3ENAA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dgdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3enaA00
3GP9A 3BH7B 1WKJA 3R9LA 2B8QA 3BBBA 3Q83A 4UOHA 3FCWA 1S57A 3G2XA 1JXVA 4CP5A 1LEOA 2DXEA 3EICA 3BBCA 1F6TA 4C6AA 3L7UA 1XIQA 5CAAA 4S0MA 1LWXA 3Q86A 2AZ1A 1NDPA 3BBFA 3FKBA 3ZTSA 2B8PA 3VGTA 1B99A 2BX6A 2VU5A 3Q8YA 1WKKA 1K44A 3NGUA 4WBFA 3Q89A 3BH6B 1BE4A 3Q8UA 4DZ6A 3NGRA 1NB2A 1ZS6A 1NSPA 2DXFA 2ZUAA 3FC9A 4KPCA 1NUEA 1XQIA 5IOLA 3PRVA 1NHKL 2HURA 4O0NA 1NSKL 3EJMA 1NLKL 3FBBA 1HIYA 4ANCA 5BXIA 3Q8VA 4F4AA 1KDNA 4DUTA 4W98A 3EM1A 3ZTQA 5CABA 4UOGA 1S5ZA 1VYAA 1BUXA 3B6BA 1NCLA 3FBCA 2CWKA 3VVUA 1EHWA 3NGTA 2NCKL 4ANEA 4F36A 3ZTRA 4FKXA 1BHNA 3ETMA 1NDCA 3VGSA 1U8WA 3EMTA 2BEFA 4HR2A 4FKYA 3ZTPA 3MPDA 4ENOA 3EVMA 1S59A 1W7WA 3FCVA 3VVTA 3ZTOA 3EE3A 1NDKA 3NGSA 1MN9A 3VGVA 2HVDA 4DI6A 3JS9A 1F3FA 3EVOA 3GPAA 2HVEA 3FBFA 3PJ9A 3B54A 1NSQA 3FBEA 3ENAA 1MN7A 3DKDA 2DYAA 2AZ3A 1HHQA 1NPKA 3WX8A 1NDLA 1UCNA 4ANDA 2DY9A 1PAEX 4UOFA 1PKUA 3ELHA 4EK2A 5C7PA 3VGUA 3EVWA 1WKLA 1B4SA 1HLWA 2DXDA 3DDIA
chains in the Genus database with same CATH superfamily
1ZZFA 3NCRA 2CZ9A 2HRTA 3RTVA 2BQ3A 4I56A 3DU5A 4OZ5A 1YTYA 5A8RB 2EW9A 1YRUA 2B7CB 4J9UE 4YUDA 3KK2B 3RBZA 2DH9A 3BO2A 2VPYB 1JNRB 3DI6A 4MK7A 2BOPA 1H0HB 5KFCA 3Q23A 3KUEA 2GVZA 2HSEB 4UQGA 4N41A 1ZTWA 1WEZA 2GVZB 1JXVA 3TUJC 4ATNA 4CO0A 1WSRA 2E5LF 1LEOA 4NRUA 3UDVA 3MD1A 3CD7A 1DTQB 1RABB 3UQSA 2HQGA 4TLRA 2XCAA 2MZRA 1X0FA 1TMJA 2KN4A 4QPTA 1U48A 1HWIA 4EUVA 1TK0A 3LOUA 1WORA 2RUSA 3GV5B 1VQPS 4LBIA 1FRHA 2VBZA 4URSA 5IQQA 3OUYB 2ZH4A 3PW0A 1TKXB 2DRDA 4WWSA 4B9LA 5J1PA 3QRPA 1R8CA 2M4MA 3BKFA 2BKOA 3ITHA 5IT0A 3CCTA 2BJ7A 5A2QU 4B3OA 2VU5A 4M5NA 2XI2A 3M8YA 1L3TA 3L09A 4NXMF 1VC5A 2RUGA 3BZQA 1TKZA 5L9NA 1LV5A 4NCAA 2JEIA 3JQJA 2FJWA 2C2NA 3BH6B 1HHTP 3BGRA 2IA0A 2WAQD 1LK7A 2HG4A 3UD5A 3JTNA 1M0SA 2CQ2A 3G6ES 5E3PA 3U1LA 2XTJP 3M05A 4L3KA 1U25A 3JQKA 4LR9A 3VF0B 4RNOA 4L76A 2G0JA 2V50A 4OZ0A 5K20B 5HLFB 1S6QA 3CJQA 3GFZA 1FWLA 3LP1B 3O5TB 4MIAA 5HMWA 4DLEA 4NYZA 1U0SA 1UKUA 2ZJRQ 4CNZA 3H25A 4USKA 3DOLB 3UN5A 5HMYA 2LXIA 4KB7A 3OR2B 2XC9A 2YKNB 2GMHA 1RBAA 5KFHA 3SCKE 4CLZA 2OFGX 2AWZA 5T41A 2EG1A 4EI2A 2NQPA 4F4AA 1A0OB 3MMCA 4KYZA 4ZVSB 3M2UA 2MKHA 5L38A 4LF8F 3NGKA 1UP1A 1I3OB 1YWXA 1XMBA 2KRRA 3CC7S 3OXLA 1U1RA 2R2SA 1FRKA 5DETA 2BW7A 4ZJQA 4I2PA 2E7VA 4WYWA 5F41A 4F36A 3JQMA 4K4WA 4DPYA 4RWXA 1X4HA 1UMJA 2Z2ZA 3UNGC 1HI8A 1FJEB 3V6HA 1V5IB 4JI1F 2NS1B 2P9CA 4CO3A 3UR0A 2BKPA 3R7BB 1KVKA 3W2VA 1XBWA 3V2UC 1S1TA 5RUBA 2VICA 2KZZA 1U6BA 5D0GA 1REVA 2H1YA 4NE9C 4WP3A 4Z7YA 4JI0F 2DNHA 1C2PA 2FTRA 1OSCA 4C7QA 4DN0A 2DR5A 1FKOA 2QMXA 3AB2B 1GNKA 2GGPA 3M2VB 1NHUA 4M5IA 4BS2A 2PI4A 2D69A 4DI6A 2YVSA 1X5SA 2MQ8A 5KAKA 4DSIA 2V8DA 3R5GA 4DMZA 5HMZA 4OV6A 1N32F 2ZOFA 4LF8J 1GMUA 2IM3A 5F8LA 1N34J 5E0OA 5J1EB 1XERA 4WFNQ 4EU0A 2XB2D 1HQEB 2FHJA 2ZC4A 3FBEA 1KLMB 2BE2A 1UWAA 3D0HE 5IZHA 3J7A1 1FHTA 1NPKA 1OS5A 3WX8A 1QVGR 5GAEI 3IR6B 1RLDA 3GU0A 5L9XA 4PKDB 1MU2B 3JSMB 2DRBA 1VGYA 3M8QA 3DDKA 3PACA 4DWIA 3NMAA 5DM7Q 2M52A 2W4CA 3PX0A 4KGKA 4TKTA 4MJKA 5G0RA 3EVWA 3VGUA 2MKKA 4KHMA 2ZBQA 2CZ4A 2KH9A 1YJRA 1CSJA 1D8ZA 2GIRA 4OHZA 2XM3A 2D1CA 1V9OA 1RTDA 2QC3A 4DR6F 1FTCA 1U26A 2HRUA 3H5UA 1KOOA 1WC4A 2V8PA 2KT3A 3UCGA 3KHRA 4F3OA 4KHPF 1JXEA 1KBRA 1N5QA 1YRXA 3BBBA 1U24A 2HFOA 2POKA 5E7OB 4RZRA 3SSRA 2XNRA 4IOAQ 1OYEA 4MKVA 4LRFA 1FRLA 1R0CB 5ETKA 1UZDA 2VQEF 1ACMB 1YX2A 2YX7A 3T1HF 1L3UA 1FJGF 4H4OA 1RT2B 1S6PA 3MMCB 3QSIA 2GMJA 2YKQA 2J8SA 2K2PA 3CJ4A 3ZZUA 3ZXWA 2HBRB 2QLWA 4Y2KA 2ZDPA 3MFHA 3OTOJ 1UVMA 6FD1A 1DQ9A 1E6YB 1YQHA 2V8HA 2XEXA 1S1VA 3GQCA 2Y1JA 2WCXA 1H72C 4IO9Q 3G8SA 1JLCB 2BYCA 1F5BA 4YB6A 3RBDA 4UT4A 3LGMA 3RB4A 3OSPA 3PO4A 4K4ZA 1XEZA 2B4OA 5JJBA 3H5YA 2PD1A 1IVZA 2EI5A 2QO3A 3T9ZA 3Q2SC 1YK9A 5J2MA 1WACA 2DGTA 2AGOA 2MJUA 3ILIA 3N01A 2FHMA 2VD3A 3SXLA 3EZUA 5KG1A 1S9FA 4WBFA 3KG4A 4DF8A 1VHIA 1PJ5A 5B0GA 1SH3A 5HQMA 1FX4A 2HHVA 1KP6A 2W1BA 3KG1A 3NGRA 4WTOB 4OX6A 2J9DA 5A0YB 5AXNA 1FX2A 1RTHB 4ZMMA 3DLGA 4HEA9 1SI9A 1ULRA 2YQ1A 3POTA 2DR9A 3G8QA 3NLCA 2MJNA 3O1LA 1K9MT 5E3CA 1BQXA 3KK1A 1KLMA 1TP7A 2BE2B 4HYKA 3D9BA 3THVA 1HMVB 5IXUA 1S1WB 3CVKA 4CLSA 3RG6A 4D3GA 1N56A 3C6TA 4I6AA 4ANCA 1UEVA 1WOOA 4Y2IA 4KIAA 1RAIB 2XZDB 4MK9A 4NZ0A 4R5PA 4ECUA 3MAQA 2RDDA 3NS7B 4ID5A 1OYDA 2IPOB 3DOKB 2AD9A 1YG0A 2KFYA 3K0JA 4ZP8A 3M6UA 2Z2MA 3PIOQ 3DRRB 5GMKa 3NNCA 1VYAA 1RT6B 5D4NA 2NXNA 2WVBA 4RX6A 4ZOSA 3P5BP 4EFAC 1S76D 3IM9A 5A2QY 2N3LA 2V9WA 2XI3A 4NL5A 4DX7A 4FN5A 2JOQA 1L3VA 2ZHOA 4G1IA 3DC2A 3GYNA 1EZZB 3FFIB 4A8MP 4WZQA 3P45B 1GMVA 2QSWA 3QMQA 3CJKB 5L1LA 3LANA 1MWZA 1SIWB 5E2QA 1L3KA 4LFCJ 1VMBA 2E7WA 4RR5A 3IM8A 1HBMB 4KJIA 2J9EA 5T14A 2V9KA 4P2FA 2LA4A 4QYRA 2BQRA 1KC8T 3EE3A 1SJRA 2JVRA 3KLGA 1RYSA 3JSRA 4X2BA 4JP8A 2OJ3A 3HJVA 3TAMA 4BBYA 1F9FA 1SKRA 3UW1A 3JS9A 1X4EA 3PEJA 4U96A 1KQGB 3SCJE 5HANA 4M95A 2R7OA 2DIVA 3BGFA 3MMAA 3PJ9A 4ZPTR 5HROB 3PV8A 1M5VC 1RHUB 1K47A 1FDBA 1VJWA 1FD8A 3K8WA 4MFBA 4OI6A 4R0EA 2RNEA 3G82B 2DYAA 4ZPBA 2B9WA 2OH2A 2JHEA 3MR5A 4XDDA 2B6AA 2CIMA 3DLEA 3GR1A 1IBKJ 2K1RB 3SZ2A 2KFNA 2CJ9A 2UUTA 4TYAA 4J9SA 4DPOA 2MY7A 4I1TA 2MQPA 1X8DA 5L46A 3Q8PB 3QZ7A 1P6TA 1UEKA 2HK3A 2OLWA 2VUGA 3I87A 1HYSB 2UXBJ 2EVZA 4RW9A 3C14A 2BACA 2H51B 4P75A 5I3PA 2WZ1A 4FF4A 2PFFB 2IM0A 3GWCA 3W63A 4NLPA 4KH1B 5A6PA 1DY3A 2FHOB 2ZFHA 4C98A 2YKOA 4B9MA 2HNDA 2GZOA 3IMQJ 3SBMA 1L3SA 2Y9HA 3C16A 2XMKA 1KEKA 4ED1A 2MHEA 5KOWA 3TEHB 2MQQA 1X5PA 1HR0F 4ICLB 4YDDB 2DXEA 2GHPA 4NYOA 3EICA 5KT5A 1WD6A 1F6TA 4DSKA 4F25A 1HNXJ 4LF7F 5M2RA 1NJYA 1U0HA 2QJ3A 2W9AA 3D6FB 1M5OC 4X4UA 1C0UA 1M90T 3RZAA 3MHYA 2GQ2A 1N5VA 3BV8A 3ZZTA 3GCXP 3RW6A 4K4UA 2DT9A 2HRYA 2Q79A 1DHMA 3PW2A 1FFGB 5KFAA 2NZ4A 3MM5A 2LU1A 5L1JA 3R5AA 2HQCA 4A4JA 3R6LB 1OPZA 4KFBB 2CPJA 2XMUA 2E5JA 4I6WA 4NX9A 3W9IA 4KFBA 4RKUC 5B0AA 2R9LA 1FNXH 3CIMA 1IKYB 2DNRA 3HHLB 4O4RA 1FK9A 5DS7A 3EXYA 2EFNA 1HBMA 2AP6A 1FRXA 1QY7A 4ZDNA 3WC0A 3BO4A 2VG6B 3HHKA 2RU9A 2RT3A 4X4VA 4K0KF 3MEGA 4CLYA 1DLOB 3M30A 4TYBA 5D0HA 1RADB 1RT7B 3TAPA 3P96A 1K8AT 1JJ2R 2VZ9A 3R5CA 4HT7A 1WOSA 4TY8A 3GIJA 3G4SS 2J6SA 3E2EA 2HKEA 1BC6A 4PG5A 2IDEA 2CPFA 4FBTA 4RW8B 1IBCB 5IWAJ 2OSRA 1EETB 4M5HA 2CA9A 3T6BA 2HWTA 5CH7B 2PMWA 2JEGA 1FFWB 2ALZA 2LU2A 3PRBA 1VR6A 2J0QD 5BYSA 2C2MB 2R7UA 1T11A 2M88A 1OO0B 2KT2A 2CADA 3TR5A 3MMJA 2Z8QA 4DHVA 1BUXA 1WWHA 1JLEB 3GR0A 4LBPA 4DDFA 4N56A 2OTJS 2K7JA 5GAGI 2L08A 3LPEA 2XS5A 3NGTA 1HKAA 1IXKA 1UTAA 3DRSA 4OI1A 3ZTRA 2YPZA 3UFCX 1S48A 2YKAA 3UN2A 1MLAA 3UCZP 3SI8A 2VG5A 4JV1A 2RE1A 1RT1B 3IN5A 2J8AA 2F3JA 3I31A 4ZVOB 2OPPA 4H4OB 2B4VA 2BEFA 4HR2A 1FD2A 4XPEA 2VHGA 1S6PB 3ITHB 3MPDA 3BM7A 2ADCA 3AA9A 2HGNA 1SC3B 1W7WA 3MR7A 2J9DE 2W7OA 5BJRA 1VS3A 2ZH1A 4J9MA 4R25A 3GJSB 3PX4A 2MKYA 1RTJB 1VQ5S 3DN9A 1N54B 2VA2A 4UQTA 3CDAA 4Y6IA 5CYMB 4FDFA 4ZCIA 4DL3A 1RP5A 4I69A 4LRDA 1RJJA 1Y5LB 2MQLA 3PCOB 1JLFB 4G6VB 4URQU 5B09A 1X5TA 2RKIA 4HHUA 4IQMA 3HT3A 4FF1A 3QAEA 3UDEA 5D6GA 3T19A 1KVIA 4FYYB 1MN7A 3DKDA 3DCAA 1CJTA 3LP1A 3QYYA 3W8GA 1EAYC 4ECZA 3T1HJ 1FJGJ 2GO8A 1RWNB 1NDLA 2VFVA 3GJTB 1JJHA 3N28A 4LT6A 1IKYA 1SH2A 2NUHA 3HDSA 5KFRA 2XCPA 1WJ9A 1IKWB 3SYZA 1VC0A 3ELHA 4YOEA 4PCQA 2AJ0A 4ECWA 4OLPA 4DUYF 4OZNA 2VG6A 3W7BA 1NK9A 2FJXA 4ZVGA 2HS0A 3DOMB 2UVRA 4NXNF 2DXDA 3W66A 4FBUA 3RRKA 3M32A 3DDIA 3MGJA 3A3OB 3MCSA 4F67A 4X66F 3M8SA 1ZH5A 2E1AA 2X1FA 2RQCA 3K5PA 4F26A 4B3OB 3MUVP 2G1DA 1EB0A 2RILA 2ZBCA 2B5JB 2U1AA 1TV6A 4GRSA 3MM9B 3RGIA 4RW6B 2QE5A 4JUZA 2YY3A 4C0OC 1NKCA 3H5SA 3TUPA 2JWNA 3CULA 1FJ7A 4P74A 3PO5A 2C22A 3IG1B 1O0PA 3OBIA 4UF4A 1ZAXA 2MEWA 5DZ6A 4DL7A 3X1LB 2XS7A 3TANA 1UVNA 4EZ9A 3O2IA 1LK5A 1LXJA 4O3PA 3L7UA 4PEOA 3F44A 2YKMA 1HNIA 4QW9A 5HLFA 4LSNB 1S10A 5F8JA 2XS2A 2HHSA 1GT8A 4KBIA 1NJIT 2HHQA 1TTHB 2M0GB 3BPDA 2CAJA 3ZTSA 2B8PA 2QA4S 1SJ3P 2Y1RI 2HNYA 4NCGA 2O66A 2OPPB 4WFAQ 1QUVA 4PUOB 2IYIA 3SMZA 1FA0A 1T9YA 1RT2A 2CDQA 2I6WA 4LF5J 4PUOA 1URNA 2JRSA 1EQMA 1ZM2A 2FD2A 3T5JA 4IRKA 3MEEB 5DQGA 4OJ1A 2A2DA 2Y8YA 2CDRB 1RBOB 2ZH9A 2CPEA 3MCNA 4HVZA 3PZPA 5E3QA 2XHWA 4NA3A 3TNVA 1FKAF 4CH1A 3G82A 1LWFA 3DHXA 4DX5A 2KJVA 3DMJB 4LSLB 1GTEA 3QGIA 1YJ9S 2HFZA 6FDRA 3QGHA 2OEMA 3EWGA 1HPZA 5CQGA 3D3BJ 2IRYA 1RYRA 3NAIA 4B17A 3HFZB 2HQIA 2YNHA 1Q78A 4N8NA 1OQ3A 4NLQA 1R27B 2Q43A 3FEZA 2HQDA 1TMMA 3R5JB 1S0MA 4AUKA 3NWGA 2AF6A 1ZAVA 2M3DA 3I9ZA 3QGPA 4QIWD 4W4MA 3R97A 1YJ7A 4CRJA 3SQGA 4N76A 4GKJJ 1UJ5A 4BDPA 1T94A 2OUGA 2FB0A 1FDDA 2LKZA 3N5BA 4IFYB 1XR5A 2MKCA 4JV0A 3CXCR 3MUTP 5A8KB 1S4FA 1SQEA 1X4GA 2YQ3A 3ULHA 2D3UA 1KHVA 2AYGA 1YZ7A 2W9BA 2XY5A 1X31C 4ELUA 1ZOTA 1I94J 2N4CA 4YB7A 2M8DB 1IM4A 1QE1B 1TL3A 4HACB 3JSMA 1URRA 4DS5A 4PQUB 4FKYA 3H4DA 3EVMA 3BKUA 3NCQA 2BM1A 2IBKA 4X4TA 4RNNA 3GYXB 4C97A 1S1TB 1Z2ZA 4TLQA 4W92B 3GLJA 2Q3PA 3WIUA 1IKXB 3B82A 5ETVA 2BANA 5DDOC 3OHBA 3TZWA 2GGPB 1VRUB 1RKIA 2COLA 2OPQB 2QLJB 3VAMA 4QIEA 2O5DA 4IDKB 5D4PA 2AGPA 3VQSA 1BQNB 3KLEB 1JXLA 2CPXA 3N6NA 4A48A 4YHHF 3JYTB 3HHLA 1KSPA 3MURP 2MZTA 2RRBA 3EGVA 1Z1ZA 2R8GA 3BREA 3H20A 1S1WA 2YWKA 3ENVA 4MIBA 1N48A 2HBQB 4JI3J 3K5OA 3LW5C 2B3TB 2I0XA 3OL8A 1T7PA 3PTWA 4ZPCA 4EZ6A 1S1VB 2CQHA 4CZCA 3D6MB 4M5LA 2O3DA 1RLCL 2CWKA 5KFGA 1SQGA 4AFFA 4OX7A 2DR6A 1UVJA 3NKYA 3LP0B 2ZVIA 4IKAA 5HN0A 2QGFB 3NMRA 4E98A 4DR7J 2GVDB 3GB0A 3THPA 4HDHA 5CYJA 4IH5A 2BJ9A 1FCAA 2EPIA 4LF5F 1IBKF 2J6UA 3JSYA 2J9CA 4PYDA 1TU0B 2VJVA 4ELVA 1ZAWA 4JI7F 4DFKA 1CJVA 1JMTA 2A6MA 2A0FB 4C9DA 1AUSL 1F9EB 2WOMA 3BSOA 2DNQA 2WOMB 5HQ8A 1FRMA 2B43A 3J81Y 5KFOA 3R1HA 5KFQA 2CNOB 3M4XA 1D9FA 1Y7PA 2JX2A 4OX9F 3X3UA 1BQMB 3KLGB 4IOCQ 3LWLA 2GHVC 5JVGQ 3CCLS 3HM9A 2P8IA 3PX6A 2HVHA 3IP0A 4DR4F 1T8EA 4FS1A 5FIIA 2BX6A 1C4AA 1V3SA 2H65B 5F9LA 4DV2F 3SQOP 5LL6d 1KVJA 1VI7A 1TL1A 2O1PA 4USHA 5E33A 1XN9A 3GONA 1HW9A 1GQEA 1FXRA 3K2YA 3HSGA 1Q8IA 1H7XA 3KUHA 3EZOA 2ZC3A 1T9XA 2JLFA 3WX4A 2YWHA 1VC6A 1U1LA 2MZQA 1NB2A 1VQSA 3HPOA 4RNMA 5DQHA 2ZZNA 4KGVB 4K4TA 4K4XA 1SC4B 2J7KA 4GC6A 3DRYA 3DRXA 4OYOA 3FDSA 3L3CA 2DRAA 1U1MA 1BQNA 3KLEA 2Y1LB 5CCLA 1WNEA 2DH7A 2HBYB 2WW8A 4NYPA 4MT1A 3V6KA 1WEYA 1H74A 1TR0A 3I5AA 1PYOB 4A8KA 4JV5J 1SKSA 5L39A 3PIPQ 1NJWA 1RWUA 2BJDA 2BZ2A 3HVTB 4AL6A 4FF3A 4X4NA 3H2UB 1PC5A 3HXMA 2KXNB 3CJ8A 3I55S 2KL8A 2WVFA 3P3DA 3PFEA 3H40A 2QN6B 3HF5A 4Q8EA 2E29A 4EWTA 4HH1A 2H5EA 4DSLA 1SCJB 4TXSA 2VC1A 3PXGa 3T5LA 4FP9A 1FESA 4ANEA 2KTQA 4OYAA 5T7LB 5F9NA 4M5KA 2VPXB 3JSBA 3SSSA 2DIUA 3OTEA 