1GAOA

Crystal structure of the l44s mutant of ferredoxin i
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCASCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN I
publication title Azotobacter vinelandii ferredoxin I: a sequence and structure comparison approach to alteration of [4Fe-4S]2+/+ reduction potential.
pubmed doi rcsb
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1gaoA00
1FRMA 3MMAB 2FGOA 2FJDB 2V4JA 2FJBB 2FD2A 1DAXA 1FXRA 2PDAA 1A6LA 2Y0SD 2Z8QA 2WB1D 3HKZD 3MM5B 1B0VA 3MM9A 4XDCA 2V2KA 5E7OB 1D3WA 3IR6B 5CHCB 1H7WA 4CI0B 4ID8A 2C3YA 2GMJA 1C4AA 1GAOA 1PC5A 1FCAA 2V4JB 5FD1A 1B0PA 7FD1A 2ZVSA 2WSEC 1H7XA 1BQXA 3MM9B 3MMAA 4OV1A 1JNZB 1Y5IB 1FDBA 1Y5NB 4DHVA 1IR0A 3EXYA 4OMFG 5L8RC 2FDNA 1FD2A 1BD6A 1FRLA 1SIWB 2WSCC 1BLUA 2C3OA 1FRKA 3MMCA 1Y5LB 1BWEA 1XERA 1DFDA 1KQFB 5BYSA 1G6BA 3EGWB 1B0TA 1FF2A 4XDDA 3IR5B 1BC6A 3MMCB 1FRIA 3MMBA 1DURA 2PMZD 1JB0C 1FDDA 2WSFC 1FRXA 1H98A 3OR2B 2FJEB 4Y28C 4AYBD 1IQZA 3MMBB 1H0HB 1AXQA 1G3OA 2VPXB 1ROFA 3LW5C 1CLFA 2GMHA 4L6V3 1F5CA 3GYXB 1C4CA 1FERA 3EUNA 1FXDA 2WAQD 1JNRB 2C3MA 1FDAA 1Y4ZB 1K0TA 3OR2A 3PNIA 6FDRA 2PA8D 3MM8A 1F5BA 2C3UA 1R27B 1RGVA 3MM6B 5BYRA 5CH7B 2XSJA 2IVFB 2C3PA 2VPYB 1F2GA 2VPWB 4RKUC 1GT8A 1GTHA 1SIZA 3MM8B 2VKRA 2VPZB 3IR7B 4KT0C 3MM7A 1FEHA 2XSJB 2FJAB 1FRHA 1FDNA 3MM6A 6FD1A 1FTCA 1PC4A 3OR1A 1KQGB 1WTFA 1KEKA 1HFEL 3MM7B 2UZAA 3C8YA 4XK8C 7FDRA 1GTEA 3MM5A 4YDDB 5BYQA 1VJWA 1FRJA 3OR1B 1Q16B 1SJ1A 2O01C 2C42A
chains in the Genus database with same CATH superfamily
1RT4A 4Z37A 3M2VA 3SDEA 3HZGA 4ID5B 3RW6A 2COLA 2CZ9A 3G86A 4ICLA 1MU2B 4QIWD 2JC1A 2DPJA 1ZM2A 4DV3F 1HKAA 5I3QA 1MMLA 4B3TF 1AZSA 1PJ7A 4YS2A 4R0JA 3TARA 1A0OB 2HG4A 4AE5A 3W5XA 3VAIA 2PMZD 4OX6A 1WWHA 1WEZA 5HJXA 2V9KA 4HDHA 3HFKA 3N5FA 2FJEB 1ZH5A 1K9MT 3K0JA 1P6TA 4I56A 2BYCA 3TO8A 3J80Y 3ZZYA 3G8TA 3QT8A 3NGDA 4U7UD 8ATCB 2XMWA 1Q8BA 3SQGB 2MQMA 4ZVOB 3GU0A 2POKA 2A1BA 4BBYA 1RJJA 2EXUA 3BSOA 3PRBA 5G4DA 3W9HA 5ETPA 4KHPJ 4KBIA 3MPUB 3UDEA 5CCMA 1HWJA 3HMJG 1DAXA 2SXLA 4F04B 1WOSA 2OEJA 2B7CB 1FKPA 3H42A 2BX6A 1YRUA 3PX6A 3H2UB 4DSEA 3EXYA 5FDLA 1WF0A 2W2PP 4HVZA 1U49A 3M8QB 3C6UA 3F44A 1QM9A 1QE1B 4CH1A 5KG4A 4DSKA 1KBRA 1Q86T 3DHXA 4NLVA 4F36A 1WD6A 4NRUA 4TLRA 4DBQA 1TK5A 1OY8A 3BO4A 5J2MB 2J7KA 5CZXA 2DIUA 2EK1A 1LWCA 3I0RB 3QIPB 1Q82T 1JLCB 3ZNJ1 1G7CB 3RW7A 3NY0A 2ROEA 3H90A 1JLFB 3A13A 1N54B 3KK2A 3MM7B 2DRDA 2H9ZA 2CQBA 4LFAJ 3A1YG 3D5MA 4R8UA 2CWXA 3PV8A 3ICLA 4NLDA 4LF6J 2CPEA 4KHRA 1RWNB 1HMVB 3H59A 3POTA 2V2VA 2KJWA 3DRXA 2XYHB 2VD3A 4USKA 3SI8A 1HD1A 1HMVA 1HWKA 2DR5A 4Q44A 4N5SA 3K5LA 1N5YB 1Q95G 3V6DA 1HWLA 2RVJA 3DXSX 3MURP 2LKZA 2ZDOA 2B4PA 2GVZB 2Q43A 4PXBA 3BPSP 2GIRA 3AFGA 4IQXA 1N88A 4Y2AA 4Y28C 4DPTA 2RRBA 4NRTA 5C42B 1R7IA 3CCTA 3M8RA 4MAKA 2XMUA 2HPUA 2K8GA 5HAOA 5C42A 2M5YA 1QSYA 2FLPA 1EKRA 1U1RA 4OHXA 1ZZFA 2QGFB 2XC9A 2WB4A 2QT7A 2W25A 4WP8A 1VLOA 5T41A 2DVIA 5GADI 2DNGA 3DOKB 1YX2A 1O0PA 2GVDA 3H4BA 2MEWA 5EDWA 3PEJA 1VDHA 2E5LF 2OI2A 5AXNA 1Q7YT 2WOMB 5KFGA 1RCOB 1WJ9A 2B6AB 4IG0B 4MTPA 2Q1LA 3KLFA 3NEKA 5ETQA 3CJSA 2QO3A 2BE2A 5CZVA 2ZBPA 2KHCA 2GNKA 4IG0A 2G0CA 3JSMB 1TKTA 2HRYA 2QG9B 5DDPC 1HBNB 1RABB 2ZOFA 5LL6d 3KHHA 3I6PA 2AJ2A 3DOMB 4L6V3 3FJ2A 4QZVB 1KLMA 3KXDA 4JI7J 5DJBA 1HBNA 3J7ZT 5ETVA 1U2FA 1M1GA 3QFWA 4EWTA 3ZTPA 5D0HA 3CC2S 2R7VA 5A8KB 1O5JA 1TR0A 2XB2D 2B8QA 3CGIA 4ZS6A 3DGPB 3GSDA 5HK4A 3RZAA 4IFVB 4I1TA 1DQ9A 2OLWA 3C6TB 4B3TJ 2BABA 1GTEA 3MF5A 5LSRA 2C42A 4TVAB 4Q0BB 2MKJA 2E5IA 2KB2A 1FX2A 5F8NA 2R2TA 3C6TA 3GB0A 3NNCA 4OYOA 3OHAA 1QTMA 4DL5A 2G1HA 4K5RA 4I6AA 1RE1B 5DG9A 2Y9HA 5AJ3F 5E2QA 4KQZA 4WYWA 1UVNA 2RH3A 4NE9C 3HSZA 5CYMB 3N0VA 5ETOA 3PACA 4J9RA 1T3NA 4YFUA 3CJ5A 1N0VC 2CQHA 5DG8A 4WZQA 1F3VA 3DGVA 4I6YA 1RAEB 1IJFB 5K5MA 5DQIA 1K47A 4DS5A 1VC0A 3GJTB 3LW5C 4OZLA 2XMAA 2IC3B 4WFZA 4ED5A 4MYTA 3O6QA 2E5GA 2DNZA 3K57A 3IMQJ 1UA1A 3EWGA 3JTPA 3MM8B 2E9RX 3AT1B 1JXVA 4RW4B 2MMYA 2XS2A 1FRHA 4A8SA 3SFUA 4N47A 2MGZB 1RTJA 4DDFA 2RD5C 3G6XA 4RW4A 5D15A 3WX4A 1QVFR 1UWBA 2DGQA 5EHHA 2YNHA 2MGZA 3HVTA 2V8VA 2YX1A 2OMLA 4RU9A 1QTNB 2VC0A 3DI6B 3IO1A 2NPFA 5A2QY 1PYSB 4ZKAA 3PHTA 3DLJA 2BE7D 1VCTA 5GAGI 1HI0P 2JL9A 2CJ9A 3M9NB 2BA9A 2F4VF 2XI2A 3DI6A 5A76A 3B78A 2BKOA 1RI7A 4K8RA 3C14B 4CLLA 1RBLA 4NEYA 3VQTA 4JV2A 1UPPA 4HACA 4YB6A 2EFOA 2HHXA 3CE8A 3OTCA 1WELA 3A3NB 2NS1B 4QIVA 5B0FA 3MDFA 5K14B 4DF4A 3Q0AA 1RGVA 2H4WB 2EBEA 4QWEA 3IN5A 4Y2MA 3CCSS 2HNZA 3M2UB 3BS9A 1DTQA 3T6BA 3QWPA 1FEHA 1TL1B 2R7XA 5KT5A 2YWGA 1B7YB 2MDAA 3LP0B 5GMEA 2YNFA 4W4MA 3GZ7A 3HKWA 1TL1A 3MCOA 3PW0A 1PGZA 1WORA 3MGJA 5E7OB 2WB1D 3W2WA 5IQQA 1K0VA 4MK7A 4DCPB 2Y8WA 2U1AA 2C2EA 5HQLA 4C4WA 4U6PA 1UETA 5D4PA 3HO1A 3HF5A 1KSPA 3IWNC 4OYAA 4K4WA 1ZOTA 1YK9A 3TUIC 4P72A 2P6SA 2YWWA 1JLAA 2HZCA 1IKYB 2GJ2A 5E5NA 3IG1A 3TAMB 1D8ZA 1K0TA 2P8IA 4UZBA 3X1LB 1IKYA 1LW2B 3TAPA 1KONA 2E5LJ 2D41A 2W8LA 1FJEB 2IA0A 2CQ2A 3TAMA 4X64F 2OMOA 2IAJA 2KN4A 1ULRA 2ZJRQ 3UR3C 4LF8F 2O66A 1KEKA 4OHYA 4PWDB 3PJWA 3GONA 2LMIA 2X7IA 5IQ6A 1Q79A 3W5YA 4AXJA 