2L48A

Solution structure of the plyg cell wall binding domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
85
Chain Sequence
GSIQKVKNGNVATTSPTKQNIIQSGAFSPYETPDVMGALTSLKMTADFILQSDGLTYFISKPTSDAQLKAMKEYLDRKGWWYEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Carbohydrate-binding protein
molecule keywords N-acetylmuramoyl-L-alanine amidase
publication title Tbd
rcsb
source organism Bacillus phage gamma
total genus 17
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12123 Amidase02_C N-acetylmuramoyl-l-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2030 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l48A00
2L48A
chains in the Genus database with same CATH superfamily
2DO4A 3NCPA 4OX9J 2GMJA 4KC5A 3I9V9 1OIAA 1U45A 1T9WA 2XLKA 1S0NA 3FEYB 1RWUA 1RWXB 3AJDA 1FFWB 2BVZA 3C19A 5F8NA 4C97A 1NKEA 3T1HJ 2O5DA 3H2VE 5E3PA 4WFYA 1QE1A 2K1RA 2RIJA 3CIZA 2QFIA 7AT1B 1YJTA 1S6OA 1M5SA 2HVHA 2CQDA 3I55S 2E5HA 1NKBA 5DDPC 2CVIA 4JOUA 3OVBA 4HVZA 2JX2A 4NLUA 1H7XA 4TKTA 3QATA 2VG6B 3QGIA 1CVJA 2K3KA 4PR6A 1NDCA 2B56A 3WC0A 4ZVEA 3H42A 3BGLA 4ZVGA 4X66F 5KFYA 3JSMA 2NPFA 2BOAA 3D0GE 3SMZA 2UUWA 2D3OR 4J9UE 3BDPA 4P9SA 3GB0A 5IT4A 3KLVA 1U47A 4W92B 4LVOP 4K2JA 1NSQA 2C3UA 2UP1A 1X4AA 5ETVA 1GH8A 1EB0A 3N01A 3PX0A 2VB6A 4CO1A 5A76A 2MZQA 4WXOA 2X1GA 3O44A 4ID5A 3QFWA 2I8EA 1S49A 2V67A 1HQEB 4J9SA 2HNDB 1CC8A 1OY6A 1ZPVA 4I1TA 1AUSL 5KFWA 2HMIB 5CAAA 1WSRA 2EKNA 2NXUA 2VOOA 1AFIA 4P2SA 4FPIA 3PJWA 3CF5Q 3FRYA 3A3NB 2MQMA 2RT3A 4IG0A 1F2HA 3EGWB 3SBMA 1QSLA 2Y1RI 5AXKA 3T1YF 4I4BA 2E1PA 3BN7A 2ZM6J 1SVDA 2VQEJ 4ZPVR 4HLBA 2VFRA 2UXBF 4XPCA 3KWMA 1N54B 1N34J 4ZKAA 2A6OA 1RT7B 4JI1J 4B9VA 4CT9A 2B4UA 1YDLA 3UN2A 3RBDA 4J9LA 2CQ1A 4FF4A 5D4PA 3GU0A 2ZBQA 4PWDA 4PZVA 2R7VA 5A0YB 3IG1B 4TQSA 1R89A 2G13A 2FIUA 3R9LA 3MEDA 3F73A 4RW4A 3NS5A 3PW7A 2J0XA 3MCSA 4HI1A 1KS2A 3MM5B 1HNIA 4N41A 5CZVA 3HDSA 4PWUA 3MMCA 4OQJA 4ICLA 2RUSA 4R5PA 3IS9A 4A8QA 3HKZD 3MUVP 5AXNA 1VQKS 1YLXA 4Q45A 2NYIA 5D77A 4UOHA 4Y34A 2XHCA 4BWMA 1HWIA 4TLQA 3E3XA 3FBFA 3QT7A 4FF1A 2AIRB 1CG2A 4QJVA 4FBUA 5C5JA 2A2CA 2YBVA 2NSCA 1PG5B 1KRPA 2U1AA 3IWLA 1G6BA 2GV1A 2V34A 1T9XA 4HTJA 4OX9F 2CPJA 2YTCA 1QAIA 2GS8A 1U8WA 3M2RB 4YY3J 5H9EJ 4RU9A 3BH6B 4ZS6A 3PO4A 4DHVA 3T1HF 1ZBTA 4R0JA 3ZZOA 4CH7A 2BJ1A 2N3LA 4A8OA 2VG6A 4ETXA 1GMVA 3CJ3A 3HHLB 2AJ2A 1X5SA 4ECUA 4J5OA 1SJ4P 1NPPA 3GJQB 3IWXA 1BHNA 3MMAB 4NXNJ 2CJXB 3RR8A 2XSJB 4IOCQ 4DV2F 5E5NA 1KEKA 1KDNA 2CRLA 5DG9A 1GTEA 3QIDA 3P8BB 1HQEA 4OMFG 1CJVB 2HNDA 2R8KA 4NLRA 5D4NA 4DU8A 3QGGA 3NNHA 2CJKA 4M94A 2Q1LA 2HMIA 2C2NA 1P1LA 3A13A 3HD1A 4ERDA 2FLLA 3GG1A 3UNYA 5FD1A 3K5NA 2I5JB 2F1FA 2WAQD 2I6WA 4KAIA 3LTOA 2QYGA 4NOHA 1IBMF 2KH9A 2R8IA 1U1NA 3PNIA 5KTQA 4L76A 2B8QA 8RUCA 5LXYA 2U2FA 2QG9B 2F4FA 4X4TA 2Y9HA 2ZM6F 3F0NA 2VQEF 1W7WA 1RT7A 1WG4A 3QRRA 4DL2A 2R2RA 3MI7X 3BZQA 2RQ4A 3TVKA 3D6HB 3W60A 1EKSA 4O3QA 4Y28C 4CO5A 1Q78A 2EWHA 1N34F 1Q5VA 5A0YA 3GYGA 3IG1A 2ASYA 4XIUA 3OXFA 3ENAA 3FRZA 4KHPJ 1MNEA 4DX6A 3W1YC 1FWKA 3MM5A 4RO0A 4ZDNA 3PACA 5E7OB 1XEZA 1S9FA 3LGHA 3SDEB 1UETA 1WOPA 4PPZA 2PE8A 2G0IA 1RBOB 2CWXA 2RH3A 4P6QA 2YQ1A 4DL0C 4GVLA 1U24A 3ETOA 4EFAC 2CPIA 4NLTA 1LW0B 1VJQA 1PAEX 2LU2A 2MQNA 5DM6Q 2EBEA 4DV3J 2HWTA 1FD2A 3W63A 4NLXA 2C1EB 2ZDOA 3OVSA 5IFMA 2AMCB 4K5RA 4EZ6A 2FHJD 4TY8B 3M2RA 1QUPA 4DR5J 2F7VA 3JAMY 2V69A 3ZZUA 4MIWA 3DDKA 1IWAA 4CP5A 3BKFA 4YY3F 2AYEA 2Z30B 3DLEB 4NPOA 2OPPB 1N4LA 1G2EA 2CWKA 3GJSB 1YIJS 3MM8B 2CPFA 3I0SB 5ETLA 3HHLA 2B9EA 3W7BA 1SH0A 4IOAQ 5C25B 2MQQA 3KK2B 1N5QA 3IBCB 5KOXA 2DGQA 2HBZB 3KHGA 2YQ3A 3MMAA 2XS2A 2XSJA 3WZ0A 1GT8A 3QYYA 3IMQJ 2W7PA 1HI1A 1GX5A 1B64A 4ELUA 1N88A 1WHVA 4NXNF 5CA5A 2EK6A 1U1OA 5KFGA 2FHOB 2F4VJ 3D3BJ 2H3EB 2NUHA 3T19A 1CJVA 4J9KA 2Q3PA 2L3MA 4JV5F 2DH9A 5C7PA 4X84A 4CTAB 3D67A 3Q8RB 1OWXA 2Z2ZA 3NWRA 2DEIA 3BH7B 2K7KA 2DISA 1V9OA 1U6ZA 4N7TA 3D1HA 2IRUA 2DPIA 5K14B 2XMJA 1Q4RA 1FERA 2UUTA 2I5JA 2D74B 1T02A 5L46A 5D8HB 1EETB 3HT0A 2UV8G 2ZC3A 2MJUA 5B0EA 1WC4A 3CDWA 2NXNA 2N4CA 2HYIB 4DF8A 1WEXA 2A1BA 1I1GA 2ILZA 4MK9A 2L9WA 2COLA 5F9NA 3CCLS 2P5VA 2OSQA 2V5HG 2XWXA 3PYGA 4DV0J 3I4HX 1TKDA 2R7OA 3OBIA 1BXNA 3PHEA 3QWPA 4FXDA 4PYAA 1FRXA 1KQKA 3EZOA 1VISA 2ZHOA 1UVLA 1S7HA 1AW0A 3SDEA 4RNOA 3R7SB 4YUDA 3CMAS 2CDRB 4RJVA 2ZVIA 1RAOA 1RI7A 4ZVHA 1UW4A 1YJVA 4DCOB 2VQFJ 1LW0A 1URNA 3JTOA 1Z1ZA 2MGZB 2MQOA 3C14B 4USJC 4PXCA 4K4SA 5IV3A 1SV5B 2EFOA 1R8CA 4TY9A 1WF1A 5AE2A 2KXNB 2BXJA 3AB2B 3EDQB 2YWEA 3HP6A 2FDNA 3OLAA 2PA3A 4TY8A 2BJ8A 3TZZA 3MURP 1HHQA 4DV3F 1SJ1A 1PSDA 2VD3A 3TOQA 4DSEA 1RYRA 1BC6A 2FJXA 1UL3A 2F65A 1RHQB 2BKNA 5FDLB 1RXOB 3HHKA 1UA1A 3OFGA 3DLEA 1F9FA 5F0WA 4OYZA 3DU6A 2OPPA 4A47A 3FJ2A 4OYWA 3CUNA 3MM8A 1E6YB 4NRTA 3I0SA 5L8RC 1NSAA 1BGXT 5CHCB 3OHAA 2AYBA 5C25A 3M9OB 3KK2A 5SZTA 2XI3A 4QIWD 3FQKA 1XNQJ 5D6GA 3GP9A 2CUYA 3OD2A 2C2KB 5I3QA 6FD1A 2YPZA 3WDOA 5F8JA 4KHMA 4WZMA 3LWMA 5KFFA 2MHEA 3CMES 1OJ4A 2FD2A 2WW4A 4CTAA 2J7UA 1H2VZ 2F4VF 5DGAA 2CPXA 2WBMA 4G1PA 3E51A 4EGLA 5D78A 2VPWB 2DPJA 1TTHB 3D3CJ 5K14A 2W8KA 4KSEB 3UD4P 1EQMA 3QAEA 1EETA 1RU2A 3BSAA 