3ENAA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dgdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3enaA00
1NSPA 3VGSA 2BX6A 3EMTA 3VGUA 3VVUA 4F36A 3WX8A 3VGTA 2DY9A 3GPAA 3BBFA 4F4AA 3EVOA 3G2XA 1WKLA 3FCVA 4DZ6A 1NSQA 1NDPA 3EJMA 1NDCA 1NHKL 2AZ1A 3BH6B 1W7WA 3FKBA 4EK2A 3DKDA 3Q86A 1KDNA 3Q8UA 3ENAA 3EM1A 1BUXA 1XIQA 3EVMA 3NGTA 1S59A 3BBCA 1F3FA 3PJ9A 1NPKA 3FBFA 1NCLA 3BBBA 1MN7A 3ZTSA 2HVDA 1K44A 1NB2A 4ANCA 1U8WA 5CABA 4DUTA 1LEOA 3B54A 1S57A 4ANEA 1NSKL 4WBFA 1BHNA 3FBCA 3FBBA 1NLKL 2ZUAA 4ANDA 1LWXA 3ZTOA 3EVWA 1JXVA 2HURA 4KPCA 2DXFA 2NCKL 1WKKA 3L7UA 3NGRA 1VYAA 3Q89A 1NDLA 1ZS6A 3VVTA 3Q8VA 4HR2A 3ZTRA 4C6AA 2CWKA 4O0NA 3BH7B 3PRVA 3DDIA 1PAEX 3ELHA 2AZ3A 3EE3A 1MN9A 2DYAA 2BEFA 4UOHA 2HVEA 1WKJA 3Q83A 4DI6A 1BE4A 5BXIA 5C7PA 3FBEA 3JS9A 3VGVA 3ZTQA 1S5ZA 5IOLA 1F6TA 5CAAA 3NGUA 1UCNA 3MPDA 1EHWA 4UOFA 2DXEA 3Q8YA 2VU5A 3B6BA 1XQIA 3R9LA 3EICA 1B4SA 3FCWA 1HLWA 4S0MA 3NGSA 4CP5A 2B8PA 2B8QA 1HIYA 1NDKA 3ZTPA 3ETMA 4UOGA 1B99A 3FC9A 4ENOA 3GP9A 1PKUA 4W98A 1HHQA 1NUEA 4FKXA 4FKYA 2DXDA
chains in the Genus database with same CATH superfamily
1D9DA 1YJ7A 1D09B 1PSDA 2MHEA 3IG1A 5DM6Q 3O5TB 4LR9A 2MQQA 2CJQA 1T11A 4ZPBA 2H5JB 1IR0A 3KLGA 2GA7A 3AQOA 3DDNA 3W2WB 3MCMA 2J6UA 5CYMA 5D0HA 3RAMA 1RKIA 4B3MJ 4OI2A 2BA9A 1NHKL 1Q1KA 3CULA 2AZ1A 4I2QA 2R2SA 4U9RA 3G87A 2R3VA 3DI6B 4LFAF 4DQQA 1MWQA 4GVBA 4ED6A 3D6FB 5IT0A 4R0JA 9RUBA 4GKKJ 4P7TA 1DLOA 1X8DA 1IKXA 2D1CA 3QIPB 1TUWA 1NPKA 1R89A 4C8ZA 5CYMB 1N8RT 2BRLA 1HNZF 2C3YA 2IA6A 3WC2A 5KFNA 4NLUA 1FI4A 2IVFB 5DETA 2OMOA 1DTTA 3TNVA 4PWDB 1N5QA 3IN5A 3PW7A 2BZ2A 2N4CA 1BHNA 4FPIA 4DOZA 4WKRA 2HFSA 3B82A 1KKHA 1NLKL 1VK3A 3CO9A 4LR8A 4F2SA 5E7OB 4TU8A 3OXLA 4EO8A 2JLGA 2ZE2A 1FFSB 2ZWPA 3H0PA 3M2UB 4HHUA 3EYZA 4WK3A 2ATLA 4Q8EA 4X84A 3GSDA 4NEYA 4DBQA 1TK0A 3CMES 4LF7J 1N54B 1VYAA 2CNOB 1L3TA 4HDGA 3PIOQ 2XMAA 1C4CA 1HWIA 1R8CA 2D74B 2HHTA 1V6HA 2OD6A 5J2PB 4KSEB 2J6TA 3QT6A 1RBAA 1TFYA 2QLXA 1TL5A 1TMJA 2KXHA 3K7RA 4UUXA 3TUJC 3SYZA 4OLOA 4AT1B 4OYWA 4R8UB 2CQGA 5C24B 4N56A 2HHXA 1N6QB 2LP4A 3QSIA 4U7UD 4LF2A 4KAIA 1OWXA 1LWCA 4I68A 2HNYB 1RACB 1FWKA 2N4DA 1MN9A 4I2PB 4CI0B 2OPQA 4ZVFA 2MQMA 2DNQA 4FBTA 4D3HA 3AXKA 3JQKA 5KG0A 2VG6A 4ZCLA 4NZ7A 1RT4A 1U26A 2J7KA 9ATCB 2AYMA 4NI2B 1SPBP 3PDNA 2CJXB 5K8NA 1IR1A 1JLCB 4BC9A 2FJEB 2CJAA 5HQ8A 1N32F 3PW2A 3KOAA 5CCLA 1S7HA 1HQUA 3PCOB 3NS7B 3MAQA 3NNHA 2R7RA 3SMZA 4AXJA 2I8EA 1F60B 4H4KA 4DPWA 3B6BA 3BGRA 1JLBA 2M88A 4FYWB 1AW0A 3M8QA 1QAJA 3G8SA 4DSIA 2E7WA 5BYQA 3GTYX 3VWSA 2W9BA 1R27B 3IRXB 2EG2A 5ETPA 5KT4A 4DV5J 2WONB 2RHQB 4JI7F 4PQUB 3FRYA 4KKOB 3TARA 2G13A 3CD7A 1H0HB 2ERRA 2WVFA 3I56S 1WORA 3DXSX 3SCIE 4FF2A 1IVZA 4DV4F 5HJYA 1B0PA 1BMQB 3MEGA 1BQNA 4DU8A 1UJ4A 2C3UA 3G9CA 1RT2A 1Q95G 3O44A 2KJVA 4GO5X 4ES3A 2W9CB 2OTJS 3J81U 3KK1A 3FDSA 1DARA 2VQEF 2DHHA 5H9EK 4QCLA 2U1AA 4G1QA 1P1TA 3MR7A 1NU4A 5KT5A 2I5JA 5DM7Q 2C2EA 1RUSA 3GSIA 5D4LA 3CMQA 2Y0SD 5G0RB 1WUUA 4NRUA 5CH7B 4C3MA 2X1FA 4DWIA 4NL5A 4QPXA 2V4JB 1ICEB 1W26A 3MD1A 5AE3A 1WC6A 3CJTA 3H5YA 1CQMA 2E1AA 1YQHA 3M2RA 1CJKB 5F8NA 1WG1A 4PKDB 4WP3A 1RHUB 2VIHA 1K0VA 4RPFA 2XMKA 3DKDA 3KUHA 4K2XA 2RJZA 5GAGI 1T3NA 4FDFA 4URGA 5D0RA 3QT7A 5HK4A 4ZA1A 2I2YA 2Q66A 1XIQA 5KAKA 3HP6A 2GV1A 4LFCF 5J2QB 2BANA 2G0CA 3PJWA 1QJHA 1V3RA 1L3VA 3RAXA 4ILLA 1W25A 3NOGA 3CMAS 1KFDA 1PBUA 3CD6S 3ZO7A 2C42A 2YKQA 4ANEA 4X62J 1ZYQA 2W1BA 2X7IA 2RD5C 2QSFA 1GX6A 4F67A 1Q5YA 2J0QD 3JTOA 1FCAA 4H54A 4AXIA 3KDOA 1KLNA 2P9GA 1YGYA 2JZ5A 4ZPAA 3W9HA 4UQTA 2ADBA 2HW3A 4A8WA 4JI2J 1B7FA 3CUNA 2LECA 4EBDA 2W2NP 4KV8B 5ITHA 3EZ5A 1YJWS 2BOPA 3D66A 2I38A 1TTHB 4DUZJ 2KHCA 1PBAA 4HT5A 2V94A 5EWFA 1CQNA 2DGUA 2CQPA 1M5VC 3MM8B 1S0OA 4A46A 1RTHB 3OTOF 5LXYA 2DNNA 3R1HA 4LSNA 2MGZB 3SI8A 5KT6A 4F0HA 3S6EA 1E6YB 5J1EA 1TR0A 1EARA 5KFMA 1S72S 3NAIA 4WFBQ 5HMWA 3HO1A 2IIHA 3A8KA 2KFYA 2GHWA 3W8PA 1LK7A 1JK9B 2EFVA 1PILA 2FY1A 2D3O1 4F3OA 2IM1A 4UQGA 3R5BA 1IBCB 5B0BA 2DGTA 4Y2IA 4DX7A 3HFZB 4DL6A 1P8GA 3ULHA 4HH1A 1RWXB 2JH3A 2IC3A 3FBEA 3M8SA 1MWZA 1R8BA 1S6UA 2X3GA 1S1WA 5KFOA 4HTIA 4X4QA 2CQHA 2W2PP 3OT9A 1REVA 2W2MP 4KO0A 2ZDOA 1UVMA 1S1UB 4DR4J 2CQ2A 5FDLA 5KT2A 3NGUA 2FUG9 2FHOB 2VC1A 4MTPA 5GAHI 4F4XA 3J7A1 2H9ZA 4K4UA 1EHWA 2RHSB 3T6BA 2I9SA 4X4VA 3A1YG 5CZVA 5GAHU 5CYQB 1VHIA 4G1QB 1QSLA 1RAAB 2AGOA 1JLCA 2JLEA 3ILLA 3MEDA 1FRLA 2AJQA 2IBKA 1G4CA 5FLXU 2MJNA 2R7UA 2C3MA 1RAHB 4DCOB 3VAHA 4LF4F 1L5UA 4DQIA 1RTJB 3NNAA 2P8IA 1NK4A 2B4PA 2EC0A 2OPQB 5T14A 2EK6A 1VRUB 4B3OA 4NLWA 4Q0BB 3OFEA 1N36J 4OZ0A 3THVA 3TEGA 1S9EA 2WONA 4I6AA 2R7QA 3Q23A 1FXLA 2MY8A 2RIJA 3D3CJ 3M8YA 1T8EA 3G6ES 4UY85 3G71S 3FMBA 1LW2B 2VDHA 4DFMA 3UVJA 2FJVA 4A8SA 4EYHB 5DRKA 4Z2XA 2RU3A 2QYGA 2EFQA 2JEIA 1F1BB 3QO9B 2DPJA 1SC6A 4MKVA 2HRYA 1HW8A 1FVSA 2CPDA 3C19A 3CJ0A 3KG0A 3WX8A 3VQSA 4QBUA 4QWDA 1UFWA 2OEMA 2K8GA 3A3NB 3EGVA 4CT9A 4ES1A 3QT8A 3EDQB 2J8AA 4PG8A 2FC9A 1OY9A 5D78A 5THWA 4KHMA 4LF1A 4TLRA 2XYPB 1HHTP 3FKBA 3M32B 3BQ2A 4KC5A 2KG0A 1EP4B 2D3UA 4KYZA 4MIBA 3J80U 1EKRA 4F04B 2DT9A 2PA8D 2F63A 3SV4A 2CADA 4M5DB 1IQTA 2HIYA 1U2FA 1EETA 4ZVQB 4FN5A 5K8PA 4HT7A 1N6QA 2DGVA 5DJBA 3GIKA 4YDXA 3TVKA 2B6AA 3TA0A 3M8ZA 1NB2A 3FSIA 1ZA1B 2POKA 3IBCB 4OX7A 3M9NB 3S7RA 2JNJA 4DF4A 2F8MA 4GVBB 2F4FA 4QJVA 4W4MA 1LFWA 4WU2A 5F3TA 3IR7B 5BYSA 3TQ1A 2YH0A 2CQDA 2Q3PA 3BN4A 3PNIA 4RO0A 3NMRA 2BE9B 2CZVC 3LWMA 3ITHA 2ZUAA 8RUCA 4DV0J 2QA1A 3J7AN 3M2UA 2HHQA 1YKWA 2AKWB 2F9JA 3OFFA 2KVIA 3HZGA 1EAYC 1TU0B 3QWUA 4ED2A 2MZRA 1QE1B 4R5PB 3PFOA 4X4UA 4EWTA 4OL8A 1C1BA 3F44A 3IMQJ 3OSPA 1NJIT 4O44A 1I51B 3M6WA 4OZ1A 5EX0A 2RDJA 3GG1A 1CVJA 3X1LB 3Q89A 1Q5VA 2MKYA 3OTCA 2FB0A 4WP9A 2F9DA 1GQEA 4HR2A 4WTYA 2QL9B 2QE5A 3SFGA 1VIXA 2C1EB 3FQKA 3TUIC 1RLCL 4C0BA 4K8RA 2VQFF 2Q79A 4DR1F 3QIPA 1FKPA 4U96A 3KTQA 2EFOA 2L48A 1Z1ZA 1VR6A 2AZ3A 3T9ZA 3Q8SB 4DL2A 2EBGA 2VG7B 4DQSA 2OAUA 1WJ9A 3DRXA 2BJDA 5ETOA 4C2MA 4P71A 1JLQA 1R0CB 2BM0A 1HNVA 3JAMY 1G3OA 2NLWA 4G1PA 2YY3A 4MFBA 3WIUA 2XC9A 5IT9Y 2QGFB 2XMWA 3CCWA 3N9UC 3CIMA 3JSMB 3AD9C 3FUYA 4CT8A 4F4WA 4NA3A 4WF9Q 4DQRA 3CCRS 2X3DA 1SH0A 3ENWA 1VC5A 4I64A 2E1RA 2R2UA 4ED5A 3DC2A 4IO1A 1IM6A 4ED7A 3HSZA 1YITS 4HEA9 1MU2B 2KXFA 4UOFA 5IXUA 1CS4A 1SUQB 1TL7B 4P10A 1V3SA 4ZK7M 2XGQA 1CULB 1X9SA 2RE1A 3R5CA 4N77A 4CLPA 1C1BB 2KM8C 3GR0A 3V4IA 2DD8S 4R5PA 4XO0A 1WEXA 1QDUB 1VBKA 2KI2A 2Z0GA 1EQMA 2AYBA 3D0GE 4NLDA 2OPRB 4ZPTR 1U45A 4HDHA 1I6JA 2AW0A 1AROP 3CF5Q 2E5JA 3ITHB 4ZPDA 2DNYA 5L9XA 5C2GA 2NR0A 1T95A 4P73A 4DPYA 1CG2A 2IRXA 2YNIA 3JTPA 3NNCA 1TAUA 2R7TA 3MR3A 3I9ZA 4RUAA 4OHVA 5DS7A 4WXOA 5KOXA 4PUOA 3NRBA 1F3VA 2O67A 4ZVHA 4OI0A 3BPDA 1YLXA 4DL3A 1TKDA 3K17A 3O1LA 2K06A 2RRBA 1ZTTA 4Y3CA 1JLGA 2QG9B 4AL5A 1NKBA 1FXRA 1TQLA 2PMHA 3A4TA 3OFHA 2R7SA 3MM9B 3QWPA 3AAWB 2W24A 2YPZA 4J9LA 1NXIA 3EVOA 5H9FJ 4ICLA 3X3UA 4OYBA 4QW9A 2QIFA 4ZVSB 1KHWA 4ELTA 1GT8A 3JSYA 1NDPA 5BJRA 2N7CA 3KK2A 2LQ9A 2UUAF 4JI3J 5D3GB 3CTRA 3ZZYA 3OXGA 1J5EJ 2W01A 1U47A 1FJ7A 1FF2A 2VFVA 4OHWA 3D6MB 3TR5A 1X4GA 4DHVA 5A0YA 2HK2A 4XPEA 2WB4A 4M95A 2V8DA 1QY7A 3RRKA 1VS3A 2IY5B 6AT1B 3MAAA 1U1PA 2H1YA 4HI2A 2FJBB 1G1XA 3E3XA 1S10A 3W1YC 1YJVA 4B02A 5J1PA 2LQ5A 4DSFA 1UAWA 4JI5F 2JFKA 1NK5A 1VQYA 4O4GA 1IXKA 1U0SA 4EMDA 4UW2A 2AQ4A 2F4VJ 1X0FA 1FRMA 2NXNA 4EYIB 1S0VA 4RWXA 1RE1B 1SXLA 2I0XA 3OL9A 3EDRB 5AJ3J 5K20B 4J37A 1DAXA 1S9GB 3TW0A 2OIHA 1CC7A 2CRLA 2WK4A 4ZVUB 4ECRA 1SJQA 2XG8A 3R5GA 3HSJA 5ETRA 3T5LA 2ROGA 4CQ1A 1K73T 2LEAA 1IKVB 2HFZA 2ZNZA 1R3NA 3IWLA 2G2ZA 2LXUA 3UDLA 1N4LA 3DRRB 2ZVIA 1UWBB 1U1MA 4M94A 5EWEA 2AF6A 1WOPA 1XNQF 2WVBA 4Y65A 4GO7X 1YG0A 1RQ0A 1RTHA 5DDOC 3QYYA 4CTAA 5HATA 3J80Y 4K0KJ 1NDLA 3C6UB 3UFCX 4GC6A 3OUYA 1OPIA 5DQHA 2VQEJ 1KLMB 3CD0A 5K14B 3V4MA 3V81B 1TUVA 1GMVA 2HEKA 4CLLA 1NZAA 2J9DE 4NASA 4ZCIA 2HHUA 4ZP9A 1R8AA 2B5JA 3T1YF 2BW2A 3KG1A 3HKWA 5E2QA 4QPTA 3SBMA 1HNWJ 2YKMB 4RJVA 2W8KA 3A13A 2HPUA 3K5PA 4LJMA 3TUPA 4UOHA 2V8VA 4DI6A 1FNMA 1BE4A 4ZMMA 2LVWA 5DZ6A 1LNQA 1OYDA 2YNFA 1IQZA 2LLZA 4X64F 1U2CA 3HHDA 5IOLA 3AHPA 2HHWA 4E98A 1GX5A 1LXJA 1SC1B 1T9VA 2KT3A 3LANA 3UNGC 1VQLS 2E44A 1FA0A 3M30B 1RT1B 4YB7A 3PR4A 3EXCX 4NX9A 2OHDA 4NLQA 1Y9OA 5IC4B 3QSYB 3PEHA 2DXEA 4ZVOB 3C16A 2H4YB 5J2MB 1HQEB 1IM4A 1K9MT 3B4DA 1XEZA 4MK9A 3M6UA 3LWLA 1ZTWA 2RS2A 1WTBA 1JX4A 3F73A 2UVUA 4PXEA 2MY7A 2AT1B 2GGPA 1HR0F 4CH1A 4QWAA 2EPIA 1T9XA 2ZC3A 3KLHB 2R2TA 4DV6F 2BYCA 2MB0B 3PG9A 2UV8A 2JDJA 4G3IA 2MZQA 2A1BA 4C9DA 4QYZJ 3MTJA 4WFXA 1AFJA 4A47A 3HHEA 1OMSA 2XHWA 4ZJQA 2KJWA 4ECTA 3OHBA 4YOEA 3LP2A 4ZIVA 8AT1B 1N33F 3EGZA 2DGQA 4ZP6A 2C2NA 3HM9A 1IKYB 1NSPA 4HHHA 3T5HA 1CJTB 1VBYA 1N5SA 1TAQA 2A6OA 3T6JA 8ATCB 2VPWB 4U6PA 4IFYB 3V81A 2FHJA 2RUSA 4JI1F 1G2EA 4PQUA 3UCZP 4DPTA 1RB0A 1XMQF 4O3NA 1AB8A 1UWAA 1QUPA 1WEZA 1WOOA 1XN9A 2HS0A 2NSBA 2PSZA 2W9BB 2A0FB 4CTAB 4NYOA 1UA0A 3H5XA 3CVKA 4DV2J 4LVNP 3MURP 1R0AA 2MJUA 3Q24A 1UWBA 2OLWA 1ACMB 2PEBA 3R7NB 5KFTA 5IFMA 4J9RA 3V6DA 3I5AA 3FEYB 2DGWA 4ZITA 4FBUA 4M5MA 1VQOS 4RUCA 4KHPF 2H48B 4CDIA 4DR4F 3DN9A 4OMFG 1CSJA 2Z56B 3DNCA 3BBCA 3N5FA 4K59A 3RYLA 4M5NA 3BO2A 3GJSB 3M9OB 3RB0A 2KKHA 3KWMA 1EIYB 1Y10A 4FF3A 3RBZA 1A6LA 1KTQA 3MZIA 1KONA 2BE2B 3A3OB 2A3JA 3NWRA 4IQMA 4KB7A 4LBIA 4ZLJA 1WELA 3G4SS 4X4NA 3P96A 4JV2A 2Y1IA 4FYYB 2QN6B 1FJCA 2E7XA 2MSSA 2N3LA 2Z2YB 2ZBRA 4DR5F 4USMA 1S97A 5A6WA 2F3JA 4EGLA 3IWNC 2DR5A 4OI3A 2FY8A 1RBOB 2O1PA 2XCAA 1RKJA 3RAQA 4M5LA 4L3KA 1XMOJ 1WC3A 2K1RA 1WKKA 2MQNA 2QLFB 3E2EA 3C6TB 2KB2A 2V5HG 3CCTA 3NMAA 1H2TZ 4I1TA 4CO4A 2W25A 4WYWA 3BYRA 5E41A 1WSRA 2DH7A 3SCJE 3EWGA 2VPYB 3MPVA 3SFUA 4CLKA 5EHHA 3CPWR 4JI7J 4P2MA 5AE2A 1F2GA 2FJDB 2P5VA 2QFIA 1H38A 2HS3A 4LF8F 3ISND 2JEJA 2GAGC 3PYDA 2W7PA 1RWMB 4M8LA 3KK2B 4UY8T 1N33J 2IAJA 4ZPWR 5KFUA 3TAMA 3DLEB 5CD4H 2V8GA 4PUOB 2ZC4A 3VAIA 3V6DB 1F9EB 5C7PA 2FVCA 1OY8A 3O6QA 4I2PA 1H3DA 4FNHA 1SJ1A 2FLLA 4K4VA 2HIQA 2L3MA 4LFCJ 4USWA 2KM8B 1U2RA 2KHDA 3D54A 2WW4A 1HR0J 2M5YA 1ITPA 3PO4A 3H5SA 5DQIA 4B9VA 3QT5A 4ED3A 4BBYA 4DL7A 3BGUA 5L1KA 4Q8FA 5IWAF 3FEZA 5KFPA 4U7UK 1HBOA 3CIZA 3NCPA 3TZZA 1X9WA 1P9QC 5JVGQ 3R9LA 4HH0A 4I6YA 4JI6F 3FGVA 1SUQA 2CNLB 4XDCA 1MLAA 2XM3A 1B4SA 3OTBA 3KLVA 1IBMJ 2OJ3A 3O3LA 1E6VA 3WDOA 3I4PA 3MFIA 1V5IB 4XTTA 1DJ0A 1ELOA 5LMUF 3BSOA 1UKUA 3MECA 4OLPA 3ZTPA 4UOGA 1RU1A 4LFBJ 1IUJA 4YDDB 5CA5A 1XMOF 2EFGA 2AX0A 2VODA 1QM9A 3PTWA 3CCVS 4L72B 4UF4A 3SCLE 4MFBB 1AYEA 1BQXA 2ABYA 2X1BA 2XZTB 5LJ5Y 5KFZA 3D2WA 5LMNF 3K5OA 