4NMXA

Pcsk9(deltacrd) in complex with phage-derived inhibitory peptide 2-8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
b'TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Identification of a Small Peptide That Inhibits PCSK9 Protein Binding to the Low Density Lipoprotein Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4nmxA01
1SPBP 3CNQP 2W2NP 4NMXA 4JP8A 2PMWA 2W2MP 2ZWPA 1V5IB 3WHIA 3H42A 3QFHA 3BPSP 4OV6A 3WIVA 3AFGA 3A3PB 2W2OP 3P5BP 2Z58B 3WIUA 2Z2YB 2W2QP 3SQOP 2Z57B 3BGOP 2W2PP 2E1PA 3A3OB 3VHQA 2Z56B 1R6VA 4YN3B 3T41A 3VV2B 1SCJB 3CO0P 4K8RA 1ITPA 2XTJP 2Z30B 2ZWOA 3A3NB 3GCXP 4NE9C 2Z2ZA 3GCWP 2QTWA
chains in the Genus database with same CATH superfamily
3JQMA 3NP5A 1F2HA 4JP8A 3HFZB 4I4BA 5HLFA 2G13A 2RH3A 3NMRA 3L7PA 1U2FA 5AE3A 3KMQA 2AGOA 3ILJA 1FRIA 3K5NA 2MLXA 3JSRA 2DNGA 1TQLA 4ENOA 2BEFA 5DGAA 1X9WA 1SH3A 2DNHA 3DXSX 1XMOJ 2HNYB 1FKPA 4H4MB 3KOAA 3AODA 4ZVUB 1H7WA 1BQXA 1XR7A 3DM2A 1CG2A 3G4SS 3UNYA 2R7WA 3AB4B 3DDKA 4LF7J 3E01A 3NS7B 2C3OA 1T9YA 3GIIA 3W9HA 4RKUC 3G8TA 4B9UA 2ZBIA 3FMWA 4HDHA 2CG4A 1BY9A 2ATCB 1M5HA 1RE1B 2HBRB 3K8VA 3TWZA 4CLPA 3C14A 3CJKB 1HNXJ 4TN2A 2ZKUA 2DD8S 4FF1A 4I56A 4E0DA 3PHTA 3M9NB 3VAFA 4A8MP 3FMBA 3MMAA 3HT0A 5T7LA 2OEKA 3CUNA 3IG1A 2VA3A 5E5NA 3OL6A 1FDAA 3D28A 3UDLA 4R5PB 1ZPWX 4Y2CA 3DI6B 2EK6A 1NH7A 1FK9B 2FZCB 3RBDA 1WOOA 1XR6A 1UL3A 2PD1A 1S6PB 5A8WB 1T9XA 4C8YA 3B82A 5A8KB 2QE5A 5KFAA 4DUZJ 2DH9A 1Y4ZB 1CS4B 2HVHA 4PQAA 4ZPBA 3THVA 1UW4A 4ZJQA 1RT1B 2R2TA 4BHQA 3N5BA 1XIQA 5KFDA 4RW7B 2KDOA 4ELUA 1REVA 4F02A 2V8HA 4J9NA 1JJHA 3BJYA 4RZRA 1UFLA 3LALA 1MN7A 1TK0A 3NGKA 4NMLA 4LF2A 1ZA2B 3MPDA 1TL7A 2JLFA 3MEDA 3TEHB 3MMCA 4F8RA 2N7YA 2CNLB 2EK1A 1UCNA 5C5JA 5JVGQ 3D0GE 1N48A 3W2VA 3EVWA 1EX8A 3D68A 1N5SA 4ID5A 2BR0A 1PBAA 3HHNB 3PJ9A 3AD8C 3UQSA 1M5SA 2ZNZA 5CCMA 3TX0A 2BANB 3OFFA 2VFVA 1WC0A 1JNZB 4RW6A 3M6VA 3KWMA 4MK9A 3L3CA 3MI7X 1IQTA 4CM2A 1PYTA 1LEOA 4A8YA 4PEOA 4MMOA 3EYZA 2WB4A 5J2NB 5J1EB 3CJQA 3MMBB 3IGNA 3ENWA 3LP1A 3US5A 3IRWP 4QIFA 4MK8A 5DDRC 3UI3A 4ECYA 2LXUA 1OJ4A 1VQOS 3FFIB 1S76D 2ZM6J 4B3SJ 4ICLA 3OLAA 1R6VA 1C0TB 2AYBA 1O0PA 2EFQA 2K1RA 2ZOMA 5DJBA 4HTJA 4QOTA 1Y5IB 5M2PA 2R4FA 4J90A 4IH7A 3NNHA 2W24A 1B7YB 2XM3A 1HNZJ 3KUGA 1SCJB 3BH6B 1KFDA 3V4IA 1KP6A 2W2NP 1XMOF 1WG1A 3MM6B 1Z2ZA 4ZP6A 2AHOB 1F9EB 3FSYA 2R8KA 2WW4A 4WKRA 1KQKA 2AZ3A 4N8OA 5JMNA 1HR0J 4LF7F 1T3OA 1TZ0A 3MM7B 2WONA 2FJBB 1HNVA 2BRLA 4DR5F 1RTJA 3KHGA 4HT7A 5FD1A 4MFBB 5LMUJ 5LJ5Y 2G1HA 1HYSB 5MAOA 1UA1A 2IM2A 4KQZA 2F3JA 3DHXA 3KK2B 5H9FK 1FRKA 1HNXF 1N5VA 1GTEA 5D0EA 3I0RA 1RCOB 1VQPS 2AU0A 2VD3A 2GHPA 3SDEB 3J7AN 3UDVA 2OJ3A 2OPRA 1DHMA 4B3OB 2ZJRQ 4U6PA 2R7UA 4YR0A 4ZK7M 2X7IA 2QG9B 3NGSA 1RHKB 1NK7A 1CBKA 1BD6A 4QU6A 5HO4A 1F9HA 4ZIWA 4X4VA 1TFYA 4DV6J 1C4CA 4HVZA 2HFSA 1HHSA 4WU3A 5HN0A 5CZXA 3BM7A 1LWFA 1CJUA 1S57A 1IR2A 2RIJA 2N7CA 1WI8A 2CRLA 2XZWA 3E8OA 2PC6A 5B09A 1QAJA 1VIXA 2F40A 3CT9A 2ATLA 3SQGB 5M2RA 4AT1B 2CQ2A 3H5XA 3TUPA 4LFBJ 4P52A 2GCFA 1NK5A 3BEGB 2QJ3A 2HWTA 4C98A 3I55S 2WVFA 1RT3B 1Q86T 3A8EA 2KJVA 1RLDA 4DX7A 2ADBA 1NXIA 2P5VA 3UWTA 3MPWA 1PC4A 4DJBA 3AJ1A 4F2RA 5L1KA 2WVDA 3GONA 2X3DA 4O4RA 2ZHBA 4HACA 3PO5A 3CW2C 3D5MA 2KRBA 2GJFA 1MW7A 2H9ZA 4K0KJ 1YTYA 3GQCA 1AW0A 3T1AA 3PW7A 4OV6A 4J9UE 2Z57B 3D6MB 4OZ1A 2JSXA 2ZM6F 4B3SF 3RZAA 2GMJA 4ANDA 1FD2A 5A2QU 3UR3C 4A8OA 2V67A 2V8PA 4DHVA 3K59A 1TL4A 2FVSA 2GFFA 3O8WA 3NBPB 4WWSA 4ILRA 1U0HA 2O01C 3J81Y 1HNZF 1HWLA 4N7TA 2Y3YA 4PRFA 5ITHA 3V4MA 4DOZA 2P6SA 4OX7A 4ES1A 3HP6A 3KHHA 3UDEA 1A6LA 2R8JA 1E6VB 2XCPA 2R2UA 2XZDB 2KJWA 2ZFHA 4HR2A 2BVZA 5CD4A 1JLCA 3SQOP 1HWJA 4DL4A 2IBKA 1LW0B 3FCHA 2XMJA 2HRTA 3PDNA 1TKXB 1Q82T 1FEHA 4TY9A 5C2GA 1P8GA 1U1RA 1UETA 4ED3A 2P2CB 5E41A 2E66A 3ZTPA 5GAHU 1R8CA 1T9WA 1IKWA 1PJ5A 1AZSA 1IBCB 4R8UA 1Y3KA 5IM0A 5KFOA 2A1BA 3T5LA 5CYQA 1PILA 4KRWA 4JBCA 3HHLD 1RJJA 4B9SA 1JQGA 1UKUA 4NLQA 4DPYA 4ZKAA 3TAPA 1SJQA 1S97A 4HL9A 3BO2A 2H1YA 2DNZA 1KONA 5GADU 4CWBA 1RT7B 3CDUA 2XULA 3ZZUA 4ZHRB 4X4NA 2H3EB 2O66A 4I2PA 4NLTA 3QLHA 3QZ8A 2DR6A 2QFJA 1QSLA 2DH7A 5L9NA 1C1CA 3PW4A 4H4KC 1SBRA 5GAEI 3I6PA 4EBEA 3I31A 4UW2A 1LWXA 3ZC4A 2Z2ZA 1A0OB 4ED4A 2NZ4A 1JJ4A 2EPIA 3R7SB 1WTFA 1VRTA 1ZM9A 3TAMA 4H4OB 2YKMA 2VG5A 3D67A 1L3KA 3VVUA 5HVGA 4LFBF 1XN9A 2H54B 3V5RA 2Y8YA 3EX7B 3FSXA 1SJRA 2VFUA 3SMZA 3BS9A 4I7FA 2LXIA 4EO8A 4N56A 5J2MA 1ZS6A 2B4VA 2KN4A 1PBUA 5BJRA 2KL8A 3OUYB 2B4OA 3IWLA 3OTCA 3IA0A 4H4KA 4E8UA 4X4RA 2B56A 4CH1A 3M2RB 2RU9A 3LW5C 4GKKJ 4PR6A 2O5DA 4K59A 1ELOA 1JLBB 3RU0A 5I42A 2BBEA 2CPXA 2V5HG 1PYOB 2J8SA 3T5JA 1KLMA 1PAEX 4K4SA 2PMZD 3WHIA 4K0KF 1CQNA 2HPUA 3MM9B 1K47A 1VOMA 5F3ZA 4LSNA 3RRHA 1CJKB 1D8ZA 1ZETA 5KFHA 2E7VA 3TZZA 1RT5B 4C6AA 2AP6A 5ETRA 3DMJA 3DRRA 4M5JA 1JXVA 2A0FB 4CM0A 2DR8A 2DEIA 2ZITA 3K0JA 4LREA 3MTJA 3RRKA 4NRUA 3DHWC 4C2MA 3NAIA 4DV1J 1U09A 3OTDA 1H73A 3BO3A 5AE2A 4Y34A 5JUMA 4ELTA 1FXLA 4IG3A 5K5MA 2HNZB 3GV5B 2JH3A 2ALZA 2BA9A 3Q8UA 4F4AA 2AEFA 4FXVA 4V19J 4YMEA 4NE9C 2UVUA 3BPDA 4NLYA 5A0YB 3AOCA 1FESA 2J9EA 3HF5A 1HBUB 2OPPB 4Q0BB 1YBUA 4ZPVR 3RUBL 3BKTA 2RDDA 3TZYA 1X4AA 1DARA 3G82A 4OHYA 3BR8A 1NJWA 1WF0A 3HFVA 2LQBA 2IMWP 5D77A 1FFSB 1BXNA 4BCAA 3ZZTA 2A3JA 5B0GA 4OI6A 2HNDA 3Q2SC 2BM1A 3M8PB 2Y8WA 4MYUA 2B3TB 2HQDA 3NY0A 3KHLA 4GVBA 2HGMA 4WU2A 3PM9A 3KK1B 3GJQB 1E6YA 3N01A 2J6UA 1CVJA 4P75A 3C2PA 4USVA 2XS5A 2V50A 2XSJB 4DWIA 4EYHB 3OR1A 2ZEJA 3I32A 2L3MA 4O3SA 3T3FA 5F3TA 3DLKA 3DGPA 2FC9A 5EX3A 3UW1A 4NZ7A 4F4ZA 3KLFB 2F4VJ 2MTLA 5KFXA 1K0VA 1SQEA 3FRYA 4YN3B 5CH7B 4JV5F 2XQCA 3I5AA 2CG8A 1ZPVA 4DZ6A 4DCJB 4OJ1A 5HP1A 3W62A 1Y9OA 1AA1B 3M8YA 3M8ZA 1SKUB 1LKZA 3VAKA 4C3MA 1N88A 1RT2A 2ZVSA 1R8PA 4LUBA 2WRMA 3QYYA 4OX8A 2MZQA 2CQBA 4YB5A 3QT5A 3RAMA 2NR0A 3DRSB 2XNQA 4DL3A 3GTYX 1NMEB 3THPA 4OX9J 4CO4A 2M88A 3LO3A 4Q8FA 4GKKF 2EVZA 2HRYA 5K9FA 3KG0A 3I5CA 3TZWA 3GR1A 4Y65A 4RL1A 2ZUAA 4ZVGA 3CCES 2YWHA 1J2VA 5KT6A 4MIAA 5J2PB 4EBCA 2NPFA 2IYGA 1WORA 3ZTRA 1S9FA 4CTAB 1ICEB 3HHLB 1IKYA 4N8NA 1KVIA 4WK1A 4ILLA 2D74B 2MY7A 5KFZA 1UVJA 1N0UA 1EQ0A 4FPRA 1FWKA 3PKYA 2V2VA 1P1LA 2VHGA 3Q8SB 1FJCA 5F41A 3CDBA 3D6FB 2GNKA 1VQMS 1NLKL 4DF8A 2DNYA 3PRDA 5B0CA 4DV1F 2J0WA 3MHYA 3SSSA 2D41A 3EICA 4KC5A 1F5CA 4IFYA 4J91A 4OJ3A 5IT4A 5KT7A 4ELVA 1WJ9A 3RG6A 2C3UA 3ZZ0A 2XG8A 4RUCA 2HMIA 4C8LA 4RJVA 4Q2MA 1MWYA 2JC0A 3CD0A 4ECXA 1RSCA 4AE5A 4DI6A 3D54A 1JXLA 3CPWR 1TV6B 5GVQA 5KFQA 3CCWA 3POTA 3H4BA 1LXNA 1V5VA 1B3TA 2XMTA 4LMZA 3GIJA 5HQMA 2GGPB 4RUBA 1JNRB 2EFGA 3E3XA 1WC4A 4PUOA 1SQGA 4A46A 2HZVA 3FCWA 3DLLQ 3WBZA 3V81B 2VB6A 3MM5B 1F0XA 3QGGA 4EZ9A 4X4UA 2Y1LB 4I64A 4QZVB 4DG1A 3TQ1A 4UZBA 1FERA 3UFCX 2D3UA 4OYPA 4RUHA 2MSSA 5B0BA 3L09A 1EZZB 1VJQA 1OSCA 1VHFA 1RU1A 5C42B 3PJXA 2D7SA 4K4YA 1M1GA 4HTIA 3VAHA 4TU9A 2NXNA 3OR2A 2XO6A 4DQIA 1YG0A 2GHVC 1TELA 4Y3CA 3M1VB 2HS4A 2GO9A 3ISZA 4WFBQ 3R97A 2F4VF 1NKEA 1RAGB 2XHCA 2E9ZA 2VG7A 2MQNA 4NYPA 5F8MA 3PRBA 3HLUA 3KJQB 3GJTB 4FYYB 4IOCQ 5IS2A 1N54B 4X4SA 2DIVA 5KG4A 2L41A 2W1BA 4Q7AA 2HHUA 1L3SA 1KEKA 2PA8D 5AXMA 1J5OB 2JL9A 2JVRA 2QMXA 2VV5A 1FKOA 4HHJA 1Z1ZA 2KT2A 1OQ3A 5ETPA 3U1NA 4N76A 3BBCA 3GILA 3PZPA 2JEFA 3BN4A 3THTA 2JZ5A 3FJ2A 5HMXA 3CNQP 2Y1JA 4FNIA 3OFEA 1EETA 2ASYA 4DV0J 3JSBA 1YZ6A 3TA2A 2Z2YB 2ZDPA 3QO9B 1Q8KA 2QL7B 3KG1A 1ZTWA 2COLA 2OGUA 4L75A 1XTZA 1J5EJ 3F0NA 1AFJA 4HKQA 2P8IA 1M5OC 1RYSA 1N33F 3TUZC 2G2OA 1HLWA 2FVPA 4HHUA 4RBUA 2DY1A 2FVQA 4WYLA 1BQNA 3G6YA 1YITS 2KG0A 1UPMB 2WSEC 1IJFB 2LQJA 4UOFA 4IH5A 3RW6A 3HCXA 3W9JA 3MUMP 3FSIA 1A7GE 3AH6A 2ZBQA 3W2WB 3W7BA 2PI4A 5AT1B 3GZ7A 4D3HA 4PYDA 3D66A 1NZ8A 2ILYA 1S4FA 4YDDB 3VAGA 2VFRA 1YIJS 2WOMA 4WXOA 1NM2A 2E5GA 4LF6F 2M2BA 3A1YG 3OJUA 1FDBA 3OHAA 1U24A 4TXSA 4ETXA 2CADA 1VQKS 1S0NA 2Z30B 2QRRA 4F4XA 3MAAA 3JAMU 1Y11A 3ZZYA 1WOPA 3SV3A 3M9OB 5FDLB 5F0WA 3HZGA 3NGRA 2CQ1A 3H5UA 3DLJA 2FQQB 2W9CB 2BV3A 3PO4A 4UY85 1HHQA 3GSIA 2BACA 1RTHB 1VQLS 1Q5YA 3CDAA 2MLZA 3NKYA 4PWUA 2AWZA 5HVFA 4FS1A 2AD9A 4UT4A 2IM3A 1F5AA 1U25A 2XS7A 2DHGA 3JYTB 1N56A 5LM7E 4Z7CA 1VLYA 3HVRA 2V4JA 2A18A 5KFNA 4UF4A 5J2QB 3UD4P 1NSAA 2RRNA 2HQCA 3GFZA 2XEXA 3HJFA 2CAJA 3AT1B 1AT1B 3LTOA 2C2OB 1VQ9S 4UOHA 4U8VA 3TW0A 2DHAA 2QEXS 4M5MA 4Q44A 2Y9HA 4XPEA 1L3UA 3VGVA 2AIRB 3H20A 4LRDA 4EWTA 3GYNA 2A6MA 3M2VB 2OSQA 5HMWA 2YKAA 2ZH8A 1B99A 1VR6A 4R25A 4J9LA 3MCSA 2RKIB 4LSLB 3DLBA 3M30B 1S12A 1H3DA 5HVHA 2ASJA 3GIKA 3QQCD 1NK6A 2LLZA 4DV0F 2NYHA 1WG5A 3D1HA 1U02A 4OHXA 1HBMB 1U26A 2OFHX 3ENVA 2B9EA 3NMAA 1NK4A 2OFGX 3PCOB 1FXDA 3AOBA 2EKNA 3VF0B 4C9DA 2XC9A 1FRLA 2DGVA 1DTTA 2M0GB 1IBMJ 4DSJA 3MCNA 2HGLA 1KKHA 2L9WA 3GMGA 4KO0A 5K8NA 2OD4A 3GSDA 5EWEA 1ROFA 2B8PA 4O0IA 1KFSA 3CSKA 3DNCA 4X4QA 4EI2A 3PACA 3IAS9 2W9BB 4K50A 2CWXA 1MROB 3DOMB 2YWFA 2QX0A 3SI8A 2KU7A 4C0HA 1GNKA 2FVCA 4RW8B 1R8BA 1ZM2A 4X66J 1CULB 4OZLA 2W2MP 1SB6A 2CPYA 4LJMA 1ZAWA 4F67A 2QGFB 5EGYA 4TKTA 4K4TA 1JLQB 4C0BA 2V0NA 2ERRA 1FXRA 3LWMA 4F2SA 1VISA 4P2MA 1TTHB 2QFIA 1JJ2R 2DVIA 4G6VB 1S1TA 3MOZA 1RWOB 5IC4B 3LGNA 1N5YA 5F8LA 1SL2A 2ZHOA 1GQEA 4NZ0A 4I6YA 1TFWA 2VU5A 3W5YA 3DOKB 1RWKB 3LP2B 2AGPA 4YB6A 4EO6A 4JI3J 2Z4PA 2YTCA 3HSZA 3CMES 1KC8T 1TK5A 4EFAC 1YRXA 1RT6B 2QA2A 3HHDA 2PI5A 1M5KC 4DV7F 1F5BA 1Z2LA 3A8IA 4QPXA 5HLFB 2DHSA 4I68A 1Q81T 5G0RB 1DTQB 4KBIA 1S1XB 1WSVA 4WTOB 2UUBF 1GMUA 3V2UC 1XMQJ 4ECTA 3I9V9 1KVKA 4FVMA 5IOLA 1QUPA 3DLEA 5CA5A 5DG8A 5KG0A 1FTCA 1VRUA 1BLUA 3Q8PB 2MGZA 5MLCV 1FKPB 2JVOA 3HSGA 2IPOB 4DLEA 4RPFA 5DS7A 3CCSS 4K2JA 2M8HA 4DX5A 3DYAB 2VC0A 4C8ZA 1UJ5A 3TQEA 4NLPA 4QJVA 4Y6IA 2VJVA 1CC8A 1KBRA 2KZZA 3C3LA 2QSWA 4FBTA 2IHR1 4ES2A 2KRRA 3GIMA 1S9EA 3PX0A 2UZAA 3MMAB 5T7LB 3TZXA 1EKSA 4O3PA 2VUGA 3HD2A 5L8RC 2F65A 3DGVA 3UD5A 3RB3A 3OTOJ 3AB2B 1XC9A 4F3QA 3CCZA 1IBMF 2EFNA 4YY3J 3OQ2A 2E9TA 1IXKA 2U1AA 1HD1A 4YP3A 2W2QP 1VK8A 3QJLA 1HBOB 1WOSA 3Q83A 5JXSA 1NDCA 3J81j 1K9MT 4KHRA 4YR3A 1TMMA 2MY8A 1SVDA 5F0UA 1OY6A 4NYZA 2HAIA 3M7VA 1RAJA 1PAUB 4M5HA 1N34J 1OY9A 3CJRA 4ZVQB 1DY3A 2MJUA 3QRQA 1Q8BA 1X5OA 2J0SD 3SSRA 1A9NB 3WIUA 2D69A 3NWRA 1VQ7S 1WDTA 2VH7A 2VASA 3LANA 4MIWA 3KYLA 3MECB 