4NMXA

Pcsk9(deltacrd) in complex with phage-derived inhibitory peptide 2-8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Identification of a Small Peptide That Inhibits PCSK9 Protein Binding to the Low Density Lipoprotein Receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4nmxA01
4OV6A 2ZWOA 1SPBP 2W2NP 3VV2B 2W2PP 3GCXP 2Z30B 1R6VA 2W2MP 3WIVA 1SCJB 2QTWA 2Z58B 1ITPA 3CO0P 3GCWP 4NMXA 3SQOP 3WHIA 3H42A 3A3OB 2ZWPA 3QFHA 1V5IB 3AFGA 2XTJP 4NE9C 2W2OP 3T41A 2E1PA 3CNQP 2W2QP 3WIUA 2PMWA 2Z2ZA 3VHQA 3P5BP 2Z56B 4K8RA 4YN3B 3A3PB 3BGOP 2Z2YB 3BPSP 2Z57B 4JP8A 3A3NB
chains in the Genus database with same CATH superfamily
4IOCQ 1N5TA 2BW2A 2ZH1A 2RS8A 3D0GE 4K59A 1HWLA 1N36F 3KK1A 3GILA 3A1YG 2NUHA 1TQLA 1Y4ZB 2BJDA 5E3AA 5SUHA 4LF1A 2YNIA 4O3QA 3Q23A 1OSDA 1NKBA 1UZDA 2Y8YA 1RHQB 1HBOB 4TU7A 3OL6A 1T05B 2WOMA 2OI2A 3F56A 3ENAA 3N9UC 5IQ6A 5M2PA 2GMJA 3ILOA 2IJFA 3RRGA 1UEKA 5IXUA 4ZVFA 3KJVB 2Z56B 2HFNA 3BGUA 3AOBA 4L75A 4ZCKA 4HDHA 2VD3A 2RIJA 1V6HA 2WBMA 4X64F 5THWA 1C1BB 4ECZA 4DS4A 5KG2A 1AUSL 1TU0B 3MM5A 4L73A 5EWEA 1HWJA 3ILJA 5E2QA 3R8YA 3KLFB 3ZNJ1 4FS1A 3M8SA 2BOAA 3NY0A 1S5ZA 2MLYA 3W8GA 4QBUA 1CSJA 1LWEA 3QZ8A 1S6PA 1RABB 3OSPA 3HF5A 1HL6A 4DHVA 2CFXA 4CO4A 4KGXB 2ZBCA 2ZD1B 4E98A 1VHIA 1WHXA 4ZIVA 1WC3A 2P9EA 1BE4A 4O23A 2GCFA 3G4SS 4DR3F 2HG4A 3GE9A 5B0EA 1ZM2A 1WHWA 1G6BA 4URGA 2YWHA 5HMXA 2MLZA 2HQCA 3GZ7A 4QPXA 2F8MA 2N82B 5CCLA 3E3XA 3DU5A 4WKYA 4DBQA 5HP1A 1WTFA 1B7YB 3GV8B 3DLKB 1WI8A 5CZVA 3D66A 2JFDA 2DRAA 3KYLA 4ZDNA 1FVQA 3H20A 1HNWJ 4F67A 3N6MA 5E0OA 1SVDA 4LIRA 2YWEA 3P49B 5C42B 3DXSX 2N3LA 3D68A 2KFNA 1VQ4S 2XO6A 2KO1A 2AKWB 4RW8A 2D41A 1N4LA 1X8DA 1Q79A 2F4FA 4FF3A 1NM2A 4PYDA 1C1CA 3AQPA 3UD3P 3QNWB 4A8MP 2I38A 3EGWB 3L09A 3HPOA 1RACB 4OHXA 2XGQA 1GFWB 4N47A 2MZSA 5D0RA 3PDNA 5D3GA 1L5UA 2QLXA 3KHHA 4LMZA 1HLWA 2WBRA 4FNHA 3V2UC 3I32A 4NLYA 2DR8A 1SIZA 3BH6B 3B4DA 3FSYA 2OPSA 4MFBB 1FJGF 5GAHU 4B3SF 2RUSA 3C2PA 4DV3J 4E0DA 2E9ZA 2IVFB 5L9NA 3SCLE 3CJRA 1U47A 1KS2A 3LF0A 4DZDA 2Y3YA 3ZFVA 2XNRA 1D1UA 2ZBPA 2EPIA 1DAXA 2FQQB 5U47A 1JLEB 2F4VF 4KPYA 3KLEB 3GG0A 2JC1A 1EETA 4G1PA 1B4SA 1Q16B 3VGUA 2HAIA 3DOLA 3WX4A 1HNIB 1CJVB 1N36J 2W8LA 5L1KA 3EZUA 3AHPA 3M8QA 2R2SA 1APSA 5D6GA 3I5BA 3W3SA 2YQ0A 1B0PA 4C98A 1PJ7A 1S49A 4K4YA 5JUMA 1WNEA 2V8PA 4DL4A 4JB8B 2VC0A 1K9MT 2ZH2A 3M1VB 1T11A 3IP0A 2MQQA 2RRAA 2F65A 4X64J 1B0TA 4LFCF 4XTTA 1IM4A 4UW2A 3RW7A 3NMAA 1RT6A 1ZS6A 1FCAA 5L8RC 1X5PA 3QAEA 1GXLA 4IH6A 4CP5A 2MZQA 2CXEA 2KHDA 4PCQA 2CIMA 3HD1A 1RT1B 1ZETA 5BXIA 3Q8YA 4OQJA 2XQCA 1BQMB 3BR8A 2J76E 2A10A 3TUZC 3W2VB 4OX9J 3J81U 1KTQA 1WHYA 1NSPA 1S1XA 4OV1A 2UXBJ 4EBEA 2EC2A 1UETA 4LREA 3H2UB 1NPRA 2E7VA 2MKIA 4OJ3A 1U45A 1SJQA 3X3UA 2JLEA 3HO1A 3MEGA 4H4KA 1IVZA 1XR7A 2NXNA 1XJWB 4C9DA 1AFJA 2DHXA 3UVJA 3JB9k 2M7SA 2OO4A 4OJHA 3DMJA 3HKZD 4PXCA 3NEKA 2VHGA 1S6QA 3PRBA 4N8NA 3QWUA 3R97A 5E3QA 4JI4J 3J80U 2IA6A 4DPUA 3ZNUA 4R8UB 3AQOA 1VCTA 4LSLA 3G86A 3OFHA 2FVQA 1YJWS 2FC9A 4F0HA 1VBYA 1PAEX 1LFWA 1X4FA 3D3CJ 3FQLA 3CCES 3FFIB 2ZUGA 3T6JA 2FPHX 3AA9A 3UE2A 4WFAQ 2HHWA 1GAOA 5A8KA 1V9OA 5IQQA 3BSCA 4ES1A 1LOUA 4IFYA 1LNQA 3FQKA 2HQDA 1F9HA 3TQ1A 2GC8A 1VLOA 1O8BA 1H72C 3OLAA 2PSZA 2G9OA 5KFHA 3QT8A 1SB6A 4USUA 2CDQA 3MR3A 1TKXB 4JI5F 2YPYA 2A6OA 3CXCR 1FJGJ 1H6KX 1N6QA 2GO9A 2YXLA 5JMNA 2KM8B 3MF5A 1JLGA 4X4UA 2QJ3A 4M5JA 3HI9A 1X60A 4CT9A 4TNOA 2VL1A 1CC7A 2C3YA 4K4SA 2W25A 5DS7A 1UVKA 1JNZB 1Y11A 4AL5A 4OL8A 2IPOB 1UJ6A 1VRUA 4KHMA 2W9CA 3MAAB 4M8LA 2VG6B 4M63A 2XS2A 4A46A 4ZVRB 4WXWA 3LW5C 5LOQA 3ZZRA 3M9OB 1YJTA 1QAYA 3QLHA 3BBBA 3L9ZA 1CS4A 2WZ1A 4O4GA 3SZ2A 3U1LA 5GAEI 1VS3A 1NAQA 4CDIA 8ATCB 2JL9A 2V94A 4F8RA 1IJEB 3N5FA 3NLCA 3BN7A 3M8PA 4B9SA 4F3MA 4HT7A 2CQ4A 4C0BA 3AXMA 1KBRA 2ASJA 1ROFA 2WONA 1YI2S 2LYVA 2W7OA 2MHNA 2HK2A 3WHIA 1RHKB 4QW9A 4LFCJ 4ICLB 2XSJB 2K7JA 4USMA 4LF8F 1JLFB 2DNLA 4WU3A 3JSRA 3OVBA 4USTA 3W62A 3EPIA 4PWDA 1X4AA 2XO7A 3LP0B 3QRPA 3UCUP 2DH7A 1RWMB 3MM7A 4I6WA 1NSAA 3DI6B 1DQ8A 2FHOB 3MEEB 1OMSA 4PXDA 3KTQA 2R2RA 1RWOB 2VA3A 1T0TV 5EGYA 3R5BA 1ZM9A 4QR1A 3D7SB 2V9WA 1TAUA 2OSQA 1IKXA 2MQLA 2FLOA 1Q78A 1HWIA 2O1PA 4C8LA 3OLBA 2XB2D 1S4EA 2ABYA 2MQ8A 1FK9A 1YZ7A 4F2SA 2J0SD 3QWPA 4C3KA 1RI7A 4FYVB 5K8NA 1HNXF 4BCAA 3F41A 4ZPAA 1OY6A 4KFBB 3NKYA 3VCDA 4KKOA 4ED0A 1GK8A 3L7PA 3DOMB 1LKZA 3EE3A 1JJ2R 4ECTA 1RTJA 1C4AA 2WVBA 3W2WB 3BEGB 4NCAA 4B3MJ 5KT3A 2W9BB 1WSVA 1EKRA 1HMVB 3QGGA 3OD2A 4DR4F 2I9SA 2FJXA 1Z4UA 1HR0F 2DNMA 3EMTA 3F73A 4QYZK 2CQ0A 2A3JA 4J9QA 4ELVA 3DRRB 3WZ0A 2DNRA 4DSFA 1KHWA 1FJCA 3OL9A 4H4MA 3VQSA 1RWKB 5JJBA 3ZTSA 4OZ2A 3BBCA 1MWQA 4CLLA 5KG7A 4U67Q 2N7CA 4KR0B 3SV4A 1U1KA 1TK5A 4MH8A 1K1QA 2GFFA 3RUBL 2VDHA 4X65F 3W8PA 1AYEA 4Q0BA 3E8OA 4CYUB 4LF4F 3N01A 3HLUA 2W01A 4X4PA 4NXNJ 3UN3A 4C11B 3GPAA 3MGJA 3CC4S 2G1DA 3QRRA 3K0JA 1NHUA 3CJKA 3TNVA 2WB4A 1SJ4P 4DX7A 1IUJA 1VLYA 2AQ4A 4U7CA 2HEKA 3ET6A 4O3PA 2XZDB 1LWCA 2AJ0A 1S9GA 3VTIA 2UUAF 1MSWD 1RDRA 3NBPA 3H4BA 1RU2A 1YJRA 1RT4A 4OX8A 1D9AA 2DISA 4N41A 5H9FJ 4C2MA 2E1RA 5LMNJ 2OPQA 3P3DA 2KZMA 4OHZA 3G8QA 2CQDA 3QFWA 4CTAA 2ZE2A 2IMWP 2JHEA 3TEGA 4FYDA 2BRLA 2JEJA 3ENVA 1PYTA 3PFOA 2XCAA 3KK2B 5K8PA 2VA2A 3X1LB 1X4GA 3D3BJ 3JSBA 2H5JB 2VH7A 3UDCA 4PG6A 2Y1JA 3TQEA 4KC5A 4QPTA 1XERA 2UVWA 3OJUA 1REVA 2CVEA 3MZIA 1SQEA 3T9ZA 3DNCA 3H0PA 2C3UA 1MN7A 3I0SA 2XZWA 4QIWD 5DM7Q 2MY8A 3NS5A 3P5TL 1Q8LA 5H9FK 4OYIA 1HARA 4DL0C 1FNOA 2R4FA 4ED8A 2DVIA 5C2GA 1N5YB 2W7AA 1LWXA 1D09B 1HIYA 1U1NA 2R8GA 3BH7B 3OUYA 2GW8A 1M5KC 4ECYA 5BJRA 3LOUA 4HHJA 3VHQA 2FJBB 1KN6A 3C14A 2PE8A 1V3RA 2XS5A 3DLGA 1ICEB 2HWHA 1TV6B 3H59A 3THTA 2JX2A 3CMAS 4ZPDA 3BSAA 3CCWA 2UVUA 1JNRB 5B0FA 3PY8A 2B51A 8AT1B 2XY5A 5J2PB 3BR9A 1EARA 1HWUA 2FVSA 3NGSA 1Z2LA 5E41A 4ZVPB 1CG2A 4I7FB 4MK8A 2KYZA 1Q7LB 4LQ3A 1VISA 4IH7A 2QYGA 4YR0A 3L4BC 1UPPA 1DURA 4ILLA 3OR2A 1K0TA 2MPUA 1WC0A 3R1LA 3O3LA 1PKUA 2CJXB 1FWLA 4OX6A 4HH1A 2KFYA 1LXJA 3LP1A 4ZITA 1U8SA 2COLA 1WC5A 1AUDA 2LMIA 3GFYA 4F4KA 5IV3A 3D6FB 1JLAB 4QWBA 4TU8A 4EEYA 1HR0J 1FHTA 3CCSS 3IGVA 5L46A 2FYXA 3D6MB 2RE1A 1V5VA 5LXYA 2K1RB 1ZPVA 4P7VA 4QIEA 2GIQA 3KWMA 3FJ2A 5FD1A 2JEGA 2UZAA 4TLRA 1JB0C 2QMXA 4RUAA 1WF0A 4ECSA 1RTHB 2F9DA 3J7Z5 3PV8A 1FRHA 2OEMA 4MAKA 2DKOB 2CG8A 3MWBA 3ZZPA 4DN9A 2MKHA 1R0AA 4LF4J 5H1SV 4Y34A 4PKDB 1ZZFA 4KYZA 2MGZB 4CLUA 3ISNC 3G9CA 3CC2S 3D1QA 2HIYA 2QG9B 2Q6CA 2WSFC 3NP5A 3FMWA 2CQBA 5DG9A 3FEZA 1YRXA 2MB0B 4PABA 4CLZA 2PDAA 3CD0A 1QVGR 7AT1B 2HKEA 3GR0A 5AXMA 1UEVA 3OTOF 5C25A 1IR2A 3OTCA 2UUAJ 4HHUA 4USJC 1FRKA 1RHMB 2GVDA 2B8QA 4ZA1A 4P10A 4C8ZA 5B09A 1C1BA 4TY8B 2OPPA 1FD2A 3IO1A 3UDVA 3P8BB 2QEXS 4L74A 5ETPA 2E1CA 2QSWA 2M0GB 2M4MA 3QO9B 2HZVA 4RBVA 2NREA 2MYFA 4KQZA 2AYBA 3M2RA 5CQGA 3CJSA 3QJJA 1J2VA 2HVHA 1U6FA 2CWKA 1RKIA 4OZNA 4ZJLA 3TEHB 3VGTA 5DG8A 1RTIB 3I4HX 3MURP 1A6LA 2UU9F 3D6TB 2B9XA 4KGMA 3SQGA 4F50A 4OI2A 5CYMB 3M32A 2L9WA 2IBKA 5T41A 1PO6A 1YJ9S 4A48A 4DS5A 3BJYA 4C8KA 5BR8J 2KYXA 4PXBA 1TFYA 2CQ2A 4J37A 2M70A 3FC9A 1Q86T 3JYTB 3CE8A 4PUOA 3MCOA 2DH9A 2GQCA 1IM6A 4OYAA 1SC6A 1WF1A 1KRPA 3KUGA 2XBPA 4J9SA 5A0YA 2FD2A 2GGPA 2VQEF 4OJ1A 1JKHA 2ROEA 1TKTA 2DY9A 3PHTA 2DPIA 1UVLA 1UFLA 1SQFA 1T9VA 3A4TA 3HZEA 3KNAA 3W60A 1BWEA 2VONA 1GMWD 4CLKA 2ZFHA 2ZZMA 3CD6S 2FZKB 3DM2B 4CQ1A 1EX8A 4C8OA 2LEPA 4DUYF 1U48A 2J0WA 3DU6A 4WWSA 2L08A 1UJ4A 1M0SA 2XZTB 3CCVS 5MLCV 1NK8A 3HJVA 1WACA 5ITHA 2G2OA 4L6V3 1NK6A 2VPYB 1ZM3A 2BV3A 5KTQA 3P45B 5G0RB 3J7ZT 2RU9A 4B9VA 2DR5A 2KJVA 5K9FA 1EP4B 1FKOA 3M2VA 2QA4S 5GAGU 2DD8S 2D1CA 3KDNA 1W2BR 4KIAA 4KH1B 3WQPA 1RWUA 3SSQA 2NXUA 3MM9B 5EX3A 1J5EJ 2MKSA 3A3PB 1VMBA 4DL6A 3US5A 5D0HA 1CC8A 4JV1A 1NJIT 1TTHB 1C0UB 3BGRA 1M5VC 2OAUA 5I42A 2W9AA 3ISZA 4MMOA 2ZKTA 2HNDA 4ZLNA 3B6BA 4IG3A 2QTWA 2EEYA 2V0NA 3HX9A 3M8RA 3NNHA 5JVHQ 2G2YA 2N4DA 4X4VA 4DCJB 4ED3A 3HVAA 4BWJA 2ZVIA 1FERA 2HHPA 3OTOJ 2B6AB 4OJGA 3I96A 3A8EA 1KLMB 4WZMA 4JI3J 2DY1A 1XK8A 2RRBA 2CPIA 4I2PA 2WAQD 4EI2A 4DSIA 3KK1B 1VQ8S 4DR6J 2YNIB 3D67A 5KFTA 3HSDA 1S9EA 4ELTA 2BJ9A 3CIMA 2AWZA 5KT6A 1YRTA 2LXUA 3AFGA 2WOMB 2BMBA 2VOPA 3R7BB 1S48A 2ACMA 1S7HA 4F4WA 3G6VA 3OXLA 4IH5A 4WK3A 4U7UK 8RUCA 2MQOA 3E2EA 1NDKA 2D9PA 4NLXA 2CWXA 4LF5J 3FBEA 4FN5A 1YJNS 5AXKA 1HBNA 1NU4A 4O3NA 1IKVA 2HHUA 3SYZA 5CCMA 2R7RA 2YQ3A 1XNRJ 3G6ES 2IM1A 1Q7YT 4USKA 4ED5A 2W2NP 2KXHA 1RT2A 3MM5B 5M2UA 1RISA 3B82A 1X4HA 2YKMA 3Q8UA 3TZYA 4C8NA 4G1IA 1BY9A 1KLNA 1P9YA 3QGPA 2J6SA 4OZJA 2A18A 1LWEB 1S6PB 5HLFA 3ZZ0A 4M5HA 4FF1A 2RSQA 3VGVA 1O6XA 4DSKA 1FNMA 2QV6A 1RWWB 2EK6A 1H98A 4TQSA 3OSNA 2X51A 1X4CA 1DJ0A 5I3PA 4M5DA 4M5KA 2BJ1A 2QZ8A 4PPDA 1HW9A 2KHCA 4YHHJ 3DN9A 5I4MA 4K4WA 2UUWA 3HM9A 2HNYA 3RW6A 3O1LA 2VQEJ 1HBUA 2HK3A 2KN4A 1YJ7A 1NZ8A 3HT3A 1BXNA 2HYIB 3Q8VA 3OQ2A 3SBMA 1KEKA 1RP5A 5GAHI 4MKAA 3BQ0A 4DV4F 2CQ1A 3CJ2A 3PO4A 1YBAA 2M52A 3CVKA 4WKRA 3QGHA 1FX4A 4MYTA 4ZKAA 1CLFA 2BOPA 2HVZA 2ZUAA 1HFEL 4ZVEA 3A13A 2E29A 2KT3A 1FT8A 1TL3A 3VQTA 3HHNB 2LECA 5ETQA 1Q8KA 2AJFE 4ECXA 3MCNA 4LF6F 3IAM9 1C1CB 1RLCL 3OVAA 2JVRA 1TKZA 3PKYA 2GQ2A 3GFZA 1H38A 2UUBF 2IDEA 1I94J 4I69A 5B0AA 3G2XA 3G96A 2ZITA 5GADU 2EXUA 1RHJB 2M2BA 1HA1A 2XMTA 3TX8A 5HK4A 2ZH5A 5D3GB 1ZBTA 1NJWA 1TP7A 4RU2A 3VALA 2WB1D 3R5DA 3A8KA 2H1YA 1FEHA 2XM3A 1H2VZ 2XMMA 9RUBA 1NSQA 2OPSB 4DV1F 1OWXA 1F9FA 1QUVA 3CCUS 3MTJA 2R7UA 1ZYQA 4KT0C 5GMEA 2K7KA 1OQ3A 4R0EA 1LW0A 2GA7A 1WEZA 1IJFB 4YDXA 2FDNA 2E44A 4URSA 4AXJA 2BE7D 3PX4A 3CJ4A 2DNZA 1S9FA 3GLJA 1EETB 1QSSA 5CABA 3DOLB 1K0VA 4RPFA 4A47A 2IBOA 1X4DA 2ZOFA 4IUFA 5T14A 2KI2A 3RAMA 1GX5A 5HATA 3VAGA 1FEEA 1K1SA 1LFPA 3NGRA 3M8QB 1ZAWA 5F0UA 4NMXA 5KG1A 2Y1LB 2ILYA 3MECA 2J6TA 5HMWA 3LGMA 3ZZYA 1S76D 3GJQB 5KFFA 4LFBF 1U1LA 4HTIA 4OZ0A 4NYOA 3WIVA 4G65A 2C2KB 2H4YB 4OX7A 3R7SB 2XMVA 2HLUA 2K3IA 4DMZA 1NK7A 3PEJA 3PACA 2HZAA 2ZC3A 5KFMA 3T1YJ 3I31A 3TVYA 3CJ0A 1J27A 3PKMA 2JLFA 2PMZD 1VC6A 4P2SA 3GV5B 4LSNA 2QYCA 3V5RA 1NB2A 2LQ9A 1NNDA 1SC4B 1X4BA 1S77D 4ZVOB 4ZVSB 2MHEA 4NLGA 3K8VA 4M5GA 1S1XB 3JSMA 4GKJF 2JC0A 2JJ4D 4NA3A 3T6BA 4I68A 4NA2A 4F7VA 4K5SA 2V8HA 2AYGA 3P4UB 1I1GA 