2OIHA

Hepatitis delta virus gemonic ribozyme precursor with c75u mutation and bound to monovalent cation tl+
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural roles of monovalent cations in the HDV ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
molecule keywords HDV ribozyme
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oihA00
3VAJA 1X4FA 1OIAA 3CUNA 2KXNB 2OIHA 2QFJA 3BO4A 3N9UC 2D3OR 5DDOC 2DNLA 2YWKA 1P27B 2F3JA 5CXTA 5DDPC 4TU7A 2MZ1A 1O0PA 1VQMS 1VBZA 3Q2SC 2CQIA 2N82B 1YTYA 5EN1A 1NU4A 2DNMA 1JJ2R 1VQ6S 1VQ5S 4IO9Q 2HGLA 2CQ3A 1JJ4A 2MKCA 1JMTA 3JB9k 3MI7X 3UCUP 4OZ0A 3G9CA 1X4DA 1UAWA 2M0GB 2J0SD 3P5TL 2XB2D 3VF0B 3TP2A 3VAFA 3NS6A 3ZZYA 4ED5A 2ERRA 1WI6A 2XS7A 2F9JA 2KVIA 2J8AA 3VAGA 3MD1A 1M5PC 1VQ9S 1H2VZ 3MURP 2KHCA 1KC8T 2CQ4A 4WF9Q 2XS2A 1FXLA 1VQPS 2YKAA 2YTCA 4WFNQ 3CCVS 2AYMA 1UP1A 1CVJA 2LXIA 2DGOA 1FHTA 1QVFR 3VAHA 3LPYA 4TU9A 1SXLA 2DNYA 1HD0A 2MJUA 2DGVA 2MGZB 4CH0S 2DH7A 5HL7Q 2GHPA 2I2YA 2E5JA 3THTA 2FC9A 1G2EA 2FPHX 3THPA 1U1QA 3B4DA 2XS5A 2J76E 2MY7A 2DNPA 2CPIA 2DNQA 3SDEB 4WCEQ 2ZJRQ 2MSSA 2RS8A 1X4GA 3D2WA 1UFWA 2DISA 1VQKS 2FC8A 1R8HA 2SXLA 1M1KT 2MQPA 2MB0B 5GMKa 5JVHQ 1PGZA 3CXCR 1OWXA 3VAMA 3S7RA 2NLWA 5ITHA 5DDRC 3BO2A 2N3OA 2MZQA 1M5OC 1DBDA 2RUGA 1X4AA 2L08A 4QU6A 2KU7A 1ZH5A 2MSTA 2PE8A 3US5A 1DZ5A 2CPYA 2X1BA 2X1GA 1SJ4P 1WHXA 3NS5A 2HZCA 2KI2A 2MZJA 2Q79A 2QA4S 3Q2TC 2RQCA 1VQNS 2HYIB 1M5VC 2DGUA 4CH1A 1NO8A 1AUDA 2K8GA 2DGSA 4Z2XA 3R27A 2ZJQQ 2OJ3A 3R1HA 4F02A 2DGQA 3G96A 2MHNA 2A3JA 3FEYB 1WELA 2HGNA 1VBXA 2MQOA 2DITA 3UWTA 2M8DB 2CPFA 2MZSA 2YH0A 1VC0A 2GO9A 2DNKA 2DHXA 3UD4P 2RRAA 2CQCA 3CF5Q 3U1MA 2G4BA 1SJFA 2K3KA 1KQSR 4LMZA 2LECA 1BY9A 2RQ4A 3ZZZA 3UE2A 3NNHA 4A8XA 5JVGQ 2DIUA 2LA4A 1VBYA 2LYVA 2M2BA 2VONA 2I38A 3CCRS 2XSFA 4W90B 2KRBA 1H2TZ 1WEZA 4F25A 5GAGU 2DNOA 2DGTA 3SDEA 2LEBA 1X0FA 1SJ3P 1N8RT 4CQ1A 2VODA 4J5OA 2KT5A 3H2UB 1HA1A 4IUFA 1N88A 3MD3A 4QU7A 2M88A 3MOJB 2UP1A 3H2VE 1M5KC 3K0JA 1URNA 5IM0B 2CJKA 1FT8A 3CCMS 2DGWA 2VOOA 5CYJA 2EVZA 2EK6A 1S79A 1U1PA 2RVJA 2ADBA 3P3DA 4UQTA 4F26A 4CIOA 1U6FA 3NNAA 3ULHA 1U6BA 2RRBA 2PEHA 1Q81T 4QPTA 3G6ES 1A7GE 2CQPA 1YHQS 4FXVA 4P6QA 4YUDA 2MXYA 5IM0A 2O3DA 3CTRA 1RKJA 1WF0A 2KG0A 3CCLS 3S6EA 2MQMA 1W2BR 4V19X 2RT3A 3S01A 2DK2A 3CCUS 5LSLA 3HHNB 2JVRA 4LJMA 2DHAA 2NZ4A 2AD9A 3DXBA 4PRFA 2DNGA 2M9KA 2N7CA 2L41A 1WHVA 4TU8A 5GVQA 3R1LA 2MPUA 1YJWS 2DNRA 2MQLA 2E44A 3MXHP 1IQTA 5GAEU 1H2UX 1SJRA 1HL6A 3MUTP 1FNXH 1X5PA 4WKRA 1FJEB 4W92B 5LSOA 2MZRA 4YB1P 4RU2A 2JVOA 3HI9A 3J7YU 2KM8B 2N3LA 2D9PA 1QM9A 4FXWA 2LQ5A 1U1OA 2EK1A 2CPZA 2DNZA 2VOPA 2KYXA 2LA6A 5IFMA 3CMES 1WG1A 1Q7YT 1FJ7A 3MUMP 1VC6A 3NNCA 4PR6A 2U1AA 2CQ0A 3P6YC 2E5HA 1KOHA 2DNNA 2M52A 3IRWP 3MDFA 1NJIT 4TLQA 2MQQA 5GADU 3TO8A 2QEXS 2CQ1A 1SJQA 2LKZA 3G4SS 5DETA 1OO0B 5H1SV 1X5TA 5LXYA 2CQHA 1VQOS 2V94A 4OZ1A 1K8AT 2F9DA 2LCWA 2AYEA 2KM8C 1U2FA 3UD3P 2D9OA 4QQBA 3PIPQ 4C7QA 1WG5A 2XNQA 2KRRA 3CCQS 1RK8A 2MKSA 5IQQA 4ERDA 1N52B 3NMRA 4LIRA 1F9FA 1X5SA 3VAIA 2ADCA 4WIIA 3CC2S 1YI2S 2G1DA 3G8TA 2KXHA 1KD1T 3CCSS 1B7FA 5DM7Q 1D8ZA 5LJ3Y 1WTBA 3UCGA 2CQBA 1JJHA 2CPJA 2M8HA 2MQNA 2ZJPQ 3RW7A 5BJRA 1P1TA 2FHOB 4Y00A 3SMZA 1DRZA 2OTLS 2CQDA 1X4HA 2DH8A 3TYTA 3V4MA 2DO4A 3CULA 2DHGA 3CC4S 2MY8A 3I56S 2AYBA 4Y0FA 2KG1A 1VQLS 3G8SA 2MGZA 5DM6Q 2MKIA 2OSQA 2DB1A 4YOEA 4M5DB 2G0CA 5HO4A 3CD6S 2JWNA 2MZTA 2CQGA 3BO3A 2LMIA 4ZKAA 1A9NB 2MKJA 2MMYA 1VQ7S 2CPDA 3LQVA 2DH9A 3CCJS 1FJCA 2XNRA 5D78A 4IOAQ 1K9MT 1K73T 3CMAS 2HGMA 1VQ4S 1VQ8S 3FEXB 1Q86T 2M70A 4UY8T 3P49B 1U1MA 2DNHA 4U67Q 1XN9A 5D77A 1WF2A 3BS9A 1WEYA 2JRSA 3I55S 3CPWR 1YIJS 2JX2A 3EGNA 1DHMA 1U1NA 1YJNS 2BOPA 2M4MA 1OPIA 1X4CA 2MYFA 3DLLQ 2KN4A 4EGLA 2RNEA 5GAHU 5FJ4A 2E5GA 1YJ9S 2M7SA 1FO1A 1X4EA 3VAKA 5CA5A 3B4MA 2OTJS 2DHSA 2HVZA 3CC7S 4C0OC 3MUVP 4PKDB 3BEGB 1H6KX 4IOCQ 1S72S 2U2FA 1WWHA 3UCZP 2MJNA 1U1RA 1X4BA 1KOOA 2CPHA 1WEXA 1U1KA 2LEAA 1X5OA 4C4WA 2E5IA 3SXLA 1QVGR 1WHYA 5LJ5Y 3PIOQ 1UW4A 2FY1A 4WFBQ 2AYGA 3OW2R 1VC5A 2DIVA 2CPEA 4WFAQ 3EGZA 1WG4A 2RS2A 2CQ2A 3J7ZT 2KXFA 2YH1A 3S8SA 1YWXA 2MKHA 2KH9A 1M90T 1U1LA 3L3CA 1ZZFA 2WBRA 2X1FA 2J0QD 2OSRA 2RU3A 1WF1A 3RW6A 1WI8A 2B0GA 3EX7B 1Q82T 2KFYA 5MLCV 1ZZNA 4BS2A 2DGXA 1WHWA 5DDQC 1D9AA 2MKKA 2LXUA 1PO6A 3CCES 3U1LA 1YITS 1L3KA 3G71S 2DO0A 2L9WA 2BZ2A 5LXRA 3VALA 3IWNC 2CPXA 1N54B 1HD1A 2X1AA 1R8PA
chains in the Genus database with same CATH superfamily
