2OIHA

Hepatitis delta virus gemonic ribozyme precursor with c75u mutation and bound to monovalent cation tl+
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HDV ribozyme
publication title Structural roles of monovalent cations in the HDV ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oihA00
1FO1A 2L41A 1YHQS 2ERRA 4P6QA 3H2UB 2MQQA 1VQ7S 1Q7YT 2F3JA 1NU4A 2XS5A 1N52B 5LSLA 4Y00A 3DLLQ 1U1QA 2MMYA 2D9OA 4W92B 5GAHU 1WF1A 2GHPA 1WHVA 5GVQA 2LCWA 3G8TA 4TU8A 2QA4S 4WFNQ 1SJRA 3NMRA 1NJIT 5H1SV 5IQQA 2DIUA 3B4MA 3HI9A 1YJWS 1D9AA 2J0SD 1NO8A 4CQ1A 5LJ5Y 2LEAA 3MOJB 1A7GE 1WHYA 1VQ8S 1B7FA 2KXHA 4WCEQ 2M9KA 1WF0A 2E5JA 1N54B 2RNEA 4PKDB 2V94A 2CQBA 1SJQA 2FC9A 2WBRA 1WTBA 1A9NB 2N7CA 1X5PA 4RU2A 4LMZA 2LA4A 2NLWA 2X1GA 3OW2R 3CMES 2JWNA 1OIAA 2U1AA 4UY8T 1KC8T 2MGZA 3CCMS 2MZJA 3MD1A 2O3DA 1X4AA 3LQVA 1U1OA 2CQ1A 2E5HA 1VQ6S 3CMAS 2CPYA 3J7YU 2RVJA 3JB9k 2CQ0A 3CCJS 1HD0A 2OTJS 1U6FA 2L08A 1KQSR 3B4DA 1VQKS 1IQTA 4WKRA 1Q82T 3CCES 3P49B 1HA1A 1AUDA 5DDRC 2QFJA 3G6ES 2KRRA 1VQ4S 3MUTP 3UCGA 2CQ4A 2KN4A 1X5OA 5DDPC 3VAIA 2X1FA 4J5OA 2DNPA 1O0PA 2KXFA 3IWNC 2CPZA 1VQNS 3G9CA 2KHCA 3LPYA 2X1BA 2M88A 1DZ5A 4TU9A 5LXYA 2D9PA 4WF9Q 1RKJA 1JJ4A 2XSFA 2RT3A 1KOOA 1SJ3P 1Q86T 1S79A 1K73T 4F26A 1OO0B 1URNA 3ZZYA 2LXIA 1U2FA 2MY7A 2DHAA 2MZQA 5DDOC 2LQ5A 2M4MA 3P3DA 5EN1A 2RS8A 1SJ4P 1X4BA 2DGTA 5LJ3Y 2RU3A 1KOHA 3CF5Q 1VC0A 2DNGA 1H2UX 2CPHA 3TYTA 2XNRA 1G2EA 2RUGA 3PIOQ 2N3LA 2MQMA 2CQPA 1QVGR 3SMZA 4TLQA 2CJKA 1U1RA 2RQCA 1WHXA 4IO9Q 1UAWA 2MQNA 2KM8C 2E5IA 4YOEA 5HO4A 2B0GA 1R8PA 4PR6A 2L9WA 4YUDA 2DNMA 2DO0A 3G96A 3HHNB 3ULHA 4EGLA 3NNAA 3BS9A 3RW6A 1X4FA 2ADBA 1OPIA 3UCZP 1WI8A 2MSTA 4OZ0A 2J0QD 2NZ4A 1X4CA 2KVIA 5HL7Q 1FJEB 2DH9A 1U6BA 5LXRA 4ZKAA 2DHSA 2DNLA 2E44A 3S8SA 2HGLA 3CCQS 5GAEU 3PIPQ 2J8AA 2KM8B 1U1LA 2M8DB 3Q2SC 3THTA 2M52A 3CC2S 1M5VC 3SDEB 1Q81T 1JJHA 3S01A 1VQMS 2MXYA 3K0JA 1BY9A 2CQIA 3H2VE 2YH0A 2MYFA 3BO3A 2DH7A 4FXVA 4ED5A 5IM0B 1VQ9S 3SXLA 2AYMA 3MURP 1DBDA 1UP1A 2MKHA 3CCLS 2DGSA 2OJ3A 3VAGA 4QU6A 2I38A 4F25A 1X0FA 2ZJPQ 3R27A 2DHXA 5GMKa 3SDEA 3J7ZT 4WIIA 1YI2S 1F9FA 3N9UC 1FJ7A 2M70A 2DH8A 2MPUA 2MHNA 2AYEA 4WFAQ 2LECA 2MZTA 2KT5A 3UWTA 5LSOA 4CH0S 3UE2A 3TP2A 2AD9A 2XB2D 3NNCA 2JVOA 2MZRA 3VAHA 3Q2TC 1YTYA 3NS6A 2YWKA 1H6KX 2DNRA 2LYVA 2A3JA 2DNQA 1M5OC 2DNZA 1X4HA 2DITA 2GO9A 2MQPA 1VBYA 2G0CA 4IOAQ 1H2TZ 3MUMP 3P6YC 3US5A 5MLCV 4C4WA 2JRSA 4F02A 2DNHA 3I56S 4A8XA 2XNQA 2FHOB 3G4SS 4UQTA 2Q79A 3UD4P 1WWHA 2CPEA 1DHMA 2PE8A 3U1LA 1S72S 2I2YA 3S7RA 2DK2A 3MD3A 2MZ1A 1FHTA 2CPXA 1PO6A 3ZZZA 1W2BR 2BOPA 3S6EA 2DGVA 2U2FA 2CQGA 3BO2A 1VC6A 1D8ZA 4W90B 2MKCA 5ITHA 2OIHA 2BZ2A 2LXUA 2DGOA 3V4MA 2OSQA 4V19X 2JVRA 2OTLS 4LJMA 1M5PC 2MKKA 4Y0FA 3L3CA 2M8HA 1VBXA 1ZZFA 2CPDA 1VBZA 1HD1A 1U1PA 5CYJA 2MZSA 3UCUP 2MJUA 1RK8A 2XS7A 2YH1A 2K8GA 3RW7A 2DO4A 2ZJQQ 2DNYA 2DISA 3FEXB 3VAMA 2M2BA 3CCRS 3R1HA 1YIJS 1QM9A 4U67Q 3CXCR 2RQ4A 1FJCA 4YB1P 1UW4A 3MI7X 1WG1A 3CULA 1WI6A 1X5TA 3CC7S 1WEZA 4ERDA 3TO8A 1WG4A 2CPIA 3NNHA 2DNNA 2CPFA 5BJRA 3R1LA 3P5TL 5DDQC 5DETA 2DHGA 2CQ2A 5DM6Q 4LIRA 1FXLA 1X4EA 1JMTA 5D77A 2XS2A 3MDFA 1JJ2R 1SXLA 2DNOA 3VF0B 2VODA 2F9DA 1PGZA 5GADU 4IOCQ 1OWXA 3VAFA 2DNKA 4QPTA 5DM7Q 2RRAA 5CA5A 1CVJA 2VOPA 4M5DB 1P1TA 3CUNA 2DIVA 4CH1A 2DGXA 1VQLS 2LEBA 4CIOA 1K8AT 2MQOA 2DB1A 2X1AA 2DGWA 2RS2A 2MGZB 2YTCA 5JVGQ 2KFYA 1WHWA 1M5KC 2EK1A 1KD1T 1VQPS 2YKAA 1N88A 2FC8A 2UP1A 2MY8A 2KYXA 2ADCA 1ZZNA 1FNXH 5IM0A 3NS5A 3U1MA 2LA6A 4C0OC 2M0GB 3BO4A 3UD3P 1WELA 1P27B 1U1MA 1X4GA 2MKSA 5IFMA 4WFBQ 2VOOA 4TU7A 2KXNB 3CCSS 1U1KA 2ZJRQ 1YJ9S 2AYBA 2EVZA 2JX2A 2MB0B 3G71S 3CD6S 3EGNA 3I55S 1HL6A 2LMIA 3VALA 2CPJA 3VAJA 2HGNA 2M7SA 5JVHQ 4BS2A 2PEHA 2CQ3A 2AYGA 1X5SA 1L3KA 2HGMA 2CQHA 3EX7B 2MKIA 3FEYB 2CQDA 1XN9A 2F9JA 2N82B 2FY1A 3BEGB 1R8HA 2LKZA 2QEXS 3EGZA 2KRBA 2OSRA 1M90T 5FJ4A 2E5GA 1K9MT 2SXLA 1U1NA 1YITS 5GAGU 3CPWR 1DRZA 2VONA 1H2VZ 2DGQA 3DXBA 2G4BA 4QU7A 3D2WA 2HYIB 2K3KA 2DGUA 2FPHX 1WEYA 2MKJA 2MQLA 3CC4S 2N3OA 2D3OR 1WEXA 2HVZA 1SJFA 1QVFR 3VAKA 2G1DA 2KU7A 1UFWA 2MSSA 1YJNS 1FT8A 3G8SA 5CXTA 1X4DA 4C7QA 4Z2XA 1WG5A 1YWXA 2CQCA 4OZ1A 3CCUS 1WF2A 1ZH5A 4IUFA 4FXWA 1N8RT 2EK6A 5D78A 2J76E 2KG1A 2HZCA 1VQOS 2KI2A 2MJNA 1M1KT 3MUVP 3CCVS 4QQBA 2KH9A 3CTRA 2RRBA 1VC5A 3MXHP 4PRFA 1VQ5S 3THPA 2KG0A 3IRWP
chains in the Genus database with same CATH superfamily
