4MFBB

Crystal structure of hiv-1 reverse transcriptase in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
425
structure length
413
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Picomolar Inhibitors of HIV Reverse Transcriptase Featuring Bicyclic Replacement of a Cyanovinylphenyl Group.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 101
structure length 413
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4mfbB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB03
3G6YA 4MIAA 2D7SA 3MEDA 3QIPB 3KK2A 5KFEA 5KFMA 2UVRA 4Q8EA 2YNHB 2RKIA 3G6VA 1BQNA 4IG3A 4J9PA 1RA7A 5F8HA 4ZPAA 3IG1A 4NLDA 3Q8QB 4ED8A 1JLBB 1EP4A 2DPIA 3I0RA 3MEEA 3OHAA 4FBTA 4EYIB 1FKOA 1T03A 4DL3A 4ZVEA 3UR0A 1IKYA 1ZTWA 4MFBB 4Q0BA 3LP2B 4ECWA 3BGRB 1DLOA 4YMEA 4O4RA 5KFFA 1SH3A 5KFAA 1YVFA 2W8LA 4I7FB 3CDUA 2YKMA 3PW0A 4ZP7A 3PJXA 4NLRA 5HROB 2WB4A 3V6DA 3BGRA 3T1AA 1N6QA 1RA6A 1SH2A 4DEZA 2BQRA 5DGBA 3ITHB 4NLGA 2EC0A 3M8QB 3KLHA 3GIIA 1S0OA 2XCAA 3RAXA 4RW8B 4K4XA 2R8KA 2YNIB 3IGNA 3T5HA 3M9MB 3TAMA 1VRTA 3DLKA 2UVUA 1HNVB 1JIHA 4ED6A 5C24B 5J2MA 4RW7B 1DTTA 1IKYB 4Q0BB 1MMLA 3C6UA 5HLFA 2UUWA 3GQCA 5DLFA 1C0UA 3HVTB 4IG3B 3TQ1A 4RNNA 3DYAA 1DTTB 2I1RA 4G1QA 5J2PA 1S48A 1BQMA 5KFIA 3BREA 4H4OA 4KKOA 3NKYA 3H4DA 3OL6A 3NL0A 3JSMA 3UQSA 2JEFA 4RW6B 2IM2A 1FK9A 5KFRA 3GIKA 2RF2A 3TAMB 4ED7A 2ILZA 1K1SA 1QAIA 5C24A 4NCGB 5D3GB 4TQSA 4J9SA 4ECVA 5I42B 4I7FA 5J2QB 2BRLA 3T5LA 1LW2B 1RTDA 3MF5A 3BSAA 2V4QA 4KO0A 3OHBA 3V81B 3KHLA 2ASLA 5DG7A 3OL9A 1TL1A 1FKPB 3PW4A 3GV8B 4ZP9A 4IR1A 1RT7B 4DG1A 4KFBB 2HWHA 5EUHA 1D1UA 4TLRA 4RUCA 4KHRA 3KHHA 3LP2A 1TKTB 2VG5A 4EYHB 1CSJA 2HNDB 3DMJB 2R8IA 1SH0A 2WHOA 5J1EB 3QGIA 2J6SA 2ATLA 3DLEB 2CJQA 4IFVA 4YR3A 1RDRA 2FJWA 5KFWA 1HNIB 5J2QA 1JKHA 4J9MA 4G1QB 3DDKA 3KLVA 3KK3B 3M9NB 3DM2A 1RTIA 3GIJA 4H4MA 2AGOA 4WYWA 4TQRA 3RB0A 2C2RA 1LWEA 1HNIA 4TYBA 2HNYB 5K14A 4KKOB 3H98A 3HVTA 5KFUA 4WFXA 2XI3A 3UDLA 2W9CA 1KHWA 2W8KA 1JLQA 4QW9A 1XR6A 1I6JA 3C6UB 3RBDA 1HMVB 3KLFB 3T19A 4NLYA 4JUZA 1C0UB 3SI8A 4FS2A 2D41A 1TKZB 2HNZA 5HBMB 3LP1B 2B5JA 4EO8A 3QO9A 3LP0A 3SFUA 4O3SA 4WXWA 2WCXA 3MEGB 1LW2A 1RTDB 5F8GA 5HROA 5F8IA 3BSCA 1C0TA 4R5PA 1U09A 5I3UA 3GILA 2ZD1A 2W9BB 4MIBA 4ZP8A 3MFHA 5DGAA 3RB3A 3PVXA 1S1VB 1LWCB 1J5OA 4F4WA 5HP1B 4ECQA 4IG0B 2R2UA 3QLHB 1S49A 2VG6A 4B3OB 5F8MA 3CVKA 3RB6A 4WE1B 4NLUA 2GC8A 4MH8A 2F8EX 1S10A 3KLGA 4H4MB 5KFBA 4ECXA 4FBUA 2J6TA 5DQHA 3QIPA 3KK2B 5K14B 3GYNA 4IH5A 4MK9A 3OLAA 3H40A 1FKOB 1T03B 2W9AA 2R2RA 2JC1A 4NRTA 4XPEA 1TKXB 1RTIB 1GX5A 4J9RA 3VQSA 3DOKA 3CJ3A 1VRTB 2IA6A 3DRRA 2C22A 1S6PB 4I2PA 4IG0A 2ZE2A 2IM3A 4ZVHA 2AGQA 4K4YA 3RBEA 2GIQA 1HQUB 1OS5A 3QGGA 5KT2A 1IKXB 1HPZA 4O3OA 4DL2A 5JXSA 3DLKB 5DLGA 5T14A 2XC9A 3KMSA 2YNIA 3UPFA 3FRZA 4G3IA 5HBMA 2AU0A 4O44A 4K4SA 1TL1B 3LP0B 1HPZB 1EETA 5CYMA 5KT4A 3E01A 4ICLB 5F8LA 2YNFB 3JSMB 4IOBA 2OPSB 5L1LA 1TL3A 5I3UB 2B5JB 2IM1A 3KLEA 4M94A 3RAQA 5F8JA 4J9OA 2R8HA 5F9LA 5J2PB 1ZTTA 1S1TB 2JEGA 1RT4A 2CKWA 3H59A 5F8NA 3ISND 3CDEA 4IKAA 1MU2A 4EBDA 4NYZA 4PUOA 2JC0A 4WXOA 4RNFA 4O4GA 4TY9A 2IMWP 5CYQA 2AX0A 4F4ZA 2FVPA 4Q44A 3V6KA 3PJWA 1IKWB 5KFTA 5HP1A 4H54A 3V4IB 3EPGA 5EWGA 4DL6A 3BQ2A 2VG5B 4WYLA 4IFYB 1TVRB 3DI6B 5FDLB 3HVWA 1XR7A 2RDJA 3Q8RB 4KBIA 3DRSB 1T05B 1RT7A 4Q43A 4IFVB 2V9WA 3I0SA 4ZHRB 5HLFB 4IH6A 4RZRA 4YP3A 1RT6A 4LSLB 2OPRB 3I5AA 5KFYA 3IS9B 3BSNA 1RT5B 1UWBB 1JX4A 1JLAA 1S9EA 3H5YA 1S9FA 3MR2A 2E9RX 2B6AB 3KJVB 5KFLA 1C1CB 1JLCA 3QZ8A 4HYKA 1T94A 1S9GA 1JLGA 1LWFB 2UUTA 4RW6A 2FVRA 4IR9A 4O44B 3N6LA 4IRDA 1VRUA 4NLTA 4U6PA 4JV2A 1WNEA 4Y2CA 5I42A 1TKZA 2R2SA 3PZPA 2BANB 4ZMMA 2FVCA 3V81A 1EP4B 3DLGB 4MK8A 5KFSA 3GV7B 1S1XB 2AWZA 4Y2AA 2UVWA 5L1JA 1HMVA 3C6TA 2FVSA 2RKIB 3T5KA 1QE1B 2B43A 1HNVA 4Q8FA 1RT1A 3CIZA 3OLBA 4IQXA 1JLFA 5KG4A 3FFIB 3QYYA 5J1EA 1RAJA 2ASDA 4GC6A 2JEIA 5DG8A 4I2QB 4ID5A 5KFXA 4NLSA 4ZVFA 3ICLA 4LQ3A 4R5PB 3DOLA 4HKQA 2E9ZA 1JLAB 2YKMB 1QUVA 5EWFA 2XGQA 4F4YA 5KG5A 3KK1B 3OSNA 1S4FA 2ZKUA 2V4RA 2OPPB 5C42B 5J2MB 4R0EA 4K4WA 3ITHA 4NLOA 1FK9B 3DRPB 4PQUB 3M9OB 1S97A 3LANA 1NHUA 3E51A 2W9BA 3KK1A 1RYRA 4F50A 4KSEB 1S6PA 3MR6A 3ISNC 3MEGA 4NRUA 1RT2A 2YNGA 2GIRA 3NAIA 3IS9A 4O3NA 3IN5A 3V6DB 4J9QA 3PR5B 2VG7A 3QO9B 2IBKA 4DL5A 1S1XA 4TYAA 4K4TA 4I2PB 1MU2B 4TN2A 3EPIA 2E9TA 1RT1B 3NBPB 5DQGA 1IKVB 3LALA 5KG0A 3CWJA 3BQ0A 1S0NA 3D28A 3FQLA 3KLIA 5C5JA 1RYSA 1BQMB 1TL3B 3LAKA 1C1BB 3I5BA 5L1IA 3NMAA 2RDIA 1HQEB 1LW0B 1QE1A 5KFZA 5DG9A 5KFCA 4MK7A 1EETB 4RNMA 3KLGB 2HNDA 1S6QB 1RT4B 3DMJA 1IM4A 5KFKA 4QWAA 4K4UA 5J2NB 4GC7A 2BE2A 3MECA 1R0AB 1RTHA 3E01B 4ICLA 4KAIA 3H5XA 5DQIA 4M95A 1TQLA 2OPSA 1DTQA 4JV0A 2W7PA 3PW2A 1TP7A 5C25B 3V6HA 2BE2B 3MECB 1KHVA 4LSNB 4NCGA 5D3GA 4URGA 2IC3B 3IRXA 4O3RA 4DG1B 4Q45A 4OL8A 3JYTB 3Q8SB 5L1KA 4EO6A 3V4IA 1RT6B 3BJYA 4Y3CA 4H4OB 3CO9A 1KLMB 1S1WA 4TXSA 5KFNA 5KFOA 2OPQB 3KMQA 2IJNA 3H4BA 4X2BA 4PWDB 1SUQB 1N5YA 4KE5A 4KV8A 4RW4A 4PUOB 3KLFA 4IFYA 4YR2A 4IRCA 3IG1B 3BR9A 3KK3A 1S1TA 5KT5A 2BRKA 3GV5B 3DRSA 2OPQA 3CDWA 2AGPA 3RB4A 1C1BA 3C6TB 