4MFBB

Crystal structure of hiv-1 reverse transcriptase in complex with 8-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)indolizine-2-carbonitrile (jlj555), a non-nucleoside inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
425
structure length
413
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Picomolar Inhibitors of HIV Reverse Transcriptase Featuring Bicyclic Replacement of a Cyanovinylphenyl Group.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 101
structure length 413
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4mfbB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4mfbB03
1EETA 4R8UB 4Q43A 1DTTA 2AGQA 1FK9B 1HPZB 4WE1B 1S10A 2IAJA 4MIAA 3IRXA 1C1BB 2W9BB 4RW8A 2C28A 5C5JA 4I2PA 3JYTA 2OPSA 5EWFA 3DMJB 3MECB 3QLHB 1J5OA 4DEZA 3UPFA 2D7SA 1T03B 1NHUA 3MFHA 1KHWA 2YNGA 1TL3A 2V0NA 2VG5A 5J2MA 3NAIA 4DL3A 5KFSA 3VQSA 1RTJB 4RW4A 1RT5B 4R8UA 3OLAA 4NRTA 4K4ZA 1JX4A 2RDIA 4K4VA 1QE1B 4M95A 1FK9A 1HPZA 4WE1A 3I5CA 2VG6B 3CDWA 2WTFA 2GC8A 1C1BA 3V81B 4R0EA 2W9BA 4KKOB 3SFUA 2W9CB 1GX5A 5DG9A 3H40A 5C25B 2I1RA 3DMJA 2C2DA 2BR0A 3MECA 3QLHA 2AWZA 4RNHA 1S4FA 3OL9A 4K4YA 4WXWA 4WFZA 1T03A 5KFJA 4RUAA 3DOKB 3GIIA 3GV8B 4ECTA 4NLVA 4O3RA 1FKOB 3BSCA 2OPQB 4IRDA 1RTJA 2WOMB 1RT5A 3CDUA 4KBIA 3HVAA 5L1IA 1S49A 5KFRA 2DPIA 4Q44A 1QE1A 1RTHB 3FSIA 4ID5B 4Y2AA 4ZPCA 2VG6A 2BRKA 5F8NA 4NCGB 3V81A 1HYSB 2C2EA 4IG3B 4KKOA 5J2PB 2W9CA 1HQEB 1TVRB 2I5JB 5C25A 4ED6A 2B43A 4KHRA 5KFVA 3GILA 4J9MA 5KFWA 2ASLA 4IRKA 3HVWA 1JKHB 2AU0A 5F9NA 3CJ0A 1S0OA 3RBDA 3DOKA 5I42B 1KHVA 3T19A 3BSNA 1SH0A 1XR6A 3KK3B 4NLYA 1FKOA 2JLEA 4NYZA 4NLRA 2OPQA 5K14B 3H5UA 3LP0B 3Q8RB 1S97A 2WOMA 1S1XB 4ZP6A 4F4ZA 4FS1A 1RTHA 4ID5A 4NLSA 5HROB 3MEDB 2FLNA 1SV5B 4NCGA 1HYSA 4ZMMA 4IG3A 4RW6B 5J2PA 3PW7A 3N6NA 1HQEA 1TVRA 2I5JA 4WXOA 1S0NA 1SH3A 4QWBA 3OSNA 4EBDA 4O44B 3PJWA 1WNEA 2FVCA 4LQ3A 5KFGA 5KG5A 1JKHA 3KLIB 5L1LA 3KJVB 1N56A 1LWEB 5KFAA 3GQCA 2HNDB 5I42A 5KFQA 1RYSA 2WCXA 4EBEA 1W25A 5DLGA 3PW2A 3OL7A 4G3IA 3KK3A 5F8GA 5K14A 3MEEB 3LP0A 1OS5A 5KFHA 4EBCA 1S1XA 4Q0BB 2HNZB 3DI6B 4J9KA 2ASDA 1S1VB 1NHVA 2BANB 4DL7A 2IM0A 5HROA 3MEDA 3GV5B 1SV5A 3LP1B 5HLFB 1D1UA 4RZRA 2W7PA 3EPGA 4O3PA 4RW6A 4ECRA 2RF2B 3I0SB 4O4RA 4O44A 4NRUA 1RYRA 1HNVB 3NMAA 4KO0B 1S9FA 3MR2A 2FLPA 1TL1B 4RW9B 3CJ4A 3KLIA 1REVB 1C0TB 3KJVA 1TP7A 3OHAA 4MK8A 1LWEA 3OHBA 1LW2B 2HNDA 4IDKB 1RT6B 3CO9A 2IA6A 4G1QB 3T5JA 2W9AA 4U7CA 1GX6A 3MEEA 1T94A 4Y3CA 4Q0BA 2HNZA 3DI6A 1JLBB 4ICLB 1S1VA 3ICLA 2BANA 1BQMB 1RA7A 5EUHA 4ECZA 1T05B 3KHLA 1RT4B 4IOBA 3KLEB 2XCAA 3LP1A 5HLFA 4OL8A 2HAIA 3M8PB 4NLDA 4DL4A 2C22A 2RF2A 3I0SA 1ZTWA 4K4WA 4EYIB 1HNVA 4KO0A 1S9EB 4EO6A 4ECYA 2WRMA 1TL1A 4RW9A 2UVUA 4JV2A 3I0RB 1REVA 4QPXA 1C0TA 4YQWA 2R2RA 3OSPA 1VRTB 4ZPAA 1LW2A 4IDKA 4TY8B 1RT6A 4F4YA 4O3OA 3G6VA 4Q8FA 3HVTB 4G1QA 2HMIB 3FRZA 3UDLA 4EYHB 3V6JA 4FBTA 4DL5A 4JV0A 3IGVA 3GV7B 3RBEA 2AGPA 1LWCB 4ICLA 1JLBA 1U09A 3NAHA 5KFLA 5KG4A 1BQMA 3GIKA 5F9LA 2J6SA 1T05A 2FLLA 4NLOA 1RT4A 4TY9A 3KLEA 1S1TB 4IFVB 4ZHRB 4MK7A 4M94A 3SI8A 1RA6A 4RU9A 1MU2B 3M8PA 3H2LA 5KG0A 4F4WA 3MEGB 2DPJA 5KT2A 4URSA 4EEYA 5DGAA 4IR9A 1S9EA 1UWBB 1QAIA 3QGGA 4H4MB 4TLRA 3KHGA 3I0RA 4WFXA 4XPCA 5DG8A 3D28A 4JV1A 3V6DB 1VRTA 1RT3B 1XR7A 3HHKA 4TY8A 5KG7A 4ECUA 3MFIA 4ED0A 2WK4A 3HVTA 2R8KA 1JLGB 3C6TB 2BE2B 4R5PB 1HARA 2HMIA 2XI2A 3CDEA 3UQSA 1IM4A 3RAXA 1JXLA 5FDLB 5KT3A 4IH6A 2D3UA 1LWCA 1SH2A 3QIDA 2V4RA 3RB6A 4ED1A 5C24B 2C2RA 2YKMB 2R2UA 2BQUA 1S1TA 4IFVA 4ZHRA 1TKXB 3V4IB 3NBPB 2IM3A 1MU2A 3PHEA 4I7FB 3FFIB 2CKWA 1CSJA 3KMSA 3MEGA 3DLKB 4LSLB 5DGBA 1UWBA 2XCPA 3MR5A 2V4QA 1TQLA 4H4MA 4XO0A 4TQSA 2VG7B 3DYAB 2IJFA 2HWHA 3V6DA 1RT3A 2OPRB 3I5AA 4NLTA 2R8GA 1JLQB 5C42B 3H59A 4H4OB 3H4DA 2J6UA 1JLGA 3C6TA 2BE2A 4R5PA 2W7OA 2UVRA 3PZPA 5FDLA 5KG1A 4ZP8A 5KFDA 2IBKA 2YNHB 1I6JA 3BJYA 3QZ7A 3GIMA 5C24A 5KT7A 2YKMA 2GIRA 4TXSA 2AQ4A 2E9RX 1TKXA 1IKYB 1K1QA 4KAIA 3V4IA 5KFPA 3TQ1A 3NBPA 5KG3A 3LP2B 2AX1A 4I7FA 3FFIA 3T1AA 3DRRB 5EWGA 4IQXA 3DLKA 4LSLA 3QGIA 5KFZA 5KFKA 4RNOA 1LW0B 1TV6B 2OH2A 5F8MA 4EO8A 2VG7A 3DYAA 5CYMB 4J9SA 2JEGA 4RNMA 2OPRA 3M9NB 4ECXA 1JLQA 5C42A 4H4OA 2QE5A 4ED7A 3OLBA 4ECWA 2ALZA 2JEJA 4WFYA 1YVFA 4WYLA 3DLGB 3G86A 2XGQA 1R0AB 3E01B 2AGOA 4Q8EA 3OL6A 4O4GB 2IM2A 3QYYA 2YNHA 3DM2B 1RTIB 4WYWA 2W8KA 4TYAA 3BQ0A 1FKPB 2HNYB 2WONB 2BQRA 1IKYA 4QWDA 1RAJA 3E51A 2J6TA 4NLUA 4KFBB 3LP2A 3OL8A 3RB0A 3DRRA 4KHMA 2B5JB 1LW0A 3ITHB 5J1EB 1TV6A 2XWYA 1S9GB 4YR2A 2YNFB 5CYMA 4XPEA 5D3GB 3DDKA 5F8IA 1RT7B 3D5MA 2VA3A 3H98A 3KOAA 2UVWA 4DL6A 4X2BA 4GC7A 3QGHA 3DLGA 1IKWB 3PVXA 1R0AA 2JC1A 5F8LA 3E01A 2AX0A 1RTDB 3H5YA 4F4XA 4NLQA 4O4GA 2ATLA 2HWIA 1QAJA 3DM2A 1RTIA 3LAMA 1FKPA 2HNYA 2R2TA 5J2QB 2W8LA 4IFYB 4K4XA 1HNIB 2WONA 5J2NB 3CIZA 4DG1B 3V6KA 3KNAA 5KFFA 3LANA 5HBMB 1C2PA 4KFBA 4KE5A 1MMLA 3SFGA 1JLEB 4J9RA 2IMWP 4K4SA 4ED8A 2ZD1B 3MR6A 2B5JA 2FVPA 3ITHA 2E9ZA 5J1EA 5HP1B 2R8HA 4IRCA 1S9GA 1JLFB 2D3ZA 4ZVFA 4K4UA 5KFEA 3N6LA 2YNFA 1BQNB 3IN5A 5D3GA 2JEIA 4Q45A 1RT7A 4QWEA 3BQ1A 4ZP7A 2IC3B 1RT2B 