3R97A 1D8YA 2J9CA 2F9DA 3PW0A 4U8YA 2RE1A 2MKCA 4OX6A 2QLBB 1ACMB 4OX7A 1PYSB 2CYYA 3DOMB 3L95X 2J8AA 1KQFB 2C2MB 3UD5A 4JBCA 1WNEA 2IC3B 2E9TA 1SPBP 1YWXA 2CNOB 1FJGF 2VDIA 5DZ6A 4O3NA 2UV8A 2ROPA 2MSSA 3DXBA 1B0TA 4LT6A 4DPTA 5EUHA 2HBYB 1S59A 2CA9A 2YWGA 1RT6B 1VFJA 1XR6A 9ATCB 2R8GA 2XGPA 1WF2A 3B8HA 2GHVC 1QSSA 1PBUA 2VPXB 3HX9A 1SQGA 1DTQB 2E5GA 2HFVA 2MXYA 3QGPA 2XMVA 5F8LA 3FKBA 3VAIA 3VVTA 1F9EB 4ZPWR 3OR2B 2BOPA 4DQPA 2EFGA 2MGZA 3C14A 3NGRA 4EBCA 1V5IB 3X3UA 2WHOA 4QW9A 3I56S 2MSTA 1SV5A 4RUAA 3B6BA 1DQAA 3CTRA 2QIFA 4J90A 3RBXA 4PYDA 2AEJA 2K06A 1CS4B 4ER8A 1RWKB 2Y8YA 5KFAA 4D3HA 3QAUA 4WIIA 4NCGB 3SCIE 3CCTA 2NSBA 2B0GA 4RWXA 5C2CA 1FTCA 4R0EA 5FDLA 1MMNA 3EVWA 3UE2A 1WEYA 1U02A 4ZLPA 3ENVA 4NYPA 4OJ1A 1E6YA 3CE8A 2R2UA 2QSWA 3H20A 2Q6CA 4IH7A 2QA1A 2CJAA 1FDAA 2WBRA 3NNAA 3H90A 2VICA 1CQNA 5M2RA 4DUTA 2J9DE 2DIVA 3AODA 4K8RA 5IQ6A 2B5JB 4I68A 2ADBA 3VV2B 4DG1B 4ZP8A 3ZFVA 4OI4A 1QVGR 2VC1A 1Y5IB 4LF2A 5ETKA 1U8SA 3FFIB 2BM1A 2W25A 4P52A 4CLZA 1YGYA 2M2BA 2DNGA 1HARA 3AJ2A 4NLWA 2HIYA 2R3VA 2HKEA 5K8OA 4MTPA 5GAEU 3HHEA 1B3TA 3KYLA 1Y3JA 1TR0A 5FIIA 2KT2A 2W9AA 3FVYA 3CEDA 2DBBA 2MY7A 2OFHX 5HI7A 1WHYA 4KGKA 5KG7A 2QLXA 3RB6A 2D3UA 4TYAA 3T5KA 1RYSA 3DOMA 4Z7CA 3HD2A 2DO0A 4HYKA 4B3MJ 2I9SA 2B9WA 4RUBA 2DNKA 3U7JA 2WRMA 2JLFA 4JI3J 2IC3A 1RTZA 2IIHA 4A8SA 4LF1A 1NZAA 2UU9F 1SL1A 3HSDA 2FLPA 2CQIA 2CFXA 5L38A 2GAGC 4KH0B 4AUKA 2HHHJ 4RNNA 1X0FA 3TEGA 3NGDA 2OPRB 1ZM9A 3SYZA 1RTJB 3RRKA 1FNMA 3MCNA 3AB4B 2UUCF 4OL8A 2HQFA 3M9NB 4M5GA 3MGJA 1RT6A 4OLOA 4P2FA 3N79A 1H3DA 2O3DA 1BLUA 1H38A 3I31A 4BLGA 2J7KA 1B0VA 1DTQA 3KKFA 3CB4A 1VQYA 3ZZTA 3OR2A 1PO6A 1S1TB 3MDFA 1VIXA 1G4CA 2Q6BA 3MF5A 1JLBB 3D7SB 2B51A 3SI8A 2FQQB 2GMHA 5EGYA 2NZCA 1GMUA 3H4DA 3PHTA 4I6WA 1CS4A 1URRA 4CCHA 2EG1A 4ZPDA 2OD6A 1OS5A 3DLKB 1TMMA 2GO9A 4NCGA 4QPXA 3GJRB 4GKKJ 1RT5B 2ZH2A 3G6YA 2DNMA 3VVUA 3MM9B 1WHXA 4DV4J 2RVJA 4KGXB 3M9MB 4CM0A 2VIHA 1RZMA 2XBPA 4GRSA 1KD1T 3AOBA 4CLPA 3PYEA 3K8VA 3W64A 1TUGB 1VBXA 3KHLA 1RDRA 5F8MA 4QCLA 1Q8IA 2FUG9 2BJ7A 3KK1B 3U02A 4NRUA 5ITHA 1NMEB 2OIHA 3UW1A 4ZVTB 4OHWA 3AFGA 4ECSA 2RF2B 2W2QP 3P5BP 4CDIA 2B5JA 3R5AA 4ZPBA 4QIVA 1RAHB 3B78A 3GCXP 4WKRA 3I5BA 4DG1A 3GYXB 5JUMA 3P49B 1QSYA 2ZHAA 2J8SA 2K7JA 2ROGA 4DR3J 3RJMB 3RGIA 2NCKL 1WELA 5EHHA 2GIRA 3FFIA 2IBKA 3DDNA 2QYCA 5HP1B 1Q79A 3RTVA 3SCLE 3DOLB 4LSLB 3CCRS 3PKYA 4DFJA 1KHVA 5KFBA 4Q0BB 2OMLA 1Q86T 1QAYA 1FXRA 3DOKB 4ES3A 4ECYA 1JK9B 2FVQA 5DO2A 3KG0A 3T5LA 2ZBIA 2J5AA 3RRGA 4ZLNA 1QM9A 2X7IA 2W01A 2OJ3A 2MKKA 1NHKL 3AXMA 5F41A 1T03B 1RWMB 2GO8A 1U09A 1I94F 1NJXA 5MLCV 2DNZA 2YWHA 1SJ3P 3MXHP 3NGTA 4OIXA 1UP1A 4RUHA 1RB0A 3H5XA 2MEWA 4X4SA 2V68A 3R5DA 3KNGA 5KG6A 3CXCR 2OPRA 1JB0C 1RTJA 1RKJA 4QU7A 1NK4A 4N8NA 1BMQB 2HHHF 4DS5A 1NDLA 3NMRA 2G2YA 2QJ3A 2OTLS 1GMWD 1TVRB 3FNNA 4L3KA 3R7NB 3EPIA 2AEMA 3GV5B 3H40A 3K7RA 3PO5A 3CCUS 4IH6A 3Q23A 3CDEA 3IBFB 1YK9A 2G2ZA 1FDDA 4Y00A 3LWLA 3MPWA 1NKCA 4LF9J 3C16B 3L3CA 1S1TA 2WTFA 2LDIA 5KG4A 4K59A 4JI8J 4RU2A 1JLBA 3GCWP 2J0WA 2OO4A 3R5JB 5HLFB 1O51A 4MKBA 3GQCA 1RHRB 3N6MA 1EKRA 2CZVC 2GQCA 4F25A 1D1UA 2MDAA 2BX6A 1WI8A 3DLKA 5B0AA 4JYAF 5CD4H 2N3OA 2YQ0A 1RT5A 2RHSB 2AD9A 2MZ1A 3GIKA 2D3O1 1WJ9A 3MM9A 1NJWA 3G96A 3EMTA 3VF0B 4USWA 5GAGI 3GONA 2E5LJ 2FHMA 4NLPA 4LFBJ 1CJKB 4RBUA 1N48A 2J6TA 3C6TB 2JWNA 1QVFR 3KK1A 4ID8A 1RE1B 1VHFA 1NHUA 4A48A 3JQMA 3OHBA 3SSQA 2O66A 4DR2J 2RF2A 2GVDB 1D9DA 3O1LA 1SC3B 4B3TF 1U25A 4QIEA 4RW8B 2V50A 2PC6A 2MZTA 3EPGA 1L3TA 4J7CA 2PO4A 3FEZA 5KFJA 5HP1A 4P7VA 4L3NA 1Q7YT 3BBBA 4USIA 3H8YA 3DOLA 2PIIA 4LSLA 2HK2A 4DR3F 4XDCA 4Q0BA 2QLJB 2QE5A 2G2OA 1VMBA 4DQSA 4NA1A 2Z2MA 3DOKA 4N8OA 2AQ4A 9RUBA 2HGMA 4EBDA 1JXLA 1JKHB 1GTHA 4M95A 3OV7A 5D3GB 3CVKA 2MHNA 1T03A 3QSYB 2W2OP 5LMNF 3LQVA 2R9LA 2DGSA 2YKPA 2H5JB 3HHLD 4WK3A 1TELA 3WC2A 3MUMP 2OKQA 4RUCA 5B08A 2YNHB 2JZ5A 4FF3A 1RWPB 4F4XA 2GJ2A 1FKAF 2JFKA 3S6EA 4ECRA 2ZVSA 1CJUB 3PIOQ 4O3PA 1KN6A 3VTIA 2XG8A 4USHA 2KDOA 1SL0A 1S1VB 3QT6A 2ACYA 3SSSA 3UVJB 1D0EA 3VAGA 2AJ1A 5CXTA 2MKJA 3TAMB 1JNZB 3ZC4A 4H54A 3CJ8A 1NH7A 1TVRA 2IRXA 1UEVA 4G3IA 1VHIA 5GMKa 4Z37A 2C3OA 4BS2A 2KN4A 1BQNB 3N6LA 1H6KX 5AT1B 2OEMA 5K8MA 2NZ4A 2HNZB 3C16A 2DY1A 2QX0A 2R7WA 3PW2A 2ZBPA 3HF5A 2XCAA 3AA8A 2MZSA 4DR1F 3Q22A 3CC4S 2XMWA 4FNIA 5HLFA 2UUBJ 2YNIB 2H65B 4DOZA 1U1PA 1VQ4S 2HHSA 2RKIB 5H9FK 1VBYA 4F26A 5BR8J 3SIPB 3SSRA 3MEEB 2UVVA 4BC7A 4HT7A 1UVKA 1O0PA 4K0KF 3OFEA 5HROB 1BD6A 1VRUB 2FJWA 2ZJPQ 1FRHA 4M63A 3TVZA 1YBUA 1KWMA 4YOEA 1XQIA 2H5EA 3MECB 4Q7AA 2BE2B 4C4WA 3DI6B 1CJKA 2VBWA 1S99A 2HZVA 3C6TA 4MJKA 5LOQA 2WONB 4LF5J 1A6LA 1SQEA 3BO4A 3RR7A 4B3SJ 4ED0A 2NXJA 1CEZA 2RQKA 2Z2YB 2E44A 4X4QA 4QWCA 4ED6A 1PJ7A 3G8SA 1P8GA 2GVDA 1Q8LA 1FRJA 1GEHA 4DSKA 2O67A 1X60A 4ED5A 3UO0A 4M1KA 4RW8A 3S01A 2BYCA 4P73A 2V4RA 3S7RA 1FD8A 3V5RA 4YQWA 2QA4S 4FYDA 5LM7E 4Z2XA 1RLCL 5HO4A 1KTQA 2JEJA 2F40A 3KDOA 3MZIA 1Y11A 3NP5A 4U67Q 3HJVA 1ELOA 2X3DA 2PFFB 3AAWB 4IQXA 4QW8A 2B9YA 1U48A 4U96A 3LO3A 4IRKA 1HWUA 1RGVA 4ANCA 1JKHA 1TKZB 1AXQA 4UOFA 2YNFB 2W2MP 2OLWA 5D3GA 1WD6A 1P27B 3M8SA 1KNZA 