1GAOA

Crystal structure of the l44s mutant of ferredoxin i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCASCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential.
pubmed doi rcsb
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gaoA00
1H98A 2VPYB 1FXRA 2XSJB 2IVFB 1C4CA 1RGVA 2FJAB 2ZVSA 1GTEA 1VJWA 3MMBA 1HFEL 2PA8D 1B0TA 1SIZA 2V4JB 1JB0C 4OMFG 1FDNA 1G6BA 4XDCA 1GTHA 4XK8C 2WSFC 3MM9B 1KQGB 5BYRA 2WB1D 1FCAA 4AYBD 4L6V3 1G3OA 2GMJA 4OV1A 2FJBB 2XSJA 1B0VA 3MMCB 1Y4ZB 3MM5B 2V2KA 2WAQD 1IR0A 1FRJA 3MM6B 2C3YA 2UZAA 2V4JA 1FDDA 1FRMA 6FDRA 1ROFA 2C3OA 7FDRA 1JNZB 4KT0C 1XERA 2C3MA 2VPZB 1R27B 5BYQA 1K0TA 3MM9A 4RKUC 3MM7B 1F5BA 1SJ1A 4DHVA 1KEKA 1JNRB 3IR7B 2FJEB 1A6LA 1FXDA 2VKRA 2FDNA 1PC5A 3MMCA 1DAXA 2O01C 4YDDB 3OR2B 3MM6A 1DURA 1Y5NB 1C4AA 5L8RC 4CI0B 1CLFA 7FD1A 3GYXB 1FDBA 3MM8B 5CH7B 3MM7A 1BWEA 1Q16B 1FRHA 5BYSA 1H0HB 2GMHA 2VPWB 3IR5B 1D3WA 3EXYA 1FERA 2C3PA 2VPXB 1SIWB 2WSEC 1BQXA 3OR2A 3C8YA 1FRXA 2FD2A 2Z8QA 1F2GA 3HKZD 2FGOA 4Y28C 3MMAB 3OR1B 5FD1A 3MM5A 1GAOA 1Y5LB 2Y0SD 1H7WA 2PDAA 3MM8A 6FD1A 1AXQA 4XDDA 1GT8A 1DFDA 1IQZA 1FD2A 2PMZD 1Y5IB 1FF2A 2WSCC 1WTFA 1FRKA 2C3UA 3EUNA 1FEHA 1FRLA 1BLUA 1FRIA 5CHCB 1BD6A 2C42A 3EGWB 3MMBB 3PNIA 4ID8A 3IR6B 1PC4A 3MMAA 3OR1A 5E7OB 3LW5C 2FJDB 1FTCA 1BC6A 1H7XA 1F5CA 1KQFB 1B0PA 1FDAA
chains in the Genus database with same CATH superfamily
3H90A 4I2PA 4LBPA 2FJAB 1Z1ZA 1S7HA 1F0XA 1NHVA 3LP2B 5D8HB 4URSA 1IBKF 3MCNA 3MTKA 4DUZF 4DR7J 4DL0C 2HVZA 2CQ4A 3CJTA 1RT1A 5J2QB 1NK7A 3M05A 5BYQA 4E98A 4IG3B 3AAWB 1TR0A 4G1QA 3L3CA 1WF1A 4RZRA 4NLYA 5EWFA 3ISND 4RW4B 3FCHA 4IG0B 3T5HA 4WE1A 2B9WA 1T9VA 2FVSA 2GAGC 1T03A 1F60B 4DFJA 2NXEA 1O5JA 1Y5LB 4E2FB 3SSRA 3E2EA 3RBZA 4A8XA 3KK3A 3QGPA 2XI2A 1MWZA 5KT7A 3NNHA 3N0VA 3EGZA 3L09A 4DPYA 4Q2MA 3MAQA 2ALYB 2LU2A 4DDFA 1C0UB 1EKSA 4CLTA 4RX6A 4CLUA 2PN6A 1SKUB 4WXWA 1OS5A 4DU8A 4QBUA 5DDQC 2BKPA 1N4LA 1FNOA 3O6QA 3O3LA 1D0EA 4L3NA 2NXNA 4JI6F 1SJ1A 2HZVA 4CT8A 3LP1B 3MAHA 1RLCL 2COLA 2CRLA 1SH0A 3AXKA 3OR2B 4TNOA 3IXQA 2ZBIA 3PIOQ 2J7WA 1NK5A 3D6HB 2MY7A 3UDVA 3VTIA 4RBUA 2V6AA 4NYPA 2C2NA 2B4VA 4PWUA 2YWFA 2R7WA 2EG2A 4G1IA 3OFHA 1AFJA 2LQ9A 2WBMA 4IH5A 2ROPA 4K4YA 1EETB 2A6OA 1HNXJ 1GEHA 1JMTA 3PDNA 1IKVA 3QLHB 4FKYA 2KYXA 2M70A 5C24B 2FYXA 4NLWA 4ZPBA 2AEJA 2GVDB 2MGZB 1HHSA 1O0PA 4OYWA 4ZJQA 3A12A 3NKYA 2GQCA 2W8KA 2X1BA 1YWXA 2X3GA 1RT4A 5ETTA 1S6QA 1WKJA 2IRXA 1W26A 2DNPA 3IGNA 3UVJA 3OTCA 4FPIA 3DC2A 3W9IA 3DLEA 3NAIA 3M32A 4XPEA 4LF5F 4ZVRB 4OZJA 2XI3A 1HQUB 3NWRA 3SCIE 2GV1A 3MAAA 3EE3A 3NOGA 4F67A 1D8ZA 5GAEI 4NZ0A 3DLLQ 2EFQA 1NKCA 2CPHA 2FGOA 2HIYA 2IRUA 2GQ2A 2OPRB 1SJRA 2EG1A 3R2DJ 3GR1A 5HATA 4ZCMA 3C66A 4KAIA 3JTPA 3SQGB 4KHPF 1WHVA 1HYSA 4LSLB 2R2UA 3M30A 3SIPB 2F3JA 2MKCA 1AUDA 1UVJA 2HLTA 2KB2A 4KB7A 1T8EA 4YR0A 1NKEA 2DGOA 2RKIA 2KG1A 3BH6B 1FFSB 2QA2A 1FWKA 2DRAA 2G1DA 3B6BA 1JLFA 3I4PA 4IYQA 2BEFA 2ZE2A 4U67Q 2IRYA 4R8UA 2LQ5A 2D3OR 3R5DA 3J7YI 4ELTA 2IC3B 2ZZMA 1F9EB 2RQCA 5FDLB 1YDLA 1T95A 4X65J 4FS2A 1H6KX 2LEBA 2W7AA 5IT9U 3GZ7A 1S12A 2EW9A 3IRXB 3FDSA 4PR6A 2Q6CA 1BQMB 1HBOB 4NLXA 4ZVEA 3GSDA 4Q5VA 2MQOA 1YQHA 2VC0A 2ZH2A 1XTZA 1E6YB 4FN5A 1JJ2R 1WG5A 4ECZA 2ZKUA 1B0PA 1FWLA 1T05B 2UVVA 1MU2B 4JB8B 2KFNA 4L3KA 1N33J 3W8PA 4FXWA 1SJFA 2CPYA 5JJBA 5IQQA 4B9SA 4PWDB 1NEEA 3CSKA 3PRVA 2OPRA 3K57A 2ERRA 4TXSA 5KG6A 4YN3B 4ENOA 4LF9F 3MMCB 2UXDF 4OJHA 4B3TF 1U02A 4M94A 4O44B 1RT7B 4X64F 2BX6A 3KWMA 2M7SA 2C2ZB 4UF4A 4A8YA 1VBZA 1WKKA 3GTYX 3QO9B 1RU1A 4JI8J 5J1PA 4J7CA 2XGQA 1FFWB 3K5MA 3GR0A 4H4MA 1X9SA 3H5XA 3Q23A 3QMQA 4A8SA 1DLOA 4HHHA 4BDPA 5F3TA 3QATA 2BMBA 2OAUA 4W4MA 1D8YA 2LFVA 4Q44A 2DNRA 5ETPA 4DR2F 4EBDA 3BGOP 3D2WA 1XNQJ 5FIIA 2CJ9A 3A1YG 4UQGA 2B3TB 4NZ6A 3Q8UA 2LXIA 3W66A 2MZ1A 2IC3A 3IR6B 3UWTA 4DX7A 2CUYA 4O0NA 5T41A 3RGIA 2ASYA 1NSQA 4ZLJA 4J9LA 2XMUA 5E3PA 3CPWR 2OELA 4CDIA 5GADI 4ECRA 2QMUB 2XULA 1VJWA 2FTRA 2PA3A 2YKNB 5M2PA 1MWQA 1LWFB 1ICEB 4NWBA 2VONA 2FVQA 1VRQC 2AGQA 1RWOB 4K4UA 3ZO7A 4DSKA 4ED8A 2JLEA 3VHQA 3PR4A 4O4GB 4NYOA 2XMMA 2OUGA 2OFHX 1YX2A 2HAIA 4ZHRA 2IJNA 3ET6A 3MR2A 1KEKA 1N8RT 2RDJA 3NBPB 4DF4A 4M5KA 2DHGA 5KTQA 3PXGa 4LR8A 5HJYA 2KM8B 3A3PB 5K20B 5KFYA 1JLGB 2GIFA 4WIQA 2ZHOA 4PWDA 4DV7J 4HEA9 5JXSA 2UUAF 3PG9A 5KFCA 3CJRA 1WG1A 2XGPA 3ZZOA 4A8QA 4OYZA 1T9YA 5HK4A 4IR9A 2WW4A 3ZC4A 1KOHA 4IH7A 2CDRB 5IV3A 4CLFA 1DQ8A 1HHQA 3RR7A 3LOUA 2EFGA 1Y7PA 2IY5B 2ZVIA 1TMMA 1GK8A 1P27B 4ED2A 2YQ0A 4RW9B 1HNVB 3QO9A 5CZVA 1BC6A 5HP1B 2VOPA 4QYZJ 4F4WA 5A0YA 3H7HB 4YDXA 3N9UC 1JQGA 3HDSA 1IBKJ 2M8HA 4DUZJ 3E01A 3M6XA 3TQ1A 2AP6A 4M5IA 3HSDA 5BYRA 1SKSA 1N5TA 1CS4B 1G3OA 1Q86T 2VIHA 2H51B 1Y4ZB 4Q43A 4KSEB 3U27A 3H20A 2UZAA 2HVEA 1HL6A 3KLVA 1WEYA 1PKUA 2W1BA 3OJSA 4ECTA 2UVUA 3HVAA 2M2BA 1HI0P 1U4BA 1NJWA 2RD5C 3J7ZT 2IMOA 1APSA 4X62J 1S57A 1U8WA 1SBRA 3IM8A 4NCGA 3IAS9 2VPXB 2WSEC 3Q0AA 4ID5A 2DHHA 1GMVA 1CPZA 5GMDA 5C42B 1H7WA 3QRPA 3N28A 3CCLS 2HLUA 1X0PA 2FLLA 4ZJOA 1JLCB 3VAFA 5E7OB 4ED7A 4I6WA 2ZZNA 2CJYB 2CJBA 4RJVA 4A8MP 3N6NA 2Z58B 