2IM1A 4ZPDA 1IKWA 3BREA 1N4LA 3G6XA 1RTDA 3PR5B 3KK2B 2YKNB 3PR4A 5F8HA 5J2QA 5DG7A 4TQRA 4IFYA 2OPPB 1HNIA 5J2NA 2JEFA 3RB4A 4DG1A 4MH8A 3QZ8A 5HBMA 2RKIB 5KFCA 1VRUB 1JLEA 4K4TA 4URGA 2ZD1A 1N48A 3DRSB 1EP4B 3M8QB 5EDWA 4DL2A 3BSOA 3T5LA 1S0MA 3DOLB 5HP1A 5KFUA 3UR0A 3LALA 5DQHA 4QWCA 1JLFA 4MKAA 5I3UB 3M9MB 4LQ9A 1BQNA 3CJ2A 1S1UB 4TN2A 3CVKA 3M9OB 2O5DA 2IC3A 2F8EX 4ED3A 3PW4A 1RT2A 2R8IA 3I5BA 1S48A 1C1CB 3CJ3A 5KT6A 3EPIA 4FBUA 3KK2A 4YR3A 1ZTTA 2CJQA 2YKNA 4Y2CA 4ZP9A 1XR5A 1KLMB 2OPPA 5JUMA 4HYKA 1NNDA 2RKIA 1VRUA 4QW8A 4JUZA 3M8QA 3DRSA 1EP4A 2FJVA 4TYBA 3MR3A 4J9QA 3DOLA 1DTQB 2R8JA 4IR1A 5I3UA 3RAQA 3RB3A 5L1JA 1S1UA 5KFXA 1IKXB 4ZVEA 3H4BA 3T5KA 1K1SA 1C0UB 2E9TA 4URQU 3KK1B 1C1CA 4MFBB 2FVRA 2FJXA 3KLVA 5KFTA 5KT5A 2V9WA 5KFYA 1KLMA 1IKVB 3FQLA 1JLAB 4KB7A 1N6QB 2BQ3A 1N5YB 1QUVA 3NKYA 3Q8SB 1HQUB 4KV8B 5KG2A 2XI3A 3QIPB 3IS9B 3CWJA 3BQ2A 4J9LA 3PW0A 3IG1B 3KLHB 2FVQA 5KG6A 4Y34A 4NLWA 1DTQA 4HKQA 4ZVHA 2XGPA 3LAKA 2D41A 3T5HA 2ILYA 1IKXA 3BGRB 4IH7A 4ECQA 2XC9A 1C0UA 4MK9A 4ED2A 2UVVA 4IH5A 3G6YA 3KK1A 4MFBA 4O3NA 3C6UB 3PJXA 4J9PA 2UUTA 3KLGB 4NLPA 3V6HA 4ECVA 2RDJA 1IKVA 3FQKA 1JLAA 2YNIB 3KLFB 1N6QA 1N5YA 2BRLA 4MIBA 3KMQA 1HQUA 4KV8A 3N6MA 4KSEB 5KFOA 3QIPA 3IS9A 2GIQA 5T14A 1TKTB 3DLEB 3IG1A 3KLHA 4QW9A 4J9NA 4GC6A 4O3SA 4F50A 2ZE2B 2FJWA 5KFMA 1JLCB 3BR9A 4U6PA 4I2QB 4YR0A 3BGRA 4QWAA 4PQUB 4PWDB 3HKWA 5KT4A 4WZMA 1JIHA 1S6QB 5F8JA 4RNFA 3H5XA 2WB4A 4ECSA 2ZKUA 3C6UA 2B6AB 3DRPB 4PUOB 3GYNA 1SUQB 4ZPBA 4LSNB 2ASJA 3KLGA 3JSMB 3TAMB 3KHRA 4RNNA 1S6PB 2YNIA 3KLFA 1S1WB 1D0EA 2ILZA 1TKZB 3ISND 3MTKA 5KFIA 2JC0A 2QV6A 2WHOA 4RW7B 2IJNA 2UUWA 3H5SA 1DLOB 3CJ5A 1TKTA 3DLEA 3IGNA 5KFBA 3PW5A 5DLFA 1LWFB 3TVKA 3QO9B 5KFNA 3NL0A 1HMVB 4H54A 4IG0B 5L1KA 4K50A 5CYQB 2ZE2A 4NLGA 4B3OB 1JLCA 1RT1B 3MF5A 3ISNC 3Q8PB 1EETB 4I2QA 3EZUA 1Z4UA 5DQIA 4PQUA 4MKBA 4PWDA 1DTTB 2VA2A 1ZETA 2FVSA 5L9XA 3NGDA 2EC0A 4WZQA 1S6QA 2IAJB 4FS2A 3IRXB 2R2SA 4RW8B 3Q8QB 4I2PB 3JYTB 2B6AA 2OPSB 3DRPA 4PUOA 1SUQA 3KHHA 4LSNA 3JSMA 4ZVGA 1J5OB 3TAMA 4YP3A 4YMEA 1S6PA 4NZ0A 4IKAA 4O3QA 1S1WA 1TKZA 1T3NA 4NLXA 4RW7A 1RDRA 3GIJA 1DLOA 5EWEA 1LWFA 3QO9A 3FDSA 1HMVA 2YNGB 4IG0A 1TL3B 5DQGA 5CYQA 2VG5B 5J2MB 5JXSA 4RUCA 4B3OA 4J9OA 1RT1A 4RW4B 3BSAA
chains in the Genus database with same CATH superfamily
3OR1A 3SCJE 4M5NA 4C8MA 4DV7F 2DXEA 1VQNS 4ZS6A 3DLHA 4KGXB 3MCMA 4DL3A 2ZBPA 1RTJB 4ELUA 2B8QA 2YQ1A 4R8UA 3LPYA 1M5PC 3Q23A 1QE1B 4USIA 1S6UA 2AZ3A 2UV8A 1CQNA 3KNGA 5BR8J 2CWXA 4YB6A 5LL6d 1NJZA 1QAYA 2DGQA 4NLVA 4O3RA 5CCMA 2Z4PA 1RT5A 1XN9A 1XTZA 3EXYA 3C16A 5AXMA 1FFWB 4PPDA 5KFVA 3HX9A 1RTZA 2GJIA 3B4MA 3LGNA 3TRGA 1F2HA 3A12A 2RIJA 2JLEA 4NLRA 2W25A 1QVGR 2HBZB 3CCRS 4NCGA 2E5LF 4IG3A 4HI2A 5IV4A 4M1KA 1B7YB 4UOGA 8ATCB 5HL7Q 2EBGA 4YEAA 3B78A 1TMJA 3OQ2A 1FWPA 1NHVA 2ZH7A 3M7VA 5HROA 2W7PA 1IJFB 5IM0A 3IC1A 4KO0B 3PYGA 4MK8A 2VL1A 2BJ3A 1RUSA 2RUGA 2Q43A 1S1VA 3CCJS 4ECZA 3K57A 2BKNA 1ZTWA 1FVQA 1SL1A 2LCWA 3CCMS 3HFKA 4CH0S 1RT6A 3J81Y 1GTHA 1JNRB 2MQPA 4DCOB 2XWXA 1NZAA 2GX8A 4ZHRB 1R3NA 1UFLA 4RU9A 4F7VA 3RTVA 4URSA 1QAIA 3ETOA 3QGGA 3BV8A 3W7BA 1FNOA 4DR1J 2FLOA 3M2VA 3OVAA 5D4NA 2QLFB 3NBPB 4I7FB 3MTJA 2F3JA 3ZNUA 2DD8S 3HM9A 3VWSA 3CMAS 3MM9A 2DBBA 4R5PA 1V6HA 2AIRB 4TU8A 4MKVA 5IXUA 4DFMA 4QCLA 2VG7A 3U27A 3M9NB 2QE5A 2ZHOA 4WFYA 1R0AB 4L3NA 2IM2A 2CPXA 4WYWA 4DXLA 4QWDA 2EFQA 3AY0A 1T9WA 4B17A 3D5MA 4DL6A 2CVIA 4OMFG 2GGPA 4DR4F 1KOHA 2R2TA 2MLXA 4OZLA 3OTBA 2NQPA 3BH7B 1TUGB 4J9RA 4DN9A 3PYDA 4ZLPA 1RT7A 2NUHA 1YRXA 4P72A 2RU9A 5D77A 3SXLA 4Q2MA 2I0XA 3OJUA 5DM6Q 1URRA 4DL2A 2KN4A 1FXDA 2R7WA 2RHSB 5FIIA 4RJVA 4CO4A 2F8MA 4ZP9A 3D0GE 4XTTA 3M8RA 1T9VA 3R2CJ 1HNXJ 1E6YB 5KFXA 4A8KA 4GRSA 4EU0A 3CMQA 2ASYA 2V9WA 2MQOA 2VD3A 1WC5A 1HQUB 4BWJA 5CD4H 4HT7A 4FZVA 3TOQA 5KG6A 2MSSA 1PC4A 2L3MA 3T41A 4ECQA 1OQ6A 4ED2A 4GVLA 2RMLA 1TAQA 2NUUG 1FDNA 5IOLA 1WDTA 2GZOA 5DDOC 2ZZTA 4U67Q 1L5UA 3RRKA 3HP6A 5A6WA 3WDOA 3Q8YA 1NPKA 4ANEA 1KN6A 2KM8B 2QA1A 3KLFA 3DGPA 2QV6A 2IJNA 3PRBA 1LWFB 2BJEA 4QQBA 2ZE2A 1X0PA 4OZ2A 1EETB 4S0MA 4I2PB 5MLCV 1U45A 2C42A 1J27A 5CYQA 3UW1A 2VIHA 1CPZA 3IBWA 1XK8A 2AGQA 2EBEA 3LW5C 4LFCJ 1LWXA 4DX5A 4P71A 4OYOA 2Q6CA 5HMZA 1ELOA 1WEZA 3H40A 2DHXA 3VV2B 2GAHC 4P7TA 3K59A 3OL9A 2UU9J 2CZ9A 2OMLA 4JI6J 4IOAQ 3Q24A 2J7WA 3MAQA 5KFRA 4LF7F 1RWOB 4F04B 3TA1A 5CQGA 2DNKA 4QJVA 4KHRA 2AEMA 4O23A 2HFNA 3TZYA 4EGLA 3QT5A 4OI4A 5HN0A 3IWLA 3GYXB 2FPHX 2QX0A 4NL5A 4ELVA 2HEKA 2YBVA 5CAAA 3UO0A 3LWMA 2GMHA 2Q6BA 3P96A 4OZJA 2YKAA 6FD1A 2YWWA 1JJ2R 1OS5A 5KFHA 2ZBCA 3KTQA 3WC2A 2BANB 4PCQA 3EZOA 2DNPA 1N5QA 2IBOA 1RCOB 2V68A 3W1YC 4U7CA 4OHVA 3MPVA 1RA7A 5J1PA 3T1YJ 1RT4B 1W2IA 2H5IB 2OD6A 3TJAA 3POTB 1REVA 4G1QA 2MJNA 3V6JA 2CQ4A 4B9SA 4PPZA 2W2OP 3NAHA 2QLBB 1EX8A 1SJFA 4IFVB 4DN0A 3VGTA 5KG0A 3P45B 1NSKL 4YUDA 2WBMA 4TLRA 1YJWS 1BWVA 5DG8A 1X4BA 1RBLA 1YHQS 4MKYA 4USTA 3RB6A 2VBYA 1S1TA 3M8SA 1H73A 1F60B 3FFIB 5KAKA 3R5JB 1UWBA 3MR5A 4KC5A 1N5VA 2OPRB 2R8GA 3H59A 4ZIWA 3KDNA 3GB0A 3TUIC 1X5SA 5KFDA 2HQIA 4B3MJ 2E9RX 1TKXA 4I56A 