4F26A 2BE2A 1NPRA 4B3TJ 3W2VB 4UOGA 2FYXA 5FLXY 3V6DA 3M6WA 1DURA 5F8JA 3IFEA 4F04B 2ZKTA 3BDEA 1T11A 1WF2A 4N41A 2WSFC 4LRBA 3NNCA 4Z37A 4DR4F 4RW6B 1I94J 1N36J 2MZRA 2RUGA 4KE5A 2HHVA 5I3QA 1HMVB 1YJ9S 3GWCA 2BE7D 4LF4J 1LNQA 4PQUB 3LP1B 4B3RF 4F25A 1NJXA 5D4OA 4WIIA 1JLGA 1BMQB 1RUSA 5LOQA 1FDDA 4ICLB 2DRBA 3H98A 1NPKA 3MR2A 1UWBA 2GQQA 2VZ9A 2Z8QA 2K1RB 4ANCA 4NZ6A 2APOA 3R2CJ 2MQLA 2VG6A 1XMQF 4IOAQ 4C7QA 1DBDA 4JI8J 1TKZA 3RBEA 3I4PA 1UWAA 4ZVEA 2NXUA 2ZC3A 5I3UA 3V4IB 1LK5A 4XAKA 2EC0A 5ETKA 1PG5B 1H38A 1R8HA 2GAGC 3M8QA 1K1SA 3EGVA 3A8KA 1P1TA 1VS3A 1N32J 3IR5B 2IIHA 4RNHA 4I2QB 1RAEB 3NEKA 4FS2A 2VDIA 3VAJA 1V5IB 1S7IA 3IN5A 3HVTA 2V8DA 2Y1RI 4DR6J 5DDPC 4DL5A 3I0RB 5GMKa 1I3OB 2AJFE 5LSRA 2MZ1A 1Q7YT 3OPKA 4F3MA 4DV4J 2GVZA 5FJ4A 1LWCB 1B70B 2BKOA 2E5LF 3U7JA 1R3NA 2ZH4A 3OTOF 1SKRA 2ACMA 4C8OA 1FX2A 2C2MB 4FN5A 2L48A 4IRKA 5KFVA 3O6QA 2Z2MA 2OTJS 1Y3JA 3VAMA 2BABA 3RB0A 4RR5A 3PY8A 1LWFB 1T05A 2HWHA 4U8YA 2UU9J 2AYEA 2I0XA 2XS2A 2HNYA 4H4MA 2E5JA 2HKEA 2IY5B 2ZC4A 3G96A 2R2RA 1W2IA 1N34F 1WNEA 3KLEA 1RTZA 2J7WA 5L39A 2R8IA 2GIQA 3RR8A 2RRBA 4UTGA 4DFJA 2BE9B 3VAIA 3H25A 2HLUA 2NXJA 4YQWA 2ZVIA 1HWIA 5L1JA 5C24A 3MPUB 3R2DJ 2LVWA 3ZFVA 3PX4A 3U1MA 4B3TF 3CJKA 2GVDA 5C25B 4RX6A 4KJIA 3A3OB 2EG1A 1S49A 2AKWB 2JFKA 3M8WA 4ZVOB 3HKZD 2JLGA 2B51A 3BGLA 3KKFA 2VA2A 5K14B 2Q66A 3MEEA 1S6OA 4JYAJ 2MLYA 4HACB 4R5PA 2HHTA 1QM9A 5AXKA 3QAUA 4KHPJ 1R0AB 4FYXB 1N36F 4BWJA 3CIMA 1FK9A 3Q0AA 1S6PA 5A8WA 3NXZA 4L72B 4LF4F 2GZOA 4LVNP 3W60A 1RAOA 5A8KA 2FUG9 1FFGB 5LSLA 3EGZA 1U49A 4ANEA 4P2SA 3QJPA 3T19A 2XTJP 1RT1A 4F0KA 3N4WA 4RW7A 4PXEA 1F3VA 1B64A 4USWA 2QMWA 1PJ6A 2DR5A 1VGYA 1UAWA 4QCLA 5D78A 1S1UB 2AF6A 3L4BC 4JI8F 2L9NA 7AT1B 2X1AA 3MF5A 4KSEB 3H2UB 2GA7A 5E3CA 2MHNA 2DO4A 3BQ2A 1G7CB 1EKRA 4NYOA 1KQFB 1RAFB 3RTVA 2UXCF 1FNXH 2E1PA 3K7RA 2NXCA 5KT2A 3MAQA 1ZZFA 4PZVA 2V8VA 1N32F 2CPHA 4DN9A 5IV3A 3KJVB 4M5DB 1X31C 2YKNB 2PGCA 2IVMA 4CYUA 1JLCB 3GR0A 5KG2A 2XO7A 2OPSA 4ZP9A 4GC7A 1CPZA 2BANA 4Z7YA 4NMXA 2UXBJ 2YQ0A 3BF4A 2G2YA 4DR3J 2EFVA 5D4LA 3PW5A 1S48A 1URNA 1X4DA 1IKWB 2QIFA 1KRPA 5J2NA 5J1EA 5IM0B 3DDIA 2JHEA 3MMBA 2AX0A 2Q3PA 1C4AA 5K8MA 2YNGB 3ETMA 3NOCA 2B4UA 3FFIA 3SBMA 3NGUA 2FGCA 1FJGF 4ED1A 2M70A 3IRXA 1FHTA 2QV6A 5KOWA 2AYMA 3ONQA 2DB1A 4PPZA 1IBKJ 2J9CA 4LVOP 4I2PB 4B9VA 1WKJA 1C1CB 2VPYB 2F7VA 1EP4B 1HW9A 3MM6A 1IM4A 2PE8A 4AQYJ 3QNWB 3NG8A 3FEYB 4O4GA 3WC0A 4KV8B 2CPEA 3TX8A 2VG5B 4EMDA 2WHOA 4ZIVA 2C2KB 4QQBA 1GFWB 4NASA 4UQTA 3M8RA 2HAFA 3H4DA 4B9TA 4NEZA 4JI1J 5J2MB 3VWSA 2CNNB 2WK4A 3KK2A 5G4DA 3M2UB 2MZSA 4CZCA 3CULA 4CT9A 3K17A 4QR1A 4UQGA 3SDEA 4W92B 3C6TA 4OZ0A 3IMQJ 2BYCA 4NA1A 4QW9A 1SKWA 2HK3A 1X0PA 3DRPA 2C2ZB 4JYAF 3IWXA 3CXCR 5I42B 2LQ9A 1H98A 3NGTA 2OD6A 2CVIA 3ZTSA 5GAGI 4DZDA 2HFZA 1L3TA 1WG4A 1X8DA 1U1KA 1WKKA 2FB0A 3JXOA 2KZMA 4TYBA 4O3RA 4ZVTB 1NCLA 3CJSA 4NL5A 1FF2A 4A8SA 1ZM3A 4O3QA 4MJKA 1NK9A 3O2IA 4ATNA 1UFWA 4BLGA 4I0WA 3SQGA 3GG0A 1YBTA 1DQ9A 1EARA 1HPZA 2W7OA 4L6V3 3LGHA 2DXDA 4ZPDA 2OSRA 2UUWA 2LP4A 3TARA 3NAHA 1U1PA 1FKAF 1RLCL 1RDRA 1QLNA 4PXDA 2IA0A 3VQTA 1XR5A 4KTQA 3ZTOA 3LOUA 2UVVA 1SV5B 3CMAS 2VOPA 2IJFA 3KNGA 1XNQF 2DO0A 3MMJA 2K8GA 2C2NA 3TNVA 3G82B 1HI1A 3FUYA 4DR3F 2J7KA 7FDRA 1X60A 1VQYA 4WFXA 3Q8QB 3K2YA 4CNYA 1RADB 2KYXA 2CJKA 2GJ2A 4PPDA 2HNDB 1OS5A 3SEOA 1YQHA 1H2TZ 3ZTQA 4ZS6A 1Y5NB 2PEHA 1YJVA 5HMZA 4MTPA 3FBBA 4LBIA 3MM8B 4CLFA 4YB7A 3C8YA 4ZPWR 3AD9C 2B9WA 2DY9A 3N0VA 4AYBD 3NBPA 1WUUA 1IBKF 3J7ZT 3MPVA 1D09B 4U7UK 5KT3A 4FBUA 1KVJA 2F4FA 1G2EA 1UVMA 2WCXA 1HI0P 4NCGB 3CJ4A 3OVBA 2E1AA 4P7VA 2E5IA 3DGPB 3UCUP 3KUEA 2DGXA 4TY8B 4AQYF 1SKSA 2N4CA 3GFHA 2BKNA 1FE4A 2HHHJ 1E6VA 1QE1B 5BR8J 1VC0A 2M4MA 3CJ2A 3QRPA 3W8GA 3GB0A 4CO5A 4URGA 3HVWA 3MR3A 1G3OA 1RT2B 3TOQA 4JI1F 1RKIA 2HBYB 1TKXA 4LFAJ 4BC9A 3QGHA 1P6TA 3W8PA 3KLIA 3PYDA 1TK8A 8ATCB 4X4TA 2FJAB 4F4WA 2MQQA 1NAQA 2VBWA 3PKMA 2X1GA 2Q6BA 1HFEL 4ECQA 4DCOB 3BPSP 1K1QA 3P5BP 3H59A 4ZVRB 1S0MA 2VPWB 2WVCA 4U7CA 5HANA 4ZVFA 3LQVA 4LF8J 4MK7A 1RT7A 4P7TA 3NCRA 3FRZA 4ZHRA 5H9EJ 3RAQA 1IKYB 4ZJOA 1T9TA 1W26A 4USTA 4ZITA 4ERDA 4GO5X 1S1WB 1WSRA 2HHPA 2CXEA 2CQDA 3B8HA 3V6KA 3IS9B 2RD5C 2X51A 1TL3A 4I67A 2LDYA 3EXYA 3V6HA 2AYGA 5KFUA 3JB9k 1EB0A 3W5ZA 2RDJA 4ECZA 1CLFA 4H4OA 5B0DA 3SCKE 3HMJG 5KFEA 4DUYF 3GCXP 2CJXB 4NLRA 3DDNA 3HT3A 3OLBA 3FQLA 2HMIB 2CDRB 1MLAA 4WFZA 3VV2B 3OUYA 2B9YA 5DM6Q 5E2QA 2XMWA 4K5RA 3R5CA 3JTPA 1M1HA 3VALA 1ZZNA 1XEZA 4MKVA 1Z4UA 2DPJA 1JLBA 3W65A 4QWBA 3BBFA 3EPIA 1ITPA 2J5AA 4PUOB 1R43A 3HJVA 1N0VC 2BJDA 3MM9A 4CO2A 5L9XA 3MUVP 2CJ9A 4KFBA 2XZTB 1RT5A 3LPEA 1U1MA 5D0RA 5DGBA 1VFJA 4TU8A 4RW4B 5IT9U 2RS2A 1YX2A 2G0JA 3PHEA 4EUVA 1T7PA 3HPOA 1F6TA 4FKYA 3D3BJ 4ECVA 4N47A 3ETOA 4NI2A 1YJTA 8AT1B 4C3KA 2W4DA 3OHBA 3TUJC 1N5QA 2ROEA 3U27A 3OR2B 5SUHA 1HIYA 2OPQB 1HA1A 3QIPA 3IBFB 4AL6A 4OLPA 3OTEA 5DDOC 2FLNA 1LOUA 1OQ6A 1W25A 4DV5F 5CCLA 1Q8IA 3A3NB 2YWGA 1DQ8A 4B3MJ 5HSPA 2RVJA 4OHVA 5A0YA 1GTHA 1J27A 1HBUA 2W8KA 2M7SA 1B0TA 2W7AA 2XMAA 2XY6A 2POKA 1T03A 1T9UA 1UMJA 4PAAA 4LFAF 1RA6A 1RKJA 2V94A 2CQ3A 1U2CA 4EYIB 1SIWB 2J8AA 1JX4A 3T6JA 4AXJA 4USMA 4OZJA 1RYRA 1NJIT 2KG1A 2IMOA 5KG7A 1EETB 2BDPA 2V63A 4KHMA 3DLHA 1RWWB 4ED5A 1SUQA 1NJYA 1FEEA 3KK1A 2XLIA 3R7BB 4LF8F 2ASDA 1KNZA 2IVFB 4MYTA 4OI4A 1S9GB 3LH2S 1TL1B 4OYOA 3QGPA 2XLKA 4LR8A 3Q8VA 4FKXA 3SCIE 2SXLA 3UE2A 3DFEA 5ETLA 1YBAA 4N77A 5EDWA 1NDPA 4ZVHA 1BQNB 2BQRA 2C3MA 6FD1A 3KLFA 1FNMA 2KB2A 4Q8EA 5HI7A 1BGXT 1FFWB 1VMBA 2ZWPA 1GMWA 3CD5A 4L3KA 5A2QY 2W25A 2R2SA 2PFFB 1U8SA 1Q7LB 1MMLA 3J7A1 4IRCA 1K8AT 3DRSA 2WOMB 3NLCA 4IOBA 2K7JA 3MFIA 3QT7A 3JTOA 4A8QA 2VQFJ 1EHWA 2W4PA 2K2PA 3DN9A 1K0TA 4G1PA 4KPYA 4NXMJ 3KLHB 1JB0C 3EZUA 1S7HA 2HLTA 5KG6A 8RUCA 2MQPA 2MQ8A 4CTAA 4J5OA 5KTQA 4X65J 4DUZF 4K4ZA 4QWAA 4MT1A 3FNNA 4KY3A 1WHWA 4IR9A 3N5FA 5IQQA 2MKYA 2XY7A 3WZ0A 3IR7B 3KG4A 2Q1LA 4OYZA 3ENAA 3PR4A 3O3LA 2Y0SD 5HROB 4KKOB 3PR5B 3QZ7A 2XY5A 5E3AA 1Q78A 3FK4A 4OHZA 4ED7A 2YX1A 1DLOB 4CLTA 3LF0A 3A12A 2V4JB 2W4CA 1GH8A 2J76E 3HZEA 1DZ5A 2YNHA 2OAUA 3HFKA 2Y1IA 1HKAA 3FQKA 3C16A 1UZDA 2DPIA 3KK3B 1WEYA 4B3MF 3M32A 3OFHA 2JNJA 5E7OB 1I5OB 4A8XA 2KKHA 1H0HB 2VBXA 3UNGC 2J9DA 1TV6A 4FPIA 5GMEA 4WKYA 1QJHA 1SQFA 4OZ3A 4A8WA 1WEXA 3TJ8A 2W2PP 2LMIA 1WHXA 3OVAA 5AJ3J 4ED2A 1PJ7A 4LRFA 4E98A 3UVJB 3SCLE 3NS5A 2EG2A 1FNOA 4RNNA 2GMHA 4ZVPB 5E0OA 4ZLLA 3MR6A 1RZMA 4JI7J 3QIDA 2ZH9A 1X0FA 1NB2A 3Q23A 3T9NA 3U1LA 4R0EA 2CPIA 1R89A 5C42A 2M8DB 5DLGA 2OHDA 3RGIA 2M9KA 2BQ3A 4KO0B 1U0SA 2DGWA 2UUCJ 4DQSA 1WTBA 2RJZA 3TA1A 5D8HB 3M1VA 4JI0J 2FJEB 1HR0F 2WB1D 3HO1A 1XERA 5U47A 5DQHA 2XBPA 1K73T 1U1NA 4P9SA 2RNEA 4EU0A 5LMUF 2DYAA 2WAQD 3Q8RB 3S7RA 2HHWA 2G0IA 2QYCA 2W7PA 4PWDB 4LR9A 3FEXB 1FWPA 3GJRB 2B7BB 1QAYA 1IWGA 2DNKA 1J5OA 1YZ7A 4GKJJ 1RWVB 2Q6CA 5B0FA 4IDKB 4OMFG 4F50A 3SIPB 2D9PA 2ZOGA 2VQFF 4Y2KA 3N6LA 3J7YI 4F0MA 1B4SA 1JK9B 3KHRA 2ZD1A 4EBDA 2ZUGA 4HDGA 4NLXA 2BQUA 2KFZA 4HH1A 3QO9A 5L38A 1UEKA 4DX6A 2AGQA 2QL9B 2KVQE 4IG0A 4DPUA 4X65F 4DV6F 2BZ2A 3JSYA 1QY7A 4URQU 3PYFA 3CDEA 1R31A 1NPPA 2NZCA 4OX6A 2FZKB 1NKCA 3KLGB 1WHVA 1B0PA 1FA0A 1HWUA 3PFEA 3MPYA 2HQ3A 3C46A 3NRBA 4NRTA 1RP5A 2IAJA 1U1OA 4G1QB 4WZMA 4KH0B 2E5HA 4N5SA 4NLUA 2IRUA 1Q5VA 1UVIA 2HVDA 3D4JA 5DDQC 3IBCB 1VQ6S 3DOLA 2VKZG 3TO8A 4X64J 1WF1A 1NU4A 2V8GA 2YNIB 4A8KA 2FJVA 2FY8A 3CE8A 2D3ZA 1YKWA 2V9KA 3PVXA 4WXWA 4USIA 3G6ES 4U96A 2BRKA 5HQLA 3N9UC 3MR7A 3H2VE 3KJFB 3J80U 4P2FA 1RTDB 4L3NA 5KFCA 2YKQA 1VK3A 1HD0A 3CCLS 1KLNA 4AXIA 3OSPA 5AJ3F 3KNAA 4DR1J 2VICA 3TUIC 2OLWA 4NLVA 1RA7A 5FDLA 1U45A 3FBEA 2HURA 3H5SA 5LXRA 3D6HB 1VBKA 3CIZA 2W9CA 5A8RB 4NXNJ 3BSNA 3C6UA 1UVLA 2WSCC 2LKZA 2J6TA 2AW0A 1WWHA 1S77D 3NL0A 4JI7F 4HLBA 4DLGA 2DGSA 3R5GA 4RLEA 2B8QA 1NHUA 3C19A 3CCJS 3JYTA 3D9BA 4F4KA 2E1RA 1RT4B 4MKBA 4DL2A 4OQJA 5D0HA 2AMCB 1F3FA 4X84A 1M1KT 2MHEA 5ETNA 2UUCF 1U6FA 5KG1A 1WC6A 1QD1A 4WE1B 4JI0F 1H72C 4I69A 4CLUA 2KT5A 3A13A 1JLFA 3BN7A 4QIEA 2N4DA 2C28A 3CVKA 2ZDOA 3G87A 1ZTTA 1KOOA 3DXBA 4OHWA 1TVRB 4RNMA 2HWIA 2CZ4A 4M5KA 1Q0NA 4QYZK 1VLOA 3VTIA 1C0UA 1U48A 4XPCA 5KFBA 2XMKA 2ZE2B 4GO7X 5CXTA 2PEBA 3M2VA 4GKJF 3SXLA 2RAQA 3AOAA 2FJXA 1VBYA 3PIOQ 3NGDA 2R7SA 2BE2B 2RKIA 5LSOA 1HNIB 3MWBA 2ILZA 1YSJA 1RAHB 4LFCJ 2E7XA 2C22A 1U6BA 1N52B 2ROGA 3V6DB 1HBMA 1FJEB 2IRYA 4UY8T 1IM6A 3D1OA 1N4LA 1QAIA 4S0MA 2B6AA 4CH7A 1APSA 4CRJA 2ZZTA 1KOHA 4P72A 1NK0A 2RQ4A 2CZVC 3R1HA 4X4OA 3VVTA 2V68A 2NXEA 3W5XA 3ITHB 1Y10A 1JLGB 5EUHA 3IBWA 2DRDA 3I0SB 3JS9A 2F8MA 4H54A 2W9BA 1UWBB 4X2BA 1OWXA 4X64F 4K4UA 4ETZA 3A3PB 2GJIA 1TKZB 1WI6A 2UUAJ 4OYAA 2MQMA 3QPIA 1U4BA 3UD3P 1CULA 2BOAA 5I3UB 3AJDA 1L3VA 4P74A 1M90T 1UFKA 3G6VA 5T14A 3DU5A 4NWBA 1MU2A 2RQCA 2HRUA 1VBXA 1HQEA 1FRJA 1FT8A 2FHKA 2QZ8A 2EI5A 2HQIA 4HI2A 3PYGA 2CQCA 4DR1F 2HIYA 4C8KA 3P8BB 4J9PA 4KPCA 1B0VA 5KFTA 3IM9A 4M1KA 4NEYA 3DOKA 2B9XA 2P9GA 3LP2A 1TAUA 5D3GA 4JV1A 2GVZB 2AT1B 4FXWA 1AROP 1S6QB 1TP7A 4RW9A 3CC4S 4YS2A 2H4YB 5LXYA 5EWFA 2AJQA 4WFYA 5IV4A 2WW8A 5G0RA 1DTQA 1S1XA 1K44A 4MIBA 1PO6A 2DNPA 3R5DA 5KT5A 4XIUA 1P9YA 1T05B 2VC1A 1S1VB 2JLEA 4OYXA 3HD1A 5L46A 3B4DA 4BBYA 3CTRA 1GXUA 1SC4B 4A48A 4WFAQ 2DGUA 4KIAA 3KLEB 2XMVA 3G9CA 5AXNA 2R8GA 5EX0A 4DR5J 2O3DA 3R5JB 4IKAA 3DYAA 5C24B 2AQ4A 2CJYB 5HAOA 4K7QA 4F36A 3EXCX 1XWLA 4DFKA 3IAM9 2CVEA 2J0XA 5JJBA 1HI8A 2IA6A 2GVDB 2XHWA 1IKVB 3M6XA 5B7WA 4RUAA 4LFCF 1ZOTA 3CCUS 3ILOA 2DRAA 2AJ1A 4PWWA 2XYHB 1BQMB 5RUBA 4AFFA 2ADCA 3MEEB 2DIUA 2UV8G 3X1LB 3FZBA 2FJDB 3Q8YA 3PIPQ 4DV2J 2HYIB 2ASLA 1QUVA 2YNFB 1JKHB 5I3PA 2YBVA 1PSDA 3G71S 5KFJA 3DU6A 1ZAXA 2C3YA 2PIIA 2R7QA 4WBFA 2RDIA 5KAKA 1HBOA 4QIWD 3JAMY 4QR0A 2LEBA 1NDLA 3W61A 2NSBA 3BV8A 2VODA 1QTMA 3AQOA 3NCQA 3MCOA 1ZH5A 1RHRB 3PXGa 4YHHJ 1X7VA 1RHUB 2UUTA 2UUAF 5J1NA 2OO4A 1NBEB 3MAHA 1GX5A 2RSQA 1M5VC 4XDDA 4C8MA 2IDEA 2QLBB 5H9EK 5AXLA 3QAEA 4ZJLA 5DG7A 4OX9F 1YRUA 3MECA 3Q89A 1IVZA 3BSCA 3OL7A 1D3WA 4CYUB 5D4PA 2CQ0A 2C1EB 2QYGA 2OPSB 3KDNA 3CD7A 4PG7A 2ACYA 4HYKA 1IKXB 3DLGB 1Q79A 1SH0A 1HNWJ 5KFGA 3R9LA 2MYFA 3WDOA 1HQUB 4IQMA 1Y00A 4DEZA 5C2CA 