2OIHA

Hepatitis delta virus gemonic ribozyme precursor with c75u mutation and bound to monovalent cation tl+
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HDV ribozyme
publication title Structural roles of monovalent cations in the HDV ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oihA00
1P27B 1KQSR 2M0GB 1W2BR 2PE8A 3MI7X 3SMZA 1SJ4P 2LEAA 3CCSS 1VC6A 5LJ5Y 1DRZA 2N3LA 4YOEA 1VQ6S 5DDRC 3CPWR 5MLCV 5EN1A 1VBXA 5LXYA 5LJ3Y 1HD1A 1FJ7A 2F9JA 5LSOA 5GVQA 2LKZA 2DGTA 2DK2A 3MOJB 2MSSA 2EK1A 2DNPA 1QVGR 2XB2D 3NMRA 1KOHA 5DDPC 1X5SA 2DNRA 2CPZA 4LIRA 5D78A 4V19X 2YWKA 4Z2XA 2DHAA 2DGSA 2MB0B 4Y0FA 2L9WA 3MUMP 2DIVA 3S8SA 2AYBA 1WI8A 3VAHA 1VQKS 2I2YA 1X4FA 3DLLQ 2KG0A 2E5IA 2FHOB 2DHGA 5GAGU 3D2WA 2MMYA 1Q86T 1X4BA 2MKKA 1VQNS 2RUGA 2KHCA 2K3KA 2LECA 2HGNA 2QEXS 2X1GA 2MQNA 1WG4A 2JRSA 3NS6A 2QA4S 3CD6S 3VAIA 1YWXA 3UE2A 2PEHA 2KXFA 1Q81T 1VQMS 1U1RA 4F25A 3G8TA 4LJMA 2MQLA 2VOPA 4IO9Q 1SJQA 3UWTA 3SXLA 1VC0A 4QU7A 5IM0B 1KD1T 1M5PC 2MJUA 3MD3A 1A7GE 2RU3A 2MPUA 2MSTA 1VQ9S 4W92B 2DGOA 2CPHA 3DXBA 3UCZP 2I38A 1JJ4A 3US5A 2LYVA 3TP2A 4TU7A 1SJFA 1U2FA 2MQQA 3UD3P 2XS2A 3CMES 3TO8A 2KN4A 3FEXB 2JVRA 3VAKA 1U6FA 3G9CA 5DETA 3VF0B 1KOOA 2E5HA 1DHMA 4CIOA 2X1BA 5H1SV 5DM7Q 2XNRA 3Q2SC 2CPEA 2MZSA 1U1NA 4OZ1A 3EX7B 1WHVA 1M5OC 5DDQC 3B4DA 3CCRS 1AUDA 2DISA 3S01A 3U1MA 2G0CA 1M5VC 4U67Q 3MDFA 4F26A 2CJKA 2DO0A 2DGQA 1U1QA 1PGZA 4ZKAA 2OSQA 2F3JA 1O0PA 2DHSA 1UP1A 1X4HA 1U6BA 1YJNS 3RW6A 2E44A 1L3KA 1R8PA 4TLQA 2E5JA 2DGXA 1ZZFA 3PIPQ 3CULA 1X4CA 1HA1A 2U2FA 1H2UX 2ADBA 3PIOQ 4UQTA 2J76E 1U1KA 3IWNC 1VQOS 2DGUA 2EVZA 3CCUS 3R1LA 2G4BA 5JVGQ 1WTBA 2CQ3A 2DNGA 5D77A 5JVHQ 2MQPA 3CCVS 3P6YC 3CCQS 2M7SA 2CQBA 2V94A 1NJIT 2ZJPQ 3UD4P 1VQ7S 2MZ1A 1WF2A 3S6EA 4PKDB 2CQ2A 2D9OA 1WF0A 2VODA 2J0QD 3N9UC 2XSFA 3BEGB 3G71S 2J8AA 5GMKa 5IQQA 3P5TL 1N52B 5LXRA 2EK6A 1WEYA 2DH7A 2FC9A 1WHWA 2RS2A 1YHQS 2RQ4A 1U1OA 3BO2A 5CXTA 3IRWP 2DNYA 3CTRA 2LXIA 1N8RT 2GHPA 2WBRA 4IOAQ 2DNMA 4RU2A 1HD0A 2MZRA 1FJEB 2MHNA 4P6QA 4Y00A 2DNZA 2NZ4A 1X5OA 1WEXA 2KG1A 1ZH5A 2CQCA 2X1AA 2HZCA 5CYJA 3VAGA 2DGVA 3G6ES 4QPTA 2FPHX 1VQPS 2DNNA 3CF5Q 1X5TA 2J0SD 2B0GA 3LQVA 1FHTA 2KI2A 2OTJS 2FC8A 2VOOA 1SXLA 2MY7A 2HVZA 3NS5A 4YUDA 2ZJRQ 1VQ4S 3ULHA 4FXWA 2CQ4A 4CH0S 3H2UB 2CQGA 2U1AA 1FT8A 2K8GA 2XNQA 3J7ZT 2NLWA 2DNKA 4A8XA 2CPIA 2DO4A 4PRFA 2MQOA 2M4MA 1P1TA 4F02A 1X4DA 2KU7A 2KM8C 3H2VE 2RVJA 1SJRA 1YJWS 1SJ3P 1FXLA 2OJ3A 2G1DA 3CCES 1DBDA 2D9PA 1YIJS 1WHYA 1VQLS 2VONA 4CQ1A 3VAFA 2SXLA 2MXYA 5FJ4A 2MKCA 1WG1A 3OW2R 1OPIA 3UCUP 3NNHA 4CH1A 1K73T 1UAWA 2DNQA 3G96A 2CQPA 2MGZA 4QU6A 2DH8A 2XS5A 3NNAA 2M2BA 1RKJA 3SDEB 3THTA 1UFWA 2MKHA 4WCEQ 4OZ0A 5CA5A 2MZQA 1K9MT 2AYEA 1KC8T 2MQMA 2FY1A 3K0JA 3G4SS 3Q2TC 3CCLS 2DIUA 1PO6A 3CC4S 1ZZNA 2YH0A 5IFMA 5DM6Q 1XN9A 2MY8A 5HO4A 1OIAA 4EGLA 1VQ8S 2M88A 3SDEA 2KM8B 4J5OA 2ERRA 2KT5A 2M52A 2L08A 2OIHA 1URNA 5ITHA 1UW4A 2BZ2A 3MURP 2YTCA 1U1MA 2F9DA 3HHNB 2ADCA 3R1HA 2JWNA 1M90T 1FO1A 4C0OC 2CQDA 3CXCR 2DH9A 1FNXH 4IOCQ 2DNOA 3EGZA 2HGLA 1WHXA 1H6KX 1WELA 3BS9A 2LMIA 2CQIA 2RT3A 1G2EA 3HI9A 1QVFR 3FEYB 2DGWA 2DITA 1NO8A 2RRAA 1X4GA 4C4WA 2CQHA 2Q79A 3CCJS 4ERDA 1OWXA 1JMTA 2AYMA 1D9AA 2MKSA 2DNHA 2LQ5A 1Q7YT 2KH9A 2MZJA 3VAJA 1N88A 1JJHA 4W90B 2MYFA 2OTLS 4WF9Q 4FXVA 3J7YU 2E5GA 2N3OA 2AD9A 2RS8A 3EGNA 2UP1A 2CQ0A 2MJNA 3L3CA 3R27A 1R8HA 3P3DA 4PR6A 4YB1P 1X4AA 4LMZA 1NU4A 5GAHU 1YTYA 5DDOC 3I55S 5GAEU 1WWHA 3I56S 4TU8A 2M70A 3CC2S 1FJCA 2KXHA 3MD1A 3ZZYA 2CPXA 3UCGA 2KRRA 3CUNA 1S72S 3U1LA 2RNEA 1VQ5S 1WI6A 2M9KA 2KRBA 1VBZA 3V4MA 2QFJA 2OSRA 4ED5A 1YITS 1H2VZ 1D8ZA 1S79A 2LXUA 4IUFA 2XS7A 3ZZZA 2CQ1A 2CPFA 1A9NB 2MGZB 4QQBA 2RQCA 1U1PA 3NNCA 2DNLA 2CPJA 1X0FA 1WG5A 3MXHP 5BJRA 3S7RA 2HYIB 2L41A 2JVOA 2LA4A 4WFBQ 2A3JA 1VC5A 3MUTP 2KFYA 2YH1A 2MKJA 1U1LA 1WEZA 2AYGA 3B4MA 2ZJQQ 3CMAS 1YI2S 5GADU 2DHXA 2CPDA 2RRBA 5IM0A 1Q82T 4BS2A 3JB9k 1QM9A 4WIIA 2GO9A 4WFAQ 1M1KT 3THPA 3CCMS 2N7CA 2M8HA 4UY8T 2JX2A 1B7FA 1OO0B 3VAMA 3P49B 2BOPA 2KYXA 1IQTA 1F9FA 2YKAA 1JJ2R 2LEBA 2O3DA 4TU9A 4C7QA 3MUVP 2KXNB 3RW7A 3BO3A 2N82B 2HGMA 3G8SA 3VALA 2KVIA 5HL7Q 2DB1A 1HL6A 2MKIA 3BO4A 2LA6A 2MZTA 1BY9A 1X5PA 1N54B 1RK8A 4M5DB 5LSLA 1H2TZ 1DZ5A 4WFNQ 4WKRA 2CPYA 2X1FA 1X4EA 3LPYA 1WF1A 3TYTA 1YJ9S 2M8DB 1CVJA 2LCWA 3CC7S 1K8AT 2D3OR 1VBYA 1M5KC
chains in the Genus database with same CATH superfamily
