 1SV5A 4DV4F 3C6TB 3EZOA 4M94A 2HHQA 5KFIA 1MSWD 3PHTA 4ITSA 2VG5A 4W90B 3R5BA 4KE5A 1WF2A 1RAIB 1VGYA 3O3LA 3HVTA 1Y7PA 3T1YJ 1JXVA 4LFBJ 4V19X 4J9QA 1SXLA 3EGNA 2VG7B 5B0BA 1T9YA 2VG6B 2QJ3A 1B99A 4OYOA 4DLGA 3CT9A 5CD4H 2YNFB 1VC0A 5C24A 1Q7LB 3T5HA 2HRUA 2HLTA 3M2VA 2AP6A 2XY6A 5FLXY 3Q8PB 4LVOP 4UZBA 1DURA 2R7SA 4WFBQ 3OFGA 3K5MA 1QTNB 5AE1A 4ES2A 4F02A 5FJ4A 3SQGB 2XULA 5LSLA 3RR8A 3DMJB 2XY7A 2DITA 2ZEJA 4PAAA 3CMQA 1RDRA 3ET6B 3PRVA 3DN9A 4WE1A 1P27B 3SCLE 4CDIA 4JYAF 1NHKL 1JLEA 3BPSP 1K0VA 2OD6A 4NCGA 3KNAA 4ILLA 2I38A 4DR3F 1QE1A 2L9WA 3C8YA 2U1AA 5HJXA 2ZH3A 2VFTA 4AL7A 3GV5B 1T9TA 1DFDA 4ERDA 4DR6F 2NYHA 5L9XA 2JVOA 4DPXA 1QM9A 3QT7A 1CPZA 2NSCA 4XAKA 4Y6IA 4QR1A 2CQGA 2HHHF 2AEMA 5CYMB 2FHKA 2AYGA 4NZ7A 2D7SA 4CI0B 4DV5J 4CCHA 4JI3F 4B3OA 2VODA 3WQPA 2FZCB 1KNZA 2HNZB 3JQKA 4DMZA 4X84A 3J7ZT 3W9IA 4TU8A 4LUBA 2WTFA 1ICEB 1FEHA 1XBWA 4C11A 1TL4A 1TFYA 1YK9A 2NCKL 3SFUA 1IBKJ 3Q24A 4O3PA 5H9EK 1N48A 3DOLA 1RT7B 2A3JA 1JK9B 2G4BA 1U1OA 4NLTA 1PBAA 1MWYA 3UQSA 3SMZA 2VASA 4JP8A 1QUVA 3UDLA 4DUYJ 4TU7A 1CJKA 1FJEB 3B78A 4AFFA 3BSOA 3TNVA 3NNCA 5ETSA 3I56S 4QR2A 4Q2MA 2GIRA 3R3TA 1VR6A 1UCNA 1TFWA 1HBNA 3ZXWA 3UD3P 4CH7A 4WFZA 5LMUF 2GX8A 1VI7A 2J7KA 3WDOA 4DV7F 2UZAA 4JI1J 1NK5A 4ED5A 1RT3B 1E6YA 4Q0BA 1S12A 3QGHA 4LIRA 1RCOB 3VGUA 2GFFA 4K50A 1FNOA 4LR8A 4J91A 2KXNB 3EVOA 2MKKA 4FXVA 4CO4A 4JI4J 4P2MA 3LGMA 3FDSA 1X9SA 3DU5A 1R43A 3MR2A 3IR7B 1HW8A 3R8YA 1UEUA 3W64A 1YI2S 3BKTA 2OSRA 3QZ8A 3FCVA 4U8VA 5GAHI 2CWXA 3LP0B 4EBDA 5FDLB 1RB0A 2RH3A 2OPRA 4R0JA 4I56A 3N28A 1H98A 4DSKA 3TA1A 1S6PB 5B09A 1M5VC 2JFDA 4IFYB 3BH6B 2GQ2A 3QATA 3HHNB 5B0CA 3I31A 1TKXB 1LW0B 4NLVA 4X66F 1WSVA 3G71S 3L7OA 1RJJA 3OLAA 1N5SA 3FBBA 3FKBA 3PRDA 1PYOB 1HL6A 5C2CA 3ZFVA 3ICLA 1IBMJ 4GRSA 3OL7A 2QA4S 3S01A 1APSA 2FZGB 3FJ2A 2CJYB 1S1UA 5J2MA 1S9FA 1R31A 2F3JA 1Q7YT 5I3PA 1RADB 4JI7J 3DC2A 1KHWA 4WTOB 4IDKB 1UFLA 3GJSB 4HL9A 1WKJA 4LSZB 4DV0F 1JMTA 4N76A 2EFOA 5KFLA 4JI6J 1NK7A 1Y5IB 2LFVA 2QSFA 4OV6A 5KFVA 3OTEA 1RTIA 3AQPA 2GMLA 5J1EB 1S1TB 1TVRA 1S7IA 3AODA 