4C3LA

Structure of wildtype pii from s. elongatus at high resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
89
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
molecule keywords NITROGEN REGULATORY PROTEIN P-II
total genus 18
structure length 89
sequence length 106
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4c3lA00
5D4PA 1V9OA 1GNKA 1O51A 4YB6A 1PILA 3BZQA 4CO5A 4R25A 2V5HG 4E98A 3O5TB 3DFEA 3LF0A 3X3UA 1KR4A 2NS1B 2GX8A 4D3HA 2ZFHA 1NZAA 1V3RA 4CO1A 4WK1A 4IYQA 1NH8A 4CO4A 2XBPA 3OPKA 1UFLA 3NCQA 1H3DA 2CZ4A 1UKUA 3AH6A 2VD3A 4OZJA 2J9EA 4OZLA 4CO2A 4Y6IA 3MHYA 4RLEA 4CNZA 2J9DE 5DRKA 2XZWA 3CE8A 5D4OA 1P1LA 2JJ4D 3O8WA 4CO0A 3GSDA 3AHPA 5D4NA 3TA0A 1O5JA 4OZNA 4C3MA 4CO3A 4CNYA 4NYOA 4D3GA 2XG8A 3M05A 1OSCA 4ZK7M 1QY7A 2Z0GA 1V6HA 4RWWA 2PIIA 1UL3A 2GNKA 4C3KA 4YB7A 4RWXA 3TA2A 3NCRA 4C3LA 4NYPA 2ZOMA 2NUHA 4USIA 2NUUG 2O66A 1VFJA 4RX6A 2EG1A 1NAQA 2J9DA 5D4LA 3L7PA 4AFFA 5L9NA 3HLUA 2GW8A 4Y65A 1VHFA 3N5BA 3T9ZA 2E66A 2XULA 3AA9A 3TA1A 3AA8A 1UMJA 4WK3A 1J2VA 1V3SA 2EG2A 2J9CA 1Q1KA 4USHA 4USJC 1XK8A 2O67A 3NCPA 2DCLA 5DS7A 2RD5C 1HWUA 1NH7A 4YB5A
chains in the Genus database with same CATH superfamily
4F50A 1P9YA 4DR7F 1S9FA 1FRHA 1K0VA 5B0CA 3G6ES 2BANB 4ZLLA 4ZVRB 2QL5B 1PJ5A 1HNWJ 5FJ4A 5L1IA 2QA2A 2GMJA 1SIWB 4NZ6A 3RB6A 3LOUA 1RA7A 3KG1A 3WX4A 2K06A 4RBTA 2OSRA 3KK2A 1VQLS 4F0KA 3FSIA 1M5OC 1IKYB 3PJ9A 3DM2B 2MQ8A 3HKZD 5J1EA 3PR5B 1KD1T 5B0DA 3CCWA 4AUKA 3H4DA 2OHDA 1SV5A 1YJ7A 3LUYA 2DYAA 1TL3B 3QGPA 2VODA 3GCWP 2PA8D 5KFYA 1RACB 4GO7X 1FJEB 2UP1A 1WOOA 4NI2A 4WU2A 5HQMA 3OUYB 4WIIA 2F63A 5CYQB 3K89A 1TR0A 3NGTA 3M6VA 2ZUGA 2HYIB 2GCFA 5KFXA 5SUHA 2YY3A 3NWGA 4NMLA 3H5UA 2AGQA 2ZH2A 5DDOC 3VWSA 2IJNA 5A8KB 4CWBA 4O3SA 2HVIA 2UVWA 1UFWA 2V69A 2W25A 4IG3B 4JP8A 4TVAB 2BJ7A 5CHCB 4UOGA 1JLFA 1RXOB 3DCAA 2XCPA 3QWPA 2YQ0A 4UT4A 3ADAC 3TNVA 3JSMB 3Q24A 2EK1A 1FWLA 3PYFA 4KPCA 5D0GA 1MROB 3H20A 2J5AA 4FP9A 1NEEA 1P27B 3MCMA 2BW2A 4ZP9A 3EPGA 1ZH5A 1FD8A 1E6VB 1JLQB 4OYPA 3SSRA 3SV3A 1FKPB 2CDQA 3UDCA 4N41A 5E3CA 2R7XA 2JJ4D 4ANCA 4DF4A 1HQ2A 2V34A 3GSDA 3UI3A 2IVMA 4LBPA 4LQ3A 1TKXB 3MFIA 1PC4A 3HD1A 2HHXA 2C3MA 3QO9B 4MK8A 3CDWA 2YWEA 2HAFA 3W8GA 4J9SA 1CLFA 4CT9A 4PPDA 2P8IA 2HNYB 4WWSA 4OZ0A 5AXNA 3T1YF 1D9DA 2QYCA 2ADCA 3EE3A 5D3GA 3H0PA 2DITA 1TAQA 1N32F 1UWBA 2RHSB 1RAEB 5HROA 1F3VA 1KP6A 3TYTA 1U1LA 2J6SA 5HVGA 4LMZA 2N7CA 2H4WB 5L8RC 2C2NA 1VQPS 3H42A 5JJBA 2PFFB 3KYLA 3AODA 4A8KA 5D78A 4DG1B 2HGNA 5GADU 1MWYA 2IBOA 1N8RT 1JXLA 3DLGB 4R8UB 4KE5A 4LQ9A 3KOAA 2ZKTA 4I0WA 4M5DB 2RQCA 4IG0B 1FT8A 4HTIA 1ZPWX 3I4HX 1Q8BA 3KXDA 3NG8A 3NWRA 2E5JA 1OO0B 1YJNS 2EG1A 2QYGA 2X1BA 3GIJA 5I3QA 1CJUB 1SC4B 2EEYA 3ENVA 3KG0A 4LRDA 2KFZA 2HNYA 5H9FJ 4EZ6A 2JNJA 3EMTA 3ENWA 2WW8A 5U47A 1B0PA 2UZAA 4H54A 3RJMB 2B56A 1PBAA 4MK7A 4LRAA 4J9QA 4AL5A 1TKXA 1WORA 2CIMA 1F9FA 2D3O1 1N56A 4O3PA 4LF5J 3BYRA 2ZE2B 1YJVA 2KG1A 4C0OC 2DPJA 4OJGA 1XK8A 2FJXA 4JV1A 1YJRA 2NREA 3I0RB 3I5CA 2KXFA 3P5BP 1DFDA 3U02A 2WK4A 1A0OB 2IM3A 2VPXB 4LFCF 1KVJA 3N01A 4OJHA 1LKZA 3JSRA 1D9AA 2X7IA 4YB5A 2J0WA 3ZZYA 4W4MA 3DLEB 2HHVA 4DMZA 5KFWA 5KFFA 2HVZA 1I5OB 1REVB 2F9JA 2NZCA 4WCEQ 3CGIA 2C2DA 2LEAA 2OEMA 4TU9A 2X1AA 4P7VA 5JMNA 1NK7A 2V2VA 2JZ5A 2HRUA 2RS8A 2GO8A 3POTB 1AROP 3OUYA 3NLCA 1U8WA 3IN5A 1X0PA 2H5EA 5K14B 1RAGB 2AT1B 1W2IA 3LF0A 4P52A 1MROA 1SJQA 5E33A 3AD7C 3IM9A 2NS1B 1IKWB 4MTPA 2JC1A 3F41A 1CJTB 1DJ0A 3BH7B 3PM9A 1QAXA 1U0HB 3IBCB 3SDEB 1OY6A 3LP1B 1SC6A 3C15B 4N56A 5DM6Q 2VG7B 2FY8A 2YQ3A 2UUBJ 4GKJF 2J6TA 3GR0A 4DUYJ 4ECSA 1NKBA 1R3NA 5HI7A 2R7WA 3T3FA 3R1LA 2D3OR 5LMUF 1Q81T 4CO4A 1IKYA 2HBQB 3KDNA 5J1EB 2VQFF 1RTIA 3LA0A 1WG1A 3JSBA 4YR3A 4ECWA 3JB9k 4DV6F 4DR2J 5DGBA 2N3LA 2YNGA 2ZH1A 3Q2TC 2RQMA 3RTVA 2A10A 2KYXA 4MKBA 4USUA 1KQGB 2MKHA 2QMWA 3RAQA 1SBRA 3PCOB 3QSYB 2LECA 3ZTSA 4C0HA 1Y5IB 4PAAA 3VQSA 1TELA 4LF4J 1XNQJ 1S6QB 3TVYA 2GAGC 3CJQA 3ISZA 1JXEA 5GAEI 4ZITA 4KV8A 1YJ9S 2HZVA 1X8DA 4IKAA 3HO1A 1X4DA 4RLEA 1IBLJ 4LF6F 2ASDA 3D0GE 1UJ4A 4HTJA 1G6BA 3PEHA 2PA3A 3CUNA 4X2BA 1Y5LB 2HBYB 4HHUA 4TNOA 2XZWA 1KHWA 1FERA 1C4AA 2HRYA 1S1UA 1VHIA 1RI7A 3GLJA 2OPPA 3E01A 5IQQA 3ZZZA 4DV1J 1HNZF 2NYHA 4BS2A 4PXEA 2HZCA 2IC3A 1EKSA 2W24A 3L7UA 2AYEA 2OEJA 4OYXA 1JLEA 1RT6B 5KG1A 1FFSB 1MLAA 4YY3J 4DR3F 4Q8EA 4CDIA 4ED0A 1PAUB 1IM4A 3UPFA 3Q86A 2XLKA 4DI6A 4DUYF 1TL7B 5LSLA 2YWHA 5G0RB 2XG8A 5LSOA 2WB1D 5IT9U 3FEYB 3MECA 1VDHA 1Z2LA 2Z2YB 4K59A 3TW0A 4ZK7M 3H25A 3DMJB 3BO2A 3PX4A 4RWWA 1MNEA 4DV6J 3N6NA 4NLRA 4DV7J 4DR2F 1R43A 4ED5A 2BM0A 2AYBA 5F8NA 2CKWA 2EI5A 4N5SA 2AD9A 3TZZA 3ISNC 3PIOQ 2IM2A 4OX7A 1LWFA 1VR6A 4NEZA 1KONA 4IQMA 3RBXA 1U1RA 2G0CA 1TVRB 1VRUB 4IH6A 1XNQF 2HS4A 1F9EB 1FD2A 1S6UA 2PT0A 5HQLA 3Q83A 4F4WA 2QGFB 4PWWA 2HFVA 1U24A 2O66A 2MQOA 1D09B 3BH6B 3JQMA 1LXNA 4QIWD 5KFNA 1T05B 1RTJA 2C22A 1NK9A 2HHPA 1IKVB 4B9LA 2PEBA 4Y65A 1NSQA 1K73T 2LXUA 5KFHA 1JWWA 3HJVA 1LWXA 1RT5B 3T9ZA 4ALZA 3AA9A 1JLGB 3A4TA 4ES1A 3AA8A 2DHXA 4NL5A 1AW0A 5GAHU 2DCUB 1WOSA 1N6QB 1QE1A 3HJFA 5KT3A 2IA6A 1T03B 