2L48A

Solution structure of the plyg cell wall binding domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GSIQKVKNGNVATTSPTKQNIIQSGAFSPYETPDVMGALTSLKMTADFILQSDGLTYFISKPTSDAQLKAMKEYLDRKGWWYEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tbd
rcsb
source organism Bacillus phage gamma
molecule tags Carbohydrate-binding protein
molecule keywords N-acetylmuramoyl-L-alanine amidase
total genus 17
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12123 Amidase02_C N-acetylmuramoyl-l-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2030 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l48A00
2L48A
chains in the Genus database with same CATH superfamily
2MGZA 2K3IA 1R6VA 4MYTA 2ZJQQ 2PA3A 1BQNB 4OJGA 4XDCA 3TA1A 2IVFB 1X4CA 2AU0A 2KTQA 4EI2A 5LMUJ 5AXMA 5KFIA 3G82A 3MMCB 4QR2A 1T7PA 3VR1A 3I31A 3BSCA 4DR2J 2BMBA 5HQ8A 1WJ9A 1TMMA 2DEIA 4ZVOB 3MD1A 3T6BA 4ZCKA 4ZLNA 5HMXA 1KEKA 1EZZB 2C2OB 2FHOB 2KJWA 5KT3A 2V67A 3AOBA 4J9QA 1RT3A 1VR6A 2QZ8A 1HI0P 2Q66A 1QTMA 2IM1A 5EGYA 1T0TV 2RDDA 3OR1B 1JXLA 2DIVA 5B0CA 1FKOA 4MTPA 4LBHA 2DEJA 4WKYA 4IOCQ 1UTAA 3KLEA 4USUA 3M8SA 1HBOB 1TAQA 4Z2XA 1YIJS 1OS5A 3X3UA 5D15A 1NO8A 2JC0A 4I68A 3EDRB 3KJQB 2J7UA 4K4ZA 3NL0A 3CMAS 1PJ7A 2RRBA 3MPVA 1C4AA 4RW4A 3K57A 1UEUA 4A8WA 2Y8WA 3DGVA 2VG5A 1EKRA 3VVUA 3CIMA 2NYHA 4MKVA 4U7CA 1HQEA 3HZEA 1HW8A 2DNMA 2VFRA 1RT6B 3LP1A 3MMJA 1Q1KA 1RTHA 4I6YA 4U95A 2DNNA 3G9CA 3I0RB 4L73A 3VAFA 2CQ4A 5B0GA 1ZTTA 1U1QA 2OH2A 2IY5B 2CJXB 2HRUA 2KZMA 1S97A 5I42B 2PD1A 4B08A 3S01A 1SH0A 4P6QA 1YZ7A 2CVEA 4J9OA 2CQPA 3FBBA 2MKKA 3DRPA 5AJ3J 4N76A 2HHTA 1MMLA 1UW4A 3HFKA 3BZQA 5JJBA 5F8GA 4YDDB 4AYBD 3CCES 1Q5VA 1T11A 2HZAA 3GWCA 3MM5B 1JNZB 2A1BA 3A3OB 1S7IA 3FRZA 4GMKA 3RAXA 2V34A 3T3FA 2V4QA 1S49A 2MTLA 3I55S 3PEJA 4CNZA 1SJFA 4M94A 4B3MF 2DHHA 2GW8A 4X66J 4CO5A 2ZKUA 4RUAA 1XMOJ 1OQ3A 1RUSA 2V8VA 3OPKA 4H4KA 2RUSA 4M5JA 4DR6J 4ECRA 4EBEA 4NYZA 1ZM9A 5G0RB 2LQ9A 3D0HE 3DOLA 4P73A 2QIFA 1NJWA 1HQ2A 1WHVA 1NBEB 5IC4B 2H65B 4M8LA 5KFGA 1VMBA 2CKWA 1CJKA 1HNVA 2XZDB 3DM2A 2NYIA 2AT1B 5FDLB 4F67A 5IQ6A 5KFHA 2RSQA 4B3RF 3DOMA 5F8MA 5M2PA 3MXHP 3GLJA 4FF2A 5BYQA 1QAJA 1HHQA 4FVMA 3UCGA 3J7AN 2P9GA 1R31A 3CDWA 2XO6A 4Q2MA 2LU1A 4DN9A 1XMQJ 1JMTA 3ITHA 1HFEL 4NA1A 4C8MA 2R7QA 3GONA 2KI2A 2XC9A 1TK0A 2CPYA 3IR5B 4I2QB 3L9ZA 4TY8B 5KFLA 2MB0B 2BACA 5DJBA 2IDEA 2EFPA 1UW9A 1ZM4A 5DM7Q 2KT5A 3M8YA 1U02A 1ACMB 3N9UC 3N6NA 1ITPA 1CC8A 4WFXA 1RHUB 1C1BA 2RDIA 1HMVA 2BA9A 2HNDB 2HNYB 1KQKA 2W7OA 2WW8A 2RUGA 3GYGA 1EQ0A 4MT1A 2CQCA 3ZTRA 3Q2SC 1FK9B 3BEGB 2W8LA 2G13A 1TU0B 4X4UA 3DU6A 4TQSA 3TJAA 5F41A 3NBPA 5E2QA 3HKZD 2RRAA 2FZGB 3LWMA 3Q23A 3TVKA 3V81A 2CWKA 1UFLA 1S57A 2LDYA 4I64A 2CG8A 2NXNA 4IFYA 1K9MT 2R2TA 1R8HA 1SVDA 2V5HG 3Q8VA 4LF5J 4PCQA 6FD1A 2KG0A 3GILA 5HP1B 2O67A 4ZN1A 2HAIA 1VBKA 2CJ9A 3R9LA 4HT5A 3HM9A 1H2VZ 5KFMA 2JEFA 2X1FA 1FKOB 4ECTA 2CZ9A 5L1KA 7FD1A 2WAQD 2ZH8A 1SKWA 4KT0C 4R5PA 4BWJA 1FERA 3NXZA 3HHKA 5KT2A 2Y3YA 3RJMB 5I3QA 2FB0A 4KGXB 1I6JA 4LF9F 3G2XA 1HPZA 2DCUB 4AQYF 3I5CA 4JI2J 1NZ8A 1S6PA 3ITHB 3W8GA 4QYRA 3ZZTA 4IUFA 1IQTA 3R7BB 4NL5A 3OL6A 3MCOA 4WFBQ 4FXDA 1LWXA 4PWUA 3H4BA 2ZM6J 4DV7F 1R6YA 4LSLB 4NLVA 4O23A 1BD6A 3UCZP 4X2BA 2RF2B 3QQCD 1X7VA 2I8EA 2AYMA 4H4OA 5GAGI 2F4VJ 4Y65A 4K5RA 4A4JA 1IKWB 3TVZA 1KC8T 2OHDA 1VBXA 1MU2A 1HI8A 4Y2KA 2R8KA 2VQFF 1P1TA 5HBMA 5IV3A 2W9AA 2CDQA 2Z30B 1KFDA 3VV2B 4G6VB 2UP1A 3KWMA 1F5AA 4USVA 1T03B 3TZYA 3BKUA 4GKKJ 2KZZA 3RRKA 5L1JA 2EI5A 5U47A 2XS2A 3GFZA 3NCPA 1BWEA 1VRQC 1UJ4A 2DGWA 2ZOFA 2HMIA 2VQEJ 2AHOB 2EK6A 3BKTA 2KN4A 1X4BA 4KKOB 4RX6A 1YRTA 4HEA9 3FBEA 3PFEA 2GIFA 3UN2A 2MKCA 1C1CB 2VF3A 3S1TA 2BJEA 1NH8A 4F04B 4A47A 2DR7A 2DNOA 1KOHA 4OFZA 2MMYA 3ENWA 2O5DA 3JXOA 3TEGA 1YI2S 1R43A 4TU7A 5ETOA 3BN7A 3PM9A 4I67A 3MR6A 2JOQA 1UA1A 3QT7A 4M5NA 1ULRA 4KGMA 2KXHA 3L09A 4JV5J 4F0KA 3I5AA 1CG2A 3L7OA 2ZH5A 1CJKB 1HNVB 2BRLA 2DO0A 2GO8A 2P9CA 1AA1B 3K2YA 4FP9A 4RNHA 5HVFA 3P45B 2R8GA 5IT4A 2UUWA 3D67A 2E5HA 5D4NA 2KL8A 2GIRA 4URSA 3J80Y 3AB4B 1XTZA 4Y2IA 5CYMA 4WFYA 5A0YB 1FEEA 3R97A 2BE2B 3W65A 5C24A 3PRVA 3QJPA 1S59A 3AT1B 2W9BB 2WOMB 3PNIA 3KLIB 4DV2J 4MKBA 4FPRA 3K17A 1HWJA 1TL1A 1Y11A 3MR7A 3V6DA 4EFAC 1RAJA 2GJFA 4DX7A 1F3FA 1FF2A 4K2JA 4TY9A 2KM8B 1C0UA 2H4YB 5A76A 2XEXA 4LFCJ 4B3SJ 1UL3A 2HNDA 2HNYA 3KKFA 4CYUB 2UUCF 2FVQA 1UMJA 4B9UA 1BGXT 3M2VB 2YNGB 4DR7F 4QOTA 1U48A 1WDTA 1TV6B 3LP0B 3QGPA 1SQEA 1TZ0A 1JNRB 1KSPA 4WFNQ 4J9MA 4JYAJ 1VQKS 3DRSB 3GU0A 4TYAA 3MEKA 2CQHA 4Y34A 4F8RA 4QR1A 3CO0P 1IBMF 4HLBA 3MI7X 1IWGA 3W8PA 1T03A 2UXDJ 1S79A 4FF1A 1JLEA 3OTBA 2V8DA 1IBKJ 1YWXA 1PC4A 2GMJA 1G1XA 1JLBA 3CGIA 3KK1A 5KFNA 1IR1A 2B9YA 1HBNB 4ICLB 5DZ7A 2RJZA 1RBAA 2E7VA 3DC2A 1UAWA 2QYGA 3MR3A 2DY1A 1RP5A 2GAHC 2KT2A 2XMVA 2HFZA 2F4FA 1NDPA 3ZFVA 5C24B 4MKAA 3NGDA 3KLHA 2AQ4A 2HPUA 4DSKA 1SXLA 3MHYA 3M32A 4FKYA 3HULA 3RUBL 4G1QB 1PC5A 4I6AA 5GAEI 3C6TA 1WD6A 2B5JA 3MAHA 3NAHA 4OX8A 5KFPA 2V8HA 1VJQA 2QT7A 3AB2B 3D1HA 3KJNB 2BOPA 2QYCA 3QWUA 1BHNA 1G7CB 1T9YA 1N5YA 5THWA 1YJNS 2IJNA 1RAEB 3QSYB 4L3KA 4CYUA 1MU2B 1NK0A 1VYAA 