1FF2A

Crystal structure of the c42d mutant of azotobacter vinelandii 7fe ferredoxin (fdi)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDDALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN I
publication title Structure of C42D Azotobacter vinelandii FdI. A Cys-X-X-Asp-X-X-Cys motif ligates an air-stable [4Fe-4S]2+/+ cluster
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ff2A00
2Y0SD 1SIZA 1KEKA 2XSJA 1WTFA 2V4JB 2FJAB 1FEHA 2O01C 3MMAA 5BYSA 2V2KA 1Y5NB 1H7WA 1Y5LB 2VPXB 5BYQA 2C3UA 3MMCB 4XDDA 1G6BA 5BYRA 5E7OB 2IVFB 1FRHA 2FJEB 3GYXB 1FDAA 2XSJB 1Q16B 1FCAA 1VJWA 3MM9B 1D3WA 1PC4A 4RKUC 2WAQD 5CHCB 3MM8A 1GTEA 2C3PA 2FDNA 2WSFC 1FRJA 1F5BA 1H98A 4KT0C 3HKZD 2WB1D 1CLFA 4Y28C 1BWEA 3MM6B 1G3OA 3OR2B 3OR1A 1BQXA 2VPYB 1DFDA 1R27B 4XDCA 1FDBA 1GAOA 1KQGB 3EUNA 2FJDB 2PA8D 1JNRB 6FD1A 1F2GA 2WSCC 2ZVSA 1FTCA 3EGWB 3MMBB 1Y5IB 2C42A 5L8RC 3LW5C 1FDDA 3IR5B 1B0PA 2VPWB 4OV1A 1B0VA 3C8YA 1H0HB 1GT8A 1FXRA 6FDRA 1PC5A 3MM7A 2VPZB 3IR6B 1FRXA 3MMAB 7FDRA 1SJ1A 1Y4ZB 1FF2A 2GMHA 2C3YA 2Z8QA 3MM5A 1ROFA 4AYBD 1BC6A 1AXQA 1FXDA 2GMJA 2C3MA 1FRMA 3PNIA 1C4CA 1FERA 1GTHA 1FRKA 4ID8A 1K0TA 4XK8C 1JNZB 3MM8B 1KQFB 7FD1A 1FDNA 1SIWB 4YDDB 2FGOA 1JB0C 2FJBB 3OR1B 1HFEL 3MM9A 1BLUA 1F5CA 1RGVA 1IQZA 1XERA 2C3OA 4CI0B 1BD6A 3IR7B 1DURA 1C4AA 3MM6A 3OR2A 1FRLA 1DAXA 3EXYA 2UZAA 2V4JA 1FRIA 2WSEC 2PDAA 4OMFG 1A6LA 4DHVA 1B0TA 4L6V3 5FD1A 2FD2A 2PMZD 3MM7B 1H7XA 5CH7B 1FD2A 3MMCA 2VKRA 3MMBA 3MM5B 1IR0A
chains in the Genus database with same CATH superfamily
3HULA 2M52A 3UR0A 4ZDNA 4A46A 3TP2A 5HJXA 1YBUA 5HP1A 5KG7A 2BABA 4MAKA 2VA3A 1W2IA 4URQU 1TVRB 1Q16B 1RT2B 2EW9A 2JEFA 2G4BA 5DLGA 1LOUA 4LFCJ 2ADCA 1VQ5S 3NGSA 2BQUA 1FO1A 1VRQC 5KG6A 3A8EA 3QFWA 3HD2A 2VC1A 4OI6A 4PXCA 4N77A 3CCLS 5GMDA 4Z37A 2JOQA 3FZ2A 1JXLA 2KN4A 4GO5X 1RAAB 2GVDA 2FZGB 1KVKA 4MIAA 3ZTQA 2HQ3A 5CD4A 2OMOA 2OTJS 2DGSA 1JK9B 5K8MA 2GFFA 2F40A 4Z2XA 1HHTP 5CAAA 2GGPB 2J7WA 2MKJA 5CYMA 5HQLA 4WE1A 1A6LA 1S76D 4F04B 2OD6A 1TK0A 2UUAF 4C8YA 3K17A 5KFAA 2V50A 1J5EF 4FXWA 3QGIA 3NGTA 3ZZTA 1U1LA 1AA1B 1R7IA 2G9OA 2WBMA 4LQ9A 5HQMA 1JLEA 3C3LA 4BWMA 1GX6A 4E98A 2HIYA 1WC5A 1CEZA 1S6PA 3IG1B 1XBWA 2FGCA 4M1KA 1TP7A 2HFNA 3NS6A 4CLFA 4NLYA 2YNIA 4UOGA 3R8YA 2UXCJ 3ILIA 1TK5A 5HAOA 2KB2A 2KI2A 1WOPA 1H2TZ 2MZTA 3MUVP 2DNKA 1FRMA 4DFMA 2W4DA 1X4CA 2J9DA 1HWUA 1RLCL 2HRUA 3FNNA 3RRGA 4YQWA 1QTNB 3C66A 2DVIA 3SCIE 3LP0A 1WUUA 2K06A 3HXMA 3MXHP 4MIBA 2KVIA 3IN5A 1CG2A 3PIOQ 1HIYA 2OKQA 3ISND 2R7VA 2AQ4A 1VQ9S 3IWXA 5J2PB 2GVZA 4XTTA 4FYYB 1FHTA 3R1HA 2VBZA 4O3RA 5IM0B 1YIJS 3KYLA 4FPIA 3Q2SC 1MROB 2BJDA 1QY7A 2LA6A 3K8VA 1YX2A 4C3MA 1RU2A 1FTCA 3QATA 4KQZA 1B0PA 4EWTA 3SQGB 4LF9J 3NAHA 1WC0A 4NYPA 4ED4A 1HNIB 1LXNA 3LA0A 2QZ8A 4AQYJ 4LFBF 2ZWOA 4NPOA 1FEEA 3HZEA 4MYTA 1WHWA 1U1KA 1HI0P 3UDCA 1CS4B 3EICA 4DR1F 2KTQA 3A4TA 1V5VA 3H59A 3EXYA 3GG1A 4O3SA 3VVTA 3HHLD 5KFCA 2Q6CA 3RW6A 4ECSA 5A8WA 2VICA 3IMQJ 5GAGI 4I0WA 2ZH4A 4P52A 3W61A 3KHHA 1KTVA 2IRXA 3KTQA 1AZSA 4DR5F 1KLMB 3DOMA 4JOUA 1OO0B 2FDNA 3MM6B 1G3OA 3AD7C 1RYRA 1GXUA 2FVSA 2SXLA 1V3ZA 3HX9A 3TAMB 4LFAJ 1VOMA 1WG5A 3BBCA 1F2GA 3ZFVA 2GC8A 3O44A 2ZC4A 3NS5A 4ES2A 4OX6A 4I1TA 2UVRA 5EX0A 2CDRB 3DOLB 2LDIA 4OI0A 1XIQA 4QWCA 1HA1A 1R89A 2ZH1A 5EX3A 3QMQA 2HBQB 1F60B 5LJ3Y 3LO3A 4BS2A 5FDLB 4JI0J 2BEFA 3MAAB 4LR9A 1IR2A 2JC0A 4JV5J 3L3CA 4Q8FA 5B0GA 3DLEA 2JHEA 3CUNA 3UD3P 3RB4A 2GO8A 1NK6A 3BR8A 1VBZA 4ICLA 2FHKA 4XO0A 1RHKB 2KZMA 4DF8A 2VDIA 3NOGA 3KLHB 4CCHA 5J2QB 4PQUA 2HAIA 3U27A 4DR7J 2C3UA 4OHYA 2H51B 4Z7CA 1RTIA 1GXLA 3PW4A 1UEVA 3H2LA 1LW2B 4ES3A 1Q53A 2YKNA 4ZA1A 5ETNA 3M2RA 3QGHA 2FC8A 4RW8B 4BDPA 3I4PA 3QSIA 4J5OA 3PYFA 3M8WA 5CABA 1F3VA 3LGMA 4J9NA 2HZVA 1M5VC 4ECTA 3JSMA 2XMMA 1PC5A 3HZGA 5F41A 7AT1B 2C2ZB 3NNCA 5A76A 4V19J 1HBNA 2COLA 1A9NB 2WVFA 5E3AA 4CDIA 3DI6A 2QL5B 2MQLA 4N56A 3FQLA 2F8MA 1YVFA 4BWJA 3AA9A 1OY8A 3AT1B 5IQ6A 2LA4A 1I94F 5IOLA 5KFEA 1SQEA 2MKKA 4OZ3A 2OPPB 2MSTA 4ANEA 2I2YA 3E51A 3MAHA 4DV1F 4K4YA 1RAFB 1XNQF 1REVB 3MD1A 3OFFA 1U7LA 3OTOF 4NCAA 3V81A 5M2PA 2YX4A 1RWNB 2IVYA 4HHUA 3W64A 4ER8A 5F8GA 3CC7S 3FFIA 2AEMA 3GYXB 1KQSR 3BS9A 3M8PB 2VQFJ 3I0RA 2KL8A 1N32J 3GIRA 3K7RA 3J81U 2DEIA 3E01A 1QAXA 2IIHA 3FBCA 2B7BB 4X64J 1SKUB 2IJFA 1VCTA 2RF2A 5I3UB 5D4OA 2OSRA 2R2UA 1RKIA 2K3IA 4G3IA 2VPWB 3OVSA 1C2PA 1DTTA 2XBPA 4OHWA 4F50A 3K5PA 2XGPA 1KOOA 1AT1B 4F0KA 1N56A 4CO0A 4MIWA 1T05A 3HJFA 2CXEA 4L3KA 1KP6A 4A47A 5JMNA 1YBTA 3CIMA 5KFJA 2MZ1A 2EFNA 1P9YA 2GVDB 3US5A 4WK1A 1C0UB 2FD2A 3F73A 1S1WA 3ISZA 4WFYA 4OJHA 5B08A 2J5AA 4C8ZA 2PA3A 2PO4A 2M88A 1RT1B 4TY8B 1ZBTA 4EFAC 2OSQA 1ZYQA 3W2WA 5KFVA 1NJYA 2WONA 2KYXA 2RKIA 4B9NA 4JI2F 2J8AA 2VV5A 2ZC3A 4GC6A 3C14A 4CRJA 3BREA 4YY3F 3P45B 1P27B 5HMWA 1WNEA 1FKOA 3WBZA 4KIAA 2YNIB 4PKDB 2DNGA 2VB6A 2YVSA 4ZVOB 1RZMA 4F7VA 3ZZPA 2RDJA 2OUGA 3QT7A 4ZLLA 2PI5A 1T9XA 5I42A 2E5IA 1S10A 2DGUA 4LBHA 1VLYA 5C24A 3N79A 3THVA 1XMOJ 1LXJA 3VAJA 3LP0B 4OQJA 1ZPWX 4TU9A 5LMNF 3H8YA 4K4VA 1M0SA 4X65F 3HPOA 1DQAA 4J90A 1IWAA 4LIRA 4YHHF 2XMJA 