1FRJA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCIYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frjA00
1FRXA 5E7OB 1R27B 5BYRA 1H0HB 3MM9A 1SIZA 1Q16B 4XDCA 2WSCC 1BWEA 2FJEB 2PA8D 1DURA 1BC6A 2Y0SD 3LW5C 3IR7B 3PNIA 1H98A 1DFDA 1BD6A 3MM6A 1JNZB 1FERA 3MMAB 4YDDB 1IR0A 4OV1A 2O01C 3MMAA 2WAQD 1G6BA 1G3OA 1D3WA 1FDDA 2V2KA 4DHVA 1FRIA 3MM9B 1IQZA 1FXDA 1CLFA 1FDNA 1ROFA 1BQXA 1JNRB 1B0TA 2FJBB 2VPWB 7FDRA 1FCAA 1SJ1A 2C3YA 1FD2A 2PDAA 1B0PA 1Y4ZB 1H7XA 2C3PA 2VKRA 4ID8A 3MM6B 2VPZB 1WTFA 4L6V3 1GAOA 5CH7B 1Y5NB 3IR5B 6FD1A 1PC5A 3EXYA 7FD1A 2VPYB 3HKZD 4Y28C 1K0TA 2WB1D 3OR2B 1GTHA 3OR2A 2C3OA 1FXRA 3C8YA 1FEHA 1FRHA 3MMBB 3MM5B 2PMZD 4XDDA 2Z8QA 3MM5A 3MMBA 3OR1A 1VJWA 1XERA 4RKUC 3IR6B 4KT0C 3MM8B 2FJDB 2FDNA 2C3MA 3MM8A 1RGVA 2C3UA 3MMCB 4OMFG 3EUNA 3EGWB 2V4JA 3GYXB 2C42A 3MMCA 1C4CA 2FJAB 1GT8A 2GMJA 2XSJB 5BYSA 2XSJA 3MM7A 1PC4A 1SIWB 1B0VA 1H7WA 2WSEC 1FRMA 1KQGB 1DAXA 1Y5IB 1HFEL 4XK8C 1F5CA 1FDBA 2FGOA 4CI0B 1F2GA 5FD1A 1FRLA 3OR1B 1FDAA 6FDRA 1KQFB 1F5BA 2GMHA 2WSFC 1AXQA 5BYQA 2VPXB 1KEKA 1FRKA 2V4JB 1JB0C 2ZVSA 2FD2A 5CHCB 1A6LA 2UZAA 5L8RC 2IVFB 1C4AA 1FRJA 3MM7B 1Y5LB 4AYBD 1FTCA 1GTEA 1FF2A 1BLUA
chains in the Genus database with same CATH superfamily
1U4BA 1UVMA 1ZPWX 4K4WA 2IYGA 1NKCA 1SKSA 4ZIVA 1HHQA 2LA4A 3QSYB 4KY3A 3J7Z5 3OFEA 4TKTA 4B3OA 5DO2A 1MU2A 4CLYA 2EW9A 4XAKA 3WDOA 2Z57B 3IC1A 2FHKA 2WW4A 2YNFB 3A13A 4N56A 1AZSA 2XLKA 2VQEF 5DLFA 1X31C 4K50A 4L76A 2OD6A 3AOBA 4K2JA 4RW8B 3TZYA 2FTRA 5B09A 2J9EA 5IQQA 4H4OB 3OL9A 2CPIA 3HSDA 3DLEA 1P9YA 2VIHA 1LXJA 3THVA 1I1GA 3QSIA 1HBMB 4HACA 2MQ8A 1KQKA 2AYMA 4AXJA 3M7VA 4WJBA 2ZHOA 5KFWA 3DHWC 3KLHA 5KFVA 2HMIB 3AOCA 4WKRA 2BZ2A 3L95X 2YPYA 2GQQA 3AHPA 2WONA 3KHHA 2BE2A 1F5AA 2DNOA 1W2IA 4MIBA 3B6BA 3CT9A 2HFZA 2WRMA 2ZH1A 2KFZA 2Z2ZA 3OJSA 1HNIB 4DJBA 4K4YA 2GO8A 1LOUA 1FD2A 4Q8FA 1RT2B 1GQEA 2X51A 3C3LA 4PUOB 4NLYA 2VPZB 2RUGA 5CH7B 1HWIA 3QIDA 4X64F 4NLSA 2B6AA 3THTA 4NOHA 4EMDA 2MJUA 2W4DA 3MMBA 1X4EA 1Z1ZA 1OY6A 3KK1B 2E7WA 3M8QA 4OHVA 1GT8A 2GMJA 2ZNYA 4UF4A 3D2WA 5HAOA 3KNAA 4TLRA 3T3FA 1KNZA 4NRTA 2MKSA 3F0NA 4KKOB 4PQUA 5ETVA 1TL1A 4ZVEA 3L7UA 1IR2A 2YWFA 4KQZA 2HZVA 4FYYB 1MMLA 3NCQA 2DY9A 2I1RA 2Q43A 1JXEA 5DZ6A 3CCSS 3QPIA 3H42A 4NA1A 3EE3A 2Y0BB 1VQMS 1RTDA 4Q45A 3HX9A 1VQ6S 1RAGB 4DZDA 2KXFA 5CYQB 2K7KA 4O3SA 1HMVB 1F1BB 2K3IA 1UVKA 4ZITA 3RBXA 2ZKUA 1B0PA 4TQRA 1S4EA 5T41A 1RISA 3DKDA 5GVQA 2QA4S 2DY1A 4OX7A 2JH3A 1MU2B 3TX0A 3G6VA 2ZBQA 1QAIA 4DS4A 3VQTA 2PMZD 2IRXA 4ZOSA 2C3UA 2OEKA 2J0WA 3TARA 3ETMA 3VV2B 2YX7A 4B9NA 4I64A 1T9UA 1PO6A 4CM0A 3M8YA 4ZPDA 3JTPA 3J81U 3MPWA 1JK9B 3R5CA 3R6LB 2YKMB 1TKZA 3AJ2A 2VC0A 1H6KX 3KXDA 2EEYA 5FLXY 3IP0A 4NXMF 4DFKA 2UU9J 3ZTQA 3W2VA 5DETA 3VAMA 2KJVA 4K4SA 1Z4UA 1WDTA 1IKVA 3QGGA 3VAGA 4BWMA 2XHCA 5B0BA 4KBIA 1U2FA 3OBIA 2XS5A 2W4CA 4EZ9A 5DZ7A 4WF9Q 3M2UA 2CPFA 2ZUGA 3KLHB 4Y2AA 4P9SA 5L1JA 2FJBB 2WONB 4DR1J 1BQNA 4K2XA 1S10A 1SH2A 2L48A 2WOMB 5KFPA 5A8RA 3PEJA 1VYAA 1VJWA 1RCOB 3EICA 4RKUC 2QLWA 4OZ2A 3X3UA 2HRTA 1MW7A 1DARA 2XMAA 3TOQA 2CQIA 3Q8UA 1EARA 3KHLA 5FD1A 4ES2A 2FLOA 2B5JB 2RAQA 2RKIB 2R8JA 4UY8T 1DBDA 1Y7PA 1VQOS 2KT2A 4ELUA 1N36J 2RNEA 2ASDA 1ZZFA 1AT1B 3Q23A 1ACMB 1FHTA 5B0EA 2PE8A 3NS6A 4ZCLA 4MKBA 2LCWA 4UOHA 2ZBPA 4RWXA 5KTQA 4P2SA 1ZM9A 4PG7A 1B7FA 2NXEA 4RW7B 2OD4A 2BJ3A 2FGCA 1FNMA 1QVGR 3BO4A 3M8RA 2P2CB 3SCLE 1S9EB 3AQOA 2ZH2A 2ZBIA 1A0OB 3UN2A 1WSVA 4FF2A 2V2ZA 2KRRA 2FB0A 5F9NA 3UDCA 3HJVA 2B9WA 3VR1A 2Z56B 2W01A 2KN4A 1T05A 3A8EA 4DFJA 3Q8SB 3EPGA 3CJQA 4IG3A 1VRTA 2BANA 4LFBJ 4F25A 2ATCB 2Y9HA 3DRPB 1K8AT 4WFAQ 3OTBA 1I94J 1T95A 4CM2A 3ZZUA 1YBAA 3IGVA 1Q7YT 1DHMA 2C2ZB 2Z2LA 1R8AA 4ECZA 2IBKA 4LVOP 4NEZA 3W2VB 1IQZA 1AB8A 5I4MA 3TRGA 4F4KA 2VG7A 3CCQS 4F26A 2VZ9A 2E5IA 3R7SB 2IVMA 4X4OA 3ILJA 3MEDA 3CJRA 3H59A 3AJDA 3LQVA 3V4IB 2KXNB 1UEKA 3LH2S 1FJCA 3OSNA 4FF3A 3IRXB 1MNEA 2LLZA 3EUNA 4K5SA 3ZNJ1 2E1PA 1TKXA 2LA6A 4NZ7A 2AJQA 2LQ8A 1HFEL 2ZWPA 2W4PA 1S6PA 3U27A 2UXDJ 3DOKB 2PFDA 3O3LA 5ADZA 4F02A 3CD6S 1UKUA 3D1HA 2A3JA 3D3BJ 3S7RA 4YB5A 2H51B 3RZAA 2B4PA 1HYSA 2QZ8A 2QA2A 4BC7A 1B64A 1UVNA 3PR5B 2E1MC 2U1AA 2DITA 4O44B 1IVZA 2CUYA 2JHEA 1NM2A 3BKUA 3QWUA 1NZAA 2W25A 1YWXA 4C8ZA 2LKZA 2DCUB 2RRNA 4LIWA 2ZNZA 1UJ6A 1YRTA 4DN9A 3PDNA 2IJNA 2DXFA 1Y3KA 1ZZNA 3SMZA 3GSIA 4J37A 4KGXB 4PCQA 3CMES 1EQMA 2VG5A 4J9OA 4NCBA 4OMFG 1RWUA 2DR6A 5KFXA 5JJBA 1NDPA 2UU9F 2FJAB 2ZKTA 3VGVA 3MAQA 2WSEC 4DR2J 3K5LA 3T1AA 3I0SB 2DRBA 3Q2SC 4CCHA 3HHKA 2A6OA 4F7VA 5LOQA 2JC0A 2N3OA 1AUSL 2Q1LA 5A2QU 3OVSA 4FYVB 3ITHA 1PGZA 2GMLA 1RAFB 4GKJJ 3ENAA 4B9SA 1RJJA 4O3PA 3ZZRA 2XMTA 4CO5A 4B3SJ 1HWLA 1VBZA 4XDCA 3D28A 4I7FB 2JJ4D 3IAM9 4DR1F 3D1OA 4DMZA 2FZKB 4OI6A 2Q6BA 2B9XA 1SBRA 5KT7A 3KUGA 2ZH7A 4B9LA 3GCXP 4PAAA 4RW9B 3RRKA 2OFGX 3B8HA 4WIIA 4YY3F 1RLDA 1RUSA 2O1PA 1SJ1A 1WC1A 4NLPA 4J90A 2LFVA 5DJBA 2CG8A 3M6XA 2GS8A 1WEZA 2AZ3A 1S97A 4OHZA 2KL8A 2OAUA 2VFUA 5D3GB 3OR2A 1X4DA 1IQTA 1S6UA 1ZM2A 1Q8LA 1IKWA 3HSJA 3IR6B 2YWEA 1P6TA 4M5IA 