3KDOA 4O23A 4JYAF 3DDNA 3E2EA 2R9LA 1PSDA 4ZVSB 5K14B 2AEJA 1KP6A 1U1QA 2QO3A 3KG4A 4M95A 1WHVA 2LCWA 4TU8A 3R6LB 4RW6B 4H4KA 1NBEB 4DR2J 1FFSB 4CWBA 4U8VA 2FJAB 4JV5J 5H1SV 1RT7A 1LV5A 3KJQB 1ELOA 5CYQB 2KL8A 4X65F 3TAMA 2KXHA 2VBWA 1RU2A 2F4VJ 4OX8A 3DI6B 2HRTA 2V4JA 3AJ1A 3LH2S 5J2NA 4PYDA 3DNCA 4ZVPB 1CJUB 5K8MA 3CMAS 1UPPA 2WVEA 2FJDB 2CVIA 2B5JB 1KQSR 1VISA 3J81U 3P49B 3Q89A 3BSOA 3VCDA 3GE9A 5E3QA 1KFSA 2F8HA 5CZVA 3H4DA 2I0XA 1XMQJ 3GR1A 1I94F 1BUXA 4XIUA 3W9IA 1ZPVA 5ETPA 2Q6CA 1B64A 2EFGA 1DZ5A 3H25A 1IM6A 1JJ4A 3CDUA 4Y3CA 4CLPA 2JZ5A 1OO0B 4F3QA 1WUUA 2V69A 5DDOC 1SJ4P 3G86A 4M5HA 2RU3A 2BJ9A 2R2UA 2IJRA 5IV3A 4DV7F 3AJ2A 3U7JA 4NYZA 3EE3A 2F65A 4BC9A 3MEDB 2PMWA 2OEJA 2DY9A 3FFIB 1PC5A 4URSA 2XMKA 3UDVA 1JXVA 4FYYB 2G9OA 4B3RF 2DHSA 2W24A 2ZE2B 2W9CB 5EWGA 1EJ7L 2J8AA 3CC2S 3QQCD 3JSBA 1YDLA 4QIGA 2HFOA 1ROFA 1VQ9S 2AYMA 4O3SA 3I9ZA 3RGIA 2DGSA 2LLZA 3D54A 1TMMA 2K3IA 4FXDA 4F25A 4DV1F 4DX7A 1GMVA 3SDEA 1RGVA 1G1XA 3EPIA 4WFAQ 2LECA 1NDLA 4KB7A 4DV2J 1HWIA 2PA8D 3M1VA 3TI0A 1MMNA 1IBMJ 1M5OC 2DNZA 3SQGA 5HP1B 4PQUB 2BKPA 3ILLA 3T5JA 3MUMP 5EHHA 2B9YA 3FRYA 1K47A 2KT3A 2CA9A 2YPZA 4B17A 4O3RA 1FHTA 3GJSB 5B0EA 4B9TA 2XZTB 4R0JA 1FX2A 4DDFA 4IQXA 1M5PC 1RT2A 2M8HA 3M32B 2MJUA 1WKKA 2W2QP 3HZEA 5BR8F 1SUQB 4F0KA 2QMUB 1ZETA 1QSYA 2ZC4A 4QR0A 4CM2A 2W7AA 3CC7S 4ZHRA 3D67A 4I56A 3A3PB 3KLHA 1FRLA 4JI5J 4USKA 2HNZA 2XSJA 4G1IA 3CJKA 3TR5A 4P2FA 2I1RA 1B0VA 2R7WA 3IS9B 1GT8A 1WC5A 4QPTA 3NL0A 2QYCA 1G7CB 3JTPA 2NS1B 4DR1F 2BR0A 3BGRB 4JI8J 3CUNA 3AODA 4J9KA 2HMIA 2HW3A 3UVJB 1SIZA 2QJ3A 2JEFA 4I2PB 3V6DB 2YNGB 4KE5A 2AYBA 2WVCA 3LA0A 4YB6A 2VD3A 2RUSA 1HL6A 4B9SA 2ZH3A 1LWEB 3NMAA 3DRSB 3CT9A 1TQLA 2BJ8A 3H40A 2CQ3A 1YBTA 2CQDA 2BXJA 1NK0A 4O4GB 1N32J 1K0TA 3PKYA 4E98A 1QE1A 4F4WA 3IFEA 4YQWA 2VONA 1RYRA 2XTJP 4EMDA 1RADB 1NM2A 1NMEB 1WEYA 5CQGA 1HWKA 3CCZA 4YB5A 2V9KA 2MSSA 2IVMA 1X4DA 4QR1A 4RR5A 3FC9A 4IUFA 5I42B 4Q8FA 2H3EB 1IR2A 1SJ1A 3HZGA 1VHFA 5A8RA 4NCGB 3FBCA 3CJ4A 2KG0A 3TANA 1NNDA 2DRBA 1FVSA 1S6UA 3HX9A 2CJ9A 4RZRA 2CJYB 3GFHA 4LVNP 4UF4A 4LFCF 1R6YA 4QYZK 4YS2A 4LF6F 1MN7A 1BQXA 2GJFA 5DS7A 2BE9B 3ZTSA 4NLRA 5H9FK 4DXLA 4Q43A 4MK8A 4XK8C 2R7XA 3MOJB 1L3VA 1WHYA 4DCOB 1VQ8S 4GC7A 3H98A 1N54B 4RW6A 2V2KA 1EETA 2ATLA 1X60A 2H4WB 3HKWA 4YHHJ 3OL6A 1TKTB 3AHPA 1OYEA 2QLWA 4O4RA 4KJIA 4ZIVA 5DGAA 3OTOJ 1R7IA 2Y9HA 4OHVA 1XNRJ 2BOAA 4J9NA 4ED0A 4QBUA 1FDNA 1TP7A 4LRAA 1F3FA 2UZAA 1C1BB 3ITHB 1OS5A 4NEZA 1FI4A 4RNNA 4ECRA 4DSJA 3D1OA 4TKTA 4ZVRB 2DHAA 1Q16B 1NK8A 4UQGA 1NJXA 1Y7PA 5EX0A 3TYTA 5GADI 4YR3A 2XLKA 1S1WB 1UJ4A 3MMCB 3SMZA 2C1EB 2F8EX 5A6PA 4WTOB 4IO9Q 2VFUA 2E5IA 1HNIB 2FHKA 4NLXA 2MLXA 3MPDA 3VTIA 4ZVUB 4J9LA 2DNMA 2DO0A 3HHNB 4USHA 2FDNA 2YNIA 3WX8A 4X4SA 5HL7Q 4NA1A 5KFDA 1FJEB 1HPZB 2ZZNA 2HWIA 3MECB 3LP2B 4ZPTR 2X7IA 4KGKA 3OV7A 1OSCA 3FFIA 4BWMA 2HHTA 3C46A 2Y0SD 1O6XA 5IM0B 5H9EK 2AIRB 2WW8A 5HBMB 1WOSA 2ZBRA 2FHMA 3TVZA 4KQZA 3OVSA 4RW8B 2EC0A 1RZMA 2XWYA 1T8EA 1TV6B 4P52A 1FJ7A 3RRKA 4R5PB 3T6BA 3T9NA 3FKBA 1FTCA 2QZ8A 1LNQA 3C16B 2CPEA 4O44A 2MZ1A 4ELVA 3VZIA 5C7PA 2Z2LA 3SQOP 1U0HB 4YDDB 3MEGB 3ICLA 4AXIA 5ADZA 4Y0FA 2J9DA 3BGUA 2MZSA 1KNZA 2HQ3A 2BJEA 3MMAB 3DU5A 3I0SA 2XY6A 1UVLA 1ZAXA 3M32A 3DOKB 3R1LA 3Q83A 2BM1A 1SUQA 1U25A 4ZN1A 4XDDA 3Q23A 2JSXA 3IM8A 1RHRB 5T41A 3GIKA 1S9EB 4TQRA 2VG6B 3RBDA 3HP6A 4K50A 3DXSX 2DGXA 3AD9C 2LEBA 2AT1B 2X1AA 2DGWA 2IM3A 3SCJE 2EBGA 3IS9A 2COLA 3B54A 3A3OB 4DX8H 3BGRA 3W60A 2LQJA 2V34A 3PX0A 3QSYB 1FXDA 1N34J 2W8LA 1LWFA 1FA0A 3ZXWA 3FUYA 2N82B 2DVIA 3V6DA 2YNGA 5LT5A 5JMNA 2QEXS 2BMBA 3BQ2A 3UQSA 1YITS 4QYZJ 1LWEA 1RWVB 1VBKA 2CFXA 4B3SJ 3GMGA 3KXDA 2MQLA 2G2YA 4Q7AA 2ZWOA 3IG1B 2CQCA 3QFHA 1S99A 4OZ1A 1S4FA 3K5NA 1WC0A 1NRKA 4F4ZA 4QWAA 3IBCB 2BQRA 3MUVP 4ATNA 2R7UA 2Y8WA 3PCOB 4IG0B 1LOUA 3JYTA 2C2OB 3QJJA 3VWSA 4IOBA 1SQFA 2R7OA 2ERRA 1KHVA 3H2UB 1B70B 2ZKTA 3DLLQ 3NGRA 1Q8IA 3OSPA 2YNHB 2Q6BA 5GVQA 1QSLA 2OFHX 3CJ8A 4ZIWA 5C2CA 2D74B 2NUHA 3M8SA 2C2MB 1S59A 2FLOA 4QWDA 3CEDA 4IFYB 5G0RA 2GQQA 3LWMA 1AXQA 2B51A 2CXEA 2ZOGA 4KY3A 2V94A 1SJQA 3I82A 1A9NB 3SSRA 2AGOA 3I31A 4IH6A 4F4XA 4MIAA 3KK3A 2CQ1A 1R89A 2E5HA 2Y1IA 2CPYA 5B09A 2BJ7A 5D3GB 3AAWB 1WNEA 2XCPA 4LF2A 3M05A 1RWXB 1HYSA 1RACB 2HWHA 4URQU 3MUTP 3UCGA 3RRGA 2XMUA 1KTQA 4L72B 5H9EJ 4NEYA 1F6TA 2KO1A 2RS8A 2L48A 2QSWA 4LIWA 3OR2B 3QSIA 2BV3A 1RT5B 2XM3A 2ZH7A 1C1BA 1Z4UA 1WDDA 1G2EA 2HQCA 4USJC 2E9RX 4IFVA 3IXQA 1EX8A 4DQPA 1FF2A 1WHXA 3HLUA 4OYMA 1AW0A 1FRMA 1QAXA 1I1GA 4A48A 4CP5A 1X9SA 1UJ6A 4EGLA 1ITPA 3NKYA 3UCZP 1WI8A 1JLQB 4B3MJ 2MDAA 3ENAA 1HNIA 1TUGB 4DS4A 3KNGA 2E44A 2IPOB 3NXZA 2FGCA 2R4FA 3Q2SC 4LSZB 1ULRA 5ETQA 1GMUA 1D9DA 2MYFA 2HVDA 2OHDA 4DPUA 2GMHA 4LFAJ 2MKHA 1HPZA 5CABA 2W9BB 1RKIA 1IQZA 5HAOA 5MAOA 2AW0A 3S1TA 3CGIA 5GMKa 2DH8A 1RQ0A 4QYRA 4RUCA 4DR4F 2J9EA 3HHDA 5HBMA 3PDNA 1UMJA 2JVOA 3Q2TC 1F5BA 3NS6A 2E29A 4RW8A 1PIEA 2GGPB 3D1HA 3KTQA 2XNQA 4UQTA 1KVIA 5J2PB 2DXDA 3CJRA 5KFSA 3HFZB 3ZZZA 1NZAA 2BOPA 4V19J 1IBLF 2QLJB 4AD6A 4W90B 2E7WA 2HURA 3C16A 2EXUA 1ZZFA 2AP6A 3AJDA 3QMQA 4YP3A 1C0TB 1KBRA 1DAXA 2ZJQQ 2DNYA 2DISA 4ES3A 1U0HA 2C42A 3GIIA 2VBXA 2FB0A 3C15B 4USIA 4AXJA 4LBPA 3MMAA 1U48A 4PWWA 3HT0A 4YR2A 3VV2B 3ETOA 5A0YA 2LQBA 2VA2A 1FJGF 2NXNA 4PG8A 1P6TA 4MKYA 4Q44A 5EX3A 4A8KA 3DOKA 5HVHA 4ZVTB 1JX4A 4DUYJ 3UDEA 3F73A 1N4LA 1PYSB 4M5DB 5F41A 3CD0A 2RQKA 4LBIA 1T0TV 5KFEA 1Q95G 3HHKA 3DLGA 3QZ8A 4F4KA 1M5KC 2YWFA 3L9ZA 1S9EA 1N36F 5FIIA 5C5JA 1XIQA 4DX5A 3UPFA 1R27B 7AT1B 4ZPVR 4CI0B 2KYZA 2FJWA 2KXNB 3QYYA 3N28A 3QLHB 3ONQA 1HBNA 2NZCA 4LF5F 1EB0A 3UR3C 1MMDA 4KHPJ 2CQHA 1CJKA 2V8GA 2H5IB 3OXGA 5LMUF 2QYGA 5BYRA 1U1NA 3HHLC 1T9YA 2G4BA 4JI4J 1IBKJ 1HBMA 1N5QA 2DGUA 