3W1YC

Crystal structure of t brucei atg8.2 in complex with e coli s10
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
90
Chain Sequence
RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/ribosomal protein
molecule keywords Microtubule-associated protein 1A/1B, light chain 3
publication title Crystal structure of T brucei ATG8.2
rcsb
source organism Trypanosoma brucei brucei
total genus 17
structure length 90
sequence length 99
ec nomenclature
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3w1yC00
5IT9U 4DV5J 2E5LJ 4JI1J 2MEWA 4V1Ak 2KL8A 1XMOJ 1N32J 4DR7J 1HNWJ 4DR3J 5LMUJ 4LF9J 3J80U 4LFCJ 4GKKJ 5LM7E 1J5EJ 2ZM6J 4LF6J 4DR1J 3T1HJ 3T1YJ 1IBLJ 2MQ8A 3R2CJ 3J7AN 4KYZA 2MTLA 5FLXU 4DR6J 1N34J 2UUAJ 1HNXJ 3R2DJ 4LFAJ 2UUBJ 3J81U 5A2QU 2UXDJ 4X66J 4JI2J 4X64J 4LF5J 4NXMJ 4JYAJ 4LF8J 4LF7J 4B3RJ 3JAMU 4B3TJ 2VQFJ 3OTOJ 4LF4J 4RJVA 2UXBJ 4X65J 2HHHJ 4JV5J 1XNRJ 3IMQJ 4DR4J 4GKJJ 4DV7J 4PWWA 2UUCJ 4DV1J 4K0KJ 2VQEJ 4B3MJ 1N36J 4JI4J 5AJ3J 1FJGJ 5LMNJ 1N33J 4AQYJ 2UU9J 2F4VJ 4JI0J 4DR2J 4DUZJ 4LFBJ 4NEZA 4OX9J 1HNZJ 3D3CJ 4DV3J 4JI5J 3D3BJ 4DV2J 5IWAJ 1HR0J 4DV0J 3W1YC 5BR8J 4X62J 1XNQJ 4JI3J 4B3SJ 4DUYJ 4KHPJ 4DV6J 4KY3A 4JI7J 4JI6J 1XMQJ 4NXNJ 4DR5J 4DV4J 1IBKJ 4NEYA 2KVQE 1I94J 1IBMJ 4YY3J 2UXCJ 4HHUA 4YHHJ 4JI8J
chains in the Genus database with same CATH superfamily
2FHJA 1BGXT 2CPFA 2ZHOA 4C8NA 5HAOA 4JV5F 4WZQA 4PXCA 4LFCJ 1UAWA 3BBCA 4UUWA 2R7VA 3UCZP 1TKTB 5F3TA 3OL7A 4WYWA 3CJKA 4OZNA 3SDEB 1BLUA 1KONA 4URQU 1RKIA 2NXUA 3MEDA 1SJFA 2E9ZA 2MQPA 3ZNJ1 3TA1A 1HMVA 5DQGA 3GCWP 1U48A 4FXVA 2M8HA 4ED5A 1RHRB 4Q0BB 4LBIA 5LXRA 1XBWA 1B70B 2YNHA 1QVGR 2LU2A 1FD2A 3R7NB 1KLMA 2CJYB 5BJRA 5D0RA 2KYXA 2VA2A 2XLIA 3MI7X 1WF0A 2MQQA 2HWHA 3H90A 4KGMA 2LQ5A 2GVZA 2B4UA 4A47A 3BSNA 3L09A 4EK2A 3RW6A 1BQNB 2IHR1 4YHHJ 2HLUA 3UR0A 1UVNA 2DPJA 1JX4A 2V34A 3M6VA 4EZ6A 4PKDB 2Q6BA 2BXJA 2Y9HA 1IJFB 4DR2F 5L38A 1SQFA 4LF5J 4EI2A 2R7WA 1Y5IB 3NG8A 2X1FA 4PXDA 3ULHA 3BSOA 1NPRA 2C3UA 1JLAA 3UDLA 2KZZA 1YZ6A 5J2MA 1X0PA 3MECB 3M1VB 3R9LA 5B0CA 3MR2A 4XPCA 3BGRA 1UVKA 1RT6A 3BM7A 4TY8A 4DV2J 4KPYA 3K59A 1WKJA 3EPIA 4H4OA 5F0WA 3E3XA 4WP9A 2YPYA 4NLPA 5EUHA 4OJGA 4FF1A 1P9YA 3C2PA 4DR5J 3ILOA 5FD1A 3CXCR 3NMAA 2H4YB 3BPSP 1TTHB 2UU9F 2YH0A 1IKVA 1H7XA 4G1QB 1G4CA 1P8GA 4YB7A 2E1PA 4M5DB 4ANEA 3DLJA 2L41A 1YI2S 5CYJA 5DG9A 1RWUA 1WEXA 4C8KA 2OD4A 4X4NA 2KHDA 1GX6A 1REGX 3ZTSA 4F67A 4K7QA 3CWJA 4ECUA 2M7SA 4I6WA 5IXUA 1XMOF 4A8KA 3UWTA 1Y11A 2WVEA 3HSGA 1RHQB 1U1QA 1U6FA 2R8GA 3GV7B 2UXBJ 4UY85 5BYRA 3IMQJ 5IV3A 1J5OB 3NKYA 3VZHA 5D77A 1NDLA 4CH1A 3HDSA 2ASJA 1RUSA 1LNQA 4RW6B 1RSCA 5E3CA 2VG7B 2DEJA 3JSMA 4JYAF 1D3WA 5KFIA 2ZZNA 1XR7A 2LLZA 4HEA9 2BBEA 3ZZUA 1WUUA 3JSBA 1VQPS 1YVFA 2DH7A 3LH2S 3MAAB 4ECRA 2PC6A 4CYUA 2LXFA 4U8VA 5A0YA 2BE2B 5EGYA 1EKRA 1CJKB 2D9OA 3C16A 1Q5VA 5HANA 3KXDA 1UW9A 1SQEA 2QSFA 2GA7A 4CO1A 4DV1F 4J9RA 2OFHX 2V0NA 2CPXA 4JI4F 3T1HJ 1ZAVA 3T1YJ 4ZDNA 5ETQA 4F50A 5FDLA 2X3DA 4RR5A 1I51B 1Y9OA 2IDEA 2AX0A 5J2NB 3VR1A 5B0AA 4URGA 2ZH6A 2AT1B 3H5SA 3G6XA 5MLCV 1YLXA 1AROP 3IAM9 1VQ6S 4DBQA 1C2PA 4DV7J 2V63A 3JYTA 1YSJA 3HF5A 3KDNA 4ZPBA 2YBVA 4RW8A 5D3GB 2DPIA 4WE1B 2MQOA 3HI9A 1YQHA 4PG4A 2HNYB 2W8KA 3D3BJ 2XG8A 1HHSA 4IDKB 2D3ZA 2G0IA 5HMZA 2UUAF 3FZ2A 4P75A 4LSLA 2JHEA 2RRNA 4A8OA 1REVA 4I0WA 4NLUA 3TP2A 3MCNA 3OR2B 2ALZA 1JLQA 5HQMA 1SJ3P 3V6DA 4WCEQ 2QLWA 4ZA1A 2W9CA 1HQ2A 4KKOB 1I1GA 1HQUB 4K2XA 2ZJQQ 3OD2A 4ZP8A 3F73A 2UXDJ 3DHXA 2BDPA 2CPYA 2I5JA 1SIWB 1PBAA 4A8QA 2HHHJ 4DX6A 3K8WA 3KHLA 3ISNC 4DR1F 5C25B 4OHWA 3VAFA 5HBMA 1QSYA 3L9ZA 3N5FA 3MOJB 3I87A 4W98A 1YHQS 3PXGa 5GAEU 2EEYA 4CM2A 4ZLLA 4ZOSA 4YEAA 3F41A 2VC1A 3Q8SB 1CBKA 3MR3A 1JNRB 3WC0A 1PJ6A 4KT0C 3H7HB 3OXGA 2B7CB 2KVQE 2UVVA 4ZLNA 2OPQB 2LECA 4HHUA 4DN0A 3UD3P 5IT9U 2RRBA 2C2OB 3T41A 2FHMA 3NNAA 1HNWJ 1FJCA 2GVDA 2J7KA 5KFBA 5JUMA 3HCXA 4Y0FA 1N33F 3WHIA 2EC0A 2APOA 1RLDA 2YWKA 1FCAA 2HHUA 3PIPQ 3KLVA 3MR5A 4Q8EA 1D8YA 4LF9F 4P73A 1SIZA 4J91A 4L3NA 1C0TA 3MPVA 3WZ0A 2RDDA 2JVRA 1YRUA 4X4UA 5HP1A 4UQTA 1LFWA 4CLKA 4P7VA 2OJ3A 2LXUA 4HACB 3W9HA 3QLHB 2C22A 3TO8A 1A7GE 1HBUB 1C1CB 3ILIA 1TR0A 2GIRA 3L7PA 3PFEA 4PPZA 4LVNP 2V4JA 3D4JA 2MGZA 3OHAA 1GEHA 2CPZA 3HZGA 1IKWA 3D1QA 3IM9A 4NCGB 5F8LA 3P45B 2RS8A 3R5BA 3MTJA 2DGUA 1KTQA 1NK8A 3PJXA 5DGAA 5GAGI 1RAAB 2Y0BB 1HBOB 3MUMP 3KHHA 3LANA 2JLEA 3JB9k 1X4FA 1LWFA 4TYBA 2I8EA 2BR0A 2OEJA 4K4WA 1XMBA 2WOMA 1UVLA 1IKXB 2DXDA 2WSFC 5IQ6A 4IH6A 4CT8A 4QIVA 4LFCF 1FRIA 2CQIA 2WHOA 4X65J 5KG5A 4Y34A 1W7WA 2UUTA 1WOOA 1PJ7A 5KFAA 2VBWA 5L46A 1KQFB 2GHPA 1UPPA 5AE2A 2YQ3A 1OO0B 3CCLS 2C2DA 1U49A 2VFSA 3MM7A 1HI1A 3DRRB 4USWA 2QIFA 4H4KA 3A8KA 3N0VA 3DGVA 3ZZTA 3I96A 2KKHA 5HMYA 1S9GA 5LT5A 2OFGX 4UZCA 2W2MP 1IBKJ 2RU3A 4DQQA 1RCXB 3HHLB 2NSBA 2MKHA 3SV4A 4K59A 2DO4A 2HNDB 2DNQA 4F4KA 1N32J 1FKPB 2VG6B 4AT1B 3K58A 1J5EJ 2VH7A 1X7VA 3QWPA 4UUXA 4Q8FA 2HSEB 6FD1A 1OWXA 1WD6A 4B9UA 2EFGA 4JI2J 4P52A 4RBTA 4NZ7A 3OTOJ 3ZXWA 1IVZA 2N3LA 3MM9A 1K9MT 3EMTA 4R8UA 2UUCJ 1W26A 1K0TA 4NLXA 1MROB 1PO6A 2J7UA 3Q8YA 3K2YA 3CCWA 2R42A 4ES1A 2AV5A 4FS2A 1R0BG 2A10A 2RB7A 4QWEA 3MR6A 2DR7A 1N5QA 4ID8A 4WKYA 4Y6IA 5KFTA 4I4BA 4QR2A 2ZC4A 4TNOA 1MMNA 2J6UA 2ZBQA 3T5LA 3KDOA 2DK2A 1URNA 1T9YA 2XMMA 4Y2CA 1EZZB 2ZNYA 5KFYA 1MWZA 2D74B 2RF2B 1I94J 1HIYA 4ZP9A 3HSDA 2I2YA 5T7LA 2CQ1A 1IQZA 2YKMA 3Q2TC 2G4BA 4DV2F 1RA6A 4AL6A 1RHKB 3D1OA 3N6NA 2DGQA 3R5GA 4MK8A 1V6HA 5F0UA 4LF2A 3DOLB 4USHA 2OTLS 1QUVA 2KT3A 1NKEA 1ITPA 4XIUA 1LWXA 3IBWA 3GIKA 3PDNA 5KFEA 2DNNA 3BBFA 5AXNA 1NDCA 1S72S 2J5AA 1LW0B 4Q44A 3MPYA 2FVPA 2LDIA 1IR0A 1H6KX 3MMCA 1AFIA 2UXBF 2LYVA 3B4MA 4USVA 2VBYA 2CNNB 3BEGB 3SSQA 2DYAA 5HSPA 3TANA 4EO6A 5F8NA 4O0NA 3KLGB 3VAMA 1GH8A 4I2PA 2IJRA 4AUKA 2FC8A 4TQRA 2HEKA 3TWZA 3QSIA 1S77D 2FJDB 1R8PA 3MEEA 4CO0A 4C8OA 4R25A 3Q8UA 4HH1A 2ZH3A 2AP6A 1U2CA 1PAEX 1KTVA 4NLQA 5C24B 1CQMA 3T1YF 1TL7B 2V69A 3V6HA 2IM0A 1FVQA 2P2CB 3CEDA 5F8IA 4O44A 2DH8A 1EQMA 1VCTA 1NXIA 5KFDA 3MFHA 5K5MA 2FHKA 4OX9J 1B4SA 2VIHA 1MMDA 2DGSA 4TLRA 2YH1A 1HNXF 3UCUP 2BJ8A 4GVBB 2RUGA 2VOOA 1Q53A 5KFUA 5A8WA 1NK0A 1FK9B 3PJ9A 4ECZA 2LP4A 2M70A 1NHUA 1WG5A 2DHHA 3PM9A 3CMES 1FRMA 5CYQB 4TYAA 1U1NA 4RWWA 4BWJA 1T0TV 1UVJA 1ZOTA 3M4XA 1HARA 1JLGA 5GVQA 3SI8A 3R2CJ 3T9NA 2QN6B 1HHTP 3LGMA 2RMLA 2V68A 1MN9A 1NCLA 1X4HA 4I6YA 3U1LA 1FRHA 1VIOA 2HK2A 4C97A 2COLA 1H2VZ 1YBTA 1XNRJ 5H9EJ 4ZPTR 5AXLA 4JI8F 3TYTA 2ZH5A 3PHEA 1A6LA 4DUTA 3DOKB 4QR1A 4DR7F 3DLHA 2C2MB 5KG0A 1FDNA 1RJJA 4Y65A 2HHHF 2QG9B 1HNIB 2BQ3A 1X4AA 1VQ7S 2DB1A 1OIAA 3Q8VA 4MT1A 1GQEA 3HSZA 1YKWA 4MAKA 3EM1A 1SJ1A 2R4FA 3W65A 2E44A 3V6JA 3UO0A 2PMZD 3G8TA 2PN6A 3V5RA 4DPYA 3MWBA 3MPUB 3HVAA 3DGPA 1VS3A 2VBZA 4DCPB 2W2NP 4HI2A 3UVJA 3T5KA 3QWUA 3MD1A 3PV8A 4IR1A 2QLJB 2AZ3A 2VASA 3I0SA 4OYIA 1S48A 4Y00A 1QJHA 2DNZA 2RS2A 5GAEI 4QIWD 1JIHA 2LEPA 2FHOB 3SCIE 1R6VA 1HNWF 1Q7LB 3VVUA 4RJVA 4CNZA 3H59A 1RBAA 4LRCA 1URRA 1IBMF 4ED1A 4GKJJ 3DN9A 1H3DA 3U1NA 2RKIA 5D4OA 2VL1A 3EZ5A 3OUYB 2PFFB 1N5YA 3VGVA 4ZVOB 4X2BA 1U25A 1L5UA 4RW9A 1XIQA 4WXOA 3MAQA 1S1TB 1JMTA 2W24A 5HJXA 2ZH2A 4QJVA 5J1PA 4HVZA 3WBZA 5CZVA 2OPRB 3B54A 2WK4A 2NZ4A 2KRRA 4V1Ak 4C3MA 2KO1A 2O67A 1O0PA 2MLYA 1SKUB 1AZSB 3W7BA 2ZM6J 4ILMA 3QPIA 2O01C 5K14A 2DO0A 3FBEA 1VK3A 1JNZB 4OZJA 3GIJA 4NLGA 2Q3PA 3JQKA 3TW0A 1GMWD 3MCSA 3MMBA 2XGPA 4NXNF 2DR8A 4MFBA 1JJCB 1G3OA 2XCPA 3MM6B 2AGOA 1UTAA 1QE1B 3UN3A 1T03A 1YJWS 1S1VA 3G8SA 4F4ZA 4OYAA 2MHNA 3V6KA 1X5SA 4DV3J 1KRPA 1N56A 4OZ3A 4DEZA 4K4SA 4QU7A 4HI1A 4RW4B 5ETPA 2HIQA 2HMIA 3HP6A 1FKOB 4K4XA 3TUJC 3I9ZA 2WRMA 3QAUA 3PX6A 2XMWA 4F04B 3KK3A 2JC0A 3WX8A 2X51A 2VONA 1JLFB 3T5HA 1B64A 1KHVA 1LXNA 2EI5A 3GIMA 3BGRB 1OPIA 1OY8A 1G1XA 1FVSA 2ZUGA 3RJMB 3ZNUA 3H2LA 4PUOA 1EETA 4A4JA 1TAQA 2ZUAA 2HGMA 2KH9A 1RAHB 3RR8A 2HZVA 3CIZA 2FLLA 2QLXA 1SH2A 3H5YA 4FVCA 4X4QA 3TA2A 1TV6A 4PCQA 1VHFA 4DR4J 4ECWA 3QFWA 4LIWA 3CJ0A 1U45A 1YDLA 3ZFVA 1FJGJ 3CPWR 5LMNJ 3DXSX 2ROPA 4DXLA 4IOBA 5HROA 2K1RA 1HNZJ 2BANB 1B0VA 2DNHA 2LQJA 4IFVB 3VQTA 2KFZA 2UUCF 2XMTA 3BN4A 2B8PA 1U2RA 5IS2A 1DQ8A 1WDDA 2P8IA 2ACYA 3KMSA 2UXCJ 4NYPA 4CM0A 3FBCA 1NB2A 4OHXA 3RZAA 3JSMB 4K0KF 3R1HA 4DN9A 3LWMA 3OR1A 2B0GA 4K4ZA 3ZZRA 4UZBA 1SI9A 3A8EA 1I94F 3AA8A 1VRUB 1U1OA 4JI5F 4PWDB 3BREA 3TVKA 4URSA 1HWIA 4XPEA 3UFCX 4G65A 2Z56B 3M30A 1PBUA 1M5OC 3Q8QB 2IVYA 4A46A 2NYIA 1CC7A 1HA1A 2F9DA 2QL5B 2YPZA 3DXBA 3KUEA 1RAFB 1R8AA 4RUHA 4NA2A 3QATA 4MKVA 2OSRA 1T11A 3VAGA 2CPDA 5FDLB 4ENOA 1U1KA 3IR7B 2H3EB 1RHMB 3C6UA 4F4WA 4JV1A 2X1AA 1Q8BA 3D5MA 2Y1JA 3HT0A 3KYLA 3IRWP 4EYHB 1JJ2R 2HHVA 3TX0A 3OTDA 4ZLPA 5ADZA 1N6QA 4C98A 4M5GA 2FJXA 1LWEA 2DBBA 2UZAA 2GGPA 2ATLA 3FBBA 1JLBA 1WSRA 1OPZA 1PGZA 1UEUA 1ZBTA 4DSIA 1DLOB 3AQOA 4K4TA 2XMUA 4J9VA 3Q8PB 3K5NA 2VKRA 4QW8A 2H5EA 1XC9A 3RBDA 1XEZA 4FYWB 2QMWA 1KKHA 2HFVA 1PYSB 5F8GA 1X4GA 1RWWB 4ZVTB 1P27B 1QAYA 1LK7A 4A8XA 1P1LA 2RDJA 4B17A 4CO3A 3ADAC 1T94A 4N5SA 1SC3B 3OTBA 1EKSA 4KTQA 1PAUB 1JKHA 3CCZA 2YNIA 3FFIB 5CA5A 3NCPA 2RQMA 4USKA 4HKQA 4ANCA 2NR0A 4DSJA 3H4DA 3DDKA 2D69A 4AQYJ 5DZ7A 3QYYA 2FZCB 1YK9A 3TAQA 2RSQA 1RLCL 5IM0B 3OL8A 1WG4A 2DEIA 2H51B 4X66F 1M1HA 3AODA 2VF3A 1S6QA 1TK5A 1WWHA 5AXKA 3BN7A 3D2WA 4I56A 5LL6d 2LCWA 4OX9F 1D1UA 4OV6A 4KO0B 1WEZA 3IFEA 2FY1A 3MCOA 3GIIA 4JV2A 2U1AA 2ZOGA 3FMWA 5H9FK 1FRLA 3DCAA 1NNDA 3Q8RB 2A18A 1VQ8S 4IH5A 1YJVA 2YXLA 3CCVS 3CCUS 2F40A 1RTIB 3L95X 2W9BA 2H9ZA 3AJ1A 1F1BB 2PMHA 4QU6A 5KFLA 4OHVA 2FVQA 1Q95G 4JB8B 1PC4A 5KFXA 2GVDB 3HHDA 2HVIA 1RI7A 5KG1A 1J27A 3AFGA 3GG0A 5EWEA 2BACA 4ES3A 3IWXA 2GO8A 1NZ8A 5IWAJ 2XY5A 3IGVA 4RUCA 5JVHQ 4DFMA 2AYGA 2ZFHA 1H0HB 1NLKL 3E51A 2O5DA 2A6MA 1TL5A 1VGYA 4A8SA 2XS5A 2WVFA 2QLFB 5G0RA 2DVIA 2VQFF 5SUHA 1Y0HA 1VRTB 3D68A 2CA9A 3M2VA 3CDWA 3OPKA 2NSCA 1RT2A 4DL3A 2WONB 2BA9A 3M6XA 5IT4A 4J90A 2QYGA 3J7AN 1RTDB 2JC1A 5F9LA 1GK8A 1UJ4A 3CDBA 3CJ2A 3JTNA 5L1LA 3ZZYA 2DHAA 4M63A 3UNYA 3OJUA 3CJ4A 3NP5A 1VLYA 3M2RB 2EPIA 3PR5B 4X4RA 5D0GA 3PYFA 2HHPA 3EGVA 2MZJA 2FIUA 4IO9Q 2YKNA 1DHMA 2HVDA 4DLEA 3ENVA 2GQCA 2EBEA 2GW8A 2YKPA 4NI2B 1ZAXA 2F7VA 2Z2YB 4DF4A 2ERRA 3A3OB 1N34F 4GKJF 2VDIA 5A6PA 4NPOA 2G0CA 1RAEB 2NLWA 4YY3J 1ZM9A 5J1EA 2NUUG 2CQDA 2AX1A 4U95A 3C6TA 2QFIA 4DS5A 1RAOA 1VBZA 3N01A 2P9CA 4B9NA 3OL6A 2PI4A 3ET6B 4C6AA 2DRDA 4N77A 2B7BB 4JBCA 1V9OA 4YFUA 5IQQA 4IYQA 2MHEA 2KDOA 4ED4A 3AAWB 2ZVIA 2MPUA 1XMQF 4B3TJ 1TVRA 