3M6WA 4EK2A 3IAS9 3MPDA 2C2RA 2UXDF 3QJJA 3NL0A 3MPYA 2BA9A 4YB6A 3FBCA 2YNHA 5A8RB 3PW4A 2A0FB 1U1MA 3MPUB 1IBLF 1FX4A 3QBCA 4RKUC 2ZZMA 1CJUA 1P9YA 3G2XA 3UDVA 1D9FA 4ZVOB 1OSDA 4ZLLA 1UMJA 1S1VA 4B9MA 5FLXU 3KJVB 5F3ZA 1W2IA 3UVJA 3VGTA 1F3VA 3Q89A 2E5JA 4I69A 3TAMA 1PC4A 5DDQC 3N28A 5G4DA 1LK5A 4WE1B 1LV5A 4KKOB 2DGXA 3VAKA 1RAIB 2PD1A 4AYBD 3SV3A 1BQNA 3CJ5A 2VBYA 2YNGB 1MWQA 5LMUF 2Y1IA 2Y1LB 2HNZA 5K20B 1OSCA 4F02A 2EK1A 2QSFA 2B3TB 2J76E 1T95A 1RLDA 4URSA 2E1RA 3CDAA 1IR0A 3DFEA 5HJYA 1KQGB 1NAQA 4C7QA 2B8PA 3IC1A 2F8EX 3H5YA 3H7HB 2YNIA 1VQSA 2QFJA 3EICA 2RU3A 2RKIA 3MEGB 4C9DA 2A2DA 1SH2A 4RNFA 4HHHA 3TR5A 3ZZRA 3MEEA 2LXIA 1VBKA 2ABYA 1UJ6A 4IG3B 5KT5A 2ADCA 1VRUA 5BR8F 1T9VA 1SJFA 5B0BA 1U4BA 1N36F 1ZOTA 4GC7A 3MECA 2BE2A 3DI6A 3PG9A 2WONA 2YWFA 4ANEA 3OR1B 4F0KA 3K17A 4OV6A 1I5OB 2PEHA 4EZ9A 1WI6A 4C3MA 2M70A 2LQ5A 1APSA 4LF5F 1GFWB 4B3SF 1RACB 4DCPB 1FFSB 2WK4A 3EYZA 1M1KT 4A8XA 4X4NA 2HRUA 3CJSA 2D1CA 3GFZA 3WX4A 1C4AA 2HFUA 3I5AA 3R1HA 3ICLA 4CIOA 2Q79A 3NWGA 4TVAB 1FKOA 3BQ2A 2WB1D 1VQMS 4UZBA 1F9HA 1FF2A 3WBZA 2JC0A 1ROFA 3MAHA 4C6AA 3R8YA 3JSBA 2E66A 1Q8BA 3HSJA 1TKZA 4ECZA 4WYLA 2B7BB 2YNFA 2ZNZA 1N33J 2KJVA 2JL9A 1HPZB 1RA6A 5HMZA 1YJ7A 1AZSB 4UOGA 1I51B 1IBCB 4OV1A 5D0EA 4KR0B 2ZH7A 4QWBA 5AXMA 4JI2J 2L08A 5EX3A 5A8RA 1K44A 2W24A 4CRJA 2DR5A 2XM3A 2BQUA 1UVNA 4IUFA 3OTCA 5DJBA 3CD5A 3E01B 1FRLA 2V8VA 4OJGA 1WSVA 2BV3A 5EWFA 1P1TA 1LNQA 1M1HA 4UY85 3KJVA 1Q95G 3D5MA 4X4VA 1RBLA 1ZPWX 3ILLA 3LF0A 4WE1A 2GJFA 4NE9C 4DUZJ 4KKOA 3KUEA 5LJ3Y 3M2VB 2YNGA 3CW2C 2YH0A 2ALZA 5J1NA 2LQBA 3AQPA 3MM7B 3A3OB 4PG5A 5F8HA 4I6AA 3L7OA 2CQCA 1HW9A 1HI0P 3HVAA 3IRWP 2HHWA 4DL5A 3L9ZA 1TK8A 4QQBA 5EDWA 2HNYB 1S97A 1VRQC 3DLJA 1JJ2R 1RSCA 3DRYA 2XHWA 3MEGA 3W9JA 4FYWB 1WOOA 4EO6A 4KHRA 4YDDB 3DHXA 3PX4A 4IG3A 4PWWA 5CCLA 1FNXH 3U1NA 4F3MA 1RWWB 1EX8A 5GAHI 4F04B 2IRYA 1N8RT 1XNRF 1IKXB 2RD5C 3Q83A 4H4OB 2YVSA 1HWKA 2XI2A 4ZJLA 4K4ZA 2EFNA 1AFJA 4ECXA 4TU7A 2MKYA 3N5BA 3OR1A 2JDJA 1VQNS 1HNXF 2V6AA 2HBQB 1X8DA 2G9OA 2EKYA 3HSGA 3DRPB 1YI2S 5H9EK 6AT1B 1KC8T 2D69A 4Y2IA 3KLGB 3MAQA 3V6JA 2OEJA 1Q7LB 2P9GA 4C0OC 3SXLA 5SUHA 3I82A 3PYDA 1SC6A 2HEKA 1WTBA 5KG3A 4MK8A 1FE0A 3I4PA 1K1QA 4PCQA 1PILA 3BREA 3NCRA 2DY9A 4LIWA 3W66A 2DTJA 3HHLC 2R7RA 5D15A 1JLEB 2D3ZA 1IM6A 2LEAA 2GMLA 5JVGQ 4N5SA 2HFOA 1AT1B 1NHVA 1SH3A 3RZAA 1HPZA 3HHNB 3FQLA 2DGOA 2DNQA 1GXLA 4LF7F 3J7AN 2KYXA 5H9FJ 1AZSA 5DLGA 1REGX 4RZRA 2HWHA 1N33F 1VR6A 1J5OB 3G87A 4LQ3A 3ZTRA 1F2GA 3FGVA 1YJRA 4NXMJ 1NU4A 2M88A 3E01A 4OZ5A 1K1SA 5HQLA 3H0PA 3NBPB 3RB4A 1HNZJ 2BACA 3CNQP 4RWWA 3GIRA 2XB2D 2BW7A 1S1XB 5DRKA 4P7TA 4K4WA 4AFFA 4KO0B 2D7SA 2H51B 4MH8A 3EM1A 2BJ9A 4P74A 3M2VA 4FS1A 1L5UA 1ZS6A 4NLQA 2IHR1 4DUZF 3MM7A 4N77A 2XS7A 4NLOA 2ACMA 3KLIB 3NNCA 1SL2A 2EEYA 3MUTP 3PFOA 2VL1A 3K59A 2I38A 5DM7Q 3NAIA 5HVFA 4HKQA 4X65J 2HNYA 4X4RA 1IR2A 1VK8A 2EW9A 3L09A 4HI2A 3ZZPA 4JUZA 2V0NA 2KZZA 2CADA 2KJWA 4PXBA 5EWGA 5AE1A 4OZ2A 1KHWA 2VFSA 4K4UA 4USKA 3ENQA 5A6PA 2XC9A 4IKAA 4DPXA 1RT4B 1N5TA 3G9CA 3KLFB 2ZHBA 5A2QU 1Q0NA 2DNOA 1IKXA 1IVZA 4H4OA 1YVFA 3SQGB 1OQ3A 3TAQA 1N5VA 1YHQS 3TJ9A 2FLOA 4G1IA 4MKAA 2WZ1A 4M5MA 3DRPA 4E8UA 1N32J 3KLGA 1VGYA 1ZM3A 1FTRA 3ITHB 4F4AA 1OY9A 1S57A 2XNRA 3CD0A 1XR7A 3QFHA 1YZ6A 3VALA 2CQBA 2Z0GA 5E33A 5BJRA 2ZJQQ 1NH8A 4C11B 5LJ5Y 3B4MA 5T7LB 1X4BA 1FRIA 2IJRA 2LECA 1JLEA 1NSPA 2B7CB 1R8BA 3UR0A 4Q2MA 2YX1A 3GFXA 1DAXA 3GJTB 2PT0A 1I6JA 2AZ3A 2FHKA 4J91A 2H4YB 1F1BB 3PRBA 3RW6A 4HACB 3LALA 4J9RA 3OJUA 3KHRA 1RJJA 4YR2A 1RABB 4WCEQ 3B82A 2BQ3A 4LRFA 1EIYB 1UKUA 2QMWA 3LOUA 4FNHA 3I96A 3L4BC 1WC5A 1VC6A 5AJ3F 1J5OA 4NZ0A 1S72S 1F5BA 4AQYF 1RQ0A 3IM9A 4Y2CA 3TQEA 4GO7X 2LP4A 3GV7B 1XMQF 3NBPA 2AYGA 4IOBA 4NXMF 4NLSA 1LXJA 3JTPA 1S1XA 1WF0A 2E9ZA 4KO0A 1S79A 2XMAA 4EBEA 2OH2A 3T5JA 3J7YI 1KONA 1HNZF 3PJXA 4QYZJ 4Y2MA 4WK1A 4C48A 3HJFA 5IOLA 1H0HB 4GKJJ 2IJFA 2KI2A 2E7XA 4ECQA 2G1DA 3CSKA 4F4KA 2LEPA 1ZH5A 4WXWA 2UVUA 4Y6IA 3CD7A 3KLIA 1TQLA 4DL4A 2YX4A 1HQ2A 2OSRA 2HS3A 2RQMA 3C8YA 4JV0A 4EMDA 4WFZA 5CCMA 1GNKA 3TUJC 2DB1A 4EYIB 4NI2B 4ITSA 3K8WA 1RAGB 5DQIA 1NK8A 3TZWA 2BJEA 4X64J 4JI5J 4ZLJA 1RT4A 3OL9A 3KLFA 2BW2A 4QWAA 4WU2A 1WKKA 2UZAA 1L3KA 2CQ0A 3KLEB 2GZOA 1FWLA 1PBAA 2N7YA 2DRDA 2D41A 2HVEA 1V5VA 3SQGA 1A0OB 1X4DA 2DCUB 3PZPA 2MLXA 2DH8A 4OI3A 2LCWA 4ILLA 1RT2B 2XO7A 3UCZP 1ZTTA 3FSXA 3LPEA 3PKMA 1HKAA 4W4MA 4WPAA 3V2UC 4DV7J 2HQDA 4CZCA 1CJTB 2ZOGA 1FFGB 3ITHA 4C8ZA 1KFDA 2W7OA 3EXCX 4ECTA 1N32F 3GFYA 1LWCB 2G1HA 4DWIA 2G0CA 4FYVB 4WFNQ 5DLFA 1GK8A 4X4PA 1TFWA 1U1QA 1UTAA 4ED4A 2KFNA 4C11A 5HATA 2VPYB 4OHZA 4JI0J 2HPUA 5T7LA 1SKRA 3G8TA 5LSRA 1QAXA 4L75A 2DR9A 2G4BA 4U7CA 5KG2A 4RPFA 1HA1A 2CJQA 4HACA 4O3RA 2BEFA 1M0SA 4HTIA 4KPYA 4B9NA 3CJ0A 4TNOA 1HBMB 3M6VA 4KBIA 1IKWB 4F4ZA 4QR1A 1VJWA 2XMKA 3SFUA 1UPPA 2YX7A 2JNJA 2KHCA 5CYMB 3R7BB 1LQ9A 4ZVUB 3P45B 4QWDA 1X4HA 2H1YA 4ILRA 4QWEA 1OY8A 2CIMA 5AXLA 1NK9A 1UEKA 2E9RX 3UCUP 1VQLS 5J2QB 4D3GA 3MR7A 4EO8A 2DVIA 1SJRA 4JB8B 2GC8A 4ZVSB 1K0VA 4ED3A 1MN7A 4CQ1A 1ZAXA 2JRSA 4LBHA 5CQGA 4PG7A 4M5NA 2ZITA 3Q2TC 2F9JA 2QN6B 