1KLNA 3M2VA 2BQUA 2HHWA 4UZBA 1S0MA 2DT9A 1HWUA 3B4MA 3JSRA 3FSYA 2XY6A 1ZYQA 1B64A 3BDPA 1MWQA 4NLOA 1JQGA 3MDFA 2W9CB 1CJVA 1UZHA 2FYXA 3FFIA 3ISZA 4PABA 5DG8A 1NK7A 2XSJA 3KNGA 3PV8A 5L38A 3QFHA 3MECB 1M5HA 2VQFJ 2XM3A 1JLBB 2VC1A 5A6WA 1JLGB 4W90B 1R27B 1K0VA 5DQGA 1V5VA 2RD5C 1U24A 2AMCB 4EUVA 1A7GE 1JKHA 3PCOB 1DHMA 5IT0A 1VC6A 2FJWA 1V5IB 2MQNA 1DTTA 4NLTA 1T9UA 4NI2A 1TKDA 4F3OA 2BM0A 2GQ2A 3M9NB 2ZBCA 1R8BA 3VGUA 3W64A 3FSXA 4X4NA 3ZO7A 5MAOA 2UXBJ 4KB7A 1RCXB 1H73A 2GV1A 2UZAA 3M30B 5C5JA 2DR5A 3IWXA 3BJYA 2V8GA 1U1OA 1F0XA 2HKEA 4M5IA 2OSQA 2VPYB 4FNHA 3TZXA 2DNPA 3V4MA 4DI6A 1N34F 2R9LA 1T02A 2BJ7A 4KSEB 5JUMA 2BE2A 2B7BB 4O4GB 1J5EF 1CQNA 4LF7F 4RBUA 3T1HF 4JP8A 2Z2YB 1U0HB 4ZP7A 3B6BA 1S1XB 2E1PA 3PX4A 4DSFA 2HS0A 1ZM2A 4DR3J 5KFRA 1VQ7S 3TAMB 3T19A 5E3AA 2HGMA 1LV5A 2DVIA 2D3ZA 4N7TA 1WHYA 1IBCB 3FSIA 2N7YA 4DSJA 3MF5A 2H48B 3W5YA 1N36J 1C0UB 2IBOA 1SJRA 2APOA 2G2YA 4FPIA 3H5UA 4J9UE 1S0NA 1YRXA 2E5LF 2OLWA 4KPYA 1IVZA 4JI8J 4DU7A 4IH7A 1CJTA 2KRBA 1YVFA 3P96A 3WQPA 4DR4F 2B9XA 5D6GA 2NSBA 1W7WA 4UUXA 3WHIA 2H5IB 4F0HA 4NXNJ 3H90A 4ID5A 3DLGA 5KFTA 3CCLS 4FVCA 4DV7J 4C3MA 1D3WA 4UOGA 4ZVGA 1X5OA 4DQRA 5J2PA 4LSNA 4WJBA 2B51A 3C14B 3N6LA 4YR2A 2GMLA 3W1YC 4JV0A 4FBUA 3DI6B 2CAJA 4CO1A 3M30A 3PR4A 2ZE2B 2BV3A 1DBDA 4DX6A 3UI3A 2QMWA 3GV8B 1LW2B 2MYFA 1PGZA 4X84A 5IT9Y 2YKNA 1OY8A 2BOAA 3OFHA 5KG2A 4ECSA 2JH3A 4ZDNA 1W25A 3SQGA 1PJ6A 2AJ0A 4LSZB 1WHWA 2BE9B 1S5ZA 2HQGA 2OPSB 4IOBA 3M6UA 5C2GA 2J0SD 1D9FA 1N52B 4LVNP 3VZHA 7FDRA 5JMNA 4YHHF 3GIKA 1YSJA 4GC7A 3K7RA 5LMNF 2XQCA 3A8KA 2B6AA 2CJAA 3I4HX 3R7SB 1M90T 2DGOA 3BSAA 1EARA 3FDSA 4IKAA 4KGVB 2V50A 3O1LA 2OPPB 1YJVA 1I51B 1KHVA 1LK5A 5EDWA 1TUGB 3CJKA 2I1RA 3OXGA 2LECA 2CQ0A 1R0CB 3R5BA 2I6WA 4WPAA 1U2FA 4B9LA 4IRCA 4CM0A 1B7YB 2EG2A 1P9YA 3SSRA 3TJ8A 4C2MA 4A8QA 2VBXA 4C6AA 1S6QB 3FUYA 3U1MA 3TI0A 3CJRA 4X65J 3V4IA 4AL5A 3GJSB 5HQLA 2OFHX 3EMTA 3MEDB 2HK2A 2WVCA 3AY0A 2FJEB 2UV8G 3NAIA 1G3OA 4Y2AA 5A2QY 4ERDA 2ASJA 4B3TF 2B56A 1XWLA 4KR0B 3VALA 4ECUA 3ZTSA 3GCXP 2BW7A 2FVPA 3PW2A 2EC0A 4EBDA 3HD1A 1RWKB 3BGUA 1Q8KA 2HW3A 1UCNA 3RB3A 1HYSB 1HBMB 2V2ZA 1S76D 2R7SA 1WSVA 2ZDPA 1M1KT 3K0JA 2MSTA 1BMQB 5ETPA 4DL5A 2BR0A 2E7WA 1CJTB 2FC8A 2IBKA 2QSFA 4NI2B 2CYYA 5IWAF 1AYEA 3K5NA 2FJBB 3IR6B 2OTLS 2A2CA 5EWGA 2R7WA 2UVRA 3NKYA 1X4HA 4ZPDA 1SH3A 4KE5A 3CEDA 1DLOB 1ZOTA 2M0GB 2MQMA 5G4DA 2BX6A 5KFDA 1P8GA 3NNCA 1FJCA 4AXJA 1DTQA 1QM9A 2GVZA 5KFAA 1NB2A 4Q8FA 1TR0A 2R7UA 3CD5A 3NGKA 1N32J 1TKXA 2EG1A 2PMWA 2AJFE 3CJ4A 1HW9A 1GXTA 3GFHA 3GSIA 1FDBA 3HVWA 4AL7A 1NDLA 1U09A 3C6UB 5KFEA 2E29A 2E1RA 1FHTA 3MM6A 4LFAJ 5BR8J 3TUZC 2ZZMA 3QT8A 2YNFB 4QBUA 1KLMB 4F4WA 3LOUA 4EMDA 4C48A 5CH7B 2EWHA 1RI7A 1U8SA 2FHJA 4O3NA 3R2DJ 2F8MA 3D2WA 2IC3A 4BC7A 2J0QD 2LCWA 3CWJA 4ID8A 3UDVA 5HQMA 1S0VA 2XNQA 4KH1B 4OYZA 2H5EA 2BXJA 2LXUA 2R4FA 2CPHA 3VGTA 3DGPB 4YY3J 4JB8B 5K8MA 1KVJA 2D9OA 1T95A 4ECYA 1WSRA 1JWWA 2FJVA 2O01C 4FXWA 4CLUA 4JI0J 2AV5A 4CLTA 2XTJP 4AL6A 1ZETA 2LKZA 2XYPB 1G2EA 5FD1A 4CDIA 4DV6J 3T1YF 2WB1D 3MAAA 3E01B 4ZPVR 3RTVA 3LP0A 4J90A 4WYWA 3W2VB 3THVA 1SKRA 1M5OC 2MHNA 1VIXA 4JI6F 1V3SA 4OYBA 4OZNA 2IIHA 2R7OA 1U2RA 4IG0B 4P52A 5FIIA 2CNKB 2XYHB 3DDIA 4CLWA 2ZHBA 4JI4J 1RXOB 5BYRA 4P2SA 4WTOB 4KH0B 3MR2A 3KJFB 2JRSA 2ZNZA 3CD0A 1SH2A 4P75A 3K5LA 4RZRA 1A9NB 1FDAA 3M2RA 3JTOA 4EGLA 2C22A 3NP5A 4B9TA 3JSMB 1SI9A 3KLIA 2EFOA 1G6BA 4RWWA 2ZZNA 1WG4A 3NCRA 2DD8S 1UVNA 3HFVA 1P27B 4LBIA 2D41A 2CADA 4JUZA 2BJ8A 3IFEA 3M2UA 2FGOA 2JHEA 3MPYA 4TXSA 2CPXA 1N48A 1UVIA 3BGFA 3FZBA 4IYQA 1VQLS 1RAHB 5ETVA 1D9AA 4DWIA 3H59A 4HR2A 1RT7B 5E3PA 5K8OA 5KTQA 4WP9A 1ZPVA 4CO2A 4MH8A 4D3HA 2IMOA 4WE1A 3C6TB 1NM2A 4HH0A 5CQGA 3Q8PB 2EVZA 1VFJA 2YQ1A 1BQXA 3IG1A 4AE5A 3I32A 1OO0B 1J5EJ 4MIAA 4ZVEA 4CIOA 3TUPA 1FX2A 2YTCA 4DUYF 2B7CB 4B3MJ 4FKXA 3DM2B 1PIEA 2H51B 4OI2A 4RR5A 1U1NA 3RR8A 4IRDA 3GP9A 4QPTA 4Y6IA 2E66A 1KKHA 1ZAVA 5JVHQ 1T3OA 1RWMB 2X1AA 2DY9A 5H9EK 2AZ1A 4B3TJ 5ETSA 3G6ES 2FJXA 1NK9A 2BVZA 3HFZB 5C25B 2R7TA 2GQCA 4C11B 4ECVA 3OVSA 2DR9A 2MKSA 2Z8QA 5D8HB 1WC4A 1PG5B 5D0EA 3J81j 3CTRA 3R1HA 2PFDA 3V2UC 2CJQA 4NMLA 1HLWA 4HACB 4I2QA 4QWEA 2AWZA 3NS5A 3M2UB 2LQJA 3R1LA 2DCLA 4DG1A 4ER8A 5BYSA 4PWDB 1FFSB 3ET6B 2NREA 2UU9F 4K4TA 1GX6A 1FE4A 4DV5J 5I3PA 3CJSA 2I9SA 4GO5X 3OTDA 5DG9A 1VRUA 2XY7A 5E0OA 4DR3F 3K89A 1H7XA 2FPHX 4USIA 2ZH7A 2PE8A 3K58A 3IG1B 3CDBA 2COLA 4KHPF 4NX9A 1GFWB 2N7CA 2HQFA 3NLCA 1CQMA 1Q0NA 1YJTA 1QUPA 2IRYA 2JVRA 3H8YA 3IC1A 3RB6A 2ASLA 1I94J 1KLMA 4LRAA 1FXDA 3EZUA 3U1NA 4QPXA 5J1EB 2K06A 1WKKA 2Q3PA 2IVYA 3NCQA 4N5SA 4DHVA 3N4WA 2A6MA 1WOOA 2HGNA 1WEXA 4UF4A 5KFUA 4K4UA 4OX6A 4DR5F 2J9DA 1S1XA 3D66A 3IWNC 3OXLA 1JLFA 2DXFA 2A2DA 3JQKA 3W7BA 3FZ2A 5ETKA 3TAMA 1RT7A 2ZFHA 2DNHA 2V4RA 4TU8A 2B9WA 3VHQA 1MROB 4K4SA 2BYCA 1W2BR 3KYLA 2LXFA 4F36A 4LBPA 2VA3A 4JI5F 4RW9B 3DLLQ 4ZVUB 2DKOB 4ZCLA 3ZZZA 4Q43A 1RWNB 3H25A 2R8JA 1WDDA 4F4KA 4NLXA 4OYXA 1I3OB 3H2VE 3J7YI 1TL3A 3BH7B 1GXLA 4PWDA 2E1MC 2HVEA 5KFWA 1UJ5A 1GMWA 5HK4A 1F9FA 1OIAA 2M9KA 3PZPA 1SC4B 4KHRA 3MTJA 2UU9J 2HQ3A 3QATA 2VDHA 2WVDA 