4P2SA

Alanine scanning mutagenesis identifies an asparagine-arginine-lysine triad essential to assembly of the shell of the pdu microcompartment
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
EALGMVETKGLTAAIEAADAMVASANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Putative propanediol utilization protein PduA
publication title Alanine Scanning Mutagenesis Identifies an Asparagine-Arginine-Lysine Triad Essential to Assembly of the Shell of the Pdu Microcompartment.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar saintpaul str. sara26
total genus 19
structure length 88
sequence length 88
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p2sA00
4OX6A 3N79A 2G13A 3H8YA 5DJBA 4P2SA 4AXJA 4QIVA 4DDFA 3MPYA 2A18A 4RBVA 4AXIA 3PACA 4P7VA 3SSRA 3I6PA 3MPWA 3IA0A 4OX8A 3NGKA 2EWHA 3DNCA 4RBTA 4RBUA 4QIEA 3SSSA 4OX7A 4LIWA 4OLPA 4P7TA 4QIFA 3BN4A 4OLOA 4PPDA 3NWGA 3SSQA 5L38A 3I96A 4QIGA 2A10A 3DN9A 3VCDA 2A1BA 3CIMA 3CGIA
chains in the Genus database with same CATH superfamily
4DBQA 3HM9A 1L3KA 4AXJA 2GO8A 3PTWA 2HFVA 2ZE2A 2W9CA 2ACMA 2HEKA 3FEYB 1RISA 4DR2F 4GMKA 3CCLS 1ZAVA 5T41A 3M7VA 4KT0C 3I9ZA 2JLFA 3DOLA 2RNEA 4FYXB 1KFDA 4TYBA 4QR2A 3FZBA 3BZQA 4NL5A 4LBPA 1GXUA 4R8UA 1JXEA 3A8KA 5F3TA 1HPZB 3CD0A 2AWZA 4OFZA 2FVSA 1WEYA 2ZH6A 4X4QA 3NGRA 1GTHA 5L1IA 1KONA 3ILLA 3M8QB 4KPYA 5HP1B 4M5LA 3G71S 3HJVA 4JI8J 4PPZA 1YHQS 1RWXB 2XG8A 3QYYA 1OIAA 4PXEA 3K8VA 1R7IA 1LWCA 3T1YF 4RUCA 1UFWA 5I42A 3RRHA 1RT7A 2ASYA 4P2SA 1IWGA 3I4PA 5DDQC 1IKYA 5KFVA 4KHPJ 2EI5A 2EWHA 4K4VA 3SQGB 1VC5A 1ZM3A 2XHWA 3FSIA 5E5NA 4K4WA 2G1DA 1EJ7L 4UY8T 4RX6A 3CDEA 2DNZA 1FRHA 4LF9J 2LVWA 2E9ZA 1UPMB 2NXNA 2EW9A 4IG0A 2R8JA 1MW7A 2DXEA 3P6YC 4HT5A 5ETLA 5JUMA 1KC8T 4OZLA 2HNDA 2IYGA 1LWXA 5DRKA 1WC6A 3B8HA 1TL1A 3N5BA 4F25A 4F2SA 1TQLA 2DO0A 2DRDA 2KT5A 2HFOA 4RUAA 1R0AB 1T05B 4C2MA 1JJ4A 4K4UA 4WZMA 1U2CA 5CQGA 1WF1A 1SC3B 4TLQA 2EXUA 1Q79A 4QQBA 1N33F 4UQTA 2GVDA 2N3LA 1RZMA 3HVWA 4ZJOA 1ULRA 1RAHB 2YQ1A 5KG2A 1FERA 4DSLA 2L3MA 1S0OA 4XTTA 2KXNB 2GGPA 2GAGC 3IR5B 1HNZJ 1WORA 1WI6A 4LSZB 2W8LA 2HHXA 1Q8LA 2HIYA 2WBMA 3QFWA 2IHR1 4X4RA 1VRTB 5L1JA 5KG0A 3HD1A 1NKEA 1WHWA 4NRUA 3DRYA 4KAIA 2JX2A 1FE4A 2XMWA 3DOMB 1B64A 3TANA 5DM6Q 2HHTA 2QSWA 1FVQA 2BM0A 4OJHA 1JLAA 3E8OA 2NLWA 4OI1A 1BUXA 3PYFA 4PXBA 1JLEB 1U26A 3W9JA 1EIYB 1T03B 1VLOA 3E3XA 5GADI 2RD5C 2IDEA 4DR2J 4PQUB 2ZZTA 4LF4F 2G2YA 1NZ8A 3OT9A 3EDQB 1YLXA 5FJ4A 3T9ZA 1FTRA 4DQSA 1RT4A 4NLYA 4NZ6A 4H4KA 1BE4A 1RU2A 1TL7A 3N01A 4G6VB 3PVXA 1AA1B 2F9DA 3AOAA 4QW8A 4LQ3A 1CS4A 2PE8A 2KG1A 2FB0A 4NZ7A 3ADAC 4N77A 4QPTA 3IRWP 4I6YA 1Y00A 3LGHA 2BV3A 2R2UA 3CXCR 1UWAA 1LFWA 4YR3A 4ZIWA 4I56A 3ILJA 2RRNA 4DJBA 1YJ7A 4OV1A 1RAEB 1R8PA 2MKCA 2W7PA 1L3VA 1VQ8S 2YKQA 4TY8A 2DGVA 2ZVSA 3GV8B 4AL7A 1LWFB 1WI8A 4WTYA 3GSDA 4CLZA 2NXEA 5J2QA 3NCPA 3T1YJ 1C1BA 2FY8A 2ZH9A 1ZTWA 1GMUA 3CCVS 1N5YA 1S6PA 2YPYA 1IBKF 2FYXA 4WZQA 1LW2A 1TKZA 2E1CA 5M2UA 1UW9A 1JNRB 1I3OB 1N8RT 2OD4A 3IG1A 3VAFA 3OHAA 3GR1A 4W98A 4P10A 2PMWA 4H4MA 1NKCA 5E0OA 1R8HA 1TELA 3LP1A 2YTCA 4OYXA 3FBCA 1S9EA 2FLOA 5CYQA 2NPIA 2E1RA 4ED0A 4NLUA 4C0OC 3M2RB 4I2QA 3NL0A 1Q78A 1NHVA 1HI0P 5LMUJ 3CMAS 3MD1A 4FYYB 3S8SA 2B56A 4OYPA 3IWLA 1F2HA 2X3DA 4ZPAA 1V6HA 4P75A 4CH1A 1LXJA 4FPIA 2GQCA 1TR0A 2R8KA 2GQQA 4DX5A 1FXRA 3RB3A 1N34F 4DEZA 1ZA1B 2G1HA 1WEXA 3CJSA 1OY9A 3H2LA 2BW7A 3BSAA 2MQPA 4DLGA 1A7GE 1N33J 4R5PA 2H54B 3UD5A 2NZCA 5THWA 1RHKB 2JL9A 1DBDA 4EYHB 4TXSA 2CJBA 3MCMA 2ATLA 3W5XA 4PWDA 3DLHA 4O44A 3UN5A 1KHVA 3KMSA 3UDVA 2G2OA 3OFEA 2DH7A 1D9DA 1CJVB 4F3QA 1HBMA 1EP4B 4OZ2A 3DGVA 3GIKA 1JLBA 2ALZA 1V5VA 3D3BJ 2R7WA 4M63A 4F04B 3V6KA 3UD3P 4WP3A 1NK8A 3TJAA 3R7BB 4M5DA 2HHSA 3HT0A 3HSDA 2W4PA 2V68A 3CTRA 1S5ZA 5JMNA 3KXDA 1N36F 2B8PA 1X5SA 1FJ7A 5KFXA 4JI3F 1NB7A 4LF4J 3FMWA 3A4TA 2AZ1A 4IG3A 3K7RA 2HG4A 3H90A 2ZH8A 4NXNF 4ZIVA 5DDRC 4DQIA 2L9WA 3DDNA 1OQ6A 3PYEA 4CRJA 4D3HA 4DG1A 1RBAA 1SIZA 4X4PA 3MAHA 1SC4B 1IXKA 1XR6A 4IKAA 2DHHA 3T5KA 3ITHA 3I9V9 3W64A 2DXFA 2V4JA 3BSNA 3LALA 4I69A 2MXYA 2W4CA 4USWA 1SH0A 3CW2C 1F3FA 1CVJA 4F8RA 2LEPA 2DY9A 5L1KA 1Q8IA 3PACA 5K8PA 1U45A 1RT2B 4EO6A 4A46A 1NCLA 3H20A 1RHQB 1Y3JA 3D0IE 1JLGA 1FD8A 5B7WA 2QA4G 1X0FA 1QTNB 1QDUB 1DLOA 3N6NA 3K5MA 2KXHA 5HO4A 4J9SA 4IH5A 3PZPA 3AQOA 2DR9A 1RHUB 5B0AA 2JVRA 3M9NB 1IBKJ 2IM2A 3VZHA 3RAMA 1RT5A 5E3CA 5IT0A 3K5NA 2ZEJA 2VPZB 4CO0A 3OVAA 3BO3A 4ZPDA 3FC9A 3DKDA 2ZVIA 4WYWA 3OTOF 3QQCD 1EQ0A 2VG7B 3IO1A 3DLKB 1RAIB 3J7AN 2N4DA 4WE1A 2MQMA 3IMQJ 2JOQA 2IA0A 4PUOB 3KLEA 2EPIA 5JJBA 1GMWA 2ROEA 3GFZA 2YNFB 3AJ2A 2KKHA 3KLGB 5LSRA 2CAJA 2H65B 3T5LA 2E5IA 2AJFE 2CQ3A 4ZMMA 2D3UA 3RUBL 1T7PA 2ZH1A 2KDOA 5IFMA 1AXQA 1TUVA 1F5CA 4MKAA 2FUG9 1N34J 5IWAF 5HAOA 1FT8A 2K7KA 1TKDA 3POTB 4ZN3A 3NEKA 2WK4A 2MKIA 4MYUA 1FX4A 3QLHB 1X9MA 3EICA 4FXDA 5HBMA 2VQFF 4FVCA 4WYLA 3T1AA 1RDRA 4GRSA 4A8WA 4AFFA 1M5HA 4DS5A 5CD4A 2ASDA 3SSQA 3ZZYA 3BS9A 1IKXB 2MMYA 2XYGB 3TOQA 2OJ3A 4QIVA 2GVZA 3U27A 1JKHB 2RDDA 3F56A 3C2PA 2WHOA 2ZH5A 3H4BA 3GYXB 3M4XA 1QE1A 3GSIA 1DHMA 4TU7A 3TJ8A 1JLQB 4UOFA 