1I51B 4PQUA 4DLEA 1TL4A 3TVYA 2N3LA 1HD1A 4WTOB 5GVQA 2E7WA 2AJFE 2DK2A 1N4LA 3UW1A 2J0XA 1SC3B 4ECUA 4LIRA 2QMXA 2E1MC 3DLEB 1Q86T 1ZTWA 1Y7PA 3LP0A 2YKMB 3UO0A 1NKEA 2ZH4A 2EI5A 1FRXA 3QO9B 4RW6A 2FHMA 3L7PA 2JEJA 2HWHA 1S9EB 4RUBA 1JWWA 1PYSB 2FJVA 3DYAB 3UI3A 1B3TA 1LWEA 2A1BA 4QR0A 2YKQA 4F7VA 2HHQA 2RU9A 3VGVA 5G0RB 4UOFA 3CMES 3VAKA 3G9CA 1KOOA 2BQ3A 3VTIA 4ELUA 3B78A 1RWVB 4ZLPA 5K8PA 3OSNA 1I1GA 3LW5C 1M5VC 2NXJA 2DGQA 4DX6A 2DHSA 5KFDA 3OTOF 3MEDA 1HBMA 1PBAA 1TMJA 3MAAA 4M1KA 4IFVA 2X3GA 1OSDA 4NLWA 3W1YC 1UVKA 3QAEA 1C0UB 2EFOA 1VQOS 3TAPA 1M1GA 3GJSB 2UUWA 5JVHQ 3E3XA 4ZP6A 2V94A 3JYTB 2RHSB 4J9RA 4ZPBA 5HMWA 3EMTA 2W7AA 2EKYA 3BO2A 1HBOB 2XSJA 4DF8A 2DNYA 5A8WA 2YNFA 3PW2A 2RKIA 1PYTA 4DR1J 1UZHA 3TVKA 3VVUA 1CQNA 3SCIE 2GGPB 3PKMA 2JOQA 3PJ9A 1F3FA 1AZSA 2YWEA 1TVRA 3BJYA 2MY7A 1FWKA 4IG0B 5J1PA 2KYZA 3BKTA 4C97A 2NXUA 1FXLA 3PR5B 2H48B 2HIYA 3W5YA 1TR0A 1A0OB 3QSIA 1HI0P 3P96A 2GMLA 3HKWA 3M9NB 1OPIA 1DARA 3L7UA 4CM0A 2DNQA 3G96A 4QU6A 3GWCA 3THTA 4B9VA 1K0VA 3A8JA 1MROB 1ZZNA 4DPUA 3Q8YA 3SIPB 4LR8A 2PFDA 4UY85 3R2CJ 2L08A 3L7OA 2FLLA 1BUXA 1TL3B 5J1NA 2KO1A 5IXUA 2N4CA 3HHNB 2JWNA 4UUWA 1Y11A 3TEGA 2V4JA 2ZKTA 2ZC3A 4TNOA 4M5LA 2WAQD 2GHVC 2Q79A 2AYMA 2YWHA 4Q7AA 1WACA 4WF9Q 3CE8A 2E5GA 2AJ0A 1YQHA 4A8WA 1UWBA 2ALYB 3MM6A 1X60A 3KHHA 4IFYA 4DPYA 1S72S 1FWPA 5CYQA 4X65F 5KFMA 4ECVA 2Y1LB 3PACA 1TAQA 3MM7B 1FJGF 3HSJA 3M1VA 3IG1A 1YITS 4DV1J 3JQKA 2LXUA 4DU7A 2Z58B 2CQ1A 2J0WA 2HVHA 1RYRA 2DNLA 2Z0GA 1VS3A 2VB6A 3OFFA 2ZM6J 2AYGA 3B4MA 3HCXA 1HQEA 4NXMJ 3CD5A 2DRDA 4WPAA 2XYGB 5LL6d 5KFEA 1OO0B 2XULA 2WHOA 5BYRA 2VFUA 2C2OB 2ZH8A 3RW7A 5T7LA 4RUAA 2R7RA 1VMBA 3G8SA 3VALA 8RUCA 1SIZA 3OQ2A 5HJYA 9ATCB 2OFHX 5F0UA 2P5VA 4DR5F 1X4EA 3I5CA 4HACB 2R7UA 4RJVA 4NLPA 2P2CB 4ICLA 1PCAA 3OHBA 4CT9A 1J5EF 3RB4A 2DCUB 3N5BA 2FVSA 3HX9A 4RR5A 4LVOP 5LSOA 2Z56B 4U95A 2EG2A 3KJQB 6FD1A 2MSSA 1Y3KA 2YWGA 4LT6A 2DNPA 4EO6A 3CCWA 1HQUA 5DDPC 2CPZA 2ROGA 3MMBA 3DN9A 2AYBA 1AA1B 6AT1B 1DTTB 5DS7A 5T41A 4EZ9A 3FRZA 4LRDA 1KFDA 5C42B 2A2CA 4JI7F 1Q95G 3PNIA 3T1YJ 2CA9A 4NA2A 1Q81T 4HHUA 1HBUA 4K2XA 4LJMA 1Q5VA 3POTA 1L3SA 4QU7A 3PFEA 1YSJA 4K59A 3QZ8A 3EICA 1WC1A 2D3UA 1RT5B 1LQ9A 2KN4A 5DETA 1R0CB 2YKNB 2EG1A 1NH7A 4ALZA 1UPPA 2CPEA 2G2YA 4O3RA 2JLEA 1PJ6A 1VRTB 1U2CA 1EETA 3CJTA 3T5LA 1ROFA 3S01A 2OHDA 5LMUF 3DC2A 1NAQA 3R9LA 3PYEA 1ZETA 2HNZB 4C11A 3PHTA 1IKWA 1JLEB 1VDHA 2Q3PA 5H9FK 1ZZFA 2OO4A 1W2IA 1XIQA 1SC6A 1ZAWA 1XEZA 4QIVA 2CQ3A 4USJC 5KFLA 1SCJB 2MQPA 3RTVA 2A6OA 1LEOA 3PO5A 3S6EA 5H9EK 3SCKE 1FVSA 4L6V3 1RTHA 2Z57B 2E1RA 1RT4A 4ZOSA 4ZVHA 1N36J 2P6TA 3FK4A 1HLWA 4DPWA 4RU9A 3EYZA 4DV4F 5DQGA 4RU2A 2MZRA 4I2QB 4U7CA 3O6QA 2WZ1A 3OSPA 4Z7CA 1QE1A 4LSNB 3NWRA 4DV7F 2DGVA 3OL9A 1VGYA 1T3NA 1S1TB 4ZVPB 3GJRB 4WP3A 3W64A 3LALA 1B0PA 4KHRA 1NHVA 3B54A 1N5YB 2CQ4A 3KHLA 3BGUA 2XMWA 3QLHB 1GK8A 2IMWP 4PZVA 1UVIA 1YBAA 3OHAA 2B8QA 1WDDA 2GJ2A 5L9NA 4X66F 4FF3A 3EM1A 2QMUB 3BH7B 3H7HB 2OEKA 4JI5F 3KLEA 3N5FA 1K73T 4CYUA 3CW2C 3G82A 2JDJA 4DQQA 2J6TA 4K50A 1S6QB 3G4SS 3BQ0A 2DT9A 2PEBA 4U6PA 2NS1B 1OIAA 5ETOA 1VQ8S 4KB7A 1LOUA 2BJ9A 2J9DA 2X7IA 3LP2A 1U09A 2YTCA 1U1MA 2F9DA 5IZHA 2FGCA 3CXCR 2D3ZA 1GH8A 1IKXB 3L9ZA 4TKTA 2CJXB 4MIWA 4C8MA 2IM1A 4NEZA 2AGPA 1S6PB 5C2CA 4DG1A 3HDSA 2LQ8A 2IPOB 3CDAA 2XWXA 3RBXA 4FYDA 4FYYB 3P8BB 7AT1B 1JX4A 2RS8A 3R27A 2PSZA 3P3DA 1NDKA 2HG4A 5GAEU 4WZQA 3NCRA 3AAWB 2M70A 1NPKA 1U0HA 1B7YB 2KZZA 3V2UC 4M5JA 3WHIA 1IWGA 4DMZA 1DLOA 2WVBA 4ILRA 1RAOA 1JLCB 1G6BA 5HLFA 4LBPA 2GVZB 5JMNA 3R5GA 3LAMA 4ZP7A 4ANEA 2CPJA 4KE5A 5KFGA 3GPAA 4NZ7A 3S7RA 1X7VA 2ACYA 1VC5A 2F8MA 2IRYA 2XMKA 3MPUB 2ZHBA 2WOMA 1TAUA 4K8RA 5J2MA 1FEEA 2J7KA 2E1PA 1RTIA 2ZUAA 4KGKA 2UUCF 4QYZK 3C14B 4X62J 4NZ6A 3V6DA 1R31A 2YKAA 2HFSA 5F9LA 2V6AA 2D7SA 2KVIA 4DS5A 1X5PA 3M30A 3AT1B 4A8KA 2P8IA 2CPYA 4WE1A 1JNRB 4DQRA 1S7HA 4ZN3A 5EWFA 3CMQA 2YNHA 1V5VA 4XAKA 4GVBA 5LJ5Y 1DRZA 4IQXA 3CPWR 3CJQA 4OLPA 4WK1A 3FKBA 3N4WA 1RDRA 2Z2MA 3PEHA 1SC4B 3RAXA 4H4MA 2DGSA 4Y0FA 1WJ9A 4KO0B 3A13A 1NXIA 4IDKA 3CCZA 1AFIA 1SB6A 2MDAA 4L3KA 5AXNA 1NK6A 2I5JB 2NYHA 4KT0C 3QAUA 1CULB 3G8TA 2VOPA 3SI8A 1U7LA 3KUHA 3OR2A 4BLGA 4XDDA 4NPOA 3M8QA 1EARA 4F2SA 1HNVB 4W92B 1LNQA 1SV5A 3NGRA 2JVRA 2ZZNA 1XWLA 4OYPA 5BYSA 4F0MA 2E5HA 4AL6A 5H1SV 2O66A 8AT1B 1YBUA 1C4CA 4LF8J 4EYHB 3FRYA 1XMOJ 2HHPA 1RTJA 3I5BA 2VZ9A 4J90A 3HMJG 4RNHA 2VDIA 1FXRA 3FQKA 5CH7B 1X4CA 1HA1A 1NH8A 3IWNC 2R7QA 4DL2A 2Z2LA 2EC2A 4ZPWR 1UA1A 2AWZA 2DNGA 3R5BA 3WQPA 1IBMJ 1A6LA 4PKDB 5KFNA 1K1QA 3JTPA 2IM2A 4USIA 4CH7A 5K5MA 2R8JA 2OPQB 2NXCA 4F2RA 3CJ4A 1RWOB 2LXIA 3GLJA 2HFOA 2B7CB 1HD0A 1Y10A 3ENQA 2MHNA 1HNWF 3HHLD 2DNZA 3D3BJ 2YNIA 1PAEX 4R0JA 3IS9B 4H4OA 4S0MA 2DCLA 3W62A 2OTJS 2DXFA 3ICLA 4O3OA 3IGNA 2IDEA 2MQOA 4F4KA 3L95X 3HULA 3GFHA 1KFSA 4HDHA 1R3NA 1WHYA 3VAFA 1TU0B 2SXLA 1W26A 4PWUA 2YNGA 3NNAA 4UW2A 4JI0J 1WOPA 2QN6B 1HIYA 1K9MT 1VJQA 4C2MA 2B43A 4RW4A 4F3MA 1KEKA 2QC3A 2UUBF 1UFKA 2DR6A 2DD8S 2MY8A 1YBTA 1G7CB 2XY7A 2BJ1A 4OYWA 5ADZA 2BZ2A 4LBIA 5F3TA 1ZA2B 2CZ9A 2IIHA 4QR1A 1DAXA 1EZZB 3FSXA 2DH9A 1FNXH 3RRKA 4IOCQ 4NI2B 4DFPA 1CJUA 3HI9A 4C8KA 2HQIA 5GAHI 3AQOA 5AT1B 4IR9A 1T8EA 1F3VA 5J2QB 4GVLA 1N88A 2PFFB 2J8SA 4Q8FA 3J7YU 2ZDOA 1AW0A 2DPJA 4LRFA 3K5NA 2HHHJ 1HW9A 4I1TA 4J9OA 5CAAA 4O44B 3D6HB 2QA4G 4YB7A 2BDPA 1Q8KA 4ZPAA 4A46A 4TU8A 3C6UA 3SSQA 4HT5A 3A3NB 1S12A 3BBCA 4ZCMA 2AX0A 3MEEB 5ETSA 5HBMA 2KRBA 1VBZA 3EXCX 1PSDA 3DLEA 2OSRA 2PIIA 2HAFA 4DSLA 1YVFA 3TZYA 2CPFA 3CD7A 4YQWA 4B9UA 1NDPA 2XBPA 2YKMA 2B6AB 1L3VA 2Z8QA 3RB6A 5SZTA 3PW5A 1R0AB 4ED1A 1S9EA 1TQLA 3DYAA 4BS2A 5C24A 2B5JA 2BE2A 4TY8B 1WOSA 3OV7A 4UY8T 3ILJA 2G13A 5CCLA 4USUA 5G0RA 3AB4B 2ZD1B 3W63A 2ZM6F 