1NDCA 3G4SS 2UV8A 1B99A 4O3PA 1KNZA 4LFBF 3UWTA 5DETA 2NSCA 2EFNA 2BQ3A 1S6OA 5A2QU 2XMJA 1WELA 2QV6A 4WU2A 3WC2A 3HXMA 4LR9A 1LW2A 4OZ5A 3ZTPA 1S9GB 2NXUA 3BO2A 2M2BA 4GO7X 4UTGA 2IHR1 1JKHB 2SXLA 1DARA 4PPDA 2XMWA 3D68A 3QMQA 4LFCF 3V6JA 1R0AB 1WC5A 1EIYB 2UXCJ 4A8FA 4MK8A 4H4KC 3GFYA 3TP2A 2VJVA 2VG7B 3R5GA 4ECZA 1KDNA 2HURA 2QTWA 3A8JA 3TJ9A 4LFBJ 3W5ZA 3G6VA 3KDOA 3GZ7A 3OV7A 3W3SA 2HWIA 4J5OA 3CCVS 3MEEA 2W4CA 5E33A 2CQBA 2LMIA 2RAQA 5A8WB 4DS5A 2VQEF 1S1WB 1S10A 4IDKA 2MPUA 3I87A 3SSQA 3Q8RB 3OSPA 2HHHJ 2JEJA 1AFIA 5AE1A 2GIQA 4QIVA 3SSSA 1FD2A 1UPPA 3DDNA 5KG7A 3T5LA 4ZIWA 4JI5J 4ZCIA 3HZGA 1FWPA 3D0IE 2MLXA 4TLQA 1N5QA 1Z2LA 2DH8A 1SJ3P 1S6QA 2B4VA 1TP7A 2WRMA 4Z37A 1VI7A 1SL1A 5LJ3Y 4C11A 2Q43A 2NUUG 3ONQA 2KFNA 1AFJA 4KGZB 2F5GA 5HJYA 4ITSA 1LXJA 1T9XA 4B17A 1YTYA 3V6DB 1X5PA 3O8WA 4TKTA 1AUDA 2ZH1A 3QIDA 3OW2R 2F40A 3EXCX 2CQIA 4KIAA 1NH7A 2CQDA 2CPZA 3TAQA 5A8KA 1QSYA 3N01A 4RKUC 4LF8F 3H2LA 1JLCA 1FKPB 1RBLA 1EB0A 4URGA 3AJ2A 4HYKA 1QSLA 1S77D 4UT4A 4WYLA 5CA5A 2QLBB 2FY1A 4K8RA 1RT6A 3DRSA 1FTCA 2Z56B 4ZVFA 3GIMA 3IN5A 3MR5A 2EFQA 3GYXB 5C42A 1DLOA 3AOAA 3HSDA 2BBEA 4NZ0A 3PW7A 1E6VA 2ABYA 1TK8A 2V9WA 3RB0A 5IC6B 4JI3J 2ACMA 4O0NA 3C46A 3QJJA 2WK4A 2XBPA 3C66A 4ZPBA 2YNIA 1QUVA 2PEBA 3IXQA 4IDKB 4XTTA 4Q5VA 1U45A 4DEZA 1N5TA 2ATCB 4F4AA 1F6TA 3BGRB 3DRPB 5D78A 3JYTA 2IA6A 1NSKL 2J6TA 2PDAA 4ED1A 4DSLA 1HYSA 1UWAA 2BE7D 2GAGC 3D5MA 1VK3A 3MM6B 1B0VA 4ES2A 3U27A 2RU3A 2CXEA 1JB0C 1X9WA 3TARA 1HIYA 3NOGA 4WCEQ 4CO3A 4PUOB 3AA9A 1FTRA 2GHPA 4BC9A 3KLGA 4NCBA 1RAOA 3EGVA 3Q22A 3SCIE 2E5JA 2F8HA 1U0SA 1VC5A 4N8OA 2RQKA 3F41A 5A8KB 2IAJB 4IFVB 3WZ0A 4ZHRA 3KK3B 1FJ7A 2V2QA 3KG1A 4KV8A 3R3TA 2B43A 3TQEA 3NMAA 1OWXA 5F0UA 4FF4A 3BGOP 1Y5LB 4RUCA 5B09A 3N6MA 2W8KA 4K4XA 4YHHJ 1X31C 2HS4A 2PIIA 3EWGA 2DXDA 3UR3C 1FRHA 2ZWPA 2R42A 1S72S 2HHHF 2Y8YA 1UJ6A 4OLOA 3ULHA 4NLSA 4KYZA 1IM4A 2W9CA 2CPIA 1EKSA 8ATCB 5H9EJ 4BWMA 2Q6CA 4OV6A 1S1UB 3BYRA 1IXKA 1PAEX 4M5LA 2YQ3A 1O8BA 3QO9B 4RPFA 5ETQA 2HYIB 1CS4B 3LPEA 1CLFA 1Y0HA 2HWHA 2HFVA 4U8YA 2VFSA 2NPIA 4YP3A 2VICA 2O66A 4HI1A 1NU4A 2KRRA 3BBBA 1QAXA 2D9PA 3QYYA 3L7UA 5GADU 3JSBA 3KLFA 3VAIA 2DK2A 3MTKA 2A0FB 1D1UA 4PRFA 4UZCA 3PKYA 3CJ0A 2KFZA 1XNQF 6FDRA 2MGZB 3ETMA 3UDLA 1QAIA 3DLEB 4B02A 3CF5Q 3DYAA 3IAS9 3R27A 4USHA 4AQYJ 1Q4RA 1WHXA 4J7CA 4WXWA 2PGCA 2IDLA 5GMEA 2YNIB 1Y5NB 2ASYA 1ROFA 4ZPTR 1RA6A 5CYQB 4DZDA 4C4WA 3T9NA 4P7TA 3QZ8A 4ED0A 3QIPA 4DL2A 2KU7A 2LFVA 2NXCA 3K8WA 2Y9HA 2QLFB 3OBIA 2W2OP 5LMUF 4F3QA 2GNKA 1FX4A 1Q8IA 2F9JA 3PJ9A 3E51A 4NLRA 4WZMA 1ZTWA 2B9EA 1NHVA 2KXFA 4PXEA 1SQGA 1RE1B 3LPYA 4ZITA 4QWCA 2RE1A 1Q53A 5AE3A 1XNRF 3UO0A 4ZJOA 1NSAA 4TNOA 4C0OC 5CD4A 1RLCL 1HR0J 2IM0A 3A4TA 4CZCA 4DV3F 2VB6A 1RWVB 5KFKA 2BQRA 2I2YA 4DR1J 4JI1J 1X8DA 1HBUB 3BREA 3MCNA 4PR6A 3RU0A 4Q44A 1KQGB 4C3LA 1M1GA 2FGCA 4LF6J 2M8DB 4XO0A 4YFUA 1VRUB 2A3JA 4HI2A 4CRJA 1I94F 3BGLA 4C3KA 3KG0A 4HHUA 4ED8A 4C98A 4A8MP 1RT1A 2P5VA 2VZ9A 5IV4A 2E1AA 4I7FB 2ZE2A 2H4WB 2ALZA 4DPTA 4OMFG 3T1AA 1SUQB 6AT1B 2YWKA 5I42A 2X1GA 5GMDA 1NK6A 3M8QB 2CPJA 4ILLA 2OMOA 2XG8A 1UETA 1Y9OA 2FZCB 5LSRA 3KHHA 4X64J 1SJQA 3KHRA 3J7Z5 1N6QB 3B54A 1PYOB 1Q81T 1V3ZA 4PKDB 3MMBB 2QE5A 1RGVA 3D3BJ 1KD1T 4I56A 3A12A 4WZQA 4OYWA 1RDRA 3T1HJ 1T3NA 1SKUB 1Z4UA 2KYZA 3N0VA 2QLXA 4V1Ak 2DRAA 4QIWD 3WIUA 1PILA 2OPPA 3AXKA 1IKVA 1BE4A 2RQMA 2DTJA 2RB7A 1AB8A 2M7SA 1SJ4P 4E8UA 1M1HA 2Z2LA 4OYOA 3PR5B 3KK3A 4NXMF 1SL2A 1O0PA 2YBVA 2MSSA 3MPDA 4HKQA 4LF9J 4FYVB 1Q8BA 1YG0A 4USJC 4ATNA 1S7HA 3I9V9 3OUYB 5E7OB 3HSGA 1Z1ZA 4C8KA 1GAOA 3S8SA 2ZC3A 5KG1A 4OZ1A 2D69A 3GMGA 4WTYA 4I2PA 4DUYJ 4U96A 4ZN3A 1JJCB 1U1RA 3I5BA 4ZMMA 5F9LA 1J5OB 4OI4A 1P6TA 3TNVA 1QE1A 5LMNJ 1S1UA 4EO8A 1NRKA 1R8AA 2G2OA 4YQWA 4QQBA 2OI2A 2RQ4A 2YKAA 3ETOA 1AUSL 2HFUA 5DDPC 1EHWA 1NCLA 3SEOA 2MZSA 1RADB 2YNHB 1FNMA 4Q0BB 3KDNA 3IBFB 1HBUA 5KFXA 4CH0S 4RU9A 2VOOA 3PACA 1S0OA 4ZVSB 1U1MA 3UD3P 5KOXA 3MFIA 4DR5J 1MLAA 1C1BB 3HX9A 1NHKL 2VL1A 4JOUA 1VRTB 2J8SA 3ICLA 4C0BA 1ZPWX 2XGQA 4B3SF 1E6YB 2F8EX 1HNXF 2M5YA 4ZK7M 1H2TZ 3RBDA 2P8IA 2C2RA 2IYGA 3THTA 2V69A 2MHEA 1A0OB 1NUEA 3D9BA 2VPWB 3OUYA 3FBCA 1X9SA 2AYEA 3AA8A 2MZRA 1VDHA 5DLFA 2RKIB 4DU8A 4X4TA 3ZZUA 2AYBA 3TR5A 4X4PA 1BXNA 2NCKL 5F3ZA 3M1VB 3MMBA 1F9EB 2B4PA 1YX2A 3GIJA 3HVRA 1R0BG 3CSKA 3KUHA 2CRLA 4E2FB 1TFWA 2P9EA 4DPOA 2WVBA 2C28A 4K0KJ 1WC6A 1JIHA 3EXYA 4WP3A 4TQRA 4NLPA 4Q45A 4YR0A 1Q95G 5T41A 3IAM9 2FHJD 2D3UA 1X5TA 1P9QC 2M3DA 3BV8A 3EUNA 2O1PA 1NPRA 3SYZA 3FVYA 4H4MB 4RUHA 3T5JA 3B8HA 3DN9A 1N5YB 2IMWP 1XR6A 2MLYA 2WBRA 5SUHA 2R8IA 1HD1A 2K8GA 1FT8A 1OY6A 4M1KA 4DZ6A 2MQOA 5DDQC 1SKSA 4BS2A 4PG7A 3OD2A 4HHHA 1FRMA 4NXMJ 3C15A 1H7WA 5DRKA 3LWLA 2HLTA 4ID5B 3JS9A 4IO9Q 4K7QA 3DRXA 2RNEA 4PXBA 3A8IA 1U8WA 3FFIB 1U6FA 5L39A 3PKMA 2QLJB 4RL1A 1NMEB 1V6HA 4NLWA 5AXLA 3EGNA 3TA0A 4CLLA 1DURA 4ELTA 4OZ2A 4QR0A 2F3JA 4TLRA 4P71A 3MMAA 1H38A 4DV4F 4PG8A 1PBAA 2WVFA 2XMMA 2KO1A 3L4BC 3SBMA 4ED2A 1KTVA 1IJFB 3FQKA 3ZNJ1 2LP4A 4NZ6A 3BYPA 4DFPA 4U7UD 1CULB 1XERA 3CC4S 2ZNYA 1Y4ZB 2RHSB 5B0EA 2JC1A 1X4AA 1JLAA 2CJBA 3NY0A 