4NMXA

Pcsk9(deltacrd) in complex with phage-derived inhibitory peptide 2-8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Identification of a Small Peptide That Inhibits PCSK9 Protein Binding to the Low Density Lipoprotein Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4nmxA01
3A3NB 2ZWPA 4YN3B 2Z57B 2W2QP 3A3OB 4NMXA 2Z56B 2W2NP 3VHQA 4OV6A 3AFGA 2W2OP 2E1PA 1R6VA 3QFHA 3WHIA 2W2MP 3CNQP 4K8RA 2ZWOA 2QTWA 3SQOP 3GCWP 2W2PP 3GCXP 1ITPA 1V5IB 2Z2YB 3WIVA 3T41A 4NE9C 2PMWA 3WIUA 3BPSP 3P5BP 2Z58B 2Z2ZA 3A3PB 3CO0P 2XTJP 4JP8A 3H42A 2Z30B 3BGOP 1SCJB 3VV2B 1SPBP
chains in the Genus database with same CATH superfamily
1YWXA 3BBFA 3OVAA 5L1JA 1AW0A 4KQZA 4CLKA 4R8UB 1WHYA 3CULA 4OX6A 2PC6A 5C24B 4RU2A 3ET6A 1VYAA 1LEOA 2HHQA 3UR0A 5B0FA 2QMXA 4B9MA 2BOAA 1AFJA 1RTIB 3MR6A 1FD8A 3S8SA 3SSRA 2CPHA 3QYYA 1X7VA 2HG4A 1N34J 3SMZA 4B9SA 4CLTA 4KSEB 4LRCA 4MK7A 1MU2A 4QJVA 5G0RA 3W5YA 5KFQA 4DR1J 3HT0A 5K14B 2QYGA 1MN9A 4GKJJ 3SV3A 5DM6Q 2BJ3A 5GMEA 3V6DB 1IBMF 4LIRA 5KTQA 2J8AA 3A1YG 2F4VJ 2ZNYA 2B7CB 2GGPB 5J1EB 2HK3A 2HHUA 1NK7A 2B9XA 1S9FA 4JI3F 4Y0FA 1DLOB 3GSDA 2FTRA 4KT0C 4CLPA 3QGPA 4KBIA 2XHCA 2X1GA 3JB9k 3SI8A 3OD2A 1JNZB 4I7FB 3GE9A 3TX0A 3KK1B 4O3OA 1I1GA 3ITHA 2BANB 3V2UC 3VGTA 3HLUA 1JLAA 2VC1A 3TOQA 3Q2SC 2MKKA 4B3SJ 5C25B 2VUGA 1NHUA 1FXDA 1Y3JA 3MAHA 5THWA 3U7JA 2LXUA 4IDKB 4QYZJ 2IMWP 2YKAA 2YPYA 3VZIA 3CCQS 4ELUA 5D77A 4NMLA 2QLJB 3K5MA 3N28A 3D1HA 2CADA 5DM7Q 1WORA 4DV3F 4PWDB 4ZVEA 4RLEA 3JAMY 2VICA 4LF4J 2HFVA 3G8SA 3L7PA 1HNIB 2XTJP 3MAQA 1X31C 2A18A 4TYBA 4ES2A 1WWHA 2XMWA 4M5DB 3MUMP 4DL3A 4UUXA 3DRPB 1WSRA 4F04B 4I56A 3KNGA 3OHAA 3ZTRA 3H5UA 4IG0B 2VA3A 2IRYA 2OELA 2OSRA 3TQEA 1NH8A 2V2VA 3BYRA 1NB7A 3G87A 4CI0B 4HACB 1LV5A 2W4CA 4ETZA 2JJ4D 1BUXA 1QUPA 5E2QA 4JI0F 3NWRA 4Q5VA 1XNQJ 1TL7B 3KHGA 1P8GA 3OBIA 4P2SA 1Q1KA 1CVJA 2P2CB 3J81Y 4MFBB 1FE4A 3VAIA 4FVCA 1X4DA 3K58A 2C3YA 4F0HA 4USKA 5CA5A 1RQ0A 4ECRA 2F4VF 3WIUA 3NBPB 1UFLA 1AB8A 2W01A 1Q79A 3PY8A 3OVSA 2F9DA 1Q5VA 1T0TV 3CWJA 4UOGA 4RO0A 4ECVA 4J9MA 4UY85 1UEUA 1FKPB 4O4GA 1LFWA 5A8WB 2KRRA 4LRDA 1S99A 4IG3B 3W60A 2DR5A 2DITA 1YG0A 2JH3A 4I6WA 4B3SF 3N9UC 1TK5A 2W24A 4C0BA 2M4MA 2MLXA 4JP8A 2DGXA 1N5SA 3DFEA 5HVFA 5C2CA 2KXNB 4HEA9 4HH1A 2CJAA 4C8MA 1OQ6A 5B0GA 2VFUA 3SCJE 4YY3J 2KL8A 3MCOA 1PJ7A 3RBDA 3B82A 4U7UK 4WU2A 2GVDB 3I31A 4FS1A 1VK3A 1IBLJ 5KFUA 3W8PA 3MM6B 1K1SA 1SL2A 4BWJA 3UW1A 3ZZ0A 4KV8A 4AE5A 2UXBJ 3QNWB 1H2VZ 4B3OB 2D69A 1IM6A 1RKIA 3BREA 3MPDA 4I2QB 2LYVA 1F6TA 3PKMA 3TEGA 3TP2A 1O51A 2MDAA 3H4DA 2R8JA 2AP6A 4RW7B 3RRGA 1URRA 1E6YB 4UQTA 2VG7A 1CULB 2MXYA 1S6OA 2M8DB 2CJKA 1M1HA 4X4RA 4J90A 2MZSA 2HNZB 5LT5A 1FD2A 4ECSA 1QLNA 1VQMS 3CD5A 2HLUA 3V4IA 4LMZA 4FBUA 3KLGB 1X9WA 1R43A 2W1BA 2MY8A 1HYSA 2KT3A 2HZVA 1SC6A 3BZQA 5A8RA 4LR8A 5A8KA 4LVNP 5HP1A 4CCHA 3UN5A 1FKOB 2EC0A 3VHQA 3VCDA 4JI2J 3IAS9 2OJ3A 3UDLA 1VIOA 4EGLA 1S4FA 1TVRB 3QIPB 4A8KA 3N0VA 2HS3A 3QO9A 1BQMB 4DV6F 1WSVA 2CNNB 3SQGA 4NASA 4L72B 2E1PA 2LQ9A 1RAGB 1HI0P 3IR5B 1PCAA 1X8DA 1JXLA 4LFAJ 1HR0J 1YRUA 3DOMB 2KVQE 4WP3A 5DETA 2B4UA 1Y9OA 1EP4B 3MECB 1S97A 1HW9A 1NH7A 3WBZA 1VHFA 5DQGA 4MIAA 2GIFA 1MW7A 3V6KA 1YJNS 3MDFA 1FVQA 2O1PA 4PXDA 2NYIA 3I32A 2XI3A 2R9LA 5L46A 2HVIA 4K4UA 3EZUA 4Q2LA 4DLGA 1NEEA 2R7WA 4HYKA 2VODA 2FDNA 4GVBA 4ZCMA 5DLGA 2PFFB 3OXGA 3W9HA 5DG9A 4JI7J 2HURA 4NCGB 2MJNA 5IT0A 4C11A 4LRBA 1HPZA 1LOUA 4A4JA 1YZ7A 4PCQA 2I6WA 5CZXA 2OUGA 3GJQB 2J0SD 4PQUA 2AW0A 3QATA 2NXCA 1VQPS 1S7HA 1GNKA 3HO1A 1FJGJ 3BN7A 4ZPWR 1O0PA 3QRRA 2BRKA 2IC3A 4TLQA 1ZBTA 1VJQA 1JJHA 3PXGa 1AXQA 2Q66A 3GYXB 2YNHA 1VRUB 4H4MA 5H9FJ 4HT7A 5KFHA 2UXCF 2MEWA 2OO4A 1N88A 4ZPTR 3AXMA 5DGAA 5D3GB 5JVHQ 5KFDA 2Z4PA 2LA6A 2QJ3A 2W7OA 1JLBB 4PG4A 1DQ9A 2NR0A 3QAUA 4ZPAA 4NX9A 3HVWA 3VAFA 3D3BJ 4DN9A 2FLLA 4USJC 4JI6J 3DLJA 4DL4A 4QWCA 1N32J 1NUEA 3GCWP 3LGMA 5CQGA 2HRYA 1VQ9S 1CPZA 1UFKA 1RT2A 2MB0B 4JV1A 1RT5B 1S48A 4P73A 4KRWA 5HAOA 4HI1A 3W9JA 4MKBA 3CJRA 1X5TA 2M88A 5SUHA 3DNCA 3PKYA 1LXJA 1X4AA 4K5SA 4Q45A 3GV8B 4RNNA 2WAQD 5HBMB 2Z0GA 3VAKA 1A7GE 1WG4A 2H5IB 3M9MB 4A8WA 2IM0A 4WPAA 2G9OA 3OTBA 3ZZRA 2FJWA 2GHWA 2A6MA 2FC8A 4QCLA 4DL6A 2XO6A 2VQFF 5HN0A 1SXLA 1C2PA 4PXCA 3NS7B 1DHMA 3VWSA 2YXLA 4GO5X 2PI4A 3W5XA 1KEKA 5DS7A 1X4HA 2AF6A 3UDEA 3K2YA 4RW4A 5CXTA 3POTB 1QY7A 3AD8C 4FVMA 4FF2A 5D0RA 2E5JA 2CNLB 5SZTA 2FLOA 3W3SA 5I4MA 2EFQA 2WSFC 3I0RB 1WKJA 3MD1A 4RBTA 2XS7A 3AA8A 4FF3A 5LJ3Y 2EKYA 3U1NA 4J9PA 1E6VB 3MPUB 4JBCA 4LR9A 1SVDA 3IM9A 3GQCA 4Q0BB 4ED1A 5J2MA 5LJ5Y 3DGVA 3KLIB 4X64F 1KP6A 4LF9J 2FJDB 3ISNC 4N8NA 4A8SA 2OEKA 2R7QA 1TELA 1H0HB 1B7FA 2JLGA 1Y5LB 3W5ZA 4IOCQ 3VAHA 4ZHRA 5CCMA 2HBZB 1RYRA 2IA6A 2VB6A 4OYWA 2IRXA 3TARA 1EQ0A 3I55S 1HHQA 4RJVA 1EETA 3QT7A 3GCXP 1U7LA 2AJQA 3R9LA 4USVA 2Y1LB 2BE7D 5K9FA 2ZH4A 1UVMA 2VPYB 3KK3B 1MWQA 1VC5A 4IUFA 2HGLA 1EARA 2DT9A 2FHMA 4OX8A 2C3OA 3BF4A 5KG1A 4JI6F 3JSRA 4MKVA 3KHLA 4B9TA 1NBEB 1XQIA 3MM8B 1ZZFA 2HKEA 3FCWA 3BQ0A 3EM1A 2BJ1A 3PVXA 2MKSA 2CDQA 5IM0B 4DSJA 5A0YA 3L9ZA 3KJFB 3ADAC 2K1RB 2CA9A 2C3MA 3D4JA 4USTA 2HWTA 2KT2A 2FHJD 2FY8A 3PIOQ 3BS9A 2QO3A 4M8LA 1B0PA 1UWBB 1YRXA 2EI5A 5T7LA 4ZIVA 3M9NB 4RWXA 1FRKA 3N4WA 3HJVA 4LFBJ 3RG6A 1LQ9A 2BE2B 2DHSA 4J9KA 2PGCA 2ROPA 2DNOA 5H9EJ 1TZ0A 4N56A 3ETMA 2HHPA 2AHOB 1JJ4A 3MEDA 3RBZA 1ITPA 1BHNA 1YZ6A 2MPUA 2GCFA 1VQ4S 4IFVA 4DX7A 4CO3A 3T9NA 4DV4J 3IBCB 1NU4A 1C1CB 4EMDA 2KDOA 4O0NA 2OD6A 4AXJA 1UW9A 5ETTA 2OPPA 4B3TJ 4ZPCA 1RWOB 1H98A 3C6TA 1NB2A 2NREA 1MG7A 2U2FA 4JB8B 4PKDB 1Y5IB 2HEKA 1M1GA 3NP5A 2OIHA 4JI4J 1NKCA 3DRXA 1RYSA 3UD3P 5LSRA 5KFNA 4LF9F 1TFWA 1VQ5S 1Q4RA 1KQFB 1GMUA 2IYIA 3MM7A 4OHZA 2HBYB 4LF5J 1AZSA 3CGIA 1G6BA 3JXOA 1S49A 1FI4A 4RNMA 2UUAF 3CJKB 1T95A 2HW3A 3ZO7A 1DZ5A 2X1FA 2VFSA 3DU6A 3HFKA 3SBMA 3HXMA 1R27B 2CPEA 1WEXA 2YY3A 2ABYA 2HZCA 5F3ZA 1XJWB 1S0NA 4OYMA 4X4SA 3I4PA 1G2EA 1TMMA 3KLEB 4ZDNA 2L9NA 1N52B 4IKAA 2XNRA 3BDPA 4DV0J 5K8PA 1FK9B 2DGQA 2LU1A 1LW0A 2BV3A 4OI0A 3JQMA 5J2QA 5RUBA 4DZDA 1RTDB 1TTHB 5HI7A 1OQ3A 2GHPA 1RDRA 3GIMA 2KHCA 4ZK7M 1YJUA 2MLYA 1DBDA 3VAGA 3SSSA 2V68A 2ZITA 2QL5B 1NJXA 4WFBQ 1WOPA 4ZVSB 2LDYA 3J7AN 4ALZA 2AEJA 1F3FA 1EHWA 4KH1B 2PFDA 4AQYF 4RW6B 2IM2A 2R2RA 4K0KJ 1IKWB 2QZ8A 1S5ZA 3QJJA 2J6UA 4TN2A 3DLBA 1RT1A 2CDRB 1KVIA 1QE1B 4P7VA 4NI2B 5I42B 4C2MA 1HNWJ 4CYUB 4DSLA 2NXNA 2A10A 3H8YA 2R2UA 4MIWA 3T41A 5B0AA 2DGSA 2QYCA 3BO2A 4LUBA 4B3TF 1W7WA 3US5A 2CZ9A 2I0XA 3MMJA 2CAJA 2AGOA 4AUKA 1S6PA 2CJ9A 2C2DA 4JI8J 3TZYA 4KC5A 1R7IA 2AV5A 4Y2KA 2D3ZA 3MTJA 2AKWB 1RTHB 4F36A 4USHA 4LF6J 5LOQA 5D0EA 2QV6A 3F41A 2QLFB 2LDIA 2DGVA 4B9VA 2ZD1B 3VQSA 2MYFA 4OZ2A 4K4XA 3J81j 5KG3A 1CJTB 5E3AA 2HLTA 3GG1A 3OPKA 1R31A 1BY9A 3DXSX 3RAXA 2R2TA 2AT1B 2YKNB 3SEOA 2IM3A 1C0UB 3RUBL 1AT1B 2MQNA 3OL9A 3GONA 4KPYA 4ID8A 4C97A 1TMJA 2RHQB 5BXIA 2J0QD 3R2DJ 3PJWA 3BSCA 1FDBA 3QPIA 4URQU 1N48A 3FSIA 4G6VB 4ZCKA 1SJ3P 2CPJA 1JLQB 3OV7A 2OI2A 4DX8H 3BQ1A 1JJCB 3VV2B 4QWEA 1CJUA 4A8YA 1RLCL 3MCMA 4XIUA 3IRXB 1Q5YA 4DV0F 3KDNA 3OUYB 5J2PA 5A2QY 3M2VB 3H2UB 4IO1A 1UL3A 3EE3A 4C6AA 3K5OA 3CDAA 2F4FA 2QA1A 1EZZB 4N8OA 3RRHA 3BBCA 1FTCA 2KT5A 1WOSA 4F25A 2OD4A 3W2VB 2GMHA 3CCES 2VBYA 3D6FB 3LP1A 3LH2S 4K7QA 2HQCA 5EN1A 4GMKA 5CD4A 3M4XA 4DSEA 4C48A 1NSKL 2BM0A 2CZVC 2GX8A 4WYLA 1S1VB 3MHYA 4F3MA 3FC9A 3C16A 2F8EX 2I5JA 3EVWA 2IBKA 1TU0B 3IXQA 2FYXA 2Z57B 1JXEA 1YIJS 2AYGA 1J5OB 1FNXH 1KHWA 4FKYA 2JC1A 5D0HA 2HS0A 3JQJA 3MPYA 2AJ0A 3DM2A 3LP0A 5IT9Y 4A46A 4JI8F 2G1HA 3PX0A 3BQ2A 3UPFA 3KG0A 4OI1A 3HX9A 3ZZZA 3H2VE 4TLRA 2DNLA 4F3QA 1TFYA 2YBVA 4TQSA 1MSWD 3KYLA 1KBRA 4X4QA 3PRDA 1XNRJ 1JB0C 3QWPA 5K20B 1NXIA 1HWJA 1AYEA 3W8GA 2R8IA 3HULA 2WBMA 3ZZTA 5KFWA 3DOKB 3HHLB 3GYGA 1NJZA 1BMQB 3P5BP 4EFAC 2Y1RI 3MEGA 4LF8J 4OYPA 2DEIA 1S1XB 2HFOA 4QYZK 1N0UA 2RE1A 1LW2A 2DNRA 3QT8A 4N47A 4YMEA 1LWEA 1FE0A 4ED3A 1QSLA 4I4BA 1J2VA 4NWBA 2J6TA 4J91A 2E44A 1NM2A 1GFWB 2POKA 2ZE2A 1YQHA 2CQDA 5D4PA 2VZ9A 1R0AB 4ZVUB 5GADU 2MMYA 4MT1A 1S9EA 2VC0A 2F8HA 3EXYA 2ZZTA 5IFMA 4KB7A 1U48A 1JKHA 2LFVA 4DSFA 1S1WB 1BQNA 3MUTP 2KZMA 4AXIA 3PNIA 4WP9A 1HARA 4O4RA 4O23A 5KFBA 1T05B 2SXLA 5ETVA 1VOMA 5IQQA 1CJVB 3FNNA 2BMBA 1TL5A 2B51A 2ZBRA 2RU9A 4DR6J 2IY5B 2VPXB 2AYBA 1UMJA 3M30B 2W9CB 5DDOC 5F8GA 2W9BB 3W2WB 4W92B 1M5VC 3L4BC 1OJ4A 4QIWD 3EZOA 2ERRA 2YWGA 4TY8B 1NK6A 1WHXA 4U9RA 3DLEA 2Q6BA 3GJSB 5HANA 1RWVB 2HNYB 3Q89A 2UUTA 3NAIA 1YSJA 3PTWA 1HBMB 2IFXA 2F65A 3CDUA 4NLTA 2YNIA 4NEZA 2HVHA 3KG4A 4PAAA 2RRBA 2VBXA 4NLUA 1F9HA 5AXMA 2MQOA 1ACMB 4RNFA 1WG1A 4OIXA 2VD3A 1BQXA 4GC6A 3KDOA 1FCAA 3EZ5A 4QR2A 4B9NA 1T9VA 1RA6A 3A12A 2DNGA 2AJFE 1RWMB 3JYTA 2BBEA 2E9TA 3T1AA 4I69A 2HPUA 1DJ0A 2LEAA 1F5BA 3UN3A 2KXHA 4MIBA 3FQKA 2ZVSA 4FXDA 2W8KA 3PR5B 5D4OA 3OR1A 2N3LA 4OJGA 4CNZA 3DYAB 4O3RA 3R5DA 4DDFA 5D15A 1DARA 4UOFA 3KJVB 4USMA 1S10A 1CEZA 1SV5B 4XPCA 3G82A 5ETLA 2CPDA 2MKYA 2R8HA 3W66A 4S0MA 4JI1J 3NWGA 3PFOA 4DU8A 3G8QA 2ZH5A 4DR7J 3ULHA 2PMWA 3JTNA 4NXMF 3EYZA 1UFWA 2AEFA 2JHEA 4R25A 1U1RA 4ETXA 3BBBA 3MEEA 2E5LJ 3C15B 3DKDA 5KT5A 2V9WA 2XO7A 2XY5A 1SH0A 3BB5A 2LQ5A 3TA0A 3ILIA 1PO6A 4JI5F 3AD9C 1IUJA 4DR6F 1TKZB 3W7BA 1KVKA 3DOLA 1HFEL 3UDVA 2XS2A 1W25A 3BYPA 1YJRA 4J9LA 4C3KA 1HBNA 5KFPA 1U8SA 3VALA 5KFEA 4CTAA 2HAIA 3CXCR 4LVOP 2LEBA 1TAQA 3DDNA 2R42A 8AT1B 5DLFA 3N6NA 2R8GA 2I1RA 1S0MA 2HVDA 1KQKA 5HROB 3ONQA 2H3EB 1F60B 2BJ9A 5DZ6A 3MF5A 1MU2B 1VRTA 5G0RB 2J8SA 3UD4P 2C2ZB 2VDIA 3PW0A 3JS9A 2QMWA 1DTQB 2Z2YB 1GTEA 2LQ8A 3THVA 3RW7A 3GMGA 1TQLA 4O3NA 3IG1B 4NLPA 3IS9A 3QWUA 1XIQA 3Q83A 1HNXF 2FLNA 3OJSA 2DO4A 4HTJA 5C5JA 4B3RJ 3THTA 2XY6A 4FF1A 3VGUA 3SZ2A 3A3PB 2XSFA 3G86A 3RR8A 3KHHA 3K5PA 2CJQA 2OPQB 2RS2A 4DZ6A 4CO4A 3GWCA 3CIMA 3KHRA 2V2QA 2CQ2A 4ZP6A 2YQ1A 3ZXWA 1GK8A 2V8PA 1Y10A 2E1CA 3CCWA 2ZBQA 4DG1A 5CAAA 5J2NB 3V6HA 4KKOB 4DBQA 3FEYB 5BYRA 1KR4A 2JFDA 3J7A1 3GR0A 4DUZJ 2FVSA 1CQNA 1S0VA 4DCOB 4WCEQ 1R8AA 2CPFA 1PJ5A 4PUOB 1JK9B 3OFFA 1FX2A 2VKZG 3M9OB 1RWWB 2UU9J 3LANA 3DU5A 3PJXA 3W1YC 1HNVA 2IPOB 3AOBA 4OFZA 2ACYA 2XMAA 1ZETA 4DV1J 1F9FA 2OGUA 1I94J 1MWZA 2RKIB 3BJYA 2COLA 3H5XA 