4O44B 2MGZB 2HFNA 2KM8B 3KK2A 3BJYA 1N0UA 1F9HA 1VRTB 2DHSA 3BSAA 3PVXA 1F2HA 4YB5A 3MI7X 3VGSA 2DKOB 2ZOGA 3MM5B 1JLBA 1Y00A 1XNRJ 1S0VA 4NMLA 4WXOA 3BGUA 1VK8A 2RU3A 4JYAJ 1AFJA 3M6XA 3QIDA 3T6JA 5D4LA 4RPFA 1Q16B 4W90B 1X0PA 2ZH5A 3UVJA 1RT5A 5M2UA 2V69A 3OVSA 3M30B 4LSZB 5DDRC 1RWVB 3CCJS 1VBXA 2AJQA 1RDRA 4JI8F 1F2GA 2MB0B 4Q44A 4JV5F 1WTBA 3T41A 2QX0A 1DURA 3VQTA 1ROFA 5C7PA 1MU2A 3VV2B 2HHTA 4LRBA 1EETA 2QFIA 2ZBPA 3OR1B 1WTFA 2YWWA 2HHHJ 3KJFB 1O51A 3BGRB 1AW0A 4ILMA 1OQ6A 3K17A 3KK3A 1VQ9S 2EFGA 1LWEB 2WVEA 2ZE2A 4KHPJ 2OO4A 3CCQS 2OHDA 3HHNB 2H5JB 4B9NA 2EWHA 5KFDA 3ET6A 3VHQA 2V8VA 4BHQA 4DCOB 2W2NP 4CIOA 2HMIB 4K0KJ 2BABA 3FSIA 1B70B 2VL1A 2D3O1 4UZBA 3PFOA 3SFUA 5AE2A 4DFPA 2XLKA 1S1XA 4BCAA 2R8HA 3IR7B 4JI4J 3GE9A 1KQFB 4OZLA 1KNZA 4QWBA 3S7RA 5F3ZA 2OMLA 1X4DA 2A6OA 1NSAA 1RI7A 2LQJA 1WHXA 2N4DA 4ZP9A 4ES3A 2VPWB 5DQIA 5KT4A 2JC0A 3D0IE 1XIQA 4ED5A 5CAAA 2IDLA 2R8KA 1N8RT 1SXLA 1XWLA 2ALYB 1YITS 2YBVA 1OWXA 4NCBA 2ZWPA 1LWXA 2C28A 4CT8A 4Y34A 3HVWA 4QIGA 1JKHA 1GK8A 1MMLA 3CMAS 3SIPB 3HMJG 2RAQA 1RSCA 4OYWA 4C8YA 3D67A 4YMEA 3NG8A 3NS6A 2GHWA 4P2XA 1FO1A 5DGAA 4F3MA 3GFYA 3HFKA 2HFUA 2AIRB 2ILZA 2R42A 2YNGA 3DGVA 2JLEA 1IWAA 2YPYA 2DY1A 3A8EA 4XK8C 4ZLJA 1Y11A 3NY0A 5L1KA 1YKWA 3RR7A 2EC2A 1TL7A 2V94A 2MY8A 3CF5Q 1C4CA 3E51A 3QWPA 1TKTA 1FK9B 5HBMA 2YWFA 1QAJA 2DHAA 3TJAA 4LVOP 3K5MA 2V2ZA 4RW7A 4HI1A 1ZS6A 4ED8A 3JTPA 4RLEA 3UVJB 1RTZA 1S0NA 4PXDA 2OTLS 3FC9A 1NNDA 2QV6A 3C6UB 4NMXA 2HURA 4DL6A 2OPSA 4WIQA 4CLWA 3PR5B 2C3YA 4FVCA 4LQ9A 3A1YG 2CJYB 4LF2A 4NA1A 5KFMA 2EXUA 2XMWA 5D77A 4IG0A 2KRBA 2DNNA 3TA2A 3ZZZA 2ASJA 1Q7YT 4P72A 1JJ4A 3Q8VA 4YHHJ 2V2KA 2IJNA 2YQ0A 3MZIA 1XR7A 4LF6F 5DZ7A 3T1YJ 1TL4A 2ZBIA 4W98A 1B0PA 2DHXA 4FZVA 3TARA 1LWEA 4UOGA 4DU7A 2CQBA 4Y65A 1U45A 3NP5A 1VIOA 2FJAB 3BDEA 3CJ2A 1N52B 5DM6Q 3VVUA 5ITHA 4X4QA 1U1KA 2MSSA 3BR8A 1SL0A 4WCEQ 4RWWA 1VQ8S 2BVZA 1C1CA 3U1NA 4CM2A 1B7FA 2Z4PA 5IC6B 1DQ8A 2AU0A 1Q86T 3I96A 2V4QA 4ENOA 4ZP7A 1XNQJ 2W9CA 1W2BR 2ZKTA 3MM7B 2VC0A 1E6VA 2VJUA 2KFZA 2CKWA 4ITSA 3CO9A 3DOMA 3ZTOA 4WE1B 2NYIA 2XGQA 3PHEA 4QR1A 1NJZA 1VQ4S 3J80Y 2PA3A 4KY3A 4FXDA 1Y4ZB 4IG3A 3AD7C 4X84A 2X1AA 2ZH6A 3M8ZA 1NK6A 2Q6CA 1JKHB 1YRTA 4QPXA 4QU7A 4OI2A 4RBVA 3K59A 3IFEA 3CJTA 3AJ2A 1AZSA 1L5UA 4DR2F 1AZSB 1OPIA 3BGLA 4QIFA 4U8YA 4ZN1A 3M6VA 2RKIB 1T9VA 5C42A 3DMJA 4LSLA 1SV5A 1X4CA 2I5JB 1EX8A 2MDAA 3FRZA 4J5OA 5J2MB 2I5JA 3IXQA 4ECSA 2KYXA 1RAHB 1PAEX 3F0NA 2QIFA 4OZ2A 3TQEA 1U1PA 4QJVA 2HHWA 3OPKA 1GTHA 5KFEA 4A8XA 2ASYA 3NS5A 4AYBD 5FJ4A 1B4SA 1PBAA 3OD2A 4U6PA 2WSFC 3OFHA 3H4BA 4OJGA 5ETRA 3B4MA 3GSIA 5A0YA 3POTB 5KFSA 2WBMA 2QL5B 3I0SB 2ZNYA 4KGZB 3M32B 1RAJA 3CSKA 1SKUB 1NZ8A 3FCWA 7FD1A 5CZVA 2L9WA 2PC6A 3U27A 1VHFA 2XO7A 2B7BB 1UFKA 3CDUA 3FCHA 2NR0A 2G1HA 4PQUA 3KLIB 4CM0A 1VQOS 2P6TA 4U95A 2CQ0A 2V0NA 2XQCA 4GC7A 1CLFA 5JMNA 4R5PB 5CD4A 4MH8A 4B3MF 5K14B 8ATCB 1HQUB 4AL7A 4NLWA 3MMBB 4DN9A 4DQPA 4FPRA 4ZPVR 2YH1A 2VG7B 4UTGA 2BKNA 3OXGA 4Q43A 3BBFA 4XPCA 4KH0B 1LFWA 1HWLA 1R3NA 4DR1J 4DL0C 1EP4A 3GIMA 2GA7A 1HBNB 1Q0NA 3KFWX 3R3TA 4J9VA 4E0DA 1SC1B 5CD4H 1RXOB 2EEYA 3Q8YA 5D0RA 1T03A 1D9AA 2R2TA 2DO0A 2BRLA 4NCGB 2I38A 3NGDA 4QWAA 1KKHA 3Q89A 2ZHAA 4LR8A 3P6YC 1BE4A 2RS8A 1AFIA 1P9QC 2AHOB 2V4RA 5I42B 1RT5B 3PKYA 3BDPA 2H9ZA 3LF0A 3OUYA 4DV5F 3TAMB 2W7PA 4DL5A 2XZWA 2C3MA 3BQ0A 3I32A 4RBUA 4XTTA 2R8IA 4F2SA 2ZUAA 2ZITA 5FLXU 4DSFA 3H90A 1G2EA 1RWPB 4DV0F 4KT0C 3DLKA 3T1YF 3MM6B 2LEBA 2UXDF 2W2OP 1MSWD 3CD5A 4RU2A 1MG7A 2O67A 3DLLQ 4B3RJ 3CGIA 3DXSX 5ETPA 2GAHC 4QR0A 1FTRA 5KFIA 3HZEA 5LSLA 5IM0B 2F4FA 3HHEA 5KT2A 1K0VA 2AGQA 1KLNA 1IM6A 3BQ1A 5GAHI 5F3TA 3M8PA 4HDGA 3O44A 2BMBA 3CTRA 3FQKA 1UJ4A 2OIHA 4ED3A 1ZM4A 5H9EJ 2RMLA 2C2DA 3FBCA 2HLUA 2AX0A 2JDJA 2QYGA 3O6QA 2D3ZA 4USMA 4ERDA 2DVIA 3CMES 1WI8A 3H7HB 1BQMA 3HKZD 1AROP 2XBPA 1Q82T 1FVQA 3KKFA 1VQKS 4CO5A 2AT1B 4F50A 2PO4A 3PW4A 1TVRB 1NDCA 2VG5B 3N4WA 3TI0A 3CD6S 1HMVA 1MMNA 4JI6F 1HNVB 4G65A 2ROPA 1J2VA 4FXVA 3TW0A 1NDKA 2DISA 5DGBA 1G1XA 3FRYA 5ETOA 3TJ8A 3ZZ0A 4C0HA 3UD3P 4DV4F 5E5NA 2DGSA 3PKMA 1S99A 2QA2A 1CJUA 2AYEA 4LRCA 4F7VA 2HYIB 3KWMA 1JLQB 1X9MA 3RAQA 5LMNJ 3GPAA 4M94A 3R8YA 4OFZA 3MAAA 3QBCA 1EP4B 1YDLA 3G6XA 2CNKB 5EX3A 3IS9B 3BGOP 3KG0A 2ZZTA 3VR1A 2HS3A 2LYVA 1IN0A 1SUQA 4HT5A 4DUZF 1W2IA 4RU9A 4JI4F 1UCNA 2AQ4A 5IT4A 1YJWS 2OPRA 2YNIB 5KG5A 5C24A 3D0GE 2L9NA 3PJWA 4DCJB 4FS2A 2NREA 3SDEB 2XO6A 1DRZA 2Q66A 1VOMA 3PHTA 1U6ZA 2KB2A 3W2WA 3LAMA 3W5ZA 1LQ9A 3M7VA 1REGX 3LAKA 1R0AA 1WKJA 1AA1B 4ZN3A 4ZLLA 4X64J 3WZ0A 2DCLA 1RAEB 1BMQB 4PG4A 3EZ5A 2R7RA 1NMEB 4FXWA 4FVMA 1RWMB 3TA0A 3NXZA 3QQCD 3OLBA 4EYIB 2HHHF 3D6HB 3FMBA 2OKQA 5J2NA 2VONA 3EGZA 1S57A 5J2NB 3G2XA 1PBUA 1WG1A 4CP5A 4WKRA 2GVDA 1FT8A 3ILLA 4YY3J 2GQCA 4V19J 4TQSA 1LW2B 5AJ3J 3PY8A 1UETA 4OZJA 5EX0A 4C6AA 3QJLA 3GFHA 2VV5A 3W1YC 2UU9F 1PIEA 2RJZA 1DTQA 4HL9A 3KJQB 4F04B 1JLAA 4X62J 2F7VA 2ILYA 1IKVB 4LF7J 1QJHA 1IKVA 1QUPA 2X3GA 1FKPA 1S1UA 3AT1B 3HSZA 4F0MA 1FRJA 3DXBA 1SIZA 1KRPA 3KLFB 7FDRA 4KAIA 2B56A 2G0IA 1LW0A 4KKOB 8RUCA 4DLGA 2C3PA 1N33J 3KNAA 1XR6A 5HMXA 1YI2S 2CQ4A 4RW4B 3L95X 2GFFA 4ZP6A 2BQUA 4DV3J 1H2VZ 1TKZB 3ZZPA 4WK3A 4ZA1A 2BJEA 2DO4A 2LEPA 1T05A 1C0UB 1RA6A 2MGZA 2ZOMA 1T05B 4AQYF 4I67A 4MMOA 5FD1A 1S79A 2DXFA 2VF3A 5F8MA 4U7CA 4LQ3A 4OX8A 2UUBJ 3K57A 1FE0A 3PG9A 4KO0A 2VFUA 3C15B 4ED4A 4DV1F 2K06A 3EJMA 2M5YA 2QMUB 2GIFA 3BKTA 3A3PB 1ZM9A 2IY5B 4LIRA 1HNWJ 4MYTA 5LJ3Y 1NPRA 3FEXB 4NZ6A 5BR8F 1ZA1B 3QT6A 1FKOB 3M2VA 3K5NA 4EBDA 4IUFA 3C19A 1R8PA 4BWJA 2XMMA 5D3GA 3K5LA 2JL9A 2NYHA 3CJSA 3M2RA 3MEKA 1S5ZA 2FJDB 4IFVB 1Y9OA 1HWJA 2KO1A 2CG8A 3UWTA 3G96A 2H4WB 1Q5VA 3RBEA 1M5KC 4DV5J 5HATA 7AT1B 2IFXA 5KFJA 3BB5A 2RQ4A 1EKSA 4GVBB 4L74A 3CJ3A 2U2FA 1BHNA 2IBOA 2HHUA 1NEEA 2YH0A 3R6GB 4IG0B 4I2PB 2VB6A 4DU8A 4L75A 3V81B 2FVPA 2DNPA 4V19X 4G3IA 3PDNA 4U7UD 1FDNA 3TUIC 5LOQA 2LQBA 1U49A 3AOBA 3QIPB 3FCVA 3IG1A 3ISND 4ECVA 2JFKA 3HHDA 1MROA 3K7RA 3RR8A 1B0TA 5GMEA 4O3OA 2HHXA 5U47A 3PYFA 1BWVA 3G6YA 1XMOJ 1MN9A 2XWXA 1DTTB 3OQ2A 4HLBA 4P7TA 4TU7A 1WC0A 3US5A 1S6QB 5LXYA 3Q22A 2ZWOA 4DR1F 3AJ1A 3C66A 2F1FA 4F02A 1AB8A 2HVEA 2CVEA 3OW2R 4O23A 1IBLJ 4DBQA 1S9GB 1PSDA 2JC1A 3LP2A 1QTNB 2E5IA 1DARA 2HIYA 3ENAA 2AZ3A 2WVDA 2NSCA 2ZBRA 1HI1A 1Y3JA 3CMQA 3RBXA 3EGNA 2FY1A 3OV7A 1TK8A 1TFYA 3ONQA 3F56A 2R7QA 3GV8B 1WEXA 1HWKA 3G8TA 2HFSA 4J37A 2VOOA 2HWIA 2FC8A 2CWXA 3MEEA 2KVIA 4L73A 1NK5A 4O0IA 1BXNA 1O6XA 5IT9U 3TO8A 4ED2A 1RK8A 1JLFA 1Q8KA 3BH7B 4KRWA 5ETTA 4FNHA 4C3LA 4DV3F 5IS2A 4ECRA 2D9OA 2DNKA 3KYLA 2DGQA 1RTDB 3W60A 1J5EF 1IBMF 3CD0A 2FZKB 4P73A 3DFEA 2VFSA 1N33F 1RWWB 1CJTB 3QT7A 3CJ5A 1TL7B 5JVHQ 4CNYA 4U9RA 4DPUA 2VFTA 2MYFA 1UFLA 3DHWC 4PG6A 5KFZA 1IQZA 3BBCA 4DR2J 2RDIA 3PR4A 1RHRB 4L3NA 1WC1A 4OI3A 1KWMA 4P10A 3Q8SB 5FDLA 1RTHA 1YJUA 4M5JA 4PYAA 1RU1A 4QIVA 4RJVA 3VTIA 2ZM6J 1CPZA 4CTAB 4QWCA 2OGUA 4TNOA 1FNMA 1OY8A 4RUHA 1T9UA 5J2PB 2WSCC 4ZPDA 3V81A 2YWEA 3AD8C 3DNCA 3GSDA 1BWEA 2WB1D 2OD4A 3DRPB 4OYBA 4N47A 2ZZMA 4OHYA 2RS2A 2KKHA 4Y00A 2ACMA 4LFAJ 1RISA 4A8OA 1MROB 1FJCA 5ETLA 1I94F 1EARA 3QGGA 4DR6J 4C3KA 1DAXA 4KGXB 3G71S 2JEFA 3CO0P 4MTPA 2ZUGA 2XYHB 4JBCA 4DX8H 5B0FA 3JAMU 3HKWA 3OXFA 4G1PA 1HBNA 2YWGA 4OI4A 5F8IA 4KPYA 1XQIA 4LJMA 4PXCA 5AXKA 1PYSB 4ETXA 3JYTA 1NLKL 4K59A 5I4MA 3AODA 4QR2A 3FZBA 3WDOA 2XLJA 4DUZJ 3QAUA 3TP2A 3A12A 2K3IA 2OPSB 1SJ1A 5K5MA 3H42A 1ZPVA 3N6LA 5BXIA 2ABYA 1OSDA 2J0WA 4OYPA 2YXLA 3CDWA 4DUTA 2E66A 1LKZA 4I0WA 3MR6A 1M1HA 1N32J 4GKKJ 4ZVHA 4DCPB 4A8WA 1RTIB 2GJIA 3IWXA 5IC4B 2DNZA 3MMAB 3OTBA 1FFSB 4G1QB 1X4BA 4TY8B 5HI7A 3E01B 1EHWA 4ZVEA 1H73A 2CPHA 1FI4A 4RNHA 3J7YU 1R8BA 1GEHA 5C25B 3QRRA 1TAQA 2V6AA 2XYPB 5HK4A 4AT1B 5D4OA 3ZNUA 2FHKA 2XMTA 4NLXA 1RU2A 4LFBJ 1PILA 1N5YA 3IGNA 1D9DA 4LFBF 5D8HB 2IVFB 3LWMA 1T0TV 5KT3A 4Q5VA 1M5HA 2GO9A 2QTWA 3VVTA 3GYGA 3TZXA 3KJVB 3UR3C 2BR0A 2J5AA 5FDLB 3SQGB 4UY8T 1FEHA 1J5OB 4RUCA 3QPIA 3DLHA 3N9UC 1X9WA 2GW8A 4DQSA 2OSQA 4QW8A 2W24A 4NLVA 2LECA 2MMYA 4DX6A 3KK1B 1NSQA 2Z2YB 1D0EA 1AT1B 1Q53A 2MZJA 4C2MA 4MYUA 5ETSA 2J76E 1LW0B 3C16B 3PNIA 4HACA 5DO2A 3DLKB 2AEJA 2LXUA 1TUVA 1QAYA 1U0HB 2BE9B 3KXDA 3C2PA 2CRLA 2FUG9 5CABA 2Y0BB 1PYTA 4DV0J 2PEBA 4CYUA 4ECTA 2YNFB 1RKJA 1IR1A 4WP9A 4O3QA 3P49B 3NRBA 1VQ7S 2EFQA 3MF5A 2VIHA 4TU9A 3FUYA 3L4BC 3A8IA 4X66J 4K4VA 3DI6B 2DBBA 4OHVA 4CO1A 4RNFA 3VAJA 3QRQA 4I2QB 1RB0A 3DYAB 1VLYA 3MEDB 2PSZA 3R27A 4JI2F 2B8QA 2HNZA 1U8SA 4USUA 3ZC4A 4F0KA 3Q83A 2HNZB 3H59A 5J1NA 5E3RA 3G87A 1MWQA 3LPYA 5LJ5Y 4ZJOA 2R2RA 3AAWB 3OFEA 2VQFF 4NXMJ 2IC3A 2GC8A 3OR2A 1HBOB 4LIWA 1UEUA 2HIQA 2HNDB 2QG9B 4M5GA 5IFMA 5I3UB 4DSEA 4K2XA 2CQ3A 3M2RB 2MQOA 4JI8J 4EO8A 4Q2LA 2IJRA 2VH7A 4WFYA 1B7YB 2GS8A 4O3SA 1F5CA 2ZM6F 3MR2A 2WB4A 4S0MA 4ZS6A 1NM2A 2CJQA 1R0AB 4GVBA 4PXEA 1OJ4A 3CDEA 4FPIA 2EKNA 4EBCA 5KG4A 5B0CA 3QFWA 4ZVTB 1IUJA 2FVQA 1UFWA 1VRTA 2BA9A 1K0TA 4J90A 2B6AB 2E5LJ 2R7SA 3I5CA 1Y3KA 4NLGA 1WKKA 2YNGB 4F4YA 1XNRF 2XWYA 2N7CA 3K58A 3RB3A 2PI5A 2N7YA 2QLFB 3KJNB 2DPIA 2NPFA 4Q7AA 3RYLA 3QSYB 3IWNC 1REVB 3T9NA 2ASDA 2EG2A 3TQ1A 4C8ZA 5H9FK 1UWBB 3WQPA 2F5GA 3ISZA 4DZ6A 1LWCB 4CI0B 3NAHA 2ROEA 2MZ1A 4RW7B 4C11B 2VBYA 1TFWA 3DRSB 3RJMB 1DLOA 1MNEA 2ATCB 5EWEA 3V4IB 1TKXA 1NBEB 4DOZA 4C8KA 1HNVA 3FBBA 5HAOA 4Y28C 2ATLA 2BJ8A 2NXEA 1UAWA 4IYQA 3MECB 4K4YA 4K4SA 3KLHB 1DFDA 1RE1B 4RW4A 5KOXA 5KFNA 2YX4A 1ZZNA 5IWAF 1TL1B 4V1Ak 3Q8QB 3UCUP 2QZ8A 4CO4A 3UNYA 2IRUA 4H4MA 3OTOF 1IBLF 1DJ0A 1T9WA 2UVVA 4Q8FA 2X7IA 4LF4J 1QVFR 2C2ZB 5ETMA 5GVQA 5FLXY 2SXLA 2FLPA 1RCXB 1IWGA 3IO1A 3C8YA 2CVIA 2DCUB 1HA1A 2HMIA 3W2VB 3BPSP 3ET6B 1NJXA 2EFVA 1F0XA 2IM1A 1Q8BA 2CQGA 3KDNA 1R6VA 2QFJA 1ZTTA 3THTA 1S0OA 1S1UB 2KZMA 3HHLD 1RT4B 4I68A 1HD1A 1VBKA 2EBGA 2GIQA 2MLZA 2R3VA 2YKNA 2W9CB 3MPVA 3H98A 4KKOA 2E9RX 4DR4J 2F4VF 2MQMA 2PE8A 2CJKA 1RWKB 2R7TA 1SJ4P 3HJFA 3N6MA 3M2UB 3R1LA 2W7AA 2LLZA 4PPZA 3CCSS 4KTQA 1AXQA 1F3FA 2QL9B 4F0HA 4CH7A 3KLVA 3J7AN 3QATA 4TN2A 3UDCA 1QAIA 2XZTB 4UZCA 1HI0P 2HGMA 1VCTA 4ID8A 1EQ0A 4N5SA 3TEGA 2DEIA 3C46A 3H0PA 4OMFG 4TY9A 3CIZA 3J7YI 2UUAJ 3QLHB 4LF1A 1OMSA 1C1BB 2WRMA 3JXOA 3LGHA 2P9GA 2CQIA 3V5RA 4ZCMA 4RUAA 2RRAA 4DR7F 2UUBF 2AYBA 1P9YA 1SQFA 1H7WA 1S4EA 2DGOA 2F8HA 2VKZG 5EGYA 2V2QA 2MZSA 4ZKAA 1MMDA 2KXFA 2BW2A 3LA0A 5DLGA 4JB8B 2W8KA 5D3GB 3AFGA 3A8JA 3VAFA 1PJ7A 2Q6BA 2P9EA 2C42A 4OV1A 3CB4A 4X65J 2DGUA 2ZHBA 1GX5A 2HNYB 3UPFA 4X4RA 3M9MB 4UOHA 2MKIA 2D41A 4JI3F 5JXSA 3HX9A 2IAJB 1V5VA 