3T9NA 1MWQA 3CVKA 1P1TA 4ES3A 2F3JA 5A8RA 4OYXA 4O3QA 2EWHA 2FYXA 3GJRB 3AA8A 3ILOA 2LLZA 1IR1A 1JNZB 4UOFA 3OXFA 2R4FA 1RTHA 2JNJA 3PFOA 3D6TB 4YB5A 3CJ2A 1WG5A 3CMAS 3T3FA 2DHXA 5KFKA 3R5DA 4KGZB 4I69A 4CRJA 5KG2A 1BHNA 2CPZA 1Z2ZA 5E3QA 4YB7A 4DU8A 4I2PB 1DQAA 4U96A 2N82B 1XR7A 2G9OA 1RAOA 5KT3A 3QT6A 1HBUA 1FERA 4I2PA 1KOOA 2Y1JA 4LQ9A 3OSNA 1SXLA 2YQ3A 1SV5A 3CCLS 1YVFA 2F9DA 2B5JB 2JRSA 1HNXF 1VQ4S 4ECZA 3GYGA 5A8WB 4DLEA 1LNQA 2J8SA 2CPHA 2FB0A 2A18A 5AJ3J 2O1PA 2B5JA 5KFRA 1P9QC 4YDDB 1FKOB 2HNYB 1EARA 3QYYA 2HURA 3CUNA 4FBTA 1XMQF 4CLZA 2PMHA 2AGQA 1JK9B 3GG1A 3CJ3A 2GC8A 1FKOA 2HNYA 3MCMA 5F9NA 3FCVA 2LP4A 4FKXA 1R6VA 3TWZA 2DGVA 4O3RA 2G2ZA 2JFDA 2HK2A 5E3CA 2C2DA 3CW2C 2I2YA 2XMKA 3DDIA 4A8KA 3V2UC 1VHFA 1WG4A 2IBOA 4F7VA 3ENQA 2YNGA 3FCWA 2K3KA 3RYLA 4M5DA 2L3MA 3MMBB 4NCGB 2OJ3A 3K7RA 1T03B 2ADBA 2ZKUA 2IY5B 2ZNZA 4GVBB 5HROB 4QU6A 3D7SB 2DCLA 2DGTA 1S99A 2M3DA 1T03A 3LWMA 5L9XA 4K4YA 3SFGA 3CB4A 2ZH8A 3H5YA 3ELHA 2CQPA 3TJAA 1X31C 3UD3P 2CNKB 4DL7A 3NL0A 1IKWA 2OPPB 4ZIVA 2DD8S 2F4VJ 1FE0A 4WBFA 5F8GA 2P9CA 2BRLA 4PUOA 2N7YA 2ZDPA 1U8WA 4B9SA 1VK8A 2MJUA 4FF1A 3SV3A 5M2PA 3KOAA 1BQXA 3MM9B 3PR5B 1UL3A 2HGMA 4MIWA 5LJ5Y 2KO1A 2D3ZA 5D0EA 4QR1A 1OSCA 1UMJA 1XNRF 2DH7A 4CT8A 3IC1A 1ZAVA 5IM0B 5J2QA 2NXCA 4TU8A 2F8MA 4KGMA 1BQNB 2RDJA 3KWMA 1FI4A 3NOGA 1OS5A 1BQNA 2VG6A 3KK1B 2W4DA 2JVOA 3P49B 4R5PB 5L1IA 2UVUA 1NBEB 2DR6A 4CM0A 3MAQA 1TL5A 2R3VA 3IRXB 1NHUA 5KFIA 1EQ0A 3D0HE 3DDKA 3C3LA 2WRMA 3AD9C 4O4RA 2Z8QA 5JJBA 4KH1B 2QMWA 4GVLA 2CWKA 4FF3A 3Q86A 4K2JA 4X4UA 3PY8A 1LWFA 2RDDA 4ANEA 1UPMB 1KFSA 3KYLA 3L4BC 1VIOA 1X60A 4JI6F 1BY9A 4CLKA 2OP5A 4ZLNA 3KLHB 1LW0A 4L3KA 4X64J 1XK8A 4LF8J 1RWOB 4ETXA 2MZJA 2FZKB 2H3EB 4ECRA 5J1NA 5DETA 5IC6B 2CQ1A 4ANDA 5AT1B 1RLDA 3FBEA 2DT9A 1SCJB 5LMUF 1PAEX 2AGPA 1WNEA 3D9BA 4YDXA 4ZN1A 4E8UA 2CPFA 1SC4B 3PIOQ 3P5TL 1U0SA 3PJ9A 1QD1A 3QGHA 4ELUA 1M0SA 3QRQA 4USUA 4Y2IA 3ZC4A 4L3NA 1RKJA 1WEXA 2PDAA 1HYSA 2YTCA 4Y2CA 3L9ZA 1OYEA 1EP4A 2BEFA 4C8KA 4L75A 2QX0A 3KHLA 1F60B 4QYRA 1L3VA 5KG3A 5I3PA 4C2MA 3PYGA 5BYSA 1G6BA 5E0OA 1SKWA 4ECTA 2ZBQA 3IR5B 4O4GB 4CLTA 1S1XB 2XY5A 1V6HA 4EBDA 1DURA 2MZTA 3MUVP 3IM8A 1HNXJ 4CLUA 5KFXA 2ILZA 1XR6A 2IM1A 4IG3A 4DL0C 2DCUB 1TVRA 2HQGA 1HNIB 4EYIB 3MPVA 4ZOSA 4P7VA 2UXDF 3D3CJ 5F41A 3RB4A 2DGWA 2W9CB 1XMQJ 2MHNA 4C7QA 3FEXB 3TVZA 3JS9A 4J37A 2V63A 3EGNA 1ZBTA 2W9CA 2H48B 2HWTA 1QSLA 1UVIA 3IFEA 4DX8H 5I42B 3R7SB 5C25B 4WP9A 4QQBA 2K3IA 4JI5F 2PC6A 1X9SA 2YKPA 5F0UA 5C24B 1ZAWA 2F1FA 1UJ5A 3J81j 3MECB 1KHWA 5C25A 3V4IA 3D68A 2DO4A 3EJMA 4F2RA 5B0CA 3BM7A 3MECA 5KFMA 1NM2A 2V4JB 4JV0A 3NMAA 4BHQA 3RUBL 2E7WA 3Q8SB 2ILYA 3KJVA 4NLPA 3TI0A 3MR5A 2C28A 4AL5A 3D0GE 1IBMF 4O44A 3AODA 4FYDA 2FC8A 4EO6A 1U25A 5HLFB 3ZFVA 3EM1A 2FVPA 3CJRA 3CMQA 5K8PA 2UVWA 2HNDB 4JI8F 3EXCX 2AV5A 4LBPA 3WIUA 2V2QA 2E1CA 3OFEA 3HFZB 4DG1B 1NO8A 3WQPA 2AF6A 2PMWA 2BJEA 3WHIA 1NB7A 2J9DA 4B3OB 2QLJB 2UVVA 1FWKA 2XGPA 3FSYA 1M5PC 4OJHA 1HNZF 4NLQA 4NX9A 2ZFHA 2GO8A 1YJ7A 3N9UC 3CO0P 4C3MA 4RBTA 4IOCQ 1G2EA 2P9EA 1XNRJ 5LXYA 2VICA 1RWPB 4RU2A 5EN1A 1IR0A 1LWXA 2VQFF 5GAEU 1B99A 1TFWA 2YX7A 3T19A 3OBIA 2YWEA 4URGA 1XMOF 1TL3A 2Q6CA 3KDOA 2MKIA 2KU7A 3TZWA 3IA0A 4JI4F 2F65A 3BPDA 1EX8A 3W7BA 1T3OA 4FXWA 2RRAA 4C9DA 2XLIA 4TYBA 4U8YA 2RJZA 4HR2A 3H98A 3JXOA 3IWXA 1HBOA 3SXLA 3IS9A 2RB7A 2YKOA 1T05B 3V6JA 1GMWA 1NAQA 5HVHA 2VPWB 4KRWA 5KFOA 3JQMA 2DGUA 3KHRA 2FJAB 2HS0A 5A0YB 3UCUP 1S7HA 3OJUA 2HQ3A 1P27B 4ZP7A 2FUG9 2L41A 4DS4A 2MQNA 4WE1A 3M6XA 5F8JA 4I4BA 2QLBB 1N48A 5HVFA 2K7KA 4ZJQA 2J0QD 4LJMA 1X4CA 3QIDA 2CNLB 3M1VA 3THTA 5KFSA 2IDLA 3AA9A 2CZVC 3DLBA 2ZH4A 4G1QB 1ZA1B 4E98A 3W3SA 3CJ0A 3G2XA 3EZ5A 2OKQA 4TY8A 2D1CA 2W2NP 3MEGB 1WDDA 1JLGB 1ZM3A 5LMUJ 4TQRA 3I5BA 1UA0A 3I9ZA 4DQQA 1KOHA 1H2TZ 4ED0A 1CULA 4MKYA 4M5HA 1U45A 2J5AA 4ECUA 2VKZG 4KKOA 3OL8A 2F5GA 2DNMA 1SJQA 2IVFB 2I5JB 2DBBA 4B9NA 4ZVTB 1RWUA 4OQJA 2XLJA 1TV6A 4DL6A 3SCLE 3J81Y 1U6FA 4EMDA 4DX7A 1N36F 1VQYA 2QV6A 3QBCA 3NGTA 3AJ1A 3AH6A 2JVRA 3CJTA 1UEKA 4XPEA 1K1QA 2CQ3A 3LAKA 4J9OA 1CBKA 1OIAA 1KTVA 1RTZA 4YOEA 4F0HA 4QYZJ 2UXDJ 2UUCF 3OPKA 3QT7A 5EWGA 2BACA 4IRCA 3KK3B 2RAQA 1JQGA 3KK3A 4XAKA 3J7A1 2YBVA 1BQMB 3MUMP 5IT9Y 4JI5J 1V9OA 2OELA 3TX0A 1UVLA 1G3OA 4X2BA 3RB6A 2XCAA 1E6YB 1JJ2R 4ZLJA 1YBTA 2X3GA 2MKCA 4HI2A 3U7JA 2EI5A 4YB1P 1E6YA 2ZOMA 1F0XA 5HQ8A 1P1LA 4C97A 4UY85 3DNCA 4HHJA 2XSJB 3BN7A 2V0NA 5G0RA 5M2RA 4AD6A 5KOXA 4K4SA 4TQSA 3UI3A 2GS8A 1JIHA 1SH0A 4K59A 1SH3A 2CPIA 3TYTA 1KVKA 4NCAA 2EVZA 3I9V9 2XO6A 1UTAA 1IBMJ 3FFIB 2D9PA 4FS2A 3QMQA 5DZ6A 2DHHA 4O3SA 3KLGA 4DPXA 1TQLA 1FDBA 3CCES 4H4OB 1RKIA 1K8AT 4JI8J 2CQCA 3OTBA 5CXTA 1KN6A 2DJWA 3S01A 2E1AA 2DHSA 4QIFA 1RAGB 1HNZJ 2AJFE 4QPXA 2LQ5A 1S77D 1LQ9A 2LQJA 1OYDA 2Y3YA 3ZZRA 3CIZA 4LRDA 1R8HA 4DV0F 4OHVA 2FHOB 4OYPA 2ASYA 5ETLA 3GFZA 3GR1A 3NP5A 1KNZA 2OPQB 3JSBA 1FO1A 3MPDA 2VQFJ 1S6QB 3BH6B 1VQSA 3MMAB 1XMOJ 2L9NA 4EYHB 5CYQB 4Q7AA 1S7IA 4JI4J 2XSFA 4KH0B 1VQPS 2UUWA 2EFVA 3N79A 3MMAA 4DL3A 3PRDA 4WZMA 3AAWB 4ZHRA 2RU3A 2F63A 2ZH6A 