4H4KC 2B4OA 3KUEA 3MMAA 1S6QA 1NUEA 3AB4B 4W98A 4A8XA 4ECSA 5DGAA 3CJQA 5F8LA 3NBPB 4NXMF 4DV2F 2WSFC 3MAHA 3CJKA 1FRXA 2AJ1A 2F8HA 4F36A 1SH2A 2DO0A 5I3UA 4YR3A 1IJFB 2MKCA 2FLNA 5F8JA 3PFEA 5B08A 3SQOP 1XMQJ 4DV3J 3UNYA 4E8UA 2CZ4A 4OI1A 2IYIA 4IDKB 4CLFA 3P3DA 3VGTA 3UR0A 3KHHA 3QIDA 1FDBA 1JB0C 5HJXA 5A2QY 3R2DJ 1PG5B 3PW4A 3HD1A 5F41A 2LFVA 3D6TB 2H65B 2RMLA 2YNFB 4WIIA 1M5KC 2YQ1A 1YX2A 1Q86T 2CKWA 3D3BJ 4ECYA 1T3OA 1SH3A 3F56A 3H20A 1M90T 2GVDB 4CH7A 4JI8J 2H5EA 4EO6A 2BJ8A 3MF5A 4OYAA 2ZOFA 1QAXA 1I3OB 2HLUA 2RSQA 3EM1A 3LP1A 1A7GE 1N34F 1RAGB 3J7YI 5E33A 2HGNA 4LRBA 1X4EA 4TXSA 3UN3A 4DDFA 1LW0A 1OQ6A 2GW8A 1MN7A 2UVWA 1EX8A 3W9JA 4KTQA 3PKMA 2VASA 3OBIA 5U47A 3W63A 2XYGB 3VQTA 5G0RA 3TUZC 2KU7A 1YJRA 1VC0A 2UUCF 1S77D 2CQIA 2LA6A 3RBEA 3MR2A 1S6PA 3DLBA 5KFVA 3QATA 1NSAA 2XLJA 2FJXA 1U24A 3C2PA 1RT3B 3FMWA 3ZTOA 1JXVA 2GC8A 5D4NA 1JJ4A 4CLYA 2VHGA 1N56A 3UE2A 1F9FA 5HI7A 4KFBB 3T5JA 1EP4A 2AD9A 2EVZA 5D6GA 3WZ0A 3DM2B 3KMQA 1X9MA 1JJ2R 2CPYA 4QWBA 2ASJA 4C8MA 2FPHX 4CO5A 3HF5A 5I3PA 1U1LA 1Q79A 2AJ0A 3GIMA 4DXLA 3M2VA 1N5YB 2IJFA 1UPPA 4ZHRA 2E5LF 1FO1A 1VK8A 1RADB 1VISA 3BB5A 4ZOSA 1JLBB 5B0DA 2V2VA 6FD1A 1S4EA 3KK3A 1IBLF 3ELHA 4OZJA 3AJ1A 4OX9J 3R5AA 5FD1A 4DL5A 4FP9A 2JX2A 3I55S 4YHHF 3T41A 1ZPWX 2HHHJ 2XS7A 1U1KA 4GKJJ 5E3PA 3D9BA 1UFKA 1UZHA 2E7VA 4CLZA 3ILIA 1C0TB 3EGWB 3FVYA 1RLDA 4LBPA 1D0EA 1P6TA 1WC0A 1XR7A 4UZBA 2LU1A 3FK4A 4M5HA 4PPZA 4CLUA 4H4MA 2C28A 3HHLD 3ZZOA 4K4XA 3AOAA 3KLIB 2BQRA 4CWBA 4WFZA 4USUA 2HSEB 4ZHRB 2R8JA 4OJGA 1NB7A 2HNYA 5AT1B 2DGOA 2OGUA 2XO7A 4W92B 2CFXA 1HWLA 3J81Y 4N76A 2FLOA 4WZMA 4ZLNA 4MKAA 1TUGB 1UEKA 3HI9A 4A8OA 3KJNB 2HWTA 2NZ4A 3BJYA 4EEYA 4LRDA 1BWVA 5HVFA 4M63A 1S9FA 5F0WA 3HVRA 2VBWA 1S79A 2LDYA 3LPYA 4PEOA 2YNIB 1BGXT 4QIGA 4TY9A 3QRRA 4ETZA 2QRRA 4ZDNA 2R2RA 4DV7J 4KO0B 2KO1A 3NGKA 3MEEB 2E9TA 2GQ2A 4NCGA 5CYQA 1HMVA 3V2UC 1CJVA 1NEEA 2HK3A 2WOMB 3D5MA 2HBRB 4HACB 2NXUA 2XNRA 7AT1B 3W8GA 3DRYA 4Q5VA 1Y00A 2BR0A 2FLPA 5A8RA 3KDNA 2JVOA 2EC2A 1TL7A 4QW8A 2HQCA 4CNYA 1BXNA 2CPHA 2CQBA 2IC3B 3CDWA 3PYEA 3QRQA 2V50A 2ZKUA 4DSJA 1MROB 3PHTA 1BWEA 2PFFB 3HHLC 3DXBA 5IC6B 3CWJA 3SDEA 1RWPB 1DBDA 4OI4A 4Q44A 2ZJPQ 4DZ6A 2Y1LB 1CC8A 1WHYA 2Q6CA 2FD2A 3MM7B 4HL9A 5MAOA 1NKEA 1UW9A 4EZ9A 2FQQB 2B4VA 2ALZA 4C48A 4V19J 2V9WA 2QA4S 3EPIA 2ZJQQ 1HL6A 4Y28C 3GFHA 5DO2A 1VQKS 3GYXB 3MM8A 3W66A 5B0EA 4Z7CA 2VKZG 1U7LA 1O8BA 2AYEA 2ASYA 2DNHA 3R7BB 3UDVA 4ZVPB 5I3QA 2YWWA 3V5RA 3POTA 4J5OA 3OQ2A 4J7CA 2E9RX 2CNKB 5E0OA 1CEZA 2XWYA 3C14B 5E3QA 5D4OA 2P6SA 3SV3A 4QU7A 1S0NA 3E51A 4WK1A 1RT1A 3MCSA 2RH3A 3HJFA 1RCXB 3W5XA 1FEHA 4ZN3A 2DNPA 3ILOA 3BO4A 2W9AA 4DR6F 3G8TA 3PW5A 2FHMA 2XQCA 2V9KA 3UDCA 1WSVA 4ANDA 4C98A 1LWXA 3K5LA 3JB9k 1HBUB 3H2VE 2GVZB 1U09A 4KPCA 3NY0A 2ZHBA 1A0OB 4DR6J 1K0TA 3H5UA 3IGVA 1SC3B 1YK9A 4B3TF 4C8OA 4B3SF 3FRZA 4HYKA 1OS5A 2ZBPA 1UA1A 4LF6J 2YQ0A 3VAJA 1Y7PA 2GCFA 1ZS6A 3T3FA 1HBOB 3GFZA 1TV6B 3TJ9A 2MKJA 3DLGB 1IR2A 3W62A 4CO1A 3KNGA 4OHZA 4YQWA 2L9NA 2NYHA 4NEZA 2CNNB 2NXCA 4FXWA 1RA6A 5IT4A 3D28A 3NCRA 4F02A 1OYEA 1C2PA 4CYUB 3LGMA 2XY7A 1RBLA 1TKTB 2M3DA 2OSRA 3MEEA 1FKOA 1H72C 2RT3A 5G4DA 1DQ9A 1LOUA 4DCPB 2OKQA 2E1MC 2W9CA 1VQNS 1U1NA 2QLBB 3R1LA 1IKVA 2IAJB 2PE8A 2RKIA 3UR3C 3G6XA 1DTQB 2VONA 5J2NA 2I5JB 3HSDA 2M7SA 1S9GA 2DNOA 3ZNUA 3BZQA 4F3QA 5KFCA 4GRSA 5IM0B 1WD6A 2AEJA 4RUBA 5F8MA 2H4WB 3LA0A 3KK1B 3P6YC 1M1HA 2CZ9A 4MMOA 2B9XA 1Q78A 3U1MA 4F25A 2AP6A 3M05A 1FXDA 3CDUA 2W4DA 4PXBA 2P9CA 2RQCA 5L1LA 3FSYA 3MXHP 1LQ9A 1GXTA 3LUYA 4H4MB 4HTJA 1H7XA 1U1QA 1LKZA 5LMNJ 5K9FA 4ZLPA 5IT9U 1N0VC 3M8PA 4X64J 3TRGA 1D8YA 2DNGA 3PV8A 3VHQA 5T7LB 3QAEA 4ECWA 5F8GA 1RJJA 5ETKA 3GG0A 5KTQA 3V6HA 4Z37A 1ZBTA 5ETSA 1S1TB 3FC9A 2QMXA 4DR5J 3QJPA 4OX8A 2PD1A 2UU9F 2CVEA 2D3ZA 4EBEA 1MSWD 1RTJA 3FQLA 2EKNA 4Z7YA 1IBMF 3R6GB 3BSNA 3T1HJ 2KFNA 1H98A 3HKZD 1HQUB 3ZZPA 2DR7A 1A9NB 2MZTA 2XHCA 2L9WA 3VGSA 4Q2MA 2Z8QA 1RAIB 1WWHA 2F40A 3KG4A 1KVIA 1HNXF 3VTIA 4NE9C 2COLA 5IS2A 1YJNS 3CD5A 2W4PA 1FFWB 2NUHA 2PFDA 3IS9B 1S7IA 4OYPA 3ZZRA 1HI0P 4NMXA 4KFBA 2DRDA 2Z57B 3VZHA 2AX1A 1TMMA 5FDLB 3HPOA 1NJYA 1L3SA 4LIWA 3OD2A 4KBIA 3DRSA 4A8KA 1FKOB 1S1WB 1HWKA 3ICLA 3D0HE 2Z2ZA 2KYXA 3NKYA 3QMQA 4OX6A 3IP0A 2IRUA 4USKA 5BYRA 5C24A 4X4TA 3GILA 2FHKA 2B9WA 1NNDA 1R8HA 4YHHJ 4DR3J 4NXNJ 2WHOA 1KC8T 2P9EA 2C2MB 1C1CA 3Q8UA 3I0RB 1RTDA 4B17A 2FIUA 1PIEA 2YPYA 3T1YJ 3L3CA 4PG5A 3TYTA 2CJBA 2RU9A 1S99A 4RBUA 1CULA 3VAFA 3VAGA 1R6YA 1IKYA 3GYNA 4FXVA 2O66A 4PXCA 3J81j 2MGZA 4I0WA 5CQGA 3NGDA 3K0JA 3W64A 4CO0A 1RCOB 4O3PA 4DUTA 1LEOA 2HAFA 3LP2B 1UVJA 2DHGA 1J5OB 1M1KT 2B43A 4EUVA 4EFAC 3PX6A 1YI2S 3GJRB 4UZCA 4KY3A 2EI5A 3JSMA 1TELA 1VQSA 4FPRA 5KG7A 1KNZA 1UVLA 4IRKA 1GXUA 5JUMA 3MPUB 1HNVB 2HNDB 1VQMS 5IV4A 1XJWB 3G6YA 3DCAA 3H7HB 1F5AA 2ZH9A 2HHVA 2PC6A 3AOCA 5D15A 4NMLA 3VV2B 2XO6A 1WNEA 3I5BA 4RW9B 3CCLS 4IO9Q 1CJUA 2C3PA 4MYUA 1HPZA 2UUCJ 1VFJA 2VPZB 2O5DA 3OVBA 4P2FA 5DLFA 4MKYA 4WP8A 3H25A 4NWBA 1VI7A 2DNKA 2QL5B 1RWNB 2RDDA 2RB7A 3UQSA 5AXNA 2GO8A 1S6QB 3DDIA 1UL3A 2QJ3A 2HNDA 2SXLA 1M0SA 2VFSA 1ZM3A 1ZM4A 1IJEB 2DYAA 4LSZB 3GU0A 4WE1A 4X66J 4RNNA 2BEFA 3KMSA 5B09A 2ADCA 1FX2A 2UUTA 3CB4A 4F2RA 1FK9B 1VLOA 3BKUA 2RILA 1TVRA 3QGGA 2DGXA 3R3TA 4ECZA 1HMVB 4AL7A 3ZTQA 5I42A 4M5KA 2FVQA 1TK5A 2HQGA 2BW7A 2HBZB 3HVWA 1S48A 3I4HX 3N6LA 4YB5A 2B51A 1B0TA 2GJ2A 4F0KA 3SSQA 2G2YA 2YX4A 4CLSA 4USIA 3TA1A 4JBCA 3ZZTA 1KHVA 5HLFA 1M5OC 2W2QP 3Q8YA 2BACA 2YBVA 5IV3A 3PM9A 4KGZB 4Y6IA 4Q45A 5CZXA 3RG6A 1Q8LA 2FGCA 3NOCA 2YKAA 3A12A 3RBXA 5KFGA 2IHR1 3QLHA 2OP5A 2V6AA 3M4XA 4QYRA 5LSLA 4S0MA 4IR9A 3ZZ0A 3RGIA 2ZUGA 3I82A 3KHGA 2IJRA 2V4QA 2B8PA 4RUHA 2KH9A 2B8QA 1HIYA 3RJMB 2ROPA 5LMUJ 5D77A 3IS9A 4ZVTB 1ZPVA 5B0FA 1APSA 4B9MA 4I69A 3H40A 5L9NA 1JLAB 3TZWA 4U8VA 5EDWA 2WRMA 4J9NA 1HBMA 1Q7LB 5DZ7A 3K8WA 2MZSA 4WFNQ 2V8PA 2ACMA 2L08A 3KLIA 3UN5A 4DR3F 1RT7A 4RW4B 4K4YA 1NK7A 2D69A 4OZ2A 1JLFB 4NA2A 3EMTA 3VVUA 4ZKAA 1PAUB 1KEKA 3OSNA 2DVIA 1DZ5A 5K8MA 2IPOB 1NPRA 1TZ0A 2ZOGA 4RW8B 3QZ7A 2WVDA 3DGPA 4IG0B 2EFPA 2K1RB 3WBZA 4TLQA 2JEFA 2QA2A 1LW2A 2FYXA 3BBFA 2DH8A 3GPAA 3MGJA 5ETMA 2KRRA 3AJ2A 3VAMA 2V0NA 2ZWOA 1JLAA 3CE8A 2DHSA 3ETOA 4DV3F 3M8PB 1SKSA 2E1CA 1WC4A 1X4DA 1RT4B 4JYAF 3GFXA 5DGBA 1F0XA 2Z30B 1X60A 3KK3B 4MAKA 3CT9A 2OPSB 3HSGA 5CYJA 5EN1A 2HVZA 1OSCA 2V2QA 4V1Ak 5E5NA 3Q8QB 4I67A 3DRPA 1BUXA 3IA0A 4DJBA 1S59A 1FRJA 2B56A 3RB6A 1FRIA 2GZOA 4B9NA 1MMNA 4A8FA 1KQSR 5HP1A 2B4UA 2HVDA 1VGYA 5C2CA 4LFBF 2WB1D 1S6PB 2GMHA 3BS9A 3HX9A 1HNZJ 3ZZUA 2M8HA 1UJ6A 2C3OA 2RKIB 3IR6B 1NKCA 2UXBJ 2AHOB 1KN6A 4QIVA 3LOUA 5JJBA 1S1UA 2F5GA 2QT7A 2PEHA 3FBBA 5KFIA 4MKBA 3BR8A 3DLKA 1X4CA 2NSCA 3HLUA 3KJQB 3WHIA 5LSRA 4E0DA 1RHJB 2DXFA 1R6VA 1TL3B 2FC8A 3HJVA 3JSBA 2IMWP 2VA2A 1FE4A 1J27A 4WE1B 3UCGA 5A6PA 3HT3A 1RT5A 1Y11A 4B3MF 1TV6A 3HCXA 2BKPA 1YZ6A 1N5TA 1T0TV 4C7QA 1WACA 1MU2A 1JIHA 2VFUA 2M2BA 4O0NA 1H74A 4F0MA 5KFAA 4NLYA 1IKWA 1X5PA 1F9HA 2Y9HA 3UD5A 4KHPJ 4M5IA 2R7OA 3WQPA 4L3NA 3CEDA 4PR6A 2DISA 1FD8A 1LWEA 1KOOA 1SQGA 2CDQA 4F7VA 1CJUB 3P45B 3AT1B 3GIRA 3GJQB 5H1SV 1VQ4S 2ZH1A 2H51B 1RAFB 4J9OA 1Y0HA 2FZKB 3D4JA 4TQSA 3KLHA 4ZIWA 2ZBCA 1RGVA 2Z2MA 2HVEA 3LAKA 2X51A 1HQ2A 1X4FA 1W2IA 4DCJB 1RK8A 2MZJA 2Z2LA 5DDQC 3BQ0A 1SCJB 4ECVA 1U49A 4JI0F 3JS9A 4MT1A 4I7FA 1F5BA 5E3RA 1FKPB 1F6TA 1PCAA 4X62F 4RNOA 4DQPA 1SIWB 1WF2A 2BJ7A 4NLSA 2RAQA 2XMUA 5A8KA 1QD1A 1WEYA 1T05B 3K5NA 4NXNF 5H9FK 4DR2F 4LBHA 1U8SA 2YQ3A 3N01A 2X1GA 4USTA 3M30A 3VR1A 2CPXA 3LAMA 1SJ4P 1FNXH 3IG1B 4P75A 4O44B 1RWVB 1XQIA 4QZVB 3WX4A 1AFIA 1KVKA 5GAEU 3MECB 3FCWA 3P8BB 3PY8A 3E01A 3NGSA 5KFRA 4H4OA 1S49A 2CVIA 3CW2C 4DV6J 2BQUA 5CXTA 3BF4A 3ETMA 4J9QA 4RW9A 2W7AA 4USVA 2DJWA 3I0SB 1D3WA 1N52B 3DOMB 1FWPA 1RHQB 4DL4A 2DR8A 2D41A 2DHAA 4LF6F 4D3GA 2IVMA 2B5JB 1O6XA 2BJ9A 2V4JA 5A8RB 4MH8A 4RZRA 2RQMA 3TAQA 1S1VA 2WVEA 2YX7A 1VQ7S 2DNZA 3D1OA 5K14A 4PWUA 2E9ZA 4WU3A 2DXDA 4J9VA 5L39A 4PPDA 5AXMA 3MTKA 4C11A 2ASDA 1SKWA 3R2CJ 1BQMB 1IWAA 2EK1A 3N5BA 4KGVB 3JYTA 4O3RA 3MM5A 1LV5A 2XLKA 1J5OA 4BLGA 4PABA 3L95X 2VFTA 4F4YA 3GMGA 3HDSA 4AYBD 3A8JA 4E2FB 3DRRA 2YH1A 3WIVA 2HGLA 1UJ5A 3C46A 5KOWA 2E66A 3EZOA 3GQCA 2XMJA 2FHJD 1PGZA 1RYSA 4TYBA 2VB6A 3DFEA 1L3KA 4KPYA 1FESA 3VZIA 4TVAB 3PVXA 4A8QA 2KG1A 1M5PC 5KG6A 3H98A 4TY8B 3SEOA 1D1UA 1SL0A 2NPFA 5KFDA 3DYAA 4USHA 2VUGA 1F2HA 3OTDA 3M9MB 3DOLA 5I4MA 3DRSB 3MUTP 4LIRA 4BWMA 1KQGB 3C6TA 3PJ9A 5GADI 1NCLA 4B3TJ 4ER8A 2XS2A 2HBYB 5CCMA 1QVFR 3FEXB 4ANCA 3QPIA 5ETVA 1MWYA 2JHEA 2VG5A 2ZNYA 2FVSA 1CLFA 1NZ8A 4PWDA 1WHWA 2HAIA 2WBRA 5HQLA 4AL6A 2E5GA 3HHLB 1HYSB 3O8WA 1Q53A 2M4MA 2HKEA 1XC9A 3CCUS 4B3OB 4PWWA 2DHXA 3U02A 1JXLA 2GJIA 1DTQA 4C97A 3CXCR 5BR8F 3CCQS 2BRKA 4RW7A 2ZD1B 4I6WA 4ZN1A 3A8EA 4NLOA 2ZH3A 1VQ9S 4WYLA 4PYAA 3UI3A 1R0AB 1X31C 2ACYA 1Q8KA 4BC7A 2R7XA 2U2FA 2AWZA 3ISZA 3NAHA 3OFGA 3HHLA 3MM5B 4UT4A 1MNEA 4AUKA 3JYTB 5L1IA 4DLGA 1HYSA 2NYIA 3OL8A 2RNEA 5SZTA 4ECXA 2VL1A 1RDRA 4C6AA 3M1VA 1XNRF 1UEUA 2VOOA 3I87A 3DGVA 3IFEA 5J2PA 4OX9F 2V2ZA 4GVLA 3AQPA 2LCWA 3OR2A 1D8ZA 4DV1J 3EE3A 2KDOA 3DYAB 2WTFA 1T7PA 1NH8A 3TANA 1AUSL 1GTEA 3DOKB 3MMBA 3RU0A 2AYGA 1WTFA 1KQKA 5JXSA 3DDKA 4BHQA 2PN6A 4A4JA 2KYZA 2IM2A 1TK8A 4AQYJ 4RNMA 1TP7A 4MK8A 3P5TL 4MIWA 3CC2S 2BOAA 4YY3J 3Q0AA 2Z4PA 1K1SA 1LW0B 4ZCKA 2MLZA 3MPDA 4R0EA 2UVRA 1KR4A 1FTRA 1YZ7A 2AGPA 2EFNA 4OHXA 4RBVA 1DQ8A 2GGPB 5D4PA 4JI8F 3RW7A 5DDPC 1QSYA 2XI3A 2A10A 3M6VA 1FRKA 1GAOA 1PYSB 1UZDA 1TL4A 1BQMA 3G96A 2OFGX 2AJ4A 3O2IA 3ZXWA 5IZHA 1AUDA 1JNRB 2J6SA 1RHRB 3QAUA 4OZ5A 5KG3A 5HBMA 1REGX 4B3RF 1T9TA 4ZVGA 3DLGA 3K8VA 1RYRA 5AXKA 1IN0A 2MQOA 2HVIA 1YJ9S 1JLQB 1NBEB 4G6VB 4WFAQ 4OV6A 5KT3A 5MLCV 3J7YU 5ADZA 1V5VA 5HSPA 2Y1RI 4WFYA 2WZ1A 4I2QB 5J2MA 2BXJA 2A18A 3B78A 3H59A 2CWXA 2BJEA 4ECUA 4LMZA 1DURA 1OQ3A 3E01B 2PDAA 2CYYA 3CC4S 3W2WA 4ED8A 2F4VF 3FNNA 3GYGA 3R27A 4G65A 3UCUP 1WI6A 3MMAB 4DG1A 2RVJA 5JMNA 1XERA 2BANB 3VGUA 4RW6A 1FKAF 4B9TA 1VRTA 3BGOP 3MWBA 4TU7A 3DLJA 4ECQA 3AD7C 2ZM6J 4DSEA 4QR2A 5D0EA 3LF0A 1PC4A 5T41A 4C8NA 1B64A 2J0XA 1KLMA 2JVRA 2M70A 3IBWA 4NLVA 1ZZFA 5FIIA 3OUYB 2LDIA 4BDPA 1NSQA 4HKQA 4WZQA 2ZITA 2W7OA 2R8GA 5KFHA 1Q7YT 2ZZNA 4KRWA 3BH6B 3UD3P 4DX8H 3QGPA 4ID5A 2IA0A 5GMDA 4FYDA 4A48A 1QTNB 5HL7Q 4B9SA 3P5BP 1XR5A 3OR1A 4FS1A 3AJDA 4O23A 4KH0B 1LWEB 4NZ6A 1F3FA 3BEGB 3HD2A 1U6ZA 4YR0A 1BD6A 2HS4A 2C2KB 1IKWB 4L76A 3RR7A 4K5SA 1U8WA 1U02A 4IOCQ 1RZMA 1S57A 1T02A 3GJTB 3IR5B 3R7SB 