1RWNB

Crystal structure of human caspase-1 in complex with 3-{2-ethyl-6-[4-(quinoxalin-2-ylamino)-benzoylamino]-hexanoylamino}-4-oxo-butyric acid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwnB00
2QLJB 3GJTB 1PAUB 1RE1B 1RWWB 3EDQB 3NS7B 2QL7B 2HBRB 2QLFB 2XYPB 1RWPB 1I51B 1SC1B 2C2MB 4ZVSB 3SIPB 3GJRB 4ZVPB 4ZVRB 2DKOB 1RWMB 3GJSB 3EDRB 3QNWB 2Y1LB 3RJMB 1I3OB 2XZDB 1RHRB 1QTNB 1RWOB 3KJQB 1GFWB 3GJQB 2C2OB 3IBFB 3R7BB 3D6FB 5IC6B 2CDRB 3KJFB 1BMQB 2H5JB 4JB8B 2H65B 3R5JB 2QLBB 3R6LB 2Y0BB 2HBQB 2C1EB 2CJXB 2H4YB 2HBYB 2XYHB 1QDUB 2CNNB 4ZVQB 3R6GB 4DCOB 4DCJB 1SC3B 2CNLB 3P4UB 1RWKB 3R7SB 4ZVUB 1RHMB 2XYGB 2QL9B 2CNOB 4ZVOB 1RHKB 2H54B 3KJNB 3R7NB 2XZTB 1IBCB 1RHUB 1RHQB 1PYOB 2C2KB 3D6HB 2P2CB 1SC4B 1RWVB 2C2ZB 2H4WB 2QL5B 2HBZB 1F9EB 2FQQB 5IC4B 2H5IB 1RWXB 2H51B 2H48B 3P45B 3D6MB 1RHJB 2CNKB 2CJYB 1NMEB 4DCPB 3IBCB 4ZVTB 4LSZB 1RWNB 5K20B 1ICEB
chains in the Genus database with same CATH superfamily
4GRSA 2MKHA 3UE2A 4PR6A 3K58A 3D5MA 3I4HX 2A1BA 3MM8B 4IOBA 2J7KA 2R42A 3TUIC 3RBEA 2A6OA 1MSWD 4CDIA 2OH2A 1OSCA 2HVHA 2M0GB 5HJYA 1BXNA 2H5EA 2QLFB 2Z2YB 3DOMA 4H54A 2UUBJ 1Q95G 1RDRA 3M8ZA 2CQ3A 3KK2A 3MM5A 4F36A 5A8KB 1XMOJ 1XMQJ 3W64A 1F6TA 1ZBTA 1SJ4P 2NXCA 2GVZB 2I9SA 3PFEA 2W9AA 2JLGA 2ZBPA 4IDKB 1YJUA 2RQMA 3M6VA 1J5OB 1CBKA 1YBTA 1HR0J 2U2FA 2Z2ZA 3OJSA 2MHEA 2YWEA 5KT5A 2XS2A 2EC2A 2DH8A 3L7OA 1WC1A 2YH0A 3MM6A 4NMXA 3KK3B 3QMQA 1AZSB 2WTFA 2ZH7A 3W65A 3G8SA 2R9LA 3T5KA 3EDRB 3OSPA 3CGIA 1QSSA 3VQSA 2L08A 2WSEC 5FLXU 1UPMB 1NKBA 1PBAA 3QPIA 2VF3A 2CJ9A 2EEYA 3D7SB 4KGVB 2VBZA 3CXCR 2Y0SD 1EIYB 4JI7F 4DV5J 4I1TA 4DFJA 4ILMA 4ZVGA 2QT7A 1QTNB 2O66A 1RGVA 3H5XA 4NXNJ 2HNDB 3AJ1A 1G4CA 1GFWB 2VG7A 2X1GA 3ITHA 2DH7A 2WCXA 4OYBA 3R7BB 2ZH6A 2YNHA 5KT2A 3I0SB 1ROFA 5BR8F 4K4YA 4IOAQ 3BREA 1QUPA 3HPOA 2VZ9A 1FE0A 5L1IA 2Q79A 4J9NA 2M7SA 1UZDA 4FYVB 1RXOB 1BQNA 1BWVA 2ZOFA 2HQGA 4KSEB 3PTWA 2CPYA 5G0RB 3X3UA 1U49A 1NJZA 4F2SA 2MZTA 2MMYA 2W25A 3ZZUA 1LWEA 2HQCA 2MLZA 7AT1B 3JYTA 3W2VB 3AD7C 3M2RA 2AU0A 3SQGB 3SV3A 3OVSA 4KHPJ 1HQEB 3CCTA 1U6ZA 3EGNA 1SL1A 1MWYA 2CA9A 2HRUA 2LEPA 2CQHA 3PRBA 4DPYA 4DPTA 1DZ5A 2YX1A 3FSXA 4R5PA 4E0DA 4B9LA 4PAAA 1A9NB 2VU5A 4N47A 2HHSA 2HQFA 4X4SA 1DQ9A 2PA3A 2ABYA 3P4UB 4FP9A 2BOAA 3FKBA 3OXFA 2OPSB 4LF1A 5IFMA 2BZ2A 2O3DA 3HZEA 4R0EA 1Y9OA 4ZVUB 2ZWOA 1QSYA 4N76A 5L39A 4CO5A 3PRDA 1UVKA 5KG2A 4JI5F 1Q5VA 3WC2A 3EJMA 4DEZA 4MKBA 2YY3A 1L3VA 1RJJA 2LA6A 3WX8A 3HJVA 4EBCA 5DQGA 2CQGA 3DI6B 5C24B 4DPXA 2HIYA 1B7YB 2RH3A 4ES3A 3ZZOA 2RQCA 4DQQA 4H4OA 1FK9B 3JSMB 2AGQA 1RWVB 2C2ZB 2VFRA 2ZVIA 4LRFA 3VVUA 3VAHA 3M2UB 5FD1A 1GXLA 3A4TA 4FF2A 4F26A 1U0HA 5B09A 5KAKA 2BDPA 4CH0S 4NYPA 1FEEA 2B4UA 1OY6A 1EETA 5C5JA 2OI2A 2QSWA 4DX8H 2H51B 1HW8A 3BSNA 4K2JA 2Z2LA 2IC3B 3GR0A 4ECQA 2UU9J 2XZWA 4ITSA 4TVAB 3G6XA 1H3DA 5D0EA 3TQEA 4RUBA 1CG2A 2ZC4A 3QFWA 4YMEA 4FXDA 4BWJA 4JI8J 1ZETA 1JLQB 2Y1IA 1YJRA 2G4BA 2HK2A 4OZJA 2RU3A 1REVB 3JQMA 3PDNA 5KOXA 1ICEB 5GVQA 3BO2A 3C6UA 1FJCA 1SJQA 1OQ3A 1SUQA 2HBRB 1PG5B 3M30A 4CNZA 1U8SA 2RDJA 2BBEA 2JL9A 2DISA 3EZUA 1ZM9A 3GG0A 5IV3A 4FS2A 2R7SA 4OX6A 1RYSA 3QLHB 1RKIA 2ZBRA 2MJUA 5H9EJ 1RAIB 4J9MA 4YN3B 1RTDB 5F8NA 2HAIA 1IKYA 4A8SA 5THWA 1Q4RA 4DR7J 1RT6B 3NP5A 1L3KA 5G0RA 4X4OA 5ETVA 1RWMB 3JTPA 3BZQA 3I96A 2AEMA 2B4VA 4DN9A 3K7RA 2BVZA 3MCMA 3H40A 3J7YU 4DV5F 4F4KA 4ECWA 4F4ZA 3AB2B 2ZM6J 1H7XA 3SDEA 1SKWA 3HSGA 3CCRS 4OX9J 2JDJA 5LXYA 2CG8A 1I3OB 1RCOB 1TUWA 1KQSR 2B5JB 1RTHA 1S1XA 3SXLA 3CMAS 2XULA 4CTAA 3V6KA 1P9QC 4IFVA 4GKKF 3BEGB 4PUOA 2MQ8A 3DYAB 3ISNC 4ED6A 2HMIA 3MAHA 2A2CA 1Q82T 3FEYB 2XS7A 1YRXA 2VFTA 3O5TB 1EX8A 1JIHA 3IO1A 3I31A 1HBOB 3M4XA 3AOBA 3O1LA 3QSIA 1UW4A 4OV6A 3O2IA 1MWQA 3W9HA 3OFHA 5GAHU 4PABA 3N5BA 1HHSA 4PQUA 3MMAB 3MI7X 3RZAA 4B3OB 1R6VA 2V2KA 2J6SA 4F67A 4GVBA 1VISA 2IM2A 2WVDA 1RABB 1CQMA 1TR0A 2AZ3A 3D6TB 4M5DA 2LFVA 3HHDA 3NXZA 2YNIA 4NYOA 3GIMA 2ZHAA 3RTVA 3KLFB 2E5LF 2B43A 5LJ5Y 2RJZA 2WBMA 3BGOP 3CD5A 3FZ2A 2AEJA 3TRGA 2CAJA 1BQXA 2YWGA 4X4VA 4DR4F 1CJTB 4ZCIA 1OPZA 3LANA 4JI6J 3SCKE 4YY3J 3DI6A 4LF2A 1Y10A 3KKFA 3M32A 4CIOA 3Q8RB 3SYZA 4A8WA 3CEDA 1X0FA 4IQXA 1DARA 4C6AA 3PIOQ 3PR4A 1S0OA 1LXNA 2UUCF 1RADB 4OZNA 4C8ZA 1KVIA 2NPIA 5KFZA 1K8AT 3T5JA 2MPUA 4QIEA 1UETA 1FCAA 2BM1A 2HFSA 2ALYB 2RS2A 1NK7A 3MF5A 1RTHB 1S1XB 3PY8A 5KFTA 1LEOA 3IRXA 2R7OA 2DR9A 2L9WA 3HCXA 4ICLA 2GAHC 2ZH5A 2DK2A 4FYWB 5CZXA 2DD8S 2OJ3A 1S0VA 4WFAQ 1LWCA 3EZOA 1JJ4A 4M8LA 3H0PA 5DRKA 4WU3A 4RBUA 2UXCF 1UVNA 5E2QA 1IXKA 4OL8A 2CG4A 1IR0A 2DIUA 3IM9A 3K0JA 1KBRA 2DHAA 3A3NB 2VKRA 1D9DA 4U7UD 3IR5B 1SC4B 2K1RB 8AT1B 1Z4UA 1LFWA 1WSRA 1IKYB 3E51A 2FLOA 5CYMB 4Y3CA 4B08A 1M5KC 3VAGA 1G6BA 1FKOA 1VQ4S 3PYEA 2FHOB 2OGUA 3IMQJ 2NXJA 3K8WA 1SPBP 3JTNA 2GIRA 4HH1A 1DTQA 1FFGB 2YX7A 6AT1B 1LW0B 4ID5B 3KTQA 1IQTA 3FDSA 4F50A 2DNGA 1Y00A 1AB8A 1WG4A 4OZ1A 3TX0A 1R0CB 4KC5A 1GXUA 2POKA 4DSIA 1RWNB 3VAMA 3QBCA 2VIHA 1W2BR 3MEDB 1R3NA 3VHQA 3BYRA 4C7QA 3TUZC 4CT9A 2ZH1A 2XY6A 4WFNQ 1YVFA 1H98A 3DRSA 4ICLB 3TVYA 3RAXA 3DGPA 3W63A 4FYYB 4MYTA 1CVJA 4F02A 4F0HA 4UT4A 4NEZA 4ELUA 1TL4A 3FCWA 3QRRA 2YQ0A 4K50A 5AJ3J 2R7XA 2F4VF 1EETB 4O4RA 5IT0A 2IA0A 3NAIA 4USWA 2KKHA 3PXGa 2QA4S 2PMHA 3I5BA 4GKKJ 2ZJRQ 3E8OA 4KRWA 2KG1A 2AJQA 2IYGA 4XTTA 3BSOA 3UN5A 1JB0C 3GJSB 4P72A 3THTA 3KLHB 3SI8A 1V5IB 2CPIA 1TMJA 3QAEA 3QSYB 3W2WA 4IDKA 1NK6A 2PDAA 3EVWA 2X1BA 3H98A 2KXNB 2OFGX 3RJMB 1U1NA 1IBMF 5D4LA 4NLDA 2MKKA 2CQCA 4FN5A 4ZLNA 2X51A 2FGCA 3HFKA 3GE9A 1HNVB 1SI9A 2BKOA 3LALA 1FRLA 4G1QB 3DOMB 5GADI 3Q24A 5HP1A 4PXDA 4J9QA 1RHRB 4KAIA 5CA5A 4F25A 2HRTA 5U47A 1NUEA 4B9MA 3FUYA 1S9EB 4RW6A 2C2OB 5KFAA 2HHTA 2MJNA 1HBOA 3JQKA 2AKWB 3L9ZA 2GMHA 5K8MA 1WC6A 2CZ9A 2CYYA 2VFVA 3BPDA 1TZ0A 3PHEA 1TKTB 2W8KA 4LF6J 2RDDA 2AJ4A 4B9TA 3THPA 2VUGA 2ZJPQ 4DV4F 2C22A 4R8UB 2NXUA 4BBYA 4QWAA 2XGPA 4QYZK 2XY7A 3ETOA 4DZ6A 4DV6F 1SKRA 1HNZF 1TL3A 4NCAA 4OZ5A 2QIFA 4G6VB 2UVUA 1Y4ZB 2HBQB 2YNGB 2UXBJ 4FKYA 1PYTA 2LXUA 2RUSA 7FD1A 4B9VA 1EJ7L 2BJ1A 2QFIA 2ROPA 1FX2A 2HBYB 3UNYA 2FJWA 1PILA 2RS8A 3CUNA 4O3RA 1BQNB 1XWLA 1QAYA 2RHQB 5D0GA 3UO0A 4ED1A 2DRBA 1C1BA 3V6HA 2HK3A 4OX9F 3Q86A 2EBGA 5KFNA 1N33J 2BXJA 2RSQA 3AOCA 4OJHA 5HBMA 3PYGA 3MECB 1VRUB 1S9EA 1HYSA 4KGZB 1V5VA 2QL9B 3DRYA 2JSXA 3MUTP 2D69A 3DU5A 1LK7A 3H2UB 3MEKA 3UPFA 5CHCB 4A8QA 3ZFVA 4C11B 5HO4A 2PEBA 3QT6A 1E6VB 2B3TB 2D3UA 3R7NB 2DGSA 2DHHA 3LAKA 4ZKAA 4YDDB 4ZCLA 1FRHA 2MKSA 4WJBA 3ZXWA 3T19A 1J5EJ 4NLVA 1T94A 2B56A 3GR1A 4MIAA 4OHXA 4OHWA 1UFKA 2DR7A 1SJ3P 2IC3A 4HH0A 2J5AA 4NXMJ 4QU6A 2LU2A 3AXMA 1EKRA 1WG5A 3NCRA 3NCQA 3HX9A 4MIWA 1P1LA 4PQAA 4ZK7M 4RU9A 5IT9Y 2DRDA 3J81Y 2Y8YA 1CC8A 4OYWA 5KFLA 4EWTA 3MPYA 5F3ZA 2OTJS 4GKJF 1KONA 3W8PA 1B70B 1J2VA 1ZAXA 3G2XA 1VQNS 3AB4B 3CDWA 3WHIA 4B02A 1NMEB 4B3RF 4DR1J 3DGPB 1HNIB 4YOEA 4ZVTB 3OR2B 2LMIA 1NHKL 5C24A 4RUHA 1Z1ZA 3KMSA 1YWXA 3V81B 1VBXA 3CCES 1X4HA 3HLUA 4XPCA 1GT8A 2LLZA 3NNAA 1S9GA 3NKYA 4RWXA 5DJBA 4B17A 4M5HA 1RWWB 4AL7A 5ETOA 1WC0A 1Q53A 3PJ9A 2DO4A 5KOWA 3FCVA 4K2XA 4L76A 1WEXA 4NLWA 2UU9F 7FDRA 5D8HB 2EPIA 3HF5A 2V6AA 1IKVB 3NGSA 4P2FA 3RBXA 3W8GA 2C3MA 2OPSA 3TVKA 3AH6A 1MU2A 3MEEA 3RYLA 5BR8J 4C8OA 2OIHA 1WD6A 1SBRA 3BGLA 4OYPA 4O3QA 2J0SD 4LIRA 2CJKA 2BE9B 4KO0A 1B3TA 4KBIA 1FEHA 4O3PA 1SL2A 1U1QA 5DETA 2X1AA 3MPVA 5E5NA 4WU2A 1GMWA 4ED3A 1OIAA 3M1VB 5KG4A 2V8PA 3CO9A 2CPZA 3I87A 3IS9B 4ZP9A 1JXVA 2YPZA 1IBLJ 2FLNA 3W2VA 1AROP 2GV1A 2J0XA 2ASLA 3AHPA 1DHMA 2IVFB 2XY5A 3QJLA 1NDCA 2A6MA 3DFEA 2N82B 1HPZA 3QGPA 2MGZA 2VKZG 3ET6A 2MKCA 3HKWA 3HZGA 5HMZA 4KHPF 2QA4G 3IBFB 2DHGA 1TKZB 3BDPA 5CAAA 4IRDA 3OTBA 1NEEA 2DR5A 3SQOP 2CUYA 2YNHB 1S9FA 1AT1B 3GIKA 4O44B 1NPKA 1JLBB 1GAOA 3MM7B 2V9KA 2MLYA 2H65B 1FRJA 3QRPA 3N4WA 2QYGA 1VQSA 4QPXA 3ZZRA 1NK8A 4F8RA 4TY9A 3K5OA 1ZTTA 2R8GA 1QD1A 2FJBB 4BC7A 1ULRA 1XMBA 2KHCA 4MK9A 4XK8C 1DBDA 3CWJA 1NDKA 1HI8A 3P8BB 5KFSA 4D3GA 4OFZA 4QR2A 4QR0A 1HA1A 4I69A 2ZH2A 2GQ2A 3OTDA 3G71S 2ROGA 4TY8A 1FWLA 1S99A 4ANDA 2BACA 4UW2A 5DG9A 3LF0A 1PJ7A 4BCAA 5E33A 3W9JA 1HD0A 1ZZFA 5HLFA 4P75A 3R8YA 1B7FA 1VFJA 3MAAA 3EPGA 5DG7A 2EFVA 5K14A 2MQMA 1OSDA 4Z7CA 2VL1A 1YGYA 2J76E 2J8AA 3FFIA 3N01A 3G9CA 3O3LA 2NS1B 3OT9A 3R7SB 3US5A 3DLHA 2EG1A 2VPWB 4I6YA 4DFPA 1F3VA 1OQ6A 2EG2A 3O44A 4NYZA 4N5SA 2UVVA 1U2FA 3AD8C 3G96A 2O5DA 2QV6A 4KHMA 5EUHA 5BYQA 1FXRA 3T1YF 1HR0F 2JLFA 4GKJJ 2R7TA 5B0FA 1KRPA 1NZAA 4R0JA 3UDVA 4Y0FA 2LQ8A 4AD6A 4KT0C 5B08A 1VQMS 1S7HA 3HSJA 1MMDA 1NNDA 3H8YA 1NO8A 3BGRA 5K8PA 2XC9A 3ILLA 2E9ZA 4FS1A 4DLEA 2FDNA 3C6TA 4NLOA 4LIWA 3A8IA 4ZPVR 3T6JA 4JOUA 3OL7A 2C2RA 4DR6J 3PHTA 5IXUA 1H2VZ 4P52A 3V4MA 1KFSA 1LW0A 4ID5A 2ZKUA 1IBKF 1UCNA 1LWFB 4ID8A 1KVKA 3JB9k 1XQIA 3FGVA 1F9EB 2HNZA 2GVDB 4QWDA 3H42A 2RD5C 4FBTA 4K4VA 5F8JA 2YNFA 3GSIA 2G13A 3GU0A 3BV8A 2F8EX 2DNMA 2LVWA 4HTIA 8RUCA 3QLHA 3UD5A 4ETZA 4ECZA 3M6UA 4X62F 3J80U 3D6MB 1QTMA 2HAFA 1G2EA 1DQ8A 4YFUA 3I4PA 2HYIB 1CULA 2V67A 3PEJA 4DQRA 1DJ0A 4IH5A 3HJFA 3HD1A 1HQUA 1HBNB 4JI1J 4O3SA 3LPYA 2R2TA 2K06A 2HPUA 1P1TA 1RLDA 2GGPB 2YQ1A 4AE5A 3NNHA 1K0VA 3RR7A 3CIMA 5J1NA 3D0IE 3H90A 1RWUA 3MDFA 4A8MP 1CQNA 1ZYQA 1N36F 4CYUA 2B9EA 2ADCA 3Q8UA 2IRXA 3NS7B 4JI2F 3V2UC 4K4TA 2HHHF 2HHPA 3GWCA 2QC3A 3K5PA 1XR5A 2RNEA 1RWPB 3MMJA 2FY8A 1B64A 3N79A 2IBOA 2JEJA 2NSCA 1MN7A 2LQ9A 2Z58B 2BW2A 4KE5A 4RO0A 1XR6A 1SC1B 1CJKB 1WORA 2AYEA 2OHDA 1V6HA 1Y3JA 3CDUA 4ZP8A 2KU7A 5DDQC 4CLFA 3D0GE 2Y1RI 4KIAA 3T1AA 1XERA 4DL6A 1FK9A 3JSMA 4FYXB 1G3OA 1IR2A 1JLAA 4H4OB 2WONB 4BC9A 2C2EA 1A7GE 1PYSB 4KPCA 4EFAC 2XLJA 3A3PB 3DMJB 3M8WA 4QYRA 1K1QA 2ZOMA 3ZNUA 2HG4A 3QJPA 1H6KX 1U02A 3ELHA 2RF2A 4ZN3A 1JQGA 3C46A 4LF7J 4ZPDA 2AQ4A 5DZ6A 4M5DB 4AQYJ 2HHXA 4C8KA 3HHLD 2VHGA 1C4AA 4FPIA 3D1QA 3MCSA 3TO8A 4DU8A 1S0NA 4EYHB 1KTQA 2OD6A 5A6WA 2RU9A 4CLKA 4O4GB 1SV5A 2DPIA 2AJFE 5E7OB 1T9WA 5L1KA 2EFOA 2GGPA 3CPWR 3MURP 3A8KA 3MPWA 4GVLA 4OHVA 2QLWA 1YJNS 4DS4A 3EE3A 4IFVB 2PIIA 2VBYA 2WB1D 5F8GA 2MZQA 2FLLA 5GAGU 2AF6A 5B0BA 4QYZJ 2KG0A 3P3DA 4HVZA 4WTOB 1HQEA 1NCLA 1P6TA 2DRAA 2JVRA 2Y0BB 2Z8QA 2OPPA 1UA0A 3KG1A 1WWHA 5KG7A 2Q66A 1R8HA 1LQ9A 2OO4A 1RI7A 2QG9B 1WF0A 4F4YA 4C0BA 1S12A 2FYXA 3JTOA 4PXCA 1QVFR 4EMDA 3DDNA 2HQDA 3DLEB 3E2EA 2RAQA 3HVTB 2UXDJ 3R1LA 2ZE2A 4LBHA 1WF2A 1RT6A 3O8WA 3R6GB 4MFBB 4F3QA 2LQJA 1FESA 2CFXA 5HANA 3MMCB 2ATCB 1FT8A 