3ENAA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dgdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
b'LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
molecule tags Transferase
source organism Acanthamoeba polyphaga mimivirus
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3enaA00
3DDIA 3R9LA 4F36A 1NPKA 4ANCA 3ELHA 5IOLA 4UOGA 3FC9A 1F3FA 5BXIA 3ENAA 1HIYA 1NB2A 3ETMA 3NGTA 4C6AA 4HR2A 2VU5A 3VGTA 1BUXA 3ZTSA 3BH6B 3FBEA 3FCWA 4S0MA 3EMTA 1PAEX 1S5ZA 3FKBA 1XQIA 4FKYA 1NUEA 1HHQA 3Q83A 3NGRA 2B8PA 2DY9A 1NHKL 1B4SA 1NDLA 1NCLA 1F6TA 3DKDA 3PJ9A 2DXDA 1S57A 1MN9A 1NSPA 1B99A 1UCNA 3VVTA 4UOHA 1PKUA 4ANEA 3WX8A 4FKXA 5CAAA 1LEOA 3BBFA 4CP5A 2NCKL 1NDCA 3VVUA 3B6BA 3FBCA 1WKKA 2ZUAA 4UOFA 1W7WA 2DXEA 2HURA 1BHNA 3FBFA 2CWKA 3Q8VA 2AZ3A 3VGUA 3EJMA 3FBBA 4W98A 1KDNA 1U8WA 3FCVA 3EVMA 1VYAA 2BX6A 3B54A 3EVWA 4ANDA 3GPAA 1WKLA 1NSQA 4WBFA 2DYAA 3ZTPA 4DI6A 1EHWA 2BEFA 3VGVA 5CABA 3EE3A 3G2XA 3EM1A 3Q89A 3VGSA 3ZTOA 1S59A 3JS9A 1NDPA 3EICA 3L7UA 1LWXA 1NDKA 3BBBA 1BE4A 3NGUA 3BBCA 3ZTQA 1HLWA 4O0NA 2HVDA 3MPDA 4F4AA 1NSKL 3BH7B 4ENOA 3NGSA 2AZ1A 2DXFA 1K44A 1ZS6A 3PRVA 3Q8UA 3Q8YA 1XIQA 4EK2A 5C7PA 4DZ6A 1JXVA 1MN7A 2HVEA 2B8QA 4DUTA 3EVOA 1NLKL 3ZTRA 3GP9A 3Q86A 4KPCA 1WKJA
chains in the Genus database with same CATH superfamily
1Y3KA 2LA6A 2V5HG 2HFZA 4OQJA 4ANCA 3I56S 2WHOA 1FERA 1RTDB 1VQ9S 1SIWB 1RAFB 1FRIA 2CQ4A 3IGNA 3DI6B 1RWXB 1FDDA 3J7AN 3QRRA 2Q6CA 1UL3A 2DD8S 2NUUG 4QWEA 3TWZA 1I94J 4RNFA 3FDSA 3QGIA 4OYIA 3KFWX 4UF4A 3L4BC 1X8DA 2QSFA 5BXIA 1RAOA 3MR6A 4ID5A 2GJIA 2VC1A 1NB7A 3S8SA 3LP1B 1MMLA 4QYRA 4C98A 8ATCB 4DS4A 1N4LA 2LQBA 1C2PA 2PMHA 4O4GB 3FKBA 1XQIA 2JH3A 1NU4A 4C8LA 4KY3A 3IR7B 4CLSA 1SXLA 4IQXA 4JYAF 5J2MB 1FHTA 2GQCA 1DLOA 2XZWA 4K0KF 5F8NA 1UJ4A 3DM2A 4K50A 2VHGA 1U48A 2CXEA 3HJVA 3CIMA 2OKQA 2E5LJ 2EFGA 1OY8A 4Y0FA 1B0PA 1NSPA 4CLKA 1B99A 3KUGA 2I38A 2OGUA 3I5BA 4WIQA 2PI5A 1K9MT 2Y1LB 2HS4A 2W4PA 2HNYA 3OT9A 2CQHA 3SIPB 5I3UB 3QATA 4KGXB 5GADI 2UXDJ 4ZIWA 1PO6A 1JXEA 2NXEA 1IR2A 3ET6A 3HHLC 5FD1A 2R7XA 4OX8A 2APOA 3O44A 1FK9B 1JXLA 3GSDA 2J6SA 1S79A 2CDRB 3H90A 4CTAA 3CMQA 3VQSA 4U6PA 1UTAA 3OSNA 5A2QY 1HNWJ 4FYWB 1QY7A 5HJYA 3VAJA 2HURA 3G9CA 1I5OB 1N5VA 3QT6A 3QJJA 3A8KA 1HNXJ 1QTMA 2RKIA 2R7RA 1TK8A 3BGUA 2EFOA 2EKNA 1FRLA 3P8BB 4HL9A 5E33A 1QUPA 2QFIA 2F4FA 3QFWA 1KVKA 1WC0A 5F0UA 5HATA 2IMOA 3NS6A 5D77A 3MCNA 3VQTA 3EVMA 4UUWA 2BMBA 1MW7A 2CADA 4NLQA 4F67A 3J80U 1U0HB 1YZ6A 2GVZA 3GV8B 3R1HA 4DR5F 3KG1A 4LRBA 4OYMA 4N56A 2DNNA 3ICLA 3LP2B 4RJVA 3THPA 1DTTA 1KBRA 3G6VA 3IXQA 2HNDA 4ZPVR 1ZM4A 1HW8A 3LGNA 2G9OA 4Z7YA 2ZJPQ 3D67A 4Q45A 1HHTP 4K4VA 2DR6A 4DV3J 1S9GB 1XTZA 3RW6A 4C8MA 3FSYA 1VC6A 1S0MA 1Q8BA 4EZ6A 4XDDA 2V34A 1VBXA 2HMIB 1BQMA 2VODA 4RW8A 1S6PB 4K5SA 1G2EA 3MTJA 1VIOA 2HWTA 3DNCA 4B3OB 3JSBA 4JI2F 3H5UA 2Z56B 1X5TA 2YNHB 4IG3A 3N5FA 1NK9A 3JXOA 4UZCA 2ZH4A 3US5A 3C19A 2KI2A 3F44A 3T9ZA 3EZUA 4G1PA 4USUA 5HQMA 3LP2A 1DBDA 1FESA 4U96A 5KFAA 2KT3A 2L48A 2VG6B 2FZCB 2F63A 3U1LA 5AJ3J 1RBAA 1L3TA 2PIIA 2OPPA 5IQQA 1WSRA 1U09A 1R0AB 1T3NA 4WTOB 2E1PA 5GAGU 1JJ2R 3CE8A 2JEGA 3SQOP 3LANA 4FXDA 3BGRA 3UD5A 4LSNB 4AUKA 1LW0B 4K7QA 5JJBA 4B9UA 4JI1F 3AHPA 4RZRA 1TV6B 1Z1ZA 3HZEA 2PEBA 2W01A 2GVDA 1VRQC 3NBPA 5CYMB 3EPIA 1S6PA 3KXDA 4O3QA 3TJ9A 2N3OA 1TL3B 4EZ9A 1RT5A 4I64A 3PACA 2CPDA 4QWDA 5H9FJ 1KFDA 3W5XA 2UUTA 3T19A 4DFPA 1N88A 1JLQB 2JVRA 3W9JA 3UDCA 2XGQA 4DUZF 2OPPB 4AT1B 4U8VA 1FWPA 5ETQA 3FCHA 3M6VA 3BQ1A 1CLFA 3ENAA 4A8SA 4IFVA 2HGLA 2R4FA 2HPUA 2AJ1A 2DK2A 3GYGA 1KC8T 2YNGA 2JLGA 2PC6A 2D74B 1RZMA 3NBPB 1TFYA 1IBMJ 3PYFA 4R25A 4DV3F 3PJ9A 3BGLA 3FFIB 2K3KA 5D78A 3OL9A 4MKVA 1WEYA 2NXJA 2Y1IA 3ISZA 1MN9A 2MKYA 2OAUA 1EKSA 3IA0A 4O23A 3SCJE 2YKOA 5D0RA 4DL5A 5IS2A 2DHHA 1HWJA 1TL7B 1YDLA 1CVJA 3OVBA 2C2ZB 1U2CA 2IM1A 1IQZA 1ICEB 1S1UA 4JI7J 3PCOB 1PKUA 3GQCA 1P6TA 1AUSL 1HARA 3FRYA 4DN9A 4LF6J 4F04B 3OTOF 2HNZB 3NWRA 3QSYB 2M52A 4X4QA 3MOJB 2X51A 3BBFA 3W60A 3DDKA 1TVRA 1MWYA 4A46A 1IR1A 4H4OA 3QIPA 4RUAA 4C7QA 1RXOB 2YNGB 1HI1A 4DU8A 2DR7A 1CC8A 2XLJA 1M5VC 3M7VA 2MDAA 5CCLA 1HNXF 3IWLA 3BDEA 2XYPB 1KOOA 4PUOA 4DDFA 3CTRA 5AXKA 5HJXA 4DX5A 1JWWA 2UV8A 1FEHA 1HPZB 3MR7A 5ETLA 2ZUGA 2VF3A 2J0QD 1B70B 5FDLB 2G4BA 2KKHA 2DGOA 4W98A 3AQPA 3KJQB 4G1QA 2RVJA 3NNAA 2ZNYA 5AXLA 2XQCA 2C2OB 4Q5VA 1KHWA 2ZHBA 4GKJF 3HSJA 2B51A 2LVWA 3NMRA 2VA2A 2N3LA 4YP3A 2RSQA 2QYCA 5A0YB 2DNMA 5KFTA 2PE8A 3GR0A 2ZH7A 4B3TJ 1WC6A 4ZN3A 4HACA 3SFGA 5KAKA 3TR5A 1U6BA 4QJVA 1VC0A 2VG5B 2LU2A 3G2XA 2UVUA 3NLCA 5KFUA 3D6MB 1K8AT 2GZOA 2O67A 1S59A 2OELA 4J7CA 4NZ6A 4ZVTB 2LEPA 1N56A 1LWFA 4ZLLA 2P6SA 2VPZB 5BYQA 1S9FA 4LR7A 4B9SA 5CYQB 4BWJA 5D3GB 4C8OA 4GO7X 4ED5A 1F9EB 2OP5A 5KOXA 4B3MF 2DO4A 3GCXP 2X1AA 1BE4A 2OEJA 4ZVFA 4OI3A 2HQFA 3V6DA 1TKTA 2MZSA 2YKPA 4ELVA 1WORA 1RAJA 2AX1A 1UW9A 4J9VA 1RYSA 1AFJA 4OI2A 3NOGA 1I3OB 4K2JA 4I1TA 5IC6B 5AJ3F 4ECUA 3DXBA 4LBIA 1ZOTA 2H51B 3HHLA 4X62J 3SV4A 3CJRA 1U2FA 2DGUA 3WIVA 2GHPA 1NK4A 3TZYA 4ELTA 1X5OA 3DYAA 3OL6A 2V68A 5A76A 2W7AA 5E3CA 2MQPA 1LWFB 1X4FA 3EVOA 1A7GE 1HFEL 4YHHF 1RU2A 1DAXA 1VFJA 3B82A 1KP6A 2AD9A 1VHIA 3GIKA 1SVDA 3AAWB 3JSYA 1DZ5A 3RU0A 5EX0A 1N5SA 3W61A 3J81Y 4KRWA 4A8MP 3R9LA 4LJMA 2DKOB 2NYIA 3PRBA 3GTYX 1YRXA 4KH1B 1TP7A 1VHFA 3CJKA 1LFWA 1C1CA 2CA9A 3G87A 4OV1A 3T1HJ 3FSIA 2ERRA 4FYDA 1RBOB 2FTRA 2XGPA 4YMEA 4DUYJ 5DM7Q 3C2PA 3THVA 2ZDOA 2GHVC 5AXNA 4P2SA 4DG1B 5IXUA 3RB3A 2J7WA 4HKQA 2AJ0A 2UU9J 1NSAA 1HKAA 2YX7A 3CB4A 1PYSB 1N32F 2P9CA 1VBKA 2DR5A 3M8QA 4AXJA 3B4MA 3JSRA 1K1QA 3D0HE 1PBAA 2B4OA 2V8HA 2VG7A 2YKNB 3IBFB 2H5JB 3S6EA 4RU9A 4P2MA 5GAHU 4P72A 3GFHA 4QZVB 2GJ2A 3KK1A 1EB0A 1NDLA 4YB7A 6AT1B 2RT3A 3CCWA 5IZHA 1F0XA 1FT8A 4ZPDA 1RAGB 3IBCB 4CLLA 3HHLD 9RUBA 3T5JA 4DF4A 3D1OA 1C1CB 4WF9Q 2VASA 1XMQJ 1G4CA 2D9OA 2W2MP 2L9DA 1F60B 1KNZA 3VALA 5KFYA 1RK8A 2MYFA 1AZSB 3GJQB 5KFLA 5KT3A 2VBXA 3O5TB 5SZTA 4DLGA 3LQVA 5E3AA 1F2GA 2EFNA 2V8VA 4ID5B 4L73A 4ES2A 3G96A 3PW5A 1VK8A 2V0NA 3LP1A 4V1Ak 5F0WA 3BKUA 4RU2A 1E6VA 3M30A 1BWEA 2YKNA 2CPHA 3NS7B 4Z37A 5GAEU 1QLNA 3CJ8A 3BDPA 1UEKA 2ROGA 1SKRA 1HQUA 5D4PA 3SCIE 3GIJA 5LJ5Y 4NCBA 1H0HB 1X4EA 1HNZJ 4JV5F 4HH0A 1P9QC 3F0NA 2UVWA 2J0WA 1FD8A 2MY8A 3VZIA 2HHHF 3M9NB 3KHHA 4MT1A 4YB1P 2WBRA 5L1LA 3FJ2A 4QR2A 4RW9B 4TKTA 3SMZA 1AZSA 4ZN1A 2WW8A 1IJEB 5IQ6A 1FRKA 4I6YA 1LXJA 2PD1A 4USIA 2Z57B 5I3UA 3MCMA 3PXGa 4DEZA 4CDIA 4ZPAA 4ZLNA 4DSEA 2BKPA 2KYZA 4NLWA 2DNLA 2PFFB 1RTJB 1RT3B 1X5PA 3EGNA 4WBFA 4QU7A 4RX6A 1E6VB 1CS4A 5KFEA 2KB2A 2ZBQA 2WSEC 2RQKA 2VL1A 2RQ4A 1JX4A 2LQ8A 2HQCA 3H7HB 2DNOA 3IS9A 2OPRA 4KBIA 2Y8YA 1F5BA 1YJWS 3C46A 4L74A 2JEFA 4OLPA 2FLOA 3MR3A 4UW2A 3BO3A 1S10A 4DJBA 2HQIA 4J9LA 2A18A 2C3PA 2POKA 1A6LA 2I5JB 2A6MA 2FGCA 4ZVEA 1X31C 1JJHA 1RHKB 1RTZA 1NK7A 4F0HA 3TYTA 2GS8A 1VS3A 2ZBCA 4ZKAA 5IWAF 3BQ2A 3NGUA 2ZOGA 2B56A 4ALZA 4NLVA 2PFDA 4F0KA 2E7VA 1JLAA 2CQ2A 2GMHA 3TI0A 5B0DA 2OO4A 2Z2ZA 5K9FA 2DHSA 3MPDA 4X62F 1FJ7A 1PC5A 5KFQA 4O44A 2BQ3A 2BJ8A 3QZ8A 3V2UC 5IT4A 2B5JA 4NLGA 3U1NA 2LEBA 1RACB 4ECXA 1XR5A 3OR2A 4NLTA 2G2OA 1Q95G 3H5YA 2G0CA 5AE3A 2F4VJ 3NAIA 5HP1A 1X9WA 2Q43A 3S01A 1YRTA 3TA2A 4LRCA 2HZCA 4ECYA 4TU8A 3NL0A 3QPIA 4O3OA 3I5AA 1NKBA 1L3VA 1A0OB 1F2HA 5KG0A 1R8BA 1BQMB 2F8HA 3I87A 4KPCA 3CEDA 2DR9A 4E2FB 3DHXA 1Q79A 5G0RA 1HNZF 4LF9F 1ZPVA 2C3OA 2K7JA 2XM3A 3IM9A 3DRPB 3PFEA 2ZKTA 4NXNF 2EBGA 3V5RA 3T5LA 4KB7A 1HQEA 3TZXA 4DX7A 1IN0A 4FP9A 4MK9A 2MQNA 5EWEA 3BO2A 2VG6A 4OX6A 2P5VA 2B5JB 1F5AA 3QQCD 1F3FA 3MMBA 3OFFA 4KC5A 3TAMA 3OR2B 4ZDNA 3ZZTA 2MQLA 1UWBB 4DUZJ 3TVZA 2DH7A 1RLCL 2E29A 1RLDA 4G6VB 3V81A 4HR2A 3VGTA 4LSNA 3OJSA 3BH6B 5KTQA 2MKSA 2IYIA 2MPUA 2YQ0A 2KHDA 2A2DA 1YGYA 1U1NA 2BW2A 2HHXA 3X3UA 1FNXH 1TUGB 1OMSA 1UEVA 5KFWA 4DQIA 3NWGA 2UVVA 1TL3A 3LGMA 2CQCA 2XB2D 1U1OA 2WONA 4O3RA 3M1VB 1U26A 3DRPA 2RF2B 1PGZA 2RIJA 3DGPB 4M5MA 2E1CA 1D3WA 1F1BB 2V9KA 4CZCA 1RKIA 2YVSA 1S4FA 3PYEA 3D54A 3A12A 2RU9A 3E51A 5DQIA 3PIPQ 1RCXB 3ZXWA 4CM2A 5IWAJ 2J5AA 3EXYA 3CJ2A 5B08A 2XG8A 2DNQA 2EPIA 3EDRB 1JLGA 1KLMB 2AIRB 2CVEA 4WFZA 3RBDA 1N36F 4B3RF 2MB0B 5D4NA 5HMWA 4JI7F 1JJ4A 4IFVB 4A8YA 3V6HA 3VR1A 2D3O1 3HKZD 3TX0A 1OYDA 1U24A 1HWLA 2MY7A 1S1XA 4QIVA 2FY1A 2KVQE 3DOLA 2A0FB 5F8GA 3KK2A 2WB4A 3H2VE 3BS9A 1UFLA 1LNQA 2B7CB 1V9OA 2MQ8A 3MPYA 1D09B 2WCXA 2XI2A 3PHTA 4K8RA 4BC9A 4QW8A 4QIGA 5K5MA 4JI2J 4B9NA 3RBZA 4JI4F 3CDWA 3FBFA 3W2VB 1DURA 8RUCA 3M1VA 8AT1B 3CUNA 4DQRA 2Y8WA 3HPOA 4UTGA 4ZLPA 3L7OA 3CC4S 3DGPA 2M8HA 2CKWA 2QLWA 5KFVA 3QZ7A 2XMAA 4R8UB 4MJKA 1M1GA 4E8UA 5A8WB 5LXYA 3R2DJ 4QR0A 4G3IA 4DR3J 3LPYA 1OO0B 4LRAA 2J6UA 4NXMF 1J5EJ 3EVWA 3SSRA 5HSPA 2HNZA 1GMWA 4WFNQ 2A3JA 1Y5LB 4ECZA 4PWDB 4ZPCA 3ZZUA 4GKJJ 4KKOA 1RWNB 4H4OB 3JQMA 3LAKA 1XBWA 1KLNA 1GXLA 1HW9A 5EX3A 1NBEB 2GIRA 2MLYA 3EM1A 3MEKA 1G6BA 1R6YA 2XHCA 3CDAA 3G82A 3GU0A 2CNLB 3Q89A 4RW7B 4A8OA 2FLNA 4YB6A 3ZFVA 3JS9A 4UT4A 2CNOB 2KRRA 4J37A 2M8DB 1FE4A 2CPJA 2X1BA 1HPZA 5ETSA 5L1KA 3MEEA 5B0GA 3HZGA 3UVJA 5K14B 4J90A 5A6WA 2IAJB 1TR0A 2W2NP 2WSFC 2XMVA 4R8UA 1HD0A 1SQFA 2CJKA 1BC6A 1I1GA 1NEEA 2A10A 1S6OA 2BJ3A 1J2VA 1DQAA 3A8JA 1C1BA 2CUYA 4G1IA 3QAEA 1DHMA 4OI1A 5K8NA 5A8KB 1S4EA 1NSKL 4PWDA 3OQ2A 1XR6A 5ETPA 1H73A 3RG6A 2W9CB 3QWUA 2BE2A 5KG1A 1G7CB 3MMCB 2XS7A 3Q8UA 4OYXA 5KFPA 3GB0A 1Y00A 3BPDA 4LFCJ 3G82B 4L72B 2B3TB 5IM0B 2WTFA 4OV6A 5I3PA 5B7WA 4YS2A 1MN7A 4PWWA 2C28A 3UDLA 4F3MA 3D1HA 3MM8A 2LEAA 4F2RA 2GO9A 2BACA 3UVJB 1SH3A 5K14A 3QYYA 5J2QB 4XO0A 3TUJC 4IH5A 4TYBA 4CLZA 2KJWA 3V6DB 4FF3A 3PJWA 2JDJA 3T5HA 5I3QA 1YK9A 2EW9A 2AMCB 3UDVA 2W4DA 1T9VA 3OLBA 2LFVA 1HD1A 2DCUB 4OYPA 2BE2B 4L75A 1U02A 1R3NA 2ZDPA 2HZAA 3A3PB 3CJ3A 2N82B 3I5CA 5DM6Q 2BRKA 4LIRA 3TA1A 4TXSA 3OV7A 1SJRA 2JSXA 4C6AA 4DS5A 3NP5A 3G71S 3ILOA 4YDXA 3S1TA 1UVLA 4NEYA 3LWMA 1S0VA 1I51B 3CSKA 2OMOA 4FKYA 4E0DA 1NUEA 1MROA 1YJUA 2QLXA 3CXCR 5D0GA 4GC6A 5J2QA 2DY9A 3JYTA 3W64A 4QCLA 1NCLA 2DPJA 1BQNA 1UPMB 3DKDA 5I4MA 2I1RA 2IYGA 4NOHA 3QRPA 1FRHA 1NO8A 1OY6A 1AB8A 4WK1A 5FIIA 1UCNA 2HSEB 2OSRA 5FLXU 2XY7A 4HHUA 2KYXA 2ZWPA 2HZVA 1WF2A 4ZJQA 1UVJA 1SQEA 3OFEA 3GR1A 4UOHA 4DFJA 1S0NA 5J1NA 5KG6A 3TX8A 2W7PA 4ELUA 1Z4UA 4DG1A 2V69A 4ANEA 2FHOB 1F3VA 5C5JA 2XBPA 2E1MC 2EI5A 1IQTA 1Y7PA 2NCKL 2ZE2B 3A1YG 3GYXB 1FRJA 3LW5C 4HHHA 1YJ9S 4OZ3A 3ILJA 4QWBA 1FRXA 1VQYA 3FBCA 3H0PA 3MMAA 4HI1A 1WC5A 3AA9A 4WKYA 5JMNA 2ZUAA 3QJLA 1SL1A 1PJ5A 2DGVA 5L9XA 1BQNB 2GQQA 2Z30B 4IDKA 2CWKA 1EETB 2AZ3A 4MFBB 3MM7A 3EZOA 1P8GA 2VV5A 4A8FA 3DU6A 1UVIA 3PYDA 2ZZMA 2V2VA 1EX8A 1U8WA 4FYYB 4KV8B 4CH1A 2ZBRA 4P10A 4ZS6A 4ZMMA 2YH1A 3GJSB 1BMQB 4Q8EA 2VPYB 2VUGA 4ZJLA 4CYUB 1VYAA 2DEJA 4N5SA 2E5JA 3MM9B 3GPAA 3I32A 4DLEA 1WI8A 4YHHJ 1FJEB 2M4MA 2ZE2A 3T9NA 4ZK7M 2VONA 5EN1A 1RQ0A 1WDDA 2QL7B 2P6TA 2U2FA 3MMAB 2DHXA 5M2RA 1J5OA 3M6UA 4AE5A 1FJGJ 3VGSA 5GAEI 1IKXB 2XY5A 4BHQA 3HK2A 2XHWA 4NCGA 4JI6J 4KGMA 1MLAA 1UMJA 2ABYA 3ZZPA 2V8PA 1UW4A 2IRXA 4TYAA 1SC4B 3IGVA 4U7UK 4CO5A 5KFCA 2JFDA 2V4RA 4BDPA 4K4UA 1JLBA 2G0JA 2JX2A 4KV8A 2H1YA 4NLUA 4WPAA 3KLIA 3BZQA 4MMOA 3D9BA 4CYUA 5ITHA 1FTRA 3GMGA 4UY8T 2GA7A 1RT2B 4W90B 1RTJA 4X4RA 2CWXA 3HLUA 2XNRA 3PJXA 3HMJG 4KAIA 4C11B 4BBYA 1T9YA 2YQ1A 3P6YC 4LF6F 4TU9A 1J5OB 3BR8A 5DS7A 2OPRB 3VV2B 1LFPA 2XYGB 1VQSA 2AT1B 1URRA 2HRTA 3DLGA 1KQSR 4DQPA 3R3TA 2V4JB 4M5GA 2ZD1A 3OTCA 2ZNZA 1S6QB 5EDWA 3SYZA 4TLQA 1YTYA 4Y65A 2CPFA 1OSCA 1RTHA 1Z2LA 2PSZA 3C6TB 1E6YA 3MEDB 2UUWA 5ETMA 1JLBB 2MSSA 2AJ2A 2QLJB 2ALYB 2VBYA 3BSCA 4OFZA 3N9UC 1SCJB 4C3KA 4FBTA 4F36A 4AQYF 1K0TA 1VRTA 3ELHA 1C0UA 4X4SA 3KWMA 4WP9A 5IOLA 1CPZA 4V19J 4H4MB 2M9KA 3G86A 1BGXT 1YLXA 4ILLA 5F3ZA 2J7UA 1SPBP 5T7LA 1UFWA 4LBHA 3KMSA 5L39A 3GIIA 1M5HA 1DTQB 2BKOA 4NPOA 5F9NA 1FI4A 2V67A 4GO5X 4ZITA 4O3PA 2NREA 1GK8A 2ZOFA 4J9MA 4DQQA 1HBOB 3RAMA 1L5UA 2MKKA 5JUMA 3EGWB 1WHXA 5E3PA 2KH9A 4CWBA 2BJDA 1U6FA 4NLPA 3SXLA 2RS2A 1E6YB 4JV1A 2YKMB 2HGMA 3PX6A 3VWSA 1S7IA 4DSKA 2M5YA 5G0RB 1B0VA 2WVCA 5CYJA 4UQGA 2RU3A 1BLUA 1YRUA 4HLBA 2RNEA 4CI0B 4KT0C 1HNIB 3NNCA 1Y10A 5JVGQ 4I56A 1HQEB 4MKBA 2OFGX 4IR9A 2MTLA 1YBTA 4H4MA 4KO0A 4BCAA 2C2MB 4ZPWR 3SSSA 4KTQA 3Q2TC 3CD5A 1O0PA 3MMBB 2AKWB 3VTIA 1M5KC 1NXIA 4CO1A 4NA2A 5J2PA 5CZVA 4EU0A 1UWBA 3K7RA 2EC0A 2OEKA 3V81B 3ISNC 1RUSA 2HVZA 2QL5B 1N36J 2XSJA 5KFKA 2ZZNA 1N33J 1WG1A 2LYVA 2DRBA 3POTA 2FJVA 1Q16B 5A2QU 1UVMA 1HBMB 4B3SJ 2C2RA 2LCWA 2BDPA 1EKRA 1FO1A 5K8MA 1WNEA 3GCWP 3TP2A 2XCAA 3DLKA 4IUFA 3CD0A 3OUYA 1RADB 1NNDA 4NE9C 1JKHA 3L95X 4NA1A 2UV8G 1HBNA 1BD6A 4KFBB 4WE1B 3MM5A 2KM8C 2KT2A 1RA7A 4KO0B 3L3CA 4QWAA 1H2TZ 3V6KA 2C22A 4I4BA 2FVPA 4F02A 5F8JA 3HSGA 2PA8D 3J7A1 1TZ0A 1Q81T 1N0UA 4KHPF 3K8VA 5CQGA 2VFTA 3PRDA 4EO6A 2IC3A 3UE2A 1LWCB 4L3NA 4MAKA 3HO1A 4U9RA 1T05A 4RUHA 1TK5A 1WF0A 1FXRA 2EKYA 4F4WA 2IY5B 2OTLS 3KUHA 4XAKA 3HHNB 1MU2A 3W2WB 2DNZA 2JJ4D 1LOUA 1N32J 3D3CJ 2QSWA 3MAAA 1V6HA 1VQ5S 3I96A 1SQGA 5KT5A 2ZM6F 5IT9U 4NXNJ 2FJEB 2WBMA 4QWCA 3MURP 4DR2F 2IFXA 1JKHB 2VD3A 4NRTA 3I0SB 2XZTB 1H2VZ 4OJGA 3JSMA 3WQPA 2BJ9A 2E7XA 3SQGA 3OL8A 2W9BB 3W62A 2RAQA 4ED2A 2K3IA 4OYZA 2ZH6A 1HR0F 2G2YA 7AT1B 1LWCA 5B0FA 2QMXA 1FX4A 3UI3A 4PXDA 1P27B 4R0EA 1ZS6A 1S6UA 3DRRA 5GAGI 4OIXA 2OSQA 4FNHA 4OZNA 4TY8A 3MAAB 1D9DA 1GNKA 2HHQA 3SDEB 2QT7A 4NYOA 3J7ZT 3CCVS 2E9RX 2Y9HA 4EI2A 2D7SA 1N33F 2MQOA 2HBYB 2W2OP 3KG4A 2I8EA 3BR9A 4LF7F 4DHVA 3KK3B 5K20B 2BUNA 1R89A 2HIQA 1KTQA 4WU3A 2IAJA 5HROB 4RNMA 4J5OA 4DPYA 2QGFB 3DM2B 1WC1A 1OQ6A 1HMVA 3KJFB 1MMNA 1TMJA 1H74A 4KGZB 5T41A 4YY3J 1YITS 1M1HA 3N79A 4QR1A 3TUIC 1HWKA 2DHAA 5LOQA 1K47A 2QYGA 5THWA 2C2EA 2IM0A 4CO2A 1VBYA 3CJTA 2JWNA 2HNYB 4U95A 2OPSA 1A9NB 2GAGC 4YR0A 1AXQA 3SDEA 1X4HA 2VJUA 1X9MA 3ET6B 4LF5F 1JIHA 2B9WA 3ZTSA 3ITHB 3CJSA 3OVSA 4OX9F 3FCWA 2XSFA 3JQJA 1FK9A 1SC6A 2CDQA 5DRKA 2K8GA 4C97A 4PWUA 4F2SA 1VLOA 2HRYA 4NXMJ 3NG8A 4LF1A 1J5EF 5D4LA 3C6UB 1VIXA 5ETNA 3TVKA 4DV1J 1U49A 4Y2IA 2K2PA 2E66A 3U1MA 2R9LA 4KHMA 2CQIA 3VAKA 2Y0SD 3DOMB 3G6YA 5L38A 1S1VB 2IJNA 2JOQA 1GQEA 4DFMA 1URNA 1R27B 2BV3A 4J9UE 4CH7A 2FVRA 3WX8A 4QU6A 3TANA 4F25A 2ALZA 2HVIA 4IH7A 3W7BA 1ZZFA 4FF4A 3KMQA 4EWTA 2QLBB 1RT6A 4M5DA 1X5SA 5HMXA 4C2MA 1WKKA 3K5LA 2ZH1A 4ATNA 1CJTA 2COLA 1UKUA 2ZEJA 2OD4A 3UQSA 2YX4A 3D6TB 5D0HA 4TN2A 1FDNA 4WJBA 3Q8VA 1M0SA 2R2UA 1R8AA 4AL5A 2Y0BB 2FC9A 2W24A 2DNKA 2R8HA 1OJ4A 2ZOMA 3FBBA 3W9IA 3G6XA 2HMIA 2FC8A 2GV1A 1XERA 2DTJA 3DOMA 2YWHA 3K5NA 3GSIA 4L3KA 1GTEA 2R8IA 3VAMA 2V8DA 3M4XA 3K5OA 4USJC 2N7CA 3A8IA 3EGVA 4IG3B 2O01C 4YDDB 5KFGA 2IA6A 4K4TA 1QJHA 3WC2A 1Z2ZA 1N34F 1EHWA 2K1RB 2MEWA 5KOWA 3MCOA 2OFHX 1N8RT 2ROEA 3QO9A 3NS5A 4HEA9 4EBCA 1YVFA 1VOMA 3DMJB 2EFVA 3L09A 1GX5A 1NDPA 2GJFA 1LW0A 2EFQA 3C15B 4N7TA 3H20A 1EP4A 1KS2A 4P7TA 1KFSA 2IMWP 4FYVB 4C8KA 3GV5B 1LWXA 2Y1JA 1Q7LB 3D68A 5B0AA 4DPXA 1L3KA 2R7VA 3MD1A 2OH2A 2N4CA 3BEGB 2GW8A 2KU7A 1NHUA 1R6VA 4WU2A 4CNYA 1RAAB 5MAOA 3V6JA 1JQGA 3PEHA 4DR7J 4F26A 5IT9Y 3RTVA 2CJYB 1YKWA 2XMUA 3KNGA 3L7PA 4BC7A 2DB1A 2AQ4A 1RA6A 1WEZA 1YI2S 2O5DA 4BS2A 5K8PA 2DO0A 2GNKA 3DRXA 1SUQB 3HF5A 3Q8RB 1QE1B 3KDNA 3RRKA 4ZIVA 2HEKA 2QMUB 3R7SB 1MNEA 3FQLA 2FVQA 3Q8SB 1UA1A 1SC1B 1QM9A 3HXMA 2NSCA 1RT4B 3M2UA 3VAFA 4DSLA 2DR8A 2V63A 5F8IA 3MMJA 5L46A 2PA3A 1CJUB 3BJYA 5HLFA 4F50A 2D3OR 3C16A 5I42A 3OTEA 4PG7A 4JI0F 2HHPA 3RW7A 3QIDA 2BYCA 4LQ9A 1RT2A 4JI3J 3AQOA 4AQYJ 4DR6F 2F4VF 3TAPA 3CJ0A 2IPOB 1S99A 4A8XA 1RWPB 2MGZB 4C11A 3ZNJ1 4ZJOA 1S9EA 2Q6BA 3HVTB 3IRXB 1UPPA 3LP0B 1X4DA 4UOGA 1S1UB 1TU0B 5KFBA 3HHDA 1RAEB 1SUQA 2VC0A 3NGKA 2VPXB 2SXLA 1QE1A 1UETA 2B7BB 4PXBA 1HIYA 2K7KA 4Y2KA 2GX8A 4CQ1A 5L9NA 2AP6A 3D28A 2L08A 1U2RA 2QL9B 3GG1A 4OYOA 5F9LA 5CD4H 1S1WA 1N34J 1DRZA 3DLLQ 3EMTA 3MHYA 1S5ZA 5KFMA 2C2DA 1RTIB 3ILLA 1QAIA 2ZFHA 4X4UA 1CJUA 2QA1A 1U25A 1FVQA 2CFXA 1NHKL 1X4CA 3D5MA 3GLJA 3OFHA 2ACYA 2BOAA 3AOAA 2CAJA 1F6TA 3K5PA 2R7UA 4DBQA 1I94F 1KN6A 2Y1RI 5KFDA 4M5JA 2ILZA 3DFEA 3MUMP 3IMQJ 1IBLF 5HAOA 1WACA 3CDEA 4RW4B 4X64J 1WHWA 3BKTA 5J2NA 3WDOA 4DSIA 1S9EB 1Q5YA 2PDAA 3HVTA 3TEHB 3CCZA 5DDPC 1CJKB 2ZHAA 4LQ3A 5U47A 1TQLA 4RW6B 1M1KT 1LK5A 2BA9A 1RWKB 4R5PB 1YBAA 5KT2A 3UN5A 1VQKS 2ASYA 2V50A 3HX9A 1V3RA 2B43A 1T9WA 4GRSA 4PKDB 5EWGA 2VG5A 3K58A 2YKMA 2R7SA 2MZTA 1RWUA 2HFSA 1MSWD 2W25A 3MR5A 4A8KA 4F4YA 1NJYA 1HNIA 1YIJS 5KFJA 5AE1A 1CULA 1XNRF 5IT0A 2QLFB 4NLRA 1WF1A 3IR5B 4DV0F 5J2NB 4NCAA 2M0GB 3DRSB 1KDNA 4B9TA 3CJQA 2RUGA 3FK4A 4NLDA 1CJKA 3UFCX 4DR1J 4MK7A 3RBXA 3B54A 3R2CJ 1KQKA 4DU7A 2PEHA 2J0XA 4R5PA 4OJ3A 4Y28C 4DI6A 3Q8PB 3HHLB 5CA5A 4KIAA 1Y0HA 5ETTA 1FF2A 2HRUA 1PBUA 1MG7A 3LTOA 3MM6A 2J9DE 4HH1A 4CCHA 2CJBA 3DYAB 4OZ2A 3PO5A 2DT9A 3OPKA 4KSEB 1T9TA 3CD7A 4QIFA 5HANA 5HMZA 2M70A 4OLOA 2H48B 4K4SA 3OW2R 1O6XA 4USVA 3D4JA 2IIHA 4FVCA 4FS2A 3K8WA 5KFXA 1F5CA 1Y4ZB 2GFFA 2XULA 4AYBD 3DRSA 4DR2J 4IR1A 4YEAA 2AU0A 4UQTA 5LMNF 2ZKUA 2IA0A 4GVBB 4WFAQ 4C0OC 5B0EA 3CJKB 1IXKA 4OI6A 2AYBA 4O0NA 3GJRB 3OVAA 3BV8A 4MTPA 2CJ9A 5B09A 1SJ3P 2AZ1A 4WFXA 1PYOB 2VBWA 3ENVA 4I7FA 1N6QA 5ETKA 1MU2B 3W2WA 5HQ8A 5GADU 2BBEA 3VAIA 1RHQB 3AOCA 5SUHA 1K73T 5C2GA 3M8QB 2HVEA 4USMA 1XMQF 3R6GB 1H7WA 2DIUA 4LF8F 3MXHP 3R1LA 2JVOA 3HVAA 2HFNA 3N6LA 1G1XA 2JEIA 3ZNUA 4UOCA 4LF7J 2XEXA 3KK1B 3CO0P 1FJCA 2H54B 2AYGA 1W2IA 3QBCA 2YTCA 1PYTA 3CMAS 3ETOA 1YJVA 3DDNA 5LSRA 1WD6A 1FE0A 2L41A 3OR1B 3AA8A 4NX9A 4FF2A 1FVSA 1XNQJ 4OZ0A 1RI7A 3DRRB 4NLXA 4P6QA 4LR8A 2LU1A 3MGJA 2PT0A 4IKAA 1TK0A 2DISA 3M8PB 1XJWB 3OXFA 2NZ4A 4XIUA 5D4OA 1SJFA 2JL9A 1ZM9A 3MTKA 5DLFA 3M6WA 3CWJA 4RWWA 5KFRA 3HCXA 3KOAA 1WOPA 4FYXB 3MECB 3JAMY 6FD1A 3MAQA 1FKAF 4ZHRB 2CPZA 1XR7A 4HTIA 1HQUB 2F65A 2X3GA 2BANB 1WHVA 3DOKB 4KHPJ 2MLXA 1SKUB 2OEMA 2V9WA 2Q66A 1TUVA 4F4KA 2JFKA 2B4VA 4DX8H 2PMZD 2KXNB 1KHVA 2G1DA 4WP3A 2ZBIA 1CBKA 3PW7A 2H4WB 3OR1A 3C66A 2W8LA 1N48A 4C8NA 3UNGC 2OPSB 2FIUA 3FUYA 3OFGA 3SCKE 2YNIB 1ZH5A 3HD2A 3LGHA 1SBRA 1RT3A 2ILYA 3AB4B 3NCRA 3R27A 2QV6A 3WC0A 2D3UA 4RL1A 1NDCA 3D6HB 5KFZA 5C25B 1B7YB 5DLGA 1JLCB 3VVUA 3U02A 3BSNA 1NJWA 3AH6A 2HNDB 4ZHRA 3DN9A 2HKEA 4URQU 3MD3A 2VB6A 2OIHA 1T95A 3BKFA 1NM2A 1PJ7A 4KYZA 2CYYA 4EEYA 4DR4J 2AYEA 4DR1F 3MZIA 1U1KA 2P9EA 1FWKA 1X9SA 3P49B 2B9EA 1ZAVA 3CCUS 3BYPA 1IBKF 2DITA 2W4CA 4P52A 1AUDA 1N0VC 3QFHA 5AE2A 2UUBF 2YNIA 4PG4A 5C25A 3QGHA 1SIZA 1RT6B 3I9ZA 3VGVA 1GMVA 3ONQA 3NNHA 4KGVB 3CVKA 1HWUA 4CTAB 1GTHA 3AXMA 2VQFJ 3K17A 5D0EA 1M5SA 4HHJA 1LW2A 3CO9A 5EHHA 3QT7A 5GMDA 1WC3A 5HBMB 4YY3F 4ECTA 1JLEB 1V5IB 1VJWA 2MLZA 3QNWB 2AJQA 4M5IA 4MIBA 1WUUA 4CT8A 3P96A 4NEZA 3NMAA 4X4PA 2IRYA 2XMTA 4GC7A 5IC4B 1KSPA 5LMNJ 2L9WA 3BBBA 3CPWR 3T1YF 1DARA 1GAOA 2F9JA 2KXHA 4M5HA 4DZDA 2EG2A 5BYSA 3KLFB 3PKMA 3ZTQA 1U0HA 2GVZB 4NL5A 3E2EA 2DNHA 2F40A 2UUAF 3IG1B 3GJTB 3I6PA 1AA1B 4E98A 2AEJA 2VA3A 4W92B 2FHMA 2LQJA 3NGSA 2HYIB 2RB7A 1ELOA 5KG2A 2WRMA 2B9YA 1ZA1B 2CQBA 2AYMA 2VFVA 1JLFB 3RJMB 4Z2XA 4DV1F 1SKSA 1JLEA 4DZ6A 1N5YB 2OJ3A 4ES3A 1ULRA 4IQMA 3H40A 4CLWA 4M5LA 5A6PA 4B3SF 4JUZA 3ENWA 1FNMA 3BYRA 1ZYQA 4IG0B 5G4DA 3T3FA 3ILIA 3MPVA 1WDTA 5JXSA 1ZBTA 2WONB 1QD1A 2YNHA 3HFKA 2RF2A 1EJ7L 2GCFA 3WIUA 4JI0J 4GKKF 2HW3A 2JLEA 2V2QA 1XNQF 2IJFA 1TL7A 3C14A 4ICLA 2NYHA 3GIMA 4OHZA 1IBKJ 1WJ9A 2MKCA 3MR2A 5BR8J 2E5LF 3OHBA 3TUPA 1RT1B 3DC2A 1HBUA 4PG5A 3KJVB 2QA4S 1NB2A 2VICA 3CDBA 1N5YA 1BUXA 4YOEA 1S1XB 2IBOA 4ZP8A 3MAHA 5B0BA 5LMUF 2FB0A 4PXCA 3M2UB 1VRUB 2DH9A 4PQUB 4J9OA 4IO9Q 2FQQB 2DJWA 3ADAC 2YWGA 4IG0A 1KD1T 3N28A 3QT5A 1H3DA 1PSDA 2CIMA 2LA4A 2O66A 4Y6IA 4ZVOB 4A4JA 4CLPA 4ETXA 4U8YA 5DG9A 2J0SD 1RT5B 4UUXA 2FZKB 1OS5A 4YFUA 3AJDA 5F8HA 4HI2A 3TQ1A 1HI8A 3JTNA 1GXTA 4OZJA 5M2UA 2MGZA 4DPWA 3EPGA 4ICLB 2J8AA 5FDLA 3T1YJ 1WWHA 4J91A 2OHDA 4Y2AA 3D6FB 2QRRA 4H54A 4YUDA 2F9DA 1TAQA 3NAHA 3PEJA 4URSA 2XC9A 2XMJA 2YNFA 4OJ1A 1TFWA 4WFBQ 3G8QA 1HR0J 1CJVA 5KT7A 3RRGA 2YWKA 1Y11A 1U6ZA 3WBZA 1RB0A 1UAWA 1P1LA 3GIRA 5A0YA 4KKOB 5LL6d 3ZC4A 3TARA 4EMDA 3P5BP 1EQMA 4ZVGA 5F3TA 1K1SA 1TAUA 1NPPA 3LPEA 1VRUA 2LQ5A 2J7KA 4PABA 2JZ5A 1RTIA 2E5IA 1U45A 1C0TB 1JK9B 3AJ2A 1EARA 2ZVSA 4UOFA 3AB2B 4RR5A 4CT9A 4TQSA 4DR7F 4HDHA 4RW7A 2HHUA 1ITPA 1BHNA 3FFIA 3W5ZA 5HQLA 1WI6A 3GG0A 2LKZA 1WELA 2VFSA 1XNRJ 3MFHA 3O8WA 2D3ZA 2MJNA 3MEEB 2WZ1A 5CYQA 5D3GA 5E5NA 1TUWA 1PAUB 2RQCA 1RT7B 2Z2YB 5DDQC 1U7LA 4LF9J 2CPEA 2KXFA 4FN5A 4A8QA 1H38A 1IJFB 1ZPWX 2YNFB 2YXLA 3D3BJ 1MWZA 1RISA 1CJVB 1UWAA 2HBRB 2C42A 5AXMA 1C1BB 3LOUA 4NRUA 4DV2J 5ETRA 1NHVA 1UEUA 2CPXA 2HG4A 2DYAA 4R0JA 3QJPA 2JLFA 1R31A 3QIPB 4JV5J 2D9PA 1UA0A 3WX4A 3EE3A 4OZ5A 2W1BA 3IBWA 4I2QB 2FUG9 2R2SA 2ADCA 3ZO7A 3FEXB 2LXIA 5LMUJ 2VPWB 3HP6A 2IRUA 2EWHA 1W2BR 4DSJA 3EWGA 2KZZA 1H7XA 3MM8B 3N01A 2AJ4A 1CULB 4RBTA 3FMWA 2DGSA 2V2ZA 3L7UA 1IKYB 1JMTA 1AYEA 3MCSA 3HI9A 4Q2LA 4URGA 5FLXY 1YJTA 4JI1J 2UXCJ 1FDAA 2GMJA 3T5KA 4P74A 2JNJA 2W7OA 2B4UA 1QDUB 4MH8A 2H4YB 1GXUA 4DF8A 3D0GE 3CC2S 4LF4F 2WOMB 4YQWA 2HIYA 3F73A 5J1EA 5FJ4A 2M2BA 4HACB 2DXFA 3BF4A 2YWFA 4LRDA 2FHKA 4LF2A 3R8YA 4I0WA 2RDDA 3BSAA 1Q0NA 2V6AA 4NZ7A 5DJBA 1JXVA 1SJ4P 3AODA 2AX0A 2BJ1A 3MUTP 3DU5A 1U1MA 