3ENAA

Crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with dgdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3enaA00
3NGTA 1WKJA 4C6AA 3VGUA 1NDPA 1EHWA 3ZTOA 3WX8A 1WKKA 2DXFA 1KDNA 1NDKA 3EVOA 2CWKA 2B8PA 1VYAA 1NHKL 3BH6B 5CABA 2AZ1A 5IOLA 1F6TA 1NDCA 2HVEA 3EMTA 2HURA 3L7UA 3ETMA 1S59A 1XIQA 1XQIA 3EVWA 4ANCA 4FKXA 4ENOA 3Q89A 2HVDA 4O0NA 4KPCA 3PRVA 1JXVA 1K44A 3Q86A 4HR2A 3FBCA 1S5ZA 1S57A 3FCVA 1NCLA 3JS9A 3BBFA 3VGSA 1UCNA 3NGRA 3VGVA 3PJ9A 3NGSA 1NB2A 1ZS6A 2VU5A 3Q8VA 3ZTQA 3ZTPA 1NUEA 1NSKL 4DI6A 2DYAA 1NPKA 1PKUA 3VVTA 3Q8YA 3EE3A 1NSQA 3FBBA 2DXDA 4FKYA 2B8QA 1HHQA 3ELHA 4F36A 5BXIA 2BX6A 1W7WA 1LWXA 1HIYA 1LEOA 3BH7B 2BEFA 3FC9A 3GPAA 1U8WA 1PAEX 3ZTRA 1BUXA 3EVMA 3FCWA 3GP9A 3FBFA 3EM1A 3EJMA 3R9LA 4EK2A 3VGTA 4S0MA 3Q83A 2ZUAA 4DZ6A 1F3FA 3DDIA 4W98A 1BHNA 3BBCA 1WKLA 1B4SA 4UOHA 1BE4A 3FBEA 4UOGA 2DXEA 4CP5A 4ANEA 1NSPA 3Q8UA 5CAAA 4F4AA 4DUTA 2NCKL 1HLWA 3EICA 3MPDA 2DY9A 3BBBA 3DKDA 3ENAA 4UOFA 4ANDA 1NDLA 1MN9A 3B54A 5C7PA 3G2XA 3FKBA 1NLKL 4WBFA 3ZTSA 1B99A 2AZ3A 3VVUA 3NGUA 3B6BA 1MN7A
chains in the Genus database with same CATH superfamily
3TJ8A 4CT9A 3D6HB 1K1SA 4X4PA 4AUKA 2W2QP 2MQLA 1IKVB 4ED4A 2YKNA 4NLSA 4ID5B 1GAOA 1S5ZA 2Q66A 1QY7A 2DO4A 2D3UA 2BANB 3BBFA 2IJFA 3ICLA 4DR6F 3Q8PB 5C5JA 1ZH5A 1UP1A 2UVWA 5KFGA 2H65B 2HHXA 4R0JA 3IWNC 1VK3A 3HO1A 2DNRA 3BKTA 4YUDA 1FDNA 5U47A 3N6NA 3DLHA 1Q53A 3FDSA 1YZ7A 5DJBA 4ZCMA 1NU4A 1FKOB 3I31A 5EUHA 2Y3YA 2MDAA 5IQQA 1Y3KA 2GVDA 1V5VA 1M1GA 2V4RA 3HVTA 4CO2A 4QCLA 3MOJB 2HHPA 4RW7A 1S4FA 1U1OA 4DL4A 3V6DA 3TOQA 1WEYA 3EMTA 4MKVA 5KFJA 4D3HA 3NAHA 3KLHA 4FS2A 2C3UA 2CJBA 3UNYA 3PYDA 4OV1A 1VBKA 2E29A 2JLFA 1FHTA 4P2SA 5KFQA 4USTA 4Q44A 2BQUA 2DXDA 5H9EK 1HHQA 3CPWR 1V6HA 1P8GA 1N52B 5BYSA 4DL3A 2F1FA 3PCOB 5BYQA 3JSRA 4ZVHA 1HPZB 1DQAA 1WJ9A 2V2QA 1MROB 2YNFA 4CZCA 1K1QA 2J0WA 3R7NB 1HBUB 1AUSL 1RB0A 3B54A 3RUBL 2CYYA 1CJVB 2RDIA 3BV8A 4OV6A 3KNGA 4IQMA 1RP5A 1N36J 3EDRB 1DTTA 4C98A 2RUGA 2VHGA 3ETOA 4A4JA 4C8MA 4O0NA 4NX9A 3PRVA 1HNVB 1YSJA 1U1LA 3LPEA 2R7OA 2BMBA 3F56A 3T5KA 1B7FA 2ATCB 1YITS 2QIFA 3BREA 2POKA 1C0TA 3CJKB 3WIUA 3IRXA 2CNNB 3M8YA 3PW4A 2JEJA 4PG5A 1NJYA 4DX6A 1P1LA 1ZM2A 4IFVB 2C42A 1SQGA 2VA3A 2HBRB 2BDPA 3BO3A 2PFFB 3LGNA 1G1XA 1NK5A 4ZCLA 4LF8F 1SL2A 2WBMA 2GGPA 4NCGB 3W61A 3OFHA 3AHPA 2CWKA 1XR6A 4ECWA 1YZ6A 5IOLA 2DGTA 2B4OA 2NPIA 2HVDA 1RWPB 4KIAA 2H5IB 5SUHA 1FD2A 3JTNA 3CCMS 1NJIT 2KG0A 1WSRA 1S49A 1SC4B 3FBBA 4X2BA 3NG8A 1LWCB 1X0FA 1F9HA 3T1YF 2IRXA 5HP1B 2QMWA 1O0PA 4DFPA 2EPIA 4Y65A 3GILA 2QC3A 3GJTB 4RR5A 3BGRB 2HQFA 2ADBA 1WG5A 1N4LA 2YKPA 5KG1A 4K4ZA 1H72C 5GAHU 3W2VA 1FFWB 3F44A 3IC1A 5RUBA 4C0HA 3T3FA 2R8GA 1QVGR 4X65F 2RS2A 3IG1A 2MQQA 1MG7A 4DV6F 5JVHQ 4GC6A 3KJVA 4X64F 1UVNA 1Y5IB 5B0AA 1RABB 2RRBA 2XWXA 2CPJA 4OJGA 8AT1B 1R0AB 2KM8C 2VICA 3CC4S 2ZVIA 3EUNA 2EFPA 1RTDA 2QO3A 3DRPB 4J91A 3FSXA 2MKIA 1RT6A 2C2RA 1S9EB 3IWXA 4A47A 2IDEA 1M5HA 1TVRB 5F0WA 4JI7J 4J9UE 3CE8A 5ETVA 3T6BA 2KXHA 4WIIA 1FE0A 5H9FK 4ITSA 4DS5A 3CDAA 4Y0FA 4OX8A 8ATCB 2GA7A 3NBPA 3SI8A 4DJBA 2DO0A 2V94A 1H98A 2R7WA 4M63A 5J1EB 2YQ1A 1SPBP 2I0XA 3RRHA 2XMJA 2AJ4A 2AF6A 4K4TA 4ZPDA 3QO9B 2XLIA 2HPUA 3LUYA 1IR2A 3DC2A 4IRCA 4LFCJ 4WBFA 2G2OA 3H98A 3M1VA 4IYQA 2E1PA 1HL6A 4TVAB 4KHRA 3HCXA 2R7SA 1M5OC 4N8OA 1D0EA 2GQQA 4YN3B 4IO1A 5J2PB 3TX0A 1QTMA 3DOMA 1RWXB 3OL9A 4XPCA 1HYSA 3MCNA 3US5A 1MMLA 1RT4B 2JNJA 4HDHA 3THTA 1VJWA 4C8NA 2FHKA 1H2UX 1FX4A 5DETA 1X4GA 1K8AT 2XSJA 2EK6A 5D4NA 3KLEA 2DHAA 1DTQA 1H7WA 4CO1A 4L73A 3GV8B 2R9LA 1SH3A 3UDEA 1JLQB 1O51A 3ZTRA 3NS7B 4FNIA 5KG4A 4UZBA 4KGVB 3HJFA 4IDKA 3IAM9 2V9WA 3QRRA 1TL3B 1SXLA 3JQMA 3GLJA 2A6MA 2HNYB 2FJBB 5D78A 1FA0A 4DS4A 2C3OA 4JI2F 4B3RJ 5J2NB 2OGUA 2HHUA 2B43A 4X4VA 1EQMA 1CJTA 5KFFA 1DURA 2F65A 2FTRA 3MM9B 1RWWB 3L3CA 4EU0A 4CTAA 4OJ3A 2HIQA 3QJLA 1S9GB 2J9DE 2ZH5A 1JJCB 2AIRB 2ZH8A 2FLLA 4DPTA 2C28A 1RXOB 2P9GA 4LF9F 5HL7Q 2HFSA 4DBQA 4QOTA 4MAKA 4DR4J 3MCMA 3CJ3A 4NA3A 5FDLA 3MEGA 3P45B 1KOOA 2OFHX 4DCJB 1Y0HA 1U7LA 5HLFA 4IRDA 1PAEX 3FCWA 4DV5F 2IM1A 3DGVA 1ZZFA 1G4CA 1U0SA 1F3FA 3T41A 2GV1A 1TV6A 4LF5F 3L95X 2ADCA 2VG5B 3RAQA 3K0JA 4YY3F 2VASA 2ZBCA 5JVGQ 4J9KA 3C16A 2P5VA 4USIA 5C25A 4EO6A 2DGVA 1HA1A 1WOOA 1F9FA 2GMJA 1JJ2R 3BDEA 1RWKB 1NZ8A 2RIJA 3FMBA 2NSCA 3D0IE 2G0JA 2HRUA 4LF2A 3NMRA 4DSFA 1QSLA 2V34A 4ECZA 4EWTA 4UF4A 4FKXA 4J9MA 2XZDB 4CDIA 3IM9A 4ZVTB 1OPIA 4NMXA 2HAFA 4KHMA 4DX5A 4JI5F 3JQJA 4MYUA 1U0HA 2CKWA 3D9BA 2W1BA 2K3KA 2BABA 4C8LA 1Q79A 1RT1B 4DR5F 1VIXA 3OSNA 2C2DA 3CCJS 2RS8A 3M2RA 3MHYA 5F8NA 2Z4PA 5E0OA 5LMUF 1LWXA 4ETXA 2NXUA 2BEFA 4WFYA 2YKNB 4Y2MA 1EETA 2EC2A 2F8MA 1HBOA 4FF4A 1NMEB 3POTA 3CJRA 3OTCA 1F5BA 1M1HA 3KNAA 5KT7A 3KLVA 2HRTA 3MGJA 4I6WA 3MFHA 3BGFA 1EQ0A 2QL5B 5KT4A 1EB0A 2KM8B 3IBCB 3OL7A 2BOPA 2IJNA 5CD4A 1U45A 5HBMA 1ZBTA 1RISA 2XY5A 3PYFA 4OLOA 2YVSA 4ELVA 3H2UB 1MSWD 1LW2A 3DU5A 3LGHA 3N79A 3GJQB 1B0VA 1GK8A 1AT1B 2ZNZA 4IG0A 2RUSA 4RW4A 1T9YA 2GVDB 3P5BP 1SC6A 4DR7J 3SYZA 3NGSA 3AB2B 5B08A 3M8SA 3HVTB 2JVOA 2UU9J 5LOQA 2LMIA 4FS1A 3ISNC 1R31A 4DPUA 1NSQA 1WI6A 5EGYA 1TL7B 4LUBA 4RW7B 4JI8J 1JLEA 4DF4A 3RJMB 1NK7A 3V6DB 5HMZA 4B3MF 3R9LA 3KLHB 3I0RA 1URNA 1W26A 4ZIVA 3G87A 3ZZOA 3OVBA 1NB7A 2WVFA 3NS5A 1UFLA 2IA6A 4DL2A 1LXJA 1UJ4A 1K9MT 5GMKa 1ZM4A 1OQ3A 1MWQA 1RGVA 2E1CA 4ZJOA 3NWRA 5DDOC 3M05A 4XAKA 4RW9A 2WOMA 2J9EA 2ZDOA 2HZAA 4MIAA 3R5BA 4EFAC 5L38A 4K0KJ 2BRLA 3CGIA 2KRBA 3OR2B 3ZNJ1 5AE1A 3WC2A 2G9OA 1NH8A 1Y11A 4WU3A 3DYAA 4ZN1A 1P6TA 3OTBA 2DKOB 3SEOA 1EIYB 5A2QU 3Q23A 1FNXH 3Q2TC 3TQ1A 3TVYA 3IBFB 1S7HA 3NCQA 4O44A 1I1GA 2B4VA 4X4NA 1EKSA 3BEGB 4Q2MA 2D74B 3D68A 4X62J 4RO0A 3EJMA 1OY9A 2VFRA 3VV2B 2J7KA 4Q45A 4DPXA 2E9RX 3MECA 3FMWA 5KFOA 2C2MB 1RBAA 3TP2A 1NBEB 2O3DA 3NOGA 3D3CJ 4IR9A 2OTJS 2ZBPA 3EICA 1QSYA 1VQ6S 3FKBA 1UVJA 3IRXB 4D3GA 5IT9Y 2CFXA 4RNMA 4ZMMA 4UTGA 2J6UA 1PIEA 3W60A 3ULHA 1RHKB 2KZMA 2UUAF 3CULA 2R8KA 1R43A 3ZZRA 3M30A 4NLDA 3IS9B 2E44A 4F3OA 3KG4A 1DQ8A 2VFTA 4UQGA 2UUBF 2FD2A 4MKAA 4X4SA 1MMDA 3PACA 1N34J 1XN9A 4CNYA 4J7CA 1LEOA 2UV8G 1GTHA 2EBGA 1CSJA 3DRSA 1KNZA 3EWGA 3HP6A 1RACB 4C8OA 5CXTA 3W66A 4TY9A 1FRHA 5D77A 5K9FA 2FJDB 4TNOA 3C19A 4DF8A 1XMOF 2MZ1A 2BYCA 3AD9C 2IIHA 4I6YA 4DSKA 2KXNB 3OSPA 4AYBD 2A2CA 4UW2A 5IC4B 5ETLA 4DG1B 2RSQA 2PMHA 2RKIA 2WONB 4F4WA 4C48A 1H0HB 4Y2AA 2OAUA 3ENVA 5A8WA 5DQGA 5MLCV 2DXFA 3MCOA 2B8PA 2ZBRA 5HQ8A 4DR3F 3NEKA 3PIOQ 2QYGA 1IM6A 2CQ1A 1GXLA 3X1LB 3HZGA 2NUUG 3W2VB 1TFWA 1RTHA 3IG1B 3DDNA 3UVJA 2AGQA 3KJVB 4B9TA 3BQ1A 2N7YA 1XMQJ 1YTYA 5LSLA 4DV2F 1IWAA 2Z30B 4AL7A 5BYRA 4F50A 1WOPA 2RHQB 1GMWD 1IKXA 3L7PA 4QWDA 4IR1A 2H1YA 3DDIA 2PEBA 1RT6B 5E3CA 2ERRA 2G2YA 2LEBA 4LF7F 2P9CA 1SKWA 1Q1KA 3TAQA 4PXCA 1HW9A 1M5KC 4ED0A 4BHQA 3IAS9 1WEXA 1WC3A 3NBPB 1Q7YT 3OD2A 1HWJA 1FNMA 3K59A 1B0PA 4KFBA 5IQ6A 3UD3P 2RF2A 2CG4A 3LO3A 5IT0A 4CO0A 4QIVA 2HVEA 2FVRA 3HVAA 1LXNA 5FJ4A 4GKJF 4TU8A 2QG9B 4OX6A 1YVFA 2MXYA 2ZWOA 1HBNB 4ZPWR 4ZVGA 3AJDA 2FZCB 4NLVA 3I4PA 4JV0A 1PKUA 3ZZYA 3JB9k 1MWZA 4FPIA 2OP5A 2ZE2A 3D5MA 2DCUB 2MQOA 5IXUA 4OZ5A 5L1LA 4RW8A 2OLWA 4OI4A 1IWGA 3MR3A 2GX8A 3DOMB 1GTEA 2QJ3A 4TQRA 1KQSR 1HYSB 2X1GA 1NKCA 3C3LA 4LBIA 2EG1A 1WKLA 4GKKF 3A8EA 4AL6A 1HBMB 4I2PA 1A9NB 2DHSA 4CYUA 1S12A 3VALA 5LSRA 3VZIA 4EUVA 1DTQB 3ENAA 3HMJG 4HHHA 3RW7A 2RJZA 3VVUA 4ZLPA 2UP1A 1RT7A 3IBWA 3CVKA 1ZZNA 3Q8SB 3BS9A 1RYSA 4YMEA 3F73A 2VFVA 4DV3F 3M9OB 5CH7B 1REGX 1HNWJ 3H4BA 1X4FA 4IDKB 4ANCA 2F9DA 3ET6A 2FVPA 2LQ5A 4OX9J 4DFMA 3R5CA 4XDCA 3H20A 1FF2A 2W4DA 1RT5B 1QTNB 2Y8YA 4X4QA 1H6KX 4UT4A 3C2PA 4TN2A 1U1QA 4EO8A 3NS6A 3VHQA 3D1QA 2W9AA 4ZPAA 3SDEA 4QZVB 4CTAB 3THPA 1FKPA 3UR0A 3B8HA 3V81A 4LT6A 4IG3B 1YRUA 3BF4A 1UA0A 2KJVA 2HHWA 1VCTA 4QYRA 2YTCA 3N5FA 3OFEA 2HMIB 3R2DJ 1I94J 1UETA 5FDLB 3QRPA 4KSEB 1A6LA 3MEGB 2HAIA 5KT5A 4PWWA 5HLFB 5ETTA 3IR7B 1S6PA 4YHHJ 4A8QA 1SC1B 4C4WA 4OZNA 2W9CB 3G9CA 1QJHA 2U1AA 1ZPVA 3UFCX 2DGQA 1VBXA 2LKZA 4LF1A 3DLBA 4GC7A 1X0PA 3C15A 3P8BB 3BPDA 1HNZF 3O44A 4UUWA 3RBZA 1T9VA 1SQFA 4R5PA 1R0BG 4AL5A 3C16B 5C25B 4CO5A 1IQTA 1RT2B 2CWXA 4J9QA 5IWAJ 4I4BA 3K17A 4K4WA 2XTJP 1LFWA 1FK9A 4JI3F 4DDFA 1YJVA 2CZ4A 3KOAA 2D3ZA 2Q43A 1IKWA 5D3GA 5L1KA 3GPAA 4LSLB 2LU2A 3CJ0A 3CJSA 3MEEA 4KPYA 3MM6A 1DBDA 4ED8A 2HSEB 4ZITA 3PHEA 4W98A 1KHWA 5IFMA 1U0HB 2NPFA 5JUMA 4DN0A 2MJNA 3RR8A 4NPOA 1NHVA 4CLYA 1T05A 2M4MA 3N9UC 2HFZA 4CLSA 3M2RB 2E5JA 3TAMA 2DR5A 4HLBA 2HNZA 3MPWA 5H1SV 1DARA 1O5JA 5KG3A 4P9SA 2M8HA 1VQPS 2QL9B 1EETB 1IBCB 1S0OA 2VDIA 4ZPVR 3H5XA 1HBOB 5J1NA 3POTB 3HSZA 3NP5A 2VQEF 1ZTWA 2GZOA 1Y3JA 2WVDA 1RQ0A 3TRGA 4YR2A 1NJXA 4WZQA 1NCLA 2HVZA 2HHHJ 3MOZA 3HHLD 2BJDA 2ASLA 1NNDA 2UV8A 5E3PA 2N7CA 3N6LA 2F9JA 5DRKA 1R0CB 1V9OA 5HBMB 3K57A 4FVMA 5T41A 4M94A 1XBWA 1F5AA 3EX7B 2MSSA 4WFAQ 3FQKA 1B70B 2IJRA 1KQKA 2OEJA 4FYDA 5CYQB 1R8HA 4R8UA 4PWUA 5CD4H 1SV5A 3CJ4A 1YBTA 2XS7A 4MMOA 4ZPCA 4DV0J 2H51B 2Y1IA 1NKBA 1CC8A 4LSNA 3BBBA 4OHVA 3QJPA 1JLEB 2Z8QA 2DPJA 4ES3A 4DUYJ 2EG2A 1EP4A 1O6XA 4I7FA 3FQLA 1SB6A 1LWEA 2KL8A 3H59A 4HTJA 3BYRA 2HHQA 1PC4A 4U7UK 1REVB 2BQRA 4Y3CA 2WW4A 2IHR1 3KK1A 2E1MC 2CQ4A 4LFAJ 2CQGA 1B0TA 3MR7A 4RW9B 2WOMB 2RQ4A 3A4TA 2H9ZA 4HACA 3DMJB 2AW0A 3PJXA 3B4DA 4M5IA 2JFDA 3HFZB 3VAKA 4USWA 2QLXA 3BBCA 1UL3A 2EFGA 3T9ZA 2GAGC 3RZAA 2LQJA 5M2RA 4TLQA 2GHPA 1HWUA 3TJAA 2UXDF 2YNHA 4JYAJ 5DG8A 3JQKA 4O44B 5ETNA 4LBPA 1FEEA 4WTYA 4HH1A 3NLCA 4NA1A 3QYYA 2ZDPA 4YR0A 2HZVA 2DR8A 2B9EA 1X7VA 3MECB 2LDIA 4IKAA 1N5SA 4I2QA 1M5VC 1PJ5A 3AAWB 2WSEC 4C8KA 2DR7A 4DPYA 1TAUA 4JI1F 3MAQA 4WTOB 4ECXA 1S7IA 3H5YA 2C3PA 3FZ2A 2I38A 2QA1A 4KRWA 2IMOA 1TUVA 2YKOA 1YJ7A 2AP6A 2JFKA 2ZH1A 4NXNJ 3KFWX 4P2MA 1KKHA 2VQFF 2HVHA 5KFPA 2BR0A 3QT5A 4FYYB 3K5PA 2L9DA 4MKYA 1VISA 1QDUB 4OYAA 3NOCA 4LJMA 3PYGA 3GIKA 3UN5A 3I0SA 1UVLA 2CQ3A 4A8SA 3JXOA 5HQMA 1HNIA 1HNXJ 4JI6F 4NLRA 1Z2LA 1GX6A 1ZAXA 1IBMF 2X3GA 1NDKA 5CYMA 2ZBIA 2LDYA 3CEDA 3PJWA 1P1TA 4I56A 1QSSA 4ATNA 2HQIA 3DOKA 1D9DA 1YJTA 2CPYA 5ETMA 4RNHA 2JOQA 2C1EB 4PG7A 1XWLA 2IC3A 2FGOA 2RQMA 5GAHI 2AJFE 3H0PA 2XEXA 2A6OA 3CD0A 3Q83A 4USKA 2BJEA 2FHMA 3BJYA 2C3YA 1RDRA 3PM9A 1WDTA 3HK2A 3DRXA 5DS7A 4NXMF 4DR6J 2QLBB 5KFHA 2XC9A 4FDFA 2MZTA 3O3LA 2HS0A 3NMAA 2OKQA 3MEDA 1RTHB 3UVJB 3R7SB 1T9XA 2PMWA 5HJYA 1RKJA 2MSTA 4YB7A 4O23A 4J9SA 4UOFA 5M2UA 2R2UA 3OV7A 1XEZA 4K4YA 4F4ZA 3OXLA 1TUGB 4OYPA 4C6AA 3SIPB 1FJEB 3OVAA 1IKXB 1NPPA 4YB1P 2PI5A 5KOXA 3AXMA 2VV5A 1OWXA 2CVEA 3M9NB 5EWGA 1EJ7L 