4P2SA

Alanine scanning mutagenesis identifies an asparagine-arginine-lysine triad essential to assembly of the shell of the pdu microcompartment
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alanine Scanning Mutagenesis Identifies an Asparagine-Arginine-Lysine Triad Essential to Assembly of the Shell of the Pdu Microcompartment.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar saintpaul str. sara26
molecule tags Biosynthetic protein
molecule keywords Putative propanediol utilization protein PduA
total genus 19
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p2sA00
3DNCA 3PACA 4RBTA 5DJBA 2G13A 3MPWA 4QIVA 3IA0A 2A1BA 4QIGA 4OX8A 2A10A 4OLPA 5L38A 4P7VA 3DN9A 4RBUA 4P2SA 3SSSA 4QIFA 3SSQA 3NGKA 4P7TA 3VCDA 4QIEA 2A18A 3CGIA 3I6PA 4PPDA 4AXIA 4DDFA 4OX6A 4RBVA 3MPYA 4OLOA 4LIWA 2EWHA 3BN4A 3H8YA 4AXJA 3NWGA 3CIMA 4OX7A 3SSRA 3I96A 3N79A
chains in the Genus database with same CATH superfamily
1NPRA 4JI8F 1SL1A 2DR9A 4R5PB 2JVRA 2XQCA 4DU8A 1ZPWX 1YBTA 3HSGA 3V5RA 2AJ1A 1C1BA 2CAJA 5CH7B 4AL7A 1RAFB 1V5IB 2A2CA 2MZTA 1CC7A 3PRDA 5J2PA 1LWEA 5HBMA 4JI4J 4RX6A 3R27A 4OI2A 1B7YB 1T9XA 2RDJA 3WX4A 2EC0A 3NGSA 3PEHA 5KFUA 2IVMA 1SKSA 2XS2A 3FQLA 1S4FA 3BDEA 4ED7A 4NLUA 2QX0A 2AKWB 2QG9B 3SCJE 4DQSA 3T1HJ 1YI2S 1UVNA 1GMWD 2BYCA 4UUWA 1RP5A 4NI2B 4NLYA 2ZBRA 4Z7CA 3HPOA 1SUQB 4RW8A 2JEFA 2XS5A 4ZS6A 3K17A 2R42A 3M9MB 3LPEA 1OIAA 1DQ8A 4ANEA 1O5JA 1PGZA 3VR1A 1NLKL 4IR1A 4ES2A 4KR0B 3N5BA 2CQPA 3C6UA 2M52A 5E3RA 4Z7YA 1PCAA 4LSNA 1NSQA 3W2VA 1R8PA 3DCAA 3IA0A 4CP5A 4J9MA 1X4CA 3GG1A 4X4QA 2V4RA 3M8QA 1X60A 1XMQJ 4PZVA 1IM4A 1HMVB 3CSKA 1T02A 1U8WA 1XWLA 4RW8B 2DR8A 3OFGA 2BQUA 1VCTA 2PA3A 1FDBA 4OJGA 4DR1F 3KHGA 4DV3J 2D7SA 3V81A 4F2SA 2RVJA 1ZPVA 2NZCA 4HACB 3U7JA 3HVTA 5CYQA 2J76E 5I3UA 1VQOS 4FF4A 4U7UD 2PFFB 2D3OR 3T3FA 5GMKa 5CZVA 1B3TA 3W5XA 1VI7A 1O51A 2HYIB 3BYPA 3K5PA 4ED0A 2L41A 2VG6B 1U1QA 5DDOC 1LWEB 3RJMB 3CEDA 5HBMB 2BE2A 4AD6A 4CNZA 1FK9B 1HQ2A 4DV3F 2I2YA 1ZAXA 3KDOA 5JXSA 3CCWA 4ZKAA 1WG4A 2CPFA 2O66A 1APSA 5ETMA 2HMIB 4QIVA 4WPAA 2DNOA 3RTVA 4C9DA 1YJUA 5KFYA 5KFXA 2DNKA 2YNHA 3I5AA 3UDVA 4FXDA 2IM3A 2HWHA 4URGA 4WZQA 1X5TA 3E2EA 2W9BA 1TAUA 5L1KA 1GMWA 1IWGA 1G6BA 4UZBA 1RT7B 1DY3A 4M5DB 3ZC4A 4ATNA 4WTOB 4JI7F 5HLFA 1KD1T 3IBWA 5CQGA 2C2DA 4YR0A 3SYZA 3PCOB 1NO8A 2HQ3A 4EEYA 1HNIB 1BWEA 4BDPA 3G4SS 1X31C 5A76A 2BUNA 4X4PA 2H5EA 4UOHA 4OV6A 5KFQA 1NDKA 1TP7A 3AXKA 2KJVA 1RAAB 4ED4A 3NMAA 4USWA 4HDGA 1XK8A 5LSRA 3DXSX 3UWTA 3FGVA 2EFPA 3MZIA 1N52B 2CZ9A 5EWEA 1U25A 1JQGA 2G13A 2JJ4D 5E3QA 2RU3A 1T05A 3MOZA 4OFZA 2YX1A 1M1GA 3UDLA 4PUOA 1WORA 1VBKA 1RT1B 4K4WA 3BBFA 1V5VA 1XMBA 2QSFA 5ETLA 3KLIB 4NYOA 5DG9A 4PQUB 2VPZB 3HD2A 2DGOA 5A6WA 3NGKA 5SUHA 4DV0J 1I94J 4DV1J 2GIRA 1S1UA 2XBPA 4HHJA 1H73A 3H5YA 4DCOB 3T9ZA 4I6WA 1CJUB 4J9OA 2IYIA 1ULRA 1RACB 1FE0A 2MQMA 4DQRA 1F5AA 2HHWA 2B5JB 4HHHA 5KFFA 1JLQB 5FDLA 4GKJJ 1NB7A 1NXIA 3ZZPA 2X1GA 4C3MA 1RT3A 4BLGA 4WFAQ 4ID5A 3KLVA 1M90T 1KQSR 2XNQA 4TLQA 4WFXA 1RUSA 2MZSA 4YS2A 4F2RA 1U02A 3C8YA 3FFIA 1KFSA 2ZOMA 3CT9A 1QVFR 1GNKA 2HS0A 1QAIA 3GILA 1ZA1B 2DH9A 4PAAA 5KT3A 4NCGA 1S6OA 2L08A 4MK7A 1PSDA 5C7PA 3UDCA 2RHSB 3HVTB 3RUBL 1SXLA 3BKFA 3BSAA 1KLMB 3IXQA 5BYRA 3THTA 2KM8B 2I5JB 2APOA 1NZ8A 3HULA 4NL5A 2W7PA 3D6TB 1M5VC 2CVEA 1QSSA 4C8KA 1C1CA 2KXHA 4OLOA 1N0VC 3R5BA 2PIIA 4PG4A 4OHZA 2XEXA 2I5JA 3ZXWA 2VIHA 1HNXJ 4TY8A 4C0BA 2AZ3A 5D6GA 1RQ0A 5AXNA 3DLEB 3GV8B 1NHKL 1D1UA 3ZZRA 4LSNB 3W2VB 1F5BA 3LW5C 2HFUA 2OMLA 3FEZA 1D9DA 5HP1B 2AEMA 8RUCA 1HW8A 2H54B 5LXRA 2LQBA 3M9OB 1YG0A 1NM2A 2KZMA 2RILA 1HNZF 4RWXA 2CG8A 4O3NA 4C98A 4OI0A 2FGOA 2UXDF 1N6QA 2B5JA 3MMJA 1VYAA 2V68A 1UFWA 1AA1B 1N34F 2UUBJ 5CXTA 2QYCA 5B0AA 3N9UC 3W1YC 1OPIA 3KK1B 2VJVA 2CQ2A 3TQ1A 2VBXA 1J5OA 1HWJA 1CS4A 1HI0P 2L9DA 2ZOFA 1VQPS 4AE5A 2MYFA 3W8GA 4OI4A 3T5HA 4NA3A 4L6V3 1HD0A 2VG7B 3TVYA 1IBMJ 3MDFA 2DKOB 3CD0A 2WZ1A 1SPBP 2LXFA 5K5MA 2FC9A 3LF0A 3H5XA 1FKOB 1HBOA 3CJ0A 4IH7A 4MK8A 5DO2A 2NR0A 2UXBJ 1F9FA 5IOLA 1CULB 1T05B 2Y9HA 1T9TA 3HZEA 1NH7A 4C11A 5E41A 1NPKA 5L1JA 4DLGA 2IJNA 3C46A 1ZM3A 3C14A 1BLUA 4LQ3A 1IKWB 1N5VA 4HTIA 5FLXY 1DTQB 1IBLJ 1G3OA 3KUEA 2JC0A 4USHA 3SMZA 1UA1A 3KFWX 1H72C 2KTQA 2J7KA 2MQPA 4CH7A 1RK8A 4DR2F 2MMYA 4DV4F 2D9OA 1KN6A 1X4GA 5DGBA 1GX5A 5FLXU 2GS8A 1J27A 5K20B 3GONA 2YNGB 3BH6B 1RT7A 4IH5A 1JLFA 5AXLA 2HBZB 6FDRA 1EKRA 4KT0C 4YUDA 1VDHA 2DHAA 2P2CB 3CF5Q 4O3QA 2HHXA 2ACMA 2K06A 3H5SA 1GFWB 3NS7B 3JXOA 2ZBIA 3U02A 1X0FA 2QN6B 4UQGA 2WTFA 3QIPA 5L1LA 2Y8YA 4WTYA 1N36F 3QJPA 3DLEA 1RYRA 4KBIA 2E1AA 3PW0A 3A12A 3BQ2A 2CA9A 4WJBA 2WBRA 3H25A 3LGNA 2IDEA 4K2XA 1X4DA 1NUEA 2KFYA 1NDLA 4Q8FA 1ITPA 3EMTA 3UFCX 3S1TA 1V6HA 2MQLA 4QU7A 2UP1A 4Y2KA 4Y2MA 2YKMB 2BM1A 3KXDA 4ZITA 4FS2A 2LEBA 3F0NA 3RYLA 1BWVA 3AA8A 1SQFA 4HTJA 3P45B 5K14A 4DL4A 4FF2A 2CQDA 3EVOA 2VQFF 3N6MA 3J80U 1R0CB 4X4SA 1VC0A 4LMZA 4ANCA 1T03B 2G1DA 3CVKA 2QEXS 1BUXA 2EG2A 2RF2B 2YY3A 3DRPB 4OV1A 4K8RA 2AGQA 1HBMA 2EFQA 1LWXA 4TU8A 5D4OA 4DR6J 4HI2A 1MNEA 1FA0A 3VGTA 4YDDB 2G0IA 2J6SA 2P9CA 5LMNJ 1KQKA 2CQ3A 