4HI2A 2D7SA 2HKEA 2H51B 4JI1J 2VQFF 2G1DA 1QD1A 3KYLA 5IT0A 3A3NB 4X84A 3QGIA 1HNVA 4H54A 2KB2A 3HHLB 1Q79A 3A8EA 2HZCA 1S1UB 5GAEI 4WP3A 4OX7A 1FRXA 4IRDA 3BGOP 3IG1A 2PFDA 2Z0GA 1WORA 5K9FA 3GFZA 1LK7A 4ILLA 4F3OA 1HR0F 5FLXY 3IP0A 4MKVA 2KVQE 3BKUA 1YZ6A 1B0PA 1AFJA 3K17A 4QW8A 1DTTA 2XI3A 4LSNA 3AOBA 2E5JA 3A8IA 3CDAA 4RU2A 2CDQA 3CNQP 3HVWA 2MZJA 4IFYA 4RU9A 4NXMF 2GQCA 2HG4A 1ZM9A 1ZAWA 4FYVB 4OQJA 5KG2A 4C8OA 2RF2B 3ENQA 5DDRC 1ZOTA 3MPUB 4ZCMA 3D6MB 2OEMA 2J5AA 1O0PA 2KHCA 2VC1A 1NHUA 5D3GA 1FCAA 3K5MA 2DJWA 1TL3A 1S79A 1Q5VA 4OZ2A 3ADAC 2PC6A 4PAAA 5EWFA 3M6WA 2CNLB 4DR3F 5HROA 5EN1A 4HTIA 3A8JA 3K8WA 1P9YA 2XNRA 3W9JA 4CLTA 1T7PA 3W62A 2ASDA 2FTRA 1UAWA 4OLPA 2GIRA 3ZTOA 4YOEA 1XEZA 3EGVA 3OR2A 2L9WA 1DQAA 2YWEA 2C2NA 1IM4A 5AE2A 1JLCB 1JLEA 4K4SA 2NZ4A 3ENWA 1U6BA 5AJ3J 5HK4A 5HQ8A 2XGPA 2K7JA 2WSFC 1UWAA 2M52A 3WQPA 1MU2B 3K2YA 2QA4G 1RXOB 1Q81T 1SI9A 1BY9A 2W7PA 3SV3A 5DLGA 2PT0A 2CNOB 4JV2A 4ETXA 5KFGA 4QR2A 3FGVA 1HBUA 1C4CA 2G1HA 4WIIA 5IV4A 1U2RA 2AYEA 1WC1A 4PG5A 3VVTA 2DNRA 3HVRA 4ED4A 1RT1B 1Q4RA 8ATCB 3JSYA 2BW2A 3FRZA 4Y6IA 4P10A 2V8DA 3D3CJ 1S12A 3MD3A 1S10A 6FD1A 3M2UA 1W2BR 1Y10A 3PFOA 2UU9F 4Y2IA 4MFBA 5KG0A 2LDIA 5K8NA 4WBFA 4C2MA 3JS9A 2YH1A 1RT4B 4C0HA 3H42A 3CULA 2HNDA 5DZ7A 3DM2B 2R3VA 1QAIA 5DGBA 2B4VA 1U6ZA 3KK2B 3A4TA 4OYWA 1TTHB 1NSQA 3T1YJ 1C0TA 1KONA 4NA2A 3DLJA 1HI1A 2CQ2A 2DRDA 3D7SB 2PMHA 5GADU 2VKRA 4ZVOB 2K7KA 1SQGA 1TKDA 3CJ5A 3UNYA 1CJTB 3BH7B 4CCHA 3BR9A 1FNOA 4I6AA 1P1TA 3CDBA 3KLGB 2DIVA 3DLKB 3GG0A 2E5LJ 2OLWA 1FFWB 4A46A 2HPUA 2YTCA 1H3DA 2O67A 4WIQA 2Z8QA 2BKOA 5DQGA 2CJAA 4WWSA 1NSPA 5IFMA 3SSSA 4TU7A 3TQ1A 3CCSS 2NREA 2ZD1B 5L46A 1YJ9S 3L95X 2QTWA 1B4SA 2JX2A 4M5KA 3CD6S 1VQSA 2OAUA 2BRLA 1WC3A 2CPJA 5F0WA 3M2VB 2HGNA 1EHWA 1HI0P 1A6LA 5F8GA 3Q8RB 2XMAA 3HK2A 4USMA 2C3UA 3MGJA 3HF5A 4ES1A 4GO5X 5E3PA 3AH6A 1GFWB 3GQCA 2FJVA 3NGDA 2GVDB 4LVOP 1HMVB 3NGKA 3G8SA 2V6AA 4ZITA 3MM6B 2MQ8A 4C48A 4MIBA 5KT5A 2BBEA 5JXSA 1ZM4A 2AV5A 2XULA 2FQQB 4FS1A 3NAIA 5FDLA 1VQ5S 1I5OB 4FP9A 3F44A 3I5CA 3DMJA 1S1UA 2VV5A 4ETZA 2CDRB 3MAAB 1YBAA 4YB7A 3R5CA 2PIIA 3OJUA 2AX0A 2L3MA 4F4AA 2OEKA 5E0OA 4K0KF 3DRRB 4KT0C 1HQEB 4OJ1A 2D1CA 2LP4A 4DZ6A 2ZH9A 4ICLA 4IDKA 1YRXA 1WF0A 2HBRB 2JLEA 1JWWA 4K4UA 4C97A 4ZN3A 2N7CA 1RT6A 2X1GA 2IY5B 3KHGA 4ZLLA 3CCMS 1VQ6S 2FZGB 1NJZA 4ZCIA 4NASA 2CJXB 3GIJA 2UUTA 1FRKA 1X9MA 2L08A 3H20A 2KKHA 2ACYA 4JI7F 1Q82T 1TUWA 1NSKL 3HDSA 3GV8B 1UA0A 4DR5F 2CQ4A 4X4NA 2VPXB 1E6YB 2AGPA 2UUCJ 4UUXA 2HHWA 4TU9A 2W4DA 3AA9A 4X4QA 4KHMA 2RF2A 4HTJA 1XTZA 1SJ3P 2DCLA 4ER8A 4GKKF 2LXIA 4K4VA 1RWMB 2HBQB 2LQ5A 1N56A 3IBFB 4X66F 3DOMB 5EUHA 1Q0NA 2MQMA 1HW9A 1JIHA 1PAUB 4I7FB 2HHXA 1OQ6A 1YJVA 1RA6A 3X3UA 4BDPA 2DEIA 3LTOA 3FCVA 4I6YA 2X51A 1IN0A 1PAEX 2DPIA 4WK1A 1H74A 4WYLA 3PYDA 2ADBA 2FGOA 2Z2ZA 3PM9A 1CEZA 3V4IB 2WCXA 1U1LA 1UVKA 4UUWA 1DLOB 3K0JA 4C3KA 1JLCA 3QT6A 3MF5A 1U8WA 2MEWA 1FK9A 4U96A 2VHGA 2PN6A 3R7BB 2XQCA 3QJPA 3NAHA 4C11A 3J81Y 3U02A 2BEFA 3TP2A 4KFBA 3E8OA 3BM7A 4R8UB 3MM8A 3ZTPA 2LYVA 2A3JA 1HNWF 2DNQA 3JQJA 3VGSA 2DITA 2GO9A 2MQPA 4JV5F 1H73A 4OV6A 4AFFA 2ZH4A 1Q8BA 3D9BA 4LF7F 3OFGA 1LW0B 3CVKA 3RRHA 1PO6A 4RNMA 3NRBA 2F4VF 3KJVB 3CMQA 3SCIE 3KMQA 5J2MA 2Q43A 1SBRA 1HBOB 4G1QA 4X4RA 1U1PA 5DRKA 5I3PA 1S7HA 1RTIB 1UVNA 2VDHA 3P45B 4WXWA 2D3UA 3CCRS 1YX2A 2HHHJ 4IQMA 2K2PA 4RW4B 2PGCA 1RAGB 4K4WA 2EEYA 3KK1A 4C8YA 1XMQF 3EUNA 3K5OA 5DJBA 1RT4A 3W5ZA 1KDNA 2RAQA 4U8YA 5D77A 3MHYA 5KG1A 3UFCX 1SXLA 3DM2A 4M1KA 2CAJA 2F9DA 1EQ0A 1NSAA 4EBCA 3GZ7A 3FQLA 3VAFA 2IM1A 2NPFA 2YWGA 2RRAA 5KFYA 1MG7A 1BQNA 4DSFA 3AXKA 1JLGA 2VB6A 2HZAA 1XR7A 3IA0A 3KLIA 1CJTA 2MY8A 1FNXH 1FKPB 1AA1B 4DR6J 1KLMB 1C4AA 2V8PA 3DLKA 4QJVA 3A12A 2ZWPA 4TN2A 5I4MA 2VPYB 3VGUA 2AYGA 1REGX 1QAYA 4NMXA 3EX7B 4TLRA 3DLHA 2JC0A 1MWQA 4ZLPA 1RAHB 5KFFA 1HIYA 4OHYA 2VG7B 4M5GA 3AB2B 4A8OA 4WKYA 4OX9J 4P72A 4U7UD 5K5MA 5KFZA 3BPSP 2A10A 3FBFA 2XZDB 3H5UA 2ILYA 1K0VA 2WVBA 1F9HA 4MKBA 1NXIA 2IVFB 1R3NA 3L7OA 1ZM3A 3R8YA 3N6LA 1EAYC 1FE4A 4X65J 1IBMF 2D3ZA 4RPFA 3UI3A 1HMVA 3CCVS 1TL7A 3CTRA 2MLYA 4B3TF 2QA2A 3IRWP 4ZPAA 3PX4A 1VQ7S 5GMEA 3JQMA 3H0PA 4IR1A 2HQDA 2F8MA 4TY8B 2A2DA 2HFSA 3KKFA 1LWXA 1I94J 1H0HB 4U6PA 2P6SA 3LP1B 1WSVA 3AT1B 3GIMA 1SKSA 2BJ1A 3M2RB 3MFIA 2BANB 1FNMA 1V3ZA 1WTBA 1TKZB 1S1XA 4O3PA 4CT8A 3CMES 3DRRA 2YX4A 4DPXA 3MD1A 5A8WA 5AXMA 5KTQA 5F9NA 2WB1D 1NCLA 3JB9k 2QX0A 4DV7J 3MMBA 3EDRB 4X4VA 1VQKS 1DQ8A 4P73A 1RHUB 4OHWA 3MCNA 2QFJA 3G6ES 3FDSA 4JI8F 4MJKA 2KTQA 3PACA 4P2MA 4EFAC 1B99A 2G13A 2XO7A 4DR7J 2M88A 3R2DJ 4B3RJ 4WZQA 3QO9B 4A8SA 5HMYA 4CNYA 3PX6A 2YNFA 1FDDA 3DYAB 2CUYA 3R5DA 2DGTA 5F8MA 2XYHB 3KWMA 2B9WA 3EWGA 3CF5Q 1EIYB 3KDNA 2N3LA 3CJQA 4DV1J 2CJKA 3DKDA 3GP9A 4NZ7A 1C0UB 4NLOA 2I5JB 2YWWA 1VR6A 2B0GA 4E2FB 2DKOB 4RUHA 3NNAA 3BS9A 3DOMA 2YQ0A 3MR3A 1X4FA 4CO2A 1RT3B 2F4FA 3D66A 4I7FA 2MSTA 1Y0HA 3IC1A 4RNFA 2B56A 5DQHA 4ZKAA 2W2NP 2ZH6A 2QSFA 4J9QA 4M5JA 5GAEU 2HNYB 3DCAA 5C2GA 4USTA 4XDCA 3H2VE 3I0RA 3SXLA 2C3MA 4DHVA 3QFWA 2VL1A 4FVCA 3M4XA 