1K1QA 1CJUA 5KFKA 4JV5J 4DX7A 2XMWA 1RZMA 2MKJA 1KS2A 3HFVA 2AKWB 1YVFA 3TWZA 1Q78A 2D3O1 1FKAF 4LSZB 3VAMA 2IJRA 4KFBB 4DFPA 4IO9Q 2XLJA 4B3TF 5J1EB 1TV6A 2RRBA 3BO3A 4NXMF 1UZHA 4YR2A 1RWVB 1Q5VA 1VQYA 3DLGA 4OYAA 1U0HA 3MAAB 4IFYB 2KHCA 3L9ZA 1MMLA 3BKUA 3G8TA 1S9GA 5E41A 2HIQA 1MMDA 3N6LA 5U47A 5LT5A 4F26A 3IRWP 3MCOA 2QT7A 4LRAA 3CC7S 1AUDA 5LMUJ 4DV4J 2FC8A 3M8QB 1YRTA 2LP4A 3KUHA 1Y4ZB 1AXQA 3ZTPA 5ETTA 4ED3A 1BY9A 3TJ8A 3EMTA 5BR8F 3Q2TC 3L4BC 5GAEU 4YR3A 1KFSA 1BUXA 1UEKA 3IR5B 5FD1A 1YBUA 2GQ2A 3TW0A 3RAQA 2KRRA 4QIFA 3IMQJ 1GH8A 3L7PA 4N5SA 4QZVB 2DRAA 1SKWA 4DR7F 2BYCA 4NLWA 2E7VA 2ACMA 2ATCB 4WWSA 3IR6B 2M0GB 2QC3A 3QT8A 3EVMA 4DMZA 2P9CA 4B3RF 1IKVA 4J90A 3GSIA 2VZ9A 3IG1A 4GC6A 2D9PA 1YK9A 1J2VA 1FCAA 1U7LA 3N0VA 1JIHA 2YKQA 4RNFA 1HBNA 2MZSA 1Q8IA 4ZPBA 2KH9A 2UUAJ 4CO0A 2DGXA 3KFWX 2UUWA 4KTQA 1IR1A 5KFBA 3TVKA 3NS7B 1HW8A 1HMVB 2MB0B 1XBWA 4QYRA 4NXNJ 4WPAA 3SCKE 4PUOA 3IM8A 4LSNA 3CUNA 2XHWA 4F3MA 4B3OA 3HJVA 2ZDOA 3H7HB 4L76A 1LFWA 2C28A 2CZ4A 4FVCA 3MPWA 1RWKB 4DEZA 4DR1F 4IUFA 5AT1B 2YNGA 1X8DA 3MCSA 3HZEA 3HKZD 4LF9J 1ITPA 5C25B 3FSXA 1W7WA 1PKUA 1TZ0A 3G82A 2HZAA 4DR5F 3GV8B 2KJWA 1TL5A 3HVAA 2V9KA 4HR2A 2AYBA 4RBUA 4EMDA 3ZTRA 4IRKA 3CJKB 2QLJB 3CJTA 1JQGA 3GIRA 4NLYA 2U2FA 5IS2A 1NK5A 1RAEB 2UXDJ 1RTHA 2H51B 5H1SV 5J2PA 1TR0A 5I4MA 3HHLC 3JSBA 5HI7A 5KG5A 3PRDA 1R6YA 3QJLA 4UOFA 1O51A 4NMLA 3GYGA 4M5HA 1FE0A 1SV5A 3EPGA 4RW6A 3MD1A 4QU7A 2CJYB 1IWGA 5CCLA 1S5ZA 1UW4A 2B0GA 2BOPA 1TUVA 2WVBA 2HFSA 2W9AA 4I68A 1WUUA 1RP5A 3IXQA 4DUZJ 4KIAA 4KYZA 1TL4A 2RF2A 4XDCA 4EO6A 4RW9A 2Z2YB 4F4YA 3FZ2A 4O3OA 3IGVA 3ZNJ1 4CH1A 1T8EA 1BQMA 2R4FA 1T05A 2FLLA 5B09A 2WVDA 4M5DA 1HNXF 1M5VC 5AJ3F 4TU9A 3G4SS 2VQFJ 1IBMJ 5E3QA 3V6DB 1UJ6A 2ROPA 4LT6A 2XI2A 2M9KA 1NM2A 5BJRA 3PY8A 3PXGa 2V4RA 3V4IB 3S01A 1MU2A 3KMSA 2K1RA 2ZJQQ 5E7OB 1TQLA 2IJFA 2IMOA 1RT3A 2V67A 3IA0A 4WK1A 5DO2A 3PZPA 4EK2A 1WC6A 4ZCMA 3TQ1A 3CD7A 3DLKA 3MM8B 3BS9A 5H9EJ 3R7SB 2OELA 5DDRC 1OSCA 3NWGA 4WYLA 1D8ZA 4JI7J 3R2DJ 3IBCB 4O4GB 4MIWA 2BEFA 4B08A 2RILA 2HNYB 4N56A 3IAS9 3E51A 3ENVA 3OL8A 2RQCA 3CF5Q 4KHMA 3ITHB 1HHQA 4QIVA 2EEYA 5F8IA 5HMWA 3RBZA 3S1TA 3BF4A 2NXEA 3KNAA 3LANA 3AQOA 3RAMA 1FEEA 2KZMA 2B5JA 2YX7A 2KVQE 5KFEA 3THPA 1AUSL 1KNZA 4TU7A 2DCLA 2PI5A 1IKWA 4FF2A 2I38A 2YKNB 4CP5A 4YFUA 1DAXA 5AE1A 2HVZA 3RB4A 2QA2A 4TKTA 2ZD1A 1EAYC 3TA0A 3TNVA 3C14A 2V63A 1S1UB 4NA3A 4C97A 4JYAF 4JI6F 4M5MA 3A3OB 1TTHB 3NCPA 2OPPA 3D1QA 2RKIA 1VRUA 1WG5A 2DR9A 1GXLA 1S7IA 1YSJA 2H5EA 1VQLS 2N4CA 2V8VA 3T5KA 2AYEA 3SQGB 1WACA 2HZCA 1HNZJ 2IDLA 1N6QB 2E44A 2XI3A 1VQKS 2ZHBA 2CQBA 2E1RA 2QMXA 1DTQA 5FLXU 4CDIA 2ILYA 2DNMA 2DJWA 4ZN3A 3KK1A 1ULRA 1PBUA 5HAOA 3QAUA 4ECVA 2YNIB 4KQZA 3IS9A 5T14A 5F41A 3KLHA 3HHLD 2EW9A 4OZ1A 2E1PA 2BXJA 4DF8A 4QWAA 4CNYA 5KT4A 1PILA 1RHUB 2KFZA 2C2OB 1U02A 4LR8A 1D0EA 1TKZB 1TKTA 1H2VZ 3T1YF 4IG0B 3Q8PB 3ISNC 1CC8A 5ETLA 2EC0A 4LUBA 1ACMB 3AOAA 2YX1A 2QMWA 3GIJA 1SQGA 3QO9A 2O67A 1FNMA 3I9V9 3C8YA 1QUPA 2G13A 3GJSB 1HPZB 3ETMA 1C1BB 3HDSA 2EKYA 4EWTA 4JI8J 5GMDA 2DH8A 3VQSA 4RW4A 1HWKA 4K4ZA 1JX4A 2HRUA 3CDWA 4R0EA 4JI5J 4BC7A 2FHKA 2HBRB 1GX5A 3ZZZA 2BR0A 3MECA 3QLHA 1ZZFA 4LF4J 4WXWA 2YKOA 3RW7A 2FHJA 3BR8A 2E66A 1DBDA 2XLKA 4UT4A 2BE7D 4U7UK 2A2DA 2I2YA 1NSAA 2C2EA 1S4EA 2VHGA 5A0YB 4XDDA 4JI1J 4XIUA 3GFXA 3K17A 3BSNA 3MURP 5L8RC 3C19A 1EKSA 2KHDA 2ZH6A 1TU0B 2JL9A 4ZMMA 1HYSA 2MZJA 3PACA 3HHLB 2A2CA 5DZ7A 3UD3P 2V4JB 3KK3A 1WHYA 5CYJA 3HSJA 2Q79A 3DI6B 2Q1LA 1F6TA 1W26A 3MEDA 4X65J 4RZRA 1WELA 1D1UA 4A8FA 1TL1B 1H2UX 1X0FA 5LMUF 4DZDA 2A10A 3FEXB 1HNWF 3AB4B 3ICLA 4DU8A 1YBAA 2HVIA 3SCIE 1CVJA 4NLDA 2RQMA 1RWPB 4WJBA 3S8SA 2GVDA 4KJIA 2IRXA 4JV2A 3AD8C 2HBYB 2QSWA 1N88A 3OD2A 2R9LA 1LWCB 2VBXA 1X4CA 3I0RA 2Z8QA 4JV1A 1FT8A 4JB8B 2ZDPA 5FDLB 4OX6A 4F2SA 2ROEA 2YXLA 3B8HA 2V4QA 3A8EA 8RUCA 1HBMA 2QRRA 1FRHA 3WX8A 5EN1A 3EGVA 2LQ9A 3MMCA 2VPYB 4IO1A 2H65B 3MUVP 4LRCA 1RHMB 1IKYB 2RS2A 4AQYJ 4BCAA 2W4PA 2JH3A 4J9SA 1QAXA 4Y28C 2XM3A 2PA3A 2XGQA 3E01B 2DGSA 2LA6A 3VGUA 3DM2B 1RTIB 2V94A 1U24A 2KTQA 2M52A 2BQRA 1V9OA 1OWXA 2GVZB 4P2XA 4NXNF 4NI2A 2VH7A 3JAMY 1NSPA 2YNFB 5CYMA 1VQ9S 4B9MA 2H9ZA 3H98A 3ZZTA 1XNQJ 1QAJA 2ZVIA 3CCZA 2G2OA 4A8MP 5J2QB 1HNIB 2MLYA 5J2NB 4DG1B 3X1LB 3A8KA 1VR6A 1R7IA 1Y3JA 1X5OA 4Q45A 3FC9A 4C48A 1FWKA 3M1VB 3TR5A 2HGNA 5F8HA 2MY8A 2G2ZA 2IYGA 1P27B 3TAQA 4DUYF 1S0MA 2XTJP 2DISA 4LF9F 5DQHA 5I3UB 4LQ9A 4DPUA 4PABA 3NXZA 3I56S 3NCQA 5KT6A 2ABYA 1NJIT 4WFAQ 3G71S 3O5TB 1D09B 4HYKA 3LTOA 2A6OA 4FKXA 2DT9A 1EP4A 4TYBA 3DOLA 1K47A 3CCWA 3RB3A 4KGZB 1F2GA 3ET6A 4DSEA 2IVFB 4ZVEA 3EXCX 3BN4A 4C9DA 4UY85 4FVMA 4J9UE 3HK2A 1I94J 4PXCA 2FVQA 2UXDF 4ZPTR 5IC4B 2MZ1A 1UZDA 2XC9A 3NWRA 1SL2A 3V6HA 2J9EA 3GZ7A 4USHA 2XS2A 2V50A 3WQPA 3OVBA 5E0OA 2VFSA 5ETQA 4PWDB 1WDDA 4RBTA 4NEYA 4HDHA 2BA9A 3VTIA 3DRPB 1W2BR 1NU4A 3UCUP 4DUZF 3C15A 1JLCA 1UTAA 4LR9A 1SI9A 3OR1B 4CYUA 1ZETA 1PC5A 2GQCA 3Q8QB 2MXYA 4B9LA 4X4OA 3TEHB 4C0BA 4KT0C 4NLXA 4CO5A 5GVQA 4CWBA 4RUCA 4EZ9A 4R8UB 1OPZA 4C8LA 2XS5A 2VQFF 1IBMF 2AMCB 2HSEB 4WKRA 