3DHXA 3I6PA 3EGWB 1Y11A 2QYGA 3CMQA 4QW8A 1N36F 4QW9A 1WC6A 4DL4A 1Q5VA 2KG1A 1UA0A 5D78A 4G1QB 1ZAWA 1RHMB 4BCAA 3N9UC 2EFNA 2EG1A 3BV8A 3N5FA 4KR0B 4CLZA 3P8BB 1XIQA 5RUBA 4FNIA 3AB4B 4ZVTB 2CPHA 1N34J 3BSCA 5A8KA 2FC8A 2CYYA 3P5BP 2WVEA 2YKOA 2AX1A 1R0CB 1YJTA 1HWUA 4RBUA 3BYRA 4JYAJ 4A8YA 2WAQD 1D3WA 3TQEA 2NZ4A 1VQYA 2GVDB 4X62F 5F8NA 3OJUA 3J80U 2AIRB 3OLAA 1U1PA 4NPOA 1LWEB 1VRUA 2DHGA 4ED6A 2X1GA 4TLQA 4LR8A 4C8KA 3NXZA 1U0HA 4RNFA 3CD7A 1RWKB 3BF4A 4IKAA 4LFBF 2P9EA 2OSRA 4KT0C 4ZVSB 3K57A 1VMBA 2RILA 3DU5A 4D3HA 3V6DB 5U47A 2WTFA 4XK8C 2R8KA 2VG5B 1YG0A 3NGTA 1V5VA 2V5HG 3MFIA 4YS2A 4ILRA 4ZJLA 5AXLA 2CJYB 2CKWA 1TV6B 3I4PA 3SCKE 5DQHA 5E7OB 2HHTA 3N6MA 3DOMA 1DTTB 3AQPA 3DFEA 3BBBA 4ZA1A 1YSJA 4DL7A 3QJLA 3ITHB 1R3NA 3CDAA 4CLUA 4U8YA 5IT9U 2YY3A 1Y4ZB 1IM4A 4DN0A 2AZ1A 1X9SA 3GWCA 2AYEA 7FD1A 1GMUA 3JB9k 2HK2A 1RSCA 2DNMA 1X4CA 1MSWD 3IXQA 4LRDA 2QC3A 2UXDF 3K0JA 1NDCA 1S9FA 1OPZA 2ZZNA 3WIVA 1DLOB 1H74A 1HARA 4DL5A 4DX8H 5KFHA 2EK6A 4L75A 1DAXA 2ZH5A 2AQ4A 3BZQA 3CJ2A 4M5KA 2YNGB 2X1BA 4J9PA 2E9TA 4BS2A 4LF1A 3NLCA 2OMOA 3VF0B 3Q8YA 2BM1A 4B08A 5EN1A 4WE1A 2MLXA 2ZH3A 3OVBA 1S9GB 4NMLA 1FJGJ 4WK1A 1HIYA 1TTHB 3H4DA 5IC6B 4GO5X 2YX4A 5HJYA 3G82B 2HNYA 4ENOA 2ZZMA 3V6JA 3TO8A 4RR5A 5C2CA 5HANA 5IQ6A 2CNNB 4C8OA 3UPFA 5KFZA 5KG1A 2V68A 4OYIA 4ZCMA 3HMJG 2IM3A 4DR2F 2KYZA 3FCHA 4MYTA 1KSPA 3BO3A 2CQGA 3LGMA 2J7WA 1HQEA 2P5VA 2KVQE 2VPYB 3WQPA 5D0EA 2PFFB 1U1MA 4USIA 2G4BA 4KFBB 4WP9A 4GKJF 4B3SF 1RT4A 1RZMA 3OLBA 5AJ3J 3M30B 3BYPA 2FLPA 1U0HB 3SCIE 2W7AA 4DQSA 4FS1A 1O6XA 4OHWA 4EYHB 2J0XA 2F4VJ 3KJFB 2VC1A 1GXTA 2VPXB 3MTJA 1DRZA 3IM8A 1UPPA 4G6VB 2MSTA 2QA1A 1GTEA 2UV8G 2HQDA 3P96A 1U2CA 2ZZTA 1XR6A 2CWKA 3H40A 1RHKB 1FWKA 2HBRB 2PGCA 4LSLB 2ACMA 2QIFA 2ATLA 2V63A 1BQXA 3FK4A 4USHA 1N52B 2DYAA 3RGIA 3RB4A 3N6LA 1WF1A 1N33J 3BQ0A 1Q53A 3IWXA 4FN5A 2VJVA 4QU7A 5GAGU 1AUDA 3HVTA 2DJWA 2W2NP 1Q81T 4WU2A 4U6PA 3GIKA 1C2PA 4Y0FA 4DR5J 2YPZA 2CVIA 2ZVIA 2VDIA 4DCOB 1OSDA 1N34F 3FBCA 5FDLB 2ZH4A 2LQ5A 2BOPA 2BDPA 2DGSA 2B9YA 1K47A 3O5TB 4JYAF 2ZVSA 3TQ1A 4QIEA 1SJQA 3SQOP 4CO0A 1GMWA 1E6YB 3FCWA 2VA3A 4DF4A 5CZXA 4DCPB 2BQRA 5SUHA 5ETPA 2LVWA 4EK2A 5KT2A 4WE1B 4U9RA 1X0FA 4ZLPA 4KGZB 1WI6A 4CH1A 1WHXA 1S1TA 1YJVA 2J6SA 4GC6A 1R8HA 4M5LA 3FBFA 3DRXA 3VVTA 2WVBA 1RU1A 2OPPA 2CJAA 3FEXB 4QQBA 3GV8B 2VBWA 4IH5A 1A7GE 2QMXA 3SDEB 4KPYA 2V34A 3MEGA 1RYSA 1VISA 3G8SA 1SI9A 1HNVA 5L8RC 3BDEA 1C4AA 1VLYA 2UV8A 3PZPA 2R42A 5L39A 2R9LA 3MAHA 2LEBA 1TFWA 4TYAA 4I2PA 4LF6J 1WNEA 2LU2A 1U0SA 2W9AA 2NYHA 2ROPA 3MPVA 4LFAJ 2E7XA 2JX2A 1J2VA 4OFZA 4USVA 2QEXS 3KUHA 2NZCA 4B3TJ 4ZVUB 1FDNA 2NPFA 2DGUA 1UA1A 2GA7A 4O23A 1S1XA 1KFSA 1HI8A 1ZA1B 4YN3B 1TZ0A 3MDFA 3AB2B 2YKNA 3CC7S 1FVSA 3OTDA 3M6WA 2DPJA 4I2QB 2GVZA 1RGVA 2QRRA 3ZTRA 2BQUA 4PRFA 1YITS 1H2UX 4PYAA 5KFUA 3BPSP 4YR2A 1FJGF 3HVTB 2K7JA 3NBPA 4HHHA 3BR9A 4EGLA 1CULB 1FRLA 3Q8QB 2V8HA 4JI7J 2DHXA 2ZFHA 3PVXA 2KI2A 1PYTA 5KFNA 1ZM3A 3A3NB 2CNKB 1VQKS 3HD2A 4WU3A 4ES1A 2C3YA 3CMAS 3DRRB 2MQOA 1BE4A 3DXSX 5D6GA 4CLTA 4I0WA 2MHNA 1AW0A 4UQGA 3N4WA 1U8WA 4QWCA 1GEHA 1C1CA 4WK3A 5JUMA 3D5MA 4KB7A 4M5NA 4C7QA 5IV3A 4RNNA 5DG9A 1CQMA 1S0VA 1IUJA 5AJ3F 4ICLB 4P73A 4ID8A 3JAMU 4H4KC 3Q2TC 3IBWA 1KLMA 2F4VF 3T5LA 2YNHB 1M0SA 1UL3A 1RDRA 5I3UA 4DV3J 3CC4S 1HBNB 1PJ7A 3IBFB 4DWIA 2F8HA 2Z2YB 1F2GA 2RHSB 4DPXA 5DLGA 3A12A 4R0EA 2VBYA 2H5JB 3CCUS 4MIAA 1JX4A 1LWFA 1W2BR 3OL6A 4O4GA 4TNOA 1XWLA 1QVFR 1Q95G 2JOQA 2CZVC 2FZGB 1VI7A 2AT1B 3OTOJ 5B08A 1N33F 1UFLA 3KLEA 4Q5VA 1PCAA 1L3UA 2JLEA 1XNRJ 4YMEA 4OYMA 2ZITA 4DR5F 1FXDA 3NWRA 2AX0A 4WTYA 2VPWB 1X4GA 1H7XA 4B9VA 4X65J 3UD5A 3SZ2A 2MKKA 4V19J 4AXIA 1IBMJ 2RQ4A 2R3VA 2BQ3A 3PFOA 1NU4A 3SQGB 2IJFA 1V5IB 2E9RX 1EAYC 2V9WA 3IS9A 2I6WA 5KG0A 2YKNB 1UTAA 1FRMA 3JQJA 2UXCJ 4RBTA 4B9UA 2DNYA 2YH1A 2ZEJA 1JLAB 1L3KA 3VGSA 4U67Q 3N28A 2CQHA 4A48A 4MFBB 2SXLA 2W7OA 2B9EA 3CJ4A 5I3PA 1KKHA 2R2RA 4Q44A 1IWGA 4G65A 2DGWA 2VD3A 1SH3A 3K5MA 3DRYA 2CQ3A 2F1FA 1T3NA 1RACB 2BABA 4FPRA 3HVAA 3QT6A 2XY5A 4OX6A 3PW2A 4F0HA 4IUFA 2M8HA 1RAEB 2BUNA 4PG4A 1O8BA 4PABA 2G9OA 5HBMA 3CCZA 2ZH9A 1LK7A 4K0KJ 4S0MA 4KO0A 1RP5A 1WORA 3GILA 1TL7B 2M7SA 2VQFJ 2C2KB 1RHUB 2R7VA 3PW4A 5F8GA 1SV5B 3DLHA 3QNWB 1NHKL 3BR8A 3G6ES 1N54B 2ACYA 2L08A 4HT7A 2FIUA 1AA1B 1DTQB 3LAMA 4LF6F 3KG0A 3B78A 1SVDA 4FPIA 2G0CA 3DMJB 4QYZJ 3HFZB 3H98A 3MPDA 1UEVA 2V8GA 5T7LB 2XGQA 4IR9A 3Q8VA 4R8UA 2XMKA 2R7RA 3AA9A 1ZS6A 4RW6B 2V8DA 2Z4PA 1Q79A 2JL9A 4I1TA 3W2WB 2G2OA 1KRPA 2DR9A 1LWFB 4GO7X 4O4GB 2I9SA 5DGAA 1Y10A 2QX0A 3B4DA 4DHVA 1QE1A 2YWGA 5C7PA 4AE5A 5J2NA 2H9ZA 2OUGA 3GIMA 1YJNS 1GTHA 2BKPA 4JI7F 3J81Y 3M32A 4W98A 4N76A 3TUPA 4I56A 4FDFA 4KC5A 1S79A 1S99A 2RMLA 5A6PA 2BACA 5LL6d 4F2RA 3S01A 1WC3A 5H9EK 4OZ0A 3SFGA 3QGHA 3VQSA 4FZVA 1TKTB 1HI1A 2DNQA 3ISND 4ZHRA 3MAAB 2XGPA 1U6BA 2HFSA 2DR8A 4U96A 1JLEA 4NCGA 2D74B 4KH0B 4GMKA 3JQMA 3AD9C 1HNWJ 4F04B 1BWEA 2Y0SD 3Q22A 4B3RJ 4G1PA 1VOMA 3CW2C 1CJVB 3M6VA 1HWJA 5KFDA 3VTIA 2OJ3A 3NGSA 2A2CA 1NEEA 2DNRA 