2OIHA

Hepatitis delta virus gemonic ribozyme precursor with c75u mutation and bound to monovalent cation tl+
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/rna
molecule keywords HDV ribozyme
publication title Structural roles of monovalent cations in the HDV ribozyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oihA00
4TU9A 3CF5Q 1N8RT 2MXYA 2MKJA 2FHOB 1U1PA 3BS9A 4ERDA 3TYTA 3JB9k 2L41A 1VBZA 1A9NB 2D3OR 2G0CA 3THPA 2MQPA 3I55S 1WF2A 5IFMA 3IWNC 1Q7YT 5JVHQ 2MY7A 2OTLS 4Y0FA 3US5A 5LXRA 4WFAQ 2FC8A 2AYBA 3NMRA 2XS2A 2MQLA 3CC4S 2YH0A 4TU7A 3P6YC 2LCWA 5EN1A 1FJEB 1X4BA 2ZJPQ 3VF0B 5IM0A 3ZZZA 1VQ9S 2E44A 5GAGU 1YHQS 2MZQA 1IQTA 2BOPA 2KXFA 2KYXA 2MZSA 2DGTA 2RQ4A 4EGLA 2MZ1A 1UAWA 3RW7A 2CPXA 3CC7S 3FEXB 4F25A 1KOOA 3CCSS 2OSQA 2DGXA 5IM0B 3MUMP 3DXBA 3UCUP 4A8XA 2PE8A 4LIRA 3V4MA 4PR6A 5CXTA 1BY9A 2L9WA 5LJ5Y 3VAMA 2VONA 1X5TA 2MGZB 2KRBA 5IQQA 1VQ6S 4OZ0A 2DITA 1N88A 1VQMS 3NS6A 1YI2S 3P3DA 1JJHA 3CXCR 3G4SS 2M7SA 1X4GA 1VQ4S 3UWTA 2RS2A 2F9JA 3MUTP 2XSFA 4U67Q 2MKIA 3J7YU 5MLCV 2NLWA 2YKAA 4W90B 3N9UC 2V94A 2F9DA 4F02A 2RNEA 5CYJA 1U1RA 4CH0S 3G6ES 2RUGA 3PIPQ 4LMZA 2MMYA 1FJ7A 1R8PA 2J0QD 5DDOC 2EVZA 1SJ4P 4FXWA 2M9KA 1N54B 5DETA 1RKJA 1U6FA 3CCRS 1WELA 2J76E 4ZKAA 3G8TA 2FY1A 1VQPS 3S6EA 1U1OA 2SXLA 2MKSA 3U1LA 4IOAQ 5CA5A 1PO6A 3G8SA 2LEAA 2YH1A 2ZJQQ 2DB1A 2EK6A 1QM9A 4W92B 1HD1A 3THTA 2N82B 3UD4P 3OW2R 2MQMA 2RQCA 4YB1P 4Y00A 4LJMA 2X1AA 2G4BA 1HL6A 1WHVA 2M0GB 4QU6A 4WKRA 2KI2A 2E5GA 2QEXS 4TLQA 2DO4A 2CPYA 2DNHA 3CC2S 4C0OC 3D2WA 1VQKS 1ZZNA 2O3DA 1L3KA 2ERRA 3FEYB 2MQOA 1WF1A 1VQLS 1SJRA 1X4FA 1YJ9S 2OIHA 3EGNA 2DHSA 3MD1A 2RU3A 1U1QA 3G9CA 2K3KA 3K0JA 2CPIA 2HGLA 2CQ2A 4WFBQ 2ADBA 2N3LA 2KN4A 1SJFA 1X4AA 3HI9A 2X1FA 5GMKa 2CQ1A 1KQSR 2B0GA 3J7ZT 2CQHA 3CCES 1D9AA 3VAFA 3IRWP 2DHAA 2DO0A 2KRRA 1R8HA 1WF0A 2E5JA 3LPYA 1FJCA 5GAHU 1Q82T 2DNMA 2MSTA 3LQVA 1U6BA 1YJWS 4V19X 3UCZP 3BO3A 1VQ7S 4F26A 1VQ5S 4P6QA 1W2BR 2DGQA 2DGUA 3SMZA 3CUNA 2LYVA 2QA4S 2HZCA 2DNLA 2OSRA 2N3OA 1VQOS 2CQGA 1U1MA 2DGSA 1YWXA 3CCMS 3U1MA 3VAJA 4IOCQ 1B7FA 2AYGA 2LXIA 2ZJRQ 3NNHA 2MSSA 3ZZYA 3DLLQ 1WTBA 2VOPA 2K8GA 2CQDA 2LA6A 1N52B 2U2FA 3MXHP 2LECA 4C7QA 3P49B 5LSOA 1X4DA 1VC0A 1DRZA 2D9PA 2DISA 2KG0A 2MKHA 1UP1A 4BS2A 3TP2A 2MB0B 1FO1A 1DHMA 1OIAA 5GVQA 2RT3A 2X1GA 2HVZA 1WHYA 3SDEA 1WI8A 1VBYA 4RU2A 3HHNB 1WG1A 1M1KT 2G1DA 2LA4A 5DM7Q 5GAEU 2DNZA 2KXNB 1KD1T 2HYIB 2ADCA 3CULA 4PRFA 3UD3P 3R27A 1A7GE 3S7RA 2XNQA 1SXLA 3R1HA 1H2VZ 3NS5A 5DDQC 1YTYA 5H1SV 3RW6A 4FXVA 1YJNS 4ED5A 3EX7B 1YIJS 1U2FA 2DH7A 1H2UX 2GO9A 2MPUA 1U1KA 4QPTA 3SDEB 3H2VE 1OO0B 4WFNQ 2M8HA 1ZH5A 1DBDA 1K73T 4Z2XA 1FXLA 1M5PC 1UFWA 2LMIA 5DDPC 2CJKA 1X5OA 1S72S 1WHWA 2EK1A 2DGWA 1U1LA 2WBRA 1VC6A 2CPDA 2X1BA 2UP1A 2CPEA 2KT5A 1XN9A 2AD9A 1D8ZA 2RRBA 3VAGA 1YITS 2OTJS 2N7CA 1JMTA 2JRSA 2LKZA 2M88A 3CCLS 3PIOQ 1FT8A 2KM8C 1WEXA 1FNXH 1AUDA 1QVFR 3CD6S 3CCVS 2DGVA 3UCGA 1URNA 2MZRA 1ZZFA 5GADU 3BO4A 3MDFA 3CTRA 1H6KX 2CQCA 2XS5A 1X4EA 2F3JA 2XB2D 2MKKA 1FHTA 2LXUA 2VOOA 5FJ4A 4J5OA 2YWKA 2U1AA 1Q81T 2FPHX 4CIOA 1NU4A 4OZ1A 1PGZA 2Q79A 2J8AA 2DH9A 2FC9A 1WEYA 2CQ3A 2M2BA 1H2TZ 1S79A 4WCEQ 2KH9A 1WHXA 2M4MA 2CQBA 2MZTA 2CQ0A 2CQPA 1JJ2R 3CCQS 2CPHA 1VQNS 3CMES 1JJ4A 2XS7A 1X5SA 3VALA 2KHCA 2KXHA 2JWNA 1VC5A 2MZJA 2JX2A 2KG1A 3CCJS 1M90T 1HD0A 4YOEA 2OJ3A 4WF9Q 1X5PA 2CPFA 1O0PA 4UQTA 2DNYA 2KVIA 2CQ4A 1SJ3P 1WG4A 3H2UB 1HA1A 3SXLA 2YTCA 1WWHA 2M52A 3S8SA 2CPZA 2MGZA 1Q86T 5LSLA 2DNQA 2M70A 1X0FA 4WIIA 3S01A 1M5KC 3MURP 2HGMA 3MUVP 2MQQA 1OWXA 2M8DB 2MJUA 1U1NA 3CCUS 3B4MA 2MHNA 3R1LA 2MQNA 3EGZA 2DH8A 1P27B 3G71S 1QVGR 1OPIA 1CVJA 5LJ3Y 1VBXA 4QU7A 2DNKA 3BO2A 1F9FA 2AYMA 2MJNA 3VAKA 4TU8A 1M5OC 3BEGB 2E5IA 5LXYA 1NJIT 4IO9Q 2HGNA 4CQ1A 4CH1A 3TO8A 5DDRC 2DNGA 3NNAA 2LQ5A 2E5HA 1WEZA 1X4HA 3UE2A 2VODA 1KC8T 3B4DA 3Q2SC 1RK8A 1G2EA 2DNRA 2JVOA 2QFJA 2KU7A 1K8AT 2DIUA 4PKDB 2LEBA 2DK2A 4UY8T 5D77A 1UW4A 5HO4A 3I56S 2A3JA 2RRAA 2KFYA 1KOHA 1X4CA 2CQIA 3G96A 1DZ5A 2DGOA 3CPWR 3NNCA 3VAIA 2PEHA 5BJRA 3MI7X 5JVGQ 3MOJB 3CMAS 2RVJA 2RS8A 3ULHA 1P1TA 2J0SD 2I2YA 5DM6Q 2DHXA 2MYFA 1VQ8S 4IUFA 2XNRA 1M5VC 4C4WA 2KM8B 3P5TL 5HL7Q 2BZ2A 3VAHA 2AYEA 3Q2TC 1SJQA 1WI6A 3L3CA 2MY8A 1NO8A 5D78A 2CPJA 5ITHA 2I38A 2DNOA 2D9OA 3MD3A 2DIVA 2JVRA 2DHGA 4QQBA 2MKCA 4M5DB 1WG5A 2DNPA 2GHPA 4YUDA 1K9MT 2L08A 2NZ4A 2DNNA
chains in the Genus database with same CATH superfamily
