1GAOA

Crystal structure of the l44s mutant of ferredoxin i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCASCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential.
pubmed doi rcsb
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gaoA00
3IR7B 2Y0SD 2FJBB 4AYBD 1Y5NB 1F2GA 4YDDB 2WAQD 1AXQA 1G3OA 1WTFA 1FRIA 1KEKA 5CHCB 2PDAA 1JNRB 1VJWA 2C3PA 3MM6B 1FCAA 1FRXA 3MMCB 1K0TA 2VPZB 1Y4ZB 1HFEL 1FXDA 1SIWB 2FDNA 2C42A 3OR2A 3MM5B 1KQFB 2C3YA 2GMJA 4RKUC 1IR0A 3EXYA 2WSFC 1FTCA 3MM9A 2O01C 1GTHA 2PMZD 1BC6A 1BWEA 1B0PA 1H98A 3IR6B 3IR5B 4CI0B 1F5CA 4L6V3 2VPWB 1GAOA 1FEHA 3LW5C 2WSCC 2V4JA 1DFDA 2C3MA 4KT0C 2XSJA 7FDRA 2FGOA 2WB1D 4XK8C 2XSJB 1FDBA 1KQGB 2FJDB 2WSEC 3MM7A 1C4CA 1BD6A 3HKZD 2VKRA 3PNIA 1F5BA 5L8RC 6FD1A 2ZVSA 1FRMA 1H7WA 1Q16B 2C3OA 3OR2B 2IVFB 2FD2A 1IQZA 2VPYB 1FDDA 3C8YA 3EUNA 1JNZB 4Y28C 5BYRA 1R27B 1RGVA 1Y5LB 2V2KA 3MMBA 5CH7B 3MM9B 1SJ1A 1FRJA 1FXRA 3MMBB 4XDCA 5FD1A 5BYSA 3MMAA 1FRLA 2UZAA 3OR1A 3OR1B 1FD2A 2V4JB 2VPXB 3GYXB 4ID8A 1C4AA 1DURA 1H0HB 1FDNA 1FF2A 4XDDA 1DAXA 2C3UA 1GTEA 2FJEB 1B0VA 1BLUA 1H7XA 1PC4A 1PC5A 1CLFA 1D3WA 3MM7B 1FERA 1G6BA 5E7OB 1A6LA 3MM8A 1ROFA 1BQXA 3MM6A 7FD1A 3MMCA 1FRHA 3MM8B 1GT8A 2PA8D 1SIZA 3EGWB 1B0TA 4OMFG 5BYQA 4DHVA 1Y5IB 4OV1A 2GMHA 2Z8QA 6FDRA 3MM5A 2FJAB 1FRKA 1XERA 1FDAA 3MMAB 1JB0C
chains in the Genus database with same CATH superfamily
1JIHA 4JI4J 3BGOP 4NRUA 1LQ9A 4HI1A 4K50A 1KEKA 2DH9A 2CJ9A 4LBPA 4AXJA 4DN9A 4KH0B 2MQQA 2MZJA 4F02A 3OTCA 4LF1A 3VAKA 1TMJA 2ZHAA 2QYCA 4PABA 1QD1A 3BGFA 3FRYA 3DRRB 1WI6A 1U45A 4OZ0A 1GFWB 3OFFA 3CJKB 3LP1A 2ZBCA 2K1RA 3WX4A 1JLQB 3G4SS 1VQYA 2UXBJ 4B9VA 1JLAB 4LF7J 1BQNB 1PJ5A 1HBUA 2X51A 4DPXA 3GONA 3Q8SB 3D7SB 3PYGA 4X4OA 1BQXA 1E6YB 3CMQA 1YITS 4LF9F 2E9ZA 2ZJRQ 3MM5A 3PW5A 2PA3A 1RHJB 4Z7YA 3W1YC 2XHWA 3IBCB 3RBDA 3CCJS 4GKJF 1PBUA 1Z1ZA 1GX5A 2ALZA 4GKKJ 4AL6A 4NMXA 3HJFA 2OPPA 2VG6A 1I3OB 4ETZA 2XYPB 1K0VA 3KLGB 4JI2J 3I4PA 4KQZA 3PX4A 2DGWA 4PPDA 4DR5J 3D0GE 5KG3A 1P6TA 1K44A 4ZCMA 1Y0HA 4NLQA 4F25A 2DNYA 3S8SA 3QZ8A 4F50A 5BR8F 3I0RA 1V3SA 2VKZG 3H8YA 1IBMF 1U26A 4AL5A 2J8AA 2V2KA 2F4FA 3NGSA 1CJKB 4U7UK 2FC9A 1FKAF 2G2OA 2UUCF 2V8DA 3HSZA 3AODA 2HNDB 1JLEA 3TARA 5IT9U 3PYFA 2XEXA 2CQBA 2W9CA 1IKXB 4WFYA 5H9FJ 1C1CB 3CCSS 5J1PA 2L9WA 4LREA 3G2XA 3CCES 1EP4B 1TKTB 3M2VA 3VGUA 1T0TV 1XNQF 1VIXA 1RWOB 3D1QA 3THPA 2FPHX 1N5VA 2FHJA 5KG7A 1HNVB 1UJ5A 3CE8A 4KO0A 5K8OA 5HROA 2WSCC 2AWZA 4NA2A 1S49A 4MFBA 2MY8A 4WYLA 4P52A 2X1GA 2NPFA 4X65F 2EFVA 2DNGA 1RT5A 5HBMB 4DG1B 2P8IA 5B0AA 5JXSA 4HDHA 3EGNA 4B3OB 1EAYC 1T9XA 2W2QP 2L3MA 3GFXA 2OPQA 2ZZNA 1FFSB 4TY8B 4DR4F 1UWBA 3KK1B 4CNZA 2VA2A 1RZMA 2HHQA 3D54A 1M90T 2ZH4A 4I7FA 2LA4A 4B08A 1S9GB 2GVZA 3N0VA 2WAQD 3CJRA 3M1VA 2QFIA 2F40A 4RNFA 5IV4A 2B9XA 2MDAA 1N6QA 1QSSA 4OYXA 3QT8A 1NPRA 1U49A 1YBTA 4I6YA 5U47A 1X4FA 4QR2A 1TAUA 2IJRA 4BHQA 1X9MA 2PIIA 3D68A 1TUWA 3KUEA 1S6UA 2QC3A 1F2HA 2JX2A 2XI2A 2HQ3A 5EX3A 1LEOA 3MDFA 1JLFA 2QMXA 3KFWX 4AFFA 3UCZP 4NLGA 4YHHJ 1K73T 3HSJA 3PRDA 3TZYA 4YY3F 1NK9A 4DCOB 4P7VA 2YQ1A 1JKHB 4C8KA 4O3QA 4MK9A 4ED0A 2MB0B 4HTJA 2DGTA 2WTFA 4WTYA 4ZPCA 5IV3A 1RTJA 1UA0A 1GTEA 4AL7A 1URRA 3UE2A 2ZH2A 2DNRA 4HACA 5H9FK 3L09A 4DU8A 3HMJG 3MPWA 2VG7A 4N47A 3DMJB 3Q8RB 1FT8A 2W7PA 2UUAJ 2Q79A 2CAJA 1KLMB 4AT1B 2ZNZA 3QLHB 3JQJA 2V2QA 5L1JA 4KGMA 2MKYA 3C2PA 2B4OA 2FVSA 4DSJA 4JI1F 3TWZA 2GGPB 1RWUA 1GMWD 1SQGA 4Y2AA 2WW8A 4X62F 1S6OA 1GTHA 4YR3A 1H98A 2XC9A 4YB7A 3CEDA 4EI2A 3DOMB 2X1AA 1YLXA 4I0WA 2V6AA 4LBIA 2HNZB 3HKZD 4KHPJ 2L9NA 2V8HA 2ZE2A 2XYHB 3OV7A 2EBEA 2GW8A 4RBTA 2YXLA 3MPVA 1X9WA 4P6QA 4R25A 1CULA 4ES3A 2RH3A 2RDIA 4H4KA 4DQIA 3AFGA 3T5JA 3GV7B 1J27A 4CZCA 3FVYA 4EYIB 1YI2S 5GAHI 5ETRA 4TN2A 2BW2A 3QIPB 1HBMB 3M2UB 2LQBA 5KFZA 3SQOP 4C0HA 3AD9C 1Q7LB 3POTB 4MAKA 1CVJA 4JYAJ 1HFEL 3R7SB 3GCWP 1FXDA 1KQFB 2F65A 2MKHA 3QO9B 4ALZA 1WG5A 2EEYA 4I6WA 2E1MC 3GYGA 5DG7A 4J37A 4U7CA 1NJWA 1XEZA 1B7FA 1M1HA 2FYXA 4JV1A 4DQQA 3UPFA 4X4PA 2HNYA 2J8SA 2RKIA 4OZ1A 1L5UA 3UN2A 3KLIB 1F60B 1Q5VA 4YR0A 3PKYA 2KYXA 2MQOA 3MF5A 1HL6A 4P71A 4FKXA 4ZVGA 4TLQA 1HI0P 3ZO7A 2L41A 5A8RB 2COLA 4DR7F 4OX7A 5B08A 1CSJA 2JC0A 4QZVB 2D69A 5LOQA 3MAQA 2MPUA 2NSCA 4QIVA 1N32F 1D8ZA 2MGZB 1KDNA 3FMWA 3T41A 4IR9A 3J81U 3B8HA 3IMQJ 4NCGA 4EU0A 3AOAA 2BJ9A 3QSYB 3D67A 3EDQB 1GX6A 4K4ZA 1C0UB 1WKJA 2HQCA 5KFPA 4WF9Q 2QLFB 4ED8A 4HHJA 3GMGA 2WB1D 5CYMB 4WK3A 1O8BA 1PSDA 4KGXB 5I3UB 4AD6A 2IVFB 3P5BP 3T6JA 4YB6A 4ZITA 1RLDA 5F9LA 3CD0A 2CJYB 3J7YI 2XNQA 2E7VA 3VVTA 4NRTA 4ID8A 2A6MA 3VV2B 3UWTA 3H4BA 3L7PA 5DQGA 5GAEI 1KBRA 1IM6A 1ZTTA 4CLYA 2W01A 1VC0A 2JWNA 4C8YA 2HKEA 4EGLA 3VGVA 3NCPA 3SBMA 4A47A 2M3DA 4WFZA 2B56A 4PEOA 2V5HG 3CJTA 1XMQF 4JUZA 1DHMA 4DV2J 2XO6A 1JNRB 1S6QA 1SI9A 5BJRA 4TVAB 1GH8A 2YPZA 5LT5A 1D9FA 4PUOA 4ED6A 1IBLJ 2G9OA 4Q2LA 3OL8A 3KK2B 3SSSA 4KPCA 4ECQA 2WSFC 2H51B 4G3IA 4QIFA 3SEOA 4FYDA 4O3PA 1B3TA 3PR4A 1RLCL 2QRRA 1S0MA 1HNZJ 3CNQP 1NB7A 1KTQA 5ETLA 5ETTA 1DZ5A 4M5NA 4YQWA 2W4CA 2DO0A 2P9EA 4NA1A 5KG5A 4DEZA 2G2YA 