4F02A 4HR2A 3LP2A 3Q83A 1WEYA 3QGIA 5ETRA 3NCQA 5C2GA 3M8PA 3RAMA 1TKZA 4CLPA 3ILLA 3MEKA 3AOCA 1BWVA 4V19X 4PG5A 4N56A 2B9YA 1Z1ZA 2MZRA 3OFHA 4AD6A 4LVOP 5A8KB 3AT1B 3E8OA 4I7FB 3WIVA 2VPYB 1HI8A 2O66A 1QUPA 3VHQA 4UQGA 4BC7A 4DDFA 1FRKA 1SV5B 1FWKA 4PZVA 4DS4A 2D3OR 2UVUA 2W7AA 1NJXA 3DM2B 2FD2A 4RUAA 4DFPA 4C0BA 1RWVB 5KG6A 4ZITA 3D7SB 4ED6A 5L9NA 3I6PA 3AOAA 1AUDA 3EGNA 4OJ3A 4ELTA 3FC9A 1APSA 2OKQA 1F2GA 1QSLA 2F4VF 2HRTA 3NWGA 1WKKA 2ZEJA 1S1UA 1FF2A 1U0HA 5HLFB 1SC1B 4AXJA 2DGTA 3RW7A 2R7QA 2CJQA 4CWBA 1GNKA 2AW0A 5KT6A 3C66A 3HHLD 5J2PA 3RRGA 1MW7A 3IA0A 3DOMA 2YNFB 4TU8A 4IFYA 4B08A 2BJ7A 5E33A 1V5IB 2RD5C 2GO9A 1UA1A 1X9WA 2JEIA 2B9EA 2IYIA 5E41A 2M0GB 1IUJA 3CJ5A 3DYAA 1S6UA 4ERDA 1E6VA 3KK1B 4KPCA 3J7A1 1Z2LA 3C14A 1HNVB 2HNZA 3OFEA 5CYMA 4B3RF 1JJHA 1IKYB 4OZ1A 4HLBA 5LMNF 1D9FA 2HHTA 2EFVA 2EKYA 2M9KA 2VA3A 4WFNQ 3V81A 4X4SA 1VYAA 2JSXA 4ID5A 2VQEF 4P2SA 1NK6A 1VC0A 2I9SA 2C3PA 3NCRA 3CF5Q 2R8JA 3GFZA 3M8QA 3DRSB 1S1WB 4DUZF 2UXCF 2EK1A 4I1TA 3VVTA 4ER8A 3PO4A 3KUHA 1HQEA 3WQPA 4PQUB 3SQGA 3TEHB 2BKNA 3FNNA 2ZHBA 4JV5J 2JDJA 1TKXA 3CDAA 2DCLA 2K7JA 1PSDA 3DMJA 5ETOA 1UWBA 2K2PA 3BSCA 2AJQA 3IS9A 2HVZA 1VQSA 4ZVSB 1JLEA 3HVTB 5B0DA 2HHWA 4TU7A 4LRAA 1RTJA 1WDTA 3GLJA 3MTKA 3V4IA 4Z7CA 4KR0B 2V8GA 3TZXA 4F7VA 3QZ8A 4QWBA 3BQ1A 4OI6A 2DGXA 3LP1B 1X8DA 1HW8A 1UFWA 2XZTB 1RQ0A 3HD1A 1TL4A 1NHKL 3CCJS 3FCVA 1CS4B 7AT1B 4PG6A 2LVWA 4YR2A 1GT8A 3E01A 1UP1A 3GQCA 1TFWA 3DHWC 3W2VB 3GFYA 2CJKA 2MSSA 2XZWA 2RHQB 2E1AA 1T05A 4WTYA 4MYTA 2M3DA 1DTQB 1PKUA 5GMDA 4OL8A 5B0GA 3B4DA 3RBXA 1NJYA 3DI6A 3CTRA 2VOPA 1H2TZ 1R6YA 4DR2J 1S97A 3GSIA 3O5TB 1L3VA 4N76A 4CO5A 4DR6F 2HW3A 2BW7A 3D6HB 1S6PB 4Q2LA 1NAQA 1S10A 1D0EA 3BF4A 3DLKA 5KAKA 2R2RA 4F4AA 3UR3C 4AQYF 2XGQA 4RX6A 3MM5B 2WB4A 2YY3A 4DL7A 2XM3A 4C11B 4XDDA 4OYOA 1HW9A 2MKJA 3GYGA 3W5YA 2UVWA 1FD8A 3I5BA 3PW7A 1M90T 2J8AA 4FYXB 3UI3A 2ZH7A 3GCXP 4CLFA 2AU0A 3QT5A 1ACMB 3UDVA 2HPUA 1O6XA 4FF3A 1HPZB 4KFBA 2R2UA 4WP8A 3FK4A 1H98A 1YG0A 2L08A 1NPKA 4ICLA 1RBLA 3OSPA 3MCMA 4PYAA 3DRPA 1PC5A 2PI5A 1BQXA 4DQIA 3A12A 3IG1B 1LXJA 2VG5B 1U0SA 3VAJA 1DTTA 1E6YB 3TEGA 3TOQA 2CNLB 4CH0S 3QRPA 2VPZB 4DU7A 1U8WA 3OXFA 3RRKA 2VC0A 1B7FA 2UUBF 2CPEA 3Q2SC 2JX2A 1F5BA 1FWLA 1B7YB 5KFJA 3SMZA 3KLFA 4W92B 4NLSA 2OPSA 3KK2B 3NNHA 1R31A 3E2EA 4EWTA 1FERA 3NXZA 4OJHA 2FVCA 2R7TA 4J9PA 2B6AB 3KG1A 3THVA 2OPPA 3H20A 2C2RA 4DZ6A 5A76A 3QSYB 3M7VA 1FEEA 3ZZZA 3D54A 9RUBA 3ZZOA 1WF1A 3CCQS 4DV6F 1VHIA 3FSXA 1F60B 5SZTA 1QY7A 1UA0A 4OJ1A 3KLHA 4DPOA 5L1KA 3DRXA 4EBEA 2GJ2A 1Q8KA 3FEXB 2BOAA 5DRKA 2OMLA 2HFOA 4ATNA 3D6FB 4R5PB 4DV1J 4U9RA 3R6GB 1VK8A 4LBPA 4JI4J 4O3QA 5AJ3J 1PIEA 2FVSA 1UPMB 3POTB 1LWCB 5I3QA 1RT4B 2GMJA 3TARA 1C4CA 1R43A 5LXYA 1S4FA 4HT7A 1YJUA 2YX1A 4B3SJ 2ATCB 4OI0A 4FYDA 3LP0A 3B8HA 4NXMF 2DNGA 2P6TA 1EP4A 1WELA 2HLTA 2WW4A 2EFQA 3ELHA 4F0MA 2K3KA 4ZHRA 1NPPA 2E29A 4OZLA 3M2UB 5LMUJ 4FBUA 4O3SA 1N36F 3GJSB 2DR5A 3WX4A 1RADB 3DLEA 3GONA 4M5MA 3HMJG 2JEFA 2VV5A 5C42B 4JP8A 2WBRA 2UUAJ 1TL3B 2AEJA 4CTAB 1DAXA 1RKJA 1RT3B 4K4VA 1SKSA 1VQKS 3BR8A 5HJYA 1F9FA 2BEFA 1G6BA 4ILRA 5C7PA 1K44A 3T9ZA 2B4VA 4QIEA 2F4FA 4EEYA 2C3MA 2RDIA 4WFYA 4G1IA 1QD1A 2CDQA 1AT1B 4FXDA 1WHVA 3BJYA 4OQJA 4LFAF 4KY3A 4EMDA 2L9NA 4M94A 5A8RA 5DQHA 2E1MC 4O3RA 5HVGA 4LF8F 4HTIA 1TV6B 1MWQA 2CVIA 2A2CA 2D9PA 1CJUB 4LF4F 3MEGB 2J6SA 3QO9B 5KT7A 1QAIA 4K5RA 2WAQD 2MQ8A 1HBMB 1NK7A 1LW2B 1X60A 1KP6A 3H0PA 3A3NB 2XY6A 4EO8A 4H4MA 4ZPDA 3K89A 4FZVA 3OW2R 2XB2D 4DUYF 2HS3A 1L3UA 1EHWA 2HQCA 4QIFA 3VQSA 4OYXA 4L72B 2D1CA 5GAHI 3AY0A 3W8GA 4YR0A 4NA1A 4J9OA 3NBPB 3FGVA 3K5LA 2X3GA 3R8YA 1SPBP 5E3RA 1N33J 1GMWA 3LF0A 2ZE2A 2ZD1A 2UUWA 3QIDA 5M2RA 1N54B 1UWAA 1R8CA 3J7Z5 2JLGA 2XI3A 2ASLA 2O3DA 4WYLA 2N7YA 3PVXA 1DARA 3QAEA 2F8MA 2OEMA 2PFDA 4C48A 3CMQA 2XO6A 1VQ5S 1TKTA 4KV8B 4CT9A 4ZVPB 1C1BB 4K5SA 1BQMB 2Y8YA 1S7HA 3SDEA 3U7JA 3CDUA 2OAUA 5I42B 1OS5A 4B3MF 4A8FA 2ZJRQ 2CQHA 3CUNA 3T6BA 2MTLA 3FSYA 1HBNB 3RUBL 3CT9A 1R89A 4Q0BA 1H72C 2BYCA 1RYSA 6AT1B 1CULB 2H65B 1T9XA 2VUGA 4ED7A 1WG1A 4LR7A 1T02A 2CPIA 2DHSA 2HAIA 5E5NA 4YN3B 1KS2A 4P71A 1KOHA 4DQRA 2XSFA 1BQNA 2BW2A 4CP5A 3CC2S 1XNQJ 2Z4PA 2IMOA 1HWJA 3JQJA 2DNKA 1SKRA 1XN9A 3MMJA 1U26A 2BRLA 2XNRA 3P49B 3JTOA 4L75A 1XERA 2AEMA 2DNMA 2GAHC 1Y7PA 5J2QB 1KN6A 5DM7Q 1DY3A 2A2DA 3HSJA 4LUBA 3OBIA 1WHYA 2UP1A 4ZK7M 2YQ0A 2UV8A 4PPDA 3M9MB 4PABA 3MFIA 2PT0A 3NS5A 1VC6A 3M6WA 1RT5B 1YWXA 1SVDA 1B3TA 3MECA 3M1VA 1S6QB 2RILA 3HHKA 2QA4S 3EJMA 4TLQA 2YWHA 5IT0A 3DRYA 4MTPA 2ABYA 3TQ1A 2M8DB 3CJSA 2W4CA 1QM9A 3SEOA 3PYDA 1D8ZA 5FIIA 4DPWA 3SZ2A 2RQKA 4DV0J 7FD1A 3N79A 5CQGA 1Q1KA 2Z2LA 4G1QA 1UVMA 1FXLA 1S76D 3M9OB 2MZQA 5JXSA 2MKKA 4M5DA 2ZDPA 2JEGA 1RACB 1UZDA 3UW1A 1GTHA 4CNYA 2OUGA 3W5ZA 3OJSA 5HK4A 1FESA 1HI0P 3DU5A 2GNKA 2XHCA 4F3OA 2IM1A 5EN1A 3PKYA 2ZDOA 2AJ1A 4U6PA 2LA4A 4JI0F 2DH9A 2MDAA 1FX2A 1ROFA 3PRBA 1LQ9A 3G86A 5IZHA 2E66A 4RW6A 4EBCA 4NLOA 4ZCLA 5K8OA 2ZKUA 3BPDA 2DY9A 3I0RB 3L7OA 3MUVP 2YX4A 2EW9A 1WC1A 2KB2A 4JV0A 4U8YA 4OLOA 5J1NA 3R6LB 1GMUA 3LW5C 1X5TA 4O3OA 3CD6S 4J9KA 1S6OA 2BE2A 4BDPA 2VFVA 3B82A 1TMMA 4F8RA 1CJKA 1SC4B 4LQ9A 1NSAA 3J81j 3KG0A 2POKA 5KFVA 4R0JA 1NJZA 4KHPJ 2BQUA 1FWPA 3PO5A 2HFSA 4ZN1A 1I6JA 1X4BA 1EB0A 2Q6CA 1I5OB 4MH8A 2BM1A 5H9FJ 3PW5A 1RT7B 5J2NA 1DZ5A 1XK8A 2QYCA 3CNQP 5L8RC 1VQYA 3MMAB 3HVRA 4OHYA 2EWHA 3N4WA 2GJIA 1NBEB 4ZCMA 1RTHB 4X62F 2XMVA 4LR8A 4LSNB 3K17A 3PJWA 2H54B 4PXEA 3QJPA 5D3GA 1AFJA 4WE1A 3V2UC 4AL5A 1BMQB 2HNYA 4HTJA 1LFPA 4X4OA 4IDKA 4M5IA 4FF2A 1NU4A 4J37A 1AA1B 3QJJA 1NRKA 3K5PA 2H1YA 1NH7A 1N8RT 3R5AA 4RNHA 3OR2A 2C28A 4OIXA 2DJWA 1SB6A 2YWEA 2CQGA 5AJ3F 2NZCA 3M8PB 5EX3A 4KKOA 4CH7A 2A3JA 2MEWA 3O2IA 1WTFA 4HL9A 4B3SF 2D3O1 4NCBA 2E1RA 4EZ9A 3GR0A 3G87A 3PW2A 4BCAA 5DDOC 2EG2A 3ZO7A 2GX8A 2P9EA 1HNXJ 2XMJA 5C25A 3RB3A 4WPAA 1SJQA 5DZ6A 3CC4S 4DL6A 5LMUF 3BH7B 2V9KA 3C15B 3CVKA 2XLJA 1RAGB 3SBMA 3DLGB 3C19A 2HURA 2Q43A 4AXIA 2ZH8A 3G82B 3PZPA 1KWMA 4ZCKA 3NLCA 3HHEA 2ROGA 2GV1A 4ILLA 4P2MA 1DQ9A 2OPQA 3W2WB 3CC7S 1U0HB 1KQGB 3SCJE 3OVSA 4BLGA 2PEBA 3C3LA 3EX7B 3CIMA 4OHZA 2LFVA 2DNOA 4JI8J 1OQ3A 2BM0A 3JS9A 2QJ3A 3W9JA 4LMZA 1Q16B 4DR7J 3U1MA 3KJVB 2V50A 4OYBA 5LM7E 2C2NA 3CD0A 2HS0A 3JTPA 3BQ2A 2MLZA 1Y3JA 2BJEA 2YNGB 4M5KA 2HZAA 3R7BB 2F9JA 5LSOA 2ZBPA 1S0NA 1RK8A 3BH6B 2UV8G 1IWGA 1MLAA 4ZVHA 4HACA 2F63A 1S9EB 4QPXA 3ZTPA 3AQPA 3QLHA 3QJLA 3Q24A 2W8LA 1YITS 1HBUA 1PG5B 2QA2A 4NRUA 1C1CA 1X0FA 2R7XA 2ACMA 4S0MA 3PEJA 3OL9A 1LOUA 4H54A 2ZWPA 1WC5A 4GKKF 4M5NA 3GYNA 5M2UA 3WIUA 3HKWA 2H5JB 1HHQA 4ZIVA 1MWYA 2GZOA 2RHSB 4NCGA 1A9NB 4ZVUB 3GU0A 2AKWB 1IBMJ 5I4MA 3PG9A 5AXMA 1HBOA 2GQ2A 3Q23A 2W9AA 1PYTA 3FZBA 2RE1A 4OI3A 1IKXA 3LGNA 1XJWB 3KWMA 2FTRA 2WZ1A 3IS9B 5K9FA 4CO2A 1XWLA 1ZS6A 5D4NA 1YBUA 1RTJB 2IDLA 2CYYA 2GIQA 3ILJA 2XS2A 1KBRA 4D3GA 3HFVA 4G3IA 1UFLA 4HH0A 2PDAA 1U4BA 4KB7A 1C4AA 3EXCX 3OQ2A 3QNWB 1VJWA 5HN0A 3ICLA 4ECVA 2HHQA 2Z57B 4C2MA 3PCOB 4QWDA 5CCLA 3HHLA 1OMSA 2PA8D 2G9OA 1SQGA 2ZH1A 5KT2A 2WW8A 1S0MA 4ECSA 1VBKA 2HNDA 4NXNJ 3A3PB 3TNVA 1FKPA 1JWWA 1ZZNA 2VG6A 3TR5A 3QRRA 1FXRA 1OSDA 1W25A 4C9DA 1TUWA 2B4PA 2W4DA 3P5TL 2BJ3A 2C2KB 5D4LA 5D0HA 2QA1A 1XNQF 3AJDA 1MNEA 4OX8A 1S57A 5JVGQ 1OSCA 4YR3A 4ANDA 2WTFA 2A6OA 4WU3A 2J9DA 1ZPWX 3R27A 1IR1A 1VQNS 1MROA 4ZP6A 2BMBA 1UKUA 1S0OA 5DLFA 4WF9Q 1JXVA 2ZZMA 2IYGA 5E2QA 4MK7A 4DCOB 4PR6A 3GFXA 4IG0B 5C2CA 4PWWA 1F9HA 4CI0B 1EQ0A 3HD2A 4Z37A 4YP3A 2B5JB 1KVJA 2RQ4A 3JQMA 2IPOB 4WIQA 3W63A 2J9CA 2CQCA 4RNNA 4O0IA 2RF2A 4KFBB 3BKUA 3K0JA 1K1SA 2XWXA 3L3CA 3X3UA 4X64F 1BY9A 3W3SA 2R7RA 3OV7A 3DOLA 4HHJA 4F25A 1SL1A 2R2SA 3IP0A 3NEKA 1NSPA 3TAMB 4DV0F 1DTTB 2Z0GA 2BE9B 2V4QA 4MIBA 3D28A 4J9QA 2V2KA 5F41A 3MHYA 4HDHA 4Z7YA 4NLDA 2RRAA 2DRBA 2J8SA 2HQ3A 5EWFA 1R27B 2V8PA 3P5BP 1S59A 1LW0A 2XLKA 1SUQB 4JI7F 5I3UB 3S01A 2J6TA 3I56S 4DSLA 4QCLA 1FDBA 1QVFR 1K1QA 8ATCB 3TQEA 4K0KJ 4DL4A 1CJVB 3ITHB 2DD8S 1WORA 4DX8H 3T5JA 4IOCQ 3QRQA 4ZCIA 1YTYA 1JXLA 2XSJB 4JI5J 3CCES 3KLGA 2NUHA 3FRYA 1S1XB 3PNIA 3RR7A 4MK9A 1ELOA 5ETTA 4RBUA 2ZJPQ 4P2XA 2AJ2A 4LRDA 2RH3A 5AT1B 4LIRA 3KOAA 2Z2MA 4KHPF 1HYSB 1TKDA 3QIPB 1WKLA 1RCOB 2D41A 1CSJA 2NXEA 3M8ZA 4FNHA 1FJ7A 4I68A 5C24A 4IG3B 1TL7A 3VGSA 3NGKA 2MY7A 2WCXA 4YMEA 4NLRA 4RW7B 2IMWP 2GAGC 4XAKA 3EWGA 2QGFB 4Y28C 5KFPA 1FA0A 4DL2A 4DJBA 4KRWA 3FKBA 4NLYA 2MQLA 2HFNA 3KJFB 1RWXB 4ZN3A 1VC5A 4GVBA 2O1PA 4O4GB 3NS7B 1KNZA 1FK9A 2GJFA 1ICEB 2IAJB 4F36A 3UN5A 1JLCB 1Y10A 3KJQB 1X9MA 5CYQA 3ETMA 2M5YA 2IBOA 3NY0A 1AB8A 2OO4A 1WI6A 2KVIA 5HQLA 1RABB 4YDDB 2SXLA 3ISND 2FLNA 3FJ2A 4AL7A 4F0KA 1R0AB 2IC3B 1OY6A 4J9SA 1RT1B 3ETOA 3D1HA 3N28A 4C8ZA 2HBRB 1CJTB 1RAJA 2WVCA 4X66J 3TZZA 4RZRA 3CJTA 4FKXA 3DOKA 4CLSA 5CHCB 5CD4A 2I1RA 2CG8A 3MM8B 3I5AA 4YDXA 4OZ0A 2VPXB 4DPUA 1RA7A 3O6QA 4M5JA 2FLOA 4MIAA 1HNIA 2MSTA 3H8YA 5IC6B 2CKWA 3AD8C 4LT6A 4ZMMA 1U02A 4UF4A 2AGPA 2ZH4A 4USIA 4FYVB 3J80Y 3IRXB 3BO4A 3F56A 4H4MB 2AQ4A 5KG2A 3GV8B 1YJTA 2NPFA 2VHGA 2EC2A 5LSRA 4PQAA 2V2QA 4J7CA 2DNYA 3GWCA 1KLNA 1U1LA 2HG4A 1NK5A 2AJ4A 2E5LJ 1FO1A 3T3FA 3P4UB 1N0VC 3C8YA 4WXWA 1TL1B 1SC6A 3GMGA 3BSAA 3IGNA 1M0SA 1CC8A 4M1KA 3G8QA 1C0UB 4FXWA 5FLXU 1Q86T 1S7IA 3US5A 4ETZA 2DT9A 5ETLA 1DJ0A 4B3OA 1RWMB 4RNFA 3HFZB 1SH3A 5HVHA 2IA0A 4RLEA 1RTZA 2VQFJ 2MQNA 2V67A 4FKYA 1YX2A 5ETSA 5DQIA 2EFOA 3OUYA 1HWUA 3G96A 1ZM3A 1KVKA 4ED8A 1S1TA 3M32B 2FUG9 3TJAA 1EIYB 4JOUA 5FJ4A 4HDGA 2CQ3A 3H5XA 4C8LA 2G2ZA 3VTIA 2OPRA 3X1LB 2KM8C 3RTVA 3KLIB 1YJNS 1FT8A 3KLEB 3I55S 2EKNA 3H2VE 1GMVA 1AZSA 1DBDA 1UL3A 4DG1A 3EVMA 3UCGA 1NO8A 2NREA 4DU8A 1P1TA 3U27A 2HAFA 2AJ0A 2KZMA 1F5CA 1YGYA 2BKOA 4TKTA 4IR9A 1AW0A 1N34J 4G6VB 2W01A 5B0FA 3D0GE 4QYZK 2LKZA 1ZM4A 3MM6A 1BWEA 3KMQA 1QE1A 3SCLE 4EGLA 2ROEA 3JAMU 3EPGA 3CJKB 1KFDA 1IBCB 2Y1IA 3MEDB 2ZKTA 3BR9A 4RNMA 4B9SA 1HMVB 4CLTA 5GADU 2KG0A 2XI2A 5F8HA 3AD9C 4RW4A 3MGJA 1FKOA 3QQCD 2OD6A 2DXFA 4IO1A 3J7YU 1HD0A 3TUZC 2AMCB 2YNHB 3MURP 1RWKB 4PEOA 3IC1A 2R7OA 1KLMB 4QW9A 5F8JA 3OTCA 1XMQJ 1JLFA 4OLPA 3B6BA 3NS6A 3OT9A 2K06A 4NRTA 3RG6A 4QIGA 3IR6B 2UVRA 2JNJA 1MG7A 4KHRA 3PW4A 5E7OB 2IM2A 1VISA 2GVZB 4FF4A 5IV4A 4LJMA 3UD5A 1ZH5A 3SFUA 3S8SA 4P7TA 2MKYA 3TRGA 1KHWA 4LF1A 1NUEA 3EZOA 1SL0A 2BUNA 4NASA 4WK1A 4P72A 1PILA 4K50A 1WC0A 5LJ5Y 1VQOS 1NEEA 2AZ1A 2CNOB 1N88A 5BR8F 3T6JA 2NS1B 3N9UC 4C3KA 1ZPVA 5KG3A 2AD9A 3WC2A 2H4WB 1TZ0A 3Q0AA 2BOPA 1YBAA 1N5VA 