5CA5A 3GIRA 5THWA 4RLEA 2QFJA 3CCLS 1KVJA 3BQ0A 1WOSA 2XI3A 2NQPA 3D3BJ 2FLPA 3CO9A 4RBVA 3Q8YA 1BGXT 3WQPA 3MM7B 3BKUA 2YNIA 1URRA 2Q6BA 1WHVA 3JYTA 4OL8A 1BQNA 5D4LA 2ZITA 1IR0A 3RR7A 4USHA 1VQ8S 1HHSA 2AYMA 3GFYA 1KEKA 3J81Y 2XI2A 5CQGA 4EGLA 1JXLA 1S4EA 1KC8T 4URSA 2XNQA 4MH8A 1I5OB 1SCJB 3Q8UA 3PY8A 2BM0A 2E5LF 1VLOA 4WXWA 3BR9A 4KY3A 3T5LA 2G13A 3IO1A 4LQ9A 1UWBA 2ZE2B 4ECVA 3CSKA 1E6YA 2ZM6F 4RW8B 1FTCA 4ZHRA 1FJGF 4NA2A 4ZVPB 1L3TA 3EVOA 5F3ZA 4NWBA 4PG8A 1CJKA 1S1VA 1S1UB 4DPOA 2KG1A 3D4JA 2EK1A 3BPSP 4RBUA 4F25A 1T94A 4I2PB 2NUHA 1YRXA 4CYUB 3RG6A 1FI4A 1TQLA 3HSGA 2AGPA 2YKQA 5KFRA 1YWXA 1U1RA 1KQGB 1RT7B 3AODA 3K8WA 3KK3A 3FFIA 3N6MA 1D9FA 3PHTA 2HBQB 1YLXA 1RLDA 1UKUA 3E3XA 4CLPA 4NLUA 2VPYB 3ET6B 3DLKA 4LRBA 1KD1T 1U26A 2H5EA 4BBYA 4CLFA 1JLGA 4DUTA 4KAIA 4MT1A 2QX0A 2V2ZA 1QE1A 4WJBA 1KTVA 3GR0A 3LW5C 3VTIA 3G2XA 3SDEB 3KMSA 2CPIA 2FHOB 2MY7A 1FRXA 1ZETA 2RB7A 2M5YA 1S1XB 1Q8IA 2JLGA 5KFYA 3KHHA 3V81B 3UWTA 3R8YA 5HROA 2FVCA 3AOBA 2AEFA 1VRQC 4ZPTR 3EVWA 1TP7A 3DI6A 1FO1A 1OO0B 4C8ZA 9ATCB 3EYZA 4LF8J 1PGZA 1NK6A 1S76D 4QPTA 2O67A 3TVKA 3N01A 3VVTA 1S6QB 3BN4A 1VI7A 1S6PB 4RNFA 2FLNA 4N5SA 4OYXA 1IM4A 3P3DA 5L9XA 2E1AA 1X8DA 4RW6A 4KV8B 3U1MA 4R5PB 4XPEA 1WELA 1CULA 1NSPA 3IXQA 3FRZA 1YIJS 3J81j 2B5JB 5ETPA 1FK9B 3KK2B 1RJJA 3T1YJ 3P4UB 1IKWB 3BN7A 1RAAB 2PD1A 4DQPA 3HHNB 5LMNF 3MEEB 3MM6B 5DLGA 3L7UA 4H54A 4M1KA 1RWOB 1FCAA 2HRYA 3W5XA 1S97A 3OXGA 1Q8KA 5B7WA 4CQ1A 2OPPB 1SC3B 4HR2A 1RTJA 1U2CA 3GYNA 3QQCD 3L7OA 1T05B 3PVXA 2EWHA 4X65J 2V4JA 3TAMB 2XYGB 4K4XA 1NPKA 4DV6J 1CS4A 4X64J 4UUXA 1SJ3P 2PI4A 1D8YA 3I9ZA 5IT9U 2BE2A 1APSA 3D6FB 1PILA 4ED5A 3PYEA 3FC9A 2YWWA 3CXCR 3EVMA 2JEFA 4B08A 5B09A 1FVQA 3MFIA 2KHDA 2DH9A 3ZXWA 4IOBA 4AE5A 2DXEA 3QIDA 3WHIA 4IH7A 4DV1F 3V5RA 1U6ZA 3R5AA 4R0EA 5KFUA 2OSRA 5A8KA 1HFEL 2BKPA 4P52A 1Q95G 4E8UA 3LWLA 1WC0A 2Y8WA 2FY1A 2CAJA 2ILYA 2DBBA 1JWWA 4C3KA 1MMNA 4OJHA 3UPFA 4P73A 4P75A 4DU8A 3FSIA 2MQMA 2OEMA 3LP1A 3A8IA 3Q24A 4L74A 2WW8A 4R8UB 4B3SJ 3GIIA 1SV5B 3NCPA 4GRSA 4V19J 1S1WB 4E2FB 3CJ8A 3JSMB 3CJTA 3GTYX 4LSNB 3ENWA 2VJVA 2DRDA 5I3QA 1FJCA 2DNOA 3VZHA 4NE9C 3V6JA 3ITHA 5KT2A 4LF4J 3OLAA 2XYPB 3HKZD 2AJQA 5LL6d 3P49B 5HO4A 1EP4B 3G96A 4Z37A 3Q8QB 2A1BA 2CQCA 4B17A 3THVA 1U1KA 1LWEB 4U7UD 1LFPA 1PG5B 1DRZA 3HSJA 3QSYB 2HK2A 4U8YA 3LPYA 2ROPA 3MM8B 2DR6A 3QLHA 2KFYA 4LFCF 3KK1B 1CC7A 3DLEA 2YKMA 3HT0A 5EWEA 3VQSA 3W3SA 4PUOA 2HQGA 5K8OA 2GW8A 4RBTA 3UNGC 5K8PA 4HACB 2BKNA 4DSIA 1KDNA 2RDDA 4PQUA 3HDSA 4AXJA 4J5OA 5CABA 2PC6A 4DCPB 3M8PA 3RB4A 1CJUB 4QR2A 2DK2A 5ETKA 1N6QB 2J8SA 2HLTA 2QTWA 2YNHB 4PCQA 4F0HA 2B9WA 2XMAA 1CPZA 1P27B 3HFKA 3OJUA 1GMWA 1RI7A 2MKHA 2CPDA 2CDRB 1HIYA 1OYDA 1U09A 4FPRA 4F8RA 4I2QB 4DQIA 5K14A 5DM6Q 2HQ3A 2ZFHA 4HI2A 3H40A 5AXNA 3AY0A 1NXIA 4HKQA 4B3RF 4FVCA 2ZKUA 4OI6A 4XO0A 1ACMB 3BSAA 4NLWA 4LVOP 2KO1A 4HHUA 3JSBA 4WYLA 4OMFG 1U1NA 3QWUA 5LXRA 1S0MA 4ZVFA 1SL1A 1MN7A 1VC0A 3C14B 3UW1A 2PN6A 5G4DA 4H4OA 2I9SA 2YQ3A 4LF5J 1IBKF 4BC7A 1N5YA 1D9AA 5BJRA 4YY3J 2D9PA 3LA0A 5JJBA 2COLA 3I0SB 4KTQA 1H38A 2VODA 4B9UA 1VC6A 2ZWPA 5J2MB 1HI1A 1NK4A 5C42A 5CYMB 1R8PA 1RA7A 3FSYA 1KSPA 4BWJA 2IYIA 2CADA 3V4MA 2EFOA 4PYDA 1KLNA 3MMBA 4JI5J 3PG9A 2DHXA 3S7RA 3KUGA 1EZZB 2X7IA 1T11A 2YX7A 5DGAA 1VIOA 1YJWS 3OL8A 2MYFA 4K8RA 4PXDA 2IC3B 1KHVA 5LMUJ 2GCFA 3IRWP 2FJEB 3ILIA 4P10A 5IZHA 4PAAA 1VQ9S 3PW7A 5HSPA 4N77A 2Z56B 4F67A 3QATA 3HPOA 3EXCX 4WKRA 1NDCA 3KUHA 2OMOA 2G0CA 4EEYA 5BR8J 4E98A 1R8AA 2KKHA 2OPQA 2WAQD 3PX0A 4KB7A 1NZAA 2DGSA 1ZS6A 2LCWA 1IUJA 2DYAA 4U8VA 5EWFA 1I3OB 3TYTA 8RUCA 4HI1A 2QV6A 4I69A 4CLWA 1KOHA 1Z4UA 4JB8B 5BXIA 1TMJA 2Z0GA 4BCAA 3PW0A 2N4DA 3MUMP 2QL7B 3FEYB 1TFYA 2YWGA 3CDBA 3ADAC 1T95A 1FT8A 1VQOS 6FD1A 3IN5A 1G6BA 5F8MA 4EYHB 1TK0A 2YNIB 2XMWA 3OVSA 3JYTB 4OI1A 4L75A 1RWNB 3DXBA 1NK0A 1BQNB 5DDPC 1XERA 1M5SA 1R6YA 3EXYA 4X4TA 1R8BA 4J9OA 2I6WA 2WVCA 1NEEA 4C7QA 4DR7F 3MWBA 3CCVS 4ECQA 4ID8A 2MZJA 4QW9A 4KPCA 2UU9F 1T9TA 2DHHA 4CIOA 2B4PA 2J0QD 2FPHX 4CLUA 1J5EF 4BWMA 1S9FA 2QSWA 1E6YB 2W9BA 2B7CB 1YBAA 4ZA1A 3TVZA 4ZHRB 3SCLE 3OR1A 4WF9Q 1HWIA 3GIMA 1S1VB 3BO2A 3BSOA 2LEPA 4N76A 5A8RA 4DR2F 3LTOA 2M9KA 3I5CA 3HFVA 1VHFA 2IA0A 4W4MA 4U67Q 4ICLA 3I4HX 2V6AA 2UUTA 3I9V9 1EKRA 2QEXS 4TKTA 2BVZA 1F0XA 3QGPA 3I82A 5HVGA 3KK3B 4HTIA 3FFIB 1F60B 2BKOA 4K0KF 2Z57B 1TTHB 1RT3A 1C1BA 4TLRA 3J7AN 2XMTA 3I96A 3PEJA 4J9VA 2NR0A 1DAXA 2PA3A 3AH6A 3K2YA 3G86A 3DLKB 3HHLA 3VAFA 1PO6A 2YY3A 1JLGB 5A0YB 1JKHA 3RYLA 1QE1B 3AQPA 2AJ0A 2PSZA 3MPVA 4M5DB 3EZOA 4H4MB 3IMQJ 4PXBA 3H8YA 2VBZA 2XMKA 2I5JA 2GS8A 1W2IA 3OLBA 1RLCL 4MJKA 3NGDA 5HROB 2VJUA 1VQKS 5MAOA 1YJ9S 3KKFA 3KHRA 4QPXA 3DI6B 2R2RA 4F4XA 4AXIA 1QUVA 1VRUA 3CDWA 3KXDA 1RBLA 1Q8BA 1S77D 4A8KA 2UUBJ 2PDAA 2XHWA 4NOHA 5CYJA 5F3TA 5DQIA 2VBXA 4OHXA 1ZAVA 3FK4A 2ZHOA 3OPKA 2VIHA 4H4KC 3B78A 3TUZC 4CT8A 2LEAA 3QZ8A 1JLFA 1Y7PA 2CQ2A 2NYIA 2DB1A 3JTPA 2R3VA 4HVZA 4I64A 4RJVA 4FN5A 4M5HA 3M32A 5FLXY 4RW6B 1XMOJ 1X4CA 3X3UA 4K50A 3CJ2A 4K2XA 2V9KA 4XK8C 1CULB 1X5OA 1BD6A 4AFFA 1N34F 1TMMA 3ZTQA 4PRFA 1NSKL 1FRMA 2GIQA 2MZSA 3O5TB 4F4KA 4CH7A 1R3NA 3QGIA 4P71A 4I68A 1IBLF 4DR3J 2CIMA 1FX2A 3F0NA 1FDAA 1XTZA 3GZ7A 2DGUA 2DNLA 4OHWA 3BQ2A 3P96A 1J2VA 3GSDA 4JI0F 4K5SA 1RTJB 3CW2C 5DLFA 1Q82T 4M8LA 3CCRS 3NXZA 3ZZUA 4ETZA 1R7IA 2V4JB 2F3JA 4DSEA 3MD1A 1WORA 2OO4A 2F5GA 1BQMA 2VG7A 4ZIWA 3VAHA 4GVBA 2X3DA 2BE2B 1IKVA 4DV2J 2P2CB 2KI2A 2BE7D 2LVWA 1NK8A 2J7WA 2NXNA 2LP4A 2DRBA 2F4VJ 1RHRB 1VFJA 1R8CA 4WWSA 3ISZA 2AU0A 4ZVUB 4NZ7A 1U49A 4LF7J 3W5YA 1UW4A 3PJ9A 5I3UA 2XGPA 3MR2A 2M3DA 1UPMB 3W62A 5M2PA 3IM8A 2KN4A 3I32A 3H25A 2MY8A 2GJIA 2O01C 4E0DA 2FJXA 2UXBJ 4BDPA 1RCXB 4GKJJ 1FXLA 5KFVA 4HDGA 2QMXA 3OTOF 4ES2A 1TL1B 2DNHA 2XZTB 2LXIA 2GQCA 1CVJA 2LA6A 5KFCA 4O4GB 3G6YA 4ECYA 3CJ5A 3AD7C 1JLCB 5HANA 2XZWA 4NLOA 1C4CA 1PSDA 4JBCA 4F3MA 4Q5VA 3CCZA 2O1PA 2UVUA 5AE2A 3MR5A 3MD3A 2AZ1A 1ZM9A 4GKKJ 1PYTA 1HMVA 2RU9A 2ATLA 4FF2A 3QLHB 3Q89A 2C3MA 4OX7A 4ILRA 3GU0A 3Q8RB 1XNQF 3TZYA 3DLEB 2YKMB 4OI0A 3NY0A 3K5MA 3C8YA 4PUOB 2YWKA 3FUYA 2ZD1B 4NLQA 1HPZA 3FEZA 4DV3J 2W2MP 3TA2A 2E7WA 2EI5A 4KYZA 4GO7X 2EEYA 4QJVA 3IGVA 3VGTA 3M8PB 4YB5A 2K7KA 2OPRA 2VL1A 1F3VA 2J7UA 3DLLQ 3HHLC 3LP2A 3KUEA 2K3IA 3TO8A 5GMDA 3U7JA 3R6LB 3GFZA 5JXSA 1FFSB 2QLJB 3BO4A 1V3SA 5HMXA 1KLMA 2O66A 3I5AA 5K8NA 2GJFA 1LK5A 1M0SA 4K7QA 2KFZA 4QIFA 3W9IA 3J7YI 2YKAA 1HNVA 2HYIB 2V0NA 2V68A 3H4DA 1NHKL 2VPWB 5K14B 1JNZB 3BM7A 1H7XA 2Y9HA 1WACA 3J81U 2QYCA 2CUYA 1S57A 5F9LA 2M2BA 3GB0A 2F7VA 2DNMA 2ZH4A 1JLBA 3OTEA 4MK9A 3A3NB 3Q2SC 4X66F 1F5CA 1AB8A 5EX0A 2HS4A 3MI7X 4K4VA 1CEZA 5L9NA 2B3TB 2G1HA 4DL7A 1YRTA 4KGZB 1HNZJ 1N5YB 3NNAA 3OW2R 4WIQA 2G1DA 1IKYB 3DFEA 3KDNA 3M2UB 4ES1A 3GJSB 1QUPA 2E5HA 3FJ2A 4ANEA 2MHNA 4LF6J 4WXOA 3DDKA 4G1QB 4YHHF 5C7PA 2VC0A 4TQSA 4USVA 4IH5A 5C42B 4RL1A 3M2VB 3G6VA 3GFXA 1BWEA 4ECSA 2WCXA 5E2QA 1K47A 3QMQA 4O3PA 4WP8A 1Y5NB 2E7XA 4F0KA 3BSCA 3PKMA 3KWMA 2APOA 1OQ6A 3MMBB 1SJQA 1PYSB 3CMES 3AQOA 5HVFA 5IWAF 5DG7A 2OD6A 2FHJA 4C0OC 3GONA 3NGRA 2Y1JA 1FKAF 1X4EA 3UDVA 2H5JB 2G2ZA 3S8SA 4KH1B 4J9PA 1RE1B 3KHGA 2N3OA 2GHVC 4KGXB 5F41A 4JV5J 2VPXB 3UDCA 4O3OA 3E2EA 3BGRA 1OIAA 2X1FA 2YXLA 2AJ1A 3OFGA 2VQEJ 2MPUA 3I56S 4RUHA 4RX6A 5GAGI 2XMUA 2KB2A 3KG1A 4UOCA 3RRKA 5D4OA 4CM2A 2Y0BB 3QBCA 4C3LA 1H2TZ 2VOOA 1JQGA 1MLAA 5E33A 2GIFA 4B3TF 1PBAA 2KFNA 2D9OA 5HN0A 2D69A 1S0VA 3MUTP 1R0AA 3TI0A 3DRPA 5A6PA 3N0VA 3W8PA 2GNKA 4DV4J 4KC5A 2Q1LA 2RILA 4AQYF 3G8QA 3L09A 3M8WA 3W63A 2XNRA 2QGFB 1Q86T 1VMBA 2V8HA 1XNRF 1RSCA 1ZYQA 1KONA 4DL0C 4NEYA 1T03A 1KN6A 2V8GA 1OSDA 4FNHA 3M4XA 5J1EA 4PPDA 1VOMA 3FVYA 3UCUP 2W01A 3QO9A 4DV7J 2ROGA 3TNVA 3C66A 1HI0P 1QM9A 4YR3A 4PZVA 4RU2A 5IS2A 2AKWB 2W9BB 2VBYA 3C6TA 1DFDA 2LU1A 2CJAA 3W8GA 2DNNA 4C11A 2XGQA 4ECRA 1WKJA 3RW6A 5A8RB 4JV1A 3RTVA 4LVNP 1FDBA 5AT1B 1ZAWA 1T0TV 4ICLB 2GO9A 4DCOB 2F4FA 4LFAF 2HWHA 2HQDA 3GJRB 2W8LA 1RADB 2WVBA 3P6YC 2CQIA 3DLJA 5JMNA 2W2PP 3TA1A 3KLGA 4B9MA 1ZM3A 1R27B 4KR0B 5KG2A 3O6QA 1WHXA 1TK5A 1WC5A 3HVWA 3EM1A 4L3KA 3HHLB 4DL6A 4S0MA 2UUCF 2J9DA 1BWVA 2L9WA 5HK4A 3QT8A 1FVSA 1VGYA 4OYZA 4JI1J 3H42A 1F2GA 5J2NA 1Q0NA 4Q2LA 2CPFA 2GVZA 4IUFA 2VPZB 2DD8S 5CAAA 2QT7A 1EARA 1K73T 2CQDA 1EX8A 2I5JB 2JWNA 4JUZA 1YJUA 2YNFB 3ZTSA 2D1CA 5E5NA 1S9GA 4LSZB 3T1HJ 2WSFC 4DU7A 4LREA 4DFJA 3K5NA 4W90B 4BLGA 1RA6A 2KHCA 3QT6A 4ZVQB 3KLFA 1N88A 1FD8A 1VRUB 1Q7LB 1KFDA 2W25A 4HYKA 3KYLA 2LQBA 1DTTB 4CLTA 4TYBA 3TUIC 2FZKB 4CLLA 2AEJA 2HW3A 3MXHP 2M7SA 2VOPA 4FF3A 2WB4A 5E41A 1IBMJ 4Z7YA 4EBCA 2VH7A 1D1UA 1CG2A 2U2FA 4M5LA 1C0TB 1XR7A 2VG5A 2XQCA 1IVZA 3RU0A 4YQWA 2E9TA 3QNWB 3D28A 3Q22A 1WHYA 1L3UA 1RTZA 3BGOP 4ELUA 2QSFA 2PMZD 3QWPA 2UZAA 4LMZA 4B9LA 3QFWA 2L41A 1L5UA 4CO3A 4HHJA 4IH6A 2P6SA 5D0EA 3PFEA 5HJXA 2GGPB 4LR8A 4X4UA 2ALZA 4NXMJ 3S6EA 3RB0A 4PKDB 3ETMA 3T6JA 3DOLA 2VDHA 2ALYB 4NCBA 1UZHA 4ED1A 4NRTA 2YX1A 3IFEA 2OEKA 2XY6A 1X4DA 1WWHA 4ZJLA 2RVJA 3C46A 2H4WB 1BQMB 2VG7B 4GVBB 2ZH6A 3PFOA 1T3OA 3AT1B 3OL6A 3GQCA 2DITA 2XG8A 2BA9A 1HWKA 3KJNB 4RUAA 1GEHA 1LOUA 4QIWD 5I3UB 4ZVOB 1SUQA 3JTOA 1R6VA 2M8DB 2IYGA 4KQZA 1NM2A 2KZZA 4KJIA 3DKDA 2HHSA 4RU9A 3R1LA 1VS3A 2WK4A 4A8WA 4OYMA 3QAEA 3ZTOA 3WX8A 3SCJE 3LALA 2DRAA 2HK3A 4IFYA 2V63A 3NRBA 4QQBA 3HLUA 4ZVRB 3PTWA 1AFIA 2DNKA 3JSYA 2RMLA 2V8PA 3CMQA 4Y34A 4ED2A 3RGIA 1AZSA 4IOCQ 2RE1A 2E5LJ 1SQEA 3SSSA 1TL7A 2OHDA 3W5ZA 3OXFA 2VU5A 2G0IA 2ZM6J 4PWDA 1RTDB 4TYAA 2EFNA 4LR7A 1UTAA 2WSCC 4UY85 1FJGJ 4OHYA 2F8EX 3W2WA 1WC6A 2DH8A 5IM0A 1PJ6A 3PDNA 3MURP 2Y1LB 3FCHA 2V4QA 1HMVB 1WTFA 4FF1A 2GC8A 4M5JA 1T9UA 1A7GE 2BV3A 2VG6A 4ZCKA 2FVQA 2JC0A 1JMTA 2MB0B 4Q0BA 1BQXA 1X5TA 3CCUS 4ZK7M 5F9NA 3LAKA 2X1BA 4F4YA 2DY9A 4HT7A 4NRUA 1VQMS 2IM0A 3OR2A 3RBEA 3T5JA 1LW0A 1NDPA 2R2TA 4CRJA 3TUPA 2CZVC 4QWEA 4I67A 3KLIA 2HHTA 1ZOTA 3M1VB 1N5VA 2OPRB 2X1AA 3M6VA 6AT1B 4FYWB 4RWXA 5G0RA 3LP2B 4NMLA 5K5MA 3J80Y 2ZOFA 4DWIA 1XJWB 1NUEA 5DG9A 1QD1A 2F63A 1FXRA 1RAOA 2F8HA 2UXCF 2R7XA 1KLMB 2DNPA 2JEGA 4JV2A 2HZCA 1SI9A 2B8QA 2HFUA 4QWAA 3ZZ0A 4G1IA 1UAWA 1W2BR 1FWLA 1GQEA 2MQ8A 2WVEA 1WNEA 4YEAA 5D6GA 2XSJB 2RDJA 1H74A 3KLEB 2ILZA 2Z2LA 2VKRA 4G65A 3GFHA 1LKZA 2HBYB 3N28A 1G7CB 4N47A 3CD7A 1JLBB 1LWFA 2HGNA 2NYHA 4LQ3A 3TA0A 2Z2YB 3SBMA 5FD1A 2EFQA 4V1Ak 2JH3A 4F02A 2J76E 3S1TA 2B4UA 2KH9A 1VQYA 2IRUA 3IS9A 4DR1J 2IMWP 3MM5A 2EW9A 1VDHA 5L8RC 1CJTB 3NGKA 1N33F 2AD9A 2YWEA 4EZ9A 1GH8A 1UPPA 2K1RA 4OZLA 5D0RA 2R7QA 3J7Z5 4ILLA 1SIZA 