3ENAA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dgdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
b'LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3enaA00
1NCLA 4UOHA 1NUEA 5CABA 3FCVA 3Q8UA 1U8WA 2DXDA 3NGTA 3EVMA 1WKKA 1XIQA 2BEFA 3Q83A 4F4AA 3FBEA 1HHQA 1F6TA 2ZUAA 4ANCA 3JS9A 3BBCA 1LWXA 3FBCA 1NSKL 2NCKL 4S0MA 3BH7B 3ZTPA 3NGUA 1B99A 1K44A 3ETMA 3FBFA 3EM1A 4FKXA 5IOLA 3NGRA 3EICA 1MN7A 4HR2A 5C7PA 2CWKA 1PAEX 2HURA 3G2XA 3PRVA 3FBBA 3ZTQA 1W7WA 2DY9A 4WBFA 1NSQA 3BBFA 1NDPA 5BXIA 3PJ9A 3DKDA 4KPCA 1ZS6A 4F36A 1B4SA 3FKBA 3EMTA 3BBBA 4CP5A 3FC9A 4UOFA 3B6BA 3VVTA 4ANEA 1NDCA 2DXEA 3EVOA 2HVDA 3GPAA 3DDIA 4UOGA 2VU5A 4DI6A 4C6AA 3Q8YA 4EK2A 1KDNA 4DUTA 3EVWA 3VVUA 1NDLA 3ELHA 3MPDA 4O0NA 3GP9A 3ZTRA 2B8PA 2B8QA 3ENAA 1NDKA 1F3FA 1BHNA 3EE3A 1BUXA 1VYAA 3ZTSA 3VGVA 1BE4A 4ENOA 3EJMA 3VGUA 1HIYA 1NLKL 1UCNA 2DYAA 1PKUA 3BH6B 3FCWA 1NPKA 3VGTA 5CAAA 3ZTOA 3Q89A 3NGSA 1LEOA 2AZ3A 1XQIA 1HLWA 1JXVA 1NB2A 1WKJA 1S57A 1S59A 1WKLA 3Q8VA 4ANDA 1NSPA 2DXFA 3R9LA 3WX8A 3VGSA 3L7UA 2AZ1A 4FKYA 1NHKL 4W98A 2BX6A 4DZ6A 1S5ZA 1EHWA 3B54A 1MN9A 3Q86A 2HVEA
chains in the Genus database with same CATH superfamily
3TWZA 2CWXA 5E3AA 2G2ZA 2UXCF 3W9IA 4WE1A 3GJTB 4OZ2A 1Q4RA 4RNNA 2QA2A 2VPXB 1S1UB 3BH7B 4ZK7M 3MPVA 5HQLA 2EPIA 5B08A 1OQ6A 1BQXA 2CIMA 2COLA 4IKAA 1HBUB 3GIJA 3LGHA 4JI3F 2VASA 3AY0A 1FT8A 4LF1A 1F60B 2CYYA 2NQPA 5BXIA 2MQMA 2O1PA 3FC9A 2VG5A 1R3NA 1SJRA 4A8QA 2FUG9 2YPZA 4DSJA 2FGCA 1M5VC 1CJKB 1RACB 3THPA 2ZJRQ 3HHLA 3MGJA 1HARA 5HJYA 1UWBB 2DTJA 4U9RA 2GZOA 4WFAQ 2BV3A 2Y1JA 3PCOB 1S0MA 5DS7A 3BGFA 4F4ZA 3E2EA 2J76E 2G2YA 2R2TA 2YX4A 3WIUA 4P10A 4XK8C 4KSEB 3RW6A 4WCEQ 2R2SA 4CRJA 2KU7A 1U7LA 4TU9A 1SJ3P 3G87A 4L74A 4J9KA 3DC2A 2E1CA 1F9HA 3OLAA 3HKZD 3D7SB 1N52B 3NG8A 4QIWD 4RW8B 4NCAA 3ILJA 4DN9A 3NGDA 2YKQA 4A4JA 4G65A 4NEYA 5DRKA 1RBAA 3DDNA 2KH9A 1RWPB 4Z37A 3AA9A 2ALZA 1P1LA 1CS4A 3Q2SC 1FXLA 4CH7A 2UUAJ 2QEXS 3LAMA 1OIAA 4KR0B 4OZNA 3UCGA 2QSFA 3LH2S 1W26A 2DNOA 1YBUA 3OVBA 2RJZA 4M5MA 4R8UB 3LA0A 2Y8WA 4KY3A 2AZ3A 5I3UA 2NPFA 4WZMA 5BR8F 4NA1A 4OLPA 3Q8VA 2I8EA 2ALYB 5ETTA 4DPYA 1J5OA 2VPYB 1REVA 4PG8A 1UA1A 3Q86A 1EHWA 1KP6A 3AB2B 4BS2A 3NGTA 4CLKA 1HI1A 1NXIA 3RAXA 4UY8T 3QMQA 2QMXA 1CJTB 4U8VA 2IM0A 4WE1B 4YN3B 4Y0FA 4ES2A 4WBFA 1RTIA 1FRJA 1V9OA 3DLKB 4OIXA 3QNWB 4ED6A 3ENQA 5F8NA 4ANEA 3RUBL 2C3UA 4PXCA 2DRBA 3R7NB 5L9XA 3DRRA 1HQUA 1TTHB 2UVWA 3MD3A 2D69A 4ECVA 2IMWP 2C2MB 3QRRA 1HBMA 3R7SB 3WQPA 2XS5A 1HIYA 2HFSA 4UZCA 5IV3A 2B5JA 1O0PA 2FQQB 2LXUA 2YVSA 3KUGA 1CG2A 2UUTA 3H4BA 2V8GA 4NZ6A 1AFIA 3CJ0A 3QIDA 1C4AA 1F2GA 1RADB 4A8SA 3KLEB 4K2JA 4DU8A 3R2DJ 3FBCA 4FXDA 3PM9A 2B4PA 2G2OA 1KBRA 1RAAB 4DL7A 2DGVA 3ET6A 2ZDOA 4JV1A 5L8RC 4ED2A 1MWQA 1NK9A 1RQ0A 2QT7A 1R0AA 3HHLD 4Q45A 4ZVFA 1WF2A 2FJWA 4CO0A 1GMWA 4LF2A 2RUSA 3TAQA 2OIHA 2KYZA 3A4TA 3BGLA 3V6HA 3OR1A 2CG4A 2R7WA 4O3QA 4DWIA 5B09A 1AYEA 2OEKA 1N0VC 3KMSA 4F8RA 2YWHA 1RA6A 2K7KA 4W90B 2SXLA 3OD2A 3O2IA 3MM9A 3J7ZT 4PQAA 2ZOMA 1HW8A 4OYPA 1VBYA 2WVDA 3V6DB 1FWPA 2RDDA 2QSWA 1KTVA 1Q16B 4UUXA 3I0RB 2J6UA 2JFKA 2CQ0A 5I3UB 2GMJA 1U02A 3POTA 4PYDA 5HJXA 2B43A 5H1SV 3LANA 2JLEA 4DFPA 2ZEJA 3DN9A 2UXBF 4LR7A 1CPZA 1P6TA 2DNMA 4F4YA 2HFNA 2V34A 5LXYA 3IC1A 3ZNJ1 2MHEA 4XDDA 2OO4A 1JKHA 3EMTA 4YB7A 2QA4G 5AXLA 5KAKA 3D54A 3TX0A 3LWMA 1T9UA 4YB1P 4PXDA 5I3QA 2OEMA 5AT1B 3AJDA 3G9CA 1KKHA 5FDLB 2B8PA 2J0QD 4IYQA 3RU0A 4EFAC 3OSNA 1I1GA 1HA1A 3DOLB 3VAHA 3PX0A 1FVQA 3Q2TC 1HBMB 1S59A 2EVZA 1FF2A 2MKJA 1WD6A 3MEEA 5E33A 3H90A 3QLHA 2KI2A 4Q0BB 4U67Q 4OLOA 3UDEA 1NJWA 1HWJA 4FPRA 2LU1A 3HSZA 1T9YA 2YNIB 3JS9A 4EZ6A 2ASLA 2EK6A 4CLYA 4DV4J 1RKIA 1KLMA 3AH6A 1VQPS 1FXDA 5CZXA 1NSQA 2HKEA 4EYHB 1KFDA 3DKDA 2MEWA 2QLBB 3ET6B 2EFQA 4BLGA 4K8RA 2JVRA 5I3PA 2K06A 2AGPA 2G4BA 4Y65A 3A13A 1RT6B 4I2PA 1IBKF 1JLBA 2E7WA 1IKXA 3NXZA 5IT4A 4AQYF 2V4JA 1SKUB 2F63A 3MM8A 1B7YB 4QPTA 2GCFA 2CZ9A 4KT0C 2RU9A 1RCXB 1Z2LA 3PV8A 1R8BA 3O3LA 4ZVSB 1TELA 3MR6A 4K50A 4ELTA 2VIHA 4K5RA 4LSNA 2ROEA 1Z4UA 4BDPA 1AUSL 4C2MA 2OTJS 3KK3A 5D4OA 1YJRA 2GQ2A 3MI7X 3T9ZA 2AT1B 2V9KA 2QYCA 3FGVA 4PRFA 1GMWD 3PO4A 3RRKA 2V9WA 2XQCA 4K4XA 4YFUA 3IRXA 3NNHA 1NU4A 1FFGB 3K2YA 2BJ3A 2LA6A 5E5NA 3BM7A 2C3MA 2BE2B 1FDNA 3CMAS 3P45B 1XMBA 3VGVA 5D8HB 1WSRA 2EEYA 2JNJA 4ZPAA 4DJBA 1HKAA 4NCGA 2J8AA 2DGUA 1FDAA 3IG1A 1S12A 4DL4A 5J1EA 1U1OA 1B0TA 1V3SA 2DGTA 3PJWA 2LMIA 3JQKA 3QAEA 5CCMA 4ER8A 3NLCA 4J9RA 2J5AA 4YP3A 1VQLS 4Q8EA 2CNLB 2QIFA 4M5GA 3KJNB 2HBZB 3G6YA 3IS9B 1RAIB 3DCAA 4URQU 3CW2C 1BWVA 2MKSA 4IQXA 4ZIWA 2VG7A 2R42A 3LW5C 1X5OA 2YKMB 1RLCL 2ROGA 3EGWB 2W2QP 4QQBA 1YZ7A 2FZCB 3OL6A 3GR1A 1RZMA 2DNGA 4JYAF 1NDLA 3M1VB 4ECUA 1X4CA 4ZVPB 4I2PB 2OAUA 3ZTOA 3MMBA 4RU9A 4OI2A 1IJEB 1DJ0A 2V4JB 3PEHA 2MHNA 2HIQA 2DKOB 5KFTA 2W7AA 1QM9A 3BN4A 2R8HA 1ZZNA 4L3NA 4ZPBA 3PYFA 4OHVA 2YH0A 1XIQA 1HHTP 1IBMF 2F9JA 4WF9Q 3R5CA 3C6TA 2DIUA 2IYIA 3DLEA 4EUVA 3BYPA 3LWLA 4LSNB 2Z2YB 1UVKA 1RTJA 4WXWA 2V8PA 3DI6A 1XBWA 1TZ0A 1NKEA 3MURP 5ETSA 3U1MA 3CJTA 1B70B 1UVMA 1WNEA 5AJ3F 3OT9A 2HWTA 4F7VA 4RUCA 1UPPA 1OJ4A 1UTAA 1NDCA 1TKDA 2ZE2A 2Q6CA 2UP1A 5DQHA 2C1EB 3M9NB 3GP9A 4DV5F 2W2MP 2VJUA 4I67A 1JLAB 2IJNA 4F04B 3VGUA 4CLUA 2DYAA 1RAJA 4QIGA 2PGCA 3QWUA 4C8KA 1U0SA 5D4LA 3QWPA 4OYBA 2P2CB 2NLWA 1FNOA 1AT1B 3IG1B 3X1LB 3QJPA 2PA8D 5HMWA 3FSXA 1ZM2A 1LXJA 3V6KA 2Z2MA 1VQNS 1RT2B 3J80Y 3TZXA 3HCXA 5BYRA 5KOWA 1L3SA 4N76A 1UJ6A 1RWKB 2R7TA 2CJBA 3AD9C 3N5BA 3RR7A 1NB7A 2QYGA 3SDEA 4ZA1A 4HL9A 4CT8A 3DLJA 2HMIB 1SJ1A 3IWLA 5C2GA 3CJSA 3M2VA 2U2FA 3DGPA 1S76D 3ELHA 2XLKA 1QDUB 2BKOA 2GMHA 4OHYA 2XCAA 2UUWA 2VFRA 4FBTA 4RR5A 2IRUA 3SZ2A 2F9DA 2EW9A 1WG1A 2H3EB 2Z57B 4WZQA 5HMYA 2DNHA 5CA5A 2Y1LB 2CQBA 4RW6B 1IR1A 1X4DA 3VWSA 1R6VA 3MM6A 1NJZA 2CAJA 1K1QA 4ZP6A 3N9UC 2CVIA 4KGKA 1VIXA 1Y10A 1Y3KA 1PYSB 4M5LA 5RUBA 3M8YA 3IR5B 4YDDB 2K3KA 5IM0A 1X4BA 4WIQA 2VONA 1MNEA 2MJUA 5DDPC 2AJQA 3M8PB 4GVBA 3AOBA 3C6TB 3G2XA 3PRVA 4GO5X 1FTRA 3M7VA 4OI6A 1BWEA 2UUBF 4KV8A 1VLYA 4NLVA 2DJWA 1FNMA 4V19J 4P2MA 3W61A 2ASJA 4JI8F 1HNWJ 4F4WA 4FN5A 4ZVOB 5D4NA 4TVAB 1QE1B 1PILA 1U8SA 2JC1A 5IT9U 2DNPA 1X9MA 3DHWC 5G4DA 2V8DA 5KG3A 1KR4A 2B9WA 1GXTA 1FD2A 4ANDA 3R9LA 1WTBA 4FVMA 3ZC4A 5LSRA 2FJDB 3BO2A 5HATA 3D67A 1EKRA 1YWXA 3S1TA 1NUEA 4I64A 1HHSA 2D7SA 1EZZB 1HWLA 2HK2A 5AXNA 2YKOA 1AFJA 1U6BA 1RAEB 1QY7A 2N82B 1T3NA 2HSEB 2XY7A 2OMLA 4OYWA 4G1PA 2J6SA 3D6MB 2XZDB 1MU2B 3I4HX 1N5YA 4KKOB 5A76A 4JV2A 4J9SA 2E7XA 1FFWB 3QSYB 5KFQA 5LMNF 4FYYB 2R8IA 3UDLA 2YQ1A 4C7QA 1H7WA 1JB0C 3SDEB 1CLFA 4JUZA 1PGZA 2CADA 3SSQA 3GPAA 1RA7A 2KB2A 2HQDA 1TU0B 2BQ3A 4LF6F 4ECYA 1ZYQA 1P27B 3F44A 2KG0A 2U1AA 4PG5A 3M2VB 2YNGB 4A8FA 2RT3A 3I31A 2YKAA 3SSRA 5GMDA 1N5TA 2NYHA 5B0AA 5C42A 2Q66A 4CLPA 3SEOA 1RT1B 5LXRA 2HFZA 2QFJA 4PQUB 3T3FA 2MZTA 4G6VB 2VFTA 4DEZA 2FVRA 1C0UA 1S9GA 1U1KA 4C3LA 1JLCB 5D78A 1PSDA 4KE5A 2NSBA 2IBKA 4ZMMA 2FJVA 4EBCA 5B7WA 1GX6A 1NSAA 2OI2A 5CABA 4DR1F 3WC0A 2QLWA 1U1LA 1H72C 2NREA 2HHSA 1K73T 2MLXA 2J0XA 5K8NA 1DY3A 3D1OA 1N34F 1C1BA 1HPZA 1RHQB 4UY85 5CYMA 2IDEA 1Y5LB 4PUOB 3H2UB 5IM0B 4DG1B 2OMOA 3KLGA 4J9OA 4B17A 3W7BA 3PZPA 2MYFA 5ADZA 5EWEA 3CC7S 1N36J 3EVOA 2ZBPA 3OTDA 4KV8B 4K4TA 3LGNA 4O4GA 4TY8B 3V6JA 3JTNA 4JI7J 3RB4A 2A3JA 4ZDNA 3M8QA 2BM0A 1R31A 3RBDA 3M2RB 3TEHB 2LECA 1VMBA 4NLTA 1X7VA 5J2QB 2D3ZA 1VOMA 3CEDA 1ULRA 4F02A 4ZIVA 2FLOA 5IZHA 4UOHA 2O01C 4RX6A 3BSNA 2A10A 2KT2A 3AXMA 1RAOA 2DD8S 4RUBA 5E3RA 3MFHA 5D0RA 3FFIA 2HGNA 1KWMA 3GILA 1R7IA 3GFXA 5ETVA 3UFCX 2JEGA 2FIUA 2AD9A 3VHQA 2AKWB 2R7OA 1R27B 1FE4A 4NOHA 1HQEA 1PJ7A 1CSJA 4IFVA 1VFJA 3AJ1A 3GWCA 4U96A 1Y4ZB 1NEEA 3QJJA 3TRGA 2P6TA 2Y3YA 2PI5A 2HHHJ 4Q2MA 3ENWA 2EG2A 1HFEL 3MM5B 2DNQA 4IH5A 1IXKA 3QFHA 3FZ2A 3GCWP 3BH6B 1BMQB 3SFUA 3AHPA 4USWA 4OFZA 5H9FK 2WONB 3R6GB 2IVMA 1V5VA 3CVKA 1S57A 2X51A 2GVDB 3A3NB 2D3UA 1KOHA 1PBAA 1TKTA 4CTAA 3Q23A 1X9SA 3J7Z5 4HHJA 1XERA 3H20A 1NKCA 4OJGA 2ZH4A 5L38A 1J5EJ 4N5SA 4ICLA 2DRDA 1ZM3A 2C3OA 3NAHA 1EIYB 4QIEA 1K8AT 5KFFA 1TAQA 4OJ1A 2MPUA 2KJWA 1C1BB 1VC5A 1HPZB 4EEYA 5CYMB 4YR0A 3W9JA 3MEGA 3F41A 3DLLQ 3D1QA 5T7LA 4K4YA 5A8KA 3MR3A 3KHLA 1NDKA 2HFUA 1BUXA 1PC5A 3I82A 2NUUG 1S9EA 1KNZA 3HVTB 3PW7A 1S0VA 1ZAWA 5KT3A 2BA9A 3QJLA 4C11A 2UU9J 3BGRB 2VQEF 5CCLA 2BOPA 1YBTA 2YWFA 2VA2A 3M8QB 4LRFA 4A48A 3W1YC 3TAMA 4ID8A 5J1NA 2AGOA 2HQCA 4XDCA 1WELA 2RQ4A 1H6KX 2KFNA 1N33J 4LF9F 4DPXA 2XHWA 1QLNA 2ZH7A 2QLJB 4DUZJ 1BY9A 2JDJA 2DISA 3TX8A 3TA0A 1BXNA 1UVIA 3OXLA 3KG0A 3OTEA 3GMGA 3CF5Q 3KJVA 1HQEB 4JV5F 3QGPA 4WFYA 2GX8A 2QJ3A 2EXUA 4KAIA 4IFVB 4NLYA 1NNDA 4DS4A 1FFSB 2F8EX 4MKYA 1A7GE 3HM9A 1SIZA 4DV3J 4DSFA 1HR0J 3N0VA 1S0NA 3UN5A 2HW3A 4C4WA 5LSOA 2PE8A 2MQLA 3K59A 3J7A1 3KDOA 4X65J 3CJQA 1Z1ZA 4JV0A 4ZCLA 3H59A 2XS2A 4B3OB 3NL0A 3TYTA 2L9DA 2WW4A 1LKZA 4B9SA 1R43A 1BD6A 1RCOB 4F4AA 1TKTB 4CTAB 4B3SF 2ZUAA 2ASDA 3EGNA 1NPPA 1N6QB 2V68A 3HLUA 3M2UB 4OQJA 1YJ7A 5IOLA 1VHFA 4KQZA 1IBKJ 4E8UA 1UJ4A 2H51B 3P4UB 1FK9B 1H74A 1RJJA 4DS5A 2RKIB 2HLTA 1VQSA 2IM3A 1G3OA 4PEOA 5SUHA 2GIRA 3BR9A 1CC8A 1QVGR 1DLOB 4L75A 1UW4A 1WF0A 1FD8A 5KFIA 2HQIA 4DF8A 1TFYA 4KHPF 1RISA 3SQOP 4OI1A 4OI3A 4Y3CA 3KLFA 1VC0A 1VQMS 3LUYA 2WVBA 1S9EB 1JXLA 3V5RA 1E6YB 4OZ0A 5DG8A 1M5OC 3MM7B 3C16A 1RHMB 4C11B 3HHLC 5F8IA 4AD6A 3CCZA 4X4UA 1GK8A 4XPEA 4JI2F 4OI4A 3DYAA 1IWGA 3H40A 3MCOA 3Q83A 4QYRA 2KT3A 2ASYA 4CO4A 3V81B 1KVIA 2BZ2A 1AA1B 2XWXA 2BVZA 3MTJA 2CPHA 2M8DB 2GGPA 3DNCA 1RHRB 2XMMA 1HYSB 4JP8A 4C8ZA 3CCLS 1A9NB 2V4RA 2A1BA 2KM8C 1SQGA 4G1QB 2UZAA 5A2QY 2UVUA 4J9MA 4ECZA 3ENVA 4B02A 5GAHU 3VZHA 2UUAF 1F3FA 3C19A 2RRAA 1Y5IB 1B0VA 2PSZA 1RSCA 1RWVB 2BM1A 1PCAA 3KWMA 3ILLA 2XULA 1DTTA 4LRDA 2BJ9A 2QFIA 5L1KA 2V5HG 1VQOS 4V19X 3I96A 3MMAA 4NLQA 2CDQA 2XI2A 3L3CA 3M30B 2N7YA 1VBXA 1CULB 1LWCB 3CXCR 2ZH5A 1HHQA 3CUNA 4E2FB 1X31C 4PZVA 3MAQA 5DZ7A 3RBXA 2WBMA 3U27A 1S6QB 2Z58B 2AQ4A 2KFYA 4DV0J 1K0TA 1JXEA 3L7OA 2K7JA 4K5SA 1YK9A 4ZN1A 5CXTA 2YXLA 4LSLB 2PA3A 3KLHA 3OFHA 3TUJC 3M8ZA 4J9LA 3HMJG 2YKNA 5DDOC 3F0NA 2ZOGA 3TQ1A 3QT6A 4IDKB 2B8QA 3BGOP 3ZTSA 1IBMJ 1KN6A 1URNA 3IRWP 2WK4A 2AJ4A 1WC5A 4DX5A 5A8RA 3R5JB 3MAHA 3JQJA 4A8KA 1K1SA 3KLFB 1ZPVA 1QSLA 2CQ4A 3DLHA 3W5ZA 3OJSA 2VG6A 5F8LA 1IWAA 3TJ8A 3KJQB 3P3DA 2VFUA 2MKKA 2A6MA 2IVYA 1PO6A 1HNVA 4FF3A 3E01B 1VJQA 5M2RA 2PEHA 4GRSA 4NYZA 1M5SA 4KTQA 2HFVA 4ZITA 1F5CA 3CCRS 4AL5A 3THTA 1UETA 2Y9HA 3RBZA 4RBVA 2YPYA 1SVDA 2XEXA 3O44A 4RO0A 1RUSA 2ADBA 3UE2A 4ED7A 4K2XA 