4L74A 5B0CA 1PC5A 3LP1B 3GV8B 3QJJA 1F9HA 2K1RB 2DNMA 4XAKA 2H4WB 3W9HA 1RKJA 4QR0A 2DHXA 2KRRA 1HBUB 3NGDA 5KFXA 3BN4A 4WFBQ 3OL7A 3V6JA 1G2EA 2XMJA 1VJWA 1KHVA 3B6BA 5DO2A 1CBKA 3NAHA 1ZAWA 1JXLA 2NUUG 2UVRA 1NK7A 3DDNA 4B3TJ 1E6VA 3N5BA 2B5JA 1ITPA 1ZZFA 4DUYF 3MM5B 2C3YA 3TQ1A 4LVOP 2CJAA 3W2VA 4DR3F 1UWAA 2I8EA 4DV5F 3MOZA 1HYSA 4TY9A 2FVCA 2BUNA 2VG6B 3T9ZA 2O1PA 3FBEA 2NXEA 3Q22A 4JV0A 2OH2A 2ZKTA 4Q7AA 1P1LA 3I56S 4UZBA 4PXCA 2UZAA 3A3OB 4LFAF 3OXGA 4F3OA 3H5UA 5C24B 3AAWB 3PZPA 2YY3A 1PBAA 1B0VA 3HVWA 4RU2A 3M8PA 3MEDA 4ILRA 5ETPA 3H5SA 5LJ5Y 2DGXA 1NBEB 4TU9A 3R6GB 4JI3F 2D3OR 2IM2A 3QJLA 1S99A 4YDDB 4USMA 1R0AA 4D3HA 1RT6A 4QOTA 3ZZYA 3MEEB 4FVCA 4CH7A 4C48A 1RU2A 4NXNF 2HVZA 3DXBA 2VPZB 4JOUA 3Q2SC 3X1LB 2OI2A 2HBZB 1VC6A 2ZOGA 2W9CB 2FJXA 2K3IA 4EO8A 1ZM4A 1C0TA 3M2VB 3DGPA 4OZ2A 4P10A 1U6FA 2GJFA 2MSTA 2ZC3A 3R2DJ 2N7CA 2JVRA 2M8DB 5KFVA 1HNXJ 2POKA 4BDPA 3KLEA 3B4DA 4OQJA 1V9OA 5B0DA 1UVKA 3RR8A 3BPDA 2PC6A 5HROB 1UA1A 3HHKA 2OIHA 3EZ5A 4MFBB 2GFFA 2QN6B 4OFZA 2HQIA 4UTGA 2W8KA 1R8PA 2Z4PA 4J7CA 4EMDA 3R9LA 1RT5B 3KHRA 2CPYA 4DDFA 3VHQA 3UDCA 4ED1A 4O3RA 3TZXA 1B70B 3C14A 2IHR1 3SFUA 1S9FA 4DUTA 5AXNA 3W7BA 2AW0A 3CJSA 4CH1A 4JB8B 2OPQB 3HHLD 1UWBB 2W2MP 3OVBA 4ECTA 3IO1A 4MJKA 1HW8A 1HQ2A 2HSEB 4I7FB 4ZVQB 1KFSA 1XMOJ 2FGCA 4DU7A 2GVZB 1HR0J 3K7RA 3M1VB 2I6WA 5HSPA 1V6HA 2VC1A 3M05A 4ZVEA 2CQ4A 4FKYA 3DHWC 1N6QB 3QBCA 5IOLA 4QPXA 2VD3A 3MM7A 3D6MB 1SQFA 4ECUA 3GPAA 4DR5F 4ECYA 1NUEA 4ECVA 2MLXA 4WKRA 3TX8A 3FBCA 1JLFB 2YH0A 1HWUA 3RRHA 5LXRA 3EM1A 1NNDA 3A8JA 4OYOA 2LXIA 5IQ6A 3TVKA 1ROFA 3GFYA 3MM6A 2LQ5A 1TELA 4R5PA 1SXLA 3JSBA 2UUWA 1NSAA 1RTJB 1TZ0A 1G3OA 5KTQA 2LQ8A 2QA4S 3D3BJ 2ZVIA 1R0BG 4DF8A 4J9LA 3S6EA 3HPOA 1Q82T 3O2IA 1VRQC 2G13A 1WOSA 2Y1RI 4F4YA 1NSQA 1I94J 2VG7B 2DGQA 1MWYA 1S6PA 4EO6A 3PJWA 3GIMA 3UDLA 5HQMA 4Q0BA 2ZFHA 1EQ0A 4NPOA 1OY8A 4A8KA 4DR2J 3VTIA 2D9OA 4QWBA 1FJGJ 2ATCB 3V4MA 2HAFA 3D5MA 2AJ4A 3HVTA 1T11A 2VFRA 3UDEA 2DCLA 5FD1A 4W90B 4V19X 3PTWA 3PW2A 4ZDNA 1SL0A 5IT0A 2X1BA 1R8BA 2XBPA 5C5JA 3AT1B 5F8MA 3K5PA 2XY5A 2X3GA 4WCEQ 2AKWB 3FRZA 2F3JA 1QTNB 3VAJA 1K47A 3SQGA 4DHVA 1WJ9A 2W24A 2ZM6J 2ZE2B 2ZH1A 2B9YA 1FDAA 3SSRA 3SXLA 4CYUA 3IR7B 2XWYA 2FJBB 2FVQA 1ZAXA 1ULRA 1CULB 2ZWOA 2MLYA 4C6AA 1TUVA 3MEKA 1LWFA 1ZAVA 1R6YA 2GNKA 2MTLA 3HHEA 3TVYA 3R5BA 3JYTA 3CJ0A 2YKNA 3I9V9 4HI2A 9ATCB 3MGJA 3PG9A 3NGRA 2DYAA 3T1YJ 4DV6J 2R7VA 1HWJA 3PDNA 1M5SA 4PQUA 2BJ7A 1HARA 1Q7YT 3BO3A 3LGMA 2LP4A 3IWNC 2AHOB 1QVGR 3ZZ0A 2EBGA 5A76A 5DQIA 2RHSB 3BJYA 4LT6A 1KC8T 2UUBJ 3GLJA 4LSLA 2HQGA 2LU2A 2Q1LA 3MFHA 3LGNA 1Z4UA 2MQ8A 2WCXA 3G96A 5BYSA 2W8LA 2CZ9A 4J90A 4TXSA 2CVIA 3Q8UA 4HR2A 3ILIA 4IO1A 5D4OA 4DL5A 2R7UA 1XK8A 4O0NA 4MKYA 1SIZA 3D1HA 3ISNC 2HNYB 2RKIB 3MECA 2EVZA 2ROEA 3NL0A 2DCUB 3V81A 1V5VA 3D2WA 2JRSA 1MMDA 1S79A 1RT1B 1UEKA 3CW2C 4L3KA 3M30A 4LJMA 2WW4A 5DDQC 1SVDA 2GO9A 1SC3B 3JAMY 2R7XA 1F5CA 1S77D 3SSQA 3FFIB 4IG3A 4ITSA 4DI6A 3DI6A 3MTJA 1RCXB 2MQPA 4NLWA 1BD6A 2D9PA 2UV8G 2XCPA 4NCGB 4MH8A 2LA6A 3UO0A 4RU9A 3CCWA 4Q2MA 1FVQA 4KJIA 2RDJA 3OJUA 3HSGA 4IFYA 3CJQA 2I2YA 3AA8A 3CD6S 2IM0A 3GQCA 1A6LA 2CDQA 1NJXA 5K5MA 2O66A 1L3KA 3IS9A 4ES2A 5LSLA 4J9MA 2EWHA 1VQ4S 3KKFA 2LXFA 2NREA 4TNOA 1WC4A 2FJAB 3I5AA 1SCJB 4JV5J 2CPIA 1DQAA 4UY85 4Q8EA 4HVZA 4MIWA 2I5JA 1ELOA 1H2VZ 1UAWA 2AGPA 4K4XA 2J6UA 2VFTA 1N5TA 4IH6A 5F9NA 2RIJA 5F8NA 2DNQA 2PEHA 3VAFA 2RE1A 1N4LA 4QIGA 1PIEA 1S6QB 4X84A 3OTDA 4CM0A 1IWAA 2MYFA 4GVBA 1UFKA 3C19A 2RUSA 1M5HA 2ZUAA 4PUOB 2ASDA 1TMMA 3MMBA 2DBBA 2BACA 3PVXA 4M63A 5GAGU 3G6VA 2J7KA 1T02A 2AJFE 1FD2A 2NCKL 5G0RA 2NLWA 1OQ3A 3WC0A 4BLGA 1CLFA 2A1BA 1NZ8A 3A3NB 5EWEA 3CCRS 2F5GA 3CIMA 4H4OA 1UMJA 3CO0P 2BW7A 5EUHA 2QFJA 3TAQA 5KFNA 2I38A 1LXJA 4NXMF 2ZHOA 1Y7PA 3LAKA 3J7AN 4N5SA 2AJ0A 4B9NA 4UW2A 1LXNA 1AUSL 1CPZA 1RAGB 1QAXA 5DM7Q 3QJPA 4DL3A 1YTYA 1PAUB 3NNHA 2DKOB 4Y3CA 2XZWA 2B4PA 2VFUA 1VBKA 2NQPA 2RRBA 1E6VB 4DSIA 2B5JB 4C8NA 4C97A 2PD1A 2OTLS 3NWRA 4B9TA 3RUBL 3R1LA 2ZDOA 4N8NA 2QLBB 5D0HA 2CVEA 3W2VB 3MFIA 2ZBQA 5C2GA 6AT1B 1NSKL 3K58A 3RB0A 3OR1A 1BUXA 4LFBJ 4KV8A 2FC8A 3NP5A 2R7SA 1XNRF 3IWLA 3SI8A 3I87A 2A10A 4K4YA 5M2PA 1TL5A 1NH7A 2PA8D 1RCOB 4FYWB 1UVNA 4K4VA 4W92B 3FZBA 3L7OA 4NLXA 4IO9Q 3MCOA 4KB7A 4OHZA 4MYTA 2IA6A 3HVRA 5IC4B 3M8PB 3MEDB 3FDSA 2HQDA 1RB0A 1BQMA 3TW0A 4JI7F 3RU0A 4H4MA 2VODA 4DX6A 3LO3A 3QATA 2JL9A 2Z57B 2C1EB 3BKUA 4M5DA 1L3UA 1R0AB 2Z30B 3F0NA 3HLUA 2IRUA 4PZVA 2HVEA 1TK8A 1UFWA 2J0XA 2F63A 4OYIA 3UR3C 1DJ0A 2YNFA 2V34A 4RW8A 3R2CJ 4DV7J 4KAIA 4IFVA 4OV6A 1KVKA 3NY0A 1RAHB 1OJ4A 3R8YA 3UFCX 1IBCB 3Q8YA 3ONQA 1F3FA 1N5SA 1U8WA 3DDKA 1X4EA 5B0EA 1C0TB 4B9LA 3E01B 3KMSA 3DGPB 4I2QA 2FHOB 4O44A 1D3WA 4NLSA 1LW2B 5D0EA 3KHGA 2APOA 3KLEB 1U1QA 3IRXA 3BREA 2W2OP 4LRDA 1VLYA 4K0KF 4QW8A 3AQPA 5CQGA 1TL4A 4RR5A 2LVWA 2BE2A 1VR6A 2YTCA 4CO2A 5F0UA 3C14B 4ZVSB 4X64F 3IAM9 2V8GA 2KHCA 4OX8A 1PJ6A 1IKWB 3FQKA 2QTWA 3I4HX 2Y1JA 3TJAA 1I5OB 5FLXY 3LUYA 2RNEA 4XK8C 1WOPA 1NDKA 1U0HA 2V68A 3JQKA 1YGYA 2F8HA 3RR7A 1WORA 