3LH2S 4JOUA 2FLOA 1AUDA 2IM3A 1FDDA 5LMNJ 1MWYA 4EBDA 5B0FA 2W8KA 4O3RA 3OTDA 2NZ4A 1TZ0A 1NK9A 4UQTA 2C2ZB 3A3OB 3EDQB 4NYOA 1U8SA 2OJ3A 5KFBA 2FVSA 2RNEA 4P72A 4MK8A 4DG1A 2IM2A 5KFSA 2UUWA 3E8OA 2WONA 3UCGA 4K2JA 5ETSA 3HKWA 3J7A1 2DHGA 4G6VB 1TL5A 3AB4B 3I87A 3T19A 2R2SA 3SSQA 4HEA9 1TV6B 2HWIA 4ELTA 2HLUA 1B99A 3E01A 4OI3A 2MKSA 3R7BB 1PC5A 4LFBJ 1VQ7S 1OMSA 1SVDA 1GMVA 1F6TA 2HVIA 2J5AA 3MAHA 3UDLA 2CVIA 4FXDA 5C24A 3DM2A 3F41A 2XULA 2R8JA 4DV1J 1SBRA 3G71S 2Q6CA 4RZRA 4ZLLA 3EGVA 3IR5B 1F2HA 3PO4A 3ZNUA 4I1TA 2EFVA 2J6TA 3RAXA 2KTQA 1SH0A 3OT9A 2UVVA 3JAMY 2YBVA 3GP9A 3CNQP 2QA4S 2W24A 5FLXU 2ZC3A 2VFSA 4ZJQA 4GO5X 2HWTA 2R4FA 1T03B 4DUZJ 2GIRA 3K5LA 3U27A 5F8LA 1CQMA 2MZQA 2NSBA 3T9NA 3NGUA 1RYRA 4JI4F 4B3SF 1HBNA 4WKYA 4J90A 1Q5YA 1ULRA 1WDDA 4C9DA 4U7CA 3RBDA 4B02A 2E9ZA 2GHWA 3WDOA 3TZXA 1AXQA 2VD3A 3RAMA 4CLZA 4OYWA 4LF4F 3QIPA 1I6JA 3C6TB 1LW2B 5HATA 4OLPA 4ZP7A 2MKJA 3DRYA 4YDXA 4ZLJA 4WFXA 5HMWA 5HMYA 1TK8A 5AXKA 1N32F 4IG0B 4C11B 2E1RA 4RW4B 1IN0A 4WZMA 4QIGA 5A6WA 2H54B 3AFGA 5IV4A 6FDRA 1HBMA 2M52A 2DPIA 4YB6A 2AYEA 1C1CA 3TZZA 4A48A 3H7HB 4USUA 4DMZA 4L3NA 4R25A 4K59A 2QA4G 1GFWB 3PW5A 3ILLA 1JX4A 1IR1A 4IO9Q 3I0RB 3SCKE 1MN9A 3A8KA 2FIUA 4PABA 3KLGB 3M6WA 3VAMA 2EXUA 4HH0A 3W9JA 4TU9A 2H48B 3TW0A 2BJ8A 3PR5B 2J0XA 4ZVEA 3HD1A 1HR0J 4A8MP 3P5TL 5D0HA 3M9MB 4WK1A 1U48A 1RT5A 2OSQA 3K7RA 1WF0A 2H3EB 1PCAA 1X9WA 2GVZB 2RH3A 1J27A 1DZ5A 1N54B 1NH7A 5B0GA 3CIZA 3KJFB 4K4SA 2GFFA 3Q8VA 4USJC 4KE5A 4O4RA 2KVQE 3DYAB 4IG3A 5EX3A 1JLAA 3AOCA 3CT9A 4KHPJ 1SJ4P 3KLFB 2ZNYA 3TANA 1IBKJ 4J9RA 1X31C 5F8IA 1GXTA 1BMQB 2MKCA 2ZUAA 2HMIA 1X9SA 2WB1D 1RAEB 1RK8A 4M5KA 4C0BA 3FGVA 2RT3A 5AJ3F 1CLFA 3GMGA 1P9QC 5L1IA 1KVIA 1XMBA 5F0UA 2W9CA 3MPYA 4OIXA 2F40A 5GADU 1IQZA 4WYWA 1KS2A 4NLGA 1QAYA 1WKKA 2EKYA 4NLYA 1F9EB 2ZZTA 4P2XA 1ITPA 1RT2A 3ZFVA 1JXVA 2CNLB 2C2OB 1J5OA 4Q8FA 2L48A 3MAAA 4LSLA 3M30B 1D3WA 1CBKA 1C4AA 1M1KT 4QWCA 4PYAA 1HWLA 4F36A 2MKYA 4NASA 3B4MA 1SKSA 3BKFA 3HJVA 4RUCA 4DQQA 3DOLB 3G4SS 1UFWA 4QR0A 3ZZTA 2BW2A 3KMQA 3DRSB 1YJRA 2LFVA 1HKAA 2AT1B 2JX2A 1T7PA 1GX5A 2W7AA 3QSIA 4P74A 5J2QA 1K0VA 4KGKA 1XC9A 1DLOA 4OYOA 1TUWA 4NYZA 4IRKA 5BR8F 2FGCA 3CCSS 1ELOA 3KDOA 3D66A 2ZJPQ 3HD2A 2RKIB 1DQ9A 5D0GA 1YHQS 5A8WB 2HGLA 3V4IA 3Q86A 2LXFA 1SUQB 2DY1A 1RAJA 1U25A 5F8GA 1ZA2B 1YG0A 4TXSA 2MMYA 1Y5LB 2HG4A 1NHUA 3M8QA 1DJ0A 1PJ7A 1VQSA 3FZBA 2ZHBA 4KBIA 2JVRA 4O3QA 5CYQA 2ZUGA 4IFYB 3UN3A 3BH7B 1MU2A 2XHCA 1AZSB 1GT8A 4ZPBA 3B82A 2CJYB 2HKEA 2J6SA 2M70A 4BS2A 1V5IB 1Q81T 1FWPA 1RU2A 2IRYA 1J5EJ 3SSRA 4LRDA 3CCTA 4PWDB 1V3ZA 1YJNS 4XIUA 1BLUA 3W2WB 2KYZA 5IM0B 3PEHA 2D7SA 1FRLA 1TKTA 3VAIA 3O8WA 4MFBA 4DR2J 2C2NA 1REVA 4DQSA 1H3DA 1HHTP 1VYAA 2V8VA 3UD5A 1CQNA 3DXSX 1YGYA 2AGOA 4ED3A 2VG6B 2ZOGA 3D67A 3VAGA 4AD6A 2ZKTA 3CCWA 1WF1A 4Q0BB 3U1LA 3WBZA 4KFBB 3SFUA 1MNEA 2RF2B 3JS9A 5F8HA 1U2FA 3UN2A 4AT1B 3DCAA 3RBXA 3DMJA 4NCAA 1M90T 2B0GA 3C6UA 3GSIA 1G3OA 4CCHA 1LW0B 3UR3C 3WX4A 2FC9A 2A2DA 4WFBQ 2MZRA 3GWCA 4RNOA 1WD6A 3KLIB 1C2PA 1VLYA 1S48A 3V6HA 1QAXA 1L3SA 2FZGB 4F2RA 5G0RB 4LIRA 1KP6A 3T5HA 1RAGB 2LQ9A 1QAJA 3NWGA 2P9EA 3LAMA 2Z58B 2IFXA 3HSDA 1KQFB 2E5GA 4F26A 4F4AA 2BXJA 1JIHA 4PXEA 2MQNA 1Q8LA 1NSAA 4HL9A 2AV5A 1JNRB 4QW8A 1RBOB 3D7SB 1AROP 1HD0A 4DSJA 4Z2XA 4HT5A 2KT2A 2CQ0A 2BRKA 2D41A 2DTJA 4I0WA 3WZ0A 4Y00A 3I55S 3TAPA 2FHJD 3BDPA 3CB4A 3GYXB 3VGSA 2CZ9A 1LWFB 1HQEA 3ZTPA 1U02A 3T1AA 2YH1A 2NXJA 4PR6A 1YX2A 1OYEA 2MQPA 1KRPA 3ZO7A 5DZ7A 3OQ2A 3CO0P 5ETQA 3A12A 3MM5B 2QLFB 3EGZA 3A8JA 4L6V3 1N36F 2OPSA 4C3MA 1S10A 1X60A 4ZN3A 2YWFA 1D8ZA 2MLXA 5CCMA 3BB5A 4PG6A 1U6FA 2K1RB 1FKPB 4DX7A 2AQ4A 1L3VA 2CJKA 1VR6A 3FEXB 4TY8A 2ASJA 3MCSA 3CC2S 1IBLJ 2V50A 2P8IA 2DIVA 3NL0A 3B6BA 5LSOA 1KVKA 4JI0J 3QPIA 2HNDA 2WRMA 1Z1ZA 2YH0A 3K5OA 1WG1A 5GAEU 5C2GA 4ZLNA 5KFLA 3IR6B 3VAJA 3UE2A 1VBZA 5E3QA 1SJRA 1FTRA 2W4PA 1WG4A 4ZDNA 2GJ2A 3Q0AA 2RU3A 2B9YA 1RHMB 3C15B 2NLWA 3QFHA 2QA2A 3E01B 1RAIB 2AYGA 2B51A 2W4CA 2YWHA 2NXEA 5EDWA 2OH2A 4DX8H 2K2PA 5C24B 3DM2B 1C0UA 4DZ6A 2VF3A 3FRYA 3MTKA 5D3GB 2RRAA 2LYVA 1UA1A 4KO0A 1VQLS 1RWUA 2FUG9 3SQOP 3OUYA 3SQGA 2BJ7A 4CH1A 1QVFR 4KKOA 4ANDA 3CDUA 3DGPA 1E6VA 2F4VF 5AXMA 4QU6A 1AYEA 2MTLA 2R8IA 1HARA 4IQXA 4ERDA 4N7TA 3D54A 4QIEA 1WHWA 4FZVA 3OTOJ 2HNZB 2D3O1 2AMCB 4EI2A 5I42A 1SIWB 3MM7A 4B3OA 1OSCA 3GYGA 3GIJA 3MMCA 2R8HA 5KFDA 4CH0S 4YP3A 2CPXA 3SCIE 2R7UA 5B0CA 2UXBF 4TU7A 1ICEB 4EMDA 1AA1B 3TX8A 3RB6A 1U2RA 1JJ4A 2BX6A 4Q7AA 2KVIA 1TKZA 3CD6S 2IVMA 3K8VA 3CTRA 2GO8A 2RHSB 7FD1A 1N5QA 2DH7A 3G6ES 1XNQJ 2CG8A 2HFNA 2VKZG 3W65A 4UOHA 1MW7A 3QIPB 3H5SA 4URQU 1FE4A 5CCLA 4LRAA 2A0FB 2KT3A 2C2EA 1FERA 4DSLA 3GG0A 1X9MA 3AJ1A 1RWVB 1S1UA 4JI7F 3H2LA 5F8JA 5T14A 1OJ4A 2XLKA 2ZVSA 2MKKA 3GR1A 3NGTA 4M5GA 4KGMA 1VBYA 1OPZA 1C1CB 2I2YA 4NL5A 4YOEA 3A1YG 1X4BA 3EZUA 2CRLA 4UY8T 2AX0A 5HVHA 2GAHC 2XY7A 4I7FB 2AYBA 3OFFA 3VGVA 4NI2A 2L08A 2LXUA 2BM1A 4N41A 2WBRA 4Q8EA 3BSNA 2E7VA 2G4BA 3WIVA 2LECA 1EAYC 4V19X 2C2KB 2P6TA 3SZ2A 5DM7Q 5ITHA 2DNQA 2ZJRQ 3M7VA 5KFAA 1BE4A 3OJSA 4I6AA 5KFKA 4RPFA 5KTQA 2KXFA 2RQCA 1HI8A 1S1XA 3NKYA 3S01A 5GMEA 4X66J 2D3OR 2ZZMA 1JLAB 3D0HE 3NAIA 3V6KA 4DL5A 2CPEA 7AT1B 4JI2J 2IBKA 1FEHA 3VQTA 3DNCA 4WP9A 1RTIA 2J9CA 4OYIA 4F3QA 2VB6A 1S6QA 2PFDA 1HD1A 5I3PA 2RQKA 1RWMB 3V2UC 3QAUA 3SV3A 3HHDA 4F2SA 4QR1A 2QRRA 5T7LA 1OY8A 4LF9J 2KT5A 2MLZA 3EE3A 2XMMA 1KBRA 2DCLA 2ZBQA 3D6TB 1RHJB 2V67A 5AXLA 3NNHA 4F0MA 4KV8A 1IXKA 2NXCA 3WC0A 1VK8A 4EK2A 2QN6B 2X51A 5A76A 2B5JA 1BHNA 4M95A 4LF6F 2MLYA 1VRTA 3KK2A 4DV5J 1J5OB 1YQHA 3RRGA 3R2CJ 2XCPA 3MUVP 3CCQS 3J80U 4OZ2A 1N56A 3MAAB 3H90A 2MEWA 1X5SA 3LANA 3DRRA 4J9LA 3N5BA 2MGZA 1XR5A 4MK7A 3H5UA 1Y10A 4DR4F 2IDLA 4DXLA 2OPPA 5LXYA 1WTBA 2KYXA 3J7ZT 5ADZA 1GMUA 1HNIB 4ENOA 4GMKA 2VBWA 3R1HA 4B3TJ 1GXUA 2N4CA 1S1TA 4WU2A 3DHXA 5J2QB 1Q78A 2OI2A 2W2NP 1DLOB 3EZ5A 4JV5F 2VC1A 3U02A 2R7TA 3BGUA 4C2MA 3DOKB 3PKYA 4OI2A 3LQVA 1W25A 5CZVA 3HXMA 4AQYJ 1Q4RA 4DR5J 2XS5A 2IY5B 2Q3PA 1XK8A 1UMJA 3V4IB 4RNNA 1N0VC 1VQNS 1XNRJ 3D6MB 1PAUB 3M8QB 5LT5A 1VJQA 3PV8A 1FJ7A 1SKRA 1N5TA 2XMVA 2KRRA 1RU1A 1YI2S 2HIYA 4YFUA 5J1PA 3GG1A 5LJ3Y 1N8RT 4DV4F 2XO6A 2B6AA 1B7YB 2IBOA 4NEZA 3MEDB 2LA4A 1MU2B 1S1WA 2ASYA 1VQ5S 2OUGA 3JSMA 5ETOA 1OS5A 1SH2A 2HURA 1UFKA 1TU0B 5E3RA 3BZQA 1Q16B 4G3IA 3GE9A 2QE5A 2NREA 5DO2A 5LM7E 1TELA 2IAJA 2XLJA 4O3NA 2CQBA 2K8GA 1WUUA 2Y1RI 1TKTB 1U1MA 1VC5A 3N4WA 4KH0B 2CNKB 4MFBB 3ONQA 2CA9A 4DV7F 3MM8A 4LRCA 2GQ2A 2R7RA 5DDQC 2GMLA 4DZDA 3FBFA 3QGHA 4ZOSA 3TUJC 1N0UA 1B4SA 4B3MJ 3I5BA 2JL9A 3PO5A 3MR6A 3C6UB 2C22A 3BYPA 3VR1A 1NDLA 4RUBA 2DR9A 1YDLA 4Y2KA 4OZ1A 4RWWA 1EHWA 1FNOA 1CJUA 2UUCJ 3JAMU 3D1OA 2VFUA 4JI8F 3MDFA 5K20B 3IP0A 1UWBB 1N6QA 4XTTA 2I8EA 2BJ1A 2ZJQQ 3TEHB 3LWMA 2QMUB 4WE1A 2HEKA 2CDQA 1NAQA 3CWJA 1CJKB 2DGXA 3HI9A 4OHZA 4QYZJ 4NYPA 3LP0A 3HHKA 4GVLA 4U9RA 4DI6A 1X5PA 1BY9A 4Y2CA 3M8RA 4ECUA 2FJVA 4NZ6A 3DLGA 5B0EA 4WCEQ 2VUGA 2ZH7A 2K06A 2JJ4D 3J7YU 2BBEA 2GMHA 1TL4A 1UEUA 4WFNQ 3MMAA 1U47A 1H73A 4OZJA 2AX1A 1HQEB 3MEKA 2B7BB 3D1HA 2EVZA 3C14A 3T1HF 2NZCA 1T8EA 1S79A 9RUBA 3KG0A 5KFNA 3PR4A 1FXDA 3MF5A 4L76A 5CZXA 4CWBA 3QJJA 1NLKL 4U6PA 2O5DA 4DEZA 5E7OB 4PQAA 1JB0C 1Y9OA 4OZ0A 2OPSB 3DU6A 2BQ3A 2ZOMA 3AOAA 2ACYA 2RRNA 1IJEB 3L9ZA 4X62F 4QBUA 5J2MA 5FIIA 4YDDB 4TY8B 2UUAJ 4MTPA 1NKEA 4DFKA 4F7VA 2JC1A 2A10A 1R89A 4LRFA 3AA8A 2XCAA 5EHHA 4ZP8A 1WC1A 3ELHA 5ETRA 1UEVA 5KFTA 2ZH9A 2JLEA 2HNDB 2J8AA 4M5MA 3TZWA 1TKXA 3PIPQ 3W1YC 3OHBA 1NJWA 4L72B 1JK9B 2BACA 4OFZA 3FBEA 3TR5A 3LF0A 4ZP6A 2QZ8A 1RHUB 2XBPA 1HQUA 4EYIB 3MTJA 4EBEA 4O0IA 1HW8A 1Q5VA 2Z2MA 2DNYA 2YNGA 1TKDA 3ISND 4ZS6A 3GCWP 3W9HA 4NLTA 4X4RA 3QT7A 1C0UB 4M5NA 2DJWA 2HBZB 5H9EJ 5L1JA 5HI7A 4Y2IA 1T02A 2AJ2A 3HM9A 4KO0B 2HGMA 1FESA 5GAGU 3GV5B 1AW0A 2OELA 3OUYB 3SQGB 2B56A 4KKOB 1RAFB 3DGPB 4WP3A 1E6VB 1OY6A 1YK9A 4OYBA 2YPZA 1A0OB 4FKYA 3G82A 4ED7A 3L4BC 3ZZZA 2RD5C 4A8FA 3G6XA 3PZPA 1X4HA 1CS4B 2PEHA 2XM3A 2FDNA 4X4OA 1T3NA 3EGWB 1YKWA 2JDJA 5I42B 4YS2A 5IT4A 4B3OB 3MMCB 4ID5A 5EN1A 5D4PA 2JSXA 2BJ3A 2BANA 3G8TA 3R27A 1SL0A 2YQ0A 1YBUA 2CJ9A 2YPYA 1T9WA 2AWZA 2V2KA 5B0DA 3QGGA 3A13A 3UI3A 4K5RA 1TKZB 4A46A 1DHMA 2RAQA 5A8KB 3R5GA 2VZ9A 4OJ1A 2LLZA 1NO8A 1XMQF 4K4UA 4J9NA 1VHIA 1S0NA 1SJFA 2CQPA 1RAHB 4WPAA 1FKOA 1FFGB 1S6OA 3LP1B 3CD5A 2HS3A 3O1LA 2DGWA 2FJAB 3IWLA 1Y4ZB 4Y6IA 1AFJA 4FXVA 2ZH2A 3ILJA 4ZCIA 4ECTA 4FBUA 3ENQA 2EBEA 2ROEA 3ITHB 4DOZA 2PT0A 4DLGA 4MKBA 4USMA 5DGBA 3NNCA 2FB0A 4JP8A 4NI2B 2OD4A 2UXCJ 3MPUB 5DDRC 4B9VA 1O8BA 1UZDA 2ZEJA 2BOAA 5KFWA 1FRIA 2VA2A 3K89A 1RKIA 2FYXA 2HFVA 2DNZA 3IGNA 4DQRA 2DNGA 3UCZP 3GCXP 4P6QA 3VGUA 4A8YA 2IPOB 5A0YA 2XSFA 2KDOA 3BGLA 1XIQA 4M5DA 5KG0A 2PIIA 4H4MA 2JEIA 4PQUB 4C97A 3FNNA 5DZ6A 3W64A 1UCNA 1KWMA 1MROA 3E51A 5L39A 1UJ5A 2Q79A 5C2CA 1HBUA 3TEGA 2N3LA 1CJVA 1FRJA 3CCES 4Q43A 1PYOB 5K8MA 2L3MA 3HX9A 2WZ1A 1N33J 1RTIB 5KFIA 5LJ5Y 5GADI 2DT9A 4FYXB 5IV3A 2HFOA 5I4MA 1HNWF 1LV5A 4N8NA 4PEOA 4OX9F 7FDRA 3PRBA 1HLWA 5T7LB 3MPDA 1WEZA 3CUNA 5D15A 2NS1B 4LIWA 1PBUA 3SV4A 1WC4A 2DEIA 4DR1F 1LNQA 2EKNA 4PPZA 3CJKA 3CJQA 2UVRA 2IVFB 1UVIA 2J0SD 2LQ8A 1ROFA 5DQHA 1Z2ZA 3ZZPA 3OHAA 3QZ7A 5H9FJ 2XO7A 3UD4P 1SJ1A 3HHEA 1VRTB 3CIMA 4P7TA 4MIBA 3PX6A 3FBCA 4H4OB 4IFVA 2V2VA 3FCVA 3VF0B 1U24A 2FQQB 4LR9A 3M6UA 1NB2A 2YX4A 3DRRB 2V8DA 1X4AA 2MGZB 2KJWA 3R3TA 5B0BA 1I94F 4NCGA 3U1NA 2CQHA 4G1PA 2W7OA 5L46A 4JI3J 1IJFB 2JHEA 1QAIA 1S1TB 3AJ2A 4DLEA 2MHEA 1K0TA 1V3RA 4LFBF 5KAKA 2E5IA 4KT0C 1RHQB 5KFMA 2PGCA 2JZ5A 4QWBA 3KHLA 4MYTA 1LWCA 4FP9A 2E66A 3BH6B 5HP1A 3ILOA 4RKUC 1XQIA 4FBTA 3SFGA 1NRKA 3NCRA 4ED6A 4MIWA 2DEJA 2L9NA 5GVQA 3UO0A 4NLXA 1UVKA 2I1RA 4DHVA 2B6AB 5AE3A 2OPQB 2FY8A 3AXKA 3A3PB 4JI4J 1UEKA 4BC9A 2V5HG 2N82B 1UWAA 4OQJA 2OTLS 1TR0A 2R42A 2DGOA 2QFIA 4ZVSB 1TL1A 4CM0A 1U8WA 3MZIA 3K58A 1ZPWX 2CPHA 1BUXA 4J37A 4CI0B 1M5PC 4A8XA 1G2EA 3I6PA 1NPRA 1KFSA 4O4GA 4XDDA 4DUZF 1RCOB 1U4BA 4U96A 1WSVA 1JLCA 1DY3A 5KFEA 2EC0A 1N32J 2IAJB 1S9EA 5A2QY 3R5JB 5KFZA 4Y28C 1TVRA 2WHOA 2ZH3A 1UJ6A 4B9SA 2HHHF 2SXLA 2XWYA 1BXNA 1JJHA 2BW7A 4ZP9A 3ZC4A 1L3KA 1B64A 2DISA 2FJWA 3G8SA 2XS2A 3GV7B 4IOAQ 1S6UA 4ER8A 2XYHB 2PO4A 1H2VZ 2ZD1A 1LQ9A 3D2WA 1QLNA 3LOUA 2M88A 2IVYA 2H4YB 4O3SA 2DVIA 1S99A 3PNIA 2V69A 4C8YA 2VONA 2R7VA 3CMAS 5IC6B 1SKUB 1HQ2A 4DV0F 1VQ4S 2W2OP 4WK3A 1W7WA 4CLKA 1B3TA 4LBHA 2BUNA 3PRDA 3SMZA 4DUYF 2K7JA 2Y0SD 1KTQA 3OR1B 4WE1B 4Z7CA 5J2PA 3HT3A 4FYVB 4WFZA 2MJUA 1NJZA 1P9YA 3BR8A 5KG7A 2A18A 3O2IA 3HZEA 2A3JA 3HULA 3LP0B 3LGMA 4P2FA 1RT4A 1TAQA 2AEMA 2DIUA 2XB2D 2CXEA 2CNOB 3KTQA 4URGA 3DLGB 1U1PA 3DN9A 1HR0F 1FWKA 5KG5A 5E3AA 2M0GB 2ASDA 4ALZA 2BE9B 4DPWA 3M8ZA 3PXGa 2HQCA 2UXDJ 4EZ6A 4X84A 2CJXB 3TJ9A 1JLQA 3R6GB 1S59A 3MMAB 1ZA1B 1RT3B 2AHOB 3UQSA 1C1BB 5AJ3J 2PE8A 3DHWC 4F04B 1TL3A 2QLWA 3AA9A 2HNYA 4KHPF 2HHVA 2Z2ZA 1U6BA 3PW2A 4JYAF 3H2VE 1JKHB 1WI8A 4H4KA 2WTFA 2OIHA 3CC7S 1IKYA 2ABYA 2CJQA 3M2UA 2CPZA 1WF2A 2B9XA 3EGNA 3MM9A 5KOWA 2ZC4A 4G1QA 4UZCA 5SZTA 2OMLA 1N48A 3M2VA 2VQFJ 4CP5A 3MMJA 2PA8D 3SXLA 5GAEI 5HQLA 3TARA 3OBIA 4ILMA 3VWSA 2NCKL 1F1BB 3IA0A 2FC8A 3W7BA 5KT3A 3CF5Q 1UVMA 3QRQA 2AZ3A 4CO4A 4FXWA 4QU7A 3R5DA 3M6XA 1TKXB 3KJQB 2ZHAA 3HF5A 3PX4A 4N56A 4NXNF 4B9NA 1JLFB 4JI6J 2ACMA 1RUSA 1RZMA 1HQUB 5HAOA 1K44A 2KU7A 5KT6A 1D09B 1KR4A 4ZKAA 1Y00A 3M32B 1ZTTA 4PG4A 2YNGB 3AD8C 4NLPA 3TWZA 3HVRA 3RB3A 2ZZNA 1I51B 5D8HB 3TQEA 5KG6A 1S72S 1GNKA 2OFGX 4NZ0A 1HNXF 3VCDA 4P7VA 5CHCB 4QYZK 2BZ2A 4U95A 1FRKA 1JXEA 3EPIA 4OZ3A 4UOGA 3CDEA 1BC6A 2BJ9A 2JRSA 5KFXA 3D0GE 1UW9A 3EPGA 1LK7A 4W92B 4DN9A 3G82B 2W7PA 3R97A 1RT1A 4CNZA 4A8OA
