4NMXA

Pcsk9(deltacrd) in complex with phage-derived inhibitory peptide 2-8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a Small Peptide That Inhibits PCSK9 Protein Binding to the Low Density Lipoprotein Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 22
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4nmxA01
2W2PP 2Z56B 2XTJP 3CO0P 3T41A 2QTWA 3A3NB 1V5IB 1SPBP 3CNQP 4NMXA 1ITPA 2Z2YB 2Z2ZA 2W2MP 3VV2B 3AFGA 4K8RA 3P5BP 1SCJB 2Z58B 2W2OP 4NE9C 3WIUA 3QFHA 2E1PA 2ZWPA 3WIVA 2Z57B 3H42A 3BGOP 3BPSP 2PMWA 1R6VA 3GCXP 2W2NP 4YN3B 3VHQA 3A3OB 4JP8A 3WHIA 2ZWOA 2W2QP 4OV6A 3GCWP 2Z30B 3SQOP 3A3PB
chains in the Genus database with same CATH superfamily
3R7NB 5JVGQ 3ZTRA 2DNRA 1RTHB 1JXVA 4Y6IA 4NLXA 4YB7A 3AQOA 3GQCA 2NXUA 5KFYA 4OYWA 1RAIB 2A3JA 2BJ7A 3A1YG 6FD1A 3UPFA 3FCVA 3OR1A 4DOZA 1REGX 2P9CA 5CXTA 3GV5B 2MMYA 4DXLA 3AOBA 5HROA 3MMAA 3ETMA 1V3SA 2CVIA 5DRKA 1YHQS 2BJ1A 4CI0B 3RG6A 3I55S 1TUWA 1S6QA 1XR6A 1N0VC 4XK8C 2V2ZA 1P9QC 4FDFA 4TU7A 3BO4A 4NZ6A 1HWKA 2OP5A 2J7UA 3PHEA 3DXSX 4C3MA 4ZP8A 1MROA 4KHMA 4CO1A 3SV4A 3K0JA 4PRFA 2JEFA 3J7Z5 3HSZA 1YK9A 1QDUB 3NGRA 4TQRA 5L1KA 2WOMA 4NWBA 4YB1P 1RT6A 2JC0A 2OEMA 2AJ2A 3I32A 4KY3A 4Q44A 2BJ3A 1RT5B 4A8QA 2H5JB 5HLFB 3CJ3A 1WKKA 1UWAA 4ED2A 1QY7A 1QSSA 4LJMA 5I3UB 4ILMA 3E01A 1RHUB 3HHEA 4URGA 1HNWJ 1NJIT 1HBMA 5KG0A 3M8PB 3GV8B 2FGOA 1MU2B 3QGPA 2IM0A 1EB0A 2LQ5A 4NLOA 2ZE2A 4AE5A 3KK3B 2K1RB 3M4XA 1FKOA 2AWZA 1RAHB 2M2BA 2R4FA 1SV5B 4HI1A 4L3KA 4LBPA 2J6TA 3SI8A 4GO7X 1YLXA 2QMWA 4BC9A 4KAIA 4MT1A 2CZ9A 3CJ5A 3RB3A 1KLMB 3DDIA 4R0JA 3TAQA 3H7HB 4OJHA 1T02A 2BRLA 3HFVA 1K73T 3GFHA 4WXOA 3TUIC 4OJGA 4DV4F 4GKKF 3R5CA 2XZDB 1XR7A 4I68A 2HLUA 2QTWA 4DV2J 1JLGB 3PO5A 4JI4F 2ABYA 2OEJA 4NLYA 3HZEA 2DNKA 3CCLS 4AL6A 4LF4F 5IT9U 3W64A 9ATCB 1NKCA 4B9VA 5D3GA 1SXLA 3HKZD 5E3PA 4DPTA 3FDSA 4IG3B 2LEPA 1C0TB 2HVZA 1SL0A 3Q2SC 4WJBA 4DX7A 2BXJA 2KT5A 3MUTP 4OI6A 2OI2A 1QE1A 3I87A 2ZHBA 2KDOA 1HQEA 4NL5A 2QSFA 4R25A 4YN3B 5KFIA 2C28A 3PDNA 1F2HA 2B9WA 1TL1A 4FYVB 2ZWOA 3T1YF 1VCTA 3BSOA 2YWFA 1R27B 2HHSA 3CTRA 4DSEA 2GV1A 2MQMA 2YNGB 3RW7A 3LWLA 1YZ6A 3CCRS 1VQ6S 1WEYA 2KL8A 2L08A 4TXSA 4EZ6A 2QYGA 3O2IA 3VAHA 2AGOA 1T3NA 1ZAXA 2ILZA 3GV7B 1KVKA 2OGUA 1OYDA 2DCUB 2OPRA 3L7OA 3QT8A 5HMWA 4A8MP 1NK9A 5CYJA 3MFIA 3JYTB 5C24A 4LBIA 4M5DB 4NCBA 3U7JA 3L7UA 2F8MA 5HMZA 1RACB 4MFBA 3TJAA 4JI6J 1RAGB 3ENAA 2W1BA 3R1HA 1YRXA 2CPZA 3FMBA 2UV8G 3NXZA 4I1TA 4OX6A 4O3NA 2J6SA 4C9DA 1TTHB 1B0VA 3K58A 4DUYJ 1XMOF 2ZJRQ 2E9TA 2WAQD 3IXQA 2J9CA 2MQPA 1HA1A 1UZHA 2XWYA 4QIGA 1QUPA 1KC8T 2LXFA 5HROB 1VQOS 4CYUB 2ASLA 3IA0A 4MK9A 1S1VA 4DLEA 4DV6J 1YBTA 1VC0A 1N56A 1TZ0A 1RISA 3AXMA 3BO2A 4U7CA 4HR2A 1F3FA 3MXHP 3OPKA 4DF4A 2KM8C 4OJ1A 3TP2A 2AX0A 4DZ6A 1UJ6A 1S10A 4JI2J 3OUYA 4RNNA 1VQNS 1KVJA 1RB0A 7AT1B 2Z58B 4KFBA 2WSFC 1EETA 1XR5A 2GJFA 4U8VA 1RWXB 3A8KA 4HVZA 3VTIA 2CPEA 3MM8A 3NKYA 5BR8J 5D15A 1N6QB 1FRKA 4BBYA 4YHHF 2C3MA 5L1JA 2XCPA 1O5JA 2RQCA 2DNPA 1C2PA 1T95A 1CJUA 4NLQA 5K8MA 4LFCF 3SQOP 1CBKA 2DK2A 3BQ1A 1VC6A 4O3OA 4OV1A 2Y1IA 4EI2A 2FY1A 3SCIE 1GMUA 3KG1A 4W4MA 4NXMF 1MG7A 3H5UA 2FHJA 2YNFA 2DYAA 1OQ6A 3G6YA 2YWEA 3MMBB 4K5RA 4OQJA 1AUSL 3BGFA 1ZA1B 4LF6F 4ECZA 3PX0A 3MEKA 4YB6A 4UZCA 2AW0A 4EU0A 5DLGA 3POTB 3KLVA 4DHVA 3SCJE 1PO6A 2FJXA 3HHLB 4EMDA 4X4UA 3K8WA 4A8YA 2YX7A 4Q0BB 1AB8A 2AJQA 1MWQA 1IWAA 2YKNB 4G1QA 2XLIA 2SXLA 2OLWA 2YH1A 1VMBA 2DHHA 2JWNA 4PWWA 2AGPA 4LF4J 1JLCB 4USMA 1ZOTA 2QA4G 1NUEA 3D1HA 4W98A 3KLEB 1MW7A 1KBRA 2R3VA 2YKNA 4EYHB 3DGPA 2ROPA 3ILIA 2RF2B 2GVZB 4P2MA 3W65A 5HVGA 1NCLA 3KK1A 2CQGA 1QAJA 1IR2A 3KK2B 2KI2A 2X1BA 4JI3F 5GAEU 2MY7A 1XNRJ 4DR7J 3MUMP 1WSVA 1R7IA 1TL3A 2GX8A 3GU0A 2OPSB 3QAUA 4L75A 5D0GA 2YKMA 1ZAWA 5FDLB 2MLYA 5FIIA 5A0YB 5B0BA 5C5JA 1RBAA 2R2RA 4W90B 3TZZA 4DSLA 3M32B 3NL0A 1Q95G 1U09A 2MJNA 3SQGB 4NXNF 1KN6A 1YJTA 2V8HA 3NY0A 3RU0A 2MZTA 3V2UC 1CC7A 1UJ4A 1SIZA 1MROB 4DQSA 2LP4A 2AZ1A 2QLBB 1BWEA 4ECQA 1RT7A 1HNWF 1T0TV 4UW2A 1HD1A 1RWUA 8ATCB 5EX3A 2CAJA 3UN5A 2NS1B 1LW2B 2CNNB 4FP9A 2B3TB 5KFHA 2AQ4A 2IC3A 1RABB 5I42B 1GX5A 2OSRA 4FXDA 1EKSA 1LWCB 3PEHA 1JKHA 4EO6A 4HDGA 2ASJA 2CUYA 1S59A 4QPTA 3B54A 3OTCA 2L9NA 3H5SA 1NMEB 3QLHA 4RU9A 1LQ9A 2QLXA 3OR1B 4L3NA 3CCJS 2FVPA 1GTEA 2E29A 2VFSA 3W9IA 3I5AA 4M5MA 4AQYJ 1ZH5A 4RW9B 3BQ2A 4DPXA 1YG0A 1A7GE 2BVZA 3M32A 1XMBA 2BJ8A 4J7CA 4TYBA 2KH9A 2HAIA 4ECUA 2KRBA 3G8SA 2NZ4A 4DX6A 2G0IA 3MCMA 1HWUA 4XIUA 4U8YA 4LRDA 4ZPTR 2PMHA 2R9LA 3GIRA 2N7YA 2HK2A 4ES3A 2M7SA 1N34J 4B9SA 1F6TA 3ZZRA 4B9UA 1XEZA 1UFLA 5J2MB 4LSZB 3MM5A 1R6VA 2C2RA 1U4BA 3W5YA 2E7WA 4DQPA 3BKFA 2GAHC 1KHVA 4JI7F 3MPDA 4DQRA 1UVIA 2LXIA 4G6VB 5F0WA 2IJNA 2NYHA 5KFQA 3PR4A 1YJWS 1D8YA 3EVOA 2DKOB 4M5JA 2E9ZA 3X1LB 1WEZA 4H4MA 2NPFA 1RWOB 4J9NA 1Q4RA 1IXKA 1TMMA 1LFWA 3NGSA 4IDKB 3IG1B 2XC9A 3MEGB 1QJHA 4NASA 1TUGB 4WF9Q 4NLUA 2QL9B 4HTIA 1IR1A 4TLRA 2VC1A 1WOOA 1YBUA 2XI2A 4QJVA 5A8RA 4X4QA 4ELUA 1LNQA 1MMDA 3AFGA 5IZHA 1N33J 2IY5B 1FWPA 1U49A 2EFQA 4C8ZA 1YDLA 2AP6A 2BYCA 3AA8A 2DR5A 4PR6A 4P75A 2G2OA 5KFWA 4ANCA 1HPZA 4RW4B 1MWYA 1LXJA 2FTRA 3F73A 2J8AA 3VHQA 2NQPA 5KT4A 1SIWB 4DUZJ 2ZJQQ 4LF1A 1U26A 3BSCA 5G4DA 4IQXA 2X3DA 4YP3A 1KR4A 2QGFB 4PG7A 5HI7A 3TVZA 2YPYA 2KZMA 2OH2A 2C22A 1S48A 2M88A 4I6YA 2QA4S 1VIXA 2G1DA 3BYRA 4YR2A 3DRRB 5AJ3J 3H5XA 1GEHA 4DR5F 3HDSA 1Q8BA 1DTTB 4HACA 1TR0A 4OZJA 3N0VA 5L39A 4DI6A 3EZ5A 4LF5F 1U8SA 1ITPA 2UXBJ 4DV0F 2MQNA 5F8MA 4JI4J 5B7WA 3RB6A 3J80Y 2HZCA 2LVWA 1EJ7L 1RK8A 4ZVFA 1QAYA 1BHNA 4J9OA 2WONB 3ZFVA 5HAOA 3CD6S 1SQFA 2CZVC 5DQHA 4CYUA 4X4PA 2AYGA 4K0KF 4C0OC 4QQBA 1JNZB 2A18A 2B51A 3R6LB 5GMDA 2GQCA 1TK8A 1FD2A 1R8CA 3IM8A 2BW2A 4N8NA 2CPXA 3ZZZA 1UKUA 1FNMA 2XULA 3O5TB 3EGWB 2IM3A 4K59A 4DS4A 1TKXB 1W26A 3GYXB 4CTAB 2JHEA 2MZRA 3P45B 1EX8A 4G1PA 2HQDA 1NLKL 4LSNB 1VQMS 1FVQA 1I1GA 1NDPA 5GVQA 3QSYB 2CVEA 2DPIA 2DNMA 2BOPA 3QFWA 4B9LA 1LWFA 2FHMA 1FKAF 3MURP 4WFNQ 3ZO7A 1VDHA 2ZD1A 3PACA 3SCLE 2NXNA 1FK9B 3V81B 2CQ0A 2XMVA 4ZVQB 3MUVP 5ETVA 1M5KC 4HL9A 2KN4A 3H8YA 5B09A 1Q86T 1CC8A 2Q3PA 4OYAA 2H51B 5I42A 1KDNA 2DNNA 4CIOA 2VFUA 1S0VA 1Q16B 1RAOA 2WVBA 4DQIA 1IBKJ 1U6FA 1AFIA 1EIYB 2N7CA 3KKFA 1UWBA 1V3ZA 1P6TA 1P27B 3M30A 4F4ZA 1M90T 4M5DA 3GONA 1X4EA 4ITSA 2Y9HA 1ZPWX 2R8IA 2GAGC 2YKQA 1U24A 4GVBA 3L3CA 3CWJA 4H4KA 1U1PA 4Q5VA 1OYEA 2XMUA 1X4DA 3CULA 1SQGA 5GMEA 4LFBJ 3OVSA 2VUGA 1GQEA 1ZTWA 3GIKA 1VQ8S 4C3LA 1N5QA 3GFYA 4O44A 2CIMA 3UD4P 4CCHA 3TAMA 3K17A 5IXUA 4DEZA 3KK1B 3TANA 1FJGJ 2R7QA 2D9PA 1S9EA 4FYYB 1YZ7A 2PGCA 2ACMA 1F5BA 4PEOA 1U0HA 1PJ5A 3I6PA 3E51A 4M5NA 1XERA 2ZE2B 4NX9A 4Y2IA 5ETNA 4J9SA 1U1NA 3L9ZA 2HYIB 3KHLA 3R5AA 1M5OC 5A8KA 1T03B 5CCMA 1ZM9A 1TAQA 2BANA 2VFVA 4S0MA 5L38A 2E5LF 3TQ1A 3BGRB 3HHLA 5D0RA 3RZAA 3QATA 4YFUA 2RVJA 4NPOA 1WACA 4Y2KA 2DR6A 4HDHA 4LF8F 3FQKA 1O51A 5E3QA 4QWDA 2LDYA 4FBUA 1S1UB 1Y11A 2RUSA 3PJWA 3ISZA 4ZVTB 1K1SA 5LOQA 4YY3J 5KG2A 1DJ0A 4ECWA 2HHUA 3KLFB 1HR0F 2Z8QA 3PY8A 3VALA 2UVVA 1RCXB 4JI0F 2BZ2A 5C2GA 3KLGB 3LWMA 4ZLLA 1HBOB 1X31C 4TY8B 1S6PB 2E5JA 3KG4A 2UVUA 3CGIA 1VFJA 4C48A 2HLTA 2KXHA 3SIPB 2DY1A 2RS8A 4OX9J 3MD1A 2R42A 2F40A 4URSA 2R7TA 3M8WA 1FKPB 4LUBA 1VQLS 1OPZA 3PG9A 3M8PA 1LFPA 3OL6A 4X64F 2V2KA 5ETTA 1J5EF 5LXYA 2IVMA 3OXLA 1IBLF 2V63A 1RT3B 4KO0A 3WX4A 3VCDA 3MPUB 5IC6B 2VHGA 3M2UA 2W2PP 1MLAA 4MMOA 5KFXA 4GMKA 4LSNA 4PZVA 4I69A 4PG5A 4RW9A 5KT3A 3BO3A 3ENQA 4I2PB 1CS4A 3GSDA 4IOBA 2LXUA 3ZNJ1 1JLEB 1TU0B 3UDLA 3WX8A 1NU4A 3EICA 2XS7A 2CNLB 1XN9A 4BC7A 3G96A 4OYZA 3MM9A 2CG8A 1URRA 2F4FA 3PYGA 4DSKA 2Z57B 4CP5A 1L3UA 1M5VC 1RXOB 3LP2A 1ZBTA 1AZSB 1R8BA 1RE1B 1S1TB 2RRNA 5D4PA 4G65A 2X1AA 1N88A 5CA5A 2IJRA 1R0AA 1YJ7A 2NXJA 2BM0A 2HG4A 2WONA 2GZOA 3BKUA 4Y00A 1KQSR 2AHOB 4A46A 2KT2A 3ET6A 1IBCB 1GMWD 3JB9k 1ZA2B 3CCMS 1ZTTA 2X1FA 1U6BA 5B0GA 2P9EA 2DGXA 3NG8A 4J9PA 4IOCQ 2DR7A 5AE2A 5F3ZA 3CNQP 5ETKA 2VQEJ 1SQEA 1PJ7A 2XO7A 4ED1A 3QRPA 1S1UA 1H2VZ 2FQQB 2FJAB 1XNQJ 1Q1KA 2DGSA 4Y65A 2ZH5A 2M4MA 1FJCA 4M5IA 4QYZJ 3NBPB 2UZAA 4NCGB 2FJBB 1BXNA 3JSMA 3JQJA 2Z4PA 2XLJA 4C8LA 4USTA 2HHVA 3Q22A 1TK5A 2VG5B 3I0SB 1SJQA 3RBXA 1HKAA 1UPPA 5B0FA 4B3SF 2D9OA 2XNQA 5J2PA 2RQKA 4MJKA 3EPIA 1XC9A 2AYBA 4IRCA 1Y9OA 1S1XA 4MKVA 3OTOF 3R27A 1PBAA 3OTBA 4WE1A 4WK1A 4NRUA 1WI6A 4NCAA 1U6ZA 3FZ2A 4RBTA 2RE1A 1TMJA 3W8GA 1UMJA 3FCWA 3KLIB 4M1KA 4ECVA 1C1CA 1VBXA 3LW5C 5L1LA 3L4BC 3RBEA 4UOFA 2R7OA 3P6YC 2UUAJ 2MY8A 3MMBA 4WFAQ 2LDIA 3H2VE 4HACB 5KFPA 2EWHA 4EEYA 4JYAJ 2ZJPQ 1C1CB 3JS9A 2R7RA 2OD4A 3TZXA 3W2VB 4MK8A 3D66A 4NLSA 2W9CB 5GAEI 5A2QU 4EYIB 3QGGA 4RBVA 5F9NA 1Y0HA 4NEZA 2ZHAA 3T5JA 4CM2A 3VGVA 2ZH3A 2JC1A 1GXTA 2HFSA 1VHFA 3CIZA 1TKZB 1C0UB 1GXLA 2IAJA 1UETA 2K1RA 2YPZA 2I9SA 3GILA 2OTJS 2N4DA 3I4PA 1WTFA 2O5DA 2ZBQA 1YITS 2QLWA 1NEEA 2XZWA 4YMEA 4FPRA 4B3TJ 3M6UA 3DOLB 2NXCA 1R8AA 3CMQA 3GIMA 1HNZJ 1IN0A 4RKUC 4ZDNA 2JEJA 4A8KA 4LF9F 1LWFB 3LPYA 3KMQA 2F8EX 2OPQB 5KFRA 2B5JA 1A0OB 3R8YA 5LSRA 2DXEA 3EE3A 2FHJD 3EM1A 1FDAA 3MZIA 3P96A 5E33A 1AROP 4DUTA 4KGVB 1N4LA 2VC0A 2E7XA 1Y5LB 5F8NA 1KHWA 1TK0A 2H1YA 2NCKL 2NREA 4PUOB 2VBYA 3UD3P 1Y10A 1NBEB 1HWLA 3R7BB 2VL1A 3WIUA 5HP1B 2ALZA 2IMOA 2R8JA 3KOAA 3HD1A 4CO3A 1A6LA 3W61A 3D3BJ 5KFCA 2J8SA 3LP2B 1LWCA 2IYGA 4ZP7A 1S0NA 4OZNA 1LEOA 2DHAA 3MM7B 4CLYA 2UUBJ 5EWGA 2X51A 3M9OB 1RI7A 1H0HB 5BYSA 1F1BB 1U25A 1G1XA 1NSAA 1S57A 1FX4A 1U2RA 1BY9A 3RJMB 1VRTA 2E7VA 1U0SA 2MLZA 4C6AA 2WVEA 2NUHA 3Q0AA 2BQ3A 4JV1A 3IFEA 3MI7X 3UNYA 2GHVC 1QUVA 4DR1F 2Y1LB 3CO0P 3DYAA 3A3NB 5KFGA 1FRXA 2VJVA 3JSRA 3P8BB 3IRXB 2U1AA 5CYQA 5IOLA 4CLUA 2HWIA 4OFZA 1N5TA 5J1NA 3DM2A 3SFUA 1TKDA 2BABA 1Q7LB 2IA0A 4DPUA 1I6JA 2X3GA 1C4CA 3QIPB 4M5HA 4A8FA 4N8OA 3VAKA 5LMUJ 1VLOA 2P8IA 1N33F 5D4OA 2GS8A 4CH0S 1HBNB 4UT4A 4O4GA 3A13A 5AXKA 1R8PA 4WKRA 1I51B 5L8RC 2JRSA 2MKSA 1WC6A 4ENOA 1RKJA 3W3SA 3RR7A 2Z30B 1GFWB 3LAMA 1WDTA 4O44B 3S6EA 3HHKA 3PW5A 1DY3A 1RAEB 1NSPA 3UWTA 4ETXA 2YXLA 4MIAA 1CJKB 2KRRA 1EKRA 1UCNA 3D7SB 2QL7B 1N5SA 1X60A 4IFVA 1H2TZ 4DWIA 2UU9F 4LIRA 4ZLNA 2R2SA 4DL0C 3CMAS 4K4TA 4XDDA 1N36J 3ZZUA 1ZZNA 3JQKA 4FNHA 4H4OA 