3R7BB

Caspase-2 bound to one copy of ac-dvad-cho
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
95
Chain Sequence
KMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGFHRCKEMSEYCSTLCRHLYLFPGHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 20
structure length 95
sequence length 97
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3r7bB00
1I3OB 1I51B 2C1EB 2H54B 3EDQB 1PAUB 4ZVOB 3QNWB 1RWOB 2XYHB 3EDRB 4ZVUB 2H5IB 1RWKB 1RWXB 2QLJB 1RHMB 1QTNB 2QL5B 2C2KB 3GJTB 3GJSB 2CDRB 1RHJB 3RJMB 3GJQB 4ZVQB 2Y0BB 1RHRB 4ZVSB 2HBZB 3D6MB 4DCPB 4ZVPB 2H4YB 3D6FB 4JB8B 1F9EB 1SC1B 2QL7B 1PYOB 2C2MB 4LSZB 2CNNB 2XYPB 3IBFB 2XZDB 2H4WB 3SIPB 1RHKB 5IC6B 2QLFB 2C2OB 2QL9B 1RE1B 2DKOB 2CNKB 2XZTB 3GJRB 3IBCB 3R5JB 2CNOB 3R7NB 2H51B 1IBCB 4ZVRB 5K20B 1SC4B 3R6GB 3R6LB 1BMQB 1RHUB 2HBQB 3KJNB 4ZVTB 2QLBB 2XYGB 1QDUB 3P45B 4DCJB 1SC3B 2H5JB 2P2CB 1RWMB 3D6HB 1RHQB 5IC4B 2H48B 3KJQB 2HBRB 2CJXB 1NMEB 1RWWB 3NS7B 3P4UB 2CNLB 2FQQB 1GFWB 1ICEB 3KJFB 2HBYB 1RWNB 2Y1LB 2CJYB 1RWVB 2H65B 3R7BB 3R7SB 2C2ZB 1RWPB 4DCOB
chains in the Genus database with same CATH superfamily
1AFIA 3NGKA 1S1WA 1Q5YA 3MPUB 4KAIA 5HSPA 1U09A 1WG5A 3MTJA 3EVMA 4CM2A 3GILA 4K2JA 2VOPA 1TAUA 4C8OA 1S1WB 1IKYA 3O3LA 5T7LB 2MJNA 1GXLA 4ZVSB 1I94J 3ENQA 2BE2A 4I6AA 2MHEA 3MR7A 2AX1A 3LPYA 1UKUA 1TL1A 5HJXA 2DH7A 1IKYB 4ES2A 2I6WA 4USUA 1RADB 4MAKA 1L3TA 2QL9B 1GMWD 2CZVC 2HSEB 2VF3A 4QYZJ 3FKBA 1SPBP 1FX4A 3C15A 1IBCB 2VL1A 2J0WA 4F2RA 3T9ZA 1KONA 5J2NA 5DG7A 4RNOA 2CZ9A 3GR0A 3C15B 1CVJA 5G4DA 2KKHA 4JI0F 4N5SA 1GMWA 1DBDA 1SIWB 1RT6A 2XY5A 2JVOA 4LSLA 1QAJA 2CYYA 2ILZA 4Y3CA 2WVBA 2MZRA 1RT6B 3VGTA 3FMBA 1S57A 3T1YJ 3T1HJ 1RB0A 4LSLB 1X4EA 1VHFA 4OX8A 4HH1A 4W90B 1T9VA 4HDHA 3TVKA 2ABYA 1NU4A 2XSFA 3CO9A 4ZVQB 2PFFB 2C2EA 3QAEA 3DDNA 2QX0A 1QUPA 1YHQS 4OIXA 3W66A 4ETXA 4OYXA 4QU6A 5AJ3F 3H7HB 2MGZA 2CQHA 3I87A 2H4WB 1Z4UA 2CA9A 4PG4A 3J80Y 4ALZA 3PXGa 3TJ9A 4J9RA 4P75A 4CO4A 4LR8A 5IS2A 2MGZB 5HATA 2ZBQA 4FVMA 3RTVA 4LRFA 1R0AA 1TFYA 2CQ0A 4NI2A 3IAM9 1FTCA 2WOMA 4M5IA 1J5EF 2CADA 4LBHA 3PY8A 5CHCB 3DNCA 1NNDA 2R9LA 1R0AB 4NMXA 4ITSA 3UDCA 2PT0A 4WZMA 1GFWB 1ICEB 2YXLA 2XNRA 4DG1A 2VC1A 4CLUA 2KHCA 1T3OA 4WJBA 2GS8A 4RUAA 3OL8A 4A8OA 3CCLS 2C1EB 1IWGA 3QT6A 4FF3A 4RW4A 4NX9A 4DG1B 2BW7A 3CNQP 5HI7A 2VKRA 2VQEJ 1U1RA 2XWYA 1ITPA 4RW4B 2K7KA 2W9BA 3J7A1 1ZPVA 5HMZA 5KT7A 4FXWA 3HK2A 3BM7A 4RO0A 4TXSA 3PCOB 2W9BB 5D6GA 2RF2A 5HLFA 2GJFA 1UFKA 2R7WA 1Z1ZA 3HZGA 2B9WA 1ZM2A 1N34F 3V6KA 3MPYA 1J27A 4WK1A 2RF2B 1FERA 1FFGB 4A4JA 5HLFB 4USKA 4K4VA 2CQIA 2VBWA 4C0BA 1R7IA 3IRWP 1PC5A 4XK8C 3RB4A 5DGAA 1B0TA 3R9LA 3CCZA 2N7CA 1RAFB 1VQPS 4TY9A 1NUEA 5LM7E 1N5YA 2VV5A 4X4SA 3KLVA 4PABA 1JXLA 3JTNA 4OYAA 2HNYA 1HL6A 5DDQC 5DRKA 2DEJA 4A8SA 2CQDA 3GPAA 4A48A 1FWPA 5AE2A 4HT5A 2HNYB 3MOJB 2N3OA 4U7CA 3MAQA 4R0JA 1AYEA 2Z4PA 4EFAC 1WACA 2MKCA 4UQTA 3CJ4A 1FNMA 3ZZZA 3AD7C 4DCPB 5HMYA 4C8YA 4LIRA 4DL6A 3UN2A 5C2CA 2QO3A 2QMXA 1PYTA 3LOUA 3VF0B 4E98A 1YQHA 3M8PA 3PM9A 2AKWB 4LRDA 3W63A 5JXSA 3M8PB 4ECWA 4DV1J 3GG0A 2IA6A 4WIQA 5GAEU 1FVSA 1R8CA 4C8MA 2R2RA 2V4JA 5KTQA 1WD6A 4NXNJ 5ETRA 1YZ7A 4J9SA 3BKFA 4M5JA 2VKZG 3THTA 2W2OP 4LFBJ 4X4TA 1HNWF 2V4JB 4HLBA 4DV5F 1B70B 2OHDA 4WFZA 1UEVA 3JQJA 2DJWA 1ZTTA 3MI7X 1H7WA 1RT2A 1L3KA 3UCZP 2ILYA 2QYCA 2BACA 5E0OA 2RQMA 3VZHA 3M8ZA 4HHUA 3DRPA 1UWBA 2L3MA 3BDEA 2ZC3A 3V81A 2W4DA 4RW8A 3H5XA 4IFYA 3ETOA 1WG4A 3O1LA 4DV3J 2MKYA 1UWBB 1HWUA 1WKKA 4QW9A 2VHGA 3V81B 4RW8B 4IFYB 4A46A 4R5PB 2HFOA 2GHPA 1RE1B 3B82A 2DHSA 3LP0B 2UUBJ 4ELUA 4LF5F 1T9TA 2XG8A 3M9NB 4WKYA 3I9ZA 4WPAA 1HQ2A 2FJWA 1TUVA 2GVDA 2YTCA 4ZA1A 2CIMA 4EK2A 4EEYA 1P8GA 4LF9J 3SDEA 2GVDB 2PMHA 1N4LA 1OYDA 3CCVS 4I68A 3QRPA 1RTZA 1YITS 1TKDA 3ETMA 3ONQA 3DDIA 5F3TA 1S1VA 3SDEB 3NS5A 3BBCA 1PAUB 3QNWB 4K4SA 2ZFHA 1R8HA 4XTTA 1KVJA 1S1VB 1X9MA 3HJVA 4X4RA 3VALA 1PIEA 2PN6A 4DR4J 4BLGA 1LW0A 5KFCA 2ZBCA 3LF0A 1F2HA 3BEGB 1M0SA 2AQ4A 1RACB 1LW0B 4YY3F 4QR0A 1M5VC 4DR1F 4I6YA 1M1HA 2XZWA 1SQGA 4MMOA 1S59A 2N4CA 1DURA 2D7SA 2KO1A 3IFEA 3CF5Q 2E7VA 1RHUB 4C8ZA 3J81j 1TK8A 1XNQJ 4LIWA 3D5MA 2AIRB 2D3O1 3ICLA 3J7YI 4WP8A 3MM7A 2B43A 1CJKB 2ZOGA 2FJEB 3ENWA 1F5BA 4YR3A 2CJKA 4TU7A 1K8AT 5EHHA 2C3YA 3KXDA 2AEMA 3M9MB 3MM7B 4G1QA 2D9OA 3OVAA 4X2BA 1C1CA 1KLMA 1SC6A 3K59A 4CWBA 2PI4A 3RAXA 1U1QA 3KLIA 5CZXA 4OI1A 1TMJA 2E1RA 3AJ1A 1YBTA 2IYIA 1C1CB 1KLMB 3QLHA 3MCMA 3PJXA 2YQ1A 1UEUA 1KS2A 2W1BA 3KLIB 1GXTA 2XO6A 1NDKA 4C8LA 1U02A 4JV2A 5KOXA 4HDGA 3QLHB 3OXGA 3SIPB 1MWYA 2OLWA 4ZIWA 4ELTA 2BM0A 2L48A 2XY7A 2JRSA 3LGMA 2KXNB 4Y6IA 2Q3PA 4N41A 5J1PA 5THWA 4YR2A 3Q8SB 2YWKA 2ZKTA 2E7XA 5KFEA 1U1KA 1B7FA 4RUHA 1LOUA 5H9EJ 3ILJA 3ILLA 1GQEA 4Y0FA 2R7RA 4KGMA 3B6BA 1IBLF 2Q66A 3EICA 3ZTRA 2WVFA 5DQGA 2EG1A 4KHPF 4C9DA 1E6VA 2IRUA 1NK8A 1I51B 1VBXA 1X5TA 4NLDA 2IM3A 2MY8A 1RQ0A 3GONA 8ATCB 2CQ1A 1E6VB 3DRXA 4UOCA 3CJQA 4P72A 1EHWA 2QN6B 4GKJJ 3H2UB 4DV6F 2PFDA 2BJDA 3VAFA 4JBCA 2QC3A 1SKUB 2N7YA 2KH9A 4L75A 1PCAA 3NAHA 2XLJA 1GTHA 1MROA 3OHAA 4DQSA 3MEEA 2BANA 2KDOA 2DO0A 2MZQA 2QG9B 1QVGR 1JJ4A 1MROB 2NXUA 3VCDA 3LWMA 3MEEB 2DGTA 3VAHA 2BJ3A 1R31A 3WHIA 2KG0A 1KHWA 4QCLA 4J9UE 5AE1A 1XMOJ 5KOWA 1YJWS 4IO1A 2ROGA 4DQIA 1QDUB 5DZ7A 2PMWA 4JI8F 3P4UB 2PA8D 2CNLB 1U1MA 4GRSA 5LSRA 4ZP6A 2E29A 4WBFA 1NPKA 2JX2A 2JLEA 2LMIA 1TAQA 4I67A 4YDXA 4HI1A 1ZOTA 2FTRA 1VI7A 2MQ8A 4PEOA 5IOLA 3SBMA 2QLJB 3CMQA 1RZMA 3BO2A 2G1DA 1WHYA 3GSDA 1S6UA 2PDAA 2E9ZA 3Q8UA 4JYAJ 2RVJA 3DRSA 3QGHA 1B0VA 2VFSA 2RB7A 3CGIA 2YKPA 1S6QA 1X5SA 4LMZA 3AXKA 2ZZNA 3DRSB 2EFPA 4ZLJA 5KFBA 3CCWA 3W8PA 1TK0A 3IRXA 3EZUA 2PD1A 1S6QB 1S9GA 3PW4A 4IRDA 3HZEA 4OZ3A 3IRXB 1SVDA 2CDQA 4KC5A 2VC0A 3BR8A 4NCGA 2B9EA 4WCEQ 2ZH5A 2X7IA 1HQUB 4GO5X 3KLEA 3SFGA 4NCGB 1KRPA 4NA2A 2V2KA 3MFHA 2QIFA 3KLFA 2HS4A 1EARA 3KLEB 5KG4A 2MZJA 3MEDA 3ET6A 3KHLA 1EQMA 3V4MA 5BR8F 3KLFB 5A8RA 4BS2A 4W92B 5FLXY 3MEDB 3ET6B 3MPDA 5L39A 3HHKA 3TQEA 2ZUAA 1TR0A 2I8EA 2L41A 5A8RB 5HAOA 4KV8A 1UJ5A 1QVFR 2E5IA 1XERA 4LF8J 3HCXA 1N33J 4IG0A 4KY3A 4PQUA 1PGZA 1FXDA 4PG7A 4KV8B 2MZ1A 2X3DA 1X0PA 4QR1A 2J9EA 4IG0B 5E3CA 4DF4A 4V19X 1RGVA 2DNYA 4PQUB 2VBZA 1S1UA 1RTJA 1LK7A 2V2VA 3CC2S 1ZAVA 1RAIB 4V19J 1UJ6A 2IY5B 4JI4J 1XWLA 3VAKA 1NCLA 4QWAA 1S1UB 1RTJB 3NS7B 1NPRA 1HNZJ 4CTAA 2CJBA 1Q8LA 2DRDA 2QA2A 2R8HA 4DFJA 5AE3A 3ZTSA 5I42A 5EGYA 2M3DA 4Y34A 4DCOB 4CTAB 4ZHRA 5A8KA 3D6TB 3VGVA 2V8HA 5I42B 5B08A 1X0FA 4HYKA 4ZHRB 5A8KB 1N8RT 2M52A 1G3OA 1OQ6A 3C46A 1FJGF 2DITA 2RS8A 3AA9A 3B4MA 4MIBA 1R6VA 1ZZFA 3VVUA 1S77D 2QYGA 5K9FA 4FYWB 2DBBA 4EMDA 2QEXS 4P2FA 4PWUA 3MPVA 3PV8A 2EWHA 4FKYA 1QSLA 5IT9Y 1X7VA 1HBOA 4C2MA 1S49A 3TAMA 2C22A 3CE8A 3OPKA 2IDEA 2GMHA 2BUNA 1HBOB 4NOHA 5LT5A 4DFKA 3TZYA 3TAMB 5SUHA 4URGA 3NCPA 3D3BJ 3R5AA 1TKXA 4DL3A 3MM8A 5B09A 2Z0GA 2OEMA 4D3HA 3V6JA 3QIDA 2BMBA 3J81Y 3MCOA 1HNXJ 2WB1D 4ED7A 2XYHB 5KT4A 1TKXB 4LF2A 3MM8B 1XC9A 3T5LA 2C2KB 2NZ4A 4LFAJ 4ZS6A 1U47A 1E6YA 4C4WA 2QLXA 3KUHA 2XCAA 1SI9A 3EVWA 1YVFA 4F3OA 1FJ7A 2G2ZA 3QBCA 3Q8RB 1E6YB 1D3WA 1YJVA 5BJRA 3EGNA 1Q8KA 4CRJA 3NOCA 4J9LA 3MAHA 3NY0A 4WE1A 2AYBA 2DEIA 2XC9A 1NJWA 1W2BR 1EJ7L 2HFVA 5IT0A 4WE1B 2VPZB 1KQGB 1GK8A 5F8NA 3IWLA 2B9YA 2MDAA 3T3FA 4K4ZA 3NCQA 4RNMA 2LCWA 1YBAA 2M8DB 1TTHB 2WSFC 3PTWA 4CLWA 4N77A 2G0JA 1BQXA 2ZITA 5AXMA 1GTEA 2QE5A 2RDDA 2X3GA 1RWKB 2FHJD 1D1UA 3RJMB 5E33A 3HF5A 3QQCD 5KG2A 3FEXB 1CPZA 4JI7F 5K8NA 4ZPAA 2BKPA 4JI3F 4Y2IA 4B9SA 4QBUA 4Q8EA 3K5OA 2FHJA 4Q0BA 3R3TA 2HHTA 4M5KA 1NH8A 2MXYA 1Y10A 3CCRS 3HMJG 3MR6A 3GIRA 1XEZA 4Q0BB 4J9OA 4TU9A 2HHUA 2OMOA 3J7YU 2R3VA 1VYAA 3ZXWA 3JTPA 2XYGB 4DR7F 5L1JA 1RT5A 4NL5A 2RU3A 2ZVIA 2DNKA 2GMJA 3HM9A 3JB9k 3D3CJ 2WZ1A 4OV6A 1S76D 1RT5B 4K4WA 3D28A 5F8HA 2R8KA 3NLCA 1RAOA 5L1IA 4OZNA 3VGSA 3D1QA 3K5MA 1RAAB 1Z2LA 3QGGA 5ETQA 1TUWA 5HQ8A 1JJ2R 3CC4S 4ZPTR 4QU7A 3I0RA 2EKNA 3MUMP 2J9CA 4LF7F 1M5OC 3C19A 4DV2J 3CCQS 3TA2A 2YKAA 4ES3A 2GA7A 4WZQA 2XGQA 5KFAA 3G6VA 3I0RB 2VH7A 2H3EB 2ZEJA 2J0XA 5F8IA 1FKOA 2OKQA 2J0SD 2DR6A 4M95A 2XMJA 2DIUA 1WTBA 2V34A 3T6BA 1VR6A 2WHOA 3R8YA 1JIHA 1FKOB 2WK4A 3DOLA 1X4BA 1HARA 1HYSA 4XPEA 4LRCA 2Y3YA 2EFVA 4DFPA 1JB0C 3DOLB 2JNJA 5ETSA 4KBIA 1HYSB 1TU0B 1VC0A 3L7UA 2DGSA 4FF1A 3NAIA 2WONA 3ENAA 4XDDA 3AD8C 1YRXA 3NMRA 2LQBA 3OXLA 3BQ1A 5E3PA 4ED3A 2WONB 2RT3A 3RG6A 5F8MA 2LXUA 3GIMA 1OYEA 3HLUA 1SL0A 4JI0J 1YX2A 3G71S 2RE1A 1WKJA 2UXBF 1MMLA 5IT4A 2RHSB 4RNHA 3K8VA 5LSOA 2BJEA 4RKUC 1IKXA 1U6FA 4ERDA 3LP1A 1YZ6A 4J9NA 1UVKA 1UETA 2DPIA 2JEGA 4LUBA 1IKXB 1SQFA 1S4FA 4ETZA 2M0GB 1Y7PA 3LP1B 3QGIA 1NM2A 3GG1A 1N5VA 2ZWOA 3E3XA 2W8LA 4ZVTB 3BN7A 2AU0A 5F8GA 4N56A 1VC6A 5AJ3J 4FYDA 3AHPA 2Z58B 2AMCB 3OBIA 2ADBA 4F8RA 3P5TL 5GMDA 2EFNA 4KR0B 4BDPA 2N4DA 1F3FA 4ED5A 1CJTA 3Q2SC 3PO4A 1U4BA 3WBZA 2YKNB 2AYMA 2R7QA 1CJTB 2W4CA 1J5EJ 2XHWA 2IVYA 3Q2TC 3CO0P 4TN2A 2HMIA 2J76E 1XNRJ 1WC1A 2EFOA 1SC1B 4NLRA 3M05A 5KFRA 4AE5A 4HH0A 4U6PA 3F56A 1NHKL 4F4XA 2HMIB 2VDHA 2FVSA 4OZ5A 3I0SA 2DKOB 3UVJA 2NQPA 2DNHA 5HJYA 4RU9A 5ETKA 2J7KA 3I0SB 4ZJLA 4ZPDA 3PJ9A 4KYZA 3PHTA 4ZKAA 1OY9A 2KB2A 3NOGA 4CLSA 5E7OB 4CDIA 2DNNA 1D9FA 4F25A 4NMLA 3GB0A 1I5OB 4GC7A 4PKDB 2AJFE 3K89A 4DZDA 2QTWA 1HMVA 4ZN1A 1TZ0A 3A8JA 3IWXA 2Z30B 4WKRA 2FB0A 3CJTA 1HI1A 1FKPA 5ETPA 1HMVB 3NNCA 4TU8A 1FKPB 4LSZB 4O3SA 4PYAA 1Q95G 4EU0A 4B9TA 4V1Ak 3S01A 3R5CA 2QA4G 1X4DA 1FA0A 2ZD1A 2DVIA 3HO1A 3JAMU 1ULRA 2LKZA 4ZVRB 3J7Z5 1WHXA 2BW2A 4YHHF 2F65A 4WU3A 4FKXA 3SQGA 3V6DA 2MKSA 1IQTA 2IFXA 4DR3F 4LBPA 3POTA 2F8EX 2ZH9A 3SQGB 4DPOA 1W7WA 4DV4J 2MPUA 2KFYA 1SJRA 3V6DB 