chains in the Genus database with same CATH topology
3NGTA 1WKJA 4C6AA 3VGUA 1NDPA 1EHWA 3ZTOA 3WX8A 1WKKA 2DXFA 1KDNA 1NDKA 3EVOA 2CWKA 2B8PA 1VYAA 1NHKL 3BH6B 5CABA 2AZ1A 5IOLA 1F6TA 1NDCA 2HVEA 3EMTA 2HURA 3L7UA 3ETMA 1S59A 1XIQA 1XQIA 3EVWA 4ANCA 4FKXA 4ENOA 3Q89A 2HVDA 4O0NA 4KPCA 3PRVA 1JXVA 1K44A 3Q86A 4HR2A 3FBCA 1S5ZA 1S57A 3FCVA 1NCLA 3JS9A 3BBFA 3VGSA 1UCNA 3NGRA 3VGVA 3PJ9A 3NGSA 1NB2A 1ZS6A 2VU5A 3Q8VA 3ZTQA 3ZTPA 1NUEA 1NSKL 4DI6A 2DYAA 1NPKA 1PKUA 3VVTA 3Q8YA 3EE3A 1NSQA 3FBBA 2DXDA 4FKYA 2B8QA 1HHQA 3ELHA 4F36A 5BXIA 2BX6A 1W7WA 1LWXA 1HIYA 1LEOA 3BH7B 2BEFA 3FC9A 3GPAA 1U8WA 1PAEX 3ZTRA 1BUXA 3EVMA 3FCWA 3GP9A 3FBFA 3EM1A 3EJMA 3R9LA 4EK2A 3VGTA 4S0MA 3Q83A 2ZUAA 4DZ6A 1F3FA 3DDIA 4W98A 1BHNA 3BBCA 1WKLA 1B4SA 4UOHA 1BE4A 3FBEA 4UOGA 2DXEA 4CP5A 4ANEA 1NSPA 3Q8UA 5CAAA 4F4AA 4DUTA 2NCKL 1HLWA 3EICA 3MPDA 2DY9A 3BBBA 3DKDA 3ENAA 4UOFA 4ANDA 1NDLA 1MN9A 3B54A 5C7PA 3G2XA 3FKBA 1NLKL 4WBFA 3ZTSA 1B99A 2AZ3A 3VVUA 3NGUA 3B6BA 1MN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGT A;  1WKJ A;  4C6A A;  3VGU A;  1NDP A;  1EHW A;  3ZTO A;  3WX8 A;  1WKK A;  2DXF A;  1KDN A;  1NDK A;  3EVO A;  2CWK A;  2B8P A;  1VYA A;  1NHK L;  3BH6 B;  5CAB A;  2AZ1 A;  5IOL A;  1F6T A;  1NDC A;  2HVE A;  3EMT A;  2HUR A;  3L7U A;  3ETM A;  1S59 A;  1XIQ A;  1XQI A;  3EVW A;  4ANC A;  4FKX A;  4ENO A;  3Q89 A;  2HVD A;  4O0N A;  4KPC A;  3PRV A;  1JXV A;  1K44 A;  3Q86 A;  4HR2 A;  3FBC A;  1S5Z A;  1S57 A;  3FCV A;  1NCL A;  3JS9 A;  3BBF A;  3VGS A;  1UCN A;  3NGR A;  3VGV A;  3PJ9 A;  3NGS A;  1NB2 A;  1ZS6 A;  2VU5 A;  3Q8V A;  3ZTQ A;  3ZTP A;  1NUE A;  1NSK L;  4DI6 A;  2DYA A;  1NPK A;  1PKU A;  3VVT A;  3Q8Y A;  3EE3 A;  1NSQ A;  3FBB A;  2DXD A;  4FKY A;  2B8Q A;  1HHQ A;  3ELH A;  4F36 A;  5BXI A;  2BX6 A;  1W7W A;  1LWX A;  1HIY A;  1LEO A;  3BH7 B;  2BEF A;  3FC9 A;  3GPA A;  1U8W A;  1PAE X;  3ZTR A;  1BUX A;  3EVM A;  3FCW A;  3GP9 A;  3FBF A;  3EM1 A;  3EJM A;  3R9L A;  4EK2 A;  3VGT A;  4S0M A;  3Q83 A;  2ZUA A;  4DZ6 A;  1F3F A;  3DDI A;  4W98 A;  1BHN A;  3BBC A;  1WKL A;  1B4S A;  4UOH A;  1BE4 A;  3FBE A;  4UOG A;  2DXE A;  4CP5 A;  4ANE A;  1NSP A;  3Q8U A;  5CAA A;  4F4A A;  4DUT A;  2NCK L;  1HLW A;  3EIC A;  3MPD A;  2DY9 A;  3BBB A;  3DKD A;  3ENA A;  4UOF A;  4AND A;  1NDL A;  1MN9 A;  3B54 A;  5C7P A;  3G2X A;  3FKB A;  1NLK L;  4WBF A;  3ZTS A;  1B99 A;  2AZ3 A;  3VVU A;  3NGU A;  3B6B A;  1MN7 A; 
#chains in the Genus database with same CATH topology
 3TJ8 A;  4CT9 A;  3D6H B;  1K1S A;  4X4P A;  4AUK A;  2W2Q P;  2MQL A;  1IKV B;  4ED4 A;  2YKN A;  4NLS A;  4ID5 B;  1GAO A;  1S5Z A;  2Q66 A;  1QY7 A;  2DO4 A;  2D3U A;  2BAN B;  3BBF A;  2IJF A;  3ICL A;  4DR6 F;  3Q8P B;  5C5J A;  1ZH5 A;  1UP1 A;  2UVW A;  5KFG A;  2H65 B;  2HHX A;  4R0J A;  3IWN C;  1VK3 A;  3HO1 A;  2DNR A;  3BKT A;  4YUD A;  1FDN A;  5U47 A;  3N6N A;  3DLH A;  1Q53 A;  3FDS A;  1YZ7 A;  5DJB A;  4ZCM A;  1NU4 A;  1FKO B;  3I31 A;  5EUH A;  2Y3Y A;  2MDA A;  5IQQ A;  1Y3K A;  2GVD A;  1V5V A;  1M1G A;  2V4R A;  3HVT A;  4CO2 A;  4QCL A;  3MOJ B;  2HHP A;  4RW7 A;  1S4F A;  1U1O A;  4DL4 A;  3V6D A;  3TOQ A;  1WEY A;  3EMT A;  4MKV A;  5KFJ A;  4D3H A;  3NAH A;  3KLH A;  4FS2 A;  2C3U A;  2CJB A;  3UNY A;  3PYD A;  4OV1 A;  1VBK A;  2E29 A;  2JLF A;  1FHT A;  4P2S A;  5KFQ A;  4UST A;  4Q44 A;  2BQU A;  2DXD A;  5H9E K;  1HHQ A;  3CPW R;  1V6H A;  1P8G A;  1N52 B;  5BYS A;  4DL3 A;  2F1F A;  3PCO B;  5BYQ A;  3JSR A;  4ZVH A;  1HPZ B;  1DQA A;  1WJ9 A;  2V2Q A;  1MRO B;  2YNF A;  4CZC A;  1K1Q A;  2J0W A;  3R7N B;  1HBU B;  1AUS L;  1RB0 A;  3B54 A;  3RUB L;  2CYY A;  1CJV B;  2RDI A;  3BV8 A;  4OV6 A;  3KNG A;  4IQM A;  1RP5 A;  1N36 J;  3EDR B;  1DTT A;  4C98 A;  2RUG A;  2VHG A;  3ETO A;  4A4J A;  4C8M A;  4O0N A;  4NX9 A;  3PRV A;  1HNV B;  1YSJ A;  1U1L A;  3LPE A;  2R7O A;  2BMB A;  3F56 A;  3T5K A;  1B7F A;  2ATC B;  1YIT S;  2QIF A;  3BRE A;  2POK A;  1C0T A;  3CJK B;  3WIU A;  3IRX A;  2CNN B;  3M8Y A;  3PW4 A;  2JEJ A;  4PG5 A;  1NJY A;  4DX6 A;  1P1L A;  1ZM2 A;  4IFV B;  2C42 A;  1SQG A;  2VA3 A;  2HBR B;  2BDP A;  3BO3 A;  2PFF B;  3LGN A;  1G1X A;  1NK5 A;  4ZCL A;  4LF8 F;  1SL2 A;  2WBM A;  2GGP A;  4NCG B;  3W61 A;  3OFH A;  3AHP A;  2CWK A;  1XR6 A;  4ECW A;  1YZ6 A;  5IOL A;  2DGT A;  2B4O A;  2NPI A;  2HVD A;  1RWP B;  4KIA A;  2H5I B;  5SUH A;  1FD2 A;  3JTN A;  3CCM S;  1NJI T;  2KG0 A;  1WSR A;  1S49 A;  1SC4 B;  3FBB A;  4X2B A;  3NG8 A;  1LWC B;  1X0F A;  1F9H A;  3T1Y F;  2IRX A;  5HP1 B;  2QMW A;  1O0P A;  4DFP A;  2EPI A;  4Y65 A;  3GIL A;  2QC3 A;  3GJT B;  4RR5 A;  3BGR B;  2HQF A;  2ADB A;  1WG5 A;  1N4L A;  2YKP A;  5KG1 A;  4K4Z A;  1H72 C;  5GAH U;  3W2V A;  1FFW B;  3F44 A;  3IC1 A;  5RUB A;  4C0H A;  3T3F A;  2R8G A;  1QVG R;  4X65 F;  2RS2 A;  3IG1 A;  2MQQ A;  1MG7 A;  4DV6 F;  5JVH Q;  4GC6 A;  3KJV A;  4X64 F;  1UVN A;  1Y5I B;  5B0A A;  1RAB B;  2RRB A;  2XWX A;  2CPJ A;  4OJG A;  8AT1 B;  1R0A B;  2KM8 C;  2VIC A;  3CC4 S;  2ZVI A;  3EUN A;  2EFP A;  1RTD A;  2QO3 A;  3DRP B;  4J91 A;  3FSX A;  2MKI A;  1RT6 A;  2C2R A;  1S9E B;  3IWX A;  4A47 A;  2IDE A;  1M5H A;  1TVR B;  5F0W A;  4JI7 J;  4J9U E;  3CE8 A;  5ETV A;  3T6B A;  2KXH A;  4WII A;  1FE0 A;  5H9F K;  4ITS A;  4DS5 A;  3CDA A;  4Y0F A;  4OX8 A;  8ATC B;  2GA7 A;  3NBP A;  3SI8 A;  4DJB A;  2DO0 A;  2V94 A;  1H98 A;  2R7W A;  4M63 A;  5J1E B;  2YQ1 A;  1SPB P;  2I0X A;  3RRH A;  2XMJ A;  2AJ4 A;  2AF6 A;  4K4T A;  4ZPD A;  3QO9 B;  2XLI A;  2HPU A;  3LUY A;  1IR2 A;  3DC2 A;  4IRC A;  4LFC J;  4WBF A;  2G2O A;  3H98 A;  3M1V A;  4IYQ A;  2E1P A;  1HL6 A;  4TVA B;  4KHR A;  3HCX A;  2R7S A;  1M5O C;  4N8O A;  1D0E A;  2GQQ A;  4YN3 B;  4IO1 A;  5J2P B;  3TX0 A;  1QTM A;  3DOM A;  1RWX B;  3OL9 A;  4XPC A;  1HYS A;  3MCN A;  3US5 A;  1MML A;  1RT4 B;  2JNJ A;  4HDH A;  3THT A;  1VJW A;  4C8N A;  2FHK A;  1H2U X;  1FX4 A;  5DET A;  1X4G A;  1K8A T;  2XSJ A;  2EK6 A;  5D4N A;  3KLE A;  2DHA A;  1DTQ A;  1H7W A;  4CO1 A;  4L73 A;  3GV8 B;  2R9L A;  1SH3 A;  3UDE A;  1JLQ B;  1O51 A;  3ZTR A;  3NS7 B;  4FNI A;  5KG4 A;  4UZB A;  4KGV B;  3HJF A;  4IDK A;  3IAM 9;  2V9W A;  3QRR A;  1TL3 B;  1SXL A;  3JQM A;  3GLJ A;  2A6M A;  2HNY B;  2FJB B;  5D78 A;  1FA0 A;  4DS4 A;  2C3O A;  4JI2 F;  4B3R J;  5J2N B;  2OGU A;  2HHU A;  2B43 A;  4X4V A;  1EQM A;  1CJT A;  5KFF A;  1DUR A;  2F65 A;  2FTR A;  3MM9 B;  1RWW B;  3L3C A;  4EU0 A;  4CTA A;  4OJ3 A;  2HIQ A;  3QJL A;  1S9G B;  2J9D E;  2ZH5 A;  1JJC B;  2AIR B;  2ZH8 A;  2FLL A;  4DPT A;  2C28 A;  1RXO B;  2P9G A;  4LF9 F;  5HL7 Q;  2HFS A;  4DBQ A;  4QOT A;  4MAK A;  4DR4 J;  3MCM A;  3CJ3 A;  4NA3 A;  5FDL A;  3MEG A;  3P45 B;  1KOO A;  2OFH X;  4DCJ B;  1Y0H A;  1U7L A;  5HLF A;  4IRD A;  1PAE X;  3FCW A;  4DV5 F;  2IM1 A;  3DGV A;  1ZZF A;  1G4C A;  1U0S A;  1F3F A;  3T41 A;  2GV1 A;  1TV6 A;  4LF5 F;  3L95 X;  2ADC A;  2VG5 B;  3RAQ A;  3K0J A;  4YY3 F;  2VAS A;  2ZBC A;  5JVG Q;  4J9K A;  3C16 A;  2P5V A;  4USI A;  5C25 A;  4EO6 A;  2DGV A;  1HA1 A;  1WOO A;  1F9F A;  2GMJ A;  1JJ2 R;  3BDE A;  1RWK B;  1NZ8 A;  2RIJ A;  3FMB A;  2NSC A;  3D0I E;  2G0J A;  2HRU A;  4LF2 A;  3NMR A;  4DSF A;  1QSL A;  2V34 A;  4ECZ A;  4EWT A;  4UF4 A;  4FKX A;  4J9M A;  2XZD B;  4CDI A;  3IM9 A;  4ZVT B;  1OPI A;  4NMX A;  2HAF A;  4KHM A;  4DX5 A;  4JI5 F;  3JQJ A;  4MYU A;  1U0H A;  2CKW A;  3D9B A;  2W1B A;  2K3K A;  2BAB A;  4C8L A;  1Q79 A;  1RT1 B;  4DR5 F;  1VIX A;  3OSN A;  2C2D A;  3CCJ S;  2RS8 A;  3M2R A;  3MHY A;  5F8N A;  2Z4P A;  5E0O A;  5LMU F;  1LWX A;  4ETX A;  2NXU A;  2BEF A;  4WFY A;  2YKN B;  4Y2M A;  1EET A;  2EC2 A;  2F8M A;  1HBO A;  4FF4 A;  1NME B;  3POT A;  3CJR A;  3OTC A;  1F5B A;  1M1H A;  3KNA A;  5KT7 A;  3KLV A;  2HRT A;  3MGJ A;  4I6W A;  3MFH A;  3BGF A;  1EQ0 A;  2QL5 B;  5KT4 A;  1EB0 A;  2KM8 B;  3IBC B;  3OL7 A;  2BOP A;  2IJN A;  5CD4 A;  1U45 A;  5HBM A;  1ZBT A;  1RIS A;  2XY5 A;  3PYF A;  4OLO A;  2YVS A;  4ELV A;  3H2U B;  1MSW D;  1LW2 A;  3DU5 A;  3LGH A;  3N79 A;  3GJQ B;  1B0V A;  1GK8 A;  1AT1 B;  2ZNZ A;  4IG0 A;  2RUS A;  4RW4 A;  1T9Y A;  2GVD B;  3P5B P;  1SC6 A;  4DR7 J;  3SYZ A;  3NGS A;  3AB2 B;  5B08 A;  3M8S A;  3HVT B;  2JVO A;  2UU9 J;  5LOQ A;  2LMI A;  4FS1 A;  3ISN C;  1R31 A;  4DPU A;  1NSQ A;  1WI6 A;  5EGY A;  1TL7 B;  4LUB A;  4RW7 B;  4JI8 J;  1JLE A;  4DF4 A;  3RJM B;  1NK7 A;  3V6D B;  5HMZ A;  4B3M F;  3R9L A;  3KLH B;  3I0R A;  1URN A;  1W26 A;  4ZIV A;  3G87 A;  3ZZO A;  3OVB A;  1NB7 A;  2WVF A;  3NS5 A;  1UFL A;  2IA6 A;  4DL2 A;  1LXJ A;  1UJ4 A;  1K9M T;  5GMK a;  1ZM4 A;  1OQ3 A;  1MWQ A;  1RGV A;  2E1C A;  4ZJO A;  3NWR A;  5DDO C;  3M05 A;  4XAK A;  4RW9 A;  2WOM A;  2J9E A;  2ZDO A;  2HZA A;  4MIA A;  3R5B A;  4EFA C;  5L38 A;  4K0K J;  2BRL A;  3CGI A;  2KRB A;  3OR2 B;  3ZNJ 1;  5AE1 A;  3WC2 A;  2G9O A;  1NH8 A;  1Y11 A;  4WU3 A;  3DYA A;  4ZN1 A;  1P6T A;  3OTB A;  2DKO B;  3SEO A;  1EIY B;  5A2Q U;  3Q23 A;  1FNX H;  3Q2T C;  3TQ1 A;  3TVY A;  3IBF B;  1S7H A;  3NCQ A;  4O44 A;  1I1G A;  2B4V A;  4X4N A;  1EKS A;  3BEG B;  4Q2M A;  2D74 B;  