2B51A 1VIOA 3GSDA 2F4FA 5HL7Q 2DB1A 3FUYA 4X4TA 4YP3A 2Z30B 3JTNA 3KWMA 3IBWA 4RNOA 2BVZA 1UVMA 3DOLB 3K5OA 1APSA 4DR4F 3UN3A 1BXNA 2CNOB 1CJTB 1TKTB 1C0UA 3FCVA 3M8PA 4QYRA 4QIGA 3I31A 4BCAA 4E8UA 3BBFA 1YGYA 2V68A 4QZVB 3G6YA 1SH0A 2XB2D 4JV0A 2QL5B 1EB0A 5ETQA 2DHAA 3CJ3A 3DLJA 2I2YA 3DLLQ 1NSAA 1NDLA 5GAGU 4FF4A 2J9CA 2RUGA 4FYVB 1S10A 1NJXA 4NLDA 3NS6A 1RYSA 3TI0A 9RUBA 3V6KA 2XYPB 3MMAB 4MIAA 1M5HA 4HVZA 2GGPA 5IM0B 2UVVA 2BM1A 1LWFB 1A7GE 2CJQA 3TAMB 5J2NA 4EFAC 1NLKL 4PWDB 4IG0A 2ZH1A 3V81A 3IWXA 1QJHA 4YR3A 4DX8H 1ZPVA 3M8SA 1HBNB 1CSJA 1Q53A 2R7WA 5KOXA 4N77A 1FWLA 2EEYA 3QSYB 4HTJA 1HWUA 3W60A 5E0OA 5F8MA 2CJKA 1HI1A 3DRYA 4QWAA 1TELA 1UP1A 1KN6A 3AOCA 3NY0A 3T9NA 3OJSA 3W3SA 4KRWA 4OJ3A 5E5NA 2HHVA 1B99A 1U48A 2DR7A 1JLQB 1Y5LB 2LQBA 4B3RF 2HMIA 1MROA 1Y4ZB 2BANB 2PO4A 1RB0A 4I64A 5A6PA 5KT2A 5GMEA 2C1EB 4J9KA 1RCXB 2MZ1A 2F5GA 2IVFB 2VODA 3G71S 2NYIA 4ELTA 2J8AA 2C2RA 2VJVA 1GEHA 2AF6A 1TL3A 1WHWA 2VBWA 4NLQA 1SKSA 2CJAA 2JEFA 3IBFB 4DV5J 3EDRB 2F63A 2CUYA 1FE4A 3TA0A 4U8YA 2Z4PA 2KG1A 2ZNYA 4C9DA 5CYJA 1LK7A 4QPTA 3ONQA 1N36F 1NB2A 3HHLB 1JLAB 1QAJA 3PFOA 3RBZA 3CDBA 4DX5A 2JJ4D 3NS5A 3KTQA 3TJAA 3TZZA 5THWA 2GAHC 1VIXA 1PJ5A 1FTCA 2RJZA 2EWHA 4MK7A 3OUYB 3MM7A 1D9DA 2C2EA 3PZPA 3N0VA 2VPXB 3OW2R 3ILLA 3BR9A 4DL6A 1CS4B 1PIEA 2DH8A 4Y2AA 1ZM2A 2BJ8A 1RKJA 2QL7B 1FXDA 2MKHA 4G65A 5E3RA 4P7TA 4L76A 1FRHA 3C46A 3T3FA 5ETKA 3D66A 4IKAA 1BLUA 1T03B 5I4MA 5HI7A 3BSOA 2H65B 1GMWD 1AB8A 2GA7A 3G8QA 4NRTA 3EGZA 1RU1A 3BS9A 3H4BA 3GONA 4GKJF 4WWSA 1CG2A 4OYBA 2JFKA 2CQHA 4HACA 2HQFA 1JMTA 2R2TA 3MFHA 4WYLA 3CIZA 3OL8A 3BPSP 1CEZA 2GMHA 3U02A 1UW9A 4K4ZA 5KG5A 3OTBA 5GAHU 3GQCA 4TQSA 3TNVA 2VICA 1TMMA 1URRA 4DV0J 2WTFA 1MWZA 2UVUA 1IUJA 4F50A 1RT2B 4CNZA 1LWCA 4FF1A 2VV5A 5U47A 2MLYA 1N0UA 3ZFVA 4IUFA 5C42A 1SKWA 4WFXA 3R5CA 5IQ6A 1Z2ZA 3HT0A 5LM7E 5DQIA 4OX6A 1JQGA 1S76D 3GTYX 2RRBA 1Q82T 1C1BB 3IN5A 3MTJA 4NLXA 2GO9A 2N7CA 1FRJA 1T02A 1M1HA 5B0EA 4UZCA 2CDRB 4C8LA 2LEBA 4OQJA 5D4NA 3QIPB 1RT5A 4ANCA 2W4CA 4DJBA 4G1QB 2YKNA 4ZJLA 3JAMY 3A1YG 2W2NP 1WNEA 2VQFJ 3ENWA 1VRTA 1HWLA 1DZ5A 1TL7B 4X62F 2OAUA 3BGFA 1RT1B 5M2RA 4P7VA 2V2VA 3LPYA 4M8LA 2HNZA 3MI7X 3SMZA 1AT1B 1GX5A 1JLEA 5HK4A 5IC6B 1MMLA 5LXYA 3HSGA 3R97A 2DGTA 1L5UA 1DJ0A 1FDAA 5KFRA 4Z37A 3EVOA 1X5SA 4URSA 3M8WA 2OLWA 2HQDA 5IWAJ 1HR0J 2IM3A 1VQKS 4Y2MA 1NNDA 2PMWA 4L75A 1T9XA 4TY9A 4F4XA 1OQ3A 4I2QA 4JUZA 3DHXA 2HHXA 1IKVB 2KXFA 1IR0A 1U1RA 1S1VA 4LSNA 3FQLA 3SQGB 2MJUA 4MYTA 4B3MJ 2BW7A 2I38A 5DRKA 4ECXA 1N5YA 4LFBF 4I0WA 1SJFA 1SH2A 2MQQA 1U0SA 2I0XA 1R8BA 2ATLA 2CNLB 1ZAVA 5DM7Q 1FRMA 5KT7A 2MZSA 2Q43A 2Q6CA 1FRLA 4OFZA 4ZVRB 1GTEA 1M5OC 2VKRA 3HZEA 2E29A 3D67A 4I6AA 2QG9B 3CJ8A 4TLQA 4AXJA 1WD6A 1H2UX 2DRAA 3BGLA 2KFZA 1S6QA 1EKRA 3HXMA 4NA1A 4CDIA 2FJEB 4USVA 1R8CA 3GR0A 3PYFA 1TL1B 4B9LA 4O3QA 5D6GA 2FLNA 2D74B 5HROA 4OJHA 1IKXA 1EJ7L 2UUAF 4J9UE 4DV2J 1H38A 3NS7B 1AZSB 2X1AA 3GFZA 5B0FA 2QLJB 4BWMA 2EBEA 3PG9A 2B0GA 4ID5B 2QGFB 1YJRA 3I0SA 1JLBB 1JLGA 1O8BA 4WFZA 1MLAA 2HVZA 4CH0S 2UVWA 4C8YA 3W9IA 1XNRF 4RBUA 1H72C 1V3RA 4XPEA 3KMQA 3Q86A 2QT7A 3OFGA 1JLCA 4I69A 2GVZA 2GNKA 3TZWA 3CDEA 2NXNA 4NCBA 2W7PA 5IT4A 4P75A 2MZQA 5DZ7A 4CO3A 4LF1A 2DRBA 2R8HA 4NLVA 4A4JA 1IQZA 5KFKA 5DM6Q 1XN9A 2WSFC 2B7BB 2M88A 3GCXP 2HFZA 1U4BA 1PYOB 2RAQA 3CO0P 4JI0F 3C14A 2HPUA 1FNOA 5F0WA 2V4JB 1UVLA 4ES1A 3KLHB 3LA0A 5HMYA 2VBYA 4D3HA 1WHXA 3HO1A 2RILA 1RAIB 4OX8A 1MW7A 1GAOA 1NO8A 2UU9J 3EZOA 1QY7A 2GW8A 2AGQA 3MM6B 4JI1J 3ILIA 2OEMA 3OVAA 2CYYA 3EGNA 3MHYA 3HT3A 4ECTA 2BJDA 2DR8A 4Y2CA 4YB1P 3R5JB 1NKCA 2IM0A 4KFBA 3M1VB 1GMUA 4Y28C 5E7OB 1IBKJ 2ASYA 2RNEA 4ECWA 4K4YA 4RWWA 2HHHF 3H4DA 3E2EA 1KR4A 3J80Y 2PGCA 4C98A 1D8ZA 4KO0A 4USKA 3LO3A 2XY5A 4MFBB 4NE9C 4FZVA 2RDJA 1S4EA 2CDQA 3D0GE 3H25A 2I5JA 1CULA 1NJWA 4JI4J 1YI2S 4LR9A 4UUXA 4F4YA 5T7LB 3CCMS 2BQUA 1HNVA 2JX2A 3RR8A 1CC8A 3P49B 4LFCF 2RQKA 4KSEB 4P72A 2IBKA 2O3DA 1VOMA 4TU9A 2HGMA 3RAQA 3M8ZA 5EDWA 3I4HX 3EPGA 1T9VA 1N54B 4ICLB 4U8VA 4WK3A 1RAHB 5F8LA 1WF1A 3T41A 2ALZA 1VBYA 2G0JA 3TW0A 3QMQA 4RZRA 3GV8B 3GZ7A 4CLKA 1U25A 2AJ1A 1J2VA 2D41A 3R5AA 1KOHA 1XNQJ 2HAIA 2V2KA 1VJWA 4CLTA 2OPQA 4ED2A 4QWBA 3IP0A 2CZVC 3MCNA 2XI3A 2K3KA 2LECA 3DOMA 4NA3A 3ZNJ1 3AA8A 4DEZA 2RDIA 2XMVA 2ZVIA 5KG1A 3UN2A 1WC5A 4DV3J 4U9RA 3ITHB 3D3CJ 3UCZP 4EBCA 2PA8D 1RWWB 4ETXA 2DXEA 5RUBA 3VVTA 4ZVOB 1Y0HA 1CPZA 3CDWA 1LFPA 2V8GA 3EX7B 1KHWA 4HHJA 1IKWB 3D7SB 5DDQC 4WBFA 3U1MA 4ZN1A 3OFEA 1IWAA 2MEWA 4WFYA 2J7UA 3W8GA 2Z2YB 1BQNB 3W2WB 1U6BA 1HNXJ 2QTWA 1UETA 3EVMA 1AUSL 2ADBA 1VISA 2U2FA 2ZZMA 1D8YA 3P45B 1HHQA 5LT5A 1RWUA 2Q1LA 1D1UA 4P10A 3P6YC 5FDLB 2CQBA 5HJXA 5J1EA 3UD4P 3RRHA 3P4UB 3P5TL 3KG4A 2DH7A 5K14B 1YX2A 3UD5A 5M2PA 4AD6A 3GYGA 2GQCA 1BQMA 1U02A 4NI2A 5CZVA 2VFVA 4Y00A 2B9EA 4KV8B 4Y34A 3KUEA 4RO0A 1WEXA 2HZCA 2RUSA 3PVXA 2FGOA 1RAJA 1VQPS 5J2QA 1KLNA 2J0SD 4YDXA 2KI2A 1UJ6A 2W9BB 1SXLA 1KVJA 2W9AA 4O44A 5KT5A 1Q1KA 5KG2A 2M4MA 4DFMA 1P9QC 2MQ8A 3TANA 3LWLA 3MAQA 4PXCA 3C6TB 4HH1A 4Q0BB 4WZMA 4LF7F 4CLPA 