2E9RX 3QSYB 1IBLF 3MEGB 3BKFA 1TZ0A 3KLHA 2RAQA 5DQIA 3TANA 5KFLA 3UVJB 5IT9U 2E1PA 4E8UA 3CDAA 5AXLA 3DMJB 1BC6A 3ILIA 4DUZF 2HVDA 2OD6A 2UP1A 1S6QB 5A2QY 3HD2A 4J90A 3GU0A 3ILLA 2NPIA 4KSEB 1NDPA 3BS9A 2NXJA 3TVZA 5KFPA 1JWWA 4A4JA 4MJKA 4LSLB 1J5OB 4X62F 4KH0B 2ASYA 4KGZB 1VQ9S 3IXQA 2BJ8A 5AT1B 2UVVA 2DT9A 5A8KB 4Q2MA 5HANA 1TKDA 4LF6J 3EDQB 3OJSA 4RBTA 4Y2AA 2CNNB 5CYJA 3H5SA 1KONA 4IFYB 3GP9A 3KHRA 4K2XA 1NO8A 2GNKA 5LMUF 1S7IA 3BKTA 2QSFA 2F63A 2HBQB 2PI5A 2Q3PA 2DJWA 1DHMA 1UA0A 2O66A 2EFNA 2GIFA 2DIVA 1S1WA 1YVFA 5KFVA 2V8GA 2H5IB 4CH0S 4CLTA 1PJ6A 1UKUA 2IRXA 1VQLS 1FNXH 4DV1J 2V9KA 2E5IA 2IYIA 1N6QB 3IBWA 1Y5IB 2EFGA 2XSFA 1KQGB 1VIXA 1JLGB 4V19J 2YY3A 4J91A 2UXCJ 3PCOB 1NRKA 4CWBA 1EB0A 2R9LA 2RF2A 2FVPA 2Y8WA 4PG4A 4TXSA 1NJYA 3GCWP 1L3VA 2X1GA 2FGOA 1ZPWX 3Q8QB 1VRUB 2OFHX 2FC8A 2W9CB 3R5AA 1SH3A 5H9EJ 1WC4A 4K50A 4FDFA 1ZAXA 3RR8A 5F9LA 2HURA 2ADCA 1EJ7L 2BKOA 1SC3B 3QLHB 2WHOA 1CS4B 4O4GB 2I5JA 1GTHA 4RNOA 1F60B 4OZ3A 5CH7B 4K5RA 4LQ9A 3RB4A 5KFZA 4UQGA 2BANA 1TL7B 3FEXB 2WONB 1VGYA 2XI2A 4Y6IA 2KXFA 5AE3A 1VJQA 1HHQA 1JLBA 2HPUA 4DL3A 1PYSB 3C46A 3AD8C 1NPPA 1VQ7S 2BVZA 1NK5A 5H9EK 1MLAA 2M3DA 1QSLA 4PWDB 1NZAA 3IWLA 3D9BA 3MM7B 3AOCA 2E9TA 4ZS6A 5DO2A 4ANCA 3T5HA 4ECWA 1R6YA 2J0QD 3W9JA 2EFOA 4R25A 1Y5NB 3L7UA 3PYDA 1VQNS 4YN3B 3TRGA 3BO2A 5CZXA 1ZZNA 4LR9A 1IKXB 5D15A 5KFYA 4GKJJ 2IM2A 4JOUA 3TAMB 2BBEA 4WYLA 4A8WA 3ETMA 5AJ3F 3DC2A 3I9V9 2D69A 3FSIA 2QIFA 2QX0A 2FUG9 3EGVA 5E33A 4KJIA 2AJ1A 1WDTA 2NSCA 3HHLA 4FNIA 2GHVC 1IBLJ 5DLFA 2V2VA 4J9RA 4M5IA 3DFEA 4FVCA 1XMOF 2KZZA 2VDIA 2R7VA 5FLXY 1K73T 4BHQA 1JLAA 2J0XA 2ZDOA 4KKOB 2ZHBA 3LQVA 1Q82T 4C3LA 3EDRB 4LBHA 1AT1B 3PR4A 4QR0A 5IC6B 1RTJB 3LUYA 4B3TF 4J9OA 4PAAA 2R8IA 2CJBA 2EWHA 3RBEA 3EGZA 2KRBA 4WK1A 4LF9F 2YWKA 3EVOA 3KUHA 5HN0A 4X62J 1FI4A 1RA7A 2FJWA 1B0VA 2GAHC 4RU9A 1RADB 4MKBA 1S57A 3QMQA 3U1NA 1H7WA 3KLGA 2PMWA 2B5JB 3LPEA 1VOMA 1SBRA 2GIRA 4JI1F 4DSEA 3RRKA 4H4MB 5T7LA 1EQ0A 1VRQC 2Z2LA 2XLKA 2VV5A 4PWUA 2P9GA 5LMUJ 3FCWA 2VPZB 4XPEA 3FRZA 3JTNA 1ZAVA 5A6PA 4Q0BB 3QYYA 2O67A 3Q2SC 4MT1A 4ILRA 2WRMA 2HS3A 5HROA 4L3KA 2HFVA 2AV5A 1SPBP 3SSRA 1JK9B 3FDSA 1MG7A 4QR2A 1HNVB 4ZJOA 3MUMP 4S0MA 2HHQA 4K4XA 2POKA 3CJKB 1T9XA 4CO0A 3BYRA 5HBMA 2M88A 1AXQA 4MIAA 4B9NA 5FJ4A 3FNNA 4C48A 3ET6B 3A8IA 1LWCB 4NLDA 1GH8A 1S9GB 4UOFA 1O51A 3ENWA 1UA1A 3SCJE 1RBLA 3CCZA 1VDHA 1WG4A 3NBPB 4WBFA 2ASDA 2BW7A 5D4PA 2OHDA 1PYOB 1RT4B 4OI6A 2HQIA 1FRJA 4AL7A 3FBBA 4J9VA 1DBDA 1HBMA 3SXLA 4JYAF 2A2DA 1S72S 1KFSA 2AX0A 5KG5A 4NLOA 1TAQA 4DZ6A 2QC3A 4CTAB 2DPJA 4C97A 2ZE2B 2HFSA 3MMBA 1RSCA 3Q2TC 2A6MA 3CD7A 4OI3A 3OTDA 4M5NA 5KFAA 3EX7B 3CUNA 2MKJA 3I4PA 2YH0A 3Q0AA 5D77A 3D1OA 2MSTA 2BQ3A 3OVSA 2QL7B 5AE2A 2FHMA 1REVB 1DTQA 3MPVA 1RCXB 2AJ4A 4C0OC 2FZGB 3OFFA 2B3TB 3H90A 2WCXA 1YK9A 3R3TA 3I0SB 2YX1A 3MI7X 4RX6A 2L3MA 1NCLA 2EVZA 4FZVA 1SL2A 3RU0A 4DUTA 3TA0A 3EUNA 5L38A 1U1RA 5KFOA 5L1JA 1YJVA 3PJWA 2R8JA 4NCGA 4M95A 2J9EA 4NPOA 4C8YA 1HD1A 3CGIA 1N32J 3OUYB 4ATNA 2VG7B 3QQCD 1DQ9A 3C14B 1OQ6A 5DJBA 4LRFA 5KFQA 2LXIA 3DLGB 1H74A 1RU1A 2RQKA 3HFKA 1JMTA 4J7CA 1MROA 2FY8A 5E3CA 5A8WA 1TUWA 1XMOJ 4RW9B 5IT9Y 3MPUB 6FDRA 3IBFB 2UXDF 2IJRA 1FFSB 3CEDA 2H54B 1JQGA 2IHR1 3OR2B 5F8LA 4B3TJ 4EO8A 1P8GA 3VR1A 1L3TA 3BREA 2ZHOA 1Y00A 5IOLA 4M5LA 4LF9J 4RWWA 3VAMA 3AY0A 1TL4A 3LP1B 1RBOB 3H42A 1UZHA 2LU2A 4ILMA 2JH3A 2R8KA 5I3UA 2E7WA 1XEZA 5IFMA 1NJXA 3QJLA 4OZ1A 4NMLA 2HWTA 5F8NA 3A8JA 2ZZTA 2H48B 3GJSB 1JLQA 2M8HA 2XI3A 4HL9A 2MQMA 3BGLA 2HRYA 5KOXA 2NR0A 3DXBA 1N56A 1N52B 2YKNA 4ZLLA 3ZZTA 1RCOB 4QWCA 2OEJA 1VI7A 4PXEA 4YB6A 2KU7A 3E01A 2RHQB 4NE9C 3E51A 5LL6d 5HVGA 4K4ZA 3NS6A 1U49A 5DDQC 1R0AB 1HI8A 2HNZA 4NASA 3HVRA 2C28A 2HFUA 2O3DA 4RUBA 2P2CB 1YGYA 3DLBA 6AT1B 2IM0A 4ZP8A 1YQHA 2LQJA 4DR7J 2PEHA 4DCPB 1KFDA 3PR5B 2X3DA 5C25B 2DH8A 2AP6A 4NA1A 1F3VA 3I56S 2GJFA 2B7BB 2CKWA 4MKYA 1AFIA 3GYNA 2GVDB 4A8QA 2AU0A 4I1TA 4DFJA 3PW5A 2KM8C 3TUJC 1HHSA 2PO4A 2A1BA 2OPPB 3BGFA 4JYAJ 1HQUA 3H2LA 2Z2ZA 4DLEA 4MTPA 1V3ZA 4USIA 4X4TA 1B99A 1A7GE 2HGNA 1PJ5A 3DRSA 2BA9A 3HHDA 4CM2A 4DFPA 4LJMA 3IC1A 4RW6A 1RBAA 3W5YA 3M2RB 4KPCA 1WD6A 1D0EA 4OX9F 4ZPWR 2H51B 4XPCA 4ZVUB 1S0VA 2AJ2A 1GXTA 5EWFA 2UXBF 3SSSA 3TOQA 5D0EA 1XWLA 1HPZA 1OY9A 1RWNB 4QJVA 3O6QA 2V4QA 2CPHA 4CLSA 3POTB 4WFXA 2ZZNA 4QIVA 3SQGB 3W5XA 3JQJA 1D3WA 3OFEA 3M32B 3IG1A 3QT6A 3DDNA 4KHRA 4ED7A 1RYSA 2P6SA 4JV2A 1W7WA 1DQAA 2CUYA 3CO9A 1NUEA 2W2QP 4Q43A 4LBIA 5DZ6A 3JXOA 2RRNA 3V6KA 5D4LA 5GAGI 2VFSA 4ERDA 4JI2F 4PUOB 1WELA 4JI4F 4ZCIA 3AODA 3OT9A 1GMWA 5KFDA 5A0YB 1WKLA 2B0GA 5HAOA 2GGPB 1PG5B 3QBCA 4B9TA 5KFWA 4O44B 1U4BA 1JKHB 1TKTB 5EN1A 4FPRA 4IR1A 4M5MA 2BR0A 4Y3CA 3CJ5A 2UXDJ 2DO4A 4KO0A 4LF7F 1EZZB 1VC0A 1KVIA 5EUHA 1BQNA 2NLWA 4G1QB 4BLGA 3H40A 1RAFB 4DL2A 4YDDB 4UOCA 5M2RA 3CULA 1TK8A 3CTRA 1B3TA 3KG1A 3IWNC 1T8EA 1IWGA 2VF3A 2UVRA 3HT0A 3RB0A 1L3KA 1WDDA 3OTBA 3EVWA 3S6EA 3EGNA 2QL9B 2NXCA 2DHSA 2WVEA 1FKOB 3IGNA 3M2VB 3V81A 4RNHA 5EDWA 4URQU 3SI8A 4N56A 2DR7A 3BKUA 4CLPA 2B4VA 3FGVA 3QATA 2EC0A 3F44A 5E7OB 1RTZA 4DF4A 3MEDA 3ZZOA 2FHKA 1RT3A 1UVIA 2FHJD 3GFHA 2YNGB 2EG1A 4P74A 4JI6J 3KLVA 2ZJQQ 1PC5A 3BGRB 1QAJA 1FDAA 3W9HA 5I42B 5KFXA 4K7QA 1XNQJ 4JI8F 3MDFA 4FXDA 2HNDB 4DV2J 3QSIA 1CPZA 4IG3B 4J9LA 3RB6A 2F5GA 3S7RA 2ERRA 2V4JA 3FKBA 2XLIA 4OZ5A 3D28A 1ZTWA 4HACB 1V5IB 1G3OA 1H2TZ 4HDGA 4USWA 2O5DA 2CG4A 1VQPS 2HHXA 3RJMB 4Y00A 1YITS 1N54B 4I2PB 4X4OA 2PIIA 1KR4A 2E66A 4ELUA 1SUQA 2DXEA 1U0HA 1S9EB 4DJBA 5AE1A 4HVZA 5ETLA 2VG5A 3ZTOA 2BJ7A 1D9DA 3R6LB 4BBYA 2EI5A 3MD1A 5GMDA 4P73A 4DEZA 3LGNA 3S01A 4NRTA 1IBMJ 1OPZA 4AE5A 3PX6A 2ZBIA 5HI7A 1FX2A 2JDJA 1HBNB 4NLWA 4AXIA 2IC3A 4K0KF 4L3NA 4MYUA 4RKUC 1IKVB 3TJ8A 4Q2LA 3UNGC 4LRBA 1NPKA 1X31C 4MIWA 2ZWPA 4DU7A 1FF2A 2W2OP 4P52A 1IBCB 4DXLA 1YRUA 1RT2B 5F41A 2ASLA 3H4DA 2P8IA 5DG7A 2GMHA 1NBEB 2YKMB 2CRLA 4I0WA 4A8OA 1CULA 4DPYA 1SL1A 5HLFB 3BDEA 5HVFA 2JOQA 3K58A 3TYTA 4DLGA 2LEAA 1S1TA 4WTOB 2AD9A 2F9JA 5LJ5Y 4JI2J 4IG0B 2LU1A 4M5DB 4B3MF 3UWTA 2M5YA 2XGPA 5GADI 1J5OA 3QPIA 2U1AA 4JBCA 1R8AA 2HNYB 1VQYA 1Y5LB 3O44A 2D74B 4CRJA 1KDNA 4Y28C 1HBUB 2V8DA 2B4UA 2CQ3A 4ZVHA 1GQEA 1SQGA 2NXEA 5KFGA 3MOZA 2MMYA 4KY3A 1T9UA 4USHA 1ZTTA 3CDEA 1LV5A 1CJUA 4LF7J 5F8JA 4FYYB 3V4IA 4AD6A 3PM9A 1F2GA 1KKHA 3ADAC 2ZVSA 2DIUA 3LTOA 2VQFJ 4C7QA 1Y10A 3GIRA 3K5LA 1NH8A 1X5OA 1U2FA 3G82A 1TL3B 3T19A 3M30A 2ZH6A 3V6JA 3U7JA 2CNLB 2OJ3A 4HT5A 4WP9A 5A6WA 4NXNF 3VF0B 2VPXB 2PFDA 3I9ZA 4ER8A 1TKZB 4NX9A 2JRSA 3DLEA 4JP8A 4I67A 3HDSA 3BYPA 1P9QC 2BZ2A 3PRDA 2HRTA 4CM0A 3MR5A 4FBTA 3UFCX 1NK9A 1U8WA 4LRCA 2U2FA 2VFVA 2F40A 1YKWA 1PCAA 2OD4A 1UWAA 4W90B 2O01C 1F1BB 3IS9A 2YKQA 4M1KA 4ECUA 3LA0A 1M1KT 1VFJA 2QFIA 4JI8J 4UUXA 4ZP7A 5LMNF 5JXSA 2DR6A 3G6YA 4XIUA 4FVMA 3PZPA 3VV2B 2JZ5A 4U95A 1S0MA 1LW0B 3NNAA 2ZH4A 4ZVTB 3JS9A 2DEIA 2EK1A 3FUYA 2C22A 3KK3A 3UN5A 4ZCMA 3DDKA 2CZ9A 3PYEA 3GJRB 3MCSA 2CADA 1TL7A 2C42A 3VZHA 1UEUA 1IBKF 2HGLA 3G71S 1SJRA 5CD4H 3OXFA 3OV7A 4OI0A 2OPRA 2Y1RI 2OLWA 3HJFA 3IN5A 5GMKa 3NWGA 4IOBA 2ZBRA 2CA9A 2Q79A 1T03A 2V69A 2CQGA 3MECB 4HKQA 4C0HA 5F0WA 1TK0A 4B02A 2LXFA 4FP9A 1NHVA 3QAUA 2QA1A 1WKKA 2HW3A 2FJDB 4Y2KA 2JSXA 4F26A 2ZHAA 1X0PA 3ETOA 3PYGA 1YWXA 2VBZA 2DGUA 2EKNA 2E7XA 3KJNB 4C8MA 4FXVA 4K0KJ 3DHWC 4ZHRA 5RUBA 4L72B 2J5AA 1FXRA 3TAMA 3DGPA 4HI1A 5KAKA 1QVFR 3IMQJ 3R2CJ 3N5BA 1GXUA 1F5BA 1U2CA 4WCEQ 1XTZA 3BN4A 2XMKA 1IR1A 4O3RA 3WC2A 4LSNB 3H98A 4WJBA 2OIHA 1WF2A 3V6DA 1R0CB 3M2UA 3MOJB 2KTQA 3LP2A 3A12A 2DHAA 4GO7X 3M6XA 1QUPA 1M5HA 3JTPA 3JSMB 2IM3A 1U25A 1YIJS 5J2MA 3BDPA 3HHLD 4DV6F 4OYMA 2RH3A 3RAXA 3JAMY 3C16A 3LANA 2K3KA 1VR6A 2RMLA 3UQSA 1FFGB 2DO0A 3KLHB 2OUGA 3NMRA 4P6QA 4NI2A 3FEYB 2KJWA 4IDKA 2FJVA 3NGTA 3LO3A 2B5JA 3HHEA 3CC7S 5K14A 3MM6A 3DLHA 2PEBA 4K4TA 1XC9A 4C6AA 4QZVB 1S99A 4F0KA 4I6AA 2KG0A 3HSGA 5HQ8A 2RKIA 4IO9Q 2MKCA 3FBCA 3N6LA 2PT0A 3I6PA 3QFHA 4KBIA 3LAMA 3FCHA 5KFEA 1RGVA 2R7QA 4CNYA 4FKYA 2Q6BA 4DPXA 2CPDA 1SH2A 2GS8A 1A0OB 2WTFA 4HTJA 5HJXA 4L76A 3CO0P 1Q81T 3UO0A 2C2MB 2BM0A 3IRXB 4Z37A 2MXYA 2V4RA 1UVJA 2OFGX 3M8ZA 4Y2CA 1HNVA 3OHAA 5IS2A 3OR1A 2QGFB 1QTMA 1Q95G 1CQMA 4LIWA 3RRHA 3K5OA 3CJ8A 1GMUA 2Y1IA 4NYPA 2RNEA 2CJQA 4OYBA 5KFIA 1LK5A 2Y9HA 1N33F 1S1WB 2A0FB 4IRCA 3N79A 2R7XA 2I2YA 1YZ6A 1YDLA 1S6OA 4EGLA 3GMGA 2HBZB 5J1EA 3W5ZA 2X3GA 4LSZB 2HHHJ 3TVKA 6FD1A 2FJEB 4Q5VA 3PJ9A 1S1VA 2ZOMA 3NWRA 2JEIA 2GJIA 2RF2B 1WEYA 3EPGA 4DV5F 3T3FA 1B70B 4ZP9A 4H54A 3Q8RB 4MIBA 3CDUA 1M90T 2HZCA 1F9EB 2FVCA 1IBKJ 5DETA 1I3OB 3UDEA 4JI7J 3MD3A 2G0CA 3GQCA 4OYXA 1KP6A 3MMJA 4RLEA 4Q7AA 2PC6A 4F3OA 2GZOA 3DLLQ 3NL0A 5G4DA 4GC7A 2C2OB 4KGVB 2I5JB 1VBZA 3ZTPA 3MEKA 1XN9A 4F4ZA 4ZIWA 1M1GA 2HVIA 3IWXA 2W4PA 3SV3A 5BR8F 2QRRA 2BANB 4NXMF 2OKQA 5B0DA 2HSEB 4FPIA 3MMAA 4WU2A 1JLBB 3IM9A 4B08A 1UP1A 2VG7A 1KWMA 1UPMB 3KMSA 3TW0A 1GNKA 1SH0A 4RJVA 3T5KA 1WTBA 1CEZA 2OTJS 2R3VA 1NH7A 1FESA 4DR5F 1X0FA 2J8AA 4A8KA 1JJCB 4PQUA 3DYAA 4CCHA 2IRYA 2CPJA 1U09A 3UPFA 4RW9A 3HFVA 3PW4A 2BDPA 3KG4A 3MMCA 3DRPB 4PRFA 2Z58B 1AROP 2PD1A 2BJEA 1H7XA 3CCQS 3EXYA 1RT5A 4B3RJ 1WG1A 2OMOA 5KFSA 2IIHA 3BZQA 4HI2A 2EKYA 4DV6J 2RU3A 3MR6A 3EZ5A 2YNFA 2ZH9A 3FRYA 2ZC4A 4YB7A 3HHLB 2ILZA 1HW8A 3W61A 2JNJA 3B54A 3TA1A 5DM6Q 4QOTA 2W7PA 1C2PA 4ZMMA 3UCZP 4WIQA 4DU8A 5IC4B 4CO5A 2BYCA 3GYGA 4N7TA 2XC9A 1R8CA 4Z7YA 2CYYA 3NGDA 4UZCA 1DLOA 3QGIA 3ZC4A 2K2PA 2DK2A 4ETXA 1NKEA 4DQRA 2FB0A 4TQRA 4ANDA 3AD9C 3GYXB 3Q86A 4X66F 2V50A 1J5EF 1Z2ZA 4EFAC 1TL5A 1RK8A 4WP8A 4USVA 2LQBA 5DDPC 3D5MA 1H0HB 3GSDA 2V2QA 2DNGA 3MFIA 3CSKA 3KLGB 1ACMB 4IKAA 5C5JA 3DGVA 3JTOA 3TR5A 4WE1A 4ZLJA 3R5JB 4F4AA 1CBKA 5T7LB 2DGSA 3MUTP 1T9WA 1D8ZA 3TX0A 2I6WA 2ALZA 3K57A 2EFVA 4UOHA 3AA8A 2QN6B 2BE2B 3W64A 3KLIA 1E6VA 3TAQA 5KT5A 5FDLA 3PRVA 3OL7A 2HRUA 2CPXA 4JI3F 3ZTRA 2R7TA 5HQMA 4DV0F 4I2QA 1SCJB 2Y0SD 2CNKB 1CJTA 2VPWB 3FVYA 3TZWA 1N33J 2MDAA 5HROB 2XY6A 2ZJRQ 1I6JA 4DR6F 1RZMA 4ED1A 1QAIA 4KE5A 3D54A 2GVZA 2AJQA 1QE1A 1PIEA 3C6TA 5HBMB 1KNZA 1QJHA 4Z7CA 1MU2A 2WSEC 4LF5F 2ZEJA 4DV5J 2IRUA 3GONA 3N6NA 2WSCC 3W66A 4DQPA 