4P2SA

Alanine scanning mutagenesis identifies an asparagine-arginine-lysine triad essential to assembly of the shell of the pdu microcompartment
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative propanediol utilization protein PduA
publication title Alanine Scanning Mutagenesis Identifies an Asparagine-Arginine-Lysine Triad Essential to Assembly of the Shell of the Pdu Microcompartment.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar saintpaul str. sara26
molecule tags Biosynthetic protein
total genus 19
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p2sA00
3SSSA 2A1BA 4OLOA 4LIWA 4PPDA 3MPYA 3I96A 4RBTA 4RBVA 4OX6A 4QIVA 4RBUA 4P7TA 3I6PA 4QIFA 4OLPA 5DJBA 3NGKA 3CIMA 3H8YA 3DNCA 4OX8A 5L38A 3PACA 3BN4A 3N79A 4P7VA 4AXIA 2EWHA 4DDFA 3MPWA 3VCDA 4AXJA 4P2SA 2A18A 2G13A 3NWGA 4QIGA 4QIEA 3IA0A 3SSRA 2A10A 4OX7A 3DN9A 3CGIA 3SSQA
chains in the Genus database with same CATH superfamily
4PWDA 4RBTA 1NHVA 3CJ3A 2MKKA 1MMLA 4IFVA 3I0RB 1Q8KA 1UFWA 3H90A 3M4XA 2DXFA 5IV3A 3EZ5A 2YKQA 4BC7A 1UVLA 4OHYA 5EX0A 1MN9A 3F44A 8RUCA 2KM8B 4H4OA 2RE1A 1I6JA 4DR1J 4EK2A 1N0VC 1U09A 5IQQA 5ETQA 1BY9A 1XN9A 1U6BA 3SIPB 3DMJA 1P9QC 1RAFB 5ETLA 3DU5A 4J9QA 2YPZA 1FKOB 4O4RA 4B9NA 2GCFA 2C42A 2QL5B 3TAPA 3CD5A 4GKKF 1IBCB 5HVGA 5HATA 4V19J 2OSQA 3MEEA 1JIHA 2CQCA 4KE5A 3MFIA 1E6YA 3RB3A 1HLWA 3W63A 1I94J 3DDKA 4DV0F 1S6PA 5ETRA 1HWKA 2KI2A 2CDQA 2F8MA 1Q16B 4WWSA 4QR0A 2G0JA 3MCOA 1TK5A 1VRUA 4DS5A 2HVDA 2IPOB 2WOMB 2D1CA 2DNQA 1S0VA 1HBMB 2HHSA 4QR2A 2FJAB 3CW2C 2KYZA 2ROEA 4C0OC 2PDAA 3D6FB 4NRUA 2R2TA 3DOKA 2VBZA 4NCAA 4J9LA 4FPRA 3DLBA 4DFKA 3IM8A 2OSRA 3MAHA 2MGZA 1X7VA 2FVRA 2ACYA 3UCGA 3ZTRA 1S57A 4IOCQ 4WP9A 1LOUA 4K59A 4YY3F 2GMLA 3D4JA 4DG1A 2VDHA 1DAXA 3FMBA 3L7UA 4YB5A 4LIWA 1YK9A 3PKMA 3D0HE 4ZCIA 1UETA 1IKXA 3VZHA 3CVKA 4RZRA 2CJYB 2YWFA 5L8RC 2E5HA 1F0XA 4Y2IA 4ZPCA 3GG0A 2AYEA 3J7A1 4B17A 2VICA 4LF8J 3AOCA 2XMUA 2ZOFA 4F04B 2V8HA 1U6ZA 4EBCA 4JI0F 2GX8A 1CJUA 4YS2A 1YBUA 3MAAA 5IM0A 4ELVA 3FEYB 2H54B 3GSDA 4OZ0A 1GQEA 3ZZZA 3Q22A 2LQ9A 1JK9B 1YQHA 1ZA1B 1PKUA 4CO2A 1RE1B 2JC0A 2IMWP 2CXEA 4NYZA 3CJQA 4UW2A 2ZJQQ 2FZKB 4A8YA 3GILA 1UEVA 2HQGA 3TARA 2HNYB 2N3OA 5D4OA 4U6PA 3MCSA 2M7SA 3BGOP 1C1CA 4DV0J 2ZH1A 1VQMS 2V2VA 4CI0B 2OIHA 4IDKA 5HQLA 2B9YA 1K0TA 3W8GA 4IFYB 2WONA 2Z8QA 1RWPB 4I1TA 3MMJA 2XWYA 3OFEA 2KJVA 2CFXA 1JXVA 5HI7A 2VOOA 1N54B 3B4DA 4FYWB 3QYYA 1CEZA 4X66F 2FYXA 2M0GB 3NRBA 4RW4A 2IM0A 2Z30B 2RU3A 4WJBA 2XEXA 4HHUA 5E5NA 1MMNA 4LF9F 4I7FA 2J6SA 4YHHF 4GC6A 4IQMA 3FGVA 3R7NB 3TJAA 1CC8A 5KG3A 3LW5C 4YY3J 1G1XA 3HHLA 3BH7B 1IR1A 3NGKA 3HJVA 2VG7B 2KJWA 1SIWB 2UUBF 2WVDA 3BF4A 1X4CA 4QOTA 4DFMA 4DFJA 1YJUA 2F9DA 2YQ0A 3DLEA 2V4JB 2HWIA 3OVSA 5I42A 3KLHB 1NZAA 1WKLA 4FF3A 3ET6A 3CDUA 4C8MA 4E8UA 3R5CA 2BVZA 3HCXA 3KKFA 2DHXA 1ITPA 3UW1A 2GMHA 5KFYA 1U1RA 4U67Q 2CDRB 5F3TA 5J2QB 2U1AA 3UDCA 1RHUB 3LANA 4H4MA 4JI0J 4JV2A 1SC3B 5ETSA 2ZNZA 3EWGA 4PG8A 1VFJA 4ZVUB 4R0JA 4BHQA 2DNRA 1J2VA 2ROGA 1PSDA 2E1MC 4PWWA 1YKWA 2VBWA 3HPOA 2G1HA 2XO6A 1X4BA 4YP3A 2K7KA 2MQNA 3PZPA 2J8AA 4TY9A 5CQGA 1LW2B 5F3ZA 4W90B 4NRTA 1SJ3P 1FTCA 3C46A 1H73A 4AD6A 1SH3A 1U1OA 1RB0A 4OHWA 3NL0A 4RWXA 2QMWA 4OYBA 2QLFB 1MLAA 1JLCA 2RUSA 3E8OA 4J9OA 3Q8UA 4X66J 2FIUA 4WF9Q 2CPHA 1KLMB 2W2QP 3V4IA 2IY5B 4LF9J 1RUSA 5HJYA 2UU9F 2RH3A 1K0VA 4YHHJ 1SJ4P 1FK9A 2AX1A 4KHPJ 3CUNA 1KQKA 3BSCA 2VB6A 3BPDA 4FVMA 1JLEB 2LU1A 2R2UA 4EO8A 2UUBJ 4YEAA 3OW2R 3QFHA 3V6DB 1GX5A 1IBKJ 1HNIB 1X5SA 2V9WA 4ECRA 4YDXA 2DGSA 3TVKA 1A7GE 4LSNB 2R2RA 2BV3A 2CQIA 4Z7YA 3TAMA 5LJ5Y 5JVGQ 1HHTP 4FXWA 3ZZUA 4IOAQ 2CQGA 1U0HB 4ZIWA 3PX0A 1NEEA 3TNVA 3G8QA 3IGNA 2DGWA 4NA1A 3MTKA 2B6AB 4FF2A 3QSIA 1JLFB 3JQJA 1YJ9S 2GVZA 1BGXT 1CJTB 1U8SA 1TUVA 2VF3A 7FD1A 3H42A 1FNXH 3ZZRA 1WKKA 4PXBA 5LXRA 2G0IA 3HHDA 2YNHB 1TKTA 4DPXA 3ZZ0A 1R43A 3RRHA 2RNEA 1UJ4A 2N4CA 2O1PA 4KGKA 4OI3A 2XMJA 1T9VA 2WW8A 2XMWA 5KG6A 1HBUA 2K3IA 1WG1A 1GK8A 5KFQA 5KG2A 4PWDB 3MFHA 4IFVB 2DB1A 2VKZG 1LK5A 1PCAA 4OZ3A 3ZTPA 1NMEB 3T9NA 1GXLA 1CQNA 1GMVA 3JSRA 1NHUA 4ZCLA 3L9ZA 3HSGA 3NCRA 5IC4B 5GAHI 4G3IA 2X1BA 4MH8A 5HBMB 1NXIA 1Q8IA 1MWQA 3EVMA 3EMTA 3IS9A 1HI8A 5KG1A 4N8NA 2LVWA 2ZEJA 2ILYA 3BGRB 3THPA 4RW6B 4LRAA 5K5MA 3DMJB 2LEAA 3D6HB 2FB0A 4RW7A 2AJ4A 2Q3PA 4CYUA 2XSJA 1RISA 4RO0A 3FUYA 3KTQA 2FLLA 1N5TA 5K8MA 1U02A 4RNOA 3JYTA 1S6OA 3CWJA 3B78A 3JAMY 1S1WA 3DI6B 3MEEB 3A3OB 3NGDA 2Y9HA 2RUGA 3SDEA 3KJFB 1UAWA 3CJKA 3ZFVA 3JQKA 2CQPA 3DGVA 2NCKL 4MAKA 2FVSA 2WSCC 1QUVA 3SQGB 3A3NB 1S6PB 2DPIA 5LSOA 4QYZJ 3ZTQA 4ZP7A 2QV6A 2R7XA 3QT8A 4K4VA 2MZTA 3BZQA 2CRLA 2RDJA 2DCUB 2VPWB 2FJEB 4A8FA 3GE9A 3R2CJ 3DRSB 2FLPA 4JYAF 2ZZNA 3DOKB 2YWEA 3QLHA 2JNJA 3GFZA 3JSYA 2B9WA 5M2PA 1FDDA 2MKIA 4JV1A 2EBGA 2MGZB 1EB0A 1RXOB 3CCZA 5G0RA 2X3DA 1HWIA 5GMDA 2XY7A 2DJWA 2QL9B 3GV5B 2KVIA 3I87A 4N77A 1XC9A 1VQSA 2ADCA 4JI2J 5CZVA 2BACA 4F25A 2XM3A 2IA6A 1HMVA 1WG5A 2P9GA 1EAYC 2FVCA 2HRYA 5J2NA 3DFEA 3IWLA 4DUYF 3H59A 4DV5F 3MTJA 1U1LA 2R7QA 1FRXA 1J5OA 2F40A 1WI6A 1RT6A 1ZAVA 3OTCA 4K8RA 1RCOB 1U8WA 1U6FA 3M9OB 3RZAA 