4OLPA 3FCHA 4DXLA 3HLUA 3QRPA 3TZZA 1LEOA 1RACB 1S1WA 4WIIA 1VQMS 1FNXH 1DQ8A 3M8PB 1H72C 2DHSA 2VODA 2YX7A 2OO4A 4P2FA 1PO6A 1DZ5A 1QSSA 3I0SB 4MFBA 3TEHB 2C2NA 4ETXA 4XDDA 3JTPA 3FEXB 2VPXB 3R6LB 1REGX 2M4MA 4F26A 2IVMA 3D1QA 4W92B 2M70A 3DLKB 4M5KA 2XCPA 3EPIA 5MLCV 4JI2F 2C2ZB 3UDCA 5H9FK 4LF1A 2IRXA 1LWFA 1LNQA 4RO0A 3RW7A 5D3GB 1AROP 1M0SA 4B9SA 5K9FA 3KMSA 3DXSX 3O5TB 4YS2A 2XI2A 3ZZYA 1QE1B 4L72B 4U9RA 3OL7A 4DV3J 4ILRA 3D6TB 1TKTB 1M5VC 2HNZA 4DSEA 4FYXB 4KRWA 1S6PB 5KFCA 4DBQA 1HNIB 4B9MA 4O3SA 4JI0F 1H0HB 2Y1IA 1NKCA 2LQ8A 2V8PA 3JQJA 1WEYA 3W9JA 4LF5F 4KJIA 2XMKA 5CXTA 4QJVA 2R2RA 3HHLD 3RYLA 2WONB 1SBRA 3WC0A 3UVJB 1VBYA 1J2VA 2J9CA 2ZD1B 4LR8A 2QSWA 1L3VA 2YKPA 4DS4A 2JL9A 3VGSA 5J2PB 1TL7B 4FBTA 2N3OA 2WHOA 1L3TA 2LA4A 2ZH9A 3DLEA 2E9ZA 1SIZA 2BJ1A 4RWXA 4O3QA 4LFAF 4I69A 3M8PA 2BJ3A 2HHPA 2PA8D 1EP4A 4M5GA 3QSIA 3PYDA 4PG6A 4IH6A 3U7JA 1KP6A 5T7LB 4F25A 2GVZB 3GYNA 3BN4A 1JJ2R 2NXEA 2LDIA 3MD3A 4ZP8A 2A6OA 2HMIB 3Q86A 2GHWA 2YKNB 1AXQA 1ZAWA 4JI4F 3X1LB 4KGKA 4YB7A 2CJYB 1F2GA 1SPBP 2AEJA 4EZ6A 2UXCF 4JV5F 1RKIA 4E0DA 3E3XA 4RU2A 2E5LJ 3HI9A 4MAKA 2ZH3A 3KLGB 2X7IA 3FMWA 2JX2A 2MJUA 3KG4A 5KG6A 4X4VA 4R25A 5I3UA 2IA0A 1UPMB 4EYIB 1OSDA 1GEHA 2ZOMA 3DYAB 3C2PA 3BBFA 1SV5B 1PSDA 3F44A 2JFKA 2NXJA 3IM8A 2CQ1A 2JLGA 4GVBB 1VCTA 1R8PA 3CVKA 4HTJA 5DQHA 3D6FB 1HMVB 4LIRA 4YUDA 5J2MB 2GJIA 1GXUA 2L48A 2PN6A 1VIOA 2XLIA 4EU0A 5E41A 3E2EA 1VQ6S 3B78A 3W2VA 4YB5A 3JSYA 4ZVHA 2F63A 3LP2B 3RG6A 3DCAA 4L75A 1ZM3A 2XI3A 3CO9A 4PQUB 3US5A 3R5CA 5J2NA 1RT1B 2AKWB 1CEZA 3S6EA 1SQFA 1N32F 1OMSA 2CNNB 3MMAB 4WIQA 2CQGA 1CJUA 3Q8SB 3BQ2A 1UA0A 3HJFA 3MECA 2OEJA 1S4EA 1VISA 3LTOA 4I4BA 4YB6A 1UFKA 2K1RA 4NLGA 1K73T 4LF4J 2GS8A 1XEZA 3MM9A 1YRUA 2OELA 2VG7A 3BS9A 2EKYA 5J2QB 2HQIA 2EXUA 2Z57B 2FJDB 4KHPJ 2XS7A 3IRXA 5K8PA 3TRGA 3AQPA 2JLEA 3AH6A 1KRPA 2X1BA 3MUVP 1IKYA 1FK9A 4OZJA 2OEMA 4A8XA 3PW5A 1S1VB 3FNNA 3UPFA 3VTIA 1YHQS 4JV2A 2QN6B 3NGUA 4N8NA 3NS6A 2ZHAA 2ZC4A 1DTQB 1Q7YT 3FQLA 1A6LA 2RHQB 3J7ZT 1U1KA 4LRFA 1IKWA 2GMHA 3DRYA 2BANA 3KLVA 1TKZA 1B0PA 2R2SA 3H5YA 3MPWA 3QT5A 4LF4F 2W1BA 4LF6F 1WG5A 3NGTA 1IM6A 3NRBA 4L74A 3WX4A 2QMUB 4QW9A 4Y0FA 3QZ7A 1TAUA 1GQEA 1VS3A 3CC2S 1RTIB 4DFMA 4IR9A 2ACYA 1NLKL 3DGPA 3HHDA 1HNWF 2H1YA 3OTOF 1D8ZA 1KBRA 2G4BA 5L8RC 1OQ6A 1F3VA 3C8YA 2L41A 1GT8A 1KONA 5D0GA 1ZAXA 3HMJG 1QDUB 1LFPA 4ED4A 2AJ1A 4CP5A 1W26A 4KKOA 2DISA 4DL6A 3D28A 5C2CA 3OQ2A 3UDEA 1C2PA 2P2CB 4U67Q 4CCHA 2R7XA 2BKOA 4PQAA 4MIWA 4J9NA 1GTEA 5J2MA 2Q79A 2VONA 2NLWA 2XMTA 2YQ0A 1X4EA 2DNLA 4P9SA 5CCLA 3F0NA 1T9VA 2ZHOA 2ZJPQ 3J81U 5JVGQ 2HAFA 4WK3A 2ERRA 4J9LA 2OGUA 2FQQB 1YZ6A 2VG6B 4NA3A 2AD9A 1RLDA 4DCJB 3DLBA 2GGPA 3H40A 3ENAA 2UUBF 3JSMA 4C97A 4TYBA 2KXNB 4N56A 1CJUB 1U1PA 2CPFA 2FUG9 5KFSA 2QC3A 2GVDA 1KR4A 1WORA 2V4JB 1HWIA 2OPQA 3DRRB 1LK7A 4C7QA 2ILYA 1KTQA 2YKOA 3I6PA 3LALA 2BJDA 3UFCX 3W60A 3GIRA 4A8SA 1C1CA 2VA2A 3CMES 2BZ2A 3DNCA 1P1LA 2W2MP 5GADI 3PW0A 3ZNUA 5KFVA 5D0RA 4U8VA 3NS7B 4YOEA 3U1LA 1I1GA 3DLJA 4DCOB 4JI6J 2KG1A 3G82B 3MMCA 4RW6B 4G65A 5FLXU 3CCJS 2MLZA 1QVGR 1RWXB 3W66A 1RHKB 3M6VA 3OXFA 3U02A 3W63A 2VFVA 3PYFA 2BUNA 2C3YA 3LH2S 2HBRB 4NMXA 4ZP6A 2F7VA 2MJNA 4NCGB 4NRTA 3SCJE 1IJEB 2BKNA 4FYWB 2KFYA 3CCUS 3Q8YA 1TUVA 2B8PA 1URNA 4KC5A 2W4PA 4P2MA 1N0VC 1RHMB 1X0FA 3IS9A 2XCAA 5M2UA 2ZKTA 2OUGA 3HHEA 4USWA 1WC0A 3KLEB 3SFGA 3UNYA 3UW1A 4N77A 2OAUA 3P5BP 2MQLA 3H0PA 4OHYA 1XN9A 5H1SV 2ASDA 4DG1B 3CNQP 1K47A 1Y00A 2DXEA 4RW4B 1R89A 2BM1A 3E8OA 3HT3A 4NA2A 3CPWR 2MKIA 3SV3A 3ZTQA 4DQIA 1NK4A 1FXRA 1U47A 1HWKA 2K2PA 3KTQA 4J9PA 4ED6A 2ZEJA 1BLUA 2H9ZA 4LJMA 3Q24A 3SV4A 1Z2ZA 1B7FA 4CQ1A 1LQ9A 3C15B 2JZ5A 5F8IA 5KFJA 4QIGA 1O51A 4DV1J 1R7IA 4U6PA 3C14A 3AD8C 2XWXA 5FLXY 4GKKF 2JSXA 3KXDA 5D77A 2YY3A 1GMWD 2VG6A 1UP1A 3J80U 4DV5F 2OMLA 1BQMA 3TQ1A 3I0SA 2IPOB 4MFBB 5DGAA 3AJ1A 4NCGA 1S9FA 4CWBA 3NEKA 4DPYA 5EHHA 4ZLJA 4X62F 2N4DA 5J1EA 1VC0A 5CD4H 2O3DA 4JBCA 2FIUA 2R8HA 4ED5A 1FFWB 4X4RA 4OZ0A 2OPQB 4FDFA 5CABA 5KT7A 5D3GA 3CULA 2UUCJ 1AW0A 4PG4A 4X4QA 1UWBA 1O5JA 2IYIA 1KVIA 4ED3A 3BH6B 4O3RA 1NDKA 2HEKA 3AD9C 3CJ8A 4X65F 3LUYA 3OHAA 3IRWP 1ZH5A 3GSDA 2JWNA 3IA0A 2QA1A 1S9EA 1OSCA 2MY8A 3EPGA 3D54A 3V6HA 4Y00A 1WTBA 1XQIA 1NZAA 2KHCA 2D3O1 3R5AA 4QU6A 4PAAA 2WONA 2HHVA 2FLLA 3GJTB 1DTTB 3UVJA 3MAAB 4DJBA 3DOMB 3MUMP 3GR1A 1RT2B 4I7FA 2DRDA 4NLDA 4NEYA 4RLEA 1Y7PA 3EVOA 3G8TA 3VAJA 4NOHA 3KNAA 1WC1A 2HNZB 1RAIB 2GQQA 3CJTA 3HHNB 4C8ZA 4HTIA 3G6XA 3VAKA 4DLGA 1RJJA 2PO4A 3H2UB 4NLUA 3ZTOA 3QGGA 2GJ2A 4C8OA 1W2IA 1IKXA 2KB2A 2OIHA 3RAMA 2XLJA 3GB0A 4O0IA 4LRCA 3CDAA 3T9ZA 2OJ3A 2C2DA 4J91A 3NMRA 1RTDB 3R2CJ 3TW0A 2XNRA 2X51A 4J9VA 5E5NA 5IOLA 3PDNA 3LGMA 2RU9A 2HLUA 2KVQE 3CJ2A 2XZTB 4USTA 3ZZOA 2LYVA 3G86A 4V19X 4RBVA 5IM0B 2P6SA 4ZJLA 1JX4A 3TZWA 1U6ZA 3ENVA 1J27A 4ANCA 4F2SA 4JI7F 3BSNA 2Z58B 1PJ5A 5T7LA 3HF5A 4DFKA 3CT9A 4QWBA 3TVYA 3AAWB 3B4DA 1FRIA 2KYXA 5HP1A 4RW7A 1TL4A 1KWMA 2Z2MA 2W2NP 1T94A 5KFOA 2YVSA 2VHGA 3H4DA 2QL7B 1VQ8S 4QW8A 4ANDA 1NXIA 4ECQA 1KN6A 4ES1A 4IG3A 2DNQA 3THPA 2J9DE 2CQ2A 4BCAA 2CWXA 2HS3A 5GAEU 4QWDA 5ADZA 