1FNMA 3K5LA 2VONA 4M5NA 1REGX 2HK3A 5AE2A 3NNHA 1RHUB 2YVSA 4FYXB 1UAWA 1VQSA 3T1HJ 1KQKA 2B6AA 3ISNC 2HBZB 3I9ZA 2B4OA 4LF4F 1YJUA 4K0KJ 4DX7A 1C1CB 3Q89A 3ZTSA 1R0AA 1RAFB 3K0JA 4USHA 2QFIA 1PO6A 4R5PA 2OPSB 1YRUA 2PA3A 1U2RA 4JI2J 3HD2A 5E3CA 2KM8B 1KNZA 4TY8A 1TUVA 4IH6A 2JC1A 4XIUA 1N32J 2C3YA 5IS2A 4X64J 5F8HA 1UWAA 2ADCA 2ZD1A 2FY8A 4DG1B 1T05B 2XYHB 4C8ZA 1E6VA 1S1XA 5JUMA 4EEYA 3DOLA 2C42A 3UQSA 2FDNA 4LSZB 2YX7A 2R7SA 3QIDA 1CJTA 4WP9A 3MM9B 1TKTA 2FJWA 3BZQA 2VA2A 3QT8A 4DOZA 4AE5A 3T5KA 4ZVFA 2ROPA 1NPRA 2KRRA 2L3MA 4JP8A 3U1LA 1LW0A 2WCXA 1SJ1A 3PYGA 4F0KA 2FJAB 2E5LJ 3W65A 5ETTA 1RISA 3GYNA 5F9NA 3SBMA 3FCHA 2RDDA 2W4PA 3H5YA 2HNDB 3H42A 2PMHA 3MMAA 5IM0A 1GNKA 2X3DA 4U7UK 4KHPJ 4DUTA 4PWDA 4K4WA 1JJ2R 1H73A 3JSYA 2GJFA 2N82B 1G3OA 1HBNA 2BEFA 3QRQA 2IRUA 3FEZA 1FKOB 4MKAA 4EZ6A 2A10A 3BO4A 1BY9A 1DQAA 2EFGA 1H2TZ 2YNHB 4WKRA 2NQPA 4V1Ak 3UDEA 3CC7S 3IXQA 1MN9A 2D3OR 1TKXB 1VCTA 3ADAC 1VI7A 2PE8A 2XGPA 3IO1A 4OV1A 2RH3A 4XO0A 4RPFA 2VQFF 4Y6IA 3MPVA 2IC3B 2LKZA 2O1PA 2CFXA 2X51A 4Y3CA 2VFSA 3QJPA 2F4VJ 2CNNB 4EUVA 3TUZC 4QJVA 5EUHA 2A18A 5SUHA 3BV8A 4XPCA 1NEEA 2RSQA 1PKUA 4HI1A 3M8YA 2MB0B 2DIVA 4UT4A 3LGMA 3QNWB 3PYDA 2MMYA 4NLYA 4F4ZA 3NEKA 3V5RA 1WG4A 1GXTA 4D3GA 3I5AA 2HW3A 1JJCB 3MAHA 4LVNP 5IWAF 1HR0F 3H20A 4IO9Q 4ZK7M 1T9YA 4IRCA 3HHLA 1JXEA 1JLAA 2R7TA 5B0AA 1F5CA 4L72B 4N8NA 3FZBA 1YRXA 2VG5B 2QMWA 1VQ9S 4JI6J 2HKEA 2ZC4A 5EWGA 4MKBA 4QR2A 3TP2A 2FB0A 2FZGB 4LRBA 3DMJB 2R42A 4EK2A 1WKKA 1MMDA 3OUYA 1R8AA 2A6MA 5A2QU 4B3MF 4Y2IA 3R7SB 2IA0A 3MDFA 4OYOA 4F26A 3E01A 2PT0A 4ZKAA 1PC5A 1L3TA 2AHOB 5EWEA 3KOAA 4DSKA 4K5SA 1CS4A 1VQYA 1DURA 2XLJA 3DRPB 3MTKA 2F65A 4FP9A 3AD7C 2O5DA 1EP4B 5M2UA 2IA6A 2DY9A 3BR8A 3CJ0A 3UPFA 3N9UC 1Q7LB 1T03A 3MGJA 4P2MA 1N52B 3ETMA 2RS2A 1EAYC 1ZPWX 4E98A 1R7IA 5A8RB 2R2RA 3EXYA 4P52A 3LANA 5D3GA 3K17A 3H0PA 1FX2A 3Q83A 5HVHA 5K8MA 3U27A 1PILA 2AQ4A 1XR6A 4PG5A 1VQ4S 4FXWA 4DV2F 1U24A 5ETVA 4HDGA 1LK5A 3BDPA 1WORA 2NLWA 4EBDA 4N76A 4A8XA 2R8KA 3D1HA 1X4DA 1Q8LA 1F9EB 2QJ3A 1SJRA 1Z2LA 2XCPA 3DM2B 3MPWA 1RT2A 2EBGA 4AL7A 3TUJC 2YQ1A 4HKQA 1S9FA 3K7RA 8ATCB 3PM9A 2GZOA 3DI6B 1LWXA 4LF9F 4DR7J 1UFWA 4K7QA 1P9YA 1HWIA 3AD9C 2FY1A 4N8OA 2YH0A 2ZBIA 2B9XA 1C1BA 1B70B 3T5HA 4P2FA 3O1LA 5KFPA 4GC7A 2ATCB 4GO5X 2W2MP 4P71A 2WK4A 2HFUA 1QUVA 3QIPA 2OEJA 4WXOA 4NCGB 2V4RA 4G1QA 2DNOA 5H9FJ 2UXBJ 1WELA 1E6YB 1G2EA 1IVZA 4X4SA 1QVFR 3HZGA 1FKPB 3R2DJ 2KFNA 1TL7A 3GMGA 1R27B 1BGXT 3NXZA 2H54B 1RT1A 1HNZF 4RBVA 2ACMA 1R43A 1Q7YT 5H9EJ 3FC9A 3C6UB 1YJVA 4DI6A 2CQ0A 2MJNA 5KAKA 3NGUA 1NKBA 2UU9F 5HBMB 4C8NA 5D4OA 2YWWA 5ETNA 1OQ6A 4FBTA 4I2PA 3BGOP 1DQ8A 4AT1B 2VPZB 4Q44A 3MCSA 4YHHJ 2BJ3A 4AYBD 5C24B 2B5JB 5KFWA 2BE2B 3PW7A 1GTHA 4ZIWA 4F36A 1IKVA 1CQMA 5AJ3F 1GXLA 1YLXA 4CP5A 3SQGA 1ZAXA 3NCQA 4GRSA 1VYAA 2RB7A 3KJVA 4I6WA 3W2VB 1B7FA 4CLSA 4ECRA 5EX0A 3BN7A 1ZM3A 2ZWPA 1FE0A 1ZS6A 3MUVP 2KXNB 4JI4F 3BO3A 2V34A 3S1TA 2UV8G 3I32A 3QZ7A 1N56A 2MZTA 4P74A 2VA3A 2HBYB 4DR6F 4QCLA 3M8PB 1SC1B 4CM2A 2GX8A 3F56A 2EW9A 3CCSS 2FD2A 4P2XA 3C66A 1IR2A 5ETMA 3IM8A 4OJ1A 2RF2B 2EK1A 1F5AA 4YR2A 1NSPA 1VRUA 5L38A 1C2PA 3X3UA 4J37A 5DG8A 1RA7A 2PI5A 1TL1A 2G0IA 1U26A 3M4XA 3MR2A 1KONA 2P9CA 3SV4A 2MQNA 4MIBA 2XMMA 3J81Y 4RX6A 1KQFB 5J2NB 2FVRA 2HSEB 4MT1A 4F67A 1XMQJ 3V81B 3MD3A 1VBKA 4ID5A 3HK2A 4KC5A 2MSTA 1T94A 1NPPA 1JLBA 2CPHA 2XLKA 3DDNA 3ZXWA 4CIOA 1GX6A 2HS4A 2C2NA 1TL5A 4NWBA 1AYEA 1SL1A 5CHCB 4B3TF 2QSFA 3H2LA 4ECSA 4RW7B 1OY8A 4GC6A 2HMIB 2NPFA 4A8SA 1L3KA 3H59A 3PIPQ 2OD4A 5KFXA 2E1CA 5L39A 2HFVA 3CB4A 3KK2B 1U1KA 1G4CA 3OTCA 4XDCA 3JSRA 2EFNA 5ETPA 3ZTOA 2OH2A 1EQ0A 4BC7A 1BMQB 4DDFA 4OJGA 1NJIT 4EWTA 2XSFA 1SI9A 4G6VB 1S1UB 3ZC4A 1EKSA 2XZTB 2EK6A 2RQ4A 4DFJA 3KLHA 2VH7A 5CXTA 1AROP 1BWVA 2KZMA 1GMWA 2W24A 1MWQA 4J9LA 2WVEA 4TYBA 3R6LB 1OY6A 2QV6A 4KKOA 4FYWB 3NGTA 1RWPB 2ZJRQ 5AXMA 3OTEA 2EFPA 5A8KA 2XMAA 2HVDA 4I4BA 2DO4A 4IRKA 3HJFA 2KU7A 3M6WA 5HAOA 2GC8A 1Q79A 4OZ3A 4USMA 4RW8B 3QWPA 5CQGA 4FXDA 2CNKB 1R6VA 2L9NA 3BF4A 2MKYA 2AGOA 2M2BA 4MFBA 2NUHA 3KYLA 3D1OA 2BW2A 5HO4A 5KFFA 2VU5A 3SDEA 4KYZA 3ISZA 2UZAA 2GFFA 4MAKA 2HBRB 1UW4A 3G6VA 2IDLA 3R1HA 1FO1A 2CQDA 3R6GB 2ZDPA 4O3PA 1ZM4A 4JI2F 4R8UB 2LMIA 3KDOA 1DQ9A 5ETRA 3D0IE 4N41A 5C2GA 1UEKA 4KGVB 2ZHAA 5F3ZA 2BABA 2ZH3A 4CO4A 2KH9A 3HFKA 4DWIA 1LW2B 4W90B 1FK9B 4FXVA 2VJUA 1SPBP 2AD9A 2KB2A 1N0VC 1IKYB 4PR6A 5KG0A 3M7VA 1V6HA 1YTYA 4N7TA 1LWCB 1T9UA 2E9RX 1RI7A 1WDTA 2KJWA 2CPXA 2W8LA 3D68A 4NRUA 3A12A 2M9KA 1WKLA 1HI8A 3LF0A 3C3LA 4ZVUB 1F0XA 4J9PA 1FD8A 1A9NB 2HZVA 1U1PA 3OPKA 4RNFA 5KG3A 4NL5A 3MOZA 2ZJQQ 1NZ8A 3NG8A 3T6JA 4LFAJ 4J9MA 3K59A 1ZTTA 3A3PB 3AH6A 3ITHA 2W01A 3JQMA 3DFEA 1IQTA 4IH7A 3OFHA 3NP5A 2VUGA 2D1CA 1SKRA 1D9FA 5KFCA 3T5JA 1FFWB 1HHSA 3VHQA 4KHPF 3GILA 3FVYA 4ER8A 2KVQE 1BQNA 3W2WA 4NLSA 4ZMMA 1VQ6S 2O67A 5LJ3Y 4DZDA 4DHVA 3RU0A 4X65J 1S9GB 1FJGJ 5FDLA 1XK8A 1M0SA 3S8SA 5I3UB 2WBMA 3PR4A 3AFGA 3QQCD 5K14A 3MM8B 2E5IA 1S1VB 1VQNS 3K8WA 1QD1A 3T6BA 3PRDA 3KMSA 2QA4S 4UZBA 5GADI 4KV8A 2ZNZA 3DGPB 