3GG1A 3UN2A 3AH6A 3CCTA 2ALYB 1BWVA 2ROGA 1XNRF 3NCRA 1LW2A 2SXLA 3AJDA 1URNA 1HBMB 2ATCB 3PNIA 3SDEA 5J2QA 2ZOGA 1AA1B 4G3IA 3POTA 3LWMA 4MKVA 3JQMA 4NWBA 2HWIA 1RWXB 2B4PA 5D78A 1U26A 1CJKB 3MMBB 2AYEA 2XHCA 4HYKA 5ETSA 3UD4P 1T02A 4FS2A 4CH1A 3PG9A 3TO8A 3CJQA 3S1TA 4ZP6A 4NXMJ 4Y2MA 1FDDA 2V63A 1SKRA 3J7AN 3GB0A 2XMWA 4WPAA 4N8OA 2EBGA 1N34J 3NNCA 1DTQB 2ZBQA 1UFWA 2W24A 4YFUA 5HSPA 3L95X 2HBYB 2WK4A 1FRXA 2MZRA 4YHHF 1EIYB 1ZA1B 4O44A 2BXJA 4JI0F 1RLDA 1R8BA 1XMBA 4DR5J 2RQCA 1S97A 3VAJA 2RT3A 4NCGB 2VKRA 2YTCA 3A3OB 1G7CB 2CQHA 2LLZA 1LQ9A 5A2QU 1BQXA 1R89A 1RJJA 2CQCA 1NXIA 1UW9A 4G1QA 3VVUA 3LALA 2WVCA 3THVA 1R8HA 2MQNA 2RDIA 3I0RA 1MROB 2DHGA 2Z2MA 2QLFB 5A8WB 2Z0GA 2VJUA 4WIIA 3GIIA 1KVKA 2D9OA 4BS2A 3H5XA 4F25A 4XK8C 2WVFA 4WFZA 1OIAA 3UDLA 2AEJA 1SKWA 3OHBA 4ID5A 3SIPB 4TN2A 1TMJA 2R2UA 2DYAA 1SV5A 4ED2A 1R6VA 4H4KC 1I94F 4LR7A 3KMQA 2QMWA 2ZNZA 1XMQF 2OP5A 4QWDA 3FSXA 5B0CA 1IQZA 4X66J 5CYQA 3D6HB 4NLRA 2XMAA 1LXNA 2VFTA 4NL5A 1C4CA 2CDRB 5I3UB 3J7A1 2YNGA 2J9DA 3QT5A 2CJYB 2KKHA 1ITPA 1RTDA 3AOAA 1WORA 5B0GA 5FIIA 3CJTA 1JLQB 1RUSA 3TA2A 3EM1A 4OLOA 1I5OB 1T94A 1GEHA 1LWFB 2DXDA 4DR3J 3SQOP 1X7VA 2YKNB 4YQWA 2UUTA 4KTQA 4HACA 4DPOA 1LEOA 3E01B 1TL1A 3HP6A 2XNQA 3MM8A 2IJNA 2YWFA 1WWHA 3PTWA 4DV0J 3K89A 1VK3A 3FCVA 2HNZB 1R31A 4K2JA 4X4NA 4NEYA 2J7UA 2YWWA 3I5AA 4WYWA 5L1IA 1WKJA 4ED4A 3R9LA 2CJAA 4DX5A 2MZ1A 2XEXA 3K5MA 1YX2A 2OH2A 1HQ2A 1KC8T 3EWGA 3PFEA 5LSOA 2HMIA 5A8RA 2NZ4A 2RJZA 2F3JA 1WEXA 3M7VA 2MEWA 4LT6A 3CB4A 5ETNA 3C19A 3T1YF 1UTAA 3G8TA 4UZBA 2RB7A 1HQUB 3GR1A 2G4BA 2AEMA 3ZO7A 3IAS9 3Q83A 2P5VA 3MPDA 5B0BA 1QM9A 3DRSB 5LT5A 2IVMA 4FF2A 1OS5A 3KOAA 4RW6B 2EW9A 2XTJP 2H9ZA 4CO1A 2ZH8A 3RR7A 2AZ1A 5D0GA 3MAHA 4B3SJ 1HPZB 2CPYA 2AGQA 3H5UA 1CVJA 4IG0A 4E2FB 3PIOQ 1NHKL 5KFJA 2C1EB 2ZM6F 1DTTA 3IG1B 2RDDA 3PVXA 1OO0B 2NYIA 4JI0J 4DI6A 3LPYA 3EICA 2X1FA 2KVQE 2F4VJ 4NLPA 4IR9A 3N28A 5FLXU 1GT8A 1QLNA 2CJ9A 4OLPA 3IR6B 5DDRC 3AJ2A 2L9NA 2IAJB 2W1BA 4F02A 1DY3A 4Q8FA 4RO0A 3U02A 3M4XA 2J7WA 4WZQA 4I4BA 4RR5A 3RB3A 1IWAA 1X5SA 4PZVA 2RQ4A 4ZLPA 2FIUA 2F8EX 4IFVA 1IQTA 1JIHA 1PC4A 4QIFA 5KFRA 3N4WA 4RUHA 3IRWP 4ZPVR 4KO0B 2NS1B 1TELA 1F0XA 2QL5B 2YKPA 3PYFA 1UW4A 1BQNB 1HQEB 5DQHA 3NS7B 5J2NA 4IQMA 1GX6A 2VB6A 2LDIA 3WDOA 1XMQJ 2YNHA 4F3QA 3HVTA 1FKAF 3CF5Q 1PSDA 3K17A 4ZK7M 4Q8EA 2XWXA 4ZVQB 4IYQA 1Q8BA 4GRSA 2DEJA 2FHJA 4ZVGA 3C15B 3V81B 3ZZUA 1S1UA 5JVGQ 4J9PA 5HO4A 1VBKA 3QIPB 5F8IA 1NK4A 3Q8SB 4ITSA 4C4WA 4QYZJ 2UXCF 4DN0A 1FJ7A 2C2ZB 3WX8A 3OXGA 5SZTA 4RZRA 5E3RA 3MEDB 1X9WA 1YG0A 3HULA 1RT3B 5I3QA 1SXLA 4N76A 1SIWB 3TJAA 2N3OA 2DCUB 1FXLA 1Y3JA 4HH0A 2QMUB 4U8VA 4D3HA 3P96A 4UTGA 4LVNP 3VVTA 2V4JB 3MAQA 2HBRB 7FD1A 5D8HB 5KG4A 4BWMA 3BPDA 2WW4A 5DLGA 4RW4A 2DGWA 4ECQA 4OYOA 1JJHA 3AT1B 1TFWA 1QTNB 2BM1A 2BEFA 1MWZA 3OTEA 1T9YA 1VK8A 4JUZA 4CZCA 2HGMA 3MHYA 1SUQB 1U0HB 3AD7C 3CWJA 1WSRA 4ZCLA 2AGOA 2VG5B 2QA2A 2V6AA 2C3MA 5K8MA 2VUGA 2VZ9A 3VWSA 4EZ9A 2DGTA 1Q53A 5KFBA 2AHOB 4OHYA 1FRLA 1BUXA 1WC1A 2IC3B 5LSLA 4JI5J 1UJ5A 4TYAA 2ZH7A 4IOAQ 2YH1A 1RHRB 3IR7B 4PR6A 1UFKA 2LCWA 3VAIA 5HL7Q 2E5LF 4FBUA 2G2ZA 4K4UA 4DG1A 1QSYA 1FKPA 1UWBA 5C7PA 1ULRA 3HSZA 4EMDA 4TYBA 2ZM6J 3C8YA 1C0TA 1CULB 1U1PA 3K59A 1P6TA 4ID8A 2NPFA 2AGPA 4QCLA 2DB1A 1BMQB 3K5PA 3VAKA 1FDNA 2UV8A 2I8EA 2HLTA 1GMVA 1S1TB 1RAGB 1NK0A 3MUVP 1VRTA 1A9NB 2V5HG 1RWPB 5K5MA 2B56A 3HMJG 4HHHA 1P27B 3UCGA 1FO1A 3MR7A 5KFUA 1N8RT 1V3SA 1AZSB 2XLJA 1RYRA 1FWKA 1P1TA 4RNFA 3R6GB 2YX7A 1N88A 2QLWA 1HHTP 4B3OB 3OPKA 3IRXA 1CJUB 5C24B 3RG6A 3AXKA 1YBTA 3KKFA 3V4IB 1KQSR 4X4SA 4LF8J 1Q8IA 4X84A 1VQKS 2VIHA 1HYSB 5HVHA 1PAUB 3IFEA 3NGKA 4DDFA 3M05A 2EFQA 4TY9A 1G4CA 2DRBA 1REGX 3RBXA 3ENQA 4GO5X 3G82B 2PA3A 2W2MP 5L39A 2OMLA 3J81Y 3M30B 1R8PA 1RAIB 4FYXB 5GVQA 3HKWA 5IM0A 1RT7A 3VGSA 2GAGC 4R5PA 2DRDA 1U7LA 4CNZA 3G6XA 2MY7A 2W2PP 4V1Ak 2IFXA 2DCLA 2Z30B 2HAFA 3DLEB 3W65A 4DQIA 3M6WA 1S79A 3FZBA 2VBWA 3PEHA 1VQ6S 4I64A 5DGAA 3J7YU 1FDBA 1RHUB 2XG8A 3NCQA 5HMZA 2EBEA 1U6BA 1TR0A 1JLCA 2DGQA 1HNXJ 1VJWA 2OGUA 1WOSA 4N77A 1QD1A 4CI0B 3H2VE 5ETOA 1U24A 2MJUA 1R3NA 2HIQA 2I1RA 3D4JA 2XULA 2M9KA 4IO1A 4H4OA 3IS9B 3J80Y 2JWNA 2B4OA 5IWAF 4K4VA 2GHPA 3KG0A 4ZPCA 3B4MA 2DHHA 3KHLA 4A8SA 4KV8A 4X4RA 1BD6A 1XIQA 2VBXA 4AFFA 4X4QA 4RW7A 1ELOA 1PGZA 2V68A 1F5CA 3GJTB 4DR4J 2GV1A 2GJ2A 3KK3B 2IY5B 4J5OA 1IKWA 1NLKL 4DPWA 1E6YA 4OMFG 2R7OA 2JVOA 5BYRA 1WI6A 4DCOB 3SFGA 1NJZA 1TUGB 3GIMA 1DFDA 1OYEA 3CMES 3BPSP 4DQSA 1URRA 3TUPA 2OPRB 3CDWA 3RBZA 3T5JA 4KGKA 1UCNA 4NZ7A 1T03B 2PFFB 3PJXA 4ECRA 4GVBA 3P5BP 3I82A 2OEKA 1IKYA 5KFNA 4X65J 4OYPA 2P6TA 3Q89A 3EZOA 3ITHA 3C6UB 1Y3KA 3T1AA 3DRPA 2AIRB 1N32F 3DOKB 4OI4A 2RD5C 4IQXA 4YB5A 3RAQA 4ZHRB 1MMDA 3I5CA 4TU9A 4J9UE 2HS4A 2NUUG 3TZZA 1HBOA 3DGPB 3H8YA 1T05A 2E5LJ 5KFKA 1FE0A 1X4EA 1RAOA 3U27A 1MW7A 2BRKA 2EG2A 3KJVA 4DFMA 3V6DB 2HVEA 3PO5A 3M2UB 3B78A 3LP2B 1OPIA 1U1OA 4GVLA 4U6PA 4OI1A 1DARA 2WVDA 2ZKUA 1FVSA 1H3DA 3SCKE 3BQ2A 1U6ZA 5J2MB 2G0IA 3HZGA 3D1HA 2OSRA 1VIOA 1FD8A 5KT2A 1NDLA 2EFPA 3KLFA 3ELHA 3C16B 3BB5A 2MZTA 1ZH5A 3L3CA 4RBUA 1L3SA 1R43A 4NI2B 1JX4A 4UOGA 3G8SA 3KNGA 4F4YA 4IDKB 2ZD1A 4I6YA 2CAJA 3ZXWA 2L9DA 1Z1ZA 5K14B 2OELA 2BQUA 3MM6B 5IT0A 2YQ1A 4ANEA 1JXLA 4OYWA 3IR5B 2RKIB 4LVOP 1K8AT 1TVRB 1WUUA 3UR0A 2DBBA 1H73A 5L1LA 3NG8A 2BE2A 1FFWB 4FXWA 1XBWA 2CPFA 1T95A 4OIXA 4NLQA 2XYPB 5B08A 3FK4A 3DLKA 2MZJA 1D8YA 3M8WA 5E3PA 1Y7PA 4DQQA 3OR1B 1Q0NA 2FLLA 2Z2YB 5C42A 4DR7F 2KDOA 2DNQA 3DKDA 4JV0A 3GIKA 2JLGA 5F3TA 3M9MB 1YHQS 3ISND 4YB1P 3R5CA 1FA0A 2R7SA 2WW8A 3BGOP 1UL3A 4PG7A 2YKOA 4OFZA 2IVYA 2LDYA 3H5YA 5IT4A 2MTLA 1M5OC 1S0NA 4YP3A 2G1HA 3OFGA 5J1EB 5IWAJ 1VHFA 2VFUA 1SI9A 1L3UA 1VC5A 1S1VB 4CT8A 4K8RA 2HHTA 1CJKA 2CVIA 1RA6A 1VQ5S 2G0JA 3LWLA 1KVJA 4HEA9 3VZIA 4QYRA 3DRXA 4MFBA 1H2UX 3Q8PB 2CPEA 3LH2S 1ZOTA 1UVMA 2HFZA 2X1BA 4U7UD 5DZ7A 3MPWA 2C3PA 5HQLA 2DNOA 3CCLS 2DGVA 4J9NA 1KHVA 1JLEA 1SL0A 3KLEA 3DDIA 4PG5A 3FZ2A 5C2CA 1CQNA 4GMKA 4RUCA 3BO3A 1HNIA 1CJVA 3MMAB 2DR9A 5F8HA 3W63A 4LR8A 1UMJA 3CPWR 2AF6A 2B7CB 2Q1LA 2QA4G 1P1LA 3M6UA 2XCPA 5DRKA 1NKCA 3CJ3A 4FYWB 4F4XA 4EYIB 2CZ4A 3KJFB 4PQUB 3DYAB 2E5GA 4DR2F 2HS0A 1HD0A 1B7FA 2HQFA 3V4MA 3MMCB 3M1VA 1QDUB 3EJMA 3I87A 4EU0A 4Q45A 2FGCA 4GC6A 2E5HA 1X9MA 3M9NB 3A3NB 3LGHA 3AB2B 4BC7A 2V2KA 2YX4A 4CIOA 4Z2XA 2PA8D 2IMOA 1RT5B 1R7IA 1O0PA 3T1HF 2K06A 5ETRA 3DCAA 2R8HA 3T5LA 1QY7A 2YNFB 3GIJA 3Q24A 4UQTA 1RT1A 1F2HA 1ZM4A 2ZNYA 2NZCA 2FVRA 4Y65A 1BQMA 2MLXA 1O5JA 4B9LA 3J81j 3H25A 3W2VA 1SJ1A 2R42A 4PWWA 2GQQA 1YJUA 4QIGA 2XS7A 1DLOB 1LWFA 3FBFA 2UU9J 2MQPA 4CLYA 4ZN3A 3RZAA 3R27A 2DGOA 1RAHB 1MN9A 4ZOSA 1RKJA 2E1MC 1WG5A 4ETZA 4JI6F 3DHXA 4EBCA 2MKYA 3BM7A 1XNQF 4WE1B 5LSRA 4XDDA 5E5NA 1RWVB 4DV2F 1RB0A 2D7SA 3NXZA 2R2TA 4R8UA 2C2DA 3C3LA 4EBDA 3THPA 2Z4PA 2HQGA 2FLNA 1RXOB 1HI1A 3ZTQA 4CH7A 3KLIB 1E6VB 3FFIA 5FDLB 4DR1F 1HWKA 2RS2A 4I2QB 5HP1B 1YTYA 3OL8A 3R1HA 1CJTB 4LBPA 4YR2A 2DITA 4DUYJ 2YVSA 5J1PA 3R5GA 3PW0A 2L41A 1FJEB 2GVZB 3SEOA 4EUVA 1QE1B 2N7YA 2C2NA 4ES2A 3C6TB 3N0VA 1N5SA 1I51B 4P2MA 3K7RA 2LA6A 1VQSA 2KRRA 1N0UA 1MU2B 2NQPA 4RW8B 1IBMF 4P2XA 4AL6A 3NOGA 1MNEA 1TKXA 4LFAF 1BGXT 3I55S 2LVWA 5KG0A 2J7KA 1TUVA 3F0NA 2VBYA 4XO0A 1LW2B 4WFBQ 1U2RA 3SDEB 5J2QB 5F9NA 4M94A 1XR5A 4AYBD 3TI0A 5ETMA 2N4CA 3MCMA 2ACYA 1N48A 2UV8G 2LFVA 4F36A 5A76A 1WOOA 3TARA 3NOCA 9ATCB 5ETKA 4DFKA 2VKZG 4BC9A 3MAAA 3CCRS 4Y2IA 1NB7A 1FWPA 2VG6A 2VFRA 2BJ3A 2IAJA 4WXOA 2RDJA 4XDCA 1PILA 1G2EA 3MPYA 4HLBA 3S8SA 5CHCB 4YS2A 4B17A 1Q5YA 1Q5VA 4AT1B 2PGCA 3GFXA 3JAMU 1Y0HA 4UY85 5KOWA 2V8VA 2LKZA 2J9DE 2X7IA 1MMLA 1S59A 2QO3A 5IV4A 4KRWA 4DR2J 3P6YC 4DWIA 2Q66A 4DL7A 4EWTA 3UW1A 3RYLA 2KB2A 4ICLA 5J1NA 3ZZZA 2XSJA 1AB8A 1JLFA 3W7BA 4DL5A 4GKKF 3NCPA 1HQEA 3L7OA 2VQFF 3T1HJ 2CQPA 2IYGA 3HXMA 3R2DJ 1RQ0A 3LP0A 4LF2A 3TJ9A 1D9FA 3DI6A 2QLBB 3HHKA 3I0RB 3MEEA 3UR3C 5DGBA 2DNNA 2XWYA 3NAHA 2HQ3A 3GV7B 1N5QA 3AB4B 1UAWA 2E1AA 4DX8H 2VU5A 4R0JA 1RAJA 2HHVA 4B9UA 4TKTA 1RT6B 1SJ3P 3C15A 1S6UA 4ID5B 4OZLA 3NRBA 2DGXA 1SV5B 3CNQP 2ZJPQ 3QIPA 2D3O1 4ZJQA 4QU7A 5GAEU 3CDBA 5CYQB 4RNNA 4YOEA 3D0IE 3OW2R 4NOHA 4C3MA 4G6VB 2M8DB 1X5TA 5LXRA 5DDOC 5B7WA 1K47A 4DF8A 4JV5F 4KFBA 3O5TB 1EQMA 5AXNA 1RTDB 3DOMA 5D4NA 4OV6A 3HSJA 1KOHA 4ZPTR 4KAIA 1EHWA 2HHSA 4KHPF 3W2WA 2MJNA 2W9BA 4DPTA 3G87A 4ED6A 3VAHA 3SCIE 4ECVA 1HMVA 5IZHA 1U02A 1TL1B 2J9CA 1OY8A 3MM8B 3OBIA 3UNYA 5LJ3Y 4DR1J 4NLUA 1FRIA 4F2RA 3FMBA 4NYZA 1U1MA 3DRRA 3JSYA 1HNZF 2AMCB 4DOZA 2PI4A 4DSJA 4DV4J 3CCMS 2B9YA 3K2YA 1IR0A 4OYZA 4F0MA 2YBVA 3K5NA 2W4DA 2ZWOA 3MR2A 2C2RA 2ADBA 1F3FA 4CO3A 1S0OA 3B8HA 3HVWA 2HMIB 4CYUA 2KG1A 5A8RB 4ALZA 4PG8A 5L9XA 2XHWA 1UVNA 4C11A 2E5JA 4LFAJ 4XAKA 2R7WA 4QQBA 1R0BG 1FE4A 1YLXA 1W25A 3PX0A 1M5PC 3Q22A 3WIUA 2UUBJ 4O3SA 1KTVA 2KXNB 4QWEA 4AQYF 3V6HA 4YR3A 3DLJA 4NZ0A 3O8WA 4DV7F 4UY8T 2VASA 4NLSA 4AUKA 2W8KA 3KXDA 2JFKA 1BHNA 2BUNA 2KFZA 1N5VA 4A8FA 2V2ZA 2KVIA 3EXCX 4EO6A 2XYGB 4YMEA 4CLFA 1MMNA 3QJPA 1VYAA 4U96A 3GTYX 1DTTB 4W92B 2X1AA 3KK2A 1TMMA 2B9EA 1AZSA 4DX6A 4ZN1A 1Q4RA 3TAPA 3O2IA 3QZ7A 2H65B 2RVJA 2KL8A 3HCXA 5HJYA 2B8PA 4ES3A 5D4OA 2H3EB 3GCXP 4EK2A 4B3OA 2QLJB 5C24A 3IM8A 1IN0A 3RGIA 2FJAB 4OHVA 4NEZA 3PHEA 4D3GA 3TUIC 4GKKJ 1HYSA 4NCBA 4DSLA 4LFBJ 4ZPBA 3M8YA 2QFJA 2PMHA 4IFVB 3M8PB 5BYQA 1Y9OA 1N5YA 2GO8A 2DNHA 1FTRA 4TLQA 2D3UA 4UUWA 1HI0P 2D3ZA 4LRDA 5EX0A 2K8GA 1FRMA 2W4CA 1OSCA 1KOOA 2BKNA 3HHLC 3BO4A 4CLWA 1TV6A 5J2NB 2HFOA 3TZXA 3WBZA 1S10A 4UT4A 7FDRA 1RAEB 2YNHB 1X9SA 1KQKA 3HVTB 4O0NA 4P75A 3RTVA 2UUCF 4KB7A 5J2PA 4LUBA 1FXDA 2RUGA 3HFZB 2VJVA 1GTEA 4UF4A 2G13A 1QAXA 4JV5J 5CD4A 2YKAA 2NSBA 4I7FA 1AW0A 3UI3A 3K8WA 4EZ6A 4QWAA 2Y0BB 1PBUA 3TP2A 2DNKA 3KDOA 1S1UB 3MXHP 2HHHF 1JXVA 4KHPJ 4O3OA 1VQMS 5F3ZA 1FK9B 4TVAB 2Z57B 5DQGA 3W9IA 3SFUA 4BDPA 1G1XA 3IA0A 3PW7A 3PIPQ 4YEAA 4RNMA 4V19X 2J6UA 2LQ5A 1SJFA 4PYAA 1EAYC 5KG6A 3D0HE 4OHWA 3BF4A 2DXFA 3AAWB 1OJ4A 3ONQA 4DUZJ 2IDLA 1B64A 1N0VC 1RE1B 4JI7F 5ADZA 2DNPA 4O0IA 3WC0A 3MFHA 4MK9A 2K1RA 1HNZJ 1R27B 2AT1B 3CIZA 2CPZA 4O4RA 2ATLA 4YY3F 2BKPA 1VQOS 