4C3LA

Structure of wildtype pii from s. elongatus at high resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
89
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 18
structure length 89
sequence length 106
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c3lA00
2EG1A 3DFEA 4USIA 5D4NA 3MHYA 1Q1KA 4NYOA 1UMJA 5L9NA 4D3GA 4R25A 3NCPA 1NAQA 2J9EA 2XBPA 3T9ZA 4C3KA 2NS1B 3M05A 5DRKA 5D4LA 1V9OA 1J2VA 2NUUG 5D4OA 4CO2A 2NUHA 3NCQA 4USJC 3AHPA 1O5JA 4E98A 4NYPA 1PILA 4C3MA 4CNYA 3N5BA 1NH8A 2O66A 4C3LA 2JJ4D 3L7PA 3BZQA 3AH6A 2DCLA 4WK3A 4AFFA 4CO3A 1OSCA 4IYQA 4OZLA 4Y65A 4WK1A 4CO0A 4ZK7M 3OPKA 2EG2A 1UFLA 2ZFHA 3LF0A 2Z0GA 3TA1A 2J9DE 1NH7A 2GX8A 4OZNA 3O5TB 4CO4A 4CNZA 3HLUA 2ZOMA 1P1LA 4RWXA 4RX6A 1V3RA 2XZWA 2XULA 1UKUA 3GSDA 4RLEA 3AA9A 4RWWA 4D3HA 4CO5A 2GNKA 3NCRA 4YB5A 2J9DA 5D4PA 2VD3A 4OZJA 1H3DA 1HWUA 4CO1A 2V5HG 3O8WA 1VFJA 2CZ4A 1KR4A 2PIIA 1QY7A 4Y6IA 2XG8A 2E66A 2GW8A 1XK8A 1O51A 3TA0A 3CE8A 5DS7A 4YB6A 1GNKA 1V3SA 2J9CA 2RD5C 4YB7A 2O67A 3AA8A 1NZAA 1UL3A 1V6HA 3TA2A 4USHA 3X3UA 1VHFA
chains in the Genus database with same CATH superfamily
1RWOB 3D1QA 4HEA9 1Y7PA 2YWHA 1JKHB 3A8JA 4U67Q 1KFSA 4WZQA 3UDLA 2VC0A 3CMAS 4J9VA 4F0MA 4OZ1A 1C0TB 4LSNA 3KJVA 3B8HA 1RI7A 2CPJA 4C97A 2MQ8A 2ZEJA 4JV1A 3OXGA 4ID5B 4USTA 4USUA 3PDNA 3PW0A 3BZQA 5HQMA 1G4CA 2DCLA 2C2ZB 1VRTA 4LSZB 4DCOB 2DRAA 4I7FA 8AT1B 2DY9A 2E7WA 1T9TA 3KLVA 5I3QA 1S1TA 2NREA 2M7SA 3EXYA 3HMJG 4USVA 2HAIA 2UUAF 3M4XA 5B08A 4DDFA 3V4MA 2MKCA 1DHMA 2GMLA 1TL1B 4Z7CA 4LFBF 3D28A 3W62A 3EZOA 5DLFA 1YBUA 4DSLA 2XG8A 1Q78A 4IFVB 2Q66A 2CJXB 2PFFB 4HL9A 4PKDB 4YB6A 1J5OA 3TRGA 1HBMA 3CJ2A 4PUOB 5ETPA 1FK9A 5A2QY 2BE2A 1J27A 1HNVA 1NK7A 4KTQA 4ZP7A 1U1NA 2H5EA 5IT9U 1RAIB 1Z2LA 4KY3A 3CJKA 3QRQA 2C3MA 3OHBA 3H2UB 1FWKA 3CJSA 3TEGA 2MQPA 4XPEA 2V34A 2M52A 1RTDA 4LQ9A 2HVZA 4I2QA 4ED2A 2XY7A 1SBRA 4NXNJ 3NWGA 1IBCB 2A18A 2HGMA 2DRBA 2IMWP 1O0PA 4M94A 1L3KA 2B6AA 5HVGA 1FJEB 2QT7A 3UW1A 4OYBA 1RLCL 1DBDA 4ZVEA 2X7IA 3V6HA 3HPOA 4O3OA 4LBPA 4UOFA 3ENVA 1S12A 1SB6A 3OTOF 5I3UB 2KZZA 1HWJA 1ZM4A 1H6KX 3LW5C 2ZITA 1T05B 4HACA 3GV8B 2HQ3A 5KFLA 2A6OA 5LXRA 1UA1A 1HQUA 4LF5J 2PSZA 3JTNA 5AJ3J 4X64F 1U1LA 4NEZA 1MWQA 2I2YA 1MNEA 3PV8A 5H9EJ 3QFHA 2LDYA 1KLNA 4C0HA 3Q0AA 3DI6A 4NOHA 2ZHAA 3T41A 2P6TA 2ZJRQ 2IY5B 3UCUP 2OAUA 4QZVB 1UVIA 1D0EA 4NZ6A 1LXJA 1DY3A 2C2EA 5BYRA 2RHQB 4A8XA 4DFPA 5AXMA 1UVJA 2V8HA 4KB7A 1Q16B 1WKLA 3HSJA 3FCHA 1O6XA 2O3DA 1X5PA 4IKAA 2AD9A 2J0SD 3ZTSA 1N0UA 1BE4A 3W7BA 3VQTA 1U48A 5G0RB 3IA0A 1URNA 4ZJOA 2I6WA 3LAKA 2ZDPA 4PWDB 2HBZB 3D1OA 2IHR1 2VQEJ 2W2OP 4ZS6A 1AFIA 4KH0B 3T19A 3IM9A 4L73A 3CCVS 1CJUA 1UVLA 3IC1A 2BDPA 4BBYA 4AXIA 4DV3J 1RAHB 4FP9A 2CQPA 2GFFA 2EFQA 4U7UD 7FDRA 1F9HA 2CG4A 3LANA 4P7TA 3BGFA 1IKWA 3FBBA 3R27A 3IR7B 1VJQA 2OO4A 4EFAC 5CYQA 3HP6A 2JNJA 2R7RA 1RHRB 2Z4PA 3P8BB 2ZZNA 4ES1A 3CGIA 1RA6A 2OELA 1VQ7S 3VAHA 2HZAA 3G4SS 3FMWA 4R5PA 1P27B 1S1VB 2VD3A 3PW4A 1ROFA 5KT7A 1YJTA 1XNQF 2ZM6J 2ZH4A 2PE8A 4YY3F 4J9LA 4PQUA 1R8HA 3QT5A 4URQU 4GC6A 3H5XA 3P49B 4FF4A 1GNKA 2CPZA 2CPEA 1NK6A 1RDRA 3PX4A 3K8WA 3LQVA 4CT9A 1OO0B 5HVFA 2HNZB 3QFWA 3HM9A 2AJ2A 4HHJA 2WVFA 4WPAA 4ECRA 1N36F 1P8GA 1LWFB 1RT2B 4LF4J 2M0GB 1XIQA 1JLEB 4JI2J 2FZCB 4PZVA 2MYFA 5F8JA 3L7PA 3MPDA 1N88A 1VOMA 1Y5IB 2QSFA 4YN3B 1UFLA 3ZTOA 2LQ8A 2C22A 1L3SA 3PRBA 3PW2A 3MCOA 3DRSA 5D0RA 2HQDA 2YQ0A 2QRRA 1NK5A 1NMEB 2Q79A 2QG9B 4TU9A 4ES3A 1W7WA 4KGMA 3W60A 3DHWC 1KR4A 2HHXA 3SV4A 1X4EA 1I6JA 1RWUA 2OPSB 2AHOB 4PWWA 2NZ4A 2G13A 5B09A 4DR6F 2DIUA 9RUBA 1UAWA 2MQMA 1WC3A 2VA2A 2UXCJ 1LFPA 2E5LJ 2HHTA 1G2EA 1TQLA 2FJVA 3CJ0A 1FXRA 2KVQE 4O44A 4WP8A 2BE9B 4O4RA 2XNRA 3J80Y 3LPYA 1KQSR 4DWIA 2XY5A 4JI0F 1EETA 1TKTB 5D4OA 1SKWA 2RDIA 2DJWA 3T5JA 3CIZA 1TAQA 4JYAF 2EFVA 2JDJA 3B6BA 1SV5A 1FRJA 5HBMB 1FNMA 5GMEA 4F4WA 1MMDA 4PXBA 1GMVA 1F9FA 2J76E 1LW2B 4DMZA 2WW8A 2ZVSA 4FKXA 4OYWA 2WTFA 1DURA 3N6NA 2PI4A 2WHOA 1U0HB 3IRXB 4ZP8A 4M5KA 1NSKL 3SQGB 4DV6J 3VAGA 1VBZA 1APSA 2BYCA 4CO1A 4X4PA 1M5PC 1YK9A 2N82B 4OI0A 3KUGA 5KFRA 3R6LB 3OXFA 3WX8A 2KN4A 1YJNS 1VJWA 2MZSA 2H51B 2COLA 3MGJA 3VAMA 1QUPA 2CQDA 4RW7A 4CLZA 1NDLA 2R2UA 2CQIA 3IWXA 2DH8A 4LSNB 2KZMA 3FBEA 4I56A 3KJVB 3KLEA 5KAKA 3P5TL 4MIAA 3RAXA 4EI2A 4J5OA 3EDQB 1F3VA 1IR2A 1VRTB 3DLJA 4HVZA 1MWZA 1LWCA 3UFCX 4I7FB 3CT9A 1PO6A 2QO3A 2M9KA 4Q2MA 5EN1A 3I5CA 2P9GA 2B3TB 3ZZ0A 1S1TB 2Z0GA 5HSPA 2DNNA 4LF9F 1W2BR 2CDQA 3MEDA 4HR2A 2KTQA 1GT8A 3TNVA 4ZPWR 2PA8D 4QR2A 3MM5A 3G6VA 2MKKA 4QYZK 4AQYF 4LMZA 3FZBA 5F8GA 1QD1A 5A8RA 1FKAF 1RWNB 5B0AA 2MLZA 3HHEA 3HHLA 2QLJB 2QV6A 1LV5A 3IM8A 1J5OB 4Y6IA 4F02A 3HT0A 1HBMB 1FESA 1NHUA 1XR6A 4F4ZA 2F5GA 2ZVIA 5DZ6A 1FK9B 2BE2B 4EK2A 1HNVB 1C0UA 3UNYA 1SH2A 4ANCA 3CJKB 3FC9A 2LQJA 3PEHA 4I64A 3PJXA 4AXJA 3FK4A 5GMKa 1SJFA 2LYVA 1RTDB 1O8BA 4I2QB 1IBMF 5LMUF 2DNQA 3NCQA 1WSRA 3CCLS 2R8IA 3BREA 2B6AB 1NU4A 1WF1A 3EGWB 1AXQA 4ZITA 3PG9A 4X2BA 1BQNA 4ED7A 4ZP6A 4F50A 1BY9A 4DF4A 1U2RA 5BYSA 2CWXA 2DR6A 4DFMA 3IXQA 4RR5A 1FX4A 4DI6A 2AEMA 3QIDA 1N4LA 