3AOAA 2M8DB 4LF1A 1AW0A 3NGRA 2BKOA 2D7SA 3V6DB 5KFSA 1T0TV 5JVHQ 1RQ0A 4O4RA 4LFCF 3DLKB 4WU2A 1URRA 5A8RA 2YBVA 3BV8A 4JI6J 3RAMA 3D6MB 3PYGA 4JV2A 4I69A 4HACA 1SUQB 2OPSB 2DXFA 4DL7A 1WACA 4WJBA 5KG2A 2IVYA 4KE5A 3ZXWA 3FMBA 3W8GA 7FD1A 3I96A 3AD8C 3WZ0A 2F63A 4ZPVR 5CZXA 2B8QA 4U96A 5CD4A 3EXYA 2C28A 4LT6A 4I2QA 3DXSX 4DEZA 1S1XA 1CS4A 2FD2A 1VQMS 2E9RX 5F41A 3D9BA 5EN1A 1HBNB 2P2CB 2QO3A 1AYEA 2YNHB 5F8MA 1KVIA 4NLVA 2VBXA 4OHZA 1S77D 1N34F 2DIUA 3P5TL 4U8VA 2FGCA 3NRBA 4DV4F 3TZYA 3G4SS 1VQOS 1H98A 3DHXA 1RWVB 3FBEA 1VS3A 4OI6A 5HO4A 2OH2A 3D7SB 3HHLA 3PYEA 5CCMA 4DX5A 1PJ7A 2OP5A 2HKEA 4WCEQ 4LF5J 1CSJA 4ECVA 2ZBCA 4LQ3A 1SKWA 2K2PA 2H3EB 3W64A 2Z30B 3N4WA 4C7QA 2ZWOA 2ADBA 3ZZPA 2CNNB 3I6PA 2OTLS 1NJZA 4G6VB 1XNRF 3JQMA 3CW2C 1RCXB 2X1FA 3RTVA 2IM3A 1S0OA 4KFBA 3F41A 2Y1JA 1RBLA 4KHPJ 3MMJA 4CNYA 3MR5A 1N0VC 3DOLB 1UVNA 2NUHA 2F8MA 1IBLF 1YJ9S 3L7PA 1PC4A 3GIIA 5F8JA 2Y3YA 1CVJA 1UZDA 1XMOF 3I4HX 2AGOA 2VDHA 2R7XA 4WTYA 3CD6S 1KQKA 3TARA 5GAHI 2OO4A 4ZIWA 4HDGA 4NXNF 4X4SA 2WVDA 4DS5A 1UVKA 2N3LA 2MJNA 2VFTA 1FCAA 1HW8A 1U1LA 1YBAA 4C48A 2DPIA 3V6KA 6FDRA 2C3OA 4QCLA 1BE4A 1S6UA 3PRBA 1E6VB 3EDQB 4WFAQ 3CF5Q 3C15B 2LA6A 2ZM6F 2J0QD 5IXUA 2KN4A 1XBWA 2O01C 3HHLC 1C4AA 2GVZB 3OXGA 3MM8B 1DZ5A 1LWCA 4M5DA 2N7YA 1L3VA 1EP4A 3M8YA 4A4JA 1GT8A 1PILA 1TL3B 3R6GB 4BCAA 2D41A 2HHQA 4IDKA 2DY1A 3HVTB 2ZDOA 4CCHA 1EAYC 5D3GB 4DSEA 4ER8A 3BS9A 1PO6A 2XWYA 4WFNQ 1HWKA 2LXUA 1KQFB 2Y1IA 4BWJA 4GO5X 4PZVA 5H9FJ 2XMAA 2GGPA 4DFMA 3B8HA 2KHDA 4C8YA 3PHTA 4ZVOB 1ZA2B 3PFEA 2RIJA 2CWKA 5KG7A 4LF9J 2UXDJ 4B3TJ 3MPVA 3JYTA 3TUIC 1D1UA 4X64J 3KLGB 4LMZA 2XMWA 1DRZA 3IP0A 2VOOA 1R27B 2DHSA 1S49A 2VKZG 2G13A 2ABYA 4DV6F 2DO0A 1KSPA 4CO4A 1CJUB 4RW6A 2G2ZA 4TQRA 2HW3A 2W8LA 2NSBA 4ES1A 4CI0B 4CO2A 3JSMA 3K17A 1Q16B 2VA3A 1NMEB 3OSNA 1Y11A 4DR2J 3JTOA 1YG0A 2X51A 1KFDA 3LALA 3BREA 5E5NA 5KG5A 4DX6A 3EZUA 1P9QC 4OJ3A 3TYTA 4NLOA 1E6VA 5KT3A 2V69A 3ELHA 2IJFA 3WIUA 3WX8A 1FTCA 2DVIA 1RWUA 2QV6A 1M5SA 1URNA 3VGUA 3CT9A 4A8KA 3H5SA 2VPYB 4A47A 4ZVUB 3HFKA 4K4XA 2UXCF 1X4DA 3DGPB 4MIAA 2Y9HA 4DSJA 5G4DA 4V19X 3HVTA 4YB5A 3S8SA 4B9VA 7FDRA 3H40A 3OLBA 2UVRA 3MHYA 1WI8A 1FXDA 4WP3A 2HQIA 2DNMA 3FJ2A 2L48A 1CULA 3W5XA 1ZYQA 4L72B 3AHPA 2UUAJ 3QT7A 1RHRB 2MB0B 4DQSA 4DF8A 2XLJA 3U1NA 3PO4A 2Z8QA 1UFWA 2CG4A 3FBCA 2CIMA 4B9NA 2O5DA 2RF2B 1TVRB 4KV8A 1Y5IB 5KG1A 1FRIA 3RYLA 3MMBB 4DQIA 1DJ0A 3NLCA 3IG1A 1KLNA 1M5PC 2CPFA 1IKXB 3M6UA 2QLJB 3NS5A 4ZLLA 1XC9A 3CULA 5F8IA 2G9OA 3IWLA 1GTEA 1NNDA 2YX7A 4DZ6A 3BBBA 2Q66A 5DG8A 1I94F 2GCFA 3MPWA 3BBFA 1LK7A 2BJ7A 2QE5A 1F3FA 3HHDA 2HNYA 3TAMA 4KC5A 2FC8A 3BQ2A 3BN7A 4KT0C 4TU8A 1QAIA 1KHVA 4OL8A 3GV8B 2BDPA 1JNRB 5U47A 3A3NB 3TA1A 1VQ6S 4JI4F 1WOSA 1PIEA 1R0CB 4ECSA 3MPDA 2XWXA 5KFLA 3G82A 4TY8B 1ZOTA 3BM7A 1YK9A 5HL7Q 4Q0BB 2DR8A 4F0KA 3DYAA 3PX0A 3GFZA 3VQTA 4XDDA 1R0AB 3D28A 4FP9A 1D9DA 2LCWA 1NK8A 3EPIA 1NO8A 4WFXA 3GLJA 4NPOA 4R0JA 1Q5YA 1VQSA 2QN6B 4C0HA 3RBDA 1H74A 4J9SA 4ZIVA 3GB0A 3CGIA 4NA2A 3N6LA 3KLHB 2V4QA 1KNZA 3D66A 2RUSA 1N5VA 4NA1A 3EPGA 1FNMA 5KAKA 2SXLA 4LFCJ 1RABB 5DQGA 1S1VB 1RTHA 3QSYB 4WKRA 3WBZA 5HVHA 2HIQA 3L95X 1IR0A 2GJ2A 4AD6A 3DU6A 4UY85 2CQGA 3V81B 1CJTB 2Z2ZA 3D0HE 4KKOB 3TJAA 1PC5A 4N47A 1EJ7L 2DKOB 5L8RC 1LWEB 2HBZB 2VF3A 3AH6A 3HX9A 3QGHA 2ZBPA 1YVFA 4DL5A 5E3AA 4IH6A 1PJ5A 5KFQA 4PG6A 1N36F 3PCOB 2K1RB 3V2UC 1HPZA 2WONB 4DV4J 4CWBA 3VAGA 3BGUA 2PMWA 2KXHA 5IV4A 2A2DA 1VRTA 5KFZA 4QR0A 1PYOB 4DR4F 4TY8A 5E3RA 3T41A 5AT1B 1ZTTA 3S01A 2B7CB 1Y00A 4DQPA 1OYEA 1U45A 3NGDA 1JXEA 2J0SD 2E66A 2F5GA 1F9FA 1X9MA 2NLWA 2JEFA 2F65A 5HI7A 1CJVB 2G0IA 4Q8EA 5DS7A 5K8PA 5H9FK 5DG7A 3GONA 2HWIA 2R42A 2HRUA 2XQCA 3FFIA 3HK2A 2JJ4D 1XNRJ 2J8SA 3VAMA 2GQQA 3NP5A 4OX6A 2YKMB 1JLAA 1R8CA 4DSLA 4J9QA 1ZM2A 1IKWA 4MYTA 1IBLJ 1SC3B 1XMQF 4R5PB 2WOMB 1AT1B 1CJTA 2E29A 2NUUG 1Y3KA 2NREA 1VDHA 1YHQS 1DQ9A 3ENAA 5HN0A 3PHEA 1UEKA 2CQ2A 3R5GA 2QLBB 4NXNJ 4KGXB 2BM1A 3TVYA 1FDNA 1ZS6A 1YRTA 2AMCB 2WVBA 2E5LF 1S4FA 1RTIA 1GX6A 4Y2IA 5C25B 4Z37A 2E1MC 1KLMA 2ZM6J 2DBBA 2WONA 5F0WA 1TK8A 1A0OB 4KH1B 2OPPA 3MDFA 3GIJA 4HVZA 4CT9A 3HVRA 1X4GA 2QLFB 1WDDA 2XY6A 1D09B 4JI0F 1JX4A 4RBTA 5B0CA 3RAXA 4DL4A 5EX3A 1HBMA 2VG6B 1FK9A 1UPPA 1UCNA 4RNNA 2HGNA 5DJBA 2ZH1A 4OZLA 1RYRA 2AWZA 1FWPA 2CNLB 4X4UA 1H38A 1U1MA 4I7FB 4YOEA 3TA0A 2J6TA 4DOZA 3PV8A 4F4YA 3T1YF 3QPIA 2DITA 4FPRA 1WHYA 2E1AA 1REVB 2VG7A 1WG4A 2HURA 4PXBA 4UOGA 1FKPB 3KG1A 4DL2A 1FD8A 3HZGA 2F4VF 4F3MA 3ETMA 2BE2B 4ILLA 1XJWB 2KKHA 1IJFB 4CNZA 3W60A 4DV6J 2WK4A 2BOAA 1FDDA 1Q95G 2FZKB 2DHAA 3I32A 3H4BA 1XERA 3T5KA 1WEZA 5IT4A 1FJEB 4LQ9A 1Q8LA 4RUCA 2IAJB 3HPOA 2KRBA 1MMDA 1D9FA 4QWCA 5H9EJ 1RT6B 4C3MA 4PQAA 4NYZA 1MMNA 2JVRA 2XBPA 2RNEA 5THWA 5A8WB 4LBIA 1S7IA 1UZHA 2MZTA 4LREA 3UDCA 4F3QA 2HHVA 2CYYA 1WOOA 2ZUGA 2J76E 3CJ3A 3V4MA 4PYAA 1EX8A 2EC0A 4QWDA 1L5UA 4RWXA 1HQEA 4B3OB 2D1CA 3CJQA 4Y2CA 3R1LA 1VQNS 4EYHB 3I5AA 2IBKA 4FF3A 3MZIA 2EXUA 4P72A 1V3RA 4MMOA 3G2XA 4PG7A 2WB1D 5E41A 4CLSA 4C98A 5F8LA 4GO7X 1C1CA 2J7KA 1F9HA 