3OTCA

Crystal structure of human trnahis guanylyltransferase (thg1)- native ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
264
Chain Sequence
SKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA(His) guanylyltransferase
publication title tRNAHis guanylyltransferase (THG1), a unique 3'-5' nucleotidyl transferase, shares unexpected structural homology with canonical 5'-3' DNA polymerases.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.7.79: tRNA(His) guanylyltransferase.
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04446 Thg1 tRNAHis guanylyltransferase
A PF14413 Thg1C Thg1 C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3otcA00
3OTBA 5AXKA 3WBZA 5AXNA 3OTCA 4KGMA 4KGKA 5AXMA 3WC0A 3WC2A 3OTEA 3OTDA 5AXLA
chains in the Genus database with same CATH superfamily
4PWDB 5F3TA 1SJFA 1RBOB 1KC8T 3G6VA 2ROEA 3PIOQ 3QIDA 5J2MB 1UJ4A 3PYGA 1RSCA 1RTIA 3P45B 1TK8A 4MTPA 1RP5A 3H20A 3M30B 2VKRA 4OQJA 3T5LA 3OFHA 2GFFA 3CD0A 4I4BA 2R9LA 1X9SA 3JXOA 5D4OA 4F4WA 1JK9B 4C97A 1S9GB 3WX8A 3M8ZA 2QG9B 3D7SB 2N3LA 2MKKA 5CYJA 2JEIA 5K5MA 1KSPA 2HRYA 3C15A 3NOGA 4LF9F 5HLFB 2DGXA 3CDWA 2WSEC 2NXNA 1REVB 1E6VB 4TKTA 2B5JB 2MHNA 3OHAA 4OZ3A 3DYAA 1H2UX 2V8PA 2DR6A 5AE1A 2YPZA 4N8OA 5I3UB 2VF3A 1FKPB 1VS3A 4K4TA 3GFYA 2UV8G 5D0RA 3NGTA 4ZVGA 1VBZA 2BANB 3U1LA 4ES2A 1LWCA 4OMFG 2VBWA 4LIRA 3BH6B 3NG8A 1BQMA 3TZZA 1YJVA 4QWCA 1UW9A 2HFSA 2O01C 3MTKA 3C16A 2AWZA 3R2DJ 1LKZA 3K59A 1LEOA 1R8CA 1NPKA 4CM2A 3TEHB 3OD2A 1YBTA 2DNYA 4X84A 2ZBPA 3KLFB 4HT5A 2YTCA 2RRNA 1C1CB 4ZVRB 3IWXA 2HNZA 3BREA 5CCMA 3VGUA 1JKHB 3I0RB 3CCLS 3QZ7A 2VODA 4OHVA 1ZPVA 5SUHA 4PG8A 1M5KC 1MWQA 2DNLA 5AXMA 1XR5A 3X3UA 1NK8A 4KO0A 1X8DA 3CSKA 3GIKA 2CDQA 1F2GA 2YKOA 3HHLB 2NXJA 3EGVA 5GAHU 1LW0B 1M0SA 2WB1D 4XO0A 5H9EJ 4PG5A 3TUPA 3UDCA 3UI3A 5D4LA 3I4PA 4X4OA 2FHKA 2BMBA 1N33J 3KXDA 3W3SA 3K5OA 2E5IA 2GQQA 2DCLA 2M70A 1OO0B 2PN6A 3P5BP 2X1FA 1UVLA 3ENVA 1T9XA 2IJNA 1L3SA 2KZZA 2ALYB 1S77D 3W9IA 4O3RA 2FZGB 3CCSS 4UTGA 3Q2TC 3J7YU 2QA4S 1G3OA 2GO8A 3DOLB 1RDRA 2A10A 2VOOA 1U7LA 4ZA1A 2ADCA 1HBOA 4ZJQA 2XO7A 1RADB 1S99A 3CC4S 3RRGA 4DSIA 4ZJOA 1M1HA 3UO0A 3EVMA 2YKPA 3CD6S 4HH1A 3W9JA 1X5OA 3CXCR 4KHPJ 1Y5LB 2DB1A 3I56S 3I6PA 4EYIB 1FK9B 1NO8A 1SC6A 1UFLA 5KFWA 1UVNA 1H74A 4O3NA 4X4PA 3C66A 3G82B 4CTAB 5B08A 2RUGA 4OL8A 1HNXJ 3DI6B 2Z4PA 4WPAA 5IT9Y 2PMWA 3T9NA 3HO1A 1R0BG 4MK9A 4AL7A 5H9FJ 1TMMA 2VHGA 1D8YA 1BUXA 4UOGA 4ELVA 5HAOA 2ZH1A 1G2EA 1EIYB 3MF5A 1RTIB 1Q86T 2E1AA 1NUEA 5EWFA 2M8HA 1ZS6A 2YNFB 1U45A 1R8AA 5CD4A 2HFUA 3R7BB 3MM5A 4DSJA 2Z2ZA 4DR2F 1EAYC 4FPRA 3TZXA 1RAFB 1JX4A 4K5RA 3C15B 1JXEA 3K5NA 1NK9A 3AA9A 3NS6A 2ZOMA 2HNDB 1I94F 1FWPA 3BBBA 2J6TA 4JI3F 4U6PA 4DXLA 2V94A 4YB6A 3NNAA 2OTJS 1RT7B 5J1EA 3ZNJ1 2YKAA 1OQ6A 2NUHA 1KHWA 2ZBRA 1C4AA 1BQXA 4ZPDA 1LWCB 5KFLA 1QUVA 1YZ6A 2I5JA 1P6TA 5DDQC 1M5OC 3KWMA 3AB4B 5LM7E 1KTVA 2VBXA 3PX6A 5DZ7A 2H9ZA 3Q8UA 3TX8A 3WC0A 2RKIA 4BDPA 2WVDA 2MQLA 4WXWA 2MZTA 2YY3A 3RBZA 5H1SV 5I4MA 5HP1B 2DGTA 3ITHB 4BBYA 3OBIA 2RAQA 2GMHA 1GMWD 2MGZB 1AYEA 2W1BA 5KG6A 1RA7A 4HH0A 1NRKA 2B4OA 2ZHOA 3VAKA 1EZZB 3JSMB 4RNNA 2AEJA 3RAQA 1B0PA 3D0HE 3QRPA 2IVYA 1RWUA 1H2TZ 2YH1A 4B3TJ 1O5JA 4DF8A 2HSEB 4CO3A 3RJMB 3K58A 5A2QU 5KFBA 2DR5A 3CO9A 3MECA 1JLEA 3G8TA 4K8RA 4FP9A 5K8NA 3HD1A 2BXJA 3FQKA 1Q95G 3BO4A 2HHUA 3AD7C 3M6UA 3MM9B 2BRLA 1KLMB 4D3HA 1HQUA 5DLGA 3FSYA 4CZCA 3PR4A 3MMBB 1PBAA 2UV8A 2V2QA 2JDJA 3OUYA 4IRDA 3EZ5A 2V4QA 4D3GA 1QAIA 2F8HA 3IO1A 3C6UA 4O4RA 5BR8J 4OYPA 3J7AN 4PXBA 4LFBJ 3M6XA 3BQ2A 4LF9J 3SMZA 3HD2A 1X4BA 4OYMA 3Q86A 3G96A 1I51B 1TL4A 2CPXA 2XMAA 3QT5A 1K47A 3T19A 3TAMA 3OVAA 2JFDA 2WVEA 2GHWA 2GS8A 4GKJF 3QAEA 1Q8LA 1L5UA 1S6OA 2X3GA 3KLIA 3MURP 2W9CA 4IG0A 1FNXH 1ZETA 4FN5A 1WC4A 1ELOA 1OS5A 1CC8A 3KJQB 3HT0A 1IKWA 3HKWA 1IKXA 1NSAA 4ZK7M 4U96A 4PRFA 2CPIA 1NCLA 1RT3A 1LW2A 4N5SA 2Y3YA 4N77A 2B51A 3KNGA 1GK8A 1BWEA 2XMJA 1FD2A 3AD9C 3HCXA 2ADBA 4DLGA 4L3NA 4ED5A 2BABA 4TY9A 1HIYA 2ZKUA 4I64A 4OX6A 5M2UA 2LQ9A 4LSZB 4ANDA 3PJWA 1YJNS 1CJTA 3QGIA 2YNHB 5F0UA 3MR7A 2XGPA 3THVA 3WBZA 3VR1A 4CT8A 1YZ7A 5D4NA 1S72S 1QD1A 2H5EA 2BW7A 4LFCF 1Y11A 4CT9A 3AQOA 1P9QC 4F25A 3B8HA 1A0OB 1MWZA 4L6V3 2JEJA 2KVIA 3T9ZA 1MN9A 2WBRA 4OZNA 3DRSB 2ASYA 2EVZA 3S7RA 5HMZA 1IXKA 3CT9A 1UWBB 4OI2A 2HVDA 2I5JB 4OX9F 2KH9A 1K0TA 1UCNA 3K0JA 5KFFA 3BQ0A 3MUVP 2AYBA 4GRSA 1TQLA 3M2VA 3I9V9 2LKZA 2YX1A 1NDKA 3LP1A 4LMZA 5IC4B 2HHSA 4WK3A 4ZOSA 2A2DA 1QVFR 4USWA 4R8UB 5DRKA 2VQFJ 1NDPA 5T7LB 1YBUA 3NOCA 5DLFA 1VC6A 2J0SD 2AX1A 4HT7A 2DHAA 4C98A 3KHLA 3DXBA 2PMHA 5CAAA 2G2OA 4XK8C 2GVDA 4DS5A 2AP6A 2HQDA 4USMA 3KNAA 3ZZOA 4TXSA 3CJ2A 5EUHA 1KFDA 4IO9Q 3MCNA 3TANA 2EFNA 2CQIA 1TKTA 2XS2A 4PR6A 2YWHA 4ZPAA 5HVHA 5IV3A 4B9UA 4YR3A 4LBPA 1FEEA 4JI6F 4WFXA 2HBYB 4ILRA 4RW8A 5B0EA 1HI1A 1TUWA 3CCQS 3Q0AA 4U67Q 3MECB 3TAQA 1NKBA 3ONQA 2PE8A 4YUDA 1RU2A 1UVMA 4ZN1A 1P1TA 4DR3F 4PQAA 3R5JB 5EWGA 2UVRA 1FDDA 2UUWA 3MI7X 3VZIA 3H0PA 3IGVA 2HHPA 5A8KA 4UZBA 1TL1A 4AQYJ 4V19J 2R8JA 1T03B 4KHRA 3HSJA 2HVHA 3M8RA 4OIXA 4X4VA 3ZTOA 3MMAA 4M5GA 3DHXA 