4P2SA

Alanine scanning mutagenesis identifies an asparagine-arginine-lysine triad essential to assembly of the shell of the pdu microcompartment
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
b'EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative propanediol utilization protein PduA
publication title Alanine Scanning Mutagenesis Identifies an Asparagine-Arginine-Lysine Triad Essential to Assembly of the Shell of the Pdu Microcompartment.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar saintpaul str. sara26
molecule tags Biosynthetic protein
total genus 19
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p2sA00
3VCDA 3H8YA 3DNCA 4LIWA 4RBUA 2G13A 3MPYA 3BN4A 4RBTA 4PPDA 5L38A 3SSQA 3IA0A 4QIEA 4OX8A 4AXIA 3MPWA 4AXJA 2A1BA 3SSSA 2A18A 5DJBA 4P2SA 4DDFA 4P7TA 3CGIA 4OX7A 4QIVA 3PACA 2EWHA 4OX6A 4OLOA 3N79A 3NWGA 4QIFA 3NGKA 4QIGA 3DN9A 4RBVA 3I6PA 3I96A 4OLPA 4P7VA 3CIMA 2A10A 3SSRA
chains in the Genus database with same CATH superfamily
5CZVA 2DNPA 2VQFF 2BX6A 1Q0NA 4PZVA 2MPUA 2BBEA 4LJMA 2IBKA 1IWGA 2ZOMA 3HHKA 2ALZA 3M8QB 2JLGA 3CCES 5ETKA 2UUCJ 4F7VA 1TVRB 3D6FB 4WP9A 3VR1A 3LTOA 3MM6A 4P2XA 2YKPA 1YJ7A 2CPIA 2HGLA 2CQHA 1VQ9S 3CVKA 3C46A 3G8TA 4F3QA 4K50A 2L9DA 3CNQP 1MWYA 2HWHA 2CQPA 4B9VA 2V4RA 2LDYA 3O6QA 1U26A 1RWNB 4KGVB 3IBCB 1MU2B 3LALA 4WXWA 2BM0A 2V6AA 2R8JA 2KXFA 3MR5A 2PIIA 4BS2A 2DHSA 2DGWA 4CTAA 3AXMA 1FDBA 3BPDA 5H1SV 2BJDA 1V6HA 3PXGa 1KHWA 3A8JA 1RK8A 2VG5B 4RW4B 4C0HA 4YOEA 1S76D 4PXBA 1X0PA 1UETA 4DQIA 1SIWB 2UUCF 2BVZA 5L8RC 4A8XA 3HM9A 4DQPA 1IN0A 2ZC4A 3CPWR 4DWIA 4I6AA 2H65B 2GX8A 2QMUB 5DDQC 1Y5IB 2D41A 1N5TA 1S0OA 1VOMA 4QWDA 4U7UD 2EFVA 1X31C 1TKTB 4PWUA 2DGVA 1R6VA 1OSDA 3BF4A 2J0WA 1XQIA 2Z4PA 1FXLA 2I38A 3LH2S 3EPIA 2G9OA 2DO0A 2R2TA 1RE1B 3EXYA 2HHHJ 1NCLA 3CCZA 2BOPA 2IM1A 4DF4A 3QYYA 3FCWA 1RT6A 3M2UB 2YPZA 1RT7B 4I69A 3T41A 1TR0A 3GQCA 2JFDA 5E3AA 2HHWA 1S10A 1AB8A 3QWPA 4LT6A 2DNRA 2KB2A 4QU7A 2W4DA 2CA9A 3J80U 3OXGA 1H2UX 2QLXA 3VWSA 2XZWA 3I9ZA 1QDUB 1TL3A 4DPOA 2Z8QA 3M8PA 4H4KC 1ROFA 2NUUG 2QT7A 1B70B 2MZTA 2ASYA 3I32A 2W9CB 1K1QA 2KO1A 1T0TV 3OHAA 1ZM2A 2DRBA 2AD9A 4R5PB 2HHHF 3QSYB 3MAHA 2J9EA 2Z56B 3BBCA 3MXHP 4ZOSA 4LF6J 5H9FK 1TKZA 1NK5A 1SJFA 5J2QB 3C15A 2DR6A 5C2CA 3MMAB 3OSNA 1VK8A 3GJQB 5FDLB 3CD7A 1GAOA 1HYSA 1RABB 1R89A 2GGPB 5K14A 5KFAA 2XMAA 4B9SA 2LA4A 1NDKA 2AKWB 2JLFA 4UY85 3C14A 1Q86T 3B54A 4X64J 5KG5A 4WU2A 3POTB 3TA2A 3SZ2A 5CZXA 4HL9A 4EUVA 3PR5B 2OD4A 1SJ3P 3DOKA 2KRRA 4OHWA 5M2PA 1SBRA 4PPZA 4LF6F 1SH0A 3TR5A 4EZ6A 1EHWA 3RR8A 2CRLA 1B4SA 4F2RA 4AE5A 4V19J 3NGDA 2LFVA 2CFXA 4Q2MA 3DDNA 5FD1A 1WKKA 4YMEA 2D3O1 3TYTA 2OH2A 1QE1A 1JIHA 5J2PB 1FHTA 1EAYC 1R8CA 2GCFA 4X64F 5C25B 1X0FA 2IYGA 4KKOA 4Y00A 3QT6A 2KZMA 3FSXA 6FD1A 1LK5A 3UVJB 4LR9A 4DU8A 1LXJA 4MYTA 3VGTA 4NZ0A 2BZ2A 3D2WA 2OEJA 2M9KA 2DXDA 1RHMB 4C3KA 2OHDA 3ZTSA 3TOQA 3TVKA 3BN7A 3T5LA 2UVUA 2AZ1A 1VRTB 4U95A 2OELA 4Q7AA 3T6JA 4YUDA 4J9PA 2B43A 2CWXA 3S8SA 1RT3B 4WKRA 2EXUA 5KFVA 1KEKA 1DBDA 4WE1B 1XNQF 2BE7D 5J1NA 1P1LA 1VI7A 3ILJA 3CGIA 4LRFA 2X3DA 4CO2A 4QIFA 2VU5A 4V19X 4P71A 4L75A 3LOUA 3RBZA 2O67A 4OJGA 1JLAA 3WBZA 3QIDA 4NLTA 1UEKA 8ATCB 2KRBA 4UOHA 4F50A 1X4GA 2R2RA 4C2MA 3D1QA 2GZOA 2DJWA 4O3PA 3M9OB 1RAJA 4QJVA 1S4EA 2AQ4A 3P5TL 2EFGA 1JLFA 3IBFB 3CJ2A 4JI2J 2UV8G 1NZ8A 4OZ1A 2W25A 3EZ5A 3CMQA 4DMZA 3A8KA 2ILYA 1MROB 1OO0B 4B9UA 2C2EA 3N5FA 2AHOB 1J27A 3HVTB 3T9ZA 5LJ3Y 5J2MA 2VFTA 4FVCA 2CQCA 5KOXA 2CPDA 4QZVB 2DK2A 4WIIA 1L3UA 4KIAA 4G1QB 2VBYA 2ZH2A 1YJVA 3G96A 3BH7B 4PG7A 1Z1ZA 1NDPA 3M4XA 2YKNA 4J9KA 2DNMA 4MIWA 1R3NA 2CAJA 2MQOA 2ZD1B 3G6XA 4DLGA 4JI2F 1FEHA 3EVWA 3DYAB 1B7YB 4OQJA 5L1IA 2BV3A 3P49B 1T94A 3CC2S 3T1YF 1U6BA 2HZCA 3HHLC 5C42B 3M8SA 2F7VA 1M5VC 2CWKA 1U1LA 4BHQA 3QO9B 4UY8T 3J7Z5 1UVLA 2DXFA 3R5BA 3ZTOA 5KT7A 1U0HA 5LMUJ 1CC7A 2R2SA 4ECUA 2KM8C 4A8OA 1X4CA 4R0EA 2JEGA 5HL7Q 2CNOB 1TK0A 2AT1B 2IA6A 3MHYA 3KK2A 2UV8A 3A13A 2N3OA 3Q86A 4S0MA 2QX0A 5KFHA 3MR2A 2DR5A 3V2UC 2DEIA 2ZE2A 2A6MA 1ZTTA 1AT1B 4LF8J 5LMUF 4WYLA 5DZ7A 4AFFA 2NR0A 2ZWOA 4JI6F 4MKBA 4NZ6A 1L3VA 3IR5B 4KB7A 3CCUS 3V6DA 5E41A 1FXRA 2I6WA 4L73A 3TI0A 1KN6A 1JKHA 2ZUGA 4AD6A 1EIYB 4KR0B 4ZLLA 3PW0A 3GR0A 1UEVA 2KHDA 4IO1A 1LV5A 1EP4B 4OJHA 4RX6A 1IM4A 4YR0A 4RZRA 1B0VA 3UD3P 4DL4A 3MCNA 1DTQA 2R8HA 4I4BA 4LF8F 2ZH3A 2V8PA 3C3LA 1LW2A 4CT8A 4DFKA 2I5JB 1FJEB 4X4OA 3CDWA 1CULB 5KT2A 3NOGA 3SDEB 1VQNS 2M88A 4WF9Q 1BY9A 1QY7A 3S1TA 3MM9B 1U47A 1VDHA 4B9TA 2D1CA 2G13A 2Q79A 2W9BA 1KBRA 1CEZA 4YQWA 3DOMA 3ZTRA 2ZVSA 2YX7A 1X5OA 4P2SA 2YNIB 2B9XA 2R7XA 1F2GA 2PT0A 4C8KA 2RDIA 3MOZA 2XWXA 1VK3A 4QPXA 1MW7A 1TU0B 2A6OA 4EK2A 1MN7A 3KHHA 2EK6A 4PAAA 2KG1A 3BS9A 4F0MA 3H2LA 2W01A 1JX4A 5EX0A 1FTRA 2XYPB 1VMBA 1URRA 1U0SA 1TFYA 4H4MA 3D67A 1PAEX 2UUTA 3KK3A 1RAIB 2R8KA 1N36J 2RQKA 1XJWB 3E3XA 3D66A 1NJYA 1M1KT 1HHTP 3WDOA 1N33J 4UOGA 3H25A 3PCOB 2HVDA 5E0OA 2AX0A 2V68A 3R8YA 5GVQA 2LU1A 3J7ZT 3E01A 2B3TB 1JLBB 4X66J 2GVZA 4TY8A 4XO0A 2W2NP 2RHQB 2H5JB 2VOOA 2XYGB 4OHYA 5IT9U 2XI2A 3LWLA 1VQPS 2VICA 5HP1A 2C2DA 3QRPA 2HWTA 