4DCJB 1R0BG 1TL1B 2I5JB 3BH6B 3LAMA 2GO9A 2P9GA 1KVJA 1IVZA 2PEHA 2WVFA 2CWXA 2GC8A 1FVQA 1VIXA 1Y7PA 2DNOA 3F0NA 3ITHB 5DQHA 1Z2ZA 3G82A 1N5VA 5KFFA 4DV4J 2CNOB 4CCHA 1ELOA 5ETLA 1KDNA 2Q1LA 5K8OA 4IG3B 1CJVB 4NLTA 3KLGA 1ZM2A 1EAYC 1JJCB 1FTRA 3GFHA 4UOHA 9RUBA 3V5RA 1VC0A 2EVZA 1LV5A 1JJ2R 5K14B 2DEJA 4GO5X 4NEYA 4PEOA 2ZBIA 4YB1P 1FWKA 2F9JA 4HHJA 4CRJA 2J0QD 1RTIB 4JI5J 3G8TA 3F73A 5K8NA 4UOCA 3W1YC 1RAJA 1ZPWX 2CPFA 3LA0A 3R9LA 3PVXA 1T05B 3F44A 2GQQA 3QWUA 1N8RT 3BDEA 2FQQB 1UJ5A 4ECRA 1M1HA 4NLXA 1KSPA 1UWBA 3HHLA 4OYIA 2H5IB 2YKNA 2GFFA 4ED0A 3C66A 1V3SA 1JLFB 2RQ4A 2CPXA 2YWKA 1YDLA 1RHJB 3SFUA 3TJ9A 1CEZA 1Q78A 1MLAA 2CJYB 1YK9A 1NZ8A 1JLBA 2V94A 4J9KA 1LNQA 4FNHA 4USUA 3WQPA 4YB6A 1MMLA 1TV6B 5DDRC 2KM8B 4DI6A 2FPHX 4NX9A 3NMAA 4HI2A 2DNPA 2W2OP 2WVEA 1S1UA 3GTYX 1EQMA 3PACA 4E98A 4LQ3A 2VOPA 3LP0A 5CCMA 3EWGA 2FVPA 1SJ1A 1BUXA 4YY3F 3BKTA 2U1AA 2XMMA 2LA4A 1IR1A 3W5ZA 2XWYA 4IR1A 2DR6A 1YI2S 2FJDB 4F04B 2PMWA 4L72B 4ZDNA 1F9FA 4EZ9A 1FKPB 1HNXJ 3GG1A 1VGYA 2YTCA 5M2UA 2D41A 3DOLA 1IM4A 3CJSA 2ADBA 4WFXA 1WTFA 1SH0A 2OP5A 2ZDPA 4OHZA 3SCJE 2E5LJ 1S76D 3U02A 2A3JA 4NI2A 4RW7A 4DR5F 3FK4A 3WBZA 1RAGB 1UAWA 1WKJA 5LOQA 1R0AB 3DRRA 1RAEB 4RLEA 4L6V3 2XS5A 2Y8WA 1FDNA 2AX1A 3ILIA 3JSYA 2HVDA 2P5VA 2C2NA 4PG4A 1GTHA 2LCWA 2WB4A 2LEBA 1RT7A 1F5AA 3MCNA 2GS8A 1YZ6A 2VFSA 3IA0A 1Q16B 5CH7B 1RTJA 1GX6A 3R5CA 4UOGA 1HNVA 3M8RA 4LFCF 5D3GA 2DGVA 1HL6A 4F7VA 2N7CA 4ECUA 1TV6A 1H2UX 1UTAA 4P7TA 5KFOA 5AJ3F 1T03A 2QE5A 1OJ4A 4B3TF 5T7LB 1MN9A 1D1UA 2QSFA 3DMJA 1JKHA 2HWIA 2R7WA 1HNIA 4NA1A 1HWLA 2HWHA 5HMYA 3KLEA 3GFZA 4P74A 5L38A 3GIJA 1SJFA 3CO0P 4NZ7A 4OX7A 2R7VA 1S72S 2PD1A 3AD9C 3KLIA 4DR2J 4MIBA 4ZPTR 4LJMA 3VAIA 1MNEA 3FSIA 4LFAF 4G65A 2R3VA 3FQKA 3D3CJ 4F3MA 3WX4A 2M4MA 4J9LA 4USTA 2N3LA 1LFPA 2HFUA 4WE1B 4CO4A 1FRKA 1RA7A 3NRBA 1QDUB 2XBPA 4C4WA 4DQIA 3S8SA 3KK1B 1XIQA 4UY8T 4M5KA 4CWBA 1REGX 4DPOA 1J5OA 1VC5A 2BRLA 4FF3A 2VONA 1T9YA 1ZPVA 5EWEA 3OV7A 2OMLA 2HVIA 2IM0A 4LMZA 1T03B 3OLAA 4CZCA 4J9RA 1NB2A 2YQ3A 4DR2F 1UVMA 1F3FA 1UEKA 2J7UA 3DLLQ 1SQGA 3N0VA 3QIDA 4JI8F 2ILZA 3K5NA 1WNEA 2X1FA 1S6PB 1TAQA 2AV5A 2BABA 2W7OA 1HYSB 4DBQA 1O6XA 2RDIA 2MTLA 2XMJA 2H54B 1RBOB 1VR6A 3OTOJ 3I55S 2XMKA 1OYEA 2XLKA 1P27B 2HNZB 3EXCX 1VQ7S 1FD2A 2ACMA 4DLGA 3SSQA 3CCLS 4ECSA 4LFCJ 1R0AA 2JNJA 3UDEA 3HVTA 2ZNZA 3OBIA 3D6HB 2P2CB 4LT6A 3FCHA 2J9EA 4C8MA 2XGQA 4U9RA 4ERDA 3MR7A 4JV5F 3JAMY 4EZ6A 1YTYA 5CYQB 1R7IA 2BJ9A 2UUCJ 4PG8A 5E3AA 2HSEB 5C2CA 2OTLS 4PG7A 4HR2A 2GW8A 3QO9B 4I7FA 2C3PA 4QU7A 2CADA 3CJ4A 4DR5J 5IM0A 4DR7F 3DU6A 3R2DJ 5FLXY 3IWLA 1OWXA 1YQHA 3KUEA 4EBDA 3FBEA 1S6QB 2DB1A 1U1LA 1TKTA 4U7UK 2EFQA 4KV8B 4KGXB 4NOHA 3UDLA 4QW9A 3THVA 3IGNA 2W9CB 2MKJA 4H4KC 4DV2J 3SSRA 1Y5IB 5HLFB 2PO4A 3V4IB 4P2XA 2HWTA 5ETMA 2QL7B 2HGMA 1U7LA 1NK9A 1UPPA 2RQKA 1S6PA 3BR8A 1IM6A 4UQTA 1PJ5A 2RMLA 3PW4A 1P9YA 4PRFA 1DTTA 3CCUS 4HACB 3D67A 3PYFA 2Q6BA 2E1CA 2K7JA 3HHLB 1NK4A 1EKSA 1M0SA 2IY5B 3NOCA 3SZ2A 1BD6A 2OKQA 4LRDA 5MAOA 1VQKS 4G3IA 1UKUA 5FIIA 1N54B 2FZKB 4I6WA 2E29A 2KI2A 2OMOA 3IAS9 1N5QA 2V8DA 3QIPB 1NJXA 4J9SA 4DR1F 1HARA 1S6UA 4DUYJ 4WP8A 2JLEA 2V2ZA 4QOTA 3H4BA 1U1OA 4HI1A 1NSAA 4ZN1A 2UUTA 4FDFA 1URNA 1UJ4A 1NPPA 5EX3A 5E3PA 4I4BA 2HHWA 3BPSP 4YHHF 4GC6A 1ITPA 3DDKA 1FNOA 3B4MA 1HPZB 3HSZA 4NA2A 2UUBF 3I0RA 1Q8KA 3VZHA 1YX2A 3G82B 3JAMU 2AW0A 1UEUA 2E5HA 4P73A 1V9OA 2MHNA 1WC5A 3G86A 3IGVA 4OQJA 3SFGA 4CI0B 3D3BJ 3J81j 3BQ1A 4IO9Q 1M5PC 3PNIA 2FHKA 1TUGB 4NCGA 3KYLA 1O5JA 2H3EB 4Q8FA 1RU1A 1W25A 2B9XA 3IS9A 2DY9A 2X3GA 5IC6B 1F2HA 5KFRA 2OEKA 3VR1A 4DG1B 4ZCMA 4C3LA 3CC2S 4NMLA 4DPUA 1Q86T 2ZZMA 1DLOA 3V6DA 4ED2A 4TQSA 2DNZA 2DNRA 4NE9C 3CCVS 2PE8A 1QUVA 4LF7F 5KFIA 4HDGA 3S01A 2KZMA 4OI1A 2ZD1A 3BQ0A 1W26A 1S0MA 1UW9A 2VQEF 2CJXB 1WSVA 2FB0A 2H4YB 2NXNA 4USKA 3DRRB 5L1JA 5I3UA 1WC3A 2G2YA 3T1YJ 1HWUA 1RT2B 2RRAA 1U4BA 2FVRA 2ROEA 1T9XA 3BSAA 2IDLA 2OPRA 4N41A 1S1VA 1TL7B 2D9PA 3IR7B 5JXSA 5GMEA 4ZPCA 1SC3B 4FZVA 2XEXA 4TLQA 4TU7A 4LR9A 4HYKA 1LWCB 2WW8A 2F7VA 2E1AA 1REVA 3H5SA 1PC5A 3I5CA 3HM9A 1CPZA 4IYQA 1QVGR 4FYDA 4X65J 2MY7A 4RNHA 1VOMA 1X4EA 1T0TV 3GSDA 1C1CA 2XYGB 2V8HA 3QZ8A 1X31C 4DJBA 2HHHJ 4M94A 5GAHI 4ETXA 3DRXA 1W2IA 1VS3A 3K5LA 3DLBA 4ZPAA 3NNCA 4DF8A 3OUYB 1JXLA 5I4MA 3CJTA 2N4DA 4WYLA 2Z2MA 2GNKA 2BE2A 3RAMA 4JI1F 4NASA 3NGRA 2RVJA 3TJ8A 3QIPA 5ETQA 3IWNC 2NQPA 3AA8A 3UFCX 1N4LA 2VDIA 2IRUA 4TY8B 3J7YI 1SH2A 2E5IA 3M6XA 4JI7J 3ZNJ1 2V8GA 3BS9A 2PI5A 2VDHA 3TEGA 4OIXA 1RT3B 4OLPA 1TK8A 1N34F 2AT1B 1VQ8S 4C97A 2R8JA 3S1TA 2G0CA 3CJKA 1VQYA 4Q2MA 5E3CA 2R8HA 5EHHA 2KO1A 4NLSA 3I56S 1T05A 2HS4A 2ACYA 3RW7A 1ZA2B 3DLGA 5J2QA 2W4CA 3QGIA 4LF9F 1Q0NA 2DIVA 5J1PA 4DV0F 4DR3F 2QLXA 2OPQA 3F41A 1VJWA 3ADAC 2BANB 1X5TA 2ZH8A 3BGUA 2F63A 2P8IA 1WOSA 2ZHOA 3HVWA 1VK8A 3GPAA 3KDNA 3UI3A 3BYPA 5LSOA 3OUYA 2HMIB 2W2NP 1YBUA 2IVMA 3NS6A 4M1KA 5C25B 3W5XA 5KT7A 3M8SA 1N34J 1KHVA 2MGZB 3FRZA 1YHQS 2XNRA 2EK1A 1CLFA 1EZZB 3DRPA 2KXHA 5K9FA 2QZ8A 3N28A 5J2PB 1JLCA 2FC8A 3VGSA 3SDEB 4DQSA 2CQBA 1XNQF 3Q22A 4QJVA 1HBMA 4F4AA 2GIFA 2YNFB 3CJRA 3G6ES 3AJDA 3QT8A 3CDAA 5BJRA 4ENOA 1WELA 3M9MB 5JMNA 1XNQJ 4ZVPB 1BC6A 1TL7A 5JVHQ 2VC1A 3CJQA 4H4MA 4Q2LA 3ETMA 3D28A 3A8EA 1X7VA 1IUJA 2LEAA 3OL6A 5A8RA 2FC9A 3GZ7A 3H7HB 3ZTOA 5I3PA 1RTDA 3ISZA 1EHWA 3OTCA 4MKAA 1IKXA 3LWLA 2YWWA 2XMAA 3R27A 2EKNA 3A12A 2KM8C 1T02A 1FERA 4C3KA 1KQGB 1RISA 1SKUB 3Q8QB 3JSRA 1VC6A 1Q7YT 1L3UA 3M30B 3BGFA 4RKUC 5KG1A 4ZOSA 3DOKA 2EI5A 4DSEA 5KFEA 2HHVA 5HQMA 4JUZA 4LRBA 4FKXA 4YB5A 4AYBD 1S9GB 5F0WA 1RCXB 2RILA 5KG0A 4DG1A 4AXIA 5EN1A 5HSPA 3FC9A 1T3NA 1EARA 4EO6A 2FGOA 5KFMA 1OMSA 3BR9A 5I42B 1WHWA 4O0IA 4I67A 4RWWA 4FPRA 5F9NA 4YDXA 2O01C 2LU1A 2ZC3A 2BM0A 3KDOA 4LUBA 3KK1A 1JX4A 2R7RA 2V34A 2XQCA 2QLBB 3BO4A 3AXKA 3R6LB 3S6EA 1SB6A 3TANA 1NSKL 2BJDA 5DM6Q 2JFDA 3TZYA 1IBLF 2GVZA 3A1YG 1HNWJ 4HEA9 4DPWA 5A8KA 2C1EB 4USMA 1GMWD 1X0PA 1YBAA 3CW2C 2F3JA 2NYIA 3NGTA 2E66A 3S7RA 1GMVA 2F40A 2YWHA 3QAUA 1FNXH 2M70A 1VQ9S 5KT6A 3P6YC 1BLUA 1JLAB 1KHWA 2JC0A 1KC8T 3ZTQA 2J6TA 2IJNA 3CE8A 2G0JA 5HQ8A 4Y00A 2WOMA 2DCLA 1VRQC 3BBBA 3K17A 3RBDA 5D4PA 4RX6A 4CLWA 1WKLA 2KVQE 4C2MA 5HL7Q 3G6YA 2EW9A 4OMFG 3K57A 4W98A 1WC4A 5B0DA 1C0TB 3LGMA 1NM2A 4OHYA 3EICA 4DL2A 1KNZA 1RTZA 4ZVOB 2JH3A 4CYUB 2VB6A 3NWRA 4O3NA 3L95X 2VQEJ 2C3OA 5ETRA 1OY8A 3EGVA 1ZS6A 1KLNA 1N32F 3KG0A 3KHRA 3CDBA 3AQPA 2CQ4A 4DR3J 2UP1A 4Q0BB 3M1VA 3SSSA 1JLEB 4J91A 3J7Z5 4DL4A 4OJGA 5EWGA 2EC0A 4Q0BA 1HLWA 4RR5A 3EYZA 1D8ZA 1Y3KA 2LP4A 4KH1B 5HROB 1S4FA 3JYTB 1NK0A 2APOA 1IWGA 2BJ8A 3P45B 2W1BA 4G1PA 4WFZA 4Z7YA 3J7ZT 4QWEA 3NGUA 2IM1A 2IM3A 3EM1A 4DV1J 2BA9A 1I94F 3DM2A 2DNQA 2IAJB 2E1RA 3Q8VA 4DCPB 1U1PA 2PN6A 3C16A 3V6JA 2ZZTA 4WFYA 1N6QB 2VG6A 4UZCA 3TP2A 4KFBB 4A48A 3UD3P 3ENAA 1WI6A 1FDAA 1LW2B 2VG7B 1S5ZA 1TAUA 1PAEX 2WK4A 3PEHA 1T95A 5AE3A 4CO2A 3FZBA 3AY0A 3VGVA 5E3QA 1MG7A 1HMVB 1AA1B 1JLFA 2B7BB 4IRKA 3ISND 5AXMA 2KL8A 1N5SA 2FZGB 3ZTPA 1X9SA 1N32J 3KOAA 2ZH9A 2CJQA 2F4VJ 5ETKA 2BKNA 2D7SA 2HNYB 5BYRA 4LVOP 3OTOF 2ZH3A 1HNZJ 2KTQA 4ANCA 3PX6A 2HURA 3RRGA 1VDHA 3W7BA 4N77A 3MCOA 5IS2A 1S97A 4PQUB 3BM7A 1C2PA 1C4CA 3GQCA 1X4DA 1FRIA 1R89A 5KFGA 1X60A 2FZCB 2KFYA 2W4PA 2W9BB 1HQ2A 3PM9A 4OJ1A 4NXMF 1VJQA 5L46A 4ED8A 2BQUA 1FJGF 1M1KT 3EGWB 2G0IA 2XZDB 2WZ1A 4QZVB 2QFJA 5LSLA 4KH0B 1IJFB 1BHNA 3IAM9 3IWXA 3MM8A 2QMUB 4DFKA 2G1HA 4L75A 4U7CA 4M5JA 4DQPA 4KFBA 4LF6F 1T11A 2VOOA 1VLYA 1RSCA 2OSQA 3OFFA 1IBMJ 2RKIA 4Q7AA 3UWTA 5F41A 2NZCA 3NCPA 2W2PP 3WC0A 3FNNA 3ILOA 2QN6B 2CVEA 5KFXA 4JV5J 2N7YA 1NDPA 5CD4H 4UQGA 1CSJA 2EKYA 2JEIA 1RT1B 2Z30B 3H5UA 4ELTA 4JI4F 4C8YA 1RT5A 3E3XA 4A8FA 4X4TA 5ETTA 2VH7A 2AJ1A 4XIUA 4LREA 1AUSL 5IV4A 2G9OA 2E9RX 4WP9A 2Y3YA 3FMWA 4DU7A 4E2FB 5KG5A 3M8PB 1TL3B 4OJ3A 3IG1B 2BOPA 3CJ3A 2E1MC 3C14B 3D1OA 4B3MF 5IWAJ 3NY0A 2B4OA 1RYRA 2IJFA 5GAEU 5CZVA 4RW7B 3B54A 4DCOB 2A18A 4OI3A 2CRLA 2CNLB 2K2PA 1U0SA 3PX4A 5DO2A 5J2NA 1Q1KA 1JLQA 1RAFB 3CD7A 1SV5B 3L09A 4CLZA 2HVEA 3HFZB 4Z2XA 3BJYA 2MSSA 2YKMB 3OXLA 3HXMA 4UUWA 2OEJA 5HP1B 4CP5A 3MXHP 1U1RA 2B6AB 3NEKA 1SKSA 2MLXA 2NUUG 2HW3A 3UCZP 1QLNA 1WHXA 1NKEA 1PSDA 2R8IA 2LDYA 3MD1A 3MZIA 3OR2A 2D9OA 1VQLS 2IVYA 3KJVB 1RT4B 3OW2R 5J1EB 3MHYA 4YUDA 2JWNA 4DL3A 3FBCA 4B9NA 2XM3A 3FVYA 4Y2CA 4B9UA 1UWAA 2ASJA 4C8LA 4K0KJ 1FDDA 1FXDA 4UTGA 2V4RA 2HS0A 5D78A 2YNIB 1X5OA 3ENVA 4J7CA 4WXWA 1U1MA 4BS2A 4CLUA 3P49B 2Q6CA 4DV0J 1IKWA 5A76A 2R7QA 4P2MA 1SXLA 3UVJA 2P6SA 5HATA 2VPYB 1YLXA 1FO1A 1WHVA 2J9CA 4YP3A 2KN4A 3SMZA 2W01A 2XO6A 2DYAA 3GIIA 5DZ7A 1HWKA 1S1WA 4USIA 2KYXA 5JVGQ 1WI8A 4OX8A 4L3KA 3SCLE 1H73A 2JOQA 1S1VB 3QQCD 2WVBA 1CJVA 3BH7B 1FA0A 3UN3A 3KLGB 4EEYA 3DHXA 4X66J 3T6BA 4V1Ak 1E6YA 3KNGA 5KT4A 1CULB 1Q81T 2XYPB 1KLMA 1AFIA 4DR4J 3WDOA 3RAQA 1ZA1B 2NSBA 3M8PA 3MECA 3MM9A 4ZVFA 1VBZA 5FJ4A 2VQFF 3M8YA 2HGNA 5ITHA 4DV3J 2L3MA 4J9VA 4ZVSB 1TL1A 1VLOA 2I5JA 3BBCA 2UUWA 4MFBA 2B9WA 2XMUA 3M8QA 2WW4A 4ZVRB 3U1MA 1QE1A 4OYMA 4JP8A 3DLEA 3U1NA 3TZZA 5DM7Q 1M5VC 2B9YA 3EPIA 3PJXA 3QT7A 2AP6A 4W4MA 3T9NA 1BWEA 4LFAJ 2CZ4A 4L74A 4MJKA 3OQ2A 3DRPB 5HN0A 1PCAA 1D8YA 1X4BA 2BQ3A 1KLMB 3RB0A 1VQ6S 2UV8G 2KRBA 4IR9A 2E44A 1SUQB 2IJRA 3N5FA 5BXIA 4N56A 2JJ4D 3NGKA 2K8GA 2HKEA 4B3MJ 2HFNA 5KG3A 2JC1A 4DXLA 1SJRA 2C2DA 3EX7B 1NJWA 1MW7A 3KHHA 1R8PA 3UN2A 2KB2A 4ZVEA 2OPQB 2XTJP 2HLTA 4MAKA 1S4EA 4Y34A 4HTJA 3MM6B 3KK3A 3LQVA 3Q0AA 3OXGA 5J2QB 2ZBCA 2J6UA 4O3OA 4JYAF 2NXEA 1HBUB 4V19J 3AFGA 2PFFB 2KJWA 2C3UA 3DKDA 3MTJA 4LVNP 4K59A 1KP6A 1QSLA 2A0FB 3UCGA 5D0RA 5EX0A 5CABA 3PV8A 1DRZA 3KLHA 1F60B 2V69A 4PYDA 4IG0A 4ZVQB 2W7PA 1UVJA 1Q8BA 1NHUA 1GXTA 2IPOB 4TXSA 2DNNA 2XHWA 2OSRA 1MMNA 4Y2AA 1S1TB 4DV1F 1N0UA 2N4CA 1YRTA 2F1FA 4MKYA 3JS9A 1FJ7A 2UVWA 4CO0A 1CJKA 4QWBA 2VG6B 2V50A 2B6AA 3VCDA 4WKYA 3PO5A 4AFFA 3GMGA 4LF8J 1FVSA 3FJ2A 1FDBA 1URRA 5JJBA 3TAQA 4QW8A 2FJEB 2V8VA 5IM0B 4RNMA 3VAJA 3SV4A 4QIGA 4WK3A 5HAOA 2W2QP 5AE1A 2M2BA 5KG6A 3DRSB 2V2QA 1R43A 4LSLA 4K5RA 4QIFA 3CCSS 1ZZNA 2F8MA 4LR7A 2D3O1 2XZTB 3MOJB 1EB0A 1OY9A 2B4PA 2RT3A 3KFWX 2QX0A 3Q8SB 1IBCB 1KWMA 1ZAVA 2CKWA 2WVCA 1HBNA 3I82A 5DDPC 1RAOA 1WDDA 2J7WA 3T5LA 3RRHA 4WXOA 1RT2A 3HULA 2CZVC 3CMQA 2HBZB 3TR5A 2ALZA 1X9MA 2ZD1B 2AYMA 2CWKA 1TQLA 3HT0A 3LGNA 1FD8A 3A13A 4X4NA 3MEEB 2E5JA 3OHAA 5CYMA 3MM9B 5KFUA 1IKVA 3FEXB 