5BYRA 2VB6A 3HFVA 3GTYX 4CP5A 4BS2A 4OI1A 4ERDA 2OHDA 3EXCX 2CPZA 3KLVA 4MIAA 1BHNA 3MM7B 3K2YA 3LP2A 2VBZA 3TUIC 2DIUA 4DUZF 1VK8A 3ILOA 3RAXA 4QWAA 1HNWF 2VIHA 3GR1A 3WIVA 4QU7A 4OYWA 2QLXA 2DR5A 3DN9A 3G82A 5SUHA 3RZAA 2FLOA 4QYZK 3WZ0A 4Q43A 4QR1A 3MM6B 2YWFA 3HP6A 3Q8PB 3HJVA 1RWMB 4B3MF 2J76E 2OFHX 1VYAA 4LF9J 1S4FA 1GXUA 2CZVC 2GMLA 3PCOB 1J5EJ 5RUBA 4RO0A 1S1WA 4NMLA 3LGHA 1N5YA 2ZBPA 5IM0A 4DV3F 3R5DA 4GKJJ 2HFZA 1HPZA 4B9UA 1WC6A 3W5YA 5L39A 3E51A 1H38A 1IQZA 3H7HB 4P2SA 2DGSA 3CCQS 1VQOS 1HI1A 1S6PB 3ADAC 1N34F 3NRBA 1Y00A 4F4WA 3EZOA 2MJUA 4Q0BB 3KTQA 4IR1A 8AT1B 2GHVC 1RHKB 3L95X 5BR8J 4A46A 3OQ2A 3B4MA 3QGIA 1F0XA 1NHKL 3HVTB 4D3GA 3F41A 4RWWA 3SZ2A 4P72A 1UL3A 1IBMJ 3HM9A 2H1YA 3DYAA 1O6XA 8RUCA 4O3OA 5AE3A 5B0BA 2UUCJ 1U2FA 4RW6A 3TQEA 3T6BA 2KM8B 5EWFA 3LOUA 4H4KC 2GMJA 4NZ6A 1U09A 5HAOA 2YX7A 4U8YA 3M8RA 3SCJE 4DJBA 2V4JA 4F4KA 3R7BB 1S48A 2HWIA 4ATNA 4HKQA 3K17A 2ZH9A 4A8OA 3JYTB 2YKNB 3H2VE 2B8QA 3QGPA 1XNQJ 2DO4A 1HR0F 4LSNB 2Y8YA 4RW7A 5K8MA 4ID5A 1FHTA 3OL6A 1RXOB 2B43A 2HBQB 1QDUB 2CQ2A 3SYZA 4LSLB 1P9QC 2DTJA 3NXZA 4DPUA 4IDKB 6FDRA 1WOOA 3KHLA 3DU6A 4ZPVR 4X65J 4USIA 3IBFB 3GZ7A 1FFGB 5J2NA 5D4PA 2CPFA 5KG0A 5KFIA 2BYCA 2B8PA 2E7XA 1CC7A 2OMOA 1MN7A 2Y1IA 4O3SA 2UP1A 4TYAA 3VGTA 4DR4J 1UEVA 3MEGA 3V6KA 3ULHA 1JJ4A 3M8SA 3V81B 1FTCA 4DZDA 5JJBA 2E29A 1F3VA 4ED7A 3M32B 3TA1A 1O0PA 1FWKA 3VQSA 4C8ZA 5EN1A 3M30B 2K8GA 4ICLB 1KN6A 5D8HB 5G4DA 4ER8A 3K57A 3HHDA 3B78A 2R3VA 4IG3B 1VDHA 3DI6B 2CJKA 1U6ZA 2HIQA 2Q6CA 4DR2F 1DLOA 4ZCIA 5JVGQ 1UPPA 4YY3J 3IGNA 3TOQA 4F4XA 1WF0A 1XERA 2E1PA 1S76D 1EARA 3D6TB 1JB0C 4IFYB 3UQSA 3CJ5A 5KG1A 1RHQB 3CD7A 5J2MA 1M1GA 2VONA 2PDAA 1CG2A 5T41A 5F3TA 1N88A 2YNIB 3MUMP 2DY9A 3IS9B 2ZITA 2IC3B 4BC9A 4MIBA 1FI4A 3LALA 4LRBA 2VH7A 2G0JA 4QWCA 4LVNP 4NLYA 1N56A 3RBEA 4R8UA 3KWMA 3J7ZT 4Y2IA 4GO5X 4WXWA 2O3DA 4OI0A 2I5JB 5DQHA 3GCXP 3M9MB 2HGNA 4ETXA 1NKCA 4O3NA 1HWKA 1WG4A 4ELVA 2GQ2A 2BJ8A 5DETA 2JEIA 3SV3A 2FHKA 4X62J 3DC2A 1LV5A 3WHIA 4GVBB 3PW0A 2FVRA 4NI2A 3GWCA 3V6HA 3VZHA 1RHRB 4WFXA 3TAPA 5DGBA 1RISA 1TV6A 2VUGA 5EDWA 2AEMA 2NYHA 3RYLA 1N36F 4L72B 1Y5NB 5C7PA 2YX1A 1Z2ZA 2P5VA 1TVRA 1OYEA 2ZEJA 2FLPA 1N0VC 1RTHA 4H4OB 1NH8A 5L9NA 1S57A 2RJZA 3VAIA 2HS3A 5KFEA 1RWXB 5CD4A 3DRSA 2DEJA 3CC4S 2MKJA 2J6TA 2KFZA 3TP2A 3H59A 2K7KA 4X4VA 3BH6B 1CJUA 1FWPA 2ZHBA 1TTHB 1ZTWA 4U8VA 1NZAA 2Q66A 5EGYA 1YQHA 2ZH8A 1FXRA 1U2CA 4LMZA 4M5IA 2R2RA 3C66A 3KXDA 1LW0A 2B9EA 4Z2XA 2E5GA 3K89A 2CFXA 2FY1A 2MXYA 1G6BA 1VOMA 5A8WA 3FCVA 3C6UA 2XSFA 2OD6A 3GIIA 1C1BB 4P74A 4ELTA 3OR1B 1JQGA 4NLVA 2JC1A 1WSRA 4TKTA 5DLFA 4I2PA 2LLZA 3OVAA 4DCPB 3JSMA 4HT7A 2RQMA 2Z0GA 1NK6A 3I0SA 2QSFA 1U0SA 3D0IE 2BZ2A 4N76A 2JVOA 4CLWA 4JV5F 1AW0A 5KFDA 4UOFA 4DR7J 4NLDA 3W2WA 4FYYB 2A2DA 2QL7B 4K4SA 1IJEB 4KR0B 1HQEA 4NLRA 4H4MB 2QA1A 1K1QA 4ZPWR 3CJ2A 3MZIA 4ZKAA 1N32J 4M5DB 3JXOA 2L48A 1Q8IA 5ETSA 4EYHB 1QAIA 1WEZA 4ZA1A 1WHVA 1PC4A 2YNFB 4GRSA 1Q8BA 4RW8B 3MWBA 4IFVB 1KS2A 3OHAA 5KFGA 2QEXS 2C2DA 1NHVA 1H3DA 2VBXA 4DR1F 4J9KA 3ISZA 1OYDA 1TKXB 3C46A 4I2QB 4O44B 2UVUA 3GFZA 2LFVA 1QTMA 3KJNB 1DY3A 3QT7A 3W8GA 5EWGA 3IRXB 3CDUA 1VFJA 2KZZA 3EXYA 2HMIA 3PYEA 1YRUA 5J2QA 4CO3A 3PX0A 3IR5B 4L6V3 3KLHB 1HNIA 1AT1B 2KG0A 1EIYB 4M5LA 3HX9A 1XMQJ 3H5XA 5IT4A 4WZMA 3SDEA 3BBBA 4FBUA 2VKRA 3QAUA 6FD1A 1Q16B 2NXUA 1PO6A 1LK5A 2QSWA 1RT2A 4ZPDA 1JLGB 4IRDA 4M5HA 3J7YU 2BV3A 4USJC 1ZPWX 2L9DA 3BV8A 3NCRA 4PWUA 1U0HB 3NEKA 2B4UA 2C2OB 3UDVA 2DNNA 2ZWPA 3LPEA 2AMCB 4L76A 1RU1A 3JTPA 4OJGA 2BDPA 4OLPA 3BBCA 1U2RA 1JXVA 1AFJA 2DH8A 5HP1A 3SV4A 4LFBF 4IOCQ 3ZXWA 1RWNB 4DPWA 3LP2B 2ROGA 3N01A 2PGCA 3O5TB 4CO4A 3FBBA 1G4CA 4OX9F 2PFFB 3NAIA 4DV1F 3G82B 2BRKA 3VF0B 3GG0A 2OELA 1IJFB 1YJRA 2AYGA 3ITHA 2ZH6A 2XQCA 1BY9A 2RS2A 1C2PA 1VQ7S 2JOQA 1RTIA 2OSRA 5AXKA 2FD2A 2FLNA 2HZVA 3IG1A 4OHWA 4DUYJ 1S1WB 4CO5A 1N5YB 1ZOTA 5HLFA 5IM0B 2GZOA 1NEEA 4DR3J 4IRCA 4DV5J 3M8YA 3KJVA 1VQ8S 3NNCA 3BGRA 3THVA 1NK4A 1QSLA 3CSKA 1IKYA 1GT8A 4G65A 5KG2A 4AE5A 3RBXA 5CA5A 3W64A 3DLGA 2XS7A 1LNQA 2QZ8A 4I68A 3N79A 3OUYB 4A8MP 3V2UC 4OLOA 4TU8A 4CLTA 3KNGA 1RWWB 4LFAJ 2AEJA 2BKOA 4OZLA 1LFWA 2WRMA 3QQCD 1CEZA 2XMAA 2JH3A 3AD8C 3J7A1 1Q95G 1Q78A 2R8GA 2Y1LB 3GJQB 2KM8C 3DYAB 3P5TL 2BEFA 2E9RX 2IPOB 1WNEA 4CWBA 3KLFA 3OFGA 3NGUA 4JI3J 3DLEA 3B82A 2JEGA 1OIAA 4ZCKA 3UNYA 1IR2A 4CTAB 4HH1A 3P4UB 3E8OA 3GIJA 4NXNJ 1ZM2A 1JJCB 1X5OA 1RAOA 2C28A 1JX4A 2PE8A 3N28A 2V4JB 4X4QA 4DLEA 2L08A 2NPIA 2WBRA 1NAQA 4FF1A 3MM8A 2HYIB 2CA9A 3ET6A 1P27B 2BABA 3DRYA 1BXNA 2ZOFA 4ZVRB 2AX1A 2E1RA 2GVDA 5CD4H 2EFGA 3KUHA 2DNKA 4RW7B 3S7RA 4ID5B 2CQ3A 2R2TA 3K5LA 3M6XA 3W61A 5I42A 5ETKA 3ZZOA 1SQEA 1VQNS 4P9SA 5H1SV 1EQMA 4CLPA 2WZ1A 5A0YA 3R97A 3HXMA 4DFJA 2XMMA 4WK1A 5KG4A 5J2NB 2DRAA 3CDEA 2PMZD 1U7LA 2XS2A 4C3LA 1FK9A 2NXNA 3DRPA 4RW4B 4B3SF 1DFDA 3Q89A 2M0GB 4QYRA 1ZETA 7FDRA 3ETOA 5FDLA 4PXDA 5C42A 1GMUA 4LRCA 3MEGB 2X3DA 2ACMA 2HFOA 3DOLA 2KJVA 3Q8QB 4MKBA 1J5EF 3NCQA 2I1RA 3DOKA 1U1NA 2AJ1A 3MR6A 3CCVS 4DN0A 2J5AA 3A1YG 3KNAA 4I4BA 1V3ZA 