1M5OC 2BQUA 5H9FK 4X2BA 3NKYA 3D0IE 3E3XA 3FBEA 2DYAA 2ATLA 5I3UB 2V8HA 2P5VA 4GC7A 1C0TB 2PA8D 3CD6S 1FESA 3DRSA 1MWYA 1NSPA 2G2YA 1Q53A 2XM3A 2YWEA 4DV7F 3TVKA 2FIUA 4OV6A 4BS2A 4NLDA 1AFIA 4OHVA 4OL8A 1RP5A 3E01B 3UWTA 1M1KT 3PYDA 2CJXB 3V81B 1MROB 4WE1A 4ZPVR 3L95X 2D9PA 3LP2B 1UEVA 4LF7J 1FJCA 4CDIA 3OSNA 2RNEA 5DJBA 2IHR1 4PYAA 3HP6A 3CD0A 2Y8YA 4DN0A 4FPRA 4DL0C 2P6SA 1RAEB 3GFHA 2MGZA 4B3RF 2E1MC 4DUTA 3V6JA 3E2EA 1Q86T 1HWUA 2P6TA 1ZA1B 4RNHA 1NDPA 3TAMB 1R8BA 4L3NA 2ZHAA 1TKXA 3WIVA 1G4CA 3MOZA 2UZAA 3ENWA 2Y3YA 2N3OA 4DWIA 2CVIA 2G13A 5E33A 4LSNB 4CIOA 3M2RA 5AJ3F 5DO2A 3LTOA 5HSPA 1SIZA 5L38A 2FB0A 2I8EA 4YB6A 3BGOP 2RSQA 5G4DA 1ZPWX 5IT4A 4MH8A 1X4BA 2G1DA 3BV8A 4Q2MA 4P9SA 3P6YC 3MXHP 4PWUA 1I51B 2HVEA 2AU0A 5M2PA 1GT8A 1C4AA 2ZOMA 2WCXA 4UOCA 2HGNA 1NKBA 2Y1IA 4YHHJ 5ETKA 2PDAA 3BO3A 3FDSA 3W65A 1GMWA 4QQBA 2J5AA 1AUDA 3FBFA 3P45B 2OMOA 3G6ES 1Y00A 1OO0B 3DC2A 2JNJA 3D0HE 2OSQA 1UAWA 3EJMA 4J9UE 1W26A 3B78A 3DN9A 3W9IA 1NK0A 2RDIA 2VQEJ 1JIHA 4P75A 1VDHA 1UZHA 3MD3A 3MTKA 4XK8C 3EICA 2KFZA 3RJMB 7AT1B 5IXUA 2KYZA 1N5VA 2WK4A 4QIVA 2WOMA 4PG5A 1V5VA 1P9YA 5HK4A 1FWPA 2YKMA 2VPWB 3CVKA 4W4MA 4K4WA 4KH0B 3U1MA 4R8UA 1T9UA 4LF7F 4V1Ak 2FVQA 3PRVA 2DRAA 5C24A 4C8ZA 1V6HA 1OYDA 1U8WA 3PHEA 3F56A 4CO0A 5E41A 2UVUA 4FDFA 1WC0A 4DQRA 3OXLA 2ZZMA 3CMES 2HBRB 2K06A 1RTIA 2ZJRQ 2LXFA 4P2FA 1SKSA 3TO8A 1D9DA 3T19A 1B3TA 4QOTA 4IH6A 1MMDA 3PW4A 4A8OA 3MCSA 2A2DA 2KXFA 1SIWB 3PV8A 1OWXA 4R0EA 2DISA 4XO0A 4U67Q 4WBFA 4X66J 5D8HB 5K14A 1U0HB 3NL0A 5KFSA 2M70A 1U2RA 3V6DA 4OYAA 1O6XA 2RQCA 2GGPA 1KSPA 5J1EA 3OW2R 1NCLA 2XYHB 4CRJA 3F73A 4CLYA 2C22A 1DLOA 1XERA 4LBHA 4EBCA 3GV5B 5IWAJ 2D3OR 1T02A 4I7FA 3I5BA 3IAM9 4YHHF 3KK1A 3IM8A 3M8ZA 1JLCB 4DJBA 2JZ5A 5C7PA 4USWA 4YN3B 3THPA 3BH7B 4JV2A 2HIQA 5C25A 2UUCJ 2OFHX 3CE8A 3HVTB 1RAAB 4ZITA 1TR0A 1OIAA 4PABA 2QMUB 4IDKA 2V2ZA 5U47A 3TWZA 3QQCD 2VG5B 2UV8G 1Q0NA 2VQEF 4X4TA 2V9KA 4NLYA 4PWDA 4RZRA 3LPYA 4NCBA 1DAXA 4PYDA 1HNIA 3HHLD 2HAFA 3ZTQA 2GW8A 4X65F 3CW2C 4U8YA 3NEKA 5M2UA 4M5DA 4IRDA 3DRPA 2B0GA 1Q7LB 3N6MA 1T3OA 4PXEA 4IG0A 1CJKB 4B3MF 4MJKA 4EBEA 3UCZP 3R3TA 4FZVA 5GADI 1FHTA 1YDLA 3I87A 2EXUA 9ATCB 5KG7A 5A6PA 1HD1A 1HBUB 2C2KB 1RCOB 4HACA 1Z4UA 3NGKA 4Q7AA 3RZAA 3L7UA 1FNMA 5EUHA 2Z8QA 2F8MA 3QGHA 3SCKE 2XGQA 3CCJS 2N82B 4C8LA 2GS8A 1JLGB 1QAJA 1TL7A 3QSIA 1RAIB 4OZNA 1HNZJ 1UVKA 2BQ3A 3NGDA 4MFBA 1J5EJ 2QGFB 2HS4A 2OFGX 5KG0A 2FHOB 5HQ8A 4RR5A 1PYSB 1H74A 1ICEB 4ZA1A 4OJ3A 3EDRB 1TUGB 2WZ1A 4UW2A 4RUHA 1SL1A 4NYPA 3NBPA 5B0EA 3CPWR 2ROGA 4I2PB 2J76E 4EZ9A 2RHSB 2E7WA 4WIQA 2B6AB 3BKTA 5IWAF 4FNIA 3I96A 3HHEA 1RTJB 3DDKA 4P71A 1OY6A 1FKPA 5A8WA 4DR5J 2KJWA 4CO2A 2KJVA 4IG3A 4NLWA 4OHWA 1R0BG 2RS8A 1K0TA 3RU0A 3HD1A 1WC3A 3GIKA 4V19J 2JEGA 2FVCA 1JLFB 5KFTA 3HHDA 4D3GA 3O2IA 4KHPJ 2FLPA 4X4NA 2RH3A 3PJ9A 3M2UB 4N77A 2NXUA 1FJEB 2C28A 1QM9A 4ZMMA 5KFXA 3HF5A 1L3SA 2GVDA 2NCKL 1IKXB 2I38A 4L75A 2NLWA 4IRKA 2GFFA 5GAHU 3CCVS 2XWXA 3MM6A 2P8IA 4EEYA 2RF2B 4TXSA 4P6QA 4XPEA 2Y9HA 3FKBA 1HWLA 2WVFA 3WHIA 1VQYA 4B3OA 2DNQA 4QU6A 3IBWA 1SUQB 2N4CA 1NHVA 3ZNUA 4I2QA 1IM4A 4HT5A 1NPKA 1SH3A 3N6LA 4RPFA 4RW7A 2FGOA 1E6YA 1CULA 1LWCB 4F8RA 5BR8F 1U26A 2IJFA 3AAWB 3MUVP 2WB1D 2ZUAA 2RQKA 2HNZA 1SPBP 3S01A 5T14A 5B0DA 4KAIA 2DXEA 1TK8A 4PG8A 4GVLA 3B4MA 4ILRA 2KYXA 3UR3C 1XMQF 3OTEA 1U0SA 4I0WA 4RUAA 1JLEB 5GAEU 3T6BA 3KLGA 2OP5A 3VTIA 5KFGA 3SIPB 3AY0A 3FZ2A 2DH7A 2Y1JA 2VOPA 3UVJB 3FCHA 2MKJA 2YKOA 4PWWA 1OPIA 5AE3A 4XDDA 1JNRB 4WKRA 1RWPB 4KGVB 4ECYA 5KG6A 3QIPA 3T1HF 4WK3A 1X4CA 1IBMJ 3DLGB 1EKRA 1BQMA 1N36F 4F4ZA 3O6QA 4QIEA 4TNOA 4M5NA 3N5FA 2Z2ZA 2X3GA 4ICLB 4JI3J 2XULA 2MSTA 3J80U 2J9DA 4M1KA 5ETPA 2ZBPA 3DOMA 5LMUJ 4KPCA 2CWKA 1EP4A 3UDCA 1P27B 3KOAA 1LXNA 4FYVB 1DQAA 3VQTA 3WC0A 3WX8A 5H1SV 1N5TA 4FNHA 1RHKB 4U8VA 1WI6A 2X7IA 3A13A 2JVRA 1AROP 2EG1A 3DGPB 4ZN1A 5HMXA 2XNQA 1AZSB 4DCJB 2HQDA 5C42B 4URGA 2KM8C 3LQVA 4C8OA 4JOUA 1RSCA 4I67A 2HQFA 3PCOB 3KLHB 2OMLA 2FQQB 4ZVQB 3KLFB 2AD9A 4B9LA 3QFWA 2AGQA 3R27A 3HFVA 4NCGA 2DR9A 2PO4A 2D1CA 4X4VA 4ANCA 2QA2A 1UKUA 4OI6A 4EZ6A 5ETMA 2FC9A 2UUWA 5CABA 1XMOJ 2CYYA 4DR2F 1NDKA 3QRQA 3N01A 1UPPA 1M5KC 2W25A 1TV6B 2QTWA 1REVB 3G6YA 5E7OB 1Y7PA 1VRUA 4Y2CA 5D3GA 2FPHX 2XQCA 2LXIA 1RAHB 1FDDA 1RACB 9RUBA 2MQQA 4JI0J 4CH1A 1JLBA 4R5PB 1QUVA 2E66A 1HBOB 2G4BA 4O3SA 3FQLA 2BOPA 1RWKB 3UI3A 3HHKA 1NDLA 4OI4A 5ETQA 4CH7A 2ZWOA 6FDRA 3GPAA 4LREA 2NXEA 1LWFB 3D68A 1M5SA 3JSYA 1RT5A 4KFBB 2V4RA 2DXFA 4RNOA 4HI2A 1PC4A 2ZH6A 2FJVA 2HQ3A 3BGRB 5EWGA 2U1AA 4LIWA 1RBLA 3F44A 3M7VA 5LMUF 3O1LA 1ZM2A 1L5UA 3IGVA 5LMNJ 3BKFA 3D54A 3TUZC 1WF1A 2R7UA 2V5HG 2QFJA 5HBMA 5IC6B 2MLZA 3T1YJ 1L3TA 2H4YB 2NSCA 1MMNA 1LKZA 1O8BA 3P8BB 4BDPA 1U49A 2HWIA 4ID5B 3POTA 1ZPVA 5DDRC 4ZCIA 3I0RA 4IO9Q 1Q16B 1FO1A 1UETA 3RB4A 3NOGA 4DXLA 2P9CA 4ZIWA 4C3LA 3JTOA 2R7XA 1E6VA 1SCJB 1RT4B 5LXYA 4Q0BA 3HSDA 1WHVA 5KFFA 2E9RX 2JLEA 3KLIA 4Q44A 4DL7A 4M5IA 1XMOF 2WSEC 5F41A 4WTOB 4ZJOA 4NLOA 2VL1A 1YHQS 1MLAA 2O67A 1VQSA 4DS5A 3BKUA 4UF4A 2BVZA 2XMTA 3NRBA 3KK3A 1S6QB 1N8RT 1S76D 1FKAF 3SCIE 3CMAS 3NXZA 4UUWA 4J9SA 4C8KA 3FRZA 2HHWA 2K8GA 4K4YA 2L08A 3FEXB 1Q7YT 3K17A 4OHXA 2PE8A 4HDHA 2H48B 2L9DA 3MM8A 3C16B 1HW8A 1X0PA 4M63A 2M0GB 4HR2A 2YX1A 1VQ7S 2V8VA 1KFDA 1TK0A 3Q86A 3MGJA 5IM0A 2YTCA 2C2RA 1KVJA 2H1YA 2K1RA 3ICLA 1GX6A 4ZP9A 3KUEA 2KFNA 5B08A 1KFSA 3I9ZA 1NPPA 2ILZA 3Q0AA 5KFRA 1HQUB 4DV6J 1FTRA 1IJFB 2ATCB 5CHCB 1HI1A 5LMNF 1UWBA 4WKYA 4NCAA 1KTQA 4RU9A 2YX7A 4DF4A 1KQSR 3KMSA 2BE2A 2H51B 3CDWA 2CVEA 3T1YF 1H7XA 3K5LA 1QVGR 2UUBJ 2M5YA 3MMAB 1N33J 1L3VA 1K1QA 1KD1T 1R8CA 3QLHB 2VU5A 3CJ0A 1C1CA 3HFZB 3L7OA 2AMCB 3NS5A 3IO1A 1HL6A 2IDEA 3MEGB 3OXFA 2DY9A 3MOJB 3SDEB 1SQFA 3A3OB 1RT3B 4MK9A 4ZJQA 2ZJQQ 3HVAA 1NNDA 4IOBA 1FA0A 1K8AT 1XR6A 3IFEA 2Z30B 2V2KA 2NZ4A 1YVFA 4OV1A 3AHPA 5JUMA 1KS2A 3M8YA 2CPIA 2C3UA 4OZ5A 1D9AA 5KG5A 4TU7A 3V5RA 3ZC4A 2GZOA 2LKZA 2VHGA 5HVGA 2L41A 4IFYB 4L3KA 2Z56B 3CJKA 2E1AA 3KG1A 3IBFB 3GP9A 2EBEA 2XSJA 4ZVRB 5IZHA 2PMHA 1KRPA 2GIQA 1AUSL 3FFIB 2UXCJ 1S6UA 5D4LA 3A8JA 3KLEA 4U96A 4ECZA 1RLDA 3MWBA 1KOOA 3D2WA 3TVYA 4CO5A 3MCNA 1ZS6A 1UZDA 5ETOA 1FK9A 1QTNB 4DHVA 1RTDA 3HD2A 1N54B 1Y11A 2MQPA 1SKUB 1LNQA 2ZOFA 3GFXA 3LAMA 1VMBA 3HKZD 1K0VA 1VBKA 2CPYA 1RCXB 3K8VA 3QGGA 3AH6A 4EO6A 5J1NA 4NLSA 4RW6A 2UUBF 1IKWA 3BSNA 2G0CA 3JQKA 1N33F 1UWAA 3GIIA 1QE1A 3ETOA 4NI2A 5I42A 4CYUA 2XZDB 3G2XA 3DCAA 4CLLA 5KFYA 2JVOA 1HI8A 4QWAA 2ZC4A 3PO5A 1D1UA 3PEJA 4BC9A 1GQEA 2VQFJ 2NUUG 1RKJA 5L9XA 1VQNS 1B0TA 1PKUA 4WZMA 2W8LA 2GO8A 2ZHOA 1RTHA 1K47A 2CUYA 2YNGB 5DG7A 3J7YU 5JJBA 1PIEA 1UVIA 1SB6A 4BCAA 2VDHA 3SV4A 2FZGB 2ZD1A 2DCLA 3LAKA 2VH7A 1CJTA 2ZWPA 4Y2IA 1BLUA 2YKNA 2YX4A 2R7RA 4NXNJ 4X64J 1QD1A 2OAUA 4DFJA 5HL7Q 3CCTA 4L6V3 2RIJA 2B5JB 3MEEB 4NA1A 4K5RA 2L9WA 4YP3A 5AXKA 3IWNC 1XTZA 4ED7A 2YNFB 1X9SA 1NKEA 2ROEA 3CT9A 4ES3A 4IYQA 4HKQA 4QU7A 4IRCA 1V3ZA 3JSMB 5HVHA 1JLQA 3KWMA 1YJVA 1FDAA 2X3DA 1TKTB 2VJVA 4U7UD 2CRLA 3IRXA 3OUYA 3M2VA 3MM9B 1X0FA 1U1MA 2XCAA 2V4QA 2QLXA 1WKLA 4X4PA 3W2VA 4QIFA 2G2OA 2KG0A 1D9FA 2EFVA 6AT1B 3MR3A 1TP7A 3RR7A 3AJDA 1S59A 2WTFA 5CYQB 4LSLB 1RAOA 1CBKA 1X60A 1S1VA 2DIUA 1T94A 1GTHA 4EI2A 5HJXA 5CYMB 1QAYA 2DNZA 1KKHA 3O44A 1N56A 4FXWA 3EVOA 2HFSA 1IKVB 3OTOF 4JYAJ 4DV5F 2XMVA 3M6UA 5F3TA 3OL8A 1J5OA 2AZ3A 1D8ZA 5GAEI 4N41A 3ZTPA 4OLOA 3H42A 3D6HB 2BE9B 3JTPA 4ELTA 1FERA 5KOXA 4FYYB 2QN6B 1ZYQA 3OQ2A 1IJEB 4DR3F 3UCUP 1X4EA 4LFCJ 1WC6A 5BYQA 4W98A 1WOOA 3TJ9A 1NMEB 3HKWA 3NGRA 4KTQA 1WACA 3OT9A 4KGXB 1IXKA 2MTLA 7FD1A 3VF0B 2V34A 3CC4S 5HMZA 4C9DA 3DOKA 1U1PA 1RHMB 5KAKA 2RU3A 3EPIA 2H4WB 1WF0A 2XWYA 3DRYA 4NXNF 4Q43A 4YR3A 5KT6A 3MMBB 1S1XA 2BX6A 4ZLPA 5HMWA 4F2SA 2Y0SD 2DGTA 5KFZA 2VG6B 4O3PA 5B0BA 3CJSA 1SQGA 2R2SA 4KJIA 2XC9A 1FXLA 4WTYA 3LF0A 2UUAJ 3GLJA 1QJHA 1R0AA 4YOEA 3GG0A 4DU7A 4RKUC 3ZTOA 3GSIA 4M5JA 2C42A 4U7CA 4RL1A 2OEJA 5BJRA 2HMIB 2W2NP 1RT7B 2MQ8A 1S1WA 4QW8A 4G1QB 1S1UB 1S9GB 2ZH8A 3I0SB 1T05A 1Q8IA 1CJVA 4EBDA 3RW6A 2R7VA 3GIRA 1NRKA 5MLCV 5BYSA 2FJXA 5D4NA 3H40A 3I56S 3M30A 2W9CA 5L39A 1NJWA 3W2WA 1KN6A 1TL1B 3TYTA 4F4XA 3EXCX 1FEEA 3UE2A 1RHJB 3RB6A 1WUUA 3R6GB 3TZWA 5K8MA 4TY8A 1GMVA 3PHTA 2QLWA 4JYAF 2EKNA 4AQYJ 3LALA 3M8PB 2ZNZA 1DQ8A 2HNYA 2QG9B 3H98A 3PFEA 5HO4A 2VFTA 3PACA 1HBMA 3U27A 2KKHA 2ILYA 4WWSA 1Q8LA 3M8QB 4YB5A 2J7WA 1U1NA 1HKAA 1UVLA 4NZ0A 3MR2A 1JMTA 4LFCF 2QC3A 1IR1A 5E3RA 1KLNA 1BXNA 3SFGA 4K2XA 4ECXA 1IWGA 3OLBA 3BH6B 4DOZA 2IYGA 1X5OA 3AJ2A 3P5TL 2EG2A 2CG8A 3IA0A 5LL6d 1MNEA 1T7PA 1XK8A 4CLSA 5IC4B 3O8WA 3MR7A 4L73A 3QGIA 1T9YA 2CJBA 3I4HX 3EUNA 4ZJLA 4ECUA 1WF2A 3VVTA 3CSKA 1B0VA 4B02A 4YUDA 2ZH2A 5K5MA 1PAEX 2EFPA 3DYAA 3MI7X 2JX2A 1VFJA 3M32B 4BBYA 3KJVA 3C3LA 5HQMA 3HI9A 1SV5A 2CZ4A 2MY7A 3E8OA 4LJMA 4RW9B 4J9OA 4X84A 4NZ6A 2GA7A 3Q22A 2DNPA 3T5JA 4N7TA 4DFPA 2X51A 3H5SA 3TUJC 3RTVA 2XYGB 4QIGA 1T9WA 1IKYB 1HMVA 4BLGA 3C15A 3IWXA 1FRMA 3DXBA 5DZ7A 3EX7B 1YLXA 2V0NA 3G8TA 2V4JB 2AGPA 1TKZA 1RK8A 3IRWP 3M05A 3C6UB 1KQGB 4ATNA 1T03B 5HLFA 4EO8A 4JV5F 2H5EA 2L3MA 1FRLA 3CB4A 3N79A 4OYOA 4NL5A 5F9NA 2JLFA 3RB0A 4TVAB 1T8EA 5F8IA 1VQOS 2MHNA 1RU1A 4A8QA 3TZXA 2VKRA 1R0CB 1DTTB 2ZFHA 3EVMA 2WONB 4TQRA 1V3SA 4CLZA 2XMUA 5HROA 3TI0A 1FWLA 3HCXA 2FUG9 2BABA 2JWNA 1Z2ZA 3GJRB 3BR9A 4RW8B 2EBGA 4ECWA 2C2EA 1DTQA 3GB0A 5FDLB 3W61A 2KRBA 3VAJA 1RT6B 2G0IA 2YH0A 3TEHB 2HFUA 3IG1A 4KO0B 2IMOA 3HK2A 3R6LB 1VI7A 3OFHA 1T9XA 1UVJA 4I68A 1HD0A 4QR0A 2BA9A 1U2FA 1CLFA 3Q8SB 4CLWA 2OPRB 3DLHA 1B4SA 2MZQA 3AOCA 3U02A 4HHHA 1VRQC 3KMQA 2BJDA 2V50A 2BACA 1V3RA 2ADBA 2AWZA 2OPQA 4F2RA 4V19X 2QSFA 4Y65A 3TVZA 3NGTA 4BC7A 4MMOA 3A8KA 3DMJB 2XZWA 1Y5NB 2HWHA 2YWHA 2B43A 4OX9F 2NPIA 5J2NA 4ZVHA 4KKOA 4QPTA 4U6PA 3CCLS 2F1FA 4OYIA 4CH0S 4NOHA 1XR7A 4UQGA 4M94A 4QWBA 1YJWS 4ZP7A 2H5JB 2NS1B 4FF4A 4P10A 3D28A 1OYEA 2DO0A 3K89A 2D74B 4PUOA 3GU0A 1CS4B 2WB4A 4DR4F 3A8EA 3S7RA 4DPUA 2HBQB 2NZCA 4J9RA 3EGVA 2XZTB 3CNQP 5KT7A 4ZOSA 4EU0A 2RKIA 3R5CA 2QX0A 3M1VB 4LBPA 1KDNA 1RZMA 1HQEB 4P74A 3D5MA 4ECQA 1H2TZ 3PX4A 3BEGB 5I3UA 3H4BA 3KKFA 4B9UA 