2C3PA 3AH6A 2XO7A 4OI2A 4HHUA 1LWCA 4DV1J 2MDAA 5ETTA 3OUYA 1UJ5A 1CSJA 2PIIA 2UUAJ 2QLBB 3M8PA 2Z8QA 3PRVA 5GAGI 1H38A 1WHYA 4LF2A 1YRXA 3MM8B 2RU3A 2VJUA 1XMOJ 3TJ9A 3GYXB 4J9RA 4IOAQ 1H73A 2B4VA 3GPAA 4RNMA 3IA0A 3OTOF 3BSNA 3PYEA 2DO0A 3TAQA 3P49B 1KOHA 1XNRF 3CC2S 2GC8A 1WC0A 5KFBA 3NKYA 3T6BA 4DX5A 2JFKA 4FNHA 2D1CA 3M6UA 1D9DA 3SSQA 4USKA 4ANEA 1KVJA 1QAYA 1YK9A 2H4WB 4X65F 1Q82T 4BWJA 2V67A 1IBMF 1REVB 3H5YA 1WKLA 1FE0A 1CJKB 1ELOA 4ZPBA 3WZ0A 1NUEA 4DX6A 3M2RA 2KDOA 1N4LA 3TUIC 3CD5A 1SKWA 5C25A 2MYFA 3J7A1 3FGVA 5ETOA 4U7UD 1ICEB 3BQ2A 2JNJA 3K8WA 1DZ5A 3EGVA 2D69A 5DDQC 2Y8WA 1W26A 2HQIA 1YLXA 2VODA 3W9IA 1XR5A 2R2UA 1PAUB 3QO9B 2BRKA 4CH0S 1NK4A 1EKSA 2W2OP 2HGNA 2YNIB 3M32B 6FDRA 4QPXA 4DR7J 3PIOQ 2NXJA 5AXNA 1LNQA 2MSSA 2CVEA 3LALA 3CJKA 1NK8A 3KJQB 4K0KF 3ULHA 1Y0HA 3TJ8A 1T03A 4B9TA 2COLA 2YQ0A 2VOOA 3WHIA 2KFYA 1DURA 4LIRA 2VQFF 3CJ8A 1BMQB 5F0WA 3KHGA 2QFJA 1RA6A 4N47A 1DFDA 4ZHRB 2MMYA 1RAIB 3PV8A 5HATA 1S0MA 3CCES 4NA3A 4WIQA 3MURP 5F9LA 1ZTTA 1XQIA 4UUXA 3UD3P 1SXLA 3KJVB 1B3TA 4CP5A 1X4BA 4F3OA 1XBWA 3FVYA 3CDWA 3A4TA 1GH8A 2CQ0A 1QAXA 3JXOA 2DPIA 3PTWA 2B7CB 4DR4J 1YHQS 4P72A 1K44A 3RAQA 5LSOA 4YR0A 3RW6A 4OI3A 1DQ9A 4X4VA 3FSIA 3G86A 4V19X 4USMA 3OFHA 2MY7A 3EVOA 4PG5A 4NYOA 2Y1JA 3QAEA 1KEKA 3D1QA 2FQQB 2J9CA 3PEHA 4DQIA 2W2QP 3MECB 1DY3A 5CD4H 2FUG9 5J2QA 4ZJOA 1CEZA 3X1LB 2RRBA 5DG8A 3BO2A 2H5EA 2WVDA 3ZTPA 4C9DA 3G96A 3QLHB 4P10A 3S6EA 3C14A 4M94A 3VGTA 5GAEI 2RH3A 2PA3A 1WOPA 3CJ0A 4G1IA 2CPEA 3RBDA 2RSQA 3M9OB 3DC2A 1SUQB 2WW8A 5D4OA 4F0MA 4DQQA 4W90B 2V8PA 3P45B 1ITPA 2BJDA 2DRAA 5E0OA 4DU7A 4ZPWR 3EJMA 4YQWA 2FLLA 2WK4A 3N01A 3EDRB 5ETKA 3GMGA 2ZHBA 3UDLA 5GAHI 3PACA 3W8PA 3TZZA 3K8VA 4GVBA 5A2QY 3NMRA 3TI0A 2NPIA 1SH0A 3CCJS 1Y5IB 1LFPA 1S1UB 1HNWF 3KDOA 3IBCB 4DV7J 2H5IB 1OYEA 4N8NA 1IKXB 4B3RF 2H48B 2AEJA 3PYGA 2N4DA 2MKHA 1NK6A 4L3NA 2G1HA 2VG6B 1I6JA 1T3OA 2N4CA 2KHDA 3UW1A 3FNNA 2W8LA 1WC4A 2F4FA 5SZTA 3WX8A 5HL7Q 4DV2J 1O5JA 2OPRA 8ATCB 4DV1F 2L9NA 4FP9A 3DRSB 2VUGA 3H90A 5IXUA 3E2EA 2BOAA 2UUAF 1JQGA 4P52A 1UW9A 3JQKA 4PWDA 1JLCB 1OQ6A 1X4AA 3CJTA 3GU0A 5E3AA 5GMDA 1XMOF 2RS2A 2NXCA 1KHVA 1YJWS 4ECSA 2F7VA 3GV7B 4DR6J 3M8ZA 2Q3PA 2C2MB 2AMCB 2HSEB 4EBEA 5HMYA 2FHJD 1D1UA 2GGPA 4O0IA 1F60B 1MG7A 1XEZA 2ASLA 2FY8A 5K5MA 3D7SB 4QR0A 4ZPTR 2HG4A 5KFQA 3LAKA 1SL0A 3LOUA 1IN0A 3GJQB 2Q79A 3TEHB 3HULA 3ZZYA 1KLNA 2OEMA 2DH9A 3VVUA 4CO4A 2B8PA 3TAMA 4A8XA 2GHWA 2ALYB 2EVZA 2HFNA 2HWIA 2IVFB 3QIPA 3NNCA 2M4MA 3RB3A 4I6WA 2B4UA 2HHVA 5HVHA 2XO6A 2R8GA 3ZZZA 1TK5A 4NLWA 1X9MA 3R2DJ 2B7BB 2HFUA 2XCAA 3J80Y 1MMDA 3R3TA 3DLGA 4Z7CA 1HHTP 5H9FK 4WFZA 4K4XA 3LP2B 2IMWP 3SIPB 1QTMA 2MTLA 3VALA 5J2QB 3KLIA 1TVRA 2G13A 4JB8B 1LV5A 1VQ8S 1ULRA 1VC0A 2XY7A 1FJEB 3C14B 4USTA 1B4SA 1HQUB 3HHNB 4A8OA 2VFSA 2YKQA 1JWWA 1VK3A 4KHPJ 3T1YF 1GXUA 5B0DA 2EPIA 2R2TA 1RBOB 1J5OA 2PO4A 3MR7A 4DR7F 2QE5A 2RQMA 1FE4A 4ID5A 1SC4B 4YP3A 4RJVA 4OX9F 2A10A 3QBCA 4PZVA 2M2BA 4UQTA 3TP2A 1I3OB 1Q78A 2UUTA 3JYTA 3G2XA 3N0VA 1PBAA 5G0RA 2EFPA 2IA0A 5E3RA 3H25A 1V6HA 2BVZA 2ROEA 1VBYA 1S77D 3OHAA 3PYFA 4OI0A 4C8YA 4MJKA 4IG0A 1BLUA 4AD6A 2PI4A 5IT9Y 3R2CJ 3C6UA 4Q0BA 4C8LA 4A47A 2OH2A 2KB2A 2LDYA 3KMSA 1HL6A 3IAS9 1IR0A 3FSYA 2O01C 4DR4F 3KLVA 4C3LA 2O3DA 5LMUJ 5HO4A 2HNDA 2NXNA 2BM0A 2DIVA 5CA5A 3LPEA 4P2MA 1C0UA 1YBTA 4F4AA 5BXIA 2AJ4A 3I96A 4OZJA 3UD4P 3JSMA 5H1SV 3QT5A 4XDDA 4NLQA 1F3FA 1V3RA 3W9HA 1OMSA 4DR3J 3HT0A 4ZPVR 5F41A 1LK5A 1M1KT 2BBEA 1R7IA 4RWWA 2HBYB 1FI4A 3FBBA 2GGPB 3W1YC 2DEIA 2LXUA 4ZK7M 3Q8PB 1YJ7A 1RTZA 4TN2A 4O3OA 4ETXA 2DR5A 2UXBJ 2N7CA 4UUWA 1GX5A 1JLGA 2MZSA 1SPBP 1S1WB 4OV6A 1RTIA 1TL5A 3GYNA 1R6YA 1F9HA 5EGYA 4USJC 1R8BA 3UVJA 2VFTA 3KLGA 4LBHA 4DLEA 2YVSA 4EUVA 2XMVA 1WKJA 2K1RB 1P9QC 5ETNA 2AJ0A 1R89A 2IC3A 1LWXA 1UEUA 1HBOA 3PHTA 1WI8A 3Q8RB 1RABB 2HK3A 2IBOA 1RT6A 2ZE2B 3W5ZA 4ER8A 2CZ9A 2RU9A 2YX1A 1CJTB 1GAOA 4RW4B 4DV7F 4KPCA 1RT5B 2GV1A 4ITSA 4OZ3A 4PYDA 2MJNA 3OT9A 4A8FA 3S1TA 1UFWA 3V6KA 4F2SA 5KT5A 4BHQA 2B4OA 4RUAA 4J9VA 2YWKA 1IKYA 4DUYJ 4LF9J 3NMAA 3D68A 4AL5A 2DT9A 4DV2F 1J5OB 1FKOA 1SQFA 1KQFB 5K14A 3TX8A 1AXQA 5J2MA 1SL1A 2J6UA 4NXNJ 2IAJB 2IFXA 5EWGA 3QQCD 1JLFA 1R27B 5LMNJ 2PI5A 4DR6F 5C2GA 2GAHC 3GFHA 5G0RB 4WP8A 2LXFA 2XYGB 2IIHA 5M2PA 4E2FB 1UWBA 5EX0A 2E5GA 1CQNA 2EBEA 1VBKA 2KZZA 4XPCA 4TYBA 2I5JA 1N5QA 1JJ4A 2ZJRQ 1JJ2R 1FTRA 3UDEA 3C46A 4J9UE 4QIFA 2R7XA 2XNRA 2OO4A 1RU2A 2J0SD 1TELA 3JSYA 2HHWA 2XZTB 4KV8A 5J1EB 4ZCIA 3B54A 3DOLA 1WF0A 1FXRA 3MM5B 2LU1A 1URNA 5AE2A 5THWA 4X4PA 3M1VB 5HK4A 4IFVA 1PYSB 3JSMB 2EBGA 2YH0A 2QLFB 4WYWA 4CYUB 3A1YG 5K8PA 2U2FA 5L9XA 4WFXA 1P27B 3HT3A 1T9VA 4C0OC 3I4HX 1FF2A 3ENVA 2MZRA 3RAXA 2GQ2A 1RTJA 5E3QA 4CO2A 3I87A 4ES3A 4CNZA 1QTNB 4KHPF 2VFRA 3QFHA 4FKXA 4F4WA 4JI4J 2L3MA 4NLGA 1YQHA 5HROA 4I4BA 1U02A 3KLGB 3AXKA 4JI2J 2BJ8A 2GCFA 4JI8J 2KFNA 2OTJS 3MPYA 2JWNA 4HLBA 4DL6A 1OIAA 3UQSA 1K0TA 3T5HA 4B02A 4HDGA 3AA8A 2OI2A 2IC3B 3K7RA 1HBOB 1N5YB 3BGFA 4UOCA 4DI6A 4F67A 4JV2A 5J1NA 4KGVB 4OI1A 3UDVA 4TY8B 