3QYYA 4RW9A 3B54A 2OPRA 5C5JA 1GMUA 3F44A 3POTB 2IRYA 4P74A 5KFVA 3AY0A 3CDAA 3R1LA 4DL4A 3H20A 4OI0A 1C2PA 4RW9B 2NYHA 1X8DA 2OPRB 2QL5B 1FRIA 2W4PA 4OLPA 3L09A 3PZPA 5ADZA 4F02A 2LDYA 4DFMA 3PEHA 1HNWJ 4IQXA 4DV5J 4N76A 3B78A 2VA2A 1WF0A 3KJVA 4DJBA 4DV7J 3S8SA 3BYPA 3U1MA 3KJVB 3PRDA 1MWZA 2FJXA 3R6LB 3KOAA 3DLBA 4WU2A 4KIAA 3EYZA 1REVA 3R2CJ 2KHDA 2PC6A 5D4LA 1IKWA 3EJMA 2AYEA 2O67A 3CDEA 4Y2CA 5K8OA 1RCXB 5I3UB 4L72B 1S99A 2D41A 1YK9A 5CA5A 4JI1F 1IKWB 4ED2A 1RT1B 1SH3A 1QUVA 1Q4RA 4LQ3A 2RRBA 1HHSA 3Q83A 4GKKF 3BF4A 1ZM9A 1CSJA 2V69A 1S9EA 3OTBA 3W9HA 2MQLA 1RWOB 3WX8A 2NCKL 3FCHA 2V8VA 4YP3A 3PJWA 4AL6A 4ICLA 1S9EB 4B9UA 2DHHA 2F1FA 2GW8A 5ETNA 4DF8A 4FP9A 3Q22A 2CVIA 1HD1A 1LEOA 5KFLA 3WC2A 2F5GA 4CLFA 1X31C 4ICLB 4Z2XA 4XAKA 5IXUA 2DGOA 3K58A 1XJWB 3BBBA 1MSWD 2RILA 5LJ3Y 4OX6A 3N6LA 1LK5A 2CNKB 4ED6A 2AZ3A 2CUYA 2UV8G 3R5DA 3ILOA 2V4RA 1NK9A 3KMQA 3SSSA 3PACA 2A6MA 2XI3A 4J91A 2IHR1 2FJDB 4GMKA 4B9MA 3FK4A 3OVBA 5FJ4A 3K57A 2UVRA 2ZM6F 4DR1J 4I0WA 1OIAA 1C1BA 3C6UA 2Y8WA 4CH7A 1NAQA 1FRXA 1C1BB 3K2YA 2CRLA 3C6UB 2Q79A 3VAMA 2ZNZA 2LVWA 3G8TA 3A1YG 2LQ5A 4DR6F 1K47A 5CCMA 1JNRB 4C0HA 3ZZ0A 2F4FA 3EM1A 4G1IA 6FDRA 4ECTA 2HIQA 5L1KA 2Y9HA 1ZTWA 4ECXA 1RTDB 2C2RA 1FNXH 2C2OB 3U02A 2EXUA 2AGPA 4B3SF 3MAAA 4E2FB 4CO1A 3I96A 4WYWA 3OVSA 1IKVA 2VPXB 5EX0A 2MEWA 4YEAA 1SXLA 1RHQB 4G6VB 4J7CA 2JHEA 3UN3A 3NG8A 2ZH6A 1IKVB 2YQ0A 4X4OA 2K7JA 4KPYA 1RTIB 2DGVA 3LO3A 1RT7A 3ZZYA 3QATA 1U1OA 2MQOA 1HHQA 2DRBA 2COLA 2MB0B 1RT7B 3R5BA 1PBUA 4P2XA 1MU2A 2GC8A 1LXNA 4CH1A 4DL2A 1LNQA 2R2TA 4WFBQ 2DRAA 2N3LA 4ZVPB 4KGKA 1MU2B 4Z37A 3UW1A 4ZP7A 2FC8A 4BBYA 4QIFA 2FJBB 1YJTA 4DX6A 4KHPJ 3HT0A 1EQ0A 4Y2MA 2BM1A 2M2BA 2DGUA 2UXCF 1C0TA 1P9YA 4C6AA 3R1HA 3RAMA 4A8XA 1LWEA 4JI6J 4DV6J 1NDPA 3TZZA 3KWMA 3DM2A 1IJEB 4LRAA 2BE9B 5ETMA 4RU2A 1C0TB 2KZMA 4IFVA 1LWEB 3DM2B 4DSIA 1N36F 4ZK7M 3A13A 4RZRA 4IFVB 3MURP 1F9FA 4CO2A 4HHHA 4KT0C 2HVDA 2OAUA 4NLPA 5J1EA 4M5LA 1XMQF 4X4QA 1S72S 1YBUA 1SBRA 4O4RA 1Z2ZA 1VQ8S 2W7OA 2C2NA 3MR5A 1NZAA 2GJIA 3FVYA 4UY85 5DQIA 5J1EB 4JI8J 2EEYA 4RX6A 3OSPA 3MEKA 5HBMA 2D74B 2WBRA 1CC8A 4I7FA 3V4IA 3IAS9 2LXFA 4CT8A 4L74A 2EC2A 3R97A 1JNZB 1RBLA 2W2QP 5IC6B 1CULA 4LT6A 4NYZA 3N9UC 3V4IB 3DLGA 1MMDA 3M9OB 2R7SA 4ZPCA 4QYZK 1CULB 3FSIA 3DLHA 2DPJA 3C3LA 5DLGA 2GQCA 1S79A 1FEHA 2Z56B 4CLYA 2R7TA 4LSNA 3TWZA 1Y3JA 3LTOA 3IM9A 3DU5A 2FD2A 4NZ0A 4W98A 3S1TA 4LSNB 2B4OA 4CQ1A 2KVIA 3CMAS 2E1AA 2K3IA 2H5IB 5K8PA 5IWAF 3UDVA 2ZH1A 4DPTA 3SI8A 4DHVA 4NPOA 3J80U 4Y2AA 2W01A 5KFHA 4ECYA 2WTFA 1VIXA 4HL9A 2V9KA 1WI8A 5IFMA 2HHVA 2H1YA 1XK8A 1BWEA 5HVGA 1BLUA 2ZVSA 5D15A 2F4VF 5CQGA 1X4FA 3GLJA 2V67A 1Q1KA 2JH3A 5BR8J 4UT4A 1UL3A 2DYAA 5K20B 2XMMA 1VRTA 4AD6A 4ZLPA 5J2QA 4B02A 1TK5A 2IC3A 4LFCF 2ZBRA 2FHMA 4NLTA 5I3PA 2V0NA 3CDWA 1VRTB 3SZ2A 5J2QB 1XMBA 5BYSA 2RDJA 2IA0A 1H98A 3HHEA 3OR1A 3RBXA 3EMTA 2WRMA 3FFIA 4ZCKA 2WVDA 3OR1B 1HW9A 1Q7YT 4X65F 1VBZA 2Q6CA 1V5IB 3FFIB 5LMNJ 5KFMA 3QT8A 3W7BA 2C2MB 2C3UA 2M8HA 2JJ4D 3W5ZA 2KYXA 5D77A 1TL4A 1T05B 1S6OA 3CTRA 2BX6A 4GC6A 3MMJA 2VFVA 3RUBL 3M2VA 1VQMS 4PXDA 4H4KA 3NXZA 4AXJA 2V94A 1TL7A 4JI5F 4MYTA 1UVMA 5LL6d 3M2VB 1XR6A 2HHHJ 2ZBIA 4BCAA 1JLGA 4LVNP 2FVPA 3CVKA 4HR2A 2GAHC 4OHXA 5DG8A 2J5AA 1JLGB 4ECSA 3C2PA 2EK6A 4PXCA 2KT5A 2FHOB 1J2VA 1I94F 2RJZA 1WELA 2KN4A 2YPYA 1N54B 3PRBA 1Y3KA 3R2DJ 2HS3A 4ZCLA 3HSDA 1D8ZA 5E41A 3C16B 2I2YA 1RWUA 4CNYA 2L08A 2M9KA 3H0PA 3G6YA 1XR5A 4OJ1A 1EB0A 4MIWA 1RHKB 1H3DA 3NNHA 4RNFA 2HRYA 2R7UA 4ZVFA 3F41A 2FGCA 3TP2A 3SSQA 2RKIB 2AX0A 5J2PA 1IM6A 1FRHA 4JV1A 2NPIA 4RW7A 2CJAA 5T14A 5CAAA 3T1AA 1OY8A 2QV6A 2FY1A 5J2PB 3OW2R 3HHLC 4EBDA 4IO9Q 4RW7B 3SV3A 3QFWA 4JP8A 2Z2YB 1OSCA 5HQLA 1R8AA 3ZTOA 2GZOA 2ZE2A 1XR7A 4UW2A 5T41A 1R0CB 2HFUA 3NGUA 4N8OA 1HPZA 2AEFA 4IH5A 3H8YA 3TA0A 3GV7B 2XBPA 4QWCA 1QAIA 1LWFA 1NB7A 3ITHA 1IVZA 1HPZB 1B3TA 1WC6A 1VBYA 1LWFB 3ITHB 1RA6A 3M8QA 1KQFB 1F5AA 1KD1T 4DS5A 3CSKA 2IM1A 4DV0F 1T0TV 4ZLLA 2HKEA 4OHWA 2QLWA 1XBWA 5J2MA 4UF4A 5CYJA 3SCLE 2LFVA 2GX8A 3M8QB 2XLIA 5SZTA 1U1LA 2QA4S 4USTA 5CZVA 3K7RA 3R5JB 3DHWC 5J2MB 4OZLA 2HFNA 3OLBA 2HBQB 3UD5A 1MN9A 1R8PA 1TV6A 4KO0A 5KFWA 4JI7J 2KJWA 2ZKUA 4AXIA 5KT3A 1ZA2B 3OL7A 4JI3J 1LW2A 2VU5A 1T9YA 1U2RA 2W8KA 1TV6B 3IC1A 4KO0B 2VQEF 3I82A 1NKBA 5L8RC 3I32A 1LW2B 3Q8QB 4K0KJ 1YIJS 4WTYA 2JC1A 2MZSA 5D78A 3BGRA 3FCWA 3MMAA 1GMVA 4DR7J 1QAYA 3MHYA 4NXMF 3KLHA 2JZ5A 2OH2A 2BV3A 3QT7A 1RK8A 5IZHA 1LWCA 3MMAB 1F9EB 3N5FA 3GR1A 4B17A 1FT8A 3KLHB 1JKHA 4PPZA 3W8GA 4A8QA 1LWCB 3NKYA 2OSRA 2OPQA 2LU1A 2C42A 3IBCB 2AEJA 3BH6B 4NE9C 3L7PA 1OMSA 4UQGA 2V8DA 2OPQB 2XMUA 2KM8B 2KT3A 3BSAA 2KJVA 3TEHB 4XIUA 1VOMA 2NSBA 2YWWA 2MLYA 1G1XA 4OHZA 4YN3B 2HQGA 1QSSA 4QOTA 3PFEA 4EGLA 2X51A 1VQSA 3TUJC 3EZ5A 2DB1A 2VFTA 1BWVA 4M8LA 2HLUA 2HHXA 4DL7A 4J5OA 3WC0A 3P5BP 3NCRA 1NEEA 3HSGA 5AT1B 1NHVA 1HWLA 4RL1A 3JSYA 2BE2B 1F6TA 2P9GA 2W2MP 3CCMS 4ED4A 1TL1B 2YY3A 3MZIA 3V6HA 1GH8A 1PJ7A 2IMWP 4OZ0A 2NXJA 2J7UA 2R2SA 4M5HA 2YX7A 4X66F 4KJIA 3UFCX 1EKRA 1S5ZA 5J2NB 2CZ4A 2MQNA 3D54A 4PG6A 4DSEA 4QIVA 5L38A 1SUQA 3VTIA 4B08A 3FGVA 4NXNF 1O0PA 3CJ5A 4XO0A 2RUSA 2K06A 1BY9A 1HBUA 2RHQB 2ATCB 1SUQB 3UCUP 4HKQA 1TFWA 2MLZA 5H9EK 2QA1A 5A6WA 4IOCQ 1HBUB 1WC0A 4FNHA 4CZCA 3BPDA 4NLOA 4NA1A 1PO6A 3GFHA 1URRA 4WK3A 1ZBTA 3TEGA 1KN6A 1UFLA 1EETA 1RDRA 3UNYA 4DV3F 3IBWA 2V63A 2HZVA 3GTYX 4USJC 2B3TB 1S0NA 2MY7A 1RSCA 4C97A 3ZZUA 1JLQA 1T9UA 1EETB 2XS7A 2NREA 3Q8PB 1U0SA 3D6MB 3GIKA 2EFGA 1T03A 2HFSA 4J9PA 4GVLA 3BV8A 5LJ5Y 4O44A 1JLQB 2ALZA 3PVXA 2EK1A 2XZDB 1KR4A 1T03B 5A8WA 3SCJE 1S1TA 3TNVA 3W5XA 4ZITA 3CCUS 1EKSA 1EIYB 3VGUA 4ATNA 4NI2B 3RR7A 4YB6A 3H59A 2WOMB 5A8WB 1T8EA 2R8GA 1QLNA 3DCAA 3KUGA 4K4YA 2VPYB 5GAGI 1M1GA 3RU0A 3I55S 3KK2A 4ZCIA 3W9IA 2ASJA 3LH2S 4M63A 4TYAA 3EGZA 1YJ9S 2VG5A 3OR2A 3KK2B 3Q89A 4O23A 5EX3A 2FC9A 3FNNA 3HVTA 3BS9A 4DR4F 2VG5B 3OR2B 3W1YC 2O66A 2MTLA 1QJHA 3NRBA 3KG0A 3HHNB 4X64J 3HVTB 1P9QC 1KTVA 5D0EA 4MT1A 2YWHA 4NRUA 2GV1A 4NA3A 1DRZA 2UVVA 3FBCA 1LKZA 1U8SA 1R43A 4JI2F 2CNNB 1W26A 4QYRA 2UUAJ 2A1BA 3RW6A 2DT9A 3E51A 2X1FA 2Y1RI 4BWJA 1FRLA 2ZOFA 1XNQF 2YNIA 1TP7A 1OS5A 2F8HA 1NO8A 4CLZA 1S4EA 4P7TA 4N8NA 1L3UA 4YFUA 1H0HB 3P96A 4DU8A 2YNIB 1KTQA 4B3RJ 1B7YB 7FD1A 4B3MF 1N5YB 1AUDA 1VIOA 4PXBA 1M5KC 2GAGC 4RUBA 2OO4A 4Q44A 5KAKA 4I56A 2EW9A 2G1HA 5HMXA 3KHRA 2FLOA 2R42A 2B5JA 5IQ6A 1RXOB 2UXDF 4XPCA 1U48A 4DUZJ 2LA6A 2XMTA 2C3PA 5FLXU 2M70A 3AODA 1ROFA 2UU9F 2B5JB 3FQKA 2ZH4A 3BJYA 1D9AA 1N48A 4YHHJ 4U7UD 5HO4A 2C3OA 3GJTB 3MD1A 1VQNS 3TVZA 4UOGA 2ZHAA 2I5JA 1QM9A 4F4YA 4DR3J 2HVHA 2RDIA 3M2RA 4A8FA 1L5UA 1WNEA 1N32F 4Z7YA 2HWIA 1M5HA 2I5JB 3MF5A 3M2RB 4G1PA 4Q2LA 4KH1B 4DOZA 3KMSA 1Q79A 3MM5A 4CO0A 3HFVA 1F3VA 3OL9A 2ZBPA 3H2LA 1HFEL 3MM5B 5GMKa 2P2CB 4B9VA 4PYDA 3AAWB 2CPIA 1RU2A 1YTYA 1PBAA 3AQPA 2VQFF 2K1RA 2E5GA 1KQSR 3OTCA 2PE8A 4FDFA 3L3CA 3SXLA 1IBMJ 4OI4A 1HWKA 2H65B 1RT2B 4YDDB 2K1RB 2YNHA 3TARA 2E5HA 1B0PA 3MFIA 1FFWB 3DRPB 2F9DA 5JMNA 4M5GA 4JV0A 2YNHB 3UD4P 4DR2J 2YVSA 3TVYA 4IDKA 2AGOA 4F3MA 3ELHA 2PGCA 2HNZA 1LFPA 3MGJA 2BJ8A 3DLJA 2F8MA 4JI1J 2FHKA 5IT9U 2XULA 3DU6A 4IDKB 3CD5A 1F0XA 2IVFB 3Q23A 3IMQJ 2FVCA 2WW8A 4NRTA 3M8WA 4GKKJ 4EBCA 1CS4A 3P49B 2KFNA 2AP6A 2XS2A 1DJ0A 3CCJS 4KGXB 3PW5A 4L3KA 1EAYC 1K1QA 2QT7A 1CS4B 3KTQA 3R6GB 4U8YA 1RP5A 4FBUA 4F2SA 1MG7A 3UQSA 4DSJA 9RUBA 1U0HA 3DMJA 4F0MA 3J81U 4P7VA 3QJLA 2DCUB 1AT1B 3VQSA 4Y00A 1HIYA 1U0HB 4Q5VA 2CQ4A 3DMJB 3R7SB 2HHWA 5LMUJ 2YKOA 2JDJA 1W2IA 2WCXA 1YJUA 3IR6B 2F63A 2HVIA 3ZFVA 2ZM6J 4CNZA 4PQAA 1HBNA 2H4YB 7AT1B 4YR0A 4DQRA 4M5DA 4CO3A 4B3TF 4C3KA 4K50A 4AT1B 4X4UA 1HBNB 3OD2A 1WC4A 1ZS6A 2Q43A 2KZZA 4M5DB 3LAKA 1ZAXA 1KNZA 3EGWB 3RAQA 2BE7D 1WHVA 2AJ0A 4UZCA 4Y28C 4YOEA 1LFWA 1NXIA 3IG1A 1NSAA 3DGVA 4EO6A 4DR6J 3PNIA 4DCJB 3HKZD 1FXLA 4U95A 3NP5A 2I1RA 1K9MT 2DR9A 2RD5C 3IG1B 4P9SA 3OTOF 3W3SA 2WSEC 1V3RA 1PC4A 4EUVA 4G1QB 2FLNA 3I4PA 3C66A 2V2ZA 4EBEA 3LWLA 2FYXA 1RWPB 1Q78A 3U7JA 2GO9A 4B3SJ 1YGYA 3NEKA 4RBVA 1F9HA 3ZTPA 4ZPVR 4ILRA 3EE3A 1FDNA 1GNKA 2HWHA 1XIQA 4RWXA 4KTQA 3LP2A 2XSJA 1REGX 3I5AA 1RAGB 3QWPA 1KOHA 5KFSA 3MMBA 4OI3A 3LP2B 2XSJB 4ZP8A 5EUHA 1FD2A 2FUG9 1X9SA 4FPRA 4F4AA 3AB2B 3MMBB 2JVRA 2AT1B 2DK2A 1VQ5S 4P2MA 4JV5J 1BC6A 3OFFA 4ZDNA 2HZAA 2A2DA 2P5VA 5B0EA 4JI4F 4RLEA 1CEZA 4I4BA 2NSCA 3J7AN 2ZDOA 2A2CA 4X62F 2OTLS 1AZSA 3JTOA 5KG6A 3D6HB 1CJUA 3KDNA 1V3SA 1U7LA 2ADCA 5D3GA 1AZSB 1MWQA 2F7VA 3J7ZT 1CJUB 3UWTA 1UVJA 3OT9A 1NJXA 3O5TB 4IOBA 5D3GB 3NMAA 1Q81T 4PAAA 6FD1A 2PSZA 1BD6A 4F67A 5L46A 3MM6A 4DQPA 2Y0BB 1D0EA 4NYOA 5GAHI 2VFUA 1RAJA 1S6PA 5J1NA 3RGIA 4DSFA 4KPCA 1N36J 2BANB 2K2PA 5IV4A 3H42A 3MM6B 3RR8A 1FRMA 3HVRA 2HHPA 3CIMA 1QD1A 1S6PB 4ZPWR 3VV2B 4JOUA 2XMVA 3ISND 1OO0B 1R0BG 4OX9J 2YKMA 2DXFA 3R7NB 2H51B 2K3KA 5KG5A 3ENVA 4AQYF 3GFZA 3GE9A 3RB3A 2YKMB 4FS1A 4ZVGA 4MTPA 2H5JB 3D9BA 3HSZA 1IUJA 1FO1A 1WOSA 4ANCA 5K8MA 4A8MP 5DDPC 4DX5A 1OQ3A 3MWBA 1R6YA 1HNXF 5B0AA 2XGPA 4PWWA 3P8BB 2ZJPQ 1VDHA 4H4KC 5E5NA 3S6EA 3WX4A 2LP4A 4DSKA 3HT3A 3RZAA 1AFJA 5K5MA 3DYAA 2HHSA 1CQNA 2G13A 2KYZA 1DARA 4ZJQA 3AJ2A 1VQ6S 3CJ3A 4O4GA 2NYIA 4NLUA 1WKLA 2W9CA 2W25A 3OFHA 1SKRA 1NH7A 2V8PA 2HW3A 5F0UA 3DI6A 4O4GB 3N79A 1HNVA 4WFAQ 1VK8A 2W9CB 1S9GB 3DI6B 4M5MA 5IWAJ 1T95A 1HNVB 4RR5A 1YWXA 2BVZA 3T41A 5GAGU 2O1PA 2VG6A 1WTFA 4P6QA 3C6TA 4DZ6A 3H5YA 2HBRB 2IVMA 2AWZA 5HL7Q 4ZVHA 2YX1A 2CQBA 2VG6B 4K4TA 1RLCL 2LQ9A 4C3MA 1NKCA 1Q5VA 3C6TB 2F4VJ 2RAQA 2XMWA 1JLCA 3T5KA 1YG0A 3EDQB 2GVZA 2YWEA 1NB2A 4Q8FA 2IYGA 4N7TA 3Q24A 2LEPA 