4Q43A 3KXDA 3NP5A 3DLEA 1RWWB 1DY3A 4JI2F 2PI4A 4GMKA 2OO4A 1WI8A 1ZM2A 2CAJA 3M8WA 4RX6A 2QA4G 5IQ6A 4O3SA 2ZJRQ 3SZ2A 1RISA 2FJAB 1YHQS 4YFUA 1CJVB 4HACA 4C8LA 4USJC 2R9LA 2HVHA 2EEYA 3SSSA 4RR5A 3KKFA 2PMZD 4CH0S 2XSFA 2NCKL 4J9KA 2QFJA 5EUHA 4DFKA 3W61A 2XSJB 2YKNA 3FFIB 3SIPB 3W5YA 5LJ3Y 3MAAB 4FF1A 4PRFA 3ET6B 3QO9A 3K58A 4QU6A 4ZJOA 2UXCJ 4P2SA 2HQDA 2XSJA 1P1LA 1LWFB 2YKNB 3FFIA 2KT5A 2CWKA 2X1AA 1GFWB 4P74A 4J9PA 2ZH5A 3I9V9 3PRVA 2LXIA 1QAIA 2J9EA 4PAAA 2PI5A 3AD8C 2CPZA 1WOSA 1WDDA 4ZPVR 1HD1A 1JLGB 2HQIA 1QAYA 1YSJA 2ILYA 2CQ1A 4DR1J 3DM2A 1KRPA 4LFAJ 1S4FA 2DR9A 3UPFA 1FHTA 3S8SA 1JLEA 1YRXA 1WG4A 3MM9A 5BXIA 4NLRA 5IWAJ 1J2VA 2DTJA 3SQGA 3KYLA 1NO8A 2CQCA 5ETNA 3LGHA 2VPXB 5A8WA 4DUYF 1FRHA 1SQEA 3US5A 2XGPA 3QGIA 2R4FA 1YTYA 2OH2A 1PYOB 2OPRA 3PEJA 2DEJA 3KFWX 2YXLA 1VRQC 5RUBA 3RB3A 2YWHA 5A2QU 2UUBJ 1SV5B 3I6PA 4URSA 4ZVEA 2IMOA 1KOHA 1Q16B 2FDNA 4RW8A 2HHPA 3QBCA 2P6TA 5B0GA 4A8YA 5GMKa 1UP1A 4TN2A 4RLEA 4IRDA 3ENVA 1DQAA 3HVTA 1CS4B 4LF7F 3NS5A 1SQFA 1R8PA 1T94A 1N48A 3I5CA 1XBWA 3FJ2A 4IQXA 3BYPA 1NDKA 3MPWA 3QNWB 4NLTA 1NJWA 4NCBA 4QR0A 5F9NA 1PJ6A 2FTRA 3CJ3A 2MPUA 4KGKA 2C2DA 1B99A 1HA1A 4NCAA 2OMLA 4IYQA 2C2ZB 4CLTA 2LA4A 2R42A 3CJ4A 3G82A 2N3OA 1RT6A 3OXFA 3IM9A 3ZFVA 1E6YA 4LREA 4JOUA 5HMYA 1CJTA 5J1EB 2AEMA 4FZVA 2ALYB 1FJGF 1XWLA 2NS1B 3UWTA 2I6WA 1FDAA 2B0GA 4XAKA 4PQAA 3U1LA 1UEVA 4OYMA 4OV1A 4LF5J 2MYFA 1N0UA 1RWOB 5HLFB 2VV5A 1HNIB 1Z4UA 2MXYA 5L46A 2AGQA 2DRAA 1FEEA 1I5OB 1O51A 2V68A 2H5IB 3PRDA 4NYPA 3M7VA 1TL1B 1WKLA 3FCVA 2IM0A 3PACA 5KFJA 3TJAA 4CIOA 2GO9A 4RBTA 4LRFA 4OIXA 1NDCA 5I42B 1F5CA 3MFHA 3RR8A 2DNMA 3HK2A 3Q22A 2BJ1A 1UFLA 2O01C 4MYTA 4ATNA 4ZVRB 1ZZNA 2JWNA 3Q2TC 2EKYA 2J0WA 4OZNA 3GIIA 4QWEA 3HXMA 2ATCB 3A3PB 2XMVA 4YY3F 2HZVA 2XB2D 5ETLA 3OL6A 4Y2KA 3FBFA 4IOBA 5HMZA 1R0BG 4AQYF 3DMJB 4DS4A 3PW0A 4ZP8A 1K44A 4OJHA 3DLLQ 3W2VB 3QFWA 3OLBA 2V63A 1VDHA 3B54A 3CDAA 1KQFB 4ALZA 2QEXS 1JWWA 2DGSA 2IBOA 4MJKA 1HPZB 4P72A 2YNHB 4WKYA 2XYHB 3RUBL 2R8IA 4B3SJ 4JI4J 1KSPA 1Q0NA 3CJKB 1EJ7L 4ID8A 1FT8A 2FVRA 1CJKA 3QGHA 5KG4A 3K57A 4ZLLA 4DV7F 1SB6A 3PHEA 1H2VZ 2G0JA 2HURA 3HHNB 4NXMJ 2HMIA 2VOPA 2HFUA 2DB1A 2GIRA 3LH2S 3TZYA 4F4KA 3UN2A 2DBBA 2Q1LA 2CG8A 2NZCA 1LK5A 2NUUG 3MI7X 3OPKA 3NGRA 4HHJA 4P7VA 3GB0A 4UOCA 2KT2A 3Q8PB 3TWZA 4F50A 5LM7E 4KGXB 5KFQA 1Y5LB 2G0IA 2LU2A 1N5VA 3VVTA 4CZCA 2XCPA 1I94F 1SKUB 2NXEA 1VBZA 1FNOA 3BH7B 2ZBIA 2MTLA 4QQBA 5C25A 3MUVP 2J0SD 3TO8A 1T9UA 1K8AT 4WJBA 2C2OB 3CJ8A 5ETTA 3GZ7A 1HNWF 1AZSA 1T03A 4FYXB 2K2PA 3H90A 7FDRA 3L09A 4ES2A 1SV5A 3D0IE 3H2LA 3I0RA 3RTVA 2K3KA 4NRTA 2CQ0A 3BSAA 2GS8A 2FJWA 2UUBF 4DR7F 5T7LA 4RU9A 1S9EB 3HHKA 4A8MP 3MD3A 1KBRA 2OEJA 3HFVA 5AE1A 3QJLA 2OD4A 2BM1A 4J9MA 4I4BA 5CAAA 3KJVB 2RF2B 2APOA 3CCZA 1YRUA 2MLXA 1XK8A 2YTCA 3GR1A 3VF0B 4AFFA 4F8RA 1VQPS 1S1XA 2JC0A 4X4PA 2KXNB 2NXJA 2PO4A 2ZBQA 2BE2A 1RAOA 3KHLA 5C42B 2V2KA 2HLTA 4KQZA 4TY8A 2PT0A 1ZAXA 3UDEA 5KT7A 5JVHQ 1NMEB 1OPZA 5KFWA 1X4AA 2MKIA 1M5HA 2OPPB 1G6BA 2QX0A 3D7SB 3IC1A 3BDEA 4IFVA 4JB8B 3T19A 4UUWA 2ZFHA 4LQ9A 4ICLB 5KFXA 2FZCB 2ZM6F 3CJ5A 2LYVA 1KP6A 3MOJB 1Y5IB 3AY0A 3R5DA 1SVDA 1X5OA 2D9PA 3I96A 1HHSA 3TEHB 3JXOA 5C42A 3NLCA 1FDNA 4QIEA 4IH7A 2BE7D 4CYUA 4K4ZA 4CO2A 2XTJP 4F3MA 1GMUA 2YX1A 1M1GA 3ILJA 4PG7A 4YS2A 5L38A 2R7WA 4L73A 4JI6J 3CJ2A 3MUMP 1FFGB 3CCES 2CA9A 1YJUA 1Z2ZA 3SSRA 4DL0C 3DU5A 3K89A 2B3TB 5GAGU 4FNIA 1JJCB 4OJ1A 2VD3A 4IUFA 4BCAA 1YVFA 2EG1A 1YIJS 2J8SA 4DEZA 3TP2A 2ZH6A 2DY9A 3TOQA 1NK0A 2RRAA 1UVIA 3G2XA 4H4OB 4XK8C 2BDPA 1JQGA 4JI5J 3V6JA 3N0VA 3PJXA 3BQ1A 3DU6A 1JKHA 5F0UA 1Q8IA 1W7WA 2CIMA 3MM6B 2IRYA 4L74A 4OYOA 4KV8A 1DRZA 2M52A 3KLEB 2V4RA 3MMJA 2ZH7A 4DR2J 2P2CB 2B9EA 4X4RA 1OIAA 4IG3A 1IBKJ 3UW1A 2QZ8A 1D9AA 1R7IA 2B9YA 2HMIB 1X0PA 5B0AA 1H7WA 4P9SA 3NGTA 1TKTA 4LF8J 4P2XA 1FERA 3H4DA 3CCSS 4Q2LA 3IAS9 3T1AA 1HQEA 4C11B 4JV1A 2JC1A 3K2YA 1IKXB 4JV0A 2QLWA 4I7FB 4IFYA 2E1PA 5CABA 4RU2A 1BC6A 5KFSA 2DIUA 4ED0A 3PZPA 1EQ0A 1NSKL 2HNZA 2BJ3A 2HQ3A 1U25A 4WBFA 3N4WA 3DI6A 4ETXA 2EW9A 3N79A 2KFZA 2F7VA 1GEHA 2FGOA 2LQ8A 3TA2A 3ISNC 4DG1B 3ENQA 4M1KA 2R8KA 2MLYA 4DN0A 2YNHA 3G86A 4KT0C 3MM7A 2OFHX 4LSLB 3D6HB 1NK6A 4L75A 1FX4A 2WAQD 3CDBA 4K4SA 3TVZA 4ED4A 5GAEI 1HBUA 2ILZA 3OL7A 2XLIA 3IWXA 3KLGB 3MDFA 1IWGA 1PJ5A 4ZPCA 5J2QA 3M2RB 1NH7A 2YVSA 4K2JA 5SUHA 2BQ3A 1GK8A 4CCHA 1RT5B 3T9NA 5BR8J 3C14A 1B7YB 3MR6A 3NS6A 3OHAA 1VC6A 3JQMA 5HN0A 2DIVA 2V69A 3EUNA 4DPOA 4GKKF 2WOMA 3EXYA 3THPA 1MMLA 3IO1A 4C0OC 5B0CA 4Q0BA 3T1HF 4N8NA 3SXLA 1G7CB 2OUGA 4MIAA 3R97A 5EGYA 1VBXA 1K47A 1MW7A 2WSEC 5KFLA 4NLGA 2XZDB 1ZETA 1KD1T 2OI2A 2DCLA 1GMWA 2Z58B 3G82B 1RTZA 1OO0B 3K59A 3HZEA 3N6MA 1V3ZA 4FYVB 2AV5A 3CGIA 3TAPA 4JI1J 4FVMA 4DFJA 5HP1B 1LFPA 2AMCB 1U4BA 3NL0A 4QIFA 3BKFA 1EKSA 1UCNA 1MROA 2VBXA 4KE5A 4KKOA 5L8RC 3QZ8A 4JI0J 1MG7A 6FDRA 2G1HA 4LT6A 4IOAQ 1DFDA 3D68A 4R25A 5D8HB 4ZCMA 5B7WA 2HWIA 1BQNB 2J9DA 4YR2A 4N7TA 2Y8YA 3BM7A 1UVKA 2DY1A 1S6OA 1NK9A 2YWGA 3EPGA 1PO6A 4GC7A 2Y8WA 4ILMA 2J7UA 5GADU 5EWGA 3TJ8A 4EI2A 3GV8B 4N5SA 2ROEA 3BDPA 2F1FA 1NHVA 3Q2SC 4ELVA 3GCWP 5A0YB 1RABB 2BVZA 1C0TA 3NCQA 4LUBA 5DG8A 4U7CA 4Y2CA 4NCGB 4DPXA 4YB1P 4C4WA 1WG5A 4LF9J 3M8QB 1RWUA 2LMIA 4NI2A 1BLUA 3GCXP 4BS2A 4X4OA 2KZZA 5FJ4A 1GXLA 1VLYA 3EZUA 3IBFB 3SQGB 2ZD1A 3OJUA 3IRWP 4RW7B 1J5EF 2HHHF 3IM8A 1WHXA 2IM3A 1HHQA 2JRSA 1JLEB 5HO4A 2WCXA 4FKXA 2OPPA 4FKYA 4IFVB 2DNLA 4ZJLA 4O3OA 3MMCB 3BGLA 1X4BA 1NHUA 3C15A 1HBMB 2Q43A 1WF1A 2Q6BA 4KGMA 4OJ3A 3JAMU 1NJZA 3PX0A 1PJ7A 3NWGA 4TU9A 2HYIB 2CJKA 3P49B 3TX0A 3DRPB 1YJTA 2BKNA 4U95A 5L1JA 1VRUA 3MMCA 2W8LA 2YWKA 1ULRA 1XMBA 4OFZA 2PA3A 4I56A 2YWEA 3RW6A 4F4AA 4YMEA 2RF2A 2JLFA 1N88A 2BKOA 5F8IA 5DDRC 4NYZA 1HBNB 2UXDJ 4URQU 4CLWA 2UUWA 4QR1A 1S0MA 3MEDB 4UTGA 1XR6A 3W5ZA 3RZAA 2E5IA 2KVQE 4XDDA 1ZA2B 2RUGA 3B8HA 2GMLA 3Q86A 3FCHA 3AOBA 1KDNA 4KR0B 4WPAA 3DGPB 4IG0A 3VCDA 1KWMA 2QYCA 2DR6A 3ZNJ1 1FTCA 2PMWA 5KG5A 2BUNA 2IYGA 3EVMA 4J91A 1SL1A 1C0UA 2CJYB 4RL1A 4YEAA 3W7BA 1HI8A 2UUAJ 1VJWA 5C25B 2IDLA 1REVB 2NPIA 2QTWA 3N6NA 5M2UA 3TI0A 5LL6d 4LF4J 2VF3A 2CQ3A 3GFYA 2MQLA 5KG1A 2ZVSA 1TVRB 1O0PA 1Y3JA 2M0GB 4K0KF 2J7WA 3FSXA 3KHRA 2GHVC 3QFHA 4DN9A 1H6KX 1Y4ZB 2LXFA 3R8YA 4P6QA 4RNHA 2O3DA 2HGMA 1K1QA 4N8OA 3NXZA 1DLOB 2RDIA 5HVHA 5LT5A 2HFNA 1TKXA 2VDIA 4QYZK 3N28A 2RQ4A 2VZ9A 3KJFB 1JJHA 1D9FA 1RT3A 4K4WA 2F8EX 1X4HA 1RHMB 2KN4A 3V6KA 5KFEA 2CQ4A 3MR5A 2D3OR 2ZH2A 4W90B 2K7JA 2XI2A 1U1OA 2DEIA 1HI1A 2XZWA 2GQQA 4L6V3 5HMXA 4NLXA 1H2UX 1HARA 3GONA 2WW8A 3Q8VA 5K8OA 1QTMA 3PXGa 1P27B 3ZZZA 3K5MA 2AJFE 2NQPA 3W2VA 5DG7A 3PKYA 2MQ8A 2KL8A 4KH1B 2CPEA 2FZGB 3UO0A 4LRAA 3EX7B 4DV1F 2HFVA 2V34A 4M5GA 3PX4A 2IFXA 1HW9A 3GIJA 4FXDA 4K50A 3AXMA 2A6MA 3G8QA 3LP1B 3NG8A 4LVOP 4NLPA 4DPUA 1FK9A 3DHXA 5A76A 2PIIA 2QL7B 2VKRA 3OVAA 4KIAA 1QE1A 2VFRA 2DKOB 2H3EB 2RRNA 2ZHOA 4JI3F 2UXCF 3LQVA 1FJEB 2HHSA 4LSLA 2VC0A 2AU0A 4C3LA 2DO4A 4HVZA 3BKTA 2WVCA 1ZM9A 4J90A 4IDKA 2CUYA 2HNZB 1RSCA 1U6FA 2JOQA 1YRTA 1UETA 1VOMA 3OLAA 1HNIA 2DPIA 4KHRA 2JFDA 2F65A 2QLJB 5I3UB 1ZOTA 2GNKA 2ZZTA 1UMJA 1RTIB 2B6AB 5HANA 4JI4F 2GIQA 1GNKA 1HWJA 3NBPA 3GE9A 2EBEA 1EETB 4LR7A 5LXRA 1HLWA 2G4BA 1OSDA 4JP8A 4O4RA 2N82B 1TKXB 4BWJA 1RT6B 3BGFA 1YBAA 3MPYA 2CG4A 2EXUA 3MOZA 3L4BC 5HBMB 3PIPQ 2C2RA 1QLNA 4OQJA 3TAMB 3BR9A 1Z2LA 4HI1A 4TKTA 1VQ5S 1JKHB 1CBKA 1RWKB 3PYFA 4TNOA 5E3CA 5D0GA 3WC0A 4C3KA 3D1QA 5KFFA 2JSXA 3KLFB 3OTEA 3OJSA 5HVGA 3DLHA 1O5JA 1E6VB 3W60A 1NAQA 2IVYA 1UTAA 2UU9J 1WC5A 4WWSA 1RT2B 3W9IA 1T9YA 1UPMB 2HFOA 4Y2AA 2R8HA 3M6XA 3MHYA 3BN7A 3P4UB 4MK7A 1VJQA 3MEGB 1OY6A 5F3ZA 2GFFA 2ASLA 3TZXA 1U1RA 2LEBA 2HRTA 5J1NA 3UVJB 1PC5A 2ZKTA 3CCMS 2M9KA 2PGCA 1Q8BA 3DOKA 3MMBB 1R31A 1YBUA 1WC1A 3TVYA 3HFKA 1XTZA 4X65F 1YDLA 3OR2B 3EJMA 4U67Q 4LF5F 5A8WB 2BMBA 4M5DA 1AA1B 1VQ8S 4OHYA 4K4TA 3BGRB 4IH6A 4EK2A 4ED1A 2OSQA 3FZ2A 4CM2A 1YWXA 4F26A 1URRA 4Y2MA 2QSWA 2VBZA 3M32A 1FD2A 1RHKB 2GHPA 2JJ4D 2YNGA 5HROA 1GTHA 3L7PA 1EB0A 5IM0A 2BABA 4JYAJ 3ZTSA 2RS8A 5KG2A 3AB2B 2ZH8A 3C15B 2JL9A 3CJSA 1KS2A 2OEKA 2RQKA 3MCNA 2HZCA 2B7CB 3PYGA 5ETQA 2AIRB 5M2RA 5J2NB 4O3QA 5HROB 2MMYA 2MKKA 1SKRA 2VG6B 4IKAA 3VAKA 3VALA 2HZAA 3ONQA 3ET6A 1TKZA 1JLFA 2DH9A 2ZDPA 2G9OA 4DX5A 3KJVA 1ZH5A 3HULA 1X7VA 1Q4RA 1Y5NB 2GJFA 3BSCA 3LGNA 4NPOA 5CD4A 3PO5A 3RRGA 5GMEA 4B9LA 4IRCA 4WXWA 4EZ6A 4EBCA 3EVWA 2ZZMA 3OTOJ 2ZHAA 2VG5B 4LF9F 4N41A 1VQ6S 2UZAA 5KFKA 5AJ3F 1NRKA 2I1RA 2L41A 2G2OA 3L7UA 2A2CA 2J76E 4ZP7A 2D7SA 4OI6A 4FVCA 2NREA 1N36F 2CXEA 2V8HA 4DV4J 1AZSB 4NZ0A 1MMDA 1OJ4A 2LQBA 3G6VA 1T03B 2E5LJ 3D1HA 3LPEA 4P52A 4PG6A 3ZTRA 1I94J 2GQCA 3PRBA 3MCOA 2XNQA 3RRHA 2MKSA 1P9YA 2GVZA 4OYZA 2BV3A 1M5SA 3I31A 3OV7A 4JV5F 2GIFA 2D9OA 2J5AA 1IBKF 2XS5A 1AXQA 1SIZA 1I1GA 1U0HB 3IXQA 4ZS6A 1WF0A 1S1VB 4ID5B 2XMTA 1GH8A 3JSRA 2XMMA 1DTTB 1ZAWA 4K7QA 3AODA 4Q7AA 2UXDF 4WIQA 2L9DA 1ROFA 5AXLA 5DG9A 2CPIA 2GAHC 3DOMA 2XULA 4NOHA 1S5ZA 4B9UA 5C5JA 1DHMA 4IH5A 4PXDA 1JXEA 4DLEA 4B3RJ 2XY6A 3F0NA 2B7BB 1B70B 1QVGR 4TQRA 1JMTA 2GMJA 3GWCA 2UV8G 4WTOB 1JNZB 1PYTA 3LTOA 1FDDA 4CRJA 4XPCA 4FS2A 1RAEB 2VBYA 4X66F 4X4SA 1VRTB 4RW6B 3KUGA 2VU5A 3DMJA 1HD0A 1QUVA 2W4CA 3I0SA 4JUZA 2MDAA 4LSNB 3J7ZT 5E3AA 1BY9A 2XBPA 4NA1A 3JTNA 3QQCD 3EICA 3HVAA 3THTA 7FD1A 1SI9A 2LKZA 1NM2A 4B08A 5HQMA 3TQEA 4CP5A 4F4ZA 3RBDA 2FVPA 2UXBF 4RNFA 2OELA 1SL2A 3SDEB 2MKHA 1HKAA 1H73A 1T9WA 4N47A 3TX8A 4DZDA 5KFBA 3CC7S 4K5RA 2IDEA 2E5HA 5EX3A 3U7JA 3BO3A 2XY5A 1R43A 1KTVA 2VICA 3IAM9 3GV7B 1SJ3P 2YKMA 1L3UA 5DLGA 4PG4A 4DV0F 4DUZF 2CDRB 2HBQB 5CHCB 2MEWA 4G1IA 4O0IA 1TL1A 2JEGA 1RP5A 3H8YA 1VMBA 2VH7A 4ITSA 4LRCA 1T05A 1RA7A 3BREA 3M8RA 2XEXA 3C8YA 5A8KB 3POTB 1B0VA 2BX6A 2Y3YA 2XWXA 4Y00A 3AA8A 3C16B 1HWUA 3S1TA 1Q81T 1SJRA 4OZLA 4EU0A 3NEKA 4X65J 2W2OP 3IGNA 2QMWA 3T5KA 2CPFA 2EWHA 4IG3B 4DU7A 3SCKE 1U0HA 3W3SA 3KLEA 2K7KA 5H9EJ 3I32A 3MM6A 3PR5B 1TFWA 1XNQJ 1U6BA 2YWFA 4QOTA 3CCJS 2VJUA 5IQQA 3AFGA 1RTDB 4C8KA 1C1CB 1FE0A 4ERDA 3ZC4A 1HFEL 4OZ3A 2C22A 3LALA 4OYXA 1FWLA 1N32J 3H42A 3LO3A 2HG4A 3IRXA 3U1NA 3ENAA 5F8HA 2DITA 5HAOA 2MHNA 2VQFJ 3DLKB 3ADAC 4YB6A 3GV5B 1QSSA 3HVTB 1XNRJ 3BBBA 5M2PA 4FF4A 3BV8A 3LP0A 5KFYA 1C0UB 3U27A 3FZBA 2QC3A 1TL3A 1V9OA 3M1VB 1VCTA 2VJVA 4YP3A 4LQ3A 1GMWD 4C8YA 2KRBA 3JQJA 4RWWA 3C6UA 2KTQA 2QO3A 4DUYJ 2R7VA 1EZZB 1X5TA 3FBCA 2GX8A 2MZ1A 1HNXJ 3R5JB 4QWCA 5D3GA 1TKZB 4HLBA 1IBLJ 3KNAA 1HBNA 3OW2R 3QJJA 1SC4B 2N7YA 3L9ZA 3J7Z5 3LW5C 2HQFA 1RXOB 4IR1A 2YKOA 4YUDA 1UVNA 2CPJA 2HRUA 2OPSA 3AA9A 4KJIA 1NPPA 1C4AA 1S1TA 2YKPA 2DNRA 2WSCC 3L7OA 4RKUC 2MSTA 3B4MA 4PCQA 1WDTA 2BBEA 1NJXA 5F9LA 2V67A 2E29A 2YNGB 4DSKA 5FLXY 3CDEA 5LOQA 2DK2A 4PZVA 4DF8A 4O4GB 1S1XB 1U48A 5GVQA 3AH6A 4M5JA 2UVVA 1RU2A 2J9CA 3CSKA 3H4BA 1LWFA 4X2BA 3OVSA 3BPSP 2Y0BB 1PAEX 3F41A 4JV5J 1FJGJ 4C0HA 3DOLB 4DS5A 4J9SA 1B3TA 3A8IA 1CPZA 3D67A 4QIWD 4DMZA 1RT7B 4RW4A 1AT1B 1VHFA 3CNQP 1Y3KA 4J9UE 3UD4P 2M8DB 3RB4A 1WKJA 2ZE2B 3Q83A 1SJFA 5K5MA 1URNA 4CO3A 1YBTA 4Y0FA 3KLFA 4DR7J 3CO0P 3S01A 3VGVA 4WCEQ 2G1DA 3C66A 3V4IB 3LP0B 1RI7A 1ZAVA 4XIUA 1N34J 2H54B 4U8YA 4AE5A 2LEPA 2ZEJA 1WHVA 3HT0A 3C3LA 2MQPA 3DHWC 4TYAA 3M2VB 5LSOA 1N5YA 2VA3A 2UP1A 1LWCB 4AD6A 4DSLA 4OYIA 4CNZA 2ZH4A 1NK8A 3QLHB 4GKJF 2GVDA 4R8UA 1RAJA 2WBMA 2K3IA 2KZMA 2AJ2A 3HMJG 3H2UB 2A2DA 1W2BR 2DCUB 3Q8RB 4V19X 4Y34A 1KVJA 3OR1B 3MEKA 3W65A 2QV6A 1S12A 5DQGA 4YN3B 3R6LB 2AEFA 1X5SA 2VG7A 4DFPA 1S76D 1RTIA 4CM0A 4DX6A 1UW4A 1KFSA 4ENOA 2IJNA 4DV5F 2OTLS 2CJ9A 2ZOMA 3GLJA 2DRBA 1FVQA 4ELUA 1VIOA 3GP9A 4ILRA 1PKUA 3CJRA 2QMUB 2Y1JA 3QRPA 1LXNA 3E8OA 2HWHA 1Q82T 2LQJA 3EGNA 1SBRA 4PYDA