2W25A 3CNQP 1NXIA 3V4MA 2KG0A 1I1GA 2L3MA 3MECA 1KN6A 4IH7A 1S6OA 5H1SV 3HSDA 1TV6B 1H2TZ 1WF2A 4NEYA 5B7WA 3TZYA 5EN1A 2C3UA 4MK8A 5BYQA 3I6PA 2E9ZA 2IM2A 3D4JA 4IRDA 3PJXA 4K8RA 1KHWA 3L9ZA 4K7QA 2LDIA 4M63A 3M8QB 4O4GA 4WU3A 4ID5B 2RHSB 4F4XA 4P6QA 4DG1A 1X4FA 4EYHB 4E8UA 1A6LA 1N6QB 1LW2A 3Q86A 4CT9A 2AZ1A 4C48A 2FGOA 1PGZA 3RB0A 1CS4B 5MLCV 1RACB 3FKBA 2XNQA 1HPZB 1WUUA 3NBPA 4NLUA 5AJ3F 4PG8A 2F4VJ 4PR6A 1N36J 5AXLA 5LM7E 1D09B 2NXCA 2AEFA 1IKWA 1C1CB 2FQQB 3OL6A 1VFJA 2I2YA 4OI0A 4KGMA 1N5TA 4M5MA 1VQMS 2IYGA 3VAHA 3CC2S 1N5SA 4N77A 4WE1A 4IFYA 3SV4A 2K8GA 4XO0A 5A8KA 2XHCA 2XMAA 3OVAA 3IA0A 4USVA 3LUYA 3PYGA 4KE5A 4CLTA 3BYPA 3OL7A 2W9BB 1JWWA 3QNWB 2E1PA 2IVMA 2VDIA 2Y0SD 5HO4A 3D1HA 5IOLA 3PRVA 4GKJF 1CQNA 2GJFA 1JLCA 2FZCB 3CCRS 3OLAA 3GG1A 3BQ2A 1NB7A 4MFBB 2QA1A 1LWFB 1YJNS 1KTVA 2ZDOA 2AW0A 2BM0A 2N82B 4C4WA 4DFJA 1B0VA 1NH8A 3GTYX 2LQ5A 3QLHA 4CH0S 5J2QB 3WC2A 5A8WA 5HP1B 4IR1A 2YKMB 2K1RA 3CDBA 5A8WB 2Z56B 5HP1A 4F4WA 1IJEB 2RF2B 3QO9B 5LMNF 2NSBA 2RQKA 3D7SB 3HD1A 3D2WA 3BSNA 2HGLA 3SCLE 2MHNA 3CCVS 2OD6A 4HH0A 3ZZYA 2B4PA 2RIJA 3W9HA 1N88A 2FZGB 1Q5YA 4C0BA 3DLGB 4P9SA 2IA6A 4ZVPB 2J0XA 4JYAF 5HJYA 3H2VE 4PZVA 4ECXA 2DNLA 3MCOA 2MPUA 2XMVA 4QZVB 4KC5A 4ELTA 2IMWP 2NXJA 9RUBA 4DL4A 1CG2A 1Y10A 2ZJPQ 4JI5F 1Q1KA 4IOBA 3DRPA 4DFMA 1NK7A 3G6VA 1RZMA 4P7VA 1HNZF 2CG4A 3VZIA 5HL7Q 1RT3A 3UO0A 1NH7A 2MKSA 1QLNA 4LF9F 3ZO7A 1HQUA 3CCES 4ZPWR 3IRXA 1JX4A 1DZ5A 1VQYA 3EVOA 3K89A 4O44A 4USIA 4JOUA 4FYDA 1H6KX 1T95A 3DLBA 3B54A 1RQ0A 3WHIA 1NHVA 4RL1A 1JLBB 1GH8A 1G6BA 2DHHA 4ALZA 1HHQA 2FLLA 1S9EB 2W8LA 3BF4A 2J7UA 1Q4RA 2VASA 3M6WA 2VQEJ 2EK1A 4ANDA 1TUGB 2XULA 3ZZOA 1PCAA 2VQFJ 2GQQA 3MM8A 3ICLA 2C3OA 1LWCA 4ZVQB 4F4KA 3MR3A 2NPIA 1DQAA 1JJCB 2OAUA 5I42A 5CYQA 3VWSA 3L7OA 4N7TA 3FMWA 3VCDA 1NU4A 2CJAA 3MPYA 1FEEA 4NXNJ 1KOHA 2R7VA 2WK4A 5J2PA 3L7PA 1UPPA 1QE1A 1TL3B 2ZD1A 3MTJA 4TU8A 2VOPA 4ICLA 4K2JA 4P52A 1VQLS 5D15A 1I5OB 2FGCA 4U8VA 2M7SA 4GO5X 3D3CJ 4YB1P 5IM0A 3CW2C 3MTKA 3TA1A 5KT7A 2DGVA 4DQIA 3LQVA 4HI2A 3U02A 3EPIA 3I0RA 4CLLA 1OY6A 4MKBA 4UOCA 3DGPB 1S7HA 2ZH2A 2RVJA 2DEJA 3EXCX 1RUSA 3VAIA 1ZPWX 3C14B 4D3HA 4Z7CA 1BD6A 1F3VA 1Q7LB 1VIXA 2Q1LA 4DQQA 1V6HA 3FSXA 2CPYA 4B3MJ 1HYSA 2AJ4A 1YGYA 1HNZJ 2QLBB 3DOLA 5F8NA 3QJPA 2OFHX 3RAMA 4JI5J 4JI7J 2QL7B 3MFIA 1KR4A 4PXBA 3V6DA 1CBKA 3D54A 4FYVB 1DBDA 3NCPA 2HLTA 3AXMA 8AT1B 3NGUA 4EBEA 2FY8A 3KLIA 1W25A 5B0EA 4JI1J 1RTIA 5IT9Y 3EDQB 2LQ8A 2HZAA 1VRQC 2QRRA 2VBWA 3CT9A 4RUBA 2HVZA 4AXJA 4BLGA 1CJKB 3Q8UA 4DPXA 4LF9J 3CC4S 2ASLA 1U6FA 1YVFA 3AOAA 3IGVA 2IRXA 1T02A 2WONA 1KFDA 3MCMA 2GV1A 4IR9A 3GG0A 4GKKF 2RHQB 1N0VC 1SL1A 1ELOA 1SJQA 3IS9A 5HJXA 1NSKL 3WBZA 3MAAB 4Y0FA 1A9NB 1F1BB 2BJ3A 2CQCA 2FVRA 3T5HA 4R0JA 1UPMB 3JTOA 2E9TA 1CC7A 3CJKA 2UU9J 4QYZJ 2GNKA 4X4PA 1GMWA 4OL8A 2WVCA 1UJ6A 3OJUA 2D3OR 2R7XA 3J7Z5 1R89A 1FF2A 2IVYA 2W4DA 4QQBA 3F41A 5CCMA 3CCWA 2C2KB 2AX1A 1NCLA 4CDIA 1M5SA 2Z2LA 1T9TA 3AJDA 4B9VA 2D7SA 2ZD1B 4XDCA 2P2CB 3ZZRA 3W9JA 2PIIA 5GAHU 2PEHA 3HK2A 3R7SB 2MQNA 4LRAA 1FXLA 1UA0A 4IRCA 2GX8A 3E3XA 2F63A 3EMTA 4NASA 3ZTPA 3KHGA 1ZYQA 1I6JA 1AUDA 1XNQF 3H8YA 4LUBA 4EEYA 1U1NA 4H4KA 2YNFA 2L48A 3NOGA 4BC9A 5KFKA 4WFBQ 4YQWA 3TVZA 3SCIE 5LSOA 2IHR1 4J9NA 2BDPA 1N6QA 5KFLA 1PG5B 3KOAA 1WSVA 3IBCB 4WJBA 4CLFA 1ZBTA 1D8YA 4OJ3A 2HHPA 5GAEU 2KM8C 3EPGA 2CQ1A 1X7VA 4DV7J 4ZVUB 4UY85 3FSYA 3GIRA 2UV8G 1S6UA 4FF2A 2FDNA 4NOHA 2BXJA 3AXKA 6AT1B 1FKPB 1S1XB 2V8GA 2OMOA 3IR5B 3RB6A 5F8HA 3ENQA 5DRKA 3UDLA 4EO6A 5KFPA 2L41A 1CQMA 1MWYA 3PYDA 1RGVA 3F73A 5LSRA 3V4IA 1TVRA 5CA5A 2LXFA 5HVGA 4UOFA 1PKUA 3VAKA 4ED0A 1RCOB 1T3OA 2FJEB 1M1KT 3TRGA 2QMWA 3MD3A 5KFWA 1WKLA 1IJFB 3SSQA 3MOJB 2V68A 3OR1A 2JFDA 4ILLA 3HFVA 2G2YA 4C8OA 3TVKA 1WF1A 2KI2A 3FQLA 3GP9A 2WONB 1IQTA 2X1GA 1TL5A 2CNNB 1XK8A 2DGXA 2XLIA 2HK2A 4J9OA 1LOUA 1SKWA 3IBWA 3IAS9 4WK1A 4TVAB 3W62A 1RAAB 4QWEA 1RHJB 2B9XA 4ER8A 3M1VA 4B02A 2JEJA 3GJRB 2FHJD 1CULA 1EJ7L 4HTJA 4TQRA 2APOA 2ZNZA 2FVCA 2OPRB 1X5OA 1G3OA 2ZH3A 5C24B 1UVKA 5KG7A 1YJTA 2HPUA 2VBXA 3HVRA 5DG8A 2HZCA 4X4SA 1P1TA 3W2WB 2O01C 5JUMA 4IFVA 2DR7A 3Q2TC 3NNHA 1TAUA 1CEZA 1HQEA 2D74B 2Z30B 3CJ0A 4DV6F 2UXCF 1RWXB 2CUYA 2RSQA 3BS9A 3VGTA 5HQLA 2G4BA 4Y2MA 4NZ7A 4KR0B 1N4LA 5KTQA 2Y1IA 1SB6A 2B9YA 1R8HA 2I9SA 1PC4A 2KVQE 2CZVC 3EUNA 5G4DA 1K44A 4YDXA 1RAOA 5E41A 4ED6A 4B3SJ 3QIPA 4J7CA 3AH6A 3AHPA 2ZE2B 3DRRA 2BOAA 3I4HX 1RHQB 2VG7A 4JV2A 1M5PC 1FVSA 1RT6A 2MKJA 2ROGA 2JLGA 1HNIB 4WXWA 3UE2A 3PW5A 2FYXA 3CE8A 5H9EK 1NSPA 2DK2A 2EFPA 2C1EB 2Z57B 3GJQB 4LF4F 5H9FJ 4KQZA 4DR3F 4IO1A 2ACYA 1NUEA 3QFHA 4YN3B 5AE3A 3PYEA 4DUYJ 2CNLB 3B8HA 4Q2MA 2Z0GA 5C2CA 3VAGA 1S9GA 3LP2B 1HNWF 3HO1A 1WHVA 3BR9A 1HBUA 1OIAA 3IBFB 2CPIA 3DU6A 4FYWB 1HW8A 2FIUA 2MTLA 4GMKA 4ZVRB 5KFVA 3I56S 4DV1J 4PPDA 2EFOA 1IR0A 3W3SA 1Y5IB 4GVLA 2PMZD 2XMJA 3ZTQA 3C3LA 3H5XA 4AQYJ 3AOCA 3AQOA 3HHLC 3M9OB 1WDDA 1Q8LA 1E6YA 5KFUA 4DG1B 2NCKL 5GAGU 5KFBA 3MM6A 5KFXA 1HWUA 2RB7A 5HROA 1NZAA 3W5YA 4ZIWA 4ES2A 5IQ6A 4ZHRB 3B78A 3ETMA 3LP0A 5C42B 2FC9A 1GX6A 1U8WA 4ZHRA 3T5KA 3BN7A 4A46A 4OIXA 3R5DA 2JH3A 4L6V3 4WTYA 2F8MA 2A18A 3FNNA 2BBEA 4NLYA 5E3AA 2ZVSA 1S59A 3N0VA 5ETNA 5HVHA 2MXYA 4ZIVA 4PRFA 2N3OA 2C2OB 1PAUB 4CLUA 3S01A 3NGSA 4RBTA 2HW3A 1XC9A 3U1MA 3H2LA 1V3RA 1W26A 3VGVA 4X62F 4CCHA 4A8FA 1UVLA 4LREA 2XY7A 5AE1A 2KU7A 4Y3CA 1X9SA 1P27B 5KG3A 2YX1A 9ATCB 5M2PA 4ZJLA 3MUMP 3TX8A 1X60A 1TK5A 1LNQA 1JLGA 3TWZA 1GFWB 1U2CA 1XJWB 1EKRA 4YY3F 3KMQA 2WTFA 2KT5A 2C2EA 3MM9A 2V34A 2LFVA 4XAKA 2BE7D 2HAFA 2A2CA 2HFVA 4NWBA 2DD8S 3SEOA 3DOKA 1YIJS 5K14A 2D9PA 1WC3A 2H54B 4EK2A 5DDQC 3CCZA 1SV5B 4N8OA 3LGNA 3AY0A 4DR3J 1ITPA 3NWRA 3CJRA 2JSXA 2UVWA 2WBRA 3CUNA 2PT0A 2V4JA 4ZLNA 3U7JA 4LSNA 5HVFA 2BANB 2LP4A 2FPHX 4I2QA 2FJVA 2RQMA 3FFIA 2AYMA 2M2BA 1QTMA 2DB1A 2HQFA 4B3SF 3GV7B 4QCLA 4FNIA 1U7LA 4UUXA 3GFXA 3RRGA 1U1OA 5C2GA 1O5JA 4I7FA 4DV2J 3VZHA 2IJFA 1P1LA 4MKAA 4ECQA 4I7FB 1J27A 4O3NA 4PWUA 1U1QA 2IAJA 5KG0A 1N36F 4F2RA 1VJQA 4X4OA 4YR2A 3TAQA 5EWFA 4A47A 4OLOA 2VA3A 1UW4A 1A7GE 2M9KA 1QM9A 3W64A 3S1TA 4CO2A 4AL5A 2Z58B 3Q24A 1C0TB 3RU0A 4H4KC 4OX9J 4Q0BB 1NDPA 4KHRA 4C8LA 5AT1B 3E01A 2UP1A 3CPWR 4DR5J 2DNOA 3A4TA 1HNXF 1SVDA 2B9EA 3W8PA 3M8WA 2ZH8A 1B99A 3ADAC 1QSSA 1FNOA 1R8AA 3A3NB 5BYRA 1WOPA 5A8RA 4JI0J 1SJFA 3PEHA 4Q45A 3HLUA 2GJ2A 1U2FA 1G4CA 1GAOA 3NL0A 3P5TL 2HS4A 2NLWA 2DPJA 2J6TA 1S9EA 2YNHB 4OJHA 5A6WA 3UI3A 1F5AA 4X65F 3M9NB 4AD6A 1JQGA 2M70A 4EMDA 3MM8B 1JLAB 1J5OA 3OL9A 2LQ9A 2HEKA 3N79A 1RWOB 4F4ZA 2UXBF 1U09A 1Z2LA 1EIYB 4HKQA 2W01A 2QSFA 4KPCA 4MIWA 3G9CA 2Y8WA 4QU6A 1NHKL 4WIIA 4ZLPA 3OTCA 2I8EA 1TQLA 2AEMA 2RH3A 4ZVFA 5K8MA 2FVSA 2UUAF 2HVIA 4A8YA 4WYLA 3J81U 4B3TJ 4DSJA 4B3RF 1NO8A 1SH0A 2E7XA 2H5IB 3A13A 4R8UA 1K73T 4ZCLA 2ZH7A 4B9SA 2UXDJ 4R8UB 1CJKA 1MW7A 5LT5A 2AJFE 4DQRA 3EM1A 1LXNA 5J2QA 3CEDA 3LTOA 3KHHA 1YBAA 4J9PA 4AXIA 3ENWA 2HWHA 4DV7F 3B6BA 1VLOA 2KYZA 3R2CJ 4HTIA 3DLJA 1I51B 2RF2A 3QO9A 4E2FB 2QLXA 3LO3A 3O3LA 4NLSA 5THWA 1FDAA 5DDPC 4P2SA 1RHKB 2NZCA 4KSEB 1KD1T 1B64A 2QEXS 2IMOA 1SUQB 4LFAF 4LVNP 1WF0A 3D68A 2LA6A 5D78A 2UUCF 2IC3B 4NA2A 4J9LA 4J9KA 3RW7A 2DNGA 3TJ9A 3GZ7A 3S6EA 3BSCA 2DH8A 2B0GA 3D5MA 3D28A 3GCWP 3SDEA 3BO3A 4USTA 2XGPA 4ED7A 4UUWA 1NKEA 1HQ2A 2MLYA 1H98A 2G2OA 2RD5C 4NLOA 4NPOA 1FERA 4C3MA 4PWDB 1VBYA 1F60B 4QOTA 1WI6A 5EUHA 4PWDA 2OELA 3AB4B 4OQJA 4Z2XA 1FWKA 2B4UA 4CWBA 2UVUA 4WF9Q 2CYYA 3MOZA 2BJ1A 5CHCB 3OT9A 1BLUA 2LDYA 1XTZA 4M5DA 1VK3A 4RW6A 4M5DB 2AMCB 1JLQA 3ISNC 3SV3A 4U67Q 2V2VA 2X1BA 1NK0A 3HP6A 2WW4A 3MDFA 1UW9A 2PMHA 1S7IA 4RO0A 2CPDA 2DY9A 3M8PB 5KG6A 2E44A 2OEKA 1VQ6S 1YZ6A 3KTQA 1AYEA 2HZVA 2BV3A 3HVAA 4J91A 5B0BA 1V3ZA 4DPWA 2BRKA 4XIUA 3KJVA 3D6TB 1KONA 3EDRB 2QT7A 3ILOA 1WC6A 4NEZA 4OYZA 2XSFA 1S49A 2H3EB 4C11A 5L1IA 4L72B 3R9LA 2DJWA 3TOQA 1SL2A 2XG8A 3FJ2A 1R0BG 3FK4A 1RT1A 2KXHA 4ETZA 3S8SA 1HBUB 2JZ5A 1JNZB 2CJXB 2HAIA 1Y0HA 2EKYA 2E1RA 2ZKUA 5J1EA 4P71A 1VISA 2JNJA 3TVYA 1GXLA 1R31A 5EDWA 2ADBA 1KQSR 1TKDA 4C8NA 1WHWA 1KQKA 5K8OA 2W2PP 1RTJA 1WC5A 3IAM9 5CYMA 5HSPA 1WG4A 4Y2AA 3B4DA 3MPUB 4NI2B 3TYTA 4ES1A 3KK3B 3OFFA 4HHJA 2PA8D 2K7KA 4A8SA 3C15A 3AD9C 3M1VB 3D1QA 1OY9A 3FGVA 1UVIA 1U47A 1PJ6A 2X51A 2YTCA 4DV6J 4NLTA 4Y2CA 3R7NB 2LMIA 4ZPAA 2V67A 3HI9A 3TX0A 1GXUA 4WPAA 2UUCJ 1HBOA 3I5BA 2OI2A 5A76A 5I3UA 2WSEC 4YR0A 3OVBA 1QDUB 3MM7A 3JB9k 5CXTA 3R2DJ 4B9UA 3E8OA 5L8RC 4BWMA 5K8NA 4JI2J 4ILRA 4YR3A 4X64F 4B3TF 3C6UA 3LALA 1RT7A 3DDNA 3WIVA 4PQAA 3EX7B 1RAFB 4EGLA 3I82A 1VDHA 4QWDA 2NXUA 4LR7A 3EYZA 3FVYA 3C6TB 5T7LA 1K1QA 4O0NA 4RW8A 4BC7A 5ADZA 4LF6J 4QYZK 4NRTA 4CLKA 2GCFA 2F8EX 2LVWA 4DZDA 4F3QA 5I3QA 1WDTA 2L9DA 3MAHA 4K5SA 5D0EA 4KO0B 5GADI 5G0RB 4LMZA 3ETOA 3GILA 4A8QA 1VQNS 4KV8A 2E1MC 4WKYA 3CCUS 2H48B 1N34F 4KV8B 1RBLA 2GAGC 5F0WA 1CC8A 3MPWA 3JAMY 1FRIA 5KG2A 2J7WA 3GMGA 2DNYA 2PGCA 3PM9A 4DL2A 5CZXA 1VRUA 2NUUG 3QJJA 3IWLA 3P8BB 1H2UX 2AJ2A 3QWUA 1VBZA 4YP3A 4NLDA 4C8MA 2A3JA 4J9RA 3FEYB 3Q0AA 5SUHA 2XSJB 4M1KA 2F9JA 1QSYA 1RA7A 3PW7A 2MLXA 3SFGA 5F8GA 1HL6A 4DJBA 3HULA 4GO7X 1HARA 3KLHA 4WFZA 5DG9A 3KNGA 4IG3B 3Q8RB 4H4MB 3FZ2A 4O4GB 5K8PA 2R4FA 1YHQS 1ZM3A 4DR5F 2HVDA 1RT3B 3RAXA 1CVJA 3KHLA 1RAGB 2EBEA 4WU2A 5DJBA 2PFDA 1H3DA 5C25A 1YBUA 3HZGA 1BGXT 1SC6A 3FBFA 2VPZB 1CS4A 3D66A 3D1OA 5MAOA 1S77D 2G0CA 1QAXA 1CULB 2W4PA 4DS4A 2G2ZA 1FE4A 2HBZB 2AJ1A 3AQPA 4I64A 5DG7A 1PO6A 1NKBA 2J0SD 1NPPA 2A1BA 2CXEA 3OFGA 4AE5A 1T03B 1CJVB 4PABA 3ZNJ1 4OZ3A 4U7UK 1R6YA 2DGWA 3ZFVA 2Y3YA 1BY9A 1E6VB 2H4YB 3HSJA 4ZCKA 1YSJA 5AXMA 5DLFA 1YBTA 4CTAA 2CQDA 3I4PA 2OP5A 2P5VA 3K8VA 4M8LA 2JJ4D 3T1AA 1S97A 4O3RA 1R43A 2DR8A 4OYIA 5B0DA 2RDJA 1Q95G 1D3WA 3V6JA 4OZ1A 1Z4UA 2DNMA 1M1GA 1LFPA 3BEGB 5GMDA 3HD2A 1GXTA 5IV4A 1G7CB 5SZTA 3QZ8A 1NK8A 3J80U 2LCWA 3MMBA 4YEAA 2IIHA 1C1BA 1U02A 5EHHA 4FYXB 5KFTA 1X4AA 4PWWA 3DLEB 3NEKA 1DTTA 3N5FA 4I4BA 1UL3A 3UD4P 2R8JA 1IKXA 1KFSA 3HCXA 5KFYA 1YJVA 1TKTB 3AA8A 5HBMB 3T3FA 2VODA 1WG5A 1H38A 1JB0C 2W2MP 3OSNA 2UZAA 4DV4J 2E1CA 2OPQA 3W5XA 1P8GA 1IR2A 4IDKA 5KT6A 2PN6A 2RRNA 2MSTA 3I0SA 4K5RA 5C5JA 2XSJA 4WP8A 3RRHA 2FLOA 1QSLA 3UN3A 1HR0J 1FXDA 1HHSA 1KTQA 1RHMB 3VALA 2UXCJ 2UV8A 5KFFA 3J81j 4JI6J 4Z37A 2ZEJA 2M8HA 1HFEL 2KHCA 1Q81T 1J5EJ 1IBMJ 2W2QP 4QBUA 4URGA 3OTDA 4I6YA 5K9FA 4ZITA 1O8BA 4PAAA 4G1QA 5LXRA 1C0TA 2B51A 4B9TA 1APSA 4Q0BA 4WZMA 4P2MA 2EC0A 2G13A 1R7IA 3IRXB 1GMWD 5EWGA 2ERRA 4WFXA 2A10A 2V4JB 3M8RA 2JVOA 3A8KA 1JK9B 3NBPB 1UA1A 4DEZA 3MXHP 3I9V9 3OJSA 1N5YB 2GMLA 2LEAA 1TELA 2XYGB 3TZZA 2AV5A 1ZETA 4IH6A 1HIYA 3OHAA 4LBHA 3IC1A 2ZJQQ 5B08A 2E5GA 4DF4A 4MAKA 2CPZA 3W61A 1KDNA 1SBRA 1ZA2B 3BYRA 3KUGA 3QT8A 1UWBA 1K1SA 1S12A 1UZHA 2YKPA 4H54A 4RW9B 2QYCA 1SPBP 2C2RA 4NLRA 5CYQB 2R7WA 3NNAA 3KDOA 2VDHA 5IV3A 1XMQF 2DTJA 3BN4A 3GIKA 4CLPA 1T3NA 1JLGB 2CFXA 4OYMA 2F9DA 1U2RA 4PG7A 1TUWA 4USJC 3RUBL 5LMUJ 2DITA 2VFRA 2R2UA 1XMOF 4FKXA 3MWBA 4YFUA 4J9QA 4IQXA 1QD1A 2K3KA 3EGWB 3W65A 2CJBA 4LFCF 2AKWB 1WHYA 2E5HA 3CCMS 4K50A 2DHGA 3NOCA 1U4BA 2QA4G 1FWPA 2EK6A 3R5BA 3TUZC 4USWA 1TZ0A 2KDOA 2XY6A 3P4UB 1NK4A 4YS2A 4HHHA 1ICEB 3G86A 4NI2A 2F65A 5GADU 3DM2B 3IRWP 3QT5A 5LMUF 4OHWA 3DGPA 3DYAA 3DM2A 3MEDA 4UW2A 4ECYA 2KHDA 1HD0A 3I0RB 5ETQA 4B08A 3J7ZT 1XMQJ 3HT0A 2P6SA 2OEJA 3LH2S 2HQ3A 3ILJA 4F8RA 1JLEA 1Q79A 2V63A 5BR8J 3PRDA 3O8WA 2YNIA 2KJWA 1NRKA 1RT4A 3GIIA 2WHOA 1D1UA 3V6DB 2KG1A 2G9OA 2CQPA 5F0UA 2VKRA 4OHXA 1NAQA 1B3TA 1WELA 3HVTA 3KLFA 2FJBB 2UUWA 4DPTA 3KMSA 3MEGB 2FLNA 2PDAA 4CQ1A 4OYXA 1YLXA 2I1RA 1KS2A 1Y5NB 1JIHA 4DXLA 1HLWA 3CWJA 4ZK7M 1S72S 2X3DA 2BUNA 2F40A 4MKYA 2B5JA 2V5HG 4CYUB 1CJUB
