4MFBB

Crystal structure of hiv-1 reverse transcriptase in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
425
structure length
413
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Picomolar Inhibitors of HIV Reverse Transcriptase Featuring Bicyclic Replacement of a Cyanovinylphenyl Group.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 101
structure length 413
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4mfbB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB03
4KO0A 4WXOA 1NHUA 3H2LA 5KG3A 2C2DA 2XGQA 1VRUA 3HVTB 1RTJB 1RDRA 4WFYA 1HARA 5C42A 4TY8B 4IOBA 3IGVA 4Y3CA 2J6UA 5I42B 1BQMA 5KG0A 4O3OA 4ECVA 1W25A 2V0NA 4EO8A 2UVUA 1JLAB 4IR1A 1LW2A 1S0OA 1I6JA 5KFZA 3H4DA 1JKHA 5HLFB 5KFEA 3NAIA 2W9BB 2D3UA 4RW8A 4NLGA 3RAQA 5T14A 4ED6A 1TVRA 2WB4A 1RTJA 4RW9B 4MFBB 5HROB 1D1UA 3D28A 4TN2A 4TY8A 2C28A 1HNIA 4Q43A 3MEDB 2UVWA 1QUVA 1T94A 3GIIA 4MIAA 5HLFA 5KFGA 4YP3A 4QWBA 2W9BA 3E01B 4XPCA 4RNMA 1C2PA 3Q8RB 5DG9A 2HWHA 4QWAA 4KSEB 4RW9A 4MFBA 3ISND 4TY9A 3M9NB 1JIHA 2O5DA 1FKPB 1QAJA 2CJQA 1TL1B 3PJXA 4ZVHA 1C0TB 4F4YA 3G6YA 4X2BA 4J9QA 4QPXA 5KT3A 3I0RB 3V4IB 3BSCA 3E01A 1QE1B 2AWZA 5KFOA 1FKOB 3QIDA 2IBKA 4EO6A 2XWYA 1RTIB 2WOMA 1D0EA 3QO9B 5DGBA 5L1LA 4FBTA 5KG2A 2JLEA 4WE1A 1C0TA 4LSNB 2IJNA 3OHBA 2W7OA 3MR2A 3BSAA 1WNEA 3V4IA 2ZD1A 3M8PB 3FSIA 1QE1A 2RDIA 3N6NA 4DL7A 3BGRB 1FKOA 3PR5B 1RTIA 5KFSA 1JLCB 5JUMA 1K1SA 4G1QB 1T03A 4WFZA 3QO9A 1RT5B 1S48A 1S9GA 3I0SB 4NLRA 2BRLA 2WTFA 1RT1A 2UUTA 2R2RA 3KK1A 3BQ0A 3LP0B 5KFFA 3OL8A 3FQKA 2R8HA 3M8PA 4J9KA 3BGRA 4ZPBA 3EPGA 3DRRB 4EBCA 4NYZA 2YNGB 4G1QA 3GILA 1RYRA 2CKWA 3QGIA 3PR4A 1RT5A 1QAIA 5C5JA 3H5SA 3I0SA 3I5BA 2B43A 3RAXA 3DLGB 2GC8A 3JYTB 4F50A 4ZVGA 3DMJB 3LP0A 3BSOA 3VQSA 4YR2A 1C1CB 3BSNA 4YR0A 4ED2A 2R8JA 1TKTB 4RNHA 4KFBB 2FLNA 2IC3B 3LP2A 1EETA 1DTTB 3Q8PB 4Q8EA 2YNGA 4DEZA 3ISNC 2FVPA 1DTQB 5DG8A 4ECRA 3V6DA 1TV6B 1DLOB 3H5XA 3G86A 4K4YA 1J5OB 4I2PB 3DLGA 4K4ZA 3M9MB 3G6XA 4IR9A 3DMJA 4RUAA 2R2UA 5DG7A 3V81B 1C1CA 3IN5A 4IFVB 4I7FB 1TKTA 4ED0A 4KFBA 2IC3A 4TYBA 3SFUA 1DTTA 5KFHA 3M8QB 3CDUA 4QWDA 4ZHRB 1DTQA 5KFJA 1TV6A 1RTHB 3UR0A 1Z4UA 4F4WA 3LP1B 2HNZB 4I2PA 3H40A 4IDKB 2IMWP 5EDWA 3T1AA 2EC0A 2R2TA 4IFVA 4I7FA 1BQNB 2AGOA 3D5MA 3QGHA 4J9OA 2B5JB 3M8QA 4O3PA 4ZHRA 5KT6A 2UVVA 2YKNA 3UQSA 3OLBA 1RTHA 4PUOB 2V4RA 3LP1A 2IJFA 2IAJB 3RB0A 3N6MA 4IDKA 3H5YA 4DL4A 2QV6A 1S10A 1JLFB 4YMEA 1BQNA 3CVKA 2JEJA 3DYAA 4Y2CA 5KT2A 3NGDA 4IG3B 2B5JA 5FDLA 3LALA 5DLGA 2JC1A 2C22A 3KK3B 2I5JB 4DL5A 1SV5B 2IAJA 3CDWA 4I2QB 2YNIB 2R2SA 2JC0A 4MKBA 5CYMA 3MTKA 4IG3A 2XCPA 5KG1A 2F8EX 1TVRB 1JLQB 3KK3A 4NLPA 2I5JA 1SV5A 1RT2B 3DRPB 1S1WA 3TAMB 4I2QA 1HNIB 5C24B 2BRKA 2ZKUA 2YNIA 1HNVB 1S9FA 4NLYA 4ZMMA 4LQ3A 1HPZB 4WFXA 4K4TA 2AGQA 3FFIB 4LSLB 2AQ4A 1IKXB 3KLFB 3T19A 4JV0A 1JLQA 3V6KA 4J9RA 4ZP6A 4IH7A 3DRPA 1RT2A 3TAMA 1N5YB 2VG6A 5KFYA 3Q8QB 2BANB 3C6TB 5C24A 2RKIB 1TQLA 3DDKA 1HNVA 3Q8SB 3HHKA 1HQUB 1XR7A 2XI3A 2IM2A 3CJ5A 1TL3A 1JXLA 2JEFA 4MK7A 2W8LA 4IRDA 1HPZA 2YKMA 5KG7A 3FFIA 4LSLA 4KV8B 1IKXA 3KLFA 4RNOA 3CJ3A 4Q0BB 4WZMA 2WOMB 2J6SA 4LQ9A 1IM4A 3UDLA 1N5YA 3IRXB 1GX5A 3QGGA 5F8IA 4IQXA 2BANA 3KHGA 4WE1B 3C6TA 2D7SA 2RKIA 2D41A 5KFDA 1ZETA 1R0AB 1TP7A 4H4OA 3RB3A 4WYWA 1HQUA 5KFPA 2ZE2B 2ZD1B 3QIPB 2HMIB 4MIBA 4ZVEA 3MECB 2RF2A 5KT5A 3PW7A 4KV8A 2WCXA 3BR9A 4ZPAA 1S1UB 3G6VA 1RT3B 4Q0BA 1YVFA 1T03B 1LWCB 5EWFA 4DL3A 3IRXA 2AX0A 1S9GB 2E9RX 3NKYA 1RT1B 1R0AA 2W7PA 2J6TA 3KK1B 4B3OB 4TQSA 1ZTTA 5L1KA 2ASLA 5C25B 2ZE2A 3QIPA 2HMIA 2V9WA 3MECA 5D3GB 1HQEB 3OL9A 3KMSA 4MK9A 3MR3A 1MMLA 1S1UA 4NRTA 2FLLA 1RT3A 5DQGA 5KT4A 1LWCA 4ECXA 4TXSA 2BQRA 5CYQB 5KFLA 3FRZA 3RB4A 1C0UB 5KFUA 4B3OA 3LAKA 3KMQA 3LAMA 4NLTA 5C25A 1RTDB 3GV5B 2VG7B 3H59A 3PJWA 5D3GA 1HQEA 2XGPA 2RDJA 5L1IA 2OH2A 3LP2B 4KHMA 1EETB 2JEIA 3KK2B 2XCAA 4RW4B 3V6DB 4GC6A 4IH6A 5JXSA 4Q8FA 5CYQA 1S9EA 1C0UA 3CDEA 4J9NA 3MFIA 4H54A 1RTDA 2BQ3A 1T3NA 2VG7A 3GIJA 3M9OB 1GX6A 1XR6A 3RB6A 4O3QA 1K1QA 4ECTA 2ASDA 1RT6B 3KK2A 1SH2A 4RW4A 4F4XA 3SI8A 3KHLA 4ED3A 3HVWA 2B6AB 5HBMB 3KLHA 2FVQA 3TVKA 4IH5A 3DLKA 4PWDB 4K4SA 4NZ0A 4IKAA 3KLVA 3TQ1A 4NLSA 5F8LA 5J2PB 3LANA 1IKVB 2UUWA 4NLOA 1LWFB 1RT6A 2HAIA 4XO0A 2YKNB 2OPQB 4RNFA 4O4GB 3KLEB 4U7CA 1IKWB 2YNFB 2B6AA 5HBMA 4NLXA 4PWDA 4IG0B 1KHWA 2W9CB 3T5KA 2FJVA 5J2PA 4ED1A 1IKVA 3DYAB 1CSJA 3BREA 1LWFA 1SUQA 1SH3A 5FDLB 3CWJA 4ECWA 3I5AA 2OPQA 3KHHA 4O4GA 3KLEA 2VG5A 1IKWA 4EYHB 2YNFA 5KFAA 1JLEA 1SH0A 5KFBA 4QW8A 3PZPA 4K4WA 5KFWA 4IG0A 4DL6A 3OSPA 4NLWA 2BR0A 2W9CA 3NMAA 1RA7A 4ECQA 1S6PA 5J2MB 3OLAA 3H98A 5CYMB 4O3NA 4Q45A 4JV2A 1N6QA 1HMVB 2JEGA 4H4MB 5EUHA 3H4BA 5J2QB 1S1WB 3GV7B 4DL2A 3H5UA 3SFGA 4O44B 5J2MA 4ECZA 3RBEA 5EWGA 4QWCA 1HMVA 1U09A 1RYSA 3ITHB 3PVXA 3KLIA 2FVSA 4NLVA 4H4MA 4ECUA 5DGAA 2WK4A 1MU2B 4FS1A 4RUCA 5J2QA 1RAJA 2VG6B 4J9PA 4IRCA 4O44A 5F8NA 1S1TB 3C6UA 2WRMA 1TL3B 3ITHA 2VA2A 2IA6A 2YKMB 1S6QB 2V4QA 4YQWA 2OPSB 3UPFA 4F4ZA 1N56A 1MU2A 1S1XB 2GIRA 2R8KA 4TLRA 5J1EB 4ED8A 3DOKB 3QZ8A 3T5JA 1TKXB 1EP4A 1REVB 4MK8A 4K50A 