3KKFA 5KFAA 2LLZA 1SJQA 4J7CA 4KPCA 2XHCA 3O8WA 1FDBA 3I6PA 3M32B 2FHJD 4ED6A 1JXLA 5LMNJ 2W9BA 4CLFA 3MWBA 2OKQA 1EIYB 3QFWA 3TO8A 4OYXA 1RHRB 2GO8A 4UF4A 4Q2MA 2ZKUA 1IJFB 3JAMU 2FVQA 3C6TA 4Q0BA 3QPIA 4YEAA 3DDIA 5DG9A 3M2VA 3NBPB 4M5MA 1LXJA 2DO0A 2VQEF 3WIVA 3W5ZA 1H98A 3A8IA 4IRDA 5D0RA 1WOOA 3LP1B 3UVJB 3CULA 1SL0A 1C1CA 2QLBB 1FRIA 2UVRA 2DGUA 4OX9F 3ZZ0A 2V5HG 2OPSA 3HHLC 3BYPA 3MECB 3LTOA 3HD1A 4I6YA 2BRLA 5DLGA 2Y8YA 5HROB 4UOCA 2J0QD 3KK3B 5IQQA 1RTDB 1JKHB 2FTRA 1YHQS 4JI7J 5A0YA 5HVFA 1N6QB 3UDLA 4DR2J 3GFXA 5HMZA 1T05A 4P6QA 4KGXB 5GMDA 2Z2ZA 4FPIA 4J91A 3I0SB 1ZH5A 1HYSB 1JLGB 4DPOA 5B0DA 3AHPA 3BYRA 1X5TA 4OZNA 4OI6A 3OR1B 4OLOA 4KGZB 5D8HB 1RAGB 2Y9HA 3MM9A 2EXUA 2XNQA 3J7ZT 3ZNUA 3ZZRA 4O4GB 2APOA 2Y0BB 3H40A 2JEIA 4F02A 2D69A 3BN4A 5LMUJ 5AE3A 2C2MB 3QATA 3LWMA 4NXNF 1DBDA 2AZ1A 1YIJS 1VQLS 1WG1A 2RE1A 3TARA 2MHEA 1HFEL 4OHWA 2CQPA 2WVCA 1RHJB 3KNAA 3CJKB 3FBBA 2FIUA 4ZITA 2HNDA 4OYIA 1FA0A 2DIUA 3CCLS 4CI0B 1RE1B 4X4VA 5KFQA 1OSCA 3DGVA 3RBEA 1F1BB 2M52A 2CJBA 3TOQA 2P9GA 3CWJA 2K3IA 5A2QY 2F40A 2WB4A 2ZH5A 4QIFA 1JB0C 2HWIA 2HRTA 2UXDJ 2OUGA 1FKOA 3DOKB 2RT3A 4A8OA 1YG0A 3FZ2A 4FKYA 1SH3A 4I68A 2GQQA 5FLXY 2PDAA 2HQCA 3C19A 4AXIA 1TKXA 2V50A 2E9ZA 4DL0C 3AB2B 3ET6B 4KFBB 1Y5IB 1TTHB 3KLGB 2R8GA 4X4QA 4NZ0A 1LXNA 1ULRA 2IC3A 2V9WA 2G2ZA 3UDVA 3PHEA 2IJNA 3JXOA 4ZJQA 1WWHA 3CC2S 2KXHA 4MTPA 3E8OA 1FFSB 1QTMA 1HNIB 1RLCL 2WONB 1REVB 1F5BA 2K7JA 4ED5A 3R3TA 1H2VZ 2XS7A 2HLTA 2MGZB 2V63A 3QJLA 4WIQA 4FS2A 4OL8A 4PCQA 2HYIB 1UA0A 5EX3A 3CMAS 3V4IB 1S49A 2KHDA 3JB9k 4YHHF 2VG5A 1B64A 1MMNA 1UFLA 4JB8B 4NOHA 3TUPA 2VG6B 3DMJA 2RRNA 2IJRA 2GJIA 7FDRA 4ZPCA 3W8PA 4FNIA 5L1KA 1HL6A 4KH1B 1S0OA 4PYDA 3M8RA 1IBLJ 4ZHRB 2LCWA 1WSVA 2GV1A 1W2BR 3GV5B 3M6XA 5FD1A 5EN1A 2LEPA 3HF5A 2F9JA 1FJ7A 4KH0B 3DRPA 1CJKB 3OXFA 1QAYA 5L8RC 1EP4A 5D4LA 2IAJB 3DOMB 3MUMP 1WI8A 3P5BP 4ZCIA 3FJ2A 1WC4A 2KG0A 2DHGA 4A8FA 2CG8A 3J80U 2HRUA 5K20B 2HGNA 5A8RA 2X1GA 3A8EA 3TUIC 4OYAA 3VAIA 4KQZA 1UPMB 4F25A 4X4NA 3F0NA 4DR1F 5CYMB 2UUCJ 3SFGA 1M5PC 2RU3A 3RR7A 1RCOB 2ZH2A 4OI1A 4BHQA 1PG5B 3FEXB 3DLGB 3VF0B 4OZ2A 1JK9B 2XNRA 2IYIA 3NMAA 1EQMA 4OZ1A 3BH6B 3PV8A 3BGRB 3DM2A 1UVJA 3JTOA 2GAGC 2J6UA 1I3OB 1JLFA 3QGHA 5CD4A 3MR3A 2LDYA 5J2PB 3DLKB 4A8QA 2K2PA 3RW6A 2AZ3A 1R8PA 1IR1A 3DI6A 3W9JA 3HVWA 5HQLA 5J1EB 3H90A 1PAUB 1UZDA 4R25A 4JYAJ 2EVZA 1RT7B 2IFXA 2LQ9A 5D77A 2XHWA 3CCVS 1BQMB 1WF2A 3GG0A 1WF0A 1QAIA 1RJJA 1FESA 1RWMB 5LXRA 1WEYA 2ZITA 1OY9A 4NCGA 1VRQC 3LPEA 4IR1A 3IA0A 3BSAA 1S0NA 1E6YA 2ILYA 2OP5A 1BD6A 5KFZA 1FKPA 4LIWA 2C3PA 4X4OA 3EE3A 2YX4A 4C8OA 4ED8A 5KT4A 1NDCA 2FC8A 5I3PA 1UEUA 3H2UB 2CQGA 2ABYA 2EPIA 1KP6A 5KFSA 1T9TA 3CJRA 1ICEB 3U1NA 2L9DA 3TQEA 3J7AN 2MKCA 2NXEA 4O0NA 5KOWA 5IV4A 1FEHA 4R5PB 2HK2A 3KG1A 1S6UA 1UVNA 2HEKA 4DV1F 1GFWB 3SFUA 5KT6A 1C0TB 1U6ZA 3K8VA 4MKYA 1FTRA 4EYIB 1QAXA 2V8VA 3Q8PB 3BDEA 2KT5A 3W2VA 3D4JA 4NXMF 4RWXA 1E6VB 3BQ1A 4RW9A 3KLIB 1S1XB 1HNWJ 2YY3A 2AT1B 3PTWA 1GQEA 2CQIA 2AP6A 2FLPA 3J7A1 2IVYA 1NHKL 4DL3A 4KY3A 4QOTA 4N47A 2Y1RI 4QW9A 2N3OA 3KFWX 3M9OB 1U8WA 1LW0B 1R8HA 2N7YA 2W2QP 1X4AA 3Q8RB 2FZCB 5D15A 3UNYA 2RF2A 1KDNA 1J27A 1SQFA 1RADB 1RHQB 2Y3YA 2FLOA 4FBUA 1VQ5S 1Y3JA 4IOBA 4PUOB 2CXEA 4Q8EA 2BYCA 2VC0A 2AEMA 2QFJA 4WYWA 4RNNA 1Y9OA 4AL5A 3FGVA 1MU2A 3L09A 4UQGA 1JNZB 4OHZA 3GIIA 4QQBA 1TKZB 2A0FB 3B6BA 4EI2A 2UUBJ 4USTA 4PG6A 4ZVTB 4EMDA 3GE9A 3EGWB 2JVOA 3GIRA 2A3JA 4OMFG 3IR5B 2DJWA 3T1YF 4BWJA 4DSJA 4RNMA 4IG3A 4J9NA 5CCMA 3RB3A 5FIIA 2M8HA 1RHMB 4KTQA 2OMLA 4DUZJ 3AXKA 1OJ4A 4LFAF 3OL7A 3SZ2A 3KLFB 2JNJA 2FVPA 2V4QA 3T1AA 4QPXA 3BM7A 4OZJA 2X1FA 1RXOB 3TYTA 4RW7A 1K8AT 3I82A 1M5KC 2F1FA 1P27B 1YJTA 2M0GB 4F04B 2DR9A 4ZIVA 3WX8A 1LV5A 4DL7A 3MEGB 5GAEI 5DDRC 5C25B 3KK2A 1IBCB 4FN5A 4F4AA 4A48A 3NGKA 1QVGR 5BYQA 2Q6BA 4ZLJA 1S1WA 4V19X 2BJEA 2HRYA 1S1UA 1GXUA 3AA9A 1QSLA 2K06A 4GKKJ 2CWKA 3HFVA 1LFWA 2QEXS 3O3LA 4WU2A 2OPPA 1Q16B 1TK8A 2WRMA 2YX1A 4LQ9A 1B0TA 1YRTA 1W25A 3SCLE 1Q8IA 5D0EA 1SBRA 3UWTA 1GT8A 2QIFA 5HSPA 4UOHA 1KLMB 1BHNA 1SUQB 4YS2A 2E7VA 3Q8QB 4M63A 1N5VA 1S59A 5EHHA 5D0HA 1U2FA 2XS2A 2QA1A 1U6FA 1NK7A 2H1YA 3R5DA 5KG4A 2ASJA 2X1BA 3C2PA 3E01B 2W1BA 2JLGA 3MPDA 4RW8A 5LMNF 4QW8A 2QLFB 4DPTA 1AUDA 2GMJA 2DISA 4OYMA 4YB5A 2AMCB 2G0CA 3WX4A 4DR4J 4BC9A 1FVQA 3MF5A 3VV2B 3NGDA 3M2UA 2BKOA 4ZJOA 1PC4A 2IMOA 1L3UA 4B17A 1VFJA 1SIWB 3R1LA 2BJ7A 1XMBA 5JVGQ 1K47A 5HVGA 4MMOA 1HMVB 2FUG9 4KHMA 5F8NA 2D9OA 3TA2A 5CD4H 5D3GB 4K4SA 5IOLA 1J5OB 4HH0A 1T11A 3Q0AA 1N8RT 2GHPA 4IOAQ 4R8UA 2VF3A 1TFWA 1DFDA 1N33J 3KJFB 4PPDA 2NREA 2BMBA 4KIAA 3H8YA 5T14A 3DRXA 6FDRA 3DRSB 2R4FA 5EGYA 1LW2A 1FHTA 1FK9A 3AOAA 4Y2KA 4DR2F 1U47A 1PJ7A 2GHWA 2QO3A 1YDLA 2ZUGA 3HSDA 2H51B 5F8IA 4U7UD 1IKYA 2K8GA 3DU5A 1OPZA 3CJSA 1H3DA 2KM8C 2AEJA 4O4RA 1FDNA 1SJ3P 2VFRA 4X4UA 4DCPB 5DQHA 2EFVA 3KDNA 2CKWA 3N6MA 4CQ1A 1DTQA 2MLXA 2QLXA 3D6FB 3SEOA 4CH1A 2HBQB 3V6JA 4B3RJ 4USWA 3DRRA 1HHTP 1I6JA 2K1RB 1FERA 3AJ1A 2FJDB 2AYEA 1VHFA 3OT9A 4QWEA 4NLUA 4CTAB 5IFMA 4RLEA 3B8HA 1B4SA 3CO9A 2FHKA 