2RS8A 1OPIA 2VG7B 4LUBA 1UFKA 3VF0B 4DV7J 4O0IA 1RBLA 3ZTRA 1IKYA 1IM4A 1NAQA 2HBQB 1V5VA 2NPFA 1GEHA 9ATCB 2XWXA 3V4IB 2KRBA 2W8KA 3M8YA 4F3QA 3K57A 3W3SA 2BM1A 3EDQB 4GVBA 3D66A 1TKTB 1IKWA 2RDJA 3AD7C 3EZ5A 3OLAA 4JI5F 1RSCA 2QMWA 4ILRA 7FD1A 2AWZA 4C9DA 2B4PA 3FGVA 4LVNP 1SKWA 4USWA 3PG9A 4I7FB 2KZMA 5LSLA 1TMMA 2MQQA 2ASLA 1XMOJ 1N54B 5T14A 2KG0A 4PEOA 5F41A 3I55S 3KKFA 3KLHB 2OTJS 2VU5A 3IO1A 3BGFA 2FHJD 4MYUA 2CQ0A 2WAQD 4NWBA 3M30B 4QPTA 1FDBA 3RRHA 1T8EA 1NJZA 3CULA 1ZETA 4KPYA 2NLWA 2ZH8A 1HHQA 3Q83A 4FXVA 5GVQA 2IJRA 4JV0A 4N8OA 1B64A 2ZWOA 4DN0A 3Q22A 3NOCA 2Q79A 3PZPA 2DXDA 1EETA 2RRNA 2YBVA 2HAFA 3BB5A 2B6AB 3Q8QB 1IWGA 2M88A 3AD8C 3RYLA 2F5GA 1SJQA 3MPWA 5DG7A 1T11A 2XNQA 3DLEA 4Q8FA 3O2IA 1VISA 3W63A 4OZLA 2MMYA 4F8RA 3Q2SC 4RW9A 3DLHA 2UXCF 2DNYA 5DG8A 2KFYA 2ZITA 2VJVA 2MKJA 2J76E 3N6MA 3BN4A 4IOBA 5CAAA 5HL7Q 3QWPA 4GKKJ 4H4KC 4YB5A 4BLGA 2MZQA 2MZ1A 2ZH2A 2VOPA 1QVFR 2AEFA 3MECA 2UUCF 2RRAA 3I31A 3I4PA 1RWMB 4PXEA 3RGIA 4A8WA 3OSPA 3UD4P 4TY9A 3IS9B 1YG0A 1X0PA 1P9YA 2M3DA 3DOKA 4TVAB 3R7NB 2IHR1 2CNNB 1TKDA 4B3TF 1VQLS 3D0IE 1H98A 1WG5A 4NCGB 2CQ1A 1XK8A 4F0MA 3GYNA 1FKOB 4RUBA 2H5IB 2C3YA 3A8EA 5E7OB 5KFIA 4ED0A 1S49A 3M8RA 2FVCA 3UN2A 4M63A 1NZAA 1VR6A 2GGPB 3L9ZA 3GE9A 2MKHA 4JYAJ 2ZJQQ 3GFZA 2VDHA 2HK2A 2V94A 2KG1A 1JLAB 2C2KB 3UPFA 4Q7AA 2MZRA 3EX7B 4C3LA 3Q23A 4DR6J 1DQ9A 2RD5C 4LF8J 3PX0A 4QYZK 3CC7S 1BXNA 4C3MA 4AD6A 4DOZA 3RB4A 2BEFA 1S48A 3K2YA 3FQKA 1RDRA 2CQ3A 1HYSB 2WVEA 1T3OA 2EK1A 3P3DA 4IYQA 4KQZA 4ECVA 1R8HA 4L76A 4Y34A 3T41A 3NRBA 2I9SA 2RKIB 1FXDA 1TKZA 4FNIA 3BM7A 1FKOA 3W5YA 2QN6B 2ZH5A 4K4ZA 1VJQA 2X7IA 1W25A 3O3LA 2GGPA 1TTHB 3CF5Q 4D3HA 1JNZB 1K0VA 1HLWA 2BABA 3DHWC 2VIHA 1WSVA 2HGNA 4CLFA 3M32A 3P5TL 3J7YU 4J9RA 2NXNA 4F4AA 4J9SA 1CS4B 2EEYA 3IAM9 3R5GA 1DTTB 3HDSA 4EBDA 2HHTA 3TAMB 5KG4A 4K4WA 2J9CA 1HYSA 3BREA 1LW2B 1T7PA 1DTQA 5HBMA 4I69A 3T6JA 2DGQA 2KDOA 3KTQA 5KFSA 4DUYF 1BWVA 2NS1B 2N4DA 3W1YC 4X4OA 3MI7X 1HBOA 1PG5B 1TKZB 1N52B 1FFGB 2G2ZA 2KL8A 3FVYA 5CZXA 2B0GA 2I5JA 3CJ5A 5HK4A 3J81U 1NH8A 1BY9A 5E2QA 2HQDA 1T03A 5IV3A 3MFIA 2VFRA 3BO4A 5MLCV 3KLFA 3DDIA 4OI0A 3LALA 4ED8A 1NPKA 3PV8A 4WKRA 4AL6A 4DPUA 1X7VA 1YQHA 3M32B 3RAXA 2XMMA 1Q86T 1HNVA 2WVDA 3QGGA 1FEEA 2GIFA 4O44B 3K89A 3UWTA 2CZVC 2YPZA 4WYLA 4DV6F 3PO4A 1R0AA 5J2PB 4DL7A 5BR8F 2FHJA 1WHYA 2QJ3A 2UZAA 3QLHB 2R42A 4A47A 5HP1B 1ZTTA 3BGRB 3DLBA 1NK6A 1JJCB 1T03B 4KR0B 4N77A 2CZ4A 1S7HA 1RHJB 1MWQA 1TV6A 4IFYB 3LUYA 5CD4A 3OTDA 2DNRA 4JI3F 5CYMA 2FJBB 1HBMA 3H59A 2I2YA 5AT1B 2BE9B 4EYHB 2Z4PA 4BWMA 4DV5F 3H42A 3DLKB 4NLSA 2RH3A 4Y2MA 4OMFG 4OX7A 4Y3CA 3OUYB 4OJHA 1D9AA 3AOBA 3C14B 1HNVB 4PQAA 1O51A 5D8HB 1U8SA 1WEXA 4ZP7A 1ROFA 5KG3A 2R3VA 3PKYA 4FDFA 1RT1A 2H65B 2ZM6J 2FLPA 4OL8A 2BJEA 2IC3B 2O3DA 4ED3A 3QLHA 1UVKA 2QO3A 5GMEA 1S0OA 2UUCJ 2DCLA 1IWAA 5DGBA 4IFYA 4N8NA 4DPTA 1FD2A 2PMWA 1YWXA 2NSBA 3AJ1A 2IVFB 3E01A 4OI4A 3R6LB 3PW0A 1IBLJ 2Z8QA 2CRLA 2CG4A 2DXEA 3CDUA 2IM3A 2QEXS 5CH7B 3KLVA 4WCEQ 2G13A 2XS5A 2WSCC 3GILA 4Q43A 2EK6A 4YR3A 1D0EA 1LV5A 5CXTA 1DFDA 5M2PA 3SQGB 3TO8A 1FX2A 2CPYA 2KO1A 3VCDA 2CQGA 1JLGB 1KLMA 3BN7A 4JI8F 3TA0A 3PR5B 1WKLA 2ROPA 4KHRA 1TKXB 4GVLA 3J7YI 3VAGA 3CCSS 3N6NA 2BOPA 5RUBA 4RNHA 1SH0A 3MEGB 1FCAA 4USKA 4NLOA 4CLUA 3KK2B 2FJDB 3M8ZA 4NYZA 2YH0A 1Y9OA 2BW7A 5C24A 3UO0A 1C4AA 2U1AA 2EG1A 3FSXA 4U7CA 4IOAQ 4QYZJ 3PFOA 1Q82T 2CNKB 4PUOB 2DBBA 4B02A 1CEZA 4IRCA 1O8BA 3W65A 3KK3A 4HYKA 1U0SA 4DL2A 4PCQA 4IRDA 1RJJA 2Q1LA 1QAYA 1RT7A 1QVGR 4G1QB 3ENQA 1TL5A 2HLTA 1HL6A 2J9EA 1HMVB 3HHEA 3HT0A 4HTJA 4ECQA 3R5CA 4LF5J 3OHAA 4ERDA 2AHOB 1TKXA 2HVDA 1NPRA 2J9DA 4K4XA 2R2RA 4NASA 3PNIA 4JBCA 3RBEA 3R5AA 2HHVA 4JI6F 5DQHA 1B0TA 5ADZA 4RPFA 1QUVA 3NEKA 3TVYA 3PRVA 4I2QA 4Q44A 3IR6B 2IBKA 1IBCB 3RR7A 4DR4F 3K0JA 3SZ2A 3CCMS 4ID8A 4DUTA 4CLYA 5D6GA 1XC9A 1FNOA 1KOHA 3FZ2A 1GMUA 2LP4A 4P2XA 3UCUP 1OWXA 2VBZA 4CO0A 1MROB 4P71A 1LK7A 1S77D 3UR0A 2GQ2A 4UY85 1PILA 3BGOP 4RUCA 3PTWA 2VOOA 3FRZA 4ED1A 3WHIA 3PR4A 3OXGA 2Z2MA 1CQMA 1YJNS 4DX6A 3C3LA 5A8KA 2WOMA 1XMBA 3B78A 5J1EB 1VI7A 2W9CA 4DV6J 2H3EB 3AD9C 4NZ0A 4USTA 3D2WA 2ATLA 1B3TA 1CG2A 2NXCA 5D15A 4RO0A 2DNGA 5EWFA 1APSA 2EFPA 2P2CB 2UUBJ 3ZZZA 1RAIB 5IM0A 1XMOF 1PJ6A 2LLZA 1M5PC 1OIAA 4S0MA 1QAJA 1NKCA 1PAEX 1P1TA 4M5DB 3I82A 2LDYA 1RHMB 4GMKA 4ZVSB 3U7JA 2VQFF 3M6XA 3NGRA 3CCRS 1CJTB 3FZBA 4FZVA 4DV5J 3V4IA 3KNAA 4ZCIA 2AGQA 2MHNA 3UR3C 4QIWD 4RNNA 5HLFB 1NK0A 4IDKB 4CRJA 1IKWB 3EYZA 2XO6A 4OYBA 1S57A 3R5BA 2FDNA 1REVA 3VVTA 3GONA 3TAQA 4X4VA 5ETVA 2O1PA 1GT8A 4HT5A 5EUHA 3ZZRA 4PPDA 4JI4J 4TQRA 2IVYA 2F1FA 4Y00A 3MPUB 4ECSA 3HSZA 3T1AA 4LFAF 1JB0C 3KLHA 2CJQA 1FJGF 3MOZA 4CP5A 2ZH3A 2XMWA 4ETZA 2VQEJ 5LM7E 4TNOA 1YSJA 5KFNA 2MQMA 1SC3B 4DR5J 3I9V9 2KHCA 2ZC3A 3QO9B 4ZVUB 2R7WA 5LXRA 3G4SS 4K4YA 3DLJA 3ZZOA 1XWLA 1T0TV 2YWWA 3HSDA 2L3MA 2WVBA 2YY3A 3C15A 4L6V3 3FMBA 4F7VA 3HKWA 2E1AA 4WFYA 2B6AA 2C3MA 2RRBA 1REVB 3S7RA 4EO8A 1NRKA 3EJMA 3DLEB 4DXLA 3UN3A 1YJ7A 2FYXA 3DRYA 4PR6A 4JI8J 2BJ7A 4ZVHA 4PAAA 4ZVRB 1RU1A 3AFGA 4LREA 2HK3A 4MKAA 5HVGA 2R7QA 1YJRA 2F8MA 3ZTPA 1J27A 2HBZB 1LQ9A 3HD1A 2LXFA 1PCAA 3WZ0A 3UCGA 5KG7A 3CIZA 3PVXA 2LXUA 1Q7YT 2KFZA 2OPQB 4LSLB 4DSFA 2ZJRQ 2RE1A 1H72C 2ASJA 1VBZA 1HI0P 1IR0A 3DLGB 3M05A 4ER8A 1R43A 2DGTA 1NK5A 3EICA 2V4JA 4PRFA 1NH7A 4O4RA 3R97A 4MFBA 3X1LB 4WZMA 4CO4A 4RBVA 1ZZNA 2Z0GA 3EUNA 1NDKA 2PGCA 2ATCB 2GHWA 3HFZB 4MIWA 1DY3A 2E5GA 2NZCA 4X84A 5KFHA 4FPIA 4LVOP 1VRTB 1WG4A 3VHQA 2R8JA 1UJ5A 3MM9A 2C3UA 1C0UB 3IWXA 3SCLE 1L3UA 3OBIA 3UCZP 1SV5B 1Q1KA 4XPCA 5J1PA 1YBUA 2DGXA 3JB9k 3IRXA 2C2NA 3KLGA 1K44A 1OSDA 2CJAA 2QA2A 1MMDA 3CT9A 4FVMA 2UXBJ 2QE5A 1T9UA 4PG6A 1Q5VA 2OPQA 4LSLA 3IAS9 4RKUC 1D1UA 2D69A 4EYIB 1IKXA 1EIYB 3F56A 2HWHA 1S1WB 2F7VA 1VQNS 4QIEA 1XN9A 5DZ6A 1FA0A 4X64F 4O3NA 1NLKL 1TL4A 1S1TA 1VGYA 5H1SV 2LDIA 3MUVP 1VMBA 3G8SA 2LQ9A 2UUAJ 4C8ZA 2R7TA 1WKJA 3TJ8A 1Q8IA 1X60A 3QMQA 4X66J 1DJ0A 2XZDB 2QC3A 4J9PA 4DV4F 1AFIA 3CCES 2ZBPA 3UDEA 1GX6A 4ED7A 1SV5A 4M5KA 4WP8A 2BR0A 5KG5A 1RHUB 2BQUA 4LFBF 3KLGB 1QAXA 3RAQA 2E9ZA 3MF5A 4JB8B 1N5TA 4RW6A 2AF6A 3JTOA 1NZ8A 2MJUA 1LWEA 4KE5A 3I4HX 2XY6A 1SL2A 3ETMA 4YN3B 4I6AA 2XSJB 3NKYA 4LRFA 5HMYA 2QIFA 4ILMA 4P9SA 4RBUA 1S6QA 4DV0J 1S12A 1S1TB 1I6JA 1RTHB 2V2KA 2XYHB 3JQKA 4M8LA 2Z58B 4ITSA 4X4NA 4Q0BB 1FFSB 5DETA 1O5JA 2R8KA 3DXSX 1OY9A 5IV4A 4OHWA 3TW0A 1RCOB 2P9GA 2V8GA 4M5NA 5BJRA 2L9NA 4J9QA 2PN6A 3IC1A 3A4TA 3H8YA 3PHEA 4HT7A 3A3OB 3MM5B 4KFBA 2R2TA 2ASDA 4WIIA 4UZBA 4OHYA 3I0RA 4OX9J 1Q53A 1C4CA 4OYWA 1IUJA 1F9HA 2VZ9A 1OQ3A 3AT1B 4LF4J 3EGZA 3GV7B 2HQ3A 3D1QA 4I6WA 2BVZA 3E3XA 1Y5IB 4DCJB 5GMKa 2P8IA 3MM6B 4Q0BA 1R7IA 1FRMA 2I6WA 3P4UB 4LSZB 4FS1A 5A8RA 3KHRA 4JP8A 3B8HA 2FLLA 5C42A 1TL1B 3F41A 3IM8A 3SI8A 1Y3JA 1WTBA 2J6TA 3SFUA 4CM0A 1X4GA 2JC1A 5BYRA 4XTTA 2FJXA 4JV2A 4X66F 4IO1A 4PPZA 3I0RB 1VQ6S 3R5DA 2VH7A 2HS0A 1R8CA 3PW4A 4JI5J 4P7VA 4ANDA 1HQ2A 1AW0A 2QZ8A 4B9LA 4OHVA 1VC5A 3LA0A 4CIOA 1ZM3A 5KT4A 4M95A 4LFBJ 2JRSA 1EAYC 2OD6A 3AXKA 3DOLB 2RILA 1VK3A 4ZP9A 1Q8KA 4P75A 1N6QB 3THTA 3E01B 2FD2A 1EZZB 2XI3A 5L8RC 3W66A 1AROP 3ZZ0A 4DL0C 3ZTOA 3M2RA 1TELA 4OZ1A 4QBUA 2ZC4A 4NA3A 2MKIA 3GWCA 5L1JA 3W2VA 4ZCMA 1RGVA 1DQ8A 1GMWD 1KONA 3M8SA 2UXDF 5C42B 1TL1A 4XPEA 3OJUA 2AV5A 1BQXA 3HULA 4F4ZA 3PYGA 1U1QA 4B9VA 5E3RA 1HBNB 2RUSA 2RHSB 4DV2F 4RWXA 5HROA 4WXOA 2E5HA 2M7SA 5K8OA 3CCJS 2C1EB 1U4BA 4ZCLA 5A8WA 3BBCA 4Y2CA 5LSOA 1RTDA 3ULHA 4Q2MA 4WTYA 4D3GA 2VFUA 4EUVA 2GAHC 3DI6A 3KJNB 4G65A 3A13A 2HFVA 3C8YA 1Q4RA 3MEGA 4C48A 1QSLA 2HHSA 2HHWA 2GC8A 3H5XA 4N76A 1Q8LA 1NJXA 3BQ0A 2A1BA 3T1HF 1XIQA 2MXYA 2QTWA 4RLEA 1ZA2B 3KHLA 5C24B 4DR3F 2BXJA 4EK2A 2CPIA 2HQGA 4M94A 4DQSA 2E7WA 2B8QA 2QFJA 4WXWA 4K2XA 2BQRA 1L3SA 2DNPA 3SV3A 1LXNA 4O4GA 2PO4A 1KTVA 2ZH9A 1U47A 1T9XA 2EXUA 4K5RA 2HS3A 2ZVIA 4IH6A 4PZVA 5E41A 1DLOB 3HFVA 4DPOA 5B0CA 3IRWP 1FFWB 2W9BA 2BE7D 3C6UA 1RWOB 1UZDA 2FJAB 5DGAA 2V4QA 2DGWA 1KQGB 2R7OA 2IDLA 3W8PA 1RE1B 1VCTA 4C8YA 4LBPA 1S76D 2WVFA 5E0OA 2DEIA 3FC9A 1S1VA 5JVHQ 3MMCA 4DCOB 2KVIA 1PIEA 4DV7F 2DHGA 3RB6A 4ED6A 3NCQA 4TY8B 3R7BB 2ADBA 2UVRA 3PY8A 2HLUA 2NPIA 3NGTA 4DL3A 1ZAXA 2QG9B 2IM2A 5DQGA 1HA1A 1JNRB 3KYLA 4DL6A 2AGPA 1G3OA 3FBEA 3H2UB 1YHQS 4V19X 4X2BA 2VKRA 1JLCA 2XMKA 2Q3PA 3VZHA 6FDRA 3RUBL 2XO7A 2DVIA 4K0KJ 1KVJA 4F3OA 2W2PP 1U1LA 1HWIA 2ACMA 3M8WA 2HFOA 4NMXA 1U1PA 3CCLS 2YKAA 1FTCA 1SB6A 2WW4A 4PYAA 2PI4A 4DMZA 1XEZA 4KJIA 2AEMA 5HVHA 2HAIA 2OLWA 1QSSA 2AGOA 2RMLA 2NUHA 4KGKA 1LKZA 3LO3A 3A3NB 3AY0A 3SEOA 1NJIT 4PYDA 2HHHJ 1CC7A 3H98A 3KDOA 4RNOA 4NYPA 4LFAJ 3ITHA 3TQEA 1Q78A 4HVZA 3HJFA 4WYWA 3U27A 1VDHA 3P45B 3O6QA 3H4DA 3NGDA 1ACMB 2DPIA 3MWBA 4ECWA 4TU7A 2GIQA 4WWSA 4ZA1A 3J81j 3JYTB 2GO8A 2BKNA 3H5SA 1OPZA 1UJ6A 2LMIA 3EXCX 1KKHA 2CQPA 3LF0A 4KH0B 3SSQA 2FGOA 1KR4A 2NQPA 1S9GA 2CVIA 3TOQA 1RAHB 2KM8B 5HN0A 2EBEA 3PIOQ 5H9FK 4P73A 2MSTA 1Y5NB 1CQNA 2MZJA 1NK8A 1SL0A 3TRGA 3N0VA 2IDEA 4EGLA 3MDFA 4RW8B 2YWEA 3FCVA 2LECA 4B17A 3RR8A 2RHQB 2ZZTA 3PM9A 4B3OA 2FY8A 3RZAA 2Y3YA 2OUGA 2BX6A 2UU9F 3IG1A 2H5EA 3JAMU 4N41A 4TLRA 4MIAA 4CLTA 1FKPA 2AW0A 2FZGB 1D8YA 1N5QA 1VQ4S 2WB1D 3SBMA 4FBUA 4B9MA 3OD2A 3ZZYA 4AFFA 3QT8A 4LIWA 3H25A 2OMLA 4C4WA 4WZQA 1JLFA 3CMES 2HVHA 4DWIA 7FDRA 2EVZA 4USHA 4CO3A 3W8GA 1NKEA 3J7Z5 3MM7B 2R8GA 1RWVB 3KHGA 1CSJA 4P2FA 5H9EK 2XWYA 3NCPA 1S72S 5DDOC 4W4MA 2GVDB 1D9FA 2JHEA 5F8MA 4U67Q 1F9FA 2DRAA 3O1LA 2F3JA 2KJVA 3KUEA 4IRKA 2CG8A 2A6OA 1SH2A 4FF1A 1NMEB 5EGYA 3RB0A 1FKPB 3JTPA 1JLQA 1RABB 4X65J 2K1RA 1RWWB 3KLEA 1ZTWA 1KRPA 3LP0A 3IWNC 3HVWA 2QX0A 1U1RA 2XLKA 3Q8YA 4C0HA 1ZAWA 2F8EX 1HBUB 2Z2LA 3KJVA 4DL4A 4XK8C 2E9TA 2UXBF 1YZ7A 1IVZA 3DMJA 5C7PA 3OL7A 5HVFA 4LT6A 3HVRA 2DRDA 4N47A 3BPSP 1V3ZA 3UNYA 3W9HA 2XS2A 1EP4B 3QSIA 3TZWA 2D1CA 3TUZC 4PQUA 4MYTA 5KFOA 3GP9A 3Q86A 2K06A 3TNVA 3J80Y 1V3SA 3FNNA 4I2PB 2B9XA 3QAUA 2W9AA 2N7YA 3OTBA 1GFWB 1WC4A 4I68A 3UW1A 3KLIB 3VAHA 4ECRA 4O3SA 1AT1B 4DFKA 3M9MB 3CW2C 3E8OA 4A48A 2VQEF 3KLEB 4DV4J 3KG0A 5DDRC 4ZVPB 4J9KA 1VQMS 2KFNA 1ZM2A 1X4BA 4NLYA 3TZZA 4FXWA 2D41A 4ZP6A 4EFAC 1M90T 3H2LA 4DCPB 2JC0A 3NXZA 1KVIA 2EC2A 1WTFA 1TVRB 1X4AA 2J8SA 3OXLA 2ZD1B 4ZPTR 2X1GA 3CGIA 3G8TA 3LWLA 1RHRB 2XCPA 1RT4A 2E1RA 1YX2A 1IBMF 1UZHA 2KN4A 3C6TA 3GZ7A 1C0TA 3MEDA 2X3DA 4M1KA 4I2PA 2B8PA 4QW9A 3Q24A 4CH0S 2KTQA 1B4SA 2VDIA 3C16B 5CHCB 5I42B 3PW2A 3HT3A 3CNQP 2FPHX 3M2VB 4OYAA 4QOTA 1UP1A 1KWMA 2CQDA 2MHEA 3CCTA 3IP0A 4LR9A 5IFMA 2DY1A 2RJZA 4XDCA 3G6ES 2YX1A 1RKJA 3N5BA 5ETOA 5T7LB 3OTOJ 2RDIA 3GFXA 4IOCQ 2BM0A 2G0IA 4HDGA 4F4XA 1VQPS 1LWEB 3LAMA 4FKXA 3M9OB 1LEOA 2X1FA 2UP1A 5HI7A 4X65F 1OYEA 4ES1A 2NXUA 1R8PA 4YR2A 1FXLA 3B6BA 3UD3P 4NMLA 3TEGA 3K5MA 4FPRA 3LH2S 3Q0AA 4J9NA 4NI2B 4MK8A 2DH8A 1T02A 1HHSA 2FVSA 1W7WA 3CJ4A 1T94A 1HNWF 3M2VA 2W2QP 4H4KA 4B08A 4QPXA 3VGUA 1RYRA 4RW4A 3NY0A 2G1HA 4AXIA 3HM9A 1IM6A 1KQFB 3QGPA 3PX4A 1SJ1A 5LT5A 1EQ0A 1GH8A 1REGX 4OHXA 1VQOS 3ISND 4AL7A 4JOUA 2A2CA 1NSQA 1PC4A 2CJXB 2IVMA 2DIVA 4X4TA 4U7UD 3D7SB 3FEZA 2NR0A 1S97A 2HFUA 3POTB 1KEKA 5CABA 2WK4A 2VKZG 2XLIA 1R0BG 2YPYA 3QRQA 4NI2A 1W26A 1IKVA 4C0BA 3N4WA 2AJFE 5DZ7A 1VQ8S 5A8RB 1M5OC 4LMZA 1B7FA 3CD6S 1WOSA 5KT6A 4ZOSA 4B3MJ 3B4DA 2BZ2A 5DO2A 4ED4A 4Z7CA 3HHKA 4LFCF 4WE1A 5HO4A 1QSYA 1D8ZA 4I67A 4ZCKA 3GFYA 1FWLA 5F8LA 4EBEA 4ZVQB 1WOOA 2YQ3A 3CCQS 3BSOA 1VLYA 5H9EJ 4MKYA 5KFFA 4WK3A 4ZPBA 3K59A 1X0FA 2JEJA 4B3RJ 2OI2A 5L1IA 1R0CB 3BH7B 1T05B 3PDNA 1RP5A 1VQ7S 2ZHOA 4ENOA 4ZLJA 3TJAA 4CNZA 2XTJP 2RQMA 4QQBA 5C2CA 3R5JB 2FJWA 1UVNA 4PG8A 3M8PA 1SI9A 3M2RB 1IKVB 5GAHI 3IFEA 2CZ9A 3H4BA 3IN5A 2KT5A 3FEYB 2QA4G 2HWIA 3V4MA 1H2UX 2H9ZA 3I0SA 3T6BA 4K59A 2BRLA 2I0XA 3DGVA 5J2MA 3DCAA 2E44A 5CCMA 2BANA 3JSMB 2YKQA 1QTNB 5E3QA 5LJ3Y 2GMLA 1H6KX
