3OTCA

Crystal structure of human trnahis guanylyltransferase (thg1)- native ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
264
Chain Sequence
SKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title tRNAHis guanylyltransferase (THG1), a unique 3'-5' nucleotidyl transferase, shares unexpected structural homology with canonical 5'-3' DNA polymerases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords tRNA(His) guanylyltransferase
total genus 67
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.7.79: tRNA(His) guanylyltransferase.
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04446 Thg1 tRNAHis guanylyltransferase
A PF14413 Thg1C Thg1 C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3otcA00
3WC0A 3OTBA 3OTDA 4KGKA 5AXKA 3WBZA 5AXMA 5AXNA 5AXLA 4KGMA 3OTEA 3WC2A 3OTCA
chains in the Genus database with same CATH superfamily
4A8FA 4DR6F 2WOMB 3DHXA 3PX0A 2XYHB 2YX7A 3D1OA 5DGBA 3PFOA 1H2UX 4WFXA 3VVUA 2QYGA 3LO3A 4DG1B 2Y1JA 1U8SA 3ETMA 5CCMA 4DG1A 1V5VA 2IA6A 4J91A 2H9ZA 5F8HA 2D3ZA 2ZFHA 2R7TA 2C3YA 2RDJA 1OJ4A 2J7WA 4KRWA 3VCDA 2DB1A 2HQFA 2WSFC 4HTIA 4CCHA 4U7UD 2YKMA 2QC3A 3CGIA 2JFKA 2VFUA 4ERDA 3O1LA 3OTCA 4DJBA 4JI2J 3FEYB 4OYWA 3LA0A 4UTGA 1U2RA 1X5SA 3BZQA 4NA2A 1KHWA 2CXEA 5D0HA 1FRJA 2J9DA 5ETPA 3J7Z5 3CMQA 1ZAVA 5L1LA 2GGPA 4MMOA 4RW9A 5J1PA 2YPYA 4WBFA 1U1RA 1LK5A 2ACMA 2GGPB 4RW9B 3MFIA 2FY1A 1KVKA 3KKFA 4J9NA 2UUBJ 2X1FA 2W7OA 5EUHA 2LXUA 1WF2A 2CPHA 5D3GB 1NZ8A 2YKNA 1S79A 2O5DA 5AJ3J 1FJ7A 2KXNB 5H9EJ 1RT5A 3B4MA 1FRIA 1Q8KA 4WP8A 2IDLA 3P45B 4MIWA 3LP2A 2OTJS 4P10A 1ZAWA 3LP2B 2NXJA 2XLJA 5AJ3F 2OPQA 5G0RA 2VC0A 2FJDB 1URNA 3CIZA 3H98A 3MMAA 4NLYA 4H4MB 4F67A 1RCOB 2LMIA 4NL5A 3GJQB 4ECYA 2OSQA 2CQ3A 3EICA 4RNMA 3LW5C 3OR1A 2C3MA 2DXDA 5HROA 1FXRA 1HW9A 5HROB 4CM2A 2LQ9A 3CT9A 3ELHA 3V81A 4F7VA 2N4CA 5D6GA 5F3TA 1MNEA 1S9EA 1A7GE 2CQ4A 3MR2A 5IC6B 3QBCA 3LWMA 1OY9A 1DY3A 1T9YA 3K7RA 4R5PB 3DLGB 1AB8A 3DLLQ 2ZBQA 4QWBA 4Q2MA 3BQ0A 2DGVA 4JI6F 4OYMA 4H54A 4OJ1A 1N56A 3EXYA 2HMIA 3EWGA 3PY8A 2V8VA 1NDKA 1HQUB 4PABA 4TU8A 1QAIA 4FXDA 1MN7A 4RUAA 1X4DA 1PKUA 1UFLA 1FWKA 3FRZA 3K57A 2WSEC 3U7JA 3T19A 1F9HA 1X31C 2M70A 2Y3YA 2UU9F 2QZ8A 1NK0A 5A2QY 2UUCJ 4NLRA 1QDUB 4YDXA 1F3FA 1JJHA 3OD2A 5HQLA 3F41A 4IQMA 3G82B 3H4DA 3CD6S 2APOA 5LT5A 3G82A 5DG8A 5KG1A 1SL1A 2FB0A 1M5PC 1RA6A 4TY8A 5LSRA 2B43A 1HHSA 5CH7B 3J80Y 2XMUA 4UOCA 3VAJA 1J5EJ 2O67A 1Y4ZB 3SQGA 4RUBA 4LFAJ 2B4PA 1FI4A 1YTYA 3PW4A 1SL0A 1PBUA 2LEAA 4LVOP 5B7WA 1UAWA 4PQUB 3VF0B 1CSJA 4I67A 3H25A 4PQUA 3IS9A 1HPZA 1U0SA 1Y10A 3UFCX 5D8HB 2HK2A 3DMJB 3AY0A 3AOBA 1O5JA 3KMQA 2F5GA 4OI4A 1WKKA 3DMJA 3PW0A 2DRAA 4CYUB 4PEOA 4CNYA 2YH1A 2ZEJA 3D3BJ 3UN2A 3ENAA 3MM9A 7AT1B 1S9FA 3BYPA 2F65A 4DFPA 1RAJA 1U8WA 1VLYA 4KV8A 4CT9A 1YZ7A 2IA0A 4YB7A 4LFAF 3R5GA 2FZCB 2ZHAA 2ADCA 4B9SA 3FEZA 1XNQF 3SIPB 3UWTA 1WKJA 4FKXA 1DBDA 4DV5F 3KNAA 2UUAF 1AFIA 5HI7A 2VDIA 4S0MA 4C0HA 4I2PA 4EYIB 1K44A 4P7VA 1TV6B 2E9TA 1SKRA 2K2PA 4DQRA 3FUYA 4CLWA 1TR0A 2NLWA 4FPIA 4NOHA 5C25A 1B3TA 1YJ7A 4OZ1A 4IRDA 1CVJA 2B4VA 2QSWA 3QYYA 3AODA 2U2FA 2XMJA 2AKWB 3NP5A 3PACA 1X0PA 1N48A 3CE8A 3QO9A 5CD4H 2XM3A 2YY3A 2MKHA 1UPMB 2MB0B 3KJVA 1NSQA 3QO9B 4OYZA 4DL5A 1YGYA 3OXLA 2AHOB 3QFHA 4ZN3A 1MW7A 5L46A 3RB4A 3TA0A 4DPWA 1TMJA 3MAHA 4G6VB 4HT7A 3GIMA 4K4VA 4DF4A 1K1QA 2CYYA 3Q23A 4LJMA 4IH7A 1WOSA 3AFGA 2DKOB 3UN3A 4R25A 2MQ8A 4CLTA 1R0AB 3CULA 3R7SB 3RAMA 1RXOB 1RT6A 2B9EA 2PEHA 2VBYA 2DY1A 2IVMA 2YXLA 5LL6d 2QN6B 1JXEA 2QRRA 3ISZA 4F3QA 3LOUA 2KM8C 1HQEA 2ZZNA 3W3SA 1T9TA 1XTZA 2GIFA 2PMZD 1EP4B 3PEHA 2HHPA 1S9GA 2DGTA 2P8IA 3DOMB 4DPYA 1EP4A 3KHRA 1Q53A 5L1JA 3HJVA 1VBZA 5IT9U 2HGLA 1TKXA 2PMWA 4Z7CA 2L9WA 2BV3A 1AT1B 1LEOA 1U45A 1ROFA 3TVYA 3T1YF 1SV5A 1X4AA 2G2ZA 1SXLA 2HS0A 3A4TA 2GQQA 3NBPA 5CZXA 5ETOA 2ZJPQ 4DUYF 2HHHF 4NPOA 3E2EA 1VGYA 2C2OB 2VOOA 4DV4F 2AYMA 3OVBA 4RNFA 4FVMA 3BPDA 3HT3A 4WK3A 2XY7A 1NJZA 2HHQA 2OP5A 1C2PA 4FKYA 3E3XA 4AFFA 3QIPA 4M1KA 4DDFA 2XHCA 3VHQA 4DSFA 2KJWA 3W61A 2D3O1 5L1IA 4WFZA 4BC9A 4I2QA 1X4HA 4NASA 3GWCA 3ZXWA 3FDSA 2NS1B 1TL1B 2M8HA 5A8KA 2WTFA 4DR4F 2Q6CA 3K5NA 2RRAA 3MEKA 4X4PA 3I4HX 4J9KA 2JEFA 2YWEA 3W9JA 5JVGQ 2OKQA 4FXVA 3HSGA 4C11B 2RU9A 3ET6A 3GB0A 3TYTA 2N3OA 2KYZA 1KBRA 4Y2CA 5KFFA 2KDOA 1X60A 3BBCA 1LKZA 3N6LA 3W62A 1NJIT 3DDIA 2ZUGA 3NAIA 4P6QA 2M52A 3D3CJ 2XSFA 3FRYA 4P7TA 1RB0A 4PYDA 3M4XA 3ONQA 4CT8A 1NHKL 1SJ1A 2ZUAA 3AD7C 3NL0A 2HBZB 2OPRA 2EFVA 3HHLA 2RNEA 2OELA 1V3ZA 3HHLB 4NXNJ 1HL6A 1S97A 5CABA 1GXUA 1P1LA 2K3IA 2IYGA 2V4QA 3BQ1A 1YJWS 4RWXA 1SKWA 2ACYA 2Z2ZA 4IG3A 2VQEF 4LUBA 1HNZF 3W2VA 4LRFA 1R8PA 4U9RA 4KHPJ 3W2VB 1WHXA 4B3MJ 5D4PA 5GAHU 4L3NA 1VRTA 2L08A 3FCVA 4UUXA 3CPWR 2RB7A 3PX6A 2GMLA 1KRPA 1RAOA 2CZ9A 2J76E 4FPRA 4DV0F 4Q44A 2GIRA 4JP8A 4FVCA 1SH0A 2ZBPA 1RTDA 2GIQA 2ZZTA 4L3KA 1LW2B 2MLXA 4C48A 1RTDB 1LNQA 3MPVA 2FHMA 3GR1A 3OLBA 3TEHB 1R6VA 4XDCA 2XG8A 3KK3A 2CNNB 2QIFA 1BY9A 4ELTA 4U7CA 3KK3B 3NGUA 1ZZFA 1VOMA 3ZZRA 1R31A 5I3UA 3FKBA 1QLNA 4DUZF 2XMKA 4KIAA 2VASA 4MH8A 4OHVA 1VQ8S 1FTCA 4HHUA 2I2YA 2V2KA 2VZ9A 2JSXA 