3VAGA 1F3VA 3TWZA 4PG7A 3MEEA 3K8VA 1Y00A 1VLYA 1AFIA 4XTTA 4Y2AA 3RAMA 3Q22A 2MHNA 2N4CA 5BR8J 4CH0S 4FBTA 4WU3A 1LXNA 5EWEA 1NJWA 3DGVA 2Y3YA 4HLBA 4JI6F 4PXEA 4LF4F 4PABA 2W1BA 3P6YC 1JKHB 2JRSA 1F0XA 4UZCA 3OFFA 3PRBA 4WJBA 5HLFB 4HT5A 4Q0BB 1TFWA 4R8UA 3DGPA 4JB8B 2OPPB 4EO8A 1S9FA 2QE5A 2MKKA 1T9WA 1VBXA 4LF8F 3MZIA 4YHHF 3OFHA 2VG5B 2H5EA 4NXNJ 1JLBA 4H4KC 3BDPA 1TKXA 2X3DA 3KJVA 4U67Q 2WSCC 3VR1A 2FJBB 1QUPA 5KT6A 2DTJA 4NX9A 1WI6A 2Z2MA 3BQ0A 4C98A 3QWPA 1RTIA 3IAS9 2XHWA 3A1YG 4ZP6A 4LIRA 3FZ2A 4RW4A 4E0DA 3I96A 4NZ0A 4IOCQ 5K8OA 1VYAA 5D0EA 5L9NA 1Z2ZA 3DRPA 1N6QA 4HKQA 3KLFB 4ES2A 5CD4H 4LSLA 4R25A 5J2NB 2AEFA 2L9DA 3W9HA 4M5MA 2KFYA 1OYDA 3UR0A 1N88A 1TMJA 1PJ6A 4ZPBA 3U1MA 4QW9A 3MR5A 5J2QB 2V4QA 3TJ9A 3O44A 4N7TA 2ZOMA 2M7SA 3MM9A 1FKPA 3I87A 3W8GA 3ZZ0A 4ALZA 5KT2A 1R8HA 2AJ2A 2KRBA 4NA3A 1M90T 2GX8A 1MLAA 1SC1B 5L1JA 4LF1A 2RD5C 2UXCJ 1T94A 5M2UA 4ZLNA 2K3KA 3MPYA 4CLKA 4LFCJ 3HSJA 4PZVA 1U0SA 2HS3A 5HQMA 4LF6J 4RBTA 3FK4A 3EYZA 4CO3A 1OQ3A 1WC4A 2PD1A 1TK0A 3RAQA 3WC2A 4ZOSA 2FVPA 4EYHB 1RB0A 2B7CB 1WKJA 4PG6A 2ZBIA 4QQBA 2KH9A 1RWNB 1Q78A 3LP0A 3TUJC 1KEKA 2DEJA 1Q7YT 2FY8A 2CG8A 3C8YA 2UXBJ 4Q45A 2W2OP 3TA1A 2GHPA 3LWLA 1R6VA 1FRJA 3PR5B 4HHUA 2DR8A 1NPKA 4IYQA 3H5XA 2OPQB 2AF6A 4P9SA 4KSEB 1D9AA 1GXLA 2J0SD 1HHQA 3BYRA 3DRXA 1RHMB 2EG2A 4ECTA 1A7GE 1ZTWA 4HR2A 4A4JA 4QPXA 4OX6A 3AXMA 3Q24A 5D6GA 4LMZA 2LA4A 3OW2R 1OIAA 4UY8T 2B6AA 4F36A 2RMLA 2BRKA 5K8PA 3ISNC 2VFSA 2JOQA 4USVA 1IKVA 1TKZA 5GMDA 4WKRA 3UO0A 4JUZA 4OMFG 2KRRA 5DO2A 3I9V9 3H8YA 5DDPC 1T05B 3QATA 5LXYA 3RBXA 2IM2A 1VQYA 4ELUA 1E6VA 5L39A 4CO5A 3VGVA 3HO1A 3TARA 2DT9A 3IM9A 2J0XA 3SV4A 3P3DA 4ZHRB 2CPHA 1YLXA 1N34F 4P74A 1UTAA 1DY3A 4U7UK 3QO9A 1RLCL 3KLHB 2ZDPA 1C1CA 2V68A 4I2QA 2HNZB 1FKAF 3RB6A 3NG8A 3CJKB 5JUMA 2HVIA 2O1PA 3DYAA 4UY85 1R0BG 2YQ3A 3G96A 3JXOA 3EGWB 2ALYB 4B3SF 1RJJA 4KV8A 4PYAA 4OYZA 3GU0A 5AXKA 3QGGA 2I5JA 3FZBA 3EJMA 5HI7A 1FD2A 4RBUA 3PNIA 2YH0A 1D8YA 4GC6A 3M8QA 4QU6A 4XO0A 1UEUA 3RBEA 2O66A 1UVIA 4C8KA 4LT6A 4B9UA 4CT9A 1S7IA 1S4EA 4L75A 4J91A 5E3AA 5C42B 1RSCA 2YWKA 1QE1B 1H72C 1X4HA 4LQ9A 3ISZA 2PI5A 3G4SS 3ILJA 4PXBA 2P9EA 3P4UB 3H5YA 4CLFA 3CJ2A 5F8JA 4HACA 5F3TA 2BZ2A 3GV7B 1JKHA 5M2PA 3ZZTA 2XBPA 3CD7A 4J9OA 1VBZA 3ZFVA 3HPOA 2QMWA 3PKMA 2ROEA 4Q0BA 3O8WA 2GNKA 2PFFB 1FDAA 1ZA2B 2OPPA 4ZP9A 3T5KA 2RE1A 1GNKA 4B9MA 3F41A 1K44A 3TW0A 4AYBD 3NNHA 2VG5A 1HNZF 3SYZA 1NHKL 3B8HA 1TL4A 3PR4A 2ILZA 1T95A 4DL6A 4L73A 1R0CB 4OV1A 3NCQA 4DQRA 1PBAA 2EBEA 3ZNUA 1FERA 1U45A 1R8AA 4P2XA 2KT2A 1CC8A 4PWUA 2A6MA 1PC4A 4RWWA 4UOCA 4ZMMA 3C2PA 1EETB 1V3RA 4QZVB 4CRJA 1LWCB 8RUCA 2V9WA 3PXGa 1EKRA 2WONA 2J9CA 3KLFA 1CSJA 3M6UA 1HHSA 3BBCA 4L76A 3I6PA 2ROPA 3O1LA 4EEYA 4FKXA 3DLBA 3W1YC 1NKEA 5KFCA 4DS5A 2OFGX 2VPZB 4IH7A 4OI1A 1XC9A 5J2QA 3OTEA 2H9ZA 2OPSB 3RB0A 2AJ0A 2XCAA 1HWLA 2BM0A 4ZJQA 4KGZB 2ZH5A 3VAKA 3ILOA 3B6BA 3VZHA 2W4PA 2RJZA 2HLUA 2NYHA 2WVDA 2OKQA 4HH0A 4NLWA 2EK6A 4RBVA 5D78A 2KG1A 1VQOS 4JI3F 2YNIB 1T02A 2HAIA 3MXHP 5L1IA 2LQ8A 4N56A 1RLDA 4K5RA 2MQQA 3IGVA 5DG8A 4DV4F 3T1HF 4K2XA 3Q0AA 2JEIA 1IR1A 3MR7A 5IQ6A 2D9OA 2R8JA 2WTFA 3G8TA 3TAPA 2VBYA 1VRQC 1J5EJ 2JH3A 4W98A 3NLCA 2QL5B 3HI9A 2V8HA 3QT5A 1FVQA 3KHHA 4K7QA 2BACA 5KFNA 2WBRA 3SFGA 3OL8A 2OPQA 2H48B 2XI2A 4ED8A 6AT1B 4PG4A 1RA7A 1KC8T 2OUGA 2ZHAA 3DN9A 2W4CA 4RX6A 5D0GA 4IRKA 1TR0A 2CQ0A 4O44B 1VRUB 1RAFB 4DUYF 2UUBF 5E3RA 3SFUA 1OY8A 1YQHA 4WPAA 3PV8A 4CZCA 3PW2A 1ZM2A 2QIFA 4CLLA 4UOGA 4CO1A 1NPPA 4WF9Q 4LFBF 1HWJA 3I0SB 4RO0A 4C0BA 1T05A 2C2DA 4DLGA 2WSEC 5HMXA 1H98A 2AU0A 1KHWA 2PSZA 3HMJG 2CJQA 1QVGR 1BMQB 4KHPF 2DPJA 4DJBA 1VJWA 5CAAA 1P8GA 3J80U 5KG5A 5HATA 2J7WA 4JI4F 2QFIA 1IBKF 2UUAJ 5I3UA 1N48A 2KVIA 2DH9A 3POTA 3KUGA 2IA6A 3K59A 3T41A 2A6OA 2M8DB 1S6QA 2EFPA 3S01A 4CM0A 2F40A 2RRNA 2IFXA 2AHOB 1YJRA 3TRGA 3TAQA 4Z37A 5FD1A 2DD8S 2AJ1A 2NSBA 3MTKA 1WTFA 1LXJA 3PZPA 1P1LA 1TFYA 3NS7B 3UWTA 4CLZA 1LWFB 4KO0B 1FKOA 1NDPA 3EM1A 1RCXB 1ZTTA 3BREA 1YGYA 2H5JB 3RB3A 2AZ1A 2O5DA 3CJSA 2JFDA 2R2RA 4NYOA 3HJVA 3QWUA 3GWCA 2GMLA 1DHMA 2XMMA 1X9WA 3S7RA 2G0JA 2YPYA 5C42A 4NLYA 1FJGJ 2DGVA 3BO2A 2HK2A 5ITHA 4A47A 2BA9A 5EDWA 1KQGB 2OTLS 4S0MA 4Z7YA 3KJNB 2XMWA 3W65A 3R1HA 3CXCR 2J0WA 3JYTB 2BQ3A 1RYSA 1N36J 1X31C 3GSDA 1Y5LB 3GCXP 2DR5A 3C14B 2DHHA 2ZKUA 1RWOB 2G0IA 5ETSA 2DHGA 2WW4A 1U49A 5DM6Q 3VGTA 3J7A1 4LF5J 1U26A 1AUSL 3GYXB 4AL7A 4AT1B 3GG1A 3MCMA 1RHKB 1OWXA 5G0RB 3AFGA 1MROB 5DZ6A 5LMUJ 5B0GA 2E9ZA 1ZS6A 4P2SA 4NRTA 2AKWB 2PMZD 1VQLS 4LRDA 2IBKA 3TX0A 3KK3B 2YKAA 2YKOA 1SH2A 2QL9B 3HSDA 3QAUA 5THWA 4C0OC 2XMJA 4M5IA 4WK3A 4J9UE 4B02A 1O51A 1HYSB 4UZBA 1LWCA 1VFJA 5IZHA 3PYGA 4ECXA 4HH1A 3QRQA 4FF4A 3FEYB 1XN9A 1AT1B 2LQ9A 2LKZA 1S0MA 1D09B 2SXLA 1SV5A 5B0CA 1UKUA 2ZNZA 1HR0J 1XQIA 2IHR1 4N8NA 2NCKL 4LRFA 1H38A 1LW2A 3KLVA 3CC4S 2IC3A 5E41A 1JNZB 4IFVB 3DLEA 1FT8A 4Y65A 3TVYA 2DXEA 2R2TA 4DL7A 2OPSA 3OUYA 1KN6A 3E51A 3D6FB 1ZH5A 4DL5A 3RR8A 4OZ3A 3CE8A 2HSEB 1L3UA 4X62J 3QPIA 5LMNF 2I9SA 2UVWA 3TJ8A 3UDCA 2GQ2A 2RRBA 3HVAA 1VC5A 