chains in the Genus database with same CATH topology
1NSPA 3VGSA 2BX6A 3EMTA 3VGUA 3VVUA 4F36A 3WX8A 3VGTA 2DY9A 3GPAA 3BBFA 4F4AA 3EVOA 3G2XA 1WKLA 3FCVA 4DZ6A 1NSQA 1NDPA 3EJMA 1NDCA 1NHKL 2AZ1A 3BH6B 1W7WA 3FKBA 4EK2A 3DKDA 3Q86A 1KDNA 3Q8UA 3ENAA 3EM1A 1BUXA 1XIQA 3EVMA 3NGTA 1S59A 3BBCA 1F3FA 3PJ9A 1NPKA 3FBFA 1NCLA 3BBBA 1MN7A 3ZTSA 2HVDA 1K44A 1NB2A 4ANCA 1U8WA 5CABA 4DUTA 1LEOA 3B54A 1S57A 4ANEA 1NSKL 4WBFA 1BHNA 3FBCA 3FBBA 1NLKL 2ZUAA 4ANDA 1LWXA 3ZTOA 3EVWA 1JXVA 2HURA 4KPCA 2DXFA 2NCKL 1WKKA 3L7UA 3NGRA 1VYAA 3Q89A 1NDLA 1ZS6A 3VVTA 3Q8VA 4HR2A 3ZTRA 4C6AA 2CWKA 4O0NA 3BH7B 3PRVA 3DDIA 1PAEX 3ELHA 2AZ3A 3EE3A 1MN9A 2DYAA 2BEFA 4UOHA 2HVEA 1WKJA 3Q83A 4DI6A 1BE4A 5BXIA 5C7PA 3FBEA 3JS9A 3VGVA 3ZTQA 1S5ZA 5IOLA 1F6TA 5CAAA 3NGUA 1UCNA 3MPDA 1EHWA 4UOFA 2DXEA 3Q8YA 2VU5A 3B6BA 1XQIA 3R9LA 3EICA 1B4SA 3FCWA 1HLWA 4S0MA 3NGSA 4CP5A 2B8PA 2B8QA 1HIYA 1NDKA 3ZTPA 3ETMA 4UOGA 1B99A 3FC9A 4ENOA 3GP9A 1PKUA 4W98A 1HHQA 1NUEA 4FKXA 4FKYA 2DXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSP A;  3VGS A;  2BX6 A;  3EMT A;  3VGU A;  3VVU A;  4F36 A;  3WX8 A;  3VGT A;  2DY9 A;  3GPA A;  3BBF A;  4F4A A;  3EVO A;  3G2X A;  1WKL A;  3FCV A;  4DZ6 A;  1NSQ A;  1NDP A;  3EJM A;  1NDC A;  1NHK L;  2AZ1 A;  3BH6 B;  1W7W A;  3FKB A;  4EK2 A;  3DKD A;  3Q86 A;  1KDN A;  3Q8U A;  3ENA A;  3EM1 A;  1BUX A;  1XIQ A;  3EVM A;  3NGT A;  1S59 A;  3BBC A;  1F3F A;  3PJ9 A;  1NPK A;  3FBF A;  1NCL A;  3BBB A;  1MN7 A;  3ZTS A;  2HVD A;  1K44 A;  1NB2 A;  4ANC A;  1U8W A;  5CAB A;  4DUT A;  1LEO A;  3B54 A;  1S57 A;  4ANE A;  1NSK L;  4WBF A;  1BHN A;  3FBC A;  3FBB A;  1NLK L;  2ZUA A;  4AND A;  1LWX A;  3ZTO A;  3EVW A;  1JXV A;  2HUR A;  4KPC A;  2DXF A;  2NCK L;  1WKK A;  3L7U A;  3NGR A;  1VYA A;  3Q89 A;  1NDL A;  1ZS6 A;  3VVT A;  3Q8V A;  4HR2 A;  3ZTR A;  4C6A A;  2CWK A;  4O0N A;  3BH7 B;  3PRV A;  3DDI A;  1PAE X;  3ELH A;  2AZ3 A;  3EE3 A;  1MN9 A;  2DYA A;  2BEF A;  4UOH A;  2HVE A;  1WKJ A;  3Q83 A;  4DI6 A;  1BE4 A;  5BXI A;  5C7P A;  3FBE A;  3JS9 A;  3VGV A;  3ZTQ A;  1S5Z A;  5IOL A;  1F6T A;  5CAA A;  3NGU A;  1UCN A;  3MPD A;  1EHW A;  4UOF A;  2DXE A;  3Q8Y A;  2VU5 A;  3B6B A;  1XQI A;  3R9L A;  3EIC A;  1B4S A;  3FCW A;  1HLW A;  4S0M A;  3NGS A;  4CP5 A;  2B8P A;  2B8Q A;  1HIY A;  1NDK A;  3ZTP A;  3ETM A;  4UOG A;  1B99 A;  3FC9 A;  4ENO A;  3GP9 A;  1PKU A;  4W98 A;  1HHQ A;  1NUE A;  4FKX A;  4FKY A;  2DXD A; 
#chains in the Genus database with same CATH topology
 1D9D A;  1YJ7 A;  1D09 B;  1PSD A;  2MHE A;  3IG1 A;  5DM6 Q;  3O5T B;  4LR9 A;  2MQQ A;  2CJQ A;  1T11 A;  4ZPB A;  2H5J B;  1IR0 A;  3KLG A;  2GA7 A;  3AQO A;  3DDN A;  3W2W B;  3MCM A;  2J6U A;  5CYM A;  5D0H A;  3RAM A;  1RKI A;  4B3M J;  4OI2 A;  2BA9 A;  1NHK L;  1Q1K A;  3CUL A;  2AZ1 A;  4I2Q A;  2R2S A;  4U9R A;  3G87 A;  2R3V A;  3DI6 B;  4LFA F;  4DQQ A;  1MWQ A;  4GVB A;  4ED6 A;  3D6F B;  5IT0 A;  4R0J A;  9RUB A;  4GKK J;  4P7T A;  1DLO A;  1X8D A;  1IKX A;  2D1C A;  3QIP B;  1TUW A;  1NPK A;  1R89 A;  4C8Z A;  5CYM B;  1N8R T;  2BRL A;  1HNZ F;  2C3Y A;  2IA6 A;  3WC2 A;  5KFN A;  4NLU A;  1FI4 A;  2IVF B;  5DET A;  2OMO A;  1DTT A;  3TNV A;  4PWD B;  1N5Q A;  3IN5 A;  3PW7 A;  2BZ2 A;  2N4C A;  1BHN A;  4FPI A;  4DOZ A;  4WKR A;  2HFS A;  3B82 A;  1KKH A;  1NLK L;  1VK3 A;  3CO9 A;  4LR8 A;  4F2S A;  5E7O B;  4TU8 A;  3OXL A;  4EO8 A;  2JLG A;  2ZE2 A;  1FFS B;  2ZWP A;  3H0P A;  3M2U B;  4HHU A;  3EYZ A;  4WK3 A;  2ATL A;  4Q8E A;  4X84 A;  3GSD A;  4NEY A;  4DBQ A;  1TK0 A;  3CME S;  4LF7 J;  1N54 B;  1VYA A;  2CNO B;  1L3T A;  4HDG A;  3PIO Q;  2XMA A;  1C4C A;  1HWI A;  1R8C A;  2D74 B;  2HHT A;  1V6H A;  2OD6 A;  5J2P B;  4KSE B;  2J6T A;  3QT6 A;  1RBA A;  1TFY A;  2QLX A;  1TL5 A;  1TMJ A;  2KXH A;  3K7R A;  4UUX A;  3TUJ C;  3SYZ A;  4OLO A;  4AT1 B;  4OYW A;  4R8U B;  2CQG A;  5C24 B;  4N56 A;  2HHX A;  1N6Q B;  2LP4 A;  3QSI A;  4U7U D;  4LF2 A;  4KAI A;  1OWX A;  1LWC A;  4I68 A;  2HNY B;  1RAC B;  1FWK A;  2N4D A;  1MN9 A;  4I2P B;  4CI0 B;  2OPQ A;  4ZVF A;  2MQM A;  2DNQ A;  4FBT A;  4D3H A;  3AXK A;  3JQK A;  5KG0 A;  2VG6 A;  4ZCL A;  4NZ7 A;  1RT4 A;  1U26 A;  2J7K A;  9ATC B;  2AYM A;  4NI2 B;  1SPB P;  3PDN A;  2CJX B;  5K8N A;  1IR1 A;  1JLC B;  4BC9 A;  2FJE B;  2CJA A;  5HQ8 A;  1N32 F;  3PW2 A;  3KOA A;  5CCL A;  1S7H A;  1HQU A;  3PCO B;  3NS7 B;  3MAQ A;  3NNH A;  2R7R A;  3SMZ A;  4AXJ A;  2I8E A;  1F60 B;  4H4K A;  4DPW A;  3B6B A;  3BGR A;  1JLB A;  2M88 A;  4FYW B;  1AW0 A;  3M8Q A;  1QAJ A;  3G8S A;  4DSI A;  2E7W A;  5BYQ A;  3GTY X;  3VWS A;  2W9B A;  1R27 B;  3IRX B;  2EG2 A;  5ETP A;  5KT4 A;  4DV5 J;  2WON B;  2RHQ B;  4JI7 F;  4PQU B;  3FRY A;  4KKO B;  3TAR A;  2G13 A;  3CD7 A;  1H0H B;  2ERR A;  2WVF A;  3I56 S;  1WOR A;  3DXS X;  3SCI E;  4FF2 A;  1IVZ A;  4DV4 F;  5HJY A;  1B0P A;  1BMQ B;  3MEG A;  1BQN A;  4DU8 A;  1UJ4 A;  2C3U A;  3G9C A;  1RT2 A;  1Q95 G;  3O44 A;  2KJV A;  4GO5 X;  4ES3 A;  2W9C B;  2OTJ S;  3J81 U;  3KK1 A;  3FDS A;  1DAR A;  2VQE F;  2DHH A;  5H9E K;  4QCL A;  2U1A A;  4G1Q A;  1P1T A;  3MR7 A;  1NU4 A;  5KT5 A;  2I5J A;  5DM7 Q;  2C2E A;  1RUS A;  3GSI A;  5D4L A;  3CMQ A;  2Y0S D;  5G0R B;  1WUU A;  4NRU A;  5CH7 B;  4C3M A;  2X1F A;  4DWI A;  4NL5 A;  4QPX A;  2V4J B;  1ICE B;  1W26 A;  3MD1 A;  5AE3 A;  1WC6 A;  3CJT A;  3H5Y A;  1CQM A;  2E1A A;  1YQH A;  3M2R A;  1CJK B;  5F8N A;  1WG1 A;  4PKD B;  4WP3 A;  1RHU B;  2VIH A;  1K0V A;  4RPF A;  2XMK A;  3DKD A;  3KUH A;  4K2X A;  2RJZ A;  5GAG I;  1T3N A;  4FDF A;  4URG A;  5D0R A;  3QT7 A;  5HK4 A;  4ZA1 A;  2I2Y A;  2Q66 A;  1XIQ A;  5KAK A;  3HP6 A;  2GV1 A;  4LFC F;  5J2Q B;  2BAN A;  2G0C A;  3PJW A;  1QJH A;  1V3R A;  1L3V A;  3RAX A;  4ILL A;  1W25 A;  3NOG A;  3CMA S;  1KFD A;  1PBU A;  3CD6 S;  3ZO7 A;  2C42 A;  2YKQ A;  4ANE A;  4X62 J;  1ZYQ A;  2W1B A;  2X7I A;  2RD5 C;  2QSF A;  1GX6 A;  4F67 A;  1Q5Y A;  2J0Q D;  3JTO A;  1FCA A;  4H54 A;  4AXI A;  3KDO A;  1KLN A;  2P9G A;  1YGY A;  2JZ5 A;  4ZPA A;  3W9H A;  4UQT A;  2ADB A;  2HW3 A;  4A8W A;  4JI2 J;  1B7F A;  3CUN A;  2LEC A;  4EBD A;  2W2N P;  4KV8 B;  5ITH A;  3EZ5 A;  1YJW S;  2BOP A;  3D66 A;  2I38 A;  1TTH B;  4DUZ J;  2KHC A;  1PBA A;  4HT5 A;  2V94 A;  5EWF A;  1CQN A;  2DGU A;  2CQP A;  1M5V C;  3MM8 B;  1S0O A;  4A46 A;  1RTH B;  3OTO F;  5LXY A;  2DNN A;  3R1H A;  4LSN A;  2MGZ B;  3SI8 A;  5KT6 A;  4F0H A;  3S6E A;  1E6Y B;  5J1E A;  1TR0 A;  1EAR A;  5KFM A;  1S72 S;  3NAI A;  4WFB Q;  5HMW A;  3HO1 A;  2IIH A;  3A8K A;  2KFY A;  2GHW A;  3W8P A;  1LK7 A;  1JK9 B;  2EFV A;  1PIL A;  2FY1 A;  2D3O 1;  4F3O A;  2IM1 A;  4UQG A;  3R5B A;  1IBC B;  5B0B A;  2DGT A;  4Y2I A;  4DX7 A;  3HFZ B;  4DL6 A;  1P8G A;  3ULH A;  4HH1 A;  1RWX B;  2JH3 A;  2IC3 A;  3FBE A;  3M8S A;  1MWZ A;  1R8B A;  1S6U A;  2X3G A;  1S1W A;  5KFO A;  4HTI A;  4X4Q A;  2CQH A;  2W2P P;  3OT9 A;  1REV A;  2W2M P;  4KO0 A;  2ZDO A;  1UVM A;  1S1U B;  4DR4 J;  2CQ2 A;  5FDL A;  5KT2 A;  3NGU A;  2FUG 9;  2FHO B;  2VC1 A;  4MTP A;  5GAH I;  4F4X A;  3J7A 1;  2H9Z A;  4K4U A;  1EHW A;  2RHS B;  3T6B A;  2I9S A;  4X4V A;  3A1Y G;  5CZV A;  5GAH U;  5CYQ B;  1VHI A;  4G1Q B;  1QSL A;  1RAA B;  2AGO A;  1JLC A;  2JLE A;  3ILL A;  3MED A;  1FRL A;  2AJQ A;  2IBK A;  1G4C A;  5FLX U;  2MJN A;  2R7U A;  2C3M A;  1RAH B;  4DCO B;  3VAH A;  4LF4 F;  1L5U A;  4DQI A;  1RTJ B;  3NNA A;  2P8I A;  1NK4 A;  2B4P A;  2EC0 A;  2OPQ B;  5T14 A;  2EK6 A;  1VRU B;  4B3O A;  4NLW A;  4Q0B B;  3OFE A;  1N36 J;  4OZ0 A;  3THV A;  3TEG A;  1S9E A;  2WON A;  4I6A A;  2R7Q A;  3Q23 A;  1FXL A;  2MY8 A;  2RIJ A;  3D3C J;  3M8Y A;  1T8E A;  3G6E S;  4UY8 5;  3G71 S;  3FMB A;  1LW2 B;  2VDH A;  4DFM A;  3UVJ A;  2FJV A;  4A8S A;  4EYH B;  5DRK A;  4Z2X A;  2RU3 A;  2QYG A;  2EFQ A;  2JEI A;  1F1B B;  3QO9 B;  2DPJ A;  1SC6 A;  4MKV A;  2HRY A;  1HW8 A;  1FVS A;  2CPD A;  3C19 A;  3CJ0 A;  3KG0 A;  3WX8 A;  3VQS A;  4QBU A;  4QWD A;  1UFW A;  2OEM A;  2K8G A;  3A3N B;  3EGV A;  4CT9 A;  4ES1 A;  3QT8 A;  3EDQ B;  2J8A A;  4PG8 A;  2FC9 A;  1OY9 A;  5D78 A;  5THW A;  4KHM A;  4LF1 A;  4TLR A;  2XYP B;  1HHT P;  3FKB A;  3M32 B;  3BQ2 A;  4KC5 A;  2KG0 A;  1EP4 B;  2D3U A;  4KYZ A;  4MIB A;  3J80 U;  1EKR A;  4F04 B;  2DT9 A;  2PA8 D;  2F63 A;  3SV4 A;  2CAD A;  4M5D B;  1IQT A;  2HIY A;  1U2F A;  1EET A;  4ZVQ B;  4FN5 A;  5K8P A;  4HT7 A;  1N6Q A;  2DGV A;  5DJB A;  3GIK A;  4YDX A;  3TVK A;  2B6A A;  3TA0 A;  3M8Z A;  1NB2 A;  3FSI A;  1ZA1 B;  2POK A;  3IBC B;  4OX7 A;  3M9N B;  3S7R A;  2JNJ A;  4DF4 A;  2F8M A;  4GVB B;  2F4F A;  4QJV A;  4W4M A;  1LFW A;  4WU2 A;  5F3T A;  3IR7 B;  5BYS A;  3TQ1 A;  2YH0 A;  2CQD A;  2Q3P A;  3BN4 A;  3PNI A;  4RO0 A;  3NMR A;  2BE9 B;  2CZV C;  3LWM A;  3ITH A;  2ZUA A;  8RUC A;  4DV0 J;  2QA1 A;  3J7A N;  3M2U A;  2HHQ A;  1YKW A;  2AKW B;  2F9J A;  3OFF A;  2KVI A;  3HZG A;  1EAY C;  1TU0 B;  3QWU A;  4ED2 A;  2MZR A;  1QE1 B;  4R5P B;  3PFO A;  4X4U A;  4EWT A;  4OL8 A;  1C1B A;  3F44 A;  3IMQ J;  3OSP A;  1NJI T;  4O44 A;  1I51 B;  3M6W A;  4OZ1 A;  5EX0 A;  2RDJ A;  3GG1 A;  1CVJ A;  3X1L