3D68 A;  4X62 J;  4RO0 A;  3EJM A;  1OY9 A;  2VFR A;  3VV2 B;  2J7K A;  4Q45 A;  4DPX A;  2E9R X;  3MEC A;  3FMW A;  5KFO A;  2C2M B;  1RBA A;  3TP2 A;  1NBE B;  2O3D A;  3NOG A;  3D3C J;  4IR9 A;  2OTJ S;  2ZBP A;  3EIC A;  1QSY A;  1VQ6 S;  3FKB A;  1UVJ A;  3IRX B;  4D3G A;  5IT9 Y;  2CFX A;  4RNM A;  4ZMM A;  4UTG A;  2J6U A;  1PIE A;  3W60 A;  3ULH A;  1RHK B;  2KZM A;  2UUA F;  3CUL A;  2R8K A;  1R43 A;  3ZZR A;  3M30 A;  4NLD A;  3IS9 B;  2E44 A;  4F3O A;  3KG4 A;  1DQ8 A;  2VFT A;  4UQG A;  2UUB F;  2FD2 A;  4MKA A;  4X4S A;  1MMD A;  3PAC A;  1N34 J;  1XN9 A;  4CNY A;  4J7C A;  1LEO A;  2UV8 G;  1GTH A;  2EBG A;  1CSJ A;  3DRS A;  1KNZ A;  3EWG A;  3HP6 A;  1RAC B;  4C8O A;  5CXT A;  3W66 A;  4TY9 A;  1FRH A;  5D77 A;  5K9F A;  2FJD B;  4TNO A;  3C19 A;  4DF8 A;  1XMO F;  2MZ1 A;  2BYC A;  3AD9 C;  2IIH A;  4I6Y A;  4DSK A;  2KXN B;  3OSP A;  4AYB D;  2A2C A;  4UW2 A;  5IC4 B;  5ETL A;  4DG1 B;  2RSQ A;  2PMH A;  2RKI A;  2WON B;  4F4W A;  4C48 A;  1H0H B;  4Y2A A;  2OAU A;  3ENV A;  5A8W A;  5DQG A;  5MLC V;  2DXF A;  3MCO A;  2B8P A;  2ZBR A;  5HQ8 A;  4DR3 F;  3NEK A;  3PIO Q;  2QYG A;  1IM6 A;  2CQ1 A;  1GXL A;  3X1L B;  3HZG A;  2NUU G;  3W2V B;  1TFW A;  1RTH A;  3IG1 B;  3DDN A;  3UVJ A;  2AGQ A;  3KJV B;  4B9T A;  3BQ1 A;  2N7Y A;  1XMQ J;  1YTY A;  5LSL A;  4DV2 F;  1IWA A;  2Z30 B;  4AL7 A;  5BYR A;  4F50 A;  1WOP A;  2RHQ B;  1GMW D;  1IKX A;  3L7P A;  4QWD A;  4IR1 A;  2H1Y A;  3DDI A;  2PEB A;  1RT6 B;  5E3C A;  2ERR A;  2G2Y A;  2LEB A;  4LF7 F;  2P9C A;  1SKW A;  1Q1K A;  3TAQ A;  4PXC A;  1HW9 A;  1M5K C;  4ED0 A;  4BHQ A;  3IAS 9;  1WEX A;  1WC3 A;  3NBP B;  1Q7Y T;  3OD2 A;  1HWJ A;  1FNM A;  3K59 A;  1B0P A;  4KFB A;  5IQ6 A;  3UD3 P;  2RF2 A;  2CG4 A;  3LO3 A;  5IT0 A;  4CO0 A;  4QIV A;  2HVE A;  2FVR A;  3HVA A;  1LXN A;  5FJ4 A;  4GKJ F;  4TU8 A;  2QG9 B;  4OX6 A;  1YVF A;  2MXY A;  2ZWO A;  1HBN B;  4ZPW R;  4ZVG A;  3AJD A;  2FZC B;  4NLV A;  3I4P A;  4JV0 A;  1PKU A;  3ZZY A;  3JB9 k;  1MWZ A;  4FPI A;  2OP5 A;  2ZE2 A;  3D5M A;  2DCU B;  2MQO A;  5IXU A;  4OZ5 A;  5L1L A;  4RW8 A;  2OLW A;  4OI4 A;  1IWG A;  3MR3 A;  2GX8 A;  3DOM B;  1GTE A;  2QJ3 A;  4TQR A;  1KQS R;  1HYS B;  2X1G A;  1NKC A;  3C3L A;  4LBI A;  2EG1 A;  1WKL A;  4GKK F;  3A8E A;  4AL6 A;  1HBM B;  4I2P A;  1A9N B;  2DHS A;  4CYU A;  1S12 A;  3VAL A;  5LSR A;  3VZI A;  4EUV A;  1DTQ B;  3ENA A;  3HMJ G;  4HHH A;  3RW7 A;  2RJZ A;  3VVU A;  4ZLP A;  2UP1 A;  1RT7 A;  3IBW A;  3CVK A;  1ZZN A;  3Q8S B;  3BS9 A;  1RYS A;  4YME A;  3F73 A;  2VFV A;  4DV3 F;  3M9O B;  5CH7 B;  1REG X;  1HNW J;  3H4B A;  1X4F A;  4IDK B;  4ANC A;  2F9D A;  3ET6 A;  2FVP A;  2LQ5 A;  4OX9 J;  4DFM A;  3R5C A;  4XDC A;  3H20 A;  1FF2 A;  2W4D A;  1RT5 B;  1QTN B;  2Y8Y A;  4X4Q A;  1H6K X;  4UT4 A;  3C2P A;  4TN2 A;  1U1Q A;  4EO8 A;  3NS6 A;  3VHQ A;  3D1Q A;  2W9A A;  4ZPA A;  3SDE A;  4QZV B;  4CTA B;  3THP A;  1FKP A;  3UR0 A;  3B8H A;  3V81 A;  4LT6 A;  4IG3 B;  1YRU A;  3BF4 A;  1UA0 A;  2KJV A;  2HHW A;  1VCT A;  4QYR A;  2YTC A;  3N5F A;  3OFE A;  2HMI B;  3R2D J;  1I94 J;  1UET A;  5FDL B;  3QRP A;  4KSE B;  1A6L A;  3MEG B;  2HAI A;  5KT5 A;  4PWW A;  5HLF B;  5ETT A;  3IR7 B;  1S6P A;  4YHH J;  4A8Q A;  1SC1 B;  4C4W A;  4OZN A;  2W9C B;  3G9C A;  1QJH A;  2U1A A;  1ZPV A;  3UFC X;  2DGQ A;  1VBX A;  2LKZ A;  4LF1 A;  3DLB A;  4GC7 A;  1X0P A;  3C15 A;  3P8B B;  3BPD A;  1HNZ F;  3O44 A;  4UUW A;  3RBZ A;  1T9V A;  1SQF A;  4R5P A;  1R0B G;  4AL5 A;  3C16 B;  5C25 B;  4CO5 A;  1IQT A;  1RT2 B;  2CWX A;  4J9Q A;  5IWA J;  4I4B A;  3K17 A;  4K4W A;  2XTJ P;  1LFW A;  1FK9 A;  4JI3 F;  4DDF A;  1YJV A;  2CZ4 A;  3KOA A;  2D3Z A;  2Q43 A;  1IKW A;  5D3G A;  5L1K A;  3GPA A;  4LSL B;  2LU2 A;  3CJ0 A;  3CJS A;  3MEE A;  4KPY A;  3MM6 A;  1DBD A;  4ED8 A;  2HSE B;  4ZIT A;  3PHE A;  4W98 A;  1KHW A;  5IFM A;  1U0H B;  2NPF A;  5JUM A;  4DN0 A;  2MJN A;  3RR8 A;  4NPO A;  1NHV A;  4CLY A;  1T05 A;  2M4M A;  3N9U C;  2HFZ A;  4CLS A;  3M2R B;  2E5J A;  3TAM A;  2DR5 A;  4HLB A;  2HNZ A;  3MPW A;  5H1S V;  1DAR A;  1O5J A;  5KG3 A;  4P9S A;  2M8H A;  1VQP S;  2QL9 B;  1EET B;  1IBC B;  1S0O A;  2VDI A;  4ZPV R;  3H5X A;  1HBO B;  5J1N A;  3POT B;  3HSZ A;  3NP5 A;  2VQE F;  1ZTW A;  2GZO A;  1Y3J A;  2WVD A;  1RQ0 A;  3TRG A;  4YR2 A;  1NJX A;  4WZQ A;  1NCL A;  2HVZ A;  2HHH J;  3MOZ A;  3HHL D;  2BJD A;  2ASL A;  1NND A;  2UV8 A;  5E3P A;  2N7C A;  3N6L A;  2F9J A;  5DRK A;  1R0C B;  1V9O A;  5HBM B;  3K57 A;  4FVM A;  5T41 A;  4M94 A;  1XBW A;  1F5A A;  3EX7 B;  2MSS A;  4WFA Q;  3FQK A;  1B70 B;  2IJR A;  1KQK A;  2OEJ A;  4FYD A;  5CYQ B;  1R8H A;  4R8U A;  4PWU A;  5CD4 H;  1SV5 A;  3CJ4 A;  1YBT A;  2XS7 A;  4MMO A;  4ZPC A;  4DV0 J;  2H51 B;  2Y1I A;  1NKB A;  1CC8 A;  4LSN A;  3BBB A;  4OHV A;  3QJP A;  1JLE B;  2Z8Q A;  2DPJ A;  4ES3 A;  4DUY J;  2EG2 A;  1EP4 A;  1O6X A;  4I7F A;  3FQL A;  1SB6 A;  1LWE A;  2KL8 A;  3H59 A;  4HTJ A;  3BYR A;  2HHQ A;  1PC4 A;  4U7U K;  1REV B;  2BQR A;  4Y3C A;  2WW4 A;  2IHR 1;  3KK1 A;  2E1M C;  2CQ4 A;  4LFA J;  2CQG A;  1B0T A;  3MR7 A;  4RW9 B;  2WOM B;  2RQ4 A;  3A4T A;  2H9Z A;  4HAC A;  3DMJ B;  2AW0 A;  3PJX A;  3B4D A;  4M5I A;  2JFD A;  3HFZ B;  3VAK A;  4USW A;  2QLX A;  3BBC A;  1UL3 A;  2EFG A;  3T9Z A;  2GAG C;  3RZA A;  2LQJ A;  5M2R A;  4TLQ A;  2GHP A;  1HWU A;  3TJA A;  2UXD F;  2YNH A;  4JYA J;  5DG8 A;  3JQK A;  4O44 B;  5ETN A;  4LBP A;  1FEE A;  4WTY A;  4HH1 A;  3NLC A;  4NA1 A;  3QYY A;  2ZDP A;  4YR0 A;  2HZV A;  2DR8 A;  2B9E A;  1X7V A;  3MEC B;  2LDI A;  4IKA A;  1N5S A;  4I2Q A;  1M5V C;  1PJ5 A;  3AAW B;  2WSE C;  4C8K A;  2DR7 A;  4DPY A;  1TAU A;  4JI1 F;  3MAQ A;  4WTO B;  4ECX A;  1S7I A;  3H5Y A;  2C3P A;  3FZ2 A;  2I38 A;  2QA1 A;  4KRW A;  2IMO A;  1TUV A;  2YKO A;  1YJ7 A;  2AP6 A;  2JFK A;  2ZH1 A;  4NXN J;  3KFW X;  4P2M A;  1KKH A;  2VQF F;  2HVH A;  5KFP A;  2BR0 A;  3QT5 A;  4FYY B;  3K5P A;  2L9D A;  4MKY A;  1VIS A;  1QDU B;  4OYA A;  3NOC A;  4LJM A;  3PYG A;  3GIK A;  3UN5 A;  3I0S A;  1UVL A;  2CQ3 A;  4A8S A;  3JXO A;  5HQM A;  1HNI A;  1HNX J;  4JI6 F;  4NLR A;  1Z2L A;  1GX6 A;  1ZAX A;  1IBM F;  2X3G A;  1NDK A;  5CYM A;  2ZBI A;  2LDY A;  3CED A;  3PJW A;  1P1T A;  4I56 A;  1QSS A;  4ATN A;  2HQI A;  3DOK A;  1D9D A;  1YJT A;  2CPY A;  5ETM A;  4RNH A;  2JOQ A;  2C1E B;  4PG7 A;  1XWL A;  2IC3 A;  2FGO A;  2RQM A;  5GAH I;  2AJF E;  3H0P A;  2XEX A;  2A6O A;  3CD0 A;  3Q83 A;  4USK A;  2BJE A;  2FHM A;  3BJY A;  2C3Y A;  1RDR A;  3PM9 A;  1WDT A;  3HK2 A;  3DRX A;  5DS7 A;  4NXM F;  4DR6 J;  2QLB B;  5KFH A;  2XC9 A;  4FDF A;  2MZT A;  3O3L A;  2HS0 A;  3NMA A;  2OKQ A;  3MED A;  1RTH B;  3UVJ B;  3R7S B;  1T9X A;  2PMW A;  5HJY A;  1RKJ A;  2MST A;  4YB7 A;  4O23 A;  4J9S A;  4UOF A;  5M2U A;  2R2U A;  3OV7 A;  1XEZ A;  4K4Y A;  4F4Z A;  3OXL A;  1TUG B;  4OYP A;  4C6A A;  3SIP B;  1FJE B;  3OVA A;  1IKX B;  1NPP A;  4YB1 P;  2PI5 A;  5KOX A;  3AXM A;  2VV5 A;  1OWX A;  2CVE A;  3M9N B;  5EWG A;  1EJ7 L;  5CA5 A;  3GIR A;  5THW A;  4RLE A;  2QFJ A;  3CCL S;  1KVJ A;  3BQ0 A;  1WOS A;  2XI3 A;  2NQP A;  3D3B J;  2FLP A;  3CO9 A;  4RBV A;  3Q8Y A;  1BGX T;  3WQP A;  3MM7 B;  3BKU A;  2YNI A;  1URR A;  2Q6B A;  1WHV A;  3JYT A;  4OL8 A;  1BQN A;  5D4L A;  2ZIT A;  1IR0 A;  3RR7 A;  4USH A;  1VQ8 S;  1HHS A;  2AYM A;  3GFY A;  1KEK A;  3J81 Y;  2XI2 A;  5CQG A;  4EGL A;  1JXL A;  1S4E A;  1KC8 T;  4URS A;  2XNQ A;  4MH8 A;  1I5O B;  1SCJ B;  3Q8U A;  3PY8 A;  2BM0 A;  2E5L F;  1VLO A;  4WXW A;  3BR9 A;  4KY3 A;  3T5L A;  2G13 A;  3IO1 A;  4LQ9 A;  1UWB A;  2ZE2 B;  4ECV A;  3CSK A;  1E6Y A;  2ZM6 F;  4RW8 B;  1FTC A;  4ZHR A;  1FJG F;  4NA2 A;  4ZVP B;  1L3T A;  3EVO A;  5F3Z A;  4NWB A;  4PG8 A;  1CJK A;  1S1V A;  1S1U B;  4DPO A;  2KG1 A;  3D4J A;  2EK1 A;  3BPS P;  4RBU A;  4F25 A;  1T94 A;  4I2P B;  2NUH A;  1YRX A;  4CYU B;  3RG6 A;  1FI4 A;  1TQL A;  3HSG A;  2AGP A;  2YKQ A;  5KFR A;  1YWX A;  1U1R A;  1KQG B;  1RT7 B;  3AOD A;  3K8W A;  3KK3 A;  3FFI A;  3N6M A;  1D9F A;  3PHT A;  2HBQ B;  1YLX A;  1RLD A;  1UKU A;  3E3X A;  4CLP A;  4NLU A;  2VPY B;  3ET6 B;  3DLK A;  4LRB A;  1KD1 T;  1U26 A;  2H5E A;  4BBY A;  4CLF A;  1JLG A;  4DUT A;  4KAI A;  4MT1 A;  2QX0 A;  2V2Z A;  1QE1 A;  4WJB A;  1KTV A;  3GR0 A;  3LW5 C;  3VTI A;  3G2X A;  3SDE B;  3KMS A;  2CPI A;  2FHO B;  2MY7 A;  1FRX A;  1ZET A;  2RB7 A;  2M5Y A;  1S1X B;  1Q8I A;  2JLG A;  5KFY A;  3KHH A;  3V81 B;  3UWT A;  3R8Y A;  5HRO A;  2FVC A;  3AOB A;  2AEF A;  1VRQ C;  4ZPT R;  3EVW A;  1TP7 A;  3DI6 A;  1FO1 A;  1OO0 B;  4C8Z A;  9ATC B;  3EYZ A;  4LF8 J;  1PGZ A;  1NK6 A;  1S76 D;  4QPT A;  2O67 A;  3TVK A;  3N01 A;  3VVT A;  1S6Q B;  3BN4 A;  1VI7 A;  1S6P B;  4RNF A;  2FLN A;  4N5S A;  4OYX A;  1IM4 A;  3P3D A;  5L9X A;  2E1A A;  1X8D A;  4RW6 A;  4KV8 B;  3U1M A;  4R5P B;  4XPE A;  1WEL A;  1CUL A;  1NSP A;  3IXQ A;  3FRZ A;  1YIJ S;  3J81 j;  2B5J B;  5ETP A;  1FK9 B;  3KK2 B;  1RJJ A;  3T1Y J;  3P4U B;  1IKW B;  3BN7 A;  1RAA B;  2PD1 A;  4DQP A;  3HHN B;  5LMN F;  3MEE B;  3MM6 B;  5DLG A;  3L7U A;  4H54 A;  4M1K A;  1RWO B;  1FCA A;  2HRY A;  3W5X A;  1S97 A;  3OXG A;  1Q8K A;  5B7W A;  4CQ1 A;  2OPP B;  1SC3 B;  4HR2 A;  1RTJ A;  1U2C A;  3GYN A;  3QQC D;  3L7O A;  1T05 B;  3PVX A;  2EWH A;  4X65 J;  2V4J A;  3TAM B;  2XYG B;  4K4X A;  1NPK A;  4DV6 J;  1CS4 A;  4X64 J;  4UUX A;  1SJ3 P;  2PI4 A;  1D8Y A;  3I9Z A;  5IT9 U;  2BE2 A;  1APS A;  3D6F B;  1PIL A;  4ED5 A;  3PYE A;  3FC9 A;  2YWW A;  3CXC R;  3EVM A;  2JEF A;  4B08 A;  5B09 A;  1FVQ A;  3MFI A;  2KHD A;  2DH9 A;  3ZXW A;  4IOB A;  4AE5 A;  2DXE A;  3QID A;  3WHI A;  4IH7 A;  4DV1 F;  3V5R A;  1U6Z A;  3R5A A;  4R0E A;  5KFU A;  2OSR A;  5A8K A;  1HFE L;  2BKP A;  4P52 A;  1Q95 G;  4E8U A;  3LWL A;  1WC0 A;  2Y8W A;  2FY1 A;  2CAJ A;  2ILY A;  2DBB A;  1JWW A;  4C3K A;  1MMN A;  4OJH A;  3UPF A;  4P73 A;  4P75 A;  4DU8 A;  3FSI A;  2MQM A;  2OEM A;  3LP1 A;  3A8I A;  3Q24 A;  4L74 A;  2WW8 A;  4R8U B;  4B3S J;  3GII A;  1SV5 B;  3NCP A;  4GRS A;  4V19 J;  1S1W B;  4E2F B;  3CJ8 A;  3JSM B;  3CJT A;  3GTY X;  4LSN B;  3ENW A;  2VJV A;  2DRD A;  5I3Q A;  1FJC A;  2DNO A;  3VZH A;  4NE9 C;  3V6J A;  3ITH