3ZTQA 1EIYB 1WTBA 1N0UA 1NK6A 1L3SA 2QZ8A 3Q8VA 3MM7B 3CCES 2LEAA 3V6JA 1QY7A 3GMGA 2PMHA 3LPYA 2W9AA 1TKXA 1HNZF 4PCQA 4B3RF 2CWXA 1LW2B 4P2MA 4FF2A 1BWEA 3B4MA 5BR8J 4C0OC 4G1PA 2HFOA 1HWJA 1QM9A 5DDOC 1WF2A 1JLQA 2YPZA 2RVJA 4QIFA 1LW0B 1FNXH 4OYBA 2YVSA 1ULRA 4TY9A 3QQCD 1S99A 2MLZA 4HL9A 3OQ2A 5CHCB 3CJKB 1OO0B 2HEKA 3OR1A 3KMSA 1RT3A 1KFSA 2HFNA 1RT6A 4J37A 1HI8A 5B0AA 1J5OB 4EU0A 4NL5A 1I94J 1F5AA 4QWBA 3D68A 1HFEL 1WC6A 2HWTA 4CO1A 2R7TA 2K8GA 1S0MA 1LV5A 3PJWA 2PSZA 2ROGA 3M2UA 4IRKA 5IS2A 3K5OA 1XMBA 1BGXT 4BC7A 4WPAA 4IRCA 1UEUA 4JBCA 2F9JA 4IFYA 4ANEA 4ZVTB 4OYOA 2DGTA 3US5A 5HANA 3QIPA 4OX9F 4LRCA 4LJMA 1RBAA 1N5YA 1BUXA 4CO5A 1VOMA 3UN2A 1XQIA 2CQCA 3HJVA 2U1AA 2J7UA 1U49A 2C3PA 3LTOA 4WTOB 2ACYA 3DLHA 3N5BA 2BJ3A 3ICLA 1K8AT 1G4CA 6FD1A 1AXQA 1B64A 2WSCC 3PEHA 3W2VA 4AT1B 3UW1A 3Q86A 1YZ7A 3MECA 2GW8A 3EX7B 1TUGB 1NKBA 2WRMA 4Z7CA 3J7A1 9ATCB 1VC6A 1LW2A 3NMAA 2XLIA 1BHNA 4LR7A 4DG1A 1YTYA 4W90B 2HVIA 3JAMY 2BW2A 1VC5A 1H73A 5IT0A 1N32F 2XLKA 1M1KT 4L73A 4F50A 2DGWA 4XDCA 2MHEA 3IFEA 4I4BA 4JI3F 4U9RA 8RUCA 3D67A 2MTLA 3BBCA 3MEDA 2HHSA 4NI2A 1GXUA 4I0WA 4XO0A 3JB9k 4HTIA 1NDCA 3PKYA 1U0HB 3SBMA 3UE2A 4TKTA 3MFHA 1Y3JA 4LF7F 3QJLA 3AJ2A 4KO0B 3VWSA 2YKQA 4HR2A 5A2QY 4EBEA 3ZZUA 1ELOA 4IOBA 2AYGA 1N36J 1VQPS 4NX9A 1X4BA 4RNMA 1KWMA 1S1TB 1AB8A 1V5VA 2QYCA 4WFZA 4DR4J 2FY8A 2IJRA 2YKPA 3BGLA 4EYIB 1QE1A 2DT9A 3ZFVA 3P45B 4QPXA 2BE7D 1MROA 1CQMA 2DR5A 3OXFA 4F04B 4FF4A 1SH3A 4NRTA 1S1WA 1UMJA 2K3KA 4HHJA 3TI0A 1OPIA 4DSFA 4BS2A 2KHCA 2M3DA 2GMJA 4RNFA 4TN2A 1X0FA 1FRJA 3V5RA 3OFFA 2ZOFA 2C3MA 2HQ3A 2E7WA 3O5TB 1ZAWA 4ECYA 4C8OA 5DQHA 3PW5A 2V34A 3N01A 1A6LA 2DGSA 3QRQA 4O23A 1JJ4A 4HT5A 1RZMA 1RHKB 3VF0B 1FRHA 2UUCF 5FLXU 1SJ4P 2PFDA 1VBKA 1XMQJ 2PEHA 3IWXA 2W9BB 1VQKS 4C6AA 5CYQB 4AL6A 4C3KA 4MKYA 1SKRA 2E5JA 3FKBA 1PJ6A 2AW0A 5H9EK 2C42A 3MMAA 4FYWB 4ECUA 1OMSA 3QRRA 4QR2A 4FYXB 1PCAA 5LSLA 1S76D 2E5LJ 2ZH4A 1NCLA 1GXTA 3W3SA 1R3NA 1VLOA 3EJMA 2J0XA 2XTJP 2KDOA 1I5OB 1N52B 3R7BB 5DQIA 1S9GB 2VUGA 2BR0A 3GWCA 3OD2A 4JI0J 1AUSL 5KT4A 2XNRA 1RA6A 2EI5A 2W4DA 4X4TA 1VQLS 4DV5F 1JKHB 3KDOA 1XR5A 3IC1A 5CXTA 1MSWD 3E8OA 1FRXA 4DR1F 2JH3A 3DLBA 2VFRA 3P5BP 5DGBA 1WTFA 3T1YJ 2C2DA 2V8VA 3QFHA 3I0RB 3LWLA 2LQJA 3AOBA 5T7LB 4OZ0A 1NBEB 3PR5B 1UL3A 5I42A 2ZFHA 3VR1A 4ECWA 1Q0NA 3SDEA 1W2BR 3KLIB 1NXIA 2F4VJ 4ICLA 2QC3A 3NOCA 1PAEX 2OMLA 2NPFA 1KRPA 2RRAA 1V3ZA 4K4WA 5HMYA 1RT2B 4LSNA 3J80Y 3DRSB 3HFZB 2NXUA 4AYBD 1TQLA 2UP1A 1KDNA 4ECXA 3DFEA 1RK8A 3TWZA 1S97A 4AE5A 5HLFA 4NXMF 3I5CA 5F9LA 1RAIB 3H2VE 2QGFB 2FDNA 5J1EA 2RS2A 2HHPA 3VAKA 3GCWP 4ETXA 1WC0A 3I9ZA 3J7Z5 1X7VA 3DMJB 3SV4A 2DR7A 1Q79A 3C8YA 3PW7A 4IFVB 2V9KA 3M8PB 4OI3A 4WZQA 4IKAA 2KFYA 1S9GA 2HG4A 1U24A 4E8UA 1B7YB 2HK3A 2AU0A 3D3BJ 4D3GA 4ZN3A 2DNNA 3PJXA 1RAJA 1H7XA 3M8ZA 3THPA 4NCBA 2XS7A 3VGTA 4ZVHA 3F44A 1B0TA 1IKYB 2QT7A 2CPDA 3R9LA 3C14B 1YIJS 5L38A 2RILA 3DOMA 4QU6A 1N56A 3ITHB 4UOFA 2BRLA 3K8VA 3I0RA 1NU4A 1RP5A 4LFAF 2MYFA 1HNZJ 4B3RJ 2BM0A 2YXLA 1IWGA 3KLIA 4ZVPB 2FY1A 3MD1A 1NJIT 5CYMA 2UUWA 1D9AA 4KH0B 3DLGB 2AZ3A 1BQNB 1DTTA 3CO0P 2WBRA 2ZH5A 5D4PA 1RAGB 2CQ0A 2YNGB 1M1GA 3GFYA 2CAJA 1JLEA 2R7QA 1U1PA 3DOKA 2C2MB 3ZZZA 5EHHA 2DISA 5D6GA 5J2MA 5G0RB 1Q7LB 3UFCX 2CQDA 3OUYB 3OL6A 3BGRB 2VL1A 2XSJB 5ETKA 3CIZA 2XYGB 1XWLA 3TJ9A 3DI6B 5CABA 1FVQA 3C6TB 3DM2B 1KC8T 3CC2S 4ZOSA 1F3VA 3M8PA 5LXYA 3SCJE 4K0KF 2FZGB 2MEWA 3DNCA 4YS2A 1JK9B 4Y34A 4WZMA 1VHIA 3M8WA 4OX9J 3RRGA 3EVMA 3MD3A 4CLKA 5RUBA 2ZKTA 2B5JB 4RW7A 3CO9A 3LQVA 2C1EB 3ZTSA 3B54A 3GYXB 1OJ4A 1Q8KA 2OSRA 1HMVA 1HNWF 4WP9A 1MMLA 1VK3A 4DJBA 1HD0A 3BN4A 4KPCA 3CCQS 3IS9A 1X4CA 5IM0B 2HBRB 5GAEU 1UW4A 1IBMF 3MXHP 1SXLA 3M8SA 1RAHB 3C2PA 2BE9B 1FJGF 1RACB 4J9MA 1TKZB 3KK2B 4LRFA 1N32J 4J9UE 3DRRB 3EVOA 3IWNC 1FI4A 4JI3J 1QJHA 4NEZA 3C16A 3KLFA 4F8RA 5D0HA 1B0VA 5KFVA 2MLYA 4EEYA 4K2JA 5IWAF 4ILRA 3KLEB 3ZNUA 4DFPA 4U7CA 4I6AA 2FHMA 2CPXA 1JWWA 4LF7J 4YUDA 4RW8B 2FJXA 4YMEA 3K0JA 1M5HA 2ILYA 4UUWA 1DURA 5DZ7A 2AJ0A 5K14B 2QL7B 5D78A 3TAPA 3J7YU 4FVMA 2R8HA 2HFVA 1GX5A 3A8KA 3LP0B 3U02A 5KG3A 2F9DA 5A6WA 3LAMA 2HQCA 5ETNA 3OXLA 4CTAB 2VG5A 1KQSR 4HYKA 2CDQA 2N7CA 2VFUA 1TMJA 2BACA 3AXMA 4UQTA 3EUNA 5A2QU 4ID8A 3VCDA 3WIVA 3Q8YA 2QIFA 1UPMB 1F5CA 4JI2F 3R97A 1S6PB 1VHFA 3D6FB 4CQ1A 3QZ7A 1U47A 4YY3F 3ZTOA 1VMBA 4NLUA 2KG0A 1Q78A 2NZCA 4P71A 4UW2A 5J2PA 1PBAA 5C2CA 4GKJJ 3CDWA 1U25A 2H5EA 2DYAA 5E0OA 4A46A 2MHNA 4P7TA 3G6ES 4J91A 2Z2MA 2UUCJ 4CYUA 3KTQA 2E5IA 2R8KA 1QAJA 1QTNB 1TV6A 3UR0A 4AXJA 2YNFA 2ZBQA 4C4WA 5IFMA 2R2TA 3FEYB 3LPEA 2BA9A 1UFKA 2CQBA 2EBEA 2Y1RI 4DL3A 2Y8WA 3CJSA 1IQTA 1DBDA 3WC2A 4ZP8A 1LNQA 3HHLD 3HZEA 1NB7A 5DLFA 3PYFA 3CMES 4NLSA 5LMUF 3SCLE 5B0EA 3EVWA 3KDNA 3DKDA 2RMLA 3G9CA 4C3LA 4IQXA 3PEJA 3HD1A 2YQ1A 3HSGA 3KK1B 3KKFA 3C3LA 3NS7B 5LL6d 3BKTA 2QTWA 2AJ2A 2KFZA 2QL9B 4DV5J 5L1LA 2EVZA 4FNIA 1NHKL 4USMA 4Y00A 3H8YA 2HHWA 4DR1J 5IQ6A 4J90A 2VPWB 3SZ2A 2HK2A 1JJCB 4ANCA 1HNIB 2H1YA 5L9NA 3TUPA 4QWAA 4C11B 1YRUA 4CLLA 2DNZA 3GJQB 3ILOA 1EQMA 3RUBL 