4W4MA 4Q44A 5ETTA 4WFNQ 1RTHA 1VBXA 1XR6A 4RW4B 4LRAA 1W2IA 2XY7A 2F8HA 2BQRA 3C6UA 3KUEA 4B9MA 3TWZA 2KH9A 2GX8A 2MGZA 3DOKA 1T9TA 3QIDA 2Q43A 4NRUA 1T3OA 5BYSA 5F8GA 3CD5A 3BSOA 1S12A 4J9MA 3RBDA 3H7HB 2P9CA 3KHGA 4RWXA 4HR2A 2B9WA 3EYZA 4RL1A 2CQIA 4NLTA 2AW0A 5HMYA 4WF9Q 4WFYA 3ULHA 3KFWX 3DRYA 4AQYJ 2A2CA 2RILA 5KT7A 1K44A 4P72A 3U1MA 4DV7J 2QT7A 2LA4A 1LK7A 4TY8A 2C3OA 1EKSA 3VAFA 2F7VA 2CJKA 4B3RF 4A8YA 2GMLA 4DG1B 1T7PA 1WC6A 2H4WB 4YUDA 2VC1A 1FKPB 4N5SA 1BLUA 1UWBB 4Y0FA 2QE5A 3QO9A 1KD1T 2H5EA 2IA0A 1C0TB 5LM7E 4QU6A 2LP4A 2YPZA 2I0XA 2ROPA 4ENOA 1ZA2B 5EWGA 3SMZA 2BABA 3KJQB 3D2WA 1RTIA 2OPQB 4PEOA 4IRDA 1VRTB 2ZDPA 4U9RA 3PXGa 2V67A 2DNYA 1IXKA 5CYMA 2CZVC 3J7YI 1TVRA 2B43A 4A8XA 3NAIA 2BX6A 2AZ3A 1HKAA 1NEEA 2Z8QA 2NCKL 4PQAA 1SKSA 2C2EA 3R7NB 4I56A 3JYTA 1SC1B 2KT5A 2BACA 3T9NA 3C66A 4IRKA 4EYHB 4P71A 1RAAB 1M1HA 2YWGA 2D3OR 4NZ6A 2KT2A 1JJ4A 3GSIA 1W26A 1OYDA 2BE9B 5KT4A 2NYHA 4P2FA 1DRZA 1U1QA 4P7TA 3EVMA 2UUCJ 4F04B 2RHSB 4WTYA 1MWYA 1YSJA 2FY1A 1RT7B 5IM0B 5KG3A 3QT7A 2MKKA 4R5PB 1T3NA 1WJ9A 2V34A 2JEFA 3DM2A 1KSPA 5F8MA 5K8OA 5EHHA 3QRQA 2XYHB 5KFCA 5CAAA 4QW8A 1HNWF 5AJ3J 5K20B 3ICLA 1FTCA 3HK2A 3BSNA 3BV8A 2F1FA 1F5AA 1XQIA 2VICA 2CNOB 3CMQA 3T41A 2AX1A 1SKUB 2AYMA 1JLCB 5G0RA 4X2BA 1Q1KA 1KQFB 3BQ1A 3BBFA 2AEFA 1U0SA 1EP4A 2GHWA 4FF4A 2MSSA 4W98A 1YBUA 2J8SA 3JQKA 2OTLS 4H4OB 1JXEA 3AJ1A 2RQMA 1WHVA 2DTJA 1NDCA 2VOOA 4KV8B 2VODA 4YY3J 1DZ5A 3MM9A 4RW7B 3PW2A 2XMUA 4MK7A 4WP3A 2PN6A 3CCJS 3CW2C 1S4FA 1F6TA 2XMJA 5ETVA 1IKWB 2FZCB 1E6YB 3UD5A 2FTRA 4NLVA 1C0UA 4FKXA 5CXTA 2APOA 3IBCB 1N34F 4J9KA 4JI1J 2L48A 4DV3F 2LQ8A 3W1YC 1M5SA 4CO2A 3CT9A 2ZH3A 3GWCA 4P9SA 5MAOA 4GVBB 3NGUA 4U8YA 1NSKL 1WOPA 2LEBA 1IKYB 1NMEB 1PBAA 2B6AA 3ITHB 4PPZA 1KLMA 3M6VA 2FLPA 3LAKA 5CA5A 3MTKA
chains in the Genus database with same CATH topology
4OV6A 2ZWOA 1SPBP 2W2NP 3VV2B 2W2PP 3GCXP 2Z30B 1R6VA 2W2MP 3WIVA 1SCJB 2QTWA 2Z58B 1ITPA 3CO0P 3GCWP 4NMXA 3SQOP 3WHIA 3H42A 3A3OB 2ZWPA 3QFHA 1V5IB 3AFGA 2XTJP 4NE9C 2W2OP 3T41A 2E1PA 3CNQP 2W2QP 3WIUA 2PMWA 2Z2ZA 3VHQA 3P5BP 2Z56B 4K8RA 4YN3B 3A3PB 3BGOP 2Z2YB 3BPSP 2Z57B 4JP8A 3A3NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OV6 A;  2ZWO A;  1SPB P;  2W2N P;  3VV2 B;  2W2P P;  3GCX P;  2Z30 B;  1R6V A;  2W2M P;  3WIV A;  1SCJ B;  2QTW A;  2Z58 B;  1ITP A;  3CO0 P;  3GCW P;  4NMX A;  3SQO P;  3WHI A;  3H42 A;  3A3O B;  2ZWP A;  3QFH A;  1V5I B;  3AFG A;  2XTJ P;  4NE9 C;  2W2O P;  3T41 A;  2E1P A;  3CNQ P;  2W2Q P;  3WIU A;  2PMW A;  2Z2Z A;  3VHQ A;  3P5B P;  2Z56 B;  4K8R A;  4YN3 B;  3A3P B;  3BGO P;  2Z2Y B;  3BPS P;  2Z57 B;  4JP8 A;  3A3N B; 
#chains in the Genus database with same CATH topology
 4IOC Q;  1N5T A;  2BW2 A;  2ZH1 A;  2RS8 A;  3D0G E;  4K59 A;  1HWL A;  1N36 F;  3KK1 A;  3GIL A;  3A1Y G;  2NUH A;  1TQL A;  1Y4Z B;  2BJD A;  5E3A A;  5SUH A;  4LF1 A;  2YNI A;  4O3Q A;  3Q23 A;  1OSD A;  1NKB A;  1UZD A;  2Y8Y A;  1RHQ B;  1HBO B;  4TU7 A;  3OL6 A;  1T05 B;  2WOM A;  2OI2 A;  3F56 A;  3ENA A;  3N9U C;  5IQ6 A;  5M2P A;  2GMJ A;  3ILO A;  2IJF A;  3RRG A;  1UEK A;  5IXU A;  4ZVF A;  3KJV B;  2Z56 B;  2HFN A;  3BGU A;  3AOB A;  4L75 A;  4ZCK A;  4HDH A;  2VD3 A;  2RIJ A;  1V6H A;  2WBM A;  4X64 F;  5THW A;  1C1B B;  4ECZ A;  4DS4 A;  5KG2 A;  1AUS L;  1TU0 B;  3MM5 A;  4L73 A;  5EWE A;  1HWJ A;  3ILJ A;  5E2Q A;  3R8Y A;  3KLF B;  3ZNJ 1;  4FS1 A;  3M8S A;  2BOA A;  3NY0 A;  1S5Z A;  2MLY A;  3W8G A;  4QBU A;  1CSJ A;  1LWE A;  3QZ8 A;  1S6P A;  1RAB B;  3OSP A;  3HF5 A;  1HL6 A;  4DHV A;  2CFX A;  4CO4 A;  4KGX B;  2ZBC A;  2ZD1 B;  4E98 A;  1VHI A;  1WHX A;  4ZIV A;  1WC3 A;  2P9E A;  1BE4 A;  4O23 A;  2GCF A;  3G4S S;  4DR3 F;  2HG4 A;  3GE9 A;  5B0E A;  1ZM2 A;  1WHW A;  1G6B A;  4URG A;  2YWH A;  5HMX A;  2MLZ A;  2HQC A;  3GZ7 A;  4QPX A;  2F8M A;  2N82 B;  5CCL A;  3E3X A;  3DU5 A;  4WKY A;  4DBQ A;  5HP1 A;  1WTF A;  1B7Y B;  3GV8 B;  3DLK B;  1WI8 A;  5CZV A;  3D66 A;  2JFD A;  2DRA A;  3KYL A;  4ZDN A;  1FVQ A;  3H20 A;  1HNW J;  4F67 A;  3N6M A;  5E0O A;  1SVD A;  4LIR A;  2YWE A;  3P49 B;  5C42 B;  3DXS X;  2N3L A;  3D68 A;  2KFN A;  1VQ4 S;  2XO6 A;  2KO1 A;  2AKW B;  4RW8 A;  2D41 A;  1N4L A;  1X8D A;  1Q79 A;  2F4F A;  4FF3 A;  1NM2 A;  4PYD A;  1C1C A;  3AQP A;  3UD3 P;  3QNW B;  4A8M P;  2I38 A;  3EGW B;  3L09 A;  3HPO A;  1RAC B;  4OHX A;  2XGQ A;  1GFW B;  4N47 A;  2MZS A;  5D0R A;  3PDN A;  5D3G A;  1L5U A;  2QLX A;  3KHH A;  4LMZ A;  1HLW A;  2WBR A;  4FNH A;  3V2U C;  3I32 A;  4NLY A;  2DR8 A;  1SIZ A;  3BH6 B;  3B4D A;  3FSY A;  2OPS A;  4MFB B;  1FJG F;  5GAH U;  4B3S F;  2RUS A;  3C2P A;  4DV3 J;  4E0D A;  2E9Z A;  2IVF B;  5L9N A;  3SCL E;  3CJR A;  1U47 A;  1KS2 A;  3LF0 A;  4DZD A;  2Y3Y A;  3ZFV A;  2XNR A;  1D1U A;  2ZBP A;  2EPI A;  1DAX A;  2FQQ B;  5U47 A;  1JLE B;  2F4V F;  4KPY A;  3KLE B;  3GG0 A;  2JC1 A;  1EET A;  4G1P A;  1B4S A;  1Q16 B;  3VGU A;  2HAI A;  3DOL A;  3WX4 A;  1HNI B;  1CJV B;  1N36 J;  2W8L A;  5L1K A;  3EZU A;  3AHP A;  3M8Q A;  2R2S A;  1APS A;  5D6G A;  3I5B A;  3W3S A;  2YQ0 A;  1B0P A;  4C98 A;  1PJ7 A;  1S49 A;  4K4Y A;  5JUM A;  1WNE A;  2V8P A;  4DL4 A;  4JB8 B;  2VC0 A;  1K9M T;  2ZH2 A;  3M1V B;  1T11 A;  3IP0 A;  2MQQ A;  2RRA A;  2F65 A;  4X64 J;  1B0T A;  4LFC F;  4XTT A;  1IM4 A;  4UW2 A;  3RW7 A;  3NMA A;  1RT6 A;  1ZS6 A;  1FCA A;  5L8R C;  1X5P A;  3QAE A;  1GXL A;  4IH6 A;  4CP5 A;  2MZQ A;  2CXE A;  2KHD A;  4PCQ A;  2CIM A;  3HD1 A;  1RT1 B;  1ZET A;  5BXI A;  3Q8Y A;  4OQJ A;  2XQC A;  1BQM B;  3BR8 A;  2J76 E;  2A10 A;  3TUZ C;  3W2V B;  4OX9 J;  3J81 U;  1KTQ A;  1WHY A;  1NSP A;  1S1X A;  4OV1 A;  2UXB J;  4EBE A;  2EC2 A;  1UET A;  4LRE A;  3H2U B;  1NPR A;  2E7V A;  2MKI A;  4OJ3 A;  1U45 A;  1SJQ A;  3X3U A;  2JLE A;  3HO1 A;  3MEG A;  4H4K A;  1IVZ A;  1XR7 A;  2NXN A;  1XJW B;  4C9D A;  1AFJ A;  2DHX A;  3UVJ A;  3JB9 k;  2M7S A;  2OO4 A;  4OJH A;  3DMJ A;  3HKZ D;  4PXC A;  3NEK A;  2VHG A;  1S6Q A;  3PRB A;  4N8N A;  3QWU A;  3R97 A;  5E3Q A;  4JI4 J;  3J80 U;  2IA6 A;  4DPU A;  3ZNU A;  4R8U B;  3AQO A;  1VCT A;  4LSL A;  3G86 A;  3OFH A;  2FVQ A;  1YJW S;  2FC9 A;  4F0H A;  1VBY A;  1PAE X;  1LFW A;  1X4F A;  3D3C J;  3FQL A;  3CCE S;  3FFI B;  2ZUG A;  3T6J A;  2FPH X;  3AA9 A;  3UE2 A;  4WFA Q;  2HHW A;  1GAO A;  5A8K A;  1V9O A;  5IQQ A;  3BSC A;  4ES1 A;  1LOU A;  4IFY A;  1LNQ A;  3FQK A;  2HQD A;  1F9H A;  3TQ1 A;  2GC8 A;  1VLO A;  1O8B A;  1H72 C;  3OLA A;  2PSZ A;  2G9O A;  5KFH A;  3QT8 A;  1SB6 A;  4USU A;  2CDQ A;  3MR3 A;  1TKX B;  4JI5 F;  2YPY A;  2A6O A;  3CXC R;  1FJG J;  1H6K X;  1N6Q A;  2GO9 A;  2YXL A;  5JMN A;  2KM8 B;  3MF5 A;  1JLG A;  4X4U A;  2QJ3 A;  4M5J A;  3HI9 A;  1X60 A;  4CT9 A;  4TNO A;  2VL1 A;  1CC7 A;  2C3Y A;  4K4S A;  2W25 A;  5DS7 A;  1UVK A;  1JNZ B;  1Y11 A;  4AL5 A;  4OL8 A;  2IPO B;  1UJ6 A;  1VRU A;  4KHM A;  2W9C A;  3MAA B;  4M8L A;  2VG6 B;  4M63 A;  2XS2 A;  4A46 A;  4ZVR B;  4WXW A;  3LW5 C;  5LOQ A;  3ZZR A;  3M9O B;  1YJT A;  1QAY A;  3QLH A;  3BBB A;  3L9Z A;  1CS4 A;  2WZ1 A;  4O4G A;  3SZ2 A;  3U1L A;  5GAE I;  1VS3 A;  1NAQ A;  4CDI A;  8ATC B;  2JL9 A;  2V94 A;  4F8R A;  1IJE B;  3N5F A;  3NLC A;  3BN7 A;  3M8P A;  4B9S A;  4F3M A;  4HT7 A;  2CQ4 A;  4C0B A;  3AXM A;  1KBR A;  2ASJ A;  1ROF A;  2WON A;  1YI2 S;  2LYV A;  2W7O A;  2MHN A;  2HK2 A;  3WHI A;  1RHK B;  4QW9 A;  4LFC J;  4ICL B;  2XSJ B;  2K7J A;  4USM A;  4LF8 F;  1JLF B;  2DNL A;  4WU3 A;  3JSR A;  3OVB A;  4UST A;  3W62 A;  3EPI A;  4PWD A;  1X4A A;  2XO7 A;  3LP0 B;  3QRP A;  3UCU P;  2DH7 A;  1RWM B;  3MM7 A;  4I6W A;  1NSA A;  3DI6 B;  1DQ8 A;  2FHO B;  3MEE B;  1OMS A;  4PXD A;  3KTQ A;  2R2R A;  1RWO B;  2VA3 A;  1T0T V;  5EGY A;  3R5B A;  1ZM9 A;  4QR1 A;  3D7S B;  2V9W A;  1TAU A;  2OSQ A;  1IKX A;  2MQL A;  2FLO A;  1Q78 A;  1HWI A;  2O1P A;  4C8L A;  3OLB A;  2XB2 D;  1S4E A;  2ABY A;  2MQ8 A;  1FK9 A;  1YZ7 A;  4F2S A;  2J0S D;  3QWP A;  4C3K A;  1RI7 A;  4FYV B;  5K8N A;  1HNX F;  4BCA A;  3F41 A;  4ZPA A;  1OY6 A;  4KFB B;  3NKY A;  3VCD A;  4KKO A;  4ED0 A;  1GK8 A;  3L7P A;  3DOM B;  1LKZ A;  3EE3 A;  1JJ2 R;  4ECT A;  1RTJ A;  1C4A A;  2WVB A;  3W2W B;  3BEG B;  4NCA A;  4B3M J;  5KT3 A;  2W9B B;  1WSV A;  1EKR A;  1HMV B;  3QGG A;  3OD2 A;  4DR4 F;  2I9S A;  2FJX A;  1Z4U A;  1HR0 F;  2DNM A;  3EMT A;  3F73 A;  4QYZ K;  2CQ0 A;  2A3J A;  4J9Q A;  4ELV A;  3DRR B;  3WZ0 A;  2DNR A;  4DSF A;  1KHW A;  1FJC A;  3OL9 A;  4H4M A;  3VQS A;  1RWK B;  5JJB A;  3ZTS A;  4OZ2 A;  3BBC A;  1MWQ A;  4CLL A;  5KG7 A;  4U67 Q;  2N7C A;  4KR0 B;  3SV4 A;  1U1K A;  1TK5 A;  4MH8 A;  1K1Q A;  2GFF A;  3RUB L;  2VDH A;  4X65 F;  3W8P A;  1AYE A;  4Q0B A;  3E8O A;  4CYU B;  4LF4 F;  3N01 A;  3HLU A;  2W01 A;  4X4P A;  4NXN J;  3UN3 A;  4C11 B;  3GPA A;  3MGJ A;  3CC4 S;  2G1D A;  3QRR A;  3K0J A;  1NHU A;  3CJK A;  3TNV A;  2WB4 A;  1SJ4 P;  4DX7 A;  1IUJ A;  1VLY A;  2AQ4 A;  4U7C A;  2HEK A;  3ET6 A;  4O3P A;  2XZD B;  1LWC A;  2AJ0 A;  1S9G A;  3VTI A;  2UUA F;  1MSW D;  1RDR A;  3NBP A;  3H4B A;  1RU2 A;  1YJR A;  1RT4 A;  4OX8 A;  1D9A A;  2DIS A;  4N41 A;  5H9F J;  4C2M A;  2E1R A;  5LMN J;  2OPQ A;  3P3D A;  2KZM A;  4OHZ A;  3G8Q A;  2CQD A;  3QFW A;  4CTA A;  2ZE2 A;  2IMW P;  2JHE A;  3TEG A;  4FYD A;  2BRL A;  2JEJ A;  3ENV A;  1PYT A;  3PFO A;  2XCA A;  3KK2 B;  5K8P A;  2VA2 A;  3X1L B;  1X4G A;  3D3B J;  3JSB A;  2H5J B;  2VH7 A;  3UDC A;  4PG6 A;  2Y1J A;  3TQE A;  4KC5 A;  4QPT A;  1XER A;  2UVW A;  3OJU A;  1REV A;  2CVE A;  3MZI A;  1SQE A;  3T9Z A;  3DNC A;  3H0P A;  2C3U A;  1MN7 A;  3I0S A;  2XZW A;  4QIW D;  5DM7 Q;  2MY8 A;  3NS5 A;  3P5T L;  1Q8L A;  5H9F K;  4OYI A;  1HAR A;  4DL0 C;  1FNO A;  2R4F A;  4ED8 A;  2DVI A;  5C2G A;  1N5Y B;  2W7A A;  1LWX A;  1D09 B;  1HIY A;  1U1N A;  2R8G A;  3BH7 B;  3OUY A;  2GW8 A;  1M5K C;  4ECY A;  5BJR A;  3LOU A;  4HHJ A;  3VHQ A;  2FJB B;  1KN6 A;  3C14 A;  2PE8 A;  1V3R A;  2XS5 A;  3DLG A;  1ICE B;  2HWH A;  1TV6 B;  3H59 A;  3THT A;  2JX2 A;  3CMA S;  4ZPD A;  3BSA A;  3CCW A;  2UVU A;  1JNR B;  5B0F A;  3PY8 A;  2B51 A;  8AT1 B;  2XY5 A;  5J2P B;  3BR9 A;  1EAR A;  1HWU A;  2FVS A;  3NGS A;  1Z2L A;  5E41 A;  4ZVP B;  1CG2 A;  4I7F B;  4MK8 A;  2KYZ A;  1Q7L B;  4LQ3 A;  1VIS A;  4IH7 A;  2QYG A;  4YR0 A;  3L4B C;  1UPP A;  1DUR A;  4ILL A;  3OR2 A;  1K0T A;  2MPU A;  1WC0 A;  3R1L A;  3O3L A;  1PKU A;  2CJX B;  1FWL A;  4OX6 A;  4HH1 A;  2KFY A;  1LXJ A;  3LP1 A;  4ZIT A;  1U8S A;  2COL A;  1WC5 A;  1AUD A;  2LMI A;  3GFY A;  4F4K A;  5IV3 A;  3D6F B;  1JLA B;  4QWB A;  4TU8 A;  4EEY A;  1HR0 J;  1FHT A;  3CCS S;  3IGV A;  5L46 A;  2FYX A;  3D6M B;  2RE1 A;  1V5V A;  5LXY A;  2K1R B;  1ZPV A;  4P7V A;  4QIE A;  2GIQ A;  3KWM A;  3FJ2 A;  5FD1 A;  2JEG A;  2UZA A;  4TLR A;  1JB0 C;  2QMX A;  4RUA A;  1WF0 A;  4ECS A;  1RTH B;  2F9D A;  3J7Z 5;  3PV8 A;  1FRH A;  2OEM A;  4MAK A;  2DKO B;  2CG8 A;  3MWB A;  3ZZP A;  4DN9 A;  2MKH A;  1R0A A;  4LF4 J;  5H1S V;  4Y34 A;  4PKD B;  1ZZF A;  4KYZ A;  2MGZ B;  4CLU A;  3ISN C;  3G9C A;  3CC2 S;  3D1Q A;  2HIY A;  2QG9 B;  2Q6C A;  2WSF C;  3NP5 A;  3FMW A;  2CQB A;  5DG9 A;  3FEZ A;  1YRX A;  2MB0 B;  4PAB A;  4CLZ A;  2PDA A;  3CD0 A;  1QVG R;  7AT1 B;  2HKE A;  3GR0 A;  5AXM A;  1UEV A;  3OTO F;  5C25 A;  1IR2 A;  3OTC A;  2UUA J;  4HHU A;  4USJ C;  1FRK A;  1RHM B;  2GVD A;  2B8Q A;  4ZA1 A;  4P10 A;  4C8Z A;  5B09 A;  1C1B A;  4TY8 B;  2OPP A;  1FD2 A;  3IO1 A;  3UDV A;  3P8B B;  2QEX S;  4L74 A;  5ETP A;  2E1C A;  2QSW A;  2M0G B;  2M4M A;  3QO9 B;  2HZV A;  4RBV A;  2NRE A;  2MYF A;  4KQZ A;  2AYB A;  3M2R A;  5CQG A;  3CJS A;  3QJJ A;  1J2V A;  2HVH A;  1U6F A;  2CWK A;  1RKI A;  4OZN A;  4ZJL A;  3TEH B;  3VGT A;  5DG8 A;  1RTI B;  3I4H X;  3MUR P;  1A6L A;  2UU9 F;  3D6T B;  2B9X A;  4KGM A;  3SQG A;  4F50 A;  4OI2 A;  5CYM B;  3M32 A;  2L9W A;  2IBK A;  5T41 A;  1PO6 A;  1YJ9 S;  4A48 A;  4DS5 A;  3BJY A;  4C8K A;  5BR8 J;  2KYX A;  4PXB A;  1TFY A;  2CQ2 A;  4J37 A;  2M70 A;  3FC9 A;  1Q86 T;  3JYT B;  3CE8 A;  4PUO A;  3MCO A;  2DH9 A;  2GQC A;  1IM6 A;  4OYA A;  1SC6 A;  1WF1 A;  1KRP A;  3KUG A;  2XBP A;  4J9S A;  5A0Y A;  2FD2 A;  2GGP A;  2VQE F;  4OJ1 A;  1JKH A;  2ROE A;  1TKT A;  2DY9 A;  3PHT A;  2DPI A;  1UVL A;  1UFL A;  1SQF A;  1T9V A;  3A4T A;  3HZE A;  3KNA A;  3W60 A;  1BWE A;  2VON A;  1GMW D;  4CLK A;  2ZFH A;  2ZZM A;  3CD6 S;  2FZK B;  3DM2 B;  4CQ1 A;  1EX8 A;  4C8O A;  2LEP A;  4DUY F;  1U48 A;  2J0W A;  3DU6 A;  4WWS A;  2L08 A;  1UJ4 A;  1M0S A;  2XZT B;  3CCV S;  5MLC V;  1NK8 A;  3HJV A;  1WAC A;  5ITH A;  2G2O A;  4L6V 3;  1NK6 A;  2VPY B;  1ZM3 A;  2BV3 A;  5KTQ A;  3P45 B;  5G0R B;  3J7Z T;  2RU9 A;  4B9V A;  2DR5 A;  2KJV A;  5K9F A;  1EP4 B;  1FKO A;  3M2V A;  2QA4 S;  5GAG U;  2DD8 S;  2D1C A;  3KDN A;  1W2B R;  4KIA A;  4KH1 B;  3WQP A;  1RWU A;  3SSQ A;  2NXU A;  3MM9 B;  5EX3 A;  1J5E J;  2MKS A;  3A3P B;  1VMB A;  4DL6 A;  3US5 A;  5D0H A;  1CC8 A;  4JV1 A;  1NJI T;  1TTH B;  1C0U B;  3BGR A;  1M5V C;  2OAU A;  5I42 A;  2W9A A;  3ISZ A;  4MMO A;  2ZKT A;  2HND A;  4ZLN A;  3B6B A;  4IG3 A;  2QTW A;  2EEY A;  2V0N A;  3HX9 A;  3M8R A;  3NNH A;  5JVH Q;  2G2Y A;  2N4D A;  4X4V A;  4DCJ B;  4ED3 A;  3HVA A;  4BWJ A;  2ZVI A;  1FER A;  2HHP A;  3OTO J;  2B6A B;  4OJG A;  3I96 A;  3A8E A;  1KLM B;  4WZM A;  4JI3 J;  2DY1 A;  1XK8 A;  2RRB A;  2CPI A;  4I2P A;  2WAQ D;  4EI2 A;  4DSI A;  3KK1 B;  1VQ8 S;  4DR6 J;  2YNI B;  3D67 A;  5KFT A;  3HSD A;  1S9E A;  4ELT A;  2BJ9 A;  3CIM A;  2AWZ A;  5KT6 A;  1YRT A;  2LXU A;  3AFG A;  2WOM B;  2BMB A;  2VOP A;  3R7B B;  1S48 A;  2ACM A;  1S7H A;  4F4W A;  3G6V A;  3OXL A;  4IH5 A;  4WK3 A;  4U7U K;  8RUC A;  2MQO A;  3E2E A;  1NDK A;  2D9P A;  4NLX A;  2CWX A;  4LF5 J;  3FBE A;  4FN5 A;  1YJN S;  5AXK A;  1HBN A;  1NU4 A;  4O3N A;  1IKV A;  2HHU A;  3SYZ A;  5CCM A;  2R7R A;  2YQ3 A;  1XNR J;  3G6E S;  2IM1 A;  1Q7Y T;  4USK A;  4ED5 A;  2W2N P;  2KXH A;  1RT2 A;  3MM5 B;  5M2U A;  1RIS A;  3B82 A;  1X4H A;  2YKM A;  3Q8U A;  3TZY A;  4C8N A;  4G1I A;  1BY9 A;  1KLN A;  1P9Y A;  3QGP A;  2J6S A;  4OZJ A;  2A18 A;  1LWE B;  1S6P B;  5HLF A;  3ZZ0 A;  4M5H A;  4FF1 A;  2RSQ A;  3VGV A;  1O6X A;  4DSK A;  1FNM A;  2QV6 A;  1RWW B;  2EK6 A;  1H98 A;  4TQS A;  3OSN A;  2X51 A;  1X4C A;  1DJ0 A;  5I3P A;  4M5D A;  4M5K A;  2BJ1 A;  2QZ8 A;  4PPD A;  1HW9 A;  2KHC A;  4YHH J;  3DN9 A;  5I4M A;  4K4W A;  2UUW A;  3HM9 A;  2HNY A;  3RW6 A;  3O1L A;  2VQE J;  1HBU A;  2HK3 A;  2KN4 A;  1YJ7 A;  1NZ8 A;  3HT3 A;  1BXN A;  2HYI B;  3Q8V A;  3OQ2 A;  3SBM A;  1KEK A;  1RP5 A;  5GAH I;  4MKA A;  3BQ0 A;  4DV4 F;  2CQ1 A;  3CJ2 A;  3PO4 A;  1YBA A;  2M52 A;  3CVK A;  4WKR A;  3QGH A;  1FX4 A;  4MYT A;  4ZKA A;  1CLF A;  2BOP A;  2HVZ A;  2ZUA A;  1HFE L;  4ZVE A;  3A13 A;  2E29 A;  2KT3 A;  1FT8 A;  1TL3 A;  3VQT A;  3HHN B;  2LEC A;  5ETQ A;  1Q8K A;  2AJF E;  4ECX A;  3MCN A;  4LF6 F;  3IAM 9;  1C1C B;  1RLC L;  3OVA A;  2JVR A;  1TKZ A;  3PKY A;  2GQ2 A;  3GFZ A;  1H38 A;  2UUB F;  2IDE A;  1I94 J;  4I69 A;  5B0A A;  3G2X A;  3G96 A;  2ZIT A;  5GAD U;  2EXU A;  1RHJ B;  2M2B A;  1HA1 A;  2XMT A;  3TX8 A;  5HK4 A;  2ZH5 A;  5D3G B;  1ZBT A;  1NJW A;  1TP7 A;  4RU2 A;  3VAL A;  2WB1 D;  3R5D A;  3A8K A;  2H1Y A;  1FEH A;  2XM3 A;  1H2V Z;  2XMM A;  9RUB A;  1NSQ A;  2OPS B;  4DV1 F;  1OWX A;  1F9F A;  1QUV A;  3CCU S;  3MTJ A;  2R7U A;  1ZYQ A;  4KT0 C;  5GME A;  2K7K A;  1OQ3 A;  4R0E A;  1LW0 A;  2GA7 A;  1WEZ A;  1IJF B;  4YDX A;  2FDN A;  2E44 A;  4URS A;  4AXJ A;  2BE7 D;  3PX4 A;  3CJ4 A;  2DNZ A;  1S9F A;  3GLJ A;  1EET B;  1QSS A;  5CAB A;  3DOL B;  1K0V A;  4RPF A;  4A47 A;  2IBO A;  1X4D A;  2ZOF A;  4IUF A;  5T14 A;  2KI2 A;  3RAM A;  1GX5 A;  5HAT A;  3VAG A;  1FEE A;  1K1S A;  1LFP A;  3NGR A;  3M8Q B;  1ZAW A;  5F0U A;  4NMX A;  5KG1 A;  2Y1L B;  2ILY A;  3MEC A;  2J6T A;  5HMW A;  3LGM A;  3ZZY A;  1S76 D;  3GJQ B;  5KFF A;  4LFB F;  1U1L A;  4HTI A;  4OZ0 A;  4NYO A;  3WIV A;  4G65 A;  2C2K B;  2H4Y B;  4OX7 A;  3R7S B;  2XMV A;  2HLU A;  2K3I A;  4DMZ A;  1NK7 A;  3PEJ A;  3PAC A;  2HZA A;  2ZC3 A;  5KFM A;  3T1Y J;  3I31 A;  3TVY A;  3CJ0 A;  1J27 A;  3PKM A;  2JLF A;  2PMZ D;  1VC6 A;  4P2S A;  3GV5 B;  4LSN A;  2QYC A;  3V5R A;  1NB2 A;  2LQ9 A;  1NND A;  1SC4 B;  1X4B A;  1S77 D;  4ZVO B;  4ZVS B;  2MHE A;  4NLG A;  3K8V A;  4M5G A;  1S1X B;  3JSM A;  4GKJ F;  2JC0 A;  2JJ4 D;  4NA3 A;  3T6B A;  4I68 A;  4NA2 A;  4F7V A;  4K5S A;  2V8H A;  2AYG A;  3P4U B;  1I1G A;  2E9R X;  3QSY B;  1IBL F;  3MEG B;  3BKF A;  1TZ0 A;  3KLH A;  2RAQ A;  5DQI A;  3TAN A;  5KFL A;  3UVJ B;  5IT9 U;  2E1P A;  4E8U A;  3CDA A;  5AXL A;  3DMJ B;  1BC6 A;  3ILI A;  4DUZ F;  2HVD A;  2OD6 A;  2UP1 A;  1S6Q B;  5A2Q Y;  3HD2 A;  4J90 A;  3GU0 A;  3ILL A;  2NPI A;  4KSE B;  1NDP A;  3BS9 A;  2NXJ A;  3TVZ A;  5KFP A;  1JWW A;  4A4J A;  4MJK A;  4LSL B;  1J5O B;  4X62 F;  4KH0 B;  2ASY A;  4KGZ B;  1VQ9 S;  3IXQ A;  2BJ8 A;  5AT1 B;  2UVV A;  2DT9 A;  5A8K B;  4Q2M A;  5HAN A;  1TKD A;  4LF6 J;  3EDQ B;  3OJS A;  4RBT A;  4Y2A A;  2CNN B;  5CYJ A;  3H5S A;  1KON A;  4IFY B;  3GP9 A;  3KHR A;  4K2X A;  1NO8 A;  2GNK A;  5LMU F;  1S7I A;  3BKT A;  2QSF A;  2F63 A;  2HBQ B;  2PI5 A;  2Q3P A;  2DJW A;  1DHM A;  1UA0 A;  2O66 A;  2EFN A;  2GIF A;  2DIV A;  1S1W A;  1YVF A;  5KFV A;  2V8G A;  2H5I B;  4CH0 S;  4CLT A;  1PJ6 A;  1UKU A;  2IRX A;  1VQL S;  1FNX H;  4DV1 J;  2V9K A;  2E5I A;  2IYI A;  1N6Q B;  3IBW A;  1Y5I B;  2EFG A;  2XSF A;  1KQG B;  1VIX A;  1JLG B;  4V19 J;  2YY3 A;  4J91 A;  2UXC J;  3PCO B;  1NRK A;  4CWB A;  1EB0 A;  2R9L A;  2RF2 A;  2FVP A;  2Y8W A;  4PG4 A;  4TXS A;  1NJY A;  3GCW P;  1L3V A;  2X1G A;  2FGO A;  1ZPW X;  3Q8Q B;  1VRU B;  2OFH X;  2FC8 A;  2W9C B;  3R5A A;  1SH3 A;  5H9E J;  1WC4 A;  4K50 A;  4FDF A;  1ZAX A;  3RR8 A;  5F9L A;  2HUR A;  2ADC A;  1EJ7 L;  2BKO A;  1SC3 B;  3QLH B;  2WHO A;  1CS4 B;  4O4G B;  2I5J A;  1GTH A;  4RNO A;  1F60 B;  4OZ3 A;  5CH7 B;  4K5R A;  4LQ9 A;  3RB4 A;  5KFZ A;  4UQG A;  2BAN A;  1TL7 B;  3FEX B;  2WON B;  1VGY A;  2XI2 A;  4Y6I A;  2KXF A;  5AE3 A;  1VJQ A;  1HHQ A;  1JLB A;  2HPU A;  4DL3 A;  1PYS B;  3C46 A;  3AD8 C;  1NPP A;  1VQ7 S;  2BVZ A;  1NK5 A;  5H9E K;  1MLA A;  2M3D A;  1QSL A;  4PWD B;  1NZA A;  3IWL A;  3D9B A;  3MM7 B;  3AOC A;  2E9T A;  4ZS6 A;  5DO2 A;  4ANC A;  3T5H A;  4ECW A;  1R6Y A;  2J0Q D;  3W9J A;  2EFO A;  4R25 A;  1Y5N B;  3L7U A;  3PYD A;  1VQN S;  4YN3 B;  3TRG A;  3BO2 A;  5CZX A;  1ZZN A;  4LR9 A;  1IKX B;  5D15 A;  5KFY A;  4GKJ J;  2IM2 A;  4JOU A;  3TAM B;  2BBE A;  4WYL A;  4A8W A;  3ETM A;  5AJ3 F;  3DC2 A;  3I9V 9;  2D69 A;  3FSI A;  2QIF A;  2QX0 A;  2FUG 9;  3EGV A;  5E33 A;  4KJI A;  2AJ1 A;  1WDT A;  2NSC A;  3HHL A;  4FNI A;  2GHV C;  1IBL J;  5DLF A;  2V2V A;  4J9R A;  4M5I A;  3DFE A;  4FVC A;  1XMO F;  2KZZ A;  2VDI A;  2R7V A;  5FLX Y;  1K73 T;  4BHQ A;  1JLA A;  2J0X A;  2ZDO A;  4KKO B;  2ZHB A;  3LQV A;  1Q82 T;  4C3L A;  3EDR B;  4LBH A;  1AT1 B;  3PR4 A;  4QR0 A;  5IC6 B;  1RTJ B;  3LUY A;  4B3T F;  4J9O A;  4PAA A;  2R8I A;  2CJB A;  2EWH A;  3RBE A;  3EGZ A;  2KRB A;  4WK1 A;  4LF9 F;  2YWK A;  3EVO A;  3KUH A;  5HN0 A;  4X62 J;  1FI4 A;  1RA7 A;  2FJW A;  1B0V A;  2GAH C;  4RU9 A;  1RAD B;  4MKB A;  1S57 A;  3QMQ A;  3U1N A;  1H7W A;  3KLG A;  2PMW A;  2B5J B;  3LPE A;  1VOM A;  1SBR A;  2GIR A;  4JI1 F;  4DSE A;  3RRK A;  4H4M B;  5T7L A;  1EQ0 A;  1VRQ C;  2Z2L A;  2XLK A;  2VV5 A;  4PWU A;  2P9G A;  5LMU J;  3FCW A;  2VPZ B;  4XPE A;  3FRZ A;  3JTN A;  1ZAV A;  5A6P A;  4Q0B B;  3QYY A;  2O67 A;  3Q2S C;  4MT1 A;  4ILR A;  2WRM A;  2HS3 A;  5HRO A;  4L3K A;  2HFV A;  2AV5 A;  1SPB P;  3SSR A;  1JK9 B;  3FDS A;  1MG7 A;  4QR2 A;  1HNV