4P2SA

Alanine scanning mutagenesis identifies an asparagine-arginine-lysine triad essential to assembly of the shell of the pdu microcompartment
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative propanediol utilization protein PduA
publication title Alanine Scanning Mutagenesis Identifies an Asparagine-Arginine-Lysine Triad Essential to Assembly of the Shell of the Pdu Microcompartment.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar saintpaul str. sara26
molecule tags Biosynthetic protein
total genus 19
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p2sA00
5L38A 4P2SA 3NWGA 3DN9A 4QIFA 3SSQA 4RBVA 3MPWA 3PACA 4QIGA 4OX6A 2A1BA 2A18A 3I96A 3NGKA 4RBTA 2A10A 4P7VA 3BN4A 3N79A 3CIMA 4OLOA 3DNCA 4RBUA 4PPDA 3H8YA 4LIWA 4QIEA 4AXJA 4P7TA 2G13A 3IA0A 4OX7A 4AXIA 4QIVA 3I6PA 4DDFA 2EWHA 5DJBA 3VCDA 4OLPA 3SSRA 3SSSA 4OX8A 3MPYA 3CGIA
chains in the Genus database with same CATH superfamily
2I0XA 1PIEA 4AFFA 1MWZA 1DURA 1LWCA 1U1LA 2A6MA 4HT5A 5GAHU 1M5OC 1GMWD 5KFPA 3M32B 2DKOB 5D78A 2QLBB 5EGYA 1M90T 2DNGA 3BQ1A 9RUBA 1X8DA 3K5NA 2ZBPA 2JLGA 3R6LB 5BYQA 3MHYA 2KXHA 3CTRA 4LBHA 2YQ3A 3SDEB 3DRRA 3MMAA 2V8DA 2HFNA 3QAEA 1SL2A 3PRBA 1J5OB 3SEOA 1BGXT 1WKKA 3VQTA 2KN4A 1Y3JA 4OHVA 2XMKA 1T3OA 1SKSA 3DLJA 5IWAF 4QBUA 1S0OA 1T8EA 1N6QA 5F8IA 1M1GA 1VI7A 1U48A 2JWNA 4P2FA 4OZLA 4KB7A 3NOCA 2N7CA 1RB0A 1TFYA 2E5IA 1PYOB 3RR7A 3Q0AA 1TL7A 3IWXA 1R8HA 4C3LA 1L3UA 2QO3A 3DRXA 1X4FA 1QJHA 2HQCA 3KG4A 4QIWD 4JI5J 4MK9A 2FJVA 1Q8IA 1PJ5A 2V2ZA 1WELA 1RT4A 2K3KA 5LSRA 4DV4J 2DGSA 5DETA 4PUOB 1D8YA 4DV6J 3L3CA 3UWTA 4MK7A 4LFAF 2CQIA 3GCWP 2XGQA 3QT8A 1ZS6A 1CJKA 4D3HA 3D6TB 5J2MB 4WE1A 2AJQA 2RAQA 2MKIA 4DL2A 5HJXA 2CUYA 2E7WA 4DPXA 5HMWA 2QSFA 1NK9A 3UNYA 1B0PA 4WKRA 4WYWA 4DL4A 2MB0B 5KG1A 2C3PA 3QT6A 4M5DA 4G1PA 2W9AA 4JV5J 2HFZA 4UUWA 4DV4F 3RRKA 3G71S 3HHLC 3I82A 4DV6F 3ENWA 2V94A 1U45A 4ZP8A 3M8SA 4QWDA 4MYTA 1F1BB 4X2BA 2CJXB 1IKYB 1JLCB 2Z56B 4ELTA 5E3AA 2OJ3A 1FFGB 3KUEA 4C0OC 5L9NA 2FY1A 1VDHA 2MZRA 2G1DA 1N5YA 2GNKA 2IFXA 3OL8A 4OI1A 3QBCA 4AQYF 4JI2J 1H74A 1X4HA 1RSCA 3BGFA 3KWMA 2XY7A 2XC9A 3ILJA 4DQQA 1KQSR 3BYPA 3M8ZA 1WHXA 3MECB 4TQRA 2KZZA 2CQDA 2QLXA 4JV5F 1KDNA 1DRZA 2ZDOA 5BYSA 2ZUGA 1RT6A 2HPUA 5IQ6A 1S1WB 1MWYA 1OS5A 4JOUA 4DV7F 2DHHA 3DGPB 4DR3J 1WF2A 1IKXB 1FKAF 3GFZA 2Q66A 3MEGB 2CG8A 1Q7YT 2BACA 3OSPA 4LF6J 1MSWD 3D9BA 3QFHA 4WIQA 1FKOA 4DSIA 3PYGA 4J9NA 1SKWA 4PXBA 2AHOB 4ZCIA 1C0UA 2E1RA 3UR3C 5J2NB 1UJ6A 1TKXA 1MU2B 2XCPA 2UXBJ 4TQSA 1P27B 4DR3F 3V6HA 3CD5A 1FJEB 3MGJA 4DWIA 4DR7J 2PSZA 1UP1A 4DSEA 4LF6F 3TJAA 3Q83A 1V3SA 3QQCD 2W4CA 1EETA 4A8WA 3CD6S 1HIYA 3I4HX 3J80U 2X1GA 1N36J 3BJYA 3CMAS 5E0OA 2E9RX 1S9FA 4CLTA 3VAMA 3QJPA 4RW9B 5E3CA 2Z2ZA 4EK2A 3DI6A 3EWGA 3GU0A 3LW5C 3W2WA 1C4CA 2H48B 2UXBF 2HFOA 3NGSA 1PAUB 4HR2A 1XNQJ 4Y28C 1MROB 1RU1A 1U0HA 3G9CA 2RVJA 3H20A 2KRRA 1Q82T 5HJYA 4LVOP 1R8AA 1URNA 2WVBA 3NOGA 2LQJA 4E2FB 2DEIA 2ASYA 2MSTA 3BN7A 3I9ZA 2GJIA 2XLKA 3H4BA 2CJBA 4J9MA 2H9ZA 1RTHB 4ZLPA 2DGOA 3HKWA 5B7WA 1PO6A 2V67A 4DZ6A 4LF7J 1FNOA 3ETMA 3ETOA 1XNQF 5J2PA 1HKAA 2HBYB 3VGTA 4WU2A 2HBRB 1Y9OA 1NKEA 1AUSL 3K5PA 5KFYA 1WG5A 3M8QA 2AX1A 1K73T 3HXMA 4O3PA 5KAKA 5CCMA 5IT9U 1OY8A 2BANB 2LEAA 4QCLA 4WTYA 1VQ7S 3ZO7A 1S79A 2KYXA 5HROB 3BS9A 1U1KA 2JVRA 2B51A 1NJIT 2PMZD 3ADAC 2RU9A 1Q78A 1Q16B 1IR2A 3BKTA 4KKOB 4Q7AA 3HZGA 1HMVB 1VRTA 1R89A 3LGHA 4NLUA 1TMJA 4J37A 5B0FA 4WFAQ 1OYDA 2FVCA 1LW0B 3I0RA 4KHPJ 4LSNB 4FXDA 1P8GA 3E2EA 1T9VA 3VAIA 3TUIC 4LUBA 1NSKL 1HWKA 5ETSA 4KGKA 3CDUA 3M05A 4O3NA 1RJJA 3EGNA 2YKNB 3V4MA 2EI5A 1KLMB 5LMNJ 4DV5F 2ZVIA 2G0IA 1S1WA 1EP4A 3MR2A 2ILZA 3PV8A 4GVBB 1FRMA 2BX6A 3EPIA 2BMBA 1RT7B 3DFEA 1FRHA 1RT3B 3WIVA 3ZNUA 3DM2B 3KJFB 1QUVA 4USVA 4YR2A 2DH7A 2MGZB 4ZPCA 3BEGB 1FWLA 3LP0B 4OI0A 2HHUA 1KR4A 5J2NA 2NREA 3TNVA 3M6WA 2VDHA 1EJ7L 1K1QA 2J0XA 3T5HA 1IR0A 3MI7X 1IXKA 1KP6A 2FTRA 3N0VA 1M0SA 4QPTA 1TZ0A 1X4AA 1T9YA 3K5OA 1JJCB 1A9NB 1IKVB 1RTDB 4FYDA 2XWXA 4G1QB 3RYLA 4QIFA 3SCJE 2CPEA 3CT9A 2GJFA 4WFNQ 3I55S 4HHHA 1UVNA 3GYNA 4ZPAA 3DOKA 2QL5B 1WHWA 4ZPTR 3KNGA 4FBTA 5KFKA 4A8XA 3VVTA 3W66A 2EG1A 2AU0A 1UMJA 3HO1A 1CSJA 2CQGA 3ZTOA 1WUUA 3BH6B 2F4VJ 1FXRA 4N8NA 2KKHA 3CCUS 4F25A 4ED5A 5I42B 1NAQA 3LOUA 3EZOA 1A6LA 1FFSB 5EX3A 5CCLA 4LRFA 4NLYA 3DHWC 1Y11A 1FWPA 2MQQA 4RR5A 4BCAA 2G2YA 2CJKA 4AD6A 1WKJA 5SZTA 3KYLA 1RACB 5K8MA 3H98A 3KHHA 4WXWA 3GIIA 1FXDA 2FJXA 1WEZA 3PG9A 2W9BA 2ALZA 1MW7A 2AJFE 2CQ1A 3N5BA 3M6UA 4HKQA 2J9DA 2DGQA 4DF4A 3CMES 1UZHA 3EVOA 4USUA 1A0OB 1I1GA 3CJQA 4CLFA 2BUNA 4MK8A 3D4JA 1YGYA 5ADZA 1YIJS 1RUSA 3ZZOA 3QT5A 4RU9A 3OV7A 1NSAA 3DLGA 2BOPA 1B0TA 3CJ3A 3W5ZA 1FJCA 2PA3A 2HWTA 1RHUB 4ZLNA 3NGRA 3CCRS 5D4NA 2R7WA 2RHQB 3V6DA 4PKDB 1RK8A 4Y2IA 1VBYA 3T6BA 1TK0A 2RS8A 3J7AN 3CJ4A 1HBMB 1FEHA 2HBZB 3PW5A 4V19J 3QRRA 1HR0J 4I0WA 1RE1B 3MMJA 1R27B 3DRSA 5EWFA 1N32J 1AFIA 1S9EA 2ZH2A 1S1UB 1QD1A 2ZC3A 1YZ6A 3HKZD 4GC6A 3D28A 4ZVEA 2V4RA 3N5FA 3POTB 2DPJA 2MKCA 1XNRJ 4K0KJ 2ZWOA 1R3NA 3FCHA 3EXCX 4IR9A 2OSQA 3WC0A 5EWGA 3PCOB 3E01A 3ISZA 4ES2A 2ZOGA 