1XK8A 4I6WA 2BXJA 1NSPA 2QV6A 1XERA 3IAS9 4MAKA 4WFNQ 1K9MT 1M5OC 3QGPA 5A0YB 4IFYA 3HJFA 1Z1ZA 1JLGA 4OYPA 3PCOB 1CJTA 2HQIA 5EHHA 2V94A 2PA8D 3K17A 2ZD1B 2AU0A 3W8GA 2DNOA 3CCZA 2FVSA 4DWIA 3EGZA 3NWRA 1BQXA 2E5JA 4ZPAA 5AT1B 5KT6A 3V6DB 2BKOA 1SUQA 1H2VZ 3V6DA 3Q0AA 4W98A 2E1CA 1JQGA 3FMWA 3TP2A 2W25A 2OEMA 4O23A 3R9LA 3VGUA 3BSOA 3TUPA 4OZLA 1LXNA 3CJQA 3DRSA 1NK6A 1GT8A 4OZ5A 3DLJA 3LALA 6FD1A 2KFYA 1T11A 4ZVFA 2VG6A 2XCAA 4GRSA 2J0SD 1QVGR 1FKPA 5HO4A 3M8WA 1UMJA 2HLUA 4JI8J 3W2WB 4Q0BB 1FKPB 1RACB 3CIMA 2BBEA 3W2WA 2MJUA 4UQTA 1F2GA 2EFGA 4FF3A 3HI9A 1GQEA 2MQQA 2KI2A 2O1PA 2DT9A 3E01A 2HW3A 1N54B 1KLMB 2QLFB 1S1WB 1HW8A 3T9NA 3QJLA 1EETB 1JMTA 2BJ9A 2KYXA 2YNFB 1S1WA 3ITHB 3NRBA 3C8YA 2LYVA 3OTDA 4QIEA 3ITHA 4KO0B 3ZTOA 5D4LA 4BBYA 5E3QA 1Q81T 3PRDA 2NUUG 2ZE2A 2BE2A 2XI2A 3SFGA 2BJ3A 4ECQA 2ZE2B 1RTJA 1GMVA 4PQAA 3WIUA 3M7VA 4N7TA 4HHHA 4DUTA 1VQYA 3ZC4A 3D6TB 1FDDA 4MT1A 1ZAXA 3FQKA 4YY3J 1RT4B 2C2KB 3PZPA 4HTJA 1Q7YT 4B9MA 1X9SA 3D67A 2HHVA 5L8RC 2HHSA 1D9AA 5IT4A 4AL6A 1RYSA 2EWHA 2VFTA 2W2NP 3CCVS 2XB2D 2GVZB 4CH1A 3NOGA 2GVDB 2C42A 2V5HG 4OYAA 3ZTRA 4LF5F 5MLCV 4WWSA 2GX8A 1RQ0A 3FEXB 3CCSS 2YH0A 5E5NA 1Q5VA 3MF5A 3M30A 4QBUA 2LQJA 1GX6A 1EKSA 1UCNA 2XWYA 2V8HA 4ZP9A 2VPWB 1NU4A 3A8KA 4DFMA 3PV8A 4F8RA 1F9EB 2DTJA 2D74B 2Z2YB 3NGKA 3DGPB 4TVAB 9RUBA 1TL3A 3KLEB 1J5EF 4XTTA 1HBOA 1TL3B 3N6NA 4K4ZA 4O3PA 3SYZA 4B9NA 4XPEA 3KMSA 1R8CA 3D6MB 2LP4A 3JQMA 3MMCA 3W5YA 4DCOB 3EVWA 1HNXF 2FPHX 3GZ7A 4I6AA 2WK4A 1YITS 2KVIA 3AAWB 1T05A 2OIHA 1T05B 2I9SA 5T14A 3PRVA 5SUHA 3P3DA 1RADB 4KKOB 4J9OA 1BLUA 2DD8S 3IR5B 4JI1F 4ED6A 3HX9A 4KGXB 1QM9A 4RLEA 5ETSA 2A2CA 2YX1A 4I1TA 4WFYA 3ZZYA 2XY6A 4EU0A 2KFNA 2GHVC 1HHTP 3IMQJ 3HFVA 3D1HA 5KT4A 2DEIA 3UVJA 3MAAA 2HS3A 1TKZA 2ZWPA 5DLGA 2FJBB 1C1CB 5AXLA 2KHCA 4H4OB 1BGXT 3KG4A 1Q1KA 4LRCA 5DDPC 2B9WA 2E5LJ 2RKIA 3FBCA 1R8BA 2HVIA 1IR1A 5K8NA 2G1HA 2AV5A 4A8WA 1YJRA 3PJ9A 5KFOA 3ENWA 1ZPVA 2FGCA 2V9KA 3M6WA 4ED2A 1N34F 4DV4J 1KS2A 2YKMB 2YNGA 2HHHJ 1DJ0A 3KLGB 1QAXA 1R8AA 4O4GB 2YNGB 2MKIA 4GVBB 3UO0A 2CQ1A 4X4VA 2D41A 4GVBA 2B9YA 3VZIA 3GV5B 1PYOB 1IKXB 1MU2B 2FYXA 3DN9A 3GYGA 4UOHA 4R8UB 3AA9A 4RW8A 1XNRF 2E9RX 1MU2A 1U02A 2DHSA 3R7NB 1N88A 8RUCA 3OHBA 4TXSA 2Z2LA 1RGVA 2UUAJ 1EJ7L 1T94A 3FZBA 3NS5A 4CTAA 2CPIA 4WFAQ 2AWZA 2HVHA 4FYWB 2DYAA 2FJVA 1U2FA 2YKNB 2V2VA 2OPSA 4DS4A 1QD1A 1XWLA 5D78A 3LP1A 2WONB 1B64A 4P74A 2WB1D 4QW8A 4U8VA 3LP1B 1N36F 5B0CA 2W01A 2P2CB 3JTNA 3O2IA 3MURP 2BQ3A 3BYRA 1YQHA 2IM3A 5HAOA 4J9SA 4IR1A 3ZFVA 2LDYA 5F9NA 2BJ7A 4PG8A 2SXLA 2H54B 2Q43A 2MPUA 3MEEB 1MWQA 1X4BA 2N3LA 3VGVA 5LSOA 3LH2S 4ECZA 1H72C 4Q5VA 5H9FK 2IRXA 2CJAA 4N47A 3A13A 1CULA 5KFRA 2QLJB 1V9OA 5LMUF 2DJWA 2I0XA 2OSRA 4RZRA 3SBMA 1QUVA 4HYKA 3V81B 2AQ4A 2DPIA 3R5AA 4A8MP 1VJWA 3M6VA 2L41A 1UWBA 3KXDA 5IV4A 1JX4A 5HVHA 3UR0A 3TX8A 2XGQA 1VC5A 3GTYX 3PX4A 5F41A 3PM9A 2FVRA 3MMBA 3P4UB 1VRUA 3N01A 3UR3C 1Q82T 1HIYA 1Y3JA 1SB6A 4NI2A 3R8YA 2N7YA 5KT2A 3K58A 1UTAA 1HBMA 4CLYA 1CJUB 4ECUA 1HBMB 1WSVA 2CIMA 1S1VB 4WF9Q 5HLFB 1T03A 2MTLA 1B0VA 1HHQA 1TFWA 4RBUA 2FHOB 1VS3A 3DM2B 4LF7J 3AB2B 2VG5A 1KVJA 2F8HA 2VPYB 4IYQA 2CQHA 1VQ5S 4DR2J 3IGNA 4P71A 4G1IA 2KT3A 3FSXA 3DU5A 1YBTA 1PIEA 3BO2A 1SQGA 4F50A 4X4QA 2HFZA 4CLSA 3HVWA 4X62J 2AGPA 1VQMS 1YWXA 4C97A 3RBZA 3I0RB 3TZWA 3VZHA 4O0NA 2V50A 3QT6A 4ILMA 1AXQA 1WD6A 1NCLA 2NPIA 4NLGA 4Z37A 3MR5A 2G4BA 1HPZB 2AJ1A 4OQJA 3CVKA 3U27A 4EO6A 3C14A 3PTWA 3CDWA 2HFNA 5AXMA 3C14B 3TNVA 1I94F 2DPJA 4Q2LA 2MKJA 3EVOA 2JWNA 4FF2A 4DV7J 2JC1A 2RAQA 3W65A 2QE5A 3ZZPA 2V4RA 2YWFA 3VQSA 1KC8T 2HYIB 4D3GA 2IY5B 2RQ4A 2ZVSA 4USHA 4B3OB 1GH8A 4C4WA 3BN7A 4QYZJ 2V2ZA 4HVZA 1IVZA 3U1MA 1WOOA 3HFZB 3I5AA 1F3VA 3Q83A 5CYQA 5K14B 4BC7A 3OFFA 4DZ6A 1TU0B 1FRHA 3G8TA 3ILLA 1U1LA 1I94J 2LXFA 3IXQA 1UW9A 2NZ4A 2K1RA 2FLOA 2MDAA 2UUBF 3BGUA 5IM0B 2K1RB 4OLPA 4DL7A 1D1UA 1XJWB 4R0JA 2DR9A 2AEFA 4TQSA 4B9VA 1TV6A 1CPZA 5J2MA 3MM6B 1WG1A 3Q86A 1QTNB 3MCNA 5J2MB 2AMCB 2GHPA 2VKRA 2RUGA 2BJEA 4JI2F 2EFQA 1YI2S 2CJKA 1UJ4A 1NNDA 4F04B 4QOTA 3CCMS 4LIWA 3OTBA 3HKZD 3JAMY 1TVRB 4IG0A 1S1XA 2ZM6J 3M2VB 1QAYA 3GQCA 2DGQA 5H9EK 3MM5A 2YX4A 1FEHA 4KH1B 1CS4A 4USKA 4ED8A 3T41A 1XNRJ 4GKKF 1ZS6A 2CQ0A 2M3DA 3WC0A 4ZLPA 4K4TA 1S7HA 3F56A 4DX8H 3RW6A 3CJTA 1S1TA 4WPAA 3AOAA 5FDLA 1F0XA 4WIIA 5THWA 1RHQB 2M2BA 4LF8F 4LFBJ 1QSYA 4NZ6A 2V34A 4IR9A 1R27B 1UVMA 1TZ0A 2XYPB 4G1QB 3PW5A 1UVIA 2CQDA 1FDAA 2QLBB 1HQEB 1XMBA 3C66A 3JSYA 3NGSA 3KLVA 4LSLA 2FLNA 1QJHA 1JLEB 3HZGA 4G1PA 5EWFA 1FO1A 1S9GB 2HSEB 1JLEA 3DOMA 1WC1A 3G86A 3NCRA 3W1YC 1KD1T 4KHPF 4ZDNA 1OYDA 4MIAA 2R7RA 2XMTA 4ZITA 2G1DA 3FSIA 3V5RA 4I0WA 1DTQA 2XC9A 3I55S 1FKOB 4CIOA 5GAGI 4K7QA 2RQCA 4DR5J 1OQ3A 1R8HA 4LBPA 4CLLA 2F9DA 1SV5B 3MWBA 3R1HA 2LQ5A 3CJSA 3I4PA 2E5IA 5GMDA 1LQ9A 2ILYA 2KO1A 4ECRA 3KTQA 1N32J 1WG4A 5T7LB 2XO7A 4XK8C 4CRJA 2BA9A 3DRXA 1PAUB 3C16A 4NWBA 2DNZA 3JXOA 4HR2A 5M2RA 1VQNS 3KDOA 4KGKA 3PO5A 4MTPA 1G7CB 5KG0A 2DNHA 3UDEA 4IO1A 2E1PA 5ADZA 1WDTA 4X64F 2J0XA 3H2VE 3CCJS 1IUJA 1DRZA 3JYTB 1CC7A 3N9UC 1ZA1B 2GAHC 4OJGA 4PUOA 1YK9A 2OTLS 