A;  5KT2 A;  4LF4 J;  3OLA A;  2XYP B;  3HKZ D;  2AJQ A;  5LL6 d;  3P49 B;  5HO4 A;  1EP4 B;  3G96 A;  4Z37 A;  3Q8Q B;  2A1B A;  2CQC A;  4B17 A;  3THV A;  1U1K A;  1LWE B;  4U7U D;  1LFP A;  1PG5 B;  1DRZ A;  3HSJ A;  3QSY B;  2HK2 A;  4U8Y A;  3LPY A;  2ROP A;  3MM8 B;  2DR6 A;  3QLH A;  2KFY A;  4LFC F;  3KK1 B;  1CC7 A;  3DLE A;  2YKM A;  3HT0 A;  5EWE A;  3VQS A;  3W3S A;  4PUO A;  2HQG A;  5K8O A;  2GW8 A;  4RBT A;  3UNG C;  5K8P A;  4HAC B;  2BKN A;  4DSI A;  1KDN A;  2RDD A;  4PQU A;  3HDS A;  4AXJ A;  4J5O A;  5CAB A;  2PC6 A;  4DCP B;  3M8P A;  3RB4 A;  1CJU B;  4QR2 A;  2DK2 A;  5ETK A;  1N6Q B;  2J8S A;  2HLT A;  2QTW A;  2YNH B;  4PCQ A;  4F0H A;  2B9W A;  2XMA A;  1CPZ A;  1P27 B;  3HFK A;  3OJU A;  1GMW A;  1RI7 A;  2MKH A;  2CPD A;  2CDR B;  1HIY A;  1OYD A;  1U09 A;  4FPR A;  4F8R A;  4I2Q B;  4DQI A;  5K14 A;  5DM6 Q;  2HQ3 A;  2ZFH A;  4HI2 A;  3H40 A;  5AXN A;  3AY0 A;  1NXI A;  4HKQ A;  4B3R F;  4FVC A;  2ZKU A;  4OI6 A;  4XO0 A;  1ACM B;  3BSA A;  4NLW A;  4LVO P;  2KO1 A;  4HHU A;  3JSB A;  4WYL A;  4OMF G;  1U1N A;  3QWU A;  5LXR A;  1S0M A;  4ZVF A;  1SL1 A;  1MN7 A;  1VC0 A;  3C14 B;  3UW1 A;  2PN6 A;  5G4D A;  4H4O A;  2I9S A;  2YQ3 A;  4LF5 J;  1IBK F;  4BC7 A;  1N5Y A;  1D9A A;  5BJR A;  4YY3 J;  2D9P A;  3LA0 A;  5JJB A;  2COL A;  3I0S B;  4KTQ A;  1H38 A;  2VOD A;  4B9U A;  1VC6 A;  2ZWP A;  5J2M B;  1HI1 A;  1NK4 A;  5C42 A;  5CYM B;  1R8P A;  1RA7 A;  3FSY A;  1KSP A;  4BWJ A;  2IYI A;  2CAD A;  3V4M A;  2EFO A;  4PYD A;  1KLN A;  3MMB A;  4JI5 J;  3PG9 A;  2DHX A;  3S7R A;  3KUG A;  1EZZ B;  2X7I A;  1T11 A;  2YX7 A;  5DGA A;  1VIO A;  1YJW S;  3OL8 A;  2MYF A;  4K8R A;  4PXD A;  2IC3 B;  1KHV A;  5LMU J;  2GCF A;  3IRW P;  2FJE B;  3ILI A;  4P10 A;  5IZH A;  4PAA A;  1VQ9 S;  3PW7 A;  5HSP A;  4N77 A;  2Z56 B;  4F67 A;  3QAT A;  3HPO A;  3EXC X;  4WKR A;  1NDC A;  3KUH A;  2OMO A;  2G0C A;  4EEY A;  5BR8 J;  4E98 A;  1R8A A;  2KKH A;  2OPQ A;  2WAQ D;  3PX0 A;  4KB7 A;  1NZA A;  2DGS A;  1ZS6 A;  2LCW A;  1IUJ A;  2DYA A;  4U8V A;  5EWF A;  1I3O B;  3TYT A;  8RUC A;  4HI1 A;  2QV6 A;  4I69 A;  4CLW A;  1KOH A;  1Z4U A;  4JB8 B;  5BXI A;  1TMJ A;  2Z0G A;  4BCA A;  3PW0 A;  2N4D A;  3MUM P;  2QL7 B;  3FEY B;  1TFY A;  2YWG A;  3CDB A;  3ADA C;  1T95 A;  1FT8 A;  1VQO S;  6FD1 A;  3IN5 A;  1G6B A;  5F8M A;  4EYH B;  1TK0 A;  2YNI B;  2XMW A;  3OVS A;  3JYT B;  4OI1 A;  4L75 A;  1RWN B;  3DXB A;  1NK0 A;  1BQN B;  5DDP C;  1XER A;  1M5S A;  1R6Y A;  3EXY A;  4X4T A;  1R8B A;  4J9O A;  2I6W A;  2WVC A;  1NEE A;  4C7Q A;  4DR7 F;  3MWB A;  3CCV S;  4ECQ A;  4ID8 A;  2MZJ A;  4QW9 A;  4KPC A;  2UU9 F;  1T9T A;  2DHH A;  4CIO A;  2B4P A;  2J0Q D;  2FPH X;  4CLU A;  1J5E F;  4BWM A;  1S9F A;  2QSW A;  1E6Y B;  2W9B A;  2B7C B;  1YBA A;  4ZA1 A;  3TVZ A;  4ZHR B;  3SCL E;  3OR1 A;  4WF9 Q;  1HWI A;  3GIM A;  1S1V B;  3BO2 A;  3BSO A;  2LEP A;  4N76 A;  5A8R A;  4DR2 F;  3LTO A;  2M9K A;  3I5C A;  3HFV A;  1VHF A;  2IA0 A;  4W4M A;  4U67 Q;  4ICL A;  3I4H X;  2V6A A;  2UUT A;  3I9V 9;  1EKR A;  2QEX S;  4TKT A;  2BVZ A;  1F0X A;  3QGP A;  3I82 A;  5HVG A;  3KK3 B;  4HTI A;  3FFI B;  1F60 B;  2BKO A;  4K0K F;  2Z57 B;  1TTH B;  1RT3 A;  1C1B A;  4TLR A;  3J7A N;  2XMT A;  3I96 A;  3PEJ A;  4J9V A;  2NR0 A;  1DAX A;  2PA3 A;  3AH6 A;  3K2Y A;  3G86 A;  3DLK B;  3HHL A;  3VAF A;  1PO6 A;  2YY3 A;  1JLG B;  5A0Y B;  1JKH A;  3RYL A;  1QE1 B;  3AQP A;  2AJ0 A;  2PSZ A;  3MPV A;  4M5D B;  3EZO A;  4H4M B;  3IMQ J;  4PXB A;  3H8Y A;  2VBZ A;  2XMK A;  2I5J A;  2GS8 A;  1W2I A;  3OLB A;  1RLC L;  4MJK A;  3NGD A;  5HRO B;  2VJU A;  1VQK S;  5MAO A;  1YJ9 S;  3KKF A;  3KHR A;  4QPX A;  3DI6 B;  2R2R A;  4F4X A;  4AXI A;  1QUV A;  1VRU A;  3CDW A;  3KXD A;  1RBL A;  1Q8B A;  1S77 D;  4A8K A;  2UUB J;  2PDA A;  2XHW A;  4NOH A;  5CYJ A;  5F3T A;  5DQI A;  2VBX A;  4OHX A;  1ZAV A;  3FK4 A;  2ZHO A;  3OPK A;  2VIH A;  4H4K C;  3B78 A;  3TUZ C;  4CT8 A;  2LEA A;  3QZ8 A;  1JLF A;  1Y7P A;  2CQ2 A;  2NYI A;  2DB1 A;  3JTP A;  2R3V A;  4HVZ A;  4I64 A;  4RJV A;  4FN5 A;  4M5H A;  3M32 A;  5FLX Y;  4RW6 B;  1XMO J;  1X4C A;  3X3U A;  4K50 A;  3CJ2 A;  4K2X A;  2V9K A;  4XK8 C;  1CUL B;  1X5O A;  1BD6 A;  4AFF A;  1N34 F;  1TMM A;  3ZTQ A;  4PRF A;  1NSK L;  1FRM A;  2GIQ A;  2MZS A;  3O5T B;  4F4K A;  4CH7 A;  1R3N A;  3QGI A;  4P71 A;  4I68 A;  1IBL F;  4DR3 J;  2CIM A;  1FX2 A;  3F0N A;  1FDA A;  1XTZ A;  3GZ7 A;  2DGU A;  2DNL A;  4OHW A;  3BQ2 A;  3P96 A;  1J2V A;  3GSD A;  4JI0 F;  4K5S A;  1RTJ B;  3CW2 C;  5DLF A;  1Q82 T;  4M8L A;  3CCR S;  3NXZ A;  3ZZU A;  4ETZ A;  1R7I A;  2V4J B;  2F3J A;  4DSE A;  3MD1 A;  1WOR A;  2OO4 A;  2F5G A;  1BQM A;  2VG7 A;  4ZIW A;  3VAH A;  4GVB A;  2X3D A;  2BE2 B;  1IKV A;  4DV2 J;  2P2C B;  2KI2 A;  2BE7 D;  2LVW A;  1NK8 A;  2J7W A;  2NXN A;  2LP4 A;  2DRB A;  2F4V J;  1RHR B;  1VFJ A;  1R8C A;  4WWS A;  3ISZ A;  2AU0 A;  4ZVU B;  4NZ7 A;  1U49 A;  4LF7 J;  3W5Y A;  1UW4 A;  3PJ9 A;  5I3U A;  2XGP A;  3MR2 A;  2M3D A;  1UPM B;  3W62 A;  5M2P A;  3IM8 A;  2KN4 A;  3I32 A;  3H25 A;  2MY8 A;  2GJI A;  2O01 C;  4E0D A;  2FJX A;  2UXB J;  4BDP A;  1RCX B;  4GKJ J;  1FXL A;  5KFV A;  4HDG A;  2QMX A;  3OTO F;  4ES2 A;  1TL1 B;  2DNH A;  2XZT B;  2LXI A;  2GQC A;  1CVJ A;  2LA6 A;  5KFC A;  4O4G B;  3G6Y A;  4ECY A;  3CJ5 A;  3AD7 C;  1JLC B;  5HAN A;  2XZW A;  4NLO A;  1C4C A;  1PSD A;  4JBC A;  4F3M A;  4Q5V A;  3CCZ A;  2O1P A;  2UVU A;  5AE2 A;  3MR5 A;  3MD3 A;  2AZ1 A;  1ZM9 A;  4GKK J;  1PYT A;  1HMV A;  2RU9 A;  2ATL A;  4FF2 A;  3QLH B;  3Q89 A;  2C3M A;  4OX7 A;  4ILR A;  3GU0 A;  3Q8R B;  1XNQ F;  3TZY A;  3DLE B;  2YKM B;  4OI0 A;  3NY0 A;  3K5M A;  3C8Y A;  4PUO B;  2YWK A;  3FUY A;  2ZD1 B;  4NLQ A;  1HPZ A;  3FEZ A;  4DV3 J;  2W2M P;  3TA2 A;  2E7W A;  2EI5 A;  4KYZ A;  4GO7 X;  2EEY A;  4QJV A;  3IGV A;  3VGT A;  3M8P B;  4YB5 A;  2K7K A;  2OPR A;  2VL1 A;  1F3V A;  2J7U A;  3DLL Q;  3HHL C;  3LP2 A;  3KUE A;  2K3I A;  3TO8 A;  5GMD A;  3U7J A;  3R6L B;  3GFZ A;  5JXS A;  1FFS B;  2QLJ B;  3BO4 A;  1V3S A;  5HMX A;  1KLM A;  2O66 A;  3I5A A;  5K8N A;  2GJF A;  1LK5 A;  1M0S A;  4K7Q A;  2KFZ A;  4QIF A;  3W9I A;  3J7Y I;  2YKA A;  1HNV A;  2HYI B;  2V0N A;  2V68 A;  3H4D A;  1NHK L;  2VPW B;  5K14 B;  1JNZ B;  3BM7 A;  1H7X A;  2Y9H A;  1WAC A;  3J81 U;  2QYC A;  2CUY A;  1S57 A;  5F9L A;  2M2B A;  3GB0 A;  2F7V A;  2DNM A;  2ZH4 A;  1JLB A;  3OTE A;  4MK9 A;  3A3N B;  3Q2S C;  4X66 F;  1F5C A;  1AB8 A;  5EX0 A;  2HS4 A;  3MI7 X;  4K4V A;  1CEZ A;  5L9N A;  2B3T B;  2G1H A;  4DL7 A;  1YRT A;  4KGZ B;  1HNZ J;  1N5Y B;  3NNA A;  3OW2 R;  4WIQ A;  2G1D A;  1IKY B;  3DFE A;  3KDN A;  3M2U B;  4ES1 A;  3GJS B;  1QUP A;  2E5H A;  3FJ2 A;  4ANE A;  2MHN A;  4LF6 J;  4WXO A;  3DDK A;  4G1Q B;  4YHH F;  5C7P A;  2VC0 A;  4TQS A;  4USV A;  4IH5 A;  5C42 B;  4RL1 A;  3M2V B;  3G6V A;  3GFX A;  1BWE A;  4ECS A;  2WCX A;  5E2Q A;  1K47 A;  3QMQ A;  4O3P A;  4WP8 A;  1Y5N B;  2E7X A;  4F0K A;  3BSC A;  3PKM A;  3KWM A;  2APO A;  1OQ6 A;  3MMB B;  1SJQ A;  1PYS B;  3CME S;  3AQO A;  5HVF A;  5IWA F;  5DG7 A;  2OD6 A;  2FHJ A;  4C0O C;  3GON A;  3NGR A;  2Y1J A;  1FKA F;  1X4E A;  3UDV A;  2H5J B;  2G2Z A;  3S8S A;  4KH1 B;  4J9P A;  1RE1 B;  3KHG A;  2N3O A;  2GHV C;  4KGX B;  5F41 A;  4JV5 J;  2VPX B;  3UDC A;  4O3O A;  3E2E A;  3BGR A;  1OIA A;  2X1F A;  2YXL A;  2AJ1 A;  3OFG A;  2VQE J;  2MPU A;  3I56 S;  4RUH A;  4RX6 A;  5GAG I;  2XMU A;  2KB2 A;  3KG1 A;  4UOC A;  3RRK A;  5D4O A;  4CM2 A;  2Y0B B;  3QBC A;  4C3L A;  1H2T Z;  2VOO A;  1JQG A;  1MLA A;  5E33 A;  2GIF A;  4B3T F;  1PBA A;  2KFN A;  2D9O A;  5HN0 A;  2D69 A;  1S0V A;  3MUT P;  1R0A A;  3TI0 A;  3DRP A;  5A6P A;  3N0V A;  3W8P A;  2GNK A;  4DV4 J;  4KC5 A;  2Q1L A;  2RIL A;  4AQY F;  3G8Q A;  3L09 A;  3M8W A;  3W63 A;  2XNR A;  2QGF B;  1Q86 T;  1VMB A;  2V8H A;  1XNR F;  1RSC A;  1ZYQ A;  1KON A;  4DL0 C;  4NEY A;  1T03 A;  1KN6 A;  2V8G A;  1OSD A;  4FNH A;  3M4X A;  5J1E A;  4PPD A;  1VOM A;  3FVY A;  3UCU P;  2W01 A;  3QO9 A;  4DV7 J;  2ROG A;  3TNV A;  3C66 A;  1HI0 P;  1QM9 A;  4YR3 A;  4PZV A;  4RU2 A;  5IS2 A;  2AKW B;  2W9B B;  2VBY A;  3C6T A;  1DFD A;  2LU1 A;  2CJA A;  3W8G A;  2DNN A;  4C11 A;  2XGQ A;  4ECR A;  1WKJ A;  3RW6 A;  5A8R B;  4JV1 A;  3RTV A;  4LVN P;  1FDB A;  5AT1 B;  1ZAW A;  1T0T V;  4ICL B;  2GO9 A;  4DCO B;  2F4F A;  4LFA F;  2HWH A;  2HQD A;  3GJR B;  2W8L A;  1RAD B;  2WVB A;  3P6Y C;  2CQI A;  3DLJ A;  5JMN A;  2W2P P;  3TA1 A;  3KLG A;  4B9M A;  1ZM3 A;  1R27 B;  4KR0 B;  5KG2 A;  3O6Q A;  1WHX A;  1TK5 A;  1WC5 A;  3HVW A;  3EM1 A;  4L3K A;  3HHL B;  4DL6 A;  4S0M A;  2UUC F;  2J9D A;  1BWV A;  2L9W A;  5HK4 A;  3QT8 A;  1FVS A;  1VGY A;  4OYZ A;  4JI1 J;  3H42 A;  1F2G A;  5J2N A;  1Q0N A;  4Q2L A;  2CPF A;  2GVZ A;  4IUF A;  2VPZ B;  2DD8 S;  5CAA A;  2QT7 A;  1EAR A;  1K73 T;  2CQD A;  1EX8 A;  2I5J B;  2JWN A;  4JUZ A;  1YJU A;  2YNF B;  3ZTS A;  2D1C A;  5E5N A;  1S9G A;  4LSZ B;  3T1H J;  2WSF C;  4DU7 A;  4LRE A;  4DFJ A;  3K5N A;  4W90 B;  4BLG A;  1RA6 A;  2KHC A;  3QT6 A;  4ZVQ B;  3KLF A;  1N88 A;  1FD8 A;  1VRU B;  1Q7L B;  1KFD A;  2W25 A;  4HYK A;  3KYL A;  2LQB A;  1DTT B;  4CLT A;  4TYB A;  3TUI C;  2FZK B;  4CLL A;  2AEJ A;  2HW3 A;  3MXH P;  2M7S A;  2VOP A;  4FF3 A;  2WB4 A;  5E41 A;  1IBM J;  4Z7Y A;  4EBC A;  2VH7 A;  1D1U A;  1CG2 A;  2U2F A;  4M5L A;  1C0T B;  1XR7 A;  2VG5 A;  2XQC A;  1IVZ A;  3RU0 A;  4YQW A;  2E9T A;  3QNW B;  3D28 A;  3Q22 A;  1WHY A;  1L3U A;  1RTZ A;  3BGO P;  4ELU A;  2QSF A;  2PMZ D;  3QWP A;  2UZA A;  4LMZ A;  4B9L A;  3QFW A;  2L41 A;  1L5U A;  4CO3 A;  4HHJ A;  4IH6 A;  2P6S A;  5D0E A;  3PFE A;  5HJX A;  2GGP B;  4LR8 A;  4X4U A;  2ALZ A;  4NXM J;  3S6E A;  3RB0 A;  4PKD B;  3ETM A;  3T6J A;  3DOL A;  2VDH A;  2ALY B;  4NCB A;  1UZH A;  4ED1 A;  4NRT A;  2YX1 A;  3IFE A;  2OEK A;  2XY6 A;  1X4D A;  1WWH A;  4ZJL A;  2RVJ A;  3C46 A;  2H4W B;  1BQM B;  2VG7 B;  4GVB B;  2ZH6 A;  3PFO A;  1T3O A;  3AT1 B;  3OL6 A;  3GQC A;  2DIT A;  2XG8 A;  2BA9 A;  1HWK A;  3KJN B;  4RUA A;  1GEH A;  1LOU A;  4QIW D;  5I3U B;  4ZVO B;  1SUQ A;  3JTO A;  1R6V A;  2M8D B;  2IYG A;  4KQZ A;  1NM2 A;  2KZZ A;  4KJI A;  3DKD A;  