4A8MP 1FNXH 2MZTA 4MJKA 2BJ1A 2BANA 1R7IA 1V5VA 4JI1F 3NWRA 3MDFA 4IFVA 2AYEA 2KI2A 2F4VJ 1UETA 1MMLA 1JLAB 4LF6F 2CJAA 2B4OA 2YTCA 1GX5A 4E8UA 1M5PC 2L3MA 5J2MB 1FTRA 3TI0A 1S4EA 1VQMS 1WF2A 3ZZPA 2B56A 1AXQA 1RT6B 4TY8B 2VDHA 1PYOB 4H4OB 1Q8IA 2NYHA 1U2FA 3LGHA 2CZ4A 2EK6A 2FC9A 1VRUA 4PWDA 4Q7AA 2QX0A 2Q66A 2V8DA 4OV1A 1IKVB 2ADBA 1RZMA 4CDIA 5L1IA 4TY9A 2GCFA 2FB0A 5LSLA 4JI3F 4DWIA 4B3RJ 4FS1A 2QL7B 4Q2MA 4ZVEA 4B9VA 2EG1A 2ZVSA 2VQEJ 2C1EB 4U7UK 2WVDA 2GFFA 4QOTA 4L74A 1L3SA 3GSDA 3FDSA 2R8IA 3CJQA 3FQLA 5CD4H 4DUZJ 5E3PA 3TA0A 3RAQA 3D0HE 1KC8T 2Q1LA 4ED0A 3CDEA 4FPIA 1NJIT 3HJFA 1N4LA 1RAIB 3HKZD 4QPTA 3M8YA 1DLOA 5KFWA 5KT3A 1IQTA 2LEAA 2V4RA 3EICA 1ULRA 1Y3KA 3T1AA 4D3HA 2BZ2A 2XULA 4CYUB 2LDYA 2U2FA 1LV5A 5A0YB 2LQ9A 3K57A 2HWTA 3VV2B 4OI1A 3TAPA 3C16B 3GR1A 4KYZA 4Y2KA 2BJ9A 1KR4A 1R8BA 4MKAA 2XCAA 4TN2A 1D9AA 5KFKA 1RDRA 4MMOA 3FFIA 2C3YA 2Y1LB 2FY8A 3F0NA 2GMHA 2KT5A 2KYZA 1T7PA 1ZAWA 5D4PA 2QEXS 3SFGA 3KNGA 5KOXA 1VJQA 2IA6A 4DV5F 3ZTRA 5IM0A 5DETA 3GJTB 3FVYA 3HZEA 3GFHA 3GP9A 4X4PA 2HHSA 1W2IA 3JYTB 1QTNB 1SJRA 2E7WA 4AYBD 4ZPVR 4RW8B 2A0FB 4A8YA 2C42A 2K8GA 4M95A 4KO0A 4TQSA 1T95A 3UN2A 1N52B 4XTTA 3BO3A 2AYMA 2MY8A 3TUIC 2P5VA 4LSLB 1VOMA 2VD3A 2V6AA 1REVB 3OTEA 2BABA 4IH7A 4F26A 2JH3A 1YIJS 2Z58B 2QFJA 1RTIA 5D78A 4NWBA 4DR6J 2WB1D 1JLQB 3CULA 3FEYB 5HL7Q 3V6DB 2HVEA 3DFEA 2W9CB 1BXNA 2FVRA 4JUZA 4DL0C 1DFDA 1KEKA 3G2XA 3EZUA 4FPRA 3PY8A 2I5JB 2E5JA 4OX7A 5DO2A 4NX9A 5IC4B 2JRSA 2QL9B 3UDEA 4AE5A 1BC6A 4KAIA 4WZMA 5DM6Q 5HBMB 1NK4A 1W2BR 1HR0J 5KG4A 5F9NA 3Q22A 5KFGA 1VBYA 1JJ4A 2GMLA 1TMJA 1VRTA 3QFHA 1X4DA 3J81Y 5A2QY 1FTCA 3I4PA 1S79A 2WONA 3HM9A 4C8YA 1RTDA 2HYIB 4IOAQ 4J9LA 1O8BA 2DCUB 4IRDA 3W5XA 4E0DA 3S1TA 4NMLA 3D6TB 3C46A 4L76A 3ONQA 3M2RA 1S9FA 2UUBJ 1NSKL 1RYRA 4NCAA 3EUNA 2E5LF 2IIHA 2V8VA 2NPIA 2W7PA 2XZDB 2VBXA 5A6WA 1ZA2B 2B9WA 1FRXA 5HATA 3LQVA 3H25A 4P74A 4NI2A 1FI4A 3BGFA 3NGUA 1VBXA 2Y8WA 2CJXB 2XMKA 5M2PA 4LRFA 2HFZA 1C0TB 3FCWA 3W60A 2HZCA 1Y4ZB 2G13A 3FBFA 5HP1B 2IRYA 3SIPB 4DV6J 4ZIWA 1M5SA 2IM3A 4FBTA 2R7UA 4BBYA 4CLYA 2ZC3A 3OSNA 3G71S 3H98A 5F8MA 2WBMA 1QLNA 3CO9A 3ET6A 1SCJB 1X9SA 2V4JB 2MGZB 2XS7A 3H2UB 3CJ3A 1A0OB 1BUXA 4ED3A 1QDUB 1IKWB 2HHXA 2V9WA 4IRKA 3CJRA 2I6WA 5B09A 4RU2A 3D0IE 3Q86A 4ZVFA 2QLBB 2E7XA 5DGBA 3MXHP 4NXMJ 3DKDA 3GG1A 4NE9C 5CH7B 1I3OB 2WVBA 1Q79A 4UTGA 5BYSA 1KQKA 1LWFB 2WSCC 2WSEC 5E0OA 3ZZ0A 1QAJA 2G0JA 2HVHA 2XY7A 2WOMB 4YHHF 1QAXA 5A8KA 2E1CA 3O3LA 4I7FA 1N36J 3RAXA 3PEHA 4K8RA 5KFRA 1WACA 1SV5A 3G6VA 3BKFA 2QZ8A 2LXIA 3KKFA 2I0XA 4I6AA 4DX7A 4FYYB 3DM2A 1UEVA 3RRHA 4JI6J 3GYXB 2AEFA 5L9XA 4LF5F 1EJ7L 3HPOA 3MM7B 4ED2A 1T9TA 5THWA 2C2EA 4DOZA 1N48A 1S9GB 5KFCA 2CUYA 1KSPA 2BKPA 5ETKA 2FJAB 4OYWA 2DITA 4I2QA 1S12A 1NDPA 1KQSR 5HLFA 3KG4A 1WI8A 4DSEA 2OTJS 4QQBA 2LA6A 4LFAJ 3TVYA 5GADI 3VZIA 1Q4RA 2XYGB 3J7ZT 4USUA 1HFEL 4I67A 2YNFA 4LF8J 4LF7J 2EBGA 4O23A 5E3AA 1T9VA 3J7YI 2V8HA 4LF4J 4DR5F 2OMOA 4WK3A 5DDQC 4RUBA 3NGDA 4WBFA 5GMKa 2D7SA 5FLXY 1K0VA 3DU6A 4DPXA 3KK1A 4WWSA 3IXQA 1HNVA 3MM9B 5B08A 3I5CA 1IKYA 4R8UB 1TELA 1ZTTA 3D66A 2J0SD 2RNEA 3W61A 1IM6A 4ELUA 4M8LA 4DUYJ 3P3DA 1HWKA 3QT8A 1RP5A 5CAAA 2L9DA 4N8OA 1AYEA 4L3KA 1V3RA 4NLTA 1T3NA 1JQGA 3DRSA 1S1WA 5HVFA 3P6YC 4ALZA 2MZ1A 3W64A 2FGCA 4OX6A 1U8SA 3FQKA 4YB1P 1YJ7A 4YB6A 3IAS9 2VZ9A 5T7LB 4PQUA 1F6TA 2QTWA 2YKMB 4KBIA 4ES2A 3VAIA 2DISA 2VICA 4G1PA 2RQCA 1FNMA 1RU2A 2E9TA 1ZA1B 4ZP7A 4FDFA 2ADCA 1U7LA 4LSZB 4DMZA 3IWLA 2DHXA 2NQPA 2ILYA 1JK9B 5ETMA 1GXTA 3BB5A 3NOCA 4B3MJ 2OIHA 2HRUA 3HVTA 3KUGA 2VB6A 1BHNA 4WP3A 4ZVQB 1RXOB 3I82A 2C2ZB 4M5HA 3BKTA 3JAMY 3MPDA 3T1HF 1UEKA 2J9DE 2GS8A 1WC4A 4DF8A 1OY9A 2NXJA 3VAHA 2QC3A 3LP1A 3MMCB 4IKAA 2DHGA 1D9DA 3PKMA 2X7IA 3OLBA 3RBZA 2ASYA 2XTJP 1LK5A 1CS4A 3QBCA 4QBUA 3GIRA 4DV7F 2F8EX 2Y0SD 3T19A 5KFQA 2RVJA 3NGSA 3A13A 3W2VA 3LALA 1K8AT 4I2PB 1DURA 4WJBA 4EFAC 2MKSA 2HGLA 1X4EA 1DTQA 4OYZA 5KTQA 3MEEB 4UW2A 5L39A 3I31A 3LA0A 5B0BA 1VLOA 4QWCA 2XC9A 1S6PA 3QGGA 4RPFA 1RE1B 2XWYA 4NZ6A 3H42A 4O44B 3MM5A 2P6SA 2PO4A 4C11A 1IJEB 4ZPCA 4ITSA 2UXDF 2HQIA 3KJNB 5B0EA 4DV4J 1H38A 4TU9A 2VFUA 4A48A 3GJQB 5F3ZA 3AJ2A 2CJBA 2FPHX 3S7RA 1IXKA 1GFWB 4KH0B 2ZBRA 5DDPC 3KHGA 2Y3YA 4F4YA 1R0CB 4C0HA 2KRBA 2HBZB 4LBHA 4K4YA 2RU9A 2CNKB 1M5VC 4LR9A 5CCMA 3EDRB 5A8WB 3MUTP 3HULA 3HK2A 1HPZA 1X5PA 3IBFB 2IBKA 3SCKE 3F44A 3Q89A 2N7CA 4IQXA 1F2HA 3EVOA 2DIVA 1WHWA 4KGKA 4HYKA 1NJWA 2E5HA 2B3TB 3OXLA 4QYRA 3IG1A 1NH8A 1JLGB 4GRSA 4YOEA 2VG5A 1Y5LB 1O51A 3GILA 1ZZFA 3K5OA 1E6YA 2J76E 2ILZA 3SXLA 2QT7A 1S49A 3N6MA 2OELA 3M8SA 2X1GA 3CCTA 4JI0J 2G1DA 4LFBJ 4EYIB 4B3OB 1VRQC 2KG1A 2M52A 3KK2A 5JMNA 1DRZA 2W2QP 1MU2A 1N5SA 2B6AA 2BQRA 1O5JA 4OMFG 4KSEB 1K73T 4FNIA 4CZCA 3AXKA 3RB6A 8AT1B 1ZETA 1N5TA 1NK9A 2I38A 1HR0F 2OSQA 2XHWA 3B78A 3HX9A 3SV3A 4LQ3A 3NRBA 4ZVGA 2RAQA 1RGVA 3UPFA 3DGPB 4R5PA 2BV3A 1RWOB 5CZXA 3UVJB 3VGTA 1Z4UA 2KFNA 1RHUB 2H5IB 3POTA 3I0SB 4DG1B 5D6GA 1LWCA 3RYLA 1RT4A 4OYPA 1TQLA 3G9CA 3M8WA 4DCJB 3H4BA 3N6LA 1ZTWA 3IBCB 5K8PA 4NEZA 4DQPA 2J0XA 4I64A 3QZ7A 4U7UD 3LWLA 4X62J 1RISA 3CE8A 2Y1RI 2HK3A 4Q43A 2KN4A 2OI2A 2JZ5A 2RKIB 4AFFA 4B02A 3M2UA 2KXFA 3UDCA 2ZITA 4RBVA 1N5YB 1U1MA 2A1BA 5T14A 2XQCA 4GMKA 4X65F 5K8MA 4RW9B 5C42A 2VPWB 3BO2A 2BJDA 4DR3J 1TL3A 3GJRB 4CTAA 2V2VA 1RT3A 4USJC 3JXOA 3K7RA 2IJNA 3ENWA 4YB5A 4B9MA 4NA3A 5K20B 1RWNB 5DS7A 3CO0P 5K14B 1IBKF 4NYZA 3NL0A 2CG4A 3EGWB 2XEXA 3R97A 3PYEA 7FDRA 2G2OA 5IT9Y 4ECTA 3FEZA 2ZBIA 3MMBB 2XMAA 1N32F 3HFKA 4MFBB 2FYXA 1J5EF 3THTA 2FHJD 4RO0A 4DSKA 4P10A 3R1LA 1CJUA 1T03B 2PE8A 1S1VB 1FDDA 2YQ1A 5ETVA 4JI2F 1WTBA 3MEGA 4O3NA 1DQAA 3QO9A 4P6QA 4ZVRB 2N4DA 3BYRA 1XQIA 2XBPA 3OTOF 4DSFA 4W4MA 3HT3A 1KVIA 5KG7A 1HBMA 1LW2A 2HMIB 5HMXA 3NGRA 4JI6F 3BDPA 2DGWA 3D9BA 2CAJA 3KK3B 4QYZJ 1VQ4S 1IBLJ 3NNCA 1JB0C 3BQ0A 1HD1A 5JJBA 5ETNA 4UOFA 4GVLA 2AYBA 2IRXA 4NOHA 3MOZA 3NBPA 4KQZA 5LOQA 3LUYA 4DI6A 1B0PA 2FJEB 4PUOB 1EETB 3FRZA 1P9QC 4NZ0A 4PRFA 3D6MB 3CMAS 1SBRA 1VQ9S 2R3VA 2RIJA 5KFNA 4RL1A 3UE2A 3NOGA 3N5BA 4LF7F 5MAOA 2IY5B 3GB0A 1FNOA 3OVBA 4KV8A 3GV5B 2W2OP 4MKBA 4OI4A 1C1BA 4OI2A 3BGUA 1BQMA 2NXNA 2HFUA 3HHLC 2XNQA 5EHHA 4OZ5A 5I42A 3MPWA 5HROB 3VALA 2K1RB 4LREA 3PR4A 2CIMA 1NMEB 1B0TA 3SQOP 1HBNA 4YS2A 2W4PA 2YWWA 3LPYA 3HVWA 1VFJA 3NMRA 4NLVA 4GKKJ 1YRTA 1Z2ZA 2BVZA 3UD4P 4OZ2A 1CULA 3RB4A 5CXTA 1CVJA 4USTA 3ENAA 3RB0A 4IQMA 3CCSS 3OR1B 3OVAA 4UOHA 1R8HA 2J9EA 2FQQB 2N3OA 2IRUA 1TUGB 3D67A 1OYEA 3BYPA 3BZQA 1U09A 4RWXA 3PRDA 1X31C 1HKAA 3M30B 3G6ES 4XK8C 4H4KC 3AXMA 2OEKA 2M2BA 1K47A 3GPAA 3CJ8A 2CZVC 2ZWOA 4PXBA 4ZJLA 2F1FA 1CEZA 1X5OA 2JLFA 2CQ0A 5J2QA 1EARA 2CZ9A 4KHMA 3C6UB 4R0EA 3BS9A 3A8IA 3DDNA 4F3QA 3LO3A 3L4BC 3R7SB 2X1BA 4HT5A 3EYZA 1N6QB 1RT5A 2PSZA 1LWEB 5L1JA 5GMEA 4W90B 2GGPB 4Z2XA 5KFHA 1JLBB 1IWAA 4NMXA 4ECXA 3M8RA 1T8EA 1NM2A 2B8QA 1FFSB 2HWIA 1T3OA 4YQWA 2KT2A 3IWNC 1YZ7A 5HMWA 1XTZA 3BGOP 2CQBA 2ALYB 3PACA 4ZJOA 2CWXA 2LEBA 2ASDA 4ZKAA 2M88A 1JKHB 2VFTA 2DGVA 2YNIB 1GXUA 4N7TA 2HS4A 1CPZA 1KD1T 2CQ2A 4ZJQA 4QR0A 1GXLA 3PFOA 3QGPA 5K8NA 4NEYA 3O44A 1V3ZA 3W66A 5DLGA 3BGLA 4N41A 5KT5A 3LAKA 2DGOA 1XNRF 3MZIA 1UZHA 4XDCA 2VFRA 4RU9A 4DV4F 1FE4A 1FEHA 4E98A 5DDRC 2Q79A 3I0RA 2W7OA 2MLXA 1U47A 2HQDA 4X64J 2YVSA 2QMUB 1IN0A 2JL9A 5BXIA 4UT4A 3L7UA 2BE7D 4GC7A 3WDOA 1KDNA 4U96A 4TXSA 1VQLS 4WFXA 2IVFB 4USMA 1F0XA 2P9GA 2W9BB 2W2PP 2DXEA 2E5IA 3QGHA 1WSVA 1FFWB 2LU1A 1WHXA 4V19J 5DG7A 2LMIA 2YKQA 3W1YC 2JVOA 1ZM2A 3KTQA 4J9UE 4JI7J 3FSIA 2Z2ZA 4TVAB 1SH0A 1NZAA 1RT7A 2YX7A 4CCHA 3VF0B 1PJ5A 1QSSA 2ZZTA 3MMAA 4LFBF 4C7QA 2YKAA 3I32A 2E5GA 1J5OA 3ENQA 5KT4A 4M5LA 3TVZA 5KFOA 4OYMA 3J80U 3TJ8A 5G0RB 1RTHA 2VG7A 4LSNA 3IM8A 5DJBA 2V94A 2B43A 2FJBB 3CCRS 1ZYQA 2PMWA 2DNRA 3M2VB 2MMYA 3IO1A 1RT2B 3MAAA 3P8BB 3A4TA 1TP7A 1WOSA 2ZOMA 2VODA 2VKZG 1H73A 4J9MA 2HIYA 2NXCA 2V5HG 1AUSL 2KXNB 2N82B 3PX0A 3AHPA 2QO3A 3UQSA 1VDHA 3JSYA 2R9LA 2HBQB 3EDQB 3G6YA 2ZHAA 1F3FA 1S99A 1FE0A 4DX5A 1L3TA 2ZM6F 2KJVA 1MSWD 1FKAF 3CW2C 1Q0NA 4O3PA 5G4DA 2YKNB 2IVMA 1YJRA 2W25A 2ZH9A 3EVWA 5D8HB 3VAKA 4BWMA 2KTQA 2GQQA 1UVIA 3PW0A 1R3NA 4K4UA 2EFPA 2CQPA 4P2FA 4WFZA 4NL5A 1SJ4P 3PRVA 4J5OA 1RHJB 5GAHU 2KL8A 3A8JA 2FJWA 2RUSA 1Y5NB 2KFYA 1UW4A 3NAIA 1RU1A 2GHWA 2MKIA 3CCMS 2QMXA 3ZTQA 5J1EB 3O1LA 2PD1A 4U67Q 3C15A 3C6TB 4BC9A 3DLGA 4DV3F 4GO5X 2MYFA 2N4CA 3TZYA 1NKCA 3G82A 4DR3F 4CIOA 1TUVA 3PX4A 2DNLA 3PHTA 3GTYX 3HO1A 4DQSA 1BD6A 4DL5A 2CQ4A 4FVMA 3LAMA 3W2WA 4EBDA 2G2YA 2QV6A 4I2QB 1TVRB 3LP2B 3FCHA 4WU2A 4Y3CA 5LJ3Y 2ZOFA 1NDKA 1TKZB 3AH6A 1HQUA 1Q82T 3PIOQ 3NAHA 8RUCA 3R5DA 1FXDA 2MJNA 3O8WA 4Y2IA 1YJ9S 3KJVA 3DLLQ 2GC8A 3TJ9A 2YWFA 2KXHA 3P96A 2KM8B 1M5HA 1XR6A 3HLUA 1BE4A 2Z8QA 5U47A 2YNGA 4DR4F 3MAHA 1FJEB 1F5AA 2CPHA 1CG2A 2G1HA 1LEOA 4HHHA 3VCDA 4Q5VA 1TU0B 2J7WA 1FJGF 3CD5A 2L9WA 3R2DJ 3IN5A 1MN7A 1HNZF 2OGUA 3VWSA 1S9EA 4MIWA 5C5JA 1HWLA 4L73A 2AIRB 4U7CA 3V4MA 1B99A 2CDRB 4OFZA 5D0EA 5HI7A 1IBLF 2QRRA 3K5MA 4ZPAA 1S1UB 5HQ8A 4EU0A 1V3SA 3G4SS 2XYHB 2AHOB 3BDEA 5J2PB 4ECQA 6FDRA 2RJZA 3U02A 2OP5A 1U6ZA 3DOMB 2VJUA 4O4RA 2FGOA 1M5KC 2CFXA 4IFYB 5AE3A 3EE3A 3R5CA 4PAAA 2PEHA 4DZDA 1S5ZA 1UJ6A 3QMQA 2KHCA 1Q7YT 3DYAB 1SKWA 3TUPA 1E6VB 3EXYA 4C4WA 2J0QD 3C14B 2KJWA 2HNZB 1IR2A 5CYMB 4C3LA 4X4TA 1WC3A 2CWKA 5E3QA 4ELVA 5H1SV 4PYDA 3THPA 3V81B 4BHQA 4QWAA 2AWZA 4ID5B 2FZKB 4Y2AA 4F2RA 9ATCB 2C3OA 3ISZA 1WNEA 3M8QB 4UOCA 2E7VA 1WJ9A 1OYDA 1Y00A 1X4CA 4PWUA 1HQEB 2JJ4D 2MZSA 5KFMA 1Q8LA 3SQGB 4KGVB 1FFGB 4DPTA 2RT3A 2MQMA 2F5GA 1TKXB 1XR5A 2MXYA 4ECYA 3DMJB 4CQ1A 1TFYA 2AF6A 1UWBB 3OLAA 1J2VA 2OH2A 4KH1B 1JLEB 1Q81T 4KGXB 4MYUA 3H40A 5AE1A 1UFKA 4N8NA 2B9XA 1YRXA 1G7CB 3V4IB 2HQFA 4KGZB 5I3PA 1KOOA 1P6TA 3IR5B 4UY8T 2J0WA 1WC6A 3DRRA 1T9WA 2DTJA 4ZS6A 3AB4B 1CLFA 2QE5A 4IG0A 3FUYA 4RKUC 4MKYA 2B5JA 3HHNB 1IM4A 4CRJA 1VI7A 1H2UX 2DNPA 3NGTA 3KHRA 3E01B 4E2FB 4F0HA 2F65A 4ZLJA 4J9NA 5HO4A 3W8PA 1T05B 2UU9J 4Y2MA 5B7WA 5BR8J 2CXEA 1NKBA 3DI6B 1G2EA 3TAMA 4WIIA 5CABA 5EX0A 4P9SA 1KFSA 3GZ7A 3DNCA 2K3IA 2VU5A 4JI1J 1NHVA 1XMOJ 3KFWX 3CB4A 3MF5A 2F3JA 3CGIA 5EDWA 3DLKB 4DFJA 1SUQA 4LF6J 5I3UA 3BV8A 4FN5A 3R5JB 3RU0A 1TK8A 1F3VA 1MU2B 1SXLA 2GIFA 5IWAF 4GC6A 1S0VA 4JYAJ 3DC2A 1CJVA 3ITHA 1H7WA 2ZNZA 2R8KA 5KFZA 4PG8A 3DLBA 1EX8A 4Q45A 5KFSA 4PG7A 2XSJA 2R7SA 2KU7A 1S1XA 2EVZA 4ICLB 4CLWA 2R2TA 1NSQA 3DRPB 4WKRA 4BS2A 1M1KT 1HLWA 4EUVA 1U24A 1H74A 4F3MA 