4DDFA 3PHEA 1BQNA 1VLOA 4IRDA 1RE1B 2GNKA 2OIHA 3BO4A 5B7WA 5KFAA 3E3XA 3EPGA 3EE3A 2DNLA 2YWKA 1P27B 4DF4A 3OXLA 4IDKA 1XERA 3HO1A 1N5VA 2F3JA 2EFQA 4ZVUB 5DDPC 1GFWB 4TU7A 4B3MF 4OL8A 1GH8A 3GYGA 3KLGB 5D6GA 1HYSB 2B51A 2YKMB 1WTFA 4ID5A 2B6AA 2HHQA 2CQIA 1FDNA 2DR6A 1U45A 2AV5A 2APOA 2DNMA 1SKSA 1RJJA 5E3QA 2IMWP 1RUSA 2ALZA 3Q8SB 4F67A 4UQGA 4PG5A 1VQ5S 3QRRA 1I94F 4YQWA 4DR2F 2RKIA 4DN9A 2BACA 1D3WA 5KG6A 1JJ4A 2LU1A 2MKCA 2IC3A 4OZLA 3MAHA 3JB9k 2WVFA 2UXDJ 2J7WA 4XDCA 4YB6A 1MWYA 3AOCA 1KLMA 4I4BA 4NLRA 4WU3A 3QNWB 2VH7A 4LSNA 2XB2D 2PN6A 2E5LF 3W65A 5J2PB 1IR0A 3NKYA 3ZTOA 4CO5A 3BSNA 2R8GA 2HMIA 1WI6A 1M1GA 3BSOA 3B8HA 3CJTA 3DRRA 3TANA 1H2VZ 3IBCB 3MURP 2FVSA 4LF6F 2R7XA 1KFDA 4RBTA 4L72B 1CJTB 3GP9A 5A8WA 1KC8T 5B0DA 2Y0SD 5D3GB 2AJQA 5KFFA 4DN0A 2VPZB 4B3SF 3SEOA 1C0UB 1SB6A 2XULA 2YKAA 4ES3A 3DLHA 2HIQA 4HT7A 5FD1A 3IC1A 3CCVS 4B17A 3QGIA 1UP1A 2FLNA 1PJ6A 1SH0A 2XYHB 2CNKB 2XYGB 4TYAA 3R8YA 3WC0A 5KT4A 2YNFA 2ZITA 1VRQC 1C2PA 2BM1A 1F5BA 1ICEB 2DJWA 3DU6A 2RKIB 5L1LA 4JI1J 1FNOA 4HACA 1BWEA 1G7CB 1FDAA 3SCJE 2V63A 4KV8A 4OI1A 4WXWA 4J9PA 1FE4A 1J5EJ 2DGVA 2FQQB 2ZH9A 1N34F 4JV1A 3OR2B 4I7FB 2F7VA 3BGRB 3J80Y 5E3RA 1HMVB 5HL7Q 2GAGC 2V9WA 3NGKA 1LOUA 2BW2A 1PYTA 2XG8A 3D0HE 1IKXA 4I1TA 3ZXWA 2V4JB 5KFQA 3OLAA 1HI0P 4LSZB 5ETRA 1VMBA 2O66A 1NZAA 2Z2YB 1NAQA 4K5RA 2HMIB 2J0SD 1TV6A 2C22A 3OFHA 2MY7A 1J5EF 1U2RA 1GTEA 2W9CA 3CJKA 2DPJA 2HRUA 5FLXY 3JAMU 3V4IA 4WCEQ 3M8QB 2ZJRQ 1O51A 1OYDA 4X2BA 4CT8A 1NK7A 1YRUA 3KUHA 4MK9A 1RWVB 4UF4A 2UUTA 4F0MA 3AA9A 2C3MA 2VL1A 2ROPA 3P5BP 5KFTA 4I2QA 4R0EA 3QQCD 3PO5A 1F9EB 5DO2A 1T9VA 2B43A 2FC8A 2XMTA 4HL9A 4OZ3A 3UD5A 2BJ8A 2JC1A 3M2RB 3TEGA 5A8RB 3LUYA 5I4MA 3FJ2A 1SUQA 3MEDA 5JVHQ 1PGZA 2HFOA 1V5VA 2GVZB 4X4QA 2HK3A 3C15A 2K06A 4RZRA 2DXDA 2D3UA 3C8YA 3D68A 3DFEA 1J27A 3S7RA 3VAMA 3PTWA 1L3SA 2CG8A 3OTCA 4C8ZA 3CD0A 3MR5A 5KT7A 3SV3A 4RW4B 2B8PA 2MZQA 3BSCA 1QLNA 2UXDF 2R8KA 5CCLA 1DBDA 3IWXA 3LP1A 1VK8A 4ELVA 4QU6A 2E9TA 2JEIA 2D1CA 4M1KA 5IV3A 3US5A 2AIRB 1JXVA 3MCMA 4FPRA 3SSQA 2ZH1A 3CDUA 5IS2A 2V5HG 3NBPB 2X1BA 3PXGa 5F9LA 4DSEA 2BKPA 2X1GA 1SJ4P 1HPZB 3GONA 2IC3B 2O67A 4JV2A 3BR9A 2KI2A 1RP5A 4P72A 2B9YA 4CCHA 3LA0A 4J9KA 2OEJA 3L4BC 1RBOB 4L73A 2H54B 4QIGA 3LP2B 4UTGA 1CJKB 2FHMA 3JSMB 1LQ9A 4ECXA 1VQNS 1XNRJ 1RWXB 3SIPB 1IJEB 3BPDA 1AUDA 2DGSA 2VBWA 4JI2F 5KFWA 3M9NB 1APSA 5EWFA 5L1JA 2ZD1B 3HHLB 5KG7A 1ZTWA 1MWZA 1FWLA 2OJ3A 1C0TB 3K5PA 1XMQJ 4P74A 3G96A 2A3JA 3BBBA 4DG1A 3TUZC 1Q7LB 2F8HA 3BDEA 2FDNA 3CCTA 1VBXA 2DR7A 1SC4B 4ZP9A 5K14A 2DITA 2QMWA 3O6QA 3UWTA 2CPFA 2MZSA 2YH0A 4JI4F 1IVZA 1C4AA 5HVHA 3BH7B 2GO9A 3CCZA 4K59A 1B0VA 3DRPA 3ET6A 2GJFA 4M95A 3MMJA 1S1UA 2KJWA 2DD8S 4FYWB 3DOMA 4QW8A 2QO3A 3WDOA 2ZM6J 4ECSA 1F5AA 2QLBB 4WP3A 2CQCA 1YKWA 4O3QA 4JI3F 2NYHA 3CGIA 1FDDA 2B3TB 3HVTA 3W8PA 3QJLA 1LW2B 4K7QA 5CYQB 2ZOFA 1UVJA 3T5KA 3OTDA 1HW8A 1HPZA 4KV8B 2Y8YA 2G1HA 4R0JA 1C1CA 2FJXA 1BY9A 3OL6A 5B0FA 2C42A 1DJ0A 2XTJP 3BGRA 3UE2A 3NNHA 2DIUA 4JOUA 3EDQB 2UVUA 2M2BA 1TK0A 3U7JA 1RA7A 4LFBF 1RKIA 3IG1B 3Q8UA 3BQ1A 3MM9B 2PGCA 4ZN3A 3BGFA 4W90B 3DGPA 3VR1A 1EARA 5SZTA 3H40A 2JC0A 3FMWA 4OLPA 2QLWA 1GXUA 4CZCA 2B4PA 2PC6A 3KHHA 1N8RT 3C46A 3Q0AA 4NYOA 1TTHB 3W5XA 2ZH7A 5CQGA 1OQ6A 3MD3A 2WSEC 2UXBF 3GLJA 2FVPA 1LWCB 4TQRA 5CZVA 4Y2KA 1NJZA 5IOLA 2L9DA 1RACB 1EAYC 1WKKA 2IYGA 1M5KC 3JYTA 3PR5B 5ETMA 3SZ2A 5IM0B 4P2SA 2CJKA 3CCMS 5E33A 2VOOA 1B7YB 3N6MA 4UUXA 2W7PA 4DUYF 1ZTTA 5ETSA 3TAMA 2EC2A 2EK6A 1S79A 3LOUA 4OHWA 2RVJA 2X3DA 2XMKA 3IWLA 4OX8A 4WTOB 3MFHA 3ZZUA 2BABA 4DV6F 3NNAA 1QY7A 5DLGA 3M4XA 1XJWB 3VVUA 2RRBA 4DUZF 1WD6A 2PEHA 4J37A 2FGCA 3MCSA 1UVMA 4O4RA 5L8RC 3G6ES 4AQYJ 4ZVGA 1RT6B 1U25A 4H54A 3IR5B 2IDEA 4DFMA 2QL7B 2MXYA 1FVQA 3EXYA 2O3DA 4LVOP 1LNQA 3UI3A 2MKYA 4U8YA 4IH6A 4M8LA 2RF2B 3CJ3A 2R7WA 1RKJA 3KLHB 1X0PA 2AJFE 3M30B 3WZ0A 1NK0A 3AJ2A 4JI8F 1CJUB 3OR1A 1UPMB 2V0NA 1D8YA 3WIVA 1GMWD 2RT3A 2Z58B 4IH5A 3OVSA 5LSLA 1RTHA 1HBUB 2F63A 4CLWA 1T9UA 3ZNUA 2K3IA 2A10A 3HHNB 2QRRA 2GA7A 5AE2A 1S9EA 5B0BA 2XEXA 3GFZA 1HARA 3IFEA 5AJ3J 3PJWA 2NZ4A 3M6XA 3VQTA 4DR6F 3IM9A 4DQQA 3DXBA 1AROP 1XQIA 4M5HA 4PRFA 2WBMA 1KVIA 5LM7E 4DV3F 4DX8H 2N7CA 1LXNA 4DL0C 1RI7A 2CZVC 4A47A 4UZBA 3MFIA 4DPWA 2MQLA 2J6SA 2CXEA 2YNGA 2H48B 4RW6A 4KPYA 2VFVA 2Z4PA 4QWDA 1TELA 3D5MA 3I6PA 5KG0A 3MUTP 3WHIA 1AXQA 3P4UB 4FYXB 3LGHA 1ZM3A 4KFBB 3OSNA 2ZVIA 4C48A 3K57A 5I3QA 1AFJA 1Y00A 3CJ5A 4Q5VA 1CS4A 1YDLA 2DXFA 3K17A 4TLRA 2FVRA 1DURA 1H7WA 2OGUA 2AZ1A 1KWMA 4OYOA 1IBLF 3CJ2A 2J0XA 4A8KA 3IXQA 4A8QA 2D9PA 2E29A 4OYBA 4HKQA 4G1PA 1SH3A 1XIQA 2LQ9A 2FJAB 2RB7A 1S0OA 1AFIA 1RAGB 2EK1A 2FVQA 4J91A 4D3HA 3QIDA 3M6WA 2HQIA 1P6TA 2VV5A 2CWXA 3NRBA 5HBMA 2VOPA 2GIFA 2LA6A 5L9XA 1WOOA 2J9CA 4GO5X 3CMES 1RAAB 1XTZA 6FDRA 3FDSA 2VQFJ 4WYWA 3E51A 5BYQA 3GR0A 3MUMP 1PBAA 2PEBA 4QIVA 4Y28C 4ZPDA 4URGA 5K20B 5F8MA 2ASLA 2PA8D 1N5SA 4WWSA 1NJYA 4OV6A 1NZ8A 2GHVC 1F3VA 3P6YC 1JNZB 3OVAA 4ED7A 5T7LA 3IRWP 1RTDB 1XWLA 4NOHA 3D6MB 4U95A 2MQQA 4DL7A 2L3MA 3DOKA 3TO8A 1BQMA 1TV6B 4U9RA 4DV7F 1MW7A 3G4SS 5DETA 4NA1A 4EBDA 2I9SA 3FKBA 4LUBA 5IT9U 1GMVA 4U96A 1X5TA 4CM2A 4ZVFA 2CQHA 1VQOS 1RA6A 4FF3A 2UU9F 3GIIA 3RZAA 3I0SA 1KRPA 2AYEA 4ELUA 3VGTA 1FRMA 4N41A 5A8KA 3H90A 1WG5A 1S6QA 5A8RA 4LRFA 4F7VA 3MCOA 2YWFA 2ZC3A 1SUQB 1N52B 2R2SA 4DQIA 4LIRA 1F9FA 5F8GA 1X5SA 3GWCA 3HVWA 4NYPA 4CNZA 2I6WA 4CLPA 2ADCA 1D9DA 1Q53A 1UVLA 3QFWA 4RNFA 4ZPTR 3SQOP 1KD1T 3M9MB 3WC2A 3PX4A 2IM2A 1LWFB 1S6UA 5GAGI 1XMQF 2IM1A 1IM6A 4J7CA 4RWXA 3ZO7A 3QIPA 2M8HA 2CPJA 2XI3A 3LP1B 2K7JA 5BXIA 5ADZA 5HQMA 1B0PA 2FJEB 3C6UB 5BJRA 3MHYA 4I6WA 3NGTA 4DSIA 3KG0A 1NDPA 4ZPWR 3MECA 2W9BB 1H98A 