1RWNB

Crystal structure of human caspase-1 in complex with 3-{2-ethyl-6-[4-(quinoxalin-2-ylamino)-benzoylamino]-hexanoylamino}-4-oxo-butyric acid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwnB00
2H48B 1GFWB 2HBYB 3QNWB 3GJQB 2CNKB 2QL9B 4ZVQB 2H65B 2QLBB 3D6MB 2CDRB 3R6GB 4DCJB 3GJTB 2CNOB 1RWWB 3SIPB 2H54B 1ICEB 2H4YB 4DCOB 1RWXB 2C2KB 2HBQB 2QL7B 3KJFB 3KJNB 4ZVTB 2C2OB 1SC3B 1PYOB 1RHQB 2XZDB 3GJRB 4ZVPB 3RJMB 2DKOB 3GJSB 4DCPB 5IC6B 1QDUB 3NS7B 1F9EB 2CJXB 1BMQB 1RHRB 3IBCB 2Y0BB 3D6HB 1RE1B 3R6LB 1RWMB 1RWOB 2XYHB 3EDRB 1RHUB 3D6FB 1SC4B 4ZVUB 5K20B 1RWPB 2H51B 3EDQB 1QTNB 2FQQB 2CJYB 3KJQB 3P45B 2C2ZB 1RHMB 3R7SB 2C2MB 1IBCB 5IC4B 1RWVB 3P4UB 2CNLB 1PAUB 2H4WB 2XYGB 2QLJB 1SC1B 1RHKB 2H5JB 3IBFB 4ZVOB 1RHJB 2QL5B 2Y1LB 2XYPB 1RWNB 3R7BB 1I3OB 1NMEB 2HBZB 2H5IB 2QLFB 4ZVRB 4ZVSB 1I51B 2C1EB 2XZTB 1RWKB 4LSZB 4JB8B 2HBRB 2P2CB 3R7NB 3R5JB 2CNNB
chains in the Genus database with same CATH superfamily
4DX7A 1MMDA 2ZKTA 3C14B 5GMEA 4CLWA 1T0TV 1RWWB 3KK2B 1FNXH 1U2CA 1HQ2A 4OYMA 3MM9A 3KLFB 2HHHJ 5B0CA 1F5BA 1KN6A 4GVLA 5KFQA 1NK6A 2ALYB 2YNIB 5T7LA 4OHZA 6FDRA 3AOCA 2J0SD 4B3SF 3DM2A 3AB4B 3MPUB 4JI1F 2LKZA 4GKJF 3NCQA 2DXEA 2PMHA 2CPJA 1N34F 3GSIA 2YTCA 1F9FA 5KT4A 1KP6A 3RU0A 1G4CA 2J9CA 2IAJB 2BKPA 3QLHA 3I31A 4DL5A 1S4EA 1OSDA 3I96A 1DTQA 3VAFA 2HMIB 4DSIA 1VQSA 1R8HA 2CKWA 4LF9F 5IT4A 4LSNB 2ZC4A 1TKZB 1C1BB 1VMBA 4PG4A 4LSZB 2ZOFA 4C98A 1RT1A 5EX3A 3DCAA 3T1YJ 3DLHA 1HBUB 3VAHA 3DRPB 1QTMA 2R8JA 2DNRA 4IYQA 1ROFA 2VDHA 1HNXF 3BZQA 4RNFA 2IJNA 3H59A 4CP5A 3I5AA 3C6TB 1T9YA 3RRGA 3FZBA 2RQCA 3BO3A 1MU2B 3TR5A 3HULA 1HLWA 1S0VA 5I3UB 4DQQA 2EW9A 2XSJA 4DR1F 3D6HB 3Q23A 2XS2A 1KKHA 3M8ZA 3D1OA 1REGX 3D7SB 1SVDA 1TKDA 5J2MB 3BN7A 1EZZB 1KFDA 4QIWD 2LQ9A 4WJBA 3MECB 4WP3A 3PRDA 1X4GA 1YRTA 1LOUA 3MEEB 4NRUA 4H4OB 3T5JA 2C2DA 3NP5A 3QSIA 1EHWA 4DZ6A 4ED7A 1RT6A 4MK8A 4LJMA 3NOCA 1OQ3A 3V6DB 4BDPA 4KPCA 2FLOA 1M5OC 3L7UA 4JB8B 2CQCA 2ZHAA 2CQIA 2ZBPA 3LH2S 2Z57B 3TAMB 2CPFA 3M8WA 2C3UA 2JZ5A 3F56A 2OH2A 4ZPVR 2RVJA 2JSXA 2J7UA 1UJ6A 1SJRA 2AJ0A 2RDIA 3TWZA 2RQMA 4C48A 2R7SA 3PIOQ 2A6OA 5AJ3F 3VR1A 1N5TA 1U2FA 3FEZA 1R31A 1BC6A 2XCPA 3PM9A 3F41A 1M5SA 4LBHA 2YQ3A 2D3UA 1FWKA 1RHUB 2ZH9A 4NLGA 4L6V3 4E8UA 5F8LA 4RW7A 2CYYA 1UTAA 4UW2A 1RWVB 4C6AA 1K44A 3T1HF 4ZPWR 4X84A 1S1TB 3OR2B 3HHKA 2XS5A 2GA7A 1S6QB 1VYAA 2QMWA 5LMNJ 3AXKA 4MIWA 1IVZA 4O23A 2MGZA 4DF4A 4X62J 3QPIA 1FRJA 3PY8A 2W8LA 3TUPA 3FQKA 3WBZA 3PYFA 5B0DA 5I3PA 4NLPA 1HNZF 3CD0A 3I0SA 1S0NA 1OY9A 3CCSS 4QJVA 5IQ6A 2FZGB 2G2ZA 2HNZB 4ECRA 1WC6A 1WORA 1OMSA 1XN9A 4LIRA 3MMJA 4C7QA 1NRKA 3G9CA 3CE8A 1VBKA 1FXLA 5U47A 5HVFA 1N5YA 1B4SA 3RBEA 4ED5A 4LR7A 2OUGA 4X4NA 3V4IB 4LF6J 3TZZA 4ZPAA 2C2ZB 1N32F 1UZHA 2ABYA 5KFHA 1TVRA 1I94F 1TU0B 2I38A 3TO8A 3GCXP 3TJ9A 1SXLA 3SSRA 1WACA 2Z2LA 4UY85 2HK3A 2R8KA 1HNVB 3EXCX 2E5JA 2HAFA 2YWEA 3BGLA 2EG2A 2WSFC 3K5OA 4ZLNA 3CCLS 1KOHA 4HEA9 3JXOA 1YRXA 1HQUA 3THVA 4IG0A 5HK4A 4DV0F 3BDPA 3DU6A 4KHRA 3EVMA 2MHNA 1WF2A 1BXNA 3K2YA 5CHCB 2DHXA 3OL9A 1CULB 1RTIA 3Q24A 2NSCA 2XBPA 1JLAA 2NZCA 2KYXA 3PYDA 4KV8B 4GVBA 1UEUA 4HYKA 1IBKF 4JV2A 1T95A 1MN7A 2CQ0A 1ZYQA 4BWMA 4TN2A 2K7KA 3H5YA 3MCNA 2FJVA 5B09A 4NXMJ 2B7CB 2KT3A 4QCLA 4BLGA 5IWAJ 2AYGA 1RHKB 1XR5A 1IM6A 5K5MA 4R0EA 1D0EA 1HD1A 1BLUA 3BSOA 3HKZD 5C25B 2XZTB 4UOFA 2QG9B 4DR5F 1HKAA 2C22A 1QUVA 1PILA 1CJVB 1QLNA 4UOCA 1LW0B 3A1YG 3OTBA 5DQGA 1VQ6S 2E1RA 5ETPA 3SIPB 5E2QA 2F9JA 1YRUA 2B9YA 4K2JA 1WKLA 3DRXA 3H4BA 2KM8B 1S9EA 1FERA 3MPVA 1IXKA 4PR6A 1U1PA 3M9MB 1Q4RA 1HNWF 4CCHA 4RR5A 5CZVA 1VLOA 5E5NA 5KFRA 2DNYA 1XNRJ 1CG2A 3CCWA 1IKVB 2UUTA 1TL7A 2E9TA 2ASDA 3ENAA 5F0UA 2R7TA 4Q45A 1NM2A 2AZ1A 3EWGA 3OW2R 4I7FB 2KXHA 2MKYA 2Z8QA 4HI2A 2Y0SD 1N36F 3AJ1A 1IKYA 2FB0A 1YVFA 4OZ3A 2J8AA 4DSLA 1N33J 2ZZNA 3M32A 2MZ1A 1FE4A 2HZCA 1NZAA 2DR7A 3MM6B 5D6GA 3AQPA 5KT6A 3S7RA 4M5MA 4CO1A 3UI3A 3OTOJ 3DNCA 5LJ5Y 1BGXT 1OY6A 2GV1A 3HHNB 4OZ1A 2RDJA 1X5PA 2H1YA 3IWNC 3VVUA 3J7Z5 2HFOA 2IDLA 2VH7A 1FDAA 1NKCA 4K4VA 2IFXA 4QWCA 1RDRA 2ZITA 3BKUA 4QIFA 3CJRA 4N5SA 3M4XA 4WFAQ 3PVXA 2WBRA 1MMLA 2YWWA 2FGCA 3BH6B 2HVZA 4ED0A 4EMDA 3MCOA 2UXBF 2XLJA 3CW2C 3THTA 4IG3A 4RW4B 1S49A 3ZTRA 5M2UA 4X4TA 4FDFA 4I2QB 1VHIA 3TX0A 3KTQA 2ZHOA 3KG1A 2HK2A 2YKOA 2YWFA 2DNHA 3NNAA 4HACB 2APOA 2DH7A 4WZQA 3HHLC 2QIFA 2X1BA 3M8QA 4P75A 2FVSA 1JLFA 2JRSA 3TUZC 1PCAA 5HI7A 2PA3A 1D09B 4CO3A 4KTQA 1GTHA 5KG5A 1NXIA 3QWUA 2J6TA 4MIBA 4USKA 3TNVA 4DPYA 3Q8SB 3W63A 3ILLA 5BJRA 2CQ1A 3PX6A 2YPYA 4KC5A 2MY8A 4ZITA 3HT0A 2AEFA 4HTJA 3TVZA 2ZH2A 2OMOA 1SUQA 4X4UA 2WVFA 4DR6J 5MLCV 1ZZFA 4A8OA 1FJGF 4O3RA 1N5VA 1OY8A 3B4MA 3PYEA 1NH8A 4OYWA 3MM5A 3LAKA 3HMJG 4RUBA 4ZDNA 1SJ3P 3AA8A 1N8RT 2RKIA 3JYTA 2MLXA 1T94A 3IWLA 5ETKA 2CZ4A 5AT1B 2HHXA 2NXNA 3GFZA 3RR8A 2HQFA 3OXFA 2DPJA 3V5RA 1TKTA 3IM9A 1KQFB 3TAPA 4KBIA 4O44B 1URRA 4YHHF 1SL1A 1T05A 4NLWA 2GO9A 2V5HG 3BGRA 1EKSA 4ZLJA 4M5NA 1SH3A 5CAAA 2G0JA 3JQJA 3EGVA 4ER8A 5B7WA 4F2RA 5KFKA 1FT8A 5F9LA 2BE2B 1S1UB 2QLBB 2FC8A 2RSQA 2H3EB 4IDKA 2Z4PA 2QSWA 1FEEA 3ITHB 2NYIA 1TL1A 2XEXA 2AYBA 4C3KA 4ICLB 3ENVA 4JV0A 4OX8A 5K8OA 3LGHA 1PO6A 1WC1A 2L9NA 2UUCF 3Q8VA 2BW2A 3DOKA 4AUKA 4LF2A 5LL6d 1SBRA 1XK8A 3FBCA 4F8RA 1GT8A 5T14A 4IFYA 2K1RA 1JIHA 3CDBA 1K1QA 2M4MA 2I0XA 2U1AA 4PQUA 3F0NA 3R5DA 2MJNA 1YJRA 5B0EA 2DB1A 4M5JA 2GGPA 1BQXA 2FPHX 4ITSA 4NMXA 4OZ0A 4NCGB 1U1NA 4C2MA 1VQ7S 5RUBA 4JI5J 1LW2B 1T9WA 3QFWA 4IH5A 1C0TB 2VPZB 1WNEA 4LVNP 5IXUA 3MAHA 5KFWA 2IM2A 2OLWA 3KJVA 2LDIA 3N6NA 1VOMA 4MK9A 1R6VA 5IT0A 1SL2A 2C28A 1BWVA 3FKBA 5CYJA 1FO1A 2QN6B 2OPPB 4OI4A 1RYRA 3VAKA 4X2BA 4A8MP 1EJ7L 4FVMA 2LVWA 2LA6A 3PFEA 2AGPA 4OZ2A 1HBNA 1MMNA 3ZZRA 1RAIB 2VA2A 3MR3A 3A4TA 1UA0A 3M8SA 4USMA 4UF4A 2GMHA 2OSRA 4EU0A 3NAHA 4ZVRB 2CXEA 1VC0A 2B56A 4ED6A 3PACA 4WU2A 4I6AA 5HMYA 2DHAA 1XBWA 1WC5A 4B3SJ 3PXGa 4C3LA 2BRKA 4HDHA 2HAIA 1NDLA 2LA4A 4JI1J 4TKTA 5F41A 3RBXA 4GKJJ 4UY8T 1RSCA 1N34J 3OTDA 1BY9A 2V8VA 1QDUB 4RUHA 5LXYA 3BR8A 4LF9J 3J7YI 3UR0A 3AD7C 3M2RB 4NASA 3P3DA 4Y28C 3TZWA 1FJEB 1WEYA 3WIVA 1H2TZ 2XULA 2ZE2A 3BKTA 3I9V9 1U45A 1RK8A 2LU1A 1XR6A 5GMKa 1WUUA 3CJKA 2NLWA 4K7QA 4OI3A 5FLXU 3LQVA 4UOHA 4L3NA 1HNXJ 3JQMA 1ZAXA 4ECSA 4USIA 1YQHA 3TW0A 2HIYA 1Y0HA 5F8GA 1CS4B 3EVOA 3KLIB 4WIQA 2HBRB 2A18A 4DR1J 2ZNYA 3NGTA 3KNGA 3PO5A 3H5XA 2JFKA 1HMVA 3A12A 5DQHA 1VDHA 1NHUA 4F02A 3VHQA 2OP5A 2HBQB 4B9LA 3FEXB 5F8IA 3G8SA 4ZHRA 1QY7A 3GJRB 2FJXA 4P2MA 4C3MA 3DMJA 2MLZA 3KK3A 4NLQA 2R7XA 4TY8B 4CLTA 4F26A 4IQXA 5J2PB 3FSIA 4O0IA 1HWLA 5DO2A 3H2LA 2JLFA 2GIRA 4NEYA 5LSOA 3IM8A 5IQQA 3IR7B 3ZC4A 3J7YU 2RS8A 1REVB 5GADI 4ZIVA 4N56A 3QJLA 1UVNA 2CQGA 1DQ8A 2DIUA 2JLGA 5ETLA 4KGZB 3DGPA 2KN4A 4YR0A 3EMTA 2GS8A 1HWIA 3CJ2A 4RO0A 3R97A 3KHRA 2YWHA 2RQ4A 2CPZA 3TARA 5AJ3J 2HFUA 1B70B 3OVBA 4JI7F 1XMQF 2J8SA 2Q66A 1UEVA 1XNQF 3GJQB 3IGVA 3HHLD 2CA9A 2NPFA 2DCLA 3D3CJ 2HEKA 4CLZA 5DDPC 2RE1A 2W9BB 4PYDA 2BANA 1LK7A 4IFVB 2MSSA 1YK9A 4C9DA 1RHQB 4OYBA 1NB7A 1FRIA 4C8OA 3KLVA 3T5LA 4RUAA 2W7OA 2NZ4A 2HVIA 3CGIA 2HQGA 1WC0A 5L1IA 3T1HJ 2YNFB 3A3OB 1FK9B 2FHJD 2C42A 3L9ZA 3DYAB 4UT4A 1BQNB 1BHNA 1S1XA 4NZ0A 4CWBA 3J7ZT 3IP0A 3RB3A 2JEGA 1S9GB 2UU9F 4YP3A 1PAUB 1QD1A 2X51A 4EYHB 4D3GA 3EZUA 2RAQA 2XS7A 3QRRA 1NK4A 2VBXA 5GADU 1VRTA 1HNZJ 4ETXA 3AY0A 5HJYA 1WKKA 4J9NA 2NQPA 5CYQB 1KD1T 2E1PA 4PKDB 2L3MA 4GC6A 1M5HA 3QMQA 4KT0C 5L38A 3AHPA 2P2CB 1F6TA 5GVQA 4QWDA 1HI8A 1DURA 5HO4A 3DLKB 4N77A 4LF8F 4Z7YA 2KO1A 3G4SS 4P52A 2LYVA 2KZZA 3FZ2A 1N32J 2MQ8A 2CDQA 1I94J 1RTHA 1K0VA 1Z4UA 5KFOA 3ILOA 5KFBA 4QR2A 2QT7A 1KDNA 5FDLB 3G87A 4CLFA 1U1OA 3OLAA 3UDVA 2XMKA 3LOUA 4RZRA 1W25A 1RAAB 2H51B 2YNGA 2OFGX 2M9KA 2A3JA 3G82B 1V6HA 2LXIA 4WP8A 4P74A 3P4UB 5SUHA 1UL3A 3IS9A 1JJ2R 2IC3A 2B6AB 2FGOA 3BEGB 3M8QB 4J37A 4NXNF 3VGSA 3PW2A 1V3ZA 4M5DA 4DV0J 4RPFA 3DC2A 2F40A 3DLGA 3M7VA 2HKEA 2R2SA 2EK6A 1EETB 3ISNC 4FKYA 5H9FK 3GYGA 4DI6A 2HHSA 3JAMY 2LFVA 3DOMA 5KFGA 3GIRA 1ZETA 4KE5A 2H4YB 3MAAA 2D9PA 3KJFB 1IBKJ 1RT2B 3M6WA 2G9OA 3CCJS 3MF5A 4PG5A 1RBLA 5E33A 4K5RA 5E41A 4DQRA 1DQAA 2F4FA 4QZVB 2V8DA 5AXKA 4ECYA 2W2NP 3NNHA 1EP4A 4QPTA 4MKYA 2DO0A 3KWMA 2QA4S 1RWOB 4AD6A 4J9QA 3OXGA 3RB0A 4WP9A 3VGTA 1HD0A 3DLEB 2RKIB 3CO9A 1ZA1B 2HS3A 1HNIB 2F8MA 4DR5J 1HPZB 3OVSA 2D3OR 5C2GA 2KYZA 5ITHA 2HIQA 4DX8H 5DJBA 5J2QB 2VICA 5KT2A 3FJ2A 3EM1A 2QLJB 3RGIA 2OI2A 3CWJA 2BDPA 1ZPVA 4EZ9A 2R7OA 2PMWA 3HSDA 3H40A 4GC7A 1HBOA 4WFZA 2JVOA 2PSZA 2YXLA 2U2FA 1HNWJ 2AW0A 3MM7A 2OD4A 1YWXA 2ZHBA 1HQEA 2V8GA 3QRQA 1GFWB 3TVKA 3MEGB 4Q8FA 4UQGA 4Y2KA 1ZA2B 5HBMA 1NK9A 1Q81T 1X7VA 4PEOA 3M6VA 4ZN1A 1Q53A 2BRLA 3CCUS 4DS5A 3WC0A 3OXLA 4XIUA 4DWIA 2VUGA 1LWEA 3U7JA 3BSAA 2ZH4A 5HJXA 3FRYA 3SBMA 2QLXA 3H8YA 2V4JA 5A8RA 4LFCF 1N36J 4RWXA 1MROA 2WONB 4DMZA 4DJBA 3NXZA 4NYOA 4DQIA 1H98A 4X66F 5EUHA 3OL6A 2CADA 3K89A 2ZKUA 1UJ4A 4OIXA 2UUBF 2QTWA 2EFNA 1R8BA 2CWKA 3M8RA 2IJFA 1J5OA 5HLFB 1KQKA 3D1HA 2VFVA 2HNDB 2OSQA 4A8WA 3DOLB 1Q8LA 4WZMA 2LLZA 1I6JA 2UXBJ 4I67A 1ZAVA 4BHQA 2WZ1A 1VR6A 4F4AA 4MKVA 2XGQA 3NMAA 3CXCR 3OR1B 1KQGB 4B3OA 2JLEA 1OPIA 3F44A 3O5TB 4Q0BA 3C66A 2RNEA 3BGUA 3QT5A 3ENWA 4TLQA 2K2PA 1SKSA 2DNOA 2FUG9 2EC2A 3K5PA 1DZ5A 5AE2A 5A8KB 3T6JA 1CJUA 2VF3A 4RW6A 5FIIA 3K5LA 3IRXA 2EBGA 1X0FA 5IM0A 3EDQB 1PYSB 4CO0A 2G2YA 2R2TA 4Y0FA 1SQFA 2AX0A 5C42B 4ZP9A 2D69A 4ZP6A 4I1TA 4FN5A 3DRSA 1VRUA 2QFIA 2DGUA 5JUMA 1YZ7A 4ECZA 3MOJB 1IR1A 4DUYF 3KUGA 1YBAA 2XI2A 3W1YC 1FJGJ 4YY3F 2XSFA 3GR0A 2PE8A 1A7GE 5D3GA 3OLBA 1H3DA 5F9NA 3T5HA 1KOOA 2VHGA 4ECTA 3E8OA 2B5JB 4LRCA 4RBUA 2BBEA 3GV5B 4F4KA 1XMBA 1TL3B 1B3TA 1S5ZA 1BQMB 3SFUA 2JWNA 5LMUF 4NCAA 3DRRA 3P96A 3G8QA 3E2EA 1S6PA 3KFWX 2O3DA 2EKYA 3IG1A 2MKHA 2VOOA 4M5KA 4YHHJ 4KO0A 3HSJA 1JJCB 5IOLA 3KK1A 1R43A 5D77A 3ZZTA 2IY5B 7FD1A 5LT5A 1A6LA 1UFLA 2BM1A 4IO9Q 2FDNA 3HHEA 3LP0B 2IJRA 4NMLA 2G1HA 2Y1JA 2F8HA 4DU7A 1IKWB 2VG6A 3BBFA 3S6EA 2D74B 2YBVA 1V9OA 4JI4F 3UN2A 2GZOA 3MFHA 1T11A 2UUCJ 3KUEA 2RB7A 5F0WA 1VGYA 3MEKA 1PJ5A 2N7CA 4WFBQ 1LWFA 3C16A 5EDWA 2ZUGA 2E1AA 3U1MA 4N7TA 3V6HA 3Q83A 1WEXA 3PZPA 3NS5A 2ASYA 1X60A 2XB2D 4TYAA 3N5BA 4LR8A 3SSSA 1C1CA 1UFWA 4F2SA 2YH1A 3UN3A 2C3YA 1WDDA 5K8MA 4OLPA 3IFEA 1S7HA 2DXFA 3HLUA 2OGUA 4M1KA 4K4ZA 4O4RA 1T8EA 2B9WA 3AAWB 2ZWPA 2DY1A 3BYPA 1U0HA 1NH7A 1NZ8A 3H98A 5A76A 1X5TA 5L39A 4A48A 5ADZA 