5E41A 4A8OA 1H74A 2V67A 3THVA 1KLNA 1HKAA 2EG2A 3HMJG 3MUVP 2HRUA 4XAKA 4C3MA 2M8DB 1AYEA 2R8KA 1FNMA 1SCJB 3IGVA 1JLFB 3L3CA 3TAPA 2OMOA 4F26A 4LF5J 4C11A 4LRDA 3B78A 4RNHA 2GAGC 5E3PA 3QLHB 5F9LA 1FRKA 4JI7F 3CDEA 2MKYA 4F4XA 2QSFA 2XLIA 3C19A 4ECWA 1GEHA 3ZNJ1 3ULHA 3BSNA 4K0KF 3HLUA 4Z7YA 2PO4A 3H8YA 3KJFB 1R89A 1D3WA 3THPA 2ROPA 2VQEJ 3GLJA 3V4MA 2IPOB 5K8MA 4FS1A 4F2SA 4HI2A 1RT3B 2OPRB 5J2PA 4DN0A 3DNCA 2B7BB 5J2PB 2NPFA 2AX0A 2KHDA 3DLHA 3ZZ0A 2PEBA 3EUNA 4V19X 2IJRA 4RBTA 5IT9Y 2OHDA 3N4WA 4IG3B 3T5HA 3CCWA 3M1VA 5DGAA 3DLEA 3QSIA 1IJFB 3OFGA 5LJ5Y 2E7VA 2XI3A 4USIA 2D3UA 4E8UA 1RHKB 2XLKA 2CUYA 1N0UA 5FD1A 4MKBA 1RP5A 2HLTA 5E3CA 3KDNA 2CQCA 2X7IA 1SBRA 1DAXA 5GAGU 2DR8A 1LFPA 3AOCA 4JUZA 1P8GA 4LF9J 2GO9A 4B9TA 2AGOA 2HAIA 2HFUA 1EARA 1R6YA 3C2PA 2EBEA 3AJ1A 2VPZB 3OBIA 3MPDA 3H2UB 1U1NA 1PC5A 1HNXJ 1WACA 4NA1A 3MI7X 2ZH5A 4TU9A 2E9ZA 3X1LB 3EYZA 2VDHA 2CZVC 3RU0A 2VFSA 1UJ5A 4RO0A 3R6GB 2V8GA 5DRKA 4KHMA 5K8OA 3EZUA 3GJTB 2MEWA 3JS9A 4RWWA 3JTOA 2ZH4A 5A8RA 2LEBA 3TQ1A 2OH2A 5DETA 2M4MA 3R1LA 3U1NA 4EEYA 3M8ZA 1AROP 3BGFA 3D1QA 4KB7A 2R2SA 4QWEA 4GC6A 1VC6A 1DZ5A 3BGRA 2KTQA 3A12A 4DSEA 5DM7Q 2J0QD 1U1QA 4J9MA 4ZHRA 4RU2A 3FBBA 4KTQA 2ZH1A 4A8KA 4LQ3A 1F2HA 1W25A 2GO8A 2V8PA 2Y1LB 3MD1A 4CZCA 1C4AA 1U6ZA 2EC0A 3RR8A 1I1GA 3JSRA 1FD2A 3K5OA 1FJEB 3KLFB 3QSYB 1E6VA 1IXKA 2C3PA 1E6VB 2RDIA 3BSAA 3PYFA 3M2RA 4M94A 3CB4A 2VG6B 3DOKB 2BJ8A 4M5LA 2YWWA 1NXIA 2H3EB 1F5CA 1NDPA 1OS5A 2B4OA 3NCQA 4H4KA 4MK9A 1WHVA 3W64A 2CFXA 2CDQA 5B0GA 2GZOA 2ZBIA 1Q8LA 2O01C 4M5DA 3RGIA 1YKWA 2ZHBA 1MLAA 3FK4A 4EWTA 4Y28C 3EVMA 4EUVA 3KLHB 3A8IA 4RKUC 3T5LA 3KJNB 4PG7A 2V6AA 1ZETA 3SDEA 1VQLS 2J8AA 1KKHA 2QEXS 5ETLA 1UJ6A 2AP6A 3DRRA 1CEZA 1PJ5A 1QVFR 3V4IA 2MLYA 3DRRB 2VL1A 3AQOA 4ZVOB 4AT1B 2HFVA 3J7YI 4PRFA 2J6TA 4RUHA 5CYJA 2R3VA 4G65A 5B09A 2B56A 2L48A 2B4UA 4AQYJ 1Y9OA 2CZ4A 3QATA 4PWDB 1T9VA 1WF1A 2D7SA 4DMZA 2W9BB 1EB0A 3R2DJ 3NMRA 1WDDA 4MIBA 2XQCA 1Q95G 4V19J 1EAYC 3D54A 2H1YA 2Q1LA 4C3LA 1N36J 1NKEA 1S77D 1JLQA 3TJAA 2GVZA 2AJ4A 1FERA 1VBKA 3D0GE 4PKDB 2GVDA 2VJVA 3MM8A 4JV2A 2AZ1A 2J5AA 3EPGA 1WC6A 3QRQA 2RF2A 3E8OA 2GQCA 4OJ3A 2NXEA 1FFGB 1KOHA 2RF2B 2HWHA 3W9HA 3BS9A 3NGDA 3GIKA 3BB5A 3G6YA 3HFKA 1HWLA 2RQMA 5D4OA 2XGPA 5U47A 4QIFA 3DGPA 4X4NA 4WKRA 1O6XA 4U8YA 1H3DA 2VF3A 3RZAA 5F0WA 1LWFB 4L75A 4EMDA 3THTA 1HWIA 5C24B 1UZHA 1TAQA 3BO4A 1FVSA 3UDVA 4IH6A 3NLCA 1Y0HA 4F4YA 4J90A 4ZMMA 3HD2A 5L39A 1IKYA 4EBEA 2DCLA 2K7JA 4BHQA 4ZPTR 1TL5A 3CJKA 3BGOP 1QAJA 2DH9A 1C1BB 1Y11A 1CJKA 4KKOA 2AZ3A 4UW2A 3Q2TC 2Q3PA 1CLFA 2C1EB 4DL6A 1B7FA 5E2QA 4CLZA 4R5PA 1QTMA 2E5HA 2VJUA 1RISA 2CNOB 1MG7A 2F3JA 2FVCA 1OSCA 1FA0A 4FN5A 1P9QC 2ZNYA 3DU6A 2C28A 3ICLA 2BKNA 1S4FA 1NRKA 3H2LA 3FFIB 2RU3A 1J5OB 2C22A 3N5FA 4K4UA 2H5EA 1IR2A 4MJKA 4ZVQB 3J80U 4QYZK 5IS2A 2ZH7A 2AD9A 1KVIA 2VKZG 4PG6A 3DCAA 2IRUA 2OEJA 4I64A 1JXLA 5JMNA 5DJBA 3M32B 2LU1A 5HMYA 3H40A 1RBOB 2HVZA 2RKIB 3RRKA 5DDQC 4DQQA 4KY3A 1DQ9A 1T9UA 3QT8A 1HR0J 2HRYA 2DNRA 3MTJA 3POTA 5A2QU 3HXMA 4YHHF 2BUNA 1RWXB 4DU8A 2XZWA 1FK9A 1BMQB 5HMXA 2IHR1 3TZZA 1FHTA 3MPWA 3I0SB 2MXYA 1KFDA 3DC2A 3QFWA 2CWXA 2ZDPA 1U4BA 1IKXA 2HZVA 4R8UA 3RRGA 2QLXA 3MCOA 3BKTA 5D0GA 3DRPA 2Z0GA 1HBUB 1RTHA 1YJTA 1R3NA 2WCXA 4FP9A 4ZPDA 4XO0A 4DL3A 1WJ9A 3I9V9 1FWLA 4NYZA 1NBEB 1F1BB 2UXCJ 2IAJB 3DLKA 4XDDA 5K9FA 5J2NB 3DRYA 3W63A 1N0VC 2EPIA 3L7UA 1S59A 1WTFA 4O44A 1PC4A 1X4CA 3GSDA 2YKAA 3DDKA 2IIHA 4IDKB 1IBMF 2NYHA 4JYAJ 3MEGB 3PKYA 4CO0A 3R3TA 3A8JA 4YP3A 3TI0A 3B82A 3CF5Q 2LU2A 2RE1A 1HNVB 1ELOA 2YPZA 3WBZA 2XMAA 2M88A 3MEEA 4M95A 1OPZA 2PSZA 4ZN1A 4TLRA 4JI3F 2YQ3A 2HQDA 2PE8A 5BXIA 4FBTA 4LR8A 3V6KA 5D3GA 4ED4A 2J9DE 2JL9A 1S72S 2BACA 2Z8QA 4OYBA 5HMWA 2VB6A 1RT5B 1I51B 1YJUA 2LKZA 1B7YB 4DPTA 2YNIB 5KFXA 4GKJJ 4P73A 2FJWA 4DSLA 3H4BA 5L9NA 2HRTA 4X4TA 1UEKA 1SJFA 1UVNA 2HAFA 2IFXA 3UD3P 4DPUA 1VRUB 1GMUA 3BH6B 3D0HE 5KFVA 3IRXA 1FFWB 5HJXA 4IOCQ 4AL7A 2UVVA 4F0MA 4X66F 4DR1J 4F4ZA 2DGSA 4J5OA 2G0JA 2ZWOA 3MD3A 4KFBA 5KFEA 3PHEA 3UNGC 3W66A 3TZXA 4IUFA 3K0JA 5HLFA 1T03B 1HFEL 2C2DA 1KFSA 2W2QP 4Y2MA 3CD7A 4DSIA 2E1RA 1H6KX 3DM2A 1RK8A 2DHGA 1S9EB 5KTQA 1L3TA 3C6UA 2HHUA 4MKYA 2B6AB 1HYSB 3C6UB 4OZ2A 1YJVA 4Y0FA 1TL7A 3GG0A 4C8KA 1W26A 2HBYB 2HIQA 2ALYB 4X66J 7FDRA 1B99A 5J1EB 4C0OC 4HI1A 4B02A 2R7WA 4DN9A 4ZVEA 1KQSR 2QA4G 4U7UK 2L3MA 4NXNF 3D0IE 4ZVGA 1KQGB 2Z58B 1RE1B 4MYTA 3HM9A 4JI1J 2JLFA 4IQXA 1HA1A 4QU6A 4CO4A 2PIIA 4F36A 5G4DA 5HBMB 2VIHA 1M5SA 1UP1A 1BHNA 2DGXA 2IRYA 4OI3A 1HNWF 2Q79A 1GMWD 1HWKA 1HD1A 1TK5A 2DNKA 5IZHA 4NXMF 2G2YA 5KFJA 3Q8UA 2VD3A 2MQOA 3PYDA 2AYBA 1U2CA 3G8QA 3ZTSA 1HARA 3W7BA 2JVOA 1VYAA 4ED1A 3P8BB 5KFTA 2DRBA 3S1TA 3Q8YA 4KHRA 5F8MA 4RW4B 1VFJA 3I5CA 2BKPA 2X51A 2WSCC 4W92B 2GA7A 3HZEA 1L3VA 3OVAA 1A6LA 1Z2LA 3DOLB 1S76D 1DTTB 2F4VF 1LXJA 3ZZZA 3DXSX 1JLAA 2OO4A 4DV7F 3AB4B 3W5XA 4DHVA 2B5JA 2BJDA 5IWAF 2X1BA 1S49A 1N5YA 4QPTA 3DI6A 3QAEA 1TKTA 4WTYA 4J7CA 1VHIA 3D6HB 3DI6B 3MUMP 4IRCA 1TKTB 5F8NA 3LUYA 3CC4S 1M1KT 4DFJA 1Q8IA 1S6PB 4OI6A 2QX0A 4HACB 3JSMB 2JOQA 1PYSB 3MM5B 4JI0F 5ITHA 1XMOF 1NHUA 