4H4OB 3T5HA 4NLUA 1S1TA 4ECYA 4R5PA 5L1JA 2RF2B 3CJ2A 3MF5A 5KT7A 1S6QA 4ZPCA 3PW4A 2OPSA 5KG4A 1S1XA 2ATLA 1C1BB 1RT4A 2HNDA 5J1EA 3KOAA 3DOKA 5KFNA 4ED7A 4RNNA 3DLEB 3GV8B 3GQCA 1TKXA 5K14B 1REVA 4URQU 2W8KA 4ECSA 2IM3A 1S97A 2FVCA 2UVRA 4K4XA 3HVTA 3IG1B 4NLDA 2W9AA 1NNDA 2HWIA 3OL6A 2BQUA 4EBDA 5I42A 4G3IA 4M94A 4WXWA 3MEGB 1C1BA 1JLAA 4KBIA 2E9ZA 2ILYA 4ZVFA 4ZP8A 3DLEA 5K14A 3QYYA 4OL8A 3V6HA 5I3UB 3CJ4A 2C2EA 3DM2B 1JX4A 1S0NA 3IG1A 2OPRB 4RW7B 5HROA 4J9MA 3E51A 3ICLA 1T05B 3DI6B 1HYSB 4ZP9A 3MEDA 3MEGA 4O4RA 3EZUA 4K4UA 4IFYB 3QLHB 3PW0A 4QW9A 2IM0A 3I5CA 2ALZA 3MR6A 3KNAA 1S9EB 4XPEA 3JSMB 5I3UA 5KFVA 3HVAA 5KFKA 3DM2A 2DPIA 5HP1B 2OPRA 4MH8A 4RW7A 1RT7B 5KG5A 5KFCA 5KFTA 3MR5A 1FKPA 2HNYB 1T05A 3DRSB 1TL1A 2WONB 3DI6A 1HYSA 4ZP7A 3OSNA 4Y34A 4EBEA 4FBUA 4IFYA 5J2NB 3BQ1A 4IRKA 3QLHA 4O3RA 4RW6B 2AX1A 3OHAA 2E9TA 3I0RA 4URSA 3KLHB 2D3ZA 4PQUB 3JSMA 3DLKB 5F9LA 4FS2A 3CJ0A 2XI2A 5HP1A 1S0MA 1JLBB 1RT7A 3MEEB 2HNYA 3DRSA 5KFXA 4Q44A 2WONA 3GIMA 4KKOB 4LSNA 4ZPDA 3PW5A 5J2NA 4RW6A 2GIQA 1FK9B 4PQUA 1KLMB 2IM1A 2AGPA 1JLCA 3QZ7A 2FJWA 1JLBA 3MEEA 1ZTWA 4WZQA 4RZRA 1VRTB 1SUQB 4KKOA 3CIZA 4YR3A 1TKZB 4R0EA 3PHEA 2R8IA 4QWEA 2VG5B 3FDSA 3CO9A 1JLEB 1FK9A 4KHRA 1KLMA 4DG1B 4NRUA 3DRRA 4URGA 3NAHA 5KFRA 1NHVA 4EYIB 3KJVB 2ILZA 1S6PB 4HYKA 4GC7A 2OPPB 4ICLB 1VRTA 1N6QB 4JUZA 5L9XA 5F8GA 3NBPB 2FLPA 1S4FA 2QE5A 5KFQA 3OL7A 1TKZA 3JYTA 1N4LA 4TQRA 3MFHA 4R8UB 2DPJA 4KAIA 4ID5B 4DG1A 5KFMA 1UWBB 1JLGB 3RBDA 3KHRA 3KJVA 2OPPA 3IS9B 5F8MA 1RA6A 4ICLA 1DLOA 4M95A 5F8HA 4J9SA 1KHVA 3NBPA 4EEYA 3GIKA 2YNHB 1J5OA 3GYNA 3KLIB 5KG6A 3PW2A 4R8UA 3V81A 4JV1A 2R8GA 4ID5A 5DLFA 1UWBA 3T5LA 1JLGA 2ASJA 2VA3A 1IKYB 2WHOA 5DQHA 1S1VB 4NCGB 5F9NA 4J9LA 3IS9A 2FJXA 3C6UB 5DQIA 3IGNA 4KB7A 3KLGB 2HNZA 2YNHA 2C2RA 1N48A 1LW0B 4NLQA 4U6PA 3DOLB 2BE2B 3FQLA 4MKAA 3BQ2A 1LWEB 4RU9A 4WYLA 2XC9A 3BJYA 4HKQA 3NL0A 1EP4B 1IKYA 4KO0B 4KE5A 4Y2AA 1S1VA 4NCGA 4TYAA 2I1RA 3V6JA 1VRUB 4PUOA 4R5PB 3KLGA 5KFIA 5C42B 1LW0A 1XR5A 1BQMB 5EWEA 1S49A 3HKWA 4K4VA 3DOLA 4O3SA 1JLFA 1OS5A 1RT4B 2BE2A 1LW2B 2HNDB 1LWEA 5F8JA 3N6LA 1JKHB 3EPIA 4RW8B 2FVRA 2AU0A
chains in the Genus database with same CATH superfamily
4M5LA 4V19J 1XC9A 4UT4A 5E3CA 1RTJB 4IOBA 2JZ5A 1IUJA 2VQEJ 4OQJA 4ED6A 5HROB 1PBUA 2XNQA 1Q4RA 5E3QA 3W5XA 2DGOA 2XY6A 1HWIA 1S99A 3Q8RB 1CJVB 2LQ5A 3KDOA 4TY9A 2CJQA 3K8VA 3RW7A 4RL1A 2VFSA 5L1LA 4C8LA 1C0TA 2X3DA 2YPZA 2ROPA 4X66J 8AT1B 1NPPA 4DI6A 4JI7J 4ZJOA 1S9GA 4NLRA 4USJC 2KT2A 2R2RA 1GNKA 2DRDA 2D9PA 1L3SA 2DT9A 3MM5B 1LFWA 4KFBB 2MLYA 1IWGA 1GTEA 2FVPA 2AJFE 5BJRA 3M6VA 2IPOB 1J2VA 2R2UA 1C1CA 1TKDA 2CQ2A 5KFHA 2HNZB 1EZZB 4S0MA 3R6GB 1RWXB 1NK9A 1DRZA 1SCJB 1U1MA 3M8QA 4LIWA 4DFMA 4ZHRA 2UVVA 2YKPA 1XMBA 3DFEA 1OJ4A 4IG3B 4RBTA 2CRLA 2I5JB 1RWOB 4AD6A 1QUPA 2IBOA 2JC0A 3W65A 3MTKA 2VV5A 3RJMB 2JX2A 5E3RA 2HURA 3J7AN 4JV5F 5GVQA 4QYZK 2HHTA 2MKKA 4KGZB 4PCQA 2DB1A 1RT2A 1TTHB 2BANB 3CJ8A 2FJBB 3Q8SB 1QY7A 3CJ5A 1FD8A 2ZJRQ 4WTYA 3NMRA 4B9VA 1Q8LA 2OAUA 2ZE2B 4ZVEA 1FI4A 4C48A 3OBIA 4EK2A 2YBVA 3HI9A 5BR8F 1PJ6A 2LFVA 3VALA 1FXDA 3W62A 3MAAB 2JRSA 3OFEA 3PJWA 4WP3A 3LP2B 2EBEA 9ATCB 1M90T 2JEIA 2KXFA 4LBIA 1U1PA 1XR6A 1A0OB 5HATA 3HVWA 5B08A 5J2PB 3HFZB 1OYDA 3OJSA 2GJ2A 1QM9A 2M70A 4CZCA 4OYAA 1QSSA 2YNFA 5KFAA 3GMGA 1SH0A 1S6PA 4GMKA 5ETVA 4JI0F 1A7GE 2KHCA 3GU0A 3BH6B 1Q8KA 2IVFB 3CCZA 4DL2A 4DSIA 1HMVA 2QEXS 4NXMJ 2CADA 2XHWA 3OVAA 1FRXA 3TZXA 3O5TB 4GVBB 1X5PA 2DHXA 2HHQA 3C6UA 2CQ1A 2WW4A 2OPSB 2GIRA 5J1EB 1H98A 2EKNA 3DXBA 1S6QA 5K8OA 3KOAA 2HQFA 2VOPA 5K14B 1V3ZA 2FVCA 4K4XA 1DJ0A 4HTJA 4M94A 4GKKJ 2E9ZA 4ZP8A 3DLEA 3QMQA 3GJQB 2ZNZA 3ICLA 3CC7S 3M2VA 3J81U 4DSJA 5T7LB 4EMDA 4QZVB 4PAAA 1DY3A 2DISA 2Y1LB 2DXDA 1KN6A 4ZP7A 5B09A 1B70B 1SB6A 2E9TA 5F9LA 4LF5F 5GMKa 3D7SB 1NH7A 1EKSA 5D6GA 2HFVA 4A47A 2KJVA 1X4DA 1T95A 2FJWA 1FF2A 1WHYA 1GAOA 1DQ8A 3UVJA 1H6KX 3D6TB 1FK9A 4NRUA 2MEWA 2CJXB 3KJVB 2XMVA 2OPPB 4DLEA 3ZZRA 1SQGA 1B7FA 4B9LA 4CO3A 1VYAA 4DG1A 3PFOA 3QJLA 3KHRA 4RWWA 2DXEA 4ICLA 3K59A 3VTIA 3QJJA 5IWAJ 1B0VA 4B9NA 4PXBA 4WF9Q 3AD8C 1FWPA 4PQAA 1UJ4A 1Q5YA 3OR1B 4NLQA 4V1Ak 2VICA 2B51A 5E5NA 4Y2AA 1WC0A 1VRUB 3KNGA 2E5LF 5C42B 4L6V3 3HKWA 1KQSR 1LWEA 4DR4J 1EQ0A 4FF3A 1PGZA 4B3TF 4OLOA 1FWLA 3HVTB 4BDPA 3GFHA 5KG0A 3SYZA 4PWUA 3H4DA 5FD1A 3NAIA 1XMQJ 1Z2LA 1U2RA 5BYRA 1CS4A 2DGXA 4FNHA 4XPCA 1HFEL 1FKPB 2J9EA 3G6YA 2HEKA 2O67A 3VZIA 3GR0A 5C7PA 2F4VF 1RTIB 3HSGA 1VDHA 2IJNA 3OTEA 3TOQA 3AB2B 2QSFA 2W7OA 3D66A 4CWBA 3BGRB 1WWHA 4OHWA 3AH6A 1PC4A 1VK8A 2MMYA 3OT9A 5KFFA 3FQKA 3M8PA 3B6BA 4WIQA 1RXOB 3GR1A 1LV5A 2B43A 1D8YA 2COLA 2PD1A 2HPUA 4Q8EA 3GWCA 3O44A 4ZLNA 4IR9A 4DSKA 1WUUA 3I6PA 3HSJA 4IDKB 1NMEB 1IBMJ 1BQNB 1U8WA 4O3PA 2XMMA 4KH1B 4Q5VA 3J81j 2W4PA 4DL4A 1KQKA 3SV3A 1WG4A 2G2YA 3CVKA 2C2NA 2J7WA 2Q3PA 1I3OB 4ATNA 5AJ3F 2XZWA 5ETSA 3TA1A 2BJ7A 2GHPA 3BGFA 1FE0A 1SV5A 4I2QA 3NXZA 3ETOA 2XG8A 1NU4A 3ILIA 4HI1A 1KKHA 4FZVA 1FHTA 3TAMA 4GRSA 4OLPA 2GFFA 1HQUB 1JXLA 2LU2A 4CO4A 5B0GA 4MKVA 1D9AA 2VKRA 4WZMA 3UDLA 3NS6A 