4KHRA 2GVZB 2P9EA 1VQLS 1QM9A 4PABA 2DR9A 2AGPA 2ADBA 1RI7A 3K5OA 4F4ZA 1H0HB 2NQPA 1BY9A 2BV3A 3CMQA 1WC4A 4K59A 2ZWPA 3HHEA 3SIPB 1DTQA 1HNXF 2CUYA 5ETKA 3KJVA 3CXCR 1FA0A 1V6HA 1PAEX 2R7UA 2JJ4D 1NK7A 2BE2A 2MPUA 5LOQA 2H48B 5KFTA 3AXKA 4OLOA 1SPBP 1EX8A 5KFXA 1HBUA 4DR6J 3GMGA 2DO0A 4WKYA 2FIUA 1N0VC 1FE0A 1M5PC 5A8WB 3Q8SB 2EKYA 2DR6A 2GA7A 5J1NA 3DLJA 4ERDA 4OV6A 5K8NA 3UDEA 2W8KA 1X9WA 4P9SA 1A7GE 5H9FK 3D0HE 1NJZA 4CYUA 3DOMB 1S6UA 5IZHA 5IC6B 3J7YU 3SCKE 1V9OA 5C2GA 2YX1A 1T9YA 3HKWA 4DXLA 1OY9A 1T3OA 4ANDA 4GC7A 1LK5A 4NLUA 3BEGB 2CKWA 1N33J 4NRUA 5DM7Q 2MKIA 4K50A 1JLCA 1U2RA 2O5DA 1JLFB 3EYZA 2E7XA 2F63A 3V6DA 1FNOA 4OYBA 4WP8A 3EPGA 4EBEA 4AL5A 3MFIA 3BGRB 3MR7A 4UOHA 5ADZA 1RHJB 3CE8A 2M5YA 3MM5B 2B8PA 4N7TA 2CQ0A 4DX5A 5K8PA 2XSJA 3L7UA 2J0QD 1IVZA 1T3NA 4DF4A 3DLEB 2MLYA 5HN0A 4ZS6A 1LV5A 5L1KA 1OQ6A 3M6XA 4NMXA 1T11A 2NS1B 5J2MA 1VC5A 3TARA 2C3PA 2OPRB 3D2WA 4PQUB 2XS2A 3HSDA 1D1UA 2G0JA 2FJDB 3OFHA 3FSYA 4G1IA 1L3UA 1UKUA 2YKNB 3Q8PB 2ZOMA 4NCBA 3QJPA 3OSNA 2IC3A 4LF5F 4LRAA 5B0DA 3PXGa 5JJBA 2UUCJ 2E9ZA 3OR1B 4ENOA 3ZZUA 3BO4A 1R0AA 1DLOA 1RWMB 2GNKA 2F5GA 3ZTOA 3SCJE 3H4BA 1EARA 5KFKA 3TEHB 2XHWA 4NXNJ 4QWBA 2W7AA 2ZH5A 3RUBL 3B4MA 2RDDA 3OJSA 2CPIA 5DJBA 3B4DA 3FDSA 1WELA 1I5OB 2B9YA 1VQMS 4J7CA 4BC9A 5HROB 1HNVB 4PG5A 4A8WA 3V81B 3QAUA 1H6KX 4OHZA 3KUEA 2DRBA 1XK8A 3FFIB 2BANA 1SXLA 4DMZA 1PKUA 3R5DA 2XWXA 4NZ6A 3I0RB 3AOAA 4KRWA 1RAIB 4HL9A 2Y8YA 4NL5A 2C2DA 1S0VA 1TTHB 2RF2B 1T9UA 5A2QU 1HMVA 3CPWR 4ED5A 2HHXA 1APSA 1S9FA 4KE5A 4ETZA 4ECRA 2XQCA 3CWJA 1QSSA 2B9WA 2EEYA 1LK7A 1VQ6S 3LGHA 4NLPA 5D3GB 1KD1T 2UUBJ 2LFVA 4M5DB 4I6WA 5I4MA 2AGOA 1VRTA 3PJWA 5CXTA 1KVIA 4LBIA 2XO6A 3AXMA 5K9FA 3GJSB 3D6HB 1Z4UA 4ZJOA 4B3OA 4L75A 4OFZA 1HBMB 4U7UK 2UU9J 3OL8A 2LU2A 1XR7A 2CNNB 2AYBA 2Y0BB 4LVOP 3NGKA 3ENWA 4O3OA 4CLWA 2DTJA 3M9MB 3SSQA 2J6UA 2XMTA 2W9BA 4EBDA 2YWEA 2WONB 1S97A 4PRFA 3I4HX 2ZUGA 3ADAC 5D0EA 3PO5A 2W25A 1FRXA 1U45A 2QMWA 1PAUB 1TL7A 2RU3A 4G1QB 2ZEJA 4OYWA 1JJ2R 3MI7X 5B7WA 4PG7A 1WHVA 3TA0A 1VQOS 2B3TB 5T14A 4KYZA 3TX8A 4G6VB 3GIKA 4DV0F 2R8IA 1FKOB 3GWCA 4CI0B 2AGQA 2B7CB 1JLQB 1AFJA 2JX2A 1ZM2A 3TX0A 1S72S 4KPCA 2AJ0A 3I0SB 1JKHB 3PCOB 4DPUA 3R3TA 3R6LB 4ECZA 3DOKA 3HM9A 4LF8F 4RW7B 4K0KJ 3GCWP 4WBFA 2J0WA 3GB0A 5IQQA 1IR1A 5KFQA 5C24B 4H4MA 2DR8A 2J9CA 3DGPA 1C0TA 2WAQD 3F0NA 1QUVA 3CJ3A 3QWPA 4DQSA 3K5MA 1TZ0A 3VGUA 1SJ3P 4CWBA 3LP2B 4I2PA 3M9NB 4FF3A 3VHQA 3J7ZT 3GJRB 4FF2A 4ZP7A 3BZQA 5HVHA 4ZPTR 2KT3A 3P8BB 1PGZA 4DFKA 3KHRA 1WSVA 3OBIA 1Q5YA 2DNNA 1X4BA 1X4AA 4O0NA 3SI8A 2PN6A 1OQ3A 3DHXA 4ECQA 2ZH2A 1NU4A 1FXLA 5ETSA 1NZAA 2CQ2A 2JWNA 4EEYA 2CPZA 1NNDA 4UZBA 3SBMA 2L48A 2DHHA 4U67Q 2FHMA 2V8HA 3NBPB 4NLGA 3TUZC 4FZVA 1OJ4A 2EG2A 3DC2A 5HVFA 5DG8A 4PXDA 1OS5A 2DPIA 1HBUB 4PR6A 4F4WA 3EGZA 1WKJA 1KFDA 4KFBB 1IKYB 1WG4A 2WRMA 3G6XA 2JEJA 1RT7B 3T3FA 4F3OA 2ERRA 2XMVA 3KG1A 3HKZD 3RAXA 2ZDPA 2DNRA 4XAKA 1L3SA 3I9V9 1KQGB 1GXTA 1L3TA 2JL9A 1EKRA 2ZJQQ 3GZ7A 1HQEA 4IG3B 1T94A 2C2MB 1N5TA 3CCSS 4CYUB 1UJ4A 4MKVA 1BWVA 2HNDB 2NPIA 3GLJA 4WCEQ 3M8ZA 3PRDA 3UE2A 3WIVA 4UUXA 3QLHB 1WTBA 1VC6A 3IBFB 3GYGA 3CMES 1N34F 4PQAA 1WC1A 2GQCA 1F5CA 1CC8A 1VGYA 1XERA 4ID5A 1RJJA 1ZM3A 3ENQA 1JLCB 2EPIA 2VG7B 4M5IA 3VZHA 2O67A 1SQFA 3QT6A 1FI4A 2J0XA 1KRPA 1UVLA 5KFPA 2CWKA 2FY8A 3GU0A 3RJMB 4WTOB 1N6QA 1U48A 3ZZYA 1LWEA 3DDNA 1QE1B 4Y6IA 4ZKAA 3KXDA 2XSJB 2QO3A 1NDPA 1QVGR 1FNXH 4LUBA 5AE1A 2HFSA 1RA7A 2B5JA 4WKRA 4ZCLA 1J5EJ 2B4OA 4CO1A 2L9DA 3M4XA 5SZTA 1UW4A 5HMYA 3NWRA 1GMVA 1WSRA 4OYMA 1ZM4A 2KXFA 1SJFA 2IC3B 1RTHA 4F0MA 1IBCB 2MKYA 4ED2A 2VUGA 2V69A 3VF0B 2M8HA 4I6AA 4YB6A 3ILJA 2LDYA 4C3LA 2LQJA 2Z2MA 4U7CA 3POTA 3MM7B 2WOMA 1DLOB 4CQ1A 3CULA 4F4AA 2XYHB 3M8QB 1M5SA 2AKWB 3GV7B 4HH0A 1U25A 3CCZA 4ITSA 4I64A 2I5JB 2VBYA 2KHCA 4P74A 3BO3A 5EHHA 2NXNA 5A8KA 2X1BA 2C2NA 4URGA 3AQPA 5ETRA 1NZ8A 1N5YB 2XYGB 3J7YI 4IG0A 3T6BA 2KHDA 5CZVA 5HANA 2DNQA 1BUXA 1S5ZA 1FXRA 1OSDA 1Y4ZB 3CCWA 3MTJA 4MYUA 1RLDA 4DN9A 4G65A 5CCMA 1E6VA 3FMWA 5AJ3J 2CG8A 3DXBA 4DR4F 4NCGB 5EWGA 1GH8A 4QIGA 1ICEB 3EM1A 2W9CA 1S48A 2QLBB 4DUYF 3M05A 1N52B 5I3PA 1WEZA 2VG6A 5AE3A 2B4PA 5IS2A 4E0DA 4DG1A 4L6V3 4ZPAA 4X4UA 4B9MA 5ETTA 3S8SA 4LFBJ 1KHVA 1KEKA 2ZE2B 1CJKA 2GJFA 1T0TV 1IKVA 3SFGA 5BYSA 4QJVA 4DR1J 1U1PA 5E0OA 2ACYA 3CJ5A 3MCOA 3DNCA 4Q2LA 4DBQA 4B3OB 5F8JA 1ZTTA 4DLGA 2LXUA 2WSCC 3MEGA 3MMBB 4DU8A 2A3JA 1VHIA 3CDWA 2Z58B 3KDOA 1L3KA 1HW8A 3HD1A 3R7BB 3ENVA 1V3SA 5B09A 2FHJD 3DRYA 2XLIA 2V8PA 2E5JA 1FJGJ 5EN1A 4WZMA 3G86A 3ET6B 4LRFA 3BBBA 1M5OC 1S12A 3G8QA 3D3CJ 4QW8A 4F8RA 3PYGA 4F26A 5B0AA 5GMKa 1BGXT 4UT4A 3RBXA 1RAEB 1S79A 3IWLA 1BHNA 2O01C 1SC6A 2GCFA 3CD5A 2UVUA 2CPFA 3LAKA 3AAWB 3WX8A 2BQRA 1U2FA 2N3OA 2X1FA 4KHMA 2NPFA 1CLFA 4ZVUB 1Q78A 5L1IA 3UWTA 1XN9A 4USVA 2MQMA 2BQ3A 4H4MB 5BR8F 4F2RA 2K8GA 4C97A 3W2VB 1UWAA 4C0OC 4JP8A 1Q1KA 4CT9A 3M8RA 2YNGA 3CT9A 4ZP6A 4DV6J 4RUAA 2ZH7A 1S1XA 3QRRA 2CZ9A 1HR0F 3GONA 2LECA 8AT1B 1WWHA 4Y2AA 2MQOA 2E1RA 3CCES 3PACA 5CYQA 4QOTA 2UZAA 2HKEA 3MCSA 1C1CA 2FLLA 4OL8A 1NHUA 