2HQFA 1F5AA 2KVQE 4QPTA 1FXRA 2HFUA 1L3TA 3PCOB 5KFDA 3CD0A 2LP4A 3KYLA 1CJUB 4OYWA 1TR0A 4B3MF 2O5DA 4A47A 2EC0A 3CB4A 3SFGA 3KLEA 2DXEA 4DV2F 3WX8A 2Y8WA 2WBMA 4CWBA 4QIFA 1HQUB 1H2UX 4J9VA 5IT0A 5DRKA 3Q86A 1OPZA 5DLFA 1VBXA 2QLXA 2JLFA 5SUHA 1RU2A 4A8XA 3BKFA 4OYXA 2EEYA 2YWWA 1HNZF 1M1KT 5DO2A 1RU1A 3C3LA 1C1CB 4WFBQ 3OFGA 2OPPB 2BX6A 2MJNA 2KFZA 3J7ZT 4IDKB 4U9RA 4USVA 3MURP 4U7UD 1QAJA 2ASDA 2V63A 2IFXA 4B08A 4YMEA 3UN2A 3QT5A 2YWKA 3PXGa 3BO2A 2PA8D 3KXDA 1TL3A 4CO5A 2BJEA 4RW4B 1YSJA 4JYAJ 3CCLS 4OX7A 4Y28C 1FFGB 4LF7J 4DHVA 1SQFA 3OR1A 4LBIA 1S77D 4CCHA 4QWAA 2C2DA 4TY8A 1YITS 1KEKA 2DGXA 3H20A 5SZTA 1B64A 5KFNA 2U2FA 1V3RA 4MIAA 2W01A 2W9BA 3HHLB 2OPQA 1OO0B 1R6VA 1RBAA 1TFYA 4CQ1A 4NLXA 2NZ4A 4X62J 4LQ3A 2E66A 4DV5J 1SKRA 5I42B 3PYFA 1YHQS 2HVEA 4WU3A 4PG7A 3GB0A 4USJC 3EX7B 1X5PA 2VZ9A 1T3OA 1UCNA 4MKBA 2DO4A 2WBRA 3UNGC 1H38A 3K5LA 1H72C 2ZBRA 4B3MJ 2WVCA 1RLCL 2XLIA 3RBXA 2OEKA 2DNNA 1LWCA 2LMIA 3SFUA 2J9CA 4OI4A 4DV2J 4LF5J 2K2PA 3W5YA 3IG1A 4CDIA 2EC2A 2JLEA 1OQ3A 4J7CA 4HT7A 2VJUA 3M8QA 3A1YG 4OZ1A 4F0HA 1S9FA 5KFAA 5DGBA 2LXUA 3OSPA 1RJJA 1RDRA 5HP1A 2ZHOA 5HMYA 2GAGC 4NLSA 3I31A 1Y5NB 3B8HA 4E0DA 3KOAA 5M2UA 1Q8LA 2OO4A 1GXUA 1S5ZA 3CCJS 1NH7A 3NGTA 2XULA 3VGUA 1Q7LB 3G4SS 3ZZPA 2OFHX 1M5SA 1ROFA 1JLCB 3GQCA 2KZZA 4PG5A 1ZZNA 2LQBA 4P6QA 2CKWA 4ECVA 1M5VC 1RT2A 3OL8A 3S7RA 1Q78A 3AOBA 4XK8C 2N82B 5J1EA 3CE8A 1SKSA 2HGLA 1CQMA 3RAQA 4QCLA 2DT9A 1N33J 2VG5A 2GC8A 2HNZA 3RBDA 1XK8A 1R0CB 1S0OA 3KHGA 2R8JA 1Y4ZB 4RNNA 2ZH5A 2JEJA 1S9GA 1N5VA 3H2LA 4DFPA 2AU0A 4F02A 3KUHA 4DQQA 3DLLQ 2E9ZA 3Q2TC 1R8AA 1VQPS 3TZWA 1S4FA 3RW7A 2AEJA 2CQHA 4OYAA 3KMSA 3HVTB 4JI3F 4ED7A 3FFIB 2B4PA 4WPAA 2YVSA 1QUPA 3WIVA 1FEEA 1IKYA 1VQYA 1SB6A 5I3PA 1UZDA 4IQXA 1S6UA 1RT3B 4C2MA 4ED1A 1J27A 3SCLE 1N6QA 4C3KA 4UZCA 2GQ2A 5HVFA 1SUQA 4MKVA 3ONQA 3OL6A 2NUHA 2GVZB 2ALZA 3T1YF 4Q7AA 5ETVA 1YGYA 4D3HA 4C11B 5LXYA 2DNKA 3CNQP 1F9HA 5KFPA 4JI8F 1TKTB 3LTOA 2Z2MA 4L3KA 4R8UA 2MZSA 2R8GA 3MCMA 4Y34A 3CO9A 3CD7A 1U49A 1EJ7L 2BDPA 4DL0C 2W9AA 1HBUB 4PWUA 3M8PA 2I0XA 2IJNA 5JJBA 3D7SB 2QMXA 3ILJA 4FPIA 3BDPA 2GHVC 1JXLA 4NLQA 1RYSA 4ANEA 4L75A 3ADAC 3PYEA 3W60A 1HNWF 5E33A 3IS9B 4ILRA 1ZYQA 2V2ZA 1HWJA 5AT1B 4NYPA 3CEDA 3R5AA 4CO4A 5CH7B 1NH8A 3DGPA 3CCES 4DR2F 3EJMA 4KQZA 4DPUA 4F7VA 1U7LA 3TZYA 3Q23A 1B4SA 3AQOA 4ECZA 4RW7B 1BLUA 3PYDA 2MZRA 2XSJB 3MCNA 4L72B 3WQPA 3L7PA 3G96A 2W4DA 5EWEA 4BCAA 2DK2A 4ECXA 2MLZA 3MPVA 2K3KA 1S1WB 4X4SA 4ZPVR 4JI3J 3DLKA 2F65A 1QAYA 2RHSB 2QC3A 2QYGA 3SDEB 5G4DA 3CJKB 4K2JA 3I9ZA 1JLAA 4ZKAA 2Z4PA 3RUBL 2ZUGA 1F3FA 4FYVB 4L76A 4UY8T 2PEHA 4NYOA 3MR6A 4DL2A 3PW5A 3MMAA 3HLUA 3V5RA 1QAIA 4F3QA 4RUCA 4ZJLA 4OV6A 3OL7A 5E3PA 4ED8A 2CQBA 2WAQD 4GO5X 3T1YJ 3W3SA 4Y0FA 1WOSA 1AB8A 4B9TA 3QBCA 1O8BA 4O3QA 2IDLA 3K8VA 2OH2A 4J9UE 3QLHB 1VC0A 1UA1A 4C0BA 4JI8J 1SKWA 3HI9A 3KJNB 5G0RB 2YXLA 3LP0B 4X4UA 5K9FA 1URRA 4NCGB 4YQWA 1GH8A 2V8DA 1BE4A 4JI1F 2AGOA 4AL5A 2XCPA 4FYXB 1HMVB 1S10A 2QSWA 3N6MA 2IBOA 2WRMA 4JI4J 2HAIA 4YDDB 1NK9A 2JEFA 2QLWA 2HYIB 5DDOC 1J5OB 2W2PP 5D15A 1WEZA 2DH9A 3M6VA 2B56A 4LSLA 2C3YA 1NJYA 3A8EA 2D41A 3CCMS 2BEFA 3EGVA 4LR8A 5FLXU 2ZZTA 3VZIA 3D54A 2MZ1A 2M52A 3TZZA 2CG4A 1QVGR 5AE1A 5B09A 1N5QA 1DLOA 3V81B 2W4CA 3FCHA 3FEXB 1VS3A 3W5ZA 3KLEB 2DNYA 3EDQB 3T19A 4B3RF 4WIQA 3HSDA 4WP8A 2CJXB 2AV5A 3NNCA 4LUBA 1HA1A 4NEYA 3BR9A 4RNFA 3MUTP 3V4MA 3X3UA 4PYDA 1CULA 2YNIA 1VGYA 4F3MA 1R0AB 2J9EA 2WVFA 4KH1B 3W2VB 2HBZB 3LP1B 5A8WA 2XO7A 4KPYA 3QGIA 1KVIA 2BQ3A 1SL1A 2W2NP 3RAMA 4DQIA 3TRGA 3A8JA 1SQGA 1OYEA 4ZDNA 4DLEA 3GJQB 1U0SA 4Y2MA 4K4TA 1WHXA 3D3CJ 2QEXS 1YVFA 2V4QA 1AROP 4PR6A 3JTPA 5C2GA 3AJDA 2MLXA 2HK3A 4MFBA 2AX0A 2GIQA 3ZZTA 4I4BA 3G8SA 1K1SA 3I9V9 4P9SA 1ZH5A 2W9BB 2B51A 1ZAXA 4C8LA 1OY6A 2OPQB 5B7WA 2AKWB 1S99A 3BQ2A 4JI1J 2GMJA 1S0MA 5A2QY 2CNKB 2OPSA 4RLEA 2MMYA 1N32J 4ZA1A 3P5TL 4NL5A 2HS0A 3U02A 3S8SA 3H4BA 3SI8A 1S1VA 2HBQB 5FLXY 2YWHA 2KT3A 2DNLA 4IR1A 3D1QA 4M95A 2NPIA 3NNAA 4ZVHA 1YWXA 2XMKA 2BMBA 4OZ2A 3T3FA 3UVJA 1QJHA 2BW7A 4P10A 2HWTA 3F56A 2DHSA 1L3SA 2ZJRQ 1RHMB 4B3RJ 4BLGA 5KFFA 1SXLA 3H7HB 2R42A 1O0PA 5C24A 2HHUA 3HHLD 5F8NA 4ECSA 1WTBA 1NHKL 1GNKA 3KDNA 4JUZA 5BJRA 4OYPA 5DLGA 5E3AA 4BS2A 4CNZA 2LA4A 2E29A 2L48A 4X4NA 5C2CA 1SC6A 1JLBA 5F8LA 1NB2A 1S79A 4HDHA 4DV6J 4YFUA 3HMJG 4WFXA 3D2WA 2BQRA 5DM7Q 2AIRB 3O8WA 4KR0B 2C2NA 1HBOB 7FDRA 4CLTA 5J1EB 1D8YA 2HNDA 2B5JA 4N56A 4PPDA 3IR5B 2I1RA 3NP5A 3I6PA 2EKNA 4KV8A 1S6QA 4ZJOA 2HNZB 5ETNA 3WC0A 5A0YA 1KTQA 3KK3A 3M9MB 1R6YA 1GTEA 5KG5A 2CJ9A 3HULA 2DGVA 1TELA 2R3VA 4K4XA 3UNYA 3D6MB 3FCWA 3M1VA 3RBEA 1KBRA 4ECWA 4HR2A 3HT3A 1FDNA 4OLPA 1YRXA 3EUNA 1UW4A 2W8LA 5EUHA 1NKEA 4DV3F 3GP9A 3K5PA 1XMQF 1JLGA 1HNVA 4HKQA 4DBQA 3QJPA 2V2QA 2UUTA 4DOZA 4USWA 1N6QB 4DX5A 1SUQB 1UPPA 2QN6B 2X1FA 3QZ8A 1Z1ZA 3FSIA 3UI3A 3FNNA 2VQEF 2VA2A 1XR6A 2H3EB 4Y2CA 3N28A 2DVIA 3SSRA 3W66A 2XTJP 1TQLA 2EK1A 3T6BA 3Q2SC 2O67A 4DV7F 4DL5A 2N3LA 4R8UB 1HNXF 1X31C 5KTQA 4B9SA 3OVBA 3PHTA 2VONA 2VC0A 1F2HA 3K5MA 4O44A 5L1JA 1CSJA 2GO9A 9RUBA 2BRLA 3M8PB 3O6QA 1LV5A 3R7SB 