chains in the Genus database with same CATH topology
3DDIA 3R9LA 4F36A 1NPKA 4ANCA 3ELHA 5IOLA 4UOGA 3FC9A 1F3FA 5BXIA 3ENAA 1HIYA 1NB2A 3ETMA 3NGTA 4C6AA 4HR2A 2VU5A 3VGTA 1BUXA 3ZTSA 3BH6B 3FBEA 3FCWA 4S0MA 3EMTA 1PAEX 1S5ZA 3FKBA 1XQIA 4FKYA 1NUEA 1HHQA 3Q83A 3NGRA 2B8PA 2DY9A 1NHKL 1B4SA 1NDLA 1NCLA 1F6TA 3DKDA 3PJ9A 2DXDA 1S57A 1MN9A 1NSPA 1B99A 1UCNA 3VVTA 4UOHA 1PKUA 4ANEA 3WX8A 4FKXA 5CAAA 1LEOA 3BBFA 4CP5A 2NCKL 1NDCA 3VVUA 3B6BA 3FBCA 1WKKA 2ZUAA 4UOFA 1W7WA 2DXEA 2HURA 1BHNA 3FBFA 2CWKA 3Q8VA 2AZ3A 3VGUA 3EJMA 3FBBA 4W98A 1KDNA 1U8WA 3FCVA 3EVMA 1VYAA 2BX6A 3B54A 3EVWA 4ANDA 3GPAA 1WKLA 1NSQA 4WBFA 2DYAA 3ZTPA 4DI6A 1EHWA 2BEFA 3VGVA 5CABA 3EE3A 3G2XA 3EM1A 3Q89A 3VGSA 3ZTOA 1S59A 3JS9A 1NDPA 3EICA 3L7UA 1LWXA 1NDKA 3BBBA 1BE4A 3NGUA 3BBCA 3ZTQA 1HLWA 4O0NA 2HVDA 3MPDA 4F4AA 1NSKL 3BH7B 4ENOA 3NGSA 2AZ1A 2DXFA 1K44A 1ZS6A 3PRVA 3Q8UA 3Q8YA 1XIQA 4EK2A 5C7PA 4DZ6A 1JXVA 1MN7A 2HVEA 2B8QA 4DUTA 3EVOA 1NLKL 3ZTRA 3GP9A 3Q86A 4KPCA 1WKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDI A;  3R9L A;  4F36 A;  1NPK A;  4ANC A;  3ELH A;  5IOL A;  4UOG A;  3FC9 A;  1F3F A;  5BXI A;  3ENA A;  1HIY A;  1NB2 A;  3ETM A;  3NGT A;  4C6A A;  4HR2 A;  2VU5 A;  3VGT A;  1BUX A;  3ZTS A;  3BH6 B;  3FBE A;  3FCW A;  4S0M A;  3EMT A;  1PAE X;  1S5Z A;  3FKB A;  1XQI A;  4FKY A;  1NUE A;  1HHQ A;  3Q83 A;  3NGR A;  2B8P A;  2DY9 A;  1NHK L;  1B4S A;  1NDL A;  1NCL A;  1F6T A;  3DKD A;  3PJ9 A;  2DXD A;  1S57 A;  1MN9 A;  1NSP A;  1B99 A;  1UCN A;  3VVT A;  4UOH A;  1PKU A;  4ANE A;  3WX8 A;  4FKX A;  5CAA A;  1LEO A;  3BBF A;  4CP5 A;  2NCK L;  1NDC A;  3VVU A;  3B6B A;  3FBC A;  1WKK A;  2ZUA A;  4UOF A;  1W7W A;  2DXE A;  2HUR A;  1BHN A;  3FBF A;  2CWK A;  3Q8V A;  2AZ3 A;  3VGU A;  3EJM A;  3FBB A;  4W98 A;  1KDN A;  1U8W A;  3FCV A;  3EVM A;  1VYA A;  2BX6 A;  3B54 A;  3EVW A;  4AND A;  3GPA A;  1WKL A;  1NSQ A;  4WBF A;  2DYA A;  3ZTP A;  4DI6 A;  1EHW A;  2BEF A;  3VGV A;  5CAB A;  3EE3 A;  3G2X A;  3EM1 A;  3Q89 A;  3VGS A;  3ZTO A;  1S59 A;  3JS9 A;  1NDP A;  3EIC A;  3L7U A;  1LWX A;  1NDK A;  3BBB A;  1BE4 A;  3NGU A;  3BBC A;  3ZTQ A;  1HLW A;  4O0N A;  2HVD A;  3MPD A;  4F4A A;  1NSK L;  3BH7 B;  4ENO A;  3NGS A;  2AZ1 A;  2DXF A;  1K44 A;  1ZS6 A;  3PRV A;  3Q8U A;  3Q8Y A;  1XIQ A;  4EK2 A;  5C7P A;  4DZ6 A;  1JXV A;  1MN7 A;  2HVE A;  2B8Q A;  4DUT A;  3EVO A;  1NLK L;  3ZTR A;  3GP9 A;  3Q86 A;  4KPC A;  1WKJ A; 
#chains in the Genus database with same CATH topology
 1Y3K A;  2LA6 A;  2V5H G;  2HFZ A;  4OQJ A;  4ANC A;  3I56 S;  2WHO A;  1FER A;  1RTD B;  1VQ9 S;  1SIW B;  1RAF B;  1FRI A;  2CQ4 A;  3IGN A;  3DI6 B;  1RWX B;  1FDD A;  3J7A N;  3QRR A;  2Q6C A;  1UL3 A;  2DD8 S;  2NUU G;  4QWE A;  3TWZ A;  1I94 J;  4RNF A;  3FDS A;  3QGI A;  4OYI A;  3KFW X;  4UF4 A;  3L4B C;  1X8D A;  2QSF A;  5BXI A;  1RAO A;  3MR6 A;  4ID5 A;  2GJI A;  2VC1 A;  1NB7 A;  3S8S A;  3LP1 B;  1MML A;  4QYR A;  4C98 A;  8ATC B;  4DS4 A;  1N4L A;  2LQB A;  1C2P A;  2PMH A;  4O4G B;  3FKB A;  1XQI A;  2JH3 A;  1NU4 A;  4C8L A;  4KY3 A;  3IR7 B;  4CLS A;  1SXL A;  4IQX A;  4JYA F;  5J2M B;  1FHT A;  2GQC A;  1DLO A;  2XZW A;  4K0K F;  5F8N A;  1UJ4 A;  3DM2 A;  4K50 A;  2VHG A;  1U48 A;  2CXE A;  3HJV A;  3CIM A;  2OKQ A;  2E5L J;  2EFG A;  1OY8 A;  4Y0F A;  1B0P A;  1NSP A;  4CLK A;  1B99 A;  3KUG A;  2I38 A;  2OGU A;  3I5B A;  4WIQ A;  2PI5 A;  1K9M T;  2Y1L B;  2HS4 A;  2W4P A;  2HNY A;  3OT9 A;  2CQH A;  3SIP B;  5I3U B;  3QAT A;  4KGX B;  5GAD I;  2UXD J;  4ZIW A;  1PO6 A;  1JXE A;  2NXE A;  1IR2 A;  3ET6 A;  3HHL C;  5FD1 A;  2R7X A;  4OX8 A;  2APO A;  3O44 A;  1FK9 B;  1JXL A;  3GSD A;  2J6S A;  1S79 A;  2CDR B;  3H90 A;  4CTA A;  3CMQ A;  3VQS A;  4U6P A;  1UTA A;  3OSN A;  5A2Q Y;  1HNW J;  4FYW B;  1QY7 A;  5HJY A;  3VAJ A;  2HUR A;  3G9C A;  1I5O B;  1N5V A;  3QT6 A;  3QJJ A;  3A8K A;  1HNX J;  1QTM A;  2RKI A;  2R7R A;  1TK8 A;  3BGU A;  2EFO A;  2EKN A;  1FRL A;  3P8B B;  4HL9 A;  5E33 A;  1QUP A;  2QFI A;  2F4F A;  3QFW A;  1KVK A;  1WC0 A;  5F0U A;  5HAT A;  2IMO A;  3NS6 A;  5D77 A;  3MCN A;  3VQT A;  3EVM A;  4UUW A;  2BMB A;  1MW7 A;  2CAD A;  4NLQ A;  4F67 A;  3J80 U;  1U0H B;  1YZ6 A;  2GVZ A;  3GV8 B;  3R1H A;  4DR5 F;  3KG1 A;  4LRB A;  4OYM A;  4N56 A;  2DNN A;  3ICL A;  3LP2 B;  4RJV A;  3THP A;  1DTT A;  1KBR A;  3G6V A;  3IXQ A;  2HND A;  4ZPV R;  1ZM4 A;  1HW8 A;  3LGN A;  2G9O A;  4Z7Y A;  2ZJP Q;  3D67 A;  4Q45 A;  1HHT P;  4K4V A;  2DR6 A;  4DV3 J;  1S9G B;  1XTZ A;  3RW6 A;  4C8M A;  3FSY A;  1VC6 A;  1S0M A;  1Q8B A;  4EZ6 A;  4XDD A;  2V34 A;  1VBX A;  2HMI B;  1BQM A;  2VOD A;  4RW8 A;  1S6P B;  4K5S A;  1G2E A;  3MTJ A;  1VIO A;  2HWT A;  3DNC A;  4B3O B;  3JSB A;  4JI2 F;  3H5U A;  2Z56 B;  1X5T A;  2YNH B;  4IG3 A;  3N5F A;  1NK9 A;  3JXO A;  4UZC A;  2ZH4 A;  3US5 A;  3C19 A;  2KI2 A;  3F44 A;  3T9Z A;  3EZU A;  4G1P A;  4USU A;  5HQM A;  3LP2 A;  1DBD A;  1FES A;  4U96 A;  5KFA A;  2KT3 A;  2L48 A;  2VG6 B;  2FZC B;  2F63 A;  3U1L A;  5AJ3 J;  1RBA A;  1L3T A;  2PII A;  2OPP A;  5IQQ A;  1WSR A;  1U09 A;  1R0A B;  1T3N A;  4WTO B;  2E1P A;  5GAG U;  1JJ2 R;  3CE8 A;  2JEG A;  3SQO P;  3LAN A;  4FXD A;  3BGR A;  3UD5 A;  4LSN B;  4AUK A;  1LW0 B;  4K7Q A;  5JJB A;  4B9U A;  4JI1 F;  3AHP A;  4RZR A;  1TV6 B;  1Z1Z A;  3HZE A;  2PEB A;  2W01 A;  2GVD A;  1VRQ C;  3NBP A;  5CYM B;  3EPI A;  1S6P A;  3KXD A;  4O3Q A;  3TJ9 A;  2N3O A;  1TL3 B;  4EZ9 A;  1RT5 A;  4I64 A;  3PAC A;  2CPD A;  4QWD A;  5H9F J;  1KFD A;  3W5X A;  2UUT A;  3T19 A;  4DFP A;  1N88 A;  1JLQ B;  2JVR A;  3W9J A;  3UDC A;  2XGQ A;  4DUZ F;  2OPP B;  4AT1 B;  4U8V A;  1FWP A;  5ETQ A;  3FCH A;  3M6V A;  3BQ1 A;  1CLF A;  3ENA A;  4A8S A;  4IFV A;  2HGL A;  2R4F A;  2HPU A;  2AJ1 A;  2DK2 A;  3GYG A;  1KC8 T;  2YNG A;  2JLG A;  2PC6 A;  2D74 B;  1RZM A;  3NBP B;  1TFY A;  1IBM J;  3PYF A;  4R25 A;  4DV3 F;  3PJ9 A;  3BGL A;  3FFI B;  2K3K A;  5D78 A;  3OL9 A;  4MKV A;  1WEY A;  2NXJ A;  2Y1I A;  3ISZ A;  1MN9 A;  2MKY A;  2OAU A;  1EKS A;  3IA0 A;  4O23 A;  3SCJ E;  2YKO A;  5D0R A;  4DL5 A;  5IS2 A;  2DHH A;  1HWJ A;  1TL7 B;  1YDL A;  1CVJ A;  3OVB A;  2C2Z B;  1U2C A;  2IM1 A;  1IQZ A;  1ICE B;  1S1U A;  4JI7 J;  3PCO B;  1PKU A;  3GQC A;  1P6T A;  1AUS L;  1HAR A;  3FRY A;  4DN9 A;  4LF6 J;  4F04 B;  3OTO F;  2HNZ B;  3NWR A;  3QSY B;  2M52 A;  4X4Q A;  3MOJ B;  2X51 A;  3BBF A;  3W60 A;  3DDK A;  1TVR A;  1MWY A;  4A46 A;  1IR1 A;  4H4O A;  3QIP A;  4RUA A;  4C7Q A;  1RXO B;  2YNG B;  1HI1 A;  4DU8 A;  2DR7 A;  1CC8 A;  2XLJ A;  1M5V C;  3M7V A;  2MDA A;  5CCL A;  1HNX F;  3IWL A;  3BDE A;  2XYP B;  1KOO A;  4PUO A;  4DDF A;  3CTR A;  5AXK A;  5HJX A;  4DX5 A;  1JWW A;  2UV8 A;  1FEH A;  1HPZ B;  3MR7 A;  5ETL A;  2ZUG A;  2VF3 A;  2J0Q D;  1B70 B;  5FDL B;  2G4B A;  2KKH A;  2DGO A;  4W98 A;  3AQP A;  3KJQ B;  4G1Q A;  2RVJ A;  3NNA A;  2ZNY A;  5AXL A;  2XQC A;  2C2O B;  4Q5V A;  1KHW A;  2ZHB A;  4GKJ F;  3HSJ A;  2B51 A;  2LVW A;  3NMR A;  2VA2 A;  2N3L A;  4YP3 A;  2RSQ A;  2QYC A;  5A0Y B;  2DNM A;  5KFT A;  2PE8 A;  3GR0 A;  2ZH7 A;  4B3T J;  1WC6 A;  4ZN3 A;  4HAC A;  3SFG A;  5KAK A;  3TR5 A;  1U6B A;  4QJV A;  1VC0 A;  2VG5 B;  2LU2 A;  3G2X A;  2UVU A;  3NLC A;  5KFU A;  3D6M B;  1K8A T;  2GZO A;  2O67 A;  1S59 A;  2OEL A;  4J7C A;  4NZ6 A;  4ZVT B;  2LEP A;  1N56 A;  1LWF A;  4ZLL A;  2P6S A;  2VPZ B;  5BYQ A;  1S9F A;  4LR7 A;  4B9S A;  5CYQ B;  4BWJ A;  5D3G B;  4C8O A;  4GO7 X;  4ED5 A;  1F9E B;  2OP5 A;  5KOX A;  4B3M F;  2DO4 A;  3GCX P;  2X1A A;  1BE4 A;  2OEJ A;  4ZVF A;  4OI3 A;  2HQF A;  3V6D A;  1TKT A;  2MZS A;  2YKP A;  4ELV A;  1WOR A;  1RAJ A;  2AX1 A;  1UW9 A;  4J9V A;  1RYS A;  1AFJ A;  4OI2 A;  3NOG A;  1I3O B;  4K2J A;  4I1T A;  5IC6 B;  5AJ3 F;  4ECU A;  3DXB A;  4LBI A;  1ZOT A;  2H51 B;  3HHL A;  4X62 J;  3SV4 A;  3CJR A;  1U2F A;  2DGU A;  3WIV A;  2GHP A;  1NK4 A;  3TZY A;  4ELT A;  1X5O A;  3DYA A;  3OL6 A;  2V68 A;  5A76 A;  2W7A A;  5E3C A;  2MQP A;  1LWF B;  1X4F A;  3EVO A;  1A7G E;  1HFE L;  4YHH F;  1RU2 A;  1DAX A;  1VFJ A;  3B82 A;  1KP6 A;  2AD9 A;  1VHI A;  3GIK A;  1SVD A;  3AAW B;  3JSY A;  1DZ5 A;  3RU0 A;  5EX0 A;  1N5S A;  3W61 A;  3J81 Y;  4KRW A;  4A8M P;  3R9L A;  4LJM A;  2DKO B;  2NYI A;  3PRB A;  3GTY X;  1YRX A;  4KH1 B;  1TP7 A;  1VHF A;  3CJK A;  1LFW A;  1C1C A;  2CA9 A;  3G87 A;  4OV1 A;  3T1H J;  3FSI A;  2ERR A;  4FYD A;  1RBO B;  2FTR A;  2XGP A;  4YME A;  4DUY J;  5DM7 Q;  3C2P A;  3THV A;  2ZDO A;  2GHV C;  5AXN A;  4P2S A;  4DG1 B;  5IXU A;  3RB3 A;  2J7W A;  4HKQ A;  2AJ0 A;  2UU9 J;  1NSA A;  1HKA A;  2YX7 A;  3CB4 A;  1PYS B;  1N32 F;  2P9C A;  1VBK A;  2DR5 A;  3M8Q A;  4AXJ A;  3B4M A;  3JSR A;  1K1Q A;  3D0H E;  1PBA A;  2B4O A;  2V8H A;  2VG7 A;  2YKN B;  3IBF B;  2H5J B;  3S6E A;  4RU9 A;  4P2M A;  5GAH U;  4P72 A;  3GFH A;  4QZV B;  2GJ2 A;  3KK1 A;  1EB0 A;  1NDL A;  4YB7 A;  6AT1 B;  2RT3 A;  3CCW A;  5IZH A;  1F0X A;  1FT8 A;  4ZPD A;  1RAG B;  3IBC B;  4CLL A;  3HHL D;  9RUB A;  3T5J A;  