1N36J 2YNGB 4GVBB 4JI3J 4ETXA 1JNZB 2GAHC 2UUTA 2Q1LA 3IGNA 3EZUA 4KB7A 5KT3A 1WJ9A 4NXNJ 3MR5A 3D1OA 3TNVA 2FD2A 2LQBA 2YX1A 3VF0B 4EFAC 3QJJA 1U1NA 2KHCA 2KL8A 1RJJA 3GTYX 1WHVA 1XMQF 5B0CA 4YB1P 4WIQA 4DX6A 4AL6A 1K8AT 1AB8A 4P73A 2UXCF 2ROGA 4M95A 3D68A 4USMA 2MY7A 1TFYA 5IZHA 1S97A 1G4CA 4QWCA 2G4BA 2ZC3A 5B09A 5DGBA 1WSRA 1LFPA 3QGPA 1JX4A 3I6PA 5KFAA 2V9WA 3R5GA 3CDAA 1WUUA 3PW0A 2B51A 2BXJA 2WB1D 3KLFB 3SCKE 1PYSB 2CQ2A 3NWRA 4DOZA 5D0HA 4DUYF 2B5JB 1F1BB 3CCZA 4ZN1A 2BKPA 1KTQA 5LL6d 2J5AA 2AEFA 4YDXA 2CNNB 3O8WA 1Y5NB 3W2WB 4ZVGA 3GONA 1FXLA 3GFXA 1N48A 3HVTB 1T11A 4I7FA 2VJUA 3OTOJ 1RAJA 4FYDA 2OMLA 5IT4A 4YB6A 1ZPVA 4MKYA 4ZVQB 2BANA 3DRRB 1CJKB 2M3DA 3LO3A 3SSRA 4CH7A 4A8KA 3R6GB 4OYMA 2O5DA 3PNIA 2HVEA 3R9LA 4JI0F 4TQRA 1S9FA 4IR9A 2DIUA 3CCQS 4R0EA 1S57A 5IWAJ 3DMJB 2JH3A 4CO2A 4G1QB 3KK2B 3TVKA 4BLGA 3SV4A 2RS2A 2V8VA 1HQUA 2ZNZA 5K20B 2XSFA 3M2UA 1VK8A 4Y34A 3KJNB 4AUKA 3O5TB 4M8LA 1NDKA 1VISA 2V0NA 4N41A 3BPDA 1N88A 1K0TA 4KKOB 2YX7A 4OHXA 2VQFJ 3BEGB 2UU9F 4L6V3 1RAAB 1J27A 2VBZA 4Q0BA 1RHJB 2K1RB 3TUPA 3HPOA 3QJPA 3RAQA 2N3OA 1X4GA 1N56A 3KWMA 4IUFA 5F41A 2YWFA 3ENWA 1YITS 1D3WA 4DR4F 3BGRA 2OMOA 1SL1A 1S76D 1CPZA 3KK3B 3H8YA 1M5OC 1X9SA 3GJSB 4ZHRB 2HFNA 1SJ4P 5J2NB 2Z56B 2ZHOA 2DPJA 2B8QA 1NBEB 3ZZOA 3FEZA 2R7SA 2V9KA 9RUBA 4JI1F 1RTHA 1WKKA 1RQ0A 3NNAA 1HHTP 5KT7A 2B4UA 3OUYB 1NHUA 1OPIA 1Q82T 1JXLA 4Z7CA 3H5YA 3UR0A 1HYSB 1KQGB 2DYAA 1XMQJ 3UVJA 2DVIA 3TZYA 2HNZA 1Y11A 2LXIA 3GPAA 1L3UA 2UXCJ 4AYBD 3KOAA 4UUXA 2XMKA 4Y6IA 5ETQA 2G0CA 4PXCA 2HK3A 1OY8A 2V34A 2KZZA 2IVFB 1PC5A 3KJVB 2YQ3A 1RACB 1DTQA 1DRZA 1O5JA 3BB5A 4OI4A 3LTOA 2AJ2A 5J2PB 2JLGA 3OL6A 3RZAA 1IQTA 3H5SA 3RAXA 3I55S 4X4SA 1KFSA 3IC1A 2M8DB 1U25A 1S1VB 2RH3A 3C16B 2PA3A 3CJ2A 4DUYJ 4HHUA 1P1TA 3DXSX 3DU5A 2XB2D 1L5UA 4EWTA 2GJIA 2L9DA 3DRSB 1Q81T 1LWEA 2CA9A 4Y3CA 2MQNA 2BJ3A 1NNDA 2DR6A 1J5OA 1QUPA 3QSIA 4Y2AA 4HL9A 1NRKA 3N6LA 4EEYA 1RYRA 1QAIA 5KT6A 2FHKA 2K7JA 1UVIA 5LOQA 3P49B 2E5LF 2L41A 3T6BA 1X7VA 4WFYA 3JSMA 4OZ3A 4C8YA 4RBVA 1HNVA 5KFCA 4OX8A 2VZ9A 1Q0NA 4JI0J 1IJFB 4DLEA 5D3GB 5T14A 3GIMA 4ZPCA 3PKYA 4U95A 2C3UA 4NX9A 3HI9A 2DITA 1T8EA 2W25A 4IFVA 3B6BA 5H9EJ 3PW2A 3DRPB 4LR8A 3JXOA 5A76A 4DV3F 1OYEA 1HR0F 2A1BA 2DIVA 1H2VZ 4H4KC 1FNXH 2WONA 2UU9J 2QYCA 3J81U 2Y1IA 1S6OA 3DLLQ 3OTBA 1HWLA 3CCES 3NRBA 3TZXA 5CA5A 1FKAF 4RNMA 4E2FB 1UPPA 3Q23A 1IN0A 3TRGA 4DR4J 1SUQA 1RAGB 4FBUA 1O51A 2DRAA 4DQPA 1TMMA 4HLBA 4D3GA 3LP0A 4A47A 4N7TA 1T0TV 3NS7B 4NMXA 3MM8A 2V6AA 1HLWA 1SKSA 3OFFA 4DF4A 3LQVA 3G8SA 2XM3A 1X4HA 1WG1A 3ETOA 4JI1J 1YBTA 1WG5A 2VF3A 5EUHA 1EZZB 3ZTRA 2ILZA 4FNHA 3JSYA 4PG4A 4LR9A 3R27A 4NA3A 4QPXA 4I6WA 1KTVA 3WX4A 1GXTA 1U1KA 1LW0B 3HHNB 1YGYA 2W1BA 1BQMA 3QZ7A 3A1YG 5I3QA 4HEA9 2AEMA 1S77D 4YMEA 3MCOA 2R2RA 1HBOB 2VONA 4LJMA 4IOAQ 2HS0A 1NPKA 3BPSP 1X5OA 2VG6B 5B0FA 2PN6A 4X66F 4HDGA 2ZC4A 1XR5A 1SJFA 1IR2A 1HBUA 2V50A 4HI1A 2HVIA 2C3PA 4HT7A 4LF7F 3RB6A 2W2OP 4CLUA 4PABA 4BBYA 1AZSA 4XDDA 5CAAA 4DCJB 2PD1A 2MQ8A 1GH8A 2F5GA 2Z2ZA 3J7YU 2NXCA 1RWUA 1Y5LB 3VR1A 5KT5A 1JQGA 4IQXA 2UZAA 3P5TL 4P52A 2D3O1 1OQ3A 2PSZA 3M6VA 2VUGA 3H0PA 1D8ZA 2CUYA 1NHKL 4Y2KA 5FDLA 3QO9A 1CQMA 3FFIA 4ELTA 4HH1A 3I5CA 3SFUA 1X4AA 3C19A 1MG7A 2E5LJ 3C6TB 4USHA 1S6UA 3UCGA 2MDAA 3PHEA 4ER8A 3ILOA 2RKIB 5KFGA 4ECQA 4KHMA 3SIPB 4NPOA 5BYQA 1Q86T 2ROPA 4B02A 5LJ3Y 1DY3A 3CJKA 5DDPC 2Z2MA 1VQ6S 1FKPA 3BR8A 3HHLC 2H48B 5E2QA 4I2PA 4WIIA 2R2TA 4IOCQ 4RU9A 4ZCMA 2IC3A 3OJUA 3RBXA 3CJRA 2B9EA 3M8YA 2WAQD 3ZC4A 3ET6B 4YUDA 4DV3J 2IRXA 1HR0J 4LMZA 4LFBJ 4ED2A 2J0SD 4DR1F 2MGZB 1HNWF 5B0BA 3R7SB 2YKMB 2AQ4A 1Q16B 1Q5YA 3FZ2A 1AFJA 3PR5B 3CD6S 4RW8A 2VKZG 4RW7B 2MYFA 3W66A 2QFIA 3M32A 2Y1RI 2VFSA 3HHLD 3KUHA 4ZVOB 1YJ9S 1UETA 1VRUA 5J1PA 2CJYB 2BABA 1YJVA 1IM4A 3A3PB 2YWEA 5LMNF 2C1EB 2VICA 3I5AA 1H74A 3PHTA 3V6DB 5GAEU 4NZ0A 2OPRB 4UW2A 1C2PA 3TAMB 4CQ1A 2VDHA 2HQCA 1X9WA 2CZ9A 3GMGA 4JV0A 3S6EA 6FD1A 3AD8C 4KJIA 1UZHA 3Q89A 2DRBA 2G0IA 2FTRA 1ZYQA 3RB4A 3P3DA 1RT6A 3ENAA 4DR6F 3MEDB 3MDFA 3BH6B 5HROB 3MM7B 2IAJB 1CJUA 2ZWOA 3UQSA 1S9GA 4IFYA 4JYAF 3RBDA 4B3MF 5CH7B 2RQ4A 3DGPB 2DHXA 2IJNA 3QRRA 2HFZA 2NXUA 4HACB 2OSQA 1TZ0A 5GAGU 4KBIA 4X66J 1RGVA 1VHFA 4RW9A 3CMQA 1IQZA 1Y7PA 4J9UE 4IRDA 1S1WB 2JJ4D 4NCAA 4DR3F 4NE9C 1VDHA 1C0TB 4LF7J 5J2MB 5D0EA 3W63A 3W62A 1AYEA 2R7OA 2ZH3A 2DR8A 1EARA 2NYIA 2COLA 4O3SA 3D6FB 3MMAA 2QL9B 3TA2A 3OJSA 3M8RA 3CJQA 4O3RA 3HF5A 1WG4A 4ZP7A 4DFJA 2CWKA 2ZFHA 4KYZA 4NI2A 4Q45A 2MSSA 4YB7A 4C8LA 3BGFA 1TFWA 2H3EB 1WD6A 1KDNA 3K0JA 3AD9C 1WKJA 2Z0GA 4L76A 3FUYA 1NSPA 1YQHA 1RB0A 2HGNA 4BC9A 3EVWA 4ZP8A 4I0WA 1BGXT 5K5MA 4B9UA 3PXGa 2D1CA 3ONQA 3JYTA 4HR2A 3AA9A 3DOKA 1REVA 3ZZ0A 2FJDB 2IYIA 2OSRA 1F9FA 3HD2A 3G6ES 3UFCX 3DDKA 3QJLA 2XLIA 4DV1F 1JWWA 4DS4A 1RK8A 1ZH5A 4K0KF 2C2MB 2X51A 4ZVUB 4NCGA 1RBOB 3MTJA 1PYTA 1YVFA 1LQ9A 4TYAA 2YH1A 3DLJA 4EMDA 1ELOA 3DLGB 1VR6A 4DR1J 1HNWJ 4RWXA 3KKFA 4OYZA 2MLYA 4ES2A 3U1LA 2AJ1A 4K50A 1RT3B 4MT1A 5CXTA 3CSKA 4U7CA 1HNXF 4NLDA 1NDCA 5F8NA 2GS8A 3PCOB 5K14A 2FY1A 3D9BA 3V5RA 1FRKA 1JLCB 3MR2A 2ALYB 1ZETA 5EGYA 4IH6A 