2Y1IA 3CC7S 3DOMA 4M1KA 1V6HA 3UN5A 1HBMA 2PO4A 3E8OA 2GVZB 1NK5A 4GO7X 2GIQA 1U6ZA 3EVOA 4MKBA 3DOMB 2IM2A 4CH0S 1HBMB 4DPUA 4CM0A 2AYGA 5G0RA 4C0OC 3RB0A 2E44A 4QQBA 4L73A 3W64A 4L3NA 2JSXA 3TOQA 2I9SA 2HGMA 1CQMA 1RABB 5G0RB 2OEJA 2UV8A 4A8WA 4EO8A 1IXKA 3U1NA 1CLFA 3EXCX 3DXBA 3RW7A 1S0VA 3OTDA 4X65J 1C0UA 4E0DA 3NBPA 2DHXA 4MH8A 2R2UA 1X5PA 3E2EA 1FFSB 1C0UB 3GFXA 4K2XA 3TUIC 3QRQA 3NBPB 2MYFA 4OZ2A 3W5YA 1A7GE 4U8VA 3T5JA 2LA4A 5C42A 1R89A 3N4WA 4IQMA 3EZOA 3LANA 1VQLS 2MLXA 4JI5J 1VFJA 5HK4A 4DMZA 1V5VA 4TYBA 4F4WA 1FWLA 1V3ZA 1KSPA 3D67A 4NWBA 5CABA 1PJ6A 2DNZA 3FEZA 5T7LA 5AXLA 2UUCF 2OI2A 5M2UA 1HW8A 2IDLA 2ASDA 1HQEA 2QLFB 5KFZA 3BQ2A 4A8YA 1WOPA 4FYVB 1Q82T 2W2NP 3F73A 5I4MA 2YWFA 3HDSA 3PX6A 3FUYA 2YKQA 1HQEB 3MR3A 4F36A 2M88A 4Q7AA 1Y0HA 2HIYA 3H4BA 4OV1A 4B3OA 3GZ7A 2KM8C 1MLAA 5CYQA 4DL5A 3T6JA 5B0BA 4B3OB 1KFSA 1UW4A 3V2UC 1QTMA 3NGTA 4C3LA 1KDNA 5CYQB 1IQZA 5FIIA 4MJKA 2E9TA 3QMQA 5LXRA 1WEXA 3A3NB 3JYTA 5DZ6A 4LF1A 1X4HA 3BPSP 3BDPA 5IQQA 3DGPA 1RHJB 2NLWA 2WVEA 3GJQB 1WI6A 2ZUGA 3JYTB 3D6FB 1IR1A 1KQKA 3DGPB 1WC3A 3PW2A 2OFGX 2CG4A 4OQJA 3HXMA 4EWTA 4F0KA 3GYNA 2DH9A 2MJUA 4UY8T 2JLGA 1VJQA 2MQQA 2DCLA 2Z8QA 3H2VE 1SJQA 2B7BB 1RAEB 2E66A 1S9FA 2LDIA 4O3NA 1FESA 1UZDA 2DXEA 4Q45A 2EI5A 3FZBA 1S10A 2J7WA 5AXNA 1JJCB 2B6AA 3OV7A 3NS6A 3I6PA 4DV0J 2RMLA 2PEHA 4F04B 4LREA 3GQCA 1AROP 2B6AB 2ZWPA 1K0VA 2KL8A 2IIHA 4FYXB 3AA8A 1HR0F 3LW5C 3MCSA 1XNRF 3PKMA 2FPHX 4X4NA 4LF6F 3A3OB 4OI2A 3OLAA 2UVUA 2DGWA 1HWJA 4OYZA 5KFFA 2E1CA 4WP9A 2V6AA 2HK3A 3SSRA 5DLFA 2OD6A 3IA0A 2N82B 1VMBA 1SJ3P 2E5LF 3DRYA 4WIIA 2HQCA 2ZH8A 1N52B 1NDCA 4MK9A 1B64A 2C2DA 1UVLA 3DN9A 4NXMJ 1DQ9A 3PYFA 2RU9A 2MZTA 3HVWA 3M7VA 4QWEA 5KT2A 2FZKB 1RYSA 2LECA 1J5OA 1JQGA 2NXEA 2KI2A 3QRRA 3VHQA 1EX8A 1RISA 3N01A 2W7AA 2Y1LB 1J5OB 2YNGA 3VZIA 2XO7A 1CG2A 3G8SA 3MOZA 1S12A 2CVEA 4U96A 1PAEX 5U47A 1WDTA 3CD6S 4KB7A 3MXHP 2YNGB 4I1TA 2XEXA 3BZQA 1H73A 2ASYA 4ECRA 3LAMA 3GV5B 5F41A 4BWMA 2Y8YA 3W61A 4ECZA 3I4HX 2QL7B 2V50A 3DC2A 3Q86A 1V9OA 1SH0A 3G6XA 4Z7CA 1IN0A 3QSIA 1O5JA 1X9WA 1GXUA 4MKAA 3SMZA 5DDOC 4QWDA 1BHNA 5DG9A 3MCNA 2RRAA 5A2QY 5MAOA 2FZCB 1VQYA 1FX2A 4DV4F 4KH0B 2XQCA 2CPXA 3QWUA 5H9FJ 5LXYA 3RBDA 5D0RA 2ZOMA 2DNGA 4X66J 2EFQA 1NK0A 4NEYA 4C8KA 3TJ8A 5ETLA 5I3QA 3UDLA 2J8AA 1FNOA 2M7SA 1LWXA 5D8HB 2BJ9A 5GAHU 4ZLNA 1Y00A 3UDEA 2MSTA 1TKZA 1OPZA 2CKWA 2JC0A 4DV7F 3PO5A 1S0OA 3BREA 1BXNA 2EG2A 2JFKA 2PIIA 1DQAA 4YQWA 2ZDPA 1TKZB 2CPDA 2CPEA 4PG8A 4A47A 2CPFA 4NZ6A 4R5PA 3EPGA 2CNOB 2QFJA 1W25A 3TX8A 3LP0A 4ANEA 1P6TA 3M6UA 3TQ1A 4DWIA 4HI2A 3BBFA 1PJ5A 5M2RA 2GHVC 1SC3B 5L9NA 4I2PA 2H48B 4AFFA 1FKAF 1U24A 1IBKF 4ECUA 4I2PB 3RYLA 1UMJA 3THPA 3EGVA 2W2PP 3G6ES 1K73T 3O8WA 1HNIA 3JXOA 2J6SA 4WFXA 3QO9A 3ZNJ1 3EPIA 1HNIB 2J6UA 2H5EA 2GFFA 5E3RA 2I38A 1EZZB 3QO9B 4DLEA 4WXOA 1U49A 2X1GA 4C8NA 4IG3A 1FDAA 1L3SA 2DISA 5JVGQ 3UVJB 2HVEA 3NWRA 3KUEA 3PFOA 3SCIE 1G6BA 2XZTB 4K4XA 2BABA 4IG3B 3KNAA 3ZO7A 3N0VA 1DFDA 1SV5A 1XQIA 3D4JA 1YRUA 1GAOA 4IYQA 2R7XA 2MKJA 1JLBA 3BGFA 1N34J 2F9JA 1SV5B 2Y0SD 2XWXA 3BGOP 1N0VC 1JLBB 2LQ8A 1R27B 3FBFA 4JI2J 1S0MA 3AFGA 2KRRA 5IM0A 1YLXA 2DNQA 4FXVA 1CJKA 4FNIA 1RAHB 2VODA 3KHGA 2CQ2A 1UP1A 3IR7B 3DLLQ 2IPOB 5IM0B 2AJ1A 4TLRA 4IR9A 1IWAA 2DNPA 2HWTA 3EX7B 2ZH2A 1RA7A 2HHQA 4AYBD 1P1TA 1S7HA 3ADAC 3PHEA 1QTNB 4B3MJ 2OGUA 2WBMA 3FRZA 1SQEA 1NDLA 3GCXP 3AT1B 2KTQA 5HMWA 3G9CA 4PCQA 3VAJA 4FZVA 2HPUA 2DR5A 2ZD1B 2UXDJ 3CD7A 3KHHA 4Q43A 2FDNA 3CD0A 2CG8A 2NUHA 1U25A 4DBQA 1RYRA 2UU9J 3H40A 1IM4A 4NEZA 2NS1B 2KG1A 2BQUA 4ANDA 4DUYF 2J8SA 1X5OA 1VRQC 3OL6A 3Q8VA 1FE0A 2YX4A 4BC9A 4FF2A 3ZC4A 1S1XA 1FCAA 1APSA 3NWGA 1N32J 2BKOA 3BO4A 3PG9A 3G2XA 3LGNA 1AW0A 2NXNA 3N6NA 1S1XB 4PG5A 5JUMA 4CYUA 3W2WA 2JL9A 2BRLA 1JLEA 4OFZA 1Y9OA 5DM6Q 4LF4F 4NCBA 1NJIT 1NJZA 4CYUB 4OJHA 3W2WB 2RUGA 2RQCA 2O5DA 5EDWA 1JLEB 2ZC4A 4I69A 4RUCA 2YWGA 3DFEA 3TO8A 1NSKL 2VQFJ 5D0HA 4ED0A 5DQHA 4HHJA 1Q86T 1KVIA 4F50A 1G7CB 2VDIA 3T5HA 3RBZA 3B4DA 2CQ3A 3VAIA 4CLLA 4JI6F 2J9DE 1UJ4A 1KEKA 3O6QA 2V2QA 4C11A 3X3UA 5KFYA 4B9LA 1REVB 4F4ZA 2GGPA 2RS2A 4K7QA 4NCAA 4F7VA 1R8BA 1SIZA 4C11B 4LF5J 4UUXA 2GGPB 1HHTP 2XNQA 4AUKA 2CJXB 1JK9B 2DR7A 4XDCA 2VOOA 2LEAA 2R8IA 1JXVA 1K44A 3BGUA 4B9NA 3SV4A 3CJSA 5L1LA 2GNKA 3TZXA 1JWWA 2YNFA 5L9XA 1BE4A 4OYMA 4O3OA 1RI7A 3K0JA 2ZZMA 1MNEA 1BGXT 4OYPA 5A76A 2YNFB 4CI0B 2H9ZA 3KKFA 1KFDA 4JB8B 3FJ2A 3A12A 2G2YA 3BN4A 4J9VA 3JS9A 1K1SA 2B56A 2QFIA 2XI2A 1WUUA 1D09B 1FRKA 1LXJA 5EWGA 2P9CA 2F3JA 1KKHA 4Q2MA 4YY3J 3MEGA 2ERRA 3IR5B 5B0CA 3HD1A 3CIZA 3WQPA 5AXKA 1QE1A 2HRUA 2LQJA 3P45B 5F3ZA 4IRCA 3D2WA 1YKWA 3MEGB 1H2TZ 1DLOA 3M6XA 1HI8A 3MTKA 3OHBA 4B3TJ 1ELOA 1QE1B 1RJJA 4DS4A 2ZH7A 1HI0P 4AL5A 1DLOB 5RUBA 4K5RA 1HQUA 2KU7A 1VISA 4DQQA 3VAGA 1N56A 3UCGA 4J90A 3ISNC 2B8QA 4LQ9A 4OYIA 4U9RA 4HVZA 2JLFA 1RUSA 2QMUB 4ECVA 3PEJA 1OJ4A 4DR5F 1TL5A 1VQOS 4J9MA 3OTOJ 4OZ1A 3M32A 4YB5A 2AJQA 3M2UA 1NZ8A 3K5LA 1FK9A 2BXJA 3M32B 4DEZA 4O0IA 3MAAB 1B4SA 3M2UB 4TQRA 1H6KX 1FK9B 1FWKA 4M94A 5F8JA 4X84A 3UO0A 3H90A 1F1BB 3L7OA 1C4AA 1N5QA 3KDOA 1NKEA 3G96A 3SYZA 3CXCR 5KFNA 4F4KA 1XN9A 2FZGB 4NASA 3R27A 3O44A 5C24A 2C2ZB 5JVHQ 3PX0A 4ZN3A 4YB7A 3L9ZA 1IBLJ 4EZ9A 1FTRA 5C24B 2HS0A 5LMNF 4X62J 3PW0A 4IOAQ 5DM7Q 2KFZA 1UEKA 5D4PA 3VVTA 2DIVA 4R8UA 2WAQD 4OJGA 4NYPA 3A8KA 4CLPA 4MIAA 1Q8BA 2B7CB 1A9NB 4ZMMA 3TZWA 2CXEA 4QPXA 3LPEA 1WDDA 4R8UB 3M8YA 3S7RA 2GQQA 1WG1A 3IO1A 3OJSA 1NBEB 3MM9A 2LXIA 2RQ4A 3IGVA 2GO8A 3CDBA 3SCKE 1HLWA 2ZJRQ 4NLWA 1VC5A 2HHHF 2RNEA 3MM9B 2G2OA 5GMEA 4K4UA 2UUTA 4TNOA 2J6TA 4DN9A 3GP9A 4WFNQ 4NLXA 4OL8A 2RQKA 4MKYA 1NRKA 4MFBA 1BQNA 4OX7A 2R7VA 2B8PA 1YDLA 1DTQA 4D3GA 4MFBB 4AQYJ 1BQNB 4DPYA 1ZM3A 1VCTA 2KXHA 2ZH3A 1FDBA 2V68A 4KRWA 1DTQB 5HBMB 5F8LA 4I7FB 5C25A 1MN7A 4IKAA 1N6QA 4UOFA 3WZ0A 2MSSA 1PILA 4ZOSA 1S97A 2V4QA 5C25B 1WWHA 4AL7A 3TA1A 1N6QB 2AV5A 3DLGB 3KFWX 5MLCV 1KHVA 2OELA 3FSYA 1NSQA 5B0DA 4HT7A 1YSJA 3BYRA 1UPMB 4U67Q 4I6WA 1NSPA 1KVKA 3X1LB 2BRKA 2DNOA 2FIUA 2Y1JA 4QIWD 2KRBA 2QRRA 2HBYB 4OMFG 4J9KA 4PRFA 2OPSA 4C48A 4KFBA 2ACYA 2AF6A 2XMKA 1MW7A 1WOOA 1U2FA 4USWA 3CDUA 2OPSB 3H98A 3OSNA 4KFBB 1IJFB 3HULA 4FF4A 4X4PA 2CDRB 3HKWA 3CEDA 3CJRA 4F3QA 3TR5A 1DZ5A 3CCSS 3PYDA 3FMWA 1U26A 4ILMA 3N6MA 2A3JA 4ER8A 3QIPA 4GVBA 4QR2A 3M6WA 2DNMA 2J0QD 4MKVA 4JUZA 2IC3B 3QIPB 1GT8A 3HFKA 4GVBB 2IBOA 2O3DA 1VS3A 1WF2A 2F40A 2OD4A 4NLVA 4K0KF 1DTTA 4DDFA 4ZJOA 1Q0NA 1UFWA 4TQSA 3FRYA 3RRKA 3MUVP 1DTTB 1T9WA 3QPIA 2DGXA 2OFHX 4FVCA 1LV5A 3UI3A 3K5NA 2V8GA 1SJ4P 3HPOA 2DXDA 3BB5A 2LEBA 2DTJA 2HQDA 3CMES 2Q6BA 1O8BA 2OEKA 4IH6A 3EUNA 5C2GA 1OWXA 4F0HA 3FSXA 4IRKA 2PEBA 5KT5A 4U7UK 3FBEA 3MMCA 4UOHA 2ROEA 4CCHA 1FJGJ 2VB6A 2HZCA 3HHLD 2VG7A 3HD2A 1JJHA 5KG7A 2ZHBA 2ACMA 3IN5A 3MMCB 1HA1A 2VG7B 3I56S 1TL7B 3CJKA 8RUCA 2QLBB 4DXLA 3GWCA 3HHLA 4H4OA 1ACMB 3CJKB 2UUCJ 1RCOB 3SFUA 3ZZPA 4USVA 1L3VA 1EP4A 2CWKA 5F9LA 4PWDA 1VK3A 4YB1P 5B0FA 1NHUA 4QJVA 3KLGA 3BO3A 3HHLB 4H4OB 3CJ2A 5CD4A 2OTJS 2CQPA 3BSCA 1EP4B 2Z2ZA 4PWDB 3EDRB 4CLTA 2RH3A 1FJEB 3KLGB 3MD3A 4WFYA 4ES1A 2QJ3A 1Y5NB 3NL0A 1UVIA 1UZHA 4O3QA 4E8UA 1UCNA 4YMEA 2FLLA 3FC9A 5HVHA 4OLOA 4K59A 2GIFA 3RB6A 2HAIA 3OFEA 2EBGA 3IM8A 1NPPA 2YQ3A 3THVA 2VD3A 3T1YF 3T1HF 1T94A 2RSQA 5DGBA 3TANA 2L9NA 5GADI 3ILIA 1M5SA 2WB4A 3IGNA 2ZE2B 2AGQA 1C4CA 3AJDA 1FF2A 3QZ7A 4P10A 4C98A 5KFTA 1VQ9S 2BJ7A 3LUYA 1UAWA 1VLOA 3WDOA 4RJVA 1UWAA 2B0GA 1DAXA 2XM3A 3DDKA 1I6JA 2E9RX 1RKJA 4PXEA 4LRBA 3TUPA 3JSRA 4MK7A 2CQCA 2YKNA 5HANA 4RPFA 4RW6A 2DY1A 6AT1B 1U6BA 1Q7LB 1DQ8A 3CT9A 3A8EA 2YBVA 3PW7A 4LBIA 5K14A 3JQMA 2MKIA 2E5JA 4RW6B 3PYGA 3CULA 2B9XA 2JEIA 1GX6A 1HR0J 2HQFA 1FRJA 5K14B 2E7WA 4LF6J 3PDNA 3TI0A 2D1CA 5HROA 1BUXA 3GU0A 2FVQA 1TQLA 1M5PC 4R25A 3T19A 3C14A 4NLYA 3IP0A 3D7SB 3L4BC 4A8KA 5IC4B 1FJCA 2LU2A 5HROB 2DD8S 5LSLA 4P73A 2M4MA 3C14B 2E5LJ 1RWVB 1N5TA 1VGYA 2GCFA 3BGRB 4X64F 4TKTA 4ZVOB 1AB8A 3O2IA 5BYRA 5ETOA 2HQ3A 5ETTA 3G87A 2A18A 4H54A 2UUAF 4DLGA 1WSVA 3WIUA 1M90T 3D1OA 3QGPA 1JKHB 3H5SA 2PI5A 2VASA 3K8WA 4LF7J 3PIOQ 2XYPB 4DPWA 3WIVA 5KFGA 3QZ8A 2BOPA 5A6PA 4B3RF 4OHYA 1OY6A 1P27B 3BSOA 4NLSA 4TY8A 3DRRA 2OPPA 2EPIA 2CAJA 1IR0A 4KKOA 1JLAA 3TAPA 3EWGA 3UPFA 1VQ7S 2G4BA 1RWMB 3KK3A 4TY8B 2XS5A 4RBTA 3QJJA 3DRRB 2X1AA 4DU7A 3KJQB 1KWMA 3BQ0A 2NUUG 4DUZF 2JEJA 2OPPB 4OHVA 4KKOB 1FE4A 2IM0A 4RBUA 1JLAB 1VBKA 1S7IA 3C8YA 4DL0C 3CJ0A 5DDRC 2IAJA 3KK3B 1RT3A 3B8HA 2IRXA 2VJVA 1URNA 4HTIA 3GFYA 1NK4A 2IAJB 3ZNUA 3PR5B 3I9V9 1RT3B 2CPHA 1FI4A 4ID5A 4EYHB 4OYBA 5EWEA 1WEZA 4UUWA 2BQ3A 1XTZA 1WHWA 4ID5B 2HBZB 2HQIA 3A8IA 4DV1F 4LR9A 5CYMA 2BZ2A 3ZZOA 2KVQE 4OJ3A 1HD0A 1NK6A 2HYIB 2WSCC 3KG1A 3UR0A 5KFQA 1A0OB 4ZPBA 2WVCA 4NLQA 5CYMB 1GX5A 3ZZRA 4LFBF 2CJ9A 2UXBJ 2U1AA 2YH0A 2UVWA 4RNNA 3CCES 4O0NA 1UPPA 2ROPA 1N0UA 4S0MA 3PR4A 1UTAA 1H72C 3VR1A 5D4NA 1UA1A 3M30A 1IBMF 3G8QA 3M6VA 4Y2KA 2MHNA 2BJ1A 4QPTA 2M5YA 3EXYA 1ZM4A 1R3NA 1RWWB 5KFOA 2BR0A 3M30B 4ILLA 3IWNC 2CJQA 2DGQA 1RWNB 3PRVA 5I3UA 4DR2F 1IR2A 3RRGA 4TVAB 1N5SA 1RT1A 4ECQA 2UUBF 2GMLA 5KT6A 1RTHA 2O01C 4KGVB 5KG0A 4URQU 1UW9A 4O44B 1FHTA 3MR2A 3K17A 1RTHB 1HWIA 1T11A 1ZPWX 1LQ9A 3AOCA 2GQ2A 1IBKJ 2HLTA 1H7XA 1SKSA 1KLNA 1S1TB 1RT4A 2VONA 4LF9F 4OI6A 3HI9A 1CJVA 4G3IA 2B4VA 5EWFA 2JEFA 1Y5LB 2AHOB 3MDFA 2VFRA 1RT4B 3BKTA 4W4MA 2DNRA 1DHMA 1ZZNA 1CJVB 4J9QA 4KHMA 3LGHA 3W2VA 2SXLA 3AH6A 1FEEA 3T9NA 1KC8T 2HEKA 2AZ1A 3W2VB 2Z57B 4ED8A 5LMUF 1QAXA 4J37A 4LJMA 1Y11A 2BOAA 3VQTA 3UD3P 2CPJA 3TX0A 4PPDA 3UR3C 2HRTA 1VQ4S 3GIIA 1YJ7A 1U1NA 5DJBA 4X4VA 