1UPPA 1YKWA 3UNGC 1K73T 2QLXA 3KHLA 3DN9A 4GVBA 4HACB 4PG6A 1RAJA 2R8GA 1TUGB 2BJ9A 4C4WA 2YWGA 2CQHA 3QJLA 3V2UC 1IKXA 2BX6A 1Q86T 3GSDA 5C7PA 1NK0A 1S7HA 1FFGB 1NCLA 1EKSA 2DH8A 1I94J 2HBYB 3CJ4A 3PZPA 4ZP9A 4ZIWA 1WKLA 4CH0S 1Y7PA 2RHSB 2C2RA 1RT3A 1X5OA 3BB5A 4HYKA 2AZ3A 2C42A 5H9EJ 3HMJG 2MKCA 4RW9B 3SXLA 5HQ8A 3Q0AA 1SKRA 2VPZB 8ATCB 1Y10A 5B0EA 1SKSA 3E8OA 4J9LA 1S6OA 4UY8T 2CPEA 5F8MA 1UL3A 1HQEB 3RBEA 2QJ3A 4AE5A 4FP9A 3BGLA 3PEHA 2HVHA 5EGYA 4USTA 4J9UE 5MLCV 4ED1A 4Y65A 3QGGA 4NYOA 4DV5F 1TKZA 2RE1A 1RHQB 2OI2A 3Q89A 3G96A 5H1SV 2CFXA 4LBPA 4RX6A 4K8RA 4UF4A 2DCLA 2Z8QA 1CULB 4ID5B 2AJQA 2XTJP 4A8QA 1KQKA 4DZDA 1NLKL 3RGIA 4DEZA 1X5PA 3TA1A 1TQLA 4DFJA 4ZLNA 2HFZA 1S77D 2B9XA 3N5BA 2MSSA 1N6QB 3VAIA 4H4OB 3VGTA 3K0JA 3EWGA 3CSKA 4ZVTB 2QA4S 3KK3A 2KJWA 4TYBA 3HVWA 1YQHA 5HLFB 1QJHA 2BYCA 1VC0A 1O6XA 2NLWA 1K47A 3I5CA 3M30A 2EC0A 4IQMA 3D6TB 2R8HA 4JI2J 4ZVEA 5FIIA 2AWZA 3JTNA 3M32B 2R7TA 2V4JA 1RTHB 2E5LJ 2E1PA 4PUOA 4YY3J 3H7HB 2QTWA 1PG5B 4NA1A 4CTAB 2BJ8A 4F4YA 1C1BB 1RP5A 2DCUB 4C9DA 4NLRA 1HWLA 3T1AA 3T5HA 1XNRJ 2L41A 2IAJB 1WEXA 2AV5A 1X5SA 4P2MA 2QL9B 3EUNA 4R8UA 3AOBA 2V6AA 5A8KB 1DQ8A 1XMOF 2ROPA 3ZZZA 1PCAA 1FX4A 3G9CA 3A8IA 1GQEA 4IG0B 1KKHA 4IFYA 2G1HA 5LMNJ 3KLFA 2QGFB 1ZA1B 1N48A 4CIOA 4X65J 2W9AA 3HI9A 4J9VA 3EDQB 2HURA 1MWQA 2C2KB 3DYAA 4YHHJ 3M2VB 3O8WA 4EI2A 3RB3A 3TUIC 5T7LA 3BR9A 1WHXA 4N41A 1FK9A 1IWGA 3HLUA 1U1QA 1DHMA 2R4FA 1F1BB 2BM0A 4A8XA 5F8LA 2W9CB 3NKYA 3E2EA 1IR0A 2YPZA 2MTLA 1QDUB 3OFEA 1RBLA 3I6PA 1HNXJ 5KFHA 4HTIA 3M1VB 2V67A 5ETMA 1GFWB 3KJQB 3I82A 4OYAA 1UVIA 4OI4A 3MM9B 3HFKA 5CHCB 4DR6F 4OX7A 2RQKA 3K89A 2HHVA 2CJAA 2HG4A 4X4PA 2YNHA 1CQMA 2LQ8A 1YJ9S 4XPCA 3A3OB 3BQ0A 4UQGA 5KG2A 3C2PA 2FLPA 3LUYA 2LEPA 1LKZA 1SB6A 5J2NA 3PJ9A 5KT3A 1HYSB 2P2CB 1CBKA 1HLWA 4MFBB 3ZTSA 2BVZA 3K8WA 2QSFA 1NM2A 2O1PA 2DKOB 3G6YA 1N54B 3W63A 5IT4A 4RW4A 2OFGX 1TUWA 4O0IA 1WI8A 4ZVGA 4DL4A 4ZLPA 1U1OA 3L09A 4QCLA 3PYDA 3KLVA 1U8SA 4ZVHA 2KT2A 2FJVA 2PFFB 1UPMB 1EHWA 1JLGB 4DQPA 2E9TA 4Q2MA 2BJ7A 1U49A 4RJVA 4CT8A 4E8UA 2AU0A 4U7UD 4OZ2A 1XMQF 3HSGA 3UVJA 1Q5VA 1RHRB 3TW0A 1KNZA 4QR1A 2KM8B 3SQOP 2WHOA 1YRTA 2QLJB 5L9NA 1Q82T 1R0CB 1VYAA 2DR7A 4GVLA 4B02A 4JI8F 1S1UA 2JLGA 4CM2A 3SYZA 3BKFA 1U6FA 3FK4A 3RR8A 4LF5J 1ZAWA 3TVZA 2LXFA 4CH7A 4RUHA 2Q1LA 3O1LA 2UUCF 1OY6A 2BRLA 2ZM6F 1M90T 3V5RA 2JFDA 3MOZA 1AYEA 2VPXB 5J1EB 4DV3F 3SDEB 2VOPA 3NAIA 4K4WA 2QLWA 1HQUB 5DLFA 2JEIA 1H98A 2VDHA 2A0FB 1IKXB 2IFXA 1WJ9A 2D7SA 1YJRA 2ZVSA 3CTRA 4AT1B 4B9UA 2ROGA 1AB8A 9ATCB 3R2DJ 1AFIA 1IBKF 2HHHF 5HK4A 4QYZJ 4N5SA 3T1YF 1VIXA 4ILRA 1UCNA 3G71S 1S0OA 4PEOA 4IR1A 3H40A 2VQEJ 3T5KA 5HL7Q 2VJUA 5A6WA 5J2PA 3ZTPA 3CO0P 3WX4A 3ISNC 1VQYA 4QIWD 2KXNB 2RHQB 5IM0A 2VG5B 4U9RA 2CJQA 3GFHA 2N7YA 1MROA 5A0YB 3GILA 1KTQA 2A2CA 1R8CA 1IM6A 3P49B 2BJ1A 3JAMY 2W2NP 2PI4A 1VQ4S 4A8SA 2AP6A 3SQGA 3EX7B 3D0GE 1HNIA 1H73A 2BKNA 2CQCA 4IFVA 3E3XA 3ZXWA 2NCKL 2MGZA 4PCQA 3H25A 5CQGA 1YLXA 2P9GA 2ZH9A 2LQ5A 4KT0C 1B4SA 1EP4A 4RBTA 2WVDA 3FCVA 2XNQA 4MKAA 1TL3B 1ZETA 3CNQP 2RIJA 4WP9A 2D3ZA 2KO1A 3CCJS 3IFEA 1IUJA 3AODA 2IBKA 1U0HB 4DUTA 4KGZB 5G0RA 3ZNJ1 4LSNB 1S49A 2UU9F 2YWFA 2ALYB 1R8PA 3OW2R 4RU2A 1F0XA 1U26A 1LQ9A 4TQRA 3MCNA 4U96A 4IQXA 4ZPDA 2YKOA 1SJQA 1GX5A 4ZCMA 1MU2A 4HLBA 3M30B 1KLMA 5DQGA 3MR2A 4DV4F 3MM6A 4I56A 3THPA 2ZHBA 5KFMA 3TAMA 4TLQA 5HVGA 3G87A 5FLXY 3KJFB 4FNHA 2B43A 1JMTA 4PYAA 3QWUA 2V4JB 3DOLA 3LGNA 1PYOB 5F3ZA 5GAHU 4DPXA 2KM8C 4HVZA 4P7VA 2QEXS 4DV0J 5BYRA 1Y9OA 1VJWA 2HFUA 2ALZA 2X51A 3OSPA 2EFGA 2UV8G 4OYPA 2IRUA 5FDLA 2EFPA 2MYFA 3F56A 1UAWA 5D77A 1VQKS 2FZCB 3H4DA 2W4PA 2D9PA 1TL1A 3CEDA 3MECB 2HSEB 3IBWA 1RUSA 3BN7A 2I38A 1Y3JA 4B08A 1URNA 1X5TA 4YOEA 3MMAB 4R8UB 3LANA 1FF2A 2XS7A 4YB1P 1RCOB 4USKA 3MCMA 3UI3A 3KLHA 4O23A 3J81j 5J2QA 4OYOA 3GIJA 3MAQA 4IKAA 1TU0B 4UOFA 3W62A 3KLFB 3Q8QB 2KRBA 2ATCB 2RUSA 1LW2A 5T41A 2HNZA 1FRIA 3G8TA 1VHFA 1XWLA 2CDQA 2VFRA 1Q4RA 5T7LB 2CG4A 2QA4G 1YDLA 2A6MA 1XMBA 4TLRA 4G1PA 3VALA 4LJMA 2MZJA 4LIWA 2DRDA 1G1XA 5GADU 2W7OA 3TO8A 2VU5A 5ETVA 2IVFB 3RRKA 4BCAA 4ILLA 1FDAA 1XTZA 2CQGA 4I7FB 5E3RA 3BJYA 2Q43A 4X4VA 2WVBA 2YWHA 2ZZTA 3LTOA 1X4DA 3UQSA 2PA8D 4ELTA 3W5XA 4XPEA 1AROP 1RWUA 2AD9A 1UVJA 2OPPA 4DV2J 1SVDA 1RB0A 3MZIA 4PWDA 3GR1A 4A8OA 1YGYA 1Z1ZA 2F3JA 5EWEA 3DLKB 5D0RA 1REVA 3IAM9 4ECWA 4O3PA 4UZCA 2MMYA 3RBZA 2VOOA 4HR2A 1IJFB 4C8LA 3M8PA 3BYRA 2GV1A 4CLZA 4D3HA 4Q0BA 2MB0B 3R1LA 1YHQS 2QT7A 2DGOA 5JUMA 2DGTA 3WZ0A 2E66A 3GFZA 4KO0B 2L08A 3OVAA 1SC3B 1BMQB 5I3UA 3CCVS 2CJBA 2Y0SD 5HO4A 1RABB 2R2SA 3GIIA 1I1GA 2AJ4A 1PYTA 4RW4B 2V2KA 4GRSA 1H7WA 4B3TF 2V4QA 3RB6A 1N34J 3ZZRA 4C7QA 4LF6F 1CJUB 4M5MA 2ZKTA 1FVSA 1RWOB 1PC4A 4CO5A 4WZQA 3R7NB 1GAOA 2ZBIA 3AJDA 2ZITA 5L8RC 3FCWA 4J37A 1C0UA 3QZ8A 4WIQA 2NUUG 4EUVA 4PXEA 4ED6A 2WW4A 2B0GA 3O3LA 3UVJB 4EZ6A 1TFWA 2HNYB 2ZOGA 1S6QB 3VAMA 1RT1A 1ULRA 4ILMA 4TY8A 1B64A 1I51B 1NXIA 3N9UC 2FGOA 3OXFA 4L3NA 3KLGA 2N4DA 1RA6A 2F7VA 4OI3A 2XSFA 4RZRA 1VBKA 3AHPA 3O2IA 1SV5A 2NXJA 3PRBA 4FKYA 2HVDA 1VBYA 4Y3CA 1S1UB 