1NLKL 2K1RA 2VG5B 1RAHB 3U27A 5RUBA 2BEFA 1WEZA 1H7WA 2DNKA 1LKZA 3C6TB 3K89A 3H59A 2DNHA 3OSNA 8ATCB 3BGRB 1VQOS 5KT3A 4P71A 3QJJA 2KH9A 5B0CA 4ZITA 4V19X 1PIEA 1H38A 4MTPA 4WCEQ 3TOQA 4IQMA 1BGXT 5HI7A 3EDQB 1N36J 3I0RB 5C7PA 1H72C 3MUMP 2AHOB 1JNRB 3BN7A 4CLTA 3OHBA 4OYXA 4WK1A 2RRBA 2HZCA 4WTYA 5F9LA 1Y5LB 1D09B 2DGWA 3FRYA 3LO3A 2BYCA 2CVIA 3HD2A 2BJEA 4A47A 2DH9A 4E8UA 5KFQA 2UXCJ 1R27B 1U09A 3GJRB 1UL3A 2CJAA 4HT5A 4L3NA 4P7VA 1KR4A 4A8OA 4AL6A 3POTB 1OO0B 3HK2A 4Q43A 4IG0B 2PI4A 1CJTA 2NLWA 1IJEB 5KFJA 3LOUA 4MYUA 1AFJA 5HQLA 3CCWA 3G6VA 5I42A 3OD2A 1PKUA 3QNWB 4N8OA 3R2CJ 1XC9A 2CJBA 2GAGC 3O6QA 2VODA 1HHQA 4NA3A 2DGUA 2ASYA 3L7UA 3CJ2A 1V3ZA 2PC6A 3CF5Q 1HBUA 5D3GB 4JI3F 3UD4P 1OPIA 1UJ6A 4WZMA 1VI7A 4FNIA 3R5AA 4GVBB 2GIQA 4P6QA 4DZDA 4ZHRB 2LXFA 1AYEA 1VHFA 4X84A 1DURA 1L5UA 4KJIA 4U8YA 4RUAA 4I0WA 5HBMB 3B4DA 3GLJA 4GC7A 5LMNJ 3HO1A 1IKXB 3ENQA 4IUFA 2M9KA 1TKZA 3PKYA 4I6AA 5LL6d 2DR8A 4JYAJ 4NXNF 3PRVA 3QATA 1AUDA 3KNAA 1Y0HA 1MROB 3DLKA 3OR1A 4LQ9A 3N6MA 1F2GA 2J0WA 1UMJA 3D68A 5H9FK 4NI2B 4Z37A 3QO9A 4RL1A 4OYOA 1PC4A 3I6PA 4ZVHA 2IIHA 1WTBA 4KPYA 3N6NA 3U1LA 2LQBA 2X7IA 3UNGC 1GH8A 1HBMB 3W60A 1Q79A 1WJ9A 5F0UA 5CYQA 5J2PA 3NS5A 1H2TZ 5CCLA 4K5SA 3MFHA 1XMOF 4RNNA 2BKPA 2CNNB 2L9NA 5DGBA 3U7JA 1A6LA 3GB0A 3TA2A 5HJXA 1RAAB 2DNLA 1KS2A 3OVAA 4HHHA 3L3CA 1RLCL 4CH7A 2CDQA 5L9XA 3QGHA 1GK8A 2RKIB 3CJ8A 4MKVA 4U67Q 1FHTA 3TNVA 4K0KF 4JV0A 2XWXA 4RW6B 5D0HA 1MWZA 4WFBQ 4DOZA 2LECA 4K4ZA 3M9NB 2HFOA 3OPKA 1PO6A 2ZOGA 1UVIA 4G1QA 2JEGA 3E01B 4F2RA 3HHNB 3QYYA 4ILRA 4RZRA 4W92B 1T9TA 1UWBB 4KR0B 3GFXA 1F1BB 4M5LA 3MR2A 2WOMB 4DMZA 1GTEA 1XEZA 2RHSB 2V63A 3N6LA 5SZTA 1PYOB 1M5OC 1ZAWA 2FY1A 3UVJB 2C3YA 4CM2A 5LT5A 2MQQA 2FVQA 2ZNYA 4ZPBA 1IKWB 3NBPB 1M1GA 2ZWPA 4NRTA 1FF2A 1Q8IA 2VD3A 1UEVA 4ELVA 2ZUGA 1XJWB 1TK5A 1U0HB 5HVGA 3EGZA 5F8HA 2FJXA 4IG3A 2RIJA 3KLIB 3VGUA 5ETNA 4DL7A 4Q5VA 3MMBB 4YS2A 2EFNA 3TARA 4NLPA 3IBCB 2LXIA 2OUGA 1PGZA 4LSZB 3DNCA 4J5OA 5T7LA 3KMQA 4RBTA 4CH1A 4ZLJA 1FTCA 1NSPA 3VQTA 2MKYA 4IKAA 1E6VA 1ZOTA 1N6QA 2L48A 2R2RA 4HKQA 1O8BA 2DXFA 4C11A 5AE2A 3E01A 5HMXA 3C16B 3RB3A 2ZZNA 3DOKB 1RACB 4PCQA 1YJ9S 2V2VA 2G2ZA 4DL5A 1N52B 5I3UB 4ED5A 1XNRJ 1DTQB 3W61A 1FKAF 4XDCA 4KHRA 1PJ6A 3NAHA 4ALZA 1VQ5S 3K2YA 3H20A 2JEFA 3T1HJ 4LF5F 4TLRA 4ED4A 4DUZF 2RUGA 3SIPB 4YR0A 1F0XA 2B51A 5A8RB 4X64F 2MEWA 2QJ3A 3W9IA 1UA1A 2DJWA 3W5YA 1U24A 1SH3A 3HT3A 4B3SJ 1JJHA 5C2GA 3MFIA 3TI0A 1JLEA 2GHWA 2YKOA 1JLGB 3G8QA 2GHPA 2MZSA 3EVOA 4LSNA 1NPRA 3SQGA 1R8BA 1YKWA 4ER8A 1NDLA 1VRTB 2HGLA 2VC0A 5IT9U 4TYBA 3GP9A 4ECYA 3J80Y 2AIRB 2LKZA 2YKAA 2ZFHA 4LSLB 2XHCA 1RT5B 1FX4A 3C19A 1VHIA 4B3RJ 3RBZA 1R6YA 1RWOB 1YJ7A 4AXJA 4FF4A 5DG8A 1V3RA 3OR1B 4TU8A 1NU4A 3TX8A 3GJQB 5C25A 5DQIA 1R8CA 2R4FA 2BX6A 3M2VA 1IQZA 2GJ2A 2LQ5A 3CTRA 1U25A 3NOGA 3BQ2A 3VTIA 4DWIA 4X4UA 3KJFB 3DLJA 1XTZA 3ZTRA 1L3TA 1A0OB 2BJ3A 4F0KA 1JNZB 1S1TA 2H5JB 3BBFA 1FRXA 2HNDA 2Z0GA 2YKQA 1B0PA 3EZ5A 2EWHA 2AYBA 3TW0A 4J9PA 1RBLA 2E5GA 2Z57B 4GO7X 3VAFA 1J5EF 1M5SA 3OTEA 3HMJG 2PFDA 3MTKA 4DUZJ 1KKHA 2HZAA 2HFVA 4EU0A 3T1HF 5LMUJ 2AZ1A 5ETSA 4LF5J 4YB7A 3RW6A 3BKUA 4UOFA 2N3OA 4OZ2A 2Y9HA 5FDLA 4B3OA 1RTIA 2JHEA 4LBIA 4ATNA 2MXYA 4PXBA 1J27A 2AWZA 4USJC 1X9WA 4F0MA 2W9CA 2F65A 5LJ3Y 2KYZA 1WUUA 2IMWP 2O67A 1I5OB 3TZXA 3D2WA 3RRKA 1HQUB 4DUYF 3CMES 1X4CA 3LW5C 2HRYA 1VIOA 4NL5A 4OZLA 4QR1A 5A0YA 2ERRA 2B5JA 4CNYA 2ATLA 4JI0J 1ZM3A 2Q3PA 2HZVA 1AXQA 2KVIA 5DLFA 1AW0A 1P8GA 3QT5A 2DPJA 2UXBF 2GVDA 3HVAA 2CPEA 3SEOA 3W62A 2FIUA 5BYSA 1RHQB 5DDOC 3OJUA 3MEGA 4DV6J 1HFEL 1S59A 3DXBA 3D1HA 2VG5A 3DGVA 1S48A 3LP2B 2MZJA 3R5DA 1S79A 4H4MB 4Q8EA 2EXUA 5B0GA 5H1SV 4LF8F 1N56A 2M8DB 2GZOA 1DAXA 1DFDA 4BLGA 5KTQA 4WKRA 4JV1A 1GMUA 1EP4A 3IM8A 4M63A 1WOOA 1RWXB 1RK8A 2DGOA 2H48B 4PG6A 4WPAA 5A8WB 3TEHB 4LFBF 1X4AA 3NL0A 2VBWA 3HHLC 2YBVA 5F3TA 2R2UA 3GCXP 2VJUA 3SCIE 4KKOB 3F56A 3QWPA 2BE7D 3DCAA 4ZLPA 2KDOA 2GMLA 4A8XA 3ICLA 2AEFA 5KFDA 5LMUF 4PXEA 1H0HB 5EGYA 5C42B 2BR0A 4PWDA 4ZJOA 3GJTB 3P5TL 5T41A 4O4GA 5GAEI 3D0HE 2I0XA 3PR5B 3Q8PB 1IBKJ 2FJVA 3CSKA 3IRXB 2UUAF 2HFZA 3OFEA 4QIVA 4FBUA 2K7KA 3GYGA 4U6PA 3W3SA 1LK5A 2L9DA 3IC1A 5KFWA 2DEIA 3R5GA 1NB7A 4PUOB 3KUHA 2CQ2A 1F5CA 2OLWA 5KFHA 3GILA 4OI0A 3PW5A 1T9VA 4B3TJ 3HHKA 2V0NA 5LM7E 4C98A 2XCPA 3P96A 3M32B 2I38A 3M2UA 4MK7A 2AJ0A 3UR3C 1WKKA 4KGKA 3I5AA 4KQZA 2DKOB 3VV2B 1NH7A 5L8RC 3RB4A 1HIYA 1RZMA 3CD0A 1JKHB 1HWIA 1U47A 2JFKA 4M5IA 1VBYA 4BHQA 3SBMA 4YR2A 1NRKA 2V4QA 3KLFA 4R25A 2ZKTA 3MOZA 4HACA 2QYCA 1DTTB 3TWZA 4ZLLA 1NJIT 2GQCA 3ET6B 3J81U 1WACA 3AT1B 1U45A 1KQFB 5GMDA 1HHTP 2NZ4A 4JI6F 2YKMA 2H9ZA 1LOUA 1N5TA 2DO0A 3I9ZA 3KJQB 3NLCA 4MMOA 5DS7A 3VALA 1U1KA 2H1YA 3BSCA 2VJVA 1SL0A 3D6FB 3Q2SC 5C42A 3CJ0A 1GEHA 4FVCA 5J2NB 2K3IA 1B0TA 4KV8A 1JLGA 1TL5A 1BMQB 2W2MP 3DYAA 3WIVA 1YIJS 5LSRA 4RW4A 2QA2A 4JB8B 2OPRB 4TN2A 3VGTA 3R5JB 3CC4S 3JSBA 1KTVA 2IMOA 2HLUA 2ZBQA 3HSDA 2JX2A 5SUHA 1EP4B 4DV7J 3UR0A 3IG1A 3HFVA 3T9ZA 1RB0A 1YSJA 3MR6A 4A8KA 3PW7A 4QQBA 3TUJC 4YQWA 1K0TA 3NMRA 2D1CA 1K1SA 4DX7A 4PWWA 1M90T 1LWFA 4LRCA 1K47A 2VFUA 5IQ6A 1BY9A 2Z4PA 2AGOA 1FNMA 3K5MA 3LP2A 2LDIA 1N0VC 3A3OB 3GV5B 2FUG9 2OFHX 5E3RA 1WG1A 2B7CB 4WBFA 4ED7A 2DITA 3PW2A 2M88A 1U2CA 4EGLA 4ES1A 4USVA 3EXYA 3RB6A 1TVRB 4PWUA 1JLCB 3HKZD 2ZEJA 2E7WA 3K8VA 3LUYA 3BF4A 2IA6A 4C8NA 1SIWB 1UVLA 1RHMB 4D3HA 1KEKA 3A8JA 4YR3A 1S7IA 2HHQA 2PMZD 1U48A 2MB0B 1TU0B 2MYFA 2OAUA 5D4NA 2YXLA 3IR6B 1T3OA 1S1WB 4HLBA 4TYAA 3PJWA 4RJVA 3R3TA 2J9DA 4U95A 1RHUB 3J7A1 2BANA 3CIZA 4HHUA 4NRUA 4KTQA 1AZSA 4L73A 3UW1A 2ZHBA 3PCOB 1DQAA 3ZTSA 3TUPA 1X5SA 2XI2A 1RBAA 1SQFA 1WHYA 3Q8YA 4K4UA 2LYVA 4ZS6A 2P6TA 2DHSA 1HKAA 4OI2A 3AQOA 1QAXA 1KOOA 3HDSA 2HQIA 1YG0A 2DY1A 4RW9B 3KK2B 4C9DA 3GYNA 2V4JB 1WF1A 2DGXA 2I6WA 4AUKA 3R1HA 2KXFA 2UXDF 4BDPA 4O44A 1W7WA 3QFHA 4UUXA 2NPFA 1LW2A 3MR5A 3DC2A 4FXWA 1TVRA 3JQJA 4ZPWR 1TKXB 2UZAA 3M2VB 4PYAA 3BN4A 4OZ3A 3G87A 2ZM6F 3FEZA 3MMCA 1PAUB 5HVFA 4Y2KA 1RE1B 4C48A 4LR8A 1Z2LA 1SIZA 1RTJB 2XMVA 1GQEA 3C8YA 3VF0B 2MZ1A 1Q5YA 2DNYA 4H4KA 3P5BP 3IN5A 2QGFB 4DFMA 1C1CB 4KY3A 2XG8A 1X8DA 3B82A 2XNQA 5A2QY 2B8PA 1CS4B 5AXKA 3M6WA 5LMNF 1VRTA 4PG5A 5A6PA 1T8EA 2VPZB 3NG8A 1SC6A 4TKTA 4J9OA 5HROA 2A2DA 1FE4A 4MH8A 2I8EA 3FBFA 1TK0A 1RKJA 4DDFA 4RW8B 2KT3A 5L9NA 1MROA 3DLKB 2IDEA 4Q45A 4JI3J 3HVRA 3BB5A 4LF4J 3Q89A 3DOLB 4OV1A 3VZIA 1S49A 1N33F 4N8NA 5KFVA 1MU2B 1NXIA 4NLUA 4C3MA 3MUVP 1QAJA 1HD1A 2CQIA 5T14A 1T7PA 1NH8A 4I56A 4RUCA 3ZZZA 4K4SA 2WBRA 2ZH4A 1RP5A 2VA3A 2R7UA 3LP0B 1PBUA 4OI6A 1S1UB 2HIQA 3DN9A 3R5BA 4IO1A 3TJAA 3VAKA 5GAGI 1NK5A 2W24A 3CDEA 5JUMA 4W90B 4UY85 1L3SA 3I0SA 2CPHA 4I64A 5MLCV 4IFYA 3V81A 1BQMA 2Q43A 4J37A 3CD6S 4ZCKA 1R8AA 2WONA 1TMMA 1T9UA 2DT9A 3MWBA 3LWMA 3MMBA 2EBEA 3MPDA 3M9OB 3POTA 2MQPA 1KD1T 2GCFA 4RW9A 4ZIVA 1KN6A 3UDCA 3D54A 2W9BA 2UVRA 2EK6A 3ULHA 4P2SA 3IFEA 2M5YA 3ONQA 4ZP7A 4P9SA 4URQU 3DDIA 3WZ0A 1VMBA 2BV3A 9ATCB 1VBKA 2XYHB 2KT2A 6FDRA 2Z56B 3MGJA 2GA7A 1B0VA 4IH7A 4QWCA 3BKFA 2D3OR 4CO1A 2X3DA 4RU2A 2XSJB 4DSKA 2DGQA 3R97A 4X66F 4M5GA 3B6BA 1SVDA 2YWFA 2COLA 1BQMB 3GYXB 2QRRA 2FJAB 4HT7A 4CLLA 4TNOA 2KRRA 3L7PA 4RBVA 4EK2A 5IZHA 1XK8A 3I32A 5E41A 2XI3A 1HMVA 4KB7A 5DGAA 2M52A 4ANEA 2DXDA 2YH1A 1F9HA 1JMTA 1VRUA 4JBCA 5HMWA 3V4IA 4HDHA 4OYZA 3W66A 4UZBA 2ZITA 4X4QA 1G7CB 2KT5A 2VPXB 4P10A 3H25A 1N5YB 4FVMA 5AT1B 5KFPA 4ES2A 1CJUA 4XDDA 2DCUB 4DV7F 2QEXS 3TQ1A 1TFYA 2ZE2B 5KFCA 1NBEB 4F4WA 2IAJA 2IRYA 2C2KB 4G1IA 4RW8A 5H9EK 1NAQA 2RB7A 2PA8D 3AOAA 4MK8A 4DN0A 3BO3A 4DV2F 3PKMA 4XAKA 3AJ2A 3KUGA 3PFOA 2XO7A 1QM9A 3DXSX 2YNGA 4I2QA 3MR3A 1TELA 3G4SS 4NPOA 3C2PA 1C0UA 4I2PB 2M3DA 1QAIA 2SXLA 3KG4A 4A4JA 4LF4F 3T5HA 3CULA 3H2VE 2VV5A 3HI9A 1RA6A 4GMKA 4ZP6A 3TA0A 1LXJA 2ZVSA 1RUSA 3LTOA 3RGIA 4RW4B 5CXTA 2WAQD 4NZ6A 4B9SA 5HVHA 3PO4A 4X62J 1U6FA 4O0NA 3TZWA 4DV3F 4DSFA 4EUVA 3PX0A 3MAAB 3KLVA 2QLJB 4USHA 1HNWF 4QIWD 3KXDA 3OVBA 2PT0A 2IYIA 4ZHRA 5FDLB 5DLGA 4URGA 2IFXA 2V4JA 3DLGB 1C0TA 1UZHA 4DR6F 1OS5A 3HHEA 3H4DA 1XBWA 3QZ7A 2YKNB 2M8HA 3ENWA 2CPJA 1NKCA 4X2BA 3J7AN 5B0AA 6FD1A 3NWGA 1XMQF 3X1LB 3GV7B 3I9V9 2OELA 4KYZA 2C28A 1JK9B 4CO3A 2PSZA 2AJ2A 4JI4J 3MM7A 3PYDA 1O0PA 4OI4A 2DBBA 3PG9A 2BMBA 4WE1A 3CCMS 2BQRA 2MQNA 2BE2B 2JVOA 1NHVA 3PZPA 2YPYA 1TP7A 4N7TA 2O1PA 3VVTA 5F8IA 1FRMA 1OYDA 1YJWS 4S0MA 4DHVA 2MQLA 4IRCA 4CTAB 4M5NA 3K59A 5IOLA 1S77D 2MSTA 3TYTA 2YKPA 4IH6A 4NWBA 5EDWA 2NR0A 5J2MB 4U8VA 5GMKa 4PKDB 2WSCC 4Y28C 1JWWA 5CQGA 2JZ5A 1K9MT 3WIUA 4DX6A 4EYIB 3PIPQ 2FD2A 2C42A 3MEDA 4M5MA 2VQFJ 4LSNB 2CDRB 2QMXA 1GNKA 5M2RA 2QMWA 2P9EA 1N88A 3CVKA 4NLYA 1LWXA 5CD4A 1I6JA 4A8YA 1Y11A 1QE1B 1FFWB 3ZZTA 4CT8A 2W8LA 3M8QB 1UP1A 4PPDA 2FTRA 2I2YA 3ZZYA 1ZH5A 4QBUA 1RU2A 4ECTA 4NCBA 2AMCB 2CQ1A 1M5HA 3C15A 3L4BC 3MPUB 5B0EA 4CM0A 4ZIWA 2XCAA 1FKOB 4KGMA 3RR8A 2DHXA 2DVIA 4NLGA 5GADU 1X4FA 3C15B 5KFYA 1ZTWA 2G2OA 1E6YB 3RUBL 2CIMA 3Q23A 4LF9J 5IWAF 3MEGB 1FJEB 1DY3A 1S57A 1XN9A 1I1GA 1VK3A 3CB4A 4NLRA 3LH2S 4CLPA 2E7XA 2MDAA 1YJTA 3C6UB 3FQLA 4MT1A 2R8KA 1IN0A 4DSJA 1HWJA 1QJHA 1RQ0A 1TFWA 4NCGB 2CQ0A 1Y5NB 2F4FA 1CS4A 3CJ5A 4JV2A 1Q7LB 1ACMB 4U96A 1U6BA 5K5MA 3AAWB 4DS5A 1WDTA 2UUAJ 5J2MA 2CQPA 1G1XA 2V68A 2A10A 2KHDA 2AYGA 2D3ZA 4C0HA 4CLSA 2NREA 4WZQA 2GJIA 2OEMA 3FFIB 4ZJQA 2VA2A 3MD3A 1HNXF 1IWAA 2RF2B 1TKXA 2E1PA 1B99A 1TUVA 3AA9A 3EUNA 3LGHA 1SCJB 4Q44A 2F5GA 2AD9A 3RG6A 3NBPA 1JXEA 2UV8A 3GV8B 3CT9A 5D77A 2K3KA 1CC7A 3OFGA 1FJGJ 4X4PA 3KJVA 3MAQA 3IP0A 4PPZA 3EVMA 4FXVA 5KFKA 4Y2IA 3LPEA 2ZUAA 2VBXA 3LP1A 2DGTA 3TAMB 2GJFA 2WRMA 3Q83A 3TVZA 4RNFA 3OL8A 3KHLA 2B0GA 2G1DA 5IC4B 4CLYA 2Y1JA 1XR7A 3NGDA 3LP1B 3TAMA 1RT3A 2OD4A 2F9DA 3IXQA 4HL9A 4RPFA 2FHJD 2CNKB 4JI0F 1FI4A 5I3QA 3MMAA 4DX5A 2R2SA 4DF4A 4QCLA 2J8SA 2XMTA 5D4OA 4I68A 2GMJA 5K20B 4XPEA 4PWDB 3CCQS 2E7VA 2BW7A 4RNOA 5AXNA 4OZ0A 1R31A 1ZM4A 3UCUP 4R5PB 4KKOA 2I1RA 1NSQA 5B7WA 2XLIA 1SQEA 3OL9A 5A2QU 2MKIA 3ZC4A 2WHOA 2WSFC 3C14A 1KOHA 2BUNA 3H2LA 3JXOA 4AT1B 3TAPA 1YITS 3AODA 5ETPA 4ILLA 1O51A 5D6GA 2XSFA 5D15A 1C0UB 1X5PA 1I51B 2AX0A 4I2PA 2C2MB 5CYJA 1FXLA 1YJVA 3D4JA 4I2QB 4J9UE 2QA1A 3CC7S 2VASA 3FMBA 3GONA 2BRKA 4C0OC 3QGGA 1I94J 3CCJS 1XNRF 2HHUA 2AGPA 4DSLA 1U26A 1VCTA 4LFBJ 2FLPA 2RRNA 4KO0B 5AXLA 5H9FJ 2MZRA 2FHJA 4YHHJ 5M2PA 1U2RA 4Y2MA 4ECXA 3M7VA 1HI1A 2Y1LB 3GFYA 1N5YA 1U8WA 2OPPB 4O23A 4EBEA 2KFNA 2VICA 1D0EA 5E0OA 3FBBA 1YZ7A 1NJYA 2ASDA 2NUHA 4X4RA 2GHVC 3DHWC 4B3SF 4WF9Q 3OLBA 1TKDA 5A0YB 4K7QA 1DLOB 2GO8A 4NLQA 3V6DB 3PW0A 2J9DE 2V9WA 4A46A 1K73T 4WP3A 5G4DA 2HS3A 5HK4A 3ILJA 4WWSA 2EFGA 1TTHB 5ADZA 4UF4A 1Q8LA 2MY8A 2IHR1 3B8HA 3N9UC 2HVZA 4DL0C 3W2WB 3HP6A 2YX4A 2IBKA 2NCKL 1EQ0A 3T3FA 1UFWA 4ZJLA 2XSJA 4OLOA 4K4WA 1HI0P 2HNYA 2ZDOA 5F8LA 4X64J 1D9FA 2ILYA 4LRAA 3IBWA 1HW9A 3QRQA 2GX8A 2KFZA 4WYWA 3MM5B 2PGCA 4F3OA 4ZA1A 1D9AA 3M05A 4FF1A 3B78A 4YEAA 3RU0A 3IRWP 2W7AA 2KZZA 5IT4A 1X4GA 5J1EA 3KLEB 1RT4A 2QTWA 4K4XA 4AQYF 1H74A 4LBPA 2CXEA 4AL5A 4IFYB 4OYAA 5IQQA 2XMWA 3CCZA 2JRSA 1WEYA 2NYHA 1RWKB 4WIQA 3VWSA 1N48A 2DXEA 4NZ0A 1KFDA 3CJKB 3DM2B 3TA1A 4EO8A 3T41A 4CQ1A 4Y65A 1RT7B 4M95A 4URSA 4XO0A 1FFSB 2KJVA 1RHKB 2CPDA 3Q2TC 1KQKA 2FVCA 3KJNB 3D66A 3D9BA 3H5YA 2EFPA 2DTJA 4QPTA 4J90A 3ZZ0A 1FWPA 1UFLA 1C1BB 5KFBA 2MQOA 1S6QA 2V5HG 4PZVA 3KHGA 2E9TA 5F8MA 1D3WA 2FVSA 2B8QA 4WIIA 3ZO7A 4TU9A 1F5BA 4JI2J 2XB2D 2L41A 2H4WB 2HQ3A 4I7FB 3ZZPA 2CQDA 2QL5B 2QO3A 2YVSA 2FHMA 3GCWP 5A8WA 4F4XA 2ZJQQ 5L1LA 1BE4A 4ECVA 1B4SA 3M2RB 1K44A 4ZMMA 4IOCQ 4BWMA 1FKPA 1LWEB 2W4DA 1WOPA 3KWMA 3UQSA 1YRUA 4DUTA 4Y6IA 1RT1A 1VYAA 3EMTA 2P9CA 2RE1A 1S6OA 4R8UA 2BJ7A 1S10A 2HEKA 2D74B 3CNQP 3FSYA 1VQPS 3GIRA 4EI2A 4TQRA 1CJUB 5LXRA 4X65F 4K8RA 2F8HA 1GX5A 5EWFA 3C3LA 1APSA 1QY7A