1MMNA 1SL1A 3FCVA 1ZETA 2G0CA 3MECA 2P6SA 1D8YA 3G82A 2CFXA 2D69A 2CWXA 3H5UA 2Q1LA 2UZAA 3DXSX 3HVAA 2HFZA 3MECB 5ETVA 2VIHA 1PG5B 5DS7A 3I5CA 3G82B 2AJ2A 1RTDA 2MQMA 4H4MA 3US5A 1NJYA 1OPIA 1WF1A 3FEYB 3H25A 1OSDA 3LA0A 1UA0A 4KGZB 4BC7A 4DN0A 3NGRA 3M8RA 4H4MB 2Z2MA 1U8WA 1KP6A 1RBOB 2FGOA 2XTJP 2XHCA 1GEHA 2POKA 3IXQA 2X1BA 3BR9A 2NR0A 2OSQA 1KOOA 1TKTA 2HNDA 1RTIA 1N88A 4DUYJ 3ZTQA 3MPWA 4YUDA 2MKHA 1U1PA 2R4FA 5LOQA 1TKTB 2HNDB 3D0IE 1RWXB 1UVNA 4N47A 2XMAA 4DUTA 1U2CA 2BEFA 3CW2C 4IUFA 3FZ2A 2AD9A 1JMTA 4JV5F 1Q53A 3IBFB 3PIPQ 4FN5A 3N28A 2FVRA 4UTGA 4LF4J 1B99A 5KFJA 4NZ7A 3KYLA 2ZJQQ 2VBXA 2A6OA 4DX8H 4OYWA 1SC4B 1H38A 1AA1B 1BMQB 4CT9A 2OIHA 4FS2A 3KJNB 3JQKA 4MYUA 3FQLA 3OTEA 5CH7B 4GKJF 4ZCMA 4FYYB 5CD4H 3AOAA 3NGSA 5HVFA 4L76A 3GSIA 1H74A 3CJ8A 1YJNS 3DHXA 2LYVA 1RKIA 3TW0A 4KHRA 4ELVA 9ATCB 1I3OB 3DOKA 2GHWA 3BKUA 3PX4A 4R0EA 3R5GA 2OP5A 1VHIA 4UZBA 3ISZA 3OJUA 5KFKA 2HNZB 3KG4A 3TRGA 3GJSB 3DOKB 3TAQA 4K8RA 1XMOF 4EYIB 1WC5A 1RHRB 3G4SS 3DKDA 2G9OA 1ZAWA 1F2GA 3TYTA 3AOBA 4OX9F 3M1VA 5H1SV 1Y5IB 4I64A 2NXCA 4CO5A 2IJFA 2PMZD 2JOQA 3M1VB 3CB4A 4P71A 1G4CA 1I1GA 2HG4A 2ZNYA 5GADU 2VZ9A 1TVRA 2DH8A 3G86A 2CPZA 2BQRA 1RBAA 2IJNA 1T3NA 1YJRA 3HFZB 1H2VZ 5HQMA 1TVRB 4USHA 4ZIVA 3HHDA 2W9AA 1SJFA 5HP1A 2W24A 4JYAF 1ZYQA 1AXQA 3MUTP 5KG3A 2CJYB 4ZVEA 5HP1B 1VQKS 3OUYA 1AUSL 1ZH5A 3LQVA 4KQZA 1PKUA 3CCTA 3OUYB 1RHMB 1X4AA 5KFDA 5C7PA 3QAUA 3CPWR 3D66A 3SEOA 1X4CA 2FLPA 2K8GA 1O6XA 2VICA 1Q8IA 1SL2A 3OXFA 1PYOB 3UNGC 1SH2A 4ID8A 2APOA 2HK2A 2MQPA 4WXWA 4YS2A 3NNAA 3CWJA 8AT1B 2P9EA 5CXTA 1SKWA 4K5SA 3GYGA 3QJPA 1TUGB 4DR5J 4WWSA 2AJ4A 5DO2A 2DNLA 1T9XA 2R7OA 3JAMY 2XY6A 3N5BA 2FJAB 3HX9A 2VJUA 2YPZA 1K0TA 3DLEA 4ZP9A 2QGFB 4P2SA 5D0GA 2B4PA 4FBTA 4WYLA 3AB4B 2OJ3A 2BKNA 2HAFA 1FVQA 3DLEB 5BYQA 3W9JA 3JSBA 2DHGA 4USIA 5KFIA 4LF8F 1N33F 2AW0A 2L9DA 1SCJB 4DX7A 1HKAA 4ZVUB 4EZ6A 3PYEA 2HVZA 2RRNA 2FJVA 4HEA9 5B0GA 2R8JA 1G2EA 1S48A 3UE2A 5GVQA 1HNZF 4DSLA 2P8IA 5E3AA 1PSDA 2E1PA 5A0YA 2ASLA 3OFGA 2D3ZA 1NK7A 2QMWA 2VBYA 2QSWA 3P3DA 5B7WA 2RIJA 2YH1A 3ZZTA 5A0YB 3D0HE 2QZ8A 3A4TA 1T05A 5KFXA 3FDSA 4KSEB 1TMMA 2MMYA 2IJRA 2UXCJ 3Q0AA 4OYOA 5ITHA 3L95X 1SB6A 3HP6A 4OZJA 5E2QA 2P6TA 4ED1A 2EC0A 1FD8A 2Z2LA 5GAEI 1JLFA 2EVZA 2BA9A 4CLKA 3JSMA 2IMOA 3GYXB 2CQGA 4HTJA 3D68A 3DLKA 1JLFB 5EN1A 2C28A 1VRUA 5F9NA 2H54B 1WORA 3JSMB 2V5HG 3HSJA 2DHAA 2KT2A 3BSNA 4G65A 3GMGA 3W62A 1VLYA 3DLKB 4ENOA 4O3RA 4TLQA 1VRUB 1KBRA 2NPFA 1P1LA 1F60B 1JXEA 2CPYA 3SQOP 2MKKA 1XMQJ 3PKYA 1T7PA 2GIRA 2VA3A 2HGNA 3C16A 4DPXA 1Q16B 2D3UA 2DY9A 3F0NA 1H2UX 4M5NA 3TJAA 2B4UA 3I5BA 1U45A 1RU1A 2C3MA 1PYSB 1M1KT 4IR1A 4I2QA 5A2QU 2DR8A 3AXMA 4P52A 2G0IA 2JWNA 5M2PA 4RWWA 1NLKL 5JJBA 3IS9A 2U2FA 2RKIA 3M4XA 4I2QB 2B51A 5IV3A 3GV8B 4LFAF 4QZVB 2WW4A 1VJWA 1NMEB 3IS9B 4QIGA 5DETA 1T02A 5H9FK 3D1HA 1BQMA 3R7BB 1WEYA 3DYAB 3E01A 1YRTA 4WP3A 3D0GE 1JX4A 4F26A 2NZCA 2LLZA 4QIEA 1BQMB 4BHQA 2UUWA 2W7PA 1RLDA 3E01B 4EI2A 5FD1A 3W60A 1QSYA 5CCLA 2DO4A 4QW8A 2XCPA 3KK1A 1WSRA 5E3QA 2HURA 2BBEA 3NGDA 3QFHA 1CBKA 5KFPA 3KK1B 4NLGA 2IBKA 2BYCA 2I0XA 2UP1A 1QY7A 2VUGA 5KG1A 2EBEA 4IH7A 3RBEA 3P6YC 1TELA 3U27A 1O51A 3GCWP 3OQ2A 4PR6A 3M8SA 1X60A 2PA3A 2QSFA 4HACA 3CUNA 2L9WA 3KJFB 3I31A 1JLCB 3H4DA 3V5RA 4FXDA 3TUZC 3QT5A 1DY3A 4WTOB 4QWBA 3A3PB 4O3PA 4LFCJ 4HACB 1TL3A 1CC7A 2VPWB 2XLKA 4DI6A 3QSYB 4L6V3 2KXFA 2JFDA 3U1LA 1TL3B 2ZHOA 3LALA 1ZA1B 3KNGA 2V9WA 4Y65A 4URSA 3W65A 2BDPA 2ALYB 2HGLA 2FY8A 2ATLA 4C7QA 2ZZTA 1D9DA 3BH7B 4PUOA 2E1MC 2OUGA 4PZVA 2D9PA 2A10A 7FDRA 1A6LA 1FDDA 2J9DA 2EKYA 2XB2D 3GJRB 3K5PA 3Q8YA 4PUOB 5BXIA 3ULHA 4CIOA 1Y4ZB 1FXRA 1SJ1A 1F5CA 2D3OR 4LVOP 5HN0A 1X4GA 4LR7A 3GIJA 4CP5A 5FDLA 4FPIA 3BGLA 4DV2F 2GJ2A 4KE5A 4WF9Q 2A0FB 3FBBA 3VWSA 4USMA 1WJ9A 3HJFA 3AQOA 5FDLB 2FQQB 1YI2S 5D4OA 2OMLA 3AD9C 4MK8A 5KFUA 5C42B 5F0WA 3RRHA
chains in the Genus database with same CATH topology
1I3OB 1I51B 2C1EB 2H54B 3EDQB 1PAUB 4ZVOB 3QNWB 1RWOB 2XYHB 3EDRB 4ZVUB 2H5IB 1RWKB 1RWXB 2QLJB 1RHMB 1QTNB 2QL5B 2C2KB 3GJTB 3GJSB 2CDRB 1RHJB 3RJMB 3GJQB 4ZVQB 2Y0BB 1RHRB 4ZVSB 2HBZB 3D6MB 4DCPB 4ZVPB 2H4YB 3D6FB 4JB8B 1F9EB 1SC1B 2QL7B 1PYOB 2C2MB 4LSZB 2CNNB 2XYPB 3IBFB 2XZDB 2H4WB 3SIPB 1RHKB 5IC6B 2QLFB 2C2OB 2QL9B 1RE1B 2DKOB 2CNKB 2XZTB 3GJRB 3IBCB 3R5JB 2CNOB 3R7NB 2H51B 1IBCB 4ZVRB 5K20B 1SC4B 3R6GB 3R6LB 1BMQB 1RHUB 2HBQB 3KJNB 4ZVTB 2QLBB 2XYGB 1QDUB 3P45B 4DCJB 1SC3B 2H5JB 2P2CB 1RWMB 3D6HB 1RHQB 5IC4B 2H48B 3KJQB 2HBRB 2CJXB 1NMEB 1RWWB 3NS7B 3P4UB 2CNLB 2FQQB 1GFWB 1ICEB 3KJFB 2HBYB 1RWNB 2Y1LB 2CJYB 1RWVB 2H65B 3R7BB 3R7SB 2C2ZB 1RWPB 4DCOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3O B;  1I51 B;  2C1E B;  2H54 B;  3EDQ B;  1PAU B;  4ZVO B;  3QNW B;  1RWO B;  2XYH B;  3EDR B;  4ZVU B;  2H5I B;  1RWK B;  1RWX B;  2QLJ B;  1RHM B;  1QTN B;  2QL5 B;  2C2K B;  3GJT B;  3GJS B;  2CDR B;  1RHJ B;  3RJM B;  3GJQ B;  4ZVQ B;  2Y0B B;  1RHR B;  4ZVS B;  2HBZ B;  3D6M B;  4DCP B;  4ZVP B;  2H4Y B;  3D6F B;  4JB8 B;  1F9E B;  1SC1 B;  2QL7 B;  1PYO B;  2C2M B;  4LSZ B;  2CNN B;  2XYP B;  3IBF B;  2XZD B;  2H4W B;  3SIP B;  1RHK B;  5IC6 B;  2QLF B;  2C2O B;  2QL9 B;  1RE1 B;  2DKO B;  2CNK B;  2XZT B;  3GJR B;  3IBC B;  3R5J B;  2CNO B;  3R7N B;  2H51 B;  1IBC B;  4ZVR B;  5K20 B;  1SC4 B;  3R6G B;  3R6L B;  1BMQ B;  1RHU B;  2HBQ B;  3KJN B;  4ZVT B;  2QLB B;  2XYG B;  1QDU B;  3P45 B;  4DCJ B;  1SC3 B;  2H5J B;  2P2C B;  1RWM B;  3D6H B;  1RHQ B;  5IC4 B;  2H48 B;  3KJQ B;  2HBR B;  2CJX B;  1NME B;  1RWW B;  3NS7 B;  3P4U B;  2CNL B;  2FQQ B;  1GFW B;  1ICE B;  3KJF B;  2HBY B;  1RWN B;  2Y1L B;  2CJY B;  1RWV B;  2H65 B;  3R7B B;  3R7S B;  2C2Z B;  1RWP B;  4DCO B; 
#chains in the Genus database with same CATH topology
 1AFI A;  3NGK A;  1S1W A;  1Q5Y A;  3MPU B;  4KAI A;  5HSP A;  1U09 A;  1WG5 A;  3MTJ A;  3EVM A;  4CM2 A;  3GIL A;  4K2J A;  2VOP A;  1TAU A;  4C8O A;  1S1W B;  1IKY A;  3O3L A;  5T7L B;  2MJN A;  1GXL A;  4ZVS B;  1I94 J;  3ENQ A;  2BE2 A;  4I6A A;  2MHE A;  3MR7 A;  2AX1 A;  3LPY A;  1UKU A;  1TL1 A;  5HJX A;  2DH7 A;  1IKY B;  4ES2 A;  2I6W A;  4USU A;  1RAD B;  4MAK A;  1L3T A;  2QL9 B;  1GMW D;  2CZV C;  2HSE B;  2VF3 A;  4QYZ J;  3FKB A;  1SPB P;  1FX4 A;  3C15 A;  1IBC B;  2VL1 A;  2J0W A;  4F2R A;  3T9Z A;  1KON A;  5J2N A;  5DG7 A;  4RNO A;  2CZ9 A;  3GR0 A;  3C15 B;  1CVJ A;  5G4D A;  2KKH A;  4JI0 F;  4N5S A;  1GMW A;  1DBD A;  1SIW B;  1RT6 A;  2XY5 A;  2JVO A;  4LSL A;  1QAJ A;  2CYY A;  2ILZ A;  4Y3C A;  2WVB A;  2MZR A;  1RT6 B;  3VGT A;  3FMB A;  1S57 A;  3T1Y J;  3T1H J;  1RB0 A;  4LSL B;  1X4E A;  1VHF A;  4OX8 A;  4HH1 A;  4W90 B;  1T9V A;  4HDH A;  3TVK A;  2ABY A;  1NU4 A;  2XSF A;  3CO9 A;  4ZVQ B;  2PFF B;  2C2E A;  3QAE A;  3DDN A;  2QX0 A;  1QUP A;  1YHQ S;  4OIX A;  3W66 A;  4ETX A;  4OYX A;  4QU6 A;  5AJ3 F;  3H7H B;  2MGZ A;  2CQH A;  3I87 A;  2H4W B;  1Z4U A;  2CA9 A;  4PG4 A;  3J80 Y;  4ALZ A;  3PXG a;  3TJ9 A;  4J9R A;  4P75 A;  4CO4 A;  4LR8 A;  5IS2 A;  2MGZ B;  5HAT A;  2ZBQ A;  4FVM A;  3RTV A;  4LRF A;  1R0A A;  1TFY A;  2CQ0 A;  4NI2 A;  3IAM 9;  1FTC A;  2WOM A;  4M5I A;  1J5E F;  2CAD A;  4LBH A;  3PY8 A;  5CHC B;  3DNC A;  1NND A;  2R9L A;  1R0A B;  4NMX A;  4ITS A;  3UDC A;  2PT0 A;  4WZM A;  1GFW B;  1ICE B;  2YXL A;  2XNR A;  4DG1 A;  2VC1 A;  4CLU A;  2KHC A;  1T3O A;  4WJB A;  2GS8 A;  4RUA A;  3OL8 A;  4A8O A;  3CCL S;  2C1E B;  1IWG A;  3QT6 A;  4FF3 A;  4RW4 A;  4NX9 A;  4DG1 B;  2BW7 A;  3CNQ P;  5HI7 A;  2VKR A;  2VQE J;  1U1R A;  2XWY A;  1ITP A;  4RW4 B;  2K7K A;  2W9B A;  3J7A 1;  1ZPV A;  5HMZ A;  5KT7 A;  4FXW A;  3HK2 A;  3BM7 A;  4RO0 A;  4TXS A;  3PCO B;  2W9B B;  5D6G A;  2RF2 A;  5HLF A;  2GJF A;  1UFK A;  2R7W A;  1Z1Z A;  3HZG A;  2B9W A;  1ZM2 A;  1N34 F;  3V6K A;  3MPY A;  1J27 A;  4WK1 A;  2RF2 B;  1FER A;  1FFG B;  4A4J A;  5HLF B;  4USK A;  4K4V A;  2CQI A;  2VBW A;  4C0B A;  1R7I A;  3IRW P;  1PC5 A;  4XK8 C;  3RB4 A;  5DGA A;  1B0T A;  3R9L A;  3CCZ A;  2N7C A;  1RAF B;  1VQP S;  4TY9 A;  1NUE A;  5LM7 E;  1N5Y A;  2VV5 A;  4X4S A;  3KLV A;  4PAB A;  1JXL A;  3JTN A;  4OYA A;  2HNY A;  1HL6 A;  5DDQ C;  5DRK A;  2DEJ A;  4A8S A;  2CQD A;  3GPA A;  4A48 A;  1FWP A;  5AE2 A;  4HT5 A;  2HNY B;  3MOJ B;  2N3O A;  4U7C A;  3MAQ A;  4R0J A;  1AYE A;  2Z4P A;  4EFA C;  1WAC A;  2MKC A;  4UQT A;  3CJ4 A;  1FNM A;  3ZZZ A;  3AD7 C;  4DCP B;  5HMY A;  4C8Y A;  4LIR A;  4DL6 A;  3UN2 A;  5C2C A;  2QO3 A;  2QMX A;  1PYT A;  3LOU A;  3VF0 B;  4E98 A;  1YQH A;  3M8P A;  3PM9 A;  2AKW B;  4LRD A;  3W63 A;  5JXS A;  3M8P B;  4ECW A;  4DV1 J;  3GG0 A;  2IA6 A;  4WIQ A;  5GAE U;  1FVS A;  1R8C A;  4C8M A;  2R2R A;  2V4J A;  5KTQ A;  1WD6 A;  4NXN J;  5ETR A;  1YZ7 A;  4J9S A;  3BKF A;  4M5J A;  2VKZ G;  3THT A;  2W2O P;  4LFB J;  4X4T A;  1HNW F;  2V4J B;  4HLB A;  4DV5 F;  1B70 B;  2OHD A;  4WFZ A;  1UEV A;  3JQJ A;  2DJW A;  1ZTT A;  3MI7 X;  1H7W A;  1RT2 A;  1L3K A;  3UCZ P;  2ILY A;  2QYC A;  2BAC A;  5E0O A;  2RQM A;  3VZH A;  3M8Z A;  4HHU A;  3DRP A;  1UWB A;  2L3M A;  3BDE A;  2ZC3 A;  3V81 A;  2W4D A;  4RW8 A;  3H5X A;  4IFY A;  3ETO A;  1WG4 A;  3O1L A;  4DV3 J;  2MKY A;  1UWB B;  1HWU A;  1WKK A;  4QW9 A;  2VHG A;  3V81 B;  4RW8 B;  4IFY B;  4A46 A;  4R5P B;  2HFO A;  2GHP A;  1RE1 B;  3B82 A;  2DHS A;  3LP0 B;  2UUB J;  4ELU A;  4LF5 F;  1T9T A;  2XG8 A;  3M9N B;  4WKY A;  3I9Z A;  4WPA A;  1HQ2 A;  2FJW A;  1TUV