1FHTA 1J5EF 2UVRA 2V8PA 3PTWA 2IBKA 1XERA 2CJQA 1LWEB 4U9RA 1UJ4A 3AJ2A 3E51A 2RUGA 3MMCB 3T41A 2KVIA 2WW8A 5CQGA 1LWEA 4OYMA 3THPA 2KYZA 1NSQA 4V19X 2AT1B 1PSDA 3KDNA 1HNWF 3W2VB 1PJ5A 1TMJA 1NPPA 3K5MA 3JAMU 1CJTA 2HIQA 2B4VA 2LEPA 3QPIA 1RAAB 2PA8D 1F5BA 1U1KA 1TK8A 5LT5A 4G3IA 3RR7A 4H4KC 2E1RA 3HVRA 4JYAF 4OZNA 2BUNA 4OX8A 3JSYA 2XZTB 4O3OA 4GKJF 3CDEA 2GHVC 3AHPA 4LBIA 4Z7CA 1IBKF 1GH8A 2L48A 5DLFA 4DQRA 2FVQA 1R8BA 2A2DA 4J9VA 3ENAA 2XTJP 2PFFB 4HHHA 4N8NA 4IOAQ 2HBZB 2JX2A 2FC9A 1SKSA 4B02A 5IC4B 1FEEA 2R7UA 4I7FB 4ZVHA 3Q83A 2R7WA 2FHJA 1F5AA 5HBMB 4LF2A 2YKMA 1AXQA 4U7CA 2FQQB 3BR9A 5LSLA 3KJFB 4X62F 5HQMA 4FF4A 2QFIA 1N36J 4KV8B 4RW8A 3CNQP 2GW8A 1FJCA 1FK9B 3BR8A 2V34A 4L76A 2HKEA 3NGKA 2CKWA 4OHWA 5JMNA 3VQSA 3I0SB 1U47A 3VAGA 2M70A 3C16A 4FKYA 1FK9A 5J1PA 4PPDA 4EU0A 2AJ1A 4OI4A 4CTAB 2UUCJ 4I68A 4DX5A 2F7VA 5F8LA 3M8ZA 4LUBA 1VJWA 2MQ8A 1U4BA 4MFBA 4ZPCA 4CTAA 1NNDA 1Y0HA 1QVGR 3CD0A 2GFFA 2ACMA 2E9TA 3R1LA 4MKVA 1QLNA 4A4JA 3F56A 5EGYA 4LR9A 4QW9A 3OUYA 2KVQE 2WVFA 3M9OB 3T1YF 5I3UB 5FLXY 3NCPA 2HYIB 4KGKA 3MTJA 3O44A 1UCNA 1CJKA 3J7YI 1FFWB 5AE3A 1T9WA 3L7UA 2HBRB 2IM3A 1AFJA 2C2MB 2PGCA 2MKYA 5CCLA 1X9MA 1S9EB 4UOGA 1HPZA 2B4UA 3VZIA 1FDAA 2FHJD 5FLXU 3AQPA 3F73A 2AKWB 1IKXA 2VUGA 2OPRB 1Q78A 1FVSA 4C3LA 1BWVA 4DR7F 2UZAA 3R5AA 2UUAF 4OJ3A 5F3TA 1N0UA 3I87A 2QMXA 1DLOB 4JI0F 5KFLA 4DPUA 2Z57B 2HWIA 3FBFA 2PD1A 4PYDA 1FXRA 5LSOA 4DR4F 5KG0A 4NYPA 1JJ4A 3UW1A 5KFQA 2U2FA 2YQ0A 2RQCA 2NLWA 1KFDA 3LA0A 1Y5NB 4FXDA 4MK8A 3BQ1A 4F4YA 2ATLA 2C1EB 1FRLA 4DV0J 1RQ0A 3GYNA 4BS2A 1N5VA 3ITHB 3G8QA 4JI2F 2XHCA 2VG7A 5I4MA 3KMQA 2QL7B 2GAGC 4IYQA 3BBBA 4LMZA 3T1AA 3I32A 1QDUB 1VQ6S 3W64A 3R5CA 4OX7A 1VRUB 3K89A 2YX4A 3EDQB 3FKBA 2RE1A 1F2GA 4KSEB 5KT6A 1J2VA 1VRUA 2B9EA 3MFIA 3KNGA 4I0WA 4NXMF 3HX9A 3M8PB 1WACA 2WVCA 1J5EJ 2JWNA 3MCSA 5KFAA 2M88A 1ZS6A 2LA4A 5KFCA 1V3RA 3A8KA 4NEZA 4QU7A 2MSTA 1J27A 4ER8A 3CDAA 5FD1A 3RBXA 1HNWJ 4IH5A 1WI6A 1S49A 5L8RC 3H0PA 2NXJA 4ZVGA 2V5HG 2NZCA 4DSLA 2CDQA 3HVAA 2ZC4A 4TY9A 3PYFA 3I5CA 4JYAJ 2CZ4A 1SUQB 4C0HA 2L08A 3C66A 2W01A 4DV6F 5KT7A 1WOOA 4GKJJ 2YKNB 1PYTA 1IBKJ 4IRDA 4CP5A 4JUZA 3OJSA 3FBCA 4JOUA 2OUGA 3ENWA 4X4VA 5H9FK 3PW5A 2ZZTA 4KT0C 2YVSA 5DM7Q 3SYZA 1LK5A 1TK0A 2E5JA 2BW7A 4NWBA 2DR7A 1H38A 4FF2A 1MN7A 5ETKA 4RJVA 1RAIB 1I5OB 2Z2YB 3OXGA 2RF2B 3IAS9 4Y6IA 4H4MA 1FKAF 1JLBB 2VHGA 1ZAXA 5DQGA 4DR5F 1RAHB 4M5JA 2BM1A 1XN9A 3OLBA 2V2KA 2WONA 1I94F 1ZYQA 2KT2A 1JLBA 2G0JA 2DRAA 2IHR1 4NZ0A 4X62J 5EX0A 1T9TA 4WU2A 2KM8B 1EETA 2PO4A 4J91A 4HHUA 5AXKA 3HHLB 2B9YA 3UN2A 4QYZK 4P7TA 1WOPA 1F2HA 2Z58B 4JI3F 4EEYA 1IJEB 4YR0A 3HHLA 3RAXA 2AJ0A 1WC1A 2CAJA 4WPAA 3R9LA 4XIUA 3EPGA 1FJGF 1S97A 1K44A 3QGIA 2FVSA 2PSZA 4DOZA 4OV6A 4FYYB 2Y1IA 5J1EB 1DBDA 2XY7A 2NUHA 5F3ZA 3NCRA 3CJKA 3HSJA 3BKUA 4ZLPA 4DLGA 2ABYA 2OTJS 1YJTA 3VAJA 2VV5A 2GHWA 3FZBA 4ILLA 2MLXA 2PA3A 1UZDA 2EG1A 1S48A 3MPWA 3UQSA 5HMYA 2VDHA 1AB8A 3DRRB 4OYWA 2WW4A 3QRRA 1W7WA 3AOAA 1VR6A 3T1YJ 1A7GE 3L7OA 4J5OA 3M2RA 3ZTRA 3SZ2A 3KNAA 3DRRA 5D6GA 3UVJA 4QPTA 3BGRA 2MZQA 2VBWA 4HEA9 4MIAA 5HP1B 2CJAA 1ICEB 2NCKL 2KFYA 2KYXA 1RT5B 2V67A 5T14A 1T7PA 4YP3A 2R7TA 1S1VA 5HP1A 2LXIA 1JLEB 2CFXA 3R27A 1L5UA 1S1UB 1EB0A 4DR7J 4Y0FA 2WVDA 2UUAJ 3QJJA 3RTVA 1JNRB 4JI0J 4FXVA 1HLWA 4DR4J 5KFNA 2OAUA 1L3SA 1PBAA 5KFHA 2BE9B 4M5LA 1PILA 5ITHA 4D3GA 4CM2A 3D54A 6FD1A 3O8WA 3VAKA 2QZ8A 2GQQA 5JVHQ 3ET6A 3JYTB 3T6JA 2W2OP 4PPZA 4RBVA 2V9WA 1G4CA 4LR7A 2OH2A 2W4CA 4NLOA 4ZLLA 2N3LA 2DHGA 4F02A 2Z2ZA 4JI2J 2ZHAA 1N32F 3MCNA 2BMBA 2K1RA 3LP2B 2BZ2A 2A6OA 4USMA 2EFNA 1I6JA 2DHAA 2WSCC 3N6MA 2OIHA 4JB8B 1RWVB 3MEDA 1SJ3P 4B9VA 3LGHA 1B0TA 5HL7Q 3PO4A 3EE3A 1VC5A 2WHOA 3HT3A 1HNVB 3PXGa 3LTOA 5C2CA 2B0GA 1VYAA 4NXMJ 2LCWA 4G6VB 1S0OA 2UXCF 2GGPA 4UY8T 1Z4UA 2JHEA 1PAUB 5DS7A 2DRBA 4AL7A 2VPYB 1N4LA 1SIZA 2N7CA 5CABA 1V5VA 1X4DA 2VJVA 2XQCA 4DF8A 4GRSA 2BJ3A 3O2IA 2ZNYA 2LXFA 4UF4A 2FHMA 4OI2A 2B4OA 1ZTWA 1X4GA 1URRA 5D4NA 2HFNA 3OD2A 2OPSA 1YQHA 2OFHX 3W62A 3QATA 1P9YA 5EWEA 4A47A 3TUPA 4DV6J 3MR2A 3KLEB 1TL7B 1H73A 1O6XA 1CQMA 1UWAA 2QA4G 3THVA 3E01B 3OT9A 3FVYA 1TL7A 2FVRA 4J90A 3MR6A 3H5UA 2MZ1A 3NLCA 1REVA 2DXDA 5L39A 1RTDB 4RW9A 3D1HA 1OY6A 1U02A 3AD7C 3BYPA 3VV2B 4W90B 2VASA 5KFYA 1R27B 2DNPA 3R6LB 3L95X 4DPYA 4DR5J 1RTIA 4CLWA 2UUBJ 3NG8A 4DFJA 1I94J 4DSJA 3H2LA 4ZPBA 5GMDA 1S6UA 1WKLA 2KRBA 4Y34A 2JFKA 1WTFA 2NUUG 1B3TA 2KZZA 1XIQA 2R7RA 2B43A 4KO0A 2W9BB 2P6TA 2FZGB 1FRMA 3IM9A 3TZXA 1UKUA 1Q7LB 3B8HA 2WCXA 4LRAA 1A6LA 2HHSA 3GMGA 5SZTA 4JI3J 3WX8A 2HHTA 3Q8RB 2AIRB 4IH6A 3MR7A 3MMJA 1FE4A 1FD2A 1FJGJ 5L38A 3T1HF 3CCUS 4KFBB 3Q2TC 2YKQA 2RQ4A 5KFEA 3MHYA 2LDIA 3D4JA 3FEYB 1FVQA 1S59A 1RT2A 3CDUA 4FYVB 2GHPA 3B82A 4C8NA 2XNQA 4LVNP 3N6NA 3FC9A 3MFHA 4ZPWR 4M94A 2P2CB 5IOLA 4JBCA 3TUJC 1ZM4A 2JLEA 4JI1F 2QJ3A 2BR0A 2VFTA 2LECA 2DXEA 1U6BA 1IWAA 1VBYA 4ID5A 5ETNA 4X66F 4O23A 4RW7B 3N5BA 5IZHA 3A3OB 1MU2A 3NNHA 2HAIA 1T9XA 4OJGA 1S9GB 4PG8A 1VQ8S 4EFAC 2DYAA 4RW7A 5DLGA 2AP6A 1OJ4A 4TYAA 4H54A 4ZP6A 1A9NB 1CJVB 3H5XA 3EGWB 1AUDA 