1C0TA 3D7SB 2WHOA 1RUSA 3MM5B 4CZCA 3LWLA 1N34F 2XLKA 2ZH3A 4GO7X 3OR2B 3E01A 1Q95G 5IOLA 3V81A 1MROA 3DRRB 4DR1F 2HNDB 2ZOGA 3DHWC 4GKJF 2VIHA 2W2QP 3LP2A 4ED2A 2KU7A 3EGNA 5A76A 1RISA 3L09A 2Y0BB 1FFGB 1S1TB 5EWEA 1RU2A 3MAAB 2JDJA 4DPOA 2V8GA 2BEFA 3AB4B 4ZVOB 1RE1B 3C46A 4PRFA 2F5GA 2X1BA 5AXLA 1KNZA 1KWMA 3B4DA 2AJ1A 1H2UX 3PYFA 3AFGA 1NZAA 4G3IA 1GAOA 3TZZA 4OZJA 5E5NA 2QA4G 3CCSS 2QIFA 1M90T 5EGYA 3KK2B 3TAMA 1F5AA 2I2YA 2ASLA 3H25A 3FUYA 1IWAA 4LSNA 3J80Y 3CJ3A 4HDGA 5IV3A 2W9AA 3BSAA 2DH9A 2VFRA 3TRGA 2V67A 1GXTA 5I3PA 3M8SA 5K8NA 1CSJA 2GIRA 3FMWA 3FGVA 4O44B 2FHKA 4OLPA 3CMQA 3DLKB 2EEYA 1IVZA 3IC1A 3HSGA 4LF4F 1RHUB 3ZZPA 1HIYA 1TL3A 3NNCA 3FRYA 1UP1A 2MSSA 3SYZA 1K9MT 2C2MB 3AB2B 3W63A 4I64A 3NMAA 1NLKL 4LT6A 2F40A 1WC5A 2RMLA 4NXMJ 4QBUA 3J7YI 1SC3B 3HZGA 5AT1B 4QZVB 4H54A 4E0DA 3LGNA 2UXDJ 5EHHA 4JI5J 1LWXA 2O01C 5MAOA 2RRNA 4Y34A 2HRUA 2A1BA 1XN9A 2FGCA 3NAHA 1BWVA 4WFYA 3EWGA 1XNQF 4KE5A 2GV1A 4F0KA 1H6KX 1N6QB 1IQTA 5F8MA 5FLXU 1EX8A 2RUSA 2ZBIA 2PI5A 2ZC3A 2V8DA 1RGVA 2E7VA 5F0WA 1SL0A 2YH1A 5J1PA 2CG4A 5GVQA 4DSIA 1ELOA 4ED5A 4M5GA 1Y3KA 1HA1A 1ZAWA 1ROFA 2H65B 3HM9A 2D41A 2PA3A 2GJFA 2GQ2A 1RHRB 3H7HB 1RWUA 1N5YB 2JEFA 1M5PC 2IJRA 3Q2TC 3KJNB 1C1BB 3FBBA 2EPIA 2LLZA 3Q24A 4H4OB 2MQMA 4L74A 5GAGU 2DR6A 3HJFA 1HNXJ 4HL9A 2OPSB 2B9EA 2R7SA 4DQQA 2ZHBA 1U0HA 3KUGA 3P4UB 2J9CA 2VASA 2ASYA 1SJRA 1R8HA 2IAJB 4J5OA 5E3CA 4P7TA 4F67A 4A47A 3TUPA 1SKWA 1SH2A 3NGSA 2GVZB 4FYDA 2LEPA 4WJBA 2NPFA 3I5AA 3DI6B 2R7OA 2KTQA 3F0NA 2FVPA 2G2ZA 2KB2A 4GKKJ 2AX1A 4Z7CA 1TAUA 2XEXA 1A9NB 3MMCB 4ZLJA 1H7WA 4MAKA 4YY3F 3NNHA 1JLCA 1WD6A 3D67A 1TUVA 3IP0A 1UTAA 4WYWA 1IBLF 1VCTA 2ZKTA 3ZNJ1 5DGBA 2JRSA 2CQBA 3ILJA 4RX6A 1YJ9S 2UXBF 5E3PA 3HVTA 2Z2MA 4C7QA 2HFNA 1PGZA 3C14B 3CC7S 4DPTA 3WX4A 3CD7A 1NK4A 3HPOA 3AXKA 2UXDF 1W2BR 1S79A 2KVIA 1YK9A 2VG5A 1UA0A 4LF2A 1SC1B 2BXJA 3FVYA 4KHMA 4YDXA 3RAMA 4CM0A 1F3VA 3ET6B 1YKWA 4HHUA 4ZCLA 1HHSA 2N4DA 1M5HA 4BWMA 4OX7A 1P1LA 1X5SA 3O3LA 3ZTSA 2P9GA 1CJKA 3KJQB 2HVZA 2KN4A 1ZZNA 2R3VA 4DV7J 4G65A 1IBCB 4ED6A 4JI2F 2C1EB 1HBUA 5CZVA 4AL7A 4ZPBA 2XLIA 2AX0A 1JLGA 2IIHA 4Y2MA 4DCPB 2LA4A 2ASDA 3G6XA 3H20A 1RABB 4LFAF 2RDJA 1NAQA 1BGXT 1HR0F 3EGWB 2RDDA 4CP5A 2LMIA 3I9V9 3GZ7A 1KHVA 2H9ZA 3MFHA 3CEDA 2JL9A 4YR2A 3QMQA 3G96A 3ITHB 1U6BA 3OHBA 2QA4S 5KT3A 4I2PA 3A8IA 1RXOB 1JLAB 4Q8EA 4DX5A 2BM1A 2WSCC 2B6AA 2CQ4A 4GKKF 1LFPA 3PZPA 2QL7B 2HZAA 4ZVTB 5AJ3J 1H73A 2J9DE 1NPRA 1RTJA 2RRAA 2WW4A 1WG5A 2J7UA 3R7BB 2IM1A 2JSXA 2BZ2A 3KTQA 4C4WA 2CQPA 3GYNA 5JXSA 2MQLA 3Q8UA 4K4VA 3PYGA 4CT9A 1PBAA 1X9MA 2DNHA 4OI2A 5LSLA 2DNNA 2KHDA 4FP9A 5K8OA 4JI7F 1JLFA 5KFMA 2EVZA 3LOUA 3R5GA 4TU8A 4ECTA 1GXLA 3H0PA 1OS5A 2EK1A 4YQWA 3QZ7A 1TKDA 4NYZA 3G9CA 1S7IA 3M2UA 2DVIA 1PYTA 2B7BB 2B56A 4PEOA 4A48A 4LR7A 1FJGF 4H4KA 1APSA 1KLMA 4N5SA 2ZEJA 4MKYA 4EYIB 2R8KA 1VS3A 1IKXA 2N7CA 2QFIA 3M8WA 4ILMA 3M6WA 2RF2A 1UA1A 4Y6IA 2GO9A 2HRTA 4K50A 2BYCA 5M2RA 1YRTA 1GMWD 1ZOTA 1G3OA 3JSBA 1SUQA 4ERDA 4G1IA 3M8RA 1P1TA 4USIA 3ENAA 2A0FB 4F3OA 2B3TB 3D0GE 3UCGA 3EDQB 1J27A 7FDRA 1RAFB 1LWCA 2C2OB 3BPDA 1N32F 1FRHA 4NLRA 5KT2A 3RRKA 4WU3A 2VJUA 1T9TA 3RYLA 1VC6A 1RA7A 2KFYA 2DY1A 1M0SA 1TUWA 2PMZD 4Y3CA 1JLEA 2CNOB 2GQCA 2QRRA 5KFCA 2VBZA 2Z2LA 4ED0A 3M6VA 3UVJA 4WF9Q 3R5BA 4O4GB 4P2MA 2X1AA 1F2GA 1ZAVA 1D3WA 1IN0A 3HMJG 3FEZA 1ZM4A 1FF2A 4NPOA 2LCWA 2LECA 1BE4A 3Q8YA 4AYBD 2DXDA 3DLGA 2LU2A 2B4VA 2Q79A 1YI2S 2GMLA 4RUBA 4DLEA 1N4LA 5DG8A 3C2PA 2A6OA 4ICLA 3BGUA 2E9ZA 2Q43A 5ETRA 5KFKA 1G1XA 2DPIA 3FZBA 3KNAA 1WDDA 3FSXA 1WJ9A 2WRMA 3TJ8A 1R8PA 2OTJS 2J7KA 4DPWA 2G0JA 2M8HA 3TAPA 2AJ2A 4LBIA 3AODA 3CJTA 4KV8B 4O3QA 2K3KA 2XLJA 3D3CJ 3HHLC 3B6BA 3DGPA 1Q78A 1DFDA 3AT1B 4XTTA 5C42A 5ETSA 3CUNA 3B54A 1V9OA 3KLHA 3QIDA 2VG7B 3KLFA 1C4CA 3ISND 4J9NA 3Q8VA 2XSJB 3GR1A 2HK2A 2FHJA 4U95A 1KOHA 2Q3PA 4X65J 2FD2A 1TL4A 4I1TA 5KFAA 4DSKA 2F3JA 3ILOA 1MN7A 1XEZA 3V4IB 2DK2A 2DR7A 4P2XA 4X62J 1HYSB 4B3MJ 1VQ8S 2V63A 4IH7A 5A8RB 5A8KB 1TV6A 5HP1B 2RUGA 2KZZA 3R5JB 2GNKA 2BRLA 3MEKA 1REVA 1UPMB 5KFOA 3QJLA 2ALZA 1VBXA 3CCRS 2AYMA 2DHAA 4FN5A 2BDPA 3RGIA 2Z58B 2BUNA 3QO9B 5AE2A 1SQEA 1YJ7A 8RUCA 4R5PA 3SQGB 1QSSA 1HBOA 1I3OB 2DKOB 4P52A 4LFBF 1U02A 3PYEA 3ZZUA 5H9EK 3B8HA 3Q8RB 2HHHJ 2V6AA 2OLWA 4C98A 1LWFA 2YQ3A 5D78A 1RBAA 3H59A 4WFXA 4TY9A 2ZKUA 2CQIA 4DQSA 1VJWA 4DV4F 2B8QA 4KFBA 1PILA 2CNKB 5FIIA 3PW5A 2J0WA 4RBVA 3GFZA 2J6SA 1WELA 2DHGA 4ITSA 3BGRA 1ZTTA 3HHNB 1GXUA 3IN5A 3OTDA 1F9EB 1VBYA 2AJ4A 2NQPA 4DF8A 3PX6A 1PJ6A 4P72A 3NS6A 3R97A 2VPZB 2BANA 3NCQA 2KH9A 3TANA 2DPJA 5KFLA 4ZLLA 4JI4F 4DFKA 4BHQA 2DBBA 3CJ8A 3QBCA 3R5AA 3J7ZT 3IR6B 4GVBB 3ILLA 3S6EA 4AD6A 2DH8A 3GIJA 4EK2A 5KG2A 1PSDA 4ZLNA 4PG7A 4C11B 5E0OA 1IBKJ 1H3DA 4DL5A 4LF5F 3PR4A 1S0OA 1HPZB 2IBOA 4ID5A 4LQ9A 1UW4A 3SXLA 3T5KA 4PQUB 1U25A 1HWIA 1OMSA 2B9WA 3CDEA 1OY9A 1RB0A 3VGSA 2IC3B 4DV2J 4FXVA 3GFYA 1RT4A 1SJ1A 2YNHB 4H4MB 4EWTA 5ITHA 5L1KA 2E5GA 3PG9A 5DRKA 2FVRA 2DRDA 3AOAA 1ULRA 4X62F 3C8YA 2NXJA 5F8NA 2RQ4A 2YKPA 4WFNQ 3OL7A 2QT7A 3VAMA 4Q8FA 3W64A 2HGMA 4OJHA 4ZN3A 3I82A 1SI9A 2CQ3A 1QSYA 2F7VA 3OTCA 2AZ1A 5BR8J 2UVRA 4PQAA 3HSJA 4ENOA 1S6QA 1RT2B 5C2GA 1YBUA 3BN4A 3RBEA 2XB2D 1WDTA 4O0IA 1XMQJ 2GQQA 2HHHF 2KI2A 4K0KF 4ZKAA 1FWKA 1PAUB 4DFMA 1QAXA 1RTZA 1NDCA 2Y8WA 2QEXS 1HNWF 2O5DA 3H2LA 1XMBA 4M5LA 2XHWA 4NMXA 2ADCA 1H38A 3CTRA 4K8RA 3T1HJ 2IDLA 2K7KA 1VK8A 1HQUA 1N36J 3CO0P 2BJ8A 3TNVA 3LA0A 2DCUB 1RJJA 4DEZA 1U2CA 1VLYA 4RW4B 1OY8A 5CH7B 1S77D 3AQOA 4LF6F 1P9QC 4NE9C 1DRZA 3U1LA 2K2PA 2YWWA 3MMAA 4GRSA 1U4BA 4FYXB 1VQLS 1U6ZA 3QLHA 4MK8A 2OKQA 5GAGI 5AE1A 2F9JA 1IBKF 3OFGA 4OHYA 5L8RC 4WXOA 5J2MB 2PD1A 4J7CA 1AA1B 3PW2A 4IR9A 4KY3A 3K5NA 1Z2LA 3SDEA 4K4ZA 3JAMU 2MHEA 2DGUA 3KXDA 2RB7A 1RT3A 4DV2F 5HQLA 3R1HA 3FK4A 4ZHRB 1YBAA 4FBTA 4DL2A 2FJEB 4CLFA 5L1LA 2O66A 1EETB 3NCRA 5DQHA 4F4WA 1FJ7A 4ED8A 2JEJA 3S1TA 1SJQA 4WIIA 2JC0A 3T6JA 1JWWA 1HWKA 4AL6A 2XG8A 2E7XA 2IA0A 1NZ8A 3QAEA 1L3UA 1U47A 2LP4A 5ADZA 4IFYA 4DR2J 4IOAQ 2EC2A 2YPZA 2E29A 1IQZA 3V4MA 3BM7A 3J81U 5A0YB 1FXRA 5B7WA 1B64A 3D1OA 4NRTA 3FFIA 4N76A 3C19A 3LPEA 2UV8A 3H90A 2R4FA 3PIPQ 1FRXA 3A4TA 2J0XA 2XI2A 3ZZYA 1U09A 3MR5A 3TX8A 1FKOA 1RADB 1F1BB 2FZCB 5T7LB 1JJ2R 2RJZA 1VGYA 2Q6CA 3LO3A 4FPIA 2VA2A 2AYEA 4QWDA 4URSA 3WZ0A 2KG1A 1TVRA 4R0JA 4KGKA 1K73T 3MEDB 8ATCB 4NA3A 2ACMA 5EWFA 4IFVB 4WK1A 3DHXA 3UD5A 4W90B 4B08A 2OPPB 2E1RA 4RBUA 3MPWA 3C6TB 4TYAA 4JV0A 1CQMA 3EMTA 1XNRF 2VFVA 3MECA 4FS2A 2HHSA 3SCLE 3PEHA 4LSZB 4YEAA 5AXNA 1JX4A 2W2OP 3CO9A 4LF8F 4OQJA 5T41A 3OL6A 3RBXA 3MM7B 4X4UA 4UTGA 5KT4A 5LXRA 4YB7A 4KGMA 4OZ0A 5EX3A 3PDNA 2BW7A 2B4OA 2YQ0A 2YNGA 3LUYA 1WNEA 1PC5A 1S72S 3CJ5A 2RILA 2ZH7A 3ZZOA 1IR0A 2CPZA 4USUA 1U1OA 3PRBA 1U1LA 5KFIA 4EUVA 1EIYB 2OTLS 2CIMA 3BDEA 4KYZA 2ZZNA 1RWXB 3R1LA 4CWBA 1ZM3A 3K8WA 1DURA 4E8UA 2CJYB 2GAHC 3FCVA 3PW7A 3UN2A 2XCPA 3QZ8A 1HMVB 2B5JA 3QT5A 1UEKA 4DQIA 3N5BA 4DMZA 3OFEA 4Z7YA 3NG8A 2W2MP 2YNFA 1RAJA 2XY7A 2DNKA 3RB3A 1LW0B 3JSMA 3P49B 5J2QB 3LWMA 3R8YA 5EDWA 1FNOA 4OZ3A 2DEJA 4OYBA 2MZTA 5HLFB 1TKTA 2JEIA 1RWNB 2YKQA 4XDCA 4PG6A 5F0UA 3G4SS 3MM9A 4I6AA 3E51A 1HQ2A 2XYPB 4TU9A 3FBCA 1EJ7L 1F0XA 3NY0A 3FJ2A 1X5PA 2D7SA 1RT1B 1URNA 2MKCA 4YR0A 2ZDPA 5IV4A 1NSQA 3ELHA 4C8YA 2EWHA 2D3O1 4ED4A 5CYQA 4LSLA 2DNYA 3SQOP 3HZEA 3T9ZA 1S6PB 5CYMA 4LRFA 3DDIA 3X1LB 1KONA 3OJUA 2JOQA 5KFJA 5B09A 1IKVA 2EW9A 2MZ1A 1U6FA 1ZAXA 1U1KA 2PEBA 3TR5A 2HQIA 4B17A 2CQCA 1VLOA 2GJ2A 2B8PA 4NYOA 4ZS6A 3R2CJ 3BGFA 3D9BA 2RVJA 4JUZA 1NK5A 2YWKA 1NJIT 2CPXA 3T5HA 2HSEB 2PT0A 4MYUA 2FZKB 4RUCA 3IWLA 2DR8A 4YDDB 4Z2XA 4G1PA 2CXEA 5DQIA 1WKKA 4PPDA 5CYJA 2ZH1A 2VONA 2BKNA 4JI1F 4CT8A 1NK9A 4EYHB 4DR7F 4ZVGA 2W4PA 4NLGA 3D6MB 2IJNA 3MMBA 1ZA2B 2ASJA 2K7JA 1FVSA 4UZCA 4IH5A 1CJUB 4NRUA 2E5LF 3W62A 1I6JA 1CG2A 5GMDA 5CCLA 3K57A 5J2PB 2VG6A 3RAQA 2NYHA 3G71S 2LVWA 4UZBA 1Y0HA 4UOHA 2VOOA 4F4KA 2RD5C 1Z1ZA 1LK7A 5CD4H 1ZM9A 1N5QA 1P6TA 2RQMA 3LP1B 1L3KA 4J9QA 2MJUA 1WEZA 2AIRB 5JMNA 4WXWA 2HMIA 1RT7A 2RT3A 3HVRA 1Q8KA 2EFGA 2M9KA 4G1QA 3HSZA 1XBWA 1S1UA 1S9GA 2EK6A 4CNYA 2IVMA 3I0SA 4K59A 1WEYA 4Z37A 2VV5A 4KHRA 2I5JB 2H54B 2DHXA 5FLXY 1S12A 4WFAQ 3T3FA 1XWLA 3CF5Q 5HJYA 3BSOA 4OYZA 1QVFR 1TL1A 2BJ7A 4M5KA 2IVYA 4J37A 2HYIB 3LP0B 3DM2B 4A8XA 3M6XA 1VHIA 2DTJA 3TW0A 3LGHA 3NNAA 4WFZA 2Q1LA 3M8PA 1VQKS 3UQSA 3AQPA 5LM7E 4HVZA 4F4YA 2LQBA 2I9SA 2WVDA 4AFFA 1FFWB 2C3PA 3M8QA 4F26A 1OSCA 1S4EA 1CC7A 2ZJPQ 5KOWA 2KM8B 2XMKA 3SFUA 3MPVA 2WVBA 3BGLA 3A3NB 2HHTA 3AA9A 1LW2B 2J9EA 4ZVPB 5JVGQ 4F4AA 3HDSA 3J7Z5 1LWEB 2ZUGA 2BR0A 4OYXA 6FD1A 4ZVFA 4ANDA 2W4DA 4DUZF 2ZE2B 1W2IA 2GAGC 4DUYJ 1T11A 2E5HA 1NHKL 3CJ2A 1TL3B 1S9EB 2B4PA 2UU9F 3O5TB 1R89A 3P3DA 2FJBB 1JKHB 3CC2S 2EFOA 1GEHA 2UP1A 1BQNB 4Y00A 4C0HA 4DV1F 1I94F 3M32A 3VR1A 3EPGA 2CQ1A 5I3QA 4A8FA 4DPYA 3NGUA 3ENVA 4RW9A 2KO1A 3Q8PB 3Q8QB 4OZLA 4H4KC 3TAQA 4CLUA 3QJPA 3L3CA 3WDOA 1FRJA 3Q23A 1HLWA 2F63A 4HHJA 1IKYA 2L48A 2ZDOA 1DY3A 4KR0B 4KGZB 3UNYA 2OH2A 3H5YA 2NUHA 3CCZA 2LQJA 2CQGA 1WI8A 2V4JA 5A6WA 5IS2A 1EKSA 3TA2A 2D9OA 3DLEB 2CQHA 3C6UA 2BKOA 1T03A 1CC8A 1UJ4A 3KUHA 1QAIA 4K2JA 2A3JA 3G6VA 4DPXA 2D3UA 1I5OB 3TQ1A 2GC8A 2YNIB 1SC4B 1NK8A 2XBPA 3CIZA 1DTTA 1YX2A 2M3DA 2JFKA 2WONA 1FDNA 3PO4A 3I6PA 1D8YA 4LRAA 3CJQA 1KC8T 1A0OB 5D0GA 2W2PP 5L1IA 2APOA 2BJEA 5DDPC 2WBRA 1N0VC 1GH8A 4UY8T 2UVWA 4RW8A 3OTOJ 4DV5J 1VQ6S 4DI6A 2HHXA 4CM2A 1XR5A 1YITS 5FDLA 3JYTB 1RT6A 4YS2A 4KO0A 1NO8A 4PR6A 4QPXA 1FFSB 4X4OA 1D09B 4ES1A 4QYRA 2FY1A 3ZFVA 3OR1B 4DR3J 2HHVA 1SJ4P 1JXVA 2OPRA 1PG5B 2QE5A 5ETNA 4ILLA 4DUYF 5B0CA 4K4TA 3G82B 4IQXA 1FX4A 4HLBA 2HIYA 2M2BA 1NSAA 3GJTB 1R6VA 3DMJA 1C0UA 3C66A 4OI3A 4I6YA 4D3HA 3T5LA 2DNMA 4XAKA 1REGX 2DHHA 3AD7C 4F0MA 2FJAB 1B70B 1EAYC 2W7PA 4HH0A 3D66A 5GMKa 5IQ6A 1SKRA 3DOLB 2XMJA 2C2NA 4DX6A 2CQ0A 5E3QA 4HTIA 1BC6A 1CS4A 1HBNB 4E98A 4KIAA 1GX5A 3K59A 1K44A 4CTAB 3BPSP 2VBWA 1B99A 5D6GA 5GAHI 2WVCA 3NOCA 2GMJA 3D1QA 1VIXA 3M1VA 2OEMA 2WW8A 1Q82T 4L76A 1HQEA 1BWEA 2XMMA 3OSPA 1YJTA 1RBOB 1WC1A 2VF3A 4YB1P 2ZBCA 1F5CA 1VRTB 5FJ4A 1U1QA 1Y4ZB 