B;  4ZJO A;  3MUM P;  4S0M A;  2HHQ A;  4K4X A;  2POK A;  3CJK B;  1T9X A;  4CO0 A;  3BYR A;  5HBM A;  2M88 A;  1AXQ A;  4MIA A;  4B9N A;  5FJ4 A;  3FNN A;  4C48 A;  3ET6 B;  3A8I A;  1LWC B;  4NLD A;  1GH8 A;  1S9G B;  4UOF A;  1O51 A;  3ENW A;  1UA1 A;  3SCJ E;  1RBL A;  3CCZ A;  1VDH A;  1WG4 A;  3NBP B;  4WBF A;  2ASD A;  2BW7 A;  5D4P A;  2OHD A;  1PYO B;  1RT4 B;  4OI6 A;  2HQI A;  1FRJ A;  4AL7 A;  3FBB A;  4J9V A;  1DBD A;  1HBM A;  3SXL A;  4JYA F;  2A2D A;  1S72 S;  1KFS A;  2AX0 A;  5KG5 A;  4NLO A;  1TAQ A;  4DZ6 A;  2QC3 A;  4CTA B;  2DPJ A;  4C97 A;  2ZE2 B;  2HFS A;  3MMB A;  1RSC A;  3Q2T C;  2A6M A;  3CD7 A;  4OI3 A;  3OTD A;  4M5N A;  5KFA A;  3EX7 B;  3CUN A;  2MKJ A;  3I4P A;  2YH0 A;  3Q0A A;  5D77 A;  3D1O A;  2MST A;  2BQ3 A;  3OVS A;  2QL7 B;  5AE2 A;  2FHM A;  1REV B;  1DTQ A;  3MPV A;  1RCX B;  2AJ4 A;  4C0O C;  2FZG B;  3OFF A;  2B3T B;  3H90 A;  2WCX A;  1YK9 A;  3R3T A;  3I0S B;  2YX1 A;  3MI7 X;  4RX6 A;  2L3M A;  1NCL A;  2EVZ A;  4FZV A;  1SL2 A;  3RU0 A;  4DUT A;  3TA0 A;  3EUN A;  5L38 A;  1U1R A;  5KFO A;  5L1J A;  1YJV A;  3PJW A;  2R8J A;  4NCG A;  4M95 A;  2J9E A;  4NPO A;  4C8Y A;  1HD1 A;  3CGI A;  1N32 J;  3OUY B;  4ATN A;  2VG7 B;  3QQC D;  1DQ9 A;  3C14 B;  1OQ6 A;  5DJB A;  4LRF A;  5KFQ A;  2LXI A;  3DLG B;  1H74 A;  1RU1 A;  2RQK A;  3HFK A;  1JMT A;  4J7C A;  1MRO A;  2FY8 A;  5E3C A;  5A8W A;  1TUW A;  1XMO J;  4RW9 B;  5IT9 Y;  3MPU B;  6FDR A;  3IBF B;  2UXD F;  2IJR A;  1FFS B;  3CED A;  2H54 B;  1JQG A;  2IHR 1;  3OR2 B;  5F8L A;  4B3T J;  4EO8 A;  1P8G A;  3VR1 A;  1L3T A;  3BRE A;  2ZHO A;  1Y00 A;  5IOL A;  4M5L A;  4LF9 J;  4RWW A;  3VAM A;  3AY0 A;  1TL4 A;  3LP1 B;  1RBO B;  3H42 A;  1UZH A;  2LU2 A;  4ILM A;  2JH3 A;  2R8K A;  5I3U A;  2E7W A;  1XEZ A;  5IFM A;  1NJX A;  3QJL A;  4OZ1 A;  4NML A;  2HWT A;  5F8N A;  3A8J A;  2ZZT A;  2H48 B;  3GJS B;  1JLQ A;  2M8H A;  2XI3 A;  4HL9 A;  2MQM A;  3BGL A;  2HRY A;  5KOX A;  2NR0 A;  3DXB A;  1N56 A;  1N52 B;  2YKN A;  4ZLL A;  3ZZT A;  1RCO B;  4QWC A;  2OEJ A;  1VI7 A;  4PXE A;  4YB6 A;  2KU7 A;  3E01 A;  2RHQ B;  4NE9 C;  3E51 A;  5LL6 d;  5HVG A;  4K4Z A;  3NS6 A;  1U49 A;  5DDQ C;  1R0A B;  1HI8 A;  2HNZ A;  4NAS A;  3HVR A;  2C28 A;  2HFU A;  2O3D A;  4RUB A;  2P2C B;  1YGY A;  3DLB A;  6AT1 B;  2IM0 A;  4ZP8 A;  1YQH A;  2LQJ A;  4DR7 J;  2PEH A;  4DCP B;  1KFD A;  3PR5 B;  2X3D A;  5C25 B;  2DH8 A;  2AP6 A;  4NA1 A;  1F3V A;  3I56 S;  2GJF A;  2B7B B;  2CKW A;  4MKY A;  1AFI A;  3GYN A;  2GVD B;  4A8Q A;  2AU0 A;  4I1T A;  4DFJ A;  3PW5 A;  2KM8 C;  3TUJ C;  1HHS A;  2PO4 A;  2A1B A;  2OPP B;  3BGF A;  4JYA J;  1HQU A;  3H2L A;  2Z2Z A;  4DLE A;  4MTP A;  1V3Z A;  4USI A;  4X4T A;  1B99 A;  1A7G E;  2HGN A;  1PJ5 A;  3DRS A;  2BA9 A;  3HHD A;  4CM2 A;  4DFP A;  4LJM A;  3IC1 A;  4RW6 A;  1RBA A;  3W5Y A;  3M2R B;  4KPC A;  1WD6 A;  1D0E A;  4OX9 F;  4ZPW R;  2H51 B;  4XPC A;  4ZVU B;  1S0V A;  2AJ2 A;  1GXT A;  5EWF A;  2UXB F;  3SSS A;  3TOQ A;  5D0E A;  1XWL A;  1HPZ A;  1OY9 A;  1RWN B;  4QJV A;  3O6Q A;  2V4Q A;  2CPH A;  4CLS A;  3POT B;  4WFX A;  2ZZN A;  4QIV A;  3SQG B;  3W5X A;  3JQJ A;  1D3W A;  3OFE A;  3M32 B;  3IG1 A;  3QT6 A;  3DDN A;  4KHR A;  4ED7 A;  1RYS A;  2P6S A;  4JV2 A;  1W7W A;  1DQA A;  2CUY A;  3CO9 A;  1NUE A;  2W2Q P;  4Q43 A;  4LBI A;  5DZ6 A;  3JXO A;  2RRN A;  3V6K A;  5D4L A;  5GAG I;  2VFS A;  4ERD A;  4JI2 F;  4PUO B;  1WEL A;  4JI4 F;  4ZCI A;  3AOD A;  3OT9 A;  1GMW A;  5KFD A;  5A0Y B;  1WKL A;  2B0G A;  5HAO A;  2GGP B;  1PG5 B;  3QBC A;  4B9T A;  5KFW A;  4O44 B;  1U4B A;  1JKH B;  1TKT B;  5EN1 A;  4FPR A;  4IR1 A;  4M5M A;  2BR0 A;  4Y3C A;  3CJ5 A;  2UXD J;  2DO4 A;  4KO0 A;  4LF7 F;  1EZZ B;  1VC0 A;  1KVI A;  5EUH A;  1BQN A;  2NLW A;  4G1Q B;  4BLG A;  3H40 A;  1RAF B;  4DL2 A;  4YDD B;  4UOC A;  5M2R A;  3CUL A;  1TK8 A;  3CTR A;  1B3T A;  3KG1 A;  3IWN C;  1T8E A;  1IWG A;  2VF3 A;  2UVR A;  3HT0 A;  3RB0 A;  1L3K A;  1WDD A;  3OTB A;  3EVW A;  3S6E A;  3EGN A;  2QL9 B;  2NXC A;  2DHS A;  2WVE A;  1FKO B;  3IGN A;  3M2V B;  3V81 A;  4RNH A;  5EDW A;  4URQ U;  3SI8 A;  4N56 A;  2DR7 A;  3BKU A;  4CLP A;  2B4V A;  3FGV A;  3QAT A;  2EC0 A;  3F44 A;  5E7O B;  1RTZ A;  4DF4 A;  3MED A;  3ZZO A;  2FHK A;  1RT3 A;  1UVI A;  2FHJ D;  3GFH A;  2YNG B;  2EG1 A;  4P74 A;  4JI6 J;  3KLV A;  2ZJQ Q;  1PC5 A;  3BGR B;  1QAJ A;  1FDA A;  3W9H A;  5I42 B;  5KFX A;  4K7Q A;  1XNQ J;  4JI8 F;  3MDF A;  4FXD A;  2HND B;  4DV2 J;  3QSI A;  1CPZ A;  4IG3 B;  4J9L A;  3RB6 A;  2F5G A;  3S7R A;  2ERR A;  2V4J A;  3FKB A;  2XLI A;  4OZ5 A;  3D28 A;  1ZTW A;  4HAC B;  1V5I B;  1G3O A;  1H2T Z;  4HDG A;  4USW A;  2O5D A;  2CG4 A;  1VQP S;  2HHX A;  3RJM B;  4Y00 A;  1YIT S;  1N54 B;  4I2P B;  4X4O A;  2PII A;  1KR4 A;  2E66 A;  4ELU A;  1SUQ A;  2DXE A;  1U0H A;  1S9E B;  4DJB A;  5AE1 A;  4HVZ A;  5ETL A;  2VG5 A;  3ZTO A;  2BJ7 A;  1D9D A;  3R6L B;  4BBY A;  2EI5 A;  3MD1 A;  5GMD A;  4P73 A;  4DEZ A;  3LGN A;  3S01 A;  4NRT A;  1IBM J;  1OPZ A;  4AE5 A;  3PX6 A;  2ZBI A;  5HI7 A;  1FX2 A;  2JDJ A;  1HBN B;  4NLW A;  4AXI A;  2IC3 A;  4K0K F;  4L3N A;  4MYU A;  4RKU C;  1IKV B;  3TJ8 A;  4Q2L A;  3UNG C;  4LRB A;  1NPK A;  1X31 C;  4MIW A;  2ZWP A;  4DU7 A;  1FF2 A;  2W2O P;  4P52 A;  1IBC B;  4DXL A;  1YRU A;  1RT2 B;  5F41 A;  2ASL A;  3H4D A;  2P8I A;  5DG7 A;  2GMH A;  1NBE B;  2YKM B;  2CRL A;  4I0W A;  4A8O A;  1CUL A;  4DPY A;  1SL1 A;  5HLF B;  3BDE A;  5HVF A;  2JOQ A;  3K58 A;  3TYT A;  4DLG A;  2LEA A;  1S1T A;  4WTO B;  2AD9 A;  2F9J A;  5LJ5 Y;  4JI2 J;  4IG0 B;  2LU1 A;  4M5D B;  4B3M F;  3UWT A;  2M5Y A;  2XGP A;  5GAD I;  1J5O A;  3QPI A;  2U1A A;  4JBC A;  1R8A A;  2HNY B;  1VQY A;  1Y5L B;  3O44 A;  2D74 B;  4CRJ A;  1KDN A;  4Y28 C;  1HBU B;  2V8D A;  2B4U A;  2CQ3 A;  4ZVH A;  1GQE A;  1SQG A;  2NXE A;  5KFG A;  3MOZ A;  2MMY A;  4KY3 A;  1T9U A;  4USH A;  1ZTT A;  3CDE A;  1LV5 A;  1CJU A;  4LF7 J;  5F8J A;  4FYY B;  3V4I A;  4AD6 A;  3PM9 A;  1F2G A;  1KKH A;  3ADA C;  2ZVS A;  2DIU A;  3LTO A;  2VQF J;  4C7Q A;  1Y10 A;  3GIR A;  3K5L A;  1NH8 A;  1X5O A;  1U2F A;  3G82 A;  1TL3 B;  3T19 A;  3M30 A;  2ZH6 A;  3V6J A;  3U7J A;  2CNL B;  2OJ3 A;  4HT5 A;  4WP9 A;  5A6W A;  4NXN F;  3VF0 B;  2VPX B;  2PFD A;  3I9Z A;  4ER8 A;  1TKZ B;  4NX9 A;  2JRS A;  3DLE A;  4JP8 A;  4I67 A;  3HDS A;  3BYP A;  1P9Q C;  2BZ2 A;  3PRD A;  2HRT A;  4CM0 A;  3MR5 A;  4FBT A;  3UFC X;  1NK9 A;  1U8W A;  4LRC A;  2U2F A;  2VFV A;  2F40 A;  1YKW A;  1PCA A;  2OD4 A;  1UWA A;  4W90 B;  2O01 C;  1F1B B;  3IS9 A;  2YKQ A;  4M1K A;  4ECU A;  3LA0 A;  1M1K T;  1VFJ A;  2QFI A;  4JI8 J;  4UUX A;  4ZP7 A;  5LMN F;  5JXS A;  2DR6 A;  3G6Y A;  4XIU A;  4FVM A;  3PZP A;  3VV2 B;  2JZ5 A;  4U95 A;  1S0M A;  1LW0 B;  3NNA A;  2ZH4 A;  4ZVT B;  3JS9 A;  2DEI A;  2EK1 A;  3FUY A;  2C22 A;  3KK3 A;  3UN5 A;  4ZCM A;  3DDK A;  2CZ9 A;  3PYE A;  3GJR B;  3MCS A;  2CAD A;  1TL7 A;  2C42 A;  3VZH A;  1UEU A;  1IBK F;  2HGL A;  3G71 S;  1SJR A;  5CD4 H;  3OXF A;  3OV7 A;  4OI0 A;  2OPR A;  2Y1R I;  2OLW A;  3HJF A;  3IN5 A;  5GMK a;  3NWG A;  4IOB A;  2ZBR A;  2CA9 A;  2Q79 A;  1T03 A;  2V69 A;  2CQG A;  3MEC B;  4HKQ A;  4C0H A;  5F0W A;  1TK0 A;  4B02 A;  2LXF A;  4FP9 A;  1NHV A;  3QAU A;  2QA1 A;  1WKK A;  2HW3 A;  2FJD B;  4Y2K A;  2JSX A;  4F26 A;  2ZHA A;  1X0P A;  3ETO A;  3PYG A;  1YWX A;  2VBZ A;  2DGU A;  2EKN A;  2E7X A;  3KJN B;  4C8M A;  4FXV A;  4K0K J;  3DHW C;  4ZHR A;  5RUB A;  4L72 B;  2J5A A;  1FXR A;  3TAM A;  3DGP A;  4HI1 A;  5KAK A;  1QVF R;  3IMQ J;  3R2C J;  3N5B A;  1GXU A;  1F5B A;  1U2C A;  4WCE Q;  1XTZ A;  3BN4 A;  2XMK A;  1IR1 A;  4O3R A;  3WC2 A;  4LSN B;  3H98 A;  4WJB A;  2OIH A;  1WF2 A;  3V6D A;  1R0C B;  3M2U A;  3MOJ B;  2KTQ A;  3LP2 A;  3A12 A;  2DHA A;  4GO7 X;  3M6X A;  1QUP A;  1M5H A;  3JTP A;  3JSM B;  2IM3 A;  1U25 A;  1YIJ S;  5J2M A;  3BDP A;  3HHL D;  4DV6 F;  4OYM A;  2RH3 A;  3RAX A;  3JAM Y;  3C16 A;  3LAN A;  2K3K A;  1VR6 A;  2RML A;  3UQS A;  1FFG B;  2DO0 A;  3KLH B;  2OUG A;  3NMR A;  4P6Q A;  4NI2 A;  3FEY B;  2KJW A;  4IDK A;  2FJV A;  3NGT A;  3LO3 A;  2B5J A;  3HHE A;  3CC7 S;  5K14 A;  3MM6 A;  3DLH A;  2PEB A;  4K4T A;  1XC9 A;  4C6A A;  4QZV B;  1S99 A;  4F0K A;  4I6A A;  2KG0 A;  3HSG A;  5HQ8 A;  2RKI A;  4IO9 Q;  2MKC A;  3FBC A;  3N6L A;  2PT0 A;  3I6P A;  3QFH A;  4KBI A;  3LAM A;  3FCH A;  5KFE A;  1RGV A;  2R7Q A;  4CNY A;  4FKY A;  2Q6B A;  4DPX A;  2CPD A;  1SH2 A;  2GS8 A;  1A0O B;  2WTF A;  4HTJ A;  5HJX A;  4L76 A;  3CO0 P;  1Q81 T;  3UO0 A;  2C2M B;  2BM0 A;  3IRX B;  4Z37 A;  2MXY A;  2V4R A;  1UVJ A;  2OFG X;  3M8Z A;  4Y2C A;  1HNV A;  3OHA A;  5IS2 A;  3OR1 A;  2QGF B;  1QTM A;  1Q95 G;  1CQM A;  4LIW A;  3RRH A;  3K5O A;  3CJ8 A;  1GMU A;  2Y1I A;  4NYP A;  2RNE A;  2CJQ A;  4OYB A;  5KFI A;  1LK5 A;  2Y9H A;  1N33 F;  1S1W B;  2A0F B;  4IRC A;  3N79 A;  2R7X A;  2I2Y A;  1YZ6 A;  1YDL A;  1S6O A;  4EGL A;  3GMG A;  2HBZ B;  5J1E A;  3W5Z A;  2X3G A;  4LSZ B;  2HHH J;  3TVK A;  6FD1 A;  2FJE B;  4Q5V A;  3PJ9 A;  1S1V A;  2ZOM A;  3NWR A;  2JEI A;  2GJI A;  2RF2 B;  1WEY A;  3EPG A;  4DV5 F;  3T3F A;  1B70 B;  4ZP9 A;  4H54 A;  3Q8R B;  4MIB A;  3CDU A;  1M90 T;  2HZC A;  1F9E B;  2FVC A;  1IBK J;  5DET A;  1I3O B;  3UDE A;  4JI7 J;  3MD3 A;  2G0C A;  3GQC A;  4OYX A;  1KP6 A;  3MMJ A;  4RLE A;  4Q7A A;  2PC6 A;  4F3O A;  2GZO A;  3DLL Q;  3NL0 A;  5G4D A;  4GC7 A;  2C2O B;  4KGV B;  2I5J B;  1VBZ A;  3ZTP A;  3MEK A;  1XN9 A;  4F4Z A;  4ZIW A;  1M1G A;  2HVI A;  3IWX A;  2W4P A;  3SV3 A;  5BR8 F;  2QRR A;  2BAN B;  4NXM F;  2OKQ A;  5B0D A;  2HSE B;  4FPI A;  3MMA A;  4WU2 A;  1JLB B;  3IM9 A;  4B08 A;  1UP1 A;  2VG7 A;  1KWM A;  1UPM B;  3KMS A;  3TW0 A;  1GNK A;  1SH0 A;  4RJV A;  3T5K A;  1WTB A;  1CEZ A;  2OTJ S;  2R3V A;  1NH7 A;  1FES A;  4DR5 F;  