chains in the Genus database with same CATH topology
2QLJB 3GJTB 1PAUB 1RE1B 1RWWB 3EDQB 3NS7B 2QL7B 2HBRB 2QLFB 2XYPB 1RWPB 1I51B 1SC1B 2C2MB 4ZVSB 3SIPB 3GJRB 4ZVPB 4ZVRB 2DKOB 1RWMB 3GJSB 3EDRB 3QNWB 2Y1LB 3RJMB 1I3OB 2XZDB 1RHRB 1QTNB 1RWOB 3KJQB 1GFWB 3GJQB 2C2OB 3IBFB 3R7BB 3D6FB 5IC6B 2CDRB 3KJFB 1BMQB 2H5JB 4JB8B 2H65B 3R5JB 2QLBB 3R6LB 2Y0BB 2HBQB 2C1EB 2CJXB 2H4YB 2HBYB 2XYHB 1QDUB 2CNNB 4ZVQB 3R6GB 4DCOB 4DCJB 1SC3B 2CNLB 3P4UB 1RWKB 3R7SB 4ZVUB 1RHMB 2XYGB 2QL9B 2CNOB 4ZVOB 1RHKB 2H54B 3KJNB 3R7NB 2XZTB 1IBCB 1RHUB 1RHQB 1PYOB 2C2KB 3D6HB 2P2CB 1SC4B 1RWVB 2C2ZB 2H4WB 2QL5B 2HBZB 1F9EB 2FQQB 5IC4B 2H5IB 1RWXB 2H51B 2H48B 3P45B 3D6MB 1RHJB 2CNKB 2CJYB 1NMEB 4DCPB 3IBCB 4ZVTB 4LSZB 1RWNB 5K20B 1ICEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLJ B;  3GJT B;  1PAU B;  1RE1 B;  1RWW B;  3EDQ B;  3NS7 B;  2QL7 B;  2HBR B;  2QLF B;  2XYP B;  1RWP B;  1I51 B;  1SC1 B;  2C2M B;  4ZVS B;  3SIP B;  3GJR B;  4ZVP B;  4ZVR B;  2DKO B;  1RWM B;  3GJS B;  3EDR B;  3QNW B;  2Y1L B;  3RJM B;  1I3O B;  2XZD B;  1RHR B;  1QTN B;  1RWO B;  3KJQ B;  1GFW B;  3GJQ B;  2C2O B;  3IBF B;  3R7B B;  3D6F B;  5IC6 B;  2CDR B;  3KJF B;  1BMQ B;  2H5J B;  4JB8 B;  2H65 B;  3R5J B;  2QLB B;  3R6L B;  2Y0B B;  2HBQ B;  2C1E B;  2CJX B;  2H4Y B;  2HBY B;  2XYH B;  1QDU B;  2CNN B;  4ZVQ B;  3R6G B;  4DCO B;  4DCJ B;  1SC3 B;  2CNL B;  3P4U B;  1RWK B;  3R7S B;  4ZVU B;  1RHM B;  2XYG B;  2QL9 B;  2CNO B;  4ZVO B;  1RHK B;  2H54 B;  3KJN B;  3R7N B;  2XZT B;  1IBC B;  1RHU B;  1RHQ B;  1PYO B;  2C2K B;  3D6H B;  2P2C B;  1SC4 B;  1RWV B;  2C2Z B;  2H4W B;  2QL5 B;  2HBZ B;  1F9E B;  2FQQ B;  5IC4 B;  2H5I B;  1RWX B;  2H51 B;  2H48 B;  3P45 B;  3D6M B;  1RHJ B;  2CNK B;  2CJY B;  1NME B;  4DCP B;  3IBC B;  4ZVT B;  4LSZ B;  1RWN B;  5K20 B;  1ICE B; 
#chains in the Genus database with same CATH topology
 4GRS A;  2MKH A;  3UE2 A;  4PR6 A;  3K58 A;  3D5M A;  3I4H X;  2A1B A;  3MM8 B;  4IOB A;  2J7K A;  2R42 A;  3TUI C;  3RBE A;  2A6O A;  1MSW D;  4CDI A;  2OH2 A;  1OSC A;  2HVH A;  2M0G B;  5HJY A;  1BXN A;  2H5E A;  2QLF B;  2Z2Y B;  3DOM A;  4H54 A;  2UUB J;  1Q95 G;  1RDR A;  3M8Z A;  2CQ3 A;  3KK2 A;  3MM5 A;  4F36 A;  5A8K B;  1XMO J;  1XMQ J;  3W64 A;  1F6T A;  1ZBT A;  1SJ4 P;  2NXC A;  2GVZ B;  2I9S A;  3PFE A;  2W9A A;  2JLG A;  2ZBP A;  4IDK B;  1YJU A;  2RQM A;  3M6V A;  1J5O B;  1CBK A;  1YBT A;  1HR0 J;  2U2F A;  2Z2Z A;  3OJS A;  2MHE A;  2YWE A;  5KT5 A;  2XS2 A;  2EC2 A;  2DH8 A;  3L7O A;  1WC1 A;  2YH0 A;  3MM6 A;  4NMX A;  3KK3 B;  3QMQ A;  1AZS B;  2WTF A;  2ZH7 A;  3W65 A;  3G8S A;  2R9L A;  3T5K A;  3EDR B;  3OSP A;  3CGI A;  1QSS A;  3VQS A;  2L08 A;  2WSE C;  5FLX U;  1UPM B;  1NKB A;  1PBA A;  3QPI A;  2VF3 A;  2CJ9 A;  2EEY A;  3D7S B;  4KGV B;  2VBZ A;  3CXC R;  2Y0S D;  1EIY B;  4JI7 F;  4DV5 J;  4I1T A;  4DFJ A;  4ILM A;  4ZVG A;  2QT7 A;  1QTN B;  2O66 A;  1RGV A;  3H5X A;  4NXN J;  2HND B;  3AJ1 A;  1G4C A;  1GFW B;  2VG7 A;  2X1G A;  3ITH A;  2DH7 A;  2WCX A;  4OYB A;  3R7B B;  2ZH6 A;  2YNH A;  5KT2 A;  3I0S B;  1ROF A;  5BR8 F;  4K4Y A;  4IOA Q;  3BRE A;  1QUP A;  3HPO A;  2VZ9 A;  1FE0 A;  5L1I A;  2Q79 A;  4J9N A;  2M7S A;  1UZD A;  4FYV B;  1RXO B;  1BQN A;  1BWV A;  2ZOF A;  2HQG A;  4KSE B;  3PTW A;  2CPY A;  5G0R B;  3X3U A;  1U49 A;  1NJZ A;  4F2S A;  2MZT A;  2MMY A;  2W25 A;  3ZZU A;  1LWE A;  2HQC A;  2MLZ A;  7AT1 B;  3JYT A;  3W2V B;  3AD7 C;  3M2R A;  2AU0 A;  3SQG B;  3SV3 A;  3OVS A;  4KHP J;  1HQE B;  3CCT A;  1U6Z A;  3EGN A;  1SL1 A;  1MWY A;  2CA9 A;  2HRU A;  2LEP A;  2CQH A;  3PRB A;  4DPY A;  4DPT A;  1DZ5 A;  2YX1 A;  3FSX A;  4R5P A;  4E0D A;  4B9L A;  4PAA A;  1A9N B;  2VU5 A;  4N47 A;  2HHS A;  2HQF A;  4X4S A;  1DQ9 A;  2PA3 A;  2ABY A;  3P4U B;  4FP9 A;  2BOA A;  3FKB A;  3OXF A;  2OPS B;  4LF1 A;  5IFM A;  2BZ2 A;  2O3D A;  3HZE A;  4R0E A;  1Y9O A;  4ZVU B;  2ZWO A;  1QSY A;  4N76 A;  5L39 A;  4CO5 A;  3PRD A;  1UVK A;  5KG2 A;  4JI5 F;  1Q5V A;  3WC2 A;  3EJM A;  4DEZ A;  4MKB A;  2YY3 A;  1L3V A;  1RJJ A;  2LA6 A;  3WX8 A;  3HJV A;  4EBC A;  5DQG A;  2CQG A;  3DI6 B;  5C24 B;  4DPX A;  2HIY A;  1B7Y B;  2RH3 A;  4ES3 A;  3ZZO A;  2RQC A;  4DQQ A;  4H4O A;  1FK9 B;  3JSM B;  2AGQ A;  1RWV B;  2C2Z B;  2VFR A;  2ZVI A;  4LRF A;  3VVU A;  3VAH A;  3M2U B;  5FD1 A;  1GXL A;  3A4T A;  4FF2 A;  4F26 A;  1U0H A;  5B09 A;  5KAK A;  2BDP A;  4CH0 S;  4NYP A;  1FEE A;  2B4U A;  1OY6 A;  1EET A;  5C5J A;  2OI2 A;  2QSW A;  4DX8 H;  2H51 B;  1HW8 A;  3BSN A;  4K2J A;  2Z2L A;  2IC3 B;  3GR0 A;  4ECQ A;  2UU9 J;  2XZW A;  4ITS A;  4TVA B;  3G6X A;  1H3D A;  5D0E A;  3TQE A;  4RUB A;  1CG2 A;  2ZC4 A;  3QFW A;  4YME A;  4FXD A;  4BWJ A;  4JI8 J;  1ZET A;  1JLQ B;  2Y1I A;  1YJR A;  2G4B A;  2HK2 A;  4OZJ A;  2RU3 A;  1REV B;  3JQM A;  3PDN A;  5KOX A;  1ICE B;  5GVQ A;  3BO2 A;  3C6U A;  1FJC A;  1SJQ A;  1OQ3 A;  1SUQ A;  2HBR B;  1PG5 B;  3M30 A;  4CNZ A;  1U8S A;  2RDJ A;  2BBE A;  2JL9 A;  2DIS A;  3EZU A;  1ZM9 A;  3GG0 A;  5IV3 A;  4FS2 A;  2R7S A;  4OX6 A;  1RYS A;  3QLH B;  1RKI A;  2ZBR A;  2MJU A;  5H9E J;  1RAI B;  4J9M A;  4YN3 B;  1RTD B;  5F8N A;  2HAI A;  1IKY A;  4A8S A;  5THW A;  1Q4R A;  4DR7 J;  1RT6 B;  3NP5 A;  1L3K A;  5G0R A;  4X4O A;  5ETV A;  1RWM B;  3JTP A;  3BZQ A;  3I96 A;  2AEM A;  2B4V A;  4DN9 A;  3K7R A;  2BVZ A;  3MCM A;  3H40 A;  3J7Y U;  4DV5 F;  4F4K A;  4ECW A;  4F4Z A;  3AB2 B;  2ZM6 J;  1H7X A;  3SDE A;  1SKW A;  3HSG A;  3CCR S;  4OX9 J;  2JDJ A;  5LXY A;  2CG8 A;  1I3O B;  1RCO B;  1TUW A;  1KQS R;  2B5J B;  1RTH A;  1S1X A;  3SXL A;  3CMA S;  2XUL A;  4CTA A;  3V6K A;  1P9Q C;  4IFV A;  4GKK F;  3BEG B;  4PUO A;  2MQ8 A;  3DYA B;  3ISN C;  4ED6 A;  2HMI A;  3MAH A;  2A2C A;  1Q82 T;  3FEY B;  2XS7 A;  1YRX A;  2VFT A;  3O5T B;  1EX8 A;  1JIH A;  3IO1 A;  3I31 A;  1HBO B;  3M4X A;  3AOB A;  3O1L A;  3QSI A;  1UW4 A;  4OV6 A;  3O2I A;  1MWQ A;  3W9H A;  3OFH A;  5GAH U;  4PAB A;  3N5B A;  1HHS A;  4PQU A;  3MMA B;  3MI7 X;  3RZA A;  4B3O B;  1R6V A;  2V2K A;  2J6S A;  4F67 A;  4GVB A;  1VIS A;  2IM2 A;  2WVD A;  1RAB B;  1CQM A;  1TR0 A;  2AZ3 A;  3D6T B;  4M5D A;  2LFV A;  3HHD A;  3NXZ A;  2YNI A;  4NYO A;  3GIM A;  2ZHA A;  3RTV A;  3KLF B;  2E5L F;  2B43 A;  5LJ5 Y;  2RJZ A;  2WBM A;  3BGO P;  3CD5 A;  3FZ2 A;  2AEJ A;  3TRG A;  2CAJ A;  1BQX A;  2YWG A;  4X4V A;  4DR4 F;  1CJT B;  4ZCI A;  1OPZ A;  3LAN A;  4JI6 J;  3SCK E;  4YY3 J;  3DI6 A;  4LF2 A;  1Y10 A;  3KKF A;  3M32 A;  4CIO A;  3Q8R B;  3SYZ A;  4A8W A;  3CED A;  1X0F A;  4IQX A;  1DAR A;  4C6A A;  3PIO Q;  3PR4 A;  1S0O A;  1LXN A;  2UUC F;  1RAD B;  4OZN A;  4C8Z A;  1KVI A;  2NPI A;  5KFZ A;  1K8A T;  3T5J A;  2MPU A;  4QIE A;  1UET A;  1FCA A;  2BM1 A;  2HFS A;  2ALY B;  2RS2 A;  1NK7 A;  3MF5 A;  1RTH B;  1S1X B;  3PY8 A;  5KFT A;  1LEO A;  3IRX A;  2R7O A;  2DR9 A;  2L9W A;  3HCX A;  4ICL A;  2GAH C;  2ZH5 A;  2DK2 A;  4FYW B;  5CZX A;  2DD8 S;  2OJ3 A;  1S0V A;  4WFA Q;  1LWC A;  3EZO A;  1JJ4 A;  4M8L A;  3H0P A;  5DRK A;  4WU3 A;  4RBU A;  2UXC F;  1UVN A;  5E2Q A;  1IXK A;  4OL8 A;  2CG4 A;  1IR0 A;  2DIU A;  3IM9 A;  3K0J A;  1KBR A;  2DHA A;  3A3N B;  2VKR A;  1D9D A;  4U7U D;  3IR5 B;  1SC4 B;  2K1R B;  8AT1 B;  1Z4U A;  1LFW A;  1WSR A;  1IKY B;  3E51 A;  2FLO A;  5CYM B;  4Y3C A;  4B08 A;  1M5K C;  3VAG A;  1G6B A;  1FKO A;  1VQ4 S;  3PYE A;  2FHO B;  2OGU A;  3IMQ J;  2NXJ A;  3K8W A;  1SPB P;  3JTN A;  2GIR A;  4HH1 A;  1DTQ A;  1FFG B;  2YX7 A;  6AT1 B;  1LW0 B;  4ID5 B;  3KTQ A;  1IQT A;  3FDS A;  4F50 A;  2DNG A;  1Y00 A;  1AB8 A;  1WG4 A;  4OZ1 A;  3TX0 A;  1R0C B;  4KC5 A;  1GXU A;  2POK A;  4DSI A;  1RWN B;  3VAM A;  3QBC A;  2VIH A;  1W2B R;  3MED B;  1R3N A;  3VHQ A;  3BYR A;  4C7Q A;  3TUZ C;  4CT9 A;  2ZH1 A;  2XY6 A;  4WFN Q;  1YVF A;  1H98 A;  3DRS A;  4ICL B;  3TVY A;  3RAX A;  3DGP A;  3W63 A;  4FYY B;  4MYT A;  1CVJ A;  4F02 A;  4F0H A;  4UT4 A;  4NEZ A;  4ELU A;  1TL4 A;  3FCW A;  3QRR A;  2YQ0 A;  4K50 A;  5AJ3 J;  2R7X A;  2F4V F;  1EET B;  4O4R A;  5IT0 A;  2IA0 A;  3NAI A;  4USW A;  2KKH A;  3PXG a;  2QA4 S;  2PMH A;  3I5B A;  4GKK J;  2ZJR Q;  3E8O A;  4KRW A;  2KG1 A;  2AJQ A;  2IYG A;  4XTT A;  3BSO A;  3UN5 A;  1JB0 C;  3GJS B;  4P72 A;  3THT A;  3KLH B;  3SI8 A;  1V5I B;  2CPI A;  1TMJ A;  3QAE A;  3QSY B;  3W2W A;  4IDK A;  1NK6 A;  2PDA A;  3EVW A;  2X1B A;  3H98 A;  2KXN B;  2OFG X;  3RJM B;  1U1N A;  1IBM F;  5D4L A;  4NLD A;  2MKK A;  2CQC A;  4FN5 A;  4ZLN A;  2X51 A;  2FGC A;  3HFK A;  3GE9 A;  1HNV B;  1SI9 A;  2BKO A;  3LAL A;  1FRL A;  4G1Q B;  3DOM B;  5GAD I;  3Q24 A;  5HP1 A;  4PXD A;  4J9Q A;  1RHR B;  4KAI A;  5CA5 A;  4F25 A;  2HRT A;  5U47 A;  1NUE A;  4B9M A;  3FUY