2J7WA 1D9AA 1HWIA 1JXEA 2EFOA 3P96A 2R7OA 5JVHQ 2N3LA 1FA0A 3PIPQ 3E3XA 2PEBA 3OTOJ 2DNHA 1UJ4A 3FZ2A 1PGZA 3KUGA 4PQAA 3MURP 3DLBA 4MK7A 3SCKE 1S1XA 5KFSA 3KJQB 1BWEA 4ZIVA 2M70A 3QWUA 5J2MB 3RRGA 3TAMA 4ZVTB 5F8IA 3BR9A 3TZWA 2YKMA 2XSJB 3GFHA 3W65A 2NXCA 3QGHA 3R6LB 5KFCA 1FDDA 1Y3JA 1RGVA 2YWHA 4F4AA 5J1EA 4A8FA 1GNKA 3OTBA 4UF4A 3BBFA 1OY9A 1Y10A 3FSXA 1WEYA 1F9EB 4J9SA 1FJ7A 2DGVA 1J5OA 3UN3A 3IM8A 4IYQA 1QVFR 5HO4A 2W4DA 2HURA 2DHGA 3M6WA 1YVFA 1S10A 2FIUA 2ILZA 4WWSA 3GE9A 4BWMA 2LQ9A 4Y34A 4NI2B 3CF5Q 2RS8A 2DIVA 3IWXA 2DNOA 1VQ5S 1NPKA 2BE9B 2ADCA 4E0DA 1JLCA 5DZ7A 1T05A 2J0WA 4H54A 1X5PA 5KFTA 1TVRB 2P9GA 3V4IA 4ECZA 1HMVA 2CRLA 3S01A 1RTHB 3QFHA 4FF2A 5CAAA 2HGMA 3AJ2A 2LDIA 4B3RF 1JMTA 1P8GA 1S1VB 2CPDA 1PYOB 3Q0AA 3DRSB 2MHEA 3PHEA 1XTZA 1VRUA 3QYYA 1MWZA 1CJUB 2OEKA 2GIQA 2ZJQQ 4CM2A 3BS9A 2XS5A 1UPMB 1G7CB 2K06A 1CS4A 4UT4A 2CADA 1FRIA 2PN6A 3PKMA 2E9TA 1NK0A 2G0IA 4Y2KA 2HVDA 2FY8A 2YWWA 3C6UB 3JTOA 2FDNA 3TANA 4I6AA 4URGA 3TO8A 3CT9A 4PXEA 4N7TA 3CGIA 2H5EA 3DRRA 2D41A 4WJBA 2QG9B 1OSCA 2FVPA 5F8HA 4C0OC 1X60A 1N8RT 1S0OA 3JSMB 2HFUA 2FJWA 2R42A 3I0SB 3TUZC 1AZSA 3W63A 2ZUGA 2R8IA 5I3PA 4N56A 2DHSA 2YH1A 3K8VA 4XTTA 3ISND 1FEEA 2JEFA 4CLKA 2AQ4A 4KY3A 1NJZA 2UXDF 1HQEB 4M5MA 2BJDA 4DL2A 4CO1A 1Y3KA 4J9OA 1O5JA 1RWVB 4ZVFA 1UVLA 4GC6A 4Q5VA 3IC1A 3PR5B 4FVMA 1WUUA 2YQ0A 4CO0A 1UZDA 4EFAC 4J9UE 4DFMA 3KLGA 3MXHP 3HD2A 2E5LF 2W7AA 3OJSA 2ERRA 1X4GA 4IUFA 2MQLA 2QO3A 1HHSA 1WDDA 2DR8A 4FF3A 3ILJA 1FKPA 3QT5A 3BSOA 2FZKB 3FEZA 2DNLA 4TU7A 4J9QA 1IM4A 2BM1A 4U7UD 3EUNA 1U24A 4K2XA 1LK7A 3IA0A 2HMIB 2R2SA 4ZP9A 3VCDA 5J2QB 5HANA 4NWBA 4XDCA 4KRWA 2HEKA 3MMAA 1HNIB 1N5QA 1H73A 1DQ9A 3IGVA 1U1PA 1U02A 1FX2A 2HNDA 1WD6A 4KKOB 3SDEB 1FERA 2D74B 2IMOA 4OZ3A 1IKVB 4LRFA 3DLKA 4L73A 3HHNB 3SCIE 4ZMMA 4DL0C 3T1HF 1WF1A 2R7RA 3NG8A 3AHPA 2VOOA 3AJDA 2P9CA 1NK8A 2DEIA 3U7JA 3E2EA 2HBRB 2DR6A 1I51B 4U6PA 4OZJA 5HP1B 1BMQB 1SC1B 1WHWA 4CI0B 2Y8WA 3C16B 4RPFA 2ZH3A 2Y0BB 1WWHA 2FQQB 2VDIA 2H3EB 2HHVA 3EVWA 4NXMJ 3FUYA 4KGKA 1C4CA 4LF4F 3CDAA 1T3NA 4DG1A 2B3TB 2KHDA 4DPTA 1YBAA 5D4LA 2J0QD 2WVDA 1SJQA 4B3OA 4KFBA 1BGXT 2YQ3A 4DL6A 2ALYB 4OX6A 3HT3A 1SH3A 3ITHB 2AZ1A 5DZ6A 1R89A 3U1LA 2U2FA 4DR6F 1SV5A 2H65B 1RTIB 1ZM3A 3V6DB 1EKRA 2QA2A 4WE1B 4BBYA 2RD5C 3IG1B 4FXDA 5KFRA 2IAJB 1OMSA 2ACYA 3JSYA 1FRKA 3ZTOA 2YKQA 5HLFB 1F2GA 3AOCA 1I1GA 1YIJS 1RJJA 1R8CA 2AIRB 4B9SA 3C6TB 3KJVB 5IWAF 2C3PA 3BGRB 2X7IA 1FRXA 1IKYB 5D78A 3KG4A 2CDRB 3DLGB 1XNRJ 2ZD1A 4USVA 1H2UX 1IXKA 4DZ6A 2W1BA 3DFEA 1QLNA 5GADU 2Y3YA 5KT7A 5C2CA 3DLLQ 2CXEA 4L3NA 3QZ7A 1TK5A 4QIWD 3JSRA 4IG0A 5MLCV 1T9WA 3NBPA 4C11A 4JI7J 5KFQA 4FNHA 4LF6F 3KLFB 5DM6Q 3ICLA 1KHWA 3G6ES 3GJRB 2GQCA 4EBCA 5IT9Y 2EXUA 1F5AA 2HHUA 5LMUF 3HF5A 2ZH7A 3IP0A 2HRUA 2IYGA 2BQRA 1SL2A 4DXLA 2OJ3A 2VU5A 2NSBA 3H4DA 4KYZA 1D09B 1AYEA 2CQIA 2EI5A 2F9JA 2HQFA 5K20B 2RU3A 4NLOA 5CCLA 4C8OA 2W2NP 3HZGA 5IXUA 3UI3A 1APSA 3ET6B 5J2PA 2V8VA 3M8QA 2UV8A 4C9DA 3MUTP 2VA3A 4J9PA 2GVDB 1YBUA 1TUGB 4FBTA 1RAJA 1ZPVA 4ZJLA 4A8WA 2NYIA 1UVMA 2DHAA 2FHJD 2YKPA 3D1OA 4EZ6A 4K0KJ 2HNZA 4DSKA 2XLJA 3ZTSA 3OXFA 1FRMA 2Z2YB 4JI5F 3U1NA 3CDWA 1RBOB 1ZA1B 4YB5A 2IY5B 5AE1A 2FZCB 3HSDA 4WZQA 3OVSA 2N4CA 3DRPB 4X64J 5LMNF 1OPIA 4ZP7A 2HGLA 3RG6A 2YNHA 5C42B 2XM3A 2IJNA 2KFYA 1K9MT 3DOLB 2PFDA 1XMBA 3AXMA 3OSPA 1VK3A 5GMDA 5CXTA 1SUQA 3RRKA 3DOKB 4IH7A 5CCMA 2CIMA 4YN3B 1TR0A 1KONA 2OPPB 3CC7S 5E3AA 3SMZA 3QO9A 3IXQA 1IN0A 1TKDA 1VS3A 1PCAA 3QFWA 1XWLA 4DUZJ 4ZS6A 2ZH5A 1HNWJ 3M2RA 3LW5C 2O67A 5KFKA 1S1UA 1YK9A 2CWKA 2DNZA 1FX4A 2KT5A 5AJ3F 3GYNA 1W25A 1XR5A 4KTQA 1KQGB 2H54B 2G1DA 4WP3A 3I0RB 2HVHA 1U25A 4FF4A 4KHMA 2W25A 1Y5LB 2PI4A 4B3MJ 2ABYA 1RYRA 1YJNS 1U1RA 1KVIA 3TAMB 5DJBA 4WKYA 2QIFA 1DURA 2CQ1A 5HL7Q 3UCUP 2YKMB 4KH1B 2OKQA 1GK8A 4C8MA 5I4MA 3MMJA 5A8RA 4DV3J 3B54A 2B7CB 4G1PA 1JLEB 1TL7A 5J1EB 3CCMS 1TKZA 2LCWA 2Z56B 2AEFA 2MSSA 2AYBA 5CZXA 3BKFA 1AXQA 1N34J 3J7Z5 4ECRA 2AYEA 4ZP8A 1SJ4P 1J5OB 3FJ2A 1GXLA 2DR7A 4NASA 1HIYA 2OPRA 1KVJA 1GMWA 1S7HA 5CYJA 1RHUB 4ANEA 1W26A 3EGVA 1VJQA 1VBZA 3ZNUA 4F3QA 4CCHA 3UNGC 3FCWA 4NZ7A 1U47A 2XG8A 1IVZA 2VPWB 2KXNB 2CG8A 2D3ZA 4C3KA 1LWCA 2XLKA 4KO0B 5KFHA 3OXLA 4WYWA 2RMLA 5I3UA 2CQDA 3N9UC 2BJ3A 1S59A 1J2VA 2C3OA 4LF5F 4NZ0A 1JLCB 2KXFA 2CPXA 3H0PA 1T05B 2V69A 3J80Y 3VR1A 5LJ3Y 3V4IB 1JLBA 1AROP 1HMVB 3K59A 1O51A 1QJHA 3IFEA 4BCAA 3PYDA 3UVJA 2XWXA 4TQRA 1EHWA 3N6NA 2FTRA 5A2QY 3MHYA 4YFUA 3IAS9 3EDRB 3MPDA 2XMTA 2HZCA 3N6LA 4KGZB 4C4WA 3MPYA 4PCQA 2V63A 4BWJA 2RDDA 4FNIA 3BDPA 3KK2A 2M2BA 2EPIA 1Z2LA 1CS4B 1GQEA 1R8AA 4IKAA 1XJWB 3DGVA 1NCLA 3M8ZA 1B0PA 2GCFA 4NL5A 3GJTB 3OTOF 1FDBA 4AUKA 2ROPA 2DRBA 3M4XA 2DT9A 9RUBA 1UKUA 1S0NA 4LIRA 2U1AA 4XDDA 2JEJA 3I5BA 5DG8A 1HD1A 3Q8VA 2WVFA 2P2CB 1AZSB 3QT6A 4I64A 1NB2A 3MMCA 4O4GA 1DTQA 3F73A 4HACB 1MROA 4RUHA 3Q2TC 1Q8KA 2Y0SD 4ANDA 4ZCLA 1KLNA 3J81Y 2F8EX 2FLLA 3QGGA 3TUPA 4JI8F 3K5OA 4QWEA 5DDOC 4MTPA 2A0FB 3T5KA 1NLKL 2R7WA 1HHQA 2QL9B 3PX6A 4ZOSA 2AD9A 1F1BB 2BKPA 4JI6F 1RUSA 2MEWA 2FJDB 