2IFXA 5BYQA 2HKEA 4JI3J 4IUFA 2CRLA 2HBYB 1CQNA 3A1YG 2AJFE 3TX8A 4XO0A 1HYSA 1UJ5A 3QIPA 1QTMA 1U6BA 3TZWA 3SYZA 2CVEA 4UOGA 5KFFA 3PYGA 1U1RA 4KC5A 4I69A 2JEJA 2PA3A 4DLGA 1UMJA 4IG3A 3M9NB 4NLWA 3KLFB 4A8WA 2OPSB 4NYOA 2IJFA 4RW7A 2MJUA 1NB7A 4RNOA 3J81U 1U1PA 2PGCA 5T41A 5A2QU 1Q78A 2OPPB 4FP9A 3AOBA 3H5UA 1UCNA 2DIUA 2Z30B 3DDIA 5IFMA 2FZGB 4O4GA 1PCAA 2FLPA 2JFKA 2V2ZA 4YY3F 2EFNA 4K2JA 2IAJA 2DR9A 1FX4A 3K8VA 2PIIA 1JLCA 3MR7A 5H9EK 1FHTA 3KLHB 3JSRA 1RWPB 2B51A 3HXMA 3OFGA 2JOQA 1FRJA 2R8HA 1N0UA 3QT6A 4KIAA 4X84A 2W1BA 3PTWA 2VJVA 5IOLA 1LKZA 4B9LA 4ETXA 1R0AA 3OHBA 4B3TF 3M05A 2IC3A 2FDNA 4DV5J 1RT1A 3SSRA 3LP0B 1HL6A 3I9V9 2CJ9A 1CJTA 3R3TA 2K7KA 2M4MA 1EP4B 2E9RX 2OLWA 3BBBA 2YWGA 3ZC4A 4DR1J 4GO7X 2CADA 2HRYA 4ZHRB 3AA9A 3MM8A 4C0OC 4DFKA 4KJIA 4C8MA 3W62A 4CLUA 5ITHA 3DLEB 3OFFA 3KNAA 2DKOB 2MB0B 1VIXA 2HQGA 3VGUA 3IRXA 4IRCA 4WFBQ 3CD7A 2JWNA 2BX6A 3LPEA 3HJVA 1L3KA 2FJVA 4CLLA 2QA4G 3D3CJ 3FMBA 2GHVC 3AD7C 4L6V3 4WTOB 2EXUA 1TL1A 3SSSA 4WFAQ 2MKCA 3RBEA 4X4VA 2DR6A 3ZTOA 2BRKA 4KE5A 2DRAA 1C0UA 3S6EA 3LTOA 1OQ6A 2JFDA 2F8HA 1RB0A 5A8RB 3MD3A 1JXEA 2XO7A 4LF9J 4F2SA 4DHVA 1RBOB 2NCKL 1GAOA 2L48A 2QSWA 3GE9A 1Q5YA 1M1GA 4LRBA 2ZBCA 1FDAA 3EGZA 4B9TA 2OHDA 1VR6A 2LQBA 1TK0A 2D3UA 3AB2B 1GTEA 3UNGC 1EAYC 2DY1A 1WOPA 3M6UA 3LOUA 3I4HX 5DG8A 3M32A 4QZVB 5GAGU 3CSKA 1TAUA 1OJ4A 4ZPWR 1D09B 3QT7A 4CLZA 2H48B 2AGQA 2HGNA 3RGIA 1F9EB 3KLIA 3KLEA 1T9UA 4YUDA 2YKOA 5D15A 2LQ8A 2CPJA 5EWGA 1VMBA 4CO4A 4F4XA 2ZE2B 2XYPB 2ZD1B 3W9IA 5KOWA 5RUBA 4N47A 1SL2A
chains in the Genus database with same CATH topology
5IT9U 4DV5J 2E5LJ 4JI1J 2MEWA 4V1Ak 2KL8A 1XMOJ 1N32J 4DR7J 1HNWJ 4DR3J 5LMUJ 4LF9J 3J80U 4LFCJ 4GKKJ 5LM7E 1J5EJ 2ZM6J 4LF6J 4DR1J 3T1HJ 3T1YJ 1IBLJ 2MQ8A 3R2CJ 3J7AN 4KYZA 2MTLA 5FLXU 4DR6J 1N34J 2UUAJ 1HNXJ 3R2DJ 4LFAJ 2UUBJ 3J81U 5A2QU 2UXDJ 4X66J 4JI2J 4X64J 4LF5J 4NXMJ 4JYAJ 4LF8J 4LF7J 4B3RJ 3JAMU 4B3TJ 2VQFJ 3OTOJ 4LF4J 4RJVA 2UXBJ 4X65J 2HHHJ 4JV5J 1XNRJ 3IMQJ 4DR4J 4GKJJ 4DV7J 4PWWA 2UUCJ 4DV1J 4K0KJ 2VQEJ 4B3MJ 1N36J 4JI4J 5AJ3J 1FJGJ 5LMNJ 1N33J 4AQYJ 2UU9J 2F4VJ 4JI0J 4DR2J 4DUZJ 4LFBJ 4NEZA 4OX9J 1HNZJ 3D3CJ 4DV3J 4JI5J 3D3BJ 4DV2J 5IWAJ 1HR0J 4DV0J 3W1YC 5BR8J 4X62J 1XNQJ 4JI3J 4B3SJ 4DUYJ 4KHPJ 4DV6J 4KY3A 4JI7J 4JI6J 1XMQJ 4NXNJ 4DR5J 4DV4J 1IBKJ 4NEYA 2KVQE 1I94J 1IBMJ 4YY3J 2UXCJ 4HHUA 4YHHJ 4JI8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 U;  4DV5 J;  2E5L J;  4JI1 J;  2MEW A;  4V1A k;  2KL8 A;  1XMO J;  1N32 J;  4DR7 J;  1HNW J;  4DR3 J;  5LMU J;  4LF9 J;  3J80 U;  4LFC J;  4GKK J;  5LM7 E;  1J5E J;  2ZM6 J;  4LF6 J;  4DR1 J;  3T1H J;  3T1Y J;  1IBL J;  2MQ8 A;  3R2C J;  3J7A N;  4KYZ A;  2MTL A;  5FLX U;  4DR6 J;  1N34 J;  2UUA J;  1HNX J;  3R2D J;  4LFA J;  2UUB J;  3J81 U;  5A2Q U;  2UXD J;  4X66 J;  4JI2 J;  4X64 J;  4LF5 J;  4NXM J;  4JYA J;  4LF8 J;  4LF7 J;  4B3R J;  3JAM U;  4B3T J;  2VQF J;  3OTO J;  4LF4 J;  4RJV A;  2UXB J;  4X65 J;  2HHH J;  4JV5 J;  1XNR J;  3IMQ J;  4DR4 J;  4GKJ J;  4DV7 J;  4PWW A;  2UUC J;  4DV1 J;  4K0K J;  2VQE J;  4B3M J;  1N36 J;  4JI4 J;  5AJ3 J;  1FJG J;  5LMN J;  1N33 J;  4AQY J;  2UU9 J;  2F4V J;  4JI0 J;  4DR2 J;  4DUZ J;  4LFB J;  4NEZ A;  4OX9 J;  1HNZ J;  3D3C J;  4DV3 J;  4JI5 J;  3D3B J;  4DV2 J;  5IWA J;  1HR0 J;  4DV0 J;  3W1Y C;  5BR8 J;  4X62 J;  1XNQ J;  4JI3 J;  4B3S J;  4DUY J;  4KHP J;  4DV6 J;  4KY3 A;  4JI7 J;  4JI6 J;  1XMQ J;  4NXN J;  4DR5 J;  4DV4 J;  1IBK J;  4NEY A;  2KVQ E;  1I94 J;  1IBM J;  4YY3 J;  2UXC J;  4HHU A;  4YHH J;  4JI8 J; 
#chains in the Genus database with same CATH topology
 2FHJ A;  1BGX T;  2CPF A;  2ZHO A;  4C8N A;  5HAO A;  4JV5 F;  4WZQ A;  4PXC A;  4LFC J;  1UAW A;  3BBC A;  4UUW A;  2R7V A;  3UCZ P;  1TKT B;  5F3T A;  3OL7 A;  4WYW A;  3CJK A;  4OZN A;  3SDE B;  1BLU A;  1KON A;  4URQ U;  1RKI A;  2NXU A;  3MED A;  1SJF A;  2E9Z A;  2MQP A;  3ZNJ 1;  3TA1 A;  1HMV A;  5DQG A;  3GCW P;  1U48 A;  4FXV A;  2M8H A;  4ED5 A;  1RHR B;  4Q0B B;  4LBI A;  5LXR A;  1XBW A;  1B70 B;  2YNH A;  1QVG R;  2LU2 A;  1FD2 A;  3R7N B;  1KLM A;  2CJY B;  5BJR A;  5D0R A;  2KYX A;  2VA2 A;  2XLI A;  3MI7 X;  1WF0 A;  2MQQ A;  2HWH A;  3H90 A;  4KGM A;  2LQ5 A;  2GVZ A;  2B4U A;  4A47 A;  3BSN A;  3L09 A;  4EK2 A;  3RW6 A;  1BQN B;  2IHR 1;  4YHH J;  2HLU A;  3UR0 A;  1UVN A;  2DPJ A;  1JX4 A;  2V34 A;  3M6V A;  4EZ6 A;  4PKD B;  2Q6B A;  2BXJ A;  2Y9H A;  1IJF B;  4DR2 F;  5L38 A;  1SQF A;  4LF5 J;  4EI2 A;  2R7W A;  1Y5I B;  3NG8 A;  2X1F A;  4PXD A;  3ULH A;  3BSO A;  1NPR A;  2C3U A;  1JLA A;  3UDL A;  2KZZ A;  1YZ6 A;  5J2M A;  1X0P A;  3MEC B;  3M1V B;  3R9L A;  5B0C A;  3MR2 A;  4XPC A;  3BGR A;  1UVK A;  1RT6 A;  3BM7 A;  4TY8 A;  4DV2 J;  4KPY A;  3K59 A;  1WKJ A;  3EPI A;  4H4O A;  5F0W A;  3E3X A;  4WP9 A;  2YPY A;  4NLP A;  5EUH A;  4OJG A;  4FF1 A;  1P9Y A;  3C2P A;  4DR5 J;  3ILO A;  5FD1 A;  3CXC R;  3NMA A;  2H4Y B;  3BPS P;  1TTH B;  2UU9 F;  2YH0 A;  1IKV A;  1H7X A;  4G1Q B;  1G4C A;  1P8G A;  4YB7 A;  2E1P A;  4M5D B;  4ANE A;  3DLJ A;  2L41 A;  1YI2 S;  5CYJ A;  5DG9 A;  1RWU A;  1WEX A;  4C8K A;  2OD4 A;  4X4N A;  2KHD A;  1GX6 A;  1REG X;  3ZTS A;  4F67 A;  4K7Q A;  3CWJ A;  4ECU A;  2M7S A;  4I6W A;  5IXU A;  1XMO F;  4A8K A;  3UWT A;  1Y11 A;  2WVE A;  3HSG A;  1RHQ B;  1U1Q A;  1U6F A;  2R8G A;  3GV7 B;  2UXB J;  4UY8 5;  5BYR A;  3IMQ J;  5IV3 A;  1J5O B;  3NKY A;  3VZH A;  5D77 A;  1NDL A;  4CH1 A;  3HDS A;  2ASJ A;  1RUS A;  1LNQ A;  4RW6 B;  1RSC A;  5E3C A;  2VG7 B;  2DEJ A;  3JSM A;  4JYA F;  1D3W A;  5KFI A;  2ZZN A;  1XR7 A;  2LLZ A;  4HEA 9;  2BBE A;  3ZZU A;  1WUU A;  3JSB A;  1VQP S;  1YVF A;  2DH7 A;  3LH2 S;  3MAA B;  4ECR A;  2PC6 A;  4CYU A;  2LXF A;  4U8V A;  5A0Y A;  2BE2 B;  5EGY A;  1EKR A;  1CJK B;  2D9O A;  3C16 A;  1Q5V A;  5HAN A;  3KXD A;  1UW9 A;  1SQE A;  2QSF A;  2GA7 A;  4CO1 A;  4DV1 F;  4J9R A;  2OFH X;  2V0N A;  2CPX A;  4JI4 F;  3T1H J;  1ZAV A;  3T1Y J;  4ZDN A;  5ETQ A;  4F50 A;  5FDL A;  2X3D A;  4RR5 A;  1I51 B;  1Y9O A;  2IDE A;  2AX0 A;  5J2N B;  3VR1 A;  5B0A A;  4URG A;  2ZH6 A;  2AT1 B;  3H5S A;  3G6X A;  5MLC V;  1YLX A;  1ARO P;  3IAM 9;  1VQ6 S;  4DBQ A;  1C2P A;  4DV7 J;  2V63 A;  3JYT A;  1YSJ A;  3HF5 A;  3KDN A;  4ZPB A;  2YBV A;  4RW8 A;  5D3G B;  2DPI A;  4WE1 B;  2MQO A;  3HI9 A;  1YQH A;  4PG4 A;  2HNY B;  2W8K A;  3D3B J;  2XG8 A;  1HHS A;  4IDK B;  2D3Z A;  2G0I A;  5HMZ A;  2UUA F;  3FZ2 A;  4P75 A;  4LSL A;  2JHE A;  2RRN A;  4A8O A;  1REV A;  4I0W A;  4NLU A;  3TP2 A;  3MCN A;  3OR2 B;  2ALZ A;  1JLQ A;  5HQM A;  1SJ3 P;  3V6D A;  4WCE Q;  2QLW A;  4ZA1 A;  2W9C A;  1HQ2 A;  4KKO B;  1I1G A;  1HQU B;  4K2X A;  2ZJQ Q;  3OD2 A;  4ZP8 A;  3F73 A;  2UXD J;  3DHX A;  2BDP A;  2CPY A;  2I5J A;  1SIW B;  1PBA A;  4A8Q A;  2HHH J;  4DX6 A;  3K8W A;  3KHL A;  3ISN C;  4DR1 F;  5C25 B;  4OHW A;  3VAF A;  5HBM A;  1QSY A;  3L9Z A;  3N5F A;  3MOJ B;  3I87 A;  4W98 A;  1YHQ S;  3PXG a;  5GAE U;  2EEY A;  4CM2 A;  4ZLL A;  4ZOS A;  4YEA A;  3F41 A;  2VC1 A;  3Q8S B;  1CBK A;  3MR3 A;  1JNR B;  3WC0 A;  1PJ6 A;  4KT0 C;  3H7H B;  3OXG A;  2B7C B;  2KVQ E;  2UVV A;  4ZLN A;  2OPQ B;  2LEC A;  4HHU A;  4DN0 A;  3UD3 P;  5IT9 U;  2RRB A;  2C2O B;  3T41 A;  2FHM A;  3NNA A;  1HNW J;  1FJC A;  2GVD A;  2J7K A;  5KFB A;  5JUM A;  3HCX A;  4Y0F A;  1N33 F;  3WHI A;  2EC0 A;  2APO A;  1RLD A;  2YWK A;  1FCA A;  2HHU A;  3PIP Q;  3KLV A;  3MR5 A;  4Q8E A;  1D8Y A;  4LF9 F;  4P73 A;  1SIZ A;  4J91 A;  4L3N A;  1C0T A;  3MPV A;  3WZ0 A;  2RDD A;  2JVR A;  1YRU A;  4X4U A;  5HP1 A;  4UQT A;  1LFW A;  4CLK A;  4P7V A;  2OJ3 A;  2LXU A;  4HAC B;  3W9H A;  3QLH B;  2C22 A;  3TO8 A;  1A7G E;  1HBU B;  1C1C B;  3ILI A;  1TR0 A;  2GIR A;  3L7P A;  3PFE A;  4PPZ A;  4LVN P;  2V4J A;  3D4J A;  2MGZ A;  3OHA A;  1GEH A;  2CPZ A;  3HZG A;  1IKW A;  3D1Q A;  3IM9 A;  4NCG B;  5F8L A;  3P45 B;  2RS8 A;  3R5B A;  3MTJ A;  2DGU A;  1KTQ A;  1NK8 A;  3PJX A;  5DGA A;  5GAG I;  1RAA B;  2Y0B B;  1HBO B;  3MUM P;  3KHH A;  3LAN A;  2JLE A;  3JB9 k;  1X4F A;  1LWF A;  4TYB A;  2I8E A;  2BR0 A;  2OEJ A;  4K4W A;  1XMB A;  2WOM A;  1UVL A;  1IKX B;  2DXD A;  2WSF C;  5IQ6 A;  4IH6 A;  4CT8 A;  4QIV A;  4LFC F;  1FRI A;  2CQI A;  2WHO A;  4X65 J;  5KG5 A;  4Y34 A;  1W7W A;  2UUT A;  1WOO A;  1PJ7 A;  5KFA A;  2VBW A;  5L46 A;  1KQF B;  2GHP A;  1UPP A;  5AE2 A;  2YQ3 A;  1OO0 B;  3CCL S;  2C2D A;  1U49 A;  2VFS A;  3MM7 A;  1HI1 A;  3DRR B;  4USW A;  2QIF A;  4H4K A;  3A8K A;  3N0V A;  3DGV A;  3ZZT A;  3I96 A;  2KKH A;  5HMY A;  1S9G A;  5LT5 A;  2OFG X;  4UZC A;  2W2M P;  1IBK J;  2RU3 A;  4DQQ A;  1RCX B;  3HHL B;  2NSB A;  2MKH A;  3SV4 A;  4K59 A;  2DO4 A;  2HND B;  2DNQ A;  4F4K A;  1N32 J;  1FKP B;  2VG6 B;  4AT1 B;  3K58 A;  1J5E J;  2VH7 A;  1X7V A;  3QWP A;  4UUX A;  4Q8F A;  2HSE B;  6FD1 A;  1OWX A;  1WD6 A;  4B9U A;  2EFG A;  4JI2 J;  4P52 A;  4RBT A;  4NZ7 A;  3OTO J;  3ZXW A;  1IVZ A;  2N3L A;  3MM9 A;  1K9M T;  3EMT A;  4R8U A;  2UUC J;  1W26 A;  1K0T A;  4NLX A;  1MRO B;  1PO6 A;  2J7U A;  3Q8Y A;  3K2Y A;  3CCW A;  2R42 A;  4ES1 A;  2AV5 A;  4FS2 A;  1R0B G;  2A10 A;  2RB7 A;  4QWE A;  3MR6 A;  2DR7 A;  1N5Q A;  4ID8 A;  4WKY A;  4Y6I A;  5KFT A;  4I4B A;  4QR2 A;  2ZC4 A;  4TNO A;  1MMN A;  2J6U A;  2ZBQ A;  3T5L A;  3KDO A;  2DK2 A;  1URN A;  1T9Y A;  2XMM A;  4Y2C A;  1EZZ B;  2ZNY A;  5KFY A;  1MWZ A;  2D74 B;  2RF2 B;  1I94 J;  1HIY A;  4ZP9 A;  3HSD A;  2I2Y A;  5T7L A;  2CQ1 A;  1IQZ A;  2YKM A;  3Q2T C;  2G4B A;  4DV2 F;  1RA6 A;  4AL6 A;  1RHK B;  3D1O A;  3N6N A;  2DGQ A;  3R5G A;  4MK8 A;  1V6H A;  5F0U A;  4LF2 A;  3DOL B;  4USH A;  2OTL S;  1QUV A;  2KT3 A;  1NKE A;  1ITP A;  4XIU A;  1LWX A;  3IBW A;  3GIK A;  3PDN A;  5KFE A;  2DNN A;  3BBF A;  5AXN A;  1NDC A;  1S72 S;  2J5A A;  1LW0 B;  4Q44 A;  3MPY A;  2FVP A;  2LDI A;  1IR0 A;  1H6K X;  3MMC A;  1AFI A;  2UXB F;  2LYV A;  3B4M A;  4USV A;  2VBY A;  2CNN B;  3BEG B;  3SSQ A;  2DYA A;  5HSP A;  3TAN A;  4EO6 A;  5F8N A;  4O0N A;  3KLG B;  3VAM A;  1GH8 A;  4I2P A;  2IJR A;  4AUK A;  2FC8 A;  4TQR A;  2HEK A;  3TWZ A;  3QSI A;  1S77 D;  2FJD B;  1R8P A;  3MEE A;  4CO0 A;  4C8O A;  4R25 A;  3Q8U A;  4HH1 A;  2ZH3 A;  2AP6 A;  1U2C