4B3OA 3DLEA 3G6XA 2HNYA 4O3PA 3MEDB 3QZ7A 3MTKA 2D3UA 3BSOA 2JLEA 1C1CA 1IKWA 3N6NA 4RW8A 4MKAA 1D0EA 4ZPCA 2BANA 2R8GA 3QLHA 4J9KA 3KHGA 2D3ZA 3DLGA 2WK4A 1REVA 4O4GB 4RW9B 3CJ4A 1N6QB 5KFQA 4ED2A 1S9GB 5EWEA 1HYSA 5KG7A 2OPRA 3Q8PB 2FJXA 2UVVA 4IH7A 1RT3B 1JXLA 4WFYA 1S9EB 5KT6A 1VRUB 3KHRA 2I5JB 2IC3A 3IRXB 4RNHA 2C2DA 2QE5A 1RTJB 2DPJA 2ZE2B 2V0NA 2HWIA 4MFBA 1JLGB 1LWFA 2WONB 3HVAA 1DLOB 3I0SB 4ZHRA 2B6AA 1IKXA 3KJVA 3I5CA 3NGDA 4QPXA 2VA3A 5F9NA 4JV1A 3BQ1A 4KHMA 4NLPA 1JLFB 3LP1A 2WTFA 4ZPBA 3D5MA 5KG1A 4ZPDA 3KOAA 4O3QA 4K4ZA 2WRMA 1HQUA 2YNHA 1SV5A 1NHVA 5JUMA 5KFJA 4ID5B 1TV6A 4YQWA 2VA2A 3FDSA 4ECUA 4F4XA 3PHEA 2BQUA 2YKNA 4WZMA 2HAIA 4RW7A 4Y34A 3HKWA 3H2LA 1TV6B 1LWCA 5KFDA 5KT3A 2FVQA 4WFZA 5CYMB 1RT2B 2WONA 2YNGB 3DYAB 4YR0A 1K1QA 4ED3A 2YKNB 5KFHA 1SUQA 1N5YB 4WE1A 4R8UA 3LAMA 1ZETA 1FKPA 1JLEB 5KG3A 3DRPA 4DL4A 4FS1A 4NLVA 2R8JA 2FLNA 2C28A 3PR4A 3M8PB 2I5JA 1R0AA 4URSA 4IRKA 4K4VA 4ED0A 1TKTA 1REVB 4RW9A 2HMIB 4KB7A 2BQ3A 1NNDA 4TY8B 3V6JA 3CJ2A 4KFBA 2XWYA 2YNFA 4PQUA 3HHKA 1HARA 3QIDA 1XR5A 4ECYA 4K50A 4RU9A 4I2QA 2OPPA 5C42A 5KG2A 1N4LA 1N56A 3MR3A 2ASJA 4TY8A 2C2EA 1RTJA 2R2TA 4NZ0A 5FDLA 4KO0B 1S6QA 4U7CA 2FLPA 2J6UA 1UWBA 2RF2B 3KNAA 1RT3A 3DOKB 1SV5B 2WOMA 2XCPA 1S1UA 1TVRA 3DI6A 1BQNB 4XO0A 4LSLA 1Z4UA 2O5DA 3NAHA 4MKBA 3KLIB 2AQ4A 3EZUA 4WZQA 4DL7A 3H5SA 4PWDA 5KFGA 4LQ9A 1T05A 1HQEA 3FQKA 3TVKA 1C2PA 2IJFA 2IAJB 3N6MA 1JLBA 4J9NA 2IM0A 4URQU 2ILYA 3NBPA 3SFGA 1S1UB 3MR5A 1N48A 1IKVA 1JKHB 4XPCA 3OSPA 2XGPA 1JLQB 3JYTA 3DM2B 2FLLA 3KLEB 2ZD1B 3G86A 5EDWA 3GIMA 4ZVGA 2VG7B 1T3NA 3M8QA 1LWEB 5CYQB 4LSNA 3KLHB 1S1WB 2XI2A 1S1VA 5KG6A 4J9LA 5C25A 4QWCA 4QWDA 2VG6B 4IDKB 4KV8B 2WOMB 4RW4B 4ZP6A 4EBCA 3OL8A 2HMIA 4NLXA 4ECSA 3CJ5A 4NLWA 2QV6A 2AX1A 4ECTA 2W7OA 1KLMA 4NLQA 1DTQB 1S0MA 2JEJA 1J5OB 1C0TB 4IDKA 5L9XA 1RTHB 3CJ0A 3M8PA 1JLCB 2BR0A 1LW0A 4R8UB 3OL7A 2HNZB 3I0RB 3MEEB 5KFVA 5KFPA 3DOLB 3MFIA 1JLEA 2W9CB 2FJVA 2ALZA 1QAJA 3FSIA 3H5UA 1RT5A 3QGHA 4RUAA 2OH2A 1GX6A 5J2NA 5KT7A 4ECRA 4RNOA 4QWEA 4EBEA 4ED1A 3DRRB 3IGVA 3PW7A 1W25A 1HYSB 4QW8A 3T5JA 4QWBA 1TKXA 4ECZA 3FFIA 3PW5A 4EEYA 2IAJA
chains in the Genus database with same CATH superfamily
4MIAA 2D7SA 2HRYA 2NLWA 3BGOP 2YNHB 3G6VA 2DNKA 4IO1A 2HVHA 1BQNA 4DX5A 4USMA 2X3GA 3MPVA 2AD9A 1RA7A 2E5GA 2RHQB 5DRKA 5F8HA 3J81U 5HL7Q 4FKXA 3IG1A 4ED8A 4B17A 3OHAA 2BKNA 4ZVEA 2HBRB 2VC1A 4LF4J 4MKYA 4LT6A 5HQMA 1NH8A 4J5OA 3K59A 5AJ3F 1PYOB 2GVDA 2VHGA 3FSXA 5KFFA 1U24A 5CZVA 5KFAA 2VJVA 4QR2A 4QIGA 3AHPA 2QFIA 2YKMA 3CDUA 3Q86A 1WC0A 3QPIA 4DR3J 3H2VE 4NLRA 2N4CA 5RUBA 1APSA 3GE9A 3BGRA 4MKVA 2U2FA 2WSFC 2LU1A 2KG0A 4DWIA 3HZEA 3ITHB 2FYXA 4F04B 3R7BB 1S99A 4OX6A 1CQNA 2OUGA 3CJQA 2FC9A 3UWTA 1S0OA 2HHVA 4RW8B 1L3KA 3UW1A 3ZTOA 2IDEA 2YNIB 3IGNA 5B0CA 3T5HA 4JI3J 1SKWA 2DR6A 3DLKA 3BO3A 1JIHA 4DPYA 2JDJA 3H8YA 3MPWA 1DTTA 3VAIA 2KZMA 1GFWB 2GX8A 2I0XA 3O1LA 2UUWA 3HVRA 2J0SD 4WF9Q 1JJ4A 1FEEA 2VPYB 4IG3B 3I55S 4DR1F 4RBVA 3DYAA 1U0SA 2KT3A 2V34A 3D1OA 3OTEA 2X1FA 2DD8S 1YBAA 3GYGA 4LFCJ 5EHHA 2Z2MA 4I1TA 4C11B 3BREA 2K06A 3H4DA 3B6BA 4CNYA 3J7A1 2IVFB 1UVNA 1ITPA 2MY7A 2IM2A 4TVAB 3VAMA 2RF2A 3TAMB 1BE4A 1ZM9A 5D3GB 3E2EA 4Y28C 1I1GA 3MF5A 4NASA 4OZ5A 4Z2XA 4DR1J 2RB7A 2V4QA 3T1HJ 3W5YA 2D3O1 2XMWA 3KHLA 1HR0J 5B09A 3SBMA 4U67Q 1FFGB 2VIHA 3PW4A 1T9UA 4RUHA 3GV8B 2ZH8A 3K8VA 3GMGA 4ZLPA 3NMRA 3CCRS 1RT7B 2HZAA 2HWHA 1DAXA 1TMMA 1YGYA 1CJKA 2B56A 2EEYA 1QLNA 4G1PA 5ETNA 3LP2A 1TKTB 1IBKF 5IOLA 1SL1A 2VG5A 1H2TZ 2M9KA 2Z0GA 4EYHB 2HRUA 2HNDB 3QNWB 4ELUA 1SH0A 5J1EB 3R6LB 2J6SA 3J7AN 3CD7A 4ILLA 4YR3A 2CQ3A 3ELHA 5J2QA 2H1YA 1JKHA 5GMDA 1P9YA 4GRSA 3UI3A 2JVRA 1Q5YA 4FKYA 3W5ZA 4KYZA 4WYWA 4B3TJ 3RB0A 1U6BA 1XMQF 3PRVA 3ZNUA 3G2XA 4TYBA 1B0TA 3LOUA 4KKOB 2G1DA 3NOCA 4LREA 3CXCR 3AB2B 2CPJA 1RWOB 3MUMP 3OD2A 3UDLA 1IBKJ 2R7UA 1KHWA 1FRLA 2EK1A 2RMLA 3AJ2A 4ETZA 4QW9A 3EWGA 1I51B 3RBDA 4Q7AA 1HBUA 2AYMA 4OYPA 4KY3A 3CCUS 2YQ0A 1AB8A 3MI7X 2D41A 2QYCA 3HD2A 2B5JA 3IP0A 2YX1A 3QO9A 4CH0S 3LP0A 1UA0A 1I94F 2Z4PA 1QAXA 2LEBA 4WXWA 2POKA 4CWBA 4B08A 3GG1A 3PRDA 1U09A 4C2MA 2KDOA 5I3UA 2HWTA 4J90A 3D4JA 4DCJB 1VC5A 3QFWA 1RKJA 3CCSS 2M0GB 2R7VA 4FXDA 5DDPC 1FO1A 4F4WA 1Q7YT 4X4SA 4IG0B 3F56A 4ECQA 2OJ3A 2CAJA 4ZITA 4K4VA 3ENVA 4AQYJ 3NGKA 4ERDA 2YPYA 1YBTA 1R0CB 1FVSA 1HWJA 4KT0C 1WACA 1XNRF 4FBUA 2J6TA 2N3OA 3LTOA 1U6FA 3MOZA 1Q8KA 2VKZG 4BWJA 5HVGA 4WCEQ 5DQHA 3QIPA 4MK9A 4NA3A 1HBMA 3H40A 1NB2A 2DITA 2I8EA 2IVYA 2JC1A 2VV5A 3U1NA 2P6SA 1TKXB 4CP5A 4F3OA 2MQ8A 4USJC 1FFWB 3TJAA 4CNZA 4J37A 2V67A 3R9LA 4DQPA 1TFYA 2NXJA 4FXWA 1FESA 4I2PA 2QGFB 2RS2A 2ZE2A 2GVZB 3D66A 1PJ7A 2ERRA 3PKMA 3E3XA 4PG8A 2MB0B 3TUJC 1OS5A 3Q22A 4B9TA 5KT2A 1I3OB 5IV4A 2F8HA 5DLGA 5T14A 4LF5J 3C16A 3ADAC 2XC9A 1GXTA 2W24A 2YNIA 2IA0A 3ZO7A 3UPFA 2P2CB 4CCHA 2IIHA 4DU7A 1FWLA 4IQMA 1TU0B 3LP0B 5CZXA 1RCOB 1HPZB 3FK4A 2V2QA 4U7UD 5CYMA 5KT4A 1RK8A 5G4DA 5F8LA 2YNFB 2DHHA 1VDHA 4ZVSB 5LSRA 3BEGB 4OX7A 5M2RA 3A8EA 4DV0F 1Q82T 4EZ6A 5I3UB 5IT4A 4M94A 3TA1A 4U95A 5E3PA 4J9OA 2RDDA 