3ENAA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dgdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3enaA00
1NDPA 1F3FA 3GP9A 2DY9A 4FKXA 3FBEA 3ZTPA 1XIQA 3NGTA 3Q83A 4WBFA 3EICA 2BX6A 4W98A 1EHWA 2B8PA 4ANDA 1B99A 4ENOA 1F6TA 1S57A 4DUTA 1NSQA 2DYAA 3ZTRA 4F4AA 1NCLA 5CABA 1NSKL 1WKKA 1HIYA 3B54A 3EM1A 1JXVA 1NSPA 2CWKA 1LEOA 2VU5A 1KDNA 3FCVA 5CAAA 4S0MA 1MN9A 3EVMA 3DDIA 2HURA 3VVTA 3PRVA 1HHQA 2B8QA 4CP5A 1NDLA 3NGRA 5BXIA 3NGUA 1PKUA 1NPKA 1BHNA 3FBCA 1S5ZA 3L7UA 2DXDA 3EE3A 1NHKL 3G2XA 2AZ3A 1WKJA 3ZTQA 3WX8A 1ZS6A 3BBFA 5IOLA 2AZ1A 4UOFA 1VYAA 4KPCA 1NDKA 4DZ6A 4UOGA 3FBFA 3FCWA 2ZUAA 3DKDA 1MN7A 3ETMA 3GPAA 4UOHA 3FC9A 3ZTOA 3BH7B 3EMTA 3R9LA 4F36A 5C7PA 4O0NA 1BE4A 3VGVA 1U8WA 4ANCA 2DXEA 3Q8VA 1BUXA 3ZTSA 2HVDA 3FBBA 2HVEA 2NCKL 4FKYA 3VGTA 3VVUA 3EVOA 1HLWA 1XQIA 3BBBA 1W7WA 4C6AA 3EJMA 3ENAA 3VGSA 3Q86A 3BBCA 1NUEA 1PAEX 1NB2A 3EVWA 3FKBA 3BH6B 4DI6A 1NDCA 4EK2A 1WKLA 3Q8YA 3NGSA 2DXFA 1K44A 3Q89A 3MPDA 2BEFA 3JS9A 3VGUA 3Q8UA 4ANEA 1B4SA 1S59A 1UCNA 3ELHA 4HR2A 1NLKL 3PJ9A 1LWXA 3B6BA
chains in the Genus database with same CATH superfamily
4W92B 4DR6J 3GP9A 5KTQA 2ABYA 3DLKB 2YKMB 2B4VA 2R8JA 4F4KA 1T0TV 3HD1A 3LO3A 2H5JB 3Q0AA 4OHZA 3D6HB 1RQ0A 2DHAA 4J9QA 2MHNA 4CM0A 2CNOB 3IAS9 4NCGB 4MKYA 1RLCL 2O66A 5A0YB 5CABA 2F4VF 1HQEA 1RHUB 2EG1A 1REVB 2E44A 4V19J 1R8AA 3LWLA 1ICEB 5B0CA 2Y1IA 2GFFA 3GQCA 2V4QA 4BWMA 4FF4A 2YQ0A 1LWEA 3RBXA 1NEEA 5L39A 2HW3A 2V5HG 1S7HA 3PTWA 3TEGA 3NS7B 1JLCB 3ITHB 1MWQA 3PACA 1NPRA 5HQ8A 2K8GA 2G2ZA 3W2VA 3V4IA 1JWWA 3DLHA 1HBNA 3KLFB 2XYGB 3CJSA 2V8GA 3G6YA 1S9GA 4KFBB 4O4RA 1Q8IA 2MSTA 3BSAA 4XPEA 5LM7E 4MAKA 4OJ3A 5F8HA 3M32B 2M7SA 5DQGA 3F56A 2CADA 2ILYA 4OIXA 4FKXA 1HBOA 2HBYB 1WSRA 2W1BA 3H90A 5HMZA 3BKFA 3BV8A 2J8SA 4RBTA 3HJVA 2HBZB 4MH8A 1TFYA 4N47A 1H3DA 1ZAXA 2KVIA 2ASLA 3IG1A 4A47A 2UVVA 4RNFA 3FDSA 1K0TA 1YGYA 4DL4A 4R5PA 4L73A 4DR1J 1S76D 4UOGA 4ED4A 1WEZA 3IM9A 4WTOB 3JQKA 4C8ZA 3KLEA 1Y3JA 1S1XA 1UVIA 4BC7A 3VGTA 4UZCA 2X1BA 4QW8A 1HWIA 2YWWA 3W7BA 5AE2A 3QT6A 5KG7A 4ED7A 1R8PA 4IKAA 4DPOA 4QWBA 2VASA 3VAJA 3GU0A 3GLJA 5D0HA 3CPWR 3W61A 1ZYQA 3EGNA 4XAKA 4WPAA 1IQZA 5KFDA 2KG1A 3PHEA 3RGIA 2X1FA 3CB4A 2Q6BA 5THWA 1MMLA 4BHQA 4HYKA 5BR8J 3FSIA 1SJRA 1B7YB 5JXSA 3E3XA 2PI4A 1VMBA 4RJVA 1S57A 4X4PA 2E5JA 2HYIB 1SV5B 3JAMY 3HM9A 1KLNA 4F2SA 2IM2A 3DM2B 3MM9A 1UWAA 3CC2S 3PW4A 2ZWPA 3V6DB 3THPA 2XTJP 1JXLA 1CQMA 3P4UB 3I87A 3MGJA 3QT5A 1ZA2B 1IBLF 3PR5B 2ATCB 1Q16B 2PE8A 2EFNA 1RU1A 3FMBA 4Q43A 3D3BJ 2UUCF 2OFHX 3AOBA 3QSYB 4FYYB 3T1YF 5KT6A 2JWNA 3JSMB 1QTNB 1UWBA 2HVDA 1UVKA 2DRBA 4KGMA 4FF1A 3GFZA 4FDFA 4IR1A 4RW8B 1FFSB 5AJ3J 5DG9A 1DJ0A 1U4BA 3TZZA 2ROPA 2KYZA 1IQTA 1S1UB 2ZOGA 3D9BA 3K17A 2QLJB 5J2NA 2Q43A 1KLMA 3DLGA 1HBUA 1CULA 4KO0B 1A0OB 4DSLA 2PN6A 3CDWA 5BYQA 1Y4ZB 3RB4A 2A1BA 2Y1JA 1G7CB 1VQYA 4JI0J 2RRNA 4P73A 3UNGC 1NJIT 1NSQA 2FY8A 5HP1A 1NK5A 1QSSA 4WXWA 2WONA 4IFVA 2NREA 1IKXB 4B3RF 3WQPA 5LMUF 2BJ1A 2D3ZA 4ZLNA 2HURA 5F9NA 4DPXA 2XYPB 4TY8B 2D74B 5KFWA 3M6VA 2GVZA 1XWLA 3NMAA 3ET6B 2DO4A 1XMOF 4GC6A 2YKQA 2V8VA 2E9TA 3LQVA 1VDHA 3B78A 4QJVA 3G6VA 3UN5A 1R3NA 3CMQA 4DL2A 3C19A 5FLXY 2AJ4A 4F4WA 4MIWA 2V0NA 1NO8A 3UPFA 4OYOA 2FZKB 2UV8A 1YRXA 2HHUA 3HFKA 5B0DA 7FD1A 4UUWA 3MMCA 3A8IA 1HNXF 5F0WA 4DR6F 3NGKA 1NK4A 3KDNA 1RK8A 1X5OA 3S7RA 1NSKL 2AV5A 3IC1A 5D0RA 2D69A 1IM4A 2BANB 3D1OA 2OH2A 3DNCA 1UZHA 2K3IA 1VLYA 3QLHA 1X4EA 4NLXA 5U47A 3W63A 1RT3A 3DDIA 4LVOP 4PPDA 1PJ6A 1RYRA 4OYMA 2HMIA 2PSZA 3VAMA 5DDQC 2BJ8A 4ATNA 4OZ5A 1K73T 3OL7A 4RW9A 2IIHA 2VPYB 1U7LA 4GVLA 4CTAB 2KVQE 2YQ3A 1OQ3A 2MZTA 2YKOA 1IXKA 5A8KB 4WF9Q 2W7OA 2DHXA 3HHLD 1TVRB 3MF5A 4ZPTR 3HZEA 1NB2A 4Y3CA 5LSLA 1GMWA 2QIFA 3UI3A 3K2YA 2D9PA 1SC1B 1PBAA 1ZETA 1SUQA 5CYMA 5H9FK 3J7YI 4Y0FA 2R42A 2HQCA 4B9LA 4P71A 3SFGA 1YWXA 2UU9F 5T7LB 2GV1A 4DEZA 2H1YA 1XNQF 2BE9B 3D54A 4JB8B 1RKJA 3DOMB 5KFHA 3CCMS 3P6YC 5DG8A 3SSRA 3HVTA 2R8HA 1TV6A 3F73A 1WOSA 1NKCA 3QRPA 5KFPA 3R5BA 3KUGA 3H5XA 5DO2A 1HWUA 3UNYA 3LP2A 4I0WA 1Q7YT 2VA3A 3MCMA 1EETB 3OR1B 4C8MA 2NXCA 1W26A 1YJVA 3HVAA 1DURA 1GX5A 4G1QA 4P9SA 1MW7A 3O8WA 1IJEB 1V5VA 1O0PA 3H40A 4LF6J 2ADBA 2LMIA 4NLQA 2C1EB 3PR4A 3JSYA 3HXMA 4K4TA 1KKHA 5HATA 2DR5A 2B9XA 1VFJA 4DR7J 1JJHA 2RS2A 4L3KA 5FDLA 1S1WB 2Y1RI 1WDTA 1KVKA 1JLAA 5D4LA 5ETRA 4E98A 4B9VA 1UVMA 2FJAB 2HQFA 4ES1A 1RT5B 3HHNB 4IQXA 1JQGA 3O6QA 2XMAA 2J0SD 2R7VA 3CJ8A 4XK8C 4ECUA 3KLIB 3GIKA 3P5TL 3HVWA 3K8WA 4LF4J 1APSA 3BYPA 3CCVS 4YY3F 3WIUA 3CDUA 1CS4B 1EKSA 3KG1A 2J7UA 2ZKTA 3R9LA 4A48A 2JEJA 4DUZF 4P52A 2PC6A 1UAWA 3K5NA 3VV2B 1W7WA 4X4NA 2BVZA 1NRKA 2NSCA 4M5DA 4Y2MA 2KFYA 5JMNA 2CJBA 2NZCA 3A3PB 3BN4A 4LF9J 2PMZD 2ZM6J 5I3UA 3RAMA 3M8PA 3IWNC 3I5CA 4UQGA 3CF5Q 2L9WA 1N88A 1XMQJ 2OSRA 3Q83A 5EN1A 2MKIA 4Y2KA 3O2IA 2VG7A 4JI3J 1Q8LA 1RZMA 2DHHA 2XBPA 5AXKA 1ZM9A 3F0NA 1LWFA 4LQ9A 1TTHB 5KG3A 3PDNA 1X0FA 1X4DA 1S6PB 1TK0A 4RUBA 3MXHP 3MI7X 4ZPDA 2B5JB 2IMOA 3L9ZA 2KXFA 3RAQA 4YHHF 2HRTA 2V69A 1C4CA 2XMJA 3H5SA 1UZDA 1F2GA 5FD1A 3TANA 2RAQA 2B43A 2DNLA 1PYOB 4Y6IA 3W65A 1XC9A 2VHGA 1FJEB 4C3KA 5K20B 3CUNA 4LSNB 5G0RB 1NDCA 1U0HB 4ED1A 5HMXA 2JHEA 5C42A 4MYUA 3TZYA 1VQLS 2RQKA 1NJZA 4PYDA 2HAFA 2H5IB 1WC6A 2CPDA 2DGXA 2DKOB 2CIMA 3D67A 5HI7A 4DWIA 2BV3A 1W25A 3KNAA 1P1LA 1HQUB 3K7RA 3I4HX 1WSVA 2FHMA 3B8HA 1FWPA 2VDIA 3TA0A 4ZN1A 3HULA 2ZH2A 1S0MA 4WFAQ 5IFMA 1YBUA 5KFLA 2FQQB 3JYTA 5A2QY 3A3NB 3UD4P 2W2QP 1T3OA 5DM7Q 4KGZB 1X5PA 2OPQA 5L1IA 3VAGA 1AT1B 1MU2A 1UPMB 4OZ2A 1VJQA 4NZ7A 3ZZZA 3KK1A 4O0NA 4K4ZA 1N36J 4QWAA 1BUXA 2BA9A 4NCBA 2OSQA 3UCUP 1F2HA 4ED3A 4ZCKA 1DQAA 2E1RA 1D9DA 3M8YA 3OLAA 1KEKA 1G1XA 2WHOA 1X4BA 2BEFA 3RUBL 2A2CA 1HKAA 1RWOB 4OHWA 3G8SA 3I9ZA 1U6BA 1C0UB 1FKOA 2XHWA 4CH0S 1RWNB 3UN3A 4FS1A 4V1Ak 2E5LJ 1IBCB 4FYXB 1YTYA 5FIIA 1QAJA 5KFBA 2HK3A 4B02A 1RI7A 4NL5A 3CW2C 2AJ1A 3IS9B 2UVUA 2L9NA 2XO7A 1T94A 1FKAF 4IRCA 3DMJB 3MOZA 4K5SA 2LDYA 1WKJA 4F0MA 3PW0A 3R27A 2RJZA 3ZXWA 2ASJA 4FVCA 5E3AA 1VQ4S 3UR3C 2JX2A 5AE1A 4HHUA 1FWLA 1RA7A 2HFUA 1CLFA 5EX0A 4DL6A 1I6JA 1N0UA 1UPPA 1I51B 2Z30B 2V94A 3NGSA 4MFBA 2CQ2A 1AZSA 3W64A 2HLTA 1R6YA 3VGUA 4QOTA 3RB6A 1X4AA 2MZJA 4BBYA 5LJ5Y 4EO6A 1WUUA 4HHHA 1K0VA 3HO1A 2ZDPA 1PGZA 1Y9OA 2IC3B 2MPUA 1ZBTA 4LF6F 1CJKA 1JLFB 1ITPA 2MJUA 3OTEA 1N5YA 3BQ0A 4KV8A 2XCPA 2CQPA 2CZ9A 2EK6A 1DTQA 3EPGA 2XSJA 3US5A 2CPXA 2GW8A 4FVMA 5KFSA 2HWIA 2PIIA 1FD8A 4ZJOA 2LKZA 3BBFA 1JB0C 2HBQB 4WXOA 4EBCA 1RT1B 2XLKA 1I1GA 1WG5A 1X9SA 1N33J 1FX4A 2FHJD 1RTHB 1CG2A 2DXEA 2EKNA 2DGTA 3E01A 2HIQA 5EWEA 3Q86A 2MZRA 1NUEA 3FKBA 2ZVSA 4ZP6A 1KFSA 2HRYA 5KG2A 4ECQA 4L76A 2BXJA 3ZNUA 3OFGA 1IKYB 1SC6A 4ZP7A 2ZH1A 2FLPA 2QMWA 5HROA 3D66A 4LF9F 4P10A 1Y0HA 1AFJA 2ZITA 3N4WA 2ATLA 2V4RA 1U1OA 1XMQF 1X9MA 5E33A 2UXDF 3TAMB 2QA4S 4JI6F 1NNDA 3E2EA 3C8YA 4OFZA 2VQFJ 1WF1A 3JTNA 2LEAA 3W9JA 5AT1B 2B56A 4RW4A 2C28A 3J7ZT 2AZ3A 4TYBA 3IAM9 3OVAA 4JV2A 3TUIC 3V2UC 1VQ8S 1YJ7A 2GZOA 2E7XA 4KSEB 3OFEA 4M63A 3I0RB 1HNVB 3T6BA 4DCJB 1FX2A 4B9SA 3ENVA 2KO1A 4M5LA 4HT5A 4J9LA 4ECYA 5K5MA 2OD6A 3KK2A 4TU8A 2B9EA 2HHVA 2WBRA 1SC3B 4LF5J 3EGVA 4BCAA 4ELTA 4PWDA 3NWRA 3K0JA 1N54B 1F3FA 4JUZA 5F8LA 2NPIA 2K7KA 1RWKB 1VS3A 5KFYA 3PFOA 3CJ2A 2N3OA 2VBZA 1ELOA 4ZIVA 4TNOA 5KFMA 3OPKA 4HKQA 4DUTA 4PUOA 2ILZA 2QLXA 4RKUC 1NJYA 3C6UB 5KT5A 3MM6A 4OI6A 4D3HA 2HS3A 4U9RA 1C1CB 4Q8FA 1S9EB 1HQ2A 2OUGA 2B8QA 5IWAF 3KMQA 2OHDA 3H7HB 2QRRA 2XQCA 3DLEA 1FDAA 3TARA 1VQ6S 1R6VA 1U0SA 4I64A 4E0DA 3TO8A 4TQRA 4F36A 1UMJA 3FEZA 4DG1A 2E1AA 3GV5B 3KFWX 4JV5F 2HVEA 3VVUA 1U49A 4K4UA 2Q3PA 3CJTA 4OLPA 3M1VA 3CD5A 5IM0B 4Q2LA 2D7SA 1PIEA 3DLLQ 3C6TB 4LF2A 3GV7B 2P9GA 1HW9A 4ELVA 1QVGR 4NMLA 2ZHAA 4OZ1A 4WKYA 3B6BA 4I4BA 4B9NA 3NBPB 1IKVB 3DDNA 1C4AA 3TEHB 1ZAVA 1UFLA 2GJFA 3OD2A 1R0CB 1UEKA 3KG4A 1FJGF 5H9EJ 4IOAQ 3QATA 3SCIE 3HK2A 4Q5VA 3EX7B 2RKIB 2E5LF 2W01A 2J0WA 1WG1A 3CD6S 2F7VA 1RGVA 2R7QA 2B4UA 4FZVA 1UFKA 2DXDA 4NI2A 2F8EX 4DL3A 1TP7A 6FD1A 4I69A 2XMVA 2DJWA 4OI4A 1Q95G 2AGOA 1NJWA 4Q45A 3UD3P 3EYZA 3X3UA 4HTIA 4IG0B 3NNCA 3GIMA 2NCKL 1AW0A 3H98A 1CVJA 1RU2A 4CDIA 3HP6A 4WP9A 1PO6A 1JKHB 3MDFA 2XGPA 2B4PA 1NH8A 2BZ2A 3PXGa 2QE5A 1HD1A 5GADI 2RQ4A 5HVFA 1H6KX 4FP9A 2BUNA 2HNYB 4KYZA 5B0EA 1AUDA 2EC2A 3KMSA 1YIJS 3FFIA 3M4XA 3POTA 2HFNA 3AB4B 3DOKA 4B9MA 4NXMJ 4PG5A 1TELA 3VAFA 1F9FA 3BSNA 1FNOA 3WC2A 3HSJA 2FGOA 2OPRB 1GK8A 1KDNA 4LF8F 1H0HB 1P8GA 2A10A 2CPHA 1RWUA 4N8NA 3ETOA 1UKUA 4IG3A 2JVOA 3A1YG 3ZTQA 4IRKA 1SC4B 1TUVA 3D0IE 1FFGB 2H65B 2J9CA 2DH8A 1VBXA 3H42A 4DV0F 4ANCA 3Q8VA 3LW5C 1SVDA 4X62J 3VF0B 1HWJA 2B6AB 2FLLA 4P74A 2ZH4A 4B3TJ 1SJ1A 5AXNA 3DLJA 2FPHX 3ONQA 1JLEA 4EBEA 1TK8A 1F60B 3M8ZA 2CZVC 2G2YA 3QFHA 1ZTTA 1HNWF 1U47A 3SDEA 1VBYA 3R7BB 1C1BB 5E2QA 4MKBA 3FBEA 1XK8A 2W4PA 1CQNA 1UVJA 2G0IA 3JAMU 3NG8A 1VGYA 3GR0A 3AA8A 5I42A 3MFIA 2WB4A 4Y28C 3ILJA 3GYGA 3AY0A 3ZTRA 4NLDA 3AQPA 3IGNA 1LFWA 2W4DA 1U1MA 2CNLB 2OEMA 3S1TA 3MEGB 1CJVA 1RTJA 3DLGB 4KRWA 2L9DA 2MQOA 1J5OB 4HI2A 3P49B 4URGA 3MUTP 1VJWA 2VQFF 1FJCA 3GSIA 2HQGA 5EHHA 3NL0A 3R2CJ 1VK8A 5EWFA 4C8OA 1XJWB 4ED2A 2VA2A 4HLBA 3BQ2A 2HWHA 4DQSA 4IFVB 2I5JB 2GJIA 3VHQA 3AD8C 3NS6A 4GRSA 2XNQA 5CD4A 2CPZA 5HQMA 1PYTA 3K5LA 3KK3B 4G65A 2ZJRQ 1FT8A 2P9CA 2QMUB 2QGFB 5KFFA 4RR5A 2DCUB 5I3QA 8RUCA 2XM3A 3QJLA 2Z2LA 1U45A 2O3DA 3MUMP 3T41A 2MYFA 3M05A 2MZQA 2DEIA 4YS2A 2MLYA 2IVFB 4LMZA 2DIUA 2AEFA 3H25A 3CCES 3IRXA 4ID5B 2PFDA 2OJ3A 4QWCA 3C16A 3QO9B 1S48A 4X66F 4CI0B 5BYRA 3L95X 2ZJPQ 1LXNA 1R31A 1NPKA 3R97A 3IMQJ 4DSJA 5GVQA 3W8GA 3R6GB 4DR3J 3EGZA 2X51A 1WHYA 1SJ3P 2QL7B 3IWLA 4C4WA 2HHWA 4K2JA 5F8MA 2PDAA 1UP1A 4P7VA 2G1DA 2IVYA 2ZH9A 2GC8A 1DZ5A 3BO3A 3MMBA 2K7JA 5E7OB 2J8AA 5A8WA 1H73A 2DNNA 1IBMF 1PAEX 4X64F 4YR2A 3KLGB 3VR1A 2BE2B 3AAWB 4CYUA 1LXJA 4PAAA 1ZZFA 4JI4J 3NEKA 1XMBA 4PXDA 2O5DA 4LFAJ 2EXUA 5J1EB 1ZOTA 1VIOA 4R0JA 1SL1A 1BWEA 4JYAJ 2QV6A 1KOOA 3T3FA 4PWWA 1WNEA 2IJNA 4CLKA 5IZHA 4X4VA 1TL7B 4J9VA 3I5AA 4C11A 2QA4G 4Z7CA 4QU6A 4OX9F 2IJFA 4GO5X 1G6BA 3G71S 3OT9A 1CC8A 2RIJA 1EZZB 4O44A 5E3CA 2F8MA 3UD5A 2YNFB 3GFHA 1D8YA 4I7FA 2HQDA 3M8QB 2J6UA 3OVSA 1E6VA 1FRKA 2CUYA 2X7IA 3DRPB 4LREA 3J7YU 4RW7A 2GCFA 1U02A 2DK2A 3BS9A 1U48A 4TYAA 1PYSB 3H2LA 3TJ9A 4A8KA 2RMLA 4RLEA 3JQJA 2HQ3A 4ZN3A 4N76A 2YNGB 4P2FA 2B9WA 3MMJA 1NB7A 3K89A 3LP2B 4C0BA 3KJFB 3PIOQ 1K1SA 3MURP 1HMVA 3MHYA 2GHWA 2OO4A 3Q24A 3SZ2A 3HT3A 7AT1B 4J7CA 4NXMF 3P3DA 2BQUA 3M2VA 4ED8A 3U7JA 5DDPC 2VD3A 1VRUB 2L3MA 1TUGB 4LRCA 