3MM5A 1IR2A 4FYWB 2ZM6J 1UCNA 2P9EA 2ZVIA 5KFVA 4NLQA 2M52A 3OR2A 2BQRA 5DDQC 2QLBB 3IS9B 4ZPDA 4M5MA 2GJIA 1PYOB 1T3NA 1S57A 3WC2A 2BW2A 5HMYA 2PSZA 4PPZA 1ZTWA 3DRRA 3NCPA 4X66F 1RI7A 1SBRA 5EX0A 2HNDA 2PEHA 3VVUA 1NJYA 2GHVC 2YWFA 3QFHA 1XC9A 4PXBA 3D6TB 4NEYA 1S1TA 3R7SB 1RHQB 3MAAA 3QT6A 4NLXA 3QRPA 1D0EA 3CCMS 3GV7B 3MZIA 4YFUA 1OSDA 4F50A 2QSWA 3HT3A 3ISZA 4C8NA 4IR1A 2DGWA 3WQPA 3QSYB 4K4SA 2E5IA 4TKTA 1YBTA 5HATA 3KK2A 4DG1B 2CKWA 1H72C 4M5HA 1WHWA 3HHLA 1FEHA 4FKXA 1X4GA 1HHTP 4PZVA 2PN6A 2AEMA 2MZJA 2UUCF 2EFNA 1OPZA 3BR8A 1EB0A 1Q8BA 4A8MP 2XS5A 1B7YB 4Y28C 2A2CA 4O44A 3PM9A 2PIIA 4M95A 5F9LA 2ZH9A 3VZHA 3CCUS 1HNVB 2DB1A 3ENQA 3X3UA 3DLKA 2RAQA 3MURP 1VISA 1R6YA 1O5JA 3UO0A 4WP8A 1KLMB 1U45A 1WTBA 2HFZA 4C0OC 1U24A 4OZ1A 2YVSA 2MKHA 4E2FB 3FSYA 5A2QU 1YTYA 3TUIC 4ANEA 1QTMA 3DRSB 3R7NB 1VBZA 2O3DA 2MZRA 3KLVA 1F2HA 4NLVA 2XGPA 2BKPA 3K0JA 1MMLA 4DQPA 3UFCX 4AT1B 1KTVA 4DS4A 4QR1A 3NLCA 1JQGA 2K3IA 4LF1A 4IQMA 2MKIA 2ALYB 4WE1B 3CDBA 3I5CA 4WZQA 1A6LA 5F8JA 1X4FA 2ZM6F 2CWXA 2W9BA 4JV5J 2N7YA 2IRUA 1HNZF 1QDUB 5LSOA 4RWWA 4MTPA 1N6QA 2MGZB 1J5EF 4F02A 2DGOA 3NMRA 3TJAA 2HQGA 2QL9B 2WVEA 4CO1A 1UJ5A 1WTFA 1G7CB 1EQMA 3FMBA 5L9NA 1TKXB 4QW9A 5IT9U 2NSBA 4F7VA 4CQ1A 1FRIA 4ZP8A 3BO4A 4ELVA 1N5YA 5FD1A 1C1BA 3IR7B 3M2RB 4MKAA 4MYTA 4H4OA 1UVNA 4C3MA 3CJ4A 2V94A 2OPSA 4NZ7A 3DLLQ 4DR5F 3OVBA 2DJWA 2M7SA 4OJ1A 5KG4A 3MFIA 2UVVA 3IMQJ 3UNGC 4UT4A 1Q81T 1V5IB 4Y2AA 2IAJA 3GTYX 1BD6A 1SJFA 2GVZA 3LW5C 4KHPF 1VC0A 3DI6A 2DRBA 2DIVA 5F8LA 2OHDA 4ER8A 4OX9J 3MMCA 2V69A 3KFWX 2R7TA 2DD8S 3OLAA 4NA2A 3P96A 1R3NA 4AL5A 3VGVA 2B9YA 3EGZA 3AJ1A 2W7AA 4DV3J 1YGYA 2CFXA 1VR6A 1ZH5A 1WC4A 1UJ6A 1PBUA 4LQ3A 3C14A 2AQ4A 2IVFB 3SSQA 3K7RA 4DR4J 2WOMB 1LK5A 3GILA 4OMFG 1FT8A 4J9VA 3IGNA 3TA1A 2YKMB 5F8HA
chains in the Genus database with same CATH topology
3A3NB 2ZWPA 4YN3B 2Z57B 2W2QP 3A3OB 4NMXA 2Z56B 2W2NP 3VHQA 4OV6A 3AFGA 2W2OP 2E1PA 1R6VA 3QFHA 3WHIA 2W2MP 3CNQP 4K8RA 2ZWOA 2QTWA 3SQOP 3GCWP 2W2PP 3GCXP 1ITPA 1V5IB 2Z2YB 3WIVA 3T41A 4NE9C 2PMWA 3WIUA 3BPSP 3P5BP 2Z58B 2Z2ZA 3A3PB 3CO0P 2XTJP 4JP8A 3H42A 2Z30B 3BGOP 1SCJB 3VV2B 1SPBP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3N B;  2ZWP A;  4YN3 B;  2Z57 B;  2W2Q P;  3A3O B;  4NMX A;  2Z56 B;  2W2N P;  3VHQ A;  4OV6 A;  3AFG A;  2W2O P;  2E1P A;  1R6V A;  3QFH A;  3WHI A;  2W2M P;  3CNQ P;  4K8R A;  2ZWO A;  2QTW A;  3SQO P;  3GCW P;  2W2P P;  3GCX P;  1ITP A;  1V5I B;  2Z2Y B;  3WIV A;  3T41 A;  4NE9 C;  2PMW A;  3WIU A;  3BPS P;  3P5B P;  2Z58 B;  2Z2Z A;  3A3P B;  3CO0 P;  2XTJ P;  4JP8 A;  3H42 A;  2Z30 B;  3BGO P;  1SCJ B;  3VV2 B;  1SPB P; 
#chains in the Genus database with same CATH topology
 1YWX A;  3BBF A;  3OVA A;  5L1J A;  1AW0 A;  4KQZ A;  4CLK A;  4R8U B;  1WHY A;  3CUL A;  4OX6 A;  2PC6 A;  5C24 B;  4RU2 A;  3ET6 A;  1VYA A;  1LEO A;  2HHQ A;  3UR0 A;  5B0F A;  2QMX A;  4B9M A;  2BOA A;  1AFJ A;  1RTI B;  3MR6 A;  1FD8 A;  3S8S A;  3SSR A;  2CPH A;  3QYY A;  1X7V A;  2HG4 A;  1N34 J;  3SMZ A;  4B9S A;  4CLT A;  4KSE B;  4LRC A;  4MK7 A;  1MU2 A;  4QJV A;  5G0R A;  3W5Y A;  5KFQ A;  4DR1 J;  3HT0 A;  5K14 B;  2QYG A;  1MN9 A;  4GKJ J;  3SV3 A;  5DM6 Q;  2BJ3 A;  5GME A;  3V6D B;  1IBM F;  4LIR A;  5KTQ A;  2J8A A;  3A1Y G;  2F4V J;  2ZNY A;  2B7C B;  2GGP B;  5J1E B;  2HK3 A;  2HHU A;  1NK7 A;  2B9X A;  1S9F A;  4JI3 F;  4Y0F A;  1DLO B;  3GSD A;  2FTR A;  4KT0 C;  4CLP A;  3QGP A;  4KBI A;  2XHC A;  2X1G A;  3JB9 k;  3SI8 A;  3OD2 A;  1JNZ B;  4I7F B;  3GE9 A;  3TX0 A;  3KK1 B;  4O3O A;  1I1G A;  3ITH A;  2BAN B;  3V2U C;  3VGT A;  3HLU A;  1JLA A;  2VC1 A;  3TOQ A;  3Q2S C;  2MKK A;  4B3S J;  5C25 B;  2VUG A;  1NHU A;  1FXD A;  1Y3J A;  3MAH A;  5THW A;  3U7J A;  2LXU A;  4IDK B;  4QYZ J;  2IMW P;  2YKA A;  2YPY A;  3VZI A;  3CCQ S;  4ELU A;  5D77 A;  4NML A;  2QLJ B;  3K5M A;  3N28 A;  3D1H A;  2CAD A;  5DM7 Q;  1WOR A;  4DV3 F;  4PWD B;  4ZVE A;  4RLE A;  3JAM Y;  2VIC A;  4LF4 J;  2HFV A;  3G8S A;  3L7P A;  1HNI B;  2XTJ P;  3MAQ A;  1X31 C;  2A18 A;  4TYB A;  4ES2 A;  1WWH A;  2XMW A;  4M5D B;  3MUM P;  4DL3 A;  4UUX A;  3DRP B;  1WSR A;  4F04 B;  4I56 A;  3KNG A;  3OHA A;  3ZTR A;  3H5U A;  4IG0 B;  2VA3 A;  2IRY A;  2OEL A;  2OSR A;  3TQE A;  1NH8 A;  2V2V A;  3BYR A;  1NB7 A;  3G87 A;  4CI0 B;  4HAC B;  1LV5 A;  2W4C A;  4ETZ A;  2JJ4 D;  1BUX A;  1QUP A;  5E2Q A;  4JI0 F;  3NWR A;  4Q5V A;  1XNQ J;  1TL7 B;  3KHG A;  1P8G A;  3OBI A;  4P2S A;  1Q1K A;  1CVJ A;  2P2C B;  3J81 Y;  4MFB B;  1FE4 A;  3VAI A;  4FVC A;  1X4D A;  3K58 A;  2C3Y A;  4F0H A;  4USK A;  5CA5 A;  1RQ0 A;  4ECR A;  2F4V F;  3WIU A;  3NBP B;  1UFL A;  1AB8 A;  2W01 A;  1Q79 A;  3PY8 A;  3OVS A;  2F9D A;  1Q5V A;  1T0T V;  3CWJ A;  4UOG A;  4RO0 A;  4ECV A;  4J9M A;  4UY8 5;  1UEU A;  1FKP B;  4O4G A;  1LFW A;  5A8W B;  2KRR A;  4LRD A;  1S99 A;  4IG3 B;  3W60 A;  2DR5 A;  2DIT A;  1YG0 A;  2JH3 A;  4I6W A;  4B3S F;  3N9U C;  1TK5 A;  2W24 A;  4C0B A;  2M4M A;  2MLX A;  4JP8 A;  2DGX A;  1N5S A;  3DFE A;  5HVF A;  5C2C A;  2KXN B;  4HEA 9;  4HH1 A;  2CJA A;  4C8M A;  1OQ6 A;  5B0G A;  2VFU A;  3SCJ E;  4YY3 J;  2KL8 A;  3MCO A;  1PJ7 A;  3RBD A;  3B82 A;  4U7U K;  4WU2 A;  2GVD B;  3I31 A;  4FS1 A;  1VK3 A;  1IBL J;  5KFU A;  3W8P A;  3MM6 B;  1K1S A;  1SL2 A;  4BWJ A;  3UW1 A;  3ZZ0 A;  4KV8 A;  4AE5 A;  2UXB J;  3QNW B;  1H2V Z;  4B3O B;  2D69 A;  1IM6 A;  1RKI A;  3BRE A;  3MPD A;  4I2Q B;  2LYV A;  1F6T A;  3PKM A;  3TEG A;  3TP2 A;  1O51 A;  2MDA A;  3H4D A;  2R8J A;  2AP6 A;  4RW7 B;  3RRG A;  1URR A;  1E6Y B;  4UQT A;  2VG7 A;  1CUL B;  2MXY A;  1S6O A;  2M8D B;  2CJK A;  1M1H A;  4X4R A;  4J90 A;  2MZS A;  2HNZ B;  5LT5 A;  1FD2 A;  4ECS A;  1QLN A;  1VQM S;  3CD5 A;  2HLU A;  3V4I A;  4LMZ A;  4FBU A;  3KLG B;  1X9W A;  1R43 A;  2W1B A;  2MY8 A;  1HYS A;  2KT3 A;  2HZV A;  1SC6 A;  3BZQ A;  5A8R A;  4LR8 A;  5A8K A;  4LVN P;  5HP1 A;  4CCH A;  3UN5 A;  1FKO B;  2EC0 A;  3VHQ A;  3VCD A;  4JI2 J;  3IAS 9;  2OJ3 A;  3UDL A;  1VIO A;  4EGL A;  1S4F A;  1TVR B;  3QIP B;  4A8K A;  3N0V A;  2HS3 A;  3QO9 A;  1BQM B;  4DV6 F;  1WSV A;  2CNN B;  3SQG A;  4NAS A;  4L72 B;  2E1P A;  2LQ9 A;  1RAG B;  1HI0 P;  3IR5 B;  1PCA A;  1X8D A;  1JXL A;  4LFA J;  1HR0 J;  1YRU A;  3DOM B;  2KVQ E;  4WP3 A;  5DET A;  2B4U A;  1Y9O A;  1EP4 B;  3MEC B;  1S97 A;  1HW9 A;  1NH7 A;  3WBZ A;  1VHF A;  5DQG A;  4MIA A;  2GIF A;  1MW7 A;  3V6K A;  1YJN S;  3MDF A;  1FVQ A;  2O1P A;  4PXD A;  2NYI A;  3I32 A;  2XI3 A;  2R9L A;  5L46 A;  2HVI A;  4K4U A;  3EZU A;  4Q2L A;  4DLG A;  1NEE A;  2R7W A;  4HYK A;  2VOD A;  2FDN A;  4GVB A;  4ZCM A;  5DLG A;  2PFF B;  3OXG A;  3W9H A;  5DG9 A;  4JI7 J;  2HUR A;  4NCG B;  2MJN A;  5IT0 A;  4C11 A;  4LRB A;  1HPZ A;  1LOU A;  4A4J A;  1YZ7 A;  4PCQ A;  2I6W A;  5CZX A;  2OUG A;  3GJQ B;  2J0S D;  4PQU A;  2AW0 A;  3QAT A;  2NXC A;  1VQP S;  1S7H A;  1GNK A;  3HO1 A;  1FJG J;  3BN7 A;  4ZPW R;  1O0P A;  3QRR A;  2BRK A;  2IC3 A;  4TLQ A;  1ZBT A;  1VJQ A;  1JJH A;  3PXG a;  1AXQ A;  2Q66 A;  3GYX B;  2YNH A;  1VRU B;  4H4M A;  5H9F J;  4HT7 A;  5KFH A;  2UXC F;  2MEW A;  2OO4 A;  1N88 A;  4ZPT R;  3AXM A;  5DGA A;  5D3G B;  5JVH Q;  5KFD A;  2Z4P A;  2LA6 A;  2QJ3 A;  2W7O A;  1JLB B;  4PG4 A;  1DQ9 A;  2NR0 A;  3QAU A;  4ZPA A;  4NX9 A;  3HVW A;  3VAF A;  3D3B J;  4DN9 A;  2FLL A;  4USJ C;  4JI6 J;  3DLJ A;  4DL4 A;  4QWC A;  1N32 J;  1NUE A;  3GCW P;  3LGM A;  5CQG A;  2HRY A;  1VQ9 S;  1CPZ A;  1UFK A;  1RT2 A;  2MB0 B;  4JV1 A;  1RT5 B;  1S48 A;  4P73 A;  4KRW A;  5HAO A;  4HI1 A;  3W9J A;  4MKB A;  3CJR A;  1X5T A;  2M88 A;  5SUH A;  3DNC A;  3PKY A;  1LXJ A;  1X4A A;  4K5S A;  4Q45 A;  3GV8 B;  4RNN A;  2WAQ D;  5HBM B;  2Z0G A;  3VAK A;  1A7G E;  1WG4 A;  2H5I B;  3M9M B;  4A8W A;  2IM0 A;  4WPA A;  2G9O A;  3OTB A;  3ZZR A;  2FJW A;  2GHW A;  2A6M A;  2FC8 A;  4QCL A;  4DL6 A;  2XO6 A;  2VQF F;  5HN0 A;  1SXL A;  1C2P A;  4PXC A;  3NS7 B;  1DHM A;  3VWS A;  2YXL A;  4GO5 X;  2PI4 A;  3W5X A;  1KEK A;  5DS7 A;  1X4H A;  2AF6 A;  3UDE A;  3K2Y A;  4RW4 A;  5CXT A;  3POT B;  1QY7 A;  3AD8 C;  4FVM A;  4FF2 A;  5D0R A;  2E5J A;  2CNL B;  5SZT A;  2FLO A;  3W3S A;  5I4M A;  2EFQ A;  2WSF C;  3I0R B;  1WKJ A;  3MD1 A;  4RBT A;  2XS7 A;  3AA8 A;  4FF3 A;  5LJ3 Y;  2EKY A;  3U1N A;  4J9P A;  1E6V B;  3MPU B;  4JBC A;  4LR9 A;  1SVD A;  3IM9 A;  3GQC A;  4Q0B B;  4ED1 A;  5J2M A;  5LJ5 Y;  3DGV A;  3KLI B;  4X64 F;  1KP6 A;  4LF9 J;  2FJD B;  3ISN C;  4N8N A;  4A8S A;  2OEK A;  2R7Q A;  1TEL A;  1H0H B;  1B7F A;  2JLG A;  1Y5L B;  3W5Z A;  4IOC Q;  3VAH A;  4ZHR A;  5CCM A;  2HBZ B;  1RYR A;  2IA6 A;  2VB6 A;  4OYW A;  2IRX A;  3TAR A;  1EQ0 A;  3I55 S;  1HHQ A;  4RJV A;  1EET A;  3QT7 A;  3GCX P;  1U7L A;  2AJQ A;  3R9L A;  4USV A;  2Y1L B;  2BE7 D;  5K9F A;  2ZH4 A;  1UVM A;  2VPY B;  3KK3 B;  1MWQ A;  1VC5 A;  4IUF A;  2HGL A;  1EAR A;  2DT9 A;  2FHM A;  4OX8 A;  2C3O A;  3BF4 A;  5KG1 A;  4JI6 F;  3JSR A;  4MKV A;  3KHL A;  4B9T A;  1NBE B;  1XQI A;  3MM8 B;  1ZZF A;  2HKE A;  3FCW A;  3BQ0 A;  3EM1 A;  2BJ1 A;  3PVX A;  2MKS A;  2CDQ A;  5IM0 B;  4DSJ A;  5A0Y A;  3L9Z A;  3KJF B;  3ADA C;  2K1R B;  2CA9 A;  2C3M A;  3D4J A;  4UST A;  2HWT A;  2KT2 A;  2FHJ D;  2FY8 A;  3PIO Q;  3BS9 A;  2QO3 A;  4M8L A;  1B0P A;  1UWB B;  1YRX A;  2EI5 A;  5T7L A;  4ZIV A;  3M9N B;  4RWX A;  1FRK A;  3N4W A;  3HJV A;  4LFB J;  3RG6 A;  1LQ9 A;  2BE2 B;  2DHS A;  4J9K A;  2PGC A;  2ROP A;  2DNO A;  5H9E J;  1TZ0 A;  4N56 A;  3ETM A;  2HHP A;  2AHO B;  1JJ4 A;  3MED A;  3RBZ A;  1ITP A;  1BHN A;  1YZ6 A;  2MPU A;  2GCF A;  1VQ4 S;  4IFV A;  4DX7 A;  4CO3 A;  3T9N A;  4DV4 J;  3IBC B;  1NU4 A;  1C1C B;  4EMD A;  2KDO A;  4O0N A;  2OD6 A;  4AXJ A;  1UW9 A;  5ETT A;  2OPP A;  4B3T J;  4ZPC A;  1RWO B;  1H98 A;  3C6T A;  1NB2 A;  2NRE A;  1MG7 A;  2U2F A;  4JB8 B;  4PKD B;  1Y5I B;  2HEK A;  1M1G A;  3NP5 A;  