2FYXA 2APOA 2FUG9 3BZQA 2HVHA 4OJGA 3WIVA 4RJVA 3U1NA 3TA0A 3X1LB 2Z4PA 2IVYA 4Y00A 4F4YA 4DLEA 3RAXA 1I6JA 4PXDA 1KVKA 4LF9F 2YXLA 2ZHOA 1SPBP 4G65A 4QIVA 4NCAA 1B3TA 4HDHA 3PJ9A 1NJIT 3PFEA 1MMLA 5KG7A 3MCOA 2LXFA 3OQ2A 2F1FA 1N0UA 3T1YF 2HK3A 4X64J 2ACMA 5IT4A 1DTQB 2NLWA 1IUJA 4ED3A 1X8DA 5L9XA 2MGZA 2O3DA 3N6MA 3LQVA 5KFJA 2JJ4D 2RHSB 3UD5A 1XBWA 3OTCA 1WACA 4C8NA 4CYUB 1SCJB 3T9ZA 4DV0F 1RHJB 4J9VA 2AJQA 5C24A 1UVJA 2X1FA 2KXFA 4Q2MA 2CPZA 1NK6A 2IYGA 1VRUA 1W25A 3GIRA 4Q5VA 2RT3A 1KOOA 4PUOA 3N01A 3J7AN 3EZ5A 3THVA 2IMWP 4X4UA 1U2FA 4ZA1A 4DU7A 3D4JA 4TYAA 1S77D 2V8VA 2HLTA 3ELHA 3QZ7A 4OLOA 4TLQA 2AGQA 3E01A 3ETMA 3C6UB 2KM8C 1PJ5A 1ZBTA 2RKIB 5A0YB 3CW2C 4DBQA 4ENOA 4DUTA 2HHSA 1S57A 1JXLA 2GCFA 3IO1A 4EBEA 2VDIA 4M5NA 3JSMA 5T7LB 2HFVA 4FZVA 4ANDA 5LXRA 4H4MA 2HGLA 4CLUA 3NGSA 1UW9A 4MMOA 2KM8B 3DLGB 4OI2A 4DPWA 2HVEA 1JJHA 4DUZJ 5F3ZA 3BO3A 4FXVA 3WHIA 2VZ9A 4IRCA 2XO6A 4DV6J 1KVJA 2R7RA 1Z2LA 4B3OB 3SZ2A 1SQEA 1HBNB 3D5MA 4NLQA 4XAKA 1GMWA 1T3NA 2KT5A 2CZVC 1HARA 1CJKB 3OXLA 2B8PA 2VKZG 2GIQA 2R42A 3QT7A 5L8RC 2EKNA 4ZPWR 1HBMB 5G4DA 1XMOJ 2JL9A 2JFKA 4KO0A 1BHNA 4JP8A 4R0EA 1IXKA 2LFVA 2HWTA 1NKBA 4ANEA 2HQFA 5H9FJ 4ECWA 1HNVB 5BXIA 2ZBCA 4HVZA 4RNHA 1HFEL 3AA8A 1AROP 1GEHA 1XK8A 8AT1B 4WP8A 1RBOB 2HHVA 2Y1RI 4OYIA 2UUCF 5KG4A 3OL7A 4DL0C 5KFWA 3FQKA 1JMTA 3BBFA 2XS2A 1JJ2R 4C3LA 1U8SA 1DTTB 5ETOA 2VC0A 3C14A 1BQMB 1CG2A 5KG6A 4YR0A 1CPZA 3ZNJ1 4LSNB 4J9RA 3MTJA 3PO4A 1RAEB 3GTYX 4A8WA 2R7TA 2BE2B 3V81A 5AE1A 4GMKA 3PYFA 5KFBA 4RKUC 1MROA 2FHJD 1VCTA 2EFVA 4DG1A 1X4GA 1U1MA 4L74A 2BABA 5LL6d 5A2QU 2E7VA 1FRHA 3GSIA 4TQSA 3KLEA 2PEHA 2ZH8A 3M9NB 3R9LA 3CWJA 1QUVA 1TL3B 2E5GA 1VJQA 1IKXB 2DGQA 1N5SA 1H7XA 5HROB 5A8KB 3OSNA 2FPHX 4YY3J 3N6NA 1WEXA 2KU7A 4DFJA 5CXTA 2GA7A 3F0NA 4P7TA 4K0KJ 2UXDF 1WOOA 3MCSA 5J1EA 4F8RA 2YKMA 2V2QA 4ZDNA 2OD6A 1N33F 1BD6A 5KFIA 4NE9C 1JLEB 4PRFA 4YMEA 2VF3A 3THPA 3Q8QB 2ALZA 4URGA 3OHBA 1NKCA 4DFKA 1URRA 2MMYA 4I6WA 2RH3A 4JI7J 2IAJA 5KFLA 1VDHA 3PEJA 3MAQA 4DR5J 5IQQA 3B4MA 1HBUB 2YKNB 1UZHA 4N77A 2FZCB 3VQTA 4PQAA 3BF4A 4RW7A 1XR5A 3BN7A 1PCAA 4GKKJ 5IC4B 1V5IB 4OZJA 4L3KA 2JWNA 4PWDB 2HFUA 1S9GA 2VU5A 1GX5A 3ZZRA 1RABB 1W7WA 2GFFA 3OBIA 2RVJA 3QT8A 2R8IA 3QGPA 3HSGA 1HW8A 3NWGA 1HLWA 1DTQA 3M2UB 5ETNA 4EZ6A 1PG5B 3C6TB 1DURA 1JLFB 4MFBB 2KN4A 1X5OA 3IBWA 4ECUA 2HQGA 3QRRA 4CYUA 2GHWA 2QA1A 2DR9A 4OFZA 1URNA 4F2RA 1S48A 2N4DA 2ZVIA 2HNDB 1NH7A 1KOHA 1VC0A 1YZ7A 1Q1KA 4O3NA 2MKYA 2RUGA 4I68A 1SH3A 1KRPA 3H2LA 1UCNA 4X4PA 4BBYA 2BW7A 4QIWD 4OX9F 2XLIA 2IM0A 3PO5A 1Q8LA 1HNWJ 3C6UA 2NPIA 2RKIA 1CS4B 2DNLA 1IKWB 1DARA 2KHDA 2ROGA 4WE1B 4LF7J 1M5VC 2ZUAA 1J5OA 1T9XA 5T7LA 1PBUA 1NPRA 1UVMA 4B08A 2YKQA 1TL5A 2Z57B 2R2SA 1RWUA 3D0HE 3C66A 2HHPA 3FMBA 5DG9A 1S0OA 2XY5A 2ZBPA 2VH7A 1YI2S 5E2QA 3N9UC 2MPUA 2J7UA 1RCOB 2XB2D 2RIJA 4QWBA 3A13A 2CIMA 3JTOA 1H6KX 2Z58B 4B3OA 2ZH1A 1UPMB 2HHQA 2G0CA 4IOAQ 3IRXB 5MLCV 4FF1A 3UD4P 3R7NB 1S72S 3PY8A 1YBUA 4PPDA 2IMOA 4NLVA 3W7BA 2CQGA 4WXOA 2HFNA 2K1RA 1D8ZA 2OIHA 4QWEA 4LR7A 3M9MB 4V19X 2JVRA 3Q8PB 2OPRB 3L3CA 2WZ1A 2CPDA 4DV3J 4F0MA 5CH7B 1HQUA 3FEXB 3PW5A 1FESA 5FDLB 3NGTA 1Z1ZA 1KS2A 3MI7X 3MAHA 1HQ2A 3AOAA 1IKYB 5KT7A 4ERDA 4DX6A 3DMJB 2DNNA 1FWKA 4HDGA 4NLDA 4DR7F 1D0EA 2OP5A 4HEA9 2P8IA 4C9DA 2DNOA 2NXJA 4ECYA 3D68A 4DQQA 2HBZB 3I5AA 4N76A 1VI7A 1QTNB 3ET6A 4ED1A 3FCHA 4ICLB 4IDKB 5SUHA 3UN5A 2Z30B 5HJYA 1RT6B 3N5FA 2MQOA 1BQMA 2Z2YB 1F60B 2VQEJ 4KKOA 3W2VA 1ZZNA 1VHIA 2LA6A 2M0GB 2IJNA 1WELA 4K4TA 2GJIA 4JV0A 2BE2A 2MB0B 5KFPA 3K89A 4YFUA 1Y5NB 2V5HG 2KFNA 4Y34A 4MKAA 4B3TJ 2CWXA 3EVWA 1S1TA 1HKAA 3GYGA 4HHHA 3CPWR 4H4OA 1S1VA 4KH1B 1H2VZ 3DXBA 2GV1A 4QU7A 3BB5A 3D2WA 9ATCB 2HZVA 3WX4A 1QVFR 1UFWA 3T5LA 5KFXA 1YJNS 3PTWA 3SIPB 1IKXA 3AD7C 5A8KA 3L4BC 2RB7A 1RISA 2MJNA 3MM7B 3MEKA 4DCJB 5DQIA 2H4YB 1ICEB 1LQ9A 1NK9A 3QJLA 3GPAA 3C19A 3HHLD 5BYSA 4W92B 3PHEA 3HVTA 4ID5A 2NYIA 2UVRA 1FK9B 4NXNF 2DXFA 2VFTA 4C11B 5LJ5Y 2W25A 3TQEA 1Q5YA 3KHRA 1V9OA 2IRUA 2M9KA 3C3LA 4KFBB 2Q66A 2CQBA 1RUSA 3MM8B 2YKNA 1QLNA 3MMJA 4I4BA 3VVUA 4B9VA 5L38A 4P71A 1RBLA 4HI1A 1QTMA 1SKRA 3N79A 1HD0A 3B82A 4OJ3A 4JI2J 1U6FA 3B4DA 3VQSA 4EZ9A 3IWLA 1IQTA 3DFEA 3CCES 4PWDA 4KR0B 3HFVA 5J2MB 3Q8SB 3OPKA 1KSPA 1Q53A 4J9PA 3OR1A 3OD2A 2WB4A 1ZA1B 4G1QB 3LPYA 1U4BA 2OI2A 3W66A 4Y2KA 1REVB 3C6TA 3MM5A 4TYBA 4M63A 4ZP7A 1JLFA 1R0AA 3KK1B 1JK9B 3I4HX 3ENVA 4NPOA 4ZJOA 1LFPA 1G4CA 3LOUA 5L1LA 4CTAA 4F7VA 3BQ1A 2XLJA 3QBCA 1RTDB 3JAMU 2EFNA 4OHXA 5HANA 2O01C 4I67A 2UXCF 1X0PA 4NL5A 4FNIA 3W3SA 1W26A 2FD2A 4OZ0A 4JI6J 2NQPA 1BQNB 4LF4J 2ZZTA 1JLGB 3L7UA 3WIUA 3CCQS 1EP4B 4K5SA 4ILMA 4EI2A 3I5BA 4MK9A 4NOHA 5K14A 1CQNA 2ASYA 3KLIB 1SH0A 1F2GA 4ZP8A 2DH7A 1XNQJ 2IYIA 1OJ4A 2ZH2A 1CS4A 3FBEA 1IKWA 4LF8J 4WE1A 4KTQA 2B43A 5CYQA 5HJXA 3DI6A 5DG7A 3BJYA 1S6OA 3LAMA 2UXBF 1CJUA 1WWHA 3FVYA 2ZM6F 2DK2A 1NJYA 2B5JA 3FSXA 1RTJB 3N5BA 2BE7D 1GTHA 2CZ4A 2MKCA 3IRXA 2XYPB 4ZVQB 2KZMA 1SIWB 3PG9A 1LFWA 3SI8A 4GKJF 4NLUA 4G1PA 4KHRA 2XS7A 3AD8C 2E1MC 1TL7B 5K20B 4DQSA 4YB1P 4DV5F 