2QN6B 1X5SA 5F9LA 3CPWR 4F3QA 3OTEA 3M8WA 4A8YA 1FRXA 1T95A 4FNHA 1XJWB 1KP6A 3KJQB 2Y0BB 1S6OA 3R2DJ 4ZVPB 5IS2A 2I38A 1EJ7L 4J7CA 3BGUA 3SQGA 9RUBA 1R0AB 1N32J 3AB2B 4DXLA 2BQRA 4FBUA 1NKBA 4O3NA 3DMJB 1NXIA 3PW7A 3JQJA 2W8KA 5A6WA 4ALZA 3DMJA 2CXEA 4G65A 4AUKA 2O3DA 8RUCA 3PYEA 3HKZD 1MMNA 2G0IA 1REGX 3NS6A 3EGZA 1VISA 3VGVA 4YY3F 2UXCJ 3MR3A 2XYGB 4RO0A 4DI6A 5B7WA 2CPYA 2YWFA 2E5HA 3M8QA 3VVTA 3D0IE 3UDLA 1PIEA 1URNA 2R7SA 1QE1A 2CQ4A 2BQUA 3CD5A 4WP3A 4TKTA 1TMMA 4A48A 2ROPA 4MJKA 3AXKA 4DR2F 2QRRA 3V4MA 4Z2XA 3V6KA 1HIYA 3OR2B 1IQZA 3MOJB 4URQU 4DCOB 5J2MA 3NWGA 1TFYA 2C3MA 3I0RA 3QIPA 3OR2A 1JLCA 3UE2A 1HARA 1S12A 3NAIA 3TP2A 1TAQA 4ZPAA 2HQDA 3NMRA 4NLTA 3SEOA 1JLFA 3KUGA 1YG0A 2CG4A 3MM7A 1S9FA 1FDNA 2RS2A 1DY3A 4IFYB 2ZC3A 4N77A 3CDWA 2YPZA 1BGXT 3OQ2A 3D6HB 3AQOA 4NLXA 3HXMA 4DQPA 4OHZA 3MM5B 2XWXA 2DTJA 3GIIA 3QLHB 2BQ3A 1N5YA 2JEGA 2GV1A 1UEVA 1Q5VA 1IQTA 3QZ7A 1X5OA 2O5DA 3TEGA 3J7AN 4S0MA 2XY6A 3MAHA 2GVZA 2FLNA 5KFDA 4USVA 1E6VB 1T9UA 4FPIA 1S5ZA 2LEAA 5MLCV 2AJ4A 2HZAA 1G1XA 1IR2A 3A8JA 2I6WA 1VFJA 1EIYB 1F5CA 4OX9F 3RRHA 4B3RF 2ZH1A 3OVBA 1W26A 5H9EJ 3MEKA 3V6HA 1MNEA 2ZJPQ 2GA7A 3OL7A 1UVMA 4F4KA 2W4PA 3DOKA 2HFOA 4NXNJ 3T1HJ 2LQBA 3MTKA 2CQ0A 4F2SA 1Q16B 1Q81T 3TQEA 2WOMA 2LQ9A 2HFSA 4N76A 1T0TV 2WK4A 4LSLB 3GCXP 2IYIA 3DRSB 2B6AA 2ZVSA 1TKDA 4QIEA 1JWWA 2NR0A 4J9PA 4NYOA 3VGUA 5D4LA 3UR0A 1HQUB 3DRSA 4KJIA 3JSMA 2DITA 3BDPA 4KB7A 1NSKL 4F0MA 4CIOA 3B54A 2IA6A 2XMVA 1ZPWX 3MD1A 4EO8A 3CCZA 3L09A 1NHKL 2HW3A 2IFXA 3DOMA 2XYPB 1X4BA 2VBYA 5HN0A 4JI1J 2WVEA 3PIPQ 3HPOA 2BM0A 4X66J 1M1HA 4B08A 1T11A 5A8KA 2DEIA 3HD2A 2APOA 2KXNB 3DGPA 4G1PA 4IFVA 1U7LA 4P52A 2DEJA 4ZDNA 4C8MA 1VQLS 4A8WA 3P8BB 1X9WA 1KHVA 5HATA 4Q0BA 1VBKA 2CA9A 1NJXA 4JV5F 1FNXH 3ZXWA 1X0PA 3MAAB 1GXUA 3IR6B 3NGUA 4CO1A 5M2UA 3VZHA 1UVJA 4WTOB 5MAOA 1I1GA 5DRKA 4CO4A 1IVZA 4DHVA 1F9HA 5CYMA 2AD9A 3UO0A 3MAAA 4W92B 2V8HA 4P9SA 4QIGA 3LUYA 3QT5A 1KDNA 2KFNA 3OL9A 1U0HB 3G8SA 5KT2A 1WDTA 2AMCB 3U27A 5K20B 1M5VC 1VGYA 3AJDA 3CCVS 2IC3A 1U0HA 4FDFA 1H3DA 2P9GA 1NK5A 3ZZZA 3QZ8A 3K58A 4O0IA 1SC6A 3MM8A 2DR8A 3QWUA 2CRLA 1F1BB 2J76E 2AYBA 3AXMA 4USWA 5T7LB 4OI0A 1WSRA 3VVUA 1GQEA 5F8MA 5L46A 1B70B 2XS5A 1NZ8A 4YY3J 3ZZTA 3Q8YA 3EX7B 1GK8A 5T7LA 1WUUA 5C2GA 7FDRA 1AFIA 3OR1B 2LFVA 2Y1LB 4DL4A 1TU0B 3S6EA 5L1LA 4DR2J 2HQFA 3FGVA 3I5AA 4ZVSB 4DR3F 2BJ7A 4Q5VA 1B0PA 2VFRA 2G4BA 3Q8PB 2X1GA 3W1YC 3KG0A 3R2CJ 3UFCX 3RBZA 5L1JA 3C14A 1HD0A 3LOUA 1FF2A 3DU5A 5DGAA 4M95A 4RNOA 1HQEB 2GCFA 2B7BB 1WTBA 3KTQA 3HZEA 3CJQA 3NNAA 2YQ1A 5K14A 2RKIB 3JB9k 4FVCA 1N5TA 5A6PA 4RUCA 2ZM6F 4WKRA 4ECYA 1MG7A 1CG2A 1NSPA 4O3PA 3M2UA 2VQEF 3RBEA 2CJXB 3ISND 1OO0B 1KC8T 3W5ZA 2RKIA 3JQKA 5J2NB 2VKRA 3D1QA 4M1KA 3LP0A 2HS4A 4IUFA 2K2PA 4X65F 1S0NA 2IMWP 3DOLB 5ETSA 4ZK7M 2AWZA 4IDKB 5IV3A 1F9FA 5D0GA 4PQUB 1NH8A 2OFGX 1EKSA 3LGMA 3ISZA 2VZ9A 1H6KX 2V4RA 1CC7A 3Q23A 3TANA 4IDKA 1QAJA 2V94A 4XDCA 2FLLA 1H7WA 5GAEI 3QJLA 2VB6A 4OIXA 2B8PA 4OX9J 2HS3A 5HMWA 1N6QB 3CT9A 3FUYA 2A0FB 4B17A 2X51A 5KFWA 4B9UA 1P8GA 3Q2SC 4B3RJ 3G82B 2MJNA 1BC6A 1NJZA 3QO9B 1JB0C 5HVGA 4OJ1A 1X4EA 3G82A 4J9KA 4LF1A 1SVDA 4DFKA 3ZO7A 2W2QP 2BANB 1VC6A 3KUHA 1WHYA 1LW2A 1B4SA 2J6TA 1R43A 3IXQA 1YJVA 2C3UA 3SV4A 2QMUB 3EMTA 3BZQA 3LWLA 4P71A 3DN9A 2EG2A 4PWDA 2G1DA 2Z30B 4ZIWA 4CO2A 4DEZA 4ED8A 1TKZB 4DV4F 3C8YA 4DV1F 4X4PA 1VQ7S 2CIMA 4DJBA 2FGOA 3C46A 3OXLA 4FP9A 2D69A 2B9XA 4PCQA 4OMFG 1SIWB 4MH8A 5GMKa 3MD3A 3S8SA 4RW6B 1X4FA 3A8IA 2JLGA 2AZ1A 2XMJA 1U48A 2VC1A 3DCAA 3G6ES 3M7VA 4ZITA 2HSEB 1Y3JA 4U95A 1PYOB 4DCJB 4JV5J 4X4QA 1YWXA 3PNIA 3PVXA 4V1Ak 4KPYA 4EGLA 5A8WA 5HJYA 1JKHB 2VDIA 3WZ0A 4UOHA 1UEUA 2BXJA 4RNHA 2YKAA 1BXNA 3RU0A 1IBCB 2VBZA 4OLPA 4NLGA 2ZHOA 2ACYA 4CLFA 1TL4A 3EICA 3V5RA 5GAHU 3W65A 2GMJA 2LVWA 4C8ZA 2RILA 1TUWA 1BD6A 1YDLA 2RSQA 1NSAA 4TU9A 1V3SA 4Y3CA 4RPFA 3PYDA 4XPCA 4RBUA 4ZVRB 2FTRA 3MMBA 4NCGA 1VQ9S 4Q2MA 4FS1A 3CWJA 4GVBA 5HROA 2KJVA 2RQKA 1NPRA 4I2QB 1N52B 2VG5B 4TLQA 3LQVA 4I2QA 1Y11A 3UN5A 3DC2A 3PG9A 5DQHA 1UW9A 2DY1A 2VG5A 4DR3J 3LO3A 1X5TA 4A46A 2OPPA 4QWDA 1C0UB 4CH0S 2QYCA 3WC0A 3KLIB 5ETRA 3H40A 2HK3A 5KFJA 4DN0A 1OPIA 3MM9A 3PDNA 3AOCA 4F67A 5B0GA 3HDSA 2GMLA 3PJXA 5E41A 2ATCB 2ZM6J 2BDPA 1RWWB 3KMSA 2VQEJ 1BWEA 1MROB 4QJVA 2MKHA 3CCRS 3WIVA 4OYIA 2W9AA 4CYUB 5F8IA 4OLOA 3OV7A 5J2PB 1RB0A 4C8OA 1NJYA 1NHVA 3MEEB 3CC7S 2AU0A 5DZ7A 3ILIA 4X65J 2Z0GA 1FT8A 4ZVUB 5IM0A 3HJFA 3R97A 1F3FA 1TUGB 2Z56B 1KR4A 2XHWA 1C1BB 2H51B 1SL0A 2YNIB 4QR2A 2Z2LA 2CQIA 4B3MJ 3KK1A 1YSJA 2MKKA 3A12A 1C1BA 4R5PA 2KT5A 3T5LA 1NK8A 4RR5A 2LU2A 3M6VA 1RU1A 3IRXA 3G6YA 5KFZA 4ECQA 5H9EK 3UCGA 4XK8C 3R7NB 3DLGB 2C2KB 2P5VA 4DUTA 5ADZA 1N56A 4WXOA 4DQSA 5FIIA 4DSFA 2QL9B 4WFXA 3UNYA 1LKZA 3BYRA 4ILMA 3DLLQ 4TN2A 5DDQC 1RT4B 3M2VB 3SDEB 5KG6A 2RIJA 4EBEA 2GAHC 3KLVA 1O51A 4J9QA 2CVEA 4EK2A 2KKHA 3KLHA 2NXEA 3BSCA 2R2SA 1MSWD 3DYAB 3DXBA 2HQIA 3Q8UA 2DK2A 3M6UA 5F0WA 1AZSB 2MKSA 3RGIA 3DYAA 1NPKA 2IM0A 2CG8A 5IT4A 4LF4J 4DV4J 3IGVA 5E3AA 4DV1J 2W7OA 4LRFA 2JZ5A 1T9YA 2AEMA 1QAIA 1XMBA 