3BR9A 2VF3A 2QLBB 3E8OA 1N36F 4JV0A 3FQLA 3TAMA 3KG1A 1C0UB 2PGCA 3FBBA 2HVHA 2BYCA 1N33F 2UU9J 2B6AB 2HQGA 3DMJB 2XMMA 4RW6B 3KDOA 1X9SA 3OJUA 3DLEA 4NLUA 2FUG9 3UD5A 4YR2A 2XY7A 2VG6A 4OZ3A 4X66F 3QGIA 3MI7X 1FKOA 4ZVGA 2UVRA 4A48A 5B0GA 1WC5A 2XHCA 1NKEA 1KDNA 1KFSA 4JI5J 1PJ7A 3IFEA 4N76A 4C8LA 2HNYB 2OJ3A 3NCQA 1U49A 4QOTA 2JRSA 3IM8A 5DS7A 1NH8A 3MR3A 1RT1A 1UZHA 3BREA 3PEHA 1DQ8A 2D3ZA 3GILA 1D8YA 2DRAA 5HO4A 1CJVA 3V81B 2IRUA 4C8YA 2FC8A 2G0JA 2J5AA 3CCQS 3WX4A 2UU9F 2IHR1 2D74B 3Q22A 3T5HA 5KFDA 1EJ7L 3QGHA 2M8HA 4DR3J 3M9MB 1TL5A 4Q0BA 1RTHA 1WTFA 1HA1A 2V69A 5KG7A 2DR9A 1JLQA 2VKRA 2QE5A 2XB2D 4J9QA 2YNFA 3W3SA 4WKYA 3FBCA 4DHVA 2K7KA 4JI5F 4FS2A 1U6ZA 5A8KB 2POKA 3KLFA 2YNHB 3M2RA 1VC5A 1Q81T 3R7NB 1N5YB 1B0TA 3IWLA 4HKQA 1SC1B 1SJRA 1TQLA 1WEYA 4FYVB 4CH1A 1YJRA 4KY3A 2AYEA 3DI6A 3GIMA 4PKDB 2M3DA 3N5BA 1TZ0A 4A4JA 1U48A 4DR3F 4HDGA 3U1NA 3I4PA 1QAJA 4IG0B 3N79A 2FHJA 4LF9F 3PJXA 5KFFA 2D7SA 2LQ9A 4HT7A 2L9WA 5ETOA 4PUOA 5GAEI 1SKSA 4Q8FA 4M5HA 1SPBP 2KT2A 2E9RX 2E1PA 1PIEA 4J91A 2IAJA 3NL0A 2VFRA 2RDJA 5T7LB 4M5DB 5A76A 4TLRA 2Z57B 5I42B 4P75A 1AUSL 4FYDA 3RBEA 4MT1A 2QZ8A 3VGSA 1ELOA 1LW0A 1KWMA 4GVBB 5CH7B 3ISNC 4ID8A 4NCAA 2DGTA 2MQ8A 5KFYA 1N5QA 3PRBA 2CQBA 5HMWA 2YKMA 4CI0B 3R3TA 1NEEA 1D09B 2IVFB 4NLRA 3L3CA 1PBAA 3W8PA 5KFLA 4J5OA 2KTQA 4WFAQ 2HK2A 4ZPBA 2ZZNA 1SH3A 2UZAA 3ZZYA 4MH8A 2HMIA 3VGUA 3HZGA 1MWQA 1X4BA 1FJGJ 4MJKA 1S12A 2RU9A 1GTEA 3VAGA 2K3KA 1ITPA 1RACB 3QGPA 3BO4A 3H5YA 2YKAA 3NCPA 4ENOA 1QTNB 3M6VA 5A8RB 1DAXA 4IH7A 4UUXA 1JB0C 4TY9A 4YB7A 3TVYA 2OSRA 3BN4A 1Q82T 1AZSB 3HVRA 1OS5A 3QQCD 2OEKA 3PX4A 1HBOA 3V4IB 3A12A 5IM0A 4RUCA 3PYGA 3ENQA 1VS3A 1U2CA 1FJGF 4R8UA 2MTLA 4CH0S 1UMJA 2GHVC 2ZH6A 2JC1A 3VAJA 4YHHJ 1BMQB 4NEZA 1TL4A 3AJ2A 2E5HA 5G0RA 4WTYA 3M8WA 4PEOA 2GQ2A 4LBPA 2YPYA 5CYMA 2FLOA 3DGPB 2KT3A 2DPJA 2FZGB 1U2FA 2DGQA 2HLTA 1D1UA 4OL8A 2NZ4A 2W9AA 4TYBA 1YIJS 2G1HA 1IBKJ 2FVQA 1G6BA 3PR4A 2MXYA 3B82A 4ZVFA 1FRMA 5D0GA 1D8ZA 3ETMA 4YB5A 3BYRA 3KLIA 4ICLB 3FVYA 2J8AA 1KLMA 1GXUA 3DRYA 3N28A 2QN6B 1GEHA 1RU2A 2DHAA 3AD8C 1QSLA 2CXEA 1APSA 4YHHF 2ATCB 2C2OB 3FEZA 2OAUA 1VC0A 4F4YA 3EMTA 3CJKA 4AYBD 1VHIA 3US5A 1JXVA 4ELVA 9ATCB 4O44A 2CZVC 4XDDA 2QTWA 1ZAWA 3C16A 2CJXB 1CJUA 5DQIA 2F8EX 3BQ0A 2NLWA 3MAAA 2Y3YA 2C28A 4FKYA 1S48A 2ZC3A 2V9KA 2YVSA 3HFVA 3BYPA 3FK4A 2WVEA 3I82A 2BKOA 3JB9k 4N56A 3HK2A 1JLEA 1N4LA 4EEYA 3OTDA 4J9MA 1LFWA 3A8EA 1OY8A 5LXRA 3BQ2A 2DHXA 1TL7B 3SQGA 2O66A 5IZHA 2BKPA 4OHZA 3LWMA 4P7VA 3MDFA 3OR1B 1E6VB 1HD1A 1KQGB 1J2VA 4DCJB 2K2PA 2BDPA 4MIBA 1FO1A 1M1HA 2R7VA 4ANCA 2GJIA 2WSFC 2IC3A 3PO5A 4OHVA 5DZ6A 4I1TA 3DLKA 1CSJA 3D1OA 3SXLA 2G4BA 2DY1A 4IFVB 5G4DA 1KVIA 4FYWB 3M1VB 4HH1A 2XMTA 3MFIA 2VKZG 3HMJG 2RNEA 2VG7B 4LSNA 2VV5A 2FJVA 1U1OA 1CLFA 2D9PA 1NPRA 2G2OA 2BANA 1GMUA 2HGNA 1CPZA 1RCOB 4DBQA 4PG6A 4DI6A 2GIFA 1N8RT 4NCGB 1NNDA 3K59A 2ZKUA 2AIRB 2MQQA 4IO9Q 5K8OA 2Y0SD 4XDCA 1R8BA 3IRXB 1NMEB 1FX4A 2J0QD 3W2WA 4FBTA 4RU9A 2LEBA 1H7XA 2C2NA 2K8GA 2XYHB 5DDPC 3AJ1A 2MQLA 1DLOB 2BR0A 1HFEL 4KFBB 3SMZA 3NGRA 2VJVA 1S6UA 4DF8A 4G3IA 4NEYA 3UN3A 1Q1KA 2XCPA 1KNZA 1VQ8S 1SIZA 1HBMA 4KE5A 1S5ZA 5K5MA 4RW8B 1BQMA 4IDKB 3H5UA 4K4SA 1EKRA 2ZITA 3J81Y 4KGMA 4DFPA 3D9BA 3LW5C 5A0YA 4F3OA 4B9NA 2QFJA 2MKKA 1XMBA 3AD9C 3SCLE 5JMNA 3P6YC 1FKPB 4ZVPB 3NGTA 2J8SA 3IM9A 2KFZA 1FJ7A 2V8GA 4TU7A 4QW9A 3R5AA 1F0XA 5B08A 3I0RA 5KFOA 4FF2A 2H48B 1KOOA 4YP3A 3PW7A 3HD1A 4KH0B 2GHPA 4WPAA 1IQZA 2BE9B 3L7OA 3ISND 1BQXA 1D0EA 4LFCJ 3MM7B 1CQMA 1UWBB 3R27A 3QT8A 5HK4A 4PPDA 2LQ8A 5GAGU 1RTIB 3SQOP 4NYZA 1FEEA 2GA7A 4LRCA 3B6BA 2HKEA 2FTRA 1RAOA 2AYMA 3U1MA 3VALA 3ETOA 1WELA 4F0KA 4EWTA 3UO0A 1TFWA 1X5SA 3WZ0A 1N56A 2HWIA 1EB0A 5KFSA 5F41A 2A1BA 2HHXA 1JMTA 3C6TB 4KT0C 2J9DA 1UFWA 2BQRA 2HHUA 4C3LA 1T9YA 3MCMA 1HQEA 1TUWA 2LYVA 5CA5A 2DHHA 2HS4A 3IGNA 1FE4A 3H7HB 2GAGC 4LFCF 1Q95G 2O5DA 4NZ7A 4HACB 1HLWA 1Q53A 5FLXY 3F0NA 4RW9B 4OI3A 4PG5A 2HS0A 4OI4A 5GAEU 4K4VA 5IWAJ 2XMVA 2Q3PA 3Q0AA 2RVJA 1VQMS 3UCZP 1VYAA 4TN2A 3MTJA 1N54B 2F3JA 2RE1A 4K4ZA 1LW2B 3FJ2A 2HVZA 4OYZA 4U7UK 5I3UA 5D78A 1S7HA 5HJYA 1HQUB 2DYAA 1W7WA 2XTJP 3M30B 1RHKB 1RTZA 1S1UB 1BXNA 1HWIA 1R0CB 1PGZA 1TMJA 2AYBA 5EUHA 3KJQB 5IWAF 4RWWA 1ZH5A 3I96A 2CG8A 2YNGB 1B3TA 1R8PA 1WACA 1T03A 2KXNB 1OYEA 3OUYA 4DUYJ 1KLNA 3HT0A 4YDDB 5BYQA 4K8RA 4ELUA 2XSJB 4OLOA 3M2VA 1RAHB 2I9SA 5IQQA 1QVGR 1NDCA 4LR7A 3H40A 2NPIA 1GMVA 5I3PA 4CNYA 1JQGA 2BJ1A 2CDQA 3FMBA 3NBPA 4Q8EA 2BMBA 2PMWA 1PBUA 2MGZB 4URSA 3M32A 2RQMA 3HFKA 4ANDA 1RTDB 3FNNA 2DNLA 3SFGA 1K1SA 5D3GB 2JHEA 1LK7A 1M1GA 4ZLPA 1YGYA 3EGWB 3R1HA 2YQ0A 2B9EA 3A4TA 4W98A 2G0IA 1U09A 3ET6A 4WU3A 4DUYF 4RNHA 1YWXA 3NRBA 2DNHA 3N6NA 1T9WA 4LIRA 4EYHB 1T9VA 2RKIA 4OIXA 1M0SA 2V63A 3GG0A 1S0VA 1RHUB 3NCRA 3OW2R 2B5JB 2IJFA 5LMNJ 4IRDA 2IY5B 3V6HA 2Z30B 2QLWA 3HJVA 2B4PA 2UVWA 1T05B 4GKKJ 3OFHA 1Y00A 4C97A 4EBDA 1RWWB 3MEGB 1WC4A 1KQKA 2DCUB 3PIOQ 5HROA 3KLHB 1MG7A 1GH8A 2R7UA 1MMNA 4NLPA 2OPRA 1U8WA 2FZKB 2J7KA 4OYBA 3T19A 2CQ0A 1XWLA 2GMLA 1Y7PA 3J7A1 2MHEA 2MKHA 2OPQB 2SXLA 3S01A 3KDNA 4JI1F 2Z2MA 