4RPFA 5HQ8A 1NHUA 3BM7A 4AD6A 1KHWA 2J0WA 3AJ1A 4CTAA 1RT5B 3QNWB 3I5CA 3W2VA 3M6UA 3C16B 4CNZA 2I1RA 1H0HB 3ADAC 4RX6A 1VOMA 3P3DA 2QEXS 2GMLA 3AOBA 1FJ7A 1MROA 3JS9A 4L75A 4Q44A 2HFVA 4NCGB 3V81A 4IG3B 2XSFA 1RHJB 2MJUA 1H72C 1U47A 3FMBA 3GILA 5KFWA 4JI7F 3UE2A 2AU0A 1U1MA 3D6TB 3DOKA 4UOCA 2QLWA 3A1YG 3OR2A 3VGSA 1XJWB 4NLSA 5HROB 4QR2A 5ETSA 2W7AA 5IM0B 5T7LA 1VQMS 4LQ3A 2CJAA 3NNCA 3CJSA 3FBEA 3PO5A 3M2UA 3H25A 5F8GA 4KGMA 3UN2A 2ALYB 3F56A 5LJ5Y 1S1VB 2D9OA 1R8HA 2H54B 2IYIA 2F4VF 4DSLA 5HQLA 2XMVA 1NH8A 1U0SA 1RT6B 4X66J 4Y2IA 3ZZYA 2VFUA 2C3MA 2OEJA 4CLLA 4UQTA 1C0TA 2AEJA 2E1AA 4ZPAA 3G6VA 2PI4A 3O8WA 2ZHAA 3NGTA 1DJ0A 5B0AA 4OHWA 1NK9A 3M2VB 1Y0HA 2J76E 1RA6A 3H2LA 3TO8A 1C4CA 3AAWB 2V2QA 5KG7A 4ED0A 3MM9B 2R8KA 4R5PB 1HNZF 3M2RA 4IH6A 2C3OA 2BQUA 2L9WA 2M5YA 2ZBIA 3PKYA 5B0GA 4UZBA 2CQPA 1VYAA 5F3TA 2VG7B 1YJNS 3PM9A 2R42A 1VLYA 2OSQA 1U1LA 4ZP8A 2H4WB 4C8YA 4WU3A 2HG4A 5KFPA 1FJGF 1F5CA 3T1AA 2XZDB 2VJVA 2OH2A 1XERA 4ETZA 9RUBA 5C42A 1YTYA 1FTRA 4CLUA 3ZXWA 2Z2ZA 2GGPB 3ILJA 5GAHU 1RWNB 3N4WA 3H90A 5HQMA 5D6GA 1FESA 1PIEA 1RK8A 3CT9A 2ZWPA 1PO6A 4V19X 1DQ8A 1IR0A 1RT7B 5IT9Y 3KJQB 3E3XA 2PO4A 2Y9HA 1F0XA 2DNGA 1FKPA 3D68A 4I4BA 2DR7A 3UN5A 3SFGA 2UV8G 4ZVFA 4K4UA 3KJFB 4QWEA 2J9DE 4HI1A 2C3PA 4NEZA 2WSEC 1N4LA 3G6XA 1RXOB 4CLTA 4LBIA 1NDKA 3QZ8A 5HBMA 1GAOA 4PG5A 2MLZA 5THWA 4K4TA 1FEHA 2XULA 5HMXA 4TN2A 4P10A 2CQCA 1HBUA 4LF4F 3I5BA 1UA0A 1YBTA 2FHMA 4Y2CA 2CAJA 1VFJA 2EVZA 5L1JA 4WTOB 3QGPA 2C2KB 1SJ4P 3EVWA 2Q66A 3ZC4A 2QA4S 3BQ2A 4ELTA 1FX4A 4UZCA 4DV0J 1T9TA 4F4AA 3HMJG 2CXEA 3GP9A 4USKA 2BACA 3KLFB 3DGPB 2GIQA 2CPFA 2DH7A 1FE4A 1RHRB 2ZE2B 4X65F 4W92B 4U6PA 2MDAA 1TK5A 2RUSA 1F1BB 5BYRA 4LMZA 2Z57B 4NE9C 3ZO7A 2Z2LA 2DGUA 2WHOA 5LMNJ 3KG4A 3WZ0A 1J5EJ 3GMGA 5CYQB 4CM2A 1RI7A 2HURA 5L9XA 4M63A 4LRFA 1UAWA 4PXBA 2CJXB 2PE8A 1HWLA 4O3QA 3PV8A 1N0UA 3OTDA 1QSLA 4LRDA 3FDSA 1HFEL 2LFVA 4C0HA 2OFHX 2HK3A 3C66A 4Q43A 2XZTB 3IR7B 1D3WA 1PJ5A 1U49A 5HMYA 2VG5A 3NAIA 2JNJA 3OLAA 3I82A 3CSKA 4U95A 3CJRA 2NXCA 3DMJA 1VQ8S 3Q89A 2ZWOA 1Y3KA 3BSCA 3SZ2A 4AQYF 1FRMA 1PJ6A 2M4MA 2CPHA 2XO6A 3CJ0A 2Y0SD 2NXUA 2YPYA 3W9JA 2YWFA 4K2JA 1FKOA 1B70B 4F4ZA 1JWWA 2J8AA 4BDPA 3N6NA 2J9DA 1JKHA 1AFIA 1XNQF 1N32J 1NXIA 6AT1B 1S12A 1YQHA 2FC9A 1REVB 5GAGU 5L9NA 3MCNA 3OTCA 4G1QB 1E6VA 2B9EA 3MEEA 2C3YA 1OYDA 1WF0A 4Q0BA 4MYUA 1ZAXA 2AYMA 4ANDA 4TVAB 4GO5X 1TK8A 3I0SA 4EYIB 2BDPA 2WRMA 2AYGA 1UVJA 4WKYA 4L3KA 3PCOB 2FDNA 3MMJA 1YX2A 2XMMA 1BE4A 2AGPA 3I31A 4NLOA 3FRYA 1S1TB 4MK7A 3M8PA 3SYZA 2DPJA 2M7SA 4EEYA 2UXBJ 1S9EA 1UWBB 1K0TA 4C8ZA 3ZZ0A 4DCJB 3CDEA 1VIOA 1LV5A 2HYIB 4ZKAA 3ILOA 2E1CA 3R7NB 1TKXB 2LQ8A 1Q5YA 1VC0A 1CJUB 3R27A 4P73A 4H4MA 4HL9A 4USVA 2ZUGA 3K5NA 4WP8A 1SKSA 1PYOB 1EARA 5KG1A 1FNXH 4CLYA 2YKMA 2AQ4A 4UUWA 3G6ES 3PFEA 4LSLA 5KFZA 5EHHA 4RNOA 5K8MA 2CJKA 1TV6B 3DYAA 3FKBA 2CUYA 1ZM2A 4DS5A 3DLGB 1MG7A 1U0HB 3LF0A 1KVIA 4B9NA 5DJBA 1Q0NA 4C2MA 3DRRA 2KFNA 2UXCJ 1A0OB 5GAEI 1S9GB 1UJ4A 4FP9A 2C2MB 3FCVA 3F0NA 1H38A 2OP5A 4NLQA 2HWIA 4DR6F 1SJ3P 4KE5A 2E9ZA 1FTCA 5D3GA 1ZM9A 3GU0A 4A8YA 3QQCD 4OZNA 4ES3A 1Z2LA 3L09A 1VISA 1UVIA 2AZ1A 3PR5B 1XNRJ 3FCHA 2CNNB 5DG7A 4TQRA 2B4VA 5HK4A 1JLEA 3AXMA 5EDWA 2DPIA 2KRBA 1YWXA 2XMJA 4HTJA 4LBPA 5A6PA 2DKOB 1IUJA 2HVDA 4RLEA 1IQTA 2IVMA 4WCEQ 4CT8A 2W01A 2R7RA 2GNKA 2D74B 4LF2A 2NZCA 1IKVB 3AODA 3NKYA 3CWJA 3IG1B 2J9CA 2RSQA 2WVFA 3IO1A 4Y34A 3M6XA 1WG4A 1HKAA 2DNNA 3ZZOA 1UVLA 1HBNB 2M3DA 1LNQA 1FRJA 4ANCA 3SSSA 2N3LA 4Y65A 4O3SA 3ZTQA 1ZYQA 3IAM9 5DRKA 3NEKA 3EJMA 4C98A 4EZ6A 4YR0A 1YJUA 4WZMA 2M2BA 2WB4A 5AE2A 4PUOB 4LSNB 3KLGA 1KOOA 2GW8A 3HI9A 1X5TA 2CDRB 5L1KA 4ATNA 3VVUA 4HTIA 4B3OB 2WB1D 2JFDA 2ZZNA 1I51B 4C11A 4FF4A 1ZAWA 3I96A 4ZCLA 5E2QA 2R7VA 3H2UB 2H1YA 2YNGB 3QFHA 2ZOFA 2AJFE 1TFYA 4KGKA 1S10A 2NREA 4LFBJ 2BKOA 2HHHJ 3G82B 3DDIA 1SB6A 5KFSA 1N36F 2W4CA 1KLNA 1V3ZA 3IFEA 4FPIA 4L73A 4PRFA 2FQQB 2W9BA 3T9ZA 3TA2A 1U8WA 1F9EB 4USWA 4CQ1A 3HSZA 3UCGA 1VQOS 2HRTA 4DV5F 2G1HA 1ICEB 2VJUA 1BD6A 2DR8A 4GKJJ 1S49A 1RTHB 4DWIA 2X3DA 4CLSA 5J2PB 4OX8A 1UEUA 4PXDA 1PJ7A 2VFVA 3DOMA 2R7OA 3DC2A 1SV5B 4RW6B 1HQEA 1TVRA 1OQ3A 3C46A 2FVCA 2XYPB 2BJ1A 2VPXB 4J9KA 1NJYA 3QRQA 1G1XA 1EIYB 4KGVB 4O3PA 4AXIA 2RF2B 4OFZA 4NRUA 3NNHA 4RW9B 1TP7A 3F73A 3EGZA 1ZOTA 1SVDA 4W4MA 1D9DA 3EGNA 1HQ2A 1X7VA 1BQMB 4JI3J 3GJRB 4DPYA 3UR3C 1T05B 4KHPJ 4OJ3A 2B7CB 2GO8A 2B8PA 4M5DB 4DCPB 1HD0A 5E33A 1R31A 4LF6F 2UVUA 2R2RA 4HH1A 3ZTOA 3M32A 3UDLA 3UDCA 4YHHJ 1CS4A 3LQVA 3BZQA 4CLWA 1JLBA 1VJWA 3KLEA 3DNCA 2DRBA 4F02A 4M94A 3SIPB 1MU2B 3E2EA 5KT2A 2K1RB 1WC1A 1SC3B 3KHGA 3BDPA 2RT3A 1RT3B 2VC0A 3MM7A 2NZ4A 1JXLA 2ZITA 2JLFA 4P9SA 1NK7A 4DV0F 3DLKB 2NR0A 4XO0A 3QJPA 1RLCL 2XMKA 3FEZA 2KG0A 3IWXA 2XY7A 3J80Y 1ZPWX 3NLCA 2P6TA 3X3UA 1WF1A 4DR2J 4C3LA 1NO8A 3QFWA 3MM5A 2ZNYA 4FDFA 3QGIA 1B0VA 3AT1B 4OJGA 2EG2A 2KU7A 3UVJA 1XMQF 2XMTA 2AEFA 1H3DA 4ZVRB 2F7VA 1OY6A 2YNHA 5LM7E 2CNOB 4ZJQA 3U7JA 3W8PA 3UNYA 3RB0A 5G4DA 1Q95G 2B5JB 2WSFC 4PR6A 2BJ8A 1NJXA 3R6LB 2UUCJ 1IKWB 2JC1A 3H42A 3DLJA 3SV4A 5AE3A 1IJEB 3O1LA 2ZD1B 