1VYAA 2XSJA 1WOPA 3CD6S 3H2LA 3CMES 1JX4A 1JLQA 2VH7A 3ZZOA 5H9FJ 4Y2IA 1T9WA 4Q5VA 3N6NA 4K7QA 1GTHA 4CNYA 3E51A 5DO2A 4DV6F 3HJFA 1R0BG 3UQSA 4M5NA 1KONA 2CJ9A 5E2QA 1WDTA 4QWDA 3HVAA 3U02A 5CH7B 3EPIA 4JOUA 4ECSA 2L48A 4FF1A 1KTQA 4K4ZA 5HVFA 4RW7A 3VVTA 4DFMA 3MPWA 2LU2A 3Q8YA 3N5FA 5LL6d 2HHWA 1U0HA 3RJMB 1RAHB 1YHQS 4FF4A 1IM4A 1NPRA 1RHJB 1OWXA 2K1RA 5DQIA 4CLLA 3B78A 4NA2A 4ID5B 3P8BB 3GE9A 1ZPWX 2HVHA 2GC8A 3MUMP 4QW9A 4WU3A 1U26A 5DLFA 5A8RB 3IGVA 1BQNA 2HHTA 1JK9B 2MMYA 4JI8J 2R7QA 2CPYA 3UNYA 3V2UC 4K4UA 1MROB 1K44A 2ROPA 1SH2A 2JEFA 1U1NA 1YRUA 2HNDB 2LQ9A 2VG6B 1XC9A 5H9EK 4DV4F 1H7XA 4PWUA 1JWWA 3OQ2A 4HHUA 1ZS6A 3FKBA 1P8GA 2BACA 1WC4A 4HT7A 4C98A 1G1XA 2RH3A 4XPCA 3D0HE 2ZHAA 3W5YA 2F8HA 5HVHA 5HL7Q 3KNAA 2RS2A 3GONA 1CJVA 2KRRA 4ZLLA 4IG0A 4F2SA 5KFXA 4LF4J 4X4RA 1VRUA 2B9XA 4WPAA 4A8YA 4OYAA 2QL5B 4LBPA 3W5XA 3CO9A 3PR5B 4I69A 1FWLA 3KNGA 2KT5A 1SUQA 2POKA 2O66A 5THWA 4UOCA 3RAMA 3H5YA 1B64A 3V4MA 4N56A 3D3CJ 1FKAF 2QMWA 4USVA 1LWEA 1LK5A 3GIIA 5KG0A 5F9LA 1IUJA 2DR8A 2VUGA 2ZZTA 3HFVA 1X9WA 6FD1A 2FB0A 5F9NA 4ZPCA 2HURA 3I5CA 3I0SA 3R2CJ 2O5DA 3K5OA 5B0CA 2B6AB 2L9NA 3K5PA 3C46A 4LBIA 2GJIA 1JQGA 2VODA 3GTYX 3TZZA 2K8GA 5DDRC 3PX6A 3K7RA 4CP5A 3KLIA 2XO7A 1T02A 1LW0B 1YJWS 1I51B 2CNNB 1U1RA 3LPEA 4HACB 2ADCA 1S10A 4B3MF 3GCXP 2ZZNA 3T9NA 2YNHA 2J7KA 1YBAA 3DDKA 4MK8A 3A3PB 1MMNA 3HD1A 1IJFB 2MKCA 1TKXB 2ZVIA 1S7HA 1Q82T 2BOAA 2RF2B 3EJMA 1FRKA 2YX7A 4EO8A 1U0HB 1NPKA 3CJ2A 2W2NP 3GIMA 1EKSA 2PEBA 3KHHA 3WIVA 4K59A 3JTPA 1T11A 4NEZA 4HT5A 3JAMY 2EBGA 4FS2A 2F4FA 3R6LB 2V0NA 4KJIA 4F3QA 5CYQB 1TR0A 4KGXB 2FVPA 3QPIA 4FYWB 3LPYA 1M1KT 2OSRA 2IBOA 5KFHA 2ZFHA 1F2HA 2ZDPA 4L72B 3VAFA 3PR4A 4PWWA 1SBRA 2IMOA 1WEYA 2RMLA 3KK1A 3K58A 2MLYA 1QAYA 1UFLA 1RE1B 4K4SA 2KRBA 1ZETA 4ZPVR 2DRAA 5K8MA 4TY9A 1V3RA 1NRKA 1KVJA 4H4KA 2R2RA 5G0RA 4TN2A 1FDDA 1Q5VA 1IKWB 1DFDA 5K9FA 5EHHA 1PYTA 3CDBA 3U1LA 4NXNF 4ZKAA 2MZQA 2VB6A 4K0KJ 4B08A 1I6JA 4NLPA 3FDSA 4ZVGA 3K5MA 2ZD1B 2AEJA 4RPFA 2YWWA 4IG0B 4CM2A 1VRUB 1EP4A 1YJTA 2AW0A 4LMZA 4N8OA 2IHR1 5JUMA 1QAJA 3KG1A 3DRSA 1VRQC 1TKZA 1DTQA 2ATCB 3P5TL 1U48A 1VS3A 5HMXA 1VBKA 3PFOA 2ZWOA 2O3DA 2NXUA 1XMOJ 2DO4A 3GYXB 3G6VA 4XAKA 3NY0A 2GJFA 3BYRA 2R8KA 5GVQA 5ETNA 1OMSA 2BJ8A 5K8OA 3CNQP 2RAQA 3NP5A 4WYLA 4K4WA 2J0WA 1RXOB 3KHRA 2V69A 2DGWA 2R7SA 1F5BA 4USJC 4HLBA 5ETLA 4U7UD 1E6VB 3EE3A 3OSPA 2YNHB 4BWMA 2KYXA 1VC6A 2AYGA 2PIIA 3S8SA 1S1UA 1JLFA 4Y6IA 1FESA 2EFPA 3A8JA 3ZZRA 4OYZA 3CCJS 1NJIT 3BDPA 2AV5A 1HBUA 3C2PA 2J7WA 3VQSA 1WHVA 3U7JA 1YI2S 1HBOB 3RTVA 5MLCV 3TA2A 2Z0GA 3SXLA 2OPRB 1CJKA 1NH8A 2FJEB 4LF5F 4BC9A 3BPSP 2Q6BA 1UWBA 2KXHA 3PW4A 2JWNA 5KT6A 2VQEJ 2BW7A 4NLXA 3A8IA 4ZJLA 3SYZA 1VR6A 4D3GA 4YB5A 1GTEA 2EFVA 3V4IB 5GMKa 1T03B 3NS5A 4AXIA 3BO4A 5GAEI 2PMWA 1IR2A 1D9FA 2RD5C 2LFVA 5G0RB 3IR6B 1UP1A 3CD5A 3MEDB 1QTNB 3T1AA 2N4CA 2HLUA 4RW8A 3W2WA 4WFBQ 4NXMF 7AT1B 4JI6F 1XMQF 4LVNP 2MZJA 3SQGA 4E0DA 2FTRA 2V6AA 3OV7A 4H4MB 2BANB 2HYIB 4QYZK 2FHJA 2JC0A 3MR5A 2ZJPQ 2NR0A 4J90A 1V3ZA 4DPWA 1TKZB 1HW9A 3OL8A 3DOMB 1DTQB 1YRXA 4R8UA 2XM3A 2XZWA 1SCJB 4C3KA 2XC9A 1X4FA 5GADU 4TU7A 2LEBA 2FC9A 4RWWA 3PHEA 1X5PA 1N5VA 4NYPA 3CDWA 5DLGA 2QE5A 4JI5J 4M94A 1TL5A 1FXRA 2YQ3A 4FNHA 2QMUB 4B3SJ 3HI9A 2JHEA 4ED5A 2HG4A 4FYXB 1CJTA 4O3PA 1YVFA 1HQ2A 2X7IA 4IR9A 3N6MA 1JLFB 3QZ7A 1N54B 1H3DA 2BJ1A 3T6BA 2Q43A 1NHKL 3UCZP 3DLKA 3PYGA 1T0TV 4MYUA 5DJBA 3AQPA 2HRYA 3QGGA 4LF7J 4B9VA 3JXOA 2NUHA 3NCQA 2R4FA 4RKUC 3S6EA 1EARA 4DR7J 3WBZA 1P9YA 1R8AA 2DNNA 3OUYB 5AE3A 5CHCB 4KHPJ 5KFRA 2BRKA 3JSBA 4F36A 3RZAA 4CM0A 4OZ1A 3I87A 4PYAA 4DX6A 5H9EJ 2BE9B 4DI6A 5B0DA 1WACA 1H2VZ 2JLFA 5F8MA 4QW8A 4IG3B 3FMWA 1WOOA 4I4BA 3I5BA 2PDAA 2XYPB 5L39A 2OD4A 4JI2J 5FD1A 3KLEA 3N01A 3KYLA 5IT0A 1AUDA 2X1AA 2VICA 2XGPA 3NBPB 5KG6A 3PVXA 5CAAA 3HT0A 3QRQA 2E5LJ 1OO0B 3IAM9 2Q3PA 1Y7PA 2XNQA 1X8DA 5C24A 4FVCA 3R27A 3W2WB 2DH7A 2DCUB 5I42A 5KFAA 1U8WA 3D5MA 1NHVA 2CPXA 4PAAA 3SQGB 2A2CA 4L73A 4IRCA 4DV2J 4NLGA 4A46A 5B0EA 3SCJE 1EQMA 3W65A 3AODA 4HR2A 3NEKA 2W9BB 3N28A 3ZTQA 3OLBA 1W7WA 1L3UA 3H8YA 1U1PA 3T1HJ 1H73A 3LP0A 2MZ1A 1FRLA 1NJXA 2DT9A 3US5A 2IC3B 2AJFE 3V6DA 1TL1A 4NMXA 3MXHP 3I0RA 4ES3A 1S77D 3NWGA 1N36F 3OFEA 1SJQA 2EKYA 2LP4A 1VGYA 2CJXB 3ZZTA 4YHHJ 2PFDA 4Y00A 3OTCA 4LF8F 2DNKA 4DLGA 3ISND 2M7SA 3H5XA 4JI7F 4DV7J 4M8LA 4BC7A 4BBYA 3VQTA 2RNEA 4DDFA 1S99A 5A2QU 4FKYA 1FX2A 4WKYA 3KHGA 3WC2A 4ZLNA 4QOTA 2EKNA 4UZBA 2YNFB 2ZBQA 2K3IA 4CQ1A 1HNIB 2CZVC 5FDLA 4J9QA 4I2QB 2E5HA 3TUIC 3MEKA 4HH1A 1REGX 4X64F 3MWBA 3OL7A 1RWOB 1S72S 1IQZA 4QIFA 1NDPA 3DOLA 4RW4B 2ZKUA 2F7VA 1R8HA 4L6V3 4CH1A 5LMUF 2W7OA 2R7XA 3T1YJ 2QRRA 2CG8A 1D9AA 3IP0A 4GC7A 1V5IB 4DUTA 4GKKJ 4KB7A 3UO0A 3ZZZA 2N7CA 4Q0BA 2XY6A 3OW2R 4NI2A 4F3MA 2DO0A 3BQ0A 2CQPA 2HHHF 4RNMA 2YNIA 1Q8LA 4I6WA 5F41A 4C8MA 3LOUA 2UUCJ 3G8SA 4ZHRB 2ACMA 1SJ4P 4H54A 2QL7B 2VV5A 1S1VA 3H5UA 4N7TA 5J2MB 1SV5B 4F0HA 5B0BA 3AT1B 1NM2A 4C8NA 2IYGA 4M5HA 5ETKA 3EXCX 4MFBB 5HVGA 5HO4A 1Q86T 1VISA 4NMLA 1LWFA 2V4QA 1NZAA 4O23A 1QSYA 5C24B 3EUNA 3EXYA 2XI3A 3QO9B 5I42B 4KGZB 4XO0A 2XY5A 5LM7E 4S0MA 1RT6A 2B4OA 3ZTPA 3Q8RB 2EK1A 4CI0B 1JLGB 1PAUB 2HHUA 2GAGC 1J5EF 4WP3A 3AD8C 4P2SA 3ZZ0A 2VL1A 2XNRA 4N41A 4X84A 1RI7A 4C0OC 4IR1A 1FX4A 3R3TA 4GKJJ 5KG7A 2R7VA 4ZCIA 1NK4A 2Y0BB 1GMUA 2HQFA 3LP0B 1YDLA 1L3VA 2KG1A 3RRHA 2WCXA 1VJWA 4J9UE 3UWTA 4IOBA 2HHPA 2QTWA 1TL1B 3FQKA 4AT1B 2VDIA 4KFBB 3M05A 1MMLA 2RILA 5HQ8A 3SCKE 2LDYA 1N88A 2MSSA 4DV6J 5KFNA 2W01A 4OZLA 4NPOA 3KJFB 2UU9F 1S4EA 4MKVA 2KHDA 2W8KA 4LR8A 1NKBA 3L9ZA 5A0YA 2RRNA 1KQSR 4R5PB 2G0JA 3ZNUA 1CC7A 1SC1B 1WUUA 5EWGA 5LJ5Y 3ITHA 4OX9J 2BE2A 3BO3A 1N33F 1AROP 1M5HA 2IM2A 3M8RA 2AEFA 2EBEA 2M88A 2H9ZA 3BZQA 4DUZF 1XNRF 3PW0A 2VPZB 1T3OA 1X0FA 2ABYA 2H1YA 4M1KA 2PO4A 2UV8G 3C66A 3PY8A 4P75A 1S4FA 3MMCB 1S7IA 2ZHOA 3K5NA 4LFCJ 3QT7A 2J8SA 4IRDA 3IS9A 4ZJQA 4ENOA 2OP5A 1X5SA 3JYTB 4DV1J 1FJGF 1HNZJ 4DV3F 1HR0F 1WOSA 2AYMA 3OTBA 2W8LA 1RT5B 4NI2B 2VBXA 2YKMA 5FIIA 4X65F 1O51A 2VBZA 4TYAA 3L7UA 1S1VB 1S5ZA 2XHCA 3DFEA 3AOAA 3CO0P 4LVOP 1TVRA 3DU6A 3DLGB 4ERDA 1M5PC 3M1VA 2GJ2A 1LWFB 2ATLA 4DX8H 3C6UB 1SL0A 4P7VA 4JI0J 2VBWA 4LIRA 2KXNB 4P74A 5HBMB 4MAKA 4O0IA 4P72A 2M2BA 5M2PA 2X3DA 4Y2AA 1QSSA 3ETOA 3I55S 2VFVA 2IM1A 4A8XA 2A2DA 2OD6A 1CEZA 3RGIA 4OV1A 3B8HA 2Z8QA 2G1DA 4TU8A 3C8YA 2LQBA 5GMEA 3N6LA 3VAKA 3DLBA 2CVEA 2NS1B 1OQ3A 1KOOA 2PC6A 4QZVB 3FMBA 4K4VA 1HNXF 1WEXA 2RIJA 3H42A 3L95X 4XTTA 3OFFA 5J1PA 1U45A 5U47A 1RWWB 1U25A 3JSMA 3CCTA 1F6TA 1CBKA 1KQFB 4WP8A 4A47A 2CNKB 3HT3A 1DURA 2D41A 5A0YB 5L9NA 1U2RA 4B3MJ 2BABA 3PNIA 2FC8A 4WJBA 1RKJA 1VQ4S 1JLAA 3UW1A 2HHQA 3ITHB 2RS8A 1S1TB 4DZDA 5DETA 1WG5A 3OL9A 1RBOB 2JOQA 2WAQD 4CYUA 1AZSA 1Q1KA 5MAOA 1QUVA 4UOFA 3UR0A 1FJCA 3ILOA 4RNFA 2GA7A 2QV6A 1X0PA 4WIIA 4CLSA 4C48A 3MOJB 3J81U 2NSCA 3HP6A 1YJNS 3GFZA 1RT2A 5ETMA 3I9V9 3NCRA 2CQGA 4Z7YA 4XIUA 1LQ9A 2B7CB 2FZKB 3RB6A 1JMTA 3TUZC 5JXSA 4ZP8A 5C25B 3PACA 4OX8A 1SXLA 3OVAA 1KVKA 4LFAJ 3B54A 2HMIA 3HHNB 4EZ9A 1KLNA 1FEHA 3Q8UA 4HTJA 3SIPB 2Q79A 5AE2A 4NA3A 4W92B 3I56S 5DGAA 1LWXA 4QWAA 1UEUA 4A8MP 2MTLA 1TVRB 1RHUB 4KRWA 2EWHA 3FEZA 1C1CB 4OX6A 1R89A 4WP9A 4L76A 3JAMU 1QVFR 4URSA 3BSAA 1NJYA 4DV0F 4NXNJ 3CJKB 3GQCA 1S6PB 2KZZA 4J91A 2C2OB 2P9GA 4RW6A 1U6ZA 1O5JA 3HF5A 1UEKA 1GEHA 4PG4A 3CB4A 5A8WB 1FWKA 4HI2A 3QT5A 4QU7A 1TL3B 3BB5A 1LOUA 4OX7A 1W2IA 1XR7A 2OFHX 2ZBIA 3M8PA 4OMFG 4AL6A 4EWTA 4ELUA 1Q7LB 3VGSA 1WC1A 4DR3J 4KHRA 2WOMB 3R5DA 3KK2B 2J0SD 4ILMA 4LQ9A 1X5TA 1RAGB 1Y00A 1G6BA 2XMWA 2QGFB 2B56A 1VQKS 4NX9A 4GC6A 1YJUA 3MOZA 2MKYA 4M5DA 1QE1A 4OHXA 3ULHA 4I6AA 3JSMB 2HNYA 4YQWA 4USUA 3B4DA 4X4SA 5IS2A 5L1JA 3M32B 4X62J 5HMZA 1Q8IA 4NRUA 3BSCA 1TUGB 1HWIA 2BJ7A 2MGZB 4MT1A 3P49B 2CXEA 3M6XA 4CYUB 1AZSB 2LA4A 3B4MA 3FEXB 1S6UA 3VAGA 2W24A 3CSKA 3IO1A 3DOKB 3NGSA 1IKYB 3R5BA 4Y2MA 3NNCA 1MU2A 4KKOA 2O67A 4LF5J 2UVRA 3M9MB 3MECA 4E98A 3DRPB 2KHCA 2C42A 2VPWB 5C2CA 2DGSA 4FDFA 2E5GA 2HBYB 4DN0A 1TV6A 3GIKA 3FBEA 4CT9A 4QU6A 2G9OA 4IRKA 2R8JA 2YNGA 3EZ5A 2WZ1A 1ZM9A 3EM1A 4PWDB 3ICLA 4KHMA 1S6OA 1GX5A 1RT1A 3C15B 3TOQA 2FGOA 1APSA 4ETZA 3TR5A 4PQUA 3NS7B 5D0HA 2BQRA 2J9EA 1JLCA 4NXMJ 1T05B 5HLFA 1XMQJ 4JI6J 3K57A 5IC4B 3MPYA 2F40A 2R3VA 5KG2A 1ZZFA 1GFWB 5IT9Y 3MTKA 1NK6A 2MY8A 3F56A 1CJUB 4ZPDA 4RZRA 4RUHA 3IWXA 3QAUA 2DIVA 1N32J 1QJHA 4R25A 3G6ES 4C8YA 4PUOA 1RBLA 2CJAA 1K0VA 1Q7YT 1OYEA 4DG1A 5CZVA 1RT3B 2DITA 1BC6A 2CFXA 4Y2KA 2ZH1A 1WKKA 1VQ6S 4OHZA 2N3OA 3LQVA 3MAAA 3KMQA 1VIOA 5D15A 1ELOA 3BBCA 2DNRA 4OZJA 3H98A 4AE5A 5ITHA 2I5JA 2YWGA 2HWIA 1C0TB 4X4TA 2X1FA 4TY8A 2JX2A 1MN7A 4PG6A 4OYIA 3D3BJ 4M5DB 6FDRA 2B3TB 4B9LA 3M2RA 2HNYB 4ZLPA 1B4SA 3TJ9A 5J2QA 2FPHX 2ZNYA 1CVJA 2M52A 4P73A 3CC4S 3QIPA 4RW9B 1H2UX 1AXQA 2Y0SD 4HDGA 4WFZA 4IO9Q 2KZMA 3BR8A 4OJ3A 3FZBA 1JLEB 3FK4A 2F8MA 4DBQA 1LEOA 3JSYA 5D6GA 5ETRA 1FRIA 4BWJA 1WHWA 4LF4F 2KJVA 3TA1A 2C2NA 2CPEA 2HVEA 2AX1A 1I94J 1UWAA 5E3CA 5JMNA 2OJ3A 4C0HA 5AE1A 4J7CA 4LRCA 1A0OB 3PRDA 3FCHA 3THVA 5EUHA 5J2NB 1SL1A 2RB7A 3MECB 2ZH9A 4R0JA 5FJ4A 2DNYA 2BBEA 2ZUGA 2OPPA 1TV6B 2GFFA 3UPFA 3OR2A 5L46A 1Q0NA 3MM5A 3EICA 5F8GA 1YJ9S 4CLTA 3R5AA 1V6HA 4USIA 2HZCA 4UQTA 4ZP9A 3SV4A 1VRTA 2WONA 4QR0A 1U2FA 2JLGA 3DGVA 1T9XA 2EFNA 2GVDA 2B51A 4MYTA 2IAJB 1LXNA 1EJ7L 5K20B 3GIRA 4I7FB 1BGXT 2PMHA 3KUHA 1OSDA 3MD1A 4PR6A 5HLFB 3N79A 1UPMB 4B3RJ 4NL5A 1NO8A 4EI2A 2VA3A 4DOZA 3O1LA 3W3SA 3NRBA 2VD3A 1ZAXA 4LJMA 4CO3A 2BUNA 4IFYB 1VHIA 3OJUA 2DPJA 1S1XB 5ETQA 5LSLA 1Y0HA 3AXKA 3ZZPA 3TZYA 3G8TA 4FXVA 1RLDA 1Y3JA 2F4VJ 2PI4A 3I9ZA 3LP1A 3T6JA 2CQHA 2JH3A 1EETB 1KD1T 2H48B 4DQRA 3G4SS 3R97A 3U1NA 3MR7A 3PG9A 1KQGB 2FYXA 2DK2A 2BW2A 4FKXA 3MAAB 2AJ1A 4Q7AA 4DHVA 3A12A 3N4WA 2FJBB 2I5JB 3HVTA 2IY5B 3UVJA 4LF8J 2MLZA 4USKA 2KTQA 3BGRA 4Q8FA 4ZJOA 2P9EA 2C2KB 3GJQB 5GAEU 3DRXA 3UD3P 1RU2A 1FHTA 1O8BA 1D1UA 4DSIA 2WSEC 3JQMA 2VKZG 2AX0A 3WZ0A 2XLJA 3LGMA 4DQIA 2W4PA 3TVKA 3SFGA 2Z4PA 4LFBJ 2HEKA 3QIPB 5KT2A 2OELA 4JI1J 1X4GA 4Q43A 2ACYA 2CQ3A 3HO1A 3HPOA 4H4KC 2D74B 3PO5A 4FF2A 2P5VA 1F9FA 4K0KF 6AT1B 3CCSS 3EPGA 1N5SA 2VG5B 1NSPA 4X64J 4CWBA 2ZNZA 1UL3A 1U1MA 3MF5A 2J9DE 1RT7A 2HHVA 1IQTA 3NOCA 2ZC4A 2ZBCA 3IWNC 4W4MA 5DDQC 3HHLB 5LMUJ 3RRGA 3CDAA 3NOGA 2AHOB 3CWJA 3DM2A 2YX1A 2EC2A 3VALA 3E8OA 1KSPA 1WORA 4OJHA 3MDFA 4ED0A 1H2TZ 1OSCA 1BQMA 2OPPB 1XEZA 5KFLA 4I0WA 1F9EB 3OR2B 2GHWA 4TQSA 2EG1A 1XMOF 5IWAJ 3PEJA 5ETOA 1F5AA 2XBPA 2PD1A 4NLOA 5KFEA 1FTCA 2Y1IA 1VRTB 4B3OA 