3RB4A 4R0EA 3EJMA 2WOMA 4WFNQ 5L8RC 3ZTQA 3MR3A 1VISA 1FRJA 3OLAA 1FRLA 2AJ2A 5HI7A 2HFSA 5C24A 3H2LA 1FKPB 2GQQA 1FNOA 2PMWA 1DQ8A 4M5JA 1LWXA 4M94A 4OMFG 1VRTA 1Y5IB 2GMHA 1YHQS 4X66F 1YWXA 3MMAB 3CCZA 3DLJA 1Q4RA 1X8DA 5KFUA 1ACMB 4C8LA 2FJVA 3QSIA 4LUBA 3MEEA 4ECWA 3HFZB 3CDBA 4AQYF 4CH0S 3BO4A 5DG9A 2UXCF 3NKYA 5HN0A 3DLKB 3RB3A 5HVFA 1RACB 3ZZRA 2QT7A 3PXGa 5JUMA 1BC6A 3TYTA 3L4BC 2CZ4A 4WP9A 3UW1A 5KOWA 3A4TA 1N36J 1YZ6A 2MKIA 4C3MA 4X4TA 1NO8A 4DS5A 5A8KA 4A8SA 1YJ7A 2IM3A 2E5HA 2XMKA 1YG0A 5CZVA 4LFCF 3VALA 5KFOA 2HK3A 4RUCA 3ENAA 2YBVA 3FEXB 1UVJA 4OI6A 5DRKA 1XN9A 5B0GA 4OI3A 3KK3A 3T9NA 2VOPA 1SJRA 3O1LA 4KFBB 3AA9A 1N48A 3C3LA 3T3FA 1H2TZ 2BOPA 2DY1A 1WHYA 5KFFA 4IOAQ 2IBOA 1MSWD 1SV5B 2KVIA 4YB1P 1PJ7A 3ZZTA 4OYAA 2BE7D 2OPSA 3R5GA 5E41A 4KSEB 5KFBA 4OYPA 2D3O1 1VQKS 4NOHA 1ZZNA 2LEAA 3U1MA 2OTJS 4F2RA 3GV5B 2KT3A 3NOGA 1R3NA 5HQ8A 4I56A 4IRKA 4DBQA 2KDOA 1F5BA 2ZD1B 4Y0FA 1T9VA 3QAEA 4ECXA 1EETA 3I31A 3H5YA 3UD5A 3NOCA 1TP7A 2ZJPQ 4JBCA 4CQ1A 2LYVA 2R4FA 5F0WA 4IG0B 4DV0F 1NDPA 3NBPB 1FXLA 3A8KA 4C11B 5CYQA 5ETMA 1HQUA 3EZUA 2EFNA 2BA9A 4A48A 1KQSR 1YJWS 1NK5A 2MKCA 2VHGA 3EPIA 2MQMA 3DM2A 3K8WA 1RAEB 1X4CA 2UVVA 2VV5A 4WPAA 3VWSA 1HA1A 2C42A 2JZ5A 3DCAA 4I1TA 3SCLE 3L7UA 2YWEA 4DR1J 2F7VA 2RQCA 3HFKA 4AXIA 4FZVA 2DITA 1YSJA 2GHWA 2VFSA 4KT0C 3MUVP 5J2PB 3M8QB 1FO1A 5B09A 5BXIA 1ICEB 1IBKJ 3OL9A 1AFIA 3OHBA 3RJMB 2VPYB 2HHHF 2F4VF 3TEHB 3V5RA 2B0GA 4ZPAA 1RWKB 3TJ8A 2E5JA 2KXHA 2N7YA 1F9FA 2CQGA 5LSOA 2NR0A 2MY7A 1WKKA 4FPRA 3HI9A 4HH0A 5KAKA 1S7IA 3HHLA 2XMUA 2BXJA 5GADI 3D66A 2MMYA 2QGFB 3UR0A 3J80U 3R3TA 4PKDB 4CT9A 1RP5A 5D6GA 4J9NA 2YNHB 1JJ2R 1T7PA 5CHCB 1LWEA 2DVIA 3PACA 4ZVHA 3GSIA 3H90A 3QMQA 4PYDA 5A2QU 2LQJA 2Q3PA 2UUTA 2C2MB 3FSYA 4ILLA 3MM9A 2CNKB 2GO8A 5D4NA 1SUQB 5KFLA 1HYSB 2WK4A 4M1KA 5L9XA 2C3MA 4DWIA 1MU2A 2VZ9A 5LM7E 4F67A 1JJHA 1AB8A 3GB0A 5KT6A 4OZ5A 3L3CA 3K5NA 3HZEA 2OAUA 1T9TA 3CJ8A 4OX9J 4JV2A 3M2RB 5M2UA 4RJVA 1S1UB 4DV1J 4FYXB 4K8RA 2KTQA 2VJUA 4KHRA 2CPJA 1SBRA 1X4HA 2FZGB 3VZIA 2VQFF 1MMNA 4ZJOA 1MMLA 3US5A 5K14A 2QYGA 3QWPA 1MNEA 1X4AA 4QYZJ 2OGUA 2A2CA 5L1IA 4CLZA 5KT2A 4RNMA 2MZRA 5GMKa 1TL1A 1RT1A 4O23A 3N5FA 1RT6B 2IBKA 1TL7B 1TKZB 1DRZA 1AA1B 1TL3A 4RLEA 2W7OA 4DV4F 2YWKA 4W4MA 2JFDA 3FFIA 4X4UA 2OPRB 4K7QA 1M5OC 2XMWA 3M7VA 2MHNA 3JQMA 4C0BA 2ZVSA 3OFHA 2GX8A 4J91A 5HMXA 3PEJA 4CLLA 3CCTA 2OMLA 1LWCB 4LF8F 2K7JA 1FKOA 3AY0A 4TQSA 2B9WA 5ETQA 3CXCR 5A6WA 1FNMA 3CIZA 3W62A 2NZCA 4NE9C 3P6YC 2F9DA 4OHYA 2JLGA 3BYPA 2LXUA 3AJ1A 1WTBA 3MD1A 1R7IA 2FUG9 1JLBB 2QJ3A 2J0SD 2B51A 4F0HA 2VJVA 4YOEA 4V1Ak 3UVJB 3AB2B 3Q83A 2CYYA 1RTZA 3R5CA 4X2BA 4QIEA 3F44A 4OHVA 4Y2CA 1RWPB 1Q8LA 2RU9A 1KSPA 1PYTA 4M5GA 4JI0F 3OFEA 5CABA 2V4RA 3NGKA 3F56A 3A8IA 3VAMA 3HK2A 3HVAA 3D4JA 2VQEJ 3LWMA 1N52B 3WBZA 4BC7A 3O8WA 3T1AA 1NDCA 1SJ3P 3VQTA 4MYUA 1N0UA 3D9BA 2XY7A 2VPXB 3TEGA 3PRBA 5KT3A 3MAHA 4B3SJ 4P7TA 1RKIA 5DDRC 3KOAA 4R5PB 5BYQA 1M5PC 3G8TA 1NKEA 5KG6A 4NA3A 2HHSA 2OFGX 5L1LA 1WG1A 4B9MA 1KP6A 2VBWA 5E3CA 3I82A 3G6YA 2Z58B 2XZTB 4WXOA 1MWQA 1CJTA 3MMCB 2QA4G 2G1HA 4O4GB 1DTQB 1MROB 4LR7A 3OR2A 3VVUA 1CQMA 3BO2A 2QE5A 1RTDA 1RSCA 1N33J 5LSRA 3JAMU 4K2JA 2ZC4A 2HFNA 2D1CA 1FVSA 2R8KA 3CPWR 2KRBA 1VGYA 1VI7A 5D0GA 4KIAA 2OO4A 3EPGA 2CNLB 3RBZA 2M9KA 1U6BA 4CNYA 2K3KA 2V0NA 2WONA 3GYXB 2JLEA 3VAHA 1C4AA 5HJXA 2XULA 3ZZPA 3QIDA 3J81j 4F2SA 1FD8A 3FMBA 1REGX 2WOMB 2BQUA 2ZOMA 1Q86T 1NSPA 4ZPBA 2SXLA 3MCNA 2IJFA 4YUDA 2MJNA 1B0TA 4I69A 3SQGB 3I55S 4RW9A 3IR6B 2AF6A 2ASJA 5K8NA 4CYUB 2DISA 4URQU 3WQPA 3MR5A 2BM0A 4A4JA 1QAYA 3H40A 1VQPS 2BANA 1LWFB 1T9YA 1VRTB 2A18A 3NMAA 1XR6A 4PG8A 2KJWA 1IR0A 2J9DE 2I0XA 1KD1T 5D3GA 3C15A 5KFAA 2WBMA 2HS0A 4PQUB 5T7LA 4DQRA 2PO4A 1NM2A 3KYLA 1CJVA 1NU4A 1S12A 2JHEA 4ED3A 2DPIA 2DXFA 4USKA 4JI4F 2HZAA 1JNZB 5K8PA 3UD4P 1UW4A 4USWA 4PRFA 2ZZTA 3E01A 3D6HB 4ZHRA 2CJBA 4UOCA 1S1TA 3R1HA 1ZYQA 5HMWA 2C3UA 4WIIA 1LW2A 4X4RA 1XQIA 3LTOA 1Q0NA 2NUHA 4DX8H 4YS2A 1UP1A 5A8KB 1IWGA 3CVKA 3W3SA 4FS1A 4PYAA 3DRXA 4B3RJ 4UZCA 3MECB 4AYBD 1YRTA 3W5XA 3QRRA 2IRXA 3KG1A 1Y9OA 4UOGA 4ED5A 4QWDA 2J6SA 4F8RA 3KK3B 3AD7C 1KR4A 2ZNYA 2UXBF 4LF7F 2HHTA 4QPTA 4QU6A 4FP9A 3S1TA 4ZK7M 4Z7CA 1IKWA 3CULA 4ZLJA 4PWWA 4EEYA 2OPSB 1S97A 2XHCA 1H7WA 4P2FA 1RYSA 4QCLA 2ZDPA 3C8YA 1U1MA 2XTJP 1Q53A 4GKKF 3ENWA 1KRPA 3I6PA 1YJUA 2KYZA 1SPBP 3OD2A 4JI2F 2M88A 2VBYA 4N8OA 1HWLA 2CG4A 4P2XA 2HRYA 5HVHA 2KT2A 3PFOA 1FNXH 3GP9A 3FNNA 4NLPA 3G9CA 2CQHA 1EETB 3G8SA 4ZIWA 4PG6A 3HCXA 4WFAQ 2MKKA 3KDNA 1QSYA 1RA6A 1REVA 3FSIA 2UXDJ 2OEMA 1BWVA 3GIKA 5CYQB 2E1AA 1HBOA 3D6FB 2OSQA 5SZTA 1HQUB 3CD5A 4USTA 4RKUC 2VG5A 3MAAA 3PJ9A 4PR6A 4P75A 4USUA 4DQPA 3DM2B 1NJIT 1KOHA 3PHTA 5F8JA 1WHXA 3D28A 4U95A 5E3RA 1NKBA 3LQVA 4FS2A 2E5LJ 2V4QA 1X5SA 1K8AT 3MMBB 3PEHA 4EK2A 1RBLA 4ELUA 2RVJA 4DFPA 1DARA 3PFEA 4YDXA 2W4PA 3H98A 5G0RB 4MT1A 5AXLA 2C2EA 1ZBTA 4G1IA 1H72C 5HATA 3ELHA 3FEYB 2JLFA 3TR5A 2MKSA 3FK4A 4NLTA 1CQNA 3IRWP 2VDHA 1EB0A 1SB6A 4NYOA 3TA2A 1X0PA 2LDYA 1WDTA 2H9ZA 2VFVA 3DHXA 