1TUWA 1SIZA 2J7WA 3GFZA 3CF5Q 3RRKA 3J7YU 3CVKA 3NXZA 3D67A 2KRRA 3KUHA 1GTEA 3NCPA 3TZWA 1XNRJ 2AJQA 3IM8A 1IR0A 4LF8J 2RS2A 1JLGA 3K59A 1N52B 4S0MA 1A6LA 4EWTA 1NK5A 4DQSA 1TK0A 4PUOA 4K4VA 3EGZA 2QL9B 1RAJA 2DHGA 1I94J 4WFYA 4KRWA 4ICLA 2HFOA 1AXQA 2MKIA 3MD3A 4CLLA 1ULRA 2K2PA 1WG4A 3ULHA 1O51A 2QLFB 5IM0A 2HHSA 3PACA 3OTOJ 1PBUA 1N6QA 3PW2A 3G86A 1T7PA 1R0CB 3SEOA 1VRUA 2A2DA 4X62F 5K8NA 2HWHA 3UE2A 2DO4A 1FJCA 1MW7A 2EBEA 2GX8A 1PC5A 2OGUA 1R0AA 2O1PA 3TAPA 2OSQA 4RUBA 5H9EJ 2DK2A 3D7SB 2ZFHA 3EJMA 2OP5A 3PRVA 2IA0A 1B0VA 4JB8B 4FYYB 4P6QA 5BYRA 3KLEB 1NXIA 1WJ9A 4B9TA 2CJYB 4ZJLA 3KLHB 2DNNA 4DR4J 4OLPA 2NPFA 2C3YA 3VHQA 3T6JA 4WZQA 4W90B 1P8GA 4WFZA 4J9VA 3M8SA 4ELUA 3NCQA 4L75A 5KFQA 4DR6J 5A6PA 3PVXA 2G4BA 4U67Q 5KFRA 1Q7YT 1KRPA 1WEXA 1JLBB 3MMAA 4DPXA 3AXKA 5F8MA 1X7VA 4A4JA 1I94F 1RTDA 3MF5A 1Y5NB 2M2BA 2Q6BA 4OZLA 3QIDA 2ZM6J 2BKOA 2GV1A 1GMWD 4WXWA 3N79A 2VG5B 4GVBA 4FVCA 1M5SA 2YBVA 4FYWB 4NLPA 4DV5J 5DRKA 2H48B 2MY7A 3IP0A 2VQEF 4N77A 3GV7B 1IWAA 4LR8A 2GJ2A 2HS0A 5HK4A 1FRIA 1R6YA 3MPVA 4O3QA 5EGYA 3EVMA 2B7CB 4H4KC 1LOUA 4ECRA 2VHGA 4CYUA 1SKWA 5D4NA 3TUZC 1L3VA 1NLKL 4DR5J 3TAMA 2CQGA 4L76A 4ZVTB 1FWPA 5GAGU 3CCZA 2ZBQA 2ZJPQ 2B43A 1U2CA 3CO0P 4ZVGA 1S1UB 3ZZPA 3H2VE 2CPFA 3RR8A 1QY7A 3GV5B 1P1TA 3IWNC 2UXBJ 3LALA 5HMYA 4DFPA 1TTHB 2RMLA 3CSKA 2YKPA 1NM2A 3W9HA 5C42A 4R0JA 3CEDA 3HD2A 3KK3A 4HACA 1K0TA 1PSDA 1T9WA 1DQAA 2IIHA 4TKTA 3MEEA 3M6WA 3H5SA 1FFGB 3UFCX 4DQRA 2ZVSA 4JI7F 5A0YB 3HSZA 4EUVA 1BLUA 1HQEB 1R8HA 2HGLA 4X65F 5HANA 5E41A 3POTA 4DV5F 4M5GA 3UCUP 2PMHA 4KQZA 1RT2A 1N4LA 4KBIA 2UVRA 1REGX 3GG1A 4DL3A 1N32J 3MEGA 3GB0A 1ZM4A 2J9DA 2R7RA 1GMWA 3CCUS 2FJBB 2QT7A 3PJWA 2GVZB 4OLOA 4DFJA 1L3UA 1D8ZA 3DHWC 2BYCA 1XC9A 2HHTA 2EFNA 2VG7A 2YNIB 4IDKA 2RHQB 3GG0A 5EUHA 4XIUA 1RU1A 1X4HA 3I55S 2CPYA 3M8ZA 4RW6A 3ZZRA 2KI2A 4IO9Q 3UD3P 4EYIB 4LJMA 1YIJS 1UVKA 2OPQB 3BBBA 5KFAA 2CZ9A 2J9CA 3DRPB 4USJC 4EZ9A 2UXBF 2YNFA 3T1HF 1NK4A 4C2MA 1S0NA 1F0XA 2OO4A 3RBZA 1F3FA 5HP1B 2CQDA 1TUVA 1JLAB 4ZJOA 4HDGA 2D1CA 1U49A 4QIGA 3ELHA 3IAM9 2BE2B 3I0SA 2DH8A 3DLEA 2BEFA 4EU0A 2YVSA 5KG2A 3D6TB 4F4YA 1X9MA 2F65A 3GIIA 2I1RA 1WOPA 4CQ1A 1A9NB 1CJUA 1S0OA 4ZLJA 1IXKA 1ACMB 2WBRA 1JKHB 5AT1B 1YZ6A 2ACYA 3J80U 4ILLA 3BZQA 5CYJA 4DL6A 4FPRA 5FDLB 1SKRA 2FVQA 4O23A 5J2QA 5DQGA 1U4BA 1S76D 4LF2A 4A46A 2P6SA 4O44A 3ETOA 1WC1A 1VK3A 1YZ7A 2Z56B 4YHHF 1SH0A 5CZXA 1RDRA 5CA5A 2Y9HA 4UF4A 3U1NA 2BE7D 3MM8B 1D0EA 2QLWA 1RWKB 4OL8A 4DR1J 3RB3A 5CABA 4YB1P 3DNCA 2C2RA 1B70B 2PD1A 5KG3A 2QSWA 1DTTB 5L38A 2QN6B 4OJ3A 4WK1A 4IYQA 3Q2SC 3T5JA 5D3GB 4JI2J 3M4XA 4RW8B 1R8BA 4ZVQB 2RILA 4KR0B 4Q2LA 3PW7A 2ZH9A 1NJYA 2DO0A 3RBEA 2XMVA 4PG7A 2Q1LA 1G7CB 2V2QA 4BC9A 3MM8A 2J7UA 3ILIA 1D3WA 3DLGA 1V3ZA 4CLUA 2LQ9A 4PXBA 4OX9J 2DXFA 4OZJA 1KQKA 1JJ2R 1UVIA 5F0WA 4GMKA 3R3TA 2KT5A 4QYRA 4ZCMA 2ZD1B 3UN2A 3O44A 1YKWA 2KL8A 2CPJA 3BN7A 5ETSA 1WKJA 3ENAA 3IC1A 3N6LA 2J9DE 1R8PA 3HVWA 3UDLA 5BR8J 4JI0F 1H2TZ 3I31A 3MPYA 2I6WA 2XO6A 2I38A 2B4PA 4J91A 2EFPA 3D4JA 3GTYX 4MYTA 4X64F 2JL9A 3Q8YA 4TLRA 3GZ7A 5EX0A 2DR6A 1I51B 2DT9A 4IR1A 3NGUA 2JX2A 2HBZB 2MDAA 2XO7A 1WI6A 4O4GB 5HVFA 3W3SA 3MEGB 5IC4B 3BF4A 2B9YA 4NLVA 5AXKA 4QR0A 6FD1A 2ZHOA 4M1KA 1GEHA 1HA1A 4NCGB 3QZ7A 3VAFA 4IOAQ 2IRUA 4X4PA 3PG9A 2JVRA 3QT6A 1FTCA 2AV5A 1RK8A 4QR1A 1UL3A 3AAWB 3LGNA 4G6VB 4OQJA 4LVNP 3MOZA 3W7BA 3KK3B 4ZVOB 1GH8A 5ETRA 4DPYA 3FGVA 1RT4B 3MM9B 3QPIA 1NDKA 5AE1A 2WRMA 3B82A 4JUZA 1MU2B 2DNOA 2UUAJ 3D5MA 3IA0A 3GSIA 1IQZA 3MPWA 2VFRA 1WELA 4MJKA 4KV8B 4OYAA 3KLGB 1YBUA 3OSPA 4DN0A 2ROEA 2YKNA 4JV5F 4QR2A 3GJTB 4NI2B 3ZTQA 2C3UA 2L9NA 4F0HA 2W7PA 2KN4A 3OFGA 1RKJA 3RB4A 1URRA 2MJUA 1IQTA 2FY1A 4FF2A 3C2PA 2AW0A 5ETPA 2KZMA 2GZOA 1R6VA 1WTFA 4ECQA 1NSKL 4CLZA 1HFEL 1UCNA 5KG5A 2YPZA 4C8KA 1UW4A 2XZDB 3FRZA 1W2BR 4B9SA 2BV3A 4B08A 5K5MA 2I5JA 1H72C 2Y1JA 1VC5A 3HHKA 1C0TB 4DX6A 3BQ0A 4DS5A 2AX1A 3B4MA 2Y1IA 2CNKB 1VJQA 4G1IA 2Y8YA 4PQAA 4QW8A 1CQNA 3J80Y 1S1XA 3GIKA 4NEYA 1DAXA 1NHKL 1GTHA 2MYFA 4K0KJ 3M6XA 1NK8A 5D0HA 2RRNA 1WC5A 3WBZA 4EO8A 4DQQA 4U8YA 2UVVA 1C0UA 3QRQA 2MXYA 3LQVA 4UZCA 4AYBD 4FS2A 4X4NA 4X4VA 5CQGA 2OD6A 2IYIA 2MQPA 1UVMA 4LF7F 1JB0C 1RCOB 1PILA 2HZAA 3D66A 4IFYB 4O3NA 4K4XA 3LP2A 3V6HA 4JI8J 4FBTA 1M1KT 1WHXA 2MMYA 2VH7A 4QIEA 4B3OA 3M1VB 5EWFA 3P3DA 3PR4A 3ILLA 5LJ5Y 4OYOA 2E1RA 2VV5A 1LFWA 2ZH8A 2ZDOA 3LP0B 3MGJA 2XTJP 1ZPVA 4J9PA 3EGWB 4KJIA 2G0IA 5KFZA 3ICLA 1DBDA 4NLTA 2HFUA 2F4FA 1RAOA 1YK9A 4WBFA 4CZCA 1NZAA 2MGZA 2WVBA 2CVEA 1CS4A 1ZAXA 3EGNA 1T9XA 2VFUA 2KM8B 3OTDA 2DHAA 3R2DJ 3OTOF 1V5IB 3Q22A 4B3SJ 2QTWA 3TUJC 1K1QA 4C7QA 2XHCA 1S59A 4Q7AA 4O3OA 4DX8H 2R8HA 4YQWA 4WZMA 1KBRA 3ZFVA 1CC7A 2IAJB 3UD5A 3HHLC 3N28A 2CZ4A 1ZBTA 2M3DA 3LPEA 1UEVA 3DLLQ 3RRGA 2XB2D 4CT8A 1M90T 2R2RA 1T9VA 1DTTA 2M9KA 3K8VA 4TY9A 1RTHB 3DKDA 5D8HB 3TX0A 3NMAA 2J9EA 2EK6A 5K8PA 3R7BB 1U26A 1QE1B 2LVWA 2V50A 1TKTB 3PIPQ 3QFHA 3ITHA 3WX8A 2KU7A 5KG7A 2ASYA 2B4OA 1T3OA 1IBMF 3HSGA 2CA9A 1SL0A 4NLXA 3CXCR 3QJJA 5AXLA 5LXRA 5FDLA 3KLIB 3NL0A 3NS5A 4ES3A 