3EXYA 3FSXA 1M5SA 2Z57B 1KWMA 1JLGA 2H4WB 1X5TA 3KJVA 2HNZA 4OHYA 1HNZJ 2NYHA 2BOAA 3Q2TC 2QYCA 1RTDA 4XO0A 2YWHA 4JI7J 4WFYA 1GT8A 3QJJA 2QJ3A 4IO9Q 4IH6A 2W2NP 1T9WA 5DLFA 5K8OA 3HHLB 1U1KA 1RYSA 2Z8QA 1M5KC 2KZMA 3RW7A 4B3TF 3S6EA 2YWFA 3GJRB 4GKJF 3KUEA 3N79A 2EEYA 1F1BB 2DNHA 2RS8A 4GKKJ 1OY8A 4Q8EA 3PG9A 3M2RA 1B99A 2QEXS 3O44A 3VAKA 2NYIA 4LFCF 3M6UA 4CLPA 1NHVA 4YMEA 1S6QA 4WK1A 1OYEA 4OL8A 1QTMA 3M2UB 3MPUB 5IOLA 2PI5A 3FJ2A 3UCZP 2D3O1 3GPAA 2JC1A 1CJTB 2CQDA 2YH1A 4OJHA 1TK5A 5A76A 4O0IA 1GNKA 4DFJA 2BJ3A 4OLOA 2FLNA 3T5KA 3MAAB 3TQ1A 2XMTA 1U8SA 1XQIA 2MGZA 1S6UA 5L38A 3QMQA 4PXCA 1DQ8A 4ZP8A 2AU0A 4R25A 1S1TB 2BM1A 2BW2A 2DHSA 1RWPB 3ENQA 4OI0A 1RT4B 5EGYA 4RPFA 2IDLA 4EU0A 1UCNA 5LXYA 1ULRA 1SKUB 4OYBA 3V6HA 4CO2A 1RAAB 4DV7J 3GFYA 1TL3A 3DYAA 3BB5A 5KG0A 4J91A 4ZVSB 1FERA 1HNIB 4USJC 1YJUA 2MKKA 4Q7AA 4RUAA 2O1PA 2I0XA 4QZVB 3FZ2A 4CLZA 1C0TB 2KRBA 2D9OA 3IM8A 2XMUA 3V4MA 3OTBA 1KD1T 1I94J 1N6QA 3GIIA 3IGVA 1RTIA 3CCJS 1RAIB 2H4YB 2F65A 4ILMA 4F50A 5E3RA 3SQGA 2IHR1 4B9UA 1RT2A 3E51A 4LR9A 3VWSA 3M6XA 2FB0A 1U09A 2ZHBA 2RDJA 1OYDA 5IQ6A 1T7PA 1N8RT 5ETOA 2RF2A 3CXCR 4HHJA 4P72A 2IM1A 3A3OB 1MWYA 5KFZA 1UW4A 2YKNA 4PQAA 2YKAA 3FQLA 4YR0A 2KT2A 3W66A 4GC7A 4LRFA 2AYMA 2ZH7A 1S59A 1DBDA 4PPZA 4J5OA 3OR2A 2M0GB 6AT1B 5LT5A 1IKWA 4O3QA 3PKYA 4X4UA 1M1KT 2CWXA 2V8PA 1BWVA 2OPSA 4URQU 2E7VA 4DV2J 3I4PA 2UP1A 3I6PA 4CCHA 2R8KA 1EJ7L 3TJ8A 5CH7B 3BGOP 1UA1A 4WZMA 5KOWA 3BR8A 1J5EF 1R0BG 1BQMA 2DR6A 2MMYA 2IFXA 1KN6A 5IV4A 4DV6F 2CKWA 1IM6A 1SKSA 2RRBA 3TUZC 3QBCA 1FF2A 3G96A 4DR2J 1JJ4A 4AL6A 3MR5A 1DLOA 4QWEA 1QUVA 3LTOA 3DGPB 1F0XA 2CJ9A 3CC4S 3G86A 4OHVA 1AB8A 4PXBA 3KJQB 1NMEB 2MXYA 1X7VA 3R5GA 4DQRA 2CAJA 1GMVA 4DDFA 4MK7A 5HJYA 5KFOA 2RRAA 1VISA 3A4TA 2YQ1A 1AXQA 2AHOB 2Z2YB 4CLWA 2RB7A 1BMQB 1BC6A 1KTVA 2POKA 4RBVA 4LR7A 1G3OA 2O01C 4ED0A 3OXLA 2UZAA 1PC4A 4LSLA 1S72S 3VTIA 3OXFA 2EW9A 1PG5B 2AYGA 5RUBA 3Q23A 2IM3A 4PG7A 3GCWP 4ZVUB 3HFVA 1VRTA 1DRZA 3PX0A 3LGMA 2MQLA 2W24A 2IAJB 1Z2ZA 4MT1A 2Q6CA 2V67A 1RJJA 1QSLA 2EKYA 3GMGA 5CZXA 1PJ7A 2ZVIA 5DZ6A 4E8UA 2M8DB 1DTQB 1HNZF 4HH1A 2LQJA 4KR0B 1PSDA 2CXEA 3OL8A 3MECA 4DMZA 1JIHA 2CQHA 2KDOA 3DLBA 1N48A 5F8JA 4PQUA 1KHWA 2HS4A 4ZIWA 1KP6A 1SQGA 3MAQA 1S1VA 5DGBA 2V2ZA 4QPXA 3LF0A 2BKOA 3E01B 1RB0A 4ENOA 1U2FA 3LGHA 3GSDA 1R8BA 4NLSA 3PKMA 2WTFA 3P8BB 1RT6A 5HN0A 5JVGQ 2KZZA 3UDCA 2ADCA 1WHWA 3CVKA 3QJPA 1FRJA 2XWXA 3J81j 1NHKL 2JZ5A 1VYAA 4I2PA 2WW8A 4AD6A 1FO1A 2HHSA 1WACA 1JJCB 3DRSB 1Q78A 4K0KJ 1GAOA 3EVOA 3T1AA 1IBKJ 1U25A 4F7VA 2DNGA 1UJ4A 2J9DA 4HDGA 2D41A 2UXCJ 2DISA 3OTOF 2YKPA 3C15B 1FJ7A 3O5TB 4G3IA 3RRGA 1IVZA 4Q44A 2PEBA 2UXBJ 3GZ7A 5KFRA 2VV5A 1GX6A 1TL1B 3GJTB 3TNVA 4DLEA 1F6TA 4DR4F 4NLPA 5A6PA 1T03A 4WTYA 5CAAA 4C8NA 2DITA 4PWDB 3TW0A 1PCAA 1R0AA 4C9DA 5CYQB 4PYAA 4USUA 3IXQA 3HFZB 2R7RA 2AEJA 4C0HA 2MZSA 2V9WA 4KHMA 4DXLA 3FRZA 3NOGA 1NBEB 2HAIA 1I94F 4H4MB 4F4YA 3DOLB 1X0PA 2BBEA 4KTQA 3C14A 3DRXA 2LQ9A 2MB0B 2KM8B 1HA1A 2PD1A 2XB2D 1LW2B 2ZNZA 5HBMB 5H9EK 4FKYA 3R7NB 4KHPF 3LP1A 2CQ3A 3A12A 4RL1A 1PC5A 2VKRA 3PX4A 3NMRA 3R7SB 1YZ6A 1RABB 3DLKA 2YKMA 1K44A 4F3QA 5D3GB 4DFPA 3TUJC 4U7UD 3NCQA 3NOCA 1GXTA 4TVAB 3MR6A 1M5VC 2UV8G 1OSDA 1Q5YA 4NCGA 3PEJA 2WRMA 4XDCA 5A0YA 3N5FA 4AUKA 2XYHB 2GIFA 1REVA 1ZAWA 4I2QB 1VHFA 2DNZA 3EWGA 5JUMA 5KG6A 2DTJA 2XY7A 2NPFA 2XY5A 1MN9A 1WDDA 4DPWA 2VICA 2BYCA 4RUHA 4C3MA 2X1GA 4AQYJ 3CC7S 4IRDA 3HF5A 3CDBA 3L7UA 1P9YA 1JLCA 3ITHA 5KFNA 2V6AA 3AJ2A 5HAOA 4JI5J 1FDBA 4J37A 4UOHA 3DXSX 3ILLA 3KLFA 3PO5A 5ADZA 4BWJA 4KFBA 4WIQA 1X4HA 1TAQA 3G8TA 3M32A 3ISND 4Y2IA 3GB0A 4J9OA 4G6VB 1RKIA 3EXCX 4JI2J 4ILRA 5D77A 1O5JA 5CCLA 2UVWA 3I32A 2GVDB 1UETA 3MTKA 3Q2SC 1NKEA 1KS2A 2AP6A 2JSXA 2WW4A 4QR2A 5DS7A 4CO1A 1VR6A 4I56A 3NGTA 3UDLA 2BRKA 2VQEJ 4CM2A 5KFIA 3CIZA 3W60A 2UUWA 4C8KA 1X60A 1WEYA 3N0VA 3BGFA 2MZ1A 3P96A 2ZBRA 3B54A 3NWGA 4ZCLA 5HLFB 3QGPA 2VZ9A 4HEA9 1S9FA 1BHNA 4ECWA 2E7WA 3AJ1A 1QD1A 1CSJA 2UUAJ 2V2QA 1D0EA 4DV5J 2VFRA 5GAEI 4ZHRB 1X8DA 3QAEA 2I1RA 4QPTA 5J1NA 2RU3A 4EWTA 1R43A 5GADU 2AKWB 3VGSA 3UN2A 4DV1J 2AQ4A 3D0GE 3N01A 2UVRA 2QA1A 1BQXA 5ETSA 3HSDA 1H7WA 4I1TA 2ZE2B 2FVQA 3Q8SB 2GIQA 4JI8F 2NQPA 1SV5A 2GGPB 3DM2A 2IRUA 2O67A 2MEWA 3V6DA 4RW6B 3KJNB 4MMOA 2E1MC 3UVJB 4F67A 1NK6A 3AH6A 2K06A 2MKSA 4YP3A 3M30B 5IT4A 4LR8A 2F5GA 2QSFA 1LWCB 3BSCA 1S6OA 3W5XA 1LQ9A 1WHVA 5IT0A 1NU4A 2N3LA 1JXEA 3JSMA 3WHIA 3O3LA 4Q0BB 1ROFA 4O3RA 2XSFA 3FBFA 3WBZA 3T6JA 1A7GE 3ILOA 5KFAA 4C97A 2J76E 1BXNA 3WC0A 1UEVA 4RW8A 3RZAA 4TY9A 1HHSA 2CDRB 1HWLA 1TKDA 1WWHA 4GVBB 2XEXA 4PXEA 4KO0A 3SCLE 2DXFA 5L8RC 2HHXA 1B4SA 3TVYA 2FJXA 2HZVA 1IBKF 2VPZB 2IA0A 4A8WA 3N6MA 5D4PA 4OYZA 2HHQA 2QL5B 1RBLA 2BJ7A 4NPOA 2WVEA 3BSOA 3J80U 1IKXA 3KNGA 2CQBA 1S10A 2KT5A 1GXUA 2UXBF 2HGNA 3OUYB 1U6ZA 2CWKA 2G2OA 4TY8A 5D4NA 1YRTA 4AXIA 2R2RA 3CJ4A 4JV1A 2C2DA 2FVRA 1WC4A 2HK2A 3ET6A 1MROB 3QIPB 2Y0SD 1WD6A 1YHQS 3D6TB 1V6HA 5DETA 5C5JA 1TU0B 5ITHA 1NSAA 2M88A 4WJBA 2JVRA 3RB0A 3FQKA 2QYGA 4CLSA 3B4MA 4LIWA 1R27B 3W5YA 1ZM4A 3OSNA 2JEFA 4X65F 3GG0A 1OY6A 4IUFA 2OFGX 1TKXB 3AD9C 1TMJA 2DGWA 3VCDA 1O6XA 1GTEA 2ZH3A 3RBEA 4KC5A 3C46A 1D09B 5ETNA 4MJKA 4F26A 1IR0A 2YX7A 3QRRA 2BANA 4A8YA 4K4XA 2GHVC 1VC5A 1T8EA 2Z4PA 4F4AA 2J0XA 3R5JB 4CO4A 2FJWA 3KDOA 3CD0A 2JC0A 2OEJA 3OL9A 4N77A 2Y8YA 3H5YA 2Z0GA 4HTJA 3HCXA 2XGQA 1JLBB 2R7OA 1MWZA 4KH1B 4ECXA 2A6OA 4CTAA 5KFEA 2WVBA 3RBZA 4B3OB 2WB1D 5A8KA 2RNEA 1TKZB 4NYOA 3MR3A 4L6V3 1TVRA 1R8CA 1QE1B 5D0EA 4YB1P 3HKZD 2AD9A 4JI5F 1U1LA 1GH8A 1CEZA 4DL7A 3BGRB 3A8EA 2J6SA 1WTFA 4KH0B 2Z56B 1GMWD 3QGIA 2N82B 4O4GB 3ELHA 5T7LA 4OZJA 1HR0J 1F3VA 2MY8A 4NASA 3DOMA 5D78A 3HVRA 2JDJA 4WU2A 4LT6A 1U1QA 2VQEF 3CJKB 2DNRA 3NGDA 2BJEA 2ZZNA 4K4SA 2R8GA 3MD3A 3M9MB 3RTVA 4PG4A 4QW9A 2V63A 1M1HA 1NKBA 2J7KA 4DX7A 1XNRJ 3JXOA 3OFHA 3DGVA 3AXKA 3MPVA 1ZS6A 3OR1A 1EETA 3CCTA 4HI1A 5CXTA 3MCNA 1FNMA 3ZZUA 1FXDA 3V81B 5T41A 2MKCA 2UUAF 2HVZA 2C42A 2GQQA 2WVFA 3IR7B 2YNHB 2KKHA 1RE1B 3ZZPA 3QQCD 2ACMA 1U26A 5E3PA 4M5MA 5DDOC 3RYLA 4DV1F 3DRRB 2MHEA 4R8UB 3LANA 2BW7A 2CNNB 4KGKA 1KSPA 4DV3J 5C24B 2QX0A 3MEKA 3MD1A 4LVNP 1RT5A 1X5SA 2MQPA 4CT9A 1H98A 1XBWA 2ZFHA 2MQMA 4ZPVR 3GJQB 1ZTWA 5LMNJ 1HYSB 2MTLA 1TMMA 1NSPA 4OYAA 4MK9A 3KLIA 4CO0A 3EVMA 1CS4A 2DNMA 3NGRA 5BXIA 2N4CA 4Z2XA 1FTCA 5C25B 2VG6B 4HL9A 4AXJA 4AYBD 2VOOA 2IY5B 4ZJLA 1Q53A 5IQQA 2JEGA 3LP0B 4M94A 2V4JB 1N32J 2GX8A 2F8HA 4B3SJ 1H38A 2KTQA 4LF7J 4FBTA 4YB7A 1KC8T 1TL4A 1T9YA 1GTHA 3CT9A 1REGX 3MM7B 2GMLA 2AYEA 4QCLA 4DOZA 3R3TA 3R6LB 3OQ2A 1YKWA 1DARA 3IBFB 1L3TA 3GR1A 2FJDB 4TLRA 4DQQA 3TRGA 1P6TA 4NX9A 4LUBA 3OHBA 1FEEA 1FWKA 4F4ZA 4K7QA 1ZA1B 1S99A 1S6PA 2HHHJ 2B5JA 3QPIA 4PEOA 4UF4A 3NGUA 2AEMA 1YVFA 3OJUA 1TL3B 4DR1F 3FBCA 3Q22A 2DEJA 1RUSA 1FTRA 4ZVQB 3FCWA 1F9HA 3NNHA 1WG4A 2GHPA 4QIGA 3DU5A 4LSNA 4USIA 5G0RA 1U0HA 4ELUA 1LW0B 2DGVA 1RACB 1N5TA 3EDQB 1TUWA 3JSRA 1N6QB 3MPWA 2BE7D 3TVKA 3J81U 3TA2A 2GQ2A 3I82A 4RU9A 3D6FB 5MLCV 2QLWA 1NJXA 1NK0A 3T5LA 5BR8F 2ZJQQ 3MM5B 1OPIA 4ZPCA 2C3MA 2YXLA 1HQUA 3BREA 4X4SA 3BQ1A 1WOPA 3FCHA 1NK9A 2ZUGA 2YPZA 2V2KA 4OI2A 4M1KA 2LDIA 5B0GA 5J1PA 4DN0A 1YRUA 2OAUA 1SJQA 4TLQA 2HG4A 4ZOSA 2FIUA 2EFPA 3SI8A 1EAYC 3V6KA 3IFEA 3OFFA 3L7PA 2KRRA 3HZGA 3OR2B 4PRFA 1S4FA 4AT1B 1IKWB 4WFXA 1FRLA 1YX2A 2B7BB 4ALZA 3LWMA 3BH7B 1FKPB 2C3PA 4WP3A 3N5BA 3KLHB 3PO4A 3SEOA 3TJAA 5AJ3F 1YI2S 3MMAB 2HRUA 1VIXA 2FY1A 4M5HA 2FLOA 1RWWB 2CVIA 4AFFA 2DNPA 3SV4A 1C0UA 4DX8H 4WE1B 2E1CA 1QY7A 1RP5A 2PEHA 2OI2A 3BGUA 4RWWA 3LOUA 4JI0F 4H4OB 3DU6A 3SSSA 2RT3A 3VQSA 5MAOA 4BDPA 4KT0C 2DR9A 4YFUA 4Z37A 2ACYA 2FC8A 3IS9A 3I0SB 1L3KA 1YLXA 2C2NA 4L75A 3T9ZA 3D2WA 3DMJA 2BKNA 4LFBJ 4U95A 2HEKA 3GFXA 1RAFB 3CNQP 3PCOB 3JTOA 2DB1A 3CGIA 2QFJA 2MKHA 1HPZB 2BDPA 1T11A 1UVLA 1XNRF 4ECRA 4A8FA 1WORA 2QLBB 2VPXB 2CA9A 3EMTA 4DUYJ 1QVFR 1RXOB 2W9CB 2JFKA 1TQLA 2R2UA 4EZ9A 7FDRA 2QA2A 2BKPA 3QAUA 2EFVA 3K58A 3EZ5A 2XG8A 2Y3YA 4CIOA 3FRYA 2IC3A 4DX6A 3PIPQ 4IDKB 4L3NA 4KKOB 5ETVA 1JLFA 2J7WA 5LOQA 2CQ0A 3MEEB 1PJ5A 2COLA 4RNHA 1CC7A 1BQNB 3F41A 2B4OA 2K2PA 4IFYB 1JLQB 4DZDA 3WDOA 2NUUG 5T14A 4WK3A 2CQ1A 3RB3A 1OY9A 1Q5VA 5LMNF 1U1PA 3UWTA 3RW6A 2JL9A 1IBLJ 5KFVA 1N5QA 1RTHA 4DF4A 2AZ1A 3U1NA 3MR7A 1TAUA 2QMXA 3S8SA 2GO8A 4UW2A 4QIWD 2CJQA 4NLWA 2UUCJ 2HLUA 2ZD1B 2W8LA 1NZAA 3SSQA 3MM8B 3GILA 3KLVA 3T1YJ 4PWUA 2NXNA 3QFWA 3DI6B 2K1RB 1IKYA 1FRHA 3TP2A 4B3SF 2CJYB 2KHCA 3TWZA 1CPZA 2DPJA 2EG2A 1RTZA 2P9EA 1KQKA 3Q8UA 3D4JA 4OYWA 2R9LA 3EZUA 2IA6A 5CZVA 2GS8A 2IJRA 1RT7B 5K14B 1HBMB 3TAMA 1LKZA 2YTCA 3QZ8A 3IN5A 5KG4A 5JVHQ 2CJAA 2R7XA 3ZZRA 2HZAA 4DCOB 2IVMA 2KL8A 4KAIA 2W9AA 3BZQA 3KTQA 5A8RB 3NNAA 5IC6B 5J2MB 2G9OA 3QRQA 2AJFE 4CP5A 4LBIA 2OELA 4B3RJ 3VALA 5LMUJ 4K4WA 2AX1A 1SIWB 1E6YB 4WP8A 2PA3A 3I0RA 4P2SA 1HNVA 3OW2R 2XZDB 1D9FA 5B08A 5I3PA 3GYXB 1IWGA 2RILA 4V19X 1B3TA 4UZBA 1N56A 4CLYA 1ZM3A 2AYBA 4X84A 1XMOJ 1FESA 1U24A 1R0AB 1WHXA 4DPTA 1CBKA 5HK4A 2FJEB 1YSJA 3SCJE 3OJSA 2ZNYA 1TKTB 4QWDA 2OPPB 1KBRA 2OD4A 4FS2A 3LGNA 2HGLA 4DR7F 3EGWB 1X9WA 2KT3A 3MFHA 1OJ4A 2NUHA 2QSWA 3Q8PB 4UY8T 2CJXB 1C1CA 3QIDA 1S9EA 1HNXJ 1VRQC 3OTCA 4RNMA 4B3MJ 4DR5J 4ICLB 4GMKA 5AXLA 3J7AN 4S0MA 1SI9A 3HT0A 2W2MP 1W2IA 5J2PB 1DTTB 4LF4F 2G13A 2KYXA 3P5BP 3TX8A 4DF8A 4JI1J 4DU7A 3DN9A 1XEZA 2I38A 4FNIA 3T5HA 4FPRA 1SIZA 2MQQA 2IRYA 5IM0A 3JQMA 1JNZB 5LL6d 3H4BA 3U02A 1JK9B 3C6TA 1EP4B 1WC5A 4U96A 3QWUA 2OIHA 2ZM6F 3R2DJ 2OTLS 2HNDB 3ZZOA 3NBPA 1IKVA 2ASYA 4X2BA 2OLWA 2VFTA 2R7SA 4QIFA 3CMES 3SFUA 3MR2A 4JI3F 4C98A 3G6XA 4PKDB 2I9SA 2XMMA 3UQSA 1FK9B 1SH3A 2RKIA 4O3SA 2BX6A 4U8YA 3LUYA 2HVIA 4XPCA 1T3NA 2UU9J 4DPYA 5ETMA 3CWJA 3QT7A 1XNQJ 2CPFA 2F9DA 4Y2AA 2FJVA 4J9RA 1S97A 2HGMA 2EBGA 2E9RX 2VF3A 4RO0A 4QBUA 3RRHA 3ADAC 4H54A 2DHGA 4LFBF 5KT2A 1MG7A 4F25A 4IG0A 2P5VA 3L09A 2Q1LA 2ASDA 4DS5A 3G82B 2XO6A 1JKHA 4PCQA 3GWCA 4USHA 4OHXA 1P1TA 2AJ2A 2W9BB 4ZCIA 4MYTA 4M5JA 1W2BR 3BBBA 4X4TA 2XULA 2R7UA 3W2WB 4DUYF 2WZ1A 2C3OA 3KUHA 2HNYA 2RQMA 5BYSA 4X4OA 3CJ5A 2D3OR 1WI8A 1M1GA 2VFUA 4ECSA 4R0EA 4OX6A 2XLJA 5KT3A 1B0PA 2VC0A 2OPRA 2WK4A 3EICA 1EQ0A 4EEYA 2C2EA 3T19A 1Y5LB 1YBTA 2PFFB 1U2CA 1A6LA 3OHAA 3CCUS 3P45B 4OV6A 1HQEB 5GAEU 1Z4UA 2M9KA 2JLGA 1S4EA 2WBMA 4BC9A 2B6AA 1N36F 2RHSB 4C2MA 4YY3J 1LWEB 4OQJA 3IWXA 6FDRA 3UR0A 2AJQA 2FZGB 4DUZJ 2Y0BB 4CNYA 1C1BA 2HQIA 3H8YA 3W2VB 3V4IB 3Q89A 2CFXA 1ZM2A 1HBNB 3QT8A 2RVJA 3OBIA 1S9GB 2VH7A 5F8GA 3HJFA 3Q8RB 4EUVA 1VHIA 4PABA 