3H25A 3BPDA 3BGRA 4NZ0A 3SEOA 2G0JA 5KT7A 4N76A 3LP1B 2RKIA 3AJDA 1NJWA 2CJKA 1Q5VA 2ASYA 4YS2A 3KDOA 5JXSA 3B8HA 4UTGA 3OHAA 2FZKB 3JQMA 3EXYA 3DKDA 2B4VA 3T6BA 5E41A 4OHYA 2V8PA 4KT0C 3MM6A 2IM1A 4AL5A 4NCGA 3BM7A 3ULHA 4CNYA 3UDVA 1JX4A 4WFXA 2XCAA 2VG7B 3FRYA 5F8GA 4MK7A 2GIFA 4X66J 2W7OA 1RAFB 2WW4A 2BV3A 3UDEA 4IDKA 3QSIA 4OX7A 1WG1A 3H20A 4UOHA 2CQPA 2WZ1A 2BUNA 3UFCX 4ZKAA 5HO4A 3MTJA 2I5JB 1DZ5A 5F8IA 2MHEA 4USVA 3P4UB 2QYCA 4NE9C 2KXFA 2K3IA 4OJ3A 4JV0A 2NYIA 2A6MA 4O3QA 4NOHA 3QZ7A 4JI0J 3CJ4A 2OEKA 4ZPWR 2ZNZA 4K4XA 4KTQA 4LREA 4X65F 1RAJA 3BR8A 1RJJA 3DLEB 3W62A 3TVKA 3LP0B 1NNDA 4DL6A 4DX5A 3VZHA 4ZHRA 3NAIA 3FBEA 5AXMA 3THPA 2EG1A 4DN9A 4TQSA 3NLCA 4LF7F 5MAOA 4K4SA 3NCPA 4IR1A 3CJQA 3DXBA 5THWA 3DRSA 3AJ1A 4WK3A 1TL3B 2CYYA 1Y3KA 1FEHA 2GO8A 2V2QA 3QAEA 5T41A 1VBKA 2MYFA 1RWPB 2OSQA 3AB2B 2K06A 5HSPA 3DGPB 3KJVA 3CUNA 3MECA 4CDIA 3KWMA 4LR7A 1S1WB 2ROEA 4PABA 1JKHB 1U1OA 2ZBIA 1MN7A 1T9WA 2O1PA 2E5LJ 4C2MA 2ZDOA 5IT9Y 3AD9C 4ZJQA 1YI2S 1ICEB 2DNOA 2KFZA 4GO5X 2XHCA 4IFYB 1BMQB 3FCHA 4ICLA 4C0HA 4R5PB 1RBLA 3D4JA 3W2VA 2ZHOA 2W9BB 3SV3A 2YY3A 3QGIA 3CC4S 2JEIA 5A8RB 1NHUA 4QWBA 4TU8A 1IKVA 1WOSA 1IQTA 1U8WA 2YQ1A 1CPZA 4OIXA 3W5XA 2MHNA 2ZH6A 5A6PA 4E0DA 2D3O1 2HVEA 3DLJA 4MTPA 4CLWA 4CT9A 5CD4A 1UEVA 4PXDA 3MR6A 3KK2A 4PKDB 2EBEA 4KE5A 1I94J 1Z4UA 5DGBA 1K47A 4J37A 3ILOA 3KYLA 1Q81T 2MDAA 3AHPA 2M3DA 1KD1T 3D54A 1KTVA 3HSJA 1H6KX 1RTIB 3EZOA 1JLAA 1RHRB 2CQBA 3NGTA 4PPZA 1CG2A 1RWKB 1VQPS 4IUFA 3U1NA 3S7RA 3CJTA 3M2RA 1WI8A 4ED7A 2KFNA 1FTCA 3OBIA 2VG6A 5T14A 4ECRA 1TFYA 2CRLA 4ZVOB 2VF3A 1OY6A 1Q8LA 1LKZA 3M8QA 1NKEA 1DARA 2EKNA 4ZLPA 3HULA 3JSBA 5HL7Q 3CD5A 1OPIA 2PFFB 2Y1RI 3ADAC 1SKUB 6AT1B 2FHKA 3TOQA 2J9DA 4QW8A 4ZN1A 3UCZP 2HQIA 2VA3A 1HNVA 3PHTA 1FFGB 4Q7AA 2VQFF 2DVIA 1WUUA 2XY7A 1FFSB 2F63A 3O3LA 4Q8EA 1JLFB 3X3UA 4OHVA 5C25A 2EG2A 4A48A 4DR5J 4CLSA 4UOGA 3V81A 1J5OA 3NNCA 3QT5A 4DU7A 3TX8A 2DR9A 3N5FA 4F02A 2XGQA 4Z7YA 2VPWB 3DM2B 1NB7A 2FJDB 4KQZA 2WBMA 3PR5B 4K7QA 3O44A 3TA2A 2JLGA 3GIIA 2ZUGA 1M1KT 3AD7C 1S99A 1EQ0A 5DG7A 3CJRA 4RR5A 2B0GA 2CPDA 3GP9A 4JI6F 3SFGA 2G13A 3AY0A 3DDNA 4ERDA 1JNRB 2B5JB 4I7FA 2DT9A 3TX0A 4X62F 5E7OB 2XYPB 2E1RA 1B4SA 3SSSA 2E44A 1FXRA 2F65A 2GQ2A 2LFVA 3HD2A 3IC1A 2VPZB 1F5CA 4X4RA 3UR3C 1N32F 2UXBF 1DQ9A 1GAOA 2CQCA 2C2ZB 1VHIA 4U9RA 3C16B 3MM7A 1GXUA 4ZA1A 3V5RA 4K4YA 1Q0NA 2CQIA 4CO0A 1FWKA 2QZ8A 3BEGB 4JP8A 4WTOB 2EW9A 3T5HA 5HJYA 1KS2A 3KUHA 3TEHB 3OJSA 4PYDA 2HGNA 4DSJA 2FB0A 4QIEA 1RT7B 5GAGI 4EBEA 2GMLA 2Z2MA 4GKKJ 4NLWA 5GADI 2V94A 4TY8A 4PG4A 1O6XA 3RAXA 4I56A 2YTCA 4FKXA 2WVFA 2NLWA 3TVYA 4A8XA 5HMXA 1TAUA 1VYAA 3DOMB 2DH7A 1QVGR 2MKCA 1UL3A 5E3CA 2UUBF 1JWWA 2CJ9A 2WW8A 2R7XA 3IP0A 3C15A 2VZ9A 3CCQS 2YNGA 4QPXA 3UNGC 3FZBA 4DG1A 3H2LA 5BR8F 2FVQA 3MM6B 2GVZA 3ISNC 2MZJA 3TEGA 4ZLJA 1IBMJ 5KG5A 4WYWA 5K8PA 3WBZA 1X5TA 4FZVA 4Y2AA 1OY9A 3KJNB 4CO4A 4CT8A 5H1SV 4CM0A 3IRWP 4Y2CA 4HHJA 1XQIA 3B4DA 3GFZA 1FVSA 4GVLA 4A8SA 4RW7A 4P10A 1S77D 1BC6A 4WP8A 3W60A 2Q6BA 1IM6A 5KFSA 3US5A 4P52A 2AJFE 2DXFA 2W9CA 4IOAQ 1R6YA 4EO8A 5ADZA 4DR7F 5HLFA 2X1GA 2GO9A 1E6VA 2ZH2A 1HNXF 2D41A 4NYOA 1U02A 5KFUA 2Q79A 5DDPC 1SKWA 4C0BA 2UUCF 1SJ4P 5DZ7A 2ZKUA 2DTJA 1FE0A 3GSIA 4MIWA 5EX0A 3K2YA 1SJ3P 1O8BA 4IFYA 4ZPDA 2GVDB 4P6QA 3PIPQ 1DAXA 1HI1A 2VONA 2KG0A 1RP5A 4ZK7M 3GYGA 4TVAB 2G0CA 2ZZNA 3W63A 3OXGA 4B3MF 4EZ9A 1J2VA 2XLKA 1HIYA 5DQGA 1S6QB 4IH5A 4NXNJ 4ANDA 4HKQA 4WWSA 2VG5A 3I0SA 1XMQJ 2WTFA 2YKPA 1IVZA 2HGLA 3HSGA 4M8LA 2ZD1B 3MD3A 3G2XA 2DRBA 1TUVA 1D9DA 3VZIA 1VK3A 1ZZFA 4UUWA 3SSRA 3IRXA 5CYQB 3K5OA 1B0PA 5DS7A 2IA6A 2IJFA 1RT6B 1V5IB 4J9UE 3J81Y 1Y5NB 3H0PA 2DB1A 2HHQA 3NS6A 3QQCD 3KLHB 2W01A 4RX6A 2VG7A 5LL6d 3VAFA 3CO9A 1P1LA 3ET6B 3M7VA 1G6BA 8AT1B 3PO4A 2MQOA 1YJNS 4USWA 1YRUA 4RL1A 4O3PA 3C6UA 1JJHA 1TL4A 3FBBA 4ECSA 2JH3A 4K4VA 3THTA 1D09B 4PQAA 3SMZA 2PMWA 5KFBA 2N4CA 4NLRA 2ZFHA 4TNOA 5AXNA 1RTJA 3PNIA 2OMOA 4RLEA 1CULB 4PG8A 3T5LA 2A1BA 2HWHA 2DHGA 2D3ZA 2HZAA 9RUBA 4WCEQ 5D0EA 2C3UA 3LGMA 4J9QA 2NXEA 2CJBA 2W4PA 3BBCA 3L7PA 3E2EA 3QYYA 2QMXA 3FFIA 1DQ8A 2CJXB 2HWTA 3DN9A 2MSSA 1IKWA 1UFWA 3NWGA 3V6HA 4P9SA 2AJ0A 1TVRB 3CE8A 4QWCA 1N32J 2QRRA 4ZVSB 1NH7A 2F9JA 3GYNA 3IGNA 3NS7B 4O4RA 1YGYA 4OZ5A 4DFJA 4N5SA 2RH3A 4ED8A 2JSXA 1U48A 1LK5A 4USHA 2VIHA 3RBDA 3Q8SB 2ZC3A 3P49B 3A8IA 3R97A 3OL8A 1JMTA 2Y0SD 4KIAA 1K1QA 5H9FK 3FRZA 1UA0A 2DJWA 3KDNA 2EPIA 3DDKA 1OO0B 3LPEA 5LM7E 1HNXJ 4J5OA 3CCVS 3D0IE 1AW0A 1YJ9S 3D3CJ 4WKYA 2XSFA 3N01A 3MR5A 5FLXY 4QZVB 3K57A 3HI9A 1RHMB 1WHYA 2WSCC 4Q2MA 3M8RA 4MKYA 2GHPA 4F0MA 1NSKL 4JV2A 1MNEA 3F41A 4L74A 1NK4A 4WFBQ 2K3KA 2V68A 4TLQA 5HBMB 5H9EJ 5HN0A 2DGUA 2KO1A 2DRAA 1IUJA 5ETMA 5KFAA 4CLPA 3P3DA 1P9YA 2BKOA 3HF5A 4ZN3A 4J9RA 1TV6A 2UUCJ 2NZCA 1DLOB 3TW0A 1X8DA 3R2DJ 2AEJA 4TU9A 1HBUA 4FS2A 2PI5A 2ZM6F 2QLFB 4ZS6A 1QSYA 2I2YA 1NAQA 4V1Ak 1KQFB 2MSTA 4OYXA 5HP1A 3PKMA 2XQCA 2DXDA 3W5ZA 3QRRA 2VU5A 1LXNA 1EETB 1RWMB 3C6TA 2R2TA 5LXRA 4QCLA 2J7KA 3I82A 3TA0A 4EBCA 1RT4A 4JI3J 1H72C 3E3XA 2HHWA 3C8YA 1HARA 1T9VA 3MR3A 2H4WB 1RT4B 4CLZA 4KO0B 2EI5A 2FPHX 2V8VA 1TKXA 4M95A 3ITHB 1VQSA 3TJ8A 2PI4A 1RT1A 1QM9A 2GJIA 4RNMA 3CT9A 1N48A 1HLWA 3G71S 1R8HA 4A8WA 1F9FA 3NRBA 2V6AA 3LF0A 1KFSA 1C1BB 1TKTA 2W8LA 2C2MB 2ASDA 3QMQA 4JI5J 1UFKA 1KNZA 2V8DA 1HNVB 1TFWA 3C6UB 3TR5A 3S1TA 4M5GA 4F36A 4DV4J 4TYAA 3KHRA 1WC3A 4C8OA 1ZM4A 2ATCB 2FLOA 2GVDA 2LLZA 4NLVA 4DBQA 5KFNA 3WZ0A 1HL6A 4AXIA 4AYBD 1EP4A 1PSDA 1F9HA 4L72B 1V5VA 1SI9A 4NMXA 4DFKA 4L73A 2E66A 3EVWA 2LQ9A 5HATA 2OPQA 4WU2A 5EHHA 1ZM3A 4KHPJ 1OMSA 4YUDA 1UVLA 1M0SA 3HT3A 4X62J 2DEJA 3A12A 3BH7B 3EXCX 4ZIWA 5JMNA 2APOA 1SKSA 4KSEB 1L3SA 4YR0A 4B9TA 2XS5A 2YX1A 5J2QB 2QX0A 3BPSP 1JLCA 4UQTA 2MGZB 2MKYA 3D6FB 1X0PA 1HQEB 3HVAA 2VJUA 1FO1A 1TV6B 1NK0A 3NNAA 4ED0A 3SBMA 3DLGA 5L46A 5KFEA 1JIHA 2OAUA 4KC5A 4N77A 3VAMA 5DDQC 4P7VA 4YDDB 3NOCA 1HBOA 2QL5B 4M5KA 3POTA 4FS1A 1R31A 4CLFA 4PQUB 1FWLA 2C1EB 4DV6F 3RR8A 2Z56B 4K2JA 1X4CA 5J1PA 4J9MA 3PW2A 1EHWA 5A8WB 4V19X 3IWXA 4IFVB 2YNFB 2CA9A 4C8NA 5J2NB 4ILLA 4YB5A 4NI2A 3FEZA 1VS3A 1LV5A 4DUYF 4ZOSA 2IIHA 2ZUAA 3D68A 1RKIA 3QJLA 4WZQA 3DOKB 3RB4A 1XMQF 1NJYA 3M6WA 3QWPA 3AOCA 2GMJA 5CD4H 2WK4A 2BM1A 4QIVA 3MPWA 3KNAA 4HHHA 3ZZOA 1KKHA 1HBNA 1RDRA 1XWLA 3KK3A 1FERA 3OLBA 3HZGA 3MECB 3OR2B 3CPWR 2HHHJ 2H4YB 3CB4A 3IO1A 5GADU 1QVFR 4DV3J 2XNRA 4X4NA 2CKWA 3NBPA 2E5HA 1FF2A 4M5LA 4DV3F 1NPKA 2VBWA 5I4MA 4GRSA 1HWIA 2V4RA 4OZ1A 4ID5A 2LKZA 5DLFA 1UA1A 4FVCA 3Q23A 1APSA 3HLUA 4GVBB 2BQUA 2O01C 1Q8KA 4D3HA 1U47A 3BDPA 2H48B 3BN4A 2O66A 1O0PA 3F0NA 3MPYA 1WTBA 1OWXA 3JAMU 3HPOA 2CPHA 3SYZA 2UUWA 2XSJA 4C11B 2OKQA 4E98A 5SZTA 1URNA 1W2IA 3ZXWA 2XMAA 1WC1A 3G86A 3H90A 3NAHA 4USIA 2ZH9A 4WYLA 4IRDA 3KUGA 1C1BA 1SC6A 1TKTB 3IBFB 3PM9A 2HS0A 1U2CA 3D0GE 4Z37A 2DNHA 3CCSS 2OD6A 1S4FA 1VJWA 1FDDA 2P9GA 2HHXA 5CQGA 4DV2F 3RTVA 1UJ5A 5DG8A 2VB6A 2W7PA 4DV7J 2DGQA 3QIDA 1HD0A 1YQHA 5DETA 3O6QA 4OI2A 2F5GA 3J7AN 3ENVA 1R3NA 1UW9A 3LO3A 5HANA 2CFXA 3KLHA 1D0EA 2IRYA 2J6UA 1OIAA 1WHXA 2CDQA 4U96A 1D1UA 5IQ6A 3VAIA 2Y1JA 5A76A 1DTTA 5M2UA 4F2SA 1S0OA 1J27A 1HQUA 3EDQB 3TAPA 2B6AA 2MEWA 4NLTA 4N56A 1VQKS 2DNLA 1SCJB 2V5HG 4XPEA 3I96A 3JTPA 2KFYA 2PD1A 1CQNA 3VAJA 1KEKA 1FDBA 3B6BA 1ZPVA 3IS9A 1Q79A 1V6HA 3HJVA 2FY8A 1TL1B 3AXKA 3GLJA 3EWGA 2LCWA 4LRAA 4N7TA 3ZZPA 4D3GA 2OFGX 2F8HA 3CD7A 3BBFA 2CJYB 3T1HF 4AXJA 2B4OA 4ECXA 4ES1A 4URQU 1RUSA 4KHRA 2KHCA 3FQLA 4OZ2A 4PXEA 3FC9A 4QWAA 2CXEA 1I5OB 5HK4A 4X65J 4B3RJ 2DO0A 4QR1A 2UVRA 4DL2A 1TVRA 2AJ1A 4OYOA 2CQDA 3G6ES 2VH7A 3F56A 3D67A 3T5KA 3MAHA 1IKVB 5ETSA 4RW8B 1W7WA 2XG8A 3ZC4A 3OV7A 4KRWA 4QR2A 1CSJA 3BF4A 4K8RA 1HNIA 3D2WA 4LSLB 2EFGA 4KV8A 3GTYX 2ATLA 1Q82T 5FLXU 4ZP6A 1OQ3A 4DQQA 4ELTA 4A4JA 4DR4F 2ZBPA 3G87A 3LGHA 4I4BA 1S1XB 1UVNA 4RJVA 3AA9A 4EGLA 2W8KA 3Q83A 3PVXA 3CXCR 2Q1LA 4LF9J 3KJQB 3MGJA 3MPVA 5J2QA 4ED3A 3C16A 1HMVA 4G1QB 3H4BA 1U45A 2HW3A 1EZZB 2HEKA 4MIBA 4LVOP 3PCOB 4C8KA 1VK8A 3FJ2A 2WBRA 1IJEB 2B43A 2LU1A 3DNCA 3PJ9A 1T3OA 4ZVPB 1FJ7A 1CJVA 1X5SA 4DN0A 4LR8A 2CG4A 1XBWA 1NRKA 2W4DA 4M63A 3DFEA 3I0RA 4HT5A 5MLCV 1SKRA 3GMGA 2XS2A 1YBAA 3BH6B 2HNZB 1IWGA 2YNIA 1JLFA 4OYIA 4DJBA 2W4CA 1DQAA 4QIFA 3WDOA 1F5AA 2ZM6J 3V4IA 1RYSA 2HNYB 1NO8A 2FLPA 3CDUA 2YNIB 2W24A 2BQRA 2UVWA 4K4UA 2DD8S 2IFXA 2MKHA 4IG0A 1GX6A 3VVUA 2W25A 2CDRB 3MMCB 5K14B 2BR0A 5KFJA 4KFBB 3PXGa 4F4WA 4RNHA 3KXDA 5GMKa 1NK7A 3HHLC 1SC3B 1S4EA 2BJ9A 2XZTB 1R0BG 3H98A 3U1MA 4J9KA 2EK6A 2ADBA 2M70A 3C46A 3SZ2A 2HS3A 4F8RA 3PJXA 3FEXB 2HRYA 1SC1B 1X5PA 2P5VA 4DMZA 1WG5A 3M8QB 3CF5Q 2FC8A 4F0KA 4P2FA 1N8RT 2Q66A 1S7IA 5L9NA 5M2PA 5K20B 1F2GA 1FFWB 1GT8A 3DOLA 3I5BA 5HQLA 3G8TA 2W2OP 5F8JA 1Y00A 5CAAA 2F1FA 2Q43A 1B7YB 3CCES 4ECYA 1H73A 4QU7A 3CJ0A 4IO9Q 2ZVSA 1SVDA 4P2SA 3OQ2A 2YVSA 2PMZD 3BN7A 2PA8D 4LQ9A 1T11A 4BHQA 1C0TA 2RB7A 3VR1A 4DR3J 3ICLA 4FF1A 2PE8A 1S6PA 1VOMA 2YWHA 3FVYA 1L3VA 4U95A 4C4WA 4HLBA 3ZTOA 1FRIA 3Q89A 1PG5B 3DRPB 5K9FA 1HWJA 4UY8T 3GG1A 2VBXA 4LMZA 3ETOA 2HK3A 5KT6A 1EAYC 2ZDPA 2NUUG 2QSWA 5FDLA 4CO5A 1KQGB 2YNHB 2KYZA 1G2EA 1FNOA 2H3EB 2A2DA 3T19A 3TZWA 4ATNA 2HFNA 4DSIA 2RU3A 1VISA 1E6YB 4OHXA 2QIFA 2AYEA 2GGPB 2PC6A 4FXVA 5HVHA 4X66F 1RTIA 1Z2LA 1FKOB 2F9DA 3MF5A 5E3AA 3PEJA 3QGHA 1S1WA 1H98A 1FTRA 2VPYB 2FZGB 1IKXA 2DEIA 2DGTA 2GGPA 3DLHA 3PYFA 1HNZF 1DTQB 2HGMA 2D74B 3AJ2A 3M8YA 4WBFA 1F60B 1RHJB 2CJAA 3BS9A 3Q8UA 4PYAA 2HZVA 3IWLA 4B9NA 4ELVA 4F3OA 4PAAA 3R2CJ 2GA7A 2H5IB 4OYMA 2KXNB 1K8AT 3PV8A 3VGSA 2VA2A 1LK7A 2XMJA 5BXIA 2ILYA 4NLDA 1VBZA 1Y7PA 2V4JA 2VODA 3MEGA 3VGUA 1BQXA 3MCNA 4B02A 4CZCA 2XMWA 2AKWB 3B78A 3K7RA 5B0CA 1H3DA 5A6WA 3RRKA 4F2RA 1KQKA 2DNGA 4R0EA 2R7UA 3MMCA 2OIHA 2EXUA 2UU9J 3LP0A 3NMAA 1NK8A 1PC4A 2XMTA 3MEEB 3WIVA 4EK2A 3R7SB 5EWEA 2DGOA 4NLPA 1CVJA 3D6MB 2HNYA 2RILA 3D0HE 5HJXA 2AEFA 4BWJA 4DPYA 1MU2A 3RGIA 1D9FA 3MEEA 3KJVB 2N82B 3MM9B 3MMAB 1H7WA 3H2UB 3MEDB 4OZ3A 1HYSA 4GC6A 2F3JA 2KG1A 2UUTA 2XSJB 4MFBB 1M5PC 2H54B 3CMES 3BR9A 3CJ8A 1CS4B 2EK1A 1WORA 4BCAA 4DR2F 2KKHA 1FESA 2HIQA 2FIUA 3AB4B 3KFWX 2QJ3A 5T7LA 1RCOB 