4QZVB 5HROB 1CVJA 3G8QA 3OL9A 2DJWA 1HNXJ 3DN9A 1PCAA 3ILJA 3D6FB 4B9UA 3QJLA 4LUBA 2V4QA 3KUGA 1SC1B 4LBIA 4MIAA 2CWKA 4LIWA 3NMRA 1G4CA 3MPUB 2VQEJ 2ZWPA 1RWMB 3NBPB 2DHSA 2FVRA 1T02A 5KFKA 4UUXA 1S1TB 3DLBA 2G2OA 2UUWA 2OFHX 1SUQB 2RB7A 3KNGA 2HNDA 3KMQA 4PKDB 3KHLA 4DR5F 3DRPA 2HIYA 1E6YA 4MMOA 1VQ9S 2N3OA 3KFWX 2A3JA 3DYAB 1FRJA 4RW4A 3TA2A 2G9OA 2P5VA 4O4RA 4N7TA 3RGIA 1HWLA 5AE2A 1JJHA 2D41A 2XMTA 4U7UD 2L9DA 2HIQA 3CT9A 1DQ8A 3CJRA 2LXIA 1VQYA 3CJTA 2M88A 4NA2A 4RBVA 3QSIA 3KMSA 2BJ3A 2B8QA 1UZHA 3IR5B 3MM7B 1RGVA 4G3IA 2DRAA 3LP0A 1FE4A 5A2QY 4IRKA 2HQIA 2J0SD 1RZMA 4OX8A 3OBIA 5L9NA 1AZSB 3PHTA 2GW8A 4W98A 5D0EA 4DV0F 1EAYC 5B0BA 4U9RA 1S0MA 3KHHA 3JAMY 2R7OA 5DO2A 1ZM3A 1UMJA 4L74A 3G6XA 4JI3F 1H38A 2D7SA 2X1FA 2YKOA 2ILYA 1WKKA 2EG2A 2MQMA 4USHA 3J81Y 4HACB 2PO4A 1TL7A 5KFLA 1JJCB 5M2PA 4P2SA 2OELA 1S1XB 3JQKA 2NQPA 1NDCA 1ZYQA 3HX9A 3W65A 5CYMA 3BV8A 4ZDNA 5HMXA 1HWUA 1FI4A 3US5A 4NXNJ 3T6BA 3HT3A 1RTIB 4I68A 2BR0A 2N4CA 1HBNB 4X4SA 3VVUA 3T1HJ 2PGCA 2KJWA 1S1WB 5LSRA 5DJBA 1RB0A 5KFTA 3CCSS 2BJ8A 1UJ6A 2CQ1A 4J9NA 3M8QA 2UU9J 1CQMA 5IWAF 1CJVB 1DURA 4TQRA 3T19A 5KFSA 2ZH6A 3FEXB 4ZHRA 3DOKB 3CD5A 1Y3KA 2RSQA 1BE4A 2FC9A 5K14A 2NXCA 1BMQB 1AFJA 2VPZB 3K5PA 3MMJA 2HVDA 4JBCA 2XYPB 3QT5A 2YNGB 1HI8A 2RAQA 3DGPA 3LW5C 4MT1A 2ZOFA 3V6JA 4NCAA 1N5YB 3MM6B 4RW9B 3GYXB 3HP6A 2EBGA 4QPTA 2VBZA 3MMAB 3NOGA 2QMUB 2Z57B 2CJ9A 3OTCA 4WP8A 3W9JA 2XY7A 3UQSA 2AX0A 1EETB 1U0HA 4U95A 4JI4J 5CZVA 1RCXB 1ZA2B 1UKUA 1FNXH 1FF2A 3FEZA 3Q0AA 1TKZA 2BVZA 3P49B 1W7WA 2X51A 3AH6A 2VD3A 2Q3PA 5KT5A 4FF1A 3DI6B 5F8LA 1N48A 4MFBB 4CO2A 3K57A 2HNDB 3FFIB 1SUQA 4QJVA 1G3OA 2DNKA 1X9WA 2XNQA 2PSZA 3M30A 3GE9A 2F7VA 1UEUA 4BWJA 4GKKJ 3HHEA 3PEJA 3UCGA 3G82B 4A8SA 2FHOB 1VBYA 3M8WA 4WYLA 3W62A 3BGRB 2N4DA 3DRRB 1WTBA 5JVHQ 3P4UB 5D0RA 2G0JA 3CCVS 5K20B 2HFSA 3CMES 2NR0A 4F4KA 1X5PA 5GADI 4H4OA 4FXVA 1SQGA 3TA0A 4JV2A 2LEPA 1TKDA 1AB8A 3OL8A 2RVJA 3P6YC 1GMVA 1KLMA 5BR8F 1VIOA 4JI7J 4M5DA 5IT4A 1NPKA 4G1QA 5J1PA 2AGOA 4DQPA 1XMBA 2FJEB 4OYIA 3K17A 1SH2A 5KFGA 4RUHA 3QT7A 2L41A 3T5HA 5LJ3Y 3UD4P 4ZPTR 3THTA 4JI4F 4HR2A 4NZ7A 4AQYJ 1VBZA 4RBUA 3LWMA 2UXCF 2BKNA 3HT0A 2XGQA 2ZITA 2PEHA 3TRGA 5KFBA 3KLVA 4UY85 4LIRA 1Y4ZB 4FXWA 4C3LA 2EC0A 3RR7A 4EGLA 1RT7B 3SYZA 5M2RA 4ED1A 2FJDB 4P72A 3CC7S 2LKZA 2CXEA 2R7QA 3HHLD 5BYQA 2NSCA 4XAKA 1CEZA 3M32A 1FO1A 3L7PA 2DGWA 4AFFA 3OJUA 3QYYA 5AJ3F 3QLHB 4CLKA 4ZCKA 4LSLA 4DUZJ 1YSJA 2G1DA 1BHNA 2IFXA 4KGKA 4K7QA 1EHWA 1UWBB 5I42A 1DZ5A 3NGDA 1M5VC 3MOJB 3TQEA 1RP5A 2RKIB 3FNNA 3JSMA 2M4MA 3EICA 3DLHA 2CNLB 2DB1A 4NLUA 4LRBA 2GIFA 2K8GA 4IG3A 3HZEA 3U27A 2FGCA 2LCWA 6AT1B 5I4MA 2RDIA 2E1MC 3LGMA 4QBUA 1S9GA 5ADZA 2RD5C 3FFIA 3KJVA 1NH7A 3V5RA 4B9MA 2LEBA 3G8TA 4I7FA 2KVIA 4P75A 1UA0A 4DLGA 1AT1B 2IVFB 4F4ZA 3MUVP 2W2QP 3R7SB 1M5HA 2KT2A 3F44A 1U6ZA 2WCXA 2AJ0A 5J2PB 2MHNA 4RW6B 2IC3B 1Q0NA 1PJ6A 4PCQA 1NZ8A 3CJ8A 3ZZOA 1M5KC 4XDCA 3BGLA 3ZZTA 2V5HG 4MK9A 2DR8A 2IMWP 1DARA 4MKVA 2VUGA 3DM2A 2W8KA 4OHXA 1EP4A 1CJKA 2VBYA 2WAQD 3HHLA 3VQTA 3BSOA 5FD1A 4A8YA 1S57A 3I6PA 1R7IA 2IYGA 1T9UA 2HNZB 1T11A 3C14A 1YHQS 3D1OA 1XBWA 3TWZA 5M2UA 1VOMA 4HVZA 4F7VA 1ROFA 2ZBCA 3IRXA 4ZHRB 4RUCA 4XO0A 1HYSB 4ILMA 1RSCA 3IS9A 1KLNA 4ATNA 4LF9F 5CD4H 4DHVA 1M0SA 3VGUA 1S1WA 1CJKB 1HBOB 1R89A 3T9NA 5IFMA 3OHBA 5H9EK 5LMNJ 4JI5J 1O6XA 1XWLA 3WHIA 3KUEA 4BDPA 1SJ1A 2FTRA 5B0EA 3MUMP 2R8JA 3CMAS 1KSPA 1YTYA 1IKWA 5E3PA 3TX8A 2V2ZA 2NSBA 3FKBA 2DKOB 3QQCD 5A6WA 2YNHA 3DRSA 3T1YJ 2VPWB 3CDEA 4FBUA 1FHTA 2ZKUA 1RBLA 2E5IA 3ET6B 5D6GA 5KT2A 1N5VA 1R8CA 2BE9B 4JV0A 4CI0B 3M8PA 3ZNJ1 4DFMA 3BO3A 3V2UC 3K5OA 2XNRA 3CDBA 2HFZA 3HDSA 3K7RA 1RJJA 3TVZA 2WTFA 3BDPA 1JMTA 3FCHA 1T3NA 4CLYA 5HMZA 3PX0A 4C8OA 3A8KA 3T5KA 2YWGA 1IBMJ 4Q5VA 4I6WA 1VQ5S 2QZ8A 3R9LA 1OSCA 2P9GA 3IR6B 1RTDB 1JLBA 4PZVA 1V6HA 3UVJA 5IT9Y 1C1BA 1NO8A 1MWZA 3MMCB 1VBXA 3I87A 2XS5A 4IOCQ 2XY5A 3SI8A 1ZM9A 1FCAA 3ZTRA 2ZE2A 4MAKA 2V94A 2V8HA 3IFEA 3CJ2A 2EFQA 2FZKB 4F04B 4ZVPB 1H73A 3M32B 3QZ8A 1HNIA 4TLQA 4TYAA 3I56S 1IJEB 3DYAA 4RW4B 3MR3A 2XZTB 2WZ1A 4F26A 2AGPA 1KVIA 3DGVA 1BQNA 3MEDA 1FNOA 1RT7A 3DOMB 2NUHA 4YR0A 3V81A 1FKOB 2M8HA 2W9AA 1NSPA 3J7AN 4C8YA 1PIEA 4YDDB 4CH7A 2AIRB 5KFPA 1EQ0A 4AL7A 2K7KA 2GIRA 2O3DA 4Q43A 5DDPC 2M0GB 4FZVA 4NA1A 3QWUA 3V4IA 2WOMA 5IM0B 2G13A 4IG0A 2GQQA 1QSYA 2HLUA 1LEOA 2XMUA 3I4PA 4AXIA 1FEHA 3NGSA 1DRZA 5E0OA 2DIVA 2RQKA 1SL2A 4JYAJ 2M7SA 1X5OA 2XEXA 1M5PC 1ELOA 1KLMB 3IGNA 1FVSA 2W4PA 1MMNA 3D54A 2CFXA 4FNHA 4L6V3 2ERRA 1ITPA 2CVIA 1T94A 2MZTA 1HD1A 1S0VA 1D8YA 1OQ6A 1JKHA 2FDNA 5A76A 2H5IB 4UOHA 4J9MA 2C2EA 1QUPA 4DPUA 1U1PA 1RHKB 1RWOB 2VPYB 5DS7A 3OHAA 2HMIB 1SPBP 1U47A 1RWPB 2YWKA 2WSFC 3KDOA 2DNPA 3NP5A 1SC3B 2I8EA 3MAAB 4NZ0A 2WB4A 4XTTA 5HP1A 1Q86T 4OMFG 5E3RA 4CCHA 1RWUA 5C7PA 2QEXS 4ELTA 3T1AA 3I5AA 2W7AA 1RWVB 2OKQA 3W60A 4CM0A 5BYSA 5KFCA 2RDJA 4DV4F 4ILRA 2VQFJ 5T14A 2OPQA 2XMMA 1Q8LA 3EUNA 3O5TB 4BBYA 4MKYA 3KJQB 5BXIA 1X31C 1Y11A 4RU2A 3BKUA 1VISA 1GK8A 1UPPA 3M2UA 2QE5A 3SFUA 1CBKA 4DZ6A 3NY0A 1FDBA 1I6JA 4FN5A 