4RW7A 4F67A 3J7Z5 4ECXA 1NK4A 4I68A 4LFCF 2V4QA 2Z4PA 1KLMA 3HD2A 5DQHA 2YKPA 3D54A 2BQRA 1HR0F 4GVBA 4OZNA 3NCQA 2CQCA 1NNDA 2W8KA 4OI2A 1N32F 2B3TB 5J1EB 8RUCA 3K7RA 4KIAA 4QW8A 1RXOB 3HI9A 3DM2A 5B09A 1XNRF 2FPHX 4K0KF 3DNCA 2XG8A 4FXWA 2XNRA 4DSFA 2DGUA 3FMBA 3DMJB 2P5VA 1YX2A 2L9NA 4LRBA 2NXJA 1YSJA 5B0EA 4YR3A 1F60B 4JUZA 2W24A 2GIFA 3IA0A 2YNFB 1HNWJ 2B9WA 4OX8A 4QQBA 1TVRA 1VHFA 4ZVTB 5C24A 4DF8A 2CJYB 1XMBA 3D1OA 1IKVA 2ZKTA 1SI9A 2O5DA 4ANEA 2VPWB 2A0FB 5F9LA 2H5JB 3SI8A 5ETKA 3Q2TC 2J76E 1EX8A 3KLHA 1TV6A 3S1TA 3PW7A 2OPRA 1HNWF 5HQMA 2PI5A 4CLKA 4LF5F 3N79A 4OJHA 2R7OA 4X62J 2MQ8A 3HJFA 2MLYA 2YY3A 2LA4A 5GAEI 1T7PA 4NXMJ 4R5PA 2OPPA 1WG1A 1HNIA 3PJ9A 4UOGA 4A48A 1PSDA 2W7AA 3BBBA 4CLUA 2ZM6F 4IG3B 1RABB 1H2UX 2E1MC 1KD1T 4ED3A 4AL6A 5CYQA 3KK1A 4C3MA 3KLIA 2CAJA 1KBRA 1KFSA 5GAEU 4YHHJ 4MTPA 4X62F 5F8HA 3OUYB 1QTMA 2QLWA 2P6TA 2CKWA 2VQEF 4K4UA 2IY5B 4NXMF 1VK3A 3MMCA 4B08A 1WSRA 2B9XA 2ATLA 3QRQA 2CA9A 4NEZA 2HKEA 2JL9A 3ZXWA 4CO2A 1TK5A 4NA2A 1AZSB 4TY8A 2YH1A 2KU7A 2YBVA 4DSLA 4RW8A 2FVPA 2W7OA 4BDPA 2XSJB 2FY8A 2PEBA 2X1FA 3IBFB 3B4DA 2OPQB 2XS2A 4RBVA 5T41A 3JSYA 4YHHF 2KT5A 2GVZB 2W2OP 7FD1A 2DVIA 3MM8B 2ZJRQ 3HVTA 1KVJA 2RRAA 2FQQB 1JLQB 4DPUA 1IR1A 2U2FA 4UY8T 1TL1A 3CNQP 3L7OA 3RB4A 4N41A 1U8WA 1KFDA 4F0HA 1JB0C 2RJZA 1TK8A 2GMHA 3NBPB 3HT3A 1UEKA 2BJ9A 2AW0A 4J9LA 1D1UA 4W90B 4U7UK 2CNOB 4URGA 4M5KA 2MHEA 3V4IB 2XI3A 4HVZA 1Q95G 4WYLA 2DK2A 2Q6BA 2J9DE 4HI1A 4DR5J 2FJBB 3R5CA 1VYAA 5KG4A 2V2VA 3SSRA 1GNKA 3K5LA 2I9SA 3IS9A 2KFZA 1YBUA 3BSAA 3W9IA 4K5SA 2DJWA 1S97A 2RF2A 3OD2A 3H5UA 1H0HB 1FRXA 1EZZB 5M2PA 1R6YA 3B54A 3LALA 3ISND 2KVQE 1U8SA 5J1EA 3SV4A 4GKKF 4OJGA 5T7LB 2JEJA 2V0NA 2OEMA 3C15B 2FGOA 4R25A 2EKNA 5KG7A 1RWMB 1ULRA 4LRDA 2BEFA 2OKQA 8ATCB 3KLEA 4OZ1A 2OI2A 2EW9A 2VODA 3DMJA 5KG6A 1YK9A 2I5JA 2QGFB 1VC5A 2YNHB 3JTNA 2JRSA 4F4WA 3UQSA 4FF2A 3C3LA 1U2RA 3K2YA 5DQGA 1B7YB 3JSMB 1S72S 2D41A 1ROFA 1EB0A 3A3NB 2YWEA 3WQPA 5BJRA 2DD8S 4DSKA 2XMJA 2YX1A 3R1HA 1U1OA 4CM0A 3ZTPA 3CCJS 4LSLA 1Q79A 2WOMA 4LF9F 4J90A 4TU8A 5C2GA 2IYGA 3CC4S 3PW2A 1NK6A 4J9PA 4YB5A 3JYTB 2V8PA 4X4TA 1S1XB 2I8EA 1SVDA 3ZFVA 3HHLA 3MM7A 2HFSA 3RW7A 3W2VA 3RAQA 2BE9B 4LQ9A 5DGBA 2KZMA 2ZD1B 1C2PA 4K2XA 3NMAA 1WACA 2MZJA 4FS2A 2J9EA 1D0EA 4KBIA 3GG0A 1ZA1B 4JI7J 1RT2A 2K3IA 5CD4H 5I3PA 2R7VA 2UXCF 1I94F 2V2KA 3DKDA 1RAFB 2R8JA 1JLAA 4XAKA 2QMWA 4KPCA 3M1VB 3CSKA 4GO5X 4CLYA 4HACB 2I38A 1X5TA 1S12A 1YQHA 1FRIA 2NYHA 3N6NA 2M70A 1S1VB 3PM9A 3LWMA 3R5AA 2R7RA 3C19A 3QGPA 1AW0A 1KLNA 1TUVA 3PX0A 2MZSA 1VQSA 2O3DA 3TVKA 2W25A 2HS3A 4YQWA 1TUWA 3CWJA 2CPDA 3GSIA 3HULA 4JI7F 2DYAA 3TUZC 1YJ9S 4FS1A 2IVYA 2HEKA 4IOAQ 3OT9A 3NNCA 1DHMA 3C66A 2ZBCA 3PKMA 2VFRA 4CDIA 2ADBA 3M9MB 3HHKA 4EO8A 3MM6A 4NXNJ 2H51B 4Q0BA 5LM7E 4P72A 4B3SJ 4ID5B 2MQNA 5KT7A 2LKZA 1S9GA 3GP9A 3HLUA 2GVZA 2ZC4A 3V81A 3O2IA 3LANA 3MM8A 5AE2A 4Z7CA 3M2RA 4M94A 3AD7C 1DFDA 3FBEA 1JLQA 1HBOB 3UDCA 4RW4B 2VBYA 4LRAA 4C6AA 1D3WA 3A8JA 1F9EB 1HI8A 2GQQA 2VJUA 1SL1A 4ILRA 5LXRA 4NI2B 3SCIE 4TNOA 2V8GA 4B3SF 3TAQA 2N7YA 2OO4A 4X4VA 2IC3A 1KEKA 1DLOA 2BM1A 2C3MA 2YTCA 2DNOA 4NLTA 4KGXB 2V63A 1OSCA 3MAAB 4MKBA 2ZBRA 1QAXA 2WB1D 2AYGA 4OV6A 4K4WA 2HZAA 1HHTP 1N88A 5KFBA 3PO5A 2Y0SD 3AD9C 1HW8A 2FHMA 2ROPA 1RHKB 2VA2A 5LXYA 4UF4A 2A3JA 4MMOA 4RO0A 2LU1A 2VG6B 4NYZA 4N77A 1FK9B 3SCKE 3D0IE 3Q8VA 2ZH3A 3M8YA 4IDKA 4JP8A 3MTKA 1HQUB 3KUGA 5EUHA 3JTPA 2H4WB 2HZCA 1FD2A 3KDOA 1LW2A 3HFZB 1NRKA 4OX6A 4XO0A 2XTJP 2WVDA 3NGDA 4KFBA 4H4KC 2R2RA 2DNHA 4CH1A 3Q8RB 1HA1A 4TLRA 1JIHA 2HAFA 1NB7A 4CYUB 3FNNA 3OQ2A 4ES1A 3KLVA 3MR7A 5E3QA 1K0VA 3UW1A 2KM8C 3SMZA 3CDWA 3LPYA 2CWKA 1O5JA 5CZXA 3BKUA 3TAPA 2DNZA 3R7BB 4DOZA 2VHGA 1G2EA 3LF0A 5KFXA 3I0SA 2J6SA 5KFJA 1SQFA 1CJUB 5JMNA 1LK5A 4K8RA 3TO8A 4P52A 3H5YA 1TAQA 1QE1B 3BB5A 1RWVB 2BOAA 4F0KA 1HQEA 4O4GA 4HLBA 3FZBA 2V9KA 3EZUA 3R27A 1U1QA 2UUBJ 3HF5A 4M5IA 1RKJA 4L75A 3EPGA 4QYZJ 1CPZA 2HHHJ 1IBKF 3RB6A 3IAM9 1JLBB 1IM6A 1HBNA 4HHJA 2JZ5A 4JI8F 5DM6Q 1OQ3A 4K4XA 2OMOA 2IA0A 1ICEB 1RQ0A 3KJVB 3GQCA 4AT1B 3B78A 1CULA 2HVZA 1YI2S 3UI3A 3HSJA 1L3VA 2DH8A 5F3TA 3SXLA 1EKRA 4J9VA 1AT1B 4IH7A 4YB7A 1LOUA 2A1BA 1JMTA 1T03B 2HQIA 2BJ8A 3QLHA 2A6OA 4ERDA 5HBMB 3LQVA 1Q81T 1KWMA 2WW4A 3GONA 2UUBF 3EVMA 5KG0A 4BBYA 3G6XA 4DX6A 4L3KA 3D0HE 4CWBA 4FXVA 1JLEA 4CO5A 5AJ3F 1N48A 3OXGA 1OYEA 2WONA 3D7SB 1N54B 1KTQA 5B0GA 2G0JA 4A47A 5DDPC 1NZ8A 1O6XA 1LV5A 4MIBA 3U7JA 1CG2A 2K7JA 4ID5A 1RISA 2LMIA 2CQHA 2X51A 2EFPA 3RB0A 4UOCA 1F6TA 2LEBA 4GMKA 4DUZJ 4FF4A 3DOMB 5LT5A 2XYHB 2RNEA 4HYKA 5A8KA 3K0JA 4RUHA 1JWWA 1SV5A 3NY0A 2HHWA 1P6TA 4IFVA 3O8WA 4B9LA 2B8QA 4N56A 2DR5A 4NI2A 1LFPA 4TKTA 4GRSA 1N0VC 5C25B 1H3DA 3GFYA 4HHUA 5F41A 3AOAA 2N82B 1VC6A 4CLWA 2HQFA 4C8MA 4NASA 2IM3A 4WFYA 1DBDA 4FYWB 4GVLA 1S6QA 1DQ9A 1WC1A 2K2PA 5C5JA 2GV1A 1RHMB 1OQ6A 4ECVA 3GE9A 3LGNA 2KYZA 4OYOA 2Y0BB 3BQ0A 4B3RJ 1SKUB 3HSGA 2F4FA 1GH8A 2V8VA 4YB1P 1LWEB 3CCSS 4DG1B 1SJFA 1T9XA 1UFLA 4IQMA 1KOOA 2UP1A 1RTJB 4CIOA 3AA8A 5B0CA 5E5NA 4HT7A 1QTNB 3MM5B 4X4OA 1E6YB 1ZZNA 4PG5A 3PHEA 4ZJQA 4AL5A 5GMKa 