chains in the Genus database with same CATH topology
3GP9A 3BH7B 1WKJA 3R9LA 2B8QA 3BBBA 3Q83A 4UOHA 3FCWA 1S57A 3G2XA 1JXVA 4CP5A 1LEOA 2DXEA 3EICA 3BBCA 1F6TA 4C6AA 3L7UA 1XIQA 5CAAA 4S0MA 1LWXA 3Q86A 2AZ1A 1NDPA 3BBFA 3FKBA 3ZTSA 2B8PA 3VGTA 1B99A 2BX6A 2VU5A 3Q8YA 1WKKA 1K44A 3NGUA 4WBFA 3Q89A 3BH6B 1BE4A 3Q8UA 4DZ6A 3NGRA 1NB2A 1ZS6A 1NSPA 2DXFA 2ZUAA 3FC9A 4KPCA 1NUEA 1XQIA 5IOLA 3PRVA 1NHKL 2HURA 4O0NA 1NSKL 3EJMA 1NLKL 3FBBA 1HIYA 4ANCA 5BXIA 3Q8VA 4F4AA 1KDNA 4DUTA 4W98A 3EM1A 3ZTQA 5CABA 4UOGA 1S5ZA 1VYAA 1BUXA 3B6BA 1NCLA 3FBCA 2CWKA 3VVUA 1EHWA 3NGTA 2NCKL 4ANEA 4F36A 3ZTRA 4FKXA 1BHNA 3ETMA 1NDCA 3VGSA 1U8WA 3EMTA 2BEFA 4HR2A 4FKYA 3ZTPA 3MPDA 4ENOA 3EVMA 1S59A 1W7WA 3FCVA 3VVTA 3ZTOA 3EE3A 1NDKA 3NGSA 1MN9A 3VGVA 2HVDA 4DI6A 3JS9A 1F3FA 3EVOA 3GPAA 2HVEA 3FBFA 3PJ9A 3B54A 1NSQA 3FBEA 3ENAA 1MN7A 3DKDA 2DYAA 2AZ3A 1HHQA 1NPKA 3WX8A 1NDLA 1UCNA 4ANDA 2DY9A 1PAEX 4UOFA 1PKUA 3ELHA 4EK2A 5C7PA 3VGUA 3EVWA 1WKLA 1B4SA 1HLWA 2DXDA 3DDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GP9 A;  3BH7 B;  1WKJ A;  3R9L A;  2B8Q A;  3BBB A;  3Q83 A;  4UOH A;  3FCW A;  1S57 A;  3G2X A;  1JXV A;  4CP5 A;  1LEO A;  2DXE A;  3EIC A;  3BBC A;  1F6T A;  4C6A A;  3L7U A;  1XIQ A;  5CAA A;  4S0M A;  1LWX A;  3Q86 A;  2AZ1 A;  1NDP A;  3BBF A;  3FKB A;  3ZTS A;  2B8P A;  3VGT A;  1B99 A;  2BX6 A;  2VU5 A;  3Q8Y A;  1WKK A;  1K44 A;  3NGU A;  4WBF A;  3Q89 A;  3BH6 B;  1BE4 A;  3Q8U A;  4DZ6 A;  3NGR A;  1NB2 A;  1ZS6 A;  1NSP A;  2DXF A;  2ZUA A;  3FC9 A;  4KPC A;  1NUE A;  1XQI A;  5IOL A;  3PRV A;  1NHK L;  2HUR A;  4O0N A;  1NSK L;  3EJM A;  1NLK L;  3FBB A;  1HIY A;  4ANC A;  5BXI A;  3Q8V A;  4F4A A;  1KDN A;  4DUT A;  4W98 A;  3EM1 A;  3ZTQ A;  5CAB A;  4UOG A;  1S5Z A;  1VYA A;  1BUX A;  3B6B A;  1NCL A;  3FBC A;  2CWK A;  3VVU A;  1EHW A;  3NGT A;  2NCK L;  4ANE A;  4F36 A;  3ZTR A;  4FKX A;  1BHN A;  3ETM A;  1NDC A;  3VGS A;  1U8W A;  3EMT A;  2BEF A;  4HR2 A;  4FKY A;  3ZTP A;  3MPD A;  4ENO A;  3EVM A;  1S59 A;  1W7W A;  3FCV A;  3VVT A;  3ZTO A;  3EE3 A;  1NDK A;  3NGS A;  1MN9 A;  3VGV A;  2HVD A;  4DI6 A;  3JS9 A;  1F3F A;  3EVO A;  3GPA A;  2HVE A;  3FBF A;  3PJ9 A;  3B54 A;  1NSQ A;  3FBE A;  3ENA A;  1MN7 A;  3DKD A;  2DYA A;  2AZ3 A;  1HHQ A;  1NPK A;  3WX8 A;  1NDL A;  1UCN A;  4AND A;  2DY9 A;  1PAE X;  4UOF A;  1PKU A;  3ELH A;  4EK2 A;  5C7P A;  3VGU A;  3EVW A;  1WKL A;  1B4S A;  1HLW A;  2DXD A;  3DDI A; 
#chains in the Genus database with same CATH topology
 1ZZF A;  3NCR A;  2CZ9 A;  2HRT A;  3RTV A;  2BQ3 A;  4I56 A;  3DU5 A;  4OZ5 A;  1YTY A;  5A8R B;  2EW9 A;  1YRU A;  2B7C B;  4J9U E;  4YUD A;  3KK2 B;  3RBZ A;  2DH9 A;  3BO2 A;  2VPY B;  1JNR B;  3DI6 A;  4MK7 A;  2BOP A;  1H0H B;  5KFC A;  3Q23 A;  3KUE A;  2GVZ A;  2HSE B;  4UQG A;  4N41 A;  1ZTW A;  1WEZ A;  2GVZ B;  1JXV A;  3TUJ C;  4ATN A;  4CO0 A;  1WSR A;  2E5L F;  1LEO A;  4NRU A;  3UDV A;  3MD1 A;  3CD7 A;  1DTQ B;  1RAB B;  3UQS A;  2HQG A;  4TLR A;  2XCA A;  2MZR A;  1X0F A;  1TMJ A;  2KN4 A;  4QPT A;  1U48 A;  1HWI A;  4EUV A;  1TK0 A;  3LOU A;  1WOR A;  2RUS A;  3GV5 B;  1VQP S;  4LBI A;  1FRH A;  2VBZ A;  4URS A;  5IQQ A;  3OUY B;  2ZH4 A;  3PW0 A;  1TKX B;  2DRD A;  4WWS A;  4B9L A;  5J1P A;  3QRP A;  1R8C A;  2M4M A;  3BKF A;  2BKO A;  3ITH A;  5IT0 A;  3CCT A;  2BJ7 A;  5A2Q U;  4B3O A;  2VU5 A;  4M5N A;  2XI2 A;  3M8Y A;  1L3T A;  3L09 A;  4NXM F;  1VC5 A;  2RUG A;  3BZQ A;  1TKZ A;  5L9N A;  1LV5 A;  4NCA A;  2JEI A;  3JQJ A;  2FJW A;  2C2N A;  3BH6 B;  1HHT P;  3BGR A;  2IA0 A;  2WAQ D;  1LK7 A;  2HG4 A;  3UD5 A;  3JTN A;  1M0S A;  2CQ2 A;  3G6E S;  5E3P A;  3U1L A;  2XTJ P;  3M05 A;  4L3K A;  1U25 A;  3JQK A;  4LR9 A;  3VF0 B;  4RNO A;  4L76 A;  2G0J A;  2V50 A;  4OZ0 A;  5K20 B;  5HLF B;  1S6Q A;  3CJQ A;  3GFZ A;  1FWL A;  3LP1 B;  3O5T B;  4MIA A;  5HMW A;  4DLE A;  4NYZ A;  1U0S A;  1UKU A;  2ZJR Q;  4CNZ A;  3H25 A;  4USK A;  3DOL B;  3UN5 A;  5HMY A;  2LXI A;  4KB7 A;  3OR2 B;  2XC9 A;  2YKN B;  2GMH A;  1RBA A;  5KFH A;  3SCK E;  4CLZ A;  2OFG X;  2AWZ A;  5T41 A;  2EG1 A;  4EI2 A;  2NQP A;  4F4A A;  1A0O B;  3MMC A;  4KYZ A;  4ZVS B;  3M2U A;  2MKH A;  5L38 A;  4LF8 F;  3NGK A;  1UP1 A;  1I3O B;  1YWX A;  1XMB A;  2KRR A;  3CC7 S;  3OXL A;  1U1R A;  2R2S A;  1FRK A;  5DET A;  2BW7 A;  4ZJQ A;  4I2P A;  2E7V A;  4WYW A;  5F41 A;  4F36 A;  3JQM A;  4K4W A;  4DPY A;  4RWX A;  1X4H A;  1UMJ A;  2Z2Z A;  3UNG C;  1HI8 A;  1FJE B;  3V6H A;  1V5I B;  4JI1 F;  2NS1 B;  2P9C A;  4CO3 A;  3UR0 A;  2BKP A;  3R7B B;  1KVK A;  3W2V A;  1XBW A;  3V2U C;  1S1T A;  5RUB A;  2VIC A;  2KZZ A;  1U6B A;  5D0G A;  1REV A;  2H1Y A;  4NE9 C;  4WP3 A;  4Z7Y A;  4JI0 F;  2DNH A;  1C2P A;  2FTR A;  1OSC A;  4C7Q A;  4DN0 A;  2DR5 A;  1FKO A;  2QMX A;  3AB2 B;  1GNK A;  2GGP A;  3M2V B;  1NHU A;  4M5I A;  4BS2 A;  2PI4 A;  2D69 A;  4DI6 A;  2YVS A;  1X5S A;  2MQ8 A;  5KAK A;  4DSI A;  2V8D A;  3R5G A;  4DMZ A;  5HMZ A;  4OV6 A;  1N32 F;  2ZOF A;  4LF8 J;  1GMU A;  2IM3 A;  5F8L A;  1N34 J;  5E0O A;  5J1E B;  1XER A;  4WFN Q;  4EU0 A;  2XB2 D;  1HQE B;  2FHJ A;  2ZC4 A;  3FBE A;  1KLM B;  2BE2 A;  1UWA A;  3D0H E;  5IZH A;  3J7A 1;  1FHT A;  1NPK A;  1OS5 A;  3WX8 A;  1QVG R;  5GAE I;  3IR6 B;  1RLD A;  3GU0 A;  5L9X A;  4PKD B;  1MU2 B;  3JSM B;  2DRB A;  1VGY A;  3M8Q A;  3DDK A;  3PAC A;  4DWI A;  3NMA A;  5DM7 Q;  2M52 A;  2W4C A;  3PX0 A;  4KGK A;  4TKT A;  4MJK A;  5G0R A;  3EVW A;  3VGU A;  2MKK A;  4KHM A;  2ZBQ A;  2CZ4 A;  2KH9 A;  1YJR A;  1CSJ A;  1D8Z A;  2GIR A;  4OHZ A;  2XM3 A;  2D1C A;  1V9O A;  1RTD A;  2QC3 A;  4DR6 F;  1FTC A;  1U26 A;  2HRU A;  3H5U A;  1KOO A;  1WC4 A;  2V8P A;  2KT3 A;  3UCG A;  3KHR A;  4F3O A;  4KHP F;  1JXE A;  1KBR A;  1N5Q A;  1YRX A;  3BBB A;  1U24 A;  2HFO A;  2POK A;  5E7O B;  4RZR A;  3SSR A;  2XNR A;  4IOA Q;  1OYE A;  4MKV A;  4LRF A;  1FRL A;  1R0C B;  5ETK A;  1UZD A;  2VQE F;  1ACM B;  1YX2 A;  2YX7 A;  3T1H F;  1L3U A;  1FJG F;  4H4O A;  1RT2 B;  1S6P A;  3MMC B;  3QSI A;  2GMJ A;  2YKQ A;  2J8S A;  2K2P A;  3CJ4 A;  3ZZU A;  3ZXW A;  2HBR B;  2QLW A;  4Y2K A;  2ZDP A;  3MFH A;  3OTO J;  1UVM A;  6FD1 A;  1DQ9 A;  1E6Y B;  1YQH A;  2V8H A;  2XEX A;  1S1V A;  3GQC A;  2Y1J A;  2WCX A;  1H72 C;  4IO9 Q;  3G8S A;  1JLC B;  2BYC A;  1F5B A;  4YB6 A;  3RBD A;  4UT4 A;  3LGM A;  3RB4 A;  3OSP A;  3PO4 A;  4K4Z A;  1XEZ A;  2B4O A;  5JJB A;  3H5Y A;  2PD1 A;  1IVZ A;  2EI5 A;  2QO3 A;  3T9Z A;  3Q2S C;  1YK9 A;  5J2M A;  1WAC A;  2DGT A;  2AGO A;  2MJU A;  3ILI A;  3N01 A;  2FHM A;  2VD3 A;  3SXL A;  3EZU A;  5KG1 A;  1S9F A;  4WBF A;  3KG4 A;  4DF8 A;  1VHI A;  1PJ5 A;  5B0G A;  1SH3 A;  5HQM A;  1FX4 A;  2HHV A;  1KP6 A;  2W1B A;  3KG1 A;  3NGR A;  4WTO B;  4OX6 A;  2J9D A;  5A0Y B;  5AXN A;  1FX2 A;  1RTH B;  4ZMM A;  3DLG A;  4HEA 9;  1SI9 A;  1ULR A;  2YQ1 A;  3POT A;  2DR9 A;  3G8Q A;  3NLC A;  2MJN A;  3O1L A;  1K9M T;  5E3C A;  1BQX A;  3KK1 A;  1KLM A;  1TP7 A;  2BE2 B;  4HYK A;  3D9B A;  3THV A;  1HMV B;  5IXU A;  1S1W B;  3CVK A;  4CLS A;  3RG6 A;  4D3G A;  1N56 A;  3C6T A;  4I6A A;  4ANC A;  1UEV A;  1WOO A;  4Y2I A;  4KIA A;  1RAI B;  2XZD B;  4MK9 A;  4NZ0 A;  4R5P A;  4ECU A;  3MAQ A;  2RDD A;  3NS7 B;  4ID5 A;  1OYD A;  2IPO B;  3DOK B;  2AD9 A;  1YG0 A;  2KFY A;  3K0J A;  4ZP8 A;  3M6U A;  2Z2M A;  3PIO Q;  3DRR B;  5GMK a;  3NNC A;  1VYA A;  1RT6 B;  5D4N A;  2NXN A;  2WVB A;  4RX6 A;  4ZOS A;  3P5B P;  4EFA C;  1S76 D;  3IM9 A;  5A2Q Y;  2N3L A;  2V9W A;  2XI3 A;  4NL5 A;  4DX7 A;  4FN5 A;  2JOQ A;  1L3V A;  2ZHO A;  4G1I A;  3DC2 A;  3GYN A;  1EZZ B;  3FFI B;  4A8M P;  4WZQ A;  3P45 B;  1GMV A;  2QSW A;  3QMQ A;  3CJK B;  5L1L A;  3LAN A;  1MWZ A;  1SIW B;  5E2Q A;  1L3K A;  4LFC J;  1VMB A;  2E7W A;  4RR5 A;  3IM8 A;  1HBM B;  4KJI A;  2J9E A;  5T14 A;  2V9K A;  4P2F A;  2LA4 A;  4QYR A;  2BQR A;  1KC8 T;  3EE3 A;  1SJR A;  2JVR A;  3KLG A;  1RYS A;  3JSR A;  4X2B A;  4JP8 A;  2OJ3 A;  3HJV A;  3TAM A;  4BBY A;  1F9F A;  1SKR A;  3UW1 A;  3JS9 A;  1X4E A;  3PEJ A;  4U96 A;  1KQG B;  3SCJ E;  5HAN A;  4M95 A;  2R7O A;  2DIV A;  3BGF A;  3MMA A;  3PJ9 A;  4ZPT R;  5HRO B;  3PV8 A;  1M5V C;  1RHU B;  1K47 A;  1FDB A;  1VJW A;  1FD8 A;  3K8W A;  4MFB A;  4OI6 A;  4R0E A;  2RNE A;  3G82 B;  2DYA A;  4ZPB A;  2B9W A;  2OH2 A;  2JHE A;  3MR5 A;  4XDD A;  2B6A A;  2CIM A;  3DLE A;  3GR1 A;  1IBK J;  2K1R B;  3SZ2 A;  2KFN A;  2CJ9 A;  2UUT A;  4TYA A;  4J9S A;  4DPO A;  2MY7 A;  4I1T A;  2MQP A;  1X8D A;  5L46 A;  3Q8P B;  3QZ7 A;  1P6T A;  1UEK A;  2HK3 A;  2OLW A;  2VUG A;  3I87 A;  1HYS B;  2UXB J;  2EVZ A;  4RW9 A;  3C14 A;  2BAC A;  2H51 B;  4P75 A;  5I3P A;  2WZ1 A;  4FF4 A;  2PFF B;  2IM0 A;  3GWC A;  3W63 A;  4NLP A;  4KH1 B;  5A6P A;  1DY3 A;  2FHO B;  2ZFH A;  4C98 A;  2YKO A;  4B9M A;  2HND A;  2GZO A;  3IMQ J;  3SBM A;  1L3S A;  2Y9H A;  3C16 A;  2XMK A;  1KEK A;  4ED1 A;  2MHE A;  5KOW A;  3TEH B;  2MQQ A;  1X5P A;  1HR0 F;  4ICL B;  4YDD B;  2DXE A;  2GHP A;  4NYO A;  3EIC A;  5KT5 A;  1WD6 A;  1F6T A;  4DSK A;  4F25 A;  1HNX J;  4LF7 F;  5M2R A;  1NJY A;  1U0H A;  2QJ3 A;  2W9A A;  3D6F B;  1M5O C;  4X4U