A;  1PAE X;  1KTV A;  4NLQ A;  5C24 B;  1CQM A;  3T1Y F;  1TL7 B;  2V69 A;  3V6H A;  2IM0 A;  1FVQ A;  2P2C B;  3CED A;  5F8I A;  4O44 A;  2DH8 A;  1EQM A;  1VCT A;  1NXI A;  5KFD A;  3MFH A;  5K5M A;  2FHK A;  4OX9 J;  1B4S A;  2VIH A;  1MMD A;  2DGS A;  4TLR A;  2YH1 A;  1HNX F;  3UCU P;  2BJ8 A;  4GVB B;  2RUG A;  2VOO A;  1Q53 A;  5KFU A;  5A8W A;  1NK0 A;  1FK9 B;  3PJ9 A;  4ECZ A;  2LP4 A;  2M70 A;  1NHU A;  1WG5 A;  2DHH A;  3PM9 A;  3CME S;  1FRM A;  5CYQ B;  4TYA A;  1U1N A;  4RWW A;  4BWJ A;  1T0T V;  1UVJ A;  1ZOT A;  3M4X A;  1HAR A;  1JLG A;  5GVQ A;  3SI8 A;  3R2C J;  3T9N A;  2QN6 B;  1HHT P;  3LGM A;  2RML A;  2V68 A;  1MN9 A;  1NCL A;  1X4H A;  4I6Y A;  3U1L A;  1FRH A;  1VIO A;  2HK2 A;  4C97 A;  2COL A;  1H2V Z;  1YBT A;  1XNR J;  5H9E J;  4ZPT R;  5AXL A;  4JI8 F;  3TYT A;  2ZH5 A;  3PHE A;  1A6L A;  4DUT A;  3DOK B;  4QR1 A;  4DR7 F;  3DLH A;  2C2M B;  5KG0 A;  1FDN A;  1RJJ A;  4Y65 A;  2HHH F;  2QG9 B;  1HNI B;  2BQ3 A;  1X4A A;  1VQ7 S;  2DB1 A;  1OIA A;  3Q8V A;  4MT1 A;  1GQE A;  3HSZ A;  1YKW A;  4MAK A;  3EM1 A;  1SJ1 A;  2R4F A;  3W65 A;  2E44 A;  3V6J A;  3UO0 A;  2PMZ D;  3G8T A;  2PN6 A;  3V5R A;  4DPY A;  3MWB A;  3MPU B;  3HVA A;  3DGP A;  1VS3 A;  2VBZ A;  4DCP B;  2W2N P;  4HI2 A;  3UVJ A;  3T5K A;  3QWU A;  3MD1 A;  3PV8 A;  4IR1 A;  2QLJ B;  2AZ3 A;  2VAS A;  3I0S A;  4OYI A;  1S48 A;  4Y00 A;  1QJH A;  2DNZ A;  2RS2 A;  5GAE I;  4QIW D;  1JIH A;  2LEP A;  2FHO B;  3SCI E;  1R6V A;  1HNW F;  1Q7L B;  3VVU A;  4RJV A;  4CNZ A;  3H59 A;  1RBA A;  4LRC A;  1URR A;  1IBM F;  4ED1 A;  4GKJ J;  3DN9 A;  1H3D A;  3U1N A;  2RKI A;  5D4O A;  2VL1 A;  3EZ5 A;  3OUY B;  2PFF B;  1N5Y A;  3VGV A;  4ZVO B;  4X2B A;  1U25 A;  1L5U A;  4RW9 A;  1XIQ A;  4WXO A;  3MAQ A;  1S1T B;  1JMT A;  2W24 A;  5HJX A;  2ZH2 A;  4QJV A;  5J1P A;  4HVZ A;  3WBZ A;  5CZV A;  2OPR B;  3B54 A;  2WK4 A;  2NZ4 A;  2KRR A;  4V1A k;  4C3M A;  2KO1 A;  2O67 A;  1O0P A;  2MLY A;  1SKU B;  1AZS B;  3W7B A;  2ZM6 J;  4ILM A;  3QPI A;  2O01 C;  5K14 A;  2DO0 A;  3FBE A;  1VK3 A;  1JNZ B;  4OZJ A;  3GIJ A;  4NLG A;  2Q3P A;  3JQK A;  3TW0 A;  1GMW D;  3MCS A;  3MMB A;  2XGP A;  4NXN F;  2DR8 A;  4MFB A;  1JJC B;  1G3O A;  2XCP A;  3MM6 B;  2AGO A;  1UTA A;  1QE1 B;  3UN3 A;  1T03 A;  1YJW S;  1S1V A;  3G8S A;  4F4Z A;  4OYA A;  2MHN A;  3V6K A;  1X5S A;  4DV3 J;  1KRP A;  1N56 A;  4OZ3 A;  4DEZ A;  4K4S A;  4QU7 A;  4HI1 A;  4RW4 B;  5ETP A;  2HIQ A;  2HMI A;  3HP6 A;  1FKO B;  4K4X A;  3TUJ C;  3I9Z A;  2WRM A;  3QAU A;  3PX6 A;  2XMW A;  4F04 B;  3KK3 A;  2JC0 A;  3WX8 A;  2X51 A;  2VON A;  1JLF B;  3T5H A;  1B64 A;  1KHV A;  1LXN A;  2EI5 A;  3GIM A;  3BGR B;  1OPI A;  1OY8 A;  1G1X A;  1FVS A;  2ZUG A;  3RJM B;  3ZNU A;  3H2L A;  4PUO A;  1EET A;  4A4J A;  1TAQ A;  2ZUA A;  2HGM A;  2KH9 A;  1RAH B;  3RR8 A;  2HZV A;  3CIZ A;  2FLL A;  2QLX A;  1SH2 A;  3H5Y A;  4FVC A;  4X4Q A;  3TA2 A;  1TV6 A;  4PCQ A;  1VHF A;  4DR4 J;  4ECW A;  3QFW A;  4LIW A;  3CJ0 A;  1U45 A;  1YDL A;  3ZFV A;  1FJG J;  3CPW R;  5LMN J;  3DXS X;  2ROP A;  4DXL A;  4IOB A;  5HRO A;  2K1R A;  1HNZ J;  2BAN B;  1B0V A;  2DNH A;  2LQJ A;  4IFV B;  3VQT A;  2KFZ A;  2UUC F;  2XMT A;  3BN4 A;  2B8P A;  1U2R A;  5IS2 A;  1DQ8 A;  1WDD A;  2P8I A;  2ACY A;  3KMS A;  2UXC J;  4NYP A;  4CM0 A;  3FBC A;  1NB2 A;  4OHX A;  3RZA A;  3JSM B;  4K0K F;  3R1H A;  4DN9 A;  3LWM A;  3OR1 A;  2B0G A;  4K4Z A;  3ZZR A;  4UZB A;  1SI9 A;  3A8E A;  1I94 F;  3AA8 A;  1VRU B;  1U1O A;  4JI5 F;  4PWD B;  3BRE A;  3TVK A;  4URS A;  1HWI A;  4XPE A;  3UFC X;  4G65 A;  2Z56 B;  3M30 A;  1PBU A;  1M5O C;  3Q8Q B;  2IVY A;  4A46 A;  2NYI A;  1CC7 A;  1HA1 A;  2F9D A;  2QL5 B;  2YPZ A;  3DXB A;  3KUE A;  1RAF B;  1R8A A;  4RUH A;  4NA2 A;  3QAT A;  4MKV A;  2OSR A;  1T11 A;  3VAG A;  2CPD A;  5FDL B;  4ENO A;  1U1K A;  3IR7 B;  2H3E B;  1RHM B;  3C6U A;  4F4W A;  4JV1 A;  2X1A A;  1Q8B A;  3D5M A;  2Y1J A;  3HT0 A;  3KYL A;  3IRW P;  4EYH B;  1JJ2 R;  2HHV A;  3TX0 A;  3OTD A;  4ZLP A;  5ADZ A;  1N6Q A;  4C98 A;  4M5G A;  2FJX A;  1LWE A;  2DBB A;  2UZA A;  2GGP A;  2ATL A;  3FBB A;  1JLB A;  1WSR A;  1OPZ A;  1PGZ A;  1UEU A;  1ZBT A;  4DSI A;  1DLO B;  3AQO A;  4K4T A;  2XMU A;  4J9V A;  3Q8P B;  3K5N A;  2VKR A;  4QW8 A;  2H5E A;  1XC9 A;  3RBD A;  1XEZ A;  4FYW B;  2QMW A;  1KKH A;  2HFV A;  1PYS B;  5F8G A;  1X4G A;  1RWW B;  4ZVT B;  1P27 B;  1QAY A;  1LK7 A;  4A8X A;  1P1L A;  2RDJ A;  4B17 A;  4CO3 A;  3ADA C;  1T94 A;  4N5S A;  1SC3 B;  3OTB A;  1EKS A;  4KTQ A;  1PAU B;  1JKH A;  3CCZ A;  2YNI A;  3FFI B;  5CA5 A;  3NCP A;  2RQM A;  4USK A;  4HKQ A;  4ANC A;  2NR0 A;  4DSJ A;  3H4D A;  3DDK A;  2D69 A;  4AQY J;  5DZ7 A;  3QYY A;  2FZC B;  1YK9 A;  3TAQ A;  2RSQ A;  1RLC L;  5IM0 B;  3OL8 A;  1WG4 A;  2DEI A;  2H51 B;  4X66 F;  1M1H A;  3AOD A;  2VF3 A;  1S6Q A;  1TK5 A;  1WWH A;  5AXK A;  3BN7 A;  3D2W A;  4I56 A;  5LL6 d;  2LCW A;  4OX9 F;  1D1U A;  4OV6 A;  4KO0 B;  1WEZ A;  3IFE A;  2FY1 A;  3MCO A;  3GII A;  4JV2 A;  2U1A A;  2ZOG A;  3FMW A;  5H9F K;  1FRL A;  3DCA A;  1NND A;  3Q8R B;  2A18 A;  1VQ8 S;  4IH5 A;  1YJV A;  2YXL A;  3CCV S;  3CCU S;  2F40 A;  1RTI B;  3L95 X;  2W9B A;  2H9Z A;  3AJ1 A;  1F1B B;  2PMH A;  4QU6 A;  5KFL A;  4OHV A;  2FVQ A;  1Q95 G;  4JB8 B;  1PC4 A;  5KFX A;  2GVD B;  3HHD A;  2HVI A;  1RI7 A;  5KG1 A;  1J27 A;  3AFG A;  3GG0 A;  5EWE A;  2BAC A;  4ES3 A;  3IWX A;  2GO8 A;  1NZ8 A;  5IWA J;  2XY5 A;  3IGV A;  4RUC A;  5JVH Q;  4DFM A;  2AYG A;  2ZFH A;  1H0H B;  1NLK L;  3E51 A;  2O5D A;  2A6M A;  1TL5 A;  1VGY A;  4A8S A;  2XS5 A;  2WVF A;  2QLF B;  5G0R A;  2DVI A;  2VQF F;  5SUH A;  1Y0H A;  1VRT B;  3D68 A;  2CA9 A;  3M2V A;  3CDW A;  3OPK A;  2NSC A;  1RT2 A;  4DL3 A;  2WON B;  2BA9 A;  3M6X A;  5IT4 A;  4J90 A;  2QYG A;  3J7A N;  1RTD B;  2JC1 A;  5F9L A;  1GK8 A;  1UJ4 A;  3CDB A;  3CJ2 A;  3JTN A;  5L1L A;  3ZZY A;  2DHA A;  4M63 A;  3UNY A;  3OJU A;  3CJ4 A;  3NP5 A;  1VLY A;  3M2R B;  2EPI A;  3PR5 B;  4X4R A;  5D0G A;  3PYF A;  2HHP A;  3EGV A;  2MZJ A;  2FIU A;  4IO9 Q;  2YKN A;  1DHM A;  2HVD A;  4DLE A;  3ENV A;  2GQC A;  2EBE A;  2GW8 A;  2YKP A;  4NI2 B;  1ZAX A;  2F7V A;  2Z2Y B;  4DF4 A;  2ERR A;  3A3O B;  1N34 F;  4GKJ F;  2VDI A;  5A6P A;  4NPO A;  2G0C A;  1RAE B;  2NLW A;  4YY3 J;  1ZM9 A;  5J1E A;  2NUU G;  2CQD A;  2AX1 A;  4U95 A;  3C6T A;  2QFI A;  4DS5 A;  1RAO A;  1VBZ A;  3N01 A;  2P9C A;  4B9N A;  3OL6 A;  2PI4 A;  3ET6 B;  4C6A A;  2DRD A;  4N77 A;  2B7B B;  4JBC A;  1V9O A;  4YFU A;  5IQQ A;  4IYQ A;  2MHE A;  2KDO A;  4ED4 A;  3AAW B;  2ZVI A;  2MPU A;  1XMQ F;  4B3T J;  1TVR A;  4F02 A;  4HR2 A;  3LP2 A;  3Q83 A;  1WEY A;  3QGI A;  5ETR A;  3NCQ A;  5C2G A;  3M8P A;  3RAM A;  1TKZ A;  4CLP A;  3ILL A;  3MEK A;  3AOC A;  1BWV A;  4V19 X;  4PG5 A;  4N56 A;  2B9Y A;  1Z1Z A;  2MZR A;  3OFH A;  4AD6 A;  4LVO P;  5A8K B;  3AT1 B;  3E8O A;  4I7F B;  3WIV A;  2VPY B;  1HI8 A;  2O66 A;  1QUP A;  3VHQ A;  4UQG A;  4BC7 A;  4DDF A;  1FRK A;  1SV5 B;  1FWK A;  4PZV A;  4DS4 A;  2D3O R;  2UVU A;  2W7A A;  1NJX A;  3DM2 B;  2FD2 A;  4RUA A;  4DFP A;  4C0B A;  1RWV B;  5KG6 A;  4ZIT A;  3D7S B;  4ED6 A;  5L9N A;  3I6P A;  3AOA A;  1AUD A;  3EGN A;  4OJ3 A;  4ELT A;  3FC9 A;  1APS A;  2OKQ A;  1F2G A;  1QSL A;  2F4V F;  2HRT A;  3NWG A;  1WKK A;  2ZEJ A;  1S1U A;  1FF2 A;  1U0H A;  5HLF B;  1SC1 B;  4AXJ A;  2DGT A;  3RW7 A;  2R7Q A;  2CJQ A;  4CWB A;  1GNK A;  2AW0 A;  5KT6 A;  3C66 A;  3HHL D;  5J2P A;  3RRG A;  1MW7 A;  3IA0 A;  3DOM A;  2YNF B;  4TU8 A;  4IFY A;  4B08 A;  2BJ7 A;  5E33 A;  1V5I B;  2RD5 C;  2GO9 A;  1UA1 A;  1X9W A;  2JEI A;  2B9E A;  2IYI A;  5E41 A;  2M0G B;  1IUJ A;  3CJ5 A;  3DYA A;  1S6U A;  4ERD A;  1E6V A;  3KK1 B;  4KPC A;  3J7A 1;  1Z2L A;  3C14 A;  1HNV B;  2HNZ A;  3OFE A;  5CYM A;  4B3R F;  1JJH A;  1IKY B;  4OZ1 A;  4HLB A;  5LMN F;  1D9F A;  2HHT A;  2EFV A;  2EKY A;  2M9K A;  2VA3 A;  4WFN Q;  3V81 A;  4X4S A;  1VYA A;  2JSX A;  4ID5 A;  2VQE F;  4P2S A;  1NK6 A;  1VC0 A;  2I9S A;  2C3P A;  3NCR A;  3CF5 Q;  2R8J A;  3GFZ A;  3M8Q A;  3DRS B;  1S1W B;  4DUZ F;  2UXC F;  2EK1 A;  4I1T A;  3VVT A;  4ER8 A;  3PO4 A;  3KUH A;  1HQE A;  3WQP A;  4PQU B;  3SQG A;  3TEH B;  2BKN A;  3FNN A;  2ZHB A;  4JV5 J;  2JDJ A;  1TKX A;  3CDA A;  2DCL A;  2K7J A;  1PSD A;  3DMJ A;  5ETO A;  1UWB A;  2K2P A;  3BSC A;  2AJQ A;  3IS9 A;  2HVZ A;  1VQS A;  4ZVS B;  1JLE A;  3HVT B;  5B0D A;  2HHW A;  4TU7 A;  4LRA A;  1RTJ A;  1WDT A;  3GLJ A;  3MTK A;  3V4I A;  4Z7C A;  4KR0 B;  2V8G A;  3TZX A;  4F7V A;  3QZ8 A;  4QWB A;  3BQ1 A;  4OI6 A;  2DGX A;  3LP1 B;  1X8D A;  1HW8 A;  1UFW A;  2XZT B;  1RQ0 A;  3HD1 A;  1TL4 A;  1NHK L;  3CCJ S;  3FCV A;  1CS4 B;  7AT1 B;  4PG6 A;  2LVW A;  4YR2 A;  1GT8 A;  3E01 A;  1UP1 A;  3GQC A;  1TFW A;  3DHW C;  3W2V B;  3GFY A;  2CJK A;  2MSS A;  2XZW A;  2RHQ B;  2E1A A;  1T05 A;  4WTY A;  4MYT A;  2M3D A;  1DTQ B;  1PKU A;  5GMD A;  4OL8 A;  5B0G A;  3B4D A;  3RBX A;  1NJY A;  3DI6 A;  3CTR A;  2VOP A;  1H2T Z;  1R6Y A;  4DR2 J;  1S97 A;  3GSI A;  3O5T B;  1L3V A;  4N76 A;  4CO5 A;  4DR6 F;  2HW3 A;  2BW7 A;  3D6H B;  1S6P B;  4Q2L A;  1NAQ A;  1S10 A;  1D0E A;  3BF4 A;  3DLK A;  5KAK A;  2R2R A;  4F4A A;  3UR3 C;  4AQY F;  2XGQ A;  4RX6 A;  3MM5 B;  2WB4 A;  2YY3 A;  4DL7 A;  2XM3 A;  4C11 B;  4XDD A;  4OYO A;  1HW9 A;  2MKJ A;  3GYG A;  3W5Y A;  2UVW A;  1FD8 A;  3I5B A;  3PW7 A;  1M90 T;  2J8A A;  4FYX B;  3UI3 A;  2ZH7 A;  3GCX P;  4CLF A;  2AU0 A;  3QT5 A;  1ACM B;  3UDV A;  2HPU A;  1O6X A;  4FF3 A;  1HPZ B;  4KFB A;  2R2U A;  4WP8 A;  3FK4 A;  1H98 A;  1YG0 A;  2L08 A;  1NPK A;  4ICL A;  1RBL A;  3OSP A;  3MCM A;  4PYA A;  3DRP A;  1PC5 A;  2PI5 A;  1BQX A;  4DQI A;  3A12 A;  3IG1 B;  1LXJ A;  2VG5 B;  1U0S A;  3VAJ A;  1DTT A;  1E6Y B;  3TEG A;  3TOQ A;  2CNL B;  4CH0 S;  3QRP A;  2VPZ B;  4DU7 A;  1U8W A;  3OXF A;  3RRK A;  2VC0 A;  1B7F A;  2UUB F;  2CPE A;  3Q2S C;  2JX2 A;  1F5B A;  1FWL A;  1B7Y B;  5KFJ A;  3SMZ A;  3KLF A;  4W92 B;  4NLS A;  2OPS A;  3KK2 B;  3NNH A;  1R31 A;  3E2E A;  4EWT A;  1FER A;  3NXZ A;  4OJH A;  2FVC A;  2R7T A;  4J9P A;  2B6A B;  3KG1 A;  3THV A;  2OPP A;  