A;  2GVD A;  2YTC A;  4ZA1 A;  2CIM A;  4EK2 A;  4EEY A;  1P8G A;  4LF9 J;  3SDE A;  2GVD B;  2PMH A;  1N4L A;  1OYD A;  3CCV S;  4I68 A;  3QRP A;  1RTZ A;  1YIT S;  1TKD A;  3ETM A;  3ONQ A;  3DDI A;  5F3T A;  1S1V A;  3SDE B;  3NS5 A;  3BBC A;  1PAU B;  3QNW B;  4K4S A;  2ZFH A;  1R8H A;  4XTT A;  1KVJ A;  1S1V B;  1X9M A;  3HJV A;  4X4R A;  3VAL A;  1PIE A;  2PN6 A;  4DR4 J;  4BLG A;  1LW0 A;  5KFC A;  2ZBC A;  3LF0 A;  1F2H A;  3BEG B;  1M0S A;  2AQ4 A;  1RAC B;  1LW0 B;  4YY3 F;  4QR0 A;  1M5V C;  4DR1 F;  4I6Y A;  1M1H A;  2XZW A;  1SQG A;  4MMO A;  1S59 A;  2N4C A;  1DUR A;  2D7S A;  2KO1 A;  3IFE A;  3CF5 Q;  2E7V A;  1RHU B;  4C8Z A;  3J81 j;  1TK8 A;  1XNQ J;  4LIW A;  3D5M A;  2AIR B;  2D3O 1;  3ICL A;  3J7Y I;  4WP8 A;  3MM7 A;  2B43 A;  1CJK B;  2ZOG A;  2FJE B;  3ENW A;  1F5B A;  4YR3 A;  2CJK A;  4TU7 A;  1K8A T;  5EHH A;  2C3Y A;  3KXD A;  2AEM A;  3M9M B;  3MM7 B;  4G1Q A;  2D9O A;  3OVA A;  4X2B A;  1C1C A;  1KLM A;  1SC6 A;  3K59 A;  4CWB A;  2PI4 A;  3RAX A;  1U1Q A;  3KLI A;  5CZX A;  4OI1 A;  1TMJ A;  2E1R A;  3AJ1 A;  1YBT A;  2IYI A;  1C1C B;  1KLM B;  3QLH A;  3MCM A;  3PJX A;  2YQ1 A;  1UEU A;  1KS2 A;  2W1B A;  3KLI B;  1GXT A;  2XO6 A;  1NDK A;  4C8L A;  1U02 A;  4JV2 A;  5KOX A;  4HDG A;  3QLH B;  3OXG A;  3SIP B;  1MWY A;  2OLW A;  4ZIW A;  4ELT A;  2BM0 A;  2L48 A;  2XY7 A;  2JRS A;  3LGM A;  2KXN B;  4Y6I A;  2Q3P A;  4N41 A;  5J1P A;  5THW A;  4YR2 A;  3Q8S B;  2YWK A;  2ZKT A;  2E7X A;  5KFE A;  1U1K A;  1B7F A;  4RUH A;  1LOU A;  5H9E J;  3ILJ A;  3ILL A;  1GQE A;  4Y0F A;  2R7R A;  4KGM A;  3B6B A;  1IBL F;  2Q66 A;  3EIC A;  3ZTR A;  2WVF A;  5DQG A;  2EG1 A;  4KHP F;  4C9D A;  1E6V A;  2IRU A;  1NK8 A;  1I51 B;  1VBX A;  1X5T A;  4NLD A;  2IM3 A;  2MY8 A;  1RQ0 A;  3GON A;  8ATC B;  2CQ1 A;  1E6V B;  3DRX A;  4UOC A;  3CJQ A;  4P72 A;  1EHW A;  2QN6 B;  4GKJ J;  3H2U B;  4DV6 F;  2PFD A;  2BJD A;  3VAF A;  4JBC A;  2QC3 A;  1SKU B;  2N7Y A;  2KH9 A;  4L75 A;  1PCA A;  3NAH A;  2XLJ A;  1GTH A;  1MRO A;  3OHA A;  4DQS A;  3MEE A;  2BAN A;  2KDO A;  2DO0 A;  2MZQ A;  2QG9 B;  1QVG R;  1JJ4 A;  1MRO B;  2NXU A;  3VCD A;  3LWM A;  3MEE B;  2DGT A;  3VAH A;  2BJ3 A;  1R31 A;  3WHI A;  2KG0 A;  1KHW A;  4QCL A;  4J9U E;  5AE1 A;  1XMO J;  5KOW A;  1YJW S;  4IO1 A;  2ROG A;  4DQI A;  1QDU B;  5DZ7 A;  2PMW A;  4JI8 F;  3P4U B;  2PA8 D;  2CNL B;  1U1M A;  4GRS A;  5LSR A;  4ZP6 A;  2E29 A;  4WBF A;  1NPK A;  2JX2 A;  2JLE A;  2LMI A;  1TAQ A;  4I67 A;  4YDX A;  4HI1 A;  1ZOT A;  2FTR A;  1VI7 A;  2MQ8 A;  4PEO A;  5IOL A;  3SBM A;  2QLJ B;  3CMQ A;  1RZM A;  3BO2 A;  2G1D A;  1WHY A;  3GSD A;  1S6U A;  2PDA A;  2E9Z A;  3Q8U A;  4JYA J;  2RVJ A;  3DRS A;  3QGH A;  1B0V A;  2VFS A;  2RB7 A;  3CGI A;  2YKP A;  1S6Q A;  1X5S A;  4LMZ A;  3AXK A;  2ZZN A;  3DRS B;  2EFP A;  4ZLJ A;  5KFB A;  3CCW A;  3W8P A;  1TK0 A;  3IRX A;  3EZU A;  2PD1 A;  1S6Q B;  1S9G A;  3PW4 A;  4IRD A;  3HZE A;  4OZ3 A;  3IRX B;  1SVD A;  2CDQ A;  4KC5 A;  2VC0 A;  3BR8 A;  4NCG A;  2B9E A;  4WCE Q;  2ZH5 A;  2X7I A;  1HQU B;  4GO5 X;  3KLE A;  3SFG A;  4NCG B;  1KRP A;  4NA2 A;  2V2K A;  3MFH A;  2QIF A;  3KLF A;  2HS4 A;  1EAR A;  3KLE B;  5KG4 A;  2MZJ A;  3MED A;  3ET6 A;  3KHL A;  1EQM A;  3V4M A;  5BR8 F;  3KLF B;  5A8R A;  4BS2 A;  4W92 B;  5FLX Y;  3MED B;  3ET6 B;  3MPD A;  5L39 A;  3HHK A;  3TQE A;  2ZUA A;  1TR0 A;  2I8E A;  2L41 A;  5A8R B;  5HAO A;  4KV8 A;  1UJ5 A;  1QVF R;  2E5I A;  1XER A;  4LF8 J;  3HCX A;  1N33 J;  4IG0 A;  4KY3 A;  4PQU A;  1PGZ A;  1FXD A;  4PG7 A;  4KV8 B;  2MZ1 A;  2X3D A;  1X0P A;  4QR1 A;  2J9E A;  4IG0 B;  5E3C A;  4DF4 A;  4V19 X;  1RGV A;  2DNY A;  4PQU B;  2VBZ A;  1S1U A;  1RTJ A;  1LK7 A;  2V2V A;  3CC2 S;  1ZAV A;  1RAI B;  4V19 J;  1UJ6 A;  2IY5 B;  4JI4 J;  1XWL A;  3VAK A;  1NCL A;  4QWA A;  1S1U B;  1RTJ B;  3NS7 B;  1NPR A;  1HNZ J;  4CTA A;  2CJB A;  1Q8L A;  2DRD A;  2QA2 A;  2R8H A;  4DFJ A;  5AE3 A;  3ZTS A;  5I42 A;  5EGY A;  2M3D A;  4Y34 A;  4DCO B;  4CTA B;  4ZHR A;  5A8K A;  3D6T B;  3VGV A;  2V8H A;  5I42 B;  5B08 A;  1X0F A;  4HYK A;  4ZHR B;  5A8K B;  1N8R T;  2M52 A;  1G3O A;  1OQ6 A;  3C46 A;  1FJG F;  2DIT A;  2RS8 A;  3AA9 A;  3B4M A;  4MIB A;  1R6V A;  1ZZF A;  3VVU A;  1S77 D;  2QYG A;  5K9F A;  4FYW B;  2DBB A;  4EMD A;  2QEX S;  4P2F A;  4PWU A;  3MPV A;  3PV8 A;  2EWH A;  4FKY A;  1QSL A;  5IT9 Y;  1X7V A;  1HBO A;  4C2M A;  1S49 A;  3TAM A;  2C22 A;  3CE8 A;  3OPK A;  2IDE A;  2GMH A;  2BUN A;  1HBO B;  4NOH A;  5LT5 A;  4DFK A;  3TZY A;  3TAM B;  5SUH A;  4URG A;  3NCP A;  3D3B J;  3R5A A;  1TKX A;  4DL3 A;  3MM8 A;  5B09 A;  2Z0G A;  2OEM A;  4D3H A;  3V6J A;  3QID A;  2BMB A;  3J81 Y;  3MCO A;  1HNX J;  2WB1 D;  4ED7 A;  2XYH B;  5KT4 A;  1TKX B;  4LF2 A;  3MM8 B;  1XC9 A;  3T5L A;  2C2K B;  2NZ4 A;  4LFA J;  4ZS6 A;  1U47 A;  1E6Y A;  4C4W A;  2QLX A;  3KUH A;  2XCA A;  1SI9 A;  3EVW A;  1YVF A;  4F3O A;  1FJ7 A;  2G2Z A;  3QBC A;  3Q8R B;  1E6Y B;  1D3W A;  1YJV A;  5BJR A;  3EGN A;  1Q8K A;  4CRJ A;  3NOC A;  4J9L A;  3MAH A;  3NY0 A;  4WE1 A;  2AYB A;  2DEI A;  2XC9 A;  1NJW A;  1W2B R;  1EJ7 L;  2HFV A;  5IT0 A;  4WE1 B;  2VPZ B;  1KQG B;  1GK8 A;  5F8N A;  3IWL A;  2B9Y A;  2MDA A;  3T3F A;  4K4Z A;  3NCQ A;  4RNM A;  2LCW A;  1YBA A;  2M8D B;  1TTH B;  2WSF C;  3PTW A;  4CLW A;  4N77 A;  2G0J A;  1BQX A;  2ZIT A;  5AXM A;  1GTE A;  2QE5 A;  2RDD A;  2X3G A;  1RWK B;  2FHJ D;  1D1U A;  3RJM B;  5E33 A;  3HF5 A;  3QQC D;  5KG2 A;  3FEX B;  1CPZ A;  4JI7 F;  5K8N A;  4ZPA A;  2BKP A;  4JI3 F;  4Y2I A;  4B9S A;  4QBU A;  4Q8E A;  3K5O A;  2FHJ A;  4Q0B A;  3R3T A;  2HHT A;  4M5K A;  1NH8 A;  2MXY A;  1Y10 A;  3CCR S;  3HMJ G;  3MR6 A;  3GIR A;  1XEZ A;  4Q0B B;  4J9O A;  4TU9 A;  2HHU A;  2OMO A;  3J7Y U;  2R3V A;  1VYA A;  3ZXW A;  3JTP A;  2XYG B;  4DR7 F;  5L1J A;  1RT5 A;  4NL5 A;  2RU3 A;  2ZVI A;  2DNK A;  2GMJ A;  3HM9 A;  3JB9 k;  3D3C J;  2WZ1 A;  4OV6 A;  1S76 D;  1RT5 B;  4K4W A;  3D28 A;  5F8H A;  2R8K A;  3NLC A;  1RAO A;  5L1I A;  4OZN A;  3VGS A;  3D1Q A;  3K5M A;  1RAA B;  1Z2L A;  3QGG A;  5ETQ A;  1TUW A;  5HQ8 A;  1JJ2 R;  3CC4 S;  4ZPT R;  4QU7 A;  3I0R A;  2EKN A;  3MUM P;  2J9C A;  4LF7 F;  1M5O C;  3C19 A;  4DV2 J;  3CCQ S;  3TA2 A;  2YKA A;  4ES3 A;  2GA7 A;  4WZQ A;  2XGQ A;  5KFA A;  3G6V A;  3I0R B;  2VH7 A;  2H3E B;  2ZEJ A;  2J0X A;  5F8I A;  1FKO A;  2OKQ A;  2J0S D;  2DR6 A;  4M95 A;  2XMJ A;  2DIU A;  1WTB A;  2V34 A;  3T6B A;  1VR6 A;  2WHO A;  3R8Y A;  1JIH A;  1FKO B;  2WK4 A;  3DOL A;  1X4B A;  1HAR A;  1HYS A;  4XPE A;  4LRC A;  2Y3Y A;  2EFV A;  4DFP A;  1JB0 C;  3DOL B;  2JNJ A;  5ETS A;  4KBI A;  1HYS B;  1TU0 B;  1VC0 A;  3L7U A;  2DGS A;  4FF1 A;  3NAI A;  2WON A;  3ENA A;  4XDD A;  3AD8 C;  1YRX A;  3NMR A;  2LQB A;  3OXL A;  3BQ1 A;  5E3P A;  4ED3 A;  2WON B;  2RT3 A;  3RG6 A;  5F8M A;  2LXU A;  3GIM A;  1OYE A;  3HLU A;  1SL0 A;  4JI0 J;  1YX2 A;  3G71 S;  2RE1 A;  1WKJ A;  2UXB F;  1MML A;  5IT4 A;  2RHS B;  4RNH A;  3K8V A;  5LSO A;  2BJE A;  4RKU C;  1IKX A;  1U6F A;  4ERD A;  3LP1 A;  1YZ6 A;  4J9N A;  1UVK A;  1UET A;  2DPI A;  2JEG A;  4LUB A;  1IKX B;  1SQF A;  1S4F A;  4ETZ A;  2M0G B;  1Y7P A;  3LP1 B;  3QGI A;  1NM2 A;  3GG1 A;  1N5V A;  2ZWO A;  3E3X A;  2W8L A;  4ZVT B;  3BN7 A;  2AU0 A;  5F8G A;  4N56 A;  1VC6 A;  5AJ3 J;  4FYD A;  3AHP A;  2Z58 B;  2AMC B;  3OBI A;  2ADB A;  4F8R A;  3P5T L;  5GMD A;  2EFN A;  4KR0 B;  4BDP A;  2N4D A;  1F3F A;  4ED5 A;  1CJT A;  3Q2S C;  3PO4 A;  1U4B A;  3WBZ A;  2YKN B;  2AYM A;  2R7Q A;  1CJT B;  2W4C A;  1J5E J;  2XHW A;  2IVY A;  3Q2T C;  3CO0 P;  4TN2 A;  2HMI A;  2J76 E;  1XNR J;  1WC1 A;  2EFO A;  1SC1 B;  4NLR A;  3M05 A;  5KFR A;  4AE5 A;  4HH0 A;  4U6P A;  3F56 A;  1NHK L;  4F4X A;  2HMI B;  2VDH A;  2FVS A;  4OZ5 A;  3I0S A;  2DKO B;  3UVJ A;  2NQP A;  2DNH A;  5HJY A;  4RU9 A;  5ETK A;  2J7K A;  3I0S B;  4ZJL A;  4ZPD A;  3PJ9 A;  4KYZ A;  3PHT A;  4ZKA A;  1OY9 A;  2KB2 A;  3NOG A;  4CLS A;  5E7O B;  4CDI A;  2DNN A;  1D9F A;  4F25 A;  4NML A;  3GB0 A;  1I5O B;  4GC7 A;  4PKD B;  2AJF E;  3K89 A;  4DZD A;  2QTW A;  1HMV A;  4ZN1 A;  1TZ0 A;  3A8J A;  3IWX A;  2Z30 B;  4WKR A;  2FB0 A;  3CJT A;  1HI1 A;  1FKP A;  5ETP A;  1HMV B;  3NNC A;  4TU8 A;  1FKP B;  4LSZ B;  4O3S A;  4PYA A;  1Q95 G;  4EU0 A;  4B9T A;  4V1A k;  3S01 A;  3R5C A;  2QA4 G;  1X4D A;  1FA0 A;  2ZD1 A;  2DVI A;  3HO1 A;  3JAM U;  1ULR A;  2LKZ A;  4ZVR B;  3J7Z 5;  1WHX A;  2BW2 A;  4YHH F;  2F65 A;  4WU3 A;  4FKX A;  3SQG A;  3V6D A;  2MKS A;  1IQT A;  2IFX A;  4DR3 F;  4LBP A;  3POT A;  2F8E X;  2ZH9 A;  3SQG B;  4DPO A;  1W7W A;  4DV4 J;  2MPU A;  2KFY A;  1SJR A;  3V6D B;  3QYY A;  4RW9 A;  3B54 A;  2OPR A;  5C5J A;  1GMU A;  3F44 A;  3POT B;  2IRY A;  4P74 A;  5KFV A;  3AY0 A;  3CDA A;  3R1L A;  4DL4 A;  3H20 A;  4OI0 A;  1C2P A;  4RW9 B;  2NYH A;  1X8D A;  2OPR B;  2QL5 B;  1FRI A;  2W4P A;  4OLP A;  3L09 A;  3PZP A;  5ADZ A;  4F02 A;  2LDY A;  4DFM A;  3PEH A;  1HNW J;  4IQX A;  4DV5 J;  4N76 A;  3B78 A;  2VA2 A;  1WF0 A;  3KJV A;  4DJB A;  4DV7 J;  3S8S A;  3BYP A;  3U1M A;  3KJV B;  3PRD A;  1MWZ A;  2FJX A;  3R6L B;  3KOA A;  3DLB A;  4WU2 A;  4KIA A;  3EYZ A;  1REV A;  3R2C J;  2KHD A;  2PC6 A;  5D4L A;  1IKW A;  3EJM A;  2AYE A;  2O67 A;  3CDE A;  4Y2C A;  5K8O A;  1RCX B;  5I3U B;  4L72 B;  1S99 