4DV2F 3FEYB 4HVZA 4HACA 2EFGA 3C14B 4I1TA 1FF2A 5DETA 3CCVS 2DXDA 2IM1A 1RTDA 2FTRA 2VV5A 4WIIA 4ZJOA 2OPPB 4DV6J 2RKIB 1VRUB 3ILIA 1NJWA 3WC0A 5K9FA 5LSRA 4AYBD 3MM6A 3BGOP 2F8EX 2FHJD 2IVYA 2VKZG 2J5AA 5HJXA 4USMA 1S48A 2AJ2A 3L95X 2OEKA 3QBCA 4PG6A 2OO4A 1GMWD 3PX6A 1NNDA 1RACB 3OTEA 2HW3A 1DTQB 3F44A 5M2PA 2E9TA 3KK1B 2FVRA 2V2KA 2PIIA 4U96A 2ZJPQ 3K8WA 2YQ3A 3IS9B 1G4CA 3KLHB 4NZ7A 4LIRA 1U1OA 2P6SA 3HD1A 1RGVA 1RWWB 2RDJA 1Y11A 2BE9B 1N32F 1TKTB 3HHNB 3BPDA 2RH3A 2WVEA 1PAUB 4A8QA 4DV1J 2C1EB 2SXLA 2E1MC 3D6MB 4DPXA 1EQ0A 3QO9B 5K20B 2KT2A 3ONQA 4I2QA 3M8YA 2XNRA 2VA2A 2L9DA 4JP8A 4ZK7M 2B6AA 4Y2MA 2OMOA 3TAMA 2OJ3A 2DY1A 1NKEA 4J9OA 4RW4B 3BSAA 5KFGA 5L39A 4G1IA 1DTTA 2BBEA 3MECB 1Y9OA 1IBLJ 3QLHB 1J5OA 1NDLA 2OAUA 1U1KA 1TL3A 2MSTA 3LGHA 2F5GA 3LUYA 3GFHA 1FK9A 1WKJA 4KH1B 5DG9A 5CZXA 4ZPWR 4WFZA 2XBPA 1G7CB 4DSJA 3NGUA 2C3UA 3EGWB 3CDUA 1VIXA 4ZPCA 1HYSB 3IP0A 2B43A 1R89A 5F9NA 1YJVA 2KXNB 3KK3B 2CQIA 3Q8RB 2UXCF 4MMOA 4ID5A 3MEDB 1S0NA 2OEMA 4X62J 3GWCA 1VDHA 4LIWA 4K7QA 3PW2A 3UWTA 4G3IA 5D0HA 1FD8A 4I67A 5K8NA 2XYGB 4M5LA 4O44A 2GVDB 4DSIA 2FZGB 1ZM3A 3KJVA 4H4KA 3OHAA 1XNRF 2IA6A 3CO9A 3AB2B 1Y5IB 4NCAA 4JOUA 1G6BA 4IOBA 2KYZA 2LQJA 2G0IA 1Q4RA 4ECYA 3I0RB 3OSPA 1QTNB 4Q8FA 3SMZA 3CJQA 4GVBA 3KXDA 1S99A 1B3TA 4EYHB 2BUNA 2K3IA 3SI8A 5D0EA 2DCUB 2ZJRQ 1HBMB 2O1PA 2AF6A 2MY7A 2DNRA 1Q7LB 3NCRA 3MMCB 1T02A 2APOA 3GPAA 2HVEA 4DV3J 1VK8A 1UPMB 2IM3A 1WG1A 1CSJA 3SDEA 3MEGA 2MPUA 1UEVA 4V19J 1SC1B 4NLTA 1JLGA 3C6TA 2E5IA 4C3MA 5RUBA 4J91A 1S76D 4YOEA 1KVKA 3PG9A 3CD6S 1CG2A 1FRKA 2D69A 3SQOP 4NI2B 5CYMB 2Y3YA 2JEGA 4OX9F 3CW2C 5JVGQ 1YIJS 5EX0A 1KSPA 1FRLA 3CNQP 5F0UA 1DQAA 2AV5A 1HL6A 2XWYA 3HPOA 2BW2A 1BQXA 1YLXA 1WC4A 3THTA 6FDRA 1NKBA 1YGYA 4ED8A 3JXOA 4LFBF 4OLPA 4DQQA 3NS5A 2HHHF 2HVHA 2Z0GA 3KG0A 5GADU 1DARA 3W5YA 2Y1LB 3LA0A 1FRIA 1EP4B 3DOLB 5HP1A 2CNLB 4AE5A 1WHXA 1JLFA 4MKAA 3MD3A 3ET6B 2BM0A 3W65A 2HIYA 4UOHA 2B3TB 4YY3F 3EPIA 2KYXA 2F4FA 4DV7J 1YITS 2LECA 4Z7YA 4GKJF 4NZ6A 1A6LA 3DRSA 2L48A 2FJVA 4J9QA 2JDJA 3L3CA 1XWLA 1UL3A 2N7YA 1RADB 1C1CA 2FJXA 3KLVA 5KFYA 2NCKL 4DOZA 3D3BJ 1VCTA 2AD9A 4X4TA 3UD4P 3PW0A 4LJMA 1AW0A 3BEGB 2UZAA 4G65A 2CADA 2NYIA 1R43A 3BKTA 5EX3A 4J9PA 1G3OA 4MIBA 4KSEB 3D54A 5KFOA 4NPOA 4J9NA 5B0CA 3MDFA 3C15B 1JLCB 1HWIA 4MYTA 3G8QA 4CYUB 2DVIA 2E5LJ 3PJ9A 4DQIA 3GCWP 3K0JA 4JI3F 2GHWA 3NL0A 4KHPF 5HVGA 1U2FA 1Z4UA 1T11A 2R2SA 1OY9A 2CA9A 1NK6A 4YMEA 5HATA 4YHHF 1T3NA 1AYEA 2WVCA 4DZ6A 4NA1A 2V2ZA 3T3FA 4CTAB 3OFEA 1JMTA 1RT1A 5E3RA 3W2VB 4WK3A 1RISA 1FDDA 2BZ2A 2MZQA 3W3SA 3I55S 2YKPA 3MPUB 1R8BA 1U6FA 1VC5A 3OFGA 5E3PA 2D7SA 4V1Ak 3K5MA 2L08A 4B3SF 2ZM6J 2OSRA 1MROB 4DR3J 5A8RA 1T9XA 2R7UA 4K4VA 3MGJA 3V81B 2YVSA 3SFUA 5CZVA 1SJQA 2QGFB 5HJYA 1N34J 2ZEJA 3DOKB 4DL0C 4YDXA 3OR2B 1LXJA 4KBIA 2W9CA 2ZUAA 3J7ZT 5CXTA 3EE3A 1VGYA 5T7LB 3SQGA 2QIFA 2JX2A 3N5FA 2MKHA 3M2UB 2BOAA 5MAOA 1RWXB 4CO3A 4AXJA 2KXFA 3NS6A 3T1HF 2FLNA 3CGIA 2MKIA 3L7UA 3EVOA 4J5OA 3PJWA 3QRPA 2PEBA 1LKZA 3ISZA 5I42A 2XYHB 2WCXA 2GQQA 5DLGA 1Q7YT 2CQDA 3QPIA 4EBCA 1S1XA 1U4BA 1TL7A 4I6WA 4N41A 5LOQA 1VQ5S 2PDAA 4LVNP 2P2CB 1C0TB 1EQMA 2HNDA 2X3GA 1ZS6A 4F3QA 4DV6F 2KZZA 1B99A 2VONA 3GSDA 5HLFA 2C22A 4ZA1A 4N8OA 2EK1A 3OT9A 4QPXA 3M2RB 3QAEA 4C4WA 4WFBQ 5KFLA 1KTVA 4W90B 2J7KA 5DGAA 1JJCB 2X7IA 5GAHI 3R5AA 2K06A 1VRTA 4TY8A 4X84A 2HMIA 1YG0A 2MGZA 3THVA 2D3UA 3ZZPA 4QOTA 2F63A 5CABA 4NA2A 4FYXB 4I6YA 2MQMA 2Z30B 3UD5A 3GJTB 4TLQA 4F8RA 5C42B 3H2VE 3EZ5A 2BE2A 2PC6A 4M5IA 5BYQA 1NSQA 3QZ7A 2Y8WA 1DFDA 5KT7A 3SCLE 5EWGA 4I69A 5F8MA 1RAHB 2J0SD 2OKQA 4Y6IA 4DV1F 4RO0A 4F3OA 1YI2S 4DBQA 4X4SA 2ZFHA 7AT1B 2OUGA 3QYYA 4PZVA 3PX0A 1FKPB 3FVYA 1QLNA 4C8KA 4HT5A 2MQLA 1QSSA 1XIQA 2VA3A 3KOAA 2HLTA 1WEXA 2ZOGA 3H5YA 2AX0A 2QFIA 2W8LA 3ENQA 1N8RT 1RAOA 5KFFA 5HBMB 2WZ1A 1WTFA 1PAEX 1N33J 2UP1A 2FVPA 2W24A 9ATCB 3PIOQ 4DPWA 4F2RA 4ZP7A 1IBLF 1HBUB 3U1LA 4A8SA 2D3OR 4HHHA 1FERA 3G2XA 1XMBA 1N48A 1MN9A 1S0VA 3UR0A 1DRZA 3TAPA 2W2NP 1DHMA 1BQNA 1N5SA 3M9OB 2IC3A 5A2QU 3RW6A 3CJ3A 4RBVA 1NB7A 2YQ0A 1AFJA 3QT6A 3EX7B 1M5OC 1RJJA 4PKDB 5A8KA 4IR1A 3SBMA 4ZLLA 1X9MA 1ZAVA 2RDDA 2EPIA 3I32A 3EWGA 1RKIA 1X4AA 1JJ4A 2KDOA 2EFOA 2DHHA 1P8GA 2D41A 3GFZA 3NOCA 4PYAA 1MWZA 3DKDA 4X62F 4B9VA 1OYEA 2JLGA 4MFBA 2LXIA 3PJXA 2GMJA 1Q53A 1FO1A 1RCXB 3KMQA 3A3PB 4J7CA 3QIPA 2LVWA 2EG1A 3NY0A 2DIVA 4RL1A 2J7UA 3BGRA 2J0QD 2CFXA 5F8JA 1HWJA 3C6UA 1X4GA 1Y5NB 5ETNA 4HHUA 3CTRA 4Z7CA 3GTYX 1P1LA 2O66A 3FUYA 4NLGA 3K89A 4PQUA 3NMRA 1UVMA 2IRYA 1GXUA 4F0KA 4CZCA 4QIGA 1P9QC 2VG5B 4OHXA 2DITA 1FI4A 4RW8A 3JYTA 2DXFA 5ETKA 3DMJB 2M88A 3DXSX 4R25A 3RG6A 1UJ5A 3R6GB 5J2MA 4DV3F 2RU3A 4LRBA 1JNZB 1NB2A 2FZKB 1H98A 1V3SA 2RQKA 2RDIA 4WE1A 3D2WA 2C2DA 4DX8H 1T03A 2ZOMA 1FKOB 5GAGI 1LEOA 4C6AA 2HS4A 3FSIA 2AP6A 2VG6A 2MKSA 1MSWD 4ZN1A 1Q81T 3CEDA 1JKHB 2W1BA 1Q8LA 3IM9A 4WF9Q 2HHXA 3JAMU 3WBZA 2J0XA 4FS1A 4Y0FA 4OIXA 4EBDA 4ZVOB 1VQ4S 1HD1A 3GJQB 5AXKA 4EBEA 1AA1B 1HLWA 2PN6A 2E5HA 1E6VB 3MEEB 3LP0A 2AJ0A 4OYMA 3N79A 4Q0BB 4ECRA 1EHWA 3I0SB 3RGIA 2HS3A 3KLIA 1U6ZA 