3PRDA 1VQ5S 1JX4A 1NUEA 2MZJA 4DFPA 4KH1B 1VC0A 2GIFA 4DN0A 2V2QA 1JXVA 4BBYA 2J0QD 2X51A 3OLBA 3J7ZT 1SI9A 5DS7A 3OFFA 3DYAB 2C3YA 2CPYA 2HQIA 1RKIA 4NI2A 2W2NP 1FESA 5T14A 4NEYA 2CNNB 1IQZA 4NLGA 1GQEA 4I2PB 3HO1A 4PUOB 3DKDA 2VKRA 1S5ZA 4Z7YA 3VGVA 1GMWA 3RU0A 3ZZYA 3MFIA 1SKSA 3KLEA 2HHQA 4X64F 4Y2KA 2DHAA 3GYNA 3NGSA 4ZITA 5KFQA 3GSDA 1YZ7A 4URGA 5E3AA 3I0RB 1RK8A 1RT2A 3V6KA 3BV8A 5HN0A 4ZPTR 4QU6A 1XR5A 1OQ6A 4O4RA 1HHSA 2V8DA 3UI3A 3JSRA 3TEHB 1LFPA 1UAWA 4TQRA 1CJTA 1C0UB 5L1KA 4A8WA 1DQ9A 1RT3B 3M2UB 2DIUA 4DV7F 2N7CA 1F5AA 2NYHA 4KGZB 4AT1B 4CH0S 3TZXA 1LWCA 2ZFHA 3ET6B 1UVMA 5IT9U 1UVIA 5JJBA 2IA6A 1GX6A 2ZOMA 4UY8T 2PMZD 2XY6A 2P6SA 1H74A 3W2VB 2FTRA 5BYSA 2RMLA 2I2YA 3X1LB 1S77D 1KVIA 4JI1F 3W3SA 4IRCA 3G6VA 1FHTA 4DV1J 2KRRA 4O4GB 1UJ5A 3VAHA 4KTQA 3N6NA 5B0GA 1IN0A 3H2LA 3A8KA 3CC7S 2OD4A 3UPFA 4OYIA 3OW2R 2DT9A 3CO9A 3W5ZA 1HNWJ 4DR7J 1RAJA 1Y5LB 2HHXA 2SXLA 1HBMA 3J80Y 3OTOJ 1WC6A 1IKWA 2O1PA 4DFMA 4Q44A 2EFVA 2DGUA 2UVRA 1YTYA 5CYMA 2JSXA 3BO2A 2EG2A 1R27B 2OPSB 1JNRB 4KGVB 5THWA 4CLUA 1QDUB 2AF6A 2EPIA 4X62J 1X9SA 3CCSS 4K4TA 5IQQA 3ILJA 4TU9A 2FC9A 5J2QA 2EBGA 3CC2S 1WG1A 1IKYB 3DC2A 1XIQA 4ZP9A 2WSCC 1X9WA 1S1WB 4WTOB 3LA0A 4HHJA 1O6XA 1R0AB 2AHOB 1HLWA 4M5HA 4C0BA 2Y0SD 2VF3A 2Z58B 1C4CA 3KLHB 3DYAA 4R25A 4U7UK 3MR5A 3MM6B 3PV8A 3GR0A 1OPIA 5L9XA 3LP2B 3BBCA 2CQ3A 3TA2A 1TK0A 2IY5B 4I2PA 4PUOA 3GMGA 2L9NA 1W26A 3H59A 2KG0A 3PCOB 2R7UA 3Q8SB 1Y3KA 4U8VA 2Y8WA 3T3FA 2L41A 3I0RA 3AA9A 4U6PA 3EZ5A 1FA0A 1C1BB 4M8LA 4K4YA 2B6AB 3CD6S 2D9OA 1C0UA 4F7VA 2XULA 3V81B 2J0SD 2ZKTA 1RT3A 5FLXY 1HL6A 2WVEA 3M2UA 4PABA 4OI0A 3Q8QB 4J9NA 3ET6A 2DNPA 4B9TA 2PDAA 4XO0A 2DNHA 1T05B 1YJWS 2VFVA 2DCLA 1NSKL 3S8SA 3W2VA 1N56A 1HBOB 2N82B 2R8HA 4NCBA 2KTQA 1JJ4A 3M8PB 1FRMA 1Q8KA 1FO1A 1TMJA 2B43A 4FYYB 4O4GA 1R8AA 5KT4A 5CABA 4PEOA 2QMUB 3KDNA 1NB2A 4AL7A 1LK7A 5B0DA 2BZ2A 1HNVB 4DV1F 4ANDA 2NLWA 2IAJB 4UUXA 4LF6J 3G4SS 3JQKA 4LSNB 5C24B 4F4YA 5GVQA 4KHPF 2VFTA 2BDPA 3EJMA 3JB9k 4DR7F 1NK5A 5KFEA 1S9EB 2A10A 4EU0A 1JJCB 2OPSA 3Q8VA 2RILA 3VAMA 5EWEA 5H1SV 2FVPA 1WORA 1JLAB 2IMWP 2VODA 4DSFA 2J9EA 3V6DB 3EGZA 2IDEA 2AP6A 1SKWA 2AW0A 2W9BB 4JI7J 1IKYA 1U1RA 1QTNB 1FK9B 2IDLA 3D1QA 5HMWA 3Q8PB 2JLGA 1JQGA 4LF8J 3FMBA 4ZVQB 5HMXA 4C3LA 2ZZNA 1S1WA 3QIPB 1OPZA 1WKLA 1IR1A 4DR5F 1R0AA 3BGOP 2MJNA 3ZZZA 3GV8B 5J1PA 2DK2A 4ZK7M 3E2EA 2CPHA 3IAM9 4IO1A 1SCJB 3R1LA 3KLHA 3Q8UA 3KFWX 1YQHA 3MM6A 4C8LA 2A3JA 3LP2A 3POTB 1GXUA 3EVMA 4JV1A 4AXIA 2OGUA 4DJBA 3M32B 2NXEA 2F8MA 2ZBRA 1TKTB 1KTVA 3OJSA 4U7UD 1TKXB 4X66J 2WOMB 3F56A 5LSLA 2R2SA 1SB6A 1FJCA 5K9FA 3QO9B 2FVCA 3P3DA 4BHQA 2HRYA 1C1BA 3KJFB 1RHKB 2B6AA 1T3NA 4EEYA 3QJPA 2D9PA 3V81A 3PRVA 3M6XA 4UQGA 5KFCA 3KMSA 3HMJG 1HQUB 5KFXA 1H72C 2QA4G 1JLGB 4ILMA 4NLVA 4B17A 3MPVA 4WFBQ 2DXDA 1VLOA 2E7VA 2JVRA 2PI5A 2DXFA 1T05A 4ECWA 2JFDA 4KFBB 2QV6A 4NA3A 1Y00A 1XN9A 3I32A 4UZCA 1HBOA 4HHUA 5GMDA 1Y7PA 2BBEA 3M8PA 3OQ2A 2VUGA 2RRBA 3K89A 3LW5C 4KPCA 4LR9A 1V6HA 4Y2AA 3HVTB 3MMJA 2WVCA 3SEOA 4PG6A 1YRTA 4LRCA 3M8RA 2JEGA 5HQ8A 1HI8A 3I87A 3RUBL 4B02A 2DHSA 4F8RA 2DGVA 4HL9A 2W7AA 2E1MC 2BE9B 4DV0F 1HNVA 2C2ZB 2M52A 1ZETA 2IAJA 3G6XA 1EQ0A 4LSNA 1OYEA 5C24A 4DF4A 4NX9A 2AX0A 3O5TB 2CJBA 3S1TA 2C2EA 3AOCA 1FXDA 4FP9A 3KK3B 1REVB 3F44A 4YB5A 5ETPA 4LF6F 5KFHA 1S9EA 4CO2A 4ES1A 3OSNA 2MMYA 2ZBCA 1CLFA 5KFOA 1N52B 4F2SA 3V4IB 4PXEA 3HFZB 3W9HA 2R4FA 4UW2A 2XO6A 1JLAA 1KOOA 5GAGU 4DSIA 5LSOA 2E29A 2Q66A 2JEFA 4Y65A 1O5JA 2VQFF 5FJ4A 3DRXA 4OZLA 3V6DA 1MLAA 2F3JA 4DPYA 4LRDA 2QL7B 2YKMB 2W9BA 5E2QA 5KFKA 2RAQA 4IFYB 1N5YB 1FK9A 4MYUA 1KOHA 5ETQA 2P2CB 3QIPA 4DFKA 3SCJE 1KBRA 4JI7F 1FX2A 2V2KA 3CJKB 1H2UX 4LF8F 2ASLA 2IM0A 2YWKA 4UUWA 2ATLA 1TUVA 2VU5A 1ZYQA 1RTHB 4G6VB 1NO8A 1RAAB 3EWGA 1VDHA 4V19J 5ETSA 4LREA 1U1LA 4CO3A 1W2BR 2FZCB 1SKUB 2RDJA 4ZIVA 1DZ5A 3POTA 4U95A 1LOUA 1NJZA 2AYMA 3DLHA 2V8GA 1K73T 1NPRA 3M32A 1XNQF 1B7YB 1PAUB 1TKTA 4P75A 2GGPB 3NAHA 1TKXA 4M5JA 2Z4PA 4ZIWA 2YPYA 2RHQB 4OLPA 2WOMA 3CJ2A 5I3PA 1HD0A 2LMIA 1B0PA 4KIAA 2WVFA 3QO9A 2CQHA 4P2XA 5CYJA 4KT0C 3B4DA 1EARA 3TI0A 1EHWA 2KHDA 4K2XA 2YKQA 3IN5A 1MMLA 4IDKB 2M7SA 3ZTOA 2JJ4D 1E6VB 2FYXA 3OL8A 4DV2J 2DJWA 3T9NA 3ZNUA 4F3QA 2EXUA 4EWTA 3D4JA 1WC0A 2HLUA 4WFXA 1R6YA 1HQUA 4FZVA 5DDRC 3GILA 1JLGA 3ISND 3M8QB 2Z57B 3NY0A 2BM0A 4WJBA 2E1CA 5IT0A 4MYTA 4KFBA 5GADI 3OTDA 2YWWA 3RAXA 2KG1A 2CVEA 2YXLA 1MW7A 3DM2B 1IBMJ 3HVTA 4P71A 2KU7A 1FVQA 2EFQA 2ZUGA 4ED8A 2GVZB 2AEFA 3D28A 2UUAJ 4WP9A 2IMOA 1RA7A 4F4WA 2UXCJ 2C28A 3IRXB 3OUYB 2HFZA 4HT5A 3ZZ0A 4DCJB 2M0GB 4ED2A 1N0VC 3ZNJ1 1D3WA 3KK3A 1REVA 3VZIA 1NPKA 1SBRA 4P72A 4UT4A 5A2QY 2BANB 2HHVA 1U2RA 2K8GA 1RAEB 3V4IA 4L72B 3VWSA 3D54A 1T9UA 2FVRA 1SC1B 4O23A 4OHXA 3Q2SC 3BSNA 2PMHA 5HAOA 2YKMA 1DFDA 3SFGA 1NK6A 4IFYA 1N5YA 1QLNA 1WDDA 4C8YA 1DJ0A 1LWFA 3TNVA 1TZ0A 3BEGB 1M5HA 1YRUA 2AU0A 3CJKA 1D8ZA 1SIWB 2HFNA 5IC6B 1NZ8A 2DNNA 3CT9A 2BUNA 4FF2A 1TP7A 3MFHA 2HAIA 1RTHA 2MKHA 4G65A 1W25A 1RTIB 4IH5A 4WTYA 2LFVA 1UFKA 2ZOFA 2GCFA 1VLYA 2ERRA 1HD1A 1HFEL 5J2PB 4YR3A 1NDPA 5DQGA 2X1BA 5CYQB 2GGPA 2LDYA 2K3IA 2LLZA 