3H20 A;  2C2R A;  4DZ6 A;  5A76 A;  3QSY B;  3M7V A;  1FEE A;  3ZZZ A;  3D54 A;  9RUB A;  3ZZO A;  1WF1 A;  3CCQ S;  4DV6 F;  1VHI A;  3FSX A;  1F60 B;  5SZT A;  1QY7 A;  1UA0 A;  4OJ1 A;  3KLH A;  4DPO A;  5L1K A;  3DRX A;  4EBE A;  2GJ2 A;  1Q8K A;  3FEX B;  2BOA A;  5DRK A;  2OML A;  2HFO A;  4ATN A;  3D6F B;  4R5P B;  4DV1 J;  4U9R A;  3R6G B;  1VK8 A;  4LBP A;  4JI4 J;  4O3Q A;  5AJ3 J;  1PIE A;  2FVS A;  1UPM B;  3POT B;  1LWC B;  5I3Q A;  1RT4 B;  2GMJ A;  3TAR A;  1C4C A;  1R43 A;  5LXY A;  1S4F A;  4HT7 A;  1YJU A;  2YX1 A;  4B3S J;  2ATC B;  4OI0 A;  4FYD A;  3LP0 A;  3B8H A;  4NXM F;  2DNG A;  2P6T A;  1EP4 A;  1WEL A;  2HLT A;  2WW4 A;  2EFQ A;  3ELH A;  4F0M A;  2K3K A;  4ZHR A;  1NPP A;  2E29 A;  4OZL A;  3M2U B;  5LMU J;  4FBU A;  4O3S A;  1N36 F;  3GJS B;  2DR5 A;  3WX4 A;  1RAD B;  3DLE A;  3GON A;  4M5M A;  3HMJ G;  2JEF A;  2VV5 A;  5C42 B;  4JP8 A;  2WBR A;  2UUA J;  1TL3 B;  2AEJ A;  4CTA B;  1DAX A;  1RKJ A;  1RT3 B;  4K4V A;  1SKS A;  1VQK S;  3BR8 A;  5HJY A;  1F9F A;  2BEF A;  1G6B A;  4ILR A;  5C7P A;  1K44 A;  3T9Z A;  2B4V A;  4QIE A;  2F4F A;  4EEY A;  2C3M A;  2RDI A;  4WFY A;  4G1I A;  1QD1 A;  2CDQ A;  1AT1 B;  4FXD A;  1WHV A;  3BJY A;  4OQJ A;  4LFA F;  4KY3 A;  4EMD A;  2L9N A;  4M94 A;  5A8R A;  5DQH A;  2E1M C;  4O3R A;  5HVG A;  4LF8 F;  4HTI A;  1TV6 B;  1MWQ A;  2CVI A;  2A2C A;  2D9P A;  1CJU B;  4LF4 F;  3MEG B;  2J6S A;  3QO9 B;  5KT7 A;  1QAI A;  4K5R A;  2WAQ D;  2MQ8 A;  1HBM B;  1NK7 A;  1LW2 B;  1X60 A;  1KP6 A;  3H0P A;  3A3N B;  2XY6 A;  4EO8 A;  4H4M A;  4ZPD A;  3K89 A;  4FZV A;  3OW2 R;  2XB2 D;  4DUY F;  2HS3 A;  1L3U A;  1EHW A;  2HQC A;  4QIF A;  3VQS A;  4OYX A;  4L72 B;  2D1C A;  5GAH I;  3AY0 A;  3W8G A;  4YR0 A;  4NA1 A;  4J9O A;  3NBP B;  3FGV A;  3K5L A;  2X3G A;  3R8Y A;  1SPB P;  5E3R A;  1N33 J;  1GMW A;  3LF0 A;  2ZE2 A;  2ZD1 A;  2UUW A;  3QID A;  5M2R A;  1N54 B;  1UWA A;  1R8C A;  3J7Z 5;  2JLG A;  2XI3 A;  2ASL A;  2O3D A;  4WYL A;  2N7Y A;  3PVX A;  1DAR A;  3QAE A;  2F8M A;  2OEM A;  2PFD A;  4C48 A;  3CMQ A;  2XO6 A;  1VQ5 S;  1TKT A;  4KV8 B;  4CT9 A;  4ZVP B;  1C1B B;  4K5S A;  1BQM B;  2Y8Y A;  1S7H A;  3SDE A;  3U7J A;  3CDU A;  2OAU A;  5I42 B;  1OS5 A;  4B3M F;  4A8F A;  2ZJR Q;  2CQH A;  3CUN A;  3T6B A;  2MTL A;  3FSY A;  1HBN B;  3RUB L;  3CT9 A;  1R89 A;  4Q0B A;  1H72 C;  2BYC A;  1RYS A;  6AT1 B;  1CUL B;  2H65 B;  1T9X A;  2VUG A;  4ED7 A;  1WG1 A;  4LR7 A;  1T02 A;  2CPI A;  2DHS A;  2HAI A;  5E5N A;  4YN3 B;  1KS2 A;  4P71 A;  1KOH A;  4DQR A;  2XSF A;  1BQN A;  2BW2 A;  4CP5 A;  3CC2 S;  1XNQ J;  2Z4P A;  2IMO A;  1HWJ A;  3JQJ A;  2DNK A;  1SKR A;  1XN9 A;  3MMJ A;  1U26 A;  2BRL A;  2XNR A;  3P49 B;  3JTO A;  4L75 A;  1XER A;  2AEM A;  2DNM A;  2GAH C;  1Y7P A;  5J2Q B;  1KN6 A;  5DM7 Q;  1DY3 A;  2A2D A;  3HSJ A;  4LUB A;  3OBI A;  1WHY A;  2UP1 A;  4ZK7 M;  2YQ0 A;  2UV8 A;  4PPD A;  3M9M B;  4PAB A;  3MFI A;  2PT0 A;  3NS5 A;  1VC6 A;  3M6W A;  1RT5 B;  1YWX A;  1SVD A;  1B3T A;  3MEC A;  3M1V A;  1S6Q B;  2RIL A;  3HHK A;  2QA4 S;  3EJM A;  4TLQ A;  2YWH A;  5IT0 A;  3DRY A;  4MTP A;  2ABY A;  3TQ1 A;  2M8D B;  3CJS A;  2W4C A;  1QM9 A;  3SEO A;  3PYD A;  1D8Z A;  5FII A;  4DPW A;  3SZ2 A;  2RQK A;  4DV0 J;  7FD1 A;  3N79 A;  5CQG A;  1Q1K A;  2Z2L A;  4G1Q A;  1UVM A;  1FXL A;  1S76 D;  3M9O B;  2MZQ A;  5JXS A;  2MKK A;  4M5D A;  2ZDP A;  2JEG A;  1RAC B;  1UZD A;  3UW1 A;  1GTH A;  4CNY A;  2OUG A;  3W5Z A;  3OJS A;  5HK4 A;  1FES A;  1HI0 P;  3DU5 A;  2GNK A;  2XHC A;  4F3O A;  2IM1 A;  5EN1 A;  3PKY A;  2ZDO A;  2AJ1 A;  4U6P A;  2LA4 A;  4JI0 F;  2DH9 A;  2MDA A;  1FX2 A;  1ROF A;  3PRB A;  1LQ9 A;  3G86 A;  5IZH A;  2E66 A;  4RW6 A;  4EBC A;  4NLO A;  4ZCL A;  5K8O A;  2ZKU A;  3BPD A;  2DY9 A;  3I0R B;  3L7O A;  3MUV P;  2YX4 A;  2EW9 A;  1WC1 A;  2KB2 A;  4JV0 A;  4U8Y A;  4OLO A;  5J1N A;  3R6L B;  1GMU A;  3LW5 C;  1X5T A;  4O3O A;  3CD6 S;  4J9K A;  1S6O A;  2BE2 A;  4BDP A;  2VFV A;  3B82 A;  1TMM A;  4F8R A;  1CJK A;  1SC4 B;  4LQ9 A;  1NSA A;  3J81 j;  3KG0 A;  2POK A;  5KFV A;  4R0J A;  1NJZ A;  4KHP J;  2BQU A;  1FWP A;  3PO5 A;  2HFS A;  4ZN1 A;  1I6J A;  1X4B A;  1EB0 A;  2Q6C A;  1I5O B;  4MH8 A;  2BM1 A;  5H9F J;  3PW5 A;  1RT7 B;  5J2N A;  1DZ5 A;  1XK8 A;  2QYC A;  3CNQ P;  5L8R C;  1VQY A;  3MMA B;  3HVR A;  4OHY A;  2EWH A;  3N4W A;  2GJI A;  1NBE B;  4ZCM A;  1RTH B;  4X62 F;  2XMV A;  4LR8 A;  4LSN B;  3K17 A;  3PJW A;  2H54 B;  4PXE A;  3QJP A;  5D3G A;  1AFJ A;  4WE1 A;  3V2U C;  4AL5 A;  1BMQ B;  2HNY A;  4HTJ A;  1LFP A;  4X4O A;  4IDK A;  4M5I A;  4FF2 A;  1NU4 A;  4J37 A;  1AA1 B;  3QJJ A;  1NRK A;  3K5P A;  2H1Y A;  1NH7 A;  1N8R T;  3R5A A;  4RNH A;  3OR2 A;  2C28 A;  4OIX A;  2DJW A;  1SB6 A;  2YWE A;  2CQG A;  5AJ3 F;  2NZC A;  3M8P B;  5EX3 A;  4KKO A;  4CH7 A;  2A3J A;  2MEW A;  3O2I A;  1WTF A;  4HL9 A;  4B3S F;  2D3O 1;  4NCB A;  2E1R A;  4EZ9 A;  3GR0 A;  3G87 A;  3PW2 A;  4BCA A;  5DDO C;  2EG2 A;  3ZO7 A;  2GX8 A;  2P9E A;  1HNX J;  2XMJ A;  5C25 A;  3RB3 A;  4WPA A;  1SJQ A;  5DZ6 A;  3CC4 S;  4DL6 A;  5LMU F;  3BH7 B;  2V9K A;  3C15 B;  3CVK A;  2XLJ A;  1RAG B;  3SBM A;  3DLG B;  3C19 A;  2HUR A;  2Q43 A;  4AXI A;  2ZH8 A;  3G82 B;  3PZP A;  1KWM A;  4ZCK A;  3NLC A;  3HHE A;  2ROG A;  2GV1 A;  4ILL A;  4P2M A;  1DQ9 A;  2OPQ A;  3W2W B;  3CC7 S;  1U0H B;  1KQG B;  3SCJ E;  3OVS A;  4BLG A;  2PEB A;  3C3L A;  3EX7 B;  3CIM A;  4OHZ A;  2LFV A;  2DNO A;  4JI8 J;  1OQ3 A;  2BM0 A;  3JS9 A;  2QJ3 A;  3W9J A;  4LMZ A;  1Q16 B;  4DR7 J;  3U1M A;  3KJV B;  2V50 A;  4OYB A;  5LM7 E;  2C2N A;  3CD0 A;  2HS0 A;  3JTP A;  3BQ2 A;  2MLZ A;  1Y3J A;  2BJE A;  2YNG B;  4M5K A;  2HZA A;  3R7B B;  2F9J A;  5LSO A;  2ZBP A;  1S0N A;  1RK8 A;  3BH6 B;  2UV8 G;  1IWG A;  1MLA A;  4ZVH A;  4HAC A;  2F63 A;  1S9E B;  4QPX A;  3ZTP A;  3AQP A;  3QLH A;  3QJL A;  3Q24 A;  2W8L A;  1YIT S;  1HBU A;  1PG5 B;  2QA2 A;  4NRU A;  1C1C A;  1X0F A;  2R7X A;  2ACM A;  4S0M A;  3PEJ A;  3OL9 A;  1LOU A;  4H54 A;  2ZWP A;  1WC5 A;  4GKK F;  4M5N A;  3GYN A;  5M2U A;  3WIU A;  3HKW A;  2H5J B;  1HHQ A;  4ZIV A;  1MWY A;  2GZO A;  2RHS B;  4NCG A;  1A9N B;  4ZVU B;  3GU0 A;  2AKW B;  1IBM J;  5I4M A;  3PG9 A;  5AXM A;  1HBO A;  2GQ2 A;  3Q23 A;  2W9A A;  1PYT A;  3FZB A;  2RE1 A;  4OI3 A;  1IKX A;  3LGN A;  1XJW B;  3KWM A;  2FTR A;  2WZ1 A;  3IS9 B;  5K9F A;  4CO2 A;  1XWL A;  1ZS6 A;  5D4N A;  1YBU A;  1RTJ B;  2IDL A;  2CYY A;  2GIQ A;  3ILJ A;  2XS2 A;  1KBR A;  4D3G A;  3HFV A;  4G3I A;  1UFL A;  4HH0 A;  2PDA A;  1U4B A;  4KB7 A;  1C4A A;  3EXC X;  3OQ2 A;  3QNW B;  1VJW A;  5HN0 A;  3ICL A;  4ECV A;  2HHQ A;  2Z57 B;  4C2M A;  3PCO B;  4QWD A;  5CCL A;  3HHL A;  1OMS A;  2PA8 D;  2G9O A;  1SQG A;  2ZH1 A;  5KT2 A;  2WW8 A;  1S0M A;  4ECS A;  1VBK A;  2HND A;  4NXN J;  3A3P B;  3TNV A;  1FKP A;  1JWW A;  1ZZN A;  2VG6 A;  3TR5 A;  3QRR A;  1FXR A;  1OSD A;  1W25 A;  4C9D A;  1TUW A;  2B4P A;  2W4D A;  3P5T L;  2BJ3 A;  2C2K B;  5D4L A;  5D0H A;  2QA1 A;  1XNQ F;  3AJD A;  1MNE A;  4OX8 A;  1S57 A;  5JVG Q;  1OSC A;  4YR3 A;  4AND A;  2WTF A;  2A6O A;  4WU3 A;  2J9D A;  1ZPW X;  3R27 A;  1IR1 A;  1VQN S;  1MRO A;  4ZP6 A;  2BMB A;  1UKU A;  1S0O A;  5DLF A;  4WF9 Q;  1JXV A;  2ZZM A;  2IYG A;  5E2Q A;  4MK7 A;  4DCO B;  4PR6 A;  3GFX A;  4IG0 B;  5C2C A;  4PWW A;  1F9H A;  4CI0 B;  1EQ0 A;  3HD2 A;  4Z37 A;  4YP3 A;  2B5J B;  1KVJ A;  2RQ4 A;  3JQM A;  2IPO B;  4WIQ A;  3W63 A;  2J9C A;  2CQC A;  4RNN A;  4O0I A;  2RF2 A;  4KFB B;  3BKU A;  3K0J A;  1K1S A;  2XWX A;  3L3C A;  3X3U A;  4X64 F;  1BY9 A;  3W3S A;  2R7R A;  3OV7 A;  3DOL A;  4HHJ A;  4F25 A;  1SL1 A;  2R2S A;  3IP0 A;  3NEK A;  1NSP A;  3TAM B;  4DV0 F;  1DTT B;  2Z0G A;  2BE9 B;  2V4Q A;  4MIB A;  3D28 A;  4J9Q A;  2V2K A;  5F41 A;  3MHY A;  4HDH A;  4Z7Y A;  4NLD A;  2RRA A;  2DRB A;  2J8S A;  2HQ3 A;  5EWF A;  1R27 B;  2V8P A;  3P5B P;  1S59 A;  1LW0 A;  2XLK A;  1SUQ B;  4JI7 F;  5I3U B;  3S01 A;  2J6T A;  3I56 S;  4DSL A;  4QCL A;  1FDB A;  1QVF R;  1K1Q A;  8ATC B;  3TQE A;  4K0K J;  4DL4 A;  1CJV B;  3ITH B;  2DD8 S;  1WOR A;  4DX8 H;  3T5J A;  4IOC Q;  3QRQ A;  4ZCI A;  1YTY A;  1JXL A;  2XSJ B;  4JI5 J;  3CCE S;  3KLG A;  2NUH A;  3FRY A;  1S1X B;  3PNI A;  3RR7 A;  4MK9 A;  1ELO A;  5ETT A;  4RBU A;  2ZJP Q;  4P2X A;  2AJ2 A;  4LRD A;  2RH3 A;  5AT1 B;  4LIR A;  3KOA A;  2Z2M A;  4KHP F;  1HYS B;  1TKD A;  3QIP B;  1WKL A;  1RCO B;  2D41 A;  1CSJ A;  2NXE A;  3M8Z A;  4FNH A;  1FJ7 A;  4I68 A;  5C24 A;  4IG3 B;  1TL7 A;  3VGS A;  3NGK A;  2MY7 A;  2WCX A;  4YME A;  4NLR A;  4RW7 B;  2IMW P;  2GAG C;  4XAK A;  3EWG A;  2QGF B;  4Y28 C;  5KFP A;  1FA0 A;  4DL2 A;  4DJB A;  4KRW A;  3FKB A;  4NLY A;  2MQL A;  2HFN A;  3KJF B;  1RWX B;  4ZN3 A;  1VC5 A;  4GVB A;  2O1P A;  4O4G B;  3NS7 B;  1KNZ A;  1FK9 A;  2GJF A;  1ICE B;  2IAJ B;  4F36 A;  3UN5 A;  1JLC B;  1Y10 A;  3KJQ B;  1X9M A;  5CYQ A;  3ETM A;  2M5Y A;  2IBO A;  3NY0 A;  1AB8 A;  2OO4 A;  1WI6 A;  2KVI A;  5HQL A;  1RAB B;  4YDD B;  2SXL A;  3ISN D;  2FLN A;  3FJ2 A;  4AL7 A;  4F0K A;  1R0A B;  2IC3 B;  1OY6 A;  4J9S A;  1RT1 B;  3ETO A;  3D1H A;  3N28 A;  4C8Z A;  2HBR B;  1CJT B;  1RAJ A;  2WVC A;  4X66 J;  3TZZ A;  4RZR A;  3CJT A;  4FKX A;  3DOK A;  4CLS A;  5CHC B;  5CD4 A;  2I1R A;  2CG8 A;  3MM8 B;  3I5A A;  4YDX A;  4OZ0 A;  2VPX B;  4DPU A;  1RA7 A;  3O6Q A;  4M5J A;  2FLO A;  4MIA A;  1HNI A;  2MST A;  3H8Y A;  5IC6 B;  2CKW A;  3AD8 C;  4LT6 A;  4ZMM A;  1U02 A;  4UF4 A;  2AGP A;  2ZH4 A;  4USI A;  4FYV B;  3J80 Y;  3IRX B;  3BO4 A;  3F56 A;  4H4M B;  2AQ4 A;  5KG2 A;  3GV8 B;  1YJT A;  2NPF A;  2VHG A;  2EC2 A;  5LSR A;  4PQA A;  2V2Q A;  4J7C A;  2DNY A;  3GWC A;  1KLN A;  1U1L A;  2HG4 A;  1NK5 A;  2AJ4 A;  2E5L J;  1FO1 A;  3T3F A;  3P4U B;  1N0V C;  3C8Y A;  4WXW A;  1TL1 B;  1SC6 A;  3GMG A;  3BSA A;  3IGN A;  1M0S A;  1CC8 A;  4M1K A;  3G8Q A;  1C0U B;  4FXW A;  5FLX U;  1Q86 T;  1S7I A;  3US5 A;  4ETZ A;  2DT9 A;  5ETL A;  1DJ0 A;  4B3O A;  1RWM B;  4RNF A;  3HFZ B;  1SH3 A;  5HVH A;  2IA0 A;  4RLE A;  1RTZ A;  2VQF J;  2MQN A;  2V67 A;  4FKY A;  1YX2 A;  5ETS A;  5DQI A;  2EFO A;  3OUY A;  