3CDAA 2HLUA 4MTPA 3VQTA 1SBRA 2CRLA 5IQ6A 4X64J 1NMEB 3AJ2A 2ZVSA 3LP1A 3CD5A 3M8PB 2AJQA 4LFCF 1S9EB 1QTMA 3HO1A 5L38A 2V8DA 5G0RA 2H4YB 2OLWA 2LDYA 5T41A 3RBEA 2QL5B 2J6SA 2B9XA 1WSRA 2GJ2A 1UVKA 3MHYA 4H4MB 3HFZB 3UI3A 4G6VB 2UU9F 4ILMA 3KYLA 5LSOA 5KT3A 3AHPA 3QIDA 3OPKA 2OHDA 4ED5A 2KKHA 2YKMB 2R2UA 3OFHA 2KL8A 3W63A 3P5TL 2F1FA 4LSLB 5DGBA 4ZVSB 2MQ8A 3JSYA 3DYAB 1X4EA 3O6QA 4RKUC 3IWNC 1IQZA 2UVRA 3ULHA 1F3VA 2B4PA 3GIMA 3PEHA 1EB0A 4NYPA 1WF2A 1X5PA 4DR7J 2NYHA 3UNGC 3DRRB 1TUWA 5B0FA 4LREA 1OJ4A 1GK8A 1V5VA 4CIOA 3TVYA 4XAKA 1RABB 2ALZA 1VMBA 3G86A 4DFKA 4OJ1A 4LFAJ 4B3RJ 3B54A 1AZSA 3TANA 2JZ5A 1OSDA 2DGTA 3LP2A 4WU2A 1VI7A 1ZZNA 5D3GB 2UVWA 4IQMA 2ADCA 2ROGA 2WONA 3V6KA 3O44A 4B02A 1JLEB 4K4SA 1L3KA 2UUBJ 2J8SA 2H3EB 1B4SA 1SKUB 3JQMA 3KG1A 3QATA 2KG1A 2E5JA 2ZH2A 2A18A 2ZM6F 2EI5A 1VHIA 4DR3F 4DFJA 2JEFA 2MZRA 2MKYA 3BSOA 4QWCA 3LALA 1CEZA 3MZIA 4WP3A 2ZBRA 1N34F 1RT2A 2YH0A 4BHQA 1X4FA 1WC3A 2DNOA 1Q86T 3A13A 4PWWA 4BWMA 3H4BA 5CA5A 2YX4A 3D9BA 4USJC 3OFFA 1LXNA 4USUA 2AW0A 3LO3A 4B3MF 1FVSA 1WI8A 5KG2A 2C2ZB 2RNEA 4DR5J 4JV5F 1I5OB 3AD9C 1GMWA 4A4JA 3LAKA 3ZTSA 4FYVB 3P8BB 1PCAA 3J7AN 5EGYA 1KWMA 4OYXA 4GO7X 2F9DA 1F9HA 3KLGB 1N5YA 2BRLA 4K2XA 2DB1A 4I64A 4QW9A 1OMSA 3BB5A 1YJ7A 1H74A 4YB1P 4C11B 2EWHA 3OTOJ 2DK2A 2ASJA 5IQQA 3FCWA 4Q2LA 4RNNA 2M8DB 1AT1B 3H5SA 5KFNA 3Q0AA 1NDPA 2DTJA 3NGDA 1S6QA 1LQ9A 3D7SB 1PG5B 3KHHA 3JSMA 4ZVGA 3C3LA 5D0GA 4IKAA 4FNHA 4DV4F 1FXLA 1T94A 3PIPQ 2BJDA 2IHR1 3IRXA 2W9BB 2DO0A 5D78A 5CD4A 3FMWA 1RSCA 1NHKL 1KQGB 3AFGA 2YWEA 1FDBA 2XB2D 3W2WA 2GC8A 2AJ4A 5AJ3J 3VHQA 4CLPA 4ZOSA 4RWWA 1JXVA 4RUAA 3GIIA 2HQGA 5JMNA 3CE8A 4KPCA 3DOMB 1M1GA 1GXTA 4LVOP 3RRGA 4N47A 3AA9A 1JK9B 1R6VA 4Y2AA 3PEJA 2NSCA 1HQEB 1TVRB 3BYPA 3DHXA 4DQRA 2ASLA 1SIZA 2L9NA 3HVWA 4JI0J 3WIUA 2VPWB 2PGCA 4NYZA 3B6BA 1S97A 4ZP6A 5IT9U 4A48A 3PW7A 1IBCB 2I5JA 5IC6B 2KXHA 4WXOA 4G1PA 1WNEA 3OW2R 3DCAA 1KKHA 4ZLNA 4H4KC 2UUAF 1ZPVA 1N56A 3EDRB 5K14A 3BYRA 1FRXA 1N33F 1ZA1B 3D1OA 1VS3A 2IM0A 3R8YA 1WC0A 3QJJA 1MWQA 5E3AA 3D6HB 5LSLA 4O4RA 3NMAA 2MEWA 3LWLA 1LWEA 3M32B 3HSGA 1GX6A 1CS4B 3EDQB 5IFMA 1JLBB 1HWUA 1RHKB 3KLEB 4OL8A 2HAIA 3JQJA 4FKYA 1NK4A 4RUBA 3W61A 1RHQB 4ZPVR 2K7KA 1LW2A 4IDKA 4DHVA 3QMQA 3MM7B 4AL7A 3FRZA 2HHVA 4ZVQB 2WW4A 3GV7B 4ICLA 1U09A 3GIKA 2ZZMA 4L74A 1PYTA 1Y10A 2KI2A 4ZJLA 1CULA 4P2MA 3QWPA 4FNIA 5FJ4A 3HHKA 3MFIA 4QIWD 2CPDA 4P74A 4JYAJ 1IM4A 3J81j 3TUZC 1SH2A 5K8OA 2C2RA 1BMQB 1UFKA 3AJDA 3MM5B 3VAHA 3K5OA 3I6PA 3M30A 3I5AA 3BO4A 2J6UA 3UVJB 7FD1A 5JJBA 4OI3A 1RWMB 1RU2A 4K59A 2QL9B 2YNHB 5C24A 1R27B 1RAGB 4A47A 4A8XA 3MAHA 3VAFA 2Z58B 3TYTA 2CJ9A 2DGVA 4EO8A 5BYSA 3MMBA 2U1AA 4ECXA 3PTWA 1JLQA 4H4OA 4Y2KA 4ECWA 2JEJA 3DN9A 3BN7A 3U02A 4HACB 1IBKJ 2BJ9A 2GJFA 1O8BA 3W64A 2POKA 2R7XA 1S57A 5HANA 5IV3A 1RTDB 1RAAB 4DS4A 3WIVA 2VICA 4NASA 1BXNA 1ZM4A 1GMVA 3MM6B 3IN5A 2JEIA 1NEEA 3BQ1A 4ED4A 4RR5A 3PR4A 2MKCA 4OZ5A 4MH8A 2CPYA 5K8PA 3Q2SC 4URGA 2DO4A 3PW4A 5E5NA 2R8IA 2LMIA 1U2RA 2EK6A 4OZ3A 1XC9A 1B0TA 4Q5VA 2N4DA 4CLKA 4WP9A 1JXEA 3ZFVA 3TUPA 1V3RA 5KFTA 2M70A 2KFYA 1UKUA 1KTQA 3HCXA 5LXYA 3JQKA 1GFWB 4Z37A 2WSCC 3O3LA 2R3VA 1KDNA 1F3FA 1MNEA 3GCXP 5F3ZA 1YZ6A 4KH0B 1U25A 4F50A 2P9GA 1HI8A 5KFMA 4I2QB 2R7TA 3HKWA 2ADBA 1Q82T 1P6TA 1KQFB 3CJ8A 2B6AB 2N7CA 3TAMB 2ILZA 3DLEA 4X64F 5DLFA 3M4XA 1VBZA 1KEKA 5LJ3Y 1DTTB 2FVSA 1D9FA 1KVJA 3CCTA 1WD6A 1R8CA 1SUQA 2QMUB 3CPWR 1CJKA 1J5OB 1S1WA 2MQNA 4RW7A 3HSDA 4NMXA 4WFNQ 4X4NA 1TL3B 4NOHA 1HNWJ 1FK9B 2BMBA 2IAJA 5C5JA 3GFYA 2OPSA 1U6BA 2G0JA 4X4UA 4ITSA 3DRXA 4I6AA 5B0DA 5M2UA 1K44A 3R9LA 1U1NA 4RNHA 3OUYA 3R97A 4ECTA 3VALA 1KRPA 3B82A 3MMAA 4IRDA 8AT1B 2HK2A 1VJQA 3W9IA 1TFWA 4ID5B 4L72B 1VQ7S 4KKOA 1VQPS 4Z2XA 3ZZRA 1KQKA 4O0IA 5A8WA 3R3TA 1NH7A 2VU5A 1S6OA 2A0FB 3RBDA 1KHVA 1KP6A 2BM1A 4LFAF 3T19A 2OPQA 2I8EA 3PKMA 3RUBL 2WOMA 1UFWA 2FGOA 3DLLQ 4E2FB 2HHSA 5HVFA 4HLBA 1SH3A 4O44B 1S59A 4U9RA 2E29A 1Q1KA 3KJVB 1RYSA 3G8SA 4E0DA 2UUBF 4N76A 5C7PA 5H9FK 2RD5C 3HXMA 1V5IB 3MR2A 2JVOA 4GVBB 1U1RA 3NGKA 1SIWB 3GR1A 1K9MT 2HNZA 5DS7A 1UETA 3T6JA 4E8UA 1PBAA 1HW9A 3OBIA 2VOOA 4DL4A 4QYZK 3PHTA 1HNVA 1NDCA 4OX7A 1PSDA 4JI8F 2MQQA 2FJDB 4CLZA 3CCUS 4DL5A 1T9YA 2HS0A 2DGWA 4J9VA 2VDIA 2G4BA 4OZ0A 2GV1A 4JI5F 4DUYJ 3SDEB 3MEGB 2DNZA 3NGRA 3OXGA 4C7QA 1Q79A 5KTQA 3PNIA 1HBOA 3HVTA 1JLGB 3C6TB 2HQ3A 3US5A 4IOCQ 3DU5A 2ZH3A 2HFUA 1WKLA 4FXWA 4KY3A 2QJ3A 3PHEA 4JI1F 1M0SA 3K7RA 3R5DA 3TEGA 4PQAA 3JTPA 3HHDA 3BJYA 1YDLA 4P2FA 2AX1A 3PYEA 1QJHA 4P7VA 2XS7A 1Y00A 5GADI 3P49B 1NCLA 1GEHA 2PEHA 3OTOF 2B4OA 2A6MA 3OLBA 5IT4A 2NXJA 2XNQA 5J1NA 4AL5A 1RAJA 3IBFB 1CJVA 2CG4A 2AT1B 1O0PA 1LW0A 2OI2A 3VAJA 1RAFB 4LF5J 1UPPA 1FFSB 4OQJA 2BW7A 3QGHA 3HZGA 3DLBA 3LAMA 5DM7Q 4K4XA 1U8SA 5JVHQ 1M5KC 1M5SA 5HP1B 1VBKA 1JLFB 1WJ9A 5K5MA 3TVZA 2MKKA 1XMOJ 2HHUA 2HHWA 5ETVA 3OV7A 3A8IA 3QWUA 2FIUA 2RAQA 2RS8A 2IFXA 3DRSB 3T5LA 1SCJB 3MEKA 4NWBA 2VUGA 2FY1A 1C1CB 1S72S 4FBUA 3VAKA 3KK2A 2B9YA 1B64A 5JUMA 4NX9A 4YDDB 4OJHA 2WW8A 2NLWA 4JI0F 3PRVA 3CIMA 1HHTP 4UTGA 1KLMA 2EFPA 3DGVA 3FQLA 4KB7A 