4JI1J 3BSCA 3IAS9 5KFEA 2N7YA 2MLYA 2OLWA 5F9NA 3MMCA 4O3RA 5HO4A 3DDNA 3TQ1A 1NH8A 1RTZA 3G6YA 2KTQA 1N5QA 2DH7A 1OY9A 3Q8RB 2JHEA 3H2LA 4LF6J 2C2MB 4B3OB 2B4VA 4WF9Q 4DPWA 3SQGB 1ZS6A 3HXMA 4TN2A 4ZPWR 4DV1F 2IHR1 3I5BA 5J2NB 3R5GA 2RUSA 3R5DA 4RNFA 5CAAA 4DQIA 5HATA 4Y00A 1UVJA 2BXJA 1N5TA 3QMQA 4BWMA 7AT1B 3M8QB 4DR3J 3VVTA 4ED4A 5GMDA 5C42B 4OV6A 2ZH4A 2QX0A 3BB5A 4N8OA 3CJKB 5IV4A 2MZRA 4OX6A 3Q8VA 2JEJA 3OR2B 3R27A 4PWUA 2ASJA 4ED8A 2DR9A 3Q89A 2HHHF 5GMKa 1SKSA 4ANDA 2R7UA 4C8NA 2J0XA 5KT7A 2RIJA 4MIWA 2RUGA 3KG4A 3NNCA 1N33J 1WHYA 3NGKA 4I6AA 1KC8T 1RWNB 2ILZA 4ZVUB 1AUDA 3X1LB 5CCMA 3GJRB 2BUNA 2WVFA 5L39A 4P71A 2XMWA 3S6EA 2PN6A 4XPEA 2ATCB 4E0DA 3QT8A 1VRTA 2OPRA 4OYMA 3M05A 3A12A 4Y3CA 4FKXA 3W1YC 3WC2A 1VQSA 2ALYB 4TY8A 1RISA 3UDVA 1HQUA 1S4FA 2YKNB 2VG5A 4GVBB 1JNRB 1LWEB 2RRAA 2CQ4A 3QIPB 2QV6A 3BJYA 4DN9A 2LFVA 2B3TB 4ZP6A 1EP4B 4WFNQ 4DCOB 2E1CA 5DZ7A 3OD2A 4I2QA 2LLZA 4CRJA 3NCRA 1HL6A 4DJBA 3KKFA 2ZOMA 2CJXB 2MJNA 3ILOA 5GAEU 3Q8UA 1IM6A 2BABA 2Z2LA 4RX6A 2ZUAA 4DZDA 3CC2S 2AMCB 3HULA 3SCIE 3W61A 4NLQA 4NLWA 2OH2A 2VA2A 4DU7A 4M63A 1WC0A 1NSAA 5ITHA 2W8LA 2E9TA 2W01A 1IWGA 4OI1A 1F6TA 4C9DA 1XEZA 1R0AB 3BN4A 1S1VA 5DDRC 1HMVA 4FS1A 2HW3A 2HPUA 3S01A 5AE3A 2QA4G 2VA3A 2F8MA 3D9BA 4O4GA 4Q8FA 2HG4A 4WK3A 5KG6A 1RAHB 1NHUA 3C19A 3HSDA 3RUBL 3PO4A 4RPFA 1KTVA 1HNVB 4KO0B 2H5JB 4WJBA 2VBWA 4CM2A 2XMAA 3CCLS 4F2RA 2GHVC 1KS2A 2FLPA 2VF3A 5AJ3J 1RLCL 1URNA 3OFEA 1CULB 4NOHA 3LH2S 1S99A 3CCJS 1U09A 1EX8A 2OMLA 4ZN1A 1NDLA 1Z2ZA 2CPZA 2ZD1A 5DDQC 1JX4A 4QYZJ 1OSDA 2EW9A 1HWIA 2YTCA 1WEZA 3T41A 8ATCB 1CC8A 3FZ2A 2B0GA 4ZIVA 4Z7CA 3TOQA 3RZAA 1K9MT 1Z1ZA 1JQGA 1ZZNA 4X4TA 1X4BA 1WKLA 2GHPA 4HT5A 4YB6A 3BO4A 3MFHA 4WKRA 3V4IB 1HBMB 4Y2MA 3GQCA 3H90A 3IG1A 2B6AB 4O0NA 4L72B 4P7TA 3RRHA 2BOPA 1U45A 4DR4F 1CG2A 1F5AA 3EVOA 4E98A 4PWDB 2ZDPA 1Q5VA 5KOXA 3DLKA 2GGPB 5KFOA 3C16A 2ZJRQ 4Q2MA 2R7SA 5MAOA 4E2FB 2A0FB 3PW5A 3W5XA 3G4SS 2R2UA 1WUUA 3FSXA 2HHUA 1GXLA 4NMXA 4PXDA 2DY9A 3VGTA 2L48A 2OMOA 3R5AA 2ZM6F 4DSEA 2XBPA 2I2YA 3G6VA 3PYGA 1LW2B 3M6UA 5L1LA 2F8HA 3R8YA 1UZDA 3SCKE 3PJXA 9ATCB 2WVDA 3SCJE 2RU9A 1RYSA 3O6QA 4QOTA 1G1XA 1U1KA 5A8RB 2FHMA 1EARA 5HVHA 3UVJB 4HLBA 3W5ZA 4DL5A 4F4AA 4RNHA 4C0BA 4OZ5A 3W63A 5IXUA 1MSWD 3V81B 4ZS6A 3EDRB 4OJ1A 4QWAA 2A6MA 4LF9J 3H4BA 1FDDA 2DRDA 2OEKA 3QO9A 2V8VA 2FJWA 1L3KA 4URQU 3OR1B 2CQ2A 1BD6A 1UEKA 2F5GA 1W25A 3CJSA 3MR2A 3MECB 2A6OA 2J6UA 1PYSB 4ZPAA 1FJGF 4IQXA 1FKPA 3DI6A 3ET6A 4J37A 2GMHA 3BPDA 5B09A 5HLFB 3QRRA 4ERDA 2WVCA 4FYVB 1UW9A 5FIIA 4DEZA 4IRDA 2XHWA 1I3OB 5DETA 3VR1A 4LRFA 2DPIA 3H40A 2VIHA 3SMZA 2YNIA 4IDKB 1YRTA 2IM1A 2KXNB 4LF5F 2DVIA 4I2QB 4K0KF 2M70A 3JSYA 3GP9A 1FDNA 2H9ZA 1XMOF 4ZOSA 1IVZA 1KN6A 1QDUB 4R0EA 7FDRA 1C1CA 3BBFA 3RAXA 1BWEA 4JOUA 4KC5A 2JLFA 3IS9B 2VONA 3HVAA 4RWXA 1YGYA 4J90A 4NA3A 3D1QA 1BXNA 3RG6A 3H59A 4ZCLA 1UETA 1YWXA 4C97A 4KHPF 3CW2C 1IR1A 4UY8T 2BQUA 1C1CB 2CAJA 4JI6J 2ZBRA 3GFXA 1HBUA 1SV5B 2AJ1A 5KG0A 1H2UX 3TP2A 4M94A 1FJGJ 1BQXA 5A2QU 3MM9A 1HBOA 2YX1A 3HLUA 3HZGA 2ZVIA 3M8YA 3MPDA 2C2KB 2KYZA 1K44A 3C15A 4Y2IA 4OZ3A 1Q82T 3EWGA 4USMA 1VLOA 1Y00A 3QGIA 4ECTA 1T0TV 2IDLA 2XULA 5CYMB 3S1TA 4BLGA 3U1LA 2C2OB 1ZM2A 2UV8G 2F4VF 4WKYA 3JTNA 2ASLA 4RW7A 4UQGA 1OPZA 2FJAB 2AHOB 4I7FB 4OFZA 2JFKA 2DNQA 5B0GA 3KWMA 1N0VC 2K1RA 4I1TA 4NCGA 2V6AA 3W9IA 3J81U 1XMOJ 2QLBB 4K4ZA 3GCXP 4TQSA 3OR1A 1HD0A 1HI1A 4NLYA 2OFGX 3VAKA 2RRBA 1VQ4S 3WQPA 2ZWOA 4PG8A 1YVFA 1VQKS 3EZ5A 4LF4F 1HHSA 3CJ5A 2B9EA 1X60A 3I0RA 5E3AA 3MURP 1S77D 4A8XA 2KJVA 4LSLB 2IMOA 1Q8IA 3KLHA 1W26A 3CD7A 2FB0A 2H51B 3WIVA 5DM7Q 3C66A 2BX6A 2VJUA 2MZQA 2CG4A 3A3PB 1S9GB 1J27A 1QAYA 3NRBA 4I2PA 1HNZJ 4YN3B 3SCLE 1RUSA 4WFXA 3X3UA 2PI4A 3H2UB 2QJ3A 1JNZB 1LK7A 1EIYB 2OI2A 1S1TA 4CO1A 4V1Ak 4RW8A 4ZIWA 1APSA 3LGHA 3ENQA 3BM7A 4Y28C 2ZZMA 5I42B 2ALZA 1VI7A 3IWXA 2IDEA 2XYHB 4IH7A 3VAHA 1S97A 2MKSA 1UFKA 4ID5B 1LWCB 2W4CA 2ABYA 4OZ2A 4OYZA 2EFVA 3R97A 1B3TA 1D1UA 4JI0J 1H3DA 1Q16B 4U6PA 3A3OB 4X64J 4JI1F 2XS2A 1RT1A 2HAIA 1K8AT 4JI5F 3I96A 3I9V9 2MZ1A 5F41A 1AA1B 4YMEA 4PEOA 4NXMJ 3FJ2A 4LSNB 2FGOA 1QSLA 2BJ9A 1XMQJ 3HFVA 2FHJA 1L5UA 1SJ4P 4AXJA 4ES2A 3VZIA 2F9DA 2H4YB 2Y0SD 4Z2XA 2KRBA 1L3SA 2VJVA 4EBEA 2V67A 4EBCA 2J8AA 5D4OA 2PC6A 2M52A 3BGRA 1HBMA 1WF0A 4IO1A 2ROGA 5JXSA 4CO0A 1X4EA 6FDRA 2EFOA 3EVWA 3CC4S 3MXHP 3FZBA 2R7TA 4OZNA 2CUYA 1F2HA 2EKNA 2P2CB 1WDDA 2RE1A 3P45B 2OTLS 1RBAA 1IKXA 3MI7X 2FHJD 3VALA 1YI2S 3BSNA 2QG9B 4LRCA 4A47A 3HFZB 1E6VA 1JLQA 2HHHJ 2J0QD 1ZETA 1OYDA 2WHOA 3ZXWA 2UVUA 1KNZA 4FKYA 1OY8A 1SJRA 3L95X 4WE1B 2CADA 2AWZA 4H4OB 2DEJA 2NXNA 4JV5J 2XSFA 2LQ8A 3QGHA 1OQ3A 3E2EA 3QRPA 1HNVA 4KO0A 4LF8F 4P10A 1VQOS 1NKCA 3D6MB 2XSJA 3H5YA 3G82A 2VDHA 3HVTB 4ELVA 1FRLA 1S4EA 5IC6B 3G8SA 5F9LA 1OJ4A 4H4MA 7FD1A 4WYWA 5I3UA 4NYPA 3ZZ0A 3MM6A 4RW9A 2GMLA 2W9CA 1XMQF 2DTJA 1N5YA 3BDEA 2JFDA 3FCVA 4HL9A 1T9YA 4HDHA 4DX7A 5C25A 2JLGA 2NXJA 4PG5A 2P9EA 3OSNA 4NRUA 1B0TA 1HW8A 4PG6A 5B0FA 4B02A 2V4JA 3GPAA 3M2RA 5A8WA 8RUCA 2R2TA 2ZH5A 3VAGA 3QFWA 4P2MA 3MEEB 