1S0NA 3HFZB 5CH7B 1RTZA 2HMIB 2F4FA 3PG9A 1NPKA 3UDVA 3K58A 2F65A 1NPPA 2QYGA 2A6OA 3FEZA 2E5GA 4QYRA 3JYTA 4DLEA 5KFDA 4DL6A 3PKMA 4OZ0A 1HI8A 2IVMA 1FKPB 1FTRA 4KGMA 2IJRA 4YMEA 4WIIA 2VH7A 4GKJJ 2QYCA 1UA0A 2HIQA 2ZBCA 2JVOA 4X4RA 4DN0A 2WVCA 3A8KA 3EGWB 2C22A 1SUQA 4H54A 2DXFA 3PHEA 4F02A 2HK2A 1X7VA 4ES1A 2IM2A 1ELOA 4HI1A 5BJRA 4Q44A 1EIYB 1VQPS 2DY9A 1NHKL 2RUGA 1SIWB 3UPFA 1JLAB 4A8YA 1JB0C 1RXOB 2EFQA 1IXKA 2VFUA 3VAGA 1O8BA 3MPYA 1VBXA 5A6PA 2HQIA 2Z4PA 1D0EA 3D3BJ 2ZZNA 4JYAF 2XY6A 2PMZD 3AFGA 2MLZA 5AJ3F 4B9LA 3DU6A 3I5BA 3LWLA 4X2BA 4DR4J 1VFJA 2MKHA 3Q2TC 2AHOB 1LEOA 5C2CA 2PFDA 3LP1B 4DUYJ 2EBEA 2V2ZA 3CCUS 3FBEA 3W9IA 2YXLA 4C11B 4FYVB 3OR2B 2C1EB 3K2YA 4IFVB 3OVBA 2XY7A 4LMZA 2MGZB 4QR0A 3CDBA 2ZHAA 2PT0A 3I96A 4YUDA 1EP4B 1NHVA 2ZNZA 4FS1A 3LQVA 3LAMA 3TEGA 3IGVA 1BC6A 2ZOFA 3NP5A 2HFVA 2O66A 3Q8VA 2Q6BA 3OPKA 2OIHA 1Q7LB 5G0RB 3MURP 3MM8B 4CLTA 3WC2A 2FHOB 3QBCA 3J7AN 3BF4A 3OXLA 1SJ4P 3DDKA 3R97A 3FCHA 3X1LB 2GX8A 5KG3A 2G2OA 2HQFA 2E1AA 1MU2B 1T8EA 1EZZB 2DGVA 1YJ7A 2KJVA 3KLEA 4QQBA 3D1QA 3T9ZA 3NGUA 1FJGF 3I9ZA 4PAAA 2HBRB 2RRAA 3DKDA 3HVRA 5J1PA 2BMBA 4WFAQ 2JC1A 2RVJA 3MTKA 2VODA 1I6JA 4LRDA 1QVFR 3AB2B 4QR2A 3T41A 1JLFA 5K14A 1KHWA 3R5AA 4Y2KA 4CLKA 2P5VA 2V94A 4JI5F 3BGRA 5DQIA 3P5TL 4CNYA 3OFGA 3C16B 4HTJA 1N8RT 3W9JA 4USHA 3QFHA 3MM5A 2DJWA 1TL1B 2MY7A 4P2XA 3A13A 2ZH3A 1S4FA 5H9EK 3DRSB 3GPAA 5BR8J 4YR0A 2V34A 5E3PA 2P6SA 2AX0A 2XZTB 1KONA 2R42A 4DUZJ 1QTMA 2OHDA 2OPRA 4DV6F 1RTDB 4OMFG 5B0CA 3BGOP 3OHAA 1NJIT 2HNZB 1ZH5A 1HR0J 5EWFA 2KYZA 2FJAB 3GTYX 2HEKA 2OP5A 2NYIA 3T5JA 3KNGA 1FKAF 3NWGA 2PD1A 1HL6A 3UN5A 4KR0B 1T9TA 3OR1A 1HD1A 3N28A 2GMLA 5HATA 4P6QA 1B0VA 3FMBA 3TVYA 1HKAA 2PIIA 2XZDB 1BQNB 4CLSA 2QX0A 4QIEA 5DO2A 4ID8A 2YWKA 4WP3A 2Y1LB 4PWDB 2Z30B 1K1QA 1Y3KA 2QL7B 1PBUA 1PBAA 4QPTA 2B4UA 4WK3A 4EU0A 5IC4B 1RGVA 4RWWA 5HROA 1HNVA 1SL1A 2HWHA 2Q3PA 1B0TA 1EJ7L 4RU9A 4FPRA 5GAHI 2XO7A 1H3DA 4Q0BB 2RS8A 2JDJA 3PW5A 3IO1A 2CZVC 1WTFA 4MKBA 3QJJA 3BDPA 3QT8A 1N36F 4LF4J 5AXNA 2RS2A 4MK8A 4KH1B 3X3UA 1M1HA 2YNFA 1UJ5A 1TELA 1KN6A 4WYWA 4DV5J 4DL0C 3FEYB 4DOZA 4DL7A 4KBIA 3AY0A 4C8KA 5D3GA 4R25A 3NY0A 1Y5IB 2FJXA 4M5DA 2DNMA 1GK8A 2XI2A 2CIMA 4L72B 3NXZA 1UFWA 3TJ9A 1IKWB 1UVMA 3HDSA 1HWJA 1RWVB 1TAQA 2EWHA 1X60A 3EZ5A 3NMRA 4S0MA 1HBMA 2IM0A 2KH9A 1WDTA 1KBRA 4N8NA 1R6YA 3G6ES 5KG5A 4KKOB 3FRZA 4DHVA 3KLGB 4A48A 5GADI 2EC2A 3NGRA 1RK8A 4FN5A 2R7SA 4CLPA 3HHDA 2CQ3A 1SV5B 2E7WA 2VA2A 3NLCA 2M0GB 2BE9B 1RWXB 2AEJA 3O6QA 4Y2IA 3OTBA 1PJ7A 1FX2A 2BW7A 4G1QA 1VQSA 1FCAA 2DNLA 1U8WA 3IP0A 4N8OA 2E5LF 1KC8T 1D09B 1D9DA 3JYTB 4B9VA 3RAMA 1SH3A 2JSXA 3EZUA 3P5BP 1NB2A 1LWFA 1JLQA 2MDAA 1H74A 2OD4A 4EYHB 2HS3A 3NNAA 1G7CB 1Q8LA 1MMNA 1VMBA 3I0SA 1JKHA 1LW0B 4NA2A 1RBAA 4PYDA 3H90A 4RW7A 1XNRF 4HDHA 1FRKA 1SUQB 2VD3A 2FLNA 2Y1JA 2OAUA 1YTYA 3T9NA 1T03B 4IH5A 4AXIA 2ATLA 2BKOA 2A10A 3BBFA 1X4GA 2DIVA 1BE4A 2W1BA 4O4GB 2D41A 3BGUA 4LSLA 2MZRA 2PDAA 1XR5A 4BBYA 1UVNA 3LP2A 2H54B 3SCLE 2AMCB 1YI2S 1HNZJ 3BH6B 2WTFA 3PR5B 1UWBA 1FD8A 3W60A 1R8HA 5F9NA 1Y5LB 2KFNA 4TVAB 1B70B 3ZNUA 4K4UA 3W9HA 1RHMB 3BQ2A 4OHXA 1YJTA 3I31A 3NMAA 1XC9A 5LSRA 3JTOA 3DMJB 2HHWA 5KFOA 3RZAA 2KVQE 5KFFA 2B4VA 4E2FB 3NBPA 3GQCA 4AYBD 3LPEA 3MDFA 3QRQA 2H1YA 2WCXA 2D69A 3WQPA 3PR4A 5LSOA 2EVZA 5I3QA 2VONA 4NLXA 4KFBA 5AE2A 1IKYA 1VLOA 1G2EA 1OYEA 2BRKA 3PEJA 1RT7A 2R7WA 3ITHA 5DDRC 4J91A 1IBMF 3TA2A 2DNPA 3SMZA 2EK6A 3HF5A 5IWAF 3TQEA 4ED7A 2P6TA 4L74A 4IG3A 3D5MA 2M70A 5RUBA 3ZZOA 2DHSA 1U2CA 2ROEA 1D9FA 2GZOA 1DY3A 2Z0GA 3QIPB 3FC9A 2HNDA 3KLEB 2E29A 2G1DA 3EVOA 1P1TA 4N76A 1HARA 3CVKA 4USMA 2J6TA 3QLHA 1NSKL 2ILYA 5DG7A 5D15A 3OQ2A 3UNYA 2N7CA 1M1GA 4IOCQ 5KOXA 2GIQA 4DSLA 1JNRB 2KG1A 1U09A 2VG7A 3H5YA 5KG0A 5K14B 2Q79A 2XG8A 3H5UA 3L95X 3SEOA 3KK1B 2I0XA 2XLJA 3HK2A 1IM4A 2EG1A 2OEKA 1QE1A 2MEWA 4RLEA 4DL5A 1AW0A 1OMSA 1XMQJ 2D3O1 1O51A 3RW7A 1S7IA 4QYZK 2UXDF 4F36A 1SL0A 1KR4A 2H4WB 2FQQB 2RRBA 1KLNA 2IM1A 4JI7J 2DPJA 3BSCA 1RCXB 2DNYA 1BQMA 3K57A 4I2QB 3I87A 1HBOA 1OYDA 1UFLA 3VQSA 2HGNA 3FEXB 1JJ4A 4JI8J 5E7OB 4NRTA 3HT0A 4ZPWR 5KFWA 1RT5B 2V2VA 5KFYA 3U1NA 4IRCA 2V8GA 2GIRA 1WOOA 2NXEA 5LXRA 3JQJA 3DXSX 4B3MF 4DWIA 1CJVB 5C42A 3L7OA 2LQBA 2FVRA 3EVWA 4C0BA 3LW5C 3ZZ0A 3C19A 2ZM6J 2MJNA 3U1LA 3MM7A 1TKTB 1ZM9A 3QRPA 3F44A 2Z56B 2HZAA 3OTEA 2F4VF 1AUSL 3M8QA 1IBLF 4DV3J 1GMWD 1MWYA 4C3KA 2I5JA 1EETB 3AQOA 3PJXA 3D67A 2G0CA 3CJ2A 2CQDA 3I32A 4F25A 1BD6A 1N5YA 5K5MA 4R5PA 1H72C 3VQTA 5KFBA 4K5RA 3M6VA 1W25A 4C48A 1IBKJ 2HHHJ 2VQEF 3T1YJ 3MR5A 3JSRA 2R7XA 4M95A 3OL7A 4QIVA 5BYQA 3TZZA 2O3DA 3G82B 2ZVIA 1TV6B 4NEZA 3M6WA 2BR0A 2ZBRA 4RKUC 2AW0A 2CPYA 2E1MC 4NCGA 3N6NA 2EXUA 2WB1D 1X8DA 2RB7A 1MWZA 2YNFB 2DNHA 1PSDA 2AYGA 2RSQA 3C15B 4KAIA 4B3SF 4Q5VA 4ED8A 3EPIA 1TMMA 3EGVA 3V6JA 3NL0A 3DRXA 1Y11A 1LFPA 3HFVA 2ZE2A 1RYSA 2GHWA 1D8ZA 2KRRA 4IYQA 3WC0A 4OZ1A 2APOA 1WG1A 1Y0HA 4ZVSB 1NJWA 2JLEA 5KT5A 5D0HA 3C6TB 4ZN3A 3BKUA 3MMBA 2DR5A 4ED3A 2E7VA 5GMEA 4FNIA 1QUPA 4NLWA 1Y00A 2LVWA 2DHXA 3DRPB 2V9KA 1AUDA 4DV4J 4GKKF 2F1FA 