4DN9A 2XMMA 5K14A 4TU7A 4L73A 1NJXA 3D0GE 2F65A 3DGPB 5G0RA 1SV5A 2MKKA 3M30B 3NAIA 3A8IA 1WOSA 1L3KA 4K5SA 3TA2A 4YB5A 3I0RB 2N82B 3BV8A 5JJBA 5KFXA 2CUYA 3R5JB 3M2VA 4ZK7M 2V94A 3W7BA 3L09A 2D9OA 4FYYB 1OWXA 4ILRA 1K73T 3NWGA 3I5BA 4LF5F 4KSEB 1CQMA 4AL6A 2BE9B 1DJ0A 2FVRA 2DRBA 3GZ7A 3N6LA 2LEPA 2ATLA 2V4QA 2B4UA 2DNPA 1JK9B 1NAQA 1OSCA 3JSMB 3UVJB 2KI2A 2AKWB 1WHYA 2GAHC 3T3FA 5B0BA 1SC4B 3POTA 5KG7A 2UV8G 3KNAA 4DX6A 3MMCA 4QYZJ 3NBPB 2Q3PA 3VAMA 1UAWA 1FWLA 2YNHA 1IR0A 4QWAA 4KKOA 4I4BA 2LDYA 4IO1A 5K9FA 4JOUA 2QLFB 3LGNA 4V1Ak 2ZC3A 3SCJE 3SQGB 1M1HA 4LRAA 1FTCA 1RT7A 1T9VA 3JAMU 2BJEA 5LXRA 1JLQB 2Z56B 3MTJA 4MKBA 3OUYB 1NJIT 3M1VB 4F67A 1FKPB 2XY7A 2WSCC 4RLEA 3MD1A 3JB9k 4WTOB 2KH9A 1E6YB 4GO5X 4QU6A 1FX4A 1RP5A 1WOOA 3HHDA 3VGUA 4USVA 1TKXB 4EO6A 1QAIA 2F3JA 2NPIA 1ZPWX 3UD5A 4LQ9A 1HHTP 3DU5A 4FYDA 4B9VA 4URSA 4ELVA 1ZM9A 4G6VB 4B9NA 1NK8A 1YZ6A 1W26A 1FTRA 2HFZA 2ILZA 3KHGA 2CQHA 2MKJA 5C24A 4PWDA 4LUBA 2BMBA 2CIMA 3R7BB 4IRKA 4B9MA 3D5MA 1FJ7A 1I51B 3I6PA 3DLGB 3W65A 8ATCB 4ATNA 1LWCA 4OZLA 3GQCA 3L7OA 1S1WA 5D0GA 4WE1B 4MFBA 3GPAA 4NZ7A 1YITS 1LQ9A 2IMWP 4U96A 3OVAA 2AEJA 1WDTA 1BD6A 5KFYA 2KHDA 4JYAF 1SJFA 3CB4A 4DUZF 3TEGA 1J2VA 1NSKL 3OL7A 4R5PA 3FEYB 5HVGA 5DDQC 3PJWA 5D0EA 4CO5A 2JL9A 3I5CA 1NPRA 1FFSB 2PD1A 1EKRA 2QSFA 4M5HA 3RAXA 2W7AA 2OMLA 2VG5B 4LQ3A 5K20B 2PFFB 2FJAB 1YJNS 1UEKA 1R3NA 2VU5A 1JLGA 4JI7J 1XMQJ 4Z7CA 3BM7A 3Q86A 2VJUA 1XNQJ 1IJFB 2AV5A 4K4YA 2POKA 3K17A 5L9NA 2VONA 4GKKF 3Q22A 1S4FA 2HPUA 5CCMA 3SXLA 1C4AA 1OYDA 4A46A 4M95A 3OL8A 4ZVSB 4Y65A 3KXDA 1QSLA 2ZH6A 2BEFA 3Q8RB 1TAUA 4DV7F 2BR0A 2FLNA 1IQZA 3DN9A 2AMCB 1NSPA 5KFSA 2C2RA 1R7IA 3OQ2A 1V3SA 1N56A 1DBDA 2GMLA 4KFBB 3V6KA 2XMUA 2L08A 1UVKA 2C2EA 3GTYX 1L5UA 2B4PA 3HSZA 4H4MB 2UU9J 4ZCKA 3SFGA 3K59A 3TEHB 4F4WA 4KGXB 1RWMB 3G8TA 2VFSA 4MIAA 3UD4P 5GAGI 2BKNA 3CC4S 1WC4A 2D3O1 3G6YA 2PT0A 4JBCA 4FYXB 1VQNS 1NNDA 3ADAC 1GH8A 4ECXA 1IBLF 3FUYA 4AE5A 1Y3KA 3CTRA 3PIPQ 2CPDA 2E7VA 4LF8J 3PEHA 4DSKA 2ZZTA 3I4PA 2DK2A 4HHUA 2FJWA 3TI0A 3CCMS 4FF2A 3CF5Q 1RISA 4WK1A 4Y2IA 3ICLA 4ZOSA 2HQDA 1WOPA 4KHMA 5M2PA 2IBKA 2H65B 4I56A 4U6PA 2VB6A 4ZJLA 2RH3A 4E2FB 2OJ3A 4G3IA 3FFIA 4CRJA 1Y7PA 3A8KA 4WFYA 4LRBA 1SKRA 1C0UB 2WAQD 2W24A 3AODA 4Y00A 3PKYA 4ZMMA 5B0GA 2QA4G 3CJ5A 4CDIA 3CJ4A 3HVWA 1YJTA 5CH7B 3EUNA 4NXNJ 2KB2A 1PYTA 3RYLA 2IM3A 2ZBIA 3QAEA 2WOMB 1R8CA 2DCUB 4DSFA 3D28A 3QT6A 2C2MB 4J9VA 3H25A 5GAGU 2OAUA 2V9WA 1E6VA 4K8RA 3CJQA 3CC2S 3K58A 3I56S 4QW8A 2QZ8A 3ZNUA 2GVDA 3P5TL 4HVZA 3GSDA 4DL4A 3ZZPA 4DR2F 3LANA 4DR7F 4LMZA 2IRXA 4DPOA 1HHSA 1CJTA 1X31C 4QWEA 2P9EA 2YY3A 3V4MA 2Q1LA 2AYMA 3PEJA 2GQ2A 2QL7B 4R0JA 4ZKAA 1KTVA 2ATCB 2E7WA 2OPQA 3MM8A 5DM6Q 3ZZUA 2WB4A 1X9MA 2DH8A 3FCWA 3JTPA 2PI5A 4CQ1A 3DDKA 4J91A 3MMAB 5KG6A 2XHWA 2J7KA 1X4DA 3TRGA 2VKRA 5J1EA 1FE0A 5A8WA 4CZCA 3CDWA 2FHJA 1HBMA 1HWUA 2M2BA 3IN5A 2MQPA 1WG1A 1VBXA 2BOAA 3EXYA 5T41A 4FXDA 4CYUB 1C2PA 3EE3A 1MNEA 2DR9A 2KVIA 3C15B 3PRBA 2EFQA 3KHLA 1JJ4A 4TYBA 5DDOC 2OPSA 4JV1A 1JLBB 4PG6A 2ZD1A 2FY1A 3ZTSA 2HURA 3HVTA 2HRTA 3I32A 1HFEL 4LFCJ 3QO9A 4QR1A 4KH0B 1IQTA 2UZAA 2N3OA 3AFGA 3KLHB 4F04B 4ED1A 5HMXA 1M1KT 2W25A 3V81B 3IRWP 1RYSA 1LKZA 2R2UA 3GU0A 2WVDA 5KG4A 2PO4A 4TQRA 2N7YA 1NJYA 3T1AA 1KC8T 4X66J 1SKWA 1TUWA 4C8LA 4USUA 1X4HA 3IBCB 3HFVA 3H0PA 1K47A 5EHHA 1Q79A 3K57A 2UUBJ 3RAMA 1Q7LB 2CQDA 2GC8A 1YG0A 4WXOA 4JI8F 1YJ7A 1UCNA 1B0PA 4OX9F 4YDDB 3W2WB 2DGSA 3HI9A 2B4OA 4XAKA 3MUMP 2WCXA 3OT9A 3GG0A 1DRZA 3UNGC 2YKMA 4R25A 2DISA 1S77D 1SQEA 5L9XA 5DLGA 2X3DA 4IR1A 2W01A 3VALA 1P6TA 1TFWA 2N3LA 1NSAA 2RF2A 4J90A 4RW8A 5DRKA 1UETA 2DRAA 4F36A 3VZHA 3OPKA 4ZLPA 2MMYA 3J80Y 2HNYB 3CVKA 1T03B 3KLEB 4ID5A 4TLRA 1RA6A 4DV5F 2E1MC 2W4CA 3CCQS 5KFZA 4WFNQ 3W61A 3NG8A 3MEDA 4QYRA 2CPIA 3CMQA 2V8HA 3T19A 4YN3B 1S12A 2HHTA 4DUYJ 2E29A 3W2VA 4YY3J 1DAXA 2W8KA 2V2VA 1PKUA 1G7CB 2DNMA 1NJZA 1O51A 2H4WB 4DN0A 2JHEA 1RT3B 2QE5A 3BBCA 3J7AN 3CC7S 2J5AA 2AEMA 5FJ4A 2I1RA 2GX8A 3DI6B 1TL5A 2P5VA 2H5IB 3C46A 2XWYA 2VG7A 3EPGA 2XWXA 3TZXA 1AUDA 3QWPA 4DFMA 2AWZA 2BJ3A 5LMUJ 3BDEA 4WK3A 1FD2A 1N0UA 3VAJA 3VGVA 1ICEB 1NU4A 3GG1A 3ETOA 3BF4A 4FXVA 3HD1A 1QAXA 2R7QA 3ISZA 1JLEA 4JV5F 1NK7A 5I42A 2DHHA 3HD2A 3LP2B 2KT2A 1M1GA 2CPYA 2GQCA 1KVKA 1YBTA 4C11A 3D6FB 3V6JA 4OQJA 3KYLA 3C3LA 5DGBA 1XR7A 4JI4J 3Q0AA 1RT4A 1U7LA 1UWBA 2GVZB 2YX7A 3DXBA 2W9CB 1FX2A 1DTTA 1VIOA 1KFSA 2XYPB 4EYIB 4F25A 1U47A 4OJGA 4PZVA 4KHPF 4BS2A 1MG7A 3A3PB 2GHVC 2HBYB 4FPIA 4ED2A 3GP9A 4O3NA 4JP8A 4WPAA 2CNOB 1S76D 2R9LA 5J2NA 2VODA 4RW9A 2UVRA 2KTQA 5C5JA 1O5JA 3SEOA 1P27B 3U1LA 5D4OA 3R2CJ 3GIMA 1F2HA 2OPRA 3DKDA 1FKOB 2DBBA 3Q8YA 2FHOB 3ZZYA 3CJ3A 1Q5YA 4LREA 2X7IA 4LR9A 3WDOA 2I2YA 4F3MA 3C6UB 4ZVUB 3QGHA 1S97A 1QTNB 2CJQA 2ERRA 4EK2A 2IDEA 3KLGB 1M90T 1TK5A 5HP1B 4OI1A 1JX4A 1K0TA 2PEHA 1HYSB 1SC1B 4W90B 2KG0A 4LF5J 4NA1A 3CCVS 3FDSA 1I3OB 2D41A 3IR5B 4EBDA 1TFYA 1RT5B 2VC1A 3B8HA 3VV2B 3MMBA 2CQBA 3NGKA 2OEMA 2ZH1A 2BQRA 1RTDB 4K2XA 2R4FA 4K4UA 3K0JA 1WC3A 1KLMB 5LOQA 1VBZA 1ZAWA 2X3GA 3KOAA 4DL0C 4ES2A 1CVJA 2FY8A 4I2PB 2DHSA 3GJSB 4CIOA 2BKOA 3WX4A 2VPXB 4J9PA 3M8PB 2VC0A 2R8IA 3SV4A 4FF3A 1DLOB 1N48A 6FD1A 1WD6A 3K7RA 4EI2A 1IKXB 1HW8A 2R3VA 3I55S 4F7VA 1ZZNA 2XNRA 4OZJA 1TV6A 3N6MA 4EFAC 4TY9A 1X4AA 4FNIA 2FIUA 5HROB 2B43A 5KT5A 3RRKA 4KR0B 2KRRA 4JI0F 2A6MA 5A0YB 5DQIA 4PUOA 5A6WA 2UXDF 3IBFB 3LP1B 1S1VA 2KG1A 5DG7A 3JS9A 4M8LA 4DL2A 4OHYA 1VC5A 5GAHI 2PN6A 3TX8A 3PHEA 1D8YA 1Y00A 1JLCB 3L95X 4LSLB 1EIYB 3QIPA 8AT1B 1JKHB 4ZVGA 2L9WA 1QUPA 3BPDA 1CSJA 9ATCB 1Z1ZA 3FBFA 4LF7F 4ZLLA 3C14A 1UA1A 4F50A 1O8BA 2HQIA 2MY7A 3KK2A 3M05A 5KFJA 3N79A 4J5OA 2ROGA 2HGNA 4ZPBA 2CQ2A 4J9OA 3KLFA 4MYUA 2VPYB 1IN0A 2YNIA 2X1AA 1X4EA 4QOTA 2OKQA 4F3QA 1Y5IB 5K8NA 2HG4A 1H6KX 2FHKA 2XTJP 4IRDA 2PIIA 1MW7A 4JYAJ 1AZSB 4DUZJ 2RMLA 3N28A 3NMRA 4OZ5A 4USHA 4NX9A 2F7VA 4JI3F 1NUEA 2VFTA 2FJDB 2GVDB 2IAJA 3PRVA 2P8IA 4ZP8A 2HMIA 2HRYA 1APSA 4JI2F 2F5GA 3T6BA 4ANCA 3PX0A 2CG8A 4LSNA 1RTJB 1TKZA 1C1BA 3ET6B 1Y3JA 5GAHU 2EKNA 4DX5A 2PI4A 2CQ3A 2LQ8A 2YKNB 4YUDA 4MH8A 3SDEB 4M5IA 2L41A 4IUFA 3HHLB 3MR7A 2CPEA 2I8EA 1HBUA 3HJFA 3DRPA 4NYZA 4X64F 1TK0A 4KY3A 3M2UB 1LV5A 2XYHB 3C6TA 4ZPTR 4WIIA 4GKKJ 1RU1A 3JQKA 4KGKA 4RKUC 4C8KA 1MU2A 3FMBA 4DPTA 3ZO7A 5I3UA 3QT7A 3QYYA 1RHMB 4DV7J 2HQCA 3KUHA 3N01A 3QBCA 2LEAA 5J2MA 2H5JB 1RHJB 5HANA 3MDFA 5H9EJ 3E01B 2DNNA 3R5GA 3H90A 3MECA 4NA3A 4J9UE 3MEEA 4TQSA 5ETRA 4KRWA 3LF0A 3OHBA 5ETQA 2FVPA 4H4OA 3IBWA 1T9XA 2RJZA 5CYMB 4ECVA 5KT7A 3ZZ0A 2LU2A 3RAQA 3V6DA 2YWGA 4K4TA 3J80U 1AUSL 2J9DA 2WW4A 3IA0A 4NI2B 1ULRA 1X4FA 2XMWA 2B7BB 4NWBA 1HWJA 3TAMA 2M3DA 3OFEA 2F8EX 4W4MA 4OI2A 5H9FJ 1IBLJ 3OV7A 2RU3A 1RE1B 3R6LB 2YPZA 1F5CA 2GO8A 2ASJA 4DL3A 4DG1B 3GYNA 2ZWOA 1NJWA 1U1KA 2E9RX 1VRQC 3KJQB 3NGRA 1VLYA 4MMOA 4HT5A 3HPOA 3OSPA 1ZM3A 3CMAS 3A13A 2Y1LB 2YKAA 1CC8A 1B7FA 2HBZB 7AT1B 3JSYA 4DEZA 4DFKA 3RB6A 4CTAB 4R8UB 1Q8IA 1S1TA 3W66A 2MYFA 1CJKB 3OR2A 1S6QA 1W2IA 3X3UA 4CH0S 4P71A 4F0KA 1WWHA 1PC4A 3M9OB 2FVQA 4NRTA 3IGNA 5AXLA 3MOZA 1FRKA 1R0AB 3PTWA 3A3NB 1MLAA 4U9RA 1S59A 3OFFA 1U1RA 5BXIA 1U8WA 5ETNA 2CJAA 2W2QP 5D4PA 2XNQA 4DR2J 3HO1A 2FQQB 1IBCB 4DR7J 2OEKA 4G1QB 3B54A 1N6QB 5KT3A 2RHQB 3ILIA 4MT1A 2I5JB 3V4IA 4LFBF 4PRFA 3UD3P 5C2CA 2MZQA 1VQMS 4HR2A 1GXLA 3LPYA 2DNLA 3MM9B 2B3TB 3KMQA 4HHJA 1CPZA 1Q86T 2IBOA 2G2OA 2D7SA 1QM9A 4P2SA 4KQZA 5T7LB 1HNVA 4DOZA 3TJAA 4Z2XA 8RUCA 1SJ4P 3DM2B 3P5BP 1EX8A 1FFWB 3H5UA 3NKYA 2B0GA 2B8PA 2YKPA 5KG3A 2FTRA 3H20A 1B99A 4G65A 4ED4A 1K8AT 4IRCA 1WG5A 1G6BA 3QLHB 1DTQB 5HMZA 4P72A 4OYXA 1S72S 2M7SA 4F4YA 2LQBA 2CVIA 3VWSA 1CULA 3TQ1A 4YOEA 1RKIA 3R7SB 2P6SA 1IJEB 3FRZA 2KL8A 1N88A 2BQ3A 4ZS6A 6AT1B 3MR5A 3D66A 4KV8A 4FPRA 2J0WA 4ZVHA 2JEFA 1QVFR 1RT1B 4ZVOB 2QL5B 3FCHA 3S8SA 2AJ1A 4PXCA 4AYBD 1DY3A 5IT9Y 3HZEA 2EK1A 1RA7A 2CNNB 2O67A 3N9UC 2L9DA 3UCUP 4YB7A 4UOGA 1PIEA 3GWCA 2ZBCA 3FQLA 2XSJB 2MQNA 4ECQA 5C25A 2J76E 1RTZA 4IOBA 3ZZZA 2B51A 2KFZA 4CO2A 4ZVTB 2C2OB 4JI8J 2XZDB 1CJVA 3VF0B 4OX9J 1LW0A 1SCJB 2V9KA 4C8ZA 3LWMA 4B17A 2XG8A 2G0CA 5EGYA 4I68A 3TJ8A 1RI7A 2BJ9A 2PC6A 1JWWA 4P6QA 2MLYA 1TK8A 1UWAA 1RT6B 1GMVA 2RIJA 2DNGA 4PYAA 2Q6BA 1IKVA 1RCOB 2Z0GA 1HIYA 3A8EA 4PABA 3QAUA 1HR0F 3M6XA 3MZIA 2Z2ZA 2YQ1A 4HT7A 1SC6A 2FVCA 3S01A 3Q2TC 3QZ8A 4I7FA 1WF0A 4DV5J 4P2XA 1GEHA 4YDXA 2KHCA 1ZBTA 1XERA 4F4ZA 4CLUA 1F5AA 3SQOP 4ZCIA 3PW0A 3ZTQA 2XZWA 5DM7Q 2AIRB 1GK8A 3MM6A 5I4MA 2ZUAA 3W8PA 2M88A 2EBEA 3EZ5A 1L3TA 1KWMA 2KT5A 3MUVP 1ZTWA 2RDDA 2XO7A 2B8QA 2H5EA 2WB1D 4RW7B 3U27A 3KMSA 3TA0A 3B78A 1F3FA 2BOPA 2DNKA 1HL6A 4RBVA 1FJCA 2AF6A 4DPUA 5BYQA 3GV7B 4K4XA 3J81j 3JTNA 3LAMA 2MGZB 3RUBL 2W2OP 3UPFA 3RG6A 1HI1A 2A2DA 2AD9A 4DDFA 3E51A 1WG4A 3AD8C 4RUCA 2RD5C 4RW4A 4I2QA 1S1VB 2DR5A 5KG0A 4JV5J 4HACA 3I0SB 5E3RA 3CCTA 5B0AA 4DSEA 4W98A 4F4XA 2VBYA 2AGOA 1N0VC 4U7CA 2EG1A 4MKAA 1I1GA 3UCZP 3I82A 1AYEA 4JI6F 1N5YB 3OJUA 2V69A 2IA6A 4X4PA 5KFLA 2QMUB 5KFTA 1Y10A 4CLSA 1UFKA 1F9EB 3ILJA 2GHWA 5FD1A 2VASA 3SCIE 3UN5A 1TVRB 1NKEA 2R7RA 1ELOA 4KIAA 1U6BA 4IOAQ 4FS2A 4KHPJ 3J81Y 2MQOA 1N54B 5DG9A 4DV3F 3D4JA 5ETVA 3QRPA 2CJKA 2R7WA 1S57A 1MSWD 2WRMA 4B3TF 2Y9HA 2YH0A 3SCLE 4B9UA 5F3ZA 3BB5A 3AA9A 2MB0B 4DSJA 2FYXA 1RABB 2W2PP 3OTCA 3L3CA 4X4QA 1HQUB 4FKXA 5F3TA 4IG0B 3AQOA 1VQ4S 3FGVA 1P1LA 2VOPA 2O66A 4TVAB 3CD7A 4O44A 4YB1P 1WELA 1AROP 1RTIB 1JLAB 4I69A 2HLUA 5DS7A 2RRBA 3WC2A 1U2RA 4GVBB 2BE2A 1S1UA 3BR9A 4DCPB 2V67A 2BW7A 1NHVA 4DV2F 3HDSA 2GJ2A 1RBOB 3ITHA 4KAIA 1JMTA 2NUHA 1Q5VA 1P1TA 2DR6A 2DPIA 3W9JA 4OYAA 4DXLA 3TAQA 2BJ1A 4ICLA 2LXFA 4DQPA 2CJYB 4QYZK 2ZOGA 1VS3A 3BS9A 3LO3A 1XJWB 4FBUA 1SKUB 1HHQA 2Q6CA 4A8YA 2HHPA 1RLCL 5LSRA 2XMAA 2ILYA 1LNQA 2Y3YA 3IO1A 2VFRA 1GMUA 1VFJA 2BQUA 2EEYA 2AJFE 4Z37A 4PPDA 3T9NA 2YQ0A 2H48B 1S9EB 3HZGA 4NCGA 2YKQA 1J5EF 5DDRC 1LW2A 3CJ0A 2R8GA 3CULA 2ZOMA 1ZOTA 3KKFA 1C0TA 2HGMA 1TL7B 4ELTA 1DARA 1SPBP 4YR2A 4DFPA 1Q95G 2GMJA 1Y5NB 4JI0J 1VC6A 3GIIA 4ZCLA 4M5GA 2Z58B 1PJ6A 4ZJOA 2UXDJ 2HVHA 2MHEA 3O2IA 3FNNA 1SL0A 1IKYB 2K3KA 2OPPA 1RWUA 3M32B 3GILA 3M8YA 2CNLB 4OI6A 3R8YA 5C7PA 5H1SV 1X5OA 4D3HA 2IVYA 4E0DA 2UV8A 4F0HA 1RAFB 3KHHA 4NLUA 2QC3A 2I9SA 2ZBRA 1OIAA 4K59A 3RZAA 4PAAA 1H0HB 1CC7A 1IWAA 3D0HE 2K7JA 4LF7J 4P2FA 2B9EA 2E9ZA 4A8QA 1QAJA 2KKHA 2UP1A 4CNZA 2FLPA 3QSYB 2OFHX 