4F4AA 3LH2S 2V4RA 2J7WA 3Q86A 2YKNB 2RRAA 1X5PA 1FESA 5K8OA 5J2PB 3A3OB 1RAEB 2BJ3A 2LCWA 4UQGA 2YNIA 1ZM4A 4PPZA 3MPUB 4KPCA 2MY7A 2GO9A 5I42B 3JXOA 4IOCQ 1D8YA 2ZBPA 3QJJA 1CJUB 2B56A 4KGZB 3HZEA 3MEDB 4M5IA 2UU9J 2HIYA 2MZTA 3HHDA 3R97A 2FIUA 2AZ3A 2PFDA 3RR7A 5HJYA 1WHVA 4XPCA 3US5A 1U8WA 2HS3A 1P8GA 3Q8QB 4RKUC 5L39A 4C4WA 2QT7A 4RW9A 4OJGA 4X64J 2JJ4D 2IAJA 1IKYA 2JEGA 5CYQA 1SIWB 2ROPA 1RA6A 4GMKA 5IXUA 2DKOB 2CAJA 2WHOA 3AOCA 2VKZG 4WBFA 3J7YU 3TX8A 1I3OB 3C19A 3DLGA 2E9ZA 3CO0P 2L9DA 1WOSA 1F2GA 1FNMA 2UXBF 2PDAA 3L3CA 4U95A 4KO0A 1X4DA 4JV5F 1S76D 2GMHA 3NNHA 3MUTP 4KTQA 4DV6F 1S0OA 4OYAA 4RBTA 3IRXB 3EE3A 3TVYA 2ZH8A 3KHGA 1YITS 2C42A 2QA1A 2YX1A 4LF8F 1RK8A 1RT1A 1N5YA 2KJVA 1Q5VA 1E6YB 4FXWA 2JX2A 5K20B 5J2NB 4K4WA 4WJBA 4USWA 1RKJA 4KGXB 1S0MA 2V67A 3L7UA 3NP5A 3IWLA 1ZBTA 4ZPVR 1AB8A 4A8SA 4E2FB 4MJKA 1PCAA 1PJ7A 4Y2CA 3DLEB 2LMIA 4C6AA 4FXDA 2VQFF 4RW6B 3THPA 4RW4B 4USUA 3EDRB 2DPIA 1HI1A 3PW0A 2D3OR 2YKQA 2VDIA 3OQ2A 4G6VB 2M2BA 2AEJA 3NWGA 2XMTA 2DNPA 1T9UA 1NKEA 1TR0A 5F3TA 2R2SA 3SEOA 5C25A 5THWA 2HBQB 4NPOA 2YVSA 2XB2D 4KHPJ 2IJNA 5H9FK 4WIIA 2P2CB 5KT7A 2W2QP 1VRTB 3B82A 4OI1A 3HSDA 4YHHF 4ZK7M 3FQKA 3ZTOA 3DRPA 1D3WA 5J2MB 1MROA 1VISA 2ALYB 4F4KA 2FGOA 1VRUB 2VFRA 3RB6A 1GEHA 2V4JA 2F1FA 4YQWA 3I55S 3CC4S 2YBVA 3W8GA 2O1PA 2EFVA 1SKWA 2G2OA 3D2WA 3GFHA 3IP0A 4DR2J 1KS2A 5D0GA 4OIXA 2BJ1A 2K8GA 3A12A 2FJVA 2MLXA 2V63A 4L72B 1FWPA 1IXKA 1VQ6S 5HO4A 1LW2A 3UN2A 2ZNZA 4LF9F 2OELA 4F26A 4W92B 1BQNB 3PYEA 5BYSA 1UWBB 1JLGA 5C42B 4P7TA 2MQMA 2B9YA 3DOMA 1CVJA 5CQGA 3W2VA 4A8WA 1R8AA 5HLFB 5DLFA 2QRRA 1IBLF 3B4DA 1DLOB 3BGRA 4I7FA 4LF7F 2EG1A 3TA2A 1VIXA 3V5RA 2ZD1B 3M8QA 5T7LB 4M5GA 4IO9Q 2DNKA 4K8RA 1S1VA 5LM7E 3CDWA 4ZDNA 4NI2B 1T03A 1VK3A 1LOUA 1Y5NB 3ITHB 2HQFA 1FVSA 5KFDA 4ZHRA 2CG4A 4Y3CA 4OI2A 2UP1A 4ZCLA 4LFAJ 1FXDA 2F9DA 1YDLA 2E7WA 3G8QA 5HROB 4OYZA 2NLWA 4O3NA 1P6TA 3EGZA 3BJYA 2H4WB 4LF5F 2DGTA 1S48A 2IM3A 1WOPA 3GSIA 4HKQA 1QSLA 2BM0A 3L4BC 1CEZA 1HNVA 4B9LA 1ACMB 2IA0A 2XTJP 3OR1B 4R5PA 1LWEA 1X8DA 4ZITA 1SUQA 3J7YI 