3TANA 3HT3A 2B9EA 3CMAS 3ET6A 1DFDA 1NBEB 4UUWA 2XZWA 4CO2A 1IJEB 3LF0A 2K1RB 5K20B 4ZHRA 1VISA 3AD9C 4LR8A 3PTWA 1RBOB 4BHQA 3NS7B 2V63A 1LWFB 1CVJA 2GQ2A 3MEEB 2MQPA 1U24A 1EB0A 2JEGA 3H5XA 2LKZA 1LWCB 4M5NA 1RADB 1SC4B 5M2RA 4DPOA 4DX8H 3NEKA 4DR2J 2XYPB 4OJ3A 4EMDA 3W2VA 3IBCB 3VVUA 2HBZB 2DNZA 3B78A 4LSLB 3KK2A 4URSA 1UA1A 4JI6J 3TAPA 4ZMMA 3HJVA 3PO4A 1R0BG 2FVQA 3N6MA 4I67A 3M8YA 3MWBA 5L9XA 1UWBB 2RRNA 2R9LA 1Q7YT 3W5YA 4Q8EA 3B54A 1JLBB 4QWEA 4Q43A 3GJQB 1T02A 3N4WA 1EQ0A 3L7PA 4W4MA 3BPDA 1X4FA 2V0NA 2GIFA 4IO1A 4QWAA 3GFXA 3UFCX 5DRKA 4HACA 2DGWA 4ZCKA 4NX9A 2ZH8A 2DB1A 3CJRA 5DDOC 2RD5C 1NH8A 4NZ7A 3HVTB 3DHWC 1SH2A 1K8AT 2W4CA 1BXNA 4DV2F 3DDIA 5MAOA 5A8RB 4IUFA 3CJ0A 2W2OP 2UV8A 5E2QA 4ECVA 3ITHB 1ZPVA 4CO4A 4RW9A 4Y2MA 3U1MA 5HBMA 3CJKA 3U02A 2CAJA 4IRDA 4XDDA 4MK7A 4YR3A 1D3WA 3VCDA 1JWWA 3W5ZA 2HYIB 2HGMA 1ZAVA 3FUYA 1FFWB 2IA6A 4B9SA 1RTJA 3AB4B 4WYLA 2QLFB 2HAFA 4U8VA 2XNRA 4KHPJ 4J9OA 4B3TJ 2CQIA 1CULA 3QIDA 4LF6J 3HP6A 2LQ9A 2FVCA 4A4JA 3NOCA 4NMLA 9RUBA 3RBDA 2KKHA 2QE5A 1F9EB 4LVNP 4H4OA 3KWMA 2F9DA 4DCOB 4NLDA 1UZDA 4I4BA 4DV7F 3J81Y 5D4PA 2U2FA 3ENAA 5HLFA 3DLLQ 4WFNQ 2RAQA 2F8EX 1S1TA 3V4IB 5D0GA 4C8OA 4JI4J 4I6YA 2XWYA 5D8HB 4IDKA 1BQMB 4LF7J 3DLGA 4PWUA 1HBOB 3AD8C 4PWWA 4KTQA 1NH7A 2Z57B 4ELVA 4ZPBA 2YKMB 3M32A 3GR0A 3UDLA 2ZH6A 1VRUA 2UVVA 4RW6B 3OTCA 4EO6A 1YITS 2H3EB 2MZSA 4PPDA 6AT1B 1GT8A 4JB8B 3PRVA 4QWDA 1SC1B 2IDEA 4CTAA 5C42B 4ZLJA 3EDRB 4ETXA 3IS9A 1C1BA 4DQQA 4OYZA 1ITPA 5ETLA 1YJVA 3BGFA 4GKJF 4F3QA 2YKPA 2AZ1A 4HT5A 4LF2A 3BV8A 3PKYA 2YKAA 2IAJA 2XB2D 2VASA 2POKA 2DH7A 3CJ8A 2UVWA 1CJTB 1HHQA 2R7QA 4RBUA 1UFKA 2W2MP 4DSIA 1F9HA 2CNLB 4R5PB 3NRBA 2MHNA 1HHSA 5LXYA 4CLUA 2N4CA 2FTRA 2FJEB 4DL3A 1UEUA 3DFEA 2LYVA 3M2VA 3TYTA 3MR6A 4JYAJ 3FBFA 5KT7A 2X3GA 4C98A 2XY5A 1YWXA 1T9VA 1FDDA 1FJCA 2JNJA 4JUZA 5HP1B 4W92B 4K2XA 1WF1A 5E41A 1SCJB 4IH6A 3ZC4A 1K0TA 3M1VA 3Q8UA 4P75A 2OO4A 1XEZA 2WK4A 4FVMA 2J0SD 1H2UX 3MM9A 2HHSA 3KOAA 3WDOA 3W8GA 4RNHA 1IQZA 2EI5A 3UR3C 5K8OA 3Q23A 2DXDA 4C8MA 3KKFA 3AA8A 4U6PA 1YRXA 2YKQA 2ZBPA 2DEJA 5LMUF 1DJ0A 3R27A 1F5AA 1H38A 4RO0A 3TWZA 4QBUA 2DY1A 1YJUA 1HYSA 2Z2YB 3HHNB 3D9BA 3GIMA 2BDPA 5CYMB 4WE1B 4MFBA 2LLZA 4J9PA 3CC4S 1U6ZA 2HHTA 2ZUAA 5AT1B 3UCZP 1HNWF 3EJMA 5G4DA 3I5AA 1YZ6A 4TQSA 4I68A 5F8IA 2QFJA 3HHLA 2JVRA 2VL1A 4ZHRB 3EMTA 4PG4A 1JLEB 2QSWA 1U0SA 2Y8WA 4ZK7M 3KJNB 1GMUA 2XM3A 3P3DA 1W2BR 1OWXA 5F0UA 4JI5J 1S6PB 1JLGA 3D68A 3PFOA 5B0FA 4FF1A 4QU7A 1K0VA 2DHAA 2LP4A 3BKTA 2NREA 1FESA 2KXHA 1JQGA 3D6FB 3MEDA 4X66F 2N3LA 1WC6A 2JLFA 2QN6B 2OPQA 4F4XA 2R8KA 2VZ9A 1NK8A 4RPFA 3CJQA 4DUZF 1KS2A 3KK2B 2AJFE 1REGX 1BWEA 4TU8A 1B99A 4F4KA 3RYLA 1YJNS 2H65B 4KC5A 4M5KA 4F3MA 4ZIVA 3S6EA 3D6MB 4DR3F 4DSFA 2MHEA 2LMIA 3N6LA 1FE4A 4UQTA 3OV7A 4ZVPB 3A3NB 1FVQA 3NG8A 4O3NA 2H5IB 1B7YB 3DLBA 3TOQA 4MT1A 3PX6A 4X62F 3THTA 3D1OA 4JI1F 4B3RF 1KQFB 1NRKA 5J1EA 3MFHA 1NSPA 3SDEA 3MHYA 1HQUA 2QV6A 4ZITA 3H42A 3ZO7A 4DS4A 1K9MT 1EQMA 3CD7A 4K4SA 2NYHA 2J7UA 2QMUB 4DSEA 4LSZB 2CA9A 3R5BA 4J9QA 3JTPA 1WF2A 4JI3F 1NKEA 3D28A 4ANCA 3CDAA 1G6BA 4OZNA 2A18A 1FRHA 1N4LA 3V4MA 5D4LA 2P8IA 5HBMB 3CJKB 3NCRA 4Y28C 2HVZA 3UO0A 3K5NA 2YY3A 3BPSP 3KUGA 3HSJA 4ECUA 5DZ7A 1JXVA 2VG5A 4P7TA 2HHPA 1PYSB 4NXMF 1L5UA 4LF4F 5JXSA 1U6BA 1ZS6A 5A0YA 6FDRA 1N36J 3DRRA 2MQNA 4WFXA 1DBDA 1E6YA 1RTJB 4K4XA 2RH3A 1P9QC 1WOSA 1AZSB 3ILOA 2D74B 1N5QA 4FBTA 1Z2LA 3NCPA 1KFSA 1R43A 4DPYA 1DURA 4NLSA 1UTAA 2FPHX 3BDEA 2R8JA 1DAXA 1TL3A 2CPDA 4NLOA 3GCXP 4HH1A 2PC6A 2RNEA 2PMHA 1U0HA 1VK8A 1LFWA 4LSNA 4FS2A 2IA0A 2NZ4A 4OIXA 5DG9A 2UXBJ 2P9CA 4LF1A 3VV2B 1NO8A 3M9OB 4IOAQ 1WKKA 5KTQA 2NR0A 3PDNA 2Y1IA 2WW8A 2BACA 1S1TB 4MK9A 5A2QY 4DSKA 1S59A 4OJGA 2PMWA 4IDKB 2GW8A 3OL9A 2HK3A 3DLGB 4O44A 2KU7A 4ICLB 4QZVB 4TU7A 2C2EA 3MUMP 4ALZA 3VAHA 3D0IE 2XC9A 2CNOB 5ETQA 4HI2A 1VRUB 1NUEA 1QAYA 3IM9A 4O4RA 1U4BA 1RTIB 5ETPA 4ZPCA 2NXUA 3TNVA 3M2RB 1PIEA 2VBWA 3TRGA 1XQIA 3G8SA 3IS9B 4AUKA 2R3VA 3Q8RB 2OTLS 1C4AA 1KDNA 5F9LA 2YQ3A 2WSEC 4LREA 2ZJRQ 3JSMB 4W90B 4ZN1A 2HWTA 3MECA 1N5VA 1S1VA 2XS5A 1HBNB 5DQHA 4TNOA 3CF5Q 1NK9A 2CZ4A 5KFSA 3MMAA 5C5JA 3DI6B 1YJWS 1TAUA 2YWWA 4A8KA 2HRYA 4PZVA 4DDFA 3NGDA 4KPYA 1TKXA 3W66A 5HJYA 1ACMB 1HNZF 3CD0A 2BM1A 2GO9A 1NDLA 4AL6A 2ACMA 4C6AA 1TKDA 5F3TA 4TN2A 1QSYA 1Q79A 1FWPA 4ZJLA 2I6WA 1YRUA 2HQGA 4P72A 1S4EA 2DBBA 4LQ3A 4DPWA 3E01B 1M5HA 2ABYA 1RISA 4I7FA 4YR2A 2KZZA 4ZVFA 5IXUA 2CPHA 5D78A 3KUHA 5CYJA 1DTTB 3RAQA 4KGKA 3MGJA 2HWIA 2EFVA 2L9WA 1T05B 4NASA 3DLKA 3IC1A 4ZP8A 3VAFA 3SSRA 4KSEB 3M6UA 2MZQA 1IBMJ 2B8QA 2UP1A 1SKWA 1PJ6A 4TXSA 3QZ7A 4X4NA 3NNHA 5IWAJ 1S1WB 4AL7A 1H2VZ 2LEAA 2F9JA 2CQ1A 5M2UA 2XGQA 4TKTA 4KO0A 4N47A 7FDRA 5D4NA 5L1LA 1SH0A 3BH7B 3D4JA 4XK8C 5EUHA 3W2WB 4WFZA 4X4OA 1ZOTA 1RT6A 2RKIB 1CJUA 3W1YC 3HHLB 3HCXA 2HS0A 5GAEU 2MLXA 3C14B 3OLAA 4NE9C 4K2JA 4FVCA 4NLVA 2D3OR 2VJVA 5JVGQ 2OJ3A 4U95A 2PEBA 2QFIA 3A12A 4KH0B 3N0VA 2YH0A 3MEDB 1GNKA 2OPQB 3VAKA 2IRYA 5CA5A 1JIHA 2CADA 2HNYA 3JS9A 2EFOA 1S6QA 2DYAA 1UW9A 2MY8A 1N88A 2Q66A 2UXDJ 3BN4A 