3NP5A 4ZMMA 3BPSP 1T05A 3CJ3A 1HBOB 5LJ3Y 5C2GA 3MEGA 1J5OA 4RNNA 2D3UA 4FXVA 1LEOA 1V5IB 9RUBA 1H2VZ 2CZ4A 2PMWA 2AF6A 1VBKA 3IR6B 1HHQA 5K8NA 2QFIA 2ZOFA 2FUG9 3MTJA 2GAHC 3BO2A 5FJ4A 3G87A 2NXUA 3IG1B 4KPCA 2I5JA 4IYQA 4QIEA 1QAIA 2VDHA 4PR6A 1UTAA 3L3CA 4R5PB 4YHHJ 4LRDA 1SBRA 3NAIA 1Y10A 4N56A 5A6WA 3KK3A 3CJ0A 4DLGA 2XY6A 4OJ1A 1RHQB 4RU2A 3KLEB 2KFNA 1S1XB 3HSZA 2BM0A 1UL3A 4M5IA 3MPDA 5D4OA 1SL2A 5F3ZA 4HR2A 3TAQA 1JNRB 1RA6A 2YBVA 2E1PA 4WBFA 3HSGA 2BQRA 2FVSA 1Q8BA 3B82A 4ID5A 5E0OA 5KFGA 1SQEA 5JJBA 4RUCA 3QO9A 3HDSA 1KQGB 4IO1A 2KJWA 3MEDA 2OTJS 2ZC3A 5C2CA 2MJNA 4YB5A 2W8KA 1X4FA 4B3MF 1Y11A 4DR5F 1M5PC 3MM9B 1T9XA 4GO7X 1KOHA 1K47A 1N33F 2CNKB 4DL5A 2F40A 4HVZA 3ISZA 5C7PA 1KVJA 2XNRA 5D15A 4JI1F 3KLGA 1KONA 2W7PA 2BE2A 3D0HE 3THVA 3CCWA 2C3UA 2JLEA 1Q7LB 1S12A 3I31A 3LA0A 4EGLA 3M8SA 1P27B 1UWBB 2CQ4A 4EK2A 2W2OP 5CA5A 1RADB 5B0AA 2R8IA 2VL1A 1F5BA 4M5KA 5J1EA 2IBKA 4X4RA 4ED6A 5IT9U 3N6LA 2V2VA 3SMZA 1RHMB 4Y65A 2CVEA 5J2NB 3J80Y 1KLMB 1TL7A 1HL6A 1HBUB 1CULB 2FJBB 1WOOA 2WVDA 4F3OA 4HH0A 1L5UA 4ZITA 1X31C 1MLAA 4J9UE 5DLGA 2M70A 2XI3A 3HHLC 4CRJA 3PYEA 1JX4A 4TU9A 2KFZA 1YITS 2M3DA 3VVTA 2YNFA 5HP1B 2HHPA 2C22A 2WAQD 2WONB 3N9UC 2LFVA 3WX4A 1VQ7S 4DZ6A 3D7SB 3M8QA 4A46A 2ZUAA 1MN7A 1PAUB 3FVYA 3VAIA 5KFKA 4A8QA 3DRPA 2GVZB 2DCLA 5GAGI 1HD0A 2ZBCA 4P75A 5DDRC 4M5GA 5KFTA 4W4MA 3TI0A 4LF5F 2Z58B 3RU0A 3ENAA 3QYYA 1VQ9S 2EVZA 2YNGA 2C3YA 2W2PP 4F02A 2D1CA 1I5OB 2FYXA 3CSKA 3D5MA 3ZNJ1 1RLDA 3BM7A 3GG1A 4N5SA 2HWTA 4DSKA 3MMCB 3IR5B 1VRUA 1DAXA 4LRAA 4ILLA 2ZZTA 2YX4A 4EBDA 3FEXB 1G2EA 4USWA 3FZBA 1PKUA 1RISA 3ZZYA 1S5ZA 2DNYA 3TUPA 2DPIA 3QLHB 1RT3B 1LFPA 3CJRA 2QZ8A 1YJTA 2OMOA 4KGXB 2E5IA 3VZHA 2HMIB 4E2FB 1YZ7A 4F4XA 4I6AA 2QN6B 3HPOA 1U1NA 4RW9B 8ATCB 2CJKA 3FUYA 3HHLA 1ACMB 4A8XA 2ZBQA 4Q2MA 3H0PA 5J2QA 3PEHA 2DR8A 1R7IA 3MUVP 3CULA 4OX7A 2AMCB 5SZTA 1H2UX 2N7YA 2ZOMA 4ZK7M 4ZLLA 3TZXA 2YNIA 5HSPA 1SUQB 2J9EA 3NY0A 5CYMB 3C66A 1YJWS 2CPJA 1FFWB 3GONA 1GEHA 1NCLA 2GMJA 2UXDJ 4JI6J 3M2UA 1ZZNA 3CCZA 4N7TA 1Q86T 3G4SS 2HVHA 2GO9A 1CJTA 2Y9HA 3K5MA 5DZ7A 5HL7Q 3W5ZA 3ENWA 3HVTB 3ZO7A 2WVCA 2XHCA 5B7WA 1TV6B 3MAAA 2NXEA 4USVA 2DH7A 4YR3A 4M5NA 3NCPA 1V3ZA 3PV8A 1S1TA 4P2XA 3RR7A 4FNHA 2DGSA 4J9MA 1J27A 1QAXA 2DRAA 1RT4A 4ID8A 2APOA 3DXBA 2C2MB 2IPOB 4YQWA 4I6YA 1WKLA 1K1QA 1H2TZ 3HHEA 2KXNB 4OMFG 2GQCA 3HKWA 1HNIA 3BKTA 4G1QB 4DQPA 1VQKS 1WI6A 1C0TA 3FK4A 3BO4A 4NZ6A 3AJDA 1YG0A 3HX9A 2U1AA 3HD2A 4PG6A 4LJMA 2ZEJA 1WKKA 3PFEA 4NLYA 4CQ1A 4OZNA 3IBWA 1YDLA 5FDLB 3CO0P 4ES3A 5ETPA 4TXSA 1JLAB 4K2XA 2WSFC 4JBCA 3UE2A 2RQCA 3S01A 1KTQA 5IWAJ 2HS0A 2NS1B 3ICLA 3T1HJ 4KQZA 2XS7A 4X62F 2KU7A 2B51A 3AT1B 4QYZK 5SUHA 1FRXA 3MAHA 4C6AA 4EMDA 1Y5IB 4JV5J 2AGQA 5KAKA 3NS5A 3BJYA 1NPPA 1FHTA 4TQSA 4M5DB 2JOQA 3UFCX 1NLKL 1SL0A 4U67Q 2DNKA 2NSBA 5M2RA 1LNQA 3I5BA 2HHTA 3PYGA 5I3UB 2OMLA 1UFWA 2ALYB 4UY85 1WF0A 2EFGA 1OQ6A 3M8PB 1QUPA 1O51A 1XR6A 4ETXA 4ZA1A 1S49A 3WIVA 1NK7A 1K9MT 1SH2A 3CCQS 2VG7B 2DYAA 1FJGJ 3OVBA 1X4GA 2DY1A 5GAHI 3I9V9 1R89A 2YH0A 2JH3A 4OI1A 4OYIA 1OWXA 2YPYA 1D3WA 2DRDA 3CDEA 2XWYA 3E8OA 3I96A 1H74A 2FVCA 1LWFB 4NA3A 3KYLA 3CCLS 1Q8KA 1HFEL 3DKDA 3DGPA 3ZTOA 2VG5A 2LA4A 1EQMA 3A8KA 2E5HA 1XR5A 2MDAA 2BQ3A 1B7FA 3J81Y 3D28A 3OL6A 3L4BC 5L9XA 1H72C 2N4DA 4EZ6A 3KHHA 4NLUA 5DQIA 3SXLA 3M8RA 1KHVA 4K4VA 2X3DA 1VQ5S 3ZZ0A 4ECZA 5C42B 5GMKa 4EYIB 4NLVA 1F9EB 1EHWA 2EK1A 4NOHA 3J7Z5 2RUSA 4RX6A 1Z2LA 4ZVTB 3HHDA 3FCVA 2R3VA 1N52B 2IAJA 2JEIA 4DR3F 4LF8J 4IQMA 1M0SA 2ZHOA 3ZZTA 2CG4A 3JYTB 1Q79A 2OEKA 2VFVA 1RBAA 1SCJB 4A8SA 5LXRA 3TQEA 4IH7A 4ZKAA 2OPQB 3QGHA 4NCAA 5DRKA 1MU2B 2C2ZB 2RD5C 4ZVPB 4DV0J 4ZP9A 4DBQA 3PX6A 3KK1B 3BBCA 4JI4F 1VK3A 3Q8YA 2W7AA 1BGXT 1YJ9S 4RWXA 3SV3A 3D68A 3CCRS 4NE9C 4LFAF 1HNWJ 3X1LB 2QT7A 2KM8C 4JYAF 1RAOA 1EB0A 3UDVA 1JJ2R 2GNKA 1FKOB 4WWSA 4ZVFA 3D3CJ 1S77D 3PYDA 4ZS6A 3MPYA 1T9VA 3A8JA 2LECA 4ZLPA 1URRA 1OS5A 2KI2A 1TR0A 5DQHA 2Q79A 3KXDA 2X1AA 2F3JA 1CJUA 1YBAA 1OMSA 1Y3KA 1M5HA 3GV8B 3DRSA 3SCKE 3N6NA 3BR9A 1DQ9A 2FD2A 1Q4RA 3A13A 1AA1B 1S0VA 2XCAA 1SH0A 4JOUA 4ZLJA 1GQEA 1SPBP 1HWKA 2H48B 1QLNA 4A8OA 4EI2A 3G6ES 1BY9A 2DR7A 4FF3A 1RAJA 2XMWA 3C15A 1FD2A 3V6JA 1QM9A 5M2UA 4W90B 1WTBA 2BOPA 1T95A 2WOMA 4WYWA 3KOAA 2VODA 4J9SA 4XDDA 1TL1A 3CDAA 2ZZMA 4MFBB 1AZSB 3G9CA 1FA0A 4UQTA 1KR4A 4HACA 5ETLA 1Q82T 3NRBA 2OKQA 5E41A 4K8RA 5CYQA 1SJ4P 2N7CA 5E3QA 2ERRA 3W9IA 1CJKB 2HKEA 1P9QC 4K4YA 2HBRB 5H1SV 1N5YB 1WC1A 4KV8B 2EPIA 4O23A 4H4MA 1NH7A 4TU7A 2LXIA 3DOLA 4X66J 4Y2CA 4M8LA 3TX0A 2XSJB 2YVSA 5K9FA 1LW2A 5HVHA 5HBMA 2BR0A 4OZ3A 2DBBA 4JP8A 2EI5A 4JI7F 2J5AA 5KFQA 4MIAA 1VI7A 4ZVEA 2FHJA 3FBBA 3T1HF 4EO8A 5D3GA 3OV7A 1M5OC 1SKWA 1IBMJ 3EZOA 4X64J 4J9KA 4PZVA 2IM0A 1UW9A 2JRSA 4I2QA 4GKKF 3W62A 3H20A 5F8NA 5F3TA 1HI1A 2V8HA 4FYDA 3ZC4A 1KQFB 3R8YA 5HROB 4O3NA 3TYTA 2YWGA 2LVWA 4KIAA 1LV5A 2Y8WA 4NYPA 3LALA 3ZFVA 4B08A 2V9KA 4N8OA 4B9TA 3GE9A 1FDNA 2M52A 3AODA 4I67A 1NDLA 4URSA 4OX9J 1N34J 3LAMA 2YWKA 2W25A 5KFUA 1RWXB 4JV0A 2RE1A 4NXNJ 5D6GA 4NLRA 2XC9A 4LRBA 4RW4B 4F04B 1U8WA 3LH2S 4YOEA 3DC2A 1QAYA 2GVDA 3M9NB 4N41A 1WJ9A 4ZVGA 2F63A 3EJMA 2LA6A 2HFZA 3K5PA 2RUGA 2J0QD 2BMBA 3PW2A 4KHRA 4DV4J 3DFEA 3JS9A 3KK2B 4DV7F 2Z2ZA 1VC6A 2GJ2A 3L7OA 4QYRA 4WU3A 5KFJA 2HSEB 3KHGA 5IC4B 3ZTPA 2B0GA 2NXJA 3RR8A 4DQIA 2MY7A 3ILIA 5HLFA 4P6QA 2OP5A 4CO5A 1LK7A 5EX3A 3MCOA 1L3SA 2JNJA 2LLZA 2DVIA 4PUOB 2QG9B 5AE3A 3MM6B 1N5VA 4ZHRA 1QDUB 3M7VA 2C2KB 1NDKA 4M95A 2VBWA 2EC0A 2VKZG 4DSFA 3DLEB 1YQHA 2U2FA 5L46A 3AOAA 3KKFA 3U1LA 5KG5A 1VBZA 1Q81T 4F0HA 1SXLA 4UTGA 4DG1B 4DI6A 5DJBA 3OSPA 5HJXA 2ZE2A 4MIBA 2FHOB 3M1VB 2RH3A 2GIRA 4ERDA 5G4DA 5BJRA 2GGPA 3PJ9A 1LWXA 1M90T 1MMDA 3U1MA 1B0TA 2VBYA 4RW6A 3UVJA 4DV2F 4KGVB 1IR1A 3M30A 2AJ0A 1B0VA 4LBHA 4GKJJ 1RDRA 4ECVA 1V3SA 1LWCA 2YY3A 3AHPA 3HLUA 2KG0A 3BF4A 1U1RA 4IH5A 1VOMA 1NXIA 4UOCA 3NCRA 5F0UA 2HPUA 2VFSA 3PRBA 2YX1A 4P2MA 4LFCJ 4WIIA 4Q0BA 1RWMB 4ZVRB 4ZPWR 2CYYA 3G2XA 3D1HA 3SIPB 4FXDA 1FE0A 4ITSA 4DR2F 2BACA 2WCXA 2NR0A 2RDIA 1T05B 2J6TA 4GVBA 3KHRA 4NI2B 2VONA 1WC0A 2H3EB 3GYNA 3K8VA 3PW7A 1RSCA 2LU1A 2BRLA 1YK9A 3HI9A 3EUNA 1FVSA 1Y00A 2DD8S 5IV3A 1HW8A 3BDEA 4MTPA 1VLOA 2ZH8A 1F5AA 1XIQA 2CDQA 3IA0A 2P8IA 1RHRB 4DU8A 3OUYA 3NKYA 4WFZA 5L1KA 4KBIA 2DNOA 1FXRA 3FFIB 3POTB 1RWVB 1MROA 3DOKB 3QIPA 3VAHA 1EARA 1RHJB 4NA1A 1A9NB 3DHXA 3TVZA 3PRVA 2AX0A 3R5CA 2H9ZA 1JMTA 2Q66A 3R5AA 3C3LA 3I55S 1XN9A 1TZ0A 1VQSA 3J7A1 2B3TB 4P7TA 4IG3B 3GIJA 1TKXA 5CQGA 4OZLA 5GMDA 3MEDB 1FEHA 3CD7A 3AB2B 1NK8A 2AW0A 2LEBA 2ZBPA 1ZH5A 2FGCA 3SBMA 4YEAA 2MQ8A 4C48A 1J2VA 2SXLA 1FE4A 4FXWA 2IBOA 1JLEB 5FLXU 2PO4A 1VC0A 3SDEB 3TZWA 4DSEA 2OGUA 1DHMA 4AL7A 1JLBA 1VCTA 4ED5A 4X4QA 1QSYA 3JB9k 5I42B 1S0OA 5HMYA 3C2PA 2VU5A 1NAQA 4QR0A 1TFWA 4B3OA 2IYIA 2F9JA 5L1LA 1TKZA 3PZPA 1J5EJ 4ES2A 1U6FA 3K5OA 1S1UA 5CCMA 1QE1A 4DV6J 1CJVB 4HDHA 1RTJB 1AUSL 3H5UA 4UOFA 3QGGA 4NEYA 2UUBJ 4K0KF 3AOCA 4OI3A 1N34F 3FEYB 3BGRA 4FYVB 1NZ8A 4DN9A 1Z1ZA 4NXNF 2RDDA 4O4GA 2FVPA 1I3OB 3AFGA 1WEXA 2G4BA 3BKUA 2XS2A 2UXCF 3THTA 4LBPA 2VB6A 2LQ8A 3O1LA 4ZJQA 2QO3A 2DY9A 3PJWA 5K8PA 4C8LA 1YJNS 4OZ0A 3FMWA 4DV4F 3CJKA 4YDDB 3DHWC 2J9DE 4MK8A 3SQOP 3LPYA 3CO9A 1XERA 2BABA 1OO0B 3EDRB 5DGAA 5HQLA 4USTA 5GMEA 3CCSS 4NA2A 4NYZA 1N4LA 1HHTP 3IRXB 4DCPB 3C16B 1AFIA 3V81A 4YUDA 3WX8A 3OLBA 5GAGU 1C2PA 2VC1A 3IO1A 2YNHA 2LXFA 2A2DA 4O3OA 3H4DA 4Z7YA 5E5NA 5DG7A 3BDPA 1L3UA 1RAGB 3EVWA 2MLXA 1EX8A 4LF1A 4F2RA 3DRRA 4R8UA 3CJQA 3MMBB 5IT9Y 2G1HA 5C24A 1G4CA 5A8WB 2ZH5A 1NDPA 2R4FA 1UJ5A 4CYUB 4EFAC 3GCXP 1RCOB 9ATCB 1IUJA 1QJHA 4I68A 4FYWB 1HYSA 1O8BA 4UT4A 4DFKA 1LK5A 3TAPA 3TOQA 3NLCA 2L41A 5ETQA 3EM1A 1LOUA 5KT7A 1ZPWX 5C25A 2VG6A 2Z2MA 4AQYF 5J2QB 1X4CA 3K57A 3CEDA 3LP0A 1FRMA 4DJBA 2V4JA 2QLFB 2XS5A 4C11B 3LPEA 5HANA 2DGUA 2YNIB 3DDKA 3BGLA 4LIRA 4U7CA 3ETMA 2WSEC 3FC9A 4ZCMA 2XLIA 4O44B 2IMWP 3MM7A 2MLZA 4JI2F 3MZIA 2C2RA 2P6SA 4Y34A 2AIRB 2M8HA 4ETZA 4I7FB 1EKRA 2C2OB 1HI0P 4CLTA 2FTRA 1N5SA 3K59A 3BYRA 1YJRA 1E6VB 1UVNA 4CT8A 3HMJG 4HT7A 4RW7B 1AROP 3OTOJ 2LYVA 3DRYA 3FGVA 2CPIA 2VBXA 1KFDA 4H4KC 4U6PA 5K8MA 4NRTA 3PW5A 4CLUA 1KQSR 2KB2A 3OTDA 1JXVA 5EWGA 4DR4J 4CWBA 1WF2A 1N0VC 2KH9A 1HMVB 2W4CA 3W1YC 1GXLA 5B0FA 3VQTA 4KJIA 1VQOS 2VIHA 1L3VA 2R7WA 4QU7A 1S0NA 2LEPA 2P6TA 4QR1A 5H9FJ 5KOXA 4ER8A 4DV5F 4FBUA 1Q1KA 4BLGA 3NAHA 1V9OA 4DL0C 3M2VB 2HFOA 1LW0A 4NLTA 2VJVA 5KT4A 4BS2A 1JLGB 5HVGA 4G1PA 2IYGA 3CE8A 1PILA 8AT1B 5L1JA 3KJVB 1IR2A 2HNZB 1S79A 1S1WA 2ALZA 4NLGA 2XZTB 3R5DA 4YN3B 5KFCA 4KY3A 4KHPJ 1RTDB 3JTPA 3MM5A 3UW1A 2KN4A 3VZIA 1R8HA 4QQBA 4USMA 2NZ4A 3B4DA 2H5EA 3FNNA 1RCXB 4ZVOB 3D6MB 3PM9A 5EDWA 3H59A 4C7QA 2I2YA 1GFWB 1VQMS 4L72B 4U8VA 3WZ0A 5I4MA 2PA8D 3DCAA 1K8AT 2V34A 4WZQA 2PMHA 1VQNS 3M2RB 4WFNQ 2YWEA 5F9LA 1DY3A 3R1LA 1MSWD 2CQGA 3PRDA 2FDNA 5A2QU 5F8IA 1ZPVA 1FKPA 1S6QB 2ZH6A 3KLHA 2AT1B 3MMAA 4H4KA 5CHCB 3RAXA 4DHVA 3JSBA 4RNOA 2LXUA 3QWPA 3I56S 4WE1A 2GA7A 3MOJB 3NXZA 2UUBF 3BN7A 1KNZA 4Y00A 2VOPA 1BD6A 2VUGA 3FSYA 1NM2A 3AD7C 1HI8A 1B70B 4H4OA 2MGZB 2DGOA 4DSIA 5AXMA 4OJGA 2E5GA 1RAHB 2A3JA 2VG5B 1F5CA 3I0SA 3MCSA 1TL5A 3PVXA 1XTZA 3UDEA 4FN5A 1UEUA 5GAHU 1FNXH 2H54B 1GMUA 5F41A 1SKRA 3QZ7A 3DYAB 2RU9A 2LQBA 5HO4A 2I6WA 1RAEB 2RHQB 4MKVA 3IRWP 3M9OB 4ZDNA 1HPZA 3T5JA 1UA0A 2G0CA 3RRKA 3HHKA 4MKAA 2XZWA 1FCAA 2FHKA 3EE3A 2ZDOA 5B09A 4F0KA 2W9CA 4IOCQ 2LCWA 1RTIB 2M4MA 1RHKB 3H2UB 2ZC4A 2GAGC 4NLOA 4J90A 3SQGB 2F1FA 4ZPBA 5L9NA 3CMAS 1HLWA 2H51B 1RT2B 4ECTA 1OPZA 3W9HA 3GJSB 4EYHB 4IDKA 4B17A 1OSCA 2HFVA 1U2RA 2MKYA 2EWHA 4KKOA 4F3MA 3D1QA 2RF2B 3MEEA 3PHTA 2YKNB 3BEGB 2HZCA 1Y7PA 3BPDA 4AE5A 1BQNA 2V8DA 4CH1A 1AYEA 2F4VJ 4F8RA 4JI8J 2R7TA 4IFYA 1JLQA 4UUXA 2WSCC 4K50A 3GIRA 2P2CB 4ZVHA 2V50A 2DO0A 5CYJA 2LP4A 2X3GA 4PG8A 2OPSB 4K5RA 1DFDA 1NHUA 4NWBA 2VJUA 3RG6A 2ZKUA 2CPYA 1D8ZA 2ZD1A 1BQMB 1FXLA 3W8PA 3MM8A 3GTYX 4L74A 1V3RA 3RBDA 4LQ3A 1Y5NB 3OXGA 3ULHA 3DI6A 2K1RA 1H7XA 1BE4A 3T9NA 4C8YA 2L48A 4IOBA 1UJ6A 1D1UA 2DIVA 5EUHA 4USKA 1CJUB 1DLOB 1FRIA 1FVQA 1RT7A 1B64A 4QYZJ 3SYZA 1T02A 4WKRA 5K14A 4ANEA 1HBMA 1HR0F 2ZBIA 3UCGA 2I8EA 2E9ZA 2MKJA 1VQPS 2CQCA 4ZPAA 1IWAA 5M2PA 3G8QA 4CLFA 2ZWOA 4FPIA 4TN2A 3QNWB 1MMNA 3PYFA 2DT9A 4W98A 5IXUA 5A8RA 4ANDA 5J2MA 3TR5A 4LSZB 2A18A 4WFBQ 4QIVA 1HIYA 5D8HB 3EPIA 1SB6A 4OV1A 5B0BA 1IN0A 5CD4H 2V68A 2QTWA 1E6YA 2NLWA 2JJ4D 2G0JA 2WOMB 1SJFA 1KRPA 3CTRA 4LSLB 4YDXA 4DPUA 2DH9A 4HACB 2HIYA 1T9TA 4KE5A 2L08A 2DNQA 2ROEA 1VRTB 4RZRA 4DX5A 3VGVA 1T9UA 2LQ5A 4G1IA 5ETTA 1KVIA 3ZTSA 3MWBA 5DM6Q 1TKTA 1Q0NA 2OPPA 3CIMA 2EFQA 4XIUA 4XTTA 2M5YA 4A8MP 1WELA 4C3LA 1FDDA 4X65J 3BH6B 2JLFA 4CH7A 2RSQA 3F44A 4NRUA 4CZCA 2PGCA 3KHLA 2VPWB 4OYPA 3AA9A 2E66A 4DS4A 3IP0A 4IR9A 4DV3F 3MECB 2GMHA 2F4FA 1MNEA 2QC3A 4CO3A 3TA1A 1WC3A 2IRXA 4ICLA 4I6WA 4PQUB 2KXHA 3IBCB 1RT1A 2XMKA 1RBOB 2B8PA 3N28A 1S1VB 2ROGA 2AWZA 5J2PA 1DTTA 4RBUA 4U7UK 3LAKA 2IDEA 4AL5A 2DGQA 3V5RA 4OYXA 2XI2A 3AQOA 5KG1A 5IS2A 3Q8QB 2MSSA 4WCEQ 1RT6B 1N32F 5D0GA 4YB6A 2FZCB 2R2TA 1EP4A 4LF7F 2M2BA 2QL9B 2CRLA 1D9AA 2FC9A 3M8WA 1OIAA 3R1HA 2HNDA 2CPEA 4CLLA 4I2PB 4O3PA 1URNA 3U27A 2B7CB 3W3SA 4A4JA 2PT0A 2JFDA 5ETKA 4J9NA 2A0FB 1IJFB 3KWMA 1EIYB 4NZ0A 4J9PA 2LU2A 5LSRA 1FK9A 2BJDA 3RJMB 2MQNA 1FI4A 2HFSA 2BJ9A 4C0OC 2CQIA 4K59A 1SQFA 4D3GA 4NMXA 3AXMA 4FF2A 2EBEA 4WYLA 2HHHF 3ISNC 2EFOA 2Y1LB 4NEZA 1XR7A 5KFXA 5HMWA 4DFMA 1T03B 4OX8A 4KB7A 1HARA 5LSOA 2R2SA 3G82A 2AGPA 3PJXA 4TKTA 2W9BA 2E29A 1PBUA 3W2WA 2B9YA 2CG8A 4KPYA 2A6MA 2UUTA 4CNZA 3PY8A 3C14B 3PNIA 2KJVA 3H2VE 2KHDA 1S7IA 2K3KA 3UO0A 3C6UA 3QSIA 3LP1B 3M6WA 1BLUA 3KG0A