1HWU A;  3G96 A;  1ZM3 A;  1KVK A;  4ED8 A;  1S1T A;  3M32 B;  2FUG 9;  3TJA A;  1EIY B;  4JOU A;  5FJ4 A;  4HDG A;  2CQ3 A;  3H5X A;  4C8L A;  2G2Z A;  3VTI A;  2OPR A;  3X1L B;  2KM8 C;  3RTV A;  3KLI B;  1YJN S;  1FT8 A;  3KLE B;  3I55 S;  2EKN A;  3H2V E;  1GMV A;  1AZS A;  1DBD A;  1UL3 A;  4DG1 A;  3EVM A;  3UCG A;  1NO8 A;  2NRE A;  4DU8 A;  1P1T A;  3U27 A;  2HAF A;  2AJ0 A;  2KZM A;  1F5C A;  1YGY A;  2BKO A;  4TKT A;  4IR9 A;  1AW0 A;  1N34 J;  4G6V B;  2W01 A;  5B0F A;  3D0G E;  4QYZ K;  2LKZ A;  1ZM4 A;  3MM6 A;  1BWE A;  3KMQ A;  1QE1 A;  3SCL E;  4EGL A;  2ROE A;  3JAM U;  3EPG A;  3CJK B;  1KFD A;  1IBC B;  2Y1I A;  3MED B;  2ZKT A;  3BR9 A;  4RNM A;  4B9S A;  1HMV B;  4CLT A;  5GAD U;  2KG0 A;  2XI2 A;  5F8H A;  3AD9 C;  4RW4 A;  3MGJ A;  1FKO A;  3QQC D;  2OD6 A;  2DXF A;  4IO1 A;  3J7Y U;  1HD0 A;  3TUZ C;  2AMC B;  2YNH B;  3MUR P;  1RWK B;  4PEO A;  3IC1 A;  2R7O A;  1KLM B;  4QW9 A;  5F8J A;  3OTC A;  1XMQ J;  1JLF A;  4OLP A;  3B6B A;  3NS6 A;  3OT9 A;  2K06 A;  4NRT A;  3RG6 A;  4QIG A;  3IR6 B;  2UVR A;  2JNJ A;  1MG7 A;  4KHR A;  3PW4 A;  5E7O B;  2IM2 A;  1VIS A;  2GVZ B;  4FF4 A;  5IV4 A;  4LJM A;  3UD5 A;  1ZH5 A;  3SFU A;  3S8S A;  4P7T A;  2MKY A;  3TRG A;  1KHW A;  4LF1 A;  1NUE A;  3EZO A;  1SL0 A;  2BUN A;  4NAS A;  4WK1 A;  4P72 A;  1PIL A;  4K50 A;  1WC0 A;  5LJ5 Y;  1VQO S;  1NEE A;  2AZ1 A;  2CNO B;  1N88 A;  5BR8 F;  3T6J A;  2NS1 B;  3N9U C;  4C3K A;  1ZPV A;  5KG3 A;  2AD9 A;  3WC2 A;  2H4W B;  1TZ0 A;  3Q0A A;  2BOP A;  1YBA A;  1N5V A;  4A8M P;  1FNX H;  2MZT A;  4MJK A;  2BJ1 A;  2BAN A;  1R7I A;  1V5V A;  4JI1 F;  3NWR A;  3MDF A;  4IFV A;  2AYE A;  2KI2 A;  2F4V J;  1UET A;  1MML A;  1JLA B;  4LF6 F;  2CJA A;  2B4O A;  2YTC A;  1GX5 A;  4E8U A;  1M5P C;  2L3M A;  5J2M B;  1FTR A;  3TI0 A;  1S4E A;  1VQM S;  1WF2 A;  3ZZP A;  2B56 A;  1AXQ A;  1RT6 B;  4TY8 B;  2VDH A;  1PYO B;  4H4O B;  1Q8I A;  2NYH A;  1U2F A;  3LGH A;  2CZ4 A;  2EK6 A;  2FC9 A;  1VRU A;  4PWD A;  4Q7A A;  2QX0 A;  2Q66 A;  2V8D A;  4OV1 A;  1IKV B;  2ADB A;  1RZM A;  4CDI A;  5L1I A;  4TY9 A;  2GCF A;  2FB0 A;  5LSL A;  4JI3 F;  4DWI A;  4B3R J;  4FS1 A;  2QL7 B;  4Q2M A;  4ZVE A;  4B9V A;  2EG1 A;  2ZVS A;  2VQE J;  2C1E B;  4U7U K;  2WVD A;  2GFF A;  4QOT A;  4L74 A;  1L3S A;  3GSD A;  3FDS A;  2R8I A;  3CJQ A;  3FQL A;  5CD4 H;  4DUZ J;  5E3P A;  3TA0 A;  3RAQ A;  3D0H E;  1KC8 T;  2Q1L A;  4ED0 A;  3CDE A;  4FPI A;  1NJI T;  3HJF A;  1N4L A;  1RAI B;  3HKZ D;  4QPT A;  3M8Y A;  1DLO A;  5KFW A;  5KT3 A;  1IQT A;  2LEA A;  2V4R A;  3EIC A;  1ULR A;  1Y3K A;  3T1A A;  4D3H A;  2BZ2 A;  2XUL A;  4CYU B;  2LDY A;  2U2F A;  1LV5 A;  5A0Y B;  2LQ9 A;  3K57 A;  2HWT A;  3VV2 B;  4OI1 A;  3TAP A;  3C16 B;  3GR1 A;  4KYZ A;  4Y2K A;  2BJ9 A;  1KR4 A;  1R8B A;  4MKA A;  2XCA A;  4TN2 A;  1D9A A;  5KFK A;  1RDR A;  4MMO A;  3FFI A;  2C3Y A;  2Y1L B;  2FY8 A;  3F0N A;  2GMH A;  2KT5 A;  2KYZ A;  1T7P A;  1ZAW A;  5D4P A;  2QEX S;  3SFG A;  3KNG A;  5KOX A;  1VJQ A;  2IA6 A;  4DV5 F;  3ZTR A;  5IM0 A;  5DET A;  3GJT B;  3FVY A;  3HZE A;  3GFH A;  3GP9 A;  4X4P A;  2HHS A;  1W2I A;  3JYT B;  1QTN B;  1SJR A;  2E7W A;  4AYB D;  4ZPV R;  4RW8 B;  2A0F B;  4A8Y A;  2C42 A;  2K8G A;  4M95 A;  4KO0 A;  4TQS A;  1T95 A;  3UN2 A;  1N52 B;  4XTT A;  3BO3 A;  2AYM A;  2MY8 A;  3TUI C;  2P5V A;  4LSL B;  1VOM A;  2VD3 A;  2V6A A;  1REV B;  3OTE A;  2BAB A;  4IH7 A;  4F26 A;  2JH3 A;  1YIJ S;  2Z58 B;  2QFJ A;  1RTI A;  5D78 A;  4NWB A;  4DR6 J;  2WB1 D;  1JLQ B;  3CUL A;  3FEY B;  5HL7 Q;  3V6D B;  2HVE A;  3DFE A;  2W9C B;  1BXN A;  2FVR A;  4JUZ A;  4DL0 C;  1DFD A;  1KEK A;  3G2X A;  3EZU A;  4FPR A;  3PY8 A;  2I5J B;  2E5J A;  4OX7 A;  5DO2 A;  4NX9 A;  5IC4 B;  2JRS A;  2QL9 B;  3UDE A;  4AE5 A;  1BC6 A;  4KAI A;  4WZM A;  5DM6 Q;  5HBM B;  1NK4 A;  1W2B R;  1HR0 J;  5KG4 A;  5F9N A;  3Q22 A;  5KFG A;  1VBY A;  1JJ4 A;  2GML A;  1TMJ A;  1VRT A;  3QFH A;  1X4D A;  3J81 Y;  5A2Q Y;  1FTC A;  3I4P A;  1S79 A;  2WON A;  3HM9 A;  4C8Y A;  1RTD A;  2HYI B;  4IOA Q;  4J9L A;  1O8B A;  2DCU B;  4IRD A;  3W5X A;  4E0D A;  3S1T A;  4NML A;  3D6T B;  3C46 A;  4L76 A;  3ONQ A;  3M2R A;  1S9F A;  2UUB J;  1NSK L;  1RYR A;  4NCA A;  3EUN A;  2E5L F;  2IIH A;  2V8V A;  2NPI A;  2W7P A;  2XZD B;  2VBX A;  5A6W A;  1ZA2 B;  2B9W A;  1FRX A;  5HAT A;  3LQV A;  3H25 A;  4P74 A;  4NI2 A;  1FI4 A;  3BGF A;  3NGU A;  1VBX A;  2Y8W A;  2CJX B;  2XMK A;  5M2P A;  4LRF A;  2HFZ A;  1C0T B;  3FCW A;  3W60 A;  2HZC A;  1Y4Z B;  2G13 A;  3FBF A;  5HP1 B;  2IRY A;  3SIP B;  4DV6 J;  4ZIW A;  1M5S A;  2IM3 A;  4FBT A;  2R7U A;  4BBY A;  4CLY A;  2ZC3 A;  3OSN A;  3G71 S;  3H98 A;  5F8M A;  2WBM A;  1QLN A;  3CO9 A;  3ET6 A;  1SCJ B;  1X9S A;  2V4J B;  2MGZ B;  2XS7 A;  3H2U B;  3CJ3 A;  1A0O B;  1BUX A;  4ED3 A;  1QDU B;  1IKW B;  2HHX A;  2V9W A;  4IRK A;  3CJR A;  2I6W A;  5B09 A;  4RU2 A;  3D0I E;  3Q86 A;  4ZVF A;  2QLB B;  2E7X A;  5DGB A;  3MXH P;  4NXM J;  3DKD A;  3GG1 A;  4NE9 C;  5CH7 B;  1I3O B;  2WVB A;  1Q79 A;  4UTG A;  5BYS A;  1KQK A;  1LWF B;  2WSC C;  2WSE C;  5E0O A;  3ZZ0 A;  1QAJ A;  2G0J A;  2HVH A;  2XY7 A;  2WOM B;  4YHH F;  1QAX A;  5A8K A;  2E1C A;  3O3L A;  4I7F A;  1N36 J;  3RAX A;  3PEH A;  4K8R A;  5KFR A;  1WAC A;  1SV5 A;  3G6V A;  3BKF A;  2QZ8 A;  2LXI A;  3KKF A;  2I0X A;  4I6A A;  4DX7 A;  4FYY B;  3DM2 A;  1UEV A;  3RRH A;  4JI6 J;  3GYX B;  2AEF A;  5L9X A;  4LF5 F;  1EJ7 L;  3HPO A;  3MM7 B;  4ED2 A;  1T9T A;  5THW A;  2C2E A;  4DOZ A;  1N48 A;  1S9G B;  5KFC A;  2CUY A;  1KSP A;  2BKP A;  5ETK A;  2FJA B;  4OYW A;  2DIT A;  4I2Q A;  1S12 A;  1NDP A;  1KQS R;  5HLF A;  3KG4 A;  1WI8 A;  4DSE A;  2OTJ S;  4QQB A;  2LA6 A;  4LFA J;  3TVY A;  5GAD I;  3VZI A;  1Q4R A;  2XYG B;  3J7Z T;  4USU A;  1HFE L;  4I67 A;  2YNF A;  4LF8 J;  4LF7 J;  2EBG A;  4O23 A;  5E3A A;  1T9V A;  3J7Y I;  2V8H A;  4LF4 J;  4DR5 F;  2OMO A;  4WK3 A;  5DDQ C;  4RUB A;  3NGD A;  4WBF A;  5GMK a;  2D7S A;  5FLX Y;  1K0V A;  3DU6 A;  4DPX A;  3KK1 A;  4WWS A;  3IXQ A;  1HNV A;  3MM9 B;  5B08 A;  3I5C A;  1IKY A;  4R8U B;  1TEL A;  1ZTT A;  3D66 A;  2J0S D;  2RNE A;  3W61 A;  1IM6 A;  4ELU A;  4M8L A;  4DUY J;  3P3D A;  1HWK A;  3QT8 A;  1RP5 A;  5CAA A;  2L9D A;  4N8O A;  1AYE A;  4L3K A;  1V3R A;  4NLT A;  1T3N A;  1JQG A;  3DRS A;  1S1W A;  5HVF A;  3P6Y C;  4ALZ A;  2MZ1 A;  3W64 A;  2FGC A;  4OX6 A;  1U8S A;  3FQK A;  4YB1 P;  1YJ7 A;  4YB6 A;  3IAS 9;  2VZ9 A;  5T7L B;  4PQU A;  1F6T A;  2QTW A;  2YKM B;  4KBI A;  4ES2 A;  3VAI A;  2DIS A;  2VIC A;  4G1P A;  2RQC A;  1FNM A;  1RU2 A;  2E9T A;  1ZA1 B;  4ZP7 A;  4FDF A;  2ADC A;  1U7L A;  4LSZ B;  4DMZ A;  3IWL A;  2DHX A;  2NQP A;  2ILY A;  1JK9 B;  5ETM A;  1GXT A;  3BB5 A;  3NOC A;  4B3M J;  2OIH A;  2HRU A;  3HVT A;  3KUG A;  2VB6 A;  1BHN A;  4WP3 A;  4ZVQ B;  1RXO B;  3I82 A;  2C2Z B;  4M5H A;  3BKT A;  3JAM Y;  3MPD A;  3T1H F;  1UEK A;  2J9D E;  2GS8 A;  1WC4 A;  4DF8 A;  1OY9 A;  2NXJ A;  3VAH A;  2QC3 A;  3LP1 A;  3MMC B;  4IKA A;  2DHG A;  1D9D A;  3PKM A;  2X7I A;  3OLB A;  3RBZ A;  2ASY A;  2XTJ P;  1LK5 A;  1CS4 A;  3QBC A;  4QBU A;  3GIR A;  4DV7 F;  2F8E X;  2Y0S D;  3T19 A;  5KFQ A;  2RVJ A;  3NGS A;  3A13 A;  3W2V A;  3LAL A;  1K8A T;  4I2P B;  1DUR A;  4WJB A;  4EFA C;  2MKS A;  2HGL A;  1X4E A;  1DTQ A;  4OYZ A;  5KTQ A;  3MEE B;  4UW2 A;  5L39 A;  3I31 A;  3LA0 A;  5B0B A;  1VLO A;  4QWC A;  2XC9 A;  1S6P A;  3QGG A;  4RPF A;  1RE1 B;  2XWY A;  4NZ6 A;  3H42 A;  4O44 B;  3MM5 A;  2P6S A;  2PO4 A;  4C11 A;  1IJE B;  4ZPC A;  4ITS A;  2UXD F;  2HQI A;  3KJN B;  5B0E A;  4DV4 J;  1H38 A;  4TU9 A;  2VFU A;  4A48 A;  3GJQ B;  5F3Z A;  3AJ2 A;  2CJB A;  2FPH X;  3S7R A;  1IXK A;  1GFW B;  4KH0 B;  2ZBR A;  5DDP C;  3KHG A;  2Y3Y A;  4F4Y A;  1R0C B;  4C0H A;  2KRB A;  2HBZ B;  4LBH A;  4K4Y A;  2RU9 A;  2CNK B;  1M5V C;  4LR9 A;  5CCM A;  3EDR B;  5A8W B;  3MUT P;  3HUL A;  3HK2 A;  1HPZ A;  1X5P A;  3IBF B;  2IBK A;  3SCK E;  3F44 A;  3Q89 A;  2N7C A;  4IQX A;  1F2H A;  3EVO A;  2DIV A;  1WHW A;  4KGK A;  4HYK A;  1NJW A;  2E5H A;  2B3T B;  3OXL A;  4QYR A;  3IG1 A;  1NH8 A;  1JLG B;  4GRS A;  4YOE A;  2VG5 A;  1Y5L B;  1O51 A;  3GIL A;  1ZZF A;  3K5O A;  1E6Y A;  2J76 E;  2ILZ A;  3SXL A;  2QT7 A;  1S49 A;  3N6M A;  2OEL A;  3M8S A;  2X1G A;  3CCT A;  4JI0 J;  2G1D A;  4LFB J;  4EYI B;  4B3O B;  1VRQ C;  2KG1 A;  2M52 A;  3KK2 A;  5JMN A;  1DRZ A;  2W2Q P;  1MU2 A;  1N5S A;  2B6A A;  2BQR A;  1O5J A;  4OMF G;  4KSE B;  1K73 T;  4FNI A;  4CZC A;  3AXK A;  3RB6 A;  8AT1 B;  1ZET A;  1N5T A;  1NK9 A;  2I38 A;  1HR0 F;  2OSQ A;  2XHW A;  3B78 A;  3HX9 A;  3SV3 A;  4LQ3 A;  3NRB A;  4ZVG A;  2RAQ A;  1RGV A;  3UPF A;  3DGP B;  4R5P A;  2BV3 A;  1RWO B;  5CZX A;  3UVJ B;  3VGT A;  1Z4U A;  2KFN A;  1RHU B;  2H5I B;  3POT A;  3I0S B;  4DG1 B;  5D6G A;  1LWC A;  3RYL A;  1RT4 A;  4OYP A;  1TQL A;  3G9C A;  3M8W A;  4DCJ B;  3H4B A;  3N6L A;  1ZTW A;  3IBC B;  5K8P A;  4NEZ A;  4DQP A;  2J0X A;  4I64 A;  3QZ7 A;  4U7U D;  3LWL A;  4X62 J;  1RIS A;  3CE8 A;  2Y1R I;  2HK3 A;  4Q43 A;  2KN4 A;  2OI2 A;  2JZ5 A;  2RKI B;  4AFF A;  4B02 A;  3M2U A;  2KXF A;  3UDC A;  2ZIT A;  4RBV A;  1N5Y B;  1U1M A;  2A1B A;  5T14 A;  2XQC A;  4GMK A;  4X65 F;  5K8M A;  4RW9 B;  5C42 A;  2VPW B;  3BO2 A;  2BJD A;  4DR3 J;  1TL3 A;  3GJR B;  4CTA A;  2V2V A;  1RT3 A;  4USJ C;  3JXO A;  3K7R A;  2IJN A;  3ENW A;  4YB5 A;  4B9M A;  4NA3 A;  5K20 B;  1RWN B;  5DS7 A;  3CO0 P;  5K14 B;  1IBK F;  4NYZ A;  3NL0 A;  2CG4 A;  3EGW B;  2XEX A;  3R97 A;  3PYE A;  7FDR A;  2G2O A;  5IT9 Y;  4ECT A;  3FEZ A;  2ZBI A;  3MMB B;  2XMA A;  1N32 F;  3HFK A;  4MFB B;  2FYX A;  1J5E F;  3THT A;  2FHJ D;  4RO0 A;  4DSK A;  4P10 A;  3R1L A;  1CJU A;  1T03 B;  2PE8 A;  1S1V B;  1FDD A;  2YQ1 A;  5ETV A;  4JI2 F;  1WTB A;  3MEG A;  4O3N A;  1DQA A;  3QO9 A;  4P6Q A;  4ZVR B;  2N4D A;  3BYR A;  1XQI A;  2XBP A;  3OTO F;  4DSF A;  4W4M A;  3HT3 A;  1KVI A;  5KG7 A;  1HBM A;  1LW2 A;  2HMI B;  5HMX A;  3NGR A;  4JI6 F;  3BDP A;  2DGW A;  3D9B A;  2CAJ A;  3KK3 B;  4QYZ J;  1VQ4 S;  1IBL J;  3NNC A;  1JB0 C;  3BQ0 A;  1HD1 A;  5JJB A;  5ETN A;  4UOF A;  4GVL