5KFOA 3QFWA 3R8YA 5A6WA 3C8YA 5LMNF 2HBRB 1LNQA 1F1BB 2DH7A 4QU6A 3TOQA 1WC5A 2YQ1A 2E5GA 3LAKA 3OQ2A 4WP3A 4FKXA 4ES3A 3BO3A 2RAQA 2ZE2A 2R7OA 2UVUA 1V6HA 4P7TA 1HARA 3TVYA 1QSYA 5F8GA 2EG2A 2B4UA 3VGTA 5J2PA 5T7LA 1T05A 3DGPB 1NK7A 4TQRA 1WC3A 5D6GA 1Z2ZA 2DRDA 3JS9A 3PIOQ 3A12A 1FFSB 2RIJA 4OYIA 7AT1B 1WD6A 4Q0BB 3W2WA 4B9VA 2ZBPA 3GFYA 3DLKB 2HHTA 1KLNA 4PZVA 1KNZA 1UFKA 1U1MA 1FFWB 2DY9A 2DNZA 1JLAB 4DV3J 1XMQJ 2QLJB 1Q81T 2PMHA 3IBCB 4KJIA 4Q2LA 3JTOA 4RWWA 4KRWA 3HP6A 2GGPA 2GVDB 3BGLA 5K14A 3MMAB 4WXWA 4FF1A 2KB2A 1C0UB 3C6UA 3DHXA 4WU2A 2NR0A 3DRRA 3C2PA 2H1YA 4X64F 3ISND 4NLPA 1R8PA 5HROA 2VQEJ 3LQVA 1KQFB 1X4DA 1ZA2B 2MQMA 2OMLA 3TR5A 3H8YA 4IO1A 5F9NA 2MSSA 1F2GA 1D8ZA 1R8CA 5LSRA 1N0UA 5M2RA 3WC2A 1HNXJ 5U47A 4CH0S 3POTA 4DPYA 4EFAC 1HHSA 4MK8A 4NLVA 1ZM2A 4RUAA 4IH6A 5AE2A 1RHRB 1R27B 4USTA 1JKHB 2EG1A 5CYMA 4HHJA 3W8PA 5H9EJ 2M4MA 4P72A 5LMNJ 2B9EA 3AH6A 3JSBA 4QJVA 1VK8A 2J0WA 4B9MA 5ADZA 3TEHB 3OFFA 2HFOA 5HANA 1WF2A 1FO1A 3HM9A 4R25A 4LSLB 2J8SA 4EZ6A 1ZS6A 4ZITA 2KTQA 3DDNA 4MKAA 2F3JA 5H9EK 3OTEA 2CQ3A 3M8SA 4LBPA 5K20B 5AXMA 3LP2A 4DR3F 3NY0A 4IG3A 5HJXA 1FHTA 2VV5A 3U1MA 4I2PA 1MN7A 4DUZF 3G8TA 1UEUA 2MKSA 4OI2A 3MM6A 3KUGA 2MEWA 1XERA 2CJKA 3DKDA 3FSYA 2MTLA 1X4HA 1XQIA 2YNIB 3FSXA 3M2RA 3ETMA 2P5VA 2V5HG 3MM5A 3FZBA 4LFAF 2W4PA 4F2RA 2J7UA 2DGUA 4WFZA 2BJ1A 1P1LA 1NSAA 3KHLA 1TL4A 2DNMA 2QX0A 2XYGB 3CDEA 4PKDB 1RCXB 2OPRB 1QAXA 4Y2KA 2CPJA 2R7WA 4ZOSA 1KONA 4DSJA 4NXNF 1BQMA 4KFBB 2DISA 2J5AA 2FJVA 3TWZA 1IVZA 3PACA 4MFBB 1BWVA 2M9KA 1P9YA 4N8OA 3RRKA 4AUKA 3CDBA 1URNA 4O3SA 4KAIA 3N6NA 2F4VF 3IXQA 2E1CA 2F5GA 4ZHRA 2YX1A 1OYDA 4OHVA 3G2XA 2VBYA 2GHWA 1QY7A 3J80Y 1TFWA 2WVBA 5ETTA 4Q45A 1GMUA 2WSEC 3THTA 1HD0A 2MZQA 4FYDA 1D0EA 4TN2A 4I69A 5A8RB 2P9EA 4KYZA 4DR3J 1EZZB 3UVJB 3QRPA 3D1HA 3MR7A 4U8VA 2ABYA 3O2IA 3MECA 2UV8A 5KFXA 4DUZJ 2OLWA 1QTMA 1LQ9A 3M32A 2G2OA 1FXLA 4LF2A 3MPWA 5AJ3F 2J0QD 5F0WA 2A10A 2ZH7A 1S59A 2IM1A 2ZH4A 4Y00A 1IKWA 4PPZA 4K5SA 2RHQB 5LJ3Y 1FJ7A 4LFAJ 4P74A 5KG4A 4RPFA 4ECTA 2EFNA 3EXYA 2XMAA 1R8HA 1V3ZA 3LGNA 1WOPA 2DBBA 2IC3B 1H7XA 3DLJA 1LWEA 2Z2YB 3CJ2A 1YZ6A 3QSYB 4N41A 2EPIA 4ZPWR 3OTBA 3ZXWA 2E5IA 4YR0A 2NXNA 2HNDB 2B5JB 1BC6A 2J0XA 4NXNJ 1JJHA 1W7WA 1S6QB 1Y7PA 2QGFB 3OBIA 2EVZA 1GFWB 3L4BC 2R7TA 1SJFA 3D0IE 4WK3A 5KT6A 1T02A 3KK3B 4LFCJ 4DN9A 2UUAF 2F4VJ 4MMOA 1SL0A 2H48B 1RT7B 1VIXA 4ZVFA 1BQNB 2DGTA 1PJ5A 3O44A 4ANCA 1G4CA 3PFEA 2K8GA 1T9TA 1NK8A 3M1VB 3D0GE 2AJFE 3Q24A 4FS1A 2HVZA 3CGIA 4NWBA 2J9DA 3R2DJ 4C8NA 1PJ6A 4CRJA 3M30A 4CTAB 2BW2A 2C2MB 2FHKA 3B54A 1UWBA 3KMQA 2FGOA 1SC4B 3S01A 2ZH6A 4WZMA 4X4PA 1TV6A 1TL7B 4FKYA 2AEMA 2XNRA 2BZ2A 2BA9A 2GHPA 3UO0A 3GIIA 5CCLA 1OWXA 2QA1A 3J81j 1B7YB 1AZSA 1RLDA 3TP2A 8ATCB 4LR9A 5GVQA 1VLOA 1RK8A 3I4HX 4ICLA 2ZVIA 1BD6A 4PEOA 2YKMB 3Q89A 2MKHA 4UUWA 3OHAA 2V6AA 3RGIA 2FUG9 2VFSA 3E01B 3BSAA 5AJ3J 2WK4A 5CAAA 5FDLA 1ACMB 1T9WA 1A9NB 1FWKA 3OJSA 3EVOA 1DTQA 3R5GA 4DR4F 2HPUA 3IWNC 3M7VA 4ES2A 4RUBA 3UCUP 2QG9B 4O44B 5KFCA 3VQSA 5EN1A 3GTYX 2WVEA 3DDIA 1VOMA 4E98A 1HW9A 4B3OA 3QJLA 2CUYA 2ZDOA 2F7VA 4ED0A 2XMTA 2KH9A 1U2CA 3DRPA 1BXNA 1H6KX 1K9MT 5MAOA 2UV8G 4GVBB 3VWSA 4G1PA 2YKOA 5CYQB 1FCAA 2IJRA 2HRTA 1C1BA 2QL7B 2DHAA 2MHEA 3I82A 4ID8A 3KLFA 4K50A 2QIFA 5J2PB 5T7LB 5DETA 3QGPA 4LRDA 4WFNQ 4HI1A 5L9XA 3CCRS 2KKHA 2RILA 4CLKA 4QIGA 2UP1A 2CA9A 3Q8QB 1FJCA 1CC7A 1WEYA 2BJ9A 1XR5A 1SL2A 4RJVA 5DS7A 2RQ4A 2VQFF 2CZ4A 2UUCF 3W2WB 3HFKA 3EDRB 3L3CA 1X0FA 2PFFB 2X7IA 5D3GA 2CQ2A 2UUWA 2D9OA 5C7PA 1RTIA 2ZBCA 3TUPA 4WFYA 1X9MA 2CQ0A 5KFRA 1C0TA 1F3VA 4RR5A 3D6TB 1H0HB 2GGPB 3GU0A 1WC0A 3MM8A 1AUDA 2CZ9A 1MU2B 1KRPA 1NSQA 2I8EA 3P49B 1F5BA 3DRRB 1UVIA 4LFBF 2XG8A 2Z58B 3DOMB 5CYJA 5HQMA 4FP9A 1RT4A 1UZHA 4FBUA 2H4WB 3KG0A 4OX9F 4DR6J 1Q5VA 5HL7Q 3W1YC 4UQTA 2PC6A 3D3BJ 2M3DA 1H98A 1IN0A 1VMBA 4WE1A 5B0AA 1KFDA 2XBPA 2M5YA 4TU8A 3C15A 1RP5A 4O3NA 1PJ7A 1QSSA 3PKYA 1ELOA 2DIVA 2GW8A 3IAS9 1DHMA 1YBTA 3NKYA 3EZOA 4WTYA 4ZLLA 2C2ZB 4FXDA 2C3PA 2NSCA 2ROPA 1KQGB 2DHHA 1KDNA 5CYMB 2VC1A 4KKOA 1WHWA 4HL9A 4C98A 3ZC4A 3BQ0A 4USHA 1SIZA 3P8BB 1IKVB 1SJQA 1LW0A 5GMEA 3WZ0A 3P96A 2F1FA 1IM4A 2R8IA 2Y0BB 1FRMA 1JQGA 2VKRA 3MPYA 2NLWA 2ZJPQ 1S1XB 1I3OB 3WHIA 2H9ZA 2YKAA 1B0PA 2SXLA 2R8KA 4IG3B 3QWUA 4NASA 2KDOA 3R1HA 5EWFA 1BMQB 4N5SA 1FEHA 2DNPA 1M5HA 1U4BA 4ZLPA 2VQFJ 2UUCJ 3W64A 1B0TA 4IRDA 2V0NA 1FJGF 2NYHA 2FC8A 5D0GA 4P75A 3ZO7A 1NNDA 1T03A 3QGHA 3CDAA 4ZVSB 1VJWA 4NI2A 4A8QA 3DRYA 3SSQA 4DL3A 3IO1A 3C16A 2W9CA 4Q8EA 3M2RB 1FE4A 2FLOA 3CCUS 4X4TA 2BJ3A 3T1HF 4OHXA 3IFEA 1GEHA 4HYKA 2YNFB 2JZ5A 2I6WA 4OJ1A 2OKQA 1FDBA 3LF0A 4LFBJ 5CCMA 5BR8F 2EFQA 3AD8C 1KSPA 4I0WA 3I96A 1TU0B 1VQNS 1T8EA 4OX9J 2QZ8A 4DL4A 3CCTA 4MYUA 1TKZA 3EVWA 4CNYA 1RQ0A 1BQMB 2RRNA 2VUGA 1HFEL 3HHEA 4NEZA 3J81U 4DV4F 3VVTA 4RL1A 1WF0A 3EGNA 5E41A 1UJ6A 5C25A 1ZZFA 3C14A 2V8PA 3LWMA 4ECQA 4ER8A 4JI6J 3M05A 2BKOA 4RW9A 5ETMA 3MOJB 1K44A 4OI0A 2FC9A 9ATCB 3FVYA 2AMCB 4HH1A 5KFGA 5HK4A 2VFTA 2HRUA 2HMIA 3P4UB 4F26A 1VC5A 4X4QA 1HL6A 4MT1A 2E7WA 2VU5A 4KGZB 1HWLA 3NAIA 2A6OA 2PMZD 3MECB 