3H5UA 5E3CA 2VBXA 4U9RA 3JTNA 2PI4A 4UF4A 3WIUA 1HIYA 5J2MB 3LP0B 2CQ4A 1XMOJ 3OTEA 4BDPA 1ZZNA 4OYMA 5L1JA 5CH7B 1H7WA 4CI0B 4IDKA 4W90B 3DU5A 2DGWA 1E6VA 1Y9OA 3GE9A 4CNYA 5F8IA 4FVCA 4LBPA 3KG4A 3MD1A 3NGUA 3G86A 2HVIA 1F6TA 1UWBB 2NR0A 1TAUA 1LFWA 1YJNS 4O3SA 2AJ0A 3M8QA 4JV5J 1P6TA 4AE5A 3QQCD 1MSWD 4NA2A 3MR2A 2IBOA 4C0HA 3QSIA 5E3RA 3I9ZA 5ETRA 1ITPA 2LXUA 5KOWA 3HZEA 1AB8A 4B3MF 5E0OA 3DM2A 4AD6A 2ZDPA 4JI3F 1S6QB 2RJZA 2POKA 2XWYA 2HS0A 2GA7A 2GVZA 5J1EB 2OUGA 5HK4A 4W98A 2Y3YA 2ZWPA 1QUVA 4ZHRB 4OHVA 3LAMA 3DRRB 4L73A 3PFEA 3IRXA 3UDEA 3OUYA 1TL3B 3BGFA 2UUAF 4K4XA 2LU1A 2UXCF 2H48B 4PRFA 2XZTB 4HR2A 5I3UB 1Q5YA 4H4KC 3Q86A 4ETZA 3LH2S 2BANA 4P10A 4N56A 1NJYA 2LEBA 1T94A 1LEOA 2GAHC 1YJ9S 4DUYJ 2CZ9A 8ATCB 3DGVA 3TAPA 4F3OA 5D0RA 2HQCA 4USUA 3JS9A 1IKVB 2H54B 1SUQB 3A1YG 3AT1B 2JEIA 2VG5B 2V4JB 4DBQA 2FJAB 3K0JA 3CCVS 5ADZA 2VC0A 3T9ZA 5LXRA 1BUXA 3RAQA 3C15B 2QEXS 5ETMA 3UNGC 1PIEA 5G0RB 4GKKF 5E41A 1KP6A 3K58A 1J5EJ 4NL5A 4DV4F 1D09B 2VBZA 2B4OA 4LFAJ 2RNEA 1BQMB 1RTIA 3W61A 1MG7A 3AD9C 1J2VA 3N5FA 1WWHA 4DPWA 4I2QB 2DH7A 1R43A 2PGCA 1B4SA 3R5BA 1X9MA 5J2PA 1KLNA 2MB0B 1RHMB 3BGUA 1FNOA 2VH7A 5CYQA 4CNZA 4YEAA 3BF4A 1QAJA 4DSJA 5HANA 4PXDA 1NM2A 1Y0HA 3MCMA 1R8PA 2FGCA 5J2MA 3LP0A 1VI7A 2ZJRQ 2HW3A 3ZXWA 5KFRA 2GQ2A 1VQ9S 1Q81T 3LGMA 3C66A 3IR6B 3KJQB 4IFVB 2R2TA 1X5PA 3TYTA 4O44B 1XMOF 1K8AT 1U2FA 1KSPA 1RISA 2LA4A 4TU8A 1UWBA 2GQQA 2UVWA 2OMOA 3JSYA 1YITS 4KY3A 1TL5A 1DLOB 1NJIT 4OI6A 1S9GB 4KYZA 4O0NA 1FCAA 5K8PA 4FS2A 1NK0A 2OELA 1RADB 2ZC4A 3L7PA 4MKVA 5MAOA 3US5A 1NBEB 2GNKA 4LIRA 1JLQB 1OYDA 2M8DB 1S4EA 4DV6J 1JWWA 4QR0A 4DV5J 3O8WA 3EGVA 3R6LB 2K2PA 1S6QA 4CLWA 2DRBA 3BGRB 3SCKE 3HPOA 1X31C 2MZRA 2ZH8A 8AT1B 1WTFA 1RHUB 5J1EA 1L3VA 3KJNB 4DR6J 3HHDA 3PEJA 4ZHRA 2AGPA 1VQ8S 4V19X 3ADAC 3GIIA 3VCDA 4XK8C 2RU9A 3DRRA 2M9KA 1TL3A 2XCPA 2VZ9A 3CPWR 1FJGJ 1FXLA 4A46A 4YN3B 3KMQA 1JJHA 1X5OA 3THPA 2KM8C 5I3UA 2HZCA 3PX6A 3TUIC 1CSJA 4IQMA 3PJ9A 5L1IA 3D9BA 4OYPA 5GAHU 2KO1A 3EVOA 4RW6B 1WEZA 2KB2A 1B70B 1X4EA 2YKAA 4NYZA 3CO0P 1UFLA 4LF9F 1HMVB 3DHWC 3W5YA 5K5MA 2EC0A 3AHPA 3IGVA 2W2PP 1EAYC 3GSIA 1HWLA 4JI8F 4DL3A 3J80U 3M8ZA 3IM8A 2ZNYA 1RHJB 1XJWB 3BKUA 1DARA 1IKVA 1SUQA 3QT5A 4DUYF 4PAAA 2DHXA 2VG5A 2V4JA 4LF4J 3OXLA 3C6UB 4I6YA 3PDNA 5IM0B 2C3PA 4OZ3A 1R7IA 3C15A 3T6JA 4CLTA 5IT9Y 1WACA 3M05A 3NOCA 5G0RA 5IXUA 3BQ1A 4K4VA 1UA0A 4JI4J 2M5YA 3MD3A 1QTMA 1HW8A 3FC9A 5CZXA 3MMBB 4C8KA 4XDDA 3FBEA 3CWJA 3IO1A 3ETMA 1DRZA 1BQMA 3BSOA 2E5LF 1Q1KA 4LFBF 2RB7A 2XLIA 1Q53A 4C2MA 2VONA 1J5EF 3CGIA 4I2QA 4CWBA 4NWBA 3UCGA 4OYOA 5C42B 4LFAF 2AX1A 3PY8A 3BO3A 3ZTSA 4E0DA 3IR7B 3ISNC 2QC3A 4DR2F 2V2VA 1VOMA 5KFTA 1Z2LA 1R3NA 3NGKA 1LW2B 4ES2A 4JP8A 2ZEJA 4N76A 4MFBB 5LT5A 2F63A 3GPAA 3OTBA 4R8UB 1L3SA 2X3GA 2CAJA 3CCES 2HBRB 2V63A 1FKOB 4IFVA 3TRGA 4O44A 2GHPA 3PTWA 3TW0A 3CIMA 4WFAQ 3PW5A 1NB7A 2KZMA 4J9PA 1TK5A 4USVA 4LFCJ 3MAAB 2BJDA 1F3FA 1DLOA 3FSYA 4CH1A 1S9GA 3KNAA 2QMXA 3OXGA 4USTA 1FJ7A 1QY7A 1RU1A 2IJNA 2APOA 3MR3A 2DHGA 1SXLA 2FVSA 5A6WA 2KXFA 2PSZA 4IR9A 2BRLA 1XTZA 1FWPA 1JLQA 4ZP6A 4DZ6A 3UFCX 2DNRA 2FPHX 1UJ4A 1UW9A 4J37A 1ZA1B 3EUNA 3BGRA 3TX8A 4OJHA 3FSIA 2FJEB 2XLJA 3PR5B 2P6TA 1YKWA 4DV6F 4DV5F 2IVMA 7FDRA 4CLSA 3OSPA 3OT9A 2R7SA 2XY5A 2UU9J 2EVZA 2OFGX 4I56A 4DR6F 2C2OB 4DLGA 4F0MA 4RW9B 2BKOA 4YR0A 3M8WA 1B99A 2IFXA 1CBKA 2XQCA 4DDFA 3ISZA 2UUCJ 3NRBA 3D6FB 1JLCB 2XZDB 4RW6A 3TANA 1X0PA 4ZVPB 3VAFA 1S0VA 2WSFC 1C0TB 3U27A 1KLMB 1HMVA 3C2PA 4DPUA 4CLLA 1AYEA 4OYAA 4C8NA 3RW7A 2DRAA 3QJLA 1JIHA 4QZVB 2IM3A 1SC4B 3R2DJ 3UD3P 4ENOA 2HFSA 3BPSP 2UUBF 2ZWOA 4ZCIA 5KFZA 3HVRA 3C6UA 2XYGB 4IR1A 4FKYA 5IM0A 4IO9Q 5KFUA 5KAKA 5KT7A 4QOTA 5JVHQ 1T7PA 1U0SA 1VQ6S 4E2FB 4LF4F 5ETOA 3DRSB 3K5MA 2RUGA 4WP8A 4ZJOA 2MQLA 2OHDA 4NYOA 2HZAA 3MMBA 2HHUA 1LWXA 2HVZA 4JI4F 4AL5A 2AGOA 4ZN1A 1H98A 4O3OA 4QYZK 5A8KB 1X5TA 2LQ9A 1HYSB 2CDQA 2G0JA 1R0BG 5C42A 2VJVA 2ZH3A 2ASDA 4FBTA 2Z8QA 4MAKA 3U1MA 4WZQA 4DZDA 3C3LA 4RNMA 3W9IA 2QRRA 5E3QA 1F5CA 4ALZA 3HK2A 2J7WA 1U0HB 1LW2A 1H73A 4MFBA 3DLGB 3MEKA 4ZPAA 4R8UA 2WSEC 4OHYA 1ZZFA 2ASJA 2XYHB 1KVKA 2DGTA 4OI1A 3J81U 4KJIA 5CD4A 1PC5A 1ZM4A 4N47A 3AY0A 2Q43A 1UVJA 2DD8S 1BY9A 3MAAA 2WCXA 1ZAWA 1LWEB 1TFYA 4NZ7A 4XTTA 4EUVA 4OZNA 3D0HE 4NEZA 1HBUB 4RR5A 5DG7A 4LFCF 2AZ1A 3PEHA 4YS2A 3J7YU 1C1CB 5DG8A 2NXCA 2PMWA 2V4QA 2L48A 4EYHB 2IA0A 3P96A 3H5SA 3JXOA 4B3RJ 5HBMB 3FZ2A 1OO0B 5F3TA 4URQU 5LL6d 2VPZB 3IA0A 4RLEA 5KFLA 4M5DB 4ZVRB 3CCJS 1I94J 3H98A 3TP2A 2FZGB 2W8LA 4I7FB 3M7VA 2MLZA 4F36A 4PKDB 3PIPQ 5IZHA 2CG8A 3NXZA 4KRWA 4RW9A 5F8GA 4DEZA 2KYZA 4GO5X 4J9MA 1NK7A 4C8OA 3KUHA 3GFHA 1JLCA 5KT6A 5HSPA 2OAUA 2LA6A 3BQ0A 4KQZA 1TL7B 3R2CJ 1C0TA 5DETA 1KLMA 1U1KA 2R8JA 1V3SA 1UCNA 3TJAA 1TU0B 5IV4A 4IYQA 5DGBA 4PG8A 1S1UB 2V8PA 4KV8B 5M2PA 4WF9Q 4MK7A 2N4DA 3SV4A 4K5SA 4AXJA 1YJUA 3VGSA 2IYIA 4NASA 2JC1A 5D4LA 3WIVA 4B3OB 3DRSA 3LPYA 2DNYA 6FDRA 3P6YC 1S48A 3DDIA 2HGLA 4MIBA 2NQPA 1WOSA 2LVWA 1UWAA 3A8EA 4JYAJ 3QRPA 1FDBA 3O6QA 5KFMA 4RL1A 5A8KA 3KG1A 1HYSA 1D9AA 1G7CB 3GR1A 3M4XA 1TL4A 4ECVA 2HHTA 3Q8YA 1RP5A 4HH0A 