4DQPA 1VISA 3WQPA 4Q2MA 2HS0A 1REVB 2VH7A 2AF6A 1HI0P 1NH8A 3W63A 2RD5C 2IA6A 3EDRB 1GMUA 5K8NA 2D3UA 1CJUB 2KYXA 5E0OA 4DSKA 4NMLA 4K50A 3V6KA 3N79A 5JUMA 3OFFA 3LANA 3JQJA 3MFHA 4JI0F 4ZJLA 3P45B 2VPYB 1R89A 1ZOTA 1R0AB 3W60A 3P3DA 2FLPA 3NGUA 3M32A 2VD3A 3VGSA 3N5BA 4LF1A 1S77D 4F02A 1ZM9A 5CYJA 4USHA 2KYZA 3NWRA 1KDNA 4DG1B 2F65A 1FK9B 3R7SB 2E1RA 2WSFC 2YPYA 4LSLA 4ELTA 2ROGA 2DHHA 1IBLF 1MN7A 3H40A 2XI2A 1M5HA 2JSXA 4B9MA 5F9NA 3I9ZA 2Y3YA 4MMOA 2HHUA 2I5JB 2KI2A 4ZVUB 2QEXS 4I7FB 4FKXA 1XBWA 2CA9A 2QLBB 1ZZNA 1WF1A 4XK8C 3AOCA 2DHSA 2K3KA 4Y2AA 2HGLA 2GMHA 3CEDA 1U0HB 2V4JA 1OY8A 4ED0A 2CQHA 4RU9A 1WF0A 3GSDA 4GVBA 1FJCA 2HVIA 3DLJA 4H4KC 3SQOP 3N6NA 1S9GB 2DGUA 4Y2KA 3KHLA 3EXYA 2DNLA 4IOCQ 2ZJRQ 2AGPA 1RA6A 3IWLA 4ZS6A 2MSSA 4WIQA 3CD5A 4O4RA 2VBXA 4EI2A 3KLEA 4M1KA 1KS2A 3D4JA 4BS2A 2WVDA 4ZIVA 4P74A 4IRDA 2BV3A 4TXSA 1PBAA 2ZZNA 2HFNA 1M1KT 2GS8A 1Y5IB 5J2QB 2IRXA 1T9XA 4CLZA 3MZIA 2ZC4A 4MH8A 3QT5A 1YIJS 3H20A 3GZ7A 3IS9B 4MAKA 5KG1A 3WC0A 2KZZA 2ACMA 4NA3A 2DEJA 2PA3A 3BYPA 2A18A 2ROPA 1BMQB 1HNVA 4K0KF 4O4GB 1BLUA 3BQ0A 1LK5A 3DI6B 4RNHA 1FNXH 2D3ZA 5KFHA 4DL3A 1N33J 1U26A 2UXCJ 4NLDA 2BQUA 1LW0A 2YX7A 2VBYA 3EWGA 2EEYA 1HBMA 2C3YA 2OP5A 4OJ1A 2VJVA 3PW2A 2BVZA 5DQIA 1SKUB 1YLXA 1KLMB 2JHEA 4FPRA 3HVRA 1NHKL 4WZQA 2A6OA 1KRPA 4ZK7M 4ZLJA 3A3OB 4L3KA 3MR7A 1NK9A 3PZPA 1U47A 2KZMA 2OEKA 1HI8A 4LUBA 3PW7A 3T9ZA 2FUG9 4WIIA 5C2CA 1S12A 2ZDPA 1TL1B 2QRRA 3SQGB 9ATCB 4ZCLA 2MQ8A 2W7OA 3PJXA 3EGZA 3C16A 1NJIT 2VKZG 1FNOA 3QWPA 2W1BA 2LQ5A 4O3NA 1WEZA 3ETOA 3C46A 2DR6A 3M8PB 1G2EA 4PWUA 3FRZA 3DLKB 4HR2A 5K20B 2NSCA 2CKWA 3UDEA 1FVSA 1OY9A 4JI2J 4LF7J 2K06A 3FBCA 2ZVIA 2NREA 2JLFA 4WBFA 2HQGA 3QGHA 2EW9A 4B9LA 3MM6A 3WBZA 3ULHA 1HBNA 1DURA 2JEGA 2WVFA 3VZIA 2ZD1A 3UNGC 4LBHA 4AYBD 3HD1A 2KM8B 1S1XA 3BGRB 2AKWB 4R25A 1YX2A 2WB4A 1WOPA 5K5MA 5F8LA 3MD3A 2V63A 3MEEB 2DNNA 3CF5Q 2VJUA 1WACA 4FVCA 3THPA 1J27A 3I55S 2J9EA 3CO0P 2FC8A 3H5SA 3NBPA 2LCWA 2V5HG 1AT1B 1VFJA 6FD1A 4Q43A 4MK8A 1EAYC 3RU0A 2KXFA 4ANDA 2MZSA 3R7NB 2FY8A 5F0WA 3I87A 1URRA 1N5QA 3HZEA 1TR0A 4B9VA 2X7IA 5I4MA 1QAYA 4NRUA 5DG9A 4QYZK 1RABB 4ECQA 2FJWA 3KDOA 2DRAA 4KFBA 1JXEA 4G1QA 4C6AA 1N88A 2OELA 1VQMS 1S6QA 3LP2B 1RHUB 2A1BA 1HHSA 4LQ3A 1MU2A 2NLWA 2YKAA 1UZDA 2W9BA 2OHDA 2AEJA 3GJTB 2KHDA 1RT4A 1R0BG 3PG9A 2B9XA 1ZAWA 4ECUA 1N54B 2DY1A 2J76E 1RU2A 1IR2A 4EZ6A 1S7HA 1TKXB 3PYFA 2HRYA 1Q4RA 1NHVA 1T03B 5FLXY 2BJ9A 2Q3PA 2HFVA 2F63A 3ZTPA 2BKOA 1NSKL 1DQ8A 2O3DA 4DL7A 4RNFA 4ZPAA 1QTMA 4DN0A 1YJ9S 1XC9A 2XMMA 4ZVOB 1X9MA 1EQ0A 4DS4A 3HI9A 1N33F 1DTQB 2WONA 3EE3A 1DQAA 3HVTB 2DHAA 3K5LA 2IM1A 1Q16B 2UXCF 3FC9A 3AOAA 5J2NA 1IWAA 1NJZA 4LIWA 1LWXA 1SBRA 1SC4B 2POKA 3DLEB 4WXWA 4KTQA 2OSRA 3K8WA 4OZNA 2NXEA 3LW5C 5CYMB 4JV1A 4ID5A 2IAJA 1V6HA 2B4OA 1R6YA 2C2MB 1FKPA 4ITSA 1UFKA 3R6GB 2DISA 4V1Ak 2JFKA 4USUA 1JXVA 2CWKA 1IBCB 1B0VA 4ELUA 1FEEA 2BKPA 2R8GA 4A8OA 2M3DA 1KD1T 3SCKE 3S7RA 2HRTA 2D69A 2VFUA 5ETSA 2B9YA 3M32B 3I0SA 3C6UB 5FIIA 3SDEB 4HT7A 1C0TB 1RUSA 1NK8A 1SIZA 2PN6A 2APOA 3CDWA 2RILA 4B17A 1VC6A 2UP1A 2EKNA 3MPUB 2A0FB 3PX0A 3SSSA 4TNOA 4JI2F 4LF7F 2QGFB 1S1UA 4ECXA 4DXLA 5KOXA 1SUQB 4HEA9 2YQ0A 1RTIA 5C42B 2OPRA 2FB0A 2H9ZA 1RT6A 1IR0A 3H7HB 5KT4A 1NU4A 2JFDA 2M2BA 1SVDA 1WC1A 4RWWA 1WHXA 2CPHA 1WC6A 4DR4J 3NCPA 5CZXA 1M90T 1S0NA 4OYZA 4WF9Q 4GVBB 3HPOA 3HHLD 3JS9A 1SJ3P 1KKHA 2F40A 2J7KA 3R8YA 3OR2B 1NSPA 1C1BB 2MJUA 4CM0A 3CCUS 1FFWB 2MHNA 1M1HA 1GXTA 2DH8A 1P27B 1VBXA 3QT8A 2AZ1A 4MT1A 2F1FA 1DJ0A 1YRXA 2IDLA 1T9VA 2XMTA 3JTPA 4Y2CA 3S1TA 3KLEB 2F8MA 3ONQA 1S9EB 3J81U 1B7YB 4USJC 2F4VJ 1X4CA 2FJAB 4OLOA 2VDIA 1IKXB 1N48A 5EWFA 2CZVC 1HYSA 1P1TA 5KFVA 1PAUB 4CP5A 2ZBRA 1SKSA 4IUFA 2XMVA 4CT9A 3RBXA 2AYEA 4LFCJ 1WI6A 1BQMB 1T05A 1HNVB 3V81A 2GJIA 2CNNB 2XHWA 5A8RA 3Q83A 2JEFA 3GYNA 2FHOB 4ZVQB 1CULA 3T5HA 2HHXA 1WF2A 2FJEB 4P71A 5JVHQ 3M2UA 3RJMB 1CS4A 3TX0A 5THWA 4A47A 4I2QA 4O0NA 2ZJPQ 3KUGA 4DN9A 4TQSA 3CJQA 5DQGA 2ASYA 4ES1A 1S1TA 2IC3B 1YG0A 1FTRA 1KTQA 5DQHA 4UY85 4F25A 2D1CA 1Q53A 2R7QA 2BJEA 2O1PA 4NYPA 2XWXA 2VONA 3JTOA 2FJXA 4DR1J 3RGIA 2HK3A 4Q0BA 2F9JA 2BANA 2FVSA 3AB2B 3G82B 5B7WA 3IRXB 1U02A 4KBIA 1J2VA 3OJUA 3LP0A 1RZMA 3LPEA 3Q86A 2MKYA 1JLGB 1WELA 5C2GA 3TQEA 1SL2A 1GT8A 3D67A 4MFBA 2LEAA 4M5GA 3GIJA 5MAOA 1WOOA 4CWBA 3UD5A 3A3PB 2HNDB 2DR8A 3QGGA 1HL6A 5KFPA 2B5JB 1S97A 3MM6B 4RW7B 2CWXA 2YY3A 2CJQA 2Z56B 5J2PB 3KLFB 2HQFA 2ERRA 1FWLA 1ROFA 4AQYJ 2VKRA 3Q8YA 2PT0A 3QFHA 1SC1B 1PYTA 4MKAA 3D0HE 5CYQB 3KJFB 1HW8A 2B0GA 3J80U 3RZAA 1ZS6A 1B3TA 3VAFA 1LNQA 5D3GB 4CM2A 2OD4A 2QLJB 2ZH6A 2KFNA 5A2QY 3BPDA 3KK2B 2HHPA 4F0KA 1MNEA 5K9FA 4PUOB 4OLPA 1VQ5S 3OXGA 4ICLB 4DR4F 2AW0A 3MMAA 3PW0A 1GQEA 3DLLQ 1WTBA 2GMLA 4PXBA 2XEXA 2C2OB 3HVWA 2MB0B 1MWQA 1OIAA 3KMQA 3WDOA 3VQTA 1VQYA 2ZITA 5DM7Q 4LFBJ 2AQ4A 4KO0A 4G1IA 1HMVA 2J7UA 3FQKA 2NYIA 3NS5A 5C24A 2XMJA 1QAXA 3ZXWA 1J5EJ 3DU5A 1QY7A 2AMCB 1VRTB 2MPUA 5IOLA 1QTNB 1TUVA 2H48B 3AT1B 3CT9A 2LQ9A 2ACYA 1RT4B 2F4VF 4MK7A 2R4FA 3M7VA 5KFWA 1OQ6A 3GFHA 4F4KA 5F41A 3A8EA 4I0WA 2Q6CA 2KM8C 3CCVS 3DGVA 2YBVA 3CTRA 1H73A 1X4EA 1E6YA 3OL8A 3KNAA 2H3EB 1JWWA 2U1AA 1BWEA 3F73A 2Y1IA 4LFCF 3ILLA 1MMDA 3V6HA 1PG5B 2RQMA 3TAMA 3C15A 2M4MA 2Z2YB 1BQNB 1VQNS 4KHMA 3BGLA 3PX6A 3HFZB 1X5SA 2ZNZA 1F9HA 1RGVA 4PPDA 4P2XA 4CYUA 1NZAA 1YBUA 4IKAA 5IT9Y 2DJWA 5F3ZA 3SXLA 4H4OB 2LDIA 1IXKA 3CIMA 3TUIC 2DVIA 1M5KC 1RBLA 1WNEA 3B4MA 3KDNA 4OHVA 1TL5A 1OPIA 4ID5B 2HFOA 3DYAB 3MECB 2JDJA 3DRRB 2CNOB 1FKPB 3D1HA 4FNHA 3IBFB 1T95A 2RIJA 5ETNA 4DR1F 4RUAA 3OL6A 5KG0A 1VJWA 2GIRA 2QMWA 2BW7A 3KLIB 5BJRA 4N41A 1H98A 2R7TA 3ZTSA 4RWXA 3MI7X 3IXQA 4ZPTR 1RKIA 3H5UA 4OZ3A 4EFAC 2DHXA 2MYFA 4C3MA 1Q1KA 