2OIH A;  4JI4 J;  1NKC A;  3DRX A;  1RYS A;  3UD3 P;  5LSR A;  5KFN A;  4LF9 F;  1TFW A;  1VQ5 S;  1Q4R A;  1KQF B;  1GMU A;  2IYI A;  3MM7 A;  4OHZ A;  2HBY B;  4LF5 J;  1AZS A;  3CGI A;  1G6B A;  3JXO A;  1S49 A;  1FI4 A;  4RNM A;  2UUA F;  3CJK B;  1T95 A;  2HW3 A;  3ZO7 A;  1DZ5 A;  2X1F A;  2VFS A;  3DU6 A;  3HFK A;  3SBM A;  3HXM A;  1R27 B;  2CPE A;  1WEX A;  2YY3 A;  2ABY A;  2HZC A;  5F3Z A;  1XJW B;  1S0N A;  4OYM A;  4X4S A;  3I4P A;  1G2E A;  1TMM A;  3KLE B;  4ZDN A;  2L9N A;  1N52 B;  4IKA A;  2XNR A;  3BDP A;  4DV0 J;  5K8P A;  1FK9 B;  2DGQ A;  2LU1 A;  1LW0 A;  2BV3 A;  4OI0 A;  3JQM A;  5J2Q A;  5RUB A;  4DZD A;  1RTD B;  1TTH B;  5HI7 A;  1OQ3 A;  2GHP A;  1RDR A;  3GIM A;  2KHC A;  4ZK7 M;  1YJU A;  2MLY A;  1DBD A;  3VAG A;  3SSS A;  2V68 A;  2ZIT A;  2QL5 B;  1NJX A;  4WFB Q;  1WOP A;  4ZVS B;  2LDY A;  3J7A N;  4ALZ A;  2AEJ A;  1F3F A;  1EHW A;  4KH1 B;  2PFD A;  4AQY F;  4RW6 B;  2IM2 A;  2R2R A;  4K0K J;  1IKW B;  2QZ8 A;  1S5Z A;  3QJJ A;  2J6U A;  4TN2 A;  3DLB A;  1RT1 A;  2CDR B;  1KVI A;  1QE1 B;  4P7V A;  4NI2 B;  5I42 B;  4C2M A;  1HNW J;  4CYU B;  4DSL A;  2NXN A;  2A10 A;  3H8Y A;  2R2U A;  4MIW A;  3T41 A;  5B0A A;  2DGS A;  2QYC A;  3BO2 A;  4LUB A;  4B3T F;  1W7W A;  3US5 A;  2CZ9 A;  2I0X A;  3MMJ A;  2CAJ A;  2AGO A;  4AUK A;  1S6P A;  2CJ9 A;  2C2D A;  4JI8 J;  3TZY A;  4KC5 A;  1R7I A;  2AV5 A;  4Y2K A;  2D3Z A;  3MTJ A;  2AKW B;  1RTH B;  4F36 A;  4USH A;  4LF6 J;  5LOQ A;  5D0E A;  2QV6 A;  3F41 A;  2QLF B;  2LDI A;  2DGV A;  4B9V A;  2ZD1 B;  3VQS A;  2MYF A;  4OZ2 A;  4K4X A;  3J81 j;  5KG3 A;  1CJT B;  5E3A A;  2HLT A;  3GG1 A;  3OPK A;  1R31 A;  1BY9 A;  3DXS X;  3RAX A;  2R2T A;  2AT1 B;  2YKN B;  3SEO A;  2IM3 A;  1C0U B;  3RUB L;  1AT1 B;  2MQN A;  3OL9 A;  3GON A;  4KPY A;  4ID8 A;  4C97 A;  1TMJ A;  2RHQ B;  5BXI A;  2J0Q D;  3R2D J;  3PJW A;  3BSC A;  1FDB A;  3QPI A;  4URQ U;  1N48 A;  3FSI A;  4G6V B;  4ZCK A;  1SJ3 P;  2CPJ A;  1JLQ B;  3OV7 A;  2OI2 A;  4DX8 H;  3BQ1 A;  1JJC B;  3VV2 B;  4QWE A;  1CJU A;  4A8Y A;  1RLC L;  3MCM A;  4XIU A;  3IRX B;  1Q5Y A;  4DV0 F;  3KDN A;  3OUY B;  5J2P A;  5A2Q Y;  3M2V B;  3H2U B;  4IO1 A;  1UL3 A;  3EE3 A;  4C6A A;  3K5O A;  3CDA A;  2F4F A;  2QA1 A;  1EZZ B;  4N8O A;  3RRH A;  3BBC A;  1FTC A;  2KT5 A;  1WOS A;  4F25 A;  2OD4 A;  3W2V B;  2GMH A;  3CCE S;  2VBY A;  3D6F B;  3LP1 A;  3LH2 S;  4K7Q A;  2HQC A;  5EN1 A;  4GMK A;  5CD4 A;  3M4X A;  4DSE A;  4C48 A;  1NSK L;  2BM0 A;  2CZV C;  2GX8 A;  4WYL A;  1S1V B;  3MHY A;  4F3M A;  3FC9 A;  3C16 A;  2F8E X;  2I5J A;  3EVW A;  2IBK A;  1TU0 B;  3IXQ A;  2FYX A;  2Z57 B;  1JXE A;  1YIJ S;  2AYG A;  1J5O B;  1FNX H;  1KHW A;  4FKY A;  2JC1 A;  5D0H A;  2HS0 A;  3JQJ A;  3MPY A;  2AJ0 A;  3DM2 A;  3LP0 A;  5IT9 Y;  4A46 A;  4JI8 F;  2G1H A;  3PX0 A;  3BQ2 A;  3UPF A;  3KG0 A;  4OI1 A;  3HX9 A;  3ZZZ A;  3H2V E;  4TLR A;  2DNL A;  4F3Q A;  1TFY A;  2YBV A;  4TQS A;  1MSW D;  3KYL A;  1KBR A;  4X4Q A;  3PRD A;  1XNR J;  1JB0 C;  3QWP A;  5K20 B;  1NXI A;  1HWJ A;  1AYE A;  3W8G A;  2R8I A;  3HUL A;  2WBM A;  3ZZT A;  5KFW A;  3DOK B;  3HHL B;  3GYG A;  1NJZ A;  1BMQ B;  3P5B P;  4EFA C;  2Y1R I;  3MEG A;  4LF8 J;  4OYP A;  2DEI A;  1S1X B;  2HFO A;  4QYZ K;  1N0U A;  2RE1 A;  1LW2 A;  2DNR A;  3QT8 A;  4N47 A;  4YME A;  1LWE A;  1FE0 A;  4ED3 A;  1QSL A;  4I4B A;  1J2V A;  4NWB A;  2J6T A;  4J91 A;  2E44 A;  1NM2 A;  1GFW B;  2POK A;  2ZE2 A;  1YQH A;  2CQD A;  5D4P A;  2VZ9 A;  1R0A B;  4ZVU B;  5GAD U;  2MMY A;  4MT1 A;  1S9E A;  2VC0 A;  2F8H A;  3EXY A;  2ZZT A;  5IFM A;  4KB7 A;  1U48 A;  1JKH A;  2LFV A;  4DSF A;  1S1W B;  1BQN A;  3MUT P;  2KZM A;  4AXI A;  3PNI A;  4WP9 A;  1HAR A;  4O4R A;  4O23 A;  5KFB A;  1T05 B;  2SXL A;  5ETV A;  1VOM A;  5IQQ A;  1CJV B;  3FNN A;  2BMB A;  1TL5 A;  2B51 A;  2ZBR A;  2RU9 A;  4DR6 J;  2IY5 B;  2VPX B;  2AYB A;  1UMJ A;  3M30 B;  2W9C B;  5DDO C;  5F8G A;  2W9B B;  3W2W B;  4W92 B;  1M5V C;  3L4B C;  1OJ4 A;  4QIW D;  3EZO A;  2ERR A;  2YWG A;  4TY8 B;  1NK6 A;  1WHX A;  4U9R A;  3DLE A;  2Q6B A;  3GJS B;  5HAN A;  1RWV B;  2HNY B;  3Q89 A;  2UUT A;  3NAI A;  1YSJ A;  3PTW A;  1HBM B;  2IFX A;  2F65 A;  3CDU A;  4NLT A;  2YNI A;  4NEZ A;  2HVH A;  3KG4 A;  4PAA A;  2RRB A;  2VBX A;  4NLU A;  1F9H A;  5AXM A;  2MQO A;  1ACM B;  4RNF A;  1WG1 A;  4OIX A;  2VD3 A;  1BQX A;  4GC6 A;  3KDO A;  1FCA A;  3EZ5 A;  4QR2 A;  4B9N A;  1T9V A;  1RA6 A;  3A12 A;  2DNG A;  2AJF E;  1RWM B;  3JYT A;  2BBE A;  2E9T A;  3T1A A;  4I69 A;  2HPU A;  1DJ0 A;  2LEA A;  1F5B A;  3UN3 A;  2KXH A;  4MIB A;  3FQK A;  2ZVS A;  4FXD A;  2W8K A;  3PR5 B;  5D4O A;  3OR1 A;  2N3L A;  4OJG A;  4CNZ A;  3DYA B;  4O3R A;  3R5D A;  4DDF A;  5D15 A;  1DAR A;  4UOF A;  3KJV B;  4USM A;  1S10 A;  1CEZ A;  1SV5 B;  4XPC A;  3G82 A;  5ETL A;  2CPD A;  2MKY A;  2R8H A;  3W66 A;  4S0M A;  4JI1 J;  3NWG A;  3PFO A;  4DU8 A;  3G8Q A;  2ZH5 A;  4DR7 J;  3ULH A;  2PMW A;  3JTN A;  4NXM F;  3EYZ A;  1UFW A;  2AEF A;  2JHE A;  4R25 A;  1U1R A;  4ETX A;  3BBB A;  3MEE A;  2E5L J;  3C15 B;  3DKD A;  5KT5 A;  2V9W A;  2XO7 A;  2XY5 A;  1SH0 A;  3BB5 A;  2LQ5 A;  3TA0 A;  3ILI A;  1PO6 A;  4JI5 F;  3AD9 C;  1IUJ A;  4DR6 F;  1TKZ B;  3W7B A;  1KVK A;  3DOL A;  1HFE L;  3UDV A;  2XS2 A;  1W25 A;  3BYP A;  1YJR A;  4J9L A;  4C3K A;  1HBN A;  5KFP A;  1U8S A;  3VAL A;  5KFE A;  4CTA A;  2HAI A;  3CXC R;  4LVO P;  2LEB A;  1TAQ A;  3DDN A;  2R42 A;  8AT1 B;  5DLF A;  3N6N A;  2R8G A;  2I1R A;  1S0M A;  2HVD A;  1KQK A;  5HRO B;  3ONQ A;  2H3E B;  1F60 B;  2BJ9 A;  5DZ6 A;  3MF5 A;  1MU2 B;  1VRT A;  5G0R B;  2J8S A;  3UD4 P;  2C2Z B;  2VDI A;  3PW0 A;  3JS9 A;  2QMW A;  1DTQ B;  2Z2Y B;  1GTE A;  2LQ8 A;  3THV A;  3RW7 A;  3GMG A;  1TQL A;  4O3N A;  3IG1 B;  4NLP A;  3IS9 A;  3QWU A;  1XIQ A;  3Q83 A;  1HNX F;  2FLN A;  3OJS A;  2DO4 A;  4HTJ A;  5C5J A;  4B3R J;  3THT A;  2XY6 A;  4FF1 A;  3VGU A;  3SZ2 A;  3A3P B;  2XSF A;  3G86 A;  3RR8 A;  3KHH A;  3K5P A;  2CJQ A;  2OPQ B;  2RS2 A;  4DZ6 A;  4CO4 A;  3GWC A;  3CIM A;  3KHR A;  2V2Q A;  2CQ2 A;  4ZP6 A;  2YQ1 A;  3ZXW A;  1GK8 A;  2V8P A;  1Y10 A;  2E1C A;  3CCW A;  2ZBQ A;  4DG1 A;  5CAA A;  5J2N B;  3V6H A;  4KKO B;  4DBQ A;  3FEY B;  5BYR A;  1KR4 A;  2JFD A;  3J7A 1;  3GR0 A;  4DUZ J;  2FVS A;  1CQN A;  1S0V A;  4DCO B;  4WCE Q;  1R8A A;  2CPF A;  1PJ5 A;  4PUO B;  1JK9 B;  3OFF A;  1FX2 A;  2VKZ G;  3M9O B;  1RWW B;  2UU9 J;  3LAN A;  3DU5 A;  3PJX A;  3W1Y C;  1HNV A;  2IPO B;  3AOB A;  4OFZ A;  2ACY A;  2XMA A;  1ZET A;  4DV1 J;  1F9F A;  2OGU A;  1I94 J;  1MWZ A;  2RKI B;  3BJY A;  2COL A;  3H5X A;  1M5O C;  2BQU A;  5H9F K;  4X2B A;  3NKY A;  3D0I E;  3E3X A;  3FBE A;  2DYA A;  2ATL A;  5I3U B;  2V8H A;  2P5V A;  4GC7 A;  1C0T B;  2PA8 D;  3CD6 S;  1FES A;  3DRS A;  1MWY A;  1NSP A;  2G2Y A;  1Q53 A;  2XM3 A;  2YWE A;  4DV7 F;  3TVK A;  2FIU A;  4OV6 A;  4BS2 A;  4NLD A;  1AFI A;  4OHV A;  4OL8 A;  1RP5 A;  3E01 B;  3UWT A;  1M1K T;  3PYD A;  2CJX B;  3V81 B;  1MRO B;  4WE1 A;  4ZPV R;  3L95 X;  2D9P A;  3LP2 B;  1UEV A;  4LF7 J;  1FJC A;  4CDI A;  3OSN A;  2RNE A;  5DJB A;  2IHR 1;  4PYA A;  3HP6 A;  3CD0 A;  2Y8Y A;  4DN0 A;  4FPR A;  4DL0 C;  2P6S A;  1RAE B;  3GFH A;  2MGZ A;  4B3R F;  2E1M C;  4DUT A;  3V6J A;  3E2E A;  1Q86 T;  1HWU A;  2P6T A;  1ZA1 B;  4RNH A;  1NDP A;  3TAM B;  1R8B A;  4L3N A;  2ZHA A;  1TKX A;  3WIV A;  1G4C A;  3MOZ A;  2UZA A;  3ENW A;  2Y3Y A;  2N3O A;  4DWI A;  2CVI A;  2G13 A;  5E33 A;  4LSN B;  4CIO A;  3M2R A;  5AJ3 F;  5DO2 A;  3LTO A;  5HSP A;  1SIZ A;  5L38 A;  2FB0 A;  2I8E A;  4YB6 A;  3BGO P;  2RSQ A;  5G4D A;  1ZPW X;  5IT4 A;  4MH8 A;  1X4B A;  2G1D A;  3BV8 A;  4Q2M A;  4P9S A;  3P6Y C;  3MXH P;  4PWU A;  1I51 B;  2HVE A;  2AU0 A;  5M2P A;  1GT8 A;  1C4A A;  2ZOM A;  2WCX A;  4UOC A;  2HGN A;  1NKB A;  2Y1I A;  4YHH J;  5ETK A;  2PDA A;  3BO3 A;  3FDS A;  3W65 A;  1GMW A;  4QQB A;  2J5A A;  1AUD A;  3FBF A;  3P45 B;  2OMO A;  3G6E S;  1Y00 A;  1OO0 B;  3DC2 A;  2JNJ A;  3D0H E;  2OSQ A;  1UAW A;  3EJM A;  4J9U E;  1W26 A;  3B78 A;  3DN9 A;  3W9I A;  1NK0 A;  2RDI A;  2VQE J;  1JIH A;  4P75 A;  1VDH A;  1UZH A;  3MD3 A;  3MTK A;  4XK8 C;  3EIC A;  2KFZ A;  3RJM B;  7AT1 B;  5IXU A;  2KYZ A;  1N5V A;  2WK4 A;  4QIV A;  2WOM A;  4PG5 A;  1V5V A;  1P9Y A;  5HK4 A;  1FWP A;  2YKM A;  2VPW B;  3CVK A;  4W4M A;  4K4W A;  4KH0 B;  3U1M A;  4R8U A;  1T9U A;  4LF7 F;  4V1A k;  2FVQ A;  3PRV A;  2DRA A;  5C24 A;  4C8Z A;  1V6H A;  1OYD A;  1U8W A;  3PHE A;  3F56 A;  4CO0 A;  5E41 A;  2UVU A;  4FDF A;  1WC0 A;  4DQR A;  3OXL A;  2ZZM A;  3CME S;  2HBR B;  2K06 A;  1RTI A;  2ZJR Q;  2LXF A;  4P2F A;  1SKS A;  3TO8 A;  1D9D A;  3T19 A;  1B3T A;  4QOT A;  4IH6 A;  1MMD A;  3PW4 A;  4A8O A;  3MCS A;  2A2D A;  2KXF A;  1SIW B;  3PV8 A;  1OWX A;  4R0E A;  2DIS A;  4XO0 A;  4U67 Q;  4WBF A;  4X66 J;  5D8H B;  5K14 A;  1U0H B;  3NL0 A;  5KFS A;  2M70 A;  1U2R A;  3V6D A;  4OYA A;  1O6X A;  2RQC A;  2GGP A;  1KSP A;  5J1E A;  3OW2 R;  1NCL A;  2XYH B;  4CRJ A;  3F73 A;  4CLY A;  2C22 A;  1DLO A;  1XER A;  4LBH A;  4EBC A;  3GV5 B;  5IWA J;  2D3O R;  1T02 A;  4I7F A;  3I5B A;  3IAM 9;  4YHH F;  3KK1 A;  3IM8 A;  3M8Z A;  1JLC B;  4DJB A;  2JZ5 A;  5C7P A;  4USW A;  4YN3 B;  3THP A;  3BH7 B;  4JV2 A;  2HIQ A;  5C25 A;  2UUC J;  2OFH X;  3CE8 A;  3HVT B;  1RAA B;  4ZIT A;  1TR0 A;  1OIA A;  4PAB A;  2QMU B;  4IDK A;  2V2Z A;  5U47 A;  3TWZ A;  3QQC D;  2VG5 B;  2UV8 G;  1Q0N A;  2VQE F;  4X4T A;  2V9K A;  4NLY A;  4PWD A;  4RZR A;  3LPY A;  4NCB A;  1DAX A;  4PYD A;  1HNI A;  3HHL D;  2HAF A;  3ZTQ A;  2GW8 A;  4X65 F;  3CW2 C;  4U8Y A;  3NEK A;  5M2U A;  4M5D A;  4IRD A;  3DRP A;  2B0G A;  1Q7L B;  3N6M A;  1T3O A;  4PXE A;  4IG0 A;  1CJK B;  4B3M F;  4MJK A;  4EBE A;  3UCZ P;  3R3T A;  4FZV A;  5GAD I;  1FHT A;  1YDL A;  3I87 A;  2EXU A;  