1HMVA 4YFUA 2RT3A 1KR4A 5DZ6A 2QT7A 5BYQA 4P73A 4PQUA 1KTQA 4PXBA 5HQ8A 4J37A 3QJJA 5T41A 1WC3A 2F63A 3BKUA 1S5ZA 1KQGB 4KB7A 2KFNA 3CGIA 4QIVA 2H65B 3ZXWA 3IRXB 3V6JA 2MKKA 3PV8A 3H90A 1F2GA 3G2XA 3TJAA 1FCAA 3UCGA 5KFLA 3IP0A 2OELA 1KN6A 2DNNA 3K5OA 3HHKA 3P3DA 1S59A 4J9OA 1BWEA 4LQ3A 4Q2LA 3T9ZA 1FD8A 3O44A 4LF1A 4DF4A 4ZCIA 1CJVA 3T6BA 4O4GB 3KUHA 4JOUA 2HFUA 3X3UA 3LP0B 2KHDA 1HBNB 5ETQA 4MH8A 1P9QC 4I2QA 5A6WA 3R7NB 3OSNA 2DK2A 4CH0S 2CPFA 3GYXB 4HEA9 2GQCA 5JVHQ 4M5GA 1IR0A 2KXFA 1MN9A 4K5SA 1P27B 4CI0B 4LT6A 2OUGA 2N3LA 1JLEB 1LWEB 1FJ7A 4OI0A 2IDLA 3C6TB 1JLAB 4FF4A 1U6ZA 3QWPA 2YWEA 1G6BA 3MEGB 1X4GA 2XB2D 1LWCA 3DRPB 4RO0A 1TUGB 3UCZP 2YWWA 2CYYA 4IFVB 4RNOA 4DV2F 2UVWA 2YKPA 1CJTA 3EDRB 1I1GA 2FC8A 3MD1A 2NPIA 3CF5Q 4Y2MA 3P96A 2LU2A 1HQ2A 3QWUA 3I56S 2MKHA 4AL5A 3SFGA 3C15A 3CD6S 4FZVA 1AFIA 2OEMA 1QSYA 2R7TA 2H5IB 1RBLA 3LUYA 3HHEA 2VOOA 3J7Z5 2OH2A 3VQSA 2HHQA 1AUDA 4YHHF 3IM8A 3GIRA 2EEYA 3H42A 3OFGA 1NEEA 3W3SA 2ZJQQ 2Z58B 1HPZB 1S0VA 3BGRA 2AZ1A 1O5JA 4P6QA 2GQ2A 1Y5LB 1JWWA 4DSKA 3D7SB 2HHXA 3EUNA 3OV7A 1FI4A 3FC9A 4P10A 2KXHA 2EWHA 3QFWA 1F1BB 3ILLA 5C25A 2RU3A 4NX9A 4QYRA 3G86A 1RWNB 4G1IA 3TJ9A 4FYVB 1LW2B 2DITA 1RTIB 2HFVA 3SYZA 5K14A 2LDIA 3NS6A 1Q53A 4E2FB 1J5EF 1H2UX 2N3OA 2E1CA 2KT3A 4HI1A 2Q43A 4NA3A 4ECRA 4DU7A 2LU1A 1HNWF 2HBZB 1YGYA 1R0AA 2BJEA 4PG5A 2Z0GA 2MPUA 4CLSA 2IRXA 2KFYA 4ZPTR 2ZNYA 4OLOA 3ZZPA 1H7XA 5HK4A 2MJNA 2MDAA 5D15A 1TKTB 4EZ6A 2J7UA 3CJ3A 2DR7A 2R7OA 4QR2A 4ZLPA 3CJ0A 4W4MA 1MMDA 2C3PA 3D1QA 3R6LB 2H5EA 3F44A 4DR2J 1TUWA 1QAXA 5GAHI 1KHWA 3CC2S 4DX8H 4P2XA 4PKDB 4C0OC 2A2DA 2KYZA 5CYMB 2GAHC 2Z2LA 1C1BA 1N6QB 1S1UA 1C2PA 2B5JB 4ZPAA 2MXYA 3DCAA 1RXOB 3UDCA 3TANA 4CLWA 5IXUA 1RHQB 2FLPA 2VKRA 1AUSL 5GADI 4CLZA 4DFMA 4OV1A 1YRTA 4J9RA 1WHYA 3P45B 4RBTA 1TU0B 1GMWD 1GX6A 2EXUA 3CDWA 1UTAA 3KJVA 4M5DA 4A47A 1IBLJ 2YKNA 2IC3A 3K8WA 3DRYA 2ZZNA 2YXLA 4LQ9A 2KVIA 4ZA1A 4DL7A 3KLIB 1F60B 4NOHA 1NUEA 2DBBA 4ILMA 2RF2B 2DNRA 2D3O1 2MSTA 3R8YA 1RQ0A 4JI5J 2YPYA 1RK8A 2R7XA 2W01A 2BW2A 2QMUB 2QA1A 2LQ8A 4O44B 2YNGA 3FVYA 1V3RA 1TL5A 4ZP7A 1NB7A 4DPWA 4ZVSB 1U47A 3D6TB 4DSLA 4JI6J 3R5BA 4O3OA 3D0IE 4M63A 2BJ9A 2CZ9A 3JTNA 4GC6A 1WEZA 3H5YA 3BGOP 2CQGA 1BE4A 3BREA 3BQ0A 3P4UB 1RHMB 2K3KA 1EP4A 1U7LA 4NPOA 1TL3B 3JSMA 1T95A 1X5SA 3DM2B 4HHHA 4PG6A 1RAIB 2CPDA 1RWUA 2VL1A 3E01B 4KV8A 4JV5J 2DNLA 4R0JA 2EFPA 4OI3A 5ETVA 3FGVA 7FD1A 3L7UA 3GLJA 1WACA 1R0BG 4JI2J 1RAAB 2WBMA 3C14B 2YH0A 4YDXA 1B7FA 1O8BA 2DNQA 3M2UA 4B9NA 1ULRA 1V6HA 1DJ0A 4C48A 1W2BR 1SXLA 3ZZRA 2ZH3A 3IG1B 2YX7A 3J81U 5BXIA 4FYWB 2XWYA 2XNRA 4CCHA 4WIQA 4USUA 2DTJA 1L5UA 5BYRA 4Q45A 3RB4A 5F9NA 2PA3A 2H48B 1ACMB 4LR7A 3L95X 4KFBB 4C11A 3UO0A 2H5JB 3TEGA 4DR2F 1FRHA 1T9VA 4RBVA 4Y2AA 2C42A 1REVB 4EEYA 4LBPA 3N6NA 2KM8C 1D0EA 2FD2A 3H40A 5HBMA 1TKDA 3GFXA 5HL7Q 4NI2B 1OSDA 4X66F 2VIHA 3ET6A 3I87A 2E9RX 2KH9A 5DZ7A 4L73A 4WP3A 3BGUA 1TL7B 3MEDB 3QIPB 3MMCB 3KMSA 1YJUA 4W98A 3JQKA 3LAMA 4HT5A 5K20B 1SJFA 2G1DA 4DMZA 4ID5B 2MKSA 2UVRA 1IBLF 1MSWD 1SC6A 4EGLA 4WTYA 1SV5A 4F0HA 3GG1A 1T03B 4JUZA 3G8QA 1WDDA 3RR7A 2CA9A 4PABA 1O51A 1G4CA 2DNOA 1X4EA 1MG7A 4JI3F 2CNOB 1KDNA 3GV8B 2FHOB 3L7OA 4DL6A 4JI5F 4J9VA 3G6XA 1QVGR 2FIUA 2RUSA 2K3IA 1SL1A 2HVIA 3M6UA 3LGMA 1EAYC 1RWXB 2I8EA 2F8HA 2BW7A 3TA0A 2RQKA 3QRRA 1SUQB 1GAOA 1S99A 4GRSA 4JI4J 2NSCA 2XGQA 2ROPA 2I5JA 4JI6F 4LIWA 2MKCA 2V4RA 1X5TA 3MM8A 5K8OA 3WIVA 1CSJA 5AE1A 4V1Ak 3EVMA 4KGVB 1GK8A 4NCGA 4O3NA 3ADAC 2EC2A 3S8SA 5KOXA 3ILIA 4TY8A 2EBEA 3VHQA 2DGTA 4NLOA 2QSFA 2WONB 2GMLA 4PCQA 1NDKA 2XYGB 1HNVB 1WKLA 4OYBA 1QE1A 1RTJB 4LF9J 2DCLA 4JI2F 1SH2A 4ZN3A 1TUVA 1D1UA 4C97A 2V2QA 1S79A 3I5BA 2BUNA 2J6SA 4C3LA 1RCXB 5IFMA 1YLXA 2OPRB 3BR9A 2RILA 3CJ8A 1DRZA 4CIOA 2Y0BB 5HJYA 2IYIA 3RBZA 2VJUA 3CJTA 4YY3F 4FYDA 3U02A 4RNFA 3EWGA 2MZJA 1ZBTA 3OVSA 4AL7A 4XO0A 5BYSA 4CP5A 2FHJA 3EGNA 3MCMA 1NHVA 1OIAA 1N33J 1NNDA 5DM7Q 1I51B 2YQ3A 1CJUB 1S1WA 1V3SA 5KFRA 3D2WA 1UEVA 3IS9A 4KAIA 2CQ4A 1REGX 2NLWA 1D9AA 2GX8A 4MKYA 5EHHA 1RBAA 4F4YA 5CQGA 3NCPA 2AJ2A 1NJZA 5J1PA 4WF9Q 5CZVA 2YNHB 2QLFB 1S0OA 1YJRA 4ZDNA 2XMMA 1AXQA 2YKOA 3DC2A 2HW3A 1NSKL 3C16B 2YX4A 1VYAA 4XK8C 3M32B 4ITSA 1Q16B 3FEZA 1BWVA 4NA2A 1R0CB 2RS8A 4PYAA 1QTNB 2FY1A 3GV7B 2HS0A 2ZH1A 2C2DA 1LV5A 4LF6J 3I96A 2XSFA 5CD4H 2HHSA 3LAKA 3QGIA 3MZIA 2LCWA 2WVBA 2F9DA 4WZQA 1I94F 5LJ3Y 3DI6A 3N6MA 1PC5A 1GXTA 3HI9A 1DQAA 3AA9A 1F9FA 3HM9A 1FDNA 1Y7PA 5DQGA 4K4VA 3BB5A 1YHQS 5E33A 3EZOA 2DXEA 3OTBA 1U2RA 4IYQA 2R7RA 4WP9A 4DR7J 3UN3A 2BJ1A 2DEJA 1CS4A 2R3VA 2WZ1A 4JI4F 4YEAA 5F8GA 4RW4A 3MURP 3AQPA 2DJWA 4LF5J 4EK2A 1HW8A 1RISA 1HWKA 2AEJA 5F8HA 3IR6B 1U0HB 3FBCA 2HZCA 4Y2IA 5CAAA 2HG4A 2X1FA 3VR1A 3CB4A 3KDOA 2OPQA 3Q22A 3W64A 2NUUG 2DXFA 2CNKB 3KXDA 1IWAA 1V9OA 2XMUA 1RABB 1XQIA 3DKDA 1ZM4A 1HL6A 2YPZA 3EVOA 3MDFA 4LF9F 3PNIA 1LK7A 2I2YA 4DR6F 2CFXA 3I4HX 1GXLA 2LEAA 4QWEA 1IJEB 2RHQB 2YH1A 3AD7C 3HVAA 4DV4F 2IJRA 2FVRA 1AZSB 4NCAA 4R8UB 3ISNC 4LSZB 3W1YC 5CYQB 4ZCLA 3N28A 3OL9A 3I9ZA 4CQ1A 5DQIA 2ZD1B 5IWAJ 2ZOFA 5SZTA 2XWXA 2XGPA 1U1LA 4QYZJ 2M52A 3ULHA 2CWKA 1C0TA 2I1RA 3KJNB 2I38A 1SIZA 4IG0B 1MWQA 2MMYA 1S9GA 2V2ZA 1TL1A 1SJ1A 4TYAA 3QLHB 3H7HB 4LIRA 1OYEA 2WTFA 2UU9F 4F7VA 6AT1B 4DN0A 4W90B 5ETMA 2IAJB 5F9LA 1VRTB 2QLJB 1DAXA 4YOEA 3BQ1A 3TAMB 2XI2A 4B9LA 1D9DA 2YKMB 3MM7A 2JRSA 1Y0HA 2UXDJ 1IN0A 3PW0A 1OPIA 1WC1A 3DOLB 4MFBA 1HYSA 2JEIA 4I7FB 5DG9A 3O5TB 1QSSA 2N82B 3G8SA 4NLSA 4CLKA 2ZBCA 4ZMMA 1YK9A 1ZAVA 2DGQA 2RB7A 2PDAA 1V3ZA 4LBHA 2LEPA 3TR5A 3VGTA 4B3OA 1G1XA 2MKIA 4KHPF 3CCQS 2VQEJ 3KLHA 1KLMB 2J9DE 4ED8A 3GE9A 1PKUA 4ER8A 2GO8A 4LSNB 2VPZB 1U8WA 2ABYA 1X5PA 1VQNS 3C6UB 4DR7F 3RB6A 3DMJB 1RGVA 3DRRB 2QC3A 3ICLA 2O1PA 1S72S 2BJ7A 2U2FA 2CJAA 2A2CA 4CO3A 4LF5F 2CIMA 4C4WA 5HROA 4KKOA 1KSPA 2BMBA 3MGJA 4DV7J 5D6GA 1I6JA 3K89A 1SI9A 3PJWA 1DLOA 4OZ2A 1R8AA 1FVQA 3C66A 2R9LA 5ETSA 4IG3B 1FX4A 2UUBJ 1WC5A 2ZH6A 1VHIA 3LPYA 4TNOA 2B0GA 5CYJA 1VJWA 4IRDA 1RT3A 4U95A 4DSFA 3KK3A 1JLFB 3MEKA 3OW2R 2ZH2A 1X9MA 3R6GB 2QL5B 2OIHA 5GAGU 4ID8A 1AB8A 4WJBA 3HDSA 3KLVA 3P5TL 2MB0B 3RJMB 2QN6B 3R27A 3F41A 2G4BA 4DV3J 4J7CA 1C0UB 2UXBF 2JEGA 4QW8A 4BDPA 1LQ9A 4J9MA 3UN5A 4B9MA 1KD1T 2GV1A 3S6EA 1H6KX 3RYLA 3VGUA 3KTQA 2YVSA 3A8JA 3QT6A 4OJHA 3UVJA 1R27B 1S4EA 3W63A 2JWNA 5IWAF 2VPXB 2HQGA 5GMDA 4GVBB 3PX6A 3BKFA 4DS5A 4DQRA 1GT8A 2EBGA 1E6YB 3BH7B 4URSA 5ADZA 4KGZB 3CCRS 2B6AB 4L76A 3JQJA 3OR1B 2FZGB 2VFTA 2OI2A 2I6WA 3W66A 4HH0A 4UZCA 3BGFA 3DLKB 1TAQA 2ZZMA 3CC7S 4WCEQ 3WC2A 2MKJA 2HQFA 2B43A 1VCTA 1VQ4S 2K7KA 4K8RA 5HP1B 2DISA 3NOGA 2UXDF 1UP1A 2HVZA 3OL8A 4DQPA 3AFGA 4M8LA 5HATA 3R5AA 1CEZA 1LW0A 4ZN1A 2HVEA 2P9EA 3CO0P 5IT9Y 4PWDA 3LA0A 4ECUA 4M5IA 3I82A 4DUTA 3MOJB 2W9AA 4IDKA 1MU2B 2G9OA 2R42A 3HXMA 1HQEB 4Y0FA 3PEJA 4DS4A 2JEJA 2ZWOA 4KH1B 3T1YJ 2EFOA 1ZYQA 2VQEF 3LWLA 3A4TA 5IT0A 4RWXA 1YJNS 1HARA 3H8YA 3QATA 2C2EA 2Z56B 4TLQA 2UV8A 1LFWA 4KGXB 5E3PA 4DR4J 3PFOA 2M3DA 2BKPA 3EE3A 2NREA 5B0EA 4MKAA 2CQIA 3B6BA 1YI2S 4DBQA 3KLGA 5D3GB 4DQQA 2JJ4D 3SV4A 2OMLA 1S6UA 2M5YA 2NUHA 4B3RJ 2HS3A 3ZZZA 1UW9A 1QDUB 2OEJA 4FP9A 4RW9B 4G1QA 4DSEA 4BC7A 1FRXA 5I4MA 2HFNA 3K5PA 2UP1A 2IFXA 4IFYB 3PTWA 4AUKA 2ZJPQ 3MD3A 4A4JA 2I9SA 1KTVA 2PMWA 3IC1A 2YNIA 4ALZA 5LMNJ 3FBFA 4J9KA 3AA8A 5C7PA 1M5PC 3IGVA 5KFWA 2IBOA 2ZH7A 5B08A 3POTB 1RACB 4OYWA 3M2RA 2DHXA 2V4QA 1URRA 4F3OA 3UPFA 3FZ2A 2V69A 5EN1A 3O1LA 4DV3F 1RTDA 2DR9A 3K57A 1FO1A 4M94A 3T41A 4I6AA 3GU0A 3ZO7A 3H2LA 4X62J 2QA4G 4ZLNA 4IH6A 4IUFA 1BHNA 1X9SA 1CJKA 4ECSA 4DCPB 2VFSA 5A8RA 3VZIA 4UUXA 3R1LA 2NYIA 1FRMA 4DG1B 2F5GA 3GYGA 5ETOA 1CC7A 2X1BA 1X4HA 3T5HA 3M8SA 2A10A 3M05A 3AAWB 2E5LJ 5KFYA 2QTWA 3HSJA 5H9FJ 1RT4A 3MFHA 3PW2A 5IQ6A 3CCVS 3GFYA 3VZHA 3Q24A 4TQRA 4NLWA 2IM1A 2HNZA 2PN6A 3CCTA 4OJGA 3W9IA 1KS2A 3NNAA 2HHHF 4WE1A 2KXNB 1KHVA 4U67Q 2VG7B 1WELA 3K5MA 9RUBA 5BR8F 1VQ8S 1Q95G 3TAQA 1DFDA 2OPPA 3CJ5A 4Q0BA 4FF3A 3S01A 2AJ0A 1U1QA 5E3QA 1TVRA 4WK3A 4MAKA 1Q8LA 3IO1A 1VQSA 3PG9A 1H74A 2ZE2A 1FKOB 4RU2A 2B4PA 3CO9A 2NCKL 3HSDA 4P71A 4IO1A 2LA4A 1SC3B 2D1CA 1HNIA 1RB0A 3M8PA 5EWGA 3OXLA 4J9SA 1NH8A 1Q1KA 3T1YF 2OTLS 2ZBPA 5L1IA 2OP5A 3SCJE 2VONA 4QPTA 3CEDA 2IVYA 2V2KA 4QBUA 2XLJA 2F8EX 3HX9A 2XSJA 1NKBA 3CCMS 3HK2A 1ZA1B 4A8FA 2DT9A 4OZ5A 3QT8A 3MXHP 1FVSA 1JMTA 4IR1A 3AXMA 2A6OA 2LFVA 5KFKA 3KFWX 3E2EA 3ITHA 3QSIA 2QO3A 4WYWA 4B02A 3I0SA 3ENQA 3FCVA 4XDCA 2FGOA 3BSOA 3MTKA 1XNRJ 4O0NA 1X4CA 3HHLC 4OYIA 4FXDA 5D4NA 3Q86A 5LMNF 2CPJA 2WBRA 3ELHA 1GMVA 3IWNC 4C8NA 9ATCB 4RU9A 5KG5A 3EM1A 4YUDA 5KFIA 3UR0A 2UXCJ 2HBQB 1JJCB 5L1LA 2JC1A 3N79A 4IQXA 1CJVB 2CKWA 1FWLA 3MAAB 4X62F 5J2PA 5KFFA 4J9QA 3IXQA 1X4BA 4AD6A 3BBBA 5DLFA 5KFMA 3L9ZA 3HHLA 2DCUB 1SJ3P 4Y00A 4WP8A 3SZ2A 1T8EA 3FDSA 1SJ4P 4V19X 4BS2A 3ZNUA 4JV0A 4NCBA 2LA6A 5DETA 2ALYB 1UZHA 1S6QA 2YWKA 1YJ7A 5A6PA 4DFPA 5KT4A 2JDJA 1CJTB 1D9FA 1FJGJ 1RU2A 5IC6B 3WX8A 4BWMA 3P6YC 1RWPB 2GHWA 3D0HE 5FLXU 3C15B 5D0GA 1UEUA 4WPAA 4IO9Q 2F9JA 4DSIA 4JV2A 2V34A 1VRQC 1W7WA 1S1VA 4DXLA 2F1FA 1OPZA 4ZLJA 4U9RA 1XBWA 2FLLA 4Q43A 2JOQA 4M5LA 2ZHAA 1PCAA 1XMBA 4DPXA 4M95A 4LRAA 2E7WA 1HHTP 1BC6A 4GMKA 2DNMA 2GGPA 5KFPA 2KTQA 3Q2TC 2LQ5A 4TU7A 4CLLA 3BGRB 3T1HJ 1EQMA 2HFOA 1LFPA 4KYZA 4O23A 3V81A 3SSQA 4ZOSA 3MM5A 4I6WA 2VDHA 5M2UA 1IKVA 3WX4A 2YQ1A 2HIQA 1BQMA 2KHCA 3QFHA 3AY0A 3S1TA 1PGZA 1MWZA 3EZ5A 3BYPA 1DTTB 5F8IA 2E1MC 4USJC 2CPZA 2YNFA 2WVEA 5E3RA 4DPTA 1JKHA 2H51B 1TR0A 3CWJA 2VF3A 1YWXA 3J80Y 2B7CB 2QLWA 2QA4S 5DRKA 1OO0B 1NHKL 4U7UD 1VIOA 1T0TV 2FHMA 4ZPCA 2W8LA 2EW9A 4UUWA 4FNHA 1YVFA 2L9DA 2G0CA 1YJWS 3RBXA 2P9CA 4B17A 1XNRF 2V9WA 3MUTP 4ED0A 1C1BB 1JIHA 2XCAA 2AX1A 3EJMA 3K5LA 4I1TA 1R7IA 3TRGA 2PMHA 5KFSA 3DRXA 2HZAA 1KQSR 2PO4A 3BDPA 5CHCB 4D3GA 2KI2A 3TYTA 4CO0A 4LRCA 4OL8A 2C2RA 2QLXA 4OFZA 1RI7A 2BOPA 5B0AA 3OJSA 3OT9A 2K06A 4NXMF 4K4XA 1UVNA 1S1TB 3GP9A 2IC3B 2ZH5A 1N5YB 2H4WB 1XNQJ 1H2VZ 2OKQA 3ZZOA 1VDHA 3RAXA 1IKXA 3DLGA 2DHHA 4XTTA 1MNEA 3CMQA 1HQUA 2GIFA 4TQSA 4CO1A 2E44A 2RQMA 2FPHX 2AEMA 4OIXA 1QVFR 3GPAA 4RWWA 1UVKA 4DDFA 5HJXA 3TVYA 2LYVA 1NSQA 3EGWB 6FDRA 