1ZA2B 4IFYA 4FF2A 5HJYA 4M5JA 4PQAA 3DGPB 3L3CA 3W5ZA 2UU9J 1IN0A 2YKNB 4QQBA 1Y0HA 4RW9B 1VRUA 1ZAXA 3QFWA 1TKDA 2R7RA 4HH1A 3HKWA 3IWNC 1T94A 1RTIB 3R2DJ 4AQYF 3KLHB 1IR1A 2B7CB 1TZ0A 3MFIA 3PFOA 2E1MC 3BKTA 1NK6A 2UXBJ 1SJ1A 2AJ0A 4DS5A 2OGUA 3R7BB 3ZTOA 4DFPA 4IR9A 4DU8A 2XI3A 1OSDA 3CB4A 5K8OA 2DGXA 2JEIA 3HJVA 3PVXA 3UCUP 2DEIA 1S5ZA 1F60B 4DMZA 5IQQA 2XHCA 2K1RB 2RS2A 1NDKA 4ED4A 3K89A 4X4RA 2BYCA 3F56A 4FXWA 4ETZA 4LFBF 2N4DA 4TN2A 3G8TA 3BDPA 3JSRA 4G6VB 2WW4A 3HHLA 2GV1A 1PYOB 3DOKA 3LGNA 4YQWA 1J5EF 2EK6A 1HQEA 2ZOFA 3CJ3A 4NASA 2G2OA 2VA3A 1RJJA 2GX8A 2N82B 1QLNA 3R5BA 2HK2A 2HAFA 3ZC4A 3DOLA 3RAQA 3D2WA 3I4HX 3LA0A 2J5AA 4FF1A 4RW8B 4WP3A 2OIHA 4IDKA 4L75A 2O5DA 4DV3J 5HROA 4RW4A 4YP3A 5L9XA 3V81B 2X1FA 4DV7J 4DSLA 3EZ5A 2IBKA 2KRRA 1WC4A 2V8DA 3QJJA 3N28A 3R97A 2L48A 2O67A 2QLWA 4U96A 3LQVA 2W4PA 3TVKA 3M2UB 4F4XA 3TJAA 1W2BR 5HP1A 2FGCA 2RSQA 2XCAA 1V3ZA 3GIMA 2LXIA 3GTYX 2ZH1A 2E1CA 4K4TA 2HVDA 2K2PA 1VHFA 2XLJA 2MKHA 4DR7J 2O01C 5GVQA 3KOAA 5HLFA 4LRBA 3SBMA 4ZVHA 3W9JA 1XEZA 3UR3C 1FRXA 2ATCB 3BN4A 2C3UA 3RUBL 2XM3A 1U09A 2QL9B 3R3TA 3KG4A 4FXVA 2RHSB 2V9KA 5D4OA 2ZHOA 2H4YB 4CLKA 4PWDA 2FHMA 3W7BA 2ASDA 4HACA 3GFYA 1FXLA 2NUHA 3TUZC 1R31A 1S72S 3FCVA 2I9SA 5DG7A 1UMJA 2HBYB 2YVSA 2BE2B 2RRBA 4F50A 4ECRA 4PXEA 3KK3A 2JRSA 4NZ7A 3NGSA 4OI3A 2VC1A 2HQ3A 3W8PA 4AXJA 2CQCA 4QCLA 2F3JA 4M8LA 1YK9A 5F3TA 2ZBPA 1MN9A 3RB0A 2PD1A 4J9QA 2UU9F 3AD9C 4DWIA 4X4UA 2J8AA 2YX4A 3OR1B 5KFGA 2E5LJ 2XO7A 4PYAA 2CQBA 5AXLA 2RDDA 1JJ2R 3EVMA 1SV5B 5I3UA 2YNIB 4IG3A 4QR1A 2JWNA 3JTNA 3RB4A 4IYQA 2Y8YA 3OXFA 2C2EA 1RTDA 1L3TA 4L76A 4M5NA 1CJTA 3IA0A 2G2ZA 3H2UB 2IM2A 1CC8A 3H59A 2H54B 4KB7A 3OUYA 1KVIA 2UXBF 4B3OB 3IR6B 4LSNB 4RUBA 2DYAA 1PJ7A 1CVJA 4QU7A 2WOMA 4TU8A 1WJ9A 4IQMA 4JI6J 4QWAA 3NNAA 3LO3A 3ADAC 4I6YA 4LF2A 2OMOA 2F4FA 3DN9A 2Y0SD 4HTIA 4P73A 5HBMB 2DK2A 1W26A 1UW4A 5HO4A 2RRAA 4FXDA 2NXNA 3NWGA 4NYZA 1UEVA 4M5IA 4IH6A 3AFGA 3M9NB 3VAIA 3PO4A 2QLXA 2HNZA 3LH2S 5AE1A 4NWBA 5C25A 2GQQA 5BYQA 2DXFA 3KJVB 2ZH2A 2RQKA 2NS1B 1CQMA 4C4WA 1F5BA 3OTEA 1VR6A 3GFXA 4RZRA 3Q8UA 1PJ5A 3IG1A 3GJQB 5ITHA 4I68A 1F1BB 1U48A 1RAIB 4XDDA 5CHCB 1FTCA 1FRHA 4A8QA 5AJ3J 4TU9A 2YNFA 4ERDA 4MJKA 4ZIWA 1NK0A 2MQPA 4H4MB 4OYIA 1E6YB 4AFFA 5LXRA 4WXOA 1HBUA 4LF5J 4DV3F 1XWLA 3KXDA 1VS3A 1AFIA 1NLKL 4NXMJ 1R27B 4FYVB 4DV7F 3W5XA 4UZCA 4RLEA 5GAGU 1RWVB 2HHWA 3MAAA 3QIDA 4A8WA 2DGTA 3BH6B 2W7AA 1MROB 1UAWA 3EM1A 4WFZA 1IJFB 5E5NA 4USMA 1HQUB 4X4OA 3KKFA 1WUUA 3MM9B 4J91A 1SC6A 2F8EX 4AUKA 2HZAA 3LAKA 2DITA 3QAUA 5E7OB 2IM3A 4UOFA 1TFWA 2JNJA 4LBIA 4DR7F 5KG5A 4J9MA 2XSJB 1MMLA 3I32A 3NXZA 5B0DA 5DETA 3Q22A 3QPIA 2WHOA 2OPSA 3W2VA 3KHRA 2Q66A 3MAQA 3I5BA 8AT1B 1FI4A 1XIQA 4C0BA 3CVKA 1XK8A 1Y4ZB 4YB1P 3V6JA 3Q8VA 2EXUA 3KYLA 3GIIA 2CPYA 2ZH8A 5AXKA 2NZCA 1L3KA 3MD1A 5DGAA 4K2XA 4Q45A 1JLCA 4QIVA 5IT0A 2P9EA 1C2PA 1X4AA 4FS2A 3KK1A 1SCJB 3IRWP 4JUZA 1VMBA 2YQ1A 5KFOA 2DNMA 1HBOB 5JMNA 1D8YA 1NHUA 4ZVRB 2E5LF 2RKIB 4P6QA 2R2TA 4A8YA 3BV8A 1C1CB 2VC0A 2C2ZB 1YBTA 2YWGA 4QWCA 1RT1A 4U8YA 3DRPB 1N5TA 4URGA 2YX1A 2EFNA 5LSOA 1KFSA 3DRSB 3PW4A 4DSEA 3BZQA 1NB2A 1QD1A 2ZE2A 5EUHA 3DM2A 1SXLA 1RAFB 4LF4J 3HO1A 3KJQB 1TKZA 2YWEA 4JI6F 3ET6A 2H4WB 3TNVA 3HD2A 3DLGB 1UFWA 5H9FJ 1NJWA 1LWEA 2EK1A 2VFRA 1BGXT 4N7TA 2IFXA 2RUSA 4ILLA 5ADZA 1GXUA 4WTYA 3GCWP 2GAGC 1XR6A 4FN5A 4UQGA 3CO9A 1TL7A 3OQ2A 3BQ2A 2LXUA 2VG7A 3R5CA 2GC8A 1CJVA 5DO2A 3DOLB 1KR4A 2HWIA 4C8LA 3SCJE 4DSFA 2DH9A 1VOMA 2CQ3A 1JLBA 3NCQA 1EKRA 4OZLA 5AJ3F 2P6TA 5HROB 3OFHA 1AROP 4D3HA 2GA7A 5KT6A 2EC0A 4LF5F 4RNOA 1FDDA 3SFUA 4QWEA 4YN3B 2EFPA 4NXMF 1NH7A 4BWMA 3MEGA 2O66A 1U1NA 4DCOB 4OX6A 1HHTP 3ZFVA 3OHBA 4ES2A 3BO2A 4OJGA 1NPKA 4HI2A 4ZLLA 4CH1A 3DLHA 3UDCA 1UA0A 2E5HA 1KC8T 2QL7B 1RP5A 3GIKA 1IM4A 2JZ5A 4OX9J 5T41A 2ZVSA 4QR2A 1KVKA 2NPFA 1RHMB 4WE1A 1IUJA 3OL7A 2HMIB 1WKKA 3FQLA 2GZOA 3N01A 4QIEA 3O5TB 1SJQA 1N0UA 3EXCX 1TK0A 2OEMA 4M5DB 2DNPA 2BM1A 4FKYA 1N8RT 2RDJA 4ZP6A 1Q78A 3TYTA 2HLUA 5A8WB 5KFIA 1EP4B 4KE5A 1P1LA 5IFMA 1S48A 1C0UB 2CDQA 2MTLA 2ZZMA 3CC4S 3D6TB 1RHJB 1S9FA 2ASJA 1D9DA 2MZQA 3TAQA 4ZVPB 2OPQA 2GMJA 4YFUA 1NSAA 5ETLA 2K7JA 4LF6J 3PCOB 1AYEA 4F7VA 2ABYA 1VIOA 1KOOA 2JLEA 3D0GE 3DNCA 4YY3J 2QG9B 5EX3A 3QLHA 3OSPA 3BR9A 3QZ7A 1TAUA 3I5CA 5LJ5Y 3CGIA 1U0SA 4KV8B 5RUBA 1DLOB 2RDIA 2KB2A 3WIUA 5KFJA 4ED1A 3MUTP 4C3KA 1A0OB 2HVHA 1AXQA 5HMWA 4KKOB 3W2WA 2RUGA 2CNKB 3MCSA 1RWPB 4NX9A 2RB7A 3M30A 4FBUA 1R8PA 1SJ4P 4YDXA 3CJKB 1U6FA 3K7RA 2C2KB 3DHWC 4GO5X 4LF4F 2X3DA 4C9DA 3CDBA 4PG6A 3U7JA 5KFBA 3HFVA 4O3PA 2DRDA 3MM7B 1BHNA 1HNIA 5IV3A 2V8HA 4WKRA 3J81j 4DV0J 1VK8A 4FYYB 1VQKS 3UR0A 1NK7A 4F3OA 3EGNA 1TL3A 3EMTA 3H90A 2KN4A 2A10A 4I1TA 1NK4A 3MMJA 4HYKA 2V34A 4W98A 3AA8A 1D9AA 3Q8QB 1VRQC 1JLEA 2VG6A 3ITHA 4C97A 3PKMA 5I3QA 1FKOA 3G8QA 1S1VA 2BQ3A 5FDLB 3M2RB 4O44A 5IV4A 1VQ7S 4GKKJ 1HBUB 3U1MA 2HSEB 3DCAA 4I56A 3TANA 4NLYA 2R7OA 1YVFA 2K8GA 1RLCL 4OZJA 2BBEA 1DHMA 2V9WA 2HVZA 1T9UA 3FZBA 1YJUA 2GFFA 1A6LA 1I5OB 2LVWA 3CULA 3UDVA 4UT4A 4KQZA 3CSKA 5I42A 3H2VE 