A;  2D41 A;  1YK9 A;  5CA5 A;  4JI1 F;  1IKW B;  4ED2 A;  1RT1 B;  1SH3 A;  1QUV A;  1Q4R A;  4LQ3 A;  2RRB A;  1HHS A;  3Q83 A;  4GKK F;  3BF4 A;  1ZM9 A;  1CSJ A;  2V69 A;  1S9E A;  3OTB A;  3W9H A;  2MQL A;  1RWO B;  3WX8 A;  2NCK L;  3FCH A;  2V8V A;  4YP3 A;  3PJW A;  4AL6 A;  4ICL A;  1S9E B;  4B9U A;  2DHH A;  2F1F A;  2GW8 A;  5ETN A;  4DF8 A;  4FP9 A;  3Q22 A;  2CVI A;  1HD1 A;  1LEO A;  5KFL A;  3WC2 A;  2F5G A;  4CLF A;  1X31 C;  4ICL B;  4Z2X A;  4XAK A;  5IXU A;  2DGO A;  3K58 A;  1XJW B;  3BBB A;  1MSW D;  2RIL A;  5LJ3 Y;  4OX6 A;  3N6L A;  1LK5 A;  2CNK B;  4ED6 A;  2AZ3 A;  2CUY A;  2UV8 G;  3R5D A;  3ILO A;  2V4R A;  1NK9 A;  3KMQ A;  3SSS A;  3PAC A;  2A6M A;  2XI3 A;  4J91 A;  2IHR 1;  2FJD B;  4GMK A;  4B9M A;  3FK4 A;  3OVB A;  5FJ4 A;  3K57 A;  2UVR A;  2ZM6 F;  4DR1 J;  4I0W A;  1OIA A;  1C1B A;  3C6U A;  2Y8W A;  4CH7 A;  1NAQ A;  1FRX A;  1C1B B;  3K2Y A;  2CRL A;  3C6U B;  2Q79 A;  3VAM A;  2ZNZ A;  2LVW A;  3G8T A;  3A1Y G;  2LQ5 A;  4DR6 F;  1K47 A;  5CCM A;  1JNR B;  4C0H A;  3ZZ0 A;  2F4F A;  3EM1 A;  4G1I A;  6FDR A;  4ECT A;  2HIQ A;  5L1K A;  2Y9H A;  1ZTW A;  4ECX A;  1RTD B;  2C2R A;  1FNX H;  2C2O B;  3U02 A;  2EXU A;  2AGP A;  4B3S F;  3MAA A;  4E2F B;  4CO1 A;  3I96 A;  4WYW A;  3OVS A;  1IKV A;  2VPX B;  5EX0 A;  2MEW A;  4YEA A;  1SXL A;  1RHQ B;  4G6V B;  4J7C A;  2JHE A;  3UN3 A;  3NG8 A;  2ZH6 A;  1IKV B;  2YQ0 A;  4X4O A;  2K7J A;  4KPY A;  1RTI B;  2DGV A;  3LO3 A;  1RT7 A;  3ZZY A;  3QAT A;  1U1O A;  2MQO A;  1HHQ A;  2DRB A;  2COL A;  2MB0 B;  1RT7 B;  3R5B A;  1PBU A;  4P2X A;  1MU2 A;  2GC8 A;  1LXN A;  4CH1 A;  4DL2 A;  1LNQ A;  2R2T A;  4WFB Q;  2DRA A;  2N3L A;  4ZVP B;  4KGK A;  1MU2 B;  4Z37 A;  3UW1 A;  4ZP7 A;  2FC8 A;  4BBY A;  4QIF A;  2FJB B;  1YJT A;  4DX6 A;  4KHP J;  3HT0 A;  1EQ0 A;  4Y2M A;  2BM1 A;  2M2B A;  2DGU A;  2UXC F;  1C0T A;  1P9Y A;  4C6A A;  3R1H A;  3RAM A;  4A8X A;  1LWE A;  4JI6 J;  4DV6 J;  1NDP A;  3TZZ A;  3KWM A;  3DM2 A;  1IJE B;  4LRA A;  2BE9 B;  5ETM A;  4RU2 A;  1C0T B;  2KZM A;  4IFV A;  1LWE B;  3DM2 B;  4DSI A;  1N36 F;  4ZK7 M;  3A13 A;  4RZR A;  4IFV B;  3MUR P;  1F9F A;  4CO2 A;  4HHH A;  4KT0 C;  2HVD A;  2OAU A;  4NLP A;  5J1E A;  4M5L A;  1XMQ F;  4X4Q A;  1S72 S;  1YBU A;  1SBR A;  4O4R A;  1Z2Z A;  1VQ8 S;  2W7O A;  2C2N A;  3MR5 A;  1NZA A;  2GJI A;  3FVY A;  4UY8 5;  5DQI A;  5J1E B;  4JI8 J;  2EEY A;  4RX6 A;  3OSP A;  3MEK A;  5HBM A;  2D74 B;  2WBR A;  1CC8 A;  4I7F A;  3V4I A;  3IAS 9;  2LXF A;  4CT8 A;  4L74 A;  2EC2 A;  3R97 A;  1JNZ B;  1RBL A;  2W2Q P;  5IC6 B;  1CUL A;  4LT6 A;  4NYZ A;  3N9U C;  3V4I B;  3DLG A;  1MMD A;  3M9O B;  2R7S A;  4ZPC A;  4QYZ K;  1CUL B;  3FSI A;  3DLH A;  2DPJ A;  3C3L A;  5DLG A;  2GQC A;  1S79 A;  1FEH A;  2Z56 B;  4CLY A;  2R7T A;  4LSN A;  3TWZ A;  1Y3J A;  3LTO A;  3IM9 A;  3DU5 A;  2FD2 A;  4NZ0 A;  4W98 A;  3S1T A;  4LSN B;  2B4O A;  4CQ1 A;  2KVI A;  3CMA S;  2E1A A;  2K3I A;  2H5I B;  5K8P A;  5IWA F;  3UDV A;  2ZH1 A;  4DPT A;  3SI8 A;  4DHV A;  4NPO A;  3J80 U;  4Y2A A;  2W01 A;  5KFH A;  4ECY A;  2WTF A;  1VIX A;  4HL9 A;  2V9K A;  1WI8 A;  5IFM A;  2HHV A;  2H1Y A;  1XK8 A;  1BWE A;  5HVG A;  1BLU A;  2ZVS A;  5D15 A;  2F4V F;  5CQG A;  1X4F A;  3GLJ A;  2V67 A;  1Q1K A;  2JH3 A;  5BR8 J;  4UT4 A;  1UL3 A;  2DYA A;  5K20 B;  2XMM A;  1VRT A;  4AD6 A;  4ZLP A;  5J2Q A;  4B02 A;  1TK5 A;  2IC3 A;  4LFC F;  2ZBR A;  2FHM A;  4NLT A;  5I3P A;  2V0N A;  3CDW A;  1VRT B;  3SZ2 A;  5J2Q B;  1XMB A;  5BYS A;  2RDJ A;  2IA0 A;  1H98 A;  3HHE A;  3OR1 A;  3RBX A;  3EMT A;  2WRM A;  3FFI A;  4ZCK A;  2WVD A;  3OR1 B;  1HW9 A;  1Q7Y T;  4X65 F;  1VBZ A;  2Q6C A;  1V5I B;  3FFI B;  5LMN J;  5KFM A;  3QT8 A;  3W7B A;  2C2M B;  2C3U A;  2M8H A;  2JJ4 D;  3W5Z A;  2KYX A;  5D77 A;  1TL4 A;  1T05 B;  1S6O A;  3CTR A;  2BX6 A;  4GC6 A;  3MMJ A;  2VFV A;  3RUB L;  3M2V A;  1VQM S;  4PXD A;  4H4K A;  3NXZ A;  4AXJ A;  2V94 A;  1TL7 A;  4JI5 F;  4MYT A;  1UVM A;  5LL6 d;  3M2V B;  1XR6 A;  2HHH J;  2ZBI A;  4BCA A;  1JLG A;  4LVN P;  2FVP A;  3CVK A;  4HR2 A;  2GAH C;  4OHX A;  5DG8 A;  2J5A A;  1JLG B;  4ECS A;  3C2P A;  2EK6 A;  4PXC A;  2KT5 A;  2FHO B;  1J2V A;  1I94 F;  2RJZ A;  1WEL A;  2KN4 A;  2YPY A;  1N54 B;  3PRB A;  1Y3K A;  3R2D J;  2HS3 A;  4ZCL A;  3HSD A;  1D8Z A;  5E41 A;  3C16 B;  2I2Y A;  1RWU A;  4CNY A;  2L08 A;  2M9K A;  3H0P A;  3G6Y A;  1XR5 A;  4OJ1 A;  1EB0 A;  4MIW A;  1RHK B;  1H3D A;  3NNH A;  4RNF A;  2HRY A;  2R7U A;  4ZVF A;  3F41 A;  2FGC A;  3TP2 A;  3SSQ A;  2RKI B;  2AX0 A;  5J2P A;  1IM6 A;  1FRH A;  4JV1 A;  2NPI A;  4RW7 A;  2CJA A;  5T14 A;  5CAA A;  3T1A A;  1OY8 A;  2QV6 A;  2FY1 A;  5J2P B;  3OW2 R;  3HHL C;  4EBD A;  4IO9 Q;  4RW7 B;  3SV3 A;  3QFW A;  4JP8 A;  2Z2Y B;  1OSC A;  5HQL A;  1R8A A;  3ZTO A;  2GZO A;  2ZE2 A;  1XR7 A;  4UW2 A;  5T41 A;  1R0C B;  2HFU A;  3NGU A;  4N8O A;  1HPZ A;  2AEF A;  4IH5 A;  3H8Y A;  3TA0 A;  3GV7 B;  2XBP A;  4QWC A;  1QAI A;  1LWF A;  1NB7 A;  3ITH A;  1IVZ A;  1HPZ B;  1B3T A;  1WC6 A;  1VBY A;  1LWF B;  3ITH B;  1RA6 A;  3M8Q A;  1KQF B;  1F5A A;  1KD1 T;  4DS5 A;  3CSK A;  2IM1 A;  4DV0 F;  1T0T V;  4ZLL A;  2HKE A;  4OHW A;  2QLW A;  1XBW A;  5J2M A;  4UF4 A;  5CYJ A;  3SCL E;  2LFV A;  2GX8 A;  3M8Q B;  2XLI A;  5SZT A;  1U1L A;  2QA4 S;  4UST A;  5CZV A;  3K7R A;  3R5J B;  3DHW C;  5J2M B;  4OZL A;  2HFN A;  3OLB A;  2HBQ B;  3UD5 A;  1MN9 A;  1R8P A;  1TV6 A;  4KO0 A;  5KFW A;  4JI7 J;  2KJW A;  2ZKU A;  4AXI A;  5KT3 A;  1ZA2 B;  3OL7 A;  4JI3 J;  1LW2 A;  2VU5 A;  1T9Y A;  1U2R A;  2W8K A;  1TV6 B;  3IC1 A;  4KO0 B;  2VQE F;  3I82 A;  1NKB A;  5L8R C;  3I32 A;  1LW2 B;  3Q8Q B;  4K0K J;  1YIJ S;  4WTY A;  2JC1 A;  2MZS A;  5D78 A;  3BGR A;  3FCW A;  3MMA A;  1GMV A;  4DR7 J;  1QAY A;  3MHY A;  4NXM F;  3KLH A;  2JZ5 A;  2OH2 A;  2BV3 A;  3QT7 A;  1RK8 A;  5IZH A;  1LWC A;  3MMA B;  1F9E B;  3N5F A;  3GR1 A;  4B17 A;  1FT8 A;  3KLH B;  1JKH A;  4PPZ A;  3W8G A;  4A8Q A;  1LWC B;  3NKY A;  2OSR A;  2OPQ A;  2LU1 A;  2C42 A;  3IBC B;  2AEJ A;  3BH6 B;  4NE9 C;  3L7P A;  1OMS A;  4UQG A;  2V8D A;  2OPQ B;  2XMU A;  2KM8 B;  2KT3 A;  3BSA A;  2KJV A;  3TEH B;  4XIU A;  1VOM A;  2NSB A;  2YWW A;  2MLY A;  1G1X A;  4OHZ A;  4YN3 B;  2HQG A;  1QSS A;  4QOT A;  3PFE A;  4EGL A;  2X51 A;  1VQS A;  3TUJ C;  3EZ5 A;  2DB1 A;  2VFT A;  1BWV A;  4M8L A;  2HLU A;  2HHX A;  4DL7 A;  4J5O A;  3WC0 A;  3P5B P;  3NCR A;  1NEE A;  3HSG A;  5AT1 B;  1NHV A;  1HWL A;  4RL1 A;  3JSY A;  2BE2 B;  1F6T A;  2P9G A;  2W2M P;  3CCM S;  4ED4 A;  1TL1 B;  2YY3 A;  3MZI A;  3V6H A;  1GH8 A;  1PJ7 A;  2IMW P;  4OZ0 A;  2NXJ A;  2J7U A;  2R2S A;  4M5H A;  2YX7 A;  4X66 F;  4KJI A;  3UFC X;  1EKR A;  1S5Z A;  5J2N B;  2CZ4 A;  2MQN A;  3D54 A;  4PG6 A;  4DSE A;  4QIV A;  5L38 A;  1SUQ A;  3VTI A;  4B08 A;  3FGV A;  4NXN F;  1O0P A;  3CJ5 A;  4XO0 A;  2RUS A;  2K06 A;  1BY9 A;  1HBU A;  2RHQ B;  2ATC B;  1SUQ B;  3UCU P;  4HKQ A;  1TFW A;  2MLZ A;  5H9E K;  2QA1 A;  5A6W A;  4IOC Q;  1HBU B;  1WC0 A;  4FNH A;  4CZC A;  3BPD A;  4NLO A;  4NA1 A;  1PO6 A;  3GFH A;  1URR A;  4WK3 A;  1ZBT A;  3TEG A;  1KN6 A;  1UFL A;  1EET A;  1RDR A;  3UNY A;  4DV3 F;  3IBW A;  2V63 A;  2HZV A;  3GTY X;  4USJ C;  2B3T B;  1S0N A;  2MY7 A;  1RSC A;  4C97 A;  3ZZU A;  1JLQ A;  1T9U A;  1EET B;  2XS7 A;  2NRE A;  3Q8P B;  1U0S A;  3D6M B;  3GIK A;  2EFG A;  1T03 A;  2HFS A;  4J9P A;  4GVL A;  3BV8 A;  5LJ5 Y;  4O44 A;  1JLQ B;  2ALZ A;  3PVX A;  2EK1 A;  2XZD B;  1KR4 A;  1T03 B;  5A8W A;  3SCJ E;  1S1T A;  3TNV A;  3W5X A;  4ZIT A;  3CCU S;  1EKS A;  1EIY B;  3VGU A;  4ATN A;  4NI2 B;  3RR7 A;  4YB6 A;  3H59 A;  2WOM B;  5A8W B;  1T8E A;  2R8G A;  1QLN A;  3DCA A;  3KUG A;  4K4Y A;  2VPY B;  5GAG I;  1M1G A;  3RU0 A;  3I55 S;  3KK2 A;  4ZCI A;  3W9I A;  2ASJ A;  3LH2 S;  4M63 A;  4TYA A;  3EGZ A;  1YJ9 S;  2VG5 A;  3OR2 A;  3KK2 B;  3Q89 A;  4O23 A;  5EX3 A;  2FC9 A;  3FNN A;  3HVT A;  3BS9 A;  4DR4 F;  2VG5 B;  3OR2 B;  3W1Y C;  2O66 A;  2MTL A;  1QJH A;  3NRB A;  3KG0 A;  3HHN B;  4X64 J;  3HVT B;  1P9Q C;  1KTV A;  5D0E A;  4MT1 A;  2YWH A;  4NRU A;  2GV1 A;  4NA3 A;  1DRZ A;  2UVV A;  3FBC A;  1LKZ A;  1U8S A;  1R43 A;  4JI2 F;  2CNN B;  1W26 A;  4QYR A;  2UUA J;  2A1B A;  3RW6 A;  2DT9 A;  3E51 A;  2X1F A;  2Y1R I;  4BWJ A;  1FRL A;  2ZOF A;  1XNQ F;  2YNI A;  1TP7 A;  1OS5 A;  2F8H A;  1NO8 A;  4CLZ A;  1S4E A;  4P7T A;  4N8N A;  1L3U A;  4YFU A;  1H0H B;  3P96 A;  4DU8 A;  2YNI B;  1KTQ A;  4B3R J;  1B7Y B;  7FD1 A;  4B3M F;  1N5Y B;  1AUD A;  1VIO A;  4PXB A;  1M5K C;  2GAG C;  4RUB A;  2OO4 A;  4Q44 A;  5KAK A;  4I56 A;  2EW9 A;  2G1H A;  5HMX A;  3KHR A;  2FLO A;  2R42 A;  2B5J A;  5IQ6 A;  1RXO B;  2UXD F;  4XPC A;  1U48 A;  4DUZ J;  2LA6 A;  2XMT A;  2C3P A;  5FLX U;  2M70 A;  3AOD A;  1ROF A;  2UU9 F;  2B5J B;  3FQK A;  2ZH4 A;  3BJY A;  1D9A A;  1N48 A;  4YHH J;  4U7U D;  5HO4 A;  2C3O A;  3GJT B;  3MD1 A;  1VQN S;  3TVZ A;  4UOG A;  2ZHA A;  2I5J A;  1QM9 A;  4F4Y A;  4DR3 J;  2HVH A;  2RDI A;  3M2R A;  4A8F A;  1L5U A;  1WNE A;  1N32 F;  4Z7Y A;  2HWI A;  1M5H A;  2I5J B;  3MF5 A;  3M2R B;  4G1P A;  4Q2L A;  4KH1 B;  4DOZ A;  3KMS A;  1Q79 A;  3MM5 A;  4CO0 A;  3HFV A;  1F3V A;  3OL9 A;  2ZBP A;  3H2L A;  1HFE L;  3MM5 B;  5GMK a;  2P2C B;  4B9V A;  4PYD A;  3AAW B;  2CPI A;  1RU2 