1FRJA

Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCIYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Alteration of individual surface charges and the [4FE-4S]2+/+ cluster reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1frjA00
1FRJA 1GTEA 2V2KA 7FD1A 3MMBA 1F5BA 2Y0SD 4RKUC 6FDRA 1C4CA 4XDCA 2PMZD 1SIZA 4YDDB 1FRMA 1FRLA 2FDNA 1FD2A 1JB0C 1PC5A 1Y4ZB 2FGOA 1GT8A 1ROFA 2FJEB 1B0VA 1FRIA 1XERA 1A6LA 4Y28C 1WTFA 5CH7B 2FJDB 1KQFB 3IR7B 1AXQA 2C42A 3EUNA 3EXYA 3OR2A 1BQXA 5E7OB 1FCAA 1FF2A 1GAOA 4KT0C 1DFDA 1HFEL 1Y5LB 2V4JA 2VPYB 3MM5B 1FDAA 1FRKA 1RGVA 5BYSA 2UZAA 1F2GA 2IVFB 2C3MA 1H0HB 6FD1A 3MM8A 1FEHA 2GMHA 3OR1B 2C3PA 1FTCA 2FJAB 3LW5C 1BC6A 1R27B 1Y5IB 2O01C 3C8YA 1DURA 1GTHA 1IQZA 3OR1A 1FDBA 3MMCB 4OMFG 1FDDA 4L6V3 1F5CA 4XDDA 5L8RC 1SIWB 2WSEC 2VKRA 1VJWA 5CHCB 2C3YA 5BYQA 3MM7B 1B0TA 2C3OA 2VPXB 2PDAA 1FDNA 3MMCA 1PC4A 5BYRA 4DHVA 2ZVSA 1C4AA 1K0TA 2WB1D 2WSFC 1H98A 2XSJB 3HKZD 3MM9B 3MM5A 2FJBB 4OV1A 1FRXA 2C3UA 1BWEA 1KEKA 1B0PA 3IR6B 3PNIA 1FXRA 1JNZB 4AYBD 1FXDA 1KQGB 5FD1A 1BD6A 3MM6B 1Y5NB 1BLUA 2GMJA 1FERA 2FD2A 2VPZB 1SJ1A 1DAXA 1FRHA 1G3OA 2WAQD 4ID8A 3MMAB 1CLFA 3OR2B 1Q16B 3MM6A 1JNRB 1H7WA 2PA8D 3MM7A 1G6BA 3MMBB 2V4JB 2VPWB 4CI0B 7FDRA 1D3WA 1H7XA 3MMAA 2WSCC 3MM8B 4XK8C 3IR5B 3GYXB 2XSJA 2Z8QA 3MM9A 1IR0A 3EGWB
chains in the Genus database with same CATH superfamily
2NYIA 4LF1A 2KXFA 2LQBA 4RKUC 4P73A 3MDFA 5CD4A 2F8HA 4TY9A 4KPYA 2L48A 4ZVEA 2C2NA 2FZCB 1X4FA 2KKHA 2GS8A 3KUHA 2A3JA 2RDIA 3KK3B 1E6VB 1TELA 2CPYA 3KYLA 3K59A 3W2WA 3L9ZA 1Y5IB 1KNZA 1IKXB 2C2EA 3C3LA 2BV3A 4NLGA 2F8EX 2W8LA 4B9LA 1PCAA 2HGNA 3MUTP 3MECB 4DV4F 1YTYA 3UFCX 5KG7A 3LH2S 2ABYA 2XZDB 3VV2B 5T41A 2VJVA 4DX6A 2B4VA 4DUYJ 1HHSA 1SV5A 2MQNA 3ET6A 2KDOA 2CZVC 3QZ7A 3HSZA 1RT4B 1H7WA 4L75A 3SI8A 4CI0B 2DB1A 4LRAA 5DQGA 3MEDA 2W25A 2GV1A 1T03B 1OIAA 1D0EA 2OPPB 2YWKA 3HM9A 3OD2A 2XTJP 4BCAA 5B7WA 3GV5B 3HCXA 5KG1A 4RW8B 1ZA1B 1GMWA 1UA0A 2HS4A 3DRRB 3DLKA 1MSWD 2B9XA 1ZZNA 5H9FK 2VPYB 3KK2A 5BYSA 3I5CA 4O44B 4B3OB 2NUUG 4P2FA 4CT9A 4FF2A 5HLFB 4UZBA 3AFGA 3FGVA 3KUEA 3FBEA 2C3OA 1TFYA 1QVFR 4ZA1A 2VG6B 5DM7Q 1LWCA 2LP4A 3BR8A 3I9ZA 1LW0A 2MZQA 2VFTA 3WQPA 4M8LA 5EX0A 4IH6A 1C1BB 4X66F 2EEYA 1VBKA 2KHCA 3Q2TC 3KMSA 3MPYA 3I82A 3HFKA 1BQNB 2YWEA 1GX6A 1WG5A 4DPXA 4YEAA 1FERA 4UOFA 4NLQA 2CWXA 2VPWB 4USJC 5EGYA 4WU2A 4XK8C 4QWBA 3OJSA 4X4VA 3RB0A 3NGTA 2QMWA 3TJ8A 1Q79A 4NPOA 3EDQB 2FJWA 4MJKA 1H74A 2H65B 4LSLA 5B0FA 1LWFA 2AEFA 4X65F 4PUOA 3RUBL 3DDKA 1Y5LB 4P71A 2CPDA 3T6BA 2CPFA 4K7QA 4DZDA 1YWXA 4NCGB 1VQ5S 3HMJG 3RW7A 1NPPA 3PTWA 3OV7A 5HANA 2C2OB 3OR1A 4L74A 5IV3A 4K4SA 3RJMB 5D78A 4ANCA 4YFUA 1GXLA 3ZTQA 3R8YA 4AD6A 2ZDPA 3MAAB 1IBLF 4NXMF 3UDVA 3CCES 3HLUA 2KM8B 3BDPA 2RU3A 3Q8PB 4NA3A 3M9OB 4B9MA 4USKA 4L73A 1B7FA 2GJ2A 4A8WA 1IBKJ 5AE1A 1CC8A 1PILA 1UJ4A 5LOQA 2MZRA 2E44A 2W1BA 3R97A 1S7HA 3MMJA 2NXUA 5DS7A 4RU2A 3ZZZA 4DX8H 2D74B 4PAAA 2XCPA 2CJAA 4EZ6A 3KHLA 1GT8A 5AE3A 5L1JA 4DV2J 1Q7YT 5KTQA 4GO7X 3QZ8A 4DDFA 4Y0FA 3V4IA 1IUJA 4OYWA 3W60A 5M2PA 4J9PA 4WE1A 2EFNA 1JXVA 4WXOA 5IC6B 4N8OA 3QWUA 1Y00A 2GHPA 2N4DA 5K5MA 4B9TA 1B64A 4WP9A 1TKZB 1TL3B 2CQHA 1IVZA 2ZZTA 2M8HA 3PO4A 1HMVB 2MGZA 4NEZA 2K8GA 3MEKA 4DFMA 1ELOA 3JS9A 3SYZA 2PI5A 2GIRA 4QZVB 2FPHX 2VIHA 4DXLA 2BQUA 4TXSA 2YPZA 4IG3A 4OJ3A 2CA9A 2LECA 3E3XA 3QT7A 3BKTA 3O1LA 2ZBQA 3ENQA 3WIUA 2X1GA 1LEOA 1JLCB 3QSIA 3MR3A 2HHTA 4IKAA 5HMXA 2UUCJ 3GIJA 2LQJA 5L1KA 2RVJA 4DR7J 2ASLA 4LFAF 3FDSA 2CNNB 4Q0BB 1FJCA 4DLGA 4YN3B 3OFHA 4ZVGA 5KFQA 2DHSA 4C8ZA 4WFZA 3CJ0A 2V9WA 1GQEA 2QV6A 3GE9A 4M94A 2HS3A 2XHCA 5AJ3J 3UVJB 1CS4B 1QAYA 2ZOFA 1FDBA 4C3MA 1QTNB 1H2TZ 5DLGA 5KT2A 5J1PA 1VQ6S 4QIGA 3G2XA 4DPTA 3QFHA 4KRWA 4K59A 4DL5A 4RUAA 1QJHA 1RBLA 2DXDA 4ZP6A 2I2YA 3B4DA 2ZKUA 1KVIA 1MU2A 2YKMA 5EWEA 5HK4A 2WW8A 1LW2A 1QM9A 1U25A 5KFHA 4WU3A 4CDIA 4K4ZA 1TAUA 2RDDA 3LF0A 2YX1A 3ITHA 4JV5J 4FYVB 4CO5A 1YQHA 3TQEA 5KOWA 5D4OA 2JVOA 3DDNA 1C2PA 3PHTA 2KXNB 1S76D 2Q79A 3Q83A 2ZWOA 3UDEA 4OYPA 3PFOA 1RTJB 2DEJA 1FCAA 4C11B 2ZUAA 4ZN3A 2Y1LB 4NWBA 3K0JA 2QLJB 9ATCB 4RBTA 3G86A 3M32A 4ED6A 4UOGA 4RW6B 4MKBA 4ID5A 3FC9A 5CAAA 2EW9A 4EYIB 2N7CA 2XHWA 4YR0A 3K5MA 4QR0A 1CBKA 2HBQB 1CJVB 1F3FA 1IJEB 3GV7B 4DQQA 5G4DA 3G71S 2HNZB 2NXCA 2DNQA 2H54B 1R8AA 4FYXB 1PSDA 2YKOA 2MDAA 4DCOB 3OLAA 1FXDA 4KGVB 4OLOA 1NDLA 2DNLA 2DR8A 2F63A 3ISNC 4F50A 3ZZRA 4EFAC 2JLEA 4K4UA 3TAMA 1VQNS 1YRUA 3FFIB 4YQWA 4DR2F 1R31A 1NDKA 4JI2J 3KHGA 1WOOA 1WC0A 4ZPDA 2CADA 1L3VA 2FVCA 1U1RA 3R6LB 2HFZA 2IDLA 3RB6A 4WFYA 4HH0A 4M63A 3JXOA 4TY8B 1BQXA 3CCRS 4BHQA 5KT6A 1S6UA 4JOUA 3CJ4A 2O66A 4AFFA 4MMOA 3FCWA 2KL8A 2HMIA 3W62A 1FTCA 3CDEA 3UD3P 4PQUB 1BC6A 1S5ZA 2Y8YA 1KBRA 5U47A 4ZVOB 4U8YA 3LAMA 3WIVA 3IC1A 4I2PA 1RWNB 1VC6A 1DLOA 2XGQA 3WC2A 5A8RB 1U8WA 3UN3A 2CNKB 3QFWA 4HT7A 4X66J 2VQEJ 1JLFB 4TU9A 5L39A 4B3TF 4QIEA 1KS2A 5SUHA 2DRAA 4JP8A 1WC6A 1P1LA 3PYDA 2LDIA 3MFIA 2ZHOA 1X4GA 3P96A 2RAQA 3HVTA 1MMDA 3JQMA 4PG5A 5AXKA 3KDNA 4MK9A 4C0HA 2D3O1 2AYMA 4RNNA 2G0JA 