A;  1S9E B;  4RW6 A;  2C2O B;  5KFA A;  2HHT A;  2MJN A;  1HBO A;  3JQK A;  2AKW B;  3L9Z A;  2GMH A;  5K8M A;  1WC6 A;  2CZ9 A;  2CYY A;  2VFV A;  3BPD A;  1TZ0 A;  3PHE A;  1TKT B;  2W8K A;  4LF6 J;  2RDD A;  2AJ4 A;  4B9T A;  3THP A;  2VUG A;  2ZJP Q;  4DV4 F;  2C22 A;  4R8U B;  2NXU A;  4BBY A;  4QWA A;  2XGP A;  4QYZ K;  2XY7 A;  3ETO A;  4DZ6 A;  4DV6 F;  1SKR A;  1HNZ F;  1TL3 A;  4NCA A;  4OZ5 A;  2QIF A;  4G6V B;  2UVU A;  1Y4Z B;  2HBQ B;  2YNG B;  2UXB J;  4FKY A;  1PYT A;  2LXU A;  2RUS A;  7FD1 A;  4B9V A;  1EJ7 L;  2BJ1 A;  2QFI A;  2ROP A;  1FX2 A;  2HBY B;  3UNY A;  2FJW A;  1PIL A;  2RS8 A;  3CUN A;  4O3R A;  1BQN B;  1XWL A;  1QAY A;  2RHQ B;  5D0G A;  3UO0 A;  4ED1 A;  2DRB A;  1C1B A;  3V6H A;  2HK3 A;  4OX9 F;  3Q86 A;  2EBG A;  5KFN A;  1N33 J;  2BXJ A;  2RSQ A;  3AOC A;  4OJH A;  5HBM A;  3PYG A;  3MEC B;  1VRU B;  1S9E A;  1HYS A;  4KGZ B;  1V5V A;  2QL9 B;  3DRY A;  2JSX A;  3MUT P;  2D69 A;  3DU5 A;  1LK7 A;  3H2U B;  3MEK A;  3UPF A;  5CHC B;  4A8Q A;  3ZFV A;  4C11 B;  5HO4 A;  2PEB A;  3QT6 A;  1E6V B;  2B3T B;  2D3U A;  3R7N B;  2DGS A;  2DHH A;  3LAK A;  4ZKA A;  4YDD B;  4ZCL A;  1FRH A;  2MKS A;  4WJB A;  3ZXW A;  3T19 A;  1J5E J;  4NLV A;  1T94 A;  2B56 A;  3GR1 A;  4MIA A;  4OHX A;  4OHW A;  1UFK A;  2DR7 A;  1SJ3 P;  2IC3 A;  4HH0 A;  2J5A A;  4NXM J;  4QU6 A;  2LU2 A;  3AXM A;  1EKR A;  1WG5 A;  3NCR A;  3NCQ A;  3HX9 A;  4MIW A;  1P1L A;  4PQA A;  4ZK7 M;  4RU9 A;  5IT9 Y;  2DRD A;  3J81 Y;  2Y8Y A;  1CC8 A;  4OYW A;  5KFL A;  4EWT A;  3MPY A;  5F3Z A;  2OTJ S;  4GKJ F;  1KON A;  3W8P A;  1B70 B;  1J2V A;  1ZAX A;  3G2X A;  1VQN S;  3AB4 B;  3CDW A;  3WHI A;  4B02 A;  1NME B;  4B3R F;  4DR1 J;  3DGP B;  1HNI B;  4YOE A;  4ZVT B;  3OR2 B;  2LMI A;  1NHK L;  5C24 A;  4RUH A;  1Z1Z A;  3KMS A;  1YWX A;  3V81 B;  1VBX A;  3CCE S;  1X4H A;  3HLU A;  4XPC A;  1GT8 A;  2LLZ A;  3NNA A;  1S9G A;  3NKY A;  4RWX A;  5DJB A;  4B17 A;  4M5H A;  1RWW B;  4AL7 A;  5ETO A;  1WC0 A;  1Q53 A;  3PJ9 A;  2DO4 A;  5KOW A;  3FCV A;  4K2X A;  4L76 A;  1WEX A;  4NLW A;  2UU9 F;  7FDR A;  5D8H B;  2EPI A;  3HF5 A;  2V6A A;  1IKV B;  3NGS A;  4P2F A;  3RBX A;  3W8G A;  2C3M A;  2OPS A;  3TVK A;  3AH6 A;  1MU2 A;  3MEE A;  3RYL A;  5BR8 J;  4C8O A;  2OIH A;  1WD6 A;  1SBR A;  3BGL A;  4OYP A;  4O3Q A;  2J0S D;  4LIR A;  2CJK A;  2BE9 B;  4KO0 A;  1B3T A;  4KBI A;  1FEH A;  4O3P A;  1SL2 A;  1U1Q A;  5DET A;  2X1A A;  3MPV A;  5E5N A;  4WU2 A;  1GMW A;  4ED3 A;  1OIA A;  3M1V B;  5KG4 A;  2V8P A;  3CO9 A;  2CPZ A;  3I87 A;  3IS9 B;  4ZP9 A;  1JXV A;  2YPZ A;  1IBL J;  2FLN A;  3W2V A;  1ARO P;  2GV1 A;  2J0X A;  2ASL A;  3AHP A;  1DHM A;  2IVF B;  2XY5 A;  3QJL A;  1NDC A;  2A6M A;  3DFE A;  2N82 B;  1HPZ A;  3QGP A;  2MGZ A;  2VKZ G;  3ET6 A;  2MKC A;  3HKW A;  3HZG A;  5HMZ A;  4KHP F;  2QA4 G;  3IBF B;  2DHG A;  1TKZ B;  3BDP A;  5CAA A;  4IRD A;  3OTB A;  1NEE A;  2DR5 A;  3SQO P;  2CUY A;  2YNH B;  1S9F A;  1AT1 B;  3GIK A;  4O44 B;  1NPK A;  1JLB B;  1GAO A;  3MM7 B;  2V9K A;  2MLY A;  2H65 B;  1FRJ A;  3QRP A;  3N4W A;  2QYG A;  1VQS A;  4QPX A;  3ZZR A;  1NK8 A;  4F8R A;  4TY9 A;  3K5O A;  1ZTT A;  2R8G A;  1QD1 A;  2FJB B;  4BC7 A;  1ULR A;  1XMB A;  2KHC A;  4MK9 A;  4XK8 C;  1DBD A;  3CWJ A;  1NDK A;  1HI8 A;  3P8B B;  5KFS A;  4D3G A;  4OFZ A;  4QR2 A;  4QR0 A;  1HA1 A;  4I69 A;  2ZH2 A;  2GQ2 A;  3OTD A;  3G71 S;  2ROG A;  4TY8 A;  1FWL A;  1S99 A;  4AND A;  2BAC A;  4UW2 A;  5DG9 A;  3LF0 A;  1PJ7 A;  4BCA A;  5E33 A;  3W9J A;  1HD0 A;  1ZZF A;  5HLF A;  4P75 A;  3R8Y A;  1B7F A;  1VFJ A;  3MAA A;  3EPG A;  5DG7 A;  2EFV A;  5K14 A;  2MQM A;  1OSD A;  4Z7C A;  2VL1 A;  1YGY A;  2J76 E;  2J8A A;  3FFI A;  3N01 A;  3G9C A;  3O3L A;  2NS1 B;  3OT9 A;  3R7S B;  3US5 A;  3DLH A;  2EG1 A;  2VPW B;  4I6Y A;  4DFP A;  1F3V A;  1OQ6 A;  2EG2 A;  3O44 A;  4NYZ A;  4N5S A;  2UVV A;  1U2F A;  3AD8 C;  3G96 A;  2O5D A;  2QV6 A;  4KHM A;  5EUH A;  5BYQ A;  1FXR A;  3T1Y F;  1HR0 F;  2JLF A;  4GKJ J;  2R7T A;  5B0F A;  1KRP A;  1NZA A;  4R0J A;  3UDV A;  4Y0F A;  2LQ8 A;  4AD6 A;  4KT0 C;  5B08 A;  1VQM S;  1S7H A;  3HSJ A;  1MMD A;  1NND A;  3H8Y A;  1NO8 A;  3BGR A;  5K8P A;  2XC9 A;  3ILL A;  2E9Z A;  4FS1 A;  4DLE A;  2FDN A;  3C6T A;  4NLO A;  4LIW A;  3A8I A;  4ZPV R;  3T6J A;  4JOU A;  3OL7 A;  2C2R A;  4DR6 J;  3PHT A;  5IXU A;  1H2V Z;  4P52 A;  3V4M A;  1KFS A;  1LW0 A;  4ID5 A;  2ZKU A;  1IBK F;  1UCN A;  1LWF B;  4ID8 A;  1KVK A;  3JB9 k;  1XQI A;  3FGV A;  1F9E B;  2HNZ A;  2GVD B;  4QWD A;  3H42 A;  2RD5 C;  4FBT A;  4K4V A;  5F8J A;  2YNF A;  3GSI A;  2G13 A;  3GU0 A;  3BV8 A;  2F8E X;  2DNM A;  2LVW A;  4HTI A;  8RUC A;  3QLH A;  3UD5 A;  4ETZ A;  4ECZ A;  3M6U A;  4X62 F;  3J80 U;  3D6M B;  1QTM A;  2HAF A;  1G2E A;  1DQ8 A;  4YFU A;  3I4P A;  2HYI B;  1CUL A;  2V67 A;  3PEJ A;  4DQR A;  1DJ0 A;  4IH5 A;  3HJF A;  3HD1 A;  1HQU A;  1HBN B;  4JI1 J;  4O3S A;  3LPY A;  2R2T A;  2K06 A;  2HPU A;  1P1T A;  1RLD A;  2GGP B;  2YQ1 A;  4AE5 A;  3NNH A;  1K0V A;  3RR7 A;  3CIM A;  5J1N A;  3D0I E;  3H90 A;  1RWU A;  3MDF A;  4A8M P;  1CQN A;  1ZYQ A;  1N36 F;  4CYU A;  2B9E A;  2ADC A;  3Q8U A;  2IRX A;  3NS7 B;  4JI2 F;  3V2U C;  4K4T A;  2HHH F;  2HHP A;  3GWC A;  2QC3 A;  3K5P A;  1XR5 A;  2RNE A;  1RWP B;  3MMJ A;  2FY8 A;  1B64 A;  3N79 A;  2IBO A;  2JEJ A;  2NSC A;  1MN7 A;  2LQ9 A;  2Z58 B;  2BW2 A;  4KE5 A;  4RO0 A;  1XR6 A;  1SC1 B;  1CJK B;  1WOR A;  2AYE A;  2OHD A;  1V6H A;  1Y3J A;  3CDU A;  4ZP8 A;  2KU7 A;  5DDQ C;  4CLF A;  3D0G E;  2Y1R I;  4KIA A;  3T1A A;  1XER A;  4DL6 A;  1FK9 A;  3JSM A;  4FYX B;  1G3O A;  1IR2 A;  1JLA A;  4H4O B;  2WON B;  4BC9 A;  2C2E A;  1A7G E;  1PYS B;  4KPC A;  4EFA C;  2XLJ A;  3A3P B;  3DMJ B;  3M8W A;  4QYR A;  1K1Q A;  2ZOM A;  3ZNU A;  2HG4 A;  3QJP A;  1H6K X;  1U02 A;  3ELH A;  2RF2 A;  4ZN3 A;  1JQG A;  3C46 A;  4LF7 J;  4ZPD A;  2AQ4 A;  5DZ6 A;  4M5D B;  4AQY J;  2HHX A;  4C8K A;  3HHL D;  2VHG A;  1C4A A;  4FPI A;  3D1Q A;  3MCS A;  3TO8 A;  4DU8 A;  1S0N A;  4EYH B;  1KTQ A;  2OD6 A;  5A6W A;  2RU9 A;  4CLK A;  4O4G B;  1SV5 A;  2DPI A;  2AJF E;  5E7O B;  1T9W A;  5L1K A;  2EFO A;  2GGP A;  3CPW R;  3MUR P;  3A8K A;  3MPW A;  4GVL A;  4OHV A;  2QLW A;  1YJN S;  4DS4 A;  3EE3 A;  4IFV B;  2PII A;  2VBY A;  2WB1 D;  5F8G A;  2MZQ A;  2FLL A;  5GAG U;  2AF6 A;  5B0B A;  4QYZ J;  2KG0 A;  3P3D A;  4HVZ A;  4WTO B;  1HQE A;  1NCL A;  1P6T A;  2DRA A;  2JVR A;  2Y0B B;  2Z8Q A;  2OPP A;  1UA0 A;  3KG1 A;  1WWH A;  5KG7 A;  2Q66 A;  1R8H A;  1LQ9 A;  2OO4 A;  1RI7 A;  2QG9 B;  1WF0 A;  4F4Y A;  4C0B A;  1S12 A;  2FYX A;  3JTO A;  4PXC A;  1QVF R;  4EMD A;  3DDN A;  2HQD A;  3DLE B;  3E2E A;  2RAQ A;  3HVT B;  2UXD J;  3R1L A;  2ZE2 A;  4LBH A;  1WF2 A;  1RT6 A;  3O8W A;  3R6G B;  4MFB B;  4F3Q A;  2LQJ A;  1FES A;  2CFX A;  5HAN A;  3MMC B;  2ATC B;  1FT8 A;  4DCJ B;  1R0B G;  1TL1 B;  2I5J B;  3BH6 B;  3LAM A;  2GO9 A;  2P9G A;  1KVJ A;  1IVZ A;  2PEH A;  2WVF A;  2CWX A;  2GC8 A;  1FVQ A;  1VIX A;  1Y7P A;  2DNO A;  3F0N A;  3ITH B;  5DQH A;  1Z2Z A;  3G82 A;  1N5V A;  5KFF A;  4DV4 J;  2CNO B;  4CCH A;  1ELO A;  5ETL A;  1KDN A;  2Q1L A;  5K8O A;  4IG3 B;  1CJV B;  4NLT A;  3KLG A;  1ZM2 A;  1EAY C;  1JJC B;  1FTR A;  3GFH A;  4UOH A;  9RUB A;  3V5R A;  1VC0 A;  2EVZ A;  1LV5 A;  1JJ2 R;  5K14 B;  2DEJ A;  4GO5 X;  4NEY A;  4PEO A;  2ZBI A;  4YB1 P;  1FWK A;  2F9J A;  4HHJ A;  4CRJ A;  2J0Q D;  1RTI B;  4JI5 J;  3G8T A;  3F73 A;  5K8N A;  4UOC A;  3W1Y C;  1RAJ A;  1ZPW X;  2CPF A;  3LA0 A;  3R9L A;  3PVX A;  1T05 B;  3F44 A;  2GQQ A;  3QWU A;  1N8R T;  3BDE A;  2FQQ B;  1UJ5 A;  4ECR A;  1M1H A;  4NLX A;  1KSP A;  1UWB A;  3HHL A;  4OYI A;  2H5I B;  2YKN A;  2GFF A;  4ED0 A;  3C66 A;  1V3S A;  1JLF B;  2RQ4 A;  2CPX A;  2YWK A;  1YDL A;  1RHJ B;  3SFU A;  3TJ9 A;  1CEZ A;  1Q78 A;  1MLA A;  2CJY B;  1YK9 A;  1NZ8 A;  1JLB A;  2V94 A;  4J9K A;  1LNQ A;  4FNH A;  4USU A;  3WQP A;  4YB6 A;  1MML A;  1TV6 B;  5DDR C;  2KM8 B;  4DI6 A;  2FPH X;  4NX9 A;  3NMA A;  4HI2 A;  2DNP A;  2W2O P;  2WVE A;  1S1U A;  3GTY X;  1EQM A;  3PAC A;  4E98 A;  4LQ3 A;  2VOP A;  3LP0 A;  5CCM A;  3EWG A;  2FVP A;  1SJ1 A;  1BUX A;  4YY3 F;  3BKT A;  2U1A A;  2XMM A;  2LA4 A;  1IR1 A;  3W5Z A;  2XWY A;  4IR1 A;  2DR6 A;  1YI2 S;  2FJD B;  4F04 B;  2PMW A;  4L72 B;  4ZDN A;  1F9F A;  4EZ9 A;  1FKP B;  1HNX J;  3GG1 A;  1VGY A;  2YTC A;  5M2U A;  2D41 A;  3DOL A;  1IM4 A;  3CJS A;  2ADB A;  4WFX A;  1WTF A;  1SH0 A;  2OP5 A;  2ZDP A;  4OHZ A;  3SCJ E;  2E5L J;  1S76 D;  3U02 A;  2A3J A;  4NI2 A;  4RW7 A;  4DR5 F;  3FK4 A;  3WBZ A;  1RAG B;  1UAW A;  1WKJ A;  5LOQ A;  1R0A B;  3DRR A;  1RAE B;  4RLE A;  4L6V 3;  2XS5 A;  2Y8W A;  1FDN A;  2AX1 A;  3ILI A;  3JSY A;  2HVD A;  2P5V A;  2C2N A;  4PG4 A;  1GTH A;  2LCW A;  2WB4 A;  2LEB A;  1RT7 A;  1F5A A;  3MCN A;  2GS8 A;  1YZ6 A;  2VFS A;  3IA0 A;  1Q16 B;  5CH7 B;  1RTJ A;  1GX6 A;  3R5C A;  4UOG A;  1HNV A;  3M8R A;  4LFC F;  5D3G A;  2DGV A;  1HL6 A;  4F7V A;  2N7C A;  4ECU A;  1TV6 A;  1H2U X;  1UTA A;  4P7T A;  5KFO A;  5AJ3 F;  1T03 A;  2QE5 A;  1OJ4 A;  4B3T F;  5T7L B;  1MN9 A;  1D1U A;  2QSF A;  3DMJ A;  1JKH A;  2HWI A;  2R7W A;  1HNI A;  4NA1 A;  1HWL A;  2HWH A;  5HMY A;  3KLE A;  3GFZ A;  4P74 A;  5L38 A;  3GIJ A;  1SJF A;  3CO0 P;  4NZ7 A;  4OX7 A;  2R7V A;  1S72 S;  2PD1 A;  3AD9 C;  3KLI A;  4DR2 J;  4MIB A;  4ZPT R;  4LJM A;  3VAI A;  1MNE A;  3FSI A;  4LFA F;  4G65 A;  2R3V A;  3FQK A;  3D3C J;  4F3M A;  3WX4 A;  2M4M A;  4J9L A;  4UST A;  2N3L A;  1LFP A;  2HFU A;  4WE1 B;  4CO4 A;  1FRK A;  1RA7 A;  3NRB A;  1QDU B;  2XBP A;  4C4W A;  4DQI A;  3S8S A;  3KK1 B;  1XIQ A;  4UY8 T;  4M5K A;  4CWB A;  1REG X;  4DPO A;  1J5O A;  1VC5 A;  2BRL A;  4FF3 A;  2VON A;  1T9Y A;  1ZPV A;  5EWE A;  3OV7 A;  2OML A;  2HVI A;  2IM0 A;  4LMZ A;  1T03 B;  3OLA A;  4CZC A;  4J9R A;  1NB2 A;  2YQ3 A;  4DR2 F;  1UVM A;  1F3F A;  1UEK A;  2J7U A;  3DLL Q;  1SQG A;  3N0V A;  3QID A;  4JI8 F;  2ILZ A;  3K5N A;  1WNE A;  2X1F A;  1S6P B;  1TAQ A;  2AV5 A;  2BAB A;  2W7O A;  1HYS B;  4DBQ A;  1O6X A;  2RDI A;  2MTL A;  2XMJ A;  2H54 B;  1RBO B;  1VR6 A;  3OTO J;  3I55 S;  2XMK A;  1OYE A;  2XLK A;  1P27 B;  2HNZ B;  3EXC X;  1VQ7 S;  1FD2 A;  2ACM A;  4DLG A;  3SSQ A;  3CCL S;  4ECS A;  4LFC J;  1R0A A;  2JNJ A;  3UDE A;  3HVT A;  2ZNZ A;  3OBI A;  3D6H B;  2P2C B;  4LT6 A;  3FCH A;  2J9E A;  4C8M A;  2XGQ A;  4U9R A;  4ERD A;  3MR7 A;  4JV5 F;  3JAM Y;  4EZ6 A;  1YTY A;  5CYQ B;  1R7I A;  2BJ9 A;  2UUC J;  4PG8 A;  5E3A A;  2HSE B;  5C2C A;  2OTL S;  4PG7 A;  4HR2 A;  2GW8 A;  3QO9 B;  4I7F A;  2C3P A;  4QU7 A;  2CAD A;  3CJ4 A;  4DR5 J;  5IM0 A;  4DR7 F;  3DU6 A;  3R2D J;  5FLX Y;  3IWL A;  1OWX A;  1YQH A;  3KUE A;  4EBD A;  3FBE A;  1S6Q B;  2DB1 A;  1U1L A;  1TKT A;  4U7U K;  2EFQ A;  4KV8 B;  4KGX B;  4NOH A;  3UDL A;  4QW9 A;  3THV A;  3IGN A;  2W9C B;  2MKJ A;  4H4K C;  4DV2 J;  3SSR A;  1Y5I B;  5HLF B;  2PO4 A;  3V4I B;  4P2X A;  2HWT A;  5ETM A;  2QL7 B;  2HGM A;  1U7L A;  1NK9 A;  1UPP A;  2RQK A;  1S6P A;  3BR8 A;  1IM6 A;  4UQT A;  1PJ5 A;  2RML A;  3PW4 A;  1P9Y A;  4PRF A;  1DTT A;  3CCU S;  4HAC B;  3D67 A;  3PYF A;  2Q6B A;  2E1C A;  2K7J A;  3HHL B;  1NK4 A;  1EKS A;  1M0S A;  2IY5 B;  3NOC A;  3SZ2 A;  1BD6 A;  2OKQ A;  4LRD A;  5MAO A;  1VQK S;  4G3I A;  1UKU A;  5FII A;  1N54 B;  2FZK B;  4I6W A;  2E29 A;  2KI2 A;  2OMO A;  3IAS 9;  1N5Q A;  2V8D A;  3QIP B;  1NJX A;  4J9S A;  4DR1 F;  1HAR A;  1S6U A;  4DUY J;  4WP8 A;  2JLE A;  2V2Z A;  4QOT A;  3H4B A;  1U1O A;  4HI1 A;  1NSA A;  4ZN1 A;  2UUT A;  4FDF A;  1URN A;  1UJ4 A;  1NPP A;  5EX3 A;  5E3P A;  4I4B A;  2HHW A;  3BPS P;  4YHH F;  4GC6 A;  1ITP A;  3DDK A;  1FNO A;  3B4M A;  1HPZ B;  3HSZ A;  4NA2 A;  2UUB F;  3I0R A;  1Q8K A;  3VZH A;  1YX2 A;  3G82 B;  3JAM U;  2AW0 A;  1UEU A;  2E5H A;  4P73 A;  1V9O A;  2MHN A;  1WC5 A;  3G86 A;  3IGV A;  4OQJ A;  3SFG A;  4CI0 B;  3D3B J;  3J81 j;  3BQ1 A;  4IO9 Q;  1M5P C;  3PNI A;  2FHK A;  1TUG B;  4NCG A;  3KYL A;  1O5J A;  2H3E B;  4Q8F A;  1RU1 A;  1W25 A;  2B9X A;  3IS9 A;  2DY9 A;  2X3G A;  5IC6 B;  1F2H A;  5KFR A;  2OEK A;  3VR1 A;  4DG1 B;  4ZCM A;  4C3L A;  3CC2 S;  4NML A;  4DPU A;  1Q86 T;  2ZZM A;  1DLO A;  3V6D A;  4ED2 A;  4TQS A;  2DNZ A;  2DNR A;  4NE9 C;  3CCV S;  2PE8 A;  1QUV A;  4LF7 F;  5KFI A;  4HDG A;  3S01 A;  2KZM A;  4OI1 A;  2ZD1 A;  3BQ0 A;  1W26 A;  1S0M A;  1UW9 A;  2VQE F;  2CJX B;  1WSV A;  2FB0 A;  2H4Y B;  2NXN A;  4USK A;  3DRR B;  5L1J A;  5I3U A;  1WC3 A;  2G2Y A;  3T1Y J;  1HWU A;  1RT2 B;  2RRA A;  1U4B A;  2FVR A;  2ROE A;  1T9X A;  3BSA A;  2IDL A;  2OPR A;  4N41 A;  1S1V A;  1TL7 B;  2D9P A;  3IR7 B;  5JXS A;  5GME A;  4ZPC A;  1SC3 B;  4FZV A;  2XEX A;  4TLQ A;  4TU7 A;  4LR9 A;  4HYK A;  1LWC B;  2WW8 A;  2F7V A;  2E1A A;  1REV A;  3H5S A;  1PC5 A;  3I5C A;  3HM9 A;  1CPZ A;  4IYQ A;  1QVG R;  4FYD A;  4X65 J;  2MY7 A;  4RNH A;  1VOM A;  1X4E A;  1T0T V;  3GSD A;  1C1C A;  2XYG B;  2V8H A;  3QZ8 A;  1X31 C;  4DJB A;  2HHH J;  4M94 A;  5GAH I;  4ETX A;  3DRX A;  1W2I A;  1VS3 A;  3K5L A;  3DLB A;  4ZPA A;  3NNC A;  4DF8 A;  3OUY B;  1JXL A;  5I4M A;  3CJT A;  2N4D A;  4WYL A;  2Z2M A;  2GNK A;  2BE2 A;  3RAM A;  4JI1 F;  4NAS A;  3NGR A;  2RVJ A;  3TJ8 A;  3QIP A;  5ETQ A;  3IWN C;  2NQP A;  3AA8 A;  3UFC X;  1N4L A;  2VDI A;  2IRU A;  4TY8 B;  3J7Y I;  1SH2 A;  2E5I A;  3M6X A;  4JI7 J;  3ZNJ 1;  2V8G A;  3BS9 A;  2PI5 A;  2VDH A;  3TEG A;  4OIX A;  1RT3 B;  4OLP A;  1TK8 A;  1N34 F;  2AT1 B;  1VQ8 S;  4C97 A;  2R8J A;  3S1T A;  2G0C A;  3CJK A;  1VQY A;  4Q2M A;  5E3C A;  2R8H A;  5EHH A;  2KO1 A;  4NLS A;  3I56 S;  1T05 A;  2HS4 A;  2ACY A;  3RW7 A;  1ZA2 B;  3DLG A;  5J2Q A;  2W4C A;  3QGI A;  4LF9 F;  1Q0N A;  2DIV A;  5J1P A;  4DV0 F;  4DR3 F;  2QLX A;  2OPQ A;  3F41 A;  1VJW A;  3ADA C;  2BAN B;  1X5T A;  2ZH8 A;  3BGU A;  2F63 A;  2P8I A;  1WOS A;  2ZHO A;  3HVW A;  1VK8 A;  3GPA A;  3KDN A;  3UI3 A;  3BYP A;  5LSO A;  3OUY A;  2HMI B;  2W2N P;  1YBU A;  2IVM A;  3NS6 A;  4M1K A;  5C25 B;  3W5X A;  5KT7 A;  3M8S A;  1N34 J;  1KHV A;  2MGZ B;  3FRZ A;  1YHQ S;  2XNR A;  2EK1 A;  1CLF A;  1EZZ B;  3DRP A;  2KXH A;  5K9F A;  2QZ8 A;  3N28 A;  5J2P B;  1JLC A;  2FC8 A;  3VGS A;  3SDE B;  4DQS A;  2CQB A;  1XNQ F;  3Q22 A;  4QJV A;  1HBM A;  4F4A A;  2GIF A;  2YNF B;  3CJR A;  3G6E S;  3AJD A;  3QT8 A;  3CDA A;  5BJR A;  4ENO A;  1WEL A;  3M9M B;  5JMN A;  1XNQ J;  4ZVP B;  1BC6 A;  1TL7 A;  5JVH Q;  2VC1 A;  3CJQ A;  4H4M A;  4Q2L A;  3ETM A;  3D28 A;  3A8E A;  1X7V A;  1IUJ A;  2LEA A;  3OL6 A;  5A8R A;  2FC9 A;  3GZ7 A;  3H7H B;  3ZTO A;  5I3P A;  1RTD A;  3ISZ A;  1EHW A;  3OTC A;  4MKA A;  1IKX A;  3LWL A;  2YWW A;  2XMA A;  3R27 A;  2EKN A;  3A12 A;  2KM8 C;  1T02 A;  1FER A;  4C3K A;  1KQG B;  1RIS A;  1SKU B;  3Q8Q B;  3JSR A;  1VC6 A;  1Q7Y T;  1L3U A;  3M30 B;  3BGF A;  4RKU C;  5KG1 A;  4ZOS A;  3DOK A;  2EI5 A;  4DSE A;  5KFE A;  2HHV A;  5HQM A;  4JUZ A;  4LRB A;  4FKX A;  4YB5 A;  4AYB D;  1S9G B;  5F0W A;  1RCX B;  2RIL A;  5KG0 A;  4DG1 A;  4AXI A;  5EN1 A;  5HSP A;  3FC9 A;  1T3N A;  1EAR A;  4EO6 A;  2FGO A;  5KFM A;  1OMS A;  3BR9 A;  5I42 B;  1WHW A;  4O0I A;  4I67 A;  4RWW A;  4FPR A;  5F9N A;  4YDX A;  2O01 C;  2LU1 A;  2ZC3 A;  2BM0 A;  3KDO A;  4LUB A;  3KK1 A;  1JX4 A;  2R7R A;  2V34 A;  2XQC A;  2QLB B;  3BO4 A;  3AXK A;  3R6L B;  3S6E A;  1SB6 A;  3TAN A;  1NSK L;  2BJD A;  5DM6 Q;  2JFD A;  3TZY A;  1IBL F;  2GVZ A;  3A1Y G;  1HNW J;  4HEA 9;  4DPW A;  5A8K A;  2C1E B;  4USM A;  1GMW D;  1X0P A;  1YBA A;  3CW2 C;  2F3J A;  2NYI A;  3NGT A;  2E66 A;  3S7R A;  1GMV A;  2F40 A;  2YWH A;  3QAU A;  1FNX H;  2M70 A;  1VQ9 S;  5KT6 A;  3P6Y C;  1BLU A;  1JLA B;  1KHW A;  2JC0 A;  1KC8 T;  3ZTQ A;  2J6T A;  2IJN A;  3CE8 A;  2G0J A;  5HQ8 A;  4Y00 A;  2WOM A;  2DCL A;  1VRQ C;  3BBB A;  3K17 A;  3RBD A;  5D4P A;  4RX6 A;  4CLW A;  1WKL A;  2KVQ E;  4C2M A;  5HL7 Q;  3G6Y A;  2EW9 A;  4OMF G;  3K57 A;  4W98 A;  1WC4 A;  5B0D A;  1C0T B;  3LGM A;  1NM2 A;  4OHY A;  3EIC A;  4DL2 A;  1KNZ A;  1RTZ A;  4ZVO B;  2JH3 A;  4CYU B;  2VB6 A;  3NWR A;  4O3N A;  3L95 X;  2VQE J;  2C3O A;  5ETR A;  1OY8 A;  3EGV A;  1ZS6 A;  1KLN A;  1N32 F;  3KG0 A;  3KHR A;  3CDB A;  3AQP A;  2CQ4 A;  4DR3 J;  2UP1 A;  4Q0B B;  3M1V A;  3SSS A;  1JLE B;  4J91 A;  3J7Z 5;  4DL4 A;  4OJG A;  5EWG A;  2EC0 A;  4Q0B A;  1HLW A;  4RR5 A;  3EYZ A;  1D8Z A;  1Y3K A;  2LP4 A;  4KH1 B;  5HRO B;  1S4F A;  3JYT B;  1NK0 A;  2APO A;  1IWG A;  2BJ8 A;  3P45 B;  2W1B A;  4G1P A;  4WFZ A;  4Z7Y A;  3J7Z T;  4QWE A;  3NGU A;  2IM1 A;  2IM3 A;  3EM1 A;  4DV1 J;  2BA9 A;  1I94 F;  3DM2 A;  2DNQ A;  2IAJ B;  2E1R A;  3Q8V A;  4DCP B;  1U1P A;  2PN6 A;  3C16 A;  3V6J A;  2ZZT A;  4WFY A;  1N6Q B;  2VG6 A;  4UZC A;  3TP2 A;  4KFB B;  4A48 A;  3UD3 P;  3ENA A;  1WI6 A;  1FDA A;  1LW2 B;  2VG7 B;  1S5Z A;  1TAU A;  1PAE X;  2WK4 A;  3PEH A;  1T95 A;  5AE3 A;  4CO2 A;  3FZB A;  3AY0 A;  3VGV A;  5E3Q A;  1MG7 A;  1HMV B;  1AA1 B;  1JLF A;  2B7B B;  4IRK A;  3ISN D;  5AXM A;  2KL8 A;  1N5S A;  2FZG B;  3ZTP A;  1X9S A;  1N32 J;  3KOA A;  2ZH9 A;  2CJQ A;  2F4V J;  5ETK A;  2BKN A;  2D7S A;  2HNY B;  5BYR A;  4LVO P;  3OTO F;  2ZH3 A;  1HNZ J;  2KTQ A;  4ANC A;  3PX6 A;  2HUR A;  3RRG A;  1VDH A;  3W7B A;  4N77 A;  3MCO A;  5IS2 A;  1S97 A;  4PQU B;  3BM7 A;  1C2P A;  1C4C A;  3GQC A;  1X4D A;  1FRI A;  1R89 A;  5KFG A;  1X60 A;  2FZC B;  2KFY A;  2W4P A;  2W9B B;  1HQ2 A;  3PM9 A;  4OJ1 A;  4NXM F;  1VJQ A;  5L46 A;  4ED8 A;  2BQU A;  1FJG F;  1M1K T;  3EGW B;  2G0I A;  2XZD B;  2WZ1 A;  4QZV B;  2QFJ A;  5LSL A;  4KH0 B;  1IJF B;  1BHN A;  3IAM 9;  3IWX A;  3MM8 A;  2QMU B;  4DFK A;  2G1H A;  4L75 A;  4U7C A;  4M5J A;  4DQP A;  4KFB A;  4LF6 F;  1T11 A;  2VOO A;  1VLY A;  1RSC A;  2OSQ A;  3OFF A;  1IBM J;  2RKI A;  4Q7A A;  3UWT A;  5F41 A;  2NZC A;  3NCP A;  2W2P P;  3WC0 A;  3FNN A;  3ILO A;  2QN6 B;  2CVE A;  5KFX A;  4JV5 J;  2N7Y A;  1NDP A;  5CD4 H;  4UQG A;  1CSJ A;  2EKY A;  2JEI A;  1RT1 B;  2Z30 B;  3H5U A;  4ELT A;  4JI4 F;  4C8Y A;  1RT5 A;  3E3X A;  4A8F A;  4X4T A;  5ETT A;  2VH7 A;  2AJ1 A;  4XIU A;  4LRE A;  1AUS L;  5IV4 A;  2G9O A;  2E9R X;  4WP9 A;  2Y3Y A;  3FMW A;  4DU7 A;  4E2F B;  5KG5 A;  3M8P B;  1TL3 B;  4OJ3 A;  3IG1 B;  2BOP A;  3CJ3 A;  2E1M C;  3C14 B;  3D1O A;  4B3M F;  5IWA J;  3NY0 A;  2B4O A;  1RYR A;  2IJF A;  5GAE U;  5CZV A;  4RW7 B;  3B54 A;  4DCO B;  2A18 A;  4OI3 A;  2CRL A;  2CNL B;  2K2P A;  1U0S A;  3PX4 A;  5DO2 A;  5J2N A;  1Q1K A;  1JLQ A;  1RAF B;  3CD7 A;  1SV5 B;  3L09 A;  4CLZ A;  2HVE A;  3HFZ B;  4Z2X A;  3BJY A;  2MSS A;  2YKM B;  3OXL A;  3HXM A;  4UUW A;  2OEJ A;  5HP1 B;  4CP5 A;  3MXH P;  1U1R A;  2B6A B;  3NEK A;  1SKS A;  2MLX A;  2NUU G;  2HW3 A;  3UCZ P;  1QLN A;  1WHX A;  1NKE A;  1PSD A;  2R8I A;  2LDY A;  3MD1 A;  3MZI A;  3OR2 A;  2D9O A;  1VQL S;  2IVY A;  3KJV B;  1RT4 B;  3OW2 R;  5J1E B;  3MHY A;  4YUD A;  2JWN A;  4DL3 A;  3FBC A;  4B9N A;  2XM3 A;  3FVY A;  4Y2C A;  4B9U A;  1UWA A;  2ASJ A;  4C8L A;  4K0K J;  1FDD A;  1FXD A;  4UTG A;  2V4R A;  2HS0 A;  5D78 A;  2YNI B;  1X5O A;  3ENV A;  4J7C A;  4WXW A;  1U1M A;  4BS2 A;  4CLU A;  3P49 B;  2Q6C A;  4DV0 J;  1IKW A;  5A76 A;  2R7Q A;  4P2M A;  1SXL A;  3UVJ A;  2P6S A;  5HAT A;  2VPY B;  1YLX A;  1FO1 A;  1WHV A;  2J9C A;  4YP3 A;  2KN4 A;  3SMZ A;  2W01 A;  2XO6 A;  2DYA A;  3GII A;  5DZ7 A;  1HWK A;  1S1W A;  4USI A;  2KYX A;  5JVG Q;  1WI8 A;  4OX8 A;  4L3K A;  3SCL E;  1H73 A;  2JOQ A;  1S1V B;  3QQC D;  2WVB A;  1CJV A;  3BH7 B;  1FA0 A;  3UN3 A;  3KLG B;  4EEY A;  3DHX A;  4X66 J;  3T6B A;  4V1A k;  1E6Y A;  3KNG A;  5KT4 A;  1CUL B;  1Q81 T;  2XYP B;  1KLM A;  1AFI A;  4DR4 J;  3WDO A;  3RAQ A;  1ZA1 B;  2NSB A;  3M8P A;  3MEC A;  3MM9 A;  4ZVF A;  1VBZ A;  5FJ4 A;  2VQF F;  3M8Y A;  2HGN A;  5ITH A;  4DV3 J;  2L3M A;  4J9V A;  4ZVS B;  1TL1 A;  1VLO A;  2I5J A;  3BBC A;  2UUW A;  4MFB A;  2B9W A;  2XMU A;  3M8Q A;  2WW4 A;  4ZVR B;  3U1M A;  1QE1 A;  4OYM A;  4JP8 A;  3DLE A;  3U1N A;  3TZZ A;  5DM7 Q;  1M5V C;  2B9Y A;  3EPI A;  3PJX A;  3QT7 A;  2AP6 A;  4W4M A;  3T9N A;  1BWE A;  4LFA J;  