3JXOA 3B6BA 2UVRA 4ZHRA 1HIYA 2IM0A 4LR8A 3H4DA 1TKTB 4OX9F 4K5SA 2X1BA 3GG0A 3UFCX 4ZP9A 1FNMA 2N7CA 3CNQP 2J6TA 3F44A 2H65B 4F36A 4PYDA 2V2ZA 4KSEB 1Q8KA 3SYZA 1H7WA 2QA2A 4X2BA 5M2UA 4BDPA 3BQ1A 2BRKA 4ANCA 1WEYA 4J7CA 4TY8B 3V6DA 4NLQA 1S79A 2Y1JA 2FLLA 2E7XA 1JLCB 3IN5A 3SIPB 1QE1B 1LK7A 1VC5A 2EG2A 5A6PA 3PRDA 4WZMA 4EMDA 3C6TB 3V4IA 4E0DA 2XMKA 2XYPB 1HA1A 2YTCA 3QO9A 3S01A 5HQMA 3JAMY 1DQ9A 2FJBB 1JKHB 3D3CJ 1RWKB 2PSZA 3IAM9 2DR7A 2HKEA 3G71S 4LF6F 5FD1A 4YY3F 5KG2A 2H1YA 4FPIA 1Y9OA 2HBQB 1FX4A 3PY8A 2QFJA 2FHJA 4DPTA 3H25A 1RTJA 1UW9A 1KOHA 1DFDA 3CJRA 2XTJP 4RPFA 2PEHA 3TA1A 2PI4A 3BGUA 3X3UA 4DFKA 1L5UA 4R8UB 1PKUA 1LWFA 5CABA 2XNRA 2ILZA 1T9YA 4X84A 5HL7Q 2BZ2A 4U7CA 3T5LA 4LF9J 5KFCA 4U7UK 2HBZB 5AT1B 1LQ9A 5J2MA 2QX0A 3P4UB 1RWXB 1RT7B 4QIFA 2NZ4A 1PYSB 2MXYA 2MKJA 4A46A 3BS9A 3N4WA 2N7YA 4DV0F 3M2VA 2Z30B 2MLYA 3IWXA 3W3SA 5E3AA 3R5GA 1RLDA 3US5A 4DPYA 4DQRA 5D4PA 3W1YC 4GO7X 1FRIA 1FJEB 1RHRB 4CTAA 1NKCA 3G87A 5ETPA 1DY3A 1T9TA 4L3NA 2HQIA 3TWZA 2GIFA 2MZ1A 1L3SA 1RT2A 5LMNJ 2PGCA 5IM0B 1UPPA 4EBDA 4GKKF 3DXBA 1DTTB 4NL5A 1MLAA 2RMLA 1R43A 4PR6A 4N77A 2NPIA 3MEGB 1X4GA 2OPPA 2VUGA 4KT0C 1GMVA 2KT3A 1UCNA 3MMBB 4TYAA 3IBWA 1QAIA 3D0IE 5KT7A 1ZBTA 1FJGJ 4L6V3 5DDOC 2EVZA 2GNKA 1RAAB 5T14A 1LXNA 4JI3J 4TYBA 3G8SA 4B3TJ 1N5SA 1HD1A 2RQCA 2W24A 1FERA 2RHQB 3EGVA 4ZCMA 5KFDA 2G4BA 3W61A 4C2MA 1RAEB 3CJ0A 2W9AA 3MEDB 2MQOA 4DUZJ 3GJRB 2PFDA 1PC5A 3FRYA 3A4TA 3K0JA 4BCAA 2XLIA 1IKVA 5CD4A 1QUPA 1IKWB 4B9SA 2ZBIA 1RSCA 2VG5B 4EYIB 1T3OA 1P9YA 2AJ1A 4V19X 3UVJB 4Y34A 4ETXA 4L73A 3GB0A 2DGQA 3MTJA 2LFVA 2XZTB 4B9NA 1B7FA 3VAJA 3T19A 2FGOA 4OV6A 1RHKB 2PO4A 2VBWA 1LW2B 4CLWA 2U2FA 2ZM6J 4Y3CA 6FDRA 2FVQA 4UUXA 1X4DA 3BKUA 2KG0A 1RT3A 4USIA 4GVLA 3TA2A 3K5NA 3MM8A 3BSCA 3SV3A 1J5OB 4DX6A 1NB7A 2J0XA 2JC0A 2XLKA 3EVWA 4J9UE 4O23A 5DDQC 2GVDB 1HWIA 1VBKA 5K8MA 5A0YA 4R0JA 1Y11A 4P2MA 1OO0B 1IKYA 4IRKA 4M5KA 4ZPCA 4DV6J 1U7LA 1RYRA 1X5OA 3J7Z5 3PR4A 1YJTA 1D8ZA 4MIWA 4M63A 4I2PB 3E01A 1HWLA 1OQ3A 4ALZA 3CCLS 2QC3A 1AUDA 2B8PA 3QIPA 5J1NA 4F04B 1KSPA 1VIXA 2VOOA 2YWKA 1HNIB 3AXKA 2FPHX 4LF9F 4CIOA 2V2VA 1N6QA 3W65A 2VPXB 2UVUA 2CVEA 4AD6A 1I51B 1TL3B 5L39A 1SH2A 1N34J 2CJAA 4R5PA 4C8OA 2HFZA 1U6ZA 2WZ1A 3CMES 4KJIA 4LQ9A 3T5KA 2JX2A 1JLEB 3B78A 1Q7LB 4UQTA 4UW2A 4MKVA 4XTTA 1RWUA 1JLQB 3MM5A 4O44B 3MURP 4NLRA 3KUHA 1RAGB 2BM0A 2YNHA 3R5DA 2VZ9A 4F4ZA 5KFSA 3LOUA 5KTQA 4UOHA 1F9FA 4WYWA 1RA7A 4OZ2A 2GVZB 5LMNF 4IO9Q 2GQ2A 2DNGA 2R2RA 3B4DA 3CJTA 3V2UC 1R3NA 1Y5NB 4B3RJ 2DNRA 4NI2B 2CNLB 3FFIA 4LSZB 2KU7A 2BJ3A 5GAHI 4YB5A 4PXCA 2X3GA 2UVWA 3C14B 3IM9A 1VLYA 1DZ5A 4NEZA 1HWJA 2DR9A 4ZP8A 1S4EA 4DL2A 1SQFA 2RS8A 1FJGF 1FXDA 4WU3A 3BPSP 3LWMA 4F4WA 5JXSA 2JJ4D 3GR0A 4JI3F 5J1EA 4ED8A 4KC5A 4DR3J 4LF8J 4B3TF 1VI7A 2YKMA 3D6FB 4IG0A 3POTB 5LMUJ 2HIYA 2L41A 3M8ZA 4WPAA 3AJDA 1HR0J 3WX8A 2R8HA 5LT5A 4ZA1A 4DLEA 4TY9A 2QJ3A 2OTLS 4DUZF 4C8KA 1UWBA 1RAHB 1FWPA 3AJ1A 2XS2A 2YH0A 2IYGA 4O3SA 3E51A 3IC1A 4IOBA 1RBAA 1YHQS 3V6DB 3SCLE 3BBBA 4Q2LA 3N6MA 3OTBA 3KLGB 1S49A 4L74A 2X51A 4A4JA 1NPPA 4B9UA 4PABA 1UEKA 4FNIA 4JV2A 2PE8A 5CXTA 1BY9A 4P72A 1D1UA 2V2KA 1VQ6S 3NG8A 3M1VA 1S4FA 3CXCR 3VCDA 2NXJA 1TU0B 1YJ7A 2MKIA 2ZM6F 1NCLA 3GLJA 2F9DA 3G6VA 3DRYA 4MIAA 5EWGA 4KHRA 1S0VA 3HJFA 3O6QA 5L1KA 4RKUC 4PPZA 3EDQB 5D6GA 2JL9A 4JI1J 5KFAA 2FLNA 1LWCB 4Z7YA 2BUNA 2W01A 2EFOA 3MMCA 1AZSA 2AJ4A 3GPAA 1D3WA 4U7UD 1QM9A 4JI5J 2LQBA 3TRGA 3TW0A 3OW2R 3BJYA 4DV2J 3EPIA 4DV6F 4DCJB 1LWFB 2BRLA 3QJLA 1JLFB 5IS2A 1M0SA 2AIRB 2UV8A 1SIWB 3K5PA 4U9RA 2B4UA 2ADBA 3D1QA 2OAUA 4A8SA 4DR2J 2CQ1A 1EJ7L 1JLAB 1TVRB 4NE9C 1WSVA 3OTDA 3LWLA 2E5JA 4RBTA 5H9FK 6AT1B 4IQXA 3JSMB 3LP1A 4Q8EA 2D7SA 3M8YA 2WVBA 2G9OA 4YR0A 2WVCA 4DQSA 2P8IA 1N34F 2Y0BB 5KT2A 1S99A 5E3CA 3QATA 1F2GA 1F5CA 4GC6A 2J9CA 2LA6A 1AA1B 1DRZA 1V5IB 3TP2A 2JH3A 2FZGB 2X1GA 4HDHA 4LFAJ 4RU2A 1JNZB 3AAWB 2G1DA 5F8IA 5L38A 4EYHB 2XNQA 1NKBA 3NRBA 4RL1A 2FVRA 8RUCA 2JOQA 2XGQA 1C4CA 2BE7D 2ZHBA 3JYTA 5T7LB 4EO8A 4B3RF 1M5PC 4CLTA 1WHWA 4DV5J 3C3LA 5E33A 1XN9A 4YR2A 3I0RA 1YITS 2QMXA 4HTJA 2E1PA 2UVVA 3UQSA 5U47A 1ZZFA 3TUPA 4EWTA 3D28A 1S6PA 1QSSA 4TVAB 3G6YA 1RTHA 1FDAA 2B4PA 1Q81T 4ELVA 1UTAA 1G3OA 4DR3F 1V3SA 4EZ9A 4LF8F 4KY3A 1R6VA 5K14B 5LMUF 2XBPA 3C8YA 3BH7B 4CZCA 1Q8LA 1IKVB 4RW6A 1HR0F 1JJ4A 1Y3KA 4UTGA 4YOEA 1FX2A 3D3BJ 1TV6B 3OJSA 2YNGA 2B3TB 3AB4B 2DXDA 4NXNJ 5LSLA 4J9VA 2YWHA 2ZZTA 4J9PA 2M8DB 1UVMA 1KHVA 5G0RA 4CDIA 3N0VA 3R1LA 1NJXA 4OYAA 2MLZA 1RT5B 3LALA 3TO8A 4E98A 1GTEA 1LV5A 2B6AA 4C8YA 3M8QA 2BEFA 2IVYA 4QW9A 1K8AT 4DCPB 2W9CB 1K47A 1BE4A 3QRRA 2CQIA 2HQDA 3OT9A 5D15A 3TA0A 2BJDA 4NZ6A 4DHVA 4O0IA 2XZWA 1N5YB 2HHVA 5A0YB 1BD6A 5DM6Q 4JI1F 3FEZA 3RTVA 4X4NA 4E2FB 3KUEA 3DMJB 3Q2TC 1REVA 3VTIA 4LT6A 4P52A 4JI5F 3SZ2A 4J9KA 1XERA 4ZVGA 5H9EJ 3E01B 4RBVA 3W5YA 4DV2F 2QYGA 2FDNA 3QIPB 1HPZB 2OKQA 5KFKA 4DFJA 3W64A 1U8SA 3TAPA 3IGVA 1HWKA 2AEMA 4I69A 3NGDA 3M4XA 1HW9A 1W25A 3B82A 4DR2F 1RACB 2BOPA 2WAQD 1R0AA 2PEBA 4R5PB 1RWOB 4JI7J 3FEXB 2ZFHA 4DJBA 1O8BA 3A8JA 1XQIA 