1NJZA 4YY3F 2Y0BB 3HCXA 3D4JA 5A8RA 1N5SA 5GAGU 1UWBB 2PMHA 3F56A 2IRUA 1KQSR 2LXIA 2XULA 2J8AA 4DLEA 3AOCA 4F50A 4LF2A 5K14B 4MIBA 3M8WA 4QWAA 4IOAQ 3CJQA 2ZUAA 4QZVB 3NGRA 5C42B 4CT8A 2AJQA 4WBFA 4JV1A 1B4SA 1E6VB 3IM9A 3KK2A 2MZTA 3QPIA 1VRTA 5LM7E 4OJ1A 4ZVTB 4L6V3 4DV0F 3MFHA 3GR0A 1QLNA 2QL5B 4O4RA 2KM8C 1V3RA 1LFWA 3M2RB 5HJXA 2GO9A 3A1YG 4ELVA 1U6BA 5ETMA 3W62A 4LR7A 2CA9A 1VQ4S 4IQXA 1FA0A 1VLOA 2VASA 3F73A 2CNOB 4YN3B 1YJUA 2XSFA 3HVAA 2OD6A 5D4OA 5D4PA 3M1VA 3TAPA 2K1RB 1B70B 3M6WA 4YR3A 2PSZA 4J9RA 1H3DA 2POKA 2VFUA 3VGVA 3PYGA 5DZ6A 4OX9F 1Q7LB 3ZZ0A 2MZJA 1RHQB 5HLFB 1PKUA 2Q6BA 2ZBIA 4PUOA 2JEIA 3IR7B 3FEZA 5DO2A 4DR7J 4LF7J 2VOPA 4CH1A 3CD6S 1OY9A 1VQOS 3OTCA 1F9HA 3QJLA 5HSPA 1WI6A 5M2RA 2WCXA 4WKRA 2VG5B 3CE8A 1RWPB 4OI0A 4FYYB 3TO8A 4RW9A 2I5JA 2FLNA 4ALZA 1RT2A 3ILIA 3LF0A 3R8YA 2RQCA 3QLHB 4N47A 3VZIA 5GMKa 2FVRA 1TQLA 2V2KA 1ZA2B 5AXKA 4YB1P 1NEEA 2DO4A 4RW8B 3MURP 1CC7A 1R8CA 1RTIA 3N79A 3OT9A 4DCPB 2WOMA 3SFUA 8AT1B 4J37A 1Q86T 1GMUA 3T6JA 3KHLA 4UW2A 4YDXA 3HO1A 3VWSA 1T9TA 3QRRA 2E5GA 4DPUA 1BC6A 2HRYA 4HACA 2QL9B 3I9ZA 4XK8C 1WG1A 2NPFA 3R7NB 2MQQA 3M8QA 5HO4A 1RT5A 4X62J 2YH1A 1XMOF 1U4BA 2CNLB 4M5DB 5K14A 2J76E 4CLPA 2QGFB 2ZH2A 2FVSA 4ES3A 2GVDB 4ENOA 5SZTA 2VJUA 4ILMA 4QIFA 3HDSA 1HL6A 2XY5A 2PI5A 1C0TB 5EN1A 2DYAA 2MKYA 5IM0A 5ETRA 5BXIA 1F60B 3TUJC 2YKMA 3MUTP 1O6XA 3MOZA 3BO4A 4ELUA 3HK2A 2HZCA 4LVOP 1YLXA 3POTB 3QAEA 3NGSA 5KG3A 5J1PA 3LAKA 1UVKA 3QWPA 5CYQA 4H54A 3W61A 2DNZA 2KDOA 2HIQA 2LA6A 4PYDA 2V0NA 5C7PA 3UN3A 2YX4A 5KOWA 3EVMA 1N56A 3BQ0A 3UNGC 3EDQB 1XMQF 1DAXA 1QAYA 2CDRB 3C6UA 3GIIA 3E01A 1BUXA 4RNMA 5HROA 2DH9A 3FCWA 4IG3B 3W2WB 2RILA 5E3QA 1N36F 4QU7A 2VKRA 2RMLA 3AJDA 1HNIA 1HARA 1WKJA 2HSEB 4TY8A 4ZLPA 4OI3A 4RBTA 2ZH6A 3T5HA 2OSRA 3R6GB 4ZLLA 4DUZF 2GFFA 2W4DA 1S1TB 4TVAB 1WNEA 4M63A 1WUUA 4NASA 5KFFA 1RB0A 2FD2A 3BKFA 5L9NA 3G96A 4C8NA 5EWEA 4DR6F 1VHFA 2AW0A 5KFYA 1YJWS 2WBMA 4WWSA 5L46A 2C2EA 2HZVA 3HSZA 2G0JA 4KHMA 2N4CA 1TL7A 1KVKA 2EKNA 3FBFA 5EWFA 2ZD1A 4DPXA 2V2VA 1NJYA 1C0TA 4RUBA 3RAQA 2G1DA 4A8OA 5BR8F 1YKWA 1HD0A 3ADAC 3EICA 4WE1B 2VU5A 4DR1F 4JI1F 1RT4A 1HNWJ 1FRLA 3UQSA 2GHVC 4MK7A 1EP4B 2OPRA 1S9GA 4K2XA 2L9NA 1H6KX 4PEOA 3TX8A 3OVAA 2VUGA 3QBCA 4ZP9A 3ZZPA 2FVCA 3DRRA 1U25A 2MKHA 1JLGA 2E5IA 1C4CA 2PMZD 3EZ5A 3CC7S 2XLKA 1QTNB 4O4GA 4OL8A 2X3GA 4F7VA 5ITHA 2J6SA 2A18A 3D6HB 2DHGA 4F0MA 2PI4A 5IT9U 2QA4S 1FCAA 1F5BA 5DLGA 4EYHB 1RU1A 2RH3A 5I3UB 4X64F 2L3MA 1XK8A 3H42A 3O6QA 4OYMA 2YWFA 1TTHB 1XIQA 1IKVB 4IRKA 2FJAB 3VAMA 3GV5B 2ILZA 4B9NA 4CTAA 3HP6A 5KT4A 3HVTB 3PX0A 2KT3A 3RB4A 1DRZA 2PFFB 1SC6A 3QFWA 4KO0A 1UEKA 2XB2D 2XZWA 3PRDA 4QYZK 2MDAA 2AP6A 1NK5A 1UVLA 4NEZA 5EUHA 2VBYA 4LF8J 1FRJA 4W98A 4UOHA 3DXBA 2L08A 4CLFA 3M8RA 3JAMU 4I1TA 3OR2A 1MWZA 1RTHB 3NWRA 4LSNB 5KT5A 1HHSA 4GRSA 2AGQA 3OSNA 1K44A 3LGNA 1WEZA 3DI6A 1XR5A 1TVRB 3SCKE 4JI7J 4E98A 1Q78A 4GC6A 1HR0F 2LEAA 2HG4A 1KS2A 1NNDA 2DB1A 1UKUA 3J7YU 3V6KA 1IKXB 2IJFA 2L9WA 2QG9B 2FZKB 3EGWB 4A48A 4OHVA 3MM9B 3FRYA 4NZ7A 2D74B 2IM3A 1RBOB 2NS1B 1FRXA 2OPSA 2YNHA 3CCWA 3Q83A 4K59A 4DL4A 3VVTA 3LAMA 1MN9A 3ILLA 1RAGB 2AX0A 5D0HA 2JFDA 2NZCA 3CB4A 4OX9J 1YBUA 3B82A 3IP0A 4ZVQB 5KG5A 1M5PC 1N0UA 5FJ4A 1IBMJ 3H7HB 1IUJA 1IKYB 4G1QA 3H5XA 3IBCB 1UFWA 2B5JB 1S1VA 2EW9A 2IM2A 3EVWA 4CTAB 5B08A 5HVGA 2ZJRQ 1FDDA 1HA1A 2DGXA 2HFSA 2QFIA 3QGIA 2CZ4A 4AXIA 5A6PA 1IBLF 3SIPB 1CPZA 2H5JB 2C3UA 3BGRA 1OYDA 2ROGA 3D3CJ 4PZVA 3BPSP 2L9DA 2YKQA 3ISND 2G9OA 3IWLA 1HI1A 2C3OA 3UN5A 4WF9Q 1AZSB 3RBEA 3MWBA 4NXNF 1YJ7A 1T9WA 1D8YA 3PIPQ 1T8EA 4BHQA 3CDUA 5HMYA 2U1AA 2HK3A 1JLFB 2KKHA 3FCVA 4Q7AA 4C8YA 3I82A 4DOZA 1S1TA 5F8HA 2LVWA 3ZC4A 2PEHA 4F3MA 2EBGA 2HRTA 3RBXA 4DL0C 2EBEA 2HGLA 3W5XA 4R8UA 1WKLA 2ZUGA 3DMJB 1F2HA 1ZS6A 3G8QA 3N5BA 4MJKA 4Z7CA 3EX7B 1N4LA 4N41A 2FLOA 3BBCA 2YNGA 2PT0A 4H4MA 2D1CA 2RS2A 3RW6A 1TV6A 4OV1A 1ZBTA 3L3CA 4ZVRB 1IR0A 2B3TB 2CFXA 2DNKA 1S6UA 1YK9A 2DJWA 1TL3B 1UEVA 2JVOA 4HHJA 1SL0A 1EJ7L 3AODA 4UUWA 3M7VA 4NYPA 4TN2A 5HATA 3BQ1A 1X9MA 4F2RA 5DGBA 2IFXA 2QX0A 2OD4A 2RRNA 3CDEA 3W9HA 1JLQB 5F8JA 2CJKA 5HMWA 3EJMA 2C3PA 1JLEB 2C1EB 2C3MA 2OEKA 2WB4A 4IFYB 4P7VA 4DFJA 1K8AT 1S4FA 1RABB 2V68A 1GTHA 4OYPA 3SDEA 3V81B 3GJRB 3KK1B 1K1SA 3GJQB 5HANA 1HBNA 1JJHA 3MPUB 2FHMA 2DR8A 2YNFA 1LWEA 4OHXA 2I38A 4FS1A 2A10A 1HNXJ 4DR2F 3DFEA 5K5MA 2B0GA 2C2MB 1NHUA 3WDOA 3IMQJ 5B0FA 1B3TA 4RNOA 3CUNA 2FLPA 1U2CA 1D09B 1RK8A 2ZBQA 4NLYA 5B0BA 2HVIA 5L9XA 1CBKA 3OJUA 1Q16B 2VC0A 4TU9A 3VAHA 3HVTA 1SC1B 1VQYA 3SQOP 1ZZNA 4WK1A 3EYZA 3WX8A 5L1LA 4G1IA 4B3RJ 4IR1A 3MCMA 2I0XA 2K3KA 2LEBA 3LW5C 1KHWA 1BY9A 3MM7B 4H4OB 4P2XA 5FDLA 2JJ4D 3N28A 5HMZA 1U26A 2J9EA 3CXCR 1YJRA 1NK8A 1RKJA 3DLKA 2F4VF 1DQ9A 3EZOA 1N33F 2UUTA 3QLHA 4IG0A 3CCRS 5DG7A 1U7LA 1L3SA 4O3OA 4EWTA 4DMZA 3CMQA 1TKTA 1TUWA 3PJXA 3LP2A 3PG9A 2WVEA 3LO3A 4ZPCA 5RUBA 3P4UB 2J0XA 3QAUA 3AQOA 2HHSA 5ETTA 5LOQA 1WWHA 3GFXA 1LWEB 4ZOSA 3PIOQ 4M5DA 2M52A 3UR0A 3N5FA 3L7PA 2XHWA 2DPIA 2B4UA 2QJ3A 3P8BB 1X60A 4IO1A 3BR8A 1TELA 2GX8A 4CLZA 5LXRA 3IGVA 2K7JA 1N8RT 4FXVA 1UVMA 4KPCA 4DUZJ 