2CZ4 A;  4L74 A;  4MJK A;  3OQ2 A;  3DRP B;  5HN0 A;  1PCA A;  1D8Y A;  1X4B A;  2BQ3 A;  1KLM B;  3RB0 A;  1VQ6 S;  2UV8 G;  2KRB A;  4IR9 A;  2E44 A;  1SUQ B;  2IJR A;  3N5F A;  5BXI A;  4N56 A;  2JJ4 D;  3NGK A;  2K8G A;  2HKE A;  4B3M J;  2HFN A;  5KG3 A;  2JC1 A;  4DXL A;  1SJR A;  2C2D A;  3EX7 B;  1NJW A;  1MW7 A;  3KHH A;  1R8P A;  3UN2 A;  2KB2 A;  4ZVE A;  2OPQ B;  2XTJ P;  2HLT A;  4MAK A;  1S4E A;  4Y34 A;  4HTJ A;  3MM6 B;  3KK3 A;  3LQV A;  3Q0A A;  3OXG A;  5J2Q B;  2ZBC A;  2J6U A;  4O3O A;  4JYA F;  2NXE A;  1HBU B;  4V19 J;  3AFG A;  2PFF B;  2KJW A;  2C3U A;  3DKD A;  3MTJ A;  4LVN P;  4K59 A;  1KP6 A;  1QSL A;  2A0F B;  3UCG A;  5D0R A;  5EX0 A;  5CAB A;  3PV8 A;  1DRZ A;  3KLH A;  1F60 B;  2V69 A;  4PYD A;  4IG0 A;  4ZVQ B;  2W7P A;  1UVJ A;  1Q8B A;  1NHU A;  1GXT A;  2IPO B;  4TXS A;  2DNN A;  2XHW A;  2OSR A;  1MMN A;  4Y2A A;  1S1T B;  4DV1 F;  1N0U A;  2N4C A;  1YRT A;  2F1F A;  4MKY A;  3JS9 A;  1FJ7 A;  2UVW A;  4CO0 A;  1CJK A;  4QWB A;  2VG6 B;  2V50 A;  2B6A A;  3VCD A;  4WKY A;  3PO5 A;  4AFF A;  3GMG A;  4LF8 J;  1FVS A;  3FJ2 A;  1FDB A;  1URR A;  5JJB A;  3TAQ A;  4QW8 A;  2FJE B;  2V8V A;  5IM0 B;  4RNM A;  3VAJ A;  3SV4 A;  4QIG A;  4WK3 A;  5HAO A;  2W2Q P;  5AE1 A;  2M2B A;  5KG6 A;  3DRS B;  2V2Q A;  1R43 A;  4LSL A;  4K5R A;  4QIF A;  3CCS S;  1ZZN A;  2F8M A;  4LR7 A;  2D3O 1;  2XZT B;  3MOJ B;  1EB0 A;  1OY9 A;  2B4P A;  2RT3 A;  3KFW X;  2QX0 A;  3Q8S B;  1IBC B;  1KWM A;  1ZAV A;  2CKW A;  2WVC A;  1HBN A;  3I82 A;  5DDP C;  1RAO A;  1WDD A;  2J7W A;  3T5L A;  3RRH A;  4WXO A;  1RT2 A;  3HUL A;  2CZV C;  3CMQ A;  2HBZ B;  3TR5 A;  2ALZ A;  1X9M A;  2ZD1 B;  2AYM A;  2CWK A;  1TQL A;  3HT0 A;  3LGN A;  1FD8 A;  3A13 A;  4X4N A;  3MEE B;  2E5J A;  3OHA A;  5CYM A;  3MM9 B;  5KFU A;  1IKV A;  3FEX B;  1NLK L;  2K1R A;  2VG5 B;  1RAH B;  3U27 A;  5RUB A;  2BEF A;  1WEZ A;  1H7W A;  2DNK A;  1LKZ A;  3C6T B;  3K89 A;  3H59 A;  2DNH A;  3OSN A;  8ATC B;  3BGR B;  1VQO S;  5KT3 A;  4P71 A;  3QJJ A;  2KH9 A;  5B0C A;  4ZIT A;  4V19 X;  1PIE A;  1H38 A;  4MTP A;  4WCE Q;  3TOQ A;  4IQM A;  1BGX T;  5HI7 A;  3EDQ B;  1N36 J;  3I0R B;  5C7P A;  1H72 C;  3MUM P;  2AHO B;  1JNR B;  3BN7 A;  4CLT A;  3OHB A;  4OYX A;  4WK1 A;  2RRB A;  2HZC A;  4WTY A;  5F9L A;  1Y5L B;  1D09 B;  2DGW A;  3FRY A;  3LO3 A;  2BYC A;  2CVI A;  3HD2 A;  2BJE A;  4A47 A;  2DH9 A;  4E8U A;  5KFQ A;  2UXC J;  1R27 B;  1U09 A;  3GJR B;  1UL3 A;  2CJA A;  4HT5 A;  4L3N A;  4P7V A;  1KR4 A;  4A8O A;  4AL6 A;  3POT B;  1OO0 B;  3HK2 A;  4Q43 A;  4IG0 B;  2PI4 A;  1CJT A;  2NLW A;  1IJE B;  5KFJ A;  3LOU A;  4MYU A;  1AFJ A;  5HQL A;  3CCW A;  3G6V A;  5I42 A;  3OD2 A;  1PKU A;  3QNW B;  4N8O A;  3R2C J;  1XC9 A;  2CJB A;  2GAG C;  3O6Q A;  2VOD A;  1HHQ A;  4NA3 A;  2DGU A;  2ASY A;  3L7U A;  3CJ2 A;  1V3Z A;  2PC6 A;  3CF5 Q;  1HBU A;  5D3G B;  4JI3 F;  3UD4 P;  1OPI A;  1UJ6 A;  4WZM A;  1VI7 A;  4FNI A;  3R5A A;  4GVB B;  2GIQ A;  4P6Q A;  4DZD A;  4ZHR B;  2LXF A;  1AYE A;  1VHF A;  4X84 A;  1DUR A;  1L5U A;  4KJI A;  4U8Y A;  4RUA A;  4I0W A;  5HBM B;  3B4D A;  3GLJ A;  4GC7 A;  5LMN J;  3HO1 A;  1IKX B;  3ENQ A;  4IUF A;  2M9K A;  1TKZ A;  3PKY A;  4I6A A;  5LL6 d;  2DR8 A;  4JYA J;  4NXN F;  3PRV A;  3QAT A;  1AUD A;  3KNA A;  1Y0H A;  1MRO B;  3DLK A;  3OR1 A;  4LQ9 A;  3N6M A;  1F2G A;  2J0W A;  1UMJ A;  3D68 A;  5H9F K;  4NI2 B;  4Z37 A;  3QO9 A;  4RL1 A;  4OYO A;  1PC4 A;  3I6P A;  4ZVH A;  2IIH A;  1WTB A;  4KPY A;  3N6N A;  3U1L A;  2LQB A;  2X7I A;  3UNG C;  1GH8 A;  1HBM B;  3W60 A;  1Q79 A;  1WJ9 A;  5F0U A;  5CYQ A;  5J2P A;  3NS5 A;  1H2T Z;  5CCL A;  4K5S A;  3MFH A;  1XMO F;  4RNN A;  2BKP A;  2CNN B;  2L9N A;  5DGB A;  3U7J A;  1A6L A;  3GB0 A;  3TA2 A;  5HJX A;  1RAA B;  2DNL A;  1KS2 A;  3OVA A;  4HHH A;  3L3C A;  1RLC L;  4CH7 A;  2CDQ A;  5L9X A;  3QGH A;  1GK8 A;  2RKI B;  3CJ8 A;  4MKV A;  4U67 Q;  1FHT A;  3TNV A;  4K0K F;  4JV0 A;  2XWX A;  4RW6 B;  5D0H A;  1MWZ A;  4WFB Q;  4DOZ A;  2LEC A;  4K4Z A;  3M9N B;  2HFO A;  3OPK A;  1PO6 A;  2ZOG A;  1UVI A;  4G1Q A;  2JEG A;  3E01 B;  4F2R A;  3HHN B;  3QYY A;  4ILR A;  4RZR A;  4W92 B;  1T9T A;  1UWB B;  4KR0 B;  3GFX A;  1F1B B;  4M5L A;  3MR2 A;  2WOM B;  4DMZ A;  1GTE A;  1XEZ A;  2RHS B;  2V63 A;  3N6L A;  5SZT A;  1PYO B;  1M5O C;  1ZAW A;  2FY1 A;  3UVJ B;  2C3Y A;  4CM2 A;  5LT5 A;  2MQQ A;  2FVQ A;  2ZNY A;  4ZPB A;  1IKW B;  3NBP B;  1M1G A;  2ZWP A;  4NRT A;  1FF2 A;  1Q8I A;  2VD3 A;  1UEV A;  4ELV A;  2ZUG A;  1XJW B;  1TK5 A;  1U0H B;  5HVG A;  3EGZ A;  5F8H A;  2FJX A;  4IG3 A;  2RIJ A;  3KLI B;  3VGU A;  5ETN A;  4DL7 A;  4Q5V A;  3MMB B;  4YS2 A;  2EFN A;  3TAR A;  4NLP A;  3IBC B;  2LXI A;  2OUG A;  1PGZ A;  4LSZ B;  3DNC A;  4J5O A;  5T7L A;  3KMQ A;  4RBT A;  4CH1 A;  4ZLJ A;  1FTC A;  1NSP A;  3VQT A;  2MKY A;  4IKA A;  1E6V A;  1ZOT A;  1N6Q A;  2L48 A;  2R2R A;  4HKQ A;  1O8B A;  2DXF A;  4C11 A;  5AE2 A;  3E01 A;  5HMX A;  3C16 B;  3RB3 A;  2ZZN A;  3DOK B;  1RAC B;  4PCQ A;  1YJ9 S;  2V2V A;  2G2Z A;  4DL5 A;  1N52 B;  5I3U B;  4ED5 A;  1XNR J;  1DTQ B;  3W61 A;  1FKA F;  4XDC A;  4KHR A;  1PJ6 A;  3NAH A;  4ALZ A;  1VQ5 S;  3K2Y A;  3H20 A;  2JEF A;  3T1H J;  4LF5 F;  4TLR A;  4ED4 A;  4DUZ F;  2RUG A;  3SIP B;  4YR0 A;  1F0X A;  2B51 A;  5A8R B;  4X64 F;  2MEW A;  2QJ3 A;  3W9I A;  1UA1 A;  2DJW A;  3W5Y A;  1U24 A;  1SH3 A;  3HT3 A;  4B3S J;  1JJH A;  5C2G A;  3MFI A;  3TI0 A;  1JLE A;  2GHW A;  2YKO A;  1JLG B;  3G8Q A;  2GHP A;  2MZS A;  3EVO A;  4LSN A;  1NPR A;  3SQG A;  1R8B A;  1YKW A;  4ER8 A;  1NDL A;  1VRT B;  2HGL A;  2VC0 A;  5IT9 U;  4TYB A;  3GP9 A;  4ECY A;  3J80 Y;  2AIR B;  2LKZ A;  2YKA A;  2ZFH A;  4LSL B;  2XHC A;  1RT5 B;  1FX4 A;  3C19 A;  1VHI A;  4B3R J;  3RBZ A;  1R6Y A;  1RWO B;  1YJ7 A;  4AXJ A;  4FF4 A;  5DG8 A;  1V3R A;  3OR1 B;  4TU8 A;  1NU4 A;  3TX8 A;  3GJQ B;  5C25 A;  5DQI A;  1R8C A;  2R4F A;  2BX6 A;  3M2V A;  1IQZ A;  2GJ2 A;  2LQ5 A;  3CTR A;  1U25 A;  3NOG A;  3BQ2 A;  3VTI A;  4DWI A;  4X4U A;  3KJF B;  3DLJ A;  1XTZ A;  3ZTR A;  1L3T A;  1A0O B;  2BJ3 A;  4F0K A;  1JNZ B;  1S1T A;  2H5J B;  3BBF A;  1FRX A;  2HND A;  2Z0G A;  2YKQ A;  1B0P A;  3EZ5 A;  2EWH A;  2AYB A;  3TW0 A;  4J9P A;  1RBL A;  2E5G A;  2Z57 B;  4GO7 X;  3VAF A;  1J5E F;  1M5S A;  3OTE A;  3HMJ G;  2PFD A;  3MTK A;  4DUZ J;  1KKH A;  2HZA A;  2HFV A;  4EU0 A;  3T1H F;  5LMU J;  2AZ1 A;  5ETS A;  4LF5 J;  4YB7 A;  3RW6 A;  3BKU A;  4UOF A;  2N3O A;  4OZ2 A;  2Y9H A;  5FDL A;  4B3O A;  1RTI A;  2JHE A;  4LBI A;  4ATN A;  2MXY A;  4PXB A;  1J27 A;  2AWZ A;  4USJ C;  1X9W A;  4F0M A;  2W9C A;  2F65 A;  5LJ3 Y;  2KYZ A;  1WUU A;  2IMW P;  2O67 A;  1I5O B;  3TZX A;  3D2W A;  3RRK A;  1HQU B;  4DUY F;  3CME S;  1X4C A;  3LW5 C;  2HRY A;  1VIO A;  4NL5 A;  4OZL A;  4QR1 A;  5A0Y A;  2ERR A;  2B5J A;  4CNY A;  2ATL A;  4JI0 J;  1ZM3 A;  2Q3P A;  2HZV A;  1AXQ A;  2KVI A;  5DLF A;  1AW0 A;  1P8G A;  3QT5 A;  2DPJ A;  2UXB F;  2GVD A;  3HVA A;  2CPE A;  3SEO A;  3W62 A;  2FIU A;  5BYS A;  1RHQ B;  5DDO C;  3OJU A;  3MEG A;  4DV6 J;  1HFE L;  1S59 A;  3DXB A;  3D1H A;  2VG5 A;  3DGV A;  1S48 A;  3LP2 B;  2MZJ A;  3R5D A;  1S79 A;  4H4M B;  4Q8E A;  2EXU A;  5B0G A;  5H1S V;  4LF8 F;  1N56 A;  2M8D B;  2GZO A;  1DAX A;  1DFD A;  4BLG A;  5KTQ A;  4WKR A;  4JV1 A;  1GMU A;  1EP4 A;  3IM8 A;  4M63 A;  1WOO A;  1RWX B;  1RK8 A;  2DGO A;  2H48 B;  4PG6 A;  4WPA A;  5A8W B;  3TEH B;  4LFB F;  1X4A A;  3NL0 A;  2VBW A;  3HHL C;  2YBV A;  5F3T A;  2R2U A;  3GCX P;  2VJU A;  3SCI E;  4KKO B;  3F56 A;  3QWP A;  2BE7 D;  3DCA A;  4ZLP A;  2KDO A;  2GML A;  4A8X A;  3ICL A;  2AEF A;  5KFD A;  5LMU F;  4PXE A;  1H0H B;  5EGY A;  5C42 B;  2BR0 A;  4PWD A;  4ZJO A;  3GJT B;  3P5T L;  5T41 A;  4O4G A;  5GAE I;  3D0H E;  2I0X A;  3PR5 B;  3Q8P B;  1IBK J;  2FJV A;  3CSK A;  3IRX B;  2UUA F;  2HFZ A;  3OFE A;  4QIV A;  4FBU A;  2K7K A;  3GYG A;  4U6P A;  3W3S A;  1LK5 A;  2L9D A;  3IC1 A;  5KFW A;  2DEI A;  3R5G A;  1NB7 A;  4PUO B;  3KUH A;  2CQ2 A;  1F5C A;  2OLW A;  5KFH A;  3GIL A;  4OI0 A;  3PW5 A;  1T9V A;  4B3T J;  3HHK A;  2V0N A;  5LM7 E;  4C98 A;  2XCP A;  3P96 A;  3M32 B;  2I38 A;  3M2U A;  4MK7 A;  2AJ0 A;  3UR3 C;  1WKK A;  4KGK A;  3I5A A;  4KQZ A;  2DKO B;  3VV2 B;  1NH7 A;  5L8R C;  3RB4 A;  1HIY A;  1RZM A;  3CD0 A;  1JKH B;  1HWI A;  1U47 A;  2JFK A;  4M5I A;  1VBY A;  4BHQ A;  3SBM A;  4YR2 A;  1NRK A;  2V4Q A;  3KLF A;  4R25 A;  2ZKT A;  3MOZ A;  4HAC A;  2QYC A;  1DTT B;  3TWZ A;  4ZLL A;  1NJI T;  2GQC A;  3ET6 B;  3J81 U;  1WAC A;  3AT1 B;  1U45 A;  1KQF B;  5GMD A;  1HHT P;  2NZ4 A;  4JI6 F;  2YKM A;  2H9Z A;  1LOU A;  1N5T A;  2DO0 A;  3I9Z A;  3KJQ B;  3NLC A;  4MMO A;  5DS7 A;  3VAL A;  1U1K A;  2H1Y A;  3BSC A;  2VJV A;  1SL0 A;  3D6F B;  3Q2S C;  5C42 A;  3CJ0 A;  1GEH A;  4FVC A;  5J2N B;  2K3I A;  1B0T A;  4KV8 A;  1JLG A;  1TL5 A;  1BMQ B;  2W2M P;  3DYA A;  3WIV A;  1YIJ S;  5LSR A;  4RW4 A;  2QA2 A;  4JB8 B;  2OPR B;  4TN2 A;  3VGT A;  3R5J B;  3CC4 S;  3JSB A;  1KTV A;  2IMO A;  2HLU A;  2ZBQ A;  3HSD A;  2JX2 A;  5SUH A;  1EP4 B;  4DV7 J;  3UR0 A;  3IG1 A;  3HFV A;  3T9Z A;  1RB0 A;  1YSJ A;  3MR6 A;  4A8K A;  3PW7 A;  4QQB A;  3TUJ C;  4YQW A;  1K0T A;  3NMR A;  2D1C A;  1K1S A;  4DX7 A;  4PWW A;  1M90 T;  1LWF A;  4LRC A;  1K47 A;  2VFU A;  5IQ6 A;  1BY9 A;  2Z4P A;  2AGO A;  1FNM A;  3K5M A;  3LP2 A;  2LDI A;  1N0V C;  3A3O B;  3GV5 B;  2FUG 9;  2OFH X;  5E3R A;  1WG1 A;  2B7C B;  4WBF A;  4ED7 A;  2DIT A;  3PW2 A;  2M88 A;  1U2C A;  4EGL A;  4ES1 A;  4USV A;  3EXY A;  3RB6 A;  1TVR B;  4PWU A;  1JLC B;  3HKZ D;  2ZEJ A;  2E7W A;  3K8V A;  3LUY A;  3BF4 A;  2IA6 A;  4C8N A;  1SIW B;  1UVL A;  1RHM B;  4D3H A;  1KEK A;  3A8J A;  4YR3 A;  1S7I A;  2HHQ A;  2PMZ D;  1U48 A;  2MB0 B;  1TU0 B;  2MYF A;  2OAU A;  5D4N A;  2YXL A;  3IR6 B;  1T3O A;  1S1W B;  4HLB A;  4TYA A;  3PJW A;  4RJV A;  3R3T A;  2J9D A;  4U95 A;  1RHU B;  3J7A 1;  2BAN A;  3CIZ A;  4HHU A;  4NRU A;  4KTQ A;  1AZS A;  4L73 A;  3UW1 A;  2ZHB A;  3PCO B;  1DQA A;  3ZTS A;  3TUP A;  1X5S A;  