1IWAA 1WG1A 2OPRA 2V2VA 3H4BA 1TK8A 2FJXA 2UV8G 4W4MA 7FDRA 3TJAA 3KHLA 4M5LA 1TAQA 4MAKA 1FXLA 3IR7B 3V2UC 3MEDA 1IKYA 2VODA 2F63A 2YWHA 2VFVA 4NCBA 2RSQA 3TZZA 4DN0A 4G3IA 1NUEA 2DCUB 4N47A 5DM7Q 5CA5A 1WKLA 3OXFA 4Y28C 2VOPA 3J7YI 3EVOA 1UWBB 4O0NA 1MSWD 2L9NA 2ZC3A 2NR0A 1S1XB 2ZE2A 2W9CA 3AY0A 2CADA 5A8WB 2EK1A 1VQPS 1GK8A 2XMTA 1JNRB 4DL3A 5ETMA 1TZ0A 2C2EA 3MMBB 3ZO7A 1FD8A 2MTLA 2ZJRQ 2XEXA 4ZK7M 3IR6B 2IIHA 4NI2B 4BS2A 4K4ZA 3NBPB 5LM7E 3FJ2A 3HD2A 1KTVA 3LALA 3RB4A 2XMVA 5KFTA 2RDJA 1HNXF 2HFZA 5HP1A 4PQUA 2YNFB 3SBMA 4NLSA 1QY7A 1F5AA 1P9QC 4KPCA 2D3OR 2HVZA 1U02A 4AQYF 1HHTP 4ZVHA 3JSRA 4C7QA 2XYGB 2J6TA 1XERA 2DR6A 2KI2A 1LEOA 1SL2A 1FXRA 3EXCX 2E66A 2I6WA 3IWXA 2QGFB 3OVAA 2XS5A 2QMXA 5LSLA 4EUVA 2FIUA 3D0IE 3MM7A 1Y11A 2EI5A 3OVBA 4HT7A 3I0RB 1U09A 2BQUA 5D0HA 1FEHA 3GCWP 1HI8A 5LSRA 1RTHB 5AE3A 1Q8KA 3MEEB 1BGXT 2R7QA 4CQ1A 1UFKA 2VFRA 2HRYA 2ZBQA 2UV8A 1JJCB 2QLXA 4RNOA 3D0GE 1GXUA 4X4OA 3HXMA 2W01A 3UVJA 2I8EA 2OMLA 1YRTA 4I2PA 3HJFA 1OSDA 3O3LA 3DGPB 2GIFA 1HA1A 1V3SA 1EQMA 5AXNA 4DR2F 2A2CA 1Q7LB 3DRSA 4DPTA 1T11A 2H54B 2LU1A 5CD4A 5B7WA 1RKJA 4O4GA 1JLBB 5M2RA 1TKXB 1Q86T 2JC1A 4WZMA 2QRRA 4F26A 3Q8VA 2MY7A 1UL3A 4Q8EA 2MZQA 3TUPA 1XMBA 3VHQA 5D4PA 2HAFA 3AOCA 4LREA 2FJEB 1M5SA 1XWLA 3JTNA 1REVA 3CCTA 4JI0J 5J1PA 5I42A 4LRBA 2ATCB 5D8HB 5HQLA 3DRPB 1N6QB 4GO7X 5IWAJ 1X4CA 1RTDA 4NCGA 4LSLB 1VK8A 4LUBA 1WJ9A 3THTA 1BLUA 1LKZA 3K5LA 1VLOA 3QRPA 1G6BA 1ZYQA 1F5CA 2W2MP 1OMSA 4EK2A 2I38A 1EP4A 1X0FA 4ZPCA 2DHXA 3J7ZT 1NK5A 1UA1A 3MM9B 3UE2A 4MK7A 4GVBB 4AE5A 2MZRA 4TY9A 4KGXB 4CH7A 1TKTA 1J5EF 2R7VA 3US5A 4C4WA 4A8XA 1HNZJ 4OYOA 2I2YA 4KBIA 5C25B 4JV1A 4JYAJ 1JXEA 3GONA 2FVSA 4KYZA 4NZ6A 3RYLA 2OSQA 1APSA 2C3PA 1S0NA 1SKWA 1BC6A 4C3MA 2JLGA 1HD1A 3UCUP 4ELTA 1YSJA 3CIMA 3ITHA 3B78A 3G82B 3J80Y 1RTJA 1YRUA 2UVVA 4Y2CA 4DV2F 3LP0B 4F04B 5HMZA 1WEZA 1FFGB 5IOLA 3J7Z5 2QV6A 2CPIA 1VK3A 1CBKA 2CPFA 5BYQA 2QC3A 1S1WA 3MMCA 5A6WA 1X4EA 3MDFA 3TUZC 4B9NA 5IT9U 3NY0A 3TNVA 1U7LA 2RU9A 1KQKA 2JEJA 3GB0A 3M8ZA 3TVKA 3TOQA 3PJXA 2V67A 4U95A 4MYTA 2ZITA 3BBBA 3MECA 3LP2A 2EKYA 3LPEA 3M6VA 3L7PA 4U7CA 2B6AB 3E3XA 5HVGA 4I69A 5IM0A 2UUWA 1UWBA 2MKSA 1IKVB 2UUAF 2B7BB 4JI5F 4F2SA 3TZXA 3G71S 2A0FB 2R8HA 3I55S 2LMIA 4J9SA 1TV6A 4TVAB 5JVHQ 4JI3J 2ABYA 3G2XA 2MKIA 3OJSA 4R5PA 2WAQD 4LR8A 1E6VB 1VIOA 1NLKL 3KUHA 4I1TA 4DV4J 3T1HJ 5U47A 4NI2A 5D4LA 5EGYA 3HCXA 3HM9A 3EDQB 3NBPA 5L1KA 1TK5A 5CHCB 1SJFA 3BH6B 2PEBA 4WFYA 1C1CB 4I2QB 3MEGA 4EU0A 1IBCB 1YWXA 4NLPA 4OHZA 1SL0A 5HVFA 1IJFB 2J76E 3GFXA 4O3QA 3T6JA 4KV8B 1PJ7A 1N5TA 2VBZA 2HIYA 2OMOA 2B8QA 1N32F 3AQOA 3FSIA 4KGMA 2F3JA 3CD5A 4XPCA 1DFDA 2C2RA 5J1NA 2UUBJ 4ZVEA 2VA3A 3IR5B 5T14A 3K57A 2E1RA 3M8QB 1T9VA 1PYOB 2DIUA 4GRSA 3W2WB 4YDXA 1HWUA 3SCKE 2Q3PA 2YX7A 2VG6A 2FHJA 4LFBJ 4DF8A 1YVFA 1B7FA 4FS2A 2RNEA 1MN9A 1UEVA 2C2KB 5KFAA 3MR2A 1SC6A 1RTHA 2OELA 3QAEA 3TEHB 3R5AA 4ECZA 2Y8YA 3IMQJ 1F2HA 4USWA 2PDAA 2Z56B 3SCLE 4OZLA 3CCJS 2JEGA 2QG9B 2NXUA 2XWXA 2IA0A 1QDUB 3OL9A 1RAIB 4RUBA 4N8OA 2J7KA 4HACB 2WOMB 2IRYA 4ZVFA 3KOAA 3D3BJ 1TVRB 1WOPA 3GLJA 3VAIA 4J5OA 3IWNC 1R8CA 2C22A 3MPWA 1RAOA 1FDBA 3FMWA 3LGHA 4IG3B 1NB2A 2ASLA 5F9LA 1NK4A 2LVWA 2DBBA 5ETRA 1X4BA 2N7YA 4DR1J 2DNGA 1H2UX 1M1GA 2CQPA 4UOFA 2CJBA 3OTOF 1K1SA 2ZFHA 1XNRF 2B4PA 4YUDA 5HN0A 5IXUA 3H90A 1MW7A 1GH8A 3MOZA 3P8BB 4IG0A 4I0WA 1YJTA 2AQ4A 3IGNA 2GVZB 4OYAA 1D9FA 4RLEA 4MH8A 1VQMS 2MXYA 3AB4B 3R2CJ 2FVQA 4MYUA 2WONB 1KLNA 3HHEA 1SKUB 2YNHA 4IO1A 4X62F 3PRDA 4F50A 2OJ3A 2ZVSA 2G2ZA 5HSPA 3M8WA 3BSCA 2NXEA 2FLNA 2M70A 3PW4A 5F0UA 4C8LA 5F8IA 2AD9A 4ED6A 3Q8YA 1YG0A 1VOMA 2IDEA 3OHAA 1Y3KA 1H2TZ 4PEOA 5LOQA 4F02A 1YJUA 2FHOB 3U1LA 4GVBA 1VRTB 2C3OA 3ZTRA 2AEMA 3RUBL 5ETVA 3N4WA 5KFUA 2GW8A 2E7XA 2U2FA 2IJFA 1DQ9A 3NWRA 4X64F 3G6YA 2HS0A 1VMBA 5KT3A 5CYJA 1RAAB 3GYNA 4PXCA 4ED7A 1W2IA 4DSKA 5C25A 3VAMA 2M2BA 2XY7A 2B9XA 2RQ4A 1FJCA 4V1Ak 5GAHI 1UW4A 1Y9OA 4YEAA 3T19A 1X5TA 4EYIB 3LF0A 1Y5IB 3RJMB 1WG4A 1RT5A 4MT1A 2E1CA 3G82A 4C8MA 5DETA 2H65B 1BE4A 3GR0A 3BV8A 1KQFB 2B9EA 1PGZA 1B0TA 3G87A 2DNKA 3HFKA 3FBBA 4Z7CA 1CVJA 1JLQA 5E7OB 1S97A 2BX6A 1NHVA 3EVMA 3W5XA 2WBMA 2RDDA 4J9MA 1JLAB 1WHWA 4OYXA 1WSRA 1RTZA 1IWGA 1ZPWX 4DFPA 3QIPB 3HSZA 2KYXA 5RUBA 5ETKA 3BO4A 4WFBQ 2W9BA 1RHQB 1J2VA 3KUEA 2D41A 4DFMA 4C8ZA 4FKYA 2OO4A 2FVRA 5KFKA 4CO0A 5LMNJ 2KDOA 3OLBA 2M5YA 1TUVA 4WFXA 3HKZD 4DUZF 2AJ4A 4UT4A 2IDLA 2FY1A 3CDWA 4A8FA 3O2IA 1XJWB 1IJEB 1RWWB 4DV6F 2QT7A 1DRZA 2GGPA 4UTGA 4LF9J 5J2PA 3BN4A 4A8MP 1QSSA 2BKNA 1WG5A 3UN2A 4F0HA 5KOXA 4FXWA 9RUBA 4OZNA 4GVLA 3V6JA 4EWTA 2W9AA 5I3UB 3G8QA 2PI4A 4IH5A 1XMOF 1Y4ZB 1T03B 4RL1A 2FLPA 3POTB 3BPDA 1FO1A 4P6QA 5F8HA 1NU4A 1S6QB 3C15A 1N52B 1SVDA 1R43A 3MPVA 2C2ZB 2MHEA 3EICA 1L3SA 4BLGA 4DV0J 1SJRA 4AL5A 3K58A 3F56A 3NMRA 2ZOFA 2PO4A 2VJUA 5A2QY 3BKFA 4WCEQ 4M5DA 4PKDB 2R8GA 4DSLA 2BJ3A 2VICA 4O0IA 1FKOB 5KFQA 3W2WA 2U1AA 4DF4A 4P75A 5KG3A 1U1OA 3J7YU 1WD6A 1SL1A 3W5YA 1ACMB 4Q2LA 2OTJS 2J6SA 1O8BA 2E9TA 2BDPA 2EG1A 3QLHA 2HQIA 1VQ4S 4DSEA 2DNPA 1VIXA 