3PNIA 2ZBCA 1VMBA 2CUYA 1JJCB 2YY3A 4JV5F 2ALZA 1U45A 4HACB 1U49A 1R6YA 1XMOJ 1RHMB 1NKCA 4QR1A 4DR7J 2FVRA 1HQUB 1ICEB 5LMNF 1JXVA 1FTRA 4OI2A 2WBRA 4CTAA 1WNEA 1CJVA 2QA4G 3TZYA 3QBCA 4JI3J 4NXMF 1Q8IA 2A0FB 1VQKS 4DV7J 3PIPQ 1SQEA 2GO8A 1U1PA 4OX8A 1IBLJ 3NGUA 1NRKA 4LR7A 2FGCA 3JSBA 3W65A 3OXLA 2NQPA 5DRKA 3W5YA 5D4LA 3DI6B 2R8KA 3DLLQ 1KWMA 3L95X 4J91A 5F8MA 5JVGQ 4Q7AA 2RU3A 2JFDA 2I9SA 1IJEB 2B4UA 2DHXA 1E6YA 3M8RA 3C46A 1NK8A 4WK1A 1OS5A 4B9MA 3D68A 1OPIA 1RCXB 3Q83A 3D3CJ 2R7XA 4CIOA 2JWNA 2MKJA 2XMKA 2RRBA 3M9MB 1AZSA 1S57A 1GMWD 3WIVA 3GSDA 1X8DA 2O1PA 1V3ZA 3VVTA 1T9XA 3SCIE 3JS9A 2ZZTA 3TVYA 1MW7A 2XMVA 1REVA 1H7XA 3RU0A 3TOQA 4I67A 1Z1ZA 1AUSL 1FX2A 1HBUA 2ZOGA 1EIYB 1RXOB 2V8GA 5D4NA 2GQCA 1EJ7L 3DDNA 1CJUB 4KFBA 4ILMA 3AD8C 4Y2MA 4CLWA 5DG7A 5U47A 2X51A 3NP5A 4PG5A 2GC8A 2Y1LB 3D6HB 2G2ZA 2VFUA 3GJRB 1T03A 2VDIA 1IKWB 3MR7A 1OSCA 5L1LA 1VQLS 2HHHF 5CYQB 3J81j 1U25A 1OY6A 4P2FA 4PG4A 3PR5B 1GXTA 3G6ES 3THVA 4TLQA 5C24A 1FVQA 4FF1A 4R5PB 4EMDA 4K4UA 4X65F 4ANDA 2XC9A 4Z7YA 1HNZJ 1CS4A 3PEJA 1OQ3A 4PQUB 4DLEA 1M5KC 2GAHC 5KFYA 3I9V9 3A3NB 3M2RA 2ZD1A 1DQ9A 2J9CA 1OSDA 5E5NA 2G2OA 4DR2F 5IWAF 1T7PA 4A8YA 1GQEA 3X3UA 4FNHA 3D0HE 1X4BA 4CH1A 2P6SA 4P52A 4ZPDA 5GAHU 3CC2S 1H74A 2ASYA 3SZ2A 3H0PA 2IC3A 1HHSA 3OFEA 2KKHA 2HRUA 2GAGC 2ZH2A 2AJ0A 2ILYA 4NLSA 1Y3KA 1KFDA 5KFGA 1JLQA 2AYEA 1RSCA 5IQ6A 5LSOA 1TP7A 2CVEA 2LMIA 3D66A 1FRHA 2RUSA 3DRSB 1GMUA 3P6YC 1RT4A 1ACMB 2GQ2A 3TI0A 1ZZNA 2AIRB 1NKBA 1M5SA 1LKZA 2J9DA 4CLTA 3S1TA 1HBNA 3NKYA 3ENQA 3UNGC 3BGLA 2CRLA 3MOJB 2NXUA 1QY7A 3WX4A 2K3IA 3MEKA 3RAMA 1PG5B 1FRMA 1X7VA 4NLOA 7FD1A 3I55S 4ALZA 4B3RJ 4DN9A 4O44B 5KG2A 2JEFA 4WFAQ 3JSRA 1Q7LB 3B78A 1FJGJ 1TK5A 2DGVA 3KYLA 1EETB 2ZWPA 3QAEA 2R8GA 1CPZA 4K2JA 2UU9F 1SV5B 3ET6A 2XYHB 3D0GE 4F67A 1TFWA 2R8HA 3NOCA 4H54A 1GTEA 2DNKA 3VALA 1SVDA 2Q3PA 2HS0A 2RVJA 2G0JA 2EC0A 3NMRA 3HFKA 3NBPA 4LT6A 1K8AT 4X4VA 4DL3A 4A4JA 3MXHP 3AXKA 3UPFA 2IM2A 2KG1A 1KOHA 3PRDA 5KT3A 2JC1A 5T7LA 3BV8A 5GAHI 1BUXA 4L74A 2FJEB 2Y0SD 4U96A 3CUNA 4LF7F 1WF2A 2ABYA 1FJCA 4RW7B 2XYGB 3IGNA 2UUAJ 1M5HA 3MPWA 3C8YA 3FKBA 3KLEB 1JK9B 3M7VA 3IG1A 3BSCA 2HIYA 2VQFF 2MQLA 2VL1A 1TU0B 2MKIA 3G2XA 1LWCB 2Z2MA 3D0IE 4X4TA 1XEZA 3M9NB 3CCMS 4OV6A 2HQCA 4WK3A 1A6LA 3D9BA 3MEDB 3W9JA 2F8EX 3MM5B 1G1XA 1T3NA 2D3ZA 3H40A 3GU0A 2K3KA 5A8RB 2DTJA 3I4HX 4NA1A 3OR1A 3HHLB 1ZOTA 3PYDA 3ILLA 3FNNA 2UUWA 3IAM9 3JB9k 2W9CA 1Y4ZB 1RHJB 5J1PA 2GW8A 4MJKA 5DM6Q 1C0UB 4DUZJ 4JI8F 2E5HA 2P8IA 2QTWA 3EYZA 3DFEA 2ZHBA 3U02A 2YNFA 1U24A 4OYPA 3HVAA 5L9XA 2QJ3A 5HAOA 4F4XA 4DUTA 3M6WA 1PJ6A 3IRWP 2Z2ZA 5GAEU 2DY1A 1FF2A 1RT5A 2EC2A 2HHVA 4ZVSB 4TYBA 3MEEA 3L7OA 2KRBA 5M2PA 2DXFA 1BQNB 5ETNA 3IR5B 5EX0A 4X64J 1IWGA 2QC3A 3CDWA 1XWLA 1UW4A 1NHKL 3EZUA 4YFUA 4OL8A 5IV4A 5KT4A 4KH1B 4F3MA 1UEUA 4B3MF 1UW9A 3W8GA 2AGPA 2XI2A 3KHHA 5KFZA 2HNDA 1B99A 3QATA 4Y2IA 4CTAB 4BWMA 1CJVB 4F25A 2CQGA 3HZEA 4LQ3A 1GH8A 2GHWA 1NM2A 1NHVA 4X84A 4LF8F 4RUBA 4D3GA 4HI1A 4ZVGA 1FJ7A 3MFIA 4FYWB 5KG3A 2YNGA 2IIHA 2KL8A 4G3IA 3R7NB 5K14A 3TAQA 3IBWA 2JJ4D 1YIJS 2FJAB 3FQKA 3D54A 1YG0A 3DLGA 1YJWS 2ZDOA 3H98A 4WP9A 4EYIB 2QSWA 4KC5A 3OLBA 1FXLA 3Q8VA 2DNHA 4DSKA 4OI4A 2QX0A 5HMZA 2MZQA 1AZSB 4C8MA 2R7TA 1EX8A 3FFIA 1HW8A 1SKRA 1RJJA 1KD1T 3K2YA 2PEBA 3UD5A 2Y1RI 3UWTA 1QE1A 1PC4A 3OBIA 2VV5A 3VVUA 5EUHA 2M8DB 5E7OB 3VV2B 1NDCA 1HBUB 5GAEI 4QU6A 3PXGa 1FWPA 1TKZA 2RS8A 1LQ9A 1TKXA 4WU3A 4J9OA 4KFBB 4TYAA 5M2RA 2FVQA 1RAAB 2RILA 2CQBA 3OFFA 4BWJA 1EZZB 1XNQJ 3MD3A 4HHHA 1H98A 4JV2A 3CCSS 4YY3J 2KT3A 3NGDA 1VBXA 4ITSA 1T03B 2XMWA 4K4WA 1TELA 2FVPA 1H7WA 3IWLA 3MAAA 1IWAA 4N8OA 4LJMA 2EVZA 6AT1B 4CO0A 1RT1A 5C7PA 1MLAA 5KFMA 3GV7B 5C24B 1D9DA 2VU5A 1UPPA 4CYUA 3MMCA 2HLUA 1U7LA 1MSWD 5IT4A 2BKPA 1GX5A 4NZ7A 4G1QA 4AL6A 2XGQA 1CS4B 2VONA 4O4GA 4CO5A 5D4PA 2CVIA 3ZTPA 1P1TA 1NJWA 3MTJA 1RGVA 1NK9A 2YWFA 2ROGA 2B4OA 3M2RB 2ADBA 2YKNA 2ZD1B 1ZAWA 3CNQP 2CQ1A 3AA8A 2I8EA 1C4AA 1TKDA 1N6QA 4LSLA 2EG1A 4IDKA 4C8ZA 1F2GA 4DPOA 1H2VZ 3CVKA 4ZCMA 2GMJA 1RUSA 3GIRA 3KNGA 1S6PA 4RW8A 2BJ9A 3VAKA 3H4BA 3WIUA 2IC3B 2E5JA 5H1SV 2RNEA 9ATCB 4DQRA 3M6XA 5EWFA 2HS4A 3N4WA 4WE1A 3K8VA 2OPRA 2VG6A 3R5JB 3NNHA 1JLQB 2QIFA 4OZ5A 2FJWA 3C15A 1WTBA 3V6JA 1FCAA 3MPVA 1S0VA 3RBZA 1X4HA 3Q8UA 3QYYA 3LF0A 2E9ZA 2FLPA 1RT4B 3AJ1A 4UOGA 4IUFA 2HIQA 3M9OB 2MLYA 3B4DA 3G8QA 4NXNF 2M5YA 3DHXA 3R9LA 2DD8S 1VS3A 1WEXA 4JI0J 1HBNB 1HWKA 1OYDA 5EX3A 4UY85 4ZVRB 4NCBA 5F8IA 4NMLA 5CD4H 1X0FA 2L3MA 3BBFA 4P74A 1N56A 4J9KA 2VA3A 1R0BG 3CCZA 4KGZB 1TL5A 3HX9A 1RT7A 1CJTA 5HQLA 4LR9A 3CJRA 4JUZA 5J1EA 5KFTA 2IRXA 4YHHF 2FB0A 2JH3A 2KM8B 1RT6A 1LW0A 1AFJA 4M5IA 2CAJA 3ET6B 1VBYA 2C2RA 4RNNA 1TAUA 1P9YA 1NUEA 2L9WA 2DT9A 2V63A 1TV6B 3OFHA 1QAYA 4OYXA 4OIXA 3W9IA 3HVWA 2RAQA 1VQYA 3TARA 3THTA 2PO4A 4C8NA 4OZLA 4QIEA 1QTNB 2L9DA 5HATA 1GXLA 3NBPB 4N76A 4NPOA 2UXBJ 4OJHA 3HLUA 3NGKA 1N5QA 4IR1A 2JLGA 1S7HA 1WORA 4RWXA 2RE1A 1R7IA 1YLXA 1SJ3P 5D0HA 1C4CA 2P2CB 5T7LB 3EVMA 5DDOC 4U9RA 1XN9A 3TUJC 3LOUA 3JSYA 3ENAA 1T9WA 3SFGA 2IJRA 