1HIYA 2CQDA 4NLTA 1HHTP 4AXIA 3FBEA 2NYIA 1VRTB 3MMBA 2LFVA 2EFPA 4MMOA 1TR0A 2VBXA 4AUKA 1DAXA 3I56S 4LT6A 3RB4A 4ID5B 3VGSA 4EYIB 2JLGA 2ZUGA 4PWUA 2YNHB 3GJQB 1IKVA 2HNDA 4OYPA 2OPPB 2MKIA 1BGXT 2DB1A 1OJ4A 3AT1B 3D3BJ 4C8MA 5LOQA 1V3ZA 2RIJA 2AEJA 4ZHRA 2ZHBA 4PEOA 3A8EA 1OYEA 2CQGA 2MZTA 3EJMA 2C3OA 3G86A 2YWEA 2LMIA 2HS0A 4NCGA 3BO3A 2BQ3A 1NK4A 3BN4A 2OPSB 4HDHA 4QWEA 5KG3A 1U47A 2FYXA 4X4PA 2PFDA 2VBZA 4NXNF 4IOAQ 1AZSB 3SSSA 5F8HA 2HNZB 1K9MT 4U6PA 1HNIA 4OLOA 2XMUA 1K73T 3MM5A 3R9LA 4JP8A 2IM0A 5KFCA 3W63A 1VQ8S 2NXEA 4LREA 2ZNZA 1RHRB 1N0UA 3FEXB 3C66A 2FB0A 3KJQB 3KMQA 2YX7A 3C16A 1DQ8A 3O3LA 3R5JB 4XDDA 4O0IA 5G4DA 4U67Q 1XN9A 3CIMA 3BS9A 4ATNA 3A8IA 3DLKB 3JTNA 1WEYA 1KQFB 3QZ8A 1T3NA 4IG3B 2GGPB 3BZQA 3H7HB 2JX2A 1S1VA 3I55S 1YIJS 2JSXA 1U1NA 3ILLA 1RWMB 1IKYA 2MQ8A 4JUZA 4MK8A 1CQMA 3D0IE 5HLFB 5C25A 1S10A 1SQEA 3DLLQ 2RNEA 4GKJJ 2GCFA 1UL3A 5GAHU 5FJ4A 4MJKA 4ZCLA 3NWRA 3EXCX 3Q8RB 2ZM6F 3RAQA 2H1YA 1KHVA 2FGOA 4OZJA 2E1AA 2YH1A 2ILYA 1FO1A 4DR3F 3I0SB 1D9FA 2ZEJA 2BUNA 4DR4J 3V6DB 2HVZA 3LF0A 2W2NP 4IYQA 4OYZA 4PKDB 4Y2IA 5C24A 3T19A 5KFSA 2E7VA 3MTKA 5DG8A 2EKNA 3DOLB 4GMKA 4DL6A 5C5JA 1NCLA 4E8UA 3N4WA 2U2FA 1UWBA 1YBAA 2QIFA 3PYDA 4F4YA 3X1LB 3GJTB 1AYEA 3QBCA 3TAMB 5HP1B 1X4BA 2XM3A 3V81B 4JV0A 2HNYB 3ISZA 1R7IA 1WEXA 1X5OA 4PABA 2E5IA 4PPZA 3RB0A 4ZJOA 2GQ2A 2ZH2A 2YNIB 1NSAA 4WXOA 1AA1B 2AZ3A 4GKKJ 1F5CA 2QA2A 2DIVA 3M2RA 5F41A 2RS2A 3J7ZT 2KXFA 3ZZOA 2W1BA 3UDVA 1YJVA 3FSXA 3VZIA 3S8SA 1ZAWA 1MWQA 3IAM9 2ZHAA 1HNZJ 5KFYA 3L3CA 1U1LA 2YXLA 3AJ1A 1ZZFA 5BYRA 2QZ8A 3BQ2A 3TARA 5D0GA 1UZDA 4EEYA 4RNHA 3M8RA 1O6XA 3ENWA 2OSRA 4F0KA 5IV4A 1KSPA 1N5YA 2J0QD 4DUYJ 1D1UA 1WF1A 4BWMA 1CJUA 1SC6A 2VHGA 2VG5A 3HDSA 3GFYA 2DGXA 1WHWA 2E1RA 5KFVA 5DDQC 1SKWA 2VFTA 3R7BB 4WU2A 4L6V3 3FQKA 2J9DA 5BR8J 2MKKA 4AL5A 1VJQA 2QMXA 2ZZTA 4NMXA 4Q2LA 1E6YB 4WK3A 4DUTA 1T05B 1PO6A 2V34A 3U1LA 2DYAA 1L3KA 1Q4RA 3PM9A 1KLNA 3C14B 3G71S 1BXNA 3RUBL 3FFIA 3NS7B 3IWNC 1CJKA 1Z1ZA 4LBIA 1WUUA 1TFWA 4ZCKA 2V2VA 1N54B 5FDLB 2AF6A 1SQFA 1GTHA 1R6YA 2E66A 3MPVA 2WVCA 1R0CB 2FHKA 4IH7A 4WBFA 4X64J 2A6OA 1R8PA 1DY3A 2R7UA 3VAJA 4MK7A 1X4FA 3V6JA 3NCQA 1OIAA 3BH6B 4F3QA 3CUNA 4U7UD 2KFNA 9ATCB 1KNZA 1T9YA 4QWAA 2UUAF 2BOAA 4P71A 1VGYA 4R5PA 4JI6F 3BPSP 2OAUA 5C7PA 1I3OB 2H5IB 1HI1A 3CCWA 3SFUA 4JV5J 1O0PA 3C15B 1VQMS 3W60A 3Q2SC 1HR0F 3MR7A 3N28A 1RTJA 2ZH8A 4ELTA 1RCOB 2HBQB 4RW8A 3C2PA 1YTYA 3GIKA 1DQAA 2BANB 2OPRB 1QSLA 2IRYA 2EKYA 2CVIA 4IO9Q 1RT3B 2D74B 2C2EA 5D4PA 3HHLD 1SQGA 2CQ3A 2DHHA 2MLYA 5IC6B 4NLWA 3PHTA 1MMNA 2F4FA 1XNQF 2G2YA 4C9DA 1T94A 1BQNB 3UCUP 2EC0A 2HHXA 1ZBTA 4O44B 3RBXA 4FP9A 5D0HA 3BR8A 5ETLA 1UAWA 4KFBA 3BQ0A 2M0GB 3GTYX 3I9ZA 3ISNC 4ZVOB 2QYGA 5AXKA 3DOKB 1Z2LA 5H9FJ 3KYLA 3VF0B 1EJ7L 1UVKA 3AA8A 4ITSA 3VAFA 1LK7A 2ERRA 2XS7A 3DC2A 4ZVSB 2XMAA 2F9JA 1UA0A 2JEJA 3VAGA 1VQ9S 2W4DA 3QSYB 2MLXA 1FTRA 2KHCA 3KJNB 2JLFA 3OD2A 3JTOA 3LWLA 4B3OA 2B4OA 2CNLB 2G2ZA 1V9OA 3LPEA 3QGHA 4QR0A 1FXLA 3B78A 4P10A 1V3SA 2L9NA 2CWKA 4DR5F 1VQPS 1FK9B 2BXJA 2K2PA 2XYPB 4WFNQ 4ED2A 3D6TB 3ZTSA 4DPUA 3SV4A 5HSPA 1TK8A 3HSZA 4CLFA 2XSJA 4NWBA 2FJDB 3AQPA 3VAHA 3KG4A 2GHWA 5F8JA 4PG8A 4DR6J 2J7UA 3CDWA 3AXMA 2Y1LB 3H5YA 3TZWA 3H8YA 4O3NA 1V5IB 3GV5B 1K1SA 4MKBA 1TMMA 1GX5A 2NXJA 2KYZA 5G0RB 2MGZB 4EFAC 1H7XA 4CH0S 2DH7A 4NEZA 5HMYA 2KZZA 2JJ4D 4XPCA 2E5JA 2BJ7A 2G13A 2CG4A 2FC9A 2P6TA 3QGPA 4NEYA 5A6WA 3THTA 1Q5VA 3KLFA 3G6XA 4NLGA 5HMZA 1QTMA 1R8AA 2RQMA 3CDEA 5E0OA 1KR4A 3B4DA 5IXUA 3KLEA 3H4DA 8AT1B 1C1BB 3I32A 3OTOJ 3L09A 3W9JA 1RZMA 1WSVA 2J76E 3UVJB 3QWPA 2Z2LA 3PEHA 2DNQA 4H4OA 3ZNJ1 2KT3A 2RS8A 3D2WA 1MLAA 2LU2A 2RDJA 2RUSA 1NK6A 1DQ9A 3WQPA 5B08A 1HLWA 3HHDA 1M1KT 1LWCA 1R8HA 2HQCA 5ETKA 4DPYA 1BC6A 5M2PA 2MB0B 3HZGA 5GMKa 3QT7A 1S9FA 1ZYQA 2H3EB 3ZTRA 1EZZB 4YFUA 3F56A 1Y11A 3MM5B 4FVMA 2CJAA 3DRRB 4DCOB 3J80U 3MPYA 4X4TA 5T14A 5H9EK 2N3OA 2PIIA 2OFHX 4K2XA 2OHDA 4KGZB 5BYSA 1X9SA 3MWBA 2V6AA 4C8NA 1FFGB 5J1EB 5CD4H 2RUGA 4KH0B 5EGYA 3PYGA 2KU7A 1RWPB 3CJKB 1ZH5A 1NSKL 2VICA 2PE8A 2AJ4A 1DZ5A 4C3KA 2CPYA 2QL9B 5K8MA 3O44A 3KLEB 1RT1B 1S1XA 1UEKA 1WHXA 3UDLA 2OPPA 1X9MA 2HSEB 2KHDA 2XI2A 2F1FA 3BBCA 1FFSB 5L1IA 2J6TA 2KO1A 4G1IA 3TR5A 3ZTPA 2QA4S 3M2UA 3TI0A 4GVBB 3TQEA 3FEZA 1M5VC 2HYIB 1G3OA 2DGUA 2CRLA 4M5LA 2K8GA 1WOSA 4ZVEA 4Z2XA 1SL1A 1DLOB 1HBMA 1RWKB 2BJ9A 1H72C 3B54A 4I7FA 4OJHA 5JXSA 5I42A 2ZKTA 1AT1B 1LW0B 2DGQA 2ZDOA 1B64A 2MHNA 3K2YA 4PXDA 3AFGA 3FEYB 2GQQA 2ASJA 1RGVA 2A6MA 4NE9C 1KONA 1Q8BA 1QD1A 2W4PA 4Y65A 2IIHA 3ZC4A 5IT0A 2MQOA 2UVRA 4X4VA 5I3UA 1QJHA 3TRGA 1I94J 3M6VA 2JEGA 1TKTA 3IS9A 4ECWA 3TX0A 3VWSA 5GAEI 1VC0A 2C2RA 1M1HA 3EGVA 3DOLA 1XMOJ 3NGSA 2QLXA 2DHXA 4IOBA 4CO1A 1JLCA 1HNWJ 2P9CA 4A8MP 2RRAA 1K0VA 2ZUAA 3R2CJ 2R2TA 1RHJB 3MEEB 2V69A 2YWHA 3U1MA 4U8VA 2FLLA 3T9NA 2DY1A 2GFFA 2JLEA 4B9VA 2G4BA 2KKHA 4GKJF 2CAJA 1HWKA 2VFUA 2JOQA 3PFEA 2LECA 3JTPA 3D4JA 2EWHA 2VD3A 1X31C 2WSFC 3MEDB 2ALYB 4BWJA 3RG6A 3ZZZA 4DR3J 3CWJA 4A8XA 1XMOF 1S77D 1EQMA 2JDJA 2VKRA 2JH3A 3ICLA 4CYUA 5IT9Y 3AB4B 