1YJ9S 4JI8F 2BJEA 3GFZA 1MLAA 1YJNS 3QIPB 4MIBA 2NXNA 2MQLA 1VLYA 2ZH1A 2Q66A 2H5JB 5EWFA 1LWCB 2A6OA 3NKYA 2PGCA 4DUZF 3OL9A 2EWHA 2FLLA 2QYGA 2CA9A 2HFOA 1RAEB 4ELTA 5C25A 1UVJA 2VG7B 3H59A 1HQEA 1N54B 1RLDA 4P7TA 5HMYA 2M8DB 4J9NA 4LFBF 3C15A 5CCLA 4M8LA 1ZPWX 1RT6B 2KKHA 4LR7A 1T0TV 3DLKA 3DNCA 4K4SA 3C19A 5JVHQ 1GMWD 1SPBP 4DV6J 1WSVA 3DU5A 2F9JA 3EJMA 3R8YA 1LWFB 3P3DA 5D15A 2YKNB 4O4GB 1WEYA 4Y2MA 4K7QA 2MQNA 3QT8A 3W2WB 2Y1IA 1JLEA 3D6MB 4DL6A 4KC5A 2FQQB 2LQJA 4F25A 5CYMB 2CPIA 4JB8B 4LF8J 2FZCB 4JBCA 4P2FA 4K8RA 1N32J 3A8IA 1IXKA 4OX7A 3ZZOA 4QWCA 2CJ9A 1N33J 2O66A 4ECUA 4RO0A 5E0OA 4G1PA 4DMZA 4JI3J 2IA6A 2YKMB 3UCUP 3RGIA 3PEJA 2UP1A 3PY8A 1TKXB 2LQ9A 3UW1A 5U47A 2QGFB 3GQCA 1REVA 1D9FA 1U2CA 2VONA 2Q6CA 4X84A 1DURA 3MEGB 1C1BA 4KBIA 3ZO7A 4JOUA 3MCOA 4AQYJ 1JX4A 2W01A 4MIWA 3GFYA 1WKJA 4O4RA 3EZUA 2V2VA 5HVGA 3R5GA 4M63A 2DPIA 2QA2A 1RT7B 2L9DA 2HNYB 4RU2A 1HYSA 2V8PA 2QJ3A 3QLHA 1SC4B 1YIJS 4URSA 2WSCC 1S0MA 3QWPA 3EXYA 2SXLA 1NKCA 2HIYA 2WONA 4KKOB 4OYXA 1YTYA 1WC1A 2B0GA 1C4CA 3GSDA 5D0HA 5IT4A 1OSCA 4HYKA 2WVBA 2C2KB 4JI6F 4BBYA 1WORA 4WBFA 3RBDA 5F0WA 5MLCV 3A13A 3NBPA 3EVWA 3KLIB 1YKWA 5KG6A 3ZZTA 2QLBB 3HJVA 3M6UA 1OIAA 3MMAA 3T5LA 4NCGB 1B4SA 1U0HB 3J7ZT 3FQLA 3BQ2A 3BJYA 2GCFA 3M6WA 4Z2XA 3MM9B 4GKJJ 2AD9A 5RUBA 3BYPA 1LW0A 1XR5A 1TL7B 2HHXA 4NEYA 2Z0GA 2Z2MA 2C2DA 3BYRA 4DSLA 2N4CA 4CH0S 5A76A 5HLFB 4NLGA 4RW8A 2VPWB 2GA7A 4TN2A 4DJBA 1HNIA 2H48B 2HQIA 3HD2A 4YB1P 4I6WA 2KFZA 4MFBA 2H5EA 3NGUA 5GAEU 4C97A 5B0DA 1MN9A 1FO1A 2B7BB 1Q7LB 5KFOA 3KG1A 1RWVB 3F44A 2LDIA 3MMBB 3M1VA 3BPDA 4DL7A 2HHPA 2LCWA 3PXGa 3FEYB 1FKOA 2XMUA 5KFSA 1RT5B 3ZZUA 2GZOA 4C8NA 3BBFA 4B9UA 2VL1A 3MI7X 3VWSA 4ZPBA 2ACMA 2DHGA 4LFCJ 4NYZA 1QAIA 3WIUA 2GO8A 3JTPA 3VQSA 4DPTA 4ED2A 2GV1A 3AJ2A 2XYHB 1YSJA 1TV6B 2KYZA 1VQ8S 1E6YA 1KD1T 3IN5A 1VGYA 4ANEA 4LRCA 3IO1A 4YHHF 1DQ9A 2RQ4A 2AYMA 4I7FA 2IRYA 3MEKA 3UQSA 1X4BA 2IJFA 4HHHA 2BX6A 1EB0A 1JNRB 5HN0A 2DVIA 3RAMA 5CD4A 2VBWA 3DRXA 5K9FA 2C2OB 2WBRA 2K7KA 1N36J 2ZKTA 5DDPC 3SQGA 3R2DJ 1VQSA 1X8DA 4ZN1A 3MUMP 1VI7A 4DCOB 1IR1A 3DDKA 1V5VA 2XI3A 4NA1A 4KV8B 1UA1A 3T1YF 4LJMA 5SZTA 2M0GB 1RT3B 5JVGQ 1T03B 1OWXA 3CPWR 1DAXA 1O8BA 4OV1A 2UUBF 4NRTA 4I56A 3EXCX 4HDHA 4FPIA 4DUTA 2V50A 2ROEA 4AE5A 1OY6A 3V6DB 5JXSA 4NA3A 4Q8FA 5CYQA 1N52B 4K0KJ 1ZS6A 3BH7B 1PC5A 1REGX 3JAMY 3KK2A 2HVIA 4DU7A 4BCAA 4ED3A 3AD7C 1UPPA 3CUNA 2G2OA 3TI0A 3EGNA 3DLJA 3CEDA 3SCIE 1CULA 5ADZA 1JWWA 4W4MA 1VIOA 4DUYJ 1K73T 5IC4B 1S7HA 1Y5IB 2Z8QA 5CZVA 4GO5X 3AA9A 4X64J 1RAIB 1YJ7A 4DQRA 3EVMA 5LMUF 4DX6A 3H98A 1IM6A 5IM0A 2JEGA 1SJQA 3PHTA 2ACYA 1VQPS 3W9JA 4NI2A 5J2MA 1RAAB 4OHVA 1FD2A 1XMOJ 4H4MA 1FFGB 4P2MA 2HG4A 2VG6B 4IRCA 3W60A 4WJBA 2WRMA 2EG2A 3CCUS 3VAGA 4YQWA 2VQFF 3T5JA 3SCJE 2HIQA 1RI7A 5IQ6A 2MY8A 4M5IA 4PWWA 3N4WA 3TANA 2AT1B 2CWKA 4ZIWA 1RAHB 1X9WA 5IT9Y 2ILYA 1FJGF 2ZH2A 3MCMA 3CJKB 3IG1A 4J9MA 4K4UA 4IFYB 2MDAA 1Y10A 3LPYA 1G2EA 2VQEF 4A46A 1PYTA 4EBEA 1RJJA 2YWFA 2A2CA 1J5EF 4PQUB 3JSMA 1TMMA 4ILMA 2DCLA 2KT3A 1FNOA 2GIQA 1KLMB 3PCOB 2IM1A 2YQ1A 1JLCA 3FCVA 3CCQS 3GCWP 3G71S 1UW4A 4RUHA 4DXLA 2EFQA 2BYCA 4EI2A 1TKZA 4KAIA 2RIJA 2YNHB 5D4PA 2FTRA 2NPFA 4ID5A 4LF1A 2ASJA 2B8PA 5D4OA 3A3OB 1M5PC 1X5TA 1L3KA 1PJ5A 1EP4B 1RCXB 2KM8B 2AZ1A 1JXEA 4PG5A 2C42A 1PAUB 1BLUA 3OTOJ 4KO0A 2X1FA 3H2LA 4OJGA 5I42B 2PMHA 3Q8YA 4OI1A 1OYEA 2XBPA 2C3MA 2OELA 2HFUA 1YBTA 2PSZA 2WB4A 2E66A 1WJ9A 4A8WA 1Q5VA 1WDTA 4MIAA 1DHMA 5HJYA 4USUA 4DPYA 1Y0HA 5I3QA 5DG9A 1TK8A 1C0TB 2LA4A 4QPXA 4FF2A 2A3JA 3E01A 2HRTA 1MMNA 2WOMA 1P9YA 4LUBA 2JLEA 1KBRA 1VHIA 2YWGA 4L72B 2CG8A 3OHBA 4UUXA 3JSRA 1T8EA 3V4IA 4Y2IA 4C0HA 4X4UA 4ZCKA 3THVA 5JUMA 4AXIA 3QAEA 2MPUA 2BRLA 3KK1A 2NREA 4WP9A 4I6AA 3EPGA 1N8RT 3VHQA 1VJQA 3SSSA 3JYTB 3MPYA 4U8VA 3CD0A 1C1CB 2GVDB 2FLNA 5DG8A 3DHXA 3H5XA 2FZKB 2MQPA 3DLGA 1NM2A 1IJFB 2V2QA 3M8QB 4ZHRB 3DDIA 1RAFB 1FRKA 2NS1B 3GG1A 3GLJA 2DXFA 4KGXB 3K58A 1NK7A 2VASA 3LP1A 4IYQA 1NB2A 2ALYB 1VHFA 2D69A 2JEJA 2AW0A 4YY3J 2IAJA 5BYQA 4USVA 1Y5LB 2Q1LA 5F41A 2VU5A 1IVZA 4HT5A 2F8EX 1RT2B 1RP5A 3QWUA 2FY8A 2J0SD 4JI5J 1HQ2A 1FFWB 1VBKA 3A12A 2YKQA 4KGVB 4K2JA 2CQ4A 2O01C 4BHQA 1W2BR 4RNOA 3AOBA 1RABB 2BE7D 3M4XA 5GAHI 2HQCA 2FHJA 1SIWB 5GMDA 1R89A 1P1TA 4ZLLA 2ZH3A 1NDCA 1W26A 4UW2A 2G0IA 1WOPA 1XNQJ 2K3IA 1RHUB 5KFUA 4B3OA 3LAMA 4G1IA 3IC1A 2YWHA 3M2RA 1SKRA 1WI8A 4GC6A 3VAJA 2OMOA 4IH6A 2RRBA 3M9OB 3KHLA 4IH5A 4NL5A 1NCLA 3MOJB 4F67A 1H2VZ 4NCAA 5GADU 1CPZA 2YNFB 2DNRA 2FJVA 1CSJA 1XTZA 3CWJA 4ECWA 2X1BA 3KHHA 4M5NA 4R0JA 2E1RA 4IG0A 2F8HA 5I3PA 4F04B 2ZUAA 2DD8S 1HMVB 2VKZG 2AYBA 4Y6IA 3PKYA 2B4UA 4X62F 1M1HA 4WPAA 4ECZA 4FXDA 1KWMA 1RYSA 2DK2A 2WVDA 1P8GA 1TL3B 3ITHA 2R7XA 2MQQA 1S6QB 2FB0A 3UPFA 2ADCA 1MMDA 4NLUA 4F0MA 4N8OA 1JJCB 3DOKA 3DLEB 1U45A 4ECSA 1VQ6S 2H51B 3E3XA 2CZ4A 2FHOB 3TJ8A 5HROA 4DR4F 1XERA 3VGTA 1NUEA 4M5DA 5FLXY 1X5OA 5KAKA 3KNAA 3HVAA 3W5ZA 3J80U 1T05A 2XWXA 3R1HA 2B4VA 2CJAA 4CCHA 2OTLS 1T3OA 5DM7Q 1RU2A 3UVJB 3OVSA 1FK9B 2V8GA 2UXDF 4L3KA 3DHWC 3PHEA 1RSCA 3AODA 2CJKA 2V63A 