A;  1YTY A;  1PBA A;  3AQP A;  2VQF F;  2K1R A;  2E5G A;  1KQS R;  3OTC A;  2PE8 A;  4FDF A;  3L3C A;  3SXL A;  1IBM J;  4OI4 A;  1HWK A;  2H65 B;  1RT2 B;  4YDD B;  2K1R B;  2YNH A;  3TAR A;  2E5H A;  1B0P A;  3MFI A;  1FFW B;  3DRP B;  2F9D A;  5JMN A;  4M5G A;  4JV0 A;  2YNH B;  3UD4 P;  4DR2 J;  2YVS A;  3TVY A;  4IDK A;  2AGO A;  4F3M A;  3ELH A;  2PGC A;  2HNZ A;  1LFP A;  3MGJ A;  2BJ8 A;  3DLJ A;  2F8M A;  4JI1 J;  2FHK A;  5IT9 U;  2XUL A;  3DU6 A;  4IDK B;  3CD5 A;  1F0X A;  2IVF B;  3Q23 A;  3IMQ J;  2FVC A;  2WW8 A;  4NRT A;  3M8W A;  4GKK J;  4EBC A;  1CS4 A;  3P49 B;  2KFN A;  2AP6 A;  2XS2 A;  1DJ0 A;  3CCJ S;  4KGX B;  3PW5 A;  4L3K A;  1EAY C;  1K1Q A;  2QT7 A;  1CS4 B;  3KTQ A;  3R6G B;  4U8Y A;  1RP5 A;  4FBU A;  4F2S A;  1MG7 A;  3UQS A;  4DSJ A;  9RUB A;  1U0H A;  3DMJ A;  4F0M A;  3J81 U;  4P7V A;  3QJL A;  2DCU B;  1AT1 B;  3VQS A;  4Y00 A;  1HIY A;  1U0H B;  4Q5V A;  2CQ4 A;  3DMJ B;  3R7S B;  2HHW A;  5LMU J;  2YKO A;  2JDJ A;  1W2I A;  2WCX A;  1YJU A;  3IR6 B;  2F63 A;  2HVI A;  3ZFV A;  2ZM6 J;  4CNZ A;  4PQA A;  1HBN A;  2H4Y B;  7AT1 B;  4YR0 A;  4DQR A;  4M5D A;  4CO3 A;  4B3T F;  4C3K A;  4K50 A;  4AT1 B;  4X4U A;  1HBN B;  3OD2 A;  1WC4 A;  1ZS6 A;  2Q43 A;  2KZZ A;  4M5D B;  3LAK A;  1ZAX A;  1KNZ A;  3EGW B;  3RAQ A;  2BE7 D;  1WHV A;  2AJ0 A;  4UZC A;  4Y28 C;  4YOE A;  1LFW A;  1NXI A;  3IG1 A;  1NSA A;  3DGV A;  4EO6 A;  4DR6 J;  3PNI A;  4DCJ B;  3HKZ D;  1FXL A;  4U95 A;  3NP5 A;  2I1R A;  1K9M T;  2DR9 A;  2RD5 C;  3IG1 B;  4P9S A;  3OTO F;  3W3S A;  2WSE C;  1V3R A;  1PC4 A;  4EUV A;  4G1Q B;  2FLN A;  3I4P A;  3C66 A;  2V2Z A;  4EBE A;  3LWL A;  2FYX A;  1RWP B;  1Q78 A;  3U7J A;  2GO9 A;  4B3S J;  1YGY A;  3NEK A;  4RBV A;  1F9H A;  3ZTP A;  4ZPV R;  4ILR A;  3EE3 A;  1FDN A;  1GNK A;  2HWH A;  1XIQ A;  4RWX A;  4KTQ A;  3LP2 A;  2XSJ A;  1REG X;  3I5A A;  1RAG B;  3QWP A;  1KOH A;  5KFS A;  3MMB A;  4OI3 A;  3LP2 B;  2XSJ B;  4ZP8 A;  5EUH A;  1FD2 A;  2FUG 9;  1X9S A;  4FPR A;  4F4A A;  3AB2 B;  3MMB B;  2JVR A;  2AT1 B;  2DK2 A;  1VQ5 S;  4P2M A;  4JV5 J;  1BC6 A;  3OFF A;  4ZDN A;  2HZA A;  2A2D A;  2P5V A;  5B0E A;  4JI4 F;  4RLE A;  1CEZ A;  4I4B A;  2NSC A;  3J7A N;  2ZDO A;  2A2C A;  4X62 F;  2OTL S;  1AZS A;  3JTO A;  5KG6 A;  3D6H B;  1CJU A;  3KDN A;  1V3S A;  1U7L A;  2ADC A;  5D3G A;  1AZS B;  1MWQ A;  2F7V A;  3J7Z T;  1CJU B;  3UWT A;  1UVJ A;  3OT9 A;  1NJX A;  3O5T B;  4IOB A;  5D3G B;  3NMA A;  1Q81 T;  4PAA A;  6FD1 A;  2PSZ A;  1BD6 A;  4F67 A;  5L46 A;  3MM6 A;  4DQP A;  2Y0B B;  1D0E A;  4NYO A;  5GAH I;  2VFU A;  1RAJ A;  1S6P A;  5J1N A;  3RGI A;  4DSF A;  4KPC A;  1N36 J;  2BAN B;  2K2P A;  5IV4 A;  3H42 A;  3MM6 B;  3RR8 A;  1FRM A;  3HVR A;  2HHP A;  3CIM A;  1QD1 A;  1S6P B;  4ZPW R;  3VV2 B;  4JOU A;  2XMV A;  3ISN D;  1OO0 B;  1R0B G;  4OX9 J;  2YKM A;  2DXF A;  3R7N B;  2H51 B;  2K3K A;  5KG5 A;  3ENV A;  4AQY F;  3GFZ A;  3GE9 A;  3RB3 A;  2YKM B;  4FS1 A;  4ZVG A;  4MTP A;  2H5J B;  3D9B A;  3HSZ A;  1IUJ A;  1FO1 A;  1WOS A;  4ANC A;  5K8M A;  4A8M P;  5DDP C;  4DX5 A;  1OQ3 A;  3MWB A;  1R6Y A;  1HNX F;  5B0A A;  2XGP A;  4PWW A;  3P8B B;  2ZJP Q;  1VDH A;  4H4K C;  5E5N A;  3S6E A;  3WX4 A;  2LP4 A;  4DSK A;  3HT3 A;  3RZA A;  1AFJ A;  5K5M A;  3DYA A;  2HHS A;  1CQN A;  2G13 A;  2KYZ A;  1DAR A;  4ZJQ A;  3AJ2 A;  1VQ6 S;  3CJ3 A;  4O4G A;  2NYI A;  4NLU A;  1WKL A;  2W9C A;  2W25 A;  3OFH A;  1SKR A;  1NH7 A;  2V8P A;  2HW3 A;  5F0U A;  3DI6 A;  4O4G B;  3N79 A;  1HNV A;  4WFA Q;  1VK8 A;  2W9C B;  1S9G B;  3DI6 B;  4M5M A;  5IWA J;  1T95 A;  1HNV B;  4RR5 A;  1YWX A;  2BVZ A;  3T41 A;  5GAG U;  2O1P A;  2VG6 A;  1WTF A;  4P6Q A;  3C6T A;  4DZ6 A;  3H5Y A;  2HBR B;  2IVM A;  2AWZ A;  5HL7 Q;  4ZVH A;  2YX1 A;  2CQB A;  2VG6 B;  4K4T A;  1RLC L;  2LQ9 A;  4C3M A;  1NKC A;  1Q5V A;  3C6T B;  2F4V J;  2RAQ A;  2XMW A;  1JLC A;  3T5K A;  1YG0 A;  3EDQ B;  2GVZ A;  2YWE A;  1NB2 A;  4Q8F A;  2IYG A;  4N7T A;  3Q24 A;  2LEP A;  2Y1I A;  3CC7 S;  3DOM A;  4M1K A;  1V6H A;  3UN5 A;  1HBM A;  2PO4 A;  3E8O A;  2GVZ B;  1NK5 A;  4GO7 X;  2GIQ A;  1U6Z A;  3EVO A;  4MKB A;  3DOM B;  2IM2 A;  4CH0 S;  1HBM B;  4DPU A;  4CM0 A;  2AYG A;  5G0R A;  4C0O C;  3RB0 A;  2E44 A;  4QQB A;  4L73 A;  3W64 A;  4L3N A;  2JSX A;  3TOQ A;  2I9S A;  2HGM A;  1CQM A;  1RAB B;  5G0R B;  2OEJ A;  2UV8 A;  4A8W A;  4EO8 A;  1IXK A;  3U1N A;  1CLF A;  3EXC X;  3DXB A;  3RW7 A;  1S0V A;  3OTD A;  4X65 J;  1C0U A;  4E0D A;  3NBP A;  2DHX A;  4MH8 A;  2R2U A;  1X5P A;  3E2E A;  1FFS B;  1C0U B;  3GFX A;  4K2X A;  3TUI C;  3QRQ A;  3NBP B;  2MYF A;  4OZ2 A;  3W5Y A;  1A7G E;  4U8V A;  3T5J A;  2LA4 A;  5C42 A;  1R89 A;  3N4W A;  4IQM A;  3EZO A;  3LAN A;  1VQL S;  2MLX A;  4JI5 J;  1VFJ A;  5HK4 A;  4DMZ A;  1V5V A;  4TYB A;  4F4W A;  1FWL A;  1V3Z A;  1KSP A;  3D67 A;  4NWB A;  5CAB A;  1PJ6 A;  2DNZ A;  3FEZ A;  5T7L A;  5AXL A;  2UUC F;  2OI2 A;  5M2U A;  1HW8 A;  2IDL A;  2ASD A;  1HQE A;  2QLF B;  5KFZ A;  3BQ2 A;  4A8Y A;  1WOP A;  4FYV B;  1Q82 T;  2W2N P;  3F73 A;  5I4M A;  2YWF A;  3HDS A;  3PX6 A;  3FUY A;  2YKQ A;  1HQE B;  3MR3 A;  4F36 A;  2M88 A;  4Q7A A;  1Y0H A;  2HIY A;  3H4B A;  4OV1 A;  4B3O A;  3GZ7 A;  2KM8 C;  1MLA A;  5CYQ A;  4DL5 A;  3T6J A;  5B0B A;  4B3O B;  1KFS A;  1UW4 A;  3V2U C;  1QTM A;  3NGT A;  4C3L A;  1KDN A;  5CYQ B;  1IQZ A;  5FII A;  4MJK A;  2E9T A;  3QMQ A;  5LXR A;  1WEX A;  3A3N B;  3JYT A;  5DZ6 A;  4LF1 A;  1X4H A;  3BPS P;  3BDP A;  5IQQ A;  3DGP A;  1RHJ B;  2NLW A;  2WVE A;  3GJQ B;  1WI6 A;  2ZUG A;  3JYT B;  3D6F B;  1IR1 A;  1KQK A;  3DGP B;  1WC3 A;  3PW2 A;  2OFG X;  2CG4 A;  4OQJ A;  3HXM A;  4EWT A;  4F0K A;  3GYN A;  2DH9 A;  2MJU A;  4UY8 T;  2JLG A;  1VJQ A;  2MQQ A;  2DCL A;  2Z8Q A;  3H2V E;  1SJQ A;  2B7B B;  1RAE B;  2E66 A;  1S9F A;  2LDI A;  4O3N A;  1FES A;  1UZD A;  2DXE A;  4Q45 A;  2EI5 A;  3FZB A;  1S10 A;  2J7W A;  5AXN A;  1JJC B;  2B6A A;  3OV7 A;  3NS6 A;  3I6P A;  4DV0 J;  2RML A;  2PEH A;  4F04 B;  4LRE A;  3GQC A;  1ARO P;  2B6A B;  2ZWP A;  1K0V A;  2KL8 A;  2IIH A;  4FYX B;  3AA8 A;  1HR0 F;  3LW5 C;  3MCS A;  1XNR F;  3PKM A;  2FPH X;  4X4N A;  4LF6 F;  3A3O B;  4OI2 A;  3OLA A;  2UVU A;  2DGW A;  1HWJ A;  4OYZ A;  5KFF A;  2E1C A;  4WP9 A;  2V6A A;  2HK3 A;  3SSR A;  5DLF A;  2OD6 A;  3IA0 A;  2N82 B;  1VMB A;  1SJ3 P;  2E5L F;  3DRY A;  4WII A;  2HQC A;  2ZH8 A;  1N52 B;  1NDC A;  4MK9 A;  1B64 A;  2C2D A;  1UVL A;  3DN9 A;  4NXM J;  1DQ9 A;  3PYF A;  2RU9 A;  2MZT A;  3HVW A;  3M7V A;  4QWE A;  5KT2 A;  2FZK B;  1RYS A;  2LEC A;  1J5O A;  1JQG A;  2NXE A;  2KI2 A;  3QRR A;  3VHQ A;  1EX8 A;  1RIS A;  3N01 A;  2W7A A;  2Y1L B;  1J5O B;  2YNG A;  3VZI A;  2XO7 A;  1CG2 A;  3G8S A;  3MOZ A;  1S12 A;  2CVE A;  4U96 A;  1PAE X;  5U47 A;  1WDT A;  3CD6 S;  4KB7 A;  3MXH P;  2YNG B;  4I1T A;  2XEX A;  3BZQ A;  1H73 A;  2ASY A;  4ECR A;  3LAM A;  3GV5 B;  5F41 A;  4BWM A;  2Y8Y A;  3W61 A;  4ECZ A;  3I4H X;  2QL7 B;  2V50 A;  3DC2 A;  3Q86 A;  1V9O A;  1SH0 A;  3G6X A;  4Z7C A;  1IN0 A;  3QSI A;  1O5J A;  1X9W A;  1GXU A;  4MKA A;  3SMZ A;  5DDO C;  4QWD A;  1BHN A;  5DG9 A;  3MCN A;  2RRA A;  5A2Q Y;  5MAO A;  2FZC B;  1VQY A;  1FX2 A;  4DV4 F;  4KH0 B;  2XQC A;  2CPX A;  3QWU A;  5H9F J;  5LXY A;  3RBD A;  5D0R A;  2ZOM A;  2DNG A;  4X66 J;  2EFQ A;  1NK0 A;  4NEY A;  4C8K A;  3TJ8 A;  5ETL A;  5I3Q A;  3UDL A;  2J8A A;  1FNO A;  2M7S A;  1LWX A;  5D8H B;  2BJ9 A;  5GAH U;  4ZLN A;  1Y00 A;  3UDE A;  2MST A;  1TKZ A;  1OPZ A;  2CKW A;  2JC0 A;  4DV7 F;  3PO5 A;  1S0O A;  3BRE A;  1BXN A;  2EG2 A;  2JFK A;  2PII A;  1DQA A;  4YQW A;  2ZDP A;  1TKZ B;  2CPD A;  2CPE A;  4PG8 A;  4A47 A;  2CPF A;  4NZ6 A;  4R5P A;  3EPG A;  2CNO B;  2QFJ A;  1W25 A;  3TX8 A;  3LP0 A;  4ANE A;  1P6T A;  3M6U A;  3TQ1 A;  4DWI A;  4HI2 A;  3BBF A;  1PJ5 A;  5M2R A;  2GHV C;  1SC3 B;  5L9N A;  4I2P A;  2H48 B;  4AFF A;  1FKA F;  1U24 A;  1IBK F;  4ECU A;  4I2P B;  3RYL A;  1UMJ A;  3THP A;  3EGV A;  2W2P P;  3G6E S;  1K73 T;  3O8W A;  1HNI A;  3JXO A;  2J6S A;  4WFX A;  3QO9 A;  3ZNJ 1;  3EPI A;  1HNI B;  2J6U A;  2H5E A;  2GFF A;  5E3R A;  2I38 A;  1EZZ B;  3QO9 B;  4DLE A;  4WXO A;  1U49 A;  2X1G A;  4C8N A;  4IG3 A;  1FDA A;  1L3S A;  2DIS A;  5JVG Q;  3UVJ B;  2HVE A;  3NWR A;  3KUE A;  3PFO A;  3SCI E;  1G6B A;  2XZT B;  4K4X A;  2BAB A;  4IG3 B;  3KNA A;  3ZO7 A;  3N0V A;  1DFD A;  1SV5 A;  1XQI A;  3D4J A;  1YRU A;  1GAO A;  4IYQ A;  2R7X A;  2MKJ A;  1JLB A;  3BGF A;  1N34 J;  2F9J A;  1SV5 B;  2Y0S D;  2XWX A;  3BGO P;  1N0V C;  1JLB B;  2LQ8 A;  1R27 B;  3FBF A;  4JI2 J;  1S0M A;  3AFG A;  2KRR A;  5IM0 A;  1YLX A;  2DNQ A;  4FXV A;  1CJK A;  4FNI A;  1RAH B;  2VOD A;  3KHG A;  2CQ2 A;  1UP1 A;  3IR7 B;  3DLL Q;  2IPO B;  5IM0 B;  2AJ1 A;  4TLR A;  4IR9 A;  1IWA A;  2DNP A;  2HWT A;  3EX7 B;  2ZH2 A;  1RA7 A;  2HHQ A;  4AYB D;  1P1T A;  1S7H A;  3ADA C;  3PHE A;  1QTN B;  4B3M J;  2OGU A;  2WBM A;  3FRZ A;  1SQE A;  1NDL A;  3GCX P;  3AT1 B;  2KTQ A;  5HMW A;  3G9C A;  4PCQ A;  3VAJ A;  4FZV A;  2HPU A;  2DR5 A;  2ZD1 B;  2UXD J;  3CD7 A;  3KHH A;  4Q43 A;  2FDN A;  3CD0 A;  2CG8 A;  2NUH A;  1U25 A;  4DBQ A;  1RYR A;  2UU9 J;  3H40 A;  1IM4 A;  4NEZ A;  2NS1 B;  2KG1 A;  2BQU A;  4AND A;  4DUY F;  2J8S A;  1X5O A;  1VRQ C;  3OL6 A;  3Q8V A;  1FE0 A;  2YX4 