3G8SA 1TKTB 3AFGA 3WZ0A 1S1TB 1S10A 1XMOF 4DUYJ 4ICLB 2NPFA 4B3RF 3KUHA 2UVWA 4L3NA 2A18A 3R7SB 1FERA 4RL1A 1C0TA 4HTIA 2PGCA 3RU0A 1D9FA 2HWIA 2Z2MA 3HVRA 3IP0A 2E5LJ 3TJ9A 3Q89A 4QU7A 4MH8A 4ZHRB 3AJ1A 1RWOB 1OPIA 3VHQA 1S6PA 2HGNA 2B56A 2LQ5A 4QR0A 4EU0A 1GTHA 4YOEA 4PXDA 4PG6A 4J9KA 1X4EA 4UOFA 4MKAA 3FCVA 1GQEA 1IKWA 1NBEB 4UZBA 1SL0A 2KT2A 1LWXA 3FZ2A 4TYBA 1QE1A 4KHMA 4L72B 1K44A 3HJVA 2BA9A 3SQOP 2DNPA 4DV2F 2E5LF 3NAHA 4I7FA 5I4MA 4C9DA 2KJVA 2KI2A 3M2UB 1YRTA 4MFBB 2JNJA 2M8HA 2M4MA 2CQPA 4EMDA 2VC1A 5IC4B 2ZH5A 3UD5A 2ROGA 2RDJA 3QWUA 3IWNC 3Q8PB 2DCUB 1Q1KA 2R9LA 2F8HA 4MKVA 3KJVA 1YJRA 5FLXU 5IC6B 4F7VA 1CJVB 3CJRA 3V5RA 2Q43A 4ZMMA 4JI1F 5M2RA 3VAJA 1UWAA 2F9JA 5HBMA 1REVB 1VQLS 5MAOA 1YTYA 5L39A 2HHVA 3LP1B 3M30A 2P6SA 3LAKA 4TN2A 5H9FJ 2WZ1A 4F4XA 2P9GA 2HVEA 3ICLA 5KT5A 4OLOA 5E33A 4QIEA 1NK7A 3W62A 2PFFB 1KQFB 1DQAA 2Q1LA 3HPOA 4LF4J 3IN5A 1S4FA 2F7VA 4RNHA 2NYIA 2XMAA 4N76A 1Z1ZA 1WF1A 1MLAA 5A8WA 1R0AB 2IVMA 3NGTA 1IWGA 1WWHA 4ZCLA 3A13A 2EFQA 3IGNA 4QIGA 3DOMA 1T9WA 4RLEA 1D8ZA 2ERRA 1FF2A 5J2QB 2B4UA 2D3OR 1NDLA 4I2QA 4XK8C 1BMQB 4LBIA 1IQTA 4RWXA 1IN0A 3ENVA 3VF0B 2PMHA 4B9VA 3KKFA 2YVSA 1RAEB 3SV3A 2NUUG 2YNGB 3DHXA 5M2UA 2WVFA 1DTTA 1UEUA 3T1YF 5D0RA 3MEDB 2GGPA 4C0BA 5DDQC 3UFCX 5HLFA 5G0RB 5KTQA 2WSFC 2QL7B 1SUQA 1YJUA 2H65B 2DHXA 4O3RA 1NK5A 4FDFA 2GCFA 1LWEA 2DNKA 5CAAA 2Y8YA 4RU2A 3BGRA 1MG7A 4P10A 2CZVC 1N33F 4IRDA 2LXIA 3CW2C 1VQ9S 1JJ4A 1IJFB 4B3MF 5F0WA 3AODA 4ETZA 2Y9HA 3HT0A 1E6YA 3OL7A 5H1SV 3G87A 1EQ0A 3K57A 1V3RA 2W01A 1K1SA 4P75A 1E6VB 4DBQA 3QJJA 3L7UA 2VV5A 3UR0A 2DXDA 4WFZA 2FB0A 4J9SA 3RB3A 4UZCA 3ENAA 2EKYA 3Q2SC 4YMEA 1LEOA 3W8GA 2NQPA 1IJEB 3C6TB 5KT3A 2ACMA 5L1JA 5EWEA 4ED7A 3ET6A 4ZHRA 5KOWA 3KTQA 2BQ3A 4NLQA 2H3EB 4B3OB 3N6MA 4ECSA 2RQMA 3MF5A 4H4MA 3VGVA 1U09A 3UN2A 3PNIA 4LFBJ 1JJ2R 1I6JA 5K8PA 2G4BA 3F44A 4A4JA 3BDEA 2CJQA 3EDRB 1EKSA 1V5VA 1RWWB 1Q86T 2IAJA 2BW2A 2YNIB 1MMNA 4NLDA 2CZ9A 2QA1A 2OIHA 3QGHA 3KK2A 3DU5A 2OD6A 4N8OA 1GMVA 4NZ7A 1SQEA 2GFFA 1DTQA 2EFOA 2J7WA 2ZUAA 1FRLA 4FPRA 2F3JA 3THPA 2ATCB 4LFBF 4ES3A 3FJ2A 4BLGA 2R8GA 4EZ6A 3MFHA 4ANCA 3OR1B 3R9LA 4ZJOA 3RUBL 1C1CA 2X1AA 2B5JB 3UDEA 3A3PB 1BQMB 1HPZA 3EXYA 2KB2A 1FWKA 2WB4A 1VQNS 5KFMA 4KPYA 1REVA 1VOMA 2CQ4A 5HMXA 1CJTB 3CD0A 2LYVA 1OJ4A 5C42B 3IRXB 3SQGB 3N9UC 2QA2A 2V34A 2HMIA 4O3QA 4F2SA 3A8IA 3GIMA 5DG9A 4NYPA 5KFFA 2AV5A 2DCLA 4A8FA 4DR4J 4ILMA 1R0AA 2OPSA 1U2FA 2V4JA 3DOLA 2C3OA 5I3UB 2ZWPA 2UVRA 1H7XA 4DR1F 4ZKAA 4TU7A 2BR0A 3PDNA 1N4LA 4IUFA 1QSSA 2IJFA 3IG1B 4HDHA 4YY3F 3CJTA 2RS2A 2HAIA 2IRUA 1WHYA 4C97A 1F2GA 1KS2A 5D15A 2KM8B 3KLFB 4P7VA 2VONA 5F0UA 5AXKA 4ATNA 3EGVA 3KOAA 3F56A 2MTLA 4O0NA 2JX2A 2YWHA 5EDWA 1Y10A 2N4DA 4UY85 5RUBA 1RTIB 3MM9B 2OEKA 4LF1A 3CF5Q 1IBLJ 4PEOA 1LQ9A 4DCPB 3HHLD 2BJEA 3AQPA 5E3PA 1C1BA 4TY9A 4WJBA 1SJ4P 2QZ8A 2DNRA 2Z2LA 4GO7X 4NWBA 5IOLA 2L9DA 5F8NA 3NGKA 3FSXA 2PN6A 2DGTA 4NRTA 1U6FA 3NRBA 2DR7A 1XMQF 1PYSB 5KFRA 4CTAB 5THWA 1H2VZ 3WDOA 1CS4A 2X1BA 3V6KA 2BW7A 3SZ2A 1RT1B 1BUXA 2VH7A 1UA0A 3MPWA 4ZVGA 1A7GE 2AYMA 4X4NA 1HI1A 1IUJA 1RA7A 2EXUA 5CABA 4LF8F 4N47A 1YLXA 1FJGJ 1REGX 3MR5A 2IM0A 3BN4A 2ZE2A 4LIWA 3HVWA 2APOA 4JV2A 2VICA 1BQNB 3FRYA 3OTEA 3ISNC 1OY9A 3G86A 3EYZA 3W5XA 1SB6A 4C8KA 2B7CB 2E1PA 3P49B 3HHDA 4HTJA 3CULA 3S01A 5GVQA 5D3GA 4W4MA 3IM8A 4P6QA 2QX0A 1UJ5A 4DXLA 2KXNB 3UCZP 3X1LB 2VUGA 2F8EX 1S7IA 2E1AA 1RLDA 3HHNB 1FJGF 4Y6IA 1IBMJ 3JSBA 1OSDA 4BWMA 3NS6A 2V8HA 4ER8A 3BM7A 3FC9A 1J27A 3BH7B 3RBZA 2D9PA 1JK9B 3PX6A 4IO1A 3MTJA 4RUCA 4IRCA 4M5NA 1QY7A 2CPHA 2XO6A 3C16A 2GMLA 1RWUA 4KYZA 3D3CJ 2W9CB 3DLEB 5HP1B 1N5SA 4CO0A 3FQLA 2HGMA 4K4YA 2IMWP 1UETA 3QO9A 3RAMA 3PR5B 5F8LA 1IBMF 2V68A 2W2MP 4ZP6A 3F73A 1OPZA 1JKHA 4KGZB 1QUPA 5HO4A 1BQMA 1YKWA 4DHVA 2VPYB 3D0GE 2POKA 5AT1B 4WXOA 2QLFB 3RBDA 4KV8A 1S7HA 3Q24A 1C4AA 4LFAJ 2CZ4A 3UO0A 2FJEB 2QFJA 2C2DA 3WX8A 2QFIA 5DZ7A 2ZBQA 3OTOJ 3MUTP 2Z57B 4RX6A 2R8KA 3QMQA 1UTAA 4PZVA 3IGVA 4OYBA 2YKMB 2AGPA 4PAAA 3FVYA 2Z8QA 4YR0A 1QSLA 2MY8A 2WVCA 1N56A 2AF6A 1K0TA 6FDRA 2ZH6A 3UDLA 1F3FA 4DI6A 2GX8A 4H4KA 1M5SA 1UWBB 3MOJB 2M52A 2HHPA 1XIQA 4ECYA 4ZVOB 4YB6A 1TR0A 2IRYA 3OVAA 3CJSA 2JHEA 2FUG9 2W2QP 4P2MA 4YP3A 1CEZA 2W7PA 2RSQA 3OTOF 3CJKB 3C14A 2C42A 2FZKB 4R8UA 1UJ4A 3MEEB 3US5A 4AQYJ 4DR6J 1QLNA 4J91A 1BD6A 1VHIA 2FJDB 1N34J 1XBWA 4RUBA 5CYMB 5KFQA 2GQ2A 1ITPA 2FZCB 2OFGX 1HHQA 3JB9k 3TA1A 4DN0A 3W3SA 4O3SA 4USTA 2R2SA 4MJKA 3TYTA 4DV7J 1JX4A 1Y7PA 3AJ2A 4RJVA 4GC7A 3M8PB 2ZJQQ 6AT1B 2X3GA 4AUKA 2BE2A 2H5IB 1R0BG 3JSRA 4Z37A 5KG2A 1YHQS 1HYSB 2VFUA 1Y0HA 4DU7A 2HW3A 3T5JA 4DR6F 1X4CA 3VAHA 1VS3A 1RCXB 4KAIA 4OZ3A 3CD7A 3PACA 1N34F 5IT0A 3TAMA 3GIKA 4F02A 1B7FA 4IFYA 4PR6A 3TEHB 1JXLA 4YEAA 2HRYA 2K1RA 1R7IA 4YDXA 1JLGB 3O3LA 3QIDA 1XC9A 4M1KA 2VG7B 5DDOC 4QWBA 4ED4A 3W8PA 4EFAC 2HRTA 4PWDB 2DGVA 4FYXB 3CDEA 1M1HA 2NZCA 3UCUP 3S7RA 1HWUA 1KHWA 2LVWA 3LGMA 3IR6B 2QG9B 1W2BR 1RBLA 4DR2J 4C8NA 1YG0A 2NXEA 4NYOA 2CQ3A 1JXVA 3PJXA 2ZZTA 1H2TZ 3GWCA 1SQGA 4RNFA 1VQYA 4ZPBA 1SIWB 2F9DA 4XIUA 2E1CA 4KTQA 3FK4A 3DYAB 3L9ZA 1PILA 