4DG1B 2E29A 4ICLB 3MM5A 3MFHA 2VODA 5DO2A 4LR8A 1R6YA 4F3OA 2AEJA 3K89A 5DQHA 2MKJA 3G6ES 3IS9A 2FJXA 2OP5A 4QR2A 3X1LB 2HNZA 2Z58B 1LWEB 2ZH8A 5L8RC 1CJKA 1Q16B 2DJWA 3KYLA 4DV1F 3FMWA 4ITSA 1UP1A 2M4MA 1RT4B 1JJ2R 5F8JA 3UN5A 1K44A 2MSSA 2J6UA 1YLXA 3IWNC 3NEKA 1VK3A 3QRRA 2CNOB 2RSQA 3IBWA 3C14A 3BDEA 5T14A 3RG6A 1T02A 3MEDB 3V5RA 3GIIA 2UZAA 2RHQB 4DS5A 1I1GA 3M9NB 2RRNA 1U7LA 4QR1A 3AQPA 4EO6A 2R7TA 3HHNB 2QT7A 1IQTA 3M8PB 5HK4A 1K1SA 5KOWA 1IN0A 1Z2ZA 3FJ2A 3OL8A 2WVFA 2M7SA 1RHKB 2D3O1 2B9XA 3GYXB 2W4CA 3QFWA 3SSRA 2R8JA 2E1MC 3LP2A 4F8RA 3W63A 3M9MB 3A3PB 2KU7A 2MQ8A 3CDUA 2XY5A 3SCKE 4U67Q 4I68A 2I38A 2R7QA 2IMWP 4L74A 3G8TA 4PXDA 3BR8A 3BPSP 2HFZA 3OLBA 4PUOB 4J5OA 4LF6F 3NGDA 2XO6A 3KJNB 5D4LA 3N9UC 1ZH5A 1SV5B 2RUSA 4I2QB 1VQ4S 4CDIA 2X1AA 2ZEJA 1KLNA 3TAMB 4A8YA 5IZHA 4H4KC 4MJKA 2N4DA 2C1EB 1RWNB 3TA0A 1FVQA 4ZP6A 4LF8F 3SBMA 1SJFA 3TVZA 3HSDA 1AUDA 3FFIA 3PACA 3CJ3A 3Q22A 3POTA 1N33F 1X9SA 3RRHA 5H9FK 1SIZA 1CC8A 2VFRA 4CT9A 4B3RF 2E44A 5C25B 3GSIA 1HQEB 1URRA 4E8UA 3P45B 2XLIA 3FRZA 2PA3A 3BS9A 4LRFA 2BZ2A 4YB5A 3C15B 3M8RA 5GMEA 5K8NA 3CCES 1VJWA 2F7VA 4OZ5A 4B3SJ 4AQYF 3MOZA 2GQ2A 4DZ6A 2UUCF 3V4MA 1CQNA 1WC4A 3H0PA 1XBWA 4KYZA 4PABA 5HI7A 3ENVA 3SZ2A 4MYUA 3I5AA 1Q7YT 2OD6A 2BJDA 5CHCB 4K4WA 2BR0A 3HF5A 4O3NA 1IJEB 4F4AA 1SQFA 1FX4A 3AB4B 2QMWA 5CZXA 4I64A 2QX0A 2XS2A 3LTOA 1R8PA 2RJZA 5F8NA 1O5JA 6FD1A 3UI3A 3OR1A 3OTCA 4N41A 1REVB 3MCNA 4FKXA 4ZPCA 1RE1B 3DKDA 1C1BB 4CT8A 3HVTA 1RGVA 3N0VA 4EBDA 4MMOA 4PG7A 4WXWA 4OI6A 2D9OA 1MW7A 3FVYA 3Q2TC 2LDYA 1HYSB 4NCBA 3DRYA 5HL7Q 3QLHB 2ZJPQ 2IM0A 4XPEA 4FYDA 1Q8BA 1FKPA 2IVYA 2WONB 1HHQA 1S12A 2AX1A 1LWXA 4PR6A 2DR9A 5AXMA 4ED5A 5DDRC 5KFXA 3IR5B 3R5BA 2PI5A 4OYBA 3SEOA 3ILOA 3CIZA 4P52A 3CJQA 1QVFR 2O3DA 2HHUA 3RBZA 3NBPB 3OL7A 1N4LA 2M2BA 2CDQA 3MMAB 2YWKA 1R7IA 5K8MA 1YITS 2XM3A 2IYGA 2B4PA 4JV1A 4LVOP 2DR5A 4CLTA 3D6HB 1YDLA 4J9LA 4C0OC 2J8AA 2H65B 1LW0B 1TMJA 4KE5A 4OHZA 5HVFA 3UD4P 1X9MA 3N6LA 3BBBA 4RW8B 3IAM9 3A8JA 3JQKA 4JYAJ 1H74A 1ZZFA 4MFBB 1X4CA 1UFKA 3PYGA 2DNPA 3J7YU 1N36F 1YRTA 2QA4S 3M1VB 3I0RB 2J8SA 2ZH9A 1FKOB 2CAJA 4FBTA 5KG2A 2A0FB 3TARA 3QSIA 2M88A 2CPDA 2CPZA 2XMTA 5G4DA 5E41A 4WIIA 3P8BB 4M5MA 3BQ0A 2GGPA 1PSDA 1RYRA 1Y3KA 3PR4A 5HMXA 1NK8A 2NXUA 1HWJA 1E6YB 1L5UA 2QLJB 1TFYA 2RUGA 5DG7A 1Q79A 2BE9B 4I7FB 2DNZA 5M2RA 4ZCMA 4TYBA 1DTTA 1SL0A 5KFJA 2JJ4D 1Z4UA 1S4EA 1AZSA 1LK7A 1YBAA 1X4HA 2JNJA 2M3DA 4J9OA 4K0KF 2UU9J 2ZOMA 2YKNA 4LIRA 4HT7A 4NYPA 2HQDA 2HS4A 3TW0A 2KTQA 1F2HA 3D54A 2H9ZA 3SQGB 4M5HA 2MKCA 1FE4A 2G0JA 5CYMA 4DUYF 4X4NA 3OW2R 2UXCJ 3FGVA 3KK3A 1UTAA 2AJ4A 2KI2A 3MPWA 4X64F 3OTBA 2OEMA 1RK8A 2DKOB 1JLQA 4ZN3A 4YS2A 1U49A 1BE4A 2VC0A 3QRPA 3VF0B 3I56S 4MK7A 2W8LA 2YKMA 4EU0A 4F7VA 1GX5A 4I0WA 3V2UC 1AW0A 4G65A 3RB3A 1WHWA 1KFDA 1XWLA 2FUG9 2QLWA 1GH8A 1ZTTA 2ZZMA 4ECXA 4AL5A 3LWLA 5CYQB 3KMQA 3K5MA 2QTWA 4FKYA 4TNOA 1AA1B 1D9DA 4NYOA 2OH2A 4KHMA 4WFNQ 4B3MF 3KK2B 4CNYA 3HK2A 1CULB 3LOUA 2ASDA 2EFNA 2R7WA 1PO6A 3CD6S 4DR6F 1GEHA 1AROP 4KY3A 3KG0A 2ZBQA 1Q1KA 3W66A 2GAGC 4RNFA 3UFCX 3FMBA 1GMWA 1IKVA 3BGOP 2RE1A 1AYEA 2YQ0A 2PI4A 4ZVPB 5KFWA 3DCAA 3NMAA 3IFEA 4NI2B 1RA7A 5J2MB 4PRFA 2XZTB 2W7AA 4MYTA 4H4MB 3M8YA 4FP9A 4C11B 1N0UA 3GV7B 3C8YA 4ZPVR 4Z37A 2Z2YB 3KLIA 1N0VC 1VOMA 3L3CA 3IWXA 3HD1A 1SC6A 3MUVP 1SJ4P 2V69A 1IWAA 3MM9A 3J7Z5 3HFKA 1MWQA 4W98A 5KT7A 2QA1A 1TL7A 2CNKB 4FN5A 3BB5A 3D67A 4CLPA 1B0PA 3TUIC 3IG1B 4WWSA 4OHYA 3IP0A 1GFWB 5B0CA 5ETQA 2V9KA 1TK0A 2CZ9A 3OTOF 1ZM4A 1B99A 2IDLA 3JSMB 3I9ZA 3DM2A 5KFTA 5LXYA 1ZYQA 3I55S 2Z4PA 4NPOA 2B4OA 3CMQA 2D3ZA 7AT1B 5HP1A 4DS4A 4LRBA 3SXLA 4DR1J 4OIXA 4RUBA 3AXMA 2L9NA 1HWLA 2FJDB 3O8WA 3D3CJ 1YG0A 1TKZB 2Q79A 3TWZA 3TZWA 3FEZA 3CCLS 3N28A 1LOUA 3PX4A 2OJ3A 4ID5B 4CLLA 3LW5C 2IMOA 5B0AA 1ACMB 4R8UA 3D1HA 3GE9A 1NJYA 2LQ8A 2VDHA 3BGUA 1R0BG 1XK8A 4FYWB 2V2ZA 4A8SA 2PIIA 4OI0A 1U1NA 4KO0B 5L38A 4TU7A 2RH3A 3KLGA 2Z2ZA 2ZWOA 2BE2A 1HD1A 2NPIA 3FBFA 3D0IE 3CF5Q 1RDRA 2ZFHA 1NKBA 1HARA 1LW2A 5KFEA 2PMZD 4WFBQ 5LMNJ 2VC1A 3KG4A 3US5A 2N3OA 1KSPA 4TY8A 4EFAC 1T94A 1RB0A 4YY3F 2OIHA 3E01B 3R5DA 1I94J 4QWAA 1KNZA 1JIHA 4CLWA 1N5SA 4IOCQ 3V4IB 5MAOA 2IBKA 4DV3J 1BD6A 1F0XA 2XSFA 2DCUB 3A4TA 3W2VA 3ILJA 1T03A 3QO9A 2I8EA 3D9BA 3W8PA 4R25A 2R8HA 1H7XA 5AE1A 3ZFVA 1LFPA 3DLGB 1MSWD 3OR2A 4Y0FA 2FZGB 2YNGA 3GB0A 2G1HA 3V6DA 1SKSA 1J5OB 3PKMA 4RUAA 1TKTA 1XNRJ 4DDFA 3LP1B 4DLGA 1JMTA 1OPZA 2F65A 4CI0B 1CC7A 2AGOA 3F0NA 3UDVA 3A3NB 3HP6A 4DR2J 2IAJB 1XIQA 2HGMA 3QBCA 2R4FA 4AYBD 1W7WA 2DYAA 4ENOA 1B0TA 2MZSA 2CQHA 3HT0A 2FLOA 2Z30B 4OI2A 4DX7A 5ETTA 1YJTA 1D3WA 4NLYA 1NPRA 5C2CA 3V6KA 4ES1A 4IH7A 2VG6A 1TQLA 3HHKA 5HVHA 3HO1A 3KLFA 3CMES 2DHSA 3C6TA 2XTJP 2EPIA 3UCZP 2DGWA 2XY7A 3JQJA 2AX0A 3WX4A 2J6TA 9RUBA 4TQSA 4B3OB 4DV5J 2E1CA 3M2RB 5KT4A 1CJUA 4P7VA 3PV8A 2DNLA 2JLFA 4A8XA 1BWVA 3I4PA 4C6AA 3GIRA 5D3GA 3BO4A 3K5NA 5SUHA 3DLBA 2CQCA 1IBKJ 3PDNA 4IQMA 3GIJA 2PT0A 4FPRA 1UVIA 2UV8G 3IXQA 2I2YA 2GW8A 1SQEA 4P73A 3LANA 3FK4A 3ZTPA 5GAGU 2KZMA 4NLXA 4IG0B 1KHWA 2UV8A 2DNHA 2OPQA 