A;  2AYB A;  2IRX A;  4NOH A;  3MOZ A;  3NBP A;  4KQZ A;  5LOQ A;  3LUY A;  4DI6 A;  1B0P A;  2FJE B;  4PUO B;  1EET B;  3FRZ A;  1P9Q C;  4NZ0 A;  4PRF A;  3D6M B;  3CMA S;  1SBR A;  1VQ9 S;  2R3V A;  2RIJ A;  5KFN A;  4RL1 A;  3UE2 A;  3NOG A;  3N5B A;  4LF7 F;  5MAO A;  2IY5 B;  3GB0 A;  1FNO A;  3OVB A;  4KV8 A;  3GV5 B;  2W2O P;  4MKB A;  4OI4 A;  1C1B A;  4OI2 A;  3BGU A;  1BQM A;  2NXN A;  2HFU A;  3HHL C;  2XNQ A;  5EHH A;  4OZ5 A;  5I42 A;  3MPW A;  5HRO B;  3VAL A;  2K1R B;  4LRE A;  3PR4 A;  2CIM A;  1NME B;  1B0T A;  3SQO P;  1HBN A;  4YS2 A;  2W4P A;  2YWW A;  3LPY A;  3HVW A;  1VFJ A;  3NMR A;  4NLV A;  4GKK J;  1YRT A;  1Z2Z A;  2BVZ A;  3UD4 P;  4OZ2 A;  1CUL A;  3RB4 A;  5CXT A;  1CVJ A;  4UST A;  3ENA A;  3RB0 A;  4IQM A;  3CCS S;  3OR1 B;  3OVA A;  4UOH A;  1R8H A;  2J9E A;  2FQQ B;  2N3O A;  2IRU A;  1TUG B;  3D67 A;  1OYE A;  3BYP A;  3BZQ A;  1U09 A;  4RWX A;  3PRD A;  1X31 C;  1HKA A;  3M30 B;  3G6E S;  4XK8 C;  4H4K C;  3AXM A;  2OEK A;  2M2B A;  1K47 A;  3GPA A;  3CJ8 A;  2CZV C;  2ZWO A;  4PXB A;  4ZJL A;  2F1F A;  1CEZ A;  1X5O A;  2JLF A;  2CQ0 A;  5J2Q A;  1EAR A;  2CZ9 A;  4KHM A;  3C6U B;  4R0E A;  3BS9 A;  3A8I A;  3DDN A;  4F3Q A;  3LO3 A;  3L4B C;  3R7S B;  2X1B A;  4HT5 A;  3EYZ A;  1N6Q B;  1RT5 A;  2PSZ A;  1LWE B;  5L1J A;  5GME A;  4W90 B;  2GGP B;  4Z2X A;  5KFH A;  1JLB B;  1IWA A;  4NMX A;  4ECX A;  3M8R A;  1T8E A;  1NM2 A;  2B8Q A;  1FFS B;  2HWI A;  1T3O A;  4YQW A;  2KT2 A;  3IWN C;  1YZ7 A;  5HMW A;  1XTZ A;  3BGO P;  2CQB A;  2ALY B;  3PAC A;  4ZJO A;  2CWX A;  2LEB A;  2ASD A;  4ZKA A;  2M88 A;  1JKH B;  2VFT A;  2DGV A;  2YNI B;  1GXU A;  4N7T A;  2HS4 A;  1CPZ A;  1KD1 T;  2CQ2 A;  4ZJQ A;  4QR0 A;  1GXL A;  3PFO A;  3QGP A;  5K8N A;  4NEY A;  3O44 A;  1V3Z A;  3W66 A;  5DLG A;  3BGL A;  4N41 A;  5KT5 A;  3LAK A;  2DGO A;  1XNR F;  3MZI A;  1UZH A;  4XDC A;  2VFR A;  4RU9 A;  4DV4 F;  1FE4 A;  1FEH A;  4E98 A;  5DDR C;  2Q79 A;  3I0R A;  2W7O A;  2MLX A;  1U47 A;  2HQD A;  4X64 J;  2YVS A;  2QMU B;  1IN0 A;  2JL9 A;  5BXI A;  4UT4 A;  3L7U A;  2BE7 D;  4GC7 A;  3WDO A;  1KDN A;  4U96 A;  4TXS A;  1VQL S;  4WFX A;  2IVF B;  4USM A;  1F0X A;  2P9G A;  2W9B B;  2W2P P;  2DXE A;  2E5I A;  3QGH A;  1WSV A;  1FFW B;  2LU1 A;  1WHX A;  4V19 J;  5DG7 A;  2LMI A;  2YKQ A;  3W1Y C;  2JVO A;  1ZM2 A;  3KTQ A;  4J9U E;  4JI7 J;  3FSI A;  2Z2Z A;  4TVA B;  1SH0 A;  1NZA A;  1RT7 A;  2YX7 A;  4CCH A;  3VF0 B;  1PJ5 A;  1QSS A;  2ZZT A;  3MMA A;  4LFB F;  4C7Q A;  2YKA A;  3I32 A;  2E5G A;  1J5O A;  3ENQ A;  5KT4 A;  4M5L A;  3TVZ A;  5KFO A;  4OYM A;  3J80 U;  3TJ8 A;  5G0R B;  1RTH A;  2VG7 A;  4LSN A;  3IM8 A;  5DJB A;  2V94 A;  2B43 A;  2FJB B;  3CCR S;  1ZYQ A;  2PMW A;  2DNR A;  3M2V B;  2MMY A;  3IO1 A;  1RT2 B;  3MAA A;  3P8B B;  3A4T A;  1TP7 A;  1WOS A;  2ZOM A;  2VOD A;  2VKZ G;  1H73 A;  4J9M A;  2HIY A;  2NXC A;  2V5H G;  1AUS L;  2KXN B;  2N82 B;  3PX0 A;  3AHP A;  2QO3 A;  3UQS A;  1VDH A;  3JSY A;  2R9L A;  2HBQ B;  3EDQ B;  3G6Y A;  2ZHA A;  1F3F A;  1S99 A;  1FE0 A;  4DX5 A;  1L3T A;  2ZM6 F;  2KJV A;  1MSW D;  1FKA F;  3CW2 C;  1Q0N A;  4O3P A;  5G4D A;  2YKN B;  2IVM A;  1YJR A;  2W25 A;  2ZH9 A;  3EVW A;  5D8H B;  3VAK A;  4BWM A;  2KTQ A;  2GQQ A;  1UVI A;  3PW0 A;  1R3N A;  4K4U A;  2EFP A;  2CQP A;  4P2F A;  4WFZ A;  4NL5 A;  1SJ4 P;  3PRV A;  4J5O A;  1RHJ B;  5GAH U;  2KL8 A;  3A8J A;  2FJW A;  2RUS A;  1Y5N B;  2KFY A;  1UW4 A;  3NAI A;  1RU1 A;  2GHW A;  2MKI A;  3CCM S;  2QMX A;  3ZTQ A;  5J1E B;  3O1L A;  2PD1 A;  4U67 Q;  3C15 A;  3C6T B;  4BC9 A;  3DLG A;  4DV3 F;  4GO5 X;  2MYF A;  2N4C A;  3TZY A;  1NKC A;  3G82 A;  4DR3 F;  4CIO A;  1TUV A;  3PX4 A;  2DNL A;  3PHT A;  3GTY X;  3HO1 A;  4DQS A;  1BD6 A;  4DL5 A;  2CQ4 A;  4FVM A;  3LAM A;  3W2W A;  4EBD A;  2G2Y A;  2QV6 A;  4I2Q B;  1TVR B;  3LP2 B;  3FCH A;  4WU2 A;  4Y3C A;  5LJ3 Y;  2ZOF A;  1NDK A;  1TKZ B;  3AH6 A;  1HQU A;  1Q82 T;  3PIO Q;  3NAH A;  8RUC A;  3R5D A;  1FXD A;  2MJN A;  3O8W A;  4Y2I A;  1YJ9 S;  3KJV A;  3DLL Q;  2GC8 A;  3TJ9 A;  2YWF A;  2KXH A;  3P96 A;  2KM8 B;  1M5H A;  1XR6 A;  3HLU A;  1BE4 A;  2Z8Q A;  5U47 A;  2YNG A;  4DR4 F;  3MAH A;  1FJE B;  1F5A A;  2CPH A;  1CG2 A;  2G1H A;  1LEO A;  4HHH A;  3VCD A;  4Q5V A;  1TU0 B;  2J7W A;  1FJG F;  3CD5 A;  2L9W A;  3R2D J;  3IN5 A;  1MN7 A;  1HNZ F;  2OGU A;  3VWS A;  1S9E A;  4MIW A;  5C5J A;  1HWL A;  4L73 A;  2AIR B;  4U7C A;  3V4M A;  1B99 A;  2CDR B;  4OFZ A;  5D0E A;  5HI7 A;  1IBL F;  2QRR A;  3K5M A;  4ZPA A;  1S1U B;  5HQ8 A;  4EU0 A;  1V3S A;  3G4S S;  2XYH B;  2AHO B;  3BDE A;  5J2P B;  4ECQ A;  6FDR A;  2RJZ A;  3U02 A;  2OP5 A;  1U6Z A;  3DOM B;  2VJU A;  4O4R A;  2FGO A;  1M5K C;  2CFX A;  4IFY B;  5AE3 A;  3EE3 A;  3R5C A;  4PAA A;  2PEH A;  4DZD A;  1S5Z A;  1UJ6 A;  3QMQ A;  2KHC A;  1Q7Y T;  3DYA B;  1SKW A;  3TUP A;  1E6V B;  3EXY A;  4C4W A;  2J0Q D;  3C14 B;  2KJW A;  2HNZ B;  1IR2 A;  5CYM B;  4C3L A;  4X4T A;  1WC3 A;  2CWK A;  5E3Q A;  4ELV A;  5H1S V;  4PYD A;  3THP A;  3V81 B;  4BHQ A;  4QWA A;  2AWZ A;  4ID5 B;  2FZK B;  4Y2A A;  4F2R A;  9ATC B;  2C3O A;  3ISZ A;  1WNE A;  3M8Q B;  4UOC A;  2E7V A;  1WJ9 A;  1OYD A;  1Y00 A;  1X4C A;  4PWU A;  1HQE B;  2JJ4 D;  2MZS A;  5KFM A;  1Q8L A;  3SQG B;  4KGV B;  1FFG B;  4DPT A;  2RT3 A;  2MQM A;  2F5G A;  1TKX B;  1XR5 A;  2MXY A;  4ECY A;  3DMJ B;  4CQ1 A;  1TFY A;  2AF6 A;  1UWB B;  3OLA A;  1J2V A;  2OH2 A;  4KH1 B;  1JLE B;  1Q81 T;  4KGX B;  4MYU A;  3H40 A;  5AE1 A;  1UFK A;  4N8N A;  2B9X A;  1YRX A;  1G7C B;  3V4I B;  2HQF A;  4KGZ B;  5I3P A;  1KOO A;  1P6T A;  3IR5 B;  4UY8 T;  2J0W A;  1WC6 A;  3DRR A;  1T9W A;  2DTJ A;  4ZS6 A;  3AB4 B;  1CLF A;  2QE5 A;  4IG0 A;  3FUY A;  4RKU C;  4MKY A;  2B5J A;  3HHN B;  1IM4 A;  4CRJ A;  1VI7 A;  1H2U X;  2DNP A;  3NGT A;  3KHR A;  3E01 B;  4E2F B;  4F0H A;  2F65 A;  4ZLJ A;  4J9N A;  5HO4 A;  3W8P A;  1T05 B;  2UU9 J;  4Y2M A;  5B7W A;  5BR8 J;  2CXE A;  1NKB A;  3DI6 B;  1G2E A;  3TAM A;  4WII A;  5CAB A;  5EX0 A;  4P9S A;  1KFS A;  3GZ7 A;  3DNC A;  2K3I A;  2VU5 A;  4JI1 J;  1NHV A;  1XMO J;  3KFW X;  3CB4 A;  3MF5 A;  2F3J A;  3CGI A;  5EDW A;  3DLK B;  4DFJ A;  1SUQ A;  4LF6 J;  5I3U A;  3BV8 A;  4FN5 A;  3R5J B;  3RU0 A;  1TK8 A;  1F3V A;  1MU2 B;  1SXL A;  2GIF A;  5IWA F;  4GC6 A;  1S0V A;  4JYA J;  3DC2 A;  1CJV A;  3ITH A;  1H7W A;  2ZNZ A;  2R8K A;  5KFZ A;  4PG8 A;  3DLB A;  1EX8 A;  4Q45 A;  5KFS A;  4PG7 A;  2XSJ A;  2R7S A;  2KU7 A;  1S1X A;  2EVZ A;  4ICL B;  4CLW A;  2R2T A;  1NSQ A;  3DRP B;  4WKR A;  4BS2 A;  1M1K T;  1HLW A;  4EUV A;  1U24 A;  1H74 A;  4F3M A;  2IFX A;  5BYQ A;  2HKE A;  4JI3 J;  4IUF A;  2CRL A;  2HBY B;  1CQN A;  3A1Y G;  2AJF E;  3TX8 A;  4XO0 A;  1HYS A;  1UJ5 A;  3QIP A;  1QTM A;  1U6B A;  3TZW A;  3SYZ A;  2CVE A;  4UOG A;  5KFF A;  3PYG A;  1U1R A;  4KC5 A;  4I69 A;  2JEJ A;  2PA3 A;  4DLG A;  1UMJ A;  4IG3 A;  3M9N B;  4NLW A;  3KLF B;  4A8W A;  2OPS B;  4NYO A;  2IJF A;  4RW7 A;  2MJU A;  1NB7 A;  4RNO A;  3J81 U;  1U1P A;  2PGC A;  5T41 A;  5A2Q U;  1Q78 A;  2OPP B;  4FP9 A;  3AOB A;  3H5U A;  1UCN A;  2DIU A;  2Z30 B;  3DDI A;  5IFM A;  2FZG B;  4O4G A;  1PCA A;  2FLP A;  2JFK A;  2V2Z A;  4YY3 F;  2EFN A;  4K2J A;  2IAJ A;  2DR9 A;  1FX4 A;  3K8V A;  2PII A;  1JLC A;  3MR7 A;  5H9E K;  1FHT A;  3KLH B;  3JSR A;  1RWP B;  2B51 A;  3HXM A;  3OFG A;  2JOQ A;  1FRJ A;  2R8H A;  1N0U A;  3QT6 A;  4KIA A;  4X84 A;  2W1B A;  3PTW A;  2VJV A;  5IOL A;  1LKZ A;  4B9L A;  4ETX A;  1R0A A;  3OHB A;  4B3T F;  3M05 A;  2IC3 A;  2FDN A;  4DV5 J;  1RT1 A;  3SSR A;  3LP0 B;  1HL6 A;  3I9V 9;  2CJ9 A;  1CJT A;  3R3T A;  2K7K A;  2M4M A;  1EP4 B;  2E9R X;  2OLW A;  3BBB A;  2YWG A;  3ZC4 A;  4DR1 J;  4GO7 X;  2CAD A;  2HRY A;  4ZHR B;  3AA9 A;  3MM8 A;  4C0O C;  4DFK A;  4KJI A;  4C8M A;  3W62 A;  4CLU A;  5ITH A;  3DLE B;  3OFF A;  3KNA A;  2DKO B;  2MB0 B;  1VIX A;  2HQG A;  3VGU A;  3IRX A;  4IRC A;  4WFB Q;  3CD7 A;  2JWN A;  2BX6 A;  3LPE A;  3HJV A;  1L3K A;  2FJV A;  4CLL A;  2QA4 G;  3D3C J;  3FMB A;  2GHV C;  3AD7 C;  4L6V 3;  4WTO B;  2EXU A;  1TL1 A;  3SSS A;  4WFA Q;  2MKC A;  3RBE A;  4X4V A;  2DR6 A;  3ZTO A;  2BRK A;  4KE5 A;  2DRA A;  1C0U A;  3S6E A;  3LTO A;  1OQ6 A;  2JFD A;  2F8H A;  1RB0 A;  5A8R B;  3MD3 A;  1JXE A;  2XO7 A;  4LF9 J;  4F2S A;  4DHV A;  1RBO B;  2NCK L;  1GAO A;  2L48 A;  2QSW A;  3GE9 A;  1Q5Y A;  1M1G A;  4LRB A;  2ZBC A;  1FDA A;  3EGZ A;  4B9T A;  2OHD A;  1VR6 A;  2LQB A;  1TK0 A;  2D3U A;  3AB2 B;  1GTE A;  3UNG C;  1EAY C;  2DY1 A;  1WOP A;  3M6U A;  3LOU A;  3I4H X;  5DG8 A;  3M32 A;  4QZV B;  5GAG U;  3CSK A;  1TAU A;  1OJ4 A;  4ZPW R;  1D09 B;  3QT7 A;  4CLZ A;  2H48 B;  2AGQ A;  2HGN A;  3RGI A;  1F9E B;  3KLI A;  3KLE A;  1T9U A;  4YUD A;  2YKO A;  5D15 A;  2LQ8 A;  2CPJ A;  5EWG A;  1VMB A;  4CO4 A;  4F4X A;  2ZE2 B;  2XYP B;  2ZD1 B;  3W9I A;  5KOW A;  5RUB A;  4N47 A;  1SL2 A; 
#chains in the Genus database with same CATH homology
 5IT9 U;  4DV5 J;  2E5L J;  4JI1 J;  2MEW A;  4V1A k;  2KL8 A;  1XMO J;  1N32 J;  4DR7 J;  1HNW J;  4DR3 J;  5LMU J;  4LF9 J;  3J80 U;  4LFC J;  4GKK J;  5LM7 E;  1J5E J;  2ZM6 J;  4LF6 J;  4DR1 J;  3T1H J;  3T1Y J;  1IBL J;  2MQ8 A;  3R2C J;  3J7A N;  4KYZ A;  2MTL A;  5FLX U;  4DR6 J;  1N34 J;  2UUA J;  1HNX J;  3R2D J;  4LFA J;  2UUB J;  3J81 U;  5A2Q U;  2UXD J;  4X66 J;  4JI2 J;  4X64 J;  4LF5 J;  4NXM J;  4JYA J;  4LF8 J;  4LF7 J;  4B3R J;  3JAM U;  4B3T J;  2VQF J;  3OTO J;  4LF4 J;  4RJV A;  2UXB J;  4X65 J;  2HHH J;  4JV5 J;  1XNR J;  3IMQ J;  4DR4 J;  4GKJ J;  4DV7 J;  4PWW A;  2UUC J;  4DV1 J;  4K0K J;  2VQE J;  4B3M J;  1N36 J;  4JI4 J;  5AJ3 J;  1FJG J;  5LMN J;  1N33 J;  4AQY J;  2UU9 J;  2F4V J;  4JI0 J;  4DR2 J;  4DUZ J;  4LFB J;  4NEZ A;  4OX9 J;  1HNZ J;  3D3C J;  4DV3 J;  4JI5 J;  3D3B J;  4DV2 J;  5IWA J;  1HR0 J;  4DV0 J;  3W1Y C;  5BR8 J;  4X62 J;  1XNQ J;  4JI3 J;  4B3S J;  4DUY J;  4KHP J;  4DV6 J;  4KY3 A;  4JI7 J;  4JI6 J;  1XMQ J;  4NXN J;  4DR5 J;  4DV4 J;  1IBK J;  4NEY A;  2KVQ E;  1I94 J;  1IBM J;  4YY3 J;  2UXC J;  4HHU A;  4YHH J;  4JI8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...