chains in the Genus database with same CATH topology
1NDPA 1F3FA 3GP9A 2DY9A 4FKXA 3FBEA 3ZTPA 1XIQA 3NGTA 3Q83A 4WBFA 3EICA 2BX6A 4W98A 1EHWA 2B8PA 4ANDA 1B99A 4ENOA 1F6TA 1S57A 4DUTA 1NSQA 2DYAA 3ZTRA 4F4AA 1NCLA 5CABA 1NSKL 1WKKA 1HIYA 3B54A 3EM1A 1JXVA 1NSPA 2CWKA 1LEOA 2VU5A 1KDNA 3FCVA 5CAAA 4S0MA 1MN9A 3EVMA 3DDIA 2HURA 3VVTA 3PRVA 1HHQA 2B8QA 4CP5A 1NDLA 3NGRA 5BXIA 3NGUA 1PKUA 1NPKA 1BHNA 3FBCA 1S5ZA 3L7UA 2DXDA 3EE3A 1NHKL 3G2XA 2AZ3A 1WKJA 3ZTQA 3WX8A 1ZS6A 3BBFA 5IOLA 2AZ1A 4UOFA 1VYAA 4KPCA 1NDKA 4DZ6A 4UOGA 3FBFA 3FCWA 2ZUAA 3DKDA 1MN7A 3ETMA 3GPAA 4UOHA 3FC9A 3ZTOA 3BH7B 3EMTA 3R9LA 4F36A 5C7PA 4O0NA 1BE4A 3VGVA 1U8WA 4ANCA 2DXEA 3Q8VA 1BUXA 3ZTSA 2HVDA 3FBBA 2HVEA 2NCKL 4FKYA 3VGTA 3VVUA 3EVOA 1HLWA 1XQIA 3BBBA 1W7WA 4C6AA 3EJMA 3ENAA 3VGSA 3Q86A 3BBCA 1NUEA 1PAEX 1NB2A 3EVWA 3FKBA 3BH6B 4DI6A 1NDCA 4EK2A 1WKLA 3Q8YA 3NGSA 2DXFA 1K44A 3Q89A 3MPDA 2BEFA 3JS9A 3VGUA 3Q8UA 4ANEA 1B4SA 1S59A 1UCNA 3ELHA 4HR2A 1NLKL 3PJ9A 1LWXA 3B6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDP A;  1F3F A;  3GP9 A;  2DY9 A;  4FKX A;  3FBE A;  3ZTP A;  1XIQ A;  3NGT A;  3Q83 A;  4WBF A;  3EIC A;  2BX6 A;  4W98 A;  1EHW A;  2B8P A;  4AND A;  1B99 A;  4ENO A;  1F6T A;  1S57 A;  4DUT A;  1NSQ A;  2DYA A;  3ZTR A;  4F4A A;  1NCL A;  5CAB A;  1NSK L;  1WKK A;  1HIY A;  3B54 A;  3EM1 A;  1JXV A;  1NSP A;  2CWK A;  1LEO A;  2VU5 A;  1KDN A;  3FCV A;  5CAA A;  4S0M A;  1MN9 A;  3EVM A;  3DDI A;  2HUR A;  3VVT A;  3PRV A;  1HHQ A;  2B8Q A;  4CP5 A;  1NDL A;  3NGR A;  5BXI A;  3NGU A;  1PKU A;  1NPK A;  1BHN A;  3FBC A;  1S5Z A;  3L7U A;  2DXD A;  3EE3 A;  1NHK L;  3G2X A;  2AZ3 A;  1WKJ A;  3ZTQ A;  3WX8 A;  1ZS6 A;  3BBF A;  5IOL A;  2AZ1 A;  4UOF A;  1VYA A;  4KPC A;  1NDK A;  4DZ6 A;  4UOG A;  3FBF A;  3FCW A;  2ZUA A;  3DKD A;  1MN7 A;  3ETM A;  3GPA A;  4UOH A;  3FC9 A;  3ZTO A;  3BH7 B;  3EMT A;  3R9L A;  4F36 A;  5C7P A;  4O0N A;  1BE4 A;  3VGV A;  1U8W A;  4ANC A;  2DXE A;  3Q8V A;  1BUX A;  3ZTS A;  2HVD A;  3FBB A;  2HVE A;  2NCK L;  4FKY A;  3VGT A;  3VVU A;  3EVO A;  1HLW A;  1XQI A;  3BBB A;  1W7W A;  4C6A A;  3EJM A;  3ENA A;  3VGS A;  3Q86 A;  3BBC A;  1NUE A;  1PAE X;  1NB2 A;  3EVW A;  3FKB A;  3BH6 B;  4DI6 A;  1NDC A;  4EK2 A;  1WKL A;  3Q8Y A;  3NGS A;  2DXF A;  1K44 A;  3Q89 A;  3MPD A;  2BEF A;  3JS9 A;  3VGU A;  3Q8U A;  4ANE A;  1B4S A;  1S59 A;  1UCN A;  3ELH A;  4HR2 A;  1NLK L;  3PJ9 A;  1LWX A;  3B6B A; 
#chains in the Genus database with same CATH topology
 4W92 B;  4DR6 J;  3GP9 A;  5KTQ A;  2ABY A;  3DLK B;  2YKM B;  2B4V A;  2R8J A;  4F4K A;  1T0T V;  3HD1 A;  3LO3 A;  2H5J B;  3Q0A A;  4OHZ A;  3D6H B;  1RQ0 A;  2DHA A;  4J9Q A;  2MHN A;  4CM0 A;  2CNO B;  3IAS 9;  4NCG B;  4MKY A;  1RLC L;  2O66 A;  5A0Y B;  5CAB A;  2F4V F;  1HQE A;  1RHU B;  2EG1 A;  1REV B;  2E44 A;  4V19 J;  1R8A A;  3LWL A;  1ICE B;  5B0C A;  2Y1I A;  2GFF A;  3GQC A;  2V4Q A;  4BWM A;  4FF4 A;  2YQ0 A;  1LWE A;  3RBX A;  1NEE A;  5L39 A;  2HW3 A;  2V5H G;  1S7H A;  3PTW A;  3TEG A;  3NS7 B;  1JLC B;  3ITH B;  1MWQ A;  3PAC A;  1NPR A;  5HQ8 A;  2K8G A;  2G2Z A;  3W2V A;  3V4I A;  1JWW A;  3DLH A;  1HBN A;  3KLF B;  2XYG B;  3CJS A;  2V8G A;  3G6Y A;  1S9G A;  4KFB B;  4O4R A;  1Q8I A;  2MST A;  3BSA A;  4XPE A;  5LM7 E;  4MAK A;  4OJ3 A;  5F8H A;  3M32 B;  2M7S A;  5DQG A;  3F56 A;  2CAD A;  2ILY A;  4OIX A;  4FKX A;  1HBO A;  2HBY B;  1WSR A;  2W1B A;  3H90 A;  5HMZ A;  3BKF A;  3BV8 A;  2J8S A;  4RBT A;  3HJV A;  2HBZ B;  4MH8 A;  1TFY A;  4N47 A;  1H3D A;  1ZAX A;  2KVI A;  2ASL A;  3IG1 A;  4A47 A;  2UVV A;  4RNF A;  3FDS A;  1K0T A;  1YGY A;  4DL4 A;  4R5P A;  4L73 A;  4DR1 J;  1S76 D;  4UOG A;  4ED4 A;  1WEZ A;  3IM9 A;  4WTO B;  3JQK A;  4C8Z A;  3KLE A;  1Y3J A;  1S1X A;  1UVI A;  4BC7 A;  3VGT A;  4UZC A;  2X1B A;  4QW8 A;  1HWI A;  2YWW A;  3W7B A;  5AE2 A;  3QT6 A;  5KG7 A;  4ED7 A;  1R8P A;  4IKA A;  4DPO A;  4QWB A;  2VAS A;  3VAJ A;  3GU0 A;  3GLJ A;  5D0H A;  3CPW R;  3W61 A;  1ZYQ A;  3EGN A;  4XAK A;  4WPA A;  1IQZ A;  5KFD A;  2KG1 A;  3PHE A;  3RGI A;  2X1F A;  3CB4 A;  2Q6B A;  5THW A;  1MML A;  4BHQ A;  4HYK A;  5BR8 J;  3FSI A;  1SJR A;  1B7Y B;  5JXS A;  3E3X A;  2PI4 A;  1VMB A;  4RJV A;  1S57 A;  4X4P A;  2E5J A;  2HYI B;  1SV5 B;  3JAM Y;  3HM9 A;  1KLN A;  4F2S A;  2IM2 A;  3DM2 B;  3MM9 A;  1UWA A;  3CC2 S;  3PW4 A;  2ZWP A;  3V6D B;  3THP A;  2XTJ P;  1JXL A;  1CQM A;  3P4U B;  3I87 A;  3MGJ A;  3QT5 A;  1ZA2 B;  1IBL F;  3PR5 B;  2ATC B;  1Q16 B;  2PE8 A;  2EFN A;  1RU1 A;  3FMB A;  4Q43 A;  3D3B J;  2UUC F;  2OFH X;  3AOB A;  3QSY B;  4FYY B;  3T1Y F;  5KT6 A;  2JWN A;  3JSM B;  1QTN B;  1UWB A;  2HVD A;  1UVK A;  2DRB A;  4KGM A;  4FF1 A;  3GFZ A;  4FDF A;  4IR1 A;  4RW8 B;  1FFS B;  5AJ3 J;  5DG9 A;  1DJ0 A;  1U4B A;  3TZZ A;  2ROP A;  2KYZ A;  1IQT A;  1S1U B;  2ZOG A;  3D9B A;  3K17 A;  2QLJ B;  5J2N A;  2Q43 A;  1KLM A;  3DLG A;  1HBU A;  1CUL A;  4KO0 B;  1A0O B;  4DSL A;  2PN6 A;  3CDW A;  5BYQ A;  1Y4Z B;  3RB4 A;  2A1B A;  2Y1J A;  1G7C B;  1VQY A;  4JI0 J;  2RRN A;  4P73 A;  3UNG C;  1NJI T;  1NSQ A;  2FY8 A;  5HP1 A;  1NK5 A;  1QSS A;  4WXW A;  2WON A;  4IFV A;  2NRE A;  1IKX B;  4B3R F;  3WQP A;  5LMU F;  2BJ1 A;  2D3Z A;  4ZLN A;  2HUR A;  5F9N A;  4DPX A;  2XYP B;  4TY8 B;  2D74 B;  5KFW A;  3M6V A;  2GVZ A;  1XWL A;  3NMA A;  3ET6 B;  2DO4 A;  1XMO F;  4GC6 A;  2YKQ A;  2V8V A;  2E9T A;  3LQV A;  1VDH A;  3B78 A;  4QJV A;  3G6V A;  3UN5 A;  1R3N A;  3CMQ A;  4DL2 A;  3C19 A;  5FLX Y;  2AJ4 A;  4F4W A;  4MIW A;  2V0N A;  1NO8 A;  3UPF A;  4OYO A;  2FZK B;  2UV8 A;  1YRX A;  2HHU A;  3HFK A;  5B0D A;  7FD1 A;  4UUW A;  3MMC A;  3A8I A;  1HNX F;  5F0W A;  4DR6 F;  3NGK A;  1NK4 A;  3KDN A;  1RK8 A;  1X5O A;  3S7R A;  1NSK L;  2AV5 A;  3IC1 A;  5D0R A;  2D69 A;  1IM4 A;  2BAN B;  3D1O A;  2OH2 A;  3DNC A;  1UZH A;  2K3I A;  1VLY A;  3QLH A;  1X4E A;  4NLX A;  5U47 A;  3W63 A;  1RT3 A;  3DDI A;  4LVO P;  4PPD A;  1PJ6 A;  1RYR A;  4OYM A;  2HMI A;  2PSZ A;  3VAM A;  5DDQ C;  2BJ8 A;  4ATN A;  4OZ5 A;  1K73 T;  3OL7 A;  4RW9 A;  2IIH A;  2VPY B;  1U7L A;  4GVL A;  4CTA B;  2KVQ E;  2YQ3 A;  1OQ3 A;  2MZT A;  2YKO A;  1IXK A;  5A8K B;  4WF9 Q;  2W7O A;  2DHX A;  3HHL D;  1TVR B;  3MF5 A;  4ZPT R;  3HZE A;  1NB2 A;  4Y3C A;  5LSL A;  1GMW A;  2QIF A;  3UI3 A;  3K2Y A;  2D9P A;  1SC1 B;  1PBA A;  1ZET A;  1SUQ A;  5CYM A;  5H9F K;  3J7Y I;  4Y0F A;  2R42 A;  2HQC A;  4B9L A;  4P71 A;  3SFG A;  1YWX A;  2UU9 F;  5T7L B;  2GV1 A;  4DEZ A;  2H1Y A;  1XNQ F;  2BE9 B;  3D54 A;  4JB8 B;  1RKJ A;  3DOM B;  5KFH A;  3CCM S;  3P6Y C;  5DG8 A;  3SSR A;  3HVT A;  2R8H A;  1TV6 A;  3F73 A;  1WOS A;  1NKC A;  3QRP A;  5KFP A;  3R5B A;  3KUG A;  3H5X A;  5DO2 A;  1HWU A;  3UNY A;  3LP2 A;  4I0W A;  1Q7Y T;  2VA3 A;  3MCM A;  1EET B;  3OR1 B;  4C8M A;  2NXC A;  1W26 A;  1YJV A;  3HVA A;  1DUR A;  1GX5 A;  4G1Q A;  4P9S A;  1MW7 A;  3O8W A;  1IJE B;  1V5V A;  1O0P A;  3H40 A;  4LF6 J;  2ADB A;  2LMI A;  4NLQ A;  2C1E B;  3PR4 A;  3JSY A;  3HXM A;  4K4T A;  1KKH A;  5HAT A;  2DR5 A;  2B9X A;  1VFJ A;  4DR7 J;  1JJH A;  2RS2 A;  4L3K A;  5FDL A;  1S1W B;  2Y1R I;  1WDT A;  1KVK A;  1JLA A;  5D4L A;  5ETR A;  4E98 A;  4B9V A;  1UVM A;  2FJA B;  2HQF A;  4ES1 A;  1RT5 B;  3HHN B;  4IQX A;  1JQG A;  3O6Q A;  2XMA A;  2J0S D;  2R7V A;  3CJ8 A;  4XK8 C;  4ECU A;  3KLI B;  3GIK A;  3P5T L;  3HVW A;  3K8W A;  4LF4 J;  1APS A;  3BYP A;  3CCV S;  4YY3 F;  3WIU A;  3CDU A;  1CS4 B;  1EKS A;  3KG1 A;  2J7U A;  2ZKT A;  3R9L A;  4A48 A;  2JEJ A;  4DUZ F;  4P52 A;  2PC6 A;  1UAW A;  3K5N A;  3VV2 B;  1W7W A;  4X4N A;  2BVZ A;  1NRK A;  2NSC A;  4M5D A;  4Y2M A;  2KFY A;  5JMN A;  2CJB A;  2NZC A;  3A3P B;  3BN4 A;  4LF9 J;  2PMZ D;  2ZM6 J;  5I3U A;  3RAM A;  3M8P A;  3IWN C;  3I5C A;  4UQG A;  3CF5 Q;  2L9W A;  1N88 A;  1XMQ J;  2OSR A;  3Q83 A;  5EN1 A;  2MKI A;  4Y2K A;  3O2I A;  2VG7 A;  4JI3 J;  1Q8L A;  1RZM A;  2DHH A;  2XBP A;  5AXK A;  1ZM9 A;  3F0N A;  1LWF A;  4LQ9 A;  1TTH B;  5KG3 A;  3PDN A;  1X0F A;  1X4D A;  1S6P B;  1TK0 A;  4RUB A;  3MXH P;  3MI7 X;  4ZPD A;  2B5J B;  2IMO A;  3L9Z A;  2KXF A;  3RAQ A;  4YHH F;  2HRT A;  2V69 A;  1C4C A;  2XMJ A;  3H5S A;  1UZD A;  1F2G A;  5FD1 A;  3TAN A;  2RAQ A;  2B43 A;  2DNL A;  1PYO B;  4Y6I A;  3W65 A;  1XC9 A;  2VHG A;  1FJE B;  4C3K A;  5K20 B;  3CUN A;  4LSN B;  5G0R B;  1NDC A;  1U0H B;  4ED1 A;  5HMX A;  2JHE A;  5C42 A;  4MYU A;  3TZY A;  1VQL S;  2RQK A;  1NJZ A;  4PYD A;  2HAF A;  2H5I B;  1WC6 A;  2CPD A;  2DGX A;  2DKO B;  2CIM A;  3D67 A;  5HI7 A;  4DWI A;  2BV3 A;  1W25 A;  3KNA A;  1P1L A;  1HQU B;  3K7R A;  3I4H X;  1WSV A;  2FHM A;  3B8H A;  1FWP A;  2VDI A;  3TA0 A;  4ZN1 A;  3HUL A;  2ZH2 A;  1S0M A;  4WFA Q;  5IFM A;  1YBU A;  5KFL A;  2FQQ B;  3JYT A;  5A2Q Y;  3A3N B;  3UD4 P;  2W2Q P;  1T3O A;  5DM7 Q;  4KGZ B;  1X5P A;  2OPQ A;  5L1I A;  3VAG A;  1AT1 B;  1MU2 A;  1UPM B;  4OZ2 A;  1VJQ A;  4NZ7 A;  3ZZZ A;  3KK1 A;  4O0N A;  4K4Z A;  1N36 J;  4QWA A;  1BUX A;  2BA9 A;  4NCB A;  2OSQ A;  3UCU P;  1F2H A;  4ED3 A;  4ZCK A;  1DQA A;  2E1R A;  1D9D A;  3M8Y A;  3OLA A;  1KEK