1EARA 4AL7A 1FKAF 4OYZA 2GQQA 2YTCA 3AA8A 2CNNB 3PX6A 2Y8YA 3I82A 5LSLA 3OVBA 4P6QA 2XS7A 3RBEA 1VBZA 1U09A 1VISA 3ITHB 2KJWA 3UWTA 3NRBA 1UA0A 3EGZA 2CQDA 4O44A 5H9EJ 2BW2A 5A8KA 4F4ZA 4OFZA 3T3FA 1N56A 3DOKB 5HSPA 1EP4A 1KRPA 4PEOA 2XYGB 4W92B 3CJ2A 2BW7A 3MWBA 3PW4A 2QRRA 2QN6B 4URQU 1NZAA 1AFJA 2KN4A 2QSWA 3MD1A 5I42A 4DV7J 1O51A 4M5DB 3TAPA 2J7UA 4KQZA 3MD3A 2C3UA 2H4YB 2BJ1A 1T05B 4C2MA 3PW0A 3M32A 2EKYA 3G8SA 4NASA 4MH8A 4ILRA 1VQMS 2IA0A 4IRKA 4DCJB 4LFAF 3GTYX 4FS2A 2GMJA 4HHUA 2ZITA 3PRBA 4RR5A 2CPJA 2HQGA 1V9OA 3B78A 3IBCB 2FD2A 3MPVA 2VG5B 3W3SA 5B0BA 4WTOB 3J81Y 2GJIA 1WC3A 2CIMA 1VRTA 4J37A 5L9XA 5KFQA 3JYTA 2GVDA 2UUAJ 3IS9B 2L08A 5IS2A 2H3EB 3GIKA 2E5GA 1G7CB 4HH0A 1CJKB 2MQOA 3FBBA 5F9NA 2BJ9A 1WD6A 4KHPJ 4ZKAA 3NL0A 1S72S 3TJ9A 4K4VA 2WSEC 2PEHA 5BR8J 3N01A 4NX9A 3C14B 2WSFC 1AB8A 3AOAA 2V94A 4LF2A 1PYOB 1JLAB 1S0OA 3EDRB 2D3UA 2HBQB 1DARA 2F9DA 1NHKL 1U1OA 1TFWA 2JFDA 4F2RA 2ABYA 4UOCA 3RR7A 2D74B 3CO0P 4A48A 3K8WA 5L39A 2GMHA 1EQMA 2CWXA 2XLJA 1K0TA 2XWYA 2KO1A 3ENAA 1RWKB 5A8RA 2HAFA 1M1GA 1OQ3A 2RDIA 1X4EA 3L95X 4JI4F 4ZLJA 1QVGR 2V67A 2BABA 5DDQC 5J1NA 4JI0J 4DR7F 1BC6A 1U4BA 3CC4S 2FJAB 3ISZA 3U1MA 3BSNA 3BGLA 2MSTA 3ET6B 4ECRA 2P8IA 1FWKA 3ETMA 3H20A 2GVZB 2VH7A 2IC3A 2FGOA 1S0VA 4F4WA 5JJBA 2I0XA 5EDWA 4WU2A 2FDNA 3CCMS 1DFDA 4B17A 1RTHA 2V4RA 2UXBF 1ZAWA 5F3TA 2NR0A 1S10A 5DDOC 4ELVA 5A2QU 2C22A 4X4VA 2ZDOA 2MYFA 3DGPA 3I32A 1DZ5A 2XCPA 2CPEA 5KG1A 1TVRB 1UVMA 3H7HB 3F41A 3CJRA 3NNCA 3D1QA 3FFIB 3T19A 4LF4J 1YQHA 3POTB 5M2UA 4LF5J 1UKUA 2P5VA 4N77A 2JEFA 4W90B 1TL3A 1RHRB 4IQXA 1MWZA 3CE8A 4KT0C 1H3DA 4WYWA 2N7CA 2ZD1B 5B0EA 2E9RX 3DU6A 4OZ3A 1UMJA 3R2CJ 2BXJA 2XZDB 2XMWA 2LEPA 1F3VA 4DN9A 5HANA 3FEXB 2J7KA 4ZLPA 3L4BC 2BQ3A 3DOMA 4CO1A 4U8YA 3EGVA 3GG0A 3RBXA 2E5LJ 2HAIA 2JFKA 1NKEA 2ZVSA 1TR0A 3B82A 2AF6A 1HI1A 1Q82T 4CIOA 1SXLA 3T5KA 4B3TJ 1RAGB 2J0QD 3PYFA 1U1KA 2W9CA 3H2VE 3T41A 1HBOB 1FRJA 1S1WB 2JVRA 5A6PA 5EWGA 3Q86A 1WOSA 1NBEB 2WK4A 4P2SA 2J9DE 1QAXA 1X5SA 2F4VJ 7FDRA 3OQ2A 3K5PA 3S8SA 3CCWA 5K8PA 4DFJA 4J9UE 2AHOB 4MK8A 4H4OB 2CPYA 2EFVA 3UN3A 1RT4A 4E2FB 2FIUA 2HWIA 2ZNYA 4USTA 1L3UA 5KTQA 3CIMA 2R7RA 2B56A 2QL9B 1T7PA 4JYAF 1CBKA 3MEDA 1RHJB 5KFKA 4RW7A 2VOOA 4IOAQ 3R7NB 4A8FA 3LA0A 2EK6A 2K1RA 2W25A 2QMXA 1SUQB 4ZVRB 1P1LA 3IR6B 2IFXA 3G82B 5AJ3J 4DFPA 4URGA 5DRKA 3G2XA 5K20B 3E2EA 2FLPA 4X4QA 3HKZD 1HR0J 4Y2KA 1KHVA 3B8HA 4FNIA 3K7RA 3PIPQ 1JLGA 2LEBA 2VA3A 2JDJA 2ZOFA 3JSBA 3PFEA 3TP2A 4JI8J 4U6PA 1QAYA 3TYTA 2DEJA 1N34F 4RWXA 2WZ1A 4PUOA 5KFIA 3H42A 5EWEA 5D0EA 4ZDNA 4O3SA 3G87A 2NCKL 1HBMA 2L9WA 2UU9F 2R42A 3HHLC 3SDEA 3KWMA 4FYXB 3LO3A 4I69A 3DLHA 1K0VA 6AT1B 2FGCA 4X4TA 3LF0A 2UXCF 4QR0A 5DGBA 1WNEA 1YZ7A 3FBEA 2QMUB 2HHHJ 2CFXA 3R7BB 2GGPB 2GHWA 1S48A 4LRDA 2W1BA 2G9OA 2QFJA 3DRRB 4USWA 2CKWA 2NLWA 1MG7A 4AT1B 3RAXA 1H72C 3JSYA 5AT1B 3LP0A 1T9XA 1WHVA 2OLWA 2RQCA 1DTTB 3ZZ0A 1AZSB 4NA2A 3G6XA 3JTNA 8ATCB 3UCGA 1VR6A 2QIFA 4I2PA 3T1AA 2FC8A 2AJQA 4B02A 2LXFA 4CTAA 3I87A 4C9DA 1YGYA 4Y2CA 3ZZPA 2B5JA 2HHWA 3LALA 1FDAA 3I96A 3KK3B 1U1QA 4MKBA 4OI3A 1X31C 3R3TA 4KGMA 1JLQB 5I4MA 2BRKA 5K5MA 5ETRA 1N5TA 4LMZA 4Z7YA 4WFXA 4YB7A 2HZCA 1IBLF 1FJEB 2Y9HA 3TUPA 4LF7F 2YX7A 3FCHA 3QFHA 3GFXA 1EX8A 3PRVA 1IM4A 1N5YA 1UEKA 2DIVA 4USKA 1ULRA 3PW7A 1TUWA 1R0CB 1X4AA 1YVFA 3E8OA 4DF4A 3IRXA 4OMFG 2MZRA 4ZCIA 5C2GA 2VD3A 1NJIT 3CB4A 4DR3F 4JI6J 3MR3A 1AXQA 3T9NA 3SMZA 3P49B 2E7XA 3EWGA 3QRQA 1HBUB 8RUCA 5G0RB 3NNHA 5CH7B 4KPYA 3AD9C 2B9YA 1RTDA 2MGZA 2KH9A 2BEFA 4ZVOB 3RRGA 4RW4A 4P74A 5A8WA 4CYUA 2FVQA 4PG6A 2DGQA 1Y7PA 3G96A 1IKVB 2U1AA 1UPMB 4LBPA 4OJ3A 2XQCA 4OYIA 2YH1A 5GAEI 4U7CA 4TVAB 1IBCB 3ZTSA 4PWDA 3AXKA 3IM9A 3NS5A 3OD2A 1X7VA 2HBYB 4DR1F 3KLEA 1QSLA 4NLWA 2KYXA 1ZZNA 4QOTA 1U0SA 4DPOA 4UUWA 3EDQB 5H1SV 4DQSA 1PJ7A 3H2UB 4LSZB 1L3VA 2ZH7A 3QGPA 1F9HA 4DF8A 4RUCA 4HACB 1KS2A 5CCMA 3ELHA 3PEHA 4DL0C 1VC6A 1MU2A 1M5SA 3T5HA 1HWKA 4TKTA 1F9EB 2RF2B 4ED7A 1SL2A 3RTVA 2Z56B 3CJTA 1RHMB 3PO4A 4P10A 3DM2B 1S0NA 3WQPA 1G3OA 4F0KA 3VR1A 4N56A 4X65F 5HP1B 4DQQA 1R8BA 5KFCA 5LMNF 4CH1A 4HI2A 4YHHJ 3I0RA 3KLHB 1H0HB 2ZBPA 1LQ9A 3BF4A 4RW6A 2AJ0A 4JP8A 3RW6A 4RZRA 4ILLA 4HDGA 5CQGA 2DH7A 3A8KA 3KJFB 4R0EA 3IBFB 4QWEA 1RBLA 1NHVA 4EYIB 4DV2J 1N6QB 5DZ7A 1M5HA 1NK0A 1NDLA 4R8UB 3GJSB 3L7OA 2XLKA 1E6VA 2HW3A 2PFFB 1M1KT 4RKUC 7FD1A 2IVMA 2RHSB 2BVZA 2VFVA 3KLGB 2C2RA 2G13A 2BE2B 1UEUA 3NGTA 1QDUB 3MR7A 1S1VA 2RQKA 4Y00A 1VC5A 1LW2B 1EKRA 3RUBL 2NUUG 4J9VA 2VPYB 4Y3CA 4TY8B 3IGVA 1U26A 3TR5A 3BV8A 4HTIA 1GXUA 4U7UK 1VQ9S 3P5TL 3CGIA 1C2PA 1LNQA 2O5DA 2V4JB 1FNXH 2BOPA 3W2VB 2XMAA 2APOA 4C8YA 2KM8C 1U1LA 3QO9B 2NXJA 2FPHX 2HGNA 1UFLA 1QD1A 2GJFA 2MY7A 3KFWX 1Q78A 2RVJA 3AFGA 3MURP 3OR2B 4YUDA 2YNGB 4L75A 1TKTB 4RNHA 2C3YA 2KZZA 2QC3A 4DEZA 1DLOB 3GJRB 4DR5F 3V81B 3UR3C 3WBZA 4ED0A 1I5OB 3IRWP 4OZJA 1F2GA 1IR0A 1URNA 3D5MA 1U6BA 5DS7A 1JLFB 3GZ7A 3OUYA 5KT2A 3T1HF 3VGSA 1FJGJ 1SVDA 3CC2S 3SCLE 2R2SA 4CLUA 3EYZA 3C66A 4C11A 4NLPA 2IJRA 2ZKUA 1S9FA 4ZMMA 4LQ3A 2AQ4A 3KLFB 3MPDA 5F0UA 5AE2A 