2LCWA 3T41A 4DL6A 2K7KA 1JLFA 2XHCA 3QZ7A 2LEPA 4B9TA 4QW9A 2RHSB 2H1YA 2EC2A 4Q5VA 1NSPA 4DR2F 2HNZA 1LWFA 2RKIB 1DARA 3HP6A 3VALA 3C6UA 4UUXA 3PVXA 3PIPQ 2AJ0A 2HSEB 3R1LA 5HMYA 2MHNA 2UUAF 4IG0B 3GJSB 4R0EA 2XBPA 3W1YC 3M32A 2GIQA 2JC0A 1FVQA 2M9KA 5A2QY 1F5AA 3OTCA 3Q8QB 1HLWA 4CO3A 7FDRA 4JI6J 1AUDA 2NLWA 3DDNA 3SDEA 3D6FB 4U8YA 2IDLA 4NMLA 1QDUB 3RW6A 1RHRB 2ZHBA 2YXLA 5A0YB 4RZRA 1J5OA 4RNMA 3TZYA 1RBAA 4DLGA 3RTVA 2EK6A 2RRBA 5HL7Q 4EWTA 3NS7B 1VLOA 4BS2A 4X4PA 5AE3A 3NS5A 1GX6A 1D09B 2QRRA 1T0TV 3QAUA 3M8RA 2VDIA 3GIRA 3MFIA 4ED2A 3NMRA 4K4TA 3I96A 4JI6F 1KRPA 4DL0C 1RAJA 3AOCA 4ZCKA 1B4SA 2FVQA 4KO0B 2XYGB 3CGIA 5HVFA 3MMBB 3CVKA 2MQLA 4PUOA 4DCJB 1NCLA 4N7TA 2NSCA 3QNWB 1RA6A 2E44A 4H4OB 2DY1A 2OUGA 4TYAA 4LT6A 1VQPS 1SJ1A 3I6PA 2DNLA 3G96A 4NZ0A 4Q45A 5J2MA 2MYFA 5KFUA 1GXTA 2Q3PA 3CJKA 5HVHA 2D74B 1PBAA 4KC5A 5H9EJ 2G9OA 5K5MA 2XZWA 5DG7A 2PEHA 1FESA 5CYMA 2CPXA 2R7XA 3IBCB 4J5OA 3U02A 3H8YA 2AZ3A 4DV5J 4CNZA 4LSZB 4DQIA 1R6VA 1ZAVA 2WTFA 3H5SA 1ZZFA 1IKYA 4OX7A 3VTIA 1JLCA 1IVZA 3W65A 2BBEA 1ZA2B 3PEJA 3R3TA 4NCGB 3AAWB 3CB4A 2CNLB 2EBEA 3PTWA 2XI2A 2YQ1A 2AJ1A 1GAOA 4C3KA 2MQPA 2ASJA 3N01A 3W64A 2GS8A 4J9QA 2AEFA 1T11A 1TAUA 1F9HA 3MECA 2R4FA 5L1IA 1T9TA 1X4DA 4IRKA 4ZVFA 2XEXA 3QIPB 1R8PA 3ZNJ1 3AHPA 3LTOA 1RGVA 2VD3A 3KMSA 1B3TA 3MURP 3DGPA 1Y5NB 5D0HA 3J7ZT 1AFJA 2VG7A 2NZ4A 2OEJA 1IKXA 3MEGA 3AJDA 2ASLA 1W25A 1HBUB 5LMUJ 3JQJA 4K4SA 4WP3A 3BSOA 4I6AA 2IM1A 2XO7A 4LIRA 4DQRA 4CO1A 4F26A 3GFHA 1Z4UA 1Q4RA 2UZAA 2MKYA 3B6BA 1TKZB 2E5GA 4QWAA 3Q22A 1MU2A 3C46A 1T05B 4TVAB 2MXYA 3OR2B 2DRDA 3GYXB 1X4BA 1VIXA 5ETQA 4K5RA 1B70B 3EGWB 4QYZK 5E3RA 2R3VA 2HQDA 5FLXY 4Y2KA 2GO9A 3VGSA 5KFAA 5LMUF 4RW6B 4DFJA 4UOHA 4FN5A 3OLBA 4P73A 5F8GA 1ZM2A 1M5VC 2AIRB 1HNXF 2WSCC 1TL5A 4YN3B 1SIZA 4RW9A 2AD9A 1VFJA 3PX4A 2QV6A 4ED0A 1PC4A 1F2HA 4ILLA 4KSEB 4ZS6A 1MROA 1XN9A 4X66J 3BQ2A 2XLIA 3W63A 2HIYA 1VJQA 4OZ5A 3ZZZA 4A8MP 2KXFA 2XCAA 1F5CA 1NEEA 4CT9A 1YRUA 4PCQA 1RTHA 3WC2A 2D3O1 4RNNA 5IV4A 2NS1B 1LWCB 4DFKA 2PD1A 2BKPA 4X66F 4JYAF 4DL5A 1O8BA 1XR7A 4ZLLA 4QIVA 2VBZA 2H5EA 3PHTA 1TUGB 3D1QA 4KO0A 2AWZA 1PJ6A 5BYRA 3K17A 5CH7B 2QN6B 3JQMA 1WC3A 4ZN3A 3MMBA 2VBWA 1WG4A 1ZM9A 1NHKL 2BANA 3DRRB 2BXJA 2B7BB 1SPBP 4OYIA 4ZLJA 4EZ9A 2ZNYA 1FD8A 1I3OB 1NJXA 4PQUB 4DL7A 1U26A 5HROA 4FYVB 1UVIA 1I5OB 2ALYB 3EVWA 2LXUA 1GT8A 1FJ7A 1N6QB 3TX0A 3D3BJ 3FGVA 3W61A 4WPAA 3ZZYA 5I3QA 1W7WA 4EUVA 1QM9A 4TLQA 2DRAA 4AL7A 3EM1A 2DO0A 1TL7B 2HQ3A 5KFZA 4LFCJ 4KKOA 1HMVA 1GK8A 2E5JA 5AE1A 1LKZA 3KLGB 3FKBA 2ZH7A 3HSDA 4DMZA 2UUWA 4JV0A 3PY8A 1LW0A 4UQGA 4Y3CA 4KH0B 4LSNA 3BPDA 1S4EA 3CC7S 1UZDA 2KHCA 3PRDA 5KG5A 1CJKB 2HURA 2QA4S 1S0VA 1Z2LA 2GW8A 4WE1B 4QYRA 1D9DA 3MOZA 2YKNA 1FDBA 4W92B 3MEKA 5D6GA 3MCOA 1WHVA 2ZITA 2BYCA 1RWNB 2KFNA 4M5DB 3EUNA 2XSFA 1VQOS 2M7SA 2KJWA 3T19A 3MXHP 4D3GA 2BRKA 2HBQB 1ZETA 1RT7A 4NLXA 3TANA 4O3OA 4ANDA 2CPYA 3DXSX 2N4CA 5FIIA 4USHA 1PBUA 1RT3A 4U8VA 4PABA 4Y2CA 5E41A 2HVIA 2D3ZA 3EDQB 1WD6A 2MGZA 1RHQB 2BQUA 2M2BA 1N5YB 3LP0A 1SH2A 3ZZPA 4WZMA 2QSWA 5CYJA 4B9SA 4DPOA 3FDSA 3DRPB 4LQ3A 1NK8A 2HLTA 2XNQA 2DISA 4CLSA 1QAJA 3A4TA 2DRBA 1Z2ZA 4LF5J 5B0DA 1U7LA 5KFGA 5F9NA 4TXSA 2UXDF 2QYCA 2V5HG 1RTDA 3AY0A 1PG5B 2NSBA 4G1QA 3KJQB 4CI0B 1V5IB 3JQKA 3ITHB 3BSCA 3L09A 3OBIA 2JEGA 1FKOB 2XMVA 2ABYA 3GFXA 2ZM6J 2WK4A 2YKAA 2DY9A 3P5BP 1C0UB 4ZVRB 2HQGA 5H9FK 2E66A 3CCZA 1AA1B 4IQXA 3KHGA 1TKDA 1WTFA 3BYRA 3T9NA 1SKRA 3KXDA 2V6AA 1VC0A 2RDIA 1NB2A 1AROP 5GMEA 2LLZA 1O51A 3PYEA 2GAGC 3DDKA 2XZTB 3CCVS 3L95X 2XS5A 2OSRA 2VQEJ 2BZ2A 1SC3B 5U47A 1EETB 5I42A 2CXEA 4DQPA 3C8YA 3CJ8A 2KVIA 5FJ4A 4ZP7A 2GZOA 3AB4B 1FI4A 1ACMB 1G3OA 4YFUA 2XMUA 2GHVC 4KJIA 2AMCB 3DI6B 3BSNA 1RAHB 3W2WB 2YX4A 3QZ8A 5KFNA 1NHUA 2WVEA 4LVNP 1U0HB 4HH0A 2FZGB 2L3MA 4A8QA 1R43A 2DHGA 2NXUA 2CPZA 3BDPA 4PQUA 1U2CA 2G1HA 2E9ZA 3O44A 3GIJA 5D0EA 1S0NA 3GB0A 3T5KA 1Y5LB 4DV1J 3IM9A 2AQ4A 3CPWR 4OHYA 4OHXA 2CQ0A 5EX0A 1OMSA 1ZH5A 1RZMA 3NP5A 5E7OB 2HHSA 3A1YG 5J2PB 4W98A 3BO4A 3BGLA 4MIWA 4F04B 3LP2B 4O4RA 3M8QB 1HBMA 2EWHA 3A12A 3KLGA 1K9MT 1YWXA 3UDVA 4OYXA 3CJ5A 2MLXA 2CIMA 4C11B 3WBZA 5MLCV 1VRQC 2WAQD 1VR6A 3PJWA 3UPFA 1MWQA 4DV1F 1S1UA 4GKKJ 3HM9A 3DLHA 4Y0FA 3M6XA 1SJ3P 3POTA 2VPXB 4C2MA 4USIA 4F36A 4NZ6A 3CUNA 2BJ1A 1NLKL 1Q8BA 4FNHA 2PO4A 2CG4A 2P2CB 1GTEA 1WKLA 1NSQA 4Q2MA 3X3UA 3EGZA 1HWIA 1S0MA 4JI5F 3G8QA 4PG8A 2JH3A 3R6GB 2IMOA 3IO1A 4A8KA 4X4QA 1PGZA 2WSEC 1H6KX 4IOCQ 5FD1A 3AD8C 5LJ5Y 4ECWA 2PMWA 2OGUA 1VRTB 3QT7A 4NA1A 5KT2A 3PZPA 2KG0A 4FF3A 5K8NA 3U27A 2DGWA 4QWEA 3I0RB 3AXKA 1YVFA 4X64J 1LK7A 1XERA 4EYIB 1SJRA 2C28A 2VPZB 1OY6A 4Z2XA 4UT4A 2Z2YB 2DTJA 3SCLE 5A6WA 2DR6A 1J2VA 4LF9J 1ZPVA 2MPUA 4FF1A 4CH0S 1NXIA 4EBDA 2K8GA 2FLNA 3T6JA 3DRPA 3IWLA 2YNFA 5CQGA 2UV8G 3K5MA 1U02A 4PG7A 1FNXH 3H2UB 1EP4B 1ZTTA 4PRFA 2OTLS 2C2OB 3MCSA 3H7HB 3Q23A 3VAGA 3ZTSA 4X64F 1Q8LA 2OHDA 2BE7D 3MPYA 2DNQA 2ACYA 1X5SA 1DQ8A 3ITHA 4JI2F 4RPFA 4NX9A 5KFWA 1DZ5A 2CQ2A 1V9OA 5IFMA 2UXCJ 1I94J 1U1RA 1UPPA 4EGLA 4FVCA 1P9YA 3LUYA 4ECRA 2GQCA 2BVZA 3OW2R 2HHTA 2YH0A 4JI3J 4EEYA 