4KKOA 3OTCA 4DR7F 3M32A 4USJC 4ZPBA 1KNZA 1RK8A 1H6KX 2IM2A 1KN6A 3TO8A 4A8KA 3ZZRA 4NCBA 1IJFB 3N5BA 2ZM6J 1VQMS 2IDLA 1L3UA 4FXWA 4L76A 3CCVS 2AKWB 3TA1A 1FRMA 4O4GA 3CDEA 3E8OA 1KTQA 1N5YA 1S6PA 2XEXA 4RBVA 2IBOA 4CYUA 2CZ4A 2DBBA 4CLWA 3G87A 2CJ9A 2W9CB 3HF5A 1F1BB 1EP4A 2EPIA 1RWWB 5E3RA 3TUZC 2GJIA 2JEGA 1R3NA 5L46A 3LA0A 1IKWB 1SC4B 7AT1B 3O1LA 1N88A 4IG3A 1HD1A 3H42A 1LW2B 2ILYA 3QLHA 2H5IB 4DSLA 4QU6A 1RAOA 2KL8A 1EX8A 4DR4F 3MEGA 3PRDA 4AD6A 2L41A 2EKYA 5GVQA 1UA1A 2VZ9A 4NI2A 5F9LA 3N28A 5JXSA 4EBDA 4X62F 3SFGA 6AT1B 3R9LA 1VQNS 4DI6A 4E98A 3AJDA 1HD0A 1GMUA 2NS1B 3TUIC 5KG2A 5ETLA 1U1LA 5DGBA 1U47A 3GPAA 4IRKA 1Y0HA 3CTRA 1WEZA 1K8AT 2MPUA 3ILIA 1YVFA 4KHMA 1IBCB 2B3TB 4ELUA 3T1YJ 2IDEA 1NXIA 1UJ5A 2HZCA 1RAGB 3KJVA 5J2QB 1SBRA 2AJ2A 3IM8A 4NCAA 5U47A 1N52B 2P6TA 2KG0A 1YKWA 2ZD1B 4TY8B 5BXIA 1OPZA 2CKWA 2FHJD 1F60B 2KHCA 1O6XA 2A18A 1S59A 1U25A 1CQMA 2QSFA 2K3IA 4TU8A 1H38A 1LK5A 2ZH3A 1T9YA 2QLJB 2VPWB 3O44A 3F0NA 4OZ0A 1U0HB 1VMBA 3N5FA 1VQ5S 1HA1A 3PEJA 4OYZA 5F0WA 3J81Y 2DHSA 2FC9A 2HWHA 3A8IA 6FD1A 5A0YB 3RBXA 3CPWR 5AT1B 3OTOF 4YDDB 2BJDA 4F67A 2VFRA 2V5HG 2EFPA 5F8IA 2V9KA 3D1QA 4HYKA 4RNHA 5J2NB 1T0TV 1JQGA 4M63A 4RLEA 1NU4A 3NAIA 5IT9U 3OLBA 3RG6A 4GKJJ 4JI8J 1HKAA 1YJTA 5DQHA 5A8WB 1RTDB 3R5BA 3PJXA 2PI5A 4C8OA 2UXBF 4I67A 3IMQJ 3EICA 4PWWA 1QVGR 2MEWA 1R6VA 4KGMA 3QQCD 3PW0A 3MR6A 2CQ3A 1KBRA 2XMKA 2CNOB 3DLGB 4NXNF 4DU7A 1X9WA 4ES1A 2M52A 2GGPB 3TA0A 2XMTA 3BGRB 2KFZA 5LXRA 3HSGA 5A8KB 3ZTSA 2CPHA 4DSKA 1FTRA 3CCTA 5M2RA 2CQHA 4DG1B 1VC0A 4DMZA 3HLUA 2WCXA 2L9NA 3MMAB 5HROA 3QJJA 3UW1A 2QYCA 2KYZA 4AXJA 3E3XA 2LXUA 1D9DA 2RJZA 2Z0GA 4U7UD 2KT2A 3CJ0A 4BS2A 4DX5A 4K5SA 1XNQJ 4TLRA 1WC0A 2MQPA 1LWFB 1FVQA 4DV5F 4NLWA 4RW4A 2KZMA 3MPVA 4O4GB 3SSSA 1WF1A 1N5YB 1VK8A 1S1WA 3L4BC 2A2CA 3CUNA 2BBEA 3MWBA 4DCOB 3LH2S 1H98A 1WSRA 3FCVA 2CJXB 3OXLA 3VVTA 4NCGA 5HBMA 3QLHB 4ZHRA 2HHHF 2XM3A 3KK1B 1JLBA 1RT6B 2YH0A 4IH6A 3CF5Q 4J9LA 3CDBA 3SI8A 3MAHA 1ZM4A 5HMYA 1VJWA 4UOHA 3CB4A 2ZJQQ 2LP4A 3W8GA 1U6FA 3MEGB 2CNKB 4X2BA 2XHWA 3ZC4A 4X4QA 4B3RJ 4TQSA 4CQ1A 2LQJA 4Z7CA 2FLPA 1PGZA 1IBKJ 1S1VA 4DCJB 2AJ0A 1FWLA 4ZN3A 2GNKA 1OY8A 3PNIA 1NAQA 1MG7A 4ETZA 4I56A 2A6MA 1M5VC 1UVIA 2MLYA 4QR0A 3RR8A 4JI6J 4P2XA 2J9DA 3EUNA 2LVWA 2BJ8A 3MM8B 4OI3A 2FZKB 5C25B 4FF4A 4EI2A 3LGNA 4ZLPA 2QZ8A 2LA6A 3PKMA 1KVJA 1YJRA 2GW8A 1HWIA 4HVZA 2F4VF 4KGVB 1O51A 1YX2A 4RW9A 3NCRA 4WJBA 2HS4A 4DR3J 4KTQA 1RKIA 2M0GB 2BJEA 3KDNA 3AD8C 4Y28C 1NJYA 2HNYA 3JQJA 3PKYA 2E44A 1T9WA 1WD6A 3CC2S 3L9ZA 5C24A 4ZVQB 2VONA 3SQOP 1S9FA 3LGHA 1RA6A 4WBFA 4P72A 1RHKB 4N56A 1U48A 5E2QA 2VBYA 2CQPA 3HVTA 4LF5F 3NWGA 4RUCA 1S6QA 2N3OA 5KOWA 5F8MA 5HJXA 1WC6A 4NEZA 4PKDB 3HPOA 5H9EK 3US5A 2V8VA 1C0UA 3G6YA 1FESA 1N8RT 1RKJA 4DFPA 2BE2A 5JVHQ 2OPPA 3K7RA 2RQCA 3DLEA 3M8QA 4GMKA 5DG7A 1SVDA 2VBZA 3R6LB 5C42A 1JWWA 1Q7YT 5E3PA 2WSCC 1G1XA 3PW5A 2GVZB 3EDRB 2EK6A 3MAAA 4B08A 2D3OR 5LSLA 4JI0J 3UVJA 1H3DA 1Y00A 3IXQA 2M7SA 4ED8A 4IUFA 5HROB 2VU5A 3MEDA 3K8WA 2H65B 2B9XA 1H0HB 4OI6A 1FXRA 2VG6A 2IRUA 3OR1A 2OPQB 1Q5YA 4HKQA 2C2DA 1LNQA 5KAKA 4LFAF 4RU2A 4ECVA 2E7XA 2J8SA 3MM7B 4NA3A 4M5IA 3MFIA 3HX9A 2V69A 3O3LA 4OZ5A 5DJBA 2ASJA 5HO4A 2ASLA 2YVSA 3PX4A 4B9MA 3R2CJ 4WE1A 4EMDA 2DNZA 1S9EA 4URGA 2DRAA 3N4WA 1HMVA 1GFWB 2ZOFA 4H4MA 1KP6A 4EK2A 1WUUA 1IR1A 1HNVB 3PYEA 5D4PA 3KOAA 4K4ZA 5ETVA 3WQPA 4G1QB 5H9FK 4I7FA 5KT7A 5DDPC 4QWBA 2VC1A 2ZH4A 2R7XA 5IQQA 1ZZNA 5CQGA 1GX5A 4HHHA 1UETA 1D9AA 3PR5B 1RI7A 4DV1F 5BJRA 4DWIA 1YHQS 4CLFA 3GMGA 1U1QA 4EYHB 5A76A 1VQ4S 1BY9A 3D6FB 2Q1LA 4R0EA 1X7VA 2F63A 1HW9A 2HAFA 2I6WA 4MIAA 4DX7A 3KLHA 8RUCA 2DR7A 2AYEA 3CO0P 1FX4A 5KFKA 2HW3A 3JTOA 2NXCA 3P4UB 1NJXA 2UXBJ 1VLOA 3LGMA 3QT6A 2QL5B 3IWLA 2O5DA 2KJVA 3DLJA 4CLSA 4GVBA 4MK8A 1FKOB 2OEJA 3UN2A 3T5HA 3RB0A 1LWEA 4FF2A 2GIQA 2UXCF 4UZCA 2HKEA 4J90A 2Y0SD 1T7PA 3OR2B 3D67A 4HACA 4NMLA 3IP0A 1U1KA 1YLXA 2RS8A 1QSSA 4DPXA 3SV4A 1C4CA 4DPYA 2V0NA 1XMOF 4JB8B 4A8QA 3HVTB 5IXUA 2XS7A 4MKAA 2RU9A 3N6MA 4DV5J 5CYQA 2C42A 4Y0FA 2BJ7A 2PMZD 2XMWA 2IVFB 3UE2A 2RHSB 1IBLF 4ENOA 2A1BA 3RRKA 1HW8A 4WWSA 1VCTA 2BACA 3D68A 2FVRA 2HBZB 2J9CA 4DSFA 2OO4A 4CH1A 1IWAA 2BJ9A 1JJHA 1LXNA 2UUBF 1UPPA 4F0KA 3D3CJ 4ILLA 2XC9A 1SKRA 3MGJA 4OJ3A 2R7RA 1ZZFA 4B9VA 2CWXA 2Y0BB 1KLNA 5E5NA 4A47A 3A3NB 2ZWPA 3CJ5A 3ICLA 3GONA 1BLUA 1TFYA 3OL6A 3MAAB 3D9BA 2Y9HA 2MSTA 1UWAA 5B0BA 1I6JA 3PZPA 4P2SA 2QFIA 2DO0A 4NA1A 4GC7A 3Q24A 1F5CA 2CVEA 4G1IA 2VUGA 1NSPA 1N36J 4PEOA 4N8NA 2FY8A 1KQSR 1NSQA 2V6AA 3W9HA 2YNGA 1RHJB 3H5UA 5EN1A 1GH8A 2RT3A 2DNNA 3KLEA 3M6WA 2G0IA 1UP1A 1Z1ZA 4WE1B 1U24A 1XN9A 1RB0A 1PO6A 4CDIA 2XHCA 1GTHA 1VQ9S 3FZBA 2FVPA 1N32J 2CVIA 4QWEA 1Q0NA 3TYTA 3BV8A 4RUHA 1SH0A 3OL7A 1R7IA 1NJZA 3I0SA 5DM7Q 1YWXA 1S79A 3WX4A 4Q45A 1H7WA 1SUQB 4LVNP 4EZ9A 2WOMB 3DOKB 5KFNA 1RWNB 4IR1A 3MMJA 2X1AA 1PCAA 2C28A 5FJ4A 1X5TA 2Y1RI 3GTYX 2G2YA 1VRQC 4PWUA 4DV2F 4DX8H 2V68A 2RDJA 4WIQA 1SL1A 3A1YG 3IRWP 2CPFA 2GO9A 5ETQA 1U2RA 2UZAA 1EETA 4HI1A 1CLFA 3MMCA 2Z56B 1XNRF 3MM6B 2EKNA 4M5JA 1N48A 2CNLB 3D66A 1G6BA 4K4VA 3KLHB 3JSRA 