1PC5A 1ZA2B 3KMQA 2QEXS 3W64A 3W9HA 5LMNF 4CLTA 3R6GB 4OZJA 2LDIA 2E5LJ 1YQHA 3J80Y 5ETSA 1QD1A 2OKQA 4GKKF 1JWWA 4UTGA 4WP3A 4RR5A 4H4OB 3GFXA 3CJ0A 2RT3A 4DR4J 2CZ4A 1WI8A 5D77A 1R0BG 3VCDA 2FHOB 3D54A 4P6QA 4F4ZA 3MUTP 2CNLB 1X60A 2NYHA 2F40A 1S6QB 5KFMA 4GRSA 3OPKA 3H20A 1NK9A 1C1CB 1HWUA 2QA4G 2KFYA 1NK4A 4KV8A 1YRTA 4TU8A 2ROPA 1CG2A 3HHDA 2HHTA 2DCLA 3IG1A 3GG1A 3HHLA 1KTVA 1AYEA 2HGMA 2HFNA 1HBNB 2ERRA 2KM8B 2E5LF 3KHLA 3W2VA 5IQ6A 2G1DA 2R4FA 4WFNQ 2E7VA 3MM5A 4DPTA 1UVNA 4DR4F 1IM6A 8AT1B 1N48A 5CCLA 1MMLA 3KLGA 1DY3A 5BYSA 2KDOA 3N9UC 4JI3J 3SEOA 3QIPB 1VJQA 2QLFB 3TA0A 1ZOTA 2CUYA 1SV5B 2R9LA 2HNDA 2DBBA 3P4UB 3KJVB 4M94A 3NMRA 1TAQA 1NB2A 4TVAB 4USIA 4CM0A 3CO9A 2R7WA 3SV3A 4ECVA 1DTTB 1WTBA 3BSAA 1S72S 2W4PA 3TQEA 2ZZMA 3MEKA 3ILLA 5LJ5Y 2RD5C 2A3JA 5K8MA 2BJ9A 3V6JA 2HEKA 1UW9A 3B4DA 3W9JA 4TYAA 4EMDA 3T3FA 3THVA 4B3OB 4A8KA 3MECA 2JFKA 1RU1A 4JI3F 4Y6IA 4ED3A 3KWMA 4IG3B 4FP9A 1WC0A 1RDRA 3GMGA 4NLWA 1NSAA 4TQSA 1XR7A 5J2NA 4LQ3A 1G3OA 2VB6A 1RBAA 3ZXWA 3BSNA 5T41A 2K1RB 2QO3A 3NS6A 3MMJA 2HS3A 1BHNA 3TUIC 4NLDA 2APOA 1DFDA 4WFYA 3DFEA 1Q8IA 3VF0B 1X9MA 2J76E 3I5BA 4HT5A 5KFQA 3P45B 3UDLA 3R2CJ 2LQ5A 3THPA 4XTTA 2FHMA 2JVRA 2W24A 1F5CA 4A8MP 4OJ3A 1S1TB 1NBEB 2E7XA 5HLFA 2W7OA 5HBMB 1H2TZ 2EFOA 1SC4B 1HMVB 5CD4A 3CT9A 5HI7A 5JVHQ 4IKAA 4WK1A 5HAOA 1GFWB 1SI9A 3I0SA 1A6LA 3KNGA 2COLA 3DXSX 4NLOA 5KAKA 2Q1LA 1NAQA 4I67A 3IS9A 1TL1B 2M8DB 3I55S 1HPZB 4IR9A 2LP4A 1JJ2R 3CDUA 3T9NA 3ITHA 4CNZA 1F1BB 1DARA 2MDAA 3NGUA 3C2PA 1TV6A 4WFZA 2MKIA 2KG0A 3WIVA 4PYAA 2PD1A 1B0PA 1J5EJ 2F9DA 4WFXA 3GB0A 4K4YA 2Q43A 4Y2AA 2KN4A 3W1YC 2RF2B 4G6VB 1SKUB 2MKJA 1WC6A 5KFZA 4ED2A 1IKVA 2HW3A 1CS4B 3GYGA 4UQGA 2WONB 1LWFA 3DC2A 4DPXA 3WQPA 2J0SD 1LWEA 4F4WA 2ZHOA 3RAMA 1JLCA 3CCJS 3LP1B 4QQBA 4IUFA 4HI2A 4FBUA 5CXTA 5K20B 1M5KC 1YHQS 4HEA9 3GLJA 1S1WA 2PI4A 1Y0HA 2VPZB 1J5EF 2OPSB 3PYEA 2BE2B 1LFPA 2OMOA 2QFIA 4K0KJ 4KGXB 2MLYA 3DRSB 1G2EA 3UNYA 1U6FA 1CJKB 4Y2MA 2VL1A 4Z7CA 1I3OB 3PV8A 4LSLB 4AL7A 3K0JA 3J7YU 1G4CA 4G1IA 3I4HX 2B4VA 2HNZA 4ZIWA 1CJTB 4HHUA 2H5EA 4ZVEA 2HPUA 3K7RA 3UN2A 2ZFHA 1NJIT 2Y9HA 2XULA 3Q8SB 2VFVA 3H4DA 1P27B 2E66A 2M70A 2GMHA 1NSPA 4IOAQ 2G0CA 2AWZA 5DO2A 3R2DJ 1UTAA 2NYIA 1J5OB 2XC9A 4OX7A 4HVZA 3QPIA 1RLCL 1RT2A 4PABA 3FSIA 4OZNA 4FVMA 4JI0J 3PO4A 2R7RA 1LWCB 3ELHA 3D7SB 4MFBB 1GXTA 3KLVA 3RZAA 4USVA 3BV8A 3JS9A 3QATA 4LUBA 1E6YA 2WBRA 2GFFA 2BACA 4PQUA 2MZRA 2Y8WA 1U1MA 3RW6A 1WF2A 1ULRA 3IO1A 3MMBB 3DRRB 4HTJA 3KK1A 3FGVA 1JLGB 3TX0A 4ECRA 5L9NA 1FVQA 4A8YA 3EZUA 4ZP9A 3OHBA 1PYOB 3CB4A 2KL8A 2KT5A 1XNRJ 4PWDA 4JI0F 2LCWA 1WDTA 4EU0A 1WG5A 1HNIB 3Q8VA 3D0HE 2KJWA 3BGOP 5HQLA 3BEGB 4E8UA 2ASDA 3TP2A 4HDHA 1S9FA 1X4FA 4DR5J 1REGX 3DOLB 2N7YA 1Q16B 3B78A 2XS2A 3O5TB 4OYMA 1QAIA 5K8PA 2A2CA 3HSGA 1NK0A 1F2HA 1F5BA 3MEDA 2W7PA 1FWPA 4M5KA 4M63A 1FK9A 3P8BB 3JQJA 1NUEA 4UZBA 2E1CA 1Q5VA 2RAQA 2KI2A 2GNKA 4N7TA 3DLGB 3V5RA 1XNRF 2CQ2A 1R0AB 4DR6J 3LAKA 5C24B 4NLQA 2Q6CA 1VQ6S 4DZ6A 1BQMB 1GT8A 4C11A 1FRIA 1F9FA 3KLEB 1LXNA 4DV2J 3KHRA 1YBUA 3QLHA 2RUSA 3TRGA 2V0NA 5IFMA 2OLWA 4P52A 2HVIA 5HVFA 1AROP 3RUBL 2PA3A 3AHPA 1HQ2A 1YBAA 3CJ3A 5E7OB 4DR5F 2OPPA 4ZIVA 4NLSA 2JX2A 2BRLA 2XM3A 3M6UA 4N8OA 3DN9A 1DRZA 3C6UB 1T9UA 1B7FA 2VA2A 1GXLA 2JNJA 1PKUA 1KC8T 2CIMA 1RTJA 2J6TA 3KG4A 2JZ5A 5AE2A 1WD6A 2DY9A 3CC4S 1UPMB 3OQ2A 2VONA 1QSSA 4KO0B 4DR6F 1YKWA 2XZTB 3DRPB 5EHHA 1FF2A 4QYZJ 4CYUB 3BSOA 3DCAA 4DV2F 2ATLA 2QA2A 4TNOA 4DV7F 5F9LA 1S59A 2V9WA 1UPPA 5DG7A 1FRHA 3N01A 4CWBA 1VBZA 1MSWD 3I9V9 1VISA 4NI2B 1IR0A 3K8VA 2C2RA 4ZVTB 1NK8A 3FKBA 1HWKA 3NMAA 4ZHRB 2HQCA 2IMOA 2PEHA 3EE3A 1ZBTA 3H4BA 4DX5A 1PG5B 3M8QA 1KVKA 3G82B 3JSYA 1S49A 3CJ5A 1TVRA 2C42A 4CLYA 3Q24A 1V5IB 3RAQA 4MMOA 4MKVA 3DLLQ 2FQQB 2ZH5A 3S7RA 2WW4A 4AXJA 2ZM6F 3QJPA 4ZCMA 2EBEA 2KJVA 2JLEA 4KC5A 1LKZA 4FYXB 3MPVA 2BA9A 3TQ1A 2CNNB 1RADB 4LRDA 2HRTA 5KFNA 3C66A 1C1BB 2JEIA 1WEZA 5KT4A 3MMCB 5C2GA 5C5JA 3BH6B 1MU2A 4AQYJ 2KFNA 5IV4A 2WCXA 1WF0A 3LP2B 3V6KA 3KFWX 1XBWA 1S1XB 3HSZA 4ID5B 1IKWB 3F56A 1X8DA 5F8MA 2I1RA 3AT1B 2VG5A 4RW4A 3LAMA 3BKUA 1Y3JA 4ZVUB 3HT3A 1HBUB 5EWEA 3MPDA 2DHGA 1Q78A 4RO0A 3SI8A 4WJBA 4YS2A 2GMJA 4QYZK 4I2QB 4ZCKA 3HXMA 4DL3A 4QIEA 2P6SA 4OZLA 4P74A 1FD2A 4EO6A 1XN9A 1SQGA 1TKTA 2OMLA 3LGHA 2QV6A 3J81j 3A3OB 5L9XA 4ED1A 2GO8A 2VC1A 3CIMA 2MYFA 3TAPA 3PDNA 1YX2A 4ZPAA 4OX9J 4B08A 3IMQJ 5DLFA 1RI7A 1XC9A 4ILMA 3QAEA 4QIVA 3SV4A 3M2UA 5DG9A 3QGGA 4OI1A 3EGZA 5GADI 3K5PA 1RT7A 5LSRA 3TO8A 3X3UA 1U1NA 2V34A 3G9CA 4DSLA 3PX0A 4NRTA 3EWGA 4K5SA 3GPAA 2W1BA 1OSCA 3KJFB 1O5JA 1H6KX 1FFSB 3GP9A 3RB0A 1RXOB 2P9EA 2M4MA 3MCOA 2MZQA 3T5JA 3M05A 4P2FA 4U7CA 3SSSA 1BQNB 4IFYB 2RSQA 3HVWA 2W9CA 3I6PA 4O4RA 4CLSA 2CJQA 1FE0A 1TK5A 5HATA 4RBUA 1V3RA 7AT1B 1RISA 2G2ZA 4R5PA 5DQHA 2ZWPA 2VD3A 3HVAA 3BJYA 3AOCA 4R25A 4ECQA 1KQFB 4O4GB 2GV1A 1SL1A 1QJHA 1HNVB 2Q66A 1NPPA 1M90T 5L1KA 5J2QA 1B99A 2CQ4A 4ZVRB 3MMAA 1NSQA 3GV7B 5FDLA 2GGPA 2ZUAA 1MWZA 3AFGA 3DRXA 1VQ5S 2VIHA 2EKNA 3BDEA 1FI4A 2RB7A 1GTHA 4Z37A 4USUA 3JYTB 3MM8B 3POTA 4ILLA 3RRHA 1N88A 4OLPA 5B0DA 1XIQA 3FRYA 2V67A 4LRBA 2F4VJ 4EYIB 1FFWB 2QA4S 1L5UA 4CLKA 1S9GB 5ETPA 1N0VC 1RCXB 3TZWA 1V5VA 3HO1A 2KYXA 5D6GA 1WOOA 2GQQA 4DL6A 3IXQA 3MEEB 3FRZA 2E7WA 1PO6A 3W62A 1YITS 2Y1LB 5IT0A 5J2PA 1YJNS 3HX9A 3PW5A 4FXWA 5CD4H 4KTQA 4Y65A 5C25A 2NXJA 1WHYA 2E44A 2BM1A 3UVJA 2FYXA 3OXFA 1D9DA 3AA8A 1RLDA 1U8SA 1OPIA 2F4VF 4USJC 3JSMB 1Q8BA 2NQPA 2JEFA 4F67A 4ZJQA 3LP0B 2BJ3A 4FDFA 1GMWA 3PW2A 1VRTA 4LIWA 3OR2B 4DL0C 5M2RA 2QSWA 3PJWA 1U1PA 1RT3A 2NZCA 3GV5B 2MLXA 2XNQA 4ZPWR 4DR2J 4MTPA 1TK8A 4WE1A 1U4BA 4DG1B 1RT4B 3H8YA 2H1YA 4KBIA 3ZC4A 4X4UA 4ER8A 4UOCA 3K57A 3HKZD 4I7FB 2C2KB 3M8YA 3PVXA 1VRUB 3OTEA 1IJFB 3NP5A 3KLGB 3EXCX 4NASA 2HFOA 1KRPA 1O51A 1M5SA 2ALYB 3W5ZA 2QSFA 4Y2CA 3BGRB 4ZPDA 2AGOA 1HNWJ 3VQTA 3P5BP 1XTZA 1Y4ZB 1FRKA 2C3UA 4I6WA 5D0HA 3JTPA 4JV1A 1WWHA 2H4YB 5AXMA 2HFVA 3H5XA 2IVYA 3QFHA 1MROA 2JSXA 2EC2A 3CW2C 1YVFA 2J7WA 2XWYA 3AB4B 4M5IA 1OQ6A 2WK4A 3EGVA 3QBCA 3D4JA 5E33A 3HVTA 3ONQA 4ZPTR 4LFBJ 2Z58B 3PIPQ 4AT1B 3G6ES 3M6WA 2QA1A 2LXUA 4PG4A 2IDEA 4G1QA 4X4PA 4PXCA 3OD2A 2VPWB 1WHVA 2GO9A 5IV3A 4EGLA 2EBGA 4O0IA 2FY8A 5J1EB 4J9UE 1RT5B 3EGNA 5H9EJ 1M5OC 2ZD1A 1HNWF 5FJ4A 3K5NA 2QYCA 2FLLA 2PN6A 1FRXA 1VQSA 2R7SA 4LSZB 3UR0A 5KFWA 3UI3A 4DUZJ 4F2SA 3DHXA 2LXIA 5FIIA 1S1VB 4YB6A 3EDQB 4X4QA 1QM9A 1LNQA 3DYAA 4C6AA 2QLJB 3CCVS 4UQTA 4CT9A 1VHFA 1UVJA 4RW7B 5GMEA 2F1FA 2XCAA 5C42A 1REVB 4ELTA 3CCRS 5KOWA 4LBIA 3QO9A 2RQ4A 5IOLA 2LQJA 4LFBF 1BLUA 1F6TA 1YSJA 4QPTA 3CMES 3ZFVA 3UD4P 4A8FA 4DCOB 1S9EB 4FN5A 3LANA 2B8QA 4J90A 2NUHA 4P72A 4USTA 2VPXB 2FZCB 3K8WA 2E29A 3PNIA 4O3OA 1V3ZA 2QL7B 2WW8A 4DUZF 2PE8A 4DJBA 3D6TB 5C7PA 1RWOB 4J9OA 2LKZA 4A47A 4RL1A 1NHKL 1S6PB 4KRWA 1FRJA 2VZ9A 2B56A 1ZS6A 5SZTA 3AJDA 3FFIB 1WNEA 1GK8A 2UXDJ 3DM2B 2OP5A 4J37A 3IN5A 3LGNA 5D4PA 2VQEJ 4LR8A 3VVUA 5KFGA 4MAKA 1T9TA 4EO8A 3EZOA 2YWWA 2YH1A 4K7QA 2PC6A 2RRBA 1N32J 1WC3A 2HHPA 1Z4UA 2KH9A 1ZYQA 2YQ1A 3KXDA 3A1YG 2Y1IA 2XY5A 1JNZB 2UUAJ 3W8GA 4ZLJA 2PMHA 4ALZA 3Q8RB 1EP4A 2WB1D 2ABYA 1XK8A 2GIRA 1UA0A 2JEJA 1YDLA 4DSFA 4K4XA 1EETB 1IKXB 2J0XA 3BKFA 3GJTB 2UXDF 5BR8J 2V4JB 1RA6A 1VGYA 1ZAXA 3CCTA 2LEPA 4G1PA 2ZZTA 1KTQA 1H38A 4P9SA 2O01C 2I5JA 2V50A 3ISZA 3NGKA 2VDHA 5ETNA 3MCSA 2VUGA 2DR8A 1CULA 3SDEA 4RNFA 3ADAC 1N32F 3PM9A 4BWJA 4F36A 2N4DA 1WORA 3MM9A 1NLKL 2AEJA 1ZPVA 2N7CA 2C3OA 3DKDA 1RWMB 2ZH7A 1IVZA 3HHEA 1U7LA 2HIYA 2J6UA 3ZTQA 2VBXA 2YNIA 2DO4A 1C0TB 3RRGA 5KFXA 4ZN1A 2Y8YA 3PRDA 2WSCC 3ENVA 3IRWP 2GC8A 4CCHA 4ZP6A 5BR8F 3LGMA 2MQNA 2DITA 2YWFA 2CPEA 5ADZA 3SSQA 3N6LA 1FERA 1VBYA 3L95X 3U02A 4USKA 5CYQB 1X4EA 1ZM4A 1TUVA 4GO5X 3ZNUA 2CPXA 3OTOJ 4NLXA 4OZ0A 5EGYA 2N4CA 3Q8UA 1IBLJ 1EKSA 3OV7A 4WCEQ 1KHVA 4LFAJ 1C4AA 4M5NA 5GADU 4NLYA 1Y5LB 1NK6A 1KS2A 3R7BB 4P7TA 3CD0A 2HRYA 1N6QB 1IKYB 1VQ7S 4X65J 1F9EB 2KXHA 1FRLA 1DHMA 1JLBA 2KHCA 2DGOA 5DGAA 5CAAA 3CD5A 2HG4A 4L6V3 1X7VA 4DPYA 2EWHA 3OTOF 4AL5A 3Q8YA 4W4MA 3UFCX 4QR2A 4Q44A 4ZVOB 5F8JA 1C0UA 2Q6BA 3EVOA 3GIRA 5E3PA 1F3FA 4MYUA 1WSRA 1M5PC 2B6AA 2NXCA 3U27A 6FDRA 4LFAF 1I51B 1HNXJ 4NA3A 3DMJA 4RW6A 1R7IA 2J9CA 3EX7B 3UDCA 4ED5A 1OJ4A 1OWXA 3RBDA 2AEFA 2V5HG 2YH0A 4I2PB 3RB6A 4I0WA 5L1JA 4X65F 2WHOA 4JV2A 3L7PA 4IOBA 2GVDB 3Q23A 5GMDA 2RS2A 4ILRA 3GIJA 1FNOA 4J9SA 1GX5A 4C48A 2CKWA 3Q83A 2NSCA 2IM2A 5KFTA 2Z2YB 2HNYA 1OQ3A 3GYNA 3VAIA 4I64A 2AW0A 4DL5A 2BKNA 1YK9A 4QWEA 2EFPA 2D69A 1R6YA 3V81A 4NA2A 1G7CB 3TAQA 2IMWP 1HNXF 1JK9B 3W61A 4KQZA 2V2ZA 2YQ3A 3IAM9 4R0JA 2XBPA 4C98A 2DVIA 4AUKA 2X1AA 3R9LA 3QJLA 4N41A 3DXBA 3HD2A 2VQFJ 4F0HA 2YTCA 1I1GA 2VC0A 3GIKA 4QU6A 2DNKA 2L41A 2WOMB 3ZTPA 2FGCA 3G87A 1Z2LA 4IYQA 4NMXA 2RH3A 5A8KA 4PYDA 3QT5A 2HYIB 4NWBA 2YNHA 1TTHB 3JAMU 2IDLA 1SUQB 1N5YA 4O3SA 3OLBA 1OY9A 2JJ4D 2RRAA 2ACMA 1IXKA 3O2IA 5ETRA 2LLZA 4F04B 4EI2A 2VOPA 1S99A 2PFFB 4Y2IA 5A6PA 1VCTA 3B8HA 1FDNA 1JJHA 2DRDA 1IR2A 4IG0A 5CYJA 1QUVA 5HQ8A 2B4OA 3BR8A 7FD1A 3MM6B 4MIAA 3MF5A 2EG1A 3TJ8A 1RWPB 1XERA 1WG4A 3IP0A 4CLUA 4DOZA 4KJIA 4OZ5A 2H3EB 3GWCA 5T7LA 4M5DA 5SUHA 1T8EA 2FHJD 1NJWA 5I42A 4J9RA 2QMWA 3HLUA 1T3OA 1UEUA 1Y5NB 2RMLA 5BYRA 5LM7E 4DR7J 2XLIA 5CCMA 4GVBA 4CTAB 2HFZA 2LVWA 4B3MJ 2W7AA 2ZBCA 3SIPB 2ZH1A 3HFZB 1L3TA 1W2IA 4LF1A 2AJ1A 2OFHX 3HSJA 2MY7A 2M0GB 4DUTA 4IH5A 4NRUA 1DJ0A 3G86A 5H9FJ 3ZZZA 4OI0A 3SYZA 2AU0A 2RS8A 3QNWB 4A8WA 1IBMJ 3H0PA 1FT8A 4B9LA 2V8HA 2M7SA 2UXCJ 5DJBA 2W2OP 3HSDA 1A0OB 1S57A 2YY3A 4OHXA 1X5TA 3I87A 1N5VA 4KYZA 4LF4J 4HHJA 2NSBA 3CCWA 5ITHA 3T6BA 4Q2LA 4DR7F 2AV5A 4B3MF 4OV6A 3PACA 2AP6A 4CO3A 2CPZA 4CIOA 1RT6B 3BSCA 3QRRA 2KU7A 3FZ2A 1OYDA 5A8RA 4G65A 3R5JB 3R97A 4NXMJ 1YZ6A 3K5LA 4L3KA 1HI8A 4NPOA 4O3RA 3CIZA 4E0DA 1AZSA 1IBMF 3QJJA 3OL9A 3QT7A 1TL3B 3M8PB 4NYPA 3V4IA 1JXEA 2UXCF 5F9NA 4NCBA 1RWXB 4BBYA 2FJEB 5EDWA 4B9MA 2PDAA 3GCWP 1NZAA 4U8YA 4LF4F 3OLAA 3TUZC 2LECA 2WAQD 2XMUA 3K5OA 3UNGC 3BPSP 2DNQA 4DCPB 1BUXA 4C8OA 3NEKA 2XS5A 4HR2A 1H2VZ 3G2XA 3D3CJ 4OX6A 2ADCA 1QLNA 4NX9A 5KT5A 3EYZA 2VPYB 4ECYA 1TKZB 2HBYB 2GHWA 4P73A 3UE2A 4NXMF 2HAIA 3QRQA 2RILA 3M8RA 3DGPA 1UZDA 1LEOA 3C15B 1NM2A 1TMMA 1U1RA 1HYSB 2D3UA 5K14B 2IIHA 3BKTA 2IM0A 3S6EA 4K4TA 4WFBQ 3GJRB 