4L72B 1Q0NA 2IMOA 3RBZA 1T3NA 2F4VF 1SC3B 4OHVA 3L7PA 4IG3B 4FBTA 5KFDA 3R1LA 1F60B 4CM0A 4M94A 4W92B 4A4JA 2JFDA 2M70A 2VQFF 4HH0A 4JI3J 1JLFB 3HXMA 2E1CA 1RWPB 2ZH8A 4AQYF 3MI7X 5BYRA 3MCMA 4JI2J 3SZ2A 3F73A 3M2RA 2HHVA 4CLKA 1LEOA 3PYGA 3DHXA 4ZVEA 4ENOA 1H74A 2LECA 2DD8S 2VBZA 1LXJA 3B6BA 2MTLA 5IT9U 1SUQB 2HFNA 2C1EB 4KH1B 4WCEQ 2QYGA 1U02A 2BABA 4DPWA 2ZZMA 2C3MA 4X64J 3MR2A 4DR4F 1IWGA 3PJXA 4DUTA 3MM5B 1SJQA 4KJIA 4FXWA 1CS4A 4O3SA 4WF9Q 2HYIB 4ES3A 2PFDA 3KLIA 3MAQA 1XEZA 1NDPA 4PQAA 3NEKA 4PWWA 4WU3A 5HSPA 3ONQA 3JYTB 5AXMA 1DHMA 5IC6B 2HS4A 4B9SA 5F8MA 2RUSA 2V63A 5KFMA 4Q5VA 2DGQA 1M5VC 1TKTB 1WI6A 2GJFA 1WI8A 3P45B 2GCFA 3OBIA 3GONA 1FDDA 4QWBA 4TY8A 2ZH7A 2KU7A 2NXJA 1T05B 1GAOA 1FVQA 5E3CA 5J2PA 3BGRB 4Q43A 2KJVA 2J6UA 1REVA 5BR8F 3EGZA 4OJ3A 3UCGA 3FBEA 2Z30B 1Q8BA 4IDKB 3R5BA 2J0QD 3BSCA 1HARA 3PO4A 3GIKA 1TL1B 2CZVC 3T41A 1PAEX 1UZDA 4WYLA 5SZTA 5D0HA 5FLXY 3MR6A 2CWXA 1AFIA 4ANEA 3DOKB 1UJ5A 5ETMA 2ZM6F 4IFYB 2K1RB 1X0PA 4ZVFA 3QATA 3HK2A 1YIJS 5A2QY 2VD3A 3W62A 5HL7Q 4PQUB 2W9BA 1RZMA 3WIUA 3LALA 2WBMA 2GIQA 4IFVA 4ED3A 2M0GB 1RU2A 1YJVA 2KFYA 2WTFA 3JTOA 3ZFVA 1C4CA 2GGPB 4A47A 1LFWA 1TP7A 5D4LA 1U25A 1OYEA 2JC0A 3UO0A 1D9FA 1M0SA 2YNFA 2DGTA 2PGCA 4M5LA 1FK9A 3DYAA 2ZJQQ 3R1HA 5HQ8A 1BQNA 5HMWA 1GNKA 3Q8QB 4EEYA 2FD2A 2XYGB 2HW3A 5CXTA 4OJ1A 3L4BC 3RTVA 1S9GA 5J1PA 2CFXA 2JDJA 3KJVB 1NDKA 4QQBA 3SV3A 1D9AA 2K8GA 2DY9A 1S6OA 3LA0A 1EARA 3UDEA 1KRPA 3AOBA 5CYQA 1U1LA 2E5HA 1RWXB 3GLJA 5B08A 4HDGA 4L74A 2LP4A 4OV6A 2VBWA 1TR0A 1HBNB 3R5AA 3B4DA 3BN4A 5HAOA 3UDLA 2DGOA 1FCAA 4YS2A 1P9YA 1BMQB 3DLKA 1Q1KA 1NDCA 4LFBJ 1OS5A 2C3OA 1DFDA 4P73A 3W5XA 4IH6A 1XMOF 1FF2A 3MCSA 2ZDOA 1UPPA 3J81U 1FKAF 3T9ZA 4NCBA 1EQ0A 4WXWA 1WHXA 5FDLA 4MJKA 4XPEA 3JSBA 3GE9A 1VQLS 4AXIA 3Q8UA 4GO7X 5E3QA 1VQOS 4LBPA 1NLKL 2GHPA 4CLLA 4UZCA 5KTQA 1NKBA 2VQEF 2AP6A 3HKWA 3DXSX 2UVWA 2OHDA 5GMDA 3G82A 2NXEA 2QYCA 2NUUG 2CG4A 2V2QA 2B6AA 3O1LA 1MN9A 4IQMA 3RJMB 5JXSA 3U1NA 2VA3A 3TYTA 3ZNJ1 2VKZG 1H72C 1R27B 2ZVIA 2H54B 4EWTA 4K50A 3TUJC 1EETA 4FP9A 2A2CA 4WYWA 5IV4A 1WF1A 2E5IA 2Z2MA 2NS1B 2ZE2B 3H2UB 4LVOP 1T9UA 3PCOB 2RT3A 1RT2A 3NLCA 4TXSA 3CJKB 2AJQA 3PX4A 1PG5B 3W9IA 3CCRS 3NRBA 2KM8C 3DLEA 1FRMA 2GW8A 1HNIA 1HMVB 1WEZA 1HPZA 2GIFA 3DFEA 2HGLA 1K1SA 1YJUA 4S0MA 5J2QA 5KG1A 1FA0A 3ENQA 1NSQA 4ZHRB 1UVLA 4KGMA 4AFFA 3MFIA 3CUNA 4UQTA 1WSRA 3DMJB 2FZCB 3KK3B 2PA8D 4DF8A 4USJC 3TZYA 4B08A 2J0XA 4C0HA 2DJWA 2DNQA 3HVRA 2XLIA 1N5SA 3O8WA 1KBRA 4NEZA 3PHTA 3MEGA 2JH3A 3LWLA 2ZJRQ 1NHKL 4H4KA 1KS2A 2HFSA 4MK7A 1HR0J 4DFJA 5EWGA 1EB0A 3HM9A 2EFVA 4KPYA 2FZKB 4K0KF 5CD4A 2ROEA 4U8VA 4PG7A 1H38A 4IH7A 2HHQA 5KFVA 2V0NA 2LCWA 9RUBA 2WONA 2UVUA 1AB8A 2RRAA 3UR3C 1NEEA 4HKQA 2UUAF 2EFOA 4YMEA 1PC5A 3CEDA 1FHTA 2BANB 4BC9A 5DG8A 3DHWC 1AFJA 1AXQA 4CT9A 3HVAA 1V5VA 2O5DA 4DCJB 3GCWP 5HLFA 3LW5C 2HNDA 3H7HB 4B3MF 3QIDA 1S1XB 4DV1F 3Q89A 1F1BB 5ETTA 1U4BA 3DOLA 4OJHA 1EAYC 4NYPA 1JXLA 2Y0BB 4NA2A 3OR1A 3EICA 3W9HA 3Q2SC 3H2VE 3CJSA 2PMZD 1IR2A 1VRTB 3QT8A 5EWEA 4XDCA 2JEIA 5A8KA 4TU8A 3JSRA 4O3OA 5E3PA 2R2RA 1KVIA 2WVCA 3Q8PB 1UVIA 3VTIA 4JI6J 2SXLA 3R2DJ 1YDLA 5C42A 3MPDA 4USWA 1F0XA 4X4VA 5A6PA 1VIXA 1SI9A 2QA1A 1U24A 3O6QA 3P49B 2BA9A 1UMJA 3PKMA 3W5YA 2JVRA 1FRLA 2QL9B 4OZNA 1RTHB 4LFAF 1J27A 1PBUA 3D2WA 5HATA 3US5A 1UKUA 1XIQA 2EPIA 2VJVA 5DGAA 3R5CA 3AXMA 1K9MT 4DV3J 1FNOA 5GAEI 2YNGB 2QGFB 3FC9A 4OMFG 4B3TJ 2BJ8A 3C8YA 3PFOA 2LQJA 3IAM9 4CLPA 2B5JA 3IS9B 4DV6F 2OIHA 4AT1B 2IC3B 3MPWA 4ZP7A 1R89A 1RKJA 1TMJA 4P9SA 2JOQA 1CLFA 1TL3A 4DU8A 3NOGA 4Y6IA 4M5DB 4L76A 1BQMA 4NLSA 2ROPA 1GTEA 2OELA 4PXEA 4LF4F 2V68A 4B3RF 2V6AA 3ULHA 4X65F 2EC0A 1MWQA 3H5SA 3PG9A 1S0OA 2F9DA 3N5FA 3WQPA 1CQNA 3GFHA 4F0MA 4YQWA 1T7PA 4Q8EA 2XY5A 3DOMB 4OX6A 1GMWD 4Q7AA 3MAAB 4DV2J 3LP0A 4DHVA 1IKWA 2HSEB 2W9AA 2XI3A 1UP1A 1GXUA 2ZBQA 3BKFA 4DCOB 1EP4B 1HW9A 1FRXA 2XO6A 4YFUA 2VDIA 1FXDA 2DITA 3EPIA 1U8SA 5A2QU 2KXFA 2OO4A 3O44A 3GYXB 1RHRB 4A8KA 5L1JA 3SCKE 5GAEU 3ZTOA 2JNJA 4WKYA 4ECWA 3QGPA 4YR3A 4DZDA 1H7WA 1QVGR 1QSYA 2UXCF 4C0BA 3G6VA 4RNHA 3W8GA 1HBOB 4F3OA 3MM7B 5LM7E 5KG2A 2BUNA 1J5EJ 3I4HX 1HQEB 2AYEA 1U1QA 1KEKA 4TNOA 3HJVA 5M2RA 5L1LA 3MD3A 5HBMB 4U7UD 2CPXA 1RWKB 1SJ1A 1OO0B 1MWZA 1LXNA 5D8HB 4C8YA 3ZTPA 1LWEB 2AHOB 3M30A 3BREA 4E98A 1IBMF 5A8RB 2V4JB 2EWHA 3I0RA 1RAOA 1AW0A 4U7UK 1MROB 3CSKA 1RAGB 3IR6B 2EXUA 1U6FA 3FCVA 4G1PA 4DQSA 1UVJA 4MTPA 5D15A 4M63A 2BACA 3RW6A 2KJWA 1FNMA 3RBDA 1B7YB 1X9WA 4CH7A 1P9QC 4HI1A 3NCRA 3W60A 2I6WA 4GMKA 1J5OB 1TMMA 3JSMA 2ZH3A 3UVJA 3M9NB 4UUWA 3VQTA 3SYZA 2OEJA 4C0OC 3G6XA 1MWYA 1YLXA 2DHGA 3EX7B 1URNA 4ZN3A 3CCZA 4LF1A 2DEJA 4JUZA 2ZJPQ 1FESA 3KG4A 2ZNZA 2F4VJ 4QR0A 4BCAA 2R7VA 4ZPCA 3NBPA 2HHUA 3UW1A 1S7IA 3RW7A 3AH6A 1LK5A 4B3OB 3P6YC 4Q0BB 3AOAA 2H9ZA 2VQFJ 2V34A 5I3QA 2LXUA 2YX1A 3BJYA 1CJUB 4AQYJ 4PWUA 2MKIA 3EGWB 3SQGA 4RW6B 3PR4A 3IRXB 3GFYA 5IM0B 1QE1A 3HP6A 1JLQA 3OUYA 2RU9A 4DBQA 3M1VA 1FKPA 2B9XA 3SMZA 4ETZA 1R8AA 1QSSA 1E6YA 2HS0A 1TELA 4L75A 3DRSB 1VRUB 2R42A 5THWA 1U49A 3I87A 4RBTA 1X9SA 4ILLA 1TKXA 4DR4J 3K8VA 2DIVA 3J7A1 1KTQA 5D3GB 2CQPA 4CI0B 3HT3A 5H9EK 3NS6A 2E5LF 2LEBA 2XMVA 1Q78A 2IYIA 1TAQA 1FRHA 1KQSR 1XWLA 5E0OA 1RUSA 2MEWA 3SI8A 1S99A 1U6ZA 4I6YA 2DGXA 4B02A 3NGUA 3FSYA 3UNYA 2ACYA 3MGJA 1Q7YT 1U0SA 3CDEA 3TANA 4FF4A 1QJHA 3DRRB 4WE1A 1S6PB 4DV4F 3WZ0A 4EZ6A 1PYOB 3D67A 3C19A 4PXDA 3IG1B 4QPXA 4KO0B 2W1BA 3ELHA 3KK1B 1OPZA 4YB6A 1NK5A 1JNZB 3QGGA 3HFZB 1G2EA 2MKSA 1RGVA 2NXCA 2X1GA 5BR8J 2A10A 2AJ2A 1V3RA 2EFPA 3ZZOA 2QMXA 2VG6B 3PJ9A 2HFVA 3AT1B 3CIMA 4IR9A 3TVYA 1RB0A 1VI7A 3OHAA 1CBKA 2HRUA 3OFHA 4X4SA 2VG5A 5D4NA 5DZ7A 1VJQA 2MZTA 2R8HA 2QEXS 2ZM6J 2V2KA 1LWFB 2YVSA 3C16B 1L3VA 1U26A 3WHIA 2AU0A 3SSQA 1NPPA 1X4CA 4NL5A 1UPMB 3VAGA 4ZVQB 3X1LB 4QIEA 2XC9A 1Y4ZB 4N76A 4ZIWA 1C1CB 2DR8A 2NSBA 2ADBA 2RS2A 1L3SA 1YHQS 1S10A 1D3WA 2K06A 2JEJA 4XPCA 4Y3CA 4KFBA 2CJXB 3GFXA 1TUVA 1L3UA 4WKRA 3PW5A 1U0HB 2VL1A 2DO4A 4N47A 4J9RA 2NREA 2VFUA 3CO0P 2O01C 4H4MA 4ANDA 5HQMA 5K14B 1G1XA 3HF5A 3IMQJ 4WBFA 2PDAA 5J1NA 5G0RB 1SV5B 3TA1A 2MKCA 2RRNA 2L48A 3PNIA 4LBIA 3MURP 1JXEA 4CH1A 2GNKA 5AE3A 1IM4A 2BX6A 5LJ3Y 2Q43A 2CRLA 3M2VB 1SH2A 1G3OA 2FJBB 4Y2CA 1GX6A 1W2BR 4J9LA 4UZBA 1U09A 2G13A 1YJWS 4Y2AA 2QLWA 4OFZA 2MZSA 4HH1A 3D6MB 3AB2B 4LIWA 1XMOJ 1Q16B 1FI4A 5EX0A 1NPKA 3KJNB 2G1DA 1H2UX 1XQIA 5D0RA 2NR0A 2XGPA 1FFGB 2DKOB 3POTB 1A0OB 2W4PA 3QQCD 4IOCQ 3CNQP 4U8YA 3MMCB 3KG0A 2G4BA 2VQEJ 2YNHB 3CJ8A 2KDOA 1C0UA 4KKOB 2MZRA 1O6XA 4OI0A 1IUJA 1V5IB 3BQ0A 4AL5A 1XC9A 1WHVA 2MZJA 3GIJA 2WOMA 2HQ3A 1PSDA 1WTFA 2IM1A 2IRUA 1RT7B 1NMEB 2K3IA 4PXBA 5CQGA 1T3OA 3TOQA 3E3XA 5KFFA 2WSEC 3M6UA 1I5OB 3UWTA 3U02A 4FNHA 4FS1A 4RX6A 4ALZA 2GQQA 1PJ7A 1TTHB 2XMTA 4DPXA 2BVZA 4O3PA 4GRSA 4DR3F 1UVMA 2RHSB 3BO4A 1RLDA 1VQPS 3NWRA 1ZM4A 3CJTA 2Q79A 4CO4A 3GR1A 1GX5A 3AJDA 3G96A 1OJ4A 1D1UA 4H4KC 4PPZA 2HHHF 2OTLS 2DRDA 5C24B 4PWDB 1JXVA 3G2XA 1TZ0A 5IS2A 5KFUA 3MWBA 3IXQA 1F3VA 4ED8A 2BYCA 3MMAA 4J9SA 2DEIA 2WVEA 1LWCB 3G6ES 1S1WB 1NO8A 4O4GA 4MFBB 4UUXA 2CPHA 2HWIA 4DS4A 2IPOB 2CVEA 4NOHA 5KFIA 1FXRA 2QX0A 2MDAA 4CYUA 1M5KC 4J7CA 4ECUA 1XTZA 1GXTA 3C15A 4R5PB 4O0NA 1YKWA 2LMIA 1F2GA 3T5KA 2VZ9A 5L8RC 2IVFB 1RCXB 2AQ4A 2OTJS 4ILMA 3PV8A 4K0KJ 4NLTA 1X5SA 1JLBA 1BE4A 2C2KB 2P9GA 2QJ3A 2O1PA 2DH9A 4OX7A 2BV3A 4P7VA 3KLHA 4OV1A 3NS7B 2Z2YB 4USTA 3BH7B 3OD2A 1SIZA 5IFMA 3V81A 4C8NA 2V50A 2AJ4A 1TUGB 2IM0A 3T1YF 1JLGB 1RADB 1N52B 2HVDA 3I9ZA 4FF1A 1UW9A 4RL1A 2HWHA 2ZDPA 4EBEA 3R27A 1S6UA 3HX9A 2UUAJ 4HHHA 4CT8A 3DLBA 5KOXA 3NL0A 2NXUA 1RAHB 4FYVB 2DTJA 4O3QA 1WJ9A 2FC9A 1ZH5A 4RWWA 1VQYA 4B3MJ 1Y9OA 2UVVA 4DL6A 4Q2LA 5AXNA 4DV1J 5B0FA 3QFHA 3UFCX 3W2WA 5KOWA 2ASLA 1Q82T 3LTOA 2DGWA 5L1KA 2F63A 3QNWB 5HVHA 2MXYA 2CDRB 4A8SA 4HTIA 5F8HA 1VJWA 3IWXA 1DQ9A 3MPYA 3CT9A 1NK0A 2AZ3A 1VCTA 1WKJA 4ELUA 3FMWA 2Y1IA 1NCLA 4U67Q 1JJHA 2KRBA 2QRRA 3GMGA 1U1MA 3D3BJ 2HNYA 1T03A 4LRDA 3BPSP 3KLEA 1ITPA 4URGA 3EGNA 4RNNA 2XY6A 2DT9A 3W5ZA 2N4DA 1BWEA 4DLGA 3LGMA 3ISND 4RNOA 3K5NA 3PW7A 4V19X 2DXDA 2X1FA 4YEAA 4LFAJ 2DGVA 2HHWA 2OD6A 3D0IE 1FD8A 1LWXA 1VHFA 2IYGA 3CIZA 1EQMA 1RT3A 3FFIB 2KVQE 4ID8A 2XQCA 5KFNA 1QAYA 2VPWB 5L46A 3CDUA 4NLYA 4RU2A 2QV6A 3K5MA 2V4RA 3DI6A 4DV6J 4ZPDA 4I6WA 1B0TA 1YX2A 1RAJA 5LMNF 3B82A 4AXJA 4A8XA 4N8OA 4QIVA 5MAOA 5LSLA 1N4LA 3PDNA 2C2NA 3ZXWA 4LF4J 4X62F 4B3RJ 4FZVA 1QE1B 2WW8A 3EZOA 4X65J 5CZXA 4AL7A 2CAJA 1HI0P 3BGOP 2UUWA 1E6VB 3CMES 2JC1A 1YJ9S 3THPA 2CZ9A 3ETMA 3LP2A 1X8DA 5CCLA 1O0PA 1Q8KA 5HQLA 3NGDA 4C8MA 4RU9A 2BJ7A 3NGSA 2M52A 3IC1A 3NNCA 3LPEA 3PW4A 3H4DA 2J9EA 2PEBA 2ZFHA 1CJTB 3OSNA 1Y5LB 3DLJA 2AGQA 2ZVSA 4J9KA 2GVZA 4LF6F 1JQGA 3G86A 3EVWA 3DDNA 4WWSA 2W9CA 2XM3A 2MPUA 2E7XA 3CDAA 1RBAA 2OPQB 2R7UA 3MM8B 1RACB 4P7TA 4L3KA 2GFFA 1S9FA 4KGVB 2B4VA 3NCPA 2A1BA 3WX8A 1FVSA 3GB0A 1FEHA 3N0VA 5J1EB 5A8WB 2UXCJ 3FK4A 4XTTA 2KFNA 4LRFA 4I64A 1HBMB 5CABA 1FDNA 2FLLA 2EVZA 2Y1RI 2DNZA 5BYSA 4MAKA 4RNMA 2FJEB 1AT1B 2COLA 5ETOA 3VAIA 2CJBA 2VV5A 1R8PA 1RAEB 5EWFA 3RRHA 1FKOA 4U95A 2QFJA 5IC4B 1OQ6A 1X4BA 3CD6S 4IKAA 1UW4A 1PGZA 2OPSB 4I0WA 2ZD1B 1M5PC 3G71S 3C6UA 2ADCA 1KR4A 3HVTB 4XK8C 3NY0A 1IBMJ 3QO9B 2DVIA 1KONA 3KLGA 5HP1A 1RXOB 4KB7A 5KFPA 4LT6A 4XO0A 3DDIA 4WFXA 1HYSA 5HN0A 2EFGA 3HSGA 4NXMF 2HZAA 1LFPA 1RJJA 2CNKB 3S1TA 3R3TA 3UQSA 3D9BA 3CCES 5IWAF 4QBUA 4QU7A 3QGIA 1RT5A 3UDCA 4HL9A 1D8ZA 1S48A 1RTDA 1YGYA 4BWJA 4Q2MA 4N41A 4EBCA 1VQKS 4C4WA 2KZMA 1KLMA 3MUTP 4FVCA 3MHYA 2VIHA 3RB4A 3VZIA 4I2PA 1FWPA 3QJJA 3QJPA 1H2VZ 3M8PA 3BSNA 1VBYA 1DLOA 2YKMB 2Y8WA 3N4WA 1IKXA 3H42A 4C97A 1YBUA 4WTYA 1XNRF 3LUYA 3FBBA 3OTEA 1D9DA 1ACMB 5HROA 2RF2B 4RW8B 2IVMA 2YX4A 4URQU 4OLOA 2BM0A 1SQGA 4V19J 5A0YA 4ID5B 2LQ5A 4PG8A 5KFEA 3LP1A 4TU9A 4CLYA 1JNRB 4A8FA 2IA0A 1GMWA 3MEDB 5DZ6A 4ZJQA 1Y11A 3KDNA 1N33F 2HNZA 4ES1A 2Y8YA 3MTKA 3D54A 3DGVA 1VQ5S 1JLCA 3W2VB 1S0MA 4LSLA 1JKHA 2GJIA 2W2MP 3OTOF 2YWKA 3C2PA 2M8DB 3EDRB 5CA5A 4Y34A 4EO8A 4OYOA 2E5LJ 3V2UC 3W64A 2IHR1 4NLVA 3TQEA 2WVBA 4NLOA 4ZCMA 4QW9A 1N5QA 3OFGA 1KLNA 2VG7B 4MYTA 1FDBA 3OJSA 5KFAA 1R0BG 1HA1A 1KVJA 4RJVA 2IIHA 3P8BB 1B64A 3TUIC 1R6YA 1TL4A 5K8PA 5DETA 5E3AA 4DV4J 4OHWA 2EI5A 5IZHA 5EN1A 4XDDA 2MQLA 1Z2LA 1JLEB 1AZSA 2JX2A 4OYPA 2HZVA 1NBEB 5I42B 2RUGA 1U48A 3R6GB 2D1CA 1KNZA 2F1FA 1H7XA 4KYZA 4HLBA 3GV8B 1VK8A 3BBBA 4NE9C 4N8NA 4C11B 1RTJA 1SB6A 5AE1A 3R9LA 1PBAA 4FYWB 3ET6A 2QA2A 4X4RA 1RT4B 4ZA1A 2WK4A 3VCDA 1WTBA 1JB0C 1UWBB 2HWTA 2YKNA 4OYZA 2WHOA 3SDEA 2HVEA 5IV3A 1VQ8S 3QZ7A 4DR6F 3HHLA 1DTTB 1B0VA 2C3PA 1YSJA 4P10A 5F8NA 1R0CB 3M2UA 2DYAA 4BBYA 1KHWA 3BQ1A 1WHWA 1ZM2A 4G1IA 4O4GB 4QIGA 4BC7A 2W7PA 3BYRA 5JVGQ 1RWNB 2G0IA 3IAS9 2ALZA 4Q44A 2AX1A 3PR5B 2JJ4D 5J2NB 1Z2ZA 4CNYA 4RW9B 1WSVA 4EUVA 1NB2A 1ZS6A 1CEZA 4ERDA 2XCAA 1RQ0A 2RQKA 3CD5A 4EGLA 2OPRB 1T9TA 3E01A 3BO2A 3AD9C 2XLKA 2J9DE 4NLDA 4OHXA 3FSXA 1KSPA 2P9CA 2BE7D 5D78A 1VK3A 3KDOA 5CYMA 3UE2A 3VVTA 2ZEJA 4OYIA 2XHCA 2CJ9A 4ZVPB 4DL7A 3VQSA 4K4SA 1W7WA 3BGFA 4H54A 2BXJA 4NI2A 2J6SA 2IRYA 2MQMA 3TP2A 2MQQA 2RILA 1TQLA 3O3LA 4OL8A 2E44A 5DLFA 3K8WA 2M5YA 1T02A 2V2ZA 3EYZA 3MMBB 1AA1B 5JMNA 4PCQA 5G4DA 4DG1A 2J7WA 1SH0A 1GQEA 3DRYA 5KFCA 1S79A 5JVHQ 1SIWB 5E7OB 7FDRA 3R7NB 1P8GA 1VQ9S 2FHMA 1BUXA 3AJ2A 2E66A 1F9HA 2NYHA 1KHVA 2NCKL 2N4CA 3D1QA 3CPWR 1YI2S 3GJTB 4NLXA 4DLEA 4NZ6A 4CTAA 1A9NB 2CQ4A 4R8UA 1H73A 1YTYA 2D3ZA 4B9TA 4JI5F 3DLLQ 1CJKA 2BJDA 4CM2A 3W3SA 1ZTTA 3RR7A 1TV6B 1HWKA 2QO3A 2W4DA 2GAGC 2BZ2A 2XMJA 3MXHP 3HCXA 2E5GA 2HLTA 1R0AA 3EJMA 4PUOB 1VISA 4UTGA 4Y2MA 2A0FB 5CD4H 4NLRA 2ACMA 4K4WA 2P6TA 2M8HA 4J9MA 4NPOA 3HFKA 3BQ2A 2MSTA 2MJUA 2V8PA 3QIPB 3A8JA 4G1QA 4DR3J 2KXNB 1N6QA 3D6TB 5KAKA 2AT1B 5ETSA 5F8JA 2ZH5A 2I5JA 4X4OA 3FVYA 3D68A