3AHPA 1IUJA 2DKOB 1O6XA 3QMQA 2V6AA 2FHJD 4ZCKA 1VC6A 2FDNA 2XYPB 3B54A 3M4XA 1GEHA 4Y28C 2NQPA 1D8YA 4USHA 1SPBP 4KGMA 3W2WA 4CLYA 2JX2A 3J7YU 3T5KA 2PT0A 2HEKA 3BYRA 2GS8A 5ETTA 3DLEB 1UA0A 1VRUB 2MGZB 1R6YA 2FJWA 3JSMB 3HULA 4Z2XA 2XI3A 2MEWA 4B08A 4X4PA 3EPGA 4OYMA 1NK8A 2RHSB 3OBIA 3LP0A 1HBNA 1TMJA 4QIGA 5THWA 5HMYA 4KGKA 5GAEU 3T1HF 5LT5A 1MMNA 3EMTA 4PG4A 1JXEA 1CQMA 3OXFA 1N5TA 4FDFA 2W2OP 2MZTA 3B78A 5K8PA 4FF2A 2L08A 4ECWA 2BX6A 2P6TA 3R3TA 1RTHA 1S9EB 1JLEA 3TI0A 1LWEA 1OYDA 3K58A 2OMOA 3VGSA 2D3OR 1OY8A 1JLAA 5FIIA 2ZBRA 4CNZA 1RBOB 2BJ3A 3MEGA 2DGOA 2VBZA 2PSZA 1PIEA 4WFNQ 4IFVA 4OI1A 4PXCA 2HSEB 2RMLA 1RHJB 1S10A 1NO8A 1VC5A 1T94A 4GVLA 5F8NA 4NLGA 5J2QA 2EKYA 2CJBA 2KO1A 4C11B 2BM0A 1AYEA 2IM0A 1SC1B 1SL0A 5IZHA 4TLRA 2AJ4A 3AJ2A 3D3CJ 3PEHA 1KWMA 3BZQA 4YR2A 3B4MA 5HBMB 1N8RT 1YDLA 3RW7A 3MR5A 2FLOA 2BXJA 3ET6B 2CUYA 1NZAA 1XK8A 3TVZA 4NLDA 2E29A 1XJWB 4QU7A 3NWGA 1M0SA 4DUYJ 1BUXA 1T3NA 3TP2A 4K4WA 1NRKA 4DL0C 1OMSA 1VQ5S 2LXFA 4FVCA 3H0PA 4LSLA 4OI2A 2YY3A 1IR1A 5A76A 1IQZA 3M30A 4ZCMA 4K2XA 2NS1B 4USKA 2IJNA 2BJ8A 3HKWA 4Q5VA 1RWMB 4OZNA 4PG8A 1LW2A 3PRVA 1RTIA 2KM8B 4ZP8A 1EJ7L 2JFDA 3P49B 1NSPA 1FE0A 3QBCA 2HGNA 3OD2A 1UJ4A 2RE1A 5KG3A 2Q79A 1VI7A 1EIYB 3QSYB 1Q4RA 3FKBA 2CJQA 2GW8A 4DU8A 2J0QD 1TKTA 2GC8A 5H1SV 2LECA 4L74A 4M5NA 1PYSB 3SFUA 2MQOA 3ZNJ1 3VCDA 2CDQA 4ED6A 4KT0C 2X3GA 2R7VA 3BO4A 1WD6A 1MROA 2I5JB 3GCWP 3DOMA 3F56A 2VG6B 4KR0B 5CYMA 1N6QA 4TVAB 4QWCA 1VBZA 3ISND 4RW8A 2B5JA 3OXGA 4CT8A 2G2ZA 2PFDA 2DH8A 3PYEA 2FTRA 5DO2A 3GJSB 4CDIA 2CQPA 4G65A 3M8QB 1JLQA 3EDQB 2CQHA 4DV5J 4QWDA 3F73A 5CABA 3AXKA 4YB1P 3M9MB 3BSAA 4UOCA 5LL6d 1T02A 3RRGA 1FTRA 3HVTB 4G3IA 2RRAA 3WQPA 4NXNF 4DPOA 2GIRA 3UN2A 4JB8B 2HK2A 3TVKA 2R8HA 1X4FA 2RF2A 1UJ6A 2VBYA 4ES3A 1UPPA 3E51A 2D9OA 2O67A 1LXJA 2AV5A 1RT6A 4O44A
chains in the Genus database with same CATH topology
1SPBP 3CNQP 2W2NP 4NMXA 4JP8A 2PMWA 2W2MP 2ZWPA 1V5IB 3WHIA 3H42A 3QFHA 3BPSP 4OV6A 3WIVA 3AFGA 3A3PB 2W2OP 3P5BP 2Z58B 3WIUA 2Z2YB 2W2QP 3SQOP 2Z57B 3BGOP 2W2PP 2E1PA 3A3OB 3VHQA 2Z56B 1R6VA 4YN3B 3T41A 3VV2B 1SCJB 3CO0P 4K8RA 1ITPA 2XTJP 2Z30B 2ZWOA 3A3NB 3GCXP 4NE9C 2Z2ZA 3GCWP 2QTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPB P;  3CNQ P;  2W2N P;  4NMX A;  4JP8 A;  2PMW A;  2W2M P;  2ZWP A;  1V5I B;  3WHI A;  3H42 A;  3QFH A;  3BPS P;  4OV6 A;  3WIV A;  3AFG A;  3A3P B;  2W2O P;  3P5B P;  2Z58 B;  3WIU A;  2Z2Y B;  2W2Q P;  3SQO P;  2Z57 B;  3BGO P;  2W2P P;  2E1P A;  3A3O B;  3VHQ A;  2Z56 B;  1R6V A;  4YN3 B;  3T41 A;  3VV2 B;  1SCJ B;  3CO0 P;  4K8R A;  1ITP A;  2XTJ P;  2Z30 B;  2ZWO A;  3A3N B;  3GCX P;  4NE9 C;  2Z2Z A;  3GCW P;  2QTW A; 
#chains in the Genus database with same CATH topology
 3JQM A;  3NP5 A;  1F2H A;  4JP8 A;  3HFZ B;  4I4B A;  5HLF A;  2G13 A;  2RH3 A;  3NMR A;  3L7P A;  1U2F A;  5AE3 A;  3KMQ A;  2AGO A;  3ILJ A;  1FRI A;  3K5N A;  2MLX A;  3JSR A;  2DNG A;  1TQL A;  4ENO A;  2BEF A;  5DGA A;  1X9W A;  1SH3 A;  2DNH A;  3DXS X;  1XMO J;  2HNY B;  1FKP A;  4H4M B;  3KOA A;  3AOD A;  4ZVU B;  1H7W A;  1BQX A;  1XR7 A;  3DM2 A;  1CG2 A;  3G4S S;  3UNY A;  2R7W A;  3AB4 B;  3DDK A;  4LF7 J;  3E01 A;  3NS7 B;  2C3O A;  1T9Y A;  3GII A;  3W9H A;  4RKU C;  3G8T A;  4B9U A;  2ZBI A;  3FMW A;  4HDH A;  2CG4 A;  1BY9 A;  2ATC B;  1M5H A;  1RE1 B;  2HBR B;  3K8V A;  3TWZ A;  4CLP A;  3C14 A;  3CJK B;  1HNX J;  4TN2 A;  2ZKU A;  2DD8 S;  4FF1 A;  4I56 A;  4E0D A;  3PHT A;  3M9N B;  3VAF A;  4A8M P;  3FMB A;  3MMA A;  3HT0 A;  5T7L A;  2OEK A;  3CUN A;  3IG1 A;  2VA3 A;  5E5N A;  3OL6 A;  1FDA A;  3D28 A;  3UDL A;  4R5P B;  1ZPW X;  4Y2C A;  3DI6 B;  2EK6 A;  1NH7 A;  1FK9 B;  2FZC B;  3RBD A;  1WOO A;  1XR6 A;  1UL3 A;  2PD1 A;  1S6P B;  5A8W B;  1T9X A;  4C8Y A;  3B82 A;  5A8K B;  2QE5 A;  5KFA A;  4DUZ J;  2DH9 A;  1Y4Z B;  1CS4 B;  2HVH A;  4PQA A;  4ZPB A;  3THV A;  1UW4 A;  4ZJQ A;  1RT1 B;  2R2T A;  4BHQ A;  3N5B A;  1XIQ A;  5KFD A;  4RW7 B;  2KDO A;  4ELU A;  1REV A;  4F02 A;  2V8H A;  4J9N A;  1JJH A;  3BJY A;  4RZR A;  1UFL A;  3LAL A;  1MN7 A;  1TK0 A;  3NGK A;  4NML A;  4LF2 A;  1ZA2 B;  3MPD A;  1TL7 A;  2JLF A;  3MED A;  3TEH B;  3MMC A;  4F8R A;  2N7Y A;  2CNL B;  2EK1 A;  1UCN A;  5C5J A;  5JVG Q;  3D0G E;  1N48 A;  3W2V A;  3EVW A;  1EX8 A;  3D68 A;  1N5S A;  4ID5 A;  2BR0 A;  1PBA A;  3HHN B;  3PJ9 A;  3AD8 C;  3UQS A;  1M5S A;  2ZNZ A;  5CCM A;  3TX0 A;  2BAN B;  3OFF A;  2VFV A;  1WC0 A;  1JNZ B;  4RW6 A;  3M6V A;  3KWM A;  4MK9 A;  3L3C A;  3MI7 X;  1IQT A;  4CM2 A;  1PYT A;  1LEO A;  4A8Y A;  4PEO A;  4MMO A;  3EYZ A;  2WB4 A;  5J2N B;  5J1E B;  3CJQ A;  3MMB B;  3IGN A;  3ENW A;  3LP1 A;  3US5 A;  3IRW P;  4QIF A;  4MK8 A;  5DDR C;  3UI3 A;  4ECY A;  2LXU A;  1OJ4 A;  1VQO S;  3FFI B;  1S76 D;  2ZM6 J;  4B3S J;  4ICL A;  3OLA A;  1R6V A;  1C0T B;  2AYB A;  1O0P A;  2EFQ A;  2K1R A;  2ZOM A;  5DJB A;  4HTJ A;  4QOT A;  1Y5I B;  5M2P A;  2R4F A;  4J90 A;  4IH7 A;  3NNH A;  2W24 A;  1B7Y B;  2XM3 A;  1HNZ J;  3KUG A;  1SCJ B;  3BH6 B;  1KFD A;  3V4I A;  1KP6 A;  2W2N P;  1XMO F;  1WG1 A;  3MM6 B;  1Z2Z A;  4ZP6 A;  2AHO B;  1F9E B;  3FSY A;  2R8K A;  2WW4 A;  4WKR A;  1KQK A;  2AZ3 A;  4N8O A;  5JMN A;  1HR0 J;  4LF7 F;  1T3O A;  1TZ0 A;  3MM7 B;  2WON A;  2FJB B;  1HNV A;  2BRL A;  4DR5 F;  1RTJ A;  3KHG A;  4HT7 A;  5FD1 A;  4MFB B;  5LMU J;  5LJ5 Y;  2G1H A;  1HYS B;  5MAO A;  1UA1 A;  2IM2 A;  4KQZ A;  2F3J A;  3DHX A;  3KK2 B;  5H9F K;  1FRK A;  1HNX F;  1N5V A;  1GTE A;  5D0E A;  3I0R A;  1RCO B;  1VQP S;  2AU0 A;  2VD3 A;  2GHP A;  3SDE B;  3J7A N;  3UDV A;  2OJ3 A;  2OPR A;  1DHM A;  4B3O B;  2ZJR Q;  4U6P A;  2R7U A;  4YR0 A;  4ZK7 M;  2X7I A;  2QG9 B;  3NGS A;  1RHK B;  1NK7 A;  1CBK A;  1BD6 A;  4QU6 A;  5HO4 A;  1F9H A;  4ZIW A;  4X4V A;  1TFY A;  4DV6 J;  1C4C A;  4HVZ A;  2HFS A;  1HHS A;  4WU3 A;  5HN0 A;  5CZX A;  3BM7 A;  1LWF A;  1CJU A;  1S57 A;  1IR2 A;  2RIJ A;  2N7C A;  1WI8 A;  2CRL A;  2XZW A;  3E8O A;  2PC6 A;  5B09 A;  1QAJ A;  1VIX A;  2F40 A;  3CT9 A;  2ATL A;  3SQG B;  5M2R A;  4AT1 B;  2CQ2 A;  3H5X A;  3TUP A;  4LFB J;  4P52 A;  2GCF A;  1NK5 A;  3BEG B;  2QJ3 A;  2HWT A;  4C98 A;  3I55 S;  2WVF A;  1RT3 B;  1Q86 T;  3A8E A;  2KJV A;  1RLD A;  4DX7 A;  2ADB A;  1NXI A;  2P5V A;  3UWT A;  3MPW A;  1PC4 A;  4DJB A;  3AJ1 A;  4F2R A;  5L1K A;  2WVD A;  3GON A;  2X3D A;  4O4R A;  2ZHB A;  4HAC A;  3PO5 A;  3CW2 C;  3D5M A;  2KRB A;  2GJF A;  1MW7 A;  2H9Z A;  4K0K J;  1YTY A;  3GQC A;  1AW0 A;  3T1A A;  3PW7 A;  4OV6 A;  4J9U E;  2Z57 B;  3D6M B;  4OZ1 A;  2JSX A;  2ZM6 F;  4B3S F;  3RZA A;  2GMJ A;  4AND A;  1FD2 A;  5A2Q U;  3UR3 C;  4A8O A;  2V67 A;  2V8P A;  4DHV A;  3K59 A;  1TL4 A;  2FVS A;  2GFF A;  3O8W A;  3NBP B;  4WWS A;  4ILR A;  1U0H A;  2O01 C;  3J81 Y;  1HNZ F;  1HWL A;  4N7T A;  2Y3Y A;  4PRF A;  5ITH A;  3V4M A;  4DOZ A;  2P6S A;  4OX7 A;  4ES1 A;  3HP6 A;  3KHH A;  3UDE A;  1A6L A;  2R8J A;  1E6V B;  2XCP A;  2R2U A;  2XZD B;  2KJW A;  2ZFH A;  4HR2 A;  2BVZ A;  5CD4 A;  1JLC A;  3SQO P;  1HWJ A;  4DL4 A;  2IBK A;  1LW0 B;  3FCH A;  2XMJ A;  2HRT A;  3PDN A;  1TKX B;  1Q82 T;  1FEH A;  4TY9 A;  5C2G A;  1P8G A;  1U1R A;  1UET A;  4ED3 A;  2P2C B;  5E41 A;  2E66 A;  3ZTP A;  5GAH U;  1R8C A;  1T9W A;  1IKW A;  1PJ5 A;  1AZS A;  1IBC B;  4R8U A;  1Y3K A;  5IM0 A;  5KFO A;  2A1B A;  3T5L A;  5CYQ A;  1PIL A;  4KRW A;  4JBC A;  3HHL D;  1RJJ A;  4B9S A;  1JQG A;  1UKU A;  4NLQ A;  4DPY A;  4ZKA A;  3TAP A;  1SJQ A;  1S97 A;  4HL9 A;  3BO2 A;  2H1Y A;  2DNZ A;  1KON A;  5GAD U;  4CWB A;  1RT7 B;  3CDU A;  2XUL A;  3ZZU A;  4ZHR B;  4X4N A;  2H3E B;  2O66 A;  4I2P A;  4NLT A;  3QLH A;  3QZ8 A;  2DR6 A;  2QFJ A;  1QSL A;  2DH7 A;  5L9N A;  1C1C A;  3PW4 A;  4H4K C;  1SBR A;  5GAE I;  3I6P A;  4EBE A;  3I31 A;  4UW2 A;  1LWX A;  3ZC4 A;  2Z2Z A;  1A0O B;  4ED4 A;  2NZ4 A;  1JJ4 A;  2EPI A;  3R7S B;  1WTF A;  1VRT A;  1ZM9 A;  3TAM A;  4H4O B;  2YKM A;  2VG5 A;  3D67 A;  1L3K A;  3VVU A;  5HVG A;  4LFB F;  1XN9 A;  2H54 B;  3V5R A;  2Y8Y A;  3EX7 B;  3FSX A;  1SJR A;  2VFU A;  3SMZ A;  3BS9 A;  4I7F A;  2LXI A;  4EO8 A;  4N56 A;  5J2M A;  1ZS6 A;  2B4V A;  2KN4 A;  1PBU A;  5BJR A;  2KL8 A;  3OUY B;  2B4O A;  3IWL A;  3OTC A;  3IA0 A;  4H4K A;  4E8U A;  4X4R A;  2B56 A;  4CH1 A;  3M2R B;  2RU9 A;  3LW5 C;  4GKK J;  4PR6 A;  2O5D A;  4K59 A;  1ELO A;  1JLB B;  3RU0 A;  5I42 A;  2BBE A;  2CPX A;  2V5H G;  1PYO B;  2J8S A;  3T5J A;  1KLM A;  1PAE X;  4K4S A;  2PMZ D;  3WHI A;  4K0K F;  1CQN A;  2HPU A;  3MM9 B;  1K47 A;  1VOM A;  5F3Z A;  4LSN A;  3RRH A;  1CJK B;  1D8Z A;  1ZET A;  5KFH A;  2E7V A;  3TZZ A;  1RT5 B;  4C6A A;  2AP6 A;  5ETR A;  3DMJ A;  3DRR A;  4M5J A;  1JXV A;  2A0F B;  4CM0 A;  2DR8 A;  2DEI A;  2ZIT A;  3K0J A;  4LRE A;  3MTJ A;  3RRK A;  4NRU A;  3DHW C;  4C2M A;  3NAI A;  4DV1 J;  1U09 A;  3OTD A;  1H73 A;  3BO3 A;  5AE2 A;  4Y34 A;  5JUM A;  4ELT A;  1FXL A;  4IG3 A;  5K5M A;  2HNZ B;  3GV5 B;  2JH3 A;  2ALZ A;  2BA9 A;  3Q8U A;  4F4A A;  2AEF A;  4FXV A;  4V19 J;  4YME A;  4NE9 C;  2UVU A;  3BPD A;  4NLY A;  5A0Y B;  3AOC A;  1FES A;  2J9E A;  3HF5 A;  1HBU B;  2OPP B;  4Q0B B;  1YBU A;  4ZPV R;  3RUB L;  3BKT A;  2RDD A;  3TZY A;  1X4A A;  1DAR A;  3G82 A;  4OHY A;  3BR8 A;  1NJW A;  1WF0 A;  3HFV A;  2LQB A;  2IMW P;  5D77 A;  1FFS B;  1BXN A;  4BCA A;  3ZZT A;  2A3J A;  5B0G A;  4OI6 A;  2HND A;  3Q2S C;  2BM1 A;  3M8P B;  2Y8W A;  4MYU A;  2B3T B;  2HQD A;  3NY0 A;  3KHL A;  4GVB A;  2HGM A;  4WU2 A;  3PM9 A;  3KK1 B;  3GJQ B;  1E6Y A;  3N01 A;  2J6U A;  1CVJ A;  4P75 A;  3C2P A;  4USV A;  2XS5 A;  2V50 A;  2XSJ B;  4DWI A;  4EYH B;  3OR1 A;  2ZEJ A;  3I32 A;  2L3M A;  4O3S A;  3T3F A;  5F3T A;  3DLK A;  3DGP A;  2FC9 A;  5EX3 A;  3UW1 A;  4NZ7 A;  4F4Z A;  3KLF B;  2F4V J;  2MTL A;  5KFX A;  1K0V A;  1SQE A;  3FRY A;  4YN3 B;  5CH7 B;  4JV5 F;  2XQC A;  3I5A A;  2CG8 A;  1ZPV A;  