4NX9A 2XZWA 4HVZA 5IFMA 1UFKA 1V3RA 5C7PA 2UXDJ 1Y11A 4NEZA 5F8NA 3MURP 2OLWA 1VIXA 1FERA 3CDEA 1MU2A 3IR5B 4IKAA 3GU0A 4WXOA 1GEHA 2H4YB 3B54A 5HJYA 4O4GA 2IMWP 1GT8A 2ZJRQ 4F4ZA 2FVPA 1QTMA 4Q44A 3PJWA 2VB6A 3NNHA 1IKWB 2VUGA 5HP1A 4H54A 4HHJA 2N82B 1UKUA 4DV1F 4DL6A 3C2PA 4HT5A 4WYLA 1TVRB 3DI6B 3LGMA 4L73A 5FDLB 4EI2A 3VGUA 5B0GA 3SQOP 3ETOA 4A47A 1H0HB 2RDJA 1PO6A 3Q8RB 4JYAJ 3I0SA 5HLFB 1WHWA 2FGCA 2FZCB 2C3MA 3DN9A 1TUVA 1KTQA 1RT6A 2CQPA 2KXFA 4XK8C 3W8GA 4DF4A 3MM9B 2BOAA 3G8SA 3ILOA 2OTLS 2VBZA 3IS9B 3I82A 4J7CA 3SCKE 4CLYA 4LFAJ 2DH8A 1MG7A 4CRJA 1U1RA 4PG7A 1SJQA 4DN9A 3B4DA 3H5YA 2CNLB 2OKQA 1S9FA 5E3CA 1HBNB 3J7YI 5KFLA 4CO4A 4OZJA 3PACA 1D9DA 3RJMB 1JK9B 3C16B 3VGSA 1LWFB 4I4BA 1HHSA 3WBZA 4DR5F 4RW6A 2DHXA 2XB2D 2M88A 4DV6J 2D9OA 3PX0A 1V9OA 1VRUA 1FX4A 2CNKB 2RD5C 4HTIA 4NLTA 4YY3J 5I42A 4U6PA 2G9OA 1TKZA 2V8DA 3AA9A 4M5LA 4S0MA 1PBUA 5FLXU 3HT3A 5E41A 4UTGA 1FD2A 2OO4A 2HVDA 4WIIA 4OI0A 2CVIA 2CWXA 3NNAA 3DLGB 1OSDA 3R5DA 4LJMA 1M1KT 1FXLA 1UTAA 4DV4F 5GAHU 3DNCA 4EZ9A 2Z30B 4DV7F 2AWZA 1U1QA 3DDIA 2CUYA 3C6TA 2HGNA 3CB4A 3P5TL 5E33A 2SXLA 2RKIB 4K5RA 1QE1B 1HNVA 2XY5A 1RT1A 1QDUB 3CIZA 4OYXA 3OLBA 1EJ7L 3MCMA 4OFZA 4IQXA 1KWMA 4JI4F 3FFIB 3P5BP 3QYYA 1NXIA 2ASDA 1B70B 4I2QB 3LQVA 1EQMA 4A8OA 1U1KA 2JHEA 1GTHA 1U1OA 1XNQF 4A4JA 1BC6A 1SIWB 2DCLA 2AIRB 2CPYA 3CJKB 2J9DE 1WHXA 3CSKA 3QT8A 4LR9A 5CA5A 1ZM3A 5KG5A 2V8PA 4DV2F 2EFPA 4C3MA 1S4FA 5IC4B 2V4RA 5C42B 3RTVA 4K4WA 1VQMS 3MMCB 1FXRA 1FK9B 4PQUB 3M9OB 3P6YC 1NHUA 3EVWA 1Z1ZA 1OIAA 3CPWR 2QA2A 1KVJA 1RT2A 1NCLA 4Q5VA 1CC7A 1PC5A 1OY6A 1UZDA 2BJ7A 1S7IA 2FUG9 2QRRA 1H7XA 3R27A 4PAAA 4YB5A 4ZJOA 3T41A 1NMEB 1KQGB 2NXCA 2LDIA 4OYMA 2KB2A 1RWPB 1TAQA 2FGOA 2HPUA 1BWEA 3CJSA 3A13A 3GTYX 1MU2B 3KDNA 5THWA 4LBIA 2KHDA 2MHEA 4A46A 2UUAJ 2CQDA 4QYRA 1U2RA 5IWAF 5GADI 3QJPA 2PDAA 1V3ZA 1FF2A 3QMQA 1AFJA 1WC1A 1L3VA 1NDLA 1HA1A 3CWJA 1AA1B 1YBUA 2DNLA 3D28A 5H1SV 3FQLA 3KLIA 1VLOA 1WF2A 2A0FB 3LAKA 2QLBB 2V9KA 8RUCA 5L1IA 5DM7Q 2LQBA 4DS5A 2CPDA 4EMDA 1JJCB 2MKJA 2UXBJ 3IWXA 1QE1A 2P5VA 5KFZA 1P8GA 2QJ3A 3DOMA 1ZPWX 2HBYB 3HDSA 1OO0B 3KLGB 3DMJA 1S6QB 1RT4B 3FCVA 4FYXB 4NCAA 4K4UA 3J80Y 4A48A 2CZ4A 2ZH3A 4JV5J 2NS1B 2AT1B 2BE2A 2K1RA 2B7BB 2V94A 3C15A 1R0AB 4FYVB 5EX3A 3ZTQA 3EX7B 3DGVA 3MWBA 4DUTA 3H5XA 4M95A 1WEXA 4X66F 3C14B 2XMTA 3SCJE 4LFCF 4GVBB 5C25B 1PBAA 4DR6J 1FRMA 3LW5C 3CUNA 3BR8A 1HBNA 1NSQA 3PIPQ 4DR4J 2ALYB 3IRXA 2VQEF 1TUGB 4DG1B 2E5HA 2Z57B 5DZ6A 3C46A 2ZC3A 3VHQA 1VISA 5E0OA 2GFFA 2GHWA 5H9EK 1JQGA 1FNXH 3Q8SB 2DNZA 3VAGA 3PX6A 3V4IA 1CULB 4YN3B 4L76A 3F0NA 1UFLA 1RAEB 4H4OB 3T6BA 3EE3A 1U8WA 3R6GB 4L3NA 4DFMA 1HI1A 3BKFA 3I4HX 4PWDB 1X9MA 4QU6A 2HW3A 4KV8A 4RW4A 4PUOB 4YR2A 4F8RA 2XG8A 3IG1B 4M5MA 1KFDA 1ZOTA 2WB1D 3P3DA 2YX7A 4USTA 5LJ5Y 2FJBB 3PYGA 4NA2A 3NWRA 3CD6S 2EFGA 1B3TA 2RIJA 2R7WA 3C6TB 4BC9A 5HK4A 4ZPWR 3W9JA 3GB0A 4ZCMA 5G0RA 2GW8A 4GKJF 3W2VA 3MMBA 3KG4A 4LRFA 5JVHQ 1F3VA 1R89A 3PXGa 5HANA 2LU2A 2CQBA 1WC4A 2HIQA 3CJ4A 4ED2A 3UCGA 5KG7A 2UVVA 2BJEA 4KHPJ 2ROEA 3MCOA 1RT3B 4ZDNA 5T7LA 3HF5A 5KT6A 1VRUB 3GJTB 1ULRA 3M6VA 3C15B 4CO2A 5KAKA 4Z7YA 1SXLA 1GMWA 3GG0A 2QE5A 3I9ZA 2DPJA 1N32F 2WAQD 2EBGA 1EQ0A 1YG0A 1JLGB 2P9EA 1SC1B 2HFUA 4HLBA 2QA4S 4GVBA 3CC4S 1OWXA 4ZHRA 4JV1A 4TNOA 2CG8A 2QMUB 4KPCA 5CABA 1PCAA 1JLFB 2WTFA 4ED4A 2GQ2A 3D5MA 4AD6A 3JAMU 2JFKA 4ZPDA 2Y0BB 2HHXA 1R7IA 1TL7A 4P74A 4CLZA 2G0IA 3HT0A 1A0OB 1HQUA 1HNWJ 4ID5B 1TV6A 1ICEB 4LFBJ 5HMXA 2QX0A 4Y00A 2O67A 2Y8YA 3M32B 1OY9A 4RUBA 2IMOA 3W3SA 2VFRA 2YKNA 4K2JA 1VQLS 4F0HA 1IM6A 2YKQA 3HKWA 4WFBQ 1PGZA 4KPYA 3HI9A 4USHA 4UT4A 4NE9C 8ATCB 1HI0P 3DCAA 1SUQA 1N5YB 2HSEB 1H7WA 1K73T 4OJHA 2MPUA 4C8LA 2HQIA 2CQ1A 2FPHX 1YDLA 4NI2B 4CYUB 1QSYA 2LKZA 4AXJA 2QSWA 5KG3A 1NKCA 4G1IA 4F2RA 4DPXA 1ZPVA 3M8WA 1RAHB 4NLVA 2F40A 2R8JA 1HNWF 3QJLA 2NPFA 3M8PB 2I5JA 1R0AA 1N5SA 2LLZA 2QLJB 2L9WA 1UVKA 2YWGA 1OYDA 1TKTA 1CQMA 2RU9A 2RUSA 3BH6B 4QIVA 3MCNA 1NNDA 4TY8B 4ZVRB 5A8WB 3NCRA 4DR5J 2B4VA 3RW7A 4OX9J 1V5IB 1XR5A 5T7LB 3SSRA 1O51A 2MLYA 2MKIA 4ECYA 1KD1T 3PO4A 4K50A 3MM7A 3ZZTA 1N56A 2ASJA 1OQ3A 4DSJA 1Q86T 1HD0A 2V8VA 4CZCA 1UWBA 1WSRA 2LCWA 3EGNA 4OZNA 2RF2B 1YJVA 3V2UC 1FCAA 2W2NP 4P7TA 1URNA 3M6UA 4C97A 4CLWA 4UF4A 2WOMA 1RLCL 5K9FA 2GHVC 1TVRA 3DI6A 2MKYA 4ATNA 2O5DA 1Z4UA 3PYDA 5HVFA 3S6EA 3KLIB 3SV4A 3EZUA 4NXNF 2RH3A 4DL7A 4PWDA 3WX8A 4FF3A 4J9NA 1M5VC 2IAJB 3TOQA 3EXYA 4URQU 5ETQA 4QQBA 4DV5F 1S1UB 2E1RA 2QSFA 3EGVA 2HFOA 4RR5A 1WKKA 1DRZA 3AFGA 2ZZNA 2C1EB 3O44A 3CCQS 1GQEA 3UN5A 1JLQB 4LF6J 3DM2B 1CJUB 1WEYA 3M6XA 3OTCA 7FDRA 4RX6A 1N36J 5EDWA 3M2VB 1T3NA 3GFYA 1LWEB 3AD7C 4LSNA 5KG6A 1S1WB 4CLFA 4QBUA 4NYPA 2J7UA 4J9LA 1D9FA 4B3SJ 5C25A 2VPWB 4QWDA 2UUBF 3FNNA 2HHPA 4LBPA 2VFUA 4NXMJ 1VC0A 5ETSA 2OMLA 3UO0A 1NB7A 2AX1A 3WC0A 2FC8A 2LEAA 2OELA 1KLMA 2H54B 3OR2A 1C0TB 4IDKA 1WI6A 2VC0A 3BB5A 3EMTA 3K8WA 2CJBA 2KRRA 3CJ0A 3M8PA 3MAQA 2ZH7A 5B0BA 3Q0AA 1UJ4A 1WG4A 2BR0A 1LWXA 2KVQE 4AE5A 2HNZB 5KFVA 5A8RB 3DOLB 4R0JA 1QM9A 4DJBA 2FJVA 1LEOA 3A1YG 5KFPA 2AKWB 1T0TV 