1KDNA 4BHQA 2CQIA 1L3KA 1Q95G 3IGNA 4LRBA 4LSZB 2VHGA 2KM8B 2L9WA 5IFMA 1OY8A 3T19A 3BF4A 1UCNA 1N6QA 1IM6A 3M2UA 2D3O1 1YZ6A 3J7AN 4DR4J 3G96A 3CDUA 1CS4B 1RWNB 3TQEA 4DR5F 3OBIA 1FK9A 2LKZA 5F8JA 2RKIA 3M6VA 2C28A 5DM6Q 5GAHI 1U6FA 3LP1B 1LFPA 3L4BC 3HZGA 1DLOA 2RVJA 4X2BA 1J2VA 5SZTA 4ED1A 4YY3J 2QZ8A 3C3LA 1SL2A 2C2ZB 2D1CA 5IC6B 1R8PA 2VZ9A 1J5OB 1REVB 1EQ0A 2XB2D 5IV4A 5HQMA 2UXDF 3PHTA 1E6YA 3UVJB 2WSCC 3MM7A 3VVUA 4FYDA 2QX0A 4TLRA 3V81A 2M70A 2IPOB 4ALZA 1TAUA 3JSRA 1RTIB 3BSOA 1X4AA 3EDRB 4ED3A 5D77A 2JJ4D 2KVIA 4DCPB 4DR6J 5KFCA 2JZ5A 2W4CA 1DHMA 3DRRB 1HQUB 3DXBA 4USHA 3VF0B 2V2QA 2R7RA 1HYSA 1U09A 4USTA 1XNRJ 1NCLA 4X4VA 1ZTTA 2WVFA 2E9RX 4RBUA 5KFYA 1EX8A 1RT7B 4G1QA 1NSKL 1WJ9A 3ISNC 2B5JB 3TO8A 1XR6A 1U1QA 2DHSA 2BJEA 1CQNA 3DM2B 4P2FA 4DL2A 1FJGJ 1N0UA 1L3TA 2GHVC 3I5AA 4L3KA 1BQMB 4HKQA 5KG4A 4UTGA 1EAYC 3DRYA 4ZP7A 3M30A 1CULA 1LWCA 1HI8A 4PXBA 3NGKA 1G7CB 4HTIA 4NWBA 1FRXA 3ONQA 2XMVA 4JI5F 2CQ1A 1LFWA 3K17A 2AJ2A 1S6QA 1XQIA 3K8VA 3G71S 3DU5A 2BE7D 4V1Ak 2KXFA 1R0AB 2DXFA 3D6TB 4LSLA 3OR1B 3TEGA 5KFWA 4C8LA 1JIHA 2P6SA 4CO1A 1ACMB 1ZAVA 4DQSA 1KRPA 2RQKA 4C9DA 4LF7F 3MM9B 2KL8A 4IDKA 4Z2XA 3B82A 1BLUA 2ILZA 2CRLA 1N4LA 4DR7F 5E3QA 2GQQA 2D9OA 2JRSA 4C3MA 2DY9A 4LRAA 3QBCA 2YWKA 3POTB 4O3RA 1HNXJ 2GW8A 1G4CA 3QRPA 5KT4A 2VC0A 3WHIA 4NLUA 4DCOB 2V94A 4NZ7A 3G86A 1VDHA 3VAIA 2MQ8A 2ZJQQ 2HWHA 5CYJA 1WTFA 3TNVA 1FJEB 4F50A 2KKHA 2MY7A 1N48A 1JKHB 2C3YA 4J5OA 3E01A 2R7UA 3ZO7A 5CD4H 2FY1A 1MG7A 4WTYA 1TK5A 3O6QA 2BX6A 2E5LF 4KIAA 5KT7A 3H25A 3HULA 1R8CA 1PBUA 2FJXA 2ZWPA 2BEFA 2VFSA 5CD4A 4ZCKA 1RTZA 3P6YC 4NLDA 4TYBA 2IA6A 4HI1A 1B99A 3GSDA 3FBFA 1HD1A 4MK7A 4DV2F 1FCAA 5F0UA 1NAQA 3IN5A 3MEEB 4IUFA 3CCMS 4CH0S 1HL6A 1HBNA 2NZ4A 4UQGA 3GYGA 5CQGA 2DH9A 2LXIA 3QLHB 4WFNQ 1VLOA 3T1HF 4CLZA 1RP5A 4IQMA 4EBDA 1YRTA 1OPIA 3FRYA 1KQKA 2Z2LA 1SB6A 2GO9A 2UVVA 1WWHA 4X4OA 2XMTA 2F1FA 3W60A 1KLMB 1I3OB 4OYMA 1RTDA 4YHHF 1B3TA 1RB0A 3VGTA 2E1RA 5LJ3Y 3Q89A 2ZM6J 3T5HA 2CZ4A 4DV7F 3FJ2A 3CD7A 4JI4F 1Q53A 3FUYA 2MZSA 2IVFB 3UNGC 4FYVB 2HRTA 1JLBB 1S49A 4DL5A 1IKXB 4ANCA 1UKUA 4NLWA 2ZH6A 1IBCB 3MM8B 3M9OB 4U7UK 2N4DA 4URGA 3HHEA 4YR2A 4ITSA 3GYNA 2CJKA 1P9QC 3M6UA 3RG6A 2EI5A 1WF1A 1IKVA 2DGXA 4ID5A 4WTOB 4M95A 3D9BA 4MKAA 1YSJA 2FLPA 3H7HB 3PKMA 2RHQB 3KK3B 3T1YF 2CNOB 4GKKF 9ATCB 4IOAQ 2HFOA 4X66J 2CPIA 1YITS 5B0FA 1MROA 2BRLA 4HH0A 1SJFA 2UUCF 2HNDA 2DVIA 3IRXB 4YR3A 5IQQA 8ATCB 1MMDA 4FS1A 1IBLF 1GMVA 3QYYA 3Q8PB 4A8WA 2HGLA 2YY3A 1YGYA 4YEAA 4NZ0A 2EC0A 2E5IA 2V8HA 5DQGA 2OSQA 2NCKL 3X3UA 4NCGB 1YJVA 3RR8A 2B9EA 2ZH3A 1VQ9S 3PIOQ 5J1EB 4MJKA 1KHVA 2VBYA 2W2PP 4OL8A 2XMAA 1IVZA 1DQ9A 2L08A 4CZCA 3KKFA 4N8NA 4YS2A 4WFXA 2C22A 2FD2A 4Z7CA 5D0GA 4NE9C 4GKJF 1HBNB 3E3XA 1U4BA 1RYRA 3L09A 3UI3A 2R8GA 1NK5A 2VG7B 5JVHQ 2Y8YA 1WSVA 3NMAA 1GXLA 2P8IA 1RTHA 4MH8A 2HPUA 1PJ5A 4AXJA 1X4HA 3IA0A 3GZ7A 3HDSA 3SV3A 5I4MA 2YTCA 4BCAA 1RTDB 2HVIA 3FQLA 3W8PA 2B6AA 1ZA2B 2BQUA 2AYEA 1XNQJ 1MN9A 1C4CA 3W8GA 4B3TJ 5DG7A 2YBVA 2AYBA 1LW0A 3HVRA 2XMJA 2JVOA 4HACA 3MZIA 3HFZB 1I5OB 4RNOA 1YG0A 4DCJB 3ETMA 3MMBB 4NLRA 1W2BR 3J80U 1TKXA 5GAGI 4OX9F 2RF2A 5D4PA 3QSIA 2E66A 1KS2A 3A8KA 2F65A 5M2UA 4X4NA 4YB6A 1GT8A 4F0KA 3GV7B 3TVYA 2XLIA 4OZ5A 2H4YB 1IKVB 2PMZD 2GHPA 3DLEB 3IXQA 4CIOA 2L41A 1RTJB 5CYQA 2VF3A 4ZVEA 2BKNA 2R2UA 3DI6B 2LEPA 3SI8A 5BYSA 4LFCF 1SI9A 1DQ8A 3OTOF 3R7BB 2RSQA 3CJ8A 2NZCA 2MQPA 4GVLA 3D6FB 2WBRA 4DXLA 1HLWA 2E1MC 4DV1F 1HNZF 2CJYB 1VQ7S 4IH7A 1RAFB 5LT5A 3PRBA 2UXCJ 3VZIA 3WX8A 2ZE2B 2HZVA 5KFDA 1ZM4A 2LQ5A 4J9PA 3OHAA 2PFFB 3PYDA 2FY8A 4TNOA 2K2PA 1UW9A 3AOCA 4Y28C 3PW2A 4C0BA 1IKWA 3LTOA 4DUYF 4JI3J 1F3VA 2HZAA 4WYWA 1RU1A 4JBCA 1J27A 1WG4A 4WK3A 5KFUA 3RB3A 2VJVA 1T95A 1FE0A 1QAXA 1HWKA 3CGIA 4JI0F 2ZD1A 3S7RA 4DPUA 1H0HB 1RWXB 2ERRA 2BKPA 3HSDA 1Y9OA 3K8WA 2RDJA 2GQCA 4EK2A 1N8RT 3Q8QB 1H98A 2W1BA 5HN0A 1ZH5A 5A6PA 5E0OA 1JNRB 2QA1A 1U49A 3UN2A 1SKRA 3TJAA 1R0CB 1RTHB 2ZZMA 3VTIA 4M5IA 4G3IA 4D3HA 3DGPB 1SC4B 2ZITA 4WK1A 1FEEA 1M1GA 1PG5B 4U95A 2CQCA 4ZVRB 4AYBD 3KLVA 2QC3A 1GXUA 2XMKA 3NNAA 3AQOA 2DBBA 3LO3A 4GMKA 2RDIA 1E6VA 3GB0A 3FRZA 3MM6B 3GV5B 2XS7A 3IR7B 2EFOA 4QBUA 1OYDA 1JJCB 2AF6A 4MKBA 3BV8A 4F26A 3FNNA 4UOGA 3M6WA 2AMCB 4H4OA 3BQ2A 1HBOA 2WRMA 1JNZB 2FHOB 3J7YI 1S1WA 1YIJS 4LREA 3MUTP 2GIQA 4LT6A 4GVBB 2DPIA 2XSFA 1RT4A 5HP1A 3ADAC 2OPRA 1ZTWA 2FZGB 5HROA 5BR8J 1NK7A 2XZTB 2NXNA 1WI8A 3CJ3A 1LK7A 2QA4S 3UD5A 4KO0A 3CULA 4DZ6A 5GADI 2Y1RI 3EGVA 5LOQA 2HQGA 4LFAF 1RGVA 2J7UA 4C97A 4RJVA 5BJRA 4P52A 1KHWA 1FA0A 4ZVTB 3V4IA 1T03A 2M9KA 2V2ZA 5KFGA 1NBEB 2CKWA 2CWKA 4X4PA 4AL7A 4J9NA 4MTPA 3LP2A 3MEDA 2HQ3A 3MHYA 1R6YA 3W64A 2GVZA 4KPCA 1RWUA 4R0EA 2IRXA 2IIHA 2H4WB 1N5QA 3BKFA 2FVCA 2G13A 1OS5A 5FLXY 1Q81T 2HVDA 1OY6A 4EYIB 2VKRA 4DR2F 1S79A 1YKWA 5KFVA 3OFGA 4H4MA 7FD1A 1ZOTA 1N5YB 1DQAA 4DSKA 2BANA 4ZVHA 4CO2A 3RBEA 2FVQA 4ATNA 2I2YA 1PYOB 3UR3C 3LAKA 2AU0A 2WVCA 1MWYA 4O4RA 3CCUS 3DOMA 1DZ5A 2CJQA 4QR1A 1NK0A 1XWLA 4UUWA 3HK2A 2E9ZA 1ROFA 3FCVA 2E9TA 4DR3F 1X60A 1D09B 4P6QA 1UMJA 5C42B 1FERA 4MMOA 2XCPA 2H54B 3CPWR 3AA8A 4O3NA 1S48A 1WHYA 2RE1A 4I1TA 2VQFF 4WWSA 4NRTA 2E1PA 1NH7A 1C0UB 1S9GB 3GFYA 4DFJA 2DHGA 2MQNA 2DR9A 3TI0A 4CNZA 1UVNA 3KTQA 1DRZA 4DQQA 1GQEA 4KGVB 4X62F 3CCWA 1U24A 2AP6A 2DXEA 3ZFVA 2LVWA 2KFZA 1PC4A 4NCBA 2H5EA 3MPDA 4O0NA 1RDRA 4DR5J 2IRYA 1MSWD 3CT9A 4KC5A 2J9DA 4MK9A 2OFGX 4PKDB 1YX2A 4H4OB 4DMZA 1NK8A 3S01A 1QAIA 1S1WB 3NAIA 3KLGB 1ICEB 3OXFA 5KFBA 2XYHB 2HNZA 3OUYA 1RT4B 5HP1B 4DSLA 3VV2B 4KH0B 3M8WA 3RB0A 2E1AA 5HROB 8RUCA 2XWYA 2NXEA 2MKIA 5EWFA 2X1BA 3D1HA 4O4GB 1FDBA 2UXDJ 4U6PA 4KO0B 1FI4A 2RQMA 2UXBJ 1Y11A 4P7TA 4IG3A 2C2DA 3CMQA 3PX4A 5EGYA 3IAS9 3I6PA 4MIAA 3MR2A 4B9TA 2IJRA 5C7PA 4J37A 3PKYA 4CLFA 5F0WA 3NBPA 5KFMA 3CJRA 2HGMA 3D28A 2MDAA 2CPFA 3MPUB 2I6WA 2C2EA 2ZH8A 3BBBA 3D2WA 3LP2B 4A8OA 2G1HA 3TZWA 2GVZB 2A18A 3ZXWA 3FFIB 2V67A 4P71A 2MQOA 1T7PA 4RWXA 3BGUA 1RK8A 1LW2A 3EX7B 2CUYA 3H2VE 5KT5A 1XJWB 2OPSA 1FVSA 4ZS6A 3QFWA 2JSXA 3R8YA 2GMLA 1SIWB 1WC6A 2W9BA 1N32F 2NYIA 2DEIA 2JFDA 2H65B 1KC8T 1NZ8A 1RABB 4AFFA 4ECTA 2IC3A 2Z30B 1O6XA 5K14A 2P9CA 8AT1B 3GJSB 3QGHA 1WC0A 2HBRB 3DMJA 1M5KC 3FSYA 3W9HA 3NGRA 1SPBP 4F4XA 2FJAB 4F0MA 2IJFA 4UW2A 3HHKA 2A0FB 1TL7A 2B9YA 4TXSA 1UA0A 3M4XA 2C2RA 3A8EA 4QR2A 1Q5YA 2HIYA 1Q78A 2OUGA 3BREA 3BN7A 3VAJA 3BEGB 4FBUA 2ZBRA 5IQ6A 2QN6B 2BJDA 1F0XA 4ICLB 4AQYJ 3G6XA 2MZRA 4DX7A 1ZA1B 2YNFA 5L1LA 4OYOA 2W2OP 3F73A 3JB9k 1D9DA 2XO6A 1HNIA 2BR0A 4I2QA 4ECRA 2DHXA 4N47A 1SC3B 4ZCMA 3MEGB 5EDWA 4ZPWR 3TAPA 2HS4A 2Z2ZA 1SKSA 2HAIA 3AJ2A 5T7LB 4RW4A 2HNZB 1FJ7A 5A8KB 1TQLA 4M5JA 4DL3A 1M1HA 3T41A 1I94F 4U7CA 3KFWX 2CQDA 4EU0A 1FRHA 1IN0A 3D68A 2VOPA 4DFKA 1YTYA 2ZOFA 5B0GA 1VBZA 4RUAA 3R1HA 1QD1A 1VQ8S 3HSJA 2HS0A 2RRBA 3Q24A 3IBFB 4FPIA 3VAMA 4ZHRA 4HYKA 1WI6A 3TAMB 4PXEA 2W7PA 2LCWA 3D66A 4LBHA 5J2MA 1SV5A 3EZUA 2W9AA 3H5SA 2XG8A 2M3DA 1TMMA 4MFBA 2HVZA 4WU2A 3ILIA 1FKOA 2DR5A 4MIBA 5D3GA 5AXMA 3ENAA 1Q8KA 5HAOA 2DR6A 3QO9A 2LYVA 1WEZA 2E5JA 2OLWA 3TANA 4B3RF 1JLGA 3KJVB 2DR7A 2QO3A 1YQHA 1JXVA 5EX3A 1LW2B 1HMVA 3MMJA 4Y34A 3VR1A 2OPSB 5K5MA 2AZ1A 7FDRA 4HDHA 3UCUP 3K0JA 4UT4A 3TW0A 4PCQA 2C3PA 3EWGA 2ZC3A 4ECWA 3W66A 1VQYA 2F4VF 2OTLS 3AB4B 2GS8A 4OV6A 1RHKB 2APOA 3WX4A 1S9FA 5K14B 5A6WA 4PPDA 2JL9A 2ILYA 1ITPA 1FO1A 4M5KA 3UDVA 1FNXH 2FLLA 2DHHA 4EGLA 2E7VA 3DMJB 1GAOA 2V50A 4KFBA 3IMQJ 2GO8A 3MCMA 2XGQA 4Q44A 1H38A 4JYAJ 2XTJP 4U8YA 1TL7B 3GV8B 4JI4J 1C2PA 4NYOA 4B9UA 1QTMA 4FZVA 2WW8A 4R5PA 4I56A 3BS9A 2NXJA 2CA9A 2FHJD 4MIWA 4LFBF 1RWMB 4O44A 5J2PA 3MUVP 4ZVQB 4CO5A 4JI1F 4OZ3A 1SH3A 1TP7A 2B4VA 1WKJA 3GG0A 2BYCA 1HWUA 1B0PA 3OPKA 1FRMA 3ISZA 4F67A 1SKWA 2A6OA 2RUGA 2DXDA 3EYZA 4RU2A 4G1IA 4ZLJA 2XYGB 4DPOA 2GV1A 2BXJA 4HHHA 1P1TA 1QUPA 1KEKA 3Q8SB 3MMCA 1TMJA 2DH8A 4ED4A 1SQFA 1U47A 3HXMA 4CDIA 5AJ3J 4YUDA 1XR5A 4AUKA 3UN3A 3JYTA 3C14A 4QJVA 3C16B 1MWZA 2FVSA 1RT5A 3DYAB 3T5LA 4DV5J 4ES1A 1VK3A 2FHMA 4PPZA 4CLWA 1L5UA 3EVWA 3BDEA 5IWAF 2DHAA 3DXSX 1WC3A 3HKWA 3CJ5A 1IBLJ 2F3JA 1JJ4A 3K5LA 3DLGA 5E3PA 1SH0A 5JVGQ 2G0CA 2ZKTA 2GGPB 1FKOB 3SCIE 2HHXA 5D3GB 3KDNA 3C6UA 2VDHA 2V2KA 1T9VA 3L7PA 2W9CA 5KFOA 5HBMA 1SC6A 2WB4A 2AGQA 2YQ0A 4DR4F 4Q2LA 4WKRA 1D3WA 1HMVB 5DZ6A 2LLZA 4CCHA 4YDXA 4P2XA 3OHBA 2W4DA 1RYSA 4DPTA 4TLQA 3Q22A 3T5KA 1ZBTA 1M0SA 1DTTB 3AD7C 1HD0A 2ZHBA 3G8QA 2QLXA 1B7FA 3MMAB 3H0PA 4KH1B 4YY3F 3G82A 4RL1A 3PJ9A 4O3OA 1WDDA 4DQPA 3Q0AA 2RU3A 4B9NA 2WHOA 4OYXA 2XMUA 2PT0A 1K9MT 1W25A 1JJHA 1URRA 3CJ4A 3ZTRA 2RQCA 5F3ZA 2DNZA 2WSFC 2DCLA 3QT8A 3GFHA 3CE8A 4YOEA 3QQCD 1LV5A 3CTRA 2V63A 1FKPA 2YKPA 3KLHB 5T14A 4QWCA 3IBWA 4PG7A 4ECXA 1OPZA 4O44B 2YKNB 5J2PB 1S1TA 4FNIA 3PJXA 3J81j 4DR6F 1TK8A 1UFWA 2V2VA 2B4UA 1PIEA 3HHDA 3EZOA 3RW7A 2B0GA 2M5YA 3LALA 4ZPTR 9RUBA 4FXWA 2KDOA 3OVSA 2LQ8A 2Q1LA 2UUBJ 4ED8A 5KFZA 4QIVA 3OTOJ 2PN6A 3GR0A 1GH8A 1CQMA 5C25A 3C14B 1UVLA 3NKYA 4LR9A 4LIWA 2JEJA 5DM7Q 5DGBA 1UJ5A 1HNVB 1SQEA 1T94A 1BE4A 2WVEA 1D0EA 2OHDA 1HI0P 4F4KA 3SSSA 4ETXA 2EFGA 3HSGA 1UAWA 3QZ8A 4DUYJ 3ZZUA 1C1CA 5JJBA 4NLSA 3OXGA 3CDEA 3MCNA 2BDPA 3CJKA 1S6PA 3NMRA 1AB8A 3PYEA 2GAHC 3MCSA 1UZHA 2W9CB 4I6YA 4QYZJ 5HANA 1IR0A 1NHUA 3VCDA 2XSJB 5A8WA 2E29A 4M63A 5LMNJ 4YMEA 1JLQB 3HJVA 1PAEX 1TL3A 1GNKA 3FBBA 4ZOSA 2MKHA 4DL0C 1Z2ZA 2QL9B 1XN9A 5BYQA 2HRUA 4I68A 4B9MA 1AW0A 3CD0A 5IXUA 4LF6J 1Y5NB 2LDIA 5KFSA 2J9CA 3NS6A 2IA0A 2M4MA 3G82B 5ETPA 2MQQA 3HD2A 2WOMA 3FVYA 1S0OA 3J81Y 1A6LA 5D0EA 4FP9A 3KK2A 1K47A 3BPDA 1VQ5S 1BHNA 5EN1A 3A1YG 1OY9A 4DU7A 4LQ3A 2BMBA 4DL6A 5L1IA 3HVWA 3PDNA 3GJRB 3TVZA 2D3OR 2L3MA 1XTZA 1MLAA 3JTOA 4TQRA 4RW7B 1WKLA 3M32A 5E41A 2KVQE 3FSIA 1UEVA 1FKPB 2M0GB 4DR1J 2F5GA 2AWZA 4OHWA 2I0XA 2V8VA 2GNKA 2CPDA 2HK3A 2OGUA 3W63A 2MGZA 5F3TA 3D0IE 1N34J 2QG9B 2OPQA 5T41A 5HK4A 4PABA 4Y2CA 3SMZA 4DF4A 2K1RB 2WTFA 1VK8A 3RAQA 4RLEA 4WXOA 2ZVSA 3DOKA 3TP2A 1VCTA 2HBQB 3RYLA 2FHKA 3UDCA 4QCLA 3TUPA 1IKYA 1BQNB 2CPZA 3PW5A 2LQJA 1G2EA 3DDIA 3EDQB 4EMDA 3R5GA 1UZDA 3DRPA 3LF0A 2FDNA 2JEIA 3QATA 3BKUA 4F3OA 3PTWA 2HAFA 2VOOA 2G0IA 4TKTA 2AEMA 2QLFB 4PWDA 2H5JB 3CIMA 5AXKA 1DARA 5KFKA 1DBDA 3O8WA 2ZM6F 4X4QA 1F1BB 3C15A 1JJ2R 3O5TB 2YH1A 3W62A 5GAGU 3W2VA 2X1GA 1X4EA 2GIFA 2B7BB 1T05A 1CJVB 3I32A 1M90T 5EX0A 3MFIA 3M8SA 4DR2J 1CJUA 4P9SA 3QGIA 1Q8BA 4UF4A 1TL4A 3BBFA 3D0GE 5K8PA 3HFKA 3ZZYA 1SUQB 3FEYB 2W25A 1TK0A 3A3OB 4ELVA 5KG5A 1LWEB 1NMEB 3PFEA 4C6AA 4KGMA 1RT3A 2LEAA 2IDLA 3D4JA 2OEJA 2DY1A 3AFGA 3PIPQ 3TARA 3I0SB 2AJ0A 3D6HB 1NLKL 4EBEA 5C5JA 2I9SA 1C0TA 3KUEA 3NWRA 3IM9A 4X66F 4N77A 1MW7A 1VI7A 5FLXU 3KLIB 2VQFJ 2RHSB 4O3SA 5HI7A 2MJNA 3GG1A 1T8EA 1TUVA 4W98A 4DLEA 2YWEA 2FLNA 4HVZA 2D9PA 5KFJA 2UV8A 4LUBA 3UD4P 2ZH2A 2MXYA 2DEJA 4QWBA 1UFKA 5HSPA 1TFWA 3CCES 4RW9A 4C8OA 1Q79A 1D8YA 2M8HA 4RBTA 5DG9A 1EB0A 3KXDA 4IO1A 4NASA 1WHXA 5F8HA 1UVJA 3SCLE 3H4DA 2OH2A 2MSTA 2KN4A 4GO7X 3HZEA 1S97A 3R1LA 2OPQB 3I4PA 3P96A 1JLEA 3GSIA 4IOCQ 1KFSA 2CQ2A 2DGOA 2J6TA 3B6BA 3AAWB 4J9VA 3PXGa 4QWEA 2I1RA 3CCVS 4EO6A 3BQ1A 4ILLA 2KO1A 3GLJA 4ZN3A 2AIRB 3HX9A 3KK1B 5J2NA 4USMA 4QPXA 3DHXA 1PKUA 2DB1A 2DNLA 1D8ZA 4KYZA 1NB2A 2R9LA 2CDRB 4ILRA 4RNHA 1XK8A 1YLXA 2OKQA 4LF9J 3EVMA 2NPIA 1XNQF 3GU0A 2IAJA 3KG4A 4IH6A 4ZVUB 4B3TF 2VC1A 4I7FA 3W2VB 1T9TA 3NGUA 2MB0B 4KBIA 4F25A 2NXCA 4JB8B 2WB1D 2H5IB 1DAXA 1EP4B 3SBMA 1LNQA 4JV5J 3J7YU 4IFYA 1S1XA 5KTQA 3EGZA 1PJ6A 3IBCB 2I38A 3T5JA 2VU5A 5E7OB 3CCQS 3DRSB 5KFPA 2N3LA 1TUWA 3P5BP 5KG1A 2DGQA 2LXFA 2IFXA 4ECQA 5KOXA 2CPJA 1EETA 4F2RA 3BJYA 3K89A 4KPYA 4OI0A 2E44A 3IM8A 3KOAA 3FCWA 4HEA9 3CIZA 1HNWF 4DSEA 3WDOA 3CC2S 2X3GA 2Z56B 3NCPA 1N56A 3BKTA 1U2CA 3IFEA 2HS3A