3GFYA 4U8VA 4OHZA 4F3OA 1VRTB 2OPRB 4LREA 1JXVA 3TZYA 4X62J 3OW2R 2E66A 2KKHA 3V6KA 2L9WA 3K5LA 4KH1B 1Q5YA 2DISA 3Q8PB 4B3MJ 4RNMA 1S6PA 2V9KA 4XDDA 4N8NA 3DU5A 4BCAA 1OYEA 4NLGA 2GS8A 3B54A 3BKTA 5ETNA 5DG8A 3OVBA 4K4WA 2ZZNA 5SZTA 8AT1B 5MLCV 1OIAA 2W1BA 2Y0BB 3K0JA 4Z37A 1MWQA 2OUGA 4DCJB 3C6UA 2YXLA 2CNNB 4CYUB 3FQKA 2I9SA 3ZO7A 2RT3A 1FRMA 2MKYA 5HAOA 4AT1B 1Q78A 1CJVA 2OJ3A 1EQMA 5HBMA 4QIFA 2NLWA 3SQOP 5HBMB 3SV4A 5ETQA 3SFGA 4RUAA 1WACA 1V9OA 2AEFA 1MN9A 2FQQB 3BR8A 5IT0A 1QAIA 2HK2A 5J2NA 4IOBA 4DL0C 1T8EA 3MEKA 1KWMA 3R6GB 5T7LB 4OHWA 5E7OB 4A8QA 2HNZA 1M1HA 3C14B 4B3RJ 5F8HA 3CJ3A 4XPCA 3VGVA 3PW4A 3TANA 4A8WA 1LQ9A 4B3SF 4M95A 4ED2A 2IJRA 4MKAA 3FQLA 3AB2B 3R5BA 3E8OA 1K47A 2CPXA 3HVTA 3J7Z5 4DR7J 1RT4A 4DL4A 2UUCF 2GIQA 2DIUA 2DNGA 3LP1A 3AQOA 3V4MA 2GA7A 3JYTA 2Y1RI 4P2XA 4KKOB 4D3HA 2YPYA 4F8RA 1HNWF 1OPIA 1V3RA 2C3PA 1FRXA 3KLEA 2WSCC 2HS3A 2VASA 2YWFA 3K8WA 1UTAA 1MG7A 4DXLA 2BM1A 1JIHA 1WNEA 3JXOA 4X4RA 2Q6CA 1RBOB 5F0UA 3MZIA 3MCSA 3P5TL 1NPRA 2HRTA 2ZHBA 1RLDA 3MM5A 4OYWA 2FIUA 2UV8A 1Q53A 3QNWB 4HH1A 3MM7A 2KB2A 1HNXF 3IXQA 3OFFA 3P8BB 2VOOA 1PG5B 5D15A 2XI2A 2V8GA 1H74A 4X65J 4B3RF 1X4FA 5DG9A 4B9NA 4ICLB 3QATA 1NJWA 4ZJQA 4R5PB 4YOEA 3KLIA 3FK4A 2OIHA 4KPYA 1TL4A 4DSIA 3GIMA 3NAHA 3O8WA 3JAMU 2DNZA 5HN0A 3VF0B 2UUCJ 5EX3A 4HKQA 4M5IA 2DGTA 4EO6A 1S12A 4G1PA 1SI9A 3UN3A 3HM9A 1HIYA 2VL1A 1YQHA 1DLOB 2E44A 4USTA 2V0NA 4WFBQ 2JEIA 2LDYA 4IH5A 2N82B 4ZA1A 2AJ4A 1X4GA 2BBEA 2HFNA 3AFGA 4GRSA 2B9XA 4ZMMA 2FUG9 3TJ8A 4DR6F 1QUVA 2GNKA 4ZPDA 4C3KA 3VAMA 5GMEA 3PRBA 3N5FA 3OLAA 4ECZA 3VTIA 1N36J 1SVDA 2Y1LB 4W92B 3BQ2A 2QMXA 2BJEA 3HHDA 4R8UA 1IKVA 3A8EA 1Z4UA 2AEJA 4MH8A 2HQFA 5C24B 3NEKA 4G1QB 1IJFB 2MGZB 1EJ7L 2W2OP 1KQSR 3KJNB 5J2QB 1HWJA 3LWLA 4USIA 3Q8SB 2NCKL 2CPDA 1VFJA 1GMUA 1O0PA 2WBMA 1Y0HA 2XMJA 5F3TA 1VQ7S 2FJVA 3KK1A 3PXGa 1NU4A 1R27B 1S49A 1VMBA 1H98A 1KDNA 2WSEC 3HI9A 1TVRA 5DG7A 3OJSA 3D28A 3DRRA 3DXBA 2FZGB 3DOMA 2WONA 2QA1A 4YP3A 1NJXA 1BQNB 3PDNA 2FVSA 3JTOA 5ETOA 2F40A 1BWVA 1HHQA 3GYGA 3J7ZT 4DR1F 2CQBA 2MZJA 5ETMA 1YJTA 4NXNF 2DNLA 4NCBA 4K5RA 2JEGA 2DH9A 1UAWA 1Q1KA 1Q79A 4NX9A 4XK8C 4GC6A 1EZZB 3JYTB 3R2CJ 4LSZB 1H2VZ 3L09A 2BKPA 2MLZA 3JTPA 2KFYA 4C48A 3THVA 2C42A 3M2VB 2IM0A 1C1BB 3GWCA 4UQTA 5J2MB 2XMKA 1PAEX 3PFEA 4KHRA 3UNGC 2F4VJ 2OPSB 3KLFB 4KGZB 4F25A 1WC6A 5D4PA 5KTQA 2BA9A 2GVZA 4DX5A 5T7LA 1SJFA 2BQRA 3CCES 1JJ4A 4IFVB 5K8MA 5DQHA 2XCAA 3OVAA 1J5OA 1S72S 4B3TJ 3L3CA 1O8BA 2Y8WA 4E8UA 4BC7A 3CDUA 3F73A 4I69A 1CSJA 2FLNA 4LFCJ 2XY6A 3DFEA 2OAUA 3DOKA 2A2CA 4CLTA 1AFIA 4ZCIA 3C46A 1KR4A 2CZVC 5GAGI 2Z2MA 1QSSA 1RA6A 1TL3A 1RHUB 3GJQB 2PDAA 5FLXU 5B08A 2DGVA 3DDKA 3LAMA 3HCXA 1TMJA 3OTEA 4EK2A 3EXYA 1J5OB 3MMBA 4HHHA 1NBEB 2GJIA 1YJUA 2LU1A 2KHDA 3TO8A 1X9SA 5EWEA 3K58A 4TYBA 4UZBA 4K4SA 3KJFB 3OPKA 3MR7A 1UFLA 2CPEA 2LA6A 3W66A 2QFJA 2E29A 4Q44A 4F4XA 5J2PA 3TAQA 1FX2A 5KOWA 2W9BB 3PTWA 2U2FA 1N34J 3M2VA 1FK9B 5EN1A 2R8IA 1TL1B 3E51A 1EB0A 2R3VA 3KLGA 5LMUJ 2JOQA 3MHYA 3UNYA 4A48A 2KH9A 1FTRA 4IUFA 2UUAF 5JVGQ 1SH3A 2AZ3A 4WXOA 1KFDA 2V4RA 2KT3A 2HK3A 3D6HB 1WSVA 3PNIA 3R6LB 2J7KA 2R42A 4DSFA 4C4WA 1U8SA 1UPMB 2WONB 4DV2J 5LT5A 4YFUA 1FKAF 1P1LA 3G71S 4N76A 3GJSB 1Y10A 1TU0B 4CLSA 1WEYA 3J7YI 2RKIA 3AHPA 4CLFA 1DTQB 3HMJG 4NXMF 4ED6A 4G65A 1JK9B 2CQPA 3PKYA 3GMGA 1ICEB 5LOQA 2HQCA 5KFMA 3H5XA 3IWLA 4NYOA 2NXUA 4ETXA 4JI2F 1OMSA 1NJIT 1CPZA 3QLHA 4YDXA 4DU8A 3ETMA 2D69A 3FC9A 4UOFA 4C98A 1SJ3P 1S6OA 2KHCA 2WW4A 3CIMA 5C24A 3OFHA 1FFWB 2JSXA 3L9ZA 3CB4A 3UWTA 3VZHA 3H8YA 2R7VA 2QO3A 2RNEA 2PIIA 3M9MB 2DR5A 3CJ4A 4LFBJ 2XYGB 2JVOA 3TARA 1X0FA 1WF2A 2CQCA 3Q8QB 2FYXA 1Y3JA 2GGPA 3L4BC 4NPOA 2E5HA 1JLCB 4ZN3A 1NRKA 1LNQA 1SXLA 1UJ5A 3A13A 4OX9F 3NBPA 5ETLA 4OYBA 2DR7A 1WHWA 4KH0B 4MIBA 1RQ0A 2VDIA 4LSNA 5B0AA 4DV7F 1V5VA 1LW2A 2YH1A 3AOCA 2E9RX 1U2RA 5KFDA 4OV1A 2HQGA 4FF4A 4YS2A 5L46A 2XM3A 4I67A 1NAQA 4U7CA 4JI8F 1PKUA 1FEEA 2YX4A 1VGYA 1F9HA 4K2JA 1EKRA 1B7FA 1PO6A 2UUBF 1G2EA 4M5JA 2FD2A 2XC9A 1R8AA 4F36A 4QPXA 1HPZB 2R2SA 3BGUA 4BHQA 5ETKA 3G96A 2XLIA 1TKTA 3T5LA 4LFAF 3QJPA 2AZ1A 2B4UA 2E5GA 2DGOA 2CQIA 3CCTA 4O0IA 1S7IA 1RT3B 2Z4PA 3MM5B 2LA4A 3CO9A 1N54B 2HBRB 3DHXA 5D77A 1U2FA 2AJ2A 3GV8B 4URGA 3BGOP 1S1VB 2FPHX 3C6TB 1Q7LB 5KAKA 4QU6A 4YUDA 2ZBPA 4MFBA 2YH0A 1WG5A 2FHKA 2RH3A 1NDPA 2AQ4A 4DLEA 3MWBA 5IZHA 4K50A 4A8MP 3GU0A 2D9PA 2RQ4A 4OHVA 1HW9A 2V8DA 1CULA 3EM1A 2GAHC 1XJWB 3CNQP 1X4CA 2QFIA 4GO5X 4RKUC 4M5LA 4DDFA 5KT6A 2XWYA 4R25A 4DL7A 2I0XA 2GQCA 3FMWA 3WDOA 1JLFB 2FVPA 5IQ6A 4P74A 2BE2A 4NASA 4J9LA 1TZ0A 2GHWA 3AT1B 4KAIA 3TEHB 4DPOA 4DSLA 1VC0A 1IUJA 3M30B 2Z58B 1NMEB 1ZOTA 2F1FA 2W2MP 2A1BA 1Q8KA 2JEFA 1WDTA 1QJHA 2YNFB 3MTKA 4IFYA 1RU2A 4A8OA 2NYIA 5LMNF 1BQMB 2DBBA 3FSYA 2R8GA 3HHNB 4PQUB 2V9WA 2VG6A 1QAJA 2UUTA 4KGXB 2BRKA 3IGVA 4USWA 2ZEJA 3UDEA 3FBCA 1A7GE 3ZNUA 1NJZA 2R4FA 3N4WA 1WI8A 4ZPBA 2MQQA 2MB0B 1PYOB 4LR9A 3IMQJ 1DY3A 3AD8C 4ITSA 1TQLA 2BACA 3NNHA 3MAQA 3AJ1A 2COLA 4LF1A 4J9RA 3MMBB 2PMZD 3KK2B 3AXMA 1RT2B 3OXLA 3QBCA 4ZPCA 1B7YB 3O2IA 