2H1YA 3LOUA 2FLOA 5A6PA 4IFYB 4NLSA 2V5HG 4CNZA 2R7SA 4EK2A 1FTRA 5CXTA 2FJVA 3PV8A 1VRTB 1R27B 4U9RA 1X4AA 1FE4A 4IH7A 4WKYA 3FUYA 1XMOF 5J2NA 4DR6F 1C4AA 1REVB 3GP9A 4E8UA 2H5EA 3I96A 4C8NA 2Z56B 4QU7A 2YXLA 3JQJA 1FNOA 2GQCA 3VGTA 4PEOA 4NXMJ 1TK5A 2FZKB 1QAJA 3NEKA 2IIHA 5KFRA 2DRDA 1DAXA 4W90B 2H5JB 4KO0B 3OR2B 2OMLA 1HR0J 4WJBA 1S9GA 3K8WA 4FPIA 4XAKA 3SQOP 2XY5A 4CTAB 3HT3A 1ZYQA 2KXHA 4Y2CA 3IG1B 4L76A 4K2JA 4OHZA 2W24A 5D4LA 1U2CA 2AIRB 2MZJA 1B3TA 4HACA 1TMJA 2LEPA 2IFXA 2IRUA 1W2BR 5ETVA 1FRIA 2N7YA 3A12A 2FB0A 2IJRA 3M2RB 2DGXA 2XI2A 4PG6A 2UZAA 5KFEA 3H90A 4I6WA 4OHWA 2NS1B 3DYAA 3EICA 3VGVA 1NDCA 2DPJA 2IM3A 1NHKL 2KRRA 1FO1A 2Y8WA 2H9ZA 1QSSA 3CVKA 3GFZA 1HNXJ 4EO6A 3QPIA 3PIPQ 6AT1B 1J5OB 4DJBA 5J2PA 3UCUP 1D1UA 2R8IA 4KBIA 1CULA 4CM0A 2AZ3A 2HKEA 4PPDA 2CRLA 1H3DA 4DV6J 2JLFA 1EP4A 1IM6A 5KFCA 3MAQA 1RHRB 4Z2XA 5GMDA 2M9KA 4I7FA 1FRLA 4KE5A 4TU7A 4LFAJ 1BQMB 4LRCA 1KLMA 2ZHAA 4NMLA 1HBMB 3M6UA 4F04B 2DKOB 2WB4A 1VBZA 1RHKB 4N56A 4FKYA 1FDAA 5L46A 1RE1B 2MEWA 4KFBB 2BKOA 2L9DA 2MQOA 3Q8SB 2W7PA 3EM1A 4OX6A 2IPOB 4C8MA 2R8GA 1EHWA 3R1HA 1XEZA 2MKCA 1K0TA 3MFHA 3PEHA 2E7WA 2FLPA 2PE8A 5E2QA 2RS8A 3CO9A 3K89A 5KFTA 5F3TA 3OUYA 4A8YA 2V9KA 3UN5A 4WBFA 4USTA 4USMA 4PXBA 5F8HA 2V4JB 3H40A 4DV5J 5KG0A 4QPXA 2QRRA 3NMAA 4IRDA 2YWWA 1TL4A 3DLBA 2BJ8A 4DF4A 3IRXB 1NB2A 1VC0A 3BF4A 1HD0A 4JV1A 2XI3A 4FS2A 4ZLLA 3QO9B 5HBMB 3T1HJ 4IG0A 4PG7A 2OEJA 4ZVPB 2E66A 2ZH1A 2LQ5A 5KAKA 4FKXA 3DMJB 2K1RA 2VU5A 3G6VA 3IP0A 2XWXA 1YJVA 3B4MA 3KNAA 4ZS6A 5KFVA 1UZHA 2AJFE 3JYTA 1VJWA 3C16A 5KT3A 4ECYA 2C3YA 2RILA 2ZH8A 3CTRA 4QR1A 4ELVA 4OJHA 2WB1D 1GEHA 4J9LA 1F9FA 2YNFA 2YNHA 3H7HB 1IBMF 4OV1A 2E5IA 1AROP 1F1BB 1IXKA 2RSQA 1APSA 1N0UA 3M05A 1UEUA 4N77A 1VK3A 3N4WA 1S9EA 2KHDA 4QU6A 1C0UB 1MLAA 3OTBA 3JTPA 4UOCA 4UW2A 3BQ2A 2HNDB 2V8HA 4KB7A 3SSQA 1URNA 2YQ0A 2DYAA 5DO2A 4LFBF 3QLHA 4DR4F 2W9CB 5A0YA 3AQPA 1Z2LA 4Y3CA 3TZYA 1DJ0A 5JVHQ 3BH7B 3RBDA 3IGNA 3NAIA 3EE3A 3OHBA 3CEDA 1HFEL 4PWUA 5F0WA 2MZSA 1SH2A 3W3SA 3BPDA 1F2HA 4K4XA 1OY8A 2BA9A 1N32F 1KFDA 4G1QB 2VKRA 4HI2A 5BYRA 4NA2A 4Y2AA 4UY8T 4C8YA 3M2VA 2NREA 2WONB 4MIBA 2HG4A 2FVSA 4HHUA 4LF2A 4R25A 4B3TJ 2K2PA 1CEZA 5ADZA 1KVKA 2E1AA 5SZTA 4V19X 3PG9A 1HI0P 2R7TA 3CDBA 1UL3A 1MWYA 1H72C 3C15A 4NYPA 4MTPA 2XSJA 3C6TB 2PO4A 2V2KA 1M1HA 4GVBA 2AYGA 2XZWA 4FVMA 2V2VA 4Q8FA 3PW0A 4PWDB 2XMMA 3POTB 4OFZA 1SH3A 1NJYA 4K5SA 1JLAB 3DRPB 1X4DA 4EEYA 1IKYA 2ZH6A 4QYRA 2AT1B 4JYAF 1SH0A 3DU5A 4WYLA 4XDDA 1R6VA 1RQ0A 1XMOJ 2HVHA 4DR6J 1RYSA 1Q53A 1PYSB 3CUNA 4GKJJ 1SI9A 1TKTA 1DTQB 4QCLA 2CPIA 3UO0A 1EIYB 1GX5A 2V8PA 1B0PA 3LPEA 2ZC4A 1BWVA 5E41A 4U67Q 4EBDA 2W01A 1S1TA 2HQCA 2BQ3A 2OUGA 2Z2YB 5DZ7A 3MURP 2QC3A 3NNAA 2HHHJ 2ZH9A 2M0GB 3MTJA 2VG5B 4WXWA 3ONQA 4H4KA 2VKZG 1NSAA 1WJ9A 1DQ8A 3D1QA 3CJQA 2HHSA 1EETA 4UUWA 4ECSA 2O5DA 4GRSA 1OMSA 3JSMA 2QJ3A 3ULHA 2GW8A 3KDOA 3KLGA 3PO5A 5LJ5Y 3VAJA 1VFJA 2JFDA 3ISND 4HTIA 2XLJA 3M30B 2XMJA 4WP8A 1QLNA 4J9SA 1RHQB 1N56A 2EC2A 1HBNA 1SC6A 2M88A 3CW2C 2RF2B 2DPIA 3ILJA 2VICA 2YY3A 1MWZA 3MD1A 3PYFA 5T7LB 3FEXB 1HD1A 4B3RJ 1OO0B 2VOOA 4DV3F 2GQQA 1RWUA 1XTZA 2CQIA 3A8EA 4DG1B 2MY7A 1PG5B 4MIWA 2UV8G 2GCFA 1NJXA 3DGVA 4ZVTB 1JLEA 5C24A 4GVLA 4JI7F 1FK9A 1TUWA 5DGBA 1RAEB 1H73A 4J90A 1N36F 3GIMA 2WK4A 3HULA 1TP7A 1YJNS 5LM7E 3MUVP 4FF3A 5KFFA 3D7SB 1TV6B 1XMQF 2KFZA 2VF3A 4DF8A 1X0FA 4ZVRB 5ETTA 1G2EA 3W66A 1RT2B 2B5JB 1SQFA 4OX8A 1H2VZ 4H54A 4ATNA 1P27B 1U45A 1HLWA 4CQ1A 4CO4A 3DRSB 4OMFG 2UVWA 3PKYA 3NCQA 2MLYA 2QTWA 5EWFA 1L3SA 1AW0A 1U2RA 2ROGA 1X9SA 1JJ4A 1RJJA 3Q86A 4WK3A 3FVYA 4M5HA 2J6UA 1XNQJ 1SJ1A 3S7RA 2IA0A 5LXYA 4USUA 1NMEB 1KOHA 2VASA 1UVMA 1RABB 3OHAA 3QYYA 4P7VA 1WDDA 2YKNB 2J7UA 2BABA 2U2FA 3QNWB 2GO8A 3EXCX 4ZJLA 4M1KA 2YWFA 3E01A 1N5VA 4RNMA 1HYSA 1F6TA 5EDWA 1WSRA 1AXQA 4X4PA 3HHLC 2W4CA 2F1FA 4DUZF 5LT5A 1T05A 3BR9A 4J9RA 1ZAWA 5KT5A 3G8SA 1CG2A 2M52A 3T1YJ 1RWMB 3QJPA 3DLLQ 1U0HB 3FBCA 7AT1B 5BXIA 2O01C 4PRFA 5LMNF 4C98A 1EX8A 1NPRA 3ZZ0A 3HXMA 3PFEA 4M5JA 2F4VF 1RAJA 3RG6A 1SQGA 3EZUA 3CCLS 2W7AA 1IBMJ 3JSYA 2AGPA 3DGPA 3CC2S 1N33F 3T9ZA 4JI3J 2BW2A 1C1CA 3ZZUA 4ECQA 2VH7A 4F26A 1T0TV 2ACMA 2VPZB 5AXNA 2CQ3A 1G3OA 2FHOB 4DMZA 2PEHA 2F4FA 1RKJA 3CULA 4LF5F 1NH8A 2B7BB 4DBQA 5DM6Q 2AV5A 5C25A 3NOGA 2BJDA 4MAKA 2QSWA 1QAIA 2ZEJA 2KVQE 4LFBJ 1BHNA 4A48A 3MCMA 2I8EA 1HW9A 1S1XA 5HQLA 4DX7A 3C2PA 1S97A 2X1FA 2V2QA 1FXLA 4BWJA 2CYYA 4YB5A 3R7SB 1A7GE 1DRZA 3MPUB 4K5RA 1WHYA 5BJRA 3IXQA 2KFYA 3QSYB 3UDLA 1O0PA 1L3TA 3CDUA 2WW4A 5THWA 1WHXA 4JI0J 5IT9Y 4LF4F 4FPRA 2H51B 2MY8A 3V6HA 2NPFA 3O3LA 1NB7A 2VQFF 2P2CB 2IM1A 1TR0A 2ZD1A 4Q8EA 1HI1A 2IMWP 1TL5A 2UUWA 2IM0A 3KJVA 4DQRA 2GJFA 3QWPA 1G1XA 2APOA 4P10A 1UFKA 4HHHA 4LRBA 2AHOB 5KG2A 1KQKA 3GZ7A 5E3RA 3Q8UA 2MQQA 1HNWF 2LMIA 2AQ4A 3TX0A 4O3SA 4JB8B 4ZDNA 3OTOJ 1YJRA 3EPGA 2JDJA 3BO4A 3CMES 3G8QA 2HWIA 2J8SA 8RUCA 3KLEA 3L09A 4MYTA 4B9VA 5KFNA 3M9MB 1TVRA 3KLVA 4JYAJ 3DLJA 2GVDB 4C4WA 1WDTA 5ETOA 1SPBP 5LSOA 4BDPA 2IC3A 3CCWA 3H98A 1SV5B 3ET6B 3CMQA 3CD5A 4N76A 4Q44A 4K8RA 1NU4A 2FHKA 3CJSA 1WKJA 1FNMA 1WF2A 1FD8A 4RW7A 2HEKA 3MEDB 3IA0A 3BPSP 3MM7A 2R7QA 5F8MA 2XMVA 2FLLA 4AUKA 2KN4A 1IJFB 2IY5B 1YZ7A 5ETQA 1VMBA 7FD1A 1FKOB 2L41A 1G7CB 2Q3PA 2J6SA 3DLKB 4TKTA 4BC9A 2CJ9A 3OXFA 4IRKA 4KGZB 3KJNB 4URGA 4YB7A 3KXDA 3C14A 1OQ6A 1VLYA 5KFSA 1YVFA 3L7OA 4A47A 2DR5A 3NRBA 1J5EF 1JLGA 3C8YA 3NS5A 4NASA 5K14B 2VB6A 4M5GA 5B09A 1S77D 2RUGA 1LWCB 1PGZA 1ZPWX 3I4HX 1NSPA 3KLIB 5LMUF 1R0AB 4QWEA 3V5RA 3DOLA 1S12A 2FJBB 1C0TA 4R5PA 2HQDA 1FWLA 5B0BA 1H38A 3W5YA 1LNQA 3TVYA 2VFSA 2ZKTA 2Z4PA 2V34A 1W26A 1PYTA 4PYDA 1SUQA 2BKPA 4JI4J 4E98A 3GG1A 1FKPB 3R3TA 1RHJB 1U02A 1S7IA 4C97A 1N36J 1EKRA 4HDHA 2FLNA 1XERA 5HP1B 5EHHA 2JOQA 2HPUA 3AD7C 1XMQJ 2OKQA 2P9EA 3DHXA 1X7VA 3BS9A 4XPCA 2X1BA 4KKOB 3PIOQ 1T9UA 1UEVA 4ZCLA 3OR1B 4FP9A 4DL7A 4FNIA 2HHWA 1VIXA 3ELHA 3RB4A 3A13A 1K44A 4PG8A 3MEGA 3D1OA 3TEGA 3TEHB 1N52B 1S1VB 2B43A 2J9EA 4ANDA 4CT8A 2YNGA 2MKSA 3CCMS 4ZLNA 1KD1T 4C0OC 2BXJA 4DV1J 3F41A 2AP6A 2AJ4A 4NCAA 4M5NA 3VAFA 4JI1F 1RACB 3MAHA 4G65A 3OL9A 2ALYB 2JC0A 4NLDA 5IT9U 1RTIA 2HLTA 4B3MF 2WBRA 4ALZA 4QW9A 2ALZA 2DNMA 1AYEA 4A4JA 4USIA 5FDLA 1N5QA 4EO8A 5D3GB 1U1PA 3TUIC 1RT6B 5EWGA 3V4IB 1XIQA 4RUBA 8ATCB 3I4PA 1RT1A 4QWAA 2PSZA 1SC1B 1Y3KA 5MAOA 3NS7B 2JC1A 3LP0A 2HFUA 3SZ2A 4CM2A 4HTJA 1GMUA 2BQRA 1OY9A 1V9OA 1Y10A 3SSSA 3CIZA 1GMVA 3TYTA 3H2UB 4OZ2A 1DQ9A 3VZIA 2F5GA 2B8PA 3KK3A 5JJBA 1E6VA 3LANA 2HQFA 3WZ0A 1N4LA 1SBRA 3A3NB 2FD2A 1SC3B 2HVZA 4J9KA 3UPFA 2GVZB 1IKXA 1K73T 3CIMA 3C66A 2UUAJ 3CJKA 3N0VA 4CLWA 1WACA 3HP6A 5IT0A 1YBTA 4DSEA 3OXLA 4RNFA 5L9XA 3SCIE 4ZP8A 2NLWA 2VOPA 2JWNA 4RUCA 1FKAF 2J5AA 2AX0A 3BB5A 3D0GE 4DFPA 1EKSA 4XPEA 2W4PA 2QN6B 1NHUA 4ZP9A 3DLGA 1MMNA 1X8DA 2G13A 3T19A 4Y2IA 1U1MA 3N5FA 3PR5B 1HQUB 1KSPA 1LQ9A 1T03A 4CH7A 1GK8A 4LF4J 5IQQA 2WVCA 1EB0A 1SIWB 4IDKB 4LT6A 4CH1A 2HYIB 3FZ2A 4A8KA 4KTQA 4C9DA 2O1PA 2ZOMA 1MU2B 3TZZA 2YKMB 1RAGB 3J7YI 2VDHA 2GIFA 1X9MA 2C2ZB 2B4UA 3EVWA 4RPFA 3OVBA 4O44A 2BOAA 5BR8F 1LOUA 2XBPA 2YPYA 4JUZA 3N6NA 3M7VA 1RT3B 1UJ5A 2VG6A 1S6OA 4DQIA 4D3GA 2UU9J 3EMTA 5CYQB 4DX5A 3Q8YA 4LFCJ 3PACA 3EVOA 2P8IA 4UTGA 2YVSA 1C1BA 4WYWA 3BBBA 1HNWJ 5K9FA 5KFBA 2YBVA 2E7XA 3A8JA 1BQNA 1Y4ZB 3MEEB 1FVQA 4U7UK 1U1OA 4QQBA 1YJ9S 1S1UB 3LGMA 3SDEB 3IR7B 2XGPA 1RCOB 1VQMS 2YQ3A 2ZJPQ 3M32B 2DJWA 2DGWA 2V94A 2OO4A 4P72A 3IN5A 3H4BA 3A3PB 2IM2A 5DRKA 3G9CA 2RKIA 1FDDA 3W9HA 4DUYF 3X1LB 2EK6A 1EQ0A 1JLBB 4P52A 3FBBA 3F0NA 1UEKA 2CPHA 2OFGX 2M4MA 2OHDA 3HKZD 3KK1A 4BLGA 1N34J 4NCGA 1XMBA 3HHLD 4BC7A 4QJVA 1MW7A 2FHJA 1O5JA 1WHWA 2OPQB 3DM2B 4YY3F 2XM3A 3TI0A 3RRGA 1KDNA 4X64J 3MAAA 4QPTA 4KYZA 5HSPA 3GCXP 1HQ2A 3EGNA 3MI7X 4MYUA 1PBAA 3N9UC 2BE2B 2LXUA 4PZVA 3R1LA 3I5AA 2HFOA 2RHQB 2HMIB 3PJWA 1UVLA 4F2RA 2Y1IA 3TP2A 3TUPA 3J7YU 2IVMA 2OD6A 4KH1B 2OMOA 4WZQA 4OYBA 4RW9A 3DXSX 4EBEA 2B0GA 3NCRA 1AZSB 5LMUJ 2P5VA 2A2DA 2VFRA 3BDEA 3QGIA 3EWGA 4NX9A 3UD5A 3RBXA 2VJUA 4ELTA 3PR4A 2OFHX 3SQGB 3VHQA 1Y5NB 4C8OA 1TKZA 3KG0A 4PKDB 2BUNA 2C2DA 4F67A 3AA9A 5KG6A 4ECVA 1Q8IA 1WOPA 2QT7A 2BE9B 3BZQA 2C2RA 1T9YA 1S6PB 2VBYA 2EFQA 2K7JA 4OHXA 2E7VA 4Y28C 2MKYA 1OQ3A 1R8HA 3IM8A 4RLEA 1I5OB 3FMWA 3BKFA 4ICLA 1WKKA 2J76E 3R9LA 2PGCA 2GGPB 3ZFVA 1RA6A 1Q1KA 1FDNA 3H5YA 1LXNA 1IBKF 1NPKA 2VUGA 1NK5A 1UPMB 4M5DB 4ED4A 5C7PA 1UZDA 3V6DA 3MOJB 1YK9A 3UVJA 1CS4A 1UETA 1L5UA 4FDFA 5H9FJ 4YOEA 4M5IA 2RS2A 3BQ0A 1RAAB 4DV2F 1HWLA 4V1Ak 4F4YA 4B3MJ 2IHR1 4HI1A 2E5GA 4JI5F 2V8VA 1LWEA 2GJIA 3SCKE 1HQEB 1B0VA 3J81j 4J9OA 2DISA 3RAMA 4A8OA 2YX4A 4X62J 4GKKJ 4ZMMA 2V68A 3DYAB 2W2OP 1H0HB 1FEHA 3BSNA 1BXNA 4QW8A 4LF9J 1L3KA 2FVRA 4C8LA 3TWZA 2W8KA 5DG8A 2NXNA 4M95A 3GTYX 2GFFA 3V6KA 1T3NA 1N6QA 3TRGA 4C11A 1WF1A 3U1MA 3UI3A 4CP5A 1LWXA 2DHXA 1F9HA 2UUCF 5M2UA 4RW6A 2MQMA 1VQYA 5E0OA 2A2CA 4F4AA 2UUBF 4DR7F 3AOCA 3S01A 1RADB 1VI7A 1NKEA 4WTYA 1LFWA 1WEYA 1YG0A 1WC3A 2FY8A 4ZPVR 4I7FB 2X7IA 2HNZA 1NK7A 4FYDA 4CZCA 1SIZA 2FDNA 1KLMB 5AJ3F 4CYUB 2GC8A 5F8LA 1IR2A 1FE0A 4QR2A 2ZNYA 2ZZMA 3HJFA 4MT1A 3FFIA 4Y34A 5KFYA 3HHNB 1KC8T 2WVEA 5J1NA 2MYFA 3EGZA 1R8BA 2DNPA 4KHPJ 3J7Z5 1XBWA 4JV5F 5E3AA 4RUHA 3CC7S 3W63A 3ZZPA 5E5NA 3KHRA 3OUYB 2HHQA 4PQUA 4OI4A 2OP5A 4Y65A 4DCPB 4OI1A 2JX2A 2XC9A 4WZMA 5KFZA 1WEXA 3WBZA 3R5DA 2LA4A 2MQPA 4ZPCA 3VAKA 1JLFA 1QUVA 4B9NA 2QSFA 4ED5A 1S0OA 1F0XA 2BJ9A 4IG0B 2DNNA 3M8PB 4PABA 3MR5A 4WFBQ 2C42A 3ILIA 2K1RB 3L7UA 1YRTA 1X4HA 1UW9A 1WSVA 3B82A 2G2YA 1U6ZA 5KFKA 1U1KA 1RAIB 3C16B 4FYWB 1RXOB 1HHQA 3CMAS 1N5YB 2CDQA 3WDOA 2VD3A 3ETMA 1HW8A 2YKPA 4RNHA 3FSIA 4IFYA 1Q8BA 2YWGA 4DSKA 3J7AN 4U7CA 4J9UE 3J81Y 4F3OA 3NGKA 1S9EB 4J5OA 3H59A 3EZ5A 2WVDA 1VK8A 3R27A 2DRBA 1V3SA 2HBZB 1VQPS 3C46A 3BO3A 3BSCA 1Q16B 4JI2F 4HT5A 4YY3J 5KFJA 4NZ0A 4ZVHA 1TUVA 2MSTA 4B3SF 1REVA 2DIVA 2HZVA 2KB2A 2UXDJ 3BKUA 2JNJA 2XULA 4DQSA 1RBAA 5JXSA 2OJ3A 5IS2A 2QFJA 3NNHA 3IWNC 1FESA 2RB7A 4KO0A 1UA1A 3OR2A 1NHVA 3DLEA 3LPYA 5I3UA 4FYYB 4FN5A 2GZOA 2FVPA 3IG1A 2F9JA 2IVYA 1ITPA 5HJXA 3VF0B 2ZM6J 2VQEF 1PBUA 1VCTA 2B6AB 4QIWD 3M2RA 3EVMA 3C19A 4NLUA 1H6KX 1CVJA 1RKIA 1ZM4A 3CDWA 5ETSA 5D4PA 3W7BA 4C3LA 3KHHA 3W8GA 1NNDA 1QTMA 3HF5A 4J9MA 1AUSL 2KT3A 3C15B 2HQIA 5DG7A 4NEYA 3K58A 4HKQA 3RRHA 3PRBA 1MNEA 1F5AA 4GVBB 3QRPA 3U02A 3VVUA 1B70B 5F9LA 4AL6A 4LSZB 3S6EA 3BBCA 2V69A 3VAGA 4B17A 4FXWA 2VBXA 1HI8A 2AEMA 1BMQB 4KR0B 3CCUS 4P6QA 1YLXA 3JSBA 3ILOA 5HROB 3W64A 4GMKA 2W9AA 1AB8A 1NLKL 2AKWB 3IBWA 5G0RA 2DD8S 2J8AA 2RHSB 2W2PP 2NZ4A 1PYOB 1VRUA 1IM4A 3IAS9 2D1CA 2DK2A 1RHMB 2GAGC 4ZLJA 1HBMA 4I4BA 1HR0F 3QIDA 4NLRA 1U1NA 5DQHA 5LXRA 4DU7A 3AT1B 4LF6J 2IAJA 1RAOA 2DXEA 5AE2A 2OI2A 3M8WA 2FZGB 1FJ7A 4I56A 3QJJA 2H48B 2OH2A 1CJKA 4JI5J 3W61A 5D0RA 2DT9A 4H4MA 3TO8A 4LRDA 2B9YA 4USHA 1CPZA 4KHRA 1HNVB 3KLGB 1CJUB 3LWMA 2V4JA 1RTHA 2NXEA 4CH0S 4U8VA 5M2RA 1HNXF 2PC6A 3QAEA 5GADI 3IRXA 2IRYA 1B7YB 8AT1B 4K0KJ 2HGMA 1X5TA 1UFLA 3WHIA 1B0TA 1QDUB 4IR9A 4DV6F 1K8AT 3CCVS 3EPIA 3HHLB 4ZITA 3D4JA 1XNRF 1S0VA 5D15A 1KTVA 2HQGA 4BWMA 2UUBJ 1JLEB 2G1HA 2EPIA 4A8QA 1HWUA 5JUMA 5HQ8A 1RA7A 1FEEA 4IFVA 1KHWA 2I0XA 1REGX 1SB6A 1F9EB 1HPZB 1U09A 3NWGA 3VAIA 4TU8A 3QJLA 4TN2A 3J81U 1RZMA 2LEBA 4ECRA 2BOPA 3CJ3A 4NI2A 1XQIA 3S1TA 3OBIA 3Q8QB 4X4RA 4UQTA 2V50A 1C0UA 3RR8A 3MM5B 3U7JA 2Q6BA 3DNCA 4WCEQ 3HD2A 2LU1A 2DTJA 5FJ4A 4CLLA 2CG8A 4X4SA 4LR7A 3UDCA 2W9CA 2MZ1A 1OYEA 2E1PA 3U1LA 1R8CA 3J7ZT 1URRA 3DOMB 5CA5A 2R7RA 1VQLS 2XEXA 3A8KA 4PG4A 2LDYA 4OYZA 5A8WA 1RK8A 2W2NP 3QBCA 4DV5F 4QIFA 4X84A 2DNOA 2JJ4D 3AB4B 4PCQA 5HMYA 2E9RX 2EG2A 4Y00A 3D28A 2Q6CA 3HSDA 2LEAA 2POKA 1FNXH 2R42A 1ZAVA 1RP5A 5KFAA 4TLQA 4CLKA 3UCZP 3T1HF 3D2WA 1V3ZA 2WONA 2B9EA 3E01B 4C6AA 4F4XA 1Y3JA 1BY9A 4ZK7M 2P6TA 1JJ2R 1R6YA 2HZCA 2HHVA 2F40A 3FEZA 2JSXA 5GADU 3QQCD 4UF4A 2KH9A 3EXYA 3G96A 3N6LA 4O4RA 3HKWA 1TL7B 3AQOA 3GYNA 1U26A 1JMTA 6FD1A 4XIUA 3RBZA 5KFDA 2HVDA 3AH6A 3C6TA 2RRNA 4LBHA 4L6V3 1F5CA 3SCJE 2WCXA 2X3DA 4WF9Q 3I0RB 2XS2A 3RW6A 4IR1A 2R4FA 3BYPA 4PWDA 5J2MA 4TYBA 4JBCA 1WTBA 4HH1A 2ZBPA 3M6XA 4DV0J 1KEKA 4I69A 1JLAA 2KVIA 1KQGB 3IS9A 2JEFA 2B56A 1JWWA 4ZHRA 4RL1A 1GXTA 3GIKA 4PXCA 5C25B 2FVQA 2XLIA 3CCZA 4F4KA 2EFOA 4WK1A 2DY1A 4B3SJ 3CC4S 3N79A 3ENAA 5L38A 1ZZFA 1DTQA 2J9CA 1S1XB 4HLBA 1GTEA 1JQGA 2PMWA 3BBFA 1GFWB 3ZZYA 3DHWC 2MJNA 3UWTA 2HWTA 4IQXA 2LCWA 1YX2A 2SXLA 3RGIA 2BX6A 2VG5A 3P49B 2CQ4A 3AODA 2GMHA 4ER8A 5CQGA 2BANA 4B08A 5ETLA 4O4GB 1FWPA 1M90T 3DC2A 1VQSA 2BJEA 2A10A 3AXKA 1LV5A 3TZWA 4CLSA 3KJVB 4OIXA 1D09B 3MM9B 3LALA 2J0WA 4LBPA 2E9ZA 3TR5A 2WOMA 5HVHA 1P6TA 2QLWA 3M30A 4FS1A 2ZH2A 1HIYA 2LKZA 3V6JA 2OLWA 3MPVA 2QO3A 4LQ3A 2QMUB 2ZJRQ 1T95A 2OPSB 3VQSA 3IWXA 3Q89A 3TZXA 4CO3A 4ZIVA 3EYZA 3G8TA 1WI6A 3T5JA 1ZTTA 2I5JA 3TUJC 2GO9A 1D9AA 3QGPA 1WHVA 2W9BA 3VCDA 3GYGA 2XQCA 1KLNA 2XYPB 4I2QA 4OYIA 4LF7F 1GH8A 2BACA 1O6XA 4M5KA 2C2KB 1HL6A 3KLEB 2V8DA 4X4UA 1IN0A 3ZTOA 4FBUA 4MKAA 1VGYA 1H2UX 2QA4S 3NBPB 2JHEA 3H5UA 3R5GA 4GKJF 4K4WA 2HK2A 3KLHA 5E33A 5GAGI 1TV6A 4LSNB 2DNKA 5ETPA 3ILLA 3HSGA 2ACYA 2OPRB 2OTJS 2HHHF 2CXEA 3IR6B 1Z1ZA 1KKHA 2VG7A 5B0CA 1RLCL 2EFGA 1QAXA 4DPWA 4RW7B 1SJQA 5KOXA 1S4EA 3DRSA 4WFNQ 2OSQA 3NS6A 1T94A 3B78A 2R8JA 4AQYF 2C1EB 1MN9A 4NLWA 2C2MB 2V0NA 4Q43A 3MMBA 4DEZA 2NUHA 2VL1A 1RDRA 3US5A 3TA2A 3MPWA 4ECTA 4UT4A 3NKYA 3LP1B 4YR3A 2VC0A 1YZ6A 2ZZNA 3K2YA 4ERDA 4DR3J 2DH7A 4Y2MA 3W5XA 2R7OA 3DU6A 4UOHA 4YMEA 1CJTA 3ZO7A 1WWHA 5DDRC 3MUMP 1UAWA 5L8RC 4B3RF 1WI8A 5F8NA 1M5PC 3MMCA 1C0TB 4LVNP 4JV2A 1HBUB 4FBTA 4OHVA 4NLPA 3L95X 3SBMA 4TQRA 4DPYA 2DR9A 1NXIA 1XNRJ 3D6MB 3ZTSA 2M8DB 1S4FA 1QUPA 2B4PA 4LR9A 4PPZA 2HFNA 1VRQC 3P5TL 3SSRA 4ETXA 3EGWB 1RTDA 4S0MA 2Q66A 2MHEA 1TMMA 1VIOA 2E29A 3B6BA 5E7OB 2UXBJ 1FRKA 5GAGU 5J1EB 3W65A 2YX7A 1RB0A 9RUBA 3NGDA 4DS5A 4OI6A 1FFGB 3C6UB 3D66A 2JEJA 2HHXA 3D1HA 4G3IA 2PN6A 2KO1A 1XNQF 4PWWA 2COLA 1SKSA 3PZPA 2AU0A 3PRDA 4ES2A 2YNGB 4X4QA 1I94F 4ZIWA 1RT7A 5C42A 2O67A 2BMBA 1RWOB 1LKZA 4OHYA 2G2ZA 4NYOA 3A4TA 4PXEA 1S6QB 4TVAB 3NXZA 7FDRA 3LP2B 1GMWD 3CCTA 3GONA 1VYAA 4O3PA 2HRTA 1Y9OA 2BJ3A 5FDLB 5C2GA 3T1YF 2YKQA 3OVAA 3GSIA 2G4BA 1VHIA 3I5BA 2OGUA 3RB3A 1K1QA 1Q95G 1FWKA 1NZAA 4OJ1A 1R43A 4EWTA 4L3NA 3BN7A 4ILMA 3LP0B 4HL9A 2NYHA 2VBZA 1T7PA 3QIPB 3OL7A 2FJAB 3KJQB 2DXFA 3FJ2A 3KJFB 4JI3F 2OTLS 3CWJA 2HVEA 4JI8F 1TL1A 2B3TB 4N8NA 3R5JB 2RMLA 3D6HB 3DLHA 4R0JA 2K06A 3A1YG 2ZE2A 1BWEA 3JAMY 2M7SA 4H4OA 4Z7YA 1TUGB 2VDIA 4OI3A 4P7TA 1DTTB 3D6FB 2GX8A 5B0AA 5HN0A 2ZH4A 3GMGA 3CJKB 2HBYB 2GVDA 2MKHA 4OZ3A 4LF8F 2HGLA 3M8ZA 2W4DA 4MFBA 1Q82T 4F8RA 4TLRA 1T8EA 4ES3A 4OL8A 3AOAA 2D3UA 1C4CA 5I42A 1VQOS 1ACMB 2GAHC 2HURA 2CPZA 3Q8VA 2HHPA 5DZ6A 1ZS6A 4LRFA 1ROFA 3PX6A 2E5LF 2XMKA 1WTFA 4O23A 2YNIB 2F9DA 5KG5A 4JI0F 2ROPA 3DLGB 3PW5A 3H4DA 4FXDA 3NL0A 1VQ9S 4J9QA 2EKYA 3UNGC 1UJ6A 4DN9A 1FKOA 3RTVA 2XS7A 2ASDA 2NR0A 1KWMA 2PDAA 1U24A 2ZVSA 3BM7A 3MWBA 1KOOA 3MCNA 1BGXT 1A9NB 2KJWA 3PW2A 5K14A 4Z7CA 1WF0A 3IMQJ 1N0VC 4ID8A 3PXGa 1NUEA 1JNRB 1S10A 5JVGQ 1ZM9A 3OTOF 1FFWB 2FC9A 3KLIA 1R0AA 5JMNA 3BO2A 2BW7A 2J7WA 4ZPWR 3AJ2A 3R2DJ 4LJMA 3ENVA 5IC4B 3FCVA 1U1LA 4NXNF 4LF7J 5F9NA 1RYRA 1GAOA 1YJ7A 2XMUA 1FKPA 2BE7D 3D3CJ 2C3MA 2XMTA 5H9EJ 5AT1B 2RKIB 3GSDA 3N5BA 3HDSA 2D3OR 1KRPA 1XR7A 1YBAA 4RJVA 2OIHA 1KONA 5L1IA 4CWBA 2QL9B 4FXVA 5HATA 4B9SA 3A8IA 5IQ6A 5HP1A 2V8GA 5A8KB 3KK1B 1U4BA 5A2QY 5D8HB 4DUTA 4KKOA 2OAUA 5B0DA 1HNZJ 5D0HA 5IZHA 1D8YA 4ED2A 1UFWA 4GC7A 4KGMA 2WTFA 1IKVA 3OPKA 1P1TA 3OVSA 4AQYJ 2RJZA 3R6GB 1U6BA 1MROB 3KG4A 5IM0A 3MM8B 1S1VA 1K9MT 3AAWB 2NCKL 4IRCA 3RZAA 3OL6A 1VDHA 4J37A 1A6LA 1UPPA 3QGGA 3BSAA 4ILLA 1FF2A 3THPA 4ENOA 1U48A 2KYXA 3E51A 4PYAA 2DIUA 4ZKAA 3W2VA 2RU9A 4RW9B 3BGRA 2OEMA 1AUDA 4BS2A 2QIFA 3TQ1A 4WPAA 3UE2A 5D3GA 1RT6A 2Z2ZA 3P3DA 3ZTRA 4ED8A 3BGLA 4JI4F 4N5SA 4RWWA 3DCAA 2WZ1A 3PY8A 3H25A 2XNQA 3MD3A 2MKIA 5HQMA 1V5IB 4B02A 3G6ES 2XNRA 3TJAA 4O0IA 2EG1A 2XO6A 1IKWA 2MPUA 2FTRA 2N3OA 1XK8A 3NOCA 1Q8LA 4W98A 2Z2LA 2XSFA 4A8SA 4DOZA 3G6YA 4DSFA 1RAFB 1RTZA 3DFEA 2E5JA 2WVBA 4F2SA 4XDCA 4DPUA 2J0QD 2KZMA 1FRMA 4H4KC 5KFMA 2I6WA 4P74A 3KLFA 3D54A 1N48A 1DZ5A 2GVZA 1Q0NA 2A0FB 3JAMU 1N5SA 2EWHA 4A46A 4OLPA 1ZBTA 1IR1A 1NKBA 4YP3A 1ZTWA 3Q2SC 2M3DA 4LQ9A 5D4NA 3CJRA 1ZM2A 2R7UA 4ICLB 2XMAA 3OFGA 3EDRB 2QLXA 2LXIA 1K1SA 2DGSA 1S1WB 3R5BA 5I4MA 2QG9B 1S57A 3P6YC 3I31A 2QL7B 1QE1B 2V2ZA 1GTHA 1SJ4P 1W25A 4F36A 2VZ9A 2BYCA 1PAEX 4DV1F 4ETZA 5ETMA 2DGOA 3QT8A 1I94J 2AJ1A 3V6DB 4OI2A 2CAJA 1N54B 1VBYA 2QA1A 3V81A 1HQUA 2RUSA 4AYBD 3FNNA 2CPXA 4OV6A 1HBOB 4J7CA 3NMRA 3M2UB 4YB1P 2IDEA 3AD8C 3UW1A 4IDKA 2B9WA 3MZIA 5F8JA 3OT9A 5DDQC 1S72S 2RE1A 5FIIA 2VA3A 3U1NA 1LWEB 3FSXA 3F73A 2DCLA 1N88A 3G82B 1V3RA 2L9NA 2BR0A 3ZZTA 4X4OA 1FD2A 2PIIA 4M5LA 4I67A 1CC7A 3I0SB 1NM2A 1HARA 1T9TA 4LREA 1RI7A 1X31C 3HT0A 2D3ZA 2C22A 3M6VA 3M8QA 1RT3A 5CZXA 4Z37A 1FHTA 2QYCA 1T02A 4KGXB 1JLQB 3PX4A 4FZVA 3K5LA 5CYQA 1XWLA 2BM1A 2E1CA 3LA0A 2XZTB 2B8QA 3DXBA 1YJWS 2M2BA 1XN9A 2OEKA 4JI8J 3MEEA 3HZEA 5KT4A 2KG1A 2UXCF 1N6QB 1RT5B 1S1UA 5H9EK 3SDEA 3MHYA 3AOBA 1R3NA 2YTCA 2ERRA 4X4TA 2CIMA 3IRWP 4NYZA 4USWA 2LYVA 1VISA 3O6QA 2UUAF 3H0PA 1Y7PA 4OZ5A 3TX8A 2ZH3A 2EFPA 2DITA 2DO4A 1TFWA 1TKXB 3MR2A 2N82B 4LF8J 2CQGA 4LUBA 3GV8B 2DBBA 4DV4J 1RU2A 4D3HA 4NRTA 1HNIB 1JLBA 4DSLA 2AJ2A 3ZNUA 3Q0AA 3RBEA 5IXUA 1D3WA 3MMAA 2R9LA 1VLOA 2AJQA 3O5TB 3DOKA 2QFIA 3DI6B 2AGOA 3SCLE 5A76A 2JEIA 2E5LJ 5A2QU 2F7VA 4AE5A 5CYMA 5F0UA 2OPQA 4IYQA 4PQAA 3DM2A 3DRYA 2WHOA 1X5OA 5K8PA 1RGVA 5KT7A 5CCLA 4DZ6A 5F41A 1Q81T 3GU0A 4ZPBA 2NPIA 2HNYB 3IGVA 3RRKA 1K47A 4FVCA 1WKLA 2BE2A 4F4ZA 3FRYA 2F8MA 3TVKA 2K3IA 3OJUA 2BEFA 2UU9F 1TK8A 1VQ8S 4ZPTR 2D69A 4LFCF 2BVZA 3QMQA 5FD1A 3LGHA 3EGVA 3B8HA 1Z4UA 1RWKB 2J0XA 3AY0A 2GHWA 1YDLA 1WEZA 1AZSA 1XR5A 4UY85 2R3VA 3CCQS 1FJEB 3THTA 1U7LA 3W2WB 4ZJOA 3SQGA 1M5HA 4GO5X 3NLCA 4FNHA 4NXNJ 1SKRA 2PEBA 3GIRA 3CD6S 1BE4A 2OELA 1SJ3P 3MR7A 2WRMA 3HHEA 3NCPA 1T9VA 2JRSA 3PJ9A 2O3DA 5DDPC 1S6PA 3H20A 1FX4A 4J9NA 2F65A 1N34F 4MH8A 4X65J 2FGCA 4UZCA 2KTQA 1NO8A 5EN1A 2L3MA 3CCSS 2FQQB 1VQKS 2MB0B 1UTAA 2RRBA 3B54A 1Q86T 1UW4A 5ETNA 3U27A 4Y6IA 4K4TA 3M8YA 2B51A 3IO1A 3PYEA 2RD5C 4X64F 3BV8A 1X5SA 3DN9A 3M9NB 3MM6A 3PYGA 4EUVA 2GGPA 3MCOA 3TA0A 3KOAA 3M4XA 3KK2B 2P6SA 1IBLJ 3HZGA 4ITSA 3IR5B 4K4VA 2RQCA 4M5DA 1DARA 3QATA 4F0MA 3GPAA 4WWSA 3DLEB 2IMOA 3K5NA 5I3UB 1Q8KA 4A8MP 3RYLA 1WG1A 2ZFHA 2LQ8A 1LW0B 1PJ5A 1OPIA 3QRQA 2XO7A 5J2QA 4R8UA 3PW7A 1UWBA 3P5BP 1PAUB 4QYZJ 1HQEA 3BYRA 2K3KA 3OQ2A 1YI2S 4CLPA 2HSEB 3BREA 3M1VA 2EI5A 2UV8A 2XYGB 3MTKA 4LVOP 2C3UA 2HZAA 4Q45A 2MTLA 3R5CA 1FA0A 4ZOSA 2QLBB 4LSLB 1NSQA 1LWFB 4U95A 3EX7B 4PUOB 1T9XA 1JKHA 2GA7A 2Z57B 5GAHI 2YKAA 4OZNA 1EARA 3H2VE 4AL7A 1QY7A 4AT1B 3VR1A 4KGKA 3FMBA 4KAIA 2AMCB 4KJIA 3TUZC 1J2VA 3ADAC 2MKKA 2AYEA 2WBMA 4AL5A 2VFVA 3HI9A 3JB9k 2CFXA 2PFDA 4ZN1A 3E2EA 1NK8A 5G0RB 2XWYA 2VV5A 5MLCV 5HVFA 3D3BJ 4RZRA 1VRUB 4PR6A 1RWVB 3QT5A 3JTOA 2NSBA 4CYUA 2MJUA 3ISZA 3OTEA 4ZVUB 4DHVA 4O3OA 4OQJA 1NJIT 3I87A 5DETA 3HX9A 4YB6A 4Q2MA 4UQGA 2IAJB 1JNZB 2HFVA 1BD6A 2EBGA 2HRYA 1V6HA 4DR1F 3E8OA 4DI6A 4KV8A 4TNOA 1FRHA 4MK7A 3T6JA 1W2IA 5CZVA 2R7VA 4KY3A 1E6YA 2ZH5A 4EGLA 1CJKB 2LVWA 3CO0P 4I6AA 1X4EA 4WE1B 3ZXWA 4ELUA 1Q5YA 3H5SA 1KQSR 4H4MB 3K5OA 4X62F 4GKKF 4RW4A 3BEGB 2DH9A 1KN6A 1KHVA 1HA1A 1KVJA 2R2RA 4LF9F 3FKBA 1RTHB 4URSA 2MGZB 4B9UA 1DFDA 3D6TB 2NSCA 1X4CA 4RWXA 3D67A 4O3QA 2RNEA 5HI7A 5LSLA 4QIVA 2MSSA 3JSRA 4CLYA 4IG3B 5DLFA 2UXCJ 3M8PA 2OD4A 5HL7Q 2CDRB 4ILRA 3ICLA 1FVSA 3EJMA 2Y9HA 1VHFA 4EZ9A 1H98A 4F25A 5F3ZA 3MECA 3RR7A 3SEOA 3CF5Q 5GAHU 2CPJA 3AD9C 3OTCA 2I9SA 2IBOA 3MR6A 1N5YA 4HEA9 3BQ1A 3VAMA 4IFVB 1RT4A 1N8RT 5D6GA 3GYXB 3SIPB 2I1RA 1TAQA 4DFJA 1U6FA 1VOMA 4YDDB 4FF4A 4NI2B 3M8SA 4MKYA 4E0DA 2EBEA 2CJQA 2OPPA 3TW0A 2UVVA 1JXLA 2BJ1A 5IOLA 1SKWA 4YS2A 3SV4A 4FF1A 4KHMA 4RW8A 4HVZA 2L9WA 5KFPA 3CJ2A 3VQTA 4KHPF 4AXJA 2XCAA 3DRRA 4DR2J 2Q1LA 4EU0A 1LW2B 3LW5C 1OWXA 1KFSA 2Y0BB 2BRKA 2IBKA 4B3OA 4OYMA 4DV7F 3ITHB 5HMWA 5A8WB 2R8HA 1JK9B 3RAQA 5HLFA 3J80Y 1DQAA 1D9FA 3IFEA 4ES1A 4O0NA 1AT1B 5LSRA 4QYZK 3FQKA 3OW2R 3HD1A 3AA8A 3HHDA 4ECXA 4E2FB 1BLUA 5HAOA 5T14A 4F7VA 3THVA 2LU2A 2V6AA 2YH0A 3PRVA 1Q5VA 2B6AA 4G1IA 1NRKA 3BGOP 2HK3A 3OSPA 3VWSA 3CB4A 3T5HA 4HYKA 2HW3A 4ID5B 5DQIA 3GFXA 2CJYB 1PC5A 2FGOA 2ZVIA 1WORA 2FJDB 4LBIA 3QGHA 3CSKA 5D0GA 1GXUA 5ETRA 4HDGA 4OJGA 2U1AA 4ZCMA 2DNGA 3NGSA 1NK0A 1JX4A 2HBRB 4RBUA 4NRUA 2X1AA 2CZ9A 3OLBA 2DHHA 2WSEC 2IYIA 5J2MB 2FY1A 3M6WA 3PCOB 5CHCB 4YHHF 5IT4A 3SV3A 1MMLA 1PC4A 1UWAA 2XLKA 3IBCB 3TAMB 1RWXB 3AJDA 3IS9B 5HROA 1NH7A 4ZHRB 1OS5A 1UVNA 1P9QC 2UXDF 1U49A 4I68A 2HWHA 1AA1B 2FC8A 1YJTA 4NLOA 5L9NA 3KTQA 2Z0GA 3BSOA 2D41A 2AYBA 4X2BA 3OL8A 5LJ3Y 4KIAA 4CO1A 2Z8QA 3TJ9A 3AXMA 3PX0A 3GILA 2JH3A 3HSJA 2ZM6F 4I2PB 1DLOB 2QA2A 1PKUA 4O3NA 4LIWA 4OYAA 2BANB 4LMZA 3GFHA 3OTDA 5GMEA 1K0VA 2MLXA 2EXUA 2LXFA 2MMYA 3T9NA 2D9OA 4N7TA 5KFXA 4MKVA 1R8PA 4K50A 4ZVFA 3NG8A 2AZ1A 1HNVA 1TL3A 4RR5A 1CJUA 1HMVA 2WOMB 3HVTB 3UNYA 2DNZA 2R7WA 4WFAQ 2YQ1A 3VGSA 1ZPVA 3HVAA 4IOCQ 1S48A 2YH1A 2BDPA 2Y3YA 4RNOA 3FK4A 1Q78A 2I5JB 4LIRA 2CVEA 1O51A 2ZJQQ 2G1DA 2W9BB 3ENWA 5HMZA 1NK9A 2PD1A 1EJ7L 1FRJA 1JLCA 1F60B 2NQPA 3MXHP 3HHLA 4I2QB 4L3KA 2CJKA 1OPZA 3VTIA 2JZ5A 3AJ1A 5J2NB 1UVIA 2V4RA 2ZOGA 2DNYA 2KM8C 2ASJA 4Q0BA 1ZM3A 2MLZA 3TNVA 4OI0A 3UR3C 3KLHB 2DEIA 2FJXA 1HPZA 3PJXA 4IO9Q 4ZJQA 3GQCA 3H8YA 1M5VC 4LF6F 2H3EB 3F44A 3HFVA 2I38A 1S9GB 1RISA 2EKNA 2VG7B 4DL2A 1Y11A 1X0PA 3MM5A 2FUG9 1RU1A 2G0IA 2BJ7A 3PNIA 4HACB 1VR6A 4DR1J 2DGUA 2AF6A 1RLDA 2Y1RI 3QAUA 5I3PA 2QEXS 3DOMA 3PHEA 2PA8D 3M8RA 3MMBB 2HQ3A 4U6PA 1UCNA 3SFUA 3I9V9 3BGFA 1FT8A 1UVJA 4CCHA 3LTOA 3J80U 3UN2A 4NLVA 2XY7A 1DY3A 4K0KF 3CD0A 2J7KA 2QMXA 3CJ5A 3UD4P 5J2PB 1CJTB 1S79A 1RTJA 1ICEB 1CULB 5EX3A 3X3UA 1SQEA 5GMKa 3NWRA 3MMCB 2RRAA 5KG3A 2PMHA 3CD7A 4DWIA 1MG7A 1EP4B 4NE9C 4EBCA 2CUYA 1CJVA 1TL7A 3D0HE 2CVIA 3SXLA 2GQ2A 4DSJA 1R0BG 4WIQA 1VBXA 1VJQA 2E9TA 3LWLA 4RBVA 1R89A 5C2CA 1CLFA 4L72B 4OZ0A 3I0RA 4NZ7A 4P2MA 2V63A 4A8XA 1WOSA 1VC5A 2ZBRA 2QGFB 5KFGA 3PVXA 1RTDB 4X4NA 3WX4A 4NLXA 3D9BA 4WP3A 4F3MA 3GJQB 2CNLB 2PMZD 2R8KA 3LGNA 2ATLA 2ZH7A 3HPOA 3KNGA 1TK0A 2DNHA 3CCJS 5DDOC 2VHGA 2K7KA 2DH8A 3LQVA 2R2TA 4ZVSB 4I1TA 2V67A 4TY8A 4DR4J 4NA1A 3SMZA 2XS5A 4PXDA 2EFVA 3QRRA 2ZUGA 2LA6A 5A6WA 4DV7J 2AD9A 2CQBA 1X9WA 2AW0A 2GNKA 1I51B 1RT7B 5C42B 2J9DA 4ED0A 2KYZA 2NZCA 3TAPA 2KI2A 2VODA 4EMDA 5E3PA 1N32J 4DN0A 5A8RA 1FI4A 2EK1A 1HWJA 2CJXB 4M5MA 2C28A 4O4GA 2CQ0A 2X51A 2IA6A 3KG1A 3MCSA 4OZJA 4NCBA 2ZWPA 3MM9A 1IR0A 2R2UA 2A6MA 2H5IB 5DG9A 2RDJA 1IWAA 3JYTB 3CE8A 1T3OA 2H4YB 3BGUA 2RQMA 1OJ4A 2HHUA 1TU0B 2YNFB 2ILZA 2XMWA 2OPSA 3CXCR 4ED1A 2YNHB 1YRXA 1WELA 1EQMA 3OFEA 5F8IA 1ZH5A 2DY9A 1SCJB 1TL1B 4DV0F 4F0KA 4OX9F 2VC1A 3VAHA 3CJ8A 1X4BA 2N4CA 3L3CA 3GR1A 3P4UB 4KSEB 1VRTA 3I55S 4YHHJ 5IWAF 1YSJA 2MQLA 2ZE2B 3G87A 1LXJA 2AX1A 1NBEB 5DJBA 2A1BA 4H4OB 2RT3A 3GR0A 3WC0A 3NBPA 1D9DA 4JV0A 4NOHA 1IWGA 2RQ4A 3QLHB 3J7A1 5A0YB 4YUDA 2RIJA 2AJ0A 2G9OA 3I32A 4MFBB 4NLYA 3PW4A 5C5JA 4HR2A 2CQDA 1FFSB 1UKUA 3RU0A 5FLXY 4EYHB 4USVA 1H7XA 4LSNA 2HLUA 1TZ0A 1PIEA 5I42B 2OPRA 4IOAQ 1YKWA 4WFXA 3KFWX 4CTAA 2CJBA 4F4WA 2A6OA 4DL6A 3R7NB 4IQMA 2EVZA 4C2MA 5AXLA 3LAKA 4IO1A 5HO4A 2GHVC 3M2VB 1ZETA 1S99A 1U8SA 1ZOTA 1ZAXA 3ZTPA 3TVZA 2DNRA 4JI6F 1U2FA 1IBCB 1LK5A 3P8BB 4DL0C 5K8MA 1RCXB 2AWZA 2HVIA 4MIAA 2D7SA 1FJGF 1B99A 3LP1A 1S49A 4OYOA 5I3QA 3NP5A 1SL2A 2DR6A 1NEEA 1NJWA 1UP1A 2BRLA 2XSJB 3K7RA 4ECUA 4G1PA 3D68A 1J5OA 3V2UC 2ZBIA 4WTOB 1SC4B 2WAQD 5EUHA 3JTNA 4TQSA 3D0IE 3DDIA 1HBUA 4ED7A 4U96A 3UR0A 3CJTA 4DV3J 1IKYB 2W7OA 1F5BA 2X3GA 3L4BC 2P9GA 1NK6A 4ZPAA 2KZZA 4IH5A 1QVGR 3NNCA 4JI7J 2RQKA 4ED3A 1TKTB 5GVQA 1BQMA 1RHUB 4ANEA 2IVFB 5HJYA 1F3VA 3T1AA 2C3PA 2KG0A 3OFFA 3TANA 2CG4A 1HWIA 4KPCA 1S1TB 4KFBA 5CABA 1S0MA 4N41A 3FSYA 1XC9A 4C0BA 1RBOB 4ZCIA 2FIUA 1FRXA 5J1EA 1AFJA 5KFLA 5IFMA 4DR5F 4J91A 1DBDA 4IUFA 1IKVB 1EETB 4KH0B 1Y0HA 2ZBCA 2VONA 4CO2A 3C6UA 3HVWA 3JSMB 5B0EA 5IM0B 4DFKA 2VA2A 3KWMA 3CDAA 1WNEA 1HKAA 2E1MC 2MHNA 3O44A 3GCWP 1NKCA 4I6YA 3O8WA 3N6MA 4DR3F 1SKUB 6FDRA 4RX6A 1RAHB 5ETKA 4Q5VA 2PI4A 1T11A 3ZC4A 2AGQA 1HBNB 4NZ6A 1KQFB 3JQKA 1S6QA 3H5XA 3EUNA 3W2VB 1UMJA 3R5AA 5KFUA 4DL3A 3VVTA 1I3OB 3BGRB 4BBYA 2YWHA 3LP2A 1F2GA 3QO9A 3EZOA 5HBMA 2PT0A 1YGYA 4RO0A 2MXYA 5LL6d 2G0CA 3PM9A 1DURA 4Q7AA 3DMJA 1EZZB 2DCUB 1TKDA 4DUZJ 1SJFA 3MF5A 1KP6A 4CRJA 1RWPB 3W5ZA 2VPXB 4OZ1A 2E1RA 2QE5A 4KC5A 5C24B 5IV4A 2WSFC 1FK9B 1U0SA 3GB0A 4A8FA 2IJNA 2LLZA 2Y1JA 5LMNJ 2BBEA 2Z58B 3QIPA 4G6VB 2P9CA 1HWKA 2OSRA 1IQTA 2ZC3A 4MK8A 1IKWB 2F4VJ 4P9SA 5GAEI 3HO1A 3VZHA 2HIQA 3GIIA 3VGUA 3Q22A 3KKFA 1R0CB 3W9JA 2QL5B 3R7BB 3GFYA 1ULRA 1N33J 3FRZA 2WSCC 1JIHA 2UXBF 4P2SA 3ZNJ1 2HNDA 3UQSA 1QD1A 4ZVQB 3KLFB 2KT2A 4P2XA 2PA3A 4OYXA 1RSCA 2KT5A 3GJTB 1DTTA 2EC0A 5CD4H 4LF5J 1NK4A 4QWDA 1PJ7A 3AHPA 5KFWA 1M5SA 4AXIA 4I0WA 3UCGA 3GLJA 1S59A 2R2SA 3IM9A 1O8BA 1TQLA 3V4MA 3NY0A 3FQLA 4W4MA 5K8OA 2A18A 5FLXU 2QZ8A 3ZZOA 3LUYA 2CZ4A 4W92B 3T3FA 1P8GA 4I64A 2YNIA 1QSYA 2FHJD 1SL0A 2PFFB 4G1QA 2BM0A 3V81B 1KTQA 1VQ4S 2J0SD 4DQPA 4C3KA 3TAQA 4J9VA 4ZP7A 1M1KT 4QWCA 4XO0A 4ZLPA 1SJRA 2Q43A 1V5VA 3HFZB 1HYSB 2VQFJ 4CNYA 3IBFB 1KR4A 1PO6A 2Z30B 1WG4A 2KU7A 4YR2A 1T05B 1R7IA 4C48A 1G6BA 3FBFA 3MPDA 3HVRA 1X60A 2KJVA 2CQPA 4V19J 1W7WA 5AXMA 1YJUA 1NAQA 2JEGA 2ADCA 3VALA 3M8QB 2E5HA 1Z2ZA 1LFPA 1SL1A 2F3JA 3PKMA 3GWCA 3T5LA 1J27A 2LFVA 1QSLA 3DGPB 3POTA 2JL9A 1YBUA 1C1CB 3PDNA 5D0EA 4OX9J 2ADBA 1IQZA 4DU8A 3DRPA 4QBUA 1VS3A 3A3OB 3G4SS 1SVDA 3CPWR 5IWAJ 5GAEU 4Y2KA 4DCJB 3NAHA 1AFIA 3QT6A 2DHGA 2B4OA 2ZDOA 1SXLA 1M5KC 3MMAB 2M70A 3BN4A 3DOKB 5F8GA 5A8KA 2DVIA 4OX7A 3K8VA 4N47A 3W8PA 4CLUA 1MN7A 1GNKA 1I1GA 1YHQS 5CYMB 5CYJA 4WIIA 1B4SA 1I6JA 1JB0C 4C8KA 2VBWA 5CH7B 3NGRA 2QLFB 3F56A 3BJYA 4CLTA 4Q2LA 3WX8A 5DGAA 3I56S 4LR8A 1WC1A 2ZD1B 4K4YA 2W2MP 1X5PA 1G4CA 4JI6J 1MROA 3MM8A 2MQ8A 2H4WB 3FZBA 1FJGJ 3K57A 2XG8A 5B08A 1LK7A 3HK2A 1M5OC 4DPOA 4DLEA 3OSNA 3TA1A 1J5EJ 2QX0A 2W2QP 2RF2A 1FXRA 3W1YC 2GMLA 2JVRA 3K17A 3IWLA 5T7LA 4UUXA 2DGTA 3N28A 4DG1A 2JLGA 5ITHA 1OSDA 2CWKA 3SFGA 1NCLA 2M5YA 4DS4A 1TVRB 2Y0SD 3G6XA 2VFUA 5B0GA 1EAYC 1P9YA 2HFSA 3IAM9 2CQCA 1UVKA 2IRXA 2DO0A 2IC3B 5K8NA 1WUUA 1Q7LB 2UP1A 2CQ2A 2ROEA 3H42A 4OZLA 4F3QA 1WD6A 1RT2A 2B5JA 3MOZA 2Z2MA 2ASYA 1HNZF 2IJFA 3MM7B 1N5TA 3GJSB 3GG0A 2FYXA 1CQMA 1NDPA 2JFKA 3L7PA 4CO0A 2B7CB 2CNOB 2FHMA 4DR5J 1XJWB 1S1WA 2N3LA 2BKNA 3R2CJ 2ATCB 3MM6B 1FX2A 1QE1A 1OY6A 4EI2A 1A0OB 3TARA 5RUBA 5HVGA 2DGQA 1TTHB 4K2XA 4O3RA 3C14B 1RWWB 1JJHA 1BUXA 4QOTA 3FCHA 2RH3A 5H1SV 1JLGB 1OYDA 3GJRB 2YKNA 1XR6A 1CSJA 3MGJA 2NXJA 3ETOA 3K5PA 1OSCA 3DRXA 4GC6A 4JI1J 1PJ6A 3PEJA 5CCMA 3FEYB 1HBOA 2V4QA 4TYAA 3M2UA 5KG4A 1S9FA 1S0NA 2UVRA 2ZITA 3S8SA 4R0EA 1ZA2B 3DOLB 5J2QB 4R8UB 2D9PA 1UWBB 2MKJA 5KFIA 4R5PB 3CGIA 3G82A 2AEJA 2ZHBA 1U0HA 5E3CA 4IOBA 3M1VB 1SUQB 3I0SA 1M0SA 5BYQA 4F02A 2HAIA 2KRBA 1YITS 3CNQP 2DGVA 3CT9A 3Q24A 1WC5A 1JXEA 4ECWA 1JLQA 3HHKA 2UVUA 3LO3A 2HRUA 2WVFA 2MZTA 5KFOA 1VQ7S 4CLZA 1JKHB 2GMJA 4ECZA 1U1QA 5E3QA 2QYGA 4YDXA 1T9WA 4P75A 2QA4G 4NLTA 1CQNA 4HHJA 2UUTA 2CKWA 3KUGA 1RT5A 3T5KA 2R7XA 2J6TA 3H2LA 1YIJS 3D5MA 3Q23A 2HIYA 3O2IA 4CLFA 1U47A 2FJEB 3TOQA 1TKXA 1NSKL 3OXGA 4RU9A 3MEGB 3BH6B 2XB2D 1HNIA 4KT0C 2XYHB 3I6PA 4DSIA 4NL5A 2DR7A 3AB2B 4U7UD 4ZCKA 2G2OA 2J9DE 3W9IA 3KMQA 3NGUA 3DI6A 1M1GA 1HHTP 1D8ZA 2XY6A 2CQ1A 5L1LA 2IYGA 5D77A 4C7QA 3P45B 3Q8RB 4F0HA 4KQZA 3RAXA 3T41A 2HS0A 1Q4RA 1RTIB 2L08A 5K20B 1JJCB 2ILYA 2ZNZA 4KV8B 1DHMA 2DHAA 1WC4A 1NZ8A 1NJZA 4CIOA 2HNYA 1RUSA 1E6YB 1MWQA 4DL4A 2CPEA 2BZ2A 3DKDA 2HAFA 2GIQA 2LQ9A 4NMXA 4URQU 1RT1B 4XTTA 4RW4B 1L3UA 3HJVA 3N01A 5BR8J 2KFNA 4WKRA
chains in the Genus database with same CATH topology
1Y3JA 2NYIA 2QSWA 1QAIA 1BY9A 2KXFA 2P6TA 2LQBA 4RKUC 4A48A 1U6FA 4ZK7M 4DFJA 1VOMA 4YDDB 4FF4A 3MDFA 2I8EA 1HW9A 1S1XA 3M8SA 1JJ2R 1R6YA 4MKYA 2HZCA 4E0DA 2EBEA 2F40A 3C2PA 1S97A 2F8HA 2HHVA 2CJQA 2OPPA 2X1FA 3FEZA 2JSXA 5GADU 3TW0A 4TY9A 4KPYA 2UVVA 1JXLA 1FXLA 4BWJA 2L48A 4ZVEA 2KH9A 1SKWA 2CYYA 3EXYA 3G96A 4YB5A 3N6LA 3SV4A 4O4RA 4FF1A 1X4FA 2KKHA 3HKWA 4KHMA 4RW8A 1A7GE 4HVZA 2L9WA 1DRZA 4K5RA 2A3JA 2RDIA 1WHYA 3AQOA 5BJRA 3IXQA 5KFPA 1E6VB 3CJ2A 2KFYA 3KK3B 3GYNA 3UDLA 1O0PA 1U26A 2CPYA 3VQTA 4KHPF 4AXJA 3KYLA 2XCAA 1JMTA 6FD1A 3DRRA 1L3TA 3K59A 4XIUA 3CDUA 5KFDA 3AH6A 2Q1LA 3C6TA 1LW2B 4EU0A 3W2WA 5THWA 2RRNA 3LW5C 1OWXA 1KFSA 1Y5IB 1KNZA 1WHXA 5IT9Y 2BRKA 2IBKA 1IKXB 4L6V3 1F5CA 2C2EA 4FPRA 3SCJE 3C3LA 4LF4F 4B3OA 2MY8A 2WCXA 2BV3A 3V6HA 4DV7F 3ITHB 5HMWA 5A8WB 2R8HA 2NPFA 4NLGA 1JK9B 4WF9Q 2F8EX 3I0RB 3O3LA 2W8LA 3RAQA 4B9LA 1NB7A 2XS2A 3RW6A 2VQFF 5HLFA 4IR1A 2HGNA 3J80Y 1DQAA 3MUTP 1D9FA 2R4FA 3MECB 2IM1A 1TR0A 4DV4F 5J2MA 1YTYA 3UFCX 5KG7A 4PWDA 3LH2S 4TYBA 2ABYA 2ZD1A 4JBCA 3IFEA 1WTBA 4Q8EA 1HI1A 4HH1A 5T41A 3M6XA 4ES1A 2IMWP 1TL5A 5LSRA 1KEKA 2UUWA 2IM0A 4I69A 3KJVA 1JLAA 2B4VA 3FQKA 4DQRA 3OW2R 2KVIA 1HHSA 1KQGB 1SV5A 3AA8A 3HHDA 3IS9A 3QWPA 4ECXA 2JEFA 2MQNA 1G1XA 1BLUA 2B56A 1JWWA 4ZHRA 5T14A 1GXTA 2APOA 2KDOA 3GIKA 4PXCA 2CZVC 3QZ7A 5C25B 1RT4B 2FVQA 2XLIA 3THVA 2LU2A 3CCZA 2YH0A 1H7WA 4F4KA 3SI8A 2B6AA 4G1IA 2EFOA 4WK1A 4CI0B 2DB1A 1NRKA 3CC4S 5DQGA 3N79A 5L38A 3MEDA 3OSPA 5KG2A 1KQKA 1ZZFA 1DTQA 3GZ7A 2J9CA 5E3RA 3VWSA 1S1XB 2W25A 3CB4A 2GV1A 3T5HA 4HYKA 4HLBA 1GTEA 1T03B 1OIAA 1D0EA 2HW3A 2OPPB 2YWKA 4ID5B 2MQQA 3HM9A 5DQIA 1HNWF 2LMIA 3GFXA 2AQ4A 5B7WA 4BCAA 1PC5A 4O3SA 2FGOA 3ZZYA 3GV5B 3DHWC 4ZDNA 2MJNA 5KG1A 2FJDB 1YJRA 4RW8B 3UWTA 3EPGA 2JDJA 3QGHA 3BO4A 3CMES 3CSKA 2HWTA 3G8QA 1GXUA 1UA0A 4IQXA 2HS4A 2LCWA 3DRRB 3DLKA 2HWIA 2SXLA 1MSWD 2B9XA 4HDGA 1ZZNA 2VPYB 3KK2A 4OJGA 2VG5A 5BYSA 3P49B 2U1AA 2CQ4A 4ZCMA 3KLEA 2GMHA 3I5CA 3L09A 4O44B 2DNGA 1NK0A 4MYTA 4B9VA 4B3OB 5CQGA 5KFNA 3M9MB 4RBUA 1JX4A 2NUUG 2BANA 1TVRA 4NRUA 4B08A 3KLVA 2X1AA 4CT9A 4FF2A 3DLJA 4O4GB 3OLBA 5HLFB 1M90T 3FGVA 4C4WA 2WSEC 2IYIA 5J2MB 3DC2A 1VQSA 2FY1A 3M6WA 4YHHF 5CHCB 2BJEA 5IT4A 2A10A 2C3OA 3SV3A 1TFYA 1QVFR 1MMLA 1PC4A 5LSOA 4ZA1A 2VG6B 5DM7Q 4BDPA 1LV5A 1LWCA 2XLKA 3KJVB 2IC3A 3BR8A 3TAMB 3I9ZA 3CCWA 3H98A 3MM9B 4OIXA 1LW0A 1SV5B 2MZQA 2VFTA 3IS9B 2J0WA 3LALA 4M8LA 1NH7A 5EX0A 5HROA 4IH6A 1C1BB 4ZHRB 4X66F 1OS5A 2E9ZA 3CD5A 3TR5A 1UVNA 2KHCA 4N76A 4Q44A 1P9QC 3Q2TC 3KMSA 3MPYA 3I82A 4I68A 