2BKOA 5IZHA 4OLOA 1RT5A 1U1PA 1CBKA 1WHWA 4KQZA 4DN9A 3P5TL 1S48A 1B4SA 1D09B 1H2VZ 5KG4A 2MB0B 4DUZF 5AE3A 2KXHA 5DM6Q 5AXLA 5HVFA 3CC7S 3FKBA 4J9MA 1LOUA 2B56A 2DEJA 3L7UA 1PKUA 1EKRA 3GJSB 2HHVA 1X9MA 3J80U 3ETOA 3SCKE 2UUCF 3MDFA 3HVWA 3OFFA 3RAXA 1H7XA 2X1BA 2MLXA 3GSIA 2CPYA 1NDLA 2DNRA 2HQCA 2CXEA 3CMAS 3W5ZA 4X64F 3CE8A 3DLHA 4B17A 3GIIA 4J37A 2MJNA 2M4MA 4FZVA 1S1XB 2FUG9 2X51A 4LFAJ 1VISA 2KHDA 1J5OA 3QGPA 1WHVA 4L75A 3DC2A 1RYRA 5CYQB 1X60A 3MR2A 3RGIA 3CCUS 1RABB 3D1OA 3MHYA 3Q89A 5IT4A 1DZ5A 1CSJA 2C3UA 2YKNA 2I1RA 3KFWX 3SCJE 4ED2A 2K1RA 3QO9B 2V4JA 2NUUG 3WC2A 1ZH5A 3P3DA 1SH3A 1GEHA 4P9SA 2N4CA 4ED3A 5FLXY 1T11A 1UZHA 4ZPCA 1U8WA 2CZ9A 2EC2A 1HNZF 2C3PA 3AJ2A 1YJ7A 1IWGA 4ECZA 1N5SA 3NBPA 1Y10A 1S7IA 5A6PA 2LDIA 3BBCA 5HQ8A 2R7OA 2Y1IA 3QAUA 3ISZA 3B4DA 2D69A 4Y2KA 2GV1A 3K57A 3SEOA 4U7CA 3GG0A 4DV1J 4QYRA 2E29A 4I6AA 5EWEA 1HNIA 4DJBA 2ZH7A 2C3YA 1NH7A 4CLTA 2FLLA 4OI1A 4JV5J 2MKJA 2YNGB 4Q0BB 3ILLA 4M5DA 2XMMA 4OZJA 5JJBA 1J27A 1RLCL 3R7SB 2FC8A 3KLEB 5A8RA 4NMXA 3HHEA 2ZVSA 4ITSA 4IFYA 2DNKA 2PC6A 2XNRA 1DTTB 3CCZA 1VBXA 4I6YA 3CJ3A 4PQUB 1Z2LA 3V4IA 2CUYA 1KOOA 4C3MA 2AGPA 2VA3A 4NLOA 3IRXB 3DGVA 4LF6F 1LQ9A 4J9RA 4RW6B 2QX0A 4Q2LA 4O3OA 1C2PA 3EM1A 1EQ0A 2OFGX 3PTWA 3KG1A 3CGIA 2UXCJ 5IWAF 4O44B 2UXDF 2B0GA 4NLXA 1XWLA 3DRRA 4Z7YA 4DHVA 1W2IA 2E1PA 5D0GA 3GIRA 4I69A 4LUBA 3MD1A 4YQWA 2V34A 2GC8A 1ZM9A 1DLOA 2Q6CA 3SZ2A 4QOTA 4NZ7A 4OJGA 4OV1A 4DEZA 2G2ZA 2HRUA 4YMEA 1EETB 1XMOJ 4J9KA 3T1AA 2FB0A 1SXLA 1WTBA 2CJYB 1UL3A 4OI4A 3LP2A 2RSQA 5LMNF 4Q44A 3M6VA 4OHWA 3RB4A 4GC6A 3FSIA 8ATCB 4QCLA 2OUGA 3NRBA 5G4DA 1FEHA 1QTMA 2IJFA 2B6AA 5HATA 2CJAA 1VQ7S 2B9EA 3T6JA 4MKVA 3N6LA 2D1CA 3LQVA 2UUBJ 2IM3A 3CDAA 4N7TA 2DHXA 1VQ6S 4Q8FA 4JI1F 1IQZA 2HVZA 3W5XA 2E5GA 1T02A 3ET6B 3U7JA 3BEGB 1K73T 2BVZA 2LFVA 2ZJRQ 4QW8A 2ZH2A 3AA8A 3M05A 1U02A 1TELA 4J5OA 4UQTA 2XQCA 1XMQF 3PYDA 3UWTA 3O2IA 4WIIA 2MQMA 1TR0A 2BQUA 4P2MA 3KJFB 2ZWOA 1BC6A 4C8KA 4DBQA 2XI3A 4R5PB 2EXUA 1APSA 2MY7A 4HTIA 2P9CA 3WIVA 2DNPA 2HS3A 3VCDA 2KI2A 3POTA 1N34F 1IR0A 1TP7A 1KFSA 1PJ7A 2VASA 4EEYA 4P6QA 4PWDA 3FBFA 1NH8A 2YKNB 2KFNA 2XGQA 2ZBIA 4WFZA 1JLAB 3D5MA 4MMOA 2KT3A 5J2MA 1R0AB 2V4JB 4L73A 3I87A 5DZ6A 3M30A 2AX0A 2ZZTA 1TL3A 3DRPA 4NYZA 4DCPB 3RU0A 2MKYA 2ROGA 1VRTA 3LP0B 5AXKA 4JI7F 2QO3A 5KFTA 3KHHA 3M9MB 2E5HA 5HLFA 3G71S 3NAHA 3UDVA 2DPIA 2M8DB 2BYCA 1RWPB 1E6VA 1WF2A 2QRRA 2JC0A 3TR5A 4GKKF 2OD6A 3L09A 1MW7A 3WHIA 1TK5A 5KFPA 3IM9A 3PIPQ 5I3UA 5KT5A 5E3CA 2JFKA 2HFZA 1FKPA 3E2EA 4NLPA 1XNRJ 4ALZA 3GIJA 3KJNB 2X1GA 4XPEA 2BANA 2JEFA 1WC3A 1SC1B 4M5DB 2R2RA 1S49A 3NLCA 4AUKA 2ZUAA 2OJ3A 1AFIA 4JP8A 3SCLE 2DGVA 3NS5A 4K4UA 3FFIB 5DS7A 3A4TA 2B43A 3W2VB 1XEZA 2W2MP 4LSNB 3RB3A 1C1CA 1VK3A 5L39A 3EGWB 4DUYF 5CYMA 1DAXA 3V4IB 2F9JA 2EBGA 1JKHA 3I0RA 3LW5C 3HFVA 5BYRA 2VA2A 3W64A 3W2WA 3PO4A 4TYBA 3VVUA 4K59A 1FVSA 3DOMB 3TZWA 2XULA 2R42A 5L1KA 5J2PB 1LFPA 4O0NA 5L9NA 5E3AA 2BKPA 4MYTA 1SPBP 3HHLA 3DRRB 1RHRB 3FEXB 3TVYA 1LW0A 1OJ4A 3U1NA 3FMBA 2J9DE 2XSJB 1WELA 4X64J 3CMQA 3O6QA 1IJEB 4CO0A 4HDGA 4ZVSB 4M5LA 2QA1A 3LOUA 2KJWA 1FTCA 4I2QB 2VIHA 2OP5A 2XLJA 4LF7J 3DLKB 4DR5F 1LXJA 2BR0A 3FBEA 4IFVB 2AHOB 4ZVFA 2CIMA 2ZH5A 4LSLB 2PSZA 2IAJB 4ZLLA 4WKRA 4BHQA 2M5YA 1VYAA 1PYOB 3H8YA 3TQEA 3QFWA 2CQ0A 1AROP 2J76E 4M5HA 1HQEB 1EJ7L 1ZAWA 1EHWA 3LPEA 4WF9Q 4PXDA 2D3O1 4KT0C 3DOLA 1FXLA 2AJ4A 3G8SA 2CPJA 3VALA 2DNOA 4QIGA 4W4MA 2QA4G 5ETOA 6FDRA 1S0OA 3ADAC 4IO1A 3F41A 1XR7A 2NLWA 3IBCB 2P5VA 1K44A 4M5KA 1ITPA 1WEYA 3GCWP 1ZYQA 2BM1A 4LRAA 2DD8S 1TVRB 2DGSA 2IRXA 2VICA 2DXDA 1SJ4P 3OL9A 3ZZZA 2ZH9A 3G82A 4CTAA 3DI6A 4C8MA 2J0QD 3SIPB 2C2EA 3POTB 3HP6A 5D15A 1R27B 4MKYA 1K9MT 4WCEQ 4A8YA 2C2OB 1U1NA 1T3NA 2OPSA 4CP5A 1ZM2A 2J0XA 3FBCA 1CPZA 2YWEA 1R8HA 1IKYB 1TKDA 1NKCA 1LWXA 1TL3B 3DRPB 3JTNA 3R7NB 4QR2A 3M9OB 2YNFA 3QIPA 2OI2A 1X4HA 1LV5A 4PG4A 1T3OA 2QYGA 5GAHI 1VRTB 4QJVA 4FNHA 2V63A 3A8JA 1FFSB 2KRBA 5F8GA 2R7WA 4O3QA 2J6UA 2LQBA 4XPCA 3GSDA 1AUSL 4BCAA 2HNDA 2G4BA 4LQ9A 4JI2J 1S6UA 3DN9A 4QIFA 1J5EJ 1M5HA 4KFBA 1H73A 2B7BB 3SQGB 2HZVA 4C4WA 1RTJB 1X4GA 2D3ZA 3PDNA 5LMUJ 4YHHF 1RT7A 2W4CA 1JLQA 3CJKB 2BA9A 3FZ2A 1KWMA 4ICLB 3SDEB 1BHNA 4LT6A 2F8MA 1NM2A 1YJWS 4LF8J 3J7YI 2VPXB 1KR4A 4ID8A 2NREA 2V2ZA 5MLCV 1RGVA 2NCKL 5KTQA 3WDOA 4K50A 2HGMA 2C3OA 1HI0P 5CYMB 3NP5A 5KFAA 3PYFA 2JZ5A 3B6BA 1FKAF 2GX8A 1NNDA 2JWNA 5HP1A 1TV6B 3ITHA 3DKDA 3W2WB 3CJQA 3PHTA 3NMRA 5F8JA 2NYHA 2MGZA 2N4DA 3LANA 1XQIA 3KUGA 1YTYA 1WC5A 1HBNB 2Z30B 1NHKL 3UPFA 3DRYA 2MKHA 1XMQJ 1JLCA 3JSMA 3CJ8A 5J1PA 2W7OA 4FXVA 2F7VA 3SSQA 2EFGA 1TKXA 3E01B 3AXMA 2DIVA 1RHUB 4O3PA 4JV1A 1JLGB 3EPIA 2OTLS 1H72C 2L9DA 1EARA 2MZQA 3ZZUA 2QFJA 1U2FA 4B9LA 3FSXA 3MM9A 5DQIA 1KLMA 3QT7A 1KHVA 4G1PA 3RAMA 2D3UA 2VH7A 3MMBA 1ZBTA 4X65F 2IA0A 4MYUA 4C0OC 4DV7F 3A12A 1KQKA 3M8SA 4JI7J 2IHR1 2CPZA 1JMTA 2DK2A 2F9DA 4FXDA 4JOUA 5RUBA 3AHPA 5HK4A 1QM9A 1S97A 1F9EB 4K4SA 2W2QP 1N4LA 4GKKJ 2PGCA 2CFXA 3TJ9A 4Q8EA 4JI4J 4KH1B 2E7VA 1JNRB 4NWBA 4Y2AA 4F2SA 2XTJP 2MQQA 3HZEA 4OI0A 3ZNUA 4Q5VA 3GV8B 3OHBA 2HGNA 3AODA 1SKWA 