B;  3Q89 A;  1Q5V A;  2MKY A;  3OTC A;  2FB0 A;  4WP9 A;  2F9D A;  1GQE A;  4HR2 A;  4WTY A;  2QL9 B;  2QE5 A;  3SFG A;  1VIX A;  2C1E B;  3FQK A;  3TUI C;  1RLC L;  4C0B A;  4K8R A;  2VQF F;  2Q79 A;  4DR1 F;  3QIP A;  1FKP A;  4U96 A;  3KTQ A;  2EFO A;  2L48 A;  1Z1Z A;  1VR6 A;  2AZ3 A;  3T9Z A;  3Q8S B;  4DL2 A;  2EBG A;  2VG7 B;  4DQS A;  2OAU A;  1WJ9 A;  3DRX A;  2BJD A;  5ETO A;  4C2M A;  4P71 A;  1JLQ A;  1R0C B;  2BM0 A;  1HNV A;  3JAM Y;  1G3O A;  2NLW A;  4G1P A;  2YY3 A;  4MFB A;  3WIU A;  2XC9 A;  5IT9 Y;  2QGF B;  2XMW A;  3CCW A;  3N9U C;  3CIM A;  3JSM B;  3AD9 C;  3FUY A;  4CT8 A;  4F4W A;  4NA3 A;  4WF9 Q;  4DQR A;  3CCR S;  2X3D A;  1SH0 A;  3ENW A;  1VC5 A;  4I64 A;  2E1R A;  2R2U A;  4ED5 A;  3DC2 A;  4IO1 A;  1IM6 A;  4ED7 A;  3HSZ A;  1YIT S;  4HEA 9;  1MU2 B;  2KXF A;  4UOF A;  5IXU A;  1CS4 A;  1SUQ B;  1TL7 B;  4P10 A;  1V3S A;  4ZK7 M;  2XGQ A;  1CUL B;  1X9S A;  2RE1 A;  3R5C A;  4N77 A;  4CLP A;  1C1B B;  2KM8 C;  3GR0 A;  3V4I A;  2DD8 S;  4R5P A;  4XO0 A;  1WEX A;  1QDU B;  1VBK A;  2KI2 A;  2Z0G A;  1EQM A;  2AYB A;  3D0G E;  4NLD A;  2OPR B;  4ZPT R;  1U45 A;  4HDH A;  1I6J A;  2AW0 A;  1ARO P;  3CF5 Q;  2E5J A;  3ITH B;  4ZPD A;  2DNY A;  5L9X A;  5C2G A;  2NR0 A;  1T95 A;  4P73 A;  4DPY A;  1CG2 A;  2IRX A;  2YNI A;  3JTP A;  3NNC A;  1TAU A;  2R7T A;  3MR3 A;  3I9Z A;  4RUA A;  4OHV A;  5DS7 A;  4WXO A;  5KOX A;  4PUO A;  3NRB A;  1F3V A;  2O67 A;  4ZVH A;  4OI0 A;  3BPD A;  1YLX A;  4DL3 A;  1TKD A;  3K17 A;  3O1L A;  2K06 A;  2RRB A;  1ZTT A;  4Y3C A;  1JLG A;  2QG9 B;  4AL5 A;  1NKB A;  1FXR A;  1TQL A;  2PMH A;  3A4T A;  3OFH A;  2R7S A;  3MM9 B;  3QWP A;  3AAW B;  2W24 A;  2YPZ A;  4J9L A;  1NXI A;  3EVO A;  5H9F J;  4ICL A;  3X3U A;  4OYB A;  4QW9 A;  2QIF A;  4ZVS B;  1KHW A;  4ELT A;  1GT8 A;  3JSY A;  1NDP A;  5BJR A;  2N7C A;  3KK2 A;  2LQ9 A;  2UUA F;  4JI3 J;  5D3G B;  3CTR A;  3ZZY A;  3OXG A;  1J5E J;  2W01 A;  1U47 A;  1FJ7 A;  1FF2 A;  2VFV A;  4OHW A;  3D6M B;  3TR5 A;  1X4G A;  4DHV A;  5A0Y A;  2HK2 A;  4XPE A;  2WB4 A;  4M95 A;  2V8D A;  1QY7 A;  3RRK A;  1VS3 A;  2IY5 B;  6AT1 B;  3MAA A;  1U1P A;  2H1Y A;  4HI2 A;  2FJB B;  1G1X A;  3E3X A;  1S10 A;  3W1Y C;  1YJV A;  4B02 A;  5J1P A;  2LQ5 A;  4DSF A;  1UAW A;  4JI5 F;  2JFK A;  1NK5 A;  1VQY A;  4O4G A;  1IXK A;  1U0S A;  4EMD A;  4UW2 A;  2AQ4 A;  2F4V J;  1X0F A;  1FRM A;  2NXN A;  4EYI B;  1S0V A;  4RWX A;  1RE1 B;  1SXL A;  2I0X A;  3OL9 A;  3EDR B;  5AJ3 J;  5K20 B;  4J37 A;  1DAX A;  1S9G B;  3TW0 A;  2OIH A;  1CC7 A;  2CRL A;  2WK4 A;  4ZVU B;  4ECR A;  1SJQ A;  2XG8 A;  3R5G A;  3HSJ A;  5ETR A;  3T5L A;  2ROG A;  4CQ1 A;  1K73 T;  2LEA A;  1IKV B;  2HFZ A;  2ZNZ A;  1R3N A;  3IWL A;  2G2Z A;  2LXU A;  3UDL A;  1N4L A;  3DRR B;  2ZVI A;  1UWB B;  1U1M A;  4M94 A;  5EWE A;  2AF6 A;  1WOP A;  1XNQ F;  2WVB A;  4Y65 A;  4GO7 X;  1YG0 A;  1RQ0 A;  1RTH A;  5DDO C;  3QYY A;  4CTA A;  5HAT A;  3J80 Y;  4K0K J;  1NDL A;  3C6U B;  3UFC X;  4GC6 A;  3OUY A;  1OPI A;  5DQH A;  2VQE J;  1KLM B;  3CD0 A;  5K14 B;  3V4M A;  3V81 B;  1TUV A;  1GMV A;  2HEK A;  4CLL A;  1NZA A;  2J9D E;  4NAS A;  4ZCI A;  2HHU A;  4ZP9 A;  1R8A A;  2B5J A;  3T1Y F;  2BW2 A;  3KG1 A;  3HKW A;  5E2Q A;  4QPT A;  3SBM A;  1HNW J;  2YKM B;  4RJV A;  2W8K A;  3A13 A;  2HPU A;  3K5P A;  4LJM A;  3TUP A;  4UOH A;  2V8V A;  4DI6 A;  1FNM A;  1BE4 A;  4ZMM A;  2LVW A;  5DZ6 A;  1LNQ A;  1OYD A;  2YNF A;  1IQZ A;  2LLZ A;  4X64 F;  1U2C A;  3HHD A;  5IOL A;  3AHP A;  2HHW A;  4E98 A;  1GX5 A;  1LXJ A;  1SC1 B;  1T9V A;  2KT3 A;  3LAN A;  3UNG C;  1VQL S;  2E44 A;  1FA0 A;  3M30 B;  1RT1 B;  4YB7 A;  3PR4 A;  3EXC X;  4NX9 A;  2OHD A;  4NLQ A;  1Y9O A;  5IC4 B;  3QSY B;  3PEH A;  2DXE A;  4ZVO B;  3C16 A;  2H4Y B;  5J2M B;  1HQE B;  1IM4 A;  1K9M T;  3B4D A;  1XEZ A;  4MK9 A;  3M6U A;  3LWL A;  1ZTW A;  2RS2 A;  1WTB A;  1JX4 A;  3F73 A;  2UVU A;  4PXE A;  2MY7 A;  2AT1 B;  2GGP A;  1HR0 F;  4CH1 A;  4QWA A;  2EPI A;  1T9X A;  2ZC3 A;  3KLH B;  2R2T A;  4DV6 F;  2BYC A;  2MB0 B;  3PG9 A;  2UV8 A;  2JDJ A;  4G3I A;  2MZQ A;  2A1B A;  4C9D A;  4QYZ J;  3MTJ A;  4WFX A;  1AFJ A;  4A47 A;  3HHE A;  1OMS A;  2XHW A;  4ZJQ A;  2KJW A;  4ECT A;  3OHB A;  4YOE A;  3LP2 A;  4ZIV A;  8AT1 B;  1N33 F;  3EGZ A;  2DGQ A;  4ZP6 A;  2C2N A;  3HM9 A;  1IKY B;  1NSP A;  4HHH A;  3T5H A;  1CJT B;  1VBY A;  1N5S A;  1TAQ A;  2A6O A;  3T6J A;  8ATC B;  2VPW B;  4U6P A;  4IFY B;  3V81 A;  2FHJ A;  2RUS A;  4JI1 F;  1G2E A;  4PQU A;  3UCZ P;  4DPT A;  1RB0 A;  1XMQ F;  4O3N A;  1AB8 A;  1UWA A;  1QUP A;  1WEZ A;  1WOO A;  1XN9 A;  2HS0 A;  2NSB A;  2PSZ A;  2W9B B;  2A0F B;  4CTA B;  4NYO A;  1UA0 A;  3H5X A;  3CVK A;  4DV2 J;  4LVN P;  3MUR P;  1R0A A;  2MJU A;  3Q24 A;  1UWB A;  2OLW A;  1ACM B;  2PEB A;  3R7N B;  5KFT A;  5IFM A;  4J9R A;  3V6D A;  3I5A A;  3FEY B;  2DGW A;  4ZIT A;  4FBU A;  4M5M A;  1VQO S;  4RUC A;  4KHP F;  2H48 B;  4CDI A;  4DR4 F;  3DN9 A;  4OMF G;  1CSJ A;  2Z56 B;  3DNC A;  3BBC A;  3N5F A;  4K59 A;  3RYL A;  4M5N A;  3BO2 A;  3GJS B;  3M9O B;  3RB0 A;  2KKH A;  3KWM A;  1EIY B;  1Y10 A;  4FF3 A;  3RBZ A;  1A6L A;  1KTQ A;  3MZI A;  1KON A;  2BE2 B;  3A3O B;  2A3J A;  3NWR A;  4IQM A;  4KB7 A;  4LBI A;  4ZLJ A;  1WEL A;  3G4S S;  4X4N A;  3P96 A;  4JV2 A;  2Y1I A;  4FYY B;  2QN6 B;  1FJC A;  2E7X A;  2MSS A;  2N3L A;  2Z2Y B;  2ZBR A;  4DR5 F;  4USM A;  1S97 A;  5A6W A;  2F3J A;  4EGL A;  3IWN C;  2DR5 A;  4OI3 A;  2FY8 A;  1RBO B;  2O1P A;  2XCA A;  1RKJ A;  3RAQ A;  4M5L A;  4L3K A;  1XMO J;  1WC3 A;  2K1R A;  1WKK A;  2MQN A;  2QLF B;  3E2E A;  3C6T B;  2KB2 A;  2V5H G;  3CCT A;  3NMA A;  1H2T Z;  4I1T A;  4CO4 A;  2W25 A;  4WYW A;  3BYR A;  5E41 A;  1WSR A;  2DH7 A;  3SCJ E;  3EWG A;  2VPY B;  3MPV A;  3SFU A;  4CLK A;  5EHH A;  3CPW R;  4JI7 J;  4P2M A;  5AE2 A;  1F2G A;  2FJD B;  2P5V A;  2QFI A;  1H38 A;  2HS3 A;  4LF8 F;  3ISN D;  2JEJ A;  2GAG C;  3PYD A;  2W7P A;  1RWM B;  4M8L A;  3KK2 B;  4UY8 T;  1N33 J;  2IAJ A;  4ZPW R;  5KFU A;  3TAM A;  3DLE B;  5CD4 H;  2V8G A;  4PUO B;  2ZC4 A;  3VAI A;  3V6D B;  1F9E B;  5C7P A;  2FVC A;  1OY8 A;  3O6Q A;  4I2P A;  1H3D A;  4FNH A;  1SJ1 A;  2FLL A;  4K4V A;  2HIQ A;  2L3M A;  4LFC J;  4USW A;  2KM8 B;  1U2R A;  2KHD A;  3D54 A;  2WW4 A;  1HR0 J;  2M5Y A;  1ITP A;  3PO4 A;  3H5S A;  5DQI A;  4B9V A;  3QT5 A;  4ED3 A;  4BBY A;  4DL7 A;  3BGU A;  5L1K A;  4Q8F A;  5IWA F;  3FEZ A;  5KFP A;  4U7U K;  1HBO A;  3CIZ A;  3NCP A;  3TZZ A;  1X9W A;  1P9Q C;  5JVG Q;  3R9L A;  4HH0 A;  4I6Y A;  4JI6 F;  3FGV A;  1SUQ A;  2CNL B;  4XDC A;  1MLA A;  2XM3 A;  1B4S A;  3OTB A;  3KLV A;  1IBM J;  2OJ3 A;  3O3L A;  1E6V A;  3WDO A;  3I4P A;  3MFI A;  1V5I B;  4XTT A;  1DJ0 A;  1ELO A;  5LMU F;  3BSO A;  1UKU A;  3MEC A;  4OLP A;  3ZTP A;  4UOG A;  1RU1 A;  4LFB J;  1IUJ A;  4YDD B;  5CA5 A;  1XMO F;  2EFG A;  2AX0 A;  2VOD A;  1QM9 A;  3PTW A;  3CCV S;  4L72 B;  4UF4 A;  3SCL E;  4MFB B;  1AYE A;  1BQX A;  2ABY A;  2X1B A;  2XZT B;  5LJ5 Y;  5KFZ A;  3D2W A;  5LMN F;  3K5O A;  4H4K C;  2B4O A;  3KUE A;  3MMA A;  1S6Q A;  1NUE A;  3AB4 B;  4W98 A;  4A8X A;  4ECS A;  5DGA A;  3CJQ A;  5F8L A;  3NBP B;  4NXM F;  4DV2 F;  2WSF C;  3MAH A;  3CJK A;  1FRX A;  2AJ1 A;  2F8H A;  4F36 A;  1SH2 A;  2DO0 A;  5I3U A;  4YR3 A;  1IJF B;  2MKC A;  2FLN A;  5F8J A;  3PFE A;  5B08 A;  3SQO P;  1XMQ J;  4DV3 J;  3UNY A;  4E8U A;  2CZ4 A;  4OI1 A;  2IYI A;  4IDK B;  4CLF A;  3P3D A;  3VGT A;  3UR0 A;  3KHH A;  3QID A;  1FDB A;  1JB0 C;  5HJX A;  5A2Q Y;  3R2D J;  1PG5 B;  3PW4 A;  3HD1 A;  5F41 A;  2LFV A;  3D6T B;  2H65 B;  2RML A;  2YNF B;  4WII A;  1M5K C;  2YQ1 A;  1YX2 A;  1Q86 T;  2CKW A;  3D3B J;  4ECY A;  1T3O A;  1SH3 A;  3F56 A;  3H20 A;  1M90 T;  2GVD B;  4CH7 A;  4JI8 J;  2H5E A;  4EO6 A;  2BJ8 A;  3MF5 A;  4OYA A;  2ZOF A;  1QAX A;  1I3O B;  2HLU A;  2RSQ A;  3EM1 A;  3LP1 A;  1A7G E;  1N34 F;  1RAG B;  3J7Y I;  5E33 A;  2HGN A;  4LRB A;  1X4E A;  4TXS A;  3UN3 A;  4DDF A;  1LW0 A;  1OQ6 A;  2GW8 A;  1MN7 A;  2UVW A;  1EX8 A;  3W9J A;  4KTQ A;  3PKM A;  2VAS A;  3OBI A;  5U47 A;  3W63 A;  2XYG B;  3VQT A;  5G0R A;  3TUZ C;  2KU7 A;  1YJR A;  1VC0 A;  2UUC F;  1S77 D;  2CQI A;  2LA6 A;  3RBE A;  3MR2 A;  1S6P A;  3DLB A;  5KFV A;  3QAT A;  1NSA A;  2XLJ A;  2FJX A;  1U24 A;  3C2P A;  1RT3 B;  3FMW A;  3ZTO A;  1JXV A;  2GC8 A;  5D4N A;  1JJ4 A;  4CLY A;  2VHG A;  1N56 A;  3UE2 A;  1F9F A;  5HI7 A;  4KFB B;  3T5J A;  1EP4 A;  2AD9 A;  2EVZ A;  5D6G A;  3WZ0 A;  3DM2 B;  3KMQ A;  1X9M A;  1JJ2 R;  2CPY A;  4QWB A;  2ASJ A;  4C8M A;  2FPH X;  4CO5 A;  3HF5 A;  5I3P A;  1U1L A;  1Q79 A;  2AJ0 A;  3GIM A;  4DXL A;  3M2V A;  1N5Y B;  2IJF A;  1UPP A;  4ZHR A;  2E5L F;  1FO1 A;  1VK8 A;  1RAD B;  1VIS A;  3BB5 A;  4ZOS A;  1JLB B;  5B0D A;  2V2V A;  6FD1 A;  1S4E A;  3KK3 A;  1IBL F;  3ELH A;  4OZJ A;  3AJ1 A;  4OX9 J;  3R5A A;  5FD1 A;  4DL5 A;  4FP9 A;  2JX2 A;  3I55 S;  4YHH F;  3T41 A;  1ZPW X;  2HHH J;  2XS7 A;  1U1K A;  4GKJ J;  5E3P A;  3D9B A;  1UFK A;  1UZH A;  2E7V A;  4CLZ A;  3ILI A;  1C0T B;  3EGW B;  3FVY A;  1RLD A;  4LBP A;  1D0E A;  1P6T A;  1WC0 A;  1XR7 A;  4UZB A;  2LU1 A;  3FK4 A;  4M5H A;  4PPZ A;  4CLU A;  4H4M A;  2C28 A;  3HHL D;  3ZZO A;  4K4X A;  3AOA A;  3KLI B;  2BQR A;  4CWB A;  4WFZ A;  4USU A;  2HSE B;  4ZHR B;  2R8J A;  4OJG A;  1NB7 A;  2HNY A;  5AT1 B;  2DGO A;  2OGU A;  2XO7 A;  4W92 B;  2CFX A;  1HWL A;  3J81 Y;  4N76 A;  2FLO A;  4WZM A;  4ZLN A;  4MKA A;  1TUG B;  1UEK A;  3HI9 A;  4A8O A;  3KJN B;  2HWT A;  2NZ4 A;  3BJY A;  4EEY A;  4LRD A;  1BWV A;  5HVF A;  4M63 A;  1S9F A;  5F0W A;  3HVR A;  2VBW A;  1S79 A;  2LDY A;  3LPY A;  4PEO A;  2YNI B;  1BGX T;  4QIG A;  4TY9 A;  3QRR A;  4ETZ A;  2QRR A;  4ZDN A;  2R2R A;  4DV7 J;  4KO0 B;  2KO1 A;  3NGK A;  3MEE B;  2E9T A;  2GQ2 A;  4NCG A;  5CYQ A;  1HMV A;  3V2U C;  1CJV A;  1NEE A;  2HK3 A;  2WOM B;  3D5M A;  2HBR B;  4HAC B;  2NXU A;  2XNR A;  7AT1 B;  3W8G A;  3DRY A;  4Q5V A;  1Y00 A;  2BR0 A;  2FLP A;  5A8R A;  3KDN A;  2JVO A;  2EC2 A;  1TL7 A;  4QW8 A;  2HQC A;  4CNY A;  1BXN A;  2CPH A;  2CQB A;  2IC3 B;  3CDW A;  3PYE A;  3QRQ A;  2V50 A;  2ZKU A;  4DSJ A;  1MRO B;  3PHT A;  1BWE A;  2PFF B;  3HHL C;  3DXB A;  