2MQMA 1Q0NA 1AXQA 4G3IA 1X7VA 2V69A 5DLGA 3CEDA 3NGUA 5HN0A 1Y4ZB 1FE4A 4JI4J 3GV5B 2RIJA 2R42A 2ZHAA 3H5XA 1TQLA 2KRBA 4ZCMA 3MD1A 1YJVA 2EEYA 3OL6A 4IG3A 2FVSA 1EIYB 2DITA 2EFVA 2E29A 4Y2MA 3MUMP 5HVGA 9ATCB 4V19X 2IJRA 3DOKB 1OIAA 2HGLA 2UU9J 4JI3F 2FLOA 3AXMA 3K8VA 2UV8A 2ZZMA 3OUYA 4WZQA 1PAEX 1X5PA 3UE2A 4DR7F 5D8HB 4JI4F 2FC9A 2W8LA 1N36F 2CFXA 5A6PA 2C3UA 1APSA 2X3DA 3QRPA 2OP5A 2VFVA 1AZSA 1NK0A 3CCES 4U95A 1G4CA 1TFWA 4E98A 2XSJA 2ZH1A 2OPQA 2UU9F 3VQSA 4UQTA 1WOOA 3OTDA 2R7SA 3DU6A 2Q79A 3U1MA 3LP2A 4K4ZA 4NRUA 4ECTA 4NMXA 4CP5A 4ZA1A 3AT1B 2W9BB 3EICA 5HK4A 3I9V9 3R5DA 4C11A 4LMZA 1YDLA 1OWXA 3AB2B 5ETLA 3UD3P 4QR1A 3NBPA 2WRMA 1T9UA 2AKWB 3FCWA 3FEZA 3OFHA 2FLLA 4X4SA 3EZ5A 4ECZA 3G4SS 3V4IA 4DZDA 4LF7F 4ZOSA 1RP5A 4RBTA 4ZVHA 2M88A 3DLGB 1WOPA 2DHSA 2R7UA 1QVFR 4ELUA 1NPPA 4IH6A 3NAIA 3Q8SB 1LFWA 4WKYA 1MMLA 2C22A 4FBUA 1XR6A 2BKOA 3V6DB 3TJ8A 5LJ3Y 3NL0A 4PPDA 3MD3A 1FVSA 1M5PC 1GX5A 3TW0A 2MZQA 4MYUA 3SFGA 2B4VA 4WCEQ 3MPVA 5T7LA 3M9OB 3C15A 4DLEA 4Q2LA 3ILIA 3H0PA 2XULA 1G7CB 4QR2A 5K9FA 1NMEB 4QJVA 3B82A 1WSVA 3DRSB 6FD1A 2Z58B 1S9EB 2WBMA 1X9SA 1X60A 2XWYA 2G2OA 3TUJC 5DGAA 1FTCA 2SXLA 2W4PA 3GYGA 4IH5A 4FNIA 2YNHA 2DR9A 3TQ1A 2UUCJ 1SC1B 3E01B 1YJTA 4RW7B 3HFKA 3QJLA 1XR5A 2W4DA 4NLRA 3M2VB 3JSMA 4NL5A 1U49A 1N8RT 4HEA9 2DNYA 2NCKL 2B43A 2CDQA 2FC8A 3FUYA 4KHPF 1U6ZA 5L46A 2MZTA 4HDGA 4ZITA 5KFVA 4Y34A 3O1LA 4L73A 2LQ9A 3J7A1 2OMLA 1TL4A 3I32A 1AYEA 1WC4A 3J81j 3Q86A 2UUCF 3MAQA 1KN6A 1IBKJ 5A76A 2XZDB 4PXCA 3RZAA 3VCDA 4JI8J 1VQ8S 1B99A 2EG2A 3JYTA 2HFUA 5LMNF 3KK3B 2YWFA 1S1XA 3TVZA 3ZC4A 1U1NA 1YITS 3GV7B 2ZD1A 5E2QA 2HYIB 2C2ZB 1TVRB 2QA4G 2Y1RI 1FCAA 2BABA 3B4MA 1NPRA 5C24B 2E7VA 3DLLQ 5D77A 3ILOA 2RQ4A 1KONA 2D9OA 2ASDA 4M5JA 3GJQB 4DPWA 1L3SA 5AJ3J 1ZAWA 4GKJJ 3M1VA 1H98A 2IDEA 3AA9A 2ZH4A 3KLHB 3U1LA 2J7KA 1TV6B 4HACA 2UVUA 5JJBA 2C2NA 2OPRB 2QMUB 3VZIA 1S1VA 3PW0A 1S59A 3DDIA 2EPIA 1QAIA 5IV3A 1N5TA 5HSPA 2JFKA 3OVSA 5DQIA 2CWXA 1HWJA 2XMWA 2J0WA 1SH0A 1UW9A 4R5PB 1RWXB 2OPPB 4I6YA 1HNIB 1F0XA 4F4ZA 5A2QU 3T1AA 2FJAB 2J9CA 4GKJF 1HNZJ 3VAKA 2F8MA 1UVKA 4ECUA 4CO4A 2M3DA 4LR8A 1VQKS 3SBMA 3CCWA 4M8LA 2D1CA 2ADCA 1ZOTA 1UEVA 5CYQB 3KK1B 1YZ7A 2JDJA 3KLIB 3CMQA 4J9UE 2IYIA 4RUAA 2Z0GA 1HBOA 3GG1A 4RW4A 3OSNA 2F4VF 1TU0B 3D68A 2VOPA 3MMCB 2AP6A 1WEXA 2GIRA 3PYDA 3BR8A 2MDAA 1HNZF 3DN9A 1FHTA 4QWCA 2KO1A 3NG8A 4P9SA 1RT5B 3CDAA 4TY8B 3D67A 1BHNA 1FFWB 4RW8B 2CJAA 2DH9A 4RKUC 2RRNA 3UD4P 4NLVA 4ZPVR 3MAAA 1YJ7A 2F63A 1R0CB 1KSPA 1XMOJ 4F50A 4LREA 2HHXA 4C8LA 2DHAA 4NEYA 3PO4A 3HVTB 2H54B 1X0PA 3MCMA 2MKJA 1TL1B 3OPKA 5D4PA 3FEXB 5KFDA 4ALZA 2CRLA 2VZ9A 1G6BA 3PFOA 1X0FA 4AE5A 2MJUA 4M63A 2I2YA 2VG6A 1FK9A 2MY7A 4FKXA 3CC2S 3TI0A 1BWVA 1HQUA 4ZP9A 3QFWA 2YKQA 2MKKA 2QLJB 3FFIB 3M2VA 4O44B 3IS9B 3FBFA 2HK2A 2RF2B 1HD1A 3SIPB 2AZ1A 1U1MA 2CNKB 2CNNB 3OXFA 4DV2J 1W2IA 2LDYA 5KFSA 4CYUA 4O0IA 3KG1A 3D6HB 3KG0A 2A2DA 3I4PA 3IAS9 3NCPA 4RBUA 1RCOB 3KLEB 3O6QA 1HD0A 3D5MA 3THVA 5F3ZA 3RBEA 2LXFA 2XMMA 1U47A 2HWHA 2I5JB 2OELA 1JNZB 3KK3A 3FSYA 1Q5VA 1CJUA 1S77D 2Y3YA 2NUHA 1S48A 3FRZA 1B0VA 4P2XA 3ZZ0A 1VQ4S 4JI1J 3OL9A 4KH1B 3BZQA 3FBBA 3VZHA 2WW8A 1WNEA 1RAGB 2VFSA 3I87A 2RQCA 5EHHA 3G82B 2XQCA 4B17A 1EHWA 4OIXA 3TRGA 2L9WA 4WFXA 1FDAA 3A8EA 5DO2A 4U96A 1WC0A 1HNVB 5J1PA 3ZZUA 1RTZA 2JFDA 1JLBA 3J81Y 1RDRA 2EC0A 3KNAA 3RRGA 2DT9A 4LSLB 2HRUA 4ZDNA 2WOMB 3DXBA 2GVDB 2MQOA 3ILLA 3TX8A 2B9EA 1L3TA 4KGMA 1F9FA 1VBXA 5ETRA 1FTRA 1T03A 2QEXS 3QSIA 4NE9C 3TEGA 2W2PP 2KL8A 3T1HJ 3HHLB 3MM7B 4BHQA 5H9EK 3W2VB 4DUTA 1H38A 3RBXA 3CE8A 4E8UA 2WBRA 4OMFG 4ZVQB 3QWPA 2FYXA 1FE0A 1EARA 3AH6A 1NDCA 5DS7A 1YBAA 3KHRA 5HQLA 1BE4A 3R5BA 1RT2B 4L6V3 4OFZA 3R7NB 3WIUA 2VOOA 2O66A 4B02A 1JLAB 3P5TL 1I51B 1CC7A 4WFBQ 2CADA 4CNYA 3M9NB 2H4YB 3OFFA 5LOQA 5KFTA 3T1YJ 2YWGA 1XWLA 3T1HF 3NKYA 4XDCA 3MPDA 1CLFA 4MIAA 1BY9A 1VRUB 4WF9Q 2VA3A 4IKAA 3ENQA 1N5VA 4CZCA 1LXJA 1NHVA 1YRXA 1KQKA 3KDNA 2ZKUA 3I56S 2XB2D 3TUPA 4NPOA 2MZ1A 5D0GA 2CPJA 4L74A 1L5UA 3L7PA 1ZTWA 1N33J 2KT3A 4BC9A 5C25A 1RT5A 1M5HA 2ZFHA 4A8YA 2XMTA 4B3MJ 3MM6B 4DPTA 2J8SA 3GSDA 4N5SA 2HG4A 3HCXA 2ZEJA 1N52B 1XTZA 4Q0BB 2QYGA 2NXCA 3I5BA 1CC8A 2P9CA 5CHCB 1S9GB 3TA2A 1UCNA 2VG5B 3V81B 3OJUA 4KR0B 5K20B 3D1HA 1NUEA 4F4KA 4PPZA 3M2RB 5D4LA 1VQMS 1S6UA 5ETNA 4PQAA 3DGVA 1XK8A 4M5LA 4ELVA 2AEMA 4DG1A 4K59A 1P9QC 2CQBA 4ENOA 1RTJA 1RAAB 4CT8A 1WTBA 4ID8A 1UVJA 2ZZNA 3MM5A 2CYYA 4OX9J 1GXUA 2LECA 3W9HA 1TKTA 1S1TA 2IC3B 3P8BB 4I2PB 1DLOB 2LFVA 4ICLA 1S99A 3BO2A 3JTOA 4DV3J 3FFIA 4O44A 1X5OA 4WK3A 2OD4A 3BR9A 5ITHA 1U0SA 4WK1A 3OHAA 3Q8UA 5DZ6A 2EVZA 4EBCA 1T02A 4WU3A 1MN7A 1U4BA 4ZIVA 3L4BC 5K14B 4F3OA 2Q6CA 3AOBA 3F41A 1XJWB 1UPMB 3JAMY 3IFEA 1VMBA 4OX9F 3UCGA 1FDDA 4DU8A 4OYPA 4DL3A 4DR5F 3ZTRA 4XTTA 4BWJA 4DV3F 1SH3A 2MMYA 3VV2B 3MR3A 4IDKB 2VQFJ 2DNMA 1FNMA 4EBEA 4IO9Q 1LW2B 3EJMA 5B08A 1X31C 1VCTA 1U1PA 4MFBA 3M2UA 3VVUA 4KFBB 3G82A 3HX9A 2J6UA 3MUVP 1BXNA 4Y2AA 4DDFA 1HNVA 2Y1IA 2C3YA 2C2RA 2FHJA 2XGPA 3UN5A 2QL9B 5LL6d 2C1EB 2GVDA 4EYHB 4AXIA 1H72C 2KHDA 4DEZA 1CJVA 3BF4A 2VQFF 1WOSA 4DV0J 