3ILLA 4OJHA 3VGVA 3PFOA 3HVAA 1S72S 3Q0AA 3C66A 5LM7E 4M5NA 3M32B 2J0SD 5JXSA 2KO1A 1O6XA 4R0EA 2CIMA 2KM8C 3KK1A 2ATCB 4J37A 1UVNA 2G13A 4KTQA 3T9ZA 1FE0A 1IKWB 4OZJA 2AQ4A 4DWIA 2KXFA 5BYQA 3PIPQ 3D5MA 2OFGX 2VD3A 4GKKJ 1IM6A 1WJ9A 3BN4A 3DXBA 3KLIA 1LWEB 2G9OA 3CJ0A 1LWFA 1CJVB 5IOLA 2JJ4D 2BE2B 2BKPA 2B4OA 2CPYA 3PY8A 2IM3A 4WKRA 1ZM4A 2DPJA 5I4MA 4QWCA 1EQ0A 3RB4A 4CLZA 3J81Y 4DS4A 2ASJA 3QAUA 1L3UA 2I2YA 5C42A 4DLGA 4PRFA 5KFMA 4DV4J 4OI6A 4C3LA 4ZJQA 2ZD1B 1AT1B 1JMTA 2HW3A 2XZWA 3CCQS 3JQMA 3W65A 3PRDA 3HVRA 3QIDA 3UPFA 1C2PA 5I3QA 1N5YB 3PTWA 1OIAA 2RRAA 4BDPA 4A4JA 3BH6B 2E9RX 3R27A 1MWYA 3T5HA 3M30B 3SXLA 1RTDA 1N48A 5A6PA 1V5IB 1UWBB 1X4EA 3AY0A 4OIXA 2QYCA 3H5UA 4QYRA 2XSFA 2HQDA 2I5JB 1JXEA 5THWA 3QIPA 4U8YA 2IRXA 1CJKA 3LH2S 1SC1B 5JVHQ 2QA4G 4ID5A 1DFDA 4WBFA 4N47A 5D4PA 4KHMA 2NZCA 3FKBA 2O3DA 1RTJA 2DRBA 3ILOA 2CNNB 1Q5YA 3LPEA 2EI5A 1M90T 1M1HA 3CIZA 3P45B 2CNLB 5HAOA 5FDLB 2YY3A 5DQHA 5KAKA 5GAGI 3KNAA 1LKZA 3I4PA 1S76D 3CJ5A 1DTQB 4IH7A 1I51B 4E2FB 3KWMA 4OJ3A 2YX4A 3OPKA 3C6TA 2BANA 3G6ES 5C5JA 1TL1A 4B3OB 3MPUB 2PFDA 3PW2A 2B7CB 1PYOB 3ETOA 1REGX 2IRUA 4LSZB 2DTJA 4WIIA 4NZ7A 3TYTA 3IA0A 1W2IA 2APOA 4LT6A 3VGSA 1IR0A 3KLFB 3P6YC 3FEZA 5DGAA 1DQ9A 1VDHA 1RAJA 3GPAA 3UN5A 5KT3A 3RW6A 4RBUA 5D0RA 1RTHB 2B8QA 3H25A 1VQ6S 4A48A 2RU9A 4FZVA 4TLRA 3W9JA 2X3GA 1QLNA 4IRCA 4DSIA 2QJ3A 4A8SA 1IWGA 2A2CA 1T3NA 5D3GB 2XHWA 3R9LA 1FNOA 4S0MA 1APSA 2XGQA 3MM9B 3GIJA 2DXDA 3PEHA 3SV3A 1FKOA 1C0TB 2QLBB 4R5PA 3R5DA 1WUUA 4ECUA 3FBEA 2QFJA 5B0EA 2ZC3A 1X5OA 1UVMA 4PXEA 3GCWP 4F50A 3BEGB 1RHQB 5KFIA 1TMMA 3M6WA 1HBNA 2CPDA 4PABA 1NPKA 2R4FA 1RT4B 2QA2A 2HQ3A 1Q8BA 1WC1A 2YWGA 3Q8RB 3N4WA 2GQQA 4WE1B 5LSLA 2WOMA 4DF4A 2BJ8A 2JWNA 3BSOA 3BPSP 2ILZA 5F9LA 1JNZB 1AXQA 3AHPA 1JJ4A 4PAAA 4M5MA 4CO0A 1VQ4S 3ZZOA 4KKOB 3W5XA 1WORA 2CPFA 3A3PB 2UXBF 2ZC4A 4U7CA 2I38A 5EDWA 1LW0B 4MK9A 1D1UA 2V8VA 3VAIA 2YTCA 5A76A 3OXGA 2AEFA 4EWTA 1Y00A 1TK0A 4Y2AA 3T5JA 4OQJA 1EP4B 4QWBA 5H9FJ 1U25A 2B8PA 1T9YA 3AQPA 2ZVSA 1S97A 3FZ2A 2HGNA 4L73A 3VQTA 3R6GB 3J7Z5 1YDLA 3TA1A 4AYBD 3AJ1A 1YJ7A 2JFDA 5H9FK 3FRYA 2UU9J 4H4OB 2LKZA 3EPGA 1RHJB 3T5KA 4Q8FA 1DURA 1T03B 3AT1B 2LDYA 4NI2B 4MTPA 1RABB 1SKUB 3C16B 2BOPA 1IUJA 2W9CB 3O1LA 2L9WA 1WHYA 1RI7A 2VPXB 2XC9A 3ENAA 4O3OA 2H51B 3VAKA 5DM6Q 4X4OA 2FY8A 1FX2A 3UR3C 1E6YB 2D3ZA 1K8AT 2MQQA 2L9NA 2OEMA 1MW7A 4JV0A 3A13A 3A8IA 2Q79A 4ZVRB 2DR9A 1VRUB 2KFYA 2ZHAA 5E0OA 5HVHA 4FN5A 1YLXA 1S1TA 4O23A 2JFKA 4EBDA 5C25B 4QYZK 3DOLA 3KLGA 1HWUA 4OZNA 2RB7A 5HN0A 1WKJA 2PIIA 2LEBA 2V50A 3OUYA 1B3TA 5DQIA 2HMIB 2VG7A 3M8RA 1U48A 2FHOB 4DX6A 3H2VE 5IQ6A 1FRLA 2ZUAA 2HHWA 2ZH8A 4OYZA 3WDOA 3IR6B 3BJYA 4DG1B 3M2UA 5HLFA 4IG0A 4ED3A 4OJGA 2ASYA 5A8KA 2V68A 2M88A 4J9NA 1IKXB 2BKNA 3CCSS 2D3O1 1Y11A 4DR5F 2FQQB 4KGMA 8AT1B 2XLJA 1T0TV 1GMWA 1TAUA 3OHBA 2IIHA 3MMBA 2AF6A 4UOHA 3TAQA 4Z7CA 4LQ9A 3KK1B 4DSFA 3MGJA 4USMA 2XQCA 3MAAB 5IM0B 2ADBA 1VCTA 5D0EA 2R2SA 1N4LA 4Z37A 4JOUA 1PO6A 3EYZA 3GLJA 1KWMA 2DH8A 3KLIB 5D0HA 2F8EX 1S9EA 2VL1A 1VQLS 1LW2A 1LWFB 2W25A 2PT0A 1WDTA 4JV5F 2JOQA 5KG7A 1N34F 3HFVA 2GS8A 1SV5A 5CD4A 2MXYA 3GWCA 2E1PA 3NOGA 3VV2B 1FDAA 5E7OB 1DQAA 3N5FA 1PILA 4IH5A 1YBAA 1CLFA 2WONB 5K8OA 5C42B 2KHCA 3CXCR 2B0GA 1IBLF 1VJQA 2P9CA 1SCJB 4K0KF 3C19A 2WZ1A 4K2XA 1F9FA 2ZOMA 4DCJB 2EWHA 1HR0F 3GZ7A 1X4AA 2YH1A 3QQCD 3OLBA 3BYPA 2NPFA 3F0NA 4CLYA 1JLEA 4I7FB 1VK3A 2D3UA 2HS4A 1X4FA 2AT1B 4G1QA 3QATA 3M2VA 1RTDB 2LFVA 3V6DA 2MKCA 3B82A 1VQ8S 4OV1A 4CLSA 4K4SA 5IZHA 2XYHB 4EO6A 3EXCX 4DUYJ 4O4GA 1Q7YT 2YPYA 3DLEB 4M5DA 4DR5J 3ET6B 2QE5A 4OLOA 2RVJA 2Z2ZA 1X60A 1U0HA 1U1KA 5D78A 1WWHA 3SQOP 2CADA 2XB2D 4NA2A 2XLKA 2B6AA 1JWWA 4H4MB 2MY7A 1MNEA 2I9SA 2CQDA 3BYRA 1YRTA 3UN3A 1WF1A 4OX8A 4RW8A 2OTLS 1QVFR 3C6TB 4G6VB 3NGRA 2BANB 4CH1A 2K06A 1EHWA 1Y10A 1QDUB 2V34A 5IC6B 2QFIA 1AYEA 2YNHA 2BR0A 3RAXA 2VHGA 1OJ4A 1N34J 3R7BB 1HNZJ 3H5XA 3TI0A 3MD1A 2XNQA 1RWWB 2B43A 4UZBA 1VBZA 3OT9A 4OYMA 2EFPA 1IBLJ 3HXMA 4N76A 2J76E 3K89A 3CJRA 4RUHA 4K0KJ 2AP6A 4FXVA 5GAEU 5E3CA 4UY85 5IXUA 3RG6A 4H4KC 2PA3A 5HBMA 1HR0J 3V4IB 3BV8A 4TVAB 3OV7A 1GTHA 3UE2A 4CIOA 1AUSL 4LF8F 1N52B 5CHCB 4DQSA 3BGRA 1NRKA 1A0OB 4RW6A 3UDEA 1FK9B 2DIUA 3DLGA 3QO9A 4RU2A 1WC6A 3SEOA 1D9DA 1B7FA 2XCAA 2RRBA 4ZVQB 4DSEA 4DX7A 2WHOA 3S1TA 3HHLC 4R5PB 1I1GA 5LL6d 4KGVB 2OELA 4YB1P 3DI6A 4NCBA 2DEIA 2G0CA 4DL6A 3W61A 5DDRC 3QRQA 2ZWPA 2B7BB 1HBNB 2ZM6F 4NLYA 3TAMB 1UVJA 2WB4A 3IMQJ 2YQ3A 1T9UA 2LEPA 3SQGA 3JTNA 1CS4A 3G82A 3E2EA 3IRWP 3RJMB 3MAQA 3EPIA 5L1IA 1EARA 4FBTA 1W26A 1RTZA 4Q2MA 3A4TA 3DRSA 4HEA9 3AODA 1AFIA 2LA6A 2GJ2A 3TQ1A 2FHJA 2K7JA 3ENWA 1SVDA 4CT9A 4ITSA 3H0PA 2NXJA 1XTZA 2DNHA 4TYBA 2P6SA 3KG4A 2DR8A 3DC2A 1U1PA 4WYWA 3HKZD 2KN4A 4ZP6A 2HHXA 5D8HB 2UVRA 1YJTA 2HZAA 1VR6A 4TQSA 4C0HA 2R8HA 2ZNYA 3PX6A 3K17A 4K4WA 3DU6A 4G65A 4QWDA 2FJBB 2Q43A 3PJWA 1VQKS 4M5IA 3V6HA 3M8ZA 3KNGA 1RZMA 3OTOF 2POKA 4F4WA 1PC4A 1VBKA 1PYTA 4B9LA 3IN5A 1AA1B 4CLWA 2NUUG 2P6TA 4RX6A 2AJQA 2FDNA 3AB4B 2V8GA 1HW8A 3LUYA 2D74B 1MWZA 4I64A 5DG9A 3J7AN 1TZ0A 4EBEA 3IR7B 3LAMA 