1GEHA 4ED3A 1WC3A 1WC5A 3TEHB 2QEXS 1NKCA 1D0EA 5DDRC 3IR7B 3NS7B 4OYZA 2JEIA 4HTJA 3CC4S 1RXOB 1YRXA 1HQ2A 1WHVA 2H5EA 4I67A 3VAHA 4DX6A 4OI1A 4WK3A 4ZN3A 3IP0A 2H54B 1VS3A 4OI3A 5SUHA 2M2BA 1Q8LA 2PFDA 5BJRA 4P73A 2F40A 3J80U 4DV2F 1NZAA 4MK9A 2X1BA 3EZUA 3HI9A 4O4GA 1FKPB 5IFMA 1S1XA 4UW2A 3G71S 5FDLB 1MN9A 1OSDA 4FPRA 4F8RA 1QUVA 3L7PA 1HNIA 3BKFA 3CCWA 1TTHB 3HHNB 3C6UB 1JLQB 1RYRA 1H0HB 5IT0A 4U7UK 3GJSB 2XNRA 1JLQA 2H4YB 2DNQA 1N5QA 4RUBA 3BGOP 1VI7A 2IJNA 5I42A 2HVHA 3GV5B 5C24A 1R8PA 1LWCB 4D3HA 4F0KA 3W8PA 1SL1A 3JTOA 3KK2B 1OPZA 1L3KA 3DFEA 3FK4A 2C2RA 2VODA 4R8UB 4I6WA 2V4JA 2ZH5A 1B0VA 3NOCA 1GAOA 3UNGC 3POTB 2FHKA 2HHPA 3NS5A 5K8MA 2J9EA 2V8GA 1KKHA 4ZPDA 5JXSA 2EFGA 3TA0A 5LM7E 3V6DB 3HLUA 5HLFA 1FNMA 1FJ7A 2W7PA 4UQGA 2XI3A 1DRZA 4CT9A 2HNDA 4R25A 2R2UA 4K4VA 3Q8VA 4Q8EA 3D67A 1NRKA 4DG1A 3S1TA 1RUSA 2ASLA 3CD7A 2V6AA 1YJ9S 4B3OA 4C98A 1NK6A 3BGLA 2ZZNA 1CEZA 3ETMA 1UFLA 1Q8KA 2YXLA 3TNVA 4FZVA 4CQ1A 4J9NA 4JP8A 1VBXA 4UUWA 3F0NA 1AW0A 4UQTA 1S1WB 3G6VA 2BJ1A 1RHRB 3Q89A 2FD2A 3EYZA 5EUHA 3C19A 3OHBA 3GIMA 1S1WA 2GVDB 3U1NA 2UU9F 2CYYA 2EK6A 2IVYA 5AE2A 3BB5A 4C0OC 2KFZA 1M5HA 3IWLA 4IKAA 2FLOA 5D0RA 3KLFB 5K9FA 2VOPA 3FNNA 4CLYA 3SSQA 2BE2B 3T5KA 1SKUB 2HVZA 4K7QA 2RRNA 2NXUA 1TKTB 1T05A 4LF7F 4YUDA 5B0DA 3UN3A 1FD8A 1DQ8A 4ZCIA 1NDCA 4ZCLA 3VAFA 5CH7B 1KLMB 2QL5B 2DGSA 5A0YA 2DGXA 2VPZB 3T5HA 4DN9A 2IVMA 3OW2R 1YJUA 2FJVA 2EW9A 3QGGA 1SJ4P 3QAEA 4H4KA 2J7WA 2GO9A 1S0MA 4BCAA 2VONA 4F3OA 1EAYC 1RHJB 4DV3J 4EBCA 2ROGA 2GQCA 3FMWA 3KFWX 3LAMA 3D28A 4G1QA 2H5IB 4NLWA 5IWAF 4RLEA 2QFJA 1QY7A 4DV5F 3MEGA 5LXRA 1WKJA 1JLGA 3CJ4A 1Q4RA 2ZUAA 1LK7A 1VBZA 3UD4P 2OSQA 2IIHA 1CSJA 4PEOA 1KVIA 2NXNA 2FVCA 4WJBA 2LA6A 2DGOA 1U6ZA 3JTNA 3D6FB 2R8JA 3ZZUA 3BF4A 1GMWD 1WC4A 2I5JA 1YHQS 1SI9A 3FQKA 4DU7A 3MI7X 1HHTP 3EGVA 3CO9A 2CJKA 3I96A 3LH2S 2R7OA 2E1PA 1QAYA 3OTOF 4DV2J 4ES2A 1K73T 1PJ6A 4DUZF 2NZ4A 5KTQA 1RTJB 4M5NA 2ZJQQ 1HL6A 1UWBB 3CIMA 2E7VA 2YNHB 4RNNA 3HVTB 2YWKA 1T9VA 5B09A 3C2PA 2GIQA 2V69A 1VLYA 2Q66A 1DFDA 4J9SA 1BQMA 5HMXA 1W25A 3R8YA 2Z4PA 2XBPA 2XO7A 3Q22A 2HHWA 3GIRA 2DIVA 4XO0A 3A8EA 3CTRA 3TAQA 2VF3A 4HACB 3RRKA 4ECSA 4HLBA 2XM3A 1QSSA 2YY3A 1D9FA 1AT1B 3N28A 2XSJA 2JEJA 5A2QU 2G2OA 2VH7A 1B64A 1GT8A 3H7HB 1RBAA 5LMNF 2JH3A 2B56A 1KTQA 1XEZA 1IM6A 2F9JA 4W98A 2HNZB 1DTQB 1M5KC 4GO7X 1B7FA 3P6YC 3FFIA 4RNMA 3NGSA 2J7UA 2KTQA 2YNFB 1ZTTA 1LEOA 1PC5A 4C6AA 4H4OA 4K4ZA 2NYHA 2HVIA 2D74B 1UZHA 4ED6A 2MPUA 1GXLA 2OO4A 3W2WB 2OEMA 3A4TA 1RT7B 4USTA 4RNFA 2QLXA 2R9LA 3W61A 3D6MB 3BGFA 3GG0A 1QAXA 4ERDA 1WKKA 1RT7A 1XTZA 4MT1A 1RHQB 3AY0A 1FDDA 1LXNA 1YLXA 1NK9A 1H98A 4NMXA 2QYGA 4AQYF 4ETZA 1BE4A 2J0SD 5F8HA 1JLAB 4WWSA 3IG1B 3MM6B 4USHA 1YTYA 2FJWA 3KG4A 5CD4A 2H5JB 2PEHA 2OPQA 3EVMA 3PZPA 2UU9J 1S6QA 2IJRA 1IWGA 4PXCA 3MM6A 4I64A 1RT1B 3MPYA 1FFGB 2IAJB 3RRGA 5CYQA 1FWLA 5CD4H 2DNLA 1U1PA 1SJ1A 4EZ9A 1RT1A 3BBFA 3HP6A 3MUTP 3PO5A 3JAMY 5D8HB 2QLFB 2UV8A 2CNNB 5A8RB 4LF7J 4ZJLA 4RUAA 1BLUA 3MMCA 2RU9A 1DJ0A 4WFYA 2O67A 1RTHB 4PZVA 4OZ3A 1NH7A 1NDKA 4TU7A 3GSIA 3W2VA 1HI8A 1RHMB 4GC6A 1TZ0A 4KGVB 2I1RA 4KAIA 2UV8G 2BJ8A 3QFHA 1ZETA 2J0XA 4PQAA 1HBUB 2HBQB 1Y7PA 4Y65A 2R8GA 2YH1A 2KZMA 1FFSB 2CDRB 2D7SA 3OLAA 3E8OA 1KQSR 1NUEA 1SV5B 2J0WA 3PRVA 3VR1A 5IWAJ 4J9UE 4DV5J 5K8OA 2PE8A 2M4MA 4KY3A 4Y2KA 2HIYA 5ETMA 2VIHA 2L9DA 3C15B 4OZ5A 2RT3A 1NCLA 2Y1RI 1XWLA 4B9LA 3C15A 1WHWA 3RG6A 2ZH9A 1T8EA 4J9MA 4ED4A 1H72C 4F26A 3VGTA 4YR3A 4I7FA 3WC2A 2XGQA 1UW4A 5HBMA 4KPCA 3IAM9 2IRYA 2LU1A 3W63A 4M5KA 4ZPVR 2WSFC 4GO5X 2E29A 3IGNA 3OTOJ 4P74A 3DKDA 4KV8A 3O3LA 3I31A 4X4OA 1X4AA 5C7PA 3ISNC 2YNGB 4M5IA 2J8AA 4DUZJ 3EUNA 3ONQA 4M5DB 4DUYF 1XQIA 1TUVA 2M52A 1UFWA 4DMZA 3B4MA 4PWUA 1KLNA 3I0SA 3L3CA 3P45B 4ZCMA 4PAAA 2D3O1 1SC1B 2HHQA 3U1MA 1ITPA 2C2NA 1GX6A 4FYXB 1RT6B 4MKAA 2KRRA 4YR2A 1S57A 1W2IA 1NK7A 4ZMMA 3M8YA 2VFVA 1H74A 2MY8A 4BWMA 2NSCA 3H5SA 3T5JA 3NRBA 1RT6A 2ZBRA 4OFZA 4E0DA 4DR6F 3HCXA 1IKWB 2FJDB 3R6GB 3CEDA 2X1AA 2IM2A 4PUOB 1XBWA 3BJYA 2RHQB 1U09A 1DZ5A 2ZH3A 4C8LA 2MXYA 1VK3A 5I3UA 2ZZMA 4IO9Q 4KC5A 3GFXA 3M9MB 1SKRA 5B0BA 3US5A 4PXEA 4RL1A 3ZTOA 2ALZA 5LMNJ 3TOQA 3BO3A 4NCBA 1S9EA 3FDSA 1N34F 2HHHF 2ZD1B 1VQKS 4M63A 2HAFA 4FYWB 2PI4A 1VQ5S 2EC0A 4A8QA 4CH7A 1CVJA 2GMHA 4RUHA 1VJQA 3EPIA 1HW8A 1S1TB 1BUXA 3ULHA 2OPRA 2ZD1A 2DXFA 4PG4A 2QC3A 5J2QB 3AOBA 1TELA 1RK8A 1S1TA 3HULA 1M5OC 2B9WA 4BWJA 3E3XA 1SL2A 3HT0A 1KQKA 2BVZA 1DLOA 1HFEL 4WIIA 4HH1A 4HH0A 2VG6B 2ZWPA 2IPOB 4CLPA 3UPFA 5GADU 3RR8A 1SQGA 4WK1A 4JV1A 3P96A 2XS7A 4Q8FA 1NKEA 4AQYJ 1Y5IB 4NL5A 4PWWA 3ITHA 3ADAC 1Q8IA 2DNKA 4CZCA 1LWFB 2CUYA 4UOCA 3FEZA 2IYGA 3D3BJ 4IRKA 4QOTA 4UUXA 4NOHA 1LW0B 1YZ6A 3A3PB 3PX4A 3K8VA 1RWXB 5DDOC 1FXDA 4WCEQ 1OQ6A 1ZZNA 4F25A 4OI6A 3FBBA 1UVKA 3W9JA 1IBLF 2ASJA 2BJ9A 3M8PA 3HHDA 4C11B 1YITS 4ED2A 4R0EA 1JJHA 1IM4A 3UDCA 5HI7A 3PCOB 2JEFA 4LF5F 4C11A 3EZOA 3CMES 2MQLA 2UXBF 1YKWA 3GIJA 1AYEA 4PXDA 3LANA 4LT6A 1IUJA 2C3YA 3GP9A 3W66A 1HYSB 3SCKE 3BEGB 3DRYA 1NLKL 4N7TA 4GC7A 4X4SA 2V68A 4RWWA 2DPIA 1EP4B 1KQFB 