1K9MT 3ZO7A 1M5OC 1PJ6A 3UDLA 4DXLA 1VRTB 3GTYX 1AA1B 2KM8B 1U0HA 4H4KA 2OPQB 2M3DA 3DLGA 1YG0A 3SQOP 2DYAA 2XY7A 3BPDA 3K2YA 2ATCB 1FJEB 1FEEA 2AJQA 3UR3C 1YBAA 4B3TJ 4UOCA 2FJDB 1LWEA 3LP1B 3PVXA 2B4PA 1Q82T 1HBUA 2CQPA 3QZ7A 3HFKA 5EX0A 2H4WB 1C1CA 3G82B 3W8GA 1ZAVA 3CCWA 3CJ4A 2GFFA 4Q2LA 1Q16B 1CQMA 1R8HA 2C3MA 3FCVA 2R7TA 5HBMA 4JI2F 4A8MP 3FUYA 1KR4A 2WVBA 4M5DA 3BS9A 5LMNJ 4B3RF 4ZVFA 1ULRA 2FJVA 1XBWA 2YY3A 3TO8A 3D2WA 2XMTA 1EP4B 4I7FA 2W4CA 1QJHA 3G71S 3O2IA 3NOGA 3VHQA 4XPEA 3TZYA 2HK3A 2HURA 5A8WB 2KFYA 1RT1B 3QWUA 2V9KA 3RG6A 2V8HA 5BXIA 4CLYA 5B0FA 2CPDA 3QNWB 4FKXA 4BWJA 1XWLA 3N9UC 3TA1A 1PYOB 2KT5A 3NEKA 2VJUA 1WHWA 1TL7A 3HVWA 2DITA 4OJ3A 4EI2A 2A6MA 1VK3A 3NS7B 4Q43A 3SZ2A 3D1OA 4LRAA 1S1UA 3ILIA 4KV8A 1G1XA 3JQJA 3A8IA 1HHTP 1VQ7S 1Y5NB 1MWZA 3TX0A 5I42B 2JH3A 3K5LA 2LXFA 2MQ8A 4DR1J 3BYRA 3AQOA 2MY8A 4FVMA 1F60B 1S6UA 1RWOB 4B3OA 1RBAA 4DMZA 4ELTA 5F0UA 3MTKA 1RTDB 4Y0FA 1JLFB 3D68A 2IPOB 2R7XA 1X4FA 3CDBA 3N4WA 2QLFB 3EGNA 1ICEB 2Z2LA 3CMQA 3UDCA 2KT3A 3QT8A 3I6PA 1CULB 4QIGA 2FC8A 4K0KJ 2W4DA 3KOAA 2FY1A 5F9LA 5HL7Q 1IWGA 5L39A 3BSCA 4FXVA 4KB7A 3W62A 5KG1A 4NLDA 4MMOA 3BDEA 3A12A 1VRTA 5HQMA 3DLLQ 3JYTB 1SJQA 2OP5A 3MHYA 2OPQA 2P8IA 5BYRA 4QBUA 3TUPA 2R7QA 2FLNA 4FPRA 3RB3A 4YP3A 2AGQA 2X1FA 2E1AA 2VA3A 4WBFA 4DQQA 1LXNA 4YB1P 2VFUA 1IBKJ 2W4PA 1RWVB 4ZPCA 1M5KC 5K8NA 2R42A 3LP1A 1WC1A 2MKIA 3GWCA 3HSZA 4F50A 1WC3A 4J9QA 3QPIA 4B9LA 2MTLA 2E7WA 4F0HA 4LR8A 4LSZB 3BYPA 3G82A 5RUBA 3A4TA 1HR0J 2CQGA 3BM7A 3Q0AA 2ZH5A 5KFSA 3IGNA 4LR7A 4OZ0A 4M5IA 1UZDA 4TLRA 1U6BA 3U1LA 2QL9B 3AD8C 4M5KA 2UXDJ 1EP4A 1I3OB 4YHHJ 3CJQA 3HM9A 2VA2A 3KUGA 3MR6A 5A8WA 2WB4A 1IBLJ 4E98A 3FK4A 4B9SA 1RT1A 2HSEB 2YKOA 1U26A 1EZZB 3VAJA 3IFEA 5GAEI 1CPZA 3RB0A 4RW7B 4AL6A 4Y3CA 2CQ2A 1K47A 1PJ5A 2ZH1A 2RRNA 1JXEA 1VS3A 1TL1B 1VIOA 2QLWA 2JOQA 3BKTA 4QPTA 5LMUJ 1A7GE 2WVDA 4X65F 4CYUB 2Y0BB 2F5GA 3G6ES 4OZ1A 2J9DA 3DMJB 4ZA1A 7FD1A 4TXSA 5HVGA 1U7LA 5I42A 1S7IA 2VV5A 2W9CB 1IXKA 4WYWA 4WKYA 1FRKA 4PQUB 5KT3A 5JMNA 5M2UA 1RTDA 1JLFA 1ZA2B 3FBBA 2I0XA 2QTWA 4ED1A 4WU3A 3NLCA 3BN4A 2IVFB 3HZGA 2XSFA 1CULA 2V2ZA 1BQXA 2FZKB 2RDIA 2DR6A 4BCAA 5DQHA 3AJ1A 3BBFA 2ZUAA 1NCLA 1N36J 3J81j 4DQIA 2KVIA 2L9DA 1VQOS 4A8KA 1G3OA 3NCQA 3BR9A 3TA0A 2P9CA 3JYTA 3HI9A 1MMDA 5KG0A 4DQRA 2P9EA 3HKWA 4NMLA 5KFDA 3C46A 3AOAA 2CPZA 1WKJA 4JV2A 3O3LA 3RBEA 2AJ4A 3OPKA 4LMZA 2OEKA 4DU7A 4OYBA 3R3TA 1AUDA 1L3UA 4FDFA 5KFIA 2ZD1B 1X4CA 3AXKA 3JAMU 3NG8A 1IUJA 3EDRB 1CC7A 1YBTA 3CCMS 1U49A 3QRQA 1IBKF 2PA8D 1KQSR 5D4OA 2VDHA 1U2CA 2XTJP 1NLKL 2PFDA 1C2PA 1H2TZ 2IM1A 4UTGA 3H4BA 3ZTQA 1HR0F 4H4MB 5DDOC 4FN5A 4DX5A 1MWYA 3OL7A 4PQAA 1IJFB 1OMSA 3GZ7A 4RX6A 3ONQA 1TV6B 2NREA 2DR7A 1BE4A 2CG4A 1J27A 2BRKA 3VQSA 2QO3A 1S6PB 1FKPB 1IQTA 2V9WA 2VOPA 3F41A 4YHHF 5B09A 2J6SA 4LJMA 3CJTA 3D6MB 4DL7A 5L9NA 4HDGA 1DTTB 3EXYA 3QGHA 4RW7A 1K0TA 3H25A 4GKJF 1VBZA 3KXDA 4YB7A 3LUYA 1TL1A 2XNQA 2RSQA 4GMKA 3DGPB 1R31A 1T9YA 5HJXA 2CJ9A 4CYUA 4DN9A 1IJEB 1NRKA 2FJBB 4TN2A 3DMJA 2ROEA 1DY3A 4CLKA 2ILYA 3WHIA 4GVBB 4MKYA 2W9CA 3V4MA 4V1Ak 1IM4A 2BR0A 3T5HA 2OI2A 4HEA9 4JI5F 3L7UA 1P9QC 4PQUA 3KTQA 2KVQE 2C22A 1JMTA 1Y10A 4F2RA 3M6UA 5GMEA 3CJRA 1EJ7L 2V94A 2KL8A 1UEUA 2XEXA 1GAOA 3M1VB 4KE5A 3PR4A 3CCZA 1PYTA 1RUSA 3T41A 3IR5B 4JI6J 1XNRJ 4DL6A 2C42A 3I5CA 1PKUA 2MQPA 5HROA 2GW8A 4ED7A 2E5IA 3WX8A 3QMQA 4OZJA 1HNXJ 2CNLB 3P5TL 1XC9A 3PM9A 3CDUA 4YMEA 2XYPB 2MYFA 2ZH9A 5IWAJ 2NS1B 1BWVA 4USMA 2LQJA 4QYRA 5U47A 3DXSX 3W65A 5B7WA 4A8YA 4P2MA 4JI0F 3UWTA 2Y1JA 4HH1A 1M5VC 4CO4A 2CNKB 3IBWA 4PG4A 2ZZTA 4DLEA 2A18A 4LBIA 2HS4A 3R6GB 2ZD1A 2GIQA 5J2NB 2IVYA 2HRTA 3M30B 3BJYA 4RBTA 4L74A 1M5PC 2FHJA 2CPEA 3J7Z5 1WDTA 1RCOB 3V6HA 3J7A1 2QL5B 2W1BA 5ETNA 3W5XA 1T3OA 3D6TB 3CULA 2OTJS 4I67A 1PCAA 5HMYA 3FCHA 3D0IE 1QD1A 2GHWA 3N0VA 3VR1A 2I1RA 2JHEA 4C3KA 4ZJQA 4DR4J 1NNDA 1Z2ZA 4H4MA 4LF7J 1DQ8A 3PYFA 3RRHA 3K57A 3ULHA 3Q24A 1TV6A 2KXHA 5KT2A 2AJFE 4MT1A 2KRBA 3HT3A 4LQ9A 2HGNA 1V3RA 1S6PA 1FKPA 5L1LA 3IWNC 3UQSA 2DKOB 3OVAA 3RYLA 1S12A 1WG5A 2VG7B 3UN3A 3MCOA 4RNHA 2ZE2B 3WQPA 1DTTA 4XAKA 1S0MA 2AWZA 2BMBA 2NUUG 1XMBA 2DR8A 2QT7A 3UN5A 2DEJA 2PEBA 4PPDA 3LGNA 4NZ6A 3RAMA 2X1AA 3HCXA 3DCAA 3DGPA 5KFPA 2BE7D 1DHMA 2HG4A 1WUUA 4DS4A 3CCQS 1N0UA 1S76D 4DSLA 1UPMB 3QLHB 2CKWA 1M1GA 3H2UB 2M8HA 5KG5A 4DPOA 4LRBA 1AROP 4OYXA 4WP3A 2LYVA 1LKZA 4GVBA 4CM2A 1FDNA 1Z4UA 2GJIA 4TYBA 4ZOSA 2AKWB 1MU2B 3M8YA 4ELVA 1KFSA 4DI6A 5GADU 3W8PA 4OI2A 2F8HA 2HHPA 3K5PA 1T8EA 3MWBA 4X4OA 4J9VA 3DN9A 4DX8H 4A4JA 1VQPS 3M1VA 4CT8A 1YRXA 2EC2A 2EFPA 5C2GA 3NMAA 4NMXA 1HWJA 2VHGA 4I64A 3DLBA 1UFWA 3P4UB 4C98A 4CLFA 2HLTA 4RBVA 4A8FA 4Q8EA 2JLEA 2BKPA 4JI6F 2DNLA 3OL6A 3TARA 3ILOA 5BYQA 4G1QB 2YKNB 5HVHA 1YX2A 2QA2A 3LAKA 3BR8A 1RWNB 5IWAF 4YDXA 3GG0A 2O01C 3HULA 1N6QB 1VYAA 2HAFA 4B9UA 3NS6A 3RBZA 5J2NA 4KGMA 4FXWA 2CJYB 4WWSA 3ZTPA 1S10A 3M30A 2ZH6A 2C2DA 3THVA 1SIZA 4ZCKA 2GX8A 3MOZA 3QZ8A 1MN9A 1HNWF 1GXTA 2HVDA 2KKHA 3OTOF 1S4FA 3W2WB 2WW8A 5JXSA 3VGUA 4X2BA 3EZUA 1R6VA 1XK8A 2IM2A 1B7FA 4CO0A 5D0GA 3G8QA 4BC9A 5I4MA 3HLUA 5KFNA 2ZH4A 1MROB 