3EM1A 4IO1A 1AROP 4IDKA 4QR1A 4UT4A 1MN9A 4E0DA 2KRBA 4UY85 1TMMA 3IWNC 3G4SS 2J7UA 4K7QA 4J9QA 1S7HA 3CDEA 1IKYB 1OPIA 5LMUF 1FFGB 3I5AA 1HWKA 1Q16B 4ECQA 1TFYA 3R1HA 5KT6A 3MCSA 2XQCA 1RE1B 1G6BA 4P75A 1QSLA 4DR3F 4QCLA 4Y65A 9RUBA 4IQMA 3ZTSA 2QTWA 5CYMB 2MPUA 1UWBB 2FLNA 2L41A 5HMZA 3H0PA 3KLFB 1HHSA 4ILLA 3EXYA 4ECXA 1WWHA 2FZCB 1WEXA 2LP4A 4OJ3A 2UXBF 5DDOC 3MMCA 4IFYA 4CWBA 1ZETA 2AKWB 4KV8B 1IM6A 3KK2B 4K59A 1SKUB 3NEKA 3TA0A 4YHHJ 5J2PA 3DOLB 3KKFA 1EP4A 4KE5A 1HLWA 3BREA 1RWNB 4CO3A 4DF8A 2Z2MA 1JXVA 5EX3A 4EO8A 1K73T 1S12A 3PO4A 1C0TA 4JUZA 1JXLA 4DS5A 5BYRA 3OL7A 4JV1A 5MLCV 3M4XA 3DLJA 3PX4A 4B3OB 3JAMY 2HURA 3MM6A 2CPDA 1X7VA 1F3VA 2VL1A 5HLFA 3OXGA 4CO1A 1TUVA 3QFWA 4I68A 4A46A 3DN9A 4LF9F 5CABA 1VGYA 4JI5F 1UPMB 1AZSB 6AT1B 4EZ6A 2W7PA 4LFCJ 3CCTA 4CTAA 3GTYX 5HROB 1XERA 3MD3A 3D0IE 4C2MA 1MROA 3ADAC 4Y2KA 5LMNF 3KK3A 3MHYA 2AW0A 2AD9A 1H2VZ 1UWAA 3FQLA 1IJFB 4EI2A 3DLEB 3TUJC 5CAAA 3BBCA 4HTJA 3H5SA 1RAAB 5KT4A 4X4QA 3ILOA 4HACB 5IFMA 3T6JA 1V3ZA 1TR0A 5ITHA 4OZNA 4LMZA 3ZNUA 3RB6A 4MKVA 2F5GA 4ZS6A 2CJQA 1VC6A 3KJNB 4WP3A 2BMBA 3MCNA 3UNYA 3HVRA 4OZLA 2DKOB 2BE2B 1TL3A 3DDKA 4N7TA 2GJFA 4AQYJ 1N5TA 2XMMA 4CNYA 3CO9A 3EWGA 2CQ1A 4I69A 3RUBL 3PX6A 2ERRA 3FFIA 4ED7A 2H54B 5D0HA 4CT9A 2HLUA 3A8IA 2B6AB 4PXBA 2AYGA 1AFJA 4JI3J 3MMBB 4P74A 2JFDA 4JI1J 4IRDA 2JC1A 3M8QB 4RX6A 1U26A 1WSRA 2OPQA 3MR3A 1O51A 3GG1A 5BYSA 3DXBA 1RBAA 3FUYA 3LA0A 3CB4A 4LSNA 1RHJB 4V1Ak 2NREA 2MZJA 4PQUB 2WSFC 1TL1B 3PR4A 2KG0A 4L74A 1M5VC 3I32A 4JI4F 2RDJA 3I0RA 3GV5B 3UN5A 3GJTB 2NQPA 3SCJE 2RUSA 4WCEQ 2ZC3A 3EGNA 4JI2F 4BC9A 4JI8F 3M9MB 1S6QA 2BKNA 1RTDB 2Y1LB 4E98A 4Z7YA 1B70B 9ATCB 2AJ2A 1RHRB 4QR2A 1OYDA 2N3LA 4QWEA 5FJ4A 5JXSA 3QGPA 1WD6A 3MM6B 4DFPA 3BGRA 1Z2ZA 4C97A 4DPWA 3GCWP 4NLOA 1RA7A 2C2OB 4CDIA 4QOTA 2MGZA 5KFSA 2FDNA 4O3RA 1XTZA 1NSPA 1N6QA 1IBCB 1NMEB 1HW9A 3HHLA 3HLUA 1VQ5S 5KFJA 4EWTA 1M90T 3GQCA 3G9CA 2R2SA 2QMWA 1TKZB 3R7BB 1FRKA 1D9FA 3N79A 1U1KA 1MROB 3IG1A 5CHCB 1T8EA 2IM0A 3NL0A 3U02A 3KK3B 4TVAB 3UI3A 1YI2S 3PM9A 1IKVB 1X4HA 3FKBA 1GK8A 2FVCA 2A6MA 2QGFB 2EC0A 5MAOA 3LANA 2P8IA 3M2UB 4OJGA 4OI4A 4XTTA 1KVIA 2QMUB 3JS9A 4RUCA 2HLTA 2OPSA 4UZCA 4O4RA 4P71A 2XLJA 5KFCA 3FCVA 3DGPA 4RUHA 3TR5A 2XHWA 5K8NA 4YHHF 1NB7A 4XO0A 1BQNB 2YKPA 2GZOA 3MEEA 2HHPA 4DUTA 2M3DA 4DPOA 5A8RB 3VAIA 2WVFA 3FFIB 3NAHA 2PT0A 3BPDA 4DPTA 1R0AA 2CA9A 4OYXA 3D67A 1PKUA 1YJRA 5D4LA 1RTHA 4PPZA 3OVAA 3C16A 1H7WA 1FJ7A 1ZH5A 1CPZA 2RIJA 1FDBA 4K4VA 2GW8A 4W4MA 5IM0A 2E66A 1BQMA 3UCZP 1FKPA 2ZWOA 4GKKJ 1O0PA 1S0NA 1SJ3P 2V94A 1N48A 2C2RA 1QY7A 1UVLA 2WSCC 1HBUA 3O44A 5IOLA 2IHR1 5EUHA 3GJRB 1KTVA 4LFCF 1S7IA 3MMAA 4DU8A 4LQ3A 5CCMA 3QGIA 3HDSA 5C42A 1S6QB 4OHYA 2M88A 4USWA 5A8WA 3LPYA 5KG6A 3SBMA 3TJAA 3IMQJ 1FKAF 4AT1B 2L9DA 4HYKA 2K8GA 4YEAA 1WG4A 1E6VA 4B3MJ 3G87A 3CJ5A 2E5HA 3V81A 2QLJB 4CLFA 2K2PA 2JEJA 2XSJA 2HAFA 4J7CA 1LW2A 2EWHA 3BGRB 3D9BA 1T05B 1OY8A 3UO0A 2YXLA 2CQDA 2AGOA 2MGZB 1U25A 4IG3B 1GX6A 5IT0A 1VRTB 4AQYF 1APSA 2BANB 4PQAA 2AWZA 3RBEA 1MWYA 1VRQC 4Y6IA 1HPZA 3WX4A 1CS4A 4A4JA 1Q4RA 1DJ0A 3PKYA 2W9CA 4YFUA 1FK9A 4N8OA 4C8MA 5B0CA 3PW0A 4ZJQA 4W92B 3GP9A 3F44A 5JVHQ 2RVJA 3R1LA 4JI3F 3G71S 3NAIA 5HVGA 4JI1F 3Q83A 1EB0A 2VG7B 1U2RA 3J7AN 1XK8A 3UR0A 1FWPA 3ISZA 5E33A 3MR6A 1OSCA 3MEDB 1VQLS 1TP7A 5LSLA 1SJRA 4U95A 3KHRA 3T5KA 3CF5Q 2OPSB 4CLSA 5K8MA 2RF2A 4FKYA 2FVSA 2HKEA 2B56A 3HZEA 1UETA 3DGPB 4CT8A 1TKXB 1S1VA 3PXGa 1KWMA 3DM2A 2AEMA 3GONA 1NJWA 1T02A 3CTRA 4ZLLA 4OZ1A 2ABYA 1QDUB 2DBBA 1YIJS 3OTCA 4CI0B 4FXDA 1S6PB 4LRFA 1GFWB 1K9MT 2CNLB 2XWXA 4M95A 1SJFA 1RAHB 4Y34A 1CVJA 3VAFA 1WEYA 3AOAA 4PR6A 4FF1A 1UMJA 1HYSB 1WHWA 2WB4A 2QJ3A 1KVKA 5C24A 1SIZA 3CO0P 5IM0B 1GNKA 3E51A 2CJKA 4MKYA 4K4TA 3R5BA 4JV5J 3ZXWA 4GC7A 5DG7A 1X8DA 2E7VA 5F8LA 1VQNS 3U1LA 4N77A 3L4BC 2MZTA 4UOGA 1U09A 3C19A 4URGA 2FPHX 1T9YA 5E41A 3BKFA 3UN3A 2BR0A 1I94F 2CPYA 1T9TA 4IOCQ 4RU9A 5FIIA 3CXCR 3KUEA 2KYXA 5C42B 3IFEA 2ROGA 2OEJA 2DGXA 4QIVA 4RW8A 5D0GA 2X1FA 2VFVA 1SQGA 4H4OA 1NRKA 3LWLA 5J1PA 4MK7A 2JVRA 4M1KA 5F8JA 1VQ7S 2IPOB 1SL2A 1SQEA 3V81B 3PRBA 1HBMA 4F50A 3FQKA 1KHWA 3OV7A 5DRKA 5L1KA 1LW2B 2IRUA 4LBIA 1PBUA 4NZ0A 2HMIA 1X5PA 5E3CA 3DCAA 3W62A 2KT5A 1EIYB 4PXEA 4M63A 2HVHA 1HPZB 4K4ZA 1CS4B 1Y3JA 4K5RA 1KS2A 5A6WA 2ASJA 2O5DA 2KH9A 3A3PB 1BUXA 3NGDA 1N0VC 1RT2A 4OLOA 4A8WA 4PUOA 3H7HB 2KXHA 5T14A 5L38A 3NOGA 3OR2B 4RPFA 8AT1B 1IKWB 4GKKF 4NEYA 4R25A 4USUA 3KK1A 3PHEA 5GMEA 3PYDA 1R8PA 4ZVRB 3SYZA 1U49A 4NYZA 1M5OC 1U7LA 1RKIA 2AJ1A 1OO0B 4DL0C 2FGOA 4FBTA 2RF2B 4KKOA 4UZBA 1S1VB 3CCVS 4WPAA 3QZ7A 5F8MA 1WF2A 5A8KB 5D0RA 4IRCA 2HBZB 5IWAJ 2XB2D 2UUCJ 4DSEA 1F2HA 3ILIA 3BGUA 4URQU 4ZP6A 1JNZB 3UR3C 4N5SA 5CYQA 5KFAA 5C24B 4DV6J 5KFRA 3M2VA 4B3MF 1HMVA 1XNQJ 4AUKA 2V0NA 4QZVB 5I3QA 2RDIA 5B7WA 2QA4G 1VRUB 4DSIA 2WZ1A 2ALZA 4KSEB 5H9FJ 4TU8A 4C8NA 2H4YB 4F36A 3AD8C 3RB0A 2I8EA 4NMXA 3FBEA 4X4RA 2HPUA 3KOAA 1UFKA 4NASA 3CNQP 4ZLNA 3MUVP 3NCRA 1NPKA 1KQGB 4DEZA 1X0PA 1U24A 1NHUA 1XMBA 5KFYA 4DG1A 