2HHS A;  4RU9 A;  3R1L A;  1VS3 A;  2WK4 A;  4A8W A;  4OYM A;  3QAE A;  3ZTO A;  3WX8 A;  3SCJ E;  3LAL A;  2DRA A;  2HK3 A;  4IFY A;  2V63 A;  3NRB A;  4QQB A;  3HLU A;  4ZVR B;  3PTW A;  1AFI A;  2DNK A;  3JSY A;  2RML A;  2V8P A;  3CMQ A;  4Y34 A;  4ED2 A;  3RGI A;  1AZS A;  4IOC Q;  2RE1 A;  2E5L J;  1SQE A;  3SSS A;  1TL7 A;  2OHD A;  3W5Z A;  3OXF A;  2VU5 A;  2G0I A;  2ZM6 J;  4PWD A;  1RTD B;  4TYA A;  2EFN A;  4LR7 A;  1UTA A;  2WSC C;  4UY8 5;  1FJG J;  4OHY A;  2F8E X;  3W2W A;  1WC6 A;  2DH8 A;  5IM0 A;  1PJ6 A;  3PDN A;  3MUR P;  2Y1L B;  3FCH A;  2V4Q A;  1HMV B;  1WTF A;  4FF1 A;  2GC8 A;  4M5J A;  1T9U A;  1A7G E;  2BV3 A;  2VG6 A;  4ZCK A;  2FVQ A;  2JC0 A;  1JMT A;  2MB0 B;  4Q0B A;  1BQX A;  1X5T A;  3CCU S;  4ZK7 M;  5F9N A;  3LAK A;  2X1B A;  4F4Y A;  2DY9 A;  4HT7 A;  4NRU A;  1VQM S;  2IM0 A;  3OR2 A;  3RBE A;  3T5J A;  1LW0 A;  1NDP A;  2R2T A;  4CRJ A;  3TUP A;  2CZV C;  4QWE A;  4I67 A;  3KLI A;  2HHT A;  1ZOT A;  3M1V B;  1N5V A;  2OPR B;  2X1A A;  3M6V A;  6AT1 B;  4FYW B;  4RWX A;  5G0R A;  3LP2 B;  4NML A;  5K5M A;  3J80 Y;  2ZOF A;  4DWI A;  1XJW B;  1NUE A;  5DG9 A;  1QD1 A;  2F63 A;  1FXR A;  1RAO A;  2F8H A;  2UXC F;  2R7X A;  1KLM B;  2DNP A;  2JEG A;  4JV2 A;  2HZC A;  1SI9 A;  2B8Q A;  2HFU A;  4QWA A;  3ZZ0 A;  4G1I A;  1UAW A;  1W2B R;  1FWL A;  1GQE A;  2MQ8 A;  2WVE A;  1WNE A;  4YEA A;  5D6G A;  2XSJ B;  2RDJ A;  1H74 A;  3KLE B;  2ILZ A;  2Z2L A;  2VKR A;  4G65 A;  3GFH A;  1LKZ A;  2HBY B;  3N28 A;  1G7C B;  4N47 A;  3CD7 A;  1JLB B;  1LWF A;  2HGN A;  2NYH A;  4LQ3 A;  3TA0 A;  2Z2Y B;  3SBM A;  5FD1 A;  2EFQ A;  4V1A k;  2JH3 A;  4F02 A;  2J76 E;  3S1T A;  2B4U A;  2KH9 A;  1VQY A;  2IRU A;  3IS9 A;  4DR1 J;  2IMW P;  3MM5 A;  2EW9 A;  1VDH A;  5L8R C;  1CJT B;  3NGK A;  1N33 F;  2AD9 A;  2YWE A;  4EZ9 A;  1GH8 A;  1UPP A;  2K1R A;  4OZL A;  5D0R A;  2R7Q A;  3J7Z 5;  4ILL A;  1SIZ A;  3LH2 S;  4JOU A;  2FLO A;  1AUD A;  2IM3 A;  1FDD A;  5LMN J;  1MWY A;  4EBD A;  5B0F A;  2W8K A;  4O3R A;  3OTD A;  2NZ4 A;  1TZ0 A;  1NK9 A;  4UQT A;  2C2Z B;  3A3O B;  3EDQ B;  4NYO A;  1U8S A;  2OJ3 A;  5KFB A;  2FVS A;  2RNE A;  4P72 A;  4MK8 A;  4DG1 A;  2IM2 A;  5KFS A;  2UUW A;  3E8O A;  2WON A;  3UCG A;  4K2J A;  5ETS A;  3HKW A;  3J7A 1;  2DHG A;  4G6V B;  1TL5 A;  3AB4 B;  3I87 A;  3T19 A;  2R2S A;  3SSQ A;  4HEA 9;  1TV6 B;  2HWI A;  4ELT A;  2HLU A;  1B99 A;  3E01 A;  4OI3 A;  2MKS A;  3R7B B;  1PC5 A;  4LFB J;  1VQ7 S;  1OMS A;  1SVD A;  1GMV A;  1F6T A;  2HVI A;  2J5A A;  3MAH A;  3UDL A;  2CVI A;  4FXD A;  5C24 A;  3DM2 A;  3F41 A;  2XUL A;  2R8J A;  4DV1 J;  1SBR A;  3G71 S;  2Q6C A;  4RZR A;  4ZLL A;  3EGV A;  3IR5 B;  1F2H A;  3PO4 A;  3ZNU A;  4I1T A;  2EFV A;  2J6T A;  3RAX A;  2KTQ A;  1SH0 A;  3OT9 A;  2UVV A;  3JAM Y;  2YBV A;  3GP9 A;  3CNQ P;  2QA4 S;  2W24 A;  5FLX U;  2ZC3 A;  2VFS A;  4ZJQ A;  4GO5 X;  2HWT A;  2R4F A;  1T03 B;  4DUZ J;  2GIR A;  3K5L A;  3U27 A;  5F8L A;  1CQM A;  2MZQ A;  2NSB A;  3T9N A;  3NGU A;  1RYR A;  4JI4 F;  4B3S F;  1HBN A;  4WKY A;  4J90 A;  1Q5Y A;  1ULR A;  1WDD A;  4C9D A;  4U7C A;  3RBD A;  4B02 A;  2E9Z A;  2GHW A;  3WDO A;  3TZX A;  1AXQ A;  2VD3 A;  3RAM A;  4CLZ A;  4OYW A;  4LF4 F;  3QIP A;  1I6J A;  3C6T B;  1LW2 B;  5HAT A;  4OLP A;  4ZP7 A;  2MKJ A;  3DRY A;  4YDX A;  4ZLJ A;  4WFX A;  5HMW A;  5HMY A;  1TK8 A;  5AXK A;  1N32 F;  4IG0 B;  4C11 B;  2E1R A;  4RW4 B;  1IN0 A;  4WZM A;  4QIG A;  5A6W A;  2H54 B;  3AFG A;  5IV4 A;  6FDR A;  1HBM A;  2M52 A;  2DPI A;  4YB6 A;  2AYE A;  1C1C A;  3TZZ A;  4A48 A;  3H7H B;  4USU A;  4DMZ A;  4L3N A;  4R25 A;  4K59 A;  2QA4 G;  1GFW B;  3PW5 A;  3ILL A;  1JX4 A;  1IR1 A;  4IO9 Q;  3I0R B;  3SCK E;  1MN9 A;  3A8K A;  2FIU A;  4PAB A;  3KLG B;  3M6W A;  3VAM A;  2EXU A;  4HH0 A;  3W9J A;  4TU9 A;  2H48 B;  3TW0 A;  2BJ8 A;  3PR5 B;  2J0X A;  4ZVE A;  3HD1 A;  1HR0 J;  4A8M P;  3P5T L;  5D0H A;  3M9M B;  4WK1 A;  1U48 A;  1RT5 A;  2OSQ A;  3K7R A;  1WF0 A;  2H3E B;  1PCA A;  1X9W A;  2GVZ B;  2RH3 A;  1J27 A;  1DZ5 A;  1N54 B;  1NH7 A;  5B0G A;  3CIZ A;  3KJF B;  4K4S A;  2GFF A;  3Q8V A;  4USJ C;  4KE5 A;  4O4R A;  2KVQ E;  3DYA B;  4IG3 A;  5EX3 A;  1JLA A;  3AOC A;  3CT9 A;  4KHP J;  1SJ4 P;  3KLF B;  2ZNY A;  3TAN A;  1IBK J;  4J9R A;  1X31 C;  5F8I A;  1GXT A;  1BMQ B;  2MKC A;  2ZUA A;  2HMI A;  1X9S A;  2WB1 D;  1RAE B;  1RK8 A;  4M5K A;  4C0B A;  3FGV A;  2RT3 A;  5AJ3 F;  1CLF A;  3GMG A;  1P9Q C;  5L1I A;  1KVI A;  1XMB A;  5F0U A;  2W9C A;  3MPY A;  4OIX A;  2F40 A;  5GAD U;  1IQZ A;  4WYW A;  1KS2 A;  4NLG A;  1QAY A;  1WKK A;  2EKY A;  4NLY A;  1F9E B;  2ZZT A;  4P2X A;  1ITP A;  1RT2 A;  3ZFV A;  1JXV A;  2CNL B;  2C2O B;  1J5O A;  4Q8F A;  2L48 A;  3MAA A;  4LSL A;  3M30 B;  1D3W A;  1CBK A;  1C4A A;  1M1K T;  4QWC A;  4PYA A;  1HWL A;  4F36 A;  2MKY A;  4NAS A;  3B4M A;  1SKS A;  3BKF A;  3HJV A;  4RUC A;  4DQQ A;  3DOL B;  3G4S S;  1UFW A;  4QR0 A;  3ZZT A;  2BW2 A;  3KMQ A;  3DRS B;  1YJR A;  2LFV A;  1HKA A;  2AT1 B;  2JX2 A;  1T7P A;  1GX5 A;  2W7A A;  3QSI A;  4P74 A;  5J2Q A;  1K0V A;  4KGK A;  1XC9 A;  1DLO A;  4OYO A;  1TUW A;  4NYZ A;  4IRK A;  5BR8 F;  2FGC A;  3CCS S;  1ELO A;  3KDO A;  3D66 A;  2ZJP Q;  3HD2 A;  2RKI B;  1DQ9 A;  5D0G A;  1YHQ S;  5A8W B;  2HGL A;  3V4I A;  3Q86 A;  2LXF A;  1SUQ B;  2DY1 A;  1RAJ A;  1U25 A;  5F8G A;  1ZA2 B;  1YG0 A;  4TXS A;  2MMY A;  1Y5L B;  2HG4 A;  1NHU A;  3M8Q A;  1DJ0 A;  1PJ7 A;  1VQS A;  3FZB A;  2ZHB A;  4KBI A;  2JVR A;  4O3Q A;  5CYQ A;  2ZUG A;  4IFY B;  3UN3 A;  3BH7 B;  1MU2 A;  2XHC A;  1AZS B;  1GT8 A;  4ZPB A;  3B82 A;  2CJY B;  2HKE A;  2J6S A;  2M70 A;  4BS2 A;  1V5I B;  1Q81 T;  1FWP A;  1RU2 A;  2IRY A;  1J5E J;  3SSR A;  4LRD A;  3CCT A;  4PWD B;  1V3Z A;  1YJN S;  4XIU A;  1BLU A;  3W2W B;  2KYZ A;  5IM0 B;  3PEH A;  2D7S A;  1FRL A;  1TKT A;  3VAI A;  3O8W A;  4MFB A;  4DR2 J;  2C2N A;  1REV A;  4DQS A;  1H3D A;  1HHT P;  1VYA A;  2V8V A;  3UD5 A;  1CQN A;  3DXS X;  1YGY A;  2AGO A;  4ED3 A;  2VG6 B;  2ZOG A;  3D67 A;  3VAG A;  4AD6 A;  2ZKT A;  3CCW A;  1WF1 A;  4Q0B B;  3U1L A;  3WBZ A;  4KFB B;  3SFU A;  1MNE A;  2RF2 B;  3JS9 A;  5F8H A;  1U2F A;  3UN2 A;  4AT1 B;  3DCA A;  3RBX A;  3DMJ A;  4NCA A;  1M90 T;  2B0G A;  3C6U A;  3GSI A;  1G3O A;  4CCH A;  1LW0 B;  3UR3 C;  3WX4 A;  2FC9 A;  2A2D A;  4WFB Q;  2MZR A;  3GWC A;  4RNO A;  1WD6 A;  3KLI B;  1C2P A;  1VLY A;  1S48 A;  3V6H A;  1QAX A;  1L3S A;  2FZG B;  4F2R A;  5G0R B;  4LIR A;  1KP6 A;  3T5H A;  1RAG B;  2LQ9 A;  1QAJ A;  3NWG A;  2P9E A;  3LAM A;  2Z58 B;  2IFX A;  3HSD A;  1KQF B;  2E5G A;  4F26 A;  4F4A A;  2BXJ A;  1JIH A;  4PXE A;  2MQN A;  1Q8L A;  1NSA A;  4HL9 A;  2AV5 A;  1JNR B;  4QW8 A;  1RBO B;  3D7S B;  1ARO P;  1HD0 A;  4DSJ A;  4Z2X A;  4HT5 A;  2KT2 A;  2CQ0 A;  2BRK A;  2D41 A;  2DTJ A;  4I0W A;  3WZ0 A;  4Y00 A;  3I55 S;  3TAP A;  2FHJ D;  3BDP A;  3CB4 A;  3GYX B;  3VGS A;  2CZ9 A;  1LWF B;  1HQE A;  3ZTP A;  1U02 A;  3T1A A;  2YH1 A;  2NXJ A;  4PR6 A;  1YX2 A;  1OYE A;  2MQP A;  1KRP A;  3ZO7 A;  5DZ7 A;  3OQ2 A;  3CO0 P;  5ETQ A;  3A12 A;  3MM5 B;  2QLF B;  3EGZ A;  3A8J A;  4L6V 3;  1N36 F;  2OPS A;  4C3M A;  1S10 A;  1X60 A;  4ZN3 A;  2YWF A;  1D8Z A;  2MLX A;  5CCM A;  3BB5 A;  4PG6 A;  1U6F A;  2K1R B;  1FKP B;  4DX7 A;  2AQ4 A;  1L3V A;  2CJK A;  1VR6 A;  3FEX B;  4TY8 A;  2ASJ A;  3MCS A;  3CC2 S;  1IBL J;  2V50 A;  2P8I A;  2DIV A;  3NL0 A;  3B6B A;  5LSO A;  1KVK A;  4JI0 J;  3QPI A;  2HND A;  2WRM A;  1Z1Z A;  2YH0 A;  3K5O A;  1WG1 A;  5GAE U;  5C2G A;  4ZLN A;  5KFL A;  3IR6 B;  3VAJ A;  3UE2 A;  1VBZ A;  5E3Q A;  1SJR A;  1FTR A;  2W4P A;  1WG4 A;  4ZDN A;  2GJ2 A;  3Q0A A;  2RU3 A;  2B9Y A;  1RHM B;  3C15 B;  2NLW A;  3QFH A;  2QA2 A;  3E01 B;  1RAI B;  2AYG A;  2B51 A;  2W4C A;  2YWH A;  2NXE A;  5EDW A;  2OH2 A;  4DX8 H;  2K2P A;  5C24 B;  3DM2 B;  1C0U A;  4DZ6 A;  2VF3 A;  3FRY A;  3MTK A;  5D3G B;  2RRA A;  2LYV A;  1UA1 A;  4KO0 A;  1VQL S;  1RWU A;  2FUG 9;  3SQO P;  3OUY A;  3SQG A;  2BJ7 A;  4CH1 A;  1QVF R;  4KKO A;  4AND A;  3CDU A;  3DGP A;  1E6V A;  2F4V F;  5AXM A;  4QU6 A;  1AYE A;  2MTL A;  2R8I A;  1HAR A;  4IQX A;  4ERD A;  4N7T A;  3D54 A;  4QIE A;  1WHW A;  4FZV A;  3OTO J;  2HNZ B;  2D3O 1;  2AMC B;  4EI2 A;  5I42 A;  1SIW B;  3MM7 A;  4B3O A;  1OSC A;  3GYG A;  3GIJ A;  3MMC A;  2R8H A;  5KFD A;  4CH0 S;  4YP3 A;  2CPX A;  3SCI E;  2R7U A;  5B0C A;  2UXB F;  4TU7 A;  1ICE B;  4EMD A;  1AA1 B;  3TX8 A;  3RB6 A;  1U2R A;  1JJ4 A;  2BX6 A;  4Q7A A;  2KVI A;  1TKZ A;  3CD6 S;  2IVM A;  3K8V A;  3CTR A;  2GO8 A;  2RHS B;  7FD1 A;  1N5Q A;  2DH7 A;  3G6E S;  1XNQ J;  2CG8 A;  2HFN A;  2VKZ G;  3W65 A;  4UOH A;  1MW7 A;  3QIP B;  3H5S A;  4URQ U;  1FE4 A;  5CCL A;  4LRA A;  2A0F B;  2KT3 A;  2C2E A;  1FER A;  4DSL A;  3GG0 A;  1X9M A;  3AJ1 A;  1RWV B;  1S1U A;  4JI7 F;  3H2L A;  5F8J A;  5T14 A;  1OJ4 A;  2XLK A;  2ZVS A;  2MKK A;  3GR1 A;  3NGT A;  4M5G A;  4KGM A;  1VBY A;  1OPZ A;  1C1C B;  2I2Y A;  4NL5 A;  4YOE A;  3A1Y G;  1X4B A;  3EZU A;  2CRL A;  4UY8 T;  2AX0 A;  5HVH A;  2GAH C;  2XY7 A;  4I7F B;  2AYB A;  3OFF A;  3VGV A;  4NI2 A;  2L08 A;  2LXU A;  2BM1 A;  4N41 A;  2WBR A;  4Q8E A;  3BSN A;  2E7V A;  2G4B A;  3WIV A;  2LEC A;  1EAY C;  4V19 X;  2C2K B;  2P6T A;  3SZ2 A;  5DM7 Q;  5ITH A;  2DNQ A;  2ZJR Q;  3M7V A;  5KFA A;  1BE4 A;  3OJS A;  4I6A A;  5KFK A;  4RPF A;  5KTQ A;  2KXF A;  2RQC A;  1HI8 A;  1S1X A;  3NKY A;  3S01 A;  5GME A;  4X66 J;  2D3O R;  2ZZM A;  1JLA B;  3D0H E;  3NAI A;  3V6K A;  4DL5 A;  2CPE A;  7AT1 B;  4JI2 J;  2IBK A;  1FEH A;  3VQT A;  3DNC A;  4WP9 A;  1RTI A;  2J9C A;  4OYI A;  4F3Q A;  2VB6 A;  1S6Q A;  2PFD A;  1HD1 A;  5I3P A;  2RQK A;  1RWM B;  3V2U C;  3QAU A;  3SV3 A;  3HHD A;  4F2S A;  4QR1 A;  2QRR A;  5T7L A;  1OY8 A;  4LF9 J;  2KT5 A;  2MLZ A;  3EE3 A;  2XMM A;  1KBR A;  2DCL A;  2ZBQ A;  3D6T B;  1RHJ B;  2V67 A;  5AXL A;  3NNH A;  4F0M A;  4KV8 A;  1IXK A;  2NXC A;  3WC0 A;  1VK8 A;  4EK2 A;  2QN6 B;  2X51 A;  5A76 A;  2B5J A;  1BHN A;  4M95 A;  4LF6 F;  2MLY A;  1VRT A;  3KK2 A;  4DV5 J;  1J5O B;  1YQH A;  3RRG A;  3R2C J;  2XCP A;  3MUV P;  3CCQ S;  3J80 U;  4OZ2 A;  1N56 A;  3MAA B;  3H90 A;  2MEW A;  1X5S A;  3LAN A;  