4C8YA 5L38A 2ZDPA 5AXLA 2CVIA 3I0SB 2HIQA 5CZVA 2CPFA 2RU3A 4HH1A 1X4GA 2HHQA 1VBKA 3LP1A 2A2CA 4C8ZA 1RU2A 4DX7A 4DR1J 4NOHA 4CCHA 4KY3A 4I67A 1HL6A 1HWLA 1HQEB 4O4GB 1XEZA 1T95A 2LQBA 3C2PA 4YY3J 3ONQA 3K8WA 1T3NA 3K89A 3W5YA 3TARA 2AGQA 1HBNB 2PC6A 4DV0F 2O01C 1UL3A 1NH7A 1QAYA 5JUMA 2GHPA 3E3XA 1NPKA 3H90A 5DLFA 5F8JA 3H40A 1FT8A 4I4BA 1CULB 1KNZA 4LF2A 1VRUA 2NXNA 4DJBA 5GAGI 1KHVA 2BV3A 3GJTB 3QLHB 1RI7A 2XLJA 5J2QA 5KT4A 3E8OA 3CCQS 3OFEA 2DR8A 4K50A 4I56A 3NLCA 2UVVA 1GEHA 4MKYA 2BJ3A 1XMQJ 1JLEB 2HS0A 3HMJG 2YPYA 4ZPWR 2HVDA 3GJRB 2XS7A 2YNGA 2WONB 4KHRA 1Y5IB 5F8MA 5J1NA 2N3OA 3MEDA 4MT1A 5GAGU 1H73A 1RHJB 1K47A 3TWZA 4LF8J 3FSIA 3QATA 3OJSA 1ZM4A 2MLZA 2VG5A 4EO6A 3J7YI 1YBTA 1QVGR 3GLJA 2ZHOA 5G0RA 2AJ4A 1WF0A 2AJ2A 2R7QA 2QT7A 5L8RC 5A8KB 4AXJA 4G1IA 4UW2A 3OXLA 3CXCR 2G13A 3PRVA 3FQKA 1SV5B 5BXIA 4IFVB 2F5GA 2O1PA 1NDPA 4NXNF 2YPZA 1GMWA 2KH9A 2WCXA 3J7YU 3HD1A 2F1FA 2DNNA 4CM2A 3T3FA 1FEEA 4I2PA 1E6VA 3G2XA 4U7CA 2XY5A 1S6QB 1VJWA 2V50A 1NJWA 1G1XA 2I1RA 3N6LA 1RAOA 3C6TA 2VL1A 1KQGB 1RBOB 3T5LA 2P9EA 2VKRA 2L08A 5K14A 5IT4A 3CCLS 5HATA 5HQ8A 3CJ0A 3ZTQA 2V2QA 1EAYC 4B3OA 2DPIA 5JXSA 3P3DA 3J80Y 2B6AB 2GC8A 4OLPA 2OH2A 4P2SA 4LJMA 4KRWA 2YWWA 3OLAA 2JSXA 4OHWA 1WJ9A 2RE1A 5LSLA 4LBPA 2R8HA 4F4YA 3P96A 4RWWA 2HNDB 4ED6A 1L3KA 3AQOA 1LXNA 1MN9A 2LU2A 5AXMA 1V3ZA 2CDRB 2YNIA 2IHR1 3D6MB 2KG1A 4NCAA 2E9TA 2IBKA 2BRLA 3RAXA 1C0TB 3TA0A 2WHOA 1YJWS 2IPOB 4P74A 2ZH8A 2J7UA 1TTHB 3P6YC 2VKZG 1PKUA 1MMDA 2A10A 1MNEA 1S6PB 3NCRA 3QGGA 3OR1A 4YS2A 5KG3A 2B5JA 1VQ5S 4J7CA 1IKWB 4F8RA 2AEJA 3RR8A 3GMGA 4NLPA 1R8CA 1SCJB 3MDFA 3DLKB 1PYTA 1WDDA 1CJTA 3R5JB 1TMMA 4I7FB 5GMDA 5C42A 3IRXA 4WP8A 3H2LA 1TL3B 3SQGA 2XY6A 2MKSA 5IT9Y 2DGXA 5EN1A 3VGUA 2FLPA 2AX0A 4OYMA 4E0DA 4F3QA 3TZXA 5B0AA 4OYAA 1TELA 4ZJLA 3TVYA 3BGUA 3VR1A 4ETXA 4C0HA 4YUDA 2LP4A 3PYFA 1K8AT 5I3UA 2CJ9A 2MSSA 2DIUA 3BPSP 3LA0A 4M95A 2ZNZA 4DS5A 4TU9A 1J5EJ 4RNOA 1ZAXA 4OV1A 2B0GA 3IG1A 1ZPWX 3D66A 2BJ7A 4G6VB 3M30B 3M8WA 2IJNA 4OZJA 3LO3A 1UFWA 4IR1A 2HHHF 2U1AA 3KLFA 2R7TA 3GV8B 3UN3A 2I6WA 1NKBA 5KFCA 4G65A 4CH7A 2W2NP 2L41A 3RRHA 5B0BA 2ZJPQ 4NCBA 2FVRA 1SJQA 4KGVB 1EQMA 2QC3A 5A8RB 1RTIA 3MM9A 3NEKA 5DDRC 3TOQA 5A8WB 4LR9A 2B4OA 3VAFA 1J5EF 3HHEA 2MJNA 2KFYA 2DB1A 2ZH9A 1HARA 4OI3A 4XPCA 3LPEA 5T14A 3IRWP 1PC5A 2E7XA 1YJNS 1PJ7A 3VWSA 3DRYA 4CTAA 4B3TJ 4I2QB 4K2JA 2DXEA 1RT1A 2AT1B 2PE8A 2RUGA 4YDDB 4A46A 3D2WA 3GR1A 3SFUA 1B64A 2QJ3A 2PIIA 1DTTB 4OI6A 3MPUB 3MAHA 5CXTA 4URSA 1W26A 4IYQA 2GJ2A 5L1KA 2GGPB 2RDDA 4DUZF 3G6ES 4FVMA 1NDKA 4P71A 5HLFB 3DC2A 5C2CA 1BQNA 3A8KA 4QU6A 3N28A 1SUQB 2IA6A 2FDNA 4B3TF 3N4WA 1NZAA 4ED1A 4EI2A 2RQKA 2DIVA 4CLZA 1P1LA 2HNYB 2M0GB 3JS9A 3BGRB 4X4RA 4KQZA 2NR0A 3M7VA 1WDTA 2YQ0A 2B6AA 1S49A 1O0PA 4C98A 2B4PA 3KHLA 1FKPB 2FIUA 2UUAJ 2X7IA 3S6EA 3PIOQ 5FDLB 4DQSA 2D7SA 2YX7A 1NH8A 2HNDA 5IZHA 4C7QA 4JV1A 3LH2S 1H7WA 2FJWA 2AYEA 3SYZA 2ZOFA 2VASA 4OYWA 2M5YA 3BKFA 1Q5YA 2B8PA 4ECQA 2HFVA 2DEJA 2RT3A 3MCNA 4DPYA 3U1NA 3JXOA 4OHZA 3K59A 3NXZA 3IR5B 1OO0B 1KKHA 2RMLA 1HW9A 4ZK7M 4Y00A 3ELHA 4USWA 4U67Q 1M1KT 3ET6B 3IR7B 2W9CA 3DLEA 5HP1A 2IVFB 5L1LA 4L76A 2D3UA 3HK2A 1HFEL 4H4MB 3BO3A 4M5HA 4DUYF 1VK8A 1NM2A 2HZVA 1N0UA 2ROEA 4O23A 5DM7Q 4A8SA 2J5AA 4DX5A 3DLKA 4DCOB 5IS2A 2IAJB 1RKIA 1WEYA 3PR4A 4PWUA 1TL3A 2XM3A 3KK2B 4DFPA 3TZZA 1ZBTA 2RUSA 2V9WA 1ZM3A 4WIIA 1DTQB 4C4WA 1DAXA 3F0NA 3GTYX 2OTJS 3R97A 2EK1A 4WTOB 3UVJB 2YKMA 3RG6A 3FBCA 4OJ3A 4OQJA 1C1CB 3R5GA 4DSJA 3E51A 2HLUA 1UAWA 3CDBA 2B9YA 2Z30B 1HPZB 1SC4B 1IWAA 3A3OB 4X4UA 2MEWA 1XQIA 1UWBA 1UVMA 2HK3A 1VIOA 5KT6A 4CRJA 4PWWA 1BWEA 2J6TA 1JJHA 3CO9A 4IOBA 2L48A 4DX8H 5IM0B 1WORA 2PA8D 2VC0A 3NWGA 3T9ZA 3O5TB 1RADB 1FX2A 1Y00A 4U6PA 4DFMA 4LR7A 4A8OA 3MEEA 2MKHA 3V6JA 4OI4A 5KFHA 2HMIB 5HANA 1FDNA 3HZEA 4J9RA 3TZWA 4Z7YA 2D69A 4ITSA 3PKYA 1F5BA 3M4XA 5A8RA 1Q7LB 1GXLA 2BJDA 4FPIA 2OPSB 2GAHC 2AGOA 2V4JB 3K58A 3DOLB 3H25A 2AYBA 5KOXA 3W9JA 1RWPB 5D4OA 3M8PA 1NKCA 1KOHA 2Y8WA 1IQZA 2JJ4D 1CQNA 2RH3A 2N3LA 8AT1B 3MWBA 4DN9A 2ZVSA 1IBCB 3FMWA 1HYSA 3QPIA 7AT1B 2EFNA 4LF4F 3DCAA 2YKOA 1FA0A 2BDPA 2IIHA 1JQGA 1UA1A 2QIFA 5LSOA 4AYBD 2OLWA 1UFKA 4U7UD 2C2MB 2COLA 1JLGA 1GMUA 3WHIA 1JNRB 1GFWB 4OZ2A 3W7BA 4DS4A 4M5GA 4PWDA 3H42A 3H4DA 1C1BB 4M5MA 4J9OA 3HFVA 2JLEA 5AXNA 2R2UA 4KE5A 3OTBA 1S57A 1HI0P 4I1TA 4CLLA 1U6BA 1Q8KA 5HI7A 2CPIA 2HNYA 1LNQA 4JB8B 1HNXJ 3KMQA 4PYDA 4HI2A 2GO8A 1CS4B 1DJ0A 1FKPA 1URRA 3DYAA 1NU4A 2XHWA 5FDLA 2VFTA 2ZBIA 4K7QA 2JLFA 4USJC 1SC6A 3HVAA 3PEHA 3NWRA 4I64A 2R2TA 4NLSA 2UUTA 3RGIA 2E5HA 2ZE2B 2J8AA 2RKIA 1KC8T 3BGOP 3V2UC 2G0CA 4CLPA 3SSSA 3THTA 4K4VA 2JVOA 1R8BA 1DY3A 2JEFA 3R8YA 2LA6A 2ILYA 1CQMA 4QOTA 5GADI 2IM2A 4IG0A 3WX4A 4ZIWA 3BREA 4C8OA 5CA5A 5D3GB 1HQ2A 2C2KB 1FX4A 1AB8A 5DJBA 1ZYQA 4FYYB 1U25A 1PCAA 3BBFA 2LQ8A 3SSQA 4JYAJ 4ZVSB 1FO1A 2M8DB 3R2CJ 4PXEA 3ZZTA 2GHWA 3IXQA 1KVKA 1TP7A 4USMA 3CCMS 3PFEA 2PFDA 5A0YA 1VQ6S 3I5CA 5K8OA 4OJ1A 3Q8YA 3IMQJ 1BLUA 5ETTA 3QGIA 2ZOMA 5GADU 4FKYA 4NLOA 3ULHA 5KFEA 2BM0A 3CO0P 1NJYA 3TQEA 1D9AA 3LAMA 1RLCL 2R8IA 3C16B 