4YDXA 2M5YA 3FBEA 3EUNA 4MKAA 1C2PA 3C14B 2VA3A 2CJYB 3PTWA 3GSIA 4ICLA 1K9MT 3TZZA 1RWKB 4ETXA 2CPFA 2QG9B 2DXEA 3DLBA 3K89A 5HMYA 2BOAA 2DNYA 3DOKB 1SJ4P 4LBHA 2QRRA 1JJ4A 1FDDA 2E5JA 2MMYA 4OMFG 4QIGA 1VJWA 3OVBA 2CPYA 2GJ2A 2CQDA 1IBKF 4QWBA 3CULA 2XI3A 1N0UA 2ROEA 3GZ7A 1WKJA 4OYWA 3GCXP 1KKHA 1QE1B 3B4MA 5HVHA 4U67Q 2R7TA 4DN0A 4M1KA 3NAIA 1V9OA 2F4FA 2W4CA 4KKOB 4M5LA 4K2XA 1XNQJ 1WUUA 4NMLA 2MSSA 2ZKTA 1M5HA 1TL7A 1C4CA 4DX7A 3L9ZA 1FA0A 3THTA 2MJNA 2GIQA 4DLEA 2RRNA 4MK9A 4DSIA 3OR1A 1E6VA 4M5GA 2EPIA 2Z2ZA 4CDIA 2OUGA 3HULA 2EEYA 2YWKA 1B64A 4F25A 1AUDA 3PKYA 3G6YA 3MR7A 3IBWA 2LMIA 2DPIA 4FXDA 4Y34A 5KTQA 4JI7J 2B7BB 5E3QA 1OPZA 1S7IA 4IFVA 3M1VA 4XIUA 2K7JA 1TKXA 1UKUA 2I2YA 4ETZA 2EW9A 3MFHA 4J9VA 1JLAB 1HD0A 5D0EA 1NJXA 3OSPA 4DR1J 1RUSA 2VG7A 4WZQA 3PRVA 3NOCA 2HFSA 1EZZB 5EN1A 1U2RA 1JLFB 2NCKL 1VLYA 3RAXA 4NCGA 1NRKA 3BM7A 2NS1B 3MGJA 4OYXA 1WHWA 3D6HB 4OI6A 4JI7F 4YFUA 5B0AA 3A3NB 3X1LB 3IRXA 2HQFA 4N8NA 3W65A 2CDRB 3T1YJ 5DG8A 3CEDA 2MB0B 5J2MB 4J9NA 5AE3A 4LF5J 2V94A 1UFKA 1DLOA 4O3NA 4KFBA 4M5JA 3PX6A 1UA1A 3R5DA 4DR1F 3D28A 3Q8PB 3R7SB 2KVQE 4OYPA 2YKNB 3WX8A 4B3RJ 2HQ3A 5AE1A 1KVJA 2P5VA 5F8GA 1R27B 2XZDB 4RW8A 4F4XA 4IDKA 1EQ0A 4JI4J 4JUZA 3ZZPA 1UVMA 1NSKL 2ZHBA 3MTKA 2ZNZA 1U45A 2HBQB 5L38A 4KSEB 4DQSA 5EX3A 3RBXA 3OFFA 3RGIA 4F4AA 2UUWA 2W2QP 5HVGA 1D9FA 1U0HB 1Q7LB 4LF5F 1GX6A 1FKPA 4FYYB 4KHPJ 1UAWA 2BW2A 2ZBPA 4URGA 3MR6A 1N5SA 4CH7A 4U96A 2E9ZA 4LMZA 3CJ8A 2H9ZA 4JI6J 2DGUA 4B3RF 3NNAA 3KK2B 4YEAA 4ANEA 1FESA 4ECTA 3KTQA 4ES2A 4B3SJ 3FQKA 3MM7A 1UWBA 4IR1A 4JI4F 1I6JA 3AD7C 2CG4A 1NU4A 5L46A 1S4FA 3GU0A 4C4WA 5ETVA 1RTIA 3VVTA 4WTOB 3KKFA 5L39A 2W8KA 5AXKA 3TW0A 4QWAA 2YWGA 1BGXT 4N5SA 3CCMS 2ZE2B 3Q2TC 3KYLA 4ZKAA 4JYAJ 2ZBQA 4KHPF 4DV0J 5K9FA 1VBXA 3CDEA 3V6DB 2MEWA 3C6TA 1QVFR 3NG8A 2CPJA 3CO0P 2XLJA 1K0TA 1A7GE 1SXLA 4H4KA 4HH0A 6AT1B 1JKHB 3CCLS 3PYDA 3UDVA 2F9JA 3M8ZA 1Y11A 1Z2ZA 4B3SF 1X4DA 4HACA 4XAKA 2MKCA 4GKJJ 3QZ8A 2E1AA 4RW9A 4IOCQ 2MY8A 1DTQB 5B0FA 1WI6A 4JYAF 1RZMA 2R7QA 5M2UA 4EZ9A 3O8WA 2FB0A 2NXNA 4DV0F 3T1AA 3BBBA 3VQSA 1WHXA 3CSKA 3W7BA 1ACMB 2QL5B 2R2UA 1XEZA 1DURA 2IBOA 3OBIA 2HZAA 2A18A 3I56S 1HQUA 5EWGA 2W9BB 2PFDA 5RUBA 1NB7A 1HW9A 2C2MB 3DOMB 2BEFA 4K2JA 3M30A 3CD6S 4UOFA 1BD6A 1S1UA 3BGFA 4A8QA 4GKJF 3KOAA 3JQMA 4ZP8A 2BQUA 3HF5A 4IRKA 1X5PA 3O3LA 2IA0A 5A2QY 1WOPA 1H3DA 2EG2A 5LXYA 1JJCB 5GMKa 2H4WB 3OL8A 2YNGA 3W63A 2ZEJA 1FNMA 4KPCA 3FBFA 4WXOA 3BZQA 1I94J 3UCUP 4H4MB 2XSJA 3KK3B 1SJ1A 4ZA1A 1RAAB 3VV2B 5IXUA 1H72C 2AJQA 3HZEA 4WP8A 2IPOB 1VFJA 1T02A 2V4QA 4RBTA 4C0OC 1K8AT 5HMXA 1ZM3A 3PJ9A 3LF0A 2W2PP 4OFZA 2KKHA 4KGZB 5CABA 1RHQB 2MGZA 1V3SA 5HANA 1RTDA 2CNKB 2IRXA 3E01B 4CO4A 1KONA 2E5GA 2GVZB 5D3GA 1MN9A 4TY8B 2RDDA 4DS4A 1RAEB 5HJXA 4DZDA 3TZYA 4LVOP 2OEMA 4LF7J 2Z2LA 1I94F 3A8IA 5HP1B 4NYOA 2HRUA 5AJ3J 3FEXB 2VASA 3TAMB 3U1LA 3RB3A 2JL9A 4J9LA 3KJNB 4DS5A 2V8DA 2B5JA 3CDAA 5HSPA 1FXDA 4CLLA 4ZP7A 2MLZA 3Q8QB 1RQ0A 4WYWA 3TNVA 3HJFA 1T05A 5F8NA 4DPUA 2F8MA 3PZPA 2JH3A 1KR4A 3MEGA 3DLEB 8RUCA 1VR6A 2VG6B 3JXOA 2BJEA 5A8WA 1FKOB 4PQAA 3KLHA 4AL6A 1YLXA 3DLJA 2ZJQQ 2OFGX 2Y1RI 4LF7F 1OY6A 3IR6B 1VC6A 3UCGA 1YJWS 5AJ3F 1MNEA 1RT1B 4KH1B 2OPQA 4DV5J 1OMSA 1U1KA 3R1LA 3N0VA 3PFOA 2PA8D 1O8BA 2B0GA 4F8RA 1CJVB 1Y9OA 4QCLA 2MQMA 5IC4B 4RJVA 2LU2A 2ZDOA 4Q0BB 1RTHB 4ZN3A 3HI9A 1JLQB 4H4OA 3OFGA 1FX2A 2YNFB 2P8IA 4QWCA 4C8MA 1WDDA 4DU7A 2WB4A 3OL7A 4CLFA 5GAGI 4LF9J 1GNKA 2AGPA 3KLFB 3MD1A 1HW8A 1S6QA 5D4LA 3M2RB 1C1CA 4CO0A 5B0BA 4DV5F 3OFEA 1P8GA 3FSYA 1RP5A 3DI6B 5F0UA 4FNHA 3ZZTA 2LEAA 2X7IA 3UN5A 1WEXA 2WVBA 1HBNA 5MLCV 2RJZA 3JTOA 2H51B 2VODA 3KG0A 3BBFA 1RBLA 4DSJA 4BDPA 2CZ9A 2J7UA 2DR7A 3OTBA 5DM7Q 4WIQA 1UWAA 2JC0A 3EICA 2OIHA 4PWWA 4ZK7M 2V2VA 1Q4RA 1WC1A 2F65A 2RQCA 1D3WA 4PUOB 2QMXA 2X1FA 5MAOA 2V2KA 3HHLD 3QSIA 2WVDA 5L1LA 3QIPA 4LF2A 4GO7X 2FIUA 2ZH9A 1DZ5A 1SV5A 1FNXH 1HKAA 2ZBIA 3CWJA 2QYGA 3KJVA 4Z7YA 2QIFA 2IAJB 4NLVA 2FPHX 3LPYA 1DTTA 4Y3CA 9RUBA 2FC9A 4PXEA 2AJ0A 1RYSA 2GS8A 1LW0B 4K59A 2HVEA 2UP1A 3G71S 2UUBJ 3OT9A 2DH9A 2WTFA 3BO3A 1NKBA 3CJSA 2ZH4A 4Y28C 2PO4A 2FHKA 2YKMB 1WJ9A 3MAQA 4B3OA 1PSDA 2P6TA 2OO4A 1RGVA 3OVSA 1OIAA 3W66A 4IG3A 4W90B 3OTCA 5EWFA 2AMCB 2GAHC 4K4UA 3BGLA 3VHQA 1IQTA 1FWLA 2MJUA 3NS5A 2HMIB 1X9WA 4NA1A 2K1RA 4JBCA 4M5MA 4ECZA 4O0NA 3IGVA 4CLZA 1XMQJ 3SCIE 2UUBF 3PKMA 3DHWC 2FVSA 2P9CA 2CQGA 3AOAA 2R8IA 2OGUA 2HIQA 3K17A 1H73A 3RJMB 5LOQA 1S1TA 2YKQA 1VQ4S 1NHUA 2C3PA 5HBMA 2DNGA 1HMVA 1R8AA 4CLPA 1S0MA 3VAKA 2XY6A 4L74A 4IQXA 1HIYA 4CZCA 5I3QA 1VIXA 3W60A 3RR7A 1RB0A 2IYIA 1HBOB 2ASJA 3F44A 2HLUA 5IM0B 1SVDA 5HMZA 1SKRA 3M9NB 2XHWA 1IBCB 1CBKA 1U24A 1TL1A 3QMQA 1T3NA 1HPZA 1RAGB 1SQFA 2DIUA 2VHGA 4R8UB 1PYSB 3KUGA 1BWVA 3ULHA 3CCSS 3CJRA 2GQCA 2L9NA 1XMQF 1PCAA 5B7WA 3IA0A 4RWXA 5E3RA 4JV5J 5G0RB 2AF6A 3IWNC 1VRQC 1TKDA 2V2QA 5CYMB 5AXLA 3K5MA 4XK8C 2RF2A 2VDIA 5F8HA 3DLHA 1HWJA 5JXSA 3TARA 1CS4A 2DIVA 3TA1A 4Q43A 2WONA 3NY0A 3PFEA 3D68A 2CJ9A 1UJ4A 4RUBA 3I31A 3KLIB 3GSDA 2DNZA 1KLMB 1U1QA 3NXZA 1VQOS 3LP1A 3F41A 2WBMA 1HWLA 2DB1A 1GQEA 1QAYA 4JV5F 