5B0BA 2JC1A 4TYAA 4DJBA 3Q2TC 2DHXA 1JJ4A 4NI2A 1FHTA 2FUG9 5B0FA 5E3CA 4F0HA 1RHKB 3RB6A 3SQGA 1UJ5A 2PEHA 4ED5A 2NQPA 4DR7J 3K8VA 4KH0B 3TARA 3ZZZA 3KMQA 1FVSA 2JEJA 3RB4A 2LEAA 3DRRB 1FD2A 1HHSA 4FVMA 4DG1A 2V8GA 2IC3B 2XWXA 2KT5A 2JHEA 2VFTA 1IKWA 4U7CA 3CD7A 4O3RA 1NK4A 3WX8A 3GJRB 2ZWOA 3DU5A 1S5ZA 4WFZA 3P4UB 1Y9OA 5B0GA 1IKYB 7FDRA 3M8PA 4ECXA 3FBCA 4WBFA 2HLUA 4HVZA 4WE1B 3W62A 2XLJA 1K8AT 3PO4A 1PJ6A 2NZ4A 3AJ1A 1NMEB 2B6AA 4MAKA 3DGPA 2DO4A 4KKOB 5SZTA 2MZRA 2KG0A 4M95A 2K7JA 1NK0A 1HBNA 1RABB 1TKTA 2CYYA 1UFKA 2CG4A 5G0RA 2B51A 4CTAA 5LL6d 4RUBA 3DM2A 1Q79A 1HWUA 2CUYA 5IC6B 4WIQA 2JRSA 4KKOA 2I6WA 1QJHA 3U1NA 1ZETA 4F7VA 5HMWA 3GJTB 2EPIA 2CPIA 3HHEA 2CJ9A 3MI7X 4RUHA 3TZZA 3D67A 2OTJS 1XN9A 1IBKF 3Q8SB 4LF4F 1NB2A 4HT5A 2VC1A 2KN4A 3VZHA 2IHR1 3JAMY 4JV0A 4DV1F 3P5BP 1KWMA 2DK2A 4Q5VA 2A6OA 2R7XA 2MKSA 3G96A 2DRBA 2LEPA 3IM9A 3POTA 2ZH2A 2DXFA 2MHEA 2VG6A 3UN2A 2QL7B 1RAOA 1ZAWA 1TR0A 2DTJA 1J2VA 2IC3A 4WWSA 1YTYA 2FLLA 4A8MP 3VAGA 4O23A 3MAQA 1GXTA 1X5SA 2HQGA 3MEEB 3PX0A 4JI2J 4OHYA 3ET6A 4OI6A 3AOAA 2B4PA 2DNHA 4O4GA 1ZA2B 4DPTA 3NRBA 2C2RA 1FNXH 5HJXA 2MZJA 1ZYQA 2N4DA 4JI4F 2EC2A 3QRQA 1UAWA 2OFGX 1OQ3A 4GMKA 3MM7A 5L46A 3W60A 2BKOA 2D3UA 5KFWA 2RQKA 3LAKA 4M5MA 1S4EA 3SFGA 5KFBA 4A47A 3HFZB 3QGHA 4J5OA 2ATLA 2B9YA 3LGMA 4JI8J 2KO1A 4MYTA 2XC9A 1N54B 5LM7E 2UVVA 1BC6A 1VRUB 3GR1A 3N79A 1R8AA 9RUBA 2FB0A 4R0JA 3RAXA 1O8BA 1LV5A 1E6YA 1P8GA 3TX8A 3M32A 2GW8A 3AJ2A 4K5SA 2DVIA 1HI8A 3EM1A 3HDSA 2M8DB 5HANA 1JJCB 1KR4A 4JBCA 1FFSB 4IG0B 4LF8J 2MZ1A 1D9AA 2OSQA 3VVTA 4XPCA 4LSLB 2R8IA 1A6LA 1WF1A 2BKNA 2CRLA 1DARA 4C8ZA 2ZITA 4JI1F 4ED1A 3CB4A 4I7FB 4USUA 2NXUA 2LXIA 3ENQA 3FEXB 1R27B 4LF8F 3N01A 1CJTB 1LEOA 3LQVA 4ZLLA 1B0TA 3MAHA 5KG5A 4FF3A 1Q53A 2HHHF 5D8HB 3CCVS 2VPWB 2ZNYA 4B9TA 1DFDA 2R7RA 4CLKA 4YHHJ 4AL5A 3PW7A 2CPYA 2J0SD 1R7IA 3FUYA 1FT8A 1WC0A 2JFKA 2PE8A 4YOEA 2E5LF 1QSLA 4I4BA 3TP2A 3JYTB 2WCXA 2XTJP 4DU7A 3JSMB 1VMBA 2YKPA 1IJEB 3UNYA 2CJYB 2GJFA 3LA0A 1KHWA 4O3SA 4QU6A 1DHMA 1RWKB 5KFMA 3I9V9 2X1FA 2J9DA 1DBDA 1WKLA 2DNQA 2BMBA 2MB0B 1U49A 2KT2A 4NLVA 2HVEA 3FQKA 1Q81T 4P71A 1U6BA 3R7NB 3EJMA 4DUYJ 3CDAA 3PYFA 2HGMA 3T19A 4USTA 3C66A 4A4JA 4Q44A 4CH1A 3BQ1A 2CJAA 3UW1A 2JLGA 2RUGA 4J9SA 4LFCF 1JXVA 1F2GA 3KK2A 3MR3A 1VQYA 1CQNA 2GQ2A 3MF5A 3MPUB 3HVAA 2VKRA 4TXSA 1U2FA 1U1RA 3D4JA 2DGXA 3R5GA 1K1SA 4RWWA 4WXOA 2WHOA 3MFHA 4DQQA 2XWYA 2AIRB 1J5OB 1UWBA 5J2QA 2LCWA 2WBMA 4P7TA 1HWLA 2DNZA 2B56A 3L09A 4MYUA 4B3OA 3OLAA 3CCJS 5L39A 4LR9A 4LBIA 1CC8A 2WRMA 4OZ3A 2OEMA 3I0SB 4LSLA 5CYQB 5KT4A 2N82B 3Q23A 1CPZA 4DV2J 2ZHBA 2EBGA 4J91A 2DH8A 3ADAC 1MROA 2PSZA 3CO0P 1I6JA 2UXBF 3E51A 1NJWA 2MQQA 2O5DA 1YJVA 3ZFVA 4KB7A 1H38A 1VJWA 1X7VA 3JTOA 4HLBA 3UI3A 3QAUA 1WC3A 4ZLNA 1X0PA 5IT0A 1NKEA 2CPHA 3FMWA 5KFRA 3ELHA 3K5NA 1S7HA 4OZ0A 5EN1A 1XNRJ 5AJ3F 3DU6A 3BGRA 5FJ4A 4C7QA 1GQEA 3QZ7A 3OV7A 2LYVA 4ED8A 1H7XA 3P8BB 4M1KA 1PO6A 4H4MA 4P7VA 3ZZOA 1WHYA 3M8RA 1IR0A 1KOHA 1Q7LB 2F8HA 2QMWA 3GCXP 2C2OB 4P9SA 3H4DA 2ZDPA 4UOGA 2ZHOA 3GIKA 4JYAF 2A18A 2ZBPA 1UTAA 2C2KB 2FZKB 4CDIA 1XMQF 3H0PA 3MEEA 2EW9A 3OD2A 4YY3J 4N8NA 4CI0B 1YWXA 2EWHA 3ONQA 4O4GB 3M4XA 4JI6F 3M2UB 3B82A 1R6YA 3ZZYA 2AT1B 2ASDA 4DSLA 1VR6A 2ZUGA 3P49B 1Z1ZA 4DR4J 1PYTA 1HHQA 1TAQA 1UPPA 3TEGA 3GQCA 4U67Q 3GE9A 3OL8A 4DSKA 5D0GA 1AT1B 2C2ZB 1M5KC 1F0XA 5LOQA 5FDLB 1N88A 3IWLA 3NAIA 3UCZP 2F9DA 2H51B 2KVIA 1Y5LB 5M2RA 3FCHA 5L9XA 2IYGA 3RG6A 1FRXA 1R6VA 3WHIA 3MM5A 3MR5A 3CCLS 4HYKA 5AT1B 3TUPA 1UKUA 1R8HA 3A3PB 4JI0J 2ASYA 1G4CA 2DRAA 4DR4F 3US5A 1AB8A 4ZVGA 1JJHA 1S1VB 1FDAA 2XZDB 3MR6A 4A8YA 1SH2A 3SDEB 4USKA 2QLFB 4RNHA 3I5BA 1B7FA 4DF8A 1Y00A 1EP4B 4CYUB 2E5HA 1SJFA 1XQIA 2QA4G 1U8SA 1ICEB 2XSFA 4X62J 4M8LA 1X4BA 2HNYA 4X4OA 1IKYA 2R7OA 4LF7F 2GX8A 4XIUA 1XMOJ 1QLNA 2RQMA 3QO9A 2VG5A 3GV5B 2BQ3A 4G1PA 2M70A 2BJDA 1WC4A 4QOTA 4RLEA 2AX0A 2VUGA 2W24A 5AXMA 1HNIA 4RU2A 2HIYA 2BA9A 3TRGA 3DRRA 3CCTA 3X1LB 1O6XA 1R8BA 2HFSA 4F4ZA 4WKYA 4R8UB 1REVA 2A0FB 2MKJA 2ZZMA 1RYSA 1S97A 4ZPTR 1A0OB 5F9LA 1CJVA 2LKZA 1H98A 2BOAA 2K3KA 2J0QD 2DIVA 2M88A 3CIMA 3DC2A 1SQGA 1S0MA 4ZK7M 3RR7A 2E9ZA 2EEYA 3DHWC 5BJRA 3AFGA 1MMDA 2CJXB 2AJ4A 2DGQA 2JL9A 2ZM6J 2HG4A 3OBIA 2BE2B 5EWFA 4OZ2A 2NYIA 1DURA 2ZD1B 4EMDA 2YWFA 2QLBB 3N4WA 3Q89A 5IQ6A 1DJ0A 1SL0A 2YKMA 3QT6A 3CCES 1SH3A 1Y3JA 5I3UB 3ZTQA 4EYHB 1XC9A 4QIFA 1B0VA 1UW9A 2V50A 5DQGA 1MROB 5K9FA 4DQIA 1Y10A 4YB7A 3N0VA 1ZOTA 3MCNA 4H4OB 3K57A 4CO3A 2I8EA 3I31A 2IY5B 5HMYA 4OX6A 3R5CA 4JI0F 2W7AA 5HROB 4DV7J 1TKDA 4I0WA 2D3O1 1LOUA 3MXHP 3D5MA 1ZM9A 3PJXA 4AL6A 3M7VA 1TL7B 1KKHA 3QSIA 2PC6A 1U47A 1H0HB 1WG1A 1U26A 1EQ0A 3QIPB 1RTIA 1YVFA 5BXIA 1RDRA 2UUCJ 2OPPB 2MQOA 3QRRA 2C3PA 3J81Y 3M2VB 4NLWA 2CZ4A 4I67A 4KV8A 2ABYA 3VAIA 3NGDA 5L38A 4QYZJ 3T1YF 2V4QA 3V4IA 2XCAA 4KHPJ 2JLFA 4P2SA 2FVPA 1K1QA 3G8TA 2XO7A 2GQCA 3IR5B 4QR0A 2Y1RI 4MKYA 4LFAF 5IV3A 1HNXF 1QTMA 1UVJA 1LFWA 1RGVA 5H9EK 2AJFE 4NXMJ 4HH1A 4NLXA 4IH6A 1VQLS 3QRPA 4ZHRB 5A8KA 1JB0C 4UW2A 4MIWA 4EGLA 3FCWA 4F4KA 1KQFB 2VG5B 3G87A 3QO9B 4URSA 1YIJS 3GIMA 3H2VE 3DDNA 