1VJQA 1K47A 2OH2A 4X4QA 5J2NA 1NO8A 3NGSA 2M8DB 2BMBA 3MMJA 4OHVA 4ZN1A 1X5OA 4HEA9 4QW8A 4A8MP 1TKXA 4ED5A 3FFIA 2RQMA 2F1FA 1RISA 1Y4ZB 2YWKA 4ZLJA 4ALZA 3G6YA 1MNEA 4ZLNA 2HURA 4DQSA 1R8CA 2DY1A 2G0JA 3BKTA 3D54A 3RR8A 3A3NB 1N5TA 3K7RA 5L38A 1F3FA 4A8YA 4ZPAA 1FRJA 3Q8QB 1WC6A 2OEJA 3KG0A 2MZRA 3N28A 3PJ9A 4FBTA 5D8HB 4LBHA 2DNMA 1T03A 2HG4A 5E5NA 3IM9A 5C2GA 2ZZMA 1U02A 4MFBB 1YQHA 3LP2B 1TUWA 2PSZA 3FBFA 3OR1B 4ZOSA 3UDCA 2VPXB 1DLOA 4YMEA 4O4RA 3CF5Q 1YITS 5LMUF 1YVFA 2ZBRA 4I7FB 4X4OA 2W8LA 3OTOF 5BR8F 3FBEA 1HWKA 2LXFA 1VMBA 3PJXA 2WB4A 4E98A 2LECA 1JJ2R 2HEKA 3KNGA 1RA6A 3ZZOA 2EC0A 2FHJA 2HBQB 4NLGA 4HH0A 1WTBA 3GIIA 4DFKA 4PXDA 2D1CA 2XCAA 4RZRA 4NYOA 4DOZA 3M9MB 1CS4A 1EKRA 3TAMA 4USVA 3FZ2A 4FZVA 2UVUA 4ED6A 1XNQJ 4YDXA 1HD1A 2I2YA 5J2MA 4NOHA 4Q0BB 3S8SA 4PG4A 2GIFA 1MWZA 1N34F 5K8OA 2OI2A 2DGQA 4HI2A 5DLFA 2BW2A 2BJ9A 2KKHA 3I6PA 4KRWA 1RWWB 3Q2TC 2KFYA 3TQ1A 2QYGA 5CCLA 4ES2A 1RB0A 5LM7E 1NK8A 3PYFA 2XLIA 4OZ1A 3HFVA 3MAAA 4RO0A 2XNRA 1S48A 3GJRB 5KFIA 3M7VA 3NKYA 2NUUG 2VQEJ 3HHNB 2ZNZA 3UQSA 2D3OR 4JI4J 2HQDA 3MUVP 3BPDA 3NCPA 4W4MA 2ILZA 1QAIA 4DQRA 5C24A 4W90B 2WSCC 3WIUA 2CJYB 3JSRA 5J2QB 1RWMB 1YI2S 1FNMA 1LW2B 1RTDA 1CJVB 4KO0A 1NZ8A 4OYIA 3SCIE 3V81B 3OHBA 2ASLA 3OL9A 2Z8QA 4N56A 1F2HA 1SVDA 2ZDOA 3JQKA 2RRBA 5IQ6A 3DXSX 1VQSA 3I4PA 5EUHA 2HHTA 2GQCA 3V4MA 2PMHA 4KHRA 4P2FA 6FD1A 2EG1A 4B3SF 2GMHA 5CQGA 1NPKA 3BBBA 3VAHA 1M0SA 3DMJB 4M8LA 3EVOA 4ZCLA 2L3MA 4UW2A 2BE9B 3ZZ0A 4EBDA 4UOFA 1A6LA 3AA8A 2CJQA 2H3EB 4YHHF 2ATLA 3R7NB 4F3MA 2F4FA 2L41A 1HNIB 2MQLA 3NRBA 4OJGA 2CIMA 2WVFA 5DO2A 1YJNS 4QU7A 4G1QB 3DDKA 3DM2A 1CJUA 2NPIA 4YFUA 3T1YF 4H4MA 4WKYA 1QVGR 2K7KA 3BGFA 2AGOA 4C0HA 2B8PA 2R7QA 1LWEA 1B4SA 3HHLC 2HFNA 3H98A 3AXMA 4RWXA 4WFXA 2MDAA 2XI3A 2HHWA 1SJRA 4X4VA 2CPHA 2W8KA 1YJRA 2YBVA 4ER8A 1YHQS 4DFPA 3C6UB 3FCHA 4Z7CA 1IVZA 4MYUA 4RJVA 3KLFB 3T19A 1JNZB 2OP5A 1UVJA 2LFVA 2OD4A 1C0UB 3OR2B 3QATA 1TKZB 5K8NA 3MM5A 3PFEA 3L4BC 4B9MA 2EG2A 1QTNB 4FXVA 4EO8A 4OZLA 4C8ZA 3K5LA 3J7ZT 2KU7A 2LXIA 3ISZA 3O2IA 4MT1A 5F0WA 4O3SA 2WCXA 3CMQA 5F8GA 1LW2A 1RTDB 2CQGA 4YB6A 5H9FK 2MZSA 1SL2A 2ZD1A 1IBMJ 4MIBA 1SJ3P 4WWSA 3W64A 3VTIA 4DR4F 3CCMS 1FE4A 1S1VB 1KQKA 1NKBA 5HP1B 4F7VA 1VQ4S 2FHKA 1S49A 2VG6A 2F4VF 3CVKA 5B0AA 3KDOA 2NSBA 3N5BA 4X64F 3RB6A 3CCZA 5A0YA 3RRKA 4X4UA 4CM2A 4MH8A 3FJ2A 4A8KA 2F8EX 4P75A 4DHVA 5L9NA 1U47A 1S10A 4ECXA 1ZYQA 1L3TA 2NXUA 1Q79A 4ZK7M 2V63A 3KK2B 1RWKB 5K14B 2FHJD 3D1QA 5K20B 4K2XA 1T03B 2G1HA 4P73A 2W9AA 4OI1A 1CBKA 4DX6A 1ZZFA 1VLYA 5E7OB 3Q24A 1BUXA 3DOKA 3CJ3A 5KOXA 1VHIA 4PG5A 1FKAF 1VRTB 2XMMA 3VGTA 2PFDA 3P96A 1ROFA 3FMBA 3QWPA 1FRHA 3DRRA 1Q8LA 5HJXA 3SSSA 3R1HA 2MQQA 2KHCA 2C22A 1URRA 2V4JA 4B9NA 3X3UA 2YH1A 2AGQA 1AYEA 3LWLA 1S5ZA 2W2OP 3OVSA 1HQUB 3G82B 4IO9Q 5JXSA 3DLKB 3CCLS 5EGYA 2DR9A 1CJVA 3MEKA 4K7QA 4EGLA 4HDGA 3FKBA 4LUBA 2MGZB 1EETA 2X7IA 3KWMA 1RCXB 1XERA 1NH7A 5M2UA 4ID8A 3SIPB 4B3RJ 3M1VB 1WTFA 4DV3F 3JSMB 4IOBA 2FD2A 2IM1A 2PE8A 4NEYA 2HGMA 1NAQA 2Q1LA 2H5IB 2V8GA 1T11A 2K2PA 3DOMB 1ZTTA 3GFHA 4DI6A 2DVIA 2JEGA 2XQCA 1RT4A 1X4AA 2QFJA 3RRGA 2HK3A 1R43A 4X65F 5U47A 1X4DA 4RNFA 3PIOQ 2CDQA 2ACMA 3FVYA 2AX0A 3I31A 5FIIA 3DU5A 3V6KA 3EZOA 4M5IA 3OTOJ 1RWNB 2IFXA 4LVOP 1BXNA 4Y2KA 4I6YA 4PKDB 4RLEA 3W2VB 2DRBA 1D8YA 3MOJB 2DHGA 2GQQA 1N52B 4GO7X 5LMNF 3M30A 2ZM6F 3UFCX 1S57A 1PILA 3DU6A 1XR7A 2QA1A 1YK9A 4RPFA 2VQFF 4LF9J 1VYAA 3UE2A 3GFXA 2IDLA 4KBIA 1RT7A 1TK0A 4L75A 1LK5A 3BH7B 4YP3A 3WQPA 2H9ZA 1FHTA 3BV8A 3TARA 1SC6A 1YX2A 2OPRB 1HHTP 2DNPA 3D6TB 4JI2F 2MZQA 2VU5A 3VGVA 4J91A 1JX4A 5E3AA 1YRTA 1S9EA 2HFZA 3Q83A 4HHHA 3W7BA 4CTAA 3MR2A 1Q8BA 2X1BA 3BYPA 2E9RX 2BVZA 2E44A 1JLCA 1KR4A 3UVJB 3QZ8A 2ZH1A 4P71A 2ZVSA 3I56S 4KR0B 2YQ1A 2HS4A 2FVRA 1VBZA 4IR9A 4UY8T 2BX6A 4CLUA 2GVDB 2FZGB 2EFOA 1GMVA 3PEJA 3VCDA 1N0UA 3AXKA 3W2WA 4Y2CA 2QMWA 1IQZA 2ZBQA 3FBCA 3GYXB 4Z37A 2R2SA 3S01A 3PZPA 2JNJA 3SXLA 2B3TB 4RU2A 2BJ1A 5CH7B 1FA0A 2ADBA 2AJQA 1QJHA 1VBXA 3BS9A 2Y3YA 1RBOB 2RQ4A 4WP3A 2VDHA 1S1XB 3GV7B 1BWVA 2QG9B 4Y2AA 2HBZB 2HLUA 4M1KA 1RWXB 2GJIA 3T5KA 2C2EA 2B43A 1RLDA 1Y00A 2K7JA 3OJSA 4OV6A 3CDAA 4PRFA 4USKA 3QSYB 1XIQA 4ZPVR 3ET6A 5J1EA 4HTJA 3L7PA 2JEIA 5DG8A 1WSVA 3EXCX 3SCLE 1Q53A 4WU2A 5ETMA 2JZ5A 3EGWB 2BW7A 4DSIA 5KFXA 3CGIA 3IBCB 4LQ3A 1P27B 1RP5A 2CPFA 5EN1A 4HKQA 3G87A 4Y2MA 4CLKA 1JLAB 2XO6A 5MLCV 5HVHA 4BS2A 1WKJA 2E7WA 1R0BG 1U0HB 2XGQA 4F4YA 2DHAA 4RBUA 1ZS6A 3KK1B 1K44A 4X4NA 3NP5A 5J2MB 4PXEA 4OZ0A 4KGKA 1H2VZ 3BN7A 1WC5A 3E51A 1EAYC 1QAYA 2BJDA 4ZJLA 2W9BA 3BGLA 4F50A 1HBUB 4KSEB 1RYRA 4DQIA 3MEGA 2PI5A 1FWKA 3BKUA 1SKUB 3HSJA 2UXCJ 2NQPA 5B0DA 4J9QA 1UVIA 3QO9B 2CPIA 2F63A 3CW2C 4HI1A 2MSSA 2CJ9A 3K2YA 4QJVA 3UNGC 3VR1A 2X1AA 5IT9U 2ZVIA 2H5EA 2QLWA 1VQ8S 1Q16B 3TW0A 4I2PB 4KH0B 1O0PA 3D0HE 4OI3A 5L46A 3R97A 2R7SA 3CC7S 1RHMB 1NDKA 4M5KA 1KONA 3N0VA 3NGRA 4WTOB 5HQ8A 4X84A 1IKVB 2DCUB 3LALA 4P6QA 1YJWS 1PIEA 2J0XA 4FDFA 1NPPA 1UPPA 2QLFB 3WX4A 4Y6IA 1TL3B 3NMAA 1X4BA 2DXEA 3V5RA 2RHSB 5DG9A 4DR2F 1HW8A 1IR1A 1WHVA 1ZAWA 3IBFB 