2JC1A 3J7YI 3SZ2A 3QAEA 4ZVTB 1HPZA 4ITSA 3M6WA 3MD3A 2EEYA 5LMNJ 2Q6CA 3MEKA 1FFGB 1ITPA 2XLJA 1H72C 4N8NA 1KKHA 2J9EA 1NXIA 5A8WB 3DHWC 4B3OB 3CMES 1IKWB 3U1MA 2BUNA 1SL2A 5EN1A 1O6XA 4EYIB 3CC4S 1VJQA 2B7CB 3MR7A 2ERRA 2CDQA 2UUWA 1PBAA 4ALZA 4PG6A 2K8GA 4DU8A 1LEOA 3TX0A 4ZDNA 4DR6J 2PEHA 1U6FA 1QJHA 1SCJB 5J1EB 1G1XA 3M9OB 3T5HA 2ZOMA 2DNHA 4FF2A 4MTPA 3SQGA 1VQMS 2E44A 5DLFA 3T9NA 3QIPB 4JYAJ 4GC7A 4KR0B 2GHVC 2VDIA 4B3MJ 3BBBA 3TZWA 1WC5A 3AFGA 1N5QA 3R5BA 3E2EA 2Z30B 2ZH2A 4DR3J 2KZMA 3D6HB 5C25A 3JQKA 1XTZA 2BRLA 2AIRB 3DI6B 1WTBA 5MLCV 3MFIA 3HSJA 5KFJA 1KEKA 4L3KA 2Y0SD 3HP6A 3EPIA 1H0HB 1F2GA 4F50A 1R0AA 1T05A 1S59A 4Y28C 1UWBB 3BQ1A 1R8BA 8AT1B 2OGUA 1D8YA 4ZCLA 2OPQB 4N8OA 1UVNA 4A8FA 1R31A 2DNLA 1LOUA 3NWGA 5ETPA 5IC6B 2HRTA 2V5HG 1SH3A 3HLUA 4DSKA 2CADA 5HMZA 4I1TA 1J2VA 5GAEI 4KGKA 5KFUA 3JAMU 3PX4A 2N7YA 4LFAF 1VCTA 1ZS6A 4DXLA 2LQ8A 4PR6A 3SDEB 3UPFA 5I42B 1RT7B 2XWXA 4DV1J 1IKYB 3AJDA 1TL5A 2M8HA 2M88A 5M2PA 1SL0A 2ZZMA 3AODA 1UKUA 4DFPA 4K0KJ 3V81B 4J9VA 3QT8A 3DOMA 4QOTA 1VIOA 5F9LA 5KFKA 5IC4B 1QSYA 2AGQA 4RO0A 1V5IB 3H2VE 4OYIA 1JLEA 2EC0A 2F40A 3AJ1A 2EBGA 4YR0A 4DL0C 1T03A 1DZ5A 1NMEB 4PQUA 5FLXU 5IXUA 3MOJB 3UNGC 5GAGI 3GV7B 1UA0A 1HNXJ 4YS2A 5FIIA 1GT8A 2V69A 3W3SA 3M05A 1T9VA 4QWBA 2ZHBA 2OKQA 4DMZA 1HKAA 1T3NA 3O3LA 1VYAA 1D9FA 2ZWPA 2E9TA 4XAKA 2FZGB 2GVDB 3Q8YA 2CRLA 2EFQA 3CD7A 3FGVA 4MAKA 2CPYA 2AJQA 3UO0A 2V63A 3VVTA 1MROB 2A10A 3OR1B 2BKNA 2M0GB 5HMXA 5GMKa 4CH0S 1LWFA 3I0SB 2HMIB 2F8EX 5KFFA 2UVWA 3MHYA 5MAOA 4Y2IA 2OFHX 1MMLA 1U7LA 3MF5A 5LJ5Y 4LRAA 5ETVA 1YI2S 1Q5VA 1VMBA 3SV3A 3K5OA 3GLJA 4MKVA 4PPDA 4LUBA 2F9JA 2GQ2A 2HAFA 2UV8A 2XMVA 1C4CA 2AKWB 4NLOA 2H1YA 5KFBA 3JQMA 1HWIA 3PYDA 2CPZA 4RW6B 2XY6A 2HW3A 1XERA 1KLMB 1ZZFA 3MMJA 3K58A 1WDDA 2NR0A 3Q8UA 1TL7B 2JVOA 3Q22A 1M90T 2LCWA 3UDEA 1EKSA 4JI2F 3I87A 1CS4B 1VS3A 2H9ZA 2R8GA 5L38A 3FSYA 2RUGA 5LXRA 2DNRA 4C11A 1FNMA 3ELHA 2B9YA 3SFGA 2VB6A 5DG8A 3M30A 3GB0A 3A3NB 1ICEB 3B4MA 4NCBA 4J9OA 2R7TA 3TYTA 1S1TB 1OMSA 3IRXA 1XEZA 2DGXA 4PWWA 3PM9A 4LFAJ 1NUEA 3FK4A 2JC0A 1ZBTA 1KWMA 1T94A 3TP2A 3F0NA 4U8YA 5EWEA 2PO4A 3LGMA 1JJ2R 1CJVA 4IRKA 2C2EA 3A8JA 1WOSA 1EP4A 3VV2B 3EZ5A 1TKZB 3PFEA 1RXOB 1HHSA 2VFTA 3CJ4A 3IG1B 3H2UB 3BH7B 1YDLA 4RU2A 2EG1A 2R7VA 4J9QA 3G82B 1BWVA 2EKNA 3VGUA 4RR5A 2VC0A 2ZDOA 2HHUA 2YKPA 3EMTA 5KOXA 4ECVA 1B4SA 3IR7B 1PC4A 5KFIA 5CYQB 5DG9A 3RGIA 2RHSB 4HKQA 3GFHA 3H98A 4M5MA 4MK8A 2UP1A 1AUSL 4Y2CA 3BJYA 1XNRF 4J37A 3NOGA 3IBFB 5ETKA 1WHYA 2BR0A 1A9NB 4JP8A 3C46A 3IFEA 1BQNB 3PJXA 1X4DA 3F73A 4LSLB 2FJXA 3MUMP 1RKJA 2UUBF 2KM8B 2HSEB 3KNGA 5DZ6A 3T6JA 1FTCA 3PEJA 2YBVA 2O01C 1WELA 2EBEA 1JJHA 2F7VA 1KOHA 1X4CA 2NXJA 4F4AA 1RSCA 2BE9B 2R7UA 1RT2A 2V67A 3SI8A 1HD1A 1RLCL 4F4WA 1KVJA 4CZCA 1B3TA 1YJTA 1QSLA 4Q2MA 3HSZA 1OO0B 4NLXA 3LP2A 5BXIA 2FVPA 1X5PA 1NAQA 4OX7A 1A0OB 1DTTB 1TL3A 3EX7B 4ECYA 1ZAWA 1U1RA 2P6TA 2KFZA 2CQ4A 4M5NA 4I6AA 4DSFA 1HI1A 3HZEA 1VK3A 2P6SA 2P9CA 4RNNA 2VG7A 3M2VA 1V3RA 3TJ9A 2RVJA 4QYZK 3DLKA 1FJEB 1IUJA 4PUOA 1ROFA 3M6XA 3H5UA 2MZ1A 2YWGA 3KJFB 5E3AA 2YNFA 1FFSB 3EJMA 2DNKA 3SXLA 2V94A 4DG1B 4JI2J 1ZOTA 1SBRA 1TU0B 1GMVA 3ILIA 3KLGA 3I32A 2HNYB 3E01A 4Y2MA 4MFBB 4LRBA 3QPIA 4NRTA 2FJBB 2VBWA 4QIEA 2HZCA 3BR9A 3HVAA 3N28A 4ZLNA 2VHGA 4O3QA 4M94A 1HL6A 3R5CA 4QWEA 3POTA 2QZ8A 3UR3C 2NREA 2OTLS 4DPTA 4Q5VA 3B4DA 4WP9A 2XC9A 3OFGA 3QLHA 1SJ3P 2HHWA 1BQXA 4E8UA 3OLAA 3FRZA 1E6YB 3W61A 1RTDA 2QC3A 2Y8WA 4PG7A 5C24A 3FQKA 2BOAA 1DLOB 5DQHA 1HWKA 3EXCX 2UXBF 4DWIA 5D4LA 4WFBQ 2HQGA 3PFOA 3MGJA 4H4OA 5ETNA 4FYWB 4URGA 4DCPB 1CJTA 3GU0A 5L39A 1IKXA 5EDWA 4QYRA 4ZOSA 3RBZA 2VA2A 1BLUA 2MLZA 4FN5A 2KRRA 1PILA 1RCXB 3DRXA 4I64A 3H4DA 2BA9A 3TVYA 3HHDA 1U4BA 2HZVA 2PDAA 1JLQA 2YNGA 1FO1A 4WE1B 2R7QA 1O0PA 3KLEB 1TMJA 4NYOA 2C22A 1XNRJ 3OLBA 3JSBA 4OX9F 2GNKA 4CYUB 1PJ5A 1ZAXA 3BBCA 1KS2A 1M1KT 2FLPA 4P74A 3J80U 3UDCA 3NG8A 3M8PB 1N5TA 1I1GA 2AGOA 2UUBJ 1I94F 2LU1A 4JV2A 1GK8A 2J8AA 1UVMA 3MPWA 2V2ZA 1Q95G 8RUCA 1U1LA 2DNPA 3ZTOA 3VGTA 3W9HA 5AE3A 3V4MA 3HJFA 2VFVA 2DKOB 2A18A 1MWZA 2Y3YA 1GX6A 2HLTA 2M9KA 2AYGA 4KPCA 4ZVFA 5JVGQ 3PW5A 3KLFA 2IDLA 4ZKAA 2ZBQA 4K59A 3GJRB 2F8MA 4N56A 2B5JA 2I0XA 3HDSA 3I82A 3FCVA 4LRFA 1HIYA 4F0KA 5SUHA 1RLDA 2AX0A 2IM1A 4PEOA 1CEZA 3TUZC 1R0CB 3MM6A 2H4WB 4ZVHA 4L74A 1FA0A 1AROP 3OXGA 3JAMY 2ZUAA 1MU2A 4CO3A 4MKBA 1HBNA 1Q1KA 4W92B 4ED7A 3DRRA 3EGWB 2QJ3A 2HGLA 2Q66A 3OPKA 2LKZA 1KP6A 2O3DA 3L4BC 1HMVB 2CPIA 2WSCC 4KFBA 4PYDA 5E7OB 2AHOB 2DNMA 1T95A 3SMZA 3O44A 2B4OA 4GO7X 1JB0C 3G86A 2ZD1B 2IA6A 3DMJA 4ED3A 3KK2A 4ZK7M 4WKYA 3MI7X 2MKHA 2OPPA 2ZDPA 4WXWA 1N52B 5FLXY 1QLNA 5CHCB 4KKOA 1RKIA 2QLJB 2QX0A 2VBYA 1Y10A 4MK7A 2UXBJ 5C7PA 3C8YA 2K1RA 5DQIA 2CNOB 2VG5A 2W9BB 1U2FA 2BQ3A 1VQ4S 1NDPA 5LMUF 1PKUA 4DL4A 1VBYA 2R7RA 3UN3A 4XO0A 2VFUA 2V8GA 3SCIE 4ZLLA 3TQ1A 2VL1A 2F63A 1H7XA 2PA8D 2GMHA 2AYBA 4ZHRA 2KU7A 5HMWA 4HH0A 3AB4B 3CNQP 2HWIA 4P7TA 3PW4A 2FVCA 2XS7A 2E1AA 2ZZNA 4MIWA 2BANB 1PO6A 2O1PA 1TV6A 1S6QA 4KRWA 1Q4RA 4A4JA 2QL5B 3IGVA 2EC2A 3VTIA 4OX9J 2PI5A 1UEUA 4ERDA 3SYZA 3ULHA 2I5JB 1X8DA 