4C8LA 4TNOA 2ZZNA 3BGFA 1ZAVA 2MXYA 2OGUA 3NCRA 1L3UA 3Q8UA 3OR2B 3QMQA 2W2NP 3RAQA 3W63A 3BPSP 1SV5A 1S1TA 1EETA 1JLGA 1LWFA 3MM8B 4NA1A 3WC0A 3H59A 1YX2A 2BXJA 5F3ZA 3T6BA 2AZ1A 4DI6A 2ZH1A 2AQ4A 2HWTA 5KFLA 3KUHA 5IS2A 2MKCA 4LSZB 3FRZA 2M5YA 2CQGA 4J7CA 4OJ3A 5K8PA 3KLEA 4WYWA 5DG8A 4LQ9A 2HFOA 1H3DA 1TVRA 1S1VA 2GO8A 1QUPA 3I0RA 4I6YA 4ZPBA 3MAAA 3MEGB 2OKQA 3NS6A 2KH9A 2DCUB 5J2NA 3PX6A 4UUXA 2UXDJ 1X9MA 5I3QA 4RNOA 5A8WA 2E1CA 2PI4A 3GYXB 2YH0A 3UE2A 2PDAA 4C3KA 3MPVA 3GU0A 2FTRA 2VASA 2QSWA 1FRMA 3MD1A 4H4KC 5AE3A 3UPFA 4PYAA 4X4UA 5EDWA 4LF2A 1QTNB 1FKPA 3BREA 3GSDA 1S9GB 1T9WA 5HVGA 2R8KA 3PG9A 1WOSA 4Y0FA 3THPA 3D3CJ 1X5PA 2E29A 1KFDA 3B6BA 5F8MA 3MURP 2ZH8A 4FPIA 4BS2A 5M2PA 1SIZA 3MTJA 1HNVA 3DOLA 3CJKA 4RPFA 4NLTA 4B3SJ 4F8RA 4OHXA 4GKKJ 1S6UA 2LDIA 3D6HB 3DFEA 4E2FB 3PIOQ 3T5JA 3DYAB 1VQ4S 1KLMA 2E9RX 3N28A 4RW7A 2RHQB 3JQMA 4G6VB 4OYWA 4WU2A 3HSZA 2OP5A 4F3QA 3UNGC 2VPXB 1HFEL 4UT4A 1H6KX 2E5IA 2RKIB 2DR6A 3ET6B 2DBBA 1R43A 4NLOA 2W8KA 5JVGQ 3WZ0A 1XBWA 2MLZA 5KFAA 2K3IA 3DNCA 4DXLA 5EUHA 4DWIA 3P96A 3IWNC 3KJVB 2HNZA 4YQWA 4UOCA 2J6TA 1EKSA 1Q8BA 4CLPA 4ES1A 2ZKUA 4MIBA 1TUWA 1OQ6A 5L1IA 5EX0A 1H74A 3DKDA 5A8WB 3RBEA 4ZA1A 4L75A 3G6ES 1PBAA 2GHVC 3I0SA 1K44A 2LMIA 1OY6A 3M8WA 3PJWA 2X3DA 4QR1A 5D4LA 1M1KT 4B3OB 1OWXA 3CMAS 3TYTA 3MMCA 2H4WB 2OPRA 3FCVA 4NZ0A 4YB1P 3KG1A 3MMBA 3H8YA 1KTVA 3WQPA 2BANB 1T9UA 2RUSA 4PPZA 2ZFHA 5GMDA 3VAKA 2D74B 2X51A 1S1TB 4DV2F 2CKWA 3GYGA 1AROP 3HKWA 4KAIA 1T0TV 2JX2A 4KC5A 1G2EA 2GCFA 3PJ9A 4RW4B 3EUNA 2B7CB 1HNZJ 2AYGA 3MM9A 1FJ7A 1K73T 2G1HA 2HK2A 1Q8IA 1PC4A 4CNYA 1BE4A 2NXNA 3EX7B 5D3GA 1NNDA 2RRBA 2V2QA 4A8OA 2BANA 4ZHRA 5A8KB 3IFEA 1HI1A 2B9EA 4M5LA 3CMQA 2RS8A 4ICLB 4R0EA 1YSJA 3OQ2A 1P1TA 2RQCA 2FHJD 4P73A 1DQAA 1GX6A 4Y2AA 4DX7A 2Z2ZA 4DL5A 4UZCA 3HHLB 3GP9A 3IGVA 5IM0A 4J90A 4KV8B 1AZSB 1BQNA 4I2PB 2KHDA 4L76A 2OPPA 2ZC4A 2RIJA 4KGVB 1YRUA 2AU0A 1Y11A 4DFKA 1VRTA 2OHDA 7AT1B 2GIQA 1XNQF 4U95A 2ZHAA 3R1LA 5A0YA 1B4SA 1GMUA 4WK3A 2QFIA 1OMSA 1IJFB 2RF2A 2PMZD 3J7YI 2W9AA 1N5YB 2RB7A 4TVAB 3F44A 1SI9A 1WF2A 2E44A 5E0OA 3UVJA 1FK9A 4Q43A 2V0NA 4KGMA 3HT3A 4FYXB 3TAQA 2BE7D 2YWEA 1FRHA 4RBUA 5DETA 1XIQA 1C4CA 4M5JA 4HACA 3OTOF 1BGXT 2JWNA 4NRUA 1TK8A 2HW3A 4B02A 1WJ9A 4KGKA 2MLYA 5GADU 4Q0BA 1GTHA 5T41A 5A8RA 4DOZA 1TK0A 1CJKA 2KT3A 3DRYA 1ACMB 2DHGA 3J7A1 3TZYA 4LVNP 2CQCA 2JH3A 4CWBA 2KU7A 3QLHB 4G3IA 1BY9A 3OJUA 4M5NA 2B8QA 1SC6A 4FNHA 4ZPDA 3KG0A 3IN5A 5KFEA 2BJ7A 5KFTA 1FKPB 2M0GB 5F0WA 4K4SA 1HWKA 4OYOA 3I5CA 1K9MT 2CIMA 1XERA 1YK9A 2BVZA 2LU2A 3HX9A 4FKYA 4KPCA 4Y3CA 4CLZA 3JQKA 2VOOA 2XI2A 4QWBA 4B3TF 2UU9J 2GAHC 1S57A 3VAHA 2CPZA 3W9JA 1RA6A 4F25A 2DHHA 3QT8A 2H48B 2DGTA 3R3TA 5ITHA 5DLGA 1X5OA 2OEKA 3DDIA 3R8YA 3OVAA 1TV6B 1RWXB 5J2PB 3BPDA 2XNRA 3CJ8A 2KRRA 1MMNA 1SBRA 3LPYA 4L3NA 5B0DA 2DNYA 2E66A 2GGPA 3EVWA 3CXCR 2HQCA 2ZJQQ 3J7AN 2Y1IA 3ISND 4CLWA 1RTZA 2JNJA 4B17A 3CJQA 3DLLQ 4MJKA 5DJBA 2CWXA 1CULA 3JB9k 1A7GE 2MGZB 3S6EA 3TA2A 1U09A 3DLGA 3PYGA 4KHMA 1EIYB 3W3SA 1YHQS 4ZVQB 4JYAJ 5ETOA 5ADZA 2B9WA 4ZLJA 1F9HA 2IRXA 2V67A 3DM2B 2WK4A 4JI6J 3DLKA 3PTWA 2HK3A 2FHOB 2FY8A 1C0TA 4XK8C 2AF6A 2YNFA 4A46A 2XGQA 3HHDA 4HDHA 3R5JB 5E5NA 4AXIA 4NLPA 1HKAA 4NRTA 5D0EA 4D3GA 4M5HA 1OY8A 5IT4A 1QD1A 5DDRC 5KOWA 1FRJA 3GIRA 3AOBA 3GCWP 4YB5A 4GVBB 4J9LA 4WE1A 4LF6J 1P1LA 2RS2A 3OTBA 1UPMB 3FBFA 1R8CA 4P74A 1WD6A 2WAQD 3PW2A 4K4XA 4WIIA 2CNKB 4K0KJ 1PC5A 1VISA 1RTJA 2GAGC 2FHKA 4IFYB 3HP6A 4DR5F 1N32F 1F6TA 1JNRB 1D3WA 2W4DA 4FXWA 2FIUA 2KXFA 3C19A 3ZNUA 3PKYA 4OI1A 1RTDA 4LF7J 3CCUS 1NHVA 1X4HA 1GT8A 4FF1A 2J7WA 2IM0A 5HVHA 3IAM9 4C0HA 3BYRA 2XMVA 1JXLA 2ALYB 1N56A 1U7LA 4KHPF 1UJ4A 4Q0BB 2WOMB 4A8FA 1MN7A 3V6DB 4BC7A 4AYBD 3GG0A 4X62F 1HBUB 1IKXA 1PJ7A 4QWDA 3OUYA 2FVRA 1WTBA 2FJAB 1RWOB 3GLJA 3IS9B 3LUYA 5HVFA 3V6JA 2XULA 4YN3B 3UO0A 1S1XB 1IR2A 1BMQB 1S72S 4MK9A 1L5UA 4ELTA 4DPXA 5C25B 2ASJA 4FVCA 2H65B 3K89A 2XMUA 2CDRB 2LQ8A 3BGLA 3IGNA 1WEZA 1KVKA 2CQ4A 4KQZA 1L3TA 2CPJA 3RR8A 1VRTB 1WHXA 3NOCA 4KJIA 4ZJOA 4FN5A 1NJYA 3V6DA 4N5SA 1F3VA 1OS5A 2NSCA 3G8SA 3GIJA 3M8YA 3OLBA 2WVFA 2XHWA 3QFHA 1SC1B 3VCDA 1RB0A 4ECQA 4N47A 3CGIA 4AQYJ 2HS3A 5EGYA 3CO9A 3D7SB 2HEKA 3HHLC 2IRYA 3IMQJ 2BJ9A 2L9NA 4PPDA 3J7YU 3OHAA 3MPYA 3JQJA 2F8MA 3H98A 2ZJRQ 1S0OA 1RTDB 4ZDNA 3BN4A 2HURA 5KFSA 1RT2B 3HHNB 2YPYA 4DPUA 2ASLA 1AFIA 2DR5A 3KLIA 1VQ9S 5T7LB 3GR0A 3CJ2A 1U1MA 3ZZUA 4WZMA 1RJJA 4NLSA 1UW4A 1WG5A 4KSEB 2KB2A 3T6JA 4NCAA 2QTWA 3W2WB 5JVHQ 2H4YB 4B08A 2OFHX 4GVBA 1SJQA 3B54A 5F0UA 1VQ8S 1ZH5A 2W4CA 3S7RA 3BGUA 1JLBA 1FERA 5C24B 1NHUA 3I87A 4FBUA 1VQNS 4Z37A 2AEJA 3SV3A 3B4DA 4TY9A 4DL2A 3AH6A 2XMTA 5GMEA 3SEOA 4RNFA 1EAYC 5KOXA 1NK8A 2VA3A 5F8NA 3U1LA 5CYMA 1FWLA 3QT7A 1WSVA 4G1QA 2KM8C 2LA6A 3LALA 1KRPA 4DDFA 3G82A 2B9XA 3O1LA 3R9LA 2UUAF 5HLFB 2VF3A 1T7PA 4ZP9A 1WELA 3DGVA 2HIQA 3DLGB 4QWEA 2WB4A 1IBLF 3UDEA 3EZ5A 2V9WA 2F4VF 2VODA 3O3LA 3SSRA 5KT7A 4X84A 4Q45A 1SJ3P 3E3XA 2HVDA 4IO1A 1YBAA 1IWAA 4XAKA 2DGWA 2CVIA 2XGPA 3MPWA 3KG4A 4Q2MA 3SCKE 4ZN1A 2FLPA 3C15B 2VG7A 5C5JA 1MU2A 1DQ9A 3LP0A 5IC4B 