4AL6A 4FF3A 3D28A 2CZ9A 1S6PB 2PA3A 3TUIC 2XSFA 4JBCA 3TEGA 1F9EB 2ASJA 2WOMA 3ZZYA 2GHVC 1TVRA 5D15A 3R3TA 3KMSA 4A8QA 4OI3A 2M4MA 3KG1A 4CDIA 2HEKA 1RU1A 3PIOQ 2YVSA 5KAKA 4QIEA 3ISND 4IG3A 1RI7A 2RQCA 2ZHBA 2DRAA 5IC6B 4IKAA 4KAIA 3HHLA 2GAGC 4NMLA 5F8LA 3ULHA 3M7VA 3TZWA 4K4XA 3GV5B 1MWZA 2J0QD 4CO4A 2P9CA 1PKUA 4YY3F 2XHCA 2E1PA 3KJFB 3EXYA 4D3GA 3S8SA 3J81j 1RBAA 1T3OA 2D3O1 3Q86A 4OI0A 4EBDA 4ED5A 1UZDA 1UP1A 3OLAA 3CCLS 2B4UA 1PILA 4RUAA 4RWXA 5A76A 5SZTA 3HT3A 3HD1A 2GVZA 4J7CA 1YK9A 2JLFA 4KPYA 4DPOA 5CCLA 1JQGA 2A18A 5GAGI 2MLZA 2MZTA 3CDEA 3NCPA 1GXTA 1UEKA 3BR8A 5B0FA 2NXCA 4B3MF 1VBYA 1SV5B 3W8PA 1N5YB 2DNHA 3I56S 5ETLA 2Q79A 3PYEA 3SSQA 1LW2B 3W64A 3T3FA 4ECVA 2CNNB 2IC3B 2H1YA 3DLEB 3DOLB 2EWHA 4LFAF 3NP5A 4NYPA 4WTYA 3OUYB 3D1QA 5AXLA 1Y3JA 1VRTA 3R6GB 1RK8A 4BWJA 3RW7A 3M30B 2DO4A 4UW2A 1YIJS 2EFQA 3M8YA 2JNJA 1NDCA 2WHOA 4KH0B 2AJFE 4RW9B 3UN3A 2KJVA 1KR4A 2QL7B 1FWPA 3DHWC 3EZOA 3R5JB 5D4NA 3CB4A 5D0RA 3RBZA 2W7OA 1S0VA 4CIOA 1K8AT 2RS2A 2MGZB 5JVGQ 1MU2A 1LK5A 3OT9A 1KD1T 2AWZA 4DL4A 4DMZA 3CO0P 2ADCA 1ZAVA 3UD3P 4EO6A 2UXDJ 1KKHA 2YKPA 5IS2A 3FNNA 1BWEA 1JLAA 3NGUA 1TL1B 3GJTB 3QIPA 5C24B 3BDEA 3VAJA 3D6TB 1N33J 1X5SA 1L3KA 1QJHA 2HGMA 4J37A 3DRYA 3V6HA 4PUOB 4NWBA 3EGZA 4ZJLA 4DOZA 5FJ4A 2V2ZA 2NSCA 1R8BA 1RT1A 3BSAA 2P6TA 1NK7A 2LEPA 2HS4A 1MNEA 3E01B 2GC8A 2WVFA 3CCUS 1NZ8A 1O5JA 3D6HB 1N8RT 2EFOA 3ZZPA 3JSMB 5CYMB 4QCLA 5E3CA 2XC9A 4FYWB 4H4MB 4FF2A 3FEZA 4DR4J 3KK2A 1XR6A 1NAQA 4UOHA 5KFMA 4DV3F 2QA4S 1T03A 2ZDOA 1D1UA 2OH2A 4JI1F 2D69A 4FNHA 1FE0A 3M9OB 5KOWA 1PYTA 5KFHA 1FRIA 1IBLJ 4K8RA 3KLGA 2FC9A 4XPEA 3WC0A 4DU8A 3RZAA 2VJVA 1SC3B 1UETA 4DWIA 3R5GA 4TXSA 3T1AA 1X4AA 1CJVB 3RR7A 1GAOA 4ZPDA 1M0SA 4X2BA 1N5VA 3NOGA 2X3GA 2ZD1A 4WYWA 1UFLA 1OY6A 3QNWB 2CRLA 2IRXA 3BGFA 3M2VA 1CQMA 3K5PA 4FBUA 3LGNA 1VQNS 2CVEA 3MR6A 2D9PA 3O5TB 2VQEF 3DU6A 2V63A 5E5NA 1K73T 4ECQA 3ILIA 1GTEA 4ZVGA 3KNAA 2ZZMA 5KFRA 2BJDA 2CNKB 2HBYB 4MTPA 3NOCA 1TELA 1S6PA 3AQPA 2GVDA 1NDKA 1M1HA 3MM6A 3P5BP 2A1BA 3M6XA 5HO4A 1BWVA 1CULB 1NEEA 4YN3B 3EZUA 1S49A 3RW6A 1OPIA 2GAHC 4ZCLA 2DY1A 3FCWA 1I51B 2HIQA 3QGHA 3V81B 2DYAA 3PIPQ 2V0NA 4E8UA 2ZNYA 3MAAA 3MURP 1DBDA 3DC2A 1SB6A 4DG1B 3H5SA 1YKWA 2UVUA 3R27A 4CLYA 2KZZA 2R7SA 1HQEA 2Q1LA 1F9FA 2LDYA 4X4TA 5B0AA 4Y2MA 3KLEB 2VQFJ 1GMWD 5LSOA 1KWMA 3LANA 3VAHA 1RE1B 4DN9A 3MWBA 3H59A 4KGVB 3GJRB 5AJ3F 3CIZA 4CNZA 3LW5C 1UJ5A 5JJBA 3OTBA 2J9DE 5D4OA 1NH8A 2PE8A 4DQIA 1D3WA 2QLFB 4K2JA 2CPXA 1MWYA 1AB8A 1N5YA 2DGOA 2LU2A 7FD1A 3Q8UA 3IAM9 2G2OA 5J1EB 1FWLA 1E6YA 2WK4A 4F3MA 4WP9A 1FX4A 3JAMY 2YKMB 3PW7A 1S5ZA 3DOLA 3PEHA 3P96A 4JI2F 4OI4A 2YQ1A 2JHEA 1U2CA 4I64A 4CLWA 3A8KA 3TO8A 3BSNA 1RDRA 2Y1JA 1F1BB 4OI6A 3M30A 3ZTQA 5DDQC 2C28A 3WBZA 2IAJB 4NRUA 2IBOA 2BUNA 4NXMJ 2RDIA 1L3TA 4LBHA 1U24A 1H7WA 3R5BA 2GJ2A 1DJ0A 2J6UA 2AX1A 4RW7B 4RW9A 2CKWA 1NB7A 3LGMA 2FVCA 2VPWB 2JDJA 4ILRA 2EPIA 4LR9A 5FLXU 4CH1A 4OYPA 3V4IA 1EZZB 1S9GB 3M8PB 1DLOA 2FC8A 4DSIA 2UP1A 1AZSB 3NS5A 4DPYA 3DDKA 2KFZA 1RP5A 1P27B 2YY3A 1G3OA 2VASA 1T9UA 3JQKA 2GMJA 1GX6A 1U1KA 4DR3J 3EGNA 4QOTA 1JB0C 3UW1A 2W2PP 4LQ3A 4FDFA 2OGUA 3BEGB 1T9TA 1XNQF 3TZYA 1K9MT 1RAJA 4PPZA 1TL1A 5AT1B 2E5LF 2RHQB 1IR0A 4ZLJA 2GS8A 4CLSA 1LW0A 3G6XA 4N5SA 2B4OA 2P9GA 2WRMA 5CCMA 2J8SA 4USUA 5CZXA 1HBOA 4KRWA 4C6AA 3KFWX 4FVMA 2XG8A 3ZZUA 1M1KT 4K4YA 4BHQA 3LUYA 4ECSA 1EARA 2L41A 1YHQS 1RT7B 1B7YB 4HHJA 1WDTA 2Y0BB 3OTDA 1J5OB 5CYMA 1I3OB 3TAMB 5I3QA 5KT4A 5GAHU 1WF1A 2F5GA 3O6QA 4OJHA 3RU0A 4WFNQ 2V4JB 2GZOA 1A0OB 5HMWA 2XGQA 1YJWS 5B0BA 4ED2A 4N41A 1NO8A 4FPIA 2BVZA 2LEAA 3ZZOA 3PVXA 2V4RA 1VS3A 2VUGA 1S76D 4M8LA 1V6HA 3LAKA 2UU9J 1X5PA 4JOUA 4B9LA 3I32A 4DI6A 2RQMA 1IVZA 3UDLA 1KLMA 3NCRA 2VIHA 1AUDA 2K1RB 1M5HA 3RTVA 1CJVA 3TX8A 3G9CA 2X1BA 2AZ3A 4OIXA 1HQUB 3EPGA 2P5VA 3CJ3A 4BCAA 2B3TB 2HRUA 2VG7A 4FPRA 6FDRA 1OPZA 4G6VB 3CJ0A 5KFOA 3OFEA 5LJ3Y 3DDIA 2NUUG 2EW9A 2M3DA 1U1RA 2MQNA 4L3NA 3WZ0A 3KG0A 2DR7A 4ID8A 5B08A 4ANCA 1R8PA 4PR6A 1QAJA 2W8KA 3ET6B 3TA2A 4MIWA 3UNGC 3IN5A 4D3HA 3MFHA 2FZKB 2CYYA 5KFVA 1CULA 4O3OA 1VGYA 2ZM6J 3SDEB 3W61A 3GILA 2CQIA 3W63A 4KKOB 2F7VA 3W2VB 5F8NA 4DCPB 3QIDA 4WU2A 4TY8A 3M1VB 4PCQA 3CCWA 2P2CB 4ZS6A 3R7SB 3GFYA 4DL2A 3V6KA 4GKJJ 1SC4B 2ZJPQ 1R31A 3SQGB 1U47A 3LP1A 2AMCB 2EC2A 3PJWA 3BYPA 3L09A 3M2RA 2BANA 3NNCA 1AYEA 4WFZA 4A8YA 1YTYA 4DV5J 1S1TB 2R8KA 4M94A 2HHUA 4H4OB 1S1VB 3NEKA 1RT2B 3DHXA 2KJWA 1KFDA 4IR9A 4LRCA 4TNOA 3R97A 3S6EA 1OY9A 1VC6A 1C2PA 2LXUA 3V4MA 2Y1LB 4LJMA 3ZC4A 1V5VA 4OYBA 3PHTA 1X7VA 3V5RA 3CO9A 1TU0B 3FSYA 4KC5A 3U27A 2K8GA 3N0VA 3GJQB 3WDOA 1QM9A 1TAUA 3PW0A 2XSJB 2XZWA 4ZCKA 4U9RA 5BJRA 3P5TL 2FLLA 1CLFA 4NLTA 3HVTB 4ID5B 1WC6A 3T5HA 1C0UA 4OZ5A 3VF0B 3CSKA 5ETTA 2CG4A 2HMIB 2C3YA 2ZUGA 1RT3A 2V50A 4K59A 2K06A 4FYDA 1HNXJ 4QIFA 2HHHF 4NLGA 2HNYA 4JI0F 4DEZA 2DB1A 4FYXB 4BC7A 1YJ7A 2E1AA 3M8RA 1K1QA 3G6VA 4ITSA 4AQYJ 4AUKA 2POKA 4KIAA 2VOOA 3CJTA 2QLBB 2EVZA 5IWAF 3M8PA 3VALA 3PRVA 4X66J 2GO8A 5E33A 3OR1B 1AZSA 3HULA 2CWKA 1FTRA 3RG6A 4J90A 1FEEA 2F9JA 3I4PA 2OSRA 1RWPB 3MM5B 2RILA 1N0VC 1L5UA 1BXNA 5GAGU 2BYCA 3K7RA 3LO3A 4L6V3 1R0AB 2YX1A 3BGLA 4P7VA 1RWKB 2ZEJA 2HYIB 1GQEA 4OL8A 2MKJA 5DLFA 3H7HB 1J27A 5HLFA 2N3OA 4DZDA 5A8RB 1EKSA 2OD4A 4CTAB 4DR6F 4FN5A 2YBVA 4HL9A 4Z2XA 4F67A 2QN6B 1WF2A 3EMTA 5IT9Y 1CC7A 4QWCA 3SEOA 4HYKA 5B0DA 3BKTA