4DFKA 4Y6IA 1LWEA 3DC2A 1LXJA 5L1JA 2MQLA 3OR2A 4QWDA 2UXDF 2LU2A 2E7XA 1NUEA 2H3EB 1S6QA 2D3ZA 4B17A 2KVQE 4HYKA 2F8EX 3PFOA 2DGXA 2O5DA 3OQ2A 4DS4A 4NRTA 3OV7A 1TV6B 3VAJA 2QLJB 3PZPA 3SIPB 3GIRA 1H6KX 1YRXA 4F3MA 3I9ZA 2EPIA 1AZSA 5I3UB 3OLBA 2PI5A 4H4MB 2Z0GA 2Q79A 3VCDA 1C2PA 1H7XA 1OS5A 2VKRA 2P9CA 5J2MA 1VJWA 4F02A 1S9EB 1I1GA 4HI1A 3DRXA 5HLFA 3KTQA 3CJKA 4YB7A 3CD0A 4YEAA 2DGUA 3AB4B 2E9ZA 1IBKJ 2E5LJ 1CJTA 3PV8A 3JQJA 4Y34A 3LO3A 3I82A 4UTGA 2B5JA 1VIXA 4EEYA 4FVMA 2Q43A 2VG6B 1IBCB 5H9FK 4HT7A 2QC3A 2CRLA 2LQ5A 3AJ2A 3IBFB 3KHGA 4Y2CA 1F5CA 4C11B 4WFAQ 2CG8A 4JYAF 2B8PA 2GFFA 1IN0A 4QW9A 2E1AA 1N36F 5IWAJ 4P73A 3NS6A 4Y2KA 4FNIA 1REVA 1VLYA 1U0SA 4ZVSB 3TUIC 4F3QA 3NS7B 1FXLA 4DF8A 3N6MA 3D2WA 1GFWB 3RYLA 3IBWA 4J9OA 4KGMA 2W2PP 3H98A 3CCMS 3HPOA 1NK6A 2VFVA 4ED3A 4L73A 2HMIA 2IBKA 1RAFB 3BEGB 5F8GA 4ANEA 3U7JA 1UP1A 2LQBA 2CJBA 4Y2AA 1RWXB 3W2WA 1E6YB 3EGVA 1NB7A 4OI2A 2GJFA 3U1MA 1BGXT 1IKXB 2CJKA 2DGSA 2O67A 3HKWA 2O01C 4KIAA 4USVA 1N5SA 5HMWA 4DL2A 4C8ZA 1QVFR 4ZVHA 1IBKF 2E5LF 3CULA 1XQIA 4PWDA 4H4KA 1B4SA 1XTZA 2AF6A 3BR9A 4WIQA 3TR5A 2B6AA 9RUBA 2AYMA 1WD6A 5C2GA 5F8IA 1FE0A 1U1QA 2CQ3A 2NPIA 3JS9A 4J5OA 1VQ6S 3K2YA 1DQ9A 5C5JA 2DNRA 4RNOA 2ZC4A 4J9UE 5GAHI 2GO9A 2DY1A 5RUBA 2MY8A 3H7HB 3ZTPA 1F60B 1VBKA 4X66F 4Q45A 1ZTTA 1TFWA 4NE9C 2IJFA 2AU0A 4DSKA 2W2NP 4DUTA 2XWXA 4CO5A 4GKKF 4PUOB 1RKIA 2MHEA 1YDLA 3BPSP 3MEDB 4PYDA 5L1KA 1KKHA 3P96A 3W2WB 4RO0A 4RNNA 2DRBA 2HQ3A 2BRLA 4O44B 1RTJB 2CJQA 4FYXB 4DG1A 3ITHB 1T05A 4PXCA 3MR5A 2DNHA 2WOMB 3K5NA 4OIXA 1FRKA 4A8FA 3MDFA 4M5NA 1C4CA 1QD1A 1RTHA 4WU3A 4UUWA 4U7UK 1NKEA 4B3TF 5J1NA 3DOLA 5F8JA 1YX2A 2WVEA 1VQNS 3TZXA 3J81j 2XGPA 3LAKA 2KO1A 3AOAA 4WP3A 4ECVA 2E1PA 2EFGA 2VZ9A 3E3XA 5B7WA 1JLAA 3SSSA 3TUPA 1PGZA 1HNIB 1KOHA 1CS4B 2XI3A 3GYNA 4X84A 4OI3A 4AD6A 3M8PB 3IR7B 3QAUA 2HVHA 1P9QC 1OWXA 2XLJA 2K3KA 2M8DB 1FVQA 2GQ2A 4N47A 2CJAA 2CPIA 4ZP8A 4CNZA 4RW7B 2ACMA 3MTJA 2ADBA 4QCLA 3L7OA 3UR3C 2BOAA 3UN5A 3DRYA 2UU9F 3DU6A 4KHMA 1FWKA 2ZH7A 1C0TA 1L3TA 4F67A 3A8IA 2V2KA 3LTOA 4PG4A 1N34F 4EMDA 4IR9A 3E01B 3RBDA 1KEKA 5KT4A 1GXTA 1U02A 1UWAA 3PX6A 3CIZA 1YBAA 5HSPA 1HQUB 2GVDB 1TV6A 3W2VA 4CH0S 4CO3A 1D9FA 4DUZF 1S48A 1HBUB 3W5YA 4RR5A 5DZ6A 1LK5A 2ZBIA 1LFPA 1F2GA 1UA1A 2BDPA 4D3GA 4ZVFA 5G0RA 5CXTA 1F1BB 5A0YA 4DV2F 1T9TA 4QU7A 1TL1A 1WF1A 2QSFA 1FK9A 2U1AA 2ZNZA 3C6UB 3FBFA 4YR2A 1F5BA 4LR7A 4NWBA 4FYDA 2LXFA 1MN7A 3NKYA 5HJXA 4F2SA 3CCQS 1KFSA 1XR6A 3HHLB 3UO0A 4C8MA 4QWEA 1H0HB 1LW0B 4LVOP 2FLOA 1RHJB 1MU2A 2VBXA 3EZOA 4DOZA 2FLLA 2FZCB 2M5YA 3M8RA 3BBCA 3RU0A 3EPIA 4HI2A 2QA4S 2ZH3A 2DGQA 4ZPVR 1LV5A 3RW6A 1KOOA 2HEKA 3R7NB 2B51A 2YKMB 5G4DA 1VK8A 1VYAA 1N0UA 1VQ8S 3TAMB 1HYSA 4LFBF 1GXUA 3EXCX 1KTQA 3M2RB 4P2FA 5D4LA 5A8WB 2B7BB 2KXHA 4V19J 2MSSA 1BQMA 3PKMA 4PQUA 4URSA 5C25B 3CPWR 3B4DA 3F0NA 1HKAA 3TA1A 2W9CB 4CTAA 1WC3A 4KTQA 3W2VB 4TU8A 1U1OA 2GVDA 1U25A 1J2VA 3D0IE 3NOCA 2XSJB 4DCPB 3EDQB 4ECUA 4KFBA 4QWCA 3J7A1 5ETTA 1AUSL 4L3KA 1FJ7A 3SDEA 4X4QA 4CH1A 4DSJA 1X5SA 4AL6A 3FDSA 3D68A 3LPYA 5A8RA 3RW7A 4WE1A 1RADB 2KDOA 4K4YA 3DLJA 2JLEA 2ZHAA 3GR1A 4ID8A 4YHHJ 1J5EJ 4ZKAA 4OI4A 3VV2B 3THPA 3UCZP 2PE8A 3CJ0A 3EYZA 2AP6A 3C6TA 4LFAJ 4ETZA 4ZP7A 1U48A 1P6TA 2K7JA 1TFYA 4FXDA 3DXSX 1GNKA 3MAAA 3HFKA 5CD4A 2BJDA 2DXDA 2YKQA 4PABA 3TEGA 1GAOA 4EI2A 3CMQA 4TXSA 3CWJA 4M8LA 1ZTWA 2QIFA 4Y0FA 4PRFA 1VCTA 1RHQB 2HWTA 3OT9A 1U7LA 2X3DA 3B8HA 3ONQA 1U1MA 1FNMA 3S8SA 1AYEA 1HPZA 5KFJA 2VKZG 5E5NA 2ZZTA 3R5JB 3KK1B 2JH3A 1WHVA 1FXDA 4ZLNA 1Q95G 3CCRS 2R8KA 1B99A 1GX5A 2EWHA 3G2XA 1KQFB 5L9XA 3ZTOA 1RE1B 2VFTA 2QRRA 1U6BA 2R9LA 4LF7J 3PYEA 2NXEA 1XERA 1YLXA 4PPZA 2HKEA 5E3QA 3FCWA 4CLWA 3KHRA 3WC0A 3PHEA 2BQ3A 1LWCA 4CLPA 1RABB 3CDAA 4QWBA 4QQBA 5LM7E 5HJYA 3KNAA 2G1HA 1J5EF 1HHTP 2ZOGA 4ED7A 2Z30B 2VB6A 3EX7B 1UVLA 4OZ1A 4Z7YA 2C1EB 1KHVA 2Y3YA 2D3UA 4K4UA 2D9OA 2HLTA 3IG1B 3O3LA 2MZSA 3M7VA 3I0SB 1SL1A 2F3JA 3MD1A 4WP9A 3LANA 4PR6A 1ZA1B 3O1LA 2HQDA 4UOCA 2YKAA 2LMIA 2IPOB 3CE8A 1YJWS 2MTLA 1RT5A 2P6TA 3VGSA 4C6AA 3AQPA 4WPAA 2CWXA 2SXLA 4M5MA 4NYZA 5THWA 1B64A 1O5JA 4FDFA 3BKFA 4L3NA 2HGMA 2KG0A 2C28A 3OXFA 5DQIA 3SZ2A 5C2CA 2AYGA 4FF3A 1QVGR 1EETA 1NHVA 1R31A 2UXDJ 4HEA9 3OTBA 1S5ZA 3K5MA 4KHPJ 3TVKA 2QLXA 1XR7A 2MQNA 2HHWA 3EZUA 2W7OA 2BW7A 3Q23A 2ATLA 3QGGA 1MMLA 2B9WA 4CTAB 1HMVB 1XIQA 2APOA 2IVYA 4JI6F 3N0VA 4OHYA 1BC6A 2EC2A 3QIPA 3PYDA 1FDAA 2K1RB 1U1NA 4CP5A 5CYQA 2IRXA 5CCLA 2E7WA 3GILA 4ER8A 1GX6A 5KFUA 4ENOA 1M1GA 2YNHB 2YX7A 1QM9A 3AD9C 3DRSB 3N9UC 3WZ0A 2RDDA 1TKZB 2XS7A 4DV3J 2W9BA 2JWNA 2J76E 4KKOA 3A3NB 3FMBA 2YKMA 5EDWA 2Q66A 1GQEA 2NUUG 2OTJS 4USKA 2YWWA 2ZJQQ 1N88A 3FBEA 3FRYA 3HSJA 4LBHA 4DV4J 3R1HA 3PO5A 1HBNA 2MLXA 1RHMB 2VU5A 3B78A 4NLOA 4DWIA 1LW0A 3NNAA 4Q0BA 4F0MA 2RJZA 4LT6A 4J9KA 5GVQA 1T95A 1FXRA 2V63A 2OPPB 4WTOB 3DGPB 1VC6A 2LYVA 2H1YA 1SB6A 1NCLA 1DHMA 1HQEA 1PYTA 2DHHA 2Z8QA 2ZC3A 3MCNA 5ETVA 5IOLA 3M9OB 3IRXB 2BJ1A 1TL5A 4K5SA 3CD6S 3CTRA 4ZVEA 2HVEA 2HWIA 3GONA 2L08A 2HSEB 1V3SA 2X1GA 1YG0A 3IO1A 3MCOA 5I3PA 3W8PA 4CIOA 3PW0A 2ZNYA 1FX4A 4I56A 2GC8A 1QTNB 2IY5B 1SKUB 1SQEA 4DV0J 4AE5A 4IFVA 4I6YA 4M5KA 2DCLA 1S79A 2DNMA 4OI0A 4GKJJ 2VC0A 2H54B 4QIVA 4K2XA 3S7RA 1H7WA 2QL7B 2DXEA 1HLWA 1K1SA 3KLFA 3W64A 4JI3J 2OPSA 2LDIA 2VC1A 5DGAA 4DV3F 1WC4A 1S6PB 2V8PA 5LXYA 1HR0J 3G9CA 2HURA 2POKA 3AY0A 4NLSA 5EHHA 5EWGA 4Q0BB 5DLGA 1S10A 2BANA 2E7VA 3UR0A 5FLXY 1GT8A 1FESA 4K8RA 2RF2A 3RAMA 1SCJB 3FBBA 4DBQA 2L3MA 3TJ9A 3KJVB 2FC8A 3BQ1A 2EXUA 5LL6d 3OL6A 2V4JB 1BUXA 1YRUA 3ZC4A 1TUGB 4KB7A 4HH0A 3TJAA 1N33F 3SQGA 4TU7A 1TMMA 5DLFA 2J8SA 2UXCJ 4I64A 4X66J 4X4OA 4KSEB 4UW2A 5AXMA 3C3LA 4EFAC 3AJDA 2KFNA 3DOLB 3A8JA 2RU3A 2Z2ZA 4K4TA 1IBLF 3HVRA 4EYHB 3OVSA 1ZZFA 5T41A 5K9FA 5KFVA 1NK0A 3D3BJ 3M2UB 1YITS 3BGFA 3M9NB 1Y7PA 3F56A 3BS9A 2BMBA 1R0BG 3D3CJ 3FUYA 5E2QA 3PRDA 5HQ8A 1HR0F 1NNDA 1SQFA 3AOBA 4YY3F 4RU9A 1QTMA 4MYUA 2KM8C 4M5HA 4KYZA 3BSAA 3R5CA 3C16B 3NAIA 3V6DB 3DLKB 1TP7A 4V19X 1YBTA 1VQMS 2OD4A 2DD8S 4KT0C 2NZ4A 4J7CA 1Q4RA 1RAIB 2MEWA 4KY3A 3DDIA 1RT3A 3UW1A 2CYYA 1DLOA 4DPTA 4HHJA 2MKKA 2W4DA 3B6BA 3MUTP 2JRSA 3A1YG 3NGRA 4FPIA 3IRWP 3OL7A 2CPHA 4C3MA 1WWHA 4CNYA 5IV3A 5KFIA 2MKCA 2FVCA 5H1SV 4WTYA 4RZRA 3V6DA 5HL7Q 1HI0P 3WIUA 5JUMA 2IAJA 4OI6A 3SXLA 3MR6A 2VICA 4QYZK 2MSTA 3SBMA 4EBDA 1RYRA 1S7HA 2LQJA 3RB0A 2ROPA 4R5PA 1RHRB 1TK5A 4ZLPA 2DEIA 1FA0A 1RT1B 4NLDA 2MKJA 3OXGA 5IS2A 2KZZA 1XR5A 2CNOB 2CQ0A 2IRYA 2MPUA 2D74B 3BREA 2XQCA 3QAEA 2LP4A 2VFSA 4ID5A 1HWKA 1T03A 3ISND 2AKWB 3BYPA 4C8LA 2JC0A 3TI0A 1X5TA 2K3IA 2X3GA 1KVKA 1U6FA 1PJ7A 1JLCA 2EKYA 2YQ1A 3C8YA 4GVLA 4I4BA 4P9SA 1ZAVA 5KG4A 3FVYA 3ZZUA 1WSRA 5F3ZA 1FKOA 3LP2B 1HARA 4C11A 3MAHA 4RJVA 4B3MF 4PYAA 4AQYF 1QLNA 3SSQA 2HHQA 3HK2A 4I2PB 2DNYA 2B5JB 1C0UB 2CDRB 1X4AA 2C3OA 1TK8A 1RWWB 1VS3A 4GC7A 1XNRF 1VHFA 1VRQC 2AJFE 2RF2B 3N5BA 1UVNA 2PFDA 3I32A 1ZAWA 3VAIA 1RAAB 1TAUA 4U96A 4IRCA 1S9EA 1IR2A 2CQHA 2G2YA 1DTQA 4B9VA 3D0HE 1JLEB 1NB2A 1RT6A 3M1VA 2G2ZA 1MMDA 4KGVB 5K8OA 4X4UA 1LWFB 2I5JB 3GFHA 5BJRA 2C2ZB 4KFBB 2VOPA 2EVZA 4RL1A 1XN9A 4ECXA 3G87A 2A18A 5A8KA 2JDJA 2BZ2A 4ECYA 1NPPA 4TY8B 3HF5A 3DMJA 2H65B 5CH7B 1BY9A 3PY8A 3D1HA 1Y9OA 2AEMA 2V68A 2PMWA
chains in the Genus database with same CATH topology
4F50A 4DR7F 1S9FA 1FRHA 1K0VA 5B0CA 3G6ES 2BANB 5FJ4A 5L1IA 2QA2A 2GMJA 1SIWB 4NZ6A 3RB6A 3LOUA 1RA7A 3KG1A 3WX4A 4RBTA 2OSRA 3KK2A 1VQLS 3FSIA 1M5OC 1IKYB 5J1EA 3DM2B 3HKZD 3PR5B 1KD1T 5B0DA 3CCWA 4AUKA 3H4DA 1SV5A 3LUYA 1TL3B 3QGPA 2VODA 2PA8D 5KFYA 4GO7X 1FJEB 2UP1A 4WU2A 3OUYB 4WIIA 5CYQB 1TR0A 3M6VA 2ZUGA 2HYIB 2GCFA 5KFXA 5SUHA 2YY3A 3NWGA 4NMLA 3H5UA 2AGQA 2ZH2A 5DDOC 3VWSA 2IJNA 5A8KB 4O3SA 2HVIA 2UVWA 1UFWA 4IG3B 2W25A 5CHCB 1JLFA 3DCAA 2XCPA 3QWPA 3TNVA 3JSMB 3Q24A 2EK1A 1MROB 3H20A 2J5AA 4FP9A 1NEEA 1P27B 2BW2A 4ZP9A 3EPGA 1ZH5A 1FD8A 1E6VB 1JLQB 3SSRA 3SV3A 4N41A 1FKPB 2CDQA 3UDCA 5E3CA 2R7XA 2JJ4D 4DF4A 3GSDA 4LQ3A 3UI3A 2IVMA 1TKXB 3MFIA 1PC4A 2HHXA 2C3MA 3QO9B 4MK8A 3CDWA 2YWEA 4J9SA 1CLFA 4CT9A 4PPDA 2HNYB 4OZ0A 5AXNA 3T1YF 1D9DA 2QYCA 2ADCA 5D3GA 2DITA 1TAQA 1N32F 1UWBA 5HROA 1U1LA 2J6SA 3TYTA 4LMZA 2N7CA 5L8RC 1VQPS 5JJBA 2PFFB 3KYLA 4A8KA 5D78A 4DG1B 2HGNA 5GADU 1MWYA 2IBOA 1N8RT 1JXLA 3DLGB 4R8UB 4KE5A 4LQ9A 3KOAA 2ZKTA 4I0WA 4M5DB 2RQCA 4IG0B 1FT8A 4HTIA 1ZPWX 3I4HX 1Q8BA 3NG8A 2E5JA 1OO0B 1YJNS 2EG1A 2X1BA 3GIJA 5I3QA 3ENVA 3KG0A 2KFZA 2HNYA 5H9FJ 4EZ6A 3ENWA 2WW8A 5U47A 1B0PA 2UZAA 4H54A 2B56A 4MK7A 4J9QA 4AL5A 1TKXA 2CIMA 1F9FA 1N56A 4O3PA 2ZE2B 1YJVA 2KG1A 4C0OC 2DPJA 4OJGA 1XK8A 2FJXA 4JV1A 1YJRA 2NREA 3I0RB 3I5CA 2KXFA 1DFDA 3U02A 2WK4A 2VPXB 2IM3A 4LFCF 1KVJA 3N01A 4OJHA 1LKZA 3JSRA 1D9AA 4YB5A 3ZZYA 2J0WA 2HHVA 3DLEB 4DMZA 5KFWA 5KFFA 2HVZA 1REVB 2F9JA 4WCEQ 3CGIA 2C2DA 2LEAA 4TU9A 2X1AA 4P7VA 1NK7A 2HRUA 2JZ5A 2RS8A 2GO8A 3POTB 1AROP 3OUYA 3NLCA 3IN5A 1X0PA 2H5EA 5K14B 1W2IA 3LF0A 1MROA 1SJQA 5E33A 4MTPA 2NS1B 1IKWB 1UVNA 2JC1A 3F41A 1DJ0A 3PM9A 1QAXA 3SDEB 3LP1B 1SC6A 4N56A 5DM6Q 2VG7B 2YQ3A 2J6TA 3GR0A 4ECSA 1NKBA 1Q81T 1R3NA 5HI7A 2R7WA 3T3FA 3R1LA 2D3OR 5LMUF 4CO4A 1IKYA 5J1EB 2VQFF 1RTIA 1WG1A 3JSBA 4YR3A 3JB9k 4DV6F 5DGBA 2N3LA 2YNGA 2ZH1A 3Q2TC 2RQMA 3RTVA 2A10A 2KYXA 4MKBA 1KQGB 2MKHA 2QMWA 3RAQA 1SBRA 2LECA 4C0HA 1Y5IB 3VQSA 1S6QB 3TVYA 3ISZA 5GAEI 1JXEA 1YJ9S 4KV8A 1X8DA 4IKAA 3HO1A 1X4DA 4RLEA 4LF6F 2ASDA 3D0GE 1UJ4A 4HTJA 1G6BA 3PEHA 2PA3A 3CUNA 4X2BA 1Y5LB 4TNOA 2XZWA 1FERA 1KHWA 1C4AA 2HRYA 1S1UA 5IQQA 1RI7A 2OPPA 3E01A 3ZZZA 1HNZF 4BS2A 4PXEA 2HZCA 2IC3A 2W24A 4QPXA 2M8DB 2AYEA 5KG1A 4YOEA 1JLEA 1RT6B 4DR3F 4Q8EA 4ED0A 1IM4A 3UPFA 2XLKA 4DUYF 5LSLA 2YWHA 5G0RB 2XG8A 5LSOA 2WB1D 3FEYB 3MECA 3TW0A 1Z2LA 3PX4A 4K59A 4ZK7M 3H25A 3DMJB 3BO2A 4RWWA 1MNEA 4DR2F 3N6NA 4NLRA 4ED5A 2R7TA 1R43A 2BM0A 2AYBA 5F8NA 2CKWA 2EI5A 4N5SA 2AD9A 3ISNC 3PIOQ 2IM2A 4OX7A 1LWFA 1KONA 4IQMA 1U1RA 2G0CA 1TVRB 1VRUB 4IH6A 1XNQF 2HS4A 1FD2A 1S6UA 2PT0A 4F4WA 1U24A 2O66A 2MQOA 1LXNA 4QIWD 5KFNA 1T05B 1RTJA 2C22A 1NK9A 2HHPA 1IKVB 4B9LA 4Y65A 1K73T 2LXUA 5KFHA 1JWWA 1RT5B 3T9ZA 4ALZA 3AA9A 1JLGB 4ES1A 3AA8A 2DHXA 4NL5A 1AW0A 5GAHU 2DCUB 1N6QB 1QE1A 