4LF9J 5KFSA 5A8WA 4EEYA 5JMNA 3MHYA 2W24A 1NPKA 2JFKA 3IG1B 2OJ3A 1B7YB 1XC9A 2H5JB 2ASJA 2QL5B 5H9FK 4ECUA 5CA5A 3DM2A 1FVSA 3ZNUA 3ZZZA 1D1UA 1PYSB 3C6UA 3MZIA 4OI3A 2DR7A 1U09A 2C2KB 2WCXA 1NSPA 2FHJA 5A76A 4DPYA 4DR5F 5IC4B 2VQEF 2OTJS 3T6JA 1FXDA 1Y5NB 3FGVA 4P2MA 3DYAA 1NCLA 5CABA 1X4AA 2YWWA 4CRJA 2PA3A 3RAQA 1YRTA 4TLRA 2V8PA 4DV3F 3OR1B 1V5IB 4ZCKA 3O6QA 4RUAA 4KPCA 5D6GA 2W9CB 1FFGB 2BANA 2OEMA 2M2BA 2E1AA 2LECA 4C2MA 2BX6A 2KDOA 4LBHA 3MUVP 1JLAA 4RNOA 2YNFB 4ZPCA 1VHFA 3TEHB 4ZN1A 1M1KT 2DNRA 1JQGA 1H72C 2JX2A 3R5CA 3CB4A 4JV5J 2BM0A 1NAQA 3NOGA 1VR6A 3EMTA 1T8EA 3EGZA 4C3KA 3R2CJ 1RT5B 5K8NA 1TL3A 1V9OA 2WRMA 1WC5A 3MEEB 3QMQA 1Y0HA 2NXJA 5LMNJ 1DARA 1KSPA 1RACB 1RTZA 2XZTB 4RNFA 3M8ZA 4J9RA 4MIBA 3M1VA 2QLBB 2RDDA 3P96A 3GG1A 5KFNA 1IR0A 1F6TA 2FGOA 3NRBA 1BLUA 1RKJA 4MAKA 4ZCIA 4N5SA 1SC1B 2HNDB 1YBAA 5B0EA 3VQSA 4A8MP 5KT5A 1IR1A 5J2PA 3P5BP 2W8KA 3Q2SC 3ILIA 4FS1A 1YJ9S 4DQPA 2DNPA 2W7AA 4KGXB 1JJ4A 2QLFB 2MY7A 2HHSA 1HQ2A 5JUMA 3SDEB 5K14B 2V2QA 1PKUA 1KOOA 1OY9A 2UXCF 3DLGB 1TK0A 3DNCA 6FDRA 2X1AA 3KHLA 1PYTA 4NLPA 4JP8A 4LRDA 4HLBA 3HD2A 4DS4A 2DYAA 1GK8A 4M63A 4GO5X 4YR2A 3QPIA 2LEPA 3FFIB 4HTJA 2XO6A 4DSIA 1YZ6A 2YNHA 4CWBA 4Z37A 2XMJA 3QLHA 4M5DA 4NI2A 1QE1B 3BO3A 1AROP 1DAXA 4NLUA 2RUGA 3RBEA 1FRIA 3KG4A 2LXUA 3MECA 3J81Y 1HMVB 3D3BJ 3G9CA 1QVFR 4J37A 4X4QA 2WB1D 4OZ0A 1TKZB 2KH9A 2EFPA 3HJVA 4PXDA 4F0HA 3N0VA 5ITHA 2KXFA 3ENWA 1TKXB 1FDAA 3O2IA 2JC0A 5FLXU 2V4JA 1K0VA 2P9CA 5BJRA 2APOA 1S0OA 4X65J 4JBCA 3H25A 3LGMA 1U6FA 4EBDA 5CD4A 3NXZA 2KVIA 1Y3JA 1WHWA 1Q8KA 2DH7A 3HHNB 3MAAB 4USJC 4DG1A 2W4CA 1VK3A 4IH7A 2D1CA 4P10A 1RT1B 4LF6F 4TKTA 2IJFA 4DX7A 1S1WA 4CYUB 3MMCB 2MPUA 2FVSA 1PBAA 4G1QB 4OLOA 4CP5A 1EQ0A 4O4GB 3H20A 5AXKA 2HFVA 4N8NA 2ROEA 5KFCA 2JVOA 3MPYA 1VC6A 1TVRA 4A8FA 3FRYA 2CPHA 2YKNB 2MDAA 5KOWA 4KJIA 5BXIA 2CQ4A 1G7CB 2AQ4A 1BQMA 1T3OA 2QE5A 3SSRA 1N6QB 4QU7A 4IDKB 1FDBA 4MK7A 3DGVA 2XMTA 4LIWA 1S6PB 4RW8B 4DZ6A 3MI7X 4R25A 3U1MA 2G1HA 3I4PA 4OX9F 3KG1A 4CLUA 1KBRA 1YWXA 5GMDA 4IFYA 3VWSA 4WE1B 2V4QA 2OPRB 2VG6B 3ZO7A 3I0SB 2AEFA 2OEKA 3C15B 1NH8A 3UDCA 2DGUA 3CD5A 4K4ZA 2DO0A 2FLLA 5E33A 2ZNZA 1R43A 4QW9A 1PGZA 4U7CA 3GG0A 4NA3A 3AB2B 4LF1A 1HI8A 3BN4A 1GMWA 4EWTA 3EM1A 1T95A 3UD4P 3SYZA 3OSPA 3R7BB 3ICLA 1SH0A 2Z58B 4R8UA 1RT7B 3SMZA 5G4DA 5J1EB 1TL4A 4LFAJ 1ULRA 3RR7A 5KFPA 1V5VA 3R6GB 2CYYA 4C0OC 3SSSA 3ZTRA 2J5AA 2DHAA 1RT6B 1LW0B 2OEJA 8RUCA 4F4KA 4I0WA 1XMOF 1MG7A 2CNLB 2N4CA 2EW9A 4XIUA 2JRSA 4OHVA 4KV8A 1WOSA 2VG5A 4DR3F 4DLGA 4L76A 4NYPA 2EPIA 1PJ7A 5KFBA 4JI3F 4LF7J 2YKMA 1RU2A 2BXJA 2NZCA 3HULA 1VDHA 2RH3A 3JTPA 4MMOA 2WVDA 1VGYA 4RO0A 3JTOA 4DF8A 5GADU 2M4MA 2B8QA 4I6AA 1U6ZA 3MOZA 3AY0A 2BJ8A 1VQPS 4KHPF 2XQCA 3LWLA 3QQCD 5C42A 1YJVA 2ROPA 4C8LA 2I38A 4IH5A 2HZVA 2V4RA 5A8WB 2JL9A 4A8OA 4NRTA 2BQRA 2DKOB 4K4TA 2CNNB 1X60A 4DR4J 4OX6A 1JXLA 3G8SA 2GIRA 4JI6J 2BV3A 3DM2B 2IA0A 3X1LB 2C3PA 4PPZA 3KLHA 4ED5A 4KO0A 3C6UB 1WJ9A 4WXOA 4Q5VA 3U1NA 4E98A 2CQHA 2VPZB 3IGVA 4JI8J 3DC2A 2XHWA 2VIHA 2R9LA 4K4VA 2NSBA 4HH0A 3DYAB 4QCLA 3TX0A 2RQ4A 3T1HJ 3W3SA 2ADCA 3TJAA 1YBTA 2MQNA 3LP0A 4RX6A 3PYEA 4UTGA 4RWWA 2BANB 1UCNA 5IT0A 1IXKA 4UOCA 1QSYA 2NXCA 1IQZA 2J7WA 1KN6A 1K1SA 4O3QA 3ITHA 1VQSA 4DV4F 3A1YG 3DU5A 5KFKA 5KFOA 4ZIVA 1BQXA 1N48A 1HNZF 3KK2A 3M8WA 4B3MJ 5E3PA 4QYRA 1PAEX 1TL3B 1R0CB 2ATCB 4W92B 3I87A 3KJFB 3IFEA 4YB1P 3IN5A 1VC5A 2LQ9A 2ZWOA 4WP3A 1Q81T 1HR0J 4QWEA 4ETXA 3GFYA 1T94A 1FRKA 4OQJA 3CJ8A 2Y3YA 2G9OA 3GJSB 2HWTA 2JOQA 4MKYA 3M1VB 4I4BA 5FJ4A 1PSDA 4LF8J 3BDPA 3VZIA 2AT1B 1R8PA 2DNYA 3EPIA 3CMES 4K4XA 1X9SA 2HVIA 2WOMA 2CWKA 2O01C 3KLFA 5DG8A 2JEIA 3BQ0A 2R4FA 4DX5A 1CJKA 3BGRA 2UXDF 2E1MC 2MJNA 5GVQA 4HH1A 2B51A 5J2PB 3OUYA 3A12A 5AXLA 3DRPA 4O0NA 3TP2A 4JI4F 4C9DA 4DEZA 2HNYB 1AB8A 2BM1A 3VGSA 5HJYA 4ZDNA 4RW6A 1UMJA 3OL7A 2J6UA 2V69A 1NJIT 4I6YA 1WTFA 3A8EA 4NX9A 3A13A 3MF5A 3TO8A 1G6BA 3MMBA 3HSGA 4CCHA 1FJGF 1X9MA 1D9FA 3MR5A 4CLKA 4RBVA 3LALA 4RNMA 2QL7B 3FMBA 1R0AA 4GRSA 2YNHB 3TA1A 5KFVA 1K9MT 4KAIA 3QLHB 4M5DB 5HMYA 4NI2B 4NMXA 4X4OA 5CYMA 5J2MB 4LRAA 1MN7A 3MECB 4J9UE 5JVHQ 4NZ0A 2CG8A 3K5PA 1JLFA 1T9UA 3KFWX 3HZGA 3HD1A 2ZH9A 1DRZA 5LOQA 4C7QA 1ZAVA 5KFJA 2V4JB 4UQGA 1X4FA 3M32A 2DGTA 3AD9C 1W25A 4DU7A 1CULA 4O3NA 1WSVA 3GFXA 3NS6A 1U0SA 3BR9A 1MN9A 3G82A 1WKKA 3MMAA 2KO1A 4DG1B 2IBOA 1WG4A 2KYZA 3CD6S 3IS9A 1KS2A 5IFMA 2HHPA 1JLGA 2V2KA 3K59A 3L9ZA 3GILA 1S1WB 2DNGA 1DLOA 4M5MA 1RISA 2XLKA 3KJQB 4TXSA 3HHDA 4DR1F 1YKWA 3PRVA 1URRA 1TVRB 2E7XA 4QWAA 3OVBA 4KBIA 3K58A 1UWAA 1ZTWA 2RJZA 1XR5A 2GO9A 2F63A 3DRRA 5M2UA 2X3GA 2OPQA 1ZAXA 2XMUA 2FDNA 4ZVUB 4ZIWA 4KGKA 5E3RA 4FYDA 3MCNA 3GP9A 2SXLA 4KHRA 1KTQA 1SJ1A 4DQQA 2VASA 1NSAA 1B64A 2LP4A 3V2UC 5E41A 2NYIA 2ZH3A 2XCPA 4GVLA 1VQNS 2BMBA 3BH6B 3VAJA 2EFNA 3Q24A 5J2QA 3NCPA 3EVOA 4IFYB 3TQEA 1KDNA 3RRKA 3CCJS 1ZA2B 4BDPA 2HHQA 5KG1A 4DUZF 4MKBA 3UVJA 4CLPA 3MUMP 1WHXA 2AYGA 2KXNB 2KJWA 4MH8A 2HHWA 3IMQJ 4ZLJA 1B7FA 5H9EK 3OL9A 3POTA 4UY8T 3G86A 4YHHJ 5KFDA 5JXSA 3RB4A 3THPA 3IR6B 3RRGA 