chains in the Genus database with same CATH topology
4O23A 2APOA 2FUG9 3BZQA 4JYAF 2HVHA 4OJGA 4FP9A 3AQOA 3FSIA 4KGMA 3U1NA 2F3JA 3F44A 3DDNA 3I5CA 3DMJA 3E2EA 3TA0A 1S1UA 2R9LA 3X1LB 2Z4PA 1PSDA 5K14B 2VV5A 2IVYA 4Y00A 4F4YA 3CD5A 4XPCA 4DLEA 2C2RA 1U1QA 2QO3A 3RAXA 5J1NA 3KG4A 4ETZA 1I6JA 4M95A 4ZVEA 4PXDA 2VA3A 4LF9F 2ZHOA 1WHVA 2LCWA 3IR5B 1YBAA 4YB7A 5T14A 4TU8A 3K57A 4QIVA 3R5CA 2E1RA 2PIIA 3OJUA 4NCAA 3M8QB 2AX0A 4RW6B 4H4KA 4HDHA 2L3MA 2FJAB 1NJIT 5H1SV 2DIUA 1RT7A 5E0OA 3W2WB 4YDXA 1LV5A 1HWUA 4K0KF 3DRRB 1ELOA 3PFEA 3SCKE 4KT0C 1HQEB 2Q3PA 1MMLA 2YX7A 2VG6A 5CYQB 5KG7A 4OJ1A 2FHJA 2D1CA 4X65F 4DF8A 2LXFA 3TAMA 2ZH9A 1YVFA 4ICLA 4IDKA 3OQ2A 1B7FA 1YRXA 2KXHA 2VBWA 1WF0A 2F1FA 1N0UA 4FS2A 2RNEA 2JLEA 4OX8A 3DI6B 3T1YF 2V4JA 1JWWA 1UEVA 3AJ1A 3LH2S 4K4UA 5J2NA 4C97A 5KFAA 3MR2A 5IT4A 1DTQB 1SC6A 2N7CA 1RTHA 3QAEA 3DNCA 2NLWA 1RT6A 2X1GA 1IUJA 3KHGA 4ED3A 1X8DA 3R5AA 5L9XA 4ECZA 2MGZA 3CCMS 2O3DA 3N6MA 3LQVA 5KFJA 2JJ4D 2PDAA 5K8MA 1VQ6S 3CMAS 1NJZA 3SCLE 1XBWA 4ZCIA 4OZLA 3GIJA 3CCJS 3OTCA 2JEGA 2UUTA 1FRKA 1WACA 4C8NA 2FJDB 2CVIA 2L08A 2B5JB 1X9MA 2NXUA 1KQSR 2XWXA 3H20A 2KKHA 2ACYA 4JI7F 2IA0A 3OL9A 1Q82T 3P49B 3BSOA 3VCDA 3HDSA 3GV8B 3T9ZA 4DV0F 3GE9A 4N8OA 5E3QA 2J7KA 1KFSA 2F8HA 2WOMB 5CZVA 2IRYA 4ZVFA 3H4DA 3KOAA 2I0XA 1TVRB 1UA0A 3GR1A 1I94F 4DR5F 2AJQA 2CQ4A 5C24A 4XIUA 4X4NA 2VPXB 3VAIA 1ZPVA 1UVJA 4J5OA 2X1FA 1E6YB 2AGPA 2KXFA 3IWNC 4Q2MA 2CPZA 2Q6CA 1R8CA 1NK6A 2C22A 2IYGA 2EFGA 1VRUA 1B64A 4UUXA 1DZ5A 2HHWA 4TU9A 3H25A 3MPWA 1W25A 2W4DA 3AA9A 3CDUA 4KHMA 4X4QA 2RF2A 4Q5VA 1JJ4A 4HTJA 1FDBA 3FMWA 4Y3CA 2RT3A 1KOOA 1XTZA 4PUOA 1SJ3P 3N01A 3EZ5A 4IG3B 2JZ5A 2DCLA 1OO0B 3THVA 2IMWP 4GKKF 4X4UA 2LXIA 4F3QA 1U2FA 4ZA1A 4K4VA 2ASLA 5F9LA 1NK4A 2LVWA 2DBBA 5DDOC 2LQ5A 1SJ4P 1X4BA 1N56A 3G86A 2N7YA 1S77D 4TYAA 2V8VA 2RU3A 2HLTA 2DNGA 3QZ7A 1H2UX 4X66F 5EUHA 2R2UA 4OLOA 2MQMA 2CQPA 1HW9A 1JIHA 4TLQA 4DV7F 3AJ2A 4I7FB 2CJBA 2AGQA 2HHXA 3E01A 1OQ6A 3C6UB 1YJVA 1RA6A 3U7JA 3OTOF 3X3UA 1ZBTA 2RKIB 5A0YB 2KM8C 4BDPA 4DBQA 4NYZA 1K1SA 4BC9A 2HHSA 2ZFHA 3MEDB 1XNRF 2B4PA 4I6YA 1JXLA 2X51A 1IN0A 2GCFA 4YUDA 3IO1A 4EBEA 2DPIA 3FFIB 4WK1A 1PC5A 5HN0A 3JSMA 4WYLA 5T7LB 5IXUA 2ADBA 4URSA 1MW7A 1GH8A 3MOZA 2XMKA 2FGOA 4FZVA 2G9OA 4I0WA 4IG0A 4B3RF 3PM9A 5LXRA 1YJTA 2DHSA 2AQ4A 4H4MA 2W24A 2ZE2B 3IGNA 2HGLA 2W9CB 1CEZA 5EWGA 3V4IB 2WCXA 4MMOA 2J8AA 2KM8B 1D9FA 3DLGB 1U1LA 4OI2A 1UVKA 3CC2S 4RLEA 4UUWA 4MH8A 3JSBA 1DLOB 1JJHA 1VQMS 2MXYA 3AB4B 4C3KA 4QIGA 3K0JA 1JLCA 5F3ZA 4MYUA 2FVQA 2WONB 3BO3A 1KLNA 3HHEA 4FXVA 2HFOA 1ROFA 3MF5A 2YNHA 2VZ9A 1VQ9S 2AYMA 4IRCA 4IO1A 4X62F 4O3SA 3I9ZA 1FK9A 2DGSA 3PRDA 4F50A 2OJ3A 2LLZA 2ZVSA 3D54A 2K3IA 4FXDA 1KVJA 2R7RA 2PN6A 4F25A 4DV1F 1Z2LA 4B3OB 3SZ2A 3QJPA 1SQEA 3BSCA 1HBNB 3SDEA 3D5MA 4NLQA 3NAHA 4C11A 1RGVA 3J81Y 2FLNA 2M70A 3PW4A 4XAKA 3U02A 5F0UA 4C8LA 1G1XA 3EPIA 4WFAQ 1T3NA 2LECA 5F8IA 2KT5A 2AD9A 2CZVC 1HARA 4KB7A 3TP2A 4KFBA 1HWIA 3E8OA 3OXLA 2PA8D 4ED6A 2VKZG 3BM7A 3M1VA 4R8UB 3TI0A 3MM8A 1YG0A 1VOMA 2LYVA 1MMNA 2A3JA 2DNQA 1HNWF 1M5OC 2DNZA 2GIQA 3OHAA 2DITA 2GO9A 2MQPA 3SQGA 1Y3KA 5L8RC 5HP1B 4PQUB 1H2TZ 3T5JA 3MUMP 4ZPWR 4JV5F 5EHHA 4F02A 1YJUA 2FHOB 4AFFA 2ZH4A 1Q8BA 1HBMB 5G4DA 2B9YA 3U1LA 2JL9A 3FRYA 4LF7F 2KT3A 2JFKA 3OFGA 1LW0B 1VRTB 2C3OA 3CVKA 4B17A 4KO0A 3RRHA 4O3RA 1FHTA 4R0EA 3N4WA 1PO6A 4RNMA 3NRBA 5B0EA 1IXKA 4B9TA 5KFUA 2E7XA 2GW8A 2U2FA 4R0JA 3KJVB 2F4VF 2HWTA 3SCIE 3KMQA 5J2MA 2IJFA 1DQ9A 4X64F 1NKBA 3G6YA 4DDFA 4IQXA 2Q43A 1M5PC 1SBRA 1RT2A 5H9FJ 4ECWA 1HBOB 2HS0A 4G1QA 2M8HA 1VMBA 1HNVB 4X4RA 1U1PA 5KT3A 5DRKA 2ZBCA 3M32B 5CYJA 4HVZA 5I3PA 2MJUA 3GYNA 4PXCA 1S7HA 4ED7A 1RTIB 1UVNA 1W2IA 3HZEA 4DSKA 5C25A 4WXWA 3VAMA 5BR8F 2D3UA 1SUQB 2M2BA 3CCRS 2XY7A 4IQMA 2B9XA 4RNHA 1HFEL 2RQ4A 3AA8A 1FJCA 2K2PA 1ZETA 1QSYA 4RW4B 1UW4A 5GAHI 1AROP 1Y9OA 2ZC4A 4QR0A 1XK8A 2PGCA 4YEAA 3T19A 2W7AA 1X5TA 4EYIB 3CC7S 3LF0A 1Y5IB 4K4WA 4ZHRA 3KK1A 1WG4A 1RT5A 4I56A 4C8YA 2E1CA 1XMQF 3EUNA 3K5OA 5DJBA 2HHVA 2Y1RI 4C8MA 1RT4A 5DETA 2UUCF 3KLHA 1FRLA 5KG4A 2HNZA 3OL7A 4DL0C 5KFWA 3FQKA 1JMTA 2XSJA 3MHYA 4G1IA 5D77A 3CJKA 5KG1A 3UFCX 2XS2A 1JJ2R 1SXLA 3DM2A 4M1KA 3GR0A 4C3LA 1U8SA 1DTTB 3TR5A 2VC0A 1KQFB 2F9DA 1PGZA 1B0TA 1BQMB 2I1RA 1B0VA 1CG2A 5KG6A 4YR0A 2R7WA 1CPZA 3IS9B 4EBCA 1GT8A 4LSNB 4J9RA 3GZ7A 3FQLA 3VAFA 2DNKA 2IM1A 3MTJA 2NPFA 3PO4A 3HFKA 2YWGA 4QPTA 2RRAA 3NL0A 2QYCA 1G7CB 3JTPA 1CVJA 1JLQA 2NS1B 5KFYA 4DR1F 5E7OB 1S97A 2BR0A 1BQNA 3BGRB 1NHVA 4A8WA 4DSFA 3CUNA 1JLGA 2VB6A 2WBMA 2R7TA 2BE2B 3V81A 5AE1A 4GMKA 4J9MA 1JLAB 5KFBA 4J9KA 1WHWA 2HMIA 1XR7A 1ZPWX 3IA0A 3KLIA 4DFPA 2HW3A 4RKUC 3QIPB 1MROA 1SIZA 2FHJD 2MY8A 2KYXA 1FNXH 3BO4A 1FKPB 2JEFA 2EFVA 4I2PB 4DG1A 1X4GA