3QIDA 5CD4H 4HKQA 3GB0A 1DTTA 1T94A 4I56A 3K5LA 1RT6A 2W2MP 2V34A 4A48A 4ZVSB 1QM9A 2CJQA 3MCOA 4IRKA 3IC1A 2NXCA 3LAMA 3EWGA 5E3AA 1IVZA 1NU4A 4IG3B 3WDOA 2LU1A 4JI3J 1UZHA 3M6XA 2P5VA 4MKVA 1KDNA 2DNPA 5KFJA 1P27B 2R2SA 2B3TB 1HMVA 3VZIA 1SC4B 3DOLB 2IM1A 1B70B 3M8QB 2BR0A 3I32A 3BGRB 4LRCA 4OZJA 1K0VA 1NDPA 1RISA 5GAGI 2P8IA 2CADA 2W4PA 3HSDA 3V2UC 4X4NA 4KTQA 4OYZA 2Q79A 2MEWA 1TZ0A 1FJCA 1KP6A 1U6ZA 2DD8S 2IAJB 2H9ZA 1SCJB 2M7SA 1SUQA 2V2KA 3FRYA 2R2UA 1KNZA 3CJRA 2Z2YB 3N6NA 2PMHA 3R5AA 1T9VA 3TZXA 3KKFA 4DMZA 2EKYA 2YNIA 5ETQA 2YQ3A 3IM8A 3LP1B 4A8XA 2Z2MA 4NCGB 2XM3A 1YBUA 1MU2B 4CO1A 2R9LA 4V19J 3Q2SC 4S0MA 2ROPA 4J9RA 2VONA 2R2TA 3CJTA 1H2UX 2UVUA 1OJ4A 3I9ZA 3LP0B 3HHKA 2GC8A 3TJ8A 5KT6A 3GIIA 1EETB 1KQGB 3E8OA 2MLXA 4RU9A 3B78A 4RNNA 3B8HA 3E01A 3BO3A 1FRIA 4CO0A 1JIHA 1RBAA 5I42B 2E1RA 1FI4A 3PV8A 3G86A 4MFBB 1XMOF 2JLEA 3VAMA 4C4WA 2NUHA 5U47A 2FVCA 2ROEA 3R6LB 3MMAA 2WW8A 4GC6A 2EFVA 4P2XA 1F5CA 1HPZA 2XMAA 4DX5A 1WOOA 3LTOA 2ILZA 4DUYF 4ZVEA 4DS4A 1U1PA 1JLBB 1M5SA 1RT1A 2UUWA 3QGGA 5C24A 2YWKA 3JSMA 3RBDA 3I55S 3CDWA 4WFNQ 1NJZA 3SV4A 1XR7A 3HMJG 2R4FA 3TOQA 4EWTA 4ZPCA 1HR0F 2AEFA 1LWCB 4ECRA 4F3MA 4OHVA 2HFNA 2AYEA 4QIWD 5IXUA 5DG7A 1U4BA 4LR8A 2OPSA 1S9EA 2B4VA 4B9LA 2OELA 2DYAA 4O3PA 1TL3A 2CXEA 1S76D 5K8OA 3MMCB 2RQ4A 4OZ1A 4P10A 1RCOB 2E9TA 1RT2A 1SB6A 2V4JB 4KGZB 2BJ3A 2C22A 5BR8F 2Q43A 1PAUB 1WC5A 3IG1A 1I1GA 1KVIA 4NZ7A 1IQTA 1EJ7L 4TN2A 3GYNA 3I4HX 5H9FJ 3BQ0A 1NKCA 1FJGF 1TL1A 1WSRA 2GHPA 4N77A 2Z4PA 4RW6B 1FE4A 1NK9A 4CLUA 3PZPA 3QNWB 3QFWA 3TA1A 1ZTTA 2HVHA 1BHNA 4LFBJ 1LW0A 4RJVA 4ZVHA 2I1RA 1T03A 4ETXA 4HR2A 4OX9F 4CLSA 5B7WA 3ETMA 4FXVA 3UR0A 3SCIE 3A3NB 3HK2A 1YZ6A 3CJSA 3CJ4A 3M6VA 3TR5A 3WC2A 1N4LA 4LUBA 3OUYB 4C6AA 3DOKA 3PXGa 1U45A 3IS9A 4OIXA 5MAOA 1RWPB 3D0GE 5BYSA 3T5LA 4RW9A 4LRAA 3M30B 3M8ZA 2UV8G 4EI2A 1XNRF 3DYAA 4Q2LA 3RBZA 2AGPA 1Q82T 1XJWB 3ENWA 5GADI 1FX2A 4W92B 4PXEA 4R8UA 3VVUA 1HL6A 1XTZA 3MEDB 3AA9A 4QW9A 1UWAA 3PDNA 2IBKA 3R5DA 2HNDB 2HSEB 4MTPA 4OI3A 2WSEC 2LP4A 4B3RF 2W2OP 4IKAA 4OZLA 2W2QP 1RT4B 3EDRB 2Q6CA 4KO0A 4E0DA 1A9NB 5HSPA 1OYEA 2HRYA 2OPSB 1KVJA 1M5PC 2PT0A 1SJ1A 2C2MB 2G2YA 2KI2A 2J0WA 2M9KA 3AXMA 2L9WA 4YMEA 2HGNA 1LWCA 5LT5A 3CJ5A 2A10A 1IR1A 1PIEA 1JLFB 2RMLA 4DPOA 2VDIA 4E8UA 1NZAA 1WKJA 2ATCB 2H1YA 2XMWA 3G2XA 4JI1J 3TVZA 5DM6Q 2YNFB 2G9OA 1WC6A 1FEEA 1Z2ZA 1D8ZA 3NAHA 4Q7AA 5J2NB 4CZCA 4B9VA 3UCGA 2CQBA 4ZIVA 2QLXA 3U27A 2J5AA 4FBTA 2QC3A 4W98A 3MMAB 1NSKL 4AFFA 5C42B 1R0BG 3D1QA 2RRAA 1S6PA 3DOMB 1S1WA 5RUBA 1URNA 4NLDA 4OL8A 2QMXA 4LF1A 1FESA 1VQMS 4IQXA 3TUIC 4MIAA 5D4PA 3VAFA 3EICA 4N41A 1JLGB 2DXEA 4ZCMA 3CCQS 3W61A 4DF4A 1FTCA 5DGAA 1M0SA 1RU1A 3OR2A 3GFHA 4LF5F 4R5PA 4ECZA 5GAHI 2V94A 1JWWA 3HSJA 4WP9A 2R7SA 4UOFA 3VHQA 2RDIA 4DFPA 3CUNA 2Y1JA 2C42A 3V6KA 1C2PA 3KWMA 3OL7A 4WFYA 2VB6A 2F3JA 4DV7F 1CS4B 3SZ2A 2KHCA 2GVDA 3F73A 3K5MA 5DM7Q 2QA2A 1UVIA 3DMJB 3SIPB 3VGSA 3C6TA 1TV6A 3JSYA 5B09A 5F8IA 2BJ8A 4F50A 2G2OA 4TQRA 4ECUA 5E7OB 4DL6A 4ZVFA 2LXUA 4M5GA 2OI2A 2K1RA 2B8PA 2CQHA 4C48A 1NCLA 2NCKL 1LXJA 2QLWA 1NK7A 4PABA 3MR2A 4D3HA 1UVKA 3M6WA 2MSTA 2R7QA 5HP1A 3A8IA 5KFGA 4ED2A 1WC1A 4K4ZA 5THWA 1MMLA 2B7BB 4DR1J 2ZVSA 5ETPA 3BN7A 2BBEA 3OL6A 1RE1B 4WCEQ 2ADCA 2HNDA 5IZHA 2XMMA 1RAGB 3OHBA 1C1CB 3HVWA 1CJKB 3BB5A 5K14B 5K8MA 1BQMB 2RD5C 2IA6A 5KG6A 3IWXA 2Y1LB 3FSXA 4KFBA 3ENVA 1EARA 1N5QA 2KDOA 4U9RA 1Y7PA 3FC9A 4RW9B 2H5JB 2BX6A 3MCSA 4NZ6A 3FK4A 2ZH3A 1RZMA 1S77D 2DEJA 1FD8A 3G8QA 3QAEA 1E6VA 4U6PA 4B3SF 4IRCA 1B64A 1TKXB 3QYYA 1PJ5A 1U2CA 3EXYA 3GV7B 1UWBB 5J2QB 3FSIA 2PEBA 3N5FA 2JZ5A 4QWCA 3VQSA 3CMES 4ILMA 4DX8H 4A8SA 2DB1A 2YX4A 2IVYA 5D15A 1U1OA 2X1BA 3CTRA 3O8WA 3UD3P 3HO1A 4X2BA 2V9KA 2MZQA 3C15A 1LW0B 2V2ZA 3RAMA 3KK3A 3KK2B 4G65A 2A1BA 3K7RA 2FZCB 4OYMA 3OXGA 5DQHA 4IRDA 1UMJA 4F26A 1RHJB 3FKBA 5F8HA 1S6QA 4ECVA 1CJVB 4JV2A 1WDTA 3OW2R 1NPPA 1S99A 4CO5A 2KXNB 3T41A 2IM2A 3MM6B 2XSJA 1R3NA 4U96A 4Y2IA 3WBZA 1RTHA 4NLRA 4G1IA 4DZDA 3FSYA 5DS7A 2W7OA 4ED6A 3RB3A 1HQEB 4TLRA 2GJIA 2P9EA 3CD6S 2ZJPQ 2COLA 4I64A 2HWIA 1X4FA 2AJ0A 1BXNA 2MKYA 4X64F 1YJRA 3D54A 3HJVA 3ZTSA 3PRVA 4Y28C 3NG8A 3M9NB 2FY1A 2ZKTA 1P6TA 3H90A 5J1EA 4LBPA 5D0RA 4DZ6A 1VC5A 2YKAA 2YBVA 3R7BB 2DCLA 1FFWB 3G9CA 4K4UA 3CDEA 5ETRA 4MMOA 3HJFA 1QAJA 2WVEA 5F8GA 2BJ1A 5KFOA 2NREA 4NASA 4OLPA 2ZE2A 2OPRB 3H40A 3A8JA 1CBKA 2LECA 1S6PB 3DOMA 4L3KA 3PYEA 4B3RJ 2UUTA 4L74A 4PEOA 5J2MB 1CLFA 2PD1A 4GRSA 3KTQA 3QJJA 2XZWA 1C0UA 2GFFA 3EVMA 5FIIA 4XO0A 4ECTA 2JVOA 2J0XA 4DSFA 1PBUA 2MKHA 3O5TB 1FX4A 2GV1A 3FVYA 2A3JA 2D9PA 1LQ9A 2Q3PA 3FZ2A 3MTKA 3MCMA 4GVLA 4IG0A 2MQNA 2V8VA 2BM0A 4BBYA 1CG2A 3O6QA 3KLGA 2ZH7A 3KJVA 4DR3F 1EHWA 1FTRA 4A8KA 2J6UA 3L3CA 1PYOB 3CDBA 4FKXA 1F60B 1QUVA 2NUUG 3Q83A 3MPDA 3JTNA 4DFMA 4PWWA 3EXCX 1V3ZA 1HA1A 4N8OA 3QZ8A 2QO3A 2WVCA 3CDUA 2CPEA 2EFNA 1Q78A 2YNIB 1VQ5S 2Y8WA 1W25A 3SSSA 1NBEB 1MW7A 2CNOB 3CWJA 1F2HA 4CQ1A 2XYHB 1YRTA 2PI5A 2BW2A 1BQMA 4EUVA 4C2MA 3J7ZT 2WOMA 5LMUJ 3W8PA 2HLTA 1QDUB 4DL7A 4EO8A 3KDNA 3L9ZA 3NKYA 3W66A 2E1MC 2F9JA 2JEGA 2OTLS 3R2CJ 2VFUA 