2XI2 A;  1RBA A;  1SQF A;  1WHY A;  3Q8Y A;  4K4U A;  2LYV A;  4ZS6 A;  2P6T A;  2DHS A;  1HKA A;  4OI2 A;  3AQO A;  1QAX A;  1KOO A;  3HDS A;  2HQI A;  1YG0 A;  2DY1 A;  4RW9 B;  3KK2 B;  4C9D A;  3GYN A;  2V4J B;  1WF1 A;  2DGX A;  2I6W A;  4AUK A;  3R1H A;  2KXF A;  2UXD F;  4BDP A;  4O44 A;  1W7W A;  3QFH A;  4UUX A;  2NPF A;  1LW2 A;  3MR5 A;  3DC2 A;  4FXW A;  1TVR A;  3JQJ A;  4ZPW R;  1TKX B;  2UZA A;  3M2V B;  4PYA A;  3BN4 A;  4OZ3 A;  3G87 A;  2ZM6 F;  3FEZ A;  3MMC A;  1PAU B;  5HVF A;  4Y2K A;  1RE1 B;  4C48 A;  4LR8 A;  1Z2L A;  1SIZ A;  1RTJ B;  2XMV A;  1GQE A;  3C8Y A;  3VF0 B;  2MZ1 A;  1Q5Y A;  2DNY A;  4H4K A;  3P5B P;  3IN5 A;  2QGF B;  4DFM A;  1C1C B;  4KY3 A;  2XG8 A;  1X8D A;  3B82 A;  2XNQ A;  5A2Q Y;  2B8P A;  1CS4 B;  5AXK A;  3M6W A;  5LMN F;  1VRT A;  4PG5 A;  5A6P A;  1T8E A;  2VPZ B;  3NG8 A;  1SC6 A;  4TKT A;  4J9O A;  5HRO A;  2A2D A;  1FE4 A;  4MH8 A;  2I8E A;  3FBF A;  1TK0 A;  1RKJ A;  4DDF A;  4RW8 B;  2KT3 A;  5L9N A;  1MRO A;  3DLK B;  2IDE A;  4Q45 A;  4JI3 J;  3HVR A;  3BB5 A;  4LF4 J;  3Q89 A;  3DOL B;  4OV1 A;  3VZI A;  1S49 A;  1N33 F;  4N8N A;  5KFV A;  1MU2 B;  1NXI A;  4NLU A;  4C3M A;  3MUV P;  1QAJ A;  1HD1 A;  2CQI A;  5T14 A;  1T7P A;  1NH8 A;  4I56 A;  4RUC A;  3ZZZ A;  4K4S A;  2WBR A;  2ZH4 A;  1RP5 A;  2VA3 A;  2R7U A;  3LP0 B;  1PBU A;  4OI6 A;  1S1U B;  2HIQ A;  3DN9 A;  3R5B A;  4IO1 A;  3TJA A;  3VAK A;  5GAG I;  1NK5 A;  2W24 A;  3CDE A;  5JUM A;  4W90 B;  4UY8 5;  1L3S A;  3I0S A;  2CPH A;  4I64 A;  5MLC V;  4IFY A;  3V81 A;  1BQM A;  2Q43 A;  4J37 A;  3CD6 S;  4ZCK A;  1R8A A;  2WON A;  1TMM A;  1T9U A;  2DT9 A;  3MWB A;  3LWM A;  3MMB A;  2EBE A;  3MPD A;  3M9O B;  3POT A;  2MQP A;  1KD1 T;  2GCF A;  4RW9 A;  4ZIV A;  1KN6 A;  3UDC A;  3D54 A;  2W9B A;  2UVR A;  2EK6 A;  3ULH A;  4P2S A;  3IFE A;  2M5Y A;  3ONQ A;  4ZP7 A;  4P9S A;  4URQ U;  3DDI A;  3WZ0 A;  1VMB A;  2BV3 A;  9ATC B;  1VBK A;  2XYH B;  2KT2 A;  6FDR A;  2Z56 B;  3MGJ A;  2GA7 A;  1B0V A;  4IH7 A;  4QWC A;  3BKF A;  2D3O R;  4CO1 A;  2X3D A;  4RU2 A;  2XSJ B;  4DSK A;  2DGQ A;  3R97 A;  4X66 F;  4M5G A;  3B6B A;  1SVD A;  2YWF A;  2COL A;  1BQM B;  3GYX B;  2QRR A;  2FJA B;  4HT7 A;  4CLL A;  4TNO A;  2KRR A;  3L7P A;  4RBV A;  4EK2 A;  5IZH A;  1XK8 A;  3I32 A;  5E41 A;  2XI3 A;  1HMV A;  4KB7 A;  5DGA A;  2M52 A;  4ANE A;  2DXD A;  2YH1 A;  1F9H A;  1JMT A;  1VRU A;  4JBC A;  5HMW A;  3V4I A;  4HDH A;  4OYZ A;  3W66 A;  4UZB A;  2ZIT A;  4X4Q A;  1G7C B;  2KT5 A;  2VPX B;  4P10 A;  3H25 A;  1N5Y B;  4FVM A;  5AT1 B;  5KFP A;  4ES2 A;  1CJU A;  4XDD A;  2DCU B;  4DV7 F;  2QEX S;  3TQ1 A;  1TFY A;  2ZE2 B;  5KFC A;  1NBE B;  4F4W A;  2IAJ A;  2IRY A;  2C2K B;  4G1I A;  4RW8 A;  5H9E K;  1NAQ A;  2RB7 A;  2PA8 D;  3AOA A;  4MK8 A;  4DN0 A;  3BO3 A;  4DV2 F;  3PKM A;  4XAK A;  3AJ2 A;  3KUG A;  3PFO A;  2XO7 A;  1QM9 A;  3DXS X;  2YNG A;  4I2Q A;  3MR3 A;  1TEL A;  3G4S S;  4NPO A;  3C2P A;  1C0U A;  4I2P B;  2M3D A;  1QAI A;  2SXL A;  3KG4 A;  4A4J A;  4LF4 F;  3T5H A;  3CUL A;  3H2V E;  2VV5 A;  3HI9 A;  1RA6 A;  4GMK A;  4ZP6 A;  3TA0 A;  1LXJ A;  2ZVS A;  1RUS A;  3LTO A;  3RGI A;  4RW4 B;  5CXT A;  2WAQ D;  4NZ6 A;  4B9S A;  5HVH A;  3PO4 A;  4X62 J;  1U6F A;  4O0N A;  3TZW A;  4DV3 F;  4DSF A;  4EUV A;  3PX0 A;  3MAA B;  3KLV A;  2QLJ B;  4USH A;  1HNW F;  4QIW D;  3KXD A;  3OVB A;  2PT0 A;  2IYI A;  4ZHR A;  5FDL B;  5DLG A;  4URG A;  2IFX A;  2V4J A;  3DLG B;  1C0T A;  1UZH A;  4DR6 F;  1OS5 A;  3HHE A;  3H4D A;  1XBW A;  3QZ7 A;  2YKN B;  2M8H A;  3ENW A;  2CPJ A;  1NKC A;  4X2B A;  3J7A N;  5B0A A;  6FD1 A;  3NWG A;  1XMQ F;  3X1L B;  3GV7 B;  3I9V 9;  2OEL A;  4KYZ A;  2C28 A;  1JK9 B;  4CO3 A;  2PSZ A;  2AJ2 A;  4JI4 J;  3MM7 A;  3PYD A;  1O0P A;  4OI4 A;  2DBB A;  3PG9 A;  2BMB A;  4WE1 A;  3CCM S;  2BQR A;  2MQN A;  2BE2 B;  2JVO A;  1NHV A;  3PZP A;  2YPY A;  1TP7 A;  4N7T A;  2O1P A;  3VVT A;  5F8I A;  1FRM A;  1OYD A;  1YJW S;  4S0M A;  4DHV A;  2MQL A;  4IRC A;  4CTA B;  4M5N A;  3K59 A;  5IOL A;  1S77 D;  2MST A;  3TYT A;  2YKP A;  4IH6 A;  4NWB A;  5EDW A;  2NR0 A;  5J2M B;  4U8V A;  5GMK a;  4PKD B;  2WSC C;  4Y28 C;  1JWW A;  5CQG A;  2JZ5 A;  1K9M T;  3WIU A;  4DX6 A;  4EYI B;  3PIP Q;  2FD2 A;  2C42 A;  3MED A;  4M5M A;  2VQF J;  4LSN B;  2CDR B;  2QMX A;  1GNK A;  5M2R A;  2QMW A;  2P9E A;  1N88 A;  3CVK A;  4NLY A;  1LWX A;  5CD4 A;  1I6J A;  4A8Y A;  1Y11 A;  1QE1 B;  1FFW B;  3ZZT A;  4CT8 A;  2W8L A;  3M8Q B;  1UP1 A;  4PPD A;  2FTR A;  2I2Y A;  3ZZY A;  1ZH5 A;  4QBU A;  1RU2 A;  4ECT A;  4NCB A;  2AMC B;  2CQ1 A;  1M5H A;  3C15 A;  3L4B C;  3MPU B;  5B0E A;  4CM0 A;  4ZIW A;  2XCA A;  1FKO B;  4KGM A;  3RR8 A;  2DHX A;  2DVI A;  4NLG A;  5GAD U;  1X4F A;  3C15 B;  5KFY A;  1ZTW A;  2G2O A;  1E6Y B;  3RUB L;  2CIM A;  3Q23 A;  4LF9 J;  5IWA F;  3MEG B;  1FJE B;  1DY3 A;  1S57 A;  1XN9 A;  1I1G A;  1VK3 A;  3CB4 A;  4NLR A;  3LH2 S;  4CLP A;  2E7X A;  2MDA A;  1YJT A;  3C6U B;  3FQL A;  4MT1 A;  2R8K A;  1IN0 A;  4DSJ A;  1HWJ A;  1QJH A;  1RQ0 A;  1TFW A;  4NCG B;  2CQ0 A;  1Y5N B;  2F4F A;  1CS4 A;  3CJ5 A;  4JV2 A;  1Q7L B;  1ACM B;  4U96 A;  1U6B A;  5K5M A;  3AAW B;  4DS5 A;  1WDT A;  2UUA J;  5J2M A;  2CQP A;  1G1X A;  2V68 A;  2A10 A;  2KHD A;  2AYG A;  2D3Z A;  4C0H A;  4CLS A;  2NRE A;  4WZQ A;  2GJI A;  2OEM A;  3FFI B;  4ZJQ A;  2VA2 A;  3MD3 A;  1HNX F;  1IWA A;  2RF2 B;  1TKX A;  2E1P A;  1B99 A;  1TUV A;  3AA9 A;  3EUN A;  3LGH A;  1SCJ B;  4Q44 A;  2F5G A;  2AD9 A;  3RG6 A;  3NBP A;  1JXE A;  2UV8 A;  3GV8 B;  3CT9 A;  5D77 A;  2K3K A;  1CC7 A;  3OFG A;  1FJG J;  4X4P A;  3KJV A;  3MAQ A;  3IP0 A;  4PPZ A;  3EVM A;  4FXV A;  5KFK A;  4Y2I A;  3LPE A;  2ZUA A;  2VBX A;  3LP1 A;  2DGT A;  3TAM B;  2GJF A;  2WRM A;  3Q83 A;  3TVZ A;  4RNF A;  3OL8 A;  3KHL A;  2B0G A;  2G1D A;  5IC4 B;  4CLY A;  2Y1J A;  1XR7 A;  3NGD A;  3LP1 B;  3TAM A;  1RT3 A;  2OD4 A;  2F9D A;  3IXQ A;  4HL9 A;  4RPF A;  2FHJ D;  2CNK B;  4JI0 F;  1FI4 A;  5I3Q A;  3MMA A;  4DX5 A;  2R2S A;  4DF4 A;  4QCL A;  2J8S A;  2XMT A;  5D4O A;  4I68 A;  2GMJ A;  5K20 B;  4XPE A;  4PWD B;  3CCQ S;  2E7V A;  2BW7 A;  4RNO A;  5AXN A;  4OZ0 A;  1R31 A;  1ZM4 A;  3UCU P;  4R5P B;  4KKO A;  2I1R A;  1NSQ A;  5B7W A;  2XLI A;  1SQE A;  3OL9 A;  5A2Q U;  2MKI A;  3ZC4 A;  2WHO A;  2WSF C;  3C14 A;  1KOH A;  2BUN A;  3H2L A;  3JXO A;  4AT1 B;  3TAP A;  1YIT S;  3AOD A;  5ETP A;  4ILL A;  1O51 A;  5D6G A;  2XSF A;  5D15 A;  1C0U B;  1X5P A;  1I51 B;  2AX0 A;  4I2P A;  2C2M B;  5CYJ A;  1FXL A;  1YJV A;  3D4J A;  4I2Q B;  4J9U E;  2QA1 A;  3CC7 S;  2VAS A;  3FMB A;  3GON A;  2BRK A;  4C0O C;  3QGG A;  1I94 J;  3CCJ S;  1XNR F;  2HHU A;  2AGP A;  4DSL A;  1U26 A;  1VCT A;  4LFB J;  2FLP A;  2RRN A;  4KO0 B;  5AXL A;  5H9F J;  2MZR A;  2FHJ A;  4YHH J;  5M2P A;  1U2R A;  4Y2M A;  4ECX A;  3M7V A;  1HI1 A;  2Y1L B;  3GFY A;  1N5Y A;  1U8W A;  2OPP B;  4O23 A;  4EBE A;  2KFN A;  2VIC A;  1D0E A;  5E0O A;  3FBB A;  1YZ7 A;  1NJY A;  2ASD A;  2NUH A;  4X4R A;  2GHV C;  3DHW C;  4B3S F;  4WF9 Q;  3OLB A;  1TKD A;  5A0Y B;  4K7Q A;  1DLO B;  2GO8 A;  4NLQ A;  3V6D B;  3PW0 A;  2J9D E;  2V9W A;  4A46 A;  1K73 T;  4WP3 A;  5G4D A;  2HS3 A;  5HK4 A;  3ILJ A;  4WWS A;  2EFG A;  1TTH B;  5ADZ A;  4UF4 A;  1Q8L A;  2MY8 A;  2IHR 1;  3B8H A;  3N9U C;  2HVZ A;  4DL0 C;  3W2W B;  3HP6 A;  2YX4 A;  2IBK A;  2NCK L;  1EQ0 A;  3T3F A;  1UFW A;  4ZJL A;  2XSJ A;  4OLO A;  4K4W A;  1HI0 P;  2HNY A;  2ZDO A;  5F8L A;  4X64 J;  1D9F A;  2ILY A;  4LRA A;  3IBW A;  1HW9 A;  3QRQ A;  2GX8 A;  2KFZ A;  4WYW A;  3MM5 B;  2PGC A;  4F3O A;  4ZA1 A;  1D9A A;  3M05 A;  4FF1 A;  3B78 A;  4YEA A;  3RU0 A;  3IRW P;  2W7A A;  2KZZ A;  5IT4 A;  1X4G A;  5J1E A;  3KLE B;  1RT4 A;  2QTW A;  4K4X A;  4AQY F;  1H74 A;  4LBP A;  2CXE A;  4AL5 A;  4IFY B;  4OYA A;  5IQQ A;  2XMW A;  3CCZ A;  2JRS A;  1WEY A;  2NYH A;  1RWK B;  4WIQ A;  3VWS A;  1N48 A;  2DXE A;  4NZ0 A;  1KFD A;  3CJK B;  3DM2 B;  3TA1 A;  4EO8 A;  3T41 A;  4CQ1 A;  4Y65 A;  1RT7 B;  4M95 A;  4URS A;  4XO0 A;  1FFS B;  2KJV A;  1RHK B;  2CPD A;  3Q2T C;  1KQK A;  2FVC A;  3KJN B;  3D66 A;  3D9B A;  3H5Y A;  2EFP A;  2DTJ A;  4QPT A;  4J90 A;  3ZZ0 A;  1FWP A;  1UFL A;  1C1B B;  5KFB A;  2MQO A;  1S6Q A;  2V5H G;  4PZV A;  3KHG A;  2E9T A;  5F8M A;  1D3W A;  2FVS A;  2B8Q A;  4WII A;  3ZO7 A;  4TU9 A;  1F5B A;  4JI2 J;  2XB2 D;  2L41 A;  2H4W B;  2HQ3 A;  4I7F B;  3ZZP A;  2CQD A;  2QL5 B;  2QO3 A;  2YVS A;  2FHM A;  3GCW P;  5A8W A;  4F4X A;  2ZJQ Q;  5L1L A;  1BE4 A;  4ECV A;  1B4S A;  3M2R B;  1K44 A;  4ZMM A;  4IOC Q;  4BWM A;  1FKP A;  1LWE B;  2W4D A;  1WOP A;  3KWM A;  3UQS A;  1YRU A;  4DUT A;  4Y6I A;  1RT1 A;  1VYA A;  3EMT A;  2P9C A;  2RE1 A;  1S6O A;  4R8U A;  2BJ7 A;  1S10 A;  2HEK A;  2D74 B;  3CNQ P;  3FSY A;  1VQP S;  3GIR A;  4EI2 A;  4TQR A;  1CJU B;  5LXR A;  4X65 F;  4K8R A;  2F8H A;  1GX5 A;  5EWF A;  3C3L A;  1APS A;  1QY7 A; 
#chains in the Genus database with same CATH homology
 2QLJ B;  3GJT B;  1PAU B;  1RE1 B;  1RWW B;  3EDQ B;  3NS7 B;  2QL7 B;  2HBR B;  2QLF B;  2XYP B;  1RWP B;  1I51 B;  1SC1 B;  2C2M B;  4ZVS B;  3SIP B;  3GJR B;  4ZVP B;  4ZVR B;  2DKO B;  1RWM B;  3GJS B;  3EDR B;  3QNW B;  2Y1L B;  3RJM B;  1I3O B;  2XZD B;  1RHR B;  1QTN B;  1RWO B;  3KJQ B;  1GFW B;  3GJQ B;  2C2O B;  3IBF B;  3R7B B;  3D6F B;  5IC6 B;  2CDR B;  3KJF B;  1BMQ B;  2H5J B;  4JB8 B;  2H65 B;  3R5J B;  2QLB B;  3R6L B;  2Y0B B;  2HBQ B;  2C1E B;  2CJX B;  2H4Y B;  2HBY B;  2XYH B;  1QDU B;  2CNN B;  4ZVQ B;  3R6G B;  4DCO B;  4DCJ B;  1SC3 B;  2CNL B;  3P4U B;  1RWK B;  3R7S B;  4ZVU B;  1RHM B;  2XYG B;  2QL9 B;  2CNO B;  4ZVO B;  1RHK B;  2H54 B;  3KJN B;  3R7N B;  2XZT B;  1IBC B;  1RHU B;  1RHQ B;  1PYO B;  2C2K B;  3D6H B;  2P2C B;  1SC4 B;  1RWV B;  2C2Z B;  2H4W B;  2QL5 B;  2HBZ B;  1F9E B;  2FQQ B;  5IC4 B;  2H5I B;  1RWX B;  2H51 B;  2H48 B;  3P45 B;  3D6M B;  1RHJ B;  2CNK B;  2CJY B;  1NME B;  4DCP B;  3IBC B;  4ZVT B;  4LSZ B;  1RWN B;  5K20 B;  1ICE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...