A;  1G1X A;  2WHO A;  1X4B A;  2BEF A;  3RUB L;  2A2C A;  1HKA A;  1RWO B;  4OHW A;  3G8S A;  3I9Z A;  1U6B A;  1C0U B;  1FKO A;  2XHW A;  4CH0 S;  1RWN B;  3UN3 A;  4FS1 A;  4V1A k;  2E5L J;  1IBC B;  4FYX B;  1YTY A;  5FII A;  1QAJ A;  5KFB A;  2HK3 A;  4B02 A;  1RI7 A;  4NL5 A;  3CW2 C;  2AJ1 A;  3IS9 B;  2UVU A;  2L9N A;  2XO7 A;  1T94 A;  1FKA F;  4IRC A;  3DMJ B;  3MOZ A;  4K5S A;  2LDY A;  1WKJ A;  4F0M A;  3PW0 A;  3R27 A;  2RJZ A;  3ZXW A;  2ASJ A;  4FVC A;  5E3A A;  1VQ4 S;  3UR3 C;  2JX2 A;  5AE1 A;  4HHU A;  1FWL A;  1RA7 A;  2HFU A;  1CLF A;  5EX0 A;  4DL6 A;  1I6J A;  1N0U A;  1UPP A;  1I51 B;  2Z30 B;  2V94 A;  3NGS A;  4MFB A;  2CQ2 A;  1AZS A;  3W64 A;  2HLT A;  1R6Y A;  3VGU A;  4QOT A;  3RB6 A;  1X4A A;  2MZJ A;  4BBY A;  5LJ5 Y;  4EO6 A;  1WUU A;  4HHH A;  1K0V A;  3HO1 A;  2ZDP A;  1PGZ A;  1Y9O A;  2IC3 B;  2MPU A;  1ZBT A;  4LF6 F;  1CJK A;  1JLF B;  1ITP A;  2MJU A;  3OTE A;  1N5Y A;  3BQ0 A;  4KV8 A;  2XCP A;  2CQP A;  2CZ9 A;  2EK6 A;  1DTQ A;  3EPG A;  2XSJ A;  3US5 A;  2CPX A;  2GW8 A;  4FVM A;  5KFS A;  2HWI A;  2PII A;  1FD8 A;  4ZJO A;  2LKZ A;  3BBF A;  1JB0 C;  2HBQ B;  4WXO A;  4EBC A;  1RT1 B;  2XLK A;  1I1G A;  1WG5 A;  1X9S A;  1N33 J;  1FX4 A;  2FHJ D;  1RTH B;  1CG2 A;  2DXE A;  2EKN A;  2DGT A;  3E01 A;  2HIQ A;  5EWE A;  3Q86 A;  2MZR A;  1NUE A;  3FKB A;  2ZVS A;  4ZP6 A;  1KFS A;  2HRY A;  5KG2 A;  4ECQ A;  4L76 A;  2BXJ A;  3ZNU A;  3OFG A;  1IKY B;  1SC6 A;  4ZP7 A;  2ZH1 A;  2FLP A;  2QMW A;  5HRO A;  3D66 A;  4LF9 F;  4P10 A;  1Y0H A;  1AFJ A;  2ZIT A;  3N4W A;  2ATL A;  2V4R A;  1U1O A;  1XMQ F;  1X9M A;  5E33 A;  2UXD F;  3TAM B;  2QA4 S;  4JI6 F;  1NND A;  3E2E A;  3C8Y A;  4OFZ A;  2VQF J;  1WF1 A;  3JTN A;  2LEA A;  3W9J A;  5AT1 B;  2B56 A;  4RW4 A;  2C28 A;  3J7Z T;  2AZ3 A;  4TYB A;  3IAM 9;  3OVA A;  4JV2 A;  3TUI C;  3V2U C;  1VQ8 S;  1YJ7 A;  2GZO A;  2E7X A;  4KSE B;  3OFE A;  4M63 A;  3I0R B;  1HNV B;  3T6B A;  4DCJ B;  1FX2 A;  4B9S A;  3ENV A;  2KO1 A;  4M5L A;  4HT5 A;  4J9L A;  4ECY A;  5K5M A;  2OD6 A;  3KK2 A;  4TU8 A;  2B9E A;  2HHV A;  2WBR A;  1SC3 B;  4LF5 J;  3EGV A;  4BCA A;  4ELT A;  4PWD A;  3NWR A;  3K0J A;  1N54 B;  1F3F A;  4JUZ A;  5F8L A;  2NPI A;  2K7K A;  1RWK B;  1VS3 A;  5KFY A;  3PFO A;  3CJ2 A;  2N3O A;  2VBZ A;  1ELO A;  4ZIV A;  4TNO A;  5KFM A;  3OPK A;  4HKQ A;  4DUT A;  4PUO A;  2ILZ A;  2QLX A;  4RKU C;  1NJY A;  3C6U B;  5KT5 A;  3MM6 A;  4OI6 A;  4D3H A;  2HS3 A;  4U9R A;  1C1C B;  4Q8F A;  1S9E B;  1HQ2 A;  2OUG A;  2B8Q A;  5IWA F;  3KMQ A;  2OHD A;  3H7H B;  2QRR A;  2XQC A;  3DLE A;  1FDA A;  3TAR A;  1VQ6 S;  1R6V A;  1U0S A;  4I64 A;  4E0D A;  3TO8 A;  4TQR A;  4F36 A;  1UMJ A;  3FEZ A;  4DG1 A;  2E1A A;  3GV5 B;  3KFW X;  4JV5 F;  2HVE A;  3VVU A;  1U49 A;  4K4U A;  2Q3P A;  3CJT A;  4OLP A;  3M1V A;  3CD5 A;  5IM0 B;  4Q2L A;  2D7S A;  1PIE A;  3DLL Q;  3C6T B;  4LF2 A;  3GV7 B;  2P9G A;  1HW9 A;  4ELV A;  1QVG R;  4NML A;  2ZHA A;  4OZ1 A;  4WKY A;  3B6B A;  4I4B A;  4B9N A;  3NBP B;  1IKV B;  3DDN A;  1C4A A;  3TEH B;  1ZAV A;  1UFL A;  2GJF A;  3OD2 A;  1R0C B;  1UEK A;  3KG4 A;  1FJG F;  5H9E J;  4IOA Q;  3QAT A;  3SCI E;  3HK2 A;  4Q5V A;  3EX7 B;  2RKI B;  2E5L F;  2W01 A;  2J0W A;  1WG1 A;  3CD6 S;  2F7V A;  1RGV A;  2R7Q A;  2B4U A;  4FZV A;  1UFK A;  2DXD A;  4NI2 A;  2F8E X;  4DL3 A;  1TP7 A;  6FD1 A;  4I69 A;  2XMV A;  2DJW A;  4OI4 A;  1Q95 G;  2AGO A;  1NJW A;  4Q45 A;  3UD3 P;  3EYZ A;  3X3U A;  4HTI A;  4IG0 B;  3NNC A;  3GIM A;  2NCK L;  1AW0 A;  3H98 A;  1CVJ A;  1RU2 A;  4CDI A;  3HP6 A;  4WP9 A;  1PO6 A;  1JKH B;  3MDF A;  2XGP A;  2B4P A;  1NH8 A;  2BZ2 A;  3PXG a;  2QE5 A;  1HD1 A;  5GAD I;  2RQ4 A;  5HVF A;  1H6K X;  4FP9 A;  2BUN A;  2HNY B;  4KYZ A;  5B0E A;  1AUD A;  2EC2 A;  3KMS A;  1YIJ S;  3FFI A;  3M4X A;  3POT A;  2HFN A;  3AB4 B;  3DOK A;  4B9M A;  4NXM J;  4PG5 A;  1TEL A;  3VAF A;  1F9F A;  3BSN A;  1FNO A;  3WC2 A;  3HSJ A;  2FGO A;  2OPR B;  1GK8 A;  1KDN A;  4LF8 F;  1H0H B;  1P8G A;  2A10 A;  2CPH A;  1RWU A;  4N8N A;  3ETO A;  1UKU A;  4IG3 A;  2JVO A;  3A1Y G;  3ZTQ A;  4IRK A;  1SC4 B;  1TUV A;  3D0I E;  1FFG B;  2H65 B;  2J9C A;  2DH8 A;  1VBX A;  3H42 A;  4DV0 F;  4ANC A;  3Q8V A;  3LW5 C;  1SVD A;  4X62 J;  3VF0 B;  1HWJ A;  2B6A B;  2FLL A;  4P74 A;  2ZH4 A;  4B3T J;  1SJ1 A;  5AXN A;  3DLJ A;  2FPH X;  3ONQ A;  1JLE A;  4EBE A;  1TK8 A;  1F60 B;  3M8Z A;  2CZV C;  2G2Y A;  3QFH A;  1ZTT A;  1HNW F;  1U47 A;  3SDE A;  1VBY A;  3R7B B;  1C1B B;  5E2Q A;  4MKB A;  3FBE A;  1XK8 A;  2W4P A;  1CQN A;  1UVJ A;  2G0I A;  3JAM U;  3NG8 A;  1VGY A;  3GR0 A;  3AA8 A;  5I42 A;  3MFI A;  2WB4 A;  4Y28 C;  3ILJ A;  3GYG A;  3AY0 A;  3ZTR A;  4NLD A;  3AQP A;  3IGN A;  1LFW A;  2W4D A;  1U1M A;  2CNL B;  2OEM A;  3S1T A;  3MEG B;  1CJV A;  1RTJ A;  3DLG B;  4KRW A;  2L9D A;  2MQO A;  1J5O B;  4HI2 A;  3P49 B;  4URG A;  3MUT P;  1VJW A;  2VQF F;  1FJC A;  3GSI A;  2HQG A;  5EHH A;  3NL0 A;  3R2C J;  1VK8 A;  5EWF A;  4C8O A;  1XJW B;  4ED2 A;  2VA2 A;  4HLB A;  3BQ2 A;  2HWH A;  4DQS A;  4IFV B;  2I5J B;  2GJI A;  3VHQ A;  3AD8 C;  3NS6 A;  4GRS A;  2XNQ A;  5CD4 A;  2CPZ A;  5HQM A;  1PYT A;  3K5L A;  3KK3 B;  4G65 A;  2ZJR Q;  1FT8 A;  2P9C A;  2QMU B;  2QGF B;  5KFF A;  4RR5 A;  2DCU B;  5I3Q A;  8RUC A;  2XM3 A;  3QJL A;  2Z2L A;  1U45 A;  2O3D A;  3MUM P;  3T41 A;  2MYF A;  3M05 A;  2MZQ A;  2DEI A;  4YS2 A;  2MLY A;  2IVF B;  4LMZ A;  2DIU A;  2AEF A;  3H25 A;  3CCE S;  3IRX A;  4ID5 B;  2PFD A;  2OJ3 A;  4QWC A;  3C16 A;  3QO9 B;  1S48 A;  4X66 F;  4CI0 B;  5BYR A;  3L95 X;  2ZJP Q;  1LXN A;  1R31 A;  1NPK A;  3R97 A;  3IMQ J;  4DSJ A;  5GVQ A;  3W8G A;  3R6G B;  4DR3 J;  3EGZ A;  2X51 A;  1WHY A;  1SJ3 P;  2QL7 B;  3IWL A;  4C4W A;  2HHW A;  4K2J A;  5F8M A;  2PDA A;  1UP1 A;  4P7V A;  2G1D A;  2IVY A;  2ZH9 A;  2GC8 A;  1DZ5 A;  3BO3 A;  3MMB A;  2K7J A;  5E7O B;  2J8A A;  5A8W A;  1H73 A;  2DNN A;  1IBM F;  1PAE X;  4X64 F;  4YR2 A;  3KLG B;  3VR1 A;  2BE2 B;  3AAW B;  4CYU A;  1LXJ A;  4PAA A;  1ZZF A;  4JI4 J;  3NEK A;  1XMB A;  4PXD A;  2O5D A;  4LFA J;  2EXU A;  5J1E B;  1ZOT A;  1VIO A;  4R0J A;  1SL1 A;  1BWE A;  4JYA J;  2QV6 A;  1KOO A;  3T3F A;  4PWW A;  1WNE A;  2IJN A;  4CLK A;  5IZH A;  4X4V A;  1TL7 B;  4J9V A;  3I5A A;  4C11 A;  2QA4 G;  4Z7C A;  4QU6 A;  4OX9 F;  2IJF A;  4GO5 X;  1G6B A;  3G71 S;  3OT9 A;  1CC8 A;  2RIJ A;  1EZZ B;  4O44 A;  5E3C A;  2F8M A;  3UD5 A;  2YNF B;  3GFH A;  1D8Y A;  4I7F A;  2HQD A;  3M8Q B;  2J6U A;  3OVS A;  1E6V A;  1FRK A;  2CUY A;  2X7I A;  3DRP B;  4LRE A;  3J7Y U;  4RW7 A;  2GCF A;  1U02 A;  2DK2 A;  3BS9 A;  1U48 A;  4TYA A;  1PYS B;  3H2L A;  3TJ9 A;  4A8K A;  2RML A;  4RLE A;  3JQJ A;  2HQ3 A;  4ZN3 A;  4N76 A;  2YNG B;  4P2F A;  2B9W A;  3MMJ A;  1NB7 A;  3K89 A;  3LP2 B;  4C0B A;  3KJF B;  3PIO Q;  1K1S A;  3MUR P;  1HMV A;  3MHY A;  2GHW A;  2OO4 A;  3Q24 A;  3SZ2 A;  3HT3 A;  7AT1 B;  4J7C A;  4NXM F;  3P3D A;  2BQU A;  3M2V A;  4ED8 A;  3U7J A;  5DDP C;  2VD3 A;  1VRU B;  2L3M A;  1TUG B;  4LRC A;  3EXY A;  3FSX A;  1M5S A;  2Z57 B;  1KWM A;  1JLG A;  2H4W B;  1X5T A;  3KJV A;  2HNZ A;  4OHY A;  1HNZ J;  2NYH A;  2BOA A;  3Q2T C;  2QYC A;  1RTD A;  4XO0 A;  2YWH A;  4JI7 J;  4WFY A;  1GT8 A;  3QJJ A;  2QJ3 A;  4IO9 Q;  4IH6 A;  2W2N P;  1T9W A;  5DLF A;  5K8O A;  3HHL B;  1U1K A;  1RYS A;  2Z8Q A;  1M5K C;  2KZM A;  3RW7 A;  4B3T F;  3S6E A;  2YWF A;  3GJR B;  4GKJ F;  3KUE A;  3N79 A;  2EEY A;  1F1B B;  2DNH A;  2RS8 A;  4GKK J;  1OY8 A;  4Q8E A;  3PG9 A;  3M2R A;  1B99 A;  2QEX S;  3O44 A;  3VAK A;  2NYI A;  4LFC F;  3M6U A;  4CLP A;  1NHV A;  4YME A;  1S6Q A;  4WK1 A;  1OYE A;  4OL8 A;  1QTM A;  3M2U B;  3MPU B;  5IOL A;  2PI5 A;  3FJ2 A;  3UCZ P;  2D3O 1;  3GPA A;  2JC1 A;  1CJT B;  2CQD A;  2YH1 A;  4OJH A;  1TK5 A;  5A76 A;  4O0I A;  1GNK A;  4DFJ A;  2BJ3 A;  4OLO A;  2FLN A;  3T5K A;  3MAA B;  3TQ1 A;  2XMT A;  1U8S A;  1XQI A;  2MGZ A;  1S6U A;  5L38 A;  3QMQ A;  4PXC A;  1DQ8 A;  4ZP8 A;  2AU0 A;  4R25 A;  1S1T B;  2BM1 A;  2BW2 A;  2DHS A;  1RWP B;  3ENQ A;  4OI0 A;  1RT4 B;  5EGY A;  4RPF A;  2IDL A;  4EU0 A;  1UCN A;  5LXY A;  1ULR A;  1SKU B;  4OYB A;  3V6H A;  4CO2 A;  1RAA B;  4DV7 J;  3GFY A;  1TL3 A;  3DYA A;  3BB5 A;  5KG0 A;  4J91 A;  4ZVS B;  1FER A;  1HNI B;  4USJ C;  1YJU A;  2MKK A;  4Q7A A;  4RUA A;  2O1P A;  2I0X A;  4QZV B;  3FZ2 A;  4CLZ A;  1C0T B;  2KRB A;  2D9O A;  3IM8 A;  2XMU A;  3V4M A;  3OTB A;  1KD1 T;  1I94 J;  1N6Q A;  3GII A;  3IGV A;  1RTI A;  3CCJ S;  1RAI B;  2H4Y B;  2F65 A;  4ILM A;  4F50 A;  5E3R A;  3SQG A;  2IHR 1;  4B9U A;  1RT2 A;  3E51 A;  4LR9 A;  3VWS A;  3M6X A;  2FB0 A;  1U09 A;  2ZHB A;  2RDJ A;  1OYD A;  5IQ6 A;  1T7P A;  1N8R T;  5ETO A;  2RF2 A;  3CXC R;  4HHJ A;  4P72 A;  2IM1 A;  3A3O B;  1MWY A;  5KFZ A;  1UW4 A;  2YKN A;  4PQA A;  2YKA A;  3FQL A;  4YR0 A;  2KT2 A;  3W66 A;  4GC7 A;  4LRF A;  2AYM A;  2ZH7 A;  1S59 A;  1DBD A;  4PPZ A;  4J5O A;  3OR2 A;  2M0G B;  6AT1 B;  5LT5 A;  1IKW A;  4O3Q A;  3PKY A;  4X4U A;  1M1K T;  2CWX A;  2V8P A;  1BWV A;  2OPS A;  4URQ U;  2E7V A;  4DV2 J;  3I4P A;  2UP1 A;  3I6P A;  4CCH A;  2R8K A;  1EJ7 L;  3TJ8 A;  5CH7 B;  3BGO P;  1UA1 A;  4WZM A;  5KOW A;  3BR8 A;  1J5E F;  1R0B G;  1BQM A;  2DR6 A;  2MMY A;  2IFX A;  1KN6 A;  5IV4 A;  4DV6 F;  2CKW A;  1IM6 A;  1SKS A;  2RRB A;  3TUZ C;  3QBC A;  1FF2 A;  3G96 A;  4DR2 J;  1JJ4 A;  4AL6 A;  3MR5 A;  1DLO A;  4QWE A;  1QUV A;  3LTO A;  3DGP B;  1F0X A;  2CJ9 A;  3CC4 S;  3G86 A;  4OHV A;  1AB8 A;  4PXB A;  3KJQ B;  1NME B;  2MXY A;  1X7V A;  3R5G A;  4DQR A;  2CAJ A;  1GMV A;  4DDF A;  4MK7 A;  5HJY A;  5KFO A;  2RRA A;  1VIS A;  3A4T A;  2YQ1 A;  1AXQ A;  2AHO B;  2Z2Y B;  4CLW A;  2RB7 A;  1BMQ B;  1BC6 A;  1KTV A;  2POK A;  4RBV A;  4LR7 A;  1G3O A;  2O01 C;  4ED0 A;  3OXL A;  2UZA A;  1PC4 A;  4LSL A;  1S72 S;  3VTI A;  3OXF A;  2EW9 A;  1PG5 B;  2AYG A;  5RUB A;  3Q23 A;  2IM3 A;  4PG7 A;  3GCW P;  4ZVU B;  3HFV A;  1VRT A;  1DRZ A;  3PX0 A;  3LGM A;  2MQL A;  2W24 A;  2IAJ B;  1Z2Z A;  4MT1 A;  2Q6C A;  2V67 A;  1RJJ A;  1QSL A;  2EKY A;  3GMG A;  5CZX A;  1PJ7 A;  2ZVI A;  5DZ6 A;  4E8U A;  2M8D B;  1DTQ B;  1HNZ F;  4HH1 A;  2LQJ A;  4KR0 B;  1PSD A;  2CXE A;  