4G3IA 5EUHA 4B9MA 2Z4PA 1RADB 3VAJA 1G1XA 1RT5B 2HS0A 4YB1P 3MUTP 4UUXA 3KUGA 3H98A 4F4KA 3EYZA 3HVWA 4K4VA 1WOPA 3CMAS 5CYJA 2I5JA 2DNYA 4RUBA 1S9FA 4B02A 5DG9A 3W9HA 4JV0A 2CZ9A 2JDJA 3FCWA 3M8QB 1K73T 5F8GA 4K8RA 2FJBB 4OIXA 3DXBA 2OPQB 2V2ZA 2CJAA 2WAQD 3P4UB 3LP2A 3TRGA 4H4KA 1N6QB 1Y0HA 2DNLA 1VIXA 2VASA 3MTJA 3I56S 1NM2A 3J80U 2QL5B 2A6MA 2E7VA 2V2QA 2W2NP 2I2YA 4GVLA 2HSEB 2DRBA 1KVKA 1SJ3P 1FDBA 4NMXA 5AXNA 5J2QA 4IG3A 3W9JA 1MLAA 4OHVA 3OTEA 4RW4A 3MEEB 1F2GA 2WZ1A 4IG0A 2B9YA 1YBTA 4O3OA 2YH0A 1NJXA 4GC6A 2OEMA 4NLTA 2OTJS 1X4AA 1TL1B 4GRSA 1S4EA 3Q22A 2FPHX 5HQMA 3I5BA 4GKKF 3CVKA 3PX6A 1HR0F 3X1LB 4F3OA 2ZNYA 4UZBA 2DH9A 2CPIA 4EGLA 2OJ3A 4DLEA 2EPIA 1C0UA 5KT6A 2PE8A 2Q3PA 4LFAJ 1V3SA 2X1AA 5B0FA 1RT5A 5BJRA 4ZP9A 1U6BA 4RBVA 3RG6A 3GV7B 4BBYA 1Y9OA 3H59A 4ES3A 1UTAA 1U6FA 1DAXA 2VZ9A 3K58A 2CNOB 4MYUA 2YTCA 2JHEA 2QSWA 2V94A 3LP1A 1Q81T 1LFWA 1Q7YT 3M6WA 3M8QA 3OR2A 4H4KC 3OTDA 1TAUA 3EMTA 3LUYA 4OV6A 5LXRA 2GMLA 1FD2A 1M5VC 3LGNA 3MEGB 2KU7A 2JL9A 2QRRA 3NL0A 2ZOGA 3CNQP 4N41A 3O8WA 4LIWA 2FIUA 1X9WA 2HQDA 1EETA 4M1KA 2HMIB 2YNIB 2WB4A 5I3UB 1YI2S 4K0KJ 1U0SA 3QLHA 4ALZA 3TR5A 1IM6A 5C24A 2YX1A 3ULHA 2GVDA 2EFOA 3TEGA 2MGZA 1TUWA 2CA9A 2O3DA 2HNZB 2FHJA 4PG5A 1TKTB 2VBWA 3BYRA 3TNVA 1AROP 1NK0A 2FHOB 1KONA 2V67A 1B70B 1HNWJ 1OYDA 4ZLNA 7AT1B 4ZVSB 1EKRA 1F1BB 3CJ4A 1MN9A 2WCXA 2BOPA 3M9MB 1IBMJ 1HQUA 3AA9A 3KG0A 1FJGJ 4MKVA 1RAOA 3AD7C 2VJUA 2RU9A 5AXMA 4I56A 3SYZA 2FB0A 2M52A 1TAQA 2V8HA 4FYVB 2AYBA 5D4LA 2MDAA 3VV2B 1SL2A 3Q24A 3T1HF 3SQGA 4LSLA 2V68A 2HBQB 3MOJB 1JLBB 2DGVA 2OI2A 5IWAJ 2Q1LA 3QYYA 3OV7A 2JWNA 3I0SB 1RLDA 3SEOA 4K5SA 2UV8G 2EFNA 2FUG9 3IR7B 4PUOB 2C2RA 4RU2A 4OYIA 3HD2A 3FBFA 3HCXA 4TU9A 1SVDA 5IZHA 4DV2F 4EZ6A 4DR7F 4F4ZA 4PABA 2EC2A 2V9WA 5FDLA 3BSCA 1BQXA 1NSKL 4X84A 5D4OA 5A6PA 4FYDA 4YQWA 5KOWA 1RTJB 1IQZA 4DBQA 1EARA 3IRXA 1TKTA 3A8JA 4JI2J 1BQMA 1VYAA 3KHHA 1HBOA 2HHUA 4M5JA 2A2CA 1CC8A 4YY3J 1Z4UA 2G2YA 2IM2A 1HLWA 2V4JB 1R31A 4ECQA 4KBIA 1E6YA 1LOUA 5ETSA 2VHGA 4DLGA 2VB6A 1XN9A 3SXLA 1T05A 5HVGA 2I0XA 1MU2A 1RWWB 5ETMA 3TOQA 4EFAC 3S7RA 1WORA 5E2QA 3NGKA 1TK0A 1CC7A 3ENQA 2BJ1A 5KFDA 4RUHA 5KFRA 1KHWA 4F2RA 3MMCA 3ZZ0A 3M2VB 1VR6A 1B3TA 1RBOB 4O44A 4P2FA 2DY9A 2RDIA 1RT7A 4N77A 3S6EA 1TL7B 2JEJA 2MQPA 3JSYA 2YY3A 1NLKL 1P1TA 1S1UB 2KXFA 1KTQA 3IBFB 1VK8A 2LQ8A 3W2WB 2RH3A 4RO0A 1RTDB 2P9GA 1SQEA 5HQLA 1REGX 1BMQB 3BQ1A 1RKJA 1R6VA 2B4OA 2DTJA 4DPXA 5AE3A 5KFIA 5I3PA 1A7GE 1B4SA 5LMUJ 2UVWA 2KJWA 3NY0A 1QLNA 2HQFA 1GNKA 1HNXF 3R8YA 3MM6B 3M6VA 4HTJA 2C2EA 4EWTA 3CIMA 2YKNA 1LWFA 2KZMA 3TZWA 4DR3F 2K7KA 4CO3A 3K2YA 2LECA 1Y10A 4X4PA 3AQOA 1QSYA 2NR0A 3FQLA 2XMKA 1UWBB 4OZ1A 4O4GA 5GMKa 2D9PA 1K9MT 1CJKB 3MUVP 3B78A 2ZDPA 3NBPA 2ZJRQ 3IR5B 3PM9A 2BVZA 4AQYF 2RRNA 3UDEA 1WWHA 1JLGA 3D4JA 2WHOA 4J5OA 1P9YA 4OYAA 1ZH5A 1RXOB 3UI3A 1WDTA 2LDYA 1YLXA 2FC9A 2KT5A 4CH1A 1VFJA 2FQQB 1FVSA 3M2VA 2C2KB 3T19A 2XS5A 4C8LA 2CFXA 1U2RA 2BZ2A 3A13A 4LR9A 2A0FB 1VRUB 4DI6A 3CCRS 4RW9A 1HNVA 1AZSB 2J9DA 1GFWB 2G2OA 5HP1A 4XK8C 4Y6IA 3MM9B 4U8YA 3CJ2A 3W2WA 5E3CA 4FNHA 3MM5B 2GO9A 1C0TB 4WF9Q 2HZAA 1ROFA 4M5MA 3ZZTA 4KHRA 3TX0A 3HSJA 3H42A 1TU0B 1X60A 5LJ5Y 4P10A 4NLGA 5IT9Y 1SQFA 2GNKA 1MG7A 1WJ9A 2LEPA 2ZH6A 1HIYA 2XHCA 1XK8A 1VQ5S 3THVA 2HNDB 4CRJA 3C6UB 4OX8A 1AFIA 2GX8A 3KHRA 4DPTA 4X4RA 1FEHA 4X65F 3BEGB 4P52A 1T3NA 1HR0J 3LW5C 1HHTP 5KFBA 3CDEA 3TVZA 5C42A 5B0BA 3POTB 2YQ3A 3AB4B 1JLCA 5HBMB 1NAQA 3MUMP 2KM8C 3OLAA 2HHXA 4P7VA 2ZJPQ 4F4XA 1H2UX 3D6TB 2L9NA 1V9OA 1M5OC 1K47A 3QJJA 1UJ4A 3KJVB 5ETOA 2F4FA 2BQ3A 4PXCA 4FS1A 4MFBB 4USIA 4ZP6A 2QJ3A 3V6DA 5GAGI 4ZPAA 1EZZB 2NCKL 3DLKA 1FHTA 4M5LA 3I82A 5A8KB 1RWNB 5F3ZA 5L1KA 2LXFA 2LLZA 1S5ZA 2IYGA 1SUQA 1IN0A 2OPSA 2XS2A 2HS3A 4EO6A 3CJ5A 2BV3A 3RW7A 4K4SA 2NS1B 4HH1A 2JC1A 3WX4A 2CZ4A 2BW7A 3MM5A 2DCLA 5KFAA 2EFVA 2P5VA 1VQ7S 2ASDA 4QR1A 4I2PB 2DGQA 4JI8F 2B9XA 2M5YA 4DCOB 3TO8A 3NMRA 1HBNA 2AYEA 2YNHA 3JSRA 5ETLA 1OIAA 3BZQA 3G86A 4YR3A 4Y2MA 4OMFG 1KBRA 3CD5A 4HKQA 1RT1B 4N5SA 1U1OA 2OD6A 3GYNA 2RUGA 3IAM9 4G1QB 1IUJA 3QT5A 4C8ZA 5KT2A 1BXNA 3W5ZA 5KFTA 2I1RA 2XC9A 3SV3A 4J9RA 2E5HA 4WE1B 3VALA 1WC5A 1ACMB 2Z2YB 2LKZA 1RHQB 1T03B 1U1RA 1PAUB 2AEFA 2MKIA 2VQFF 2AF6A 3UDLA 2V5HG 3Q8RB 1DY3A 3TZXA 3OFEA 4X4VA 3AB2B 2AZ1A 2L9WA 2MKHA 4EUVA 1T3OA 1H0HB 1RWMB 5EWGA 2L3MA 3KK3B 4JYAF 3ENWA 1IWAA 2W01A 1PBUA 5C2GA 2CNKB 1AA1B 2AV5A 2GJFA 3DDNA 3Q8SB 2HHTA 2NPIA 1YJRA 5HMWA 4QIWD 4USJC 3HLUA 3W65A 3CJ8A 5D15A 4DUYF 3T1HJ 1X4HA 3MR3A 3PW0A 1LQ9A 2ASJA 3KJQB 4I64A 4JI1F 2LYVA 1TL5A 3AY0A 4ZPCA 5I3QA 1GMWA 3G87A 3DOLA 3RBEA 1RU2A 4QYZK 3HF5A 4OLPA 4U7UD 1Q53A 4F0HA 4CIOA 5AJ3F 3W5YA 4RUAA 3B4DA 3BPDA 1CG2A 1KN6A 4QOTA 2C3YA 2IFXA 4O3SA 1UA0A 5KFJA 1VQ4S 3SMZA 4QU7A 3RBXA 3WQPA 1HKAA 1EQ0A 2VICA 1K44A 1RI7A 2VV5A 4KQZA 2XMJA 1U1KA 2GHPA 1TP7A 4DV2J 3FZ2A 3NEKA 1ZAXA 2XSFA 1Y5NB 3NNCA 2AKWB 4PXEA 1TTHB 2GFFA 3C15A 4USTA 4J9NA 2OMOA 2ZJQQ 4KIAA 1UAWA 1TFYA 2XM3A 1NRKA 2GVZA 4FBUA 2H9ZA 2QSFA 1IKVB 3MM8A 3BKFA 2QFIA 2QA4G 1Z2ZA 2P8IA 