5B0CA 1UJ6A 3CJKB 1X4AA 4X4RA 1YRXA 5BXIA 4O44B 2OPSA 4HTIA 1SL2A 2BE2A 2ROGA 3QWUA 3C16B 3A3PB 2DT9A 2X51A 3DRSA 1CJUB 1ZAVA 1CJKA 4TXSA 3MAAB 3DU6A 3OJSA 1P1TA 4YN3B 2JWNA 2ASLA 2EFNA 4LSLA 4DPWA 1L3SA 2OTJS 5LL6d 3WHIA 1BWEA 3GFZA 1JLEB 1U02A 1HHSA 1CJTA 2VH7A 4V1Ak 3N4WA 1LWXA 3ZO7A 4KGKA 4TQRA 4ZLNA 5F8IA 1NJZA 5KG2A 1VBKA 3SQGB 4Z2XA 2IJNA 4K0KF 1UFLA 4UW2A 1RWUA 2WVFA 4X84A 3GONA 1Q8LA 4DSEA 1KD1T 1J5OA 2WSEC 3CJQA 1EARA 4UZCA 3R5CA 4RU2A 4CP5A 1FD8A 2C3YA 4UF4A 2A2DA 1HARA 4ZPVR 4BWMA 1H0HB 1LWCA 2G2YA 4FNIA 2IC3B 2FDNA 1K47A 1RHRB 4MFBA 3TWZA 1WKLA 5DDRC 3VTIA 4DV4J 3DLKB 2U1AA 3AA9A 4I68A 1RJJA 3NGSA 4RLEA 3C19A 5HQMA 2Z0GA 1P6TA 3PG9A 4ECSA 2DGXA 3K2YA 3CMAS 3G8QA 2NPFA 2RHSB 5DM6Q 5KFIA 1Y10A 4LSNB 4USHA 1EQMA 1TKXB 3MMBA 3DRRA 5KG1A 5KT3A 1SJQA 1Y3KA 1JLGA 2BANB 5GAHI 2FVPA 3VAMA 4MKYA 4M95A 2RIJA 4DXLA 4P10A 4WWSA 5LSLA 2DNOA 3QAUA 1RYRA 1H74A 1PILA 5KFRA 4NXNJ 1RWVB 4E2FB 1HNIA 4AXIA 4LVNP 2BJ7A 3JQKA 4DX8H 4DV4F 1ZETA 4C9DA 1JXLA 3U7JA 3W2WB 5AT1B 3J7AN 2CJKA 2FJBB 5T14A 3PY8A 2ZVIA 3DOLA 1K0VA 2ILZA 3CE8A 4I6YA 4ED4A 1I5OB 2ACYA 3PEJA 4ECXA 3VZHA 5D8HB 2B8PA 2HFUA 2XMKA 4YY3J 5LSOA 4QR0A 2DH8A 2K3IA 5KFKA 4RUAA 4JI8J 1HBMB 2FY1A 2X1GA 2OI2A 3MPWA 4C3MA 2YX4A 3DLGA 4B3TJ 2QL9B 1R0AA 3CJTA 2IRYA 2CVEA 2CPHA 5C24A 1UCNA 4NXNF 2P2CB 1HL6A 1VQYA 2IVMA 4ES1A 4PCQA 3KLEA 5CHCB 1SB6A 3HCXA 3ILIA 5A0YB 2F8HA 3FUYA 2PI5A 1XMOJ 4M8LA 3RW7A 3T5KA 2FLPA 5KFBA 3QFWA 3SBMA 1WSVA 1AW0A 3I0RB 2HHVA 3C6UA 1AA1B 2XSFA 4YY3F 1MMDA 2MSTA 4HHHA 2VFUA 4USMA 1SC3B 1NKCA 1O6XA 3H2VE 4JI8F 4KAIA 3L09A 1HI0P 1UL3A 3F73A 4F02A 4B3TF 4IRCA 1H7WA 2E1MC 4KO0A 3DRPA 1YJUA 1W2BR 4ITSA 1TP7A 4N77A 2C22A 2CVIA 4CYUA 4JP8A 2Y1JA 5A2QU 3BGUA 1IR1A 4X62J 3G8SA 4L72B 1ZZFA 4UUWA 3FCVA 2C3MA 1WOSA 1XMOF 1UJ5A 2XO6A 4BLGA 4DX6A 4A46A 3AAWB 4IQMA 2L48A 4EFAC 2GJFA 1N34J 1A9NB 5IC6B 3H5SA 4NI2A 1S79A 4CO1A 5KT6A 2MZ1A 2D9OA 2VFSA 4DDFA 1QTMA 1HQEB 1HI1A 4C8NA 4ZHRA 2HHQA 3MZIA 2UXBJ 3G82A 3P96A 4CQ1A 3CXCR 1NHVA 2ZJPQ 1HR0J 4FPIA 3TEGA 1JNRB 4GVLA 2LXFA 5DLGA 1P9QC 4X62F 4FPRA 4ZDNA 2F63A 2B4UA 3AXKA 2JDJA 4ZVSB 4ED0A 4QIWD 4HI1A 1YZ7A 2PEBA 4PR6A 4D3GA 4XPCA 2HAFA 1C1BA 4ZS6A 2R42A 3MMCA 2HBRB 1N34F 3MOJB 3LP2A 3KUEA 4C0BA 1XR5A 1S1XA 4ID5A 3J7YI 1G1XA 3OVAA 1VQKS 3UWTA 5I3UB 1IKWA 4GMKA 4HLBA 2J6SA 3CJ4A 4DL2A 1U25A 5F0WA 3JTNA 2UXBF 1ZA1B 5KFPA 2JOQA 4DQQA 5F3TA 1HBUA 5IS2A 1NPKA 2P9GA 3D5MA 1NDLA 2EI5A 1HR0F 1YG0A 2CADA 1H98A 1KOHA 1RA7A 2OTLS 4I2QA 5D0RA 2N82B 4OI2A 3JAMY 2JVOA 3V4MA 1KP6A 3GJSB 4ZVHA 4ZMMA 4AQYF 2FGOA 3RTVA 3W5YA 3TVZA 3MPUB 3FDSA 1PJ6A 1T7PA 2HZVA 3AODA 4DL7A 5ETMA 1T03B 3OUYB 1ZZNA 1AFJA 3RU0A 1SL0A 1FCAA 1YBTA 2XS7A 3M2VB 4ED8A 4RPFA 5E2QA 3DU5A 2MKSA 1IUJA 3AQOA 4NL5A 3JSRA 1Q7YT 2NXEA 2ZOFA 3RRKA 4X4TA 2ZHAA 3NBPB 4RNOA 1UVKA 5ETLA 3BB5A 2YKOA 4YR3A 3M32B 3NAHA 4OX9F 2J9DE 2K06A 2WVCA 2QGFB 2YWEA 2W2MP 1RAFB 2IFXA 4DFJA 2FJXA 5F3ZA 1BQNA 4IFYA 2KVIA 2HURA 3GYXB 2MHNA 1SCJB 1D9AA 3ET6B 4PXDA 3H59A 4RBVA 4ES3A 3O1LA 1QUPA 3MURP 3E51A 4MK7A 2B9WA 3M7VA 4O4GA 2U2FA 3NS7B 2XEXA 2RKIB 5F8LA 1HNVA 2C2ZB 3LPEA 4BCAA 1UP1A 2FJDB 4LREA 2A0FB 5D4NA 4B17A 1S6OA 2YX1A 1WF1A 2ZOGA 2FVCA 2O3DA 4JI1J 5KG4A 1QAXA 3LA0A 3D0IE 3D1HA 2O1PA 2CJBA 2YWHA 2CJAA 1FTCA 3NLCA 4ZVQB 5IT4A 2I0XA 3ICLA 5HROB 2FD2A 2AJ2A 3I5CA 1L3KA 1AFIA 3JYTA 3MM8A 1SKWA 2VJUA 5A8WB 2OPRB 3CF5Q 2E9TA 4ED6A 1LOUA 1WG1A 2XG8A 4WZMA 4FXVA 2FVRA 3PW4A 1RKIA 1CC8A 3GR1A 2E1RA 3CUNA 4JOUA 4F4KA 4KHMA 4PG8A 5JJBA 1IWAA 3GIIA 5DDOC 5HN0A 1FWKA 3GTYX 1S9GA 3EVMA 1ZTWA 2DNNA 3UR3C 2H5IB 5DGBA 4K5RA 1UVIA 3MEEA 4WBFA 1X4HA 4UT4A 4FF3A 5U47A 4ZJOA 4IH6A 4RUHA 2WZ1A 2EKYA 2R8GA 1RKJA 1R43A 2FJWA 4YB1P 5J1PA 5DETA 4ATNA 5ETQA 4GC7A 3R5GA 4Q45A 3KMSA 3NNCA 5BJRA 4X4VA 4QBUA 3LQVA 4DV6J 1SH2A 3GFYA 3UPFA 3OXLA 3BDPA 1Q5YA 4KV8B 3JSMA 2XMWA 3LP0A 3IG1B 3HHLB 4NE9C 3HPOA 3RG6A 3GV8B 3AH6A 3OR2A 1SQEA 3W2VB 2MQPA 3AB2B 2HQDA 4D3HA 2HQIA 3GFHA 3MM5B 3T1HJ 3DNCA 4FF1A 4OV1A 2AJ4A 4ERDA 3HHNB 2I8EA 2BW7A 4Y2KA 4ECWA 4DG1A 1RT4A 5KFEA 1YJTA 2C1EB 3G4SS 4I7FA 4JB8B 1VRUA 4DN9A 5D4OA 3NKYA 1GMWD 3TEHB 5LT5A 4X4SA 3GE9A 4DV6F 4NOHA 4TLQA 4Q5VA 1YTYA 1NO8A 4TU9A 2HNDB 3PHEA 4DFMA 3BGRA 3R6LB 4ED7A 5THWA 3RB4A 3EJMA 3MD3A 5AXNA 5K8NA 2XO7A 7FDRA 1BC6A 3IWXA 4DR2F 4USWA 5GAHU 2IJRA 1RSCA 1O0PA 3N6MA 3UDEA 1YRUA 3T1HF 5B0EA 2B7CB 2LA6A 4F26A 4EBCA 3QZ7A 2YXLA 1VIOA 2F5GA 3DDIA 3CDBA 1DQAA 2DD8S 3MECB 3I5AA 2DEJA 4QR1A 3WIUA 2ADBA 1CVJA 2RU3A 2XNRA 4RKUC 5J2NB 1Q79A 3G6VA 1S0NA 3AOBA 2EC0A 5J1EA 2KZZA 1RT5A 3BO2A 2HK3A 2M52A 3PHTA 1P9YA 2B51A 3LO3A 4ZITA 4XPEA 3ENWA 1S1VA 2UVVA 4PRFA 4O3QA 4RW7A 4LQ9A 1REVA 3AQPA 4C8ZA 3ZZUA 1W26A 1FVSA 4FS1A 4LRAA 3UW1A 2BJ8A 5ETTA 3D6MB 2L3MA 3MPYA 5HLFB 2WRMA 4CLWA 1F9HA 2XGQA 1T9XA 2BRKA 1S9EA 2XQCA 2H54B 4NLGA 2KYZA 2AYGA 2ZH8A 3I0SB 1KSPA 3MUVP 2W8LA 1T95A 3SCJE 3DGVA 3D0GE 2XLKA 3IS9B 4EBEA 2AJFE 5KG6A 4K4WA 1MLAA 3ITHB 2LQBA 4CM2A 1ZM9A 4KHRA 3HDSA 2CQ1A 4N47A 1S6PA 1TV6B 3FFIA 2XMJA 4O23A 2B9YA 1SC6A 3FEYB 1NK7A 2CYYA 4P2MA 4WK3A 3DM2A 4KPYA 3VGVA 4DEZA 3NWRA 2ZNYA 4X4NA 3IAS9 2ZJRQ 