1N34J 5EX3A 2W7AA 5AE2A 4PWWA 3VF0B 1NB7A 2N3LA 5H9FJ 5B0DA 3H98A 2CZVC 4NE9C 3MGJA 2ALYB 4K5SA 4CO0A 5BJRA 2J0WA 4S0MA 2AYGA 4B3OB 3J81Y 1RWWB 3PYEA 1FRKA 2Z4PA 5IS2A 3OJSA 1RTJA 4XIUA 1LKZA 1MW7A 4WP8A 3ISNC 4DV4J 1RWUA 1SCJB 3R5JB 4R5PB 4FS2A 4AFFA 3CCSS 3WIVA 1U0HA 4ETZA 2UVUA 1GK8A 1HKAA 3H20A 2WZ1A 4XPEA 1KQFB 4ED7A 1U1LA 1VQNS 5C25A 4KTQA 2PC6A 1FWLA 1S12A 2MQ8A 3BM7A 1XMBA 2E7XA 2ZOGA 2XWYA 3DOKB 3FGVA 3IBWA 2ROEA 2C42A 3DHWC 2W9BA 2CQ3A 4DN0A 3GV7B 3PVXA 3NOCA 3S7RA 2XS5A 2Z0GA 1S9EB 1FEHA 3PTWA 1VQPS 4BDPA 3PHEA 1XBWA 4F02A 4HVZA 2CUYA 1Q5YA 4KBIA 1X4FA 2IAJA 1QY7A 4IFVA 5J1NA 4FNIA 4ZHRB 3CCQS 2KHDA 2H3EB 4I6WA 1N88A 3TWZA 2RVJA 4NLQA 4HL9A 1HQEB 2MZQA 3LP1B 2BABA 1QD1A 1D9DA 3DU5A 4QYZJ 4LT6A 3EE3A 3NNAA 3OHBA 2BDPA 1VBZA 5KFBA 2W2QP 2AGOA 5CZXA 2D3OR 3Q8UA 2OKQA 5IXUA 5LSLA 2E9TA 4CLYA 2R7VA 3TX0A 3FMBA 1HQUB 2HFOA 2HBYB 1VGYA 2MEWA 2OFGX 3MM5A 4P74A 4ICLA 1UZDA 3C19A 1PAUB 4Y28C 1U49A 1IQZA 2W2PP 2BJ9A 4Q0BA 5F8LA 3HPOA 1D0EA 3IRXB 2MXYA 1X5SA 3M4XA 4PXCA 3KLFB 2ZVIA 2IC3B 2GCFA 1RTDA 1XNQJ 1JK9B 1RHRB 5AJ3F 3HKWA 3LGHA 4GKJF 3Q2TC 3HHLA 3P49B 2ZBPA 3NNHA 4CLKA 5G0RA 3KFWX 2AJ4A 2CVIA 2DGVA 4Y2CA 2DRBA 5HVHA 2AEMA 2HIYA 3KOAA 4DL7A 4ZCMA 5IWAJ 1Q82T 4U7UK 1XNRJ 3WBZA 2AIRB 1NKBA 1PCAA 3QNWB 3W2WA 2Q1LA 3CJ5A 1PYTA 1VJWA 2ZBRA 3MEDA 3O3LA 2QFJA 2F65A 1FESA 1NJIT 1UVJA 3PO5A 4C0HA 2QLWA 2VBZA 1NSPA 4YMEA 2HQCA 1FVQA 1H2UX 5T14A 3PRBA 3P3DA 2JEGA 1RSCA 1M5KC 5AXNA 4DV1F 2M8HA 4JYAF 2B8QA 3A3PB 4EO6A 2Y1JA 3JQMA 2J7KA 9RUBA 3M9MB 1TVRA 2ZM6F 1HBMA 4OIXA 2HQDA 1RTZA 4OHZA 2ZVSA 4DV0J 2HFNA 4DQPA 1NSQA 4CLSA 2XGPA 1TFYA 1RU2A 1KFSA 3OL9A 1ICEB 1FXLA 2Z2ZA 4Q8EA 5HAOA 2UXBF 1MN7A 1FO1A 1ZA1B 2W24A 4Y3CA 3R5DA 5LJ5Y 2EC2A 1RT4B 1G4CA 3T5KA 4B9VA 4EEYA 2HBZB 3I4PA 2RT3A 2G0CA 3HHLB 4CO4A 5KFQA 3AD7C 5GAHI 3OLAA 3JB9k 4FYDA 3PO4A 1NAQA 2C2KB 2GZOA 2DH7A 1L3KA 3KUEA 4KFBA 3UD4P 3PY8A 4AUKA 3NBPB 4J9SA 4FN5A 3MOJB 2R3VA 5LXYA 2ZITA 2ADCA 2J7WA 3K8VA 2DPJA 2JNJA 4LRBA 4LIWA 3LA0A 4A8YA 3BO3A 2HWTA 1XJWB 4X4SA 4USKA 4JI3F 1MNEA 3LQVA 2VV5A 2FDNA 3DOKA 3PXGa 2BKPA 4CH7A 1XC9A 4OJHA 1CULA 1FWKA 2Y0SD 5KFZA 3PEHA 1PYSB 3M32B 2YPYA 1N54B 3GTYX 4ZVPB 1T05B 3UE2A 4CT9A 1SB6A 3OFEA 4RW6A 1CVJA 1Y3JA 4PXDA 2DNGA 2YWGA 1F5CA 2XHCA 7AT1B 2AGPA 1LWCB 2QA2A 2VKZG 1APSA 5LT5A 1WF2A 2YWEA 3CW2C 4ZJQA 1VOMA 3LANA 1OPZA 4P72A 5DDOC 1F1BB 5DM6Q 9ATCB 4JI8F 4USMA 2KH9A 3ENQA 2EPIA 2NZ4A 2NUHA 3ET6A 2UUBJ 1MMNA 2EFGA 2HBQB 1LWFB 2I5JB 2VBWA 2H54B 2F9DA 1CJVB 3KUGA 3GPAA 4RW8A 3A8EA 2G0IA 1JLQA 1QJHA 3BB5A 4I2PB 1YGYA 1DQAA 1E6YA 1X4DA 2WSFC 4MMOA 4ECXA 3ELHA 1J5OA 4NCAA 5F8NA 3MEGB 2Y1RI 1AT1B 3MM8A 3V5RA 4ANEA 4Z7YA 4G3IA 4PQUA 1GH8A 2Y1LB 4F4YA 1RAFB 1OYEA 5CYJA 3MCSA 1YDLA 3OVBA 4DSIA 2HHXA 2MY7A 3P6YC 4IH5A 1WF0A 1WOPA 4DPWA 1LXNA 2LEPA 2UXDF 1RT5B 1WACA 1JLCB 1FKPA 2VD3A 4OJ3A 3IGNA 1WF1A 4NWBA 3CD7A 3UCUP 1RQ0A 4ZA1A 4AD6A 3OL8A 2B6AB 2LU2A 1WC3A 2DHXA 1QVFR 1HBOA 3GQCA 2UVWA 3OTOJ 2OP5A 3K5PA 3POTA 1NPKA 2BRKA 3ILOA 3OFGA 2WW4A 3FK4A 1BWVA 1M5SA 2AEFA 3CIZA 2YKMB 3CJKB 2VH7A 3ZXWA 1RYSA 2D7SA 1NJXA 5AT1B 4KFBB 2R2UA 4LQ3A 1DFDA 2XO7A 4WFZA 2LLZA 3SDEB 5LL6d 3G71S 4DQQA 3VAGA 4LMZA 1EAYC 2DGSA 4EZ9A 4K4YA 1K1QA 1GNKA 2GA7A 4KQZA 1RT3B 2ZWOA 4KY3A 4XPCA 4DV2F 2BANB 5HROB 3DHXA 3SMZA 4OYIA 2ZDOA 5KG4A 2AX1A 2UUAF 2CPDA 1ELOA 3C3LA 4PG5A 4EK2A 3P5TL 3FC9A 2AF6A 2NQPA 3DMJA 2J6UA 4K4VA 1SV5A 5A8RB 3RRHA 2E1CA 4OZ3A 2N82B 2NR0A 5CZVA 5IZHA 1FDNA 2B4OA 2VDIA 2WSEC 1HNZF 1CSJA 2DNYA 3EM1A 3DLGB 1JJ4A 4OZLA 4KV8B 3HHLC 3HJVA 2JDJA 2V9KA 4WFAQ 3AHPA 3IO1A 4L76A 1SJ1A 4DUTA 4R0JA 3TOQA 1FE0A 3I0RA 2DHAA 3M05A 3A3NB 1TK5A 1VK8A 1YJ9S 4IQMA 5A8WA 3SI8A 1KOOA 3DKDA 4HH1A 4DV6F 1TKXB 4WXOA 1WI8A 4A46A 5ETLA 1LOUA 3SCLE 2FTRA 5KG0A 4LRDA 1VQ9S 2BW2A 1RTJB 1EX8A 2DIUA 2KJVA 3TA2A 5DQIA 2DGUA 1N5VA 1CS4A 5JXSA 4ZKAA 8RUCA 4B3OA 4K50A 2K7KA 3C16A 4J9KA 4CM2A 2YH0A 3CJ3A 4OI6A 4DDFA 1IWAA 2LQBA 2QEXS 3KLHB 1SIWB 3D0GE 2AZ3A 3QGHA 5CAAA 1IBKF 4OHWA 3OFFA 3QRQA 1Q79A 3FEYB 1RHJB 1JLAB 3D7SB 2FY8A 4ECWA 2UUAJ 4BBYA 2HVZA 1LWCA 3KJVA 2MKJA 3GG0A 4URQU 5B0AA 3PX6A 5B7WA 1JXVA 2AJ2A 3MZIA 4O44A 2WTFA 3OLBA 3PHTA 1FKAF 2VFTA 4RW7B 3VQSA 3K59A 3PW4A 3FJ2A 5F9NA 3CCMS 2P6TA 4KO0B 4ZPWR 4ZS6A 3QIPB 5EX0A 3RBZA 4MKYA 1VLYA 1VHIA 1RZMA 3OR2B 2M88A 3Q89A 4HDGA 4DR4J 4C8LA 1FI4A 4MYUA 1IBLJ 2YPZA 1JXEA 4QIEA 1XR7A 4RNNA 3MEGA 3MM8B 1EETB 3O44A 5F0WA 1SC3B 3TUIC 5CCMA 5HBMB 3RZAA 5CHCB 4UQGA 1Y5IB 3TYTA 1GMVA 4KAIA 5IQQA 4DF8A 4CNYA 2XSJB 4DX8H 3EGZA 3AFGA 3JYTB 4DQSA 2DNRA 1FD8A 4FZVA 1N6QA 2E9RX 3QT6A 2IJRA 4M5MA 1NPPA 1LW0A 4WU3A 4K4WA 3PFOA 5K8NA 2DGQA 3NG8A 4HDHA 2BEFA 2CG4A 3KK2B 3MEEB 2VPZB 3BR9A 3D1OA 2YXLA 1MG7A 3H5SA 3TANA 1L3UA 4V19J 3T41A 4O44B 2QRRA 2U2FA 3L95X 2XMAA 2DBBA 1Q8LA 1SUQA 2GGPB 4GVBA 1RWOB 1URRA 2RF2A 1REVA 3I56S 3G87A 1BQMB 2ROPA 3HSJA 4XAKA 2XMUA 1TL5A 3A13A 4G1PA 4FF3A 1S48A 1RAAB 1ZZFA 3C16B 1Y3KA 1AZSA 3HT0A 1N33J 1DJ0A 1HPZB 3GCWP 3OR1A 4NRUA 2LQ5A 4CI0B 4DX5A 1EETA 5KAKA 3W9IA 3SZ2A 4C9DA 5ETNA 4EBCA 2EEYA 2V94A 5K20B 5J2NB 2RS8A 5HLFA 4LSLA 3MAQA 4R8UB 2QA4G 2R7RA 3T1YJ 