1VBYA 2LYVA 1IR1A 1FKPA 3NL0A 3HFKA 4QWBA 5EHHA 3T9ZA 4N7TA 5KFKA 2VDIA 3MAQA 4C3LA 4KO0B 4OYIA 2BE9B 3OBIA 1ZETA 1XMBA 4JI2J 5GAGU 3SDEA 3V5RA 3KJVB 4ECQA 1IBLJ 4MKVA 2QYCA 3OPKA 2KJVA 2KT5A 1EETB 4HT5A 3SCKE 4IUFA 2XMMA 1N88A 2OEKA 1RHQB 2HBZB 5C2CA 1TL1A 2VU5A 1RHMB 5F9NA 2RU9A 1ACMB 2BR0A 4CP5A 1NEEA 3ZFVA 4GKKF 1RT2B 1HR0J 4OZ2A 2IRXA 4WFYA 2W25A 2YNIA 3HMJG 2EVZA 3LP0A 1Z2ZA 5HN0A 3KTQA 2NPIA 1S9GB 2Z2MA 4KSEB 1MU2B 2ADBA 1HHQA 1CULB 4LSNB 5ETVA 1XBWA 1IJFB 2EG2A 3DXSX 3M2VB 5IT4A 1N32J 5D4LA 2HS3A 3PEJA 3W2VB 4DV1F 3OXGA 2BV3A 4DQRA 7AT1B 3PFOA 1RAJA 1UJ6A 1RDRA 4QPTA 3TAPA 4LF1A 5J1EA 4LF5J 1REVA 4FNIA 4K0KJ 1YHQS 4ZS6A 3EZOA 1AB8A 2QSWA 4P6QA 4DR1J 4P7TA 2GVDA 1S4FA 2B6AB 3OV7A 1TKZA 3CTRA 4WPAA 4C3MA 5HROB 3W62A 3PYFA 1HNIB 2COLA 1GAOA 4OI4A 3OFGA 1B99A 5DLFA 4CH7A 5KFJA 4YS2A 2HHSA 4IO1A 1UMJA 3K8VA 2WCXA 4FDFA 4GVBA 5HMXA 3N6NA 4QZVB 3CCLS 1DARA 2EFNA 1ROFA 2IBOA 3BREA 4HLBA 4ZK7M 4V19X 3VTIA 3S01A 5J2PA 3VVTA 1NDKA 1REGX 2K1RA 2VPYB 4X4SA 2GMLA 1JKHA 4KKOB 4B3RJ 2XMJA 2OMOA 3CDBA 4P75A 4YR2A 4LJMA 5B0AA 4DV0F 1UEUA 4NMLA 3U02A 2RDDA 3NGUA 4O4GA 3PW7A 4G3IA 1S1VB 2AD9A 1S6PB 3QRQA 5A8WB 2M9KA 2VG7B 2PDAA 4ZOSA 3ZZTA 1S9GA 1S5ZA 2P9GA 3UQSA 1VRUB 2L41A 2Y1IA 4C8LA 4ZDNA 2PMWA 2MPUA 3MMBB 1YJWS 1WDDA 1N6QA 1TVRA 4F3OA 2E44A 3RYLA 4ILLA 5C42A 4KYZA 3EMTA 5C25B 1IQTA 1VK3A 1H2UX 4OYAA 4BLGA 4MYUA 4IRCA 4X84A 3IN5A 1X5PA 3UFCX 3O2IA 4Y6IA 2ZHOA 4USKA 3DYAB 1IBMF 2MZRA 1S0MA 4YB1P 2HQDA 3GMGA 2JVOA 4RU2A 2J8SA 3HI9A 2Y1RI 1Y9OA 1F9HA 2VUGA 3OXFA 2B4VA 3POTA 4OJ3A 2N3LA 3UN5A 2KM8B 1QM9A 5LMUJ 2WB4A 2CNOB 2WW4A 2Z2ZA 1L3VA 4URSA 2NXUA 1U1OA 1LKZA 1OSCA 2YPZA 3TAQA 3GJSB 2XLKA 9RUBA 1HBNB 2ZOMA 3UN3A 1N5QA 4FF4A 2K7KA 2KYXA 4ED8A 2HAIA 3TZZA 2JFKA 2HZAA 3A13A 1RAHB 4LBPA 3HT3A 1Q7YT 2E5LJ 1FJ7A 3OFFA 2Q1LA 1NHKL 3EZ5A 3DNCA 2YKNA 2YY3A 2V4JA 4RPFA 5CABA 1VC6A 4RUAA 3NNCA 4PR6A 1YG0A 2GZOA 4OYWA 3PRDA 2U1AA 3QAUA 2AGQA 3MAAB 4PYDA 5J1NA 4LF9J 1Y5LB 2VFSA 3NXZA 2M52A 4FKYA 4RW7A 2RH3A 4YDXA 2ZH4A 4TLQA 3V4IB 1NJIT 2POKA 3A1YG 4PXBA 4DCJB 3IM8A 2R8HA 2QEXS 3DLKA 4EK2A 2CQ1A 4X66J 2UXCF 4NI2A 2LKZA 4B3RF 5A76A 1Q95G 2CUYA 3S1TA 4KHPJ 4R8UB 4YY3J 4FN5A 2ZBPA 3DYAA 5KFIA 1J5OB 4OZ1A 5B0EA 3OHBA 1K8AT 2CVEA 1S99A 2F9DA 3A12A 1WKJA 5DQGA 4ED6A 4DS5A 3LAKA 1SL2A 3WX8A 3WX4A 2XLJA 2W8LA 2KFZA 1OQ3A 4LRCA 5L39A 3CCQS 4DL3A 3HJFA 1RK8A 1ZM4A 3GIJA 1S97A 4WZQA 2O5DA 1B0TA 1R43A 3H59A 5IQQA 4RBUA 4LF7J 4ERDA 3I5CA 1L3TA 5K5MA 3NMRA 2VC0A 2VA3A 2ZOGA 2BBEA 5BR8F 4ZMMA 3CC2S 2GX8A 1F2HA 4RR5A 1VS3A 1ELOA 2P9EA 4CTAB 2ZE2B 6FD1A 4NLPA 1XEZA 2QV6A 3G8TA 4ED3A 2YPYA 1OPZA 3O5TB 2B9WA 3CCSS 5C24B 1TUGB 2YX1A 4P52A 2UVVA 3FC9A 3GPAA 2V2KA 3JQKA 1HQEB 2ZFHA 5C2GA 2ATLA 1RXOB 4K50A 2DTJA 4M5DA 4U7CA 1TUVA 1U09A 2MQNA 4X65F 1WTBA 1PSDA 2RDIA 2FZCB 2RRNA 1NJWA 2NZCA 1UKUA 3HZEA 3IP0A 1P1TA 2FHOB 3N6LA 3K5NA 4NCBA 4ZIVA 1RAIB 1Y10A 2ROEA 4DR5J 2HG4A 1X4HA 2OD4A 2B5JB 1T03B 2DO4A 3I4HX 2DHGA 2WONB 4KH1B 3CULA 3J81j 4F4AA 3GIMA 3CB4A 2AYBA 3MR6A 4KTQA 2YKMA 5A0YB 1VQLS 4JV5F 1XNQJ 2A0FB 3BN7A 3M8PA 4IFVA 4NZ0A 4QBUA 4DR7F 2OSQA 4FS1A 4I69A 2RSQA 1ZOTA 1UVIA 5F0UA 2C3UA 1TFYA 5HO4A 5KFRA 5L38A 1H74A 2ILZA 4UY85 4NXMJ 4I67A 1EKRA 4K8RA 1S1TB 1N5TA 3DN9A 4ZKAA 4K4UA 1DFDA 4PQAA 1UVNA 2CPDA 2DVIA 2DH9A 3CNQP 1MSWD 2BA9A 1UJ5A 1FJCA 4UOCA 1HNVB 2ZWPA 2GW8A 4HH0A 4IQMA 4DHVA 3OLBA 2XNRA 5CYMA 4MKYA 1FWKA 4O23A 3NCPA 2ATCB 5AE3A 2BQUA 3W3SA 3MPWA 2DY9A 2ACMA 2W9BA 2HGMA 3DM2A 5H9FK 1VYAA 3C14A 1Q86T 4OX6A 1PG5B 3GCWP 4UY8T 4I68A 3DGPB 5CD4A 4LRAA 4P2FA 4Y2AA 1RABB 2I5JA 4OHZA 3OJUA 1EIYB 1G1XA 5D77A 5AE1A 1KDNA 1S1WA 1SPBP 2HLUA 4YB5A 2C28A 5KG5A 4G1QA 4QW9A 3ITHB 3MM6A 1HD1A 4IFYA 4M5MA 4DU8A 4DPXA 3FSIA 4M94A 4DV7J 4WFZA 2GMHA 3EZUA 2PD1A 2ZH5A 1LW0A 2ZNYA 2W24A 1Y3KA 5HVGA 4JI4J 5DQIA 3GFHA 2MYFA 1F1BB 2KN4A 3KG1A 4EGLA 4PXEA 1K1QA 5CZXA 5KFDA 1HBOA 1UPPA 2DEJA 4TY9A 3OSPA 4BCAA 1HNWF 1FX2A 1IKXB 4PPDA 5M2UA 4DF8A 4YMEA 2OMLA 2OI2A 1SL0A 3M8SA 4BDPA 4HACB 4A8SA 1RTJB 1X4EA 5RUBA 2HBRB 2B4UA 4JB8B 2C2MB 2BE2A 1PJ5A 3B4MA 2HHVA 2OTJS 4ID8A 3HF5A 4DV0J 1XNRF 2DCLA 2DR9A 3D66A 5J2MB 2N4CA 3BEGB 5HJXA 4F4KA 4IOCQ 2AW0A 3GSIA 2LLZA 2IVYA 1RAOA 4A8OA 1IKVB 2HNDB 3EM1A 3NEKA 1EKSA 1U1RA 2HIYA 1F60B 3THVA 4O44A 1KOOA 1S7IA 4EI2A 2CNNB 3J7AN 2BM0A 1CULA 2RF2A 1U1KA 2QT7A 4WTYA 4XAKA 3AAWB 1R8CA 3HD2A 4RKUC 3SXLA 2JZ5A 4RL1A 3RBEA 2L48A 3OT9A 3SCLE 4M5NA 4USMA 2NUUG 5LJ5Y 4XIUA 1JLEA 2W2PP 1AUSL 2Z56B 1R8BA 4A46A 2AYGA 5GADI 3GG0A 3OW2R 2DR5A 1I1GA 2XO7A 3EGZA 2MTLA 2CYYA 3TA0A 1YWXA 2MKHA 4JI3J 3FCHA 2VJUA 2X7IA 4NLUA 3RR7A 1KS2A 4GVLA 1VQSA 4MIAA 2VBYA 2WBRA 2VF3A 3MM8A 2X1FA 3MZIA 1ZS6A 3MM7B 5E41A 1S9EB 4RBVA 4HYKA 1WI8A 2B0GA 3EX7B 4RW4A 5KOXA 1O8BA 2KFYA 1HWJA 1ZZNA 2C2ZB 1RAFB 2K1RB 1PJ7A 4OI3A 3DDKA 4LFBJ 2HFVA 2QGFB 3P96A 2CADA 3Q89A 4NYZA 3M1VA 1IM4A 4B3TF 2LXUA 2IJRA 2HVIA 1HKAA 3LWMA 3AQOA 3CCES 1FXDA 3MEGB 2C2DA 1X9WA 1Q1KA 2D69A 5G0RA 3HSJA 5HLFA 1PKUA 4K2JA 1HNVA 2L9WA 4WK1A 5LXRA 3VALA 4ECRA 3DLBA 5GMEA 5KFGA 1G4CA 1U0SA 3GV7B 1HYSA 3K8WA 