2HGMA 2BQ3A 5I3PA 1QDUB 4K0KJ 2CQ1A 1U1PA 2XSJA 2OFGX 2V8PA 3FSYA 1IKXA 4IH7A 1C0UA 3MOJB 4IH5A 3G6YA 2VODA 2UUTA 4NLPA 1OIAA 1JLAA 1RBOB 2N3OA 4KV8A 4N7TA 3J7YU 5B0BA 1M1KT 1URNA 2PFDA 5DDPC 3Q8UA 3KWMA 2JRSA 3CC4S 2NPIA 3MTKA 2JC0A 1SJ1A 3PW5A 1CJTA 3PDNA 3TJ9A 4K50A 1HR0J 4PWUA 1RT1B 2XG8A 2EXUA 5DQIA 2XO7A 4X4PA 1G2EA 3N28A 2F4VJ 1SQEA 1NUEA 1S6PA 4NZ0A 1RDRA 4CH7A 4F36A 1DLOA 4DPTA 3V2UC 5A8RB 2RJZA 1LK7A 1MMNA 4MIAA 2AHOB 4EFAC 2R7QA 2B4UA 2JWNA 3UPFA 1B7FA 2DHGA 3PYFA 4NRTA 3J80U 5B08A 2W9CB 1WWHA 1IR2A 1H7XA 3VZIA 1QY7A 3OXLA 1GTEA 5KFJA 2QG9B 3RYLA 1RBAA 1I94F 3VAIA 1RTJA 4O0NA 5L1IA 1QE1A 1NRKA 2BRKA 3M6WA 3S6EA 1R8AA 1RQ0A 2DY9A 4J9MA 1L3TA 3RRHA 1S0OA 5I42B 2LEAA 2W2QP 3D4JA 1S1XB 2LEPA 1NLKL 1JJHA 1IBKF 1FJGJ 1TL7B 2NS1B 3FNNA 2QYCA 3W9HA 3K5LA 1M5HA 3DDNA 4LR7A 5KFAA 1YZ7A 3GQCA 2HNDB 5KFQA 1ZH5A 1W25A 3M05A 2PSZA 2VDHA 5A76A 1NKCA 2LEBA 4DL7A 1RLDA 3NOGA 5HLFB 2CQ3A 2CPEA 3D3CJ 3FK4A 5HSPA 2FLPA 2ZH9A 4ZCKA 4ILRA 3TP2A 1PGZA 3CXCR 4KO0A 3EYZA 3ZZUA 4YQWA 2VQEJ 1VRTB 4TY8B 1VLOA 3L7OA 2HMIB 2MGZB 3UFCX 3BKFA 4JV0A 4C8NA 5F9LA 4PEOA 3WHIA 2WAQD 4F4WA 4DSKA 1T0TV 4A8OA 2BE2B 3OXFA 1APSA 4YN3B 3W60A 3MUMP 1FFGB 4ED1A 2DNLA 3VVTA 5A2QY 4ZHRA 1OPIA 4NCBA 3BGFA 3K58A 3U1MA 4CM0A 1WOOA 1NK8A 2F9JA 3HLUA 4DF4A 3W5XA 4UQGA 2BJ7A 3NBPA 4QR1A 2LA4A 4I7FA 4K5RA 4RNMA 4ED7A 2OGUA 3UDVA 2FZCB 3CCLS 3OL6A 4YB5A 4TYAA 1I3OB 3NGSA 4OI1A 2BX6A 1T9UA 2I6WA 2FJAB 1U26A 3LOUA 1TMMA 2HPUA 4PG7A 4X66F 3PVXA 1R0AA 2ATLA 3AA8A 3R7BB 4GKKJ 3CIZA 1H7WA 1AB8A 2IMWP 3J81U 1FD2A 2I9SA 4K8RA 2D3ZA 3FJ2A 4JI2J 1BQNB 3CC2S 2LU2A 5ADZA 2Y8YA 2IC3B 3N9UC 4QU6A 2QLXA 4ZPDA 3LGMA 2B7BB 3EICA 2HQDA 2YWGA 1VBYA 2CG8A 4CI0B 2HHPA 3T9NA 1KONA 5A8KB 1NAQA 2VB6A 1VK3A 2O5DA 1T7PA 2YWHA 1BWEA 2XHCA 3CDBA 1ZTTA 4JBCA 4W98A 2QZ8A 4QW8A 3H20A 2R8JA 4YB7A 1HA1A 2OD4A 1K1SA 4JI4J 3TX0A 4MFBB 4QBUA 1IWAA 3KDOA 2PMWA 3G87A 3HD2A 3QIPB 2DIUA 2VBZA 2DNYA 4DSFA 3W8GA 4HKQA 4QPTA 4ZVHA 1E6YA 3BGRB 1H6KX 1SL0A 2XQCA 4DJBA 3TI0A 5B7WA 3BO2A 3C6UB 4CO2A 2FJEB 1N54B 3Q22A 1HQUA 3W66A 2FJBB 1BLUA 2RB7A 2KVIA 1REGX 2JSXA 4PQUB 4FXVA 1JB0C 4KR0B 3VF0B 4EUVA 1FJEB 2PT0A 1GT8A 3ISND 1HIYA 4F25A 1X9WA 3HF5A 3MF5A 2DR6A 2FUG9 2JHEA 4ALZA 3R5GA 4WZQA 2ZH4A 1FXRA 3DFEA 3RBXA 4RW8B 3JYTB 4LF8J 3HHEA 4YP3A 2XLIA 1DZ5A 4AFFA 3JTOA 1LWFA 2HAFA 1CLFA 1I1GA 3KKFA 5JXSA 5J2MB 4OI6A 5D4LA 4IR9A 1EETA 5D8HB 4NYOA 1P9YA 1F5AA 3V5RA 3K2YA 3N5BA 4WE1B 2CJBA 4I2PA 3JB9k 2DHAA 1Q16B 1T03B 3D0IE 4U8VA 1FHTA 3MFHA 4ZDNA 2IRUA 2P8IA 2QL7B 2V0NA 3JSRA 3CMES 1X4DA 4P6QA 2K3KA 4M95A 2BV3A 2VG6B 2MYFA 2CYYA 4ETXA 1KD1T 1P1TA 1S7HA 1K8AT 1UVNA 3QSYB 2HFOA 3TARA 4N77A 3A8JA 4ES1A 2COLA 1WORA 3H8YA 1MW7A 1KC8T 1SH0A 2FHOB 2QFJA 3GE9A 4F4KA 3H5UA 4PAAA 3LP0B 2CQHA 4LF5F 4QR0A 2DNHA 3KLIB 4UW2A 5L1LA 5FLXY 3NNAA 5LMNF 2LQBA 2NXNA 1J5EF 1Z2ZA 4OI0A 1WI6A 1QSYA 2RRNA 3GV5B 3LP1B 2DRDA 4D3GA 3ENAA 3J7A1 1XMOF 4ES2A 1RB0A 1S9FA 3CJ4A 2CNKB 4B9UA 1D8YA 5G0RB 3GG0A 2BABA 2O3DA 2D1CA 3A4TA 1YJTA 1NBEB 4Y3CA 5LXRA 4DR6J 5EUHA 2BANA 3MXHP 3KHLA 3TQEA 4KPYA 4RUHA 3G96A 3VR1A 2E7WA 1UMJA 2W2MP 2PFFB 2XEXA 5D4OA 5HO4A 2V6AA 4Q7AA 2HWTA 5ITHA 2X1GA 3CD0A 4TY9A 1RT4A 1B0PA 1PYSB 4L6V3 3TUJC 1X60A 3CCSS 2WBRA 3POTA 4UUXA 2L41A 1LFPA 4RWXA 2C2NA 2XMUA 1HHSA 3VGVA 4ER8A 4ECUA 2WK4A 1HARA 3RAXA 2ZNZA 2O01C 1SQFA 3T6BA 4K0KF 2V69A 4IFVA 3MWBA 2PA8D 2CKWA 3MPYA 2XCPA 4UY8T 4HH0A 4WIQA 3H4DA 2FY8A 4ZCIA 2W7OA 2CZVC 2Y0BB 4BS2A 1I6JA 2Y1JA 1AZSB 4OYZA 3LP2B 5GMEA 3FFIA 4M8LA 1QVFR 3D6FB 3PFOA 2OPRA 3BH6B 2AGOA 4ZVPB 2W8KA 3BQ0A 2WONB 4MT1A 1HR0F 2CPJA 1F9FA 3HT3A 2RRAA 5ETOA 3R5BA 1N52B 2JFKA 4XPEA 5B0EA 3CCQS 3W62A 4XK8C 4X2BA 4GC7A 2X1BA 5F8LA 4F4XA 4CRJA 1R0CB 4KFBA 1U2CA 5J1EA 4IRCA 3GG1A 3I4PA 4C3KA 2HGLA 1RT2B 2NSBA 3MAAA 4IFYA 4EI2A 5KFCA 3GLJA 5KFUA 2UXBF 1L3VA 1IM6A 3CJ2A 3Q86A 2CVEA 3CO0P 1T95A 1SC6A 3K5PA 1CBKA 2HZVA 4DQPA 1U1QA 3M8QA 2OIHA 2GO9A 1VQ6S 3BBFA 1N36J 1HI0P 5C2CA 3I87A 5E3CA 3CULA 2YY3A 2X51A 2AJ1A 2V8HA 1N5YB 1QUVA 3Q8SB 5M2RA 4J9LA 4DV5J 3ENWA 1M90T 3LH2S 4M5GA 4WTYA 4E98A 3QSIA 2LQ5A 2KO1A 4MK9A 4O3NA 3C2PA 1NK0A 4DQSA 4OLOA 4CO1A 2V34A 3NG8A 4ILLA 1X31C 4AT1B 2V8GA 1S6QB 2ZKUA 3JSMB 4HEA9 2B51A 1FDAA 5KFIA 2H5JB 2G1DA 3IGNA 3DXBA 1AROP 4ERDA 1TELA 4N8NA 2QA4G 4MKBA 5IZHA 1NPRA 4OV6A 4F67A 3IRXB 2IIHA 4ZLJA 2VQEF 3EUNA 1WOPA 3ILLA 5EWEA 3Q8VA 1HMVA 1VHFA 2OTLS 1MLAA 2QN6B 2KT3A 5ETMA 4DI6A 3W2WB 1MWYA 1YRUA 3KUGA 1FJCA 2MMYA 4LF6J 2V5HG 4A46A 3FBFA 4K5SA 2HHQA 1TK0A 4X4RA 1BHNA 4M5JA 2ERRA 2HQCA 4ZVUB 3I4HX 2AWZA 1S4FA 3QT7A 4FF3A 2W2PP 2ZKTA 3A3NB 1KBRA 1S79A 4DPOA 1EKRA 1X9SA 5F8NA 2I5JB 5C25A 2A1BA 4ED6A 2ZC4A 4R0JA 2QSFA 2VKRA 2LU1A 1XR6A 4PXEA 5K14B 1GNKA 1VRQC 1IN0A 1WTBA 2KJVA 5H9FJ 4U7UD 3OSNA 2PD1A 3CJKA 4BLGA 5BXIA 1KQSR 1LWEB 2LLZA 1R8PA 2F8HA 1XMQJ 4GKKF 3DU6A 2DGOA 2YWKA 3UCZP 2ASDA 3BGUA 3D66A 4JI2F 4QYZJ 1RYRA 4FYYB 3B4DA 1LW2B 4IDKB 2VC1A 3T5JA 5DZ6A 4OI2A 2MZTA 4LF1A 4ICLB 2P5VA 2XCAA 3P4UB 2XZWA 3SSRA 1CULB 2VF3A 1GQEA 1FWLA 4K4WA 3F41A 4DV2J 5C2GA 5ETPA 4CCHA 4DU7A 1Y7PA 5IWAJ 5GMKa 