4B9NA 2P9CA 1UAWA 3BO2A 3MM5A 1FXRA 2KHCA 5HI7A 1REGX 2AX1A 3V4MA 3MOZA 4MK8A 2DR9A 1XEZA 1RWOB 2ASJA 1QY7A 2U2FA 4F0KA 4ANDA 5F41A 1NPPA 5IOLA 1IQZA 4IO1A 2XCPA 1HBMB 2E9TA 3FBEA 1DZ5A 3GV7B 1YSJA 1QSSA 2Z2LA 4MIWA 2PSZA 3UD5A 4J9UE 3T1YF 1WEXA 4B3TF 2DR8A 3WX4A 1RSCA 1YBUA 4JUZA 3M05A 3UD4P 2ZWPA 5BYRA 2UUWA 2FY1A 3Q8SB 4FBUA 2OFGX 4DX8H 1UEVA 1PBUA 4IUFA 2N4DA 2XMVA 2MJUA 4URGA 2WOMB 3LP2A 3R2DJ 4X62J 5AJ3J 2XBPA 1J27A 2OPSB 2JHEA 3Q2TC 4PXCA 5IZHA 3ETMA 4PYDA 2FJAB 1D1UA 4ZOSA 2C2MB 5ETVA 2CG8A 2M3DA 2DYAA 2ATCB 2UXCJ 2CPIA 1FE4A 3FFIA 1UVKA 1U0HB 5ETPA 4YB5A 4ES1A 4ED7A 4C8KA 1ZTWA 4IOBA 2NYIA 3I9V9 2KYZA 1S1XA 2LQ9A 4TQRA 4ZPAA 2KH9A 1DAXA 3HF5A 2CQBA 1M5OC 1MMLA 1FHTA 2VOOA 9RUBA 5ETRA 3DRSA 1B3TA 1N88A 2HYIB 2BDPA 1FEEA 3AOAA 1FRJA 1FX2A 2F4FA 3T5LA 4ED0A 4XDDA 4EGLA 4DSLA 2FC9A 3DOKB 4MKAA 1OSDA 2XM3A 1NLKL 4GKJF 4ZLLA 5LOQA 1NM2A 1DQAA 1OIAA 4EUVA 1NBEB 1EIYB 2W9CB 3CJKB 2GGPA 4HVZA 2IM1A 2QTWA 1WWHA 3KLIA 2XGPA 3OVAA 2V8DA 4JI0J 2HEKA 3ENWA 3PKYA 2FVRA 2NUHA 3EYZA 1TMJA 3P49B 3EDQB 3IFEA 4ZLPA 1PAEX 4QWBA 4X4QA 4LVNP 1M90T 4ZVRB 4IG0A 4F8RA 4PG7A 3BKFA 4LF6J 2MDAA 3M2UA 2FTRA 4XK8C 3THTA 2FVPA 2W25A 3PCOB 1YJVA 2E5IA 3ZZZA 4Y00A 3CCJS 2BKPA 4DQQA 2BQ3A 2CQ4A 3BBCA 3BV8A 3CJ5A 1T05A 1ZAVA 5F8IA 4CLYA 1IR2A 3O8WA 1IKXB 3ENQA 2RSQA 4IRCA 4LR9A 4XTTA 3G82A 3W5YA 1M0SA 2Q1LA 4OZ2A 1VQ5S 2GNKA 2EFPA 5KFHA 3WHIA 4C3MA 2ZNYA 2AF6A 4DR5F 1NKCA 3TAMA 2H5JB 4WK1A 3BR8A 1FO1A 3MECB 2W2NP 5F8NA 5HP1B 3S1TA 3OTOJ 1GXLA 2XYPB 3MR7A 3DI6A 4NLXA 3NGRA 4JI1F 1H6KX 2O67A 5KOWA 2BJ8A 2YPZA 1YHQS 3LTOA 3I4PA 1RT6A 2ZOFA 3MOJB 4LSLA 3NG8A 3KLFA 1BLUA 3C16B 2RMLA 1U4BA 2KM8B 2WB4A 1UL3A 4CLKA 1R6YA 2XSJB 2HNDB 1RTDB 4Z37A 3OD2A 4PRFA 1X60A 2V68A 4QQBA 1WC4A 5E2QA 1NSPA 3T3FA 2WONB 4YY3J 1U6BA 3NS5A 5L9NA 1XMQF 3G87A 1HWUA 2JEJA 4L76A 2HZCA 1Y5LB 1OMSA 3M4XA 1JJHA 3E01B 5H9EJ 1OY6A 1X5TA 5I4MA 4WFAQ 3MWBA 4A8FA 1RWMB 2CVEA 2LA6A 1Q81T 2ZBIA 3M8YA 5CD4A 5KOXA 4O44A 1Y9OA 3OSPA 4GKKF 3LQVA 2D9OA 1XNQJ 2BE7D 4RW8A 4NLWA 2IM2A 4ES3A 1ZPWX 4DSIA 3KFWX 2J0SD 4JI7F 