chains in the Genus database with same CATH topology
2H48B 1GFWB 2HBYB 3QNWB 3GJQB 2CNKB 2QL9B 4ZVQB 2H65B 2QLBB 3D6MB 2CDRB 3R6GB 4DCJB 3GJTB 2CNOB 1RWWB 3SIPB 2H54B 1ICEB 2H4YB 4DCOB 1RWXB 2C2KB 2HBQB 2QL7B 3KJFB 3KJNB 4ZVTB 2C2OB 1SC3B 1PYOB 1RHQB 2XZDB 3GJRB 4ZVPB 3RJMB 2DKOB 3GJSB 4DCPB 5IC6B 1QDUB 3NS7B 1F9EB 2CJXB 1BMQB 1RHRB 3IBCB 2Y0BB 3D6HB 1RE1B 3R6LB 1RWMB 1RWOB 2XYHB 3EDRB 1RHUB 3D6FB 1SC4B 4ZVUB 5K20B 1RWPB 2H51B 3EDQB 1QTNB 2FQQB 2CJYB 3KJQB 3P45B 2C2ZB 1RHMB 3R7SB 2C2MB 1IBCB 5IC4B 1RWVB 3P4UB 2CNLB 1PAUB 2H4WB 2XYGB 2QLJB 1SC1B 1RHKB 2H5JB 3IBFB 4ZVOB 1RHJB 2QL5B 2Y1LB 2XYPB 1RWNB 3R7BB 1I3OB 1NMEB 2HBZB 2H5IB 2QLFB 4ZVRB 4ZVSB 1I51B 2C1EB 2XZTB 1RWKB 4LSZB 4JB8B 2HBRB 2P2CB 3R7NB 3R5JB 2CNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H48 B;  1GFW B;  2HBY B;  3QNW B;  3GJQ B;  2CNK B;  2QL9 B;  4ZVQ B;  2H65 B;  2QLB B;  3D6M B;  2CDR B;  3R6G B;  4DCJ B;  3GJT B;  2CNO B;  1RWW B;  3SIP B;  2H54 B;  1ICE B;  2H4Y B;  4DCO B;  1RWX B;  2C2K B;  2HBQ B;  2QL7 B;  3KJF B;  3KJN B;  4ZVT B;  2C2O B;  1SC3 B;  1PYO B;  1RHQ B;  2XZD B;  3GJR B;  4ZVP B;  3RJM B;  2DKO B;  3GJS B;  4DCP B;  5IC6 B;  1QDU B;  3NS7 B;  1F9E B;  2CJX B;  1BMQ B;  1RHR B;  3IBC B;  2Y0B B;  3D6H B;  1RE1 B;  3R6L B;  1RWM B;  1RWO B;  2XYH B;  3EDR B;  1RHU B;  3D6F B;  1SC4 B;  4ZVU B;  5K20 B;  1RWP B;  2H51 B;  3EDQ B;  1QTN B;  2FQQ B;  2CJY B;  3KJQ B;  3P45 B;  2C2Z B;  1RHM B;  3R7S B;  2C2M B;  1IBC B;  5IC4 B;  1RWV B;  3P4U B;  2CNL B;  1PAU B;  2H4W B;  2XYG B;  2QLJ B;  1SC1 B;  1RHK B;  2H5J B;  3IBF B;  4ZVO B;  1RHJ B;  2QL5 B;  2Y1L B;  2XYP B;  1RWN B;  3R7B B;  1I3O B;  1NME B;  2HBZ B;  2H5I B;  2QLF B;  4ZVR B;  4ZVS B;  1I51 B;  2C1E B;  2XZT B;  1RWK B;  4LSZ B;  4JB8 B;  2HBR B;  2P2C B;  3R7N B;  3R5J B;  2CNN B; 
#chains in the Genus database with same CATH topology
 4DX7 A;  1MMD A;  2ZKT A;  3C14 B;  5GME A;  4CLW A;  1T0T V;  1RWW B;  3KK2 B;  1FNX H;  1U2C A;  1HQ2 A;  4OYM A;  3MM9 A;  3KLF B;  2HHH J;  5B0C A;  1F5B A;  1KN6 A;  4GVL A;  5KFQ A;  1NK6 A;  2ALY B;  2YNI B;  5T7L A;  4OHZ A;  6FDR A;  3AOC A;  2J0S D;  4B3S F;  3DM2 A;  3AB4 B;  3MPU B;  4JI1 F;  2LKZ A;  4GKJ F;  3NCQ A;  2DXE A;  2PMH A;  2CPJ A;  1N34 F;  3GSI A;  2YTC A;  1F9F A;  5KT4 A;  1KP6 A;  3RU0 A;  1G4C A;  2J9C A;  2IAJ B;  2BKP A;  3QLH A;  3I31 A;  4DL5 A;  1S4E A;  1OSD A;  3I96 A;  1DTQ A;  3VAF A;  2HMI B;  4DSI A;  1VQS A;  1R8H A;  2CKW A;  4LF9 F;  5IT4 A;  4LSN B;  2ZC4 A;  1TKZ B;  1C1B B;  1VMB A;  4PG4 A;  4LSZ B;  2ZOF A;  4C98 A;  1RT1 A;  5EX3 A;  3DCA A;  3T1Y J;  3DLH A;  1HBU B;  3VAH A;  3DRP B;  1QTM A;  2R8J A;  2DNR A;  4IYQ A;  1ROF A;  2VDH A;  1HNX F;  3BZQ A;  4RNF A;  2IJN A;  3H59 A;  4CP5 A;  3I5A A;  3C6T B;  1T9Y A;  3RRG A;  3FZB A;  2RQC A;  3BO3 A;  1MU2 B;  3TR5 A;  3HUL A;  1HLW A;  1S0V A;  5I3U B;  4DQQ A;  2EW9 A;  2XSJ A;  4DR1 F;  3D6H B;  3Q23 A;  2XS2 A;  1KKH A;  3M8Z A;  3D1O A;  1REG X;  3D7S B;  1SVD A;  1TKD A;  5J2M B;  3BN7 A;  1EZZ B;  1KFD A;  4QIW D;  2LQ9 A;  4WJB A;  3MEC B;  4WP3 A;  3PRD A;  1X4G A;  1YRT A;  1LOU A;  3MEE B;  4NRU A;  4H4O B;  3T5J A;  2C2D A;  3NP5 A;  3QSI A;  1EHW A;  4DZ6 A;  4ED7 A;  1RT6 A;  4MK8 A;  4LJM A;  3NOC A;  1OQ3 A;  3V6D B;  4BDP A;  4KPC A;  2FLO A;  1M5O C;  3L7U A;  4JB8 B;  2CQC A;  2ZHA A;  2CQI A;  2ZBP A;  3LH2 S;  2Z57 B;  3TAM B;  2CPF A;  3M8W A;  2C3U A;  2JZ5 A;  3F56 A;  2OH2 A;  4ZPV R;  2RVJ A;  2JSX A;  2J7U A;  1UJ6 A;  1SJR A;  2AJ0 A;  2RDI A;  3TWZ A;  2RQM A;  4C48 A;  2R7S A;  3PIO Q;  2A6O A;  5AJ3 F;  3VR1 A;  1N5T A;  1U2F A;  3FEZ A;  1R31 A;  1BC6 A;  2XCP A;  3PM9 A;  3F41 A;  1M5S A;  4LBH A;  2YQ3 A;  2D3U A;  1FWK A;  1RHU B;  2ZH9 A;  4NLG A;  4L6V 3;  4E8U A;  5F8L A;  4RW7 A;  2CYY A;  1UTA A;  4UW2 A;  1RWV B;  4C6A A;  1K44 A;  3T1H F;  4ZPW R;  4X84 A;  1S1T B;  3OR2 B;  3HHK A;  2XS5 A;  2GA7 A;  1S6Q B;  1VYA A;  2QMW A;  5LMN J;  3AXK A;  4MIW A;  1IVZ A;  4O23 A;  2MGZ A;  4DF4 A;  4X62 J;  3QPI A;  1FRJ A;  3PY8 A;  2W8L A;  3TUP A;  3FQK A;  3WBZ A;  3PYF A;  5B0D A;  5I3P A;  4NLP A;  1HNZ F;  3CD0 A;  3I0S A;  1S0N A;  1OY9 A;  3CCS S;  4QJV A;  5IQ6 A;  2FZG B;  2G2Z A;  2HNZ B;  4ECR A;  1WC6 A;  1WOR A;  1OMS A;  1XN9 A;  4LIR A;  3MMJ A;  4C7Q A;  1NRK A;  3G9C A;  3CE8 A;  1VBK A;  1FXL A;  5U47 A;  5HVF A;  1N5Y A;  1B4S A;  3RBE A;  4ED5 A;  4LR7 A;  2OUG A;  4X4N A;  3V4I B;  4LF6 J;  3TZZ A;  4ZPA A;  2C2Z B;  1N32 F;  1UZH A;  2ABY A;  5KFH A;  1TVR A;  1I94 F;  1TU0 B;  2I38 A;  3TO8 A;  3GCX P;  3TJ9 A;  1SXL A;  3SSR A;  1WAC A;  2Z2L A;  4UY8 5;  2HK3 A;  2R8K A;  1HNV B;  3EXC X;  2E5J A;  2HAF A;  2YWE A;  3BGL A;  2EG2 A;  2WSF C;  3K5O A;  4ZLN A;  3CCL S;  1KOH A;  4HEA 9;  3JXO A;  1YRX A;  1HQU A;  3THV A;  4IG0 A;  5HK4 A;  4DV0 F;  3BDP A;  3DU6 A;  4KHR A;  3EVM A;  2MHN A;  1WF2 A;  1BXN A;  3K2Y A;  5CHC B;  2DHX A;  3OL9 A;  1CUL B;  1RTI A;  3Q24 A;  2NSC A;  2XBP A;  1JLA A;  2NZC A;  2KYX A;  3PYD A;  4KV8 B;  4GVB A;  1UEU A;  4HYK A;  1IBK F;  4JV2 A;  1T95 A;  1MN7 A;  2CQ0 A;  1ZYQ A;  4BWM A;  4TN2 A;  2K7K A;  3H5Y A;  3MCN A;  2FJV A;  5B09 A;  4NXM J;  2B7C B;  2KT3 A;  4QCL A;  4BLG A;  5IWA J;  2AYG A;  1RHK B;  1XR5 A;  1IM6 A;  5K5M A;  4R0E A;  1D0E A;  1HD1 A;  1BLU A;  3BSO A;  3HKZ D;  5C25 B;  2XZT B;  4UOF A;  2QG9 B;  4DR5 F;  1HKA A;  2C22 A;  1QUV A;  1PIL A;  1CJV B;  1QLN A;  4UOC A;  1LW0 B;  3A1Y G;  3OTB A;  5DQG A;  1VQ6 S;  2E1R A;  5ETP A;  3SIP B;  5E2Q A;  2F9J A;  1YRU A;  2B9Y A;  4K2J A;  1WKL A;  3DRX A;  3H4B A;  2KM8 B;  1S9E A;  1FER A;  3MPV A;  1IXK A;  4PR6 A;  1U1P A;  3M9M B;  1Q4R A;  1HNW F;  4CCH A;  4RR5 A;  5CZV A;  1VLO A;  5E5N A;  5KFR A;  2DNY A;  1XNR J;  1CG2 A;  3CCW A;  1IKV B;  2UUT A;  1TL7 A;  2E9T A;  2ASD A;  3ENA A;  5F0U A;  2R7T A;  4Q45 A;  1NM2 A;  2AZ1 A;  3EWG A;  3OW2 R;  4I7F B;  2KXH A;  2MKY A;  2Z8Q A;  4HI2 A;  2Y0S D;  1N36 F;  3AJ1 A;  1IKY A;  2FB0 A;  1YVF A;  4OZ3 A;  2J8A A;  4DSL A;  1N33 J;  2ZZN A;  3M32 A;  2MZ1 A;  1FE4 A;  2HZC A;  1NZA A;  2DR7 A;  3MM6 B;  5D6G A;  3AQP A;  5KT6 A;  3S7R A;  4M5M A;  4CO1 A;  3UI3 A;  3OTO J;  3DNC A;  5LJ5 Y;  1BGX T;  1OY6 A;  2GV1 A;  3HHN B;  4OZ1 A;  2RDJ A;  1X5P A;  2H1Y A;  3IWN C;  3VVU A;  3J7Z 5;  2HFO A;  2IDL A;  2VH7 A;  1FDA A;  1NKC A;  4K4V A;  2IFX A;  4QWC A;  1RDR A;  2ZIT A;  3BKU A;  4QIF A;  3CJR A;  4N5S A;  3M4X A;  4WFA Q;  3PVX A;  2WBR A;  1MML A;  2YWW A;  2FGC A;  3BH6 B;  2HVZ A;  4ED0 A;  4EMD A;  3MCO A;  2UXB F;  2XLJ A;  3CW2 C;  3THT A;  4IG3 A;  4RW4 B;  1S49 A;  3ZTR A;  5M2U A;  4X4T A;  4FDF A;  4I2Q B;  1VHI A;  3TX0 A;  3KTQ A;  2ZHO A;  3KG1 A;  2HK2 A;  2YKO A;  2YWF A;  2DNH A;  3NNA A;  4HAC B;  2APO A;  2DH7 A;  4WZQ A;  3HHL C;  2QIF A;  2X1B A;  3M8Q A;  4P75 A;  2FVS A;  1JLF A;  2JRS A;  3TUZ C;  1PCA A;  5HI7 A;  2PA3 A;  1D09 B;  4CO3 A;  4KTQ A;  1GTH A;  5KG5 A;  1NXI A;  3QWU A;  2J6T A;  4MIB A;  4USK A;  3TNV A;  4DPY A;  3Q8S B;  3W63 A;  3ILL A;  5BJR A;  2CQ1 A;  3PX6 A;  2YPY A;  4KC5 A;  2MY8 A;  4ZIT A;  3HT0 A;  2AEF A;  4HTJ A;  3TVZ A;  2ZH2 A;  2OMO A;  1SUQ A;  4X4U A;  2WVF A;  4DR6 J;  5MLC V;  1ZZF A;  4A8O A;  1FJG F;  4O3R A;  1N5V A;  1OY8 A;  3B4M A;  3PYE A;  1NH8 A;  4OYW A;  3MM5 A;  3LAK A;  3HMJ G;  4RUB A;  4ZDN A;  1SJ3 P;  3AA8 A;  1N8R T;  2RKI A;  3JYT A;  2MLX A;  1T94 A;  3IWL A;  5ETK A;  2CZ4 A;  5AT1 B;  2HHX A;  2NXN A;  3GFZ A;  3RR8 A;  2HQF A;  3OXF A;  2DPJ A;  3V5R A;  1TKT A;  3IM9 A;  1KQF B;  3TAP A;  4KBI A;  4O44 B;  1URR A;  4YHH F;  1SL1 A;  1T05 A;  4NLW A;  2GO9 A;  2V5H G;  3BGR A;  1EKS A;  4ZLJ A;  4M5N A;  1SH3 A;  5CAA A;  2G0J A;  3JQJ A;  3EGV A;  4ER8 A;  5B7W A;  4F2R A;  5KFK A;  1FT8 A;  5F9L A;  2BE2 B;  1S1U B;  2QLB B;  2FC8 A;  2RSQ A;  2H3E B;  4IDK A;  2Z4P A;  2QSW A;  1FEE A;  3ITH B;  2NYI A;  1TL1 A;  2XEX A;  2AYB A;  4C3K A;  4ICL B;  3ENV A;  4JV0 A;  4OX8 A;  5K8O A;  3LGH A;  1PO6 A;  1WC1 A;  2L9N A;  2UUC F;  3Q8V A;  2BW2 A;  3DOK A;  4AUK A;  4LF2 A;  5LL6 d;  1SBR A;  1XK8 A;  3FBC A;  4F8R A;  1GT8 A;  5T14 A;  4IFY A;  2K1R A;  1JIH A;  3CDB A;  1K1Q A;  2M4M A;  2I0X A;  2U1A A;  4PQU A;  3F0N A;  3R5D A;  2MJN A;  1YJR A;  5B0E A;  2DB1 A;  4M5J A;  2GGP A;  1BQX A;  2FPH X;  4ITS A;  4NMX A;  4OZ0 A;  4NCG B;  1U1N A;  4C2M A;  1VQ7 S;  5RUB A;  4JI5 J;  1LW2 B;  1T9W A;  3QFW A;  4IH5 A;  1C0T B;  2VPZ B;  1WNE A;  4LVN P;  5IXU A;  3MAH A;  5KFW A;  2IM2 A;  2OLW A;  3KJV A;  2LDI A;  3N6N A;  1VOM A;  4MK9 A;  1R6V A;  5IT0 A;  1SL2 A;  2C28 A;  1BWV A;  3FKB A;  5CYJ A;  1FO1 A;  2QN6 B;  2OPP B;  4OI4 A;  1RYR A;  3VAK A;  4X2B