4J37A 1TFYA 2G4BA 4OHWA 1HYSA 4PCQA 1ZBTA 1EQMA 2GVZA 4ZOSA 1QY7A 3D9BA 2BW7A 2V8DA 2HQFA 2F65A 4TU9A 4DFJA 2DJWA 5LMUF 3C6UB 3CIZA 4ECSA 5GAGU 4BWMA 2C2EA 4DS5A 3FEYB 1S9GA 2E7XA 2JFDA 2W8LA 4Q8EA 1RTJB 2KJWA 4DUZJ 1GXLA 5B08A 3DRXA 1U2RA 3KLGB 2K1RB 4NWBA 4B9MA 4F3OA 3OTCA 3I82A 2FJVA 4RW6A 1KHVA 2XG8A 2YWWA 3MAAB 3MEGA 4EO6A 3AY0A 2LQ9A 2UXCJ 2RH3A 1QE1A 3FMBA 4F4AA 4RUCA 4ID8A 3HT0A 3IRWP 1LK7A 1S0NA 3D28A 2DGUA 1C0TB 3IG1B 5EHHA 3DLBA 2OPQA 2DXDA 5MLCV 1TMMA 3TANA 3I0RB 3OPKA 4LF9J 1VGYA 2YKNA 1FFGB 1SVDA 2KVQE 3LOUA 4PQUA 1UEVA 1I3OB 3ETOA 2MJNA 2W25A 4UQTA 1VBYA 3K0JA 2EXUA 3EZUA 2QL9B 3CJ3A 3VWSA 2LQJA 1VLOA 2AWZA 3PYDA 5HATA 2RNEA 1Q8LA 2ROGA 4JP8A 4LT6A 5HJYA 2MGZA 3KYLA 1KLNA 3QATA 2HHHJ 3G6YA 1Q7YT 3G6XA 2HKEA 4CO4A 5T14A 4DL3A 1S1WB 3ICLA 5CCLA 4FYYB 4DV4J 1IKVA 3ZZ0A 2J8SA 1VQ7S 1FVQA 1N5TA 1W2BR 1LW2A 4F04B 4EZ9A 4U8YA 2MQ8A 4O44B 1P9YA 1VC6A 2IVFB 4UY85 4W90B 4NCBA 3JS9A 3NCPA 3UCUP 2KZZA 4GKJF 4A8QA 1JNZB 1Q16B 2C3UA 2OLWA 3Q24A 4K50A 1RLDA 4P72A 1Q8KA 3MFIA 2UUCF 4MFBA 5B0EA 1VIOA 4TU7A 2ZDOA 2WSCC 2Z56B 2OH2A 1RWMB 1RU2A 4IQMA 2IRUA 2MTLA 4V19X 3CULA 1PYSB 1JLCB 3M2VA 3D3BJ 3IAS9 1MWYA 4K7QA 4H54A 1NJIT 3FBBA 2XYPB 4PXCA 4DPYA 3B4MA 3H2LA 4P6QA 1CEZA 4MKBA 5F3TA 4F0MA 2QJ3A 3DDKA 3EGWB 1FNMA 2OPQB 3IR6B 3PFOA 3M8SA 2W9CB 3DXBA 4ZLPA 2G0CA 4DQPA 2E7VA 3LP1A 2YXLA 2F8EX 3V4MA 1N36J 4U7UK 3UN3A 1WUUA 2RDDA 1AW0A 3Q8VA 2YPZA 3V81B 1JLAA 3DRSA 3N6LA 4WK1A 1V9OA 3RRHA 1DRZA 3T9NA 3DOKB 4HL9A 3NNHA 2C3MA 2AYBA 5A2QY 3HF5A 5AJ3J 1UVMA 3CCZA 3RRGA 1U0SA 3MECA 3HVRA 1HR0J 4F02A 2P9GA 5F41A 3KJQB 5HI7A 3UD4P 5L9NA 4NXNJ 2WB1D 1RHMB 3GJSB 5C25A 3KHRA 5KG1A 2VDHA 5CCMA 3CPWR 3PNIA 1VK8A 2HVZA 4OQJA 2VA2A 1DLOB 2OUGA 3ITHA 4KHRA 4RL1A 4ENOA 2KFZA 1HYSB 2MHNA 1RAJA 3J81j 2ZVIA 2EFOA 1IKXB 1GAOA 1SC3B 2QYGA 5HQ8A 1TL1B 4IFVA 5HO4A 2F1FA 3AB2B 2IA0A 4M63A 4IR9A 4DCPB 2J9EA 2IPOB 4H4KA 3RZAA 2Q66A 2VL1A 1U0HA 1VLYA 4TYBA 5L8RC 1L3SA 3NNCA 7FD1A 2HVIA 2LDYA 2V6AA 5GAEU 1PAEX 2CJKA 1TQLA 3H20A 3KLFA 4V1Ak 5KFIA 4X4TA 1TKZA 2N4CA 3POTB 2HRUA 2VBWA 3K8WA 3MD3A 4DR7F 2XY7A 1RHRB 4RKUC 1C1BB 3VF0B 2M8HA 3S01A 1VHFA 3H7HB 3P6YC 3MR7A 5HL7Q 3KMSA 3TAPA 3GWCA 2W2PP 4IOCQ 5IWAF 2CNNB 4IOBA 2FYXA 4ZVUB 3TAMA 4WU3A 1NKBA 1ZM4A 1XR6A 3G82B 3BBBA 4EK2A 3KK1A 1S79A 2ZBCA 4OZ5A 4G1QB 4B9UA 5CYMB 2B6AB 4WYLA 5GAHU 1SL2A 5DDPC 3MGJA 3RU0A 1RADB 3L4BC 4ILRA 5A6PA 1WI8A 4EBEA 4YR3A 3CD5A 1Y5NB 2CZVC 4QYRA 4Z2XA 2GQQA 1T95A 4NA2A 1EZZB 3PRBA 3OR1B 2R7TA 1ELOA 4B3TJ 1R89A 2E7WA 3M05A 3M2UA 4OX8A 4ZVRB 3W7BA 4DG1B 1FDDA 2PFDA 2PMWA 4KO0B 4DR3J 2FJDB 3ISNC 5T7LA 4U8VA 3JSRA 1F3FA 2N7YA 3J80Y 1VIXA 2JOQA 1X4EA 4TY8B 4WP3A 5ETKA 2IBOA 2Q6BA 1WHVA 3LGHA 2AP6A 3MM6A 4QQBA 3AD9C 1YJ7A 1WTFA 5LJ3Y 2G2ZA 3JSBA 5IFMA 4F67A 2XO6A 5KG2A 3A4TA 4B3MF 2HFZA 1Z4UA 5ETNA 4EBCA 1B0PA 3ITHB 3IP0A 4IFVB 2YWGA 3L7UA 1RT5A 3GJQB 2UVWA 1UCNA 2EBEA 2XLIA 1JKHB 2ZH4A 4IDKB 3BEGB 1DLOA 2C2NA 2WSFC 2HAFA 1UL3A 2I38A 1YZ7A 2BRLA 3MECB 3X3UA 2QA4S 2F4VJ 1YITS 1UJ6A 3W5YA 4DL0C 1RT3B 1WF0A 3DN9A 2FDNA 3NEKA 2XCPA 2HHSA 3DRSB 1JLQA 1VBZA 5KFCA 2W1BA 4PRFA 1I51B 5LSLA 1LK5A 2UV8A 4LF6F 2YKOA 3OXLA 4EU0A 1JLAB 1FXRA 1N33F 1CJUA 3PEJA 4DUZF 1IN0A 4M5IA 4CCHA 4W4MA 4KYZA 5A2QU 1HARA 2YQ1A 3W65A 4F4WA 1LKZA 1TVRB 2YVSA 3ZTOA 3QWUA 2MPUA 3NBPA 2GMLA 1Y5IB 3KLEB 2W9CA 1TL3B 2EVZA 4NPOA 2XS7A 1FDNA 3MHYA 5A0YB 1S9EB 1XEZA 2DITA 3W5ZA 3TUJC 3LH2S 1RAEB 3FJ2A 5D4NA 4ZP8A 1TELA 2R2RA 4ZPVR 3BO2A 2EK1A 5M2UA 5DQIA 2VKZG 3HZGA 1OPZA 4LJMA 3ILOA 3CCSS 1FEHA 2NPIA 2DH7A 4FYWB 4K59A 5LMNF 2HZCA 4N56A 4JOUA 4J9KA 1ZM2A 1HPZB 3H2UB 4M5KA 1G1XA 1U1LA 4JI7J 3Q8RB 3R2DJ 1RLCL 1DTQA 3LP2A 1HHTP 5C2GA 2P6TA 3EGVA 2AW0A 3DLKB 2DO0A 3R6GB 4NMXA 1YKWA 2JDJA 4OYAA 1N0UA 3CCMS 3HLUA 3M1VB 1Y4ZB 3DI6A 5JMNA 2I9SA 5DDQC 5I42A 4QBUA 4OYXA 1VBXA 4OYIA 4A8WA 1HNWJ 4JV5J 2J9DE 4PYDA 3K59A 2AHOB 1KTQA 1WEYA 3TJAA 3BM7A 3TUZC 4NEYA 6AT1B 2HRTA 2HBRB 1IM6A 1S7IA 1FF2A 2Z30B 3AQOA 1JLEB 3P3DA 3ZO7A 4FYVB 4ALZA 2VD3A 2FHMA 2MDAA 1ZZNA 1RA7A 2OMOA 5GAEI 4X66F 3NY0A 1Y0HA 4I7FA 3F41A 4KE5A 4ER8A 3EYZA 1TTHB 1QE1B 4ECYA 1T3OA 4URQU 4DCJB 1YGYA 4DSIA 2ZNZA 4LF9F 3TJ9A 4DN9A 4LRDA 2DPIA 4C8OA 4ZVOB 4Y00A 2IJRA 2BOPA 5KFZA 4DSEA 4X66J 4EFAC 4FYDA 4K4YA 1S0VA 3D1HA 3ZNJ1 1WDDA 2R3VA 2MY8A 4I6AA 5KG0A 1VQSA 2H3EB 5IV4A 2CDQA 4IOAQ 2XLKA 1D9FA 3VV2B 4C97A 1S48A 1VHIA 4K4TA 1MG7A 3BGOP 2DR7A 2BACA 2K8GA 2V63A 3O2IA 3HKZD 2N3LA 1KBRA 4USIA 4XPEA 2OAUA 2RKIA 1TMJA 4ZCIA 2X7IA 2GVZB 4P75A 1AUDA 3MEDA 3TQEA 3QBCA 3D0IE 3A8EA 2VQFJ 2Q1LA 4J9PA 2OIHA 1HNWF 4PXDA 3M30A 3PFEA 3TX0A 3HFKA 2YH1A 1REVB 3MM7B 4OZNA 4CT9A 3MUMP 1IUJA 5D77A 3TEHB 3UD5A 2NLWA 1HNVB 4LRBA 3KUGA 2DGVA 2BZ2A 2FD2A 5E2QA 1NK6A 2Z57B 4OX7A 1QVGR 1RAHB 1M5HA 2EG1A 2KYXA 5AXKA 3OT9A 3FFIB 1RT6B 3OVSA 2ZC3A 4FPRA 1RWWB 4Y6IA 3MOJB 3PX4A 1GTEA 2CFXA 2JSXA 3TA0A 3ILJA 2QZ8A 3D1OA 4WP8A 2CQIA 1OO0B 2LLZA 2VHGA 1T8EA 2BDPA 4NE9C 2VFVA 3NWRA 1W2IA 2VJUA 4JI3F 2CQ1A 1C0UB 1D8YA 1RI7A 4B3MJ 3RB0A 4PWDA 3QGPA 3BBCA 1ROFA 2E1PA 2I0XA 1JK9B 3OSNA 1HBNB 1TKTB 2CPXA 1SH0A 1UEUA 3HFVA 5I3PA 