3K8WA 1REVA 1HYSA 4XIUA 4CYUB 1R7IA 2IHR1 3VHQA 1L3KA 1HQUA 3UDVA 3CCVS 1D09B 1KVKA 3JYTB 3UWTA 3QNWB 2ZM6J 3D66A 4U95A 3DYAA 2LXIA 2OPPA 3VTIA 1UL3A 4URQU 5F8MA 2V4RA 2C2OB 2DITA 1WSVA 2D9PA 4IYQA 4ZN3A 3LA0A 4C48A 2D69A 2XHCA 2XI2A 2FJDB 4H4KA 3G6VA 4EI2A 1JJCB 1RT5A 3W9HA 5KFTA 2CAJA 3AXMA 1S1TB 2L08A 2R7VA 1FXDA 4XDCA 2CPZA 4BC9A 3DOLB 3PX4A 3KLGB 1YG0A 4ZN1A 4DJBA 2AYMA 4KHPF 3WBZA 1GT8A 3MEGA 1TP7A 3BKTA 4PUOA 1TL5A 4KT0C 1EETA 2ZWOA 2NQPA 3OUYB 5KT5A 2D7SA 4K5RA 2HAFA 1IBKF 2VPZB 5DDQC 2JDJA 3PEJA 4YN3B 2ZOGA 3AFGA 3M2UB 3B6BA 5HLFB 4LMZA 2BRKA 4IG0B 3N6LA 1H7WA 5A8KB 1XWLA 2C2EA 5J2NB 2LECA 3SZ2A 3OTOJ 3GYGA 1FD8A 1HNWJ 2MLYA 2OTJS 1VBYA 4RBVA 3GIMA 5LOQA 1RT6B 1V9OA 3MMBB 2XS5A 4NXMF 2Q66A 3ISNC 4ZPBA 1BWEA 4DR2J 2JSXA 5KFHA 4CLLA 1ZTTA 2FZCB 2P8IA 2Y1IA 4HDGA 2C3MA 4CH7A 1NDLA 3GV8B 1KOOA 4K4ZA 4TKTA 2VA3A 1N5SA 4ZCMA 3UFCX 2PI4A 1NPRA 3TUIC 3GONA 2VIHA 3HHKA 2BABA 4LR7A 1S9EB 2E7XA 3ZNJ1 5IS2A 2E5LF 1P27B 2JRSA 2YBVA 3N79A 1RT1A 1SV5B 5FJ4A 3Q8VA 2RKIA 3J7YU 1R8BA 4WK1A 2GJIA 4IO9Q 4X65F 3O3LA 4FNIA 2IVYA 3CMQA 2VBXA 3H5YA 1Q95G 2BJDA 4I67A 4K7QA 4AT1B 3ZZYA 1TL3B 3S6EA 2IBKA 3UD5A 4EMDA 3Q8SB 3NXZA 2FD2A 1NSPA 4ZS6A 2ASLA 4ZLJA 3PG9A 3HDSA 1VRTA 5HQ8A 3OR1B 1RBOB 3IRXA 3MXHP 1KHVA 5IT9U 3AD7C 4TY8B 4ZVGA 1R31A 1DBDA 2HIYA 2AJ1A 1H2TZ 2EW9A 2RJZA 4F4AA 3GFHA 4G1QB 4NLGA 3I5AA 3M2VB 2ZHBA 2CWXA 2VH7A 2AGQA 1D9AA 2P2CB 3E51A 2QMUB 2QTWA 1WOOA 3HVTA 6FDRA 3ENVA 3FFIA 4O4GB 3QPIA 3AA8A 4M5DB 1PC5A 4LVOP 3JAMU 4MKYA 2AYGA 5KFSA 3DXSX 3SBMA 5KT2A 3U1LA 3L7OA 3EE3A 3X1LB 1RT3A 5KOWA 4NXMJ 1RWMB 2HEKA 2N7YA 2WCXA 1P8GA 2OGUA 2CQ1A 2FVQA 2L9DA 3OVAA 1IWAA 3CJSA 1OPIA 1NO8A 2RDIA 4JI7F 3PW7A 5KFZA 1UJ5A 1LWCB 4C11A 4RW8B 1JNRB 1KQSR 1RWOB 1M5OC 3IG1B 3K5OA 3MUVP 4F67A 1FTRA 2NXEA 2A3JA 1F60B 4FVCA 2E5LJ 2JVOA 3U1NA 4NLWA 3M8QB 1BQXA 3I0SA 3MR2A 1HPZA 5HP1B 1U24A 5EGYA 1AFJA 4GVLA 2JVRA 4JI2F 3CJ4A 1NJWA 4J9MA 4HT5A 4X65J 5L9NA 1OY8A 1S12A 1XEZA 4OX6A 4N7TA 1FRHA 3CIMA 2YKPA 1NDPA 1RT2B 3HHNB 4F2SA 1KR4A 2W2OP 4LF1A 5IT9Y 1S7HA 1WSRA 4F4YA 2Y1JA 5AXKA 3DM2A 5CA5A 4F4KA 1HQEA 2B9XA 1RADB 4CLUA 3NMRA 4DEZA 2VG5B 3B4MA 2MPUA 3DLGB 3T41A 3QO9B 2DR5A 1WHVA 3DRXA 1S9GB 1FVSA 1VQ7S 1D9FA 3N01A 4XAKA 3CSKA 3VF0B 5F8HA 2QRRA 2AZ1A 2MQOA 3KHRA 1B0VA 4M63A 4DX8H 2OJ3A 3MD3A 2IYGA 5F0UA 1S7IA 1SJRA 4HACA 1CS4B 3G82B 2R7SA 1IKYB 1UA0A 4EZ9A 2XY5A 1YTYA 1NUEA 3HSZA 1GX6A 1T11A 2KG1A 2HQIA 3PV8A 4JI7J 4F8RA 2ZBQA 4U96A 1X8DA 2HFZA 3CPWR 2RQCA 3VAHA 4ES1A 1U2FA 3MMCA 2RS2A 4LF7F 2ZDPA 4F0MA 5BXIA 1W25A 2DNOA 3LP0A 2HQCA 3CJTA 4ZVEA 3SV4A 4NCGA 3F41A 3PYGA 2W7PA 1ULRA 3K0JA 2PN6A 1Y9OA 2VPYB 1VQ5S 2MKYA 1M5KC 4X62F 3BSNA 2IJFA 3Q8YA 3K57A 3RU0A 1WELA 3FBBA 2RT3A 1HIYA 3NLCA 4UOGA 3SYZA 1SBRA 5CABA 2MQ8A 1AW0A 1FA0A 2XS2A 4AL7A 1J5EF 2DY1A 2HHHF 4I2QA 5DZ7A 1NBEB 3GIKA 2ZFHA 4TNOA 3AOAA 2IAJA 3V81A 3CC7S 2Z0GA 2F4FA 1YX2A 1REVB 4G1IA 2BQUA 2G2YA 1HYSB 4LF5F 2RD5C 3QJJA 2MJUA 5B0CA 1IR2A 4OL8A 1T94A 1SH0A 2HVIA 4CT8A 1XJWB 1DZ5A 4LREA 1UKUA 4GKJF 2OD4A 3KHHA 3BGFA 2GQCA 2A0FB 3DYAB 3QRRA 3EZUA 1F5CA 3HT0A 5E2QA 1VIOA 1R0AA 3TZXA 5IT4A 4C8YA 3W2VA 3LP1A 2PMWA 4P71A 5LT5A 1FRJA 2QSFA 1Y3JA 3KFWX 3W62A 2H5EA 2NSBA 3LALA 3AB2B 2ZZMA 5KG0A 1RT5B 4YR3A 5J2MA 3T1AA 2WTFA 4NPOA 3US5A 4QIEA 2ERRA 3HK2A 2GNKA 3ENQA 2FGCA 3UD4P 2BUNA 3RBZA 5HMWA 1X5TA 1N33F 3DNCA 2RSQA 3OD2A 3LOUA 3MEGB 4DV7J 4PUOB 1EETB 3DN9A 3QAEA 1RBLA 3KLVA 1VLYA 2V67A 2DO0A 2X1GA 1S48A 3NWRA 2X51A 1KVJA 3KJQB 3FQKA 4ZIVA 3GJTB 4L74A 4JB8B 4WKYA 2FVPA 3G9CA 3AAWB 4C8KA 3K59A 5ETOA 1U47A 3KJVA 3BBFA 4V1Ak 3GIRA 4ZCKA 1J5EJ 2HHHJ 2LU2A 4KSEB 4DQRA 3JXOA 3VAMA 4ZPTR 4OMFG 3F73A 1UWAA 1Q86T 3L95X 1QM9A 2XWXA 4HLBA 1Q1KA 4GC7A 3ZNUA 4JP8A 1DLOB 3PJ9A 3PJXA 4A8KA 2PSZA 2K1RA 5D4LA 3W9IA 1RKJA 3CJ8A 2C1EB 1PBUA 4GKJJ 3N5BA 1NSKL 2Z57B 3D1OA 2PO4A 1RWUA 5E3QA 4O3PA 1EKSA 1RT1B 1CULB 1C4CA 2M8HA 5CZXA 1KTVA 3PM9A 1T95A 2RKIB 2HFSA 5A8WB 1XNQF 5GAEI 2VJVA 5EX3A 2Z56B 1NK5A 1HBOA 4M5GA 1GMWD 4X64J 4TYAA 4YB7A 3R5BA 1FRIA 4WYLA 5DG8A 4X4RA 2IVMA 2GZOA 5KFJA 2XGPA 3RR7A 3GCXP 4Q43A 4ERDA 1U1QA 3NGUA 1BUXA 1VRTB 3HD2A 4HI2A 2QT7A 4IKAA 1S49A 4ED6A 4O3RA 3IRXB 4DU8A 5AE3A 1X9SA 1RWNB 2GA7A 3T5LA 1Q82T 4CO1A 3M6UA 1XBWA 1CBKA 1NDKA 3NCPA 1B99A 4I6AA 1XMOF 3L09A 2ACMA 2OPSB 2ATLA 4OFZA 3HO1A 1TVRA 4PCQA 1OS5A 1S1VB 3V6KA 4WXOA 1N88A 2HWHA 1RA7A 2MYFA 2JX2A 2PGCA 2BM0A 4A8OA 3UD3P 3QT6A 4ZLNA 3TEGA 4PXCA 4P52A 1FWLA 1RAAB 3GMGA 3BDEA 4J9PA 3KK2A 1KHWA 4RU9A 2BXJA 2CQ4A 4J5OA 3CDWA 3HZGA 4B02A 1RACB 1KP6A 4Y65A 3HKWA 3OSNA 3VR1A 5FD1A 1XNRF 1LFPA 1K47A 3BBBA 3EGWB 2C28A 5C24B 4B9UA 2KU7A 5T14A 5T41A 1YJRA 3I0SB 1MROA 5EWGA 1PG5B 1HPZB 3ULHA 2JEIA 3IP0A 1HI0P 3BKUA 4DXLA 1IJFB 5CXTA 3SMZA 1NLKL 1XNQJ 2MHNA 1JLBB 2BYCA 4GRSA 4ED5A 3UDLA 2UZAA 4AL6A 3MR3A 4JI4F 1RKIA 3D67A 1OMSA 3G71S 1FKAF 4ZVPB 3M9NB 4LRFA 3DM2B 3KUEA 2HFNA 4CZCA 1FI4A 1HQEB 1LEOA 3HF5A 4KV8B 3DHWC 3N9UC 1FESA 1QD1A 1WEXA 5A0YB 2HK2A 5L38A 3W7BA 1S1UA 4PYAA 5D77A 1OY9A 3TUJC 2MDAA 3SSSA 5F41A 1XMOJ 4ATNA 3SCKE 3TO8A 4P2MA 1VRQC 4KHRA 2GO8A 2E1AA 2NXUA 4Q0BA 