chains in the Genus database with same CATH topology
1NCLA 4UOHA 1NUEA 5CABA 3FCVA 3Q8UA 1U8WA 2DXDA 3NGTA 3EVMA 1WKKA 1XIQA 2BEFA 3Q83A 4F4AA 3FBEA 1HHQA 1F6TA 2ZUAA 4ANCA 3JS9A 3BBCA 1LWXA 3FBCA 1NSKL 2NCKL 4S0MA 3BH7B 3ZTPA 3NGUA 1B99A 1K44A 3ETMA 3FBFA 3EM1A 4FKXA 5IOLA 3NGRA 3EICA 1MN7A 4HR2A 5C7PA 2CWKA 1PAEX 2HURA 3G2XA 3PRVA 3FBBA 3ZTQA 1W7WA 2DY9A 4WBFA 1NSQA 3BBFA 1NDPA 5BXIA 3PJ9A 3DKDA 4KPCA 1ZS6A 4F36A 1B4SA 3FKBA 3EMTA 3BBBA 4CP5A 3FC9A 4UOFA 3B6BA 3VVTA 4ANEA 1NDCA 2DXEA 3EVOA 2HVDA 3GPAA 3DDIA 4UOGA 2VU5A 4DI6A 4C6AA 3Q8YA 4EK2A 1KDNA 4DUTA 3EVWA 3VVUA 1NDLA 3ELHA 3MPDA 4O0NA 3GP9A 3ZTRA 2B8PA 2B8QA 3ENAA 1NDKA 1F3FA 1BHNA 3EE3A 1BUXA 1VYAA 3ZTSA 3VGVA 1BE4A 4ENOA 3EJMA 3VGUA 1HIYA 1NLKL 1UCNA 2DYAA 1PKUA 3BH6B 3FCWA 1NPKA 3VGTA 5CAAA 3ZTOA 3Q89A 3NGSA 1LEOA 2AZ3A 1XQIA 1HLWA 1JXVA 1NB2A 1WKJA 1S57A 1S59A 1WKLA 3Q8VA 4ANDA 1NSPA 2DXFA 3R9LA 3WX8A 3VGSA 3L7UA 2AZ1A 4FKYA 1NHKL 4W98A 2BX6A 4DZ6A 1S5ZA 1EHWA 3B54A 1MN9A 3Q86A 2HVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCL A;  4UOH A;  1NUE A;  5CAB A;  3FCV A;  3Q8U A;  1U8W A;  2DXD A;  3NGT A;  3EVM A;  1WKK A;  1XIQ A;  2BEF A;  3Q83 A;  4F4A A;  3FBE A;  1HHQ A;  1F6T A;  2ZUA A;  4ANC A;  3JS9 A;  3BBC A;  1LWX A;  3FBC A;  1NSK L;  2NCK L;  4S0M A;  3BH7 B;  3ZTP A;  3NGU A;  1B99 A;  1K44 A;  3ETM A;  3FBF A;  3EM1 A;  4FKX A;  5IOL A;  3NGR A;  3EIC A;  1MN7 A;  4HR2 A;  5C7P A;  2CWK A;  1PAE X;  2HUR A;  3G2X A;  3PRV A;  3FBB A;  3ZTQ A;  1W7W A;  2DY9 A;  4WBF A;  1NSQ A;  3BBF A;  1NDP A;  5BXI A;  3PJ9 A;  3DKD A;  4KPC A;  1ZS6 A;  4F36 A;  1B4S A;  3FKB A;  3EMT A;  3BBB A;  4CP5 A;  3FC9 A;  4UOF A;  3B6B A;  3VVT A;  4ANE A;  1NDC A;  2DXE A;  3EVO A;  2HVD A;  3GPA A;  3DDI A;  4UOG A;  2VU5 A;  4DI6 A;  4C6A A;  3Q8Y A;  4EK2 A;  1KDN A;  4DUT A;  3EVW A;  3VVU A;  1NDL A;  3ELH A;  3MPD A;  4O0N A;  3GP9 A;  3ZTR A;  2B8P A;  2B8Q A;  3ENA A;  1NDK A;  1F3F A;  1BHN A;  3EE3 A;  1BUX A;  1VYA A;  3ZTS A;  3VGV A;  1BE4 A;  4ENO A;  3EJM A;  3VGU A;  1HIY A;  1NLK L;  1UCN A;  2DYA A;  1PKU A;  3BH6 B;  3FCW A;  1NPK A;  3VGT A;  5CAA A;  3ZTO A;  3Q89 A;  3NGS A;  1LEO A;  2AZ3 A;  1XQI A;  1HLW A;  1JXV A;  1NB2 A;  1WKJ A;  1S57 A;  1S59 A;  1WKL A;  3Q8V A;  4AND A;  1NSP A;  2DXF A;  3R9L A;  3WX8 A;  3VGS A;  3L7U A;  2AZ1 A;  4FKY A;  1NHK L;  4W98 A;  2BX6 A;  4DZ6 A;  1S5Z A;  1EHW A;  3B54 A;  1MN9 A;  3Q86 A;  2HVE A; 
#chains in the Genus database with same CATH topology
 3TWZ A;  2CWX A;  5E3A A;  2G2Z A;  2UXC F;  3W9I A;  4WE1 A;  3GJT B;  4OZ2 A;  1Q4R A;  4RNN A;  2QA2 A;  2VPX B;  1S1U B;  3BH7 B;  4ZK7 M;  3MPV A;  5HQL A;  2EPI A;  5B08 A;  1OQ6 A;  1BQX A;  2CIM A;  2COL A;  4IKA A;  1HBU B;  3GIJ A;  3LGH A;  4JI3 F;  2VAS A;  3AY0 A;  1FT8 A;  4LF1 A;  1F60 B;  2CYY A;  2NQP A;  5BXI A;  2MQM A;  2O1P A;  3FC9 A;  2VG5 A;  1R3N A;  1SJR A;  4A8Q A;  2FUG 9;  2YPZ A;  4DSJ A;  2FGC A;  1M5V C;  1CJK B;  1RAC B;  3THP A;  2ZJR Q;  3HHL A;  3MGJ A;  1HAR A;  5HJY A;  1UWB B;  2DTJ A;  4U9R A;  2GZO A;  4WFA Q;  2BV3 A;  2Y1J A;  3PCO B;  1S0M A;  5DS7 A;  3BGF A;  4F4Z A;  3E2E A;  2J76 E;  2G2Y A;  2R2T A;  2YX4 A;  3WIU A;  4P10 A;  4XK8 C;  4KSE B;  3RW6 A;  4WCE Q;  2R2S A;  4CRJ A;  2KU7 A;  1U7L A;  4TU9 A;  1SJ3 P;  3G87 A;  4L74 A;  4J9K A;  3DC2 A;  2E1C A;  1F9H A;  3OLA A;  3HKZ D;  3D7S B;  1N52 B;  3NG8 A;  4QIW D;  4RW8 B;  4NCA A;  3ILJ A;  4DN9 A;  3NGD A;  2YKQ A;  4A4J A;  4G65 A;  4NEY A;  5DRK A;  1RBA A;  3DDN A;  2KH9 A;  1RWP B;  4Z37 A;  3AA9 A;  2ALZ A;  1P1L A;  1CS4 A;  3Q2S C;  1FXL A;  4CH7 A;  2UUA J;  2QEX S;  3LAM A;  1OIA A;  4KR0 B;  4OZN A;  3UCG A;  2QSF A;  3LH2 S;  1W26 A;  2DNO A;  1YBU A;  3OVB A;  2RJZ A;  4M5M A;  4R8U B;  3LA0 A;  2Y8W A;  4KY3 A;  2AZ3 A;  5I3U A;  2NPF A;  4WZM A;  5BR8 F;  4NA1 A;  4OLP A;  3Q8V A;  2I8E A;  2ALY B;  5ETT A;  4DPY A;  1J5O A;  2VPY B;  1REV A;  4PG8 A;  1UA1 A;  3Q86 A;  1EHW A;  1KP6 A;  3AB2 B;  4BS2 A;  3NGT A;  4CLK A;  1HI1 A;  1NXI A;  3RAX A;  4UY8 T;  3QMQ A;  2QMX A;  1CJT B;  4U8V A;  2IM0 A;  4WE1 B;  4YN3 B;  4Y0F A;  4ES2 A;  4WBF A;  1RTI A;  1FRJ A;  1V9O A;  3DLK B;  4OIX A;  3QNW B;  4ED6 A;  3ENQ A;  5F8N A;  4ANE A;  3RUB L;  2C3U A;  4PXC A;  2DRB A;  3R7N B;  5L9X A;  3DRR A;  1HQU A;  1TTH B;  2UVW A;  3MD3 A;  2D69 A;  4ECV A;  2IMW P;  2C2M B;  3QRR A;  1HBM A;  3R7S B;  3WQP A;  2XS5 A;  1HIY A;  2HFS A;  4UZC A;  5IV3 A;  2B5J A;  1O0P A;  2FQQ B;  2LXU A;  2YVS A;  3KUG A;  1CG2 A;  2UUT A;  3H4B A;  2V8G A;  4NZ6 A;  1AFI A;  3CJ0 A;  3QID A;  1C4A A;  1F2G A;  1RAD B;  4A8S A;  3KLE B;  4K2J A;  4DU8 A;  3R2D J;  3FBC A;  4FXD A;  3PM9 A;  2B4P A;  2G2O A;  1KBR A;  1RAA B;  4DL7 A;  2DGV A;  3ET6 A;  2ZDO A;  4JV1 A;  5L8R C;  4ED2 A;  1MWQ A;  1NK9 A;  1RQ0 A;  2QT7 A;  1R0A A;  3HHL D;  4Q45 A;  4ZVF A;  1WF2 A;  2FJW A;  4CO0 A;  1GMW A;  4LF2 A;  2RUS A;  3TAQ A;  2OIH A;  2KYZ A;  3A4T A;  3BGL A;  3V6H A;  3OR1 A;  2CG4 A;  2R7W A;  4O3Q A;  4DWI A;  5B09 A;  1AYE A;  2OEK A;  1N0V C;  3KMS A;  4F8R A;  2YWH A;  1RA6 A;  2K7K A;  4W90 B;  2SXL A;  3OD2 A;  3O2I A;  3MM9 A;  3J7Z T;  4PQA A;  2ZOM A;  1HW8 A;  4OYP A;  1VBY A;  2WVD A;  3V6D B;  1FWP A;  2RDD A;  2QSW A;  1KTV A;  1Q16 B;  4UUX A;  3I0R B;  2J6U A;  2JFK A;  2CQ0 A;  5I3U B;  2GMJ A;  1U02 A;  3POT A;  4PYD A;  5HJX A;  2B43 A;  5H1S V;  3LAN A;  2JLE A;  4DFP A;  2ZEJ A;  3DN9 A;  2UXB F;  4LR7 A;  1CPZ A;  1P6T A;  2DNM A;  4F4Y A;  2HFN A;  2V34 A;  5LXY A;  3IC1 A;  3ZNJ 1;  2MHE A;  4XDD A;  2OO4 A;  1JKH A;  3EMT A;  4YB7 A;  2QA4 G;  5AXL A;  5KAK A;  3D54 A;  3TX0 A;  3LWM A;  1T9U A;  4YB1 P;  4PXD A;  5I3Q A;  2OEM A;  5AT1 B;  3AJD A;  3G9C A;  1KKH A;  5FDL B;  2B8P A;  2J0Q D;  4IYQ A;  3RU0 A;  4EFA C;  3OSN A;  1I1G A;  1HA1 A;  3DOL B;  3VAH A;  3PX0 A;  1FVQ A;  3Q2T C;  1HBM B;  1S59 A;  2EVZ A;  1FF2 A;  2MKJ A;  1WD6 A;  3MEE A;  5E33 A;  3H90 A;  3QLH A;  2KI2 A;  4Q0B B;  4U67 Q;  4OLO A;  3UDE A;  1NJW A;  1HWJ A;  4FPR A;  2LU1 A;  3HSZ A;  1T9Y A;  2YNI B;  3JS9 A;  4EZ6 A;  2ASL A;  2EK6 A;  4CLY A;  4DV4 J;  1RKI A;  1KLM A;  3AH6 A;  1VQP S;  1FXD A;  5CZX A;  1NSQ A;  2HKE A;  4EYH B;  1KFD A;  3DKD A;  2MEW A;  2QLB B;  3ET6 B;  2EFQ A;  4BLG A;  4K8R A;  2JVR A;  5I3P A;  2K06 A;  2AGP A;  2G4B A;  4Y65 A;  3A13 A;  1RT6 B;  4I2P A;  1IBK F;  1JLB A;  2E7W A;  1IKX A;  3NXZ A;  5IT4 A;  4AQY F;  2V4J A;  1SKU B;  2F63 A;  3MM8 A;  1B7Y B;  4QPT A;  2GCF A;  2CZ9 A;  4KT0 C;  2RU9 A;  1RCX B;  1Z2L A;  3PV8 A;  1R8B A;  3O3L A;  4ZVS B;  1TEL A;  3MR6 A;  4K50 A;  4ELT A;  2VIH A;  4K5R A;  4LSN A;  2ROE A;  1Z4U A;  4BDP A;  1AUS L;  4C2M A;  2OTJ S;  3KK3 A;  5D4O A;  1YJR A;  2GQ2 A;  3MI7 X;  3T9Z A;  2AT1 B;  2V9K A;  2QYC A;  3FGV A;  4PRF A;  1GMW D;  3PO4 A;  3RRK A;  2V9W A;  2XQC A;  4K4X A;  4YFU A;  3IRX A;  3NNH A;  1NU4 A;  1FFG B;  3K2Y A;  2BJ3 A;  2LA6 A;  5E5N A;  3BM7 A;  2C3M A;  2BE2 B;  1FDN A;  3CMA S;  3P45 B;  1XMB A;  3VGV A;  5D8H B;  1WSR A;  2EEY A;  2JNJ A;  4ZPA A;  4DJB A;  1HKA A;  4NCG A;  2J8A A;  2DGU A;  1FDA A;  3IG1 A;  1S12 A;  4DL4 A;  5J1E A;  1U1O A;  1B0T A;  1V3S A;  2DGT A;  3PJW A;  2LMI A;  3JQK A;  3QAE A;  5CCM A;  4ER8 A;  3NLC A;  4J9R A;  2J5A A;  4YP3 A;  1VQL S;  4Q8E A;  2CNL B;  2QIF A;  4M5G A;  3KJN B;  2HBZ B;  3G6Y A;  3IS9 B;  1RAI B;  3DCA A;  4URQ U;  3CW2 C;  1BWV A;  2MKS A;  4IQX A;  4ZIW A;  2VG7 A;  2R42 A;  3LW5 C;  1X5O A;  2YKM B;  1RLC L;  2ROG A;  3EGW B;  2W2Q P;  4QQB A;  1YZ7 A;  2FZC B;  3OL6 A;  3GR1 A;  1RZM A;  2DNG A;  4JYA F;  1NDL A;  3M1V B;  4ECU A;  1X4C A;  4ZVP B;  4I2P B;  2OAU A;  3ZTO A;  3MMB A;  4RU9 A;  4OI2 A;  1IJE B;  1DJ0 A;  2V4J B;  3PEH A;  2MHN A;  2HIQ A;  2DKO B;  5KFT A;  2W7A A;  1QM9 A;  3BN4 A;  2R8H A;  1ZZN A;  4L3N A;  4ZPB A;  3PYF A;  4OHV A;  2YH0 A;  1XIQ A;  1HHT P;  1IBM F;  2F9J A;  4WF9 Q;  3R5C A;  3C6T A;  2DIU A;  2IYI A;  3DLE A;  4EUV A;  3BYP A;  3LWL A;  4LSN B;  2Z2Y B;  1UVK A;  1RTJ A;  4WXW A;  2V8P A;  3DI6 A;  1XBW A;  1TZ0 A;  1NKE A;  3MUR P;  5ETS A;  3U1M A;  3CJT A;  1B70 B;  1UVM A;  1WNE A;  5AJ3 F;  3OT9 A;  2HWT A;  4F7V A;  4RUC A;  1UPP A;  1OJ4 A;  1UTA A;  1NDC A;  1TKD A;  2ZE2 A;  2Q6C A;  2UP1 A;  5DQH A;  2C1E B;  3M9N B;  3GP9 A;  4DV5 F;  2W2M P;  2VJU A;  4I67 A;  1JLA B;  2IJN A;  4F04 B;  3VGU A;  4CLU A;  2DYA A;  1RAJ A;  4QIG A;  2PGC A;  3QWU A;  4C8K A;  1U0S A;  5D4L A;  3QWP A;  4OYB A;  2P2C B;  2NLW A;  1FNO A;  1AT1 B;  3IG1 B;  3X1L B;  3QJP A;  2PA8 D;  5HMW A;  3FSX A;  1ZM2 A;  1LXJ A;  3V6K A;  2Z2M A;  1VQN S;  1RT2 B;  3J80 Y;  3TZX A;  3HCX A;  5BYR A;  5KOW A;  1L3S A;  4N76 A;  1UJ6 A;  1RWK B;  2R7T A;  2CJB A;  3AD9 C;  3N5B A;  3RR7 A;  1NB7 A;  2QYG A;  3SDE A;  4ZA1 A;  4HL9 A;  4CT8 A;  3DLJ A;  2HMI B;  1SJ1 A;  3IWL A;  5C2G A;  3CJS A;  3M2V A;  2U2F A;  3DGP A;  1S76 D;  3ELH A;  2XLK A;  1QDU B;  2BKO A;  2GMH A;  4OHY A;  2XCA A;  2UUW A;  2VFR A;  4FBT A;  4RR5 A;  2IRU A;  3SZ2 A;  2F9D A;  2EW9 A;  1WG1 A;  2H3E B;  2Z57 