2BW7A 1F5BA 2YTCA 2YKMA 3W3SA 4A8SA 2Y3YA 4J5OA 1VQ4S 3HFKA 1PAEX 3DOMB 4C3MA 2Q66A 4GRSA 4R5PA 2CAJA 1X60A 3HFVA 1S72S 3DNCA 1NHVA 3QYYA 1FO1A 4EU0A 2MQLA 3RTVA 2E1AA 1T0TV 4TXSA 2DNZA 1PJ6A 5CCLA 4KIAA 2CADA 1HR0J 3JTOA 2KTQA 1TK0A 4FXVA 3MCMA 4HH1A 4O3QA 2WOMA 1QAJA 5GADU 1T9WA 4TU9A 4NLTA 1B0VA 1UVIA 3GR1A 5LXRA 4I6YA 1U1LA 1GMWD 3A8KA 3HSZA 5B0AA 3CCWA 5DDRC 2DRDA 2I2YA 4JV5F 3R5DA 2B5JA 4MIWA 3QT8A 2WHOA 4CQ1A 2FD2A 3HK2A 2GAGC 2RKIA 1UAWA 3W61A 1FTCA 1M5KC 1KQSR 2N82B 1NH8A 2F65A 3UNGC 2LXIA 4NLUA 5M2RA 1BC6A 4H4MA 2HNYB 5HMXA 2W9BA 2Q6CA 2XCPA 1T7PA 1CLFA 1CC8A 3PKMA 2B8QA 4ED5A 4QWAA 1NKBA 1B0TA 3K2YA 3DLKA 4LF4J 2HRUA 4RW7A 2HHQA 1R0BG 4FYWB 3HJFA 1K1QA 3AODA 1HQEB 4HI2A 4E8UA 2VH7A 1S9EA 4M5DA 3M2VB 2G0IA 2AF6A 5IV4A 4NI2A 2RT3A 3N6NA 3BJYA 4J9KA 1VIXA 2V4JA 4PWWA 1T9XA 4YB6A 1RT4B 4WWSA 1LW0A 4QYZK 1FWLA 5HP1A 4PEOA 4JOUA 3W7BA 3MUMP 2DGTA 2NUUG 1YX2A 1ZM4A 3D6MB 3DRPA 3GFYA 3T19A 5AXMA 4CLKA 4A8MP 4WYLA 4DG1B 5K20B 3GE9A 3QRQA 3EYZA 2X3DA 2ZJPQ 4YDDB 2XZWA 1SCJB 3J7ZT 5D8HB 5D4PA 2FYXA 1QUVA 2XI3A 4R5PB 1WOSA 4IO9Q 4OJHA 2JLFA 4ZPAA 2G1DA 2VKRA 2MQNA 3H8YA 3QJJA 1WTFA 1D9AA 1G7CB 4RNHA 4QWDA 2EKYA 2P6TA 2VICA 5BJRA 4HL9A 5B0GA 3V4IA 4ECUA 4OIXA 5DQIA 2W1BA 4DPUA 3RR7A 2C3MA 3IRXA 1X9WA 4UW2A 3GG0A 2MEWA 3MM7A 4Q2MA 1KD1T 2XG8A 5IWAF 1PILA 5KFFA 2UUCF 4NLDA 1ZAVA 3THPA 1EZZB 2ZOGA 2ZOMA 3MTKA 4LUBA 4YY3J 3DOKA 3TZXA 2XC9A 4DV6F 1XNQF 4MK8A 2DK2A 5BR8J 4X4SA 2AP6A 5JMNA 2G0JA 3RW7A 1FVQA 4RO0A 1EHWA 2YBVA 2QSWA 1NKEA 1OWXA 3EMTA 1OQ3A 1WG5A 4AL7A 2DR7A 1RBLA 1WUUA 3I9V9 2UP1A 4DLGA 3FMWA 1KDNA 4O44A 4M5MA 1UP1A 2IM2A 3B82A 2NR0A 1S1TB 4CIOA 2QG9B 4H4MB 1VQSA 5LM7E 5IZHA 2W9BB 2CG4A 2Y1RI 5KFIA 1BGXT 1RXOB 1FEHA 4C48A 3I82A 2OPPB 3DLKB 3TUZC 3EZOA 1NK0A 3VAHA 4MAKA 3UE2A 1RWWB 4M5DB 3I0SA 1LEOA 1S49A 2FJWA 4NI2B 3MEGB 5LJ3Y 1NJXA 1URRA 2V4JB 1HNVB 2FHMA 1FFWB 3CEDA 4X62J 2LQ9A 3BB5A 1LW0B 4I2PB 4WZMA 2FHOB 5HP1B 1Q7LB 2EFQA 1HR0F 3I56S 2CWXA 1EJ7L 3CVKA 4P7TA 4I7FA 1HNXJ 3QWPA 4ZCKA 5HI7A 4AL6A 3BH7B 1NH7A 2H1YA 4DSKA 1S48A 4C3KA 2AV5A 4RW9A 1S1XB 3HXMA 3ELHA 4ZPCA 2QV6A 5HQMA 3W5XA 2V4RA 5DM6Q 5D3GA 1M5PC 1Q8KA 2GVZB 4ZVGA 2YKAA 1YKWA 3KFWX 2J8AA 2X7IA 2DEJA 3QZ8A 3WC2A 4ZVPB 4I6AA 4OZ5A 3NBPB 1IBLJ 4FYDA 3W65A 4G1QA 2MZ1A 4ZVHA 1YTYA 2AYBA 1Q86T 3VCDA 3E01A 2QL5B 4ED2A 3CDBA 3MM7B 3TW0A 5AE3A 1PJ5A 4DBQA 4C0BA 4H54A 3R8YA 1SC1B 1SJ4P 4LF4F 5ETSA 4DL2A 2QL9B 5HVFA 3HHDA 1C1CB 1PIEA 1VIOA 2OKQA 4OJ1A 5F0UA 2GO9A 4PWUA 1RAOA 4G3IA 4FYXB 1FRIA 2GVDA 1BWVA 2V6AA 4OX8A 3BGLA 2MLZA 2UUBJ 3VGUA 1B99A 4DV4J 1LWEA 3EZ5A 2JEGA 2IMOA 1RWXB 3MD1A 2HNZA 4IH7A 3R9LA 3IR5B 3DLBA 4NWBA 1KLMB 1TUGB 4IQXA 3R7NB 4LFAF 4I67A 1I51B 1P1LA 2ZDPA 1RT1A 4QWBA 2CQCA 5I3UB 4B3TF 2F8EX 3A3OB 1NJIT 2MXYA 4ECVA 3V6DA 2OGUA 1F5CA 1D8ZA 4IRKA 2HW3A 5KAKA 2FVRA 4QU6A 2D3OR 3NP5A 1C1BA 4F3MA 1VC5A 1SKRA 1TV6A 3OSPA 3MMJA 3K5OA 1DTTA 3KLEB 2AEFA 4O0NA 3L3CA 1R31A 3CCLS 1BD6A 4UOFA 1FERA 1NDLA 2LQJA 4ECWA 1W25A 1JNRB 1RT3A 2PDAA 4WXOA 2FJXA 4YDXA 2XYHB 4Q7AA 3BGOP 3Q24A 2CZ4A 3H5UA 3H2UB 1JLBA 2HHUA 2BJ9A 3LO3A 1DLOA 1VHFA 3C6TA 5BR8F 3IS9B 1X5OA 4YUDA 4KGKA 4XPEA 1FXLA 2POKA 2BJ7A 2YNGA 1XC9A 2GMHA 3ILLA 3PCOB 3MEKA 3IGNA 3KYLA 4L73A 2QL7B 4F4XA 1S9GA 2VHGA 2H3EB 2FVPA 4DV3F 3E01B 4CRJA 2IM1A 3ET6A 4DSJA 1HA1A 3G82A 3NGUA 3OHBA 2MKYA 1DQ8A 2RDDA 2Z58B 2HS0A 5HBMB 1BHNA 2V2KA 1BXNA 1VR6A 2VONA 3PX0A 1Q1KA 4KO0B 4WKYA 1WJ9A 2VV5A 4M5JA 2NYIA 4ZDNA 1NK7A 4X4NA 4WFYA 4OLPA 3T9ZA 2V50A 4PXCA 2PEHA 1ZTWA 2Z30B 3B4MA 3EXCX 2BJ1A 4A8KA 1EX8A 2DNHA 3ONQA 2WVCA 2C42A 4KFBA 3CGIA 3FC9A 1KTQA 2HNZB 4M5HA 4KHRA 3TZWA 3M30A 5GADI 1U1QA 1U8SA 3MF5A 4ZIWA 2DHAA 1HNXF 1D0EA 5KG3A 3BN4A 1RT1B 4DXLA 1A6LA 4R8UB 1NJYA 3RR8A 2A18A 1F9EB 2UVWA 3IWLA 1WG1A 4C0HA 4OYWA 3U1MA 1C1BB 3EGZA 1S76D 2UUWA 1UVJA 1S5ZA 2UXCF 4LSLA 5EWFA 4WZQA 3DU6A 1QE1B 2ASYA 1ROFA 3NOCA 4JI0J 2C28A 2QT7A 2C2DA 1ZOTA 5J2NB 3NRBA 4Y00A 2DTJA 3U7JA 2MKIA 1IBLF 2R7WA 3Q0AA 1LQ9A 3L09A 3KNGA 4HT5A 1P8GA 3LF0A 3PJXA 1RT3B 3G6XA 3CSKA 4CLLA 4F8RA 1H3DA 3GIJA 4N41A 1ZYQA 5G4DA 2KT3A 5FDLA 1KR4A 1RHQB 1KFDA 1JLBB 4ECYA 4EBDA 2JSXA 4X84A 3C2PA 3D4JA 3C6TB 1F9FA 1FRJA 4PPDA 3UWTA 2MLYA 1JLEB 3D6TB 4NCGB 1E6YA 3D54A 3MM9A 2D7SA 2W2PP 2UUBF 3R5JB 1VS3A 4DV4F 2HVEA 1H98A 1T11A 4NLRA 2MZQA 1G3OA 2XY6A 3PJWA 4HI1A 3KG1A 1FCAA 1KBRA 4WTOB 3ET6B 3RYLA 2MQMA 3FSXA 5JVGQ 4LREA 1FA0A 3W8GA 1LWCB 2BW2A 5CD4A 1Y9OA 2HWTA 3OUYB 3KWMA 1T94A 2CNOB 3M8PB 1FX2A 1S59A 3G8QA 3RG6A 2HBQB 3DDNA 3GJSB 5HQLA 2XS7A 3HM9A 3KMQA 3HO1A 4F3QA 4KYZA 4J9LA 1L3TA 2EFOA 2V4QA 3L7OA 3SDEA 3GR0A 3I9ZA 3I5BA 3CD0A 3IO1A 2KVIA 4KAIA 3W66A 1G4CA 2PD1A 4NA2A 3HSGA 3GIRA 4NRUA 1MLAA 5EWEA 3PJ9A 1FNXH 4MMOA 2PEBA 1TU0B 4TQSA 2B3TB 2EC2A 2HHSA 2HQFA 1IWAA 2CFXA 1W7WA 2R7SA 1X5TA 5GMKa 2P6SA 1KC8T 3M2RB 1N8RT 4PG6A 3RBZA 4XIUA 3DI6A 5C25B 4LSZB 2D41A 1LKZA 4DSFA 1NAQA 2VDHA 4X4UA 2ADBA 1NSAA 5CYJA 3D66A 4I2QA 3QT7A 1VJQA 4DL3A 2JVOA 2VASA 2C1EB 4C11A 3T41A 3WBZA 4DDFA 3MZIA 1SIWB 2OP5A 2EG2A 4HR2A 4MT1A 