4DFKA 3M8WA 3HHLB 3IBWA 3P45B 1SC6A 2E1CA 3P49B 4IQMA 4XO0A 2DB1A 2HHXA 1LWEB 1T95A 3BGLA 3EVOA 1NMEB 3T1HJ 3SIPB 1NDLA 2AJQA 3HT0A 2WSEC 2DD8S 5FLXU 3FC9A 5JMNA 3DNCA 1UETA 5I3QA 3MM9B 4LSNA 3G6XA 3A13A 4Y2MA 3WIUA 3T5HA 2RQ4A 1K1SA 4P73A 2V2VA 2IMWP 3FQLA 1FDNA 4KV8B 1MU2B 3H25A 5KFYA 5KOXA 4HHHA 4IDKA 3RTVA 4C7QA 4LF4J 1FTRA 2DH7A 2ADBA 3W8PA 3ZZZA 4YHHF 3R7NB 2KZMA 5KT5A 3CB4A 4OYMA 1RI7A 3GG1A 2HRTA 3LF0A 4DL4A 5K14B 1VC5A 4DR6J 1BQMB 1DBDA 1Y11A 1UEUA 2JDJA 3GSDA 1FJEB 2IIHA 2O01C 1WC0A 5A6PA 4NCBA 2CNOB 3M32A 1TL1B 2M52A 4WIQA 1L3VA 4WU2A 3JB9k 1MN9A 3LP0A 3JS9A 5D15A 2KH9A 5IWAJ 1WEXA 4I67A 4RNOA 3LAMA 1TL3B 4ICLA 2R9LA 3U02A 2XCAA 2UUAF 2BKNA 1QE1A 1SKSA 1TAQA 3RB6A 1HBNA 4CT8A 1RT3A 1IBKF 4G1QA 1T94A 1TFYA 1URNA 4NYPA 1T03A 1VMBA 5DDPC 1S9EA 2Z2LA 2XNRA 1NPPA 4MKAA 1FKOB 1X4DA 4CLSA 3M6UA 4LF6J 4HLBA 4KHPF 2YNIA 2LEPA 1OSDA 1T8EA 4B02A 2IC3A 1PG5B 2EK6A 1VBXA 4OIXA 2KN4A 3P8BB 2DK2A 2PMHA 1SL1A 2IDLA 2BE2B 3BN7A 5LMUJ 1A0OB 4DSEA 3K5MA 4GO7X 1UVIA 2IVMA 1AUDA 3VGSA 1FEHA 4W98A 1HI8A 3ZNJ1 2V50A 3MCMA 3FCHA 1RBAA 4USHA 1R8HA 1VLOA 5E33A 1TK0A 1U48A 1XBWA 4ZLPA 2W9BA 3GJSB 1PAEX 1R43A 3NMRA 5L1KA 5THWA 1VHFA 2KG1A 2OD4A 2HVIA 4JYAF 4P2MA 1S0VA 2EFPA 3KJFB 3MCSA 2C2RA 4OV1A 5MAOA 1OY6A 3AB4B 4UQGA 5KFWA 2HG4A 3RW6A 2YPYA 4JI5J 2BRLA 1RT4A 2N82B 1W7WA 3ZC4A 2K2PA 1PKUA 4YMEA 3FBFA 5F41A 4ANCA 1DTTA 2XZDB 5ETVA 2GJIA 1OO0B 2ATLA 5T14A 2BJ1A 3UCGA 4Y00A 5LMNJ 5C25A 5L38A 2B6AA 5HJYA 3PRVA 1B99A 3WC2A 2DGUA 3CJ4A 2Y9HA 2EC0A 3GILA 4C98A 1YRXA 1MG7A 2GAHC 3H20A 4EBEA 1CJTB 1YZ7A 2IRYA 4L75A 1HPZB 1L3SA 4CRJA 2GJ2A 3HKWA 3W9IA 3OR2B 4F0KA 5B0FA 4K5RA 3KDOA 1P1TA 3MI7X 4Y28C 3OLBA 4FPIA 1XC9A 2M4MA 3CTRA 3RW7A 3ENQA 1RTDB 2LKZA 3I32A 4UUWA 4HT5A 3MTKA 2HFVA 3AQOA 2MZSA 3M9OB 5AJ3J 1FRHA 2CQPA 2HBYB 1C1BA 3EGWB 2AV5A 4MKVA 5IFMA 4LBHA 3NNAA 3DU5A 4EZ9A 1YJTA 2WONB 1PYSB 2AX0A 4PG7A 2DXEA 3OSNA 1TFWA 4ZVPB 2HPUA 4ZVOB 1X7VA 1R0CB 2UU9J 4A8YA 1Y4ZB 2MZQA 5HK4A 3WX8A 1SH2A 1FWLA 4RW6B 3BQ1A 3MD3A 1UW9A 4RW9B 1RQ0A 2DPJA 3BGUA 1SKWA 4LQ9A 3ENVA 2AZ3A 2H48B 3CUNA 2PSZA 4F7VA 4LF2A 2BANB 1OPZA 4DSFA 2G0CA 4OHXA 2KU7A 3P3DA 2G2ZA 3HULA 1X31C 1KNZA 2C2ZB 2EG1A 3ZZUA 4NEZA 1QM9A 5D3GB 2JSXA 3C15B 2C2NA 1RHMB 5T7LB 2AT1B 4X4NA 4DV2F 1L3TA 2ZKUA 2DR9A 3TX0A 1CJVB 2XMVA 4TLRA 2V67A 2VQEF 1IBLF 4FXWA 2OP5A 3EYZA 1X9SA 1Q5YA 3OPKA 5K9FA 2R8HA 4LF5J 4ZLNA 4ZHRB 1TKXA 5J1NA 1S1TB 2KL8A 4WBFA 2DNPA 2E7WA 3G87A 1HNZF 1D8YA 3CCLS 2GC8A 3NLCA 1UCNA 4K5SA 5M2RA 2LMIA 1GMVA 4GVLA 2J9EA 4ZVUB 1HKAA 2OLWA 2CPHA 2ZBRA 2ZZMA 5B7WA 1BE4A 3M9NB 1HW9A 3KLHA 3GU0A 4FDFA 1YJVA 4E8UA 2B7BB 1VBYA 1RA7A 2WVCA 5E0OA 4E98A 5L46A 3CCUS 4R0JA 4PPZA 2W2PP 2XGQA 2HLTA 4URSA 4OJ1A 5E2QA 4XPEA 3BDEA 3A3PB 1YKWA 1JLGA 4ES1A 1M1KT 1N33F 1MW7A 1FF2A 2XGPA 4B3TF 2WVBA 2R7QA 4A8QA 3MOJB 2VL1A 2YKOA 4RBUA 1QUPA 2HAIA 1DLOB 3QPIA 3ETMA 3NS7B 3TRGA 3HO1A 1RT7A 3CJ3A 3AOBA 2Z2ZA 4Y65A 3BR8A 4MMOA 1JK9B 2BVZA 2YNGA 4GC7A 4ZN3A 1ZA2B 1WSVA 2EG2A 1RAIB 3PV8A 4RBVA 2IA0A 2F8MA 3EX7B 5F3ZA 3G86A 1REVB 2QV6A 4LRAA 4V19J 1HLWA 4R8UB 4PXBA 3TZZA 4NLUA 1R31A 5ITHA 3A12A 2M8HA 4Y6IA 5FIIA 3HD1A 1HBOB 1T9UA 2EK1A 4F26A 4JI8J 4JP8A 4YEAA 1UJ6A 2VG5B 4K4UA 3MAAB 1N54B 1X0FA 1WC5A 2O5DA 2EKYA 5F8GA 4RUAA 3LANA 5HQLA 4U9RA 1DAXA 2HLUA 4DQSA 4ZJQA 1ZM9A 4Z37A 4JI6J 5GVQA 2WB4A 2DHHA 3IM9A 1D1UA 4S0MA 3O3LA 4RL1A 3TNVA 3OUYA 1S72S 4N77A 1IQTA 1TV6B 3QNWB 2LEBA 1B64A 1LFPA 3QRPA 4E2FB 3R27A 1HNXF 2R2UA 4FN5A 5E3QA 3BH7B 4J5OA 4F3MA 5KFJA 3LPYA 1FFWB 1MLAA 4DSLA 1U1KA 2Z2MA 3HHLC 4X66J 5DS7A 2RF2A 2OEJA 4KGVB 5IQQA 2HW3A 2I9SA 2FGOA 5DLGA 2C22A 4NCAA 3O6QA 1RDRA 1WF2A 4PWDA 4WU3A 4CTAA 3I96A 3CMAS 4QBUA 1D9DA 4FYVB 4AQYJ 3RGIA 2RRNA 2UXCJ 1Q79A 4ENOA 1VCTA 4HHUA 3I9ZA 2GS8A 1LW0B 4LIWA 2QL5B 1VHIA 2RT3A 2KVQE 1FESA 2QLWA 3EWGA 3BZQA 2GA7A 2DXDA 5A8WB 2E5IA 1XMOF 4YP3A 2CQCA 4KE5A 3FGVA 5D77A 1IR1A 3TUJC 2J7UA 4F0MA 1GXTA 2A3JA 3W60A 5H9EJ 3Q24A 2XYGB 2FHMA 4DMZA 3W5ZA 4LFCJ 2EC2A 4IH5A 4I2PB 2UVWA 2YKAA 3FKBA 4PG5A 3CJKA 4CDIA 2XI3A 3H42A 4LR8A 3WDOA 4EWTA 2XO7A 1S5ZA 3CC2S 1RAFB 2QX0A 1JLQA 1OQ6A 3N6MA 3N4WA 4RW4A 1JLAA 4J9RA 1BQNA 2G4BA 3W2WB 2H5IB 1V3RA 4ED2A 4NEYA 1QUVA 2PT0A 2PI5A 2Q6BA 1E6YA 2XLIA 1B4SA 1SJFA 1SJ1A 3D0HE 3BM7A 3KHHA 1EZZB 4OZNA 1V5IB 3LP0B 3CMES 4DOZA 4RNNA 4F04B 5DGAA 1I94F 7FD1A 2HWHA 3QRQA 8ATCB 1X5TA 4PAAA 3EGZA 2GIRA 1U1LA 4HDGA 4A8XA 3W9JA 4Q44A 4UUXA 2BQ3A 1QE1B 5KFMA 4OI4A 2C2KB 2V9KA 1FJGF 3NWGA 2DGOA 1HBNB 3NS6A 2CJQA 2RAQA 1RT3B 4G1QB 2HS4A 3PW7A 5FJ4A 1T03B 3EICA 1WELA 3O44A 4DV0J 2CJXB 1S4EA 1S9EB 2HHWA 4G6VB 1TQLA 4F36A 1Q81T 3CWJA 1CJKA 3BB5A 2BBEA 1ZH5A 2BX6A 2IYIA 4IOBA 3G8QA 2XSJA 2GIFA 1VQMS 2ZM6F 4DF4A 4N41A 4QJVA 3VAGA 1RT2B 4U96A 2IVYA 3PJXA 2ZBIA 2AU0A 1IKXA 4HEA9 2V9WA 4PG4A 4LQ3A 4QW9A 1P9YA 1C1CA 4M95A 1KQKA 1H7XA 4LR9A 1EP4A 1RABB 1TKTA 1X4BA 4MK8A 5H9EK 2VICA 4QQBA 1GEHA 3T1YF 4DV6F 4JI1J 3TJ9A 5EHHA 4Q45A 2OUGA 1PILA 2W9BB 2HHPA 2HHHJ 2F4VJ 4HYKA 1HNVA 3DLHA 5KT4A 3BYRA 3L9ZA 1SC4B 4CIOA 2UUBF 2QMWA 3LWLA 3AH6A 1FCAA 