4JI7F 1UP1A 3TR5A 5I42B 5C25A 4MTPA 3KDNA 3TZXA 4FKXA 3RRHA 1HW9A 2ZHOA 2E9RX 2CJYB 2HMIA 2GQQA 2M3DA 4HT7A 4OZLA 4P2FA 2G2YA 4HKQA 3G2XA 3GV8B 2B6AA 2N82B 2RMLA 2OPSA 4YN3B 4FXVA 4OX9J 2M2BA 4B3MJ 2GHPA 3OD2A 2QRRA 1F9FA 3NCQA 1YG0A 4F67A 3CD6S 1FKPA 3WHIA 1VI7A 3UD5A 4MKYA 1W26A 1QD1A 2CJXB 2X7IA 2PGCA 2DGXA 3P96A 4CZCA 5KT4A 4WJBA 5KT6A 4LRBA 1WDDA 1JX4A 2F4VJ 2XHCA 3D66A 3C6UA 1MMLA 1IBLJ 4CP5A 4GO7X 2HQDA 5AXLA 3GFYA 3H0PA 1DTQB 3RTVA 2GS8A 2KFYA 2HVEA 3KJVB 2CWXA 3TAQA 3I56S 4YFUA 2BE2B 4GMKA 2M8DB 1SJRA 2JRSA 3DLHA 1JLAA 1WEYA 2ILZA 1RWPB 1WF0A 4USWA 4ZOSA 3TUJC 4OYIA 4ATNA 4DFPA 1G4CA 2HPUA 5KFRA 2PE8A 1IN0A 3SZ2A 4QIFA 3T1HJ 1OPIA 2LXIA 1GMWA 3BSOA 2HGLA 3BO2A 3FRYA 2KFZA 3B6BA 4EGLA 2RQMA 5DM6Q 4K5SA 4OLPA 3DRRB 1FDNA 4HHJA 4XIUA 4Q45A 1TL4A 2W7PA 3LP1A 1E6YB 2HRTA 4ZCIA 2UUWA 1BLUA 3IXQA 5KFIA 1LWXA 2D3UA 1F3FA 1VQ7S 4C11A 3OUYA 3GP9A 4B3SJ 2W2PP 3OR2A 4NA3A 1RAGB 1NEEA 4FDFA 4AXJA 1WD6A 4LFCF 1ZZFA 3MMCA 4OHVA 3TJAA 4L76A 2CQPA 4EK2A 2MKSA 3N01A 1P8GA 2J9EA 1R3NA 4FBUA 3V6DB 3KG4A 1OIAA 3A8JA 1RWKB 2E5HA 2YQ0A 1ZAXA 3MM8A 4RNNA 3LALA 3CJSA 2MQQA 1RT4A 5E33A 2RT3A 2ZJPQ 1UZHA 1NDKA 3HHLC 4WWSA 1XJWB 4RNOA 3MR3A 1Q8KA 4U8YA 3M2UA 4FF4A 3RR7A 3DCAA 5HSPA 3PX4A 3VWSA 5L1JA 5KOWA 1NJXA 2F8HA 2V2QA 5E3QA 4O44B 3CCRS 2M9KA 3PYEA 3UCGA 2UUAJ 3D1HA 4GKKJ 4EBCA 3FVYA 3TJ8A 1MMDA 5J2MB 4ZVRB 5DGAA 1S0MA 4EO8A 2OEJA 3EZOA 3N5FA 2V4RA 3J7Z5 2H5JB 3QSYB 4M8LA 3C16A 2KG0A 2R2RA 2UXCF 3A1YG 3AJ2A 2IYIA 3SFUA 1X0FA 1Y5NB 2DGQA 4DR2F 1S1VB 1JJCB 3ICLA 2H9ZA 2IMWP 2OH2A 3JXOA 1R0AB 1GTEA 3MOJB 1HPZA 3DRSA 5IV4A 2FY1A 3JAMU 5LT5A 4JI6F 1VS3A 5KFZA 1TKXB 1RTDA 1KSPA 4H4KA 2JZ5A 4W98A 1FFSB 2J9DE 4DCJB 2J8SA 1T9WA 2EK1A 2DO4A 3TZWA 3FKBA 2FYXA 2VFTA 1X31C 2M4MA 2W01A 3W3SA 4V1Ak 4B17A 2HFOA 2BANB 3MPVA 3OHBA 3MPUB 4FYDA 2BXJA 1PO6A 2RQCA 3SV3A 2ASLA 2CPXA 2ZNYA 5EDWA 4D3GA 4R0JA 3OXGA 3JSYA 3QT5A 5GVQA 1HMVB 2I1RA 2M7SA 4USUA 1YZ7A 4LF9F 1BQNA 1W7WA 2RQ4A 2HQCA 4NZ0A 4USJC 3PY8A 4AQYF 4DI6A 3CC2S 3IAS9 5FLXU 1F5BA 4TY9A 3G4SS 2NXCA 1HD0A 2AYMA 5LJ5Y 2D9OA 5LSLA 1JXEA 4J9MA 1DRZA 4Z7YA 3S7RA 4TYAA 3PW7A 1F6TA 1VRTB 3FBBA 2PSZA 2B56A 4ED0A 2DISA 1D8YA 1FJEB 4QW9A 2IM3A 2V8VA 2D1CA 1O5JA 3KMSA 4LR7A 1FT8A 5ITHA 1B3TA 3JSBA 4JBCA 4PG8A 4RNFA 4DX7A 4BLGA 1TL5A 3IR7B 3HHKA 4NOHA 2HS4A 4KHPF 2W9BB 1RSCA 1WACA 4DR5J 1J5OA 1RT6B 3KG0A 4LFAF 4R0EA 3FQKA 2R7OA 2VKZG 4NI2A 1TL7B 5DGBA 1CC7A 4QU6A 2WZ1A 4L73A 1ZA2B 1IKWA 2OEMA 2VFVA 1S9EA 2K7JA 4MH8A 5L46A 1FRJA 3CIZA 4NLTA 1S9GA 1BQXA 4JI0F 1TMJA 4DV7J 5B0BA 5KT2A 4DQRA 4KKOA 4JV5F 4KJIA 4JI4F 3DOKB 1M5KC 4RL1A 3IRXA 4K7QA 5C25B 4LF7F 2C3YA 3S1TA 4Y2CA 1ROFA 2IY5B 5F0WA 2FVPA 4KGXB 4KGVB 2CVEA 2BOPA 1O0PA 3DGPB 1C0TB 1D9AA 5E3CA 4CNZA 4DR7F 2YX7A 4Y0FA 2NSBA 4DQIA 2IMOA 2B6AB 4I2PB 2OPSB 1UMJA 2DIUA 4WU3A 3OTDA 3AOCA 1S99A 2CYYA 1QLNA 1N0UA 2VBXA 2AEFA 1LW0A 1KVJA 2IPOB 2AJ2A 3C6UB 2VC0A 5KFGA 1R8AA 3PV8A 3QNWB 2J76E 2YPYA 2ASDA 2QMXA 4P73A 2DXEA 1T03A 1VR6A 2C2OB 5IV3A 4XDCA 4F2SA 5AXMA 3OT9A 4O4GA 1PJ5A 2W8LA 3R5GA 1RKJA 4KB7A 1TUVA 2CQBA 3IR6B 3KHGA 5L39A 2AX1A 4AD6A 1QAJA 2J7KA 4O3QA 5DETA 1UEKA 1AXQA 4ECXA 4WF9Q 2DH9A 3A3PB 4K4TA 3R2CJ 1SL2A 2XMAA 3S01A 1N5SA 1VDHA 5KG4A 5GAEI 3J80Y 4DV1J 5IFMA 1RACB 4CM0A 1XNQJ 3TZYA 3CCTA 3OTOJ 1P6TA 4YEAA 4C0HA 1UJ6A 3UCUP 2VQFF 2HW3A 4IH7A 3UN3A 3LWMA 1N32F 2RJZA 3DMJA 3CGIA 2OELA 4X64F 1H7XA 2Z2LA 3KLIA 3AJ1A 3ETMA 1SIZA 3OUYB 1OSCA 1Q8BA 1RAOA 4YDXA 2CRLA 1U47A 3UD4P 4JV2A 4DZ6A 1YBAA 3MMCB 2R7RA 4AFFA 8RUCA 2PEHA 1X4EA 2YTCA 2LU1A 2H4YB 2YH1A 2FZKB 1WORA 1SI9A 2MXYA 3F41A 1FDBA 1B7FA 1Z2ZA 3HVAA 2L9NA 4X4TA 6FD1A 4IRKA 1Q81T 1PILA 2FJWA 4YS2A 2GJIA 5LMUJ 2ZD1A 3IR5B 1T95A 5F8HA 1RT4B 1K1SA 3JQKA 5KFUA 3UW1A 3TUPA 1YSJA 3TI0A 2R2TA 1RQ0A 5ETOA 2ASJA 1LWEB 1Q0NA 2Y9HA 1FXDA 3DM2A 2K2PA 3LH2S 2AIRB 1HWIA 4M5GA 3P6YC 3IGNA 3M2UB 3PVXA 5HMZA 2NZCA 2BOAA 1LNQA 3QIPA 2W24A 2CNKB 1VIOA 2YBVA 2HVIA 1NSAA 4P10A 2JFKA 5SUHA 2B5JB 4IR9A 2E44A 3QO9A 4UOCA 1HNWJ 4J9RA 1UETA 1NK5A 2HLUA 4LT6A 4M94A 3EVMA 2VFSA 1L3VA 1I3OB 2H5EA 1WC3A 4MMOA 1IQTA 2XI3A 1JJHA 1NKBA 3CJTA 1TR0A 1X9MA 1U1MA 3SV4A 3HO1A 3KK1A 2VF3A 4RBVA 2QC3A 1KOHA 2KDOA 2MJUA 3J80U 3BM7A 4PPZA 3CCMS 2FHJA 3G6VA 4X66J 4DJBA 1Q95G 2ZKUA 3POTB 2WOMB 3CCQS 2BJEA 2DD8S 1HPZB 1S57A 3GG0A 1U02A 4OV1A 4KV8A 2EBGA 3C8YA 1MW7A 2K3KA 4HDGA 3Q83A 3H5SA 5U47A 3DU5A 2DHGA 4I2QA 2IJNA 3CW2C 3P4UB 3LOUA 1YK9A 2CVIA 3Q24A 3BQ1A 2I8EA 7FD1A 2FJBB 1CPZA 4WU2A 3L9ZA 2G0IA 1RT5A 1U1NA 3R5JB 2YQ1A 4YB5A 2U1AA 2G13A 4RWXA 4DR3J 4A8FA 1CJVA 3Q86A 3U7JA 2BJ3A 2I9SA 5THWA 4CLLA 2KT5A 1E6VB 4X62J 1FEHA 1TKTA 4UY85 4JI1J 4B3RJ 5D6GA 4BC7A 4JV0A 4YB7A 3FSXA 4RUBA 3T6JA 2Z2ZA 3SSSA 1MN7A 1EETA 4NWBA 1R6VA 4JV1A 2CPJA 1XR6A 3W65A 2VG6B 1V5IB 1SQGA 4DG1B 2ZZMA 3PW0A 2EKNA 4Y34A 1HQ2A 5IT9Y 1CJKB 4UW2A 1IKVB 4JI3J 3CB4A 4HEA9 2ASYA 1SJ1A 3RG6A 5JVHQ 2BZ2A 1V3RA 4K4ZA 2FB0A 3PNIA 3IRWP 2L3MA 3PX0A 1DQ9A 1GTHA 3R6GB 2MQ8A 3H2UB 2RILA 2GJ2A 4YDDB 3G82A 3ULHA 1NSQA 3Q8YA 1TV6A 5KAKA 4LRCA 3BSNA 2B51A 2X1GA 1HWKA 3L4BC 4X84A 3D7SB 3QAEA 