3OL8 A;  3MEC A;  4DMZ A;  1JIH A;  2CQH A;  2KDO A;  3DLB A;  1N48 A;  5F8J A;  4PQU A;  1KHW A;  2HS4 A;  4ZIW A;  1KP6 A;  1SQG A;  3MAQ A;  1S1V A;  5DGB A;  2V2Z A;  4QPX A;  3LF0 A;  2BKO A;  3E01 B;  1RB0 A;  4ENO A;  1U2F A;  3LGH A;  3GSD A;  1R8B A;  4NLS A;  3PKM A;  2WTF A;  3P8B B;  1RT6 A;  5HN0 A;  5JVG Q;  2KZZ A;  3UDC A;  2ADC A;  1WHW A;  3CVK A;  3QJP A;  1FRJ A;  2XWX A;  3J81 j;  1NHK L;  2JZ5 A;  1VYA A;  4I2P A;  2WW8 A;  4AD6 A;  1FO1 A;  2HHS A;  1WAC A;  1JJC B;  3DRS B;  1Q78 A;  4K0K J;  1GAO A;  3EVO A;  3T1A A;  1IBK J;  1U25 A;  4F7V A;  2DNG A;  1UJ4 A;  2J9D A;  4HDG A;  2D41 A;  2UXC J;  2DIS A;  3OTO F;  2YKP A;  3C15 B;  1FJ7 A;  3O5T B;  4G3I A;  3RRG A;  1IVZ A;  4Q44 A;  2PEB A;  2UXB J;  3GZ7 A;  5KFR A;  2VV5 A;  1GX6 A;  1TL1 B;  3GJT B;  3TNV A;  4DLE A;  1F6T A;  4DR4 F;  4NLP A;  5A6P A;  1T03 A;  4WTY A;  5CAA A;  4C8N A;  2DIT A;  4PWD B;  3TW0 A;  1PCA A;  1R0A A;  4C9D A;  5CYQ B;  4PYA A;  4USU A;  3IXQ A;  3HFZ B;  2R7R A;  2AEJ A;  4C0H A;  2MZS A;  2V9W A;  4KHM A;  4DXL A;  3FRZ A;  3NOG A;  1NBE B;  2HAI A;  1I94 F;  4H4M B;  4F4Y A;  3DOL B;  1X0P A;  2BBE A;  4KTQ A;  3C14 A;  3DRX A;  2LQ9 A;  2MB0 B;  2KM8 B;  1HA1 A;  2PD1 A;  2XB2 D;  1LW2 B;  2ZNZ A;  5HBM B;  5H9E K;  4FKY A;  3R7N B;  4KHP F;  3LP1 A;  2CQ3 A;  3A12 A;  4RL1 A;  1PC5 A;  2VKR A;  3PX4 A;  3NMR A;  3R7S B;  1YZ6 A;  1RAB B;  3DLK A;  2YKM A;  1K44 A;  4F3Q A;  5D3G B;  4DFP A;  3TUJ C;  4U7U D;  3NCQ A;  3NOC A;  1GXT A;  4TVA B;  3MR6 A;  1M5V C;  2UV8 G;  1OSD A;  1Q5Y A;  4NCG A;  3PEJ A;  2WRM A;  4XDC A;  5A0Y A;  3N5F A;  4AUK A;  2XYH B;  2GIF A;  1REV A;  1ZAW A;  4I2Q B;  1VHF A;  2DNZ A;  3EWG A;  5JUM A;  5KG6 A;  2DTJ A;  2XY7 A;  2NPF A;  2XY5 A;  1MN9 A;  1WDD A;  4DPW A;  2VIC A;  2BYC A;  4RUH A;  4C3M A;  2X1G A;  4AQY J;  3CC7 S;  4IRD A;  3HF5 A;  3CDB A;  3L7U A;  1P9Y A;  1JLC A;  3ITH A;  5KFN A;  2V6A A;  3AJ2 A;  5HAO A;  4JI5 J;  1FDB A;  4J37 A;  4UOH A;  3DXS X;  3ILL A;  3KLF A;  3PO5 A;  5ADZ A;  4BWJ A;  4KFB A;  4WIQ A;  1X4H A;  1TAQ A;  3G8T A;  3M32 A;  3ISN D;  4Y2I A;  3GB0 A;  4J9O A;  4G6V B;  1RKI A;  3EXC X;  4JI2 J;  4ILR A;  5D77 A;  1O5J A;  5CCL A;  2UVW A;  3I32 A;  2GVD B;  1UET A;  3MTK A;  3Q2S C;  1NKE A;  1KS2 A;  2AP6 A;  2JSX A;  2WW4 A;  4QR2 A;  5DS7 A;  4CO1 A;  1VR6 A;  4I56 A;  3NGT A;  3UDL A;  2BRK A;  2VQE J;  4CM2 A;  5KFI A;  3CIZ A;  3W60 A;  2UUW A;  4C8K A;  1X60 A;  1WEY A;  3N0V A;  3BGF A;  2MZ1 A;  3P96 A;  2ZBR A;  3B54 A;  3NWG A;  4ZCL A;  5HLF B;  3QGP A;  2VZ9 A;  4HEA 9;  1S9F A;  1BHN A;  4ECW A;  2E7W A;  3AJ1 A;  1QD1 A;  1CSJ A;  2UUA J;  2V2Q A;  1D0E A;  4DV5 J;  2VFR A;  5GAE I;  4ZHR B;  1X8D A;  3QAE A;  2I1R A;  4QPT A;  5J1N A;  2RU3 A;  4EWT A;  1R43 A;  5GAD U;  2AKW B;  3VGS A;  3UN2 A;  4DV1 J;  2AQ4 A;  3D0G E;  3N01 A;  2UVR A;  2QA1 A;  1BQX A;  5ETS A;  3HSD A;  1H7W A;  4I1T A;  2ZE2 B;  2FVQ A;  3Q8S B;  2GIQ A;  4JI8 F;  2NQP A;  1SV5 A;  2GGP B;  3DM2 A;  2IRU A;  2O67 A;  2MEW A;  3V6D A;  4RW6 B;  3KJN B;  4MMO A;  2E1M C;  3UVJ B;  4F67 A;  1NK6 A;  3AH6 A;  2K06 A;  2MKS A;  4YP3 A;  3M30 B;  5IT4 A;  4LR8 A;  2F5G A;  2QSF A;  1LWC B;  3BSC A;  1S6O A;  3W5X A;  1LQ9 A;  1WHV A;  5IT0 A;  1NU4 A;  2N3L A;  1JXE A;  3JSM A;  3WHI A;  3O3L A;  4Q0B B;  1ROF A;  4O3R A;  2XSF A;  3FBF A;  3WBZ A;  3T6J A;  1A7G E;  3ILO A;  5KFA A;  4C97 A;  2J76 E;  1BXN A;  3WC0 A;  1UEV A;  4RW8 A;  3RZA A;  4TY9 A;  1HHS A;  2CDR B;  1HWL A;  1TKD A;  1WWH A;  4GVB B;  2XEX A;  4PXE A;  4KO0 A;  3SCL E;  2DXF A;  5L8R C;  2HHX A;  1B4S A;  3TVY A;  2FJX A;  2HZV A;  1IBK F;  2VPZ B;  2IA0 A;  4A8W A;  3N6M A;  5D4P A;  4OYZ A;  2HHQ A;  2QL5 B;  1RBL A;  2BJ7 A;  4NPO A;  2WVE A;  3BSO A;  3J80 U;  1IKX A;  3KNG A;  2CQB A;  1S10 A;  2KT5 A;  1GXU A;  2UXB F;  2HGN A;  3OUY B;  1U6Z A;  2CWK A;  2G2O A;  4TY8 A;  5D4N A;  1YRT A;  4AXI A;  2R2R A;  3CJ4 A;  4JV1 A;  2C2D A;  2FVR A;  1WC4 A;  2HK2 A;  3ET6 A;  1MRO B;  3QIP B;  2Y0S D;  1WD6 A;  1YHQ S;  3D6T B;  1V6H A;  5DET A;  5C5J A;  1TU0 B;  5ITH A;  1NSA A;  2M88 A;  4WJB A;  2JVR A;  3RB0 A;  3FQK A;  2QYG A;  4CLS A;  3B4M A;  4LIW A;  1R27 B;  3W5Y A;  1ZM4 A;  3OSN A;  2JEF A;  4X65 F;  3GG0 A;  1OY6 A;  4IUF A;  2OFG X;  1TKX B;  3AD9 C;  1TMJ A;  2DGW A;  3VCD A;  1O6X A;  1GTE A;  2ZH3 A;  3RBE A;  4KC5 A;  3C46 A;  1D09 B;  5ETN A;  4MJK A;  4F26 A;  1IR0 A;  2YX7 A;  3QRR A;  2BAN A;  4A8Y A;  4K4X A;  2GHV C;  1VC5 A;  1T8E A;  2Z4P A;  4F4A A;  2J0X A;  3R5J B;  4CO4 A;  2FJW A;  3KDO A;  3CD0 A;  2JC0 A;  2OEJ A;  3OL9 A;  4N77 A;  2Y8Y A;  3H5Y A;  2Z0G A;  4HTJ A;  3HCX A;  2XGQ A;  1JLB B;  2R7O A;  1MWZ A;  4KH1 B;  4ECX A;  2A6O A;  4CTA A;  5KFE A;  2WVB A;  3RBZ A;  4B3O B;  2WB1 D;  5A8K A;  2RNE A;  1TKZ B;  4NYO A;  3MR3 A;  4L6V 3;  1TVR A;  1R8C A;  1QE1 B;  5D0E A;  4YB1 P;  3HKZ D;  2AD9 A;  4JI5 F;  1U1L A;  1GH8 A;  1CEZ A;  4DL7 A;  3BGR B;  3A8E A;  2J6S A;  1WTF A;  4KH0 B;  2Z56 B;  1GMW D;  3QGI A;  2N82 B;  4O4G B;  3ELH A;  5T7L A;  4OZJ A;  1HR0 J;  1F3V A;  2MY8 A;  4NAS A;  3DOM A;  5D78 A;  3HVR A;  2JDJ A;  4WU2 A;  4LT6 A;  1U1Q A;  2VQE F;  3CJK B;  2DNR A;  3NGD A;  2BJE A;  2ZZN A;  4K4S A;  2R8G A;  3MD3 A;  3M9M B;  3RTV A;  4PG4 A;  4QW9 A;  2V63 A;  1M1H A;  1NKB A;  2J7K A;  4DX7 A;  1XNR J;  3JXO A;  3OFH A;  3DGV A;  3AXK A;  3MPV A;  1ZS6 A;  3OR1 A;  1EET A;  3CCT A;  4HI1 A;  5CXT A;  3MCN A;  1FNM A;  3ZZU A;  1FXD A;  3V81 B;  5T41 A;  2MKC A;  2UUA F;  2HVZ A;  2C42 A;  2GQQ A;  2WVF A;  3IR7 B;  2YNH B;  2KKH A;  1RE1 B;  3ZZP A;  3QQC D;  2ACM A;  1U26 A;  5E3P A;  4M5M A;  5DDO C;  3RYL A;  4DV1 F;  3DRR B;  2MHE A;  4R8U B;  3LAN A;  2BW7 A;  2CNN B;  4KGK A;  1KSP A;  4DV3 J;  5C24 B;  2QX0 A;  3MEK A;  3MD1 A;  4LVN P;  1RT5 A;  1X5S A;  2MQP A;  4CT9 A;  1H98 A;  1XBW A;  2ZFH A;  2MQM A;  4ZPV R;  3GJQ B;  1ZTW A;  5LMN J;  1HYS B;  2MTL A;  1TMM A;  1NSP A;  4OYA A;  4MK9 A;  3KLI A;  4CO0 A;  3EVM A;  1CS4 A;  2DNM A;  3NGR A;  5BXI A;  2N4C A;  4Z2X A;  1FTC A;  5C25 B;  2VG6 B;  4HL9 A;  4AXJ A;  4AYB D;  2VOO A;  2IY5 B;  4ZJL A;  1Q53 A;  5IQQ A;  2JEG A;  3LP0 B;  4M94 A;  2V4J B;  1N32 J;  2GX8 A;  2F8H A;  4B3S J;  1H38 A;  2KTQ A;  4LF7 J;  4FBT A;  4YB7 A;  1KC8 T;  1TL4 A;  1T9Y A;  1GTH A;  3CT9 A;  1REG X;  3MM7 B;  2GML A;  2AYE A;  4QCL A;  4DOZ A;  3R3T A;  3R6L B;  3OQ2 A;  1YKW A;  1DAR A;  3IBF B;  1L3T A;  3GR1 A;  2FJD B;  4TLR A;  4DQQ A;  3TRG A;  1P6T A;  4NX9 A;  4LUB A;  3OHB A;  1FEE A;  1FWK A;  4F4Z A;  4K7Q A;  1ZA1 B;  1S99 A;  1S6P A;  2HHH J;  2B5J A;  3QPI A;  4PEO A;  4UF4 A;  3NGU A;  2AEM A;  1YVF A;  3OJU A;  1TL3 B;  4DR1 F;  3FBC A;  3Q22 A;  2DEJ A;  1RUS A;  1FTR A;  4ZVQ B;  3FCW A;  1F9H A;  3NNH A;  1WG4 A;  2GHP A;  4QIG A;  3DU5 A;  4LSN A;  4USI A;  5G0R A;  1U0H A;  4ELU A;  1LW0 B;  2DGV A;  1RAC B;  1N5T A;  3EDQ B;  1TUW A;  3JSR A;  1N6Q B;  3MPW A;  2BE7 D;  3TVK A;  3J81 U;  3TA2 A;  2GQ2 A;  3I82 A;  4RU9 A;  3D6F B;  5MLC V;  2QLW A;  1NJX A;  1NK0 A;  3T5L A;  5BR8 F;  2ZJQ Q;  3MM5 B;  1OPI A;  4ZPC A;  2C3M A;  2YXL A;  1HQU A;  3BRE A;  4X4S A;  3BQ1 A;  1WOP A;  3FCH A;  1NK9 A;  2ZUG A;  2YPZ A;  2V2K A;  4OI2 A;  4M1K A;  2LDI A;  5B0G A;  5J1P A;  4DN0 A;  1YRU A;  2OAU A;  1SJQ A;  4TLQ A;  2HG4 A;  4ZOS A;  2FIU A;  2EFP A;  3SI8 A;  1EAY C;  3V6K A;  3IFE A;  3OFF A;  3L7P A;  2KRR A;  3HZG A;  3OR2 B;  4PRF A;  1S4F A;  4AT1 B;  1IKW B;  4WFX A;  1FRL A;  1YX2 A;  2B7B B;  4ALZ A;  3LWM A;  3BH7 B;  1FKP B;  2C3P A;  4WP3 A;  3N5B A;  3KLH B;  3PO4 A;  3SEO A;  3TJA A;  5AJ3 F;  1YI2 S;  3MMA B;  2HRU A;  1VIX A;  2FY1 A;  4M5H A;  2FLO A;  1RWW B;  2CVI A;  4AFF A;  2DNP A;  3SV4 A;  1C0U A;  4DX8 H;  4WE1 B;  2E1C A;  1QY7 A;  1RP5 A;  2PEH A;  2OI2 A;  3BGU A;  4RWW A;  3LOU A;  4JI0 F;  4H4O B;  3DU6 A;  3SSS A;  2RT3 A;  3VQS A;  5MAO A;  4BDP A;  4KT0 C;  2DR9 A;  4YFU A;  4Z37 A;  2ACY A;  2FC8 A;  3IS9 A;  3I0S B;  1L3K A;  1YLX A;  2C2N A;  4L75 A;  3T9Z A;  3D2W A;  3DMJ A;  2BKN A;  4LFB J;  4U95 A;  2HEK A;  3GFX A;  1RAF B;  3CNQ P;  3PCO B;  3JTO A;  2DB1 A;  3CGI A;  2QFJ A;  2MKH A;  1HPZ B;  2BDP A;  1T11 A;  1UVL A;  1XNR F;  4ECR A;  4A8F A;  1WOR A;  2QLB B;  2VPX B;  2CA9 A;  3EMT A;  4DUY J;  1QVF R;  1RXO B;  2W9C B;  2JFK A;  1TQL A;  2R2U A;  4EZ9 A;  7FDR A;  2QA2 A;  2BKP A;  3QAU A;  2EFV A;  3K58 A;  3EZ5 A;  2XG8 A;  2Y3Y A;  4CIO A;  3FRY A;  2IC3 A;  4DX6 A;  3PIP Q;  4IDK B;  4L3N A;  4KKO B;  5ETV A;  1JLF A;  2J7W A;  5LOQ A;  2CQ0 A;  3MEE B;  1PJ5 A;  2COL A;  4RNH A;  1CC7 A;  1BQN B;  3F41 A;  2B4O A;  2K2P A;  4IFY B;  1JLQ B;  4DZD A;  3WDO A;  2NUU G;  5T14 A;  4WK3 A;  2CQ1 A;  3RB3 A;  1OY9 A;  1Q5V A;  5LMN F;  1U1P A;  3UWT A;  3RW6 A;  2JL9 A;  1IBL J;  5KFV A;  1N5Q A;  1RTH A;  4DF4 A;  2AZ1 A;  3U1N A;  3MR7 A;  1TAU A;  2QMX A;  3S8S A;  2GO8 A;  4UW2 A;  4QIW D;  2CJQ A;  4NLW A;  2UUC J;  2HLU A;  2ZD1 B;  2W8L A;  1NZA A;  3SSQ A;  3MM8 B;  3GIL A;  3KLV A;  3T1Y J;  4PWU A;  2NXN A;  3QFW A;  3DI6 B;  2K1R B;  1IKY A;  1FRH A;  3TP2 A;  4B3S F;  2CJY B;  2KHC A;  3TWZ A;  1CPZ A;  2DPJ A;  2EG2 A;  1RTZ A;  2P9E A;  1KQK A;  3Q8U A;  3D4J A;  4OYW A;  2R9L A;  3EZU A;  2IA6 A;  5CZV A;  2GS8 A;  2IJR A;  1RT7 B;  5K14 B;  1HBM B;  3TAM A;  1LKZ A;  2YTC A;  3QZ8 A;  3IN5 A;  5KG4 A;  5JVH Q;  2CJA A;  2R7X A;  3ZZR A;  2HZA A;  4DCO B;  2IVM A;  2KL8 A;  4KAI A;  2W9A A;  3BZQ A;  3KTQ A;  5A8R B;  3NNA A;  5IC6 B;  5J2M B;  2G9O A;  3QRQ A;  2AJF E;  4CP5 A;  4LBI A;  2OEL A;  4B3R J;  3VAL A;  5LMU J;  4K4W A;  2AX1 A;  1SIW B;  1E6Y B;  4WP8 A;  2PA3 A;  3I0R A;  4P2S A;  1HNV A;  3OW2 R;  2XZD B;  1D9F A;  5B08 A;  5I3P A;  3GYX B;  1IWG A;  2RIL A;  4V19 X;  1B3T A;  4UZB A;  1N56 A;  4CLY A;  1ZM3 A;  2AYB A;  4X84 A;  1XMO J;  1FES A;  1U24 A;  1R0A B;  1WHX A;  4DPT A;  1CBK A;  5HK4 A;  2FJE B;  1YSJ A;  3SCJ E;  3OJS A;  2ZNY A;  1TKT B;  4QWD A;  2OPP B;  1KBR A;  2OD4 A;  4FS2 A;  3LGN A;  2HGL A;  4DR7 F;  3EGW B;  1X9W A;  2KT3 A;  3MFH A;  1OJ4 A;  2NUH A;  2QSW A;  3Q8P B;  4UY8 T;  2CJX B;  1C1C A;  3QID A;  1S9E A;  1HNX J;  1VRQ C;  