4HT7A 4BWMA 3TQEA 2DGUA 3ZNJ1 4DXLA 3JS9A 2JX2A 3MOZA 4X62F 1TL3A 3UN3A 4USWA 3JTNA 1RT4B 1S6QB 4C2MA 1NPPA 5D3GA 3UVJB 4MJKA 3GJRB 3NGSA 3AODA 4TYAA 2YX4A 3DLEB 2Q6BA 3WDOA 3UO0A 3M32B 3MCOA 2I6WA 2FVRA 3OL9A 1K1SA 2AX0A 3DGVA 4JP8A 3MAAB 4NCAA 1WC3A 2OEJA 3UR3C 2DNQA 3QZ8A 4C8NA 3ILLA 3U1LA 3PZPA 1RTZA 4QZVB 2L08A 3KLGA 4DCJB 1XR6A 2DO4A 4MIBA 1CJUA 1TK5A 2F7VA 4DN9A 4MTPA 3VZIA 2M88A 1HYSB 4IOAQ 3QNWB 2Y0SD 3M30B 2MKKA 8AT1B 2WVEA 4FZVA 3MCMA 2YWKA 1FRKA 2ZC4A 3A3OB 2RKIB 2KH9A 2ATCB 3MF5A 2RDDA 3RB0A 4CM2A 2RQMA 2PO4A 3AFGA 3X3UA 4RR5A 2W7PA 1RKIA 1JLFB 5LSRA 2ZE2B 5CAAA 4R8UB 5DO2A 4K4TA 3RU0A 1HI1A 4TU7A 4DR3J 3ILIA 4ZVFA 6AT1B 2PGCA 2E1PA 1W7WA 5F8NA 4DV1F 3DGPA 1QSSA 5CCLA 1ZM3A 3QAEA 2W2OP 5MLCV 5ETRA 3GCXP 3NCRA 1G2EA 2D3ZA 4AQYJ 3RW6A 5KT5A 2KO1A 3MGJA 1S79A 3J81Y 1FE0A 3R7SB 2B56A 4J9OA 3K5NA 1U6ZA 5I4MA 3VQSA 4MH8A 2Z0GA 3CD0A 4NE9C 2R8GA 4GVBB 1FF2A 4C97A 1XR7A 1H72C 3E51A 5F9NA 3LWMA 3R2CJ 4OYPA 2IYIA 1P1LA 2X7IA 4OI4A 1LEOA 1R8PA 2RF2A 1TVRA 4YEAA 1QUVA 1UP1A 1ZA1B 3P8BB 4CZCA 3THTA 4CM0A 2Z2LA 3L7OA 5LOQA 3MMBA 2PD1A 1X8DA 1PYSB 1K0VA 1KOOA 3OL8A 1IKXA 4I6YA 3AJ1A 5B0GA 4LRDA 2EK6A 2NXCA 3RR8A 4H4MB 3EZOA 5DDPC 1DLOB 5K9FA 4DCPB 4YDDB 1R0BG 2JLFA 1N34J 4YB7A 4HI1A 2HPUA 3D0IE 5BYSA 3LGMA 1ZTWA 2B4UA 2DR9A 4XIUA 2CPJA 1GAOA 4PG8A 3OSPA 1SL0A 2IVMA 2LQBA 2HS4A 1GXLA 4Q0BA 3K8WA 1ZBTA 2XZWA 4QYRA 3VGVA 2AX1A 4DL6A 4FF1A 1R0AA 2J6SA 2JLGA 2HBYB 1QVGR 1UEVA 4ANDA 4B9UA 4ILMA 3Q2TC 4NASA 3TEHB 3KLHA 4ZHRB 1FESA 3ET6B 3Q8QB 4F26A 2CQHA 4GVBA 1TZ0A 2HAFA 4Q45A 3CCJS 3IMQJ 8ATCB 1S1VA 4TYBA 2PI4A 4LVOP 3QJPA 5DZ6A 4HDHA 1YJWS 5KFHA 3BKUA 3G96A 1YITS 3HT3A 1WF0A 2OKQA 3OFGA 3V81A 4XAKA 5CH7B 1XMOJ 2VA2A 2V50A 2IDLA 1SJQA 2XB2D 3G6XA 4KKOA 1NZ8A 1SIWB 2KI2A 1J27A 2W2MP 4LRAA 3ZTPA 4RWWA 1NZAA 5KFXA 1RJJA 3P49B 1LWEA 2H4YB 1NB2A 5A0YB 2VQEF 4UT4A 2CVEA 1IJEB 3MWBA 2XY5A 2QFJA 3EGWB 3A4TA 2CKWA 1U1NA 3E01B 5KFEA 2K1RA 1O51A 2ZNZA 2D74B 3UQSA 1FX4A 3HT0A 4Y3CA 2QYGA 3FBBA 5KOXA 2DPJA 3BF4A 4B3MF 3GG0A 2Y8YA 1U2FA 2W2PP 4ZJLA 2XEXA 2O1PA 2BABA 4FVCA 3GJSB 4RNHA 2QX0A 2KZZA 4MKBA 4IO9Q 5KFOA 2VQFJ 3G71S 1PG5B 2W24A 2FJEB 4NCGB 2AHOB 4OYMA 2ROEA 2A1BA 4ID5B 3JSBA 4JYAJ 1N5QA 1CJVA 4KTQA 3CUNA 3A8EA 3A8IA 5LT5A 5SZTA 2WTFA 4Y65A 2JFDA 2DHXA 3D54A 1ZAVA 2ZOMA 4OI1A 4DUYJ 2RU3A 4RLEA 3U7JA 2YKMA 1Q8BA 4JI1J 4LF8F 1M5KC 5ETQA 3UPFA 9RUBA 2NYHA 1H2VZ 3M4XA 2FLNA 2RB7A 2FJWA 2CQ1A 1WHXA 1N54B 3H2LA 2GIQA 4R5PA 3K7RA 2KVQE 1R7IA 2WOMA 1F6TA 5A8RB 2RT3A 5AJ3J 4I68A 3ZZYA 2QA4S 2UXBF 3VZHA 1NH7A 4HACB 3LGHA 2AD9A 2OFGX 3G8TA 1DHMA 1RISA 4DSIA 1SB6A 2FJVA 3OHAA 2K3IA 2WVCA 4WWSA 2CQIA 5K5MA 4DHVA 1RHMB 1SV5B 2EKYA 3OTBA 1VQYA 5C25A 4I2QB 3SQOP 1S1XB 3OW2R 3IM9A 1U8SA 4IO1A 3BYPA 4MT1A 2MMYA 3KUHA 3KHLA 4M63A 1JJHA 3UNGC 4O0IA 2UXCJ 1SC6A 2V63A 2VG6A 2JNJA 3HHLB 3NGUA 1KD1T 4ED5A 3BH7B 5KFMA 4LF4F 3RRKA 4I7FA 2FVPA 4DPOA 4N8OA 2RS8A 1U2CA 4WFYA 3W63A 1W25A 3BR9A 5KFGA 1REVA 3LANA 1FKPA 2MSTA 4H4OB 1NDPA 2V8PA 2BE2A 4ZK7M 4YFUA 2K7JA 2UUTA 1MWYA 4OZNA 2EWHA 5JUMA 4KFBB 4ZPDA 3GQCA 3NAHA 4X4QA 1HQ2A 5HVFA 4YR2A 2R4FA 4OJGA 3RJMB 1RAFB 2R3VA 2IAJA 1VBYA 2Y1LB 3SSSA 3T3FA 2APOA 5ETVA 2DNHA 2H5JB 1I51B 4AXIA 1IBCB 5LSOA 2D3O1 3GIKA 4OLOA 1BD6A 2XNQA 1SV5A 4YHHF 2ALZA 4QJVA 1FA0A 5A8WA 4KY3A 3PACA 2GC8A 2E9TA 3W1YC 3QSIA 2OIHA 1T9UA 4UOHA 4MKAA 5EDWA 1C4CA 1YGYA 2ZVSA 2ZZTA 4JI4J 2GIRA 1NSAA 3TZZA 5D0RA 4C8KA 2Q79A 4B3OA 1G7CB 1HWLA 3HP6A 4DV1J 4WU3A 4F25A 2I38A 2FLPA 4CO0A 3CXCR 2ZH8A 1J5EF 1YZ6A 2CXEA 4K5RA 3OL7A 1LWCB 4M5DB 2G4BA 2BXJA 3BB5A 5AXKA 2V4RA 3LO3A 1EP4B 3FZBA 2O67A 4HLBA 3MM7A 3IN5A 1JXVA 4U7UK 4IDKB 2HHHF 1T02A 3AA8A 3OTOF 4OQJA 5K8NA 2CJXB 1VGYA 2J9EA 2P6SA 2OSQA 4H4OA 2HRTA 3TW0A 5DM6Q 2GGPB 3LH2S 2RSQA 2JC0A 2CADA 3J81U 1LW0A 3CCMS 2DNOA 4PKDB 3IO1A 5J2NB 4NEYA 1RWXB 3JYTB 3HO1A 5SUHA 3MPYA 1Q82T 3CJKA 4XTTA 4EO8A 3D0GE 2PA8D 3KOAA 5E33A 3G8SA 3CC7S 4L76A 3C46A 1NSPA 2MKSA 4LUBA 1J5OA 3ILJA 4RW6B 4ZPTR 1SL1A 4BHQA 2HVHA 4PEOA 1JNZB 4F2SA 2VPZB 3JSMB 2KL8A 4CH7A 1FKAF 3CCWA 3SI8A 2MQLA 1Q4RA 3BJYA 3HHNB 2M0GB 4RL1A 3PVXA 3ZZRA 3KXDA 4JOUA 4NLPA 2YKOA 3MCSA 1SC4B 3KNAA 2J9CA 5KFNA 3H5UA 1R6YA 4K50A 1U48A 5K8MA 3H25A 2V0NA 4P2SA 4LF6F 2P6TA 1WD6A 2PDAA 4QW8A 3OVBA 3KJNB 3FK4A 4CLZA 3Q89A 5HQ8A 1KS2A 3CJ0A 3ISNC 1OQ3A 2BJ9A 2MKJA 3JQKA 1QUPA 1FXRA 2M4MA 4OJ1A 1UFLA 1S48A 1G6BA 1R89A 4DPWA 3EGVA 4M5NA 1V5IB 1S72S 1EB0A 2R7UA 3QGIA 2B7BB 4F7VA 2CVIA 1CULB 5HJXA 4LF2A 2R7VA 4B17A 4TVAB 1FO1A 2B0GA 5J2NA 1LXJA 1OQ6A 3EWGA 4PAAA 1CLFA 2J8AA 2FLOA 2OHDA 4ZCKA 3FGVA 4KV8B 1U0HA 4WK3A 3R7NB 2DNKA 2LA4A 2JVOA 2VQEJ 4GC7A 2VC1A 4Y28C 3KJFB 1NK4A 1T9WA 3IG1B 1F2HA 4KO0A 2GAHC 2F40A 4F02A 3T9ZA 4Q2LA 3KNGA 1S6OA 2C2OB 4URGA 4ZPWR 3FSXA 1ZZFA 1S1TA 2DD8S 4B3MJ 2HNYB 3TAMB 5CD4H 1C2PA 4KRWA 2JSXA 2JEIA 3K5LA 3TAQA 3HM9A 3CD7A 3D1HA 4X2BA 4L6V3 2CPEA 3IRWP 2DH7A 4IR1A 3KG4A 1DQAA 3Q83A 3G82B 4OHXA 1T7PA 2V2VA 4K59A 5LMNF 1YBUA 4ZVQB 1H2TZ 3SSQA 3DYAB 2XZTB 1WSRA 2RAQA 4E0DA 2ACMA 1X4EA 2JEGA 5D77A 2MZRA 5E3QA 1TUVA 