B;  4WZQ A;  5HMY A;  2DNH A;  5CA5 A;  2Y1L B;  2CQB A;  4RW6 B;  1IR1 A;  1X4D A;  3VWS A;  1R6V A;  3MM6 A;  1NJZ A;  2CAJ A;  1K1Q A;  4ZP6 A;  3N9U C;  2CVI A;  4KGK A;  1VIX A;  1Y10 A;  1Y3K A;  1PYS B;  4M5L A;  5RUB A;  3M8Y A;  3IR5 B;  4YDD B;  2K3K A;  5IM0 A;  1X4B A;  4WIQ A;  2VON A;  1MNE A;  2MJU A;  5DDP C;  2AJQ A;  3M8P B;  4GVB A;  3AOB A;  3C6T B;  3G2X A;  3PRV A;  4GO5 X;  1FTR A;  3M7V A;  4OI6 A;  1BWE A;  2UUB F;  4KV8 A;  1VLY A;  4NLV A;  2DJW A;  1FNM A;  4V19 J;  4P2M A;  3W61 A;  2ASJ A;  4JI8 F;  1HNW J;  4F4W A;  4FN5 A;  4ZVO B;  5D4N A;  4TVA B;  1QE1 B;  1PIL A;  1U8S A;  2JC1 A;  5IT9 U;  2DNP A;  1X9M A;  3DHW C;  5G4D A;  2V8D A;  5KG3 A;  1KR4 A;  2B9W A;  1GXT A;  1FD2 A;  4AND A;  3R9L A;  1WTB A;  4FVM A;  3ZC4 A;  5LSR A;  2FJD B;  3BO2 A;  5HAT A;  3D67 A;  1EKR A;  1YWX A;  3S1T A;  1NUE A;  4I64 A;  1HHS A;  2D7S A;  1EZZ B;  1HWL A;  2HK2 A;  5AXN A;  2YKO A;  1AFJ A;  1U6B A;  1RAE B;  1QY7 A;  2N82 B;  1T3N A;  2HSE B;  2XY7 A;  2OML A;  4OYW A;  4G1P A;  2J6S A;  3D6M B;  2XZD B;  1MU2 B;  3I4H X;  1N5Y A;  4KKO B;  5A76 A;  4JV2 A;  4J9S A;  2E7X A;  1FFW B;  3QSY B;  5KFQ A;  5LMN F;  4FYY B;  2R8I A;  3UDL A;  2YQ1 A;  4C7Q A;  1H7W A;  1JB0 C;  3SDE B;  1CLF A;  4JUZ A;  1PGZ A;  2CAD A;  3SSQ A;  3GPA A;  1RA7 A;  2KB2 A;  2HQD A;  1TU0 B;  2BQ3 A;  4LF6 F;  4ECY A;  1ZYQ A;  1P27 B;  3F44 A;  2KG0 A;  2U1A A;  4PG5 A;  3M2V B;  2YNG B;  4A8F A;  2RT3 A;  3I31 A;  2YKA A;  3SSR A;  5GMD A;  1N5T A;  2NYH A;  5B0A A;  5C42 A;  2Q66 A;  4CLP A;  3SEO A;  1RT1 B;  5LXR A;  2HFZ A;  2QFJ A;  4PQU B;  3T3F A;  2MZT A;  4G6V B;  2VFT A;  4DEZ A;  2FVR A;  1C0U A;  1S9G A;  1U1K A;  4C3L A;  1JLC B;  5D78 A;  1PSD A;  4KE5 A;  2NSB A;  2IBK A;  4ZMM A;  2FJV A;  4EBC A;  5B7W A;  1GX6 A;  1NSA A;  2OI2 A;  5CAB A;  4DR1 F;  3WC0 A;  2QLW A;  1U1L A;  1H72 C;  2NRE A;  2HHS A;  1K73 T;  2MLX A;  2J0X A;  5K8N A;  1DY3 A;  3D1O A;  1N34 F;  1C1B A;  1HPZ A;  1RHQ B;  4UY8 5;  5CYM A;  2IDE A;  1Y5L B;  4PUO B;  3H2U B;  5IM0 B;  4DG1 B;  2OMO A;  3KLG A;  4J9O A;  4B17 A;  3W7B A;  3PZP A;  2MYF A;  5ADZ A;  5EWE A;  3CC7 S;  1N36 J;  3EVO A;  2ZBP A;  3OTD A;  4KV8 B;  4K4T A;  3LGN A;  4O4G A;  4TY8 B;  3V6J A;  3JTN A;  4JI7 J;  3RB4 A;  2A3J A;  4ZDN A;  3M8Q A;  2BM0 A;  1R31 A;  3RBD A;  3M2R B;  3TEH B;  2LEC A;  1VMB A;  4NLT A;  1X7V A;  5J2Q B;  2D3Z A;  1VOM A;  3CED A;  1ULR A;  4F02 A;  4ZIV A;  2FLO A;  5IZH A;  4UOH A;  2O01 C;  4RX6 A;  3BSN A;  2A10 A;  2KT2 A;  3AXM A;  1RAO A;  2DD8 S;  4RUB A;  5E3R A;  3MFH A;  5D0R A;  3FFI A;  2HGN A;  1KWM A;  3GIL A;  1R7I A;  3GFX A;  5ETV A;  3UFC X;  2JEG A;  2FIU A;  2AD9 A;  3VHQ A;  2AKW B;  2R7O A;  1R27 B;  1FE4 A;  4NOH A;  1HQE A;  1PJ7 A;  1CSJ A;  4IFV A;  1VFJ A;  3AJ1 A;  3GWC A;  4U96 A;  1Y4Z B;  1NEE A;  3QJJ A;  3TRG A;  2P6T A;  2Y3Y A;  2PI5 A;  2HHH J;  4Q2M A;  3ENW A;  2EG2 A;  1HFE L;  3MM5 B;  2DNQ A;  4IH5 A;  1IXK A;  3QFH A;  3FZ2 A;  3GCW P;  3BH6 B;  1BMQ B;  3SFU A;  3AHP A;  4USW A;  4OFZ A;  5H9F K;  2WON B;  3R6G B;  2IVM A;  1V5V A;  3CVK A;  1S57 A;  2X51 A;  2GVD B;  3A3N B;  2D3U A;  1KOH A;  1PBA A;  1TKT A;  4CTA A;  3Q23 A;  1X9S A;  3J7Z 5;  4HHJ A;  1XER A;  3H20 A;  1NKC A;  4OJG A;  2ZH4 A;  5L38 A;  1J5E J;  4N5S A;  4ICL A;  2DRD A;  1ZM3 A;  2C3O A;  3NAH A;  1EIY B;  4QIE A;  1K8A T;  5KFF A;  1TAQ A;  4OJ1 A;  2MPU A;  2KJW A;  1C1B B;  1VC5 A;  1HPZ B;  4EEY A;  5CYM B;  4YR0 A;  3W9J A;  3MEG A;  3F41 A;  3DLL Q;  3D1Q A;  5T7L A;  4K4Y A;  5A8K A;  3MR3 A;  3KHL A;  1NDK A;  2HFU A;  1BUX A;  1PC5 A;  3I82 A;  2NUU G;  1S9E A;  1KNZ A;  3HVT B;  3PW7 A;  1S0V A;  1ZAW A;  5KT3 A;  2BA9 A;  3QJL A;  4C11 A;  2UU9 J;  3BGR B;  2VQE F;  5CCL A;  2BOP A;  1YBT A;  2YWF A;  2VA2 A;  3M8Q B;  4LRF A;  4A48 A;  3W1Y C;  3TAM A;  4ID8 A;  5J1N A;  2AGO A;  2HQC A;  4XDC A;  1WEL A;  2RQ4 A;  1H6K X;  2KFN A;  1N33 J;  4LF9 F;  4DPX A;  2XHW A;  1QLN A;  2ZH7 A;  2QLJ B;  4DUZ J;  1BY9 A;  2JDJ A;  2DIS A;  3TX8 A;  3TA0 A;  1BXN A;  1UVI A;  3OXL A;  3KG0 A;  3OTE A;  3GMG A;  3CF5 Q;  3KJV A;  1HQE B;  4JV5 F;  3QGP A;  4WFY A;  2GX8 A;  2QJ3 A;  2EXU A;  4KAI A;  4IFV B;  4NLY A;  1NND A;  4DS4 A;  1FFS B;  2F8E X;  4MKY A;  1A7G E;  3HM9 A;  1SIZ A;  4DV3 J;  4DSF A;  1HR0 J;  3N0V A;  1S0N A;  3UN5 A;  2HW3 A;  4C4W A;  5LSO A;  2PE8 A;  2MQL A;  3K59 A;  3J7A 1;  3KDO A;  4X65 J;  3CJQ A;  1Z1Z A;  4JV0 A;  4ZCL A;  3H59 A;  2XS2 A;  4B3O B;  3NL0 A;  3TYT A;  2L9D A;  2WW4 A;  1LKZ A;  4B9S A;  1R43 A;  1BD6 A;  1RCO B;  4F4A A;  1TKT B;  4CTA B;  4B3S F;  2ZUA A;  2ASD A;  3EGN A;  1NPP A;  1N6Q B;  2V68 A;  3HLU A;  3M2U B;  4OQJ A;  1YJ7 A;  5IOL A;  1VHF A;  4KQZ A;  1IBK J;  4E8U A;  1UJ4 A;  2H51 B;  3P4U B;  1FK9 B;  1H74 A;  1RJJ A;  4DS5 A;  2RKI B;  2HLT A;  1VQS A;  2IM3 A;  1G3O A;  4PEO A;  5SUH A;  2GIR A;  3BR9 A;  1CC8 A;  1QVG R;  1DLO B;  4L75 A;  1UW4 A;  1WF0 A;  1FD8 A;  5KFI A;  2HQI A;  4DF8 A;  1TFY A;  4KHP F;  1RIS A;  3SQO P;  4OI1 A;  4OI3 A;  4Y3C A;  3KLF A;  1VC0 A;  1VQM S;  3LUY A;  2WVB A;  1S9E B;  1JXL A;  3V5R A;  1E6Y B;  4OZ0 A;  5DG8 A;  1M5O C;  3MM7 B;  3C16 A;  1RHM B;  4C11 B;  3HHL C;  5F8I A;  4AD6 A;  3CCZ A;  4X4U A;  1GK8 A;  4XPE A;  4JI2 F;  4OI4 A;  3DYA A;  1IWG A;  3H40 A;  3MCO A;  3Q83 A;  4QYR A;  2KT3 A;  2ASY A;  4CO4 A;  3V81 B;  1KVI A;  2BZ2 A;  1AA1 B;  2XWX A;  2BVZ A;  3MTJ A;  2CPH A;  2M8D B;  2GGP A;  3DNC A;  1RHR B;  2XMM A;  1HYS B;  4JP8 A;  4C8Z A;  3CCL S;  1A9N B;  2V4R A;  2A1B A;  2KM8 C;  1SQG A;  4G1Q B;  2UZA A;  5A2Q Y;  2UVU A;  4J9M A;  4ECZ A;  3ENV A;  4B02 A;  5GAH U;  3VZH A;  2UUA F;  1F3F A;  3C19 A;  2RRA A;  1Y5I B;  1B0V A;  2PSZ A;  1RSC A;  1RWV B;  2BM1 A;  1PCA A;  3KWM A;  3ILL A;  2XUL A;  1DTT A;  4LRD A;  2BJ9 A;  2QFI A;  5L1K A;  2V5H G;  1VQO S;  4V19 X;  3I96 A;  3MMA A;  4NLQ A;  2CDQ A;  2XI2 A;  3L3C A;  3M30 B;  2N7Y A;  1VBX A;  1CUL B;  1LWC B;  3CXC R;  2ZH5 A;  1HHQ A;  3CUN A;  4E2F B;  1X31 C;  4PZV A;  3MAQ A;  5DZ7 A;  3RBX A;  2WBM A;  3U27 A;  1S6Q B;  2Z58 B;  2AQ4 A;  2KFY A;  4DV0 J;  1K0T A;  1JXE A;  3L7O A;  2K7J A;  4K5S A;  1YK9 A;  4ZN1 A;  5CXT A;  2YXL A;  4LSL B;  2PA3 A;  3KLH A;  3OFH A;  3TUJ C;  3M8Z A;  4J9L A;  3HMJ G;  2YKN A;  5DDO C;  3F0N A;  2ZOG A;  3TQ1 A;  3QT6 A;  4IDK B;  2B8Q A;  3BGO P;  3ZTS A;  1IBM J;  1KN6 A;  1URN A;  3IRW P;  2WK4 A;  2AJ4 A;  1WC5 A;  4DX5 A;  5A8R A;  3R5J B;  3MAH A;  3JQJ A;  4A8K A;  1K1S A;  3KLF B;  1ZPV A;  1QSL A;  2CQ4 A;  3DLH A;  3W5Z A;  3OJS A;  2VG6 A;  5F8L A;  1IWA A;  3TJ8 A;  3KJQ B;  3P3D A;  2VFU A;  2MKK A;  2A6M A;  2IVY A;  1PO6 A;  1HNV A;  4FF3 A;  3E01 B;  1VJQ A;  5M2R A;  2PEH A;  4GRS A;  4NYZ A;  1M5S A;  4KTQ A;  2HFV A;  4ZIT A;  1F5C A;  3CCR S;  4AL5 A;  3THT A;  1UET A;  2Y9H A;  3RBZ A;  4RBV A;  2YPY A;  1SVD A;  2XEX A;  3O44 A;  4RO0 A;  1RUS A;  2ADB A;  3UE2 A;  4ED7 A;  4K2X A;  1VYA A;  2XSJ A;  1WOP A;  3CD6 S;  3H2L A;  3CME S;  1JX4 A;  1JLQ A;  2VH7 A;  3ZZO A;  5H9F J;  4Y2I A;  1T9W A;  4Q5V A;  3N6N A;  4K7Q A;  1GTH A;  4CNY A;  3E51 A;  5DO2 A;  4DV6 F;  3HJF A;  1R0B G;  3UQS A;  4M5N A;  1KON A;  2CJ9 A;  5E2Q A;  1WDT A;  4QWD A;  3HVA A;  3U02 A;  5CH7 B;  3EPI A;  4JOU A;  4ECS A;  2L48 A;  4FF1 A;  1KTQ A;  4K4Z A;  5HVF A;  4RW7 A;  3VVT A;  4DFM A;  3MPW A;  2LU2 A;  3Q8Y A;  3N5F A;  5LL6 d;  2HHW A;  1U0H A;  3RJM B;  1RAH B;  1YHQ S;  4FF4 A;  1IM4 A;  1NPR A;  1RHJ B;  1OWX A;  2K1R A;  5DQI A;  4CLL A;  3B78 A;  4NA2 A;  4ID5 B;  3P8B B;  3GE9 A;  1ZPW X;  2HVH A;  2GC8 A;  3MUM P;  4QW9 A;  4WU3 A;  1U26 A;  5DLF A;  5A8R B;  3IGV A;  1BQN A;  2HHT A;  1JK9 B;  2MMY A;  4JI8 J;  2R7Q A;  2CPY A;  3UNY A;  3V2U C;  4K4U A;  1MRO B;  1K44 A;  2ROP A;  1SH2 A;  2JEF A;  1U1N A;  1YRU A;  2HND B;  2LQ9 A;  2VG6 B;  1XC9 A;  5H9E K;  4DV4 F;  1H7X A;  4PWU A;  1JWW A;  3OQ2 A;  4HHU A;  1ZS6 A;  3FKB A;  1P8G A;  2BAC A;  1WC4 A;  4HT7 A;  4C98 A;  1G1X A;  2RH3 A;  4XPC A;  3D0H E;  2ZHA A;  3W5Y A;  2F8H A;  5HVH A;  5HL7 Q;  3KNA A;  2RS2 A;  3GON A;  1CJV A;  2KRR A;  4ZLL A;  4IG0 A;  4F2S A;  5KFX A;  4LF4 J;  4X4R A;  1VRU A;  2B9X A;  4WPA A;  4A8Y A;  4OYA A;  2QL5 B;  4LBP A;  3W5X A;  3CO9 A;  3PR5 B;  4I69 A;  1FWL A;  3KNG A;  2KT5 A;  1SUQ A;  2POK A;  2O66 A;  5THW A;  4UOC A;  3RAM A;  3H5Y A;  1B64 A;  3V4M A;  4N56 A;  3D3C J;  1FKA F;  2QMW A;  4USV A;  1LWE A;  1LK5 A;  3GII A;  5KG0 A;  5F9L A;  1IUJ A;  2DR8 A;  2VUG A;  2ZZT A;  3HFV A;  1X9W A;  6FD1 A;  2FB0 A;  5F9N A;  4ZPC A;  2HUR A;  3I5C A;  3I0S A;  3R2C J;  2O5D A;  3K5O A;  5B0C A;  2B6A B;  2L9N A;  3K5P A;  3C46 A;  4LBI A;  2GJI A;  1JQG A;  2VOD A;  3GTY X;  3TZZ A;  2K8G A;  5DDR C;  3PX6 A;  3K7R A;  4CP5 A;  3KLI A;  2XO7 A;  1T02 A;  1LW0 B;  1YJW S;  1I51 B;  2CNN B;  1U1R A;  3LPE A;  4HAC B;  2ADC A;  1S10 A;  4B3M F;  3GCX P;  2ZZN A;  3T9N A;  2YNH A;  2J7K A;  1YBA A;  3DDK A;  4MK8 A;  3A3P B;  1MMN A;  3HD1 A;  1IJF B;  2MKC A;  1TKX B;  2ZVI A;  1S7H A;  1Q82 T;  2BOA A;  2RF2 B;  3EJM A;  1FRK A;  2YX7 A;  4EO8 A;  1U0H B;  1NPK A;  3CJ2 A;  2W2N P;  3GIM A;  1EKS A;  2PEB A;  3KHH A;  3WIV A;  4K59 A;  3JTP A;  1T11 A;  4NEZ A;  4HT5 A;  3JAM Y;  2EBG A;  4FS2 A;  2F4F A;  3R6L B;  2V0N A;  4KJI A;  4F3Q A;  5CYQ B;  1TR0 A;  4KGX B;  2FVP A;  3QPI A;  4FYW B;  3LPY A;  1M1K T;  2OSR A;  2IBO A;  5KFH A;  2ZFH A;  1F2H A;  2ZDP A;  4L72 B;  3VAF A;  3PR4 A;  4PWW A;  1SBR A;  2IMO A;  1WEY A;  2RML A;  3KK1 A;  3K58 A;  2MLY A;  1QAY A;  1UFL A;  1RE1 B;  4K4S A;  2KRB A;  1ZET A;  4ZPV R;  2DRA A;  5K8M A;  4TY9 A;  1V3R A;  1NRK A;  1KVJ A;  4H4K A;  2R2R A;  5G0R A;  4TN2 A;  1FDD A;  1Q5V A;  1IKW B;  1DFD A;  5K9F A;  5EHH A;  1PYT A;  3CDB A;  3U1L A;  4NXN F;  4ZKA A;  2MZQ A;  2VB6 A;  4K0K J;  4B08 A;  1I6J A;  4NLP A;  3FDS A;  4ZVG A;  3K5M A;  2ZD1 B;  2AEJ A;  4RPF A;  2YWW A;  4IG0 B;  4CM2 A;  1VRU B;  1EP4 A;  1YJT A;  2AW0 A;  4LMZ A;  4N8O A;  2IHR 1;  5JUM A;  1QAJ A;  3KG1 A;  3DRS A;  1VRQ C;  1TKZ A;  1DTQ A;  2ATC B;  3P5T L;  1U48 A;  1VS3 A;  5HMX A;  1VBK A;  3PFO A;  2ZWO A;  2O3D A;  2NXU A;  1XMO J;  2DO4 