4DZ6 A;  4DCJ B;  4OJ1 A;  5HP1 A;  3W62 A;  1Y9O A;  1AA1 B;  3M8Y A;  3M8Z A;  1SKU B;  1LKZ A;  3VAK A;  4C3M A;  1N88 A;  1RT2 A;  2ZVS A;  1R8P A;  4LUB A;  2WRM A;  3QYY A;  4OX8 A;  2MZQ A;  2CQB A;  4YB5 A;  3QT5 A;  3RAM A;  2NR0 A;  3DRS B;  2XNQ A;  4DL3 A;  3GTY X;  1NME B;  3THP A;  4OX9 J;  4CO4 A;  2M88 A;  3LO3 A;  4Q8F A;  4GKK F;  2EVZ A;  2HRY A;  5K9F A;  3KG0 A;  3I5C A;  3TZW A;  3GR1 A;  4Y65 A;  4RL1 A;  2ZUA A;  4ZVG A;  3CCE S;  2YWH A;  1J2V A;  5KT6 A;  4MIA A;  5J2P B;  4EBC A;  2NPF A;  2IYG A;  1WOR A;  3ZTR A;  1S9F A;  4CTA B;  1ICE B;  3HHL B;  1IKY A;  4N8N A;  1KVI A;  4WK1 A;  4ILL A;  2D74 B;  2MY7 A;  5KFZ A;  1UVJ A;  1N0U A;  1EQ0 A;  4FPR A;  1FWK A;  3PKY A;  2V2V A;  1P1L A;  2VHG A;  3Q8S B;  1FJC A;  5F41 A;  3CDB A;  3D6F B;  2GNK A;  1VQM S;  1NLK L;  4DF8 A;  2DNY A;  3PRD A;  5B0C A;  4DV1 F;  2J0W A;  3MHY A;  3SSS A;  2D41 A;  3EIC A;  4KC5 A;  1F5C A;  4IFY A;  4J91 A;  4OJ3 A;  5IT4 A;  5KT7 A;  4ELV A;  1WJ9 A;  3RG6 A;  2C3U A;  3ZZ0 A;  2XG8 A;  4RUC A;  2HMI A;  4C8L A;  4RJV A;  4Q2M A;  1MWY A;  2JC0 A;  3CD0 A;  4ECX A;  1RSC A;  4AE5 A;  4DI6 A;  3D54 A;  1JXL A;  3CPW R;  1TV6 B;  5GVQ A;  5KFQ A;  3CCW A;  3POT A;  3H4B A;  1LXN A;  1V5V A;  1B3T A;  2XMT A;  4LMZ A;  3GIJ A;  5HQM A;  2GGP B;  4RUB A;  1JNR B;  2EFG A;  3E3X A;  1WC4 A;  4PUO A;  1SQG A;  4A46 A;  2HZV A;  3FCW A;  3DLL Q;  3WBZ A;  3V81 B;  2VB6 A;  3MM5 B;  1F0X A;  3QGG A;  4EZ9 A;  4X4U A;  2Y1L B;  4I64 A;  4QZV B;  4DG1 A;  3TQ1 A;  4UZB A;  1FER A;  3UFC X;  2D3U A;  4OYP A;  4RUH A;  2MSS A;  5B0B A;  3L09 A;  1EZZ B;  1VJQ A;  1OSC A;  1VHF A;  1RU1 A;  5C42 B;  3PJX A;  2D7S A;  4K4Y A;  1M1G A;  4HTI A;  3VAH A;  4TU9 A;  2NXN A;  3OR2 A;  2XO6 A;  4DQI A;  1YG0 A;  2GHV C;  1TEL A;  4Y3C A;  3M1V B;  2HS4 A;  2GO9 A;  3ISZ A;  4WFB Q;  3R97 A;  2F4V F;  1NKE A;  1RAG B;  2XHC A;  2E9Z A;  2VG7 A;  2MQN A;  4NYP A;  5F8M A;  3PRB A;  3HLU A;  3KJQ B;  3GJT B;  4FYY B;  4IOC Q;  5IS2 A;  1N54 B;  4X4S A;  2DIV A;  5KG4 A;  2L41 A;  2W1B A;  4Q7A A;  2HHU A;  1L3S A;  1KEK A;  2PA8 D;  5AXM A;  1J5O B;  2JL9 A;  2JVR A;  2QMX A;  2VV5 A;  1FKO A;  4HHJ A;  1Z1Z A;  2KT2 A;  1OQ3 A;  5ETP A;  3U1N A;  4N76 A;  3BBC A;  3GIL A;  3PZP A;  2JEF A;  3BN4 A;  3THT A;  2JZ5 A;  3FJ2 A;  5HMX A;  3CNQ P;  2Y1J A;  4FNI A;  3OFE A;  1EET A;  2ASY A;  4DV0 J;  3JSB A;  1YZ6 A;  3TA2 A;  2Z2Y B;  2ZDP A;  3QO9 B;  1Q8K A;  2QL7 B;  3KG1 A;  1ZTW A;  2COL A;  2OGU A;  4L75 A;  1XTZ A;  1J5E J;  3F0N A;  1AFJ A;  4HKQ A;  2P8I A;  1M5O C;  1RYS A;  1N33 F;  3TUZ C;  2G2O A;  1HLW A;  2FVP A;  4HHU A;  4RBU A;  2DY1 A;  2FVQ A;  4WYL A;  1BQN A;  3G6Y A;  1YIT S;  2KG0 A;  1UPM B;  2WSE C;  1IJF B;  2LQJ A;  4UOF A;  4IH5 A;  3RW6 A;  3HCX A;  3W9J A;  3MUM P;  3FSI A;  1A7G E;  3AH6 A;  2ZBQ A;  3W2W B;  3W7B A;  2PI4 A;  5AT1 B;  3GZ7 A;  4D3H A;  4PYD A;  3D66 A;  1NZ8 A;  2ILY A;  1S4F A;  4YDD B;  3VAG A;  2VFR A;  1YIJ S;  2WOM A;  4WXO A;  1NM2 A;  2E5G A;  4LF6 F;  2M2B A;  3A1Y G;  3OJU A;  1FDB A;  3OHA A;  1U24 A;  4TXS A;  4ETX A;  2CAD A;  1VQK S;  1S0N A;  2Z30 B;  2QRR A;  4F4X A;  3MAA A;  3JAM U;  1Y11 A;  3ZZY A;  1WOP A;  3SV3 A;  3M9O B;  5FDL B;  5F0W A;  3HZG A;  3NGR A;  2CQ1 A;  3H5U A;  3DLJ A;  2FQQ B;  2W9C B;  2BV3 A;  3PO4 A;  4UY8 5;  1HHQ A;  3GSI A;  2BAC A;  1RTH B;  1VQL S;  1Q5Y A;  3CDA A;  2MLZ A;  3NKY A;  4PWU A;  2AWZ A;  5HVF A;  4FS1 A;  2AD9 A;  4UT4 A;  2IM3 A;  1F5A A;  1U25 A;  2XS7 A;  2DHG A;  3JYT B;  1N56 A;  5LM7 E;  4Z7C A;  1VLY A;  3HVR A;  2V4J A;  2A18 A;  5KFN A;  4UF4 A;  5J2Q B;  3UD4 P;  1NSA A;  2RRN A;  2HQC A;  3GFZ A;  2XEX A;  3HJF A;  2CAJ A;  3AT1 B;  1AT1 B;  3LTO A;  2C2O B;  1VQ9 S;  4UOH A;  4U8V A;  3TW0 A;  2DHA A;  2QEX S;  4M5M A;  4Q44 A;  2Y9H A;  4XPE A;  1L3U A;  3VGV A;  2AIR B;  3H20 A;  4LRD A;  4EWT A;  3GYN A;  2A6M A;  3M2V B;  2OSQ A;  5HMW A;  2YKA A;  2ZH8 A;  1B99 A;  1VR6 A;  4R25 A;  4J9L A;  3MCS A;  2RKI B;  4LSL B;  3DLB A;  3M30 B;  1S12 A;  1H3D A;  5HVH A;  2ASJ A;  3GIK A;  3QQC D;  1NK6 A;  2LLZ A;  4DV0 F;  2NYH A;  1WG5 A;  3D1H A;  1U02 A;  4OHX A;  1HBM B;  1U26 A;  2OFH X;  3ENV A;  2B9E A;  3NMA A;  1NK4 A;  2OFG X;  3PCO B;  1FXD A;  3AOB A;  2EKN A;  3VF0 B;  4C9D A;  2XC9 A;  1FRL A;  2DGV A;  1DTT A;  2M0G B;  1IBM J;  4DSJ A;  3MCN A;  2HGL A;  1KKH A;  2L9W A;  3GMG A;  4KO0 A;  5K8N A;  2OD4 A;  3GSD A;  5EWE A;  1ROF A;  2B8P A;  4O0I A;  1KFS A;  3CSK A;  3DNC A;  4X4Q A;  4EI2 A;  3PAC A;  3IAS 9;  2W9B B;  4K50 A;  2CWX A;  1MRO B;  3DOM B;  2YWF A;  2QX0 A;  3SI8 A;  2KU7 A;  4C0H A;  1GNK A;  2FVC A;  4RW8 B;  1R8B A;  1ZM2 A;  4X66 J;  1CUL B;  4OZL A;  2W2M P;  1SB6 A;  2CPY A;  4LJM A;  1ZAW A;  4F67 A;  2QGF B;  5EGY A;  4TKT A;  4K4T A;  1JLQ B;  4C0B A;  2V0N A;  2ERR A;  1FXR A;  3LWM A;  4F2S A;  1VIS A;  4P2M A;  1TTH B;  2QFI A;  1JJ2 R;  2DVI A;  4G6V B;  1S1T A;  3MOZ A;  1RWO B;  5IC4 B;  3LGN A;  1N5Y A;  5F8L A;  1SL2 A;  2ZHO A;  1GQE A;  4NZ0 A;  4I6Y A;  1TFW A;  2VU5 A;  3W5Y A;  3DOK B;  1RWK B;  3LP2 B;  2AGP A;  4YB6 A;  4EO6 A;  4JI3 J;  2Z4P A;  2YTC A;  3HSZ A;  3CME S;  1KC8 T;  1TK5 A;  4EFA C;  1YRX A;  1RT6 B;  2QA2 A;  3HHD A;  2PI5 A;  1M5K C;  4DV7 F;  1F5B A;  1Z2L A;  3A8I A;  4QPX A;  5HLF B;  2DHS A;  4I68 A;  1Q81 T;  5G0R B;  1DTQ B;  4KBI A;  1S1X B;  1WSV A;  4WTO B;  2UUB F;  1GMU A;  3V2U C;  1XMQ J;  4ECT A;  3I9V 9;  1KVK A;  4FVM A;  5IOL A;  1QUP A;  3DLE A;  5CA5 A;  5DG8 A;  5KG0 A;  1FTC A;  1VRU A;  1BLU A;  3Q8P B;  2MGZ A;  5MLC V;  1FKP B;  2JVO A;  3HSG A;  2IPO B;  4DLE A;  4RPF A;  5DS7 A;  3CCS S;  4K2J A;  2M8H A;  4DX5 A;  3DYA B;  2VC0 A;  4C8Z A;  1UJ5 A;  3TQE A;  4NLP A;  4QJV A;  4Y6I A;  2VJV A;  1CC8 A;  1KBR A;  2KZZ A;  3C3L A;  2QSW A;  4FBT A;  2IHR 1;  4ES2 A;  2KRR A;  3GIM A;  1S9E A;  3PX0 A;  2UZA A;  3MMA B;  5T7L B;  3TZX A;  1EKS A;  4O3P A;  2VUG A;  3HD2 A;  5L8R C;  2F65 A;  3DGV A;  3UD5 A;  3RB3 A;  3OTO J;  3AB2 B;  1XC9 A;  4F3Q A;  3CCZ A;  1IBM F;  2EFN A;  4YY3 J;  3OQ2 A;  2E9T A;  1IXK A;  2U1A A;  1HD1 A;  4YP3 A;  2W2Q P;  1VK8 A;  3QJL A;  1HBO B;  1WOS A;  3Q83 A;  5JXS A;  1NDC A;  3J81 j;  1K9M T;  4KHR A;  4YR3 A;  1TMM A;  2MY8 A;  1SVD A;  5F0U A;  1OY6 A;  4NYZ A;  2HAI A;  3M7V A;  1RAJ A;  1PAU B;  4M5H A;  1N34 J;  1OY9 A;  3CJR A;  4ZVQ B;  1DY3 A;  2MJU A;  3QRQ A;  1Q8B A;  1X5O A;  2J0S D;  3SSR A;  1A9N B;  3WIU A;  2D69 A;  3NWR A;  1VQ7 S;  1WDT A;  2VH7 A;  2VAS A;  3LAN A;  4MIW A;  3KYL A;  3MEC B;  4F26 A;  2BE2 A;  1NPR A;  4B3T J;  3W2V B;  4UOG A;  2FYX A;  5FLX Y;  3V6D A;  3M6W A;  1DUR A;  5F8J A;  3IFE A;  4F04 B;  2ZKT A;  3BDE A;  1T11 A;  1WF2 A;  4N41 A;  2WSF C;  4LRB A;  3NNC A;  4Z37 A;  4DR4 F;  4RW6 B;  1I94 J;  1N36 J;  2MZR A;  2RUG A;  4KE5 A;  2HHV A;  5I3Q A;  1HMV B;  1YJ9 S;  3GWC A;  2BE7 D;  4LF4 J;  1LNQ A;  4PQU B;  3LP1 B;  4B3R F;  4F25 A;  1NJX A;  5D4O A;  4WII A;  1JLG A;  1BMQ B;  1RUS A;  5LOQ A;  1FDD A;  4ICL B;  2DRB A;  3H98 A;  1NPK A;  3MR2 A;  1UWB A;  2GQQ A;  2VZ9 A;  2Z8Q A;  2K1R B;  4ANC A;  4NZ6 A;  2APO A;  3R2C J;  2MQL A;  2VG6 A;  1XMQ F;  4IOA Q;  4C7Q A;  1DBD A;  4JI8 J;  1TKZ A;  3RBE A;  3I4P A;  1UWA A;  4ZVE A;  2NXU A;  2ZC3 A;  5I3U A;  3V4I B;  1LK5 A;  4XAK A;  2EC0 A;  5ETK A;  1PG5 B;  1H38 A;  1R8H A;  2GAG C;  3M8Q A;  1K1S A;  3EGV A;  3A8K A;  1P1T A;  1VS3 A;  1N32 J;  3IR5 B;  2IIH A;  4RNH A;  4I2Q B;  1RAE B;  3NEK A;  4FS2 A;  2VDI A;  3VAJ A;  1V5I B;  1S7I A;  3IN5 A;  3HVT A;  2V8D A;  2Y1R I;  4DR6 J;  5DDP C;  4DL5 A;  3I0R B;  5GMK a;  1I3O B;  2AJF E;  5LSR A;  2MZ1 A;  1Q7Y T;  3OPK A;  4F3M A;  4DV4 J;  2GVZ A;  5FJ4 A;  1LWC B;  1B70 B;  2BKO A;  2E5L F;  3U7J A;  1R3N A;  2ZH4 A;  3OTO F;  1SKR A;  2ACM A;  4C8O A;  1FX2 A;  2C2M B;  4FN5 A;  2L48 A;  4IRK A;  5KFV A;  3O6Q A;  2Z2M A;  2OTJ S;  1Y3J A;  3VAM A;  2BAB A;  3RB0 A;  4RR5 A;  3PY8 A;  1LWF B;  1T05 A;  2HWH A;  4U8Y A;  2UU9 J;  2AYE A;  2I0X A;  2XS2 A;  2HNY A;  4H4M A;  2E5J A;  2HKE A;  2IY5 B;  2ZC4 A;  3G96 A;  2R2R A;  1W2I A;  1N34 F;  1WNE A;  3KLE A;  1RTZ A;  2J7W A;  5L39 A;  2R8I A;  2GIQ A;  3RR8 A;  2RRB A;  4UTG A;  4DFJ A;  2BE9 B;  3VAI A;  3H25 A;  2HLU A;  2NXJ A;  4YQW A;  2ZVI A;  1HWI A;  5L1J A;  5C24 A;  3MPU B;  3R2D J;  2LVW A;  3ZFV A;  3PX4 A;  3U1M A;  4B3T F;  3CJK A;  2GVD A;  5C25 B;  4RX6 A;  4KJI A;  3A3O B;  2EG1 A;  1S49 A;  2AKW B;  2JFK A;  3M8W A;  4ZVO B;  3HKZ D;  2JLG A;  2B51 A;  3BGL A;  3KKF A;  2VA2 A;  5K14 B;  2Q66 A;  3MEE A;  1S6O A;  4JYA J;  2MLY A;  4HAC B;  4R5P A;  2HHT A;  1QM9 A;  5AXK A;  3QAU A;  4KHP J;  1R0A B;  4FYX B;  1N36 F;  4BWJ A;  3CIM A;  1FK9 A;  3Q0A A;  1S6P A;  5A8W A;  3NXZ A;  4L72 B;  4LF4 F;  2GZO A;  4LVN P;  3W60 A;  1RAO A;  5A8K A;  2FUG 9;  1FFG B;  5LSL A;  3EGZ A;  1U49 A;  4ANE A;  4P2S A;  3QJP A;  3T19 A;  2XTJ P;  1RT1 A;  4F0K A;  3N4W A;  4RW7 A;  4PXE A;  1F3V A;  1B64 A;  4USW A;  2QMW A;  1PJ6 A;  2DR5 A;  1VGY A;  1UAW A;  4QCL A;  5D78 A;  1S1U B;  2AF6 A;  3L4B C;  4JI8 F;  2L9N A;  7AT1 B;  2X1A A;  3MF5 A;  4KSE B;  3H2U B;  2GA7 A;  5E3C A;  2MHN A;  2DO4 A;  3BQ2 A;  1G7C B;  1EKR A;  4NYO A;  1KQF B;  1RAF B;  3RTV A;  2UXC F;  1FNX H;  2E1P A;  3K7R A;  2NXC A;  5KT2 A;  3MAQ A;  1ZZF A;  4PZV A;  2V8V A;  1N32 F;  2CPH A;  4DN9 A;  5IV3 A;  3KJV B;  4M5D B;  1X31 C;  2YKN B;  2PGC A;  2IVM A;  4CYU A;  1JLC B;  3GR0 A;  5KG2 A;  2XO7 A;  2OPS A;  4ZP9 A;  4GC7 A;  1CPZ A;  2BAN A;  4Z7Y A;  4NMX A;  2UXB J;  2YQ0 A;  3BF4 A;  2G2Y A;  4DR3 J;  2EFV A;  5D4L A;  3PW5 A;  1S48 A;  1URN A;  1X4D A;  1IKW B;  2QIF A;  1KRP A;  5J2N A;  5J1E A;  5IM0 B;  3DDI A;  2JHE A;  3MMB A;  2AX0 A;  2Q3P A;  1C4A A;  5K8M A;  2YNG B;  3ETM A;  3NOC A;  2B4U A;  3FFI A;  3SBM