3QZ7A 2CPXA 4AL6A 5C42B 2R7OA 1WORA 3J81Y 4KAIA 1BQMB 3MTJA 4H4OB 4EBEA 2P8IA 1FESA 3DLGA 5HBMB 3LALA 3NGRA 4JI0J 3IO1A 3UVJA 1LWEA 2I5JB 3N9UC 4ETZA 2D3OR 5DDOC 4K4TA 5K14B 2BQRA 1NDLA 2MZ1A 3QT5A 4NLYA 1VR6A 4FPIA 4C11A 5KFXA 5H9EJ 1JLQA 1UWAA 2DPIA 4GRSA 2DRAA 1T05A 4NXNJ 3OL9A 3KK2A 2DEIA 1KQKA 1RU1A 1JLGA 3D6HB 2R7QA 4M5KA 2H4YB 1S6PA 2PA3A 1NU4A 1MROB 5EN1A 4JI1F 2Q43A 1HBOB 1FRIA 3J7A1 3NP5A 1H38A 4JI6J 4LF4J 2B9EA 3TNVA 2HGLA 1NHVA 1N6QB 4G6VB 3M6UA 4KHRA 5J2QA 1TK5A 1LV5A 3F73A 3KHLA 1AW0A 3MM9A 1T95A 3RU0A 4IG0B 1S57A 1JMTA 3I87A 1NNDA 1RT1A 4ICLA 2FTRA 3UW1A 4OZ0A 2X51A 5JJBA 3BV8A 3HJVA 3M7VA 4RW7B 2V4QA 3G9CA 1QTNB 2NUHA 1X7VA 3P5TL 5SUHA 3LAMA 3FQLA 2GJIA 3DHWC 3T6BA 1VRTA 4YR3A 2V2QA 4UW2A 3H4BA 5AT1B 4ED5A 3EVMA 1FA0A 2VJVA 3OFEA 4DV4F 2KVIA 3MEKA 4CI0B 3JSBA 3MMAB 3MD1A 1QSSA 2OPQA 3SQGB 3B82A 1T02A 1EETA 1SIZA 4DQPA 5A2QU 4WF9Q 2FZGB 2XS2A 3OR2A 1HBNA 1OY6A 5HANA 8ATCB 2FZKB 4J9RA 3FK4A 1NH7A 5F3ZA 2YTCA 4BBYA 3FGVA 5A6PA 2BX6A 2AYMA 3NCRA 5HJYA 2WVBA 4FYDA 3HSDA 4YB7A 1S12A 2BDPA 2LXIA 2DGOA 4V1Ak 2DKOB 1Y7PA 1OS5A 3LPYA 3DGVA 3BM7A 4TU9A 1HW9A 3HFVA 5KFEA 2P5VA 3DRSA 4USJC 5M2RA 5K8PA 3RRGA 1WDTA 1FD8A 2UXCJ 3T41A 2HWIA 1OY8A 2V8VA 3BSAA 4MFBA 3SBMA 2VFRA 3DKDA 2EFGA 4J90A 3TX8A 4LF8J 3G82B 4IR9A 2UU9J 3C16B 2NS1B 4L3NA 5IWAF 2GHPA 3UN2A 2RQKA 3TQ1A 1LFPA 4ZITA 2ACYA 2FPHX 2HVEA 3M1VB 5D0RA 2F40A 1IR2A 2GC8A 4LVNP 3THPA 3N5FA 4XTTA 1W25A 2Z8QA 3AD8C 5DZ6A 1BQXA 1UFLA 3TVKA 2GIQA 2XS5A 2C3YA 3TUJC 4F8RA 2FJWA 2GV1A 1VIOA 5D0EA 3TZYA 2DNPA 1NKBA 1TL7B 1HNZF 1VJWA 4LQ9A 4JI0F 3SDEB 2I1RA 2IJNA 2NPFA 5EUHA 4ED0A 1W26A 3TW0A 3OHAA 4WIQA 1FX4A 1RT7B 1X4GA 4WFXA 1TQLA 5DS7A 3DLGB 4RO0A 2RE1A 2GO8A 1YGYA 2DISA 3AODA 4DR2J 4OI0A 1TU0B 2E7WA 4HEA9 3D54A 2FIUA 1SJ1A 3CW2C 3QT6A 4RNMA 3NLCA 4IKAA 1BWVA 4QIFA 4TVAB 3OUYB 1VRUA 3F44A 3CXCR 4MYTA 4IR1A 1TAUA 1OWXA 3CIZA 1FRKA 2NLWA 3X3UA 1M0SA 4C11B 3JSMA 4FZVA 5DDRC 3PG9A 5LT5A 5EX3A 2V4RA 3GILA 3E2EA 1RCXB 3W2VA 1PBUA 1YJRA 2E9ZA 1NK8A 3TJ8A 1GMUA 2IPOB 4DL2A 2H9ZA 4X4UA 3L95X 1FK9A 2D3ZA 2LQ8A 1RB0A 1N33F 1W2IA 2AX0A 4JI5F 4C8KA 4GO7X 2ZH6A 3VGUA 3T1YJ 2VDHA 5ETPA 4NXMF 3RRKA 4CLTA 2YWGA 3QJPA 3NS5A 1SV5A 5HROA 2AJ2A 1JNRB 3ILJA 3PZPA 2XWYA 3G2XA 4DR4F 3QLHB 4CO2A 4DLGA 4PWDB 3H5SA 4USUA 1FJGJ 3T1HF 3D1QA 1VISA 1NO8A 4I0WA 3GG1A 2QA4G 4Y3CA 2QA1A 3L7PA 2I8EA 2QE5A 1ZPWX 4XPEA 2ZJQQ 2C3PA 4F02A 2ZZNA 4ILMA 1VOMA 4OFZA 1KN6A 3DI6B 2RILA 1N34J 2HURA 3K58A 4C6AA 5DGBA 4ECZA 4EUVA 1WELA 2BJ3A 2HGNA 3R5AA 2VIHA 2E1CA 4DSJA 3OVBA 2HBYB 3DRXA 3HX9A 3J7Z5 2M8DB 2AJ0A 1U6ZA 5KFNA 4KGVB 4NZ6A 4K4XA 3I9V9 4IRKA 4V19J 2R7RA 2H4WB 2FLOA 5F8IA 4DG1B 4DBQA 2UUBF 2YWWA 3UD4P 1S1WB 3I0RA 5J2NB 3FFIB 4CLKA 1JQGA 1NPRA 3VZHA 3AY0A 3D7SB 4JI7F 2ZD1A 3HHLA 4O3SA 2BJ1A 4USTA 5LL6d 4YP3A 4EMDA 1WC6A 3R6LB 2CJQA 2KB2A 1WC4A 1SJFA 2QLFB 1KQSR 3GCXP 3R97A 1TL3B 4I56A 4N76A 6AT1B 5AJ3F 4ZLJA 2Q6CA 1JX4A 1Q78A 1FRJA 2Y3YA 4CLUA 3RB3A 2KDOA 4CRJA 1NSQA 4QWCA 4DV2F 5A2QY 5I3PA 3HKZD 1LWFA 2VONA 1JLFB 1N32F 4L76A 3DRPB 2I38A 3DLJA 2VG5B 4CTAA 2XSFA 4K0KF 2KRBA 1NKCA 1WEZA 2EBEA 1X0FA 4F3MA 4LRDA 2YKQA 1CC7A 3MM7A 2HEKA 2LEBA 4CQ1A 3A8KA 1Q79A 2VODA 1YK9A 4J5OA 4P2MA 2AGPA 2EEYA 3QRPA 3H2UB 1HA1A 5LMNJ 2OPRA 1EP4B 3QATA 1FXRA 2UP1A 3H2VE 4F36A 3HD1A 3K0JA 1JB0C 3HFZB 4W98A 5F3TA 1URNA 1YJ7A 2Z30B 4QYZJ 1PCAA 1S4EA 1ZM2A 2DGWA 4A8WA 3T3FA 1IBMJ 4Z7CA 4ZHRB 2UUCF 3IGNA 3OQ2A 4UQTA 4F26A 3ULHA 4Q8FA 2HKEA 3Q8YA 2HRYA 3HHLC 5E3CA 1RTHB 1A7GE 4KE5A 3PR4A 4FXVA 5FIIA 3I5BA 1FVSA 1RT3A 3CD7A 3Q8VA 5IQ6A 3JYTB 2HVHA 5IM0A 3CJ8A 2LDIA 3KUGA 4ANEA 5GMDA 3GV8B 3D67A 1FF2A 3VHQA 1RYSA 1HI8A 2BKOA 2Y0BB 3HVAA 4ENOA 4DCPB 1O5JA 5J1PA 1AZSA 1WF0A 3MEEA 2KG0A 4E0DA 2G0IA 2IVMA 4PWDA 1WNEA 1DTQB 3RAMA 2MQMA 3S6EA 1W2BR 1KP6A 1QDUB 2Y8WA 5CAAA 5KOWA 2DK2A 3CCUS 2FUG9 4PZVA 3KLVA 3HVRA 3FNNA 2FHJD 2ZDPA 5LSRA 3IGVA 4CDIA 1B4SA 3HSGA 4ZIWA 3Q24A 4RU9A 2JVRA 1IKWB 5HATA 1CS4B 4CYUB 3QO9B 3M8QA 4P7VA 1FKPB 1YSJA 2ZWOA 3OTBA 5DG9A 2M3DA 3R5BA 4RWWA 4ZVQB 3MR2A 3W61A 7FD1A 1JWWA 1RHUB 2CFXA 3PX6A 4K4SA 1DTTA 3RGIA 5GVQA 3R1LA 1XC9A 4ECVA 3I31A 4EZ6A 2C2OB 1FRHA 2QTWA 4X4RA 4KY3A 2F4VJ 4O0NA 1SJRA 4NPOA 1BLUA 1HL6A 1NMEB 3PJXA 2WHOA 3HM9A 1FNXH 2GVZA 4PWWA 4O3PA 1VBKA 3HCXA 3D1HA 2R7SA 1HWLA 2HQGA 2VASA 4LR8A 5LSOA 4HTIA 4RUCA 4AFFA 2XSJB 4MT1A 3D6FB 3J7YU 4HI2A 5HP1A 4NRTA 4FXWA 1NLKL 1JXEA 3V6DA 2LQ5A 2RHQB 3ETOA 3D9BA 3PX0A 1BHNA 1DTQA 1MU2A 4FNHA 4RLEA 3ZTQA 4YY3F 2CPZA 2G0JA 5E5NA 3KLFB 5J2QB 4DXLA 3TJ9A 4ECTA 4NL5A 5IFMA 1FRLA 2FHJA 3C6TA 4DPTA 2WRMA 1PYSB 3CO0P 3KLGA 5CYMB 2IYIA 1WJ9A 4IDKB 4F4ZA 1EB0A 3HP6A 3H2LA 1K47A 1N0VC 4P9SA 4AQYF 1KFSA 2F4VF 3KK3A 4Q8EA 2HHWA 2CQ0A 3GYXB 3KNAA 1TAQA 4ZVRB 3U1NA 2E5HA 3IRXA 3UNYA 2DNNA 3MM6B 4ZPBA 4X64F 1TKDA 4LIWA 5HK4A 1N5YB 4DWIA 1FFWB 5JUMA 4ZPCA 4F04B 4GC7A 4ILRA 5GADU 4HVZA 4ZLNA 5ETQA 4JBCA 3FBFA 4F50A 1H3DA 2QSFA 3ITHA 3R7NB 5H1SV 3O8WA 3W8GA 1TL7A 1IWGA 2KTQA 1JKHB 4KKOA 3T1AA 2NR0A 2IBKA 2V94A 2XHWA 4RUBA 5JMNA 4RX6A 3TEHB 1VHIA 1E6VB 4DFJA 2LCWA 2KM8C 