3O8WA 2UP1A 1U6FA 4WYLA 1Q79A 3KHHA 1MWYA 2JZ5A 3HULA 2DNMA 1M5HA 1HD0A 5GAEI 5HQMA 3OL6A 1EKRA 1U0HB 2MZJA 2O3DA 3VV2B 4KSEB 4CQ1A 2KFZA 2W9CB 3MEDA 3BBFA 3DLGA 3PG9A 1OY8A 2K06A 1S12A 4LF2A 5KFBA 2A2DA 1NDCA 4RW7A 1PSDA 1RZMA 1YG0A 2F9JA 3UW1A 3KJVB 4OX7A 4ANEA 2IM0A 1M90T 1OY6A 3IR6B 4BLGA 4N5SA 4JI0J 4OHXA 3O5TB 4YQWA 4LQ9A 3I5BA 3R27A 3IM8A 3DKDA 4C9DA 3EPIA 4K2XA 5DQGA 1Q78A 1C4CA 1RT7B 2RUSA 3VVTA 5BJRA 1Q0NA 2P6SA 1Q5YA 6AT1B 2LA6A 3HT0A 4PR6A 5T7LA 2Z4PA 2AJ0A 3TA1A 2BJ1A 3C16B 4LBIA 2VBWA 4AE5A 3SQGB 2Y1RI 2BMBA 3SMZA 2FQQB 2BVZA 1IWAA 1HQ2A 2WVBA 2VH7A 3BM7A 1CG2A 2X3GA 3EE3A 3QGIA 4DV5J 3IC1A 3GMGA 3Q89A 3B4DA 3TAQA 4DU7A 4HH1A 1X4GA 1JLFA 5B0FA 1PJ6A 1VBYA 2R7QA 2XNQA 3AH6A 4NXMJ 4JV5F 5E3RA 3CNQP 5HATA 4AD6A 1JLCA 2MY8A 1X5PA 4ZLLA 4LR9A 2L9DA 3D6FB 4ZJOA 4KV8B 1JLCB 1YDLA 4TKTA 1UL3A 1VQ9S 3WDOA 3QGGA 1LW0B 1U48A 4UT4A 2QG9B 2DR5A 5HL7Q 5KOXA 1HR0F 1K8AT 5E33A 4NLOA 4Q7AA 3TARA 4WZQA 1VK3A 4OFZA 5HANA 2KXFA 4YOEA 3HSJA 2AYGA 4C2MA 5KFSA 4LFCJ 2BOAA 4OX6A 4ZPBA 3PJXA 4OX8A 5KG5A 1VIOA 3GR0A 4KJIA 2DRDA 3MHYA 1U1PA 1YHQS 5C25B 2GC8A 5B0BA 3H59A 4WK1A 1JIHA 5AXKA 3VQTA 1WEYA 3MECA 4DQSA 1K0VA 2BZ2A 1EIYB 2QO3A 3MECB 1RTIA 2ZBCA 1N33J 3WZ0A 4M8LA 1RTIB 1S4EA 4QZVB 4USUA 3UN5A 5HJYA 3D2WA 1EZZB 4RNOA 2ILZA 2N4DA 2XHWA 1QY7A 4OMFG 4LRBA 4P9SA 3PO4A 4P75A 2CQBA 2DO0A 2G0IA 4PG4A 3ENVA 4DR1F 1OIAA 2IJFA 5EGYA 3G6VA 4LSNB 3A3NB 3CSKA 3FQLA 3HHEA 5J2QB 1NPRA 1D9DA 3CCTA 2VFVA 3MAQA 1IM6A 1P9YA 3DXBA 4OZ0A 1FX4A 3R7BB 2PD1A 4P2FA 4LT6A 1IN0A 4Y2KA 3MPUB 2CPYA 5HN0A 3CDAA 3PIOQ 1VBXA 2R8JA 4F4AA 4EZ6A 3Q8VA 4C8MA 2RMLA 3G4SS 4WE1B 5A8RB 1F6TA 3QQCD 5ETQA 4JI3J 4K4SA 3D5MA 2C2MB 1RT1B 5M2UA 2K3KA 5I3UB 1RT1A 1IKVB 1L5UA 1IBKF 3W60A 3M8SA 4A8XA 4GKJF 2CQPA 3MGJA 5KFAA 3I6PA 2AJQA 4IFVA 4WU3A 5B0AA 3OUYB 2P9EA 4IFVB 2IC3A 5GMEA 1M0SA 3PW2A 2UXCF 5EX3A 1HBNB 3LGMA 3DYAA 4O3NA 2RRBA 5D4NA 2DR6A 4CNZA 3DOKA 4O0IA 3GFZA 1YRUA 3C6TB 1WF0A 4NLPA 1S7IA 2J0WA 4F25A 3SCLE 4CO2A 2FLLA 2IBKA 2QL5B 4I2QB 3TAMB 4P2SA 4ZVUB 4UOGA 3VAIA 4DL2A 1TL1A 1YRTA 1FFSB 2QT7A 4USVA 5A8WB 2Z56B 2VU5A 4UZCA 2R8HA 3SI8A 1GX5A 1NH7A 1SUQB 3CJ0A 5A6PA 2MGZA 2XSJA 3SSQA 4B9UA 1NK8A 2HNDA 4DLEA 3HSZA 4ZKAA 1XR6A 2BYCA 2CG4A 4RW6B 4ANCA 1N5QA 4YHHJ 4OIXA 4ZLNA 3IG1A 1Y3KA 3D28A 2R7VA 5LXRA 3IG1B 5L38A 3IO1A 2RH3A 5ETVA 2V8DA 3T9ZA 4EBCA 4JI4F 2FZGB 4YEAA 3UCZP 1RYRA 3HF5A 2KKHA 5FLXU 3NNCA 1JNZB 1NPPA 2MKSA 4ZVHA 5GAHI 4TU7A 4PWDA 4K0KJ 2KT5A 4RUCA 2AYEA 3LPEA 2FC9A 4U95A 4G3IA 3OLAA 2OEKA 3IFEA 2AEJA 3BR8A 5D77A 1JWWA 2RS8A 1FRXA 1HI0P 2B7CB 4ILLA 2ERRA 1N33F 1KTVA 3IBCB 3EX7B 1N4LA 1A9NB 4HHJA 3J7ZT 2YTCA 4I68A 4IRKA 1KHVA 1UZDA 1FJGJ 1NSKL 1YJNS 1NB2A 1HNIB 3EJMA 5BYQA 4YS2A 1V5IB 2MMYA 2W7PA 2YQ0A 4K5SA 1VQ7S 1L3UA 2DR7A 3K5MA 2GJFA 3EM1A 1KQFB 3NGRA 3CUNA 3H5XA 4NEYA 4DSKA 1NK4A 3PYEA 1RSCA 1JK9B 4L6V3 5KFWA 3OL9A 1T95A 1ULRA 3V6HA 3LQVA 4WP9A 1GNKA 4NCBA 4X62F 4LF9F 3BPSP 2JLGA 5EWEA 1Y5NB 3FSYA 2XYGB 3RW7A 3IP0A 3JB9k 3RAXA 2HBRB 2JX2A 2YKQA 3AQPA 3CJ8A 1CJKB 3FZ2A 2RD5C 3GJSB 3M30B 4USJC 5A0YA 5KFYA 3VAMA 4DUZJ 2MQPA 1BE4A 1JKHA 4M63A 4AUKA 3M9NB 1CQMA 5DQHA 1MROA 5BR8F 1UFKA 3EZ5A 2JHEA 4F0KA 3TUZC 2JEJA 5E7OB 3ZZTA 1Y00A 1ACMB 2V4JA 4QR0A 3OV7A 1NEEA 5A6WA 2VICA 2PT0A 1ZTTA 4CDIA 1OQ6A 2ZOMA 1RBLA 3PXGa 1J5OA 5CXTA 3OXFA 1WHWA 1E6YB 2EFPA 2UV8G 1NKBA 1U47A 1NK7A 1IKWA 3QWPA 2K7KA 3UPFA 1SJRA 2AIRB 4RR5A 5F3ZA 3M6XA 3BKFA 4ID8A 5KFNA 2ZH9A 1HI1A 2UU9J 5FLXY 1H2TZ 1PG5B 2AJ2A 1D0EA 3O3LA 4UF4A 3BDPA 2CVEA 1TL4A 3QAUA 4JV1A 1QE1A 1RTZA 2FIUA 3FGVA 2F63A 3FMBA 3OSNA 5DLFA 2M7SA 1GK8A 1SH2A 2WOMA 3KG0A 3D66A 3DGVA 2R2TA 1XBWA 3I0SA 1TKZB 1TMMA 1NSAA 3N0VA 1ZOTA 2GCFA 4MKAA 4ZK7M 1WC5A 1VR6A 5KFLA 4F4WA 4YB6A 1D8YA 3AD8C 2MSSA 3ETOA 1ZM4A 2DNLA 1V3RA 3TOQA 3LP0B 1C1CA 4N8NA 1XQIA 1JLBB 5IXUA 4X4SA 3QIDA 2E1MC 4KO0A 3LP0A 2OD6A 1PGZA 3DDNA 3BBBA 2DK2A 2NZCA 1U7LA 4A47A 3OL7A 1R43A 5F0UA 5L9XA 3HVTB 3JTPA 1RTJB 2HGMA 1M5VC 3IWNC 3HDSA 4X64J 4I6YA 4PYAA 4O3SA 5H9FJ 4EFAC 2P6TA 3OFHA 2ADBA 1AZSB 2WRMA 1SC6A 1FE4A 2HPUA 5KAKA 4CM0A 4DV6J 3M8QA 3GIIA 1S57A 3RB0A 3R6LB 3M6UA 3G2XA 2WVEA 3CJ5A 4OV6A 3PHTA 2W8KA 2PFFB 4DX7A 4PPDA 5IOLA 3CJ3A 5I3PA 1UPPA 3IN5A 3CCRS 2OAUA 1FRMA 3G9CA 4K5RA 4LIRA 4PPZA 3H90A 2RS2A 3N6MA 4MYUA 2DIVA 4L74A 4HEA9 1BWVA 3WX8A 1FJGF 3AJ2A 2UXBF 2RVJA 1R0BG 2WW8A 3C15A 5KFZA 4AXJA 4AXIA 4QWCA 4Y34A 5G0RB 1TK8A 2DIUA 1JNRB 1WELA 2FJEB 1AUSL 3CCLS 1FE0A 3KLIB 3MMAB 3QT5A 4DV6F 4OX9F 3NNHA 2OUGA 2QGFB 3IRXB 5DQIA 3HD1A 2YKPA 2HNZA 2F8MA 2LXIA 2DNGA 1RA7A 2NYIA 4ETZA 2HNZB 3JAMU 1CULB 2VC1A 1ZM2A 4F3OA 5AE3A 2XULA 3GIJA 4A8YA 2KG1A 1M1GA 3EMTA 1F5AA 3RAQA 2CQ2A 4JI5F 1W2IA 1L3KA 2W2OP 2ZH2A 1EX8A 2GNKA 3LAMA 1H38A 3TUIC 4LREA 4OYXA 2HMIB 2A3JA 2XMWA 5HVGA 2IJNA 3EZOA 1H98A 1HQUA 1U09A 5KFIA 2W4DA 3UVJB 4ED3A 1YJ9S 1FXLA 3HHDA 3D68A 3GE9A 1J27A 2HQGA 2NSCA 3EGWB 2R42A 4P2MA 4DOZA 1KNZA 3UI3A 3LANA 2ZH8A 1NH8A 5JJBA 4KBIA 4ANDA 1VIXA 4H4OA 4IOAQ 4OZJA 1U1KA 3QRPA 2QJ3A 5HVFA 4QPXA 2DHHA 2Z57B 3MR7A 3P5BP 1PAEX 2VG7A 2LFVA 5HBMA 4EBDA 5KG2A 3IM9A 3LWLA 4TY8B 2DNQA 3TJ9A 