2PDAA 1ZAXA 2HQFA 4X66J 2MDAA 4DDFA 5JMNA 4LREA 1Q79A 1YITS 9RUBA 2OPSB 2M9KA 1PYSB 3M9NB 5DGAA 2RU3A 1FDAA 1RHQB 1FFGB 2W01A 3K2YA 1TUVA 3KK2B 1WDTA 3QIPB 1IM6A 1FF2A 3K8VA 3MEKA 2YNHA 3LPYA 1HLWA 1DQAA 2ZE2B 3MCMA 2ZITA 4AL6A 2VQEF 2OH2A 1DTQB 5KFGA 3KLGA 1GMVA 1Q7LB 4MH8A 2Z2YB 5IS2A 1NK5A 2GZOA 2HIYA 1V5VA 3A8KA 2GHPA 4OZ1A 4KFBB 1N0UA 1TKZB 4NOHA 5B09A 3BSAA 3BSOA 4HR2A 3DRSA 1D1UA 2DGQA 2RILA 2DHHA 3CCMS 3D2WA 4NLSA 3KMQA 1JLQB 4ZCMA 1V9OA 2MQ8A 1QTNB 3C2PA 1YG0A 4DR5J 1UWBA 4H4KC 5LXYA 2P9GA 3GU0A 1P27B 1RT4A 3I32A 4KPCA 3MPYA 2H51B 2NZ4A 3ISND 2DCUB 1NB2A 3FGVA 2XYPB 3V6DA 1SL2A 4DV0F 1B3TA 1F9HA 2IMOA 2B8QA 1FI4A 1VIXA 2E5LF 3DMJA 4ZIVA 4R8UA 3K5LA 2W9BA 1FJGF 5T7LA 4M1KA 1R0CB 2DNHA 5GAGU 4HHJA 3I4HX 3HULA 4C8NA 3V6JA 3EXYA 2BM0A 2C2NA 2MJUA 1Q4RA 4A48A 4ECUA 2FD2A 3IA0A 1M1GA 3GQCA 2VPZB 1GXUA 3FCWA 3H2VE 4XDCA 3C6TA 4YB7A 3LWLA 2E1CA 3H40A 1X4AA 5I3QA 1QY7A 3IR5B 1JLCB 1KOHA 3EE3A 4F04B 3T1HJ 1S1TB 4MIBA 3MZIA 2DNGA 4OV6A 4PXCA 1TKXB 4DZ6A 1T9VA 3IC1A 2XY5A 5KFQA 2C2MB 1RWOB 2VG5B 3GV5B 1HPZA 2QIFA 1DY3A 2OHDA 4CIOA 1F2HA 1U1RA 1V3SA 1PJ5A 4EBEA 1P9YA 2IYIA 4B3OB 4DL7A 2ALZA 2PO4A 1VHIA 2RNEA 2FJVA 4ZDNA 1RBLA 1S10A 2DITA 3TP2A 2DVIA 1CQNA 3OL8A 5KFCA 4NLTA 3O5TB 2ZJPQ 2L08A 2JLFA 1PYTA 3NMAA 4WZMA 4ID5A 3ENWA 1PBUA 2YPYA 2Z58B 3TOQA 1CJUA 3BJYA 2DRBA 1GMWA 3NEKA 1JXVA 3OFGA 3HK2A 4K7QA 1G7CB 2WONA 3CVKA 4OYOA 1T03A 2B4PA 4KBIA 1OYEA 4NASA 1ROFA 4EBCA 4TU7A 3UFCX 4XTTA 4FYWB 1WACA 3NCQA 2X7IA 4AT1B 3HDSA 1PC5A 2YWWA 4BC7A 2IA6A 2DHGA 5KG1A 1YRXA 2F8EX 4TVAB 3GV7B 4DPTA 3FEYB 1X4FA 2HYIB 4DR1F 3D3BJ 2JVRA 4ZCIA 2CWKA 3N0VA 1M5PC 2BRKA 4ECSA 4EO8A 2E66A 2R7UA 3C8YA 4Z2XA 1Q82T 3OXFA 4W92B 3P8BB 3TNVA 1KKHA 2QTWA 5F8HA 4URSA 1N6QB 3FJ2A 1OIAA 2HVIA 1D8ZA 5GMEA 1RWVB 5ETPA 4CO5A 1WDDA 2QJ3A 3EZOA 3MR3A 4KGXB 1DRZA 1FE0A 2OMOA 1F3FA 4RL1A 2ATLA 4F8RA 4OJ1A 2HHWA 3PVXA 2RF2B 3NXZA 4YY3F 2XSFA 2XY7A 1VR6A 5T14A 4J91A 1SC3B 3FRZA 1RAHB 3M8PB 2JL9A 2KDOA 5ETRA 3W63A 2CQCA 4BWMA 3TVZA 2JX2A 1RXOB 3JAMY 2ZFHA 2M2BA 4EU0A 1AZSB 1UEKA 2KVQE 5FDLB 3HSDA 3AT1B 2CZVC 1NLKL 3CD5A 2MZRA 4PUOA 4ETXA 1FNOA 1SJQA 2Y1LB 4RU9A 3KLGB 1N5VA 4LIWA 3DFEA 1TL7B 3GIMA 2VL1A 2AJFE 4USVA 5J2QA 2V4RA 1NPRA 5KFOA 1MMNA 3I55S 2PEHA 2V2KA 1N33F 4ZVUB 2ZD1A 4TY8A 1RT4B 2VKZG 3K89A 3KUHA 2V67A 1PIEA 4H4OB 3V6DB 4NEYA 3HHNB 1Q1KA 3HMJG 1FRLA 2PFFB 3R5DA 3AJ1A 2NXEA 4DU8A 4N47A 4KR0B 5F9NA 1BMQB 4OYIA 4WFBQ 3CULA 1RTHA 4JV2A 2W4DA 4IDKA 3C46A 3DMJB 3N01A 3CIMA 2W9BB 1P1LA 2JHEA 3UDLA 4FS1A 1U0HA 4X65J 1ULRA 4RUAA 4DV7J 1HWJA 4Z37A 2GMJA 3IN5A 5A0YA 3C6TB 5HQMA 2R7SA 5AJ3F 3JSBA 4K0KF 2HFOA 4M95A 1KVKA 2EG1A 3KKFA 1SIWB 1C0TB 5J2NA 4KHPF 2EFQA 3BO3A 1YIJS 1RYSA 1HBUA 1NPPA 1Q81T 1YJUA 5KFJA 2BEFA 5ETNA 4DL5A 1HPZB 2BX6A 5A8WA 1RTDA 3HHLD 3SSRA 1FNMA 1DFDA 1EQMA 3SFUA 4NLDA 1T05A 3DU5A 3R5AA 4P73A 3RZAA 2Z2LA 4ECRA 2ROPA 4ED0A 1DHMA 4DLEA 4IH5A 2I9SA 3DLGA 5KFMA 2C2KB 2GGPA 4ID5B 1HARA 1C1BB 2LEPA 4UUWA 1CJUB 3BGRA 4ER8A 3BBFA 2BUNA 1FRJA 2HEKA 2WONB 3BS9A 3BZQA 4DG1A 2UVUA 4WFNQ 4UOFA 4XAKA 4NLGA 2QT7A 4DL3A 3U1MA 2POKA 4DR2J 1W25A 3CEDA 2G0CA 2NYIA 4ZLJA 2ZNYA 1R8BA 4DZDA 2Q79A 1UVJA 3QMQA 1N5TA 2J5AA 2CJKA 4A8MP 2ERRA 1FCAA 3FMWA 1HBMB 1TMJA 1WC1A 2RS2A 2HK2A 3EZUA 3JYTB 4C2MA 3MAQA 5GADI 1LWFA 1I94J 4USHA 2KO1A 3M2RB 4JI3J 1B7YB 1FD8A 2FJDB 5KT3A 3Q22A 3KDOA 5CXTA 4OHYA 3V2UC 2YQ1A 1S57A 2ZH8A 3BPSP 3CDUA 1OMSA 4RWWA 2MZ1A 4O3SA 2WSFC 1WEXA 1G4CA 2W8LA 3DLLQ 4F3OA 4MAKA 4XDDA 2YXLA 4DV0J 4ZKAA 3KK1A 1RT6A 4ES3A 3IBWA 2FLNA 2OPRB 1SQEA 1V3ZA 4NPOA 3N9UC 3H90A 4NYOA 1HR0F 1UEUA 2UVVA 3GFXA 1B99A 4Y2IA 4F02A 4TU9A 1S0NA 2WW4A 2GAHC 4PUOB 3Q8QB 3IG1B 1YJ9S 1HFEL 1SQFA 4P52A 2J7WA 2RMLA 1VQ8S 3PFEA 5LL6d 4NXMF 2RQ4A 5C2CA 1X5SA 4FKXA 3LF0A 4PG6A 3DGPB 4RKUC 2HGLA 1CS4B 3MM8A 3HSZA 4CM0A 3TEGA 2U2FA 1EB0A 5C25A 2R2UA 1N54B 4KY3A 1VDHA 5E41A 5D8HB 5CCLA 4B3TF 4ANEA 5CABA 1GXLA 5KT6A 5KFYA 3RTVA 1JB0C 3VQSA 1HHTP 1RAJA 4QU7A 5KT4A 4ZPVR 1D3WA 4Q43A 1NHVA 1RTHB 3P96A 4PAAA 4IDKB 3EVOA 4C9DA 2H3EB 2RD5C 2ZZMA 3PEHA 2MMYA 4USKA 2NPFA 2JLGA 1PC4A 2R2SA 1RTZA 2IY5B 4DL6A 3I5BA 5KFIA 4FF1A 4P2FA 4NA2A 2JVOA 3M1VB 1VRUB 2XG8A 4DR1J 5BR8F 1RQ0A 1SKSA 3G4SS 4LFBF 4RNOA 1GX6A 3QBCA 2H4YB 5L9XA 2XBPA 4DQSA 3BGUA 1HBUB 1I3OB 4L72B 2FHJA 4CLKA 2FJEB 3GR0A 1F5BA 3FK4A 4OLPA 5D3GA 4DPOA 2ZC4A 2RIJA 2LECA 2HVEA 3FBBA 5ETTA 1T05B 3QSYB 1P8GA 2W2OP 4DV3F 3BO2A 1Y5NB 5ITHA 2DY1A 1FA0A 3TA2A 2HWTA 4K4YA 4NE9C 2E9ZA 4YY3J 2VC0A 4EZ6A 2R8HA 1U6ZA 1U0SA 2GVZA 2EWHA 2YNIB 1Z2ZA 1JLFB 1XTZA 4ELTA 3H2LA 3UN3A 3H7HB 3V6KA 2PIIA 3NNCA 1LK7A 4WP3A 2IBKA 2B4VA 3DM2B 1SL0A 1WG5A 5B0CA 3DRXA 3O8WA 2OPQA 1IM4A 4QYZJ 4AXIA 3CJSA 4C8LA 1TZ0A 2DGWA 4LFCJ 3MM7A 2EEYA 4YEAA 5HI7A 1CULB 3MEEB 2OGUA 5CH7B 1U49A 2EW9A 4KE5A 1CJVB 3R6GB 5G0RB 1K1QA 4RUBA 4QWDA 2P8IA 1YRUA 3T5KA 1VBKA 5L1LA 2CJQA 4OX9J 3HZGA 4ZJLA 2BE7D 1HNVA 3FQLA 3ULHA 3U02A 2OIHA 2ZDPA 2FHMA 3W1YC 1X4CA 4RBUA 5E7OB 4G1QA 5KFXA 1TU0B 3TJ8A 3HFKA 4GO7X 2G13A 1WJ9A 5MAOA 1HI8A 3C14A 2VQFF 4J9PA 2F65A 5I42B 1RAAB 1JJCB 3FVYA 1JIHA 1Q53A 3IR7B 5AJ3J 3DHWC 