A;  4A8M P;  1EJ7 L;  4FVM A;  2LVW A;  2LA6 A;  3PFE A;  2AGP A;  4OZ2 A;  1HBN A;  1MMN A;  3ZZR A;  1RAI B;  2VA2 A;  3MR3 A;  3A4T A;  1UA0 A;  3M8S A;  4USM A;  4UF4 A;  2GMH A;  2OSR A;  4EU0 A;  3NAH A;  4ZVR B;  2CXE A;  1VC0 A;  2B56 A;  4ED6 A;  3PAC A;  4WU2 A;  4I6A A;  5HMY A;  2DHA A;  1XBW A;  1WC5 A;  4B3S J;  3PXG a;  4C3L A;  2BRK A;  4HDH A;  2HAI A;  1NDL A;  2LA4 A;  4JI1 J;  4TKT A;  5F41 A;  3RBX A;  4GKJ J;  4UY8 T;  1RSC A;  1N34 J;  3OTD A;  1BY9 A;  2V8V A;  1QDU B;  4RUH A;  5LXY A;  3BR8 A;  4LF9 J;  3J7Y I;  3UR0 A;  3AD7 C;  3M2R B;  4NAS A;  3P3D A;  4Y28 C;  3TZW A;  1FJE B;  1WEY A;  3WIV A;  1H2T Z;  2XUL A;  2ZE2 A;  3BKT A;  3I9V 9;  1U45 A;  1RK8 A;  2LU1 A;  1XR6 A;  5GMK a;  1WUU A;  3CJK A;  2NLW A;  4K7Q A;  4OI3 A;  5FLX U;  3LQV A;  4UOH A;  4L3N A;  1HNX J;  3JQM A;  1ZAX A;  4ECS A;  4USI A;  1YQH A;  3TW0 A;  2HIY A;  1Y0H A;  5F8G A;  1CS4 B;  3EVO A;  3KLI B;  4WIQ A;  2HBR B;  2A18 A;  4DR1 J;  2ZNY A;  3NGT A;  3KNG A;  3PO5 A;  3H5X A;  2JFK A;  1HMV A;  3A12 A;  5DQH A;  1VDH A;  1NHU A;  4F02 A;  3VHQ A;  2OP5 A;  2HBQ B;  4B9L A;  3FEX B;  5F8I A;  3G8S A;  4ZHR A;  1QY7 A;  3GJR B;  2FJX A;  4P2M A;  4C3M A;  3DMJ A;  2MLZ A;  3KK3 A;  4NLQ A;  2R7X A;  4TY8 B;  4CLT A;  4F26 A;  4IQX A;  5J2P B;  3FSI A;  4O0I A;  1HWL A;  5DO2 A;  3H2L A;  2JLF A;  2GIR A;  4NEY A;  5LSO A;  3IM8 A;  5IQQ A;  3IR7 B;  3ZC4 A;  3J7Y U;  2RS8 A;  1REV B;  5GAD I;  4ZIV A;  4N56 A;  3QJL A;  1UVN A;  2CQG A;  1DQ8 A;  2DIU A;  2JLG A;  5ETL A;  4KGZ B;  3DGP A;  2KN4 A;  4YR0 A;  3EMT A;  2GS8 A;  1HWI A;  3CJ2 A;  4RO0 A;  3R97 A;  3KHR A;  2YWH A;  2RQ4 A;  2CPZ A;  3TAR A;  5AJ3 J;  2HFU A;  1B70 B;  3OVB A;  4JI7 F;  1XMQ F;  2J8S A;  2Q66 A;  1UEV A;  1XNQ F;  3GJQ B;  3IGV A;  3HHL D;  2CA9 A;  2NPF A;  2DCL A;  3D3C J;  2HEK A;  4CLZ A;  5DDP C;  2RE1 A;  2W9B B;  4PYD A;  2BAN A;  1LK7 A;  4IFV B;  2MSS A;  1YK9 A;  4C9D A;  1RHQ B;  4OYB A;  1NB7 A;  1FRI A;  4C8O A;  3KLV A;  3T5L A;  4RUA A;  2W7O A;  2NZ4 A;  2HVI A;  3CGI A;  2HQG A;  1WC0 A;  5L1I A;  3T1H J;  2YNF B;  3A3O B;  1FK9 B;  2FHJ D;  2C42 A;  3L9Z A;  3DYA B;  4UT4 A;  1BQN B;  1BHN A;  1S1X A;  4NZ0 A;  4CWB A;  3J7Z T;  3IP0 A;  3RB3 A;  2JEG A;  1S9G B;  2UU9 F;  4YP3 A;  1PAU B;  1QD1 A;  2X51 A;  4EYH B;  4D3G A;  3EZU A;  2RAQ A;  2XS7 A;  3QRR A;  1NK4 A;  2VBX A;  5GAD U;  1VRT A;  1HNZ J;  4ETX A;  3AY0 A;  5HJY A;  1WKK A;  4J9N A;  2NQP A;  5CYQ B;  1KD1 T;  2E1P A;  4PKD B;  2L3M A;  4GC6 A;  1M5H A;  3QMQ A;  4KT0 C;  5L38 A;  3AHP A;  2P2C B;  1F6T A;  5GVQ A;  4QWD A;  1HI8 A;  1DUR A;  5HO4 A;  3DLK B;  4N77 A;  4LF8 F;  4Z7Y A;  2KO1 A;  3G4S S;  4P52 A;  2LYV A;  2KZZ A;  3FZ2 A;  1N32 J;  2MQ8 A;  2CDQ A;  1I94 J;  1RTH A;  1K0V A;  1Z4U A;  5KFO A;  3ILO A;  5KFB A;  4QR2 A;  2QT7 A;  1KDN A;  5FDL B;  3G87 A;  4CLF A;  1U1O A;  3OLA A;  3UDV A;  2XMK A;  3LOU A;  4RZR A;  1W25 A;  1RAA B;  2H51 B;  2YNG A;  2OFG X;  2M9K A;  2A3J A;  3G82 B;  1V6H A;  2LXI A;  4WP8 A;  4P74 A;  3P4U B;  5SUH A;  1UL3 A;  3IS9 A;  1JJ2 R;  2IC3 A;  2B6A B;  2FGO A;  3BEG B;  3M8Q B;  4J37 A;  4NXN F;  3VGS A;  3PW2 A;  1V3Z A;  4M5D A;  4DV0 J;  4RPF A;  3DC2 A;  2F40 A;  3DLG A;  3M7V A;  2HKE A;  2R2S A;  2EK6 A;  1EET B;  3ISN C;  4FKY A;  5H9F K;  3GYG A;  4DI6 A;  2HHS A;  3JAM Y;  2LFV A;  3DOM A;  5KFG A;  3GIR A;  1ZET A;  4KE5 A;  2H4Y B;  3MAA A;  2D9P A;  3KJF B;  1IBK J;  1RT2 B;  3M6W A;  2G9O A;  3CCJ S;  3MF5 A;  4PG5 A;  1RBL A;  5E33 A;  4K5R A;  5E41 A;  4DQR A;  1DQA A;  2F4F A;  4QZV B;  2V8D A;  5AXK A;  4ECY A;  2W2N P;  3NNH A;  1EP4 A;  4QPT A;  4MKY A;  2DO0 A;  3KWM A;  2QA4 S;  1RWO B;  4AD6 A;  4J9Q A;  3OXG A;  3RB0 A;  4WP9 A;  3VGT A;  1HD0 A;  3DLE B;  2RKI B;  3CO9 A;  1ZA1 B;  2HS3 A;  1HNI B;  2F8M A;  4DR5 J;  1HPZ B;  3OVS A;  2D3O R;  5C2G A;  2KYZ A;  5ITH A;  2HIQ A;  4DX8 H;  5DJB A;  5J2Q B;  2VIC A;  5KT2 A;  3FJ2 A;  3EM1 A;  2QLJ B;  3RGI A;  2OI2 A;  3CWJ A;  2BDP A;  1ZPV A;  4EZ9 A;  2R7O A;  2PMW A;  3HSD A;  3H40 A;  4GC7 A;  1HBO A;  4WFZ A;  2JVO A;  2PSZ A;  2YXL A;  2U2F A;  1HNW J;  2AW0 A;  3MM7 A;  2OD4 A;  1YWX A;  2ZHB A;  1HQE A;  2V8G A;  3QRQ A;  1GFW B;  3TVK A;  3MEG B;  4Q8F A;  4UQG A;  4Y2K A;  1ZA2 B;  5HBM A;  1NK9 A;  1Q81 T;  1X7V A;  4PEO A;  3M6V A;  4ZN1 A;  1Q53 A;  2BRL A;  3CCU S;  4DS5 A;  3WC0 A;  3OXL A;  4XIU A;  4DWI A;  2VUG A;  1LWE A;  3U7J A;  3BSA A;  2ZH4 A;  5HJX A;  3FRY A;  3SBM A;  2QLX A;  3H8Y A;  2V4J A;  5A8R A;  4LFC F;  1N36 J;  4RWX A;  1MRO A;  2WON B;  4DMZ A;  4DJB A;  3NXZ A;  4NYO A;  4DQI A;  1H98 A;  4X66 F;  5EUH A;  3OL6 A;  2CAD A;  3K89 A;  2ZKU A;  1UJ4 A;  4OIX A;  2UUB F;  2QTW A;  2EFN A;  1R8B A;  2CWK A;  3M8R A;  2IJF A;  1J5O A;  5HLF B;  1KQK A;  3D1H A;  2VFV A;  2HND B;  2OSQ A;  4A8W A;  3DOL B;  1Q8L A;  4WZM A;  2LLZ A;  1I6J A;  2UXB J;  4I67 A;  1ZAV A;  4BHQ A;  2WZ1 A;  1VR6 A;  4F4A A;  4MKV A;  2XGQ A;  3NMA A;  3CXC R;  3OR1 B;  1KQG B;  4B3O A;  2JLE A;  1OPI A;  3F44 A;  3O5T B;  4Q0B A;  3C66 A;  2RNE A;  3BGU A;  3QT5 A;  3ENW A;  4TLQ A;  2K2P A;  1SKS A;  2DNO A;  2FUG 9;  2EC2 A;  3K5P A;  1DZ5 A;  5AE2 A;  5A8K B;  3T6J A;  1CJU A;  2VF3 A;  4RW6 A;  5FII A;  3K5L A;  3IRX A;  2EBG A;  1X0F A;  5IM0 A;  3EDQ B;  1PYS B;  4CO0 A;  2G2Y A;  2R2T A;  4Y0F A;  1SQF A;  2AX0 A;  5C42 B;  4ZP9 A;  2D69 A;  4ZP6 A;  4I1T A;  4FN5 A;  3DRS A;  1VRU A;  2QFI A;  2DGU A;  5JUM A;  1YZ7 A;  4ECZ A;  3MOJ B;  1IR1 A;  4DUY F;  3KUG A;  1YBA A;  2XI2 A;  3W1Y C;  1FJG J;  4YY3 F;  2XSF A;  3GR0 A;  2PE8 A;  1A7G E;  5D3G A;  3OLB A;  1H3D A;  5F9N A;  3T5H A;  1KOO A;  2VHG A;  4ECT A;  3E8O A;  2B5J B;  4LRC A;  4RBU A;  2BBE A;  3GV5 B;  4F4K A;  1XMB A;  1TL3 B;  1B3T A;  1S5Z A;  1BQM B;  3SFU A;  2JWN A;  5LMU F;  4NCA A;  3DRR A;  3P96 A;  3G8Q A;  3E2E A;  1S6P A;  3KFW X;  2O3D A;  2EKY A;  3IG1 A;  2MKH A;  2VOO A;  4M5K A;  4YHH J;  4KO0 A;  3HSJ A;  1JJC B;  5IOL A;  3KK1 A;  1R43 A;  5D77 A;  3ZZT A;  2IY5 B;  7FD1 A;  5LT5 A;  1A6L A;  1UFL A;  2BM1 A;  4IO9 Q;  2FDN A;  3HHE A;  3LP0 B;  2IJR A;  4NML A;  2G1H A;  2Y1J A;  2F8H A;  4DU7 A;  1IKW B;  2VG6 A;  3BBF A;  3S6E A;  2D74 B;  2YBV A;  1V9O A;  4JI4 F;  3UN2 A;  2GZO A;  3MFH A;  1T11 A;  2UUC J;  3KUE A;  2RB7 A;  5F0W A;  1VGY A;  3MEK A;  1PJ5 A;  2N7C A;  4WFB Q;  1LWF A;  3C16 A;  5EDW A;  2ZUG A;  2E1A A;  3U1M A;  4N7T A;  3V6H A;  3Q83 A;  1WEX A;  3PZP A;  3NS5 A;  2ASY A;  1X60 A;  2XB2 D;  4TYA A;  3N5B A;  4LR8 A;  3SSS A;  1C1C A;  1UFW A;  4F2S A;  2YH1 A;  3UN3 A;  2C3Y A;  1WDD A;  5K8M A;  4OLP A;  3IFE A;  1S7H A;  2DXF A;  3HLU A;  2OGU A;  4M1K A;  4K4Z A;  4O4R A;  1T8E A;  2B9W A;  3AAW B;  2ZWP A;  2DY1 A;  3BYP A;  1U0H A;  1NH7 A;  1NZ8 A;  3H98 A;  5A76 A;  1X5T A;  5L39 A;  4A48 A;  5ADZ A;  4DN9 A;  2XMM A;  5K14 A;  4TU7 A;  4L73 A;  1NJX A;  3D0G E;  2F65 A;  3DGP B;  5G0R A;  1SV5 A;  2MKK A;  3M30 B;  3NAI A;  3A8I A;  1WOS A;  1L3K A;  4K5S A;  3TA2 A;  4YB5 A;  3I0R B;  2N82 B;  3BV8 A;  5JJB A;  5KFX A;  2CUY A;  3R5J B;  3M2V A;  4ZK7 M;  2V94 A;  3W7B A;  3L09 A;  2D9O A;  4FYY B;  1OWX A;  4ILR A;  1K73 T;  3NWG A;  3I5B A;  4LF5 F;  4KSE B;  1CQM A;  4AL6 A;  2BE9 B;  1DJ0 A;  2FVR A;  2DRB A;  3GZ7 A;  3N6L A;  2LEP A;  2ATL A;  2V4Q A;  2B4U A;  2DNP A;  1JK9 B;  1NAQ A;  1OSC A;  3JSM B;  3UVJ B;  2KI2 A;  2AKW B;  1WHY A;  2GAH C;  3T3F A;  5B0B A;  1SC4 B;  3POT A;  5KG7 A;  2UV8 G;  3KNA A;  4DX6 A;  3MMC A;  4QYZ J;  3NBP B;  2Q3P A;  3VAM A;  1UAW A;  1FWL A;  2YNH A;  1IR0 A;  4QWA A;  4KKO A;  4I4B A;  2LDY A;  4IO1 A;  5K9F A;  4JOU A;  2QLF B;  3LGN A;  4V1A k;  2ZC3 A;  3SCJ E;  3SQG B;  1M1H A;  4LRA A;  1FTC A;  1RT7 A;  1T9V A;  3JAM U;  2BJE A;  5LXR A;  1JLQ B;  2Z56 B;  3MTJ A;  4MKB A;  3OUY B;  1NJI T;  3M1V B;  4F67 A;  1FKP B;  2XY7 A;  2WSC C;  4RLE A;  3MD1 A;  3JB9 k;  4WTO B;  2KH9 A;  1E6Y B;  4GO5 X;  4QU6 A;  1FX4 A;  1RP5 A;  1WOO A;  3HHD A;  3VGU A;  4USV A;  1TKX B;  4EO6 A;  1QAI A;  2F3J A;  2NPI A;  1ZPW X;  3UD5 A;  4LQ9 A;  1HHT P;  3DU5 A;  4FYD A;  4B9V A;  4URS A;  4ELV A;  1ZM9 A;  4G6V B;  4B9N A;  1NK8 A;  1YZ6 A;  1W26 A;  1FTR A;  2HFZ A;  2ILZ A;  3KHG A;  2CQH A;  2MKJ A;  5C24 A;  4PWD A;  4LUB A;  2BMB A;  2CIM A;  3R7B B;  4IRK A;  4B9M A;  3D5M A;  1FJ7 A;  1I51 B;  3I6P A;  3DLG B;  3W65 A;  8ATC B;  4ATN A;  1LWC A;  4OZL A;  3GQC A;  3L7O A;  1S1W A;  5D0G A;  4WE1 B;  4MFB A;  3GPA A;  4NZ7 A;  1YIT S;  1LQ9 A;  2IMW P;  4U96 A;  3OVA A;  2AEJ A;  1WDT A;  1BD6 A;  5KFY A;  2KHD A;  4JYA F;  1SJF A;  3CB4 A;  4DUZ F;  3TEG A;  1J2V A;  1NSK L;  3OL7 A;  4R5P A;  3FEY B;  5HVG A;  5DDQ C;  3PJW A;  5D0E A;  4CO5 A;  2JL9 A;  3I5C A;  1NPR A;  1FFS B;  2PD1 A;  1EKR A;  2QSF A;  4M5H A;  3RAX A;  2W7A A;  2OML A;  2VG5 B;  4LQ3 A;  5K20 B;  2PFF B;  2FJA B;  1YJN S;  1UEK A;  1R3N A;  2VU5 A;  1JLG A;  4JI7 J;  1XMQ J;  4Z7C A;  3BM7 A;  3Q86 A;  2VJU A;  1XNQ J;  1IJF B;  2AV5 A;  4K4Y A;  2POK A;  3K17 A;  5L9N A;  2VON A;  4GKK F;  3Q22 A;  1S4F A;  2HPU A;  5CCM A;  3SXL A;  1C4A A;  1OYD A;  4A46 A;  4M95 A;  3OL8 A;  4ZVS B;  4Y65 A;  3KXD A;  1QSL A;  2ZH6 A;  2BEF A;  3Q8R B;  1TAU A;  4DV7 F;  2BR0 A;  2FLN A;  1IQZ A;  3DN9 A;  2AMC B;  1NSP A;  5KFS A;  2C2R A;  1R7I A;  3OQ2 A;  1V3S A;  1N56 A;  1DBD A;  2GML A;  4KFB B;  3V6K A;  2XMU A;  2L08 A;  1UVK A;  2C2E A;  3GTY X;  1L5U A;  2B4P A;  3HSZ A;  4H4M B;  2UU9 J;  4ZCK A;  3SFG A;  3K59 A;  3TEH B;  4F4W A;  4KGX B;  1RWM B;  3G8T A;  2VFS A;  4MIA A;  3UD4 P;  5GAG I;  2BKN A;  3CC4 S;  1WC4 A;  2D3O 1;  3G6Y A;  2PT0 A;  4JBC A;  4FYX B;  1VQN S;  1NND A;  3ADA C;  1GH8 A;  4ECX A;  1IBL F;  3FUY A;  4AE5 A;  1Y3K A;  3CTR A;  3PIP Q;  2CPD A;  2E7V A;  4LF8 J;  3PEH A;  4DSK A;  2ZZT A;  3I4P A;  2DK2 A;  4HHU A;  2FJW A;  3TI0 A;  3CCM S;  4FF2 A;  3CF5 Q;  1RIS A;  4WK1 A;  4Y2I A;  3ICL A;  4ZOS A;  2HQD A;  1WOP A;  4KHM A;  5M2P A;  2IBK A;  2H65 B;  4I56 A;  4U6P A;  2VB6 A;  4ZJL A;  2RH3 A;  4E2F