A;  3GYX B;  3G6V A;  4XAK A;  3NY0 A;  2GJF A;  3BYR A;  2R8K A;  5GVQ A;  5ETN A;  1OMS A;  2BJ8 A;  5K8O A;  3CNQ P;  2RAQ A;  3NP5 A;  4WYL A;  4K4W A;  2J0W A;  1RXO B;  3KHR A;  2V69 A;  2DGW A;  2R7S A;  1F5B A;  4USJ C;  4HLB A;  5ETL A;  4U7U D;  1E6V B;  3EE3 A;  3OSP A;  2YNH B;  4BWM A;  2KYX A;  1VC6 A;  2AYG A;  2PII A;  3S8S A;  1S1U A;  1JLF A;  4Y6I A;  1FES A;  2EFP A;  3A8J A;  3ZZR A;  4OYZ A;  3CCJ S;  1NJI T;  3BDP A;  2AV5 A;  1HBU A;  3C2P A;  2J7W A;  3VQS A;  1WHV A;  3U7J A;  1YI2 S;  1HBO B;  3RTV A;  5MLC V;  3TA2 A;  2Z0G A;  3SXL A;  2OPR B;  1CJK A;  1NH8 A;  2FJE B;  4LF5 F;  4BC9 A;  3BPS P;  2Q6B A;  1UWB A;  2KXH A;  3PW4 A;  2JWN A;  5KT6 A;  2VQE J;  2BW7 A;  4NLX A;  3A8I A;  4ZJL A;  3SYZ A;  1VR6 A;  4D3G A;  4YB5 A;  1GTE A;  2EFV A;  3V4I B;  5GMK a;  1T03 B;  3NS5 A;  4AXI A;  3BO4 A;  5GAE I;  2PMW A;  1IR2 A;  1D9F A;  2RD5 C;  2LFV A;  5G0R B;  3IR6 B;  1UP1 A;  3CD5 A;  3MED B;  1QTN B;  3T1A A;  2N4C A;  2HLU A;  4RW8 A;  3W2W A;  4WFB Q;  4NXM F;  7AT1 B;  4JI6 F;  1XMQ F;  4LVN P;  2MZJ A;  3SQG A;  4E0D A;  2FTR A;  2V6A A;  3OV7 A;  4H4M B;  2BAN B;  2HYI B;  4QYZ K;  2FHJ A;  2JC0 A;  3MR5 A;  2ZJP Q;  2NR0 A;  4J90 A;  1V3Z A;  4DPW A;  1TKZ B;  1HW9 A;  3OL8 A;  3DOM B;  1DTQ B;  1YRX A;  4R8U A;  2XM3 A;  2XZW A;  1SCJ B;  4C3K A;  2XC9 A;  1X4F A;  5GAD U;  4TU7 A;  2LEB A;  2FC9 A;  4RWW A;  3PHE A;  1X5P A;  1N5V A;  4NYP A;  3CDW A;  5DLG A;  2QE5 A;  4JI5 J;  4M94 A;  1TL5 A;  1FXR A;  2YQ3 A;  4FNH A;  2QMU B;  4B3S J;  3HI9 A;  2JHE A;  4ED5 A;  2HG4 A;  4FYX B;  1CJT A;  4O3P A;  1YVF A;  1HQ2 A;  2X7I A;  4IR9 A;  3N6M A;  1JLF B;  3QZ7 A;  1N54 B;  1H3D A;  2BJ1 A;  3T6B A;  2Q43 A;  1NHK L;  3UCZ P;  3DLK A;  3PYG A;  1T0T V;  4MYU A;  5DJB A;  3AQP A;  2HRY A;  3QGG A;  4LF7 J;  4B9V A;  3JXO A;  2NUH A;  3NCQ A;  2R4F A;  4RKU C;  3S6E A;  1EAR A;  4DR7 J;  3WBZ A;  1P9Y A;  1R8A A;  2DNN A;  3OUY B;  5AE3 A;  5CHC B;  4KHP J;  5KFR A;  2BRK A;  3JSB A;  4F36 A;  3RZA A;  4CM0 A;  4OZ1 A;  3I87 A;  4PYA A;  4DX6 A;  5H9E J;  2BE9 B;  4DI6 A;  5B0D A;  1WAC A;  1H2V Z;  2JLF A;  5F8M A;  4QW8 A;  4IG3 B;  3FMW A;  1WOO A;  4I4B A;  3I5B A;  2PDA A;  2XYP B;  5L39 A;  2OD4 A;  4JI2 J;  5FD1 A;  3KLE A;  3N01 A;  3KYL A;  5IT0 A;  1AUD A;  2X1A A;  2VIC A;  2XGP A;  3NBP B;  5KG6 A;  3PVX A;  5CAA A;  3HT0 A;  3QRQ A;  2E5L J;  1OO0 B;  3IAM 9;  2Q3P A;  1Y7P A;  2XNQ A;  1X8D A;  5C24 A;  4FVC A;  3R27 A;  3W2W B;  2DH7 A;  2DCU B;  5I42 A;  5KFA A;  1U8W A;  3D5M A;  1NHV A;  2CPX A;  4PAA A;  3SQG B;  2A2C A;  4L73 A;  4IRC A;  4DV2 J;  4NLG A;  4A46 A;  5B0E A;  3SCJ E;  1EQM A;  3W65 A;  3AOD A;  4HR2 A;  3NEK A;  2W9B B;  3N28 A;  3ZTQ A;  3OLB A;  1W7W A;  1L3U A;  3H8Y A;  1U1P A;  3T1H J;  1H73 A;  3LP0 A;  2MZ1 A;  1FRL A;  1NJX A;  2DT9 A;  3US5 A;  2IC3 B;  2AJF E;  3V6D A;  1TL1 A;  4NMX A;  3MXH P;  3I0R A;  4ES3 A;  1S77 D;  3NWG A;  1N36 F;  3OFE A;  1SJQ A;  2EKY A;  2LP4 A;  1VGY A;  2CJX B;  3ZZT A;  4YHH J;  2PFD A;  4Y00 A;  3OTC A;  4LF8 F;  2DNK A;  4DLG A;  3ISN D;  2M7S A;  3H5X A;  4JI7 F;  4DV7 J;  4M8L A;  4BC7 A;  4BBY A;  3VQT A;  2RNE A;  4DDF A;  1S99 A;  5A2Q U;  4FKY A;  1FX2 A;  4WKY A;  3KHG A;  3WC2 A;  4ZLN A;  4QOT A;  2EKN A;  4UZB A;  2YNF B;  2ZBQ A;  2K3I A;  4CQ1 A;  1HNI B;  2CZV C;  5FDL A;  4J9Q A;  4I2Q B;  2E5H A;  3TUI C;  3MEK A;  4HH1 A;  1REG X;  4X64 F;  3MWB A;  3OL7 A;  1RWO B;  1S72 S;  1IQZ A;  4QIF A;  1NDP A;  3DOL A;  4RW4 B;  2ZKU A;  2F7V A;  1R8H A;  4L6V 3;  4CH1 A;  5LMU F;  2W7O A;  2R7X A;  3T1Y J;  2QRR A;  2CG8 A;  1D9A A;  3IP0 A;  4GC7 A;  1V5I B;  4DUT A;  4GKK J;  4KB7 A;  3UO0 A;  3ZZZ A;  2N7C A;  4Q0B A;  2XY6 A;  3OW2 R;  4NI2 A;  4F3M A;  2DO0 A;  3BQ0 A;  2CQP A;  2HHH F;  4RNM A;  2YNI A;  1Q8L A;  4I6W A;  5F41 A;  4C8M A;  3LOU A;  2UUC J;  3G8S A;  4ZHR B;  2ACM A;  1SJ4 P;  4H54 A;  2QL7 B;  2VV5 A;  1S1V A;  3H5U A;  4N7T A;  5J2M B;  1SV5 B;  4F0H A;  5B0B A;  3AT1 B;  1NM2 A;  4C8N A;  2IYG A;  4M5H A;  5ETK A;  3EXC X;  4MFB B;  5HVG A;  5HO4 A;  1Q86 T;  1VIS A;  4NML A;  1LWF A;  2V4Q A;  1NZA A;  4O23 A;  1QSY A;  5C24 B;  3EUN A;  3EXY A;  2XI3 A;  3QO9 B;  5I42 B;  4KGZ B;  4XO0 A;  2XY5 A;  5LM7 E;  4S0M A;  1RT6 A;  2B4O A;  3ZTP A;  3Q8R B;  2EK1 A;  4CI0 B;  1JLG B;  1PAU B;  2HHU A;  2GAG C;  1J5E F;  4WP3 A;  3AD8 C;  4P2S A;  3ZZ0 A;  2VL1 A;  2XNR A;  4N41 A;  4X84 A;  1RI7 A;  4C0O C;  4IR1 A;  1FX4 A;  3R3T A;  4GKJ J;  5KG7 A;  2R7V A;  4ZCI A;  1NK4 A;  2Y0B B;  1GMU A;  2HQF A;  3LP0 B;  1YDL A;  1L3V A;  2KG1 A;  3RRH A;  2WCX A;  1VJW A;  4J9U E;  3UWT A;  4IOB A;  2HHP A;  2QTW A;  1TL1 B;  3FQK A;  4AT1 B;  2VDI A;  4KFB B;  3M05 A;  1MML A;  2RIL A;  5HQ8 A;  3SCK E;  2LDY A;  1N88 A;  2MSS A;  4DV6 J;  5KFN A;  2W01 A;  4OZL A;  4NPO A;  3KJF B;  2UU9 F;  1S4E A;  4MKV A;  2KHD A;  2W8K A;  4LR8 A;  1NKB A;  3L9Z A;  5A0Y A;  2RRN A;  1KQS R;  4R5P B;  2G0J A;  3ZNU A;  1CC7 A;  1SC1 B;  1WUU A;  5EWG A;  5LJ5 Y;  3ITH A;  4OX9 J;  2BE2 A;  3BO3 A;  1N33 F;  1ARO P;  1M5H A;  2IM2 A;  3M8R A;  2AEF A;  2EBE A;  2M88 A;  2H9Z A;  3BZQ A;  4DUZ F;  1XNR F;  3PW0 A;  2VPZ B;  1T3O A;  1X0F A;  2ABY A;  2H1Y A;  4M1K A;  2PO4 A;  2UV8 G;  3C66 A;  3PY8 A;  4P75 A;  1S4F A;  3MMC B;  1S7I A;  2ZHO A;  3K5N A;  4LFC J;  3QT7 A;  2J8S A;  4IRD A;  3IS9 A;  4ZJQ A;  4ENO A;  2OP5 A;  1X5S A;  3JYT B;  4DV1 J;  1FJG F;  1HNZ J;  4DV3 F;  1HR0 F;  1WOS A;  2AYM A;  3OTB A;  2W8L A;  1RT5 B;  4NI2 B;  2VBX A;  2YKM A;  5FII A;  4X65 F;  1O51 A;  2VBZ A;  4TYA A;  3L7U A;  1S1V B;  1S5Z A;  2XHC A;  3DFE A;  3AOA A;  3CO0 P;  4LVO P;  1TVR A;  3DU6 A;  3DLG B;  4ERD A;  1M5P C;  3M1V A;  2GJ2 A;  1LWF B;  2ATL A;  4DX8 H;  3C6U B;  1SL0 A;  4P7V A;  4JI0 J;  2VBW A;  4LIR A;  2KXN B;  4P74 A;  5HBM B;  4MAK A;  4O0I A;  4P72 A;  2M2B A;  5M2P A;  2X3D A;  4Y2A A;  1QSS A;  3ETO A;  3I55 S;  2VFV A;  2IM1 A;  4A8X A;  2A2D A;  2OD6 A;  1CEZ A;  3RGI A;  4OV1 A;  3B8H A;  2Z8Q A;  2G1D A;  4TU8 A;  3C8Y A;  2LQB A;  5GME A;  3N6L A;  3VAK A;  3DLB A;  2CVE A;  2NS1 B;  1OQ3 A;  1KOO A;  2PC6 A;  4QZV B;  3FMB A;  4K4V A;  1HNX F;  1WEX A;  2RIJ A;  3H42 A;  3L95 X;  4XTT A;  3OFF A;  5J1P A;  1U45 A;  5U47 A;  1RWW B;  1U25 A;  3JSM A;  3CCT A;  1F6T A;  1CBK A;  1KQF B;  4WP8 A;  4A47 A;  2CNK B;  3HT3 A;  1DUR A;  2D41 A;  5A0Y B;  5L9N A;  1U2R A;  4B3M J;  2BAB A;  3PNI A;  2FC8 A;  4WJB A;  1RKJ A;  1VQ4 S;  1JLA A;  3UW1 A;  2HHQ A;  3ITH B;  2RS8 A;  1S1T B;  4DZD A;  5DET A;  1WG5 A;  3OL9 A;  1RBO B;  2JOQ A;  2WAQ D;  4CYU A;  1AZS A;  1Q1K A;  5MAO A;  1QUV A;  4UOF A;  3UR0 A;  1FJC A;  3ILO A;  4RNF A;  2GA7 A;  2QV6 A;  1X0P A;  4WII A;  4CLS A;  4C48 A;  3MOJ B;  3J81 U;  2NSC A;  3HP6 A;  1YJN S;  3GFZ A;  1RT2 A;  5ETM A;  3I9V 9;  3NCR A;  2CQG A;  4Z7Y A;  4XIU A;  1LQ9 A;  2B7C B;  2FZK B;  3RB6 A;  1JMT A;  3TUZ C;  5JXS A;  4ZP8 A;  5C25 B;  3PAC A;  4OX8 A;  1SXL A;  3OVA A;  1KVK A;  4LFA J;  3B54 A;  2HMI A;  3HHN B;  4EZ9 A;  1KLN A;  1FEH A;  3Q8U A;  4HTJ A;  3SIP B;  2Q79 A;  5AE2 A;  4NA3 A;  4W92 B;  3I56 S;  5DGA A;  1LWX A;  4QWA A;  1UEU A;  4A8M P;  2MTL A;  1TVR B;  1RHU B;  4KRW A;  2EWH A;  3FEZ A;  1C1C B;  4OX6 A;  1R89 A;  4WP9 A;  4L76 A;  3JAM U;  1QVF R;  4URS A;  3BSA A;  1NJY A;  4DV0 F;  4NXN J;  3CJK B;  3GQC A;  1S6P B;  2KZZ A;  4J91 A;  2C2O B;  2P9G A;  4RW6 A;  1U6Z A;  1O5J A;  3HF5 A;  1UEK A;  1GEH A;  4PG4 A;  3CB4 A;  5A8W B;  1FWK A;  4HI2 A;  3QT5 A;  4QU7 A;  1TL3 B;  3BB5 A;  1LOU A;  4OX7 A;  1W2I A;  1XR7 A;  2OFH X;  2ZBI A;  3M8P A;  4OMF G;  4AL6 A;  4EWT A;  4ELU A;  1Q7L B;  3VGS A;  1WC1 A;  4DR3 J;  4KHR A;  2WOM B;  3R5D A;  3KK2 B;  2J0S D;  4ILM A;  4LQ9 A;  1X5T A;  1RAG B;  1Y00 A;  1G6B A;  2XMW A;  2QGF B;  2B56 A;  1VQK S;  4NX9 A;  4GC6 A;  1YJU A;  3MOZ A;  2MKY A;  4M5D A;  1QE1 A;  4OHX A;  3ULH A;  4I6A A;  3JSM B;  2HNY A;  4YQW A;  4USU A;  3B4D A;  4X4S A;  5IS2 A;  5L1J A;  3M32 B;  4X62 J;  5HMZ A;  1Q8I A;  4NRU A;  3BSC A;  1TUG B;  1HWI A;  2BJ7 A;  2MGZ B;  4MT1 A;  3P49 B;  2CXE A;  3M6X A;  4CYU B;  1AZS B;  2LA4 A;  3B4M A;  3FEX B;  1S6U A;  3VAG A;  2W24 A;  3CSK A;  3IO1 A;  3DOK B;  3NGS A;  1IKY B;  3R5B A;  4Y2M A;  3NNC A;  1MU2 A;  4KKO A;  2O67 A;  4LF5 J;  2UVR A;  3M9M B;  3MEC A;  4E98 A;  3DRP B;  2KHC A;  2C42 A;  2VPW B;  5C2C A;  2DGS A;  4FDF A;  2E5G A;  2HBY B;  4DN0 A;  1TV6 A;  3GIK A;  3FBE A;  4CT9 A;  4QU6 A;  2G9O A;  4IRK A;  2R8J A;  2YNG A;  3EZ5 A;  2WZ1 A;  1ZM9 A;  3EM1 A;  4PWD B;  3ICL A;  4KHM A;  1S6O A;  1GX5 A;  1RT1 A;  3C15 B;  3TOQ A;  2FGO A;  1APS A;  4ETZ A;  3TR5 A;  4PQU A;  3NS7 B;  5D0H A;  2BQR A;  2J9E A;  1JLC A;  4NXM J;  1T05 B;  5HLF A;  1XMQ J;  4JI6 J;  3K57 A;  5IC4 B;  3MPY A;  2F40 A;  2R3V A;  5KG2 A;  1ZZF A;  1GFW B;  5IT9 Y;  3MTK A;  1NK6 A;  2MY8 A;  3F56 A;  1CJU B;  4ZPD A;  4RZR A;  4RUH A;  3IWX A;  3QAU A;  2DIV A;  1N32 J;  1QJH A;  4R25 A;  3G6E S;  4C8Y A;  4PUO A;  1RBL A;  2CJA A;  1K0V A;  1Q7Y T;  1OYE A;  4DG1 A;  5CZV A;  1RT3 B;  2DIT A;  1BC6 A;  2CFX A;  4Y2K A;  2ZH1 A;  1WKK A;  1VQ6 S;  4OHZ A;  2N3O A;  3LQV A;  3MAA A;  3KMQ A;  1VIO A;  5D15 A;  1ELO A;  3BBC A;  2DNR A;  4OZJ A;  3H98 A;  4AE5 A;  5ITH A;  2I5J A;  2YWG A;  2HWI A;  1C0T B;  4X4T A;  2X1F A;  4TY8 A;  2JX2 A;  1MN7 A;  4PG6 A;  4OYI A;  3D3B J;  4M5D B;  6FDR A;  2B3T B;  4B9L A;  3M2R A;  2HNY B;  4ZLP A;  1B4S A;  3TJ9 A;  5J2Q A;  2FPH X;  2ZNY A;  1CVJ A;  2M52 A;  4P73 A;  3CC4 S;  3QIP A;  4RW9 B;  1H2U X;  1AXQ A;  2Y0S D;  4HDG A;  4WFZ A;  4IO9 Q;  2KZM A;  3BR8 A;  4OJ3 A;  3FZB A;  1JLE B;  3FK4 A;  2F8M A;  4DBQ A;  1LEO A;  3JSY A;  5D6G A;  5ETR A;  1FRI A;  4BWJ A;  1WHW A;  4LF4 F;  2KJV A;  3TA1 A;  2C2N A;  2CPE A;  2HVE A;  2AX1 A;  1I94 J;  1UWA A;  5E3C A;  5JMN A;  2OJ3 A;  4C0H A;  5AE1 A;  4J7C A;  4LRC A;  1A0O B;  3PRD A;  3FCH A;  3THV A;  5EUH A;  5J2N B;  1SL1 A;  2RB7 A;  3MEC B;  2ZH9 A;  4R0J A;  5FJ4 A;  2DNY A;  2BBE A;  2ZUG A;  2OPP A;  1TV6 B;  2GFF A;  3UPF A;  3OR2 A;  5L46 A;  1Q0N A;  3MM5 A;  3EIC A;  5F8G A;  1YJ9 S;  4CLT A;  3R5A A;  1V6H A;  4USI A;  2HZC A;  4UQT