2ZH9A 3NS7B 1M5PC 4ENOA 2LYVA 3UQSA 2OHDA 1DTTA 4A46A 1SQEA 2VOPA 4GO7X 4NOHA 1TK8A 4HACB 1NZ8A 1F6TA 1U26A 2GVDA 3NOCA 5KFVA 2DYAA 1JLGB 1C0UA 2XS7A 5HMZA 1ZM3A 1HNVB 3VVUA 1FWPA 4MIBA 3H40A 3NBPA 4X84A 2JEGA 2V94A 5HO4A 3CULA 5JUMA 3MUMP 1IXKA 1JX4A 1NK0A 2G1DA 4W98A 1XNRJ 5GADU 1ZBTA 4M5LA 3OL9A 1FD2A 3TVZA 2PE8A 3MMCB 1QTNB 4M5JA 3HSJA 3LWLA 4DPTA 1UFLA 1KFSA 1RWKB 4IOBA 1VHFA 3MOZA 2AW0A 4GMKA 3JSMA 2QA4S 1ZPWX 4Y3CA 2C22A 1ZM9A 4ALZA 2LXFA 5L1KA 2R7UA 4NLOA 1JKHA 3ZTOA 2VFRA 1N32F 2BBEA 3BR8A 2YNGA 4LVNP 5BYRA 2PD1A 3VCDA 1RA6A 3RB6A 5A2QU 2YKNA 1E6VA 3OJUA 4F4ZA 2B3TB 1RWVB 4ED4A 3MR5A 3PNIA 1W2BR 4XDDA 2RQKA 1NKCA 3WX4A 2Y3YA 3MZIA 1SJ1A 2AGPA 1TAQA 3ILIA 1H2VZ 2ZE2B 2KT5A 4QIWD 1L3VA 2YX7A 2V2KA 4I2QB 3HFZB 4YUDA 3BO4A 4HHHA 1Z2LA 4RKUC 2IA0A 2FHJD 2UUAJ 2IAJB 1T05B 4QZVB 3PW0A 1R0BG 2KYXA 3NWGA 4KGXB 4CM0A 2W7AA 1YJNS 1T9XA 2Q6BA 2XY6A 4DU7A 1IBMF 3BREA 1PAEX 5L46A 2RQMA 3JB9k 3P3DA 2IMOA 4AFFA 1KC8T 1TKDA 4BWMA 3PVXA 3FDSA 3ITHA 4K4YA 2HG4A 2Y1RI 4LRBA 3J7YI 1K73T 4DCOB 4EGLA 1TMJA 4J9SA 2IDEA 3K7RA 1Q53A 1JLQA 4DV6F 3I5BA 1UW9A 2IRYA 1BHNA 5K14B 3C6UB 4XPEA 2J6UA 1FF2A 3CF5Q 1FVQA 3FRZA 2OPRA 3ISZA 5J2MB 3UCZP 1ICEB 2AHOB 2H5IB 4LBHA 4QR1A 5HROB 2O66A 4WZQA 4KFBA 2COLA 2C3OA 4QBUA 2HGMA 3GR0A 1NU4A 4NMXA 5L1LA 3QMQA 4AQYF 4DR4J 1O5JA 3PDNA 3FBFA 1SI9A 4C8ZA 2DNGA 2VG6A 3POTB 1T7PA 5IFMA 1FT8A 4I68A 4PQUA 3KG1A 3IM9A 3I5CA 2AJ2A 3KJVB 4EUVA 5B08A 3BB5A 2VFUA 1TUGB 4DI6A 4NZ6A 1CPZA 3QGGA 5KFKA 4O0IA 5A8RA 3BS9A 4A8MP 5ETKA 4DL7A 2AJ0A 2CJBA 3EM1A 4D3GA 2EFGA 1S4EA 3LP2B 4KH0B 3O5TB 3R97A 4USKA 3RRGA 4C6AA 4B3TF 1LWXA 2VODA 4I2PB 2K1RB 5E3RA 3I55S 1IBMJ 1N56A 4NLUA 4CM2A 4ANDA 1FNMA 3TX8A 3MM6B 2W8KA 4FDFA 1NJIT 2GV1A 1XIQA 4F0KA 1KN6A 3NS6A 2FHMA 1Y3KA 3NAHA 1FX4A 4RNMA 4TU9A 2FLNA 3OTDA 2H5JB 3MM5B 3U7JA 2IC3A 2HFVA 4URGA 1YIJS 5K8PA 4NMLA 3LPYA 1Y5IB 2VFVA 4DN0A 3UR0A 1X9WA 1LK7A 5D4NA 4WTOB 2HS3A 1NM2A 4UOCA 5F8JA 4KPCA 1PAUB 2MZJA 4HTJA 3FCVA 1G2EA 1ZPVA 4Q44A 4QW8A 1HHQA 4TXSA 1RAGB 4FF4A 4AQYJ 4ZPDA 1RT7A 1IQZA 3THVA 1Q4RA 1BQNA 2F63A 1WDDA 2DGQA 5DDPC 1SPBP 3NEKA 2OI2A 3PW4A 2XMVA 5DG7A 4ZHRB 2LQJA 3EGZA 1UVKA 1TVRB 2HHVA 3TJ9A 1NPPA 2KRBA 5I3UA 4CTAA 2C2RA 2FJXA 3QT7A 2Q1LA 2KRRA 3NMAA 4F36A 1TL7A 3TW0A 5L39A 3PR4A 3A8KA 4J90A 2Y8YA 1VC6A 3H98A 3V2UC 3BQ1A 2B4VA 3CCWA 4Z2XA 2RF2A 4ETZA 3KK2B 3HD1A 1UEKA 4NLTA 2JC1A 5FIIA 1VQOS 1PIEA 2M2BA 4I56A 2HHQA 4B3TJ 2YKMA 3GYXB 1QE1A 3R1LA 1G3OA 4LF6F 3E01A 4DQPA 1JB0C 1R3NA 3OXFA 4DZDA 1NKBA 2GFFA 1FJGJ 2FJWA 2NREA 3GJSB 1MROB 3PRBA 4EU0A 3M8WA 1OSDA 3MEDA 2BE7D 4J91A 2W1BA 2HSEB 1FRKA 1FJEB 3T1HJ 2FPHX 3BBCA 4J9RA 1TTHB 3RTVA 5ITHA 4UUXA 2Y0SD 1ZETA 5BR8J 2R9LA 3I56S 2LQ8A 4KO0A 3K58A 3VAJA 4GVBA 2O01C 4LIRA 1EX8A 1RYRA 5CYQA 4UQGA 3SCJE 2UVWA 4ZP9A 4ELTA 2ZKTA 5AXLA 3TANA 6FD1A 3VAGA 2A1BA 3D28A 4ZMMA 3HJFA 4HH0A 1DARA 1VQ9S 4EYHB 2G2ZA 1S1UB 5B0BA 2WW4A 3RR8A 1G7CB 4DSKA 1ZTWA 3OR2A 4B3SF 2LQ5A 2UXDF 2X1AA 2M70A 1FKPA 2J6TA 3U27A 3MEKA 5EHHA 1M0SA 4X4VA 1DTTB 2DR7A 3R6LB 1ZAWA 2CPEA 4DV1F 2VASA 2KZMA 2LCWA 3BN7A 1NJXA 4XTTA 5LMUF 3N0VA 4DCPB 1TV6B 1MU2A 2CPIA 4URSA 1VYAA 1HI1A 1TKXA 2IYIA 3NG8A 4A8WA 4OI1A 1AZSB 3NBPB 3DOMA 3CC2S 5RUBA 1NB7A 2GAHC 1WC4A 3VALA 1WNEA 1V3SA 4LF6J 2J7KA 2OAUA 4ICLB 3P5BP 4QWEA 3E3XA 3IGVA 4Y6IA 2KXNB 4P73A 3MPDA 2OMOA 1NCLA 2L3MA 4H54A 1DQ8A 2ZITA 3JSMB 3AD9C 1A6LA 5GAGU 4FS2A 2HVHA 5KFBA 2MB0B 2KXHA 2R7RA 2HLTA 1JJ2R 2RS8A 4USUA 3TX0A 4Q5VA 3CTRA 2HZVA 1IJEB 3M8YA 2CJQA 1NK4A 2AYBA 2YNGB 2N7CA 1H3DA 2RMLA 1WI8A 2V69A 2YKNB 1E6VB 2HZCA 2GJFA 5B0DA 3MM7A 1IKVA 5IV4A 2CVIA 3DRPB 3J80U 2BE9B 2EBEA 2C2KB 2ZH3A 3FK4A 3D68A 2NXCA 3I32A 3BGUA 4TU7A 4YB6A 1C1BB 3I0RA 1S1XA 2G4BA 3H5SA 4C3MA 4L3NA 4CLPA 4QPXA 1RSCA 3DCAA 4B3SJ 2XMMA 5HMXA 2CG8A 2UXDJ 2MQLA 1YI2S 3KDOA 1WG4A 1O51A 4KB7A 4ILMA 4C9DA 3PHEA 4OYOA 2HHPA 5KFEA 3TUZC 4DV1J 3ITHB 2GIRA 2N4DA 1K1QA 1V5VA 1RTIB 2Q6CA 3IC1A 3H4DA 1B70B 5LMUJ 3FBCA 1P6TA 2EFOA 2DCLA 2YNFA 1JLQB 5F8IA 1FERA 1TUWA 3MF5A 2FY1A 3HZEA 4CLFA 3MM8B 4ILLA 4ZVTB 1LXJA 2HBYB 2OUGA 2CJAA 4DF8A 1EIYB 4DPOA 4MK7A 3LGHA 1M1GA 4M8LA 3HVWA 1X0PA 3EICA 2EXUA 5KOXA 3G6XA 2WSFC 1YRUA 1NDCA 2E9TA 4PG6A 4M5HA 4MJKA 4BBYA 3R3TA 1Y5LB 2A18A 3ICLA 2IVFB 1I5OB 1U45A 2AWZA 2KHDA 4OZ5A 2EFVA 5CD4H 1HBMA 4LFCF 3C15B 1RAOA 3PO4A 4CO3A 1LFWA 4C8OA 4PQAA 2VG6B 2MKJA 2PI5A 3OXLA 4ZVOB 2VDIA 4ELUA 3TA2A 4MYTA 2EKYA 4TLQA 1RWXB 3CD6S 1NAQA 4YOEA 2UVVA 1EQMA 5KFUA 3IWXA 1WTFA 2H65B 4PQUB 1WACA 1RAHB 3MDFA 3PRVA 1YJWS 3Q8PB 4K4UA 2KT2A 1ZOTA 2E7VA 4KC5A 5MLCV 1KOHA 4ZP8A 2MQPA 4ED2A 3AXKA 5GMKa 2J9DE 3DLHA 4P2FA 3IAM9 2OD6A 2QO3A 1HD1A 4HTIA 3GV7B 4V19X 3RB0A 4PXDA 3IBFB 1VISA 4NX9A 5GAHU 4P2SA 2MY8A 1GXTA 2DRAA 2CVEA 4W4MA 1Q79A 4M94A 4NZ0A 3PR5B 5H1SV 2CNOB 4U7UK 3GFXA 2F9JA 4AXIA 2IM2A 2JLGA 4W92B 2DEJA 4WFAQ 4CP5A 2MSTA 3CT9A 4MIWA 2CZVC 1U1NA 1HQ2A 1CJVA 3R5JB 3D9BA 4ZPAA 2LDIA 3CC4S 1H74A 4YR2A 1MG7A 2BE2A 2HNYA 2NS1B 1U2RA 4ZK7M 2EK6A 1N36F 4QU7A 2D3OR 3FC9A 1R89A 1CG2A 1SH2A 2HLUA 1TKZB 4O0NA 1X4GA 1S0NA 5B0FA 4IFYA 3FJ2A 3GR1A 2UXCF 5DQGA 4WCEQ 