A;  3NGU A;  2FGC A;  1FJG F;  4ED1 A;  2M70 A;  3IRX A;  1FHT A;  2QV6 A;  5KOW A;  2AYM A;  3ONQ A;  2DB1 A;  4PPZ A;  1IBK J;  2J9C A;  4LVO P;  4I2P B;  4B9V A;  1WKJ A;  1C1C B;  2VPY B;  2F7V A;  1EP4 B;  1HW9 A;  3MM6 A;  1IM4 A;  2PE8 A;  4AQY J;  3QNW B;  3NG8 A;  3FEY B;  4O4G A;  3WC0 A;  4KV8 B;  2CPE A;  3TX8 A;  2VG5 B;  4EMD A;  2WHO A;  4ZIV A;  2C2K B;  4QQB A;  1GFW B;  4NAS A;  4UQT A;  3M8R A;  2HAF A;  3H4D A;  4B9T A;  4NEZ A;  4JI1 J;  5J2M B;  3VWS A;  2CNN B;  2WK4 A;  3KK2 A;  5G4D A;  3M2U B;  2MZS A;  4CZC A;  3CUL A;  4CT9 A;  3K17 A;  4QR1 A;  4UQG A;  3SDE A;  4W92 B;  3C6T A;  4OZ0 A;  3IMQ J;  2BYC A;  4NA1 A;  4QW9 A;  1SKW A;  2HK3 A;  1X0P A;  3DRP A;  2C2Z B;  4JYA F;  3IWX A;  3CXC R;  5I42 B;  2LQ9 A;  1H98 A;  3NGT A;  2OD6 A;  2CVI A;  3ZTS A;  5GAG I;  4DZD A;  2HFZ A;  1L3T A;  1WG4 A;  1X8D A;  1U1K A;  1WKK A;  2FB0 A;  3JXO A;  2KZM A;  4TYB A;  4O3R A;  4ZVT B;  1NCL A;  3CJS A;  4NL5 A;  1FF2 A;  4A8S A;  1ZM3 A;  4O3Q A;  4MJK A;  1NK9 A;  3O2I A;  4ATN A;  1UFW A;  4BLG A;  4I0W A;  3SQG A;  3GG0 A;  1YBT A;  1DQ9 A;  1EAR A;  1HPZ A;  2W7O A;  4L6V 3;  3LGH A;  2DXD A;  4ZPD A;  2OSR A;  2UUW A;  2LP4 A;  3TAR A;  3NAH A;  1U1P A;  1FKA F;  1RLC L;  1RDR A;  1QLN A;  4PXD A;  2IA0 A;  3VQT A;  1XR5 A;  4KTQ A;  3ZTO A;  3LOU A;  2UVV A;  1SV5 B;  3CMA S;  2VOP A;  2IJF A;  3KNG A;  1XNQ F;  2DO0 A;  3MMJ A;  2K8G A;  2C2N A;  3TNV A;  3G82 B;  1HI1 A;  3FUY A;  4DR3 F;  2J7K A;  7FDR A;  1X60 A;  1VQY A;  4WFX A;  3Q8Q B;  3K2Y A;  4CNY A;  1RAD B;  2KYX A;  2CJK A;  2GJ2 A;  4PPD A;  2HND B;  1OS5 A;  3SEO A;  1YQH A;  1H2T Z;  3ZTQ A;  4ZS6 A;  1Y5N B;  2PEH A;  1YJV A;  5HMZ A;  4MTP A;  3FBB A;  4LBI A;  3MM8 B;  4CLF A;  4YB7 A;  3C8Y A;  4ZPW R;  3AD9 C;  2B9W A;  2DY9 A;  3N0V A;  4AYB D;  3NBP A;  1WUU A;  1IBK F;  3J7Z T;  3MPV A;  1D09 B;  4U7U K;  5KT3 A;  4FBU A;  1KVJ A;  2F4F A;  1G2E A;  1UVM A;  2WCX A;  1HI0 P;  4NCG B;  3CJ4 A;  3OVB A;  2E1A A;  4P7V A;  2E5I A;  3DGP B;  3UCU P;  3KUE A;  2DGX A;  4TY8 B;  4AQY F;  1SKS A;  2N4C A;  3GFH A;  2BKN A;  1FE4 A;  2HHH J;  1E6V A;  1QE1 B;  5BR8 J;  1VC0 A;  2M4M A;  3CJ2 A;  3QRP A;  3W8G A;  3GB0 A;  4CO5 A;  4URG A;  3HVW A;  3MR3 A;  1G3O A;  1RT2 B;  3TOQ A;  4JI1 F;  1RKI A;  2HBY B;  1TKX A;  4LFA J;  4BC9 A;  3QGH A;  1P6T A;  3W8P A;  3KLI A;  3PYD A;  1TK8 A;  8ATC B;  4X4T A;  2FJA B;  4F4W A;  2MQQ A;  1NAQ A;  2VBW A;  3PKM A;  2X1G A;  2Q6B A;  1HFE L;  4ECQ A;  4DCO B;  3BPS P;  1K1Q A;  3P5B P;  3H59 A;  4ZVR B;  1S0M A;  2VPW B;  2WVC A;  4U7C A;  5HAN A;  4ZVF A;  3LQV A;  4LF8 J;  4MK7 A;  1RT7 A;  4P7T A;  3NCR A;  3FRZ A;  4ZHR A;  5H9E J;  3RAQ A;  1IKY B;  4ZJO A;  1T9T A;  1W26 A;  4UST A;  4ZIT A;  4ERD A;  4GO5 X;  1S1W B;  1WSR A;  2HHP A;  2CXE A;  2CQD A;  3B8H A;  3V6K A;  3IS9 B;  2RD5 C;  2X51 A;  1TL3 A;  4I67 A;  2LDY A;  3EXY A;  3V6H A;  2AYG A;  5KFU A;  3JB9 k;  1EB0 A;  3W5Z A;  2RDJ A;  4ECZ A;  1CLF A;  4H4O A;  5B0D A;  3SCK E;  3HMJ G;  5KFE A;  4DUY F;  3GCX P;  2CJX B;  4NLR A;  3DDN A;  3HT3 A;  3OLB A;  3FQL A;  2HMI B;  2CDR B;  1MLA A;  4WFZ A;  3VV2 B;  3OUY A;  2B9Y A;  5DM6 Q;  5E2Q A;  2XMW A;  4K5R A;  3R5C A;  3JTP A;  1M1H A;  3VAL A;  1ZZN A;  1XEZ A;  4MKV A;  1Z4U A;  2DPJ A;  1JLB A;  3W65 A;  4QWB A;  3BBF A;  3EPI A;  1ITP A;  2J5A A;  4PUO B;  1R43 A;  3HJV A;  1N0V C;  2BJD A;  3MM9 A;  4CO2 A;  5L9X A;  3MUV P;  2CJ9 A;  4KFB A;  2XZT B;  1RT5 A;  3LPE A;  1U1M A;  5D0R A;  5DGB A;  1VFJ A;  4TU8 A;  4RW4 B;  5IT9 U;  2RS2 A;  1YX2 A;  2G0J A;  3PHE A;  4EUV A;  1T7P A;  3HPO A;  1F6T A;  4FKY A;  3D3B J;  4ECV A;  4N47 A;  3ETO A;  4NI2 A;  1YJT A;  8AT1 B;  4C3K A;  2W4D A;  3OHB A;  3TUJ C;  1N5Q A;  2ROE A;  3U27 A;  3OR2 B;  5SUH A;  1HIY A;  2OPQ B;  1HA1 A;  3QIP A;  3IBF B;  4AL6 A;  4OLP A;  3OTE A;  5DDO C;  2FLN A;  1LOU A;  1OQ6 A;  1W25 A;  4DV5 F;  5CCL A;  1Q8I A;  3A3N B;  2YWG A;  1DQ8 A;  4B3M J;  5HSP A;  2RVJ A;  4OHV A;  5A0Y A;  1GTH A;  1J27 A;  1HBU A;  2W8K A;  2M7S A;  1B0T A;  2W7A A;  2XMA A;  2XY6 A;  2POK A;  1T03 A;  1T9U A;  1UMJ A;  4PAA A;  4LFA F;  1RA6 A;  1RKJ A;  2V94 A;  2CQ3 A;  1U2C A;  4EYI B;  1SIW B;  2J8A A;  1JX4 A;  3T6J A;  4AXJ A;  4USM A;  4OZJ A;  1RYR A;  1NJI T;  2KG1 A;  2IMO A;  5KG7 A;  1EET B;  2BDP A;  2V63 A;  4KHM A;  3DLH A;  1RWW B;  4ED5 A;  1SUQ A;  1NJY A;  1FEE A;  3KK1 A;  2XLI A;  3R7B B;  4LF8 F;  2ASD A;  1KNZ A;  2IVF B;  4MYT A;  4OI4 A;  1S9G B;  3LH2 S;  1TL1 B;  4OYO A;  3QGP A;  2XLK A;  4LR8 A;  3Q8V A;  4FKX A;  3SCI E;  2SXL A;  3UE2 A;  3DFE A;  5ETL A;  1YBA A;  4N77 A;  5EDW A;  1NDP A;  4ZVH A;  1BQN B;  2BQR A;  2C3M A;  6FD1 A;  3KLF A;  1FNM A;  2KB2 A;  4Q8E A;  5HI7 A;  1BGX T;  1FFW B;  1VMB A;  2ZWP A;  1GMW A;  3CD5 A;  4L3K A;  5A2Q Y;  2W25 A;  2R2S A;  2PFF B;  1U8S A;  1Q7L B;  1MML A;  3J7A 1;  4IRC A;  1K8A T;  3DRS A;  2WOM B;  3NLC A;  4IOB A;  2K7J A;  3MFI A;  3QT7 A;  3JTO A;  4A8Q A;  2VQF J;  1EHW A;  2W4P A;  2K2P A;  3DN9 A;  1K0T A;  4G1P A;  4KPY A;  4NXM J;  3KLH B;  1JB0 C;  3EZU A;  1S7H A;  2HLT A;  5KG6 A;  8RUC A;  2MQP A;  2MQ8 A;  4CTA A;  4J5O A;  5KTQ A;  4X65 J;  4DUZ F;  4K4Z A;  4QWA A;  4MT1 A;  3FNN A;  4KY3 A;  1WHW A;  4IR9 A;  3N5F A;  5IQQ A;  2MKY A;  2XY7 A;  3WZ0 A;  3IR7 B;  3KG4 A;  2Q1L A;  4OYZ A;  3ENA A;  3PR4 A;  3O3L A;  2Y0S D;  5HRO B;  4KKO B;  3PR5 B;  3QZ7 A;  2XY5 A;  5E3A A;  1Q78 A;  3FK4 A;  4OHZ A;  4ED7 A;  2YX1 A;  1DLO B;  4CLT A;  3LF0 A;  3A12 A;  2V4J B;  2W4C A;  1GH8 A;  2J76 E;  3HZE A;  1DZ5 A;  2YNH A;  2OAU A;  3HFK A;  2Y1I A;  1HKA A;  3FQK A;  3C16 A;  1UZD A;  2DPI A;  3KK3 B;  1WEY A;  4B3M F;  3M32 A;  3OFH A;  2JNJ A;  5E7O B;  1I5O B;  4A8X A;  2KKH A;  1H0H B;  2VBX A;  3UNG C;  2J9D A;  1TV6 A;  4FPI A;  5GME A;  4WKY A;  1QJH A;  1SQF A;  4OZ3 A;  4A8W A;  1WEX A;  3TJ8 A;  2W2P P;  2LMI A;  1WHX A;  3OVA A;  5AJ3 J;  4ED2 A;  1PJ7 A;  4LRF A;  4E98 A;  3UVJ B;  3SCL E;  3NS5 A;  2EG2 A;  1FNO A;  4RNN A;  2GMH A;  4ZVP B;  5E0O A;  4ZLL A;  3MR6 A;  1RZM A;  4JI7 J;  3QID A;  2ZH9 A;  1X0F A;  1NB2 A;  3Q23 A;  3T9N A;  3U1L A;  4R0E A;  2CPI A;  1R89 A;  5C42 A;  2M8D B;  5DLG A;  2OHD A;  3RGI A;  2M9K A;  2BQ3 A;  4KO0 B;  1U0S A;  2DGW A;  2UUC J;  4DQS A;  1WTB A;  2RJZ A;  3TA1 A;  5D8H B;  3M1V A;  4JI0 J;  2FJE B;  1HR0 F;  2WB1 D;  3HO1 A;  1XER A;  5U47 A;  5DQH A;  2XBP A;  1K73 T;  1U1N A;  4P9S A;  2RNE A;  4EU0 A;  5LMU F;  2DYA A;  2WAQ D;  3Q8R B;  3S7R A;  2HHW A;  2G0I A;  2QYC A;  2W7P A;  4PWD B;  4LR9 A;  3FEX B;  1FWP A;  3GJR B;  2B7B B;  1QAY A;  1IWG A;  2DNK A;  1J5O A;  1YZ7 A;  4GKJ J;  1RWV B;  2Q6C A;  5B0F A;  4IDK B;  4OMF G;  4F50 A;  3SIP B;  2D9P A;  2ZOG A;  2VQF F;  4Y2K A;  3N6L A;  3J7Y I;  4F0M A;  1B4S A;  1JK9 B;  3KHR A;  2ZD1 A;  4EBD A;  2ZUG A;  4HDG A;  4NLX A;  2BQU A;  2KFZ A;  4HH1 A;  3QO9 A;  5L38 A;  1UEK A;  4DX6 A;  2AGQ A;  2QL9 B;  2KVQ E;  4IG0 A;  4DPU A;  4X65 F;  4DV6 F;  2BZ2 A;  3JSY A;  1QY7 A;  4URQ U;  3PYF A;  3CDE A;  1R31 A;  1NPP A;  2NZC A;  4OX6 A;  2FZK B;  1NKC A;  3KLG B;  1WHV A;  1B0P A;  1FA0 A;  1HWU A;  3PFE A;  3MPY A;  2HQ3 A;  3C46 A;  3NRB A;  4NRT A;  1RP5 A;  2IAJ A;  1U1O A;  4G1Q B;  4WZM A;  4KH0 B;  2E5H A;  4N5S A;  4NLU A;  2IRU A;  1Q5V A;  1UVI A;  2HVD A;  3D4J A;  5DDQ C;  3IBC B;  1VQ6 S;  3DOL A;  2VKZ G;  3TO8 A;  4X64 J;  1WF1 A;  1NU4 A;  2V8G A;  2YNI B;  4A8K A;  2FJV A;  2FY8 A;  3CE8 A;  2D3Z A;  1YKW A;  2V9K A;  3PVX A;  4WXW A;  4USI A;  3G6E S;  4U96 A;  2BRK A;  5HQL A;  3N9U C;  3MR7 A;  3H2V E;  3KJF B;  3J80 U;  4P2F A;  1RTD B;  4L3N A;  5KFC A;  2YKQ A;  1VK3 A;  1HD0 A;  3CCL S;  1KLN A;  4AXI A;  3OSP A;  5AJ3 F;  3KNA A;  4DR1 J;  2VIC A;  3TUI C;  2OLW A;  4NLV A;  1RA7 A;  5FDL A;  1U45 A;  3FBE A;  2HUR A;  3H5S A;  5LXR A;  3D6H B;  1VBK A;  3CIZ A;  2W9C A;  5A8R B;  4NXN J;  3BSN A;  3C6U A;  1UVL A;  2WSC C;  2LKZ A;  2J6T A;  2AW0 A;  1WWH A;  1S77 D;  3NL0 A;  4JI7 F;  4HLB A;  4DLG A;  2DGS A;  3R5G A;  4RLE A;  2B8Q A;  1NHU A;  3C19 A;  3CCJ S;  3JYT A;  3D9B A;  4F4K A;  2E1R A;  1RT4 B;  4MKB A;  4DL2 A;  4OQJ A;  5D0H A;  2AMC B;  1F3F A;  4X84 A;  1M1K T;  2MHE A;  5ETN A;  2UUC F;  1U6F A;  5KG1 A;  1WC6 A;  1QD1 A;  4WE1 B;  4JI0 F;  1H72 C;  4I69 A;  4CLU A;  2KT5 A;  3A13 A;  1JLF A;  3BN7 A;  4QIE A;  2N4D A;  2C28 A;  3CVK A;  2ZDO A;  3G87 A;  1ZTT A;  1KOO A;  3DXB A;  4OHW A;  1TVR B;  4RNM A;  2HWI A;  2CZ4 A;  4M5K A;  1Q0N A;  4QYZ K;  1VLO A;  3VTI A;  1C0U A;  1U48 A;  4XPC A;  5KFB A;  2XMK A;  2ZE2 B;  4GO7 X;  5CXT A;  2PEB A;  3M2V A;  4GKJ F;  3SXL A;  2RAQ A;  3AOA A;  2FJX A;  1VBY A;  3PIO Q;  3NGD A;  2R7S A;  2BE2 B;  2RKI A;  5LSO A;  1HNI B;  3MWB A;  2ILZ A;  1YSJ A;  1RAH B;  4LFC J;  2E7X A;  2C22 A;  1U6B A;  1N52 B;  2ROG A;  3V6D B;  1HBM A;  1FJE B;  2IRY A;  4UY8 T;  1IM6 A;  3D1O A;  1N4L A;  1QAI A;  4S0M A;  2B6A A;  4CH7 A;  1APS A;  4CRJ A;  2ZZT A;  1KOH A;  4P72 A;  1NK0 A;  2RQ4 A;  2CZV C;  3R1H A;  4X4O A;  3VVT A;  2V68 A;  2NXE A;  3W5X A;  3ITH B;  1Y10 A;  1JLG B;  5EUH A;  3IBW A;  2DRD A;  3I0S B;  3JS9 A;  2F8M A;  4H54 A;  2W9B A;  1UWB B;  4X2B A;  1OWX A;  4X64 F;  4K4U A;  4ETZ A;  3A3P B;  2GJI A;  1TKZ B;  1WI6 A;  2UUA J;  4OYA A;  2MQM A;  3QPI A;  1U4B A;  3UD3 P;  1CUL A;  2BOA A;  5I3U B;  3AJD A;  1L3V A;  4P74 A;  1M90 T;  1UFK A;  3G6V A;  5T14 A;  3DU5 A;  4NWB A;  1MU2 A;  2RQC A;  2HRU A;  1VBX A;  1HQE A;  1FRJ A;  1FT8 A;  2FHK A;  2QZ8 A;  2EI5 A;  2HQI A;  4HI2 A;  3PYG A;  2CQC A;  4DR1 F;  2HIY A;  4C8K A;  3P8B B;  4J9P A;  4KPC A;  1B0V A;  5KFT A;  3IM9 A;  4M1K A;  4NEY A;  3DOK A;  2B9X A;  2P9G A;  3LP2 A;  1TAU A;  5D3G A;  4JV1 A;  2GVZ B;  2AT1 B;  4FXW A;  1ARO P;  1S6Q B;  1TP7 A;  4RW9 A;  3CC4 