3LPEA 2LECA 4YFUA 1P9QC 4IDKB 4J9RA 3NMRA 2ZKUA 2BX6A 3CJ3A 1NK0A 1NK7A 1R89A 1I94J 2LFVA 5D4OA 4X4UA 4ECXA 4KC5A 1K47A 4MIBA 4EU0A 3KHLA 2J9CA 3X1LB 4PCQA 5HVGA 4P7VA 1S7HA 5KFQA 3NBPB 4C97A 1FX2A 1REGX 3THPA 3QMQA 3H40A 3THVA 2Y9HA 5A0YA 1S1VA 3C16A 1OJ4A 1VC0A 3EE3A 2IVYA 3HSGA 2R9LA 1N6QB 3QRPA 3DRSA 1V3ZA 2HBRB 1SQFA 4LRCA 2CPDA 2IY5B 1RWKB 7FDRA 2RJZA 1U2RA 1RHRB 4OZ0A 2KFNA 1S49A 4KGMA 4OX6A 1RT1B 5SZTA 3CDWA 2UUCF 3L7PA 4B3RF 2W8KA 3DLBA 2EFPA 3AHPA 4C8ZA 2BJDA 3MPVA 1M1HA 2J7UA 3N9UC 2IJRA 4P2MA 3KUEA 4JI6F 1NK6A 3CIZA 2VOOA 2CQBA 4LVOP 1LXNA 3LA0A 3D2WA 4DQRA 1VQLS 2KJVA 1UL3A 2DGOA 3GIRA 3A13A 5C5JA 2XLKA 1RWNB 3D6TB 4OZ5A 3IWNC 3AH6A 4BC7A 3V4IB 4PXDA 5ETMA 3BN7A 2I6WA 2RF2B 3MM5A 1JXVA 3ZZPA 2YKNB 4C6AA 2OEMA 4C48A 3RG6A 4CIOA 4X64F 4OLOA 2FHJD 2YNIB 4CLSA 4N47A 3HO1A 3A3OB 2GIFA 4DL6A 4IR1A 2OUGA 1PJ7A 4UOCA 5C2GA 5CCLA 2I9SA 5HQMA 4X2BA 1E6VB 3CDBA 3CF5Q 1UEVA 1S0VA 5JXSA 4C3LA 3EPGA 2OPSB 2RQMA 1U6BA 1LWEB 3MWBA 2FQQB 3H42A 3IAM9 3BO4A 5KFLA 5ADZA 4NYZA 4P2FA 1G7CB 2WW4A 2AW0A 4K2JA 4F26A 1QVFR 1K1QA 2EVZA 1RAFB 2QA2A 4IRCA 2KJWA 4EBCA 1YSJA 2OI2A 1FRMA 1S7IA 2D3OR 1P8GA 3CGIA 2PGCA 2VD3A 1FE0A 3HX9A 3I56S 2W2NP 4FVMA 4FZVA 4Q8EA 1SV5A 4J9MA 2EKYA 1LW0A 3R1LA 2HGMA 3D54A 1GXLA 4JV5F 4O4GA 2Q43A 1UW4A 1VQ7S 2XNQA 5ETRA 2MKJA 2E66A 5CYMA 2JHEA 2XMMA 4HHHA 4IFVB 3W60A 4ICLB 5GAHI 3JSRA 4F2RA 3MMCB 4KGVB 2QYGA 1HBOA 1T9YA 3KK1A 1XMBA 3HHLA 2UVUA 3V6JA 4LF8F 1WACA 1MMDA 3P8BB 4KO0A 2JRSA 3R2CJ 2W9AA 4BWJA 3VVUA 4PAAA 3LF0A 2ZOFA 1WC4A 4YOEA 3P5BP 3FBFA 4WU2A 3R7NB 5CCMA 5EX3A 4C8OA 1Q53A 2HHHF 3LP0B 2OAUA 1Q7YT 1W2BR 3LANA 2QTWA 2NS1B 4H54A 2MZQA 3LPYA 3MUVP 5A8KB 4RBUA 1VBZA 5GVQA 4M5IA 3Q8SB 1FFWB 3G8TA 2UUCJ 2QMWA 4QBUA 4USTA 4B3RJ 1QSSA 5CZVA 1H3DA 4USUA 3C6TA 4KV8B 4K4YA 1Y3KA 2LA6A 3NMAA 3K17A 2AGPA 4JI6J 4RZRA 3P4UB 3FQLA 3T41A 3WIVA 2BJ8A 2RKIA 2E7XA 3DYAB 3QSYB 3K57A 1NEEA 5ETTA 4NLSA 3CWJA 2F1FA 9ATCB 3TUIC 2ZJPQ 2AU0A 2ATCB 1FRIA 5D15A 2ZNYA 4NOHA 3UCZP 3ET6A 1GAOA 4J9NA 4WU3A 2JSXA 3MECA 4X64J 4QWAA 3W5ZA 5EHHA 2GJ2A 1SC6A 2B6AB 2MGZA 4EUVA 2M52A 1HA1A 4R0JA 4CDIA 2HK2A 2IRUA 1FDDA 1TAQA 4F0HA 5DGAA 3LAMA 1J5EF 4RW7A 3IA0A 2I8EA 3S1TA 2CNKB 2MQLA 2ZUGA 3MR3A 3J80Y 4NLQA 4UT4A 5HN0A 3FCHA 3EM1A 5KFNA 3PJWA 3CCJS 4ETZA 4DFKA 1IWAA 5K8OA 1FVSA 1HARA 2Z57B 5KFSA 5FDLB 5KG1A 3V6DA 3BSCA 1CBKA 3P45B 4MMOA 2HBQB 2HPUA 2OPRA 2FJEB 2RSQA 3VQTA 2YNHB 4XDCA 3QT7A 4C4WA 1VLYA 5D0RA 4BS2A 1TKXB 4DR5F 5LSOA 1B99A 1SB6A 2C42A 4ES3A 2N82B 2E5GA 2CJ9A 2LU2A 3QRQA 3FJ2A 4KSEB 1M5SA 4JV5J 2BE2B 2DISA 1FKPB 3MEDA 1RA6A 5HROA 3MM7A 1YG0A 2IAJA 3OXLA 1O8BA 3AT1B 1KBRA 1CLFA 2UXDF 3GIJA 2RHQB 2H5EA 3DGPA 3C14B 3K5LA 2RRBA 1B7YB 3MEGB 5D78A 7AT1B 3UN2A 5AT1B 4LF8J 3BDPA 2F4VF 2WOMA 1S1WA 4A8QA 3KNAA 5A2QU 2B0GA 5M2RA 2WW8A 1OWXA 1X0PA 1FHTA 1VBXA 1Q8KA 1RBLA 1D1UA 4DV6F 3M8SA 2R4FA 3AOBA 1U0HA 3JB9k 2PMHA 3QAUA 3KYLA 3WHIA 3HT3A 2HHHJ 3U02A 4QU7A 1YJRA 1M1GA 3W2VB 3OVSA 2RUSA 4OHYA 2A3JA 1ZPWX 2D9OA 1KN6A 2R42A 5DLGA 1FNOA 2PC6A 2QLXA 4AXIA 4EI2A 1IJEB 3C3LA 4LIWA 2DJWA 2DXDA 1QAYA 4ZVPB 3DN9A 5A8RB 2YH0A 2DBBA 4ECUA 4M1KA 2XZTB 4K5RA 4RL1A 1XNQF 2AYEA 2RDIA 5HMYA 1MN9A 4DPYA 3NGDA 2I1RA 3EWGA 4KIAA 1NB2A 2K06A 2J7KA 4ZS6A 3D0GE 2XWYA 1CJUB 4IFYB 4O3OA 5B08A 2IPOB 1YRTA 2JDJA 3NS6A 3DLGA 5KFRA 4PG8A 4FF4A 4DF8A 2KN4A 3RYLA 4WF9Q 2HQFA 4QWDA 1NK4A 3TI0A 5H9FK 4LBIA 1H98A 2VBXA 5FD1A 1J5EJ 3EGVA 1JJCB 1W26A 2X7IA 4J5OA 2WTFA 1R0BG 1N5VA 3AQPA 2KH9A 4OZ1A 1QD1A 3O2IA 2R8HA 1JLCA 2K3IA 2YKAA 4WK1A 3BYRA 3UDLA 3GG0A 3MEEA 4A48A 1Q7LB 2PI4A 3GJQB 3PDNA 5L46A 4DPXA 4CLKA 2XSJB 3NS5A 5HVFA 1EQMA 4CLLA 1MLAA 1LK5A 1KR4A 2AZ3A 1I5OB 2WCXA 5A8WA 1OS5A 4ZVSB 3Q86A 2QV6A 1IKWA 1WWHA 4BWMA 3JYTB 5F9NA 2W2QP 3MPYA 3DOKB 4DR5J 3NY0A 2DNYA 2FHMA 4QZVB 4ECRA 3LGNA 1Z2LA 2DR7A 4WTOB 2FZCB 4CM2A 2B9WA 4NLWA 3GZ7A 5J1EA 2J7WA 2IIHA 4TY9A 4LFCF 4J9KA 1NPPA 1YBUA 1R6VA 2IJFA 5G0RA 3V2UC 5F8MA 4URSA 4UZBA 2PFDA 4KE5A 3QZ8A 4DX7A 2XS2A 2UXDJ 5B0GA 1U1QA 2XI3A 3PX0A 4G1IA 3Q24A 1SC1B 3IM8A 4CO1A 1QVGR 2QG9B 1VRQC 2BQRA 2XTJP 2F4VJ 2BMBA 4CT8A 4WFAQ 3OR2A 3RRKA 3G2XA 4F3MA 3BKTA 4DV4F 2QGFB 2P9EA 3WQPA 3DI6A 4DV6J 2EFGA 1PAUB 5K14B 5U47A 1NO8A 3C6UA 3BO2A 1Y4ZB 2NQPA 2ZH4A 2QEXS 4I68A 1H38A 2BW2A 3GIIA 1A6LA 4HDHA 4E98A 1YRUA 1NJWA 1UWBA 3KDNA 4NWBA 4Z2XA 4BDPA 4FF3A 3PV8A 5E3PA 4DN9A 5KG5A 4KY3A 4K4SA 5B0EA 2OPQA 1KOOA 1WNEA 4R25A 1RE1B 1C1CA 1UVJA 3PW7A 4WXOA 1OPZA 1RTIB 2X3GA 2PFFB 2H4YB 5AE1A 3LAKA 1RWOB 3CC7S 1G6BA 4LSNB 2LQ5A 2FZKB 2ZJQQ 2HIQA 1XNQJ 5DJBA 2ZJRQ 4DCOB 3SDEA 3LWLA 2P5VA 1X4BA 3KHHA 4UY85 3G87A 3AB2B 3TEHB 4V19J 1HWUA 3I31A 3MM9A 3UI3A 1TKTA 4U9RA 2IM0A 3X3UA 3BSOA 4HVZA 4JB8B 3V81A 3GQCA 4K4ZA 1OSDA 2G2ZA 4OV6A 1WOPA 1MWYA 3L9ZA 1W25A 5EWFA 2QRRA 1R43A 1RU1A 1QAXA 1DQAA 1UTAA 3JTOA 1YIJS 2HFUA 1BWEA 3GE9A 3L95X 4X84A 5C25B 6FDRA 1FRXA 1LK7A 3QWPA 1TUWA 3ZZZA 2KFYA 1GTEA 4ED8A 1UEKA 2ZOGA 2VKRA 1FXDA 1KVKA 1FWLA 4LREA 4DV0F 4DPUA 5GMDA 3TQEA 1R27B 2KT3A 1X4FA 4MJKA 1HWJA 3VQSA 2DGQA 3ZZTA 2XYHB 3MAQA 2FVQA 1UMJA 1IKVB 2NUHA 4WP8A 2WVFA 3D28A 2GC8A 3R3TA 4ZCIA 5HSPA 2MKSA 3SEOA 5DQGA 2Z2LA 2OTJS 1WSVA 3WIUA 4IH7A 4MH8A 4DSEA 4FP9A 1MROA 4LFBF 3CT9A 3OR1A 4OL8A 4CLFA 3BQ2A 2F4FA 3I0SA 2CQIA 2HMIA 2ASJA 3D7SB 4WK3A 3W5YA 4HTIA 4DL2A 2KT2A 4MYTA 2BYCA 1H73A 2V8PA 4ILRA 5DG7A 2ASLA 4C0HA 4LFCJ 1DJ0A 2WRMA 3UD4P 2VPYB 4FXWA 2EFOA 3IN5A 2JWNA 2EFVA 4ED4A 5C42B 1WHXA 2KRBA 4DQQA 3PIPQ 5F3ZA 2G9OA 2JEGA 3NLCA 4K8RA 3HVRA 1D0EA 2D3ZA 3MMBA 4YDDB 2CQ1A 4WFNQ 2VV5A 3WDOA 3BDEA 1RWPB 5LM7E 4B17A 3OL7A 1WC0A 2XNRA 2RS8A 3MAAB 3KLIA 4RW6A 3DC2A 2OEKA 2QIFA 4F7VA 1KLMA 3C15B 2GHPA 1IM6A 4DV4J 2U2FA 3CCRS 4IYQA 1PCAA 5L9NA 2WVDA 3FVYA 3CD5A 4E0DA 2IBKA 4DSJA 2H5JB 2JLEA 5E33A 1NJIT 4C9DA 3DHXA 1FWPA 5KFHA 2DK2A 4B9SA 3GV5B 4EK2A 4NYPA 4EBEA 1NK5A 2B7BB 4OHWA 2UVRA 1DQ9A 5KT2A 4J91A 2MY8A 2KXFA 1HNIA 1S1TA 1APSA 4G1PA 3QFHA 5F8GA 1DARA 1NSAA 2B4VA 3IS9B 2CQCA 3MUTP 3TA0A 3W8PA 2W7OA 2CQ0A 3GYNA 1JLFA 3IM9A 3MPDA 4O3NA 2BJ9A 3BM7A 1S4EA 2HS4A 1FJGF 3KHRA 2OIHA 2J6SA 1HQEB 1RAOA 1UZDA 3MPUB 4QIWD 2AJ0A 3ISZA 4ZVRB 3UE2A 4I67A 1QM9A 1UAWA 2QA1A 2H51B 3G82A 1S0NA 1LKZA 1W2IA 1X31C 4C0BA 4CNYA 4ENOA 4F4KA 2XMJA 5IM0B 5I3PA 1IBMF 1KQSR 2MHEA 3HCXA 2QT7A 3CE8A 2IMWP 1HW9A 1NJYA 2GJFA 1ZM2A 4DPOA 4XPEA 1PIEA 4C8KA 1RUSA 2MJUA 3LW5C 3NGKA 3O6QA 2AD9A 4ANCA 4JI7F 5HLFB 3TW0A 4DV0J 2VODA 4W4MA 2FC8A 4CNZA 2RU9A 1Y9OA 4ZCKA 1SJ1A 1BQNA 3B78A 4KTQA 4C11B 5KFEA 4LSLA 3CCUS 1CULB 3Q0AA 1VHIA 1K0VA 2IRYA 3M30B 4GKKF 4OI6A 1Z4UA 1U02A 2M2BA 4OJ1A 1BXNA 1FK9B 4L72B 5HVHA 2H5IB 3IRXB 4RW4B 2CJAA 5A2QY 1SKWA 3J7ZT 3FCWA 2D7SA 4IO1A 1WKLA 5DETA 1MWQA 4ZLPA 2DNOA 1EAYC 1U47A 1EX8A 1Q8BA 3DLEB 2XCPA 2CDRB 2GMJA 2RB7A 2HVHA 2NSCA 3Q2SC 4NLPA 4NASA 1XMOF 3TX8A 1DTTA 3TZZA 1YJUA 2YWHA 1U48A 3L7UA 1U8WA 2IBOA 4M5HA 4DI6A 4OIXA 3FBBA 3CB4A 5KG6A 2ZBPA 3W65A 3OV7A 2C2OB 3FRYA 5F8IA 1SXLA 2PEBA 4OJ3A 4LF2A 1S1XB 4CO5A 1VQYA 2HQDA 4CLYA 4CTAB 3GWCA 4CWBA 3IXQA 1DFDA 1C0UB 1WTFA 2HNYA 2CVIA 4MFBA 4URQU 5T7LB 3Q8QB 3KLHB 4G3IA 2QLWA 2MTLA 2AX1A 1B0PA 4ECSA 4ECWA 2DEIA 3I0RB 3S7RA 2OLWA 2QLBB 2VFRA 2CYYA 3IAS9 4NLTA 3HFKA 1E6YA 4RKUC 5HJXA 3SCLE 2FDNA 4YHHF 1S1UB 2IM3A 4FKYA 3KHGA 2XGPA 2CQDA 2HRYA 2G0JA 3LP2B 1TVRB 1PG5B 3D67A 3HMJG 4WWSA 1FJGJ 1PJ6A 4QU6A 3CIMA 5HL7Q 3CJ5A 1TL3B 1C4AA 4LRDA 2JNJA 1KHWA 2ZH7A 4CP5A 4U67Q 4J9PA 3KMQA 4FXVA 2J9DE 1GEHA 1IBMJ 3M2VB 3VAJA 3VGVA 2Z2YB 4PG5A 2E29A 4IO9Q 1U0SA 2BE7D 1IVZA 2AMCB 5IS2A 2Y0BB 2DB1A 2DPIA 3CDUA 1OSCA 3DXBA 4DSIA 4CYUA 4JI7J 2FIUA 3E01B 1XBWA 2E5HA 3LUYA 3CPWR 4QIGA 2CJQA 3M8PA 4Z37A 5BYRA 4N76A 4UUWA 4HHJA 2FVRA 3DM2B 3PO5A 4GKKJ 5I3UB 1UJ4A 2YXLA 4LF1A 4DUTA 4BHQA 2J8SA 1TK0A 2BM1A 2LDYA 5LXYA 4M5JA 2LQJA 1RTDB 3EVOA 5C24B 1RTJB 4X4TA 2RE1A 2HFSA 3CCMS 2FGCA 1FF2A 1FKOB 2M4MA 4H4OB 2CJKA 5EWGA 4ZITA 1CJTB 2XMTA 1D09B 4KH0B 1XMOJ 4LT6A 2C28A 5E3QA 2HYIB 1H2TZ 2HHVA 1S99A 1ZZNA 3NGTA 5EX0A 2IFXA 3CJ0A 4YN3B 3M1VB 2QO3A 1TK5A 1QAJA 1ZTTA 1WC1A 4B9MA 4ID5B 3HKZD 2XS5A 4O3PA 2RRAA 2Y1LB 4EZ9A 4X4VA 4UOHA 2X1GA 2EFNA 2LMIA 1K1SA 2W4DA 2XZDB 2OEJA 4B9TA 4B9NA 2LEBA 3M8QA 2EK6A 3J81j 5HP1A 1VGYA 4JBCA 1VFJA 4MK9A 5L9XA 3T1HF 1EETB 3THTA 2BKOA 1U49A 4FS2A 1S72S 1GNKA 1IBLF 2KI2A 1HMVA 2QLFB 2DGWA 3NGUA 3ZNJ1 4BCAA 4DV7F 4F4XA 3N79A 1YRXA 2MPUA 2Y8YA 2ZD1A 2OH2A 2W2MP 3TWZA 4YB5A 1PYOB 2CPFA 3PKMA 3MCSA 3ZTSA 3O1LA 5AXKA 2U1AA 4AL5A 4FKXA 3ZZUA 3NP5A 3NNHA 2ZE2B 2W9CB 1VQ5S 1KSPA 2HURA 4YHHJ 1F6TA 1TP7A 5IV3A 3AA8A 3LH2S 4CM0A 2BEFA 4NXMF 3DOLB 4LBHA 2W9BA 3TR5A 3ISNC 2UVVA 1XN9A 4QW9A 1KLNA 1HHQA 2XI2A 2VPXB 3ZTPA 4R8UB 2V2KA 2DEJA 3VAHA 2RAQA 2MQOA 3MM6B 2QN6B 5IOLA 4RLEA 3CO0P 1Z2ZA 3HZGA 1PAEX 3PRDA 2CQHA 3KTQA 5F8LA 1MU2B 3NKYA 5L8RC 1HBNB 3FNNA 3ETMA 1S10A 2NPFA 2HHPA 3R5JB 2FHJA 4PRFA 1KNZA 4WPAA 2MQQA 2PIIA 4B08A 2J6TA 2Z8QA 3ISND 3CJTA 1HQ2A 2I5JA 2C3YA 4KFBB 2JZ5A 3QGIA 4DUZF 1LWCB 1W7WA 1T9WA 1SH2A 4P9SA 4IDKA 4P72A 4AT1B 2MSTA 1VRTA 1KRPA 2HHQA 2O66A 2WVEA 2YQ0A 2ACYA 2Q3PA 2OPPB 3CC2S 4DV5F 4AQYF 1UA1A 2NSBA 3BREA 3NBPA 4Q7AA 1TK8A 1B0VA 2F8HA 4P6QA 2L9NA 2LYVA 1RABB 4IG0B 2BOPA 4B9LA 4CLPA 4LR7A 1F60B 1GX5A 2VG5B 3PRBA 2HNDB 2J6UA 1NSKL 4KGZB 1TL1B 2J0QD 2DHGA 1N6QA 4ECZA 4DL3A 2VASA 2KYXA 5AJ3F 3RRGA 1UFLA 2MZJA 3RBEA 4U7UK 2E1PA 3SQOP 4ANDA 1RT1A 4WCEQ 2ZITA 1TV6B 2M5YA 1S6QB 3KG0A 4Y0FA 4FDFA 2GGPB 4HI2A 3TVZA 4V1Ak 3T1HJ 4TNOA 4NMLA 1S12A 1IBLJ 4A8XA 5LT5A 1FDBA 2GIQA 5D0GA 4YR2A 1YWXA 4DV7J 5IT9U 3OXFA 2AP6A 2BJ7A 3QGGA 4F4ZA 3I96A 4OJGA 1GFWB 2ABYA 4HTJA 1M5PC 4ZPTR 3V4IA 3T5JA 2RF2A 5D77A 2YKNA 4KH1B 2RU3A 1JLAB 4RBTA 4EGLA 5HANA 2KYZA 3US5A 2R8IA 2YNIA 1N5SA 1F5BA 1FD2A 1UVLA 2C2NA 2V2QA 2JEIA 1NKBA 4ED6A 1ACMB 2ADCA 3J7A1 2BJEA 3OW2R 4USKA 4GKJF 3UW1A 5A0YB 2VC1A 1RT4B 4NXMJ 3BN4A 1E6VA 1SQGA 3M2RA 3Q2TC 3JTNA 3SBMA 1G2EA 3D0HE 2FHOB 1YZ7A 4ZPBA 1I6JA 2OPSA 3LOUA 2HLUA 3DDIA 3HHKA 1FCAA 3E51A 2CWXA 3T19A 3BBFA 2XEXA 4FBTA 2JFKA 3OSNA 2CQGA 3G4SS 2DNNA 3K5PA 5ETOA 4K5SA 4CLTA 4JOUA 5IQ6A 2AT1B 4DZDA 3CVKA 1R8CA 4NLVA 3DNCA 2V2VA 5A6WA 1UFKA 4ZLJA 1N32F 1UCNA 4TU9A 4ED1A 2YWWA 4TY8B 5GMEA 5KOWA 5I4MA 5J2QB 2DY1A 4DUZJ 1VIXA 2DH8A 1RADB 1C1BB 2WSEC 4OHVA 2ZKTA 2JEJA 2J9DA 4FPRA 1NPRA 1N5YB 