1RYRA 4Q2LA 3G8SA 2HVHA 1K0TA 2RDJA 4LQ9A 2QO3A 4UOCA 3GE9A 1Y10A 2ZZTA 5HI7A 4MK9A 2CIMA 1VQSA 3M6XA 1YITS 3RRGA 1FVSA 2F1FA 1IR2A 2MZ1A 4BLGA 4A8KA 1BQNA 3UD5A 4PYAA 1RCOB 2ADBA 1YQHA 3I96A 2KVIA 4PPZA 1PBUA 2W25A 4ZPAA 4X66F 3G6YA 3J7A1 2XYGB 4GKJJ 2YWWA 3IS9B 1HWLA 4YEAA 5I4MA 4X4OA 4RNFA 2ATLA 2GC8A 1V9OA 3OTEA 3Q0AA 4M5HA 5E3CA 2UVVA 1HQUA 2OTJS 2X3DA 2FHKA 4GVLA 2G2ZA 3HD2A 4OYAA 4ZIVA 5IFMA 1REVB 3VQTA 5DS7A 1R3NA 1DY3A 5LSOA 3D6MB 4RJVA 3SQGB 4OQJA 2OPRB 1TKZB 4F4ZA 1H98A 4LUBA 2JLFA 3BF4A 3RGIA 3NWGA 3FKBA 4AT1B 1FJGJ 1OJ4A 4HT7A 5GAHU 2EFVA 2VIHA 1EQMA 5J2QA 2DR6A 1X4GA 3M8ZA 1HHTP 3KJVB 3CCTA 2MQPA 1FFGB 1TMJA 4Y2MA 5D4LA 4K0KF 1MWYA 3BPDA 2G1HA 4R0EA 3ILJA 1FJGF 1FNOA 1TL1B 4NPOA 4LREA 3KHGA 5L1IA 3RR7A 3JAMY 3K5MA 2FC9A 4D3GA 1VQ5S 4L3NA 3MM7A 1RA7A 2QMXA 3GG1A 1GX5A 3O2IA 4UOFA 1MMDA 3AXMA 1MROA 4W4MA 2HHUA 3DDKA 3BDEA 2EK1A 3DOLB 1IN0A 3SXLA 2DGTA 5GVQA 2WSCC 1X0PA 2RKIA 3JTNA 3VCDA 4DL3A 4NYOA 3M9OB 3BSOA 4OI1A 4DF4A 2CPEA 3V4IB 5HL7Q 3PJWA 1WTFA 2RIJA 2YX1A 5CYMB 1H74A 2V6AA 1YBTA 5F3TA 1OPIA 5A0YA 2W7PA 1NKEA 1HNZJ 1T05A 4F4XA 3KMQA 4UY85 3CCZA 5HN0A 4M95A 1I5OB 3QO9A 5KT6A 2ZH4A 5E3RA 1B0TA 4I0WA 4OX7A 3ZZRA 3DLHA 3Q8QB 1FJEB 1MSWD 1WOSA 1RISA 1S99A 2HVDA 2J5AA 4P10A 1LW0B 1YBAA 1R0AA 2YWHA 2V4JA 4UY8T 2E44A 2V63A 1L5UA 5DDRC 4UQTA 4QCLA 2DITA 3K5OA 2HHQA 2W01A
chains in the Genus database with same CATH topology
2MGZA 2K3IA 4MYTA 2ZJQQ 2PA3A 1BQNB 4OJGA 4XDCA 3TA1A 2IVFB 1X4CA 2AU0A 5AXMA 5KFIA 3MMCB 4QR2A 1T7PA 3VR1A 3I31A 3BSCA 5HQ8A 3MD1A 3T6BA 4ZCKA 5HMXA 1KEKA 2FHOB 2KJWA 5KT3A 4J9QA 1RT3A 2QZ8A 1HI0P 1QTMA 2IM1A 5EGYA 3OR1B 1JXLA 2DIVA 5B0CA 1FKOA 4MTPA 4IOCQ 4WKYA 3KLEA 3M8SA 1HBOB 1TAQA 4Z2XA 1YIJS 1OS5A 3X3UA 1NO8A 2JC0A 4I68A 4K4ZA 2J7UA 3NL0A 3CMAS 2RRBA 3MPVA 1C4AA 4RW4A 3K57A 1UEUA 4A8WA 2VG5A 3CIMA 4U7CA 1HQEA 3HZEA 1HW8A 2DNMA 2VFRA 1RT6B 3LP1A 3MMJA 1Q1KA 1RTHA 4I6YA 1FKAF 2DNNA 3G9CA 3I0RB 3VAFA 2CQ4A 5B0GA 1ZTTA 1U1QA 2OH2A 2HRUA 2KZMA 1S97A 5I42B 2PD1A 4B08A 3S01A 1SH0A 4P6QA 2CVEA 4J9OA 2CQPA 2MKKA 4N76A 3DRPA 2HHTA 1MMLA 1UW4A 3HFKA 3BZQA 5JJBA 5F8GA 4YDDB 4AYBD 3CCES 3GWCA 3MM5B 1JNZB 2A1BA 3FRZA 4GMKA 3RAXA 3T3FA 2V4QA 1S49A 3I55S 3PEJA 4CNZA 1SJFA 4M94A 4B3MF 2GW8A 4CO5A 2ZKUA 4RUAA 1OQ3A 2V8VA 3OPKA 4H4KA 4ECRA 4EBEA 4NYZA 1ZM9A 5G0RB 2LQ9A 3D0HE 3DOLA 2QIFA 1NJWA 1WHVA 4M8LA 5KFGA 1VMBA 2CKWA 1HNVA 3DM2A 2NYIA 5IQ6A 5FDLB 4F67A 5KFHA 4B3RF 2RSQA 3DOMA 5F8MA 5M2PA 3MXHP 4FF2A 5BYQA 1QAJA 4FVMA 3UCGA 2P9GA 1R31A 3CDWA 4Q2MA 2LU1A 4DN9A 1JMTA 3ITHA 1HFEL 4NA1A 4C8MA 2R7QA 1TK0A 2KI2A 2XC9A 2MB0B 2CPYA 3IR5B 4I2QB 4TY8B 5KFLA 2BACA 5DJBA 2EFPA 1ZM4A 5DM7Q 2KT5A 3N9UC 3N6NA 1CC8A 4WFXA 1C1BA 2RDIA 1HMVA 2BA9A 2HNDB 2HNYB 1KQKA 2W7OA 2WW8A 2RUGA 2CQCA 3Q2SC 1FK9B 3BEGB 2W8LA 2G13A 4X4UA 3DU6A 4TQSA 5F41A 3NBPA 5E2QA 3HKZD 2RRAA 3LWMA 3Q23A 3TVKA 3V81A 1UFLA 4I64A 2LDYA 4IFYA 1K9MT 2R2TA 1R8HA 2V5HG 4PCQA 6FD1A 2KG0A 3GILA 5HP1B 2O67A 2HAIA 2CJ9A 3HM9A 4HT5A 1H2VZ 5KFMA 2JEFA 2X1FA 1FKOB 4ECTA 5L1KA 7FD1A 2WAQD 2ZH8A 1SKWA 4KT0C 4R5PA 4BWJA 1FERA 5KT2A 3HHKA 5I3QA 2FB0A 1I6JA 4LF9F 4AQYF 1HPZA 2DCUB 3I5CA 1S6PA 3ITHB 3ZZTA 4QYRA 4IUFA 4NL5A 3OL6A 4WFBQ 4FXDA 3H4BA 4PWUA 4DV7F 1R6YA 4LSLB 4NLVA 4O23A 1BD6A 3UCZP 4X2BA 2RF2B 1X7VA 2I8EA 2AYMA 4H4OA 5GAGI 4Y65A 4K5RA 4A4JA 1IKWB 3TVZA 1KC8T 1VBXA 1MU2A 1HI8A 4Y2KA 2R8KA 2VQFF 1P1TA 5HBMA 2W9AA 2CDQA 1KFDA 4G6VB 2UP1A 3KWMA 1F5AA 1T03B 2KZZA 3RRKA 5L1JA 2EI5A 5U47A 2XS2A 3GFZA 3NCPA 1BWEA 1UJ4A 2DGWA 2ZOFA 2HMIA 2EK6A 2KN4A 1X4BA 4KKOB 4RX6A 1YRTA 4HEA9 3PFEA 2MKCA 1C1CB 3S1TA 2BJEA 1NH8A 2DR7A 4A47A 2DNOA 1KOHA 4OFZA 2MMYA 3ENWA 2O5DA 1YI2S 1R43A 4TU7A 3BN7A 3PM9A 4I67A 3MR6A 2JOQA 1UA1A 1ULRA 4KGMA 2KXHA 3L09A 3I5AA 1CG2A 3L7OA 2ZH5A 1HNVB 2GO8A 2BRLA 2DO0A 2P9CA 3K2YA 4FP9A 4RNHA 2R8GA 5IT4A 2UUWA 2E5HA 5D4NA 2GIRA 4URSA 3J80Y 3AB4B 1XTZA 4Y2IA 5CYMA 4WFYA 5A0YB 1FEEA 2BE2B 5C24A 3QJPA 2W9BB 2WOMB 3PNIA 3KLIB 4MKBA 4FPRA 3V6DA 1HWJA 1TL1A 4EFAC 1RAJA 1FF2A 4TY9A 2KM8B 1IQTA 1C0UA 2XEXA 1UL3A 2HNDA 2HNYA 3KKFA 2UUCF 4B9UA 2FVQA 1UMJA 1BGXT 3M2VB 2YNGB 4DR7F 4QOTA 1U48A 1TV6B 3LP0B 3QGPA 1SQEA 1TZ0A 1JNRB 1KSPA 4WFNQ 4J9MA 1VQKS 3DRSB 4TYAA 3MEKA 2CQHA 4Y34A 4F8RA 4QR1A 1IBMF 4HLBA 3MI7X 1T03A 1S79A 4FF1A 1JLEA 3OTBA 2V8DA 1YWXA 1PC4A 2GMJA 1G1XA 1JLBA 3CGIA 3KK1A 5KFNA 2B9YA 1HBNB 4ICLB 2RJZA 3DC2A 1UAWA 3MR3A 3W3SA 2KT2A 1RP5A 2XMVA 2HFZA 3ZFVA 5C24B 3NGDA 3KLHA 4MKAA 4DSKA 2AQ4A 2HPUA 1SXLA 3MHYA 3M32A 5GAEI 4G1QB 1PC5A 4I6AA 3C6TA 1WD6A 2B5JA 3MAHA 3NAHA 4OX8A 5KFPA 2V8HA 3AB2B 2QT7A 3D1HA 4F2SA 2BOPA 2QYCA 3QWUA 1G7CB 1N5YA 5THWA 1YJNS 2IJNA 1MU2B 1NK0A 1KLNA 3M2VA 2BQUA 2HHWA 1S0MA 2DT9A 1HWUA 3B4MA 3JSRA 3FSYA 2XY6A 1ZYQA 1B64A 3BDPA 4NLOA 3MDFA 2W9CB 3FFIA 3ISZA 5DG8A 1NK7A 2XSJA 3KNGA 3PV8A 5L38A 3MECB 1M5HA 1JLBB 2VC1A 5A6WA 1JLGB 1K0VA 1R27B 5DQGA 2RD5C 1U24A 4EUVA 1A7GE 1JKHA 5IT0A 1DHMA 1VC6A 2FJWA 2MQNA 1DTTA 4NLTA 1TKDA 4F3OA 2BM0A 2GQ2A 3M9NB 2ZBCA 1R8BA 4X4NA 3FSXA 5MAOA 4KB7A 2GV1A 3M30B 2UZAA 5C5JA 2DR5A 3IWXA 3BJYA 2V8GA 1U1OA 1F0XA 2OSQA 2VPYB 