2ZBQA 3CCQS 2QZ8A 4QWEA 4AE5A 5T41A 4ZVPB 2NXEA 1FTCA 1FFGB 3NS6A 3O2IA 5DG7A 3CD7A 5SUHA 3QWUA 1OQ6A 3J81j 3AB2B 1FKOA 1N56A 1WSRA 1JLCA 1XN9A 4LSNA 4UUXA 5A0YA 1YJ9S 1FRHA 2GQCA 1I94J 2C3YA 4QOTA 3HHEA 1DTQB 2H9ZA 3ZC4A 2HQ3A 4IFVB 5K8PA 2ZH7A 1FK9B 2YWWA 4EBCA 3MAHA 3TX0A 4DQIA 3ETOA 3JYTA 2NXCA 1X4BA 2OEJA 2E1CA 2G0CA 4DEZA 4YP3A 5B0DA 4LQ3A 4Z2XA 3JSRA 2HHVA 4DL3A 2CFXA 4KKOA 3GG1A 1TL5A 2E29A 3CD0A 4ECTA 3CJ4A 3R7BB 2HKEA 4F2SA 1N52B 3VZHA 3MMBB 4UY85 2RILA 1F5CA 3DDIA 1B0PA 3UN3A 3PRBA 5BR8J 2O01C 1TAUA 4X64F 4RW7A 2DGWA 3CCZA 1M5HA 3CJ8A 3Q2SC 2UUBJ 2Q6CA 3V6KA 1SH3A 4IOAQ 3RBDA 2B6AA 3HX9A 3H2VE 4F0MA 2MZSA 4LF2A 1VLYA 3DRYA 2RUGA 1YX2A 4FF3A 2FC8A 4DQPA 2Z0GA 5KG7A 2V2QA 3HHLB 2ZITA 3WIUA 1N0UA 3GCXP 4EO8A 3AJ2A 2MKCA 4WIQA 2AJ2A 4ED3A 4OYIA 3SCJE 1JNRB 5M2RA 3VWSA 1S49A 3EGVA 3C14A 1Y11A 4FS1A 4MKBA 3MMAB 3HM9A 2QO3A 1T11A 4BS2A 1FRLA 4HYKA 3TEGA 3SDEA 3ZO7A 2GIFA 3KK2B 4B3RJ 1HBOB 1F3VA 3D0GE 1XMOJ 1HKAA 1FDAA 1NSQA 2FJXA 1RLCL 4L75A 3ADAC 4A8QA 3FEXB 3VF0B 2OGUA 3PEJA 1CQNA 2ZH4A 1FDNA 3WC2A 3H25A 5KFFA 2A6MA 3BN7A 3EJMA 3QIPA 1OWXA 3BYRA 4FYVB 2WW4A 1YJ7A 2KU7A 3WZ0A 4CO1A 1S10A 5F8GA 3LOUA 1URRA 4NA3A 4CLPA 5DLGA 2H5IB 1N5VA 4F25A 1DBDA 4C9DA 3Q89A 4U7UK 3CEDA 2K7KA 3HLUA 3IBCB 4LF1A 2KXFA 1BGXT 2NSBA 3R1LA 1S9GB 4X4PA 1S1WB 3KK3A 2OTLS 1HNIB 1HNZF 1QLNA 2ALZA 3PJXA 2HG4A 1DTTB 1A6LA 1S9EB 2HS4A 2RHSB 3K0JA 1ROFA 1HHSA 2XO6A 2BRKA 3GG0A 3PFOA 4DR4F 2PD1A 3I96A 2R2RA 5J1PA 1WG1A 3OXLA 1ZPVA 3CCMS 3VAMA 9ATCB 3ZZOA 1IR0A 2KFZA 1HWJA 3FZBA 1IKWB 4ILMA 5F8MA 3FUYA 3V81B 5AXMA 2C2KB 4Q44A 1RCXB 1CJTB 3G8SA 2VIHA 5KFCA 3IBWA 2J5AA 1RAAB 4PQAA 4MH8A 1RT4B 3NBPA 2HFOA 5LJ5Y 3PW2A 2MSTA 1CULB 1HHTP 3MTJA 2JOQA 2R7OA 1NSKL 2OPPA 1S6QA 4F67A 3EZUA 2AW0A 3QT8A 2NREA 4Y0FA 3UR3C 4W98A 5ADZA 3IO1A 2YWHA 4U7UD 3DLHA 2RUSA 3OL8A 1N34J 2DHGA 2VBYA 5CH7B 5KG2A 3PJ9A 1SKRA 2AU0A 4KFBB 5KFOA 4P71A 4CLWA 3NLCA 1BUXA 1F2HA 3QO9B 5HQ8A 4NA1A 4TNOA 4KGVB 3Q0AA 5L1LA 2XMUA 4J9OA 3MF5A 2JFKA 1S6UA 4WFYA 4C48A 1IQTA 2E5LJ 1QAJA 5H9FJ 7FD1A 1PKUA 5F8HA 3JSMA 