4X4NA 2LDIA 2R7RA 3TX8A 2O66A 4PG4A 3CB4A 4H54A 4LF8J 4JI7F 4C0BA 2KRRA 1RWPB 4WIIA 4ATNA 2W9BA 2G0CA 3VAIA 1WC4A 2IBOA 1RTHB 2GA7A 5JVGQ 1BY9A 5BR8F 5CYQA 2UXBJ 3AD9C 5L39A 2Q43A 4EK2A 1GTHA 2R2RA 4URQU 2DEIA 2X1GA 4M5GA 4PWWA 4USUA 2FHJD 3P96A 2MQQA 4U6PA 4G65A 4P6QA 4LIRA 4FXVA 2MZQA 1Q8IA 2JOQA 3BO2A 4AL7A 1VQ8S 4F4AA 2F8HA 1K0TA 1RB0A 2MQNA 1YRXA 2HFUA 4N8NA 1HBUB 4X66F 2BJ8A 1R8HA 1O6XA 1UA1A 3I9V9 3SFUA 2PIIA 1NUEA 2CPZA 3GPAA 4B3SF 1D3WA 1HPZB 4OFZA 2R9LA 2QA1A 4P75A 4NLRA 1JKHA 1UETA 1VRTB 2L41A 4O3PA 3PO5A 3L7UA 1FTRA 4LF4J 2HFSA 2KTQA 2V8GA 1VCTA 3Q8PB 4MK7A 1LKZA 3HI9A 1RGVA 4QIGA 4Q8FA 5T7LA 4KGVB 3MURP 1WELA 1R8BA 1RCOB 1WNEA 2MKYA 1LK5A 3FFIB 3L9ZA 4DUTA 1FRMA 2IIHA 4QWEA 2D3UA 4A8WA 1RT2A 3DRSA 3DU5A 3RAQA 3OJUA 1QDUB 2VU5A 1JLAB 1IKWB 4Z2XA 1FT8A 3FRZA 2HGLA 3QT6A 1NK9A 1J2VA 2HVDA 1M90T 2JZ5A 4WYWA 1SC1B 3GILA 1XIQA 1JXLA 1OSCA 3DMJA 3FSIA 4KR0B 4YHHJ 3T9NA 4PPZA 4UZCA 3R3TA 5KG0A 2E1RA 4ZCLA 1RUSA 4QQBA 2ZD1B 4IFVA 5DM7Q 4RPFA 1HBUA 4QIVA 4PXDA 3BQ0A 5KFUA 1RTIB 3WHIA 4CP5A 1KLMB 3QAUA 3LA0A 2HGMA 3NWGA 1QTMA 4ED4A 2OPPB 4N56A 4OX7A 3B82A 2EEYA 1J5EJ 5HROB 3W61A 1IKYA 5DLGA 3M9NB 2IM0A 3C14A 1HBMB 4AUKA 5HSPA 1FK9B 3R5JB 2XCPA 4U95A 3ITHA 4GMKA 1K1QA 4RU9A 4X4OA 2HHHJ 4OZ3A 3OTOJ 4IQMA 2VJVA 2G0JA 5FLXY 2ZUAA 2KYZA 1KVJA 4MK8A 1RHJB 2DEJA 2N4CA 5FD1A 2GJIA 2Z56B 3I87A 3AOCA 3M1VB 3WC0A 3ZTRA 2ZH7A 3R27A 3DLGA 4FYYB 3O2IA 1BQNA 2AYMA 2ZH3A 3KMQA 2VG7B 2H48B 3T1AA 3UCZP 4QPTA 1UVMA 3NS6A 3AT1B 2W9CB 3ONQA 2YNGA 4QW9A 2P9EA 1NDKA 3JAMU 3AJDA 1T11A 5G0RA 2HZCA 3ENVA 2ZWPA 2UV8A 3RB6A 3OUYA 3QT8A 3BGRA 2XSJA 3OPKA 3CTRA 2R8IA 3P6YC 1ZETA 3DI6A 2HRYA 1QVFR 1WKLA 4ES2A 3C6TA 3DM2A 2ZD1A 3RB3A 3VAHA 5EWEA 4IOCQ 3F56A 3M7VA 4A8FA 4ZMMA 2BYCA 5M2UA 5J1NA 2EBGA 3FMWA 2MLXA 3RZAA 1W2IA 3OVSA 5D4NA 3BO3A 5F8HA 3FRYA 4LF6J 3OHBA 1IXKA 2B5JA 2GS8A 1X4FA 3HKZD 3RRHA 3DRXA 5HROA 1HQEB 1FE4A 3GG1A 3PNIA 5IM0A 3M2RB 5B7WA 2EKNA 4MIWA 2DXEA 2RHQB 1LXNA 2YWWA 2U2FA 1C1CB 4MK9A 4B9LA 4ETZA 1L3KA 1TKZA 2CQ3A 3KK2A 4USKA 5IC4B 2OD4A 2B8PA 5D0EA 2DB1A 3M1VA 3DRRA 1HW9A 4ZKAA 4LFBF 1KTVA 1TKXB 1TKDA 3BDPA 2AIRB 1T94A 2W9CA 1RWKB 3FQKA 4LVNP 2DNGA 1JLQB 1RE1B 2QLWA 2YPYA 3KLEA 3EM1A 3CDUA 1UW9A 1LWXA 3HFVA 2GHVC 2XHWA 5HMXA 1PGZA 4FKXA 5JMNA 2LP4A 3NNAA 4RW8A 2QEXS 3EXCX 2H4WB 3OR1B 2ILZA 5K14A 4OZ2A 2FZCB 2IA6A 4J9PA 1RT3B 4K4ZA 3H5YA 4UOCA 2LVWA 3LP0A 2BKNA 3CWJA 1VQ9S 4OHYA 2E1CA 2N4DA 2C3UA 3AQPA 1FEEA 1X5OA 2GO8A 5GADU 2MQ8A 2ZHAA 4CTAA 1VBXA 3K59A 5GVQA 3M2UB 2IMWP 3QBCA 1WUUA 5B0DA 2DIVA 1UVLA 4DV3F 1X31C 5L46A 1SIZA 4IFYB 4NA3A 2UU9F 1S10A 1S6PA 5B09A 2D9OA 1RSCA 2ZHBA 3CE8A 2DCUB 4TQSA 1ZZNA 3QIPB 2QMXA 5LMNJ 3CMQA 3DRYA 1QAXA 4V1Ak 1N5YB 4DR6F 3BO4A 2MSSA 2A10A 3M2RA 3GFXA 1DARA 3LF0A 2W25A 3NGTA 2L9DA 2BJDA 4DZDA 1VLYA 4Y2KA 3KUEA 1DTQB 2IHR1 4WKYA 2UUBF 4M8LA 4EBCA 3MR7A 1OSDA 3FC9A 4JV1A 5DRKA 3W2VB 2E7XA 2EFPA 1UKUA 2J0WA 4JI7J 4V19J 3MECB 4TLQA 3MR6A 3I55S 3ISZA 2PT0A 2MPUA 2AJFE 4DG1B 4HH0A 4CLPA 2RE1A 2PC6A 2HYIB 1OY9A 2F8EX 2ASLA 2VH7A 5LM7E 2B43A 5ITHA 4NXMJ 3BR8A 4NZ7A 4OI2A 1NJYA 4OHWA 3EDRB 4JV5F 3MEDB 5C5JA 2MQMA 5K8OA 4NI2B 3TP2A 4ZCIA 3PW4A 2QLXA 5DETA 1IR2A 1QD1A 1HARA 4KYZA 1Z2LA 5KFPA 2QMWA 1ZM4A 4WP8A 4NRUA 3KFWX 4J9VA 4X66J 5KFFA 4EZ9A 2X3DA 3ETOA 1FFGB 2AEMA 4P2XA 3DDKA 4B3SJ 3MFIA 3KK1A 3IBCB 4K2XA 4M95A 4P73A 4DU7A 4USVA 2RJZA 3NXZA 4DX8H 4DV0F 3N79A 4N7TA 5C7PA 1R43A 2ATLA 3HMJG 3BSAA 1QE1B 1YKWA 1MROB 1QSLA 1HNIA 5L1JA 2I8EA 3RB4A 1UWAA 3IGVA 1GMWD 1S1WB 4HI2A 4C11A 1HWIA 4ED6A 1WSVA 5BXIA 1TFWA 5EGYA 1DTQA 4ERDA 3J81j 3P3DA 1RYSA 1SI9A 4DWIA 2YWEA 2AJ1A 2DXDA 1WC1A 4JUZA 1M1HA 2BQUA 1JB0C 1SPBP 3R5AA 3GJTB 2MJUA 3R1HA 2J9DE 1I6JA 3H4DA 3EGNA 5L1IA 3IBWA 3PJ9A 3CC4S 3PRDA 4RKUC 1F5BA 5M2RA 4Z7YA 2HFZA 2OEKA 2OPQA 1V6HA 3UD4P 2R7OA 2K06A 3FEZA 1N6QA 2BJEA 3DCAA 1HD1A 2VFSA 3V4IB 4F36A 3MMAB 3UNYA 3H2UB 4RNOA 3J7AN 3FVYA 4XPCA 2W2QP 1N5SA 2DR6A 3K5PA 1N48A 5F0UA 3C19A 1IR1A 4EI2A 3MEEA 4J9KA 3G8QA 2V8DA 1YJNS 4OZ5A 3UD3P 2RQKA 4YB6A 3QGGA 5AXLA 2KT3A 3VGSA 1P8GA 1ZM9A 3FNNA 4FXDA 1TL1A 2VODA 2GZOA 1NH8A 2EK1A 3GP9A 4OV1A 1YSJA 1OWXA 1H3DA 2H5IB 3HXMA 2ZC3A 4MAKA 4UTGA 3M9OB 5A76A 3W62A 1T9TA 1ITPA 4JI5F 5GAGU 4WFBQ 2XG8A 2CJKA 4WXOA 1RAEB 4Q7AA 5IOLA 1JIHA 3GFHA 3CCSS 1ZPVA 4GKJF 4DFKA 5T14A 3KYLA 3OVAA 5I42B 5HAOA 1SQGA 4K7QA 3SDEB 4D3HA 2PMZD 2XYHB 1EHWA 3EICA 4EMDA 4CLWA 4ICLB 2CZVC 4Y0FA 3LAKA 3HKWA 2IM1A 3GIMA 1OY8A 5GAHU 4KHMA 4LSNB 2FHKA 2YWHA 1FDAA 3E3XA 2IVFB 2MZJA 4DR5F 5CA5A 3MEGA 3V4IA 4PQUB 3Q2SC 4B08A 3HULA 4B9TA 5HLFB 2A18A 4KGKA 3FEXB 2VD3A 3FCVA 5J1EB 2HMIA 2YNIA 5I3UA 3UN5A 2C22A 4PPDA 1NHUA 3TVKA 3TJ8A 2IA0A 4PYDA 3T5JA 2XY7A 3QWPA 5GMEA 2KXNB 2HNZA 3CEDA 2BQRA 4KGZB 2LMIA 3CCVS 3PKMA 1YJ7A 4DPUA 1RA7A 1UVIA 2Y0BB 1FKOB 1XEZA 3KHGA 4IRDA 4ZA1A 4R25A 1PSDA 4I1TA 1C1BB 2AGPA 1OY6A 2CJQA 4I67A 2F1FA 1FRLA 2OGUA 1R8AA 4A8OA 2R8JA 4WK1A 2VBYA 3BDEA 4ELVA 4CLYA 2PI5A 3NCQA 2XMVA 4KGMA 3VVTA 2MY8A 3DOMB 5IC6B 1FJ7A 3VVUA 3D3CJ 1GQEA 4ELUA 3NG8A 1GMUA 5KFWA 4LFBJ 