The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
88
|
structure length |
88
|
Chain Sequence |
EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Alanine Scanning Mutagenesis Identifies an Asparagine-Arginine-Lysine Triad Essential to Assembly of the Shell of the Pdu Microcompartment.
pubmed doi rcsb |
molecule tags |
Biosynthetic protein
|
source organism |
Salmonella enterica subsp. enterica serovar saintpaul str. sara26
|
molecule keywords |
Putative propanediol utilization protein PduA
|
total genus |
19
|
structure length |
88
|
sequence length |
88
|
chains with identical sequence |
B, C, D, E, F, G, H, I
|
ec nomenclature | |
pdb deposition date | 2014-03-03 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |