1FRJA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCIYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frjA00
3MM5A 1BWEA 3PNIA 1A6LA 1WTFA 1AXQA 1B0PA 5CHCB 3MM8A 4DHVA 2C42A 1DFDA 2FJEB 3MM8B 1IQZA 3MM6A 3EGWB 5E7OB 7FDRA 1IR0A 2C3YA 1D3WA 1Y5LB 1G3OA 2V2KA 4OMFG 2WB1D 2VPWB 1FRLA 1BQXA 2V4JA 1H0HB 2FJDB 1DAXA 6FDRA 4XK8C 2V4JB 5FD1A 2C3MA 2FGOA 2WAQD 1BLUA 1SIWB 3MM7B 1H7XA 1H7WA 2WSCC 5BYQA 3MM5B 1DURA 1GT8A 4L6V3 4RKUC 2WSFC 1ROFA 1FRKA 5CH7B 2VKRA 1G6BA 3MM6B 4YDDB 2O01C 1FRXA 3EUNA 3C8YA 3LW5C 1BC6A 1VJWA 4Y28C 1SIZA 2VPZB 2VPXB 3OR1A 1FF2A 2ZVSA 2C3OA 7FD1A 5L8RC 1H98A 1GTEA 1BD6A 2VPYB 1K0TA 1GAOA 3MMAA 1JB0C 2FJBB 1FTCA 2GMJA 1JNRB 2Y0SD 1FXDA 1XERA 1FD2A 4CI0B 1B0VA 1PC5A 2XSJA 2PDAA 1KQGB 3IR7B 1FEHA 2XSJB 1Q16B 2C3UA 1F5CA 1SJ1A 1HFEL 1RGVA 1GTHA 2PA8D 1FDNA 3MMBA 5BYRA 2UZAA 1CLFA 2PMZD 2C3PA 4XDDA 4AYBD 1KQFB 2IVFB 1FRJA 1FDAA 1F5BA 2FJAB 2Z8QA 3OR1B 1FXRA 3IR5B 1FCAA 1Y4ZB 4XDCA 1C4AA 1FERA 3MM9A 1FRHA 1C4CA 1FRIA 2FDNA 1FDBA 2WSEC 2FD2A 3MMAB 3MM9B 3EXYA 3OR2A 6FD1A 1KEKA 1Y5IB 3MMCA 3OR2B 4OV1A 3IR6B 2GMHA 5BYSA 1JNZB 3MMCB 3HKZD 1Y5NB 3GYXB 4ID8A 1F2GA 1R27B 1B0TA 1PC4A 3MMBB 1FDDA 3MM7A 1FRMA 4KT0C
chains in the Genus database with same CATH superfamily
1KR4A 4FPRA 2V2ZA 4ZCLA 4M5DA 5H9FJ 4Q0BB 1VFJA 1VYAA 3OFHA 1YJRA 2PT0A 5DO2A 3KLHB 2PSZA 1IKVB 4FF1A 1OY9A 3I0SB 4GO5X 2BQ3A 2QLBB 1X4EA 1S7IA 5CZVA 3UD4P 2H5EA 2FVPA 1M5VC 3BBFA 2BE7D 1RYSA 4LF7F 4DV7F 4NLRA 3H98A 2WVEA 2WZ1A 3SBMA 3HI9A 4ZCKA 1YVFA 3NCRA 4GKKF 5I3UA 4P52A 1GTEA 1CQNA 1MLAA 3HVRA 2AGPA 4LF9F 1ZBTA 2MSTA 5BYRA 2KI2A 2XCAA 2F9DA 4B9LA 2W24A 4I64A 1T7PA 2AEMA 2HQ3A 2V63A 2MZQA 1PKUA 4RBTA 4DV1F 1VI7A 3SFGA 4QPTA 2MKKA 2BA9A 5HBMB 5KFOA 4H4KA 4UY8T 4FYYB 1BQMA 4ZLJA 4M5HA 1NJXA 1Q8LA 1CJTA 2K06A 4K0KJ 5RUBA 4RW7B 1U2CA 3QBCA 3A4TA 1NJZA 3BBCA 5FDLB 3H5UA 3GSIA 3MM6B 5DS7A 4NXMJ 1Y7PA 5IZHA 2XI2A 3T41A 4GRSA 5IQQA 2LQBA 3GB0A 3TEHB 3DMJB 2FLOA 4PXEA 1H2VZ 4KKOA 1EKRA 3I96A 3DRYA 2GIFA 4B3SJ 3EVOA 3BQ0A 2ZOGA 4X2BA 2YH0A 3BGRA 2IVFB 4EEYA 2VJUA 2N7CA 4EZ6A 1GEHA 2MQOA 3F0NA 2OEMA 1PCAA 1FERA 5F8HA 4QR0A 4ZPTR 3CE8A 1KEKA 4KQZA 3K5LA 2GW8A 1JXVA 3EPIA 1DBDA 1N6QB 2BRLA 3L7OA 4NLGA 4L3KA 3FCWA 2CYYA 2G4BA 5L39A 3TZXA 4LQ3A 5F8JA 2YWKA 3OTCA 4ZLNA 4RW8B 3AD8C 5CD4A 3ZTSA 4ICLA 1NU4A 1IBKF 3HHLC 1LWXA 1R8CA 4LF4J 1JLGA 1QSSA 4LJMA 5BYQA 2A6MA 3OBIA 1ROFA 4ZVQB 4P2FA 4OZ1A 4XPCA 4MKYA 2E1CA 4TVAB 2XGQA 2VPZB 4B02A 2M0GB 2K7KA 2QJ3A 4OJHA 4JV1A 1EETB 2CNOB 3ILJA 1KQFB 2E7WA 2CJBA 3NNCA 2C2RA 4J5OA 4XIUA 2ALYB 3R6GB 2FDNA 3PYGA 2K1RB 2EC2A 5K5MA 2VICA 1S4FA 2ASDA 2XNRA 3MOJB 3I0RB 4I68A 4RX6A 5KTQA 4YUDA 2UUTA 1GMUA 3FZ2A 5HATA 1O8BA 1U6FA 3E3XA 4USWA 1LWFB 5M2RA 2DISA 4F67A 2V94A 2QO3A 2KB2A 4V19J 4IOBA 3PDNA 4KJIA 5B0GA 2JEFA 5DG8A 4WU3A 3W65A 4LF6F 2A2DA 3X1LB 2VC0A 4NX9A 1RYRA 4URQU 1XNRF 2CPDA 3QGIA 2N3OA 5J2PA 3QWPA 1VLYA 1PG5B 2JLFA 2Y8YA 1S12A 4ZJLA 3D1QA 4GVLA 2WONB 3OVAA 4I2QA 1TUGB 3PYFA 2PMZD 2DGTA 5K20B 3JB9k 3JSBA 5AXLA 1NUEA 2HQIA 3QGHA 4R0EA 1FXLA 3OR2A 2AKWB 4L73A 4PUOB 2AYBA 4NWBA 1NDCA 4EBDA 1K0VA 1R7IA 1S6QA 2X1BA 4CT9A 5IOLA 3KG0A 3PG9A 4PG4A 2AX1A 1YHQS 4KHPF 1URNA 2ZJRQ 2CNKB 1ZETA 1H0HB 5C5JA 4MH8A 2B43A 3NGTA 1U1MA 4ILMA 2Q79A 1YJVA 2AGQA 1QE1B 4FKYA 2RQMA 5J2NB 3CCQS 1RT3A 2OPPA 3LA0A 3K0JA 3TA0A 1B3TA 2LA4A 1CJKB 3QO9B 5HO4A 2CA9A 5KFFA 3VCDA 1V9OA 2AJ1A 4LF8F 3CJ8A 5CXTA 1REVB 2R7RA 1X7VA 1H2UX 4DV2J 1P9QC 2HS4A 1RWXB 2XC9A 4NOHA 3N5FA 4LF2A 4UUXA 2WCXA 4J9PA 4C3MA 1U25A 4XDCA 3G82B 3ZFVA 2NXJA 2B8QA 1SCJB 4LFBF 4O44B 1T9YA 1YDLA 2ZH1A 1O6XA 4ZIWA 2MPUA 2DPIA 3HJFA 3HLUA 4LR9A 3W2VB 1ZPWX 5AT1B 3I31A 4IFVB 4KPYA 4X65F 3JXOA 4PXBA 3O1LA 2W7AA 4C11A 1L3UA 5AXMA 1RTJA 4DR1J 3K89A 1QSYA 4E98A 1S99A 3OD2A 3PHEA 5BR8F 1X9SA 3UO0A 3I5CA 4LFCF 2CJQA 5LSLA 5CA5A 4UZCA 1FKAF 3ELHA 3QLHA 4ES3A 2CJXB 1KN6A 4WFAQ 4HEA9 2B3TB 3KMSA 2LEAA 3WQPA 3QJJA 4C9DA 5E2QA 1XMBA 2KT3A 4H4KC 2RDJA 2F1FA 4QU7A 1RHUB 3PEHA 4Q8EA 3GE9A 1HQUA 4Q8FA 5E3QA 4TU9A 4DV7J 3KK2B 3M8WA 5KT6A 1IR0A 5KFKA 2D9PA 3D68A 1F3VA 1YLXA 4OLPA 2DPJA 4Y65A 3RR8A 2RB7A 4WFXA 4EI2A 4LF9J 4HACA 1FRLA 2FY8A 2W01A 1B7YB 4N7TA 2XLIA 3QRQA 2K8GA 4DFPA 4C4WA 2IJNA 2D41A 1QVFR 2CPJA 2CAJA 4A8OA 1VC6A 4DV0J 2AZ3A 4DEZA 2ROGA 1RUSA 3TJAA 3TYTA 4HR2A 1RXOB 4Y28C 2J8SA 2CPHA 4KAIA 4DV1J 3DOLA 3GJRB 5ETPA 1R89A 1NHKL 1X4DA 1LNQA 4DQPA 3TUJC 3ENAA 3H5YA 1YRXA 2HPUA 3GIMA 1UFWA 4NEZA 3BPDA 3OL9A 3EDRB 2U2FA 1F5AA 4A8YA 1NDKA 5DQGA 2EEYA 3K5PA 1Y4ZB 1PAUB 2OTJS 4K4TA 2GQQA 4ETZA 1S57A 1RBAA 2P9GA 1RHRB 3KK3B 2W9AA 4RU9A 3HHNB 4WP3A 4TKTA 1VQ9S 4WTOB 1FDDA 2FVCA 3FQKA 2QMXA 4X4UA 3CMQA 2RQCA 1X5PA 3V4MA 4DPYA 4DU7A 1XMQJ 4UF4A 2NPIA 2YNGA 1XEZA 3P45B 5HI7A 5E7OB 2HMIA 2A6OA 1NM2A 2HVDA 1Q5VA 1WTBA 5KG0A 1SIWB 3PYEA 3MM7B 1NMEB 4N8NA 1R8PA 2QYGA 2HZAA 4ZA1A 1KLMA 4WTYA 3C15B 2WB4A 4J9NA 1S48A 2HS0A 5C24B 2B4UA 4WFNQ 2BKNA 3G96A 2IM0A 1SBRA 4PG8A 2V4QA 4J37A 2OPSA 2OSQA 4CT8A 3KWMA 1UJ6A 1IBKJ 1FDAA 2V34A 4C8MA 1PJ6A 2DGUA 2MJUA 4W90B 2QA1A 2HNZB 4P6QA 2HFSA 4RW4A 3OXLA 4ZCIA 4ECXA 5THWA 4ECYA 2MY7A 5LMUF 3MM8B 2ZE2B 3C6UB 4CH7A 3DOMA 3PTWA 5HMXA 2B6AB 1VQ6S 1I94F 1WF1A 3QNWB 2LU2A 4MKVA 3BKUA 1W7WA 4YB7A 5HL7Q 2ZVIA 2V5HG 3SYZA 3SV3A 1UP1A 1YSJA 5GAEI 3CF5Q 1TKXB 2H4WB 4DN0A 4OJ1A 5LSOA 4IH7A 3UCUP 5DM6Q 2CQIA 4L75A 5KT5A 2PFDA 1HNZF 1X4GA 4MMOA 1HWIA 4DG1A 4HHJA 1FDNA 2EXUA 3BGOP 3VALA 4OLOA 1PAEX 4ZPVR 3IWNC 2W2MP 2HLTA 4LF6J 5DGBA 4B3TJ 4CLWA 3A8EA 1DARA 3T5KA 1KWMA 2OUGA 4GO7X 4Z37A 3AD7C 3WX4A 4OZLA 3L4BC 2DEIA 1TUWA 3OFEA 3JYTA 1X4HA 2IMWP 4TLRA 3NKYA 3PACA 3HHDA 1DAXA 2BJ8A 3BYPA 2B9YA 2ZH6A 3EM1A 3LQVA 4MK8A 2APOA 2BKOA 3LH2S 4RR5A 2CQ1A 3M32A 4CRJA 5H9EK 3IGNA 4C98A 4KGKA 3DI6B 5IV3A 3M8YA 4PXCA 3VAHA 1BD6A 2J7WA 1S0VA 2IBOA 3TVYA 2BQRA 3DM2B 1NXIA 2ZHAA 1SUQA 3G6VA 1TVRA 1F5BA 1V3RA 2LCWA 3DU5A 2RQ4A 4G1PA 3NNAA 2V68A 4IFYA 2Y1LB 2CZVC 1KS2A 1ACMB 1TAQA 3FSXA 4NLPA 3CJTA 3NAIA 3HKZD 1XC9A 4DQRA 3D9BA 8ATCB 3NS7B 2KVIA 1CC8A 1WI8A 2JWNA 2JFDA 1IKWB 4DPOA 3JSRA 4YP3A 1VHIA 2ZC3A 3EZ5A 1KVJA 9ATCB 4J9VA 1TL3B 2N4CA 4DQIA 3LWLA 4LF8J 3HDSA 1ZTWA 1T9XA 5E3PA 8RUCA 3QT6A 4IG0B 4C0OC 1IR1A 4B9NA 3PR5B 4LFBJ 1U0HB 1D1UA 3MEKA 3CCMS 2JLEA 1IUJA 3HCXA 2RVJA 5IC4B 1RTIA 1DQAA 4KY3A 4JI8J 1FKOB 2YQ0A 2VFSA 3BR8A 5EX0A 4P2SA 4ANEA 1JNRB 2RDIA 1H74A 2ZNZA 4OJGA 1Q16B 2M4MA 2UVUA 2OPRB 3G6ES 5K8MA 3CULA 5HK4A 4QWAA 4G1IA 5DLGA 3KLFA 3GV8B 2VU5A 2Z8QA 3AODA 3GFZA 1YRTA 3KDNA 1S1WA 1NKEA 1S79A 2CVIA 2FHJD 4OL8A 2V9WA 2ABYA 1NK6A 2MZRA 5J1EB 4DSIA 1HHSA 3HHLB 3MEGB 1RAOA 1RSCA 1HW9A 4EBEA 1VMBA 3CJ0A 3DHWC 3FSYA 5K14A 2DGSA 2DHGA 1VK8A 4O0NA 2ZJPQ 3PW7A 2XMAA 5ETQA 4OYOA 1NDLA 2E1PA 2B7CB 1V5VA 3K58A 1JJCB 3DOKA 2J7KA 1IVZA 3H59A 4ELTA 4RW9B 3UVJA 4KH0B 5KFBA 2L9DA 1PYSB 2MZJA 1SQFA 5FJ4A 4IH5A 4QIWD 3CGIA 1U8WA 2UUBF 2HNDA 5J2MB 3RBDA 5T7LA 1M90T 5DQIA 1KP6A 2XM3A 5D4OA 3AA9A 3D5MA 3DLKA 2FJAB 1KFSA 1EQMA 3B78A 4ATNA 2YKPA 3POTB 3PV8A 1NLKL 1UWBA 1JK9B 2G0CA 2LDYA 3MEEB 1M5SA 4DZ6A 2J6UA 1FNMA 5M2PA 1JKHA 3PO5A 1N33F 3HFKA 4C8KA 1GH8A 5E3AA 5AJ3J 4DFKA 2CJAA 2QIFA 4N77A 4MFBB 3MTJA 1Q82T 1HPZA 9RUBA 1CG2A 3MM5B 1ZPVA 3B8HA 2H3EB 1SJRA 4CIOA 2GCFA 2LLZA 4QR2A 4FBUA 5C42A 2P6SA 4ZVEA 4X66F 4FF3A 2QMUB 2CQGA 3DLGB 3FFIA 1KQGB 3CCSS 2WBMA 1RBLA 4U6PA 4MK9A 1GTHA 1DY3A 3DYAB 1VBXA 1L3SA 1JJHA 2ZH3A 4FF4A 3GJSB 3NL0A 2C28A 4WZMA 3ISNC 3KDOA 1NK4A 1RB0A 1JQGA 4AL6A 3ICLA 1PJ5A 1UEVA 3OTOJ 2KYXA 3CJKB 5HP1A 5HVGA 4ECRA 2QX0A 2F8MA 3TJ9A 3HSGA 4BC9A 1T11A 1EB0A 1WSRA 1HIYA 3WC2A 3NY0A 5ETSA 2KM8C 5LJ5Y 1W2BR 3KHGA 3NCPA 1RT4A 3HX9A 2IJRA 1WF0A 4HDHA 3BGFA 4URGA 2ALZA 3NS6A 1UVIA 3TZWA 4M5DB 4CO5A 2NREA 2BW2A 1KOHA 1X8DA 4TU7A 3ENVA 3GJQB 3PIPQ 4BDPA 4N76A 4B3OB 1HLWA 3J81U 4F2RA 1AFIA 2DGXA 3DRPA 4ENOA 4B3MF 2N82B 3AXMA 1YBTA 5LMUJ 3H90A 2XSJA 2BANA 3S6EA 1VQ5S 1ZM9A 4FBTA 3CMES 1I94J 4FYXB 2HLUA 4LUBA 1DTQA 2ZUAA 2CJ9A 4WF9Q 2VQFJ 4ZPWR 5I3UB 4W92B 5MLCV 2CPEA 3EDQB 4MJKA 4ILRA 2OGUA 3OUYB 2HQDA 1HHTP 2MKSA 3BV8A 3QT5A 1NSQA 4ID5A 3LP0A 1HW8A 5F9LA 3ZTOA 2EKYA 5EUHA 4B9MA 2ADBA 4WK3A 2WW8A 1HNZJ 2F4VF 3DHXA 4JI2F 3VQSA 2QLWA 2O3DA 2QN6B 1CC7A 2QV6A 4C8NA 3M9NB 3ZZOA 2BJ9A 5EWEA 4OHWA 3M05A 1UVKA 4NPOA 3CCUS 2CJYB 1YJ9S 4NXNF 1BQMB 2FUG9 1CJTB 4I7FA 4JB8B 1HNXF 3SDEB 2R7SA 2MQ8A 2F8HA 4DS4A 2DGQA 3TR5A 2R8KA 4OX6A 5A2QU 5HMYA 5DLFA 2H51B 4CWBA 1ZZNA 3U1NA 2KXNB 1JLFA 2XYPB 3S7RA 2VFVA 1RI7A 4ZP6A 1NO8A 4NI2A 3QSIA 2WSEC 4F4KA 1ZOTA 3TQEA 1JJ2R 4FXVA 5A0YB 1F0XA 1QTNB 3QZ8A 1NJYA 3EGNA 3CC7S 3M2RA 5D78A 4DR4F 3BGRB 4PYDA 3OVBA 1MN7A 3G6YA 1GXUA 1TKZA 2PMHA 4ZDNA 3F73A 1GFWB 1U48A 3TJ8A 4QYRA 1PYTA 2GS8A 3I56S 2DD8S 1WG1A 2V4JA 4ZVFA 4KFBA 3PKMA 3RBXA 3NG8A 2YNHB 2EKNA 4NLOA 3DRXA 3J7AN 4EO6A 1FRKA 2HQFA 2EBEA 4EU0A 4Q5VA 5HVHA 1T8EA 2ZH9A 2YTCA 4ICLB 5B0DA 4CCHA 4CNYA 3OHBA 5HMWA 5B09A 2OHDA 2W4PA 1TFYA 1JLGB 3DGVA 3W63A 5C25B 2V8PA 2BYCA 2H9ZA 3A8JA 2GJ2A 2VV5A 1RWMB 1VRUA 1RDRA 3FBBA 2NR0A 2L9WA 4U95A 2UV8G 3JAMY 1FCAA 5SZTA 1Q78A 3MM9A 1KDNA 3IGVA 4DV6F 1JNZB 4NYPA 4UOHA 2B8PA 5A8RA 4LBIA 2VOPA 1D9FA 2FJWA 5GADI 2XZTB 1LW2B 3CJ5A 1P6TA 3W5ZA 1Q4RA 1S59A 2C42A 3I9ZA 3H4BA 3EGVA 1AB8A 4XPEA 4NCGA 4KIAA 4BBYA 2YKNB 3MWBA 1U2FA 2M88A 2CQHA 2Y3YA 2PI4A 2PEBA 2WW4A 1U26A 1JLAA 2BE2A 5GVQA 5AXNA 4CYUA 1HNIA 4K4UA 5KFSA 2NSBA 2YQ3A 1JXLA 3PFOA 1RAIB 5BXIA 4ZVOB 2FJBB 4CO0A 4Q7AA 1N36F 4TY9A 2DNYA 2XLKA 3B6BA 4O3OA 1RGVA 1T0TV 1UWAA 2DNQA 3N6MA 4IOCQ 3MUVP 4TN2A 3J7Z5 3E8OA 3CWJA 4W4MA 3OLAA 4OI2A 2EFNA 4P75A 4PG6A 1N56A 3HSZA 3JSMA 3ZO7A 4I2QB 2LQ5A 1Y5NB 2WVDA 3RBZA 1MNEA 1E6YA 2X1FA 3VF0B 1PBUA 4ELUA 1D09B 2DY1A 1WC1A 3LPEA 2PO4A 1HWLA 2JC1A 3BREA 2UUBJ 3EGWB 3EZUA 2C3YA 3F41A 3MCMA 3JTNA 2C22A 4NLDA 1TR0A 5ADZA 3OPKA 3AY0A 3MPVA 2KRRA 5LXYA 4M5IA 3KXDA 1S6QB 5D0GA 5T14A 2KZMA 2HYIB 1Q7YT 1RCOB 3TUIC 2N7YA 3KLGA 4NA1A 1U1PA 4F04B 2C2MB 4DR5F 3BQ2A 5LXRA 4WJBA 3H40A 1SQEA 4DX8H 3GYGA 3UN5A 3SSQA 3R7NB 3Q2SC 1X9MA 3C66A 2CUYA 2V6AA 4JI1J 1PIEA 1RAEB 2PA8D 2CKWA 1RT3B 2OPPB 4A8QA 5L1IA 5CD4H 3AJ2A 3M6XA 1SXLA 4F2SA 2DH8A 3PW5A 3EVMA 3TRGA 5C2CA 3AH6A 4G1QA 2DNMA 1CQMA 3CD7A 1RAGB 4O4GB 2CG4A 2EW9A 3CCWA 3I9V9 1GXLA 1S49A 2W9BA 1S1TB 4K5RA 2IYIA 1Y9OA 4DX6A 2MDAA 4X66J 5HJYA 1AA1B 1IQZA 1LEOA 5HLFA 3KJVA 2AMCB 3DDIA 2HK3A 2NSCA 2XS7A 5EDWA 5E0OA 4DL6A 2AJ4A 3BGLA 2WRMA 1CULB 2E1AA 4C11B 4KC5A 3V2UC 3C14A 3HP6A 1FF2A 5SUHA 3IC1A 3BN4A 2VD3A 2HK2A 1Q8IA 3OTEA 1H38A 5LSRA 5D8HB 3NWRA 5J2QB 5AE2A 1EQ0A 2AJ0A 3BKTA 3OVSA 2QE5A 1JJ4A 2MTLA 3P4UB 2CZ4A 2KFNA 3EXYA 4ZK7M 4KV8A 2WOMA 2YKMA 1RZMA 1OY8A 1RT6B 1N5SA 4RW6A 2U1AA 1TP7A 1BWEA 4LBHA 4B3MJ 1B0PA 2QG9B 3W64A 3VAFA 3UCGA 2P5VA 1HBOB 4OI4A 1JX4A 1KSPA 3KJNB 3KHLA 4PWUA 4O3QA 3PO4A 4JI0F 2FGOA 3W5YA 4U9RA 1MG7A 1VBYA 3H8YA 1S0MA 1RTHA 1EARA 4QIVA 2R9LA 4RNNA 3TAMA 4CLFA 3FMBA 3TUZC 1Z4UA 1MU2A 5K8PA 3C8YA 4QIFA 3V6HA 1TL1A 1VGYA 2BM1A 4TQRA 3WIUA 3E51A 5L8RC 4QYZJ 4YR2A 1VIOA 1OYEA 2GGPA 2CPXA 4CI0B 2LQJA 1F9EB 3ZC4A 4DV5F 1JLQA 2R7QA 2F4VJ 1NK8A 4DR6J 4JI2J 2FHKA 3IP0A 3DOLB 2RE1A 5J1NA 5IM0A 2VG5B 4X62J 1NB2A 2MY8A 4ID8A 1R27B 2OFHX 3FBFA 3FDSA 2DJWA 4WXOA 5DZ7A 2RS2A 2PIIA 3QRRA 2KZZA 3DXBA 2ZBIA 4NLWA 1NK9A 2ILZA 3IWXA 2DNZA 2Z58B 1Y0HA 1HYSB 3BS9A 3C16A 3QSYB 3D3CJ 3WBZA 1LW0A 4LRCA 1NAQA 4CO4A 2QMWA 2YNGB 3TWZA 5B0FA 3ZZPA 3EYZA 4OZ0A 4DR4J 2IA6A 3M8ZA 3PEJA 3CB4A 4JBCA 4PRFA 1RABB 1FEHA 1KLMB 1T3OA 2UZAA 3A8IA 4A47A 4AYBD 5E41A 1R3NA 1RHMB 4OX9F 3AXKA 1R0AA 1WHYA 4KR0B 4FKXA 2JEJA 1VHFA 1RTDA 4O3RA 4LSNA 2XMUA 1QSLA 2BOPA 4P2MA 3HSDA 3PJXA 4KPCA 4CQ1A 3M9MB 3D1OA 4EWTA 4USKA 1D9DA 3C46A 2QLFB 2CFXA 5G0RB 2HWHA 2ROEA 1IKYB 5EX3A 3Q8QB 1XR6A 3RUBL 1N5VA 4K59A 4I0WA 4DV6J 4G3IA 3CCLS 2O66A 2OPQA 2OMOA 1C1BA 2KXFA 1YJWS 2XMKA 2ZBCA 3QFWA 1JLBB 1PYOB 1I6JA 1YTYA 2VA2A 1TQLA 2BABA 2YWEA 5B08A 1P27B 2B4VA 2FYXA 2JVRA 4OHZA 1RWUA 1YJ7A 1UA1A 4BHQA 2HBQB 4DR2J 2VQEJ 3IR5B 2EBGA 1C4AA 3GONA 5F41A 1FRIA 4PPDA 2QYCA 2KM8B 2KT2A 2HAFA 2MSSA 4ZPAA 5CYQA 4M5NA 4YHHF 2XSFA 2D3O1 1YITS 1X5TA 5A8WA 1PO6A 3CXCR 4MIAA 1HBMB 1KTQA 1PBAA 1EIYB 2RU9A 2K2PA 3K17A 3N0VA 3GV7B 2J0WA 3B4DA 5C7PA 1DRZA 4IQXA 4EZ9A 4B9VA 2R42A 1FI4A 3BH7B 3JYTB 3OTDA 5F0WA 4ZVPB 4DI6A 2GA7A 2RNEA 2CG8A 2Z56B 2OIHA 4C8YA 2IAJA 2F40A 3HSJA 3TI0A 1OJ4A 2V9KA 2JOQA 2LFVA 3IR7B 3QT7A 2OO4A 2H54B 2X51A 3HT0A 2Y8WA 1APSA 1F5CA 3W9IA 4U7CA 3RAMA 1JLEA 1CPZA 1WEXA 2HGMA 3FCVA 3GFHA 3M32B 2PD1A 5CYMA 5GAEU 4ECTA 1N48A 2KHDA 2ZD1A 3THPA 2GVZA 1K1SA 5KFGA 2ERRA 3Q23A 2P8IA 1KVIA 2OEJA 3ZNUA 4NA2A 4F3MA 3RJMB 1WHWA 1U2RA 1TVRB 3LGMA 1WTFA 5CHCB 4DR5J 1VC5A 3QIPA 3T5HA 1SJQA 2KFYA 1VLOA 3VGUA 1FFWB 2I9SA 3P96A 3M2VB 1NPKA 3NBPB 2E9ZA 2XWYA 3HZGA 3TEGA 3NMRA 2BQUA 2E44A 1C0TA 4LF5F 2AP6A 3KNAA 4LFAF 5E33A 5F0UA 3M6WA 2ZVSA 4O3NA 5JUMA 2GO8A 3GYNA 1GAOA 3HF5A 2E5JA 4YFUA 3UNYA 1K1QA 1N32F 1V6HA 1TL5A 2ASJA 1OSDA 3DGPA 3CD5A 2QA4G 4ZPCA 5L1JA 2WBRA 3A1YG 3HFVA 2BV3A 4NLYA 1RTIB 2R8GA 2HRTA 4Y34A 3WDOA 3NOGA 1DJ0A 3O6QA 3CT9A 1D9AA 3FC9A 2P9CA 4C0HA 4M5LA 4Y3CA 1NZAA 2R7XA 1U1QA 4QIEA 2BJEA 3KTQA 3Q24A 4MYTA 1TKDA 2O1PA 4DBQA 4OYIA 4QWBA 3M9OB 2NZCA 3KLHA 2YX1A 1IKVA 2RRNA 4DFMA 3MAQA 1WDTA 4DR3F 4I6AA 2PE8A 3VZIA 2XEXA 1MSWD 2DT9A 4C0BA 4P7TA 4IDKA 3UR3C 5K14B 5HVFA 3SCJE 3R6LB 1W25A 4GKJF 2VB6A 1X31C 3FQLA 2W9CA 5HQMA 1RT5B 3CC4S 4O3SA 5KG6A 4YMEA 4ZN1A 3U7JA 3IG1A 1RWWB 2KH9A 2OAUA 5HROA 2CDRB 2C3PA 4JI6F 3DOKB 3DNCA 4JI0J 1NDPA 2NZ4A 1SV5A 3BKFA 2D69A 4DU8A 1UEUA 3A3OB 4J9SA 2YNIA 1M5OC 2DB1A 1KLNA 4YR3A 2QA4S 2CQ4A 2HNDB 4OYWA 2Q43A 3Q8YA 5T7LB 2R7VA 1M5PC 3GMGA 1E6VB 2F8EX 3ZXWA 1J5EF 4DV5J 3PJWA 4LIRA 4RW7A 3T1YJ 4QBUA 4HHHA 2AHOB 2YPZA 5B0EA 4M1KA 1FWLA 2HHVA 1G6BA 2LMIA 3VGVA 3OL7A 3BZQA 2FHOB 4AFFA 3M8QA 2OD4A 1EX8A 1HPZB 4ALZA 3DMJA 3MMAA 4CLPA 4X64J 2XTJP 3JQMA 1XIQA 3UN2A 4RWWA 2FC9A 2MGZA 2Z57B 1RLCL 1NBEB 5C42B 5ETOA 2QSFA 3S8SA 3K5NA 2V8VA 4U7UK 5EWGA 1C2PA 3VAJA 3FFIB 2PMWA 4GVBB 1KHWA 4NLVA 5L1LA 1FE4A 1DLOB 5I3QA 1YI2S 4N5SA 3G9CA 1A6LA 4GMKA 5JJBA 2FC8A 2W25A 2HHSA 4RW8A 1NPPA 4ED8A 4N41A 1EAYC 1IBCB 3Q8SB 2ASLA 1KD1T 1U6BA 3W9HA 2MLXA 1SC6A 1GXTA 5HP1B 4OX9J 3QPIA 2MZ1A 1U8SA 3MD1A 2RRBA 3H20A 4H54A 5D4PA 2ZEJA 1RQ0A 1VBZA 1RT4B 1NH7A 2DK2A 2J9DE 5L38A 2ZITA 1UFKA 2JFKA 3ZTRA 1XQIA 1N5YA 5DETA 2GHWA 1X5OA 2VHGA 4DWIA 2VBYA 3O3LA 5JVGQ 3MCOA 2ZNYA 2IVYA 1GMVA 3K7RA 3IO1A 1S72S 4Q44A 5IS2A 3ULHA 2BANB 1WNEA 1Y3JA 4Y00A 1SJ4P 2IM1A 1VIXA 3BO4A 1L3VA 2NXNA 1S77D 1WC6A 3DLEB 3FJ2A 4GC7A 4K7QA 3WIVA 2EFPA 3ZZ0A 5LL6d 2R7WA 1RJJA 1TL7A 1RKJA 5IT9Y 4PR6A 2UVVA 3UDEA 3AD9C 4WCEQ 4YHHJ 1IKXA 1FX4A 1CSJA 2D3OR 3IA0A 3R5DA 3KJFB 4ZCMA 2DHXA 2HIQA 3IS9B 2GJFA 3EVWA 5H1SV 3PW4A 3MFIA 2EG1A 1BXNA 1ELOA 2ZDOA 2COLA 3Q0AA 2WTFA 1KHVA 4ZIVA 2XO6A 3KUGA 4I7FB 1RT2A 3R8YA 2J5AA 1AZSA 4J7CA 1AUSL 1UW4A 5D4LA 2AT1B 2OTLS 4F8RA 3VAGA 4WZQA 1C0UA 3Q86A 3JS9A 4ZOSA 4NI2B 3KK1B 1NKCA 2HHWA 4DPUA 3PYDA 1SJ3P 1I5OB 4DL7A 2RRAA 1UZHA 4C8ZA 2DHHA 2RH3A 2FZGB 4OMFG 3WZ0A 2GZOA 2HBYB 2OI2A 1M5HA 4OI3A 1VQNS 1QE1A 3M2RB 3HMJG 2IRXA 1NK5A 2V8HA 1TKZB 2CRLA 2D9OA 2JL9A 1OYDA 4KBIA 4K4ZA 4IRDA 1FKPA 3TX0A 1YBAA 1ZA1B 2DO0A 2F7VA 2VG7B 2EG2A 1CJKA 2YQ1A 3QO9A 2UV8A 3D3BJ 1N8RT 3CPWR 1WOSA 1VRQC 3UW1A 3RU0A 4J90A 3LP1B 3PW2A 4USVA 3P5TL 1TMJA 4H4OA 2QA2A 2UUCF 1FJGJ 3MEDB 1CJUB 3G82A 3CCES 2FLLA 1IR2A 4F3OA 3LPYA 3W3SA 2XYHB 2E1RA 4FNIA 1JLCA 4RWXA 4KHRA 4TYAA 1S9GA 4LFAJ 3PVXA 1VRUB 4DS5A 2RU3A 2B4OA 2V4RA 2KHCA 2HURA 2Z2ZA 1OS5A 2CQ0A 4KB7A 1TV6A 3SEOA 4HHUA 2E5IA 2VG6A 1T9UA 1BWVA 3K8WA 2UXCF 2CQBA 1WEZA 1HKAA 4FYWB 4A8KA 1QAXA 4WE1A 4NYOA 4FF2A 2CQDA 1FWKA 3SFUA 5E5NA 5KT3A 3OT9A 4RLEA 1S7HA 2LDIA 3W2WA 3SCLE 1UL3A 3BDPA 3MAAA 4NLXA 2B5JA 2QLXA 3SV4A 2A1BA 1JLAB 2IRYA 2BE2B 2KJVA 3TX8A 4CYUB 2G1HA 3G8QA 3K5OA 1RACB 7AT1B 3AFGA 2A2CA 2H4YB 1C4CA 3T1HF 1Q95G 1TKTB 4DUZF 2YWHA 3KK2A 1PC4A 3ILOA 4GKJJ 4URSA 1MN9A 1HR0F 4DUYJ 2R4FA 2DBBA 1AYEA 3WHIA 1TK5A 1ZS6A 2NXEA 4LR8A 2MLZA 2WB1D 3JSMB 5AXKA 4ZLPA 1SC4B 1E6YB 1LWEA 4JI6J 1QUVA 3CCVS 1KNZA 4WPAA 3MCNA 2PC6A 1BMQB 5GADU 2W7OA 2YWFA 2UUAF 3OFGA 1Y10A 3VVTA 1BHNA 2ZH5A 1U6ZA 2OEKA 3VWSA 2Z2LA 2N3LA 4J9QA 3M6UA 2R2SA 2VPYB 2R2RA 4QYZK 2IDLA 3TAPA 1F60B 1AT1B 1R0CB 3TZYA 1S4EA 2XHWA 3ISZA 1HL6A 2MXYA 1CJVB 4JI3F 2HZCA 3R7BB 2KJWA 1N0UA 1X60A 5KG4A 4ED4A 4PXDA 4N47A 1RBOB 4MTPA 4DCJB 4DOZA 1BQNA 2G0JA 2RKIB 1NNDA 3PNIA 3R5JB 3RZAA 1SB6A 3KK3A 3RB4A 4WFZA 3MMCB 2ACMA 1Y00A 2ZKUA 2LEBA 4JYAJ 1FJCA 1RA6A 4AE5A 4NA3A 4G1QB 3TA1A 2K3IA 4M63A 1IN0A 2IVMA 4KRWA 3KLEA 5E3RA 1T3NA 2AWZA 3V6JA 3G87A 3AOAA 2MHNA 4PABA 3CDAA 2IMOA 1HBUB 4MT1A 5CH7B 4NZ7A 5B7WA 3C15A 5HLFB 4HH1A 4ZP7A 1SKUB 1VJWA 4DFJA 2LQ9A 4G6VB 2C3OA 3IMQJ 2B0GA 1H73A 4OZ2A 2XMJA 5FLXY 4LSLB 2XS2A 2KRBA 1X0FA 1JWWA 2NCKL 2FB0A 3T3FA 1JMTA 1RAHB 4LQ9A 2J9EA 2RF2B 3H42A 1FX2A 5KFJA 3O5TB 3RW7A 3U1LA 3M4XA 4KGVB 2G13A 2MLYA 3I6PA 2MMYA 2W8LA 4OZNA 1FESA 3NXZA 4RJVA 2VF3A 3MM8A 4ZLLA 3C6UA 3UD3P 4NLUA 2B6AA 4KV8B 2O5DA 2ADCA 2NUUG 2YKMB 2W8KA 2VUGA 2E7XA 2B56A 1U47A 2PA3A 4DUTA 4U67Q 3T1AA 2V8GA 3LTOA 2R7OA 4ZVSB 3HM9A 4YDDB 2VBZA 5CQGA 3HD1A 1PILA 4UTGA 4DPTA 3OR1A 3RRKA 1R43A 1VQMS 1KONA 1SI9A 3ZNJ1 2Y0SD 3BSAA 3ZZRA 2DEJA 1RTHB 4LF7J 3TAMB 3RBEA 3KJQB 4RUAA 3R5BA 2ZH8A 4FS2A 1MU2B 2B9WA 1TL1B 3M30A 3ZZUA 4GKKJ 2X1AA 3DC2A 2R8IA 2FJVA 2DITA 4NRTA 2GMLA 2DNRA 2ZDPA 1JLQB 1QAYA 1YGYA 3I55S 2UU9F 4DX5A 2AEJA 5KFXA 2PI5A 1DZ5A 2RQKA 4UOGA 2C2NA 1T94A 2K7JA 3KG1A 2FZCB 5IM0B 3SSRA 2A0FB 4Y2CA 5KOWA 3TW0A 1Y5LB 2FHJA 5GAHU 4NXMF 3IAS9 3Q2TC 3TOQA 2ZZMA 2MHEA 4W98A 3PRVA 1NJWA 1GT8A 3W8PA 4ZHRB 4X4SA 3VAMA 2F5GA 2IDEA 2SXLA 2HHHF 1LW0B 1HWKA 3DM2A 4J9RA 2IA0A 1Q8BA 3UD5A 3CJ3A 1WHVA 4JV5F 3PZPA 3SZ2A 2LXIA 3QJLA 2XO7A 1LK5A 1RADB 2MKIA 2KL8A 4UOCA 2JC0A 2QLJB 2YVSA 4X4PA 5KT2A 3PR4A 3KUHA 2M70A 3UWTA 1TL3A 1OIAA 1X4CA 3MHYA 4X4TA 1WHXA 2QT7A 2MQQA 5D15A 1R0AB 4ZP9A 2BW7A 3R97A 3BPSP 1M1GA 5F3ZA 4F25A 1RTDB 1R6YA 2C3MA 5KFEA 2DR6A 4LSNB 3C19A 4G65A 4X4QA 3CEDA 2Y1RI 1KC8T 4L6V3 3PKYA 2ZWOA 3UPFA 2HFZA 1ZM4A 1WACA 4EYIB 1RP5A 3QQCD 2E9TA 1GQEA 1WKLA 2DIUA 2V69A 1FRXA 4F0MA 1S0OA 4NCBA 3DFEA 4KHMA 3DLHA 1WC4A 4F3QA 2GO9A 1FO1A 1XWLA 3VGTA 4EMDA 1QAIA 1FTCA 2IIHA 4FS1A 1VRTB 4O23A 2HIYA 2MQMA 4DL4A 2OPQB 1W2IA 1C1BB 4RNHA 4LRBA 3RRGA 3FRZA 4U7UD 4CLLA 2UXCJ 4I2PB 3W9JA 3PIOQ 1T02A 1LWCA 2HRUA 3QAEA 5KG1A 5J1EA 2AV5A 3HHLA 3MOZA 2RUGA 3W5XA 2IYGA 4YB1P 3F56A 1UKUA 2BR0A 2IC3A 3ITHB 2DR9A 4K4SA 4ITSA 5KT7A 3MDFA 4WYWA 4OZJA 1FE0A 1CBKA 4E8UA 3KMQA 1EKSA 3T9ZA 2VPWB 4YOEA 4XK8C 5CYQB 3FCHA 1FK9B 1TK8A 1S1UB 1RHJB 3MPYA 3UDVA 5A8WB 4Y0FA 3B54A 2VBWA 3T1HJ 1DTTB 4UOFA 3LGNA 2I38A 4NLTA 1VQ8S 1KFDA 3FUYA 4FVCA 1FD8A 4RW9A 2XG8A 2AYEA 4GC6A 4DSFA 4MIBA 1RAFB 1HR0J 5DDRC 3RB6A 3G71S 4J9MA 5DJBA 3J80Y 3AB2B 1W26A 3VQTA 3GU0A 1RU2A 2MJNA 3KKFA 1G1XA 4USJC 1XNRJ 4OZ5A 2IAJB 4ELVA 3NWGA 4OYBA 4BWMA 2AF6A 4TQSA 2UUAJ 2GIRA 1N52B 1RK8A 4DF8A 4Y2IA 3AOBA 5CYMB 4YN3B 1MROB 3ENWA 1VQLS 2ZD1B 3RYLA 1DFDA 2HS3A 3D1HA 3CJSA 2UXDF 1LQ9A 2DNOA 2GVZB 3C6TB 3A8KA 1PSDA 4JI3J 1NRKA 1XK8A 3BN7A 2EK6A 3CCTA 1WSVA 4UQGA 1A7GE 4DSKA 4Y2MA 3OTBA 1Q1KA 4EYHB 2GAHC 1NSAA 4HLBA 5HQ8A 4P73A 3ZZZA 4KGXB 1RCXB 4KHPJ 5F8MA 4F7VA 3BYRA 5HMZA 3D6TB 4DV2F 1HBNA 4OIXA 1UAWA 2DRDA 4R8UA 4UY85 3DLGA 2FHMA 4PG5A 4M8LA 3NGRA 1XJWB 1KQSR 3DYAA 4UW2A 5F8NA 2FPHX 3RR7A 4M5MA 1P1TA 3H0PA 1SKSA 2J6TA 2I5JB 4DF4A 3R3TA 3ETMA 1IJEB 3NGSA 2R2TA 2MQNA 2ZOMA 4DR1F 4FN5A 5D3GA 3EGZA 4F0HA 4AXIA 3T5JA 2R3VA 2RHQB 1I3OB 4P10A 1UMJA 1RLDA 2LU1A 3SQGA 1WC5A 2OLWA 1BQXA 2AD9A 3PX6A 4AD6A 1Q86T 3OJSA 1TELA 3G2XA 4LMZA 2RUSA 1DURA 3ENQA 4I4BA 3M8SA 3A3PB 4IRKA 1NB7A 3M7VA 4X65J 4B3OA 5DRKA 4F02A 4DLGA 2GV1A 3GG1A 1QTMA 3MXHP 4TNOA 5BR8J 1FVQA 3UNGC 3M2UB 4LFCJ 1B0VA 5HQLA 3ZZYA 1X5SA 1Q53A 4IDKB 4PPZA 2RIJA 5DDQC 5KG7A 4XTTA 3DRRB 5G4DA 2XNQA 4C6AA 3V6DA 4V1Ak 1UVMA 1OY6A 2W9CB 4JP8A 3E01A 1C1CB 4IKAA 3OUYA 3G8TA 3EZOA 1GMWD 3IG1B 1X4BA 5HROB 4CM0A 2AEFA 4X4OA 3V4IA 2X1GA 2YNFA 1ZM3A 1SV5B 3QRPA 2FIUA 1FWPA 3K5MA 2XGPA 5KFNA 4DV0F 3L09A 2YNIB 2BE9B 3B82A 4CLSA 1FNOA 4HTIA 3H4DA 2G1DA 3AT1B 2ZH2A 3NMAA 1Z2LA 2DCLA 1WORA 2I0XA 2XI3A 4PKDB 4X84A 4PWWA 3BSOA 2UU9J 3IM8A 1T05B 4A8FA 1EJ7L 2DNPA 2CWKA 3SDEA 1KKHA 2PGCA 2DNLA 3CC2S 2Q6BA 1BUXA 1U1OA 3BSNA 1R8AA 3BR9A 3LOUA 3US5A 2VA3A 1EHWA 2XBPA 3M8QB 1XMQF 3C3LA 4A8WA 3MMAB 5A0YA 2UXBF 4EFAC 1VCTA 2B4PA 3IBCB 1X4AA 2MGZB 4CH0S 3KHRA 2HHHJ 2OSRA 2CQCA 3DU6A 4AXJA 1VC0A 2CWXA 7FDRA 2VOOA 2H5JB 3N79A 3BO3A 5E3CA 1S97A 4F4XA 2YNHA 4JV5J 1DQ8A 1DQ9A 3X3UA 2BX6A 2PEHA 4DL5A 2I8EA 3HHLD 1HHQA 3D67A 4BC7A 1K44A 1O51A 3BQ1A 1SIZA 1FA0A 3GWCA 3W66A 4D3HA 1F9FA 4ED0A 5C25A 2D7SA 3HVTA 2RMLA 4OZ3A 2UVWA 4KE5A 4E2FB 5KFRA 1HFEL 5DDPC 4C48A 3MMBA 2HHQA 1HQ2A 4CO2A 4CLKA 5ETLA 2M3DA 3JAMU 5EWFA 4R5PA 3FVYA 3IR6B 4Z2XA 1N5YB 5KFWA 5LOQA 3PHTA 2C2DA 2BVZA 4C8OA 1LW2A 1H6KX 4DSJA 3GSDA 1V3ZA 2AW0A 4MKBA 1HNVA 5GMEA 2YH1A 3TNVA 4TU8A 1S9FA 3MECA 1PJ7A 2CNLB 5IXUA 2YKNA 4PZVA 4CM2A 2FZKB 3IAM9 2G2ZA 2XHCA 1ZZFA 1BLUA 1O5JA 2CPZA 3HULA 1K8AT 2XZDB 2KVQE 3HXMA 2JJ4D 1WC3A 4ZP8A 3LAKA 3PXGa 5A76A 5L9NA 3TVZA 1QVGR 5IT0A 3QT8A 4DLEA 2EPIA 1TL7B 5ETKA 2JLGA 3OLBA 1FXDA 5B0BA 4CLUA 4PYAA 2Q1LA 4B3TF 3T6JA 3MMJA 4DR7F 1RHQB 4BCAA 3ILIA 4C2MA 3NS5A 1WG4A 3BM7A 3ILLA 4USMA 2I2YA 1IKXB 4QIGA 1Q81T 4EBCA 1FJ7A 4FNHA 1VQSA 1XN9A 5I4MA 1LXJA 3ZZTA 2DNGA 1MMDA 3IBFB 2OMLA 2XS5A 1RT2B 1SC1B 3N9UC 1AZSB 4DSLA 2BACA 4AUKA 2RAQA 1C0UB 3QJPA 3OFFA 4IRCA 1IM6A 1NPRA 3Q83A 2BM0A 3H2VE 3FEZA 2NLWA 2W2PP 1TMMA 2JDJA 2B9EA 2ZBQA 5KFMA 2FLPA 3PFEA 2DH9A 2DIVA 4M95A 3TO8A 2VASA 2W2QP 2GX8A 2MKHA 4OV6A 3MI7X 2IRUA 1XR7A 2ZOFA 2W4CA 2XY7A 3MD3A 4KKOB 2UXDJ 1K9MT 1G4CA 4Y6IA 1NJIT 2NS1B 4LRFA 2M7SA 3OW2R 1UJ4A 1FKPB 4ECZA 4USIA 2RS8A 1VQ7S 1GK8A 4RUHA 4DCOB 1RWNB 2FD2A 2G9OA 4ANDA 3OHAA 1YZ6A 3HT3A 4Q2LA 4O4GA 4EUVA 2CPYA 3MGJA 1S1TA 3V6KA 1FRMA 4P71A 4YY3F 2PFFB 4H4OB 4ZJQA 2YPYA 3E2EA 2OKQA 1XR5A 5FIIA 3KNGA 3KFWX 3KLVA 1VDHA 2V8DA 1JLCB 1R8HA 2V2KA 5AE3A 4H4MA 4JI8F 1S9GB 4M5GA 2DRAA 2M8HA 2W4DA 2XLJA 3NLCA 3MCSA 4BS2A 1WD6A 3AQPA 5JVHQ 1CULA 2HQCA 1N34F 3GILA 1TV6B 2ZHOA 4IUFA 2X3DA 1U1RA 4TY8A 7FD1A 2VG6B 3NCQA 4DV3F 4IQMA 1Z1ZA 2DNKA 1PC5A 3DLJA 4HI2A 3LGHA 2B9XA 4YQWA 1OWXA 3W62A 3JTPA 5KFZA 1SJ1A 4WE1B 4FVMA 4OYMA 1IJFB 2OD6A 2EFVA 5J2QA 4ED6A 1WF2A 3CDUA 4IG3A 2GVDA 2DGOA 3W2WB 3MAAB 3AJ1A 3OXGA 2B5JB 3AJDA 4QW8A 4LF1A 1Y5IB 2E5HA 2D3UA 1RWOB 4B3RF 5KFPA 2VH7A 2W2OP 8AT1B 2XQCA 2Z4PA 3LP2A 3ZTPA 1RT6A 3I87A 2FVQA 3MPDA 1FJEB 2DVIA 1HBOA 1YIJS 1XMOF 1UW9A 2FTRA 2B7BB 3H2UB 3Q22A 5KFQA 4JV2A 4CO3A 4DSEA 5A6PA 3HJVA 3GJTB 4PWDA 2GHPA 3I5AA 2O01C 2Y1IA 2KFZA 2VIHA 3SSSA 4F0KA 3DDNA 3K2YA 2FVSA 2E5LF 3MUMP 1UFLA 1LWEB 5J2PB 3KUEA 1M1HA 4HVZA 1UVJA 1KRPA 1M5KC 1K73T 4WBFA 3VGSA 5I42A 2VG5A 3CMAS 3A12A 3J81j 5AJ3F 2E9RX 3BO2A 3OR2B 1N5QA 3FSIA 2CQPA 3NOCA 1AUDA 3DDKA 4O4RA 4DV4F 4AT1B 2KN4A 4HYKA 4P7VA 4I67A 1BQNB 3RTVA 3H2LA 4ER8A 2AYMA 2V67A 3KOAA 5KFVA 1HYSA 6FDRA 2GC8A 4WP8A 4QWDA 3LUYA 4S0MA 1N33J 4LT6A 2R8HA 4CLYA 2CVEA 2LKZA 2FJXA 2UXBJ 1TZ0A 1RTZA 2XMWA 5KFUA 3KLEB 2E5GA 3CCRS 4ECUA 3S1TA 2BRKA 2GMJA 4P2XA 4USTA 4LSZB 3UFCX 2HKEA 3D6FB 1ZAWA 3PJ9A 1LK7A 2XY6A 3OTOF 3LANA 1NHVA 3J7YI 4KSEB 5DQHA 3RRHA 2QEXS 1TFWA 2R8JA 2L9NA 3HPOA 4F4ZA 3P6YC 1HQEA 2VDIA 2DR7A 2I6WA 3RGIA 1T03A 5F8IA 2CPIA 2ZZNA 4O3PA 4DZDA 4CTAA 4RUCA 3CJRA 5G0RA 3MR6A 3C2PA 1IKYA 1RTJB 2POKA 3FBCA 4USUA 1U02A 2N4DA 2WAQD 5CABA 2ATLA 2HFUA 1SH2A 3A13A 3WC0A 1LV5A 5KT4A 3S01A 3FGVA 2VDHA 4RNOA 3J7ZT 3K59A 3U02A 3ONQA 2V2QA 3QLHB 4NMXA 3HVWA 4K8RA 2KO1A 1JLBA 1YRUA 2A18A 3MPWA 3EE3A 2VQFF 1UZDA 5GAHI 1F1BB 5MAOA 1TU0B 1NCLA 5CYJA 3UE2A 2DCUB 1FNXH 5DM7Q 4RO0A 1U1LA 1WELA 3OR1B 1LOUA 3M1VA 4CO1A 2AZ1A 5HAOA 1HQUB 4HT5A 4JI4F 1S9EA 4K4WA 3EWGA 5EN1A 3QGPA 1B7FA 4L72B 5KG3A 1B64A 4OYZA 3JQJA 4DL3A 3M30B 4TYBA 2UVRA 1F6TA 2YX4A 1HBMA 3VHQA 3HVAA 1D3WA 3FBEA 1RAJA 2FJDB 2AJQA 4HACB 4DR7J 2I1RA 2MQLA 4HL9A 2CJKA 4I6WA 4MKAA 2WSCC 4N56A 4I69A 4ED3A 2KTQA 2Q66A 1QM9A 3W61A 2NQPA 2GNKA 6AT1B 2X7IA 1VQPS 1UVNA 4FZVA 2DXDA 1H98A 3SXLA 3FMWA 4JOUA 4K4YA 3NRBA 4NXNJ 3CVKA 1OMSA 3D54A 3D66A 3ETOA 1LFPA 3HD2A 4DX7A 4ED5A 3H25A 2BUNA 3M8PA 1N54B 2BKPA 1HNXJ 1HA1A 5ETMA 4KTQA 2VBXA 4ED7A 3V81A 4IOAQ 4FYVB 2VONA 3I82A 3GZ7A 4ED2A 1S6OA 4QCLA 5KFDA 1M1KT 2FJEB 4P72A 3TP2A 2D74B 5DDOC 1VBKA 3M2VA 4B9TA 3NBPA 2Y9HA 2HMIB 4QJVA 3IRXA 2Z30B 2HFVA 1TK0A 1RT7A 3G4SS 1H7WA 3OL8A 2JX2A 4F50A 2C1EB 2QL9B 4RKUC 2WSFC 4CLTA 2ILYA 4DQQA 3BGUA 3P8BB 2D1CA 2R7TA 2CNNB 1QLNA 2Y0BB 5A8KA 2M9KA 1S6UA 4F36A 3GFXA 2MQPA 4WYLA 4YY3J 1SKRA 2A3JA 4PQUA 3O44A 1NK0A 2LYVA 2HVZA 4PG7A 2ATCB 4HH0A 4NEYA 4QOTA 4IO1A 2OPSB 4QWCA 1RWPB 4MYUA 3RG6A 1CS4A 4OX7A 3M6VA 5D0HA 2DNNA 3AQOA 3SI8A 4K2XA 2HBZB 2CQ3A 2RT3A 5CAAA 1WKKA 3OQ2A 3AAWB 1N34J 3H7HB 4RW4B 3QZ7A 3Q8UA 2AX0A 3DRSA 3OL6A 2LEPA 4DV3J 1Y11A 2OP5A 1LWCB 2LA6A 3PX0A 3QWUA 3DOMB 4WK1A 2HNYA 4ZITA 2KG0A 2FY1A 1S6PA 4UQTA 1OPIA 3QIDA 1HMVA 2IC3B 2YWGA 1VJQA 1P1LA 1XNQF 3IM9A 2QFIA 5H9FK 4NCAA 2HHXA 4B3RJ 4ZVRB 3HKWA 2VZ9A 3OV7A 1RT5A 3ET6A 3VAIA 4QR1A 3N01A 2OH2A 2GJIA 3GG0A 4J9OA 2LVWA 3B4MA 4DG1B 4B08A 2QC3A 1XMOJ 2NXUA 4ERDA 4YB5A 1V3SA 1IBLF 2BXJA 5IV4A 3CUNA 3T6BA 1N36J 2MKJA 1S1XA 5GAGI 3Q8PB 4RNMA 5KFCA 1U24A 3KLIA 4CDIA 2BJ1A 1O0PA 1NZ8A 2GIQA 1E6VA 4D3GA 4KO0A 5GMKa 4KT0C 5K9FA 2E5LJ 1WC0A 2WK4A 4DL2A 3GIIA 5M2UA 1ZA2B 2QGFB 3CD6S 2H5IB 2NYHA 4A46A 3I32A 4OI6A 4P74A 3CD0A 3HK2A 3CJ4A 3FRYA 3JTOA 4IYQA 5ETNA 4ZS6A 2Z2YB 4LIWA 2J6SA 2CIMA 1ICEB 3SCKE 3BB5A 2CPFA 4LR7A 2VKRA 4X4NA 4JI1F 1RA7A 1S1VA 3PCOB 3BEGB 4ZKAA 3OJUA 4DV4J 3P5BP 3MUTP 3AB4B 3LAMA 3R7SB 2CZ9A 4EGLA 1UPPA 3VTIA 3IFEA 1SUQB 1HBNB 4JI5F 1NSKL 4IFYB 4R8UB 3MF5A 4PCQA 5J1PA 2KDOA 4LVOP 4NL5A 1Q5YA 4OQJA 4GVBA 1RT1A 4K4VA 1XBWA 4ANCA 1DLOA 5D0RA 3ISND 2DXEA 1J5OA 3NGDA 1EP4A 3PX4A 3ZTQA 1TUVA 1RU1A 4WWSA 3NGUA 2W1BA 3GTYX 4I6YA 3VV2B 1QDUB 5B0AA 1YZ7A 2DHSA 5D3GB 1L3TA 1A0OB 4ES1A 1CVJA 2HW3A 1P9YA 4U8VA 2G2YA 3DXSX 1RHKB 2BBEA 4XAKA 3SQGB 4YB6A 2MB0B 3LALA 3IBWA 4BLGA 3BDEA 4C3LA 2MZTA 3NAHA 1A9NB 1SH0A 2C2ZB 1XERA 2YKQA 2HGLA 1MW7A 2Z2MA 1KOOA 3LO3A 3UR0A 1KBRA 1J27A 3I5BA 4YEAA 4Q45A 2M52A 4RBUA 3N5BA 3KLFB 2EK1A 1T9VA 4C3KA 3R5CA 5LM7E 4Q0BA 1S1WB 2IJFA 3FEXB 4HKQA 1ZAXA 3CCZA 3JSYA 2JZ5A 3I0SA 2VJVA 4I56A 2Z0GA 4Q43A 3V6DB 1HD1A 5D4NA 2DKOB 3DLEA 5L1KA 3DLLQ 1QD1A 3E01B 3CDWA 1KVKA 2DR8A 4OYAA 1ULRA 1BY9A 4HI1A 2ACYA 3CCJS 4KH1B 1WDDA 2E1MC 3W7BA 3EICA 1HD0A 2QZ8A 3UN3A 4B9SA 4EO8A 1ZTTA 5IT9U 5A6WA 4IH6A 3EMTA 3V4IB 2YNFB 1D8YA 4UUWA 3GLJA 3CNQP 2PN6A 4JI4J 2XZWA 4ZPBA 4DR6F 2UP1A 2VPXB 2R2UA 3QMQA 3UVJB 4B9UA 2FGCA 4X62F 4WKYA 1ITPA 3CIZA 3IS9A 4RUBA 2RJZA 1YX2A 1SC3B 2XMTA 2Y1JA 2GAGC 3W1YC 5HBMA 3DLKB 1IWGA 1WOPA 4CH1A 3GV5B 4WXWA 4A8XA 3QFHA 4RL1A 1Y3KA 3RB0A 4FXDA 2C2EA 1UWBB 1S0NA 2DYAA 3K57A 4HTJA 5KAKA 2MKYA 3KK1A 2LECA 5FDLA 1JKHB 4K5SA 4BWJA 3MM6A 2K3KA 1G7CB 1NHUA 1SJFA 4PQAA 3VR1A 1IBMF 2XB2D 4FDFA 2LQ8A 1B70B 2AQ4A 4ZPDA 1D0EA 3CJQA 2DHAA 4NLSA 1U1NA 4OYPA 5AE1A 3AOCA 1RISA 2EI5A 4K2JA 1Q8KA 1YQHA 2VG7A 1N0VC 2F63A 4Z7CA 3R2DJ 2C2KB 3CDBA 1LXNA 2PDAA 1OPZA 4AL5A 3TUPA 1N6QA 3D0GE 3LP1A 1IM4A 2M8DB 2XULA 1NK7A 1AW0A 3CW2C 3MEDA 1G2EA 1CJUA 1H2TZ 5CCMA 4OYXA 4Y2KA 3VZHA 4QQBA 2GQ2A 4I1TA 4LRDA 3HVTB 3CO9A 2GHVC 1X0PA 3MMBB 4ZVTB 3G6XA 3SQOP 4AQYF 3LWMA 4C97A 3P49B 3A3NB 3QYYA 3D0IE 4J9UE 1TAUA 2QTWA 4R5PB 1N5TA 2G2OA 4C7QA 4CP5A 3OSNA 2QL5B 2KU7A 2BOAA 2UUWA 1HNVB 4ES2A 2NYIA 3K8VA 4LBPA 3PRBA 3MECB 2L3MA 1EETA 3J81Y 1URRA 3N28A 1RWKB 4RU2A 1H72C 1VK3A 2HGNA 1VS3A 2ZBRA 4DR2F 4X4VA 2VQEF 3DRPB 3TANA 2K1RA 4ZMMA 2XSJB 4A4JA 3QAUA 3PY8A 2DGWA 2MKCA 2BJDA 2IM3A 3IRWP 2DGVA 2ZM6F 5B0CA 2AU0A 2X3GA 4LREA 3I0RA 3UQSA 1DTQB 1S76D 3W8GA 1AROP 1TKTA 1QUPA 1XNQJ 3OXFA 2J9CA 3R1LA 3RAXA 4NYZA 1LWFA 1SL0A 3QATA 3GYXB 5KFTA 1WUUA 3L3CA 1U1KA 2YY3A 4ID5B 3TVKA 3LP0B 4L3NA 3MR3A 1HI8A 4OFZA 2HZVA 4NMLA 4MIWA 3HHKA 2HWIA 3FK4A 1X4FA 4A8SA 1IBLJ 2JEGA 2WONA 2IHR1 3AHPA 3EUNA 1FFSB 3Q89A 1X9WA 1T95A 3DLBA 1MWYA 5KFLA 2AIRB 4X4RA 3EXCX 1LKZA 4PUOA 2RDDA 5A2QY 1V5IB 1CJVA 4OI1A 2ZUGA 1OO0B 1U45A 1CLFA 5KFIA 1JLFB 2IY5B 2RKIA 5F8GA 4R25A 3TQ1A 3HZEA 2YX7A 4F4WA 1FDBA 2BMBA 3MMCA 1OQ3A 5KG2A 3NGKA 2HWTA 1UTAA 2KKHA 2HHUA 2HQGA 3H5XA 1AXQA 1VQOS 1GX6A 3KG4A 2W2NP 5J2NA 1FFGB 5L46A 4KGZB 3RB3A 3CO0P 2ZWPA 2V4JB 1WG5A 1HI0P 4KFBB 1FTRA 4JI5J 2M5YA 2EFQA 1HBUA 2ASYA 1REVA 2F3JA 4QPXA 4WIQA 4H4MB 1KTVA 1YJNS 1N4LA 4Q2MA 4B17A 3R5AA 3ADAC 4LSLA 4O44A 4ECVA 2WVCA 5FLXU 4LF5J 2VODA 4WFYA 1YK9A 2ZKTA 2RF2A 3W2VA 3KYLA 5F8LA 4U96A 2RILA 4TY8B 3UI3A 2KT5A 4IFVA 2VC1A 3I4HX 1S10A 1MMNA 4M94A 4F4YA 3MM9B 4HT7A 1N32J 3D0HE 2OELA 3RW6A 1UVLA 3L7UA 1CEZA 2JSXA 2IM2A 5KFAA 5A8RB 4J9LA 1VISA 4Z7YA 1TL4A 2XWXA 1U7LA 1WWHA 4WU2A 2V2VA 4IG3B 2AJ2A 2GVDB 1I51B 3L7PA 1Q79A 3CDEA 1IXKA 1RKIA 4NE9C 1UJ5A 4LVNP 2ZHBA 4NCGB 5HSPA 4JI7F 1SPBP 3LP2B 1T9WA 2OJ3A 2DY9A 3GCWP 2EC0A 2NXCA 3GQCA 5K8OA 1HNIB 2KYZA 4ETXA 1BC6A 2M2BA 4NZ6A 4DR3J 3N6LA 4J9KA 4PAAA 1R0BG 3NP5A 4PWDB 2JVOA 3EJMA 2HFOA 1XTZA 3D7SB 4RZRA 3O8WA 1NKBA 1R8BA 2L48A 5U47A 5KFYA 1U0SA 1HWJA 3GR1A 5LMNF 4AL7A 1TTHB 2KG1A 1B0TA 3GIKA 3FKBA 3T1YF 5DGAA 2ZJQQ 2ZH7A 2JRSA 4U8YA 5I42B 2ZC4A 5L9XA 3VVUA 5I3PA 1WJ9A 1PGZA 2YXLA 3MR2A 3T5LA 2DXFA 1SVDA 2VFRA 5FD1A 3MAHA 1F9HA 1AFJA 5IWAF 4ZHRA 4X64F 1J5EJ 3HHEA 3O2IA 3TARA 3KLGB 1Q7LB 5F3TA 1K0TA 3W60A 4NZ0A 2HEKA 1HNWF 2BJ7A 2HVHA 2RD5C 2YBVA 1R6VA 2FLNA 1IBMJ 2HVEA 1L3KA 1NEEA 2O67A 5GMDA 3MR5A 3BF4A 2AJFE 1FVSA 4OV1A 1RWVB 1F2HA 4QW9A 5K8NA 1LFWA 2G0IA 3MM7A 2OFGX 2W9BB 3MFHA 1YJTA 1H3DA 3U27A 1VR6A 3UCZP 3IN5A 2DO4A 2DH7A 4TLQA 1B4SA 3PRDA 3KJVB 4FPIA 1SQGA 1HQEB 4OJ3A 4F4AA 2XMVA 3N6NA 4K50A 2NPFA 1UETA 2ZH4A 4MK7A 5C24A 2YKOA 1T03B 3FNNA 5KFHA 1YKWA 1SKWA 3DN9A 3R2CJ 4CTAB 5DG7A 4E0DA 5CZXA 3C14B 2AYGA 4K4XA 2Q3PA 1REGX 4AQYJ 3GPAA 3D6HB 3FEYB 4DXLA 1QAJA 2V0NA 2HNZA 4P9SA 3SCIE 1VRTA 1ZM2A 2H48B 3BSCA 3AA8A 2IFXA 2A10A 2D3ZA 4I2PA 2B51A 3VAKA 2ZE2A 4ECSA 3MPUB 2RHSB 3TA2A 1Z2ZA 3T19A 5ETVA 3D6MB 3U1MA 2L08A 2WOMB 3WX8A 4A8MP 3ITHA 5C2GA 3MTKA 2DR5A 4WFBQ 1MWZA 4RW6B 3QGGA 2XMMA 2VFUA 1SL1A 3M1VB 3DKDA 3J7YU 1TKXA 4YR0A 3V5RA 1S9EB 5BJRA 1HWUA 4WKRA 3J7A1 2ZM6J 3BH6B 5T41A 1FK9A 1S1UA 4L76A 1BE4A 2DTJA 4NLQA 1DTTA 3SMZA 3IWLA 3SIPB 5D6GA 4JUZA 2JNJA 5DZ6A 2BEFA 5EHHA 1SL2A 1OQ6A 2W7PA 1D8ZA 3THVA 4ILLA 2P9EA 4OHVA 4YDXA 2CXEA 2GGPB 2HHPA 3G8SA 3J80U 4A48A 3M8RA 2R7UA 1I1GA 4M5KA 2GQCA 4K0KF 2AGOA 2MEWA 2QRRA 1JIHA 3TAQA 2E7VA 4CZCA 5ETTA 1FT8A 2VFTA 5BYSA 2J0SD 4KGMA 4L74A 3EPGA 3R27A 3CTRA 1QJHA 1MROA 1R31A 2P2CB 1YG0A 1B99A 1IWAA 3M8PB 2MZSA 5EGYA 4B3SF 2HRYA 4DCPB 1SH3A 3C6TA 4C8LA 4NASA 3V81B 4M5JA 4MAKA 4DQSA 3DI6A 1K47A 2J0XA 3GCXP 1GMWA 4RNFA 2ZFHA 3C16B 4DMZA 4CLZA 2F9JA 3F44A 1WKJA 2C2OB 5IFMA 2Q6CA 3BBBA 1OSCA 3IRXB 2EVZA 3I4PA 5JMNA 1T9TA 1FJGF 2MYFA 3H5SA 1RT7B 2BZ2A 1FEEA 4ECWA 1FD2A 3Q8VA 4WP9A 2HG4A 4O0IA 3R1HA 1F3FA 3MR7A 1U4BA 5JXSA 3LF0A 5KOXA 3PW0A 4ED1A 4Y2AA 4XDDA 1WEYA 3N4WA 5A8KB 3L95X 4LF4F 1IKWA 3CIMA 2FQQB 5LT5A 3PM9A 4OHXA 1FRHA 3FZBA 2I5JA 4PQUB 2LXUA 1UEKA 1VQYA 2J0QD 4IR1A 2GMHA 1FHTA 3HO1A 4OI0A 4N8OA 4IG0A 2IBKA 2UUCJ 1CS4B 4DHVA 4DPWA 5F9NA 1RAAB 4QU6A 1U0HA 1HI1A 4OX8A 2WHOA 1J2VA 2J7UA 1Q0NA 2HVIA 4DDFA 4JV0A 3GIJA 1G3OA 1FKOA 4FP9A 2E66A 2JEIA 2XCPA 1NH8A 3RAQA 2VL1A 4USHA 2EWHA 3DRSB 2J9DA 3DCAA 2F65A 4DJBA 2OPRA 1U49A 4IO9Q 2DRBA 2HNYB 1MWQA 1S6PB 4FYDA 5ITHA 3JQKA 1HMVB 3M2UA 2V50A 2LXFA 5CCLA 3P3DA 4QWEA 3T9NA 3HFZB 2CDQA 2C3UA 3CJ2A 3DRRA 3MEGA 1M0SA 2P6TA 4ZJOA 4JI7J 1FRJA 1YJUA 1BGXT 2QSWA 4NRUA 4DUYF 2KXHA 1RE1B 2H65B 5HJXA 3Q8RB 3ET6B 1C1CA 3NEKA 2HHTA 2E29A 2QL7B 1QY7A 1P8GA 1UPMB 2J76E 2BDPA 5KG5A 4J91A 2ROPA 2ZZTA 1VOMA 3UDCA 4FXWA 3MURP 4ZN3A 4DUZJ 2HSEB 1L5UA 1S1XB 4DL0C 2YWWA 2H1YA 4KYZA 3KLIB 3GIRA 2LP4A 4KO0B 4QZVB 4CNZA 2EFGA 5J2MA 1UCNA 4LRAA 5H9EJ 5LMNJ 3LW5C 1T05A 2EFOA 2CQ2A 2HFNA 1GNKA 1JB0C 1JXEA 4RBVA 1WI6A 1YWXA 3POTA 4XO0A 3OSPA 3KHHA 2HAIA 1MMLA 3G86A 1VQKS 1JLEB 3MEEA 1S1VB 5DG9A 4JYAF 1FXRA 3IXQA 4EK2A 4HDGA 5IQ6A 3TZZA 1VQ4S 2QFJA 4PEOA 5IWAJ 5HANA 4RPFA 4MFBA 1WOOA 2BJ3A 1NSPA 2IPOB 1U09A 1F2GA 2NUHA 2L41A 2WVFA 3GP9A 3MM5A 2XYGB 3UDLA 2JH3A 4ZVGA 3QIPB 5IT4A 1HNWJ 4F26A 2VKZG 1RT1B 1ZAVA 3L9ZA 3BJYA 4R0JA 3THTA 5GAGU 1YBUA 4IR9A 4ZVHA 2YKAA 1H7XA 5LJ3Y 1J5OB 3D4JA 1EP4B 1S5ZA 2F4FA 2HBRB 1C0TB 3GFYA 3R5GA 1N88A 2J8AA 4DN9A 4V19X 1UA0A 5D0EA 2JHEA 2GFFA 4DPXA 5ETRA 1ZH5A 2XY5A 1DHMA 5D77A 3EX7B 1KQKA 2CADA 3NNHA 4UT4A 2RSQA 4ZVUB 4WIIA 4YS2A 3DGPB 4OHYA 4TXSA 3D28A 3GR0A 5IC6B 3CJKA 1HARA 3D2WA 2WVBA 1IQTA 3CSKA 6FD1A 3MZIA 1ZYQA 5HN0A 1GX5A 3R9LA 4ECQA 1EZZB 2DNHA 2ZBPA 4UZBA 2FVRA
chains in the Genus database with same CATH topology
1KR4A 3CJ5A 2AX0A 4FPRA 1P6TA 3DRSA 4ZCLA 3MM8A 1Q4RA 3OL6A 2C42A 2LEPA 3I9ZA 4M5DA 5H9FJ 3C6UA 3H4BA 3UD3P 4Q0BB 1VFJA 2OP5A 3OFHA 1YJRA 2PT0A 1LWCB 2LA6A 4NLUA 2B6AA 3PX0A 3QWUA 5DO2A 4NCGA 4XPEA 4WK1A 2KG0A 2HNYA 4KIAA 4KV8B 2O5DA 2YKNB 4BBYA 3MWBA 2FY1A 1U2FA 1S6PA 2M88A 1OPIA 4UQTA 2NUUG 3KLHB 2PSZA 3QIDA 2ADCA 1IKVB 2YKMB 2W8KA 2CQHA 4FF1A 2VUGA 2E7XA 3I0SB 4GO5X 2BQ3A 1HMVA 2PI4A 2B56A 1U47A 1X4EA 2IC3B 2YWGA 5CZVA 2PA3A 3UD4P 1P1LA 1XNQF 1U26A 1JLAA 2H5EA 4U67Q 2BE2A 5GVQA 5AXNA 3T1AA 2V8GA 1M5VC 2FVPA 2R7OA 1HNIA 1RYSA 4NCAA 4LF7F 3HM9A 4DV7F 4NLRA 2HHXA 3H98A 4YDDB 5KFSA 4K4UA 2NSBA 2VBZA 5CQGA 2YQ3A 3HKWA 3HI9A 1PILA 1JXLA 2VZ9A 4ZCKA 3OV7A 3OR1A 1YVFA 1RT5A 3PFOA 3RRKA 3NCRA 4GKKF 1R43A 5I3UA 1GTEA 3VAIA 4QR1A 1VQMS 3N01A 1KONA 1SI9A 2OH2A 2FJBB 4CO0A 2Y0SD 2GJIA 4Q7AA 3BSAA 3ZZRA 1N36F 1CQNA 3GG0A 1RTHB 4TY9A 2DNYA 4J9OA 2XLKA 4O3OA 2LVWA 3TAMB 3B4MA 3HVRA 2AGPA 4LF9F 1RGVA 3RBEA 1ZBTA 4RUAA 2MSTA 2DNQA 3R5BA 4B08A 4DG1B 2ZH8A 5BYRA 4FS2A 1MU2B 3N6MA 2B9WA 2NXUA 1TL1B 4IOCQ 4ERDA 3M30A 3ZZUA 4YB5A 1V3SA 3MUVP 4TN2A 3J7Z5 2KI2A 2BXJA 1IBLF 3E8OA 3CWJA 2XCAA 3OLAA 3CUNA 4OI2A 2X1AA 2F9DA 4B9LA 3DC2A 2R8IA 2W24A 3T6BA 2FJVA 4I64A 2EFNA 2DITA 4NRTA 2MKJA 4PG6A 2GMLA 1S1XA 1N56A 5GAGI 1T7PA 3Q8PB 2HQ3A 4RNMA 3JSMA 2DNRA 2ZDPA 4I2QB 2LQ5A 1Y5NB 1JLQB 1QAYA 1YGYA 5KFCA 3I55S 1MNEA 1U24A 2MZQA 3KLIA 1E6YA 2UU9F 4RBTA 4DV1F 1O0PA 1VI7A 2X1FA 2GIQA 3SFGA 1E6VA 3VF0B 4KO0A 4D3GA 5KFXA 4KT0C 4QPTA 5GMKa 2PI5A 1DZ5A 5K9FA 2MKKA 2RQKA 4ELUA 2BA9A 1T94A 2WK4A 5HBMB 2K7JA 3KG1A 4DL2A 5KFOA 3GIIA 5IM0B 2PO4A 1HWLA 2JC1A 3BREA 4H4KA 3SSRA 5M2UA 4UY8T 3CD6S 3EGWB 4Y2CA 3EZUA 5KOWA 2C3YA 3F41A 4A46A 3TW0A 1BQMA 1Y5LB 2FHJA 3JTNA 1NJXA 5GAHU 4NXMF 3IAS9 3Q2TC 2C22A 4NLDA 1TR0A 3TOQA 5ADZA 3I32A 3OPKA 1Q8LA 3AY0A 4OI6A 2ZZMA 3MPVA 4RW7B 2MHEA 3CD0A 3HK2A 3CJ4A 3FRYA 3JTOA 4IYQA 2KRRA 5LXYA 4ZS6A 1NJWA 1NJZA 1GT8A 4LIWA 2J6SA 1S6QB 2CIMA 3SCKE 3BB5A 5FDLB 5T14A 2CPFA 2KZMA 2HYIB 3H5UA 4ZHRB 1Q7YT 2VKRA 3MM6B 4X4SA 4JI1F 4X4NA 3VAMA 1RA7A 5DS7A 1S1VA 3TUIC 1Y7PA 5IZHA 2XI2A 2N7YA 2SXLA 3KLGA 3BEGB 4NA1A 5IQQA 2LQBA 3GB0A 1U1PA 4DR5F 4ZKAA 3OJUA 2HHHF 3DMJB 3BQ2A 5LXRA 2FLOA 4WJBA 4PXEA 3H40A 1H2VZ 1SQEA 4KKOA 1LW0B 1HWKA 3I96A 3AB4B 3LAMA 3MUTP 4DX8H 3DM2A 3DRYA 3SSQA 3Q2SC 3BQ0A 3C66A 2ZOGA 4J9RA 1X9MA 4X2BA 4EGLA 2IA0A 3VTIA 1Q8BA 3IFEA 2PA8D 2CKWA 1RT3B 2OPPB 2YH0A 4A8QA 1SUQB 3CJ3A 5L1IA 5CD4H 1WHVA 3AJ2A 3M6XA 1SXLA 3BGRA 2IVFB 4EEYA 4JV5F 4F2SA 1HBNB 3PZPA 2DH8A 2N7CA 4EZ6A 3PW5A 3SZ2A 3TRGA 4JI5F 3AH6A 2MQOA 4IFYB 2LXIA 4R8UB 4G1QA 2XO7A 3MF5A 1FERA 2DNMA 3QJLA 4PCQA 5F8HA 1CQMA 1LK5A 5J1PA 2KDOA 4QR0A 4ZPTR 3CE8A 4LVOP 1KEKA 4NL5A 4KQZA 4OQJA 3CD7A 2MKIA 3K5LA 2GW8A 4O4GB 1RT1A 4UOCA 3EPIA 4K4VA 2CG4A 1DBDA 2JC0A 1N6QB 2EW9A 3CCWA 3I9V9 2BRLA 1XBWA 1GXLA 1S49A 2YVSA 4X4PA 3L7OA 4NLGA 1DLOA 2W9BA 1S1TB 3ISND 4K5RA 5KT2A 3PR4A 1J5OA 3NGDA 2IYIA 1EP4A 2CYYA 1Y9OA 2MDAA 2G4BA 5L39A 3PX4A 2M70A 3UWTA 1TL3A 1TUVA 4LQ3A 1OIAA 5F8JA 2YWKA 1X4CA 1IQZA 3MHYA 3OTCA 4X4TA 5HLFA 4RW8B 4I6YA 1WHXA 2QT7A 2MQQA 3KJVA 1R0AB 4ZP9A 5B0AA 4ICLA 5F3ZA 4F25A 2NSCA 2XS7A 1NU4A 1IBKF 1RTDB 1R6YA 2C3MA 3HHLC 5KFEA 5EDWA 4LSNB 2DHSA 5D3GB 5E0OA 1R8CA 4X4QA 1L3TA 1JLGA 1QSSA 4LJMA 5BYQA 3CEDA 4DL6A 2Y1RI 4ES1A 1KC8T 1CVJA 3OBIA 4L6V3 3PKYA 2HW3A 3UPFA 1ROFA 2HFZA 2AJ4A 1ZM4A 1WACA 4EYIB 3BGLA 1RP5A 4OZ1A 4XPCA 2E9TA 1GQEA 3DXSX 4MKYA 2DIUA 2WRMA 2BBEA 2E1CA 1FRXA 2E1AA 4XAKA 3SQGB 4C11B 4YB6A 1S0OA 4KC5A 3V2UC 2MB0B 2XGQA 3LALA 4NCBA 2VPZB 3DFEA 3IBWA 4KHMA 4B02A 3DLHA 3HP6A 1FF2A 4F3QA 5SUHA 2GO9A 3BDEA 4C3LA 2MZTA 2M0GB 3NAHA 3IC1A 3BN4A 1FO1A 1XWLA 1A9NB 2VD3A 1SH0A 1QAIA 1FTCA 2K7KA 1XERA 2YKQA 2HGLA 1MW7A 1Q8IA 2Z2MA 3OTEA 4FS1A 1H38A 1KOOA 3LO3A 4OJHA 3UR0A 5LSRA 5D8HB 4JV1A 3I5BA 1EETB 1VRTB 4O23A 4YEAA 5J2QB 5AE2A 2MQMA 4DL4A 2OPQB 2AJ0A 1KQFB 1W2IA 1C1BB 4RNHA 2M52A 2E7WA 2CJBA 2QE5A 4RBUA 4Q45A 3OVSA 1JJ4A 3N5BA 3RRGA 3NNCA 3FRZA 3KLFB 2C2RA 2EK1A 2CZ4A 4I2PB 4J5OA 4XIUA 4C3KA 3R5CA 4Q0BA 3PIOQ 1T02A 2FDNA 1S1WB 2KFNA 3EXYA 1LWCA 2IJFA 4ZK7M 2HRUA 3FEXB 2K1RB 3QAEA 4HKQA 1ZAXA 4KV8A 5K5MA 3CCZA 5KG1A 5J1EA 3JSYA 2WOMA 2YKMA 2AV5A 2JZ5A 3HHLA 1S4FA 2ASDA 3I0SA 3MOZA 2RUGA 2XNRA 2IYGA 4I56A 1RT6B 1N5SA 2Z0GA 4YB1P 4RW6A 3F56A 1UKUA 2U1AA 2BR0A 4Q43A 2IC3A 3V6DB 3ITHB 1HD1A 5D4NA 3MOJB 1TP7A 3DLEA 5L1KA 1BWEA 2DR9A 3I0RB 3DLLQ 4K4SA 4ITSA 1B0PA 5KT7A 3MDFA 3E01B 4I68A 3CDWA 4WYWA 4RX6A 5KTQA 3VAFA 4OZJA 3UCGA 4YUDA 2UUTA 2DR8A 1FE0A 2P5VA 1HBOB 1ULRA 1BY9A 4OI4A 4E8UA 3KMQA 3FZ2A 1JX4A 1KSPA 4HI1A 3T9ZA 1O8BA 1U6FA 3E3XA 2ACYA 3KHLA 3CCJS 4PWUA 2VPWB 1LWFB 4O3QA 4XK8C 5CYQB 4YOEA 3PO4A 5M2RA 4JI0F 2E1MC 2FGOA 2DISA 3FCHA 4U9RA 4F67A 3W7BA 2V94A 1FK9B 1HD0A 1TK8A 2QZ8A 1S1UB 2KB2A 2QO3A 4B9SA 4EO8A 1ZTTA 4V19J 4IOBA 5A6WA 1VBYA 4IH6A 3H8YA 1S0MA 3MPYA 1RTHA 3PDNA 4QIVA 5A8WB 5B0GA 4Y0FA 3V4IB 2JEFA 2YNFB 2R9LA 2VBWA 4RNNA 3TAMA 5DG8A 1D8YA 4UUWA 4WU3A 1DTTB 4LF6F 2A2DA 2PN6A 3X1LB 3LGNA 2VC0A 3FMBA 3TUZC 2XZWA 1Z4UA 2I38A 4NX9A 4NLTA 1MU2A 4ZPBA 1RYRA 5K8PA 1KFDA 1VQ8S 4DR6F 3C8YA 4FVCA 4QIFA 3V6HA 1FD8A 4URQU 1TL1A 4RW9A 1VGYA 2BM1A 2XG8A 4TQRA 2UP1A 1XNRF 2CPDA 2AYEA 2VPXB 4GC6A 3QGIA 4DSFA 2R2UA 3QMQA 3E51A 4MIBA 5L8RC 2N3OA 4B9UA 2FGCA 4YR2A 5J2PA 1VIOA 3QWPA 5DDRC 4QYZJ 3RB6A 1VLYA 3G71S 2GGPA 2JLFA 2CPXA 4CI0B 4J9MA 2LQJA 3D1QA 5DJBA 4X62F 3J80Y 3AB2B 2WONB 3VQTA 3ZC4A 4WKYA 3OVAA 4I2QA 3CIZA 1JLQA 2R7QA 2RJZA 3IS9A 4DV5F 2XMTA 1NK8A 2MJNA 3KKFA 1G1XA 2FHKA 2PMZD 2Y1JA 4USJC 2DGTA 4OZ5A 5HBMA 3DLKB 3JB9k 3JSBA 3DOLB 2IAJB 2RE1A 5AXLA 5J1NA 2HQIA 5IM0A 4ELVA 3NWGA 2VG5B 3QGHA 4BWMA 2AF6A 4R0EA 1FXLA 3OR2A 4CH1A 3GV5B 4TQSA 4WXWA 4A8XA 2GIRA 1N52B 2MY8A 4PUOB 2AYBA 4NWBA 1Y3KA 3RB0A 4ID8A 4FXDA 1RK8A 1R27B 2C2EA 1UWBB 2OFHX 1S0NA 3K57A 4DF8A 4Y2IA 4EBDA 4HTJA 3FDSA 2DJWA 4WXOA 1K0VA 5CYMB 1MROB 5KAKA 3ENWA 2RS2A 1R7IA 1VQLS 2PIIA 1S6QA 3KK1A 2LECA 2ZD1B 3RYLA 2X1BA 5FDLA 1JKHB 4CT9A 1DFDA 2HS3A 3D1HA 4K5SA 2KZZA 2UXDF 4BWJA 1LQ9A 2DNOA 3KG0A 3MM6A 3DXBA 4PG4A 2K3KA 2ZBIA 2AX1A 3C6TB 1G7CB 4NLWA 1YHQS 1NK9A 2ILZA 3IWXA 4KHPF 1URNA 2ZJRQ 1ZETA 1NHUA 1PSDA 4PQAA 3VR1A 1SJFA 1IBMF 2DNZA 1H0HB 1Y0HA 5C5JA 2XB2D 1NRKA 1HYSB 4MH8A 2B43A 1XK8A 1U1MA 3BN7A 2AQ4A 3BS9A 4ZPDA 2EK6A 1D0EA 4ILMA 2Q79A 3CCTA 4UQGA 2DHAA 1A7GE 1YJVA 3WBZA 1QE1B 2AGQA 4NLSA 4DSKA 4Y2MA 1LW0A 2RQMA 1Q1KA 3OTBA 4EYHB 1U1NA 1NAQA 4CO4A 5AE1A 2QMWA 4HLBA 5HQ8A 2YNGB 5J2NB 1RISA 3ZZZA 2EI5A 3CCQS 1RT3A 2OPPA 5B0FA 3ZZPA 1YQHA 5F8MA 3EYZA 5HMZA 3K0JA 4DV2F 2VG7A 3TA0A 1HBNA 4OIXA 1N0VC 1UAWA 2LA4A 4UY85 4R8UA 3QO9B 4OZ0A 5HO4A 2IA6A 3DLGA 3PEJA 2FHMA 3CB4A 4JBCA 4PG5A 3CDBA 4PRFA 1LXNA 5KFFA 4M8LA 2PDAA 3VCDA 1V9OA 1FEHA 2AJ1A 1OPZA 4LF8F 4AL5A 5CXTA 1N6QA 3D0GE 1KQSR 1KLMB 1REVB 1T3OA 3LP1A 3DYAA 1X7VA 2R7RA 1H2UX 1IM4A 2UZAA 4UW2A 5F8NA 1P9QC 2HS4A 2M8DB 2XC9A 4NOHA 4A47A 4AYBD 2FPHX 2XULA 3N5FA 1NK7A 1AW0A 3MEDA 1G2EA 4UUXA 2WCXA 4J9PA 1H2TZ 4C3MA 5CCMA 3RR7A 5E41A 4Y2KA 1U25A 4XDCA 1R3NA 4OX9F 3VZHA 3ZFVA 1P1TA 4QQBA 2GQ2A 4LFBF 1SKSA 2J6TA 2I5JB 1R0AA 4I1TA 4O44B 4DF4A 3R3TA 1WHYA 3HVTB 2ZH1A 3CO9A 4KR0B 1IJEB 2JEJA 1VHFA 2MPUA 2GHVC 2MQNA 2ZOMA 2R2TA 1RTDA 4DR1F 4O3RA 4LSNA 2XMUA 4FN5A 1X0PA 5D3GA 3EGZA 3MMBB 2DPIA 3HJFA 1QSLA 3HLUA 3G6XA 2BOPA 3W2VB 4AXIA 1ZPWX 4AQYF 3LWMA 3T5JA 3I31A 4C97A 3PJXA 3P49B 4IFVB 4KPYA 3QYYA 4X65F 3D0IE 4CQ1A 3M9MB 3D1OA 4EWTA 4PXBA 1TAUA 1UMJA 1D9DA 3O1LA 3C46A 2LU1A 2W7AA 3SQGA 4R5PB 4C11A 1L3UA 2CFXA 5G0RB 5AXMA 1RTJA 2OLWA 1BQXA 2AD9A 1N5TA 4C7QA 3PX6A 2HWHA 1Q86T 2ROEA 4E98A 3OSNA 1S99A 3OJSA 1QSYA 1IKYB