2FJXA 4FKYA 2RDIA 4K0KJ 4Q2MA 3BGFA 4WTYA 1NKEA 1HNWF 2WRMA 4RWXA 4QWAA 3NGKA 2P6SA 4F50A 2CQBA 1VQSA 4DS4A 3OVBA 3IS9B 4PG7A 1RLDA 3QZ8A 1JJ2R 1L3TA 1WOSA 2HRTA 4OZLA 4KIAA 1RZMA 1FWKA 4ANCA 3P49B 4QPXA 3HFZB 3HKZD 4QIVA 4M5NA 4NX9A 1HHSA 1NBEB 1X4EA 4TLQA 2DO4A 4JV0A 5AXNA 2W2NP 4X4NA 2DTJA 4ZMMA 3R1LA 1XMBA 1FKOA 3C3LA 1I5OB 3V81A 2WZ1A 1MLAA 3GILA 3PM9A 1MROB 3VGVA 1KDNA 2LEBA 2Z8QA 1TTHB 2Q43A 4M94A 4U8YA 2AF6A 2C2ZB 5D77A 2HPUA 1VOMA 3OR2A 3PFOA 3BKTA 2Q66A 1RE1B 3THTA 4AQYF 2LMIA 5HL7Q 2HS0A 4A8WA 4QW9A 3BKUA 2CQ2A 4DR7J 4Y6IA 4IKAA 1B0VA 3DXSX 4CRJA 2QV6A 3KG0A 1AUDA 3CCWA 2FVSA 2I38A 4QBUA 3GB0A 3A3OB 2OEKA 5D6GA 3VAGA 4DFKA 3DDIA 2ZM6F 4X4RA 1Q78A 3KK3A 5HMXA 2B4UA 3IBFB 3DYAB 4HI2A 5D3GB 3BGLA 2VPYB 2H4WB 3D6HB 3OTDA 3R97A 1KVIA 1BXNA 4O23A 1F3VA 2M3DA 1BQMB 3CJRA 1UW4A 3C16B 4GVLA 4OZ2A 5KG7A 4DR4J 2EK1A 4E0DA 3JAMU 2BQ3A 2JC1A 1Y4ZB 3HT3A 4X62J 3QYYA 2HNZB 1HR0J 4UY8T 4KV8A 2E5JA 1NJWA 4G6VB 3UCZP 2CNNB 3UQSA 2WBMA 1UEVA 4LR8A 3RW6A 4ED1A 5LT5A 4KO0B 4BWJA 3RBDA 2ILZA 4ZVHA 4NXMJ 4YFUA 4LF1A 2MKIA 4QQBA 4ZVTB 1U6BA 4DUTA 1Q8IA 1QAJA 1M5SA 3T1YF 1R6YA 2XCPA 1FRHA 2RB7A 3ZXWA 3G6XA 3CW2C 3NGDA 2MQOA 2PA3A 3OLAA 4MJKA 1SUQA 5D0EA 2WOMA 3QJPA 1NZAA 4IRCA 4FYYB 3DOKA 2P2CB 1IKVA 1NB7A 2ZC3A 1DQ9A 3SCIE 2FTRA 1T9UA 2V2VA 3IGNA 4ED7A 4ZCKA 4FYDA 4UOCA 3C14B 4U8VA 2KTQA 1HBOB 3ISNC 3OTOJ 3R3TA 1PAUB 4CI0B 4USUA 3CMES 1Y3KA 3D54A 2I2YA 2H5JB 2YQ0A 5HVGA 2AQ4A 4KJIA 3NL0A 1RJJA 2VDHA 3MM6A 1UVKA 1HWKA 3NGSA 1GT8A 2KU7A 1PG5B 2YX7A 3W8PA 4U9RA 2ZDOA 4J9UE 3HVRA 1GQEA 2RE1A 1JJ4A 1URNA 4WZQA 4JI8F 3PCOB 4KGKA 3BN7A 3T41A 3JS9A 1S4FA 4DV3J 3OJUA 4LRCA 2YBVA 4NLQA 2Z57B 1PILA 4WYLA 3DDKA 3V81B 4DQQA 4NXNJ 3GCXP 1VJQA 5HN0A 4RJVA 3T3FA 4LBHA 2CQ4A 2LQ5A 2YWGA 1XIQA 2XLIA 3W60A 2YWKA 1WI6A 1UTAA 4CLYA 3OJSA 4MKBA 1OWXA 1VLYA 2AYGA 1YDLA 4IOCQ 5T41A 1S1XA 3MM5B 4ZCLA 3NS7B 4FBTA 5EHHA 2ACYA 3ZZ0A 1XNQF 4CWBA 4A8SA 2AZ3A 5KFHA 1IVZA 2VFSA 1V5IB 3KK3B 2ACMA 2WVCA 4CLZA 3OTBA 3QO9A 2XCAA 4O0IA 3EVWA 1S1UA 4H54A 4LRFA 5J1EB 1SIZA 5IQ6A 3R8YA 4OYXA 1V3RA 1U09A 5DO2A 1KS2A 2HHHJ 2IPOB 3QSIA 3R5CA 3G8QA 2J0WA 1SJRA 1RBAA 1ACMB 2GAGC 2L3MA 1A6LA 2OMLA 2Y1JA 4B9SA 4KV8B 4UT4A 2RKIB 3NY0A 2XNQA 3GJRB 4DL4A 3JB9k 1XJWB 5CA5A 2LA4A 1B70B 2M88A 4B3RF 2J9EA 2VFVA 1U4BA 3HHKA 1HNWJ 1IBKF 3EWGA 5LJ3Y 3EGNA 2RHQB 4Q0BA 2IYGA 2KB2A 2LU2A 4B3MF 4LBIA 4ZLNA 2NPIA 1NMEB 4C3KA 4F4XA 1UJ6A 3ETMA 1BQNA 5D0HA 2GJ2A 2YKQA 2XO6A 2VFUA 3VF0B 1DTTA 3MUTP 3H5XA 2DNMA 2QLXA 4PQUA 3ZTRA 2F1FA 1MWYA 2Q6BA 4HLBA 2OEMA 1TAUA 4OHZA 2F4VJ 2X3DA 3IRXA 2PD1A 4RW6A 1JLEB 1FFWB 1RISA 2W24A 4OX7A 2PFDA 4IQXA 3TVKA 3HI9A 3OVSA 4OX8A 2C22A 1B0TA 1QDUB 1IKVB 4O44A 2HURA 3EJMA 3J81U 1BE4A 4CO2A 4K4XA 1AB8A 1HQUB 1SV5A 1BD6A 4IQMA 2G1HA 2CYYA 4GO5X 5IV4A 4I0WA 2GIFA 4LR7A 2WTFA 4WXOA 4A46A 4C3LA 1WI8A 2QA2A 3OUYB 4LF2A 3BYRA 3MOZA 5KFUA 5LOQA 1V6HA 4AYBD 4LF5J 4IOAQ 3AQPA 3C6UB 1JXLA 2J8AA 3VAFA 3AFGA 4EGLA 1SH2A 5K14A 2YQ3A 1EKSA 3EDQB 4RX6A 4IH7A 5B7WA 1GTEA 5KG5A 2BJ3A 2R3VA 4OYWA 2DXEA 1TK0A 2E7WA 1ICEB 3HM9A 2XLKA 3VWSA 3TAMB 2UVWA 5E33A 2HBRB 3I96A 4OYBA 4OJHA 2W25A 1FX2A 1WTFA 3KLIB 4IG0B 1GXTA 3PO5A 4H4KA 3Q8VA 3ET6A 2ZHBA 1IKXB 2DEIA 2YX4A 1RT3B 1RT2A 1SJ3P 1M90T 2FPHX 3HHLC 2MQNA 2DR9A 1I1GA 4S0MA 2UU9F 1WOPA 4PZVA 2L9WA 3QGGA 3UD5A 5IM0A 4QZVB 3EPGA 4UY85 1NJIT 1MN7A 4CNZA 5K9FA 2YKMA 4JI0F 3D1HA 1CJTB 2JH3A 7FD1A 2DGUA 4ZIWA 3W61A 4P74A 4R5PA 3KLVA 1SI9A 4L3KA 3AOBA 5LSRA 1RWXB 3KYLA 2BDPA 1PAEX 2XZDB 1JLAA 5B0DA 1R0AA 4ED4A 3ENAA 5GADU 5LSOA 3BPDA 1S1UB 3G6ES 4LF4F 1KRPA 3JQMA 5KFZA 3Q8YA 2QMUB 5K8OA 3LP0A 1WWHA 2P9EA 4WFYA 2DR8A 4C0BA 3SBMA 4FPIA 4URQU 3M2VB 4F4ZA 3BDPA 3LP1B 1MMLA 4IOBA 4FBUA 3N6NA 1PJ6A 4DQPA 1L3KA 1VHFA 3TWZA 3DLBA 4J9VA 2OFHX 3ZTQA 4P7TA 3M8YA 1NK6A 3QRRA 2BKNA 3S6EA 4OHXA 5E3QA 3PXGa 2PA8D 2GVDB 3L7PA 1RCOB 2FQQB 2PEBA 1T94A 1SB6A 2OSQA 1Q16B 4WK1A 1TKTB 1BQNB 2V50A 3FFIA 3G9CA 4N76A 3VGSA 4X4SA 2QEXS 3W2VA 3V6HA 4LSNA 1FRIA 4E2FB 4NLRA 2LXIA 2GJFA 1J2VA 3D0GE 4RW8B 3ZZPA 4C48A 4ZS6A 3H4BA 5FD1A 3OSPA 4Y34A 1ZA2B 4EUVA 2CAJA 3J7ZT 3DOMA 2VG7A 4P75A 2ABYA 3FNNA 3VAMA 2B9YA 5J2PA 2DJWA 4J9SA 4USTA 4J9OA 1Y9OA 1U2CA 2ZOGA 2K7KA 3ILJA 1SV5B 3J80Y 2XSJA 1TL1B 2B7CB 4ATNA 5HMWA 5GMKa 3DNCA 4B02A 5ETKA 2UUTA 2GHVC 4I2QA 4JYAF 5C7PA 4I2PA 1YI2S 5K8MA 1KONA 4LRDA 3PW2A 4KKOB 3MFHA 3DLKA 3M32B 5K14B 4IFVA 3SYZA 2JOQA 4LSLA 2IAJA 1QSLA 2HFVA 5EX0A 2G9OA 2ZBCA 2A6OA 1IBLJ 2FVQA 1HQEA 2COLA 3RYLA 1DBDA 1XR6A 2LXFA 2Z2MA 1S6PB 3Q23A 2D9PA 4CYUB 3LTOA 4M5MA 3AOAA 1NSKL 2N7YA 1WG4A 3TAPA 3MOJB 1EP4B 2WAQD 1O0PA 2DRDA 2H1YA 4ZVOB 1U1MA 2D74B 3NKYA 3X1LB 2CRLA 2O1PA 4DFJA 4IG3B 4RPFA 5GAEI 2V8DA 2OLWA 1RT2B 3SXLA 1FJCA 2VOPA 3MCSA 2EG2A 4ZVPB 2HIQA 1E6YA 1QSYA 4C11A 1TVRA 5IM0B 1UA0A 4PPZA 2KKHA 4ERDA 3IAS9 3H5SA 4NI2B 3IR6B 3OPKA 2WB4A 4RW7A 1KQGB 2FJWA 2YKMB 3IWNC 2Y8WA 1WSVA 3Q8SB 1N36F 1UMJA 5L1IA 4B3MJ 4KRWA 2VDIA 1QE1A 4BC9A 3DU6A 4UW2A 1CJKA 2C2RA 2JRSA 1RCXB 4HL9A 3KJVB 2JJ4D 3ELHA 2XYGB 3A13A 2UUAF 2V9WA 1IKYA 4G3IA 1MMDA 2XWXA 3LAMA 4L74A 4UQGA 1N32F 3PACA 2IMWP 2DGOA 