5KG5A 4WFBQ 5HSPA 4YB1P 1Q8IA 3NGKA 1CULA 3LUYA 1F0XA 2AU0A 1LFWA 3BM7A 1U1NA 4B9MA 4MYUA 2G2YA 2IJRA 3CJKB 4F4YA 1V9OA 2HFVA 1U47A 1T03B 1UCNA 3T1HJ 2J9DE 3DRRA 4ANDA 3K5PA 5L1LA 2BYCA 2D3ZA 5CQGA 5I42A 3D6HB 4LJMA 3TEGA 3MM9B 1U45A 3UCUP 5ETLA 2DXEA 2DHSA 2C2EA 3D0GE 3SV4A 4ECRA 4ATNA 4ICLA 4ED8A 2ZHAA 2BEFA 1G1XA 1ZAXA 1M1GA 3MR5A 3R97A 4FVCA 4ANCA 4OYBA 2YNHA 2IDLA 4H4KA 2QN6B 4O3NA 1UZHA 3D6FB 2I0XA 1MMNA 2YWHA 5LSRA 3EVMA 3O1LA 1HBNA 1WACA 2M5YA 3OXFA 4CZCA 3MOJB 2R7QA 3G6YA 5KG2A 3R27A 1YDLA 3US5A 2NLWA 2ZH8A 3FZBA 2ZUAA 4JI0F 3CIMA 3ZZTA 5DDPC 2C2NA 3HKWA 4HTIA 5KFTA 3HZGA 2DVIA 3EX7B 3BDPA 2NCKL 4ZP7A 3CULA 4DQRA 1K0VA 3I55S 3GIIA 4AFFA 4KTQA 4LVNP 3A8JA 3H2LA 4HHJA 1NDKA 3PFEA 2R7OA 4DZ6A 2MQPA 3DLLQ 1RWMB 2VF3A 4K8RA 2DXDA 3W5YA 2KJWA 5D77A 1J27A 4DCJB 4U7CA 4QPTA 2XULA 2B43A 4YR3A 3OR1A 1WOOA 2BX6A 2KO1A 3DI6B 3SQGA 4GVBB 3VAJA 2K06A 3FRYA 3M05A 2YWWA 3NNAA 4K4UA 3U1NA 2CPJA 2XBPA 1YJ9S 4FVMA 1JLAA 5KFKA 3JTNA 3LP1A 3FDSA 4C11B 4RL1A 2LYVA 4DOZA 4LR9A 3D0HE 3JSRA 4MFBA 3BBFA 1PSDA 4Z37A 2E5LJ 2E44A 4HH0A 1NPRA 2QSFA 4X2BA 5HJXA 4ED3A 2OPRB 1RQ0A 3LW5C 2OMLA 3OPKA 4L3KA 1JKHA 4B17A 2R7UA 1RI7A 1N5VA 2AJFE 3BN7A 2AGPA 4PWDB 3HVWA 3QRRA 2DCLA 2DGQA 3NWGA 5A76A 1CBKA 4OL8A 2W2MP 3R6GB 5GAEU 3CWJA 3SFUA 2HRYA 1TL7A 3TA2A 2DH8A 5I42B 2G2ZA 3FJ2A 4Y28C 1SV5A 5DM7Q 3IM9A 2BE7D 2J9DA 1TAUA 3PRDA 2OSQA 1NPPA 4D3GA 1DTQA 2DIUA 3I31A 2PN6A 4QYRA 3ZZOA 5GAHU 2NS1B 1K1SA 3QAUA 3DMJA 3TAMB 2CQBA 3VHQA 1VBXA 4P2XA 4DUZJ 2JRSA 5T7LA 3CUNA 3QIPB 1FNOA 3G8TA 1H0HB 3ZZ0A 4RW6A 4OYZA 2VA2A 4HEA9 1S57A 1FX4A 1SC6A 2GHVC 1HD0A 2D9PA 3W2WA 4NCAA 3NNHA 2OTLS 3DLGB 3CJ3A 2F63A 3K17A 5LJ5Y 1ZPVA 3EPIA 5FLXU 4RU2A 4LT6A 3KLIB 3K89A 1TVRB 3TWZA 5IT4A 1RADB 1VK8A 2F9DA 3Q89A 4NE9C 3HP6A 4ZP8A 3QRPA 2NSBA 2VBXA 3HD1A 2BKOA 3QMQA 4ZVOB 2LQBA 1YGYA 1IBKJ 2ILYA 2PSZA 4ID5B 4Y2IA 4EYIB 2C22A 2RRAA 2JLGA 5HMWA 3IN5A 5K8OA 3TVZA 1P1TA 3NY0A 3AXMA 3T1HF 3ENWA 3JYTB 4L72B 2BRLA 2IY5B 4Y3CA 3OR1B 1FDAA 1Q5YA 1TUWA 1VLOA 1TKTA 3NGRA 1SB6A 2OELA 1RCXB 2KHCA 5A0YA 4IG0B 3MAAA 4P2FA 4LBPA 4ELVA 2XLIA 3Q86A 2M0GB 4LR7A 2DNLA 3C6UB 4Q0BB 4KJIA 3MPUB 3LP1B 4EBCA 2DB1A 4F0KA 1CJVA 1YZ6A 3BQ1A 2CDRB 5AE1A 2M9KA 2DNKA 3QATA 3RU0A 2ZM6J 2HNDB 2HQ3A 2EXUA 1C0UB 1JKHB 2XWYA 2J76E 3PG9A 2WCXA 2LMIA 2OFHX 4FF4A 2F9JA 2E9ZA 2DO4A 3BKTA 1YRUA 3MM8A 1CG2A 1R43A 2NSCA 3LTOA 2GX8A 2HQGA 3FEZA 4ED0A 1RB0A 4LF5J 3MI7X 3UFCX 3BS9A 3J81j 4JP8A 4DX7A 3K59A 2LEPA 5L46A 2V2QA 1IJEB 4CLWA 5DGBA 1Y5LB 1DQAA 2HIQA 3MWBA 3DGVA 2YQ3A 3TNVA 1UW4A 4P7VA 1JLGB 3V4MA 2XMWA 3UCGA 1RTIB 3MOZA 2FJEB 2RB7A 2ZBCA 3UVJB 3JSBA 1VQ9S 1NLKL 1NSQA 3LGNA 2GFFA 1QD1A 3F41A 3ZTOA 4OV1A 5CZVA 1REVA 1JLQA 1CJKA 1YBUA 2BA9A 3E8OA 7FDRA 4A8QA 1RAJA 3LP0A 5F3TA 1RT6B 2B0GA 2VBZA 1Q0NA 1Y5NB 4ALZA 6FD1A 1CJUA 2EKNA 4LRAA 4DPYA 2B51A 1MWZA 2IDEA 2HGMA 3NCPA 2DNGA 2HHHJ 1QSSA 2QFIA 4P6QA 3GLJA 1H72C 2CQPA 2E5LF 1RKJA 5F8HA 1J5EJ 2N7YA 3QO9A 4ZP9A 1FKOB 3AT1B 1X5SA 3ZZPA 5K14B 2YNIA 4QIGA 2V69A 4ERDA 5J2MB 4C98A 1QSYA 4ZMMA 4KHMA 3CCRS 1WHVA 2CPZA 3BSAA 3TA1A 4HKQA 1JLFB 1L3SA 1Z2LA 2ZOFA 2R4FA 3AAWB 3E3XA 3TVKA 1BY9A 5KFGA 3VWSA 2BJEA 3CPWR 2F40A 3PNIA 4WFNQ 2J6TA 5A0YB 1QLNA 1G2EA 2I5JB 1RWOB 2HEKA 3HHEA 2RHQB 4KRWA 2XSFA 1NBEB 4DV5J 4J9NA 4NLVA 1VDHA 3KJVA 4X4TA 1XMQJ 2M52A 1RWPB 5D4NA 2DGOA 1PC5A 5EHHA 3HKZD 3RRGA 3O2IA 2IRYA 1PG5B 4DUZF 2HAIA 5F3ZA 3LGHA 1IXKA 4R0JA 1QM9A 3M9NB 4LF8J 1PC4A 1YZ7A 4IFVB 5AT1B 4YOEA 1HD1A 3R5AA 3AD7C 2RJZA 3HF5A 4BBYA 3CDUA 1WKKA 3J7YU 1XR7A 1OY9A 2A2DA 3GFZA 8RUCA 3EZUA 2UVUA 3NG8A 2Y1IA 1KP6A 3MECA 3MR2A 2XNQA 2LECA 5HN0A 1RTJB 3WC0A 4ZKAA 1GXLA 3K58A 5KG4A 2HS3A 4MH8A 3H5XA 3QLHA 4DUYF 1IBKF 1OS5A 1FFSB 1D8YA 2OIHA 1B7YB 2VB6A 5EDWA 3M8WA 2JEFA 2L9WA 2QYCA 4OYOA 2DNPA 3D3CJ 1SUQA 4NXNF 2GNKA 5L9NA 2FVQA 4DFMA 4KGMA 2O67A 4M5GA 2MKCA 1N88A 3OTEA 5KOXA 1UJ4A 1HI0P 1JLQB 5KFOA 2DD8S 2A0FB 2WB1D 2YQ1A 1N0UA 1NO8A 2APOA 1GMVA 5ETQA 4MTPA 3GFXA 2DH7A 4WBFA 5CXTA 2FJDB 3P6YC 3LP0B 4YB7A 4ZVQB 4F4ZA 1RT7A 1FEEA 3VAKA 3P4UB 1CJUB 2HVIA 1S1UA 4IDKB 1PYOB 2BXJA 2MY8A 1IKXA 3C15A 2QO3A 2ADCA 1FD8A 1JB0C 2HS4A 1M5SA 4DV0J 5KFMA 4OQJA 2VG6A 1XN9A 2ZM6F 3SSRA 1JJCB 3POTA 3T1YJ 1F6TA 4NYPA 5HQ8A 3IR7B 4FXWA 4JV0A 1TK8A 3ISNC 5KFEA 4Q2LA 3DRSA 2D3O1 4OX9J 3K5NA 1FDDA 1JLCA 2XM3A 2ZDOA 3ZC4A 2R7TA 2H65B 4ZN1A 5B0FA 2HVDA 1ZBTA 4LF5F 3T9NA 5M2UA 1HW8A 2PC6A 3P3DA 2C3OA 1D09B 3FRZA 2IA6A 5E5NA 2CQ4A 1REGX 2GIRA 3ZFVA 4ZVFA 3HCXA 3MMCB 4IFYB 2HIYA 2CIMA 5E2QA 1MWQA 4OHXA 1U1OA 4WXWA 5J2PB 3DDIA 1EP4B 1QJHA 1U1RA 3OQ2A 2ZD1A 2UZAA 1C0TB 1NSKL 2HGLA 3IRWP 1JMTA 3C66A 4BDPA 1WTBA 3V2UC 1JIHA 1N32J 4GVLA 2DGVA 3GYGA 4QJVA 3LP2A 4LF7J 2D3UA 5LXYA 1NXIA 4Y2MA 5HLFB 2FC9A 3TANA 1V3SA 2HHHF 2XMUA 4X66J 5K9FA 1J5EF 1HQUA 3NS5A 2XEXA 3V5RA 1RYRA 2OLWA 4CTAB 3LWMA 4FS2A 3HHLD 1RK8A 2E1CA 5ETRA 4DSLA 4RUBA 3CIZA 5KG7A 3MFHA 3OFGA 2KM8C 3VZIA 2DISA 4JI6J 2XI2A 3HI9A 1TL4A 3T5JA 1NNDA 5IC4B 5H9EJ 3PW5A 3W9JA 2KM8B 4MK9A 1KONA 5F8IA 2GIQA 1WDDA 3M8SA 1UZDA 4LRCA 1RT7B 