2OPRB 4RNFA 1UTAA 3GFXA 2BA9A 5HVFA 4C8MA 1W2BR 2A2CA 4K4WA 2HFOA 1UW4A 2BDPA 2B9EA 5J1EA 3J81U 3HCXA 2LECA 1X4AA 1M5HA 4I6WA 2BRKA 4R8UB 2Y8WA 1WC0A 1XNQF 2EFVA 2QA1A 3E8OA 4IYQA 5G0RB 3SCKE 4DU8A 3W2WA 2ZITA 1FE4A 3ELHA 2Z2LA 3FGVA 3KHHA 1JLQA 4OHZA 2L48A 2PA3A 1TKZA 4X4TA 2IC3B 3TYTA 1D9AA 3Q8YA 4IQMA 1MSWD 3PW4A 2CZ4A 3KHGA 2JDJA 2QV6A 3JTNA 2WB1D 4FNIA 4F3MA 1YSJA 4JB8B 1HNIB 2E5GA 3GG0A 4RW6A 2AT1B 3NGKA 5C24B 3NEKA 2KM8B 1YJUA 2OJ3A 3T9NA 4HH0A 3C19A 3T6JA 5IT4A 3SQGA 4FF3A 1MMLA 2PFDA 1E6VB 1DHMA 4ES2A 2HMIB 1NK5A 3J7A1 3DRRA 1TELA 4B3MJ 2V69A 2KHDA 4RUBA 5B0DA 4R5PA 2W9BA 5GAGU 1T05B 3TUJC 2HBQB 1NJXA 2IBKA 3M2RB 5B0AA 2RD5C 4WU3A 1FXLA 2UXCF 4WIQA 3W9JA 3RBZA 2UP1A 4O4GB 2MGZA 1KSPA 2QC3A 4DV5J 1T8EA 3MTKA 2IHR1 4FYWB 2RDJA 1FJEB 1S9EB 3IS9B 4PCQA 5DO2A 3VAGA 2LEAA 1CEZA 3Q24A 2PEHA 3MR7A 1Q78A 4H4OB 1RWVB 3A3PB 2COLA 2G2YA 3TUZC 1DFDA 2XM3A 2Z2ZA 4Y28C 2RDDA 2C2EA 2I8EA 3U27A 3R5BA 2I6WA 5LSLA 4RW6B 1R0CB 1KLMA 3WC0A 4DL5A 3VF0B 4RUCA 1NHVA 1S49A 1LOUA 1QD1A 2M52A 2OMLA 2FYXA 4DV0J 1QSLA 4JOUA 1CJUB 3CC7S 2DH9A 2QG9B 4FYDA 4DCPB 4OYPA 5JUMA 1TL5A 3CDAA 3OVAA 2VKZG 3FSXA 3LTOA 2BE2B 2ZH4A 3WHIA 1NJZA 4LF8J 3MOJB 2BOAA 2IM2A 1IKYB 4PWUA 1RT1B 3A4TA 4QYRA 3UDCA 1WNEA 4DR1J 5JJBA 4DUZF 2HIYA 2V4QA 3OLAA 4FBTA 3JXOA 3FNNA 4ZVRB 2JEGA 2RQ4A 1S5ZA 3WC2A 2V9WA 1FJGF 2DBBA 4ZVGA 3EGVA 4ED4A 2D69A 3H59A 2JVRA 3N9UC 4OLOA 4USJC 3ZZYA 1L3TA 3W66A 3TJ9A 2JX2A 5K14A 1LWEB 3QFHA 1GMWA 2HQFA 4CWBA 2IMWP 1S76D 3IR7B 2EFOA 2JLEA 3HX9A 1F9EB 4KH0B 3PIOQ 3DLLQ 3W8PA 4MH8A 4YOEA 2W7AA 1YTYA 4UF4A 2R8HA 1N0UA 1WHWA 2C3PA 3ZTQA 2F4VJ 3FKBA 1W25A 2RDIA 3PX4A 1X0FA 1X9SA 2FHOB 3QJJA 2VPXB 5HQ8A 5LMNJ 4RW8A 4HT7A 2DHSA 3FEYB 2DITA 2AZ3A 2J0WA 4RUHA 5A8WA 2EC0A 4HH1A 4IH7A 1DBDA 3AH6A 1VGYA 4MAKA 4DS5A 3FK4A 3UN3A 4KGMA 4JI8J 3RB0A 1D3WA 2VG6B 4O3RA 4K4ZA 1FCAA 3OFHA 5A0YA 4X4VA 1YJVA 5F41A 2PDAA 4Y3CA 4Y0FA 3CJKB 1FDNA 2M0GB 3DU6A 2WVDA 3KLEA 4DV1J 4B9MA 4F4XA 4P72A 3QWUA 4ZPAA 2IAJB 3RYLA 2VOOA 4F26A 5F3TA 3OHBA 2WCXA 4MKBA 3C14B 1BD6A 4P73A 3TI0A 1PAEX 3TAMB 4YQWA 5HBMA 4B3TF 1WDDA 4UQGA 1RADB 1ELOA 2D1CA 2IDEA 3K8VA 4LSLA 1LW0A 1F3VA 1UZDA 4V19J 3IAS9 1K0VA 2JNJA 2XGPA 3IR6B 4ID8A 1RWWB 1XJWB 2IYIA 3O8WA 5IS2A 5KFFA 4YR3A 3HFKA 1L5UA 4FYXB 4LF5J 2EC2A 2V9KA 2CPFA 3TZYA 2AF6A 3TARA 1EP4B 3EZUA 3M05A 5IQQA 4LQ3A 4B3SJ 2G4BA 1Y3JA 4JUZA 5DDRC 2MQQA 1HR0J 2XI3A 1FXDA 5ETRA 4K2XA 5JVHQ 5A8KB 3UVJB 4ETZA 2GNKA 2BACA 1V9OA 2HFZA 1TL7A 1G3OA 1WF1A 4KYZA 1RZMA 4F7VA 2QN6B 3ZNUA 3UN2A 2QT7A 3SSQA 2P6SA 1U7LA 5CHCB 1S6OA 2UXDF 1RTZA 1SL2A 3V4MA 2CWKA 1N6QA 1RLDA 4Q43A 2MZSA 2QE5A 1FK9A 4X4SA 4ANEA 3E01B 3GZ7A 3DGVA 3ITHA 4CRJA 1FRHA 4L6V3 5J1EB 3GR0A 4J91A 3RAQA 4OZLA 2J0XA 4I7FB 4F67A 3MOZA 3NGUA 1R43A 1BE4A 2OELA 4LVNP 1UEUA 2FC9A 5T7LB 3BSNA 1IM4A 2AEMA 2RUGA 2L9WA 1RTDB 3OL9A 1WC5A 3R3TA 3LAKA 5K8OA 4OI0A 4HHUA 1N34F 3D9BA 5KG7A 1CULA 1KFDA 1LWXA 2ZH1A 2NSBA 1EARA 2FJWA 2DNZA 2RMLA 2H5EA 2ZBCA 3DRYA 4XTTA 2VQEF 3N6LA 4NXMJ 3GCXP 4RWWA 3AD8C 1WKLA 2W2NP 3CEDA 1C0UA 1DRZA 2O3DA 3CDBA 2XO6A 1FT8A 2FGCA 2HS4A 4ILRA 4DFPA 5B08A 2CPYA 2UXDJ 4NA1A 4O3SA 2V2VA 2CJQA 4I64A 1VIOA 1WEXA 3ZZTA 1J5EJ 3S8SA 4X64J 1U1LA 2MB0B 2Y3YA 3UE2A 2OHDA 4Y2MA 3M2UB 4GKJJ 2N3OA 4O0IA 3OSPA 2HRTA 1XIQA 2XBPA 3GJTB 5KOWA 4OX9F 4N47A 2YX4A 4WP3A 1VQ9S 3LQVA 4DX8H 2GFFA 1X4FA 2IVFB 4F4KA 4A47A 3PKYA 2IRUA 2C3OA 1FKPA 2PT0A 3M2VA 3THVA 1S12A 3Q8QB 2CQHA 1K0TA 1FNXH 2IDLA 1QE1B 4RBUA 1QLNA 2ZH7A 2FLNA 1HPZB 2JLFA 4RW4A 3TO8A 5LMNF 1U1RA 4FXWA 1IBLJ 5LSOA 4QOTA 2M5YA 4OMFG 1OY8A 1RHKB 1T05A 1S0MA 1SH0A 2AGQA 2A0FB 4NA3A 1A9NB 4J9VA 3KLGA 2HMIA 3CDEA 1T94A 2MXYA 5J2NA 1HFEL 1BQNA 7FDRA 1WG4A 1JLBB 1T9YA 2OPPB 4AD6A 2EFNA 3W1YC 4JI8F 1C4AA 1TP7A 1B99A 3ILLA 4PQUA 2XY6A 2HNDA 3HHLD 4NZ7A 1KLNA 4C8YA 4EFAC 1R0AB 1AFJA 5KFOA 3DMJB 3OFEA 3MMJA 4Q2LA 4U7UD 2DNYA 2E1MC 5CH7B 1N36F 4XAKA 2VBZA 4KPCA 1B7FA 4EUVA 4JI1J 1RSCA 3MR2A 3CJKA 3V6DA 4Q8FA 3C2PA 1JK9B 2ERRA 1LWEA 1XMOJ 1X9MA 2HSEB 1FRLA 4F50A 1ZETA 5I3UA 1PJ6A 5AT1B 4JI5F 2B6AB 1RT2B 5BJRA 4I2PA 1HHQA 3G9CA 2K7KA 1IBKF 5KFDA 3UCUP 4LR9A 1S72S 3FFIB 3EGZA 1RLCL 2DRDA 2H9ZA 2P2CB 3GE9A 3IAM9 3HHDA 3Q8PB 8RUCA 1PILA 4OHWA 1VRQC 3GB0A 4I2QA 3G6VA 2HBYB 1FA0A 3UW1A 1S1VB 3MEDA 2ZH8A 1NDCA 5D0HA 4ZPCA 3NS5A 3JSYA 3R5JB 3N28A 2CQ2A 4KGZB 2HFUA 4GC7A 2ROGA 3P5TL 4KGXB 1S79A 1OS5A 4IRKA 3DU5A 2RIJA 1SH2A 5SUHA 5J2MA 4N41A 3RW6A 2R7VA 5KFVA 4OV6A 3HMJG 1N5YA 3K59A 1AT1B 2Q6CA 4H4KC 3HKWA 5U47A 3MFHA 3M9NB 1WC4A 4LFCJ 4JI7J 4JI1F 2RHQB 3NOGA 4FF2A 2Y8YA 1RBOB 1UEKA 1S6UA 2HBRB 2V50A 2W9AA 1NB2A 3T41A 3DLKB 1BWVA 1KP6A 2ACYA 2BEFA 3DC2A 3J7YU 4ECTA 4PG6A 4CQ1A 3HVTA 3K5LA 3OVBA 1FRMA 1LW0B 3GWCA 1M5SA 2QFJA 2B9XA 4LFAF 3D1QA 2B4PA 3DHXA 4KJIA 4WP9A 1UVMA 3I4HX 3T3FA 1BQMA 4JI2F 3HVRA 4IR9A 1IKYA 2WRMA 4ZJLA 4FPIA 4O23A 4XPCA 3Q86A 5ITHA 1RA6A 4LFAJ 3H5YA 2JFKA 2WHOA 4GKJF 2IBOA 2E9RX 5L9XA 4X2BA 4KKOB 2D3OR 2KYXA 3M1VB 3W7BA 1ULRA 3GPAA 4HYKA 1JJ4A 2C2OB 5CYMB 1JB0C 1UP1A 2HNDB 2E5IA 2YKAA 2BJEA 1WWHA 2BKPA 4DV5F 5D3GB 3M6XA 1PAUB 1PC5A 3DRXA 1OSCA 4MKAA 1AA1B 4OI4A 2CPJA 3HP6A 2V4JB 2KB2A 5A2QY 3N5BA 2YKMB 1SUQB 4LRBA 3MDFA 1UVKA 5GAHU 1S9FA 1CQMA 5E2QA 4CH7A 3PX6A 3TQEA 2C3YA 2HFVA 1U1KA 2LA6A 3TRGA 1UWBB 5I3PA 4USKA 2QLJB 3V6JA 2U2FA 1WKJA 2VASA 5C7PA 3KG0A 4F4AA 1T03A 1DURA 3TWZA 1IKXB 2E1PA 1NH8A 2HKEA 3OFFA 2BW7A 1WJ9A 3BGOP 3J7YI 4JYAF 2CADA 2BJDA 2OO4A 3U1LA 2L41A 3I31A 5G0RA 2AMCB 2H65B 2B4UA 4LBHA 2HVIA 1BQMB 2B8PA 4ALZA 1KTQA 4DCOB 2QA2A 4DR2J 1F0XA 5H9FJ 3CSKA 2C42A 1VRUB 3RUBL 3EX7B 1X5OA 2C2DA 3R5GA 2XTJP 3DOMA 1RWNB 2CWXA 4TN2A 2WOMB 1H74A 2GC8A 2D7SA 2CQ3A 3QNWB 3AQPA 1FRJA 3OXFA 5K8NA 4F0HA 5C42B 3VGTA 3VQSA 4CTAA 5KOXA 2C2NA 4JBCA 1N52B 2MZQA 2D3UA 3PYEA 4Z2XA 3NNHA 3BREA 1GTHA 2ZC4A 3M6VA 3WQPA 4LF6J 1CJTA 1HW9A 3EPGA 4DSFA 4ZCKA 1AZSA 1S1TA 2YBVA 2HVDA 3RRGA 3TNVA 1WOPA 4TKTA 2XB2D 2NPIA 3BJYA 2RRAA 3PTWA 1PBUA 1HI8A 4LF7J 3NCRA 4OL8A 2HNZA 3K5PA 2E1CA 3EMTA 4R8UA 5FJ4A 4C11A 4LRCA 3CIMA 4PWDB 1JXEA 2BE7D 1NPPA 1H7XA 1T9UA 2GCFA 1VLYA 1M1GA 3MAAA 3DLBA 2JVOA 3S01A 2QMUB 4QW9A 2DGVA 2R8GA 1RTHA 2PEBA 1RYRA 2I38A 3BSAA 1VR6A 1PYOB 2L9DA 4P71A 1VQ4S 2FDNA 4X4OA 2ALYB 1NZ8A 3MWBA 4KR0B 2CQ4A 2V8GA 3D28A 4RO0A 1UPMB 1J5OB 5EWFA 3IWNC 3DLEA 2JL9A 1B0TA 1R89A 2JFDA 3G4SS 2KVIA 2CPIA 4Z7CA 3PZPA 4WXWA 3B82A 4AQYF 2LEBA 2HHTA 4I67A 2V34A 4KBIA 1T9TA 5D4NA 3W9HA 2R7WA 1PGZA 4M94A 3PRBA 1HI0P 3DOKA 1RAAB 3I0RB 4ZP9A 3HSDA 2EKYA 3QT7A 4LT6A 1JXLA 1AXQA 2ZEJA 2G2ZA 4J9LA 1WHVA 4UZBA 5D78A 3CJ2A 4CLKA 3JYTA 3J81j 4DR3F 2J9DE 2MJUA 6FDRA 3PW7A 3FBCA 5DGAA 4UOCA 1GH8A 5AE3A 2PIIA 2ADCA 1YVFA 2W2MP 2M8DB 3KLIA 1RQ0A 3D5MA 2HRUA 3OFGA 4ICLB 4OLPA 5EGYA 3FSIA 3IM9A 3FBFA 3BGUA 2KT3A 2RU9A 3DLGB 2AIRB 2RF2A 1Y4ZB 3D6HB 4WIIA 1SJ1A 2CQ1A 2LQBA 4YEAA 4U7UK 2AJ4A 1HW8A 3AOAA 2AU0A 1JLQB 1G7CB 1S9GB 2ZOMA 2CNKB 1NDLA 3A3OB 4BWMA 3PW0A 2NR0A 1XNRF 2A6OA 2ZNYA 3NGDA 2W2QP 4YDXA 5RUBA 5BYQA 5D8HB 5F9LA 4EWTA 3A8JA 4ZIVA 4ZPBA 3UO0A 3T1YJ 2WSEC 3C15B 1YWXA 2GMHA 5IT0A 1Q5YA 1BGXT 1WSRA 3OUYB 4F4YA 2WB4A 4CO2A 3K89A 1QAIA 3HVWA 2DGWA 1Y5IB 2MKIA 5LJ5Y 4XO0A 1NDKA 5EDWA 1X9WA 1T7PA 3T1AA 2BBEA 3DYAB 4NLGA 1KRPA 1RU2A 1X7VA 1OSDA 2L3MA 2KVQE 3M30B 2F7VA 4NYPA 5ETQA 5LMUF 4ED5A 1YRTA 4H4MB 5D6GA 1B64A 2HVHA 1UVJA 4C7QA 1S7HA 4FVMA 3D1OA 4IG0B 5C2CA 1ZS6A 3LOUA 4ZITA 5B0EA 4DZDA 2RT3A 3QT6A 4OI1A 1X4GA 2DY9A 5ETLA 4H54A 5KG1A 5HQMA 3OJUA 1HBMB 5IV4A 3Q2TC 2DIUA 1CJTB 1NSQA 4FN5A 2EEYA 2I5JA 3KJFB 4I2QB 1PKUA 1VJQA 5CCLA 3IBCB 2LQJA 2VKRA 4IH6A 3D6TB 3FUYA 1HQ2A 1CJVB 2ZOFA 1GK8A 2VQFJ 1KOHA 1IR0A 4I0WA 4PPDA 3DLKA 3MAQA 2YWWA 1MMNA 5IC4B 5KG3A 1RT2A 3UCGA 3OL7A 2V67A 3MAAB 3ENWA 1WF2A 2XMMA 1NM2A 2VV5A 4DV1F 4F04B 1NK6A 4ZHRB 3QLHB 4P74A 4QU6A 3GJQB 1FX2A 5IM0B 2FVCA 3CCWA 5D4LA 2FD2A 5E0OA 4A8OA 3IN5A 1HBUB 2I1RA 2MQ8A 1PCAA 3H42A 1HHTP 2G1HA 3N4WA 2FJEB 3T9ZA 4C3KA 2FLLA 2ZZMA 3LALA 1S97A 3KUEA 3O1LA 3C3LA 3PFOA 2XYHB 1LW2A 2BE9B 4U6PA 3EVMA 4B08A 4ZMMA 1AUDA 1QAXA 2RSQA 3BDEA 1VQ5S 4DPWA 2ZZTA 5EN1A 3DI6B 3PYDA 2YNHA 3CC2S 4TY9A 2K2PA 3R9LA 2OPPA 2CNOB 3Q8VA 2F4VF 2B7CB 2GJ2A 1SBRA 3LGNA 2IVYA 1AYEA 5CABA 3AODA 3IBWA 3J80U 2C2KB 1I94F 1CJKA 3I5CA 2DISA 1VRUA 1QTNB 4ZVEA 2P6TA 3U02A 2RAQA 2M8HA 5CYMA 5KAKA 2VD3A 3RAMA 1M1HA 5DDOC 5KFZA 1VI7A 7FD1A 5L1IA 1DTQA 1VQYA 3HFZB 1B3TA 1FD8A 3OT9A 3V6DB 4AUKA 2BKNA 3BV8A 1P8GA 1WF0A 1MWZA 1S9GA 2RJZA 2YWKA 3EUNA 4O0NA 2YWGA 1Q53A 3DCAA 4DPOA 5M2RA 3CCZA 3M9MB 2UUAF 4LRFA 2RKIB 2KZZA 2HQ3A 3HHNB 5AJ3F 3JTOA 4IG3A 2VFRA 4DG1B 4LF2A 4ZVHA 4EBDA 3T1HJ 3EGNA 3R6GB 3TA1A 3UI3A 3HJFA 1GMVA 3MHYA 4NI2B 1HQUB 1MN9A 1SUQA 2J9EA 3SDEA 4BS2A 3I9ZA 1L3KA 3OTOJ 1T9XA 3QJPA 5F8HA 1BQNB 2IRXA 5KFLA 5IWAJ 4RNOA 2DHXA 1JJCB 1VBYA 1KVIA 2VDHA 5I3QA 3VV2B 1I3OB 5DZ6A 4ZJOA 3DHWC 3VWSA 2B7BB 2JJ4D 3V6KA 5IWAF 4F3QA 2PN6A 3M8SA 2WVCA 4JV5J 1RTJB 2JZ5A 3CD0A 3G82B 3VVTA 2XEXA 5J2PB 3MM5B 1SC4B 4WTYA 5K5MA 3NMRA 2JOQA 2EFPA 2HURA 4DV7F 4DLGA 2VFTA 1RGVA 1KWMA 1FHTA 3FSYA 2GHWA 3JSMB 3BQ0A 3IGVA 5ETOA 4FKYA 3HK2A 1SL1A 1JLEA 4X84A 3CW2C 5AE1A 3ZTPA 4NEYA 4RPFA 1WELA 2QO3A 2XYGB 5IV3A 2AX1A 3DRSB 2V0NA 3OD2A 2HHHF 3HM9A 2Z2YB 2YQ0A 4ID5B 1SJFA 1RT3A 4QYZK 1VRTB 2KJVA 4UY85 2HQGA 2J76E 3NCQA 4PWDA 3OTDA 2UXCJ 1VC5A 4DR4J 4B17A 2J0QD 3HO1A 4ZVUB 1HMVB 2GQQA 2MPUA 4DL3A 1YX2A 3LUYA 5ETPA 5KG6A 2VOPA 1YKWA 5KG4A 4CNZA 4B3OB 2HBZB 2XWXA 1Z1ZA 1DLOA 3MCSA 4WFYA 1GNKA 3BGLA 4J90A 2R8KA 4P7TA 1YJRA 1SB6A 4Q45A 2LA4A 4L76A 2RHSB 4KV8B 1TQLA 2LQ8A 2Z0GA 5KFKA 5F8LA 5C42A 4NRTA 4RU2A 5CZXA 3KMSA 1U2FA 1NXIA 3FMWA 1K44A 2B8QA 3ONQA 2OTLS 3QRQA 3KLFA 1SPBP 2DIVA 2LMIA 2QFIA 3CCTA 2N3LA 4NA2A 4PXCA 4DFMA 3SDEB 5KFMA 5DM7Q 1JJ2R 1IBMF 2J7WA 1D8ZA 2OPSA 2ZBRA 4AFFA 2POKA 2RRBA 3KTQA 4JV5F 3M1VA 4PXBA 1NHKL 3G6XA 2XMKA 4KHPF 1Q7YT 2GW8A 1JLAB 1ACMB 4ED6A 2DH8A 5LT5A 4E2FB 2QEXS 2G9OA 2YKOA 2DO4A 2MQLA 1IJFB 3CDWA 1TL7B 2YQ3A 3IMQJ 3M2VB 4MYTA 4U67Q 4CH1A 4DL4A 4YY3F 2AYMA 2EVZA 3LP1A 4Q0BA 3PFEA 3ZTSA 3AAWB 5KTQA 1BLUA 3CCUS 2J0SD 2MLXA 1REVB 5IFMA 2B9YA 2I0XA 2MTLA 1XTZA 4G1IA 3GJRB 