4DF4 A;  3D1O A;  1C1C B;  4WF9 Q;  2VAS A;  1XMQ J;  1G4C A;  2D9O A;  2W2M P;  2L9D A;  1F60 B;  1KNZ A;  3VAL A;  5KFY A;  1RK8 A;  2MYF A;  1AZS B;  3GJQ B;  5KFL A;  5KT3 A;  2VBX A;  3O5T B;  5SZT A;  4DLG A;  3LQV A;  5E3A A;  1F2G A;  2EFN A;  2V8V A;  4ID5 B;  4L73 A;  4ES2 A;  3G96 A;  3PW5 A;  1VK8 A;  2V0N A;  3LP1 A;  4V1A k;  5F0W A;  3BKU A;  4RU2 A;  1E6V A;  3M30 A;  1BWE A;  2YKN A;  2CPH A;  3NS7 B;  4Z37 A;  5GAE U;  1QLN A;  3CJ8 A;  3BDP A;  1UEK A;  2ROG A;  1SKR A;  1HQU A;  5D4P A;  3SCI E;  3GIJ A;  5LJ5 Y;  4NCB A;  1H0H B;  1X4E A;  1HNZ J;  4JV5 F;  4HH0 A;  1P9Q C;  3F0N A;  2UVW A;  2J0W A;  1FD8 A;  2MY8 A;  3VZI A;  2HHH F;  3M9N B;  3KHH A;  4MT1 A;  4YB1 P;  2WBR A;  5L1L A;  3FJ2 A;  4QR2 A;  4RW9 B;  4TKT A;  3SMZ A;  1AZS A;  4ZN1 A;  2WW8 A;  1IJE B;  5IQ6 A;  1FRK A;  4I6Y A;  1LXJ A;  2PD1 A;  4USI A;  2Z57 B;  5I3U A;  3MCM A;  3PXG a;  4DEZ A;  4CDI A;  4ZPA A;  4ZLN A;  4DSE A;  2BKP A;  2KYZ A;  4NLW A;  2DNL A;  2PFF B;  1RTJ B;  1RT3 B;  1X5P A;  3EGN A;  4WBF A;  4QU7 A;  4RX6 A;  1E6V B;  1CS4 A;  5KFE A;  2KB2 A;  2ZBQ A;  2WSE C;  2RQK A;  2VL1 A;  2RQ4 A;  1JX4 A;  2LQ8 A;  2HQC A;  3H7H B;  2DNO A;  3IS9 A;  2OPR A;  4KBI A;  2Y8Y A;  1F5B A;  1YJW S;  3C46 A;  4L74 A;  2JEF A;  4OLP A;  2FLO A;  3MR3 A;  4UW2 A;  3BO3 A;  1S10 A;  4DJB A;  2HQI A;  4J9L A;  2A18 A;  2C3P A;  2POK A;  1A6L A;  2I5J B;  2A6M A;  2FGC A;  4ZVE A;  1X31 C;  1JJH A;  1RHK B;  1RTZ A;  1NK7 A;  4F0H A;  3TYT A;  2GS8 A;  1VS3 A;  2ZBC A;  4ZKA A;  5IWA F;  3BQ2 A;  3NGU A;  2ZOG A;  2B56 A;  4ALZ A;  4NLV A;  2PFD A;  4F0K A;  2E7V A;  1JLA A;  2CQ2 A;  2GMH A;  3TI0 A;  5B0D A;  2OO4 A;  2Z2Z A;  5K9F A;  2DHS A;  3MPD A;  4X62 F;  1FJ7 A;  1PC5 A;  5KFQ A;  4O44 A;  2BQ3 A;  2BJ8 A;  3QZ8 A;  3V2U C;  5IT4 A;  2B5J A;  4NLG A;  3U1N A;  2LEB A;  1RAC B;  4ECX A;  1XR5 A;  3OR2 A;  4NLT A;  2G2O A;  1Q95 G;  3H5Y A;  2G0C A;  5AE3 A;  2F4V J;  3NAI A;  5HP1 A;  1X9W A;  2Q43 A;  3S01 A;  1YRT A;  3TA2 A;  4LRC A;  2HZC A;  4ECY A;  4TU8 A;  3NL0 A;  3QPI A;  4O3O A;  3I5A A;  1NKB A;  1L3V A;  1A0O B;  1F2H A;  5KG0 A;  1R8B A;  1BQM B;  2F8H A;  3I87 A;  4KPC A;  3CED A;  2DR9 A;  4E2F B;  3DHX A;  1Q79 A;  5G0R A;  1HNZ F;  4LF9 F;  1ZPV A;  2C3O A;  2K7J A;  2XM3 A;  3IM9 A;  3DRP B;  3PFE A;  2ZKT A;  4NXN F;  2EBG A;  3V5R A;  3T5L A;  4KB7 A;  1HQE A;  3TZX A;  4DX7 A;  1IN0 A;  4FP9 A;  4MK9 A;  2MQN A;  5EWE A;  3BO2 A;  2VG6 A;  4OX6 A;  2P5V A;  2B5J B;  1F5A A;  3QQC D;  1F3F A;  3MMB A;  3OFF A;  4KC5 A;  3TAM A;  3OR2 B;  4ZDN A;  3ZZT A;  2MQL A;  1UWB B;  4DUZ J;  3TVZ A;  2DH7 A;  1RLC L;  2E29 A;  1RLD A;  4G6V B;  3V81 A;  4HR2 A;  3VGT A;  4LSN A;  3OJS A;  3BH6 B;  5KTQ A;  2MKS A;  2IYI A;  2MPU A;  2YQ0 A;  2KHD A;  2A2D A;  1YGY A;  1U1N A;  2BW2 A;  2HHX A;  3X3U A;  1FNX H;  1TUG B;  1OMS A;  1UEV A;  5KFW A;  4DQI A;  3NWG A;  2UVV A;  1TL3 A;  3LGM A;  2CQC A;  2XB2 D;  1U1O A;  2WON A;  4O3R A;  3M1V B;  1U26 A;  3DRP A;  2RF2 B;  1PGZ A;  2RIJ A;  3DGP B;  4M5M A;  2E1C A;  1D3W A;  1F1B B;  2V9K A;  4CZC A;  1RKI A;  2YVS A;  1S4F A;  3PYE A;  3D54 A;  3A12 A;  2RU9 A;  3E51 A;  5DQI A;  3PIP Q;  1RCX B;  3ZXW A;  4CM2 A;  5IWA J;  2J5A A;  3EXY A;  3CJ2 A;  5B08 A;  2XG8 A;  2DNQ A;  2EPI A;  3EDR B;  1JLG A;  1KLM B;  2AIR B;  2CVE A;  4WFZ A;  3RBD A;  1N36 F;  4B3R F;  2MB0 B;  5D4N A;  5HMW A;  4JI7 F;  1JJ4 A;  4IFV B;  4A8Y A;  3V6H A;  3VR1 A;  2D3O 1;  3HKZ D;  3TX0 A;  1OYD A;  1U24 A;  1HWL A;  2MY7 A;  1S1X A;  4QIV A;  2FY1 A;  2KVQ E;  3DOL A;  2A0F B;  5F8G A;  3KK2 A;  2WB4 A;  3H2V E;  3BS9 A;  1UFL A;  1LNQ A;  2B7C B;  1V9O A;  2MQ8 A;  3MPY A;  1D09 B;  2WCX A;  2XI2 A;  3PHT A;  4K8R A;  4BC9 A;  4QW8 A;  4QIG A;  5K5M A;  4JI2 J;  4B9N A;  3RBZ A;  4JI4 F;  3CDW A;  3FBF A;  3W2V B;  1DUR A;  8RUC A;  3M1V A;  8AT1 B;  3CUN A;  4DQR A;  2Y8W A;  3HPO A;  4UTG A;  4ZLP A;  3L7O A;  3CC4 S;  3DGP A;  2M8H A;  2CKW A;  2QLW A;  5KFV A;  3QZ7 A;  2XMA A;  4R8U B;  4MJK A;  1M1G A;  4E8U A;  5A8W B;  5LXY A;  3R2D J;  4QR0 A;  4G3I A;  4DR3 J;  3LPY A;  1OO0 B;  4LRA A;  2J6U A;  4NXM F;  1J5E J;  3EVW A;  3SSR A;  5HSP A;  2HNZ A;  1GMW A;  4WFN Q;  2A3J A;  1Y5L B;  4ECZ A;  4PWD B;  4ZPC A;  3ZZU A;  4GKJ J;  4KKO A;  1RWN B;  4H4O B;  3JQM A;  3LAK A;  1XBW A;  1KLN A;  1GXL A;  1HW9 A;  5EX3 A;  1NBE B;  2GIR A;  2MLY A;  3EM1 A;  3MEK A;  1G6B A;  1R6Y A;  2XHC A;  3CDA A;  3G82 A;  3GU0 A;  2CNL B;  3Q89 A;  4RW7 B;  4A8O A;  2FLN A;  4YB6 A;  3ZFV A;  3JS9 A;  4UT4 A;  2CNO B;  2KRR A;  4J37 A;  2M8D B;  1FE4 A;  2CPJ A;  2X1B A;  1HPZ A;  5ETS A;  5L1K A;  3MEE A;  5B0G A;  3HZG A;  3UVJ A;  5K14 B;  4J90 A;  5A6W A;  2IAJ B;  1TR0 A;  2W2N P;  2WSF C;  2XMV A;  4R8U A;  1HD0 A;  1SQF A;  2CJK A;  1BC6 A;  1I1G A;  1NEE A;  2A10 A;  1S6O A;  2BJ3 A;  1J2V A;  1DQA A;  3A8J A;  1C1B A;  2CUY A;  4G1I A;  3QAE A;  1DHM A;  4OI1 A;  5K8N A;  5A8K B;  1S4E A;  1NSK L;  4PWD A;  3OQ2 A;  1XR6 A;  5ETP A;  1H73 A;  3RG6 A;  2W9C B;  3QWU A;  2BE2 A;  5KG1 A;  1G7C B;  3MMC B;  2XS7 A;  3Q8U A;  4OYX A;  5KFP A;  3GB0 A;  1Y00 A;  3BPD A;  4LFC J;  3G82 B;  4L72 B;  2B3T B;  5IM0 B;  2WTF A;  4OV6 A;  5I3P A;  5B7W A;  4YS2 A;  1MN7 A;  4PWW A;  2C28 A;  3UDL A;  4F3M A;  3D1H A;  3MM8 A;  2LEA A;  4F2R A;  2GO9 A;  2BAC A;  3UVJ B;  1SH3 A;  5K14 A;  3QYY A;  5J2Q B;  4XO0 A;  3TUJ C;  4IH5 A;  4TYB A;  4CLZ A;  2KJW A;  3V6D B;  4FF3 A;  3PJW A;  2JDJ A;  3T5H A;  5I3Q A;  1YK9 A;  2EW9 A;  2AMC B;  3UDV A;  2W4D A;  1T9V A;  3OLB A;  2LFV A;  1HD1 A;  2DCU B;  4OYP A;  2BE2 B;  4L75 A;  1U02 A;  1R3N A;  2ZDP A;  2HZA A;  3A3P B;  3CJ3 A;  2N82 B;  3I5C A;  5DM6 Q;  2BRK A;  4LIR A;  3TA1 A;  4TXS A;  3OV7 A;  1SJR A;  2JSX A;  4C6A A;  4DS5 A;  3NP5 A;  3G71 S;  3ILO A;  4YDX A;  3S1T A;  1UVL A;  4NEY A;  3LWM A;  1S0V A;  1I51 B;  3CSK A;  2OMO A;  4FKY A;  4E0D A;  1NUE A;  1MRO A;  1YJU A;  2QLX A;  3CXC R;  5D0G A;  4GC6 A;  5J2Q A;  2DY9 A;  3JYT A;  3W64 A;  4QCL A;  1NCL A;  2DPJ A;  1BQN A;  1UPM B;  3DKD A;  5I4M A;  2I1R A;  2IYG A;  4NOH A;  3QRP A;  1FRH A;  1NO8 A;  1OY6 A;  1AB8 A;  4WK1 A;  5FII A;  1UCN A;  2HSE B;  2OSR A;  5FLX U;  2XY7 A;  4HHU A;  2KYX A;  2ZWP A;  2HZV A;  1WF2 A;  4ZJQ A;  1UVJ A;  1SQE A;  3OFE A;  3GR1 A;  4UOH A;  4DFJ A;  1S0N A;  5J1N A;  5KG6 A;  3TX8 A;  2W7P A;  4ELU A;  1Z4U A;  4DG1 A;  2V69 A;  4ANE A;  2FHO B;  1F3V A;  5C5J A;  2XBP A;  2E1M C;  2EI5 A;  1IQT A;  1Y7P A;  2NCK L;  2ZE2 B;  3A1Y G;  3GYX B;  1FRJ A;  3LW5 C;  4HHH A;  1YJ9 S;  4OZ3 A;  3ILJ A;  4QWB A;  1FRX A;  1VQY A;  3FBC A;  3H0P A;  3MMA A;  4HI1 A;  1WC5 A;  3AA9 A;  4WKY A;  5JMN A;  2ZUA A;  3QJL A;  1SL1 A;  1PJ5 A;  2DGV A;  5L9X A;  1BQN B;  2GQQ A;  2Z30 B;  4IDK A;  2CWK A;  1EET B;  2AZ3 A;  4MFB B;  3MM7 A;  3EZO A;  1P8G A;  2VV5 A;  4A8F A;  3DU6 A;  1UVI A;  3PYD A;  2ZZM A;  2V2V A;  1EX8 A;  1U8W A;  4FYY B;  4KV8 B;  4CH1 A;  2ZBR A;  4P10 A;  4ZS6 A;  4ZMM A;  2YH1 A;  3GJS B;  1BMQ B;  4Q8E A;  2VPY B;  2VUG A;  4ZJL A;  4CYU B;  1VYA A;  2DEJ A;  4N5S A;  2E5J A;  3MM9 B;  3GPA A;  3I32 A;  4DLE A;  1WI8 A;  4YHH J;  1FJE B;  2M4M A;  2ZE2 A;  3T9N A;  4ZK7 M;  2VON A;  5EN1 A;  1RQ0 A;  1WDD A;  2QL7 B;  2P6T A;  2U2F A;  3MMA B;  2DHX A;  5M2R A;  1J5O A;  3M6U A;  4AE5 A;  1FJG J;  3VGS A;  5GAE I;  1IKX B;  2XY5 A;  4BHQ A;  3HK2 A;  2XHW A;  4NCG A;  4JI6 J;  4KGM A;  1MLA A;  1UMJ A;  2ABY A;  3ZZP A;  2V8P A;  1UW4 A;  2IRX A;  4TYA A;  1SC4 B;  3IGV A;  4U7U K;  4CO5 A;  5KFC A;  2JFD A;  2V4R A;  4BDP A;  4K4U A;  1JLB A;  2G0J A;  2JX2 A;  4KV8 A;  2H1Y A;  4NLU A;  4WPA A;  3KLI A;  3BZQ A;  4MMO A;  3D9B A;  4CYU A;  5ITH A;  1FTR A;  3GMG A;  4UY8 T;  2GA7 A;  1RT2 B;  4W90 B;  1RTJ A;  4X4R A;  2CWX A;  3HLU A;  2XNR A;  3PJX A;  3HMJ G;  4KAI A;  4C11 B;  4BBY A;  1T9Y A;  2YQ1 A;  3P6Y C;  4LF6 F;  4TU9 A;  1J5O B;  3BR8 A;  5DS7 A;  2OPR B;  3VV2 B;  1LFP A;  2XYG B;  1VQS A;  2AT1 B;  1URR A;  2HRT A;  3DLG A;  1KQS R;  4DQP A;  3R3T A;  2V4J B;  4M5G A;  2ZD1 A;  3OTC A;  2ZNZ A;  1S6Q B;  5EDW A;  3SYZ A;  4TLQ A;  1YTY A;  4Y65 A;  2CPF A;  1OSC A;  1RTH A;  1Z2L A;  2PSZ A;  3C6T B;  1E6Y A;  3MED B;  2UUW A;  5ETM A;  1JLB B;  2MSS A;  2AJ2 A;  2QLJ B;  2ALY B;  2VBY A;  3BSC A;  4OFZ A;  3N9U C;  1SCJ B;  4C3K A;  4FBT A;  4F36 A;  4AQY F;  1K0T A;  1VRT A;  3ELH A;  1C0U A;  4X4S A;  3KWM A;  4WP9 A;  5IOL A;  1CPZ A;  4V19 J;  4H4M B;  2M9K A;  3G86 A;  1BGX T;  1YLX A;  4ILL A;  5F3Z A;  2J7U A;  1SPB P;  5T7L A;  1UFW A;  4LBH A;  3KMS A;  5L39 A;  3GII A;  1M5H A;  1DTQ B;  2BKO A;  4NPO A;  5F9N A;  1FI4 A;  2V67 A;  4GO5 X;  4ZIT A;  4O3P A;  2NRE A;  1GK8 A;  2ZOF A;  4J9M A;  4DQQ A;  1HBO B;  3RAM A;  1L5U A;  2MKK A;  5JUM A;  3EGW B;  1WHX A;  5E3P A;  2KH9 A;  4CWB A;  2BJD A;  1U6F A;  4NLP A;  3SXL A;  2RS2 A;  1E6Y B;  4JV1 A;  2YKM B;  2HGM A;  3PX6 A;  3VWS A;  1S7I A;  4DSK A;  2M5Y A;  5G0R B;  1B0V A;  2WVC A;  5CYJ A;  4UQG A;  2RU3 A;  1BLU A;  1YRU A;  4HLB A;  2RNE A;  4CI0 B;  4KT0 C;  1HNI B;  3NNC A;  1Y10 A;  5JVG Q;  4I56 A;  1HQE B;  4MKB A;  2OFG X;  4IR9 A;  2MTL A;  1YBT A;  4H4M A;  4KO0 A;  4BCA A;  2C2M B;  4ZPW R;  3SSS A;  4KTQ A;  3Q2T C;  3CD5 A;  1O0P A;  3MMB B;  2AKW B;  3VTI A;  1M5K C;  1NXI A;  4CO1 A;  4NA2 A;  5J2P A;  5CZV A;  4EU0 A;  1UWB A;  3K7R A;  2EC0 A;  2OEK A;  3V81 B;  3ISN C;  1RUS A;  2HVZ A;  2QL5 B;  1N36 J;  2XSJ A;  5KFK A;  2ZZN A;  1N33 J;  1WG1 A;  2LYV A;  2DRB A;  3POT A;  2FJV A;  1Q16 B;  5A2Q U;  1UVM A;  1HBM B;  4B3S J;  2C2R A;  2LCW A;  2BDP A;  1EKR A;  1FO1 A;  5K8M A;  1WNE A;  3GCW P;  3TP2 A;  2XCA A;  3DLK A;  4IUF A;  3CD0 A;  3OUY A;  1RAD B;  1NND A;  4NE9 C;  1JKH A;  3L95 X;  4NA1 A;  2UV8 G;  1HBN A;  1BD6 A;  4KFB B;  4WE1 B;  3MM5 A;  2KM8 C;  2KT2 A;  1RA7 A;  4KO0 B;  3L3C A;  4QWA A;  1H2T Z;  3V6K A;  2C22 A;  4I4B A;  2FVP A;  4F02 A;  5F8J A;  3HSG A;  2PA8 D;  3J7A 1;  1TZ0 A;  1Q81 T;  1N0U A;  4KHP F;  3K8V A;  5CQG A;  2VFT A;  3PRD A;  4EO6 A;  2IC3 A;  3UE2 A;  1LWC B;  4L3N A;  4MAK A;  3HO1 A;  4U9R A;  1T05 A;  4RUH A;  1TK5 A;  1WF0 A;  1FXR A;  2EKY A;  4F4W A;  2IY5 B;  2OTL S;  