3OFFA 1HNZJ 2PMWA 4QIWD 4NZ6A 1FRXA 4DV5F 3C15B 1XMQF 1L3VA 1CC7A 1LXNA 4FBUA 2ZJQQ 5DS7A 2MQQA 1FT8A 1TL3B 1FESA 3RJMB 2XTJP 1U48A 4NX9A 2F3JA 2CQ2A 4LQ9A 3ICLA 3POTB 2R8IA 4LF8F 3S8SA 4ILMA 3CJSA 4J9SA 4C4WA 2CJ9A 4RLEA 3CCMS 3VZHA 2GIFA 3C8YA 4EFAC 1FRHA 1M5HA 4PKDB 3ZO7A 4HDHA 2FHJA 2OPQB 4RBVA 3QJPA 3TVYA 1IR1A 1HKAA 4LSNB 2HVZA 1OJ4A 2W8KA 2BV3A 1VQPS 2EFGA 2NXUA 3GSDA 1YJUA 3H4BA 5KOWA 2VU5A 4TY9A 4C6AA 2MHEA 2HQCA 3SEOA 2E29A 3I0RB 4QBUA 2PMHA 4Y2CA 1WELA 3FMBA 1KOOA 1S1WA 3W64A 4KH1B 3DYAA 2V9KA 2RD5C 2ZD1B 4EO6A 1VFJA 2J0QD 2O66A 1NZ8A 2K1RA 3GZ7A 2JDJA 1EETA 2ZC4A 3V6HA 2KZMA 4MKAA 2BE9B 1M1HA 2RE1A 2KKHA 3OL8A 2HHXA 3L7PA 4IYQA 3OD2A 3P5TL 5KT3A 2XMJA 2ZE2A 3MGJA 4M8LA 4IH6A 2WBRA 1CJTA 4RW4A 1RT5A 2IVYA 1NJZA 4Q43A 3HHLC 2XYPB 2XS2A 4DV0F 4EEYA 1S0OA 4PG8A 2AGQA 4JBCA 1N6QB 4OYPA 4IR1A 4NL5A 1C4CA 1RLCL 3SXLA 3HHLB 3BH6B 5L1IA 3BEGB 4ECTA 1NK5A 1A9NB 2F8MA 1QUPA 1N56A 2LEAA 2GQCA 3KG4A 3IG1B 4RNOA 3BSOA 2VQEJ 2P9GA 2K3KA 4UTGA 2IAJA 1R8CA 4IOBA 3ENQA 3KDNA 2P9CA 1S4FA 2I38A 1TAQA 1MN7A 1U6ZA 1Q8BA 2UVRA 4J91A 2UVVA 2FY1A 4RZRA 1NCLA 2HZAA 1N5SA 2ILZA 1XJWB 3W60A 4HVZA 3PIPQ 2CJXB 2VKZG 4ETZA 2HYIB 5DQGA 4TU7A 3PW7A 2QLXA 4BLGA 2CJBA 1NB2A 3NS7B 2M8DB 2GJIA 1HQ2A 2MKJA 4L6V3 5J1EA 3MEEB 3MCOA 3R5GA 2V2VA 2HZCA 2NUHA 3MM5A 1R0AB 3SSSA 1AFIA 3TAPA 4Q8EA 4ELTA 1RTHB 2DHHA 4ZN3A 3C16B 4ED1A 3M1VA 2HFOA 3F56A 1N32F 3SI8A 5C5JA 4X64J 4CYUA 3OW2R 1BQMB 1FKPB 3WIUA 5E3PA 4LF7F 2OHDA 2CDQA 1X4FA 1EQ0A 2D9OA 2A1BA 5BYQA 4X66F 3MXHP 2JZ5A 2E1RA 3TYTA 1AYEA 1HBUB 2WBMA 1WC5A 1JJHA 4CH7A 3MMAB 2YNFA 2CPXA 1Y00A 3EDQB 4DQPA 2X1AA 2CXEA 3PY8A 3FEYB 1R6VA 2DNNA 3DYAB 3EVWA 2JEIA 2EI5A 4Z2XA 3FZ2A 4JI6F 2FJVA 5A8WB 2EK1A 3O8WA 1TMJA 2CRLA 1EETB 3RRHA 4ZLJA 2V8VA 1E6VB 5D15A 1N5YA 1HNZF 2RQCA 2XSJB 3H2VE 2KU7A 2E5JA 2MB0B 4TY8A 2GHPA 2RQKA 2RS8A 1VHIA 2EFVA 2X3GA 3MUTP 3L9ZA 3W63A 2ZBRA 3N5BA 1NK9A 2AHOB 4U7UK 4AYBD 1SC3B 5KFLA 2M70A 3J7YI 2XZDB 2J8SA 2W9CB 1FK9B 4JI5J 4U8VA 1HNIA 2PA8D 2HWHA 2Z0GA 3PO5A 2LDIA 2VOPA 3OXLA 4URSA 1RWVB 3AY0A 1KN6A 3HPOA 4J9MA 2R8HA 5LT5A 4NXMJ 2J7KA 1EKRA 3H20A 3I5CA 5CYMA 4PXDA 3KLFA 3SV3A 3O6QA 1YVFA 1U6FA 4CLPA 3AJ1A 1VCTA 2Y8YA 3F73A 4LRBA 2J5AA 1H2TZ 3DM2B 4OYAA 1TQLA 3RAMA 3CE8A 5AXKA 3KK2A 1TKDA 5IS2A 3ETOA 1L5UA 3KTQA 4NLXA 7AT1B 5ETMA 2ZH6A 2IYIA 1I5OB 2W24A 3GB0A 4ED4A 2GJ2A 1ZA2B 3AFGA 1S6OA
chains in the Genus database with same CATH topology
2R2RA 3UI3A 1U4BA 1UVMA 1YI2S 1ZPWX 4K4WA 4Q44A 4NRUA 2IYGA 1IKVB 3PM9A 2DGWA 1X4HA 2VD3A 5EWEA 1NKCA 1SKSA 1SH3A 3K5MA 2FVCA 1FNXH 3DRYA 4MMOA 2CQ3A 2F1FA 2LA4A 2EC0A 1T3NA 2BABA 4FPRA 3HVAA 5MAOA 3LANA 2XY5A 4TQSA 4OX6A 3J7Z5 3M2UB 2B3TB 3OFEA 4TKTA 3PW2A 2HHSA 4OJGA 4IUFA 4B3OA 2M8HA 2BUNA 5DO2A 4OI4A 4PG4A 1O8BA 1MU2A 1KVIA 2G9OA 2CFXA 5HBMA 2R7SA 3CCZA 1X5TA 2ZH9A 4RUCA 2EW9A 2HLTA 2OPSA 4XAKA 5GMKa 3WDOA 1LK7A 4O4RA 2P6SA 2XLJA 1KC8T 5KFCA 3M2RB 1N8RT 3DGPA 4PG6A 4RUHA 4KO0A 1RP5A 4XIUA 3DI6A 5C25B 3IC1A 3TR5A 3GILA 2XHWA 2D41A 2M7SA 5K8NA 4XO0A 4YHHF 1BQNB 1NB7A 2FHKA 1LKZA 2YKPA 2R7VA 4DSFA 2YNFB 3PW4A 1NAQA 4N56A 3MEEA 4X4UA 5F8GA 1SV5B 2HHPA 2M3DA 2ADBA 4DPOA 5A8RB 2XLKA 3DLHA 5CYJA 3BR8A 3VAIA 3FFIB 3G6ES 1N54B 2ACYA 3NAHA 2PT0A 4I2QA 1R0AA 2L08A 4HT7A 2VQEF 5DLFA 4DL3A 2JVOA 2FIUA 2VASA 4K50A 1YJRA 4C11A 1DTQB 2OD6A 5D4LA 3WBZA 4DDFA 1RTHA 3MZIA 4PPZA 1SIWB 3LAMA 3KG0A 4RW8B 2OP5A 3OVAA 4LF6F 1H7WA 2EG2A 2FTRA 1FJ7A 5B09A 2J9EA 5IQQA 4H4OB 3OL9A 3B78A 1ZH5A 5KG5A 4WFBQ 1CPZA 4YB1P 2RIJA 1FDBA 2G0CA 3DMJB 4K4VA 2CPIA 1Q8IA 2GW8A 3NGKA 4QYZJ 3DLEA 5IM0A 3LUYA 1LXJA 2E66A 3H98A 1BQMA 1UEVA 1F0XA 3UCZP 2AU0A 1LFWA 3THVA 1FKPA 2V8GA 1I1GA 3BM7A 5T7LB 2XGQA 1HBMB 1U1NA 1O0PA 4B9MA 4IR9A 4MYUA 1KQKA 2AYMA 1S0NA 4R8UA 1SJ3P 4AXJA 3CJKB 4F4YA 4WJBA 2XMKA 1V9OA 2ZHOA 1U47A 5KFWA 3DHWC 2V94A 1T03B 1N48A 3KLHA 5KFVA 3AA9A 2R7RA 4RW6B 2HMIB 2BZ2A 2C2RA 4WKRA 2V8DA 2Z4PA 3L95X 1Q79A 2J9DE 1QY7A 3DRRA 1UVLA 2WSCC 1HBUA 2GQQA 3K5PA 2JL9A 3AHPA 3O44A 4I1TA 3W2WB 5L1LA 2BYCA 2WONA 3KHHA 2IHR1 2BE2A 5EUHA 1KRPA 2D3ZA 1F5AA 2DNOA 1KTVA 1LWFB 4GO7X 2DR9A 1W2IA 4MIBA 5CQGA 4LFCF 4O4GB 5I42A 3CT9A 3MMAA 4LJMA 2I9SA 5DGAA 2HFZA 3B4DA 4DHVA 1QE1A 4LQ3A 2WRMA 3MM9B 1U45A 5CCMA 3QGIA 3HDSA 5C42A 2ZH1A 2KFZA 3UCUP 3OJSA 1HNIB 2YWGA 4DJBA 4K4YA 4AE5A 2GO8A 5J2NA 1S6QB 1LOUA 1FD2A 2H9ZA 4OHYA 2M88A 4Q8FA 2DHSA 2C2EA 1RT2B 3D0GE 1GQEA 2X51A 3GIMA 3SV4A 4ECRA 1YJNS 3C3LA 4ATNA 5A8WA 4PUOB 3LPYA 4ICLA 4NLYA 5KG6A 2VPZB 2RUGA 5CH7B 1HWIA 3QIDA 4X64F 4ED8A 2ZHAA 4NLSA 2B6AA 3THTA 4NOHA 1GTHA 1FKAF 2MJUA 4JI7F 2W4DA 2L9DA 4HYKA 1G1XA 2K8GA 1ZAXA 4YEAA 3J81Y 3MR5A 3MMBA 1X4EA 1WG4A 3M32A 4FVCA 1Z1ZA 1E6VA 4N76A 2YNHA 3KK1B 4I56A 3CJ5A 2E5HA 2E7WA 4H4KA 4KC5A 1S79A 3M8QA 4OHVA 3V81A 1S99A 2RMLA 4O3NA 1GT8A 2GMJA 5A6PA 2K2PA 2JEJA 2XSJA 2ZNYA 2I0XA 2BACA 1MMNA 2YWHA 5LSRA 5LL6d 1LW2A 2EWHA 3BGRB 3D2WA 3O1LA 4F2RA 3S01A 1T05B 3KNAA 1HBNA 1WACA 2M5YA 4TLRA 3OXFA 4CZCA 3T3FA 1KNZA 2CQDA 2AGOA 4OZ0A 3MOJB 2MGZB 4NRTA 3SFGA 1U25A 3QGHA 