A;  1C0U A;  1M90 T;  3RZA A;  3MHY A;  2GQ2 A;  1N5V A;  3BV8 A;  3ZZT A;  3GCX P;  3RW6 A;  4K4U A;  2DT9 A;  2HRY A;  2Q79 A;  1DHM A;  3PW2 A;  1FFG B;  5KFA A;  2NZ4 A;  3MM5 A;  2LU1 A;  5L1J A;  3R5A A;  2HQC A;  4A4J A;  3R6L B;  1OPZ A;  4KFB B;  2CPJ A;  2XMU A;  2E5J A;  4I6W A;  4NX9 A;  3W9I A;  4KFB A;  4RKU C;  5B0A A;  2R9L A;  1FNX H;  3CIM A;  1IKY B;  2DNR A;  3HHL B;  4O4R A;  1FK9 A;  5DS7 A;  3EXY A;  2EFN A;  1HBM A;  2AP6 A;  1FRX A;  1QY7 A;  4ZDN A;  3WC0 A;  3BO4 A;  2VG6 B;  3HHK A;  2RU9 A;  2RT3 A;  4X4V A;  4K0K F;  3MEG A;  4CLY A;  1DLO B;  3M30 A;  4TYB A;  5D0H A;  1RAD B;  1RT7 B;  3TAP A;  3P96 A;  1K8A T;  1JJ2 R;  2VZ9 A;  3R5C A;  4HT7 A;  1WOS A;  4TY8 A;  3GIJ A;  3G4S S;  2J6S A;  3E2E A;  2HKE A;  1BC6 A;  4PG5 A;  2IDE A;  2CPF A;  4FBT A;  4RW8 B;  1IBC B;  5IWA J;  2OSR A;  1EET B;  4M5H A;  2CA9 A;  3T6B A;  2HWT A;  5CH7 B;  2PMW A;  2JEG A;  1FFW B;  2ALZ A;  2LU2 A;  3PRB A;  1VR6 A;  2J0Q D;  5BYS A;  2C2M B;  2R7U A;  1T11 A;  2M88 A;  1OO0 B;  2KT2 A;  2CAD A;  3TR5 A;  3MMJ A;  2Z8Q A;  4DHV A;  1BUX A;  1WWH A;  1JLE B;  3GR0 A;  4LBP A;  4DDF A;  4N56 A;  2OTJ S;  2K7J A;  5GAG I;  2L08 A;  3LPE A;  2XS5 A;  3NGT A;  1HKA A;  1IXK A;  1UTA A;  3DRS A;  4OI1 A;  3ZTR A;  2YPZ A;  3UFC X;  1S48 A;  2YKA A;  3UN2 A;  1MLA A;  3UCZ P;  3SI8 A;  2VG5 A;  4JV1 A;  2RE1 A;  1RT1 B;  3IN5 A;  2J8A A;  2F3J A;  3I31 A;  4ZVO B;  2OPP A;  4H4O B;  2B4V A;  2BEF A;  4HR2 A;  1FD2 A;  4XPE A;  2VHG A;  1S6P B;  3ITH B;  3MPD A;  3BM7 A;  2ADC A;  3AA9 A;  2HGN A;  1SC3 B;  1W7W A;  3MR7 A;  2J9D E;  2W7O A;  5BJR A;  1VS3 A;  2ZH1 A;  4J9M A;  4R25 A;  3GJS B;  3PX4 A;  2MKY A;  1RTJ B;  1VQ5 S;  3DN9 A;  1N54 B;  2VA2 A;  4UQT A;  3CDA A;  4Y6I A;  5CYM B;  4FDF A;  4ZCI A;  4DL3 A;  1RP5 A;  4I69 A;  4LRD A;  1RJJ A;  1Y5L B;  2MQL A;  3PCO B;  1JLF B;  4G6V B;  4URQ U;  5B09 A;  1X5T A;  2RKI A;  4HHU A;  4IQM A;  3HT3 A;  4FF1 A;  3QAE A;  3UDE A;  5D6G A;  3T19 A;  1KVI A;  4FYY B;  1MN7 A;  3DKD A;  3DCA A;  1CJT A;  3LP1 A;  3QYY A;  3W8G A;  1EAY C;  4ECZ A;  3T1H J;  1FJG J;  2GO8 A;  1RWN B;  1NDL A;  2VFV A;  3GJT B;  1JJH A;  3N28 A;  4LT6 A;  1IKY A;  1SH2 A;  2NUH A;  3HDS A;  5KFR A;  2XCP A;  1WJ9 A;  1IKW B;  3SYZ A;  1VC0 A;  3ELH A;  4YOE A;  4PCQ A;  2AJ0 A;  4ECW A;  4OLP A;  4DUY F;  4OZN A;  2VG6 A;  3W7B A;  1NK9 A;  2FJX A;  4ZVG A;  2HS0 A;  3DOM B;  2UVR A;  4NXN F;  2DXD A;  3W66 A;  4FBU A;  3RRK A;  3M32 A;  3DDI A;  3MGJ A;  3A3O B;  3MCS A;  4F67 A;  4X66 F;  3M8S A;  1ZH5 A;  2E1A A;  2X1F A;  2RQC A;  3K5P A;  4F26 A;  4B3O B;  3MUV P;  2G1D A;  1EB0 A;  2RIL A;  2ZBC A;  2B5J B;  2U1A A;  1TV6 A;  4GRS A;  3MM9 B;  3RGI A;  4RW6 B;  2QE5 A;  4JUZ A;  2YY3 A;  4C0O C;  1NKC A;  3H5S A;  3TUP A;  2JWN A;  3CUL A;  1FJ7 A;  4P74 A;  3PO5 A;  2C22 A;  3IG1 B;  1O0P A;  3OBI A;  4UF4 A;  1ZAX A;  2MEW A;  5DZ6 A;  4DL7 A;  3X1L B;  2XS7 A;  3TAN A;  1UVN A;  4EZ9 A;  3O2I A;  1LK5 A;  1LXJ A;  4O3P A;  3L7U A;  4PEO A;  3F44 A;  2YKM A;  1HNI A;  4QW9 A;  5HLF A;  4LSN B;  1S10 A;  5F8J A;  2XS2 A;  2HHS A;  1GT8 A;  4KBI A;  1NJI T;  2HHQ A;  1TTH B;  2M0G B;  3BPD A;  2CAJ A;  3ZTS A;  2B8P A;  2QA4 S;  1SJ3 P;  2Y1R I;  2HNY A;  4NCG A;  2O66 A;  2OPP B;  4WFA Q;  1QUV A;  4PUO B;  2IYI A;  3SMZ A;  1FA0 A;  1T9Y A;  1RT2 A;  2CDQ A;  2I6W A;  4LF5 J;  4PUO A;  1URN A;  2JRS A;  1EQM A;  1ZM2 A;  2FD2 A;  3T5J A;  4IRK A;  3MEE B;  5DQG A;  4OJ1 A;  2A2D A;  2Y8Y A;  2CDR B;  1RBO B;  2ZH9 A;  2CPE A;  3MCN A;  4HVZ A;  3PZP A;  5E3Q A;  2XHW A;  4NA3 A;  3TNV A;  1FKA F;  4CH1 A;  3G82 A;  1LWF A;  3DHX A;  4DX5 A;  2KJV A;  3DMJ B;  4LSL B;  1GTE A;  3QGI A;  1YJ9 S;  2HFZ A;  6FDR A;  3QGH A;  2OEM A;  3EWG A;  1HPZ A;  5CQG A;  3D3B J;  2IRY A;  1RYR A;  3NAI A;  4B17 A;  3HFZ B;  2HQI A;  2YNH A;  1Q78 A;  4N8N A;  1OQ3 A;  4NLQ A;  1R27 B;  2Q43 A;  3FEZ A;  2HQD A;  1TMM A;  3R5J B;  1S0M A;  4AUK A;  3NWG A;  2AF6 A;  1ZAV A;  2M3D A;  3I9Z A;  3QGP A;  4QIW D;  4W4M A;  3R97 A;  1YJ7 A;  4CRJ A;  3SQG A;  4N76 A;  4GKJ J;  1UJ5 A;  4BDP A;  1T94 A;  2OUG A;  2FB0 A;  1FDD A;  2LKZ A;  3N5B A;  4IFY B;  1XR5 A;  2MKC A;  4JV0 A;  3CXC R;  3MUT P;  5A8K B;  1S4F A;  1SQE A;  1X4G A;  2YQ3 A;  3ULH A;  2D3U A;  1KHV A;  2AYG A;  1YZ7 A;  2W9B A;  2XY5 A;  1X31 C;  4ELU A;  1ZOT A;  1I94 J;  2N4C A;  4YB7 A;  2M8D B;  1IM4 A;  1QE1 B;  1TL3 A;  4HAC B;  3JSM A;  1URR A;  4DS5 A;  4PQU B;  4FKY A;  3H4D A;  3EVM A;  3BKU A;  3NCQ A;  2BM1 A;  2IBK A;  4X4T A;  4RNN A;  3GYX B;  4C97 A;  1S1T B;  1Z2Z A;  4TLQ A;  4W92 B;  3GLJ A;  2Q3P A;  3WIU A;  1IKX B;  3B82 A;  5ETV A;  2BAN A;  5DDO C;  3OHB A;  3TZW A;  2GGP B;  1VRU B;  1RKI A;  2COL A;  2OPQ B;  2QLJ B;  3VAM A;  4QIE A;  2O5D A;  4IDK B;  5D4P A;  2AGP A;  3VQS A;  1BQN B;  3KLE B;  1JXL A;  2CPX A;  3N6N A;  4A48 A;  4YHH F;  3JYT B;  3HHL A;  1KSP A;  3MUR P;  2MZT A;  2RRB A;  3EGV A;  1Z1Z A;  2R8G A;  3BRE A;  3H20 A;  1S1W A;  2YWK A;  3ENV A;  4MIB A;  1N48 A;  2HBQ B;  4JI3 J;  3K5O A;  3LW5 C;  2B3T B;  2I0X A;  3OL8 A;  1T7P A;  3PTW A;  4ZPC A;  4EZ6 A;  1S1V B;  2CQH A;  4CZC A;  3D6M B;  4M5L A;  2O3D A;  1RLC L;  2CWK A;  5KFG A;  1SQG A;  4AFF A;  4OX7 A;  2DR6 A;  1UVJ A;  3NKY A;  3LP0 B;  2ZVI A;  4IKA A;  5HN0 A;  2QGF B;  3NMR A;  4E98 A;  4DR7 J;  2GVD B;  3GB0 A;  3THP A;  4HDH A;  5CYJ A;  4IH5 A;  2BJ9 A;  1FCA A;  2EPI A;  4LF5 F;  1IBK F;  2J6U A;  3JSY A;  2J9C A;  4PYD A;  1TU0 B;  2VJV A;  4ELV A;  1ZAW A;  4JI7 F;  4DFK A;  1CJV A;  1JMT A;  2A6M A;  2A0F B;  4C9D A;  1AUS L;  1F9E B;  2WOM A;  3BSO A;  2DNQ A;  2WOM B;  5HQ8 A;  1FRM A;  2B43 A;  3J81 Y;  5KFO A;  3R1H A;  5KFQ A;  2CNO B;  3M4X A;  1D9F A;  1Y7P A;  2JX2 A;  4OX9 F;  3X3U A;  1BQM B;  3KLG B;  4IOC Q;  3LWL A;  2GHV C;  5JVG Q;  3CCL S;  3HM9 A;  2P8I A;  3PX6 A;  2HVH A;  3IP0 A;  4DR4 F;  1T8E A;  4FS1 A;  5FII A;  2BX6 A;  1C4A A;  1V3S A;  2H65 B;  5F9L A;  4DV2 F;  3SQO P;  5LL6 d;  1KVJ A;  1VI7 A;  1TL1 A;  2O1P A;  4USH A;  5E33 A;  1XN9 A;  3GON A;  1HW9 A;  1GQE A;  1FXR A;  3K2Y A;  3HSG A;  1Q8I A;  1H7X A;  3KUH A;  3EZO A;  2ZC3 A;  1T9X A;  2JLF A;  3WX4 A;  2YWH A;  1VC6 A;  1U1L A;  2MZQ A;  1NB2 A;  1VQS A;  3HPO A;  4RNM A;  5DQH A;  2ZZN A;  4KGV B;  4K4T A;  4K4X A;  1SC4 B;  2J7K A;  4GC6 A;  3DRY A;  3DRX A;  4OYO A;  3FDS A;  3L3C A;  2DRA A;  1U1M A;  1BQN A;  3KLE A;  2Y1L B;  5CCL A;  1WNE A;  2DH7 A;  2HBY B;  2WW8 A;  4NYP A;  4MT1 A;  3V6K A;  1WEY A;  1H74 A;  1TR0 A;  3I5A A;  1PYO B;  4A8K A;  4JV5 J;  1SKS A;  5L39 A;  3PIP Q;  1NJW A;  1RWU A;  2BJD A;  2BZ2 A;  3HVT B;  4AL6 A;  4FF3 A;  4X4N A;  3H2U B;  1PC5 A;  3HXM A;  2KXN B;  3CJ8 A;  3I55 S;  2KL8 A;  2WVF A;  3P3D A;  3PFE A;  3H40 A;  2QN6 B;  3HF5 A;  4Q8E A;  2E29 A;  4EWT A;  4HH1 A;  2H5E A;  4DSL A;  1SCJ B;  4TXS A;  2VC1 A;  3PXG a;  3T5L A;  4FP9 A;  1FES A;  4ANE A;  2KTQ A;  4OYA A;  5T7L B;  5F9N A;  4M5K A;  2VPX B;  3JSB A;  3SSS A;  2DIU A;  3OTE A;  4O44 B;  2MGZ B;  2HFN A;  2KM8 B;  3KK2 A;  3BJY A;  1N0U A;  1F9H A;  1VRT B;  2DHS A;  3BSA A;  3PVX A;  1F2H A;  4YB5 A;  3MI7 X;  3VGS A;  2DKO B;  2ZOG A;  3MM5 B;  1JLB A;  1Y00 A;  1XNR J;  1S0V A;  4NML A;  4WXO A;  3BGU A;  1VK8 A;  2RU3 A;  4JYA J;  1AFJ A;  3M6X A;  3QID A;  3T6J A;  5D4L A;  4RPF A;  1Q16 B;  4W90 B;  1X0P A;  2ZH5 A;  3UVJ A;  1RT5 A;  5M2U A;  2V69 A;  3OVS A;  3M30 B;  4LSZ B;  5DDR C;  1RWV B;  3CCJ S;  1VBX A;  2AJQ A;  1RDR A;  4JI8 F;  1F2G A;  2MB0 B;  4Q44 A;  4JV5 F;  1WTB A;  3T41 A;  2QX0 A;  1DUR A;  3VQT A;  1ROF A;  5C7P A;  1MU2 A;  3VV2 B;  2HHT A;  4LRB A;  1EET A;  2QFI A;  2ZBP A;  3OR1 B;  1WTF A;  2YWW A;  2HHH J;  3KJF B;  1O51 A;  3BGR B;  1AW0 A;  4ILM A;  1OQ6 A;  3K17 A;  3KK3 A;  1VQ9 S;  2EFG A;  1LWE B;  2WVE A;  2ZE2 A;  4KHP J;  2OO4 A;  3CCQ S;  2OHD A;  3HHN B;  2H5J B;  4B9N A;  2EWH A;  5KFD A;  3ET6 A;  3VHQ A;  2V8V A;  4BHQ A;  4DCO B;  2W2N P;  4CIO A;  2HMI B;  4K0K J;  2BAB A;  3FSI A;  1B70 B;  2VL1 A;  2D3O 1;  4UZB A;  3PFO A;  3SFU A;  5AE2 A;  4DFP A;  2XLK A;  1S1X A;  4BCA A;  2R8H A;  3IR7 B;  4JI4 J;  3GE9 A;  1KQF B;  4OZL A;  1KNZ A;  4QWB A;  3S7R A;  5F3Z A;  2OML A;  1X4D A;  2A6O A;  1NSA A;  1RI7 A;  2LQJ A;  1WHX A;  2N4D A;  4ZP9 A;  4ES3 A;  2VPW B;  5DQI A;  5KT4 A;  2JC0 A;  3D0I E;  1XIQ A;  4ED5 A;  5CAA A;  2IDL A;  2R8K A;  1N8R T;  1SXL A;  1XWL A;  2ALY B;  1YIT S;  2YBV A;  1OWX A;  4NCB A;  2ZWP A;  1LWX A;  2C28 A;  4CT8 A;  4Y34 A;  3HVW A;  4QIG A;  1JKH A;  1GK8 A;  1MML A;  3CMA S;  3SIP B;  3HMJ G;  2RAQ A;  1RSC A;  4OYW A;  4C8Y A;  3D67 A;  4YME A;  3NG8 A;  3NS6 A;  2GHW A;  4P2X A;  1FO1 A;  5DGA A;  4F3M A;  3GFY A;  3HFK A;  2HFU A;  2AIR B;  2ILZ A;  2R42 A;  2YNG A;  3DGV A;  2JLE A;  1IWA A;  2YPY A;  2DY1 A;  3A8E A;  4XK8 C;  4ZLJ A;  1Y11 A;  3NY0 A;  5L1K A;  1YKW A;  3RR7 A;  2EC2 A;  1TL7 A;  2V94 A;  2MY8 A;  3CF5 Q;  1C4C A;  3E51 A;  3QWP A;  1TKT A;  1FK9 B;  5HBM A;  2YWF A;  1QAJ A;  2DHA A;  3TJA A;  4LVO P;  3K5M A;  2V2Z A;  4RW7 A;  4HI1 A;  1ZS6 A;  4ED8 A;  3JTP A;  4RLE A;  3UVJ B;  1RTZ A;  1S0N A;  4PXD A;  2OTL S;  3FC9 A;  1NND A;  2QV6 A;  3C6U B;  4NMX A;  2HUR A;  4DL6 A;  2OPS A;  4WIQ A;  4CLW A;  3PR5 B;  2C3Y A;  4FVC A;  4LQ9 A;  3A1Y G;  2CJY B;  4LF2 A;  4NA1 A;  5KFM A;  2EXU A;  2XMW A;  5D77 A;  4IG0 A;  2KRB A;  2DNN A;  3TA2 A;  3ZZZ A;  2ASJ A;  1Q7Y T;  4P72 A;  1JJ4 A;  3Q8V A;  4YHH J;  2V2K A;  2IJN A;  2YQ0 A;  3MZI A;  1XR7 A;  4LF6 F;  5DZ7 A;  3T1Y J;  1TL4 A;  2ZBI A;  4W98 A;  1B0P A;  2DHX A;  4FZV A;  3TAR A;  1LWE A;  4UOG A;  4DU7 A;  2CQB A;  4Y65 A;  1U45 A;  3NP5 A;  1VIO A;  2FJA B;  3BDE A;  3CJ2 A;  1N52 B;  5DM6 Q;  3VVU A;  5ITH A;  4X4Q A;  1U1K A;  2MSS A;  3BR8 A;  1SL0 A;  4WCE Q;  4RWW A;  1VQ8 S;  2BVZ A;  1C1C A;  3U1N A;  4CM2 A;  1B7F A;  2Z4P A;  5IC6 B;  1DQ8 A;  2AU0 A;  1Q86 T;  3I96 A;  2V4Q A;  4ENO A;  4ZP7 A;  1XNQ J;  2W9C A;  1W2B R;  2ZKT A;  3MM7 B;  2VC0 A;  1E6V A;  2VJU A;  2KFZ A;  2CKW A;  4ITS A;  3CO9 A;  3DOM A;  3ZTO A;  4WE1 B;  2NYI A;  2XGQ A;  3PHE A;  4QR1 A;  1NJZ A;  1VQ4 S;  3J80 Y;  2PA3 A;  4KY3 A;  4FXD A;  