2CNOB 1C0TB 1SUQA 5U47A 3FRYA 4ED1A 1F9EB 2GQ2A 2KG0A 5B0EA 3BH7B 4LQ3A 2YKNA 3PW2A 1C0TA 2EKYA 2VPXB 2ERRA 3HHEA 1LOUA 1C4CA 1GFWB 4IG3B 5CYJA 1Y4ZB 1TVRB 1NU4A 4LSNB 3TA2A 2HLUA 3PM9A 1Q53A 4P2MA 3ENVA 3CSKA 3UDVA 4Z7YA 5THWA 4CWBA 2UUBF 1VMBA 4LSNA 2RF2A 4CNYA 3BQ2A 4ITSA 3E2EA 2AZ3A 2KDOA 4Y00A 2ZH7A 4ZA1A 3PFEA 3K5PA 3ZTSA 2MQQA 3UD5A 2QLWA 4C0BA 2O01C 3TZYA 3GFHA 2XLKA 2C22A 3KHGA 3N4WA 4G1IA 3V4IB 4LREA 4WTYA 2OTLS 2L9WA 4DPWA 2BBEA 4LSZB 1WG1A 3GFYA 4DUYJ 3N6LA 3D2WA 4RWXA 3R5BA 3CDBA 3O1LA 2QSFA 2HFZA 5GAGU 3KJVB 4BLGA 5KFBA 2EEYA 2ZBCA 4OZ1A 5H1SV 2RUSA 3NXZA 4PG7A 4O44B 3H2VE 4HI1A 4ECWA 1FTRA 5KFVA 1FA0A 4K0KF 2LXUA 2AJQA 2VU5A 3HFVA 5J1EA 2R42A 2GX8A 4PABA 1KD1T 3M6WA 4DR6J 1XR5A 2J9DE 4F4ZA 1RHKB 4LIWA 1NJWA 1R89A 4NLUA 2XMTA 4A8XA 2R8KA 1SJFA 1HHSA 2A2CA 3LF0A 3NBPB 4DZ6A 4DPOA 1R3NA 1GX5A 4QBUA 2WTFA 4DWIA 3S7RA 2VA2A 2HBYB 3NBPA 1D9DA 3DU6A 3UWTA 1RU2A 2V4QA 1N34J 2HHHJ 3I56S 2AYGA 2A10A 4OV1A 2HVDA 2JLFA 1RT5A 1U24A 1HR0F 2E9ZA 1D8YA 5BR8F 2HRUA 1JLEA 1XNQF 4ZJOA 1ZM9A 2I8EA 4N56A 1Y00A 2IJFA 2YWHA 1S1UA 3HHLD 4NLYA 4CLSA 5HANA 3CJ8A 3QAUA 2N3OA 1X5PA 1TL3B 3TJ9A 5IV4A 3GJQB 1RZMA 2N4CA 1TKXB 4A8MP 2QA1A 2CQDA 2C3PA 2RHSB 1HBOB 3IS9B 3PEHA 2RQMA 2BW2A 4WF9Q 1TKXA 7AT1B 3JYTA 3K59A 4K4TA 2X3DA 3M05A 4X4RA 4LRBA 3K8WA 5KFUA 4M5GA 1SC3B 5BYQA 2WVBA 1JMTA 3DLKB 2JSXA 2BRKA 3LP2A 4F4XA 2E7XA 2BKPA 4DFMA 5KFPA 3QJPA 5KAKA 4WE1B 2HFUA 2ZOGA 1C4AA 3HVWA 4MKBA 3DLKA 2UUTA 3D1OA 1RAJA 4JI6J 2DH8A 2C3OA 1FRKA 4URSA 3EVWA 4P10A 1R8CA 1HNVA 3GR0A 3M1VB 2QSWA 3LALA 3ILJA 1IBLJ 1WC6A 1SQEA 1RYSA 4TY8B 1DTTB 4CO5A 4LR8A 3GQCA 2ZHBA 1SH2A 4XTTA 4LF5J 1ZPVA 2FJXA 2OD4A 1CULB 1DTTA 1LV5A 5DO2A 2UXBJ 2Z2MA 2CVIA 1U1MA 4A8OA 3SSRA 4ZVFA 4DR1F 4KKOB 3IBFB 5B0AA 4ZVQB 3I4PA 1VRQC 5D77A 3QSYB 5H9FJ 1ZA2B 2VBXA 2CJBA 3R7BB 2C2ZB 1C1CB 4PRFA 1HBMB 1TV6B 1RISA 3TJ8A 1N8RT 1R0CB 4CCHA 3VAMA 4DFPA 4P6QA 3GV8B 3KLEA 2EC2A 1C1CA 1HBMA 3H20A 1Z2LA 1Y10A 3E01A 3OVSA 2CQGA 1U1NA 4F4WA 1GMVA 2DR9A 1DHMA 2RDIA 3I55S 1CC8A 2D9OA 2KXFA 1RTDA 2I0XA 2ADCA 1WF1A 2A6MA 3ZZOA 4MIBA 3K5NA 3J81U 3ZNUA 2PI5A 2QIFA 1Z1ZA 3ZTQA 3VTIA 4F50A 4C48A 1LFWA 2K7JA 3LGNA 4KHMA 1HI1A 4LFBF 4OL8A 5DG7A 2Y8YA 4HT7A 2ZH2A 2JOQA 1QUPA 3IBCB 4P2SA 2W9BA 1YBAA 8AT1B 4WFAQ 4DSIA 5E3RA 5G0RB 2LEBA 3RAMA 3PKYA 1U8SA 3OFGA 2R8IA 1RADB 4NXNF 5IT9U 4KYZA 5E3PA 2LQ8A 1T94A 1YIJS 3EDRB 1D3WA 3OL6A 2CJYB 3DM2B 3QRPA 4CI0B 5L1KA 2HGLA 1CPZA 3FRZA 4IR1A 2W7AA 4GKKF 1D9AA 4KFBA 4K0KJ 3BREA 2NREA 1D09B 3DM2A 3KLGB 5KFTA 4QCLA 2VL1A 2EFQA 3KUEA 4DL2A 3M30B 3GIKA 4V19J 3M30A 1NB2A 5GVQA 4F3MA 2CADA 4K2XA 2VJUA 2HMIB 2M7SA 2XZDB 4QR0A 3HK2A 1NMEB 4U67Q 4DQIA 5HSPA 4EUVA 2R2RA 4KIAA 3K2YA 4X4NA 3BSNA 4C3KA 4LIRA 2HMIA 2F8EX 2R7QA 4DV7F 2CPXA 3CXCR 2EFPA 1PC4A 1HR0J 3OFHA 1RT3B 5BR8J 1RA6A 1XNQJ 2W24A 5L9NA 1R8AA 1FRJA 1H2UX 4IR9A 2FZCB 1S9GA 3R3TA 2DNYA 3K17A 1RT3A 3TR5A 1D1UA 1WHXA 4HL9A 2D3UA 4OZ0A 1H7XA 2DNNA 4WIQA 2YH0A 1V3ZA 1CJVA 1RCXB 1YRTA 3AB4B 2ZVIA 1X0FA 1I3OB 2XULA 2V50A 4ZHRB 3EVOA 4XDDA 4IO1A 4OYBA 3HSDA 2ASDA 4L74A 3F41A 2DNOA 3HM9A 2AYEA 4MYUA 1R0AA 3BSAA 2BOAA 3Q8QB 4WU3A 2AHOB 5BYRA 1S6PB 2DY9A 2FGCA 1CQNA 3O5TB 1CJTB 2QTWA 3HSGA 2HHUA 3RB3A 3TW0A 3SMZA 2OHDA 1RSCA 1S6PA 4K4UA 3UCZP 2X1FA 1EZZB 4UT4A 1JX4A 1S4EA 5GAHI 4X84A 2QA4S 3M32B 3TVKA 3R5GA 2J6UA 3ZZ0A 4BC9A 1RWMB 5CHCB 2XG8A 4ID8A 3G9CA 3AD8C 7FD1A 2FY1A 3M32A 1YI2S 5K8NA 3RAQA 1U1LA 5CA5A 2NQPA 3MOZA 2H65B 2HVEA 4WFBQ 4J9LA 1IKVB 4NYZA 3VALA 1PG5B 1KRPA 2W1BA 4BC7A 4DR1J 2HLTA 2HFVA 1IKVA 2IMOA 1BMQB 3FSIA 3D66A 5AXMA 2M0GB 3DDNA 3KJNB 2E66A 1RWKB 5D3GB 4FNIA 4USJC 2YKMB 1N33F 4ZVEA 1VOMA 1NDLA 3G96A 2HWHA 5ETTA 4QWBA 4IFYA 4RW8B 5D3GA 4AFFA 3U1LA 5IXUA 3TX8A 2ZITA 3KKFA 4IQMA 1RP5A 3C16B 4LVOP 2BKNA 3MM5A 1L3TA 3QLHA 4P2FA 4GMKA 2RMLA 2Y0SD 3RB0A 4MFBB 4YHHF 2OGUA 2I9SA 4QW8A 1JJCB 5KG7A 3QGPA 1RAFB 1E6VA 2GIFA 1WEYA 1CS4B 3HD1A 4WYLA 9ATCB 3BBCA 2DNRA 1IN0A 3CF5Q 3CULA 4LFBJ 2N4DA 3FQLA 3OUYB 2D3OR 4DZDA 1MMDA 2Q6BA 3FZ2A 1CS4A 1U26A 2ZKTA 3IBWA 1Q1KA 1UFKA 1F6TA 1OMSA 3V81B 2XEXA 1CJKB 3H25A 3BKTA 4ELTA 4USIA 1MWYA 1M90T 2AX1A 5BXIA 1HPZB 3DRPB 2KH9A 4RKUC 3V81A 2H1YA 4TXSA 1SBRA 4GKKJ 3TZZA 4CO3A 1IKXB 3P4UB 3NKYA 2MLYA 3DRPA 2MZSA 1RHUB 1DARA 4LBHA 2AEJA 1RA7A 5HMZA 4LSLA 6AT1B 1IXKA 1K1SA 2OD6A 1WF2A 4NASA 2XZWA 4B9TA 1PCAA 3BO2A 2WSEC 1HQUA 3VHQA 5KOWA 4WFNQ 4FVMA 2MY7A 3NGRA 3DHWC 3OSPA 2DKOB 2QA2A 3OFFA 2LYVA 4HDGA 1FRIA 3TVYA 4DV7J 3HJVA 2VA3A 1R6YA 1FX4A 4HYKA 2JJ4D 3GV7B 3SSSA 2VG7B 1I51B 4NMLA 4NZ6A 4YN3B 6FDRA 4EZ6A 2OEKA 4NLRA 4ATNA 3P3DA 1LXJA 2B51A 4NI2B 2YPYA 1L3UA 2M8DB 2RS8A 5JVGQ 1HWIA 1FTCA 4NI2A 4CO0A 2ZUGA 4WKYA 4C8YA 2MSSA 3K5OA 1O8BA 2WBRA 1JXEA 1TP7A 1UP1A 1T02A 3ZZPA 2VFUA 4N8OA 4FN5A 1TAUA 4PG6A 4BDPA 1GMUA 3LP1B 1FXLA 2LDYA 3GTYX 3RJMB 4ECXA 2HEKA 2CPJA 1APSA 1NK4A 2KT3A 4HT5A 1S79A 1FESA 2VFSA 3LP1A 1S0VA 3BQ0A 2ALYB 1SQFA 1YJRA 4PR6A 4OZJA 2AEFA 3TRGA 4TNOA 5D78A 2F4FA 1CLFA 1Q0NA 3R1HA 2NYIA 3FSXA 3G87A 1MLAA 1HA1A 5EWFA 1X7VA 5AXLA 2ZEJA 1VHIA 2AW0A 2PIIA 5E33A 5AE1A 