A;  4ZP9 A;  3SV4 A;  1VRT A;  2WON A;  4QR0 A;  1U2F A;  2JLG A;  3DGV A;  1T9X A;  2EFN A;  2GVD A;  2B51 A;  4MYT A;  2IAJ B;  1LXN A;  1EJ7 L;  5K20 B;  3GIR A;  4I7F B;  1BGX T;  2PMH A;  3KUH A;  1OSD A;  3MD1 A;  4PR6 A;  5HLF B;  3N79 A;  1UPM B;  4B3R J;  4NL5 A;  1NO8 A;  4EI2 A;  2VA3 A;  4DOZ A;  3O1L A;  3W3S A;  3NRB A;  2VD3 A;  1ZAX A;  4LJM A;  4CO3 A;  2BUN A;  4IFY B;  1VHI A;  3OJU A;  2DPJ A;  1S1X B;  5ETQ A;  5LSL A;  1Y0H A;  3AXK A;  3ZZP A;  3TZY A;  3G8T A;  4FXV A;  1RLD A;  1Y3J A;  2F4V J;  2PI4 A;  3I9Z A;  3LP1 A;  3T6J A;  2CQH A;  2JH3 A;  1EET B;  1KD1 T;  2H48 B;  4DQR A;  3G4S S;  3R97 A;  3U1N A;  3MR7 A;  3PG9 A;  1KQG B;  2FYX A;  2DK2 A;  2BW2 A;  4FKX A;  3MAA B;  2AJ1 A;  4Q7A A;  4DHV A;  3A12 A;  3N4W A;  2FJB B;  2I5J B;  3HVT A;  2IY5 B;  3UVJ A;  4LF8 J;  2MLZ A;  4USK A;  2KTQ A;  3BGR A;  4Q8F A;  4ZJO A;  2P9E A;  2C2K B;  3GJQ B;  5GAE U;  3DRX A;  3UD3 P;  1RU2 A;  1FHT A;  1O8B A;  1D1U A;  4DSI A;  2WSE C;  3JQM A;  2VKZ G;  2AX0 A;  3WZ0 A;  2XLJ A;  3LGM A;  4DQI A;  2W4P A;  3TVK A;  3SFG A;  2Z4P A;  4LFB J;  2HEK A;  3QIP B;  5KT2 A;  2OEL A;  4JI1 J;  1X4G A;  4Q43 A;  2ACY A;  2CQ3 A;  3HO1 A;  3HPO A;  4H4K C;  2D74 B;  3PO5 A;  4FF2 A;  2P5V A;  1F9F A;  4K0K F;  6AT1 B;  3CCS S;  3EPG A;  1N5S A;  2VG5 B;  1NSP A;  4X64 J;  4CWB A;  2ZNZ A;  1UL3 A;  1U1M A;  3MF5 A;  2J9D E;  1RT7 A;  2HHV A;  1IQT A;  3NOC A;  2ZC4 A;  2ZBC A;  3IWN C;  4W4M A;  5DDQ C;  3HHL B;  5LMU J;  3RRG A;  3CDA A;  3NOG A;  2AHO B;  3CWJ A;  3DM2 A;  2YX1 A;  2EC2 A;  3VAL A;  3E8O A;  1KSP A;  1WOR A;  4OJH A;  3MDF A;  4ED0 A;  1H2T Z;  1OSC A;  1BQM A;  2OPP B;  1XEZ A;  5KFL A;  4I0W A;  1F9E B;  3OR2 B;  2GHW A;  4TQS A;  2EG1 A;  1XMO F;  5IWA J;  3PEJ A;  5ETO A;  1F5A A;  2XBP A;  2PD1 A;  4NLO A;  5KFE A;  1FTC A;  2Y1I A;  1VRT B;  4B3O A;  1KDN A;  4BHQ A;  2CQI A;  1L3K A;  1Q95 G;  3IGN A;  4LRB A;  4LSZ B;  2VHG A;  2KM8 B;  2L9W A;  5IFM A;  1OY8 A;  3T19 A;  3BF4 A;  1UCN A;  1N6Q A;  1IM6 A;  3M2U A;  2D3O 1;  1YZ6 A;  3J7A N;  4DR4 J;  3G96 A;  3CDU A;  1CS4 B;  1RWN B;  3TQE A;  4DR5 F;  3OBI A;  1FK9 A;  2LKZ A;  5F8J A;  2RKI A;  3M6V A;  2C28 A;  5DM6 Q;  5GAH I;  1U6F A;  3LP1 B;  1LFP A;  3L4B C;  3HZG A;  1DLO A;  2RVJ A;  4X2B A;  1J2V A;  5SZT A;  4ED1 A;  4YY3 J;  2QZ8 A;  3C3L A;  1SL2 A;  2C2Z B;  2D1C A;  5IC6 B;  1R8P A;  2VZ9 A;  1J5O B;  1REV B;  1EQ0 A;  2XB2 D;  5IV4 A;  5HQM A;  2UXD F;  3PHT A;  1E6Y A;  3UVJ B;  2WSC C;  3MM7 A;  3VVU A;  4FYD A;  2QX0 A;  4TLR A;  3V81 A;  2M70 A;  2IPO B;  4ALZ A;  1TAU A;  3JSR A;  1RTI B;  3BSO A;  1X4A A;  3EDR B;  4ED3 A;  5D77 A;  2JJ4 D;  2KVI A;  4DCP B;  4DR6 J;  5KFC A;  2JZ5 A;  2W4C A;  1DHM A;  3DRR B;  1HQU B;  3DXB A;  4USH A;  3VF0 B;  2V2Q A;  2R7R A;  1HYS A;  1U09 A;  4UST A;  1XNR J;  1NCL A;  4X4V A;  1ZTT A;  2WVF A;  2E9R X;  4RBU A;  5KFY A;  1EX8 A;  1RT7 B;  4G1Q A;  1NSK L;  1WJ9 A;  3ISN C;  2B5J B;  3TO8 A;  1XR6 A;  1U1Q A;  2DHS A;  2BJE A;  1CQN A;  3DM2 B;  4P2F A;  4DL2 A;  1FJG J;  1N0U A;  1L3T A;  2GHV C;  3I5A A;  4L3K A;  1BQM B;  4HKQ A;  5KG4 A;  4UTG A;  1EAY C;  3DRY A;  4ZP7 A;  3M30 A;  1CUL A;  1LWC A;  1HI8 A;  4PXB A;  3NGK A;  1G7C B;  4HTI A;  4NWB A;  1FRX A;  3ONQ A;  2XMV A;  4JI5 F;  2CQ1 A;  1LFW A;  3K17 A;  2AJ2 A;  1S6Q A;  1XQI A;  3K8V A;  3G71 S;  3DU5 A;  2BE7 D;  4V1A k;  2KXF A;  1R0A B;  2DXF A;  3D6T B;  4LSL A;  3OR1 B;  3TEG A;  5KFW A;  4C8L A;  1JIH A;  2P6S A;  4CO1 A;  1ACM B;  1ZAV A;  4DQS A;  1KRP A;  2RQK A;  4C9D A;  4LF7 F;  3MM9 B;  2KL8 A;  4IDK A;  4Z2X A;  3B82 A;  1BLU A;  2ILZ A;  2CRL A;  1N4L A;  4DR7 F;  5E3Q A;  2GQQ A;  2D9O A;  2JRS A;  4C3M A;  2DY9 A;  4LRA A;  3QBC A;  2YWK A;  3POT B;  4O3R A;  1HNX J;  2GW8 A;  1G4C A;  3QRP A;  5KT4 A;  2VC0 A;  3WHI A;  4NLU A;  4DCO B;  2V94 A;  4NZ7 A;  3G86 A;  1VDH A;  3VAI A;  2MQ8 A;  2ZJQ Q;  2HWH A;  5CYJ A;  1WTF A;  3TNV A;  1FJE B;  4F50 A;  2KKH A;  2MY7 A;  1N48 A;  1JKH B;  2C3Y A;  4J5O A;  3E01 A;  2R7U A;  3ZO7 A;  5CD4 H;  2FY1 A;  1MG7 A;  4WTY A;  1TK5 A;  3O6Q A;  2BX6 A;  2E5L F;  4KIA A;  5KT7 A;  3H25 A;  3HUL A;  1R8C A;  1PBU A;  2FJX A;  2ZWP A;  2BEF A;  2VFS A;  5CD4 A;  4ZCK A;  1RTZ A;  3P6Y C;  4NLD A;  4TYB A;  2IA6 A;  4HI1 A;  1B99 A;  3GSD A;  3FBF A;  1HD1 A;  4MK7 A;  4DV2 F;  1FCA A;  5F0U A;  1NAQ A;  3IN5 A;  3MEE B;  4IUF A;  3CCM S;  4CH0 S;  1HL6 A;  1HBN A;  2NZ4 A;  4UQG A;  3GYG A;  5CQG A;  2DH9 A;  2LXI A;  3QLH B;  4WFN Q;  1VLO A;  3T1H F;  4CLZ A;  1RP5 A;  4IQM A;  4EBD A;  1YRT A;  1OPI A;  3FRY A;  1KQK A;  2Z2L A;  1SB6 A;  2GO9 A;  2UVV A;  1WWH A;  4X4O A;  2XMT A;  2F1F A;  3W60 A;  1KLM B;  1I3O B;  4OYM A;  1RTD A;  4YHH F;  1B3T A;  1RB0 A;  3VGT A;  2E1R A;  5LJ3 Y;  3Q89 A;  2ZM6 J;  3T5H A;  2CZ4 A;  4DV7 F;  3FJ2 A;  3CD7 A;  4JI4 F;  1Q53 A;  3FUY A;  2MZS A;  2IVF B;  3UNG C;  4FYV B;  2HRT A;  1JLB B;  1S49 A;  4DL5 A;  1IKX B;  4ANC A;  1UKU A;  4NLW A;  2ZH6 A;  1IBC B;  3MM8 B;  3M9O B;  4U7U K;  2N4D A;  4URG A;  3HHE A;  4YR2 A;  4ITS A;  3GYN A;  2CJK A;  1P9Q C;  3M6U A;  3RG6 A;  2EI5 A;  1WF1 A;  1IKV A;  2DGX A;  4ID5 A;  4WTO B;  4M95 A;  3D9B A;  4MKA A;  1YSJ A;  2FLP A;  3H7H B;  3PKM A;  2RHQ B;  3KK3 B;  3T1Y F;  2CNO B;  4GKK F;  9ATC B;  4IOA Q;  2HFO A;  4X66 J;  2CPI A;  1YIT S;  5B0F A;  1MRO A;  2BRL A;  4HH0 A;  1SJF A;  2UUC F;  2HND A;  2DVI A;  3IRX B;  4YR3 A;  5IQQ A;  8ATC B;  1MMD A;  4FS1 A;  1IBL F;  1GMV A;  3QYY A;  3Q8P B;  4A8W A;  2HGL A;  2YY3 A;  1YGY A;  4YEA A;  4NZ0 A;  2EC0 A;  2E5I A;  2V8H A;  5DQG A;  2OSQ A;  2NCK L;  3X3U A;  4NCG B;  1YJV A;  3RR8 A;  2B9E A;  2ZH3 A;  1VQ9 S;  3PIO Q;  5J1E B;  4MJK A;  1KHV A;  2VBY A;  2W2P P;  4OL8 A;  2XMA A;  1IVZ A;  1DQ9 A;  2L08 A;  4CZC A;  3KKF A;  4N8N A;  4YS2 A;  4WFX A;  2C22 A;  2FD2 A;  4Z7C A;  5D0G A;  4NE9 C;  4GKJ F;  1HBN B;  3E3X A;  1U4B A;  1RYR A;  3L09 A;  3UI3 A;  2R8G A;  1NK5 A;  2VG7 B;  5JVH Q;  2Y8Y A;  1WSV A;  3NMA A;  1GXL A;  2P8I A;  1RTH A;  4MH8 A;  2HPU A;  1PJ5 A;  4AXJ A;  1X4H A;  3IA0 A;  3GZ7 A;  3HDS A;  3SV3 A;  5I4M A;  2YTC A;  4BCA A;  1RTD B;  2HVI A;  3FQL A;  3W8P A;  2B6A A;  1ZA2 B;  2BQU A;  2AYE A;  1XNQ J;  1MN9 A;  1C4C A;  3W8G A;  4B3T J;  5DG7 A;  2YBV A;  2AYB A;  1LW0 A;  3HVR A;  2XMJ A;  2JVO A;  4HAC A;  3MZI A;  3HFZ B;  1I5O B;  4RNO A;  1YG0 A;  4DCJ B;  3ETM A;  3MMB B;  4NLR A;  1W2B R;  3J80 U;  1TKX A;  5GAG I;  4OX9 F;  2RF2 A;  5D4P A;  3QSI A;  2E66 A;  1KS2 A;  3A8K A;  2F65 A;  5M2U A;  4X4N A;  4YB6 A;  1GT8 A;  4F0K A;  3GV7 B;  3TVY A;  2XLI A;  4OZ5 A;  2H4Y B;  1IKV B;  2PMZ D;  2GHP A;  3DLE B;  3IXQ A;  4CIO A;  2L41 A;  1RTJ B;  5CYQ A;  2VF3 A;  4ZVE A;  2BKN A;  2R2U A;  3DI6 B;  2LEP A;  3SI8 A;  5BYS A;  4LFC F;  1SI9 A;  1DQ8 A;  3OTO F;  3R7B B;  2RSQ A;  3CJ8 A;  2NZC A;  2MQP A;  4GVL A;  3D6F B;  2WBR A;  4DXL A;  1HLW A;  2E1M C;  4DV1 F;  1HNZ F;  2CJY B;  1VQ7 S;  4IH7 A;  1RAF B;  5LT5 A;  3PRB A;  2UXC J;  3VZI A;  3WX8 A;  2ZE2 B;  2HZV A;  5KFD A;  1ZM4 A;  2LQ5 A;  4J9P A;  3OHA A;  2PFF B;  3PYD A;  2FY8 A;  4TNO A;  2K2P A;  1UW9 A;  3AOC A;  4Y28 C;  3PW2 A;  4C0B A;  1IKW A;  3LTO A;  4DUY F;  4JI3 J;  1F3V A;  2HZA A;  4WYW A;  1RU1 A;  4JBC A;  1J27 A;  1WG4 A;  4WK3 A;  5KFU A;  3RB3 A;  2VJV A;  1T95 A;  1FE0 A;  1QAX A;  1HWK A;  3CGI A;  4JI0 F;  2ZD1 A;  3S7R A;  4DPU A;  1H0H B;  1RWX B;  2ERR A;  2BKP A;  3HSD A;  1Y9O A;  3K8W A;  2RDJ A;  2GQC A;  4EK2 A;  1N8R T;  3Q8Q B;  1H98 A;  2W1B A;  5HN0 A;  1ZH5 A;  5A6P A;  5E0O A;  1JNR B;  2QA1 A;  1U49 A;  3UN2 A;  1SKR A;  3TJA A;  1R0C B;  1RTH B;  2ZZM A;  3VTI A;  4M5I A;  4G3I A;  4D3H A;  3DGP B;  1SC4 B;  2ZIT A;  4WK1 A;  1FEE A;  1M1G A;  1PG5 B;  4U95 A;  2CQC A;  4ZVR B;  4AYB D;  3KLV A;  2QC3 A;  1GXU A;  2XMK A;  3NNA A;  3AQO A;  2DBB A;  3LO3 A;  4GMK A;  2RDI A;  1E6V A;  3GB0 A;  3FRZ A;  3MM6 B;  3GV5 B;  2XS7 A;  3IR7 B;  2EFO A;  4QBU A;  1OYD A;  1JJC B;  2AF6 A;  4MKB A;  3BV8 A;  4F26 A;  3FNN A;  4UOG A;  3M6W A;  2AMC B;  4H4O A;  3BQ2 A;  1HBO A;  2WRM A;  1JNZ B;  2FHO B;  3J7Y I;  1S1W A;  1YIJ S;  4LRE A;  3MUT P;  2GIQ A;  4LT6 A;  4GVB B;  2DPI A;  2XSF A;  1RT4 A;  5HP1 A;  3ADA C;  2OPR A;  1ZTW A;  2FZG B;  5HRO A;  5BR8 J;  1NK7 A;  2XZT B;  2NXN A;  1WI8 A;  3CJ3 A;  1LK7 A;  2QA4 S;  3UD5 A;  4KO0 A;  3CUL A;  4DZ6 A;  5GAD I;  2Y1R I;  3EGV A;  5LOQ A;  2HQG A;  4LFA F;  1RGV A;  2J7U A;  4C97 A;  4RJV A;  5BJR A;  4P52 A;  1KHW A;  1FA0 A;  4ZVT B;  3V4I A;  1T03 A;  2M9K A;  2V2Z A;  5KFG A;  1NBE B;  2CKW A;  2CWK A;  4X4P A;  4AL7 A;  4J9N A;  4MTP A;  3LP2 A;  3MED A;  2HQ3 A;  3MHY A;  1R6Y A;  3W64 A;  2GVZ A;  4KPC A;  1RWU A;  4R0E A;  2IRX A;  2IIH A;  2H4W B;  1N5Q A;  3BKF A;  2FVC A;  2G13 A;  1OS5 A;  5FLX Y;  1Q81 T;  2HVD A;  1OY6 A;  4EYI B;  2VKR A;  4DR2 F;  1S79 A;  1YKW A;  5KFV A;  3OFG A;  4H4M A;  7FD1 A;  1ZOT A;  1N5Y B;  1DQA A;  4DSK A;  2BAN A;  4ZVH A;  4CO2 A;  3RBE A;  2FVQ A;  4ATN A;  2I2Y A;  1PYO B;  3UR3 C;  3LAK A;  2AU0 A;  2WVC A;  1MWY A;  4O4R A;  3CCU S;  3DOM A;  1DZ5 A;  2CJQ A;  4QR1 A;  1NK0 A;  1XWL A;  4UUW A;  3HK2 A;  2E9Z A;  1ROF A;  3FCV A;  2E9T A;  4DR3 F;  1X60 A;  1D09 B;  4P6Q A;  1UMJ A;  5C42 B;  1FER A;  4MMO A;  2XCP A;  2H54 B;  3CPW R;  3AA8 A;  4O3N A;  1S48 A;  1WHY A;  2RE1 A;  4I1T A;  2VQF F;  4WWS A;  4NRT A;  2E1P A;  1NH7 A;  1C0U B;  1S9G B;  3GFY A;  4DFJ A;  2DHG A;  2MQN A;  2DR9 A;  3TI0 A;  4CNZ A;  1UVN A;  3KTQ A;  1DRZ A;  4DQQ A;  1GQE A;  4KGV B;  4X62 F;  3CCW A;  1U24 A;  2AP6 A;  2DXE A;  3ZFV A;  2LVW A;  2KFZ A;  1PC4 A;  4NCB A;  2H5E A;  3MPD A;  4O0N A;  1RDR A;  4DR5 J;  2IRY A;  1MSW D;  3CT9 A;  4KC5 A;  2J9D A;  4MK9 A;  2OFG X;  4PKD B;  1YX2 A;  4H4O B;  4DMZ A;  1NK8 A;  3S01 A;  1QAI A;  1S1W B;  3NAI A;  3KLG B;  1ICE B;  3OXF A;  5KFB A;  2XYH B;  2HNZ A;  3OUY A;  1RT4 B;  5HP1 B;  4DSL A;  3VV2 B;  4KH0 B;  3M8W A;  3RB0 A;  2E1A A;  5HRO B;  8RUC A;  2XWY A;  2NXE A;  2MKI A;  5EWF A;  2X1B A;  3D1H A;  4O4G B;  1FDB A;  2UXD J;  4U6P A;  4KO0 B;  1FI4 A;  2RQM A;  2UXB J;  1Y11 A;  4P7T A;  4IG3 A;  2C2D A;  3CMQ A;  3PX4 