2P9CA 3FUYA 4P9SA 2PEBA 1KP6A 1YJUA 2MXYA 5CYMB 4AL5A 1JLBA 5L9XA 1B7FA 2NYIA 4L75A 2KT2A 2XO7A 1BWVA 3I0SA 1DTTB 3EZ5A 3HHEA 2QG9B 3DRPB 3UCGA 4PQUA 3ADAC 2XMTA 4PUOA 3QFWA 1JLEB 1P6TA 1U1QA 3R5CA 3UCUP 2DK2A 1CBKA 3DOKB 1IVZA 3GV5B 5J2MB 3TUJC 1L3UA 2CG8A 3F73A 4DS4A 2W4PA 2VFVA 3HHKA 3V6HA 2BRKA 4LSZB 3BSOA 4IUFA 1A9NB 4DV3J 1VJQA 1I3OB 1RTJA 1YJTA 1VI7A 2ZBRA 2UU9J 4C9DA 4N76A 1RAAB 4CH0S 1FKOA 1X5SA 2IDEA 3OT9A 2BANB 3N5FA 1HA1A 3QIDA 3GU0A 4O3RA 4KJIA 1C1BA 1VIOA 2AT1B 1NPRA 3JXOA 4DR6J 4RW7B 1YJVA 4FBTA 2V2KA 1Q1KA 5DDRC 3T6BA 2V4JA 1O8BA 2JRSA 3K89A 4C8MA 3CCTA 2DH8A 1HMVB 2VKRA 2FVCA 2UUBJ 3CDAA 4WYLA 2YWGA 3GE9A 4ED3A 2ZH9A 4S0MA 3IS9B 2IPOB 3UD5A 4O3NA 3O1LA 2R2SA 1QAYA 3S1TA 1U7LA 4M5HA 1TL4A 4FDFA 1RHUB 1M0SA 2RQ4A 3OBIA 1S0VA 4LBHA 4DMZA 3PW2A 1TL7A 1DFDA 2OLWA 3D1OA 1PYTA 2HWHA 1S1UA 3GIRA 1U26A 4NOHA 5HMZA 3CDBA 3CCZA 4DN0A 3C16B 3KLFB 5MAOA 1ZPWX 3DRPA 3BSNA 4JV5J 1RTDA 4A48A 4BLGA 3HJFA 4WBFA 1T9XA 4Y2AA 2NQPA 1S59A 2KJVA 5AE2A 4PRFA 3PY8A 1WHWA 2B6AB 3HSZA 5DGAA 2NSCA 3NCPA 1GH8A 3PYDA 5D0GA 2CQPA 3R5BA 1VC0A 2GHWA 3D1QA 2KVIA 4TLRA 4UY8T 3I31A 2POKA 2DRDA 2N82B 2B9EA 3DN9A 4ED1A 1IM4A 2AQ4A 1SCJB 2E5GA 2VDIA 3MM6A 4DV0J 5CQGA 2PFFB 3GYGA 2VG5B 1NPKA 5H1SV 3T5LA 1B99A 2BBEA 2BANA 3TANA 2DGXA 2H54B 2WW8A 3BGFA 4DQRA 4GKKJ 4OI0A 3DDIA 1S0NA 1UWBA 2NZ4A 3L4BC 4NLQA 2Z57B 4BC9A 1CJKA 4ED0A 1FJCA 4USHA 3H0PA 4ZN1A 3T6JA 3TA2A 1X5PA 2RHSB 2XO6A 2JFKA 5LJ3Y 2J5AA 1U09A 5J2PB 2HQGA 2MZSA 2G1HA 1X5TA 2ADCA 3BPSP 3N6MA 4O3QA 1N88A 2ZITA 1WEXA 2WSFC 1KQGB 2RRBA 2BUNA 3U1MA 1N33F 3F0NA 1TELA 3O44A 1VRUA 4P74A 1AZSA 3MPUB 3PX4A 4CYUB 3MM9A 1S9EB 1TV6B 1MNEA 3SFGA 3R6LB 2YNFB 1C0TA 3FSYA 2ZEJA 4L74A 2B4PA 2NXJA 2GMHA 4NMLA 3M8RA 1FERA 2B6AA 3D5MA 4DQQA 3JQJA 3TUZC 4HHUA 2E9ZA 4OYXA 4YP3A 1Q5VA 1OPZA 3MEKA 1BLUA 2I9SA 4QIEA 1UJ6A 1XNQF 2FJDB 2HNDA 3G6YA 3C6UA 3SCKE 3PTWA 4AFFA 4W92B 2J6UA 4NLDA 4F0MA 2YH1A 5FJ4A 2W4CA 1UJ5A 2E44A 3POTA 4ZP7A 1HWUA 4ZS6A 1RDRA 2M9KA 1KR4A 5KFKA 4LRBA 2R7SA 5HBMA 2W7OA 5KG4A 1NDLA 2N3OA 3QWUA 4JI5J 1LFPA 5AE1A 4ZITA 4ITSA 3KJVA 1FX2A 1VISA 2DJWA 1FXLA 3DLJA 3PFOA 4MFBA 2AJQA 2A3JA 4ZLPA 5B08A 1CQNA 1L3TA 2XCAA 2WVFA 5A8KA 3DHWC 1I1GA 2XYPB 3PIPQ 4W98A 3IA0A 2B51A 4ZVGA 1MN7A 4DV7F 3MI7X 5EX0A 4R0EA 2LU1A 2I5JB 1S9EA 1CEZA 2H65B 3G6VA 4KPYA 3GSIA 1SH2A 2D69A 4ZDNA 1WI6A 5ADZA 1KKHA 4DR5J 1MW7A 3CCUS 2YKAA 2VBZA 2XZDB 3W7BA 2AJ4A
chains in the Genus database with same CATH topology
2VG7A 2HNYB 1WG4A 4I2PA 4PXBA 3TAMB 5CD4H 1FKPB 2IM2A 2FJAB 1Z1ZA 3KG1A 1S7HA 1C2PA 1F0XA 1R31A 1FD8A 2V4JB 1NHVA 3LP2B 2JSXA 4KRWA 3HZGA 1E6YA 1LOUA 4KBIA 2JEIA 2F4VF 3K5LA 5D8HB 4F3MA 3TAQA 4URSA 1IBKF 2BE2B 4DLGA 4ILLA 2VB6A 3MTKA 3HM9A 2KKHA 1IJFB 1XN9A 3CD7A 3SXLA 4CNZA 4DUZF 3D1HA 4X2BA 1T05A 4L6V3 4DL0C 2HVZA 2CPEA 3IRWP 2DH7A 2I0XA 1MU2A 2CQ4A 2WK4A 4IR1A 1FDDA 2DHAA 3I32A 3KG4A 3H4BA 1XERA 1DQAA 3TOQA 4EFAC 3S7RA 5E2QA 3T5KA 3NGKA 1RT1A 5J2QB 4OHXA 3M05A 1NK7A 1TK0A 5BYQA 1WEZA 1T7PA 4K59A 5IT4A 5LMNF 1CC7A 1FJEB 4E98A 4IG3B 3AAWB 1TR0A 3ENQA 5KFDA 4G1QA 4LQ9A 4RUHA 5KFRA 3L3CA 1KHWA 1Q8LA 4RUCA 4F2RA 1WF1A 1H2TZ 2IAJB 3HPOA 3SSQA 2KRBA 1MMDA 3DYAB 3MMCA 3ZZ0A 4NLYA 4RZRA 3M2VB 1D9FA 5EWFA 4QWCA 3ISND 4RW4B 4E0DA 3FCHA 4O44A 4IG0B 5H9EJ 1RT6B 3T5HA 1X4EA 4C3MA 2RDIA 1RT7A 4N77A 4WE1A 3S6EA 2B9WA 2FVSA 2JEGA 2JEJA 5D77A 2MZRA 4PQAA 4NYZA 1MMNA 2MQPA 5E3QA 3JSYA 1T03A 1F60B 1TUVA 2JVRA 2LDIA 2R7RA 4X4NA 2YY3A 3TX8A 1P1TA 4DFJA 1S1UB 2KXFA 1KTQA 2XBPA 2O66A 2RNEA 5THWA 1VK8A 5A8WB 1O5JA 4PG4A 1Y5LB 3CB4A 4H54A 4JI7F 3W2WB 4C0BA 2KRRA 3SSRA 3E2EA 2RH3A 4A8XA 3KK3A 3QGPA 1RTDB 2XI2A 2P9GA 2MZTA 4WIIA 1SQEA 3UDCA 4F3QA 1MWZA 2HHVA 4ATNA 2CYYA 5KT7A 2W9BA 3NNHA 3N0VA 2G0CA 3EGZA 3L09A 2ZUGA 3VAIA 2J76E 3BQ1A 3CJ3A 2IBOA 1RTHB 3V4MA 1RKJA 2EC0A 2B4OA 2GA7A 4QWDA 2DTJA 1L5UA 4Q2MA 5JVGQ 1BY9A 5BR8F 5CYQA 4RWXA 1HQEA 4B3OB 3MAQA 2LU2A 5AE3A 4DDFA 1C0UB 5KFIA 5I3PA 2D1CA 1A7GE 4RX6A 5L39A 2UVWA 2KJWA 2PN6A 2Q43A 4Y2CA 3R1LA 4WXWA 1OS5A 1VQNS 4EYHB 3I5AA 2IBKA 4FF3A 4QBUA 1QLNA 5DDQC 3MZIA 1N4LA 1GTHA 2R2RA 4URQU 1V3RA 1FNOA 2X1GA 4MMOA 4PG7A 2WB1D 2FHJD 3O6QA 5E41A 4C98A 1GNKA 5F8LA 3P96A 3O3LA 4GO7X 2MQQA 4U6PA 1HNXF 1C1CA 1D0EA 4P6QA 2J7KA 3MM6B 3M6VA 4FXVA 2MZQA 4HTJA 4LIRA 1Q8IA 2C2EA 2JOQA 4EWTA 4L3NA 3BO2A 3CIMA 4AL7A 2YKNA 1WTBA 1VQ8S 1N0UA 1LWFA 2KZMA 1NK6A 1L3SA 2F8HA 2QZ8A 1K0TA 3MM7B 4JI6F 1SJ1A 2MQNA 4CT8A 3LP1B 4DR3F 1YRXA 3MAHA 3CCES 2LEAA 2COLA 4N8NA 2K7KA 3V6JA 1QY7A 2CRLA 4CO3A 1SH0A 3K2YA 3GMGA 2LECA 4X4PA 2PMHA 3AQOA 3LPYA 1HBUB 1QSYA 2NR0A 3FQLA 3OR2B 4X66F 2XMKA 2W9AA 1R8HA 4TNOA 1UWBB 1TKXA 3IXQA 4OZ1A 1HNZF 4O4GA 2ZBIA 4PCQA 5GMKa 2D9PA 4B3RF 1UA1A 3PIOQ 2J7WA 1NK5A 3I9V9 1LW2B 3SFUA 2PIIA 2MY7A 1K9MT 3VTIA 2CPZA 4RBUA 4NYPA 4FF2A 1BWEA 3MUVP 3B4MA 3B78A 4B3SF 2ZDPA 3NBPA 2B4VA 4C0OC 4G1PA 2HFOA 1HWJA 3IR5B 2ZJRQ 3PM9A 1D3WA 1HPZB 4PWUA 2YWFA 2BVZA 2R7WA 1QM9A 4OFZA 2R9LA 5DDOC 4AQYF 1WF2A 2EG2A 2QA1A 2RRNA 1JLQA 2RVJA 4QIFA 1LW0B 1WWHA 4NLRA 1FNXH 1JKHA 4G1IA 3OFHA 