4NXMJ 1MN9A 3MEGB 3JQMA 5E5NA 1DZ5A 4P71A 4M5LA 2OFHX 3VTIA 1NAQA 3B82A 3IM8A 2W2QP 3C15A 2XMWA 2V68A 1TVRA 4FXDA 1J5OB 1HI1A 4B9TA 3CO9A 4PXBA 1RT2A 3J7A1 4ELUA 5LL6d 5FJ4A 4OJ1A 5DZ6A 4J9SA 3DGVA 4NI2B 4ZVQB 2A2DA 1N33F 3QPIA 4OX8A 4DS5A 2HHQA 4FYXB 2AF6A 1NB7A 1OPZA 2K7KA 1S9EB 2C28A 2BBEA 2XCAA 3PIPQ 2UXBF 5KFLA 1S9GB 2OLWA 4Q7AA 5F8NA 3C6TA 2WBRA 2V8DA 2FLOA 2IYGA 3V6HA 2GMHA 4OI1A 3MF5A 2C3MA 3PHTA 4QPXA 5L38A 1FERA 3V6KA 1F2HA 1FJ7A 2GGPA 3IRXB 2LCWA 1VQNS 3DRPA 2RU9A 1Q8IA 3K59A 1ZZNA 1U1RA 1J2VA 4P2SA 3VR1A 3IA0A 2FUG9 3IWNC 4CH1A 3VGSA 3C46A 3CDUA 3OJUA 3ONQA 2YNGB 3RB0A 1FD2A 1K44A 1X4HA 3WIUA 1S1XB 2K1RA 2QA1A 4M5HA 2AJ1A 2BE7D 5IT9U 3EGNA 2J6SA 5H9FJ 4HHHA 3M8SA 2DT9A 5GAGU 5BXIA 3IG1A 1MLAA 4H4KC 3MEEA 2WSFC 3OL6A 2AYEA 5IT0A 2IDLA 1LWCA 5CYQB 1RHUB 4DCPB 3FSIA 1R27B 4MJKA 2XCPA 1C1CB 1T7PA 4EZ9A 2XLKA 2E1CA 3GE9A 3EE3A 4WPAA 1VQ8S 1FNMA 4I69A 2X1AA 4USIA 3FJ2A 4GVBB 4UTGA 2XULA 1SBRA 3QQCD 4NXNF 1RAHB 3HSZA 4IOBA 4J9KA 2VHGA 3LPYA 3MEKA 3W8PA 3MD3A 1X0PA 1RT3B 1MG7A 4OI2A 3MUTP 1JLBA 5CCLA 5FD1A 5KFNA 2BW2A 2XMUA 3EXCX 3AH6A 4OZJA 3FGVA 1QAIA 4RR5A 2NSCA 3KLIB 4DX6A 5AXKA 4F0HA 3QYYA 3ZTRA 4CO3A 5HMXA 3GV5B 3MMJA 4RNMA 2DITA 3H2VE 2VPYB 2XMKA 3GSIA 3HVTA 2X3DA 3R5CA 1TKZB 5CZXA 5HI7A 1QSLA 1M1KT 1RWWB 3T19A 1ZTWA 5A8RA 2UUBF 1NDCA 4DPTA 4C2MA 3OLBA 3W7BA 1CS4A 2GMJA 2JH3A 4OZ5A 2ZD1B 3CDEA 3VZIA 3VGVA 5DS7A 1JNZB 3TVKA 1X9SA 2NUHA 4WTYA 1HFEL 3DM2B 3O5TB 3KK3B 1EAYC 1FWLA 3PW2A 3R9LA 4V19X 2ZFHA 2BUNA 1RE1B 4CLYA 3M7VA 2IHR1 2HLTA 1FWKA 2XEXA 1TK8A 2QG9B 3QO9B 4WXWA 2G2ZA 2GAHC 3KMQA 2IBOA 1RU1A 4ZJQA 4M63A 2DNOA 5DDPC 2HZCA 3PM9A 4IO9Q 2WB4A 4A8MP 5LM7E 2V9WA 2V5HG 4PUOB 1RDRA 1WHYA 2DK2A 4OYXA 2CJKA 3GYNA 3UN2A 3KNAA 3H98A 2GHVC 2VIHA 4WXOA 3MAAA 1VK3A 4NLQA 2OMLA 2OGUA 1C4CA 1URRA 3ILLA 1WI6A 3V4IA 4KV8B 2RDIA 4K0KF 1CQNA 1NKCA 4LF8J 3JB9k 3BYPA 1KWMA 1NK4A 4ZPVR 2C3OA 3PFEA 2Y1RI 1FRLA 2LEBA 1UVKA 2YKMA 3RU0A 2QA2A 4IFYB 2GAGC 4C8NA 1A0OB 2VKRA 4RW6A 2UUTA 5CD4H 2CJ9A 3Q22A 1TFYA 1J27A 4OX9F 2HHUA 1CSJA 3FZBA 1P1LA 4DL2A 4RW8A 3DYAB 4DSJA 4Y00A 3KFWX 2FC9A 1NPRA 1FK9B 3BSAA 3ELHA 2ZDOA 4X4SA 3ETOA 3H20A 3I55S 3MPDA 4NYZA 2AT1B 4EYIB 1GEHA 3T5LA 1CJTA 3GJTB 4X4QA 4DU7A 3R7SB 4WFBQ 1DARA 1NMEB 3QGPA 1R8BA 2Y3YA 3D54A 1VJQA 5DDQC 5KG1A 2ZBQA 4RUCA 3TQ1A 2WVEA 3MPWA 4ECYA 4NEYA 1MSWD 1R31A 2YNHB 2QIFA 4M5JA 1MNEA 3T1HF 4FYWB 2A1BA 2BA9A 3B8HA 3K5LA 4KY3A 2CQ4A 4YP3A 2BKPA 2DRAA 5J2NB
chains in the Genus database with same CATH topology
2M52A 4KGKA 1KEKA 2ZE2B 3IO1A 3MGJA 2CZVC 3UR0A 1WTFA 3PW5A 1IKVA 4MKBA 4ZDNA 4A46A 3QJJA 2HWIA 3TP2A 5HP1A 3BDPA 3SFGA 5KG7A 5BYSA 2BABA 2EFVA 2L9WA 1N36F 4MAKA 1T05B 5AXNA 2VA3A 4QJVA 3DLKA 1W2IA 2RS2A 1U1PA 4MK8A 3X3UA 2YNFA 1UJ5A 3IC1A 4URQU 5E0OA 1TVRB 2ACYA 4ZP8A 1Q16B 3VAFA 3CJ5A 3DNCA 3SSRA 1KN6A 4KSEB 4WYWA 3M6UA 4Q2LA 4DBQA 2MZQA 1RT2B 2EW9A 2JEFA 2G4BA 4B3OB 4DL0C 2UP1A 5DLGA 1LOUA 1SKWA 2ADCA 1VQ5S 3FEYB 2BQUA 4DOZA 4TXSA 1FO1A 3QZ7A 5F8JA 4X4NA 4DL7A 1ZTTA 4DLGA 4KBIA 3AY0A 3NNHA 2LXUA 4C8KA 5KG6A 5D3GA 2WSCC 3A8EA 4R25A 1S1WB 4AL7A 1H2VZ 2LEAA 3MEGA 2F9JA 3MMBB 2CQ1A 1Y5IB 2FJXA 5M2UA 4M5DA 2DNMA 2A3JA 2VC1A 2XGQA 2XI2A 4OI6A 4TKTA 4KO0A 4N47A 3CDWA 4PXCA 2CIMA 4N77A 3CCLS 7FDRA 1L3KA 1HW8A 4L72B 3ENVA 1V3SA 5D4NA 4Z37A 1UFWA 2JOQA 5L1LA 5B09A 1SH0A 3FZ2A 1JXLA 2KN4A 2FHJD 3DRYA 1IKWB 2XLIA 4GO5X 1UVMA 3HDSA 1HWJA 2E5JA 4XK8C 5EN1A 4MIAA 1TAQA 2HQ3A 2EWHA 4WZMA 5EUHA 3G86A 3W2WB 4WFZA 4X4OA 2OMOA 1ZOTA 1RT6A 2RKIB 3EZ5A 2OTJS 3NMRA 2DGSA 1HBMA 2IM0A 1JK9B 2KH9A 5K8MA 2GFFA 2F40A 4N8NA 4Z2XA 3HHLB 1R6YA 3G6ES 1M5OC 2HS0A 5GAEU 1HHTP 3G8QA 4QW8A 2GGPB 4F8RA 2J7WA 5KG5A 2MKJA 4KKOB 5CYMA 4WE1A 3FRZA 1A6LA 4F26A 4DHVA 5B0AA 4A48A 3KLGB 1S76D 5GMKa 5GADI 2OD6A 3OLAA 1TK0A 2UUAF 1BGXT 4C8YA 1RK8A 4FN5A 2R7SA 4FVCA 4NLVA 2D3OR 5KFAA 3HHDA 1S79A 5JVGQ 2OJ3A 2CQ3A 1SV5B 2E7WA 2VA2A 3IWLA 3NLCA 2M0GB 1J5EF 2O01C 1SC6A 4FXWA 3N0VA 3QGIA 2YH0A 3O6QA 2GCFA 3MEDB 3CD5A 4Y2IA 2UVUA 2CPFA 3ZZTA 1U1LA 3LAKA 3AAWB 1R7IA 2BQRA 1GNKA 1U2FA 2G9OA 3OTBA 2OPQB 3VAKA 2N3OA 2IRYA 4G1QA 5CA5A 1JIHA 2WBMA 1VQSA 4LQ9A 1FCAA 1JLEA 2HNYA 2DNLA 2EFOA 1S6QA 4N8OA 2E5LF 2MY8A 3C3LA 4BWMA 2X1FA 4KHMA 1N88A 1KC8T 2Q66A 1GX6A 4E98A 3BN4A 1D9DA 2NPFA 3JYTB 1CLFA 4JI7F 1UP1A 4B9VA 3RAMA 1Q78A 1SH3A 5L1IA 3UWTA 1XN9A 1CEZA 2JSXA 2MQMA 3TR5A 2BQ3A 3EZUA 5I42B 1S6PA 4H4MB 3IG1B 1XBWA 2FGCA 5C25A 5BR8F 4F2RA 4MTPA 4M1KA 2K8GA 4C97A 3W2VB 4C0OC 1LWFA 1Q1KA 1JLQA 1TP7A 2MDAA 2HFNA 2OD4A 4EYHB 3NS6A 4CT9A 3M8RA 2HS3A 4NLYA 3NNAA 1G7CB 2YNIA 1Q8LA 2YNGA 3CT9A 1MMNA 1TK5A 3RAQA 1VMBA 3I0SA 4ZP6A 3RRHA 1HW9A 2ZHOA 2E9RX 1JKHA 4RUAA 1LW0B 4NA2A 2ZH7A 2KB2A 2KI2A 2HMIA 1S1XA 1H2TZ 2MZTA 3MUVP 2DNKA 2GQQA 2M3DA 4HT7A 1FRMA 4DFMA 4RW7A 1HR0F 1XNRF 4HDHA 4OZLA 1FRKA 1SUQB 4HKQA 3GV8B 2W4DA 2B6AA 2VD3A 1X4CA 2FLNA 2J9DA 2N82B 2LECA 2RMLA 2Y1JA 1HWUA 2OAUA 2OPSA 2HRUA 1YTYA 4FXVA 2M2BA 3T9NA 1T03B 1WWHA 4IH5A 4AXIA 2ATLA 2GHPA 2QRRA 4Y2AA 1F9FA 3NCQA 1YG0A 3FNNA 4F67A 2MQOA 2A10A 2E1RA 4YQWA 3CCES 3RRGA 3CD6S 