4OJ3A 4ZN1A 1RAAB 4GMKA 5E3PA 2GAGC 1NJYA 4DCJB 4U67Q 2M7SA 3U27A 5HBMA 1HD0A 1RT4B 2KO1A 3LH2S 1OWXA 2MLZA 1DTTB 1NXIA 4YR2A 3THTA 5ETOA 3PO5A 3OW2R 5EX0A 5AE2A 3LA0A 5C25B 3OBIA 3TA0A 4KPYA 4TY8A 3KK1A 2B6AB 4C2MA 4NX9A 2J9CA 1S1VA 2P6TA 3BSNA 1H74A 3RAMA 1UZHA 2QMUB 3MR7A 5LXYA 1EJ7L 3BQ2A 5IC6B 1S9GA 3JTNA 4DX7A 1B7YB 2NS1B 3OTEA 2MZTA 3EE3A 1IUJA 2WHOA 1Q1KA 4RX6A 2CKWA 2Z8QA 2BR0A 4K4WA 2JJ4D 1WKLA 4XIUA 5AT1B 1U4BA 2IDEA 3DDIA 1YDLA 2JNJA 4RNHA 3ZTRA 1A7GE 1VQSA 1FJCA 1U1OA 2DRDA 2KKHA 2E66A 3Q23A 2ILYA 1JKHA 2VQFJ 5GAHU 3Q86A 3AXKA 3ILLA 3KMQA 1GAOA 3H2UB 1RE1B 2V2ZA 4RWXA 1M0SA 3DLEB 5F8LA 3BSCA 3PNIA 5GMEA 1CC8A 4DL7A 2XY6A 5GAGI 2KI2A 3D3CJ 1R27B 5CH7B 4NYZA 2R7TA 3BQ0A 3MR2A 2F1FA 4RZRA 4DX5A 3DMJA 1FE4A 4KBIA 5HMYA 1KLMA 1ZS6A 2GHPA 3SFGA 4DV4J 4OYBA 4LSZB 1KFDA 2V94A 3QLHA 4HL9A 4CLFA 2CNNB 1SKUB 1NRKA 3MM8B 3RAQA 2RB7A 1UFLA 2RILA 2GGPA 2AYMA 2WVEA 4ZLLA 4ED4A 3PY8A 4M5KA 2IM1A 4DS4A 1WC3A 1WTFA 7AT1B 2NZ4A 5IS2A 2NXJA 2CPEA 1KKHA 2HWTA 1WACA 1FE0A 4EUVA 1LOUA 5D0RA 1M5VC 4LF8J 3DOMA 2RRAA 5ETNA 2KB2A 2RQKA 4J9VA 4OYZA 3ZTPA 5I42B 3T5LA 3BF4A 3EVMA 1R6VA 5AXMA 3PIOQ 3G71S 2YWGA 5A0YB 2YX4A 2R8JA 4FXVA 1I6JA 5HMZA 4O4RA 3BEGB 4RUBA 1W2BR 1FK9B 4ECSA 2VC0A 4M8LA 5FDLB 4EBDA 1U8SA 3DXSX 1XR7A 3W66A 3BPSP 1VQLS 3NS5A 2AGQA 4JI0J 3R5JB 2YVSA 1SH0A 1NHUA 2CWXA 3QIPA 1HBMA 1H0HB 1RK8A 3M2UA 4KKOA 2RSQA 1IKVA 1F6TA 3POTA 1UTAA 1QY7A 1SKRA 2CUYA 4TYBA 1YJ9S 1OS5A 2N4DA 2HIYA 3NGTA 4ILMA 3I5CA 2AGOA 2D3UA 5GAEU 3R5AA 1YX2A 5ADZA 1K0TA 2D7SA 2RHQB 1SIWB 2EW9A 1RT7B 2V8PA 1G1XA 3PM9A 4O0IA 3X3UA 4DPOA 1S1XB 3C16A 3K0JA 3KLIA 1M5KC 1RADB 4CLUA 1QAJA 2MZ1A 3GR0A 3UN5A 2VASA 2YNGB 2AP6A 2UU9F 2E44A 3A8EA 3ZFVA 2IFXA 4ZPTR 5IZHA 1WI8A 3M6VA 3MPUB 4ZP6A 1KWMA 5E5NA 1D0EA 4DPYA 4B17A 1TU0B 2BJEA 4F4ZA 2FJEB 3V6DA 1XIQA 2XB2D 5E7OB 4WE1A 1T3OA 2J9DA 2MGZA 2KFNA 2IAJA 2X1FA 4IQXA 3BSAA 2EKNA 2FB0A 2EFQA 4X4SA 2CQ0A 2A6OA 2MQNA 2QLJB 3TVZA 4OI2A 3C6TA 1C0UA 3TI0A 2DJWA 2LECA 1W2IA 4OJHA 4DV7F 3PW4A 3T19A 1JWWA 5CYMA 1LKZA 4K59A 1HHTP 4UQTA 3IN5A 4OL8A 1KOOA 3UD3P 3OT9A 1KTVA 2LU1A 1EX8A 2RUGA 3EMTA 4KC5A 3GIRA 2BMBA 2HK2A 2P6SA 4WP8A 4UY8T 2VF3A 1H6KX 2H4YB 3HDSA 2N3OA 5HVGA 2B4VA 4HTIA 2ASYA 4DLGA 2Q43A 1EKSA 1WC1A 4Q8FA 2BOAA 5LL6d 2GV1A 2ASLA 2M5YA 2RF2B 4XPCA 2JFKA 1A9NB 1BLUA 4PWDB 1VRUB 3BKTA 1VIOA 4WTOB 3DKDA 4K4TA 3CO9A 1VQ9S 2H5JB 3KG0A 1VQ6S 3PO4A 2W9AA 4UOHA
chains in the Genus database with same CATH topology
1JIHA 4PG6A 4IO9Q 4DL0C 4NRUA 4KB7A 1LQ9A 3T1HF 4HI1A 1WF1A 4OHZA 4MYTA 4WFAQ 2R7RA 2MKKA 2IA6A 4K50A 3HVRA 1KEKA 2DH9A 3NG8A 1QSYA 1RA6A 1REVA 3M8PB 3AHPA 3MEDB 3FSIA 2CJ9A 2VOOA 4AXJA 4DN9A 3FDSA 2MQQA 2MZJA 4F02A 3OTCA 1BQMA 3TW0A 4JI7F 3RU0A 4H4MA 3GIKA 5CYQB 2P9CA 2VODA 2E1AA 1NK8A 1HBOA 3U7JA 2OSQA 3E2EA 3VAKA 2ZHAA 5SZTA 2QYCA 1HQUB 3CD5A 3LO3A 4U6PA 4RKUC 2JL9A 4OZJA 5HP1B 2VG5A 4M5DA 1L3UA 3BGFA 1R0AB 4PR6A 1WHWA 3HLUA 3FRYA 2IRUA 4CI0B 4DQPA 1TK8A 1UFWA 2J0XA 3DM2B 3DRRB 1NJIT 1WI6A 2ZH3A 3UR3C 1U45A 1KOHA 4OZ0A 1WWHA 2HHVA 3OFFA 1DJ0A 2YNFA 3CJKB 4KGKA 5F8JA 1C4CA 1WHXA 3D28A 3LP1A 4LF4F 3CDAA 1T3NA 4DG1A 5E3RA 4RW8A 1NKBA 2ZBCA 2B3TB 3LQVA 4KAIA 2KHDA 4IFVA 4FS2A 1YBAA 2V4QA 1X5SA 2K1RA 5D4LA 1K8AT 3UFCX 2J0QD 1SJQA 3WX4A 4B3OA 1JLQB 3MMBB 3PEHA 1BGXT 4KFBA 2YQ3A 3G4SS 3ONQA 4DL6A 1N5SA 1VQYA 4ELUA 3DDKA 4B9VA 1JLAB 4OX6A 3HT3A 1BQNB 1SH3A 1X4EA 2RVJA 3ITHB 5B0EA 4DFPA 1DARA 1C0TB 1HBUA 3PFEA 4B9LA 4YDXA 1R89A 2W4PA 2X51A 3E01B 3H98A 5G0RB 3U1LA 3Q8SB 3KMSA 4I2QA 2FHOB 2U2FA 4DR6F 4O44A 1D3WA 1SV5A 4NLSA 4X4OA 1LW2B 1RTIB 1ZM3A 5AXLA 3KHGA 3V6DB 1BQXA 1E6YB 1YITS 4LF9F 2QA2A 2APOA 4WE1B 2C2EA 4BBYA 2E9ZA 3KLEB 2RD5C 3IG1B 4FXDA 1U1QA 1ZBTA 4G1IA 5KFRA 2IAJB 2ZJRQ 2ACYA 3MM5A 3PW5A 3IRXA 2PA3A 3JSYA 1FRKA 3FEYB 3BREA 2JLFA 2XHWA 2YKQA 3RBDA 3CCJS 3TR5A 4GKJF 5HLFB 2MKSA 1F2GA 4NLTA 1CQNA 1Z1ZA 1VLYA 1GX5A 1I1GA 2ALZA 4K0KF 4QW8A 1YIJS 1RJJA 1R8CA 3IRWP 4AL6A 3AQPA 4B9SA 3C6TB 1SB6A 3KJVB 3HJFA 5CQGA 5IWAF 4NYOA 2OPPA 2VG6A 1TL4A 3TA2A 2C3PA 3BGRB 1X0PA 4ETZA 2LDYA 2H9ZA 1FRXA 1K0VA 1IKYB 5D78A 3KLGB 2LVWA 2VFVA 2BE2A 3I4PA 3KG4A 4KQZA 3DHXA 3PX4A 4DFKA 2YTCA 4CO2A 2DGWA 3DLGB 2ZD1A 4PPDA 5F0UA 3HHLB 3D0GE 4X64F 5KG3A 3IAM9 1P6TA 1H2UX 1IXKA 4ZCMA 3IBWA 2V8GA 3DFEA 2KHCA 1QLNA 1SC6A 1Y0HA 2E1CA 3P49B 4IQMA 4OX8A 4NLQA 5GADU 4XO0A 4F25A 2DNYA 3S8SA 1IKWB 3FQKA 5KT7A 3QZ8A 2DB1A 2HHXA 1LWEB 1T95A 3I4HX 2Y1JA 3BGLA 4F50A 5BR8F 5FLXY 3LUYA 2RNEA 3DLLQ 4XK8C 4L3NA 3QZ7A 2AJQA 3I0RA 1TK5A 2WSEC 4QIWD 1V3SA 1YGYA 2DD8S 2VKZG 2F8HA 3H8YA 3JSRA 4IG0A 5MLCV 1IBMF 3RR7A 1U26A 5BYRA 4AL5A 2VB6A 3DNCA 3NBPA 1UETA 2J8AA 4C11A 2V2KA 5I3QA 5KFQA 3MM9B 4LSNA 3G6XA 4Y2MA 4FNHA 4BS2A 4LF6F 4OI1A 4U7UK 3KLFB 5DM6Q 4ERDA 3ICLA 3T5HA 2FC9A 1K1SA 2RQ4A 1KHWA 3G6ES 1FKAF 2IMWP 3FQLA 2UUCF 1FDNA 2V8DA 4KV8B 1MU2B 2GQCA 3EXCX 4EBCA 2CPZA 3KLVA 5IT9Y 4MIAA 1F5AA 3H25A 5KFYA 5KOXA 2HHUA 3MM7B 2HNDB 5LMUF 1JLEA 3TARA 3K2YA 3LP2A 3HF5A 2ZH7A 1QSSA 2VBZA 3TUIC 2HRUA 4IDKA 2IYGA 2BQRA 1SL2A 2DIUA 4DUZF 1VK8A 