1SIZA 2DXFA 2XY5A 3KLGA 2DGOA 3M9MB 2WZ1A 3OSPA 3HHLC 4HT5A 4PXEA 3WQPA 5JUMA 4DV3F 4EZ9A 3D7SB 2QFIA 2W2PP 1HWJA 3PJWA 4ZIVA 2JJ4D 3T5JA 3CJ2A 1ICEB 2BEFA 4RW8B 1UA1A 2LCWA 4RW4A 4IO9Q 3VAKA 2VONA 3OJSA 4K4YA 2HVDA 3UQSA 1XN9A 4DZDA 5DDRC 2OPSB 5GADI 1S0OA 2UXDF 3MFHA 2JC0A 5IT0A 4A4JA 5C2GA 4QWDA 1FCAA 3KK1B 4PG5A 4ED5A 3KK1A 4MKVA 2HWTA 2B5JB 4CO1A 1P27B 2VBXA 3GSIA 4B3OA 1RT2B 3I96A 3C46A 5GMKa 2DNYA 2OPQB 4J9LA 1FRLA 1Q16B 1RT2A 2CNKB 3GV7B 3UDLA 1S5ZA 1Y5IB 2J7KA 4H4MA 2VQFF 1UVLA 2I8EA 2JLEA 4I7FA 1CBKA 1TAUA 3PYGA 4I7FB 3ZO7A 1I3OB 1UEVA 4YB5A 5DG9A 1UA0A 2HG4A 4NRUA 1Y7PA 3CXCR 1GXLA 2ALZA 2V0NA 1RU2A 3CCQS 3EGVA 3BV8A 3Q8QB 1U0HA 3TVZA 1UWBB 4C0BA 2RHSB 2YQ1A 2A0FB 3G87A 4FNIA 3D4JA 4M5GA 4ZVTB 3SCJE 3S8SA 3HHKA 1N52B 5D0RA 1LOUA 2OFHX 4DPOA 1LWXA 2D1CA 1N8RT 2LECA 3WC2A 4ITSA 4PAAA 3MMBB 4B3TJ 2KU7A 4KT0C 4B3MF 3JQJA 4RW7B 3I31A 1TVRA 4IG0B 3L09A 4IKAA 4DF8A 2G9OA 3G96A 4I4BA 5CCLA 2Z2MA 2KXHA 2M5YA 4LF4F 5LMUJ 2I5JA 1RI7A 5DZ6A 3J7YU 3NNAA 2VG5B 1BXNA 5FDLB 2YWHA 1NM2A 4QR2A 3SCIE 2KH9A 2WBRA 3NWGA 3QJJA 2EEYA 4G1QA 2PMHA 1B70B 4IOBA 3N79A 4HL9A 3BO3A 3H5SA 4EO8A 4JI5J 1HLWA 4X4UA 4LSLB 3MR6A 3LPYA 2J9EA 1WC4A 3RJMB 1QSSA 2FDNA 1R0CB 3A3PB 2ZKTA 3OFEA 2J9CA 4I56A 1LWEA 3IS9B 4QJVA 2X1AA 4DV2J 2DCUB 3H7HB 5KG7A 5KG6A 1LWEB 1S6QA 4A48A 4DX5A 1KONA 1VHFA 2C3OA 2UUWA 2YWKA 3BREA 1NAQA 3FVYA 4CYUA 3GILA 3CCES 2Z30B 1T02A 3PR4A 3B6BA 3LF0A 1Y5LB 2GFFA 4X65J 3EGNA 4GO7X 2UUTA 5E3AA 4U67Q 2G13A 5DS7A 1NKCA 1Q8BA 2DBBA 4DFKA 4WXOA 3FCHA 1SQEA 4KPCA 1T9WA 3VAGA 1RAIB 4KC5A 5HP1A 3FBFA 3TO8A 4M5JA 1NK9A 4OI0A 1LW0A 3V6JA 2EKYA 3OXGA 5ETKA 4WJBA 3Q22A 5HP1B 2PI4A 5F8JA 4NLQA 2EG1A 1P6TA 1VMBA 4GVLA 2UVWA 4O3RA 3RR7A 1VQOS 5A8KB 5KFCA 2R8GA 2QFJA 1IR0A 2XEXA 3O6QA 2PI5A 3KHGA 1FF2A 2CRLA 4F3MA 4RU9A 3KUEA 4RJVA 2NQPA 2MZRA 3AJDA 3ET6B 4Z2XA 4NLXA 3SCKE 4CH0S 3PDNA 1X0FA 3SXLA 1EQ0A 3QLHA 1VDHA 2ASJA 3AXMA 3S01A 4LF4J 1C0TB 3ILOA 1NJYA 2BANB 1H0HB 3LGHA 1KSPA 2UVRA 3CEDA 1FDNA 3GFYA 3IR7B 3M2UA 2B8QA 2BANA 4M5MA 1TTHB 3I32A 3S7RA 3WX4A 1TKDA 3M2UB 3JQKA 5E0OA 2W2MP 4C3KA 2H51B 2EK6A 3QZ7A 3SZ2A 4OHWA 5KFDA 5GADU 3HKWA 3HP6A 3RYLA 2EK1A 2AX1A 1U1OA 1R0AA 4J9UE 2JFDA 1RT6B 4ZVPB 1DARA 4O3OA 1QUPA 4LR7A 1RWMB 3ZTQA 2Y8YA 2XMVA 3CO9A 2FC8A 1T7PA 3SFUA 3Q8RB 2HZAA 3SV3A 2MKKA 2CA9A 3FJ2A 3QRRA 3HVAA 4B3SJ 1SPBP 4DL0C 2FHKA 4CLKA 1SQFA 2EXUA 3MM7A 4FDFA 5K5MA 3T3FA 1V3SA 3MM7B 1RWPB 1TKXB 4USTA 4CWBA 2M9KA 5F8IA 3L95X 4X65F 4DR3J 4Y00A 1DTQB 2UZAA 2WB4A 1N5VA 4K2JA 4C8NA 3NBPB 2NREA 5ETMA 1FT8A 2ZH6A 3Q8SB 2HQCA 2RILA 2ZHOA 3R97A 1UFWA 1X5TA 2OFGX 2MSTA 3QT7A 2KRRA 2C2EA 1SI9A 4IFYB 2IC3B 3NG8A 1G2EA 3DYAB 1UKUA 1CJTB 3R5CA 3BJYA 1VCTA 2EFNA 5EDWA 1ZYQA 4C8LA 1S0MA 3C3LA 2DNPA 4MFBA 1KWMA 3MZIA 4ZJLA 4M5NA 3TAMA 1D8ZA 3I82A 3MDFA 4PXBA 2BQUA 2NUHA 1I6JA 5A8WA 3OVSA 4LVNP 1T3OA 3G8SA 2BOPA 4N76A 2PN6A 1VK8A 1CJVB 2OGUA 4ECVA 1TFYA 2BW7A 3NAHA 1CJVA 4WU2A 1T9XA 3OHAA 3TANA 5KFHA 1PJ7A 1MN9A 2WVFA 4EI2A 4ZIWA 1SC3B 3K5LA 4A46A 5CA5A 3H5UA 1GAOA 1LV5A 1XR7A 4B3RF 2CG8A 2ZZMA 1EHWA 2LQ8A 1BQNB 4OV1A 1NPKA 4Y2AA 4D3HA 4FNHA 1QSLA 1JJCB 4B17A 1LFWA 1BQNA 1YVFA 1U6BA 3SEOA 3NGTA 1XNQJ 1NHVA 4URSA 4ZCIA 4WP3A 3PR5B 1YX2A 2IM2A 2GMJA 2H4WB 3E01B 4OJHA 2BW2A 4L73A 3KLHA 1XMQF 2PDAA 4A8SA 2CQGA 1K0TA 4ETXA 4WCEQ 4YUDA 5KT7A 3PW7A 1IWGA 3CWJA 3E51A 4NLVA 3V4IB 3K8WA 1J2VA 2CKWA 4FYVB 2QA4S 4WTOB 4NLUA 3MCMA 2QMXA 4ID5A 1N5TA 4EGLA 1X7VA 1GMWA 1RHRB 4X2BA 3GP9A 2B0GA 1LW2A 1XR5A 3KUGA 4ES3A 5EN1A 3KFWX 3RTVA 3A8EA 4FYXB 4EYHB 1VQSA 3Q2SC 2UXBJ 2RSQA 1WUUA 1KQKA 4HKQA 5SZTA 4DPXA 1BQMA 2KZMA 1W2BR 1NUEA 3J81Y 2R2RA 1BQMB 8AT1B 4YR3A 3BF4A 3NEKA 5KFKA 4J9RA 1S0NA 3HHNB 1YZ6A 1NLKL 3MM8B 5I4MA 3T1AA 1G6BA 4GC7A 3U02A 4QIWD 1U1MA 3MTKA 2Y8WA 3ADAC 2F40A 2F7VA 1UWAA 2P9GA 2X1GA 4ZPCA 1JLGB 1WI8A 5KG4A 4USMA 1X9WA 3CMES 2MYFA 3PFEA 3TJ8A 4KE5A 2HNYB 1CC8A 1S6UA 4WIQA 2K8GA 1YBAA 3LAKA 2ZD1A 1MROB 2ZNZA 4GO5X 3BGRB 4K50A 2DITA 4O3QA 1KTQA 1LWFA 2HWIA 3GONA 1REGX 5ETNA 5C24A 2YVSA 3OTOF 4DS5A 2EC2A 3QJPA 2XS5A 4DV2F 2CPDA 4MK7A 4FZVA 4KPYA 1K73T 1TUVA 2W7AA 1PBAA 4JOUA 2HQ3A 3DRSB 1URRA 4LF6J 3MUTP 4ES2A 2I6WA 2GW8A 3DHWC 3UD5A 3IRWP 2O66A 3CD5A 4KGVB 3ISND 1WNEA 5C7PA 4DV1J 4YDDB 3IWXA 2WHOA 3GCXP 2MHNA 4NA3A 4CI0B 3H42A 2DNNA 3T5KA 1ZPWX 2IBOA 2RQKA 4M5DB 2Y9HA 1QE1B 3WHIA 2XTJP 4HH0A 1PYTA 4P2XA 5L1KA 2QLWA 2FHJA 5CYMA 2CPEA 4WKYA 3SDEB 1N34J 3K8VA 5CYMB 2RHQB 5BYSA 4KQZA 2YBVA 4NYPA 4URQU 1OPIA 2FVPA 2YNFA 3MXHP 2JH3A 3CDUA 4NLSA 5C42B 1NJXA 4BDPA 4ATNA 5LXYA 2IVYA 1JLBA 2WVCA 4Y3CA 2CQIA 2BE2B 3CMAS 4OLOA 1VC0A 4C8OA 2F1FA 3L7PA 3HVTA 3ILIA 2C2ZB 3OL8A 3POTB 2FD2A 4E0DA 1KOOA 3GFHA 1U25A 1NK5A 1ZH5A 4C7QA 4O4GA 1RT4A 1HMVB 4KAIA 2KN4A 3R2CJ 4QIGA 3RG6A 2W9BA 4N77A 1AZSA 2W9AA 2JEGA 3VGTA 2GS8A 1G3OA 1PILA 2EFOA 5KFGA 4CH7A 1LWCA 1DURA 3M8QB 3NCPA 2HBQB 2VQFJ 4J9PA 3JSBA 3TEGA 1GTHA 4E98A 4JV0A 2PGCA 2XCPA 1HBUA 1RTHB 2DY9A 2GJIA 3A3OB 2ZJQQ 4NLWA 2FJXA 2CDRB 2E5GA 3TX0A 1H7XA 2HKEA 4ILRA 2WONA 3TVKA 4NCAA 1GXTA 2ZVIA 4W90B 1BC6A 3AA8A 2CPJA 3KLEA 3EDRB 4IDKA 3MEGA 2XWXA 5I42B 