1X0F A;  2J8A A;  4A8K A;  1JJC B;  4PQU A;  3DYA A;  4CCH A;  2IRY A;  2CPJ A;  1U09 A;  3UPF A;  4RW9 A;  3HFV A;  3PW4 A;  2BDP A;  3KG4 A;  3MMC A;  3DRP B;  4PRF A;  2Z58 B;  1ARO P;  2PD1 A;  2BJE A;  1H7X A;  3CCQ S;  3EXY A;  1RT5 A;  4B3R J;  1WG1 A;  2OMO A;  5KFS A;  2IIH A;  3BZQ A;  4HI2 A;  2EKY A;  4DV6 J;  2RU3 A;  3MR6 A;  3EZ5 A;  2YNF A;  2ZH9 A;  3FRY A;  2ZC4 A;  4YB7 A;  3HHL B;  2ILZ A;  1HW8 A;  3W61 A;  2JNJ A;  3B54 A;  3TA1 A;  5DM6 Q;  4QOT A;  2W7P A;  1C2P A;  4ZMM A;  3UCZ P;  4WIQ A;  4DU8 A;  5IC4 B;  4CO5 A;  2BYC A;  3GYG A;  4N7T A;  2XC9 A;  1R8C A;  4Z7Y A;  2CYY A;  3NGD A;  4UZC A;  1DLO A;  3QGI A;  3ZC4 A;  2K2P A;  2DK2 A;  4ETX A;  1NKE A;  4DQR A;  2FB0 A;  4TQR A;  4AND A;  3AD9 C;  3GYX B;  3Q86 A;  4X66 F;  2V50 A;  1J5E F;  1Z2Z A;  4EFA C;  1TL5 A;  1RK8 A;  4WP8 A;  4USV A;  2LQB A;  5DDP C;  3D5M A;  1H0H B;  3GSD A;  2V2Q A;  2DNG A;  3MFI A;  3CSK A;  3KLG B;  1ACM B;  4IKA A;  5C5J A;  3DGV A;  3JTO A;  3TR5 A;  4WE1 A;  4ZLJ A;  3R5J B;  4F4A A;  1CBK A;  5T7L B;  2DGS A;  3MUT P;  1T9W A;  1D8Z A;  3TX0 A;  2I6W A;  2ALZ A;  3K57 A;  2EFV A;  4UOH A;  3AA8 A;  2QN6 B;  2BE2 B;  3W64 A;  3KLI A;  1E6V A;  3TAQ A;  5KT5 A;  5FDL A;  3PRV A;  3OL7 A;  2HRU A;  2CPX A;  4JI3 F;  3ZTR A;  2R7T A;  5HQM A;  4DV0 F;  4I2Q A;  1SCJ B;  2Y0S D;  2CNK B;  1CJT A;  2VPW B;  3FVY A;  3TZW A;  1N33 J;  2MDA A;  5HRO B;  2XY6 A;  2ZJR Q;  1I6J A;  4DR6 F;  1RZM A;  4ED1 A;  1QAI A;  4KE5 A;  3D54 A;  2GVZ A;  2AJQ A;  1QE1 A;  1PIE A;  3C6T A;  5HBM B;  1KNZ A;  1QJH A;  4Z7C A;  1MU2 A;  2WSE C;  4LF5 F;  2ZEJ A;  4DV5 J;  2IRU A;  3GON A;  3N6N A;  2WSC C;  3W66 A;  4DQP A;  3GG1 A;  3UN2 A;  3AH6 A;  3CCT A;  2ALY B;  1BWV A;  2ROG A;  1XNR F;  3NCR A;  1LW2 A;  2SXL A;  3AJD A;  1URN A;  1HBM B;  2ATC B;  3PNI A;  3SDE A;  5J2Q A;  2ZOG A;  1AA1 B;  4G3I A;  3POT A;  3LWM A;  4MKV A;  3JQM A;  4NWB A;  2HWI A;  1RWX B;  2B4P A;  5D78 A;  1U26 A;  1CJK B;  3MMB B;  2AYE A;  2XHC A;  4HYK A;  5ETS A;  3UD4 P;  1T02 A;  4FS2 A;  4CH1 A;  3PG9 A;  3TO8 A;  3CJQ A;  3S1T A;  4ZP6 A;  4NXM J;  4Y2M A;  1FDD A;  2V63 A;  1SKR A;  3J7A N;  3GB0 A;  2XMW A;  4WPA A;  4N8O A;  2EBG A;  1N34 J;  3NNC A;  1DTQ B;  2ZBQ A;  1UFW A;  2W24 A;  4YFU A;  5HSP A;  3L95 X;  2HBY B;  2WK4 A;  1FRX A;  2MZR A;  4YHH F;  1EIY B;  1ZA1 B;  4O44 A;  2BXJ A;  4JI0 F;  1RLD A;  1R8B A;  1XMB A;  4DR5 J;  2RQC A;  1S97 A;  3VAJ A;  2RT3 A;  4NCG B;  2VKR A;  2YTC A;  3A3O B;  1G7C B;  2CQH A;  2LLZ A;  1LQ9 A;  5A2Q U;  1BQX A;  1R89 A;  1RJJ A;  2CQC A;  1NXI A;  1UW9 A;  4G1Q A;  3VVU A;  3LAL A;  2WVC A;  3THV A;  1R8H A;  2MQN A;  2RDI A;  3I0R A;  1MRO B;  2DHG A;  2Z2M A;  2QLF B;  5A8W B;  2Z0G A;  2VJU A;  4WII A;  3GII A;  1KVK A;  2D9O A;  4BS2 A;  3H5X A;  4F25 A;  4XK8 C;  2WVF A;  4WFZ A;  1OIA A;  3UDL A;  2AEJ A;  1SKW A;  3OHB A;  4ID5 A;  3SIP B;  4TN2 A;  1TMJ A;  2R2U A;  2DYA A;  1SV5 A;  4ED2 A;  1R6V A;  4H4K C;  1I94 F;  4LR7 A;  3KMQ A;  2QMW A;  2ZNZ A;  1XMQ F;  2OP5 A;  4QWD A;  3FSX A;  5B0C A;  1IQZ A;  4X66 J;  5CYQ A;  3D6H B;  4NLR A;  2XMA A;  1LXN A;  2VFT A;  4NL5 A;  1C4C A;  2CDR B;  5I3U B;  3J7A 1;  2YNG A;  2J9D A;  3QT5 A;  2CJY B;  2KKH A;  1ITP A;  1RTD A;  3AOA A;  1WOR A;  5B0G A;  5FII A;  3CJT A;  1JLQ B;  1RUS A;  3TA2 A;  3EM1 A;  4OLO A;  1I5O B;  1T94 A;  1GEH A;  1LWF B;  2DXD A;  4DR3 J;  3SQO P;  1X7V A;  2YKN B;  4YQW A;  2UUT A;  4KTQ A;  4HAC A;  4DPO A;  1LEO A;  3E01 B;  1TL1 A;  3HP6 A;  2XNQ A;  3MM8 A;  2IJN A;  2YWF A;  1WWH A;  3PTW A;  4DV0 J;  3K89 A;  1VK3 A;  3FCV A;  2HNZ B;  1R31 A;  4K2J A;  4X4N A;  4NEY A;  2J7U A;  2YWW A;  3I5A A;  4WYW A;  5L1I A;  1WKJ A;  4ED4 A;  3R9L A;  2CJA A;  4DX5 A;  2MZ1 A;  2XEX A;  3K5M A;  1YX2 A;  2OH2 A;  1HQ2 A;  1KC8 T;  3EWG A;  3PFE A;  5LSO A;  2HMI A;  5A8R A;  2NZ4 A;  2RJZ A;  2F3J A;  1WEX A;  3M7V A;  2MEW A;  4LT6 A;  3CB4 A;  5ETN A;  3C19 A;  3T1Y F;  1UTA A;  3G8T A;  4UZB A;  2RB7 A;  1HQU B;  3GR1 A;  2G4B A;  2AEM A;  3ZO7 A;  3IAS 9;  3Q83 A;  2P5V A;  3MPD A;  5B0B A;  1QM9 A;  3DRS B;  5LT5 A;  2IVM A;  4FF2 A;  1OS5 A;  3KOA A;  4RW6 B;  2EW9 A;  2XTJ P;  2H9Z A;  4CO1 A;  2ZH8 A;  3RR7 A;  2AZ1 A;  5D0G A;  3MAH A;  4B3S J;  1HPZ B;  2CPY A;  2AGQ A;  3H5U A;  1CVJ A;  4IG0 A;  4E2F B;  3PIO Q;  1NHK L;  5KFJ A;  2C1E B;  2ZM6 F;  1DTT A;  3IG1 B;  2RDD A;  3PVX A;  1OO0 B;  2NYI A;  4JI0 J;  4DI6 A;  3LPY A;  3EIC A;  2X1F A;  2KVQ E;  2F4V J;  4NLP A;  4IR9 A;  3N28 A;  5FLX U;  1GT8 A;  1QLN A;  2CJ9 A;  4OLP A;  3IR6 B;  5DDR C;  3AJ2 A;  2L9N A;  2IAJ B;  2W1B A;  4F02 A;  1DY3 A;  4Q8F A;  4RO0 A;  3U02 A;  3M4X A;  2J7W A;  4WZQ A;  4I4B A;  4RR5 A;  3RB3 A;  1IWA A;  1X5S A;  4PZV A;  2RQ4 A;  4ZLP A;  2FIU A;  2F8E X;  4IFV A;  1IQT A;  1JIH A;  1PC4 A;  4QIF A;  5KFR A;  3N4W A;  4RUH A;  3IRW P;  4ZPV R;  4KO0 B;  2NS1 B;  1TEL A;  1F0X A;  2QL5 B;  2YKP A;  3PYF A;  1UW4 A;  1BQN B;  1HQE B;  5DQH A;  3NS7 B;  5J2N A;  4IQM A;  1GX6 A;  2VB6 A;  2LDI A;  3WDO A;  1XMQ J;  2YNH A;  4F3Q A;  3HVT A;  1FKA F;  3CF5 Q;  1PSD A;  3K17 A;  4ZK7 M;  4Q8E A;  2XWX A;  4ZVQ B;  4IYQ A;  1Q8B A;  4GRS A;  2DEJ A;  2FHJ A;  4ZVG A;  3C15 B;  3V81 B;  3ZZU A;  1S1U A;  5JVG Q;  4J9P A;  5HO4 A;  1VBK A;  3QIP B;  5F8I A;  1NK4 A;  3Q8S B;  4ITS A;  4C4W A;  4QYZ J;  2UXC F;  4DN0 A;  1FJ7 A;  2C2Z B;  3WX8 A;  3OXG A;  5SZT A;  4RZR A;  5E3R A;  3MED B;  1X9W A;  1YG0 A;  3HUL A;  1RT3 B;  5I3Q A;  1SXL A;  4N76 A;  1SIW B;  3TJA A;  2N3O A;  2DCU B;  1FXL A;  1Y3J A;  4HH0 A;  2QMU B;  4U8V A;  4D3H A;  3P96 A;  4UTG A;  4LVN P;  3VVT A;  2V4J B;  3MAQ A;  2HBR B;  7FD1 A;  5D8H B;  5KG4 A;  4BWM A;  3BPD A;  2WW4 A;  5DLG A;  4RW4 A;  2DGW A;  4ECQ A;  4OYO A;  1JJH A;  3AT1 B;  1TFW A;  1QTN B;  2BM1 A;  2BEF A;  1MWZ A;  3OTE A;  1T9Y A;  1VK8 A;  4JUZ A;  4CZC A;  2HGM A;  3MHY A;  1SUQ B;  1U0H B;  3AD7 C;  3CWJ A;  1WSR A;  4ZCL A;  2AGO A;  2VG5 B;  2QA2 A;  2V6A A;  2C3M A;  5K8M A;  2VUG A;  2VZ9 A;  3VWS A;  4EZ9 A;  2DGT A;  1Q53 A;  5KFB A;  2AHO B;  4OHY A;  1FRL A;  1BUX A;  1WC1 A;  2IC3 B;  5LSL A;  4JI5 J;  1UJ5 A;  4TYA A;  2ZH7 A;  4IOA Q;  2YH1 A;  1RHR B;  3IR7 B;  4PR6 A;  1UFK A;  2LCW A;  3VAI A;  5HL7 Q;  2E5L F;  4FBU A;  2G2Z A;  4K4U A;  4DG1 A;  1QSY A;  1FKP A;  1UWB A;  5C7P A;  1ULR A;  3HSZ A;  4EMD A;  4TYB A;  2ZM6 J;  3C8Y A;  1C0T A;  1CUL B;  1U1P A;  3K59 A;  1P6T A;  4ID8 A;  2NPF A;  2AGP A;  4QCL A;  2DB1 A;  1BMQ B;  3K5P A;  3VAK A;  1FDN A;  2UV8 A;  2I8E A;  2HLT A;  1GMV A;  1S1T B;  1RAG B;  1NK0 A;  3MUV P;  1VRT A;  1A9N B;  2V5H G;  1RWP B;  5K5M A;  2B56 A;  3HMJ G;  4HHH A;  1P27 B;  3UCG A;  1FO1 A;  3MR7 A;  5KFU A;  1N8R T;  1V3S A;  1AZS B;  2XLJ A;  1RYR A;  1FWK A;  1P1T A;  4RNF A;  3R6G B;  2YX7 A;  1N88 A;  2QLW A;  1HHT P;  4B3O B;  3OPK A;  3IRX A;  1CJU B;  5C24 B;  3RG6 A;  3AXK A;  1YBT A;  3KKF A;  3V4I B;  1KQS R;  4X4S A;  4LF8 J;  1Q8I A;  4X84 A;  1VQK S;  2VIH A;  1HYS B;  5HVH A;  1PAU B;  3IFE A;  3NGK A;  4DDF A;  3M05 A;  2EFQ A;  4TY9 A;  1G4C A;  2DRB A;  1REG X;  3RBX A;  3ENQ A;  4GO5 X;  3G82 B;  2PA3 A;  2W2M P;  5L39 A;  2OML A;  3J81 Y;  3M30 B;  1R8P A;  1RAI B;  4FYX B;  5GVQ A;  3HKW A;  5IM0 A;  1RT7 A;  3VGS A;  2GAG C;  4R5P A;  2DRD A;  1U7L A;  4CNZ A;  3G6X A;  2MY7 A;  2W2P P;  4V1A k;  2IFX A;  2DCL A;  2Z30 B;  2HAF A;  3DLE B;  3W65 A;  4DQI A;  3M6W A;  1S79 A;  3FZB A;  2VBW A;  3PEH A;  1VQ6 S;  4I64 A;  5DGA A;  3J7Y U;  1FDB A;  1RHU B;  2XG8 A;  3NCQ A;  5HMZ A;  2EBE A;  1U6B A;  1TR0 A;  1JLC A;  2DGQ A;  1HNX J;  1VJW A;  2OGU A;  1WOS A;  4N77 A;  1QD1 A;  4CI0 B;  3H2V E;  5ETO A;  1U24 A;  2MJU A;  1R3N A;  2HIQ A;  2I1R A;  3D4J A;  2XUL A;  2M9K A;  4IO1 A;  4H4O A;  3IS9 B;  3J80 Y;  2JWN A;  2B4O A;  5IWA F;  4K4V A;  2GHP A;  3KG0 A;  4ZPC A;  3B4M A;  2DHH A;  3KHL A;  4A8S A;  4KV8 A;  4X4R A;  1BD6 A;  1XIQ A;  2VBX A;  4AFF A;  4X4Q A;  4RW7 A;  1ELO A;  1PGZ A;  2V68 A;  1F5C A;  3GJT B;  4DR4 J;  2GV1 A;  2GJ2 A;  3KK3 B;  2IY5 B;  4J5O A;  1IKW A;  1NLK L;  4DPW A;  1E6Y A;  4OMF G;  2R7O A;  2JVO A;  5BYR A;  1WI6 A;  4DCO B;  3SFG A;  1NJZ A;  1TUG B;  3GIM A;  1DFD A;  1OYE A;  3CME S;  3BPS P;  4DQS A;  1URR A;  3TUP A;  2OPR B;  3CDW A;  3RBZ A;  3T5J A;  4KGK A;  1UCN A;  4NZ7 A;  1T03 B;  2PFF B;  3PJX A;  4ECR A;  4GVB A;  3P5B P;  3I82 A;  2OEK A;  1IKY A;  5KFN A;  4X65 J;  4OYP A;  2P6T A;  3Q89 A;  3EZO A;  3ITH A;  3C6U B;  1Y3K A;  3T1A A;  3DRP A;  2AIR B;  1N32 F;  3DOK B;  4OI4 A;  2RD5 C;  4IQX A;  4YB5 A;  3RAQ A;  4ZHR B;  1MMD A;  3I5C A;  4TU9 A;  4J9U E;  2HS4 A;  2NUU G;  3TZZ A;  1HBO A;  3DGP B;  3H8Y A;  1T05 A;  2E5L J;  5KFK A;  1FE0 A;  1X4E A;  1RAO A;  3U27 A;  1MW7 A;  2BRK A;  2EG2 A;  3KJV A;  4DFM A;  3V6D B;  2HVE A;  3PO5 A;  3M2U B;  3B78 A;  3LP2 B;  1OPI A;  1U1O A;  4GVL A;  4U6P A;  4OI1 A;  1DAR A;  2WVD A;  2ZKU A;  1FVS A;  1H3D A;  3SCK E;  3BQ2 A;  1U6Z A;  5J2M B;  2G0I A;  3HZG A;  3D1H A;  2OSR A;  1VIO A;  1FD8 A;  5KT2 A;  1NDL A;  2EFP A;  3KLF A;  3ELH A;  3C16 B;  3BB5 A;  2MZT A;  1ZH5 A;  3L3C A;  4RBU A;  1L3S A;  1R43 A;  4NI2 B;  1JX4 A;  4UOG A;  3G8S A;  3KNG A;  4F4Y A;  4IDK B;  2ZD1 A;  4I6Y A;  2CAJ A;  3ZXW A;  2L9D A;  1Z1Z A;  5K14 B;  2OEL A;  2BQU A;  3MM6 B;  5IT0 A;  2YQ1 A;  4ANE A;  1JXL A;  4OYW A;  3IR5 B;  2RKI B;  4LVO P;  1K8A T;  1TVR B;  1WUU A;  3UR0 A;  2DBB A;  1H73 A;  5L1L A;  3NG8 A;  2BE2 A;  1FFW B;  4FXW A;  1XBW A;  2CPF A;  1T95 A;  4OIX A;  4NLQ A;  2XYP B;  5B08 A;  3FK4 A;  3DLK A;  2MZJ A;  1D8Y A;  3M8W A;  5E3P A;  1Y7P A;  4DQQ A;  3OR1 B;  1Q0N A;  2FLL A;  2Z2Y B;  5C42 A;  4DR7 F;  2KDO A;  2DNQ A;  3DKD A;  4JV0 A;  3GIK A;  2JLG A;  5F3T A;  3M9M B;  1YHQ S;  3ISN D;  4YB1 P;  3R5C A;  