3DRPA 4M5JA 3C6TB 1J5EJ 4F26A 1F5AA 1T9VA 5THWA 4WE1B 4DV4F 2BKNA 1SI9A 2AEFA 5EN1A 1A9NB 3W1YC 2MKSA 4ZPAA 2I9SA 4Q0BA 3R6LB 1CJUB 2DGSA 4MKYA 1R0AA 2HSEB 3H90A 2B3TB 3AQOA 5D3GB 5D77A 5HQ8A 4MK9A 3KJQB 1S1UA 5DQGA 3NOCA 4ZOSA 1HHSA 3HHDA 5L1IA 1EETB 3IMQJ 1YJRA 5ETPA 1T11A 4BLGA 2DY1A 1C0UA 4DV7F 3TEGA 1UL3A 3LGNA 1PAEX 4O3QA 1K1QA 4ECTA 4A8MP 5CAAA 1YRXA 4HH1A 1TZ0A 1VFJA 2DY9A 3F56A 2UUWA 2H54B 1UAWA 1NJWA 3ULHA 4XO0A 1ZAXA 2OPQB 3R5JB 4K5SA 4X66F 2HHVA 4JI7F 4RPFA 4QW8A 3OSPA 3MHYA 1APSA 2L3MA 1PIEA 2XSJA 4JV2A 2KG0A 4DX8H 2KVIA 3SFGA 3ZNJ1 4O44B 3QJPA 2G1DA 2F1FA 5KOXA 4NLVA 5A8KB 2HFSA 3DLLQ 3Q89A 2X7IA 1S5ZA 2UUAF 3L7PA 2R8KA 4C8KA 1KDNA 4CRJA 1U02A 1S1TA 1AUSL 1U1RA 2P9EA 2Q6BA 3Q8UA 5KG4A 5LT5A 3MCSA 2ATLA 5KFNA 2LP4A 3MTJA 2QL7B 1R31A 4KHPF 2W2NP 1WDDA 1SBRA 2GX8A 1TAUA 3M32B 2AIRB 2C2EA 2EBGA 3U1NA 1VBXA 1KOOA 1Q81T 4QW9A 3LUYA 2JOQA 1S9EB 5I3UA 5KFVA 2P9GA 1KTQA 2OPRA 3MR5A 2VF3A 4FBUA 2F4FA 3OHAA 4U9RA 4PKDB 1YJWS 3TQEA 3MM7A 4U95A 2E5JA 1JLBA 4KH0B 3BDPA 4UOHA 1VRTB 1U6FA 3TUJC 1LK5A 2PMWA 2LA6A 1X4FA 4TQRA 2EG1A 1WKKA 3J80Y 1S6UA 4BWMA 5F8MA 5F8HA 1J5OA 3D0GE 4DPWA 1ROFA 3CCSS 1NPKA 4YFUA 2O1PA 1T9YA 4HLBA 2I1RA 3V6JA 1NEEA 4R5PB 2DRAA 2NSBA 4AL6A 4NZ6A 5F3ZA 2RRAA 1EIYB 5GADI 2AYGA 2PN6A 5KFZA 1JKHA 1WF0A 3CCRS 2ZUGA 3PO5A 5BXIA 1FDDA 3D28A 3TUZC 2C28A 3CD5A 2DNYA 4YP3A 3D3BJ 3Q0AA 1NXIA 4RW9A 1UEVA 1TL1B 4NXMF 1N88A 5A8RB 4QYRA 3DDNA 2Z57B 3QIDA 1WF1A 1U8SA 4XAKA 4LSNB 4LF4F 4BS2A 3NNAA 1FRLA 3TX0A 1QE1A 1YHQS 1WSRA 2LXIA 1VLOA 2DH8A 2VIHA 1R6VA 4ZVUB 3K17A 4G1QA 2ZH6A 3W9HA 2NSCA 2M8HA 4X62J 4GKKF 2QO3A 2A2DA 4ZVGA 3C16A 2IC3B 4NWBA 3UN2A 3ONQA 3UD3P 3ISNC 4FXWA 3T6JA 4C7QA 1JJHA 4ALZA 5E3AA 4QWDA 1RTHB 1SL1A 2EC0A 2XMKA 5KT6A 3DGPB 3N6MA 3BZQA 2VJVA 2W24A 1OY8A 3LGHA 4DL5A 3M2UA 4LR9A 1T9TA 2OI2A 1FESA 2KVQE 1ELOA 4FYVB 2QL5B 4J9RA 2ZJQQ 2H5IB 3AJDA 4DCPB 4QQBA 5IWAF 2F3JA 1HPZA 3SIPB 5EGYA 1IQZA 1UVKA 2RKIA 2D41A 2AP6A 2XYPB 1F5CA 5KFPA 2UXDJ 5JMNA 4LF9J 5EX3A 2QLXA 3G8QA 4TLQA 1RT1B 3B4DA 4OI4A 4M5GA 5L1KA 4RJVA 1ZA1B 3KMSA 1CG2A 3TA2A 1P9QC 2HK2A 1VQKS 3DOMB 1XMQF 1FT8A 4NMLA 3M8ZA 4WU3A 4Y65A 2DR8A 3UNYA 2CQPA 1SH2A 3VGVA 2HK3A 2JL9A 2HVEA 3GP9A 1KVJA 4IKAA 3KLVA 4DV1J 2V34A 1FJ7A 2MZJA 1VQNS 3CTRA 3T9ZA 2B8QA 4P9SA 2CPHA 1KONA 3Q2SC 2W9CB 2JVOA 3DYAB 4QU6A 1XJWB 3MMCA 1JXVA 2VG5A 1HA1A 3U02A 3EVOA 4LVNP 4ECQA 4DPXA 1RQ0A 1VQLS 5EUHA 4DQPA 2LYVA 4P72A 2C3PA 1M5KC 2CJYB 2PDAA 1YX2A 1HWUA 2VZ9A 1S79A 3OXLA 1S57A 4TU9A 4QIFA 1WACA 5LJ3Y 1Q95G 1HR0F 4OZNA 2VA2A 1VBYA 4DZDA 2V4QA 4QCLA 4MT1A 4TLRA 3AJ1A 2YX4A 1NH8A 1IBMF 4DV0J 1CLFA 1SJ3P 2XEXA 3MF5A 5LOQA 4ES3A 2RQMA 2CG4A 4IO1A 2BACA 3JB9k 3X3UA 3HFVA 2UVRA 2LMIA 4NLDA 1NNDA 3UE2A 4G3IA 4CLKA 1JLAA 3LGMA 3V6HA 4RW7B 1BY9A 4ETZA 1UETA 3E51A 1NDPA 3QPIA 5IT0A 4QIWD 2C2ZB 4ER8A 2K1RB 4Y34A 1ZPVA 3HT3A 1TAQA 2RDDA 3HM9A 2XI2A 1HNWJ 3NOGA 1KQGB 2NYHA 4ZPDA 1R3NA 3PW5A 2ATCB 2BM0A 1UVNA 4LF6J 5DZ6A 5AXLA 1OPIA 3S1TA 1D09B 1WC6A 4WZQA 3MEEA 3W61A 4F0HA 3ZZYA 1FX2A 2BMBA 3FDSA 1L3TA 4KHRA 3DXSX 4GC7A 2HHHF 2V6AA 3HHLD 3HPOA 1JLGB 1Q86T 2K8GA 3ET6A 2DNNA 3VVTA 1RA6A 4M95A 3LH2S 4EEYA 2F40A 3THPA 4HVZA 3PW2A 2WBMA 2GVZA 4C4WA 4CQ1A 1UWBA 4ID8A 2CXEA 5CYJA 5DQIA 4KB7A 4CH7A 1ITPA 3ENWA 3P4UB 4DOZA 4HKQA 1BWEA 2G4BA 1IKYA 4DV6F 1HBMB 3GJTB 1ZM2A 3KTQA 3L09A 3J7A1 4B3RJ 1F9FA 2DNMA 2HNDB 2X3GA 3SDEB 4DBQA 1NHUA 3PYEA 5KG3A 1FEHA 2HRUA 2XGQA 4K5RA 4WFYA 4IUFA 2CVIA 4ECVA 1W25A 4EO8A 1HNXJ 4I4BA 1TVRA 2KHDA 4Q43A 1N32F 3ZZZA 2W9BA 2HWHA 2CQIA 1FJCA 3AAWB 4ZVHA 4X2BA 3NWRA 1DBDA 3BSCA 2UUCJ 1QSYA 4I1TA 4JI3F 4CLZA 1G6BA 2RD5C 1UVLA 3TZZA 2ZD1A 2B9WA 2LLZA 2PA8D 4PPDA 2KT5A 2ZZNA 1U2FA 4B9TA 2OUGA 3LP0B 4UOFA 1VIXA 4EBCA 2IIHA 4DSFA 5CA5A 1U25A 2EXUA 3BEGB 3I0SA 2ZC4A 4YR0A 4OJ1A 2DGUA 3QSYB 3FNNA 2RMLA 4QJVA 1FEEA 4I2PB 5AXKA 1NAQA 3HHLB 5B7WA 2DIUA 1DTQA 2MZQA 1H38A 3F73A 4N5SA 4H4KA 1UCNA 4CTAB 1YK9A 1NSAA 2IHR1 2B5JB 4IO9Q 1GMVA 2D3OR 2MJNA 2RNEA 3RB0A 2Q43A 4ZCLA 3IWLA 4YMEA 4J90A 2F63A 3CDWA 2HS0A 1GXLA 1HBOA 1S1WA 2DBBA 2YNIA 1VCTA 1ZAVA 1YJUA 1TU0B 2K7JA 5H9FJ 1N5YB 1TL5A 5C24A 1NK5A 4YB6A 1RKJA 3FBCA 3WZ0A 1XR7A 3CXCR 1IKXA 2OEJA 3IRXB 3KHGA 2EK1A 3BM7A 4YN3B 4H4OA 4ZPTR 4GKJF 3PYDA 2WCXA 2B9EA 4DL3A 5T41A 4HHJA 1KTVA 1MROA 3GCXP 3PNIA 1EHWA 2HMIA 3MECA 2QYCA 4NXNJ 4QIEA 4TXSA 2E7VA 4EGLA 3LAKA 1RTDB 2MGZB 4FXVA 3WC2A 4XDDA 4RW4B 5A8WB 1HNZJ 4CYUB 3EUNA 4H54A 2VBXA 4PG4A 2AKWB 4F4XA 4XIUA 4WCEQ 2J0XA 1FCAA 2DHAA 3THTA 4A4JA 4PWDB 1P27B 2OFHX 4NZ0A 4Z7CA 5F8LA 5IXUA 2KRRA 1RBAA 2HQ3A 4P75A 3J7YI 3KLEB 2E7WA 2B6AA 2WAQD 3L9ZA 4UTGA 1WF2A 2YPYA 2HVHA 4YDDB 4ED1A 1SUQA 5FDLB 2MZTA 2GQCA 3G82A 1FDBA 3FKBA 1OSDA 3UDEA 2R9LA 3BKUA 1Q53A 4LFCF 4ZJLA 2Y1RI 3OFGA 2YXLA 3CJSA 4WK3A 3WX8A 4RBVA 2ZBIA 1SJ1A 3VV2B 4FYYB 3PVXA 4A8QA 2V8DA 4DV2F 1MU2B 1KC8T 4J9PA 3OFHA 4NEZA 1H2TZ 2YWWA 1NLKL 2YQ3A 3O3LA 3L7UA 4Q2LA 3VAIA 1S1XA 1R27B 2QLFB 3O2IA 1HBNA 2W8KA 2K06A 1BQXA 4LBHA 2IM3A 3B54A 1S97A 4N76A 3OL6A 2BQUA 2KB2A 2CQGA 2M52A 1GMUA 3BBCA 1FTRA 1U24A 5IFMA 4PPZA 4ANDA 