A;  5EGY A;  3IAS 9;  3I6P A;  4MIA A;  3MR2 A;  4B9T A;  2IJR A;  5C7P A;  4J37 A;  3PKY A;  4CLF A;  5F0W A;  3NBP A;  5KFM A;  3CJR A;  2HGM A;  3D28 A;  2MDA A;  2CPF A;  3MPU B;  2I6W A;  2C2E A;  2ZH8 A;  3BBB A;  3D2W A;  3LP2 B;  4A8O A;  2G1H A;  3TZW A;  2GVZ B;  2A18 A;  3ZXW A;  3FFI B;  2V67 A;  4P71 A;  2MQO A;  1T7P A;  4RWX A;  3BGU A;  1RK8 A;  1LW2 A;  3EX7 B;  2CUY A;  3H2V E;  5KT5 A;  1XJW B;  2OPS A;  1FVS A;  4ZS6 A;  3QFW A;  2JSX A;  3R8Y A;  2GML A;  1SIW B;  1WC6 A;  2W9B A;  1N32 F;  2NYI A;  2DEI A;  2JFD A;  2H65 B;  1KC8 T;  1NZ8 A;  1RAB B;  4AFF A;  4ECT A;  2IC3 A;  2Z30 B;  1O6X A;  5K14 A;  2P9C A;  8AT1 B;  3GJS B;  3QGH A;  1WC0 A;  2HBR B;  3DMJ A;  1M5K C;  3FSY A;  3W9H A;  3NGR A;  1SPB P;  4F4X A;  2FJA B;  4F0M A;  2IJF A;  4UW2 A;  3HHK A;  2A0F B;  1TL7 A;  2B9Y A;  4TXS A;  1UA0 A;  3M4X A;  2C2R A;  3A8E A;  4QR2 A;  1Q5Y A;  2HIY A;  1Q78 A;  2OUG A;  3BRE A;  3BN7 A;  3VAJ A;  3BEG B;  4FBU A;  2ZBR A;  5IQ6 A;  2QN6 B;  2BJD A;  1F0X A;  4ICL B;  4AQY J;  3G6X A;  2MZR A;  4DX7 A;  1ZA1 B;  2YNF A;  5L1L A;  4OYO A;  2W2O P;  3F73 A;  3JB9 k;  1D9D A;  2XO6 A;  1HNI A;  2BR0 A;  4I2Q A;  4ECR A;  2DHX A;  4N47 A;  1SC3 B;  4ZCM A;  3MEG B;  5EDW A;  4ZPW R;  3TAP A;  2HS4 A;  2Z2Z A;  1SKS A;  2HAI A;  3AJ2 A;  5T7L B;  4RW4 A;  2HNZ B;  1FJ7 A;  5A8K B;  1TQL A;  4M5J A;  4DL3 A;  1M1H A;  3T41 A;  1I94 F;  4U7C A;  3KFW X;  2CQD A;  4EU0 A;  1FRH A;  1IN0 A;  3D68 A;  2VOP A;  4DFK A;  1YTY A;  2ZOF A;  5B0G A;  1VBZ A;  4RUA A;  3R1H A;  1QD1 A;  1VQ8 S;  3HSJ A;  2HS0 A;  2RRB A;  3Q24 A;  3IBF B;  4FPI A;  3VAM A;  4ZHR A;  4HYK A;  1WI6 A;  3TAM B;  4PXE A;  2W7P A;  2LCW A;  3D66 A;  4LBH A;  5J2M A;  1SV5 A;  3EZU A;  2W9A A;  3H5S A;  2XG8 A;  2M3D A;  1TMM A;  4MFB A;  2HVZ A;  4WU2 A;  3ILI A;  1FKO A;  2DR5 A;  4MIB A;  5D3G A;  5AXM A;  3ENA A;  1Q8K A;  5HAO A;  2DR6 A;  3QO9 A;  2LYV A;  1WEZ A;  2E5J A;  2OLW A;  3TAN A;  4B3R F;  1JLG A;  3KJV B;  2DR7 A;  2QO3 A;  1YQH A;  1JXV A;  5EX3 A;  1LW2 B;  1HMV A;  3MMJ A;  4Y34 A;  3VR1 A;  2OPS B;  5K5M A;  2AZ1 A;  7FDR A;  4HDH A;  3UCU P;  3K0J A;  4UT4 A;  3TW0 A;  4PCQ A;  2C3P A;  3EWG A;  2ZC3 A;  4ECW A;  3W66 A;  1VQY A;  2F4V F;  2OTL S;  3AB4 B;  2GS8 A;  4OV6 A;  1RHK B;  2APO A;  3WX4 A;  1S9F A;  5K14 B;  5A6W A;  4PPD A;  2JL9 A;  2ILY A;  1ITP A;  1FO1 A;  4M5K A;  3UDV A;  1FNX H;  2FLL A;  2DHH A;  4EGL A;  2E7V A;  3DMJ B;  1GAO A;  2V50 A;  4KFB A;  3IMQ J;  2GO8 A;  3MCM A;  2XGQ A;  4Q44 A;  1H38 A;  4JYA J;  2XTJ P;  4U8Y A;  1TL7 B;  3GV8 B;  4JI4 J;  1C2P A;  4NYO A;  4B9U A;  1QTM A;  4FZV A;  2WW8 A;  4R5P A;  4I56 A;  3BS9 A;  2NXJ A;  2CA9 A;  2FHJ D;  4MIW A;  4LFB F;  1RWM B;  4O44 A;  5J2P A;  3MUV P;  4ZVQ B;  4CO5 A;  4JI1 F;  4OZ3 A;  1SH3 A;  1TP7 A;  2B4V A;  1WKJ A;  3GG0 A;  2BYC A;  1HWU A;  1B0P A;  3OPK A;  1FRM A;  3ISZ A;  4F67 A;  1SKW A;  2A6O A;  2RUG A;  2DXD A;  3EYZ A;  4RU2 A;  4G1I A;  4ZLJ A;  2XYG B;  4DPO A;  2GV1 A;  2BXJ A;  4HHH A;  1P1T A;  1QUP A;  1KEK A;  3Q8S B;  3MMC A;  1TMJ A;  2DH8 A;  4ED4 A;  1SQF A;  1U47 A;  3HXM A;  4CDI A;  5AJ3 J;  4YUD A;  1XR5 A;  4AUK A;  3UN3 A;  3JYT A;  3C14 A;  4QJV A;  3C16 B;  1MWZ A;  2FVS A;  1RT5 A;  3DYA B;  3T5L A;  4DV5 J;  4ES1 A;  1VK3 A;  2FHM A;  4PPZ A;  4CLW A;  1L5U A;  3EVW A;  3BDE A;  5IWA F;  2DHA A;  3DXS X;  1WC3 A;  3HKW A;  3CJ5 A;  1IBL J;  2F3J A;  1JJ4 A;  3K5L A;  3DLG A;  5E3P A;  1SH0 A;  5JVG Q;  2G0C A;  2ZKT A;  2GGP B;  1FKO B;  3SCI E;  2HHX A;  5D3G B;  3KDN A;  3C6U A;  2VDH A;  2V2K A;  1T9V A;  3L7P A;  2W9C A;  5KFO A;  5HBM A;  1SC6 A;  2WB4 A;  2AGQ A;  2YQ0 A;  4DR4 F;  4Q2L A;  4WKR A;  1D3W A;  1HMV B;  5DZ6 A;  2LLZ A;  4CCH A;  4YDX A;  4P2X A;  3OHB A;  2W4D A;  1RYS A;  4DPT A;  4TLQ A;  3Q22 A;  3T5K A;  1ZBT A;  1M0S A;  1DTT B;  3AD7 C;  1HD0 A;  2ZHB A;  3G8Q A;  2QLX A;  1B7F A;  3MMA B;  3H0P A;  4KH1 B;  4YY3 F;  3G82 A;  4RL1 A;  3PJ9 A;  4O3O A;  1WDD A;  4DQP A;  3Q0A A;  2RU3 A;  4B9N A;  2WHO A;  4OYX A;  2XMU A;  2PT0 A;  1K9M T;  1W25 A;  1JJH A;  1URR A;  3CJ4 A;  3ZTR A;  2RQC A;  5F3Z A;  2DNZ A;  2WSF C;  2DCL A;  3QT8 A;  3GFH A;  3CE8 A;  4YOE A;  3QQC D;  1LV5 A;  3CTR A;  2V63 A;  1FKP A;  2YKP A;  3KLH B;  5T14 A;  4QWC A;  3IBW A;  4PG7 A;  4ECX A;  1OPZ A;  4O44 B;  2YKN B;  5J2P B;  1S1T A;  4FNI A;  3PJX A;  3J81 j;  4DR6 F;  1TK8 A;  1UFW A;  2V2V A;  2B4U A;  1PIE A;  3HHD A;  3EZO A;  3RW7 A;  2B0G A;  2M5Y A;  3LAL A;  4ZPT R;  9RUB A;  4FXW A;  2KDO A;  3OVS A;  2LQ8 A;  2Q1L A;  2UUB J;  4ED8 A;  5KFZ A;  4QIV A;  3OTO J;  2PN6 A;  3GR0 A;  1GH8 A;  1CQM A;  5C25 A;  3C14 B;  1UVL A;  3NKY A;  4LR9 A;  4LIW A;  2JEJ A;  5DM7 Q;  5DGB A;  1UJ5 A;  1HNV B;  1SQE A;  1T94 A;  1BE4 A;  2WVE A;  1D0E A;  2OHD A;  1HI0 P;  4F4K A;  3SSS A;  4ETX A;  2EFG A;  3HSG A;  1UAW A;  3QZ8 A;  4DUY J;  3ZZU A;  1C1C A;  5JJB A;  4NLS A;  3OXG A;  3CDE A;  3MCN A;  2BDP A;  3CJK A;  1S6P A;  3NMR A;  1AB8 A;  3PYE A;  2GAH C;  3MCS A;  1UZH A;  2W9C B;  4I6Y A;  4QYZ J;  5HAN A;  1IR0 A;  1NHU A;  3VCD A;  2XSJ B;  5A8W A;  2E29 A;  4M63 A;  5LMN J;  4YME A;  1JLQ B;  3HJV A;  1PAE X;  1TL3 A;  1GNK A;  3FBB A;  4ZOS A;  2MKH A;  4DL0 C;  1Z2Z A;  2QL9 B;  1XN9 A;  5BYQ A;  2HRU A;  4I68 A;  4B9M A;  1AW0 A;  3CD0 A;  5IXU A;  4LF6 J;  1Y5N B;  2LDI A;  5KFS A;  2J9C A;  3NS6 A;  2IA0 A;  2M4M A;  3G82 B;  5ETP A;  2MQQ A;  3HD2 A;  2WOM A;  3FVY A;  1S0O A;  3J81 Y;  1A6L A;  5D0E A;  4FP9 A;  3KK2 A;  1K47 A;  3BPD A;  1VQ5 S;  1BHN A;  5EN1 A;  3A1Y G;  1OY9 A;  4DU7 A;  4LQ3 A;  2BMB A;  4DL6 A;  5L1I A;  3HVW A;  3PDN A;  3GJR B;  3TVZ A;  2D3O R;  2L3M A;  1XTZ A;  1MLA A;  3JTO A;  4TQR A;  4RW7 B;  1WKL A;  3M32 A;  5E41 A;  2KVQ E;  3FSI A;  1UEV A;  1FKP B;  2M0G B;  4DR1 J;  2F5G A;  2AWZ A;  4OHW A;  2I0X A;  2V8V A;  2GNK A;  2CPD A;  2HK3 A;  2OGU A;  3W63 A;  2MGZ A;  5F3T A;  3D0I E;  1N34 J;  2QG9 B;  2OPQ A;  5T41 A;  5HK4 A;  4PAB A;  4Y2C A;  3SMZ A;  4DF4 A;  2K1R B;  2WTF A;  1VK8 A;  3RAQ A;  4RLE A;  4WXO A;  2ZVS A;  3DOK A;  3TP2 A;  1VCT A;  2HBQ B;  3RYL A;  2FHK A;  3UDC A;  4QCL A;  3TUP A;  1IKY A;  1BQN B;  2CPZ A;  3PW5 A;  2LQJ A;  1G2E A;  3DDI A;  3EDQ B;  4EMD A;  3R5G A;  1UZD A;  3DRP A;  3LF0 A;  2FDN A;  2JEI A;  3QAT A;  3BKU A;  4F3O A;  3PTW A;  2HAF A;  2VOO A;  2G0I A;  4TKT A;  2AEM A;  2QLF B;  4PWD A;  2H5J B;  3CIM A;  5AXK A;  1DAR A;  5KFK A;  1DBD A;  3O8W A;  2ZM6 F;  4X4Q A;  1F1B B;  3C15 A;  1JJ2 R;  3O5T B;  2YH1 A;  3W62 A;  5GAG U;  3W2V A;  2X1G A;  1X4E A;  2GIF A;  2B7B B;  1T05 A;  1CJV B;  3I32 A;  1M90 T;  5EX0 A;  3MFI A;  3M8S A;  4DR2 J;  1CJU A;  4P9S A;  3QGI A;  1Q8B A;  4UF4 A;  1TL4 A;  3BBF A;  3D0G E;  5K8P A;  3HFK A;  3ZZY A;  1SUQ B;  3FEY B;  2W25 A;  1TK0 A;  3A3O B;  4ELV A;  5KG5 A;  1LWE B;  1NME B;  3PFE A;  4C6A A;  4KGM A;  1RT3 A;  2LEA A;  2IDL A;  3D4J A;  2OEJ A;  2DY1 A;  3AFG A;  3PIP Q;  3TAR A;  3I0S B;  2AJ0 A;  3D6H B;  1NLK L;  4EBE A;  5C5J A;  2I9S A;  1C0T A;  3KUE A;  3NWR A;  3IM9 A;  4X66 F;  4N77 A;  1MW7 A;  1VI7 A;  5FLX U;  3KLI B;  2VQF J;  2RHS B;  4O3S A;  5HI7 A;  2MJN A;  3GG1 A;  1T8E A;  1TUV A;  4W98 A;  4DLE A;  2YWE A;  2FLN A;  4HVZ A;  2D9P A;  5KFJ A;  2UV8 A;  4LUB A;  3UD4 P;  2ZH2 A;  2MXY A;  2DEJ A;  4QWB A;  1UFK A;  5HSP A;  1TFW A;  3CCE S;  4RW9 A;  4C8O A;  1Q79 A;  1D8Y A;  2M8H A;  4RBT A;  5DG9 A;  1EB0 A;  3KXD A;  4IO1 A;  4NAS A;  1WHX A;  5F8H A;  1UVJ A;  3SCL E;  3H4D A;  2OH2 A;  2MST A;  2KN4 A;  4GO7 X;  3HZE A;  1S97 A;  3R1L A;  2OPQ B;  3I4P A;  3P96 A;  1JLE A;  3GSI A;  4IOC Q;  1KFS A;  2CQ2 A;  2DGO A;  2J6T A;  3B6B A;  3AAW B;  4J9V A;  3PXG a;  4QWE A;  2I1R A;  3CCV S;  4EO6 A;  3BQ1 A;  4ILL A;  2KO1 A;  3GLJ A;  4ZN3 A;  2AIR B;  3HX9 A;  3KK1 B;  5J2N A;  4USM A;  4QPX A;  3DHX A;  1PKU A;  2DB1 A;  2DNL A;  1D8Z A;  4KYZ A;  1NB2 A;  2R9L A;  2CDR B;  4ILR A;  4RNH A;  1XK8 A;  1YLX A;  2OKQ A;  4LF9 J;  3EVM A;  2NPI A;  1XNQ F;  3GU0 A;  2IAJ A;  3KG4 A;  4IH6 A;  4ZVU B;  4B3T F;  2VC1 A;  4I7F A;  3W2V B;  1T9T A;  3NGU A;  2MB0 B;  4KBI A;  4F25 A;  2NXC A;  4JB8 B;  2WB1 D;  2H5I B;  1DAX A;  1EP4 B;  3SBM A;  1LNQ A;  4JV5 J;  3J7Y U;  4IFY A;  1S1X A;  5KTQ A;  3EGZ A;  1PJ6 A;  3IBC B;  2I38 A;  3T5J A;  2VU5 A;  5E7O B;  3CCQ S;  3DRS B;  5KFP A;  2N3L A;  1TUW A;  3P5B P;  5KG1 A;  2DGQ A;  2LXF A;  2IFX A;  4ECQ A;  5KOX A;  2CPJ A;  1EET A;  4F2R A;  3BJY A;  3K89 A;  4KPY A;  4OI0 A;  2E44 A;  3IM8 A;  3KOA A;  3FCW A;  4HEA 9;  3CIZ A;  1HNW F;  4DSE A;  3WDO A;  3CC2 S;  2X3G A;  2Z56 B;  3NCP A;  1N56 A;  3BKT A;  1U2C A;  3IFE A;  2HS3 A; 
#chains in the Genus database with same CATH homology
 1NCL A;  4UOH A;  1NUE A;  5CAB A;  3FCV A;  3Q8U A;  1U8W A;  2DXD A;  3NGT A;  3EVM A;  1WKK A;  1XIQ A;  2BEF A;  3Q83 A;  4F4A A;  3FBE A;  1HHQ A;  1F6T A;  2ZUA A;  4ANC A;  3JS9 A;  3BBC A;  1LWX A;  3FBC A;  1NSK L;  2NCK L;  4S0M A;  3BH7 B;  3ZTP A;  3NGU A;  1B99 A;  1K44 A;  3ETM A;  3FBF A;  3EM1 A;  4FKX A;  5IOL A;  3NGR A;  3EIC A;  1MN7 A;  4HR2 A;  5C7P A;  2CWK A;  1PAE X;  2HUR A;  3G2X A;  3PRV A;  3FBB A;  3ZTQ A;  1W7W A;  2DY9 A;  4WBF A;  1NSQ A;  3BBF A;  1NDP A;  5BXI A;  3PJ9 A;  3DKD A;  4KPC A;  1ZS6 A;  4F36 A;  1B4S A;  3FKB A;  3EMT A;  3BBB A;  4CP5 A;  3FC9 A;  4UOF A;  3B6B A;  3VVT A;  4ANE A;  1NDC A;  2DXE A;  3EVO A;  2HVD A;  3GPA A;  3DDI A;  4UOG A;  2VU5 A;  4DI6 A;  4C6A A;  3Q8Y A;  4EK2 A;  1KDN A;  4DUT A;  3EVW A;  3VVU A;  1NDL A;  3ELH A;  3MPD A;  4O0N A;  3GP9 A;  3ZTR A;  2B8P A;  2B8Q A;  3ENA A;  1NDK A;  1F3F A;  1BHN A;  3EE3 A;  1BUX A;  1VYA A;  3ZTS A;  3VGV A;  1BE4 A;  4ENO A;  3EJM A;  3VGU A;  1HIY A;  1NLK L;  1UCN A;  2DYA A;  1PKU A;  3BH6 B;  3FCW A;  1NPK A;  3VGT A;  5CAA A;  3ZTO A;  3Q89 A;  3NGS A;  1LEO A;  2AZ3 A;  1XQI A;  1HLW A;  1JXV A;  1NB2 A;  1WKJ A;  1S57 A;  1S59 A;  1WKL A;  3Q8V A;  4AND A;  1NSP A;  2DXF A;  3R9L A;  3WX8 A;  3VGS A;  3L7U A;  2AZ1 A;  4FKY A;  1NHK L;  4W98 A;  2BX6 A;  4DZ6 A;  1S5Z A;  1EHW A;  3B54 A;  1MN9 A;  3Q86 A;  2HVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...