3KUH A;  4XAK A;  3HHN B;  1MU2 A;  3W2W B;  2DNZ A;  2JJ4 D;  1LOU A;  1N32 J;  3D3C J;  2QSW A;  3MAA A;  1V6H A;  1VQ5 S;  3I96 A;  1SQG A;  5KT5 A;  2ZM6 F;  5IT9 U;  4NXN J;  2FJE B;  2WBM A;  4QWC A;  3MUR P;  4DR2 F;  2IFX A;  1JKH B;  2VD3 A;  4NRT A;  3I0S B;  2XZT B;  1H2V Z;  4OJG A;  3JSM A;  3WQP A;  2BJ9 A;  2E7X A;  3SQG A;  3OL8 A;  2W9B B;  3W62 A;  2RAQ A;  4ED2 A;  2K3I A;  4OYZ A;  2ZH6 A;  1HR0 F;  2G2Y A;  7AT1 B;  1LWC A;  5B0F A;  2QMX A;  1FX4 A;  3UI3 A;  4PXD A;  1P27 B;  4R0E A;  1ZS6 A;  1S6U A;  3DRR A;  5GAG I;  4OIX A;  2OSQ A;  4FNH A;  4OZN A;  4TY8 A;  3MAA B;  1D9D A;  1GNK A;  2HHQ A;  3SDE B;  2QT7 A;  4NYO A;  3J7Z T;  3CCV S;  2E9R X;  2Y9H A;  4EI2 A;  2D7S A;  1N33 F;  2MQO A;  2HBY B;  2W2O P;  3KG4 A;  2I8E A;  3BR9 A;  4LF7 F;  4DHV A;  3KK3 B;  5K20 B;  2BUN A;  1R89 A;  2HIQ A;  1KTQ A;  4WU3 A;  2IAJ A;  5HRO B;  4RNM A;  4J5O A;  4DPY A;  2QGF B;  3DM2 B;  1WC1 A;  1OQ6 A;  1HMV A;  3KJF B;  1MMN A;  1TMJ A;  1H74 A;  4KGZ B;  5T41 A;  4YY3 J;  1YIT S;  1M1H A;  3N79 A;  4QR1 A;  3TUI C;  1HWK A;  2DHA A;  5LOQ A;  1K47 A;  2QYG A;  5THW A;  2C2E A;  2IM0 A;  4CO2 A;  1VBY A;  3CJT A;  2JWN A;  2HNY B;  4U95 A;  2OPS A;  1A9N B;  2GAG C;  4YR0 A;  1AXQ A;  3SDE A;  1X4H A;  2VJU A;  1X9M A;  3ET6 B;  4LF5 F;  1JIH A;  2B9W A;  3ZTS A;  3ITH B;  3CJS A;  3OVS A;  4OX9 F;  3FCW A;  2XSF A;  3JQJ A;  1FK9 A;  1SC6 A;  2CDQ A;  5DRK A;  2K8G A;  4C97 A;  4PWU A;  4F2S A;  1VLO A;  2HRY A;  4NXM J;  3NG8 A;  4LF1 A;  1J5E F;  5D4L A;  3C6U B;  1VIX A;  5ETN A;  3TVK A;  4DV1 J;  1U49 A;  4Y2I A;  2K2P A;  2E66 A;  3U1M A;  2R9L A;  4KHM A;  2CQI A;  3VAK A;  2Y0S D;  3DOM B;  3G6Y A;  5L38 A;  1S1V B;  2IJN A;  2JOQ A;  1GQE A;  4DFM A;  1URN A;  1R27 B;  2BV3 A;  4J9U E;  4CH7 A;  2FVR A;  3WX8 A;  4QU6 A;  3TAN A;  4F25 A;  2ALZ A;  2HVI A;  4IH7 A;  3W7B A;  1ZZF A;  4FF4 A;  3KMQ A;  4EWT A;  2QLB B;  1RT6 A;  4M5D A;  1X5S A;  5HMX A;  4C2M A;  1WKK A;  3K5L A;  2ZH1 A;  4ATN A;  1CJT A;  2COL A;  1UKU A;  2ZEJ A;  2OD4 A;  3UQS A;  2YX4 A;  3D6T B;  5D0H A;  4TN2 A;  1FDN A;  4WJB A;  3Q8V A;  1M0S A;  2R2U A;  1R8A A;  4AL5 A;  2Y0B B;  2FC9 A;  2W24 A;  2DNK A;  2R8H A;  1OJ4 A;  2ZOM A;  3FBB A;  3W9I A;  3G6X A;  2HMI A;  2FC8 A;  2GV1 A;  1XER A;  2DTJ A;  3DOM A;  2YWH A;  3K5N A;  3GSI A;  4L3K A;  1GTE A;  2R8I A;  3VAM A;  2V8D A;  3M4X A;  3K5O A;  4USJ C;  2N7C A;  3A8I A;  3EGV A;  4IG3 B;  2O01 C;  4YDD B;  5KFG A;  2IA6 A;  4K4T A;  1QJH A;  3WC2 A;  1Z2Z A;  1N34 F;  1EHW A;  2K1R B;  2MEW A;  5KOW A;  3MCO A;  2OFH X;  1N8R T;  2ROE A;  3QO9 A;  3NS5 A;  4HEA 9;  4EBC A;  1YVF A;  1VOM A;  3DMJ B;  2EFV A;  3L09 A;  1GX5 A;  1NDP A;  2GJF A;  1LW0 A;  2EFQ A;  3C15 B;  4N7T A;  3H20 A;  1EP4 A;  1KS2 A;  4P7T A;  1KFS A;  2IMW P;  4FYV B;  4C8K A;  3GV5 B;  1LWX A;  2Y1J A;  1Q7L B;  3D68 A;  5B0A A;  4DPX A;  1L3K A;  2R7V A;  3MD1 A;  2OH2 A;  2N4C A;  3BEG B;  2GW8 A;  2KU7 A;  1NHU A;  1R6V A;  4WU2 A;  4CNY A;  1RAA B;  5MAO A;  3V6J A;  1JQG A;  3PEH A;  4DR7 J;  4F26 A;  5IT9 Y;  3RTV A;  2CJY B;  1YKW A;  2XMU A;  3KNG A;  3L7P A;  4BC7 A;  2DB1 A;  2AQ4 A;  1RA6 A;  1WEZ A;  1YI2 S;  2O5D A;  4BS2 A;  5K8P A;  2DO0 A;  2GNK A;  3DRX A;  1SUQ B;  3HF5 A;  3Q8R B;  1QE1 B;  3KDN A;  3RRK A;  4ZIV A;  2HEK A;  2QMU B;  3R7S B;  1MNE A;  3FQL A;  2FVQ A;  3Q8S B;  1UA1 A;  1SC1 B;  1QM9 A;  3HXM A;  2NSC A;  1RT4 B;  3M2U A;  3VAF A;  4DSL A;  2DR8 A;  2V63 A;  5F8I A;  3MMJ A;  5L46 A;  2PA3 A;  1CJU B;  3BJY A;  5HLF A;  4F50 A;  2D3O R;  3C16 A;  5I42 A;  3OTE A;  4PG7 A;  4JI0 F;  2HHP A;  3RW7 A;  3QID A;  2BYC A;  4LQ9 A;  1RT2 A;  4JI3 J;  3AQO A;  4AQY J;  4DR6 F;  2F4V F;  3TAP A;  3CJ0 A;  2IPO B;  1S99 A;  4A8X A;  1RWP B;  2MGZ B;  4C11 A;  3ZNJ 1;  4ZJO A;  1S9E A;  2Q6B A;  3HVT B;  3IRX B;  1UPP A;  3LP0 B;  1X4D A;  4UOG A;  1S1U B;  1TU0 B;  5KFB A;  3HHD A;  1RAE B;  1SUQ A;  2VC0 A;  3NGK A;  2VPX B;  2SXL A;  1QE1 A;  1UET A;  2B7B B;  4PXB A;  1HIY A;  2K7K A;  4Y2K A;  2GX8 A;  4CQ1 A;  5L9N A;  2AP6 A;  3D28 A;  2L08 A;  1U2R A;  2QL9 B;  3GG1 A;  4OYO A;  5F9L A;  5CD4 H;  1S1W A;  1N34 J;  1DRZ A;  3DLL Q;  3EMT A;  3MHY A;  1S5Z A;  5KFM A;  2C2D A;  1RTI B;  3ILL A;  1QAI A;  2ZFH A;  4X4U A;  1CJU A;  2QA1 A;  1U25 A;  1FVQ A;  2CFX A;  1NHK L;  1X4C A;  3D5M A;  3GLJ A;  3OFH A;  2ACY A;  2BOA A;  3AOA A;  2CAJ A;  1F6T A;  3K5P A;  2R7U A;  4DBQ A;  1I94 F;  1KN6 A;  2Y1R I;  5KFD A;  4M5J A;  2ILZ A;  3DFE A;  3MUM P;  3IMQ J;  1IBL F;  5HAO A;  1WAC A;  3CDE A;  4RW4 B;  4X64 J;  1WHW A;  3BKT A;  5J2N A;  3WDO A;  4DSI A;  1S9E B;  1Q5Y A;  2PDA A;  3HVT A;  3TEH B;  3CCZ A;  5DDP C;  1CJK B;  2ZHA A;  4LQ3 A;  5U47 A;  1TQL A;  4RW6 B;  1M1K T;  1LK5 A;  2BA9 A;  1RWK B;  4R5P B;  1YBA A;  5KT2 A;  3UN5 A;  1VQK S;  2ASY A;  2V50 A;  3HX9 A;  1V3R A;  2B43 A;  1T9W A;  4GRS A;  4PKD B;  5EWG A;  2VG5 A;  3K58 A;  2YKM A;  2R7S A;  2MZT A;  1RWU A;  2HFS A;  1MSW D;  2W25 A;  3MR5 A;  4A8K A;  4F4Y A;  1NJY A;  1HNI A;  1YIJ S;  5KFJ A;  5AE1 A;  1CUL A;  1XNR F;  5IT0 A;  2QLF B;  4NLR A;  1WF1 A;  3IR5 B;  4DV0 F;  5J2N B;  4NCA A;  2M0G B;  3DRS B;  1KDN A;  4B9T A;  3CJQ A;  2RUG A;  3FK4 A;  4NLD A;  1CJK A;  3UFC X;  4DR1 J;  4MK7 A;  3RBX A;  3B54 A;  3R2C J;  1KQK A;  4DU7 A;  2PEH A;  2J0X A;  4R5P A;  4OJ3 A;  4Y28 C;  4DI6 A;  3Q8P B;  3HHL B;  5CA5 A;  4KIA A;  1Y0H A;  5ETT A;  1FF2 A;  2HRU A;  1PBU A;  1MG7 A;  3LTO A;  3MM6 A;  2J9D E;  4HH1 A;  4CCH A;  2CJB A;  3DYA B;  4OZ2 A;  3PO5 A;  2DT9 A;  3OPK A;  4KSE B;  1T9T A;  3CD7 A;  4QIF A;  5HAN A;  5HMZ A;  2M70 A;  4OLO A;  2H48 B;  4K4S A;  3OW2 R;  1O6X A;  4USV A;  3D4J A;  2IIH A;  4FVC A;  4FS2 A;  3K8W A;  5KFX A;  1F5C A;  1Y4Z B;  2GFF A;  2XUL A;  4AYB D;  3DRS A;  4DR2 J;  4IR1 A;  4YEA A;  2AU0 A;  4UQT A;  5LMN F;  2ZKU A;  2IA0 A;  4GVB B;  4WFA Q;  4C0O C;  5B0E A;  3CJK B;  1IXK A;  4OI6 A;  2AYB A;  4O0N A;  3GJR B;  3OVA A;  3BV8 A;  4MTP A;  2CJ9 A;  5B09 A;  1SJ3 P;  2AZ1 A;  4WFX A;  1PYO B;  2VBW A;  3ENV A;  4I7F A;  1N6Q A;  5ETK A;  1MU2 B;  3W2W A;  5HQ8 A;  5GAD U;  2BBE A;  3VAI A;  1RHQ B;  3AOC A;  5SUH A;  1K73 T;  5C2G A;  3M8Q B;  2HVE A;  4USM A;  1XMQ F;  3R6G B;  1H7W A;  2DIU A;  4LF8 F;  3MXH P;  3R1L A;  2JVO A;  3HVA A;  2HFN A;  3N6L A;  1G1X A;  2JEI A;  3ZNU A;  4UOC A;  4LF7 J;  2XEX A;  3KK1 B;  3CO0 P;  1FJC A;  2H54 B;  2AYG A;  1W2I A;  3QBC A;  2YTC A;  1PYT A;  3CMA S;  3ETO A;  1YJV A;  3DDN A;  5LSR A;  1WD6 A;  1FE0 A;  2L41 A;  3OR1 B;  3AA8 A;  4NX9 A;  4FF2 A;  1FVS A;  1XNQ J;  4OZ0 A;  1RI7 A;  3DRR B;  4NLX A;  4P6Q A;  4LR8 A;  2LU1 A;  3MGJ A;  2PT0 A;  4IKA A;  1TK0 A;  2DIS A;  3M8P B;  1XJW B;  3OXF A;  2NZ4 A;  4XIU A;  5D4O A;  1SJF A;  2JL9 A;  1ZM9 A;  3MTK A;  5DLF A;  3M6W A;  3CWJ A;  4RWW A;  5KFR A;  3HCX A;  3KOA A;  1WOP A;  4FYX B;  3MEC B;  3JAM Y;  6FD1 A;  3MAQ A;  1FKA F;  4ZHR B;  2CPZ A;  1XR7 A;  4HTI A;  1HQU B;  2F65 A;  2X3G A;  2BAN B;  1WHV A;  3DOK B;  4KHP J;  2MLX A;  1SKU B;  2OEM A;  2V9W A;  2Q66 A;  1TUV A;  4F4K A;  2JFK A;  2B4V A;  4DX8 H;  2PMZ D;  2KXN B;  1KHV A;  2G1D A;  4WP3 A;  2ZBI A;  1CBK A;  3PW7 A;  2H4W B;  3OR1 A;  3C66 A;  2W8L A;  1N48 A;  4C8N A;  3UNG C;  2OPS B;  2FIU A;  3FUY A;  3OFG A;  3SCK E;  2YNI B;  1ZH5 A;  3HD2 A;  3LGH A;  1SBR A;  1RT3 A;  2ILY A;  3AB4 B;  3NCR A;  3R27 A;  2QV6 A;  3WC0 A;  2D3U A;  4RL1 A;  1NDC A;  3D6H B;  5KFZ A;  5C25 B;  1B7Y B;  5DLG A;  1JLC B;  3VVU A;  3U02 A;  3BSN A;  1NJW A;  3AH6 A;  2HND B;  4ZHR A;  3DN9 A;  2HKE A;  4URQ U;  3MD3 A;  2VB6 A;  2OIH A;  1T95 A;  3BKF A;  1NM2 A;  1PJ7 A;  4KYZ A;  2CYY A;  4EEY A;  4DR4 J;  2AYE A;  4DR1 F;  3MZI A;  1U1K A;  2P9E A;  1FWK A;  1X9S A;  3P49 B;  2B9E A;  1ZAV A;  3CCU S;  3BYP A;  1IBK F;  2DIT A;  2W4C A;  4P52 A;  1AUD A;  1N0V C;  3QFH A;  5AE2 A;  2UUB F;  2YNI A;  4PG4 A;  5C25 A;  3QGH A;  1SIZ A;  1RT6 B;  3I9Z A;  3VGV A;  1GMV A;  3ONQ A;  3NNH A;  4KGV B;  3CVK A;  1HWU A;  4CTA B;  1GTH A;  3AXM A;  2VQF J;  3K17 A;  5D0E A;  1M5S A;  4HHJ A;  1LW2 A;  3CO9 A;  5EHH A;  3QT7 A;  5GMD A;  1WC3 A;  5HBM B;  4YY3 F;  4ECT A;  1JLE B;  1V5I B;  1VJW A;  2MLZ A;  3QNW B;  2AJQ A;  4M5I A;  4MIB A;  1WUU A;  4CT8 A;  3P96 A;  4NEZ A;  3NMA A;  4X4P A;  2IRY A;  2XMT A;  4GC7 A;  5IC4 B;  1KSP A;  5LMN J;  2L9W A;  3BBB A;  3CPW R;  3T1Y F;  1DAR A;  1GAO A;  2F9J A;  2KXH A;  4M5H A;  4DZD A;  2EG2 A;  5BYS A;  3KLF B;  3PKM A;  3ZTQ A;  1U0H A;  2GVZ B;  4NL5 A;  3E2E A;  2DNH A;  2F40 A;  2UUA F;  3IG1 B;  3GJT B;  3I6P A;  1AA1 B;  4E98 A;  2AEJ A;  2VA3 A;  4W92 B;  2FHM A;  2LQJ A;  3NGS A;  2HYI B;  2RB7 A;  1ELO A;  5KG2 A;  2WRM A;  2B9Y A;  1ZA1 B;  2CQB A;  2AYM A;  2VFV A;  1JLF B;  3RJM B;  4Z2X A;  4DV1 F;  1SKS A;  1JLE A;  4DZ6 A;  1N5Y B;  2OJ3 A;  4ES3 A;  1ULR A;  4IQM A;  3H40 A;  4CLW A;  4M5L A;  5A6P A;  4B3S F;  4JUZ A;  3ENW A;  1FNM A;  3BYR A;  1ZYQ A;  4IG0 B;  5G4D A;  3T3F A;  3ILI A;  3MPV A;  1WDT A;  5JXS A;  1ZBT A;  2WON B;  1QD1 A;  2YNH A;  3HFK A;  2RF2 A;  1EJ7 L;  2GCF A;  3WIU A;  4JI0 J;  4GKK F;  2HW3 A;  2JLE A;  2V2Q A;  1XNQ F;  2IJF A;  1TL7 A;  3C14 A;  4ICL A;  2NYH A;  3GIM A;  4OHZ A;  1IBK J;  1WJ9 A;  2MKC A;  3MR2 A;  5BR8 J;  2E5L F;  3OHB A;  3TUP A;  1RT1 B;  3DC2 A;  1HBU A;  4PG5 A;  3KJV B;  2QA4 S;  1NB2 A;  2VIC A;  3CDB A;  1N5Y A;  1BUX A;  4YOE A;  1S1X B;  2IBO A;  4ZP8 A;  3MAH A;  5B0B A;  5LMU F;  2FB0 A;  4PXC A;  3M2U B;  1VRU B;  2DH9 A;  4PQU B;  4J9O A;  4IO9 Q;  2FQQ B;  2DJW A;  3ADA C;  2YWG A;  4IG0 A;  1KD1 T;  3N28 A;  3QT5 A;  1H3D A;  1PSD A;  2CIM A;  2LA4 A;  2O66 A;  4Y6I A;  4ZVO B;  4A4J A;  4CLP A;  4ETX A;  4U8Y A;  5DG9 A;  2J0S D;  1RT5 B;  4UUX A;  2FZK B;  1OS5 A;  4YFU A;  3AJD A;  5F8H A;  4HI2 A;  3TQ1 A;  1HI8 A;  3JTN A;  1GXT A;  4OZJ A;  5M2U A;  2MGZ A;  4DPW A;  3EPG A;  4ICL B;  2J8A A;  5FDL A;  3T1Y J;  1WWH A;  4J91 A;  2OHD A;  4Y2A A;  3D6F B;  2QRR A;  4H54 A;  4YUD A;  2F9D A;  1TAQ A;  3NAH A;  3PEJ A;  4URS A;  2XC9 A;  2XMJ A;  2YNF A;  4OJ1 A;  1TFW A;  4WFB Q;  3G8Q A;  1HR0 J;  1CJV A;  5KT7 A;  3RRG A;  2YWK A;  1Y11 A;  1U6Z A;  3WBZ A;  