2QC3A 1AFJA 3UR3C 3M2UA 2J6SA 4A8OA 3ZO7A 3G86A 2WK4A 4HHUA 3T6BA 4QIEA 2ATCB 3D6TB 4WP8A 1XERA 3MPUB 3LALA 4DV2J 3GR1A 2BOPA 1CEZA 2HHXA 4RNFA 2XY6A 1ZOTA 3SQGA 4I68A 4YS2A 1RTJA 1ZTTA 5C2GA 4CO4A 2MTLA 3CJKA 1NEEA 4MK7A 2LDYA 2VB6A 3KMSA 4ICLA 3SDEA 4YR2A 1HYSA 4Y2MA 4B9NA 3CCES 4DPUA 4NRUA 4QYZK 2BQRA 4HDHA 3QATA 1YSJA 4DL2A 3MD3A 1RWMB 3KHGA 1QUPA 3BDEA 2AU0A 2XS5A 5KT2A 1F5AA 1RT1A 2E1MC 2NXUA 4YB1P 1UZDA 1WKJA 3VAJA 2V8HA 3R27A 1SJ1A 2F40A 4DUZJ 4DQIA 1NK7A 2HMIA 5IFMA 1AA1B 4R25A 1TV6A 2I0XA 3M4XA 3PX0A 2QMXA 3NGRA 1IR2A 3QGHA 4P10A 3TJAA 4ZP7A 3ZZTA 2VG7B 3HXMA 2UUCJ 2EC0A 2MY8A 2XYHB 1HBNA 3VHQA 4BLGA 2UU9J 4NRTA 1R43A 2RDDA 5SZTA 1URRA 3UD3P 3OW2R 4FVCA 1A7GE 1ZA1B 2QN6B 3E01A 5EGYA 5THWA 1VBYA 2R7TA 2WVFA 2DH8A 1DURA 4LR9A 5CHCB 3GYGA 4TQRA 4I2PB 3D28A 1S0MA 2QLWA 3S1TA 1JLGA 3EYZA 2QLFB 3BF4A 3HVAA 2GQCA 2ZUGA 1SKUB 2CQGA 1U26A 1TAQA 5F8NA 1GNKA 3FC9A 4ECTA 4B9TA 4MFBA 2W2PP 4F26A 4WFAQ 4RW4B 3TUJC 3H98A 4RNMA 2DYAA 3OV7A 1T95A 2KXFA 1R8PA 2QSWA 3GJQB 4LF4J 1S1WB 3S8SA 2CG8A 4R0JA 2ASDA 1OPIA 3Q83A 1F9FA 2N82B 1HNZJ 4F0HA 1XC9A 4EO6A 2D9OA 9ATCB 4NCGB 5HBMB 1M1KT 2AYMA 4RR5A 2J7UA 5CZXA 4ZHRB 4KH0B 1JLBB 4F2RA 3L7OA 4ED6A 1E6YB 2IM1A 3F73A 2JSXA 2HLUA 2ZKTA 4C11B 1U8SA 1REGX 1TL5A 5KG0A 2GA7A 4RW7B 4M8LA 1HQ2A 4F3QA 3PV8A 2FGOA 3BH7B 4E8UA 5IOLA 1YBAA 1S1VB 3VQTA 3GYXB 1CG2A 4ZPTR 4JV5F 1XK8A 1NDCA 1PSDA 1SCJB 1IUJA 3M8WA 3Q8PB 3D0IE 2EFVA 1QE1B 2E9RX 2F3JA 1CJKB 2NSBA 4X4UA 5JVGQ 4YR0A 3MXHP 2CJBA 3QRQA 1OSDA 4CCHA 3OQ2A 3KK2A 4LF6J 1KD1T 2JNJA 4KAIA 4I1TA 2RQKA 3M2UB 5IWAJ 2UXDJ 4RW9B 3J7Z5 2ZE2A 4DFMA 2LU1A 4WTOB 4N41A 1DTQA 5K8PA 4JI5F 1BGXT 5BYSA 1B7FA 2DT9A 2HNYB 4DV4F 1GAOA 1VGYA 4JUZA 3I82A 5KFRA 1TKZA 5C24B 5JUMA 3GWCA 2O67A 3OTEA 1WNEA 4JYAJ 4CLLA 3NWRA 4YN3B 2YWFA 4MIWA 2FLOA 1HYSB 3UCGA 3W7BA 5LMNJ 1VI7A 2IVMA 1N56A 3BSCA 3GYNA 2A3JA 1S12A 2R8GA 3HJFA 3B82A 1HWUA 1OQ3A 2D41A 3CJTA 1S6QB 3L3CA 4B3SF 1RT1B 4WYWA 5HANA 1S4EA 3H25A 2MZJA 3FUYA 4F0MA 2WVBA 3VGTA 3GLJA 2J7KA 7FDRA 2HMIB 2AGQA 3UN5A 3JSYA 1X0FA 4JI1J 2KRRA 2R4FA 1C0UB 4OFZA 2DY9A 2BE2B 2A0FB 2OPPB 5E0OA 1VFJA 1WF0A 2CQDA 3DLEB 3M8QB 2CADA 3I5AA 2C3MA 2FJAB 2ZBQA 4PPDA 5C42B 4WU3A 2FVCA 4F36A 3GJTB 3CIZA 3ZZYA 2OAUA 2ZZNA 1S1TA 5ETSA 5CZVA 2OSRA 3TW0A 3MTJA 3T5JA 1WHXA 3BGOP 2W8KA 2KM8B 2KYXA 5A6WA 3UVJB 2VG5A 1ZPWX 1VQOS 3PRVA 1OY9A 3MEDB 4EFAC 4B3OA 2EBEA 2VG6B 2W4PA 2HQGA 3OR1B 3PY8A 2FY1A 3VV2B 3F44A 2KT5A 1N34J 2KN4A 2HLTA 4KGZB 5IC6B 3C19A 2FJBB 4QR1A 4AFFA 2EFOA 2HHTA 3W65A 2RVJA 4MFBB 4EWTA 1XBWA 3VAIA 5DG8A 5FLXU 2XWYA 2DKOB 2RUSA 2UUAJ 2BW2A 4ZPWR 2I8EA 1RACB 1FT8A 5L8RC 2KG1A 1RU1A 4NL5A 1S9EB 1B64A 3VZHA 3RR7A 2DIUA 1HMVB 4V1Ak 3CJ4A 3ENQA 2AW0A 4H4MB 3ZTPA 4CNYA 3KUEA 1W26A 4RZRA 1VQKS 3QT8A 2K3KA 4LVOP 3PJ9A 5L38A 4DR6F 1S76D 4I7FB 5EDWA 4DPWA 2DH7A 1NHUA 3UNYA 2AMCB 5F3ZA 4ECWA 2HG4A 3QFHA 4G65A 4QPTA 5B0FA 3TI0A 1VC5A 4FNIA 1N6QA 2LEAA 3CWJA 2WW8A 3BQ1A 1Q5VA 3MUMP 4DN0A 1IN0A 2EI5A 2ZEJA 5C5JA 2LLZA 3RRHA 5D78A 1RUSA 1UAWA 1R89A 5AE2A 2LCWA 4OYAA 4Y2CA 5GAGI 2VFTA 3LWMA 1W2BR 2F4FA 1X5PA 1VQPS 2RF2A 4ECQA 2GMLA 2N7CA 3DDNA 3BB5A 4DUYJ 2QLBB 2ZVIA 1N0VC 2Y8YA 2QL9B 3M8PA 1YGYA 2CPEA 3NGUA 2GIRA 3LO3A 3AAWB 1AZSA 5FDLA 1MU2A 3J81j 2PT0A 2IJRA 4GVBB 1WOOA 4P71A 3RUBL 4F4AA 5KFDA 1LWEB 2L48A 4CLUA 1NK4A 2MHEA 3B78A 2HBQB 4CO1A 2W9AA 2BJ1A 3G2XA 1TL7A 4KC5A 5KFVA 2HQIA 1SQGA 1CC7A 3UDEA 4HACB 3OT9A 1FJEB 4FDFA 5B0GA 1KEKA 1HWLA 3TZYA 4RO0A 4LF7F 5DQGA 4H4OA 2K2PA 2O3DA 3E51A 2FDNA 3QWPA 4DV6F 4W98A 3AB2B 5HQLA 3MPDA 1Y7PA 3LAKA 3DCAA 2QMWA 3HJVA 4KSEB 5EX3A 2FGCA 4TYAA 2AZ1A 4J9NA 2DISA 2BV3A 4USIA 1T9TA 1FHTA 2CQ1A 4TN2A 3Q8RB 2LQ8A 4ZP6A 5K20B 1X0PA 1FO1A 2DNQA 2ZHAA 1IQTA 4DSEA 2XB2D 4FVMA 2MXYA 4ECXA 1C0TA 2OKQA 3ZFVA 2HFNA 3U27A 1NZ8A 2E9TA 2R8KA 1AT1B 1S0VA 2F5GA 4FS2A 4U95A 4HTJA 4YOEA 1NK0A 4PYAA 4AE5A 1UFKA 2BOAA 2AGOA 1RHMB 2K7JA 1X31C 2GQ2A 1K1SA 4IR9A 3UNGC 2PI4A 1IBMF 2DH9A 1FDNA 2DPJA 2C1EB 2HAIA 3QJLA 1K0VA 1D9FA 1Z4UA 2LYVA 2UP1A 3H59A 3BYPA 1C1BA 5IT0A 2MKSA 4PABA 1VQYA 1O8BA 1Q8BA 4WKYA 3BKFA 2R7VA 4FYVB 4U7UK 1JNZB 3FDSA 3Q2SC 4A8FA 2AD9A 2K06A 4WU2A 3RB6A 1FJ7A 3I0SB 2AEFA 4NZ6A 2B9WA 3EX7B 3MR5A 4YP3A 2VD3A 3WZ0A 1HBMA 3BN4A 4JI5J 4A4JA 3JYTA 4J9QA 4W90B 1DJ0A 4KB7A 3W5YA 3OXGA 4DV4J 3M2RA 3GG1A 5J1NA 3VTIA 3FCHA 2XZTB 5F41A 2MLZA 4YHHJ 3TX0A 2AV5A 4K4WA 4JI2F 1J5EF 4NLUA 5HJYA 2MKCA 4YB5A 2VJUA 4LQ3A 5LMUF 3NNHA 3MMCB 2E1RA 3KTQA 5DG9A 2MSSA 3GE9A 3KHRA 1ZM3A 4LF8F 1OSCA 3K17A 3KG4A 4B3SJ 4KPYA 4LJMA 1RWKB 1CVJA 4F3MA 1ZAVA 1TUGB 2OPRA 2QL7B 5ETMA 1T8EA 1RT5B 2O66A 3TRGA 2AIRB 1KQFB 5DDOC 3R1HA 3A3PB 1F6TA 5KFEA 1MU2B 3D6MB 1QAYA 3IFEA 1WKLA 3JTPA 4TNOA 4CH0S 2H48B 3IG1A 3A8EA 4JBCA 4K2XA 4DF4A 1RAIB 4F4KA 4NZ0A 2HWIA 3RBEA 2HQ3A 1DARA 1W7WA 2NR0A 3IAM9 3DGPA 1QJHA 4HEA9 1CS4A 2K8GA 1YRTA 2IC3A 2B8PA 1J5OB 4ZP8A 3R5GA 4LRBA 2IRYA 1BWVA 2R8IA 3TQ1A 2NSCA 5A2QY 1MNEA 4PCQA 5DDRC 1FERA 3M7VA 4K2JA 5F8LA 4F4YA 3BSNA 4Y3CA 3H5YA 2K1RB 3ILOA 2RQMA 4PYDA 4Y00A 1A9NB 1YQHA 2CDRB 4RBTA 2R2TA 2FYXA 3S01A 2W7PA 2XMVA 4YDXA 2BZ2A 3PW4A 2XI2A 