S;  4YS2 A;  2H4Y B;  5LXY A;  5EWF A;  2AJQ A;  4WFY A;  5IV4 A;  2WW8 A;  5G0R A;  1DTQ A;  1S1X A;  1K44 A;  4MIB A;  1PO6 A;  2DNP A;  3R5D A;  5KT5 A;  4XIU A;  1P9Y A;  1T05 B;  2VC1 A;  1S1V B;  2JLE A;  4OYX A;  3HD1 A;  5L46 A;  3B4D A;  4BBY A;  3CTR A;  1GXU A;  1SC4 B;  4A48 A;  4WFA Q;  2DGU A;  4KIA A;  3KLE B;  2XMV A;  3G9C A;  5AXN A;  2R8G A;  5EX0 A;  4DR5 J;  2O3D A;  3R5J B;  4IKA A;  3DYA A;  5C24 B;  2AQ4 A;  2CJY B;  5HAO A;  4K7Q A;  4F36 A;  3EXC X;  1XWL A;  4DFK A;  3IAM 9;  2CVE A;  2J0X A;  5JJB A;  1HI8 A;  2IA6 A;  2GVD B;  2XHW A;  1IKV B;  3M6X A;  5B7W A;  4RUA A;  4LFC F;  1ZOT A;  3CCU S;  3ILO A;  2DRA A;  2AJ1 A;  4PWW A;  2XYH B;  1BQM B;  5RUB A;  4AFF A;  2ADC A;  3MEE B;  2DIU A;  2UV8 G;  3X1L B;  3FZB A;  2FJD B;  3Q8Y A;  3PIP Q;  4DV2 J;  2HYI B;  2ASL A;  1QUV A;  2YNF B;  1JKH B;  5I3P A;  2YBV A;  1PSD A;  3G71 S;  5KFJ A;  3DU6 A;  1ZAX A;  2C3Y A;  2PII A;  2R7Q A;  4WBF A;  2RDI A;  5KAK A;  1HBO A;  4QIW D;  3JAM Y;  4QR0 A;  2LEB A;  1NDL A;  3W61 A;  2NSB A;  3BV8 A;  2VOD A;  1QTM A;  3AQO A;  3NCQ A;  3MCO A;  1ZH5 A;  1RHR B;  3PXG a;  4YHH J;  1X7V A;  1RHU B;  2UUT A;  2UUA F;  5J1N A;  2OO4 A;  1NBE B;  3MAH A;  1GX5 A;  2RSQ A;  1M5V C;  4XDD A;  4C8M A;  2IDE A;  2QLB B;  5H9E K;  5AXL A;  3QAE A;  4ZJL A;  5DG7 A;  4OX9 F;  1YRU A;  3MEC A;  3Q89 A;  1IVZ A;  3BSC A;  3OL7 A;  1D3W A;  4CYU B;  5D4P A;  2CQ0 A;  2C1E B;  2QYG A;  2OPS B;  3KDN A;  3CD7 A;  4PG7 A;  2ACY A;  4HYK A;  1IKX B;  3DLG B;  1Q79 A;  1SH0 A;  1HNW J;  5KFG A;  3R9L A;  2MYF A;  3WDO A;  1HQU B;  4IQM A;  1Y00 A;  4DEZ A;  5C2C A;  1HMV A;  4YFU A;  2RT3 A;  1KR4 A;  5DZ6 A;  2QT7 A;  5BYQ A;  4P73 A;  4PQU A;  1KTQ A;  4PXB A;  5HQ8 A;  4J37 A;  3QJJ A;  5T41 A;  1WC3 A;  2F63 A;  3BKU A;  1S5Z A;  1KQG B;  4KB7 A;  2KFN A;  3CGI A;  4QIV A;  2H65 B;  3ZXW A;  3IRX B;  3V6J A;  2MKK A;  3PV8 A;  3H90 A;  1F2G A;  3G2X A;  3TJA A;  1FCA A;  3UCG A;  5KFL A;  3IP0 A;  2OEL A;  1KN6 A;  2DNN A;  3K5O A;  3HHK A;  3P3D A;  1S59 A;  4J9O A;  1BWE A;  4LQ3 A;  4Q2L A;  3T9Z A;  1FD8 A;  3O44 A;  4LF1 A;  4DF4 A;  4ZCI A;  1CJV A;  3T6B A;  4O4G B;  3KUH A;  4JOU A;  2HFU A;  3X3U A;  3LP0 B;  2KHD A;  1HBN B;  5ETQ A;  4MH8 A;  1P9Q C;  4I2Q A;  5A6W A;  3R7N B;  3OSN A;  2DK2 A;  4CH0 S;  2CPF A;  3GYX B;  4HEA 9;  2GQC A;  5JVH Q;  4M5G A;  1IR0 A;  2KXF A;  1MN9 A;  4K5S A;  1P27 B;  4CI0 B;  4LT6 A;  2OUG A;  2N3L A;  1JLE B;  1LWE B;  1FJ7 A;  4OI0 A;  2IDL A;  3C6T B;  1JLA B;  4FF4 A;  1U6Z A;  3QWP A;  2YWE A;  1G6B A;  3MEG B;  1X4G A;  2XB2 D;  1LWC A;  3DRP B;  4RO0 A;  1TUG B;  3UCZ P;  2YWW A;  2CYY A;  4IFV B;  4RNO A;  4DV2 F;  2UVW A;  2YKP A;  1CJT A;  3EDR B;  1I1G A;  2FC8 A;  3MD1 A;  2NPI A;  3CF5 Q;  4Y2M A;  3P96 A;  2LU2 A;  1HQ2 A;  3QWU A;  3I56 S;  2MKH A;  4AL5 A;  3SFG A;  3C15 A;  3CD6 S;  4FZV A;  1AFI A;  2OEM A;  1QSY A;  2R7T A;  2H5I B;  1RBL A;  3LUY A;  3HHE A;  2VOO A;  3J7Z 5;  2OH2 A;  3VQS A;  2HHQ A;  1AUD A;  4YHH F;  3IM8 A;  3GIR A;  2EEY A;  3H42 A;  3OFG A;  1NEE A;  3W3S A;  2ZJQ Q;  2Z58 B;  1HPZ B;  1S0V A;  3BGR A;  2AZ1 A;  1O5J A;  4P6Q A;  2GQ2 A;  1Y5L B;  1JWW A;  4DSK A;  3D7S B;  2HHX A;  3EUN A;  3OV7 A;  1FI4 A;  3FC9 A;  4P10 A;  2KXH A;  2EWH A;  3QFW A;  1F1B B;  3ILL A;  5C25 A;  2RU3 A;  4NX9 A;  4QYR A;  3G86 A;  1RWN B;  4G1I A;  3TJ9 A;  4FYV B;  1LW2 B;  2DIT A;  1RTI B;  2HFV A;  3SYZ A;  5K14 A;  2LDI A;  3NS6 A;  1Q53 A;  4E2F B;  1J5E F;  1H2U X;  2N3O A;  2E1C A;  2KT3 A;  4HI1 A;  2Q43 A;  4NA3 A;  4ECR A;  4DU7 A;  2LU1 A;  1HNW F;  2HBZ B;  1YGY A;  1R0A A;  2BJE A;  4PG5 A;  2Z0G A;  2MPU A;  4CLS A;  2IRX A;  2KFY A;  4ZPT R;  2ZNY A;  4OLO A;  3ZZP A;  1H7X A;  5HK4 A;  2MJN A;  2MDA A;  5D15 A;  1TKT B;  4EZ6 A;  2J7U A;  3CJ3 A;  2DR7 A;  2R7O A;  4QR2 A;  4ZLP A;  3CJ0 A;  4W4M A;  1MMD A;  2C3P A;  3D1Q A;  3R6L B;  2H5E A;  3F44 A;  4DR2 J;  1TUW A;  1QAX A;  5GAH I;  1KHW A;  3CC2 S;  4DX8 H;  4P2X A;  4PKD B;  4C0O C;  2A2D A;  2KYZ A;  5CYM B;  2GAH C;  2Z2L A;  1C1B A;  1N6Q B;  1S1U A;  1C2P A;  2B5J B;  4ZPA A;  2MXY A;  3DCA A;  1RXO B;  3UDC A;  3TAN A;  4CLW A;  5IXU A;  1RHQ B;  2FLP A;  2VKR A;  1AUS L;  5GAD I;  4CLZ A;  4DFM A;  4OV1 A;  1YRT A;  4J9R A;  1WHY A;  3P45 B;  4RBT A;  1TU0 B;  1GMW D;  1GX6 A;  2EXU A;  3CDW A;  1UTA A;  3KJV A;  4M5D A;  4A47 A;  1IBL J;  2YKN A;  2IC3 A;  3K8W A;  3DRY A;  2ZZN A;  2YXL A;  4LQ9 A;  2KVI A;  4ZA1 A;  4DL7 A;  3KLI B;  1F60 B;  4NOH A;  1NUE A;  2DBB A;  4ILM A;  2RF2 B;  2DNR A;  2D3O 1;  2MST A;  3R8Y A;  1RQ0 A;  4JI5 J;  2YPY A;  1RK8 A;  2R7X A;  2W01 A;  2BW2 A;  2QMU B;  2QA1 A;  2LQ8 A;  4O44 B;  2YNG A;  3FVY A;  1V3R A;  1TL5 A;  4ZP7 A;  1NB7 A;  4DPW A;  4ZVS B;  1U47 A;  3D6T B;  4DSL A;  4JI6 J;  3R5B A;  4O3O A;  3D0I E;  4M63 A;  2BJ9 A;  2CZ9 A;  3JTN A;  4GC6 A;  1WEZ A;  3H5Y A;  3BGO P;  2CQG A;  1BE4 A;  3BRE A;  3BQ0 A;  3P4U B;  1RHM B;  2K3K A;  1EP4 A;  1U7L A;  4NPO A;  1TL3 B;  3JSM A;  1T95 A;  1X5S A;  3DM2 B;  4HHH A;  4PG6 A;  1RAI B;  2CPD A;  1RWU A;  2VL1 A;  3E01 B;  4KV8 A;  4JV5 J;  2DNL A;  4R0J A;  2EFP A;  4OI3 A;  5ETV A;  3FGV A;  7FD1 A;  3L7U A;  3GLJ A;  1WAC A;  1R0B G;  4JI2 J;  1RAA B;  2WBM A;  3C14 B;  2YH0 A;  4YDX A;  1B7F A;  1O8B A;  2DNQ A;  3M2U A;  4B9N A;  1ULR A;  1V6H A;  1DJ0 A;  4C48 A;  1W2B R;  1SXL A;  3ZZR A;  2ZH3 A;  3IG1 B;  2YX7 A;  3J81 U;  5BXI A;  4FYW B;  2XWY A;  2XNR A;  4CCH A;  4WIQ A;  4USU A;  2DTJ A;  1L5U A;  5BYR A;  4Q45 A;  3RB4 A;  5F9N A;  2PA3 A;  2H48 B;  1ACM B;  4LR7 A;  3L95 X;  4KFB B;  4C11 A;  3UO0 A;  2H5J B;  3TEG A;  4DR2 F;  1FRH A;  1T9V A;  4RBV A;  4Y2A A;  2C42 A;  1REV B;  4EEY A;  4LBP A;  3N6N A;  2KM8 C;  1D0E A;  2FD2 A;  3H40 A;  5HBM A;  1TKD A;  3GFX A;  5HL7 Q;  4NI2 B;  1OSD A;  4X66 F;  2VIH A;  3ET6 A;  3I87 A;  2E9R X;  2KH9 A;  5DZ7 A;  4L73 A;  4WP3 A;  3BGU A;  1TL7 B;  3MED B;  3QIP B;  3MMC B;  3KMS A;  1YJU A;  4W98 A;  3JQK A;  3LAM A;  4HT5 A;  5K20 B;  1SJF A;  2G1D A;  4DMZ A;  4ID5 B;  2MKS A;  2UVR A;  1IBL F;  1MSW D;  1SC6 A;  4EGL A;  4WTY A;  1SV5 A;  4F0H A;  3GG1 A;  1T03 B;  4JUZ A;  3G8Q A;  1WDD A;  3RR7 A;  2CA9 A;  4PAB A;  1O51 A;  1G4C A;  2DNO A;  1X4E A;  1MG7 A;  4JI3 F;  2CNO B;  1KDN A;  3GV8 B;  2FHO B;  3L7O A;  4DL6 A;  4JI5 F;  4J9V A;  3G6X A;  1QVG R;  2FIU A;  2RUS A;  2K3I A;  1SL1 A;  2HVI A;  3M6U A;  3LGM A;  1EAY C;  1RWX B;  2I8E A;  2F8H A;  2BW7 A;  3TA0 A;  2RQK A;  3QRR A;  1SUQ B;  1GAO A;  1S99 A;  4GRS A;  4JI4 J;  2NSC A;  2XGQ A;  2ROP A;  2I5J A;  4JI6 F;  4LIW A;  2MKC A;  2V4R A;  1X5T A;  3MM8 A;  5K8O A;  3WIV A;  1CSJ A;  5AE1 A;  4V1A k;  3EVM A;  4KGV B;  1GK8 A;  4NCG A;  4O3N A;  3ADA C;  2EC2 A;  3S8S A;  5KOX A;  3ILI A;  4TY8 A;  2EBE A;  3VHQ A;  2DGT A;  4NLO A;  2QSF A;  2WON B;  2GML A;  4PCQ A;  1NDK A;  2XYG B;  1HNV B;  1WKL A;  4OYB A;  1QE1 A;  1RTJ B;  4LF9 J;  2DCL A;  4JI2 F;  1SH2 A;  4ZN3 A;  1TUV A;  1D1U A;  4C97 A;  2V2Q A;  1S79 A;  3I5B A;  2BUN A;  2J6S A;  4C3L A;  1RCX B;  5IFM A;  1YLX A;  2OPR B;  3BR9 A;  2RIL A;  3CJ8 A;  1DRZ A;  4CIO A;  2Y0B B;  5HJY A;  2IYI A;  3RBZ A;  2VJU A;  3CJT A;  4YY3 F;  4FYD A;  3U02 A;  4RNF A;  3EWG A;  2MZJ A;  1ZBT A;  3OVS A;  4AL7 A;  4XO0 A;  5BYS A;  4CP5 A;  2FHJ A;  3EGN A;  3MCM A;  1NHV A;  1OIA A;  1N33 J;  1NND A;  5DM7 Q;  1I51 B;  2YQ3 A;  1CJU B;  1S1W A;  1V3S A;  5KFR A;  3D2W A;  1UEV A;  3IS9 A;  4KAI A;  2CQ4 A;  1REG X;  2NLW A;  1D9A A;  2GX8 A;  4MKY A;  5EHH A;  1RBA A;  4F4Y A;  5CQG A;  3NCP A;  2AJ2 A;  1NJZ A;  5J1P A;  4WF9 Q;  5CZV A;  2YNH B;  2QLF B;  1S0O A;  1YJR A;  4ZDN A;  2XMM A;  1AXQ A;  2YKO A;  3DC2 A;  2HW3 A;  1NSK L;  3C16 B;  2YX4 A;  1VYA A;  4XK8 C;  3M32 B;  4ITS A;  1Q16 B;  3FEZ A;  1BWV A;  4NA2 A;  1R0C B;  2RS8 A;  4PYA A;  1QTN B;  2FY1 A;  3GV7 B;  2HS0 A;  2ZH1 A;  2C2D A;  1LV5 A;  4LF6 J;  3I96 A;  2XSF A;  5CD4 H;  2HHS A;  3LAK A;  3QGI A;  3MZI A;  2LCW A;  2WVB A;  2F9D A;  4WZQ A;  1I94 F;  5LJ3 Y;  3DI6 A;  3N6M A;  1PC5 A;  1GXT A;  3HI9 A;  1DQA A;  3AA9 A;  1F9F A;  3HM9 A;  1FDN A;  1Y7P A;  5DQG A;  4K4V A;  3BB5 A;  1YHQ S;  5E33 A;  3EZO A;  2DXE A;  3OTB A;  1U2R A;  4IYQ A;  2R7R A;  4WP9 A;  4DR7 J;  3UN3 A;  2BJ1 A;  2DEJ A;  1CS4 A;  2R3V A;  2WZ1 A;  4JI4 F;  4YEA A;  5F8G A;  4RW4 A;  3MUR P;  3AQP A;  2DJW A;  4LF5 J;  4EK2 A;  1HW8 A;  1RIS A;  1HWK A;  2AEJ A;  5F8H A;  3IR6 B;  1U0H B;  3FBC A;  2HZC A;  4Y2I A;  5CAA A;  2HG4 A;  2X1F A;  3VR1 A;  3CB4 A;  3KDO A;  2OPQ A;  3Q22 A;  3W64 A;  2NUU G;  2DXF A;  2CNK B;  3KXD A;  1IWA A;  1V9O A;  2XMU A;  1RAB B;  1XQI A;  3DKD A;  1ZM4 A;  1HL6 A;  2YPZ A;  3EVO A;  3MDF A;  4LF9 F;  3PNI A;  1LK7 A;  2I2Y A;  4DR6 F;  2CFX A;  3I4H X;  1GXL A;  2LEA A;  4QWE A;  1IJE B;  2RHQ B;  2YH1 A;  3AD7 C;  3HVA A;  4DV4 F;  2IJR A;  2FVR A;  1AZS B;  4NCA A;  4R8U B;  3ISN C;  4LSZ B;  3W1Y C;  5CYQ B;  4ZCL A;  3N28 A;  3OL9 A;  3I9Z A;  4CQ1 A;  5DQI A;  2ZD1 B;  5IWA J;  2ZOF A;  5SZT A;  2XWX A;  2XGP A;  1U1L A;  4QYZ J;  2M52 A;  3ULH A;  2CWK A;  1C0T A;  2I1R A;  3KJN B;  2I38 A;  1SIZ A;  4IG0 B;  1MWQ A;  2MMY A;  1S9G A;  2V2Z A;  1TL1 A;  1SJ1 A;  4TYA A;  3QLH B;  3H7H B;  4LIR A;  1OYE A;  2WTF A;  2UU9 F;  4F7V A;  6AT1 B;  4DN0 A;  4W90 B;  5ETM A;  2IAJ B;  5F9L A;  1VRT B;  2QLJ B;  1DAX A;  4YOE A;  3BQ1 A;  3TAM B;  2XI2 A;  4B9L A;  1D9D A;  2YKM B;  3MM7 A;  2JRS A;  1Y0H A;  2UXD J;  1IN0 A;  3PW0 A;  1OPI A;  1WC1 A;  3DOL B;  4MFB A;  1HYS A;  2JEI A;  4I7F B;  5DG9 A;  3O5T B;  1QSS A;  2N82 B;  3G8S A;  4NLS A;  4CLK A;  2ZBC A;  4ZMM A;  1YK9 A;  1ZAV A;  2DGQ A;  2RB7 A;  2PDA A;  1V3Z A;  4LBH A;  2LEP A;  3TR5 A;  3VGT A;  4B3O A;  1G1X A;  2MKI A;  4KHP F;  3CCQ S;  2VQE J;  3KLH A;  1KLM B;  