2POKA 3C15B 4ZVSB 2NXCA 1N6QB 3NOCA 4DLGA 1HNVA 2D9PA 2P5VA 1IBMJ 4JYAF 4WZMA 2EKNA 6FDRA 5KFMA 2HFOA 2AW0A 4WFBQ 3K5PA 7FD1A 2XBPA 1YLXA 1DFDA 1IQZA 3D9BA 5M2PA 5KFQA 5HMZA 2PFDA 4JB8B 4V1Ak 4LFBF 2E1AA 2QA1A 2GQ2A 1PCAA 2C2RA 4LBHA 2E29A 1S6OA 5JVHQ 4J9QA 4FYDA 1YSJA 2AF6A 2HK3A 5KFUA 1KR4A 1RAEB 3IWLA 4Q45A 2KM8B 4K59A 4QW9A 2R2UA 2KZZA 2DVIA 3MAAB 3WIVA 3FFIA 1VQ6S 2BE9B 3W9IA 1ZZNA 3QPIA 3KK2B 2UV8A 3R5JB 3IAM9 3MMJA 1OYEA 1B0PA 1T8EA 1S1VA 3VR1A 4TQRA 3B8HA 4ENOA 1X5OA 1P1TA 2B51A 2W4CA 2NXUA 2GHWA 3AD9C 3M32A 4KGMA 4IH5A 4UY8T 2MZQA 3X3UA 2ZJRQ 4JV5J 2CJ9A 2KJVA 2Y1IA 1RAGB 2QA2A 2VG7B 3AXKA 3W8PA 2B6AA 2PC6A 9ATCB 1ZTWA 2JVRA 4RL1A 1VQ4S 1HYSA 1REVB 1B0TA 3G6ES 3CTRA 4YN3B 2CPFA 5IC4B 1REVA 4ZP8A 3I9ZA 5EWGA 4X4OA 3G6XA 4LF7F 1AA1B 2P9CA 4PWUA 1XMQJ 4HLBA 2MLZA 1RHUB 3ISNC 2AT1B 1WHYA 4J37A 4JI8F 1FNXH 1IBCB 4N41A 4F02A 1N32F 1RDRA 4LF8J 2ZC4A 4CTAB 2LQBA 4DQIA 5ETTA 4CLFA 5KG3A 5B0EA 3UCGA 2IAJA 3BH7B 3DLKB 5J2NA 2QTWA 2AEMA 4CO5A 4UY85 2B8PA 2CJYB 3ZZOA 1JXVA 2HS4A 1SKSA 2GJ2A 3KWMA 4AL5A 1OSDA 2HHWA 4OYIA 4C6AA 4LRAA 1EQMA 2FVQA 1SH3A 3BQ2A 1JB0C 4O4RA 3KHLA 2ZBRA 4U96A 2E7WA 2ZOFA 4ZVRB 4ZPWR 5CYQB 5K14A 3J81j 2MZTA 1SIWB 4P52A 3CC2S 3BDEA 3GPAA 3K59A 1BD6A 1OO0B 2HIYA 3V2UC 1WC3A 4ZJQA 1D9FA 4F4KA 4ER8A 1AUDA 3QWUA 1O8BA 5B08A 4UZBA 1TP7A 2W1BA 1VJQA 4K4WA 3SSSA 5IM0A 3DLBA 4N8OA 2A10A 3PRBA 2I1RA 2OJ3A 3MM6A 5DG7A 1RWUA 1M5KC 1KP6A 1TELA 1SJ4P 4PWWA 3MOJB 4JI4J 4JI6J 2J8SA 2CPZA 1FEEA 4BWJA 3US5A 2R7SA 4UQGA 2EW9A 2NSBA 2KL8A 2C3UA 4NI2B 3TW0A 3M2VA 4Y6IA 1S6PA 1GTEA 4ES1A 4HACA 3JSMA 1CS4B 1CJUA 3OR1B 1T3NA 4DV0J 4KFBB 2J6SA 2GV1A 4LF6F 3QNWB 2A6MA 3VAHA 1AW0A 4Y65A 2D69A 3TA2A 4AYBD 2I5JB 2BX6A 1I5OB 1X4EA 3H20A 2MKCA 4YR2A 4B3SF 1Z4UA 2H5IB 3MOZA 3QMQA 5DZ7A 1RBAA 2NXNA 1A0OB 1RWVB 3P96A 3HCXA 4ZP7A 2W9CA 4OL8A 1R7IA 1UETA 1SC1B 2ASYA 2KB2A 4TLQA 4ZOSA 4ED7A 4B3TF 3I0RA 2KRBA 4TN2A 3ENQA 2HGNA 3CC7S 1ITPA 1FWPA 2IVFB 2N82B 1IQTA 2LEPA 3Q8PB 3SSRA 5A76A 1HWUA 3FC9A 1T0TV 1KEKA 3R5DA 1FXDA 1IBKJ 1WKLA 3GCWP 5MAOA 1S6QB 3OW2R 1MMNA 3QGHA 3HPOA 1UVJA 1NZAA 1RJJA 1ZA2B 2JNJA 5JXSA 1RT7A 1FKAF 3HK2A 1TQLA 1WEZA 1B4SA 3QZ8A 3IA0A 1SJQA 2QL9B 2H4YB 1SJ3P 2CJQA 1RU1A 4HDHA 2CVIA 4ECSA 4FF1A 3ILJA 4NYOA 4DR4J 2V68A 4ALZA 1VRQC 2VPXB 4NE9C 1UEUA 1WORA 2MHEA 4QQBA 1H7WA 4F0HA 4CLUA 2U1AA 2V2QA 2ZH3A 1FJCA 1O0PA 2DH7A 4OHZA 2MQMA 3BEGB 3BR9A 3CJ4A 1PO6A 2WAQD 1RCXB 3DOLA 1WSRA 1DTTA 2XZTB 2L9NA 1JLAB 1VQKS 3K2YA 3MM9B 2H65B 1TK0A 4UOFA 1N5YB 4UUWA 2XS2A 2JDJA 2ZITA 3S6EA 2FZKB 4RNNA 3FCWA 2Y0BB 1FVQA 2EVZA 2FLPA 4DBQA 1C0TA 4CLPA 2ATLA 1CQNA 1S1XB 2RDDA 1WOPA 4ZCLA 4K8RA 2FUG9 1RT3A 1SL2A 2ASLA 1YRXA 5HQ8A 1HNZJ 2IDEA 3CJRA 4I2PB 4QYRA 3UNYA 2IMWP 4PCQA 3SV4A 1S1TB 1X8DA 2CJXB 5H1SV 1IBLF 2F4FA 4YY3F 1U24A 5HK4A 2AGQA 4QCLA 4DXLA 1LK7A 4LMZA 1SKUB 1GFWB 3MEDB 2MQNA 4PXDA 3GIRA 4ZS6A 3W5ZA 3KG1A 1RHJB 2Y0SD 3NS6A 3SQOP 4Q43A 2F8EX 1RLDA 1VLOA 3CCUS 4NMXA 3OT9A 1K47A 3VAFA 2DGUA 4DV1F 4A8QA 1XMOJ 4QIVA 2MY7A 1U49A 1SVDA 3BKUA 1V6HA 5K8PA 3I56S 4PXCA 2HZCA 1RUSA 4KYZA 4NEZA 1RLCL 4J9VA 1OWXA 2EI5A 2HVEA 1IBLJ 5GVQA 4OI2A 2MJNA 1FKOA 5CAAA 4OZ3A 4Y2IA 4OYOA 4LSZB 3OTOJ 2VUGA 2HFSA 4LSNA 4NMLA 5J2QA 5BYRA 2E66A 5F8GA 4OX9J 4E2FB 1FDBA 2CAJA 1RWWB 1C0UA 2DXEA 4B9LA 3IBFB 2V63A 1C0UB 3OQ2A 4YB1P 2XO6A 4ZA1A 1RHMB 2NCKL 4DX6A 2DHXA 3RB6A 1RAHB 2FHJD 2LVWA 3J81U 3JYTA 2MQLA 4PUOB 1APSA 2BABA 2W24A 4H4KC 4USWA 3M8PB 2KG0A 4MFBB 4K4XA 1ZBTA 3M8PA 3FNNA 1VQPS 3KYLA 4F2RA 1BUXA 1HNWJ 1IKVA 2XZDB 2YWGA 2R7XA 2D9OA 4JBCA 4DEZA 3RRHA 4ZP6A 5LOQA 2E7XA 2PA3A 4XIUA 2LLZA 3KLFA 3UE2A 3L7OA 2RIJA 4BS2A 1FNOA 3O44A 4ZCKA 2FTRA 3M2RB 5C5JA 3QIPB 5F8LA 1DQAA 2QMWA 2BM0A 3OJUA 3VTIA 1MMDA 4M5KA 5AE2A 1X4FA 2CADA 4B08A 3C6TA 3T1HF 2RJZA 1DLOB 1G4CA 2CPXA 4FXWA 1WC0A 3T6JA 2W8LA 3GV8B 2BE7D 1DLOA 2I38A 2OD4A 3HSDA 4RBVA 5IQQA 3M8YA 5LM7E 4EK2A 2MZSA 3H5YA 1BWEA 3F44A 4Q8FA 3CO0P 4KH0B 2YNHB 2E5LF 2XSJB 3VWSA 4N56A 4DV3J 2YNHA 4DL4A 1UVKA 5FIIA 3M1VB 2FY8A 2HNDB 2BRKA 4LF1A 5AE1A 1N5SA 3M8RA 3RBXA 4RW6A 2IMOA 1RWOB 2RRNA 3DLEB 4AQYF 1D09B 2W4PA 1FD8A 3Q24A 4NRTA 4ID5B 2BR0A 2FJAB 2WBMA 3TUJC 1WWHA 2ATCB 4ICLA 3CDBA 5IFMA 1S10A 2LA4A 1XIQA 4ICLB 4OZNA 1WG5A 1L3SA 3NMAA 4LFCF 3VGSA 4YMEA 2DHAA 2ZM6F 3OTEA 1JJ4A 2VBZA 4PZVA 4U6PA 4DSJA 1FTRA 2HURA 1XEZA 1JLQB 2ROEA 1VISA 2WVDA 3GJRB 2ZKUA 3RB3A 2VA3A 1W7WA 2GMHA 4YR0A 3J7AN 3P49B 1VRTB 4WXWA 5RUBA 5DDOC 2UXDJ 4YFUA 3ZTPA 2DEJA 3U1LA 3P6YC 5BR8J 2VOPA 4ECXA 1G1XA 3P5TL 2EBGA 2V69A 4WE1A 3UCUP 1RAFB 2VODA 4R0EA 2H5JB 1HNIA 4FS2A 1F9FA 2HNYA 3N28A 3CD0A 4RPFA 4DCJB 4C8ZA 2B3TB 3RBEA 2N7CA 2R9LA 2BQRA 2OLWA 3IBWA 4ZHRB 2MZ1A 4BWMA 5DM6Q 3NY0A 1AFJA 4NLTA 2VA2A 1IKYB 2CWKA 3RUBL 2QYCA 2J7UA 4DR3F 3NXZA 4TYAA 3CJKB 4X4RA 1WTBA 2OPPA 3OUYA 3TZYA 3N5BA 4TY9A 5LSLA 3KJQB 4CP5A 3OPKA 2OPPB 3DFEA 5DO2A 5KT5A 1Q86T 2VFRA 1HBNA 5AXNA 2JEIA 4ECTA 3BGLA 4M5HA 3LGNA 3TRGA 1MMLA 3BN4A 4ED0A 1RABB 4KGZB 3ZZUA 1Q7LB 1NJWA 4NCGB 3VALA 5HSPA 2R4FA 4CO3A 4NCGA 5D15A 3GG1A 4ZCMA 4DUYJ 4X84A 3T1YJ 2FGOA 2JRSA 5IV3A 3UD4P 1K1SA 1KN6A 2QL7B 3UDCA 4BCAA 