1QSYA 4OHYA 1U2FA 3UD3P 2D9OA 2WVDA 3ILIA 4QQBA 1N36F 2R8IA 4YN3B 3C6UA 3MPDA 3H25A 1YLXA 2MKSA 1FKAF 3KKFA 4KB7A 3G6VA 3D28A 1U2CA 3DRSB 5IWAJ 3GYNA 2NSBA 1TL5A 1F3FA 1TKTB 3IS9B 4X62J 5EWEA 3J7YI 3VAIA 1FERA 2PI5A 3M32B 2KXHA 1QE1B 1TKXA 2AHOB 3QPIA 2HW3A 4G65A 3R5DA 5DM7Q 4B08A 5K8OA 4OIXA 5EX0A 1D0EA 3IG1A 2OFGX 3R6GB 3GJRB 2CQBA 1DLOA 1IBCB 1WSRA 2EBGA 2ZC4A 2AP6A 1FD2A 3RW7A 5E2QA 2YNHA 4OJGA 4DV4J 4Z37A 3SMZA 2H51B 3TA1A 3ZZPA 1DRZA 4CWBA 3J81U 3PW0A 3T6JA 1YX2A 2ZBIA 1NB2A 3V4MA 1NB7A 2BANA 1S49A 1SV5B 4DR1F 5E7OB 2HNZA 3QIPB 5HVFA 2MY8A 1GT8A 3QLHA 5IC4B 3SCIE 2RAQA 4A48A 4Y0FA 2XCAA 2KG1A 2CIMA 4DEZA 2FY8A 3KK2B 3G8SA 1S76D 4F4WA 5DM6Q 5EWGA 2RHSB 2ZE2A 2CZ9A 3KJVA 3CD6S 2GAHC 3MM8B 4LF8F 1ZA1B 3KOAA 1A9NB 2MKJA 2MMYA 4I64A 5LMUF 1VQ7S 1HWIA 1S7HA 3LQVA 4LF2A 5U47A 2GGPA 3R5CA 1VHFA 4ZVHA 5D78A 4C8OA 3DHXA 1JK9B 4PUOB 3LGMA 1RBAA 2H5JB 3A8JA 3FBCA 3VV2B 2MEWA 4ZLPA 3HXMA 4XK8C 5D15A 4YEAA 4LFAJ 4DV3J 2HK2A 3SYZA 4C98A 3V2UC 4I2QB 4QYRA 3N79A 2UV8A 1VFJA 1HMVA 1W7WA 4PAAA 5KFZA 5IZHA 1WKLA 4Q43A 3P49B 4M5IA 1U1MA 4FBUA 3SFGA 4X62F 3W2WB 1WF2A 2XZDB 2CDQA 2FJBB 1S0NA 2XZWA 4JI8J 2PMHA 4KO0A 3M9OB 2PFFB 3FZ2A 3NOCA 1IWAA 2W9AA 1PIEA 4HI1A 2ZKUA 4E2FB 2WTFA 2W2QP 4FS2A 2W9CB 3RB6A 3DI6A 4LF7F 1RT5B 3KHRA 4DS4A 3OTEA 3R2DJ 1OPIA 1X4CA 1BUXA 2DT9A 1HNXF 4OI2A 2FLPA 3JQJA 4Y2MA 2EFVA 4QOTA 4D3GA 2OP5A 1XR6A 3N0VA 4RJVA 1MMDA 5DJBA 2E9RX 4X4NA 3LP2A 4HH1A 4MFBB 4ZPVR 2X3GA 3ONQA 3DM2B 4OV1A 3NY0A 1R3NA 3W5ZA 2BJEA 3G82A 2QN6B 3KWMA 2HAFA 2BJDA 1NRKA 1LFWA 1SKUB 1P9YA 2B8QA 3QAEA 4MAKA 5CA5A 3OL8A 4M63A 4DV6J 5J2NA 3MUVP 3CC7S 2R7VA 1RLDA 1OY9A 2VQEF 4LF4F 4FKXA 4MH8A 1H6KX 3TUIC 3DLEB 3HULA 4DJBA 5MAOA 3T1YF 2HZVA 1ZM9A 1RLCL 3W64A 1WC3A 1C0TA 1C1BA 2LVWA 3TA2A 4HHUA 1FEHA 2XCPA 1QE1A 1JLBB 1TKXB 1YBTA 1SC1B 4PCQA 2HQFA 4DL4A 1R0AA 4FXDA 2UXBJ 1QVGR 4C2MA 2LXFA 4ZP8A 1T0TV 3PIOQ 1FEEA 1VCTA 3FUYA 1UW4A 3FRZA 2FY1A 2V8DA 4WFBQ 2W8KA 3IMQJ 1VC5A 4WFAQ 2W2OP 2XHCA 2OPQB 1FRXA 3SQGA 2HNYA 1S1UB 2CJBA 4B02A 4CNYA 5KFUA 3TVYA 7FDRA 1FWPA 1GEHA 1H73A 4ANDA 2NSCA 5EDWA 4K4WA 4R25A 2VG7A 4AL7A 4KC5A 4A8YA 4EBCA 4H4MB 4KPCA 1KLMB 1D09B 4DFPA 3V81A 1T7PA 2RU3A 1JLAA 1HQUB 2KT2A 5DQHA 4NLQA 1FE0A 5MLCV 4NLXA 3A3OB 3H0PA 3RBDA 4WP8A 1P8GA 1ZPVA 1U7LA 2B56A 3AJDA 3MOZA 2YKNB 1RHKB 4LSLB 4DZDA 2V8GA 1BE4A 2VPWB 3PYEA 3F41A 4FYYB 4KRWA 4EU0A 4MTPA 5D3GA 1ZA2B 1Y4ZB 1Q16B 3NAIA 1SI9A 1HQ2A 1SCJB 1PC5A 1KHWA 4DI6A 3GU0A 3FCVA 1Q8IA 2QMUB 3HVTB 1N4LA 5KFPA 3T5HA 4UZCA 2AGOA 2WVEA 2FD2A 1FKOB 1IQZA 2IFXA 3PDNA 4KT0C 3E01B 4OMFG 3KK1B 2GS8A 4ZLLA 1JJCB 2X1AA 1RYRA 2NREA 1I5OB 2KXNB 3RRHA 1K44A 2HWHA 1Z4UA 3CEDA 5D4OA 2QFJA 2HFSA 4AD6A 2HHTA 1M5SA 3ELHA 1TL4A 1MN7A 2PO4A 4Z7YA 2XO6A 1T8EA 2HHUA 5L9NA 1V3RA 3Q8PB 5CXTA 4Y34A 3K59A 4DX6A 2QLJB 1Y5NB 1U0HB 4DSLA 1VBZA 2C1EB 4PXCA 4Q7AA 2ZVSA 2R2UA 2YQ1A 4OZNA 3I0RB 3W1YC 2ROGA 2N82B 4Y2CA 1CJTA 4CM0A 3G6YA 1JIHA 3KHGA 4C0BA 1GXTA 5AXMA 2QL5B 4RW9B 1JJ2R 1VQ6S 1PAUB 4O3RA 1J2VA 3LW5C 3LANA 4NX9A 4R8UA 1A0OB 3D1OA 1GXLA 2E1PA 2AMCB 4X65J 3CE8A 2GIRA 4LR7A 2LQBA 3T5LA 2A2CA 3KLIB 3PVXA 2HS4A 3AD7C 3KFWX 3MI7X 1X4DA 4HHHA 1PC4A 3M30A 3R5GA 5E3AA 1CPZA 3NAHA 3UNGC 5LMNF 1FKOA 4LR9A 4YR0A 3BYRA 3TP2A 3NS6A 5HAOA 1T03A 2V68A 3PACA 3ZZYA 5CH7B 3KMSA 1SKRA 5CHCB 4CO0A 3PW4A 2XZTB 1TL1B 3RR8A 5DG7A 2D3O1 2C2NA 2EPIA 2J8AA 2ASYA 3MCNA 3BF4A 2NXNA 3NOGA 1M5PC 2EG1A 2PI4A 1RT6A 1XR7A 2IHR1 4OYXA 2YQ0A 4RW6B 1ITPA 2CQ4A 3GE9A 3I82A 5B09A 4B9LA 1EP4A 1RU2A 3JS9A 3VQSA 2XMVA 4DFKA 4DX7A 1CJVB 4TY8B 4ALZA 1M5HA 4ZPAA 1BMQB 1S1TA 4LQ3A 5KFMA 3GQCA 4DV1J 5ETOA 3QT8A 1NHUA 2CJYB 4CO4A 1IKYB 4KHMA 2IRUA 1CVJA 1FTCA 2QC3A 4H4KC 2JNJA 2VA2A 3OR1B 1FHTA 1QVFR 4ICLB 2J9DE 2QX0A 1YVFA 1YRXA 5AXLA 1SXLA 2DNYA 1RWOB 5KT5A 1RTZA 5E3PA 2OLWA 4UOHA 4HDGA 4ZJQA 2IM3A 1HD0A 2IDLA 2EI5A 2MJUA 4B3OB 1Q8KA 1TKZB 2KVQE 4WKYA 4B3TJ 1Y5IB 2VQEJ 1LXJA 3C19A 2WONA 3DMJA 3I5AA 3PW5A 2I2YA 1REVB 2H65B 1G2EA 4AE5A 2R7TA 4N8OA 3Q83A 3UO0A 2OKQA 4F4XA 1CQNA 1U1QA 2XY7A 1E6VA 4LFCJ 4U7UK 4ECYA 3M05A 4ZA1A 1F2GA 3W9HA 2IAJA 4ED4A 2E7XA 3ET6B 1UFKA 2CPIA 2ZH3A 1HNXJ 4K5SA 4H4KA 4HR2A 4ZVTB 2MSSA 1NSPA 1OSDA 1HWUA 4EO8A 1CJVA 2OO4A 1UFWA 4TY8A 3E01A 4OJ1A 3L9ZA 5T7LB 1RTDA 4XO0A 1SBRA 2DRBA 1VQKS 2DRDA 2SXLA 4QCLA 1B3TA 3PY8A 3H20A 1T9XA 4WJBA 2MQPA 5THWA 3KUEA 1HHSA 2AWZA 1DTTB 4QIEA 3HLUA 5KT2A 4J9NA 3PRBA 4OHVA 4N8NA 5ITHA 1GQEA 1U0HA 4L74A 3TVZA 2JFDA 3A3NB 1L5UA 3R7SB 1IXKA 1NH8A 2CJXB 3BO2A 2MHEA 4TYBA 1RT4B 5GAHI 1M5OC 1NXIA 1S59A 3A3PB 3AB2B 3POTB 4EWTA 5KAKA 2AEFA 4ZCIA 2AU0A 1GMWA 3P45B 1X4AA 2L08A 3PJ9A 2C2KB 4C0HA 4IFYB 4DR7J 4QYZK 2MSTA 2XMWA 2O1PA 3G87A 3QYYA 1ZAXA 4C8YA 4ES1A 1YQHA 2YVSA 4MKAA 1UCNA 5KFOA 4ED1A 3L7UA 1KEKA 1RWNB 5I3UB 2A1BA 4EO6A 1NM2A 2HZCA 2MZJA 3TUPA 2Q79A 2HFZA 1RSCA 3EDRB 3ENQA 3MMCA 3OTOF 2RQCA 4BC9A 8RUCA 5KFBA 4Q0BB 1CC8A 2H5EA 4JYAJ 4CH1A 3Q2TC 1E6YA 1NUEA 1JLCB 1Q0NA 3C6TB 2V8HA 2BEFA 3R27A 4ZJLA 3MPUB 3R1HA 4FBTA 3K5OA 5KTQA 1PAEX 5AXNA 2BMBA 3K7RA 3FRYA 2O01C 3L7OA 4ER8A 5HI7A 1IN0A 2P2CB 3FCWA 