1RB0 A;  1UAW A;  1P1L A;  3GIR A;  5A0Y A;  4KKO B;  5LL6 d;  3ZC4 A;  3TAR A;  4EMD A;  3P5B P;  1EQM A;  4ZVG A;  5F3T A;  1K1S A;  1TAU A;  1NPP A;  3LPE A;  1VRU A;  2LQ5 A;  2J7K A;  4PAB A;  2JZ5 A;  1RTI A;  2E5I A;  1U45 A;  1C0T B;  1JK9 B;  3AJ2 A;  1EAR A;  2ZVS A;  4UOF A;  3AB2 B;  4RR5 A;  4CT9 A;  4TQS A;  4DR7 F;  4HDH A;  4RW7 A;  2HHU A;  1ITP A;  1BHN A;  3FFI A;  3W5Z A;  5HQL A;  1WI6 A;  3GG0 A;  2LKZ A;  1WEL A;  2VFS A;  1XNR J;  3MFH A;  3O8W A;  2D3Z A;  2MJN A;  3MEE B;  2WZ1 A;  5CYQ A;  5D3G A;  5E5N A;  1TUW A;  1PAU B;  2RQC A;  1RT7 B;  2Z2Y B;  5DDQ C;  1U7L A;  4LF9 J;  2CPE A;  2KXF A;  4FN5 A;  4A8Q A;  1H38 A;  1IJF B;  1ZPW X;  2YNF B;  2YXL A;  3D3B J;  1MWZ A;  1RIS A;  1CJV B;  1UWA A;  2HBR B;  2C42 A;  5AXM A;  1C1B B;  3LOU A;  4NRU A;  4DV2 J;  5ETR A;  1NHV A;  1UEU A;  2CPX A;  2HG4 A;  2DYA A;  4R0J A;  3QJP A;  2JLF A;  1R31 A;  3QIP B;  4JV5 J;  2D9P A;  1UA0 A;  3WX4 A;  3EE3 A;  4OZ5 A;  2W1B A;  3IBW A;  4I2Q B;  2FUG 9;  2R2S A;  2ADC A;  3ZO7 A;  3FEX B;  2LXI A;  5LMU J;  2VPW B;  3HP6 A;  2IRU A;  2EWH A;  1W2B R;  4DSJ A;  3EWG A;  2KZZ A;  1H7X A;  3MM8 B;  3N01 A;  2AJ4 A;  1CUL B;  4RBT A;  3FMW A;  2DGS A;  2V2Z A;  3L7U A;  1IKY B;  1JMT A;  1AYE A;  3MCS A;  3HI9 A;  4Q2L A;  4URG A;  5FLX Y;  1YJT A;  4JI1 J;  2UXC J;  1FDA A;  2GMJ A;  3T5K A;  4P74 A;  2JNJ A;  2W7O A;  2B4U A;  1QDU B;  4MH8 A;  2H4Y B;  1GXU A;  4DF8 A;  3D0G E;  3CC2 S;  4LF4 F;  2WOM B;  4YQW A;  2HIY A;  3F73 A;  5J1E A;  5FJ4 A;  2M2B A;  4HAC B;  2DXF A;  3BF4 A;  2YWF A;  4LRD A;  2FHK A;  4LF2 A;  3R8Y A;  4I0W A;  2RDD A;  3BSA A;  1Q0N A;  2V6A A;  4NZ7 A;  5DJB A;  1JXV A;  1SJ4 P;  3AOD A;  2AX0 A;  2BJ1 A;  3MUT P;  3DU5 A;  1U1M A;  2RS8 A;  1OPI A;  2VG7 B;  4LUB A;  1UFK A;  3VF0 B;  4DV7 J;  4O0I A;  1RBL A;  3ZTR A;  1IKY A;  1IM4 A;  1NAQ A;  2HBQ B;  1V5V A;  2NPF A;  1GEH A;  9ATC B;  2XWX A;  3V4I B;  2KRB A;  2W8K A;  3M8Y A;  4F3Q A;  3K57 A;  3W3S A;  2BM1 A;  3EDQ B;  4GVB A;  3D66 A;  1TKT B;  1IKW A;  2RDJ A;  3AD7 C;  3EZ5 A;  3OLA A;  4JI5 F;  1RSC A;  2QMW A;  4ILR A;  7FD1 A;  2AWZ A;  4C9D A;  2B4P A;  3FGV A;  4LVN P;  1SKW A;  4USW A;  3PG9 A;  4I7F B;  2KZM A;  5LSL A;  1TMM A;  2MQQ A;  2ASL A;  1XMO J;  1N54 B;  5T14 A;  2KG0 A;  4PEO A;  5F41 A;  3I55 S;  3KKF A;  3KLH B;  2OTJ S;  2VU5 A;  3IO1 A;  3BGF A;  2FHJ D;  4MYU A;  2CQ0 A;  2WAQ D;  4NWB A;  3M30 B;  4QPT A;  1FDB A;  3RRH A;  1T8E A;  1NJZ A;  3CUL A;  1ZET A;  4KPY A;  2NLW A;  2ZH8 A;  1HHQ A;  3Q83 A;  4FXV A;  5GVQ A;  2IJR A;  4JV0 A;  4N8O A;  1B64 A;  2ZWO A;  4DN0 A;  3Q22 A;  3NOC A;  2Q79 A;  3PZP A;  2DXD A;  1EET A;  2RRN A;  2YBV A;  2HAF A;  3BB5 A;  2B6A B;  3Q8Q B;  1IWG A;  2M88 A;  3AD8 C;  3RYL A;  2F5G A;  1SJQ A;  3MPW A;  5DG7 A;  1T11 A;  2XNQ A;  3DLE A;  4Q8F A;  3O2I A;  1VIS A;  3W63 A;  4OZL A;  2MMY A;  4F8R A;  3Q2S C;  4RW9 A;  3DLH A;  2UXC F;  2DNY A;  5DG8 A;  2KFY A;  2ZIT A;  2VJV A;  2MKJ A;  2J76 E;  3N6M A;  3BN4 A;  4IOB A;  5CAA A;  5HL7 Q;  3QWP A;  4GKK J;  4H4K C;  4YB5 A;  4BLG A;  2MZQ A;  2MZ1 A;  2ZH2 A;  2VOP A;  1QVF R;  2AEF A;  3MEC A;  2UUC F;  2RRA A;  3I31 A;  3I4P A;  1RWM B;  4PXE A;  3RGI A;  4A8W A;  3OSP A;  3UD4 P;  4TY9 A;  3IS9 B;  1YG0 A;  1X0P A;  1P9Y A;  2M3D A;  3DOK A;  4TVA B;  3R7N B;  2IHR 1;  2CNN B;  1TKD A;  4B3T F;  1VQL S;  3D0I E;  1H98 A;  1WG5 A;  4NCG B;  2CQ1 A;  1XK8 A;  4F0M A;  3GYN A;  1FKO B;  4RUB A;  2H5I B;  2C3Y A;  3A8E A;  5E7O B;  5KFI A;  4ED0 A;  1S49 A;  3M8R A;  2FVC A;  3UN2 A;  4M63 A;  1NZA A;  1VR6 A;  2GGP B;  3L9Z A;  3GE9 A;  2MKH A;  4JYA J;  2ZJQ Q;  3GFZ A;  2VDH A;  2HK2 A;  2V94 A;  2KG1 A;  1JLA B;  2C2K B;  3UPF A;  4Q7A A;  2MZR A;  3EX7 B;  4C3L A;  3Q23 A;  4DR6 J;  1DQ9 A;  2RD5 C;  4LF8 J;  3PX0 A;  4QYZ K;  3CC7 S;  1BXN A;  4C3M A;  4AD6 A;  4DOZ A;  3RB4 A;  2BEF A;  1S48 A;  3K2Y A;  3FQK A;  1RDR A;  2CQ3 A;  1HYS B;  2WVE A;  1T3O A;  2EK1 A;  3P3D A;  4IYQ A;  4KQZ A;  4ECV A;  1R8H A;  4L76 A;  4Y34 A;  3T41 A;  3NRB A;  2I9S A;  2RKI B;  1FXD A;  1TKZ A;  4FNI A;  3BM7 A;  1FKO A;  3W5Y A;  2QN6 B;  2ZH5 A;  4K4Z A;  1VJQ A;  2X7I A;  1W25 A;  3O3L A;  2GGP A;  1TTH B;  3CF5 Q;  4D3H A;  1JNZ B;  1K0V A;  1HLW A;  2BAB A;  3DHW C;  2VIH A;  1WSV A;  2HGN A;  4CLF A;  3M32 A;  3P5T L;  3J7Y U;  4J9R A;  2NXN A;  4F4A A;  4J9S A;  1CS4 B;  2EEY A;  3IAM 9;  3R5G A;  1DTT B;  3HDS A;  4EBD A;  2HHT A;  3TAM B;  5KG4 A;  4K4W A;  2J9C A;  1HYS A;  3BRE A;  1LW2 B;  1T7P A;  1DTQ A;  5HBM A;  4I69 A;  3T6J A;  2DGQ A;  2KDO A;  3KTQ A;  5KFS A;  4DUY F;  1BWV A;  2NS1 B;  2N4D A;  3W1Y C;  4X4O A;  3MI7 X;  1HBO A;  1PG5 B;  1TKZ B;  1N52 B;  1FFG B;  2G2Z A;  2KL8 A;  3FVY A;  5CZX A;  2B0G A;  2I5J A;  3CJ5 A;  5HK4 A;  3J81 U;  1NH8 A;  1BY9 A;  5E2Q A;  2HQD A;  1T03 A;  5IV3 A;  3MFI A;  2VFR A;  3BO4 A;  5MLC V;  3KLF A;  3DDI A;  4OI0 A;  3LAL A;  4ED8 A;  1NPK A;  3PV8 A;  4WKR A;  4AL6 A;  4DPU A;  1X7V A;  1YQH A;  3M32 B;  3RAX A;  2XMM A;  1Q86 T;  1HNV A;  2WVD A;  3QGG A;  1FEE A;  2GIF A;  4O44 B;  3K89 A;  3UWT A;  2CZV C;  2YPZ A;  4WYL A;  4DV6 F;  3PO4 A;  1R0A A;  5J2P B;  4DL7 A;  5BR8 F;  2FHJ A;  1WHY A;  2QJ3 A;  2UZA A;  3QLH B;  2R42 A;  4A47 A;  5HP1 B;  1ZTT A;  3BGR B;  3DLB A;  1NK6 A;  1JJC B;  1T03 B;  4KR0 B;  4N77 A;  2CZ4 A;  1S7H A;  1RHJ B;  1MWQ A;  1TV6 A;  4IFY B;  3LUY A;  5CD4 A;  3OTD A;  2DNR A;  4JI3 F;  5CYM A;  2FJB B;  1HBM A;  3H59 A;  2I2Y A;  5AT1 B;  2BE9 B;  4EYH B;  2Z4P A;  4BWM A;  4DV5 F;  3H42 A;  3DLK B;  4NLS A;  2RH3 A;  4Y2M A;  4OMF G;  4OX7 A;  4Y3C A;  3OUY B;  4OJH A;  1D9A A;  3AOB A;  3C14 B;  1HNV B;  4PQA A;  1O51 A;  5D8H B;  1U8S A;  1WEX A;  4ZP7 A;  1ROF A;  5KG3 A;  2R3V A;  3PKY A;  4FDF A;  1RT1 A;  2H65 B;  2ZM6 J;  2FLP A;  4OL8 A;  2BJE A;  2IC3 B;  2O3D A;  4ED3 A;  3QLH A;  1UVK A;  2QO3 A;  5GME A;  1S0O A;  2UUC J;  2DCL A;  1IWA A;  5DGB A;  4IFY A;  4N8N A;  4DPT A;  1FD2 A;  2PMW A;  1YWX A;  2NSB A;  3AJ1 A;  2IVF B;  3E01 A;  4OI4 A;  3R6L B;  3PW0 A;  1IBL J;  2Z8Q A;  2CRL A;  2CG4 A;  2DXE A;  3CDU A;  2IM3 A;  2QEX S;  5CH7 B;  3KLV A;  4WCE Q;  2G13 A;  2XS5 A;  2WSC C;  3GIL A;  4Q43 A;  2EK6 A;  4YR3 A;  1D0E A;  1LV5 A;  5CXT A;  1DFD A;  5M2P A;  3SQG B;  3TO8 A;  1FX2 A;  2CPY A;  2KO1 A;  3VCD A;  2CQG A;  1JLG B;  1KLM A;  3BN7 A;  4JI8 F;  3TA0 A;  3PR5 B;  1WKL A;  2ROP A;  4KHR A;  1TKX B;  4GVL A;  3J7Y I;  3VAG A;  3CCS S;  3N6N A;  2BOP A;  5RUB A;  4RNH A;  1SH0 A;  3MEG B;  1FCA A;  4USK A;  4NLO A;  4CLU A;  3KK2 B;  2FJD B;  3M8Z A;  4NYZ A;  2YH0 A;  1Y9O A;  2BW7 A;  5C24 A;  3UO0 A;  1C4A A;  2U1A A;  2EG1 A;  3FSX A;  4U7C A;  4IOA Q;  4QYZ J;  3PFO A;  1Q82 T;  2CNK B;  4PUO B;  2DBB A;  4B02 A;  1CEZ A;  4IRC A;  1O8B A;  3W65 A;  3KK3 A;  4HYK A;  1U0S A;  4DL2 A;  4PCQ A;  4IRD A;  1RJJ A;  2Q1L A;  1QAY A;  1RT7 A;  1QVG R;  4G1Q B;  3ENQ A;  1TL5 A;  2HLT A;  1HL6 A;  2J9E A;  1HMV B;  3HHE A;  3HT0 A;  4HTJ A;  4ECQ A;  3R5C A;  4LF5 J;  3OHA A;  4ERD A;  2AHO B;  1TKX A;  2HVD A;  1NPR A;  2J9D A;  4K4X A;  2R2R A;  4NAS A;  3PNI A;  4JBC A;  3RBE A;  3R5A A;  2HHV A;  4JI6 F;  5DQH A;  1B0T A;  5ADZ A;  4RPF A;  1QUV A;  3NEK A;  3TVY A;  3PRV A;  4I2Q A;  4Q44 A;  3IR6 B;  2IBK A;  1IBC B;  3RR7 A;  4DR4 F;  3K0J A;  3SZ2 A;  3CCM S;  4ID8 A;  4DUT A;  4CLY A;  5D6G A;  1XC9 A;  1FNO A;  1KOH A;  3FZ2 A;  1GMU A;  2LP4 A;  4P2X A;  3UCU P;  1OWX A;  2VBZ A;  4CO0 A;  1MRO B;  4P71 A;  1LK7 A;  1S77 D;  3UR0 A;  2GQ2 A;  4UY8 5;  1PIL A;  3BGO P;  4RUC A;  3PTW A;  2VOO A;  3FRZ A;  4ED1 A;  3WHI A;  3PR4 A;  3OXG A;  2Z2M A;  1CQM A;  1YJN S;  4DX6 A;  3C3L A;  5A8K A;  2WOM A;  1XMB A;  3B78 A;  5J1E B;  1VI7 A;  2W9C A;  4DV6 J;  2H3E B;  3AD9 C;  4NZ0 A;  4UST A;  3D2W A;  2ATL A;  1B3T A;  1CG2 A;  2NXC A;  5D15 A;  4RO0 A;  2DNG A;  5EWF A;  1APS A;  2EFP A;  2P2C B;  2UUB J;  3ZZZ A;  1RAI B;  5IM0 A;  1XMO F;  1PJ6 A;  2LLZ A;  1M5P C;  1OIA A;  4S0M A;  1QAJ A;  1NKC A;  1PAE X;  1P1T A;  4M5D B;  3I82 A;  2LDY A;  1RHM B;  4GMK A;  4ZVS B;  3U7J A;  2VQF F;  3M6X A;  3NGR A;  3CCR S;  1CJT B;  3FZB A;  4FZV A;  4DV5 J;  3V4I A;  3KNA A;  4ZCI A;  2AGQ A;  2MHN A;  3UR3 C;  4QIW D;  4RNN A;  5HLF B;  1NK0 A;  4IDK B;  4CRJ A;  1IKW B;  3EYZ A;  2XO6 A;  4OYB A;  1S57 A;  3R5B A;  2FDN A;  1REV A;  3VVT A;  3GON A;  3TAQ A;  4X4V A;  5ETV A;  2O1P A;  1GT8 A;  4HT5 A;  5EUH A;  3ZZR A;  4PPD A;  4JI4 J;  4TQR A;  2IVY A;  2F1F A;  4Y00 A;  3MPU B;  4ECS A;  3HSZ A;  3T1A A;  4LFA F;  1JB0 C;  3KLH A;  2CJQ A;  1FJG F;  3MOZ A;  4CP5 A;  2ZH3 A;  2XMW A;  4ETZ A;  2VQE J;  5LM7 E;  4TNO A;  1YSJ A;  5KFN A;  2MQM A;  1SC3 B;  4DR5 J;  3I9V 9;  2KHC A;  2ZC3 A;  3QO9 B;  4ZVU B;  2R7W A;  5LXR A;  3G4S S;  4K4Y A;  3DLJ A;  3ZZO A;  1XWL A;  1T0T V;  2YWW A;  3HSD A;  2L3M A;  2WVB A;  2YY3 A;  3C15 A;  4L6V 3;  3FMB A;  4F7V A;  3HKW A;  2E1A A;  4WFY A;  2B6A A;  2C3M A;  2RRB A;  1REV B;  3S7R A;  4EO8 A;  1NRK A;  3EJM A;  3DLE B;  4DXL A;  3UN3 A;  1YJ7 A;  2FYX A;  3DRY A;  4PR6 A;  4JI8 J;  2BJ7 A;  4ZVH A;  4PAA A;  4ZVR B;  1RU1 A;  3AFG A;  4LRE A;  2HK3 A;  4MKA A;  5HVG A;  2R7Q A;  1YJR A;  2F8M A;  3ZTP A;  1J27 A;  2HBZ B;  1LQ9 A;  3HD1 A;  2LXF A;  1PCA A;  3WZ0 A;  3UCG A;  5KG7 A;  3CIZ A;  3PVX A;  2LXU A;  1Q7Y T;  2KFZ A;  2OPQ B;  4LSL B;  4DSF A;  2ZJR Q;  2RE1 A;  1H72 C;  2ASJ A;  1VBZ A;  1HI0 P;  1IR0 A;  3DLG B;  3M05 A;  4ER8 A;  1R43 A;  2DGT A;  1NK5 A;  3EIC A;  2V4J A;  4PRF A;  1NH7 A;  4O4R A;  3R97 A;  4MFB A;  3X1L B;  4WZM A;  4CO4 A;  4RBV A;  1ZZN A;  2Z0G A;  3EUN A;  1NDK A;  2PGC A;  2ATC B;  2GHW A;  3HFZ B;  4MIW A;  1DY3 A;  2E5G A;  2NZC A;  4X84 A;  5KFH A;  4FPI A;  4LVO P;  1VRT B;  1WG4 A;  3VHQ A;  2R8J A;  1UJ5 A;  3MM9 A;  2C3U A;  1C0U B;  3IWX A;  3SCL E;  1L3U A;  3OBI A;  3UCZ P;  1SV5 B;  1Q1K A;  4XPC A;  5J1P A;  1YBU A;  2DGX A;  3JB9 k;  3IRX A;  2C2N A;  3KLG A;  1K44 A;  1OSD A;  2CJA A;  2QA2 A;  1MMD A;  3CT9 A;  4FVM A;  2UXB J;  2QE5 A;  1T9U A;  4PG6 A;  1Q5V A;  2OPQ A;  4LSL A;  3IAS 9;  4RKU C;  1D1U A;  2D69 A;  4EYI B;  1IKX A;  1EIY B;  3F56 A;  2HWH A;  1S1W B;  2F7V A;  1VQN S;  