3SDEA 3AQPA 3PM9A 3DGPB 3QPIA 4ZJLA 5J2MA 2N3OA 3K5OA 3NNAA 2HQDA 4ICLA 2HHVA 2FVQA 1HD1A 2ZWPA 4ZP7A 2W01A 1VK3A 3QGIA 3V6HA 1JXEA 3KLFB 3FBEA 3IBCB 5D3GB 1SV5B 2QA1A 3M8PB 2ZE2B 3HCXA 3MM8A 4F36A 4DLEA 4UY8T 5H1SV 2Z2LA 3IRXA 3MM9B 2GNKA 2UVRA 1RAIB 2QT7A 1NSAA 3VAJA 3ZZTA 2XY6A 1HWIA 4RW4A 4ETZA 3W2WA 3DI6B 1U6FA 1URRA 1GMVA 3NCQA 3RW7A 1RWVB 4ZVTB 5HMZA 2IJFA 2ZZTA 1T9YA 2WVDA 3LP2B 4QZVB 3SQGB 3CC2S 4ELUA 5BYQA 1OSDA 2A2DA 2KG1A 4BWJA 1T3NA 1Q5YA 3KHLA 1PILA 5JUMA 4JB8B 3PW5A 1U1NA 4ANDA 4X4RA 4DBQA 3M2RA 1NRKA 2FLOA 2QRRA 2L48A 4NEZA 3KHHA 1RWNB 1RTHB 1ZS6A 2OSRA 5ETSA 4X65J 4TQSA 3V4IB 2D69A 4JV5F 2RSQA 1GXUA 3E01B 4C8YA 2FJEB 1HIYA 3D6MB 2Z58B 1N5SA 2DNLA 2XYGB 1RTIB 3GFYA 3NLCA 2PA8D 2VBZA 4LREA 2M4MA 3R1HA 2Z0GA 1HBMB 2DISA 5F9NA 1N48A 3C2PA 1KSPA 4OJ1A 2R7WA 2DT9A 3DRPA 4PQAA 2YTCA 2DY1A 3KK3B 2HNZB 2R7VA 2X3GA 1W7WA 2B4OA 3MEKA 3SCLE 4J9NA 4LFBF 4KIAA 2BABA 1REGX 5HROA 2F7VA 2WVBA 1WHWA 3EDQB 1UFLA 2MKKA 1NAQA 1MWZA 2EKNA 2F4FA 3M6UA 1TK5A 2ZUAA 3GFZA 3MUTP 5F8JA 4H4OA 5CAAA 2B4UA 1UP1A 1E6VB 4BC9A 1SJRA 5DZ7A 4QPXA 1YJWS 1Q86T 3RBXA 3UQSA 4KGXB 2HPUA 5CZXA 2NYHA 4HI1A 3TW0A 2AD9A 1D09B 4XDDA 2V69A 3D0HE 4KH1B 2AX1A 5KFVA 4PWUA 4K0KF 1K47A 3A1YG 3UVJB 2FJXA 4USJC 4I69A 4K2JA 3HM9A 4RR5A 3CJKB 1P9QC 3LWMA 1UVLA 5KT5A 3GSIA 3BO4A 1ZTWA 1BQXA 3SBMA 2K2PA 4HT7A 3QT5A 2GHWA 3EPGA 4IFYA 1NEEA 4L72B 5CABA 2QL5B 1TL5A 1IXKA 1UETA 4Y34A 1DZ5A 4LIRA 5IM0B 2XMKA 3PHEA 3TWZA 4K4VA 2M2BA 1LFPA 4XDCA 5HK4A 1HLWA 1R31A 4HEA9 2FQQB 2DRDA 2YNGA 3IO1A 4IG3A 4QIEA 3ZTRA 3J81U 2QIFA 2AMCB 2HBYB 2R8HA 3BDPA 1PG5B 2B0GA 3RRKA 1SJ4P 3DMJA 4QR2A 4BHQA 3PY8A 2XY5A 1GK8A 2CJBA 3DLJA 3W9IA 2J8AA 4DR2J 1DTTB 1NK5A 2KFNA 1UEKA 3JYTA 4N76A 3H5UA 3LANA 4C11B 5G4DA 2UXCF 1FNOA 5HMXA 2HNYB 2VQEF 2MKIA 3PIPQ 3G71S 2IMWP 2WONA 4HH0A 3IR7B 4WXWA 3MWBA 3T5KA 1VS3A 3L7OA 5KAKA 2VH7A 3C16B 3K2YA 4ILLA 3NGRA 4J9VA 4ELVA 4X64J 4MKAA 2ZOGA 2WONB 3BSCA 1U48A 2FC8A 1EP4A 2VU5A 3LO3A 2F40A 2DNRA 4DSJA 1JX4A 2GGPB 4MT1A 3D2WA 4AUKA 1CVJA 1KOOA 2R7UA 4LFCJ 4QW8A 3TO8A 2A6MA 4AT1B 5EWGA 2VC0A 4FZVA 4DV5F 4EBDA 3HI9A 4BCAA 4CLTA 5C42A 3VTIA 4PWDB 1G7CB 2QE5A 2ILYA 1D0EA 5EX3A 4PXBA 4QYZK 3HHLD 2FHJA 4LIWA 3R97A 2U1AA 3I56S 4KRWA 2BEFA 2ZM6F 2IDLA 3P5TL 1DAXA 1M1HA 1TU0B 2SXLA 4DEZA 5CA5A 3G6VA 4DV5J 2D1CA 2V8HA 4RUAA 4QCLA 1FXLA 2VPYB 2VOPA 4YDXA 4TKTA 1NDCA 1VJQA 4JI2F 1YJ9S 5KFKA 5IWAJ 3R7SB 2DGSA 4E98A 1H7WA 1RBLA 3F56A 3GPAA 2UZAA 4DV0F 2VICA 1S49A 4CLFA 1RT4A 1YDLA 1YJNS 1RBOB 9ATCB 3VGUA 6FD1A 2EK6A 2RJZA 1WKKA 5KFNA 5A8RB 2ZH6A 2HFVA 1Q95G 2DIUA 1QAXA 2VQEJ 1S10A 3CW2C 2YX7A 3ISZA 1RKJA 5E3PA 1V3SA 4ZIWA 1GH8A 4F0KA 4Y2CA 2MJUA 4PG8A 4C0OC 1T11A 1TL4A 4FNIA 2XI3A 3CNQP 1L3KA 3BS9A 4JI5F 3BKTA 3ILIA 1FRKA 1EB0A 1I5OB 2KKHA 3A13A 4ID5B 4M94A 5H9FK 1O0PA 3ILLA 4CT8A 4IO9Q 5HQLA 5KG4A 2AJ2A 3BSNA 3BZQA 1MWQA 1WACA 4WFBQ 5DLFA 1FJGJ 3J7Z5 4NXMF 2LVWA 2RT3A 1OSCA 4PR6A 3T1HF 2V5HG 3O44A 2GMHA 4YEAA 3T1AA 1VQ6S 1BQNB 4I2PA 3NP5A 3BKUA 3D66A 5HAOA 2AV5A 1Q4RA 3GFXA 2AYMA 3HHLA 2NPFA 2GMJA 3S8SA 1L3VA 1M5OC 3PR5B 5HN0A 2D3ZA 1JJ2R 2Y3YA 3KNAA 4USMA 2NXEA 4QJVA 3Q86A 5E33A 3OVBA 2X1AA 1V3RA 1QAYA 2K7KA 3FNNA 4CTAB 3OJSA 4AQYF 3NXZA 3PHTA 5CHCB 4CM2A 2VFSA 1GEHA 2DNGA 2Z8QA 4DHVA 4L73A 3SXLA 4X65F 3TI0A 4PUOB 3PKMA 2VBYA 4CRJA 2GZOA 2V2VA 3AHPA 3OFFA 4CH0S 2POKA 2BQRA 2YQ0A 5LJ5Y 1C4AA 4YB6A 1JLCA 4NYPA 1S9FA 1U24A 2QGFB 1RCXB 2OD4A 3AJDA 3EGNA 4I2QB 4PG7A 1OYDA 2ACYA 2O3DA 2RAQA 3KLHB 1U1KA 4F4YA 4EZ6A 5J1EB 2HHUA 3HD1A 1R0AA 4OYPA 4ZMMA 4P52A 5KFPA 2F5GA 1AXQA 1AYEA 2NSBA 2HS4A 2NXJA 3NL0A 1H2TZ 2QFJA 3CCRS 5AE2A 4ERDA 4PKDB 4O44A 2KL8A 2NS1B 5K8NA 1VQKS 4C8MA 4WKRA 2ZBQA 3OFEA 4NYZA 2AGOA 4C8NA 3BR8A 1XR5A 3FZBA 4Y65A 2HHPA 2YNHB 5KG3A 2XSJB 5DRKA 4CM0A 3OXFA 3TZWA 2HZAA 4DR5J 3BJYA 3JTPA 3OFHA 2FVSA 1S6QB 2RRNA 3NMRA 4EYIB 4QWAA 1AFJA 5LSOA 3EZOA 5LXYA 2PO4A 3NOGA 5GVQA 3VQTA 4HHUA 4DPWA 2HQIA 4FP9A 2HMIA 4LRFA 4DV6J 1TL7A 4OYBA 4PG5A 1RHQB 2BRKA 4O3OA 3CC4S 4GKKF 3MUVP 3SQOP 2YKNB 2FZGB 3OTOJ 1NH8A 1CSJA 2XHCA 5IQQA 3C3LA 3DHXA 2Y0SD 1F9EB 3SSQA 1RXOB 2E5JA 1TUGB 1JMTA 1VRQC 1WEXA 2C1EB 3I4PA 1TKXA 4I68A 1FJEB 4CLYA 1RKIA 2IIHA 5KFDA 2IAJA 3NGUA 3NS5A 2G0JA 4ES3A 2J9CA 4CIOA 4KFBB 3Q0AA 3AODA 2QMUB 3WIUA 1NSPA 1N34J 2DPJA 3AAWB 1S12A 1SIWB 2UUBF 2ZD1A 1WI6A 4P2MA 1MSWD 2CPDA 4H4MB 3I96A 1E6YB 4N7TA 4O4RA 4CO2A 3PW4A 1FWPA 3GZ7A 1H2VZ 3KJNB 4C3LA 4ZPAA 2DNMA 2RE1A 5AE1A 3QLHA 1VRUA 1IQZA 2YWHA 5FD1A 3EPIA 5IT9U 5D0HA 3QQCD 1IBMF 3THVA 2E5GA 2BKPA 2FPHX 4DUTA 2LFVA 2ADBA 3A3OB 3OTDA 4P2FA 4OX9J 4NX9A 4NOHA 4O0NA 3UN5A 3H4BA 2ZH9A 1X9WA 3KOAA 1KEKA 3PVXA 4ITSA 2KYZA 2PN6A 1FRLA 2XMJA 3ENAA 4LBHA 1QSYA 2FJWA 2L3MA 5ETTA 2C28A 4J9UE 5KTQA 2OEJA 1SKWA 1VOMA 5HQMA 2QV6A 3AD8C 3AOCA 4X4VA 4OJHA 2EI5A 2UUAJ 2V8PA 3LWLA 2GVDB 1N33J 3OR1A 5D78A 2HHQA 1X4AA 2M3DA 1N5YA 3OL9A 3VGVA 1JLEA 1LWFB 3FDSA 1UZDA 2GO9A 3BSOA 1HQUA 1LXNA 1FKOA 1HBOB 3AD7C 2HGLA 3OSPA 3QWPA 1N8RT 1AZSA 2R8GA 3EGZA 3L7PA 2F63A 3CE8A 3GMGA 4RNMA 3D68A 2O67A 3SFUA 5H9EJ 2HAIA 3M1VA 2AJQA 1K0TA 1B99A 2IFXA 5JJBA 5G0RB 3I6PA 