2E5IA 1IKVB 1FFGB 5H9EK 1FDAA 1F60B 1URNA 1K73T 3FZBA 1LWFB 2QJ3A 4Y0FA 5DRKA 1LQ9A 1LWEB 1VQLS 1JLCB 3TANA 5JVGQ 2X1BA 3KHGA 1YJ9S 1W25A 1ICEB 3BQ1A 2VBZA 4QYRA 4OJ1A 4FZVA 2VQEF 2FJAB 1IJEB 3K58A 1EETA 1S1WB 1IKXA 3VAHA 2AZ3A 2V4JA 1HNZJ 1F5AA 1KQSR 3M6XA 1K44A 2NXUA 2PSZA 2M2BA 4ZCIA 3ZZRA 2OD6A 3E2EA 2V8VA 3H90A 2L08A 4DSKA 1PAUB 2UUAF 2RUGA 1S97A 4L3NA 3NNHA 5KG0A 1HHQA 3TUPA 4TKTA 2HNZB 2N3LA 3PYFA 2X3GA 2IM3A 1TUGB 5E5NA 1C0TA 1AXQA 4HYKA 5A6WA 5KFCA 4ZPCA 3W9IA 5JUMA 5DQGA 1S77D 4U6PA 3SFUA 1BE4A 4OX8A 2EFQA 1RBOB 1HNZF 5KFUA 1N52B 4U8VA 4CRJA 2HBZB 3O44A 5CYQA 1RT2B 3ZNJ1 1R31A 2EK1A 3WC0A 3C8YA 3TJ9A 4BC7A 3J81U 4MK8A 1YI2S 2ZDPA 3HP6A 1DQ9A 4GC6A 3H98A 2AX1A 2A10A 3FCHA 3SCKE 3TZXA 4J7CA 4RNMA 3ENAA 2MZSA 1E6YB 2MZJA 4PQUB 5E3CA 4X2BA 2D3OR 3TUJC 2QC3A 3JSBA 2BXJA 3SSRA 3CTRA 4OYOA 3TJAA 3KK1B 3EDRB 1VLOA 1N6QA 1IKYA 4CO5A 3L7UA 3ZZ0A 4U9RA 4OYAA 3OL6A 3VZIA 2R3VA 1ZPWX 4OZ2A 3FMWA 2AGQA 3ILOA 2VBWA 3D3BJ 4PWDB 3ZZOA 3L4BC 1IBLF 2Y0BB 1T11A 3AY0A 1PJ5A 5KFJA 4BC9A 3H2UB 3EM1A 4FKXA 4DV1J 4L76A 4H54A 3EPGA 3TX8A 3P3DA 4C7QA 1XR6A 3MWBA 1UW4A 2MKYA 2DKOB 3Q2SC 3UQSA 3MEDB 4DQRA 2HSEB 3W5XA 1FK9B 5D15A 4I2PA 4F3MA 5CQGA 2DGSA 2GVDA 1PC4A 2R7OA 3IR7B 2EVZA 2DH7A 1KFDA 1CQNA 3DDKA 3IC1A 3VAFA 4C11B 1R8HA 2AEMA 2XGPA 2BQ3A 2NREA 5FLXU 4DV3J 3QLHB 5B09A 2CQIA 4DV1F 3MUMP 3FC9A 3KUHA 2OPPB 4DV7J 1Q8KA 1QSYA 1EX8A 4I56A 2DISA 3KNAA 1F3VA 4E98A 3RYLA 1TELA 1RTJB 2FLNA 4W92B 2YBVA 3LUYA 3Q89A 4B02A 1NXIA 4OYIA 2WOMA 4ZJLA 3WC2A 2BABA 5I4MA 3NWGA 4FF4A 4QW8A 1FKAF 2GW8A 4A8SA 1NH7A 2PMZD 4DV3F 2ZBRA 4RNNA 1TAUA 1SUQA 2CQ3A 5IT9Y 2OSQA 4URQU 2BUNA 2DTJA 5KG3A 1FJCA 1RHJB 2ZM6J 3CC7S 2HHSA 3HKWA 3H42A 1PYTA 4ZCLA
chains in the Genus database with same CATH topology
1DTTA 1KOOA 2DNPA 2ZD1A 4Y3CA 5CZVA 4YP3A 2VQFF 3PW7A 1HNWF 5FJ4A 3K5NA 2FC9A 4PXEA 2QYCA 2FLLA 2AJ0A 2MPUA 1RYSA 2PN6A 1FRXA 1VQSA 2R7SA 3UR0A 5KFWA 1LW0B 2BBEA 2GHPA 4K59A 3UI3A 4LJMA 2IBKA 4F2SA 1IQZA 2LXIA 3DHXA 5FIIA 2UP1A 1S1VB 4YB6A 4X4QA 1QM9A 3G71S 3L7OA 2ZOMA 3ISND 3DYAA 1BQXA 3HHKA 3CCVS 2DH9A 4UQTA 4CT9A 2ALZA 1VHFA 1D0EA 1UVJA 3MM7B 1CQMA 1UWBB 3M8QB 2JLGA 4RW7B 3R27A 2WTFA 2F1FA 3BO3A 2XCAA 1NKBA 2ZH4A 5C42A 3CCES 4Y28C 2PO4A 4PPDA 1REVB 4ELTA 2FHKA 5GAGU 3CCRS 5KOWA 1RTIB 2YKMB 1TVRB 4NYZA 3VR1A 1FEEA 2GA7A 3MAQA 3MM6A 4B3OA 3QO9A 2RQ4A 1PSDA 2YKPA 2LQJA 2CPIA 2P6TA 2FTRA 2HGLA 4LFBF 2AYMA 1BLUA 1YSJA 3U1MA 4QPTA 2CQHA 3VALA 2OO4A 1RGVA 3OVSA 1VQ9S 1OIAA 3CVKA 3CMES 4IG3A 3ZFVA 3C46A 3G8TA 3ETOA 3UD4P 1WELA 4F3QA 4A8FA 4W90B 3OTCA 1S9EB 2L9DA 4FN5A 5EWFA 4K50A 4EWTA 3LANA 1MWYA 4K4UA 2HWHA 1TFWA 2CQPA 4B9VA 1X5SA 3WZ0A 3BGLA 2V4RA 1N56A 2HWIA 5KFSA 5F41A 2LDYA 3O6QA 1IQTA 1U26A 2A1BA 2NUHA 2HHXA 2MJUA 1JMTA 3C6TB 3NS5A 4KT0C 2J9DA 2HMIB 1UFWA 1MU2B 4NA1A 2BQRA 1X9WA 2VPXB 2HHUA 4C3LA 3K8WA 2K1RA 3LALA 4JBCA 4WXWA 2E29A 3PNIA 2BM0A 4O3OA 4ECZA 1HQEA 2R8JA 2KXFA 3MR5A 1V3ZA 3IGVA 2PIIA 2WW8A 4BS2A 2DHSA 4DUZF 2DGWA 2PE8A 4CTAA 4DJBA 1FDBA 5H1SV 2BJDA 3SCIE 1V6HA 2LYVA 3PXGa 5CA5A 2UUBF 2HS4A 4J9OA 3IGNA 3PKMA 3DHWC 2LKZA 4A47A 2FVSA 1FE4A 2P9CA 1KHWA 2CQGA 4LFCF 1RK8A 2R8IA 2VG5B 4RW4B 4C0HA 2HIQA 4YOEA 2O5DA 1S76D 4NZ7A 1S6PB 4KRWA 1FRJA 1X0PA 2VZ9A 4PXBA 2B56A 1UETA 4DQIA 5SZTA 1SIWB 3FFIB 2UUCF 1S1TA 1WNEA 1Q53A 2BVZA 5L8RC 2YKQA 1VQ4S 1NHUA 5FLXY 4A8XA 3HM9A 4DQPA 2C3PA 1IN0A 2ZC4A 5HBMA 3CPWR 2DNGA 4I6AA 4RW9B 4DWIA 3DM2B 4OI3A 2GX8A 1HMVA 1R8AA 2OP5A 4J37A 4PG5A 5DDQC 3IN5A 2HS0A 1Y5IB 1S0MA 3LGNA 3VAKA 5D4PA 4OI4A 2XY6A 5GAEU 4IQXA 2D41A 1N5TA 4CZCA 5I3QA 1S0OA 4K4VA 5KFGA 1VOMA 2XMVA 1VIXA 4MAKA 2Q3PA 3Q0AA 4QWDA 2EFVA 1TKTB 2RVJA 3RR7A 1VQMS 2IYIA 3UCZP 4PWUA 1HBOB 2ASJA 4EO8A 2DGVA 4TN2A 2YH1A 3F44A 3MTJA 1N54B 2F3JA 2RE1A 2HLUA 5IM0B 2PC6A 5HMZA 2RRBA 1SKRA 3M9NB 2XHWA 2HHPA 1OSDA 3BF4A 1U24A 4K4ZA 1Z4UA 1LW2B 2J0WA 2Z4PA 1FXLA 3FJ2A 2KH9A 1TL1A 2HVZA 3QMQA 1T3NA 1HPZA 1ZYQA 2I38A 3LH2S 4U7UK 3EPIA 5I3UA 2G9OA 5D78A 2DIUA 3A1YG 4R8UB 1S7HA 2DO0A 2R2TA 2Y1IA 3EXYA 2XY5A 3ULHA 1HQUB 3CCSS 1JNZB 3CCZA 2GQCA 2L9NA 1XMQF 2BOPA 2IM1A 5B7WA 4DF4A 3IA0A 2PMHA 3QYYA 4RWXA 1RT6A 3M2UB 5E3RA 4ALZA 3Q8RB 1RT7B 3M30B 1EP4A 4I69A 5G0RB 2AF6A 2WB1D 3IWNC 1S1UB 2ABYA 1TR0A 3GQCA 1XK8A 1HWIA 2GIRA 2JFDA 1UA0A 1TKDA 5E3AA 1PGZA 2JEJA 2HHWA 4DSFA 1S10A 4K4XA 1EETB 1IKXB 3QWPA 5CYMB 4LT6A 2J0XA 5AXLA 2UXDF 2AYBA 2DNRA 2KB2A 5EUHA 2V4JB 4QU7A 3K5MA 2W4DA 1RA6A 1VGYA 3OXGA 1ZAXA 3CCTA 1H2UX 2LEPA 2QLXA 4XK8C 4G1PA 3VWSA 2XZWA 2RF2A 1KTQA 5IWAF 3I9ZA 5F8HA 1H38A 1HWJA 1TL3A 4DPOA 2Z8QA 3DLHA 3M8PA 5JXSA 4H4KC 2O01C 2I5JA 4RWWA 1ROFA 3TARA 3ISZA 3NGKA 1ZH5A 3I96A 3MCSA 2YNGB 2DIVA 2VUGA 2DR8A 3TA1A 4Q43A 2NUUG 2QT7A 3SDEA 1R8PA 2MZTA 4RNFA 2WONA 3PFEA 2ASYA 1N32F 1WACA 3PM9A 4BWJA 3I32A 2W9CB 1T03A 1K1QA 2N4DA 2KXNB 2CJ9A 3OUYA 1UJ4A 3MM9A 1KLNA 4YDDB 3I31A 2KO1A 1ZPVA 5BYQA 2N7CA 4ELUA 3KLIB 3OHAA 2C3OA 2XSJB 3GSDA 2DNZA 4OLOA 1KLMB 1ZM2A 2DRBA 2AD9A 1U1QA 3M2VA 4R5PB 1VQOS 2HHHF 3LP1A 3F41A 2WBMA 2ZH7A 3MAHA 3HHEA 1HWLA 1U7LA 2J9EA 2J6UA 2I9SA 2DB1A 3MXHP 1GQEA 5IQQA 2VBXA 1QVGR 2YNIA 