3M8YA 2ZZTA 1DHMA 3POTB 1IM4A 4LVNP 5KFKA 1Q5VA 3LA0A 3M05A 4UOGA 2YVSA 3MECA 4ZS6A 5D78A 3TVZA 2AJ2A 3BDPA 2XY7A 1U2CA 2XZTB 3KUEA 3MTJA 3PW2A 4X4PA 2QT7A 3JB9k 1VQ7S 1GH8A 4OHWA 5D4NA 1SBRA 2CG4A 1KQFB 7AT1B 2IC3B 4O3RA 2ROPA 1AUSL 2ZWPA 1AZSA 4Q45A 2AJ4A 5DDQC 1FDBA 1S12A 2CA9A 1V6HA 3ZZYA 3K57A 4GKJJ 4DPWA 1SB6A 4DXLA 1WOPA 5A76A 1S1WA 4TXSA 5KFNA 1AUDA 3THVA 3DHWC 4A8QA 2OPQB 3KMQA 1AXQA 1SUQB 1N5YA 2J8SA 2E5LF 2DGSA 3KLFA 2OD6A 3FUYA 1X8DA 3BR9A 1YJTA 3HZGA 2VZ9A 5HQLA 1S1TA 3J7Z5 1LV5A 3P4UB 2ZH9A 2UUAF 3I9V9 4ZVPB 1C1BA 1LQ9A 3DLEA 4DDFA 1X9SA 3QWUA 4DUZF 4U8YA 2V2ZA 2EI5A 2FDNA 2PA3A 4EU0A 3CD5A 2UV8A 2D3UA 3P45B 3C3LA 3RGIA 3JS9A 4ZPCA 2C3OA 4MKAA 4PEOA 2QZ8A 2R8GA 2HRTA 5AXNA 4J9KA 1HFEL 2LQ8A 3KHGA 2D3ZA 3EUNA 2WK4A 3MHYA 4O4GB 2F9DA 4F0KA 3UCZP 1HKAA 4JI7J 5J1PA 1RHQB 2K3KA 5EWEA 3Q8PB 2XHWA 1KFSA 3AD8C 4IH7A 3QRRA 1RU2A 2ZEJA 3R1LA 4ES3A 1RABB 4YB7A 1NJIT 3PCOB 2W4PA 6AT1B 2BV3A 1B0PA 1S4EA 3FSYA 3THTA 4RNHA 1F60B 2UZAA 5AXKA 1RTJB 2VBYA 2ZE2B 2GVZA 1ZBTA 2Q3PA 1MSWD 1TK5A 2BE7D 5K8MA 3HVAA 3I0SB 1FVQA 1E6VB 2P8IA 3I5CA 2GO8A 5F9NA 2UP1A 3BQ1A 2KT5A 1HBOB 4FP9A 4N8OA 4NI2A 1L5UA 2WBMA 4OX8A 5ETTA 1RQ0A 1PG5B 5KG1A 4IOCQ 3FBBA 1Y3KA 3MAAB 2ZJPQ 1U1PA 1Q81T 4O3QA 1R6VA 1QVFR 4WKRA 4FF2A 1U8SA 1Y3JA 2VDIA 2HS0A 2PN6A 3OXLA 2VA2A 3FDSA 4L3KA 5K5MA 3UR3C 1YZ7A 5GMEA 2NR0A 5ETPA 1MMDA 1T8EA 4RW7A 3MM6A 4LF9F 3CULA 1KP6A 2PMZD 4WFZA 5KT3A 1TK8A 2YNGB 2QO3A 1E6YB 1GMUA 1HW9A 1NEEA 2HS3A 5KFHA 3L3CA 1VQPS 2KVIA 1F5BA 4DFJA 1A7GE 3LAMA 1ZETA 4DL4A 2LQJA 3M1VA 3D67A 2PFFB 4FS1A 1RGVA 3T9NA 4Y2IA 3K5NA 3H42A 3ZNJ1 3PR4A 4CT8A 4IRKA 2XNQA 2XS2A 4GKKF 3UNYA 3GONA 4F4KA 2HMIB 3GIRA 2BQ3A 3DDNA 4P52A 3CJ2A 2CXEA 1DFDA 4QPTA 2KO1A 5GAEU 1U7LA 1V5VA 2XMVA 2HFSA 1N32J 4I2QA 1D9AA 3MM9A 4M5DB 3M2VA 2V4JB 1RTJA 3M4XA 3CCJS 2JLGA 2E29A 2YWEA 3AOAA 3PO5A 2APOA 3GJQB 3KNAA 4MJKA 3KYLA 1SV5B 3RAMA 3NNCA 2BACA 5A6WA 4XO0A 4LSLA 4WBFA 3NAHA 4MKBA 1N0VC 2DNNA 3U7JA 5KFGA 4F02A 4LQ9A 5CHCB 3K89A 2R4FA 2JVOA 4YB1P 2RILA 4DSLA 2CQIA 1JLBA 2ZH2A 2IM0A 2OTJS 2E7VA 3NBPA 2RE1A 3H20A 3MR5A 1RXOB 5HI7A 2EFNA 1FJEB 3SQGB 5KTQA 1BHNA 3DKDA 2XS5A 3SMZA 2OSRA 2YKOA 4XTTA 2XGPA 3JYTA 3W9HA 1LKZA 3IRWP 2QMXA 3G86A 4UY85 4ZVGA 2OMOA 2DGTA 5CYQB 3ILJA 4QIEA 3G6ES 1U45A 2P6TA 3I96A 2UUCF 3QRQA 4KJIA 2F8MA 2UU9F 1XNRJ 4QWCA 1X7VA 1M90T 4IH6A 3OL8A 1D3WA 4NLXA 1FE0A 4NLWA 2QV6A 1AZSB 1RAIB 2UV8G 2H5JB 4KHPF 2D9PA 4K59A 1DTQB 1U26A 1AT1B 5T41A 2C42A 3TEGA 3VZIA 3AAWB 4TU8A 2O3DA 1UPMB 1RTHB 3UN2A 3UCUP 3BM7A 1EZZB 3HLUA 4ETXA 4K0KF 4R8UB 4L6V3 3OBIA 4TU9A 5ETLA 3NS7B 4B3RF 2Z2ZA 2ALZA 2E1CA 1H3DA 3A3OB 1F1BB 1FWPA 2I9SA 5ETVA 4N47A 4EWTA 5KT7A 1R6YA 4J9VA 4L72B 4RUAA 4RNOA 4ECRA 2EKYA 1HYSB 3IBWA 3U1MA 3JQJA 3PW5A 1N48A 1NK0A 4EEYA 4JV5F 2DT9A 1Q4RA 3CO0P 3JTOA 2ZOMA 3QIPB 3EM1A 5KFEA 5KFMA 1RU1A 1NRKA 2B9EA 4C8OA 1T9YA 4ELVA 4Q8EA 2J7WA 5AE3A 3VQTA 4IG3A 5E2QA 3DLBA 2DR8A 3A12A 4AL7A 4E2FB 2XMUA 3TO8A 4JP8A 4DV5J 3RR7A 2DKOB 1JLBB 1Z2LA 3MM8B 2DPIA 3I0RA 3AQPA 1T9XA 1NDPA 1PSDA 1RBLA 2OFHX 5FD1A 3HO1A 1C4AA 1HQ2A 3OFEA 3H2UB 1X5SA 4AFFA 4Q0BA 1ZTWA 1UFWA 3Q8UA 4RKUC 3BGRB 2KXHA 1UWAA 1H6KX 3QSIA 1SH3A 2X51A 3BF4A 4DV7J 2FY1A 3HFZB 1GK8A 1FI4A 3OFFA 5C2CA 2CZVC 2AF6A 5HROB 4GVLA 5E3RA 2LYVA 4Q2MA 1SPBP 1M5HA 2EBEA 1LFWA 3N9UC 4YEAA 1J2VA 3H25A 1ZH5A 1SH2A 2BQRA 5DGBA 2CPXA 5L8RC 3KLHA 1TKDA 1UW9A 3CEDA 3BPSP 3CNQP 3MMBB 4HDHA 2F9JA 3ZZRA 4F3QA 3BO4A 4K4XA 1RHKB 1VRTA 2HFVA 2V50A 1SKRA 2FIUA 2XHCA 1KC8T 5C24B 1OYEA 2BZ2A 2R42A 1IKYB 2XSJB 3SDEB 2XS7A 2CRLA 2Z58B 3C6UA 1VQNS 1U0HA 3AB4B 4ZVTB 5F0UA 3IAS9 4C11A 1YJ9S 1C0UA 1NDCA 3WIVA 3D6HB 1DTTB 4ZKAA 1RHUB 4DBQA 1NK6A 1H2UX 4DV4J 2KFZA 5D77A 1BQMA 1TAUA 1BQXA 4H4OA 2DTJA 3FMWA 3PNIA 4KKOA 2NYHA 5LMNJ 3OL6A 1BLUA 3NL0A 3JSMA 2JEFA 4WP8A 4Q2LA 3GIKA 3BYRA 2P9GA 3RZAA 3JAMY 3J81Y 4LRDA 4ITSA 1TL7B 2RAQA 5I3PA 2GO9A 2HHHJ 3T5LA 3MM7B 1U4BA 1NK5A 1YRXA 2YX4A 3CT9A 1S0VA 3UD4P 5DETA 1NK4A 2KRBA 3K17A 2MJUA 2A3JA 2RS8A 4FVMA 4DSEA 1T7PA 4NA1A 4M5DA 1TL1A 4A8WA 2AYGA 1HWLA 3GZ7A 4LFAF 1NJXA 1YLXA 3EDQB 4ZP9A 3TZXA 3J81j 4KFBB 1WWHA 3HHLB 1BY9A 1D1UA 3BDEA 1WUUA 2C2ZB 4TLRA 4RUCA 1NBEB 3KHHA 3TAPA 5CAAA 3W66A 3UN3A 9RUBA 2R3VA 5FJ4A 1Q8IA 5BYQA 3K5MA 2C3PA 4CYUA 4FF4A 2R8IA 2DIUA 2WHOA 3DGPB 4U8VA 1FDDA 3NY0A 2M4MA 3DLEB 3H0PA 2FJWA 3KJFB 3SSQA 2RUGA 2LQ9A 1PJ6A 2AYEA 1SI9A 1Q95G 3SQGA 2LA4A 3KK3B 1R8PA 3GIJA 3IFEA 4FF1A 1X5TA 2C2RA 1IR0A 2HNYB 1RI7A 4AXIA 2AEMA 4C48A 5HO4A 2I6WA 3CC2S 1SQEA 3GFZA 4E0DA 2A6MA 3ILLA 1XR6A 1I6JA 4I64A 2IBOA 1HMVB 4RBTA 3RBXA 1GMWD 3TX0A 3LH2S 4DV0J 1MWQA 3W2WB 1L3SA 4ZCKA 1T9TA 3RRHA 3SI8A 4FS2A 2HNZA 5LXRA 3QT6A 2YTCA 5HBMB 2RRAA 1NJYA 4JI2J 2FTRA 4XDCA 3OT9A 2MZTA 4NZ6A 1ZA1B 2XYHB 5B08A 3SFUA 2N7YA 5I4MA 2VFTA 3MEGB 2G2ZA 3R3TA 2AMCB 5HROA 3AODA 3BSCA 3KFWX 3TZZA 5F8IA 4DV3J 2BA9A 4ZP8A 3MFHA 4DR6F 2WVEA 1WG5A 1P1LA 3N5FA 3W9IA 4A8FA 5D15A 3TR5A 1J5OA 3ZFVA 2IVMA 3IWLA 3UDVA 2R2UA 1F2GA 4B3OB 2Y1IA 5ETOA 2HZCA 2VQFJ 2MMYA 3HULA 1X0FA 1J5EF 1HHQA 4JYAF 2ZUGA 4C3LA 2ASYA 