B;  2OJ3 A;  4G3I A;  3FFI A;  4CRJ A;  1Y7P A;  3A8K A;  4WFY A;  4LRB A;  1SKR A;  1C0U B;  2WAQ D;  2W24 A;  3AOD A;  4Y00 A;  3PKY A;  4ZMM A;  5B0G A;  2QA4 G;  3CJ5 A;  4CDI A;  3CJ4 A;  3HVW A;  1YJT A;  5CH7 B;  3EUN A;  4NXN J;  2KB2 A;  1PYT A;  3RYL A;  2IM3 A;  2ZBI A;  3QAE A;  2WOM B;  1R8C A;  2DCU B;  4DSF A;  3D28 A;  3QT6 A;  2C2M B;  4J9V A;  3H25 A;  5GAG U;  2OAU A;  2V9W A;  1E6V A;  4K8R A;  3CJQ A;  3CC2 S;  3K58 A;  3I56 S;  4QW8 A;  2QZ8 A;  3ZNU A;  2GVD A;  3P5T L;  4HVZ A;  3GSD A;  4DL4 A;  3ZZP A;  4DR2 F;  3LAN A;  4DR7 F;  4LMZ A;  2IRX A;  4DPO A;  1HHS A;  1CJT A;  1X31 C;  4QWE A;  2P9E A;  2YY3 A;  3V4M A;  2Q1L A;  2AYM A;  3PEJ A;  2GQ2 A;  2QL7 B;  4R0J A;  4ZKA A;  1KTV A;  2ATC B;  2E7W A;  2OPQ A;  3MM8 A;  5DM6 Q;  3ZZU A;  2WB4 A;  1X9M A;  2DH8 A;  3FCW A;  3JTP A;  2PI5 A;  4CQ1 A;  3DDK A;  4J91 A;  3MMA B;  5KG6 A;  2XHW A;  2J7K A;  1X4D A;  3TRG A;  2VKR A;  5J1E A;  1FE0 A;  5A8W A;  4CZC A;  3CDW A;  2FHJ A;  1HBM A;  1HWU A;  2M2B A;  3IN5 A;  2MQP A;  1WG1 A;  1VBX A;  2BOA A;  3EXY A;  5T41 A;  4FXD A;  4CYU B;  1C2P A;  3EE3 A;  1MNE A;  2DR9 A;  2KVI A;  3C15 B;  3PRB A;  2EFQ A;  3KHL A;  1JJ4 A;  4TYB A;  5DDO C;  2OPS A;  4JV1 A;  1JLB B;  4PG6 A;  2ZD1 A;  2FY1 A;  3ZTS A;  2HUR A;  3HVT A;  2HRT A;  3I32 A;  1HFE L;  4LFC J;  3QO9 A;  4QR1 A;  4KH0 B;  1IQT A;  2UZA A;  2N3O A;  3AFG A;  3KLH B;  4F04 B;  4ED1 A;  5HMX A;  1M1K T;  2W25 A;  3V81 B;  3IRW P;  1RYS A;  1LKZ A;  2R2U A;  3GU0 A;  2WVD A;  5KG4 A;  2PO4 A;  4TQR A;  2N7Y A;  1NJY A;  3T1A A;  1KC8 T;  4X66 J;  1SKW A;  1TUW A;  4C8L A;  4USU A;  1X4H A;  3IBC B;  3HFV A;  3H0P A;  1K47 A;  5EHH A;  1Q79 A;  3K57 A;  2UUB J;  3RAM A;  1Q7L B;  2CQD A;  2GC8 A;  1YG0 A;  4WXO A;  4JI8 F;  1YJ7 A;  1UCN A;  1B0P A;  4OX9 F;  4YDD B;  3W2W B;  2DGS A;  3HI9 A;  2B4O A;  4XAK A;  3MUM P;  2WCX A;  3OT9 A;  3GG0 A;  1DRZ A;  3UNG C;  2YKM A;  4R25 A;  2DIS A;  1S77 D;  1SQE A;  5L9X A;  5DLG A;  2X3D A;  4IR1 A;  2W01 A;  3VAL A;  1P6T A;  1TFW A;  2N3L A;  1NSA A;  2RF2 A;  4J90 A;  4RW8 A;  5DRK A;  1UET A;  2DRA A;  4F36 A;  3VZH A;  3OPK A;  4ZLP A;  2MMY A;  3J80 Y;  2HNY B;  3CVK A;  1T03 B;  3KLE B;  4ID5 A;  4TLR A;  1RA6 A;  4DV5 F;  2E1M C;  2W4C A;  3CCQ S;  5KFZ A;  4WFN Q;  3W61 A;  3NG8 A;  3MED A;  4QYR A;  2CPI A;  3CMQ A;  2V8H A;  3T19 A;  4YN3 B;  1S12 A;  2HHT A;  4DUY J;  2E29 A;  3W2V A;  4YY3 J;  1DAX A;  2W8K A;  2V2V A;  1PKU A;  1G7C B;  2DNM A;  1NJZ A;  1O51 A;  2H4W B;  4DN0 A;  2JHE A;  1RT3 B;  2QE5 A;  3BBC A;  3J7A N;  3CC7 S;  2J5A A;  2AEM A;  5FJ4 A;  2I1R A;  2GX8 A;  3DI6 B;  1TL5 A;  2P5V A;  2H5I B;  3C46 A;  2XWY A;  2VG7 A;  3EPG A;  2XWX A;  3TZX A;  1AUD A;  3QWP A;  4DFM A;  2AWZ A;  2BJ3 A;  5LMU J;  3BDE A;  4WK3 A;  1FD2 A;  1N0U A;  3VAJ A;  3VGV A;  1ICE B;  1NU4 A;  3GG1 A;  3ETO A;  3BF4 A;  4FXV A;  3HD1 A;  1QAX A;  2R7Q A;  3ISZ A;  1JLE A;  4JV5 F;  1NK7 A;  5I42 A;  2DHH A;  3HD2 A;  3LP2 B;  2KT2 A;  1M1G A;  2CPY A;  2GQC A;  1KVK A;  1YBT A;  4C11 A;  3D6F B;  3V6J A;  4OQJ A;  3KYL A;  3C3L A;  5DGB A;  1XR7 A;  4JI4 J;  3Q0A A;  1RT4 A;  1U7L A;  1UWB A;  2GVZ B;  2YX7 A;  3DXB A;  2W9C B;  1FX2 A;  1DTT A;  1VIO A;  1KFS A;  2XYP B;  4EYI B;  4F25 A;  1U47 A;  4OJG A;  4PZV A;  4KHP F;  4BS2 A;  1MG7 A;  3A3P B;  2GHV C;  2HBY B;  4FPI A;  4ED2 A;  3GP9 A;  4O3N A;  4JP8 A;  4WPA A;  2CNO B;  1S76 D;  2R9L A;  5J2N A;  2VOD A;  4RW9 A;  2UVR A;  2KTQ A;  5C5J A;  1O5J A;  3SEO A;  1P27 B;  3U1L A;  5D4O A;  3R2C J;  3GIM A;  1F2H A;  2OPR A;  3DKD A;  1FKO B;  2DBB A;  3Q8Y A;  2FHO B;  3ZZY A;  3CJ3 A;  1Q5Y A;  4LRE A;  2X7I A;  4LR9 A;  3WDO A;  2I2Y A;  4F3M A;  3C6U B;  4ZVU B;  3QGH A;  1S97 A;  1QTN B;  2CJQ A;  2ERR A;  4EK2 A;  2IDE A;  3KLG B;  1M90 T;  1TK5 A;  5HP1 B;  4OI1 A;  1JX4 A;  1K0T A;  2PEH A;  1HYS B;  1SC1 B;  4W90 B;  2KG0 A;  4LF5 J;  4NA1 A;  3CCV S;  3FDS A;  1I3O B;  2D41 A;  3IR5 B;  4EBD A;  1TFY A;  1RT5 B;  2VC1 A;  3B8H A;  3VV2 B;  3MMB A;  2CQB A;  3NGK A;  2OEM A;  2ZH1 A;  2BQR A;  1RTD B;  4K2X A;  2R4F A;  4K4U A;  3K0J A;  1WC3 A;  1KLM B;  5LOQ A;  1VBZ A;  1ZAW A;  2X3G A;  3KOA A;  4DL0 C;  4ES2 A;  1CVJ A;  2FY8 A;  4I2P B;  2DHS A;  3GJS B;  4CIO A;  2BKO A;  3WX4 A;  2VPX B;  4J9P A;  3M8P B;  2VC0 A;  2R8I A;  3SV4 A;  4FF3 A;  1DLO B;  1N48 A;  6FD1 A;  1WD6 A;  3K7R A;  4EI2 A;  1IKX B;  1HW8 A;  2R3V A;  3I55 S;  4F7V A;  1ZZN A;  2XNR A;  4OZJ A;  1TV6 A;  3N6M A;  4EFA C;  4TY9 A;  1X4A A;  4FNI A;  2FIU A;  5HRO B;  2B43 A;  5KT5 A;  3RRK A;  4KR0 B;  2KRR A;  4JI0 F;  2A6M A;  5A0Y B;  5DQI A;  4PUO A;  5A6W A;  2UXD F;  3IBF B;  3LP1 B;  1S1V A;  2KG1 A;  5DG7 A;  3JS9 A;  4M8L A;  4DL2 A;  4OHY A;  1VC5 A;  5GAH I;  2PN6 A;  3TX8 A;  3PHE A;  1D8Y A;  1Y00 A;  1JLC B;  3L95 X;  4LSL B;  1EIY B;  3QIP A;  8AT1 B;  1JKH B;  4ZVG A;  2L9W A;  1QUP A;  3BPD A;  1CSJ A;  9ATC B;  1Z1Z A;  3FBF A;  4LF7 F;  4ZLL A;  3C14 A;  1UA1 A;  4F50 A;  1O8B A;  2HQI A;  2MY7 A;  3KK2 A;  3M05 A;  5KFJ A;  3N79 A;  4J5O A;  2ROG A;  2HGN A;  4ZPB A;  2CQ2 A;  4J9O A;  3KLF A;  4MYU A;  2VPY B;  1IN0 A;  2YNI A;  2X1A A;  1X4E A;  4QOT A;  2OKQ A;  4F3Q A;  1Y5I B;  5K8N A;  2HG4 A;  1H6K X;  2FHK A;  2XTJ P;  4IRD A;  2PII A;  1MW7 A;  4JYA J;  1AZS B;  4DUZ J;  2RML A;  3N28 A;  3NMR A;  4OZ5 A;  4USH A;  4NX9 A;  2F7V A;  4JI3 F;  1NUE A;  2VFT A;  2FJD B;  2GVD B;  2IAJ A;  3PRV A;  2P8I A;  4ZP8 A;  2HMI A;  2HRY A;  1APS A;  4JI2 F;  2F5G A;  3T6B A;  4ANC A;  3PX0 A;  2CG8 A;  4LSN A;  1RTJ B;  1TKZ A;  1C1B A;  3ET6 B;  1Y3J A;  5GAH U;  2EKN A;  4DX5 A;  2PI4 A;  2CQ3 A;  2LQ8 A;  2YKN B;  4YUD A;  4MH8 A;  3SDE B;  4M5I A;  2L41 A;  4IUF A;  3HHL B;  3MR7 A;  2CPE A;  2I8E A;  1HBU A;  3HJF A;  3DRP A;  4NYZ A;  4X64 F;  1TK0 A;  4KY3 A;  3M2U B;  1LV5 A;  2XYH B;  3C6T A;  4ZPT R;  4WII A;  4GKK J;  1RU1 A;  3JQK A;  4KGK A;  4RKU C;  4C8K A;  1MU2 A;  3FMB A;  4DPT A;  3ZO7 A;  5I3U A;  3QT7 A;  3QYY A;  1RHM B;  4DV7 J;  2HQC A;  3KUH A;  3N01 A;  3QBC A;  2LEA A;  5J2M A;  2H5J B;  1RHJ B;  5HAN A;  3MDF A;  5H9E J;  3E01 B;  2DNN A;  3R5G A;  3H90 A;  3MEC A;  4NA3 A;  4J9U E;  3MEE A;  4TQS A;  5ETR A;  4KRW A;  3LF0 A;  3OHB A;  5ETQ A;  2FVP A;  4H4O A;  3IBW A;  1T9X A;  2RJZ A;  5CYM B;  4ECV A;  5KT7 A;  3ZZ0 A;  2LU2 A;  3RAQ A;  3V6D A;  2YWG A;  4K4T A;  3J80 U;  1AUS L;  2J9D A;  2WW4 A;  3IA0 A;  4NI2 B;  1ULR A;  1X4F A;  2XMW A;  2B7B B;  4NWB A;  1HWJ A;  3TAM A;  2M3D A;  3OFE A;  2F8E X;  4W4M A;  4OI2 A;  5H9F J;  1IBL J;  3OV7 A;  2RU3 A;  1RE1 B;  3R6L B;  2YPZ A;  1F5C A;  2GO8 A;  2ASJ A;  4DL3 A;  4DG1 B;  3GYN A;  2ZWO A;  1NJW A;  1U1K A;  2E9R X;  1VRQ C;  3KJQ B;  3NGR A;  1VLY A;  4MMO A;  4HT5 A;  3HPO A;  3OSP A;  1ZM3 A;  3CMA S;  3A13 A;  2Y1L B;  2YKA A;  1CC8 A;  1B7F A;  2HBZ B;  7AT1 B;  3JSY A;  4DEZ A;  4DFK A;  3RB6 A;  4CTA B;  4R8U B;  1Q8I A;  1S1T A;  3W66 A;  2MYF A;  1CJK B;  3OR2 A;  1S6Q A;  1W2I A;  3X3U A;  4CH0 S;  4P71 A;  4F0K A;  1WWH A;  1PC4 A;  3M9O B;  2FVQ A;  4NRT A;  3IGN A;  5AXL A;  3MOZ A;  1FRK A;  1R0A B;  3PTW A;  3A3N B;  1MLA A;  4U9R A;  1S59 A;  3OFF A;  1U1R A;  5BXI A;  1U8W A;  5ETN A;  2CJA A;  2W2Q P;  5D4P A;  2XNQ A;  4DR2 J;  3HO1 A;  2FQQ B;  1IBC B;  4DR7 J;  2OEK A;  4G1Q B;  3B54 A;  1N6Q B;  5KT3 A;  2RHQ B;  3ILI A;  4MT1 A;  2I5J B;  3V4I A;  4LFB F;  4PRF A;  3UD3 P;  5C2C A;  2MZQ A;  1VQM S;  4HR2 A;  1GXL A;  3LPY A;  2DNL A;  3MM9 B;  2B3T B;  3KMQ A;  4HHJ A;  1CPZ A;  1Q86 T;  2IBO A;  2G2O A;  2D7S A;  1QM9 A;  4P2S A;  4KQZ A;  5T7L B;  1HNV A;  4DOZ A;  3TJA A;  4Z2X A;  8RUC A;  1SJ4 P;  3DM2 B;  3P5B P;  1EX8 A;  1FFW B;  3H5U A;  3NKY A;  2B0G A;  2B8P A;  2YKP A;  5KG3 A;  2FTR A;  3H20 A;  1B99 A;  4G65 A;  4ED4 A;  1K8A T;  4IRC A;  1WG5 A;  1G6B A;  3QLH B;  1DTQ B;  5HMZ A;  4P72 A;  4OYX A;  1S72 S;  2M7S A;  4F4Y A;  2LQB A;  2CVI A;  3VWS A;  1CUL A;  3TQ1 A;  4YOE A;  1RKI A;  3R7S B;  2P6S A;  1IJE B;  3FRZ A;  2KL8 A;  1N88 A;  2BQ3 A;  4ZS6 A;  6AT1 B;  3MR5 A;  3D66 A;  4KV8 A;  4FPR A;  2J0W A;  4ZVH A;  2JEF A;  1QVF R;  1RT1 B;  4ZVO B;  2QL5 B;  3FCH A;  3S8S A;  2AJ1 A;  4PXC A;  4AYB D;  1DY3 A;  5IT9 Y;  3HZE A;  2EK1 A;  1RA7 A;  2CNN B;  2O67 A;  3N9U C;  2L9D A;  3UCU P;  4YB7 A;  4UOG A;  1PIE A;  3GWC A;  2ZBC A;  3FQL A;  2XSJ B;  2MQN A;  4ECQ A;  5C25 A;  2J76 E;  1RTZ A;  4IOB A;  3ZZZ A;  2B51 A;  2KFZ A;  4CO2 A;  4ZVT B;  2C2O B;  4JI8 J;  2XZD B;  1CJV A;  3VF0 B;  4OX9 J;  1LW0 A;  1SCJ B;  2V9K A;  4C8Z A;  3LWM A;  4B17 A;  2XG8 A;  2G0C A;  5EGY A;  4I68 A;  3TJ8 A;  1RI7 A;  2BJ9 A;  2PC6 A;  1JWW A;  4P6Q A;  2MLY A;  1TK8 A;  1UWA A;  1RT6 B;  1GMV A;  2RIJ A;  2DNG A;  4PYA A;  2Q6B A;  1IKV A;  1RCO B;  2Z0G A;  1HIY A;  3A8E A;  4PAB A;  3QAU A;  1HR0 F;  3M6X A;  3MZI A;  2Z2Z A;  2YQ1 A;  4HT7 A;  1SC6 A;  2FVC A;  3S01 A;  3Q2T C;  3QZ8 A;  4I7F A;  1WF0 A;  4DV5 J;  4P2X A;  1GEH A;  4YDX A;  2KHC A;  1ZBT A;  1XER A;  4F4Z A;  4CLU A;  1F5A A;  3SQO P;  4ZCI A;  3PW0 A;  3ZTQ A;  2XZW A;  5DM7 Q;  2AIR B;  1GK8 A;  3MM6 A;  5I4M A;  2ZUA A;  3W8P A;  2M88 A;  2EBE A;  3EZ5 A;  1L3T A;  1KWM A;  2KT5 A;  3MUV P;  1ZTW A;  2RDD A;  2XO7 A;  2B8Q A;  2H5E A;  2WB1 D;  4RW7 B;  3U27 A;  3KMS A;  3TA0 A;  3B78 A;  1F3F A;  2BOP A;  2DNK A;  1HL6 A;  4RBV A;  1FJC A;  2AF6 A;  4DPU A;  5BYQ A;  3GV7 B;  4K4X A;  3J81 j;  3JTN A;  3LAM A;  2MGZ B;  3RUB L;  2W2O P;  3UPF A;  3RG6 A;  1HI1 A;  2A2D A;  2AD9 A;  4DDF A;  3E51 A;  1WG4 A;  3AD8 C;  4RUC A;  2RD5 C;  4RW4 A;  4I2Q A;  1S1V B;  2DR5 A;  5KG0 A;  4JV5 J;  4HAC A;  3I0S B;  5E3R A;  3CCT A;  5B0A A;  4DSE A;  4W98 A;  4F4X A;  2VBY A;  2AGO A;  1N0V C;  4U7C A;  2EG1 A;  4MKA A;  1I1G A;  3UCZ P;  3I82 A;  1AYE A;  4JI6 F;  1N5Y B;  3OJU A;  2V69 A;  2IA6 A;  4X4P A;  5KFL A;  2QMU B;  5KFT A;  1Y10 A;  4CLS A;  1UFK A;  1F9E B;  3ILJ A;  2GHW A;  5FD1 A;  2VAS A;  3SCI E;  3UN5 A;  1TVR B;  1NKE A;  2R7R A;  1ELO A;  4KIA A;  1U6B A;  4IOA Q;  