9ATC B;  5KG7 A;  5A6P A;  1HD1 A;  1HBU B;  2C2K B;  1RCO B;  4HAC A;  1Z4U A;  3NGK A;  4Q7A A;  3RZA A;  3L7U A;  1FNM A;  5EUH A;  2Z8Q A;  2F8M A;  3QGH A;  3SCK E;  2XGQ A;  3CCJ S;  2N82 B;  4C8L A;  2GS8 A;  1JLG B;  1QAJ A;  1TL7 A;  3QSI A;  1RAI B;  4OZN A;  1HNZ J;  1UVK A;  2BQ3 A;  3NGD A;  4MFB A;  1J5E J;  2QGF B;  2HS4 A;  2OFG X;  5KG0 A;  2FHO B;  5HQ8 A;  4RR5 A;  1PYS B;  1H74 A;  1ICE B;  4ZA1 A;  4OJ3 A;  3EDR B;  1TUG B;  2WZ1 A;  4UW2 A;  4RUH A;  1SL1 A;  4NYP A;  3NBP A;  5B0E A;  3CPW R;  2ROG A;  4I2P B;  2J76 E;  4EZ9 A;  2RHS B;  2E7W A;  4WIQ A;  2B6A B;  3BKT A;  5IWA F;  4FNI A;  3I96 A;  3HHE A;  1RTJ B;  3DDK A;  4P71 A;  1OY6 A;  1FKP A;  5A8W A;  4DR5 J;  2KJW A;  4CO2 A;  2KJV A;  4IG3 A;  4NLW A;  4OHW A;  1R0B G;  2RS8 A;  1K0T A;  3RU0 A;  3HD1 A;  1WC3 A;  3GIK A;  4V19 J;  2JEG A;  2FVC A;  1JLF B;  5KFT A;  3HHD A;  4D3G A;  3O2I A;  4KHP J;  2FLP A;  4X4N A;  2RH3 A;  3PJ9 A;  3M2U B;  4N77 A;  2NXU A;  1FJE B;  2C28 A;  1QM9 A;  4ZMM A;  5KFX A;  3HF5 A;  1L3S A;  2GVD A;  2NCK L;  1IKX B;  2I38 A;  4L75 A;  2NLW A;  4IRK A;  2GFF A;  5GAH U;  3CCV S;  2XWX A;  3MM6 A;  2P8I A;  4EEY A;  2RF2 B;  4TXS A;  4P6Q A;  4XPE A;  2Y9H A;  3FKB A;  1HWL A;  2WVF A;  3WHI A;  1VQY A;  4B3O A;  2DNQ A;  4QU6 A;  3IBW A;  1SUQ B;  2N4C A;  1NHV A;  3ZNU A;  4I2Q A;  1IM4 A;  4HT5 A;  1NPK A;  1SH3 A;  3N6L A;  4RPF A;  4RW7 A;  2FGO A;  1E6Y A;  1CUL A;  1LWC B;  4F8R A;  5BR8 F;  1U26 A;  2IJF A;  3AAW B;  3MUV P;  2WB1 D;  2ZUA A;  2RQK A;  2HNZ A;  1SPB P;  3S01 A;  5T14 A;  5B0D A;  4KAI A;  2DXE A;  1TK8 A;  4PG8 A;  4GVL A;  3B4M A;  4ILR A;  2KYX A;  3UR3 C;  1XMQ F;  3OTE A;  1U0S A;  4I0W A;  4RUA A;  1JLE B;  5GAE U;  3T6B A;  3KLG A;  2OP5 A;  3VTI A;  5KFG A;  3SIP B;  3AY0 A;  3FZ2 A;  2DH7 A;  2Y1J A;  2VOP A;  3UVJ B;  3FCH A;  2MKJ A;  2YKO A;  4PWW A;  1OPI A;  5AE3 A;  4XDD A;  1JNR B;  4WKR A;  1RWP B;  4KGV B;  4ECY A;  5KG6 A;  3QIP A;  3T1H F;  4WK3 A;  1X4C A;  1IBM J;  3DLG B;  1EKR A;  1BQM A;  1N36 F;  4F4Z A;  3O6Q A;  4QIE A;  4TNO A;  4M5N A;  3N5F A;  2Z2Z A;  2X3G A;  4ICL B;  4JI3 J;  2XUL A;  2MST A;  3J80 U;  2J9D A;  4M1K A;  5ETP A;  2ZBP A;  3DOM A;  5LMU J;  4KPC A;  2CWK A;  1EP4 A;  3UDC A;  1P27 B;  3KOA A;  1LXN A;  4FYV B;  1DQA A;  3VQT A;  3WC0 A;  3WX8 A;  5H1S V;  1N5T A;  4FNH A;  1RHK B;  4U8V A;  1WI6 A;  2X7I A;  3A13 A;  2JVR A;  1ARO P;  2EG1 A;  3DGP B;  4ZN1 A;  5HMX A;  2XNQ A;  1AZS B;  4DCJ B;  2HQD A;  5C42 B;  4URG A;  2KM8 C;  3LQV A;  4C8O A;  4JOU A;  1RSC A;  4I67 A;  2HQF A;  3PCO B;  3KLH B;  2OML A;  2FQQ B;  4ZVQ B;  3KLF B;  2AD9 A;  4B9L A;  3QFW A;  2AGQ A;  3R27 A;  3HFV A;  4NCG A;  2DR9 A;  2PO4 A;  2D1C A;  4X4V A;  4ANC A;  2QA2 A;  1UKU A;  4OI6 A;  4EZ6 A;  5ETM A;  2FC9 A;  2UUW A;  5CAB A;  1XMO J;  2CYY A;  4DR2 F;  1NDK A;  3QRQ A;  3N01 A;  1UPP A;  1M5K C;  2W25 A;  1TV6 B;  2QTW A;  1REV B;  3G6Y A;  5E7O B;  1Y7P A;  1VRU A;  4Y2C A;  5D3G A;  2FPH X;  2XQC A;  2LXI A;  1RAH B;  1FDD A;  1RAC B;  9RUB A;  2MQQ A;  4JI0 J;  4CH1 A;  1JLB A;  4R5P B;  1QUV A;  2E66 A;  1HBO B;  2G4B A;  4O3S A;  3FQL A;  2BOP A;  1RWK B;  3UI3 A;  3HHK A;  1NDL A;  4OI4 A;  5ETQ A;  4CH7 A;  2ZWO A;  6FDR A;  3GPA A;  4LRE A;  2NXE A;  1LWF B;  3D68 A;  1M5S A;  3JSY A;  1RT5 A;  4KFB B;  2V4R A;  2DXF A;  4RNO A;  4HI2 A;  1PC4 A;  2ZH6 A;  2FJV A;  2HQ3 A;  3BGR B;  5EWG A;  2U1A A;  4LIW A;  1RBL A;  3F44 A;  3M7V A;  5LMU F;  3O1L A;  1ZM2 A;  1L5U A;  3IGV A;  5LMN J;  3BKF A;  3D54 A;  3TUZ C;  1WF1 A;  2R7U A;  2V5H G;  2QFJ A;  5HBM A;  5IC6 B;  2MLZ A;  3T1Y J;  1L3T A;  2H4Y B;  2NSC A;  1MMN A;  1LKZ A;  1O8B A;  3P8B B;  4BDP A;  1U49 A;  2HWI A;  4ID5 B;  3POT A;  1ZPV A;  5DDR C;  4ZCI A;  3I0R A;  4IO9 Q;  1Q16 B;  1FO1 A;  1UET A;  3RB4 A;  3NOG A;  4DXL A;  2P9C A;  4ZIW A;  4C3L A;  3JTO A;  2R7X A;  1E6V A;  1SCJ B;  1RT4 B;  5LXY A;  4Q0B A;  3HSD A;  1WHV A;  5KFF A;  2E9R X;  2JLE A;  3KLI A;  4Q44 A;  4DL7 A;  4M5I A;  1XMO F;  2WSE C;  5F41 A;  4WTO B;  4ZJO A;  4NLO A;  2VL1 A;  1YHQ S;  1MLA A;  2O67 A;  1VQS A;  4DS5 A;  3BKU A;  4UF4 A;  2BVZ A;  2XMT A;  3NRB A;  3KK3 A;  1S6Q B;  1N8R T;  1S76 D;  1FKA F;  3SCI E;  3CMA S;  3NXZ A;  4UUW A;  4J9S A;  4C8K A;  3FRZ A;  2HHW A;  2K8G A;  4K4Y A;  2L08 A;  3FEX B;  1Q7Y T;  3K17 A;  4OHX A;  2PE8 A;  4HDH A;  2H48 B;  2L9D A;  3MM8 A;  3C16 B;  1HW8 A;  1X0P A;  4M63 A;  2M0G B;  4HR2 A;  2YX1 A;  1VQ7 S;  2V8V A;  1KFD A;  1TK0 A;  3Q86 A;  3MGJ A;  5IM0 A;  2YTC A;  2C2R A;  1KVJ A;  2H1Y A;  2K1R A;  3ICL A;  1GX6 A;  4ZP9 A;  3KUE A;  2KFN A;  5B08 A;  1KFS A;  3I9Z A;  1NPP A;  2ILZ A;  3Q0A A;  5KFR A;  1HQU B;  4DV6 J;  1FTR A;  1IJF B;  2ATC B;  5CHC B;  1HI1 A;  5LMN F;  1UWB A;  4WKY A;  4NCA A;  1KTQ A;  4RU9 A;  2YX7 A;  4DF4 A;  1KQS R;  3KMS A;  2BE2 A;  2H51 B;  3CDW A;  2CVE A;  3T1Y F;  1H7X A;  3K5L A;  1QVG R;  2UUB J;  2M5Y A;  3MMA B;  1N33 J;  1L3V A;  1K1Q A;  1KD1 T;  1R8C A;  3QLH B;  2VU5 A;  3CJ0 A;  1C1C A;  3HFZ B;  3L7O A;  2AMC B;  3NS5 A;  3IO1 A;  1HL6 A;  2IDE A;  3MEG B;  3OXF A;  2DY9 A;  3MOJ B;  3SDE B;  1SQF A;  3A3O B;  1RT3 B;  4MK9 A;  4ZJQ A;  2ZJQ Q;  3HVA A;  1NND A;  4IOB A;  1FA0 A;  1K8A T;  1XR6 A;  3IFE A;  2Z30 B;  2V2K A;  2NZ4 A;  1YVF A;  4OV1 A;  3AHP A;  5JUM A;  1KS2 A;  3M8Y A;  2CPI A;  2C3U A;  4OZ5 A;  1D9A A;  5KG5 A;  4TU7 A;  3V5R A;  3ZC4 A;  2GZO A;  2LKZ A;  2VHG A;  5HVG A;  2L41 A;  4IFY B;  4L3K A;  2Z56 B;  3CJK A;  2E1A A;  3KG1 A;  3IBF B;  3GP9 A;  2EBE A;  2XSJ A;  4ZVR B;  5IZH A;  2PMH A;  1KRP A;  2GIQ A;  1AUS L;  3FFI B;  2UXC J;  1S6U A;  5D4L A;  3A8J A;  3KLE A;  4U96 A;  4ECZ A;  1RLD A;  3MWB A;  1KOO A;  3D2W A;  3TVY A;  4CO5 A;  3MCN A;  1ZS6 A;  1UZD A;  5ETO A;  1FK9 A;  1QTN B;  4DHV A;  1RTD A;  3HD2 A;  1N54 B;  1Y11 A;  2MQP A;  1SKU B;  1LNQ A;  2ZOF A;  3GFX A;  3LAM A;  1VMB A;  3HKZ D;  1K0V A;  1VBK A;  2CPY A;  1RCX B;  3K8V A;  3QGG A;  3AH6 A;  4EO6 A;  5J1N A;  4NLS A;  4RW6 A;  2UUB F;  1IKW A;  3BSN A;  2G0C A;  3JQK A;  1N33 F;  1UWA A;  3GII A;  1QE1 A;  3ETO A;  4NI2 A;  5I42 A;  4CYU A;  2XZD B;  3G2X A;  3DCA A;  4CLL A;  5KFY A;  2JVO A;  1HI8 A;  4QWA A;  2ZC4 A;  3PO5 A;  1D1U A;  3PEJ A;  4BC9 A;  1GQE A;  2VQF J;  2NUU G;  1RKJ A;  5L9X A;  1VQN S;  1B0T A;  1PKU A;  4WZM A;  2W8L A;  2GO8 A;  2ZHO A;  1RTH A;  1K47 A;  2CUY A;  2YNG B;  5DG7 A;  3J7Y U;  5JJB A;  1PIE A;  1UVI A;  1SB6 A;  4BCA A;  2VDH A;  3SV4 A;  2FZG B;  2ZD1 A;  2DCL A;  3LAK A;  2VH7 A;  1CJT A;  2ZWP A;  4Y2I A;  1BLU A;  2YKN A;  2YX4 A;  2R7R A;  4NXN J;  4X64 J;  1QD1 A;  2OAU A;  4DFJ A;  5HL7 Q;  3CCT A;  4L6V 3;  2RIJ A;  2B5J B;  3MEE B;  4NA1 A;  4K5R A;  2L9W A;  4YP3 A;  5AXK A;  3IWN C;  1XTZ A;  4ED7 A;  2YNF B;  1X9S A;  1NKE A;  2ROE A;  3CT9 A;  4ES3 A;  4IYQ A;  4HKQ A;  4QU7 A;  4IRC A;  1V3Z A;  3JSM B;  5HVH A;  1JLQ A;  3KWM A;  1YJV A;  1FDA A;  2X3D A;  1TKT B;  2VJV A;  4U7U D;  2CRL A;  3IRX A;  3OUY A;  3M2V A;  3MM9 B;  1X0F A;  1U1M A;  2XCA A;  2V4Q A;  2QLX A;  1WKL A;  4X4P A;  3W2V A;  4QIF A;  2G2O A;  2KG0 A;  1D9F A;  2EFV A;  6AT1 B;  3MR3 A;  1TP7 A;  3RR7 A;  3AJD A;  1S59 A;  2WTF A;  5CYQ B;  4LSL B;  1RAO A;  1CBK A;  1X60 A;  1S1V A;  2DIU A;  1T94 A;  1GTH A;  4EI2 A;  5HJX A;  5CYM B;  1QAY A;  2DNZ A;  1KKH A;  3O44 A;  1N56 A;  4FXW A;  3EVO A;  2HFS A;  1IKV B;  3OTO F;  4JYA J;  4DV5 F;  2XMV A;  3M6U A;  5F3T A;  3OL8 A;  1J5O A;  2AZ3 A;  1D8Z A;  5GAE I;  4N41 A;  3ZTP A;  4OLO A;  3H42 A;  3D6H B;  2BE9 B;  3JTP A;  4ELT A;  1FER A;  5KOX A;  4FYY B;  2QN6 B;  1ZYQ A;  3OQ2 A;  1IJE B;  4DR3 F;  3UCU P;  1X4E A;  4LFC J;  1WC6 A;  5BYQ A;  4W98 A;  1WOO A;  3TJ9 A;  1NME B;  3HKW A;  3NGR A;  4KTQ A;  1WAC A;  3OT9 A;  4KGX B;  1IXK A;  2MTL A;  7FD1 A;  3VF0 B;  2V34 A;  3CC4 S;  5HMZ A;  4C9D A;  3DOK A;  1U1P A;  1RHM B;  5KAK A;  2RU3 A;  3EPI A;  2H4W B;  1WF0 A;  2XWY A;  3DRY A;  4NXN F;  4Q43 A;  4YR3 A;  5KT6 A;  3MMB B;  1S1X A;  2BX6 A;  4ZLP A;  5HMW A;  4F2S A;  2Y0S D;  2DGT A;  5KFZ A;  2VG6 B;  4O3P A;  5B0B A;  3CJS A;  1SQG A;  2R2S A;  4KJI A;  2XC9 A;  1FXL A;  4WTY A;  3LF0 A;  2UUA J;  3GLJ A;  1QJH A;  1R0A A;  4YOE A;  3GG0 A;  4DU7 A;  4RKU C;  3ZTO A;  3GSI A;  4M5J A;  2C42 A;  4U7C A;  4RL1 A;  2OEJ A;  5BJR A;  2HMI B;  2W2N P;  1RT7 B;  2MQ8 A;  1S1W A;  4QW8 A;  4G1Q B;  1S1U B;  1S9G B;  2ZH8 A;  3I0S B;  1T05 A;  1Q8I A;  1CJV A;  4EBD A;  3RW6 A;  2R7V A;  3GIR A;  1NRK A;  5MLC V;  5BYS A;  2FJX A;  5D4N A;  3H40 A;  3I56 S;  3M30 A;  2W9C A;  5L39 A;  1NJW A;  3W2W A;  1KN6 A;  1TL1 B;  3TYT A;  4F4X A;  3EXC X;  1FEE A;  3UE2 A;  1RHJ B;  3RB6 A;  1WUU A;  3R6G B;  3TZW A;  5K8M A;  4TY8 A;  1GMV A;  3PHT A;  2QLW A;  4JYA F;  2EKN A;  4AQY J;  3LAL A;  3M8P B;  2ZNZ A;  1DQ8 A;  2HNY A;  2QG9 B;  3H98 A;  3PFE A;  5HO4 A;  2VFT A;  3PAC A;  1HBM A;  3U27 A;  2KKH A;  2ILY A;  4WWS A;  1Q8L A;  3M8Q B;  4YB5 A;  2J7W A;  1U1N A;  1HKA A;  1UVL A;  4NZ0 A;  3MR2 A;  1JMT A;  4LFC F;  2QC3 A;  1IR1 A;  5E3R A;  1KLN A;  1BXN A;  3SFG A;  4K2X A;  4ECX A;  1IWG A;  3OLB A;  3BH6 B;  4DOZ A;  2IYG A;  1X5O A;  3AJ2 A;  3P5T L;  2EG2 A;  2CG8 A;  3IA0 A;  5LL6 d;  1MNE A;  1T7P A;  1XK8 A;  4CLS A;  5IC4 B;  3O8W A;  3MR7 A;  4L73 A;  3QGI A;  1T9Y A;  2CJB A;  3I4H X;  3EUN A;  4ZJL A;  4ECU A;  1WF2 A;  3VVT A;  3CSK A;  1B0V A;  4B02 A;  4YUD A;  2ZH2 A;  5K5M A;  1PAE X;  2EFP A;  3DYA A;  3MI7 X;  2JX2 A;  1VFJ A;  3M32 B;  4BBY A;  3KJV A;  3C3L A;  5HQM A;  3HI9 A;  1SV5 A;  2CZ4 A;  2MY7 A;  3E8O A;  4LJM A;  4RW9 B;  4J9O A;  4X84 A;  4NZ6 A;  2GA7 A;  3Q22 A;  2DNP A;  3T5J A;  4N7T A;  4DFP A;  2X51 A;  3H5S A;  3TUJ C;  3RTV A;  2XYG B;  4QIG A;  1T9W A;  1IKY B;  1HMV A;  4BLG A;  3C15 A;  3IWX