2J9D E;  4ED8 A;  3GE9 A;  1PKU A;  4ER8 A;  2GO8 A;  4LSN B;  2VPZ B;  1U8W A;  2ABY A;  1X5P A;  1VQN S;  3C6U B;  4DR7 F;  3RB6 A;  3DMJ B;  1RGV A;  3DRR B;  2QC3 A;  3ICL A;  2O1P A;  1S72 S;  2BJ7 A;  2U2F A;  2CJA A;  2A2C A;  4CO3 A;  4LF5 F;  2CIM A;  4C4W A;  5HRO A;  4KKO A;  1KSP A;  2BMB A;  3MGJ A;  4DV7 J;  5D6G A;  1I6J A;  3K89 A;  1SI9 A;  3PJW A;  1DLO A;  4OZ2 A;  1R8A A;  1FVQ A;  3C66 A;  2R9L A;  5ETS A;  4IG3 B;  1FX4 A;  2UUB J;  1WC5 A;  2ZH6 A;  1VHI A;  3LPY A;  4TNO A;  2B0G A;  5CYJ A;  1VJW A;  4IRD A;  1RT3 A;  4U95 A;  4DSF A;  3KK3 A;  1JLF B;  3MEK A;  3OW2 R;  2ZH2 A;  1X9M A;  3R6G B;  2QL5 B;  2OIH A;  5GAG U;  4ID8 A;  1AB8 A;  4WJB A;  3HDS A;  3KLV A;  3P5T L;  2MB0 B;  3RJM B;  2QN6 B;  3R27 A;  3F41 A;  2G4B A;  4DV3 J;  4J7C A;  1C0U B;  2UXB F;  2JEG A;  4QW8 A;  4BDP A;  1LQ9 A;  4J9M A;  3UN5 A;  4B9M A;  1KD1 T;  2GV1 A;  3S6E A;  1H6K X;  3RYL A;  3VGU A;  3KTQ A;  2YVS A;  3A8J A;  3QT6 A;  4OJH A;  3UVJ A;  1R27 B;  1S4E A;  3W63 A;  2JWN A;  5IWA F;  2VPX B;  2HQG A;  5GMD A;  4GVB B;  3PX6 A;  3BKF A;  4DS5 A;  4DQR A;  1GT8 A;  2EBG A;  1E6Y B;  3BH7 B;  4URS A;  5ADZ A;  4KGZ B;  3CCR S;  2B6A B;  4L76 A;  3JQJ A;  3OR1 B;  2FZG B;  2VFT A;  2OI2 A;  2I6W A;  3W66 A;  4HH0 A;  4UZC A;  3BGF A;  3DLK B;  1TAQ A;  2ZZM A;  3CC7 S;  4WCE Q;  3WC2 A;  2MKJ A;  2HQF A;  2B43 A;  1VCT A;  1VQ4 S;  2K7K A;  4K8R A;  5HP1 B;  2DIS A;  3NOG A;  2UXD F;  1UP1 A;  2HVZ A;  3OL8 A;  4DQP A;  3AFG A;  4M8L A;  5HAT A;  3R5A A;  1CEZ A;  1LW0 A;  4ZN1 A;  2HVE A;  2P9E A;  3CO0 P;  5IT9 Y;  4PWD A;  3LA0 A;  4ECU A;  4M5I A;  3I82 A;  4DUT A;  3MOJ B;  2W9A A;  4IDK A;  1MU2 B;  2G9O A;  2R42 A;  3HXM A;  1HQE B;  4Y0F A;  3PEJ A;  4DS4 A;  2JEJ A;  2ZWO A;  4KH1 B;  3T1Y J;  2EFO A;  1ZYQ A;  2VQE F;  3LWL A;  3A4T A;  5IT0 A;  4RWX A;  1YJN S;  1HAR A;  3H8Y A;  3QAT A;  2C2E A;  2Z56 B;  4TLQ A;  2UV8 A;  1LFW A;  4KGX B;  5E3P A;  4DR4 J;  3PFO A;  2M3D A;  2BKP A;  3EE3 A;  2NRE A;  5B0E A;  4MKA A;  2CQI A;  3B6B A;  1YI2 S;  4DBQ A;  3KLG A;  5D3G B;  4DQQ A;  2JJ4 D;  3SV4 A;  2OML A;  1S6U A;  2M5Y A;  2NUH A;  4B3R J;  2HS3 A;  3ZZZ A;  1UW9 A;  1QDU B;  2OEJ A;  4FP9 A;  4RW9 B;  4G1Q A;  4DSE A;  4BC7 A;  1FRX A;  5I4M A;  2HFN A;  3K5P A;  2UP1 A;  2IFX A;  4IFY B;  3PTW A;  4AUK A;  2ZJP Q;  3MD3 A;  4A4J A;  2I9S A;  1KTV A;  2PMW A;  3IC1 A;  2YNI A;  4ALZ A;  5LMN J;  3FBF A;  4J9K A;  3AA8 A;  5C7P A;  1M5P C;  3IGV A;  5KFW A;  2IBO A;  2ZH7 A;  5B08 A;  3POT B;  1RAC B;  4OYW A;  3M2R A;  2DHX A;  2V4Q A;  1URR A;  4F3O A;  3UPF A;  3FZ2 A;  2V69 A;  5EN1 A;  3O1L A;  4DV3 F;  1RTD A;  2DR9 A;  3K57 A;  1FO1 A;  4M94 A;  3T41 A;  4I6A A;  3GU0 A;  3ZO7 A;  3H2L A;  4X62 J;  2QA4 G;  4ZLN A;  4IH6 A;  4IUF A;  1BHN A;  1X9S A;  1CJK A;  4ECS A;  4DCP B;  2VFS A;  5A8R A;  3VZI A;  4UUX A;  3R1L A;  2NYI A;  1FRM A;  4DG1 B;  2F5G A;  3GYG A;  5ETO A;  1CC7 A;  2X1B A;  1X4H A;  3T5H A;  3M8S A;  2A10 A;  3M05 A;  3AAW B;  2E5L J;  5KFY A;  2QTW A;  3HSJ A;  5H9F J;  1RT4 A;  3MFH A;  3PW2 A;  5IQ6 A;  3CCV S;  3GFY A;  3VZH A;  3Q24 A;  4TQR A;  4NLW A;  2IM1 A;  2HNZ A;  2PN6 A;  3CCT A;  4OJG A;  3W9I A;  1KS2 A;  3NNA A;  2HHH F;  4WE1 A;  2KXN B;  1KHV A;  4U67 Q;  2VG7 B;  1WEL A;  3K5M A;  9RUB A;  5BR8 F;  1VQ8 S;  1Q95 G;  3TAQ A;  1DFD A;  2OPP A;  3CJ5 A;  4Q0B A;  4FF3 A;  3S01 A;  2AJ0 A;  1U1Q A;  5E3Q A;  1TVR A;  4WK3 A;  4MAK A;  1Q8L A;  3IO1 A;  1VQS A;  3PG9 A;  1H74 A;  2ZE2 A;  1FKO B;  4RU2 A;  2B4P A;  3CO9 A;  2NCK L;  3HSD A;  4P71 A;  4IO1 A;  2LA4 A;  1SC3 B;  2D1C A;  1HNI A;  1RB0 A;  3M8P A;  5EWG A;  3OXL A;  4J9S A;  1NH8 A;  1Q1K A;  3T1Y F;  2OTL S;  2ZBP A;  5L1I A;  2OP5 A;  3SCJ E;  2VON A;  4QPT A;  3CED A;  2IVY A;  2V2K A;  4QBU A;  2XLJ A;  2F8E X;  3HX9 A;  2XSJ A;  1NKB A;  3CCM S;  3HK2 A;  1ZA1 B;  4A8F A;  2DT9 A;  4OZ5 A;  3QT8 A;  3MXH P;  1FVS A;  1JMT A;  4IR1 A;  3AXM A;  2A6O A;  2LFV A;  5KFK A;  3KFW X;  3E2E A;  3ITH A;  3QSI A;  2QO3 A;  4WYW A;  4B02 A;  3I0S A;  3ENQ A;  3FCV A;  4XDC A;  2FGO A;  3BSO A;  3MTK A;  1XNR J;  4O0N A;  1X4C A;  3HHL C;  4OYI A;  4FXD A;  5D4N A;  3Q86 A;  5LMN F;  2CPJ A;  2WBR A;  3ELH A;  1GMV A;  3IWN C;  4C8N A;  9ATC B;  4RU9 A;  5KG5 A;  3EM1 A;  4YUD A;  5KFI A;  3UR0 A;  2UXC J;  2HBQ B;  1JJC B;  5L1L A;  2JC1 A;  3N79 A;  4IQX A;  1CJV B;  2CKW A;  1FWL A;  3MAA B;  4X62 F;  5J2P A;  5KFF A;  4J9Q A;  3IXQ A;  1X4B A;  4AD6 A;  3BBB A;  5DLF A;  5KFM A;  3L9Z A;  3HHL A;  2DCU B;  1SJ3 P;  4Y00 A;  4WP8 A;  3SZ2 A;  1T8E A;  3FDS A;  1SJ4 P;  4V19 X;  4BS2 A;  3ZNU A;  4JV0 A;  4NCB A;  2LA6 A;  5DET A;  2ALY B;  1UZH A;  1S6Q A;  2YWK A;  1YJ7 A;  5A6P A;  4DFP A;  5KT4 A;  2JDJ A;  1CJT B;  1D9F A;  1FJG J;  1RU2 A;  5IC6 B;  3WX8 A;  4BWM A;  3P6Y C;  1RWP B;  2GHW A;  3D0H E;  5FLX U;  3C15 B;  5D0G A;  1UEU A;  4WPA A;  4IO9 Q;  2F9J A;  4DSI A;  4JV2 A;  2V34 A;  1VRQ C;  1W7W A;  1S1V A;  4DXL A;  2F1F A;  1OPZ A;  4ZLJ A;  4U9R A;  1XBW A;  2FLL A;  4Q43 A;  2JOQ A;  4M5L A;  2ZHA A;  1PCA A;  1XMB A;  4DPX A;  4M95 A;  4LRA A;  2E7W A;  1HHT P;  1BC6 A;  4GMK A;  2DNM A;  2GGP A;  5KFP A;  2KTQ A;  3Q2T C;  2LQ5 A;  4TU7 A;  4CLL A;  3BGR B;  3T1H J;  1EQM A;  2HFO A;  1LFP A;  4KYZ A;  4O23 A;  3V81 A;  3SSQ A;  4ZOS A;  3MM5 A;  4I6W A;  2VDH A;  5M2U A;  1IKV A;  3WX4 A;  2YQ1 A;  2HIQ A;  1BQM A;  2KHC A;  3QFH A;  3AY0 A;  3S1T A;  1PGZ A;  1MWZ A;  3EZ5 A;  3BYP A;  1DTT B;  5F8I A;  2E1M C;  4USJ C;  2CPZ A;  2YNF A;  2WVE A;  5E3R A;  4DPT A;  1JKH A;  2H51 B;  1TR0 A;  3CWJ A;  2VF3 A;  1YWX A;  3J80 Y;  2B7C B;  2QLW A;  2QA4 S;  5DRK A;  1OO0 B;  1NHK L;  4U7U D;  1VIO A;  1T0T V;  2FHM A;  4ZPC A;  2W8L A;  2EW9 A;  4UUW A;  4FNH A;  1YVF A;  2L9D A;  2G0C A;  1YJW S;  3RBX A;  2P9C A;  4B17 A;  1XNR F;  2V9W A;  3MUT P;  4ED0 A;  1C1B B;  1JIH A;  2XCA A;  2AX1 A;  3EJM A;  3K5L A;  4I1T A;  1R7I A;  3TRG A;  2PMH A;  5KFS A;  3DRX A;  2HZA A;  1KQS R;  2PO4 A;  3BDP A;  5CHC B;  4D3G A;  2KI2 A;  3TYT A;  4CO0 A;  4LRC A;  4OL8 A;  2C2R A;  2QLX A;  4OFZ A;  1RI7 A;  2BOP A;  5B0A A;  3OJS A;  3OT9 A;  2K06 A;  4NXM F;  4K4X A;  1UVN A;  1S1T B;  3GP9 A;  2IC3 B;  2ZH5 A;  1N5Y B;  2H4W B;  1XNQ J;  1H2V Z;  2OKQ A;  3ZZO A;  1VDH A;  3RAX A;  1IKX A;  3DLG A;  2DHH A;  4XTT A;  1MNE A;  3CMQ A;  1HQU A;  2GIF A;  4TQS A;  4CO1 A;  2E44 A;  2RQM A;  2FPH X;  2AEM A;  4OIX A;  1QVF R;  3GPA A;  4RWW A;  1UVK A;  4DDF A;  5HJX A;  3TVY A;  2LYV A;  1NSQ A;  3EGW B;  6FDR A;  3AHP A;  1IUJ A;  2DKO B;  1O6X A;  3QMQ A;  2V6A A;  2FHJ D;  4ZCK A;  1VC6 A;  2FDN A;  2XYP B;  3B54 A;  3M4X A;  1GEH A;  4Y28 C;  2NQP A;  1D8Y A;  4USH A;  1SPB P;  4KGM A;  3W2W A;  4CLY A;  2JX2 A;  3J7Y U;  3T5K A;  2PT0 A;  2HEK A;  3BYR A;  2GS8 A;  5ETT A;  3DLE B;  1UA0 A;  1VRU B;  2MGZ B;  1R6Y A;  2FJW A;  3JSM B;  3HUL A;  4Z2X A;  2XI3 A;  2MEW A;  4B08 A;  4X4P A;  3EPG A;  4OYM A;  1NK8 A;  2RHS B;  3OBI A;  3LP0 A;  1HBN A;  1TMJ A;  4QIG A;  5THW A;  5HMY A;  4KGK A;  5GAE U;  3T1H F;  5LT5 A;  1MMN A;  3EMT A;  4PG4 A;  1JXE A;  1CQM A;  3OXF A;  1N5T A;  4FDF A;  2W2O P;  2MZT A;  3B78 A;  5K8P A;  4FF2 A;  2L08 A;  4ECW A;  2BX6 A;  2P6T A;  3R3T A;  1RTH A;  1S9E B;  1JLE A;  3TI0 A;  1LWE A;  1OYD A;  3K58 A;  2OMO A;  3VGS A;  2D3O R;  1OY8 A;  1JLA A;  5FII A;  2ZBR A;  4CNZ A;  1RBO B;  2BJ3 A;  3MEG A;  2DGO A;  2VBZ A;  2PSZ A;  1PIE A;  4WFN Q;  4IFV A;  4OI1 A;  4PXC A;  2HSE B;  2RML A;  1RHJ B;  1S10 A;  1NO8 A;  1VC5 A;  1T94 A;  4GVL A;  5F8N A;  4NLG A;  5J2Q A;  2EKY A;  2CJB A;  2KO1 A;  4C11 B;  2BM0 A;  1AYE A;  2IM0 A;  1SC1 B;  1SL0 A;  5IZH A;  4TLR A;  2AJ4 A;  3AJ2 A;  3D3C J;  3PEH A;  1KWM A;  3BZQ A;  4YR2 A;  3B4M A;  5HBM B;  1N8R T;  1YDL A;  3RW7 A;  3MR5 A;  2FLO A;  2BXJ A;  3ET6 B;  2CUY A;  1NZA A;  1XK8 A;  3TVZ A;  4NLD A;  2E29 A;  1XJW B;  4QU7 A;  3NWG A;  1M0S A;  4DUY J;  1BUX A;  1T3N A;  3TP2 A;  4K4W A;  1NRK A;  4DL0 C;  1OMS A;  1VQ5 S;  2LXF A;  4FVC A;  3H0P A;  4LSL A;  4OI2 A;  2YY3 A;  1IR1 A;  5A76 A;  1IQZ A;  3M30 A;  4ZCM A;  4K2X A;  2NS1 B;  4USK A;  2IJN A;  2BJ8 A;  3HKW A;  4Q5V A;  1RWM B;  4OZN A;  4PG8 A;  1LW2 A;  3PRV A;  1RTI A;  2KM8 B;  4ZP8 A;  1EJ7 L;  2JFD A;  3P49 B;  1NSP A;  1FE0 A;  3QBC A;  2HGN A;  3OD2 A;  1UJ4 A;  2RE1 A;  5KG3 A;  2Q79 A;  1VI7 A;  1EIY B;  3QSY B;  1Q4R A;  3FKB A;  2CJQ A;  2GW8 A;  4DU8 A;  2J0Q D;  1TKT A;  2GC8 A;  5H1S V;  2LEC A;  4L74 A;  4M5N A;  1PYS B;  3SFU A;  2MQO A;  3ZNJ 1;  3VCD A;  2CDQ A;  4ED6 A;  4KT0 C;  2X3G A;  2R7V A;  3BO4 A;  1WD6 A;  1MRO A;  2I5J B;  3GCW P;  3DOM A;  3F56 A;  2VG6 B;  4KR0 B;  5CYM A;  1N6Q A;  4TVA B;  4QWC A;  1VBZ A;  3ISN D;  4RW8 A;  2B5J A;  3OXG A;  4CT8 A;  2G2Z A;  2PFD A;  2DH8 A;  3PYE A;  2FTR A;  5DO2 A;  3GJS B;  4CDI A;  2CQP A;  4G65 A;  3M8Q B;  1JLQ A;  3EDQ B;  2CQH A;  4DV5 J;  4QWD A;  3F73 A;  5CAB A;  3AXK A;  4YB1 P;  3M9M B;  3BSA A;  4UOC A;  5LL6 d;  1T02 A;  3RRG A;  1FTR A;  3HVT B;  4G3I A;  2RRA A;  3WQP A;  4NXN F;  4DPO A;  2GIR A;  3UN2 A;  4JB8 B;  2HK2 A;  3TVK A;  2R8H A;  1X4F A;  2RF2 A;  1UJ6 A;  2VBY A;  4ES3 A;  1UPP A;  3E51 A;  2D9O A;  2O67 A;  1LXJ A;  2AV5 A;  1RT6 A;  4O44 A; 
#chains in the Genus database with same CATH homology
 1SPB P;  3CNQ P;  2W2N P;  4NMX A;  4JP8 A;  2PMW A;  2W2M P;  2ZWP A;  1V5I B;  3WHI A;  3H42 A;  3QFH A;  3BPS P;  4OV6 A;  3WIV A;  3AFG A;  3A3P B;  2W2O P;  3P5B P;  2Z58 B;  3WIU A;  2Z2Y B;  2W2Q P;  3SQO P;  2Z57 B;  3BGO P;  2W2P P;  2E1P A;  3A3O B;  3VHQ A;  2Z56 B;  1R6V A;  4YN3 B;  3T41 A;  3VV2 B;  1SCJ B;  3CO0 P;  4K8R A;  1ITP A;  2XTJ P;  2Z30 B;  2ZWO A;  3A3N B;  3GCX P;  4NE9 C;  2Z2Z A;  3GCW P;  2QTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...