5KT3A 2IA6A 1T03B 1SIZA 2J7WA 3GFZA 3CF5Q 3RRKA 3J7YU 3CVKA 2KRRA 1GTEA 3NCPA 2AJQA 1IR0A 2RS2A 1JLGA 3K59A 1N52B 4EWTA 1A6LA 1NK5A 1TK0A 4DQSA 4K4VA 4PUOA 3EGZA 1RAJA 2DHGA 4WFYA 4KRWA 4ICLA 2HFOA 1AXQA 2MKIA 3MD3A 1ULRA 2K2PA 1WG4A 3ULHA 1O51A 5IM0A 2HHSA 3PACA 1N6QA 3PW2A 3G86A 1T7PA 3SEOA 1VRUA 2A2DA 4X62F 5K8NA 2HWHA 3UE2A 2DO4A 1FJCA 1MW7A 2EBEA 2GX8A 1PC5A 1R0AA 2O1PA 3TAPA 2OSQA 5H9EJ 2DK2A 2ZFHA 2OP5A 2IA0A 1B0VA 4P6QA 5BYRA 3KLEB 4B9TA 2DNNA 4OLPA 2NPFA 2C3YA 3T6JA 4WZQA 4W90B 1P8GA 4WFZA 3M8SA 4ELUA 3NCQA 5KFQA 5A6PA 3PVXA 2G4BA 4U67Q 5KFRA 1Q7YT 1KRPA 1WEXA 1JLBB 3MMAA 1RTDA 5F8MA 1X7VA 4A4JA 1I94F 3MF5A 1Y5NB 2M2BA 2Q6BA 4OZLA 3QIDA 2GV1A 4WXWA 3N79A 2VG5B 4FVCA 1M5SA 4NLPA 5DRKA 2MY7A 2VQEF 4N77A 3GV7B 2GJ2A 2HS0A 1FRIA 1R6YA 3MPVA 4O3QA 5EGYA 2B7CB 4H4KC 1LOUA 4ECRA 1SKWA 5D4NA 3TUZC 1L3VA 3TAMA 2CQGA 5GAGU 3CCZA 2ZJPQ 2B43A 4ZVGA 3ZZPA 1S1UB 3H2VE 2CPFA 3RR8A 1QY7A 3GV5B 1P1TA 3IWNC 3LALA 5HMYA 4DFPA 2RMLA 3CSKA 2YKPA 5C42A 4R0JA 3CEDA 3KK3A 1K0TA 1PSDA 1DQAA 4TKTA 3MEEA 3M6WA 3H5SA 3UFCX 4DQRA 2ZVSA 5A0YB 4EUVA 1BLUA 1HQEB 1R8HA 2HGLA 4X65F 5E41A 3POTA 4DV5F 3UCUP 2PMHA 4KQZA 1RT2A 1N4LA 4KBIA 2UVRA 3GG1A 4DL3A 3MEGA 3GB0A 1ZM4A 2J9DA 2R7RA 3CCUS 2FJBB 2QT7A 3PJWA 4OLOA 4DFJA 1L3UA 1D8ZA 3DHWC 2BYCA 1XC9A 2HHTA 2EFNA 2VG7A 2YNIB 4IDKA 3GG0A 5EUHA 4XIUA 1X4HA 3I55S 2CPYA 4RW6A 3ZZRA 4IO9Q 2KI2A 3UD3P 4EYIB 4LJMA 1YIJS 1UVKA 2OPQB 5KFAA 2J9CA 3DRPB 4USJC 4EZ9A 2UXBF 2YNFA 3T1HF 4C2MA 1S0NA 1F0XA 2OO4A 5HP1B 2CQDA 1TUVA 1JLAB 4HDGA 2D1CA 1U49A 4QIGA 3IAM9 2BE2B 3I0SA 2DH8A 3DLEA 4EU0A 2YVSA 5KG2A 1X9MA 4F4YA 3GIIA 2I1RA 4CQ1A 1A9NB 1S0OA 1IXKA 2WBRA 1JKHB 2ACYA 4ILLA 3BZQA 5CYJA 4DL6A 4FPRA 5FDLB 1SKRA 2FVQA 4O23A 5J2QA 5DQGA 1U4BA 1S76D 4A46A 2P6SA 4O44A 3ETOA 4YHHF 1VK3A 1CEZA 1SH0A 5CZXA 1RDRA 5CA5A 3U1NA 1D0EA 3MM8B 2QLWA 4OL8A 3RB3A 4YB1P 3DNCA 2PD1A 5KG3A 2QSWA 1DTTB 5L38A 4OJ3A 4WK1A 4IYQA 3Q2SC 3T5JA 5D3GB 3M4XA 4RW8B 1R8BA 3PW7A 2RILA 4KR0B 4Q2LA 2ZH9A 1NJYA 2DO0A 3RBEA 2XMVA 4PG7A 2Q1LA 1G7CB 4BC9A 3MM8A 2J7UA 1D3WA 3DLGA 1V3ZA 2LQ9A 4PXBA 4OZJA 1KQKA 1JJ2R 1UVIA 5F0WA 4GMKA 3R3TA 2KT5A 4QYRA 4ZCMA 2ZD1B 3O44A 2CPJA 3BN7A 3IC1A 3N6LA 2J9DE 1R8PA 3HVWA 3UDLA 4JI7F 4JI0F 1H2TZ 3I31A 3MPYA 2I38A 2B4PA 4MYTA 2EFPA 4ECWA 4X64F 2JL9A 5EX0A 4TLRA 3GZ7A 2DT9A 4IR1A 2JX2A 2MDAA 2XO7A 1WI6A 4O4GB 3W3SA 3MEGB 3BF4A 2B9YA 4NLVA 5AXKA 4QR0A 6FD1A 2ZHOA 4M1KA 1HA1A 4NCGB 3QZ7A 3VAFA 4IOAQ 2IRUA 4X4PA 2JVRA 1FTCA 2AV5A 1RK8A 4QR1A 1UL3A 3AAWB 3LGNA 4G6VB 4OQJA 4LVNP 3MOZA 3W7BA 3KK3B 1GH8A 3FGVA 1RT4B 3MM9B 3QPIA 5AE1A 2WRMA 3B82A 4JUZA 1MU2B 2DNOA 3D5MA 3IA0A 3MPWA 1IQZA 2VFRA 1WELA 4MJKA 4KV8B 3KLGB 3OSPA 4DN0A 2ROEA 2YKNA 4JV5F 4QR2A 2C3UA 2L9NA 2W7PA 2KN4A 3OFGA 1RKJA 3RB4A 1URRA 2MJUA 1IQTA 2FY1A 4FF2A 3C2PA 2AW0A 2KZMA 1WTFA 4ECQA 1HFEL 5KG5A 4C8KA 1UW4A 3FRZA 1W2BR 4B9SA 2BV3A 4B08A 5K5MA 2I5JA 2Y1JA 1VC5A 3HHKA 1C0TB 3BQ0A 4DS5A 2AX1A 3B4MA 2Y1IA 4G1IA 4PQAA 4QW8A 1CQNA 3J80Y 1S1XA 3GIKA 1DAXA 2MYFA 1GTHA 3M6XA 1NK8A 2RRNA 4EO8A 3WBZA 4DQQA 2UVVA 1C0UA 2MXYA 3LQVA 4AYBD 4FS2A 4X4NA 4X4VA 5CQGA 2OD6A 2IYIA 2MQPA 1UVMA 4LF7F 1JB0C 4K4XA 1PILA 4IFYB 3V6HA 4O3NA 3LP2A 1M1KT 1WHXA 2MMYA 2VH7A 4QIEA 4B3OA 3M1VB 5EWFA 3P3DA 3PR4A 5LJ5Y 2E1RA 2VV5A 1LFWA 2ZH8A 2ZDOA 3LP0B 3MGJA 1ZPVA 4J9PA 3EGWB 4KJIA 5KFZA 3ICLA 1DBDA 4NLTA 4CZCA 1NZAA 2MGZA 2CVEA 1ZAXA 3EGNA 2VFUA 2KM8B 3OTDA 2DHAA 3OTOF 3Q22A 3TUJC 4C7QA 1K1QA 4DX8H 4O3OA 4Q7AA 2R8HA 4YQWA 4WZMA 3ZFVA 1CC7A 2IAJB 3HHLC 3N28A 2CZ4A 1ZBTA 2M3DA 3DLLQ 1UEVA 3RRGA 2XB2D 4CT8A 1M90T 2R2RA 1DTTA 2M9KA 3K8VA 4TY9A 1RTHB 5D8HB 3NMAA 2J9EA 2EK6A 5K8PA 1U26A 1QE1B 2LVWA 3PIPQ 1TKTB 3ITHA 2KU7A 5KG7A 2ASYA 2B4OA 1T3OA 1IBMF 1SL0A 4NLXA 3CXCR 3QJJA 5AXLA 5LXRA 5FDLA 3KLIB 3NL0A 3NS5A 4ES3A 4QZVB 5HROB 1CVJA 3G8QA 3OL9A 2DJWA 3DN9A 4B9UA 3QJLA 4LUBA 2V4QA 4MIAA 4LIWA 3NMRA 3NBPB 2DHSA 2FVRA 1T02A 5KFKA 4UUXA 1S1TB 3DLBA 2UUWA 2OFHX 1SUQB 2RB7A 3KNGA 2HNDA 3KMQA 4PKDB 3KHLA 4DR5F 3DRPA 1E6YA 4MMOA 1VQ9S 2N3OA 3KFWX 2A3JA 3DYAB 1FRJA 4RW4A 3TA2A 2G9OA 2P5VA 4O4RA 1HWLA 5AE2A 1JJHA 2D41A 2XMTA 2L9DA 2HIQA 3CT9A 1DQ8A 3KMSA 2LXIA 1VQYA 4NA2A 2M88A 4RBVA 3KLHB 2DRAA 3MM7B 3IR5B 4G3IA 1RGVA 3LP0A 1FE4A 5A2QY 4IRKA 2HQIA 2J0SD 4OX8A 3OBIA 5L9NA 2GW8A 4DV0F 5B0BA 4U9RA 1S0MA 3KHHA 3JAMY 2R7OA 5DO2A 1ZM3A 1UMJA 3G6XA 4JI3F 2X1FA 1H38A 2D7SA 2YKOA 2ILYA 2EG2A 2MQMA 4USHA 3J81Y 2PO4A 5KFLA 5M2PA 4P2SA 1S1XB 2NQPA 1ZYQA 3HX9A 5HMXA 5CYMA 4ZDNA 1HWUA 3US5A 3T6BA 3HT3A 1RTIB 4I68A 2BR0A 2N4CA 1HBNB 4X4SA 2PGCA 2KJWA 1S1WB 5LSRA 5DJBA 5KFTA 3CCSS 1UJ6A 2CQ1A 4J9NA 3M8QA 1CQMA 5IWAF 1DURA 4TQRA 3T19A 5KFSA 2ZH6A 3FEXB 4ZHRA 3DOKB 3CD5A 1Y3KA 2RSQA 2FC9A 5K14A 1AFJA 2VPZB 3K5PA 3MMJA 4JBCA 2YNGB 1HI8A 3LW5C 3DGPA 3V6JA 4NCAA 2ZOFA 1N5YB 3MM6B 4RW9B 3GYXB 3HP6A 2EBGA 4QPTA 2VBZA 3MMAB 3OTCA 2CJ9A 2XY7A 3UQSA 2AX0A 1EETB 5CZVA 1UKUA 1FNXH 1FF2A 3FEZA 3Q0AA 1TKZA 2BVZA 3P49B 2X51A 3AH6A 2VD3A 2Q3PA 5KT5A 4FF1A 3DI6B 5F8LA 1N48A 4MFBB 4CO2A 3K57A 2HNDB 3FFIB 1SUQA 4QJVA 1G3OA 2DNKA