1FA0 A;  2R7S A;  2WW8 A;  3BGO P;  1UL3 A;  4PG7 A;  2YKO A;  4OFZ A;  2IVY A;  2LDY A;  3H5Y A;  5IT4 A;  2MTL A;  1M5O C;  1S0N A;  4YP3 A;  2G1H A;  3OFG A;  5J1E B;  5IWA J;  1VHF A;  2VFU A;  1SI9 A;  1L3U A;  1VC5 A;  1S1V B;  4CT8 A;  4K8R A;  2HHT A;  1CJK A;  2CVI A;  1RA6 A;  1VQ5 S;  2G0J A;  3LWL A;  1KVJ A;  4HEA 9;  3VZI A;  4QYR A;  3DRX A;  4MFB A;  1H2U X;  3Q8P B;  2CPE A;  3LH2 S;  1ZOT A;  1UVM A;  2HFZ A;  2X1B A;  4U7U D;  5DZ7 A;  3MPW A;  2C3P A;  5HQL A;  2DNO A;  3CCL S;  2DGV A;  4J9N A;  1KHV A;  1JLE A;  1SL0 A;  3KLE A;  3DDI A;  4PG5 A;  3FZ2 A;  5C2C A;  1CQN A;  4GMK A;  4RUC A;  3BO3 A;  1HNI A;  1CJV A;  3MMA B;  2DR9 A;  5F8H A;  3W63 A;  4LR8 A;  1UMJ A;  3CPW R;  2AF6 A;  2B7C B;  2Q1L A;  2QA4 G;  1P1L A;  3M6U A;  2XCP A;  5DRK A;  1NKC A;  3CJ3 A;  4FYW B;  4F4X A;  4EYI B;  2CZ4 A;  3KJF B;  4PQU B;  3DYA B;  2E5G A;  4DR2 F;  2HS0 A;  1HD0 A;  1B7F A;  2HQF A;  3V4M A;  3MMC B;  3M1V A;  1QDU B;  3EJM A;  3I87 A;  4EU0 A;  4Q45 A;  2FGC A;  4GC6 A;  2E5H A;  1X9M A;  3M9N B;  3A3N B;  3LGH A;  3AB2 B;  4BC7 A;  2V2K A;  2YX4 A;  4CIO A;  4Z2X A;  2PA8 D;  2IMO A;  1RT5 B;  1R7I A;  1O0P A;  3T1H F;  2K06 A;  5ETR A;  3DCA A;  2R8H A;  3T5L A;  1QY7 A;  2YNF B;  3GIJ A;  3Q24 A;  4UQT A;  1RT1 A;  1F2H A;  1ZM4 A;  2ZNY A;  2NZC A;  2FVR A;  4Y65 A;  1BQM A;  2MLX A;  1O5J A;  4B9L A;  3J81 j;  3H25 A;  3W2V A;  1SJ1 A;  2R42 A;  4PWW A;  2GQQ A;  1YJU A;  4QIG A;  2XS7 A;  1DLO B;  1LWF A;  3FBF A;  2UU9 J;  2MQP A;  4CLY A;  4ZN3 A;  3RZA A;  3R27 A;  2DGO A;  1RAH B;  1MN9 A;  4ZOS A;  1RKJ A;  2E1M C;  1WG5 A;  4ETZ A;  4JI6 F;  3DHX A;  4EBC A;  2MKY A;  3BM7 A;  1XNQ F;  4WE1 B;  5LSR A;  4XDD A;  5E5N A;  1RWV B;  4DV2 F;  1RB0 A;  2D7S A;  3NXZ A;  2R2T A;  4R8U A;  2C2D A;  3C3L A;  4EBD A;  3THP A;  2Z4P A;  2HQG A;  2FLN A;  1RXO B;  1HI1 A;  3ZTQ A;  4CH7 A;  3KLI B;  1E6V B;  3FFI A;  5FDL B;  4DR1 F;  1HWK A;  2RS2 A;  4I2Q B;  5HP1 B;  1YTY A;  3OL8 A;  3R1H A;  1CJT B;  4LBP A;  4YR2 A;  2DIT A;  4DUY J;  2YVS A;  5J1P A;  3R5G A;  3PW0 A;  2L41 A;  1FJE B;  2GVZ B;  3SEO A;  4EUV A;  1QE1 B;  2N7Y A;  2C2N A;  4ES2 A;  3C6T B;  3N0V A;  1N5S A;  1I51 B;  4P2M A;  3K7R A;  2LA6 A;  1VQS A;  2KRR A;  1N0U A;  1MU2 B;  2NQP A;  4RW8 B;  1IBM F;  4P2X A;  4AL6 A;  3NOG A;  1MNE A;  1TKX A;  4LFA F;  1BGX T;  3I55 S;  2LVW A;  5KG0 A;  2J7K A;  1TUV A;  3F0N A;  2VBY A;  4XO0 A;  1LW2 B;  4WFB Q;  1U2R A;  3SDE B;  5J2Q B;  5F9N A;  4M94 A;  1XR5 A;  4AYB D;  3TI0 A;  5ETM A;  2N4C A;  3MCM A;  2ACY A;  1N48 A;  2UV8 G;  2LFV A;  4F36 A;  5A76 A;  1WOO A;  3TAR A;  3NOC A;  9ATC B;  5ETK A;  4DFK A;  2VKZ G;  4BC9 A;  3MAA A;  3CCR S;  4Y2I A;  1NB7 A;  1FWP A;  2VG6 A;  2VFR A;  2BJ3 A;  2IAJ A;  4WXO A;  2RDJ A;  4XDC A;  1PIL A;  1G2E A;  3MPY A;  4HLB A;  3S8S A;  5CHC B;  4YS2 A;  4B17 A;  1Q5Y A;  1Q5V A;  4AT1 B;  2PGC A;  3GFX A;  3JAM U;  1Y0H A;  4UY8 5;  5KOW A;  2V8V A;  2LKZ A;  2J9D E;  2X7I A;  1MML A;  1S59 A;  2QO3 A;  5IV4 A;  4KRW A;  4DR2 J;  3P6Y C;  4DWI A;  2Q66 A;  4DL7 A;  4EWT A;  3UW1 A;  3RYL A;  2KB2 A;  4ICL A;  5J1N A;  3ZZZ A;  2XSJ A;  1AB8 A;  1JLF A;  3W7B A;  4DL5 A;  4GKK F;  3NCP A;  1HQE A;  3L7O A;  2VQF F;  3T1H J;  2CQP A;  2IYG A;  3HXM A;  3R2D J;  1RQ0 A;  3LP0 A;  4LF2 A;  3TJ9 A;  1D9F A;  3DI6 A;  2QLB B;  3HHK A;  3I0R B;  3MEE A;  3UR3 C;  5DGB A;  2DNN A;  2XWY A;  3NAH A;  2HQ3 A;  3GV7 B;  1N5Q A;  3AB4 B;  1UAW A;  2E1A A;  4DX8 H;  2VU5 A;  4R0J A;  1RAJ A;  2HHV A;  4B9U A;  4TKT A;  1RT6 B;  1SJ3 P;  3C15 A;  1S6U A;  4ID5 B;  4OZL A;  3NRB A;  2DGX A;  1SV5 B;  3CNQ P;  2ZJP Q;  3QIP A;  2D3O 1;  4ZJQ A;  4QU7 A;  5GAE U;  3CDB A;  5CYQ B;  4RNN A;  4YOE A;  3D0I E;  3OW2 R;  4NOH A;  4C3M A;  4G6V B;  2M8D B;  1X5T A;  5LXR A;  5DDO C;  5B7W A;  1K47 A;  4DF8 A;  4JV5 F;  4KFB A;  3O5T B;  1EQM A;  5AXN A;  1RTD B;  3DOM A;  5D4N A;  4OV6 A;  3HSJ A;  1KOH A;  4ZPT R;  4KAI A;  1EHW A;  2HHS A;  4KHP F;  3W2W A;  2MJN A;  2W9B A;  4DPT A;  3G87 A;  4ED6 A;  3VAH A;  3SCI E;  4ECV A;  1HMV A;  5IZH A;  1U02 A;  1TL1 B;  2J9C A;  1OY8 A;  3MM8 B;  3OBI A;  3UNY A;  5LJ3 Y;  4DR1 J;  4NLU A;  1FRI A;  4F2R A;  3FMB A;  4NYZ A;  1U1M A;  3DRR A;  3JSY A;  1HNZ F;  2AMC B;  4DOZ A;  2PI4 A;  4DSJ A;  4DV4 J;  3CCM S;  2B9Y A;  3K2Y A;  1IR0 A;  4OYZ A;  4F0M A;  2YBV A;  3K5N A;  2W4D A;  2ZWO A;  3MR2 A;  2C2R A;  2ADB A;  1F3F A;  4CO3 A;  1S0O A;  3B8H A;  3HVW A;  2HMI B;  4CYU A;  2KG1 A;  5A8R B;  4ALZ A;  4PG8 A;  5L9X A;  2XHW A;  1UVN A;  4C11 A;  2E5J A;  4LFA J;  4XAK A;  2R7W A;  4QQB A;  1R0B G;  1FE4 A;  1YLX A;  1W25 A;  3PX0 A;  1M5P C;  3Q22 A;  3WIU A;  2UUB J;  4O3S A;  1KTV A;  2KXN B;  4QWE A;  4AQY F;  3V6H A;  4YR3 A;  3DLJ A;  4NZ0 A;  3O8W A;  4DV7 F;  4UY8 T;  2VAS A;  4NLS A;  4AUK A;  2W8K A;  3KXD A;  2JFK A;  1BHN A;  2BUN A;  2KFZ A;  1N5V A;  4A8F A;  2V2Z A;  2KVI A;  3EXC X;  4EO6 A;  2XYG B;  4YME A;  4CLF A;  1MMN A;  3QJP A;  1VYA A;  4U96 A;  3GTY X;  1DTT B;  4W92 B;  2X1A A;  3KK2 A;  1TMM A;  2B9E A;  1AZS A;  4DX6 A;  4ZN1 A;  1Q4R A;  3TAP A;  3O2I A;  3QZ7 A;  2H65 B;  2RVJ A;  2KL8 A;  3HCX A;  5HJY A;  2B8P A;  4ES3 A;  5D4O A;  2H3E B;  3GCX P;  4EK2 A;  4B3O A;  2QLJ B;  5C24 A;  3IM8 A;  1IN0 A;  3RGI A;  2FJA B;  4OHV A;  4NEZ A;  3PHE A;  4D3G A;  3TUI C;  4GKK J;  1HYS A;  4NCB A;  4DSL A;  4LFB J;  4ZPB A;  3M8Y A;  2QFJ A;  2PMH A;  4IFV B;  3M8P B;  5BYQ A;  1Y9O A;  1N5Y A;  2GO8 A;  2DNH A;  1FTR A;  4TLQ A;  2D3U A;  4UUW A;  1HI0 P;  2D3Z A;  4LRD A;  5EX0 A;  2K8G A;  1FRM A;  2W4C A;  1OSC A;  1KOO A;  2BKN A;  3HHL C;  3BO4 A;  4CLW A;  1TV6 A;  5J2N B;  2HFO A;  3TZX A;  3WBZ A;  1S10 A;  4UT4 A;  7FDR A;  1RAE B;  2YNH B;  1X9S A;  1KQK A;  3HVT B;  4O0N A;  4P75 A;  3RTV A;  2UUC F;  4KB7 A;  5J2P A;  4LUB A;  1FXD A;  2RUG A;  3HFZ B;  2VJV A;  1GTE A;  4UF4 A;  2G13 A;  1QAX A;  4JV5 J;  5CD4 A;  2YKA A;  2NSB A;  4I7F A;  1AW0 A;  3UI3 A;  3K8W A;  4EZ6 A;  4QWA A;  2Y0B B;  1PBU A;  3TP2 A;  2DNK A;  3KDO A;  1S1U B;  3MXH P;  2HHH F;  1JXV A;  4KHP J;  4O3O A;  1VQM S;  5F3Z A;  1FK9 B;  4TVA B;  2Z57 B;  5DQG A;  3W9I A;  3SFU A;  4BDP A;  1G1X A;  3IA0 A;  3PW7 A;  3PIP Q;  4YEA A;  4RNM A;  4V19 X;  2J6U A;  2LQ5 A;  1SJF A;  4PYA A;  1EAY C;  5KG6 A;  3D0H E;  4OHW A;  3BF4 A;  2DXF A;  3AAW B;  1OJ4 A;  3ONQ A;  4DUZ J;  2IDL A;  1B64 A;  1N0V C;  1RE1 B;  4JI7 F;  5ADZ A;  2DNP A;  4O0I A;  3WC0 A;  3MFH A;  4MK9 A;  2K1R A;  1HNZ J;  1R27 B;  2AT1 B;  3CIZ A;  2CPZ A;  4O4R A;  2ATL A;  4YY3 F;  2BKP A;  1VQO S;  4W4M A;  4Q44 A;  5ETT A;  4WFN Q;  1RTH A;  1VBX A;  1XR6 A;  4RW4 B;  4LRA A;  1W2I A;  2XY7 A;  2F8H A;  2BQR A;  3C6U A;  3KUE A;  4B9M A;  3TWZ A;  2KH9 A;  2GX8 A;  2MGZ A;  3DOK A;  1T9T A;  3QID A;  2Q43 A;  4NRU A;  1T3O A;  5BYS A;  5F8G A;  3CD5 A;  3BSO A;  1S12 A;  4J9M A;  3RBD A;  3H7H B;  2P9C A;  3KHG A;  4RWX A;  4HR2 A;  2B9W A;  3EYZ A;  4RL1 A;  2CQI A;  4NLT A;  2AW0 A;  5HMY A;  4WF9 Q;  4WFY A;  3ULH A;  3KFW X;  3DRY A;  4AQY J;  2A2C A;  2RIL A;  5KT7 A;  1K44 A;  4P72 A;  3U1M A;  4DV7 J;  2QT7 A;  2LA4 A;  1LK7 A;  4TY8 A;  2C3O A;  1EKS A;  3VAF A;  2F7V A;  2CJK A;  4B3R F;  4A8Y A;  2GML A;  4DG1 B;  1T7P A;  1WC6 A;  2H4W B;  4YUD A;  2VC1 A;  1FKP B;  4N5S A;  1BLU A;  1UWB B;  4Y0F A;  2QE5 A;  3QO9 A;  1KD1 T;  2H5E A;  2IA0 A;  1C0T B;  5LM7 E;  4QU6 A;  2LP4 A;  2YPZ A;  2I0X A;  2ROP A;  4ENO A;  1ZA2 B;  5EWG A;  3SMZ A;  2BAB A;  3KJQ B;  3D2W A;  1RTI A;  2OPQ B;  4PEO A;  4IRD A;  1VRT B;  2ZDP A;  4U9R A;  3PXG a;  2V67 A;  2DNY A;  1IXK A;  5CYM A;  2CZV C;  3J7Y I;  1TVR A;  2B43 A;  4A8X A;  3NAI A;  2BX6 A;  2AZ3 A;  1HKA A;  1NEE A;  2Z8Q A;  2NCK L;  4PQA A;  1SKS A;  2C2E A;  3R7N B;  4I56 A;  3JYT A;  1SC1 B;  2KT5 A;  2BAC A;  3T9N A;  3C66 A;  4IRK A;  4EYH B;  4P71 A;  1RAA B;  1M1H A;  2YWG A;  2D3O R;  4NZ6 A;  2KT2 A;  1JJ4 A;  3GSI A;  1W26 A;  1OYD A;  2BE9 B;  5KT4 A;  2NYH A;  4P2F A;  1DRZ A;  1U1Q A;  4P7T A;  3EVM A;  2UUC J;  4F04 B;  2RHS B;  4WTY A;  1MWY A;  1YSJ A;  2FY1 A;  1RT7 B;  5IM0 B;  5KG3 A;  3QT7 A;  2MKK A;  4R5P B;  1T3N A;  1WJ9 A;  2V34 A;  2JEF A;  3DM2 A;  1KSP A;  5F8M A;  5K8O A;  5EHH A;  3QRQ A;  2XYH B;  5KFC A;  5CAA A;  4QW8 A;  1HNW F;  5AJ3 J;  5K20 B;  3ICL A;  1FTC A;  3HK2 A;  3BSN A;  3BV8 A;  2F1F A;  1F5A A;  1XQI A;  2VIC A;  2CNO B;  3CMQ A;  3T41 A;  2AX1 A;  1SKU B;  2AYM A;  1JLC B;  5G0R A;  4X2B A;  1Q1K A;  1KQF B;  3BQ1 A;  3BBF A;  2AEF A;  1U0S A;  1EP4 A;  2GHW A;  4FF4 A;  2MSS A;  4W98 A;  1YBU A;  2J8S A;  3JQK A;  2OTL S;  4H4O B;  1JXE A;  3AJ1 A;  2RQM A;  1WHV A;  2DTJ A;  1NDC A;  2VOO A;  4KV8 B;  2VOD A;  4YY3 J;  1DZ5 A;  3MM9 A;  4RW7 B;  3PW2 A;  2XMU A;  4MK7 A;  4WP3 A;  2PN6 A;  3CCJ S;  3CW2 C;  1S4F A;  1F6T A;  2XMJ A;  5ETV A;  1IKW B;  2FZC B;  1E6Y B;  3UD5 A;  2FTR A;  4NLV A;  1C0U A;  4FKX A;  5CXT A;  2APO A;  3IBC B;  1N34 F;  4J9K A;  4JI1 J;  2L48 A;  4DV3 F;  2LQ8 A;  3W1Y C;  1M5S A;  4CO2 A;  3CT9 A;  2ZH3 A;  3GWC A;  4P9S A;  5MAO A;  4GVB B;  3NGU A;  4U8Y A;  1NSK L;  1WOP A;  2LEB A;  1IKY B;  1NME B;  1PBA A;  2B6A A;  3ITH B;  4PPZ A;  1KLM A;  3M6V A;  2FLP A;  3LAK A;  5CA5 A;  3MTK A; 
#chains in the Genus database with same CATH homology
 4OV6 A;  2ZWO A;  1SPB P;  2W2N P;  3VV2 B;  2W2P P;  3GCX P;  2Z30 B;  1R6V A;  2W2M P;  3WIV A;  1SCJ B;  2QTW A;  2Z58 B;  1ITP A;  3CO0 P;  3GCW P;  4NMX A;  3SQO P;  3WHI A;  3H42 A;  3A3O B;  2ZWP A;  3QFH A;  1V5I B;  3AFG A;  2XTJ P;  4NE9 C;  2W2O P;  3T41 A;  2E1P A;  3CNQ P;  2W2Q P;  3WIU A;  2PMW A;  2Z2Z A;  3VHQ A;  3P5B P;  2Z56 B;  4K8R A;  4YN3 B;  3A3P B;  3BGO P;  2Z2Y B;  3BPS P;  2Z57 B;  4JP8 A;  3A3N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...