2QEXS 4A47A 1ZPVA 3QSIA 2GV1A 3BQ2A 1LNQA 2KT2A 2DXDA 3PTWA 4KSEB 4CO4A 3PW7A 1EB0A 3HHLC 2VPXB 2N3OA 4DPTA 4M5GA 1KQFB 1M1GA 2ACMA 3SCLE 4R8UB 3H2VE 3DMJA 1RAFB 1U8WA 2MHNA 5GAGI 1WC4A 3GCXP 5I3PA 4PQAA 3OLAA 2DGWA 3I31A 1SH3A 2UZAA 2XSJA 4L72B 5HJXA 1UL3A 2AZ3A 2AU0A 5MAOA 4OHZA 2F7VA 1NXIA 1UEKA 3KK3A 4GKJJ 4B9SA 5CCLA 2X1GA 3BN7A 3PFEA 4KV8B 3R2DJ 5F0UA 2VG5B 3R5DA 2KYXA 3N9UC 2VH7A 1UEVA 3N5FA 3NS7B 5EHHA 2XEXA 1UZDA 2YKMB 4DS5A 2K7JA 1T0TV 3JYTA 3MAQA 3BJYA 1F1BB 1MMLA 4FXDA 1HKAA 2V68A 3VHQA 1NZ8A 1YRUA 2MKHA 5AT1B 3MDFA 2Q6BA 3SCKE 4FYVB 1HWIA 1QLNA 1F0XA 4MK9A 1IBKF 2CJBA 1V3RA 2WSFC 1FD8A 1OWXA 2BJEA 2FC8A 3KNAA 3D7SB 5C42B 2VB6A 2PIIA 4DR5J 2YQ3A 5THWA 2A2CA 2XCAA 4IG0A 2DITA 4LFCJ 4WJBA 5HVHA 1HYSA 3HHLD 4WU2A 4B9NA 3KHGA 3KLHB 4ID8A 4KO0B 3CO9A 3IBCB 1JX4A 5IQQA 2XWYA 1XMQF 4L3KA 2E1PA 3CJ4A 1Q5VA 5ETMA 3PR4A 1NJXA 2HPUA 1VRUA 4UZCA 1IM4A 2CA9A 1JB0C 3KMSA 4HYKA 2Y1JA 3JAMU 4C0BA 2RS2A 2LLZA 5IOLA 1IKXA 3NEKA 2PMHA 2W2MP 2XULA 1U6BA 1X31C 2L08A 4DL0C 2DEIA 3HF5A 4UUXA 1FTCA 1DTTA 1YJ7A 3U27A 5KFXA 4GMKA 2QFIA 2G0IA 3Q23A 3KK2B 1RWXB 3O44A 3OTEA 4C8KA 5LJ5Y 4JV0A 2JEJA 3NL0A 2HQFA 4RKUC 4YP3A 2EFGA 4MKAA 1AT1B 4OJGA 2C2NA 3FCVA 1LFWA 2ALYB 2QLXA 2O66A 2IVMA 4YR0A 2JLEA 5IV3A 1LWEA 3TUIC 3C14A 5EGYA 3UI3A 2EKYA 4NLVA 2ACYA 4M95A 2J8SA 5FD1A 2L41A 1C0TA 2WOMB 2OMOA 2QMUB 3KKFA 1HI1A 4F36A 3KLFB 1SPBP 1QSSA 1SKUB 2IM1A 1CJKB 3I32A 3BGRB 2IDLA 2MGZA 1VFJA 2ZC3A 3RBXA 3OUYB 2XB2D 2NXEA 3DRPB 1O51A 1SCJB 3M6VA 5MLCV 3EPGA 3FEXB 3GQCA 4Y2CA 2XWXA 2OI2A 1KTVA 4RW6B 5EDWA 4AYBD 4DV2F 1IUJA 1Y10A 1HNXF 2NR0A 1U4BA 4KGVB 4FZVA 5ETLA 2YWKA 3CDUA 1NLKL 1FNOA 4YUDA 1YGYA 4IFVA 3Q8SB 4X4RA 2F9DA 1X5OA 1EKRA 1WOPA 3JQKA 5LL6d 2PT0A 2XZDB 1S6QA 1R0AB 1KONA 1R8BA 1K47A 2B43A 1MU2A 3V6KA 1SC6A 1QAIA 5CYMB 4FBUA 2ZOMA 3IP0A 3E3XA 1S10A 4RLEA 1N34F 2DPJA 1JLFB 2BRKA 1RAJA 3FDSA 4HDGA 1S77D 2UXBF 4LF6J 2F4VF 4DFKA 2KM8C 2BKOA 3M32B 4B9VA 1QAXA 2BW2A 3EE3A 4U8YA 4GKKF 1CULB 4DV0F 2FHKA 1FE0A 2KHDA 2QL9B 3G82B 3MM8A 3MMAB 1YHQS 4URGA 2VFSA 2G1DA 2E1RA 4FDFA 3FVYA 4ZHRA 2EWHA 2G2YA 3IS9B 1FRXA 3CXCR 4N7TA 1YITS 4F3QA 3T5LA 5BYQA 4EBEA 1JLGB 2V2VA 2Y1IA 1HHTP 1N32F 2FHMA 4P72A 5HK4A 1DLOB 1Y11A 4AFFA 4XTTA 4K50A 2WW4A 3HI9A 2R7QA 3Q8PB 3M30A 2U2FA 2RT3A 4OX9J 4RPFA 3F56A 4WTOB 1YI2S 3ILOA 4J9PA 3DRRB 1UWBA 2OPQB 4RUCA 1X4DA 2HFZA 1TL7A 4HKQA 2LXFA 2HQGA 3DRXA 1R6VA 3PO4A 4BC7A 5LM7E 2AWZA 4OI1A 3LTOA 1RWVB 3ADAC 4CLFA 2PMWA 2UUTA 1VCTA 1NSQA 3FBFA 1CQNA 1PCAA 3TA0A 4FF3A 2E5GA 4LRBA 1V3SA 3RYLA 1T9VA 2D7SA 4RW9A 4EBCA 1S9FA 1RAEB 5J2QB 1R8CA 2VICA 2OSRA 4DV1J 4Y3CA 3CSKA 2VC1A 4Q45A 3UVJB 4ZA1A 2BVZA 2OP5A 2QA4S 4PYDA 2R2TA 3GTYX 1K44A 4DCJB 2K8GA 2UUCJ 3POTB 4IOAQ 1RK8A 3QT8A 1D09B 4K4SA 2W9BA 1VIOA 3WC0A 2DK2A 2DR8A 2VHGA 4DXLA 3TQ1A 1GFWB 5E2QA 1LWXA 4OZNA 2K1RA 4P71A 1U1MA 2FJXA 5CXTA 2IFXA 3F73A 1U2FA 3DMJB 3CJQA 4DR3J 3OL8A 4EU0A 3UR3C 1H3DA 2ZC4A 2DNOA 2U1AA 1KC8T 1RWKB 4B9TA 4I6WA 3K5LA 3KXDA 2XSJB 3G71S 1JLCA 3MAHA 3OTBA 4W90B 4DFJA 3KK3B 4L6V3 1Q5YA 4ECSA 1XTZA 2XI3A 4AT1B 1HFEL 4BS2A 3Q22A 2DEJA 4P2XA 4RU2A 3N79A 2H1YA 1KQGB 3K5MA 4KHPJ 4ENOA 3DLHA 3PHTA 2RU9A 4XO0A 1ZM2A 1HA1A 4G6VB 2DO4A 5DO2A 3JYTB 2CIMA 3BKFA 3QNWB 5KOXA 4CDIA 1FA0A 2GJ2A 1NBEB 3PJ9A 5A2QU 2HW3A 3HO1A 5AE2A 4ZJLA 3Q89A 2HBYB 1EP4A 4NLXA 4PRFA 4F8RA 2UVVA 4PYAA 1P1LA 2B4PA 3MCMA 5KG6A 4J9SA 1TMJA 2XNQA 3H8YA 4Q0BA 1S9GA 2JSXA 1RWWB 3AJDA 3WQPA 1IM6A 1ZZFA 3VGVA 3PYGA 4IG0B 5CH7B 4YB7A 4USHA 1N5YA 5K8MA 3MD1A 1I5OB 2W7PA 1RBLA 3OJSA 4DSJA 4IQXA 4FPIA 2NXNA 3FCWA 2ZZMA 3S8SA 4NLDA 3BB5A 4CZCA 2EKNA 3IBFB 4DV4J 4IG3A 3CCES 2AJFE 4USKA 2ZE2A 1S4FA 3BEGB 1YZ7A 2XGPA 4F04B 2LA4A 3J7AN 3HDSA 2JVRA 4NRUA 1IKXB 3Q2TC 1Q86T 3QAUA 3RJMB 2WBMA 5HQ8A 2BE7D 4N47A 5SZTA 3K89A 2FY8A 2BZ2A 2XZWA 3E51A 3W5ZA 1FKPA 3BKUA 1HD1A 2VFVA 1K0TA 3NAHA 2VBWA 2KI2A 1DTTB 4F4AA 2AGOA 2GCFA 2AJQA 4TU7A 1VRQC 1XERA 2JEGA 3FRZA 1RWPB 1LK7A 4ZPVR 5L1KA 3EUNA 4NLQA 3GPAA 5KFQA 3T5HA 4ELTA 4QR0A 1S1UA 4MK8A 1UFKA 3NMAA 4ZVHA 2FVCA 3ETMA 2LEAA 2UXDJ 4Y2KA 1HIYA 1SUQA 1H73A 2LQ5A 1N5VA 3BM7A 1SI9A 4A46A 4IRCA 4DUYF 3P45B 1D9AA 3SXLA 1IKVA 3SQOP 3H7HB 2H4WB 1C1BA 2C2MB 1LWEB 4JI4J 4UQTA 3C14B 2UV8G 4TY8A 4FYXB 4XDDA 4ZOSA 3EX7B 3US5A 3EVWA 2D3O1 4ED8A 5DLGA 4RNHA 4CH7A 2MSTA 3GONA 1RADB 3HXMA 2MGZB 3GV5B 2AJ4A 2R8JA 4BHQA 2Z2LA 1VQ6S 3VAIA 4ED1A 4IRDA 1VI7A 1U2CA 2YH1A 1HW9A 3ZZPA 1HWLA 2DGXA 3ZFVA 4WZMA 3DOKA 4B9LA 1PC5A 3JQMA 1EQMA 2ZH1A 5HN0A 2J0QD 3DLBA 1DJ0A 1RT3A 3CTRA 4I1TA 2XS7A 2LKZA 2WB4A 2IPOB 4J90A 1QTMA 2CXEA 3DLKA 4LFAF 1HNWF 1BXNA 2KB2A 3N6MA 2BA9A 5IM0A 1S6QB 2DNZA 3VGUA 3D6TB 2WAQD 1MU2B 1M5VC 4EYHB 2E44A 3HSDA 5A8KA 2IYIA 5LSRA 5B0BA 5KFFA 2DHHA 2WZ1A 2BBEA 4LVNP 3W64A 5ETSA 2I0XA 1I1GA 1L5UA 3VGTA 1YVFA 2UVRA 1HLWA 2BACA 1U02A 3MPUB 3V4IA 2F8HA 3GB0A 2P9EA 4WFYA 1SC4B 4DR1J 2HQIA 5K8PA 3MM8B 4A8SA 2VBXA 4ZPAA 1HARA 3NGTA 5L9NA 3CD7A 2GIFA 4ZHRB 4AD6A 1T02A 5F41A 2NYHA 3GIMA 3GYNA 2ATLA 1HL6A 2XSFA 3W2WA 1JJHA 1J5EJ 4KKOA 5ETOA 2WVBA 3NGRA 2VG7A 4OLPA 4K7QA 