2IPOB 1SH3A 3OLAA 5A6WA 3P8BB 2L9WA 1SPBP 4ID8A 2WRMA 2QT7A 5KG7A 4N5SA 4DG1A 4P7TA 3PRBA 1FK9A 3I5AA 4M5LA 4URSA 2YNHB 1FCAA 4RJVA 4U67Q 4W90B 2BJ7A 2AJFE 3G6ES 3I31A 7FDRA 4W4MA 4C11A 1U2CA 4LFAF 2A2CA 1NNDA 2IVMA 3K58A 3L4BC 3H5XA 1NDPA 2CFXA 2I5JA 4I7FA 3MWBA 1X7VA 1PO6A 2DB1A 2GCFA 1TELA 2QE5A 4ZPBA 3HSGA 2C3MA 2VFTA 1U0HA 5EWEA 4QU6A 4LSLB 4TLQA 4DV5F 4I64A 2DPIA 2ZWOA 3FEYB 4ZLNA 2R7UA 1NUEA 3MHYA 2DXEA 4WFBQ 3RRKA 2N3LA 3SSRA 1XJWB 5J1EB 3HULA 4PZVA 2HIQA 2AP6A 4KGXB 2W2QP 3THVA 3QWUA 1NJYA 2HZVA 3CJ2A 4I67A 5D8HB 3UNYA 4EK2A 1XR7A 4RR5A 2MHEA 4CLPA 2V4JB 3BO3A 5L46A 1Q5YA 1ZTWA 5HMYA 2EI5A 5HVGA 2C42A 5J2QA 1XMBA 1K1SA 2V68A 2UUBJ 1S10A 4NXNF 2I8EA 2UUWA 2DBBA 1HFEL 1X9SA 4U8VA 2RT3A 2XYGB 3VZHA 4ZLPA 1BUXA 3IS9A 2DY9A 4ZN3A 1SKWA 4G65A 2HYIB 3HFKA 3OBIA 1YTYA 5HK4A 2R9LA 2PMZD 4CLYA 3AA9A 4I6AA 1TK8A 2IJRA 1T0TV 1XTZA 3DI6A 2HQCA 5AE3A 3GQCA 3VGTA 1NMEB 1H72C 2CJKA 1U1LA 2DKOB 3QRQA 4K4VA 1K0VA 5KT5A 4AL5A 5KFNA 2ZEJA 2UUCF 2VBZA 1URNA 2XY7A 3QQCD 4XPCA 1PCAA 1T8EA 1KLMA 1PSDA 3BGFA 2CRLA 1HLWA 1FWKA 2BABA 1RQ0A 4ZOSA 2QA4G 1X31C 4MKBA 5E3RA 2LEPA 3QZ8A 5E41A 4ZCIA 4EO6A 3K8VA 1GX5A 1SI9A 1LW0B 4KPCA 3GV5B 3SQGA 3NOGA 1M5SA 1HBMB 1X5PA 4FZVA 4OL8A 2A6MA 4WFXA 3IO1A 2P5VA 2RAQA 3MEKA 2MGZA 3MTKA 1Q86T 1OSCA 2C2NA 2M70A 4NMXA 1KHWA 1T3NA 3KNGA 4DPWA 3M8PA 4RNMA 3OXLA 1WOSA 3DOMA 3M8SA 4JI7F 5D4NA 3Q23A 2G1HA 1M5OC 5DLFA 4C8NA 2HGNA 3VHQA 1X4HA 1FKAF 3Q2SC 4DBQA 4JI8J 1IJEB 4NLGA 2BACA 1EB0A 4O3QA 2VDHA 3C16B 1WDTA 3WZ0A 1UVKA 5HVHA 2VFSA 4ILMA 2XMWA 2CJ9A 3MEEA 1U2RA 1YQHA 4EUVA 2NXUA 3BB5A 3JSYA 2CPJA 5LSRA 1YKWA 3I0RB 3QNWB 1HBNB 1AB8A 2L08A 2ZD1B 3M8WA 3OL9A 4UOGA 1LOUA 5CCMA 4AL7A 4GC7A 1U1PA 3TI0A 1VYAA 1JNRB 3AY0A 1VBZA 1AUSL 1S1XB 5CD4H 3OV7A 2YKQA 3TOQA 3ISNC 2B43A 3TEHB 2EWHA 4HT5A 3NMRA 5L1JA 2GHWA 4HH0A 2YWWA 3ZZZA 3OPKA 1V5VA 4B9TA 1EZZB 1FE0A 2Z2MA 3V5RA 3AH6A 1KEKA 3NBPB 3LP2A 2EFQA 4ZVSB 2WVEA 5KG3A 2YNGB 3ZNJ1 4PXDA 1V9OA 3FSIA 4OZ0A 2AT1B 1B4SA 2CDRB 1YI2S 2RE1A 2CZ9A 3G4SS 1VQ4S 3UWTA 1GFWB 4AXIA 3KG1A 2UUTA 3GP9A 1TKXA 2UUBF 4KFBB 4AT1B 5HMZA 4E8UA 1ZTTA 3PV8A 4G1QB 1VQSA 1T03A 5LOQA 2B6AB 1S6QB 1MU2B 1QSLA 3CD7A 5L1LA 2YQ3A 5DZ7A 4DL4A 4OIXA 1UKUA 2W9BB 1ZYQA 4IOAQ 1UZHA 3CD0A 3FBEA 4W92B 3GYGA 2J9DE 3THTA 4JB8B 4Y00A 1F2HA 1RBOB 1FA0A 4AL6A 2M0GB 1DTQA 3BBCA 4OHYA 2DO4A 1H0HB 3HVTA 2DNHA 3GYXB 3CC2S 4JV0A 5F8JA 1U1QA 4ZCKA 4USTA 4DPOA 5KFRA 1R7IA 4Z7CA 3DLEA 1Q8BA 2DO0A 3KLVA 4MTPA 4ECWA 5CYMA 2R7WA 3FVYA 3L9ZA 2CJYB 1SB6A 3F41A 3MR6A 3HSDA 2LXFA 2BOAA 2WONB 1RISA 2ZH7A 4J90A 5BYRA 4NCGA 1QAJA 3MCOA 1UPMB 4G3IA 1YJRA 4DZ6A 5J2NB 4HHUA 2VOPA 3H2LA 4K59A 1WSRA 2HURA 3UN5A 3C6UA 2CADA 2WTFA 4NLOA 3DLBA 3SDEA 5CCLA 1C0TA 2IVFB 2IAJB 3J81Y 1TTHB 3P5BP 2DNZA 1RCXB 1KONA 4LBPA 5IXUA 4CNYA 2H51B 5H1SV 3EX7B 4P10A 1FRLA 2HFUA 1TK5A 4WKYA 2Z8QA 4A48A 4ER8A 1NDCA 1DBDA 2H5JB 4OHWA 4JI8F 1K73T 3WHIA 1GTHA 1SUQA 2RU9A 4C11B 5F8NA 2IMOA 3HCXA 4X66J 3HHDA 4NA2A 4PWWA 5C42A 4K5RA 1Y10A 3I0SB 2LKZA 2M88A 3HHKA 2DCLA 1Q0NA 3CD6S 3PX4A 3T6BA 5FLXU 5FJ4A 3TJ8A 3PEJA 2QYCA 4OQJA 5B0BA 4MIBA 3PHEA 1PGZA 1S1UB 4B08A 4CO4A 3D54A 4KAIA 2CIMA 2GJFA 3T3FA 3OR2A 2OPRB 1C1BA 2CVIA 5D0GA 4OI6A 3VALA 2KKHA 2KXHA 1RT6B 2OFGX 1D0EA 2KVIA 3GMGA 4DL5A 3ZNUA 2B51A 4YDDB 4FYDA 3E8OA 2DT9A 3Q8SB 1QUVA 2XMAA 1S9EA 1QVGR 2DNKA 1W7WA 4C48A 2E5IA 2Y1LB 4HHHA 4OI0A 3D6MB 1TL4A 3H98A 2NUUG 1IKXA 4KYZA 2PC6A 5DGBA 1UVJA 1EETA 1F0XA 4UY8T 5D77A 3I56S 4QWBA 2KFYA 4LREA 1ZPVA 3CPWR 3VQSA 1BQMA 1W2IA 2E29A 3CMAS 3MOJB 4PG8A 4NEYA 3U02A 2OMLA 2W7PA 4KGKA 2EPIA 1M5VC 2ZWPA 2R7SA 3VAHA 1S6OA 2HS4A 4LRAA 1NO8A 2BXJA 2D9OA 1RI7A 1S6UA 1WG5A 1HYSB 3J80Y 3ILJA 3RRGA 2HBRB 2AWZA 3B8HA 1LEOA 5KAKA 1Q7YT 1T05B 2IC3A 1F3VA 3I96A 2NYHA 3IFEA 3VVTA 9RUBA 3I6PA 5A8RB 4DSIA 1Y3JA 1OJ4A 1CULB 3KFWX 4ED2A 1L3UA 1IM6A 4JP8A 3QSIA 1FEHA 3ZZOA 2C28A 1N5VA 3RBZA 3D6HB 1CS4B 1ZA1B 4ZDNA 4I2QB 4N56A 5D0EA 3G82A 3IRXA 4WP9A 1S1TB 2MGZB 2F8HA 3CDEA 2QO3A 1NDLA 1JLGA 2B9EA 2ALYB 3GE9A 3EZUA 3LGHA 3DOMB 5GMDA 1U1RA 3PIPQ 2MMYA 2HNDA 1UVIA 1ELOA 2M9KA 4FYXB 3BYRA 4Q0BB 2B5JA 2BANB 4RW7A 3KLFA 5J2PA 4J9LA 4DZDA 1PAEX 2RF2A 3LP0B 3I9V9 4DUYJ 1HNWJ 3KJNB 3K5MA 5CYQA 3FCWA 4D3GA 1RWMB 3FJ2A 4K4ZA 1PJ6A 4NLVA 4X66F 5D3GA 3MAHA 4MFBB 3AHPA 4OYWA 3PW5A 3BM7A 4PG5A 1X4FA 3G9CA 1WKJA 1Y00A 3PEHA 2CQ2A 3NGKA 4H54A 3KK2A 1KQGB 4PUOA 4OYOA 3H4BA 3G2XA 2WBMA 4ICLA 3PYGA 1Y5LB 1CPZA 3ILIA 1X0PA 3ZZUA 3TVYA 3UCZP 3L7PA 2V8VA 3BSOA 1VQOS 3CCMS 1P9QC 4NYOA 4QYRA 2FIUA 1IVZA 1NPRA 4ZMMA 1OY6A 2LECA 1VC0A 2LQ8A 4CCHA 1ZM4A 4A8MP 1M1GA 1N32J 1O6XA 3W8GA 2ZHAA 1VRTA 1WHYA 1S76D 2ALZA 3MMAB 4K4YA 2HAIA 3A8KA 4NLTA 3UD3P 1A7GE 2FYXA 3NAHA 2YKOA 2ASLA 2VPZB 2I6WA 1YJNS 3UDLA 1U1KA 2FTRA 4DX5A 5CH7B 3TJ9A 4Z2XA 1GXLA 2FJDB 5DDPC 4KO0B 2XO6A 1HMVB 3BN7A 2DGWA 5C24B 3CCZA 5EHHA 2D3O1 5DRKA 3AJ2A 2OEJA 5EDWA 1QVFR 2Q1LA 1RWWB 4OI1A 4NZ0A 3TZYA 1BQNA 2E7VA 3IAS9 4OZ1A 4RNNA 4OX8A 2YXLA 5HAOA 4DR5J 2B8QA 2W2NP 3MR3A 2CJBA 4H4OA 2CQ0A 2R3VA 3CCQS 2P9CA 1F3FA 4EBEA 4F2RA 2KHCA 2ZOMA 3WC2A 