3DRR A;  4J9L A;  3N5B A;  2MGZ A;  1XR5 A;  4MK7 A;  3H5U A;  1Y10 A;  4DR4 F;  2IDL A;  4DXL A;  2OPP A;  5LXY A;  1WTB A;  2KYX A;  3J7Z T;  5ADZ A;  1GMU A;  1HNI B;  4ENO A;  4GMK A;  2VBW A;  3R1H A;  4B3T J;  1GXU A;  2N4C A;  1S1T A;  4WU2 A;  3DHX A;  5J2Q B;  1Q78 A;  2OI2 A;  2W2N P;  1DLO B;  3EZ5 A;  4JV5 F;  2VC1 A;  3U02 A;  2R7T A;  3BGU A;  4C2M A;  3DOK B;  3PKY A;  4OI2 A;  3LQV A;  1W25 A;  5CZV A;  3HXM A;  4AQY J;  1Q4R A;  4DR5 J;  2XS5 A;  2IY5 B;  2Q3P A;  1XK8 A;  1UMJ A;  3V4I B;  4RNN A;  1N0V C;  1VQN S;  1XNR J;  3D6M B;  1PAU B;  3M8Q B;  5LT5 A;  1VJQ A;  3PV8 A;  1FJ7 A;  1SKR A;  1N5T A;  2XMV A;  2KRR A;  1RU1 A;  1YI2 S;  2HIY A;  4YFU A;  5J1P A;  3GG1 A;  5LJ3 Y;  1N8R T;  4DV4 F;  2XO6 A;  2B6A A;  1B7Y B;  2IBO A;  4NEZ A;  3MED B;  2LA4 A;  1MU2 B;  1S1W A;  2ASY A;  1VQ5 S;  2OUG A;  3JSM A;  5ETO A;  1OS5 A;  1SH2 A;  2HUR A;  1UFK A;  1TU0 B;  5E3R A;  3BZQ A;  1Q16 B;  4G3I A;  3GE9 A;  2QE5 A;  2NRE A;  5DO2 A;  5LM7 E;  1TEL A;  2IAJ A;  2XLJ A;  4O3N A;  2CQB A;  2K8G A;  1WUU A;  2Y1R I;  1TKT B;  1U1M A;  1VC5 A;  3N4W A;  4KH0 B;  2CNK B;  4MFB B;  3ONQ A;  2CA9 A;  4DV7 F;  3MM8 A;  4LRC A;  2GQ2 A;  2R7R A;  5DDQ C;  2GML A;  4DZD A;  3FBF A;  3QGH A;  4ZOS A;  3TUJ C;  1N0U A;  1B4S A;  4B3M J;  3I5B A;  2JL9 A;  3PO5 A;  3MR6 A;  3C6U B;  2C22 A;  3BYP A;  3VR1 A;  1NDL A;  4RUB A;  2DR9 A;  1YDL A;  4Y2K A;  4OZ1 A;  4RWW A;  1EHW A;  1FNO A;  1CJU A;  2UUC J;  3JAM U;  3D1O A;  2VFU A;  4JI8 F;  3MDF A;  5K20 B;  3IP0 A;  1UWB B;  1N6Q A;  4XTT A;  2I8E A;  2BJ1 A;  2ZJQ Q;  3TEH B;  3LWM A;  2QMU B;  4WE1 A;  2HEK A;  2CDQ A;  1NAQ A;  3CWJ A;  1CJK B;  2DGX A;  3HI9 A;  4OHZ A;  4QYZ J;  4NYP A;  3LP0 A;  3HHK A;  4GVL A;  4U9R A;  4DI6 A;  1X5P A;  1BY9 A;  4Y2C A;  3M8R A;  4ECU A;  2FJV A;  4NZ6 A;  3DLG A;  5B0E A;  4WCE Q;  2VUG A;  2ZH7 A;  2K06 A;  2JJ4 D;  3J7Y U;  2BBE A;  2GMH A;  1TL4 A;  1UEU A;  4WFN Q;  3MMA A;  1U47 A;  1H73 A;  4OZJ A;  2AX1 A;  1HQE B;  3MEK A;  2B7B B;  3D1H A;  2EVZ A;  3C14 A;  3T1H F;  2NZC A;  1T8E A;  1S79 A;  9RUB A;  3KG0 A;  5KFN A;  3PR4 A;  1FXD A;  3MF5 A;  4L76 A;  5CZX A;  4CWB A;  3QJJ A;  1NLK L;  4U6P A;  2O5D A;  4DEZ A;  5E7O B;  4PQA A;  1JB0 C;  1Y9O A;  4OZ0 A;  2OPS B;  3DU6 A;  2BQ3 A;  2ZOM A;  3AOA A;  2ACY A;  2RRN A;  1IJE B;  3L9Z A;  4X62 F;  4QBU A;  5J2M A;  5FII A;  4YDD B;  4TY8 B;  2UUA J;  4MTP A;  1NKE A;  4DFK A;  4F7V A;  2JC1 A;  2A10 A;  1R89 A;  4LRF A;  3AA8 A;  2XCA A;  5EHH A;  4ZP8 A;  1WC1 A;  3ELH A;  5ETR A;  1UEV A;  5KFT A;  2ZH9 A;  2JLE A;  2HND B;  2J8A A;  4M5M A;  3TZW A;  1TKX A;  3PIP Q;  3W1Y C;  3OHB A;  1NJW A;  4L72 B;  1JK9 B;  2BAC A;  4OFZ A;  3FBE A;  3TR5 A;  3LF0 A;  4ZP6 A;  2QZ8 A;  1RHU B;  2XBP A;  1HQU A;  4EYI B;  3MTJ A;  4EBE A;  4O0I A;  1HW8 A;  1Q5V A;  2Z2M A;  2DNY A;  2YNG A;  1TKD A;  3ISN D;  4ZS6 A;  3GCW P;  3W9H A;  4NLT A;  4X4R A;  3QT7 A;  1C0U B;  4M5N A;  2DJW A;  2HBZ B;  5H9E J;  5L1J A;  5HI7 A;  4Y2I A;  1T02 A;  2AJ2 A;  3HM9 A;  4KO0 B;  2HGM A;  1FES A;  5GAG U;  3GV5 B;  1AW0 A;  2OEL A;  3OUY B;  3SQG B;  2B56 A;  4KKO B;  1RAF B;  3DGP B;  4WP3 A;  1E6V B;  1OY6 A;  1YK9 A;  4OYB A;  2YPZ A;  1A0O B;  4FKY A;  3G82 A;  4ED7 A;  3L4B C;  3ZZZ A;  2RD5 C;  4A8F A;  3G6X A;  3PZP A;  1X4H A;  1CS4 B;  2PEH A;  2XM3 A;  2FDN A;  4X4O A;  1T3N A;  3EGW B;  1YKW A;  2JDJ A;  5I42 B;  4YS2 A;  5IT4 A;  4B3O B;  3MMC B;  4ID5 A;  5EN1 A;  5D4P A;  2JSX A;  2BJ3 A;  2BAN A;  3G8T A;  3R27 A;  1SL0 A;  2YQ0 A;  1YBU A;  2CJ9 A;  2YPY A;  1T9W A;  2AWZ A;  2V2K A;  5B0D A;  3QGG A;  3A13 A;  3UI3 A;  4K5R A;  1TKZ B;  4A46 A;  1DHM A;  2RAQ A;  5A8K B;  3R5G A;  2VZ9 A;  4OJ1 A;  2LLZ A;  1NO8 A;  1XMQ F;  4K4U A;  4J9N A;  1VHI A;  1S0N A;  1SJF A;  2CQP A;  1RAH B;  4WPA A;  1FKO A;  1FFG B;  1S6O A;  3LP1 B;  3CD5 A;  2HS3 A;  3O1L A;  2DGW A;  2FJA B;  3IWL A;  1Y4Z B;  4Y6I A;  1AFJ A;  4FXV A;  2ZH2 A;  3ILJ A;  4ZCI A;  4ECT A;  4FBU A;  3ENQ A;  2EBE A;  2ROE A;  3ITH B;  4DOZ A;  2PT0 A;  4DLG A;  4MKB A;  4USM A;  5DGB A;  3NNC A;  2FB0 A;  4JP8 A;  4NI2 B;  2OD4 A;  2UXC J;  3MPU B;  5DDR C;  4B9V A;  1O8B A;  1UZD A;  2ZEJ A;  2BOA A;  5KFW A;  1FRI A;  2VA2 A;  3K89 A;  1RKI A;  2FYX A;  2HFV A;  2DNZ A;  3IGN A;  4DQR A;  2DNG A;  3UCZ P;  3GCX P;  4P6Q A;  3VGU A;  4A8Y A;  2IPO B;  5A0Y A;  2XSF A;  2KDO A;  3BGL A;  1XIQ A;  4M5D A;  5KG0 A;  2PII A;  4H4M A;  2JEI A;  4PQU B;  4C97 A;  3FNN A;  5DZ6 A;  3W64 A;  1UCN A;  1KWM A;  1MRO A;  3E51 A;  5L39 A;  1UJ5 A;  2Q79 A;  5C2C A;  1HBU A;  3TEG A;  2N3L A;  1CJV A;  1FRJ A;  3CCE S;  4Q43 A;  1PYO B;  5K8M A;  2L3M A;  3HX9 A;  2WZ1 A;  1N33 J;  1RTI B;  5KFI A;  5LJ5 Y;  5GAD I;  2DT9 A;  4FYX B;  5IV3 A;  2HFO A;  5I4M A;  1HNW F;  1LV5 A;  4N8N A;  4PEO A;  4OX9 F;  7FDR A;  3PRB A;  1HLW A;  5T7L B;  3MPD A;  1WEZ A;  3CUN A;  5D15 A;  2NS1 B;  4LIW A;  1PBU A;  3SV4 A;  1WC4 A;  2DEI A;  4DR1 F;  1LNQ A;  2EKN A;  4PPZ A;  3CJK A;  3CJQ A;  2UVR A;  2IVF B;  1UVI A;  2J0S D;  2LQ8 A;  1ROF A;  5DQH A;  1Z2Z A;  3ZZP A;  3OHA A;  3QZ7 A;  5H9F J;  2XO7 A;  3UD4 P;  1SJ1 A;  3HHE A;  1VRT B;  3CIM A;  4P7T A;  4MIB A;  3PX6 A;  3FBC A;  4H4O B;  4IFV A;  2V2V A;  3FCV A;  3VF0 B;  1U24 A;  2FQQ B;  4LR9 A;  3M6U A;  1NB2 A;  2YX4 A;  3DRR B;  2V8D A;  1X4A A;  2MGZ B;  2KJW A;  3R3T A;  5B0B A;  1I94 F;  4NCG A;  3U1N A;  2CQH A;  4G1P A;  2W7O A;  5L46 A;  4JI3 J;  1IJF B;  2JHE A;  1QAI A;  1S1T B;  3AJ2 A;  4DLE A;  2MHE A;  1K0T A;  1V3R A;  4LFB F;  5KAK A;  2E5I A;  4KT0 C;  1RHQ B;  5KFM A;  2PGC A;  2JZ5 A;  4QWB A;  3KHL A;  4MYT A;  1LWC A;  4FP9 A;  2E66 A;  3BH6 B;  5HP1 A;  3ILO A;  4RKU C;  1XQI A;  4FBT A;  3SFG A;  1NRK A;  3NCR A;  4ED6 A;  4MIW A;  2DEJ A;  2L9N A;  5GVQ A;  3UO0 A;  4NLX A;  1UVK A;  2I1R A;  4DHV A;  2B6A B;  5AE3 A;  2OPQ B;  2FY8 A;  3AXK A;  3A3P B;  4JI4 J;  1UEK A;  4BC9 A;  2V5H G;  2N82 B;  1UWA A;  4OQJ A;  2OTL S;  1TR0 A;  2R42 A;  2DGO A;  2QFI A;  4ZVS B;  1TL1 A;  4CM0 A;  1U8W A;  3MZI A;  3K58 A;  1ZPW X;  2CPH A;  1BUX A;  4J37 A;  4CI0 B;  1M5P C;  4A8X A;  1G2E A;  3I6P A;  1NPR A;  1KFS A;  4O4G A;  4XDD A;  4DUZ F;  1RCO B;  1U4B A;  4U96 A;  1WSV A;  1JLC A;  1DY3 A;  5KFE A;  2EC0 A;  1N32 J;  2IAJ B;  1S9E A;  5A2Q Y;  3R5J B;  5KFZ A;  4Y28 C;  1TVR A;  2WHO A;  2ZH3 A;  1UJ6 A;  4B9S A;  2HHH F;  2SXL A;  2XWY A;  1BXN A;  1JJH A;  2BW7 A;  4ZP9 A;  3ZC4 A;  1L3K A;  1B64 A;  2DIS A;  2FJW A;  3G8S A;  2XS2 A;  3GV7 B;  4IOA Q;  1S6U A;  4ER8 A;  2XYH B;  2PO4 A;  1H2V Z;  2ZD1 A;  1LQ9 A;  3D2W A;  1QLN A;  3LOU A;  2M88 A;  2IVY A;  2H4Y B;  4O3S A;  2DVI A;  1S99 A;  3PNI A;  2V69 A;  4C8Y A;  2VON A;  2R7V A;  3CMA S;  5IC6 B;  1SKU B;  1HQ2 A;  4DV0 F;  1VQ4 S;  2W2O P;  4WK3 A;  1W7W A;  4CLK A;  1B3T A;  4LBH A;  2BUN A;  3PRD A;  3SMZ A;  4DUY F;  2K7J A;  2Y0S D;  1KTQ A;  3OR1 B;  4WE1 B;  4Z7C A;  5J2P A;  3HT3 A;  4FYV B;  4WFZ A;  2MJU A;  1NJZ A;  1P9Y A;  3BR8 A;  5KG7 A;  2A18 A;  3O2I A;  3HZE A;  2A3J A;  3HUL A;  3LP0 B;  3LGM A;  4P2F A;  1RT4 A;  1TAQ A;  2AEM A;  2DIU A;  2XB2 D;  2CXE A;  2CNO B;  3KTQ A;  4URG A;  3DLG B;  1U1P A;  3DN9 A;  1HR0 F;  1FWK A;  5KG5 A;  5E3A A;  2M0G B;  2ASD A;  4ALZ A;  2BE9 B;  4DPW A;  3M8Z A;  3PXG a;  2HQC A;  2UXD J;  4EZ6 A;  4X84 A;  2CJX B;  3TJ9 A;  1JLQ A;  3R6G B;  1S59 A;  3MMA B;  1ZA1 B;  1RT3 B;  2AHO B;  3UQS A;  1C1B B;  5AJ3 J;  2PE8 A;  3DHW C;  4F04 B;  1TL3 A;  2QLW A;  3AA9 A;  2HNY A;  4KHP F;  2HHV A;  2Z2Z A;  1U6B A;  3PW2 A;  4JYA F;  3H2V E;  1JKH B;  1WI8 A;  4H4K A;  2WTF A;  2OIH A;  3CC7 S;  1IKY A;  2ABY A;  2CJQ A;  3M2U A;  2CPZ A;  1WF2 A;  2B9X A;  3EGN A;  3MM9 A;  5KOW A;  2ZC4 A;  4G1Q A;  4UZC A;  5SZT A;  2OML A;  1N48 A;  3M2V A;  2VQF J;  4CP5 A;  3MMJ A;  2PA8 D;  3SXL A;  5GAE I;  5HQL A;  3TAR A;  3OBI A;  4ILM A;  3VWS A;  2NCK L;  1F1B B;  3IA0 A;  2FC8 A;  3W7B A;  5KT3 A;  3CF5 Q;  1UVM A;  3QRQ A;  2AZ3 A;  4CO4 A;  4FXW A;  4QU7 A;  3R5D A;  3M6X A;  1TKX B;  3KJQ B;  2ZHA A;  3HF5 A;  3PX4 A;  4N56 A;  4NXN F;  4B9N A;  1JLF B;  4JI6 J;  2ACM A;  1RUS A;  1RZM A;  1HQU B;  5HAO A;  1K44 A;  2KU7 A;  5KT6 A;  1D09 B;  1KR4 A;  4ZKA A;  1Y00 A;  3M32 B;  1ZTT A;  4PG4 A;  2YNG B;  3AD8 C;  4NLP A;  3TWZ A;  3HVR A;  3RB3 A;  2ZZN A;  1I51 B;  5D8H B;  3TQE A;  5KG6 A;  1S72 S;  1GNK A;  2OFG X;  4NZ0 A;  1HNX F;  3VCD A;  4P7V A;  5CHC B;  4QYZ K;  2BZ2 A;  4U95 A;  1FRK A;  1JXE A;  3EPI A;  4OZ3 A;  4UOG A;  3CDE A;  1BC6 A;  2BJ9 A;  2JRS A;  5KFX A;  3D0G E;  1UW9 A;  3EPG A;  1LK7 A;  4W92 B;  4DN9 A;  3G82 B;  2W7P A;  3R97 A;  1RT1 A;  4CNZ A;  4A8O A; 
#chains in the Genus database with same CATH homology
 3NGT A;  1WKJ A;  4C6A A;  3VGU A;  1NDP A;  1EHW A;  3ZTO A;  3WX8 A;  1WKK A;  2DXF A;  1KDN A;  1NDK A;  3EVO A;  2CWK A;  2B8P A;  1VYA A;  1NHK L;  3BH6 B;  5CAB A;  2AZ1 A;  5IOL A;  1F6T A;  1NDC A;  2HVE A;  3EMT A;  2HUR A;  3L7U A;  3ETM A;  1S59 A;  1XIQ A;  1XQI A;  3EVW A;  4ANC A;  4FKX A;  4ENO A;  3Q89 A;  2HVD A;  4O0N A;  4KPC A;  3PRV A;  1JXV A;  1K44 A;  3Q86 A;  4HR2 A;  3FBC A;  1S5Z A;  1S57 A;  3FCV A;  1NCL A;  3JS9 A;  3BBF A;  3VGS A;  1UCN A;  3NGR A;  3VGV A;  3PJ9 A;  3NGS A;  1NB2 A;  1ZS6 A;  2VU5 A;  3Q8V A;  3ZTQ A;  3ZTP A;  1NUE A;  1NSK L;  4DI6 A;  2DYA A;  1NPK A;  1PKU A;  3VVT A;  3Q8Y A;  3EE3 A;  1NSQ A;  3FBB A;  2DXD A;  4FKY A;  2B8Q A;  1HHQ A;  3ELH A;  4F36 A;  5BXI A;  2BX6 A;  1W7W A;  1LWX A;  1HIY A;  1LEO A;  3BH7 B;  2BEF A;  3FC9 A;  3GPA A;  1U8W A;  1PAE X;  3ZTR A;  1BUX A;  3EVM A;  3FCW A;  3GP9 A;  3FBF A;  3EM1 A;  3EJM A;  3R9L A;  4EK2 A;  3VGT A;  4S0M A;  3Q83 A;  2ZUA A;  4DZ6 A;  1F3F A;  3DDI A;  4W98 A;  1BHN A;  3BBC A;  1WKL A;  1B4S A;  4UOH A;  1BE4 A;  3FBE A;  4UOG A;  2DXE A;  4CP5 A;  4ANE A;  1NSP A;  3Q8U A;  5CAA A;  4F4A A;  4DUT A;  2NCK L;  1HLW A;  3EIC A;  3MPD A;  2DY9 A;  3BBB A;  3DKD A;  3ENA A;  4UOF A;  4AND A;  1NDL A;  1MN9 A;  3B54 A;  5C7P A;  3G2X A;  3FKB A;  1NLK L;  4WBF A;  3ZTS A;  1B99 A;  2AZ3 A;  3VVU A;  3NGU A;  3B6B A;  1MN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...