4F3OA 1Y0HA 1NK6A 2AZ3A 2ZD1A 4KIAA 1Q0NA 2CPXA 1RHKB 5J1NA 2DGOA 4JBCA 5IWAF 1OQ6A 4DMZA 3GYNA 2KG0A 4XO0A 4AE5A 2M8DB 2ZKUA 3C14B 1N5YA 2J7WA 2ZH2A 4J9KA 2BOAA 2DD8S 3QWPA 1P1TA 4RW9B 2XZTB 1UMJA 5I3UB 4IRKA 2UXBJ 3ZTSA 2PEBA 1VHIA 2JL9A 1CVJA 1DJ0A 4KY3A 3TA0A 3TQEA 3G6YA 3HX9A 4FYYB 2I5JA 3TJ8A 2FTRA 2Y1LB 2KFNA 2RDDA 3IBWA 2OEJA 3OLAA 1HKAA 1PBAA 5DJBA 3FMWA 3OFHA 3M6XA 2RF2B 2V4JA 5GADI 5BYSA 3KLHA 4JI5F 1G6BA 3Q83A 1UP1A 4DR7F 3MI7X 4DPWA 2KL8A 2HIQA 1QE1B 1EKRA 5KT7A 2YH0A 5J2QA 4DR6F 2OP5A 2DHGA 2XYPB 3LGMA 4EEYA 4DUTA 4OHZA 3CO0P 1XR7A 1N8RT 4HVZA 4PG4A 4NA3A 3GG1A 3MEDB 4X2BA 3FQLA 2LLZA 4EYIB 6AT1B 4KBIA 1UPMB 5DZ6A 3H2UB 4FNHA 3NS5A 4QIVA 1QSLA 1LXNA 2A2DA 4KO0B 1VI7A 4P2XA 4UOFA 4M5KA 3K2YA 1N36J 3VAFA 4LF4F 4I6WA 3NGSA 4C97A 1NJZA 2C3UA 2HKEA 3SCIE 4QW9A 5JMNA 5B0GA 3T6JA 2UXCJ 2H4YB 2GIFA 4RNHA 3G86A 5HSPA 4ECYA 2XI3A 4DDFA 4USIA 3MWBA 3G87A 1RTHA 2XZDB 2FZGB 5ETPA 3AJ2A 1KLMA 3GSIA 5IWAJ 1C4AA 3OR2B 4I6YA 4NLDA 4C4WA 2DKOB 1FKPB 4UT4A 2E5JA 4DZ6A 3K5NA 3NCQA 1KD1T 3BM7A 3V6JA 4DR1F 1GAOA 1DRZA 3CMAS 4M1KA 3MM9A 1RAIB 1XMBA 1UTAA 5K8NA 4BWJA 1KS2A 1Z4UA 2CYYA 4AXJA 1MSWD 1KKHA 3MHYA 1HNIA 1YZ7A 4IUFA 1OSCA 4LSNA 3AA9A 4QQBA 3QIPB 1TKXB 2E44A 2WB1D 4JI5J 3RYLA 1CJKB 4OZLA 2A6MA 3GJRB 4DR7J 4LRCA 4C7QA 5J1PA 4ID5B 2NYIA 2F8HA 4F4XA 1D3WA 1RGVA 2BJ7A 4DSLA 3QZ7A 2ALYB 1RTJB 1PYSB 2AD9A 2W2MP 1I94F 2JH3A 3CMES 1RAEB 4P7VA 4ETXA 5AXNA 1MMDA 2L41A 2W24A 1JLFA 2E1RA 3WIUA 1DY3A 2BM1A 1CJTA 4L6V3 3ELHA 5KT4A 3LO3A 3NNHA 5KFLA 2Z2LA 2CWKA 4NE9C 4UTGA 4JI6F 1TL1B 2DR6A 4LJMA 5KFWA 4UF4A 1L5UA 1YJVA 2HURA 2W7OA 4LF4J 4JV5J 3MM7B 1PGZA 4NLRA 2V9KA 1F9EB 2JHEA 1IQTA 2ZBIA 3PO5A 4XPCA 4IR9A 1EP4A
chains in the Genus database with same CATH topology
1NK5A 2KT3A 1HBNA 2DNLA 4IR1A 1HBOA 2CPDA 4PWDA 4RBTA 1NHVA 3D1QA 3CJ3A 4M95A 2R4FA 1MMLA 4IFVA 2MKKA 3I0RB 2NPIA 1RT4B 4TYAA 3NNAA 4ZVHA 4YB7A 1UFWA 1YWXA 2XMKA 3M4XA 3R5BA 2QA2A 1FRIA 4WYLA 5DG8A 4X4RA 2IVMA 2HQ3A 1Q8BA 2YWGA 3Q8RB 3N4WA 3EZ5A 3T3FA 5KFJA 1QJHA 2XGPA 3RR7A 2YKQA 2GQQA 4WE1B 5LSLA 2WOMA 2HWTA 4BC7A 4DF4A 3F56A 4Q43A 1UVLA 2DHSA 4OHYA 4ERDA 5EX0A 1U1QA 2JWNA 1L3SA 1VRTB 3BSOA 2ZJRQ 4HI2A 3F44A 2QT7A 4IKAA 1S49A 2ILZA 4ED6A 2KM8B 4H4OA 3IRXB 5AE3A 1X9SA 5F9LA 4O3RA 1JNZB 5KFFA 1AXQA 1SXLA 2RE1A 1I6JA 2GA7A 1N0VC 1O0PA 5C24A 3T5LA 1U09A 5IQQA 3AHPA 1Q82T 1BY9A 4CO1A 1JJ4A 2HHUA 1XN9A 3M6UA 3HHLD 1XBWA 1U6BA 5F8NA 3NCPA 3DMJA 4ECSA 1P9QC 4I6AA 1WTBA 4CO0A 1VQ4S 3ZZOA 1GNKA 3DU5A 1XMOF 4JUZA 3L09A 4KKOB 5BJRA 5DLGA 5E3AA 2OPSB 2ATLA 4OFZA 4J9QA 3HO1A 1FKOB 2CPFA 4BS2A 4O4RA 4B9NA 2GCFA 2C42A 2UXBF 1TVRA 4CNZA 3TAPA 2LA4A 2E29A 2L48A 2ZC4A 4X4NA 3CD5A 1SC6A 4PCQA 4GKKF 1JLBA 4U7CA 5F8LA 2I38A 5EDWA 1OS5A 1LW0B 1S79A 4HDHA 1S1VB 4MK9A 3V6KA 4WXOA 4YFUA 1D1UA 4V19J 2OSQA 3MEEA 2V8VA 3HMJG 3VAIA 4WFXA 1JIHA 3D2WA 1N88A 2BQRA 2HWHA 2YTCA 3OXGA 4EWTA 1RA7A 5DM7Q 1Y00A 2CQCA 2MYFA 1TK0A 4KE5A 4Y2AA 2JX2A 3T5JA 2PGCA 1EP4B 3O8WA 4OQJA 2BM0A 3MFIA 1E6YA 4KR0B 4QWBA 5H9FJ 4A8OA 1HBOB 1U25A 3RB3A 7FDRA 3UD3P 3AQPA 2ZVSA 1S97A 4PXCA 3DDKA 3FZ2A 2HGNA 5J1EB 1D8YA 4DV0F 1S6PA 1HWKA 2HNDA 2KI2A 2B5JA 2CDQA 4N56A 3GMGA 4PPDA 3IR5B 2I1RA 3BDEA 2F8MA 1Q16B 3VQTA 4QR0A 3NP5A 4J9PA 3J7Z5 3I6PA 3KK2A 1KHWA 3TA1A 1TK5A 1VRUA 4KV8A 4AYBD 2BXJA 4RU9A 3AJ1A 2CQ4A 4DS5A 1S6QA 4J5OA 3CDWA 3HZGA 2WOMB 2D1CA 4B02A 2DNQA 1S0VA 1HBMB 2JFDA 2HHSA 2HNZB 4QR2A 2FJAB 3WC0A 4Y65A 2KYZA 3HKWA 3OSNA 3VR1A 5A0YA 1KTQA 3FRYA 2ROEA 5FD1A 4C0OC 3KK3A 1XNRF 1LFPA 4H4OB 3M9MB 2LKZA 3EPGA 3T5KA 2PDAA 3EGWB 4Q8FA 2C28A 5C24B 1R6YA 1DURA 4B9UA 1GTEA 2KU7A 1T03B 4NRUA 5KG5A 3DOKA 2LDYA 2VBZA 2R2TA 5T14A 4MTPA 5T41A 2CJ9A 4NCAA 4J9LA 4FPRA 1YJRA 3DLBA 2DGVA 4DFKA 2BOPA 3I0SB 1IUJA 2W9CB 1MROA 2OSRA 4K4XA 5EWGA 3MAHA 3M1VA 2MGZA 1X7VA 3O1LA 1HPZB 3ULHA 2JEIA 1HI0P 3RBEA 2L9WA 1WHYA 1IJFB 5CXTA 2FVRA 1RI7A 2ACYA 2VPXB 3SMZA 4ECWA 3UCGA 3HT3A 1FDNA 4OLPA 2XC9A 4O3OA 4IOCQ 1YRXA 2MHNA 1JLBB 1LOUA 3EUNA 4K59A 1UW4A 2W8LA 2BYCA 4YY3F 3VAKA 5DM6Q 2GMLA 5EUHA 4ED5A 3UDLA 2UZAA 4DG1A 4AL6A 1NKEA 3FMBA 1DAXA 3MR3A 4X4OA 4DV3F 3K5PA 1XMQF 4YB5A 1JLGA 4JI4F 4LIWA 3UR3C 1HNVA 1E6YB 3PKMA 1RKIA 3D0HE 4DBQA 3QJPA 4HKQA 4ZCIA 1UETA 2UUTA 3G71S 2D3ZA 1K8AT 4DOZA 1FKAF 2MQQA 1IKXA 2L9NA 1N6QB 3VZHA 3CVKA 1MW7A 3M9NB 4JV0A 3DM2B 1SUQB 2HFNA 2Q79A 2X1FA 4CZCA 1HQEB 4RZRA 2DR9A 3HF5A 1VRUB 2YWFA 2E5HA 4KV8B 5L8RC 2KFYA 1F0XA 4Y2IA 4ZPCA 3GG0A 3QZ8A 2ZHAA 1Z1ZA 2AYEA 5E0OA 4B17A 3J7A1 3FSIA 3DHWC 3UI3A 4FN5A 3N9UC 3FNNA 2VQEF 1FESA 1WEXA 2VA2A 5A0YB 1S1TA 4O23A 1XR6A 2JFKA 5L38A 4EBDA 2XMUA 2ZOFA 3W7BA 4Y2CA 1S1UA 3N28A 2DVIA 2V8HA 1U6ZA 5C25B 4EBCA 5D77A 4JI0F 3SSRA 3TUJC 2GX8A 2MDAA 3SSSA 5F41A 3DOLA 5IM0A 1TQLA 2EK1A 3FEYB 3SCKE 1HWUA 3GSDA 4KHRA 3T6BA 3TO8A 3Q2SC 4OZNA 3KLGA 2RB7A 2O67A 4DV7F 4DL5A 5HN0A 2GO8A 2N3LA 2E1AA 4R8UB 2NXUA 1HNXF 5KTQA 4B9SA 3OVBA 4Q0BA 2ZH9A 2PIIA 1M5PC 2LEBA 4OZ0A 2VONA 1GQEA 2VC0A 3ZZZA 2LQ9A 3Q22A 1JK9B 3K5MA 1YQHA 4O44A 3OUYA 2LYVA 3UQSA 5L1JA 1CSJA 4CO2A 2GO9A 2JC0A 2IMWP 2BRLA 5DQIA 1DTTA 2HMIB 4A46A 2VG7A 3M8PB 