1RADB 2KG1A 3MF5A 1HD0A 3UW1A 2DNYA 3TAMB 2B7BB 3C15B 2V67A 3DYAA 1CEZA 3MECA 3D1OA 3DRRA 5D0HA 1YRTA 5A2QU 1X0FA 5H9EK 2J0WA 4YEAA 2BQRA 4QWDA 3BSAA 4NCGB 4CYUB 2AYMA 1NEEA 3HF5A 2HRUA 5DDRC 4FF4A 3KLIA 3CDUA 3FMBA 1MMNA 1VCTA 2XWYA 4QIGA 2AGOA 4K2JA 4PKDB 3HK2A 2ZH3A 4F67A 5LL6d 3UPFA 2DGOA 4KH1B 2PDAA 4HHJA 4WJBA 1TMJA 3DGPA 4OFZA 1NRKA 2YKNA 1JQGA 3QSYB 4RW9A 1VJQA 3HZGA 4Q7AA 1FESA 2MDAA 3ZZRA 4X4TA 4RO0A 2G13A 1HWUA 2DIVA 3KLHA 4DUYF 1YGYA 1HNWF 2DHGA 3DFEA 2GHPA 4KH0B 1K9MT 1RCOB 4IFYB 4ED7A 3DRXA 3EVOA 4Y0FA 3M05A 2EFVA 3BREA 1XMOJ 1VRUB 2PIIA 2QL5B 2CAJA 4ZVTB 1N4LA 3HMJG 3PM9A 2GGPA 5KFZA 2FHJD 5EX0A 2XMUA 1RWNB 3T1AA 1VQ9S 5IQ6A 4URQU 1I94J 2LP4A 3GSIA 4DDFA 2AU0A 1T7PA 2K1RA 1IBKJ 2Y8WA 4B3SJ 1OS5A 4KGVB 3CCSS 2FD2A 4Y2MA 4KGZB 2P9GA 3MUMP 4FP9A 5IT9U 2E66A 3VAMA 3NLCA 3K17A 4Y6IA 4K4XA 2HHSA 4BC9A 2GJ2A 3D5MA 1JJHA 1SL0A 2L3MA 4ECYA 4PG4A 2FHKA 3HXMA 5MLCV 3M9OB 5BXIA 5F8GA 2RNEA 4CO0A 1N32F 4HLBA 1CQNA 3DC2A 3RR7A 3MCNA 3CDAA 3OFEA 1U25A 2ROEA 4EEYA 4OJ3A 1ZPWX 3CCTA 3F0NA 2VPWB 1SH0A 1RKJA 4B02A 4F2SA 1EETB 3EICA 1U1OA 1GH8A 2SXLA 2JLGA 2MKSA 4YHHJ 3MR5A 4RW8A 1BQXA 2OFHX 1FFSB 4OI2A 1U24A 4LVOP 4CRJA 1T11A 4QR0A 3HHLB 2Z2ZA 3OTCA 2Z57B 3DOKB 2VQEJ 1HQEB 1SJRA 1XNRJ 3RYLA 2JC1A 3LAMA 3ZZ0A 3ENQA 4I4BA 1FRMA 2C1EB 2CXEA 4MK9A 4N76A 4IDKB 2HEKA 1YJWS 1I1GA 4KHPJ 4RW4B 1GNKA 4DR5F 3QAEA 3PO5A 3SMZA 2R2UA 2HZCA 2K3IA 1YDLA 3N5FA 4NLXA 3DXSX 3RBEA 1KQKA 4XIUA 4FS1A 3K59A 1TFYA 1N52B 3PACA 5HSPA 3PTWA 5DS7A 2IBOA 3GJSB 5HP1B 3TARA 4YMEA 2L9DA 4CLUA 1PIEA 1AFJA 3GFZA 4P9SA 5GAEU 3A12A 1MWZA 2ADCA 1JJCB 3R27A 2KFZA 3EJMA 3PR5B 1NKEA 2BW2A 2B4VA 3NY0A 2BE2A 3BSNA 1U2FA 5HLFB 2LQJA 1RAOA 3VR1A 1ZH5A 1VDHA 1Z1ZA 4LRCA 5ETTA 2F5GA 2LMIA 3FMWA 4OYPA 1KWMA 3TZXA 1G7CB 2EG1A 2KT5A 2FVPA 3EPGA 5IZHA 1ZAVA 3B54A 4PWDB 4HVZA 5KFTA 3PIOQ 1FT8A 4KPYA 3OR1A 5HN0A 3NL0A 4HACB 4K4UA 2RF2B 3BO4A 5B0GA 2F7VA 3A3NB 3HSZA 2ZH4A 2UZAA 2QMUB 1GEHA 2XB2D 5CQGA 3TVZA 1FRJA 2VU5A 1SV5A 5KFUA 2YNIA 5SZTA 7AT1B 1UJ5A 3VGVA 3KK3B 5AXNA 2EBEA 4NPOA 2J9DA 4XAKA 4X65J 2FQQB 1TMMA 3T1HJ 2AX1A 2Z58B 2IIHA 1KN6A 4B3OA 3DDKA 4LSNA 3G6XA 2BE9B 5KFYA 4C8MA 2CPFA 2OUGA 2IRYA 1Q8IA 1XMOF 2CQ4A 3JQMA 2VA2A 2VQFJ 2CYYA 5I3UB 4NLPA 4IG3B 1I94F 2QZ8A 1RTDB 1E6VA 3AXMA 5HBMA 4ATNA 2HVEA 5LJ3Y 1IBKF 1CJTB 4S0MA 5LM7E 1S57A 3PKYA 4B3SF 3VAKA 5LXYA 4OV1A 2LU2A 2XY5A 2OD6A 3OUYB 1KQFB 1UFLA 2JVOA 3EUNA 4PQUA 3KJVA 2KTQA 2DIUA 1U8WA 4XPEA 4V19J 2A3JA 1LKZA 2WOMB 1L3VA 3MPVA 4WU2A 3ZTQA 4RUHA 3OSNA 4ECSA 1XNQJ 1NBEB 3T9NA 1LFPA 2VHGA 3SFGA 2I2YA 1EKSA 4CNZA 3T5JA 1UVNA 2EKYA 4IFVA 3SV4A 3CJ5A 4H4MA 4F0HA 4YHHF 2MY8A 3X1LB 2HNZB 5E3QA 1BXNA 2JVRA 3GCXP 5C25B 2KJVA 1CLFA 4CO5A 5KFQA 1PBUA 4HI1A 1A9NB 5ETMA 3KTQA 4X4PA 3SCIE 2YKPA 3D68A 4IR1A 1KP6A 2VQEF 3IG1B 1KBRA 4R0EA 2W2OP 3RG6A 1MROA 4WFAQ 4OI4A 1XNRF 4WFYA 4DLGA 4TU7A 1FE4A 3AQOA 3P6YC 3LGMA 4OX7A 1HQUA 4BC7A 1X4BA 2YNFB 5DLGA 3MM9A 2E44A 3NS7B 3CJ8A 4N47A 7FD1A 3HP6A 2RQ4A 3RW7A 1UA1A 4WYLA 4KHPF 1WC5A 3HT0A 3VV2B 2GQCA 2XULA 2M5YA 4U6PA 2AJ2A 2R7VA 3MAAB 2XSJA 3H0PA 4QZVB 2J6UA 2LLZA 2M7SA 2XSFA 2V94A 3L7OA 1YZ6A 4TQRA 2IRUA 1XR5A 3QT7A 2W8KA 1X8DA 1UVLA 3GIRA 3A8IA 3CCRS 1B64A 1VQPS 1U4BA 1UEUA 5CA5A 2DRBA 4OMFG 2ZJQQ 5M2PA 3ENVA 2MQMA 4X4VA 3FBBA 3IBCB 3ENWA 2E5GA 1TP7A 5ETOA 5KFLA 3E3XA 4EBCA 2OPSB 4FDFA 1EIYB 2HFSA 4MYUA 3W2VB 5SUHA 2RU3A 2CPIA 1Z4UA 3WIVA 1HBOA 3FKBA 1WC0A 3KHGA 2ZKTA 1B99A 5E2QA 3CW2C 2RKIA 3QJPA 1P6TA 1OMSA 3CCES 1C1CA 3RB6A 4C98A 3LPYA 2E9TA 3TQ1A 1S7IA 2MSTA 3DRPA 4DU7A 3Q0AA 4X65F 2J7WA 3DRSA 1FDNA 3KK1B 3T1HF 2W4CA 2ZH5A 2HS3A 2DGSA 1YWXA 3A1YG 4ED6A 2GGPB 2P6SA 2CJXB 4P7VA 3ZZTA 1F9EB 2D41A 4P75A 2D9PA 2Y9HA 2VASA 4JI4J 4NCBA 2EFGA 2VQFF 1VBYA 2GIQA 1RT1B 5BR8J 3U1NA 2LA4A 3DLGA 3QMQA 2HWTA 1N56A 1C4AA 1HKAA 1KFDA 1UL3A 3ZTRA 5KG6A 4CO2A 1H2VZ 4CI0B 3C2PA 1GK8A 1PC4A 4P2FA 2FVCA 2UUAJ 2DH7A 4QPTA 4WTOB 2ZE2B 4GMKA 2BA9A 3DM2B 2CG4A 4UUWA 2ZDOA 2LU1A 1B70B 2VV5A 4LRDA 4DL6A 2CPDA 3Q24A 5HJXA 1K1QA 3VVUA 1TKZB 3ET6B 1JMTA 1XNQF 2QV6A 3PJWA 1ITPA 3UCGA 2MZRA 5GADU 1H6KX 1LWEB 2MKKA 1FHTA 1QJHA 3HM9A 1P8GA 4X4QA 3PFEA 4M94A 2N4CA 1TL7B 4WK3A 2ZUGA 2VG7B 1CJVB 4DV4J 1QDUB 4Q44A 1HHQA 3PJ9A 3CCJS 2ZBQA 2ZOGA 2PI5A 3BF4A 3EZOA 1B0TA 1JLBB 3R6LB 1V3RA 3J7AN 1VGYA 4DX8H 4A8FA 2HGMA 3DU6A 2MQQA 1OWXA 2KDOA 1S59A 2B9WA 3FK4A 4ECTA 3AODA 3ZZPA 3H5YA 2MJNA 3BEGB 5G4DA 3HT3A 3FSXA 2OLWA 1Z2LA 2FLOA 4USVA 3AQPA 1RK8A 1HQ2A 2D74B 4P2SA 1Z2ZA 2HMIA 4F4YA 5D4LA 3R5JB 2HG4A 2W2PP 5JVGQ 3O8WA 1Q95G 5L9NA 4PG7A 4M5DA 1F5AA 4DUTA 3W66A 2XZDB 1H38A 1VQ8S 5IT4A 3P5TL 2KT2A 5A8WA 4Q8FA 1NAQA 3PDNA 3L7UA 4K4SA 1EP4A 4DOZA 1KVJA 1SC3B 5D78A 1C0UA 2I38A 4WE1B 2DNOA 1AW0A 4U95A 3HHLC 4UZBA 1JIHA 1RYSA 1QSYA 2W8LA 4LR9A 4F8RA 1K0TA 3OVSA 1DARA 2MY7A 3U27A 2GW8A 2MQLA 1U49A 2XY6A 3IR5B 1FVQA 3O44A 1CG2A 1IQTA 2XCPA 4F3QA 2Z2LA 4KV8A 5DG8A 1BC6A 1FRKA 1DLOA 3CC7S 5C5JA 3LTOA 4KGMA 2OSQA 2VIHA 3R5AA 3DDNA 4F3MA 4KKOA 4LIRA 3V4MA 1GMWD 2OPQB 2NSBA 1X5TA 1RHQB 3LF0A 3D7SB 1RDRA 3CJKA 3SSQA 4NLSA 3ENAA 