1MMDA 3W2WB 2ADBA 4HLBA 5E3QA 4BWJA 1WDTA 3P45B 2XWXA 4DSEA 3D1QA 4NLRA 2DO4A 1IN0A 4DZ6A 3MAQA 2CZ9A 3OPKA 5KFMA 2UVVA 1HBUA 2QLJB 4Y65A 3BGUA 4M5MA 1Z1ZA 4EK2A 2CQCA 1R89A 3KLVA 2BRLA 4I1TA 5AT1B 2BANA 4BDPA 3C15B 4OLPA 2BBEA 4USIA 2JZ5A 2SXLA 2F8HA 3QJLA 1HMVA 3SV3A 4EO6A 5E33A 4LT6A 5M2UA 4ECUA 5KG5A 1NPRA 2BZ2A 3DYAA 1HQ2A 3CD6S 2JRSA 4LMZA 2MKSA 1J5EJ 3PO5A 1WI8A 4HHUA 3NL0A 4HT7A 3AXMA 1Z2LA 3PIPQ 2AZ1A 1JLQB 3TQ1A 4I2PA 5AE2A 4B9UA 3ZZRA 2HWTA 2KFNA 3SXLA 2DNYA 5DJBA 3P3DA 2AJFE 2KVIA 2Q3PA 4B3MJ 4GVBA 4F36A 2PA8D 2B51A 2UVRA 2M5YA 1NJZA 2FUG9 3HJFA 1EB0A 2B9WA 2CNKB 4NASA 1TL1B 1XR6A 1RAJA 4FYYB 4P2SA 1VQLS 5EWFA 4RU9A 1TKTA 3JSYA 4MFBB 4A46A 4HEA9 3K5NA 5DO2A 1WJ9A 5DM7Q 2A18A 3R6GB 1WTFA 5IM0B 3PX6A 4ILRA 3ZZPA 5C7PA 2LYVA 2MGZB 4MTPA 2YKOA 2IBOA 4K2JA 2R8JA 3H5XA 3KLHA 3NGDA 2DGQA 3HD2A 1YIJS 1JJCB 1RAGB 2ZH9A 4OHYA 4ELUA 4JI8J 2KG0A 2V0NA 1HI0P 2VJUA 2K7JA 3T41A 3GIRA 1SCJB 4ECSA 2ZJRQ 2BJDA 2KT2A 1I6JA 1PC5A 2XHCA 3Q8YA 3R7SB 1FVQA 4DG1B 3DXBA 2G1HA 3HKZD 1C1CA 1HQEA 4C3LA 2AJ1A 3MCMA 3LALA 3D3CJ 3I0SA 2IVFB 1NK0A 1EETB 3DDKA 2OPQA 2VHGA 4IH7A 5E3PA 1SC6A 3BM7A 1VOMA 1KLMA 2YWGA 1OYEA 3MEKA 2B9EA 3GB0A 1HARA 3W62A 2NZ4A 2OPPB 1NDPA 2ZM6F 4B9TA
chains in the Genus database with same CATH topology
1KQFB 1VQNS 2JFDA 3G4SS 2LEAA 4IFYB 2DVIA 2GQ2A 3HHNB 1T94A 4A8KA 2WK4A 4YR2A 4OQJA 5B0CA 4OZ5A 4U67Q 2B7CB 3TAPA 3I31A 1TKXB 2HGLA 3HHKA 1NEEA 3CCTA 1LW0B 1ZAXA 4IQXA 4NLVA 4X66F 3CSKA 3G71S 5D3GB 4WKRA 3L7OA 2XMKA 2QMXA 3CIMA 1RJJA 3R5DA 3T19A 1RT1B 3OLAA 2EC0A 1N5YB 1N5SA 2W8KA 1X4EA 3PRDA 3F41A 3NCPA 4ZP9A 1N33F 5K8MA 1KVIA 1HL6A 4G3IA 4B17A 2J0WA 3ZFVA 4TLQA 1YRTA 3ICLA 3BGFA 4MMOA 4R8UA 4ZVGA 5F9LA 1UMJA 4AL6A 3DXSX 4Q8EA 2HQIA 4WK3A 2FVQA 1WG4A 3M6WA 5DQGA 3OL7A 4URSA 3VAJA 2CQPA 3TA0A 1G1XA 2QA4S 4MKYA 2CZVC 3S01A 4C0HA 1APSA 2IA6A 3BQ1A 3FJ2A 4N47A 1LWFB 1DHMA 1VQ8S 1S1UA 2RVJA 5J2MA 5CYMA 3PO4A 1FJ7A 2RU9A 2CPEA 1S9FA 1VQSA 1R31A 2F3JA 4B9SA 5F8LA 1Q7YT 5I3PA 1NJWA 2JSXA 1JKHA 2DH7A 1RI7A 2F4VF 2HPUA 4OJ3A 2J9DA 3SCIE 1V6HA 5KFPA 