2AYMA 2FPHX 1AUSL 4K5SA 1LFPA 3J7Z5 3OR1A 2PT0A 5B08A 4A8FA 2AQ4A 1WSVA 4YQWA 4ILRA 2ZE2B 3CD6S 5HO4A 4ELVA 2IRUA 1KWMA 2IDEA 2KL8A 4E2FB 1VQOS 3N01A 4H4MB 2ZE2A 2M9KA 4AXIA 2WONB 4YMEA 2FDNA 1QJHA 1SB6A 4NA2A 1N33J 3JSRA 3X3UA 3MZIA 3NAHA 1HQEA 4ZP8A 4ZP9A 1RDRA 1EETB 3CCQS 1M5SA 3B6BA 1EQMA 2OSRA 3PKMA 3WDOA 2MLZA 4AYBD 5FJ4A 2J9CA 4KR0B 2QE5A 3SQOP 5J2NA 3WBZA 3NWRA 1W2BR 3QSIA 4L72B 3CCMS 4UZCA 2G2YA 4YHHJ 3DLEB 4B3MF 3DOLA 4ES1A 4K4XA 4PQUA 3CJKB 5LJ3Y 4LFCF 1VQMS 4Q2LA 2HHVA 3LPEA 2W2MP 2HGNA 2RNEA 1UJ6A 3DLEA 3P5BP 4AL6A 4K50A 1S72S 2M8HA 4PYAA 5CAAA 4LF9F 1U2RA 2AX0A 5KG1A 3H4DA 1N6QA 4F4AA 1UAWA 3M2RB 5JUMA 4KTQA 4RZRA 1U1OA 2PEBA 2XMMA 3BN4A 3GILA 5EX3A 5KT4A 3QO9A 1Y5LB 3UVJB 2MYFA 4CDIA 3VF0B 3BGRB 4B3SF 3FMBA 4U8VA 3Q24A 3SCJE 1EHWA 2BANA 3QQCD 2DB1A 1S1VB 1HHQA 2DO0A 2V8DA 1ROFA 2JC0A 2FY8A 2KXHA 3QNWB 4ZPTR 2ZWOA 2KHDA 2WAQD 4LF4F 3CCJS 2UP1A 2DH9A 4EI2A 3GPAA 1RBOB 4LRCA 1M1KT 1SPBP 4PKDB 1TKZA 3ILLA 1OQ3A 1JXLA 4O0NA 1RACB 2MHEA 2HZVA 2HQCA 2A3JA 2BOPA 3OTDA 3FCHA 3GE9A 3ET6B 1Y9OA 2FJBB 4KGXB 1VIXA 3GLJA 3MWBA 2EBGA 1OY9A 4P75A 4NA1A 2AGOA 1Y3KA 1FWPA 4PG5A 2K1RB 4RW6A 1U1QA 4WXWA 2R8HA 4KHPF 3T9ZA 2Q79A 4NLSA 1OWXA 1YBUA 3MEDB 4MMOA 1S76D 4HTIA 4ED7A 2GJFA 3VGSA 3RBDA 3MXHP 4NZ7A 3DLHA 1YJNS 4QWAA 1JKHA 5KG5A 2GGPB 1XC9A 2G13A 4NA3A 3KG1A 1NJIT 1MW7A 3PW4A 1HW9A 1Q5YA 2NPIA 2GJIA 3SBMA 2K06A 5DGBA 2MB0B 1KQGB 2ZBIA 1PKUA 1R0BG 2GZOA 1PO6A 1AROP 1VQNS 1CJUB 1MWZA 3VCDA 2JDJA 1FCAA 1KVJA 1ACMB 2OPSB 3I82A 4QWCA 1CJUA 1H2VZ 2WBMA 3PHEA 3BV8A 1HWUA 1J5OB 4LFAF 4LF6F 2DNHA 1C2PA 3GWCA 3W8GA 4Q45A 3SIPB 2CPDA 4NPOA 1J5OA 1WC0A 2MTLA 4UTGA 4AT1B 1GXTA 3W9IA 3HHKA 3PR4A 2WZ1A 4ECVA 3U02A 1REVB 1YGYA 3GYXB 3PX0A 2IRXA 4RW9B 1NK0A 4IH7A 1N5SA 3R5JB 4N41A 2MZRA 1C0UA 4ENOA 1NEEA 1NDPA 1GTHA 3KLIA 5D4OA 3OVAA 2B3TB 4M8LA 4RX6A 1FNOA 2EKNA 3BDEA 4ANCA 2KI2A 1RTIB 2E44A 2FIUA 2MQOA 3GCWP 4CNZA 2Q3PA 3B4DA 2MQPA 4YEAA 2VOOA 5DM6Q 1R31A 4KO0B 2KG1A 3ETOA 2J6SA 3LPYA 4OZ2A 1AA1B 3TUZC 2HRTA 4KE5A 1MROA 1RLCL 4ZCKA 4B9MA 3TA1A 4CYUA 2KM8C 1ELOA 4HKQA 5J2PA 3HHLC 3MEEA 1VRTB 3NCQA 2BV3A 3G4SS 1PBUA 3M4XA 2DISA 2V2ZA 2NSBA 3VWSA 1U2CA 4LFCJ 1VRTA 2YNIA 3H8YA 4X4TA 1YJWS 3I4HX 1X4HA 4M5MA 1X8DA 2C2OB 3J7YU 1RT2B 1GNKA 3TQ1A 4Q43A 1YZ7A 4LF9J 2XCPA 2PN6A 4IOBA 2XWYA 3IRWP 3M8SA 1V5IB 1S4FA 4L73A 1KS2A 4P2XA 2E1MC 1WI8A 3DLGA 5LOQA 5KFFA 2F8HA 5RUBA 2BJDA 1SJRA 1S10A 4JI7F 3SCIE 3W60A 4B3SJ 4ICLB 5C5JA 2EPIA
chains in the Genus database with same CATH topology
1RT4A 4DL4A 4Z37A 3FFIB 2D9PA 3M2VA 3S6EA 3SDEA 5L1LA 4FS2A 3HZGA 3GIJA 4ID5B 3FGVA 3I5AA 4PXDA 3QMQA 4DR3F 3LANA 3RW6A 4LT6A 1IUJA 2C3YA 2COLA 3G86A 4Q5VA 3KLGA 1B0PA 2VFRA 4ICLA 4O3SA 1MU2B 4QIWD 3Q8PB 2G4BA 1HYSB 3SCKE 3BEGB 2JC1A 1TQLA 2X1GA 1FDBA 2DPJA 3DRYA 3CCES 1ZM2A 3KG0A 4DV3F 4GC7A 5I3QA 4H4OB 4X4SA 1RKIA 1MMLA 1K8AT 4RWWA 3UFCX 4B3TF 2CQCA 5L1JA 2DPIA 3OTBA 1EP4B 1HD0A 5CXTA 1KQFB 1KN6A 3LOUA 4R0JA 2DJWA 3TARA 1FF2A 1C0TB 3DU5A 1SUQA 2HG4A 2E1AA 3FRYA 5U47A 3S01A 4AE5A 2DHSA 5DGAA 4M95A 4ED1A 4QIFA 3VAIA 2PMZD 4OX6A 4RNOA 1WWHA 1HQEB 2GCFA 2GQ2A 1WEZA 2V9KA 2KG0A 2B7BB 1WTBA 5B0EA 4HDHA 3HFKA 3N5FA 3KTQA 3HZEA 4LQ3A 2FJEB 2AJFE 2YKNA 1ZH5A 4QPXA 3PW2A 1C0TA 2LQ5A 3NNAA 1K9MT 2EKYA 1S77D 2VPXB 5K14A 3K0JA 2ERRA 2RKIB 1LQ9A 3HHEA 1LOUA 3JB9k 1P6TA 1C4CA 4FVCA 2LQJA 1N5TA 5A6PA 4RUCA 4IG3B 3ZZRA 4I56A 3CIZA 5CYJA 2ZM6F 4WKRA 4ECYA 2BYCA 1R8HA 1CG2A 1Y4ZB 4O3PA 1TVRB 4DV0F 3M2UA 2VQEF 3RBEA 3ISND 4OHVA 1OO0B 1KC8T 1NU4A 4LSNB 3TO8A 3J80Y 2FHOB 3ZZYA 3TA2A 2RKIA 2ASYA 3G8TA 2HLUA 3NGDA 3PM9A 5J2NB 1Q53A 3ENVA 3CSKA 2VKRA 3D1QA 3GFZA 2XMWA 4M1KA 1Q8BA 5THWA 3GR1A 3SQGB 2MQMA 3NP5A 3LP0A 2HS4A 2UUBF 4IUFA 2K2PA 1VMBA 4X65F 4LSNA 2POKA 1S0NA 2OPQB 2RF2A 4CNYA 3BQ2A 3JSBA 3DOLB 4ITSA 2IMWP 1KNZA 4ZK7M 2A1BA 1FO1A 2AWZA 3E2EA 4BBYA 1S6QB 1RJJA 4IDKB 2KDOA 4Y00A 2ZH7A 1F9FA 3PRBA 4ZA1A 3BSOA 3PFEA 5G4DA 3K5PA 4PQUB 4KBIA 1NH8A 2OFGX 2MQQA 2QLWA 3LGMA 4C0BA 2O01C 3ISZA 2VZ9A 3GFHA 1VQSA 1H6KX 5CCMA 2V4RA 1CC7A 3MMAB 2XLKA 1HWJA 2L9NA 3Q23A 3HMJG 4EYHB 5CYQB 3TANA 4IDKA 1QAJA 1DAXA 2SXLA 2C22A 4Q7AA 2V94A 4XDCA 2FLLA 3KHGA 3N4WA 1H7WA 4G1IA 3V4IB 5GAEI 2B7CB 4WTYA 2XSFA 3QJLA 1VQPS 2OTLS 1FKPA 2L9WA 2UUWA 1YRUA 3PX6A 2VB6A 2EFVA 3N79A 3H2UB 3MMAA 4OIXA 4DSEA 3PRDA 4DL3A 4WZMA 3AAWB 4ZHRA 2BBEA 3EXYA 5FDLA 2RU3A 2HS3A 2ZH6A 1WG1A 3GFYA 5HMWA 1N6QB 3CT9A 4B17A 3N6LA 3D2WA 4RWXA 1FHTA 2X51A 3CDBA 3R5BA 5KFWA 1J5EF 2UVRA 3O1LA 2IBKA 1XERA 1WF0A 2CJQA 1LWEB 1P8GA 2QSFA 3Q2SC 4B9UA 2HFZA 4U9RA 1UJ4A 3AJ2A 4HVZA 3E51A 2MJNA 5GAGU 1U49A 2RUGA 3KJVB 3M8QB 3MMCB 3C6UA 1BC6A 1NJZA 3F44A 1QM9A 2KVIA 2WW8A 3QO9B 1QE1B 5KFBA 1JB0C 4CH1A 2ZBCA 4OZ1A 5H1SV 4OJ1A 5CQGA 5KG4A 4DSKA 1LWEA 1X4EA 3THPA 4PG7A 1Q86T 2KYZA 3DHXA 4O44B 4J9KA 3H2VE 4DFKA 4NLVA 4HI1A 4ECWA 4V19X 1PSDA 1FTRA 5KFVA 1FA0A 1HNWF 2LXUA 2BANB 3W2VB 1VC6A 4K0KF 2AJQA 1WD6A 1WHYA 5J1EA 2GX8A 4NRUA 1LW2A 4TLRA 1KD1T 3K5MA 2J6TA 3M6WA 4DBQA 2HIQA 1R43A 3IXQA 2B4VA 1XR5A 2LEPA 3QPIA 1TK5A 2PA8D 1F5BA 1U1KA 1YJVA 1TK8A 2C3UA 