4FNHA 2DNPA 3V4MA 1N34F 2R9LA 1T02A 4LF7F 4KSEB 5JUMA 2BE2A 2B7BB 4O4GB 1J5EF 1CQNA 4RBUA 3T1HF 4ZP7A 1S1XB 3PX4A 2HS0A 1ZM2A 5KFRA 1VQ7S 3TAMB 3T19A 5E3AA 2HGMA 1LV5A 2DVIA 2D3ZA 3FSIA 1WHYA 4DSJA 2N7YA 3MF5A 1C0UB 2IBOA 1SJRA 2APOA 3H5UA 1S0NA 1YRXA 2E5LF 2OLWA 4KPYA 4IH7A 2KRBA 1YVFA 3P96A 4DR4F 2B9XA 5D6GA 2NSBA 4UUXA 4ID5A 3DLGA 5KFTA 3CCLS 4FVCA 4C3MA 1D3WA 4ZVGA 1X5OA 4DQRA 5J2PA 4LSNA 4WJBA 2B51A 3N6LA 4YR2A 2GMLA 4FBUA 4JV0A 3DI6B 4CO1A 3PR4A 3M30A 2ZE2B 2BV3A 1DBDA 3GV8B 3UI3A 2QMWA 1LW2B 2MYFA 1PGZA 4X84A 5IT9Y 2YKNA 3OFHA 5KG2A 4ECSA 2JH3A 4ZDNA 1W25A 3SQGA 2AJ0A 3GIKA 2J0SD 1WHWA 2OPSB 4IOBA 3M6UA 1D9FA 1N52B 4LVNP 3VZHA 7FDRA 4YHHF 1YSJA 4GC7A 3K7RA 5LMNF 1M90T 2B6AA 2CJAA 3I4HX 2DGOA 3BSAA 3FDSA 4IKAA 3O1LA 2OPPB 1YJVA 1LK5A 1KHVA 5EDWA 3CJKA 2I1RA 3OXGA 2LECA 2CQ0A 3R5BA 1U2FA 4B9LA 4IRCA 4A8QA 2EG2A 3SSRA 4C2MA 2VBXA 1S6QB 3U1MA 4AL5A 3V4IA 2OFHX 3MEDB 3AY0A 2UV8G 2FJEB 3NAIA 1G3OA 4Y2AA 5A2QY 4ERDA 2ASJA 4B3TF 2B56A 1XWLA 4KR0B 3VALA 4ECUA 2EC0A 2FVPA 3PW2A 4EBDA 3BGUA 2HW3A 3RB3A 1HYSB 1HBMB 1S76D 2R7SA 1M1KT 2ZDPA 3K0JA 2MSTA 4DL5A 2BR0A 2E7WA 2FC8A 2IBKA 2QSFA 5IWAF 2CYYA 3K5NA 2OTLS 1XNRF 2FJBB 3IR6B 2UVRA 2A2CA 5EWGA 2R7WA 3NKYA 1X4HA 4ZPDA 1SH3A 4KE5A 3CEDA 1DLOB 1ZOTA 2M0GB 2MQMA 5G4DA 5KFDA 2PI5A 1P8GA 3NNCA 1FJCA 4AXJA 1DTQA 1QM9A 5KFAA 4Q8FA 1TR0A 2R7UA 3CD5A 3NGKA 1TKXA 2EG1A 4AL7A 2AJFE 3CJ4A 1HW9A 1GXTA 3GFHA 3HVWA 1FDBA 2E9TA 1U09A 3C6UB 5KFEA 2E29A 2E1RA 1FHTA 3MM6A 2ZZMA 3TUZC 4QBUA 2YNFB 1KLMB 4F4WA 3LOUA 5CH7B 2EWHA 1RI7A 1U8SA 2FHJA 4O3NA 2F8MA 3D2WA 2IC3A 4BC7A 2J0QD 2LCWA 3CWJA 4ID8A 1S0VA 2XNQA 2H5EA 2BXJA 2LXUA 2R4FA 2CPHA 1KVJA 5K8MA 2D9OA 1T95A 4ECYA 1JWWA 2FJVA 2O01C 4FXWA 2AV5A 4AL6A 1ZETA 2LKZA 1G2EA 5FD1A 3T1YF 2WB1D 4ZPVR 3E01B 3RTVA 3THVA 3LP0A 1SKRA 4WYWA 3W2VB 1M5OC 2MHNA 1VIXA 4JI6F 1V3SA 4OZNA 2R7OA 1U2RA 4IG0B 5FIIA 2ZHBA 5BYRA 4P2SA 3MR2A 1D0EA 2JRSA 2ZNZA 3CD0A 1SH2A 3K5LA 1A9NB 4RZRA 1FDAA 3M2RA 3JTOA 4EGLA 2C22A 3NP5A 4B9TA 3JSMB 1SI9A 3KLIA 2EFOA 1G6BA 4RWWA 2ZZNA 1WG4A 3NCRA 2DD8S 1UVNA 1P27B 2D41A 4JUZA 3IFEA 3M2UA 2FGOA 2JHEA 3MPYA 4TXSA 2CPXA 1N48A 1UVIA 3BGFA 3FZBA 4IYQA 1VQLS 4DWIA 3J7A1 1D9AA 3H59A 5E3PA 1RT7B 5K8OA 5KTQA 1ZPVA 4CO2A 4MH8A 4D3HA 2IMOA 4WE1A 3C6TB 4HH0A 5CQGA 3Q8PB 2EVZA 1VFJA 1BQXA 3IG1A 4AE5A 3I32A 1OO0B 4MIAA 4ZVEA 4CIOA 2YTCA 4DUYF 2B7CB 1U1NA 3DM2B 4OI2A 4IRDA 3RR8A 4QPTA 4Y6IA 2E66A 1ZAVA 5JVHQ 1T3OA 2X1AA 3G6ES 2FJXA 1NK9A 2BVZA 5C25B 2R7TA 2GQCA 4C11B 4ECVA 3OVSA 2DR9A 2MKSA 2Z8QA 5D8HB 3R1HA 3CTRA 3V2UC 2CJQA 4NMLA 4I2QA 4QWEA 2AWZA 3NS5A 3M2UB 2LQJA 3R1LA 2DCLA 4DG1A 5BYSA 4PWDB 2NREA 2UU9F 4K4TA 1GX6A 1FE4A 5I3PA 2I9SA 4GO5X 3OTDA 5DG9A 1VRUA 2XY7A 5E0OA 4DR3F 1H7XA 2FPHX 4USIA 2ZH7A 2PE8A 3K58A 3IG1B 3CDBA 2COLA 4KHPF 4NX9A 2N7CA 3NLCA 1CQMA 1YJTA 1QUPA 2IRYA 2JVRA 3H8YA 3IC1A 3RB6A 2ASLA 4JV5F 1KLMA 3U1NA 1FXDA 3EZUA 4QPXA 5J1EB 2Q3PA 4N5SA 3NCQA 2IVYA 4DHVA 3N4WA 2HGNA 4K4UA 1WEXA 5KFUA 4OX6A 4DR5F 2J9DA 1S1XA 3IWNC 3OXLA 1JLFA 2A2DA 3W7BA 3FZ2A 3TAMA 1RT7A 2ZFHA 2DNHA 2V4RA 4TU8A 2B9WA 1MROB 4K4SA 2BYCA 1W2BR 3KYLA 2LXFA 2VA3A 4JI5F 4RW9B 3DLLQ 2NQPA 4Q43A 4ZCLA 3ZZZA 2R8JA 3H25A 4NLXA 3H2VE 3J7YI 1TL3A 4PWDA 1GXLA 2E1MC 5KFWA 1UJ5A 1F9FA 1OIAA 2M9KA 3PZPA 4KHRA 3MTJA 2HQ3A 3G4SS 1KNZA 2UV8A 4LFBF 4O3PA 3UWTA 5DETA 2NSCA 2EFNA 2BQ3A 1S6OA 2XMJA 1WELA 2QV6A 4WU2A 3HXMA 1LW2A 4OZ5A 1S9GB 2NXUA 3BO2A 2M2BA 4GO7X 2IHR1 1JKHB 2SXLA 1DARA 4PPDA 2XMWA 4LFCF 3QMQA 3V6JA 1R0AB 4A8FA 4MK8A 4H4KC 3GFYA 3TP2A 2VG7B 4ECZA 3G6VA 3GZ7A 3OV7A 2HWIA 4J5OA 3CCVS 3MEEA 2W4CA 5E33A 2CQBA 2LMIA 5A8WB 4DS5A 2VQEF 1S1WB 4IDKA 2MPUA 3I87A 3SSQA 3Q8RB 3OSPA 2JEJA 1AFIA 5AE1A 2GIQA 4QIVA 3SSSA 1FD2A 3DDNA 5KG7A 3T5LA 4ZCIA 3HZGA 3D0IE 4TLQA 1SJ3P 1N5QA 1Z2LA 2DH8A 1S6QA 2B4VA 1TP7A 2WRMA 4Z37A 1VI7A 1SL1A 5LJ3Y 4C11A 2Q43A 2NUUG 3ONQA 2KFNA 1AFJA 4ITSA 1LXJA 4B17A 1YTYA 3V6DB 1X5PA 3O8WA 4TKTA 1AUDA 2ZH1A 3QIDA 3OW2R 2F40A 3EXCX 2CQIA 4KIAA 1NH7A 2CQDA 2CPZA 3TAQA 5A8KA 1QSYA 3N01A 4RKUC 4LF8F 3H2LA 1JLCA 1FKPB 4URGA 1QSLA 1S77D 3AJ2A 4HYKA 4WYLA 5CA5A 2FY1A 1RT6A 3DRSA 1FTCA 3GIMA 4ZVFA 3IN5A 3MR5A 2EFQA 3GYXB 5C42A 1DLOA 3PW7A 1TK8A 2BBEA 4NZ0A 1E6VA 2ABYA 2V9WA 3RB0A 3C46A 3QJJA 2WK4A 2XBPA 3C66A 4ZPBA 2YNIA 1QUVA 3IXQA 4Q5VA 4IDKB 1U45A 4DEZA 1N5TA 3JYTA 2IA6A 3BGRB 5D78A 3DRPB 2J6TA 2PDAA 4ED1A 4DSLA 1HYSA 3D5MA 1VK3A 3MM6B 1B0VA 4ES2A 3U27A 2RU3A 1JB0C 1X9WA 3TARA 4WCEQ 4CO3A 4PUOB 3AA9A 1FTRA 2GHPA 4BC9A 3KLGA 4NCBA 3Q22A 3SCIE 2E5JA 2F8HA 1VC5A 4N8OA 2RQKA 3F41A 5A8KB 2IAJB 4IFVB 3WZ0A 4ZHRA 3KK3B 1FJ7A 3KG1A 4KV8A 3R3TA 2B43A 3NMAA 1OWXA 5F0UA 4FF4A 1Y5LB 4RUCA 5B09A 3N6MA 2W8KA 4K4XA 2PIIA 2HS4A 3UR3C 2HHHF 1FRHA 1S72S 1UJ6A 4OLOA 3ULHA 4NLSA 1IM4A 2W9CA 2CPIA 5H9EJ 4BWMA 2Q6CA 1S1UB 2HYIB 1IXKA 2YQ3A 1O8BA 3QO9B 1CLFA 1Y0HA 2HWHA 4YP3A 2VFSA 2NPIA 2O66A 4HI1A 1NU4A 2KRRA 1QAXA 2D9PA 3QYYA 3KLFA 5GADU 3JSBA 3VAIA 2DK2A 3MTKA 1D1UA 4PRFA 3PKYA 3CJ0A 2KFZA 1XNQF 6FDRA 2MGZB 3UDLA 1QAIA 3DLEB 4B02A 3CF5Q 3DYAA 3IAS9 3R27A 4USHA 1Q4RA 1WHXA 4WXWA 2PGCA 2YNIB 1Y5NB 2ASYA 1ROFA 4ZPTR