1Y4Z B;  4IG3 A;  3AD7 C;  4X84 A;  2X1A A;  2ZH6 A;  3M8Z A;  1NK6 A;  2Q6C A;  1JKH B;  1YRT A;  4QPX A;  4QU7 A;  4OI2 A;  4RBV A;  3K59 A;  3IFE A;  3CJT A;  3AJ2 A;  1AZS A;  1L5U A;  4DR2 F;  1AZS B;  1OPI A;  3BGL A;  4QIF A;  4U8Y A;  4ZN1 A;  3M6V A;  2RKI B;  1T9V A;  5C42 A;  3DMJ A;  4LSL A;  1SV5 A;  1X4C A;  2I5J B;  1EX8 A;  2MDA A;  3FRZ A;  4J5O A;  5J2M B;  2I5J A;  3IXQ A;  4ECS A;  2KYX A;  1RAH B;  1PAE X;  3F0N A;  2QIF A;  4OZ2 A;  3TQE A;  1U1P A;  4QJV A;  2HHW A;  3OPK A;  1GTH A;  5KFE A;  4A8X A;  2ASY A;  3NS5 A;  4AYB D;  5FJ4 A;  1B4S A;  1PBA A;  3OD2 A;  4U6P A;  2WSF C;  3OFH A;  3H4B A;  4OJG A;  5ETR A;  3B4M A;  3GSI A;  5A0Y A;  3POT B;  5KFS A;  2WBM A;  2QL5 B;  3I0S B;  2ZNY A;  4KGZ B;  3M32 B;  1RAJ A;  3CSK A;  1SKU B;  1NZ8 A;  3FCW A;  7FD1 A;  5CZV A;  2L9W A;  2PC6 A;  3U27 A;  1VHF A;  2XO7 A;  2B7B B;  1UFK A;  3CDU A;  3FCH A;  2NR0 A;  2G1H A;  4PQU A;  3KLI B;  4CM0 A;  1VQO S;  2P6T A;  4U95 A;  2CQ0 A;  2V0N A;  2XQC A;  4GC7 A;  1CLF A;  5JMN A;  4R5P B;  5CD4 A;  4MH8 A;  4B3M F;  5K14 B;  8ATC B;  1HQU B;  4AL7 A;  4NLW A;  3MMB B;  4DN9 A;  4DQP A;  4FPR A;  4ZPV R;  2YH1 A;  2VG7 B;  4UTG A;  2BKN A;  3OXG A;  4Q43 A;  3BBF A;  4XPC A;  4KH0 B;  1LFW A;  1HWL A;  1R3N A;  4DR1 J;  4DL0 C;  1EP4 A;  3GIM A;  2GA7 A;  1HBN B;  1Q0N A;  3KFW X;  3R3T A;  4J9V A;  4E0D A;  1SC1 B;  5CD4 H;  1RXO B;  2EEY A;  3Q8Y A;  5D0R A;  1T03 A;  1D9A A;  2R2T A;  2DO0 A;  2BRL A;  4NCG B;  2I38 A;  3NGD A;  4QWA A;  1KKH A;  3Q89 A;  2ZHA A;  4LR8 A;  3P6Y C;  1BE4 A;  2RS8 A;  1AFI A;  1P9Q C;  2AHO B;  2V4R A;  5I42 B;  1RT5 B;  3PKY A;  3BDP A;  2H9Z A;  3LF0 A;  3OUY A;  4DV5 F;  3TAM B;  2W7P A;  4DL5 A;  2XZW A;  2C3M A;  3BQ0 A;  3I32 A;  4RBU A;  4XTT A;  2R8I A;  4F2S A;  2ZUA A;  2ZIT A;  5FLX U;  4DSF A;  3H90 A;  1G2E A;  1RWP B;  4DV0 F;  4KT0 C;  3DLK A;  3T1Y F;  3MM6 B;  2LEB A;  2UXD F;  2W2O P;  1MSW D;  3CD5 A;  4RU2 A;  1MG7 A;  2O67 A;  3DLL Q;  4B3R J;  3CGI A;  3DXS X;  5ETP A;  2GAH C;  4QR0 A;  1FTR A;  5KFI A;  3HZE A;  5LSL A;  5IM0 B;  2F4F A;  3HHE A;  5KT2 A;  1K0V A;  2AGQ A;  1KLN A;  1IM6 A;  3BQ1 A;  5GAH I;  5F3T A;  3M8P A;  4HDG A;  3O44 A;  2BMB A;  3CTR A;  3FQK A;  1UJ4 A;  2OIH A;  4ED3 A;  1ZM4 A;  5H9E J;  2RML A;  2C2D A;  3FBC A;  2HLU A;  2AX0 A;  2JDJ A;  2QYG A;  3O6Q A;  2D3Z A;  4USM A;  4ERD A;  2DVI A;  3CME S;  1WI8 A;  3H7H B;  1BQM A;  3HKZ D;  1ARO P;  2XBP A;  1Q82 T;  1FVQ A;  3KKF A;  1VQK S;  4CO5 A;  2AT1 B;  4F50 A;  2PO4 A;  3PW4 A;  1TVR B;  1NDC A;  2VG5 B;  3N4W A;  3TI0 A;  3CD6 S;  1HMV A;  1MMN A;  4JI6 F;  1HNV B;  4G65 A;  2ROP A;  1J2V A;  4FXV A;  3TW0 A;  1NDK A;  2DIS A;  5DGB A;  1G1X A;  3FRY A;  5ETO A;  3TJ8 A;  3ZZ0 A;  4C0H A;  3UD3 P;  4DV4 F;  5E5N A;  2DGS A;  3PKM A;  1S99 A;  2QA2 A;  1CJU A;  2AYE A;  4LRC A;  4F7V A;  2HYI B;  3KWM A;  1JLQ B;  1X9M A;  3RAQ A;  5LMN J;  3GPA A;  4M94 A;  3R8Y A;  4OFZ A;  3MAA A;  3QBC A;  1EP4 B;  1YDL A;  3G6X A;  2CNK B;  5EX3 A;  3IS9 B;  3BGO P;  3KG0 A;  2ZZT A;  3VR1 A;  2HS3 A;  2LYV A;  1IN0 A;  1SUQ A;  4HT5 A;  4DUZ F;  1W2I A;  4RU9 A;  4JI4 F;  1UCN A;  2AQ4 A;  5IT4 A;  1YJW S;  2OPR A;  2YNI B;  5KG5 A;  5C24 A;  3D0G E;  2L9N A;  3PJW A;  4DCJ B;  4FS2 A;  2NRE A;  3SDE B;  2XO6 A;  1DRZ A;  2Q66 A;  1VOM A;  3PHT A;  1U6Z A;  2KB2 A;  3W2W A;  3LAM A;  3W5Z A;  1LQ9 A;  3M7V A;  1REG X;  3LAK A;  1R0A A;  1WKJ A;  1AA1 B;  4ZN3 A;  4ZLL A;  4X64 J;  3WZ0 A;  2DCL A;  1RAE B;  1BMQ B;  4PG4 A;  3EZ5 A;  2R7R A;  1NME B;  4FXW A;  4FVM A;  1RWM B;  3TA0 A;  3NXZ A;  3QQC D;  3OLB A;  4EYI B;  2HHH F;  3D6H B;  3FMB A;  2OKQ A;  5J2N A;  2VON A;  3EGZ A;  1S57 A;  5J2N B;  3G2X A;  1PBU A;  1WG1 A;  4CP5 A;  4WKR A;  2GVD A;  1FT8 A;  3ILL A;  4YY3 J;  2GQC A;  4V19 J;  4TQS A;  1LW2 B;  5AJ3 J;  3PY8 A;  1UET A;  4OZJ A;  5EX0 A;  4C6A A;  3QJL A;  3GFH A;  2VV5 A;  3W1Y C;  2UU9 F;  1PIE A;  2RJZ A;  1DTQ A;  4HL9 A;  3KJQ B;  4F04 B;  1JLA A;  4X62 J;  2F7V A;  2ILY A;  1IKV B;  4LF7 J;  1QJH A;  1IKV A;  1QUP A;  2X3G A;  1FKP A;  1S1U A;  3AT1 B;  3HSZ A;  4F0M A;  1FRJ A;  3DXB A;  1SIZ A;  1KRP A;  3KLF B;  7FDR A;  4KAI A;  2B56 A;  2G0I A;  1LW0 A;  4KKO B;  8RUC A;  4DLG A;  2C3P A;  1N33 J;  3KNA A;  1XR6 A;  5HMX A;  1YI2 S;  2CQ4 A;  4RW4 B;  3L95 X;  2GFF A;  4ZP6 A;  2BQU A;  4DV3 J;  1H2V Z;  1TKZ B;  3ZZP A;  4WK3 A;  4ZA1 A;  2BJE A;  2DO4 A;  2LEP A;  1T05 A;  1C0U B;  1RA6 A;  2MGZ A;  2ZOM A;  1T05 B;  4AQY F;  4I67 A;  4MMO A;  5FD1 A;  1S79 A;  2DXF A;  2VF3 A;  5F8M A;  4U7C A;  4LQ3 A;  4OX8 A;  2UUB J;  3K57 A;  1FE0 A;  3PG9 A;  4KO0 A;  2VFU A;  3C15 B;  4ED4 A;  4DV1 F;  2K06 A;  3EJM A;  2M5Y A;  2QMU B;  2GIF A;  3BKT A;  3A3P B;  1ZM9 A;  2IY5 B;  4LIR A;  1HNW J;  4MYT A;  5LJ3 Y;  1NPR A;  3FEX B;  4NZ6 A;  5BR8 F;  1ZA1 B;  3QT6 A;  1FKO B;  3M2V A;  3K5N A;  4EBD A;  4IUF A;  3C19 A;  1R8P A;  4BWJ A;  2XMM A;  5D3G A;  3K5L A;  2JL9 A;  2NYH A;  3CJS A;  3M2R A;  3MEK A;  1S5Z A;  2FJD B;  4IFV B;  1Y9O A;  1HWJ A;  2KO1 A;  2CG8 A;  3UWT A;  3G96 A;  2H4W B;  1Q5V A;  3RBE A;  1M5K C;  4DV5 J;  5HAT A;  7AT1 B;  2IFX A;  5KFJ A;  3BB5 A;  2RQ4 A;  1EKS A;  4GVB B;  4L74 A;  3CJ3 A;  2U2F A;  1BHN A;  2IBO A;  2HHU A;  1NEE A;  2YH0 A;  3R6G B;  4IG0 B;  4I2P B;  2VB6 A;  4DU8 A;  4L75 A;  3V81 B;  2FVP A;  2DNP A;  4V19 X;  4G3I A;  3PDN A;  4U7U D;  1FDN A;  3TUI C;  5LOQ A;  2LQB A;  1U49 A;  3AOB A;  3QIP B;  3FCV A;  3IG1 A;  3ISN D;  4ECV A;  2JFK A;  3HHD A;  1MRO A;  3K7R A;  3RR8 A;  1B0T A;  5GME A;  4O3O A;  2HHX A;  5U47 A;  3PYF A;  1BWV A;  3G6Y A;  1XMO J;  1MN9 A;  2XWX A;  1DTT B;  3OQ2 A;  4HLB A;  4P7T A;  4TU7 A;  1WC0 A;  3US5 A;  1S6Q B;  5LXY A;  3Q22 A;  2ZWO A;  4DR1 F;  3AJ1 A;  3C66 A;  2F1F A;  4F02 A;  1AB8 A;  2HVE A;  2CVE A;  3OW2 R;  4O23 A;  1IBL J;  4DBQ A;  1S9G B;  1PSD A;  2JC1 A;  3LP2 A;  1QTN B;  2E5I A;  1DAR A;  2HIY A;  3ENA A;  2AZ3 A;  2WVD A;  2NSC A;  2ZBR A;  1HI1 A;  1Y3J A;  3CMQ A;  3RBX A;  3EGN A;  2FY1 A;  3OV7 A;  1TK8 A;  1TFY A;  3ONQ A;  3F56 A;  2R7Q A;  3GV8 B;  1WEX A;  1HWK A;  3G8T A;  2HFS A;  4J37 A;  2VOO A;  2HWI A;  2FC8 A;  2CWX A;  3MEE A;  2KVI A;  4L73 A;  1NK5 A;  4O0I A;  1BXN A;  1O6X A;  5IT9 U;  3TO8 A;  4ED2 A;  1RK8 A;  1JLF A;  1Q8K A;  3BH7 B;  4KRW A;  5ETT A;  4FNH A;  4C3L A;  4DV3 F;  5IS2 A;  4ECR A;  2D9O A;  2DNK A;  3KYL A;  2DGQ A;  1RTD B;  3W60 A;  1J5E F;  1IBM F;  3CD0 A;  2FZK B;  4P73 A;  3DFE A;  2VFS A;  1N33 F;  1RWW B;  1CJT B;  3QT7 A;  3CJ5 A;  1TL7 B;  5JVH Q;  4CNY A;  4U9R A;  4DPU A;  2VFT A;  2MYF A;  1UFL A;  3DHW C;  4PG6 A;  5KFZ A;  1IQZ A;  3BBC A;  4DR2 J;  2RDI A;  3PR4 A;  1RHR B;  4L3N A;  1WC1 A;  4OI3 A;  1KWM A;  4P10 A;  3Q8S B;  5FDL A;  1RTH A;  1YJU A;  4M5J A;  4PYA A;  1RU1 A;  4QIV A;  4RJV A;  3VTI A;  2ZM6 J;  1CPZ A;  4CTA B;  4QWC A;  2OGU A;  4TNO A;  1FNM A;  1OY8 A;  4RUH A;  1T9U A;  5J2P B;  2WSC C;  4ZPD A;  3V81 A;  2YWE A;  3AD8 C;  3DNC A;  3GSD A;  1BWE A;  2WB1 D;  2OD4 A;  3DRP B;  4OYB A;  4N47 A;  2ZZM A;  4OHY A;  2RS2 A;  2KKH A;  4Y00 A;  2ACM A;  4LFA J;  1RIS A;  4A8O A;  1MRO B;  1FJC A;  5ETL A;  1I94 F;  1EAR A;  3QGG A;  4DR6 J;  4C3K A;  1DAX A;  4KGX B;  3G71 S;  2JEF A;  3CO0 P;  4MTP A;  2ZUG A;  2XYH B;  4JBC A;  4DX8 H;  5B0F A;  3JAM U;  3HKW A;  3OXF A;  4G1P A;  1HBN A;  2YWG A;  4OI4 A;  5F8I A;  4KPY A;  1XQI A;  4LJM A;  4PXC A;  5AXK A;  1PYS B;  4ETX A;  3JYT A;  1NLK L;  4K59 A;  5I4M A;  3AOD A;  4QR2 A;  3FZB A;  3WDO A;  2XLJ A;  4DUZ J;  3QAU A;  3TP2 A;  3A12 A;  2K3I A;  2OPS B;  1SJ1 A;  5K5M A;  3H42 A;  1ZPV A;  3N6L A;  5BXI A;  2ABY A;  1OSD A;  2J0W A;  4OYP A;  2YXL A;  3CDW A;  4DUT A;  2E66 A;  1LKZ A;  4I0W A;  3MR6 A;  1M1H A;  1N32 J;  4GKK J;  4ZVH A;  4DCP B;  4A8W A;  1RTI B;  2GJI A;  3IWX A;  5IC4 B;  2DNZ A;  3MMA B;  3OTB A;  1FFS B;  4G1Q B;  1X4B A;  4TY8 B;  5HI7 A;  3E01 B;  1EHW A;  4ZVE A;  1H73 A;  2CPH A;  1FI4 A;  4RNH A;  3J7Y U;  1R8B A;  1GEH A;  5C25 B;  3QRR A;  1TAQ A;  2V6A A;  2XYP B;  5HK4 A;  4AT1 B;  5D4O A;  3ZNU A;  2FHK A;  2XMT A;  4NLX A;  1RU2 A;  4LFB J;  1PIL A;  1N5Y A;  3IGN A;  1D9D A;  4LFB F;  5D8H B;  2IVF B;  3LWM A;  1T0T V;  5KT3 A;  4Q5V A;  1M5H A;  2GO9 A;  2QTW A;  3VVT A;  3GYG A;  3TZX A;  3KJV B;  3UR3 C;  2BR0 A;  2J5A A;  5FDL B;  3SQG B;  4UY8 T;  1FEH A;  1J5O B;  4RUC A;  3QPI A;  3DLH A;  3N9U C;  1X9W A;  2GW8 A;  4DQS A;  2OSQ A;  4QW8 A;  2W24 A;  4NLV A;  2LEC A;  2MMY A;  4DX6 A;  3KK1 B;  1NSQ A;  2Z2Y B;  1D0E A;  1AT1 B;  1Q53 A;  2MZJ A;  4C2M A;  4MYU A;  5ETS A;  2J76 E;  1LW0 B;  3C16 B;  3PNI A;  4HAC A;  5DO2 A;  3DLK B;  2AEJ A;  2LXU A;  1TUV A;  1QAY A;  1U0H B;  2BE9 B;  3KXD A;  3C2P A;  2CRL A;  2FUG 9;  5CAB A;  2Y0B B;  1PYT A;  4DV0 J;  2PEB A;  4CYU A;  4ECT A;  2YNF B;  1RKJ A;  1IR1 A;  4WP9 A;  4O3Q A;  3P49 B;  3NRB A;  1VQ7 S;  2EFQ A;  3MF5 A;  2VIH A;  4TU9 A;  3FUY A;  3L4B C;  3A8I A;  4X66 J;  4K4V A;  3DI6 B;  2DBB A;  4OHV A;  4CO1 A;  4RNF A;  3VAJ A;  3QRQ A;  4I2Q B;  1RB0 A;  3DYA B;  1VLY A;  3MED B;  2PSZ A;  3R27 A;  4JI2 F;  2B8Q A;  2HNZ A;  1U8S A;  4USU A;  3ZC4 A;  4F0K A;  3Q83 A;  2HNZ B;  3H59 A;  5J1N A;  5E3R A;  3G87 A;  1MWQ A;  3LPY A;  5LJ5 Y;  4ZJO A;  2R2R A;  3AAW B;  3OFE A;  2VQF F;  4NXM J;  2IC3 A;  2GC8 A;  3OR2 A;  1HBO B;  4LIW A;  1UEU A;  2HIQ A;  2HND B;  2QG9 B;  4M5G A;  5IFM A;  5I3U B;  4DSE A;  4K2X A;  2CQ3 A;  3M2R B;  2MQO A;  4JI8 J;  4EO8 A;  4Q2L A;  2IJR A;  2VH7 A;  4WFY A;  1B7Y B;  2GS8 A;  4O3S A;  1F5C A;  2ZM6 F;  3MR2 A;  2WB4 A;  4S0M A;  4ZS6 A;  1NM2 A;  2CJQ A;  1R0A B;  4GVB A;  4PXE A;  1OJ4 A;  3CDE A;  4FPI A;  2EKN A;  4EBC A;  5KG4 A;  5B0C A;  3QFW A;  4ZVT B;  1IUJ A;  2FVQ A;  1UFW A;  1VRT A;  2BA9 A;  1K0T A;  4J90 A;  2B6A B;  2E5L J;  2R7S A;  3I5C A;  1Y3K A;  4NLG A;  1WKK A;  2YNG B;  4F4Y A;  1XNR F;  2XWY A;  2N7C A;  3K58 A;  3RB3 A;  2PI5 A;  2N7Y A;  2QLF B;  3KJN B;  2DPI A;  2NPF A;  4Q7A A;  3RYL A;  3QSY B;  3IWN C;  1REV B;  3T9N A;  2ASD A;  2EG2 A;  3TQ1 A;  4C8Z A;  5H9F K;  1UWB B;  3WQP A;  2F5G A;  3ISZ A;  4DZ6 A;  1LWC B;  4CI0 B;  