2NPIA 1YZ6A 1U45A 4YY3J 4DS4A 2AW0A 1M90T 4DQPA 2C2KB 2HGLA 4ZVSB 4OZ5A 5K8NA 5HQMA 3IRXA 4CO0A 4LREA 4O23A 3CCJS 1OWXA 3W9HA 2HHUA 3PJWA 1F6TA 4FF2A 2UXDF 2CJYB 1KKHA 3MM5A 4I2PB 3K58A 2DVIA 2UUTA 1HKAA 1UEVA 4ED4A 3I56S 1RT3B 1VK3A 1FJCA 1S9GA 2HVEA 4PWWA 3K5MA 3O5TB 5E41A 3PX4A 3BBBA 5I3UA 2JFDA 2ZE2B 3MM8A 4OI0A 2HZAA 1XR5A 4EU0A 2RQCA 3PCOB 3NNCA 1RBOB 4M5KA 3CJ5A 3KJVB 3DKDA 2NZCA 1CC7A 3DGPA 3NL0A 2JHEA 3N6LA 1T0TV 3VGSA 3M32A 4DPXA 3THPA 1I94J 2DTJA 2H3EB 3QGGA 2RIJA 4GKJJ 2BR0A 2Y8WA 1QDUB 3IGVA 1HW8A 3MCMA 1RK8A 4NASA 2DY1A 3J7YI 3NBPA 2HVIA 4LF8F 1KQSR 4PQAA 1XMOF 1X0PA 4K4TA 4DR3J 4KJIA 3LP1A 1VC6A 3UVJA 4Q2LA 1K1SA 1VRUB 4QIEA 4PXDA 5E33A 3QGPA 4KAIA 1IBLF 3KJNB 1FI4A 3MECA 1QTNB 5IV3A 3DLHA 5DLFA 3VGUA 4Y65A 3CVKA 2B9WA 3RB0A 4Z2XA 4ZPVR 3KK3A 1IBMF 4BDPA 1RTDA 1X4FA 1JKHA 4L74A 3C16B 3HVRA 4DV6J 4ILMA 2HS0A 1N6QA 4ED3A 5BXIA 3C15B 2PMZD 2JRSA 4WXWA 3D6TB 1YWXA 3VQSA 3THVA 3A4TA 4DQSA 1HYSA 5HP1B 3VZIA 3SXLA 2DKOB 2EKNA 3OR1A 3G6XA 3IC1A 3GSIA 5D0GA 3PX6A 2XY6A 2VBXA 1JJ4A 3D0HE 1H7WA 4O4GA 2E1AA 1DHMA 2RQMA 3QYYA 3SV3A 3K57A 2VL1A 4B9NA 3WZ0A 1NHUA 1MNEA 2EFQA 2B4UA 2BOAA 3W61A 1R0BG 3TQ1A 2W4DA 1X4HA 1QLNA 1YJNS 4NLRA 4YDDB 1D0EA 4LUBA 3EDQB 3CJKA 3PIOQ 2J76E 1KS2A 2GIQA 5MAOA 1WTBA 2HFNA 5BR8J 2QSWA 5GAGI 3BEGB 2OI2A 3AODA 4TYAA 4AQYJ 4R0EA 3UN5A 3DDKA 5KFIA 1RAEB 4JYAF 3I9V9 3IRWP 3GP9A 3ELHA 3RAMA 3A8KA 2WBRA 4KR0B 3DOKA 1VK8A 3QWUA 4KKOB 4JV5J 1SL2A 2NZ4A 1X5OA 2IJFA 1S0MA 3J81U 1N5SA 4LSLA 5L1IA 3I96A 5A8KB 1DY3A 4B9SA 4HHHA 3ET6A 3D54A 4LFBJ 3KLGA 3A3OB 4F4WA 3RJMB 1AFJA 2GVDA 4LF5J 4YUDA 4CRJA 4OI4A 4M5IA 1TV6B 5KFUA 4NEYA 4PPZA 2V67A 4JOUA 3GU0A 4EBEA 3TAQA 3G87A 1YJWS 4X84A 1HNIA 2WONA 1REVA 1WC6A 1KSPA 4HLBA 4HYKA 3UCUP 3VCDA 3ETOA 3OJUA 2ZH6A 2MGZA 2XS5A 3HVTB 2DR5A 3SDEB 3SYZA 1S57A 2HIQA 5CA5A 5CABA 2XI2A 1CBKA 4M94A 3FBFA 5CZXA 4B02A 3Q2TC 3HLUA 3LGHA 3CC4S 1SVDA 5B0GA 2XO7A 3PXGa 3V4IA 4ZVGA 4EGLA 2C22A 2I1RA 2YXLA 4J5OA 2ERRA 3I87A 3K2YA 3AJ2A 5ITHA 3MURP 3N28A 2XCAA 2UUAJ 3TR5A 4G3IA 2VG6A 4E2FB 1N48A 2E7XA 1H6KX 1NCLA 3UFCX 3ZZOA 3FEYB 2DGWA 2DITA 1XBWA 1X9WA 2B3TB 2Y0SD 4ZHRA 3DNCA 2DNHA 3OLBA 1D09B 2LU2A 1XNRJ 2I8EA 3O2IA 2CRLA 1N34J 2KKHA 3GB0A 3RG6A 3DXSX 1CJKA 4FKXA 5DDOC 1LKZA 3MD1A 1OYEA 3SQOP 2MLZA 5I42B 2K7KA 2IAJA 2Q66A 2XGQA 4IYQA 1S79A 5B08A 3UR0A 4ECQA 5A6WA 1X0FA 4C48A 1QSSA 1WKJA 3PRVA 3HPOA 5CYMA 2CPDA 4UTGA 4WKYA 4ITSA 1RGVA 2BOPA 4C3LA 4DXLA 4ETZA 1CJVB 4DSFA 3HVAA 2FHJA 3DLGA 1KVKA 4JV1A 3LAKA 4PXEA 2OFGX 2LA6A 4ZVQB 4JI8J 2W7OA 4M5DB 3BGRA 3F41A 4PG7A 2H9ZA 2R3VA 2J9DE 4DUZF 1CVJA 4G1PA 3H5SA 5J2PA 3DLKA 2BM0A 1SJ4P 1RTZA 3FBCA 4CO2A 4DZ6A 2D3O1 3N01A 4YOEA 5C5JA 2Y1JA 3GFYA 3AY0A 1VBXA 3KK1B 1NZAA 2YPYA 4RKUC 2R8IA 1RT7A 3LUYA 3MMCB 4Q43A 2R9LA 5D78A 2DYAA 5I3QA 2JZ5A 5E2QA 2BUNA 3KXDA 3RGIA 1UJ4A 5B7WA 1HPZB 5L46A 3CD0A 1ZYQA 1WTFA 4ES2A 2FYXA 1P1LA 4DV5F 3UE2A 2MQLA 4ZP9A 4GKKF 2IRXA 2AU0A 4LFCJ 2NSBA 1EHWA 3QO9A 3JS9A 3R7NB 2YBVA 2DGOA 3GR1A 5HMXA 3OVBA 4I67A 4ZP8A 2COLA 1R89A 2DEIA 3B82A 3M2VB 2LU1A 3Q2SC 1NK9A 7FD1A 4B3SJ 5KG7A 1K44A 2LP4A 3BSNA 3ILOA 3LH2S 4C6AA 3RRGA 2F3JA 4B3OB 4H4KA 2NR0A 1C4AA 3FBEA 2WW4A 2E5JA 5JJBA 2LDIA 3NGSA 2HNYB 4KPYA 1C0TA 3TJ8A 2OMOA 1V3ZA 3CCUS 2UV8A 3QRRA 1TK5A 3BB5A 1VR6A 5A0YB 1MN7A 4I7FB 3CCQS 2ZJPQ 1VQ7S 4WP8A 2HURA 3HSZA 2WVFA 2DEJA 3R8YA 3KLIA 3PJXA 1U1OA 3JYTA 4DF4A 2GIRA 3IR6B 5KG6A 3Q24A 3MR7A 4LQ3A 4DQIA 2O01C 5L1LA 4P73A 2CQCA 1HBOA 2R2UA 3Q22A 1X31C 3VZHA 2M3DA 2BXJA 2W25A 1S99A 1W7WA 4DBQA 1N33F 4IH5A 1TZ0A 5K9FA 2R7OA 3ZTRA 2V2QA 4DUYJ 3MR6A 3TJ9A 2PC6A 4K4XA 3I0RB 4PUOA 2AV5A 3CCES 2D9PA 4DV0F 1V5IB 3X1LB 2VPYB 3G2XA 1UMJA 3QT5A 2OGUA 4M95A 1TKZA 4WCEQ 3IAM9 1ELOA 2IY5B 4O0IA 3QGIA 3FFIB 2I9SA 3EWGA 2QRRA 2HWTA 1RP5A 2NUUG 2HHTA 2AJ4A 4YMEA 2OIHA 3EZUA 1XR7A 3AOBA 2F8EX 3KHGA 4C0BA 5HATA 3TEHB 2VG7B 1RBLA 1YJ7A 3KLFA 4YY3F 1VLOA 5KFYA 2ROEA 5KFVA 2BX6A 1ZM9A 2J6SA 3TX0A 4CWBA 2ILZA 4PG4A 2OTLS 2B8PA 3KHRA 4DN0A 2CVIA 3MEGA 3NOGA 4FVMA 2QYGA 1NK5A 4ZVEA 4F8RA 4U96A 1SKUB 4FDFA 3H5UA 5C25A 2DXDA 1HWKA 3M6UA 4LF7J 1FCAA 3WIUA 3DU6A 5L1JA 2XG8A 5B0CA 3MCOA 2W8KA 1FRKA 2CG4A 3VGTA 5DGBA 1XTZA 2UXCJ 4JI3J 4TVAB 4MH8A 1ZA1B 4LF4J 1Z1ZA 2J9EA 4Z7YA 2ZBCA 2BV3A 3J7Z5 2CADA 2YH1A 4LF6J 5HANA 4FNHA 1KLMA 1SUQA 4WIIA 2NSCA 3M6VA 1NB7A 1QUPA 3HHEA 1F9FA 4OIXA 3T19A 3QFHA 3EPIA 1VHIA 3D5MA 1RT6B 4C0HA 1IM6A 4DFKA 4C3KA 1I94F 2M8DB 2XZDB 2ZFHA 5FLXU 2YKOA 2VDHA 5AE1A 4AFFA 3RBDA 3JSMB 3ZZUA 3GJTB 1X9MA 3FSYA 2WSCC 3MOJB 2B9YA 3HKZD 3AJDA 1HMVA 4DR3F 3OXGA 2LXFA 2VASA 3MMJA 3GV7B 2L48A 2ZHOA 3VAHA 2ZBPA 2OPRB 3E51A 3VQTA 3D2WA 2MKKA 1J5OA 4X2BA 3T9ZA 4NLOA 4CLZA 1DTTA 2PEHA 3QJJA 4ANDA 3M2RB 5K8OA 4M5HA 1XQIA 2YPZA 2R2SA 2G9OA 3Q8VA 1Y00A 2H5JB 2KT3A 4DV6F 3DRSA 3KUGA 4B9TA 3AQPA 3DXBA 2ASDA 1V9OA 3US5A 3JSBA 2V9KA 4YB6A 1FX4A 1JLFB 1NBEB 2HS3A 4URGA 1I5OB 2AIRB 2W9CB 3MEKA 2IVMA 1OS5A 1RLDA 5KFHA 3TZXA 3W5XA 3B4DA 2CJ9A 1RUSA 4OX7A 2HHWA 5DJBA 4A8YA 1O0PA 3W66A 1F9HA 4PQUB 3GG1A 2E44A 2DGXA 4LBHA 2VHGA 2K1RA 4UQTA 