3M6UA 4DBQA 4DR4F 4K5RA 1OQ6A 4QIFA 4JI6F 3M30B 1F3FA 5AXNA 1WEYA 1FWLA 3R1LA 1RZMA 5F8LA 3BSNA 1UWBB 4TN2A 3J80U 2FC9A 4QWDA 2Q6CA 3NAIA 2RF2A 3TVKA 1TL7B 2CJQA 1FHTA 2YX1A 3ZZYA 4WKYA 5A0YA 3EGNA 4RUHA 1HWUA 1KP6A 3QIPA 2HWIA 3QJPA 2ZH8A 3BPDA 3DN9A 3FJ2A 3CCTA 1I94J 3E2EA 3T1HF 3T9NA 1SQFA 4K59A 4A8QA 4RW9B 4ZVPB 3DGPA 5ETRA 2DBBA 2D3OR 1S1XA 2NPIA 4USIA 1IN0A 3LO3A 2ZBPA 2JZ5A 2PD1A 4U6PA 1W2IA 1CC7A 2PEHA 2VKZG 1QM9A 1L3VA 1NDKA 5FIIA 1RYRA 3T9ZA 2QGFB 2QMXA 1Q8BA 2HRYA 4WFNQ 4ZJQA 2W9BB 2EK6A 1JMTA 1FEHA 5FDLA 4ZKAA 3TX8A 1N33J 1HD0A 3J7A1 3H5YA 5L39A 2K1RB 2LQBA 2ERRA 3PM9A 3MM6A 2HLTA 1VLOA 3UO0A 3KDNA 5F0WA 4Z2XA 4IOBA 3UQSA 2AYBA 1HR0F 4UUWA 5C25A 3AQOA 4NE9C 1UKUA 1YQHA 2OHDA 1FO1A 4I69A 2YTCA 5DDQC 4AE5A 5F8NA 2Z30B 2DR5A 1VK8A 2ZBRA 3O8WA 1B70B 5KT2A 2R7OA 1JLCB 2V50A 1YX2A 4KT0C 2MZJA 1JLBA 4I2PA 3HKZD 4OYIA 1NPPA 2J8AA 1RLDA 2ASDA 2L48A 4Q43A 3C16A 1N54B 5F9NA 1S76D 1IBKJ 4H4KC 2AKWB 1E6YB 2J9EA 5DDRC 3GIKA 4XPCA 1NPRA 2DGSA 5T41A 4OYMA 4CO2A 2JLFA 3OVAA 1FNXH 2WVEA 1RABB 4IYQA 3BPSP 3H90A 4WFXA 4JI1F 1EP4B 3OPKA 2IAJA 2ASLA 3IWNC 1YDLA 2OKQA 4Y28C 5DQGA 1REVB 5KTQA 3O5TB 1XMBA 3W63A 1S7IA 2B5JA 5J2NA 1XMQJ 2DVIA 2HSEB 4Q0BB 2CPYA 4FS2A 4LRCA 1S9GB 1HNIA 4YB5A 2FHJD 3N28A 2AP6A 4ED3A 2XS5A 3RZAA 3PY8A 1YJRA 2ZNYA 4IO1A 3QGHA 4OYAA 4PEOA 2VPWB 1N5YB 4ED0A 3C6TA 4MT1A 3M2VA 4ATNA 2VOPA 1MMNA 5KFUA 2E29A 1NK4A 3DDKA 2UUBF 3QJJA 1OIAA 1J2VA 3A8IA 4IG3B 2ZE2B 1WWHA 2GS8A 2I1RA 4MYUA 2C28A 1R8AA 2DRDA 2MKSA 1MROA 1RTJA 3BKTA 3CCRS 3UD3P 2X1BA 4ECQA 3NY0A 5KG0A 2K06A 2Q1LA 1FKPB 2EFOA 2LEBA 4F7VA 3AA9A 4K4YA 3AOAA 3PHEA 1M0SA 1Y5LB 1FRLA 4O3PA 3PCOB 2W2QP 4ECTA 1P6TA 2MTLA 1PAUB 5DGAA 1S9EA 4PXEA 1Y9OA 4QWCA 2B9XA 1TFYA 3RTVA 2DB1A 1S1UB 4F4YA 3CD0A 3N01A 1XNRJ 1VQ8S 4E2FB 1VLYA 2YKAA 5IS2A 2NPFA 3TZZA 1SUQB 2YXLA 3R97A 1VQOS 1KKHA 3M8YA 2AF6A 2K7KA 1LXNA 3K57A 3RB6A 3FEYB 1IKVB 3A8KA 4FPRA 3DOMA 3PKYA 3H42A 1C1BB 3CJTA 2CPIA 2HAFA 2ILZA 1NJYA 4TY8B 4IO9Q 2C42A 4TY9A 2EK1A 3AH6A 4MYTA 2V2ZA 4DV2J 1HNXJ 2ZFHA 4FBTA 4X66F 4P2SA 2V67A 4G1IA 1R27B 2MXYA 4ECWA 2OUGA 3TJ9A 1EAYC 1YSJA 2Y9HA 1RCOB 3J7Z5 2MKYA 4ED6A 2NLWA 5E3AA 3DOKB 2O67A 3JXOA 1UVMA 1TZ0A 1B0PA 2QFJA 3J7YU 4XDCA 1RT3B 1VC0A 1N34J 2M70A 4DL6A 3DLKB 1S4EA 1FERA 4U8VA 2PDAA 5IM0B 3I96A 1O5JA 1B4SA 2F4VJ 3M8PA 3BR8A 2G0CA 4NL5A 1WUUA 4GKJF 3R5BA 3L09A 1JNRB 1B0TA 1VQ5S 2CJ9A 4GKKJ 4DV0J 1IJFB 2QYCA 4ZVOB 4QYZJ 3OD2A 5A8KB 1KVIA 4NEYA 1WC6A 2F3JA 1X4GA 5D15A 1B0VA 3LWMA 4Q44A 2OPPA 3BO4A 4DSEA 4J7CA 1N32J 2XTJP 3V4IB 1CC8A 3D6MB 4C8YA 2VFTA 1S0NA 3HCXA 3W2VA 4P7VA 2BABA 2BJ7A 3K0JA 2EBEA 4FNIA 3UN2A 4AL7A 1VQ9S 2B56A 4DU8A 3KDOA 1RP5A 2Z8QA 3MCSA 4MFBA 3KOAA 4A48A 2AEJA 1TTHB 3W2WB 4KKOB 2XLJA 4ECVA 3SEOA 3AD7C 4UW2A 2OLWA 2VG7B 2NUHA 5L8RC 1X4CA 2H4YB 3C2PA 4LFCF 4G65A 4EO6A 4ETZA 3G96A 2J6TA 1F60B 4JOUA 2F40A 2V8DA 2CJYB 2MB0B 1NH7A 2EI5A 2VDHA 2RF2B 3CULA 2OGUA 4NLGA 1WEZA 3GE9A 5A0YB 3J7YI 2EXUA 3AT1B 3QIPB 1ZS6A 2QMWA 3B82A 2CDRB 3JQJA 1SKSA 1RU1A 4LUBA 2W2PP 2OFGX 3UCGA 2YNIA 4XK8C 1XBWA 4YR3A 1RQ0A 3DGPB 4E0DA 2RB7A 1C2PA 3K7RA 1F2HA 1S1XB 2M88A 3FSYA 5D3GA 1REGX 4ECZA 1G3OA 5LJ3Y 1F5CA 2W4PA 4DN0A 2AX1A 1S97A 5ETKA 3BYRA 3R5GA 2N3LA 2BUNA 5HMXA 4Y34A 2BQ3A 1NK0A 2J0WA 2ZH6A 3UR0A 2POKA 1NO8A 2HHUA 2HFNA 3TAMA 2OIHA 3OVSA 1WKJA 5B0DA 3VF0B 2WVCA 3BYPA 1Q79A 3QZ7A 2RQKA 3ZNJ1 3T1YJ 1SIWB 5FDLB 2W9AA 4WF9Q 2XS2A 2KRRA 3RUBL 3T3FA 1A7GE 1NNDA 4OMFG 4B3SF 3MM6B 3MR6A 3PIOQ 4YEAA 3RG6A 2GX8A 5HLFA 5C25B 2AX0A 1VQMS 4B3TF 1QUVA 4YOEA 2YKOA 3GR1A 1Q95G 4YMEA 2BRLA 5E3QA 4OZJA 4F0KA 1N0VC 3TAPA 3LP1A 3CEDA 1JLBB 4I2PB 3E8OA 2YNGB 4EZ9A 5L38A 1UFWA 3LPEA 3EJMA 4TU8A 1HQEA 3C16B 5EWEA 2CNOB 2VUGA 1NZAA 2MZTA 5BR8F 3EWGA 1GX6A 3ELHA 2HZCA 4S0MA 4RW4A 4JI5F 4L3NA 3HSZA 4WFZA 2IM3A 1SIZA 2HFSA 3GCWP 4KHMA 4RU9A 1X5SA 5HMWA 4DOZA 5KFIA 1DFDA 2IAJB 1VHIA 1C1CA 3I9ZA 3WC2A 1CLFA 1H2UX 2VBZA 3LGNA 2FYXA 3B54A 4ED4A 2N7CA 1S6UA 4Q2LA 2HMIA 2B5JB 3O1LA 3KLGA 5J2NB 4JB8B 3PW5A 4X4NA 4JI7J 4ANEA 2DISA 1HNIB 1I51B 3GMGA 1SQGA 1UJ5A 4MTPA 4QPTA 2RMLA 3NCRA 2CZVC 3ZZTA 2B7CB 1BHNA 5DM7Q 1Q4RA 2DPIA 3RB0A 4KR0B 2XMAA 4DL4A 4OX7A 2DGOA 3C6TB 3ILJA 4ZVQB 4X62J 3P4UB 2YPYA 2JHEA 5CAAA 1Q7YT 5D0GA 3M2VB 4HT7A 3M2UA 4NYOA 3H4DA 2D41A 1Q82T 1CSJA 1KHWA 1KLMA 1VBKA 2KFNA 3LP2A 2O5DA 4LR8A 4MIWA 1FDNA 5DDPC 4DJBA 4OHWA 1KNZA 1TR0A 4WYLA 3KUHA 4P9SA 1PIEA 4QBUA 4M1KA 1CVJA 4F2SA 1MROB 1RTJB 1FD2A 1FE4A 4ECYA 4Y65A 1YJUA 3F41A 1RTIA 3R5AA 2WSEC 4P6QA 1S6OA 1S59A 2A10A 5HO4A 3I5AA 1WDDA 3SV3A 1H38A 3GIIA 2VBYA 3E01A 4ELVA 3DLEA 4C8OA 2J7KA 1TV6A 4LSLB 4NCGA 2LVWA 1NJZA 3AB4B 4DUYJ 3OJUA 3D4JA 4TQSA 2FUG9 1BMQB 4KIAA 1S9EB 4PCQA 2R2SA 2MSSA 3CW2C 1TUWA 2HKEA 2R7VA 1R89A 1N5TA 2BOPA 3BSOA 5DGBA 1WD6A 5CZVA 2XBPA 4C4WA 2NS1B 5KG5A 3DOMB 4LREA 2C3UA 1TK8A 5DQIA 4ICLA 2D69A 1FFWB 5IC6B 3C3LA 2C2OB 3R1HA 2LCWA 2FY1A 1NEEA 3KK1A 1SL0A 4DV1F 3CMQA 3MR3A 2PFDA 4LFBJ 3H5SA 3TUPA 1WDTA 2HVEA 4M8LA 1ZH5A 1CJTB 3KTQA 2UUCF 5CCMA 4GO7X 2GA7A 5B0CA 3D2WA 1CG2A 4C48A 1HNWJ 3VTIA 