3ZZRA 1VLYA 1VGYA 4WBFA 1SBRA 5L9XA 2NPIA 1KTVA 3P45B 3IBWA 5ETPA 5DRKA 3QYYA 4QPXA 3M6VA 3QO9B 3PW4A 3R2DJ 3TR5A 4V1Ak 2RB7A 4KT0C 2FHKA 3P4UB 2VF3A 3UVJA 4X84A 2JEIA 1X9MA 4ZVUB 2J0QD 1JKHB 1WC5A 1WI6A 3MMAB 4H4OA 1S6OA 2RILA 3UNGC 4B9NA 4WP9A 4ZPDA 3J81U 1RYRA 5IM0A 2F40A 2RD5C 2FD2A 4F4AA 5KFOA 3G6YA 2DO4A 2EFGA 4KV8B 2F65A 2K06A 3GZ7A 4PG4A 4F3MA 2VIHA 4Q43A 1SXLA 2QTWA 2IRXA 4ZVPB 2EBGA 1T94A 3KFWX 4UTGA 2OAUA 3BV8A 4Q8EA 5IQQA 3G8TA 2JOQA 2PI4A 3B8HA 2PT0A 2DXFA 3CIMA 4JBCA 3EE3A 1S5ZA 5JVGQ 3GPAA 2VBXA 3PXGa 1R31A 1FRKA 3EMTA 4FZVA 5BR8J 1RT4B 4USKA 3MR6A 4NCGA 2G2ZA 1Y3KA 2LDIA 2O67A 4XPEA 3OVBA 3KJNB 1JXEA 4NLGA 4NLWA 4R0JA 4XDDA 2DBBA 1X9WA 2FHJD 2Y1LB 3OHBA 2P8IA 4JI0J 2OFHX 3W60A 3QSYB 4X65J 1BC6A 3C14B 4Y65A 4R8UB 1UW4A 2PDAA 4P7TA 1V6HA 3GR0A 4PYAA 3QIPA 4OYZA 4DR4F 1NJZA 3HDSA 5BR8F 4FP9A 1FXLA 3MZIA 5JVHQ 2CVEA 3CIZA 5ETOA 3OFGA 4URQU 5DG8A 4LRCA 2Y1JA 5G4DA 2VB6A 3HSZA 4B9MA 5ETVA 1HBUA 2W1BA 4ZN1A 2UXDJ 5CD4A 1QSYA 3S8SA 1ELOA 2BE2B 5C7PA 4JI0F 4X65F 1TKZA 2GA7A 1NO8A 4HL9A 3NNHA 3H2VE 1T05A 2IBOA 3TP2A 3OR2A 2KTQA 3G6VA 3IC1A 3TAMB 1WI8A 4QZVB 1Q53A 1UKUA 4IFYB 4OZ0A 1RT6B 1KVIA 1IBLF 1RAIB 1N5QA 5IXUA 5ETMA 2K1RB 3I5AA 2VJVA 4RW6A 2J0SD 4CQ1A 2XYPB 5HAOA 3GILA 2QE5A 1FRJA 5HMZA 1IM4A 2FHOB 1RYSA 1U24A 4I6WA 3RJMB 4H54A 2GMJA 4Q8FA 2C2EA 1RWKB 3EX7B 3H59A 4MAKA 2FGCA 3DLBA 2YWKA 4ED8A 2VU5A 3CCTA 2KDOA 4F2RA 1S76D 3CJ2A 4OL8A 5KFLA 3NNAA 2QMXA 4S0MA 1CBKA 1TKXB 2HS4A 4F0MA 1WC6A 3LWLA 1P1TA 3BBCA 4BC7A 4I69A 4NA3A 3GCXP 1VISA 5GAHI 3I31A 1JLFB 1VBZA 1HHSA 4B9UA 3FEYB 3JAMU 1M5KC 1UVLA 4Q44A 2HVHA 1CVJA 4U9RA 1BQXA 2HNZB 5SUHA 4C48A 1LWFB 2JC1A 2BKNA 4WWSA 1F3VA 3C6UB 5IWAJ 5KFIA
chains in the Genus database with same CATH topology
4WF9Q 1LW2A 2VA3A 2I0XA 4IKAA 3ENQA 1N5VA 4AFFA 4CZCA 1MWZA 1DURA 1LWCA 1U1LA 1NRKA 4HT5A 4OX6A 4XO0A 3NGDA 1LXJA 4J9QA 1NHVA 5GAHU 1M5OC 1TAUA 4KFBA 3MECA 2R4FA 1YRXA 1KQKA 3M32B 5KFPA 4H4KC 2R2RA 5L1IA 2DNHA 5D78A 4CH1A 3Q8RB 2ZKUA 1X4DA 1HA1A 4IRKA 5EGYA 3I56S 2XB2D 1M90T 4ZVFA 2DNGA 3BQ1A 4TLRA 2XEXA 1JIHA 3QIPB 1X8DA 1NB7A 1R8PA 3K5NA 2JLGA 3AHPA 3FNNA 4NPOA 3OQ2A 1RGVA 2VD3A 3MHYA 2KXHA 3CTRA 5BYQA 4ES1A 5E3QA 2MZ1A 3KLVA 2YQ3A 2CPJA 1K0VA 1L5UA 3MURP 3L7PA 3UW1A 3SDEB 1ZTWA 2KM8C 2KT3A 4BC9A 3SMZA 5C25A 3DRRA 3CDWA 3LPYA 3DGPA 3MMAA 1RT5A 1Y5NB 2V8DA 3J7ZT 1AFJA 1M5HA 2VG7A 2NZ4A 1O5JA 2ZFHA 4A8YA 2HFNA 1IKXA 3QAEA 5CZXA 1SL2A 3MEGA 2XMTA 2ASLA 3PRBA 1W25A 1J5OB 3MM6B 3TAPA 1HBUB 2DNZA 3GSDA 3SEOA 1BGXT 4N5SA 4K4SA 2HG4A 4DOZA 3VQTA 2KN4A 1G2EA 3LF0A 1Y3JA 4OHVA 1N52B 1XTZA 3BSOA 2XMKA 4I6AA 4Q0BB 2IM1A 2XO7A 1T3OA 4LIRA 1SKSA 4DQRA 3DLJA 4CO1A 5IWAF 4F26A 3GFHA 3I5BA 1CC8A 4QBUA 5KFXA 1Z4UA 3I0SA 2J6SA 5KFJA 1S0OA 1Q4RA 2P9CA 5CHCB 1S9GB 3TA2A 1T8EA 1LK5A 2VG5B 3V81B 2UZAA 3TO8A 1N6QA 3H5YA 1TAQA 5F8IA 3OJUA 1QE1B 1TKZB 4KR0B 3D1HA 3BB5A 1VI7A 2E5GA 1U48A 2JWNA 4F4KA 4PPZA 4OZLA 4KB7A 3M2RB 2N7CA 5D4LA 4QWAA 3Q22A 1TFYA 1MU2A 1S6UA 1VQMS 3C46A 2E5IA 4PQAA 1T05B 2MXYA 3RR7A 1HQEA 4O4GA 3OR2B 4HLBA 3Q0AA 3GYXB 3IWXA 1R8HA 3FZBA 1XK8A 4ELVA 4C3LA 4DG1A 1L3UA 2QO3A 1X4BA 3DRXA 2V9KA 1X4FA 1QJHA 1VIXA 3EZUA 4K5RA 3R27A 3EGWB 4K59A 3KG4A 4QIWD 5E3RA 1U1QA 3HF5A 4MK9A 1RKJA 3EPGA 4QYZJ 1P9QC 2FJVA 1Q8IA 1CPZA 5FLXY 2CQBA 4Y2KA 2GO9A 1IBKF 1RTJA 3RB6A 3IAM9 1JLBB 1WELA 1RT4A 2K3KA 1HBNA 5KFAA 4CT8A 5LSRA 5LMUF 4RW6B 1WTBA 2DGSA 4ID8A 4HHJA 2JZ5A 4JI8F 5DETA 4DFJA 4PUOB 1UVJA 4FN5A 1D8YA 3MM5A 2ZZNA 5DM6Q 3OLBA 1OQ3A 4K4XA 3L3CA 2CYYA 2OMOA 2IA0A 5F8GA 1GXUA 1ZM2A 3UWTA 1RQ0A 2LECA 4MK7A 3KJVB 1TKTA 3GQCA 3B78A 4LFAF 1M5VC 1S1TA 2HVZA 2IC3B 4I2PB 1YI2S 1DLOB 3UI3A 4ICLA 1L3VA 1HNXF 2CQIA 1TL5A 2WSCC 1S99A 2DH8A 3BO2A 1SIZA 5F3TA 3JTOA 2XGQA 3SXLA 3FFIA 4O44A 1X5OA 4IH7A 4RW9A 4WK3A 4D3HA 2OD4A 3BR9A 4YB7A 5J2MB 1LOUA 2A1BA 4WE1A 2AD9A 1JMTA 2AJQA 1T03B 1VFJA 2MKIA 4DL2A 2HQIA 5ITHA 2QV6A 3PX4A 4WK1A 3QLHA 4ED0A 3OHAA 4ERDA 1PC4A 5HBMB 2E7WA 5HMWA 3LQVA 2QSFA 1NK9A 2EVZA 4EBCA 1T02A 4WU3A 1Q81T 4ILLA 1B0PA 1BY9A 4WKRA 4WYWA 1U4BA 2UUBF 4DL4A 4KSEB 5KG0A 4BBYA 4ZS6A 3G6XA 5K14B 1MROA 4F3OA 1XN9A 2MB0B 5KG1A 2C3PA 3BQ2A 2Q6CA 2XLIA 4M5DA 3D0HE 4G1PA 2W9AA 2HFZA 4UUWA 4DV4F 4OZ5A 3RRKA 4FXVA 3F41A 1JLEA 3G71S 4CO5A 5AJ3F 3HHLC 3I82A 3JAMY 3ENWA 2V94A 4DV6F 3IFEA 1N48A 1U45A 4ZP8A 3M8SA 4QWDA 3OXGA 1VMBA 4OX9F 3UCGA 2WONA 1FDDA 1N54B 4MYTA 3ZZZA 4A8MP 2KXFA 4X2BA 2XCAA 1KTQA 1IKYB 1F5CA 5B0GA 1JLCB 4DL3A 4ELTA 4DR5F 1NEEA 4A47A 5DDPC 1LV5A 5E3AA 4BWJA 4MIBA 2OJ3A 4CT9A 3U7JA 1CG2A 2K7JA 4ID5A 4DV3F 1RISA 4C0OC 5L9NA 2FY1A 2LMIA 1SH3A 2MZRA 1YRUA 2MMYA 3MR3A 4IDKB 4PCQA 1RTHA 2CQHA 2X51A 2DNMA 3WC2A 2G1DA 2EFPA 3RB0A 1N5YA 1FNMA 2GNKA 4UOCA 4EBEA 2IFXA 4RNNA 2LEBA 2NS1B 4GMKA 3OL8A 4OI1A 4AQYF 1X4HA 4IO9Q 1LW2B 5B08A 1LWCB 4FF4A 3BGFA 3KWMA 1U1PA 2XY7A 2XC9A 4MFBA 3M2UA 5LT5A 4DFKA 2PD1A 2RNEA 4HYKA 5A8KA 4DQQA 1KQSR 4X66F 3K0JA 4KFBB 1WHXA 3MECB 4TQRA 2KZZA 2CQDA 3HX9A 4RUHA 2QLXA 4JYAF 2J6UA 4DL5A 4JV5F 3MUVP 1O8BA 1DRZA 4Y2AA 1XR7A 4QIVA 2VBZA 2ZDOA 5BYSA 1SV5A 4DDFA 1JWWA 2H5EA 2ZUGA 2HHWA 1P6TA 