4FBTA 1ROFA 3RZAA 5KG4A 4FYWB 5CHCB 3VZHA 1UCNA 1YJ9S 5ETRA 1WHVA 5AXNA 3M30B 3R5CA 4JI4F 4WFXA 4BC9A 1K0VA 2OTJS 1CQMA 4FF1A 1A7GE 1KFDA 3VAGA 2XMAA 4C8OA 5C24B 2Z2MA 1DY3A 1U48A 1N0VC 2CPZA 4P75A 2Q3PA 3M6VA 4MAKA 4TQSA 3MMBB 3V6DA 1JLQB 4H4OB 3RU0A 3AH6A 2IY5B 1IXKA 2GA7A 3J7Z5 4AL6A 2IBKA 2DNQA 3G9CA 2GIRA 3V4IA 1H2TZ 2LXUA 4ZVTB 1OY8A 2HFZA 3MR7A 2DHSA 4DLEA 3TZZA 4DUTA 3S7RA 4PG4A 2J6TA 2Y1IA 5I3QA 3MM8A 3OVSA 3DDKA 4LF8F 1DURA 3SEOA 4WBFA 1A9NB 2YH1A 4O4GA 2IA0A 2K8GA 3GR0A 2HNYA 2R7SA 3MR6A 3ITHA 1XQIA 3HJFA 2IPOB 1RAIB 4YS2A 2K7JA 4UF4A 4IYQA 2LXFA 2IDEA 1LK5A 4QIEA 5D15A 2VFTA 4A8WA 4AUKA 3GONA 1KR4A 5KOWA 2JJ4D 4OYIA 2GCFA 3Q83A 4GMKA 2X1AA 1VBXA 2CQGA 2CJQA 2YKNA 3SSQA 1XR5A 3BDEA 2DEJA 4JUZA 1FX2A 2GIFA 2ZBQA 4CT9A 1S1UA 4URQU 1N5TA 1SXLA 4DR2F 3R1LA 2QTWA 2XY5A 3KUEA 2GAGC 3T5HA 1UP1A 1RWUA 4X4VA 2UVVA 1Z1ZA 3FBCA 3D67A 2NPFA 1CC7A 3H0PA 1N6QA 5HVHA 4KRWA 1ZA2B 3DLEB 1WEYA 1SKRA 2X1FA 1IVZA 2A3JA 5AXLA 3BGLA 2MTLA 4ENOA 3AXKA 3H5XA 2UUCF 3GYNA 1SUQB 1MN7A 1CJKB 2HQFA 2HRYA 2YNIA 1S1WB 4RW7B 3HVRA 1NZ8A 3E8OA 1Q8BA 3KJNB 3EM1A 4MJKA 3PO4A 2IAJB 2G9OA 2OPSB 3M8ZA 1C4AA 1TKZA 2GS8A 4DR4J 4IG0A 2VPZB 5DQGA 4OV1A 3TZXA 4J37A 1SPBP 3VCDA 5EWFA 3UDEA 4RU2A 5SZTA 3MPDA 3OUYB 1TAUA 4LBHA 3I9ZA 3RR8A 2DYAA 3MMAB 1WOSA 4FXDA 1HPZA 1FA0A 2N82B 2WTFA 1C1BA 1R0BG 4KKOB 2ZH5A 2Z56B 4K4YA 5A8WB 4TNOA 3V4MA 1EZZB 3D1HA 2OPQB 1X4HA 2WOMB 4HDGA 2GHPA 3AOCA 2P9EA 2YTCA 3MOZA 4FPRA 2HHTA 1QD1A 2VASA 3CB4A 4PG8A 2ZC3A 4DDFA 2VBWA 2E5GA 4X4QA 2BVZA 4QWBA 1LOUA 5A0YA 4OX9J 3OL7A 4C0OC 2EKNA 2CWKA 2HNZB 2KT5A 2RQ4A 5SUHA 3HHLA 4OYPA 1HNVB 2PMZD 2FYXA 2V4JA 3OHBA 3OJSA 1UWAA 2BKPA 2MHNA 3DI6A 2LYVA 4FN5A 1O5JA 1TL1A 5L46A 1WKKA 1HBOB 3HVTB 1M1HA 2CIMA 2B9WA 2MHEA 1GMUA 2RE1A 1T3OA 1F5BA 1O6XA 4I0WA 2B56A 2V2VA 4XPCA 3D28A 1XR7A 3JTNA 2CQ0A 3CCES 2W4DA 3ELHA 3UQSA 4YY3J 1LWCA 5KOXA 1RE1B 1ZBTA 2KB2A 2EFVA 1L3SA 1VC6A 1D9AA 2HWHA 3WX4A 3MI7X 2ZH8A 4B9TA 3NRBA 3PX4A 1NPPA 2M8HA 4ZIVA 4ZITA 5FDLA 4P52A 4TXSA 4KAIA 3BBCA 4U8YA 3TZWA 5KG3A 4IQXA 2DR5A 1CJVB 4PYDA 4CLFA 1LW0B 4LF7J 1UA1A 1RKJA 1YJRA 2E7XA 5D0RA 4F0HA 3SV3A 5CH7B 1K73T 4Q8EA 2QO3A 1IKYA 1Y5LB 4NLUA 1Q8KA 1UW9A 3AD7C 2LDIA 3TX8A 3U1NA 4FYDA 3DHWC 5H9EK 3E01A 4HHJA 3DM2A 1RTIA 4DX6A 1C2PA 2GVZA 3FGVA 3M8WA 2R8HA 2YNFA 1BC6A 3NP5A 3AQPA 3LPEA 2HKEA 3BREA 4D3HA 3P6YC 7FDRA 1TKDA 3KK2B 2H48B 5DDQC 1XEZA 5J2QA 2CQ2A 2PMHA 3UN3A 1HNIA 5J2NA 4DG1A 5D4PA 2G0CA 2EFNA 1BGXT 3K8VA 3M9MB 1VQSA 3CVKA 1YKWA 3J7YI 3QRRA 3FBBA 3N01A 2K2PA 3M1VA 3P5BP 1KLMB 4B3SJ 3MR3A 1RU1A 2XSJB 5I3UA 1IKXB 3FZBA 1C0UB 5IT0A 2VOPA 1HI1A 4BBYA 2GFFA 5KT5A 2YPZA 2HBQB 1JLAB 2DEIA 4KV8B 2RHQB 2FGCA 3HULA 2CDQA 2VFRA 2XGPA 2EC2A 2QYGA 1DQ9A 2F40A 2JOQA 2F65A 4OHZA 1L3UA 3RJMB 1SJRA 4OHYA 3R1HA 3D0HE 3FQKA 3N6MA 2DH9A 2FB0A 1CJTB 4OYWA 2Y1RI 3HT0A 5F0WA 2FJWA 3BR9A 2ACYA 3MUTP 3T1HJ 3W5ZA 2GHVC 1OO0B 4ECSA 4OYBA 4Y00A 2KM8C 3KHRA 3BBBA 1SC4B 1S6PB 1DLOB 3CJ5A 1WHWA 3BPSP 1WSVA 4DLGA 4H54A 1EJ7L 3DRYA 2JVRA 3EZUA 4PWDA 4B3TJ 2FD2A 4F0MA 4FS2A 4NXMJ 2XY6A 4P2SA 3O2IA 3DRPA 5IWAF 4M5KA 2CPIA 2G2YA 1QM9A 3RR7A 2ZH1A 1S77D 2LKZA 2RVJA 4ID8A
chains in the Genus database with same CATH topology
4EZ9A 4R8UB 3OR1A 3SCJE 1OPZA 2RJZA 4C8LA 1LK7A 2XS5A 2VQFF 1IBMF 1MMNA 4C8MA 4MIAA 3W2VB 4WK3A 1RISA 4EFAC 1FDDA 2BZ2A 2MZQA 2R7QA 3I55S 3W3SA 2YKPA 4WKRA 2B4UA 1R8BA 2JWNA 1U6FA 5HQ8A 4DV7F 1VC5A 3OFGA 5E3PA 3UPFA 2D7SA 1VQNS 3K5MA 2L08A 4ZS6A 4B3SF 1NHUA 3BM7A 1B7FA 2DHGA 3DLHA 2OSRA 1KHWA 2J0WA 3AJ1A 4CTAA 4DL3A 1MROB 1RTJB 5A8RA 4ELUA 1RT5B 4R8UA 3LPYA 4NRTA 2R7UA 1M5PC 3Q23A 1QE1B 4K4VA 4USIA 3I5CA 1S6UA 3MGJA 3W2VA 5B08A 3M6UA 3V81B 2YVSA 1CQNA 2UV8A 3SFUA 4CNZA 2W9CB 3KNGA 1WWHA 2I1RA 5CZVA 1H0HB 1SJQA 1H7XA 3VZIA 4YB6A 5LL6d 1QY7A 1NJZA 3OXLA 1GTEA 5KFJA 4RX6A 3DOKB 1VOMA 1I94F 1QAYA 3P3DA 2DGQA 3RYLA 4DL0C 2QEXS 4NLVA 4O3RA 5CCMA 2GMLA 4YDXA 1FJ7A 1MROA 3OR2B 3VAIA 1RTJA 2Z4PA 1RT5A 1XN9A 1LXJA 4KBIA 5L1IA 4Q44A 1QE1A 1NRKA 2BRKA 1XTZA 3EXYA 3M6WA 4NCGB 3V81A 5AXMA 4IG3B 4PPDA 2W9CA 3S6EA 1R8AA 2XSFA 2MJUA 3J7ZT 1U47A 5KFVA 5CXTA 1VGYA 1RQ0A 3FMBA 3HX9A 3GILA 4J9MA 5T7LB 3SQGA 2QIFA 2GJIA 5KFWA 3B4MA 4JI7F 3UE2A 2AU0A 1U1MA 1L3TA 3RRHA 3LGNA 1S0OA 2JX2A 3DOKA 5I42B 2LEAA 4UOCA 3N5FA 2MKHA 3M2UB 3TRGA 2RIJA 2QLWA 2JLEA 3A1YG 5MAOA 4NLRA 2W25A 3OR2A 4CO3A 1QVGR 1S1XB 2LEPA 4AXJA 2KXFA 3NS6A 3T1HF 4NLSA 3CCRS 5HROB 1JJHA 2FLNA 4QR2A 4NCGA 3CGIA 2MKIA 1IBKF 2E5LF 4IG3A 2NS1B 2W7AA 4HI2A 5IM0B 4J5OA 3PJWA 4M1KA 3FNNA 5T7LA 2QYCA 3K5LA 1VQMS 4LQ3A 1M5HA 3DDNA 2CJAA 3NNCA 1LKZA 5HL7Q 5KFAA 3GQCA 2HNDB 5I42A 2EBGA 3B78A 2WCXA 3ISZA 4YEAA 1W25A 2GQQA 3M05A 5KFQA 5DLGA 3PO5A 3M2UA 2PSZA 3H25A 5F8GA 3OQ2A 4KGMA 1Q7YT 2CQDA 3F56A 3QPIA 5LJ5Y 4EBCA 1NKCA 1S1XA 1U4BA 1S1VB 1NHVA 2LEBA 4DL7A 2D9OA 2ZH7A 1R8HA 5HROA 5HLFB 2W7PA 4I6WA 4N41A 1IJFB 5IM0A 1VQ5S 2CQ3A 2PDAA 3IC1A 2IYIA 4LVNP 2F4VF 4KO0B 4DSLA 2CPEA 2XMVA 2FLPA 1NH8A 1C0TB 4MK8A 2ZH9A 2HNDA 1RT6B 2X3GA 2VL1A 4F3QA 4Y2IA 4DV6F 2KZZA 4ZCKA 2RUGA 2Q43A 1S1VA 3ZZYA 3CCJS 2VONA 4ECZA 3GSDA