5IC6 B;  3CWJ A;  3SDE A;  1RWP B;  1DBD A;  4OI4 A;  4Q44 A;  2ZJP Q;  4DZ6 A;  2Y1L B;  1CC8 A;  1WHY A;  2Q6C A;  2FD2 A;  3MM7 B;  4HL9 A;  5MAO A;  1NKE A;  1UW9 A;  4EZ9 A;  2FQQ B;  2B4V A;  2ALZ A;  4C48 A;  4V19 J;  2V9W A;  2QA4 S;  3EPI A;  2ZJQ Q;  1HL6 A;  4Y28 C;  3GFH A;  5DO2 A;  1VQK S;  3GYX B;  3MM8 A;  3W66 A;  5B0E A;  4Z7C A;  2VKZ G;  1U7L A;  1O8B A;  2AYE A;  2ASY A;  2DNH A;  3R7B B;  3UDV A;  4ZVP B;  5I3Q A;  2YWW A;  3V5R A;  3POT A;  4J5O A;  3OQ2 A;  4J7C A;  2E9R X;  2CNK B;  5E0O A;  1CEZ A;  2XWY A;  3C14 B;  5E3Q A;  5D4O A;  2P6S A;  3SV3 A;  4QU7 A;  1S0N A;  3E51 A;  4WK1 A;  1RT1 A;  3MCS A;  2RH3 A;  3HJF A;  1RCX B;  3W5X A;  1FEH A;  4ZN3 A;  2DNP A;  3ILO A;  3BO4 A;  2W9A A;  4DR6 F;  3G8T A;  3PW5 A;  2FHM A;  2XQC A;  2V9K A;  3UDC A;  1WSV A;  4AND A;  4C98 A;  1LWX A;  3K5L A;  3JB9 k;  1HBU B;  3H2V E;  2GVZ B;  1U09 A;  4KPC A;  3NY0 A;  2ZHB A;  1A0O B;  4DR6 J;  1K0T A;  3H5U A;  3IGV A;  1SC3 B;  1YK9 A;  4B3T F;  4C8O A;  4B3S F;  3FRZ A;  4HYK A;  1OS5 A;  2ZBP A;  1UA1 A;  4LF6 J;  2YQ0 A;  3VAJ A;  1Y7P A;  2GCF A;  1ZS6 A;  3T3F A;  1HBO B;  3GFZ A;  1TV6 B;  3TJ9 A;  2MKJ A;  3DLG B;  1IR2 A;  3W62 A;  4CO1 A;  3KNG A;  4OHZ A;  4YQW A;  2L9N A;  2NYH A;  4NEZ A;  2CNN B;  2NXC A;  4FXW A;  1RA6 A;  5IT4 A;  3D28 A;  3NCR A;  4F02 A;  1OYE A;  1C2P A;  4CYU B;  3LGM A;  2XY7 A;  1RBL A;  1TKT B;  2M3D A;  2OSR A;  3MEE A;  1FKO A;  1H72 C;  2RT3 A;  5G4D A;  1DQ9 A;  1LOU A;  4DCP B;  2OKQ A;  2E1M C;  2W9C A;  1VQN S;  1U1N A;  2QLB B;  3R1L A;  1IKV A;  2IAJ B;  2PE8 A;  2RKI A;  3UR3 C;  3G6X A;  1DTQ B;  2VON A;  5J2N A;  2I5J B;  3HSD A;  2M7S A;  1S9G A;  2DNO A;  3ZNU A;  3BZQ A;  4F3Q A;  5KFC A;  4GRS A;  5IM0 B;  1WD6 A;  2AEJ A;  4RUB A;  5F8M A;  2H4W B;  3LA0 A;  3KK1 B;  3P6Y C;  1M1H A;  2CZ9 A;  4MMO A;  2B9X A;  1Q78 A;  3U1M A;  4F25 A;  2AP6 A;  3M05 A;  1FXD A;  3CDU A;  2W4D A;  4PXB A;  2P9C A;  2RQC A;  5L1L A;  3FSY A;  3MXH P;  1LQ9 A;  1GXT A;  3LUY A;  4H4M B;  4HTJ A;  1H7X A;  1U1Q A;  1LKZ A;  5LMN J;  5K9F A;  4ZLP A;  5IT9 U;  1N0V C;  3M8P A;  4X64 J;  3TRG A;  1D8Y A;  2DNG A;  3PV8 A;  3VHQ A;  5T7L B;  3QAE A;  4ECW A;  5F8G A;  1RJJ A;  5ETK A;  3GG0 A;  5KTQ A;  3V6H A;  4Z37 A;  1ZBT A;  5ETS A;  1S1T B;  3FC9 A;  2QMX A;  4DR5 J;  3QJP A;  4OX8 A;  2PD1 A;  2UU9 F;  2CVE A;  2D3Z A;  4EBE A;  1MSW D;  1RTJ A;  3FQL A;  2EKN A;  4Z7Y A;  1IBM F;  3R6G B;  3BSN A;  3T1H J;  2KFN A;  1H98 A;  3HKZ D;  1HQU B;  3ZZP A;  2DR7 A;  1A9N B;  2MZT A;  2XHC A;  2L9W A;  3VGS A;  4Q2M A;  2Z8Q A;  1RAI B;  1WWH A;  2F40 A;  3KG4 A;  1KVI A;  1HNX F;  3VTI A;  4NE9 C;  2COL A;  5IS2 A;  1YJN S;  3CD5 A;  2W4P A;  1FFW B;  2NUH A;  2PFD A;  3IS9 B;  1S7I A;  4OYP A;  3ZZR A;  1HI0 P;  4NMX A;  4KFB A;  2DRD A;  2Z57 B;  3VZH A;  2AX1 A;  1TMM A;  5FDL B;  3HPO A;  1NJY A;  1L3S A;  4LIW A;  3OD2 A;  4KBI A;  3DRS A;  4A8K A;  1FKO B;  1S1W B;  1HWK A;  3ICL A;  3D0H E;  2Z2Z A;  2KYX A;  3NKY A;  3QMQ A;  4OX6 A;  3IP0 A;  2IRU A;  4USK A;  5BYR A;  5C24 A;  4X4T A;  3GIL A;  2FHK A;  2B9W A;  1NND A;  1R8H A;  4YHH J;  4DR3 J;  4NXN J;  2WHO A;  1KC8 T;  2P9E A;  2C2M B;  1C1C A;  3Q8U A;  3I0R B;  1RTD A;  4B17 A;  2FIU A;  1PIE A;  2YPY A;  3T1Y J;  3L3C A;  4PG5 A;  3TYT A;  2CJB A;  2RU9 A;  1S99 A;  4RBU A;  1CUL A;  3VAF A;  3VAG A;  1R6Y A;  1IKY A;  3GYN A;  4FXV A;  2O66 A;  4PXC A;  3J81 j;  2MGZ A;  4I0W A;  5CQG A;  3NGD A;  3K0J A;  3W64 A;  4CO0 A;  1RCO B;  4O3P A;  4DUT A;  1LEO A;  2HAF A;  3LP2 B;  1UVJ A;  2DHG A;  1J5O B;  1M1K T;  2B43 A;  4EUV A;  4EFA C;  3PX6 A;  1YI2 S;  3GJR B;  4UZC A;  4KY3 A;  2EI5 A;  3JSM A;  1TEL A;  1VQS A;  4FPR A;  5KG7 A;  1KNZ A;  1UVL A;  4IRK A;  1GXU A;  5JUM A;  3MPU B;  1HNV B;  2HND B;  1VQM S;  5IV4 A;  1XJW B;  3G6Y A;  3DCA A;  3H7H B;  1F5A A;  2ZH9 A;  2HHV A;  2PC6 A;  3AOC A;  5D15 A;  4NML A;  3VV2 B;  2XO6 A;  1WNE A;  3I5B A;  4RW9 B;  3CCL S;  4IO9 Q;  1CJU A;  2C3P A;  4MYU A;  1HPZ A;  2UUC J;  1VFJ A;  2VPZ B;  2O5D A;  3OVB A;  4P2F A;  5DLF A;  4MKY A;  4WP8 A;  3H25 A;  4NWB A;  1VI7 A;  2DNK A;  2QL5 B;  1RWN B;  2RDD A;  2RB7 A;  3UQS A;  5AXN A;  2GO8 A;  1S6Q B;  3DDI A;  1UL3 A;  2QJ3 A;  2HND A;  2SXL A;  1M0S A;  2VFS A;  1ZM3 A;  1ZM4 A;  1IJE B;  2DYA A;  4LSZ B;  3GU0 A;  4WE1 A;  4X66 J;  4RNN A;  2BEF A;  3KMS A;  5B09 A;  2ADC A;  1FX2 A;  2UUT A;  3CB4 A;  4F2R A;  1FK9 B;  1VLO A;  3BKU A;  2RIL A;  1TVR A;  3QGG A;  2DGX A;  3R3T A;  4ECZ A;  1HMV B;  4AL7 A;  3ZTQ A;  5I42 A;  4M5K A;  2FVQ A;  1TK5 A;  2HQG A;  2BW7 A;  2HBZ B;  3HVW A;  1S48 A;  3I4H X;  3N6L A;  4YB5 A;  2B51 A;  1B0T A;  2GJ2 A;  4F0K A;  3SSQ A;  2G2Y A;  2YX4 A;  4CLS A;  4USI A;  3TA1 A;  4JBC A;  3ZZT A;  1KHV A;  5HLF A;  1M5O C;  2W2Q P;  3Q8Y A;  2BAC A;  2YBV A;  5IV3 A;  3PM9 A;  4KGZ B;  4Y6I A;  4Q45 A;  5CZX A;  3RG6 A;  1Q8L A;  2FGC A;  3NOC A;  2YKA A;  3A12 A;  3RBX A;  5KFG A;  2IHR 1;  3QLH A;  2OP5 A;  2V6A A;  3M4X A;  4QYR A;  5LSL A;  4S0M A;  4IR9 A;  3ZZ0 A;  3RGI A;  2ZUG A;  3I82 A;  3KHG A;  2IJR A;  2V4Q A;  2B8P A;  4RUH A;  2KH9 A;  2B8Q A;  1HIY A;  3RJM B;  2ROP A;  5LMU J;  5D77 A;  3IS9 A;  4ZVT B;  1ZPV A;  5B0F A;  1APS A;  4B9M A;  4I69 A;  3H40 A;  5L9N A;  1JLA B;  3TZW A;  4U8V A;  5EDW A;  2WRM A;  4J9N A;  1HBM A;  1Q7L B;  5DZ7 A;  3K8W A;  2MZS A;  4WFN Q;  2V8P A;  2ACM A;  2L08 A;  3KLI A;  3UN5 A;  4DR3 F;  1RT7 A;  4RW4 B;  4K4Y A;  1NK7 A;  2D69 A;  4OZ2 A;  1JLF B;  4NA2 A;  3EMT A;  3VVU A;  4ZKA A;  1PAU B;  1KEK A;  3OSN A;  2DVI A;  1DZ5 A;  5K8M A;  2IPO B;  1NPR A;  1TZ0 A;  2ZOG A;  4RW8 B;  3QZ7 A;  2WVD A;  3DGP A;  4IG0 B;  2EFP A;  2K1R B;  3WBZ A;  4TLQ A;  2JEF A;  2QA2 A;  1LW2 A;  2FYX A;  3BBF A;  2DH8 A;  3GPA A;  3MGJ A;  5ETM A;  2KRR A;  3AJ2 A;  3VAM A;  2V0N A;  2ZWO A;  1JLA A;  3CE8 A;  2DHS A;  3ETO A;  4DV3 F;  3M8P B;  1SKS A;  2E1C A;  1WC4 A;  1X4D A;  1RT4 B;  4JYA F;  3GFX A;  5DGB A;  1F0X A;  2Z30 B;  1X60 A;  3KK3 B;  4MAK A;  3CT9 A;  2OPS B;  3HSG A;  5CYJ A;  5EN1 A;  2HVZ A;  1OSC A;  2V2Q A;  4V1A k;  5E5N A;  3Q8Q B;  4I67 A;  3DRP A;  1BUX A;  3IA0 A;  4DJB A;  1S59 A;  1FRJ A;  2B56 A;  3RB6 A;  1FRI A;  2GZO A;  4B9N A;  1MMN A;  4A8F A;  1KQS R;  5HP1 A;  2B4U A;  2HVD A;  1VGY A;  5C2C A;  4LFB F;  2WB1 D;  1S6P B;  2GMH A;  3BS9 A;  3HX9 A;  1HNZ J;  3ZZU A;  2M8H A;  1UJ6 A;  2C3O A;  2RKI B;  3IR6 B;  1NKC A;  2UXB J;  2AHO B;  1KN6 A;  4QIV A;  3LOU A;  5JJB A;  1S1U A;  2F5G A;  2QT7 A;  2PEH A;  3FBB A;  5KFI A;  4MKB A;  3BR8 A;  3DLK A;  1X4C A;  2NSC A;  3HLU A;  3KJQ B;  3WHI A;  5LSR A;  4E0D A;  1RHJ B;  2DXF A;  1R6V A;  1TL3 B;  2FC8 A;  3HJV A;  3JSB A;  2IMW P;  2VA2 A;  1FE4 A;  1J27 A;  4WE1 B;  3UCG A;  5A6P A;  3HT3 A;  1RT5 A;  1Y11 A;  4B3M F;  1TV6 A;  3HCX A;  2BKP A;  1YZ6 A;  1N5T A;  1T0T V;  4C7Q A;  1WAC A;  1MU2 A;  1JIH A;  2VFU A;  2M2B A;  4O0N A;  1H74 A;  4F0M A;  5KFA A;  4NLY A;  1IKW A;  1X5P A;  1F9H A;  2Y9H A;  3UD5 A;  4KHP J;  4M5I A;  2R7O A;  3WQP A;  4L3N A;  3CED A;  4PR6 A;  2DIS A;  1FD8 A;  1LWE A;  1KOO A;  1SQG A;  2CDQ A;  4F7V A;  1CJU B;  3P45 B;  3AT1 B;  3GIR A;  3GJQ B;  5H1S V;  1VQ4 S;  2ZH1 A;  2H51 B;  1RAF B;  4J9O A;  1Y0H A;  2FZK B;  3D4J A;  4TQS A;  3KLH A;  4ZIW A;  2ZBC A;  1RGV A;  2Z2M A;  2HVE A;  3LAK A;  2X51 A;  1HQ2 A;  1X4F A;  1W2I A;  4DCJ B;  1RK8 A;  2MZJ A;  2Z2L A;  5DDQ C;  3BQ0 A;  1SCJ B;  4ECV A;  1U49 A;  4JI0 F;  3JS9 A;  4MT1 A;  4I7F A;  1F5B A;  5E3R A;  1FKP B;  1F6T A;  1PCA A;  4X62 F;  4RNO A;  4DQP A;  1SIW B;  1WF2 A;  2BJ7 A;  4NLS A;  2RAQ A;  2XMU A;  5A8K A;  1QD1 A;  1WEY A;  1T05 B;  3K5N A;  4NXN F;  5H9F K;  4DR2 F;  4LBH A;  1U8S A;  2YQ3 A;  3N01 A;  2X1G A;  4UST A;  3M30 A;  3VR1 A;  2CPX A;  3LAM A;  1SJ4 P;  1FNX H;  3IG1 B;  4P75 A;  4O44 B;  1RWV B;  1XQI A;  4QZV B;  3WX4 A;  1AFI A;  1KVK A;  5GAE U;  3MEC B;  3FCW A;  3P8B B;  3PY8 A;  3E01 A;  3NGS A;  5KFR A;  4H4O A;  1S49 A;  2CVI A;  3CW2 C;  4DV6 J;  2BQU A;  5CXT A;  3BF4 A;  3ETM A;  4J9Q A;  4RW9 A;  2W7A A;  4USV A;  2DJW A;  3I0S B;  1D3W A;  1N52 B;  3DOM B;  1FWP A;  1RHQ B;  4DL4 A;  2DR8 A;  2D41 A;  2DHA A;  4LF6 F;  4D3G A;  2IVM A;  2B5J B;  1O6X A;  2BJ9 A;  2V4J A;  5A8R B;  4MH8 A;  4RZR A;  2RQM A;  3TAQ A;  1S1V A;  2WVE A;  2YX7 A;  1VQ7 S;  2DNZ A;  3D1O A;  5K14 A;  4PWU A;  2E9Z A;  4WU3 A;  2DXD A;  4J9V A;  5L39 A;  4PPD A;  5AXM A;  3MTK A;  4C11 A;  2ASD A;  1SKW A;  3R2C J;  1BQM B;  1IWA A;  2EK1 A;  3N5B A;  4KGV B;  3JYT A;  4O3R A;  3MM5 A;  1LV5 A;  2XLK A;  1J5O A;  4BLG A;  4PAB A;  3L95 X;  2VFT A;  4F4Y A;  3GMG A;  3HDS A;  4AYB D;  3A8J A;  4E2F B;  3DRR A;  2YH1 A;  3WIV A;  2HGL A;  1UJ5 A;  3C46 A;  5KOW A;  2E66 A;  3EZO A;  3GQC A;  2XMJ A;  2FHJ D;  1PGZ A;  1RYS A;  4TYB A;  2VB6 A;  3DFE A;  1L3K A;  4KPY A;  1FES A;  3VZI A;  4TVA B;  3PVX A;  4A8Q A;  2KG1 A;  1M5P C;  5KG6 A;  3H98 A;  4TY8 B;  3SEO A;  1D1U A;  1SL0 A;  2NPF A;  5KFD A;  3DYA A;  4USH A;  2VUG A;  1F2H A;  3OTD A;  3M9M B;  3DOL A;  5I4M A;  3DRS B;  3MUT P;  4LIR A;  4BWM A;  1KQG B;  3C6T A;  3PJ9 A;  5GAD I;  1NCL A;  4B3T J;  4ER8 A;  2XS2 A;  2HBY B;  5CCM A;  1QVF R;  3FEX B;  4ANC A;  3QPI A;  5ETV A;  1MWY A;  2JHE A;  2VG5 A;  2ZNY A;  2FVS A;  1CLF A;  1NZ8 A;  4PWD A;  1WHW A;  2HAI A;  2WBR A;  5HQL A;  4AL6 A;  2E5G A;  3HHL B;  1HYS B;  3O8W A;  1Q53 A;  2M4M A;  2HKE A;  1XC9 A;  3CCU S;  4B3O B;  4PWW A;  2DHX A;  3U02 A;  1JXL A;  2GJI A;  1DTQ A;  4C97 A;  3CXC R;  5BR8 F;  3CCQ S;  2BRK A;  4RW7 A;  2ZD1 B;  4I6W A;  4ZN1 A;  3A8E A;  4NLO A;  2ZH3 A;  1VQ9 S;  4WYL A;  4PYA A;  3UI3 A;  1R0A B;  1X31 C;  2ACY A;  1Q8K A;  4BC7 A;  2R7X A;  2U2F A;  2AWZ A;  3ISZ A;  3NAH A;  3OFG A;  3HHL A;  3MM5 B;  4UT4 A;  1MNE A;  4AUK A;  3JYT B;  5L1I A;  4DLG A;  1HYS A;  2NYI A;  3OL8 A;  2RNE A;  5SZT A;  4ECX A;  2VL1 A;  1RDR A;  4C6A A;  3M1V A;  1XNR F;  1UEU A;  2VOO A;  3I87 A;  3DGV A;  3IFE A;  5J2P A;  4OX9 F;  2V2Z A;  4GVL A;  3AQP A;  2LCW A;  3OR2 A;  1D8Z A;  4DV1 J;  3EE3 A;  2KDO A;  3DYA B;  2WTF A;  1T7P A;  1NH8 A;  3TAN A;  1AUS L;  1GTE A;  3DOK B;  