3EMTA 1S9GA 2R7QA 3M1VA 1VRUA 4CLPA 1S7HA 4C0HA 2HK3A 1AXQA 4DR6J 3TARA 3W66A 3NBPB 3GFZA 2FZCB 3B54A 4C6AA 3F56A 1QLNA 1REVA 3I31A 1VIOA 2B5JA 1UPMB 5GAEU 2RH3A 1F0XA 2G1DA 2NZCA 3H2UB 3PG9A 4QIWD 3EGZA 4JI4F 3N79A 2QE5A 3VAHA 4FYXB 1HNIB 1UFWA 2W7AA 4WP9A 4X4TA 2IM0A 1N5QA 2Q3PA 3L95X 1Q8KA 3CCJS 2RRBA 1HNXF 3UD4P 3D4JA 3QWUA 4MT1A 4DQRA 4C8ZA 3CNQP 4NLYA 3J7A1 3HHDA 2HHQA 4UUXA 5GMDA 5A8RB 3SV3A 4DL0C 4X66F 1AW0A 4IFYB 3JQKA 4C7QA 2CG4A 3KLFA 3AOCA 2YNIA 2CA9A 1JLFA 1R31A 2BE9B 5I3PA 3AXKA 1FE4A 5ADZA 5CD4H 3CCRS 3LUYA 2IFXA 3DM2A 1ZTWA 3AH6A 4P7VA 1S5ZA 2NQPA 2MYFA 3K5PA 2IIHA 2ZNZA 4J7CA 2VV5A 1OYDA 8AT1B 2VQEJ 1U1OA 3V4MA 2H54B 2AEMA 1UKUA 2XMUA 2DXFA 3K5MA 5KFSA 1RAEB 1CULA 3MEEA 4DOZA 1VQLS 4FF3A 4AL5A 3EXCX 5FIIA 4UF4A 1TFWA 1CJVA 3FRYA 3H4DA 3MCOA 3OFEA 5G0RA 4CH7A 1Y3JA 1DLOB 4KYZA 2QGFB 4ZVEA 3BR8A 4IYQA 3PRBA 1WHYA 5KOXA 4F7VA 1OY6A 2VJVA 2RRAA 4ZITA 1LFWA 4Y65A 2FIUA 5B0AA 3UCUP 3RW7A 3OSNA 3PW7A 3LP2B 1QAXA 4C8YA 4DV6J 2GCFA 3W62A 3B4MA 2E5LJ 1FRXA 5M2PA 1FJGJ 3P6YC 1WKKA 2CPDA 1Y5IB 3MPWA 2B6AB 4A8XA 3GP9A 4XIUA 2AJQA 2KXNB 2APOA 2KM8C 4Q7AA 4V19X 2MZSA 2V8GA 3BR9A 5I42A 2U1AA 3THPA 3NCPA 5LJ5Y 1WG1A 3GZ7A 3BM7A 4PXEA 1HL6A 3V5RA 2AT1B 1FRKA 2XZWA 2HZAA 5HSPA 1DQ8A 1FXDA 5BYQA 3CD7A 3PHEA 1D0EA 1WORA 3I9ZA 4I6WA 3QNWB 3IS9A 2JLEA 1HHQA 2G0JA 2KFYA 4NYPA 1FK9A 3T1HF 1MSWD 4NLVA 4ZP9A 2WHOA 2OELA 5KG3A 2IC3B 3WIUA 1FDBA 4ECYA 2OD4A 2FHOB 4ILMA 3I5CA 1IBMJ 3AY0A 1L3VA 1X4DA 4DX6A 2AJ1A 2ZH6A 2D7SA 5L1JA 5DETA 1YK9A 2SXLA 3FEZA 3GFHA 3QPIA 3UR0A 1MROA
chains in the Genus database with same CATH topology
2ZJPQ 2L08A 2JLFA 1D9AA 3S6EA 3PR5B 3NMAA 1RI7A 4OHXA 5BJRA 4DV1F 5F3TA 1SJFA 4DWIA 4PWDB 4ID5A 3ENWA 1YHQS 3TOQA 1KC8T 3BJYA 3G6VA 2ROEA 2DRBA 5E3QA 3GMGA 3PXGa 2PA8D 3PIOQ 4EYHB 1U1QA 3L7PA 1BY9A 3OFGA 3QIDA 5J2MB 1VQ4S 3HK2A 1UJ4A 2Q1LA 4R0EA 1G7CB 1X7VA 2WONA 3CVKA 1RTIA 1T94A 1TK8A 1HW9A 1SB6A 4MTPA 2OSQA 1T03A 1Q16B 1RP5A 2B4PA 3H20A 3M30B 4WK1A 2VKRA 4OQJA 3T5LA 3OFHA 4KBIA 4MIAA 1TKTB 1ROFA 2GFFA 3KLHA 4EBCA 1BQNB 3CD0A 4I4BA 3FFIA 3G9CA 4N76A 4TU7A 2R9LA 1X9SA 2DR7A 5D4OA 4F4WA 3UFCX 1JK9B 4C97A 4X4SA 2QEXS 3W2VA 1S9GB 1WACA 2AYEA 3V6HA 3NCQA 3HDSA 1PC5A 4BC7A 2IA6A 2N3LA 2DHGA 2MKKA 4LSNA 1FRIA 5KG1A 5KFKA 2HW3A 3JTOA 5CYJA 1YRXA 2JEIA 2F8EX 4NLRA 2LXIA 1J2VA 3GV7B 5K5MA 1NJXA 3FEYB 1X4FA 3D0GE 4RW8B 3ZZPA 2HYIB 4DR1F 1KSPA 2HRYA 4LF9F 5HLFB 3LGMA 2DGXA 4ZS6A 3CDWA 2WSEC 3H4BA 5FD1A 3OSPA 2JVRA 4ZCIA 4Y34A 3N0VA 3IWLA 1REVB 1E6VB 2O5DA 4TKTA 2KJVA 3DLJA 2B5JB 4EUVA 1M5PC 2MHNA 3J7ZT 2BRKA 4MK8A 3DOMA 4ECSA 4EO8A 2E66A 1FKOB 2VG7A 3OHAA 3C8YA 2R7UA 4Z2XA 3DYAA 1H2UX 1Q82T 3T5HA 2ABYA 3RB0A 3FNNA 3VAMA 1LWEA 5AE1A 2B9YA 3OXFA 4W92B 3TNVA 5J2PA 4FF2A 2DJWA 4N8OA 5I3UB 2GIQA 5F8HA 4J9SA 4URSA 1N6QB 3FJ2A 4J9OA 2UXCF 1OIAA 1FKPB 1Y9OA 1VS3A 4K4TA 2HVIA 1D8ZA 3GFYA 2UV8G 4CO5A 2ZOGA 2K7KA 1SV5B 4ZVGA 1VBZA 2BANB 3U1LA 3J80Y 2XSJA 4NLTA 1TL1B 2B7CB 2Y0SD 1LWCA 4OMFG 2VBWA 4ATNA 4LIRA 4ES2A 3MR3A 1T7PA 3OR2B 3NG8A 1DRZA 1BQMA 5HMWA 1FE0A 2OMOA 4NMLA 5GMKa 1YJVA 4QWCA 2O01C 3MTKA 3DNCA 1U1KA 4B02A 2ATLA 2UUTA 2AWZA 4F8RA 2GHVC 1LKZA 4I2QA 4OJ1A 3K59A 1R8CA 4I2PA 4JYAF 2HHWA 1YI2S 3PVXA 2RF2B 2DNYA 2RS8A 4X84A 3KLFB 3SV4A 1QSSA 5K8MA 4HT5A 2YTCA 4YY3F 1C4CA 2XSFA 2XY7A 1KONA 2V0NA 1XMOF 3PW2A 4KKOB 3MFHA 3DLKA 2RRNA 3HVTB 3M32B 5K14B 5IXUA 5T14A 1C1CB 4MKAA 3IWXA 4A8QA 2XS7A 2RU9A 3FRZA 4IFVA 2HNZA 3BREA 3M8PB 2JL9A 5CCMA 2JOQA 2KDOA 3SYZA 3N6MA 2CQCA 4WZMA 4LSLA 4BWMA 5CYQA 2IAJA 3TVZA 2C42A 1JKHB 3I0RB 2JX2A 1QSLA 3CCLS 4Y0FA 3QZ7A 2VODA 3JAMY 2PMZD 4OHVA 5EX0A 1ZPVA 2G9OA 2XMWA 2ZBCA 5SUHA 4PG8A 2ZFHA 1M5KC 2IVFB 2M2BA 4EU0A 2DNLA 3UE2A 2FVQA 5FDLB 2CZVC 5AXMA 1XR5A 3X3UA 1NK8A 1HQEA 4KO0A 1X8DA 1IBLF 2A1BA 2COLA 3RYLA 1DBDA 2MZRA 3CD5A 1XR6A 3RRKA 4PUOA 2LXFA 1HW8A 2Z2MA 3CSKA 1S6PB 4ETXA 3Q23A 2BACA 2D9PA 2FVRA 3GIKA 1FNOA 2CDQA 2J9CA 1SJQA 4DSFA 1F2GA 2OO4A 4CH1A 2YKOA 3HHLB 4RU9A 2N7YA 3KLGB 1N5VA 4LIWA 1WG4A 1JJHA 3DFEA 3TAPA 5GAHU 3MOJB 1EP4B 1LXNA 2UUBF 1LW0B 2WAQD 1O0PA 1M0SA 3GIMA 1U1MA 2VL1A 2WB1D 4ILLA 4XO0A 2AJFE 2D74B 3NKYA 5H9EJ 3X1LB 4PG5A 2XC9A 2CRLA 1SKRA 5J2QA 2V4RA 3UDCA 3UI3A 2O1PA 3MGJA 3I4PA 4OJ3A 5D4LA 4X4OA 4DFJA 4IG3B 2FHKA 5GAEI 2R7RA 1ZZFA 2V8DA 4B9VA 5KFOA 3W3SA 1MMNA 2OLWA 1KLNA 5E5NA 3I55S 1RT2B 3SXLA 4A47A 1FJCA 2PEHA 2VOPA 2V2KA 3CJ5A 3MCSA 2EG2A 1N33F 2HIQA 3ICLA 3K5OA 1E6YA 2E5IA 2GQQA 1BLUA 2DCLA 2M70A 1OO0B 2PN6A 1TFYA 2ZD1A 4TY8A 2X1FA 3OL6A 1RT4B 1QSYA 4C11A 1TVRA 2MSTA 5B0BA 5IM0B 2VKZG 4PPZA 1UA0A 1UVLA 2KKHA 1I6JA 3ENVA 4ERDA 3IAS9 2IJNA 3H5SA 1L3SA 3PZPA 4P2SA 4H4OB 2DO0A 3V6DB 3IR6B 3OPKA 2WB4A 4RW7A 3HHNB 1Q1KA 3HMJG 2KZZA 1FRLA 1KQGB 4NA1A 4GC7A 2FJWA 2PFFB 2YKMB 3R5DA 3AJ1A 3Q24A 1F5CA 2CVEA 4G1IA 3IWNC 2VUGA 4N47A 4KR0B 5F9NA 3CULA 4WFBQ 1S77D 1RTHA 4JV2A 2W4DA 4N8NA 4IDKA 3C46A 3DMJB 4O3RA 1KQSR 3Q8SB 3N01A 3CIMA 1UMJA 2W9BB 3CCSS 1N36F 1P1LA 3Q2TC 2JHEA 3UDLA 3J7YU 2QA4S 5L1IA 1G3OA 4FS1A 4KRWA 2YNGA 2GO8A 3DOLB 1ULRA 3H5UA 1RDRA 2A10A 4RUAA 2VOOA 5EN1A 1U7LA 4ZA1A 2ADCA 1HBOA 1HWJA 