4Y65A 5KFBA 4UUXA 1XN9A 1RKIA 2MKHA 4AT1B 2MKSA 3GYNA 3OLAA 4U7UK 2GAHC 2CDRB 2G13A 2R2RA 2XO7A 2EVZA 8AT1B 1TZ0A 5AT1B 1GX5A 2VPZB 2X1GA 4OYOA 2DGWA 4DZ6A 4XDDA 1FRIA 3PRBA 1HNZF 2I38A 3RUBL 1FXDA 1HBOA 3I32A 4F2SA 1WDTA 2WW8A 4UZBA 3TUPA 1WORA 4ANDA 1TMJA 4C3KA 3JXOA 3QGPA 4CLLA 1VK3A 3RBEA 3QGGA 1S77D 1IKXB 1HPZA 4DL2A 1DQ8A 4I6WA 2DH9A 4CLPA 4EK2A 1H72C 2DB1A 5HBMA 1ACMB 3FRZA 5A2QY 2AU0A 4G3IA 3LGHA 2KN4A 4KH1B 1TL1B 2DJWA 1KS2A 5A8WA 2CWKA 1SKSA 2G4BA 2R7XA 4ZIWA 4BLGA 3T9ZA 3ZZZA 2WZ1A 2OEMA 4DR7F 2OPSB 1F0XA 2QEXS 1TL3A 1SQFA 2L9NA 1ELOA 2PIIA 2ZBCA 3VV2B 2HHQA 4HACA 3HD1A 5F8JA 1CPZA 1SCJB 3D6MB 3HCXA 5F9LA 2ZC4A 4ANEA 3OUYB 1S1TB 2CFXA 3H59A 2DGVA 3HHLD 5LT5A 1KEKA 2ZWOA 3A8KA 4PUOA 4NYZA 3TP2A 4D3HA 5B7WA 2HGLA 3J7YU 1KNZA 4TY9A 1VQYA 5CYQA 4LF2A 1SJFA 1IR2A 1MN9A 1MN7A 3GPAA 2B0GA 4BWMA 2XLJA 3S7RA 4RWWA 5KFTA 3M2RA 1G4CA 1VS3A 2E5IA 4UOHA 4U96A 3EPGA 1CS4B 2DIVA 1IBCB 4IFYB 1IWAA 1UCNA 3OXGA 3VVUA 4K0KJ 3HVWA 3JTPA 1RACB 1T05B 3Q8YA 4Q43A 4IFVB 4LRBA 4DSFA 3MD1A 2V5HG 2EPIA 2DEJA 4LSLB 2F5GA 1Y0HA 4LRCA 4NXNJ 3Q89A 3I5AA 2C2KB 2K3IA 1SL0A 3NXZA 3TUIC 2GGPA 1B0VA 1NU4A 1TTHB 2DK2A 1E6VA 1OPIA 4QZVB 1WDDA 1C1CB 1VHFA 2ATCB 2FJEB 1B7YB 4BCAA 1JLGA 3HKZD 2UUTA 4WP9A 4OZ2A 3UD5A 1N54B 1WOOA 2FZKB 3R2CJ 3DHXA 3N6LA 3TA2A 4IRDA 2Y1LB 2KJWA 3PV8A 4JV2A 3VVTA 3CCES 3VWSA 4A8XA 3V81A 2IYGA 3MM8A 4K8RA 4MK8A 5KFSA 1WELA 2XBPA 5BYSA 4N41A 4OYZA 4R25A 4YUDA 2ZBIA 3NLCA 3MR7A 1HMVA 1SC4B 2FVSA 2KYXA 4N77A 1AW0A 4ILMA 3OJUA 1MROA 4DCPB 2HZVA 2J8AA 3TJ8A 4LF7J 3J80U 3BBFA 2KJVA 1RAJA 2NSCA 1PYSB 2W2QP 2A10A 3IXQA 4GC6A 2AP6A 4C8MA 4BHQA 1OY8A 1FEHA 1OMSA 2U1AA 3O5TB 1RBAA 2NUHA 3OTDA 4FYDA 1K0VA 3ICLA 3PFOA 4JI0J 2XTJP 2YWWA 1XTZA 1HR0F 2YKMB 2UUBJ 2DNGA 3R5CA 3TVYA 5EWFA 1IN0A 1Q7LB 1RADB 3BGUA 4FPIA 3OSNA 2L08A 2B51A 2V2VA 2ADCA 3EICA 3ITHA 4HL9A 3KJNB 2VBWA 4NLOA 3DRPB 3OFHA 5IT0A 1W2IA 2FY8A 4DPTA 3LANA 4LF7F 1IQTA 1S6PA 2MXYA 1M1HA 2Y0SD 3US5A 4NRUA 1LK7A 4F26A 2YNGA 3RYLA 5IC6B 4B9VA 3GSIA 3R5GA 4O3NA 3IN5A 3TQEA 4ZA1A 3V6DB 2VG7A 3LF0A 1N88A 1KQSR 2IBKA 3OQ2A 4DL5A 1KLNA 3ULHA 4BC7A 4P72A 3KXDA 4K4TA 1RWVB 1I5OB 4LIRA 3IAM9 4TN2A 3EPIA 3HXMA 2E9TA 3GWCA 2YY3A 2GNKA 1RT1B 1X4HA 2JSXA 3NOGA 4UQTA 3QBCA 1CEZA 2NZCA 4DPUA 3VALA 5DQGA 1IBLJ 5KG0A 2VFSA 3ZTPA 1RYSA 4DUYJ 2ACYA 4JI3F 4LF6F 3GR1A 4X62J 3TZYA 3FC9A 2CJKA 3HK2A 1LW0B 1MROB 5L39A 4MAKA 1T9VA 4MK7A 2DXFA 1EETB 1KKHA 2HQCA 1UL3A 2M70A 1IWGA 2CNNB 3B82A 4QWAA 2NCKL 2KH9A 4P10A 1OPZA 1HL6A 3GLJA 4P7VA 1VQ5S 3H7HB 3M6WA 3JQMA 1RTHA 3ZZPA 3AOCA 4DN0A 2COLA 4M5GA 3MMCA 2VF3A 2OPSA 4JV0A 2W7PA 3IA0A 1TP7A 1X9WA 2GCFA 2GGPB 5AXLA 1OQ6A 3V6HA 1IBMF 2BE2B 1CJTB 2K1RB 2V69A 4GMKA 1YWXA 1XMQJ 1N8RT 4NCGA 3D0IE 5GADU 1K8AT 3FRYA 4DLGA 1IXKA 3T6JA 6FDRA 4DUZJ 4OL8A 1NK7A 1R8BA 3JYTB 1BMQB 2YH0A 5L1KA 1HNZJ 1HIYA 3BJYA 2UXDF 1T9WA 3G82A 4K5SA 2GV1A 4PPDA 4Y3CA 5JMNA 2VICA 1R27B 2E66A 3MZIA 3ZTRA 2A2DA 2IJNA 4ENOA 4X2BA 1QY7A 1T02A 1XMOF 5CD4A 2GJFA 4IFYA 1UEUA 4ZVOB 3SYZA 4USWA 1PAUB 2CQCA 2YWHA 2XYPB 5G0RB 5A8KA 5HSPA 4QIFA 1JXEA 1ZM4A 1F9HA 1BD6A 5MAOA 5KT5A 4ZCIA 1H38A 3RB4A 2IJRA 4YS2A 1N33J 2B4OA 4OQJA 2HIYA 3G6XA 1K0TA 1RHRB 3TUZC 3UDEA 1Q78A 1VC6A 3X1LB 2JOQA 2UXCF 3MEDB 3MTKA 3EGZA 4X4TA 3KG1A 2R7RA 1XMBA 3O6QA 2JLEA 2G0CA 3KJQB 3MAHA 3LPEA 3UVJA 4RW8A 5SUHA 3WDOA 4UQGA 2BANA 2EXUA 3CMAS 4UUWA 2EWHA 2MKCA 3QLHA 3G9CA 2A1BA 2R7TA 1REVA 4RW9B 1HYSA 2FJXA 5D6GA 2JRSA 2IPOB 2OFGX 3R5AA 4C9DA 1NHKL 4TLQA 1X4EA 2DNRA 2HAFA 4WFYA 4X65J 3WC2A 3C8YA 1N33F 2I5JB 3IRXB 3I87A 2C2DA 2KXNB 2WW4A 2F65A 4DMZA 1LWFA 1LOUA 1B64A 3EJMA 2BOPA 5E3QA 5ETKA 1KRPA 1KBRA 1SIZA 2Y1RI 2B6AA 3KJVA 2AJ1A 2HK2A 3GR0A 2ABYA 4ZPTR 4QPXA 5CYJA 2ZOGA 3NGDA 5AXMA 3K0JA 4PG6A 2GA7A 4KHMA 4NLPA 5GAHI 2VFVA 2LXUA 2Q43A 4NCBA 4K4ZA 1F5AA 1NHVA 3S1TA 5JUMA 5KFJA 3L7OA 1A9NB 1UP1A 1Y5LB 2Q6BA 5LL6d 4F4XA 1S7HA 4CIOA 4B3TF 2J9CA 3ILIA 1TV6B 2MSTA 3GCXP 1UETA 2FVQA 5A8KB 5KFDA 2ZHBA 4YR0A 2WONA 4ED3A 4YOEA 3PEHA 1CJKB 4CT9A 2UU9J 2YKNB 1LFPA 4MMOA 1B7FA 2MEWA 1EARA 4R8UA 2AEFA 2JWNA 3IR6B 1SJ4P 4CI0B 3OTBA 3DRPA 2BXJA 2HQGA 2QL5B 2XSJA 3SDEA 4YDDB 3G96A 3G71S 2F7VA 2JX2A 2FLNA 4QYZK 4ZIVA 1KSPA 1I94J 3HJVA 1REVB 4RW9A 1WKLA 4KB7A 1KOOA 1NK9A 3TX8A 3N4WA 5HMWA 5IT9Y 2YNFA 4PQUA 1RAOA 3HHKA 1CJTA 4KGVB 4ZN3A 3QIDA 4DV6F 4RU9A 5CD4H 3MMAA 2OPPA 3CJRA 5D0RA 1X31C 4TY8A 4NZ0A 2J6UA 2EK6A 3D7SB 2Q79A 3FGVA 2XCPA 1S1UA 1J5EJ 4P2SA 3HM9A 2AQ4A 4RL1A 2QTWA 5BXIA 3H5SA 1CC8A 5HAOA 3W5XA 1T05A 3FQKA 5LMUJ 1YJ7A 2L48A 1UEKA 2ZBPA 3N6MA 2EW9A 4OX9F 1KVKA 4HHUA 4PXCA 3TEHB 3OSPA 2DGOA 2FHOB 2DXDA 4CDIA 2HHSA 4P2MA 4IOAQ 2F3JA 2FLLA 3A8IA 3GIMA 1U48A 3ENQA 2BDPA 2QIFA 3KLHB 4JI0F 5GAGU 3MDFA 1KDNA 3HPOA 4WFNQ 3DGPA 5AE1A 1WF0A 4IDKB 1HWUA 1R8AA 2AZ3A 3OVAA 1NJZA 4ECSA 3CJ5A 4WK1A 1NPRA 4LR7A 2W7OA 5A8RA 2JEJA 1S0MA 4I56A 4OZ3A 1J5OB 2QL9B 3D1HA 2FB0A 1NSPA 2FQQB 2DNYA 5A6PA 3DXBA 2M5YA 1JLCB 3KUHA 4C8NA 2XMKA 2GMLA 4LRAA 5GAEI 3OL7A 3TA0A 3RW6A 2RQKA 3I0RB 3TWZA 3MFIA 1JLEA 3POTA 2H51B 3ZC4A 3FSIA 5JJBA 1RT5A 4OI4A 2J7KA 