1SQEA 4KY3A 4RO0A 3TAMB 1KONA 1MN9A 3Q8PB 4QPTA 1X9SA 1R0AB 4DX6A 4ZPWR 2IMOA 3U1MA 4WF9Q 3KLHA 2BV3A 3RGIA 1XNQJ 5KG7A 1N6QB 5ETVA 1Q5VA 5IT9Y 4I2QA 4K5RA 3Q8QB 2FLNA 4ZN3A 3CC7S 3PACA 2BJEA 2YKQA 4RBTA 5J1NA 3BH7B 3TNVA 1I94F 1YJTA 3KJFB 2C3OA 4J9QA 4JI5J 3BV8A 1TKZB 4IYQA 4ZCLA 2H5IB 5J1PA 3AB4B 1FKAF 5KT2A 4B9SA 4LF5J 1RSCA 4F4XA 4YP3A 4ZCKA 3MMBB 5C2CA 2OJ3A 4YR2A 2VV5A 2VZ9A 1CJTA 3SI8A 3QJLA 3NBPB 1HQEA 3AT1B 1YRXA 4DR6F 1U0HB 4GC7A 2QLJB 1PKUA 4IUFA 2JEIA 4NLGA 3EE3A 3VALA 1J5EJ 2DNNA 1FWKA 1WOPA 2U2FA 3T1YJ 3TVKA 5B0CA 2GA7A 1W26A 3HXMA 4FS1A 2PGCA 1EX8A 3IBFB 3KNGA 4NXNF 5CYJA 1CQMA 1ZZFA 2LA4A 2P6SA 4XTTA 3NGTA 3JAMU 3PR4A 5BR8J 1TFWA 2XZTB 3Q22A 2R8JA 2HHTA 2MY7A 2OD6A 2DEIA 4USVA 1IBCB 2VFRA 2C3YA 2N7CA 1FXDA 1S1XA 4GO7X 4CLLA 4MH8A 4ZJQA 3M32B 1TUVA 4IDKA 1AUSL 1JKHA 1Z2LA 1FCAA 2XB2D 4QIGA 1RT5B 4YY3F 2UU9F 5KFHA 4YHHF 3L95X 4YFUA 2BE9B 2D41A 3A8KA 4LVOP 4RW7B 1RWUA 1J5EF 8AT1B 1WNEA 1MLAA 1HBUA 1SKRA 2E5LJ 3M2RB 1Q0NA 1Y3KA 2DHSA 2RU9A 4UTGA 1VFJA 4RZRA 4ED3A 2CNLB 1S1UB 4RBVA 4DN0A 2CWKA 1YLXA 3BR9A 2V4JA 3H42A 5I4MA 5CD4A 2ERRA 4LR7A 4AXJA 3Q8YA 4DV6F 3PO5A 4KPYA 1S59A 1WWHA 4ZVPB 3W9HA 2HZVA 1IBKJ 3ULHA 4LF4J 2GJ2A 4ZP6A 1F1BB 1N32J 2B43A 3UR3C 2J7UA 2KRBA 1HW9A 2WW4A 1OY9A 3OTEA 1NJXA 2OO4A 4NMLA 2O1PA 4UF4A 3IRXB 4I1TA 4PG6A 3W64A 3DLHA 1LNQA 1Q1KA 4R25A 1FO1A 5F8LA 1KS2A 3BF4A 3ZTPA 3GTYX 4O0IA 1UA0A 8ATCB 3QSYB 2Y0BB 2ZH5A 1SKUB 2HBQB 4OMFG 3WIVA 4CYUA 2O01C 2ALZA 4ECWA 2GIFA 4GO5X 4NLQA 2DY9A 3C6TB 4LFAJ 2FJBB 2LQ5A 1LW2B 3D6FB 3K58A 2ZEJA 4FDFA 1X8DA 5DZ6A 1KC8T 1IKVB 3RW6A 4M5DA 3C14B 1RHUB 2FGCA 2MSSA 2EFGA 2CQ0A 4JV1A 3NWGA 2W9BB 1BD6A 1YQHA 3MM5B 1HQUB 4JUZA 3C16A 4B9NA
chains in the Genus database with same CATH topology
4JI8F 1SL1A 2DR9A 4R5PB 2JVRA 1ZPWX 3V5RA 2AJ1A 1C1BA 5CH7B 4AL7A 2A2CA 2MZTA 1CC7A 3PRDA 5J2PA 1LWEA 5HBMA 4RX6A 3R27A 4OI2A 2RDJA 3WX4A 2EC0A 3PEHA 5KFUA 2IVMA 1SKSA 2XS2A 3FQLA 1S4FA 3BDEA 4ED7A 4NLUA 3SCJE 4DQSA 1YI2S 1UVNA 2BYCA 4UUWA 1RP5A 4NLYA 3HPOA 1SUQB 4RW8A 2JEFA 2XS5A 4ZS6A 1PGZA 3M9MB 1OIAA 1DQ8A 1O5JA 3VR1A 4IR1A 4ES2A 4KR0B 3N5BA 2CQPA 3C6UA 2M52A 5E3RA 4LSNA 3W2VA 1R8PA 3DCAA 3IA0A 4J9MA 1X4CA 3GG1A 4X4QA 2V4RA 3M8QA 1IM4A 1HMVB 3CSKA 1T02A 1XWLA 2DR8A 4RW8B 3OFGA 2BQUA 2PA3A 1FDBA 4OJGA 4DR1F 3KHGA 2D7SA 3V81A 4F2SA 2RVJA 1ZPVA 3U7JA 1VQOS 3HVTA 5CYQA 2J76E 5I3UA 4FF4A 2PFFB 2D3OR 3T3FA 5GMKa 5CZVA 1VI7A 1O51A 2HYIB 3K5PA 4ED0A 2L41A 2VG6B 1U1QA 5DDOC 1LWEB 5HBMB 3CEDA 2BE2A 4CNZA 1FK9B 4DV3F 1ZAXA 5JXSA 3CCWA 4ZKAA 1WG4A 2CPFA 2O66A 1APSA 2HMIB 4QIVA 2DNOA 3RTVA 4C9DA 1YJUA 5KFYA 5KFXA 2DNKA 2YNHA 3I5AA 4FXDA 2IM3A 2HWHA 4URGA 4WZQA 1X5TA 3E2EA 2W9BA 1TAUA 5L1KA 1G6BA 1RT7B 4JI7F 4M5DB 3ZC4A 4ATNA 5HLFA 1KD1T 3IBWA 5CQGA 2C2DA 4YR0A 3SYZA 4EEYA 1NO8A 2HQ3A 1BWEA 1HNIB 4BDPA 3G4SS 2BUNA 4X4PA 2H5EA 5KFQA 1TP7A 2KJVA 3NMAA 4HDGA 1XK8A 5LSRA 3DXSX 3UWTA 3FGVA 2EFPA 3MZIA 1N52B 5EWEA 1U25A 2G13A 2JJ4D 5E3QA 2RU3A 1T05A 3MOZA 4OFZA 2YX1A 3UDLA 4PUOA 4K4WA 1RT1B 1XMBA 2QSFA 3KLIB 4NYOA 5DG9A 4PQUB 2VPZB 2DGOA 5A6WA 3NGKA 5SUHA 2GIRA 1S1UA 2XBPA 4HHJA 3H5YA 3T9ZA 4I6WA 4J9OA 2IYIA 1ULRA 1FE0A 2MQMA 4DQRA 1F5AA 2HHWA 2B5JB 5KFFA 1JLQB 5FDLA 1NB7A 3ZZPA 2X1GA 4C3MA 1RT3A 4WFAQ 4ID5A 3KLVA 1M90T 2XNQA 4TLQA 4WFXA 4F2RA 2MZSA 3FFIA 3C8YA 1KFSA 2ZOMA 3CT9A 1QVFR 1GNKA 2HS0A 1QAIA 3GILA 2DH9A 5KT3A 4NCGA 1S6OA 2L08A 4MK7A 1PSDA 3UDCA 3HVTB 1SXLA 3BSAA 3IXQA 1KLMB 3THTA 5BYRA 2KM8B 2I5JB 2APOA 4NL5A 2W7PA 1M5VC 2CVEA 1QSSA 4C8KA 1C1CA 2KXHA 4OLOA 1N0VC 3R5BA 2PIIA 4PG4A 4OHZA 2XEXA 2I5JA 4TY8A 4C0BA 5D6GA 1RQ0A 5AXNA 3DLEB 3GV8B 1D1UA 3ZZRA 4LSNB 3W2VB 1F5BA 3LW5C 2OMLA 3FEZA 1D9DA 5HP1B 1HW8A 5LXRA 2LQBA 3M9OB 1YG0A 2KZMA 2RILA 1HNZF 4RWXA 4O3NA 4C98A 4OI0A 2FGOA 2UXDF 1N6QA 2B5JA 3MMJA 1N34F 1UFWA 5CXTA 2QYCA 5B0AA 3N9UC 3KK1B 1OPIA 3TQ1A 2CQ2A 2VBXA 1J5OA 1HWJA 1HI0P 2L9DA 2ZOFA 1VQPS 4AE5A 2MYFA 4OI4A 3T5HA 4NA3A 4L6V3 1HD0A 2VG7B 3TVYA 3MDFA 3CD0A 2LXFA 5K5MA 2FC9A 3LF0A 3H5XA 1FKOB 1HBOA 3CJ0A 4IH7A 4MK8A 5DO2A 2NR0A 1F9FA 1T05B 3HZEA 1NH7A 4C11A 5E41A 4DLGA 2IJNA 3C46A 1ZM3A 1BLUA 4LQ3A 1IKWB 1N5VA 4HTIA 5FLXY 1DTQB 1G3OA 2JC0A 4USHA 3SMZA 1UA1A 3KFWX 2KTQA 2J7KA 2MQPA 4CH7A 1RK8A 4DR2F 2MMYA 4DV4F 2D9OA 1KN6A 1X4GA 5DGBA 1GX5A 1N32F 2YNGB 4IH5A 1RT7A 5AXLA 1JLFA 6FDRA 3CF5Q 4KT0C 4YUDA 2DHAA 4O3QA 2HHXA 3H5SA 3U02A 2ZBIA 1X0FA 5L1LA 4UQGA 2WTFA 3QIPA 4WTYA 1N36F 3QJPA 3DLEA 1RYRA 4KBIA 2E1AA 3PW0A 3BQ2A 4WJBA 2WBRA 3H25A 3LGNA 4K2XA 1X4DA 4Q8FA 2KFYA 3UFCX 3S1TA 1V6HA 2MQLA 4QU7A 2UP1A 4Y2KA 4Y2MA 2YKMB 2BM1A 4FS2A 2LEBA 1ZTWA 3RYLA 3AA8A 5K14A 4HTJA 4DL4A 4FF2A 2CQDA 2VQFF 3N6MA 4X4SA 1VC0A 4LMZA 1T03B 2G1DA 3CVKA 2QEXS 2EG2A 2RF2B 2YY3A 3DRPB 4OV1A 2AGQA 1HBMA 2EFQA 4TU8A 5D4OA 4HI2A 1MNEA 1FA0A 4YDDB 2J6SA 2P9CA 1KQKA 2CQ3A 5B0BA 2JC1A 4TYAA 4DJBA 3Q2TC 2DHXA 1JJ4A 1FHTA 2FUG9 5B0FA 5E3CA 3RB6A 3SQGA 1UJ5A 2PEHA 4ED5A 2NQPA 3K8VA 3TARA 3ZZZA 1FVSA 2JEJA 3RB4A 2LEAA 3DRRB 1FD2A 1HHSA 4FVMA 4DG1A 2V8GA 2IC3B 2XWXA 2KT5A 2JHEA 2VFTA 1IKWA 4U7CA 3CD7A 4O3RA 1NK4A 3DU5A 4WFZA 1Y9OA 