1GH8A 2RT3A 2XO7A 2DNNA 3KLEA 1QE1A 4Z37A 4BC9A 2GMJA 3DU6A 3IN5A 1S99A 3M6WA 5A0YA 4UW2A 1UP1A 3CC4S 3RRGA 2C2RA 1Z1ZA 3C6TB 4DSIA 2R7SA 2JRSA 5AJ3F 4WE1B 1U24A 1XN9A 4HL9A 3KJVB 2JJ4D 3JSBA 1PO6A 2YKPA 4K0KF 3CD6S 2UUAF 4HH1A 1GTHA 2V9WA 1VQ9S 3FZBA 1IKYA 2HFOA 4G3IA 4M95A 1MMDA 1X5OA 2FVPA 3CXCR 2EG1A 2XWXA 2CVIA 1Y5LB 3LAMA 4QWEA 3KKFA 1SIWB 2DB1A 3TYTA 3I56S 1C0TB 4UQGA 3I6PA 5J2NA 4EYIB 1N32F 4KHPF 4RUHA 3PACA 1SH0A 2IMWP 2DGOA 1R7IA 2EFQA 1FK9B 3OL7A 3BO3A 1YIJS 3I0SA 5DM7Q 1NJZA 1RYSA 1NO8A 1YWXA 1AFJA 1S79A 3WX4A 1SC6A 1HBUA 1Q81T 3UR3C 4Q45A 1YJUA 5KFJA 3M2UA 2J6SA 1H7WA 1UFLA 5KFWA 1UVNA 1SUQB 4DL5A 1HPZB 4A8OA 4LVNP 4EZ9A 2WOMB 5A8WA 3G86A 1RTDA 2WK4A 4O3NA 4X4PA 3HHLD 3C66A 3DOKB 3SSRA 5KFNA 3T6BA 4IR1A 1FNMA 1DFDA 3MMJA 4CTAB 5B08A 4QIEA 2RUGA 4OL8A 2X1AA 3DI6B 2Z4PA 5FJ4A 2C28A 3SFUA 1X5TA 2Y1RI 4NLDA 1T05A 5IT9Y 1XERA 3DU5A 3LALA 3R5AA 3T9NA 3RZAA 2Z2LA 4ECRA 2ROPA 3GR1A 2BOPA 3HO1A 1CEZA 2HHXA 4PWUA 4RNFA 4DV2F 4ED0A 1DHMA 2XY6A 4DLEA 4DX8H 1ZOTA 4IH5A 4MK9A 3SQGA 4I68A 2I9SA 2RDJA 4AL7A 1RTJA 1ZTTA 3DLGA 5H9FJ 1SL1A 3A1YG 5KFMA 3IRWP 2CPFA 2GO9A 1D8YA 4CO4A 2GGPA 4ID5B 3CJKA 1U2RA 1HARA 1C1BB 1NEEA 4MK7A 2UZAA 1EETA 2LEPA 4ELVA 2LDYA 4HI1A 4UUWA 2VB6A 3KMSA 3BGRA 3MMCA 4ICLA 2ZH1A 1G2EA 1CLFA 3SDEA 1XNRF 2BUNA 3MM6B 4YR2A 3MF5A 1N48A 1HYSA 4Y2MA 1FRJA 4B9NA 2WONB 3CCES 1RTIB 3BS9A 3BZQA 1Q86T 4NRUA 4DG1A 2UVUA 4WFNQ 2E1AA 2BQRA 1G6BA 4HDHA 4XAKA 4K4VA 4NLGA 2QT7A 1YSJA 3U1MA 4DL3A 5EWFA 3KLHB 3MD3A 3JSRA 2POKA 4DL2A 2M8HA 3KHGA 1QUPA 3BDEA 2YNFB 1R8AA 1W25A 3CEDA 5IZHA 2G0CA 2NYIA 4OLOA 2AU0A 1U45A 2XS5A 5KT2A 2ZNYA 1R8BA 2Q79A 1F5AA 1RT1A 2E1MC 1RT5A 3MM5A 4DSJA 1UVJA 2NXUA 3QMQA 4DR2F 1N5TA 4YB1P 1U1PA 2J5AA 3VAJA 4A8MP 2CJKA 2ERRA 2V8HA 4FPRA 1WHWA 1FCAA 1SJ1A 2F40A 3R27A 4KQZA 3FMWA 4DN9A 1HBMB 3P5TL 1JX4A 1NK7A 4DQIA 1S48A 4K5RA 2RS2A 1H2VZ 5KG4A 2HMIA 2MB0B 5IFMA 3EZUA 3JYTB 4DUZF 4C2MA 1JXEA 5GADI 4R25A 3MAQA 5AE3A 1LWFA 3K5NA 1TV6A 2I0XA 2KXHA 3M4XA 1NK9A 3PX0A 2QMXA 4USHA 3AA9A 2KO1A 3NS6A 2ZOMA 5AXLA 3M2RB 5DM6Q 3CC7S 3QGHA 2HNDB 1FD8A 2FJDB 4ZP7A 5KT3A 3Q22A 3ZZTA 1I94F 4J9MA 1LOUA 2VG7B 2B56A 5CXTA 2J6TA 4OHYA 4JI3F 3V2UC 4U6PA 2HHVA 2ZH8A 3HXMA 1X9MA 2V94A 4YB6A 2EC0A 3CDUA 2MY8A 1HBNA 3ETOA 3NNAA 3SCKE 2OTJS 1RT7B 4RWWA 5J1EA 2UUCF 2MZ1A 2YKAA 4O3SA 2WSFC 3MDFA 1OQ6A 1WEXA 2NUHA 2W8LA 3HVWA 4NRTA 3DLLQ 1KHWA 1R43A 5SZTA 1C4AA 3OFFA 3RAXA 1URRA 1H7XA 2X1BA 3OW2R 3UD3P 1BQXA 4FVCA 4ZPDA 1LWCB 4F3OA 5KFLA 1QUVA 1A7GE 2I5JA 2CPYA 3E01A 2DNRA 4MAKA 1P6TA 5EGYA 5THWA 4XDDA 1VBYA 5DDQC 2R7TA 2DH8A 1M5OC 1DURA 3CMAS 4ZKAA 4X64F 3KWMA 3AB4B 3KK1A 5CHCB 1KTVA 3CE8A 1RT6A 4ES3A 4TQRA 3IBWA 2VBXA 4I2PB 4B17A 2FLNA 3D28A 3DLHA 3GIIA 4J37A 2MJNA 2QLWA 2OPRB 1S0MA 3PX6A 2M4MA 3S1TA 4FZVA 1SQEA 1S1XB 1V3ZA 2FUG9 2H9ZA 2X51A 1JLGA 3TX8A 3WC0A 3EYZA 2KHDA 1J5OA 3BF4A 3HVAA 3QGPA 1WHVA 2GQCA 2ZUGA 4NPOA 3DC2A 3N9UC 2CQGA 1U26A 1RYRA 2RKIA 4BDPA 5CYQB 3MR2A 4NYOA 3CCUS 1HR0F 2MQLA 1TAQA 1UEUA 3D1OA 2UVVA 4WXWA 3GFXA 2MZTA 2YY3A 5H1SV 3MHYA 5I4MA 5HP1B 4Y2IA 5F8NA 1GNKA 2DGTA 3ITHB 4BBYA 3OBIA 4ECTA 4B9TA 4F02A 4TU9A 1S0NA 4MFBA 2GMHA 5IT4A 4F26A 4WFAQ 1DZ5A 4RW4B 1CSJA 3TUJC 2C3UA 3H98A 4RNMA 2YKNA 2MGZB 3OV7A 1T95A 4PUOB 2I1RA 2KXFA 3Q8QB 3IG1B 5KG6A 1R8PA 1RA7A 4HH0A 2QSWA 3KFWX 3SCJE 4ED2A 2K1RA 3QO9B 1YJ9S 1S1WB 1NRKA 3S8SA 1HFEL 2B4OA 2NUUG 2V4JA 2ZHOA 3WC2A 3VAKA 4R0JA 2ASDA 1ZH5A 3P3DA 1OPIA 1SH3A 2J7WA 2N4CA 4ED3A 2RMLA 5FLXY 1VQ8S 3PFEA 3JSMB 5LL6d 4NXMF 2RQ4A 1F9FA 4RNNA 3RAQA 4ZPCA 2N82B 1B0PA 3D0HE 1X5SA 2IVYA 1XC9A 3LF0A 4PG6A 4EO6A 1RWUA 2D9OA 4NCGB 1H2TZ 4RKUC 5HBMB 2YH1A 1M1KT 1HNZF 2HGLA 2AYMA 2C3PA 3MM8A 2J7UA 5CZXA 2U2FA 3AJ2A 4ZHRB 5C25A 1JLBB 4F2RA 3L7OA 4ED6A 2R2UA 1E6YB 4ECZA 1N54B 1O5JA 1N5SA 3NBPA 2IM1A 3F73A 2JSXA 5E41A 4DF8A 5D8HB 4CO3A 5CCLA 4B3TF 5A6PA 3K58A 1GXLA 5KT6A 2HLUA 5KFBA 2LDIA 5HQ8A 2ZKTA 4C11B 1U8SA 5KFYA 3RTVA 2R7OA 2Y1IA 1JB0C 2DR5A 3CO9A 3MECA 3QAUA 3VQSA 1JLEA 1HHTP 3ISZA 1TL5A 3B4DA 5KG0A 2GA7A 4Y2KA 3G8TA 4RW7B 2GV1A 4FP9A 5K8NA 1RAJA 2BXJA 3FQKA 5KT4A 4QU7A 3K57A 3BO4A 2HHUA 4ZPVR 3SEOA 3GG0A 4U7CA 4M8LA 4QYRA 1D3WA 2E29A 4I6AA 5EWEA 4Q43A 3M6UA 1HNIA 1NHVA 1RTHB 3P96A 4DJBA 4F3QA 3MM9B 2ZH7A 2C3YA 1NH7A 2BRLA 2FGOA 4IDKB 3PV8A 4E8UA 2FLLA 1KLMB 4OI1A 1YBAA 1S1VB 4C9DA 3VQTA 4D3HA 2MKJA 2RD5C 3GYXB 1HQUA 5DLGA 2YNGB 4Q0BB 2ZZMA 3FSYA 1CG2A 3PEHA 4CZCA 4ZPTR 3PR4A 4JV5F 2MMYA 4M5DA 1XK8A 1PSDA 3MMBB 1IUJA 2XMMA 4OZJA 2UV8A 5JJBA 3Q8PB 3D0IE 2FC8A 2NPFA 3KLEB 5A8RA 2EFVA 1QE1B 2JDJA 1PC4A 2JLGA 2R2SA 2F3JA 3HHEA 3OUYA 2E9RX 4IRDA 2NSBA 4DL6A 2ZVSA 4ITSA 4IFYA 2DNKA 4X4UA 3I5BA 2V4QA 3EZ5A 2PC6A 5JVGQ 4D3GA 4YR0A 1QAIA 3MXHP 5KFIA 4FF1A 2XNRA 2CJBA 1DTTB 2F8HA 3IO1A 4NA2A 2JVOA 3M1VB 3C6UA 4O4RA 1VRUB 2XG8A 3CCZA 1OSDA 1VBXA 4PXBA 4I6YA 3CJ3A 3M6XA 3BQ2A 4PQUB 1Z2LA 4CCHA 5BR8F 3V4IA 1RQ0A 3SMZA 1KOOA 1SKSA 4C3MA 3G4SS 2AGPA 4LFBF 3OQ2A 1X4BA 3KK2A 2VA3A 4NLOA 4RNOA 1GX6A 3G96A 3IRXB 1TL4A 2XBPA 5L9XA 1KD1T 2CPXA 4LF6F 1LQ9A 4KAIA 4DQSA 4J9RA 3BGUA 1HBUB 4I1TA 4RW6B 2RQKA 3M2UB 4Q2LA 4L72B