1S6PB 1VOMA 5F8HA 4ELVA 3IP0A 1LW2B 4ICLA 4F4YA 1SIWB 3JQJA 3MM5B 4DV5J 3MMCA 4M5GA 4AQYJ 4O4RA 2I2YA 5BR8F 4J7CA 3EXYA 4H4MB 2Y1JA 1R3NA 3LP1B 4QYZJ 3VWSA 2V8HA 2F3JA 1NZAA 1S9EB 1HD0A 1HI8A 1XR7A 2FJVA 4I2QB 5HJYA 2MLXA 2J76E 3JS9A 5BYSA 4ZPWR 4TN2A 4TVAB 5C2CA 3G9CA 3GG1A 2OD6A 5AJ3J 1AFIA 3PEHA 1MNEA 2CG8A 3MTKA 5A8KA 1T9XA 4R5PB 2AF6A 1NSQA 4YP3A 3DCAA 3TARA 2MHNA 4PQAA 3MCNA 1KQFB 2LA4A 4KV8A 1SPBP 3BF4A 4U6PA 2ZBCA 2WVBA 4K7QA 1FWKA 4PWDB 1XC9A 1SV5B 4O44B 3DYAA 4TQSA 4O4GB 2XY5A 2A2CA 2W01A 3RTVA 5KFYA 3RR8A 2GIRA 5KFMA 3W1YC 1HBMB 3ZTQA 4FS1A 3A12A 5CYMB 1JLBB 2GO9A 1LNQA 2D69A 5H9EK 2HZAA 3KK1B 3TAQA 2ZBIA 3HHLB 5KFZA 2VA3A 3D4JA 4M5DB 2FLNA 2B6AA 1YBAA 2DCLA 4A8SA 3OBIA 1PSDA 4KO0B 3CCSS 4ILLA 4C3MA 3VGSA 3NAHA 1XIQA 4IG3B 1JK9B 1WEZA 4GKJJ 3L09A 3AOCA 2J0WA 1N0UA 5B0DA 2D41A 2GX8A 5AE2A 5DS7A 2FC9A 4EBDA 5JVHQ 3FMBA 3QBCA 1RA7A 3Q8RB 5F8JA 2FJAB 2KVIA 1FDAA 2KM8C 4L3NA 2GFFA 3G6VA 4RUHA 2MKYA 1MN7A 2D9PA 1F0XA 4OI0A 1VC6A 3ITHB 2XHCA 2UV8G 5KFPA 1FI4A 2OO4A 2V4JB 3OQ2A 1M5VC 1UVKA 2CIMA 5A6PA 2VPWB 5HATA 3MZIA 4JI5F 2G13A 3KLVA 3WX8A 1VQKS 2JEFA 4JI4F 3R8YA 2R3VA 2YNHA 1BD6A 1N32J 4O0NA 1WOOA 1TKXA 1SKRA 1JLGB 3KJQB 2GMLA 4OHZA 4B9VA 3D3CJ 2PT0A 1P6TA 6AT1B 1N54B 4ED5A 2BE2A 4RPFA 3BKUA 2E5JA 1N4LA 3J7Z5 5HQLA 2CPEA 1BY9A 3PRVA 2K3KA 1NH8A 1RT5B 4PYAA 1JKHA 1EB0A 3MECB 1T3OA 3C14A 1VQ9S 4C98A 1D9AA 7FD1A 2OFGX 3MEGA 5BR8J 5AXMA 2W7AA 2BBEA 1U8SA 5DM7Q 2MKKA 3QT5A 3GCXP 2P2CB 4GVBA 3IWXA 4ZJLA 3JTPA 2YKOA 5K8NA 2XO7A 1U1PA 2DO4A 1VQNS 1YX2A 2J0XA 2A0FB 4Y65A 1URNA 5IV4A 2DHAA 4IQMA 4UQGA 3W2VA 3BQ0A 2I38A 2GZOA 4DU7A 4QIFA 2BACA 3VAMA 1YTYA 2WSFC 4M5KA 3NCRA 2CNLB 1B0TA 2CJXB 2X1AA 1EKRA 1FDNA 4KQZA 3R5DA 2QA4S 3UNYA 3BGLA 5A8RA 1BC6A 2QE5A 1K9MT 3OD2A 4ZPVR 1RWVB 5HBMB 2XZWA 1L3SA 2KVQE 2MJNA 2VU5A 5DDOC 3N0VA 3K59A 2FGOA 3IBWA 1YJNS 2W24A 4F67A 5DZ7A 2E7WA 3OL9A 2AYMA 1X4EA 2GA7A 2GVZB 5KFOA 1T9UA 2CPJA 4DFMA 2XQCA 2DGSA 3W2WA 1UJ5A 4OYWA 3NOCA 3D1QA 1QE1B 2RQKA 1AUDA 3HVTA 2WOMB 2KB2A 4FF1A 1S48A 5H1SV 4K2XA 2RIJA 8ATCB 4ATNA 2ZHAA 4OQJA 1RHMB 3MURP 2XYPB 3Q8PB 1WC3A 2AEJA 1YZ6A 1G3OA 4L75A 3R2DJ 1CJKA 4P2XA 1IBCB 1U0HB 3NNCA 1H6KX 1U24A 4XK8C 1R6YA 5CABA 1RCOB 5D4NA 4DN0A 3PG9A 5GAHU 2WB4A 2XSJA 2KG0A 3OFHA 3F41A 3V6HA 4G1QA 5L1LA 2POKA 3HKWA 1DAXA 2HAIA 4JI5J 1GMWD 2HQ3A 2HBYB 4F02A 4JI4J 3VAGA 2BZ2A 1U09A 3ZFVA 2FJWA 5AXLA 2HRUA 4F0MA 4USJC 3VAIA 5E3RA 2NZ4A 4AD6A 3G6YA 3BGUA 4PWUA 1RI7A 3FBEA 2CKWA 2X1BA 3CCWA 1VJWA 2E1MC 4DL7A 3H59A 2V4RA 2ZM6F 4C8NA 1FRLA 1F5AA 3KK3A 3HFZB 3GP9A 2E7VA 4I7FB 5J2NA 2R7XA 1OYDA 4DR7F 4L73A 2B43A 4KHRA 2HKEA 2C2ZB 1OY6A 3PYGA 3IBCB 1R8AA 3IR6B 2IVMA 4CO4A 4RNOA 2WBRA 3D1HA 4DL5A 3ZXWA 5DO2A 5IT9Y 3M9MB 3OUYA 2JFDA 3ZNUA 4JUZA 1Y0HA 5G4DA 4RUBA 4DHVA 2YX4A 3MEEB 2Q6BA 3HFVA 2KO1A 1HYSA 1SI9A 1CQNA 3C66A 4QJVA 3R5AA 4DZ6A 4RJVA 1ZM4A 3MFHA 3G6XA 3L7OA 1HQUB 2B9XA 3QGHA 3M2UB 1RTIA 1VQPS 5HQ8A 2RMLA 1XJWB 3FKBA 2DGUA 3M8WA 4WFZA 4LQ9A 2QMXA 1FEHA 4LSNA 2XO6A 4MIAA 3KJVA 1NU4A 4ZA1A 2E9RX 5KG3A 1K44A 4Q0BB 5J2PA 4USVA 2ILYA 1QTMA 4ID8A 4CLWA 5G0RB 1GQEA 2X1FA 4B3SF 1TL4A 3M8ZA 3BGRB 3OTCA 1SKUB 3PY8A 3AY0A 2QFJA 4LVNP 3QWUA 1B7FA 2CVEA 3SSSA 2A6OA 4ZP9A 5KFTA 3K8WA 4J90A 2OP5A 3OR2B 2FPHX 1H2UX 2C2RA 4CCHA 1ZM9A 5IQQA 1RTHB 4B3TF 4OYAA 3C6UB 3P96A 3R97A 3I5BA 5HI7A 4ILMA 1S4FA 3W8GA 3EGZA 2VH7A 2V4QA 1RWWB 5D3GA 2RT3A 3KDOA 5KAKA 1IKVA 3UVJB 2HNZB 1C1CB 2DR5A 3QNWB 2P9GA 4OZNA 4ANEA 1RP5A 4GVLA 2EK1A 3RB0A 2EG2A 2MZRA 4U8VA 3DRPA 4WJBA 2HQIA 1M5KC 1WDTA 4Q8FA 3J81Y 2DD8S 2GCFA 2OELA 1NJZA 4LIRA 2CXEA 2GW8A 3TA1A 1DTQB 1FESA 4UOGA 1NM2A 5KTQA 1FJCA 1Y5IB 1ZA2B 3RU0A 5AXNA 3LWMA 3HULA 3MM9B 2UUAF 1TKTB 3TO8A 4X4NA 2LXUA 1EHWA 3A8EA 5C42A 2ZM6J 3GYGA 2AV5A 2YVSA 1IR1A 3OL8A 4N5SA 1FEEA 4F36A 2DH9A 1TUGB 1LV5A 1J5OB 4RNHA 3SCJE 2BRKA 4FYVB 5D4PA 1UJ6A 1V9OA 2BJ1A 3MAAA 5J1NA 4DR7J 3S01A 2LXFA 1KVIA 4C3KA 3TAPA 2YWKA 5D8HB 1NK9A 3C15A 1DQ8A 3T3FA 2CPXA 2AJ4A 1U1OA 1I51B 2XBPA 1SJQA 4G65A 4DV2F 3U7JA 1N0VC 4CI0B 5D6GA 3R1HA 1U6ZA 2MB0B 4OI3A 1MMNA 3JSMB 1NLKL 1HNVB 2N7CA 5BJRA 5KFDA 3UCUP 2P8IA 3KFWX 2DHSA 3BV8A 3R6LB 2IMOA 1HW8A 3H25A 3B82A 3EYZA 4LF6F 3QIDA 2CG4A 3RJMB 3H7HB 4GC6A 2VG6A 2A2DA 3IS9A 5RUBA 3K89A 3CULA 2HVDA 3U1NA 2WONB 3Q8VA 4X62F 1JIHA 1RYSA 3VAKA 1RWMB 2C3OA 2R2SA 1UP1A 2L08A 2HS3A 3VHQA 5E41A 1HQEA 3AAWB 4B3SJ 3D6MB 1SUQB 3UWTA 1SJRA 4AE5A 3AD7C 5KG7A 3MMBB 3VCDA 3MM8B 1BMQB 3CCTA 5IM0A 3CJ8A 5F0UA 3KLIB 1IR0A 2PMZD 1RTZA 5ETSA 4ZP6A 2FLLA 3GJTB 5K8MA 3PO4A 5K9FA 2F65A 3AXMA 3I4HX 1S0MA 4B3TJ 3KG4A 4DDFA 2C2KB 1P9YA 2OHDA 3GR0A 3N4WA 3MXHP 5HLFA 1F9HA 2HWHA 4P71A 1BQMB 4X4OA 3EUNA 4UF4A 1T02A 1CULA 4XIUA 4X65F 2MEWA 3BKFA 2C3MA 3A8IA 4I4BA 1HNIB 1FK9A 1XWLA 3RR7A 4RW4A 4YY3F 3MOZA 2BQUA 3ENVA 4OZJA 5HK4A 1CSJA 1HBUB 3NGSA 2YKMA 2KTQA 2WZ1A 3OTEA 1JLFB 3DU6A 2ADBA 1L3TA 2HBZB 3NXZA 2LLZA 3DLEA 1AZSB 2LDIA 4YQWA 1S79A 4Q44A 2UUAJ 1NH7A 3VZIA 3L3CA 4K4TA 2NUUG 2RQCA 4QR1A 2CZVC 4PZVA 2ZBRA 3NCQA 2NYHA 4OYOA 2GHWA 2LEAA 1YK9A 3CUNA 1V3SA 4K4XA 4FNIA 4U96A 3QO9B 2YY3A 3BYPA 3FFIB 1S1XA 4WBFA 2C2DA 