3OTC A;  4RNM A;  4B3M J;  4DR5 J;  4ICL B;  4GMK A;  5AXL A;  3J7A N;  4S0M A;  1SI9 A;  3HT0 A;  2W2M P;  1W2I A;  5J2P B;  1DTT B;  4LF4 F;  2G13 A;  2KYX A;  3P5B P;  3TX8 A;  4DF8 A;  4JI1 J;  4DU7 A;  3DN9 A;  1XEZ A;  2I38 A;  4FNI A;  3T5H A;  4FPR A;  1SIZ A;  2MQQ A;  2IRY A;  5IM0 A;  3JQM A;  1JNZ B;  5LL6 d;  3H4B A;  3U02 A;  1JK9 B;  3C6T A;  1EP4 B;  1WC5 A;  4U96 A;  3QWU A;  2OIH A;  2ZM6 F;  3R2D J;  2OTL S;  2HND B;  3ZZO A;  3NBP A;  1IKV A;  2ASY A;  4X2B A;  2OLW A;  2VFT A;  2R7S A;  4QIF A;  3CME S;  3SFU A;  3MR2 A;  4JI3 F;  4C98 A;  3G6X A;  4PKD B;  2I9S A;  2XMM A;  3UQS A;  1FK9 B;  1SH3 A;  2RKI A;  4O3S A;  2BX6 A;  4U8Y A;  3LUY A;  2HVI A;  4XPC A;  1T3N A;  2UU9 J;  4DPY A;  5ETM A;  3CWJ A;  3QT7 A;  1XNQ J;  2CPF A;  2F9D A;  4Y2A A;  2FJV A;  4J9R A;  1S97 A;  2HGM A;  2EBG A;  2E9R X;  2VF3 A;  4RO0 A;  4QBU A;  3RRH A;  3ADA C;  4H54 A;  2DHG A;  4LFB F;  5KT2 A;  1MG7 A;  4F25 A;  4IG0 A;  2P5V A;  3L09 A;  2Q1L A;  2ASD A;  4DS5 A;  3G82 B;  2XO6 A;  1JKH A;  4PCQ A;  3GWC A;  4USH A;  4OHX A;  1P1T A;  2AJ2 A;  2W9B B;  4ZCI A;  4MYT A;  4M5J A;  1W2B R;  3BBB A;  4X4T A;  2XUL A;  2R7U A;  3W2W B;  4DUY F;  2WZ1 A;  2C3O A;  3KUH A;  2HNY A;  2RQM A;  5BYS A;  4X4O A;  3CJ5 A;  2D3O R;  1WI8 A;  1M1G A;  2VFU A;  4ECS A;  4R0E A;  4OX6 A;  2XLJ A;  5KT3 A;  1B0P A;  2VC0 A;  2OPR A;  2WK4 A;  3EIC A;  1EQ0 A;  4EEY A;  2C2E A;  3T19 A;  1Y5L B;  1YBT A;  2PFF B;  1U2C A;  1A6L A;  3OHA A;  3CCU S;  3P45 B;  4OV6 A;  1HQE B;  5GAE U;  1Z4U A;  2M9K A;  2JLG A;  1S4E A;  2WBM A;  4BC9 A;  2B6A A;  1N36 F;  2RHS B;  4C2M A;  4YY3 J;  1LWE B;  4OQJ A;  3IWX A;  6FDR A;  3UR0 A;  2AJQ A;  2FZG B;  4DUZ J;  2Y0B B;  4CNY A;  1C1B A;  2HQI A;  3H8Y A;  3W2V B;  3V4I B;  3Q89 A;  2CFX A;  1ZM2 A;  1HBN B;  3QT8 A;  2RVJ A;  3OBI A;  1S9G B;  2VH7 A;  5F8G A;  3HJF A;  3Q8R B;  4EUV A;  1VHI A;  4PAB A;  3NP5 A;  4ZMM A;  3BPS P;  1T05 A;  3CJ3 A;  1HBO B;  5LJ3 Y;  5C2G A;  3MEG A;  1J5O A;  4RNN A;  2D3U A;  4FXV A;  1LEO A;  1V5I B;  9RUB A;  1H2V Z;  2CZ4 A;  2PMW A;  2AF6 A;  1VBK A;  3IR6 B;  1HHQ A;  5K8N A;  2QFI A;  2ZOF A;  2FUG 9;  3MTJ A;  2GAH C;  3BO2 A;  5FJ4 A;  3G87 A;  2NXU A;  3IG1 B;  4KPC A;  2I5J A;  4IYQ A;  4QIE A;  1QAI A;  2VDH A;  4PR6 A;  1UTA A;  3L3C A;  4R5P B;  4YHH J;  4LRD A;  1SBR A;  3NAI A;  1Y10 A;  4N56 A;  5A6W A;  3KK3 A;  3CJ0 A;  4DLG A;  2XY6 A;  4OJ1 A;  1RHQ B;  4RU2 A;  3KLE B;  2KFN A;  1S1X B;  3HSZ A;  2BM0 A;  1UL3 A;  4M5I A;  3MPD A;  5D4O A;  1SL2 A;  5F3Z A;  4HR2 A;  3TAQ A;  1JNR B;  1RA6 A;  2YBV A;  2E1P A;  4WBF A;  3HSG A;  2BQR A;  2FVS A;  1Q8B A;  3B82 A;  4ID5 A;  5E0O A;  5KFG A;  1SQE A;  5JJB A;  4RUC A;  3QO9 A;  3HDS A;  1KQG B;  4IO1 A;  2KJW A;  3MED A;  2OTJ S;  2ZC3 A;  5C2C A;  2MJN A;  4YB5 A;  2W8K A;  1X4F A;  4B3M F;  1Y11 A;  4DR5 F;  1M5P C;  3MM9 B;  1T9X A;  4GO7 X;  1KOH A;  1K47 A;  1N33 F;  2CNK B;  4DL5 A;  2F40 A;  4HVZ A;  3ISZ A;  5C7P A;  1KVJ A;  2XNR A;  5D15 A;  4JI1 F;  3KLG A;  1KON A;  2W7P A;  2BE2 A;  3D0H E;  3THV A;  3CCW A;  2C3U A;  2JLE A;  1Q7L B;  1S12 A;  3I31 A;  3LA0 A;  4EGL A;  3M8S A;  1P27 B;  1UWB B;  2CQ4 A;  4EK2 A;  2W2O P;  5CA5 A;  1RAD B;  5B0A A;  2R8I A;  2VL1 A;  1F5B A;  4M5K A;  5J1E A;  2IBK A;  4X4R A;  4ED6 A;  5IT9 U;  3N6L A;  2V2V A;  3SMZ A;  1RHM B;  4Y65 A;  2CVE A;  5J2N B;  3J80 Y;  1KLM B;  1TL7 A;  1HL6 A;  1HBU B;  1CUL B;  2FJB B;  1WOO A;  2WVD A;  4F3O A;  4HH0 A;  1L5U A;  4ZIT A;  1X31 C;  1MLA A;  4J9U E;  5DLG A;  2M70 A;  2XI3 A;  3HHL C;  4CRJ A;  3PYE A;  1JX4 A;  4TU9 A;  2KFZ A;  1YIT S;  2M3D A;  3VVT A;  2YNF A;  5HP1 B;  2HHP A;  2C22 A;  2WAQ D;  2WON B;  3N9U C;  2LFV A;  3WX4 A;  1VQ7 S;  4DZ6 A;  3D7S B;  3M8Q A;  4A46 A;  2ZUA A;  1MN7 A;  1PAU B;  3FVY A;  3VAI A;  5KFK A;  4A8Q A;  3DRP A;  2GVZ B;  2DCL A;  5GAG I;  1HD0 A;  2ZBC A;  4P75 A;  5DDR C;  4M5G A;  5KFT A;  4W4M A;  3TI0 A;  4LF5 F;  2Z58 B;  3RU0 A;  3ENA A;  3QYY A;  1VQ9 S;  2EVZ A;  2YNG A;  2C3Y A;  2W2P P;  4F02 A;  2D1C A;  1I5O B;  2FYX A;  3CSK A;  3D5M A;  3ZNJ 1;  1RLD A;  3BM7 A;  3GG1 A;  4N5S A;  2HWT A;  4DSK A;  3MMC B;  3IR5 B;  1VRU A;  1DAX A;  4LRA A;  4ILL A;  2ZZT A;  2YX4 A;  4EBD A;  3FEX B;  1G2E A;  4USW A;  3FZB A;  1PKU A;  1RIS A;  3ZZY A;  1S5Z A;  2DNY A;  3TUP A;  2DPI A;  3QLH B;  1RT3 B;  1LFP A;  3CJR A;  2QZ8 A;  1YJT A;  2OMO A;  4KGX B;  2E5I A;  3VZH A;  2HMI B;  4E2F B;  1YZ7 A;  4F4X A;  4I6A A;  2QN6 B;  3HPO A;  1U1N A;  4RW9 B;  8ATC B;  2CJK A;  3FUY A;  3HHL A;  1ACM B;  4A8X A;  2ZBQ A;  4Q2M A;  3H0P A;  5J2Q A;  3PEH A;  2DR8 A;  1R7I A;  3MUV P;  3CUL A;  4OX7 A;  2AMC B;  5SZT A;  1H2U X;  2N7Y A;  2ZOM A;  4ZK7 M;  4ZLL A;  3TZX A;  2YNI A;  5HSP A;  1SUQ B;  2J9E A;  3NY0 A;  5CYM B;  3C66 A;  1YJW S;  2CPJ A;  1FFW B;  3GON A;  1GEH A;  1NCL A;  2GMJ A;  2UXD J;  4JI6 J;  3M2U A;  1ZZN A;  3CCZ A;  4N7T A;  1Q86 T;  3G4S S;  2HVH A;  2GO9 A;  1CJT A;  2Y9H A;  3K5M A;  5DZ7 A;  5HL7 Q;  3W5Z A;  3ENW A;  3HVT B;  3ZO7 A;  2WVC A;  2XHC A;  5B7W A;  1TV6 B;  3MAA A;  2NXE A;  4USV A;  2DH7 A;  4YR3 A;  4M5N A;  3NCP A;  1V3Z A;  3PV8 A;  1S1T A;  4P2X A;  3RR7 A;  4FNH A;  2DGS A;  4J9M A;  1J27 A;  1QAX A;  2DRA A;  1RT4 A;  4ID8 A;  2APO A;  3DXB A;  2C2M B;  2IPO B;  4YQW A;  4I6Y A;  1WKL A;  1K1Q A;  1H2T Z;  3HHE A;  2KXN B;  4OMF G;  2GQC A;  3HKW A;  1HNI A;  3BKT A;  4G1Q B;  4DQP A;  1VQK S;  1WI6 A;  1C0T A;  3FK4 A;  3BO4 A;  4NZ6 A;  3AJD A;  1YG0 A;  3HX9 A;  2U1A A;  3HD2 A;  4PG6 A;  4LJM A;  2ZEJ A;  1WKK A;  3PFE A;  4NLY A;  4CQ1 A;  4OZN A;  3IBW A;  1YDL A;  5FDL B;  3CO0 P;  4ES3 A;  5ETP A;  4TXS A;  1JLA B;  4K2X A;  2WSF C;  4JBC A;  3UE2 A;  2RQC A;  3S01 A;  1KTQ A;  5IWA J;  2HS0 A;  2NS1 B;  3ICL A;  3T1H J;  4KQZ A;  2XS7 A;  4X62 F;  2KU7 A;  2B51 A;  3AT1 B;  4QYZ K;  5SUH A;  1FRX A;  3MAH A;  4C6A A;  4EMD A;  1Y5I B;  4JV5 J;  2AGQ A;  5KAK A;  3NS5 A;  3BJY A;  1NPP A;  1FHT A;  4TQS A;  4M5D B;  2JOQ A;  3UFC X;  1NLK L;  1SL0 A;  4U67 Q;  2DNK A;  2NSB A;  5M2R A;  1LNQ A;  3I5B A;  2HHT A;  3PYG A;  5I3U B;  2OML A;  1UFW A;  2ALY B;  4UY8 5;  1WF0 A;  2EFG A;  1OQ6 A;  3M8P B;  1QUP A;  1O51 A;  1XR6 A;  4ETX A;  4ZA1 A;  1S49 A;  3WIV A;  1NK7 A;  1K9M T;  1SH2 A;  3CCQ S;  2VG7 B;  2DYA A;  1FJG J;  3OVB A;  1X4G A;  2DY1 A;  5GAH I;  3I9V 9;  1R89 A;  2YH0 A;  2JH3 A;  4OI1 A;  4OYI A;  1OWX A;  2YPY A;  1D3W A;  2DRD A;  3CDE A;  2XWY A;  3E8O A;  3I96 A;  1H74 A;  2FVC A;  1LWF B;  4NA3 A;  3KYL A;  3CCL S;  1Q8K A;  1HFE L;  3DKD A;  3DGP A;  3ZTO A;  2VG5 A;  2LA4 A;  1EQM A;  3A8K A;  2E5H A;  1XR5 A;  2MDA A;  2BQ3 A;  1B7F A;  3J81 Y;  3D28 A;  3OL6 A;  3L4B C;  5L9X A;  1H72 C;  2N4D A;  4EZ6 A;  3KHH A;  4NLU A;  5DQI A;  3SXL A;  3M8R A;  1KHV A;  4K4V A;  2X3D A;  1VQ5 S;  3ZZ0 A;  4ECZ A;  5C42 B;  5GMK a;  4EYI B;  4NLV A;  1F9E B;  1EHW A;  2EK1 A;  4NOH A;  3J7Z 5;  2RUS A;  4RX6 A;  1Z2L A;  4ZVT B;  3HHD A;  3FCV A;  2R3V A;  1N52 B;  2IAJ A;  2JEI A;  4DR3 F;  4LF8 J;  4IQM A;  1M0S A;  2ZHO A;  3ZZT A;  2CG4 A;  3JYT B;  1Q79 A;  2OEK A;  2VFV A;  1RBA A;  1SCJ B;  4A8S A;  5LXR A;  3TQE A;  4IH7 A;  4ZKA A;  2OPQ B;  3QGH A;  4NCA A;  5DRK A;  1MU2 B;  2C2Z B;  2RD5 C;  4ZVP B;  4DV0 J;  4ZP9 A;  4DBQ A;  3PX6 A;  3KK1 B;  3BBC A;  4JI4 F;  1VK3 A;  3Q8Y A;  2W7A A;  1BGX T;  1YJ9 S;  4RWX A;  3SV3 A;  3D68 A;  3CCR S;  4NE9 C;  4LFA F;  1HNW J;  3X1L B;  2QT7 A;  2KM8 C;  4JYA F;  1RAO A;  1EB0 A;  3UDV A;  1JJ2 R;  2GNK A;  1FKO B;  4WWS A;  4ZVF A;  3D3C J;  1S77 D;  3PYD A;  4ZS6 A;  3MPY A;  1T9V A;  3A8J A;  2LEC A;  4ZLP A;  1URR A;  1OS5 A;  2KI2 A;  1TR0 A;  5DQH A;  2Q79 A;  3KXD A;  2X1A A;  2F3J A;  1CJU A;  1YBA A;  1OMS A;  1Y3K A;  1M5H A;  3GV8 B;  3DRS A;  3SCK E;  3N6N A;  3BR9 A;  1DQ9 A;  2FD2 A;  1Q4R A;  3A13 A;  1AA1 B;  1S0V A;  2XCA A;  1SH0 A;  4JOU A;  4ZLJ A;  1GQE A;  1SPB P;  1HWK A;  2H48 B;  1QLN A;  4A8O A;  4EI2 A;  3G6E S;  1BY9 A;  2DR7 A;  4FF3 A;  1RAJ A;  2XMW A;  3C15 A;  1FD2 A;  3V6J A;  1QM9 A;  5M2U A;  4W90 B;  1WTB A;  2BOP A;  1T95 A;  2WOM A;  4WYW A;  3KOA A;  2VOD A;  4J9S A;  4XDD A;  1TL1 A;  3CDA A;  2ZZM A;  4MFB B;  1AZS B;  3G9C A;  1FA0 A;  4UQT A;  1KR4 A;  4HAC A;  5ETL A;  1Q82 T;  3NRB A;  2OKQ A;  5E41 A;  4K8R A;  5CYQ A;  1SJ4 P;  2N7C A;  5E3Q A;  2ERR A;  3W9I A;  1CJK B;  2HKE A;  1P9Q C;  4K4Y A;  2HBR B;  5H1S V;  1N5Y B;  1WC1 A;  4KV8 B;  2EPI A;  4O23 A;  4H4M A;  1NH7 A;  4TU7 A;  2LXI A;  3DOL A;  4X66 J;  4Y2C A;  4M8L A;  3TX0 A;  2XSJ B;  2YVS A;  5K9F A;  1LW2 A;  5HVH A;  5HBM A;  2BR0 A;  4OZ3 A;  2DBB A;  4JP8 A;  2EI5 A;  4JI7 F;  2J5A A;  5KFQ A;  4MIA A;  1VI7 A;  4ZVE A;  2FHJ A;  3FBB A;  3T1H F;  4EO8 A;  5D3G A;  3OV7 A;  1M5O C;  1SKW A;  1IBM J;  3EZO A;  4X64 J;  4J9K A;  4PZV A;  2IM0 A;  1UW9 A;  2JRS A;  4I2Q A;  4GKK F;  3W62 A;  3H20 A;  5F8N A;  5F3T A;  1HI1 A;  2V8H A;  4FYD A;  3ZC4 A;  1KQF B;  3R8Y A;  5HRO B;  4O3N A;  3TYT A;  2YWG A;  2LVW A;  4KIA A;  1LV5 A;  2Y8W A;  4NYP A;  3LAL A;  3ZFV A;  4B08 A;  2V9K A;  4N8O A;  4B9T A;  3GE9 A;  1FDN A;  2M52 A;  3AOD A;  4I67 A;  1NDL A;  4URS A;  4OX9 J;  1N34 J;  3LAM A;  2YWK A;  2W25 A;  5KFU A;  1RWX B;  4JV0 A;  2RE1 A;  4NXN J;  5D6G A;  4NLR A;  2XC9 A;  4LRB A;  4RW4 B;  4F04 B;  1U8W A;  3LH2 S;  4YOE A;  3DC2 A;  1QAY A;  2GVD A;  3M9N B;  4N41 A;  1WJ9 A;  4ZVG A;  2F63 A;  3EJM A;  2LA6 A;  2HFZ A;  3K5P A;  2RUG A;  2J0Q D;  2BMB A;  3PW2 A;  4KHR A;  4DV4 J;  3DFE A;  3JS9 A;  3KK2 B;  4DV7 F;  2Z2Z A;  1VC6 A;  2GJ2 A;  3L7O A;  4QYR A;  4WU3 A;  5KFJ A;  2HSE B;  3KHG A;  5IC4 B;  3ZTP A;  2B0G A;  2NXJ A;  3RR8 A;  4DQI A;  2MY7 A;  3ILI A;  5HLF A;  4P6Q A;  2OP5 A;  4CO5 A;  1LK7 A;  5EX3 A;  3MCO A;  1L3S A;  2JNJ A;  2LLZ A;  2DVI A;  4PUO B;  2QG9 B;  5AE3 A;  3MM6 B;  1N5V A;  4ZHR A;  1QDU B;  3M7V A;  2C2K B;  1NDK A;  4M95 A;  2VBW A;  2EC0 A;  2VKZ G;  4DSF A;  3DLE B;  1YQH A;  2U2F A;  5L46 A;  3AOA A;  3KKF A;  3U1L A;  5KG5 A;  1VBZ A;  1Q81 T;  4F0H A;  1SXL A;  4UTG A;  4DG1 B;  4DI6 A;  5DJB A;  3OSP A;  5HJX A;  2ZE2 A;  4MIB A;  2FHO B;  3M1V B;  2RH3 A;  2GIR