3J81j 2BBEA 3NAIA 4RUCA 4CTAA 4QWDA 4CLUA 1MWYA 1RKIA 3KG0A 2CQ2A 4QWCA 5GMKa 2OD6A 1H74A 2JH3A 2KJVA 3WDOA 3WC2A 1FKAF 4NMXA 3LP0B 3NOCA 2FJXA 2DNMA 4DL5A 5BR8F 1FJEB 3LOUA 1R6YA 4RW6B 4AQYF 4K4VA 4DN9A 2XMTA 4PAAA 2FPHX 1LWEB 2DNNA 3HHKA 1NJYA 4JV5F 4JI1F 5IT9U 2DBBA 1S1TA 4DL4A 5G4DA 3D1QA 1RT3A 4WU3A 3DLBA 2WSEC 2QYCA 3H2VE 2RVJA 2HQ3A 2HLUA 1HARA 2OJ3A 3ZZTA 4OI2A 3CT9A 3PW0A 1OMSA 1HWJA 5E3QA 2XQCA 3QLHA 1Q5YA 5KFOA 1QSYA 4RL1A 4LF5F 4NYOA 1IBKF 2YQ0A 2C2DA 2XMJA 5FJ4A 2ZE2A 3QT6A 3MEDB 1HBMB 4HI2A 3MAAB 1UCNA 4IFVB 2JLFA 2WVDA 2AX1A 2LFVA 3U7JA 2E66A 1RAAB 3TWZA 4OYZA 4RW9B 1X8DA 1KHVA 5C7PA 4MJKA 1URNA 1NJZA 2JEGA 4F3OA 2N4DA 2XEXA 2V0NA 2XSJB 4NX9A 4FPRA 3D9BA 5A8WB 2EC0A 4ECYA 2YNFB 3JQJA 2RKIB 4UOGA 3FDSA 4TQRA 4HL9A 2RRAA 3IAS9 4OI3A 2ZH7A 4XTTA 4LF2A 1D9AA 3SCJE 3D28A 4DCOB 2MZJA 2H5IB 4DLGA 1JJHA 2MYFA 2MTLA 1TVRB 1S6PA 1U8SA 3L3CA 4L73A 4MK9A 4MYUA 4PABA 2QLWA 3I55S 1Q4RA 1S4FA 4MKVA 3OL6A 3Q8SB 3UCGA 4YFUA 1MU2B 1RABB 1K0TA 1WI6A 5JXSA 1BC6A 1N34F 3V4MA 1T7PA 2FZKB 2GIFA 1XNQF 1S7IA 1RWNB 1NK8A 3C16A 2W2OP 4LF9J 2BA9A 3C15A 2XTJP 4NYZA 3MXHP 1TUGB 1JXVA 4IG3B 1ZBTA 3UNGC 1HQ2A 4Q5VA 1UTAA 5HP1A 2DHXA 3HFZB 2DPIA 1SQGA 4K2JA 5ETLA 4ZLLA 3EZ5A 1QM9A 3MFIA 2VBZA 2ZWOA 3VAMA 4DV3F 2KYXA 2E9TA 2NCKL 4C7QA 3BSCA 2JSXA 4ELVA 3M9MB 2VD3A 1HNZJ 4QYZJ 3NKYA 1FD2A 2J5AA 1H7XA 2QL9B 4I56A 4TLRA 2BKPA 3CSKA 2QA2A 3GYXB 3GIKA 1S1WB 5MLCV 2V8PA 4JI8F 1UWBB 3MR5A 1HNXF 2RHQB 4IFYB 4F0HA 1OYDA 2XWYA 3HJVA 3NMRA 2DNRA 2LVWA 5CYQB 2V8DA 2YWKA 5B0BA 5IT0A 2L9WA 2OPPB 3AXMA 3ZTQA 1XC9A 3IG1B 4CLWA 2WW8A 2FHOB 4WTYA 2XM3A 2QE5A 5DG7A 5AJ3J 5AXKA 1KVIA 1VQMS 4C3MA 3ZZPA 1HQEB 1FFGB 4OV6A 1VC0A 5DGAA 1KD1T 2HHSA 4K5RA 3DCAA 3IR7B 2MPUA 4CO1A 3GIJA 3EVWA 2V2ZA 2H4YB 3CNQP 2R7VA 5LSRA 1S48A 2LYVA 4KGMA 3NRBA 1TV6A 3OTOJ 2ZOMA 1BE4A 4ZLNA 2G1HA 4URQU 3OD2A 4DR6J 1U1NA 3H98A 4HEA9 1NK4A 3CCRS 4LR7A 3M2UB 1NSQA 2FJBB 1X9SA 4DSIA 1WUUA 2ZOFA 3OXLA 2QZ8A 1VLYA 4OHXA 1Q78A 3HVTA 3CEDA 1PBUA 3IWLA 4B3SF 1N5QA 3T1HF 3EGVA 4X4RA 4ECZA 4K0KF 1HQUB 2YQ3A 2M7SA 3MMBB 2R7XA 1AXQA 3RYLA 3C8YA 2BKNA 2IHR1 4E0DA 2J7WA 2IYGA 1RSCA 1N32F 4X64F 3CTRA 3RZAA 2C3MA 4FS1A 1RACB 1HBUB 4JBCA 1MSWD 4XK8C 3VAGA 3ENVA 3G6ES 2P6SA 3POTB 4JV2A 4H4KC 2VIHA 4YR0A 2BACA 4ILLA 3ULHA 1G1XA 3IS9A 5E3AA 2U1AA 1FT8A 2C3OA 2ZZTA 2DNKA 2BE9B 4N5SA 2CPIA 1GMVA 4NYPA 3QBCA 1P1TA 1YZ7A 2C3UA 1DTQB 4B3TJ 1WC0A 5I42A 1ZOTA 2G1DA 1EETB 4CLYA 3DRRB 3IMQJ 3CJ2A 3SSSA 3OTDA 4LRAA 2KL8A 1M5SA 4CLLA 1S77D 1KQGB 4C11B 5F8GA 2RMLA 4DUYF 2E5LF 1NK0A 2V8HA 4FVCA 5L9XA 2POKA 2B56A 1KC8T 2MQMA 3BKUA 1KTVA 4AUKA 3AD8C 4ZA1A 1RTHB 3TA1A 1RT4B 2KTQA 1S97A 2GCFA 1CJVA 3IRXB 2WB1D 1JIHA 1Q0NA 5HN0A 2ZVSA 4OHYA 2CAJA 4M5DA 1QE1B 2QX0A 1X4GA 1MG7A 3MM5B 4ERDA 1TK0A 3PDNA 1UKUA 2DHHA 2MKSA 3QT7A 5E3PA 1B0VA 5A76A 1V3SA 3I4PA 3WC0A 2UP1A 2KDOA 3FMWA 3N79A 1YK9A 3FNNA 4PG8A 4OZLA 1RA6A 4LMZA 4NCAA 1RWXB 3KK1A 1NU4A 2JC0A 4B08A 4CNYA 3FSIA 3ZZYA 3MMCA 3CUNA 1P8GA 1O6XA 4OHVA 2IBOA 2F4VF 4BBYA 4NLGA 3N6NA 2PI4A 2CVEA 2VKZG 3GCWP 1IJEB 1HPZA 1RWKB 5B09A 3KLEB 3MEEA 2VFTA 4CYUB 3G82B 1WG5A 5BJRA 3UR3C 2L41A 2LA4A 3PRBA 4WFBQ 1U49A 1TKDA 2MKJA 4F3QA 1U1LA 3IBCB 2UXCF 4JI3F 3CIMA 4WFAQ 1FF2A 4B9MA 3LP2B 3DHWC 4ZPTR 2ZEJA 4DR5J 2BRKA 5DZ6A 3PO4A 4CO5A 4EO8A 4JI6F 1D3WA 4LF6F 3PW4A 4IO1A 1T95A 3GJQB 1J5EJ 1FDDA 4ZCKA 4LRCA 4ZDNA 3RUBL 4RUHA 5LSLA 3IFEA 4O3SA 1XJWB 3MZIA 1P6TA 3CGIA 2VPWB 3ZTPA 4ATNA 3NWGA 3BPDA 4HR2A 1TUWA 1T3OA 2AEFA 4B3OA 3D6MB 2LEAA 1BWEA 5D4PA 1NSKL 2CWXA 4ED0A 2HNYA 3QRPA 3LGNA 1NM2A 2H4WB 1U0HB 2B4VA 5KFTA 2JL9A 4I7FA 5IC4B 1DLOB 4CCHA 5HLFB 2CZ4A 3L4BC 5AXLA 1S6OA 1Z4UA 2PD1A 3NLCA 1X4BA 4J9SA 3IM9A 2KHCA 3ENAA 2BQRA 1CLFA 3CD6S 1EX8A 4HT7A 1Q8BA 2F7VA 3G86A 4A47A 3SSRA 2H5EA 4P9SA 1IN0A 2WOMB 3O44A 1O5JA 5J2MB 2C2ZB 1RTIB 4L3NA 4O3NA 3V6DB 3OBIA 2Y1IA 2F8HA 4TU7A 2G2OA 3UD3P 1LWFA 3ZO7A 3PY8A 3V6HA 1O51A 3TAMA 4PYAA 3M30B 1H0HB 3I0RA 1WHVA 2V69A 2BE7D 1Y5NB 1TFYA 4WE1B 3HP6A 4U67Q 1U1QA 1PGZA 1BQXA 2OSQA 3Q23A 1TP7A 2AJ2A 3EJMA 3CDUA 4ES3A 4GVBB 1S5ZA 1SQEA 3CCTA 3KLVA 1T9WA 4GO7X 3FFIA 4QBUA 4DR7F 4DV4J 2G4BA 3GIMA 4J9VA 5LOQA 1KTQA 4H4MB 1JLQA 4DU8A 2BANA 3M05A 4DV7J 2FC9A 1XERA 4ZS6A 4CT8A 4IDKB 4LSLB 2ZOGA 2VG7A 1ACMB 3Q8UA 3FCWA 2UXBF 2GVDB 5DO2A 1YKWA 2KT2A 2W2PP 4H54A 3OR2B 3UDCA 1RQ0A 3CF5Q 4G1IA 3W7BA 3M8QB 3LQVA 4X4PA 4ID8A 1N5TA 4A8MP 4DSEA 2YKPA 2VOOA 4YN3B 4J9QA 1UL3A 4X66J 2B4PA 1RHKB 2XMUA 1SV5B 2ZBQA 2FQQB 4JI5J 4PRFA 5F8JA 2YWFA 2VQEJ 4WJBA 2RD5C 3BREA 4GMKA 4RBTA 1RTJB 4TXSA 2MXYA 3OVSA 4HTIA 2XZWA 5KTQA 3NAHA 4M5GA 4OX9J 2CIMA 2GQ2A 3F44A 4OZ0A 2OELA 4PXBA 2I6WA 5KFJA 1S0VA 3FMBA 2GS8A 3VWSA 2VC1A 3TRGA 2P9EA 2ZH9A 5HQ8A 2XO6A 1KBRA 2PN6A 4TN2A 3ISND 1IXKA 4C0OC 4W4MA 1WC3A 4PEOA 2FVCA 3TVZA 3BQ2A 1RT6A 1F2GA 4KBIA 2YNIB 4C4WA 3MPYA 1RU2A 4H4OB 2LQ5A 3OLAA 3VAJA 3K5PA 4ZPDA 1KRPA 3JSMA 4N56A 1NUEA 2AJQA 3F73A 1F60B 1RBAA 4NXNJ 2XC9A 4IQMA 4MK8A 1IM4A 2HQGA 4Q45A 4P2SA 2ZBRA 2C28A 3K89A 3EUNA 2OPRA 3HHDA 4W98A 1RZMA 1ITPA 3PX0A 3PKYA 3ZZZA 4K4UA 2LQJA 2YNGB 2M5YA 4CZCA 1NRKA 4NLTA 2ASLA 3BKFA 3M2RA 4RW4B 3PEJA 5IT9Y 3MUTP 2KFYA 3NCPA 1WEZA 5KFBA 5GADU 2XLIA 4QIWD 3H5XA 4ED7A 1M1KT 1F2HA 2A2DA 4V19J 1NMEB 1XMQF 5KT3A 4NMLA 3HM9A 1WSRA 4ENOA 4ZCLA 2MKIA 1CJUB 2W9CA 3KNGA 4WFNQ 2AKWB 3WBZA 5F41A 4DCJB 1YJ9S 3R7BB 1UJ5A 1KWMA 3VR1A 3TX8A