1QAYA 3H40A 2DO4A 1C0TB 2NPIA 5KFXA 4ZOSA 5I3PA 5B0CA 1UJ6A 3RRGA 4JV5F 3CJKB 3PRDA 1TKZA 1X4AA 4CNYA 2WSCC 4X4RA 1NK5A 1SJFA 1YRXA 3ENVA 2CDQA 3IRWP 3FMBA 4O44B 2OPSA 4HTIA 2GC8A 1SL2A 5J2QB 4CCHA 3NBPA 4ZP6A 4Q8EA 5BR8F 3LGMA 2BE2A 2MQNA 2MGZB 4URSA 2DITA 2ROGA 2YWFA 2CPEA 3MMAB 3OSNA 3QWUA 2RQMA 1VK8A 3HFKA 3M32A 3N6LA 2DT9A 2X51A 3CD7A 3DRSA 1GAOA 1FERA 5FDLB 1RTDB 1VBYA 1ZAVA 3FNNA 2DNLA 3L95X 1R89A 2GGPB 3U02A 1HYSA 5K14A 5KFAA 3SFGA 1K1SA 5D3GB 4B9SA 5CYQB 2JHEA 2LA4A 4TXSA 1LK7A 1X4EA 4ZLPA 1YGYA 3DU6A 3OJSA 1P1TA 3EGWB 1ZM4A 1TUVA 4GO5X 2JLFA 3R1HA 2JWNA 2ASLA 2CPXA 2EFNA 4LSLA 1L3SA 4UY85 2OTJS 1Q86T 5LL6d 5KG5A 1U09A 4NLXA 4WU3A 4WU2A 3POTB 4OZ0A 5EGYA 1BWEA 4DUYF 2N4CA 3TA2A 3GFZA 4RNHA 1YWXA 3SZ2A 1JLEB 3NRBA 1HHSA 2DNHA 3N6NA 2VH7A 5CZXA 3N4WA 4HL9A 4LIRA 4EUVA 3PR5B 3OV7A 2OD4A 1SJ3P 3DOKA 4WCEQ 2KRRA 4EYHB 4OHWA 2RKIA 4OIXA 4KGKA 4TQRA 1M0SA 1M5OC 1KHVA 5F8IA 5M2PA 1SBRA 4PPZA 4LF6F 1NJZA 1SH0A 3GG0A 5KG2A 1C4AA 1S0VA 3NCRA 3SQGB 3TR5A 3OW2R 2B5JB 2IJFA 4EZ6A 4Z2XA 3RR8A 2CRLA 2IJNA 4K0KF 1UFLA 4IRDA 4F2RA 5GADU 4AE5A 4NLYA 1RWUA 4UW2A 1Y5LB 3V6HA 1NK6A 1KS2A 2QLWA 4P7TA 2B4PA 4X84A 1T05B 3NGDA 2UVWA 4V19J 3CD0A 2HRYA 3OFHA 1IKYB 1Y00A 4C97A 2CFXA 1VQ7S 4Q2MA 1Q8LA 4EBDA 1N6QB 4DSEA 1KD1T 1J5OA 2KXHA 2WSEC 3DDNA 5FD1A 1FRLA 1DHMA 1JLBA 3MEGB 4YMEA 1KQKA 2DCUB 3R5CA 4RU2A 3PIOQ 2KHCA 1FD8A 5HROA 2DGOA 5DGAA 3KLHB 3TYTA 2OH2A 1QE1A 1GH8A 2C3YA 3CD5A 2R7UA 2A2DA 1HARA 1JIHA 1MMNA 2HG4A 4ZPVR 4L6V3 5J2PB 4BWMA 1H0HB 1LWCA 1X7VA 4FNIA 2IC3B 4NLPA 2FDNA 1FHTA 2EWHA 4MFBA 5DDRC 3VTIA 3OTOF 4AL5A 1R8CA 2GCFA 2OPRA 4X64F 2J7KA 3DLKB 3T19A 5C25B 2U1AA 3AA9A 1X0FA 2IYGA 2CQ0A 4KKOA 1XWLA 3UFCX 4I68A 1RJJA 2GMLA 4Y00A 2KZMA 3FSXA 4RLEA 6FD1A 1LK5A 1Y7PA 4QR2A 4Q44A 2Z0GA 3J7A1 1P6TA 5F8JA 4ECSA 2DGXA 3K2YA 2MHEA 2MKHA 1C0UA 2OPQB 2SXLA 3S01A 3CMAS 2Q6BA 1LXJA 3G8QA 5E3PA 4JI1F 4MYTA 2Z2MA 4MYUA 1PC5A 4NZ0A 2NPFA 1M5PC 3KMQA 5DM6Q 2BZ2A 3D2WA 2QEXS 2M9KA 5KFIA 2B6AA 3U27A 6FDRA 4LFAF 4LSNB 4USHA 4C3KA 1TKXB 3MMBA 3DRRA 5LMNF 4NA3A 3DMJA 5KG1A 5KT3A 4OZJA 1SJQA 1Y3KA 3TOQA 3TVKA 3BN7A 4RW6A 1R7IA 1JLGA 2J9CA 2LDIA 2BANB 5GAHI 3EX7B 3UDCA 1YQHA 4ED5A 1OWXA 3T5LA 3RBDA 2V5HG 3VAMA 2FVPA 2UVUA 3J80Y 4MKYA 4M95A 2YH0A 1VRTB 4I2PB 3RB6A 2OKQA 4GKKF 4Q7AA 1JWWA 3T6JA 4I0WA 5L1JA 4X65F 2WHOA 4YUDA 2RIJA 4JV2A 4J9PA 2B43A 3L7PA 3S8SA 4IOBA 5LSLA 1RT3B 3Q23A 4H4OB 3GFXA 2DNOA 2RS2A 3CJ0A 2RT3A 3QAUA 1RYRA 4ILRA 3GIJA 1PILA 4WKRA 1FNOA 2CZ4A 1WI8A 5D77A 5KFRA 3VCDA 4J9SA 1GX5A 2CKWA 2NSCA 2FHOB 2IM2A 3D54A 4P6QA 5KFTA 5KFVA 1KEKA 1HNIA 4AXIA 4F4ZA 3MUTP 1DBDA 4WE1B 1XNQF 2HNYA 4LVNP 5J1NA 1OQ3A 1P1LA 1VI7A 4DX8H 4DV4F 3GYNA 3CGIA 3VAIA 1ZETA 4C9DA 1JXLA 4CO2A 2F40A 4I64A 2AW0A 4QIFA 3U7JA 4DL5A 3W2WB 1S6QB 4V19X 2CJKA 5KFMA 3LOUA 3OPKA 2FJBB 3H20A 2O67A 1NK9A 5T14A 4QWEA 3PY8A 1C1CB 4OJGA 1JLAA 1HWUA 3WBZA 3QIDA 4NLTA 3DOLA 2QA4G 2KRBA 2EFPA 2KFYA 4F50A 1X4GA 1NK4A 1R6YA 2R2RA 3V81A 4KV8A 1K0VA 4NA2A 4C2MA 1YRTA 1G7CB 4TU8A 2ILZA 2ROPA 3D1QA 1CG2A 3CE8A 3HHDA 2DJWA 4I6YA 4O3PA 2ACYA 3M9OB 3TAQA 3PEJA 2HHTA 4ECXA 1RAJA 2DCLA 3IG1A 3VZHA 2IMWP 5D8HB 3GG1A 3HHLA 1KTVA 1HNXF 2XMKA 4QJVA 1JK9B 5LSOA 4QR0A 4KQZA 2DH8A 2K3IA 5KFKA 2YQ3A 4RUAA 2HGMA 2HFNA 2AQ4A 3P5TL 1HBNB 2ERRA 2EFGA 1JLFA 3IAM9 4R0JA 2KM8B 2E5LF 2XBPA 4C98A 3KHLA 2DVIA 1HBMB 2FY1A 4AUKA 2X1AA 3CJ2A 3QJLA 2UV8G 2X1GA 4OZ1A 3W2VA 5IQ6A 3MPWA 2G1DA 2R4FA 2W25A 3EZ5A 4N41A 3DXBA 4C3MA 2YX4A 3DLGA 4WFNQ 2YTCA 1I1GA 2VC0A 3GIKA 3MM5A 4DMZA 1R0AA 4QU6A 2IRYA 2DNKA 2L41A 2WOMB 1UVNA 2ILYA 2CVEA 2FGCA 1MROB 4DR4F 2CPHA 5C24A 1Z2LA 1OO0B 4IYQA 4B9UA 4NXNF 1N48A 5CCLA 2RH3A 5A8KA 2C2EA 1HL6A 1MMLA 3N5FA 3KLGA 1VQYA 2HYIB 2IVMA 4ES1A 4NWBA 5BYSA 4PCQA 2KDOA 2YNHA 3KLEA 5CHCB 1SB6A 3HVTB 3N9UC 5A0YB 3T9ZA 5LJ3Y 5J2MA 2VFTA 2F8HA 3SEOA 4FVCA 3QIPB 1SUQB 2CQCA 3TA0A 1ZOTA 5KOXA 1N5YA 2CPDA 2PI5A 4QZVB 4O3SA 2DK2A 4M8LA 3OLBA 4WIIA 1L3UA 4KIAA 2JJ4D 1SV5B 2RRAA 3RW7A 1IXKA 4G1QB 2R9LA 3T5KA 2VBYA 2ZH2A 1YJVA 3G96A 2FLPA 3O2IA 2HNDA 5KFBA 2DBBA 3KJVB 4M94A 3NMRA 4PG7A 1TAQA 1Z1ZA 2LLZA 1AW0A 3M4XA 3I0RB 2HHVA 2YKNA 3C6UA 4USIA 2VOPA 2XSFA 3CO9A 4J9KA 2DNMA 4MIWA 1R3NA 4YY3F 2R7WA 1MMDA 2MQOA 2MSTA 3SV3A 4ECVA 1DTTB 2ZD1B 3G6XA 1WTBA 1S99A 2VFUA 2PFFB 1NKCA 3BSAA 3H2VE 4Y2IA 5A6PA 4JI8F 1S72S 4KAIA 3L09A 4DLGA 1HI0P 1UL3A 3B8HA 4JI2F 2W4PA 1FDNA 1FEHA 1JJHA 3F73A 2ZZMA 4IG0A 4F02A 3MEKA 3DYAB 4OQJA 5CYJA 5LJ5Y 4B3TF 2RD5C 2A3JA 5K8MA 5L1IA 1QUVA 2BV3A 1H7WA 4IRCA 2E1MC 3V6JA 3P49B 4KO0A 1T94A 5HQ8A 3CC2S 2B4OA 3T1YF 3DRPA 1YJUA 1W2BR 1U6BA 2HZCA 3B4DA 3HHLC 5C42B 3M8SA 2F7VA 4ITSA 1M5VC 1TP7A 3BR8A 4TYAA 4N77A 7FD1A 2C22A 2CVIA 3T3FA 1U1LA 3THVA 2Y1JA 4BHQA 3BGUA 3MM6B 4B3OB 3G8SA 3QO9B 4L72B 4MIAA 3J7Z5 3MF5A 2EG1A 3MECA 4A8KA 2JFKA 4UY8T 1ZZFA 1UVLA 4UUWA 3R5BA 4JI3F 4Y6IA 1XERA 5KT7A 4ED3A 3KWMA 1CC7A 1WG4A 2C3MA 4IG3B 2R2SA 4FP9A 4ECUA 1XMOF 2KM8C 1RDRA 1UJ5A 3GMGA 4DOZA 4NLWA 4A46A 4TQSA 4KJIA 1XR7A 5J2NA 3AAWB 4A8OA 4IQMA 2L48A 1X4CA 4OZ5A 4EFAC 4LQ3A 4R0EA 2JEGA 3GWCA 5T7LA 4M5DA 5SUHA 1T8EA 1G3OA 2VB6A 2FHJD