1PYTA 3QO9B 4G3IA 3NWRA 4ER8A 3N79A 3TUPA 4FF4A 1REVA 1PYSB 4HI2A 4P2XA 3H40A 1X4BA 2HAFA 3GJSB 3P5BP 1XK8A 3R1LA 3DI6A 3LH2S 4QR0A 2ZVIA 1VQ7S 3H4DA 1N5YB 4OI3A 5CZVA 2YH0A 1HHSA 2IPOB 4KKOA 1NKBA 4LFBF 1K9MT 1UAWA 4C97A 2DNQA 3L09A 1P1TA 3LA0A 3QPIA 3C66A 4DL7A 4HEA9 3MM8B 5IM0A 5LJ3Y 3GCWP 3PRVA 3QIPA 1FEEA 1KONA 1G4CA 2BMBA 3SXLA 3A8EA 4CLLA 2UV8A 2A10A 3PRDA 4PUOA 4IO1A 4KH1B 5D77A 3F44A 2KU7A 2E1AA 1RT5A 2J5AA 5E3RA 1IKWB 3J7ZT 1YIJS 4ZCIA 3HT0A 4DR6F 1SJRA 4MYUA 4WPAA 2DCLA 3QBCA 4DDFA 4YHHJ 4BLGA 3K5NA 2LYVA 2LU2A 3ISND 2HHPA 1RHQB 3C6TB 3QZ8A 2KTQA 1CLFA 2EBGA 1FI4A 2KJWA 4K5SA 2FVRA 1HYSB 4F25A 2NSCA 5C25B 3CVKA 2ZWPA 1V3RA 4QBUA 1N5VA 3BYPA 3OSNA 2PSZA 3UQSA 3I56S 4BDPA 2MKKA 4KPYA 4NYZA 4B3OA 2GIQA 3UR0A 3G82A 3V4IB 3VQTA 3EJMA 4DR6J 2FJVA 3DMJA 4QIWD 4AT1B 1Q8IA 3K5MA 4WZMA 2XY5A 5HMYA 1ROFA 2X7IA 3BZQA 5BYRA 1Z2ZA 1U1MA 2FZCB 2K8GA 4ZCLA 3I9V9 2RNEA 5DG9A 1RA7A 2MKJA 1NPRA 3BKTA 2HPUA 2O67A 5AXLA 3ZZ0A 5KT2A 3JAMY 2K7JA 2M9KA 2GIRA 5H9EK 2RS2A 1SH3A 1IQZA 1KOOA 1OJ4A 3N6MA 4C98A 2MZ1A 4K0KJ 4I6AA 2VICA 1X4HA 3C14A 3CJSA 4WE1B 4WFZA 5FD1A 5KFTA 2ZKTA 3LANA 3NP5A 3OR2A 1QTMA 1B70B 4E8UA 3AT1B 4AL7A 4B3RF 1ZM2A 2BE2A 2PO4A 3BB5A 3M8ZA 1NZAA 1RU1A 4UUXA 1ZYQA 3BBBA 4CLTA 4KGKA 5DQIA 3UVJA 1E6YA 3OTEA 4ZCMA 2DPJA 2ZOGA 3KNGA 4RWXA 3MCOA 5EUHA 5F0UA 2BX6A 2DR8A 1H38A 2B56A 4K50A 3B4MA 2HQCA 4HTJA 2OFHX 4USUA 3N6NA 1JLBA 4OX8A 5KT5A 4RZRA 4ZPVR 3QO9A 1JLGA 3EDRB 4IKAA 4NMLA 3OW2R 3DRPA 3GR1A 2XHWA 3IG1A 3L95X 5DJBA 4XDCA 3HXMA 1U1QA 2FVSA 4OYBA 4DCJB 2FUG9 4DF8A 1PIEA 1H2UX 5E5NA 1JQGA 2BANB 2AD9A 5DM6Q 4RW7B 5GAHI 1BUXA 3RRHA 2AV5A 1ZAVA 1SV5A 3GIJA 2R7SA 3G8QA 2R2UA 4OZ0A 1N54B 1U0HB 2OUGA 1WD6A 3UD5A 3ILJA 3W2WB 2VDIA 4RUAA 3IR5B 4QWEA 3EYZA 2RQMA 4LIWA 3Q8RB 4KB7A 3R5DA 1EQMA 1RTDA 4W92B 3HVTB 2Y0BB 4Y34A
chains in the Genus database with same CATH topology
2W2PP 2Z56B 2XTJP 3CO0P 3T41A 2QTWA 3A3NB 1V5IB 1SPBP 3CNQP 4NMXA 1ITPA 2Z2YB 2Z2ZA 2W2MP 3VV2B 3AFGA 4K8RA 3P5BP 1SCJB 2Z58B 2W2OP 4NE9C 3WIUA 3QFHA 2E1PA 2ZWPA 3WIVA 2Z57B 3H42A 3BGOP 3BPSP 2PMWA 1R6VA 3GCXP 2W2NP 4YN3B 3VHQA 3A3OB 4JP8A 3WHIA 2ZWOA 2W2QP 4OV6A 3GCWP 2Z30B 3SQOP 3A3PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2P P;  2Z56 B;  2XTJ P;  3CO0 P;  3T41 A;  2QTW A;  3A3N B;  1V5I B;  1SPB P;  3CNQ P;  4NMX A;  1ITP A;  2Z2Y B;  2Z2Z A;  2W2M P;  3VV2 B;  3AFG A;  4K8R A;  3P5B P;  1SCJ B;  2Z58 B;  2W2O P;  4NE9 C;  3WIU A;  3QFH A;  2E1P A;  2ZWP A;  3WIV A;  2Z57 B;  3H42 A;  3BGO P;  3BPS P;  2PMW A;  1R6V A;  3GCX P;  2W2N P;  4YN3 B;  3VHQ A;  3A3O B;  4JP8 A;  3WHI A;  2ZWO A;  2W2Q P;  4OV6 A;  3GCW P;  2Z30 B;  3SQO P;  3A3P B; 
#chains in the Genus database with same CATH topology
 3R7N B;  5JVG Q;  3ZTR A;  2DNR A;  1RTH B;  1JXV A;  4Y6I A;  4NLX A;  4YB7 A;  3AQO A;  3GQC A;  2NXU A;  5KFY A;  4OYW A;  1RAI B;  2A3J A;  2BJ7 A;  3A1Y G;  6FD1 A;  3UPF A;  3FCV A;  3OR1 A;  4DOZ A;  1REG X;  2P9C A;  5CXT A;  3GV5 B;  2MMY A;  4DXL A;  3AOB A;  5HRO A;  3MMA A;  3ETM A;  1V3S A;  2CVI A;  5DRK A;  1YHQ S;  2BJ1 A;  4CI0 B;  3RG6 A;  3I55 S;  1TUW A;  1S6Q A;  1XR6 A;  1N0V C;  4XK8 C;  2V2Z A;  1P9Q C;  4FDF A;  4TU7 A;  3BO4 A;  4NZ6 A;  1HWK A;  2OP5 A;  2J7U A;  3PHE A;  3DXS X;  4C3M A;  4ZP8 A;  1MRO A;  4KHM A;  4CO1 A;  3SV4 A;  3K0J A;  4PRF A;  2JEF A;  3J7Z 5;  3HSZ A;  1YK9 A;  1QDU B;  3NGR A;  4TQR A;  5L1K A;  2WOM A;  4NWB A;  4YB1 P;  1RT6 A;  2JC0 A;  2OEM A;  2AJ2 A;  3I32 A;  4KY3 A;  4Q44 A;  2BJ3 A;  1RT5 B;  4A8Q A;  2H5J B;  5HLF B;  3CJ3 A;  1WKK A;  1UWA A;  4ED2 A;  1QY7 A;  1QSS A;  4LJM A;  5I3U B;  4ILM A;  3E01 A;  1RHU B;  3HHE A;  4URG A;  1HNW J;  1NJI T;  1HBM A;  5KG0 A;  3M8P B;  3GV8 B;  2FGO A;  1MU2 B;  3QGP A;  2IM0 A;  1EB0 A;  2LQ5 A;  4NLO A;  2ZE2 A;  4AE5 A;  3KK3 B;  2K1R B;  3M4X A;  1FKO A;  2AWZ A;  1RAH B;  2M2B A;  2R4F A;  1SV5 B;  4HI1 A;  4L3K A;  4LBP A;  2J6T A;  3SI8 A;  4GO7 X;  1YLX A;  2QMW A;  4BC9 A;  4KAI A;  4MT1 A;  2CZ9 A;  3CJ5 A;  3RB3 A;  1KLM B;  3DDI A;  4R0J A;  3TAQ A;  3H7H B;  4OJH A;  1T02 A;  2BRL A;  3HFV A;  1K73 T;  3GFH A;  4WXO A;  3TUI C;  4OJG A;  4DV4 F;  4GKK F;  3R5C A;  2XZD B;  1XR7 A;  4I68 A;  2HLU A;  2QTW A;  4DV2 J;  1JLG B;  3PO5 A;  4JI4 F;  2ABY A;  2OEJ A;  4NLY A;  3HZE A;  2DNK A;  3CCL S;  4AL6 A;  4LF4 F;  5IT9 U;  3W64 A;  9ATC B;  1NKC A;  4B9V A;  5D3G A;  1SXL A;  3HKZ D;  5E3P A;  4DPT A;  3FDS A;  4IG3 B;  2LEP A;  1C0T B;  2HVZ A;  1SL0 A;  3Q2S C;  4WJB A;  4DX7 A;  2BXJ A;  2KT5 A;  3MUT P;  4OI6 A;  2OI2 A;  1QE1 A;  3I87 A;  2ZHB A;  2KDO A;  1HQE A;  4NL5 A;  2QSF A;  4R25 A;  4YN3 B;  5KFI A;  2C28 A;  3PDN A;  1F2H A;  2B9W A;  1TL1 A;  4FYV B;  2ZWO A;  3T1Y F;  1VCT A;  3BSO A;  2YWF A;  1R27 B;  2HHS A;  3CTR A;  4DSE A;  2GV1 A;  2MQM A;  2YNG B;  3RW7 A;  3LWL A;  1YZ6 A;  3CCR S;  1VQ6 S;  1WEY A;  2KL8 A;  2L08 A;  4TXS A;  4EZ6 A;  2QYG A;  3O2I A;  3VAH A;  2AGO A;  1T3N A;  1ZAX A;  2ILZ A;  3GV7 B;  1KVK A;  2OGU A;  1OYD A;  2DCU B;  2OPR A;  3L7O A;  3QT8 A;  5HMW A;  4A8M P;  1NK9 A;  5CYJ A;  3MFI A;  3JYT B;  5C24 A;  4LBI A;  4M5D B;  4NCB A;  3U7J A;  3L7U A;  2F8M A;  5HMZ A;  1RAC B;  4MFB A;  3TJA A;  4JI6 J;  1RAG B;  3ENA A;  2W1B A;  3R1H A;  1YRX A;  2CPZ A;  3FMB A;  2UV8 G;  3NXZ A;  4I1T A;  4OX6 A;  4O3N A;  2J6S A;  4C9D A;  1TTH B;  1B0V A;  3K58 A;  4DUY J;  1XMO F;  2ZJR Q;  2E9T A;  2WAQ D;  3IXQ A;  2J9C A;  2MQP A;  1HA1 A;  1UZH A;  2XWY A;  4QIG A;  1QUP A;  1KC8 T;  2LXF A;  5HRO B;  1VQO S;  4CYU B;  2ASL A;  3IA0 A;  4MK9 A;  1S1V A;  4DLE A;  4DV6 J;  1YBT A;  1VC0 A;  1N56 A;  1TZ0 A;  1RIS A;  3AXM A;  3BO2 A;  4U7C A;  4HR2 A;  1F3F A;  3MXH P;  3OPK A;  4DF4 A;  2KM8 C;  4OJ1 A;  3TP2 A;  2AX0 A;  4DZ6 A;  1UJ6 A;  1S10 A;  4JI2 J;  3OUY A;  4RNN A;  1VQN S;  1KVJ A;  1RB0 A;  7AT1 B;  2Z58 B;  4KFB A;  2WSF C;  1EET A;  1XR5 A;  2GJF A;  4U8V A;  1RWX B;  3A8K A;  4HVZ A;  3VTI A;  2CPE A;  3MM8 A;  3NKY A;  5BR8 J;  5D15 A;  1N6Q B;  1FRK A;  4BBY A;  4YHH F;  2C3M A;  5L1J A;  2XCP A;  1O5J A;  2RQC A;  2DNP A;  1C2P A;  1T95 A;  1CJU A;  4NLQ A;  5K8M A;  4LFC F;  3SQO P;  1CBK A;  2DK2 A;  3BQ1 A;  1VC6 A;  4O3O A;  4OV1 A;  2Y1I A;  4EI2 A;  2FY1 A;  3SCI E;  1GMU A;  3KG1 A;  4W4M A;  4NXM F;  1MG7 A;  3H5U A;  2FHJ A;  2YNF A;  2DYA A;  1OQ6 A;  3G6Y A;  2YWE A;  3MMB B;  4K5R A;  4OQJ A;  1AUS L;  3BGF A;  1ZA1 B;  4LF6 F;  4ECZ A;  3PX0 A;  3MEK A;  4YB6 A;  4UZC A;  2AW0 A;  4EU0 A;  5DLG A;  3POT B;  3KLV A;  4DHV A;  3SCJ E;  1PO6 A;  2FJX A;  3HHL B;  4EMD A;  4X4U A;  3K8W A;  4A8Y A;  2YX7 A;  4Q0B B;  1AB8 A;  2AJQ A;  1MWQ A;  1IWA A;  2YKN B;  4G1Q A;  2XLI A;  2SXL A;  2OLW A;  2YH1 A;  1VMB A;  2DHH A;  2JWN A;  4PWW A;  2AGP A;  4LF4 J;  1JLC B;  4USM A;  1ZOT A;  2QA4 G;  1NUE A;  3D1H A;  4W98 A;  3KLE B;  1MW7 A;  1KBR A;  2R3V A;  2YKN A;  4EYH B;  3DGP A;  2ROP A;  3ILI A;  2RF2 B;  2GVZ B;  4P2M A;  3W65 A;  5HVG A;  1NCL A;  3KK1 A;  2CQG A;  1QAJ A;  1IR2 A;  3KK2 B;  2KI2 A;  2X1B A;  4JI3 F;  5GAE U;  2MY7 A;  1XNR J;  4DR7 J;  3MUM P;  1WSV A;  1R7I A;  1TL3 A;  2GX8 A;  3GU0 A;  2OPS B;  3QAU A;  4L75 A;  5D0G A;  2YKM A;  1ZAW A;  5FDL B;  2MLY A;  5FII A;  5A0Y B;  5B0B A;  5C5J A;  1RBA A;  2R2R A;  4W90 B;  3TZZ A;  4DSL A;  3M32 B;  3NL0 A;  1Q95 G;  1U09 A;  2MJN A;  3SQG B;  4NXN F;  1KN6 A;  1YJT A;  2V8H A;  3NY0 A;  3RU0 A;  2MZT A;  3V2U C;  1CC7 A;  1UJ4 A;  1SIZ A;  1MRO B;  4DQS A;  2LP4 A;  2AZ1 A;  2QLB B;  1BWE A;  4ECQ A;  1RT7 A;  1HNW F;  1T0T V;  4UW2 A;  1HD1 A;  1RWU A;  8ATC B;  5EX3 A;  2CAJ A;  3UN5 A;  2NS1 B;  1LW2 B;  2CNN B;  4FP9 A;  2B3T B;  5KFH A;  2AQ4 A;  2IC3 A;  1RAB B;  5I42 B;  1GX5 A;  2OSR A;  4FXD A;  1EKS A;  1LWC B;  3PEH A;  1JKH A;  4EO6 A;  4HDG A;  2ASJ A;  2CUY A;  1S59 A;  4QPT A;  3B54 A;  3OTC A;  2L9N A;  3H5S A;  1NME B;  3QLH A;  4RU9 A;  1LQ9 A;  2QLX A;  3OR1 B;  4L3N A;  3CCJ S;  2FVP A;  1GTE A;  2E29 A;  2VFS A;  3W9I A;  3I5A A;  4M5M A;  4AQY J;  1ZH5 A;  4RW9 B;  3BQ2 A;  4DPX A;  1YG0 A;  1A7G E;  2BVZ A;  3M32 A;  1XMB A;  2BJ8 A;  4J7C A;  4TYB A;  2KH9 A;  2HAI A;  4ECU A;  2KRB A;  3G8S A;  2NZ4 A;  4DX6 A;  2G0I A;  3MCM A;  1HWU A;  4XIU A;  4U8Y A;  4LRD A;  4ZPT R;  2PMH A;  2R9L A;  3GIR A;  2N7Y A;  2HK2 A;  4ES3 A;  2M7S A;  1N34 J;  4B9S A;  1F6T A;  3ZZR A;  4B9U A;  1XEZ A;  1UFL A;  5J2M B;  4LSZ B;  3MM5 A;  1R6V A;  2C2R A;  1U4B A;  3W5Y A;  2E7W A;  4DQP A;  3BKF A;  2GAH C;  1KHV A;  4JI7 F;  3MPD A;  4DQR A;  1UVI A;  2LXI A;  4G6V B;  5F0W A;  2IJN A;  2NYH A;  5KFQ A;  3PR4 A;  1YJW S;  1D8Y A;  3EVO A;  2DKO B;  4M5J A;  2E9Z A;  3X1L B;  1WEZ A;  4H4M A;  2NPF A;  1RWO B;  4J9N A;  1Q4R A;  1IXK A;  1TMM A;  1LFW A;  3NGS A;  4IDK B;  3IG1 B;  2XC9 A;  3MEG B;  1QJH A;  4NAS A;  1TUG B;  4WF9 Q;  4NLU A;  2QL9 B;  4HTI A;  1IR1 A;  4TLR A;  2VC1 A;  1WOO A;  1YBU A;  2XI2 A;  4QJV A;  5A8R A;  4X4Q A;  4ELU A;  1LNQ A;  1MMD A;  3AFG A;  5IZH A;  1N33 J;  2IY5 B;  1FWP A;  1U49 A;  2EFQ A;  4C8Z A;  1YDL A;  2AP6 A;  2BYC A;  3AA8 A;  2DR5 A;  4PR6 A;  4P75 A;  2G2O A;  5KFW A;  4ANC A;  1HPZ A;  4RW4 B;  1MWY A;  1LXJ A;  2FTR A;  3F73 A;  2J8A A;  3VHQ A;  2NQP A;  5KT4 A;  1SIW B;  4DUZ J;  2ZJQ Q;  4LF1 A;  1U26 A;  3BSC A;  5G4D A;  4IQX A;  2X3D A;  4YP3 A;  1KR4 A;  2QGF B;  4PG7 A;  5HI7 A;  3TVZ A;  2YPY A;  2KZM A;  2OH2 A;  2C22 A;  1S48 A;  2M88 A;  4I6Y A;  2QA4 S;  1VIX A;  2G1D A;  3BYR A;  4YR2 A;  3DRR B;  5AJ3 J;  3H5X A;  1GEH A;  4DR5 F;  3HDS A;  1Q8B A;  1DTT B;  4HAC A;  1TR0 A;  4OZJ A;  3N0V A;  5L39 A;  4DI6 A;  3EZ5 A;  4LF5 F;  1U8S A;  1ITP A;  2UXB J;  4DV0 F;  2MQN A;  5F8M A;  4JI4 J;  5B7W A;  3RB6 A;  3J80 Y;  2HZC A;  2LVW A;  1EJ7 L;  1RK8 A;  4ZVF A;  1QAY A;  1BHN A;  4J9O A;  2WON B;  3ZFV A;  5HAO A;  3CD6 S;  1SQF A;  2CZV C;  5DQH A;  4CYU A;  