2OJ3A 3RTVA 2XEXA 2CQBA 4C7QA 3RAXA 2NSBA 4QWAA 1HNWF 1FTRA 3H4DA 3GR1A 2DH7A 2W9CA 4QU7A 2DR5A 2QLXA 2ADBA 1IKXB 2CQIA 2EI5A 2F9JA 3DN9A 5SUHA 4WFYA 3RZAA 2FLOA 3ZZZA 4YHHF 5H9FJ 3WZ0A 1C1CB 3CCSS 5J1PA 2L9WA 2KZMA 5KT5A 2RU3A 3CB4A 4NLOA 5CCLA 4C8OA 3CCES 1EP4B 4Q43A 3HZGA 4QR1A 1TKTB 3M2VA 5IXUA 3UI3A 3MM6B 1APSA 1RI7A 2YWFA 3HP6A 5J2PA 2V8VA 3GG1A 1VIXA 3Q8PB 1XNQF 3M8QA 2UV8A 3D1QA 3THPA 3LF0A 4DL4A 4C9DA 5K14B 4B3MF 1VC5A 1BQMB 2FPHX 1N5VA 2J76E 2OFHX 3MUTP 2VA3A 2FHJA 4J9PA 1S4FA 1GXUA 1DBDA 2CZVC 2GMLA 1UEUA 2JDJA 5KG7A 3GSDA 1RAJA 1FJEB 4FBTA 1HNVB 2O01C 1ZPVA 1UJ5A 3CE8A 4KO0A 3M32A 5A6PA 1S1WA 4NMLA 5K8OA 2NYIA 4A8WA 5HROA 1UVMA 2WSCC 1TL1B 1N5YA 2DHAA 2FHJD 2M52A 2YKPA 5IM0A 4DV3F 3R5DA 2AWZA 2HFZA 1L3VA 1HPZA 4NA2A 1S49A 3D1OA 4EZ6A 4B9UA 4WU2A 2HNZA 3JB9k 4MFBA 4DSKA 2MY8A 4WYLA 3LP0A 5L39A 2X1GA 2KH9A 2NPFA 2XLJA 3OXFA 1FRMA 1WEXA 3E51A 4X65F 1H38A 2EFVA 4I67A 2DNGA 4RNOA 1IQZA 3LAMA 1RT5A 4P2SA 4JI5F 5HBMB 3U1NA 2DGSA 1TL3B 3CDWA 4ICLA 4DG1B 3CCQS 1VQOS 2R9LA 3U02A 1HI1A 5B0AA 1S6PB 1N34F 2XCAA 3NRBA 2UUAF 1Y00A 4YB5A 5AE1A 5JXSA 4HDHA 4WZQA 3EGNA 4B3OB 4F4WA 2MJUA 3OVSA 2N4CA 3DRPB 1QE1A 4Q0BB 3KTQA 4IR1A 2L3MA 5LMNF 1OPIA 3GFXA 4ZP7A 2HGLA 1SKSA 2GHVC 2OPQA 1TAQA 3RB6A 2YNHA 2ZZNA 5C42B 4TY8B 4DR4F 1HBNA 1UWBA 4CT8A 3KK1B 2IJNA 3L95X 4CNZA 1RT3A 2VA2A 1IBKF 4G1QA 4A46A 3OQ2A 2KFYA 3B4MA 2HHQA 3QGIA 1T94A 1F0XA 3HVTB 4D3GA 1K9MT 3D54A 3F41A 4RWWA 3SZ2A 3DOLB 1M90T 1TFYA 2ZH4A 4I7FA 1URNA 1XMBA 4NYPA 1T03A 2LA4A 4B08A 1UL3A 1VMBA 1S9GB 5DDPC 3OSPA 3HM9A 1S9EA 2Z2LA 2XNRA 3N0VA 4MKAA 2WAQD 1FKOB 1VK3A 3DYAA 1X4DA 3M6UA 5CXTA 1SUQA 3M1VA 3RRKA 2F40A 3DOKB 4RNFA 4IH7A 5CCMA 4O3OA 4HLBA 2CIMA 4KHPF 2B9XA 5AE3A 2MDAA 2YNIA 1N6QA 2LEPA 5B0BA 1OSDA 1KONA 1TR0A 1U2FA 4B02A 1T8EA 2IC3A 2OPPB 2EK6A 1VBXA 4OIXA 2KN4A 2DK2A 2PMHA 4RW6A 1SL1A 3T6BA 1U49A 5E3AA 3CC7S 3SMZA 4I6YA 2BE2B 3QO9A 5U47A 3BN7A 1X4FA 4QR2A 2KM8B 1TAUA 4BHQA 3IXQA 1X9MA 5EWFA 3LOUA 2PIIA 1IN0A 4H4KC 4DSEA 2GMJA 1S6UA 3K5MA 4NZ6A 1TKDA 1U09A 1VS3A 1XWLA 4GO7X 1UVIA 2YX7A 2JX2A 4ZS6A 2XI2A 2HQ3A 2IVMA 1AUDA 5EX3A 2ZH5A 3MDFA 3M8RA 1FEHA 3LW5C 3M2RA 3SCJE 1JLFA 2O67A 4DJBA 5KFKA 1HI8A 2V4JA 1S1UA 2UVUA 2QMXA 4F4KA 3KFWX 4AFFA 2DNZA 3UCZP 1S48A 2HWIA 2KT5A 5AJ3F 4NLGA 3GYNA 4ATNA 1K73T 4HKQA 3FCHA 3PRDA 4YY3F 1W25A 1XR5A 4KTQA 1KQGB 2ZH9A 1NK9A 4A8OA 3JYTB 2G1DA 4P7VA 2YKNB 3H2VE 3I0RB 2HVHA 3QGPA 4USHA 1U25A 1JKHB 4FF4A 4C8KA 4O3QA 4MK9A 1R8HA 4KHMA 2DO4A 2W25A 1Y5LB 5E33A 4ED0A 2MB0B 2PI4A 4HTJA 1TK0A 1U48A 2DGTA 2ABYA 1HR0F 1RYRA 1YJNS 1XBWA 4ZLPA 2WTFA 2W9BA 4WTYA 1U1RA 1KVIA 4LSNB 3TAMB 4ZPCA 1R43A 5DJBA 3NMRA 4WKYA 5L1KA 1RTJA 5THWA 2QIFA 4RW7A 5K8MA 4ID5A 1DURA 2CQ1A 5HL7Q 1UA0A 1FHTA 1VHFA 3OL6A 2KG1A 3UCUP 2OD4A 1GTEA 2YKMB 2HVIA 2OKQA 4JYAF 4C8MA 5I4MA 4AL7A 1URRA 2B43A 1S0VA 3MMJA 5A8RA 3UE2A 2CQ2A 2ZH2A 2DNRA 3SYZA 2EFPA 3L09A 4LSLB 2B7CB 4G1PA 1P9QC 1JLEB 2DTJA 5J1EB 4IDKB 3CCMS 3HMJG 3MCSA 2C2RA 1TKZA 2LCWA 3MPWA 4OV1A 5MAOA 3AB4B 6FDRA 4UQGA 5KFWA 2HG4A 2MSSA 3KHLA 3DU6A 3RW6A 4ZPVR 2AYBA 4USIA 5CZXA 2VG7A 3GZ7A 2BRLA 4N47A 5J2NA 1RT4A 2N82B 3DMJB 3ZC4A 3Q8RB 2K2PA 5D4PA 1FT8A 2W7PA 1AXQA 2CPFA 4YMEA 5KG0A 3J7Z5 4ECRA 2Q79A 5KFIA 5F41A 1KLMB 2BYCA 2AYEA 1DTTA 4ZP8A 1SJ4P 3FJ2A 1J5OB 2ZNZA 1GXLA 2E7XA 2DR7A 3QLHB 2GJIA 2OPRA 1CC7A 1KVJA 1S7HA 1OO0B 5CYJA 5L1JA 2ATLA 2OMOA 4KGMA 5T14A 3C2PA 2B4OA 3UCGA 2FVSA 4Y00A 4DSJA 5C25A 2Y1IA 1VBZA 4JI1F 5L38A 2B6AA 2UP1A 4O3SA 2GGPB 4TYAA 4F3QA 1UEVA 3WC2A 1RWUA 3MEGA 3V6KA 4CCHA 4Y2AA 2DGUA 3ULHA 1JJ4A 2WW8A 3M8SA 3V81B 3CJ4A 3UNGC 1FTCA 4X62F 4NZ7A 1S6OA 2EC0A 1GTHA 4YR3A 5JJBA 2E29A 1H98A 1U47A 3GILA 2XG8A 2VPWB 2KXNB 2XC9A 4ED7A 4YB7A 2D3ZA 3CEDA 1LWCA 4C3KA 2XLKA 4KO0B 3M32B 4C98A 5KFHA 3TA1A 1O0PA 1YRXA 3H20A 4EBEA 3OXLA 4WYWA 2X1AA 2IRYA 2RMLA 3VQSA 1HPZB 2CQDA 5I3UA 1L3SA 4I0WA 3N9UC 4C8ZA 5EN1A 2GJ2A 2HNZB 3HKZD 3HKWA 1J2VA 3M30B 2C3OA 3OR2B 4LF5F 2L9NA 5B0FA 4K5RA 1P1TA 2K8GA 3MI7X 4Y28C 4NZ0A 3OLBA 1XC9A 2M4MA 1JLCB 3CTRA 2KXFA 2CPXA 3RW7A 2V8HA 1T05B 4ICLB 1KN6A 5D8HB 3ENQA 2ZE2A 2LKZA 3I32A 1RTDB 3OV7A 2EBEA 2GW8A 4RBTA 4UUWA 3MPVA 5G4DA 3J80Y 3VR1A 1X9WA 3K57A 3HHDA 4P6QA 4HT5A 5LJ3Y 3B78A 3MTKA 3V4IB 1JLBA 1AROP 4R25A 4IG3B 1HMVB 4ES3A 3K59A 3AQOA 3DI6B 2CJKA 1U6ZA 2MZSA 2HIQA 2Q6CA 3M9OB 1O51A 4DR2F 1QJHA 2RH3A 3IFEA 4BCAA 2RDIA 2XWXA 4TQRA 1DLOA 3N6NA 2FTRA 1FRHA 2CQPA 4ZCIA 4H4KA 1C1BA 5A2QY 4DQIA 5JVGQ 3EGWB 2AV5A 3MHYA 3GV7B 3T5JA 5IFMA 3IGNA 3TOQA 4CZCA 3IAS9 3FVYA 4YFUA 3NNAA 3DU5A 4EYIB 4F4XA 4EZ9A 1WF0A 1XERA 1S76D 4ZMMA 1YI2S 1YJTA 1JB0C 2WONB 5GAHI 2AX0A 4PG7A 4TN2A 2XMTA 2HZCA 3N6LA 4IFYB 4C4WA 2BW2A 3QIPB 3CJ5A 3UQSA 1HBMB 5KG1A 3OSNA 1TFWA 3M2UB 3MPYA 4PCQA 3CD7A 5J2MA 2LQBA 5KFZA 4BWJA 2HPUA 2VONA 2PDAA 1CG2A 5T41A 4C0HA 4FNIA 5F3TA 1Q7LB 1N88A 3POTB 3BDPA 1X7VA 2YNIB 4MAKA 3IS9B 3MUMP 2ZITA 4A8YA 1CVJA 1Y4ZB 2MZQA 2IC3B 4BC9A 3KK2A 1HFEL 2M2BA 1SH2A 4RW6B 4MIBA 2EPIA 1FXDA 3BQ1A 3MD3A 1Z2LA 3LALA 1KQFB 1GQEA 2MKHA 3QO9B 4ALZA 2VH7A 4QWCA 4RW9B