4IG3B 2R7QA 3VQSA 1GX6A 5IT0A 3G6YA 1VRTB 2MKSA 4AQYF 4KKOB 1APSA 2BANB 4FZVA 1TKTB 5KG2A 4PQUA 1TL1A 3R27A 4ZVEA 1HI1A 2DNQA 4PQAA 3ISND 2AWZA 3US5A 2NLWA 2ZH8A 3RBEA 3FZBA 4ZHRA 2YWFA 1MWYA 4KQZA 1U6BA 2XGPA 4Y6IA 1HPZA 1MMLA 4JI0F 3NCQA 3CIMA 2DR8A 3WX4A 1JLEA 2Q43A 2I1RA 4NCGA 4A4JA 2D74B 3ZZTA 5DDPC 1JXEA 3HKWA 1Q4RA 4GMKA 1DJ0A 3PKYA 2W9CA 4HTIA 4YFUA 1FK9A 3HZGA 5KFTA 1BWEA 3CCSS 2DVIA 3EX7B 3QPIA 4N8OA 3BDPA 2Y0SD 4C8MA 5B0CA 3Q22A 3PW0A 4NA1A 4ZP7A 4G1PA 4W92B 3CULA 1VOMA 3F44A 4DQRA 1VQMS 5JVHQ 1RTDA 4Q45A 3HX9A 1K0VA 2RVJA 3R1LA 1VQ6S 3I55S 3M6VA 3GIIA 4AFFA 4JI3F 2KXFA 5CYQB 3G71S 4KTQA 3NAIA 4LVNP 2K7KA 1HWJA 3H2LA 4JI1F 1HMVB 4HHJA 5KFDA 4O3SA 3VTIA 3PFEA 2K3IA 2VG7B 2OJ3A 2R7OA 2MQPA 1U2RA 2A2CA 1XK8A 1NEEA 3UR0A 1UVKA 3DLLQ 3ISZA 5E33A 2ZKUA 1B0PA 3MR6A 4TQRA 1OSCA 2DNRA 5T41A 1RISA 2C3PA 3MEDB 3AH6A 1VQLS 1TP7A 2KJWA 5D77A 5GVQA 2XO7A 2QA4S 4OI2A 1LWCA 5LSLA 1SJRA 4OX7A 2JH3A 2MDAA 4QPTA 4U7CA 3KHRA 2XULA 1UJ5A 1MU2B 3OUYA 3T5KA 2B43A 3CF5Q 1CSJA 2PIIA 1QAIA 3G6VA 4YR3A 4DS4A 3VQTA 2OPSB 3M8PA 2PMZD 5K8MA 2IRXA 2Z8QA 2RF2A 3OR1A 2FVSA 5GAGI 1H38A 1WHYA 1YRXA 3MM8B 2B56A 3HZEA 1UETA 4ZOSA 2KO1A 2C3UA 2RU3A 2J0WA 3DI6B 3GYXB 3SQGA 4CT8A 3TARA 4J9RA 1TKXB 3VAJA 4IOAQ 1S1VA 2YX7A 3PXGa 4B9NA 3DM2A 2B4VA 3FRYA 4I64A 1NJWA 1T02A 4RNMA 1PO6A 3CTRA 3M05A 4OZ1A 3IA0A 3OTOF 2ABYA 3NNAA 3BSNA 2DO0A 2DBBA 3TAQA 4K4UA 1YIJS 3U1NA 3OTCA 4CI0B 3P49B 4FXDA 1S6PB 1KOHA 4ZPDA 2CPJA 3JTPA 1XNRF 2XBPA 1YJ9S 3MPWA 4FVMA 3CC2S 1JK9B 2GC8A 3R5CA 1K9MT 1JLAA 5KFKA 2YKMB 1TKZA 2XWXA 3AJ2A 5KFBA 3JTNA 3LP1A 2VC0A 3FDSA 1H6KX 3NKYA 3T6BA 1SJFA 4M95A 4Y34A 1CVJA 3VAFA 1WEYA 4C11B 2JFKA 2LYVA 4FNHA 4PR6A 2D1CA 5FLXY 4DOZA 3D0HE 3JSRA 4MFBA 4NXMF 4FF1A 4DFKA 1UMJA 3M6UA 1D9DA 1PSDA 4Z37A 1HYSB 1WHWA 2WB4A 3SSQA 3W2VA 2E44A 5C24A 5DETA 1SIZA 3VAMA 2KJVA 4K4SA 1Z4UA 4HH0A 2QSFA 4X2BA 1KVJA 1IKVA 5IM0B 1QAYA 3QGGA 1GNKA 3E51A 3VAGA 4BWMA 2CJKA 4MKYA 4X65F 5B0BA 2OPRB 4ED3A 4KBIA 1RQ0A 1U2FA 3OBIA 1Q82T 3LW5C 4BWJA 2XS5A 2W4CA 4EZ9A 4K4TA 3R5BA 4WF9Q 2OMLA 3OPKA 4GC7A 1JKHA 5DG7A 1X8DA 3M2UA 4B17A 2R7UA 1RI7A 1IBMF 5F8LA 1N5VA 2AJFE 1REVB 2CPFA 2ZUGA 3H5YA 3BN7A 1FE0A 1VQNS 3U1LA 2AGPA 4PWDB 3KLHB 3HVWA 4N77A 4Y2AA 2DCLA 1ELOA 2DGQA 2MZTA 3NWGA 5L1JA 4ZPBA 3WZ0A 2FJBB 4OL8A 1U09A 4URGA 5GAEU 2FPHX 3CWJA 3M2RA 2KDOA 2HRYA 3SFUA 1N4LA 3TUIC 3CD5A 2WONB 5E41A 1SKWA 5C25A 2MYFA 2BR0A 1I94F 3TA2A 2CPYA 3J7A1 3FGVA 2DH8A 1BQNA 5I42B 4K2XA 4IOCQ 1S10A 3BQ2A 1SH2A 3K8WA 3FJ2A 2L48A 4Y28C 4RU9A 1SV5A 5FIIA 3CXCR 1DZ5A 2KYXA 2WOMB 5C42B 5KFPA 5A8RA 3IFEA 5DDQC 5DM7Q 3PEJA 2J9DA 1TAUA 1VJWA 2ROGA 4RKUC 2QLWA 3PRDA 2HQIA 3X3UA 2OSQA 2VODA 1MW7A 1XR5A 4D3GA 1DTQA 2DGXA 4QIVA 2DIUA 1DARA 3TOQA 3I31A 2PN6A 4QYRA 4RW8A 3ZZOA 2R2UA 3QO9B 2BRKA 2X1FA 2VFVA 2CQIA 4CH0S 4H4OA 5GAHU 1NRKA 3LWLA 2NS1B 1NK4A 5J1PA 4MK7A 3KHLA 1K1SA 5FD1A 3QAUA 3DMJA 4ES2A 2FLOA 2HGNA 2YNIB 3TAMB 3M32B 6FDRA 2CQBA 2B5JB 2JVRA 4M1KA 1VBXA 4QPXA 5F8JA 1VQ7S 1SL2A 3PIOQ 1SQEA 2RKIB 3V81B 2R8JA 2JRSA 5T7LA 3PRBA 4UY8T 1HBMA 4F50A 3CUNA 3QIPB 5AXNA 3FQKA 1KHWA 2MSSA 1FNOA 1DBDA 5DRKA 3OV7A 1Y7PA 2CVEA 3LALA 3CJKA 5L1KA 1LW2B 1NK8A 2IRUA 4K0KF 3ULHA 1VQOS 1Y0HA 1H0HB 2KT2A 3G8TA 1T03A 4NZ0A 4ELUA 3ZZ0A 2HMIA 1X5PA 4RW6A 2RNEA 4B9TA 5E3CA 2COLA 2ASDA 2VA2A 2VOOA 4HEA9 2KFYA 1SC6A 1DURA 2GHVC 1ZZFA 4LIRA 1HD0A 2D9PA 2VQFF 3DCAA 3W2WA 4NCAA 3NNHA 2OTLS 3DLGB 5F0WA 3Q23A 2KT5A 3CJ3A 1FHTA 4PXEA 3KHGA 1RA6A 2QFJA 4N47A 5LJ5Y 5B0EA 1DFDA 4ZHRB 2PE8A 1ZPVA 3EPIA 2MMYA 4M63A 3NS6A 4ZCLA 4MKBA 3PV8A 4RU2A 4LT6A 1S0MA 1HPZB 2HVHA 3CCES 2LCWA 4K4ZA 4NA3A 3KLIB 1Y3JA 1TVRB 5IT4A 4RWXA 1VK8A 2F9DA 4K5RA 5KTQA 3MURP 1KS2A 4P2SA 3HP6A 5A6WA 4ZP8A 5F9LA 2O5DA 2ASJA 2KH9A 1ZM9A 1ZTTA 4PG7A 1B7FA 2NSBA 4RW7B 4UUXA 2OD4A 3NGDA 3UD3P 1SXLA 3KJVB 2VBXA 1N0VC 2FGCA 1FNMA 1QVGR 1X4BA 4F3OA 1XBWA 3FVYA 3BO4A 3M8RA 1RT2A 3CDWA 4OLOA 4A8WA 4PUOA 3SCLE 1GH8A 1S9EB 2CQ0A 3QMQA 3AQOA 2KXHA 1QAXA 2LQBA 5T14A 1YGYA 5L38A 2DPIA 3OR2B 2ZH2A 2ZBIA 2ILYA 2PSZA 2B7CB 4ID5B 4Y2IA 4EYIB 2C22A 1IKWB 4GKKF 1YHQS 4FF2A 4R25A 2RRAA 3KK1A 2JLGA 2KRRA 3PHEA 5HMWA 2FB0A 5F9NA 3IN5A 5K8OA 3TVZA 3UDCA 2B9WA 3RAQA 1P1TA 3VR1A 5LSOA 3T1HF 1R8PA 4YR0A 3ENWA 4OI3A 1DQ9A 4L72B 3JYTB 3SYZA 1U49A 2BRLA 3RW6A 4NYZA 1M5OC 2KN4A 1U7LA 3FSIA 1T05A 1RKIA 2AJ1A 3G86A 4Y3CA 4X4VA 1OO0B 4DL0C 2FGOA 3A8EA 4V19X 4FBTA 2RF2B 3OFHA 3OR1B 1FDAA 2MY7A 4PG5A 4NYOA 4DFJA 3Q8SB 3EPGA 4IG3A 2Y1JA 3QAEA 1KEKA 1VRTA 4KKOA 3D1QA 2BANA 1TKTA 4F25A 1S1VB 3CCVS 2J9CA 1SB6A 2KHCA 3DRPB 3PEHA 5A0YA 4IG0B 4DQIA 3QZ7A 5F8MA 1K8AT 1WF2A 3MECB 4WFAQ 2XLIA 5CD4H 4ELVA 2FUG9 2M0GB 3OTBA 5A8KB 5J2QA 1CEZA 2DNLA 1T95A 3C6UB 4IRCA 3X1LB 4Q0BB 4KJIA 3ZZUA 2RRBA 5DG8A 3BO2A 2H5EA 2XB2D 4DSEA 4C9DA 3G96A 1YBAA 3IGVA 3LP1B 4EBCA 3QLHB 1Q7YT 3S6EA 1DHMA 2Z2LA 4M94A 3BGUA 4URQU 1R8AA 4ECZA 2IBKA 4ZP6A 2DB1A 5GAEI 1JNZB 2RH3A 2PA3A 4LVOP 3BQ1A 3UR3C 4N5SA 3CJ0A 5CYQA 4G1IA 2CPEA 5KFAA 2RSQA 3RBDA 3W2VB 5AE1A 2M9KA 5C24B 3M9OB 1IQZA 5KFRA 2DNKA