4WFXA 3TAMA 3EZOA 3PIOQ 3WC2A 1CG2A 1XK8A 3EVMA 1DURA 4S0MA 3W7BA 4CTAA 4DV2J 4U7UD 4LF5F 5KFWA 4NEZA 2GV1A 4UZCA 2DNQA 2VQEF 1H7WA 4C8MA 2CQPA 1C0UA 3MR6A 4ES1A 1WF0A 4NA2A 3CJKB 5T7LA 3KUGA 1URRA 4PKDB 4Y00A 1AW0A 4DPWA 1YJWS 3WC0A 2LQ9A 3G8QA 3W9IA 3KLHA 1T9TA 4I2PB 3WBZA 3N6MA 2XULA 4ELUA 2XMAA 2IC3B 4USIA 3G96A 5KG4A 3I0RA 4LF6J 5KT4A 1VI7A 3OSPA 1X5TA 4HACA 1FRJA 2N4CA 2KHDA 5CD4H 2QL7B 1Z1ZA 3ZZRA 2BVZA 5H9FJ 1S1UA 2DNGA 2RILA 1C0TA 3HHEA 2B3TB 5J2MA 4KGXB 1M0SA 4X62J 1KD1T 2APOA 4RW8B 1K73T 1TVRA 1JMTA 3DFEA 3OTDA 4A8MP 2DGTA 2YPZA 2HWTA 3M32B 3AXKA 2Z58B 3ENQA 2XMUA 3GILA 4ECTA 3D66A 3GFYA 1VRUB 4QR0A 4JV1A 4EZ6A 4A8OA 1VQOS 3WZ0A 2XGQA 1F3VA 1PBUA 2A6MA 4Q2LA 2MZTA 3B54A 1SVDA 2Z4PA 4NLRA 5CYJA 4Q43A 3TEGA 2W2PP 2QMUB 1CC8A 3D5MA 4OYBA 2XY7A 4F3OA 4NEYA 4JI8F 3KG1A 2HVZA 4OI2A 4YEAA 4TU8A 3OVBA 4V19X 1RT6B 4DX8H 1XQIA 3BGOP 1TAUA 1F9EB 4KHPF 5CZXA 4NA1A 1P27B 2DTJA 2L48A 4X65J 4TLRA 3DM2A 1S9GB 5I3UA 4QCLA 4NLGA 4TKTA 2NCKL 5GADU 2VOPA 3FEXB 4Z7YA 3FSXA 4YY3J 4LF9F 4EO8A 1B70B 4XPCA 2B4PA 4RW9B 3GCWP 1RTJA 3CEDA 2O67A 3VALA 1P1LA 1TTHB 1X60A 1CC7A 1PGZA 3TUJC 3HXMA 3OHBA 1FKOA 1YKWA 4A8YA 1SQEA 4OLPA 3EGNA 1RT3A 3EDRB 1AT1B 1VQSA 2VIHA 1QY7A 3MMAB 4OMFG 3QATA 1U1MA 3F44A 3H5XA 1HFEL 3PJ9A 2D74B 1NDLA 4UTGA 2DT9A 4ZVEA 4W90B 3HK2A 4NI2B 3RW7A 3M1VA 5ITHA 3M6UA 4ID5A 5LSLA 4O0IA 4O23A 3ZO7A 4C7QA 3PX6A 4CT9A 2CZ4A 2V8DA 5F0WA 4RWWA 2CPHA 1QUVA 2DCUB 2SXLA 4HYKA 4GO5X 3RW6A 2VJVA 3Q83A 2MZSA 4B3OA 4ZJQA 1KQKA 2K2PA 3FDSA 1EETA 4LF5J 1HNZF 2BDPA 1MSWD 1REVB 2VQEJ 3NAIA 1VBKA 2RDJA 3PR4A 3ICLA 4J9LA 2M7SA 1NJXA 3CO9A 4IOBA 1WF2A 4NCGB 3N5FA 3K2YA 2QSFA 4WKRA 2M70A 4RNFA 2WVCA 2XCAA 3QIPA 2CFXA 2LP4A 2Q79A 1BHNA 3QT6A
chains in the Genus database with same CATH topology
5GAEU 1RT1A 4NZ0A 4DBQA 4WCEQ 3HM9A 1L3KA 4AXJA 3V6JA 4LF8F 1WACA 2ZITA 2OPRB 2GO8A 4UW2A 1C2PA 1TV6B 3TAMB 1MMDA 4CQ1A 2ZE2A 2M5YA 2W9CA 4KO0A 1S6QB 3FEYB 3KG0A 4Y0FA 1RISA 4DR2F 4GMKA 3CCLS 1ZAVA 2JRSA 5T41A 2W9AA 1X9WA 2GGPB 4HI2A 4KT0C 4BWJA 3TVZA 3GMGA 3LF0A 4TNOA 3I9ZA 4JV0A 3S6EA 4NMLA 6FD1A 2JLFA 2ZOFA 2RNEA 3DOLA 1KFDA 4YOEA 4A8XA 5LT5A 4KJIA 2DRBA 1FDBA 2GIQA 4TYBA 2FTRA 4WU2A 1ZYQA 5CCMA 3RB4A 3P3DA 1RT6A 4DR6F 4QR2A 4YR2A 5EX3A 3FZBA 1YWXA 3BZQA 4C8OA 4NL5A 3MEDB 3OXFA 2AP6A 3MDFA 1Q53A 3QGGA 5HROB 4F4ZA 1GXUA 3I96A 4OJGA 3LP0B 2HHHF 2ABYA 2OAUA 3MM7B 4HTJA 1Q7YT 4R8UA 2IAJB 1W2BR 1M5PC 1JXEA 3LANA 4ZPTR 3V4IA 5F3TA 1HPZB 3UQSA 1S9GA 3T5JA 3CD0A 4IFYA 2AWZA 2NS1B 4OFZA 4H54A 2RF2A 2MZQA 3LPYA 4JYAF 5D77A 3RBDA 2YKNA 2FVSA 3MUVP 2RU3A 4B3MF 5CH7B 1WEYA 1JLAB 2RQ4A 4RBTA 4EGLA 2KYZA 5A8KB 2DHXA 4RBUA 2ZH6A 3US5A 4X4QA 2R8IA 2YNIA 2IJNA 1VBZA 2HFZA 2NXUA 5GVQA 3Q8SB 1GTHA 1N5SA 1TZ0A 1F5BA 2OSQA 5GAGU 5L1IA 1KONA 4KBIA 1RGVA 1VHFA 4RW9A 3G8TA 1FD2A 2QMWA 4QBUA 1IQZA 1Y7PA 3M8QB 1UVLA 4IRDA 1S1WB 2JJ4D 4NCAA 1QSSA 4KPYA 5CZVA 2JEIA 4DR3F 1H3DA 5HP1B 1NKBA 1C0TB 4ED6A 2ADCA 3J7A1 3C6TA 4KV8B 5J2MB 2BJEA 4K4YA 1Y3KA 2LA6A 3OW2R 3NMAA 3G71S 4PPZA 1YHQS 4GKJF 2AGPA 2XG8A 2R7OA 3QYYA 3UW1A 2VC1A 1RT4B 5A0YB 4RZRA 1OIAA 3FQLA 2ZH3A 3BN4A 4PXEA 3K8VA 1E6VA 1R7IA 2DR8A 3M2RA 2NYIA 2RKIA 3Q2TC 2COLA 3JTNA 4O3SA 2E7XA 3DYAB 1LWCA 1G2EA 3D0HE 2FHOB 3MMAA 4RUCA 3T1YF 3TA2A 3OJSA 3M8RA 4ZPBA 1UFWA 3K57A 3RRHA 1NEEA 1RT7A 2ASYA 4P2SA 5I42A 3HF5A 3I4PA 5DDQC 1WG4A 1IKYA 2OPSA 3LOUA 1I6JA 4ZP7A 2HLUA 4NLSA 5KFVA 2EI5A 2EWHA 3CWJA 2F1FA 4DFJA 3TUIC 2ZJPQ 2AU0A 4K4VA 2ZFHA 3SQGB 3HHKA 4Q45A 1FCAA 2MSSA 3E51A 3T19A 1VC5A 2XEXA 4FBTA 1ZM3A 4YB7A 4C8LA 3BGFA 1TFWA 2XHWA 2JFKA 1FRIA 3OSNA 3FSIA 5E5NA 4K4WA 1WD6A 2CQGA 2G1DA 2ZNYA 4NOHA 3G4SS 2DNNA 3K5PA 3UCZP 4K5SA 4UY8T 1GAOA 4J9NA 4JOUA 4WU3A 2JSXA 4RX6A 5IQ6A 3MECA 3K0JA 3CDEA 3CVKA 4QWAA 2DNZA 5EHHA 1FRHA 2Z0GA 1R8CA 4NLVA 2LVWA 1YQHA 2GJ2A 1SC6A 2E9ZA 3DNCA 2HGNA 5A6WA 2B6AB 2MGZA 4EUVA 2M52A 4BC9A 4ZP8A 2EW9A 1HA1A 4IG0A 4I0WA 4R0JA 2R8JA 1MW7A 1BGXT 5K5MA 3P6YC 4B9UA 1N32F 3PXGa 2D1CA 3ONQA 2IRUA 1FDDA 1TAQA 4HT5A 5JUMA 4TU9A 3JYTA 4ED1A 1KC8T 3AA9A 5DGAA 3DOKA 2HNDA 4OZLA 4TY8B 5KOWA 1REVA 3LAMA 3ZZ0A 5I4MA 1J5EF 2IYGA 2FJDB 4RW7A 2IYIA 2OSRA 5DRKA 1F9FA 3IA0A 2I8EA 3S1TA 3B8HA 3G6ES 5J2QB 3UFCX 2MQLA 3DDKA 2ZUGA 3MR3A 3J80Y 1TL1A 1VIXA 2DH8A 3QJLA 4NLQA 2WSEC 1C1BB 4OHVA 5HN0A 3N5BA 2XLIA 2ZKTA 4DV1F 4F25A 1JWWA 3FCHA 4F2SA 2JEJA 4DS4A 1TQLA 2J9DA 4FPRA 2DO0A 2KT5A 5KFNA 2HFOA 4RUAA 1R0AB 1N5YB 1S6PB 1VOMA 1T05B 3PJWA 4C2MA 1RK8A 5F8HA 1ZH5A 4ELVA 3CCJS 4K0KF 4ETZA 2X51A 1LW2B 4NCGA 4DFKA 1JJ4A 4ICLA 4F4YA 4K4UA 1SIWB 4WZMA 3MTJA 3MM5B 5K8OA 3MMCA 1FVSA 1YVFA 1LQ9A 1WF1A 4TYAA 5CQGA 4TLQA 1HARA 5KFSA 2YH1A 5FDLB 5KG1A 1Q79A 3DLJA 4QQBA 1N33F 3V6DA 4O4RA 4UQTA 3BSCA 2I2YA 1ELOA 3DLGB 2N3LA 5BR8F 3HVWA 3EXYA 4MMOA 4H4MB 1ULRA 2Y1JA 1R3NA 2HPUA 2OPRA 2FJEB 5KG2A 1FERA 4RWXA 4DSLA 2L3MA 3LP1B 3KKFA 1S0OA 2RSQA 3VQTA 2YNHB 4QYZJ 3VWSA 2V8HA 2KXNB 2F3JA 1NZAA 4XDCA 1S9EB 4C4WA 1VLYA 2GGPA 4ES2A 1HD0A 4BS2A 1HI8A 1TKXB 1XR7A 2FJVA 3U1LA 3IR5B 2AJ1A 4DR5F 5LSOA 4K50A 1RT3B 5CXTA 1HNXF 3CSKA 4I2QB 4U7CA 4NLDA 1SB6A 1WI6A 2C42A 4ES3A 2N82B 2E5GA 5F8NA 2CJ9A 2J76E 2LU2A 5BYSA 4ZPWR 4TN2A 2W8LA 3FJ2A 2HHXA 4KSEB 1M5SA 5K14A 1Q8LA 2WBMA 4X4RA 2IHR1 2FY1A 2BE2B 2DISA 3V5RA 1FKPB 3MEDA 3G9CA 1FRKA 1JLCB 1VRTB 5L1JA 5KG0A 3MR2A 1ZETA 1RA6A 5HROA 1NKEA 1WHWA 3GG1A 4NRUA 5EGYA 3DRYA 2OD6A 4IH6A 4LF5F 3MM7A 4KAIA 1YG0A 2JC1A 2JX2A 2IAJA 3J7YI 3SZ2A 3QAEA 1FE4A 3OXLA 1AFIA 1O8BA 3PEHA 2XMWA 1HPZA 4ITSA 3M6WA 1MNEA 1B64A 1CLFA 3MD3A 2UXDF 3TANA 2Q6CA 5DM6Q 3GIJA 2HHTA 2QSWA 3MEKA 1FVQA 2BM0A 4OJHA 1JLAA 3MTKA 5A8KA 2H5EA 3E8OA 3DGPA 2NLWA 4OI1A 2XLJA 3K5LA 2RRBA 4N8NA 3MEGB 5D78A 4PXBA 1JLEB 1U26A 2J9EA 4R5PB 2AF6A 5A8WB 3BDPA 4YP3A 3DCAA 2F4VF 2WOMA 3TARA 1S1WA 2MHNA 4A8QA 3DHWC 3E3XA 1T03B 4PQAA 5GADI 1KQFB 2RD5C 4B3OB 3CMES 1IKWB 4PQUB 3U1MA 2BUNA 1SL2A 2LA4A 3KNAA 5EN1A 4KV8A 4LF4F 2B0GA 3BF4A 5M2RA 4U6PA 2ZBCA 4EYIB 3CC4S 2WW8A 5FJ4A 2B7CB 3T9ZA 1FTRA 2ERRA 4DQSA 1RT4A 1OWXA 4NLYA 1X0PA 2CDQA 4H4KA 4NZ6A 1FHTA 1VBXA 2UUWA 1XC9A 4PWDB 4ALZA 4PG6A 2K8GA 1SV5B 1D1UA 4O44B 4DV6F 3DYAA 3N01A 4G6VB 3PVXA 2F9DA 4TQSA 4O4GB 3M8SA 4ZDNA 2XY5A 2A2CA 2R4FA 2PEHA 1U6FA 3RTVA 5KFYA 1QJHA 3JB9k 3RR8A 4QW8A 2GIRA 4LQ3A 5KFMA 5J1EB 2PMHA 1G1XA 3QAUA 2PE8A 3M9OB 1HBMB 3T5HA 2ZOMA 2KG1A 3KYLA 2DNHA 3HT3A 4FF2A 4FS1A 2FB0A 5CYMB 4NZ7A 3U02A 4QU7A 1YJRA 1JLBB 4MTPA 3SQGA 3W2VB 3OVSA 1VQMS 2GO9A 4OHYA 2E44A 4N77A 5DLFA 4QPTA 2A3JA 1ZPWX 3T9NA 3IRWP 3KK1B 3QIPB 3TAQA 2ZBIA 4I6YA 4GC7A 4KR0B 1Y00A 3HHLB 2D9OA 2GHVC 5KFZA 1KN6A 2BV3A 2R2UA 2VA3A 3CXCR 5DLGA 1FNOA 4M5DB 2PC6A 1LFWA 2QLXA 2FLNA 4AXIA 1N5QA 4YR3A 3R5BA 2B6AA 4I56A 1YBAA 1IJEB 2DCLA 4A8SA 3C3LA 3OBIA 1PSDA 4KO0B 3CCSS 3E2EA 4LIWA 2RRNA 4DJBA 4ILLA 2DJWA 2ZH2A 4OV1A 4C3MA 1QAYA 3NAHA 1R8PA 2MKCA 2W7PA 3DN9A 5A8RB 2YH0A 2DBBA 1L3VA 4ECUA 4IG3B 1JK9B 2YKQA 4M1KA 1VQ8S 1WEZA 4TY8A 2KZMA 2DGVA 5C25A 2ZVSA 3L09A 3GV8B 1XTZA 1LWFB 4AL7A 1WI8A 2J0WA 1N0UA 4WTYA 4K5RA 1XNQF 2BRLA 3GSDA 2AYEA 2RDIA 5J2QA 5HMYA 3DI6B 5B0DA 2D41A 2GX8A 5AE2A 5MLCV 5DS7A 3MFIA 1WTBA 3NCPA 2FC9A 1C1BA 5KFJA 1KEKA 3NGDA 5JVHQ 4EBDA 3FMBA 2ZH9A 1ZTWA 2I1RA 3CCVS 2Y0SD 4KIAA 1RA7A 3HP6A 3EPIA 3Q8RB 1H0HB 1F2GA 2J7KA 4ZS6A 5F8JA 4F50A 2FJAB 1S6PA 1R0AA 1T05A 2KVIA 1N5YA 1FDAA 3D0GE 2KM8C 2XWYA 1IBKF 4Y28C 4L3NA 4WZQA 2GFFA 1LW2A 1UWBB 3G6VA 1TKZA 4RUHA 3BQ1A 1R8BA 2E1CA 2D9PA 1F0XA 4IFYB 4OI0A 5M2UA 1VC6A 1D8YA 1JNRB 1N8RT 4ZCLA 4O3OA 2OD4A 2OPQB 5B08A 3ITHB 4N8OA 3IG1A 2UV8G 1UVNA 3VAFA 4A8FA 5KFPA 3OHAA 2OO4A 1R31A 1YRTA 2DNLA 1LOUA 3NWGA 2JDJA 3NS6A 2V4JB 3GR1A 3OQ2A 1M5VC 1UVKA 3DLGA 2CIMA 5KFRA 4PG8A 5A6PA 2VPWB 4DF8A 2V5HG 1SH3A 3HLUA 4FF4A 4H4MA 3MZIA 4JI5F 2G13A 2KN4A 1NKCA 5E0OA 3RYLA 4WF9Q 3KLVA 1R8HA 4DSKA 1VQKS 4QWDA 3LP1A 2JEFA 4JI4F 2YTCA 1NK4A 2YNHA 5HMZA 4I1TA 1BD6A 1J2VA 5GAEI 4KGKA 3TI0A 1S9EA 5KFUA 2FLOA 1H98A 3PX4A 2VBXA 5CYQA 2NPIA 1TKXA 5FD1A 2E1RA 1SKRA 4ED0A 2N7YA 4NLUA 4LFAF 1JLGB 4C0OC 2GMLA 4OHZA 3M2RB 4I2QA 4B9VA 3NL0A 1Q78A 1NHVA 4J5OA 1HI0P 3CMAS 2WTFA 3MD1A 1N5VA 2PT0A 1P6TA 3AQPA 3S8SA 2KH9A 4PR6A 4OZ1A 2B56A 3SDEB 3UPFA 5I42B 3IWLA 1RT7B 1N54B 3O2IA 4ED5A 2XWXA 2BE2A 1IKYB 4ZPAA 1TL5A 2R8HA 2M8HA 1V6HA 1JLCA 2K3IA 2M88A 5M2PA 1SL0A 2ZZMA 2E5JA 1N4LA 4CH1A 1LXJA 3J7Z5 2YKAA 1UKUA 4WK1A 4DFPA 2CPEA 1BY9A 3UDLA 3GG0A 2GQCA 3V81B 2K3KA 1NH8A 3MEEA 4A48A 1TR0A 1RT5B 3DOMA 4QOTA 2R8KA 2GQQA 1Q7LB 2PI4A 1VIOA 1JKHA 3PDNA 5F9LA 1FXRA 2XSJB 3RB3A 3NS5A 5KFKA 1N34F 4DEZA 1WEXA 3H2LA 3MECB 2MQPA 3BSAA 1T3OA 1A7GE 4DLGA 4C98A 1D9AA 1VQ9S 7FD1A 1LK5A 2OFGX 1KR4A 2AGQA 1QSYA 3MEGA 3H2VE 5AXMA 1JLEA 4R5PA 2EC0A 2WCXA 5A8WA 1OS5A 2F40A 2W7AA 2BBEA 2EBGA 3AJ1A 1U8SA 5DM7Q 4YR0A 5THWA 2QV6A 4DL0C 1T03A 2MKKA 2JL9A 1DZ5A 1DBDA 4EYHB 1IKWA 4PQUA 1WWHA 5IXUA 4BWMA 3MOJB 3JYTB 5F9NA 4TXSA 3UNGC 5GAGI 3IWXA 3MPYA 3GV7B 3DOKB 2CJBA 1UA0A 3JTPA 2ATLA 5FIIA 2DNYA 2FHMA 4QZVB 4ECRA 4PWDA 2YKOA 3DLHA 5K8NA 4O44A 1KHVA 3LGNA 1GT8A 2XO7A 1Z2LA 2DR7A 3KMSA 3OFEA 1U1PA 3W3SA 2DH7A 2DO4A 1VQNS 3M05A 2B9WA 4NLWA 3GZ7A 1D9DA 5J1EA 4F3QA 1HBMA 2J7WA 2J0XA 4QWBA 2ZHBA 4Y65A 1EP4B 4TY9A 1URNA 4LFCF 2OKQA 4DMZA 4J9KA 2DHAA 2IJFA 3GIKA 5G0RA 3V2UC 5F8MA 4IQMA 1JLBA 4URSA 4UQGA 3W2VA 2ALZA 3BQ0A 1T3NA 2I38A 4KE5A 3O3LA 4QIFA 2R7WA 4M63A 2BACA 3QZ8A 3V6KA 2XS2A 3UD3P 5B0GA 1U1QA 1NK8A 2XI3A 3PX0A 3VAMA 1YTYA 1D9FA 2WSFC 4G1IA 2E9TA 4XAKA 3Q24A 4M5DA 2HHSA 3NCRA 4CO1A 1QVGR 2W4PA 2CRLA 1B0TA 2X1AA 2EFQA 2BQRA 1FDNA 4KQZA 3R5DA 3CTRA 2QA4S 3CD7A 3FGVA 4MAKA 2CPYA 2AJQA 4CT8A 1N36F 1X5SA 4WFAQ 1FJ7A 3OR2A 5KFXA 3BGLA 4JI3F 1NB7A 5A8RA 1BC6A 1MROB 2A10A 2QE5A 3FMWA 3OR1B 1K9MT 3RRKA 4IG3A 3K7RA 4F3MA 2M0GB 5HMXA 4ZPVR 4CH0S 5GMKa 5HBMB 4DV4F 2XZWA 1L3SA 2HG4A 2ZH8A 1LWFA 3I0SB 4NXNF 2MJNA 5DDRC 5DDOC 2HMIB 2P9EA 3DI6A 4DQIA 2F8EX 2L9WA 2EFGA 3DDNA 5K14B 5KFFA 5U47A 2UVWA 1NO8A 4O3RA 3C6UA 3BO2A 3N0VA 3K59A 1Y4ZB 2FGOA 1OQ6A 2NQPA 2ZH4A 3IBWA 2QEXS 4D3HA 4DG1A 3MHYA 4I68A 1YJNS 1H38A 2BW2A 3GIIA 2W24A 1A6LA 4F67A 5MAOA 4HDHA 4Y2IA 2OFHX 2E7WA 3OL9A 4E98A 1SIZA 1MMLA 4X4PA 1YRUA 3MAHA 1U7LA 1NJWA 1UWBA 1X4EA 2AYMA 2GA7A 3MF5A 4NWBA 5LJ5Y 4Z2XA 4BDPA 4FF3A 1YI2S 1VMBA 1IXKA 3PV8A 5E3PA 4DN9A 5KG5A 1XR6A 4IKAA 3SV3A