3NEKA 4C98A 4QWEA 2OSQA 4KIAA 4O0IA 1RAAB 5ITHA 1TL4A 1P1TA 3T5JA 2LVWA 4ELTA 4QWBA 2DHSA 4BDPA 2KM8B 3P49B 1D8ZA 2IAJA 2LP4A 1RSCA 2PT0A 3CDWA 3HSDA 3MEDA 3KK2A 4LF1A 3JSBA 2UVRA 1KN6A 5SZTA 2RQCA 2RKIA 3MGJA 5LOQA 4JBCA 2RJZA 3ETMA 1X4GA 4J9PA 1PC4A 4OHYA 4B3MJ 3PX4A 3NS6A 4OYWA 4CH7A 4HT7A 5D4LA 4W92B 4NLDA 2MTLA 3K5OA 1UA1A 1EP4A 3MEEA 2MZ1A 4EYIB 1FKOA 1G3OA 1U6ZA 2H48B 2IRXA 2M7SA 4DX7A 3UR0A 3G4SS 4DL3A 2CQ2A 1XC9A 1S76D 1IKYA 3OVBA 1M5PC 4ECWA 4JI5J 1TL5A 3VF0B 2KM8C 4C6AA 1VOMA 4CO3A 5D0GA 3R2DJ 2KZZA 2W1BA 2PEHA 2PMWA 3CCTA 5GVQA 3E8OA 1HLWA 1AROP 5K8PA 2F4VJ 3PW0A 2M52A 4ZP7A 4ED0A 3A3PB 4U9RA 3V6DA 1DJ0A 2CYYA 2O01C 2VH7A 3OR1A 3T1AA 1N6QA 2J76E 4OYBA 4DEZA 2RT3A 2MYFA 3M8QB 2QN6B 3RU0A 3G8TA 2AEJA 3RAXA 1EIYB 1VFJA 1WI8A 3W63A 2R8KA 2DO4A 2OHDA 3CJ8A 3TANA 1GAOA 2QL7B 5DDRC 2AHOB 2G2YA 1HNVB 3QQCD 3FEXB 1M5OC 2RU3A 4RW7B 3FEZA 3MM6B 1HWIA 4G65A 1MMLA 3HSGA 4I69A 1HNXF 1UVMA 5HLFA 2HHHF 3GQCA 3AD9C 4OHXA 1MW7A 3HVTB 2WVDA 3HHEA 4D3GA 4IUFA 2W2PP 4RNNA 2I1RA 2YXLA 3LGNA 3TI0A 4G1QA 4JI8F 5J2PA 3VAJA 4CLSA 3BO2A 2DNQA 3LUYA 4N76A 1O8BA 2Z2LA 2XULA 4C4WA 4CLTA 2XEXA 2ZH6A 2BABA 2IY5B 1SQGA 2JJ4D 2M2BA 2HVIA 1U1LA 4RW6B 2G2OA 1FK9A 5KFRA 1WG1A 4KGMA 2LMIA 4ED7A 3QAEA 1N5VA 1XBWA 1K1SA 2CQ0A 1VQ6S 2EFVA 4TQSA 4NCGB 4OYAA 4J9SA 2M3DA 4ECVA 5I42B 4I7FA 2BRLA 2MQOA 1VQKS 1XWLA 1Y5IB 3BSAA 1T3OA 3ENAA 2CPEA 1XMOJ 5DG7A 1VK8A 3AT1B 4NXMF 3Q23A 2CZ9A 3ONQA 1FKPB 3BBCA 3Q8VA 3U27A 2L9DA 2A6OA 4IR1A 4DG1A 3AQOA 3MPUB 4M5NA 1B99A 1UAWA 1UJ5A 2C3UA 4X62F 1OJ4A 2XMJA 2MLZA 2R7OA 4CQ1A 3D3BJ 2K8GA 1RAFB 2V6AA 3C66A 1CSJA 3KKFA 3P8BB 2DGXA 2FJAB 4NL5A 3NG8A 2B9XA 3QGIA 4V1Ak 4PQAA 4IFVA 1RDRA 5BYRA 3MPDA 5KFWA 3MD3A 4J9MA 3DFEA 2DBBA 3KLVA 2HVZA 3M9NB 3THPA 2CVEA 2ZDPA 1RTIA 4DQQA 4TQRA 4JI1F 4WZQA 1OSCA 1YTYA 2Q66A 1HNIA 2W4DA 1Q0NA 5K14A 4FYWB 3JSYA 2Y8WA 3HVTA 5KFUA 1DY3A 2W9CA 4B3MF 3UD3P 2FHMA 2PD1A 4XAKA 1JLQA 2IHR1 2ZHAA 3TJ9A 3LPYA 5HMZA 1VI7A 1XQIA 2KG1A 4DUYF 1HNXJ 2LDYA 4NLYA 1RAGB 4JUZA 4L74A 1N34J 3AOBA 2J0QD 4USIA 1KOHA 2M8HA 1N5QA 3LP1B 3CDBA 4WPAA 3NGTA 2JLFA 3NCQA 3ZTSA 1U25A 3OUYA 4MIWA 4O0NA 2WSEC 2D74B 2WBRA 3MM5B 3O8WA 5IM0B 3EVMA 4DR3F 1C0TA 4R5PA 3G8QA 3GILA 3AJDA 3RB3A 2W9BB 3IC1A 4DF8A 5DGAA 2NREA 1W2BR 3JTNA 3PVXA 1LWCB 3QLHB 5F8MA 1H98A 3D3CJ 4WE1B 1SJ1A 2GC8A 4NLUA 4WU3A 4KGZB 3KUGA 3KLGA 4H4MB 1JB0C 2C2OB 2RVJA 2YWFA 1F9EB 2ROGA 4CH1A 1RZMA 4FNIA 2DR5A 3D6FB 3M32A 4IH5A 3D68A 5KOWA 2E5LJ 1FKOB 1M5SA 4NRTA 4XPEA 2QC3A 2NZ4A 2PO4A 1VJWA 1DQ9A 1RTZA 1RTIB 2HVEA 1Q1KA 2CJAA 1S59A 3MCSA 1XK8A 3VQSA 3M8RA 4J9RA 3EYZA 2Y9HA 4XIUA 3KTQA 2FLOA 1VBYA 4M5HA 2IA6A 2CNOB 3HSZA 2PA8D 1U1NA 4DR7J 1UZHA 1S6PB 4IG0A 1ZM2A 2KTQA 2IM3A 2VODA 3M2UB 4ZVHA 4MYTA 1UEVA 4K4YA 4DX8H 2VL1A 2GIQA 2RNEA 3PG9A 4O3OA 4JI1J 3W60A 2LEPA 3AH6A 3KMSA 3L95X 3HJFA 2DO0A 2DRAA 1Y5NB 4X4RA 4F4AA 1AFIA 4QR1A 4O44A 5D4PA 5JVGQ 4K4SA 1TR0A 1YKWA 2ZITA 4DPOA 1JNRB 1XJWB 2Z2YB 3PKYA 4DL0C 4DV1J 3E01A 4ICLB 2GZOA 3IMQJ 3CTRA 3TZWA 3CIMA 4JOUA 5L1LA 2DY9A 2GAGC 1D09B 1N36F 4TKTA 2B5JB 3KLEA 3RAQA 5GMKa 3TNVA 3WZ0A 2R8HA 4ES1A 4HH1A 5J2PB 2MZJA 4N8NA 1X60A 2CKWA 1W7WA 2C2MB 3PM9A 3ISND 4WTYA 3T3FA 2JC0A 1FT8A 1QUPA 2HQ3A 5IWAJ 1H73A 4V19X 4PCQA 1GNKA 1FJGF 3V4IB 4GO5X 3OFGA 4OI6A 1M1GA 5EWGA 3QAUA 3SEOA 2XMAA 3BQ2A 2VG5B 4E8UA 5DS7A 1FDAA 3IR7B 2KYZA 4AQYF 1JMTA 3DRSB 2IYIA 2J9EA 2V9WA 2MKKA 4ZHRB 1U49A 1YIJS 1NSKL 1R8HA 3W61A 2HQFA 2PEBA 5LJ3Y 4LFBF 2AZ1A 1RWUA 5LXYA 3F44A 5KFYA 4X66J 2VASA 4ZLLA 3BSNA 5HN0A 1RT5B 2VKRA 1UWBB 1JLAA 2DGUA 4PABA 3VAKA 3N79A 4NWBA 4CO1A 2B6AB 3KJVB 3A4TA 4WJBA 1FJGJ 4HYKA 4LR8A 2AYBA 5IM0A 3AY0A 1T94A 2B4UA 1S9GA 2AJFE 2BJ3A 1IJEB 1U2FA 1P6TA 4LIWA 1VBKA 1FDNA 1IBLF 4CTAB 4O44B 1FTCA 3U02A 1WNEA 1IUJA 3IWNC 2BUNA 4J9UE 3C19A 2A18A 4ZVQB 4N5SA 3NS5A 3M8SA 1FNOA 2BKPA 2BANB 5B0EA 1F5CA 4ZMMA 4ZJQA 2FVCA 2XLKA 3FCWA 1EP4B 2BYCA 3ZZUA 1WJ9A 4LMZA 4JI8J 4OLOA 4P2XA 2UVWA 5F3TA 5L1JA 1ZZNA 1Z2ZA 3ZXWA 3OV7A 1W26A 2O1PA 2PGCA 2BKOA 4DCOB 2N7CA 5F3ZA 2HKEA 4C8KA 3WHIA 4Q8FA 4I67A 1JLFA 5KG4A 1UW4A 2O66A 3O3LA 2DNOA 2J9DA 2B9YA 5F41A 3VZHA 2R9LA 4WFAQ 1TFWA 3LWMA 4YY3F 1QSSA 4OV1A 4DZDA 1NSAA 2JH3A 2NXEA 3PTWA 4ID5A 2OEKA 3DLJA 1ZAXA 4NLSA 1P9QC 2VBXA 4ZVFA 3T1HF 4R5PB 2UUCJ 3DOLA 1M5KC 2E9ZA 1ZA2B 1QUVA 4QOTA 5LSLA 2BEFA 3FEYB 4PYDA 1CG2A 2EKNA 4F36A 4Y0FA 2VONA 2B9WA 4QYZJ 2BBEA 2ZKUA 2OPPB 3M8ZA 2CPZA 1S6UA 4OJ3A 4R0EA 5DM6Q 2H65B 3HFKA 3LO3A 4I6AA 4OMFG 3QJJA 1S97A 2IRYA 2DEIA 4PXBA 5AE2A 2WVBA 3KK1A 3HX9A 1FRKA 1R31A 1V3SA 3R5JB 4KQZA 1DURA 3MR6A 3L09A 3ISNC 3EDRB 2C2NA 4LF8F 2CJXB 4YHHJ 3NAIA 2GIRA 3IS9A 2HLTA 2V2KA 3R8YA 4EUVA 3PR5B 1F6TA 2XY6A 3U1LA 1KTVA 2E5JA 3GP9A 2ZH5A 3CJTA 3DLHA 4P9SA 1S1XA 4TYAA 1MLAA 2B8QA 3HP6A 4OLPA 1KVIA 2GMJA 1EHWA 4F67A 3D2WA 1UJ6A 4CO5A 1JWWA 2LA6A 2KT2A 2AW0A 3NBPB 4NMLA 2ZOFA 4C8YA 4AL5A 1CLFA 2ZJQQ 3BQ0A 3RBZA 3N01A 3SZ2A 3ET6B 5D4OA 1S0NA 5C5JA 4C0BA 1BQMB 3I5BA 1C1BB 5HATA 1HBMB 2RDIA 1HQEB 1DQAA 3FZBA 2W7AA 4DS4A 3TYTA 2W01A 3HHDA 5KFCA 4RNMA 4O23A 5D0HA 2HNDA 4ZVUB 5H9FJ 