A;  1FRM A;  3DXB A;  5DZ7 A;  3EX7 B;  1YLX A;  2V0N A;  3G8T A;  2V4J B;  2AGP A;  1TKZ A;  1RK8 A;  3IRW P;  3M05 A;  3C6U B;  1KQG B;  4ATN A;  1T03 B;  5HLF A;  4EO8 A;  4JV5 F;  2H5E A;  2L3M A;  1FRL A;  3CB4 A;  3N79 A;  4OYO A;  4NL5 A;  5F9N A;  2JLF A;  3RB0 A;  4TVA B;  1T8E A;  5F8I A;  1VQO S;  2MHN A;  1RU1 A;  4A8Q A;  3TZX A;  2VKR A;  1R0C B;  1DTT B;  2ZFH A;  3EVM A;  2WON B;  4TQR A;  1V3S A;  4CLZ A;  2XMU A;  5HRO A;  3TI0 A;  1FWL A;  3HCX A;  2FUG 9;  2BAB A;  2JWN A;  1Z2Z A;  3GJR B;  3BR9 A;  4RW8 B;  2EBG A;  4ECW A;  2C2E A;  1DTQ A;  3GB0 A;  5FDL B;  3W61 A;  2KRB A;  3VAJ A;  1RT6 B;  2G0I A;  2YH0 A;  3TEH B;  2HFU A;  3IG1 A;  4KO0 B;  2IMO A;  3HK2 A;  3R6L B;  1VI7 A;  3OFH A;  1T9X A;  1UVJ A;  4I68 A;  1HD0 A;  4QR0 A;  2BA9 A;  1U2F A;  1CLF A;  3Q8S B;  4CLW A;  2OPR B;  3DLH A;  1B4S A;  2MZQ A;  3AOC A;  3U02 A;  4HHH A;  1VRQ C;  3KMQ A;  2BJD A;  2V50 A;  2BAC A;  1V3R A;  2ADB A;  2AWZ A;  2OPQ A;  4F2R A;  4V19 X;  2QSF A;  4Y65 A;  3TVZ A;  3NGT A;  4BC7 A;  4MMO A;  3A8K A;  3DMJ B;  2XZW A;  1Y5N B;  2HWH A;  2YWH A;  2B43 A;  4OX9 F;  2NPI A;  5J2N A;  4ZVH A;  4KKO A;  4QPT A;  4U6P A;  3CCL S;  2F1F A;  4OYI A;  4CH0 S;  4NOH A;  1XR7 A;  4UQG A;  4M94 A;  4QWB A;  1YJW S;  4ZP7 A;  2H5J B;  2NS1 B;  4FF4 A;  4P10 A;  3D28 A;  1OYE A;  2DO0 A;  3K89 A;  2D74 B;  4PUO A;  3GU0 A;  1CS4 B;  2WB4 A;  4DR4 F;  3A8E A;  3S7R A;  4DPU A;  2HBQ B;  2NZC A;  4J9R A;  3EGV A;  2XZT B;  3CNQ P;  5KT7 A;  4ZOS A;  4EU0 A;  2RKI A;  3R5C A;  2QX0 A;  3M1V B;  4LBP A;  1KDN A;  1RZM A;  1HQE B;  4P74 A;  3D5M A;  4ECQ A;  1H2T Z;  3PX4 A;  3BEG B;  5I3U A;  3H4B A;  3KKF A;  4B9U A;  1C0T A;  3D7S B;  2WHO A;  1RUS A;  3MM5 B;  4CZC A;  3LWL A;  1N34 F;  2XLK A;  2ZH3 A;  4GO7 X;  3OR2 B;  3E01 A;  1Q95 G;  5IOL A;  3V81 A;  1MRO A;  3DRR B;  4DR1 F;  2HND B;  2ZOG A;  3DHW C;  4GKJ F;  2VIH A;  2W2Q P;  3LP2 A;  4ED2 A;  2KU7 A;  3EGN A;  5A76 A;  1RIS A;  3L09 A;  2Y0B B;  1FFG B;  1S1T B;  5EWE A;  1RU2 A;  3MAA B;  2JDJ A;  4DPO A;  2V8G A;  2BEF A;  3AB4 B;  4ZVO B;  1RE1 B;  3C46 A;  4PRF A;  2F5G A;  2X1B A;  5AXL A;  1KNZ A;  1KWM A;  3B4D A;  2AJ1 A;  1H2U X;  3PYF A;  3AFG A;  1NZA A;  4G3I A;  1GAO A;  3TZZ A;  4OZJ A;  5E5N A;  2QA4 G;  3CCS S;  2QIF A;  1M90 T;  5EGY A;  3KK2 B;  3TAM A;  1F5A A;  2I2Y A;  2ASL A;  3H25 A;  3FUY A;  1IWA A;  4LSN A;  3J80 Y;  3CJ3 A;  4HDG A;  5IV3 A;  2W9A A;  3BSA A;  2DH9 A;  2VFR A;  3TRG A;  2V67 A;  1GXT A;  5I3P A;  3M8S A;  5K8N A;  1CSJ A;  2GIR A;  3FMW A;  3FGV A;  4O44 B;  2FHK A;  4OLP A;  3CMQ A;  3DLK B;  2EEY A;  1IVZ A;  3IC1 A;  3HSG A;  4LF4 F;  1RHU B;  3ZZP A;  1HIY A;  1TL3 A;  3NNC A;  3FRY A;  1UP1 A;  2MSS A;  3SYZ A;  1K9M T;  2C2M B;  3AB2 B;  3W63 A;  4I64 A;  3NMA A;  1NLK L;  4LT6 A;  2F40 A;  1WC5 A;  2RML A;  4NXM J;  4QBU A;  3J7Y I;  1SC3 B;  3HZG A;  5AT1 B;  4QZV B;  4H54 A;  4E0D A;  3LGN A;  2UXD J;  5EHH A;  4JI5 J;  1LWX A;  2O01 C;  5MAO A;  2RRN A;  4Y34 A;  2HRU A;  2A1B A;  1XN9 A;  2FGC A;  3NAH A;  1BWV A;  4WFY A;  3EWG A;  1XNQ F;  4KE5 A;  2GV1 A;  4F0K A;  1H6K X;  1N6Q B;  1IQT A;  5F8M A;  5FLX U;  1EX8 A;  2RUS A;  2ZBI A;  2PI5 A;  2ZC3 A;  2V8D A;  1RGV A;  2E7V A;  5F0W A;  1SL0 A;  2YH1 A;  5J1P A;  2CG4 A;  5GVQ A;  4DSI A;  1ELO A;  4ED5 A;  4M5G A;  1Y3K A;  1HA1 A;  1ZAW A;  1ROF A;  2H65 B;  3HM9 A;  2D41 A;  2PA3 A;  2GJF A;  2GQ2 A;  1RHR B;  3H7H B;  1RWU A;  1N5Y B;  2JEF A;  1M5P C;  2IJR A;  3Q2T C;  3KJN B;  1C1B B;  3FBB A;  2EPI A;  2LLZ A;  3Q24 A;  4H4O B;  2MQM A;  4L74 A;  5GAG U;  2DR6 A;  3HJF A;  1HNX J;  4HL9 A;  2OPS B;  2B9E A;  2R7S A;  4DQQ A;  2ZHB A;  1U0H A;  3KUG A;  3P4U B;  2J9C A;  2VAS A;  2ASY A;  1SJR A;  1R8H A;  2IAJ B;  4J5O A;  5E3C A;  4P7T A;  4F67 A;  4A47 A;  3TUP A;  1SKW A;  1SH2 A;  3NGS A;  2GVZ B;  4FYD A;  2LEP A;  4WJB A;  2NPF A;  3I5A A;  3DI6 B;  2R7O A;  2KTQ A;  3F0N A;  2FVP A;  2G2Z A;  2KB2 A;  4GKK J;  2AX1 A;  4Z7C A;  1TAU A;  2XEX A;  1A9N B;  3MMC B;  4ZLJ A;  1H7W A;  4MAK A;  4YY3 F;  3NNH A;  1JLC A;  1WD6 A;  3D67 A;  1TUV A;  3IP0 A;  1UTA A;  4WYW A;  1IBL F;  1VCT A;  2ZKT A;  3ZNJ 1;  5DGB A;  2JRS A;  2CQB A;  3ILJ A;  4RX6 A;  1YJ9 S;  2UXB F;  5E3P A;  3HVT A;  2Z2M A;  4C7Q A;  2HFN A;  1PGZ A;  3C14 B;  3CC7 S;  4DPT A;  3WX4 A;  3CD7 A;  1NK4 A;  3HPO A;  3AXK A;  2UXD F;  1W2B R;  1S79 A;  2KVI A;  1YK9 A;  2VG5 A;  1UA0 A;  4LF2 A;  1SC1 B;  2BXJ A;  3FVY A;  4KHM A;  4YDX A;  3RAM A;  4CM0 A;  1F3V A;  3ET6 B;  1YKW A;  4HHU A;  4ZCL A;  1HHS A;  2N4D A;  1M5H A;  4BWM A;  4OX7 A;  1P1L A;  1X5S A;  3O3L A;  3ZTS A;  2P9G A;  1CJK A;  3KJQ B;  2HVZ A;  2KN4 A;  1ZZN A;  2R3V A;  4DV7 J;  4G65 A;  1IBC B;  4ED6 A;  4JI2 F;  2C1E B;  1HBU A;  5CZV A;  4AL7 A;  4ZPB A;  2XLI A;  2AX0 A;  1JLG A;  2IIH A;  4Y2M A;  4DCP B;  2LA4 A;  2ASD A;  3G6X A;  3H20 A;  1RAB B;  4LFA F;  2RDJ A;  1NAQ A;  1BGX T;  1HR0 F;  3EGW B;  2RDD A;  4CP5 A;  2LMI A;  3I9V 9;  3GZ7 A;  1KHV A;  2H9Z A;  3MFH A;  3CED A;  2JL9 A;  4YR2 A;  3QMQ A;  3G96 A;  3ITH B;  1U6B A;  3OHB A;  2QA4 S;  5KT3 A;  4I2P A;  3A8I A;  1RXO B;  1JLA B;  4Q8E A;  4DX5 A;  2BM1 A;  2WSC C;  2B6A A;  2CQ4 A;  4GKK F;  1LFP A;  3PZP A;  2QL7 B;  2HZA A;  4ZVT B;  5AJ3 J;  1H73 A;  2J9D E;  1NPR A;  1RTJ A;  2RRA A;  2WW4 A;  1WG5 A;  2J7U A;  3R7B B;  2IM1 A;  2JSX A;  2BZ2 A;  3KTQ A;  4C4W A;  2CQP A;  3GYN A;  5JXS A;  2MQL A;  3Q8U A;  4K4V A;  3PYG A;  4CT9 A;  1PBA A;  1X9M A;  2DNH A;  4OI2 A;  5LSL A;  2DNN A;  2KHD A;  4FP9 A;  5K8O A;  4JI7 F;  1JLF A;  5KFM A;  2EVZ A;  3LOU A;  3R5G A;  4TU8 A;  4ECT A;  1GXL A;  3H0P A;  1OS5 A;  2EK1 A;  4YQW A;  3QZ7 A;  1TKD A;  4NYZ A;  3G9C A;  1S7I A;  3M2U A;  2DVI A;  1PYT A;  2B7B B;  2B56 A;  4PEO A;  4A48 A;  4LR7 A;  1FJG F;  4H4K A;  1APS A;  1KLM A;  4N5S A;  2ZEJ A;  4MKY A;  4EYI B;  2R8K A;  1VS3 A;  1IKX A;  2N7C A;  2QFI A;  3M8W A;  4ILM A;  3M6W A;  2RF2 A;  1UA1 A;  4Y6I A;  2GO9 A;  2HRT A;  4K50 A;  2BYC A;  5M2R A;  1YRT A;  1GMW D;  1ZOT A;  1G3O A;  3JSB A;  1SUQ A;  4ERD A;  4G1I A;  3M8R A;  1P1T A;  4USI A;  3ENA A;  2A0F B;  4F3O A;  2B3T B;  3D0G E;  3UCG A;  3EDQ B;  1J27 A;  7FDR A;  1RAF B;  1LWC A;  2C2O B;  3BPD A;  1N32 F;  1FRH A;  4NLR A;  5KT2 A;  3RRK A;  4WU3 A;  2VJU A;  1T9T A;  3RYL A;  1VC6 A;  1RA7 A;  2KFY A;  2DY1 A;  1M0S A;  1TUW A;  2PMZ D;  4Y3C A;  1JLE A;  2CNO B;  2GQC A;  2QRR A;  5KFC A;  2VBZ A;  2Z2L A;  4ED0 A;  3M6V A;  3UVJ A;  4WF9 Q;  3R5B A;  4O4G B;  4P2M A;  2X1A A;  1F2G A;  1ZAV A;  1D3W A;  1IN0 A;  3HMJ G;  3FEZ A;  1ZM4 A;  1FF2 A;  4NPO A;  2LCW A;  2LEC A;  1BE4 A;  3Q8Y A;  4AYB D;  2DXD A;  3DLG A;  2LU2 A;  2B4V A;  2Q79 A;  1YI2 S;  2GML A;  4RUB A;  4DLE A;  1N4L A;  5DG8 A;  3C2P A;  2A6O A;  4ICL A;  3BGU A;  2E9Z A;  2Q43 A;  5ETR A;  5KFK A;  1G1X A;  2DPI A;  3FZB A;  3KNA A;  1WDD A;  3FSX A;  1WJ9 A;  2WRM A;  3TJ8 A;  1R8P A;  2OTJ S;  2J7K A;  4DPW A;  2G0J A;  2M8H A;  3TAP A;  2AJ2 A;  4LBI A;  3AOD A;  3CJT A;  4KV8 B;  4O3Q A;  2K3K A;  2XLJ A;  3D3C J;  3HHL C;  3B6B A;  3DGP A;  1Q78 A;  1DFD A;  3AT1 B;  4XTT A;  5C42 A;  5ETS A;  3CUN A;  3B54 A;  1V9O A;  3KLH A;  3QID A;  2VG7 B;  3KLF A;  1C4C A;  3ISN D;  4J9N A;  3Q8V A;  2XSJ B;  3GR1 A;  2HK2 A;  2FHJ A;  4U95 A;  1KOH A;  2Q3P A;  4X65 J;  2FD2 A;  1TL4 A;  4I1T A;  5KFA A;  4DSK A;  2F3J A;  3ILO A;  1MN7 A;  1XEZ A;  3V4I B;  2DK2 A;  2DR7 A;  4P2X A;  4X62 J;  1HYS B;  4B3M J;  1VQ8 S;  2V63 A;  4IH7 A;  5A8R B;  5A8K B;  1TV6 A;  5HP1 B;  2RUG A;  2KZZ A;  3R5J B;  2GNK A;  2BRL A;  3MEK A;  1REV A;  1UPM B;  5KFO A;  3QJL A;  2ALZ A;  1VBX A;  3CCR S;  2AYM A;  2DHA A;  4FN5 A;  2BDP A;  3RGI A;  2Z58 B;  2BUN A;  3QO9 B;  5AE2 A;  1SQE A;  1YJ7 A;  8RUC A;  4R5P A;  3SQG B;  1QSS A;  1HBO A;  1I3O B;  2DKO B;  4P52 A;  4LFB F;  1U02 A;  3PYE A;  3ZZU A;  5H9E K;  3B8H A;  3Q8R B;  2HHH J;  2V6A A;  2OLW A;  4C98 A;  1LWF A;  2YQ3 A;  5D78 A;  1RBA A;  3H59 A;  4WFX A;  4TY9 A;  2ZKU A;  2CQI A;  4DQS A;  1VJW A;  4DV4 F;  2B8Q A;  4KFB A;  1PIL A;  2CNK B;  5FII A;  3PW5 A;  2J0W A;  4RBV A;  3GFZ A;  2J6S A;  1WEL A;  2DHG A;  4ITS A;  3BGR A;  1ZTT A;  3HHN B;  1GXU A;  3IN5 A;  3OTD A;  1F9E B;  1VBY A;  2AJ4 A;  2NQP A;  4DF8 A;  3PX6 A;  1PJ6 A;  4P72 A;  3NS6 A;  3R97 A;  2VPZ B;  2BAN A;  3NCQ A;  2KH9 A;  3TAN A;  2DPJ A;  5KFL A;  4ZLL A;  4JI4 F;  4DFK A;  4BHQ A;  2DBB A;  3CJ8 A;  3QBC A;  3R5A A;  3J7Z T;  3IR6 B;  4GVB B;  3ILL A;  3S6E A;  4AD6 A;  2DH8 A;  3GIJ A;  4EK2 A;  5KG2 A;  1PSD A;  4ZLN A;  4PG7 A;  4C11 B;  5E0O A;  1IBK J;  1H3D A;  4DL5 A;  4LF5 F;  3PR4 A;  1S0O A;  1HPZ B;  2IBO A;  4ID5 A;  4LQ9 A;  1UW4 A;  3SXL A;  3T5K A;  4PQU B;  1U25 A;  1HWI A;  1OMS A;  2B9W A;  3CDE A;  1OY9 A;  1RB0 A;  3VGS A;  2IC3 B;  4DV2 J;  4FXV A;  3GFY A;  1RT4 A;  1SJ1 A;  2YNH B;  4H4M B;  4EWT A;  5ITH A;  5L1K A;  2E5G A;  3PG9 A;  5DRK A;  2FVR A;  2DRD A;  3AOA A;  1ULR A;  4X62 F;  3C8Y A;  2NXJ A;  5F8N A;  2RQ4 A;  2YKP A;  4WFN Q;  3OL7 A;  2QT7 A;  3VAM A;  4Q8F A;  3W64 A;  2HGM A;  4OJH A;  4ZN3 A;  3I82 A;  1SI9 A;  2CQ3 A;  1QSY A;  2F7V A;  3OTC A;  2AZ1 A;  5BR8 J;  2UVR A;  4PQA A;  3HSJ A;  4ENO A;  1S6Q A;  1RT2 B;  5C2G A;  1YBU A;  3BN4 A;  3RBE A;  2XB2 D;  1WDT A;  4O0I A;  1XMQ J;  2GQQ A;  2HHH F;  2KI2 A;  4K0K F;  4ZKA A;  1FWK A;  1PAU B;  4DFM A;  1QAX A;  1RTZ A;  1NDC A;  2Y8W A;  2QEX S;  1HNW F;  2O5D A;  3H2L A;  1XMB A;  4M5L A;  2XHW A;  4NMX A;  2ADC A;  1H38 A;  3CTR A;  4K8R A;  3T1H J;  2IDL A;  2K7K A;  1VK8 A;  1HQU A;  1N36 J;  3CO0 P;  2BJ8 A;  3TNV A;  3LA0 A;  2DCU B;  1RJJ A;  4DEZ A;  1U2C A;  1VLY A;  4RW4 B;  1OY8 A;  5CH7 B;  1S77 D;  3AQO A;  4LF6 F;  1P9Q C;  4NE9 C;  1DRZ A;  3U1L A;  2K2P A;  2YWW A;  