3MMB A;  3RU0 A;  2AYG A;  1WTF A;  1KQK A;  5JXS A;  3DDK A;  4BHQ A;  2PN6 A;  4A4J A;  2KYZ A;  2IM2 A;  1TK8 A;  4AQY J;  4RNM A;  1TP7 A;  4MK8 A;  3P5T L;  4MIW A;  3CC2 S;  2BOA A;  4YY3 J;  3Q0A A;  2Z4P A;  1K1S A;  1LW0 B;  4ZCK A;  2MLZ A;  3MPD A;  4R0E A;  2UVR A;  1KR4 A;  1FTR A;  1YZ7 A;  2AGP A;  2EFN A;  4OHX A;  4RBV A;  1DQ8 A;  2GGP B;  5D4P A;  4JI8 F;  3RW7 A;  5DDP C;  1QSY A;  2XI3 A;  2A10 A;  3M6V A;  1FRK A;  1GAO A;  1PYS B;  1UZD A;  1TL4 A;  1BQM A;  3G96 A;  2OFG X;  2AJ4 A;  3O2I A;  3ZXW A;  5IZH A;  1AUD A;  1JNR B;  2J6S A;  1RHR B;  3QAU A;  4OZ5 A;  5KG3 A;  5HBM A;  1REG X;  4B3R F;  1T9T A;  4ZVG A;  3DLG A;  3K8V A;  1RYR A;  5AXK A;  1IN0 A;  2MQO A;  2HVI A;  1YJ9 S;  1JLQ B;  1NBE B;  4G6V B;  4WFA Q;  4OV6 A;  5KT3 A;  5MLC V;  3J7Y U;  5ADZ A;  1V5V A;  5HSP A;  2Y1R I;  4WFY A;  2WZ1 A;  4I2Q B;  5J2M A;  2BXJ A;  2A18 A;  3B78 A;  3H59 A;  2CWX A;  2BJE A;  4ECU A;  4LMZ A;  1DUR A;  1OQ3 A;  3E01 B;  2PDA A;  2CYY A;  3CC4 S;  3W2W A;  4ED8 A;  2F4V F;  3FNN A;  3GYG A;  3R27 A;  4G65 A;  3UCU P;  1WI6 A;  3MMA B;  4DG1 A;  2RVJ A;  5JMN A;  1XER A;  2BAN B;  3VGU A;  4RW6 A;  1FKA F;  4B9T A;  1VRT A;  3BGO P;  3MWB A;  4TU7 A;  3DLJ A;  4ECQ A;  3AD7 C;  2ZM6 J;  4DSE A;  4QR2 A;  5D0E A;  3LF0 A;  1PC4 A;  5T41 A;  4C8N A;  1B64 A;  2J0X A;  1KLM A;  2JVR A;  2M70 A;  3IBW A;  4NLV A;  1ZZF A;  5FII A;  3OUY B;  2LDI A;  4BDP A;  1NSQ A;  4HKQ A;  4WZQ A;  2ZIT A;  2W7O A;  2R8G A;  5KFH A;  1Q7Y T;  2ZZN A;  4KRW A;  3BH6 B;  3UD3 P;  4DX8 H;  3QGP A;  4ID5 A;  2IA0 A;  5GMD A;  4FYD A;  4A48 A;  1QTN B;  5HL7 Q;  4B9S A;  3P5B P;  1XR5 A;  3OR1 A;  4FS1 A;  3AJD A;  4O23 A;  4KH0 B;  1LWE B;  4NZ6 A;  1F3F A;  3BEG B;  3HD2 A;  1U6Z A;  4YR0 A;  1BD6 A;  2HS4 A;  2C2K B;  1IKW B;  4L76 A;  3RR7 A;  4K5S A;  1U8W A;  1U02 A;  4IOC Q;  1RZM A;  1S57 A;  1T02 A;  3GJT B;  3IR5 B;  3R7S B;  4Q43 A;  3KXD A;  3NP5 A;  3DLE A;  1RWW B;  1DY3 A;  4JI2 F;  2PI4 A;  4GMK A;  2OO4 A;  1WI8 A;  1ZM2 A;  2CAJ A;  3M8W A;  4RX6 A;  2QA4 G;  5IQ6 A;  4O3S A;  2ZJR Q;  3SZ2 A;  1RIS A;  2FJA B;  1YHQ S;  4YFU A;  1CJV B;  4HAC A;  4C8L A;  4USJ C;  2R9L A;  2HVH A;  2EEY A;  3SSS A;  4RR5 A;  3KKF A;  2PMZ D;  4CH0 S;  2XSF A;  2NCK L;  4J9K A;  2QFJ A;  5EUH A;  4DFK A;  3W61 A;  2XSJ B;  2YKN A;  3FFI B;  3SIP B;  3W5Y A;  5LJ3 Y;  3MAA B;  4FF1 A;  4PRF A;  3ET6 B;  3QO9 A;  3K58 A;  4QU6 A;  4ZJO A;  2UXC J;  4P2S A;  2HQD A;  2XSJ A;  1P1L A;  1LWF B;  2YKN B;  3FFI A;  2KT5 A;  2CWK A;  2X1A A;  1GFW B;  4P74 A;  4J9P A;  2ZH5 A;  3I9V 9;  3PRV A;  2LXI A;  1QAI A;  2J9E A;  4PAA A;  2PI5 A;  3AD8 C;  2CPZ A;  1WOS A;  1WDD A;  4ZPV R;  1HD1 A;  1JLG B;  2HQI A;  1QAY A;  1YSJ A;  2ILY A;  2CQ1 A;  4DR1 J;  3DM2 A;  1KRP A;  4LFA J;  1S4F A;  2DR9 A;  3UPF A;  1FHT A;  3S8S A;  1JLE A;  1YRX A;  1WG4 A;  3MM9 A;  5BXI A;  4NLR A;  5IWA J;  1J2V A;  2DTJ A;  3SQG A;  3KYL A;  1NO8 A;  2CQC A;  5ETN A;  3LGH A;  2VPX B;  5A8W A;  4DUY F;  1FRH A;  1SQE A;  3US5 A;  2XGP A;  3QGI A;  2R4F A;  1YTY A;  2OH2 A;  1PYO B;  2OPR A;  3PEJ A;  2DEJ A;  3KFW X;  2YXL A;  1VRQ C;  5RUB A;  3RB3 A;  2YWH A;  5A2Q U;  2UUB J;  1SV5 B;  3I6P A;  4URS A;  4ZVE A;  2IMO A;  1KOH A;  1Q16 B;  2FDN A;  4RW8 A;  2HHP A;  3QBC A;  2P6T A;  5B0G A;  4A8Y A;  5GMK a;  1UP1 A;  4TN2 A;  4RLE A;  4IRD A;  3ENV A;  1DQA A;  3HVT A;  1CS4 B;  4LF7 F;  3NS5 A;  1SQF A;  1R8P A;  1T94 A;  1N48 A;  3I5C A;  1XBW A;  3FJ2 A;  4IQX A;  3BYP A;  1NDK A;  3MPW A;  3QNW B;  4NLT A;  1NJW A;  4NCB A;  4QR0 A;  5F9N A;  1PJ6 A;  2FTR A;  3CJ3 A;  2MPU A;  4KGK A;  2C2D A;  1B99 A;  1HA1 A;  4NCA A;  2OML A;  4IYQ A;  2C2Z B;  4CLT A;  2LA4 A;  2R42 A;  3CJ4 A;  3G82 A;  2N3O A;  1RT6 A;  3OXF A;  3IM9 A;  3ZFV A;  1E6Y A;  4LRE A;  4JOU A;  5HMY A;  1CJT A;  5J1E B;  2AEM A;  4FZV A;  2ALY B;  1FJG F;  1XWL A;  2NS1 B;  3UWT A;  2I6W A;  1FDA A;  2B0G A;  4XAK A;  4PQA A;  3U1L A;  1UEV A;  4OYM A;  4OV1 A;  4LF5 J;  2MYF A;  1N0U A;  1RWO B;  5HLF B;  2VV5 A;  1HNI B;  1Z4U A;  2MXY A;  5L46 A;  2AGQ A;  2DRA A;  1FEE A;  1I5O B;  1O51 A;  2V68 A;  2H5I B;  3PRD A;  4NYP A;  3M7V A;  1TL1 B;  1WKL A;  3FCV A;  2IM0 A;  3PAC A;  5KFJ A;  3TJA A;  4CIO A;  2GO9 A;  4RBT A;  4LRF A;  4OIX A;  1NDC A;  5I42 B;  1F5C A;  3MFH A;  3RR8 A;  2DNM A;  3HK2 A;  3Q22 A;  2BJ1 A;  1UFL A;  2O01 C;  4MYT A;  4ATN A;  4ZVR B;  1ZZN A;  2JWN A;  3Q2T C;  2EKY A;  2J0W A;  4OZN A;  3GII A;  4QWE A;  3HXM A;  2ATC B;  3A3P B;  2XMV A;  4YY3 F;  2HZV A;  2XB2 D;  5ETL A;  3OL6 A;  4Y2K A;  3FBF A;  4IOB A;  5HMZ A;  1R0B G;  4AQY F;  3DMJ B;  4DS4 A;  3PW0 A;  4ZP8 A;  1K44 A;  4OJH A;  3DLL Q;  3W2V B;  3QFW A;  3OLB A;  2V63 A;  1VDH A;  3B54 A;  3CDA A;  1KQF B;  4ALZ A;  2QEX S;  1JWW A;  2DGS A;  2IBO A;  4MJK A;  1HPZ B;  4P72 A;  2YNH B;  4WKY A;  2XYH B;  3RUB L;  2R8I A;  4B3S J;  4JI4 J;  1KSP A;  1Q0N A;  3CJK B;  1EJ7 L;  4ID8 A;  1FT8 A;  2FVR A;  1CJK A;  3QGH A;  5KG4 A;  3K57 A;  4ZLL A;  4DV7 F;  1SB6 A;  3PHE A;  1H2V Z;  2G0J A;  2HUR A;  3HHN B;  4NXM J;  2HMI A;  2VOP A;  2HFU A;  2DB1 A;  2GIR A;  3LH2 S;  3TZY A;  4F4K A;  3UN2 A;  2DBB A;  2Q1L A;  2CG8 A;  2NZC A;  1LK5 A;  2NUU G;  3MI7 X;  3OPK A;  3NGR A;  4HHJ A;  4P7V A;  3GB0 A;  4UOC A;  2KT2 A;  3Q8P B;  3TWZ A;  4F50 A;  5LM7 E;  4KGX B;  5KFQ A;  1Y5L B;  2G0I A;  2LU2 A;  1N5V A;  3VVT A;  4CZC A;  2XCP A;  1I94 F;  1SKU B;  2NXE A;  1VBZ A;  1FNO A;  3BH7 B;  2ZBI A;  2MTL A;  4QQB A;  5C25 A;  3MUV P;  2J0S D;  3TO8 A;  1T9U A;  1K8A T;  4WJB A;  2C2O B;  3CJ8 A;  5ETT A;  3GZ7 A;  1HNW F;  1AZS A;  1T03 A;  4FYX B;  2K2P A;  3H90 A;  7FDR A;  3L09 A;  4ES2 A;  1SV5 A;  3D0I E;  3H2L A;  3I0R A;  3RTV A;  2K3K A;  4NRT A;  2CQ0 A;  3BSA A;  2GS8 A;  2FJW A;  2UUB F;  4DR7 F;  5T7L A;  4RU9 A;  1S9E B;  3HHK A;  4A8M P;  3MD3 A;  1KBR A;  2OEJ A;  3HFV A;  5AE1 A;  3QJL A;  2OD4 A;  2BM1 A;  4J9M A;  4I4B A;  5CAA A;  3KJV B;  2RF2 B;  2APO A;  3CCZ A;  1YRU A;  2MLX A;  1XK8 A;  2YTC A;  3GR1 A;  3VF0 B;  4AFF A;  4F8R A;  1VQP S;  1S1X A;  2JC0 A;  4X4P A;  2KXN B;  2NXJ A;  2PO4 A;  2ZBQ A;  2BE2 A;  1RAO A;  3KHL A;  5C42 B;  2V2K A;  2HLT A;  4KQZ A;  4TY8 A;  2PT0 A;  1ZAX A;  3UDE A;  5KT7 A;  5JVH Q;  1NME B;  1OPZ A;  5KFW A;  1X4A A;  2MKI A;  1M5H A;  2OPP B;  1G6B A;  2QX0 A;  3D7S B;  3IC1 A;  3BDE A;  4IFV A;  4JB8 B;  3T19 A;  4UUW A;  2ZFH A;  4LQ9 A;  4ICL B;  5KFX A;  2FZC B;  2ZM6 F;  3CJ5 A;  2LYV A;  1KP6 A;  3MOJ B;  1Y5I B;  3AY0 A;  3R5D A;  1SVD A;  1X5O A;  2D9P A;  3I96 A;  1HHS A;  3TEH B;  3JXO A;  5C42 A;  3NLC A;  1FDN A;  4QIE A;  4IH7 A;  2BE7 D;  4CYU A;  4K4Z A;  4CO2 A;  2XTJ P;  4F3M A;  1GMU A;  2YX1 A;  1M1G A;  3ILJ A;  4PG7 A;  4YS2 A;  5L38 A;  2R7W A;  4L73 A;  4JI6 J;  3CJ2 A;  3MUM P;  1FFG B;  3CCE S;  2CA9 A;  1YJU A;  1Z2Z A;  3SSR A;  4DL0 C;  3DU5 A;  3K89 A;  2B3T B;  5GAG U;  4FNI A;  1JJC B;  4OJ1 A;  2VD3 A;  4IUF A;  4BCA A;  1YVF A;  2EG1 A;  1YIJ S;  2J8S A;  4DEZ A;  3TP2 A;  2ZH6 A;  2DY9 A;  3TOQ A;  1NK0 A;  2RRA A;  1UVI A;  3G2X A;  4H4O B;  4XK8 C;  2BDP A;  1JQG A;  4JI5 J;  3V6J A;  3N0V A;  3PJX A;  3BQ1 A;  3DU6 A;  1JKH A;  5F0U A;  1Q8I A;  1W7W A;  2CIM A;  3MM6 B;  2IRY A;  4L74 A;  4OYO A;  4KV8 A;  1DRZ A;  2M52 A;  3KLE B;  2V4R A;  3MMJ A;  2ZH7 A;  4DR2 J;  2P2C B;  2B9E A;  4X4R A;  1OIA A;  4IG3 A;  1IBK J;  3UW1 A;  2QZ8 A;  1D9A A;  1R7I A;  2B9Y A;  2HMI B;  1X0P A;  5B0A A;  1H7W A;  4P9S A;  3NGT A;  1TKT A;  4LF8 J;  4P2X A;  1FER A;  3H4D A;  3CCS S;  4Q2L A;  3IAS 9;  3T1A A;  1HQE A;  4C11 B;  4JV1 A;  2JC1 A;  3K2Y A;  1IKX B;  4JV0 A;  2QLW A;  4I7F B;  4IFY A;  2E1P A;  5CAB A;  4RU2 A;  1BC6 A;  5KFS A;  2DIU A;  4ED0 A;  3PZP A;  1EQ0 A;  1NSK L;  2HNZ A;  2BJ3 A;  2HQ3 A;  1U25 A;  4WBF A;  3N4W A;  3DI6 A;  4ETX A;  2EW9 A;  3N79 A;  2KFZ A;  2F7V A;  1GEH A;  2FGO A;  2LQ8 A;  3TA2 A;  3ISN C;  4DG1 B;  3ENQ A;  4M1K A;  2R8K A;  2MLY A;  4DN0 A;  2YNH A;  3G86 A;  4KT0 C;  3MM7 A;  2OFH X;  4LSL B;  3D6H B;  1NK6 A;  4L75 A;  1FX4 A;  2WAQ D;  3CDB A;  4K4S A;  3TVZ A;  4ED4 A;  5GAE I;  1HBU A;  2ILZ A;  3OL7 A;  2XLI A;  3IWX A;  3KLG B;  3MDF A;  1IWG A;  1PJ5 A;  4ZPC A;  5J2Q A;  3M2R B;  1NH7 A;  2YVS A;  4K2J A;  5SUH A;  2BQ3 A;  1GK8 A;  4CCH A;  1RT5 B;  3T9N A;  5BR8 J;  3C14 A;  1B7Y B;  3MR6 A;  3NS6 A;  3OHA A;  1VC6 A;  3JQM A;  5HN0 A;  2DIV A;  2V69 A;  3EUN A;  4DPO A;  4GKK F;  2WOM A;  3EXY A;  3THP A;  1MML A;  3IO1 A;  4C0O C;  5B0C A;  4Q0B A;  3T1H F;  4N8N A;  3SXL A;  1G7C B;  2OUG A;  4MIA A;  3R97 A;  5EGY A;  1VBX A;  1K47 A;  1MW7 A;  2WSE C;  5KFL A;  4NLG A;  2XZD B;  1ZET A;  1KD1 T;  2OI2 A;  2DCL A;  1GMW A;  2Z58 B;  3G82 B;  1RTZ A;  1OO0 B;  3K59 A;  3HZE A;  3N6M A;  1V3Z A;  4FYV B;  2AV5 A;  3CGI A;  3TAP A;  4JI1 J;  4FVM A;  4DFJ A;  5HP1 B;  1LFP A;  2AMC B;  1U4B A;  3NL0 A;  4QIF A;  3BKF A;  1EKS A;  1UCN A;  1MRO A;  2VBX A;  4KE5 A;  4KKO A;  5L8R C;  3QZ8 A;  4JI0 J;  1MG7 A;  6FDR A;  2G1H A;  4LT6 A;  4IOA Q;  1DFD A;  3D68 A;  4R25 A;  5D8H B;  4ZCM A;  5B7W A;  2HWI A;  1BQN B;  2J9D A;  4YR2 A;  4N7T A;  2Y8Y A;  3BM7 A;  1UVK A;  2DY1 A;  1S6O A;  1NK9 A;  2YWG A;  3EPG A;  1PO6 A;  4GC7 A;  2Y8W A;  4ILM A;  2J7U A;  5GAD U;  5EWG A;  3TJ8 A;  4EI2 A;  3GV8 B;  4N5S A;  2ROE A;  3BDP A;  2F1F A;  1NHV A;  3Q2S C;  4ELV A;  3GCW P;  5A0Y B;  1RAB B;  2BVZ A;  1C0T A;  3NCQ A;  4LUB A;  5DG8 A;  4U7C A;  4Y2C A;  4NCG B;  4DPX A;  4YB1 P;  4C4W A;  1WG5 A;  4LF9 J;  3M8Q B;  1RWU A;  2LMI A;  4NI2 A;  1BLU A;  3GCX P;  4BS2 A;  4X4O A;  2KZZ A;  5FJ4 A;  1GXL A;  1VLY A;  3EZU A;  3IBF B;  3SQG B;  2ZD1 A;  3OJU A;  3IRW P;  4RW7 B;  1J5E F;  2HHH F;  3IM8 A;  1WHX A;  2IM3 A;  1HHQ A;  2JRS A;  1JLE B;  5HO4 A;  2WCX A;  4FKX A;  2OPP A;  4FKY A;  4IFV B;  2DNL A;  4ZJL A;  4O3O A;  3MMC B;  3BGL A;  1X4B A;  1NHU A;  3C15 A;  1HBM B;  2Q43 A;  1WF1 A;  2Q6B A;  4KGM A;  4OJ3 A;  3JAM U;  1NJZ A;  3PX0 A;  1PJ7 A;  3NWG A;  4TU9 A;  2HYI B;  2CJK A;  3P49 B;  3TX0 A;  3DRP B;  1YJT A;  2BKN A;  4U95 A;  5L1J A;  1VRU A;  3MMC A;  2W8L A;  2YWK A;  1ULR A;  1XMB A;  4OFZ A;  2PA3 A;  4I56 