2RB7A 2F5GA 2LVWA 2MKYA 3Q24A 3DI6A 2JWNA 2Y3YA 3ZXWA 4O3RA 1PKUA 4RW6B 2VPXB 4ZK7M 5ETLA 3HCXA 1TK5A 1WTFA 5ETKA 2OO4A 1GTHA 4DN0A 2AGPA 1X0PA 4A8OA 3EMTA 4YR3A 1F5BA 4YOEA 3C2PA 4L76A 2EFPA 1Q8IA 3DRRA 2RILA 2ILZA 3FRYA 4USHA 5F8GA 4JUZA 2DO0A 1S4FA 1E6VB 1CEZA 4OHXA 3IM8A 3OV7A 2DGVA 4OZ0A 3DC2A 5J1PA 1X4GA 1UWAA 3R5AA 1S1VB 1N48A 4OX8A 1Y3JA 4CM0A 4OZLA 2XC9A 1T9UA 1I51B 4EWTA 2E5HA 1WC5A 1HL6A 3PJ9A 1RWWB 3DOLA 2ASYA 3MAQA 1F6TA 3M8SA 1BQMA 2ZBCA 1K9MT 3HVRA 2IRXA 2DR6A 4DQIA 5E33A 3TAQA 4B3MJ 3W8GA 1KR4A 3AOCA 2Y0SD 5KFGA 2DNKA 3VAFA 4KSEB 4DR6J 1XMOF 2AV5A 4J9QA 1SKUB 1D8ZA 5HAOA 2OKQA 4LRAA 4LREA 1GK8A 2V5HG 3MXHP 3PR5B 1SC1B 4WFZA 2WTFA 1S76D 3MM8A 4PG8A 4WP8A 1F3FA 2XULA 3QGIA 4KJIA 4HEA9 1HBUA 1PYSB 4UY8T 5G0RA 1NRKA 2ZWPA 2EC2A 1KEKA 5D8HB 2PE8A 3MPUB 3Q8PB 2Y0BB 4JI1J 5A0YB 1UJ5A 3I9V9 3DMJA 3PX0A 3U7JA 4DWIA 2OTJS 5EHHA 2QG9B 3D68A 3H40A 1WI6A 2A1BA 2R2TA 4IFVA 5E7OB 1VQ7S 3OUYB 1FTCA 1YWXA 3VAHA 4RX6A 1R8CA 2QV6A 4F02A 1HKAA 2AEMA 3BKTA 4B08A 1RACB 2J9DA 3QNWB 2PFDA 5CABA 4P2XA 1NJXA 1FFSB 3FCWA 2HGLA 3DRPB 1CJTA 2LECA 1HLWA 2DEIA 2VBZA 1FERA 4ZIVA 2NXCA 1ZM3A 4HACA 1RTZA 2JLGA 4WFAQ 1HNVA 1N5VA 3CT9A 3HJFA 2BKPA 5KG7A 4LSLA 2J76E 4Q0BB 5F8IA 1ZETA 5KFDA 2GAHC 1R0AB 1TP7A 3JAMU 3QATA 1M5OC 2RF2A 5KT5A 3BR9A 1S1UB 1YRUA 4OYWA 3Q23A 4ZS6A 1S9GB 2ZH4A 3NGRA 2MXYA 4O0IA 2DITA 2ASLA 2V9WA 1ZOTA 1EAYC 2YH0A 1MMLA 3M30A 4UQGA 3RB4A 1C0UB 3FSYA 4NLTA 1XN9A 1DQAA 2N82B 1LKZA 3IR7B 1U6ZA 3CDEA 3QT6A 1GQEA 2VFTA 3JS9A 3Q83A 4WKYA 4PYDA 1GX6A 2HS3A 3ENQA 4N47A 4OX6A 3SI8A 3KLHA 1R43A 4DSEA 3TQ1A 3K2YA 3TX8A 4E98A 1MN7A 2MLXA 5HBMA 1Y4ZB 1RCOB 1JJ4A 2XSJB 2OMLA 4F2SA 1B64A 1LEOA 1IKWA 2YVSA 3HMJG 4XK8C 3OXFA 1N6QA 2HBZB 2MKHA 3P96A 3CW2C 1Y5NB 5IT9U 4L73A 3NLCA 3KUGA 5J2QA 1RAJA 2G0CA 3EM1A 1S1TB 3O6QA 1VRQC 4N8NA 2KFYA 1OY9A 3NCRA 3EGWB 4ECYA 1OO0B 3CNQP 1S59A 3MAHA 3ZTOA 2V2KA 2ZVIA 3GV8B 2MJUA 3FZ2A 2YKOA 1BUXA 2RU9A 3A1YG 3HULA 4DPUA 5I3UB 2OPRB 3FC9A 2ZHAA 2N7YA 4ZVQB 4ZP9A 1Z1ZA 2CJBA 2ALZA 4QU7A 4NMXA 2YWEA 1WELA 4ZJQA 3D2WA 2V4JA 4JI5F 2P6TA 4JI2J 3I4HX 3MM7B 3MM6A 2PEBA 1JLBB 2HVDA 4OYPA 3DRSA 4Q44A 5J2NA 1N5QA 1RU1A 4RBUA 4NE9C 2U2FA 5DJBA 5FIIA 4OX9J 2Y8WA 2GNKA 1KFSA 2EFGA 2GHVC 4CO0A 2VJUA 4X4OA 1S6PB 1RKIA 4RLEA 1XNQF 4K2XA 3K57A 1CVJA 2KXNB 5KFMA 1DLOA 2HRYA 1MNEA 3P6YC 3V81A 5GAHU 5DLFA 3S7RA 3JTOA 3C6UB 2LU1A 4BWJA 2LEAA 4EUVA 2ZZTA 3U27A 1B7YB 2A6MA 4MKAA 3PG9A 2OFGX 3KDNA 3CCVS 4FVMA 1S49A 4C8ZA 3PRDA 1JLFA 4B9MA 1JKHB 2FVRA 4WXOA 4F3QA 3UDCA 1RZMA 4PXCA 3TZYA 2HZVA 5GAGI 3G9CA 4G6VB 2NYIA 3K5OA 1NK6A 3RAQA 3HDSA 1RTJA 4RW9B 1QLNA 5E2QA 1A6LA 3M2VB 2M9KA 1YZ6A 2UVWA 1H73A 3TVYA 2HLUA 4QWBA 1Y00A 3CMAS 1KP6A 3ISND 3R7SB 3PJXA 3S01A 4F4YA 2R7SA 4U96A 2LKZA 3WDOA 3D4JA 1QE1B 2AWZA 1CJVA 4WE1A 2DH9A 1V6HA 2VDIA 4OYOA 3MR2A 1NJZA 4CM2A 4G1QB 1F60B 1WKLA 2V8VA 1NO8A 4KR0B 3C16B 4ETXA 2W2OP 3QT7A 3GILA 3JXOA 4LF9F 3H5SA 2BJ8A 3NWGA 4CLFA 4F50A 4HL9A 4YR2A 1EETA 1FNMA 4OJHA 4KTQA 4K4YA 3D1OA 2Y1JA 2BM1A 4CLSA 2DTJA 2ZM6J 4KFBA 2NQPA 3UR0A 5HJXA 1FXLA 2A10A 5A6WA 1QTMA 3QGHA 2NUHA 2IDEA 3UO0A 3M2UB 1JB0C 3H5YA 3BO2A 3SV4A 2VPZB 3HSZA 2DRBA 2XS5A 2JC1A 2MLZA 4IG3A 1FDNA 2BBEA 1CS4B 2ZDPA 2I5JA 2MQMA 4C3KA 3D6FB 2JSXA 2FYXA 1HPZB 2AGQA 5KFYA 4QIVA 4LFAJ 3Q8QB 3P5BP 2RKIB 3S6EA 3W64A 4IRDA 1SJRA 2BANA 1VMBA 3TJAA 2MB0B 5A2QY 1HHTP 3CCJS 4UZBA 3KKFA 5HQLA 4BC9A 2ZE2A 1QTNB 3VQTA 4DFKA 5IV3A 4UOGA 4DV0F 5D4NA 4ZVTB 5CD4H 2RDJA 3UNGC 1BMQB 5L46A 2AJ1A 3Q8VA 2MTLA 2WW8A 1S9EA 1KOHA 3MAAA 3MFIA 2D1CA 2RU3A 1RWMB 5M2PA 3RB6A 1NK4A 3ZTRA 2HLTA 4NLSA 4CO5A 3T6BA 3LWMA 1WOOA 3MMCB 3KUHA 2J0WA 3DGVA 3M8WA 1FVSA 1XEZA 5J2PA 2VHGA 1SH3A 4KIAA 2KXHA 1HNWF 4JV5J 3PZPA 2PO4A 1J27A 2HZAA 3OLAA 3O1LA 3SSQA 4AXJA 2KL8A 3BKFA 2KDOA 3C46A 2FVSA 2FJEB 1F1BB 2IYIA 4FDFA 5FLXU 2CZVC 4GVBA 2V68A 4FVCA 2HVZA 4JI4J 1M5VC 3VAMA 4R5PA 2OPSA 5J1EA 2CUYA 3R97A 3TRGA 2DR7A 1K8AT 4DR7J 4FF1A 2DNOA 4M1KA 1RADB 5K14A 1HD0A 3QYYA 2LXUA 3CDAA 3HXMA 2FC9A 1LXJA 1RWUA 5HO4A 1S77D 2ADBA 3I5CA 2BKOA 5IC6B 4MTPA 1S6OA 1HNXF 1TL1A 3OSNA 5T7LA 3BQ1A 2HYIB 4O23A 2CQ3A 3DLKB 2BA9A 3MEEB 2UXBJ 1GT8A 4LSNA 2HWTA 2M5YA 1FRIA 2XHCA 1ZA2B 2OEKA 1TUGB 3R1LA 1JLEB 4PXEA 3RU0A 2P9CA 2VB6A 2R7VA 5ETOA 2R7OA 3KUEA 2W2PP 2J9CA 2BV3A 2MZ1A 3GYGA 1UWBB 1EJ7L 1BXNA 3KJVA 2OPPA 4J9SA 4YDXA 3MDFA 1IKYB 4KGKA 3WHIA 4B3SF 2XMJA 5ETNA 2XO7A 4X4RA 1S7IA 2OSQA 1ZM9A 4WYLA 3KXDA 2DO4A 3AHPA 4QYZJ 1OS5A 2AU0A 2PC6A 3GPAA 1VRUA 4GVLA 5C42A 1WHXA 4O3OA 2BDPA 2UVUA 4IR1A 3LPEA 4WK1A 2W9BB 1JNZB 4DU8A 1D1UA 3MGJA 4PYAA 1WEXA 4LT6A 4ZITA 1RAOA 4A8KA 5KT3A 3VCDA 1FRMA 4WKRA 2EEYA 5D0RA 2Z2LA 3BSAA 3CULA 3FSIA 3N6NA 1RTIA 2ERRA 3I0SB 1RT1A 1PCAA 2UUTA 4OYMA 3RYLA 4EZ9A 3TEHB 4J9KA 3BGRA 3HLUA 5C5JA 2GC8A 1PBAA 2CQ0A 4K59A 5IOLA 1DTQB 3H8YA 3R5CA 5D78A 4NXNF 2POKA 3SFUA 5AXNA 4F4KA 1HNZF 3K5LA 5BYSA 6FDRA 4USMA 2AYEA 4IDKA 1BQNA 3DYAA 3NP5A 2W4DA 4UZCA 2MHNA 1WG1A 5DLGA 2NXEA 2RS8A 4O0NA 5AE3A 2YNIB 3EZOA 2R7UA 3R9LA 3MZIA 2AZ3A 2XNRA 1HNIB 5C24B 2CPXA 3LQVA 2OSRA 1IKXB 4AFFA 4OZ2A 