3DC2A 1KHWA 4CO5A 2H5EA 3FZ2A 2DK2A 4LFBF 3CC7S 4M95A 1YG0A 4IDKB 1UFLA 5EX3A 2RKIB 3GIKA 3LWLA 1U1RA 1UVJA 2HNZA 2J6UA 4DWIA 1TQLA 4HL9A 2LXFA 2XO7A 4NYZA 4DV0F 1JLQA 3CGIA 4ZCIA 4U7CA 1X5SA 1JMTA 4N76A 2EFOA 2JH3A 3DLKB 5KFLA 4C8LA 1HYSA 5L1JA 1NK7A 4URQU 1PILA 4KIAA 2DGXA 4I6YA 2VOPA 4QIFA 3PEHA 1N34F 1Y5IB 5GVQA 1ZYQA 2QSFA 5DGAA 4WYLA 4I6AA 4OHZA 4OHXA 1VQOS 5KFVA 3OTEA 1RTIA 2Y1RI 3AQPA 2GMLA 5J1EB 1S1TB 4A47A 2E9RX 1TVRA 3LH2S 2V4RA 2J7WA 5C25B 2EFQA 1X4HA 2YKNB 1SJQA 2Z2MA 2RRAA 2RD5C 3OXFA 3GSDA 1GXTA 3I0RA 3PW4A 3F73A 4HHJA 1X5PA 2IJFA 1K0TA 3GFYA 1FESA 5K8OA 5J2PB 3GIJA 5A6PA 2W9BB 4YFUA 1RT7A 1K8AT 2J0XA 4KHMA 3OTOF 2BJEA 3UWTA 2EG2A 1TL1A 2OIHA 1X4CA 4PWDA 3CO9A 4IYQA 2MMYA 1NNDA 2QMWA 2LCWA 2OTJS 4UQGA 2R8GA 2YNIA 5KFYA 2E5LF 5KFGA 5HMZA 1ZM4A 3DRPB 4PPZA 3H59A 4QIWD 4MFBA 1MROB 2MY7A 2GO9A 2RDIA 5I42B 2IYGA 3I5AA 4OI4A 4QW9A 1WI6A 2DNZA 3ZZYA 2GA7A 2FLOA 2RRBA 1PGZA 4IOCQ 4K5SA 1D8YA 1U7LA 2V4JB 2A10A 2UXDF 5IM0A 3UW1A 5D4OA 3QMQA 4IH6A 3UE2A 2B56A 1R0AA 3QJJA 1RQ0A 2MYFA 3HZEA 3MEDB 4TQSA 3BDEA 4UY8T 2MGZA 3PKMA 5JJBA 1TL3B 2B9XA 2K1RB 2B4OA 2MZTA 3HHDA 1Q79A 3S7RA 2R8IA 4YB6A 1RP5A 2FIUA 2F7VA 1ULRA 1U1QA 4ECRA 2Z8QA 3RR7A 1U47A 2JLFA 3PX4A 1H2UX 1KTQA 5B0AA 5K14B 1WHVA 4XPCA 2DGUA 3US5A 2X51A 2MHEA 2HS3A 1P8GA 1JWWA 3Q8QB 2V94A 2VZ9A 4RKUC 5K8NA 3PJWA 5L39A 2N82B 3UI3A 3FNNA 2HRYA 4C4WA 2QT7A 1YRUA 2RU3A 2N3LA 1AXQA 4RW9A 4OJGA 4EYHB 4PG5A 2ILYA 1SJFA 4DN0A 3HHLC 3UR0A 2AJ4A 1RT3A 2IAJA 2JJ4D 1IKYA 1LW2B 2JEGA 4X4UA 2RQCA 3OVBA 5CYQA 1SIWB 4E0DA 5F3ZA 5D4NA 3GQCA 1RT2B 3MEEB 2ROPA 1RA6A 5IWAF 2YX7A 3SSRA 4GMKA 3H98A 1RTHA 3N6NA 5IXUA 3TUIC 1MNEA 2WHOA 1NU4A 2HFZA 4WTYA 2A2DA 4K59A 2VKZG 4Q43A 1KR4A 2JVRA 4DG1A 1FKPB 3JTNA 2IBKA 3FGVA 1JLGB 2ZHAA 4DL6A 1WTBA 1ZM2A 4DV5F 3POTB 3OTCA 3J7YU 1J5EF 3TX8A 4ID8A 4TYBA 3DLGA 2E9ZA 4LQ9A 3BS9A 3RBEA 3LP1A 5HMYA 1EETA 2L9DA 4I2QB 1F2GA 1FNMA 3W2VB 3M9NB 2UXBF 2PDAA 2Y1IA 5L1KA 4N56A 3L3CA 4WKYA 2M8DB 2YQ3A 3H4DA 3JTPA 5GADU 3A8EA 5J2QB 4KO0A 4J9NA 3B8HA 3UDCA 7FDRA 5KFEA 3PV8A 2K2PA 1KTVA 