4FS2 A;  4KHP J;  3J81 Y;  2MQO A;  1N54 B;  5DG9 A;  4DV3 F;  3D4J A;  5ETV A;  3QRP A;  2CJK A;  2R7W A;  1S57 A;  1MSW D;  2WRM A;  4B3T F;  2Y9H A;  2YH0 A;  3SCL E;  4B9U A;  5F3Z A;  3BB5 A;  3AA9 A;  2MB0 B;  4DSJ A;  2FYX A;  1RAB B;  2W2P P;  3OTC A;  3L3C A;  4X4Q A;  1HQU B;  4FKX A;  5F3T A;  4IG0 B;  3AQO A;  1VQ4 S;  3FGV A;  1P1L A;  2VOP A;  2O66 A;  4TVA B;  3CD7 A;  4O44 A;  4YB1 P;  1WEL A;  1ARO P;  1RTI B;  1JLA B;  4I69 A;  2HLU A;  5DS7 A;  2RRB A;  3WC2 A;  1U2R A;  4GVB B;  2BE2 A;  1S1U A;  3BR9 A;  4DCP B;  2V67 A;  2BW7 A;  1NHV A;  4DV2 F;  3HDS A;  2GJ2 A;  1RBO B;  3ITH A;  4KAI A;  1JMT A;  2NUH A;  1Q5V A;  1P1T A;  2DR6 A;  2DPI A;  3W9J A;  4OYA A;  4DXL A;  3TAQ A;  2BJ1 A;  4ICL A;  2LXF A;  4DQP A;  2CJY B;  4QYZ K;  2ZOG A;  1VS3 A;  3BS9 A;  3LO3 A;  1XJW B;  4FBU A;  1SKU B;  1HHQ A;  2Q6C A;  4A8Y A;  2HHP A;  1RLC L;  5LSR A;  2XMA A;  2ILY A;  1LNQ A;  2Y3Y A;  3IO1 A;  2VFR A;  1GMU A;  1VFJ A;  2BQU A;  2EEY A;  2AJF E;  4Z37 A;  4PPD A;  3T9N A;  2YQ0 A;  2H48 B;  1S9E B;  3HZG A;  4NCG A;  2YKQ A;  1J5E F;  5DDR C;  1LW2 A;  3CJ0 A;  2R8G A;  3CUL A;  2ZOM A;  1ZOT A;  3KKF A;  1C0T A;  2HGM A;  1TL7 B;  4ELT A;  1DAR A;  1SPB P;  4YR2 A;  4DFP A;  1Q95 G;  2GMJ A;  1Y5N B;  4JI0 J;  1VC6 A;  3GII A;  4ZCL A;  4M5G A;  2Z58 B;  1PJ6 A;  4ZJO A;  2UXD J;  2HVH A;  2MHE A;  3O2I A;  3FNN A;  1SL0 A;  1IKY B;  2K3K A;  2OPP A;  1RWU A;  3M32 B;  3GIL A;  3M8Y A;  2CNL B;  4OI6 A;  3R8Y A;  5C7P A;  5H1S V;  1X5O A;  4D3H A;  2IVY A;  4E0D A;  2UV8 A;  4F0H A;  1RAF B;  3KHH A;  4NLU A;  2QC3 A;  2I9S A;  2ZBR A;  1OIA A;  4K59 A;  3RZA A;  4PAA A;  1H0H B;  1CC7 A;  1IWA A;  3D0H E;  2K7J A;  4LF7 J;  4P2F A;  2B9E A;  2E9Z A;  4A8Q A;  1QAJ A;  2KKH A;  2UP1 A;  4CNZ A;  2FLP A;  3QSY B;  2OFH X;  4L72 B;  1Q0N A;  2IMO A;  3RBZ A;  1T3N A;  2F4V F;  1SC3 B;  4OHV A;  3L7P A;  4IG3 B;  4FBT A;  5KFD A;  3R1L A;  1F60 B;  4CM0 A;  4M94 A;  4W92 B;  4A4J A;  2JFD A;  2M70 A;  2VQF F;  4HH0 A;  4JI3 J;  1JLF B;  3HXM A;  2E1C A;  1RWP B;  2ZH8 A;  4AQY F;  3MI7 X;  5BYR A;  3MCM A;  4JI2 J;  3SZ2 A;  3F73 A;  3M2R A;  2HHV A;  4CLK A;  1LEO A;  3PYG A;  3DHX A;  4ZVE A;  4ENO A;  1H74 A;  2LEC A;  2DD8 S;  2VBZ A;  1LXJ A;  3B6B A;  2MTL A;  5IT9 U;  1SUQ B;  2HFN A;  2C1E B;  4KH1 B;  4WCE Q;  2QYG A;  1U02 A;  2BAB A;  4DPW A;  2ZZM A;  2C3M A;  4X64 J;  3MR2 A;  4DR4 F;  1IWG A;  3PJX A;  4DUT A;  3MM5 B;  1SJQ A;  4KJI A;  4FXW A;  1CS4 A;  4O3S A;  4WF9 Q;  2HYI B;  4ES3 A;  2PFD A;  3KLI A;  3MAQ A;  1XEZ A;  1NDP A;  4PQA A;  3NEK A;  4PWW A;  4WU3 A;  5HSP A;  3ONQ A;  3JYT B;  5AXM A;  1DHM A;  5IC6 B;  2HS4 A;  4B9S A;  5F8M A;  2RUS A;  2V63 A;  5KFM A;  4Q5V A;  2DGQ A;  1M5V C;  1TKT B;  1WI6 A;  2GJF A;  1WI8 A;  3P45 B;  2GCF A;  3OBI A;  3GON A;  1FDD A;  4QWB A;  4TY8 A;  2ZH7 A;  2KU7 A;  2NXJ A;  1T05 B;  1GAO A;  1FVQ A;  5E3C A;  5J2P A;  3BGR B;  4Q43 A;  2KJV A;  2J6U A;  1REV A;  5BR8 F;  3EGZ A;  4OJ3 A;  3UCG A;  3FBE A;  2Z30 B;  1Q8B A;  4IDK B;  3R5B A;  2J0Q D;  3BSC A;  1HAR A;  3PO4 A;  3GIK A;  1TL1 B;  2CZV C;  3T41 A;  1PAE X;  1UZD A;  4WYL A;  5SZT A;  5D0H A;  5FLX Y;  3MR6 A;  2CWX A;  1AFI A;  4ANE A;  3DOK B;  1UJ5 A;  5ETM A;  2ZM6 F;  4IFY B;  2K1R B;  1X0P A;  4ZVF A;  3QAT A;  3HK2 A;  1YIJ S;  5A2Q Y;  2VD3 A;  3W62 A;  5HL7 Q;  4PQU B;  2W9B A;  1RZM A;  3WIU A;  3LAL A;  2WBM A;  2GIQ A;  4IFV A;  4ED3 A;  2M0G B;  1RU2 A;  1YJV A;  2KFY A;  2WTF A;  3JTO A;  3ZFV A;  1C4C A;  2GGP B;  4A47 A;  1LFW A;  1TP7 A;  5D4L A;  1U25 A;  1OYE A;  2JC0 A;  3UO0 A;  1D9F A;  1M0S A;  2YNF A;  2DGT A;  2PGC A;  4M5L A;  1FK9 A;  3DYA A;  2ZJQ Q;  3R1H A;  5HQ8 A;  1BQN A;  5HMW A;  1GNK A;  3Q8Q B;  4EEY A;  2FD2 A;  2XYG B;  2HW3 A;  5CXT A;  4OJ1 A;  3L4B C;  3RTV A;  1S9G A;  5J1P A;  2CFX A;  2JDJ A;  3KJV B;  1NDK A;  4QQB A;  3SV3 A;  1D9A A;  2K8G A;  2DY9 A;  1S6O A;  3LA0 A;  1EAR A;  3UDE A;  1KRP A;  3AOB A;  5CYQ A;  1U1L A;  2E5H A;  1RWX B;  3GLJ A;  5B08 A;  4HDG A;  4L74 A;  2LP4 A;  4OV6 A;  2VBW A;  1TR0 A;  1HBN B;  3R5A A;  3B4D A;  3BN4 A;  5HAO A;  3UDL A;  2DGO A;  1FCA A;  4YS2 A;  1P9Y A;  1BMQ B;  3DLK A;  1Q1K A;  1NDC A;  4LFB J;  1OS5 A;  2C3O A;  1DFD A;  4P73 A;  3W5X A;  4IH6 A;  1XMO F;  1FF2 A;  3MCS A;  2ZDO A;  1UPP A;  3J81 U;  1FKA F;  3T9Z A;  4NCB A;  1EQ0 A;  4WXW A;  1WHX A;  5FDL A;  4MJK A;  4XPE A;  3JSB A;  3GE9 A;  1VQL S;  4AXI A;  3Q8U A;  4GO7 X;  5E3Q A;  1VQO S;  4LBP A;  1NLK L;  2GHP A;  4CLL A;  4UZC A;  5KTQ A;  1NKB A;  2VQE F;  2AP6 A;  3HKW A;  3DXS X;  2UVW A;  2OHD A;  5GMD A;  3G82 A;  2NXE A;  2QYC A;  2NUU G;  2CG4 A;  2V2Q A;  2B6A A;  3O1L A;  1MN9 A;  4IQM A;  3RJM B;  5JXS A;  3U1N A;  2VA3 A;  3TYT A;  3ZNJ 1;  2VKZ G;  1H72 C;  1R27 B;  2ZVI A;  2H54 B;  4EWT A;  4K50 A;  3TUJ C;  1EET A;  4FP9 A;  2A2C A;  4WYW A;  5IV4 A;  1WF1 A;  2E5I A;  2Z2M A;  2NS1 B;  2ZE2 B;  3H2U B;  4LVO P;  1T9U A;  3PCO B;  2RT3 A;  1RT2 A;  3NLC A;  4TXS A;  3CJK B;  2AJQ A;  3PX4 A;  1PG5 B;  3W9I A;  3CCR S;  3NRB A;  2KM8 C;  3DLE A;  1FRM A;  2GW8 A;  1HNI A;  1HMV B;  1WEZ A;  1HPZ A;  2GIF A;  3DFE A;  2HGL A;  1K1S A;  1YJU A;  4S0M A;  5J2Q A;  5KG1 A;  1FA0 A;  3ENQ A;  1NSQ A;  4ZHR B;  1UVL A;  4KGM A;  4AFF A;  3MFI A;  3CUN A;  4UQT A;  1WSR A;  3DMJ B;  2FZC B;  3KK3 B;  2PA8 D;  4DF8 A;  4USJ C;  3TZY A;  4B08 A;  2J0X A;  4C0H A;  2DJW A;  2DNQ A;  3HVR A;  2XLI A;  1N5S A;  3O8W A;  1KBR A;  4NEZ A;  3PHT A;  3MEG A;  2JH3 A;  3LWL A;  2ZJR Q;  1NHK L;  4H4K A;  1KS2 A;  2HFS A;  4MK7 A;  1HR0 J;  4DFJ A;  5EWG A;  1EB0 A;  3HM9 A;  2EFV A;  4KPY A;  2FZK B;  4K0K F;  5CD4 A;  2ROE A;  4U8V A;  4PG7 A;  1H38 A;  4IH7 A;  2HHQ A;  5KFV A;  2V0N A;  2LCW A;  9RUB A;  2WON A;  2UVU A;  1AB8 A;  2RRA A;  3UR3 C;  1NEE A;  4HKQ A;  2UUA F;  2EFO A;  4YME A;  1PC5 A;  3CED A;  1FHT A;  2BAN B;  4BC9 A;  5DG8 A;  3DHW C;  1AFJ A;  1AXQ A;  4CT9 A;  3HVA A;  1V5V A;  2O5D A;  4DCJ B;  3GCW P;  5HLF A;  3LW5 C;  2HND A;  3H7H B;  4B3M F;  3QID A;  1S1X B;  4DV1 F;  3Q89 A;  1F1B B;  5ETT A;  1U4B A;  3DOL A;  4OJH A;  1EAY C;  4NYP A;  1JXL A;  2Y0B B;  4NA2 A;  3OR1 A;  3EIC A;  3W9H A;  3Q2S C;  3H2V E;  3CJS A;  2PMZ D;  1IR2 A;  1VRT B;  3QT8 A;  5EWE A;  4XDC A;  2JEI A;  5A8K A;  4TU8 A;  3JSR A;  4O3O A;  5E3P A;  2R2R A;  1KVI A;  2WVC A;  3Q8P B;  1UVI A;  3VTI A;  4JI6 J;  2SXL A;  3R2D J;  1YDL A;  5C42 A;  3MPD A;  4USW A;  1F0X A;  4X4V A;  5A6P A;  1VIX A;  1SI9 A;  2QA1 A;  1U24 A;  3O6Q A;  3P49 B;  2BA9 A;  1UMJ A;  3PKM A;  3W5Y A;  2JVR A;  1FRL A;  2QL9 B;  4OZN A;  1RTH B;  4LFA F;  1J27 A;  1PBU A;  3D2W A;  5HAT A;  3US5 A;  1UKU A;  1XIQ A;  2EPI A;  2VJV A;  5DGA A;  3R5C A;  3AXM A;  1K9M T;  4DV3 J;  1FNO A;  5GAE I;  2YNG B;  2QGF B;  3FC9 A;  4OMF G;  4B3T J;  2BJ8 A;  3C8Y A;  3PFO A;  2LQJ A;  3IAM 9;  4CLP A;  2B5J A;  3IS9 B;  4DV6 F;  2OIH A;  4AT1 B;  2IC3 B;  3MPW A;  4ZP7 A;  1R89 A;  1RKJ A;  1TMJ A;  4P9S A;  2JOQ A;  1CLF A;  1TL3 A;  4DU8 A;  3NOG A;  4Y6I A;  4M5D B;  4L76 A;  1BQM A;  4NLS A;  2ROP A;  1GTE A;  2OEL A;  4PXE A;  4LF4 F;  2V68 A;  4B3R F;  2V6A A;  3ULH A;  4X65 F;  2EC0 A;  1MWQ A;  3H5S A;  3PG9 A;  1S0O A;  2F9D A;  3N5F A;  3WQP A;  1CQN A;  3GFH A;  4F0M A;  4YQW A;  1T7P A;  4Q8E A;  2XY5 A;  3DOM B;  4OX6 A;  1GMW D;  4Q7A A;  3MAA B;  4DV2 J;  3LP0 A;  4DHV A;  1IKW A;  2HSE B;  2W9A A;  2XI3 A;  1UP1 A;  1GXU A;  2ZBQ A;  3BKF A;  4DCO B;  1EP4 B;  1HW9 A;  1FRX A;  2XO6 A;  4YFU A;  2VDI A;  1FXD A;  2DIT A;  3EPI A;  1U8S A;  5A2Q U;  2KXF A;  2OO4 A;  3O44 A;  3GYX B;  1RHR B;  4A8K A;  5L1J A;  3SCK E;  5GAE U;  3ZTO A;  2JNJ A;  4WKY A;  4ECW A;  3QGP A;  4YR3 A;  4DZD A;  1H7W A;  1QVG R;  1QSY A;  2UXC F;  4C0B A;  3G6V A;  4RNH A;  3W8G A;  1HBO B;  4F3O A;  3MM7 B;  5LM7 E;  5KG2 A;  2BUN A;  1J5E J;  3I4H X;  1HQE B;  2AYE A;  1U1Q A;  1KEK A;  4TNO A;  3HJV A;  5M2R A;  5L1L A;  3MD3 A;  5HBM B;  4U7U D;  2CPX A;  1RWK B;  1SJ1 A;  1OO0 B;  1MWZ A;  1LXN A;  5D8H B;  4C8Y A;  3ZTP A;  1LWE B;  2AHO B;  3M30 A;  3BRE A;  4E98 A;  1IBM F;  5A8R B;  2V4J B;  2EWH A;  3I0R A;  1RAO A;  1AW0 A;  4U7U K;  1MRO B;  3CSK A;  1RAG B;  3IR6 B;  2EXU A;  1U6F A;  3FCV A;  4G1P A;  4DQS A;  1UVJ A;  4MTP A;  5D15 A;  4M63 A;  2BAC A;  3RW6 A;  2KJW A;  1FNM A;  3RBD A;  1B7Y B;  1X9W A;  4CH7 A;  1P9Q C;  4HI1 A;  3NCR A;  3W60 A;  2I6W A;  4GMK A;  1J5O B;  1TMM A;  3JSM A;  2ZH3 A;  3UVJ A;  3M9N B;  4UUW A;  3VQT A;  3SYZ A;  2OEJ A;  4C0O C;  3G6X A;  1MWY A;  1YLX A;  2DHG A;  3EX7 B;  1URN A;  4ZN3 A;  3CCZ A;  4LF1 A;  2DEJ A;  4JUZ A;  2ZJP Q;  1FES A;  3KG4 A;  2ZNZ A;  2F4V J;  4QR0 A;  4BCA A;  2R7V A;  4ZPC A;  3NBP A;  2HHU A;  3UW1 A;  1S7I A;  3RW7 A;  3AH6 A;  1LK5 A;  4B3O B;  3P6Y C;  4Q0B B;  3AOA A;  2H9Z A;  2VQF J;  2V34 A;  5I3Q A;  2LXU A;  2YX1 A;  3BJY A;  1CJU B;  4AQY J;  4PWU A;  2MKI A;  3EGW B;  3SQG A;  4RW6 B;  3PR4 A;  3IRX B;  3GFY A;  5IM0 B;  1QE1 A;  3HP6 A;  1JLQ A;  3OUY A;  2RU9 A;  4DBQ A;  3M1V A;  1FKP A;  2B9X A;  3SMZ A;  4ETZ A;  1R8A A;  1QSS A;  1E6Y A;  2HS0 A;  1TEL A;  4L75 A;  3DRS B;  1VRU B;  2R42 A;  5THW A;  1U49 A;  3I87 A;  4RBT A;  1X9S A;  4ILL A;  1TKX A;  4DR4 J;  3K8V A;  2DIV A;  3J7A 1;  1KTQ A;  5D3G B;  2CQP A;  4CI0 B;  3HT3 A;  5H9E K;  3NS6 A;  2E5L F;  2LEB A;  2XMV A;  1Q78 A;  2IYI A;  1TAQ A;  1FRH A;  1KQS R;  1XWL A;  5E0O A;  1RUS A;  2MEW A;  3SI8 A;  1S99 A;  1U6Z A;  4I6Y A;  2DGX A;  4B02 A;  3NGU A;  3FSY A;  3UNY A;  2ACY A;  3MGJ A;  1Q7Y T;  1U0S A;  3CDE A;  3TAN A;  4FF4 A;  1QJH A;  3DRR B;  4WE1 A;  1S6P B;  4DV4 F;  3WZ0 A;  4EZ6 A;  1PYO B;  3D67 A;  3C19 A;  4PXD A;  3IG1 B;  4QPX A;  4KO0 B;  2W1B A;  3ELH A;  3KK1 B;  1OPZ A;  4YB6 A;  1NK5 A;  1JNZ B;  3QGG A;  3HFZ B;  1G2E A;  2MKS A;  1RGV A;  2NXC A;  2X1G A;  5BR8 J;  2A10 A;  2AJ2 A;  1V3R A;  2EFP A;  3ZZO A;  2QMX A;  2VG6 B;  3PJ9 A;  2HFV A;  3AT1 B;  3CIM A;  4IR9 A;  3TVY A;  1RB0 A;  1VI7 A;  3OHA A;  1CBK A;  2HRU A;  