5B0GA 1IKYB 7FDRA 3M8PA 4ECXA 2HLUA 4HVZA 4WE1B 2XLJA 1K8AT 3PO4A 2NZ4A 3AJ1A 2B6AA 4MAKA 3DGPA 2DO4A 4KKOB 5SZTA 2MZRA 2KG0A 4M95A 2K7JA 1NK0A 1HBNA 1TKTA 5G0RA 2CYYA 2CG4A 3G96A 2C2EA 2B51A 4CTAA 5LL6d 1KQSR 3DM2A 1Q79A 1HWUA 3U1NA 1QSLA 2JRSA 4KKOA 1QJHA 1ZETA 5HMWA 4RUHA 2EPIA 2CPIA 3HHEA 2CJ9A 3MI7X 2OTJS 1XN9A 1IBKF 3Q8SB 4LF4F 4HT5A 2VC1A 2KN4A 3VZHA 2IHR1 3JAMY 4JV0A 4DV1F 2DK2A 4Q5VA 2R7XA 2MKSA 2DRBA 2LEPA 3POTA 2ZH2A 2VG6A 2MHEA 1ZAWA 2DTJA 1TR0A 2IC3A 1J2VA 1YTYA 2FLLA 4A8MP 3VAGA 4O23A 3MAQA 1GXTA 1X5SA 3MEEB 3PX0A 4OHYA 4OI6A 2B4PA 2DNHA 4O4GA 2C2RA 1FNXH 3NRBA 4JI4F 2MZJA 1ZYQA 2N4DA 1UAWA 2OFGX 1OQ3A 4GMKA 3MM7A 2D3UA 5KFWA 2RQKA 3LAKA 3SFGA 5KFBA 4A47A 3QGHA 2ATLA 4J5OA 2B9YA 3LGMA 2KO1A 4MYTA 2XC9A 1N54B 1BC6A 2UVVA 1VRUB 3GR1A 3N79A 1R8AA 2FB0A 4R0JA 3RAXA 1O8BA 1LV5A 1E6YA 1P8GA 3TX8A 3M32A 2GW8A 3AJ2A 4K5SA 2DVIA 1HI8A 3HDSA 2M8DB 1KR4A 4JBCA 4IG0B 2MZ1A 1D9AA 2OSQA 4XPCA 4LSLB 2R8IA 1A6LA 1WF1A 2CRLA 1DARA 4C8ZA 2ZITA 4ED1A 3CB4A 4I7FB 2NXUA 2LXIA 3ENQA 3FEXB 1R27B 4LF8F 3N01A 3LQVA 1B0TA 3MAHA 5KG5A 4FF3A 1Q53A 2HHHF 5D8HB 3CCVS 2VPWB 2ZNYA 4B9TA 1DFDA 2R7RA 4AL5A 3PW7A 2CPYA 2J0SD 1R7IA 1FT8A 2JFKA 2PE8A 4YOEA 2E5LF 4I4BA 3TP2A 3JYTB 2WCXA 3JSMB 1VMBA 2YKPA 1IJEB 1KHWA 4QU6A 1DHMA 5KFMA 2X1FA 3I9V9 2J9DA 1DBDA 2DNQA 2MB0B 1U49A 2KT2A 4NLVA 3FQKA 1Q81T 1U6BA 3CDAA 2HGMA 3T19A 4Q44A 3C66A 4A4JA 4CH1A 3BQ1A 3CUNA 2CJAA 3UW1A 2JLGA 2RUGA 4J9SA 1F2GA 3KK2A 1VQYA 1CQNA 2GQ2A 3MF5A 3HVAA 2VKRA 4TXSA 1U2FA 1U1RA 2DGXA 4WXOA 1K1SA 4RWWA 3MFHA 2WHOA 4DQQA 2XWYA 1J5OB 1UWBA 5J2QA 2LCWA 2WBMA 4P7TA 1HWLA 2DNZA 2B56A 3L09A 4MYUA 4B3OA 3OLAA 3CCJS 5L39A 5KT4A 1CC8A 2WRMA 5CYQB 3I0SB 2N82B 4LSLA 1CPZA 3Q23A 2ZHBA 2EBGA 2DH8A 1MROA 2PSZA 1I6JA 2UXBF 3E51A 1NJWA 2MQQA 2O5DA 1YJVA 3ZFVA 4KB7A 1H38A 1VJWA 1X7VA 3JTOA 4HLBA 3UI3A 3QAUA 1X0PA 5IT0A 1NKEA 2CPHA 3FMWA 1S7HA 4OZ0A 5EN1A 5AJ3F 3DU6A 3BGRA 5FJ4A 4C7QA 1GQEA 3QZ7A 3OV7A 2LYVA 4ED8A 1H7XA 4M1KA 1PO6A 4H4MA 4P7VA 3ZZOA 1WHYA 3M8RA 1IR0A 1KOHA 1Q7LB 2F8HA 2QMWA 3H4DA 2ZDPA 4JYAF 2ZHOA 3GIKA 2A18A 1XMQF 3MEEA 2EW9A 4N8NA 4CI0B 1YWXA 2EWHA 3ONQA 4O4GB 3M4XA 4JI6F 3M2UB 3B82A 1R6YA 3ZZYA 2ASDA 4DSLA 2ZUGA 3P49B 1Z1ZA 1TAQA 3GQCA 4U67Q 3GE9A 3OL8A 1M5KC 1F0XA 5FDLB 1N88A 3IWLA 3NAIA 3UCZP 2F9DA 2KVIA 5L9XA 1Y5LB 5M2RA 3FCHA 3MR3A 2IYGA 4LFCF 1FRXA 3CCLS 4HYKA 3MM5A 3MR5A 1UKUA 1R8HA 4DR4F 2ASYA 2DRAA 3US5A 4ZVGA 3MR6A 1JJHA 1S1VB 1FDAA 4A8YA 1SH2A 3SDEB 4RNHA 3I5BA 1B7FA 4DF8A 1Y00A 1EP4B 2E5HA 1SJFA 2QA4G 1U8SA 2XSFA 4M8LA 1X4BA 2HNYA 4X4OA 1IKYA 2R7OA 4LF7F 2GX8A 4XIUA 1QLNA 2RQMA 3QO9A 2VG5A 3GV5B 2BQ3A 4G1PA 2M70A 2BJDA 4QOTA 4RLEA 2AX0A 2VUGA 2W24A 5AXMA 1HNIA 4RU2A 2BA9A 3TRGA 3DRRA 3CCTA 3X1LB 1R8BA 4F4ZA 4WKYA 4R8UB 1REVA 2MKJA 2ZZMA 1RYSA 1S97A 4ZPTR 5F9LA 2LKZA 1H98A 2K3KA 2J0QD 2DIVA 2M88A 3CIMA 3DC2A 1S0MA 4ZK7M 3RR7A 2E9ZA 5BJRA 3DHWC 1MMDA 2AJ4A 2DGQA 2JL9A 2HG4A 3OBIA 2BE2B 5EWFA 2NYIA 1DURA 2ZD1B 2YWFA 3N4WA 5IQ6A 1SL0A 1DJ0A 2YKMA 3CCES 1SH3A 1Y3JA 5I3UB 4EYHB 1XC9A 4QIFA 1B0VA 4DQIA 5DQGA 1MROB 5K9FA 4YB7A 3N0VA 1ZOTA 3K57A 4H4OB 4CO3A 2I8EA 3I31A 5HMYA 4OX6A 3R5CA 4JI0F 2W7AA 5HROB 1TKDA 4I0WA 3MXHP 1LOUA 3D5MA 1ZM9A 3PJXA 4AL6A 2PC6A 1U47A 1H0HB 1WG1A 1U26A 3QIPB 1RTIA 1YVFA 1RDRA 2OPPB 2MQOA 2C3PA 3J81Y 3M2VB 4NLWA 2CZ4A 4I67A 4KV8A 2ABYA 3VAIA 3NGDA 5L38A 4QYZJ 3T1YF 2V4QA 3V4IA 2XCAA 2JLFA 4P2SA 2FVPA 1K1QA 3G8TA 2XO7A 2GQCA 3IR5B 4QR0A 2Y1RI 4MKYA 4LFAF 1HNXF 1UVJA 1LFWA 1RGVA 2AJFE 4HH1A 4NLXA 4IH6A 1VQLS 4ZHRB 5A8KA 1JB0C 4UW2A 4MIWA 4EGLA 4F4KA 1KQFB 2VG5B 1YIJS 3QO9B 4URSA 3GIMA 3H2VE 3DDNA 4C8LA 4TNOA 2ZZNA 3BGFA 1ZAVA 2MXYA 3NCRA 1L3UA 3QMQA 3OR2B 3RAQA 1SV5A 1S1TA 1EETA 1JLGA 1LWFA 3MM8B 4NA1A 3WC0A 3H59A 5F3ZA 2BXJA 2ZH1A 3T6BA 3KMQA 2AQ4A 2HWTA 5KFLA 5IS2A 2MKCA 3FRZA 2M5YA 2CQGA 4OJ3A 5K8PA 3KLEA 1VC6A 4WYWA 5DG8A 4LQ9A 2HFOA 1H3DA 1TVRA 1S1VA 2GO8A 1QUPA 3I0RA 4I6YA 4ZPBA 3MEGB 2KH9A 2OKQA 3NS6A 5J2NA 2DCUB 3PX6A 4UUXA 1X9MA 5I3QA 5A8WA 2E1CA 2PI4A 3GYXB 2YH0A 3UE2A 2PDAA 4C3KA 3MPVA 4H4KC 2FTRA 2VASA 2QSWA 1FRMA 3MD1A 5AE3A 3UPFA 4X4UA 5EDWA 3BREA 1FKPA 3GSDA 2R8KA 1S9GB 4Y0FA 3THPA 1X5PA 2E29A 1KFDA 5F8MA 2ZH8A 3MURP 4BS2A 5M2PA 1SIZA 3MTJA 1HNVA 3DOLA 3CJKA 4NLTA 4F8RA 4OHXA 1S6UA 2LDIA 3DFEA 3PIOQ 3T5JA 3DYAB 1VQ4S 1KLMA 2E9RX 3N28A 4RW7A 4G6VB 4WU2A 4F3QA 2OP5A 3UNGC 2VPXB 1HFEL 1H6KX 2E5IA 2RKIB 2DBBA 1R43A 4NLOA 2W8KA 5JVGQ 3WZ0A 1XBWA 5KFAA 2K3IA 3DNCA 5EUHA 4DWIA 3P96A 3IWNC 3KJVB 2HNZA 4YQWA 4UOCA 2J6TA 1Q8BA 4ES1A 2ZKUA 4MIBA 5L1IA 1OQ6A 5EX0A 5A8WB 3RBEA 4ZA1A 3G6ES 2GHVC 3I0SA 5D4LA 2LMIA 3PJWA 4QR1A 1M1KT 4B3OB 1OWXA 3CMAS 3TYTA 3MMCA 2OPRA 4NZ0A 4YB1P 3KG1A 3MMBA 3H8YA 1KTVA 4RNOA 2BANB 4PPZA 3VAKA 2ZFHA 2D74B 2X51A 1S1TB 4DV2F 2CKWA 3HKWA 1AROP 4KAIA 2JX2A 4KC5A 1G2EA 2GCFA 4RW4B 3EUNA 2B7CB 2AYGA 3MM9A 1FJ7A 1K73T 1Q8IA 1PC4A 4CNYA 5D3GA 3EX7B 1NNDA 2RRBA 4A8OA 4ZHRA 2BANA 5A8KB 3KLFB 3IFEA 1HI1A 1MSWD 2RS8A 4ICLB 4R0EA 1YSJA 3OQ2A 1P1TA 2RQCA 2FHJD 1DQAA 1GX6A 4Y2AA 4DL5A 3HHLB 5IM0A 3IGVA 4KV8B 1BQNA 4I2PB 2KHDA 2OPPA 2ZC4A 2RIJA 1YRUA