A;  4ERD A;  5G4D A;  5BJR A;  2GGP A;  3PJ9 A;  1LWX A;  1M90 T;  1MMD A;  3U1M A;  1B0T A;  2VBY A;  4RW6 A;  3UVJ A;  4DV2 F;  4KGV B;  1IR1 A;  3M30 A;  2AJ0 A;  1B0V A;  4LBH A;  4GKJ J;  1RDR A;  4ECV A;  1V3S A;  1LWC A;  2YY3 A;  3AHP A;  3HLU A;  2KG0 A;  3BF4 A;  1U1R A;  4IH5 A;  1VOM A;  1NXI A;  4UOC A;  3NCR A;  5F0U A;  2HPU A;  2VFS A;  3PRB A;  2YX1 A;  4P2M A;  4LFC J;  4WII A;  4Q0B A;  1RWM B;  4ZVR B;  4ZPW R;  2CYY A;  3G2X A;  3D1H A;  3SIP B;  4FXD A;  1FE0 A;  4ITS A;  4DR2 F;  2BAC A;  2WCX A;  2NR0 A;  2RDI A;  1T05 B;  2J6T A;  4GVB A;  3KHR A;  4NI2 B;  2VON A;  1WC0 A;  2H3E B;  3GYN A;  3K8V A;  3PW7 A;  1RSC A;  2LU1 A;  2BRL A;  1YK9 A;  3HI9 A;  3EUN A;  1FVS A;  1Y00 A;  2DD8 S;  5IV3 A;  1HW8 A;  3BDE A;  4MTP A;  1VLO A;  2ZH8 A;  1F5A A;  1XIQ A;  2CDQ A;  3IA0 A;  2P8I A;  1RHR B;  4DU8 A;  3OUY A;  3NKY A;  4WFZ A;  5L1K A;  4KBI A;  2DNO A;  1FXR A;  3FFI B;  3POT B;  1RWV B;  1MRO A;  3DOK B;  3QIP A;  3VAH A;  1EAR A;  1RHJ B;  4NA1 A;  1A9N B;  3DHX A;  3TVZ A;  3PRV A;  2AX0 A;  3R5C A;  2H9Z A;  1JMT A;  2Q66 A;  3R5A A;  3C3L A;  3I55 S;  1XN9 A;  1TZ0 A;  1VQS A;  3J7A 1;  2B3T B;  4P7T A;  4IG3 B;  3GIJ A;  1TKX A;  5CQG A;  4OZL A;  5GMD A;  3MED B;  1FEH A;  3CD7 A;  3AB2 B;  1NK8 A;  2AW0 A;  2LEB A;  2ZBP A;  1ZH5 A;  2FGC A;  3SBM A;  4YEA A;  2MQ8 A;  4C48 A;  1J2V A;  2SXL A;  1FE4 A;  4FXW A;  2IBO A;  1JLE B;  5FLX U;  2PO4 A;  1VC0 A;  3SDE B;  3TZW A;  4DSE A;  2OGU A;  1DHM A;  4AL7 A;  1JLB A;  1VCT A;  4ED5 A;  4X4Q A;  1QSY A;  3JB9 k;  5I42 B;  1S0O A;  5HMY A;  3C2P A;  2VU5 A;  1NAQ A;  4QR0 A;  1TFW A;  4B3O A;  2IYI A;  2F9J A;  5L1L A;  1TKZ A;  3PZP A;  1J5E J;  4ES2 A;  1U6F A;  3K5O A;  1S1U A;  5CCM A;  1QE1 A;  4DV6 J;  1CJV B;  4HDH A;  1RTJ B;  1AUS L;  3H5U A;  4UOF A;  3QGG A;  4NEY A;  2UUB J;  4K0K F;  3AOC A;  4OI3 A;  1N34 F;  3FEY B;  3BGR A;  4FYV B;  1NZ8 A;  4DN9 A;  1Z1Z A;  4NXN F;  2RDD A;  4O4G A;  2FVP A;  1I3O B;  3AFG A;  1WEX A;  2G4B A;  3BKU A;  2XS2 A;  2UXC F;  3THT A;  4LBP A;  2VB6 A;  2LQ8 A;  3O1L A;  4ZJQ A;  2QO3 A;  2DY9 A;  3PJW A;  5K8P A;  4C8L A;  1YJN S;  4OZ0 A;  3FMW A;  4DV4 F;  3CJK A;  4YDD B;  3DHW C;  2J9D E;  4MK8 A;  3SQO P;  3LPY A;  3CO9 A;  1XER A;  2BAB A;  1OO0 B;  3EDR B;  5DGA A;  5HQL A;  4UST A;  5GME A;  3CCS S;  4NA2 A;  4NYZ A;  1N4L A;  1HHT P;  3IRX B;  4DCP B;  3C16 B;  1AFI A;  3V81 A;  4YUD A;  3WX8 A;  3OLB A;  5GAG U;  1C2P A;  2VC1 A;  3IO1 A;  2YNH A;  2LXF A;  2A2D A;  4O3O A;  3H4D A;  4Z7Y A;  5E5N A;  5DG7 A;  3BDP A;  1L3U A;  1RAG B;  3EVW A;  2MLX A;  1EX8 A;  4LF1 A;  4F2R A;  3DRR A;  4R8U A;  3CJQ A;  3MMB B;  5IT9 Y;  2G1H A;  5C24 A;  1G4C A;  5A8W B;  2ZH5 A;  1NDP A;  2R4F A;  1UJ5 A;  4CYU B;  4EFA C;  3GCX P;  1RCO B;  9ATC B;  1IUJ A;  1QJH A;  4I68 A;  4FYW B;  1HYS A;  1O8B A;  4UT4 A;  4DFK A;  1LK5 A;  3TAP A;  3TOQ A;  3NLC A;  2L41 A;  5ETQ A;  3EM1 A;  1LOU A;  5KT7 A;  1ZPW X;  5C25 A;  2VG6 A;  2Z2M A;  4AQY F;  5J2Q B;  1X4C A;  3K57 A;  3CED A;  3LP0 A;  1FRM A;  4DJB A;  2V4J A;  2QLF B;  2XS5 A;  4C11 B;  3LPE A;  5HAN A;  2DGU A;  2YNI B;  3DDK A;  3BGL A;  4LIR A;  4U7C A;  3ETM A;  2WSE C;  3FC9 A;  4ZCM A;  2XLI A;  4O44 B;  2IMW P;  3MM7 A;  2MLZ A;  4JI2 F;  3MZI A;  2C2R A;  2P6S A;  4Y34 A;  2AIR B;  2M8H A;  4ETZ A;  4I7F B;  1EKR A;  2C2O B;  1HI0 P;  4CLT A;  2FTR A;  1N5S A;  3K59 A;  3BYR A;  1YJR A;  1E6V B;  1UVN A;  4CT8 A;  3HMJ G;  4HT7 A;  4RW7 B;  1ARO P;  3OTO J;  2LYV A;  3DRY A;  3FGV A;  2CPI A;  2VBX A;  1KFD A;  4H4K C;  4U6P A;  5K8M A;  4NRT A;  3PW5 A;  4CLU A;  1KQS R;  2KB2 A;  3OTD A;  1JXV A;  5EWG A;  4DR4 J;  4CWB A;  1WF2 A;  1N0V C;  2KH9 A;  1HMV B;  2W4C A;  3W1Y C;  1GXL A;  5B0F A;  3VQT A;  4KJI A;  1VQO S;  2VIH A;  1L3V A;  2R7W A;  4QU7 A;  1S0N A;  2LEP A;  2P6T A;  4QR1 A;  5H9F J;  5KOX A;  4ER8 A;  4DV5 F;  4FBU A;  1Q1K A;  4BLG A;  3NAH A;  1V9O A;  4DL0 C;  3M2V B;  2HFO A;  1LW0 A;  4NLT A;  2VJV A;  5KT4 A;  4BS2 A;  1JLG B;  5HVG A;  4G1P A;  2IYG A;  3CE8 A;  1PIL A;  8AT1 B;  5L1J A;  3KJV B;  1IR2 A;  2HNZ B;  1S79 A;  1S1W A;  2ALZ A;  4NLG A;  2XZT B;  3R5D A;  4YN3 B;  5KFC A;  4KY3 A;  4KHP J;  1RTD B;  3JTP A;  3MM5 A;  3UW1 A;  2KN4 A;  3VZI A;  1R8H A;  4QQB A;  4USM A;  2NZ4 A;  3B4D A;  2H5E A;  3FNN A;  1RCX B;  4ZVO B;  3D6M B;  3PM9 A;  5EDW A;  3H59 A;  4C7Q A;  2I2Y A;  1GFW B;  1VQM S;  4L72 B;  4U8V A;  3WZ0 A;  5I4M A;  2PA8 D;  3DCA A;  1K8A T;  2V34 A;  4WZQ A;  2PMH A;  1VQN S;  3M2R B;  4WFN Q;  2YWE A;  5F9L A;  1DY3 A;  3R1L A;  1MSW D;  2CQG A;  3PRD A;  2FDN A;  5A2Q U;  5F8I A;  1ZPV A;  1FKP A;  1S6Q B;  2ZH6 A;  3KLH A;  2AT1 B;  3MMA A;  4H4K A;  5CHC B;  3RAX A;  4DHV A;  3JSB A;  4RNO A;  2LXU A;  3QWP A;  3I56 S;  4WE1 A;  2GA7 A;  3MOJ B;  3NXZ A;  2UUB F;  3BN7 A;  1KNZ A;  4Y00 A;  2VOP A;  1BD6 A;  2VUG A;  3FSY A;  1NM2 A;  3AD7 C;  1HI8 A;  1B70 B;  4H4O A;  2MGZ B;  2DGO A;  4DSI A;  5AXM A;  4OJG A;  2E5G A;  1RAH B;  2A3J A;  2VG5 B;  1F5C A;  3I0S A;  3MCS A;  1TL5 A;  3PVX A;  1XTZ A;  3UDE A;  4FN5 A;  1UEU A;  5GAH U;  1FNX H;  2H54 B;  1GMU A;  5F41 A;  1SKR A;  3QZ7 A;  3DYA B;  2RU9 A;  2LQB A;  5HO4 A;  2I6W A;  1RAE B;  2RHQ B;  4MKV A;  3IRW P;  3M9O B;  4ZDN A;  1HPZ A;  3T5J A;  1UA0 A;  2G0C A;  3RRK A;  3HHK A;  4MKA A;  2XZW A;  1FCA A;  2FHK A;  3EE3 A;  2ZDO A;  5B09 A;  4F0K A;  2W9C A;  4IOC Q;  2LCW A;  1RTI B;  2M4M A;  1RHK B;  3H2U B;  2ZC4 A;  2GAG C;  4NLO A;  4J90 A;  3SQG B;  2F1F A;  4ZPB A;  5L9N A;  3CMA S;  1HLW A;  2H51 B;  1RT2 B;  4ECT A;  1OPZ A;  3W9H A;  3GJS B;  4EYH B;  4IDK A;  4B17 A;  1OSC A;  2HFV A;  1U2R A;  2MKY A;  2EWH A;  4KKO A;  4F3M A;  3D1Q A;  2RF2 B;  3MEE A;  3PHT A;  2YKN B;  3BEG B;  2HZC A;  1Y7P A;  3BPD A;  4AE5 A;  1BQN A;  2V8D A;  4CH1 A;  1AYE A;  2F4V J;  4F8R A;  4JI8 J;  2R7T A;  4IFY A;  1JLQ A;  4UUX A;  2WSC C;  4K50 A;  3GIR A;  2P2C B;  4ZVH A;  2V50 A;  2DO0 A;  5CYJ A;  2LP4 A;  2X3G A;  4PG8 A;  2OPS B;  4K5R A;  1DFD A;  1NHU A;  4NWB A;  2VJU A;  3RG6 A;  2ZKU A;  2CPY A;  1D8Z A;  2ZD1 A;  1BQM B;  1FXL A;  3W8P A;  3MM8 A;  3GTY X;  4L74 A;  1V3R A;  3RBD A;  4LQ3 A;  1Y5N B;  3OXG A;  3ULH A;  3DI6 A;  2K1R A;  1H7X A;  1BE4 A;  3T9N A;  4C8Y A;  2L48 A;  4IOB A;  1UJ6 A;  1D1U A;  2DIV A;  5EUH A;  4USK A;  1CJU B;  1DLO B;  1FRI A;  1FVQ A;  1RT7 A;  1B64 A;  4QYZ J;  3SYZ A;  1T02 A;  4WKR A;  5K14 A;  4ANE A;  1HBM A;  1HR0 F;  2ZBI A;  3UCG A;  2I8E A;  2E9Z A;  2MKJ A;  1VQP S;  2CQC A;  4ZPA A;  1IWA A;  5M2P A;  3G8Q A;  4CLF A;  2ZWO A;  4FPI A;  4TN2 A;  3QNW B;  1MMN A;  3PYF A;  2DT9 A;  4W98 A;  5IXU A;  5A8R A;  4AND A;  5J2M A;  3TR5 A;  4LSZ B;  2A18 A;  4WFB Q;  4QIV A;  1HIY A;  5D8H B;  3EPI A;  1SB6 A;  4OV1 A;  5B0B A;  1IN0 A;  5CD4 H;  2V68 A;  2QTW A;  1E6Y A;  2NLW A;  2JJ4 D;  2G0J A;  2WOM B;  1SJF A;  1KRP A;  3CTR A;  4LSL B;  4YDX A;  4DPU A;  2DH9 A;  4HAC B;  2HIY A;  1T9T A;  4KE5 A;  2L08 A;  2DNQ A;  2ROE A;  1VRT B;  4RZR A;  4DX5 A;  3VGV A;  1T9U A;  2LQ5 A;  4G1I A;  5ETT A;  1KVI A;  3ZTS A;  3MWB A;  5DM6 Q;  1TKT A;  1Q0N A;  2OPP A;  3CIM A;  2EFQ A;  4XIU A;  4XTT A;  2M5Y A;  4A8M P;  1WEL A;  4C3L A;  1FDD A;  4X65 J;  3BH6 B;  2JLF A;  4CH7 A;  2RSQ A;  3F44 A;  4NRU A;  4CZC A;  2PGC A;  3KHL A;  2VPW B;  4OYP A;  3AA9 A;  2E66 A;  4DS4 A;  3IP0 A;  4IR9 A;  4DV3 F;  3MEC B;  2GMH A;  2F4F A;  1MNE A;  2QC3 A;  4CO3 A;  3TA1 A;  1WC3 A;  2IRX A;  4ICL A;  4I6W A;  4PQU B;  2KXH A;  3IBC B;  1RT1 A;  2XMK A;  1RBO B;  2B8P A;  3N28 A;  1S1V B;  2ROG A;  2AWZ A;  5J2P A;  1DTT A;  4RBU A;  4U7U K;  3LAK A;  2IDE A;  4AL5 A;  2DGQ A;  3V5R A;  4OYX A;  2XI2 A;  3AQO A;  5KG1 A;  5IS2 A;  3Q8Q B;  2MSS A;  4WCE Q;  1RT6 B;  1N32 F;  5D0G A;  4YB6 A;  2FZC B;  2R2T A;  1EP4 A;  4LF7 F;  2M2B A;  2QL9 B;  2CRL A;  1D9A A;  2FC9 A;  3M8W A;  1OIA A;  3R1H A;  2HND A;  2CPE A;  4CLL A;  4I2P B;  4O3P A;  1URN A;  3U27 A;  2B7C B;  3W3S A;  4A4J A;  2PT0 A;  2JFD A;  5ETK A;  4J9N A;  2A0F B;  1IJF B;  3KWM A;  1EIY B;  4NZ0 A;  4J9P A;  2LU2 A;  5LSR A;  1FK9 A;  2BJD A;  3RJM B;  2MQN A;  1FI4 A;  2HFS A;  2BJ9 A;  4C0O C;  2CQI A;  4K59 A;  1SQF A;  4D3G A;  4NMX A;  3AXM A;  4FF2 A;  2EBE A;  4WYL A;  2HHH F;  3ISN C;  2EFO A;  2Y1L B;  4NEZ A;  1XR7 A;  5KFX A;  5HMW A;  4DFM A;  1T03 B;  4OX8 A;  4KB7 A;  1HAR A;  5LSO A;  2R2S A;  3G82 A;  2AGP A;  3PJX A;  4TKT A;  2W9B A;  2E29 A;  1PBU A;  3W2W A;  2B9Y A;  2CG8 A;  4KPY A;  2A6M A;  2UUT A;  4CNZ A;  3PY8 A;  3C14 B;  3PNI A;  2KJV A;  3H2V E;  2KHD A;  1S7I A;  2K3K A;  3UO0 A;  3C6U A;  3QSI A;  3LP1 B;  3M6W A;  1BLU A;  3KG0 A; 
#chains in the Genus database with same CATH homology
 1NDP A;  1F3F A;  3GP9 A;  2DY9 A;  4FKX A;  3FBE A;  3ZTP A;  1XIQ A;  3NGT A;  3Q83 A;  4WBF A;  3EIC A;  2BX6 A;  4W98 A;  1EHW A;  2B8P A;  4AND A;  1B99 A;  4ENO A;  1F6T A;  1S57 A;  4DUT A;  1NSQ A;  2DYA A;  3ZTR A;  4F4A A;  1NCL A;  5CAB A;  1NSK L;  1WKK A;  1HIY A;  3B54 A;  3EM1 A;  1JXV A;  1NSP A;  2CWK A;  1LEO A;  2VU5 A;  1KDN A;  3FCV A;  5CAA A;  4S0M A;  1MN9 A;  3EVM A;  3DDI A;  2HUR A;  3VVT A;  3PRV A;  1HHQ A;  2B8Q A;  4CP5 A;  1NDL A;  3NGR A;  5BXI A;  3NGU A;  1PKU A;  1NPK A;  1BHN A;  3FBC A;  1S5Z A;  3L7U A;  2DXD A;  3EE3 A;  1NHK L;  3G2X A;  2AZ3 A;  1WKJ A;  3ZTQ A;  3WX8 A;  1ZS6 A;  3BBF A;  5IOL A;  2AZ1 A;  4UOF A;  1VYA A;  4KPC A;  1NDK A;  4DZ6 A;  4UOG A;  3FBF A;  3FCW A;  2ZUA A;  3DKD A;  1MN7 A;  3ETM A;  3GPA A;  4UOH A;  3FC9 A;  3ZTO A;  3BH7 B;  3EMT A;  3R9L A;  4F36 A;  5C7P A;  4O0N A;  1BE4 A;  3VGV A;  1U8W A;  4ANC A;  2DXE A;  3Q8V A;  1BUX A;  3ZTS A;  2HVD A;  3FBB A;  2HVE A;  2NCK L;  4FKY A;  3VGT A;  3VVU A;  3EVO A;  1HLW A;  1XQI A;  3BBB A;  1W7W A;  4C6A A;  3EJM A;  3ENA A;  3VGS A;  3Q86 A;  3BBC A;  1NUE A;  1PAE X;  1NB2 A;  3EVW A;  3FKB A;  3BH6 B;  4DI6 A;  1NDC A;  4EK2 A;  1WKL A;  3Q8Y A;  3NGS A;  2DXF A;  1K44 A;  3Q89 A;  3MPD A;  2BEF A;  3JS9 A;  3VGU A;  3Q8U A;  4ANE A;  1B4S A;  1S59 A;  1UCN A;  3ELH A;  4HR2 A;  1NLK L;  3PJ9 A;  1LWX A;  3B6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...