4X4P A;  2AYG A;  4K0K F;  4C0O C;  4QQB A;  1JNZ B;  2A18 A;  2B51 A;  3R6L B;  5GMD A;  2GQC A;  1TK8 A;  1FD2 A;  1R8C A;  3IM8 A;  2BW2 A;  4N8N A;  2CPX A;  3ZZZ A;  1UKU A;  1FNM A;  2XUL A;  3O5T B;  3EGW B;  2IM3 A;  4K59 A;  4DS4 A;  1TKX B;  1W26 A;  3GYX B;  4CTA B;  2JHE A;  2MZR A;  3P45 B;  1EX8 A;  4G1P A;  2HQD A;  1NLK L;  4LSN B;  1VQM S;  1FVQ A;  1I1G A;  1NDP A;  5GVQ A;  3QSY B;  2CVE A;  2DPI A;  2DNM A;  2BOP A;  3QFW A;  4B9L A;  1LWF A;  2FHM A;  1FKA F;  3MUR P;  4WFN Q;  3ZO7 A;  1VDH A;  2ZD1 A;  3PAC A;  3SCL E;  2NXN A;  1FK9 B;  3V81 B;  2CQ0 A;  2XMV A;  4ZVQ B;  3MUV P;  5ETV A;  1M5K C;  4HL9 A;  2KN4 A;  3H8Y A;  5B09 A;  1Q86 T;  1CC8 A;  2Q3P A;  4OYA A;  2H51 B;  5I42 A;  1KDN A;  2DNN A;  4CIO A;  2VFU A;  1S0V A;  1Q16 B;  1RAO A;  2WVB A;  4DQI A;  1IBK J;  1U6F A;  1AFI A;  1EIY B;  2N7C A;  3KKF A;  1UWB A;  1V3Z A;  1P6T A;  1P27 B;  3M30 A;  4F4Z A;  1M90 T;  4M5D A;  3GON A;  1X4E A;  4ITS A;  2Y9H A;  1ZPW X;  2R8I A;  2GAG C;  2YKQ A;  1U24 A;  4GVB A;  3L3C A;  3CWJ A;  4H4K A;  1U1P A;  4Q5V A;  1OYE A;  2XMU A;  1X4D A;  3CUL A;  1SQG A;  5GME A;  4LFB J;  3OVS A;  2VUG A;  1GQE A;  1ZTW A;  3GIK A;  1VQ8 S;  4C3L A;  1N5Q A;  3GFY A;  4O44 A;  2CIM A;  3UD4 P;  4CCH A;  3TAM A;  3K17 A;  5IXU A;  4DEZ A;  3KK1 B;  3TAN A;  1FJG J;  2R7Q A;  2D9P A;  1S9E A;  4FYY B;  1YZ7 A;  2PGC A;  2ACM A;  1F5B A;  4PEO A;  1U0H A;  1PJ5 A;  3I6P A;  3E51 A;  4M5N A;  1XER A;  2ZE2 B;  4NX9 A;  4Y2I A;  5ETN A;  4J9S A;  1U1N A;  3L9Z A;  2HYI B;  3KHL A;  3R5A A;  1M5O C;  5A8K A;  1T03 B;  5CCM A;  1ZM9 A;  1TAQ A;  2BAN A;  2VFV A;  4S0M A;  5L38 A;  2E5L F;  3TQ1 A;  3BGR B;  3HHL A;  5D0R A;  3RZA A;  3QAT A;  4YFU A;  2RVJ A;  4NPO A;  1WAC A;  4Y2K A;  2DR6 A;  4HDH A;  4LF8 F;  3FQK A;  1O51 A;  5E3Q A;  4QWD A;  2LDY A;  4FBU A;  1S1U B;  1Y11 A;  2RUS A;  3PJW A;  3ISZ A;  4ZVT B;  1K1S A;  5LOQ A;  4YY3 J;  5KG2 A;  1DJ0 A;  4ECW A;  2HHU A;  3KLF B;  1HR0 F;  2Z8Q A;  3PY8 A;  3VAL A;  2UVV A;  1RCX B;  4JI0 F;  2BZ2 A;  5C2G A;  3KLG B;  3LWM A;  4ZLL A;  1HBO B;  1X31 C;  4TY8 B;  1S6P B;  2E5J A;  3KG4 A;  2UVU A;  3CGI A;  1VFJ A;  4C48 A;  2HLT A;  2KXH A;  3SIP B;  2DY1 A;  2RS8 A;  4OX9 J;  3MD1 A;  2R42 A;  2F40 A;  4URS A;  2R7T A;  3M8W A;  1FKP B;  4LUB A;  1VQL S;  1OPZ A;  3PG9 A;  3M8P A;  1LFP A;  3OL6 A;  4X64 F;  2V2K A;  5ETT A;  1J5E F;  5LXY A;  2IVM A;  3OXL A;  1IBL F;  2V63 A;  1RT3 B;  4KO0 A;  3WX4 A;  3VCD A;  3MPU B;  5IC6 B;  2VHG A;  3M2U A;  2W2P P;  1MLA A;  4MMO A;  5KFX A;  4GMK A;  4LSN A;  4PZV A;  4I69 A;  4PG5 A;  4RW9 A;  5KT3 A;  3BO3 A;  3ENQ A;  4I2P B;  1CS4 A;  3GSD A;  4IOB A;  2LXU A;  3ZNJ 1;  1JLE B;  1TU0 B;  3UDL A;  3WX8 A;  1NU4 A;  3EIC A;  2XS7 A;  2CNL B;  1XN9 A;  4BC7 A;  3G96 A;  4OYZ A;  3MM9 A;  2CG8 A;  1URR A;  2F4F A;  3PYG A;  4DSK A;  2Z57 B;  4CP5 A;  1L3U A;  1M5V C;  1RXO B;  3LP2 A;  1ZBT A;  1AZS B;  1R8B A;  1RE1 B;  1S1T B;  2RRN A;  5D4P A;  4G65 A;  2X1A A;  1N88 A;  5CA5 A;  2IJR A;  1R0A A;  1YJ7 A;  2NXJ A;  2BM0 A;  2HG4 A;  2WON A;  2GZO A;  3BKU A;  4Y00 A;  1KQS R;  2AHO B;  4A46 A;  2KT2 A;  3ET6 A;  1IBC B;  1GMW D;  3JB9 k;  1ZA2 B;  3CCM S;  1ZTT A;  2X1F A;  1U6B A;  5B0G A;  2P9E A;  2DGX A;  3NG8 A;  4J9P A;  4IOC Q;  2DR7 A;  5AE2 A;  5F3Z A;  3CNQ P;  5ETK A;  2VQE J;  1SQE A;  1PJ7 A;  2XO7 A;  4ED1 A;  3QRP A;  1S1U A;  1H2V Z;  2FQQ B;  2FJA B;  1XNQ J;  1Q1K A;  2DGS A;  4Y65 A;  2ZH5 A;  2M4M A;  1FJC A;  4M5I A;  4QYZ J;  3NBP B;  2UZA A;  4NCG B;  2FJB B;  1BXN A;  3JSM A;  3JQJ A;  2Z4P A;  2XLJ A;  4C8L A;  4UST A;  2HHV A;  3Q22 A;  1TK5 A;  2VG5 B;  3I0S B;  1SJQ A;  3RBX A;  1HKA A;  1UPP A;  5B0F A;  4B3S F;  2D9O A;  2XNQ A;  5J2P A;  2RQK A;  4MJK A;  3EPI A;  1XC9 A;  2AYB A;  4IRC A;  1Y9O A;  1S1X A;  4MKV A;  3OTO F;  3R27 A;  1PBA A;  3OTB A;  4WE1 A;  4WK1 A;  4NRU A;  1WI6 A;  4NCA A;  1U6Z A;  3FZ2 A;  4RBT A;  2RE1 A;  1TMJ A;  3W8G A;  1UMJ A;  3FCW A;  3KLI B;  4M1K A;  4ECV A;  1C1C A;  1VBX A;  3LW5 C;  5L1L A;  3L4B C;  3RBE A;  4UOF A;  2R7O A;  3P6Y C;  2UUA J;  2MY8 A;  3MMB A;  4WFA Q;  2LDI A;  3H2V E;  4HAC B;  5KFP A;  2EWH A;  4EEY A;  4JYA J;  2ZJP Q;  1C1C B;  3JS9 A;  2R7R A;  2OD4 A;  3TZX A;  3W2V B;  4MK8 A;  3D66 A;  4NLS A;  2W9C B;  5GAE I;  5A2Q U;  4EYI B;  3QGG A;  4RBV A;  5F9N A;  1Y0H A;  4NEZ A;  2ZHA A;  3T5J A;  4CM2 A;  3VGV A;  2ZH3 A;  2JC1 A;  1GXT A;  2HFS A;  1VHF A;  3CIZ A;  1TKZ B;  1C0U B;  1GXL A;  2IAJ A;  1UET A;  2K1R A;  2YPZ A;  2I9S A;  3GIL A;  2OTJ S;  2N4D A;  3I4P A;  1WTF A;  2O5D A;  2ZBQ A;  1YIT S;  2QLW A;  1NEE A;  2XZW A;  4YME A;  4FPR A;  4B3T J;  3M6U A;  3DOL B;  2NXC A;  1R8A A;  3CMQ A;  3GIM A;  1HNZ J;  1IN0 A;  4RKU C;  4ZDN A;  2JEJ A;  4A8K A;  4LF9 F;  1LWF B;  3LPY A;  3KMQ A;  2F8E X;  2OPQ B;  5KFR A;  2B5J A;  1A0O B;  3R8Y A;  5LSR A;  2DXE A;  3EE3 A;  2FHJ D;  3EM1 A;  1FDA A;  3MZI A;  3P96 A;  5E33 A;  1ARO P;  4DUT A;  4KGV B;  1N4L A;  2VC0 A;  2E7X A;  1Y5L B;  5F8N A;  1KHW A;  1TK0 A;  2H1Y A;  2NCK L;  2NRE A;  4PUO B;  2VBY A;  3UD3 P;  1Y10 A;  1NBE B;  1HWL A;  3R7B B;  2VL1 A;  3WIU A;  5HP1 B;  2ALZ A;  2IMO A;  2R8J A;  3KOA A;  3HD1 A;  4CO3 A;  1A6L A;  3W61 A;  3D3B J;  5KFC A;  2J8S A;  3LP2 B;  1LWC A;  2IYG A;  4ZP7 A;  1S0N A;  4OZN A;  1LEO A;  2DHA A;  3MM7 B;  4CLY A;  2UUB J;  5EWG A;  2X51 A;  3M9O B;  1RI7 A;  1H0H B;  5BYS A;  1F1B B;  1U25 A;  1G1X A;  1NSA A;  1S57 A;  1FX4 A;  1U2R A;  1BY9 A;  3RJM B;  1VRT A;  2E7V A;  1U0S A;  2MLZ A;  4C6A A;  2WVE A;  2NUH A;  3Q0A A;  2BQ3 A;  4JV1 A;  3IFE A;  3MI7 X;  3UNY A;  2GHV C;  1QUV A;  4DR1 F;  2Y1L B;  3CO0 P;  3DYA A;  3A3N B;  5KFG A;  1FRX A;  2VJV A;  3JSR A;  3P8B B;  3IRX B;  2U1A A;  5CYQ A;  5IOL A;  4CLU A;  2HWI A;  4OFZ A;  1N5T A;  5J1N A;  3DM2 A;  3SFU A;  1TKD A;  2BAB A;  1Q7L B;  2IA0 A;  4DPU A;  1I6J A;  2X3G A;  1C4C A;  3QIP B;  4M5H A;  4A8F A;  4N8O A;  3VAK A;  5LMU J;  1VLO A;  2P8I A;  1N33 F;  5D4O A;  2GS8 A;  4CH0 S;  1HBN B;  4UT4 A;  4O4G A;  3A13 A;  5AXK A;  1R8P A;  4WKR A;  1I51 B;  5L8R C;  2JRS A;  2MKS A;  1WC6 A;  4ENO A;  1RKJ A;  3W3S A;  3RR7 A;  2Z30 B;  1GFW B;  3LAM A;  1WDT A;  4O44 B;  3S6E A;  3HHK A;  3PW5 A;  1DY3 A;  1RAE B;  1NSP A;  3UWT A;  4ETX A;  2YXL A;  4MIA A;  1CJK B;  2KRR A;  1EKR A;  1UCN A;  3D7S B;  2QL7 B;  1N5S A;  1X60 A;  4IFV A;  1H2T Z;  4DWI A;  2UU9 F;  4LIR A;  4ZLN A;  2R2S A;  4DL0 C;  3CMA S;  4K4T A;  4XDD A;  1N36 J;  3ZZU A;  1ZZN A;  3JQK A;  4FNH A;  4H4O A;  3H25 A;  3BPD A;  3BGR A;  4NZ0 A;  3SEO A;  2G0J A;  5KT7 A;  4N76 A;  3LP1 B;  2RKI A;  3AJD A;  1NJW A;  2CJK A;  1Q5V A;  2ASY A;  4YS2 A;  3KDO A;  5JXS A;  3B8H A;  4UTG A;  3OHA A;  2FZK B;  3JQM A;  3EXY A;  3DKD A;  2B4V A;  3T6B A;  5E41 A;  4OHY A;  2V8P A;  4KT0 C;  3MM6 A;  2IM1 A;  4AL5 A;  4NCG A;  3BM7 A;  3ULH A;  4CNY A;  3UDV A;  1JX4 A;  4WFX A;  2XCA A;  2VG7 B;  3FRY A;  5F8G A;  4MK7 A;  2GIF A;  4X66 J;  2W7O A;  1RAF B;  2WW4 A;  2BV3 A;  3UDE A;  4IDK A;  3QSI A;  4OX7 A;  1WG1 A;  3H20 A;  4UOH A;  2CQP A;  2WZ1 A;  2BUN A;  3UFC X;  4ZKA A;  5HO4 A;  3MTJ A;  2I5J B;  1DZ5 A;  5F8I A;  2MHE A;  4USV A;  3P4U B;  2QYC A;  4NE9 C;  2KXF A;  2K3I A;  4OJ3 A;  4JV0 A;  2NYI A;  2A6M A;  4O3Q A;  4NOH A;  3QZ7 A;  4JI0 J;  3CJ4 A;  2OEK A;  4ZPW R;  2ZNZ A;  4K4X A;  4KTQ A;  4LRE A;  4X65 F;  1RAJ A;  3BR8 A;  1RJJ A;  3DLE B;  3W62 A;  3TVK A;  3LP0 B;  1NND A;  4DL6 A;  4DX5 A;  3VZH A;  4ZHR A;  3NAI A;  3FBE A;  5AXM A;  3THP A;  2EG1 A;  4DN9 A;  4TQS A;  3NLC A;  4LF7 F;  5MAO A;  4K4S A;  3NCP A;  4IR1 A;  3CJQ A;  3DXB A;  5THW A;  3DRS A;  3AJ1 A;  4WK3 A;  1TL3 B;  2CYY A;  1Y3K A;  1FEH A;  2GO8 A;  2V2Q A;  3QAE A;  5T41 A;  1VBK A;  2MYF A;  1RWP B;  2OSQ A;  3AB2 B;  2K06 A;  5HSP A;  3DGP B;  3KJV A;  3CUN A;  3MEC A;  4CDI A;  3KWM A;  4LR7 A;  1S1W B;  2ROE A;  4PAB A;  1JKH B;  1U1O A;  2ZBI A;  1MN7 A;  1T9W A;  2O1P A;  2E5L J;  4C2M A;  2ZDO A;  5IT9 Y;  3AD9 C;  4ZJQ A;  1YI2 S;  1ICE B;  2DNO A;  2KFZ A;  4GO5 X;  2XHC A;  4IFY B;  1BMQ B;  3FCH A;  4ICL A;  4C0H A;  4R5P B;  1RBL A;  3D4J A;  3W2V A;  2ZHO A;  2W9B B;  3SV3 A;  2YY3 A;  3QGI A;  3CC4 S;  2JEI A;  5A8R B;  1NHU A;  4QWB A;  4TU8 A;  1IKV A;  1WOS A;  1IQT A;  1U8W A;  2YQ1 A;  1CPZ A;  4OIX A;  3W5X A;  2MHN A;  2ZH6 A;  5A6P A;  4E0D A;  2D3O 1;  2HVE A;  3DLJ A;  4MTP A;  4CLW A;  4CT9 A;  5CD4 A;  1UEV A;  4PXD A;  3MR6 A;  3KK2 A;  4PKD B;  2EBE A;  4KE5 A;  1I94 J;  1Z4U A;  5DGB A;  1K47 A;  4J37 A;  3ILO A;  3KYL A;  1Q81 T;  2MDA A;  3AHP A;  2M3D A;  1KD1 T;  3D54 A;  1KTV A;  3HSJ A;  1H6K X;  1RTI B;  3EZO A;  1JLA A;  1RHR B;  2CQB A;  3NGT A;  4PPZ A;  1CG2 A;  1RWK B;  1VQP S;  4IUF A;  3U1N A;  3S7R A;  3CJT A;  3M2R A;  1WI8 A;  4ED7 A;  2KFN A;  1FTC A;  3OBI A;  2VG6 A;  5T14 A;  4ECR A;  1TFY A;  2CRL A;  4ZVO B;  2VF3 A;  1OY6 A;  1Q8L A;  1LKZ A;  3M8Q A;  1NKE A;  1DAR A;  2EKN A;  4ZLP A;  3HUL A;  3JSB A;  5HL7 Q;  3CD5 A;  1OPI A;  2PFF B;  2Y1R I;  3ADA C;  1SKU B;  6AT1 B;  2FHK A;  3TOQ A;  2J9D A;  4QW8 A;  4ZN1 A;  3UCZ P;  2HQI A;  2VA3 A;  1HNV A;  3PHT A;  1FFG B;  4Q7A A;  2VQF F;  2DVI A;  1WUU A;  2XY7 A;  1FFS B;  2F63 A;  3O3L A;  4Q8E A;  1JLF B;  3X3U A;  4OHV A;  5C25 A;  2EG2 A;  4A48 A;  4DR5 J;  4CLS A;  4UOG A;  3V81 A;  1J5O A;  3NNC A;  3QT5 A;  4DU7 A;  3TX8 A;  2DR9 A;  3N5F A;  4F02 A;  2XGQ A;  4Z7Y A;  2VPW B;  3DM2 B;  1NB7 A;  2FJD B;  4KQZ A;  2WBM A;  3PR5 B;  4K7Q A;  3O44 A;  3TA2 A;  2JLG A;  3GII A;  2ZUG A;  1M1K T;  3AD7 C;  1S99 A;  1EQ0 A;  5DG7 A;  3CJR A;  4RR5 A;  2B0G A;  2CPD A;  3GP9 A;  4JI6 F;  3SFG A;  2G13 A;  3AY0 A;  3DDN A;  4ERD A;  1JNR B;  2B5J B;  4I7F A;  2DT9 A;  3TX0 A;  4X62 F;  5E7O B;  2XYP B;  2E1R A;  