2OH2A 3J7YU 1E6VB 4QOTA 3QLHB 5CAAA 3N9UC 4OYMA 4CH0S 5E3PA 4YB7A 4IO1A 4JI4F 1FJ7A 2E7WA 5BR8F 3MM7A 1KLNA 3QGIA 4BHQA 1G6BA 2V8PA 4PQUB 1JXLA 3S6EA 4N8OA 3CIZA 4JBCA 2NQPA 3PXGa 3W2WB 2UUAF 2R8KA 4NLUA 3M6XA 3M30B 3HHEA 2RH3A 2ATLA 4FBTA 1WHVA 2V2QA 3QGPA 5M2RA 1FDBA 2IDEA 1T9WA 4IFVB 2C3PA 3MOZA 4BBYA 3H42A 4DL0C 4ZPWR 5FDLA 4BLGA 2VFVA 3M2RA 3ICLA 4ZPDA 2BDPA 1MWYA 4RX6A 2QA1A 4FYWB 4CLSA 2XGPA 3PYEA 1R8HA 5F8HA 1VHIA 3IGNA 5GAHU 4CO1A 3Q8RB 1RU1A 1S1WA 4QPXA 3NGRA 4J37A 4XDCA 3K5OA 4F26A 3CUNA 2LYVA 3VWSA 2VG6B 4DV4F 3ITHB 1YJVA 2FZKB 1FKOB 2HWHA 4O3RA 1S1VB 1X9WA 3R9LA 4WWSA 3MXHP 3P49B 4DSJA 5A8KA 4DFMA 1UP1A 1EARA 4ES3A 1FO1A 4ANEA 3BDEA 4DF4A 1WI8A 3Q89A 5D0RA 2HLTA 2HPUA 2QSFA 3QYYA 3E2EA 1TKTA 1FXRA 1MSWD 4ED5A 4DPXA 2AHOB 3PRVA 4IH7A 1H2UX 5GAGI 4WFNQ 2WB1D 2HHHJ 2CZ4A 2I1RA 2DR5A 1R8CA 2CPEA 2IA0A 3BR8A 2JEJA 1I6JA 5I42B 4NA1A 4GRSA 8ATCB 4I6WA 2CUYA 4ZHRB 4PAAA 4TY8A 3MDFA 4XO0A 2QFIA 2ZC3A 2XS5A 2DPJA 4J5OA 1PILA 2V50A 1QE1A 3FCHA 4HDGA 2Q79A 4ZP7A 4OZ5A 3C6TA 1N36J 4CLLA 4ILRA 2YPZA 2KO1A 4WCEQ 4USWA 1YZ7A 4MKYA 2CQPA 4C8ZA 1JKHA 2XS7A 2B56A 1RE1B 1NSQA 1GX6A 3OVAA 4L72B 1EHWA 2GHVC 2FZCB 1WG4A 1WWHA 3RAMA 4RBUA 4ZN1A 3ILOA 3OVBA 2R8JA 1HNZJ 2MQNA 2V0NA 4ECZA 4DQIA 3ISND 1I3OB 2G2YA 5JJBA 3V4IB 5HMXA 2DD8S 4GKJJ 3MCMA 3HKZD 3QO9B 3D66A 3DDIA 4EU0A 4OHXA 2VODA 3O1LA 2HW3A 1NXIA 4R8UA 3OLBA 4LR7A 1DAXA 2V4RA 3TUJC 2VICA 1RXOB 2OO4A 4NLWA 4QIWD 2XG8A 3QRPA 5DJBA 3CWJA 2XQCA 1CJKA 1RT7A 2J0SD 1S0MA 1RTJB 1BWVA 5BYSA 3FUYA 2IYIA 3FGVA 4QJVA 5I3PA 3RR8A 4Y65A 3A13A 5AE2A 4YUDA 3RB3A 2K7KA 3JB9k 5HQLA 3PHTA 1VK3A 5J2MB 2AYBA 4CH7A 1NM2A 5EN1A 1Q79A 3TEGA 2UV8G 5IM0A 1DTTA 3M2VB 3OTOJ 1HI1A 3HDSA 2PFFB 5HI7A 1UJ6A 2CPXA 4A8KA 3HLUA 4CTAB 4IRCA 3MMBA 2P2CB 3W9HA 5ETVA 3UN2A 1D9FA 4K4WA 1FFGB 3TX8A 2KRBA 3JAMU 1HARA 4OHZA 3FBFA 1RT2B 5KG4A 3EGWB 3NMAA 2QTWA 2J6SA 2PA8D 4PCQA 2Z4PA 5F8MA 4DV1J 1KTVA 2C2DA 5ETRA 2AGQA 1Q5VA 3T1YJ 1FF2A 1RB0A 4J9OA 3EYZA 3WX4A 2OPPB 1WTFA 3CMQA 2H5IB 4QBUA 4ZKAA 2FY1A 2NXCA 3MEDA 1H74A 3GWCA 1X60A 2YH1A 1FD8A 4ENOA 3ELHA 2HHHF 4LJMA 2X1AA 2V6AA 5KFEA 3C66A 2VF3A 2PMHA 3DHXA 4C0OC 3L95X 4DQQA 1IKWA 5GAEI 4QYZJ 1NZ8A 2VG5A 2NCKL 1SJFA 3UVJA 4X64J 5GMKa 3J7ZT 1WD6A 3R2CJ 4ZITA 1R8AA 4J9NA 5F9LA 2E9RX 1MW7A 1U6BA 3BBFA 2H5EA 3MPDA 5B08A 1LW2A 4DF8A 4FVMA 3KMSA 3J7A1 4OJHA 1N36F 2MLXA 4CLFA 4J9SA 4ZJOA 2IY5B 2QA4S 3UI3A 5C7PA 1YBAA 4K7QA 3MPYA 3H8YA 2N3OA 2CQGA 1Y7PA 1J5OA 4IH5A 5B0FA 2FJVA 1R0CB 2CQDA 4C7QA 2GVDA 2V4QA 2ILYA 1JK9B 2AV5A 3HHNB 2EBGA 1WG1A 2AX0A 1H3DA 3SEOA 2QN6B 2UXDJ 3FDSA 1HNZF 2IJFA 4C3LA 2RJZA 1RT3B 4GKJF 2HNYA 2ZUAA 3I82A 4I2PA 3MM8B 2ZH9A 4NOHA 1D09B 2YWFA 4TKTA 3IMQJ 1NK5A 5KT3A 3VGUA 2UUCJ 1O5JA 2MEWA 2AD9A 1OPZA 1RAJA 2RRNA 2WK4A 3VAGA 1MG7A 2OTJS 1GAOA 4LVNP 1IKYB 2ZBCA 1GMWA 1WEXA 2DGVA 4ZVFA 1RTZA 5AXMA 3KG0A 3NKYA 3NAIA 5ETQA 3QT6A 1IBMJ 3IM8A 5B0AA 1CJUA 2BJ8A 5HQ8A 2FC9A 2L9NA 2MZTA 5L8RC 1JLQA 5CZVA 1N6QB 2G0JA 1T02A 2OJ3A 1UETA 4B3MJ 1ICEB 1IQZA 2GVZA 4YB6A 3S8SA 2M52A 2CPZA 4OYBA 2DNQA 1LFWA 1S1WB 3OTOF 4NI2A 3RBDA 1WORA 5GMEA 3C19A 3C14A 1LXJA 5L1IA 4F0MA 1KNZA 3MM5B 5A8KB 2G0IA 1ACMB 1HNXJ 5DZ6A 2COLA 1WKLA 2LEBA 4BWJA 3HVAA 1YSJA 4N8NA 3NNCA 1TUGB 4DV1F 3M8RA 4JV5J 2CG8A 4HL9A 1S0OA 5IWAJ 3T1YF 1OYEA 3O2IA 3FFIB 4C0HA 3POTA 3NOCA 2Q43A 5EGYA 2DCUB 1R8BA 4WK1A 4CO3A 1EQMA 3OFGA 4JOUA 4DX7A 3SI8A 3UN3A 2VB6A 3I4PA 1ZETA 1H7XA 5KFFA 3IP0A 5KOWA 3T41A 2D3OR 2G0CA 5B09A 4ZJQA 4Y2IA 4Z37A 3KLGA 3GG1A 4JYAJ 4K8RA 2C2RA 1S9GA 2WW8A 2YKMB 3M6UA 4IG0B 3W9IA 3TZWA 3VF0B 3W62A 4X64F 1N0VC 3AD8C 1IWGA 2HHQA 1XMQJ 4EGLA 1UWBB 3GU0A 2KVQE 3GONA 4WP8A 5B0EA 2IMWP 4A8XA 1JX4A 4X4SA 5KFXA 2WSCC 4DPUA 2E1AA 3T6JA 3NS6A 3OD2A 3HSJA 1LWCA 3KHHA 4KRWA 3L09A 1SL1A 4M95A 2PMWA 5F0UA 1SKRA 4X62J 3MGJA 4LMZA 3M1VB 4DR6J 2J0QD 2UXDF 1UJ4A 2QLFB 4KIAA 3ISZA 4USKA 1G1XA 5KFMA 4O4GA 3U1LA 3FSYA 1JLFA 1UWAA 4Y28C 1EX8A 3GILA 5K8PA 2BJ1A 2AJQA 1TUWA 1ULRA 3HX9A 3UD4P 4LRFA 3FNNA 3LUYA 2DTJA 1CJKB 1JLAA 1TVRA 3MMCB 4CT8A 1AZSB 4G1PA 2KL8A 3NGTA 1SQGA 1VQLS 5IC6B 4UF4A 2QIFA 3JSMA 5HATA 2NR0A 1KQSR 4KR0B 5ETKA 2XC9A 2AZ3A 1IBMF 1Q82T 4OYXA 1WC3A 3CCWA 4JI0J 2W2MP 1TL1A 1TAQA 2R42A 1U1MA 2AEFA 3TR5A 5GADI 2AYGA 3CJ4A 3O3LA 3NNHA 3ZZYA 3KWMA 1YRUA 3LP1B 4PEOA 4B3MF 2XYHB 1U45A 2WSEC 4J9RA 4DEZA 3DLKA 2GAHC 5T7LA 4MYTA 2KXNB 4PRFA 2Y1RI 1WDDA 3G86A 3R1HA 1IBLJ 3RW6A 2ZKUA 3FZ2A 2GO9A 1ZM2A 2A2DA 5B0CA 2M8HA 1HNXF 1JB0C 3BGRA 3QBCA 2WBRA 2VL1A 2J8SA 3RRHA 4ECVA 3BKFA 2LDYA 2Q6BA 1G4CA 1APSA 3K2YA 1F6TA 3JYTB 4JV5F 2BR0A 5IWAF 4HKQA 2R2SA 4TLRA 5K14A 4O3OA 2C22A 3P96A 3M9MB 5HANA 2EC2A 3GV7B 4AE5A 3NP5A 1VLOA 4DI6A 1REGX 1TV6A 3AOBA 3AD7C 1S6PB 1H2TZ 1TQLA 2KH9A 2WCXA 5IC4B 1RTHB 1SQEA 3IR7B 4NRTA 2V69A 3JQKA 1OYDA 3D9BA 4M5HA 3CJSA 3GV8B 2MZJA 4JYAF 1O0PA 4ZVEA 2QSWA 2HHTA 2W4DA 3PYDA 3ZO7A 2V8GA 5HVFA 1CSJA 1RT5A 2I0XA 1CC7A 2BX6A 3NEKA 4RW6B 3MUVP 4NCAA 3CE8A 3MPWA 2ZNYA 4ZPVR 4F4AA 1XMQF 4UOCA 1CBKA 2W9CA 2C3OA 3MR2A 2KJWA 3DKDA 1K44A 4Q5VA 3PNIA 1FD2A 4CQ1A 3OHAA 3BGOP 2GO8A 3RAXA 2Z0GA 4QW8A 2OI2A 3UE2A 2W25A 3JSBA 5G0RB 1B0PA 1N5YA 3UO0A 4ED3A 2BKNA 5J1PA 3TZZA 2R8IA 3N6LA 3G96A 2IJNA 4K0KJ 1ZM3A 3DMJA 1O51A 2RVJA 2HNYB 4YR3A 3M8QB 4X62F 2E9ZA 3K57A 4DR6F 3M6WA 2IHR1 5A76A 3M6VA 1HPZA 2R7XA 4H4KA 2BMBA 3ETMA 4RUCA 4YS2A 3GR1A 4M5MA 2MKCA 3J7YI 3NCRA 3Q8PB 4FF3A