1FKPA 1X4GA 2DIVA 1VI7A 4O4GB 2D41A 3C66A 3BGUA 4MKYA 2DVIA 3PACA 5CYQA 4LSLA 4QOTA 2UZAA 2PGCA 2MZRA 2PDAA 3MCSA 1C1CA 2DGXA 3P96A 1NHUA 3SCIE 1XR5A 4BBYA 4CZCA 2FLLA 3LP0A 1UVNA 4OL8A 5KT4A 4WJBA 3HXMA 5KT6A 3MXHP 3LP2A 4MIBA 3SCLE 3UNGC 1JX4A 2KVIA 3C6UA 1MMLA 1YI2S 1K73T 3IN5A 2QLXA 1CG2A 4GO7X 3PIOQ 3KHLA 2OKQA 3ISND 5AXLA 2WTFA 3DN9A 4PG6A 3PR5B 3GFYA 1UWBA 1FD8A 1RAJA 2R8GA 2R7VA 1DTQB 3RTVA 1R8HA 2AQ4A 5F9NA 1VQ9S 2KFYA 1Y5LB 4C4WA 2KFNA 3KJVB 2YWGA 2CQHA 3IWXA 3V2UC 3QJLA 3TAQA 1IKXA 4K4UA 5J2PB 1Q86T 3I56S 3GSDA 3BQ2A 4OHXA 1YJTA 3I31A 4YFUA 1NK0A 3NMAA 1XC9A 2BE2B 1S7HA 4GMKA 2M8DB 1SJRA 1FHTA 5LSRA 3JTOA 3R1HA 2VBZA 2JRSA 3DLHA 4O3RA 1JLAA 2DH8A 5IM0B 1YIJS 3KYLA 3CJ4A 3PZPA 1WEYA 4ZP9A 3Q2SC 2ILZA 3DMJB 2HHWA 4CH0S 1MROB 1Y7PA 5KFOA 2BJDA 1QY7A 2LA6A 3K8VA 1WF0A 2C2RA 1RT3A 1X5OA 4ZOSA 3RZAA 4C3MA 1FTCA 3BB5A 3TUJC 4KQZA 4HYKA 4ATNA 2C42A 4DFPA 5KFFA 2HPUA 5KFRA 1B0PA 4EWTA 2PE8A 5H9EJ 2B4VA 3HMJG 2MKCA 1IN0A 4RW9B 3SQGB 3SXLA 5HQ8A 3Q0AA 1SKRA 3NBPA 2VPZB 3NAHA 3GQCA 4NYPA 4QIFA 3SZ2A 1HNIB 1LXNA 1OPIA 2LXIA 4AYBD 3MDFA 5B0EA 1SKSA 2QZ8A 3E8OA 4LFBF 3BSOA 2HGLA 3BO2A 3FRYA 4NPOA 4J9LA 1FEEA 2KFZA 1S6OA 2WCXA 3HZEA 4UY8T 4MYTA 2CPEA 4EGLA 1WHWA 1U1KA 5F8MA 1UL3A 1HQEB 3RBEA 3PR4A 5LSOA 2RQMA 2EVZA 5DM6Q 5I3QA 4K5SA 1HI0P 4OLPA 3DRRB 1FDNA 4HHJA 4AE5A 2VONA 3UDCA 4XIUA 4Q45A 1TL4A 2W7PA 3LP1A 1E6YB 4NLXA 4KFBA 5AE2A 4DR1F 4FP9A 1IKYA 4ZCIA 3BGLA 1G2EA 2BRKA 2UUWA 3PEHA 5EGYA 2KTQA 2HVHA 3PEJA 1RT7A 1BLUA 3IXQA 5KFIA 2D3UA 5MLCV 4ED1A 2R7WA 3ITHA 3H59A 4Y65A 1VQ7S 4C11A 3OUYA 3QGGA 3OR2A 4NYOA 3EXYA 4NA3A 5DDRC 4DV5F 1IBMF 3GG1A 1NEEA 4AXJA 3HHLD 5KFCA 4O3SA 1WD6A 1TKZA 2RE1A 3TA2A 4LFCF 2DNPA 3SMZA 2Q6CA 3G96A 1ZZFA 2EK6A 3RW6A 3HF5A 5H1SV 4ECSA 5A8WA 2CFXA 3MMCA 5GAGI 4RX6A 5IWAF 2DCLA 2Z8QA 4OHVA 2P6TA 4ED7A 4I0WA 4ID5B 2ZH4A 4IG3A 2AJQA 3D5MA 4A8QA 1KQKA 2M70A 2CQPA 3ZZOA 2DHSA 1D9FA 2ROEA 2Z0GA 1KTVA 3QIPB 3KHHA 2MKSA 4DEZA 2IRXA 2HNDA 1X5PA 3KLEB 3N01A 1P8GA 2E29A 2J9EA 3TA1A 1TQLA 4DFJA 2G1DA 3KTQA 1P1TA 1R3NA 4DR5F 4FBUA 1KLMB 3V6DB 3KG4A 4N76A 1OIAA 2HFZA 1HARA 3CVKA 3DOMA 1S77D 2E5HA 3MM8A 1ZAXA 4JOUA 2B9XA 2J6TA 4RNNA 3LALA 3N5BA 1OO0B 2FDNA 2MSSA 2ILYA 3QLHA 2MQQA 5DG7A 1N6QB 3VAIA 4H4OB 1RT4A 3OQ2A 5E33A 3MM6B 1G3OA 2N7CA 3K0JA 4IOCQ 5KOXA 2RT3A 1RYRA 1GXUA 2FVSA 2SXLA 1V3ZA 3HX9A 3TAMB 2ZJPQ 3CSKA 2GIQA 2QA4S 1VOMA 1WG5A 4DSLA 3KK3A 3HHLC 1JNRB 2KJWA 1F2GA 3ZFVA 2GC8A 3O44A 2ZC4A 3NS5A 4TYBA 3HVWA 4ES2A 4OX6A 4I1TA 4RNOA 1YQHA 3MR3A 2KG1A 1U09A 5HLFB 1QJHA 2VG7A 3M2UA 2BYCA 1VC0A 5EX0A 2UVRA 4FF4A 3H5YA 5KG0A 3RR7A 2NLWA 5K14B 3DCAA 3DOLB 3PX4A 2LDIA 3I5CA 4OI0A 3VWSA 5L1JA 2Q79A 5KOWA 2XG8A 1NJXA 2F8HA 5E3QA 4QWCA 3H5UA 3M30A 3L95X 4O44B 3CCRS 2M9KA 3SEOA 2EC0A 3UCGA 3D1HA 4IQMA 1HA1A 4EBCA 3FVYA 3KK1B 2I0XA 1MMDA 2XLJA 1R89A 5J2MB 3HK2A 2ZH1A 1IM4A 5EX3A 2EG1A 3QMQA 2R8HA 1F60B 5LJ3Y 1QE1A 3LO3A 4RLEA 4BS2A 5FDLB 4ZVEA 5DGAA 1S0MA 4DL5A 1AW0A 5FIIA 2AWZA 3JTNA 3M32B 4EO8A 1O51A 3RW7A 2JC0A 3N5FA 2V4RA 2R7TA 3J7Z5 2UXDF 2V4JA 3L3CA 1RTHB 1SL0A 1KR4A 4Q8FA 2RRBA 1KLNA 2IM1A 4PUOA 5B0GA 3DLEA 2JHEA 2DPJA 3CUNA 3UD3P 3RB4A 4M8LA 2GO8A 1NK6A 3BSCA 4NA1A 2DNYA 2KG0A 4CTAB 2R2RA 1BQMA 3BR8A 1VBZA 4ICLA 2FHKA 4XO0A 4F4YA 3K57A 2KZMA 4I2QB 1C1BB 3I87A 1HBOA 4DF8A 2UXCF 3KLHB 1RP5A 1UFLA 3A1YG 2HGNA 3VQSA 3AJ2A 2DCUB 2IYIA 3SFUA 5J2QB 1X0FA 4CCHA 1Y5NB 4PQUA 2HAIA 3U27A 2C3UA 3FEXB 2DGQA 4NLRA 1JJ4A 4C9DA 4DR2F 4OHYA 1S1VB 5E7OB 1HWLA 3ICLA 2H9ZA 4NRTA 2IMWP 2OH2A 4ZPWR 1RTIA 1GXLA 3T1AA 1R0AB 3T5HA 1UEVA 3PW4A 5KFWA 1GTEA 1RT5B 3H2LA 1LW2B 3MOJB 4ES3A 1HPZA 1Q53A 5KFYA 3DRSA 2YKNA 3U1NA 4ZA1A 2L41A 2V8GA 2IAJB 3M2RA 3QGHA 4IRCA 2GIRA 2FY1A 1WEXA 2AV5A 2FC8A 1X5SA 4RW8B 5LXRA 4BDPA 3EUNA 3DXSX 3I4PA 4J5OA 4R8UA 4B3MF 4DWIA 5A8KB 1DQ8A 5LT5A 5C42A 1XMOF 2ROPA 3L7OA 2LQBA 3ZZZA 2FVRA 4C0BA 4JI6F 3G9CA 1VS3A 5KFZA 3LGMA 1TKXB 3LW5C 1RTDA 3ZZ0A 1KSPA 4J9NA 1GQEA 1M5VC 4ECTA 2MJNA 4H4KA 3JSMA 2XMMA 4IG0B 3U1LA 1PC5A 3MM7A 1TKTB 3HZGA 4IFYA 5F41A 2JZ5A 1ZM9A 3F44A 3NNCA 3KLFA 3OTEA 4V19J 2F4VF 1HBNA 2COLA 2J9DE 1N48A 3M8QA 1IBLF 4CIOA 1A9NB 1MWYA 2W9AA 5E3AA 4C3KA 2EK1A 3HI9A 2DO4A 3DI6A 2MQLA 2I5JA 1EETB 4N56A 3AQOA 3FQLA 2VFTA 3DYAA 3M2VB 3O8WA 3PJXA 3TUIC 3RB3A 5T7LA 2M4MA 2F8MA 3W3SA 1YVFA 3BR9A 2G0CA 1WHXA 4B17A 4N41A 3CJ2A 2HFOA 2BANB 1FK9A 2CQDA 3AA9A 3I32A 3MPVA 4BWJA 4F25A 3OHBA 4FYDA 1BD6A 3HLUA 2BXJA 1U1QA 1PO6A 1N5YA 5K5MA 4R5PA 2RQCA 3SV3A 2ASLA 5IQ6A 2LA4A 1DHMA 2CPXA 1I94F 3VQTA 5KFBA 5KFEA 4K5RA 2R4FA 3M6VA 1SQEA 2MKKA 2BM0A 2OPPB 4A8XA 5F8LA 2MSTA 2W9CB 1W25A 2ZNYA 3NKYA 5EDWA 2I2YA 3E51A 3E2EA 4D3GA 4R0JA 1IR0A 2VQEF 3OXGA 3JSYA 3MAHA 5GVQA 3MR5A 4DV1F 4K4YA 3OFEA 1HMVB 3JSRA 1XNQF 2I1RA 1REVB 2M7SA 3I6PA 5KFHA 2R7XA 3MD1A 4HTIA 3M1VB 1U7LA 3OFFA 3OTOF 4LF9F 4NCAA 3OL7A 3V81A 4M95A 4QIVA 5M2PA 2YX4A 5BYQA 1BQNA 2IVYA 2O3DA 2RQ4A 4USJC 4NZ0A 5F8GA 3CC7S 3FFIA 3I82A 3PY8A 4AQYF 1UVIA 1TV6B 4OI4A 3GYXB 1KQSR 3BS9A 3M8PB 3HFKA 3MM9B 3M6WA 3CC2S 2BR0A 3I0RA 4RKUC 5CHCB 2AW0A 2CPYA 2E1MC 4NCGA