2UUCF 1SC4B 2QMUB 3BSCA 2YKOA 3KNGA 4I69A 2MGZB 5EX0A 2IM1A 4WYWA 1F5BA 4XPCA 4NZ0A 4DR7F 5C42A 2XS7A 5CZVA 2R7UA 4DR5F 5C2CA 5CD4A 3T1HJ 2E44A 2M0GB 2VV5A 2X3DA 1S1UB 4OI1A 2KT2A 3R5BA 3OR2A 4FBUA 3FBEA 1S1UA 1RKJA 4DR7J 3OR2B 1Q4RA 3HHLD 1F60B 1FK9B 4DQPA 1WEXA 2G0CA 3F73A 5FJ4A 1UW4A 1HMVA 3H0PA 3ZNUA 4QWAA 4QR1A 2C2NA 3EDQB 3I87A 1ZM9A 3K89A 5KFPA 1KLMA 5ETRA 1XC9A 5B0DA 5LMNJ 1NB7A 4B3RJ 4ZPVR 1LWCB 5GAEU 1EETA 2BRLA 2IYIA 5D0EA 2ASDA 3J7A1 3PKMA 1MSWD 2OI2A 1DQ8A 3DRPB 4NLDA 5KOWA 2ABYA 4TYBA 2J6UA 2NR0A 4ELVA 1TUGB 1NO8A 2DO4A 1HI8A 2WW4A 1S48A 1WI6A 1Z2ZA 1H73A 5LJ3Y 3HVRA 4Q0BA 4GKKJ 4O44B 4L76A 5IWAJ 2UVUA 4GMKA 1M1HA 1ZM3A 2DISA 2KVQE 4MK8A 1YIJS 4FYYB 2Q66A 4KR0B 1VI7A 4TNOA 2F4VJ 2CJBA 3PVXA 2CNLB 4ELUA 1NDLA 2R7OA 3MCSA 4W4MA 1KDNA 1S99A 2B9XA 3AHPA 3GYNA 5J1NA 5I42A 2A6OA 2A1BA 2D3OR 2COLA 5I3QA 1N6QA 1MWZA 1DHMA 2G2OA 4C8YA 3G71S 1RAAB 3L4BC 3MR3A 3B54A 1OMSA 1NMEB 2RT3A 1C1BA 2ROGA 3A1YG 1RWKB 5T41A 3M05A 4URGA 3GYXB 4FF4A 4QU7A 2DGWA 2OMLA 3AT1B 2ZC3A 1S0VA 3GFXA 4RX6A 3PEJA 3TR5A 5CHCB 2ZOGA 2YNIA 3MPYA 1JKHB 1HBOB 3NKYA 4ZLJA 3HO1A 4Q8EA 3NS7B 2BDPA 4NX9A 4OHYA 1FESA 2V9WA 2A18A 2VHGA 1JJ2R 4HDGA 2H48B 4M5IA 3MMCB 2HHXA 4DI6A 2BM1A 1RWNB 3KLIA 2V4JB 3RBDA 1IJEB 4C98A 1RKIA 3KOAA 2XNRA 2DH8A 2HEKA 3KUHA 4L72B 4DR2F 4DCPB 2ZDOA 3KK2A 1E6YA 5KT3A 3L9ZA 5CQGA 2LDIA 3CW2C 1IKWB 3EXCX 1TUWA 4NZ7A 2AJFE 8ATCB 3LTOA 3PIPQ 3TWZA 1FX2A 3F0NA 2HHTA 2Q6BA 1U26A 1X9MA 4JI7J 3GU0A 3T6BA 4DR6J 3PNIA 5K20B 3M9OB 5LMNF 1TL7B 1YBUA 4P72A 2R8IA 3TQEA 5IQ6A 2XMMA 1O51A 1IM4A 5J1EA
chains in the Genus database with same CATH topology
4A8FA 4DR6F 2WOMB 3DHXA 3PX0A 2YX7A 3D1OA 5DGBA 3PFOA 1H2UX 3LO3A 4DG1B 2Y1JA 1U8SA 5CCMA 4DG1A 2IA6A 2H9ZA 5F8HA 2D3ZA 2ZFHA 2R7TA 2C3YA 2RDJA 2J7WA 4KRWA 3VCDA 2DB1A 2WSFC 4HTIA 4CCHA 2YKMA 3CGIA 2JFKA 2VFUA 4ERDA 3O1LA 3OTCA 4DJBA 3FEYB 1U2RA 1X5SA 3BZQA 4NA2A 1KHWA 3SCIE 3J7Z5 1FRJA 2J9DA 4C8ZA 5L1LA 1ZAVA 2GGPA 4MMOA 4RW9A 5J1PA 1U1RA 1LK5A 3MFIA 2GGPB 4RW9B 2FY1A 2X1FA 3KKFA 4J9NA 2W7OA 5EUHA 2LXUA 1WF2A 2CPHA 5D3GB 2YKNA 1S79A 2O5DA 1FJ7A 2KXNB 5H9EJ 1RT5A 3B4MA 1FRIA 4MIWA 3LP2A 2OTJS 1ZAWA 3LP2B 2XLJA 5AJ3F 2OPQA 5G0RA 2VC0A 2FJDB 1URNA 3CIZA 3H98A 3MMAA 4NLYA 4H4MB 4F67A 2LMIA 4NL5A 4ECYA 2OSQA 2CQ3A 3LW5C 3OR1A 2C3MA 5HROA 1FXRA 1HW9A 5HROB 3V81A 2LQ9A 3CT9A 2N4CA 5D6GA 5F3TA 1MNEA 1S9EA 1A7GE 2CQ4A 3MR2A 3LWMA 3K7RA 4R5PB 3DLGB 3DLLQ 4QWBA 4Q2MA 3BQ0A 2DGVA 4JI6F 4H54A 4OJ1A 1N56A 3EXYA 2HMIA 3PY8A 2V8VA 1HQUB 4TU8A 1QAIA 4FXDA 4RUAA 1X4DA 1UFLA 3FRZA 3K57A 2WSEC 3U7JA 3T19A 2M70A 2UU9F 2QZ8A 1NK0A 5A2QY 4NLRA 4YDXA 1JJHA 3F41A 4IQMA 3CD6S 3H4DA 2APOA 5LT5A 5DG8A 5KG1A 1SL1A 2FB0A 1M5PC 1RA6A 4TY8A 5LSRA 2B43A 1HHSA 5CH7B 3J80Y 2XMUA 4UOCA 3VAJA 2O67A 1Y4ZB 3SQGA 2B4PA 1YTYA 1SL0A 3PW4A 2LEAA 4LVOP 5B7WA 1UAWA 4PQUB 3VF0B 1CSJA 4I67A 3H25A 4PQUA 3IS9A 1HPZA 3UFCX 5D8HB 3DMJB 3AY0A 1O5JA 3KMQA 4OI4A 3PW0A 3DMJA 2DRAA 4CNYA 2YH1A 1S9FA 3MM9A 4DFPA 1RAJA 1VLYA 4KV8A 4CT9A 2IA0A 4YB7A 4LFAF 2ZHAA 2ADCA 4B9SA 3FEZA 1XNQF 3UWTA 3KNAA 1DBDA 4DV5F 2UUAF 1AFIA 5HI7A 4C0HA 4I2PA 4P7VA 1TV6B 2E9TA 1SKRA 2K2PA 4DQRA 5C25A 1TR0A 2NLWA 4NOHA 4IRDA 1CVJA 4OZ1A 2B4VA 2QSWA 3QYYA 2U2FA 2XMJA 3NP5A 3PACA 1N48A 1X0PA 3CE8A 3QO9A 5CD4H 2YY3A 2MKHA 2MB0B 3KJVA 3QO9B 4DL5A 1YGYA 3OXLA 1MW7A 3TA0A 3MAHA 4G6VB 4HT7A 3GIMA 4K4VA 4DF4A 1K1QA 2CYYA 3Q23A 4LJMA 4IH7A 1R0AB 4R25A 3CULA 3RAMA 5KFHA 2PEHA 1RT6A 2VBYA 5LL6d 2IVMA 4F3QA 2QRRA 1JXEA 3ISZA 2ZZNA 2KM8C 3LOUA 3W3SA 1HQEA 1XTZA 2PMZD 1EP4B 3PEHA 2HHPA 1S9GA 2DGTA 3KHRA 1EP4A 1Q53A 5L1JA 1VBZA 2HGLA 1TKXA 2BV3A 1U45A 1ROFA 3TVYA 3T1YF 1SV5A 1X4AA 2HS0A 1SXLA 4DUYF 2GQQA 3NBPA 5CZXA 2ZJPQ 2HHHF 4NPOA 3E2EA 1VGYA 2VOOA 4DV4F 2AYMA 3OVBA 4RNFA 4FVMA 3HT3A 4WK3A 2XY7A 1NJZA 2HHQA 2OP5A 1C2PA 3E3XA 4AFFA 3QIPA 4M1KA 4DDFA 4DSFA 2KJWA 5L1IA 4WFZA 4BC9A 4I2QA 1X4HA 3GWCA 3FDSA 2NS1B 1TL1B 2M8HA 5A8KA 2WTFA 4DR4F 2Q6CA 3K5NA 2RRAA 3MEKA 4X4PA 3I4HX 4J9KA 2JEFA 2YWEA 5JVGQ 2OKQA 4FXVA 4C11B 2RU9A 3GB0A 3TYTA 2N3OA 2KYZA 4Y2CA 5KFFA 2KDOA 3N6LA 1LKZA 1NJIT 2ZUGA 3NAIA 4P6QA 2M52A 4P7TA 2XSFA 3FRYA 3M4XA 3ONQA 4CT8A 3NL0A 1SJ1A 2OPRA 2EFVA 3HHLA 2RNEA 1V3ZA 3HHLB 1HL6A 1S97A 1SKWA 1P1LA 1GXUA 2K3IA 2IYGA 2V4QA 3BQ1A 1YJWS 4RWXA 2ACYA 4IG3A 2VQEF 4LUBA 1HNZF 3W2VA 1R8PA 4U9RA 3W2VB 1WHXA 5D4PA 5GAHU 4L3NA 1VRTA 2L08A 4UUXA 3CPWR 1KRPA 2RB7A 3PX6A 2GMLA 4OHYA 4FPRA 2J76E 4DV0F 4Q44A 2GIRA 1RTDA 4FVCA 1SH0A 2GIQA 1RTDB 1LW2B 3MPVA 2FHMA 3GR1A 3OLBA 4XDCA 2XG8A 3KK3A 2QIFA 1BY9A 4ELTA 4U7CA 3KK3B 1ZZFA 1VOMA 3ZZRA 1R31A 5I3UA 1QLNA 4DUZF 2XMKA 4KIAA 2VASA 4MH8A 4OHVA 1VQ8S 1FTCA 2I2YA 2V2KA 2VZ9A 2JSXA 1XK8A 4I6WA 2BXJA 1K9MT 2QV6A 1XERA 3IAS9 4MAKA 4WFNQ 1M5OC 3QGPA 5A0YB 4IFYA 3HJFA 1Z1ZA 1JLGA 2HQIA 5EHHA 2V94A 2PA8D 2AU0A 2ZD1B 2DNOA 3CCZA 2FVSA 4DWIA 3EGZA 5KT6A 1BQXA 2E5JA 4ZPAA 3V6DB 1SUQA 1H2VZ 3V6DA 3Q0AA 2E1CA 3FMWA 3TP2A 2W25A 4O23A 3BSOA 4OZLA 1LXNA 3DRSA 1NK6A 1GT8A 4OZ5A 3DLJA 3LALA 6FD1A 2KFYA 4ZVFA 2VG6A 2XCAA 2J0SD 1QVGR 1FKPA 5HO4A 1UMJA 2HLUA 3W2WB 1FKPB 3CIMA 2BBEA 3W2WA 2MJUA 4UQTA 