5EN1A 2DXEA 3T6BA 4X4UA 4DR4F 2HQ3A 3LANA 5AJ3J 4X62F 3HXMA 1ZM2A 3A3PB 3B54A 4AQYJ 5DZ7A 2ZKUA 2B9XA 2XMUA 3HFVA 3AD7C 4S0MA 1N5SA 3IXQA 4M5LA 3A8JA 1XMQJ 1HBNB 3BB5A 1ZTWA 1NDKA 2VG7A 4ZMMA 2ZE2A 3TVYA 5T41A 2MLYA 3K5OA 3TQ1A 1A9NB 3D66A 3GIMA 1U6FA 2RRAA 2BABA 2J6UA 3DNCA 3GIJA 1M90T 4FYXB 3J81Y 3R5GA 4K50A 1FT8A 1Y4ZB 2AT1B 3KHHA 2HQGA 4Q8FA 1QE1B 2K1RB 3QLHA 1KVJA 1RCXB 4B08A 1VC5A 4LVNP 4I0WA 3FZBA 4OX8A 2XZWA 1S0OA 1T9TA 3TWZA 1DBDA 2CZ4A 4QR2A 3T1AA 2HWIA 3EE3A 3EX7B 3FDSA 1PGZA 1MU2A 2DHHA 5AE3A 1DURA 4NLYA 3JSMB 4UQTA 3MTJA 2XS5A 3GLJA 4DX7A 4ZN3A 5IC4B 3TJ8A 2NPIA 3FEXB 4O0IA 2BJ3A 2YH1A 4L6V3 3OFHA 5KFVA 1UZHA 2RS2A 3PXGa 4Q5VA 4IRDA 2XGQA 2CXEA 2MPUA 4F67A 2H9ZA 4HDHA 4ID5B 2LQ8A 1SQFA 1T0TV 3E8OA 2FY8A 4J9OA 1O8BA 2JVOA 3TUZC 3VQTA 4GC6A 4G1QA 1X4GA 2YKNA 3NKYA 2H5IB 1RAFB 1NXIA 3R27A 2RQCA 3T1YJ 2B4VA 4IG0B 2KFZA 3FMWA 1N6QA 3THTA 2RS8A 4MIAA 2UXBJ 5B0CA 1YSJA 1T11A 2IYGA 4K7QA 1NEEA 2VKZG 1FI4A 2ALYB 3AH6A 2FGOA 1FEHA 1FE4A 2RDDA 3R5CA 5D0HA 1R0CB 4C8MA 1TUWA 3W2WA 1V3ZA 2FB0A 2Z56B 4ZCLA 3ENWA 4PWDB 2AV5A 2XMMA 3VZHA 1X7VA 4YFUA 5ETTA 1F0XA 3MEDB 2QZ8A 4RW4B 2VASA 1VCTA 1MROA 2QGFB 2EI5A 4WIQA 4ZCMA 1HNIB 4ATNA 3MMCB 1FVSA 2PN6A 2M4MA 3IP0A 4ICLB 2BQRA 4R5PB 3IS9B 3MOJB 4LUBA 2MKSA 4NCAA 3FCWA 1KKHA 2LKZA 2HIQA 1LWFB 1TAQA 4QIFA 1BWEA 4ZP7A 1HBNA 5IS2A 3ELHA 4OFZA 1XERA
chains in the Genus database with same CATH topology
4OI1A 2FC9A 4QIEA 4RW8B 4KJIA 5J2QA 2PC6A 2MZTA 1PC5A 2EBGA 1WG1A 2DO4A 3NCPA 3CC2S 2GMJA 1IKYB 4KC5A 3EPGA 1ZM4A 3DC2A 3I9V9 1OIAA 1U45A 4N47A 1L3TA 2PO4A 3FEZA 5KFJA 3AY0A 2XLKA 1S0NA 5HP1A 2Q43A 3FEYB 4P7VA 4ZP9A 1UVJA 1RWUA 2WSCC 2DD8S 1S1WB 3H8YA 4L3NA 3DOLA 1BY9A 2PIIA 4LSLA 4USIA 4DR3F 2BVZA 2WCXA 1ZAWA 4HHJA 1LWEB 1TFYA 4NZ7A 5F8NA 1R0AB 4XDCA 4C97A 1NKEA 4Q0BA 2QE5A 4EUVA 1VMBA 4OZNA 4DQSA 4C0BA 2O5DA 4NA1A 2Z2MA 3H2VE 3D0HE 5E3PA 2Y0SD 1HBUB 4WFYA 3DOKA 5DG7A 1QE1A 2K1RA 4LFCF 3PEHA 4N8OA 3J7YU 1C4CA 2AQ4A 1C1CB 2RIJA 5DG8A 3CIZA 3KLHB 2HGMA 4EBDA 1JXLA 1YJTA 2V4QA 1JKHB 1S6OA 3DYAA 1GTHA 2L48A 4M95A 1M5SA 4R25A 2CQDA 4U7UK 3I55S 4EYHB 3MR5A 2HVHA 3MM6B 3OV7A 3PV8A 3GR0A 2E5HA 5D3GB 1NKBA 1OPIA 2IA0A 3P96A 5L9XA 3H5SA 3CVKA 5DDPC 2CVIA 3LP2B 4JOUA 3OVBA 4HVZA 2JX2A 2MHNA 1H7XA 4NLUA 4TKTA 1T03A 5HBMB 3FZ2A 2CQ3A 2VG6B 3QGIA 3TA2A 1OO0B 2K3KA 1CVJA 5F3TA 5LMNF 4PR6A 3LQVA 2R9LA 1TK0A 4URQU 5LL6d 2B56A 2DGSA 3WC0A 2YKPA 4ZVEA 4I2PA 3BGLA 2VPZB 3IA0A 4ZVGA 3HHLD 4WK3A 4RLEA 4PUOA 3GMGA 5KFLA 4X66F 2L9NA 5KFYA 3JSMA 4M5DB 2NPFA 3MUMP 3WC2A 3H59A 2OKQA 4RUCA 3CCJS 2KG0A 3D0GE 3SMZA 5B08A 2UUWA 2D3OR 2YNHB 2R7UA 2JZ5A 4FF3A 3BDPA 3H98A 4F4XA 2GJ2A 3Q8SB 1FKAF 2JFKA 3GB0A 3TP2A 5IT4A 3S6EA 2W8LA 4ECRA 4I7FB 2ZVSA 1Y3KA 3KLVA 4PKDB 3PIOQ 4O3PA 1KN6A 3PIPQ 1U47A 3VTIA 4W92B 2XG8A 4USHA 4LVOP 2KDOA 3T3FA 5IZHA 2L41A 2C3UA 4KRWA 4RW9A 2UP1A 1SL0A 1X4AA 1GH8A 1S1VB 3I0RA 3AA9A 5F8GA 4DEZA 2KYZA 4U6PA 2ACYA 3EZ5A 3N01A 3PX0A 3SSSA 1FA0A 4GO5X 2VB6A 1C1BB 4M8LA 1D0EA 4CO1A 3VAGA 2AJ1A 4J9MA 4K4YA 2MZQA 4WXOA 1NK7A 5CXTA 2MKJA 2B6AB 4C8OA 2X1GA 3O44A 4ID5A 3TAMB 1JNZB 3ZC4A 3CD6S 2I8EA 4H54A 1S49A 2D9OA 3GFHA 1JLCA 1NH7A 1TVRA 2IRXA 5KT6A 2OAUA 1UEVA 1HQEB 2LA6A 4J9SA 2HNDB 1CC8A 3BQ0A 4G3IA 1C0UA 2XULA 5GMKa 3V81B 4Z37A 2C3OA 2ZKTA 2J0SD 4BS2A 2KN4A 4KQZA 1RT3A 5FLXY 1BQNB 1C0TA 1ZPVA 1KLMA 3N6LA 1HL6A 5DETA 1U1KA 2R8JA 1H6KX 1V3SA 3M2UA 4I1TA 5KFWA 2HMIB 5K8MA 4OI0A 2NZ4A 3Q8QB 2HNZB 4IYQA 2NXUA 1AFIA 4J9NA 5DGBA 2VOOA 4P2SA 2DNPA 4B9TA 2PDAA 4XO0A 3PJWA 3CF5Q 3FRYA 4PG8A 1S1UB 2MQMA 2RT3A 4IG0A 2DNHA 4KV8B 2R7WA 3PW2A 5M2PA 1T05B 3HF5A 1YJWS 2XCAA 2VFVA 3AA8A 3EGWB 2MZSA 2DCLA 4DR1F 3S8SA 1QSLA 4WF9Q 2Y1RI 5AXKA 3W2VA 4MK7A 3Q22A 3T1YF 3CC4S 2XMWA 4I4BA 2N4DA 1HBOB 1N56A 3SV4A 2N82B 3BN7A 4FNIA 2R8HA 4K5SA 4AXJA 5HLFA 1YJUA 2YNIB 2IYIA 4NCBA 2KTQA 4ZPVR 4HLBA 4DOZA 3M8PB 1U1PA 1JJ4A 1VQ4S 2HHSA 2JC1A 1FRMA 5D4LA 1FO1A 2RKIB 2B43A 2VFRA 2UXBF 1VBYA 3DRSA 4F26A 4B3OB 4O4GA 4XPCA 3KWMA 3LPYA 1R8AA 5KT4A 2DNYA 1N54B 3SSRA 6FDRA 4ZKAA 1RT7B 3P6YC 3MEEB 1S48A 4BC7A 2UVVA 4CT9A 4B9VA 2B4UA 4HT7A 1UVKA 2HGLA 1O0PA 4K0KF 3OFEA 4AL7A 1LK7A 4MIBA 2NQPA 2LVWA 5HROB 5B0DA 1BD6A 3RBDA 2BZ2A 1HNVB 4DV1F 1VRUB 3A8EA 4J9LA 2FJWA 1FDBA 3O6QA 5KFMA 2NLWA 2CQ1A 2IAJB 4FF4A 4UUXA 5D4PA 2ZJPQ 1FRHA 4M63A 3TVZA 5A8KA 3G4SS 4YOEA 4PWDA 3KG1A 2R7VA 2H5EA 4LSNB 1D9AA 1G7CB 3MECB 1HYSA 3GR1A 4Q7AA 5A0YB 3IG1B 5C24B 4TQSA 3M4XA 4F4YA 1R89A 2BE2B 2G13A 5GVQA 4KHPF 4C4WA 2VFTA 2BDPA 2FIUA 3DI6B 3JB9k 2VBWA 4DR7F 1TL4A 1S99A 4ECVA 3MEDA 3C6TA 4MJKA 3F73A 2WONB 1NK5A 1A6LA 1SQEA 4RW4A 2HHTA 3NS5A 5KFEA 3BO4A 1RP5A 4HH0A 3PW7A 2J0XA 1K9MT 3MCSA 3RR7A 1S9EB 2A10A 1M5OC 4HI1A 4ED0A 1KS2A 3UDLA 3MM5B 4EU0A 1CEZA 2RQKA 1HNIA 2E44A 4N41A 2OPSA 5CZVA 3HDSA 4PWUA 3MMCA 4X4QA 4QWCA 4OQJA 2RILA 4ICLA 5EWEA 3VAMA 1VRTB 4ED6A 4R5PA 3IS9A 5H1SV 4A8QA 2KM8B 2FVPA 3HKZD 3MUVP 1JLAB 5AXNA 1P8GA 3G8SA 1VQKS 4H4KA 2IMWP 2OPQB 4Q45A 2VODA 2NYIA 1Q8LA 4DSFA 5D77A 2M3DA 4Y34A 3DLGA 1YG0A 1FRJA 4BWMA 2J9EA 1HWIA 2XY7A 2O67A 4TLQA 4DSKA 3K2YA 3E3XA 3V6DB 3EGZA 1FJEB 1FEEA 4FF1A 