3NAH A;  2ROE A;  2MZ1 A;  4RW7 B;  4C11 B;  2VBY A;  1TFW A;  3DRS B;  3RJM B;  1DLO A;  1MNE A;  2ATC B;  5EWE A;  3V4I B;  1TKX A;  1NBE B;  4DOZ A;  4C8K A;  1HNV A;  3FBB A;  5HAO A;  4Y28 C;  2ATL A;  2BJ8 A;  2NXE A;  1UAW A;  4IYQ A;  3MEC B;  4K4Y A;  4K4S A;  3KLH B;  1DFD A;  1RE1 B;  4RW4 A;  5KOX A;  5KFN A;  2YX4 A;  1ZZN A;  5IWA F;  1TL1 B;  4V1A k;  3Q8Q B;  3UCU P;  2QZ8 A;  4CO4 A;  3UNY A;  2IRU A;  4H4M A;  3OTO F;  1IBL F;  1DJ0 A;  1T9W A;  2UVV A;  4Q8F A;  2X7I A;  4LF4 J;  1QVF R;  2C2Z B;  5ETM A;  5GVQ A;  5FLX Y;  2SXL A;  2FLP A;  1RCX B;  1IWG A;  3IO1 A;  3C8Y A;  2CVI A;  2DCU B;  1HA1 A;  2HMI A;  3W2V B;  3BPS P;  3ET6 B;  1NJX A;  2EFV A;  1F0X A;  2IM1 A;  1Q8B A;  2CQG A;  3KDN A;  1R6V A;  2QFJ A;  1ZTT A;  3THT A;  1S0O A;  1S1U B;  2KZM A;  3HHL D;  1RT4 B;  4I68 A;  1HD1 A;  1VBK A;  2EBG A;  2GIQ A;  2MLZ A;  2R3V A;  2YKN A;  2W9C B;  3MPV A;  3H98 A;  4KKO A;  2E9R X;  4DR4 J;  2F4V F;  2MQM A;  2PE8 A;  2CJK A;  1RWK B;  2R7T A;  1SJ4 P;  3HJF A;  3N6M A;  3M2U B;  3R1L A;  2W7A A;  2LLZ A;  4PPZ A;  3CCS S;  4KTQ A;  1AXQ A;  1F3F A;  2QL9 B;  4F0H A;  4CH7 A;  3KLV A;  3J7A N;  3QAT A;  4TN2 A;  3UDC A;  1QAI A;  2XZT B;  4UZC A;  1HI0 P;  2HGM A;  1VCT A;  4ID8 A;  1EQ0 A;  4N5S A;  3TEG A;  2DEI A;  3C46 A;  3H0P A;  4OMF G;  4TY9 A;  3CIZ A;  3J7Y I;  2UUA J;  3QLH B;  4LF1 A;  1OMS A;  1C1B B;  2WRM A;  3JXO A;  3LGH A;  2P9G A;  2CQI A;  3V5R A;  4ZCM A;  4RUA A;  2RRA A;  4DR7 F;  2UUB F;  2AYB A;  1P9Y A;  1SQF A;  1H7W A;  1S4E A;  2DGO A;  2F8H A;  2VKZ G;  5EGY A;  2V2Q A;  2MZS A;  4ZKA A;  1MMD A;  2KXF A;  2BW2 A;  3LA0 A;  5DLG A;  4JB8 B;  2W8K A;  5D3G B;  3AFG A;  3A8J A;  3VAF A;  1PJ7 A;  2Q6B A;  2P9E A;  2C42 A;  4OV1 A;  3CB4 A;  4X65 J;  2DGU A;  2ZHB A;  1GX5 A;  2HNY B;  3UPF A;  4X4R A;  3M9M B;  4UOH A;  2MKI A;  2D41 A;  4JI3 F;  5JXS A;  3HX9 A;  2IAJ B;  1V5V A;  2W25 A;  3CNQ P;  1NXI A;  3V4M A;  2KG0 A;  1I1G A;  2L3M A;  3MEC A;  1KN6 A;  4IH7 A;  1S6O A;  5H1S V;  3HSD A;  1TV6 B;  1H2T Z;  1WF2 A;  4NEY A;  5B7W A;  3TZY A;  5EN1 A;  2C3U A;  4MK8 A;  5BYQ A;  3I6P A;  2E9Z A;  2IM2 A;  3D4J A;  4IRD A;  3PJX A;  4K8R A;  1KHW A;  3L9Z A;  4K7Q A;  2LDI A;  4M63 A;  3M8Q B;  4O4G A;  4WU3 A;  4ID5 B;  2RHS B;  4F4X A;  4P6Q A;  4DG1 A;  1X4F A;  4EYH B;  4E8U A;  1A6L A;  1N6Q B;  1LW2 A;  3Q86 A;  4CT9 A;  2AZ1 A;  4C48 A;  2FGO A;  1PGZ A;  3RB0 A;  1CS4 B;  5MLC V;  1RAC B;  3FKB A;  2XNQ A;  1HPZ B;  1WUU A;  3NBP A;  4NLU A;  5AJ3 F;  4PG8 A;  2F4V J;  4PR6 A;  1N36 J;  5AXL A;  5LM7 E;  1D09 B;  2NXC A;  2AEF A;  1IKW A;  1C1C B;  2FQQ B;  3OL6 A;  1VFJ A;  2I2Y A;  4OI0 A;  4KGM A;  1N5T A;  4M5M A;  1VQM S;  2IYG A;  3VAH A;  3CC2 S;  1N5S A;  4N77 A;  4WE1 A;  4IFY A;  3SV4 A;  2K8G A;  4XO0 A;  5A8K A;  2XHC A;  2XMA A;  3OVA A;  3IA0 A;  4USV A;  3LUY A;  3PYG A;  4KE5 A;  4CLT A;  3BYP A;  3OL7 A;  2W9B B;  1JWW A;  3QNW B;  2E1P A;  2IVM A;  2VDI A;  2Y0S D;  5HO4 A;  3D1H A;  5IOL A;  3PRV A;  4GKJ F;  1CQN A;  2GJF A;  1JLC A;  2FZC B;  3CCR S;  3OLA A;  3GG1 A;  3BQ2 A;  1NB7 A;  4MFB B;  2QA1 A;  1LWF B;  1YJN S;  1KTV A;  2ZDO A;  2AW0 A;  2BM0 A;  2N82 B;  4C4W A;  4DFJ A;  1B0V A;  1NH8 A;  3GTY X;  2LQ5 A;  3QLH A;  4CH0 S;  5J2Q B;  3WC2 A;  5A8W A;  5HP1 B;  4IR1 A;  2YKM B;  2K1R A;  3CDB A;  5A8W B;  2Z56 B;  5HP1 A;  4F4W A;  1IJE B;  2RF2 B;  3QO9 B;  5LMN F;  2NSB A;  2RQK A;  3D7S B;  3HD1 A;  3D2W A;  3BSN A;  2HGL A;  3SCL E;  2MHN A;  3CCV S;  2OD6 A;  4HH0 A;  3ZZY A;  2B4P A;  2RIJ A;  3W9H A;  1N88 A;  2FZG B;  1Q5Y A;  4C0B A;  3DLG B;  4P9S A;  2IA6 A;  4ZVP B;  2J0X A;  4JYA F;  5HJY A;  3H2V E;  4PZV A;  4ECX A;  2DNL A;  3MCO A;  2MPU A;  2XMV A;  4QZV B;  4KC5 A;  4ELT A;  2IMW P;  2NXJ A;  9RUB A;  4DL4 A;  1CG2 A;  1Y10 A;  2ZJP Q;  4JI5 F;  1Q1K A;  4IOB A;  3DRP A;  4DFM A;  1NK7 A;  3G6V A;  1RZM A;  4P7V A;  1HNZ F;  2CG4 A;  3VZI A;  5HL7 Q;  1RT3 A;  3UO0 A;  1NH7 A;  2MKS A;  1QLN A;  4LF9 F;  3ZO7 A;  1HQU A;  3CCE S;  4ZPW R;  3IRX A;  1JX4 A;  1DZ5 A;  1VQY A;  3EVO A;  3K89 A;  4O44 A;  4USI A;  4JOU A;  4FYD A;  1H6K X;  1T95 A;  3DLB A;  3B54 A;  1RQ0 A;  3WHI A;  1NHV A;  4RL1 A;  1JLB B;  1GH8 A;  1G6B A;  2DHH A;  4ALZ A;  1HHQ A;  2FLL A;  1S9E B;  2W8L A;  3BF4 A;  2J7U A;  1Q4R A;  2VAS A;  3M6W A;  2VQE J;  2EK1 A;  4AND A;  1TUG B;  2XUL A;  3ZZO A;  1PCA A;  2VQF J;  2GQQ A;  3MM8 A;  3ICL A;  2C3O A;  1LWC A;  4ZVQ B;  4F4K A;  3MR3 A;  2NPI A;  1DQA A;  1JJC B;  2OAU A;  5I42 A;  5CYQ A;  3VWS A;  3L7O A;  4N7T A;  3FMW A;  3VCD A;  1NU4 A;  2CJA A;  3MPY A;  1FEE A;  4NXN J;  1KOH A;  2R7V A;  2WK4 A;  5J2P A;  3L7P A;  1UPP A;  1QE1 A;  1TL3 B;  2ZD1 A;  3MTJ A;  4TU8 A;  2VOP A;  4ICL A;  4K2J A;  4P52 A;  1VQL S;  5D15 A;  1I5O B;  2FGC A;  4U8V A;  2M7S A;  4GO5 X;  3D3C J;  4YB1 P;  5IM0 A;  3CW2 C;  3MTK A;  3TA1 A;  5KT7 A;  2DGV A;  4DQI A;  3LQV A;  4HI2 A;  3U02 A;  3EPI A;  3I0R A;  4CLL A;  1OY6 A;  4MKB A;  4UOC A;  3DGP B;  1S7H A;  2ZH2 A;  2RVJ A;  2DEJ A;  3EXC X;  1RUS A;  3VAI A;  1ZPW X;  3C14 B;  4D3H A;  4Z7C A;  1BD6 A;  1F3V A;  1Q7L B;  1VIX A;  2Q1L A;  4DQQ A;  1V6H A;  3FSX A;  2CPY A;  4B3M J;  1HYS A;  2AJ4 A;  1YGY A;  1HNZ J;  2QLB B;  3DOL A;  5F8N A;  3QJP A;  2OFH X;  3RAM A;  4JI5 J;  4JI7 J;  2QL7 B;  3MFI A;  1KR4 A;  4PXB A;  3V6D A;  1CBK A;  3D54 A;  4FYV B;  1DBD A;  3NCP A;  2HLT A;  3AXM A;  8AT1 B;  3NGU A;  4EBE A;  2FY8 A;  3KLI A;  1W25 A;  5B0E A;  4JI1 J;  1RTI A;  5IT9 Y;  3EDQ B;  2LQ8 A;  2HZA A;  1VRQ C;  2QRR A;  2VBW A;  3CT9 A;  4RUB A;  2HVZ A;  4AXJ A;  4BLG A;  1CJK B;  3Q8U A;  4DPX A;  4LF9 J;  3CC4 S;  2ASL A;  1U6F A;  1YVF A;  3AOA A;  3IGV A;  2IRX A;  1T02 A;  2WON A;  1KFD A;  3MCM A;  2GV1 A;  4IR9 A;  3GG0 A;  4GKK F;  2RHQ B;  1N0V C;  1SL1 A;  1ELO A;  1SJQ A;  3IS9 A;  5HJX A;  1NSK L;  3WBZ A;  3MAA B;  4Y0F A;  1A9N B;  1F1B B;  2BJ3 A;  2CQC A;  2FVR A;  3T5H A;  4R0J A;  1UPM B;  3JTO A;  2E9T A;  1CC7 A;  3CJK A;  2UU9 J;  4QYZ J;  2GNK A;  4X4P A;  1GMW A;  4OL8 A;  2WVC A;  1UJ6 A;  3OJU A;  2D3O R;  2R7X A;  3J7Z 5;  1R89 A;  1FF2 A;  2IVY A;  2W4D A;  4QQB A;  3F41 A;  5CCM A;  3CCW A;  2C2K B;  2AX1 A;  1NCL A;  4CDI A;  1M5S A;  2Z2L A;  1T9T A;  3AJD A;  4B9V A;  2D7S A;  2ZD1 B;  4XDC A;  2P2C B;  3ZZR A;  3W9J A;  2PII A;  5GAH U;  2PEH A;  3HK2 A;  3R7S B;  2MQN A;  4LRA A;  1FXL A;  1UA0 A;  4IRC A;  2GX8 A;  3E3X A;  2F63 A;  3EMT A;  4NAS A;  3ZTP A;  3KHG A;  1ZYQ A;  1I6J A;  1AUD A;  1XNQ F;  3H8Y A;  4LUB A;  4EEY A;  1U1N A;  4H4K A;  2YNF A;  2L48 A;  3NOG A;  4BC9 A;  5KFK A;  4WFB Q;  4YQW A;  3TVZ A;  3SCI E;  5LSO A;  2IHR 1;  4J9N A;  2BDP A;  1N6Q A;  5KFL A;  1PG5 B;  3KOA A;  1WSV A;  3IBC B;  4WJB A;  4CLF A;  1ZBT A;  1D8Y A;  4OJ3 A;  2HHP A;  5GAE U;  2KM8 C;  3EPG A;  2CQ1 A;  1X7V A;  4DV7 J;  4ZVU B;  4UY8 5;  3FSY A;  3GIR A;  2UV8 G;  1S6U A;  4FF2 A;  2FDN A;  4NOH A;  2BXJ A;  3AXK A;  6AT1 B;  1FKP B;  1S1X B;  2V8G A;  2OMO A;  3IR5 B;  3RB6 A;  5F8H A;  3ENQ A;  5DRK A;  3UDL A;  4EO6 A;  5KFP A;  2L41 A;  1CQM A;  1MWY A;  3PYD A;  1RGV A;  3F73 A;  5LSR A;  3V4I A;  1TVR A;  5CA5 A;  2LXF A;  5HVG A;  4UOF A;  1PKU A;  3VAK A;  4ED0 A;  1RCO B;  1T3O A;  2FJE B;  1M1K T;  3TRG A;  2QMW A;  3MD3 A;  5KFW A;  1WKL A;  1IJF B;  3SSQ A;  3MOJ B;  2V68 A;  3OR1 A;  2JFD A;  4ILL A;  3HFV A;  2G2Y A;  4C8O A;  3TVK A;  1WF1 A;  2KI2 A;  3FQL A;  3GP9 A;  2WON B;  1IQT A;  2X1G A;  1TL5 A;  2CNN B;  1XK8 A;  2DGX A;  2XLI A;  2HK2 A;  4J9O A;  1LOU A;  1SKW A;  3IBW A;  3IAS 9;  4WK1 A;  4TVA B;  3W62 A;  1RAA B;  4QWE A;  1RHJ B;  2B9X A;  4ER8 A;  3M1V A;  4B02 A;  2JEJ A;  3GJR B;  2FHJ D;  1CUL A;  1EJ7 L;  4HTJ A;  4TQR A;  2APO A;  2ZNZ A;  2FVC A;  2OPR B;  1X5O A;  1G3O A;  2ZH3 A;  5C24 B;  1UVK A;  5KG7 A;  1YJT A;  2HPU A;  2VBX A;  3HVR A;  5DG8 A;  2HZC A;  4X4S A;  1P1T A;  3W2W B;  2O01 C;  5JUM A;  4IFV A;  2DR7 A;  3Q2T C;  3NNH A;  1TAU A;  1CEZ A;  1HQE A;  2D74 B;  2Z30 B;  3CJ0 A;  4DV6 F;  2UXC F;  1RWX B;  2CUY A;  2RSQ A;  3BS9 A;  3VGT A;  5HQL A;  2G4B A;  4Y2M A;  4NZ7 A;  4KR0 B;  1N4L A;  5KTQ A;  2Y1I A;  1SB6 A;  2B9Y A;  1R8H A;  2I9S A;  1PC4 A;  2KVQ E;  2CZV C;  3EUN A;  5G4D A;  1K44 A;  4YDX A;  1RAO A;  5E41 A;  4ED6 A;  4B3S J;  3QIP A;  4J7C A;  3AH6 A;  3AHP A;  2ZE2 B;  3DRR A;  2BOA A;  3I4H X;  1RHQ B;  2VG7 A;  4JV2 A;  1M5P C;  1FVS A;  1RT6 A;  2MKJ A;  2ROG A;  2JLG A;  1HNI B;  4WXW A;  3UE2 A;  3PW5 A;  2FYX A;  3CE8 A;  5H9E K;  1NSP A;  2DK2 A;  2EFP A;  2C1E B;  2Z57 B;  3GJQ B;  4LF4 F;  5H9F J;  4KQZ A;  4DR3 F;  4IO1 A;  2ACY A;  1NUE A;  3QFH A;  4YN3 B;  5AE3 A;  3PYE A;  4DUY J;  2CNL B;  3B8H A;  4Q2M A;  2Z0G A;  5C2C A;  3VAG A;  1S9G A;  3LP2 B;  1HNW F;  3HO1 A;  1WHV A;  3BR9 A;  1HBU A;  1OIA A;  3IBF B;  2CPI A;  3DU6 A;  4FYW B;  1HW8 A;  2FIU A;  2MTL A;  4GMK A;  4ZVR B;  5KFV A;  3I56 S;  4DV1 J;  4PPD A;  2EFO A;  1IR0 A;  3W3S A;  1Y5I B;  4GVL A;  2PMZ D;  2XMJ A;  3ZTQ A;  3C3L A;  3H5X A;  4AQY J;  3AOC A;  3AQO A;  3HHL C;  3M9O B;  1WDD A;  1Q8L A;  1E6Y A;  5KFU A;  4DG1 B;  2NCK L;  5GAG U;  5KFB A;  3MM6 A;  5KFX A;  1HWU A;  2RB7 A;  5HRO A;  1NZA A;  3W5Y A;  4ZIW A;  4ES2 A;  5IQ6 A;  4ZHR B;  3B78 A;  3ETM A;  3LP0 A;  5C42 B;  2FC9 A;  1GX6 A;  1U8W A;  4ZHR A;  3T5K A;  3BN7 A;  4A46 A;  4OIX A;  3R5D A;  2JH3 A;  4L6V 3;  4WTY A;  2F8M A;  2A18 A;  3FNN A;  2BBE A;  4NLY A;  5E3A A;  2ZVS A;  1S59 A;  3N0V A;  5ETN A;  5HVH A;  2MXY A;  4ZIV A;  4PRF A;  2N3O A;  2C2O B;  1PAU B;  4CLU A;  3S01 A;  3NGS A;  4RBT A;  2HW3 A;  1XC9 A;  3U1M A;  3H2L A;  1V3R A;  1W26 A;  3VGV A;  4X62 F;  4CCH A;  4A8F A;  1UVL A;  4LRE A;  2XY7 A;  5AE1 A;  2KU7 A;  4Y3C A;  1X9S A;  1P27 B;  5KG3 A;  2YX1 A;  9ATC B;  5M2P A;  4ZJL A;  3MUM P;  3TX8 A;  1X60 A;  1TK5 A;  1LNQ A;  1JLG A;  3TWZ A;  1GFW B;  1U2C A;  1XJW B;  1EKR A;  4YY3 F;  3KMQ A;  2WTF A;  2KT5 A;  2C2E A;  3MM9 A;  2V34 A;  2LFV A;  4XAK A;  2BE7 D;  2HAF A;  2A2C A;  2HFV A;  4NWB A;  2DD8 S;  3SEO A;  3DOK A;  1YIJ S;  5K14 A;  2D9P A;  1WC3 A;  2H54 B;  4EK2 A;  5DDQ C;  3CCZ A;  1SV5 B;  4N8O A;  3LGN A;  3AY0 