1F2GA 2EFGA 4FF3A 3HI9A 1GQEA 2MQQA 2KI2A 2O1PA 2DT9A 3E01A 2HW3A 1N54B 1KLMB 1S1WB 1HW8A 3T9NA 3QJLA 1EETB 1JMTA 2KYXA 3ITHB 2YNFB 1S1WA 4QIEA 3NRBA 3C8YA 2LYVA 3OTDA 4WFXA 3ITHA 4KO0B 4BBYA 5D4LA 4EYIB 5E3QA 1Q81T 3PRDA 2NUUG 2ZE2A 2BE2A 2XI2A 3SFGA 4ECQA 2ZE2B 1RTJA 4PQAA 1VQYA 3ZC4A 1FDDA 1ZAXA 3FQKA 3PZPA 1RT4B 1Q7YT 4HTJA 4B9MA 1X9SA 2HHVA 5L8RC 2HHSA 1D9AA 5IT4A 4AL6A 1RYSA 2EWHA 2VFTA 3CCVS 2XB2D 4CH1A 2C42A 2V5HG 4LF5F 5MLCV 2GX8A 1RQ0A 3FEXB 3CCSS 2YH0A 5E5NA 3MF5A 4QBUA 3M30A 2LQJA 1GX6A 2XWYA 2V8HA 4ZP9A 2VPWB 1NU4A 4DFMA 3PV8A 4F8RA 2DTJA 2D74B 3NGKA 1TL3A 3KLEB 1J5EF 1HBOA 1TL3B 3N6NA 4K4ZA 4O3PA 3SYZA 4B9NA 4XPEA 3KMSA 1R8CA 3MMCA 3RRGA 1HNXF 2FPHX 3GZ7A 4I6AA 2WK4A 1YITS 2KVIA 3AAWB 1T05A 2OIHA 1T05B 2I9SA 5T14A 5SUHA 3P3DA 4KKOB 4J9OA 1BLUA 2DD8S 3IR5B 4JI1F 4ED6A 3HX9A 1QM9A 4RLEA 2A2CA 2YX1A 4I1TA 4WFYA 3ZZYA 2XY6A 4EU0A 2KFNA 2GHVC 1HHTP 3D1HA 5KT4A 2HS3A 1TKZA 5DLGA 2FJBB 1C1CB 5AXLA 2KHCA 4H4OB 1BGXT 3KG4A 1Q1KA 4N41A 5DDPC 2B9WA 2RKIA 2HVIA 1R8BA 5K8NA 2AV5A 4A8WA 1YJRA 5KFOA 3ENWA 1ZPVA 2FGCA 2V9KA 3M6WA 4ED2A 1N34F 1KS2A 2YKMB 2YNGA 1DJ0A 3KLGB 1QAXA 1R8AA 4O4GB 2YNGB 2MKIA 2CQ1A 4X4VA 2D41A 2B9YA 3VZIA 3GV5B 1IKXB 1MU2B 3DN9A 1XNRF 4R8UB 3AA9A 4RW8A 2E9RX 1MU2A 2DHSA 1N88A 3OHBA 4TXSA 2Z2LA 1RGVA 1T94A 3FZBA 3NS5A 4CTAA 2CPIA 4WFAQ 2AWZA 2HVHA 2FJVA 1U2FA 2YKNB 4DS4A 2OPSA 1XWLA 5D78A 3LP1A 2WONB 1B64A 2WB1D 4QW8A 3LP1B 1N36F 5B0CA 3JTNA 3O2IA 3MURP 2BQ3A 1YQHA 2IM3A 4J9SA 4IR1A 3ZFVA 2LDYA 5F9NA 4PG8A 2SXLA 2KG1A 2Q43A 2MPUA 3MEEB 1X4BA 2N3LA 5LSOA 4ECZA 3LH2S 4Q5VA 2IRXA 2CJAA 4N47A 5KFRA 4HYKA 1V9OA 5LMUF 2DJWA 2I0XA 2OSRA 4RZRA 2C22A 1QUVA 3V81B 2AQ4A 2DPIA 3R5AA 4A8MP 1VJWA 3M6VA 2L41A 1UWBA 1JX4A 3UR0A 3TX8A 2XGQA 1VC5A 3PX4A 5F41A 3PM9A 2FVRA 3MMBA 1VRUA 3N01A 3UR3C 1Q82T 1Y3JA 1SB6A 5KT2A 2N7YA 3K58A 1HBMA 4ECUA 1HBMB 4WF9Q 2CIMA 1S1VB 5HLFB 1T03A 1B0VA 1TFWA 4RBUA 2FHOB 1VS3A 3DM2B 3AB2B 2VG5A 1KVJA 2F8HA 2VPYB 4IYQA 2CQHA 1VQ5S 3IGNA 4G1IA 2KT3A 3FSXA 3DU5A 3BO2A 4F50A 4X4QA 2HFZA 3HVWA 2AGPA 1VQMS 1YWXA 4C97A 3I0RB 3VZHA 4ILMA 1AXQA 1WD6A 2NPIA 4NLGA 4Z37A 3MR5A 2G4BA 1HPZB 2AJ1A 4OQJA 3CVKA 3U27A 4EO6A 3CDWA 2HFNA 5AXMA 1I94F 3TNVA 2DPJA 4FF2A 4Q2LA 2MKJA 2JWNA 2JC1A 2QE5A 1O51A 3ZZPA 2YWFA 3VQSA 2V4RA 1KC8T 4D3GA 2HYIB 2RQ4A 2ZVSA 4USHA 4B3OB 1GH8A 4C4WA 3BN7A 4QYZJ 4HVZA 3U1MA 3I5AA 5K14B 5CYQA 4BC7A 3OFFA 1FRHA 3G8TA 1U1LA 2LXFA 3IXQA 2NZ4A 2K1RA 2FLOA 2MDAA 2UUBF 3BGUA 5IM0B 2K1RB 4OLPA 4DL7A 1D1UA 2DR9A 4R0JA 4B9VA 4TQSA 1TV6A 1CPZA 5J2MA 3MM6B 1WG1A 5J2MB 2GHPA 2VKRA 2RUGA 2BJEA 4JI2F 2EFQA 1YI2S 2CJKA 1UJ4A 1NNDA 3CCMS 4QOTA 4LIWA 3OTBA 3HKZD 3JAMY 1TVRB 4IG0A 1S1XA 3GQCA 3M2VB 1QAYA 2DGQA 3MM5A 2YX4A 1FEHA 4ED8A 4GKKF 2CQ0A 2M3DA 3WC0A 4ZLPA 4K4TA 1S7HA 3F56A 4DX8H 3RW6A 1S1TA 5FDLA 1F0XA 4WIIA 5THWA 2M2BA 4LF8F 1QSYA 4NZ6A 4IR9A 1UVMA 1R27B 1TZ0A 4G1QB 3PW5A 1UVIA 2CQDA 1FDAA 1HQEB 1XMBA 3C66A 3JSYA 2FLNA 3KLVA 4LSLA 1QJHA 1JLEB 3HZGA 4G1PA 5EWFA 1FO1A 1S9GB 3DOMA 1JLEA 3G86A 3NCRA 1KD1T 4KHPF 4ZDNA 4MIAA 2R7RA 2XMTA 2G1DA 3FSIA 3V5RA 4I0WA 1DTQA 2XC9A 3I55S 1FKOB 4CIOA 5GAGI 2RQCA 1OQ3A 1R8HA 2F9DA 1SV5B 3MWBA 3R1HA 2LQ5A 3I4PA 2E5IA 1LQ9A 2ILYA 2KO1A 4ECRA 3KTQA 1WG4A 5T7LB 2XO7A 4XK8C 2BA9A 3DRXA 4NWBA 2DNZA 5M2RA 4KGKA 4MTPA 1G7CB 5KG0A 2DNHA 4IO1A 5ADZA 3CCJS 4X64F 2J0XA 3H2VE 1IUJA 1DRZA 3JYTB 1CC7A 3N9UC 4PUOA 4OJGA 2OTLS 5E41A 4A8OA 3THVA 1KLNA 3HMJG 2EG2A 3MUVP 2HRUA 4XAKA 4C3MA 2M8DB 2R8KA 1FNMA 3IGVA 1JLFB 3L3CA 3TAPA 2OMOA 4F26A 4C11A 3B78A 4RNHA 5E3PA 3QLHB 5F9LA 1FRKA 4JI7F 3CDEA 4F4XA 2QSFA 2XLIA 4ECWA 3ULHA 3BSNA 4K0KF 3HLUA 2PO4A 3H8YA 3THPA 1R89A 1D3WA 4F2SA 2ROPA 3V4MA 5K8MA 4FS1A 4HI2A 1RT3B 2OPRB 5J2PA 4DN0A 3DNCA 2B7BB 5J2PB 2NPFA 2AX0A 2KHDA 3DLHA 3ZZ0A 3EUNA 4V19X 4RBTA 5IT9Y 4IG3B 3N4WA 3T5HA 3CCWA 3M1VA 5DGAA 3DLEA 1IJFB 3OFGA 5LJ5Y 2XI3A 4USIA 2D3UA 4E8UA 2XLKA 1N0UA 5FD1A 4MKBA 1RP5A 2HLTA 5E3CA 2CQCA 5GAGU 1SBRA 1DAXA 2DR8A 1LFPA 4JUZA 1P8GA 2GO9A 4B9TA 2AGOA 2HAIA 1R6YA 3C2PA 2EBEA 3AJ1A 2VPZB 3OBIA 3H2UB 1U1NA 1PC5A 1WACA 4NA1A 3MI7X 2ZH5A 4TU9A 2E9ZA 3X1LB 3EYZA 2CZVC 3RU0A 2VFSA 1UJ5A 5DRKA 2V8GA 4KHMA 5K8OA 3EZUA 2LEBA 4RWWA 3JTOA 2ZH4A 5A8RA 3TQ1A 2OH2A 5DETA 2M4MA 3R1LA 3U1NA 4EEYA 2R2SA 1AROP 3BGFA 3D1QA 4KB7A 4GC6A 4QWEA 1DZ5A 1VC6A 2KTQA 3BGRA 4DSEA 4KTQA 5DM7Q 2J0QD 1U1QA 4RU2A 4ZHRA 2ZH1A 4A8KA 4LQ3A 1W25A 3MD1A 2GO8A 4CZCA 1C4AA 1U6ZA 2EC0A 3RR8A 1I1GA 3JSRA 1FD2A 3K5OA 1FJEB 3KLFB 1E6VA 1IXKA 2C3PA 1E6VB 2RDIA 3BSAA 3M2RA 4M94A 3CB4A 2VG6B 3DOKB 4RNMA 3G6ES 4H4KA 1F5CA 1OS5A 2B4OA 3NCQA 4MK9A 1WHVA 2CFXA 2CDQA 5B0GA 2ZBIA 1Q8LA 2O01C 4M5DA 2ZHBA 4EWTA 3T5LA 4Y28C 4EUVA 3KLHB 4RKUC 4PG7A 1ZETA 3SDEA 1VQLS 2J8AA 2QEXS 1UJ6A 2AP6A 3DRRA 1CEZA 1QVFR 3V4IA 3DRRB 2VL1A 3AQOA 4PRFA 3J7YI 2J6TA 4RUHA 5CYJA 5B09A 2B56A 2L48A 2B4UA 1Y9OA 2CZ4A 4PWDB 1WF1A 2D7SA 4DMZA 2W9BB 3NMRA 4MIBA 4V19J 3D54A 2Q1LA 4C3LA 1NKEA 1S77D 1JLQA 2AJ4A 1FERA 3D0GE 4PKDB 4JV2A 3MM8A 2J5AA 3EPGA 2RF2A 3E8OA 2GQCA 4OJ3A 1KOHA 2RF2B 2HWHA 3G6YA 3BS9A 3NGDA 3GIKA 3BB5A 3HFKA 1HWLA 2RQMA 5D4OA 2XGPA