4R0EA 2VJUA 3I56S 1ZA1B 5ADZA 4ZP9A 3TUZC 1XJWB 2MJUA 2GZOA 1NB2A 3PFOA 1LEOA 3RW6A 5K8OA 5DG9A 1WF0A 2YKPA 3D67A 4FXVA 3R8YA 4QIVA 4HTIA 2H54B 4ZN3A 3H59A 2YX7A 2GHVC 3EGVA 2GGPA 1AA1B 2OD6A 4OYOA 3PX0A 3C19A 2HGNA 2CJAA 2PGCA 1ZYQA 2E9RX 2GJFA 2J6SA 4DHVA 2CPDA 2C3OA 4V1Ak 4M5NA 3M8PB 1A9NB 4IRKA 3UN3A 4NWBA 3H2LA 2RHSB 4URSA 3RRHA 4C3LA 3TW0A 1KVJA 3OTOJ 4W98A 1S48A 1JIHA 5DZ7A 1X5TA 2F9JA 2QLWA 2QYGA 4B17A 3QWUA 3M8QA 3HHKA 5FLXY 2HBQB 2ZHOA 1S0MA 4IH6A 2DHGA 5LXYA 2OPPB 1Q8LA 1TUVA 3R3TA 3W9HA 1JJ2R 3NLCA 1N8RT 2WONA 1SL1A 2IM0A 2XYPB 1U1OA 2C1EB 1WOOA 2Y8WA 3EICA 3W2VB 3UCZP 1X9WA 3SCJE 3V81A 2NSCA 2D74B 1E6VA 5B7WA 4MFBB 4KRWA 2AJ1A 2FLOA 4WKRA 2CJKA 4X4UA 3BF4A 1D8YA 2R7UA 2H48B 4I68A 4NLYA 4ZLPA 3OSNA 1SJRA 2RRAA 3FBCA 4CNYA 1RHKB 2GQQA 3MM7A 3R7SB 5HROA 1WELA 3DXSX 4ZVFA 3DXBA 4ER8A 4QJVA 1RYSA 2HG4A 4O3RA 5KFWA 4PPDA 3GLJA 4NA2A 3SDEA 4TVAB 1Z4UA 5AE1A 2ZKTA 5DJBA 1ZETA 1JLAB 4ZVTB 4LVOP 3CJ5A 5I42A 3A4TA 2R42A 1BC6A 2C3YA 1RTHA 3AJ2A 3QSYB 2YNIB 4CLLA 2HWHA 4ILLA 4QPXA 2HGLA 4PR6A 2FZGB 4NCAA 2BOAA 4QOTA 5CZXA 3UN5A 5D3GB 2YWGA 3OV7A 4PXCA 4WCEQ 4DX8H 3QZ8A 2LFVA 3KLIA 2A1BA 3Q86A 3RBDA 1S72S 4O3SA 3ZZUA 1UPMB 4ZLNA 2K2PA 3GWCA 2OD4A 5HP1A 5B0GA 2RKIA 2BQUA 3TAMB 1HMVA 1LOUA 1A0OB 3FUYA 1ELOA 2X1FA 4K5SA 3QGPA 1LK5A 3BSAA 4K0KF 4F26A 3M8SA 4DV5F 1CBKA 4C98A 4WBFA 1FT8A 3OHAA 4ZLLA 5HLFB 3SI8A 2QZ8A 1IKYA 2GIQA 4LBIA 3D5MA 2VPYB 1R3NA 2HS3A 1ZM9A 3MTKA 4PG6A 4YDXA 1X0PA 3BO2A 3LP1B 2RIJA 2M8HA 3QRRA 2M3DA 4RBTA 2KJVA 1QJHA 2V5HG 2OH2A 1HQEB 4JI1J 2F8MA 1N36J 3TZXA 2LA6A 2FJDB 1GTHA 3PX6A 3AAWB 1S49A 1I3OB 3S01A 3F44A 4RW4B 4OJ3A 4ES2A 3DKDA 3W5XA 3FSIA 2J0XA 1UJ4A 2ZOFA 4DQIA 2RQMA 3BQ1A 1H0HB 3QO9A 2BJ3A 1C1CB 3PZPA 1KQKA 4M5JA 1B3TA 2QA1A 4CO3A 5F3ZA 5F3TA 2HMIB 1WI6A 3KLGB 3G6YA 3PYFA 3WZ0A 5J1NA 1RHQB 2GHPA 4A8WA 2KU7A 1FKOA 1VIXA 4U7UK 4ILRA 3I0SA 4DR6J 3SSQA 2AV5A 2UUBJ 4E8UA 2RDJA 3BBBA 1VQ4S 4HDHA 1ZPWX 3W8PA 2Q43A 3VR1A 7AT1B 4R0JA 3D1HA 2E66A 3LAMA 1JNZB 1UZHA 4Q8FA 3AFGA 1ITPA 1PYOB 5GAGU 5K20B 2Y0BB 3WBZA 3M2UB 3TA2A 4RJVA 4JYAJ 4RBUA 4G1PA 3TWZA 3FQLA 1WI8A 2V6AA 1UA0A 1KLMB 1WC1A 3LP2B 1CEZA 1GAOA 2YWEA 3U7JA 3O3LA 1WHVA 2HVHA 4P73A 3I6PA 3AHPA 1S79A 1KHVA 2IVYA 1FEEA 2DGQA 2RQCA 2MQOA 4BC9A 2GVZA 1RTIB 3K17A 1FFSB 3QRPA 2FTRA 2EG2A 1OPZA 4LF5F 1BQMB 1HPZA 1WG5A 3E01B 1J5EF 5AJ3F 4HI2A 3DLEB 2KFYA 4H4MA 4NCGB 4WXWA 2KG0A 1R31A 3W66A 2BEFA 1OMSA 2BW7A 2B7BB 4D3HA 1Q0NA 4WWSA 2GNKA 3TJ8A 3S6EA 4CLYA 3GFZA 2MLXA 2HBRB 4DSFA 2V94A 2VF3A 1FI4A 5C5JA 3FSXA 1KVKA 3QT7A 3HJFA 2H65B 3KWMA 4X66J 1U1RA 4C11A 4ELUA 3GIJA 3KHRA 4W4MA 3DOLA 2B9EA 1ZBTA 5CHCB 2MY8A 2W8LA 1Q1KA 3KUEA 1PJ5A 4GC7A 2V8VA 1NKEA 2H3EB 1I94F 1BWEA 2FZKB 2VOOA 4ICLB 3J81U 4WIIA 3RR8A 4FVMA 3W1YC 3W61A 4HT5A 5D77A 1YTYA 3KK1B 4LRFA 2DIVA 3C66A 5KFEA 4AQYJ 4J9NA 2KT5A 4Y2AA 2IVFB 3L4BC 4ZK7M 2N4DA 1AYEA 2FD2A 3P3DA 2IJNA 3J7ZT 4F2RA 1U1QA 2CKWA 3I0RA 4OZ2A 4BLGA 2YVSA 2GVDA 2DH9A 4FF2A 2KXHA 3GJTB 2UVUA 3HVTA 3MM9A 2F65A 1U8SA 1N33F 1Q53A 3A3PB 2B8PA 8ATCB 4N56A 5LSLA 4PG8A 5F9LA 3HFVA 4YDDB 4QW8A 3V6DA 1BD6A 3U1LA 3T5KA 5H9FJ 3Q8YA 2RD5C 1IBMJ 1TUGB 5LMUJ 2GGPB 2P5VA 3CDBA 3NGSA 2WK4A 3QT6A 2OTLS 1BGXT 3KG0A 3OR2A 4DCPB 1QDUB 5A6PA 3NNAA 2B4VA 1KRPA 2CQCA 1WG1A 2RRNA 3PACA 1W26A 2D3UA 3CWJA 5CYJA 5C2CA 1PILA 2AYMA 3A3OB 2AZ1A 1L3UA 1Z2ZA 2ZM6F 5ETVA 1OYEA 4B3OA 4V19X 3M8QB 2PI5A 2B0GA 4FVCA 3PKMA 2VJVA 5JJBA 2RSQA 2X3DA 5ETTA 2OSQA 2QA2A 4H4KA 2YQ1A 1EARA 4ZCLA 4EGLA 3DRYA 4HHUA 4NLRA 4YQWA 4H4OA 3SBMA 3GSIA 4ZPTR 1UTAA 4DZDA 2W01A 2WONB 3UDEA 3SIPB 1UP1A 3L7UA 4NXMJ 4LF4F 3MEGA 2E7VA 4JI2F 3CPWR 4L75A 3QJLA 3KJNB 5DQHA 1NDPA 3PJWA 3CE8A 3V81B 5DS7A 2BJ1A 3PVXA 1E6VB 5C2GA 3DDIA 2V9WA 1T11A 1S99A 2HFUA 4NYZA 2DHSA 2LXIA 1F9EB 3G8TA 4B9UA 1WACA 2OFHX 3EXCX 4CM2A 2IYGA 4QWBA 3BDEA 3NWRA 3OTCA 2XMMA 3MM7B 4EZ6A 3LP0B 1RBAA 2IRYA 5HROB 2HNYA 4OFZA 5IT9Y 2CPFA 2YH0A 3EDRB 2XY6A 4F3OA 2HYIB 1DQAA 3MR2A 1D3WA 3ITHB 4M5HA 1GEHA 2MZRA 4J9MA 4CNZA 5I42B 2E5LF 2QN6B 4LF2A 1RTHB 1TMMA 3JSMA 2I5JA 2W2NP 3HK2A 1HBOA 4B02A 3T6BA 1RWMB 2CPXA 1DTQA 3VZHA 2KFZA 3CJ3A 4B3SJ 3KLIB 4GVBA 2W4DA 5HL7Q 3OQ2A 4DPWA 1JXEA 3CCWA 5J2MA 2W25A 5HP1B 4YS2A 2RKIB 4B3TJ 5HANA 2FPHX 2FQQB 2XLIA 2HHHJ 3ISZA 1JKHA 3I82A 4ECXA 2ZH5A 4WTYA 3IO1A 2YKQA 3TANA 4DV6F 2HVDA 4X4SA 2H9ZA 3MURP 1SC3B 2PN6A 5BR8J 4ID5A 1XNRF 4KYZA 2E1CA 4FXWA 1IKYB 2DR9A 2A6MA 2MHEA 3Q8QB 1DZ5A 3RGIA 3RW7A 4JI5J 1FDDA 1NB7A 4V19J 4OYZA 3LH2S 4DR2J 5IWAJ 5D78A 3QGIA 3NG8A 2D9PA 5AE3A 2Z2YB 1L3TA 3T1AA 1TL1A 2CZ4A 2MZ1A 3AOBA 3CO0P 2MEWA 4PWUA 4OHXA 2YX4A 4TQRA 3L3CA 4AUKA 2BJDA 4KE5A 4Y00A 1K1QA 1RBOB 2BR0A 3MMBB 4PUOA 3ZZOA 3DCAA 4O23A 2R7WA 4CT8A 2FLNA 3PO5A 4QIWD 4CM0A 3M05A 2HK3A 2AGQA 5KFAA 2MQQA 2CNKB 3QO9B 1IVZA 2F1FA 4C3MA 1PBUA 2EEYA 2XM3A 3GZ7A 3SFUA 3MFHA 2YBVA 1VYAA 2Z56B 1FKOB 1SL2A 2KHCA 2XO7A 2R7SA 1EKSA 1UVNA 4EUVA 4C6AA 2J7UA 4QQBA 2HFOA 3F0NA 4DPUA 3TYTA 2OMLA 3BGUA 2ZUAA 5D8HB 3NNCA 4TNOA 2PC6A 5B0FA 3ZXWA 3OW2R 4O0IA 1ZM3A 3K5OA 5I3UA 2GJIA 1UETA 5KFHA 2D9OA 1T05A 