3HFKA 1U49A 2UXDF 1BQNB 2YWEA 1GX6A 2WOMA 1NU4A 1WG5A 2HWHA 1P6TA 2FC8A 1YJTA 2FHKA 2QLWA 3M30A 4FS1A 4YEAA 1FERA 4NLOA 5L9NA 1FNMA 1WF2A 2ZH2A 1FD8A 2LKZA 3V6JA 3KTQA 4RW7A 2OLWA 2Z0GA 3MEDB 3MPVA 2QO3A 4LQ3A 4NLQA 2ZJRQ 3IA0A 3BSOA 1T95A 3MM7A 2OPSB 2D41A 2R7QA 3VQSA 2VPWB 3IWXA 4USJC 5EGYA 5F8MA 2AYBA 2XMVA 4CO3A 4X2BA 3OL8A 3EYZA 4WU2A 3G8TA 2FLLA 4AUKA 1WI6A 3T5JA 2KN4A 1ZTTA 5LJ3Y 1IJFB 2I5JA 4KIAA 4XK8C 4QWBA 4CO1A 3TUJC 2Z8QA 3OJSA 2GO9A 1VMBA 1D9AA 7FD1A 3QGPA 1WHVA 1FKOB 4X4VA 3RB0A 2W9BA 2QMWA 3VCDA 2L41A 3PX0A 1Q79A 4NPOA 1G7CB 3GILA 2JH3A 2Q3PA 2FJWA 2J6SA 3DLKB 4MJKA 4TKTA 1KLNA 4I2QA 4LSLA 4BC9A 2ZM6F 2CJ9A 1LWFA 3OXFA 5B0FA 4IRKA 4LF7F 2BACA 1GH8A 4X65F 4PUOA 4I2PB 1HL6A 3DDKA 3KLEB 1DLOB 2V8DA 4URGA 4YB7A 2QA2A 4X4UA 1IN0A 4FBUA 1OQ6A 1VGYA 1VLYA 1H2UX 4MKAA 5KFSA 1Y5LB 1YVFA 3L7OA 4O3NA 4A47A 2CPDA 3T6BA 2QA4S 4LIWA 2BANB 2CPFA 4LMZA 3NBPB 3GFHA 3OTDA 1YWXA 2JHEA 3H5UA 4NCGB 1VQ5S 2DR5A 4GKJF 3HMJG 3RW7A 4K4WA 3NRBA 1J5EF 1JLGA 3OV7A 1K0VA 3C8YA 2LXFA 3NS5A 2MMYA 5K14B 2VB6A 3OR1A 3T9NA 3KLHA 2NZ4A 5B09A 2D9OA 1S77D 2RUGA 1LWCB 5KFXA 1PGZA 1ZPWX 4K50A 1R8PA 5E33A 3I4HX 5GAGI 4ZVFA 3NG8A 3KLIB 5LMUF 4K4SA 1R0AB 1HNVA 1TV6A 4LSNB 1TL3A 2DNKA 5D78A 2ACYA 2OPRB 3V5RA 4QWEA 3DOLA 4YFUA 1GXLA 2OTJS 1HMVA 2HHHF 2WOMB 3HVTB 2FJBB 2ZDPA 1C0TA 4R5PA 2DNZA 2R7WA 3IR6B 5B0BA 1H38A 1IBLF 1Z1ZA 4WFAQ 4NXMF 2VG7A 5B0CA 2EFGA 1ZPVA 1QAXA 3CCES 3HVAA 4IOCQ 1S48A 4RW7B 3HLUA 3TVYA 1SJQA 2KM8B 2YH1A 2VFSA 3BDPA 2RU3A 2ZKTA 3Q8PB 4NA3A 5KOXA 3M9OB 2BDPA 4B9MA 2Z4PA 4RNOA 3DRSA 4WFNQ 2OSQA 1B7FA 1Q78A 3NS6A 2GJ2A 4A8WA 1SUQA 5AE1A 1CC8A 1T94A 1PILA 3B78A 2I5JB 2R8JA 1UJ4A 4E98A 3GG1A 4LIRA 4AQYF 1FKPB 2CVEA 4NLWA 1O51A 1U6BA 2ZJQQ 2MZRA 2V0NA 3R3TA 2G1DA 2E44A 2W9BB 4Q43A 3ENWA 1S7HA 3MMJA 2NXUA 5HMZA 3MMBA 4DEZA 1NK9A 2PD1A 1FRJA 2NUHA 1JLCA 1F60B 5DS7A 4C97A 2VL1A 4RU2A 2NQPA 3MXHP 1RDRA 3HHLA 3US5A 4I2QB 3ZZZA 4DX8H 2D74B 2XCPA 2CJKA 3TA2A 2CJAA 4EZ6A 3MPWA 4ECTA 3NKYA 3KHLA 1OPZA 1GT8A 3VTIA 2JZ5A 4HDHA 5AE3A 2FLNA 3LP1B 5L1JA 1XERA 5HP1B 1Q7YT 5EHHA 2JOQA 2HPUA 3AJ1A 4YR3A 5J2NB 1UVIA 5KTQA 2OKQA 2V4RA 2VC0A 2P9EA 2ZOGA 2ZZNA 2DNYA 3K2YA 3DHXA 4ERDA 1X7VA 3BS9A 4GO7X 3QZ8A 2KM8C 4DDFA 2ASJA 4XPCA 2X1BA 4Y0FA 4KKOB 1IUJA 3V4IA 2DH7A 4Y2MA 3PIOQ 4Q0BA 1ZM3A 1UEVA 4ZCLA 5M2PA 3TNVA 4J9PA 3OR1B 4OI0A 3UR3C 4WE1A 3KLHB 4FP9A 2EFNA 4DL7A 4FNIA 2R7OA 3DU6A 4WXOA 2HHWA 1VIXA 4YMEA 4N8OA 2FJXA 3QWUA 1Y00A 1WWHA 1HPZA 3PJXA 4IO9Q 5DDRC 3GQCA 2GHPA 3RB4A 3H8YA 2N4DA 3MUMP 5K5MA 4B9TA 1B64A 1M5VC 1UAWA 5L8RC 1TKZB 1TL3B 4PG8A 4B3RF 2CQHA 4LF6F 3F44A 2M8HA 1WI8A 3PO4A 1HMVB 5F8NA 2I38A 1M5PC 3MMCA 2MGZA 3MEGA 1S9GB 3D1OA 1C0TB 1RISA 4LVNP 4JV2A 1HBUB 4FBTA 4OHVA 1N52B 2VG7B 4NLPA 1S1VB 3L95X 2K8GA 3MEKA 4DFMA 2B43A 1ELOA 4DL2A 2J9EA 1X0PA 3MM5A 2FUG9 4TQRA 2DR9A 3SYZA 2PI5A 4CT8A 2YNGA 3PNIA 2GIRA 4QZVB 2FPHX 2MKSA 3CCMS 2BQUA 1KD1T 4TXSA 2DGUA 4C0OC 2AF6A 2BXJA 2M8DB 3F41A 1S4FA 2Y1RI 4IG3A 4OJ3A 2AP6A 3QAUA 2LECA 1QUPA 3E3XA 2AJ4A 4NCAA 5I3PA 4JI1F 3VAFA 2QEXS 2B4PA 3DOMA 3O1LA 3PHEA 2PA8D 3ENQA 3MAHA 3M8RA 4PPZA 3MMBB 2HQ3A 4U6PA 2X1GA 2HFNA 3OL9A 1JLCB 3MR3A 3P5TL 2JC0A 2HHTA 4IKAA 4NLDA 5HMXA 1RTIA 3SFUA 3SSRA 4ETXA 3GIJA 3I9V9 3EGWB 2LQJA 3BGFA 2HLTA 4B3MF 1FT8A 1UVJA 5L1KA 2WBRA 4ALZA 4CCHA 1RTDA 4QW9A 2RVJA 4NLVA 2XY7A 2ALZA 2ASLA 2Q66A 2DNMA 4A4JA 4USIA 5FDLA 1N5QA 4LFAF 2MHEA 3FDSA 4EO8A 5D3GB 1U1PA 4K0KF 3TUIC 1VIOA 1RT6B 5EWGA 3CD0A 3V4IB 4Q0BB 2E29A 4DLGA 1FJCA 2J7KA 3I4PA 3OFHA 2QMXA 5E7OB 4ZVGA 5KFQA 3CJ5A 2DHSA 4C8ZA 3UD4P 4WFZA 1RT1A 5J2PB 1FRKA 1S79A 3CJ0A 5GAGU 1RTJA 2V9WA 5J1EB 4QWAA 2PSZA 1Y3KA 1GQEA 2QV6A 3GE9A 4M94A 2HS3A 2YX7A 5MAOA 5EX3A 3X3UA 3NGDA 2JC1A 1SQEA 3LP0A 1QAYA 2ZOFA 5GMKa 4DS5A 3SZ2A 4OI6A 4HTJA 2BQRA 1FDBA 3MMCB 4C3MA 2RRAA 1V9OA 1H2TZ 3C6UB 5KG3A 2PMHA 5DLGA 3SSSA 2JEJA 3CIZA 3CD7A 3D1HA 2HHXA 4DWIA 4G3IA 3TYTA 5KT2A 3H2UB 5J1PA 1VQ6S 4QIGA 1EP4B 2PN6A 1DQ9A 2KO1A 4KRWA 1XNQF 2COLA 1SKSA 3VZIA 3PZPA 4EBCA 3PRDA 2AU0A 4K59A 4ES2A 4DL5A 2YNGB 4X4QA 4RUAA 1I94F 1QJHA 4ZP6A 3KK3A 3B4DA 3D0HE 2I2YA 5JJBA 1E6VA 2ZKUA 3LANA 1RT7A 2CVIA 1KVIA 3SXLA 1MU2A 5C42A 2O67A 2YKMA 2GQ2A 5EWEA 3WZ0A 1LKZA 4DSJA 1N4LA 2WW8A 4OHYA 1LW2A 1QM9A 1VBXA 1U25A 4NYOA 5KFHA 2E9TA 4WU3A 1SBRA 4K4ZA 1TAUA 3LWLA 2FD2A 4RBVA 2HVZA 4J9KA 3UPFA 4PXEA 1IKXA 1S6QB 1R89A 3LF0A 1K73T 2YX1A 1CLFA 3ITHA 4L72B 3CIMA 3C66A 4CO5A 4OZ0A 3I0RA 4NZ7A 3CJKA 4A8XA 1VC5A 7FDRA 3LP2B 3N0VA 5KFGA 3PVXA 1YQHA 5KOWA 3CCTA 1RTDB 4X4NA 5D4OA 3WX4A 1WACA 2JVOA 3HP6A 3DDNA 1C2PA 5IT0A 4O3PA 4NLXA 2KXNB 1Y9OA 4DSEA 1S76D 3OXLA 5FDLB 4RNFA 4F3MA 2PMZD 5L9XA 2YKQA 3SCIE 3T1YF 2Q79A 4ZP8A 3OVAA 2R8KA 2NLWA 2VOPA 2G4BA 2JWNA 4RUCA 1FKAF 2J5AA 3LGNA 2ATLA 2ZH7A 3HPOA 3KNGA 2AX0A 3PFOA 3I5BA 3BB5A 3RB3A 1K1QA 1TK0A 1RTJB 2DNHA 1NZAA 3D0GE 3CCJS 5DDOC 4DFPA 1FCAA 4OJ1A 2K7KA 2DH8A 1R43A 4C11B 4XPEA 2W4PA 3LQVA 4EWTA 1NHUA 2R2TA 4L3NA 4NWBA 3BN7A 4ZP9A 4ILMA 3LP0B 4I1TA 3K0JA 4HL9A 1T7PA 2VBZA 3DLGA 1MMNA 4TY8A 1X8DA 2G13A 4NA1A 3T19A