4QIE A;  1XN9 A;  5DZ6 A;  1FA0 A;  4X64 F;  4O3N A;  1NLK L;  1TL4 A;  1S1T A;  1VGY A;  5H1S V;  2LDI A;  3MUV P;  1VMB A;  3G8S A;  2LQ9 A;  2UUA J;  4C8Z A;  2R7T A;  1WKJ A;  3TJ8 A;  1Q8I A;  1X60 A;  3QMQ A;  4X66 J;  1DJ0 A;  2XZD B;  2QC3 A;  4J9P A;  4DV4 F;  1AFI A;  3CCE S;  2ZBP A;  3UDE A;  1GX6 A;  4ED7 A;  1SV5 A;  4M5K A;  4WP8 A;  2BR0 A;  5KG5 A;  1RHU B;  2BQU A;  4LFB F;  3KLG B;  1QAX A;  3RAQ A;  2E9Z A;  3MF5 A;  4JB8 B;  1N5T A;  4RW6 A;  2AF6 A;  3JTO A;  1NZ8 A;  2MJU A;  1LWE A;  4KE5 A;  3I4H X;  2XY6 A;  1SL2 A;  3ETM A;  4YN3 B;  4I6A A;  2XSJ B;  3NKY A;  4LRF A;  5HMY A;  2QIF A;  4ILM A;  4P9S A;  4RBU A;  1S6Q A;  4DV0 J;  1S12 A;  1S1T B;  1I6J A;  1RTH B;  2V2K A;  2XYH B;  3JQK A;  4M8L A;  2Z58 B;  4ITS A;  4X4N A;  4Q0B B;  1FFS B;  5DET A;  1O5J A;  2R8K A;  3DXS X;  1OY9 A;  5IV4 A;  4OHW A;  3TW0 A;  1RCO B;  2P9G A;  2V8G A;  4M5N A;  5BJR A;  2L9N A;  4J9Q A;  2PN6 A;  3IC1 A;  3A4T A;  3H8Y A;  3PHE A;  4HT7 A;  3A3O B;  3MM5 B;  4KFB A;  2R2T A;  2ASD A;  4WII A;  4UZB A;  4OHY A;  3I0R A;  4OX9 J;  1Q53 A;  1C4C A;  4OYW A;  1IUJ A;  1F9H A;  2VZ9 A;  1OQ3 A;  3AT1 B;  4LF4 J;  3EGZ A;  3GV7 B;  2HQ3 A;  3D1Q A;  4I6W A;  2BVZ A;  3E3X A;  1Y5I B;  4DCJ B;  5GMK a;  2P8I A;  3MM6 B;  4Q0B A;  1R7I A;  1FRM A;  2I6W A;  3P4U B;  4LSZ B;  4FS1 A;  5A8R A;  3KHR A;  4JP8 A;  3B8H A;  2FLL A;  5C42 A;  1TL1 B;  3F41 A;  3IM8 A;  3SI8 A;  1Y3J A;  1WTB A;  2J6T A;  3SFU A;  4CM0 A;  1X4G A;  2JC1 A;  5BYR A;  4XTT A;  2FJX A;  4JV2 A;  4X66 F;  4IO1 A;  4PPZ A;  3I0R B;  1VQ6 S;  3R5D A;  2VH7 A;  2HS0 A;  1R8C A;  3PW4 A;  4JI5 J;  4P7V A;  4AND A;  1HQ2 A;  1AW0 A;  2QZ8 A;  4B9L A;  4OHV A;  1VC5 A;  3LA0 A;  4CIO A;  1ZM3 A;  5KT4 A;  4M95 A;  4LFB J;  2JRS A;  1EAY C;  2OD6 A;  3AXK A;  3DOL B;  2RIL A;  1VK3 A;  4ZP9 A;  1Q8K A;  4P75 A;  1N6Q B;  3THT A;  3E01 B;  2FD2 A;  1EZZ B;  2XI3 A;  5L8R C;  3W66 A;  1ARO P;  3ZZ0 A;  4DL0 C;  3ZTO A;  3M2R A;  1TEL A;  4OZ1 A;  4QBU A;  2ZC4 A;  4NA3 A;  2MKI A;  3GWC A;  5L1J A;  3W2V A;  4ZCM A;  1RGV A;  1DQ8 A;  1GMW D;  1KON A;  3M8S A;  2UXD F;  5C42 B;  1TL1 A;  4XPE A;  3OJU A;  2AV5 A;  1BQX A;  3HUL A;  4F4Z A;  3PYG A;  1U1Q A;  4B9V A;  5E3R A;  1HBN B;  2RUS A;  2RHS B;  4DV2 F;  4RWX A;  5HRO A;  4WXO A;  2E5H A;  2M7S A;  5K8O A;  3CCJ S;  2C1E B;  1U4B A;  4ZCL A;  5A8W A;  3BBC A;  4Y2C A;  5LSO A;  1RTD A;  3ULH A;  4Q2M A;  4WTY A;  4D3G A;  2VFU A;  4EUV A;  2GAH C;  3DI6 A;  3KJN B;  4G65 A;  3A13 A;  2HFV A;  3C8Y A;  1Q4R A;  3MEG A;  4C48 A;  1QSL A;  2HHS A;  2HHW A;  2GC8 A;  3H5X A;  4N76 A;  1Q8L A;  1NJX A;  3BQ0 A;  2A1B A;  3T1H F;  1XIQ A;  2MXY A;  2QTW A;  4RLE A;  1ZA2 B;  3KHL A;  5C24 B;  4DR3 F;  2BXJ A;  4EK2 A;  2CPI A;  2HQG A;  4M94 A;  4DQS A;  2E7W A;  2B8Q A;  2QFJ A;  4WXW A;  4K2X A;  2BQR A;  1L3S A;  2DNP A;  3SV3 A;  1LXN A;  4O4G A;  2PO4 A;  1KTV A;  2ZH9 A;  1U47 A;  1T9X A;  2EXU A;  4K5R A;  2HS3 A;  2ZVI A;  4IH6 A;  4PZV A;  5E41 A;  1DLO B;  3HFV A;  4DPO A;  5B0C A;  3IRW P;  1FFW B;  2W9B A;  2BE7 D;  3C6U A;  1RWO B;  1UZD A;  2FJA B;  5DGA A;  2V4Q A;  2DGW A;  1KQG B;  2R7O A;  2IDL A;  3W8P A;  1RE1 B;  1VCT A;  4C8Y A;  4LBP A;  1S76 D;  2WVF A;  5E0O A;  2DEI A;  3FC9 A;  1S1V A;  5JVH Q;  3MMC A;  4DCO B;  2KVI A;  1PIE A;  4DV7 F;  2DHG A;  3RB6 A;  4ED6 A;  3NCQ A;  4TY8 B;  3R7B B;  2ADB A;  2UVR A;  3PY8 A;  2HLU A;  2NPI A;  3NGT A;  4DL3 A;  1ZAX A;  2QG9 B;  2IM2 A;  5DQG A;  1HA1 A;  1JNR B;  3KYL A;  4DL6 A;  2AGP A;  1G3O A;  3FBE A;  3H2U B;  1YHQ S;  4V19 X;  4X2B A;  2VKR A;  1JLC A;  2XMK A;  2Q3P A;  3VZH A;  6FDR A;  3RUB L;  2XO7 A;  2DVI A;  4K0K J;  1KVJ A;  4F3O A;  2W2P P;  1U1L A;  1HWI A;  2ACM A;  3M8W A;  2HFO A;  4NMX A;  1U1P A;  3CCL S;  2YKA A;  1FTC A;  1SB6 A;  2WW4 A;  4PYA A;  2PI4 A;  4DMZ A;  1XEZ A;  4KJI A;  2AEM A;  5HVH A;  2HAI A;  2OLW A;  1QSS A;  2AGO A;  2RML A;  2NUH A;  4KGK A;  1LKZ A;  3LO3 A;  3A3N B;  3AY0 A;  3SEO A;  1NJI T;  4PYD A;  2HHH J;  1CC7 A;  3H98 A;  3KDO A;  4RNO A;  4NYP A;  4LFA J;  3ITH A;  3TQE A;  1Q78 A;  4HVZ A;  3HJF A;  4WYW A;  3U27 A;  1VDH A;  3P45 B;  3O6Q A;  3H4D A;  3NGD A;  1ACM B;  2DPI A;  3MWB A;  4ECW A;  4TU7 A;  2GIQ A;  4WWS A;  4ZA1 A;  3J81 j;  3JYT B;  2GO8 A;  2BKN A;  3H5S A;  1OPZ A;  1UJ6 A;  2LMI A;  3EXC X;  1KKH A;  2CQP A;  3LF0 A;  4KH0 B;  3SSQ A;  2FGO A;  1KR4 A;  2NQP A;  1S9G A;  2CVI A;  3TOQ A;  1RAH B;  2KM8 B;  5HN0 A;  2EBE A;  3PIO Q;  5H9F K;  4P73 A;  2MST A;  1Y5N B;  1CQN A;  2MZJ A;  1NK8 A;  1SL0 A;  3TRG A;  3N0V A;  2IDE A;  4EGL A;  3MDF A;  4RW8 B;  2YWE A;  3FCV A;  2LEC A;  4B17 A;  3RR8 A;  2RHQ B;  2ZZT A;  3PM9 A;  4B3O A;  2FY8 A;  3RZA A;  2Y3Y A;  2OUG A;  2BX6 A;  2UU9 F;  3IG1 A;  2H5E A;  3JAM U;  4N41 A;  4TLR A;  4MIA A;  4CLT A;  1FKP A;  2AW0 A;  2FZG B;  1D8Y A;  1N5Q A;  1VQ4 S;  2WB1 D;  3SBM A;  4FBU A;  4B9M A;  3OD2 A;  3ZZY A;  4AFF A;  3QT8 A;  4LIW A;  3H25 A;  2OML A;  4C4W A;  4WZQ A;  1JLF A;  3CME S;  2HVH A;  4DWI A;  7FDR A;  2EVZ A;  4USH A;  4CO3 A;  3W8G A;  1NKE A;  3J7Z 5;  3MM7 B;  2R8G A;  1RWV B;  3KHG A;  1CSJ A;  4P2F A;  5H9E K;  2XWY A;  3NCP A;  1S72 S;  5DDO C;  4W4M A;  2GVD B;  1D9F A;  2JHE A;  5F8M A;  4U67 Q;  1F9F A;  2DRA A;  3O1L A;  2F3J A;  2KJV A;  3KUE A;  4IRK A;  2CG8 A;  2A6O A;  1SH2 A;  4FF1 A;  1NME B;  5EGY A;  3RB0 A;  1FKP B;  3JTP A;  1JLQ A;  1RAB B;  4X65 J;  2K1R A;  1RWW B;  3KLE A;  1ZTW A;  1KRP A;  3LP0 A;  3IWN C;  3HVW A;  2QX0 A;  1U1R A;  2XLK A;  3Q8Y A;  4C0H A;  1ZAW A;  2F8E X;  1HBU B;  2Z2L A;  3KJV A;  4DL4 A;  4XK8 C;  2E9T A;  2UXB F;  1YZ7 A;  1IVZ A;  3DMJ A;  5C7P A;  3OL7 A;  5HVF A;  4LT6 A;  3HVR A;  2DRD A;  4N47 A;  3BPS P;  1V3Z A;  3UNY A;  3W9H A;  2XS2 A;  1EP4 B;  3QSI A;  3TZW A;  2D1C A;  3TUZ C;  4PQU A;  4MYT A;  5KFO A;  3GP9 A;  3Q86 A;  2K06 A;  3TNV A;  3J80 Y;  1V3S A;  3FNN A;  4I2P B;  2B9X A;  3QAU A;  2W9A A;  2N7Y A;  3OTB A;  1GFW B;  1WC4 A;  4I68 A;  3UW1 A;  3KLI B;  3VAH A;  4ECR A;  4O3S A;  1AT1 B;  4DFK A;  3M9M B;  3CW2 C;  3E8O A;  4A48 A;  2VQE F;  3KLE B;  4DV4 J;  3KG0 A;  5DDR C;  4ZVP B;  4J9K A;  1VQM S;  2KFN A;  1ZM2 A;  1X4B A;  4NLY A;  3TZZ A;  4FXW A;  2D41 A;  4ZP6 A;  4EFA C;  1M90 T;  3H2L A;  4DCP B;  2JC0 A;  3NXZ A;  1KVI A;  2EC2 A;  1WTF A;  1TVR B;  1X4A A;  2J8S A;  3OXL A;  2ZD1 B;  4ZPT R;  2X1G A;  3CGI A;  3G8T A;  3LWL A;  1RHR B;  2XCP A;  1RT4 A;  2E1R A;  1YX2 A;  1IBM F;  1UZH A;  2KN4 A;  3C6T A;  3GZ7 A;  1C0T A;  3MED A;  2X3D A;  4M1K A;  4I2P A;  2B8P A;  4QW9 A;  3Q24 A;  4CH0 S;  2KTQ A;  1B4S A;  2VDI A;  3C16 B;  5CHC B;  5I42 B;  3PW2 A;  3HT3 A;  3CNQ P;  2FPH X;  3M2V B;  4OYA A;  4QOT A;  1UP1 A;  1KWM A;  2CQD A;  2MHE A;  3CCT A;  3IP0 A;  4LR9 A;  5IFM A;  2DY1 A;  2RJZ A;  4XDC A;  3G6E S;  2YX1 A;  1RKJ A;  3N5B A;  5ETO A;  5T7L B;  3OTO J;  2RDI A;  3GFX A;  4IOC Q;  2BM0 A;  2G0I A;  4HDG A;  4F4X A;  1VQP S;  1LWE B;  3LAM A;  4FKX A;  3M9O B;  1LEO A;  2X1F A;  2UP1 A;  5HI7 A;  4X65 F;  1OYE A;  4ES1 A;  2NXU A;  1R8P A;  4YR2 A;  1FXL A;  3B6B A;  3UD3 P;  4NML A;  3TEG A;  3K5M A;  4FPR A;  3LH2 S;  3Q0A A;  4J9N A;  4NI2 B;  4MK8 A;  2DH8 A;  1T02 A;  1HHS A;  2FVS A;  1W7W A;  3CJ4 A;  1T94 A;  1HNW F;  3M2V A;  2W2Q P;  4H4K A;  4B08 A;  4QPX A;  3VGU A;  1RYR A;  4RW4 A;  3NY0 A;  2G1H A;  4AXI A;  3HM9 A;  1IM6 A;  1KQF B;  3QGP A;  3PX4 A;  1SJ1 A;  5LT5 A;  1EQ0 A;  1GH8 A;  1REG X;  4OHX A;  1VQO S;  3ISN D;  4AL7 A;  4JOU A;  2A2C A;  1NSQ A;  1PC4 A;  2CJX B;  2IVM A;  2DIV A;  4X4T A;  4U7U D;  3D7S B;  3FEZ A;  2NR0 A;  1S97 A;  2HFU A;  3POT B;  1KEK A;  5CAB A;  2WK4 A;  2VKZ G;  2XLI A;  1R0B G;  2YPY A;  3QRQ A;  4NI2 A;  1W26 A;  1IKV A;  4C0B A;  3N4W A;  2AJF E;  5DZ7 A;  1VQ8 S;  5A8R B;  1M5O C;  4LMZ A;  1B7F A;  3CD6 S;  1WOS A;  5KT6 A;  4ZOS A;  4B3M J;  3B4D A;  2BZ2 A;  5DO2 A;  4ED4 A;  4Z7C A;  3HHK A;  4LFC F;  4WE1 A;  5HO4 A;  1QSY A;  1D8Z A;  4I67 A;  4ZCK A;  3GFY A;  1FWL A;  5F8L A;  4EBE A;  4ZVQ B;  1WOO A;  2YQ3 A;  3CCQ S;  3BSO A;  1VLY A;  5H9E J;  4MKY A;  5KFF A;  4WK3 A;  4ZPB A;  3K59 A;  1X0F A;  2JEJ A;  4B3R J;  2OI2 A;  5L1I A;  1R0C B;  3BH7 B;  1T05 B;  3PDN A;  1RP5 A;  1VQ7 S;  2ZHO A;  4ENO A;  4ZLJ A;  3TJA A;  4CNZ A;  2XTJ P;  2RQM A;  4QQB A;  5C2C A;  3R5J B;  2FJW A;  1UVN A;  4PG8 A;  3M8P A;  1SI9 A;  3M2R B;  1IKV B;  5GAH I;  3IFE A;  2CZ9 A;  3H4B A;  3IN5 A;  2KT5 A;  3FEY B;  2QA4 G;  2HWI A;  3V4M A;  1H2U X;  2H9Z A;  3I0S A;  3T6B A;  4K59 A;  2BRL A;  2I0X A;  3DGV A;  5J2M A;  3DCA A;  2E44 A;  5CCM A;  2BAN A;  3JSM B;  2YKQ A;  1QTN B;  5E3Q A;  5LJ3 Y;  2GML A;  1H6K X; 
#chains in the Genus database with same CATH homology
 3DDI A;  3R9L A;  4F36 A;  1NPK A;  4ANC A;  3ELH A;  5IOL A;  4UOG A;  3FC9 A;  1F3F A;  5BXI A;  3ENA A;  1HIY A;  1NB2 A;  3ETM A;  3NGT A;  4C6A A;  4HR2 A;  2VU5 A;  3VGT A;  1BUX A;  3ZTS A;  3BH6 B;  3FBE A;  3FCW A;  4S0M A;  3EMT A;  1PAE X;  1S5Z A;  3FKB A;  1XQI A;  4FKY A;  1NUE A;  1HHQ A;  3Q83 A;  3NGR A;  2B8P A;  2DY9 A;  1NHK L;  1B4S A;  1NDL A;  1NCL A;  1F6T A;  3DKD A;  3PJ9 A;  2DXD A;  1S57 A;  1MN9 A;  1NSP A;  1B99 A;  1UCN A;  3VVT A;  4UOH A;  1PKU A;  4ANE A;  3WX8 A;  4FKX A;  5CAA A;  1LEO A;  3BBF A;  4CP5 A;  2NCK L;  1NDC A;  3VVU A;  3B6B A;  3FBC A;  1WKK A;  2ZUA A;  4UOF A;  1W7W A;  2DXE A;  2HUR A;  1BHN A;  3FBF A;  2CWK A;  3Q8V A;  2AZ3 A;  3VGU A;  3EJM A;  3FBB A;  4W98 A;  1KDN A;  1U8W A;  3FCV A;  3EVM A;  1VYA A;  2BX6 A;  3B54 A;  3EVW A;  4AND A;  3GPA A;  1WKL A;  1NSQ A;  4WBF A;  2DYA A;  3ZTP A;  4DI6 A;  1EHW A;  2BEF A;  3VGV A;  5CAB A;  3EE3 A;  3G2X A;  3EM1 A;  3Q89 A;  3VGS A;  3ZTO A;  1S59 A;  3JS9 A;  1NDP A;  3EIC A;  3L7U A;  1LWX A;  1NDK A;  3BBB A;  1BE4 A;  3NGU A;  3BBC A;  3ZTQ A;  1HLW A;  4O0N A;  2HVD A;  3MPD A;  4F4A A;  1NSK L;  3BH7 B;  4ENO A;  3NGS A;  2AZ1 A;  2DXF A;  1K44 A;  1ZS6 A;  3PRV A;  3Q8U A;  3Q8Y A;  1XIQ A;  4EK2 A;  5C7P A;  4DZ6 A;  1JXV A;  1MN7 A;  2HVE A;  2B8Q A;  4DUT A;  3EVO A;  1NLK L;  3ZTR A;  3GP9 A;  3Q86 A;  4KPC A;  1WKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...