4USHA 4DV2J 3QO9A 3GFXA 1S1XB 2RJZA 2PT0A 3N01A 3QSIA 4PG7A 4UUWA 3SSRA 3KJFB 3WBZA 3UR0A 4N56A 1U4BA 1HFEL 3FSYA 4DQSA 2HVDA 3DLEA 2PSZA 2DNKA 2IVFB 4EYHB 3LH2S 3QMQA 4CT9A 1X8DA 1EX8A 3TWZA 2BRLA 3BJYA 3CF5Q 3KLHA 3RAXA 3LGNA 3EYZA 2D41A 4B3MJ 4PG4A 1QUVA 1S6OA 2J7KA 3BKFA 2K3KA 1I51B 2LDYA 4DU7A 1RT5A 4LMZA 1RWWB 1UZHA 3DCAA 1WC0A 2GQCA 3HKWA 1Q5YA 3MECB 2RQ4A 3OUYA 2B9XA 1EHWA 3BB5A 2BW7A 1XR5A 5JVGQ 3H5UA 1FDBA 2VG6B 4K4VA 2LA4A 1S48A 2R9LA 1EQ0A 4B9TA 2YBVA 1XK8A 4J9QA 2OELA 3EWGA 3BGUA 2IA0A 4OX7A 3MGJA 1HQEA 2B7CB 5T41A 2RD5C 2HHHF 4KJIA 3EICA 3CCRS 1R27B 4OZ5A 3SI8A 3HT0A 4LF6J 1H2TZ 4RUHA 1GK8A 4F25A 2DNOA 2DGTA 4KGKA 2PMZD 3PV8A 3AOBA 2YKPA 2IAJB 3PCOB 4MIBA 1SJ3P 3H98A 1YJTA 1GX6A 4I2PB 1JLGB 4J9OA 3JXOA 3MEGA 2XY5A 2B5JA 2CKWA 3CJSA 1WC1A 1TZ0A 3AHPA 4JYAF 4QU7A 2M88A 2BE7D 3MOJB 2VB6A 2CZ4A 1SIWB 4KIAA 4LSLA 2EW9A 3P8BB 3NGDA 4J9MA 1R31A 1JLBA 1R0AB 2F5GA 2W01A 4ETXA 3BKUA 1FT8A 3E8OA 3IR7B 1MN9A 1UETA 2M5YA 1WC5A 4NA2A 1KTQA 5CYJA 2KL8A 4DV5J 2WB1D 3NMAA 3MR3A 1URRA 1U1PA 3CJ4A 1LWEB 4OX9F 4F0HA 1H0HB 1T3OA 3P3DA 3GB0A 1KBRA 3HHKA 2E1MC 4CIOA 4DL5A 1U6FA 1C4CA 1QAYA 2UZAA 4TQSA 1U6BA 4LF9F 5KT3A 1Q81T 3PO4A 3HK2A 2HHHJ 2G9OA 4JI5J 4ZVPB 3LP0B 2W4CA 1MROA 4Q45A 2CQPA 4YHHF 4FF2A 4Q44A 1TUWA 4LFCF 2R4FA 4K4ZA 1RADB 5HMWA 4P73A 1N56A 4DX5A 4YUDA 1ZAVA 3KXDA 1RT2A 2Q3PA 2Y1JA 1UJ4A 4K4YA 3QFHA 3BGOP 4PUOA 2KZMA 4X66F 1TVRB 1F0XA 2XBPA 3CJQA 3DU5A 4O4GB 4CLZA 1UA1A 2GJ2A 3IBFB 4TN2A 4X4OA 4Q0BA 2BKNA 3EVWA 3K89A 5ETTA 2OH2A 1YBUA 1U8WA 3I4PA 3GR1A 4IG0A 1SC3B 3BBFA 2F8MA 4NZ7A 4QR1A 2R42A 2HFUA 2AQ4A 4FVCA 1KVJA 4DUZJ 2ASDA 3M8WA 4M5JA 2DHAA 2D7SA 2VKZG 1JLFA 3CJRA 2W7AA 2DCUB 2DNGA 1P1LA 1VDHA 3KLIA 2N4DA 2DXEA 2NXCA 2Z0GA 1WHVA 2JHEA 1RISA 2UUWA 4KBIA 4PYAA 4TU8A 4ECUA 3MMAA 2DNRA 2I0XA 5CYQA 3K5LA 3ZZRA 1N36J 2MDAA 1YZ7A 1YJUA 3PKYA 3MXHP 4CLSA 1VLYA 5GAEU 4KHPF 3AD9C 2V9KA 4WKRA 1MNEA 4B9NA 3B6BA 1FJEB 4UOGA 4W92B 1FI4A 4J9UE 3RTVA 3ISND 2G2OA 4HTJA 4Q2MA 2CA9A 2BVZA 3ADAC 3UDEA 2OD6A 2ZBCA 4AT1B 2LP4A 1KVKA 2WAQD 2YKOA 2P6SA 3AOAA 1UTAA 5D8HB 2Y9HA 2XGPA 4USIA 1RBLA 5FDLA 2R8JA 1U24A 3LO3A 1X60A 4OHXA 2DNZA 4FYVB 2QJ3A 1RTIB 3W5YA 1HBMB 3DDNA 1FNMA 1YRTA 2LQJA 3MAAA 3QGGA 2JEFA 1C0UA 2UUCJ 5I42B 1WG1A 3BDPA 1NPKA 3IR6B 3W66A 1T11A 2VC1A 1S6QB 1L3UA 3M2UB 4CLLA 2J6UA 4LRBA 1N48A 4B3SJ 3IA0A 4DLEA 1A6LA 2CDRB 4RNNA 1BD6A 4UOFA 4LF5F 5F8LA 1NBEB 2QFIA 3TZXA 4J9LA 4N5SA 4WZMA 1KOHA 4NCGB 3ZZ0A 4GC6A 3UDCA 4NRUA 5K8NA 3MDFA 4NLOA 3ENVA 3QWUA 3Q22A 4HHJA 3W2WA 3BKTA 4B9UA 4OX9J 2VPXB 2YQ3A 1SJQA 4M5GA 2OEMA 4F2RA 2ZZMA 1OO0B 5DRKA 1JLAB 1HQUA 3CO9A 5LXYA 4OQJA 2Q66A 1F6TA 2F8EX 1RWUA 3Q8QB 3QJJA 3CVKA 1LW2A 3HHEA 2Q6BA 2V67A 2B7BB 4DPOA 4YHHJ 4EZ9A 1CEZA 4PQUB 1ULRA 3Q86A 4KGXB 3PIPQ 3PW2A 4C7QA 1LEOA 2XNQA 4J9VA 2KRRA 5L46A 2XLIA 3BGLA 1VI7A 3HPOA 3Q23A 1U49A 4OYMA 1J5OA 1VQYA 4WYLA 2W2MP 3FBBA 2YNFB 1YI2S 4LBHA 4WIIA 3OL7A 1HBUA 2G1DA 4NASA 4E98A 4DMZA 3ENAA 1B7FA 1R89A 3M8PB 4IFVB 3KK1A 4OI6A 1D8ZA 3NWGA 4NLDA 4BHQA 3W9IA 5LJ3Y 5L1KA 3UCGA 1RAEB 4N77A 4P2XA 1JJHA 2HHPA 1QAXA 2ZJPQ 3PRVA 3D0GE 3UR3C 5ETNA 5KG1A 4ANCA 2UUBJ 4LFAF 2NQPA 3ILOA 4Y00A 5DZ7A 3I96A 2OTLS 3GIRA 2ABYA 2AJ1A 2DH8A 2V2ZA 2AKWB 3CSKA 3DRYA 3TJAA 3TYTA 3G8QA 1MMLA 3U27A 3CC4S 2YNGB 1WACA 3FVYA 3NBPA 2WOMA 2J0WA 4KGMA 1OMSA 4BC7A 1LWXA 4ZCMA 2MGZA 4USVA 4YOEA 4IG3A 2V50A 2XWXA 4M5DB 1KKHA 4WE1A 1IUJA 2G0CA 3M32A 1CLFA 4AXJA 2JWNA 4H4MA 3BYPA 3IRXB 4N47A 1YZ6A 3M2VA 3EPIA 5A0YA 1MG7A 2AT1B 3EUNA 4G1QB 4DSFA 3CCJS 1I6JA 1RT4A 3IAS9 1TL3A 1NKEA 4AYBD 4B9SA 2VZ9A 4ZN1A 3KDNA 4ZP7A 2ZBQA 1WOPA 2XC9A 4CO3A 4L3KA 1S0VA 3CMAS 4J9SA 2UV8G 1NPPA 2AX1A 3AXKA 2GVDB 1VQ4S 1IBKF 1RTIA 1R6VA 1NJXA 4RNOA 2R2RA 1LK5A 1QAIA 3IBWA 4TKTA 2M70A 1NK9A 4A4JA 3EGWB 3MF5A 2DR8A 2HRTA 2DNHA 4ZP6A 2XY6A 1NK5A 1U02A 2UVWA 3DOMB 3F0NA 4QJVA 4F2SA 2JRSA 1UWBB 5B0CA 3EVOA 3CPWR 2JL9A 1V6HA 2WZ1A 3EGNA 3PKMA 2ZBRA 1DHMA 3LTOA 1U48A 2WOMB 3CMQA 2BRKA 5K9FA 1CSJA 1YJNS 2HQ3A 3WIUA 1CG2A 2WSCC 2M4MA 4KR0B 2BOPA 2IJFA 4L75A 2W7OA 2BE2B 1NDCA 2IY5B 2GMJA 4S0MA 4I6YA 2LEPA 3W7BA 4IQXA 1RQ0A 2E5GA 2XQCA 1YJ9S 4QR2A 3H5XA 4RW9A 2M7SA 2F65A 3N5BA 2J5AA 4I2PA 4MIWA 3VAKA 3D3CJ 5A8KB 2DBBA 1UW9A 2UUAJ 1JLEB 1KTVA 2WW8A 2DHSA 3VGVA 1IBKJ 4PQUA 4C0OC 1FJGF 3T5JA 1U26A 3CT9A 3GZ7A 1GNKA 3CD5A 3JSYA 2IA6A 4CLYA 4R5PB 2MLZA 1S72S 1G6BA 4C97A 5F8NA 1RT7A 5HQLA 2BYCA 3PNIA 1WWHA 4QIWD 4NCAA 5B0GA 1U8SA 4FF1A 3UCZP 2MJNA 1JXLA 4DOZA 2EFOA 3DDIA 3NG8A 2QG9B 2R3VA 2CPHA 1CBKA 4USWA 4C4WA 2LEAA 2VG6A 1PILA 2HWTA 2IMOA 2RMLA 2YX4A 2WK4A 3VCDA 3V6KA 3V6HA 4ES2A 3FMBA 5J2MA 3GSDA 4WP9A 1QAJA 1WHYA 3H42A 1C1CB 1UEVA 1SVDA 3T1HJ 4KQZA 5DGAA 5KFHA 3JSRA 2V8PA 1T9TA 3JQMA 4NA3A 4TXSA 1TP7A 3AH6A 2CPEA 4I6AA 2FVCA 3UPFA 3C3LA 1WG4A 5D4NA 2CQ2A 5KFLA 5KT6A 4NLVA 3JAMY 5FLXU 1Y3JA 2KH9A 1P9QC 1PYOB 3M8YA 4JI7J 1M90T 4NI2B 1FCAA 4TNOA 1R0BG 4O3OA 3M8ZA 2A18A 3ETMA 1KQGB 3RJMB 3OJSA 1N33J 2NCKL 1SH2A 4B9MA 3K5MA 2CJ9A 2A2DA 4A8FA 1IKWA 4DV5F 3RW6A 2OPSA 3RBZA 1Q82T 5KG2A 4UT4A 3A4TA 5F0WA 3CJ0A 3TOQA 4BS2A 3KDOA 1VIXA 3FZBA 2Z57B 3O1LA 4PG6A 3R3TA 4WE1B 2HPUA 2EXUA 1D9AA 5CCMA 4YDDB 1QUPA 1Q8LA 2J9EA 2HLTA 3KNGA 3KK3B 1YITS 2VQFF 4RW8B 1K0TA 2XGQA 2DO0A 3MMCB 4DSKA 3CDAA 4URQU 2BZ2A 2OUGA 4DZ6A 2FJVA 1B70B 1TMJA 3DMJB 1JLQB 1Y0HA 5HQ8A 4QPXA 2AEMA 5KG4A 2N7YA 4W4MA 4NLSA 1T9WA 2HFNA