2P6TA 3BGRB 4A4JA 1X4DA 3LP0A 4JV5F 2CPHA 1Q16B 3M32B 5CCLA 1S76D 5FDLA 4CO2A 2ZVSA 3ENVA 4I7FB 2V9WA 1H0HB 2GMHA 3NNHA 3MUTP 2B4PA 3TVKA 3DRXA 4AYBD 4KTQA 4B3MF 4DV6F 1S6PA 3NAIA 2W8LA 1KSPA 1S0NA 1E6VB 1S0OA 1HW9A 3M8QB 2CPYA 4IFYA 1A7GE 4OHVA 4RBTA 3QYYA 2M8HA 4NCAA 2PMHA 3IRXB 1IBKF 1H3DA 2HFNA 2B4VA 2F40A 1TKXA 1S1VB 4Y2KA 3MM8B 3TVYA 1LW0A 4BWMA 3GIIA 2ZH8A 3KHGA 1YITS 2LU1A 2IRUA 5D3GA 2C42A 1T03B 2OJ3A 4TY9A 2QA1A 2CZ4A 2YX1A 5D8HB 3GR1A 4LF8F 2WSFC 1S0VA 3G9CA 1RK8A 2GHPA 2W7OA 1RT1A 5MAOA 1N5YA 2KJVA 2C22A 3H5UA 1IUJA 1E6YB 1ZM9A 4FXWA 4U9RA 2RQKA 4O4GB 3QAUA 4Q2LA 2JX2A 4MIBA 4ZHRB 4CTAB 4RNFA 1DQ9A 3SZ2A 5J2NB 5A2QY 4K4WA 2MQOA 3M6XA 5LMNF 4KBIA 3KHRA 4WJBA 1QTMA 4D3GA 3NMRA 2K3KA 2YX4A 5A8RB 1RKJA 4X4VA 1MW7A 1GT8A 4OX7A 2YTCA 4M63A 2MKIA 3DFEA 3NCQA 1M5SA 4EU0A 2ILZA 3JAMY 1S0MA 3QZ7A 4DUYF 1LWFA 5KFXA 3MDFA 3K58A 3NP5A 3IWLA 3PW5A 1ZBTA 3TOQA 4ID5B 4ZPVR 5EX0A 1T8EA 5IQQA 2EBEA 3RRGA 4HDGA 4A8SA 4MJKA 4CNYA 4ICLB 3I0SB 4Y2CA 1ZM3A 1LK5A 3DLEB 3ISNC 2DCUB 1HNVB 4XIUA 2LMIA 4WYWA 3MPYA 4FXDA 1VQKS 1AUDA 2OP5A 5U47A 2VQFF 4IDKA 4RW6B 3TUZC 2XWYA 2RKIA 3PHEA 4J5OA 2HWIA 4R5PB 3THPA 1G7CB 1LWEB 5KFKA 2E5GA 2AJQA 4RW4B 2EFGA 3TW0A 4KRWA 1Q4RA 3H8YA 2CQIA 5DDPC 1SUQB 2DPIA 1CSJA 1HI1A 2FPHX 4FF1A 2DIVA 2YH0A 1TV6B 1SH2A 1F60B 2OLWA 3DLKA 3PW0A 3MM5B 1RT5B 2D3OR 2YKQA 1U2RA 4JI8F 3BB5A 3MFIA 4JI2F 3OQ2A 4G6VB 2R4FA 1KHVA 1P1TA 3FMBA 3CJ0A 2M2BA 2HGNA 3NWGA 2DGSA 3OHAA 4WZQA 2XMTA 2DNPA 3I5BA 1SBRA 1NKEA 5J1EA 2MXYA 1MU2B 1S1TA 4C2MA 3IC1A 2BXJA 5CCMA 4DQSA 1JB0C 1GTHA 3T9ZA 1TR0A 2DTJA 5F3TA 2R2SA 4IRDA 4LFCF 3SEOA 5C25A 4G1QB 2YKNA 5THWA 3PACA 1SL2A 2R8KA 2UV8G 1WEZA 3J7A1 2ADCA 4NPOA 4K4YA 2YVSA 5F0WA 2XB2D 5J2PA 2IJNA 2VPZB 2BW2A 4WIIA 5KT7A 2W9BA 4JI4F 1VRTB 3B82A 4OI1A 2LA4A 2NQPA 1V9OA 2OAUA 2YNGB 3IG1B 3IAS9 3MPWA 4YHHF 2HVHA 4ZK7M 3FQKA 5JVHQ 5BR8F 2UUCF 2UVUA 4ZCMA 3DRPA 3DLLQ 4DSKA 1JJ2R 1D3WA 2R7RA 5J2MB 1MROA 1C2PA 1WELA 1RYSA 3NCRA 5I42A 4F4KA 2VUGA 2FGOA 4OJ1A 3BEGB 1ZETA 1VRUB 2CYYA 2VFRA 2EW9A 3OR2B 3RB6A 3MUMP 5I3UB 2V4JA 