4B9LA 4I0WA 4JI7F 4OIXA 3OXFA 5J2NB 4I68A 4GC7A 2FLPA 4OJ1A 1S72S 3PY8A 4FPRA 5AJ3J 3E01B 4ICLA 4HACB 4KAIA 3W62A 5DQIA 1DZ5A 1TQLA 1DTQA 1JJHA 4FNHA 3T1YJ 3TAQA 3CMES 3NWGA 5BJRA 5BR8J 1G7CB 3MECB 2Y1JA 2MQPA 1ZAVA 1S6OA 1KHVA 4LSNB 5IQQA 4BBYA 4B9SA 5D3GA 4URGA 4KTQA 2B4PA 5A2QU 2VOPA 2HHUA 1WC3A 2UXBF 2E1AA 4QR0A 4JI6F 9ATCB 1G2EA 3GCWP 4QIWD 1K9MT 1RUSA 4EO6A 5IV3A 1YZ6A 3M2RB 1RT6B 4M63A 3CO9A 1KLMB 5EX0A 2PI4A 5IXUA 2IRUA 5KFOA 1QSLA 1GTEA 2YKPA 4IYQA 1PJ5A 2N4DA 4TU7A 3H4BA 4DV2J 3IM8A 4KE5A 1EKSA 4IRCA 1VQOS 1G6BA 3KK3A 2CADA 2CQ4A 3GV5B 2BRKA 3DRSA 2OPQA 5D0EA 2AGPA 1MWYA 2AJ0A 4B9UA 1EB0A 1X0PA 4B3OA 2DRDA 4DLEA 2DR7A 2HNYA 4OHZA 3EZ5A 4JI6J 4O3PA 3QZ7A 5CXTA 2KFNA 4W98A 3BSOA 4KGXB 1C1CA 1IKWA 1PYTA 3A8JA 3N6NA 5LSOA 1D0EA 4DSKA 5DDOC 4HR2A 5DJBA 1XEZA 1VR6A 3MMAB 3DLGA 1R3NA 4DU8A 5KFQA 4JI5F 1N6QB 1S9GB 2MJNA 1GXLA 2OPRA 1X4CA 1RJJA 2MQNA 5FLXY 3W8PA 5M2PA 1MMNA 1JXLA 1G1XA 1S9EB 2ZKTA 3KHRA 2IC3A 1Y7PA 3OPKA 4OI2A 2V0NA 3CD0A 3CE8A 2DISA 2HWIA 4UOCA 4MFBA 5J1NA 3QT5A 4AYBD 1DBDA 2WONB 2Z56B 1DLOB 1PKUA 1IKXA 2AV5A 4FYYB 2VA3A 1NKEA 4F0MA 4PZVA 1FX2A 1BGXT 1REGX 3IO1A 3PYEA 1YSJA 3LP1A 2DYAA 4ZPBA 1L3UA 1SC3B 2XZDB 3DRYA 3AJ1A 4FVCA 1FJCA 2GHPA 3KOAA 3B8HA 2WRMA 2QA4G 3D9BA 2YNHA 1SV5A 2HYIB 1YJUA 2BJ8A 1RHJB 4YQWA 3MPYA 1U1MA 4LF5F 4PR6A 2J0WA 3M2UA 3CCWA 5DZ7A 1O6XA 3QT7A 2JFDA 4ECUA 3NGUA 3PHEA 4M5JA 1E6YA 2BQUA 2ZM6J 4WZMA 3MUTP 2HAIA 2OAUA 3PDNA 2ZHOA 4QCLA 4PPZA 4Y34A 2XYGB 3H2LA 4H4KC 1LWCA 4WK3A 3BN4A 4AUKA 4CO0A 5CYMB 3TRGA 1RT2B 1GXUA 3DYAB 2ZNYA 4H4KA 1K1QA 1WHYA 3D0GE 4F25A 1X5PA 1IJFB 4USUA 5CCMA 4WE1A 1UMJA 4G6VB 1J27A 3DC2A 2Q6CA 2VJUA 1FKPA 1JLEB 4MTPA 1FTRA 2MLXA 3HMJG 4V19J 4PWUA 3MXHP 3VAFA 2V68A 4CM0A 2C28A 2D69A 4FN5A 4URSA 5I3QA 1VCTA 1WOSA 2PC6A 2P9CA 3DRXA 2B7CB 1X4FA 4AL6A 1NLKL 2MGZA 3V6JA 3CJKA 1EX8A 5GAGI 5HMYA 1WD6A 4KFBA 2X3DA 3HHLA 2XWYA 3W1YC 1HARA 2E1PA 2BM0A 2YQ3A 4N7TA 3F73A 3BZQA 1DARA 1NUEA 1PAEX 5C42A 3CCVS 5KG2A 1N4LA 1QD1A 1C4CA 2H4WB 3MR3A 2ZH4A 2R2TA 3F41A 3R7SB 5FDLA 4KO0B 1S6QA 1FD8A 7FD1A 4U7CA 2JL9A 2C3YA 2GS8A 1Y10A 2XM3A 2ZFHA 1RT3A 3DOKB 3B4MA 1VQ9S 4LF8J 1F9FA 4LF4F 1NZAA 4B02A 1BQNB 1YRUA 1H74A 4KC5A 4X64J 2MY8A 2XSFA 4NPOA 2W2MP 4UZCA 1VIOA 2KI2A 2QLXA 1HQEA 2VD3A 2W25A 1C2PA 2IJFA 2W4CA 4ILRA 3TVKA 1RE1B 2ILYA 2DNHA 3L7UA 2E1MC 2A2CA 3PHTA 3SFGA 3QFHA 5IS2A 3OW2R 3SV3A 3M30B 1IKVA 1JKHB 4XPCA 2GJ2A 2YPZA 4LSZB 5H9EJ 2OIHA 3GSDA 2MHNA 4A8SA 1VGYA 3K5PA 4EFAC 1O5JA 3KLEB 2ZD1B 4DR2J 1CVJA 3H90A 2VOOA 5IZHA 1CULA 2CQHA 3ENWA 2VG7B 1TELA 3M8QA 2XI2A 1UVLA 1S1VA 2BM1A 2N3LA 2RRNA 2V8HA 2VG6B 2EC2A 4C7QA 1FJ7A 4KV8B 2WOMB 4RW4B 4ZP6A 4EBCA 5A0YB 2HMIA 1T95A 1LXNA 1JXVA 2FJDB 2NYIA 2LQ5A 1WF1A 3L9ZA 2XWXA 5B0FA 4NLQA 4ECTA 2MQMA 1LXJA 1FFSB 2YKAA 1Y9OA 2E7XA 3B78A 1FRXA 1LNQA 4NZ7A 5ETRA 3DLLQ 5L9XA 3R5BA 3Q2SC 3GJSB 2EFQA 2WVCA 1LW0A 4ANCA 3C14A 3MEEB 2W9CB 4NMXA 2J5AA 1S79A 1WEZA 2RSQA 1QAJA 3H5UA 3W65A 3RG6A 3QGHA 3K58A 1GX6A 4C0OC 4PYAA 4EBEA 4ED1A 1NM2A 2DH7A 3DRRB 2NXNA 4PWWA 3IGVA 1VRQC 1W25A 4JB8B 4WIQA 2KL8A 3PW7A 2OGUA 1HI8A 1NJWA 4ECZA 4GKKJ 2ZUAA 3QRPA 5ADZA
chains in the Genus database with same CATH topology
4MIAA 2D7SA 2HRYA 2NLWA 2YNHB 3G6VA 2DNKA 4IO1A 2HVHA 1BQNA 2X3GA 3MPVA 2AD9A 1RA7A 2E5GA 5DRKA 5F8HA 5HL7Q 3IG1A 4ED8A 4B17A 3OHAA 4ZVEA 2VC1A 4MKYA 4LT6A 1NH8A 4J5OA 3K59A 5AJ3F 3FSXA 5KFFA 1U24A 5CZVA 5KFAA 4QR2A 4QIGA 3AHPA 3CDUA 2YKMA 3QPIA 3H2VE 4NLRA 2N4CA 1APSA 3GE9A 3BGRA 2U2FA 2WSFC 2LU1A 2KG0A 4DWIA 3HZEA 3ITHB 1S99A 4OX6A 1CQNA 3UWTA 2FC9A 1S0OA 4RW8B 1L3KA 3UW1A 5B0CA 2YNIB 3IGNA 3T5HA 1SKWA 3DLKA 3BO3A 1JIHA 2JDJA 3H8YA 3MPWA 1DTTA 3VAIA 2KZMA 2I0XA 2GX8A 3O1LA 2UUWA 3HVRA 4WF9Q 1JJ4A 1FEEA 2VPYB 4IG3B 3I55S 4DR1F 4RBVA 3DYAA 2KT3A 3D1OA 3OTEA 2X1FA 2DD8S 1YBAA 5EHHA 2Z2MA 4I1TA 4C11B 3BREA 3H4DA 4CNYA 3J7A1 2IVFB 1UVNA 2MY7A 2IM2A 3VAMA 2RF2A 3TAMB 1ZM9A 5D3GB 3E2EA 4Y28C 1I1GA 3MF5A 4OZ5A 4Z2XA 2RB7A 2V4QA 2XMWA 3KHLA 5B09A 4U67Q 3PW4A 4RUHA 3GV8B 2ZH8A 3NMRA 3K8VA 3GMGA 4ZLPA 3CCRS 1RT7B 2HWHA 1DAXA 1YGYA 2B56A 1QLNA 4G1PA 3LP2A 1TKTB 1IBKF 1SL1A 2VG5A 1H2TZ 2M9KA 2Z0GA 4EYHB 2HRUA 2HNDB 4ELUA 1SH0A 5J1EB 2J6SA 4ILLA 3CD7A 4YR3A 2CQ3A 5J2QA 1JKHA 3UI3A 2JVRA 4WYWA 1U6BA 3RB0A 1XMQF 4TYBA 1B0TA 3LOUA 4KKOB 2G1DA 3CXCR 3AB2B 2CPJA 3MUMP 3UDLA 2R7UA 1KHWA 1FRLA 2EK1A 2RMLA 3AJ2A 4ETZA 4QW9A 3RBDA 4Q7AA 1HBUA 2AYMA 3CCUS 3MI7X 2D41A 2QYCA 2B5JA 4CH0S 2YX1A 3QO9A 1I94F 3LP0A 1UA0A 2Z4PA 1QAXA 2LEBA 4WXWA 2POKA 4B08A 3GG1A 3PRDA 1U09A 4C2MA 2KDOA 5I3UA 2HWTA 1VC5A 1RKJA 3CCSS 2M0GB 2R7VA 5DDPC 1FO1A 4F4WA 1Q7YT 4X4SA 4IG0B 3F56A 4ECQA 2OJ3A 4K4VA 3ENVA 3NGKA 1FVSA 1HWJA 4KT0C 1WACA 1XNRF 4FBUA 2J6TA 2N3OA 2VKZG 1U6FA 3MOZA 4BWJA 4WCEQ 5DQHA 3QIPA 4MK9A 1HBMA 3H40A 2DITA 2I8EA 2IVYA 2JC1A 2VV5A 3U1NA 2P6SA 1TKXB 4F3OA 4USJC 4CNZA 4J37A 4DQPA 1TFYA 4FXWA 1FESA 4I2PA 2RS2A 2ZE2A 2ERRA 3E3XA 4PG8A 2MB0B 3TUJC 1OS5A 3Q22A 4B9TA 5KT2A 2F8HA 5DLGA 5T14A 2XC9A 1GXTA 2W24A 2YNIA 2IA0A 3UPFA 4CCHA 4IQMA 3LP0B 5CZXA 1HPZB 5CYMA 5KT4A 1RK8A