1XK8A 4K2XA 2UU9J 2E9TA 4FN5A 3D6FB 3I5BA 4QIGA 3CDEA 1F5AA 3JAMY 2ZBIA 4Q8EA 2LDIA 2DNLA 4OV1A 1JWWA 1GXUA 2AMCB 2L9NA 2ZJPQ 2HEKA 3QGGA 2CFXA 5L1IA 1U47A 5L46A 5E3CA 1RHUB 3WDOA 1RB0A 1YRXA 1DQ8A 2H5IB 4M5LA 2HK2A 2GVZB 3OL6A 3N5BA 3ETOA 4A8KA 5T14A 4DL2A 4PABA 3MWBA 4DR7F 4WYWA 4UT4A 3Q8RB 2IA6A 1HPZB 1F5BA 4OHYA 2MMYA 3ZC4A 1HHQA 3KMQA 4H4MB 3V5RA 2CQ2A 2VZ9A 5DETA 3VCDA 4LIRA 3FEZA 4WFBQ 4DV7F 3EZ5A 2UVWA 4KQZA 3OFGA 1IBLF 2HRTA 4N41A 4PAAA 3GFHA 4C11B 2V0NA 2LU1A 1OJ4A 3DOLB 5I4MA 3ISNC 2BKNA 1WHYA 3IAS9 2VQFJ 4Y0FA 5G0RA 1V6HA 4IQMA 2WSCC 4K8RA 4FKYA 2DCUB 4PWDA 3S7RA 4N77A 2W1BA 3MUTP 1VISA 5D0EA 1UJ6A 2NUUG 4USMA 5K9FA 2CQ0A 3UDVA 4BCAA 5ETQA 1RAOA 1S5ZA 3DU6A 3FZ2A 3CDAA 4CH0S 4ZMMA 2Y8YA 3RB3A 3N6LA 4FYYB 2FIUA 3I0RB 4USWA 4B08A 3G87A 2GVDB 2W7OA 2VODA 3HVTB 3T1YF 3MM9B 1WC0A 2C2DA 3WHIA 2ZUGA 2FJBB 4P75A 4OZ3A 4AL5A 1XQIA 1SXLA 1S1VA 3V6DB 3CC7S 1U26A 3BS9A 2FHOB 5HI7A 3CCUS 2UP1A 1XR7A 1M1HA 2UV8A 4UOHA 3GYGA 4NLWA 1CQMA 4RL1A 2ZH7A 2GMHA 3HVRA 5A6WA 2AW0A 1Y00A 1D8ZA 3NS5A 3HFZB 4XAKA 3MMJA 5KG4A 3TVZA 5CQGA 3OR2B 2CADA 2ZKUA 4UZBA 5K5MA 1RKIA 2ZBQA 1IQTA 3AOCA 2V9KA 2HNZA 4NASA 2A2DA 1SJQA 2VKRA 1MWYA 3TZWA 4WIQA 1K73T 5IZHA 1LWFA 1RT2A 3HT3A 1JLEA 3B4MA 4B3OB 2R2RA 5E0OA 2IMOA 3GR0A 2F4FA 3AQPA 4CLSA 3AODA 3ISND 2Z57B 1P9QC 2NCKL 4DL5A 4H4OB 5GADI 2EBGA 3TR5A 1AUDA 4IR9A 3HKWA 1N5SA 3ZTQA 2VFRA 5SUHA 1M5OC 1T9YA 1H2TZ 5KG7A 1HI0P 3QWPA 4DPXA 3ZZRA 2N7YA 3LA0A 1QVGR 3MEGB 1ZTTA 1HYSB 2HURA 4MKVA 2B9YA 5LT5A 1SJ4P 3OTDA 3CCQS 2A3JA 1M90T 3CC4S 5IXUA 4JI7F 5KT6A 4ERDA 3LGHA 2YPZA 2CZ9A 2OPSA 4DL7A 4UF4A 2B9WA 3BBCA 2CQ3A 4RZRA 1VRUB 3VAFA 3CIMA 6FD1A 4J9QA 2R3VA 5RUBA 3G6XA 2IRUA 3OT9A 4CI0B 5L1JA 2XHCA 1RA7A 2E5IA 1KEKA 3K5NA 1UVKA 4X62F 1RE1B 4NLTA 1TKTA 4OI6A 2IDEA 3ULHA 3AXMA 4ZPBA 4EO8A 3BH7B 2IBKA 3ONQA 5HBMA 4PG7A 3BGOP 4OJ1A 4DX6A 4CQ1A 5EWGA 1AW0A 2J9DE 1QAJA 3CF5Q 1QSLA 2ZJQQ 4B3RF 3JSMB 3H5UA 2I5JB 3GYXB 1LW2A 5F8HA 4IOCQ 3GJQB 1HBOB 4U95A 2LU2A 1U0HA 3IRXA 1DTQB 1U1KA 1EHWA 2DXEA 2DNMA 4K0KJ 2G4BA 3SQGA 1N52B 4DV5J 4GVBB 1RAGB 1BWVA 3LUYA 1OY8A 4KPYA 2PMZD 4DQSA 3UE2A
chains in the Genus database with same CATH topology
4LSLA 4RW6B 5EDWA 2EG1A 4HT7A 4AYBD 4DV2F 4IDKA 1IUJA 3M2UA 4C8ZA 1F2GA 4NYOA 3H4DA 4DPOA 1H2VZ 1HNXF 2NR0A 3CVKA 4ZCMA 2D41A 2GMJA 3D1QA 1Q82T 4HEA9 1Y7PA 1S6PA 2YWHA 3KNGA 1JKHB 1U4BA 1CSJA 4RW8A 3VAKA 1KHWA 3H4BA 4FZVA 1KLMA 2KFNA 2YWKA 2IC3B 3CDUA 4U67Q 3LP2A 1FNOA 4YUDA 1KFSA 1YGYA 2O5DA 4WZQA 3UDLA 2VC0A 2E5JA 4IFVA 4MIWA 1FDNA 2RNEA 4DJBA 5H1SV 5DDPC 4OHWA 4X4RA 3Q8SB 3CMAS 4DQRA 4OZ1A 1KNZA 1TR0A 3M6XA 1C0TB 4LSNA 4WYLA 3KJVA 2F9DA 3B8HA 5EWFA 1RI7A 2CPJA 2HS4A 3N4WA 1X5OA 4WE1A 3K8VA 4C97A 2OPRA 2VG6A 4JV1A 3OXGA 4ID5B 3NNHA 3PDNA 5LL6d 2PT0A 1JLQB 4M1KA 2QIFA 4QBUA 3BZQA 4OZ5A 3PW0A 1CVJA 2FJWA 4F2SA 1WTBA 3V6JA 1MROB 1RTJB 1FD2A 2DCLA 1FE4A 1S6QA 1FCAA 1R0AB 1VRTA 4ECYA 3MPVA 1S0VA 4Y65A 1YJUA 2DRAA 3F41A 1KONA 4I7FA 1RTIA 1X4HA 3QYYA 3R5AA 2WSEC 1R8BA 3LF0A 2E9ZA 4P6QA 2B43A 2FLPA 1RT4B 2E7WA 1S6OA 1MU2A 3AJ1A 3V6KA 4IUFA 1SC6A 2A10A 3KLVA 2HIQA 5HO4A 5I3QA 3M9OB 1S1TA 1QAIA 2NREA 2M7SA 5CYMB 4FBUA 3EXYA 3B4DA 3I5AA 3SV3A 1H38A 2ZOMA 3G8QA 3HMJG 4NXNF 2M5YA 3GIIA 3DHXA 2VBYA 2DD8S 2HAIA 3E01A 1VS3A 1WEXA 3E3XA 3M4XA 2UUAF 1S10A 1HBNB 1HWKA 3DLEA 5EX3A 4C8OA 2J7KA 5B08A 1TV6A 4DDFA 4LSLB 4UY85 4NCGA 3V4MA 2LVWA 4RLEA 1N34F 2DPJA 2MKCA 1NJZA 1DHMA 3AB4B 4NCBA 2GMLA 1JLFB 2BRKA 1RAJA 3FDSA 4HDGA 1S77D 3OJUA 1TL1B 5F8IA 4NMLA 5CD4H 1X0FA 2L3MA 4LFBF 3D28A 4TQSA 1N56A 4J9KA 2FUG9 2VA3A 5DLFA 4KIAA 2UXBF 3CCZA 4DSLA 2XG8A 1S9EB 4PCQA 1Q78A 4IFVB 2Q66A 2R2SA 2MSSA 2F4VF 4DFKA 2PFFB 1TL5A 2KM8C 3HX9A 1RT7A 4HL9A 4PKDB 3M32B 4YB6A 1J5OA 2R7VA 4B9VA 4JUZA 1HBMA 3CJ2A 3TRGA 5J1EA 4PUOB 5KFTA 1QAXA 2BW2A 2IRXA 4GKKF 1R89A 4YHHF 2FB0A 1FK9A 2JH3A 2BE2A 5A2QY 4DV0F 1HNVA 1NK7A 4KTQA 2FHKA 1FE0A 2KHDA 1N5TA 4ZP7A 2KM8B 1U1NA 2H5EA 2BOPA 1Z2LA 1RT6A 1LW0A 3MM8A 3CJKA 3BSOA 5DGBA 1WD6A 3MMAB 5CZVA 1YHQS 1AFJA 4URGA 2C3MA 3OHBA 2VFSA 3H2UB 2G1DA 2E1RA 2XBPA 4C4WA 2NS1B 3FVYA 4ZHRA 2MQPA 5KG5A 1VBYA 2EWHA 4RNNA 4XPEA 2C2RA 1TAUA 2C3UA 3IS9B 2M52A 1TK8A 1FRXA 3CXCR 1RTDA 2L9WA 4LQ9A 2HVZA 1YITS 4I2QA 4F3QA 5DQIA 3T5LA 5BYQA 2DT9A 4EBEA 4ED2A 2XY7A 1SBRA 3NWGA 1JLGB 4ICLA 2Y1IA 1HHTP 1N32F 3C3LA 3R1HA 1TV6B 3OFHA 1QAYA 2A18A 2LCWA 2FHMA 4OIXA 2FY1A 3HVWA 2HGMA 2DRBA 1NEEA 1VQYA 3TARA 1DLOB 3THTA 3KK1A 2PO4A 1SL0A 4DV1F 2IMWP 3MR3A 4AFFA 4C8NA 1O0PA 4OZLA 4QIEA 1L3KA 4M94A 2B6AA 1FJEB 4K50A 2QT7A 3UW1A 3HI9A 1DBDA 2L9DA 2R7QA 4ZVEA 1GXLA 3NBPB 3Q8PB 4N76A 4NPOA 3H5SA 3M30A 2U2FA 4OJHA 2RT3A 4M8LA 3V6HA 1ZH5A 3F56A 3KTQA 3HLUA 3NGKA 1N5QA 3HPOA 4IR1A 2JLGA 1S7HA 1YI2S 4O3OA 2UUCF 4RWXA 2RE1A 4J9PA 5CCMA 1R7IA 3DRRB 1UWBA 4GO7X 3ENVA 2GA7A 5B0CA 1SJ3P 3D2WA 1C4CA 1CG2A 2OPQB 1SB6A 3OTOF 4RUCA 3VTIA 4R0EA 1X4DA 2HFZA 5I3UB 2KZZA 5T7LB 4HKQA 3I56S 5ADZA 4ZP9A 1HWJA 2LXFA 3DRXA 3TUZC 3PO4A 4BC7A 4M95A 2MJUA 5DDOC 3PFOA 4U9RA 2AWZA 1XN9A 4OI1A 1ZM4A 1H6KX 3TUJC 3LW5C 2ZITA 1T05B 