1B4S A;  3SSS A;  2E44 A;  1FXR A;  2F65 A;  2GQ2 A;  2LFV A;  3HD2 A;  3IC1 A;  2VPZ B;  1F5C A;  4X4R A;  3UR3 C;  1N32 F;  2UXB F;  1DQ9 A;  1GAO A;  2CQC A;  2C2Z B;  1VHI A;  4U9R A;  3C16 B;  3MM7 A;  1GXU A;  4ZA1 A;  3V5R A;  4K4Y A;  1Q0N A;  2CQI A;  4CO0 A;  1FWK A;  2QZ8 A;  3BEG B;  4JP8 A;  4WTO B;  2EW9 A;  3T5H A;  5HJY A;  1KS2 A;  3KUH A;  3TEH B;  3OJS A;  4PYD A;  2HGN A;  4DSJ A;  2FB0 A;  4QIE A;  1RT7 B;  5GAG I;  4EBE A;  2GML A;  2Z2M A;  4GKK J;  4NLW A;  5GAD I;  2V94 A;  4TY8 A;  4PG4 A;  1O6X A;  3RAX A;  4I56 A;  2YTC A;  4FKX A;  2WVF A;  2NLW A;  3TVY A;  4A8X A;  5HMX A;  1TAU A;  1VYA A;  3DOM B;  2DH7 A;  1QVG R;  2MKC A;  1UL3 A;  5E3C A;  2UUB F;  1JWW A;  2CJ9 A;  2WW8 A;  2R7X A;  3IP0 A;  3C15 A;  2VZ9 A;  3CCQ S;  2YNG A;  4QPX A;  3UNG C;  3FZB A;  4DG1 A;  3H2L A;  5BR8 F;  2FVQ A;  3MM6 B;  2GVZ A;  3ISN C;  2MZJ A;  3TEG A;  4ZLJ A;  1IBM J;  5KG5 A;  4WYW A;  5K8P A;  3WBZ A;  1X5T A;  4FZV A;  4Y2A A;  1OY9 A;  3KJN B;  4CO4 A;  4CT8 A;  5H1S V;  4CM0 A;  3IRW P;  4Y2C A;  4HHJ A;  1XQI A;  3B4D A;  3GFZ A;  1FVS A;  4GVL A;  4A8S A;  4RW7 A;  4P10 A;  1S77 D;  1BC6 A;  4WP8 A;  3W60 A;  2Q6B A;  1IM6 A;  5KFS A;  3US5 A;  4P52 A;  2AJF E;  2DXF A;  2W9C A;  4IOA Q;  1R6Y A;  4EO8 A;  5ADZ A;  4DR7 F;  5HLF A;  2X1G A;  2GO9 A;  1E6V A;  2ZH2 A;  1HNX F;  2D41 A;  4NYO A;  1U02 A;  5KFU A;  2Q79 A;  5DDP C;  1SKW A;  4C0B A;  2UUC F;  1SJ4 P;  5DZ7 A;  2ZKU A;  2DTJ A;  1FE0 A;  3GSI A;  4MIW A;  5EX0 A;  3K2Y A;  1SJ3 P;  1O8B A;  4IFY A;  4ZPD A;  2GVD B;  4P6Q A;  3PIP Q;  1DAX A;  1HI1 A;  2VON A;  2KG0 A;  1RP5 A;  4ZK7 M;  3GYG A;  4TVA B;  2G0C A;  2ZZN A;  3W63 A;  3OXG A;  4B3M F;  4EZ9 A;  1J2V A;  2XLK A;  1HIY A;  5DQG A;  1S6Q B;  4IH5 A;  4NXN J;  4AND A;  4HKQ A;  4WWS A;  2VG5 A;  3I0S A;  1XMQ J;  2WTF A;  2YKP A;  1IVZ A;  2HGL A;  3HSG A;  4M8L A;  2ZD1 B;  3MD3 A;  3G2X A;  2DRB A;  1TUV A;  1D9D A;  3VZI A;  1VK3 A;  1ZZF A;  4UUW A;  3SSR A;  3IRX A;  5CYQ B;  3K5O A;  1B0P A;  5DS7 A;  2IA6 A;  2IJF A;  1RT6 B;  1V5I B;  4J9U E;  3J81 Y;  1Y5N B;  3H0P A;  2DB1 A;  2HHQ A;  3NS6 A;  3QQC D;  3KLH B;  2W01 A;  4RX6 A;  2VG7 A;  5LL6 d;  3VAF A;  3CO9 A;  1P1L A;  3ET6 B;  3M7V A;  1G6B A;  8AT1 B;  3PO4 A;  2MQO A;  1YJN S;  4USW A;  1YRU A;  4RL1 A;  4O3P A;  3C6U A;  1JJH A;  1TL4 A;  3FBB A;  4ECS A;  2JH3 A;  4K4V A;  3THT A;  1D09 B;  4PQA A;  3SMZ A;  2PMW A;  5KFB A;  2N4C A;  4NLR A;  2ZFH A;  4TNO A;  5AXN A;  1RTJ A;  3PNI A;  2OMO A;  4RLE A;  1CUL B;  4PG8 A;  3T5L A;  2A1B A;  2HWH A;  2DHG A;  2D3Z A;  2HZA A;  9RUB A;  4WCE Q;  5D0E A;  2C3U A;  3LGM A;  4J9Q A;  2NXE A;  2CJB A;  2W4P A;  3BBC A;  3L7P A;  3E2E A;  3QYY A;  2QMX A;  3FFI A;  1DQ8 A;  2CJX B;  2HWT A;  3DN9 A;  2MSS A;  1IKW A;  1UFW A;  3NWG A;  3V6H A;  4P9S A;  2AJ0 A;  1TVR B;  3CE8 A;  4QWC A;  1N32 J;  2QRR A;  4ZVS B;  1NH7 A;  2F9J A;  3GYN A;  3IGN A;  3NS7 B;  4O4R A;  1YGY A;  4OZ5 A;  4DFJ A;  4N5S A;  2RH3 A;  4ED8 A;  2JSX A;  1U48 A;  1LK5 A;  4USH A;  2VIH A;  3RBD A;  3Q8S B;  2ZC3 A;  3P49 B;  3A8I A;  3R97 A;  3OL8 A;  1JMT A;  2Y0S D;  4KIA A;  1K1Q A;  5H9F K;  3FRZ A;  1UA0 A;  2DJW A;  3KDN A;  2EPI A;  3DDK A;  1OO0 B;  3LPE A;  5LM7 E;  1HNX J;  4J5O A;  3CCV S;  3D0I E;  1AW0 A;  1YJ9 S;  3D3C J;  4WKY A;  2XSF A;  3N01 A;  3MR5 A;  5FLX Y;  4QZV B;  3K57 A;  3HI9 A;  1RHM B;  1WHY A;  2WSC C;  4Q2M A;  3M8R A;  4MKY A;  2GHP A;  4F0M A;  1NSK L;  4JV2 A;  1MNE A;  3F41 A;  4L74 A;  1NK4 A;  4WFB Q;  2K3K A;  2V68 A;  4TLQ A;  5HBM B;  5H9E J;  5HN0 A;  2DGU A;  2KO1 A;  2DRA A;  1IUJ A;  5ETM A;  5KFA A;  4CLP A;  3P3D A;  1P9Y A;  2BKO A;  3HF5 A;  4ZN3 A;  4J9R A;  1TV6 A;  2UUC J;  2NZC A;  1DLO B;  3TW0 A;  1X8D A;  3R2D J;  2AEJ A;  4TU9 A;  1HBU A;  4FS2 A;  2PI5 A;  2ZM6 F;  2QLF B;  4ZS6 A;  1QSY A;  2I2Y A;  1NAQ A;  4V1A k;  1KQF B;  2MST A;  4OYX A;  5HP1 A;  3PKM A;  2XQC A;  2DXD A;  3W5Z A;  3QRR A;  2VU5 A;  1LXN A;  1EET B;  1RWM B;  3C6T A;  2R2T A;  5LXR A;  4QCL A;  2J7K A;  3I82 A;  3TA0 A;  4EBC A;  1RT4 A;  4JI3 J;  1H72 C;  3E3X A;  2HHW A;  3C8Y A;  1HAR A;  1T9V A;  3MR3 A;  2H4W B;  1RT4 B;  4CLZ A;  4KO0 B;  2EI5 A;  2FPH X;  2V8V A;  1TKX A;  4M95 A;  3ITH B;  1VQS A;  3TJ8 A;  2PI4 A;  1RT1 A;  1QM9 A;  2GJI A;  4RNM A;  3CT9 A;  1N48 A;  1HLW A;  3G71 S;  1R8H A;  4A8W A;  1F9F A;  3NRB A;  2V6A A;  3LF0 A;  1KFS A;  1C1B B;  1TKT A;  2W8L A;  2C2M B;  2ASD A;  3QMQ A;  4JI5 J;  1UFK A;  1KNZ A;  2V8D A;  1HNV B;  1TFW A;  3C6U B;  3TR5 A;  3S1T A;  4M5G A;  4F36 A;  4DV4 J;  4TYA A;  3KHR A;  1WC3 A;  4C8O A;  1ZM4 A;  2ATC B;  2FLO A;  2GVD A;  2LLZ A;  4NLV A;  4DBQ A;  5KFN A;  3WZ0 A;  1HL6 A;  4AXI A;  4AYB D;  1EP4 A;  1PSD A;  1F9H A;  4L72 B;  1V5V A;  1SI9 A;  4NMX A;  4DFK A;  4L73 A;  2E66 A;  3EVW A;  2LQ9 A;  5HAT A;  2OPQ A;  4WU2 A;  5EHH A;  1ZM3 A;  4KHP J;  1OMS A;  4YUD A;  1UVL A;  1M0S A;  3HT3 A;  4X62 J;  2DEJ A;  3A12 A;  3BH7 B;  3EXC X;  4ZIW A;  5JMN A;  2APO A;  1SKS A;  4KSE B;  1L3S A;  4YR0 A;  4B9T A;  2XS5 A;  2YX1 A;  5J2Q B;  2QX0 A;  3BPS P;  1JLC A;  4UQT A;  2MGZ B;  2MKY A;  3D6F B;  1X0P A;  1HQE B;  3HVA A;  2VJU A;  1FO1 A;  1TV6 B;  1NK0 A;  3NNA A;  4ED0 A;  3SBM A;  3DLG A;  5L46 A;  5KFE A;  1JIH A;  2OAU A;  4KC5 A;  4N77 A;  3VAM A;  5DDQ C;  4P7V A;  4YDD B;  3NOC A;  1HBO A;  2QL5 B;  4M5K A;  3POT A;  4FS1 A;  1R31 A;  4CLF A;  4PQU B;  1FWL A;  2C1E B;  4DV6 F;  3RR8 A;  2Z56 B;  4K2J A;  1X4C A;  5J1P A;  4J9M A;  3PW2 A;  1EHW A;  5A8W B;  4V19 X;  3IWX A;  4IFV B;  2YNF B;  2CA9 A;  4C8N A;  5J2N B;  4ILL A;  4YB5 A;  4NI2 A;  3FEZ A;  1VS3 A;  1LV5 A;  4DUY F;  4ZOS A;  2IIH A;  2ZUA A;  3D68 A;  1RKI A;  3QJL A;  4WZQ A;  3DOK B;  3RB4 A;  1XMQ F;  1NJY A;  3M6W A;  3QWP A;  3AOC A;  2GMJ A;  5CD4 H;  2WK4 A;  2BM1 A;  4QIV A;  3MPW A;  3KNA A;  4HHH A;  3ZZO A;  1KKH A;  1HBN A;  1RDR A;  1XWL A;  3KK3 A;  1FER A;  3OLB A;  3HZG A;  3MEC B;  3OR2 B;  3CPW R;  2HHH J;  2H4Y B;  3CB4 A;  3IO1 A;  5GAD U;  1QVF R;  4DV3 J;  2XNR A;  4X4N A;  2CKW A;  3NBP A;  2E5H A;  1FF2 A;  4M5L A;  4DV3 F;  1NPK A;  2VBW A;  5I4M A;  4GRS A;  1HWI A;  2V4R A;  4OZ1 A;  4ID5 A;  2LKZ A;  5DLF A;  1UA1 A;  4FVC A;  3Q23 A;  1APS A;  3HLU A;  4GVB B;  2BQU A;  2O01 C;  1Q8K A;  4D3H A;  1U47 A;  3BDP A;  2H48 B;  3BN4 A;  2O66 A;  1O0P A;  3F0N A;  3MPY A;  1WTB A;  1OWX A;  3JAM U;  3HPO A;  2CPH A;  3SYZ A;  2UUW A;  2XSJ A;  4C11 B;  2OKQ A;  4E98 A;  5SZT A;  1URN A;  1W2I A;  3ZXW A;  2XMA A;  1WC1 A;  3G86 A;  3H90 A;  3NAH A;  4USI A;  2ZH9 A;  4WYL A;  4IRD A;  3KUG A;  1C1B A;  1SC6 A;  1TKT B;  3IBF B;  3PM9 A;  2HS0 A;  1U2C A;  3D0G E;  4Z37 A;  2DNH A;  3CCS S;  2OD6 A;  1S4F A;  1VJW A;  1FDD A;  2P9G A;  2HHX A;  5CQG A;  4DV2 F;  3RTV A;  1UJ5 A;  5DG8 A;  2VB6 A;  2W7P A;  4DV7 J;  2DGQ A;  3QID A;  1HD0 A;  1YQH A;  5DET A;  3O6Q A;  4OI2 A;  2F5G A;  3J7A N;  3ENV A;  1R3N A;  1UW9 A;  3LO3 A;  5HAN A;  2CFX A;  3KLH A;  1D0E A;  2IRY A;  2J6U A;  1OIA A;  1WHX A;  2CDQ A;  4U96 A;  1D1U A;  5IQ6 A;  3VAI A;  2Y1J A;  5A76 A;  1DTT A;  5M2U A;  4F2S A;  1S0O A;  1J27 A;  1HQU A;  3EDQ B;  3TAP A;  2B6A A;  2MEW A;  4NLT A;  4N56 A;  1VQK S;  2DNL A;  1SCJ B;  2V5H G;  4XPE A;  3I96 A;  3JTP A;  2KFY A;  2PD1 A;  1CQN A;  3VAJ A;  1KEK A;  1FDB A;  3B6B A;  1ZPV A;  3IS9 A;  1Q79 A;  1V6H A;  3HJV A;  2FY8 A;  1TL1 B;  3AXK A;  3GLJ A;  3EWG A;  2LCW A;  4LRA A;  4N7T A;  3ZZP A;  4D3G A;  2OFG X;  2F8H A;  3CD7 A;  3BBF A;  2CJY B;  3T1H F;  4AXJ A;  2B4O A;  4ECX A;  4ES1 A;  4URQ U;  1RUS A;  4KHR A;  2KHC A;  3FQL A;  4OZ2 A;  4PXE A;  3FC9 A;  4QWA A;  2CXE A;  1I5O B;  5HK4 A;  4X65 J;  4B3R J;  2DO0 A;  4QR1 A;  2UVR A;  4DL2 A;  1TVR A;  2AJ1 A;  4OYO A;  2CQD A;  3G6E S;  2VH7 A;  3F56 A;  3D67 A;  3T5K A;  3MAH A;  1IKV B;  5ETS A;  4RW8 B;  1W7W A;  2XG8 A;  3ZC4 A;  3OV7 A;  4KRW A;  4QR2 A;  1CSJ A;  3BF4 A;  4K8R A;  1HNI A;  3D2W A;  4LSL B;  2EFG A;  4KV8 A;  3GTY X;  2ATL A;  1Q82 T;  5FLX U;  4ZP6 A;  1OQ3 A;  4DQQ A;  4ELT A;  4A4J A;  4DR4 F;  2ZBP A;  3G87 A;  3LGH A;  4I4B A;  1S1X B;  1UVN A;  4RJV A;  3AA9 A;  4EGL A;  2W8K A;  3Q83 A;  3PVX A;  3CXC R;  2Q1L A;  4LF9 J;  3KJQ B;  3MGJ A;  3MPV A;  5J2Q A;  4ED3 A;  3C16 A;  1HMV A;  4G1Q B;  3H4B A;  1U45 A;  2HW3 A;  1EZZ B;  2HEK A;  4MIB A;  4LVO P;  3PCO B;  4C8K A;  1VK8 A;  3FJ2 A;  2WBR A;  1IJE B;  2B43 A;  2LU1 A;  3DNC A;  3PJ9 A;  1T3O A;  4ZVP B;  1FJ7 A;  1CJV A;  1X5S A;  4DN0 A;  4LR8 A;  2CG4 A;  1XBW A;  1NRK A;  2W4D A;  4M63 A;  3DFE A;  3I0R A;  4HT5 A;  5MLC V;  1SKR A;  3GMG A;  2XS2 A;  1YBA A;  3BH6 B;  2HNZ B;  1IWG A;  2YNI A;  1JLF A;  4OYI A;  4DJB A;  2W4C A;  1DQA A;  4QIF A;  3WDO A;  1F5A A;  2ZM6 J;  3V4I A;  1RYS A;  2HNY B;  1NO8 A;  2FLP A;  3CDU A;  2YNI B;  2W24 A;  2BQR A;  2UVW A;  4K4U A;  2DD8 S;  2IFX A;  2MKH A;  4IG0 A;  1GX6 A;  3VVU A;  2W25 A;  2CDR B;  3MMC B;  5K14 B;  2BR0 A;  5KFJ A;  4KFB B;  3PXG a;  4F4W A;  4RNH A;  3KXD A;  5GMK a;  1NK7 A;  3HHL C;  1SC3 B;  1S4E A;  2BJ9 A;  2XZT B;  1R0B G;  3H98 A;  3U1M A;  4J9K A;  2EK6 A;  2ADB A;  2M70 A;  3C46 A;  3SZ2 A;  2HS3 A;  4F8R A;  3PJX A;  3FEX B;  2HRY A;  1SC1 B;  1X5P A;  2P5V A;  4DMZ A;  1WG5 A;  3M8Q B;  3CF5 Q;  2FC8 A;  4F0K A;  4P2F A;  1N8R T;  2Q66 A;  1S7I A;  5L9N A;  5M2P A;  5K20 B;  1F2G A;  1FFW B;  1GT8 A;  3DOL A;  3I5B A;  5HQL A;  3G8T A;  2W2O P;  5F8J A;  1Y00 A;  5CAA A;  2F1F A;  2Q43 A;  1B7Y B;  3CCE S;  4ECY A;  1H73 A;  4QU7 A;  3CJ0 A;  4IO9 Q;  2ZVS A;  1SVD A;  4P2S A;  3OQ2 A;  2YVS A;  2PMZ D;  3BN7 A;  2PA8 D;  4LQ9 A;  1T11 A;  4BHQ A;  1C0T A;  2RB7 A;  3VR1 A;  4DR3 J;  3ICL A;  4FF1 A;  2PE8 A;  1S6P A;  1VOM A;  2YWH A;  3FVY A;  1L3V A;  4U95 A;  4C4W A;  4HLB A;  3ZTO A;  1FRI