A;  4DR3 J;  1ITP A;  3NWR A;  3CJR A;  2JSX A;  2UVW A;  2WBR A;  3CUN A;  2PT0 A;  2V4J A;  4ZLN A;  3U7J A;  4LSN A;  5HVF A;  2BAN B;  2LP4 A;  2FPH X;  4I2Q A;  2FJV A;  2RQM A;  3FFI A;  2AYM A;  2M2B A;  1QTM A;  2DB1 A;  2HQF A;  4B3S F;  3GV7 B;  4QCL A;  4FNI A;  1U7L A;  4UUX A;  3GFX A;  3RRG A;  1U1O A;  5C2G A;  1O5J A;  4I7F A;  4DV2 J;  3VZH A;  2IJF A;  1P1L A;  4MKA A;  4ECQ A;  4I7F B;  1J27 A;  4O3N A;  4PWU A;  1U1Q A;  2IAJ A;  5KG0 A;  1N36 F;  4F2R A;  1VJQ A;  4X4O A;  4YR2 A;  3TAQ A;  5EWF A;  4A47 A;  4OLO A;  2VA3 A;  1UW4 A;  1A7G E;  2M9K A;  1QM9 A;  3W64 A;  3S1T A;  4CO2 A;  4AL5 A;  2Z58 B;  3Q24 A;  1C0T B;  3RU0 A;  4H4K C;  4OX9 J;  4Q0B B;  1NDP A;  4KHR A;  4C8L A;  5AT1 B;  3E01 A;  2UP1 A;  3CPW R;  4DR5 J;  2DNO A;  3A4T A;  1HNX F;  1SVD A;  2B9E A;  3W8P A;  3M8W A;  2ZH8 A;  1B99 A;  3ADA C;  1QSS A;  1FNO A;  1R8A A;  3A3N B;  5BYR A;  1WOP A;  5A8R A;  4JI0 J;  1SJF A;  3PEH A;  4Q45 A;  3HLU A;  2GJ2 A;  1U2F A;  1G4C A;  1GAO A;  3NL0 A;  3P5T L;  2HS4 A;  2NLW A;  2DPJ A;  2J6T A;  1S9E A;  2YNH B;  4OJH A;  5A6W A;  3UI3 A;  1F5A A;  4X65 F;  3M9N B;  4AD6 A;  1JQG A;  2M70 A;  4EMD A;  3MM8 B;  1JLA B;  1J5O A;  3OL9 A;  2LQ9 A;  2HEK A;  3N79 A;  1RWO B;  4F4Z A;  2UXB F;  1U09 A;  1Z2L A;  1EIY B;  4HKQ A;  2W01 A;  2QSF A;  4KPC A;  4MIW A;  3G9C A;  2Y8W A;  4QU6 A;  1NHK L;  4WII A;  4ZLP A;  3OTC A;  2I8E A;  1TQL A;  2AEM A;  2RH3 A;  4ZVF A;  5K8M A;  2FVS A;  2UUA F;  2HVI A;  4A8Y A;  4WYL A;  3J81 U;  4B3T J;  4DSJ A;  4B3R F;  1NO8 A;  1SH0 A;  2E7X A;  2H5I B;  3A13 A;  4R8U A;  1K73 T;  4ZCL A;  2ZH7 A;  4B9S A;  2UXD J;  4R8U B;  1CJK A;  1MW7 A;  5LT5 A;  2AJF E;  4DQR A;  3EM1 A;  1LXN A;  5J2Q A;  3CED A;  3LTO A;  3KHH A;  1YBA A;  4J9P A;  4AXI A;  3ENW A;  2HWH A;  4DV7 F;  3B6B A;  1VLO A;  2KYZ A;  3R2C J;  4HTI A;  3DLJ A;  1I51 B;  2RF2 A;  3QO9 A;  4E2F B;  2QLX A;  3LO3 A;  3O3L A;  4NLS A;  5THW A;  1FDA A;  5DDP C;  4P2S A;  1RHK B;  2NZC A;  4KSE B;  1KD1 T;  1B64 A;  2QEX S;  2IMO A;  1SUQ B;  4LFA F;  4LVN P;  1WF0 A;  3D68 A;  2LA6 A;  5D78 A;  2UUC F;  2IC3 B;  4NA2 A;  4J9L A;  4J9K A;  3RW7 A;  2DNG A;  3TJ9 A;  3GZ7 A;  3S6E A;  3BSC A;  2DH8 A;  2B0G A;  3D5M A;  3D28 A;  3GCW P;  3SDE A;  3BO3 A;  4UST A;  2XGP A;  4ED7 A;  4UUW A;  1NKE A;  1HQ2 A;  2MLY A;  1H98 A;  2G2O A;  2RD5 C;  4NLO A;  4NPO A;  1FER A;  4C3M A;  4PWD B;  1VBY A;  1F60 B;  4QOT A;  1WI6 A;  5EUH A;  4PWD A;  2OEL A;  3AB4 B;  4OQJ A;  4Z2X A;  1FWK A;  2B4U A;  4CWB A;  2UVU A;  4WF9 Q;  2CYY A;  3MOZ A;  2BJ1 A;  5CHC B;  3OT9 A;  1BLU A;  2LDY A;  1XTZ A;  4M5D A;  1VK3 A;  4RW6 A;  4M5D B;  2AMC B;  1JLQ A;  3ISN C;  3SV3 A;  4U67 Q;  2V2V A;  2X1B A;  1NK0 A;  3HP6 A;  2WW4 A;  3MDF A;  1UW9 A;  2PMH A;  1S7I A;  4RO0 A;  2CPD A;  2DY9 A;  3M8P B;  5KG6 A;  2E44 A;  2OEK A;  1VQ6 S;  1YZ6 A;  3KTQ A;  1AYE A;  2HZV A;  2BV3 A;  3HVA A;  4J91 A;  5B0B A;  1V3Z A;  4DPW A;  2BRK A;  4XIU A;  3KJV A;  3D6T B;  1KON A;  3EDR B;  2QT7 A;  3ILO A;  1WC6 A;  4NEZ A;  4OYZ A;  2XSF A;  1S49 A;  2H3E B;  4C11 A;  5L1I A;  4L72 B;  3R9L A;  2DJW A;  3TOQ A;  1SL2 A;  2XG8 A;  3FJ2 A;  1R0B G;  3FK4 A;  1RT1 A;  2KXH A;  4ETZ A;  3S8S A;  1HBU B;  2JZ5 A;  1JNZ B;  2CJX B;  2HAI A;  1Y0H A;  2EKY A;  2E1R A;  2ZKU A;  5J1E A;  4P71 A;  1VIS A;  2JNJ A;  3TVY A;  1GXL A;  1R31 A;  5EDW A;  2ADB A;  1KQS R;  1TKD A;  4C8N A;  1WHW A;  1KQK A;  5K8O A;  2W2P P;  1RTJ A;  1WC5 A;  3IAM 9;  5CYM A;  5HSP A;  1WG4 A;  4Y2A A;  3B4D A;  3MPU B;  4NI2 B;  3TYT A;  4ES1 A;  3KK3 B;  3OFF A;  4HHJ A;  2PA8 D;  2K7K A;  4A8S A;  3C15 A;  3AD9 C;  3M1V B;  3D1Q A;  1OY9 A;  3FGV A;  1UVI A;  1U47 A;  1PJ6 A;  2X51 A;  2YTC A;  4DV6 J;  4NLT A;  4Y2C A;  3R7N B;  2LMI A;  4ZPA A;  2V67 A;  3HI9 A;  3TX0 A;  1GXU A;  4WPA A;  2UUC J;  1HBO A;  3I5B A;  2OI2 A;  5A76 A;  5I3U A;  2WSE C;  4YR0 A;  3OVB A;  1QDU B;  3MM7 A;  3JB9 k;  5CXT A;  3R2D J;  4B9U A;  3E8O A;  5L8R C;  4BWM A;  5K8N A;  4JI2 J;  4ILR A;  4YR3 A;  4X64 F;  4B3T F;  3C6U A;  3LAL A;  1RT7 A;  3DDN A;  3WIV A;  4PQA A;  3EX7 B;  1RAF B;  4EGL A;  3I82 A;  1VDH A;  4QWD A;  2NXU A;  4LR7 A;  3EYZ A;  3FVY A;  3C6T B;  5T7L A;  1K1Q A;  4O0N A;  4RW8 A;  4BC7 A;  5ADZ A;  4LF6 J;  4QYZ K;  4NRT A;  4CLK A;  2GCF A;  2F8E X;  2LVW A;  4DZD A;  4F3Q A;  5I3Q A;  1WDT A;  2L9D A;  3MAH A;  4K5S A;  5D0E A;  4KO0 B;  5GAD I;  5G0R B;  4LMZ A;  3ETO A;  3GIL A;  4A8Q A;  1VQN S;  4KV8 A;  2E1M C;  4WKY A;  3CCU S;  2H48 B;  1N34 F;  4KV8 B;  1RBL A;  2GAG C;  5F0W A;  1CC8 A;  3MPW A;  3JAM Y;  1FRI A;  5KG2 A;  2J7W A;  3GMG A;  2DNY A;  2PGC A;  3PM9 A;  4DL2 A;  5CZX A;  1VRU A;  2NUU G;  3QJJ A;  3IWL A;  3P8B B;  1H2U X;  2AJ2 A;  3QWU A;  1VBZ A;  4YP3 A;  4NLD A;  4C8M A;  2A3J A;  4J9R A;  3FEY B;  3Q0A A;  5SUH A;  2XSJ B;  4M1K A;  2F9J A;  1QSY A;  1RA7 A;  3PW7 A;  2MLX A;  3SFG A;  5F8G A;  1HL6 A;  4DJB A;  3HUL A;  4GO7 X;  1HAR A;  3KLH A;  4WFZ A;  5DG9 A;  3KNG A;  4IG3 B;  3Q8R B;  4H4M B;  3FZ2 A;  4O4G B;  5K8P A;  2R4F A;  1YHQ S;  1ZM3 A;  4DR5 F;  2HVD A;  1RT3 B;  3RAX A;  1CVJ A;  3KHL A;  1RAG B;  2EBE A;  4WU2 A;  5DJB A;  2PFD A;  1H3D A;  5C25 A;  1YBU A;  3HZG A;  1BGX T;  1SC6 A;  3FBF A;  2VPZ B;  1CS4 A;  3D66 A;  3D1O A;  5MAO A;  1S77 D;  2G0C A;  1QAX A;  1CUL B;  2W4P A;  4DS4 A;  2G2Z A;  1FE4 A;  2HBZ B;  2AJ1 A;  3AQP A;  4I64 A;  5DG7 A;  1PO6 A;  1NKB A;  2J0S D;  1NPP A;  2A1B A;  2CXE A;  3OFG A;  4AE5 A;  1T03 B;  1CJV B;  4PAB A;  3ZNJ 1;  4OZ3 A;  4U7U K;  1R6Y A;  2DGW A;  3ZFV A;  2Y3Y A;  1BY9 A;  1E6V B;  2H4Y B;  3HSJ A;  4ZCK A;  1YSJ A;  5AXM A;  5DLF A;  1YBT A;  4CTA A;  2CQD A;  3I4P A;  2OP5 A;  2P5V A;  3K8V A;  4M8L A;  2JJ4 D;  3T1A A;  1S97 A;  4O3R A;  1R43 A;  2DR8 A;  4OYI A;  5B0D A;  2RDJ A;  1Q95 G;  1D3W A;  3V6J A;  4OZ1 A;  1Z4U A;  2DNM A;  1M1G A;  1LFP A;  3BEG B;  5GMD A;  3HD2 A;  1GXT A;  5IV4 A;  1G7C B;  5SZT A;  3QZ8 A;  1NK8 A;  3J80 U;  2LCW A;  3MMB A;  4YEA A;  2IIH A;  1C1B A;  1U02 A;  5EHH A;  4FYX B;  5KFT A;  1X4A A;  4PWW A;  3DLE B;  3NEK A;  1DTT A;  3N5F A;  4I4B A;  1UL3 A;  3UD4 P;  2R8J A;  1IKX A;  1KFS A;  3HCX A;  5KFY A;  1YJV A;  1TKT B;  3AA8 A;  5HBM B;  3T3F A;  2VOD A;  1WG5 A;  1H38 A;  1JB0 C;  2W2M P;  3OSN A;  2UZA A;  4DV4 J;  2E1C A;  2OPQ A;  3W5X A;  1P8G A;  1IR2 A;  4IDK A;  5KT6 A;  2PN6 A;  2RRN A;  2MST A;  3I0S A;  4K5R A;  5C5J A;  2XSJ A;  4WP8 A;  3RRH A;  2FLO A;  1QSL A;  3UN3 A;  1HR0 J;  1FXD A;  1HHS A;  1KTQ A;  1RHM B;  3VAL A;  2UXC J;  2UV8 A;  5KFF A;  3J81 j;  4JI6 J;  4Z37 A;  2ZEJ A;  2M8H A;  1HFE L;  2KHC A;  1Q81 T;  1J5E J;  1IBM J;  2W2Q P;  4QBU A;  4URG A;  3OTD A;  4I6Y A;  5K9F A;  4ZIT A;  1O8B A;  4PAA A;  4G1Q A;  5LXR A;  1C0T A;  2B51 A;  4B9T A;  1APS A;  4Q0B A;  4WZM A;  4P2M A;  2EC0 A;  2G13 A;  1R7I A;  3IRX B;  1GMW D;  5EWG A;  2ERR A;  4WFX A;  2A10 A;  2V4J B;  3M8R A;  2JVO A;  3A8K A;  1JK9 B;  3NBP B;  1UA1 A;  4DEZ A;  3MXH P;  3I9V 9;  3OJS A;  1N5Y B;  2GML A;  2LEA A;  1TEL A;  2XYG B;  3TZZ A;  2AV5 A;  1ZET A;  4IH6 A;  1HIY A;  3OHA A;  4LBH A;  3IC1 A;  2ZJQ Q;  5B08 A;  2E5G A;  4DF4 A;  4MAK A;  2CPZ A;  3W61 A;  1KDN A;  1SBR A;  1ZA2 B;  3BYR A;  3KUG A;  3QT8 A;  1UWB A;  1K1S A;  1S12 A;  1UZH A;  2YKP A;  4H54 A;  4RW9 B;  2QYC A;  1SPB P;  2C2R A;  4NLR A;  5CYQ B;  2R7W A;  3NNA A;  3KDO A;  2VDH A;  5IV3 A;  1XMQ F;  2DTJ A;  3BN4 A;  3GIK A;  4CLP A;  1T3N A;  1JLG B;  2CFX A;  4OYM A;  2F9D A;  1U2R A;  4PG7 A;  1TUW A;  4USJ C;  3RUB L;  5LMU J;  2DIT A;  2VFR A;  2R2U A;  1XMO F;  4FKX A;  3MWB A;  4YFU A;  4J9Q A;  4IQX A;  1QD1 A;  2K3K A;  3EGW B;  3W65 A;  2CJB A;  4LFC F;  2AKW B;  1WHY A;  2E5H A;  3CCM S;  4K50 A;  2DHG A;  3NOC A;  1U4B A;  2QA4 G;  1FWP A;  2EK6 A;  3R5B A;  3TUZ C;  4USW A;  1TZ0 A;  2KDO A;  2XY6 A;  3P4U B;  1NK4 A;  4YS2 A;  4HHH A;  1ICE B;  3G86 A;  4NI2 A;  2F65 A;  5GAD U;  3DM2 B;  3IRW P;  3QT5 A;  5LMU F;  4OHW A;  3DGP A;  3DYA A;  3DM2 A;  3MED A;  4UW2 A;  4ECY A;  2KHD A;  1HD0 A;  3I0R B;  5ETQ A;  4B08 A;  3J7Z T;  1XMQ J;  3HT0 A;  2P6S A;  2OEJ A;  3LH2 S;  2HQ3 A;  3ILJ A;  4F8R A;  1JLE A;  1Q79 A;  2V63 A;  5BR8 J;  3PRD A;  3O8W A;  2YNI A;  2KJW A;  1NRK A;  1RT4 A;  3GII A;  2WHO A;  1D1U A;  3V6D B;  2KG1 A;  2G9O A;  2CQP A;  5F0U A;  2VKR A;  4OHX A;  1NAQ A;  1B3T A;  1WEL A;  3HVT A;  3KLF A;  2FJB B;  2UUW A;  4DPT A;  3KMS A;  3MEG B;  2FLN A;  2PDA A;  4CQ1 A;  4OYX A;  1YLX A;  2I1R A;  1KS2 A;  1Y5N B;  1JIH A;  4DXL A;  1HLW A;  3CWJ A;  4ZK7 M;  1S72 S;  2X3D A;  2BUN A;  2F40 A;  4MKY A;  2B5J A;  2V5H G;  4CYU B;  1CJU B; 
#chains in the Genus database with same CATH homology
 3GP9 A;  3BH7 B;  1WKJ A;  3R9L A;  2B8Q A;  3BBB A;  3Q83 A;  4UOH A;  3FCW A;  1S57 A;  3G2X A;  1JXV A;  4CP5 A;  1LEO A;  2DXE A;  3EIC A;  3BBC A;  1F6T A;  4C6A A;  3L7U A;  1XIQ A;  5CAA A;  4S0M A;  1LWX A;  3Q86 A;  2AZ1 A;  1NDP A;  3BBF A;  3FKB A;  3ZTS A;  2B8P A;  3VGT A;  1B99 A;  2BX6 A;  2VU5 A;  3Q8Y A;  1WKK A;  1K44 A;  3NGU A;  4WBF A;  3Q89 A;  3BH6 B;  1BE4 A;  3Q8U A;  4DZ6 A;  3NGR A;  1NB2 A;  1ZS6 A;  1NSP A;  2DXF A;  2ZUA A;  3FC9 A;  4KPC A;  1NUE A;  1XQI A;  5IOL A;  3PRV A;  1NHK L;  2HUR A;  4O0N A;  1NSK L;  3EJM A;  1NLK L;  3FBB A;  1HIY A;  4ANC A;  5BXI A;  3Q8V A;  4F4A A;  1KDN A;  4DUT A;  4W98 A;  3EM1 A;  3ZTQ A;  5CAB A;  4UOG A;  1S5Z A;  1VYA A;  1BUX A;  3B6B A;  1NCL A;  3FBC A;  2CWK A;  3VVU A;  1EHW A;  3NGT A;  2NCK L;  4ANE A;  4F36 A;  3ZTR A;  4FKX A;  1BHN A;  3ETM A;  1NDC A;  3VGS A;  1U8W A;  3EMT A;  2BEF A;  4HR2 A;  4FKY A;  3ZTP A;  3MPD A;  4ENO A;  3EVM A;  1S59 A;  1W7W A;  3FCV A;  3VVT A;  3ZTO A;  3EE3 A;  1NDK A;  3NGS A;  1MN9 A;  3VGV A;  2HVD A;  4DI6 A;  3JS9 A;  1F3F A;  3EVO A;  3GPA A;  2HVE A;  3FBF A;  3PJ9 A;  3B54 A;  1NSQ A;  3FBE A;  3ENA A;  1MN7 A;  3DKD A;  2DYA A;  2AZ3 A;  1HHQ A;  1NPK A;  3WX8 A;  1NDL A;  1UCN A;  4AND A;  2DY9 A;  1PAE X;  4UOF A;  1PKU A;  3ELH A;  4EK2 A;  5C7P A;  3VGU A;  3EVW A;  1WKL A;  1B4S A;  1HLW A;  2DXD A;  3DDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...