1RISA 2AJ2A 4OV6A 1UW9A 1NDKA 4Q7AA 4LQ9A 4ZVSB 3QGGA 3HHEA 1MROB 1WEZA 3EE3A 4V19X 1HQUA 3R27A 2HMIB 3MECB 1U48A 2BJ3A 1RLCL 5LSOA 2W7PA 4C0BA 2J5AA 2WB1D 3QIPA 5IQQA 1LWCA 4Y28C 2W2QP 2BQRA 2YY3A 3M6XA 3M7VA 3GV5B 1NSPA 3AY0A 4C98A 1T3NA 2VG7A 3GONA 2MHEA 2B6AB 1N34J 4D3HA 2X1GA 1RT6A 2DNQA 1HW9A 3CSKA 4X4PA 1K47A 1IR2A 4M5KA 4ED4A 3M05A 1P6TA 1C4AA 2ROGA 2E1AA 3BREA 1LWFA 2ZHBA 5LSRA 4O4GA 3UD5A 3D0HE 2EW9A 2E5IA 3RRKA 4UF4A 4XDCA 4Q45A 4EZ6A 3HX9A 3W2WA 2HFNA 3WIVA 1X0FA 4TU8A 1VQ5S 4U7UD 2GO9A 3QQCD 1TUVA 2MKIA 4FS1A 3AT1B 2IY5B 2C3OA 1NZ8A 3CD7A 1S1XB 4ED8A 1GXTA 4CO2A 4DUZJ 1HBNB 4GO7X 2P2CB 5LL6d 4P71A 1VS3A 4ELUA 1LXNA 2KFNA 2I6WA 2KRBA 4C8OA 2DGTA 1H2UX 2HNDA 1O0PA 1Y11A 1VC0A 1TKXA 2CVEA 2V8HA 2VUGA 4F3MA 2P6SA 2F8MA 4LFBJ 2HHSA 1HIYA 3CJ4A 1VQYA 5ETMA 3FSXA 2R3VA 2DHHA 2OD4A 3DI6B 2VBYA 5DM6Q 3MEGA 2GS8A 3A8EA 3NCQA 3U1LA 2XB2D 4ANCA 1KVIA 5DETA 4J91A 3CJ0A 1BHNA 1RT7A 2HNYA 3GIMA 3ADAC 1T9WA 3MUTP 1ZTWA 2FY1A 1ZBTA 2WVCA 1WTBA 4KKOA 4C3MA 3RR8A 4E0DA 1O6XA 3NGKA 5IM0B 1RUSA 2QE5A 4PZVA 1KQFB 4OZ1A 3HZGA 1UZHA 3B4MA 1IBLJ 3GYNA 4LF7J 3HHLA 3WC0A 2GMLA 2WHOA 3G4SS 3QAUA 4JI1F 3DOLB 4RU9A 2QZ8A 2JH3A 4NCGA 4TYAA 2E1PA 1AFIA 1U0HA 4DX5A 4HR2A 1RWPB 1BQMB 4AUKA 5FJ4A 3FUYA 5ITHA 3EPIA 2YKAA 4DR3J 2K3KA 2V0NA 3I31A 2FHMA 2OGUA 3EZ5A 1I6JA 1U47A 4CNZA 1B3TA 1SKWA 1UFWA 4UQTA 3W9IA 3VZHA 1QUVA 2QA4G 5HLFA 2ZOGA 1YI2S 4N7TA 4D3GA 4RNMA 1QAJA 2LQBA 3OPKA 1D0EA 3OTDA 3MM8B 5LXRA 2C2MB 1JLCB 3N79A 3PTWA 2WVEA 2IRUA 2ZC3A 3MMBA 1ICEB 3RZAA 5HQMA 1UJ6A 1RT5A 4CP5A 1V3RA 3I5BA 3DMJB 3BSOA 3QT5A 1CQMA 4KRWA 3G86A 4K4ZA 1RHQB 2CQBA 3H25A 2DNGA 4IFVB 2KG1A 4ES2A 1TV6A 4MAKA 4QIGA 4XTTA 5E3PA 4I67A 2AMCB 3TNVA 4CLYA 1SC3B 4I6YA 1PILA 3BO3A 4ZA1A 2CPFA 5CXTA 4C8MA 3OJUA 5L9NA 5FDLA 2GIFA 2NZ4A 2ZHOA 1CJTB 3EX7B 1YBUA 1FA0A 1BGXT 3VAKA 4X4SA 3ILLA 1V3SA 1QJHA 1OMSA 2RT3A 4FF4A 1RBOB 1G4CA 4ERDA 1HNVB 2CNLB 4X65J 1UZDA 4YEAA 4K4TA 4LSLB 4JV0A 2BUNA 1Q0NA 2JHEA 2IM2A 2FHJD 2WOMB 2CDRB 2J6SA 1TL4A 5HMWA 2D7SA 2QFIA 1HI8A 4KV8A 3G6VA 3M30B 3KK1B 2L41A 1FXRA 1RT3A 1Y9OA 3SQOP 5KFLA 3N5BA 2XGPA 2XCAA 2A18A 5D0GA 2EI5A 3W7BA 3OFFA 2BOAA 4BC7A 3IAS9 1XQIA 1I94F 5HBMB 3TVKA 3VVUA 3IA0A 2OHDA 4DHVA 4NLOA 2VFUA 3FZBA 4DV3F 4B9SA 3NS7B 5EX0A 1IKWB 2X51A 5B0FA 4JI2F 3MMJA 3PIOQ 3ZC4A 1X60A 4EYHB 2YX1A 5KFBA 4KPCA 2EVZA 4L3NA 2EFOA 3H4BA 1JK9B 1KVKA 5J2QB 1W2IA 4OX9F 2FHKA 3H5UA 5LM7E 5LJ5Y 3T1YJ 2ZH5A 5DGAA 3NY0A 1H7WA 1TELA 3JQMA 5IV4A 1NB7A 1XNRF 3BN4A 4QBUA 3N5FA 3NGSA 1MWYA 2UUBJ 3QZ8A 4ZPWR 3C3LA 1G1XA 4K50A 1AT1B 1OQ6A 3W5YA 2HKEA 5L1JA 1V5IB 4Q2MA 1HW8A 1R8HA 5H9EK 4DR2F 4RNNA 2K2PA 2W9AA 1FRHA 2NZCA 1PG5B 3OXGA 4ZVFA 3BN7A 2G2ZA 4OL8A 3K0JA 4DR5J 3MR6A 2HBRB 2RS2A 3CJKA 1NSKL 3MM6B 5KG5A 3DRSB 4IFYA 5J2NB 3CDBA 2ZBRA 1VQOS 5LMUJ 2RAQA 4PQUA 3QZ7A 3T1HJ 2R8IA 3CO9A 1KLMA 3CCTA 3EICA 3NAHA 5KFRA 4DV5F 3HZEA 3ZNUA 3VGUA 2L48A 1M0SA 2DPJA 1HI0P 4J7CA 1WG5A 2H1YA 2CYYA 4UY85 2VQFJ 4NOHA 5A0YA 4F36A 4NZ7A 1JQGA 1R8AA 1NSQA 3NCPA 2B7CB 2R8GA 1IBKF 3PM9A 2N3LA 5HMZA 4QPTA 3IGNA 3ZTQA 2YNHA 3NG8A 4DV4J 1YJVA 2W2MP 4C3LA 3TO8A 2ZM6F 2H4WB 3DN9A 4USIA
chains in the Genus database with same CATH topology
3MAQA 4V19J 1XC9A 5E3CA 1RTJB 1HBMA 2MSSA 2L9WA 4IOBA 3M8SA 2J6UA 2JZ5A 2UU9F 1BQMA 2ZBCA 3IWNC 1K9MT 3HVRA 3HHLC 1VK3A 1IUJA 2IRXA 3SDEA 4DQIA 5E33A 2RSQA 3KWMA 4OQJA 3IBWA 3TAQA 3BDEA 3LO3A 5T14A 4ED6A 5HROB 1KR4A 4I69A 2XNQA 1T02A 2Y0SD 1Q4RA 3MEDB 3V5RA 3DLHA 5E3QA 3GIIA 2DGOA 1K0VA 2UZAA 5KFGA 2XY6A 2DNKA 4DS5A 1HWIA 1S99A 2FGCA 4X4TA 3Q8RB 3LF0A 2LQ5A 3VAFA 4KSEB 1I1GA 4TY9A 3M9NB 2CJQA 2RRNA 1XMOF 2AV5A 2UXCF 4QR0A 1U7LA 4J9QA 3K8VA 4QR1A 3AQPA 3RW7A 1D8ZA 4EO6A 2VFSA 2R7TA 5DGBA 3HHNB 5L1LA 2QT7A 4C8LA 1C0TA 2OKQA 1WNEA 2ROPA 1IQTA 2V5HG 3M8PB 3MXHP 3PR5B 2CFXA 2GGPB 1K1SA 5KOWA 4WFZA 1IN0A 2GHWA 1S48A 1S9GA 1Z2ZA 4NLRA 4USJC 2WTFA 3MM8A 1S76D 2KT2A 2R2RA 3FJ2A 3OL8A 2G9OA 4PG8A 2QFJA 1GNKA 2M7SA 3DRRB 2XULA 2D9PA 2CKWA 3QGIA 2NLWA 4KJIA 4HEA9 1L3SA 3RAXA 1HBUA 2B9XA 2DT9A 3GYXB 3JSYA 3MM5B 5G0RA 4UY8T 3LP0A 2W4CA 1LFWA 1NRKA 1WHVA 2OLWA 3SSRA 1KEKA 2R8JA 2E1MC 2RQCA 5D8HB 4KFBB 2PE8A 3LP2A 4F8RA 1DTTB 3Q8PB 1GTEA 2FVPA 2AJFE 5BJRA 3ZZ0A 5A0YB 1UJ5A 3I9V9 4NA2A 3M6VA 3M9MB 3G6XA 3DMJA 1J2VA 3JTNA 2R2UA 3PX0A 3UCGA 1C1CA 3U7JA 1TKDA 4DWIA 2OTJS 2CQ2A 4X4VA 5KFHA 5EHHA 2KU7A 3CDUA 2XY5A 2QIFA 3SCKE 2HNZB 4U67Q 4I2PA 2I38A 4I68A 3H40A 2R7QA 1NK9A 2IMWP 1WI6A 3T1AA 2A1BA 2R2TA 4IFVA 2FC8A 5E7OB 1VQ7S 2AJQA 3OUYB 3G8TA 1FTCA 1DRZA 4PXDA 1YWXA 4B02A 3BR8A 3M8QA 4LIWA 4DFMA 3VAHA 1U1MA 2HFZA 4ZHRA 2UVVA 4RX6A 2YKPA 1XMBA 2LXFA 4PUOB 3OLBA 1R8CA 2QV6A 4CTAA 3DFEA 3I87A 4J5OA 4LF6F 4F02A 4C9DA 1YGYA 4Y2CA 3NGDA 4IG3B 2B5JA 3ZZPA 2HHWA 3LALA 1FDAA 5D4LA 4B08A 3N9UC 3I96A 4RBTA 2J9DA 2CRLA 1ZH5A 3KK3B 2I5JB 1SV5B 4I2QB 1QUPA 1VQ4S 2IBOA 1NJXA 2JC0A 2X1AA 4MKBA 1U1QA 3MTKA 4OI3A 2VV5A 2JX2A 3R3TA 2HGLA 4KGMA 1JLQB 5E3RA 3DRPB 5I4MA 3TAMB 2LECA 1KLNA 4A8YA 5IZHA 5GVQA 2BRKA 4H4KC 5K5MA 4JV5F 4MJKA 2N4DA 2HHTA 1N5TA 2MKKA 4LMZA 4WFXA 4YB7A 2VBZA