3OFH A;  4X4S A;  2VG5 A;  5D4N A;  5DZ7 A;  1VJQ A;  2MZT A;  2R8H A;  2QEX S;  2ZM6 J;  2V2K A;  1LWF B;  2YVS A;  3C16 B;  1L3V A;  1U26 A;  3WHI A;  2AU0 A;  3SSQ A;  1NPP A;  1X4C A;  4NL5 A;  1UPM B;  3VAG A;  4ZVQ B;  3X1L B;  4QIE A;  2XC9 A;  1Y4Z B;  4N76 A;  4ZIW A;  1C1C B;  2DR8 A;  2NSB A;  2ADB A;  2RS2 A;  1L3S A;  1YHQ S;  1S10 A;  1D3W A;  2K06 A;  2JEJ A;  4XPC A;  4Y3C A;  4KFB A;  2CJX B;  3GFX A;  1TUV A;  1L3U A;  4WKR A;  3PW5 A;  1U0H B;  2VL1 A;  2DO4 A;  4N47 A;  4J9R A;  2NRE A;  2VFU A;  3CO0 P;  2O01 C;  4H4M A;  4AND A;  5HQM A;  5K14 B;  1G1X A;  3HF5 A;  3IMQ J;  4WBF A;  2PDA A;  5J1N A;  5G0R B;  1SV5 B;  3TA1 A;  2MKC A;  2RRN A;  2L48 A;  3PNI A;  4LBI A;  3MUR P;  1JXE A;  4CH1 A;  2GNK A;  5AE3 A;  1IM4 A;  2BX6 A;  5LJ3 Y;  2Q43 A;  2CRL A;  3M2V B;  1SH2 A;  1G3O A;  2FJB B;  4Y2C A;  1GX6 A;  1W2B R;  4J9L A;  4UZB A;  1U09 A;  2G13 A;  1YJW S;  4Y2A A;  2QLW A;  4OFZ A;  2MZS A;  4HH1 A;  3D6M B;  3AB2 B;  4LIW A;  1XMO J;  1Q16 B;  1FI4 A;  5EX0 A;  1NPK A;  3KJN B;  2G1D A;  1H2U X;  1XQI A;  5D0R A;  2NR0 A;  2XGP A;  1FFG B;  2DKO B;  3POT B;  1A0O B;  2W4P A;  3QQC D;  4IOC Q;  3CNQ P;  4U8Y A;  3MMC B;  3KG0 A;  2G4B A;  2VQE J;  2YNH B;  3CJ8 A;  2KDO A;  1C0U A;  4KKO B;  2MZR A;  1O6X A;  4OI0 A;  1IUJ A;  1V5I B;  3BQ0 A;  4AL5 A;  1XC9 A;  1WHV A;  2MZJ A;  3GIJ A;  2WOM A;  2HQ3 A;  1PSD A;  1WTF A;  2IM1 A;  2IRU A;  1RT7 B;  1NME B;  2K3I A;  4PXB A;  5CQG A;  1T3O A;  3TOQ A;  3E3X A;  5KFF A;  2WSE C;  3M6U A;  1I5O B;  3UWT A;  3U02 A;  4FNH A;  4FS1 A;  4RX6 A;  4ALZ A;  2GQQ A;  1PJ7 A;  1TTH B;  2XMT A;  4DPX A;  2BVZ A;  4O3P A;  4GRS A;  4DR3 F;  1UVM A;  2RHS B;  3BO4 A;  1RLD A;  1VQP S;  3NWR A;  1ZM4 A;  3CJT A;  2Q79 A;  4CO4 A;  3GR1 A;  1GX5 A;  3AJD A;  3G96 A;  1OJ4 A;  1D1U A;  4H4K C;  4PPZ A;  2HHH F;  2OTL S;  2DRD A;  5C24 B;  4PWD B;  1JXV A;  3G2X A;  1TZ0 A;  5IS2 A;  5KFU A;  3MWB A;  3IXQ A;  1F3V A;  4ED8 A;  2BYC A;  3MMA A;  4J9S A;  2DEI A;  2WVE A;  1LWC B;  3G6E S;  1S1W B;  1NO8 A;  4O4G A;  4MFB B;  4UUX A;  2CPH A;  2HWI A;  4DS4 A;  2IPO B;  2CVE A;  4NOH A;  5KFI A;  1FXR A;  2QX0 A;  2MDA A;  4CYU A;  1M5K C;  4J7C A;  4ECU A;  1XTZ A;  1GXT A;  3C15 A;  4R5P B;  4O0N A;  1YKW A;  2LMI A;  1F2G A;  3T5K A;  2VZ9 A;  5L8R C;  2IVF B;  1RCX B;  2AQ4 A;  2OTJ S;  4ILM A;  3PV8 A;  4K0K J;  4NLT A;  1X5S A;  1JLB A;  1BE4 A;  2C2K B;  2P9G A;  2QJ3 A;  2O1P A;  2DH9 A;  4OX7 A;  2BV3 A;  4P7V A;  3KLH A;  4OV1 A;  3NS7 B;  2Z2Y B;  4UST A;  3BH7 B;  3OD2 A;  1SIZ A;  5IFM A;  3V81 A;  4C8N A;  2V50 A;  2AJ4 A;  1TUG B;  2IM0 A;  3T1Y F;  1JLG B;  1RAD B;  1N52 B;  2HVD A;  3I9Z A;  4FF1 A;  1UW9 A;  4RL1 A;  2HWH A;  2ZDP A;  4EBE A;  3R27 A;  1S6U A;  3HX9 A;  2UUA J;  4HHH A;  4CT8 A;  3DLB A;  5KOX A;  3NL0 A;  2NXU A;  1RAH B;  4FYV B;  2DTJ A;  4O3Q A;  1WJ9 A;  2FC9 A;  1ZH5 A;  4RWW A;  1VQY A;  4B3M J;  1Y9O A;  2UVV A;  4DL6 A;  4Q2L A;  5AXN A;  4DV1 J;  5B0F A;  3QFH A;  3UFC X;  3W2W A;  5KOW A;  2ASL A;  1Q82 T;  3LTO A;  2DGW A;  5L1K A;  2F63 A;  3QNW B;  5HVH A;  2MXY A;  2CDR B;  4A8S A;  4HTI A;  5F8H A;  1VJW A;  3IWX A;  1DQ9 A;  3MPY A;  3CT9 A;  1NK0 A;  2AZ3 A;  1VCT A;  1WKJ A;  4ELU A;  3FMW A;  2Y1I A;  1NCL A;  4U67 Q;  1JJH A;  2KRB A;  2QRR A;  3GMG A;  1U1M A;  3D3B J;  2HNY A;  1T03 A;  4LRD A;  3BPS P;  3KLE A;  1ITP A;  4URG A;  3EGN A;  4RNN A;  2XY6 A;  2DT9 A;  3W5Z A;  2N4D A;  1BWE A;  4DLG A;  3LGM A;  3ISN D;  4RNO A;  3K5N A;  3PW7 A;  4V19 X;  2DXD A;  2X1F A;  4YEA A;  4LFA J;  2DGV A;  2HHW A;  2OD6 A;  3D0I E;  1FD8 A;  1LWX A;  1VHF A;  2IYG A;  3CIZ A;  1EQM A;  1RT3 A;  3FFI B;  2KVQ E;  4ID8 A;  2XQC A;  5KFN A;  1QAY A;  2VPW B;  5L46 A;  3CDU A;  4NLY A;  4RU2 A;  2QV6 A;  3K5M A;  2V4R A;  3DI6 A;  4DV6 J;  4ZPD A;  4I6W A;  1B0T A;  1YX2 A;  1RAJ A;  5LMN F;  3B82 A;  4AXJ A;  4A8X A;  4N8O A;  4QIV A;  5MAO A;  5LSL A;  1N4L A;  3PDN A;  2C2N A;  3ZXW A;  4LF4 J;  4X62 F;  4B3R J;  4FZV A;  1QE1 B;  2WW8 A;  3EZO A;  4X65 J;  5CZX A;  4AL7 A;  2CAJ A;  1HI0 P;  3BGO P;  2UUW A;  1E6V B;  3CME S;  2JC1 A;  1YJ9 S;  3THP A;  2CZ9 A;  3ETM A;  3LP2 A;  1X8D A;  5CCL A;  1O0P A;  1Q8K A;  5HQL A;  3NGD A;  4C8M A;  4RU9 A;  2BJ7 A;  3NGS A;  2M52 A;  3IC1 A;  3NNC A;  3LPE A;  3PW4 A;  3H4D A;  2J9E A;  2PEB A;  2ZFH A;  1CJT B;  3OSN A;  1Y5L B;  3DLJ A;  2AGQ A;  2ZVS A;  4J9K A;  2GVZ A;  4LF6 F;  1JQG A;  3G86 A;  3EVW A;  3DDN A;  4WWS A;  2W9C A;  2XM3 A;  2MPU A;  2E7X A;  3CDA A;  1RBA A;  2OPQ B;  2R7U A;  3MM8 B;  1RAC B;  4P7T A;  4L3K A;  2GFF A;  1S9F A;  4KGV B;  2B4V A;  3NCP A;  2A1B A;  3WX8 A;  1FVS A;  3GB0 A;  1FEH A;  3N0V A;  5J1E B;  5A8W B;  2UXC J;  3FK4 A;  4XTT A;  2KFN A;  4LRF A;  4I64 A;  1HBM B;  5CAB A;  1FDN A;  2FLL A;  2EVZ A;  2Y1R I;  2DNZ A;  5BYS A;  4MAK A;  4RNM A;  2FJE B;  1AT1 B;  2COL A;  5ETO A;  3VAI A;  2CJB A;  2VV5 A;  1R8P A;  1RAE B;  5EWF A;  3RRH A;  1FKO A;  4U95 A;  2QFJ A;  5IC4 B;  1OQ6 A;  1X4B A;  3CD6 S;  4IKA A;  1UW4 A;  1PGZ A;  2OPS B;  4I0W A;  2ZD1 B;  1M5P C;  3G71 S;  3C6U A;  2ADC A;  1KR4 A;  3HVT B;  4XK8 C;  3NY0 A;  1IBM J;  3QO9 B;  2DVI A;  1KON A;  3KLG A;  5HP1 A;  1RXO B;  4KB7 A;  5KFP A;  4LT6 A;  4XO0 A;  3DDI A;  4WFX A;  1HYS A;  5HN0 A;  2EFG A;  3HSG A;  4NXM F;  2HZA A;  1LFP A;  1RJJ A;  2CNK B;  3S1T A;  3R3T A;  3UQS A;  3D9B A;  3CCE S;  5IWA F;  4QBU A;  4QU7 A;  3QGI A;  1RT5 A;  3UDC A;  4HL9 A;  1D8Z A;  1S48 A;  1RTD A;  1YGY A;  4BWJ A;  4Q2M A;  4N41 A;  4EBC A;  1VQK S;  4C4W A;  2KZM A;  1KLM A;  3MUT P;  4FVC A;  3MHY A;  2VIH A;  3RB4 A;  3VZI A;  4I2P A;  1FWP A;  3QJJ A;  3QJP A;  1H2V Z;  3M8P A;  3BSN A;  1VBY A;  1DLO A;  2YKM B;  2Y8W A;  3N4W A;  1IKX A;  3H42 A;  4C97 A;  1YBU A;  4WTY A;  1XNR F;  3LUY A;  3FBB A;  3OTE A;  1D9D A;  1ACM B;  5HRO A;  2RF2 B;  4RW8 B;  2IVM A;  2YX4 A;  4URQ U;  4OLO A;  2BM0 A;  1SQG A;  4V19 J;  5A0Y A;  4ID5 B;  2LQ5 A;  4PG8 A;  5KFE A;  3LP1 A;  4TU9 A;  4CLY A;  1JNR B;  4A8F A;  2IA0 A;  1GMW A;  3MED B;  5DZ6 A;  4ZJQ A;  1Y11 A;  3KDN A;  1N33 F;  2HNZ A;  4ES1 A;  2Y8Y A;  3MTK A;  3D54 A;  3DGV A;  1VQ5 S;  1JLC A;  3W2V B;  1S0M A;  4LSL A;  1JKH A;  2GJI A;  2W2M P;  3OTO F;  2YWK A;  3C2P A;  2M8D B;  3EDR B;  5CA5 A;  4Y34 A;  4EO8 A;  4OYO A;  2E5L J;  3V2U C;  3W64 A;  2IHR 1;  4NLV A;  3TQE A;  2WVB A;  4NLO A;  4ZCM A;  4QW9 A;  1N5Q A;  3OFG A;  1KLN A;  2VG7 B;  4MYT A;  1FDB A;  3OJS A;  5KFA A;  1R0B G;  1HA1 A;  1KVJ A;  4RJV A;  2IIH A;  3P8B B;  1B64 A;  3TUI C;  1R6Y A;  1TL4 A;  5K8P A;  5DET A;  5E3A A;  4DV4 J;  4OHW A;  2EI5 A;  5IZH A;  5EN1 A;  4XDD A;  2MQL A;  1Z2L A;  1JLE B;  1AZS A;  2JX2 A;  4OYP A;  2HZV A;  1NBE B;  5I42 B;  2RUG A;  1U48 A;  3R6G B;  2D1C A;  1KNZ A;  2F1F A;  1H7X A;  4KYZ A;  4HLB A;  3GV8 B;  1VK8 A;  3BBB A;  4NE9 C;  4N8N A;  4C11 B;  1RTJ A;  1SB6 A;  5AE1 A;  3R9L A;  1PBA A;  4FYW B;  3ET6 A;  2QA2 A;  4X4R A;  1RT4 B;  4ZA1 A;  2WK4 A;  3VCD A;  1WTB A;  1JB0 C;  1UWB B;  2HWT A;  2YKN A;  4OYZ A;  2WHO A;  3SDE A;  2HVE A;  5IV3 A;  1VQ8 S;  3QZ7 A;  4DR6 F;  3HHL A;  1DTT B;  1B0V A;  2C3P A;  1YSJ A;  4P10 A;  5F8N A;  1R0C B;  3M2U A;  2DYA A;  4BBY A;  1KHW A;  3BQ1 A;  1WHW A;  1ZM2 A;  4G1I A;  4O4G B;  4QIG A;  4BC7 A;  2W7P A;  3BYR A;  5JVG Q;  1RWN B;  2G0I A;  3IAS 9;  2ALZ A;  4Q44 A;  2AX1 A;  3PR5 B;  2JJ4 D;  5J2N B;  1Z2Z A;  4CNY A;  4RW9 B;  1WSV A;  4EUV A;  1NB2 A;  1ZS6 A;  1CEZ A;  4ERD A;  2XCA A;  1RQ0 A;  2RQK A;  3CD5 A;  4EGL A;  2OPR B;  1T9T A;  3E01 A;  3BO2 A;  3AD9 C;  2XLK A;  2J9D E;  4NLD A;  4OHX A;  3FSX A;  1KSP A;  2P9C A;  2BE7 D;  5D78 A;  1VK3 A;  3KDO A;  5CYM A;  3UE2 A;  3VVT A;  2ZEJ A;  4OYI A;  2XHC A;  2CJ9 A;  4ZVP B;  4DL7 A;  3VQS A;  4K4S A;  1W7W A;  3BGF A;  4H54 A;  2BXJ A;  4NI2 A;  2J6S A;  2IRY A;  2MQM A;  3TP2 A;  2MQQ A;  2RIL A;  1TQL A;  3O3L A;  4OL8 A;  2E44 A;  5DLF A;  3K8W A;  2M5Y A;  1T02 A;  2V2Z A;  3EYZ A;  3MMB B;  1AA1 B;  5JMN A;  4PCQ A;  5G4D A;  4DG1 A;  2J7W A;  1SH0 A;  1GQE A;  3DRY A;  5KFC A;  1S79 A;  5JVH Q;  1SIW B;  5E7O B;  7FDR A;  3R7N B;  1P8G A;  1VQ9 S;  2FHM A;  1BUX A;  3AJ2 A;  2E66 A;  1F9H A;  2NYH A;  1KHV A;  2NCK L;  2N4C A;  3D1Q A;  3CPW R;  1YI2 S;  3GJT B;  4NLX A;  4DLE A;  4NZ6 A;  4CTA A;  1A9N B;  2CQ4 A;  4R8U A;  1H73 A;  1YTY A;  2D3Z A;  4B9T A;  4JI5 F;  3DLL Q;  1CJK A;  2BJD A;  4CM2 A;  3W3S A;  1ZTT A;  3RR7 A;  1TV6 B;  1HWK A;  2QO3 A;  2W4D A;  2GAG C;  2BZ2 A;  2XMJ A;  3MXH P;  3HCX A;  2E5G A;  2HLT A;  1R0A A;  3EJM A;  4PUO B;  1VIS A;  4UTG A;  4Y2M A;  2A0F B;  5CD4 H;  4NLR A;  2ACM A;  4K4W A;  2P6T A;  2M8H A;  4J9M A;  4NPO A;  3HFK A;  3BQ2 A;  2MST A;  2MJU A;  2V8P A;  3QIP B;  3A8J A;  4G1Q A;  4DR3 J;  2KXN B;  1N6Q A;  3D6T B;  5KAK A;  2AT1 B;  5ETS A;  5F8J A;  2ZH5 A;  2I5J A;  4X4O A;  3FVY A;  3D68 A; 
#chains in the Genus database with same CATH homology
 2H48 B;  1GFW B;  2HBY B;  3QNW B;  3GJQ B;  2CNK B;  2QL9 B;  4ZVQ B;  2H65 B;  2QLB B;  3D6M B;  2CDR B;  3R6G B;  4DCJ B;  3GJT B;  2CNO B;  1RWW B;  3SIP B;  2H54 B;  1ICE B;  2H4Y B;  4DCO B;  1RWX B;  2C2K B;  2HBQ B;  2QL7 B;  3KJF B;  3KJN B;  4ZVT B;  2C2O B;  1SC3 B;  1PYO B;  1RHQ B;  2XZD B;  3GJR B;  4ZVP B;  3RJM B;  2DKO B;  3GJS B;  4DCP B;  5IC6 B;  1QDU B;  3NS7 B;  1F9E B;  2CJX B;  1BMQ B;  1RHR B;  3IBC B;  2Y0B B;  3D6H B;  1RE1 B;  3R6L B;  1RWM B;  1RWO B;  2XYH B;  3EDR B;  1RHU B;  3D6F B;  1SC4 B;  4ZVU B;  5K20 B;  1RWP B;  2H51 B;  3EDQ B;  1QTN B;  2FQQ B;  2CJY B;  3KJQ B;  3P45 B;  2C2Z B;  1RHM B;  3R7S B;  2C2M B;  1IBC B;  5IC4 B;  1RWV B;  3P4U B;  2CNL B;  1PAU B;  2H4W B;  2XYG B;  2QLJ B;  1SC1 B;  1RHK B;  2H5J B;  3IBF B;  4ZVO B;  1RHJ B;  2QL5 B;  2Y1L B;  2XYP B;  1RWN B;  3R7B B;  1I3O B;  1NME B;  2HBZ B;  2H5I B;  2QLF B;  4ZVR B;  4ZVS B;  1I51 B;  2C1E B;  2XZT B;  1RWK B;  4LSZ B;  4JB8 B;  2HBR B;  2P2C B;  3R7N B;  3R5J B;  2CNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...