3HMJG 2F1FA 2QEXS 4YQWA 3I55S 3CC4S 3BQ2A 2O1PA 2EFVA 4NLGA 3MEDA 4FP9A 2HHXA 3CDEA 2MSSA 1SKWA 1C4CA 2M52A 3D2WA 1TL3A 2K1RA 3BSAA 3GFHA 3GILA 1KS2A 1VS3A 4J37A 2VC1A 5LT5A 3K59A 2MY8A 2KKHA 4OIXA 4ZMMA 3K5LA 4F4YA 4DFPA 2YWKA 5K14A 3DM2B 2K8GA 1U6ZA 3MFHA 2BUNA 4NLDA 5A8KB 1HWLA 2VPYB 3CDBA 3FCHA 2QFJA 1SL0A 1Q8BA 1YJUA 2X1AA 4PUOB 4I6WA 4GC7A 1X4AA 2FJVA 4CIOA 1GAOA 1R27B 2MQNA 2ROGA 4RNHA 2QV6A 2OKQA 4L72B 3LP2B 1RWUA 1TK8A 3DLJA 3WBZA 1IXKA 1VQ6S 2WSCC 5HO4A 1IBMF 1LW2A 2L41A 1RT2A 3MEEA 2KO1A 2HHTA 3LUYA 3CJ3A 2MQPA 2P5VA 1K1QA 1X9MA 1KRPA 2ZNZA 2HLUA 4ZPDA 5KFBA 5DS7A 4LF9F 3M9MB 1BD6A 2CQ2A 4DOZA 3RW6A 1U25A 3BQ0A 1RGVA 4JI5F 1WNEA 4F26A 3C3LA 2FHOB 3BZQA 4W92B 5SZTA 4B3RF 4HT5A 1BQNB 1FKPA 5BYSA 1UWBB 2FB0A 1JLGA 2GJ2A 3I4HX 2DNOA 1DJ0A 3LGNA 2RS2A 3CULA 1FF2A 5C42B 5KG1A 4P7TA 1IKVB 1T95A 4F2RA 3RRKA 2MQMA 3FFIB 2B9YA 4H4KA 3R5CA 2AD9A 3DOMA 4PG4A 2POKA 1CVJA 5CQGA 4I2QA 4A8OA 4K4SA 3W2VA 4A8WA 3TANA 1Q82T 3RB4A 1R8AA 5HLFB 1NH7A 1FDBA 2MQQA 5K9FA 1CC7A 5DLFA 2DHXA 3OBIA 2QRRA 3U27A 1W2IA 5KG3A 4CO3A 2HVZA 1MMNA 2D3UA 4KB7A 1S1XB 4ECXA 5J2QA 1IBLF 4QR0A 3NGKA 2CDQA 3B4DA 2VBWA 1DLOB 2AWZA 4JI6F 3BGRA 2BM1A 3M32A 5K5MA 4O4RA 4I7FA 3KHLA 4LF7F 2EG1A 5BYQA 4C8NA 4M1KA 3TA2A 1VIXA 3U1LA 3V5RA 5EGYA 1UETA 1QSYA 4ZVHA 3DDNA 4FVMA 4YMEA 1RYRA 3AA9A 1FXLA 4EZ6A 2YKMB 2FHMA 1E6VA 2ZD1B 3M8QA 3DRSB 4WXWA 5T7LB 4NX9A 1S7HA 3THVA 4CO0A 3C6UB 1OO0B 2E66A 4ELVA 2NPIA 3IRXA 4IO9Q 2DNKA 5HBMB 1S1VA 3MPVA 2V5HG 3MM8A 5IFMA 3CDWA 4ZDNA 1T03A 5KFTA 1VK3A 2R2UA 1LOUA 2WBRA 2E5HA 2IVYA 1Y5NB 2E7XA 1KFSA 1Y3JA 3ITHB 2FJWA 1FVSA 1U2FA 1IJFB 5KFDA 3GYNA 1Z4UA 4ZS6A 5A8WB 2VPWB 2KM8C 2AGOA 4DL2A 1CC8A 1FERA 4O4GA 4ZHRA 5EN1A 4CTAA 2CG4A 3CMAS 1VQPS 5J2NA 4QWCA 4ATNA 2XS5A 3BO3A 1ELOA 2EWHA 2IMOA 4Y3CA 4CQ1A 4OI2A 5KT3A 5A8RA 4ZCLA 2UP1A 1I1GA 2HGMA 1U26A 1FXDA 2XI2A 1N36F 1FKAF 2F9DA 3UCZP 3BDPA 2E7WA 3G8QA 1JNZB 5HROB 2GMJA 5KG0A 2ABYA 2NLWA 5B08A 1N0VC 3H40A 4O3NA 1P6TA 5E3CA 2DIUA 3EGZA 1IJEB 1B64A 3BJYA 4ID5A 4LF5F 2DGTA 3LPYA 4K4VA 2DNLA 1F9FA 1S48A 2IM3A