3O6QA 3M8RA 1SQEA 1U48A 2VOPA 2FHOB 1LV5A 4NYZA 4UW2A 2ZJQQ 3H2VE 5IQ6A 4A8YA 3GILA 1UEVA 1FRLA 3TARA 4GO7X 5KFOA 2HNYB 4NOHA 1TK8A 2N3OA 2HHWA 5A6WA 2ZH8A 3WDOA 3IR6B 3BJYA 5D4OA 4DG1B 4U6PA 3MCSA 3M2UA 2M7SA 3C8YA 1U26A 5LMNF 1C1CA 5HLFA 5KFVA 1JLGB 1C0UA 4IG0A 2DH7A 2XS7A 5HMZA 4QU6A 1ZM3A 3TOQA 2ZH1A 4ED3A 4OJGA 1VQMS 2ASYA 5A8KA 1HNVB 4CI0B 2E5GA 2OIHA 3LAKA 4IDKA 4MIBA 3OQ2A 4ES3A 2B9YA 1K0TA 2M88A 3BO3A 4J9NA 3H40A 1IKXB 4IFYB 2WONA 3NBPA 2Z8QA 2ZE2A 2R7OA 4X84A 4I1TA 2UVUA 2JEGA 3CCSS 2V94A 1V6HA 4P7TA 3MMJA 4DR5F 1HARA 2XWYA 2KJVA 3OFEA 4KGMA 5HO4A 5JUMA 3CULA 3MUMP 3TVYA 2CFXA 2XLJA 1IXKA 1JX4A 1QSYA 1NK0A 5F8GA 2G1DA 2EG2A 2B4UA 1TAUA 5GADU 1ZBTA 5HI7A 5J2PA 5T7LA 3OHBA 3OL9A 2VOOA 1FD2A 1N54B 3MMBA 3TVZA 3B4DA 2AF6A 1T05A 2PE8A 3QYYA 1CEZA 3MMCB 4X66F 1NK7A 2M0GB 3TAQA 3NRBA 4TQRA 4RW4A 3LWLA 5D6GA 4LQ9A 3KK1B 2IM0A 1Z2ZA 1UFLA 4DSFA 2RU3A 1KFSA 4WJBA 4IOBA 2XEXA 1VHFA 5E5NA 3MOZA 3MGJA 1MMNA 2AW0A 4GMKA 3JSMA 3PIOQ 5IM0B 4LF9F 2ADBA 4I7FA 2J6SA 4YHHF 2QA4S 4GC6A 2RIJA 1ZPWX 4IQMA 3FGVA 2R2SA 1N4LA 4Z37A 4Y3CA 1WD6A 4JOUA 4Q0BB 2C22A 3W2WA 4B9VA 1ZM9A 1PO6A 3EYZA 3GFYA 1CC8A 5KG3A 4ALZA 3DLKB 2LXFA 2HHTA 3LW5C 5L1KA 1KLNA 1KNZA 2DH8A 2R7UA 1G1XA 3HHLA 4NLOA 3KLIB 1U1MA 1JKHA 3NGKA 2F8EX 2VFRA 1N32F 2BBEA 1S9EA 2DNZA 2VG7B 2VL1A 3BR8A 1LW2A 2YNGA 4LVNP 1JLAB 5BYRA 2KJWA 1SIWB 1LWFB 2UUBF 2W25A 2PD1A 3VCDA 1Q81T 2PT0A 3BF4A 2PMHA 1X4CA 1RA6A 3RB6A 4JV5F 2JOQA 4QOTA 2YKNA 1E6VA 5KG7A 3OJUA 1YJUA 4F4ZA 4Q2LA 2B3TB 4DFMA 4DFJA 1N34F 3JTOA 2F9DA 4RWWA 4KRWA 3HP6A 2GGPA 1SV5A 3MR5A 3PNIA 2MXYA 1W2BR 3BGLA 3GWCA 3MMAB 3DLEA 4WXWA 5K14A 4FF1A 1FDAA 1C0UB 2KB2A 3C6UA 2V4JB 3DHXA 2RQKA 4XDDA 2HWIA 1NKCA 5E7OB 3WX4A 3OVSA 3KLHB 5I42A 3MZIA 1NZAA 4FF3A 1DQAA 3N5FA 1PILA 1SJ1A 3CDUA 4IH5A 4C8MA 4E8UA 2AGPA 1TAQA 2BVZA 3R5CA 4WU2A 1YBAA 2NR0A 3KKFA 2DHXA 1H2VZ 3DRRA 3C2PA 1CLFA 3UW1A 2WONB 5K8OA 5C42B 4X64F 2GMHA 5KFYA 2ZE2B 1U1RA 2KHCA 2KT5A 3ISND 4QIWD 4U67Q 3CXCR 2B0GA 1L3VA 1IBLF 2YX7A 5F3TA 2V2KA 1R8PA 4NLPA 5HROA 4I2QB 2P9CA 5J2QB 3LQVA 1KQFB 4YUDA 3BO4A 2U1AA 4K0KF 1X4DA 1Z2LA 2MQMA 4RKUC 4K2XA 3UDCA 2IA0A 2FHJD 3LANA 1F9FA 4H4MA 2IAJB 2OMLA 2ZOMA 3TR5A 1T05B 3H8YA 4JV2A 4IO1A 4QZVB 3PW0A 5F9NA 2MSSA 2EWHA 1F2GA 2ZNZA 1HR0F 1D8ZA 2KYXA 1R8CA 3NWGA 4PG8A 1VFJA 5LSRA 1N0UA 4R0JA 3GZ7A 5M2RA 3WC2A 4BHQA 5U47A 2W7AA 1X4AA 2YH1A 3OLBA 2NPFA 4CH0S 1YJNS 2DNRA 2Q6BA 2XY6A 1J2VA 3POTA 1IBMF 2ROGA 1JLEA 4I7FB 1PSDA 3BREA 2E1MC 4EFAC 1HHSA 1VK3A 2D3UA 4MK8A 4NLVA 2HS4A 2RQMA 3P3DA 1X4FA 1ZM2A 3JB9k 4RUAA 2IMOA 2VBWA 3HPOA 4AFFA 4G1QA 1X4BA 4IH6A 3M2VA 1KC8T 1TKDA 1RTDB 3V6DA 2MKCA 5AE2A 4BWMA 4YP3A 2K7KA 3FDSA 2MQNA 3PVXA 3ITHA 4K4YA 1R27B 3PZPA 2J8AA 1JKHB 2EG1A 3B82A 4TY9A 5CYMA 4HHJA 1VQ8S 5CQGA 4OV1A 5H9EJ 2M4MA 1LW2B 2HG4A 2Y1RI 5F3ZA 4NRTA 4K4SA 4W90B 1SJ3P 3J7YI 3AH6A 1FTCA 1K73T 3JSBA 3C46A 4QJVA 5IZHA 1VK8A 2J0WA 4EGLA 5ADZA 4B9MA 1SH3A 4J9SA 3K7RA 1Q53A 1JLQA 4DV6F 3OFFA 3EXCX 4EO6A 1U1OA 2HFOA 1WF2A 1FO1A 3I5BA 3HM9A 2IRYA 4O4GA 1Q7YT 5K14B 3DLEB 4OHWA 3C6UB 4XPEA 4M5DA 2J6UA 4R25A 4LSLB 3NL0A 4RWXA 1FF2A 2QMWA 4EZ6A 3CF5Q 2QE5A 1FVQA 3FRZA 1JLCA 2OPRA 4OLOA 2RVJA 3ISZA 1U1KA 2KTQA 5J2MB 3DDNA 4MKAA 5D78A 2F3JA 3E8OA 4J9OA 3UCZP 1WWHA 3OTEA 2CQ3A 3M8SA 2XB2D 4QR1A 5HROB 2O66A 2FIUA 4WF9Q 5AXMA 4WZQA 4NA2A 2CPHA 3LP2A 2XLKA 4DR3F 1KLMB 4KFBA 2COLA 2B6AA 2C3OA 3V4IA 1JWWA 4H4MB 4QBUA 2MY7A 2HGMA 4IG3A 3GR0A 1MNEA 2I9SA 1FHTA 2VV5A 3U1MA 4I2PA 2CQDA 1YRTA 1NU4A 1WF1A 4DUZF 3G8TA 1UEUA 2MKSA 2RH3A 2UU9F 1K0VA 4OI2A 1FK9A 1SJ4P 2AX1A 5L1LA 3QMQA 4OX8A 4AQYF 4RW8A 1O5JA 3PDNA 3CUNA 2OTLS 3MM6A 1QVFR 3C6TB 1KQKA 3BSCA 4G6VB 2BANB 1SI9A 1XERA 4CH1A 2CJKA 2VB6A 4C8ZA 4FVMA 2DNGA 2VG6A 3POTB 1JLEB 2LU1A 3FSYA 2R2UA 1X4HA 1T7PA 4EO8A 2YNHA 4YEAA 3OW2R 2BR0A 3RAXA 3V6DB 1GX5A 1HNIB 1X5SA 2V9WA 4ECRA 4YDXA 2DGSA 3TVKA 2YNIB 5IFMA 1A7GE 3FSXA 3M2RA 3H5XA 3TI0A 1FT8A 3MD1A 4I68A 2P5VA 2V5HG 3MM5A 4LSNB 2R2RA 3FZBA 2BV3A 2XNQA 2CQIA 4LFAF 2W4PA 4F2RA 4PQUA 2J7UA 3KG1A 2DGUA 3I5CA 3KJVB 4WFZA 1P1LA 3TAMA 4EUVA 5B08A 3BB5A 2B43A 5LJ5Y 1VBZA 2VFUA 5JVGQ 1HHTP 4NZ6A 1CPZA 3KHLA 2EFPA 4FXWA 3QGGA 1TL4A 2DNMA 5KFKA 3ZZUA 3CDEA 2CQGA 4O0IA 3HXMA 4N76A 4IOAQ 5A8RA 4PKDB 2J76E 2OPRB 3BS9A 1QAXA 4RUHA 4Y2KA 2CPJA 4A8MP 2AP6A 4FXVA 1NEEA 3PX0A 5GAEU 5E3CA 2AJ0A 4DL7A 2R7WA 2CJBA 4ZOSA 4UY85 5IXUA 3TNVA 3G8QA 1KONA 3IGNA 4H4KC 4DSJA 4D3GA 2EFGA 2DGWA 4NXNF 2PA3A 5HBMA 3LP2B 4NA1A 1BQMA 4KFBB 2DISA 2J5AA 3MTKA 2B6AB 2FJVA 3O5TB 3V4IB 3RRGA 3PACA 4FF2A 4MFBB 4B3TF 3OV7A 1GTHA 3UE2A 1JLFB 2M9KA 4CIOA 2VODA 4LF8F 1YJ9S 4I2PB 1N52B 5CHCB 4DQSA 4N8OA 3RRKA 4AUKA 3BGRA 3CDBA 2K1RB 5E3RA 1BGXT 3I55S 1URNA 1NRKA 4O3SA 4KAIA 1N56A 4RW6A 4NLUA 1FK9B 1U8SA 2DIUA 3DLGA 3N6NA 2F4VF 3IXQA 3QO9A 1TUVA 1FNMA 4RU2A 3TX8A 3MM6B 2E1CA 3SEOA 2W8KA 7FD1A 1FNXH 3ZZRA 1D9DA 1B7FA 4PXBA 2XCAA 5LXRA 4ZHRA 1NJIT 3HHDA 2GV1A 4IR9A 2RRBA 2YX1A 2YNHB 1TKTA 4OHVA 4DSEA 2WHOA 3ZZ0A 2VBYA 3S1TA 3HHLC 1KN6A 1R43A 2GHWA 4R5PB 3NS6A 1I1GA 3RRHA 5LL6d 2FHMA 1QY7A 1Y3KA 3J80Y 2RNEA 1TFWA 1UJ4A 2N4CA 3NAHA