A;  3Q89 A;  1PG5 B;  3DRP B;  5K9F A;  1HWJ A;  4UY8 T;  3GG1 A;  2VBX A;  4LMZ A;  3ETO A;  2HK3 A;  5KT6 A;  1EAY C;  2ZDP A;  2NUU G;  2QSW A;  5FDL A;  4CO5 A;  1KQG B;  2YNH B;  2KYZ A;  1G2E A;  1FNO A;  2H3E B;  2A2D A;  3T19 A;  3TZW A;  4ATN A;  2HFN A;  4DSI A;  2RU3 A;  1VIS A;  1E6Y B;  4OHX A;  2QIF A;  2AYE A;  2GGP B;  2PC6 A;  4FXV A;  5HVH A;  4X66 F;  1RTI A;  1Z2L A;  1FKO B;  2F9D A;  3MF5 A;  5E3A A;  3PEJ A;  3QGH A;  1S1W A;  1H98 A;  1FTR A;  2VPY B;  2FZG B;  1IKX A;  2DEI A;  2DGT A;  2GGP A;  3DLH A;  3PYF A;  1HNZ F;  1DTQ B;  2HGM A;  2D74 B;  3AJ2 A;  3M8Y A;  4WBF A;  1F60 B;  1RHJ B;  2CJA A;  3BS9 A;  3Q8U A;  4PYA A;  2HZV A;  3IWL A;  4B9N A;  4ELV A;  4F3O A;  4PAA A;  3R2C J;  2GA7 A;  2H5I B;  4OYM A;  2KXN B;  1K8A T;  3PV8 A;  3VGS A;  2VA2 A;  1LK7 A;  2XMJ A;  5BXI A;  2ILY A;  4NLD A;  1VBZ A;  1Y7P A;  2V4J A;  2VOD A;  3MEG A;  3VGU A;  1BQX A;  3MCN A;  4B02 A;  4CZC A;  2XMW A;  2AKW B;  3B78 A;  3K7R A;  5B0C A;  1H3D A;  5A6W A;  3RRK A;  4F2R A;  1KQK A;  2DNG A;  4R0E A;  2R7U A;  3MMC A;  2OIH A;  2EXU A;  2UU9 J;  3LP0 A;  3NMA A;  1NK8 A;  1PC4 A;  2XMT A;  3MEE B;  3WIV A;  4EK2 A;  3R7S B;  5EWE A;  2DGO A;  4NLP A;  1CVJ A;  3D6M B;  2HNY A;  2RIL A;  3D0H E;  5HJX A;  2AEF A;  4BWJ A;  4DPY A;  1MU2 A;  3RGI A;  1D9F A;  3MEE A;  3KJV B;  2N82 B;  3MM9 B;  3MMA B;  1H7W A;  3H2U B;  3MED B;  4OZ3 A;  1HYS A;  4GC6 A;  2F3J A;  2KG1 A;  2UUT A;  2XSJ B;  4MFB B;  1M5P C;  2H54 B;  3CME S;  3BR9 A;  3CJ8 A;  1CS4 B;  2EK1 A;  1WOR A;  4BCA A;  4DR2 F;  2KKH A;  1FES A;  2HIQ A;  2FIU A;  3AB4 B;  3KFW X;  2QJ3 A;  5T7L A;  1RCO B;  2OPR B;  4RNF A;  1UTA A;  3GFX A;  2BA9 A;  5HVF A;  4C8M A;  1W2B R;  2A2C A;  4K4W A;  2HFO A;  1UW4 A;  2BDP A;  2B9E A;  5J1E A;  3J81 U;  3HCX A;  2LEC A;  1X4A A;  1M5H A;  4I6W A;  2BRK A;  4R8U B;  2Y8W A;  1WC0 A;  1XNQ F;  2EFV A;  2QA1 A;  3E8O A;  4IYQ A;  5G0R B;  3SCK E;  4DU8 A;  3W2W A;  2ZIT A;  1FE4 A;  3ELH A;  2Z2L A;  3FGV A;  3KHH A;  1JLQ A;  4OHZ A;  2L48 A;  2PA3 A;  1TKZ A;  4X4T A;  2IC3 B;  3TYT A;  1D9A A;  3Q8Y A;  4IQM A;  1MSW D;  3PW4 A;  2CZ4 A;  3KHG A;  2JDJ A;  2QV6 A;  3JTN A;  2WB1 D;  4FNI A;  4F3M A;  1YSJ A;  4JB8 B;  1HNI B;  2E5G A;  3GG0 A;  4RW6 A;  2AT1 B;  3NGK A;  5C24 B;  3NEK A;  2KM8 B;  1YJU A;  2OJ3 A;  3T9N A;  4HH0 A;  3C19 A;  3T6J A;  5IT4 A;  3SQG A;  4FF3 A;  1MML A;  2PFD A;  1E6V B;  1DHM A;  4ES2 A;  2HMI B;  1NK5 A;  3J7A 1;  3DRR A;  1TEL A;  4B3M J;  2V69 A;  2KHD A;  4RUB A;  5B0D A;  4R5P A;  2W9B A;  5GAG U;  1T05 B;  3TUJ C;  2HBQ B;  1NJX A;  2IBK A;  3M2R B;  5B0A A;  2RD5 C;  4WU3 A;  1FXL A;  2UXC F;  4WIQ A;  3W9J A;  3RBZ A;  2UP1 A;  4O4G B;  2MGZ A;  1KSP A;  2QC3 A;  4DV5 J;  1T8E A;  3MTK A;  2IHR 1;  4FYW B;  2RDJ A;  1FJE B;  1S9E B;  3IS9 B;  4PCQ A;  5DO2 A;  3VAG A;  2LEA A;  1CEZ A;  3Q24 A;  2PEH A;  3MR7 A;  1Q78 A;  4H4O B;  1RWV B;  3A3P B;  2COL A;  2G2Y A;  3TUZ C;  1DFD A;  2XM3 A;  2Z2Z A;  4Y28 C;  2RDD A;  2C2E A;  2I8E A;  3U27 A;  3R5B A;  2I6W A;  5LSL A;  4RW6 B;  1R0C B;  1KLM A;  3WC0 A;  4DL5 A;  3VF0 B;  4RUC A;  1NHV A;  1S49 A;  1LOU A;  1QD1 A;  2M52 A;  2OML A;  2FYX A;  4DV0 J;  1QSL A;  4JOU A;  1CJU B;  3CC7 S;  2DH9 A;  2QG9 B;  4FYD A;  4DCP B;  4OYP A;  5JUM A;  1TL5 A;  3CDA A;  3OVA A;  2VKZ G;  3FSX A;  3LTO A;  2BE2 B;  2ZH4 A;  3WHI A;  1NJZ A;  4LF8 J;  3MOJ B;  2BOA A;  2IM2 A;  1IKY B;  4PWU A;  1RT1 B;  3A4T A;  4QYR A;  3UDC A;  1WNE A;  4DR1 J;  5JJB A;  4DUZ F;  2HIY A;  2V4Q A;  3OLA A;  4FBT A;  3JXO A;  3FNN A;  4ZVR B;  2JEG A;  2RQ4 A;  1S5Z A;  3WC2 A;  2V9W A;  1FJG F;  2DBB A;  4ZVG A;  3EGV A;  4ED4 A;  2D69 A;  3H59 A;  2JVR A;  3N9U C;  4OLO A;  4USJ C;  3ZZY A;  1L3T A;  3W66 A;  3TJ9 A;  2JX2 A;  5K14 A;  1LWE B;  3QFH A;  1GMW A;  2HQF A;  4CWB A;  2IMW P;  1S76 D;  3IR7 B;  2EFO A;  2JLE A;  3HX9 A;  1F9E B;  4KH0 B;  3PIO Q;  3DLL Q;  3W8P A;  4MH8 A;  4YOE A;  2W7A A;  1YTY A;  4UF4 A;  2R8H A;  1N0U A;  1WHW A;  2C3P A;  3ZTQ A;  2F4V J;  3FKB A;  1W25 A;  2RDI A;  3PX4 A;  1X0F A;  1X9S A;  2FHO B;  3QJJ A;  2VPX B;  5HQ8 A;  5LMN J;  4RW8 A;  4HT7 A;  2DHS A;  3FEY B;  2DIT A;  2AZ3 A;  2J0W A;  4RUH A;  5A8W A;  2EC0 A;  4HH1 A;  4IH7 A;  1DBD A;  3AH6 A;  1VGY A;  4MAK A;  4DS5 A;  3FK4 A;  3UN3 A;  4KGM A;  4JI8 J;  3RB0 A;  1D3W A;  2VG6 B;  4O3R A;  4K4Z A;  1FCA A;  3OFH A;  5A0Y A;  4X4V A;  1YJV A;  5F41 A;  2PDA A;  4Y3C A;  4Y0F A;  3CJK B;  1FDN A;  2M0G B;  3DU6 A;  2WVD A;  3KLE A;  4DV1 J;  4B9M A;  4F4X A;  4P72 A;  3QWU A;  4ZPA A;  2IAJ B;  3RYL A;  2VOO A;  4F26 A;  5F3T A;  3OHB A;  2WCX A;  4MKB A;  3C14 B;  1BD6 A;  4P73 A;  3TI0 A;  1PAE X;  3TAM B;  4YQW A;  5HBM A;  4B3T F;  1WDD A;  4UQG A;  1RAD B;  1ELO A;  2D1C A;  2IDE A;  3K8V A;  4LSL A;  1LW0 A;  1F3V A;  1UZD A;  4V19 J;  3IAS 9;  1K0V A;  2JNJ A;  2XGP A;  3IR6 B;  4ID8 A;  1RWW B;  1XJW B;  2IYI A;  3O8W A;  5IS2 A;  5KFF A;  4YR3 A;  3HFK A;  1L5U A;  4FYX B;  4LF5 J;  2EC2 A;  2V9K A;  2CPF A;  3TZY A;  2AF6 A;  3TAR A;  1EP4 B;  3EZU A;  3M05 A;  5IQQ A;  4LQ3 A;  4B3S J;  2G4B A;  1Y3J A;  4JUZ A;  5DDR C;  2MQQ A;  1HR0 J;  2XI3 A;  1FXD A;  5ETR A;  4K2X A;  5JVH Q;  5A8K B;  3UVJ B;  4ETZ A;  2GNK A;  2BAC A;  1V9O A;  2HFZ A;  1TL7 A;  1G3O A;  1WF1 A;  4KYZ A;  1RZM A;  4F7V A;  2QN6 B;  3ZNU A;  3UN2 A;  2QT7 A;  3SSQ A;  2P6S A;  1U7L A;  5CHC B;  1S6O A;  2UXD F;  1RTZ A;  1SL2 A;  3V4M A;  2CWK A;  1N6Q A;  1RLD A;  4Q43 A;  2MZS A;  2QE5 A;  1FK9 A;  4X4S A;  4ANE A;  3E01 B;  3GZ7 A;  3DGV A;  3ITH A;  4CRJ A;  1FRH A;  4L6V 3;  5J1E B;  3GR0 A;  4J91 A;  3RAQ A;  4OZL A;  2J0X A;  4I7F B;  4F67 A;  3MOZ A;  3NGU A;  1R43 A;  1BE4 A;  2OEL A;  4LVN P;  1UEU A;  2FC9 A;  5T7L B;  3BSN A;  1IM4 A;  2AEM A;  2RUG A;  2L9W A;  1RTD B;  3OL9 A;  1WC5 A;  3R3T A;  3LAK A;  5K8O A;  4OI0 A;  4HHU A;  1N34 F;  3D9B A;  5KG7 A;  1CUL A;  1KFD A;  1LWX A;  2ZH1 A;  2NSB A;  1EAR A;  2FJW A;  2DNZ A;  2RML A;  2H5E A;  2ZBC A;  3DRY A;  4XTT A;  2VQE F;  3N6L A;  4NXM J;  3GCX P;  4RWW A;  3AD8 C;  1WKL A;  2W2N P;  3CED A;  1C0U A;  1DRZ A;  2O3D A;  3CDB A;  2XO6 A;  1FT8 A;  2FGC A;  2HS4 A;  4ILR A;  4DFP A;  5B08 A;  2CPY A;  2UXD J;  4NA1 A;  4O3S A;  2V2V A;  2CJQ A;  4I64 A;  1VIO A;  1WEX A;  3ZZT A;  1J5E J;  3S8S A;  4X64 J;  1U1L A;  2MB0 B;  2Y3Y A;  3UE2 A;  2OHD A;  4Y2M A;  3M2U B;  4GKJ J;  2N3O A;  4O0I A;  3OSP A;  2HRT A;  1XIQ A;  2XBP A;  3GJT B;  5KOW A;  4OX9 F;  4N47 A;  2YX4 A;  4WP3 A;  1VQ9 S;  3LQV A;  4DX8 H;  2GFF A;  1X4F A;  2IVF B;  4F4K A;  4A47 A;  3PKY A;  2IRU A;  2C3O A;  1FKP A;  2PT0 A;  3M2V A;  3THV A;  1S12 A;  3Q8Q B;  2CQH A;  1K0T A;  1FNX H;  2IDL A;  1QE1 B;  4RBU A;  1QLN A;  2ZH7 A;  2FLN A;  1HPZ B;  2JLF A;  4RW4 A;  3TO8 A;  5LMN F;  1U1R A;  4FXW A;  1IBL J;  5LSO A;  4QOT A;  2M5Y A;  4OMF G;  1OY8 A;  1RHK B;  1T05 A;  1S0M A;  1SH0 A;  2AGQ A;  2A0F B;  4NA3 A;  1A9N B;  4J9V A;  3KLG A;  2HMI A;  3CDE A;  1T94 A;  2MXY A;  5J2N A;  1HFE L;  1BQN A;  7FDR A;  1WG4 A;  1JLB B;  1T9Y A;  2OPP B;  4AD6 A;  2EFN A;  3W1Y C;  4JI8 F;  1C4A A;  1TP7 A;  1B99 A;  3ILL A;  4PQU A;  2XY6 A;  2HND A;  3HHL D;  4NZ7 A;  1KLN A;  4C8Y A;  4EFA C;  1R0A B;  1AFJ A;  5KFO A;  3DMJ B;  3OFE A;  3MMJ A;  4Q2L A;  4U7U D;  2DNY A;  2E1M C;  5CH7 B;  1N36 F;  4XAK A;  2VBZ A;  4KPC A;  1B7F A;  4EUV A;  4JI1 J;  1RSC A;  3MR2 A;  3CJK A;  3V6D A;  4Q8F A;  3C2P A;  1JK9 B;  2ERR A;  1LWE A;  1XMO J;  1X9M A;  2HSE B;  1FRL A;  4F50 A;  1ZET A;  5I3U A;  1PJ6 A;  5AT1 B;  4JI5 F;  2B6A B;  1RT2 B;  5BJR A;  4I2P A;  1HHQ A;  3G9C A;  2K7K A;  1IBK F;  5KFD A;  3UCU P;  4LR9 A;  1S72 S;  3FFI B;  3EGZ A;  1RLC L;  2DRD A;  2H9Z A;  2P2C B;  3GE9 A;  3IAM 9;  3HHD A;  3Q8P B;  8RUC A;  1PIL A;  4OHW A;  1VRQ C;  3GB0 A;  4I2Q A;  3G6V A;  2HBY B;  1FA0 A;  3UW1 A;  1S1V B;  3MED A;  2ZH8 A;  1NDC A;  5D0H A;  4ZPC A;  3NS5 A;  3JSY A;  3R5J B;  3N28 A;  2CQ2 A;  4KGZ B;  2HFU A;  4GC7 A;  2ROG A;  3P5T L;  4KGX B;  1S79 A;  1OS5 A;  4IRK A;  3DU5 A;  2RIJ A;  1SH2 A;  5SUH A;  5J2M A;  4N41 A;  3RW6 A;  2R7V A;  5KFV A;  4OV6 A;  3HMJ G;  1N5Y A;  3K59 A;  1AT1 B;  2Q6C A;  4H4K C;  3HKW A;  5U47 A;  3MFH A;  3M9N B;  1WC4 A;  4LFC J;  4JI7 J;  4JI1 F;  2RHQ B;  3NOG A;  4FF2 A;  2Y8Y A;  1RBO B;  1UEK A;  1S6U A;  2HBR B;  2V50 A;  2W9A A;  1NB2 A;  3T41 A;  3DLK B;  1BWV A;  1KP6 A;  2ACY A;  2BEF A;  3DC2 A;  3J7Y U;  4ECT A;  4PG6 A;  4CQ1 A;  3HVT A;  3K5L A;  3OVB A;  1FRM A;  1LW0 B;  3GWC A;  1M5S A;  2QFJ A;  2B9X A;  4LFA F;  3D1Q A;  2B4P A;  3DHX A;  4KJI A;  4WP9 A;  1UVM A;  3I4H X;  3T3F A;  1BQM A;  4JI2 F;  3HVR A;  4IR9 A;  1IKY A;  2WRM A;  4ZJL A;  4FPI A;  4O23 A;  4XPC A;  3Q86 A;  5ITH A;  1RA6 A;  4LFA J;  3H5Y A;  2JFK A;  2WHO A;  4GKJ F;  2IBO A;  2E9R X;  5L9X A;  4X2B A;  4KKO B;  2D3O R;  2KYX A;  3M1V B;  3W7B A;  1ULR A;  3GPA A;  4HYK A;  1JJ4 A;  2C2O B;  5CYM B;  1JB0 C;  1UP1 A;  2HND B;  2E5I A;  2YKA A;  2BJE A;  1WWH A;  2BKP A;  4DV5 F;  5D3G B;  3M6X A;  1PAU B;  1PC5 A;  3DRX A;  1OSC A;  4MKA A;  1AA1 B;  4OI4 A;  2CPJ A;  3HP6 A;  2V4J B;  2KB2 A;  5A2Q Y;  3N5B A;  2YKM B;  1SUQ B;  4LRB A;  3MDF A;  1UVK A;  5GAH U;  1S9F A;  1CQM A;  5E2Q A;  4CH7 A;  3PX6 A;  3TQE A;  2C3Y A;  2HFV A;  1U1K A;  2LA6 A;  3TRG A;  1UWB B;  5I3P A;  4USK A;  2QLJ B;  3V6J A;  2U2F A;  1WKJ A;  2VAS A;  5C7P A;  3KG0 A;  4F4A A;  1T03 A;  1DUR A;  3TWZ A;  1IKX B;  2E1P A;  1NH8 A;  2HKE A;  3OFF A;  2BW7 A;  1WJ9 A;  3BGO P;  3J7Y I;  4JYA F;  2CAD A;  2BJD A;  2OO4 A;  3U1L A;  2L41 A;  3I31 A;  5G0R A;  2AMC B;  2H65 B;  2B4U A;  4LBH A;  2HVI A;  1BQM B;  2B8P A;  4ALZ A;  1KTQ A;  4DCO B;  2QA2 A;  4DR2 J;  1F0X A;  5H9F J;  3CSK A;  2C42 A;  1VRU B;  3RUB L;  3EX7 B;  1X5O