chains in the Genus database with same CATH topology
1BQNA 2HNZA 3W2WA 4NLSA 4PQUA 3MI7X 3SMZA 1SJ4P 1GX5A 4CO2A 4ZMMA 4DLEA 1TL4A 3TVYA 3N01A 1JLEA 2N3LA 4YOEA 5C5JA 1VQ6S 2Y1JA 2O67A 3GFYA 3AY0A 1VBXA 1MMLA 5LXYA 5LJ3Y 1HD1A 5GVQA 3KK1B 2E7WA 2AJFE 2DGTA 1NZAA 2DK2A 4RKUC 4DHVA 2R8IA 1L5UA 1RT7A 1N4LA 3LUYA 3RU0A 1DJ0A 1FDAA 5KFRA 3UW1A 3MMCB 1S9GB 4Z37A 2J0XA 4Q43A 2R9LA 5FDLA 1X5SA 4URSA 4ECUA 5D78A 4LIRA 1XK8A 1M0SA 2QMXA 2OLWA 5I3QA 2JZ5A 3S8SA 2E1MC 5I3UB 2IM3A 1VQKS 2WBMA 5E2QA 2BUNA 3DLEB 3PR4A 4Y2MA 1NNDA 5K14A 1UJ4A 5B7WA 3MM8B 2E5IA 1Q86T 1S1VB 1VQNS 1HPZB 3K8WA 1ZTWA 1Y7PA 3CD0A 3T6BA 4TY9A 1ZYQA 3LP0A 1WTFA 4F4XA 1OQ3A 2YKMB 4ES2A 3PRDA 3KMSA 2QA4S 4I2QA 1P1LA 4DV5F 4JUZA 3DHXA 5GADI 2HHXA 3UE2A 4KV8A 2ZH4A 1NKEA 1IKVB 2EI5A 2KXFA 2ZNZA 1IR0A 1FRXA 3KKFA 1U1RA 3QO9B 4RW6A 1S1VA 2MQLA 5KFAA 2FHMA 3L7PA 4LSNA 2JEJA 3FQLA 2HWHA 1S9EB 2LLZA 1SJQA 1JWWA 2FJVA 3DYAB 3UI3A 1LWEA 4ZP9A 3O8WA 3SQGB 4GKKF 1FDBA 2IRXA 2AU0A 3I6PA 2NSBA 2A1BA 3M32B 2MJUA 4QR0A 2YKQA 4MYTA 2FHJD 4ED6A 1JXLA 3QO9A 2HHQA 2W9BA 2RU9A 2DGOA 3MWBA 2I38A 5DRKA 4ECXA 1N5YA 2OKQA 3GR1A 5HMXA 4LFBF 4I0WA 5G0RB 1SJFA 1SH2A 3OVBA 4I67A 4ZP8A 2MQQA 3CMES 2COLA 3TO8A 1R89A 3VAKA 2I0XA 2GO8A 3G9CA 1R8BA 2ATLA 1KOOA 3B82A 3M2VB 2BQ3A 4Q2MA 3VTIA 1ZAVA 5DM7Q 1FRMA 2LU1A 3Q2SC 5KT7A 2ZKUA 1NK9A 1IJFB 2MZSA 2FVQA 4ELUA 7FD1A 2Q43A 3C6TA 2Q6CA 1FRLA 4OFZA 4Q0BA 3B78A 1GTEA 1M5OC 3QPIA 4ZLPA 2VKRA 5K8PA 3OSNA 1I1GA 4YEAA 5KG7A 3LW5C 5DG9A 3M2VA 3NBPB 1M5VC 3HZEA 3BSNA 1LXJA 2DO0A 2VQEF 2DGQA 2E29A 3LH2S 1H98A 4IRDA 3RRGA 2F3JA 4B3OB 4H4KA 2DHSA 2NR0A 5KFDA 3OTOF 3MEDA 1C4AA 1HBMA 4I6AA 4M1KA 3LP1B 4TLQA 4IFVA 2E5JA 2X3GA 1OSDA 4AXJA 3CULA 5JJBA 1SL0A 2LDIA 4NLWA 1UVKA 1H2UX 1WD6A 2HNYB 3QAEA 1C0UB 4KPYA 1C0TA 1C1CA 2EFOA 1VQOS 1FRIA 3BGLA 2DRAA 3TAPA 2UVRA 2KFZA 2OMOA 1S6QA 2DGUA 4OX9F 3ZZ0A 2V5HG 1V3ZA 4NA1A 2UV8A 3HXMA 3CCUS 2OPSA 2FJEB 3HHLC 3MECB 1R8CA 1TK5A 3BB5A 2UUWA 4I6YA 5A0YB 5JVHQ 2BRLA 4I7FB 5DLGA 3E3XA 3CCQS 3GR0A 4ZP6A 2V94A 3JYTB 5HROB 2ZJPQ 1VQ7S 4UOCA 4J9RA 2J0QD 4ZPBA 5HMWA 3KK3B 5IQQA 1TL1B 4B9LA 1RTDB 2W7AA 1JKHB 4O3QA 2EKYA 5D6GA 2FTRA 3KLIA 3PJXA 1YHQS 1U1OA 2FLNA 5A0YA 2D74B 3BO2A 3JYTA 1HBOB 5HROA 2XSJA 1N6QB 4DF4A 4DF8A 2DNYA 2GIRA 3IR6B 4OJHA 5KG6A 3UDLA 5A8WA 3Q24A 4LQ3A 1IKXA 4DQIA 2YNFA 3GFXA 3PW2A 5HMZA 2RKIA 1T05A 2O01C 2UUAF 4P6QA 3TVKA 5L1LA 1H38A 1CQNA 3I0SB 1ZH5A 2CQCA 2X1AA 1HBOA 1HYSB 3GFZA 5B0FA 1JLGB 3SCIE 4DPOA 5B0DA 2GGPB 3AHPA 2R2UA 3Q22A 3PKMA 4BWMA 2JOQA 3VZHA 1X5TA 4OZNA 4OI6A 2M3DA 2EBEA 2B0GA 2BXJA 3OR1B 2W25A 4ID5B 1S99A 4OLOA 5D8HB 1YJRA 4DBQA 3I0SA 1JLBB 1TVRA 2YWEA 3BJYA 1JLGA 1N33F 1O8BA 4IH5A 2MY7A 4WFZA 2HVZA 4CH0S 3MM9A 4IG0B 5J1PA 2UVWA 2KYZA 4C8YA 1TZ0A 2XNQA 4RBUA 3J7ZT 1XNRF 5K9FA 3ZZRA 4C97A 4O4GB 2R7OA 2APOA 3H40A 2JEIA 4F02A 2NXUA 3MR6A 3BN4A 5AE3A 1FXLA 2PC6A 3LWMA 4K4XA 3I0RB 1V3RA 3PR5B 4PUOA 4NXNF 2AV5A 3CCES 4XPEA 1DBDA 2D9PA 1TR0A 3KMQA 1HI0P 4DV0F 1YIJS 2QT7A 3P96A 1VQLS 3X1LB 2GMLA 3OFGA 1JLCA 2VPYB 4I69A 3HKWA 1WG1A 2GNKA 2RE1A 3M9NB 3TARA 1OPIA 1DARA 2MHEA 1UMJA 1HFEL 3CDEA 2DNQA 4OHWA 2CQPA 3G96A 3GWCA 1TKZA 4M95A 4QU6A 4NCBA 3THTA 4WCEQ 3KNAA 2W7PA 5IT4A 3CJKB 2MZQA 4CO3A 4B9VA 3IAM9 2FIUA 1K0VA 1ELOA 4O0IA 3QGIA 2DRBA 2R8HA 2HNDA 1MROB 1FA0A 2DIUA 3CCLS 3FFIB 4NLVA 1ZZNA 4A4JA 4CI0B 2I9SA 1IQZA 4X4VA 5KFKA 4UY85 5DM6Q 1XN9A 2WSFC 2B7BB 2QRRA 2HWTA 2M88A 1RP5A 2NUUG 2HHTA 2HFZA 5KFQA 1U4BA 1OSCA 3RBEA 2M52A 2AJ4A 2L08A 4YMEA 2OIHA 2CJBA 3L7OA 4JI0F 2HPUA 3EZUA 1XR7A 2FLLA 3TOQA 1FNOA 2P9GA 5F0WA 3CWJA 2K3IA 1TL3B 2V4JB 5J1NA 1UVLA 5A2QY 4ES1A 2KO1A 5IXUA 2N4CA 3HHNB 2F40A 3KLHB 2F8EX 2JWNA 4UUWA 3KHGA 2WB4A 4C0BA 2ZH5A 4QIFA 5HMYA 1JB0C 2HWIA 2VBYA 2VG7B 1WHXA 4D3HA 3HO1A 2RILA 3KLFA 1FKOA 3DOKB 2RT3A 2V4JA 4A8OA 4OX8A 1MW7A 1YG0A 3FZ2A 1GAOA 1SH3A 4I68A 2GQQA 2ZKTA 1NO8A 4YY3F 2ZC3A 4TNOA 5FLXY 2WAQD 1QY7A 5KFYA 2GHVC 2Q79A 2ROEA 2AYMA 2GW8A 2AGQA 2YWHA 5KFVA 2PDAA 2J6SA 1ZM9A 4AXIA 1TKXA 3MM6B 2E9ZA 4DL0C 3AB2B 2ILZA 4Q7AA 4KFBB 1WACA 4PG4A 1Y5IB 3KLGB 2OTLS 4WF9Q 2R8GA 3KHRA 4DN0A 3CE8A 2CVIA 2E5GA 3MEGA 3OVAA 2CYYA 4X4QA 4FVMA 4NZ0A 1LXNA 1NK5A 3EGNA 4ZVEA 4F8RA 1ULRA 3MHYA 3HT3A 4ECTA 2BJDA 2DR8A 2AJ0A 1YQHA 2IC3A 3H5UA 1UWBA 4Y2CA 5C25A 4YB1P 4A8WA 2V9WA 3MM6A 1HWKA 3PHEA 2IJNA 1NKCA 2IM0A 4KFBA 1WWHA 3M6UA 3KHHA 4IFYA 3CC2S 3M1VB 2KXHA 1FCAA 4MTPA 4Y28C 3E8OA 5E7OB 1S72S 2ASYA 2RNEA 1QTMA 4ECWA 1HNIB 2WONB 3DU6A 5CYQA 1REVB 5L1JA 2XG8A 5B0CA 5KFMA 4X65F 4K4YA 4RWWA 4ECVA 2HHHF 1F5BA 2W8KA 3PACA 1FRKA 3H4DA 1TAQA 2CG4A 3MM7B 3E2EA 1FJGF 2K7JA 1KR4A 1XTZA 3M1VA 5DGBA 3J80Y 2PGCA 4ED5A 4C98A 3IG1A 3R3TA 1H2VZ 1YITS 1D8ZA 4MH8A 4KO0A 2LXUA 2XS7A 3LO3A 2CQ1A 2HLTA 1Z1ZA 2MGZB 2J0WA