A;  2YWE A;  3RW6 A;  4F4A A;  4YME A;  2RF2 A;  2JLF A;  1N88 A;  2BKO A;  5F8I A;  5DDR C;  4NYZ A;  1HBN B;  2UXD J;  4URQ U;  4CLW A;  2UUW A;  4QR1 A;  1S0M A;  3MED B;  4UTG A;  1XR6 A;  3W5Z A;  3RZA A;  2E5I A;  2KVQ E;  4XDD A;  1ZA2 B;  2RUG A;  3B8H A;  2GML A;  3Q86 A;  3FCH A;  3AOB A;  1KDN A;  4KR0 B;  4WPA A;  3DGP B;  4IG0 A;  3VCD A;  1KWM A;  2QYC A;  2DR6 A;  3ZNJ 1;  1FTC A;  2PMW A;  5KG5 A;  2BUN A;  2IYG A;  3EVM A;  4J91 A;  1SL1 A;  1C0U A;  2CJY B;  4RL1 A;  4YEA A;  3W7B A;  1HI8 A;  2UUA J;  1VJW A;  5C25 B;  2IDL A;  1REV B;  2NPI A;  2QTW A;  3N6N A;  5M2U A;  3TI0 A;  5LL6 d;  4LF4 J;  2VF3 A;  2CQ3 A;  3GFY A;  2MQL A;  5KG1 A;  2ZVS A;  1TVR B;  1O0P A;  1Y3J A;  2M0G B;  4K0K F;  2J7W A;  3FSX A;  3KHR A;  2GHV C;  3QFH A;  4DN9 A;  1H6K X;  1Y4Z B;  2LXF A;  3R8Y A;  4P6Q A;  4RNH A;  2O3D A;  2HGM A;  1K1Q A;  4N8O A;  3NXZ A;  1DLO B;  2RDI A;  5HVH A;  5LT5 A;  2HFN A;  1TKX A;  2VDI A;  4QYZ K;  3N28 A;  2RQ4 A;  2VZ9 A;  3KJF B;  1JJH A;  1D9F A;  1RT3 A;  4K4W A;  2F8E X;  1X4H A;  1RHM B;  2KN4 A;  3V6K A;  5KFE A;  2CQ4 A;  3MR5 A;  2D3O R;  2ZH2 A;  4W90 B;  2K7J A;  2XI2 A;  1U1O A;  2DEI A;  1HI1 A;  2XZW A;  2GQQ A;  4L6V 3;  5HMX A;  4NLX A;  1H2U X;  1HAR A;  3GON A;  2WW8 A;  3Q8V A;  5K8O A;  1QTM A;  3PXG a;  1P27 B;  3ZZZ A;  3K5M A;  2AJF E;  2NQP A;  3W2V A;  5DG7 A;  3PKY A;  2MQ8 A;  2KL8 A;  4KH1 B;  2CPE A;  2FZG B;  3UO0 A;  4LRA A;  3EX7 B;  4DV1 F;  2HFV A;  2V34 A;  4M5G A;  3PX4 A;  2IFX A;  1HW9 A;  3GIJ A;  4FXD A;  4K50 A;  3AXM A;  2A6M A;  3G8Q A;  3LP1 B;  3NG8 A;  4LVO P;  4NLP A;  4DPU A;  1FK9 A;  3DHX A;  5A76 A;  2PII A;  2QL7 B;  2VKR A;  3OVA A;  4KIA A;  1QE1 A;  2VFR A;  2DKO B;  2H3E B;  2RRN A;  2ZHO A;  4JI3 F;  2UXC F;  3LQV A;  1FJE B;  2HHS A;  4LSL A;  2VC0 A;  2AU0 A;  4C3L A;  2DO4 A;  4HVZ A;  3BKT A;  2WVC A;  1ZM9 A;  4J90 A;  4IDK A;  2CUY A;  2HNZ B;  1RSC A;  1U6F A;  2JOQ A;  1YRT A;  1UET A;  1VOM A;  3OLA A;  1HNI A;  2DPI A;  4KHR A;  2JFD A;  2F65 A;  2QLJ B;  5I3U B;  1ZOT A;  2GNK A;  2ZZT A;  1UMJ A;  1RTI B;  2B6A B;  5HAN A;  4JI4 F;  2GIQ A;  1GNK A;  1HWJ A;  3NBP A;  3GE9 A;  2EBE A;  1EET B;  4LR7 A;  5LXR A;  1HLW A;  2G4B A;  1OSD A;  4JP8 A;  4O4R A;  2N82 B;  1TKX B;  4BWJ A;  1RT6 B;  3BGF A;  1YBA A;  3MPY A;  2CG4 A;  2EXU A;  3MOZ A;  3L4B C;  5HBM B;  3PIP Q;  2C2R A;  1QLN A;  4OQJ A;  3TAM B;  3BR9 A;  1Z2L A;  4HI1 A;  4TKT A;  1VQ5 S;  1JKH B;  1CBK A;  1RWK B;  3PYF A;  4TNO A;  5E3C A;  5D0G A;  3WC0 A;  4C3K A;  3D1Q A;  5KFF A;  2JSX A;  3KLF B;  3OTE A;  3OJS A;  5HVG A;  3DLH A;  1O5J A;  1E6V B;  3W60 A;  1NAQ A;  2IVY A;  1UTA A;  2UU9 J;  1WC5 A;  4WWS A;  1RT2 B;  3W9I A;  1T9Y A;  1UPM B;  2HFO A;  4Y2A A;  2R8H A;  3M6X A;  3MHY A;  3BN7 A;  3P4U B;  4MK7 A;  1VJQ A;  3MEG B;  1OY6 A;  5F3Z A;  2GFF A;  2ASL A;  3TZX A;  1U1R A;  2LEB A;  2HRT A;  5J1N A;  3UVJ B;  1PC5 A;  2ZKT A;  3CCM S;  2M9K A;  2PGC A;  1Q8B A;  3DOK A;  3MMB B;  1R31 A;  1YBU A;  1WC1 A;  3TVY A;  3HFK A;  1XTZ A;  4X65 F;  1YDL A;  3OR2 B;  3EJM A;  4U67 Q;  4LF5 F;  5A8W B;  2BMB A;  4M5D A;  1AA1 B;  1VQ8 S;  4OHY A;  4K4T A;  3BGR B;  4IH6 A;  4EK2 A;  4ED1 A;  2OSQ A;  3FZ2 A;  4CM2 A;  1YWX A;  4F26 A;  1URR A;  4Y2M A;  2QSW A;  2VBZ A;  3M32 A;  1FD2 A;  1RHK B;  2GHP A;  2JJ4 D;  2YNG A;  5HRO A;  1GTH A;  3L7P A;  1EB0 A;  5IM0 A;  2BAB A;  4JYA J;  3ZTS A;  2RS8 A;  5KG2 A;  3AB2 B;  2ZH8 A;  3C15 B;  2JL9 A;  3CJS A;  1KS2 A;  2OEK A;  2RQK A;  3MCN A;  2HZC A;  2B7C B;  3PYG A;  5ETQ A;  2AIR B;  5M2R A;  5J2N B;  4O3Q A;  5HRO B;  2MMY A;  2MKK A;  1SKR A;  2VG6 B;  4IKA A;  3VAK A;  3VAL A;  2HZA A;  3ONQ A;  3ET6 A;  1TKZ A;  1JLF A;  2DH9 A;  2ZDP A;  2G9O A;  4DX5 A;  3KJV A;  1ZH5 A;  3HUL A;  1X7V A;  1Q4R A;  1Y5N B;  2GJF A;  3BSC A;  3LGN A;  4NPO A;  5CD4 A;  3PO5 A;  3RRG A;  5GME A;  4B9L A;  4IRC A;  4WXW A;  4EZ6 A;  4EBC A;  3EVW A;  2ZZM A;  3OTO J;  2ZHA A;  2VG5 B;  4LF9 F;  4N41 A;  1VQ6 S;  2UZA A;  5KFK A;  5AJ3 F;  1NRK A;  2I1R A;  2L41 A;  2G2O A;  3L7U A;  2A2C A;  2J76 E;  4ZP7 A;  2D7S A;  4OI6 A;  4FVC A;  2NRE A;  1N36 F;  2CXE A;  2V8H A;  4DV4 J;  1AZS B;  4NZ0 A;  1MMD A;  1OJ4 A;  2LQB A;  3G6V A;  1T03 B;  2E5L J;  3D1H A;  3LPE A;  4P52 A;  4PG6 A;  3ZTR A;  1I94 J;  2GQC A;  3PRB A;  3MCO A;  2XNQ A;  3RRH A;  2MKS A;  1P9Y A;  2GVZ A;  4OYZ A;  2BV3 A;  1M5S A;  3I31 A;  3OV7 A;  4JV5 F;  2GIF A;  2D9O A;  2J5A A;  1IBK F;  2XS5 A;  1AXQ A;  1SIZ A;  1I1G A;  1U0H B;  3IXQ A;  4ZS6 A;  1WF0 A;  1S1V B;  4ID5 B;  2XMT A;  1GH8 A;  3JSR A;  2XMM A;  1DTT B;  1ZAW A;  4K7Q A;  3AOD A;  4Q7A A;  2UXD F;  4WIQ A;  2L9D A;  1ROF A;  5AXL A;  5DG9 A;  2CPI A;  2GAH C;  3DOM A;  2XUL A;  4NOH A;  1S5Z A;  4B9U A;  5C5J A;  1DHM A;  4IH5 A;  4PXD A;  1JXE A;  4DLE A;  4B3R J;  2XY6 A;  3F0N A;  2B7B B;  1B70 B;  1QVG R;  4TQR A;  1JMT A;  2GMJ A;  3GWC A;  2UV8 G;  4WTO B;  1JNZ B;  1PYT A;  3LTO A;  1FDD A;  4CRJ A;  4XPC A;  4FS2 A;  1RAE B;  2VBY A;  4X66 F;  4X4S A;  1VRT B;  4RW6 B;  3KUG A;  2VU5 A;  3DMJ A;  1HD0 A;  1QUV A;  2W4C A;  3I0S A;  4JUZ A;  2MDA A;  4LSN B;  3J7Z T;  5E3A A;  1BY9 A;  2XBP A;  4NA1 A;  3JTN A;  3QQC D;  3EIC A;  3HVA A;  3THT A;  7FD1 A;  1SI9 A;  2LKZ A;  1NM2 A;  4B08 A;  5HQM A;  3TQE A;  4CP5 A;  4F4Z A;  3RBD A;  2FVP A;  2UXB F;  4RNF A;  2OEL A;  1SL2 A;  3SDE B;  2MKH A;  1HKA A;  1H73 A;  1T9W A;  4N47 A;  3TX8 A;  4DZD A;  5KFB A;  3CC7 S;  4K5R A;  2IDE A;  2E5H A;  5EX3 A;  3U7J A;  3BO3 A;  2XY5 A;  1R43 A;  1KTV A;  2VIC A;  3IAM 9;  3GV7 B;  1SJ3 P;  2YKM A;  1L3U A;  5DLG A;  4PG4 A;  4DV0 F;  4DUZ F;  2CDR B;  2HBQ B;  5CHC B;  2MEW A;  4G1I A;  4O0I A;  1TL1 A;  2JEG A;  1RP5 A;  3H8Y A;  1VMB A;  2VH7 A;  4ITS A;  4LRC A;  1T05 A;  1RA7 A;  3BRE A;  3M8R A;  2XEX A;  3C8Y A;  5A8K B;  3POT B;  1B0V A;  2BX6 A;  2Y3Y A;  2XWX A;  4Y00 A;  3AA8 A;  3C16 B;  1HWU A;  3S1T A;  1Q81 T;  1SJR A;  4OZL A;  4EU0 A;  3NEK A;  4X65 J;  2W2O P;  3IGN A;  2QMW A;  3T5K A;  2CPF A;  2EWH A;  4IG3 B;  4DU7 A;  3SCK E;  1U0H A;  3W3S A;  3KLE A;  2K7K A;  5H9E J;  3I32 A;  3MM6 A;  3PR5 B;  1TFW A;  1XNQ J;  1U6B A;  2YWF A;  4QOT A;  3CCJ S;  2VJU A;  5IQQ A;  3AFG A;  1RTD B;  4C8K A;  1C1C B;  1FE0 A;  4ERD A;  3ZC4 A;  1HFE L;  4OZ3 A;  2C22 A;  3LAL A;  4OYX A;  1FWL A;  1N32 J;  3H42 A;  3LO3 A;  2HG4 A;  3IRX A;  3U1N A;  3ENA A;  5F8H A;  2DIT A;  5HAO A;  2MHN A;  2VQF J;  3DLK B;  3ADA C;  4YB6 A;  3GV5 B;  1QSS A;  3HVT B;  1XNR J;  3BBB A;  5M2P A;  4FF4 A;  3BV8 A;  3LP0 A;  5KFY A;  1C0U B;  3U27 A;  3FZB A;  2QC3 A;  1TL3 A;  1V9O A;  3M1V B;  1VCT A;  2VJV A;  4YP3 A;  4LQ3 A;  1GMW D;  4C8Y A;  2KRB A;  3JQJ A;  4RWW A;  3C6U A;  2KTQ A;  2QO3 A;  4DUY J;  2R7V A;  1EZZ B;  1X5T A;  3FBC A;  2GX8 A;  2MZ1 A;  1HNX J;  3R5J B;  4QWC A;  5D3G A;  1TKZ B;  4HLB A;  1IBL J;  3KNA A;  1HBN A;  3OW2 R;  3QJJ A;  1SC4 B;  2N7Y A;  3L9Z A;  3J7Z 5;  3LW5 C;  2HQF A;  1RXO B;  4IR1 A;  2YKO A;  4YUD A;  1UVN A;  2CPJ A;  2HRU A;  2OPS A;  3AA9 A;  4KJI A;  1NPP A;  1C4A A;  1S1T A;  2YKP A;  2DNR A;  2WSC C;  3L7O A;  4RKU C;  2MST A;  3B4M A;  4PCQ A;  1WDT A;  2BBE A;  1NJX A;  5F9L A;  2V67 A;  2E29 A;  2YNG B;  4DSK A;  5FLX Y;  3CDE A;  5LOQ A;  2DK2 A;  4PZV A;  4DF8 A;  4O4G B;  1S1X B;  1U48 A;  5GVQ A;  3AH6 A;  4M5J A;  2UVV A;  1RU2 A;  2J9C A;  3CSK A;  3H4B A;  1LWF A;  4X2B A;  3OVS A;  3BPS P;  2Y0B B;  1PAE X;  3F41 A;  4JV5 J;  1FJG J;  4C0H A;  3DOL B;  4DS5 A;  4J9S A;  1B3T A;  3A8I A;  1CPZ A;  3D67 A;  4QIW D;  4DMZ A;  1RT7 B;  4RW4 A;  1AT1 B;  1VHF A;  3CNQ P;  1Y3K A;  4J9U E;  3UD4 P;  2M8D B;  3RB4 A;  1WKJ A;  2ZE2 B;  3Q83 A;  1SJF A;  5K5M A;  1URN A;  4CO3 A;  1YBT A;  4Y0F A;  3KLF A;  4DR7 J;  3CO0 P;  3S01 A;  3VGV A;  4WCE Q;  2G1D A;  3C66 A;  3V4I B;  3LP0 B;  1RI7 A;  1ZAV A;  4XIU A;  1N34 J;  2H54 B;  4U8Y A;  4AE5 A;  2LEP A;  2ZEJ A;  1WHV A;  3HT0 A;  3C3L A;  2MQP A;  3DHW C;  4TYA A;  3M2V B;  5LSO A;  1N5Y A;  2VA3 A;  2UP1 A;  1LWC B;  4AD6 A;  4DSL A;  4OYI A;  4CNZ A;  2ZH4 A;  1NK8 A;  3QLH B;  4GKJ F;  2GVD A;  4R8U A;  1RAJ A;  2WBM A;  2K3I A;  2KZM A;  2AJ2 A;  3HMJ G;  3H2U B;  2A2D A;  1W2B R;  2DCU B;  3Q8R B;  4V19 X;  4Y34 A;  1KVJ A;  3OR1 B;  3MEK A;  3W65 A;  2QV6 A;  1S12 A;  5DQG A;  4YN3 B;  3R6L B;  2AEF A;  1X5S A;  2VG7 A;  4DFP A;  1S76 D;  1RTI A;  4CM0 A;  4DX6 A;  1UW4 A;  1KFS A;  4ENO A;  2IJN A;  4DV5 F;  2OTL S;  2CJ9 A;  2ZOM A;  3GLJ A;  2DRB A;  1FVQ A;  4ELU A;  1VIO A;  3GP9 A;  4ILR A;  1PKU A;  3CJR A;  2QMU B;  2Y1J A;  3QRP A;  1LXN A;  3E8O A;  2HWH A;  1Q82 T;  2LQJ A;  3EGN A;  1SBR A;  4PYD A; 
#chains in the Genus database with same CATH homology
 1NSP A;  3VGS A;  2BX6 A;  3EMT A;  3VGU A;  3VVU A;  4F36 A;  3WX8 A;  3VGT A;  2DY9 A;  3GPA A;  3BBF A;  4F4A A;  3EVO A;  3G2X A;  1WKL A;  3FCV A;  4DZ6 A;  1NSQ A;  1NDP A;  3EJM A;  1NDC A;  1NHK L;  2AZ1 A;  3BH6 B;  1W7W A;  3FKB A;  4EK2 A;  3DKD A;  3Q86 A;  1KDN A;  3Q8U A;  3ENA A;  3EM1 A;  1BUX A;  1XIQ A;  3EVM A;  3NGT A;  1S59 A;  3BBC A;  1F3F A;  3PJ9 A;  1NPK A;  3FBF A;  1NCL A;  3BBB A;  1MN7 A;  3ZTS A;  2HVD A;  1K44 A;  1NB2 A;  4ANC A;  1U8W A;  5CAB A;  4DUT A;  1LEO A;  3B54 A;  1S57 A;  4ANE A;  1NSK L;  4WBF A;  1BHN A;  3FBC A;  3FBB A;  1NLK L;  2ZUA A;  4AND A;  1LWX A;  3ZTO A;  3EVW A;  1JXV A;  2HUR A;  4KPC A;  2DXF A;  2NCK L;  1WKK A;  3L7U A;  3NGR A;  1VYA A;  3Q89 A;  1NDL A;  1ZS6 A;  3VVT A;  3Q8V A;  4HR2 A;  3ZTR A;  4C6A A;  2CWK A;  4O0N A;  3BH7 B;  3PRV A;  3DDI A;  1PAE X;  3ELH A;  2AZ3 A;  3EE3 A;  1MN9 A;  2DYA A;  2BEF A;  4UOH A;  2HVE A;  1WKJ A;  3Q83 A;  4DI6 A;  1BE4 A;  5BXI A;  5C7P A;  3FBE A;  3JS9 A;  3VGV A;  3ZTQ A;  1S5Z A;  5IOL A;  1F6T A;  5CAA A;  3NGU A;  1UCN A;  3MPD A;  1EHW A;  4UOF A;  2DXE A;  3Q8Y A;  2VU5 A;  3B6B A;  1XQI A;  3R9L A;  3EIC A;  1B4S A;  3FCW A;  1HLW A;  4S0M A;  3NGS A;  4CP5 A;  2B8P A;  2B8Q A;  1HIY A;  1NDK A;  3ZTP A;  3ETM A;  4UOG A;  1B99 A;  3FC9 A;  4ENO A;  3GP9 A;  1PKU A;  4W98 A;  1HHQ A;  1NUE A;  4FKX A;  4FKY A;  2DXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...