3MMA A;  4GRS A;  1U4B A;  4FYX B;  1VQL S;  1U6Z A;  3QLH A;  4MK8 A;  2OKQ A;  5GAG I;  5AE1 A;  2F9J A;  1IBK F;  3OFG A;  4OHY A;  5L8R C;  4WXO A;  5J2M B;  2PD1 A;  4J7C A;  1AA1 B;  3PW2 A;  4IR9 A;  4KY3 A;  3K5N A;  1Z2L A;  3SDE A;  4K4Z A;  3JAM U;  2MHE A;  2DGU A;  3KXD A;  2RB7 A;  1RT3 A;  4DV2 F;  5HQL A;  3R1H A;  3FK4 A;  4ZHR B;  1YBA A;  4FBT A;  4DL2 A;  2FJE B;  4CLF A;  5L1L A;  2O66 A;  1EET B;  3NCR A;  5DQH A;  4F4W A;  1FJ7 A;  4ED8 A;  2JEJ A;  3S1T A;  1SJQ A;  4WII A;  2JC0 A;  3T6J A;  1JWW A;  1HWK A;  4AL6 A;  2XG8 A;  2E7X A;  2IA0 A;  1NZ8 A;  3QAE A;  1L3U A;  1U47 A;  2LP4 A;  5ADZ A;  4IFY A;  4DR2 J;  4IOA Q;  2EC2 A;  2YPZ A;  2E29 A;  1IQZ A;  3V4M A;  3BM7 A;  3J81 U;  5A0Y B;  1FXR A;  5B7W A;  1B64 A;  3D1O A;  4NRT A;  3FFI A;  4N76 A;  3C19 A;  3LPE A;  2UV8 A;  3H90 A;  2R4F A;  3PIP Q;  1FRX A;  3A4T A;  2J0X A;  2XI2 A;  3ZZY A;  1U09 A;  3MR5 A;  3TX8 A;  1FKO A;  1RAD B;  1F1B B;  2FZC B;  5T7L B;  1JJ2 R;  2RJZ A;  1VGY A;  2Q6C A;  3LO3 A;  4FPI A;  2VA2 A;  2AYE A;  4QWD A;  4URS A;  3WZ0 A;  2KG1 A;  1TVR A;  4R0J A;  4KGK A;  1K73 T;  3MED B;  8ATC B;  4NA3 A;  2ACM A;  5EWF A;  4IFV B;  4WK1 A;  3DHX A;  3UD5 A;  4W90 B;  4B08 A;  2OPP B;  2E1R A;  4RBU A;  3MPW A;  3C6T B;  4TYA A;  4JV0 A;  1CQM A;  3EMT A;  1XNR F;  2VFV A;  3MEC A;  4FS2 A;  2HHS A;  3SCL E;  3PEH A;  4LSZ B;  4YEA A;  5AXN A;  1JX4 A;  2W2O P;  3CO9 A;  4LF8 F;  4OQJ A;  5T41 A;  3OL6 A;  3RBX A;  3MM7 B;  4X4U A;  4UTG A;  5KT4 A;  5LXR A;  4YB7 A;  4KGM A;  4OZ0 A;  5EX3 A;  3PDN A;  2BW7 A;  2B4O A;  2YQ0 A;  2YNG A;  3LUY A;  1WNE A;  1PC5 A;  1S72 S;  3CJ5 A;  2RIL A;  2ZH7 A;  3ZZO A;  1IR0 A;  2CPZ A;  4USU A;  1U1O A;  3PRB A;  1U1L A;  5KFI A;  4EUV A;  1EIY B;  2OTL S;  2CIM A;  3BDE A;  4KYZ A;  2ZZN A;  1RWX B;  3R1L A;  4CWB A;  1ZM3 A;  3K8W A;  1DUR A;  4E8U A;  2CJY B;  2GAH C;  3FCV A;  3PW7 A;  3UN2 A;  2XCP A;  3QZ8 A;  1HMV B;  2B5J A;  3QT5 A;  1UEK A;  4DQI A;  3N5B A;  4DMZ A;  3OFE A;  4Z7Y A;  3NG8 A;  2W2M P;  2YNF A;  1RAJ A;  2XY7 A;  2DNK A;  3RB3 A;  1LW0 B;  3JSM A;  3P49 B;  5J2Q B;  3LWM A;  3R8Y A;  5EDW A;  1FNO A;  4OZ3 A;  2DEJ A;  4OYB A;  2MZT A;  5HLF B;  1TKT A;  2JEI A;  1RWN B;  2YKQ A;  4XDC A;  4PG6 A;  5F0U A;  3G4S S;  3MM9 A;  4I6A A;  3E51 A;  1HQ2 A;  2XYP B;  4TU9 A;  3FBC A;  1EJ7 L;  1F0X A;  3NY0 A;  3FJ2 A;  1X5P A;  2D7S A;  1RT1 B;  1URN A;  2MKC A;  4YR0 A;  2ZDP A;  5IV4 A;  1NSQ A;  3ELH A;  4C8Y A;  2EWH A;  2D3O 1;  4ED4 A;  5CYQ A;  4LSL A;  2DNY A;  3SQO P;  3HZE A;  3T9Z A;  1S6P B;  5CYM A;  4LRF A;  3DDI A;  3X1L B;  1KON A;  3OJU A;  2JOQ A;  5KFJ A;  5B09 A;  1IKV A;  2EW9 A;  2MZ1 A;  1U6F A;  1ZAX A;  1U1K A;  2PEB A;  3TR5 A;  2HQI A;  4B17 A;  2CQC A;  1VLO A;  2GJ2 A;  2B8P A;  4NYO A;  4ZS6 A;  3R2C J;  3BGF A;  3D9B A;  2RVJ A;  4JUZ A;  1NK5 A;  2YWK A;  1NJI T;  2CPX A;  3T5H A;  2HSE B;  2PT0 A;  4MYU A;  2FZK B;  4RUC A;  3IWL A;  2DR8 A;  4YDD B;  4Z2X A;  4G1P A;  2CXE A;  5DQI A;  1WKK A;  4PPD A;  5CYJ A;  2ZH1 A;  2VON A;  2BKN A;  4JI1 F;  4CT8 A;  1NK9 A;  4EYH B;  4DR7 F;  4ZVG A;  2W4P A;  4NLG A;  3D6M B;  2IJN A;  3MMB A;  1ZA2 B;  2ASJ A;  2K7J A;  1FVS A;  4UZC A;  4IH5 A;  1CJU B;  4NRU A;  2E5L F;  3W62 A;  1I6J A;  1CG2 A;  5GMD A;  5CCL A;  3K57 A;  5J2P B;  2VG6 A;  3RAQ A;  2NYH A;  3G71 S;  2LVW A;  4UZB A;  1Y0H A;  4UOH A;  2VOO A;  4F4K A;  2RD5 C;  1Z1Z A;  1LK7 A;  5CD4 H;  1ZM9 A;  1N5Q A;  1P6T A;  2RQM A;  3LP1 B;  1L3K A;  4J9Q A;  2MJU A;  1WEZ A;  2AIR B;  5JMN A;  4WXW A;  2HMI A;  1RT7 A;  2RT3 A;  3HVR A;  1Q8K A;  2EFG A;  2M9K A;  4G1Q A;  3HSZ A;  1XBW A;  1S1U A;  1S9G A;  2EK6 A;  4CNY A;  2IVM A;  3I0S A;  4K59 A;  1WEY A;  4Z37 A;  2VV5 A;  4KHR A;  2I5J B;  2H54 B;  2DHX A;  5FLX Y;  1S12 A;  4WFA Q;  3T3F A;  1XWL A;  3CF5 Q;  5HJY A;  3BSO A;  4OYZ A;  1QVF R;  1TL1 A;  2BJ7 A;  4M5K A;  2IVY A;  4J37 A;  2HYI B;  3LP0 B;  3DM2 B;  4A8X A;  3M6X A;  1VHI A;  2DTJ A;  3TW0 A;  3LGH A;  3NNA A;  4WFZ A;  2Q1L A;  3M8P A;  1VQK S;  3UQS A;  3AQP A;  5LM7 E;  4HVZ A;  4F4Y A;  2LQB A;  2I9S A;  2WVD A;  4AFF A;  1FFW B;  2C3P A;  3M8Q A;  4F26 A;  1OSC A;  1S4E A;  1CC7 A;  2ZJP Q;  5KOW A;  2KM8 B;  2XMK A;  3SFU A;  3MPV A;  2WVB A;  3BGL A;  3A3N B;  2HHT A;  3AA9 A;  1LW2 B;  2J9E A;  4ZVP B;  5JVG Q;  4F4A A;  3HDS A;  3J7Z 5;  1LWE B;  2ZUG A;  2BR0 A;  4OYX A;  6FD1 A;  4ZVF A;  4AND A;  2W4D A;  4DUZ F;  2ZE2 B;  1W2I A;  2GAG C;  4DUY J;  1T11 A;  2E5H A;  1NHK L;  3CJ2 A;  1TL3 B;  1S9E B;  2B4P A;  2UU9 F;  3O5T B;  1R89 A;  3P3D A;  2FJB B;  1JKH B;  3CC2 S;  2EFO A;  1GEH A;  2UP1 A;  1BQN B;  4Y00 A;  4C0H A;  4DV1 F;  1I94 F;  3M32 A;  3VR1 A;  3EPG A;  2CQ1 A;  5I3Q A;  4A8F A;  4DPY A;  3NGU A;  3ENV A;  4RW9 A;  2KO1 A;  3Q8P B;  3Q8Q B;  4OZL A;  4H4K C;  3TAQ A;  4CLU A;  3QJP A;  3L3C A;  3WDO A;  1FRJ A;  3Q23 A;  1HLW A;  2F63 A;  4HHJ A;  1IKY A;  2L48 A;  2ZDO A;  1DY3 A;  4KR0 B;  4KGZ B;  3UNY A;  2OH2 A;  3H5Y A;  2NUH A;  3CCZ A;  2LQJ A;  2CQG A;  1WI8 A;  2V4J A;  5A6W A;  5IS2 A;  1EKS A;  3TA2 A;  2D9O A;  3DLE B;  2CQH A;  3C6U A;  2BKO A;  1T03 A;  1CC8 A;  1UJ4 A;  3KUH A;  1QAI A;  4K2J A;  2A3J A;  3G6V A;  4DPX A;  2D3U A;  1I5O B;  3TQ1 A;  2GC8 A;  2YNI B;  1SC4 B;  1NK8 A;  2XBP A;  3CIZ A;  1DTT A;  1YX2 A;  2M3D A;  2JFK A;  2WON A;  1FDN A;  3PO4 A;  3I6P A;  1D8Y A;  4LRA A;  3CJQ A;  1KC8 T;  1A0O B;  5D0G A;  2W2P P;  5L1I A;  2APO A;  2BJE A;  5DDP C;  2WBR A;  1N0V C;  1GH8 A;  4UY8 T;  2UVW A;  4RW8 A;  3OTO J;  4DV5 J;  1VQ6 S;  4DI6 A;  2HHX A;  4CM2 A;  1XR5 A;  1YIT S;  5FDL A;  3JYT B;  1RT6 A;  4YS2 A;  4KO0 A;  1NO8 A;  4PR6 A;  4QPX A;  1FFS B;  4X4O A;  1D09 B;  4ES1 A;  4QYR A;  2FY1 A;  3ZFV A;  3OR1 B;  4DR3 J;  2HHV A;  1SJ4 P;  1JXV A;  2OPR A;  1PG5 B;  2QE5 A;  5ETN A;  4ILL A;  4DUY F;  5B0C A;  4K4T A;  3G82 B;  4IQX A;  1FX4 A;  4HLB A;  2HIY A;  2M2B A;  1NSA A;  3GJT B;  1R6V A;  3DMJ A;  1C0U A;  3C66 A;  4OI3 A;  4I6Y A;  4D3H A;  3T5L A;  2DNM A;  4XAK A;  1REG X;  2DHH A;  3AD7 C;  4F0M A;  2FJA B;  1B70 B;  1EAY C;  2W7P A;  4HH0 A;  3D66 A;  5GMK a;  5IQ6 A;  1SKR A;  3DOL B;  2XMJ A;  2C2N A;  4DX6 A;  2CQ0 A;  5E3Q A;  4HTI A;  1BC6 A;  1CS4 A;  1HBN B;  4E98 A;  4KIA A;  1GX5 A;  3K59 A;  1K44 A;  4CTA B;  3BPS P;  2VBW A;  1B99 A;  5D6G A;  5GAH I;  2WVC A;  3NOC A;  2GMJ A;  3D1Q A;  1VIX A;  3M1V A;  2OEM A;  2WW8 A;  1Q82 T;  4L76 A;  1HQE A;  1BWE A;  2XMM A;  3OSP A;  1YJT A;  1RBO B;  1WC1 A;  2VF3 A;  4YB1 P;  2ZBC A;  1F5C A;  1VRT B;  5FJ4 A;  1U1Q A;  1Y4Z B;  3MM5 A;  1IR2 A;  4FYW B;  2ZM6 J;  1UCN A;  2P9E A;  2ZVI A;  5KFV A;  4NLQ A;  2M52 A;  3OR2 A;  2BQR A;  5DDQ C;  2QLB B;  3IS9 B;  4ZPD A;  4M5M A;  2GJI A;  1PYO B;  1T3N A;  1S57 A;  3WC2 A;  2BW2 A;  5HMY A;  2PSZ A;  4PPZ A;  1ZTW A;  3DRR A;  3NCP A;  4X66 F;  1RI7 A;  1SBR A;  5EX0 A;  2HND A;  2PEH A;  3VVU A;  1NJY A;  2GHV C;  2YWF A;  3QFH A;  1XC9 A;  4PXB A;  3D6T B;  4NEY A;  1S1T A;  3R7S B;  1RHQ B;  3MAA A;  3QT6 A;  4NLX A;  3QRP A;  1D0E A;  3CCM S;  3GV7 B;  3MZI A;  4YFU A;  1OSD A;  4F50 A;  2QSW A;  3HT3 A;  3ISZ A;  4C8N A;  4IR1 A;  2DGW A;  3WQP A;  3QSY B;  4K4S A;  2E5I A;  4TKT A;  1YBT A;  5HAT A;  3KK2 A;  4DG1 B;  2CKW A;  1H72 C;  4M5H A;  1WHW A;  3HHL A;  1FEH A;  4FKX A;  1X4G A;  1HHT P;  4PZV A;  2PN6 A;  2AEM A;  2MZJ A;  2UUC F;  2EFN A;  1OPZ A;  3BR8 A;  1EB0 A;  1Q8B A;  4A8M P;  2XS5 A;  1B7Y B;  4Y28 C;  2A2C A;  4O44 A;  3PM9 A;  2PII A;  4M95 A;  5F9L A;  2ZH9 A;  3VZH A;  3CCU S;  1HNV B;  2DB1 A;  3ENQ A;  3X3U A;  3DLK A;  2RAQ A;  3MUR P;  1VIS A;  1R6Y A;  1O5J A;  3UO0 A;  4WP8 A;  1KLM B;  1U45 A;  1WTB A;  2HFZ A;  4C0O C;  1U24 A;  4OZ1 A;  2YVS A;  2MKH A;  4E2F B;  3FSY A;  5A2Q U;  1YTY A;  3TUI C;  4ANE A;  1QTM A;  3DRS B;  3R7N B;  1VBZ A;  2O3D A;  2MZR A;  3KLV A;  1F2H A;  4NLV A;  2XGP A;  2BKP A;  3K0J A;  1MML A;  4DQP A;  3UFC X;  4AT1 B;  1KTV A;  4DS4 A;  4QR1 A;  3NLC A;  1JQG A;  2K3I A;  4LF1 A;  4IQM A;  2MKI A;  2ALY B;  4WE1 B;  3CDB A;  3I5C A;  4WZQ A;  1A6L A;  5F8J A;  1X4F A;  2ZM6 F;  2CWX A;  2W9B A;  4JV5 J;  2N7Y A;  2IRU A;  1HNZ F;  1QDU B;  5LSO A;  4RWW A;  4MTP A;  1N6Q A;  2MGZ B;  1J5E F;  4F02 A;  2DGO A;  3NMR A;  3TJA A;  2HQG A;  2QL9 B;  2WVE A;  4CO1 A;  1UJ5 A;  1WTF A;  1G7C B;  1EQM A;  3FMB A;  5L9N A;  1TKX B;  4QW9 A;  5IT9 U;  2NSB A;  4F7V A;  4CQ1 A;  1FRI A;  4ZP8 A;  3BO4 A;  4ELV A;  1N5Y A;  5FD1 A;  1C1B A;  3IR7 B;  3M2R B;  4MKA A;  4MYT A;  4H4O A;  1UVN A;  4C3M A;  3CJ4 A;  2V94 A;  2OPS A;  4NZ7 A;  3DLL Q;  4DR5 F;  3OVB A;  2DJW A;  2M7S A;  4OJ1 A;  5KG4 A;  3MFI A;  2UVV A;  3IMQ J;  3UNG C;  4UT4 A;  1Q81 T;  1V5I B;  4Y2A A;  2IAJ A;  3GTY X;  1BD6 A;  1SJF A;  2GVZ A;  3LW5 C;  4KHP F;  1VC0 A;  3DI6 A;  2DRB A;  2DIV A;  5F8L A;  2OHD A;  4ER8 A;  4OX9 J;  3MMC A;  2V69 A;  3KFW X;  2R7T A;  2DD8 S;  3OLA A;  4NA2 A;  3P96 A;  1R3N A;  4AL5 A;  3VGV A;  2B9Y A;  3EGZ A;  3AJ1 A;  2W7A A;  4DV3 J;  1YGY A;  2CFX A;  1VR6 A;  1ZH5 A;  1WC4 A;  1UJ6 A;  1PBU A;  4LQ3 A;  3C14 A;  2AQ4 A;  2IVF B;  3SSQ A;  3K7R A;  4DR4 J;  2WOM B;  1LK5 A;  3GIL A;  4OMF G;  1FT8 A;  4J9V A;  3IGN A;  3TA1 A;  2YKM B;  5F8H A; 
#chains in the Genus database with same CATH homology
 3A3N B;  2ZWP A;  4YN3 B;  2Z57 B;  2W2Q P;  3A3O B;  4NMX A;  2Z56 B;  2W2N P;  3VHQ A;  4OV6 A;  3AFG A;  2W2O P;  2E1P A;  1R6V A;  3QFH A;  3WHI A;  2W2M P;  3CNQ P;  4K8R A;  2ZWO A;  2QTW A;  3SQO P;  3GCW P;  2W2P P;  3GCX P;  1ITP A;  1V5I B;  2Z2Y B;  3WIV A;  3T41 A;  4NE9 C;  2PMW A;  3WIU A;  3BPS P;  3P5B P;  2Z58 B;  2Z2Z A;  3A3P B;  3CO0 P;  2XTJ P;  4JP8 A;  3H42 A;  2Z30 B;  3BGO P;  1SCJ B;  3VV2 B;  1SPB P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...