A;  2C2D A;  3R5G A;  2XTJ P;  3DOM A;  1RWN B;  2CWX A;  4TN2 A;  2WOM B;  1H74 A;  2GC8 A;  2D7S A;  2CQ3 A;  3QNW B;  3AQP A;  1FRJ A;  3OXF A;  5K8N A;  4F0H A;  5C42 B;  3VGT A;  3VQS A;  4CTA A;  5KOX A;  2C2N A;  4JBC A;  1N52 B;  2MZQ A;  2D3U A;  3PYE A;  4Z2X A;  3NNH A;  3BRE A;  1GTH A;  2ZC4 A;  3M6V A;  3WQP A;  4LF6 J;  1CJT A;  1HW9 A;  3EPG A;  4DSF A;  4ZCK A;  1AZS A;  1S1T A;  2YBV A;  2HVD A;  3RRG A;  3TNV A;  1WOP A;  4TKT A;  2XB2 D;  2NPI A;  3BJY A;  2RRA A;  3PTW A;  1PBU A;  1HI8 A;  4LF7 J;  3NCR A;  4OL8 A;  2HNZ A;  3K5P A;  2E1C A;  3EMT A;  4R8U A;  5FJ4 A;  4C11 A;  4LRC A;  3CIM A;  4PWD B;  1JXE A;  2BE7 D;  1NPP A;  1H7X A;  1T9U A;  2GCF A;  1VLY A;  1M1G A;  3MAA A;  3DLB A;  2JVO A;  3S01 A;  2QMU B;  4QW9 A;  2DGV A;  2R8G A;  1RTH A;  2PEB A;  1RYR A;  2I38 A;  3BSA A;  1VR6 A;  1PYO B;  2L9D A;  4P71 A;  1VQ4 S;  2FDN A;  4X4O A;  2ALY B;  1NZ8 A;  3MWB A;  4KR0 B;  2CQ4 A;  2V8G A;  3D28 A;  4RO0 A;  1UPM B;  1J5O B;  5EWF A;  3IWN C;  3DLE A;  2JL9 A;  1B0T A;  1R89 A;  2JFD A;  3G4S S;  2KVI A;  2CPI A;  4Z7C A;  3PZP A;  4WXW A;  3B82 A;  4AQY F;  2LEB A;  2HHT A;  4I67 A;  2V34 A;  4KBI A;  1T9T A;  5D4N A;  3W9H A;  2R7W A;  1PGZ A;  4M94 A;  3PRB A;  1HI0 P;  3DOK A;  1RAA B;  3I0R B;  4ZP9 A;  3HSD A;  2EKY A;  3QT7 A;  4LT6 A;  1JXL A;  1AXQ A;  2ZEJ A;  2G2Z A;  4J9L A;  1WHV A;  4UZB A;  5D78 A;  3CJ2 A;  4CLK A;  3JYT A;  3J81 j;  4DR3 F;  2J9D E;  2MJU A;  6FDR A;  3PW7 A;  3FBC A;  5DGA A;  4UOC A;  1GH8 A;  5AE3 A;  2PII A;  2ADC A;  1YVF A;  2W2M P;  2M8D B;  3KLI A;  1RQ0 A;  3D5M A;  2HRU A;  3OFG A;  4ICL B;  4OLP A;  5EGY A;  3FSI A;  3IM9 A;  3FBF A;  3BGU A;  2KT3 A;  2RU9 A;  3DLG B;  2AIR B;  2RF2 A;  1Y4Z B;  3D6H B;  4WII A;  1SJ1 A;  2CQ1 A;  2LQB A;  4YEA A;  4U7U K;  2AJ4 A;  1HW8 A;  3AOA A;  2AU0 A;  1JLQ B;  1G7C B;  1S9G B;  2ZOM A;  2CNK B;  1NDL A;  3A3O B;  4BWM A;  3PW0 A;  2NR0 A;  1XNR F;  2A6O A;  2ZNY A;  3NGD A;  2W2Q P;  4YDX A;  5RUB A;  5BYQ A;  5D8H B;  5F9L A;  4EWT A;  3A8J A;  4ZIV A;  4ZPB A;  3UO0 A;  3T1Y J;  2WSE C;  3C15 B;  1YWX A;  2GMH A;  5IT0 A;  1Q5Y A;  1BGX T;  1WSR A;  3OUY B;  4F4Y A;  2WB4 A;  4CO2 A;  3K89 A;  1QAI A;  3HVW A;  2DGW A;  1Y5I B;  2MKI A;  5LJ5 Y;  4XO0 A;  1NDK A;  5EDW A;  1X9W A;  1T7P A;  3T1A A;  2BBE A;  3DYA B;  4NLG A;  1KRP A;  1RU2 A;  1X7V A;  1OSD A;  2L3M A;  2KVQ E;  3M30 B;  2F7V A;  4NYP A;  5ETQ A;  5LMU F;  4ED5 A;  1YRT A;  4H4M B;  5D6G A;  1B64 A;  2HVH A;  1UVJ A;  4C7Q A;  1S7H A;  4FVM A;  3D1O A;  4IG0 B;  5C2C A;  1ZS6 A;  3LOU A;  4ZIT A;  5B0E A;  4DZD A;  2RT3 A;  3QT6 A;  4OI1 A;  1X4G A;  2DY9 A;  5ETL A;  4H54 A;  5KG1 A;  5HQM A;  3OJU A;  1HBM B;  5IV4 A;  3Q2T C;  2DIU A;  1CJT B;  1NSQ A;  4FN5 A;  2EEY A;  2I5J A;  3KJF B;  4I2Q B;  1PKU A;  1VJQ A;  5CCL A;  3IBC B;  2LQJ A;  2VKR A;  4IH6 A;  3D6T B;  3FUY A;  1HQ2 A;  1CJV B;  2ZOF A;  1GK8 A;  2VQF J;  1KOH A;  1IR0 A;  4I0W A;  4PPD A;  3DLK A;  3MAQ A;  2YWW A;  1MMN A;  5IC4 B;  5KG3 A;  1RT2 A;  3UCG A;  3OL7 A;  2V67 A;  3MAA B;  3ENW A;  1WF2 A;  2XMM A;  1NM2 A;  2VV5 A;  4DV1 F;  4F04 B;  1NK6 A;  4ZHR B;  3QLH B;  4P74 A;  4QU6 A;  3GJQ B;  1FX2 A;  5IM0 B;  2FVC A;  3CCW A;  5D4L A;  2FD2 A;  5E0O A;  4A8O A;  3IN5 A;  1HBU B;  2I1R A;  2MQ8 A;  1PCA A;  3H42 A;  1HHT P;  2G1H A;  3N4W A;  2FJE B;  3T9Z A;  4C3K A;  2FLL A;  2ZZM A;  3LAL A;  1S97 A;  3KUE A;  3O1L A;  3C3L A;  3PFO A;  2XYH B;  1LW2 A;  2BE9 B;  4U6P A;  3EVM A;  4B08 A;  4ZMM A;  1AUD A;  1QAX A;  2RSQ A;  3BDE A;  1VQ5 S;  4DPW A;  2ZZT A;  5EN1 A;  3DI6 B;  3PYD A;  2YNH A;  3CC2 S;  4TY9 A;  2K2P A;  3R9L A;  2OPP A;  2CNO B;  3Q8V A;  2F4V F;  2B7C B;  2GJ2 A;  1SBR A;  3LGN A;  2IVY A;  1AYE A;  5CAB A;  3AOD A;  3IBW A;  3J80 U;  2C2K B;  1I94 F;  1CJK A;  3I5C A;  2DIS A;  1VRU A;  1QTN B;  4ZVE A;  2P6T A;  3U02 A;  2RAQ A;  2M8H A;  5CYM A;  5KAK A;  2VD3 A;  3RAM A;  1M1H A;  5DDO C;  5KFZ A;  1VI7 A;  7FD1 A;  5L1I A;  1DTQ A;  1VQY A;  3HFZ B;  1B3T A;  1FD8 A;  3OT9 A;  3V6D B;  4AUK A;  2BKN A;  3BV8 A;  1P8G A;  1WF0 A;  1MWZ A;  1S9G A;  2RJZ A;  2YWK A;  3EUN A;  4O0N A;  2YWG A;  1Q53 A;  3DCA A;  4DPO A;  5M2R A;  3CCZ A;  3M9M B;  2UUA F;  4LRF A;  2RKI B;  2KZZ A;  2HQ3 A;  3HHN B;  5AJ3 F;  3JTO A;  4IG3 A;  2VFR A;  4DG1 B;  4LF2 A;  4ZVH A;  4EBD A;  3T1H J;  3EGN A;  3R6G B;  3TA1 A;  3UI3 A;  3HJF A;  1GMV A;  3MHY A;  4NI2 B;  1HQU B;  1MN9 A;  1SUQ A;  2J9E A;  3SDE A;  4BS2 A;  3I9Z A;  1L3K A;  3OTO J;  1T9X A;  3QJP A;  5F8H A;  1BQN B;  2IRX A;  5KFL A;  5IWA J;  4RNO A;  2DHX A;  1JJC B;  1VBY A;  1KVI A;  2VDH A;  5I3Q A;  3VV2 B;  1I3O B;  5DZ6 A;  4ZJO A;  3DHW C;  3VWS A;  2B7B B;  2JJ4 D;  3V6K A;  5IWA F;  4F3Q A;  2PN6 A;  3M8S A;  2WVC A;  4JV5 J;  1RTJ B;  2JZ5 A;  3CD0 A;  3G82 B;  3VVT A;  2XEX A;  5J2P B;  3MM5 B;  1SC4 B;  4WTY A;  5K5M A;  3NMR A;  2JOQ A;  2EFP A;  2HUR A;  4DV7 F;  4DLG A;  2VFT A;  1RGV A;  1KWM A;  1FHT A;  3FSY A;  2GHW A;  3JSM B;  3BQ0 A;  3IGV A;  5ETO A;  4FKY A;  3HK2 A;  1SL1 A;  1JLE A;  4X84 A;  3CW2 C;  5AE1 A;  3ZTP A;  4NEY A;  4RPF A;  1WEL A;  2QO3 A;  2XYG B;  5IV3 A;  2AX1 A;  3DRS B;  2V0N A;  3OD2 A;  2HHH F;  3HM9 A;  2Z2Y B;  2YQ0 A;  4ID5 B;  1SJF A;  1RT3 A;  4QYZ K;  1VRT B;  2KJV A;  4UY8 5;  2HQG A;  2J76 E;  3NCQ A;  4PWD A;  3OTD A;  2UXC J;  1VC5 A;  4DR4 J;  4B17 A;  2J0Q D;  3HO1 A;  4ZVU B;  1HMV B;  2GQQ A;  2MPU A;  4DL3 A;  1YX2 A;  3LUY A;  5ETP A;  5KG6 A;  2VOP A;  1YKW A;  5KG4 A;  4CNZ A;  4B3O B;  2HBZ B;  2XWX A;  1Z1Z A;  1DLO A;  3MCS A;  4WFY A;  1GNK A;  3BGL A;  4J90 A;  2R8K A;  4P7T A;  1YJR A;  1SB6 A;  4Q45 A;  2LA4 A;  4L76 A;  2RHS B;  4KV8 B;  1TQL A;  2LQ8 A;  2Z0G A;  5KFK A;  5F8L A;  5C42 A;  4NRT A;  4RU2 A;  5CZX A;  3KMS A;  1U2F A;  1NXI A;  3FMW A;  1K44 A;  2B8Q A;  3ONQ A;  2OTL S;  3QRQ A;  3KLF A;  1SPB P;  2DIV A;  2LMI A;  2QFI A;  3CCT A;  2N3L A;  4NA2 A;  4PXC A;  4DFM A;  3SDE B;  5KFM A;  5DM7 Q;  1JJ2 R;  1IBM F;  2J7W A;  1D8Z A;  2OPS A;  2ZBR A;  4AFF A;  2POK A;  2RRB A;  3KTQ A;  4JV5 F;  3M1V A;  4PXB A;  1NHK L;  3G6X A;  2XMK A;  4KHP F;  1Q7Y T;  2GW8 A;  1JLA B;  1ACM B;  4ED6 A;  2DH8 A;  5LT5 A;  4E2F B;  2QEX S;  2G9O A;  2YKO A;  2DO4 A;  2MQL A;  1IJF B;  3CDW A;  1TL7 B;  2YQ3 A;  3IMQ J;  3M2V B;  4MYT A;  4U67 Q;  4CH1 A;  4DL4 A;  4YY3 F;  2AYM A;  2EVZ A;  3LP1 A;  4Q0B A;  3PFE A;  3ZTS A;  3AAW B;  5KTQ A;  1BLU A;  3CCU S;  2J0S D;  2MLX A;  1REV B;  5IFM A;  2B9Y A;  2I0X A;  2MTL A;  1XTZ A;  4G1I A;  3GJR B;  1PYT A;  3QO9 B;  4G3I A;  3NWR A;  4ER8 A;  3N79 A;  3TUP A;  4FF4 A;  1REV A;  1PYS B;  4HI2 A;  4P2X A;  3H40 A;  1X4B A;  2HAF A;  3GJS B;  3P5B P;  1XK8 A;  3R1L A;  3DI6 A;  3LH2 S;  4QR0 A;  2ZVI A;  1VQ7 S;  3H4D A;  1N5Y B;  4OI3 A;  5CZV A;  2YH0 A;  1HHS A;  2IPO B;  4KKO A;  1NKB A;  4LFB F;  1K9M T;  1UAW A;  4C97 A;  2DNQ A;  3L09 A;  1P1T A;  3LA0 A;  3QPI A;  3C66 A;  4DL7 A;  4HEA 9;  3MM8 B;  5IM0 A;  5LJ3 Y;  3GCW P;  3PRV A;  3QIP A;  1FEE A;  1KON A;  1G4C A;  2BMB A;  3SXL A;  3A8E A;  4CLL A;  2UV8 A;  2A10 A;  3PRD A;  4PUO A;  4IO1 A;  4KH1 B;  5D77 A;  3F44 A;  2KU7 A;  2E1A A;  1RT5 A;  2J5A A;  5E3R A;  1IKW B;  3J7Z T;  1YIJ S;  4ZCI A;  3HT0 A;  4DR6 F;  1SJR A;  4MYU A;  4WPA A;  2DCL A;  3QBC A;  4DDF A;  4YHH J;  4BLG A;  3K5N A;  2LYV A;  2LU2 A;  3ISN D;  2HHP A;  1RHQ B;  3C6T B;  3QZ8 A;  2KTQ A;  1CLF A;  2EBG A;  1FI4 A;  2KJW A;  4K5S A;  2FVR A;  1HYS B;  4F25 A;  2NSC A;  5C25 B;  3CVK A;  2ZWP A;  1V3R A;  4QBU A;  1N5V A;  3BYP A;  3OSN A;  2PSZ A;  3UQS A;  3I56 S;  4BDP A;  2MKK A;  4KPY A;  4NYZ A;  4B3O A;  2GIQ A;  3UR0 A;  3G82 A;  3V4I B;  3VQT A;  3EJM A;  4DR6 J;  2FJV A;  3DMJ A;  4QIW D;  4AT1 B;  1Q8I A;  3K5M A;  4WZM A;  2XY5 A;  5HMY A;  1ROF A;  2X7I A;  3BZQ A;  5BYR A;  1Z2Z A;  1U1M A;  2FZC B;  2K8G A;  4ZCL A;  3I9V 9;  2RNE A;  5DG9 A;  1RA7 A;  2MKJ A;  1NPR A;  3BKT A;  2HPU A;  2O67 A;  5AXL A;  3ZZ0 A;  5KT2 A;  3JAM Y;  2K7J A;  2M9K A;  2GIR A;  5H9E K;  2RS2 A;  1SH3 A;  1IQZ A;  1KOO A;  1OJ4 A;  3N6M A;  4C98 A;  2MZ1 A;  4K0K J;  4I6A A;  2VIC A;  1X4H A;  3C14 A;  3CJS A;  4WE1 B;  4WFZ A;  5FD1 A;  5KFT A;  2ZKT A;  3LAN A;  3NP5 A;  3OR2 A;  1QTM A;  1B70 B;  4E8U A;  3AT1 B;  4AL7 A;  4B3R F;  1ZM2 A;  2BE2 A;  2PO4 A;  3BB5 A;  3M8Z A;  1NZA A;  1RU1 A;  4UUX A;  1ZYQ A;  3BBB A;  4CLT A;  4KGK A;  5DQI A;  3UVJ A;  1E6Y A;  3OTE A;  4ZCM A;  2DPJ A;  2ZOG A;  3KNG A;  4RWX A;  3MCO A;  5EUH A;  5F0U A;  2BX6 A;  2DR8 A;  1H38 A;  2B56 A;  4K50 A;  3B4M A;  2HQC A;  4HTJ A;  2OFH X;  4USU A;  3N6N A;  1JLB A;  4OX8 A;  5KT5 A;  4RZR A;  4ZPV R;  3QO9 A;  1JLG A;  3EDR B;  4IKA A;  4NML A;  3OW2 R;  3DRP A;  3GR1 A;  2XHW A;  3IG1 A;  3L95 X;  5DJB A;  4XDC A;  3HXM A;  1U1Q A;  2FVS A;  4OYB A;  4DCJ B;  2FUG 9;  4DF8 A;  1PIE A;  1H2U X;  5E5N A;  1JQG A;  2BAN B;  2AD9 A;  5DM6 Q;  4RW7 B;  5GAH I;  1BUX A;  3RRH A;  2AV5 A;  1ZAV A;  1SV5 A;  3GIJ A;  2R7S A;  3G8Q A;  2R2U A;  4OZ0 A;  1N54 B;  1U0H B;  2OUG A;  1WD6 A;  3UD5 A;  3ILJ A;  3W2W B;  2VDI A;  4RUA A;  3IR5 B;  4QWE A;  3EYZ A;  2RQM A;  4LIW A;  3Q8R B;  4KB7 A;  3R5D A;  1EQM A;  1RTD A;  4W92 B;  3HVT B;  2Y0B B;  4Y34 A; 
#chains in the Genus database with same CATH homology
 2W2P P;  2Z56 B;  2XTJ P;  3CO0 P;  3T41 A;  2QTW A;  3A3N B;  1V5I B;  1SPB P;  3CNQ P;  4NMX A;  1ITP A;  2Z2Y B;  2Z2Z A;  2W2M P;  3VV2 B;  3AFG A;  4K8R A;  3P5B P;  1SCJ B;  2Z58 B;  2W2O P;  4NE9 C;  3WIU A;  3QFH A;  2E1P A;  2ZWP A;  3WIV A;  2Z57 B;  3H42 A;  3BGO P;  3BPS P;  2PMW A;  1R6V A;  3GCX P;  2W2N P;  4YN3 B;  3VHQ A;  3A3O B;  4JP8 A;  3WHI A;  2ZWO A;  2W2Q P;  4OV6 A;  3GCW P;  2Z30 B;  3SQO P;  3A3P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...