3RW6A 3LOUA 5K8OA 5DG9A 1WF0A 2UUTA 3GV8B 3JSYA 2HQ3A 1CQNA 2YKPA 5KFLA 3TA0A 3SFGA 4FF3A 4FXVA 2E5GA 4QIVA 1V3SA 5LXRA 3RYLA 1HQUA 1UA1A 4HTIA 2D7SA 2PSZA 4RW9A 3JTNA 4EBCA 1S9FA 3H59A 5KFSA 2YX7A 5A8WA 4EEYA 4X64F 1U1LA 3MHYA 2W24A 5J2QB 2GHVC 1R8CA 2GGPA 2OD6A 2JFKA 2OSRA 3IG1B 4Y3CA 3PX0A 2I2YA 2OJ3A 2HGNA 3CSKA 2CJAA 1XC9A 2PGCA 2VC1A 1ZYQA 4Q45A 1MNEA 2E9RX 3PV8A 5H9EJ 2ASJA 2LDYA 4ECUA 1KLNA 2J6SA 4DHVA 2CPDA 5CA5A 2C3OA 4ZA1A 2BVZA 2OP5A 2QA4S 4C0HA 3DM2A 2R2TA 3M8PB 1FVSA 3Q0AA 1A9NB 4IRKA 2K8GA 4NWBA 3H2LA 3DI6A 4NOHA 4URSA 3ZZZA 2ZHAA 1D1UA 3RRHA 2P6TA 3POTB 2ZJRQ 4IOAQ 3C6UA 3MZIA 3TW0A 4OI3A 4C3LA 1RK8A 1U09A 2DR7A 1KVJA 3UCUP 2WCXA 4K4SA 1S48A 2W9BA 2OAUA 2FHJA 1VIOA 1JIHA 4QZVB 4DR5F 1UVIA 3WC0A 2DK2A 2VQEF 1X5TA 2F9JA 2DR8A 2OTJS 2QLWA 1D0EA 4B17A 3QWUA 3M8QA 3TQ1A 4NZ6A 3T6JA 1FXDA 3HHKA 1LXJA 1Y5NB 5E2QA 3FGVA 2C2EA 3DYAA 5BYRA 1S0MA 4A8XA 5FLXY 4OZNA 2K1RA 2ZHOA 1U1MA 1X4AA 4DFPA 2FJXA 5AXMA 2PA3A 4IH6A 2V8HA 3RAQA 1YRTA 2DHGA 4KB7A 4TLRA 5LXYA 4DV3F 2OPPB 5CXTA 1Q8LA 1TUVA 3R3TA 3OR1B 2IFXA 1Q16B 3F73A 4ZCKA 1U2FA 3FCHA 3DMJB 3O6QA 1JJ2R 3OL8A 2O3DA 4EU0A 3NLCA 4RUAA 1N8RT 2WONA 1SL1A 2IM0A 1U1OA 3UR3C 1H3DA 5D6GA 2ZC4A 2DNOA 1X5PA 2W9CB 2U1AA 2BANA 1KC8T 4IKAA 2AD9A 2J0SD 4B9TA 4I6WA 3K5LA 2M2BA 1N0UA 3W7BA 2E1AA 3W2VB 3VQTA 3UCZP 2XSJB 3G71S 2LECA 1U48A 4C2MA 5G0RB 1JLCA 3MAHA 1X9WA 2KDOA 3OTBA 4DFJA 3IA0A 4W90B 3MUVP 1URNA 3KK3B 1JLAA 4L6V3 4RNOA 3LAKA 3SCJE 1XTZA 4ECSA 3V81A 2YNFB 2XI3A 4ZPCA 1VHFA 2ZDPA 2NSCA 4PWDB 1HFEL 2D74B 1M1KT 4BS2A 1E6VA 5B7WA 4MFBB 3Q22A 2DNRA 3D1OA 4KRWA 2IHR1 2JX2A 3R5CA 4ZS6A 1AFIA 2AJ1A 2FLOA 3CB4A 4RU2A 3N79A 2BM0A 4WKRA 1NAQA 3T19A 2CJKA 4X4UA 1T8EA 1KQGB 3K5MA 3EGZA 3BF4A 3CCVS 4C3KA 1D8YA 2R7UA 1RT5B 1UVLA 3IC1A 5K8NA 1TL3A 1V9OA 4I68A 4NLYA 4ZLPA 3OSNA 2BDPA 3DLHA 2WRMA 4BBYA 2RU9A 3MEEB 3QMQA 1SJRA 4XO0A 1ZM2A 1HA1A 2RRAA 4G6VB 2DO4A 4AXIA 1Y0HA 5DO2A 3JYTB 2CIMA 4CNYA 4FP9A 1DARA 2GQQA 5KOXA 3MM7A 1KSPA 2CQPA 1FA0A 2GFFA 2GJ2A 4RNFA 5HROA 2EFQA 1WELA 3DXSX 4ZVFA 7FDRA 3DXBA 2CG4A 3OLAA 4J9RA 3LANA 4P7TA 4QJVA 1RYSA 2HW3A 2HG4A 3BGFA 5AE2A 4O3RA 3HO1A 1IKWA 4MIBA 5KFWA 4PPDA 3R27A 3M1VA 1EP4A 3IR7B 4NA2A 2OO4A 3SDEA 4NLXA 3P96A 4EFAC 4PRFA 5CYQA 4F8RA 3HP6A 2R7RA 1Z4UA 3GG1A 2Z4PA 5AE1A 2UVVA 2ZKTA 5DJBA 2ZZNA 4ES1A 1P1LA 1ZETA 3CGIA 5KFNA 1IR0A 1JLAB 1RA6A 2B4PA 3VAHA 1VQ7S 4LVOP 2FGOA 3CJ5A 5KG6A 5I42A 3G4SS 3FMWA 4J9SA 4R5PA 1P27B 2XNQA 3H8YA 1S1VB 3NRBA 2C3YA 1BC6A 1RTHA 1BLUA 3AJ2A 4Q0BA 2VD3A 1S9GA 3PW4A 2YNIB 1ROFA 5KT7A 2HWHA 4ILLA 1RKJA 1YJTA 1XNQF 2JSXA 4QPXA 2HGLA 4MAKA 4PR6A 4NCAA 2ZH4A 2PE8A 4ZCIA 4YY3F 4N5SA 4QOTA 4J9LA 5CZXA 2HNDB 4PQUA 5D3GB 1R8HA 1YBAA 2YWGA 3OV7A 4URQU 5B0EA 4PXCA 1ZZFA 3VQSA 4GC6A 4WCEQ 4DX8H 3H5XA 3P49B 4FF4A 3QZ8A 1GNKA 2CPZA 2CPEA 4A8MP 5KT5A 1NK6A 4IG0B 5CH7B 4YB7A 3KLIA 5J2PA 2A1BA 3RBDA 4USHA 1RDRA 1S72S 4O3SA 3ZZUA 1N5YA 2W8KA 5K8MA 3Q2SC 2K2PA 3MD1A 4FS1A 2W7PA 1YJ9S 3GWCA 2OD4A 4DQPA 5HP1A 2DNPA 2W7AA 5B0GA 3OJSA 2RKIA 3K8WA 3LQVA 4CT9A 3PX4A 1JJ4A 4DSJA 4IQXA 1OO0B 2BQUA 2HNZB 1HMVA 3TAMB 2MY7A 3HM9A 2HHSA 4HHJA 2ZZMA 4ECRA 3S8SA 1LOUA 1P8GA 4NLDA 5JUMA 1N36F 3SDEB 1LWFB 1RT2B 3BB5A 2M0GB 5K14B 1JLEB 1ELOA 4CZCA 1KOOA 4IG3A 2MYFA 3CCES 5F8JA 2UXCF 2AJFE 3DLGB 1TK0A 2X1FA 3DNCA 4K5SA 3QGPA 2ZE2A 3L7PA 1S4FA 6FDRA 1LK5A 3BSAA 4K0KF 2X1AA 3KHLA 4F26A 1N88A 3M8SA 1VOMA 3BEGB 4NLPA 4DV5F 4C98A 1Y5IB 2QSFA 4HLBA 4DS4A 4M63A 2XGPA 1FT8A 2LA4A 3OHAA 4GO5X 1UFLA 5HLFB 3HDSA 3SI8A 4YR2A 3QPIA 2QZ8A 1IKYA 2LEPA 2JVRA 2GIQA 3FFIB 4HTJA 4NRUA 1IKXB 3D5MA 3Q2TC 1Q86T 4DSIA 2VPYB 2C22A 3QAUA 2YNHA 2WBMA 5HQ8A 1L3SA 3PRBA 3PW2A 1R3NA 2HS3A 4N47A 5SZTA 1ZM9A 3MTKA 3DRSA 4Z37A 2BZ2A 2QRRA 2XMJA 4PG6A 2XZWA 3QLHA 4M5DA 3E51A 4YDXA 2Q79A 1QE1B 1X0PA 3BO3A 3BO2A 1NK5A 1FKPA 1AROP 1DAXA 4NLUA 1HD1A 2VFVA 1K0TA 2RUGA 3LP1B 3RBEA 1FRIA 2RIJA 3NAHA 4TU9A 4ES3A 2M8HA 4KGMA 3KG4A 2VBWA 2KI2A 2M3DA 2LXUA 2KJVA 3DHWC 1DTTB 1QJHA 2V5HG 3MECA 4RBTA 1HMVB 3J81Y 2AGOA 3G9CA 1QVFR 1KR4A 2GCFA 2HHXA 2AJQA 2OH2A 1HQEB 3SV4A 1X4EA 4J37A 4X4QA 2F8MA 4TU7A 2WB1D 4OZ0A 1TKZB 1I6JA 1RWUA 2OPSB 2KH9A 1XERA 2EFPA 2JEGA 2NZ4A 2G13A 2LA6A 3FRZA 5B09A 4PXDA 2DIUA 4DR6F 2FJDB 1GTHA 3PX6A 1LK7A 4ZPVR 5L1KA 3N0VA 1UAWA 5ITHA 2MQMA 2KXFA 1TKXB 1FDAA 3ENWA 3EUNA 3O2IA 2JC0A 4NLQA 3AAWB 1S49A 2VA2A 3S01A 2V4JA 1LFPA 1K0VA 5KFQA 2P9CA 3T5HA 5BJRA 2HHTA 1G2EA 3F44A 4RW4B 4OJ3A 2APOA 1S0OA 4ELTA 1TQLA 2FJVA 4JBCA 4QR0A 3CJ0A 1FXRA 1S1UA 4O44A 3H25A 4MK8A 4ES2A 4O4RA 3LGMA 1U6FA 3NMAA 4EBDA 4ZVHA 3J80Y 2XNRA 2FVCA 3LPYA 2LEAA 1KQSR 3FSIA 2J0XA 4DWIA 2KVIA 1Y3JA 1UJ4A 2XY5A 1WHWA 4JI0F 4Y2KA 1EETA 1SUQA 2ZOFA 1TKTB 5D4OA 1SKWA 2DH7A 2LQ5A 2RDIA 1N5VA 3BM7A 4DQIA 2DJWA 1SI9A 3HHNB 2RQMA 4USJC 4A46A 4DG1A 4IRCA 3T5JA 3CIZA 1TAQA 4DUYF 4JYAF 1D9AA 3SXLA 2EFVA 3BQ1A 2W4CA 2JDJA 1H0HB 1IKVA 1VK3A 4IH7A 1SV5A 3QO9A 1FRJA 1C1CB 3PZPA 2D1CA 5HBMB 1C1BA 1FNMA 1KQKA 1LWEB 1RT1B 2QA1A 4UQTA 4CO3A 2UV8G 4TY8A 5F3ZA 4TKTA 4LF6F 4F4WA 5F3TA 1MMDA 4PXBA 2IJFA 2HMIB 1WI6A