chains in the Genus database with same CATH topology
4DDFA 3PHEA 1BQNA 4IRDA 2GNKA 2OIHA 3BO4A 5B7WA 5KFAA 3E3XA 3EPGA 2DNLA 2YWKA 1P27B 4DF4A 3OXLA 4IDKA 1XERA 3HO1A 1N5VA 2F3JA 2EFQA 5DDPC 4TU7A 4OL8A 4B3MF 1GH8A 3KLGB 5D6GA 1HYSB 2B51A 2YKMB 1WTFA 4ID5A 2B6AA 2HHQA 2CQIA 1FDNA 1U45A 2AV5A 2APOA 2DNMA 1SKSA 1RJJA 5E3QA 2IMWP 2ALZA 3Q8SB 4F67A 4UQGA 4PG5A 1VQ5S 1I94F 4YQWA 4DR2F 2RKIA 4DN9A 2BACA 1D3WA 5KG6A 1JJ4A 2LU1A 2MKCA 2IC3A 4OZLA 3MAHA 3JB9k 2J7WA 4XDCA 4YB6A 1MWYA 4I4BA 1KLMA 4WU3A 4NLRA 2VH7A 4LSNA 2XB2D 2PN6A 2E5LF 5J2PB 1IR0A 3NKYA 4CO5A 3BSNA 2R8GA 2HMIA 1WI6A 3BSOA 3B8HA 3DRRA 3TANA 1H2VZ 3MURP 4LF6F 2R7XA 1KFDA 4RBTA 4L72B 5A8WA 1KC8T 5B0DA 2Y0SD 5D3GB 2AJQA 5KFFA 4DN0A 2VPZB 4B3SF 3SEOA 1C0UB 1SB6A 2XULA 2YKAA 4ES3A 3DLHA 2HIQA 4HT7A 5FD1A 3IC1A 3CCVS 4B17A 3QGIA 1UP1A 2FLNA 1SH0A 3WC0A 4TYAA 5KT4A 2YNFA 2ZITA 1C2PA 2BM1A 1F5BA 2DJWA 3DU6A 2RKIB 5L1LA 1BWEA 1FNOA 1G7CB 1FDAA 3SCJE 4OI1A 4KV8A 4J9PA 4WXWA 1FE4A 2DGVA 2ZH9A 1N34F 4JV1A 3OR2B 4I7FB 2F7VA 3BGRB 3J80Y 5E3RA 1HMVB 5HL7Q 2V9WA 3NGKA 1LOUA 2BW2A 3D0HE 2XG8A 1IKXA 4I1TA 5KFQA 2V4JB 3OLAA 1HI0P 1VMBA 2O66A 1NZAA 4K5RA 1NAQA 2HMIB 1TV6A 2C22A 3OFHA 2MY7A 1J5EF 1U2RA 1GTEA 2W9CA 3CJKA 2DPJA 2HRUA 5FLXY 3V4IA 4WCEQ 3M8QB 2ZJRQ 1O51A 4X2BA 4CT8A 1NK7A 1YRUA 4MK9A 2UUTA 4C8LA 3AA9A 2C3MA 2VL1A 2ROPA 5KFTA 3PO5A 4I2QA 4R0EA 5DO2A 2B43A 2FC8A 2XMTA 4HL9A 5A8RB 2JC1A 3M2RB 3LUYA 5I4MA 3FJ2A 1SUQA 3MEDA 5JVHQ 1PGZA 2HFOA 4X4QA 4RZRA 2D3UA 3C8YA 3DFEA 3S7RA 3VAMA 1L3SA 4C8ZA 3OTCA 3CD0A 3MR5A 5KT7A 3SV3A 4RW4B 2MZQA 3BSCA 1QLNA 2UXDF 2R8KA 5CCLA 1DBDA 3IWXA 3LP1A 1VK8A 4ELVA 4QU6A 2E9TA 2JEIA 2D1CA 4M1KA 3US5A 4FPRA 3SSQA 2ZH1A 3CDUA 5IS2A 2V5HG 3NBPB 2X1BA 3PXGa 5F9LA 4DSEA 2X1GA 1SJ4P 1HPZB 4JV2A 2IC3B 2O67A 3BR9A 2KI2A 1RP5A 4CCHA 2B9YA 4J9KA 4QIGA 3Q2TC 3LP2B 4ECXA 1VQNS 2FHMA 3JSMB 1LQ9A 1IJEB 1AUDA 2DGSA 2VBWA 4JI2F 5KFWA 3M9NB 1APSA 5EWFA 5L1JA 2ZD1B 3HHLB 5KG7A 1ZTWA 1MWZA 2OJ3A 1C0TB 3K5PA 3G96A 2A3JA 4DG1A 3TUZC 1Q7LB 2F8HA 3BDEA 2FDNA 3CCTA 1VBXA 2DR7A 4ZP9A 5K14A 2DITA 2QMWA 3O6QA 3UWTA 2CPFA 2MZSA 2YH0A 4JI4F 1C4AA 2GO9A 3CCZA 4K59A 1B0VA 3DRPA 4M95A 3MMJA 1S1UA 2KJWA 2DD8S 3DOMA 4QW8A 2QO3A 3WDOA 4ECSA 1F5AA 2CQCA 4O3QA 4JI3F 3CGIA 1FDDA 2B3TB 3HVTA 3QJLA 1LW2B 5CYQB 1UVJA 2ZOFA 3T5KA 3OTDA 1HW8A 1HPZA 4KV8B 4R0JA 1C1CA 2FJXA 1BY9A 3OL6A 5B0FA 2C42A 1DJ0A 3BGRA 3UE2A 3NNHA 2DIUA 4JOUA 2UVUA 2M2BA 1TK0A 3U7JA 1RA7A 4LFBF 1RKIA 3IG1B 3BQ1A 3MM9B 2PGCA 3BGFA 4W90B 3DGPA 3VR1A 5SZTA 3H40A 2JC0A 3FMWA 4OLPA 2QLWA 1GXUA 4CZCA 2B4PA 2PC6A 3KHHA 1N8RT 3C46A 3Q0AA 4NYOA 2ZH7A 5CQGA 1OQ6A 3MD3A 2WSEC 2UXBF 2FVPA 1LWCB 4TQRA 5CZVA 4Y2KA 1NJZA 2L9DA 2IYGA 1M5KC 3JYTA 3PR5B 3SZ2A 5IM0B 4P2SA 2CJKA 3CCMS 5E33A 2VOOA 3N6MA 4UUXA 2W7PA 4DUYF 1ZTTA 3TAMA 4OHWA 2EK6A 1S79A 3LOUA 4OX8A 2RVJA 3IWLA 2XMKA 3MFHA 3ZZUA 2BABA 4DV6F 3NNAA 1QY7A 5DLGA 3M4XA 4DUZF 2RRBA 1WD6A 2PEHA 4J37A 2FGCA 3MCSA 1UVMA 4O4RA 5L8RC 3G6ES 4ZVGA 1RT6B 1U25A 4H54A 3IR5B 4DFMA 2MXYA 1FVQA 3EXYA 2O3DA 4LVOP 3UI3A 4IH6A 4M8LA 2RF2B 3CJ3A 2R7WA 1RKJA 3KLHB 1X0PA 2AJFE 3M30B 3WZ0A 3AJ2A 4JI8F 1D8YA 3OR1A 2V0NA 2RT3A 4IH5A 3OVSA 5LSLA 1RTHA 1HBUB 2K3IA 2A10A 3HHNB 2QRRA 2GA7A 5AE2A 1S9EA 5B0BA 2XEXA 3GFZA 1HARA 3IFEA 3PJWA 2NZ4A 3M6XA 3VQTA 4DR6F 4DQQA 3DXBA 1AROP 4PRFA 1KVIA 2WBMA 4DV3F 4DX8H 2N7CA 1LXNA 4DL0C 1RI7A 2CZVC 4A47A 3MFIA 2MQLA 2J6SA 2YNGA 4RW6A 4KPYA 2VFVA 2Z4PA 4QWDA 3I6PA 3D5MA 5KG0A 3MUTP 1AXQA 1ZM3A 4KFBB 3OSNA 3K57A 5I3QA 1AFJA 1Y00A 3CJ5A 4Q5VA 4TLRA 2FVRA 1DURA 1H7WA 1IBLF 3CJ2A 2J0XA 4A8KA 3IXQA 4A8QA 2D9PA 2E29A 4HKQA 4G1PA 1SH3A 2LQ9A 2FJAB 2RB7A 1S0OA 1AFIA 2FVQA 2EK1A 4D3HA 3QIDA 3M6WA 2HQIA 1P6TA 2VV5A 3NRBA 5HBMA 2VOPA 2LA6A 5L9XA 2J9CA 4GO5X 3CMES 1XTZA 6FDRA 3FDSA 4WYWA 3E51A 5BYQA 3GR0A 3MUMP 4QIVA 4ZPDA 4Y28C 4URGA 5F8MA 2ASLA 2PA8D 1N5SA 1NJYA 2GHVC 3P6YC 1JNZB 3OVAA 4ED7A 5T7LA 3IRWP 1RTDB 1XWLA 4NOHA 2MQQA 4DL7A 2L3MA 3DOKA 3TO8A 1BQMA 1TV6B 4U9RA 4DV7F 1MW7A 3G4SS 5DETA 4NA1A 4EBDA 2I9SA 4LUBA 1X5TA 4ZVFA 2CQHA 1VQOS 1RA6A 4FF3A 2UU9F 3GIIA 3RZAA 3I0SA 1KRPA 2AYEA 4ELUA 1FRMA 4N41A 5A8KA 1WG5A 1S6QA 5A8RA 2YWFA 2ZC3A 1SUQB 1N52B 2R2SA 4DQIA 4LIRA 1F9FA 5F8GA 1X5SA 3GWCA 3HVWA 4NYPA 4CNZA 2ADCA 1D9DA 1Q53A 1UVLA 4RNFA 4ZPTR 1KD1T 3WC2A 3M9MB 3PX4A 2IM2A 1LWFB 1S6UA 5GAGI 1XMQF 2IM1A 4RWXA 3QIPA 2M8HA 2CPJA 2XI3A 3LP1B 2K7JA 5ADZA 1B0PA 2FJEB 3C6UB 5BJRA 3MHYA 4I6WA 4DSIA 3KG0A 4ZPWR 3MECA 2W9BB 1H98A 2CQDA 4NLTA 1HHTP 4AXIA 2NYIA 1VRTB 3MMBA 4MMOA 2EFPA 1TR0A 2VBXA 4AUKA 1DAXA 3I56S 4LT6A 3RB4A 4ID5B 4EYIB 2JLGA 2ZUGA 4PWUA 2YNHB 1IKVA 2HNDA 2OPPB 2MKIA 1BGXT 2DB1A 4C8MA 1V3ZA 2RIJA 4ZHRA 2ZHBA 3A8EA 2MZTA 2CQGA 4NCGA 2BQ3A 2C3OA 3G86A 2YWEA 2LMIA 2HS0A 3BO3A 1NK4A