chains in the Genus database with same CATH topology
4TU9A 4RBVA 4DV2F 1CLFA 2YNFA 4DQPA 4ERDA 2FDNA 4CO5A 5KFQA 3QIPB 4MJKA 4HI1A 4Q2MA 1A9NB 1NK0A 2HS0A 2MQPA 3KTQA 1REVB 2VH7A 4H4MB 2AF6A 1HI0P 1HPZB 4X4PA 1NH8A 3SCIE 2OKQA 2YKPA 1E6YB 5KFKA 4DFJA 4IR1A 4AFFA 2VQEF 3IG1B 1U8SA 3TAPA 4R0EA 2RD5C 2IA6A 3IGVA 1HWKA 1MROA 4WXOA 5LXRA 1HBUA 4WFAQ 4OI4A 4I69A 1XNRF 4WFYA 4DLGA 4TU7A 1FE4A 3AQOA 3P6YC 3LGMA 4OX7A 5K8NA 4DV3F 1HQUA 4BC7A 1XWLA 3NGDA 3M4XA 1X4BA 2YNFB 1HW9A 5DLGA 1VS3A 1W25A 2D3UA 3B82A 1AFIA 4DR2F 1R27B 3MM9A 4DV7F 2E44A 4RLEA 5GAGU 2BOPA 2HHWA 2KYXA 4N47A 3QIDA 5E0OA 4A8WA 2DGTA 2WAQD 7FD1A 1R0AA 3HP6A 2W7AA 2RQ4A 4R5PB 1MROB 4NMLA 4DSKA 4K50A 1UAWA 4WFZA 3RW7A 1UA1A 3V6KA 1IJFB 4WYLA 3N79A 5E5NA 3FEXB 2ZFHA 1HQUB 5JUMA 3OFFA 4KHPF 3LANA 4DJBA 3MFHA 4JI0F 1O8BA 4X4OA 3KKFA 2GQCA 2XULA 3MM9B 2M5YA 1SH3A 4U6PA 2VPYB 3OLAA 1SC6A 2F8EX 5A6WA 2R7VA 1R89A 4AUKA 2L9WA 4ID8A 3LAKA 2WRMA 2QT7A 2XSJA 1ZOTA 5KG7A 4N5SA 1R0AB 2DITA 4DG1A 4QZVB 4P7TA 3PRBA 2J6UA 3P3DA 1FK9A 3I5AA 3QAUA 2FLPA 2LLZA 3M32A 4URSA 2VD3A 2M7SA 5E7OB 2YNHB 2IM3A 1FCAA 2XSFA 4U67Q 1TFWA 3N5BA 1S77D 4W90B 2V94A 4F02A 1ZM9A 4DR7F 5KG5A 3L7OA 5CYJA 4TQRA 2IRUA 4J9MA 2AJFE 3G6ES 4USHA 3I31A 2XSJB 1MMLA 7FDRA 1XR5A 4C11A 2KYZA 4LFAF 2W8KA 4DG1B 2A2CA 1X8DA 1FK9B 1NNDA 2IVMA 3I32A 3K58A 2E1RA 5B0DA 1UVLA 3H5XA 2WSFC 2CFXA 5DETA 3CCRS 3Q22A 2I5JA 1B64A 4LSLA 4ELTA 2ROGA 4I7FA 1VQPS 3MWBA 3QPIA 1U4BA 2WHOA 2OPSA 1IBLF 3W2VA 3KHRA 2Q66A 1UEUA 3MAQA 1X7VA 5CA5A 3H40A 1PO6A 4OMFG 2DRBA 3I5BA 2XI2A 2ZJQQ 1M5HA 2DB1A 2GCFA 4C0BA 3CVKA 1XK8A 2QE5A 1Y4ZB 5M2PA 3ENVA 2JSXA 4ZPBA 2MQMA 4YB1P 4B9MA 2C3MA 2VFTA 3I9ZA 5F9NA 3V6JA 4X4VA 5EWEA 4MMOA 2HHUA 4QU6A 3ENWA 2I5JB 2E5GA 2KI2A 4LSLB 1TP7A 2QEXS 4I7FB 5KFLA 3KYLA 4TLQA 3E3XA 4EBCA 3GIIA 1XBWA 2OPSB 4DV5F 2CPYA 2ZH8A 3W2VB 4MYUA 1ZZNA 4I64A 5AXKA 5SUHA 2DPIA 1L3KA 3FEYB 1WF1A 2R7UA 4XK8C 3MHYA 3MD1A 2DHSA 2RU3A 5DGAA 2K3KA 4K2XA 4Y2AA 2CPIA 1Z4UA 2HGLA 1HBOA 4WFBQ 3RRKA 2GMHA 2N3LA 4Q45A 1JLCA 3SSRA 4QIVA 5J1EB 3KHGA 3CEDA 5IT0A 2ZKTA 2V4JA 2P9EA 1C2PA 5E2QA 1X4AA 2HIQA 2RKIA 3QJPA 1P6TA 4FS2A 3KK1A 4ED0A 2CQHA 3CCES 4RU9A 2AP6A 1C1CA 3RB6A 3IRWP 1WF0A 4JUZA 1VMBA 3GSDA 4C98A 3LPYA 5KFOA 3QWUA 3THVA 2E9TA 1FJCA 2HVIA 3DLJA 4H4KC 1NJYA 3TQ1A 3CJ2A 2DNMA 2MSTA 1HBOB 3DRPA 1D8YA 4I67A 5D8HB 1XR7A 3Q0AA 2MHEA 3N6NA 2V4JB 1NHUA 4X65F 2J7WA 3BO3A 3DRSA 2E5LF 2RKIB 1FDNA 1S9GB 4P6QA 3KK1B 3T1HF 2R2TA 2W4CA 2DGUA 4Y2KA 3KHLA 4A8YA 1C1CB 2VC0A 3EXYA 2DNLA 2ZH5A 2HS3A 2DGSA 1YWXA 3A1YG 4ED6A 2GGPB 4IOCQ 1ZTWA 2YWGA 2EI5A 5HMYA 4QWCA 1RT1A 2ZJRQ 2P6SA 2AGPA 1RA6A 3IWLA 4P7VA 2MSSA 4ZS6A 3DRPB 1N5TA 4URGA 3ZZTA 2C42A 2YX1A 5J2QA 1XMBA 3CD5A 4O4RA 2VBXA 2EFNA 2D41A 1K1SA 3DRSB 5LSOA 1KFSA 3KLEA 2D9PA 3PW4A 4M1KA 1KS2A 1S10A 4BS2A 4NXNF 4DSEA 2I8EA 4FF3A 2UUWA 2DBBA 3BZQA 1HFEL 1X9SA 2RT3A 3VZHA 2VASA 4IRDA 4ZLPA 2BV3A 4NCBA 4TXSA 2EFGA 2ZE2A 2VQFF 3IS9A 2GIQA 5EUHA 1VBYA 1RT1B 2ZZNA 3DM2A 2HFNA 1M1KT 3U1NA 2LA4A 1SKWA 3DLGA 3QMQA 2HYIB 1Y5IB 2HWTA 5J2QB 1N56A 1C4AA 1KFDA 1UL3A 2IRXA 1SXLA 3HFKA 3OBIA 5KG6A 4CO2A 1H2VZ 3MZIA 1YTYA 2R9LA 4CI0B 3HO1A 3C2PA 2ZC4A 1PC4A 4MH8A 2FVCA 2PMZD 1YIJS 3AA9A 1TKZA 4I6AA 2YWEA 2DH7A 3H20A 4JI6F 1TK8A 4QPTA 3GZ7A 2ZE2B 3IS9B 4GMKA 4MAKA 5KG1A 2BA9A 3DM2B 2CG4A 1XTZA 3DI6A 3TNVA 5AE3A 3WC0A 3GQCA 3DLGB 4UUWA 2KZZA 2ZDOA 1UFWA 5H9FJ 2LU1A 4NA3A 2CJKA 2VV5A 1NJWA 1LWEA 2PA3A 2EK1A 1U1LA 2VFRA 4DL6A 2CPDA 3Q24A 2ROPA 1BGXT 2A18A 4K4VA 1K0VA 5KT5A 2IFXA 4ILLA 1HNVA 4AL5A 1K1QA 4K0KF 1TKZB 5ADZA 5KFNA 1GXUA 1JMTA 4O4GB 2UUCF 1BLUA 3BQ0A 1LK5A 1XNQF 2QV6A 3DI6B 4RNHA 3PJWA 1FNXH 4WTYA 2VBZA 3UCGA 1URNA 2D3ZA 2MZRA 1XR6A 2XY7A 4FN5A 5KFHA 5GADU 4UQGA 4DL3A 1H6KX 1LWEB 3CO9A 4XPCA 3OQ2A 2MKKA 1KLMA 3BQ2A 1U26A 1T8EA 1PSDA 2LXUA 3BGFA 1FHTA 2CRLA 2VG7A 3R5CA 2BABA 2GC8A 5DO2A 3DOLB 4NLDA 1QJHA 2BQUA 1RQ0A 4ZOSA 3HM9A 1LW0A 1KR4A 1P8GA 2HWIA 2YX7A 2VBYA 2QA4G 4C8LA 3SCJE 4MKBA 5E3RA 4X4QA 2LEPA 3PFEA 4DSFA 4M94A 1HBMA 2DH9A 2N4CA 2C3YA 3QZ8A 1VOMA 2OP5A 2CQ3A 4OJ1A 1JLBA 3PW2A 5E41A 3NCQA 2BVZA 4OZLA 5DQIA 4WK3A 5AJ3F 2ZUGA 2C22A 1KLMB 2P6TA 2JHEA 4ZCIA 5HROB 3OFHA 4EO6A 3K8VA 4FPRA 2VG7B 3HVRA 1AROP 4D3HA 1GX5A 2GA7A 5KT6A 1SI9A 4WZQA 1KRPA 4ZK7M 1LW0B 4Q44A 3GV5B 3SQGA 1NK9A 3CCJS 3PZPA 2EC0A 1M5SA 1HBMB 2ZOGA 2PI5A 1X5PA 1U47A 3BF4A 2KZMA 4LF5F 4FZVA 1HI8A 4RNOA 1B0TA 1JLBB 4OL8A 1FDDA 3SFUA 4LUBA 4WFXA 4QWEA 3IO1A 1V3RA 2P5VA 2EFPA 3MEKA 2MGZA 1VGYA 3MTKA 4DX8H 3PW7A 1Q86T 4A8FA 3T9ZA 2FUG9 1OSCA 2M70A 4WIIA 1KHWA 4NXMF 1NH7A 2HGMA 3DU6A 4BWMA 1T3NA 2MQQA 3MEGA 1OWXA 2ZDPA 1TL1B 2QRRA 2O66A 1U1NA 2KDOA 3KNGA 3SQGB 3M8PA 4ZCLA 4RNMA 3OXLA 2W7OA 2B9WA 3PJXA 3EGZA 4OX6A 4ECTA 3ZFVA 1HHTP 3OHBA 3DOMA