3BO4A 5LT5A 5J2MB 4G3IA 2J9DE 4F4ZA 3SV4A 2J7KA 5CZXA 3RR7A 2DIUA 2EK1A 4LIWA 1NJWA 1R89A 1LWCA 3I0RB 2E1RA 3QIPB 3BZQA 4H4KC 1Q82T 4NLUA 1JLCB 3LWLA 3HVRA 4JYAF 2XMTA 3DN9A 4A8XA 1G7CB 4OZNA 2EG2A 4PWDA 2BUNA 2G1DA 4OX8A 3JSYA 3RW7A 2ROEA 1JLFB 2R8KA 1SJFA 1HHSA 4CO2A 4O3OA 1N54B 3KK2A 4DEZA 3MM7B 2A2CA 2H9ZA 4ED8A 1TKZB 2CQBA 4R8UA 3A1YG 3D5MA 4DV4F 3C8YA 4DV1F 3PV8A 3CDEA 3ICLA 4GKJF 3LF0A 3NBPB 2GHVC 3AHPA 4NLDA 2CPEA 4KHRA 4X4PA 1HMVB 4DPOA 1R3NA 1VQ7S 1IBKF 1GX5A 2CIMA 3H59A 4QBUA 1GH8A 2WTFA 2L48A 5DLFA 4DJBA 2FGOA 3C46A 3POTA 4DWIA 2KJWA 3OXLA 4FP9A 3S7RA 4DQRA 2VA2A 3DRXA 2FVQA 1R8BA 2A2DA 2VD3A 3NBPA 3SI8A 1D9DA 1HD1A 3DU6A 3UWTA 2V4QA 2B9XA 1HMVA 2PFFB 3I56S 4PCQA 2AYGA 1HWKA 2A10A 4OV1A 4Q44A 2DR5A 2JLFA 4N8NA 4N5SA 1RT5A 1U24A 3K5LA 4IOAQ 4OMFG 1N5YB 1HR0F 3V6DA 1SIWB 4MH8A 2E9ZA 1D8YA 5BR8F 1HWLA 2JX2A 5GMKa 2HRUA 1JLEA 3MD3A 1XNQF 3S8SA 2RVJA 3DXSX 1ZM9A 2FC9A 3MURP 2I8EA 2LKZA 1SKSA 4N56A 4RW6B 1Y00A 2IJFA 2ZDOA 2YWHA 2B4PA 1S1UA 2Q43A 4PXBA 4B02A 1FEEA 1X4FA 2GIRA 2R7UA 4IQXA 4I7FB 2JLGA 3HHLD 1N88A 4ZVHA 2XMJA 4NLYA 4Y2AA 2R7WA 2FHJA 1F5AA 1U48A 2VC1A 3QAUA 3DCAA 3G6ES 5HBMB 2N3OA 4Y28C 1X5PA 1TL3B 2RRBA 2YKMA 4NRTA 5C42B 1AXQA 4U7CA 3BR9A 5LSLA 1R7IA 4X62F 1Y3JA 3CCTA 3M8RA 2N4CA 4MAKA 4FF4A 2XMUA 4KV8B 4RW8A 2HPUA 4X4QA 1YWXA 2K8GA 3PNIA 1TKXB 2GW8A 1FJCA 4A8MP 3PVXA 1FK9B 5C42A 4KPYA 2M5YA 2QA1A 3BR8A 2CQDA 2C3PA 1QSYA 2FLPA 4EGLA 5A8WA 1U1RA 1JKHB 1HBOB 4OHXA 3NGKA 2CKWA 3IS9B 4OHWA 3WZ0A 3PEHA 1ZZFA 1UEUA 2RQMA 3I0SB 2BW2A 3VQSA 3VAGA 2M70A 1U47A 4WF9Q 1TKXA 2XC9A 2BXJA 2WB4A 4RNHA 1FK9A 2YKAA 5J1PA 4PPDA 4EU0A 2W25A 2QT7A 2AJ1A 3JYTA 3K59A 4OI4A 4K4TA 3RU0A 4CTAB 3M05A 4I68A 4X4RA 3K8WA 2F7VA 2VBZA 5T41A 2DVIA 5GADI 2DNGA 5KFUA 5F8LA 4OLPA 5BYQA 4LUBA 1VJWA 1U4BA 4NLGA 3DOKB 4MFBA 3DLKB 1O0PA 1JMTA 2ZHOA 2ACYA 4ZPCA 1TL4A 2JSXA 2BRKA 4CTAA 3H4BA 1NNDA 3LP2A 4F4XA 1Y0HA 1QVGR 5EDWA 3PEJA 2E7XA 3CD0A 4DFMA 2GFFA 5KFPA 2E5LF 3V5RA 5KAKA 3QJPA 4WE1B 2E9TA 5AXNA 5GAHU 1Q7YT 3R1LA 2ZOGA 2GMJA 1C4AA 3HVWA 4MKBA 3DLKA 2UUTA 1QLNA 2WOMB 2LVWA 5KFGA 4A4JA 3F56A 4C8ZA 2RILA 3D1OA 1RAJA 1BD6A 5EGYA 2B6AB 2DH8A 4IG0B 2RSQA 4MTPA 4TU9A 2C3OA 4QW9A 2Q1LA 1FRKA 1V3SA 4URSA 4Y3CA 3OUYA 3KLFA 4XPCA 4RBUA 1R8CA 1HNVA 3M9OB 3GR0A 2QO3A 2FTRA 3M1VB 2QSWA 3LALA 2BE2A 5CZVA 3T1YF 5I3UB 2KHCA 2GNKA 5FLXY 3NCPA 3MMBA 2HYIB 4KGKA 1SQEA 2G0CA 4IG0A 3MTJA 4NCGA 3JSMB 1VQ9S 1TKTA 1RYSA 4Q2MA 2HRYA 4TY8B 3O44A 4FS1A 1DTTB 3CWJA 4CO5A 5DDPC 5HROA 2KJVA 1HBNB 2ZOFA 2RQKA 5LL6d 3KHHA 3I6PA 2UXBF 3J7YI 4I2QB 5AE3A 3GQCA 2ZHBA 1SH2A 2IM3A 1AFJA 2PGCA 5CCLA 1X9MA 1ZPVA 4L6V3 1N52B 2VG5B 3FJ2A 2FJXA 2OD4A 1KLMA 4QZVB 1S9EB 4TLQA 1HPZA 3LQVA 2B4UA 1DTTA 3VZIA 1FDAA 1LV5A 2FHJD 5DJBA 1HBNA 5DO2A 3J7ZT 1U2FA 2Z2MA 3AQPA 2CVIA 4I2QA 4EWTA 1U1MA 3DC2A 4A8OA 3CC2S 3F73A 3SSRA 1IKXA 4ZVFA 5DQHA 2VG5A 2R7VA 2VUGA 2OPRB 3LO3A 4DR1F 1Q78A 4KKOB 5A8KB 1O5JA 1TR0A 1FVSA 1X5TA 5B0AA 4A46A 2XB2D 2OPPA 3I4PA 4QWDA 1C0UB 3CGIA 4ZS6A 5D77A 3GSDA 4CH0S 5H9FJ 4C3LA 2VBXA 2QYCA 3WC0A 3KLIB 2CJBA 3RZAA 4IFVB 4I1TA 4DR7F 1DQ9A 2UZAA 3R5AA 2OLWA 3C6TB 2UUAF 4OJ3A 5F3TA 3H40A 1N0UA 3I87A 2BABA 1GTEA 2QMXA 3MF5A 5C5JA 1DLOB 5LSRA 4JI0F 5KFLA 2C42A 5KFJA 2HWIA 1C1CB 2MKJA 4Q0BB 4PRFA 1HBMB 1TV6B 2E5IA 4DN0A 1RISA 2KB2A 2PD1A 1N8RT 1OPIA 2R2TA 5F8NA 4CCHA 1FXRA 3C6TA 5LSOA 4DR4F 3GB0A 3MM9A 3VAMA 5KG0A 4NYPA 4DFPA 3OHAA 1QTMA 3NNCA 1JJ4A 4P6QA 3UW1A 3GV8B 5KFQA 3KLEA 2U2FA 4DL5A 3PDNA 1C1CA 2RQCA 4F67A 5B0GA 1HBMA 2NLWA 1KFDA 3H20A 3HDSA 4K5RA 1Y5NB 4FXDA 2GMLA 4MK8A 3BQ1A 4F4YA 2ATLA 1Z2LA 3E01A 4I6AA 3PJXA 5DG9A 3OVSA 1FRLA 5E41A 5AJ3F 2CQGA 5E2QA 4KQZA 2BDPA 4WYWA 1UVNA 3KMSA 2RH3A 1BWEA 1MROB 1RQ0A 1U1NA 4F4WA 3GYNA 4QJVA 5CYMB 3N0VA 4BS2A 2MKHA 3PACA 3CCRS 2DR9A 1N5VA 2W9AA 4J9RA 1T3NA 1DHMA 2RDIA 4YFUA 3I55S 1CC8A 3ITHB 2D9OA 2KXFA 1RTDA 3G8QA 2I0XA 5F8IA 3CJ5A 4OLOA 3OV7A 1N0VC 2CQHA 4JI2F 5J2PB 5DG8A 2ADCA 4C8OA 4WZQA 1NJYA 1NHVA 1WF1A 3ZZOA 3MEEB 3CC7S 4MIBA 2VG7A 5I4MA 4I6YA 2AU0A 1IJFB 5K5MA 3K5NA 5DQIA 2Z0GA 3KMQA 1FT8A 5IM0A 2PI5A 2QIFA 3HJFA 4DS5A 1Z1ZA 1VC0A 3VTIA 4IYQA 4LMZA 3LW5C 3T1AA 4F50A 3I32A 4OZLA 1KR4A 2XHWA 1LFWA 1VQ6S 2K7JA 1C1BB 2IC3B 3R5CA 3LGNA 1SL0A 4OX7A 4WFZA 2YNIB 4QR2A 2Z2LA 1VRUB 4ED5A 2CQIA 4MYTA 3O6QA 4KHMA 1HI1A 2E5GA 2YX4A 2DNZA 3K57A 1UA1A 4LFBF 2RE1A 4OL8A 1F2GA 3JTPA 3KK1A 1YSJA 2MKKA 5DG7A 1C1BA 3MM8B 2E9RX 4HT7A 4KSEB 1J2VA 5KT6A 2KT5A 4R5PA 3T5LA 1VRUA 4RW4B 1NK8A 2ZH2A 2JOQA 2MMYA 2LU2A 3M6VA 3MFIA 3KNGA 1FRHA 2XS2A 4A8SA 1QUPA 3SFUA 4P2SA 2W9BA 1YBAA 4N47A 2MGZB 3IRXA 4I0WA 4WFAQ 3G6YA 4NXMF 3HX9A 3M8PB 1WACA 4DSIA 5KFZA 1RTJA 2JWNA 5E3RA 5G0RB 4ECQA 2LEBA 4DDFA 3MCSA 2RD5C 3RAMA 3UCGA 3G6XA 4XK8C 3PKYA 4RW4A 5KFAA 1U8SA 3DLGB 2M88A 2P5VA 5ADZA 2LA4A 1N56A 4WXOA 3WX4A 4DQSA 1QVFR 3OFGA 5FIIA 1UWBA 2DGQA 2R8IA 5EHHA 4DSFA 2YNHA 4NXNF 2MGZA 4WFXA 3HVTA 5KFCA 1LKZA 1V3RA 2V8VA 2OMLA 2YX1A 5E3PA 4RU9A 1T94A 1YIJS 4ILMA 3DLLQ 4QU7A 2MSTA 1D3WA 3OL6A 4TN2A 3DM2B 4CI0B 5DDQC 5L1KA 1RT4B 2HGLA 1CPZA 3FRZA 4IR1A 2VC0A