1UETA 1VRTB 1AFJA 2YVSA 1JLGA 1ULRA 2LQ9A 2WHOA 4J5OA 4TY9A 2L41A 2WBMA 1ZH5A 4O3PA 3UI3A 4IH5A 1S99A 2ROPA 4K4YA 3PO5A 4HL9A 3OQ2A 2LDYA 2FC9A 2KT5A 1EETB 5CHCB 3CJKB 4CH1A 1VFJA 1OO0B 1FTRA 3OR1A 3KMSA 1JMTA 1FVSA 3M2VA 2KTQA 1RT3A 2V8GA 3PDNA 1IKVA 1KFSA 3QLHB 2KYXA 3Q8PB 3T19A 2XS5A 2HFNA 1RT6A 2M70A 4MK7A 4J37A 5C24B 4C8LA 1LKZA 1HI8A 2CFXA 1U2RA 4NLWA 2BZ2A 5B0AA 1J5OB 4ZPBA 4EU0A 2MGZB 1HHSA 3HI9A 1O0PA 4NL5A 1F5AA 1RGVA 1VRUB 4QWBA 4QIGA 1HFEL 3NKYA 4Q8FA 2HWTA 2GQCA 5T7LA 4CO1A 3CCRS 2W8KA 2R7TA 4RW9A 1HNVA 2J9DA 2K8GA 1S0MA 1LV5A 3PJWA 2X1BA 5HP1A 1YWXA 2PSZA 3MURP 4XK8C 4Y6IA 3MM9B 1WELA 2X3GA 2ROGA 3M2UA 1R8BA 3CJ2A 1RT4A 1WNEA 1S6QA 2IRXA 1LK5A 3W2WA 5IS2A 4IRKA 5E3CA 3K5OA 4FNHA 1XMBA 3MM5B 3FFIB 1BGXT 4BC7A 2DNPA 3IGNA 3OTCA 2GO9A 1C0TB 4IRCA 1UEUA 4WF9Q 4JBCA 1FRMA 1ROFA 2F9JA 4IFYA 3ZZTA 4KHRA 3DC2A 4QWEA 3DLEA 2D3UA 4A8WA 1RT2A 3DRSA 3NAIA 3M32A 4XPEA 3DU5A 3RAQA 3OJUA 4LF5F 2DGTA 3US5A 5LJ5Y 4OZJA 3QIPA 1JLAB 2XI3A 4OX9F 1HQUB 3SCIE 2GV1A 1IKWB 4LJMA 1N5YA 4CO5A 4Z2XA 1FT8A 1VOMA 4NLGA 5IT9Y 3FRZA 2HGLA 1NK9A 4F67A 2GNKA 1J2VA 1D8ZA 2CQCA 1M90T 5GAEI 2U1AA 2J7UA 4NZ0A 1U49A 2LEPA 2C3PA 2ZH6A 3DLLQ 2ACYA 3DLHA 2EFQA 2JZ5A 3N5BA 4WYWA 1NKCA 1XK8A 1VQ5S 3ICLA 3GILA 3THVA 2CPHA 2FGOA 1K8AT 2IRUA 1JXLA 1OSCA 2HNDB 3DMJA 2GQ2A 2OPRB 3C6UB 1SJRA 2EG1A 4OX8A 1AXQA 6FD1A 3FSIA 1AFIA 2GX8A 3KHRA 4KR0B 1B64A 3T9NA 2WSCC 3GR1A 4ZCMA 3C66A 3PEHA 3W2VA 4PPZA 3UW1A 3R3TA 5KG0A 4KAIA 4X4RA 1FEHA 2E1RA 3JTPA 3BEGB 4X65F 4ZCLA 4QQBA 3MECA 3SQGB 4KHPF 2ZD1B 1WHVA 2GW8A 4LSLB 4IFVA 3EX7B 2R2UA 5DM7Q 1T3NA 1HYSA 1HBUA 3LW5C 4DL2A 5KFBA 1HHTP 4QIVA 3CDEA 3TVZA 3M30A 5C42A 2F3JA 2MKCA 1NKBA 1AUDA 1UVJA 4PXDA 5B0BA 2HLTA 3POTB 2WRMA 2KB2A 3BQ0A 4KB7A 1T8EA 5KFUA 3J7A1 1VC6A 1LW2A 3NMAA 2XLIA 1YTYA 4DG1A 4YR0A 2YQ3A 1RTIB 4W90B 2HVIA 1NKEA 3AB4B 1JLCA 2DGOA 2RKIA 5HBMB 3JAMY 2BW2A 1NAQA 1VC5A 3MUMP 2KM8C 3OLAA 1KLMB 2KG1A 3QAUA 2HHXA 5IT0A 2HGMA 1N32F 2XLKA 1M1KT 3NWGA 4F50A 2QA2A 2DGWA 4P7VA 1QTMA 2ZJPQ 4XDCA 4F4XA 1H2UX 2OPPB 2L9NA 2MHEA 2DRAA 1V9OA 3IFEA 4I4BA 1M5OC 4JI3F 3QJJA 4N56A 1UJ4A 4U9RA 2G1DA 3KJVB 4OX7A 3B82A 1JLFA 3I4PA 4PXCA 2BQ3A 5HROB 4FS1A 4IYQA 1IKYA 5DLGA 4MFBB 4USIA 4ZP6A 3MEDA 2ZE2A 4U67Q 2IRYA 4R8UA 2LQ5A 2D3OR 3V6DA 3M9NB 5GAGI 2HHSA 4ZPAA 3R5DA 2IM0A 1GXUA 4I0WA 4XO0A 3JB9k 4HTIA 1HBMB 3DLKA 4AUKA 1FHTA 3J7YI 3PKYA 4ELTA 2IC3B 3I82A 2ZZMA 5A8KB 3UE2A 1FK9B 4TKTA 2RQCA 2XCPA 5FDLB 3ITHA 4GMKA 1K1QA 5F3ZA 1T95A 4RU9A 2LXFA 3MFHA 5L1KA 1Y3JA 4X4OA 4FS2A 4LF7F 1H6KX 2LLZA 2LEBA 2IYGA 2W7AA 3QJLA 1SUQA 4IQMA 3AJ2A 4KO0B 3VWSA 1IN0A 3GZ7A 2YKQA 2OPSA 5A2QY 2XS2A 4EBEA 3ZZUA 2EW9A 2HS3A 5FLXY 3IRXB 3FDSA 4EO6A 3CJ5A 2KYZA 2BV3A 3RW7A 4K4SA 1KVJA 4PR6A 1ELOA 4IOBA 4MK8A 2NS1B 4HH1A 2AYGA 2Q6CA 1BQMB 2JC1A 3WX4A 1VQPS 2CZ4A 4NX9A 2N4CA 1X4BA 1HBOB 4NLXA 5FD1A 4RNMA 3MM5A 2DCLA 2GJIA 3I87A 3M1VB 3WC0A 4ZVEA 3GSDA 2ZH7A 1S1TB 5KFAA 3R27A 3DLGA 2EFVA 2P5VA 3O2IA 1BQNA 2AYMA 2ZH3A 3KMQA 1VQ7S 2ASDA 4Q5VA 2VG7B 2MQOA 4QR1A 4I2PB 1YQHA 2DGQA 4JI8F 2QYCA 2B9XA 2M5YA 3T1AA 3UCZP 2VC0A 4WFZA 2ZH2A 4QPTA 1UVMA 1XTZA 3TO8A 3NMRA 1E6YB 3NS6A 4FN5A 2YKPA 2W9CB 1HBNA 3BGLA 4EYIB 2AYEA 3ONQA 1JJ2R 2YNHA 1WG5A 1QE1A 2DT9A 2YNGA 3ZFVA 4QPXA 4QW9A 4ECZA 2ZKUA 1B0PA 1MROA 1CQMA 1T05B 2DR5A 2UVVA 2P9EA 3JSRA 1OIAA 3OXFA 3BZQA 1MU2B 2KFNA 3G86A 4YR3A 4FXWA 1SJFA 2CPYA 4FF4A 1SH3A 5JJBA 4NRTA 1S1WA 4Y2MA 5G0RA 2HZCA 1UMJA 3ENVA 4OMFG 5IQQA 3CD5A 4HKQA 1RT1B 4N5SA 4B9SA 4PWDB 1U1OA 2K3KA 1NEEA 2OD6A 3CSKA 3GYNA 2RUGA 4HHJA 3TI0A 2UV8A 1OPIA 3IAM9 4DSFA 4G1QB 2OPRA 3RB6A 3K57A 4BS2A 2ERRA 2KHCA 3OUYA 2M3DA 4TXSA 2GMJA 1IUJA 3BGRA 4C8ZA 5KG6A 4RNFA 2XSJA 3OPKA 5KT2A 3CTRA 3MMCB 4TN2A 4LF9F 5KFTA 2UXDF 1X0FA 2R8IA 4OJHA 3P6YC 2I1RA 1ZETA 2XC9A 1FRJA 4B3TF 4M94A 3SV3A 4J9RA 3DI6A 2HRYA 3V5RA 4O44B 2E5HA 3OFFA 2ZOFA 1QVFR 2C3MA 4ES2A 3C6TA 3DM2A 2ZD1A 2HQ3A 1RT7B 2E7WA 4WE1B 3VALA 3RB3A 3O5TB 4X64F 1ZAWA 3KWMA 4ECYA 4C8OA 2LKZA 5DQHA 3VAHA 2M7SA 5EWEA 4IOCQ 3F56A 3PW5A 3N01A 1A6LA 1T03B 2DGSA 4A8FA 1U1RA 4ZMMA 4A8YA 4O23A 1VBZA 2BYCA 2MKIA 2VQFF 3QO9B 2AF6A 3UDLA 5M2UA 2V5HG 1JJ4A 5J1NA 5J1PA 4HT5A 3Q8RB 2XGQA 2EBGA 3K5MA 3FMWA 3GR0A 3RZAA 1W2IA 3OFEA 4H4MA 1X9SA 3H5XA 4X4VA 3Q23A 3AB2B 3OVSA 2MKHA 2L9WA 5D4NA 3QMQA 4EUVA 3VF0B 1FRHA 5F8HA 3FRYA 1T3OA 1H0HB 5EWGA 1DLOA 3BO3A 3OHBA 4A8SA 2L3MA 3KK3B 1SJ4P 2UUCF 4BDPA 5F3TA 3ENWA 1IXKA 4JYAF 2B5JA 1X4FA 2PEHA 2OAUA 3IWXA 3HKZD 1D8YA 2W9BB 2AV5A 4Q44A 2DNRA 3DDNA 1VQKS 3Q8SB 4DR2F 4EBDA 3DRXA 3RRHA 5HROA 2HHTA 2NPIA 1YJRA 3D2WA 5FIIA 5HMWA 2CJ9A 5CYQB 1HQEB 1FE4A 3A1YG 4QIWD 4UQGA 2B3TB 4AL6A 4USJC 4C3KA 3HLUA 4MKYA 1SKRA 2E5JA 4NZ6A 2LXIA 3GG1A 2AW0A 4DUYF 2C42A 1X4HA 3PNIA 2IC3A 3IR6B 2MZ1A 3MR3A 3UWTA 3MMAA 3PW0A 1LQ9A 2ASJA 5IM0A 4I64A 3M2RB 4ECUA 5B7WA 5T41A 2ASYA 4JI1F 4MIWA 2LYVA 4QR2A 1TL5A 3AY0A 4ZPCA 4J9LA 2XMUA 5E3PA 5I3QA 3CPWR 3DOLA 5GADI 1LXNA 4ECRA 5LSLA 2U2FA 1S76D 2XULA 1C1CB 1VJWA 3RBEA 4MK9A 4B9LA 2FTRA 3HF5A 4ETZA 2PA3A 4OLPA 2ZH4A 1L3KA 2YKNB 5M2PA