4ED5A 2AJQA 2AP6A 1CG2A 3UR3C 4M1KA 1SKWA 1YBAA 4RW8A 3S01A 2AW0A 4QJVA 4FBUA 4UOCA 2BYCA 5C5JA 2W9BB 2A2CA 2V4RA 3S7RA 1IKYA 1U1RA 1FD8A 2NSCA 3V5RA 4YQWA 1FK9B 2QA4S 3D1QA 5HMWA 2JLGA 3Q8PB 1KRPA 4FYDA 3FMBA 2U1AA 3IWLA 1G6BA 4Z2XA 5HMXA 4C3LA 2ZZNA 1S1WA 2GV1A 5HO4A 1KTQA 2FJDB 3QIPB 2JEJA 1OPZA 2F40A 1LWEA 4HTJA 3LP1B 4DR5F 4OX9F 3MZIA 1R0AA 3NP5A 2CPJA 4U67Q 2YTCA 1QAIA 3PVXA 1ELOA 2MJNA 3ZZZA 2B4PA 3GV8B 2PFFB 1Q82T 3AAWB 3M2RB 5J1PA 2DK2A 4ZK7M 3E2EA 1HBUA 2CQPA 3QZ7A 5H9EJ 2CPHA 3HFKA 4IQXA 4QW8A 5EX0A 4RU9A 3IAM9 1C1CA 2B9YA 4ZS6A 4IO1A 3R1LA 1U48A 1ZAVA 3CCWA 3CJ4A 2GFFA 4DHVA 3KLHA 3PO4A 3KFWX 3LO3A 3T1HF 4IRKA 1YQHA 1HWUA 1RGVA 1JKHA 1ZBTA 4R0JA 1TKZB 1AXQA 4Q2LA 2YNFB 3ZZOA 1Q16B 2OLWA 3MM6A 1CQMA 5D3GA 1R8HA 4C8LA 1WD6A 1P27B 2C3MA 2A3JA 3LP2A 4CH7A 3POTB 2N3LA 2R7TA 1GXUA 3M8SA 1KNZA 5HBMA 3M6WA 4A8OA 2VG6A 4ETXA 3IAS9 4JI2F 4JV1A 4A8MP 4AXIA 2C2RA 4DJBA 2UXDF 3CJ3A 3QJJA 3HHLB 3NL0A 3MPYA 3M32B 2BA9A 1KR4A 1X5SA 4ECUA 2F8MA 4YB6A 4M5DA 4J5OA 1SJ4P 1TKTB 3BS9A 4B3RF 4ZVFA 2YNHA 5A8RB 1KTVA 3OJSA 1ULRA 3PW4A 2FJVA 1U1MA 1XBWA 2YY3A 3TO8A 3D2WA 2XMTA 1EP4B 1IBLF 1TKXB 4I7FA 4RKUC 2ZZMA 2WOMB 3F56A 2W4CA 1QJHA 3G71S 3IWXA 5LSLA 2R2SA 3O2IA 1SB6A 4XPEA 3MMAB 5A8WB 3RR8A 1FJCA 2XSJB 5K9FA 1D9FA 2KFYA 1RT1B 3QO9B 2FVCA 3QWUA 2V9KA 1OSDA 3P3DA 1UMJA 1S1VA 4IOCQ 4B9MA 2V8HA 3KJVB 5F3ZA 1W2IA 4BHQA 2HRYA 5B0FA 4DV2F 1C1BA 5E5NA 1KEKA 2CPDA 2E5JA 4BWJA 4I69A 1XWLA 2B6AA 3N9UC 1T3NA 3TA1A 3TAMA 1PC4A 5DDQC 3N28A 2CRLA 5DG9A 5G4DA 1LK5A 4WE1B 1GTEA 3QIDA 1LV5A 4KKOB 4EEYA 1HQEA 2KT5A 4OMFG 3QJPA 2D9PA 2HNDA 2DGXA 3VAKA 2R8KA 3V81A 4NLRA 2PD1A 4AYBD 1WHWA 3SV3A 3HVWA 1BQNA 3M6XA 2DITA 5D4NA 5KFCA 4UQGA 4OJ3A 3KMSA 3QGGA 3CJ5A 2VBYA 3HMJG 2YNGB 3NNHA 1HQUB 5KFXA 2CJKA 4M94A 2QA4G 5LMUF 1VK3A 2Q1LA 2Y1IA 1JLGB 4ILMA 2HMIA 4NLVA 4Q43A 2HNZA 1P1LA 4B17A 1OSCA 4F02A 3MPVA 2EK1A 3SZ2A 4ERDA 3D1OA 2QSFA 2B3TB 2J76E 3GG1A 4WFBQ 1T95A 2FLLA 5FD1A 4URSA 1S1UA 2E1RA 2JVRA 3CDAA 3K5NA 4KV8A 2PI5A 1G1XA 1IR0A 1T05A 4ECWA 2I5JB 2JFDA 4KFBB 2QV6A 1HHTP 2F1FA 2WAQD 3DFEA 4NA3A 1VQ7S 1KQGB 1Y00A 1Y5NB 4KAIA 1NAQA 1XN9A 3I32A 1MWZA 1HBOA 4C7QA 4NOHA 3IC1A 2F8EX 1IBMF 3H5YA 2KH9A 1Y7PA 2YNIA 5I42B 2JH3A 3K5LA 2LXFA 2R8IA 2BBEA 3M8PA 1U1NA 3OQ2A 2VUGA 2RRBA 1VQSA 3PNIA 2QFJA 3AQOA 2MY8A 3LW5C 4FVMA 5KTQA 1F60B 1S6UA 1V6HA 2RU3A 2RKIA 4Y2AA 5LXYA 3HVTB 2U2FA 4B3OA 3MMJA 3MEGB 3SEOA 4DMZA 4X4TA 4ELTA 4PG6A 2ZM6F 5F0UA 1YRTA 3MTKA 2A2DA 4C9DA 2VQEF 1SH2A 3M8RA 1RTDB 1RT7A 1JLFB 1WG4A 4RNFA 5HQ8A 4Y0FA 2JEGA 1HI8A 3I87A 3TR5A 3MEEA 3ZZRA 2R7XA 2LXIA 4B02A 1X4FA 3CDBA 3N4WA 2ABYA 3EGNA 2DHSA 4DL2A 1UJ6A 2Z2LA 2R2RA 3MI7X 2DGVA 3CCUS 3BZQA 2RQ4A 3TVKA 4F8RA 4IG3B 4HL9A 5KT5A 2W7AA 4O3QA 2E1MC 4DV0F 2ADCA 1HNVA 1VRUA 4Y28C 3UDCA 4CO5A 5BR8F 1Q78A 2KT3A 2M52A 1ZETA 3I6PA 2EWHA 2IAJA 1SJFA 4QIGA 1N34F 3G6XA 5B0BA 2FC8A 1U4BA 1N36F 2W4DA 3KOAA 1ZOTA 4LSNA 4GC7A 3MECA 5A0YA 5C24A 2FY1A 3IG1A 2ASYA 5F9LA 4XIUA 2BE2A 4DF4A 5HL7Q 4NX9A 2AX0A 3DI6A 2CJBA 3O5TB 5L39A 3S1TA 2C2EA 3BSCA 3OXFA 1FXDA 4FP9A 3KK3B 2WONA 2YWFA 1REVB 4FXVA 3OR1B 3F44A 4YB5A 4LF6F 3FRZA 5KFHA 1MNEA 4KB7A 2PEHA 1S9EA 4EZ9A 4CO2A 4ES1A 1WI6A 5KG1A 3OSNA 3MM5A 4NLDA 2MMYA 4ZDNA 4MMOA 2ZBCA 1CLFA 4C3MA 3PACA 5E7OB 5KFOA 1N52B 2M70A 1XEZA 2LQ5A 3BDEA 4PXEA 3V4IB 1S9FA 4F2SA 1APSA 1VRTA 3DLLQ 3SDEB 3JYTB 1SJQA 4LF5F 1UETA 2R4FA 4UW2A 4PPZA 2OP5A 1JLAA 1KOOA 3MHYA 5GAGU 4DSIA 5LSOA 4B3SF 2OPQA 2E29A 2PE8A 5BYRA 2Q66A 4QBUA 4Y65A 2JEFA 1O5JA 2WK4A 2R7QA 3EYZA 1M1KT 2VQFF 5FJ4A 3DRXA 4OZLA 2FLNA 2RH3A 4FPRA 3V6DA 3RB3A 4P6QA 2F3JA 4YP3A 4DL0C 2AGQA 1U24A 3ETOA 4EFAC 4A8XA 2X1FA 2YKMB 2CPIA 2E1AA 2HRUA 4X4NA 2VA3A 2W9BA 5E2QA 4NLTA 5KFKA 1LW0B 4DQQA 2LU2A 1LXNA 4IFYB 2MQNA 1FK9A 1N5YB 2D1CA 4YB1P 3GFZA 3WX4A 4MYUA 2VFUA 1C4AA 1KOHA 2W4PA 5DM6Q 3I5AA 2EBEA 3R1HA 4ZPCA 3ICLA 1M5KC 2HWTA 3QIPA 5K8NA 4CIOA 2Q79A 4DFKA 1FD2A 3SCJE 4NLXA 3LP1A 2ZDOA 3GWCA 2MKIA 4JI7F 4F50A 3NWGA 3OVSA 5IFMA 2V2KA 4K5RA 3CJKB 4EZ6A 1FKOA 1H2UX 2FHJD 3BQ2A 4TY8B 4J9QA 3M2RA 4LF8F 1QUPA 2WB1D 3QPIA 1VQMS 2ASLA 4B9LA 1FF2A 2IM0A 2YWKA 4UUWA 3WBZA 2E7WA 2JC0A 2F7VA 3JAMY 2ATLA 1TUVA 1Q7YT 1ROFA 1ZYQA 1RTHB 3ZZUA 3MAHA 4MIWA 4G6VB 1NO8A 3JSBA 2E66A 1Q8BA 3DDKA 4V19J 1TKZA 4ECZA 1U1LA 4WYLA 2B7BB 2YNFA 4YY3F 4CO3A 2CQGA 2ZNZA 3BM7A 1W2BR 2AYEA 3Q0AA 2RDJA 3DLEB 2ZH5A 2KJVA 2JL9A 1DZ5A 5KFSA 1HPZB 3POTA 4NPOA 1LOUA 1RA6A 2OPPB 1N4LA 1G2EA 3IGNA 4OZ0A 5HMZA 1YIJS 1NJZA 2AYMA 3DLHA 3MM8B 4TLRA 2CPFA 2V8GA 3I0SB 1U6BA 3HHLA 1K73T 4OV1A 3W7BA 3M32A 1SH0A 1XNQF 3U1LA 4IOAQ 4KR0B 1TKTA 2ZH7A 5C25B 4QWBA 5AXMA 2MQQA 2L08A 5EX3A 5A8RA 2W24A 3KK2B 2DR5A 2BQUA 1N5QA 2GGPB 3NAHA 5KOXA 1EP4A 1UVNA 1TKXA 2Z4PA 2DGQA 3OTCA 3KHGA 4IUFA 4OLPA 5DJBA 3CD5A 2WOMA 3E01B 3CJ2A 5I3PA 1FRLA 2V8VA 2YQ3A 4OJGA 1HD0A 3HM9A 2VA2A 2LMIA 3MMAA 1B0PA 2XS2A 3MR6A 5A8WA 2WB4A 4KIAA 2XSJA 3WZ0A 4E98A 4B9SA 1RT1A 2BV3A 3QO9A 2CQHA 1GT8A 5EWFA 3QYYA 1P1TA 2YKOA 1U26A 2W7PA 5CYJA 1HI1A 4KT0C 4UY85 1GX5A 3B4DA 3KJVA 1B64A 3TI0A 4ELUA 1N88A 3VAJA 3IFEA 2KHDA 4K2XA 5GAEI 2YKQA 1CPZA 3IN5A 1MMLA <