1RT6A 3D1QA 4IFVA 3O8WA 2AWZA 2HPUA 1HNVA 4KO0A 5IQ6A 4B9LA 5BYRA 4N56A 2DR5A 5CH7B 1S1WB 4TKTA 1LFPA 2C3YA 2FHJA 2Y1IA 2C2RA 1MWYA 3MMBA 2VBWA 2XGPA 1WG4A 1ZM9A 1N0VC 1OS5A 5C25B 1H3DA 4JOUA 2BANA 4DV7F 3DRRB 5LL6d 3GFYA 2BXJA 2B7BB 5F41A 1WF2A 1IKXB 4EZ9A 4EYHB 2N82B 1VC6A 2ZNYA 3GFZA 1FD8A 3MEGB 1FKAF 2Q66A 4AXIA 1Q7YT 2KHDA 4C8MA 2BACA 4DEZA 2IM3A 3BF4A 4WFYA 2VQFF 3OSPA 1NJXA 4PQUB 1MSWD 4C8YA 4DL7A 5L38A 1DBDA 2ZDPA 1S6QA 5AXLA 2CVIA 1U26A 1DQ9A 5HROA 2K2PA 5C5JA 2GV1A 1UVIA 3I0SB 1FKOA 1OQ6A 2HIQA 4DSIA 5CZVA 4ECVA 3GE9A 2CPFA 1GT8A 2LXUA 4J9NA 1FJ7A 3LGNA 1SKWA 1N6QB 2KYZA 4HH1A 2RU3A 4PXBA 1X4GA 2HHQA 3FGVA 4ZCIA 1C0UA 3BQ0A 2E1RA 3LP1A 2A2CA 4C8ZA 3UR3C 1GH8A 4NOHA 5J2NB 3ZZYA 1UJ6A 5I3QA 4CCHA 4EUVA 4I67A 1QM9A 1TKXA 1MU2B 4TLQA 2DRAA 2XCPA 4AL7A 2V8VA 1HL6A 1HWLA 1HQEB 4O4GB 4YB1P 1XEZA 2DO0A 5KFZA 2HQ3A 1LWEB 3CCSS 4KKOA 1T95A 2LQBA 3C2PA 4DG1B 4TQSA 1SJFA 3ONQA 1HMVA 3K8WA 2E5JA 5AE1A 1LKZA 1P27B 1UFLA 4IQMA 3KLGB 4DR3F 3V6HA 3CD5A 1T3NA 3MGJA 1FJEB 1KOOA 3TARA 2ZH7A 2UP1A 1RTJB 2AGQA 4DWIA 4CIOA 2PSZA 1UP1A 4DMZA 1HBNB 2PC6A 3AA8A 4DSEA 2UUWA 4LF6F 5B0CA 5E5NA 4HT7A 4DV0F 4JV0A 1V3SA 3PY8A 2W4CA 2O01C 1LW0A 3MM5B 1UL3A 1EETA 4Y3CA 4X4OA 1NH7A 4UQGA 1E6YB 4LSNA 1ZZNA 4A8WA 1QAYA 5JUMA 2GHPA 3E3XA 4PG5A 3CD6S 3PHEA 3I4HX 4AL5A 5GMKa 3G8SA 5DLFA 5F8JA 3H40A 1FT8A 1TKTB 2X1GA 4I4BA 3WZ0A 1S1TB 1S10A 3CC7S 1KNZA 3BJYA 3CMAS 1XMOF 5E0OA 4ICLB 2NPFA 2E9RX 1S9FA 1VRUA 2KHCA 3VAMA 3PRDA 4B3RF 5KG5A 2UVWA 3QJPA 4L3NA 4RW9B 2QA4S 1S0VA 1Z2LA 5E3CA 4DJBA 2A18A 2GW8A 4WE1B 4QYRA 5GAGI 1KHVA 1D9DA 3DI6A 2BV3A 3LW5C 3MOZA 3QLHB 1RI7A 1FERA 2YKNA 3W2WA 1C0TA 1C4CA 4HTIA 2XLJA 2PGCA 2UXBF 2HFOA 5J2QA 5KT4A 3RU0A 3E8OA 1FDBA 3CCQS 1D9FA 2HWIA 2Z2MA 3OFEA 3HVRA 4W92B 2DR8A 3MEKA 5D6GA 4Y28C 4K50A 4I56A 3NLCA 1WHVA 2ZITA 4QU7A 1MROB 2BYCA 4MH8A 4ZHRB 2UVVA 4MKYA 3AJ1A 2KFNA 4M5DB 1OPIA 3EUNA 2XSFA 3G9CA 2RVJA 1VQOS 2M7SA 3H20A 1JLEB 1S6PA 2KRRA 2HS0A 1Q82T 3HMJG 2KJWA 4LVOP 3T19A 1R8AA 4ZPWR 2HGNA 2B56A 3MXHP 4D3GA 2BRKA 2LQ5A 1URNA 2XS7A 2YNGA 1RT7A 2WONB 4KHRA 1ZETA 4NLXA 4QR0A 1Y5IB 3TANA 2LQJA 4O3OA 5F8MA 4EU0A 1GTHA 2ASYA 2CPYA 2MSTA 3DXSX 5J1NA 2N4CA 2N3OA 4YOEA 3BN7A 3MEDA 4USHA 4PXDA 1RT3A 4PG6A 5FIIA 5GAGU 4J9KA 3I9ZA 1X4EA 2GJIA 4MKAA 2XLKA 4Y2CA 5E41A 3FSIA 3H4BA 2CJBA 4J9MA 3OJSA 1ZM4A 1GQEA 1IKWA 1SL0A 2KT2A 2HVIA 2D3ZA 1WD6A 2VG5A 2H9ZA 4EO6A 3FZ2A 4TYBA 3J7YI 2MGZA 1RTHB 1QVGR 4ZLPA 2BQUA 1QE1A 2DGOA 3HKWA 4KHMA 2M2BA 5B7WA 2ZHOA 1N5YB 5G0RA 1PO6A 2AJ4A 3LP0A 4L72B 1SH2A 3ZZPA 1FNOA 1WF0A 4WZMA 2BA9A 2DNPA 2R7QA 2QSWA 5CYJA 4DV2F 2E5LF 3ETOA 1XNQF 2QT7A 3NAHA 4I7FA 5I4MA 4C9DA 2KJVA 4B9SA 4DPOA 5J2PA 2KI2A 3M2UB 1YRTA 4MFBB 4WU2A 5L8RC 5A8KB 1Y9OA 1NKEA 2M8HA 3FDSA 4AXJA 4G1IA 3DRPB 2M4MA 3K5PA 5KFYA 1WG5A 2CQPA 3M8QA 4UW2A 1NK8A 4LQ3A 3OXLA 3CXCR 2HLTA 2G13A 2XNQA 3FQKA 2DISA 1QAJA 1SV5B 2DRBA 2VC1A 2AX1A 1Z2ZA 4IFVB 1K73T 3HXMA 2ZH5A 2O1PA 4NXNF 5B0DA 1U7LA 5KFGA 4O3PA 5KAKA 5F9NA 2ROGA 2RDJA 4TXSA 5CCMA 2KH9A 2BANB 2WCXA 3J7YU 3QWUA 2F1FA 2UXDF 3IWNC 2QYCA 3Q8PB 2DNNA 2V5HG 1RTDA 2DCUB 1Q1KA 2R9LA 2F8HA 3AY0A 3KJVA 3T3FA 1YJRA 2LEAA 4QCLA 4WTYA 1VQ7S 2NSBA 1FEEA 4I2PA 4G1QA 1E6VA 4CI0B 1S79A 4U7CA 2XY5A 3V5RA 1S6QB 1VJWA 2Q43A 3ITHB 4ZMMA 1NJWA 2KYXA 4JI1F 5M2RA 5HROB 3BS9A 3VAJA 3BSCA 3L09A 3OBIA 2JEGA 1G1XA 1FKOB 2I1RA 1U1KA 2JVRA 3N6LA 2XMVA 2B51A 1NJIT 2F9JA 2ABYA 3GFXA 5HBMA 2PMZD 2WK4A 1REVB 2YKAA 1VQLS 5MAOA 1YTYA 3C6TA 1C0UB 5L39A 2VL1A 2HHVA 3LP1B 3M30A 2RU9A 1KQGB 2P6SA 2E66A 3LAKA 3T5LA 3CCZA 2P9EA 4TN2A 2VKRA 5H9FJ 4IQXA 2L08A 5K14A 5IT4A 3CCLS 3KHGA 4F4XA 1Q78A 1TKDA 1Q16B 5HQ8A 3CJ0A 1WTFA 2P9GA 3ICLA 3T9NA 5KT5A 1SKRA 4B3OA 4OLOA 5E33A 2DPIA 4KKOB 4Q7AA 4QIEA 1VC0A 2RDIA 1NK7A 5JXSA 1AROP 3HZGA 1HMVB 3P3DA 2PFFB 1KQFB 2LLZA 1VRTA 1O51A 1DQAA 2Q1LA 3DDKA 2B6AB 2GC8A 1R89A 3J80Y 3HPOA 3CCVS 4OLPA 3L95X 2OH2A 4P2SA 3IN5A 4NLUA 2OSRA 2XS5A 4LJMA 4J37A 5B0FA 4WFAQ 2BZ2A 4KRWA 1S4FA 5U47A 3OLAA 2JSXA 2FVCA 4OHWA 2F7VA 2RE1A 5LSLA 1LW0B 4RNHA 1EETB 3I0RA 2R8HA 2NYIA 4LSNB 4F4YA 3P96A 4RWWA 5I42A 2HNDB 4N76A 4FXDA 1P8GA 1Z1ZA 4ED6A 3E2EA 1WF1A 1L3KA 5A8WA 4DQPA 3C8YA 1R0AB 3VAIA 3AQOA 2KVIA 2IVMA 3TUIC 1LXNA 5FJ4A 4ZP7A 2LU2A 3AB4B 4LUBA 1WWHA 5AXMA 1V3ZA 4ZCLA 1HWKA 1G3OA 2EFQA 2YNIA 4YFUA 2IHR1 3IGNA 2XMUA 2GHVC 2KG1A 4KJIA 4NCAA 4QIGA 2IBKA 2E9TA 3DOMA 4KGKA 3CDUA 2BRLA 3M05A 3DI6B 4O3NA 3RAXA 1RJJA 4RLEA 1D8ZA 3EGNA 3BSNA 2YKNB 3W2WB 2ERRA 1C0TB 3TA0A 2YX4A 1FF2A 2WHOA 3V4MA 5J2QB 1YJWS 2B4UA 2D3OR 2EI5A 2ZH8A 1KLMB 4DV5F 4I2QA 4XK8C 3QZ8A 5KFNA 2J7UA 1IQTA 4RWXA 1NHUA 3P6YC 1S1WA 1IN0A 1EP4A 4LVNP 3ENVA 2VKZG 3MR2A 3VF0B 1MMDA 4HH0A 2A10A 1MNEA 2L3MA 2PMHA 4B9VA 2ILZA 4A8QA 1R43A 3PV8A 1FRMA 1S6PB 3KKFA 2YVSA 3EPIA 3NCRA 2DHGA 2NXUA 3SV3A 3QGGA 2NUUG 2YNGB 1RT7B 2CPZA 3DHXA 5M2UA 3OR1A 3DFEA 1DTTA 3BDPA 4PQUA 1FRHA 1UEUA 5KG3A 3T1YF 3MEDB 1RT3B 2B5JA 2GGPA 1VQ5S 2E9ZA 3DM2B 3O44A 3GIJA 1QUVA 1S0NA 3GB0A 3T5KA 1Y5LB 1IKWB 4F8RA 4YR2A 3RR8A 4C0BA 2DH7A 5DDQC 2AQ4A 2MGZB 3CPWR 4OHYA 3UFCX 4OHXA 2CQ0A 3GMGA 5HLFA 4ZPCA 3BEGB