A;  4BC9 A;  4FF2 A;  3ZC4 A;  1S1X A;  1FCA A;  1APS A;  3NWG A;  1N32 J;  2BKO A;  3BO4 A;  3PG9 A;  3G2X A;  3LGN A;  1AW0 A;  2NXN A;  3N6N A;  1S1X B;  4PG5 A;  5JUM A;  4CYU A;  3W2W A;  2JL9 A;  2BRL A;  1JLE A;  4OFZ A;  1Y9O A;  5DM6 Q;  4LF4 F;  4NCB A;  1NJI T;  1NJZ A;  4CYU B;  4OJH A;  3W2W B;  2RUG A;  2RQC A;  2O5D A;  5EDW A;  1JLE B;  2ZC4 A;  4I69 A;  4RUC A;  2YWG A;  3DFE A;  3TO8 A;  1NSK L;  2VQF J;  5D0H A;  4ED0 A;  5DQH A;  4HHJ A;  1Q86 T;  1KVI A;  4F50 A;  1G7C B;  2VDI A;  3T5H A;  3RBZ A;  3B4D A;  2CQ3 A;  3VAI A;  4CLL A;  4JI6 F;  2J9D E;  1UJ4 A;  1KEK A;  3O6Q A;  2V2Q A;  4C11 A;  3X3U A;  5KFY A;  4B9L A;  1REV B;  4F4Z A;  2GGP A;  2RS2 A;  4K7Q A;  4NCA A;  4F7V A;  1R8B A;  1SIZ A;  4C11 B;  4LF5 J;  4UUX A;  2GGP B;  1HHT P;  2XNQ A;  4AUK A;  2CJX B;  1JK9 B;  2DR7 A;  4XDC A;  2VOO A;  2LEA A;  2R8I A;  1JXV A;  1K44 A;  3BGU A;  4B9N A;  3SV4 A;  3CJS A;  5L1L A;  2GNK A;  3TZX A;  1JWW A;  2YNF A;  5L9X A;  1BE4 A;  4OYM A;  4O3O A;  1RI7 A;  3K0J A;  2ZZM A;  1MNE A;  1BGX T;  4OYP A;  5A76 A;  2YNF B;  4CI0 B;  2H9Z A;  3KKF A;  1KFD A;  4JB8 B;  3FJ2 A;  3A12 A;  2G2Y A;  3BN4 A;  4J9V A;  3JS9 A;  1K1S A;  2B56 A;  2QFI A;  2XI2 A;  1WUU A;  1D09 B;  1FRK A;  1LXJ A;  5EWG A;  2P9C A;  2F3J A;  1KKH A;  4Q2M A;  4YY3 J;  3MEG A;  2ERR A;  3IR5 B;  5B0C A;  3HD1 A;  3CIZ A;  3WQP A;  5AXK A;  1QE1 A;  2HRU A;  2LQJ A;  3P45 B;  5F3Z A;  4IRC A;  3D2W A;  1YKW A;  3MEG B;  1H2T Z;  1DLO A;  3M6X A;  1HI8 A;  3MTK A;  3OHB A;  4B3T J;  1ELO A;  1QE1 B;  1RJJ A;  4DS4 A;  2ZH7 A;  1HI0 P;  4AL5 A;  1DLO B;  5RUB A;  4K5R A;  1HQU A;  2KU7 A;  1VIS A;  4DQQ A;  3VAG A;  1N56 A;  3UCG A;  4J90 A;  3ISN C;  2B8Q A;  4LQ9 A;  4OYI A;  4U9R A;  4HVZ A;  2JLF A;  1RUS A;  2QMU B;  4ECV A;  3PEJ A;  1OJ4 A;  4DR5 F;  1TL5 A;  1VQO S;  4J9M A;  3OTO J;  4OZ1 A;  3M32 A;  4YB5 A;  2AJQ A;  3M2U A;  1NZ8 A;  3K5L A;  1FK9 A;  2BXJ A;  3M32 B;  4DEZ A;  4O0I A;  3MAA B;  1B4S A;  3M2U B;  4TQR A;  1H6K X;  1FK9 B;  1FWK A;  4M94 A;  5F8J A;  4X84 A;  3UO0 A;  3H90 A;  1F1B B;  3L7O A;  1C4A A;  1N5Q A;  3KDO A;  1NKE A;  3G96 A;  3SYZ A;  3CXC R;  5KFN A;  4F4K A;  1XN9 A;  2FZG B;  4NAS A;  3R27 A;  3O44 A;  5C24 A;  2C2Z B;  5JVH Q;  3PX0 A;  4ZN3 A;  4YB7 A;  3L9Z A;  1IBL J;  4EZ9 A;  1FTR A;  5C24 B;  2HS0 A;  5LMN F;  4X62 J;  3PW0 A;  4IOA Q;  5DM7 Q;  2KFZ A;  1UEK A;  5D4P A;  3VVT A;  2DIV A;  4R8U A;  2WAQ D;  4OJG A;  4NYP A;  3A8K A;  4CLP A;  4MIA A;  1Q8B A;  2B7C B;  1A9N B;  4ZMM A;  3TZW A;  2CXE A;  4QPX A;  3LPE A;  1WDD A;  4R8U B;  3M8Y A;  3S7R A;  2GQQ A;  1WG1 A;  3IO1 A;  3OJS A;  1NBE B;  3MM9 A;  2LXI A;  2RQ4 A;  3IGV A;  2GO8 A;  3CDB A;  3SCK E;  1HLW A;  2ZJR Q;  4NLW A;  1VC5 A;  2HHH F;  2RNE A;  3MM9 B;  2G2O A;  5GME A;  4K4U A;  2UUT A;  4TNO A;  2J6T A;  4DN9 A;  3GP9 A;  4WFN Q;  4NLX A;  4OL8 A;  2RQK A;  4MKY A;  1NRK A;  4MFB A;  1BQN A;  4OX7 A;  2R7V A;  2B8P A;  1YDL A;  1DTQ A;  4D3G A;  4MFB B;  4AQY J;  1BQN B;  4DPY A;  1ZM3 A;  1VCT A;  2KXH A;  2ZH3 A;  1FDB A;  2V68 A;  4KRW A;  1DTQ B;  5HBM B;  5F8L A;  4I7F B;  5C25 A;  1MN7 A;  4IKA A;  1N6Q A;  4UOF A;  3WZ0 A;  2MSS A;  1PIL A;  4ZOS A;  1S97 A;  2V4Q A;  5C25 B;  1WWH A;  4AL7 A;  3TA1 A;  1N6Q B;  2AV5 A;  3DLG B;  3KFW X;  5MLC V;  1KHV A;  2OEL A;  3FSY A;  1NSQ A;  5B0D A;  4HT7 A;  1YSJ A;  3BYR A;  1UPM B;  4U67 Q;  4I6W A;  1NSP A;  1KVK A;  3X1L B;  2BRK A;  2DNO A;  2FIU A;  2Y1J A;  4QIW D;  2KRB A;  2QRR A;  2HBY B;  4OMF G;  4J9K A;  4PRF A;  2OPS A;  4C48 A;  4KFB A;  2ACY A;  2AF6 A;  2XMK A;  1MW7 A;  1WOO A;  1U2F A;  4USW A;  3CDU A;  2OPS B;  3H98 A;  3OSN A;  4KFB B;  1IJF B;  3HUL A;  4FF4 A;  4X4P A;  2CDR B;  3HKW A;  3CED A;  3CJR A;  4F3Q A;  3TR5 A;  1DZ5 A;  3CCS S;  3PYD A;  3FMW A;  1U26 A;  4ILM A;  3N6M A;  2A3J A;  4ER8 A;  3QIP A;  4GVB A;  4QR2 A;  3M6W A;  2DNM A;  2J0Q D;  4MKV A;  4JUZ A;  2IC3 B;  3QIP B;  1GT8 A;  3HFK A;  4GVB B;  2IBO A;  2O3D A;  1VS3 A;  1WF2 A;  2F40 A;  2OD4 A;  4NLV A;  4K0K F;  1DTT A;  4DDF A;  4ZJO A;  1Q0N A;  1UFW A;  4TQS A;  3FRY A;  3RRK A;  3MUV P;  1DTT B;  1T9W A;  3QPI A;  2DGX A;  2OFH X;  4FVC A;  1LV5 A;  3UI3 A;  3K5N A;  2V8G A;  1SJ4 P;  3HPO A;  2DXD A;  3BB5 A;  2LEB A;  2DTJ A;  2HQD A;  3CME S;  2Q6B A;  1O8B A;  2OEK A;  4IH6 A;  3EUN A;  5C2G A;  1OWX A;  4F0H A;  3FSX A;  4IRK A;  2PEB A;  5KT5 A;  4U7U K;  3FBE A;  3MMC A;  4UOH A;  2ROE A;  4CCH A;  1FJG J;  2VB6 A;  2HZC A;  3HHL D;  2VG7 A;  3HD2 A;  1JJH A;  5KG7 A;  2ZHB A;  2ACM A;  3IN5 A;  3MMC B;  1HA1 A;  2VG7 B;  3I56 S;  1TL7 B;  3CJK A;  8RUC A;  2QLB B;  4DXL A;  3GWC A;  3HHL A;  4H4O A;  1ACM B;  3CJK B;  2UUC J;  1RCO B;  3SFU A;  3ZZP A;  4USV A;  1L3V A;  1EP4 A;  2CWK A;  5F9L A;  4PWD A;  1VK3 A;  4YB1 P;  5B0F A;  1NHU A;  4QJV A;  3KLG A;  3BO3 A;  3HHL B;  4H4O B;  3CJ2 A;  5CD4 A;  2OTJ S;  2CQP A;  3BSC A;  1EP4 B;  2Z2Z A;  4PWD B;  3EDR B;  4CLT A;  2RH3 A;  1FJE B;  3KLG B;  3MD3 A;  4WFY A;  4ES1 A;  2QJ3 A;  1Y5N B;  3NL0 A;  1UVI A;  1UZH A;  4O3Q A;  4E8U A;  1UCN A;  4YME A;  2FLL A;  3FC9 A;  5HVH A;  4OLO A;  4K59 A;  2GIF A;  3RB6 A;  2HAI A;  3OFE A;  2EBG A;  3IM8 A;  1NPP A;  2YQ3 A;  3THV A;  2VD3 A;  3T1Y F;  3T1H F;  1T94 A;  2RSQ A;  5DGB A;  3TAN A;  2L9N A;  5GAD I;  3ILI A;  1M5S A;  2WB4 A;  3IGN A;  2ZE2 B;  2AGQ A;  1C4C A;  3AJD A;  1FF2 A;  3QZ7 A;  4P10 A;  4C98 A;  5KFT A;  1VQ9 S;  2BJ7 A;  3LUY A;  1UAW A;  1VLO A;  3WDO A;  4RJV A;  1UWA A;  2B0G A;  1DAX A;  2XM3 A;  3DDK A;  1I6J A;  2E9R X;  1RKJ A;  4PXE A;  4LRB A;  3TUP A;  3JSR A;  4MK7 A;  2CQC A;  2YKN A;  5HAN A;  4RPF A;  4RW6 A;  2DY1 A;  6AT1 B;  1U6B A;  1Q7L B;  1DQ8 A;  3CT9 A;  3A8E A;  2YBV A;  3PW7 A;  4LBI A;  5K14 A;  3JQM A;  2MKI A;  2E5J A;  4RW6 B;  3PYG A;  3CUL A;  2B9X A;  2JEI A;  1GX6 A;  1HR0 J;  2HQF A;  1FRJ A;  5K14 B;  2E7W A;  4LF6 J;  3PDN A;  3TI0 A;  2D1C A;  5HRO A;  1BUX A;  3GU0 A;  2FVQ A;  1TQL A;  1M5P C;  4R25 A;  3T19 A;  3C14 A;  4NLY A;  3IP0 A;  3D7S B;  3L4B C;  4A8K A;  5IC4 B;  1FJC A;  2LU2 A;  5HRO B;  2DD8 S;  5LSL A;  4P73 A;  2M4M A;  3C14 B;  2E5L J;  1RWV B;  1N5T A;  1VGY A;  2GCF A;  3BGR B;  4X64 F;  4TKT A;  4ZVO B;  1AB8 A;  3O2I A;  5BYR A;  5ETO A;  2HQ3 A;  5ETT A;  3G87 A;  2A18 A;  4H54 A;  2UUA F;  4DLG A;  1WSV A;  3WIU A;  1M90 T;  3D1O A;  3QGP A;  1JKH B;  3H5S A;  2PI5 A;  2VAS A;  3K8W A;  4LF7 J;  3PIO Q;  2XYP B;  4DPW A;  3WIV A;  5KFG A;  3QZ8 A;  2BOP A;  5A6P A;  4B3R F;  4OHY A;  1OY6 A;  1P27 B;  3BSO A;  4NLS A;  4TY8 A;  3DRR A;  2OPP A;  2EPI A;  2CAJ A;  1IR0 A;  4KKO A;  1JLA A;  3TAP A;  3EWG A;  3UPF A;  1VQ7 S;  2G4B A;  1RWM B;  3KK3 A;  4TY8 B;  2XS5 A;  4RBT A;  3QJJ A;  3DRR B;  2X1A A;  4DU7 A;  3KJQ B;  1KWM A;  3BQ0 A;  2NUU G;  4DUZ F;  2JEJ A;  2OPP B;  4OHV A;  4KKO B;  1FE4 A;  2IM0 A;  4RBU A;  1JLA B;  1VBK A;  1S7I A;  3C8Y A;  4DL0 C;  3CJ0 A;  5DDR C;  2IAJ A;  3KK3 B;  1RT3 A;  3B8H A;  2IRX A;  2VJV A;  1URN A;  4HTI A;  3GFY A;  1NK4 A;  2IAJ B;  3ZNU A;  3PR5 B;  3I9V 9;  1RT3 B;  2CPH A;  1FI4 A;  4ID5 A;  4EYH B;  4OYB A;  5EWE A;  1WEZ A;  4UUW A;  2BQ3 A;  1XTZ A;  1WHW A;  4ID5 B;  2HBZ B;  2HQI A;  3A8I A;  4DV1 F;  4LR9 A;  5CYM A;  2BZ2 A;  3ZZO A;  2KVQ E;  4OJ3 A;  1HD0 A;  1NK6 A;  2HYI B;  2WSC C;  3KG1 A;  3UR0 A;  5KFQ A;  1A0O B;  4ZPB A;  2WVC A;  4NLQ A;  5CYM B;  1GX5 A;  3ZZR A;  4LFB F;  2CJ9 A;  2UXB J;  2U1A A;  2YH0 A;  2UVW A;  4RNN A;  3CCE S;  4O0N A;  1UPP A;  2ROP A;  1N0U A;  4S0M A;  3PR4 A;  1UTA A;  1H72 C;  3VR1 A;  5D4N A;  1UA1 A;  3M30 A;  1IBM F;  3G8Q A;  3M6V A;  4Y2K A;  2MHN A;  2BJ1 A;  4QPT A;  2M5Y A;  3EXY A;  1ZM4 A;  1R3N A;  1RWW B;  5KFO A;  2BR0 A;  3M30 B;  4ILL A;  3IWN C;  2CJQ A;  2DGQ A;  1RWN B;  3PRV A;  5I3U A;  4DR2 F;  1IR2 A;  3RRG A;  4TVA B;  1N5S A;  1RT1 A;  4ECQ A;  2UUB F;  2GML A;  5KT6 A;  1RTH A;  2O01 C;  4KGV B;  5KG0 A;  4URQ U;  1UW9 A;  4O44 B;  1FHT A;  3MR2 A;  3K17 A;  1RTH B;  1HWI A;  1T11 A;  1ZPW X;  1LQ9 A;  3AOC A;  2GQ2 A;  1IBK J;  2HLT A;  1H7X A;  1SKS A;  1KLN A;  1S1T B;  1RT4 A;  2VON A;  4LF9 F;  4OI6 A;  3HI9 A;  1CJV A;  4G3I A;  2B4V A;  5EWF A;  2JEF A;  1Y5L B;  2AHO B;  3MDF A;  2VFR A;  1RT4 B;  3BKT A;  4W4M A;  2DNR A;  1DHM A;  1ZZN A;  1CJV B;  4J9Q A;  4KHM A;  3LGH A;  3W2V A;  2SXL A;  3AH6 A;  1FEE A;  3T9N A;  1KC8 T;  2HEK A;  2AZ1 A;  3W2V B;  2Z57 B;  4ED8 A;  5LMU F;  1QAX A;  4J37 A;  4LJM A;  1Y11 A;  2BOA A;  3VQT A;  3UD3 P;  2CPJ A;  3TX0 A;  4PPD A;  3UR3 C;  2HRT A;  1VQ4 S;  3GII A;  1YJ7 A;  1U1N A;  5DJB A;  4X4V A;  1MMN A;  1SL1 A;  3FCV A;  1ZET A;  2G0C A;  3MEC A;  2P6S A;  1D8Y A;  3G82 A;  2CFX A;  2D69 A;  2CWX A;  3H5U A;  2Q1L A;  2UZA A;  3DXS X;  3HVA A;  2HFZ A;  3MEC B;  5ETV A;  2VIH A;  1PG5 B;  5DS7 A;  3I5C A;  3G82 B;  2AJ2 A;  1RTD A;  2MQM A;  4H4M A;  3US5 A;  1NJY A;  1OPI A;  1WF1 A;  3FEY B;  3H25 A;  1OSD A;  3LA0 A;  1UA0 A;  4KGZ B;  4BC7 A;  4DN0 A;  3NGR A;  3M8R A;  4H4M B;  2Z2M A;  1U8W A;  1KP6 A;  1RBO B;  2FGO A;  2XTJ P;  2XHC A;  1GEH A;  2POK A;  3IXQ A;  2X1B A;  3BR9 A;  2NR0 A;  2OSQ A;  1KOO A;  1TKT A;  2HND A;  1RTI A;  1N88 A;  4DUY J;  3ZTQ A;  3MPW A;  4YUD A;  2MKH A;  1U1P A;  2R4F A;  5LOQ A;  1TKT B;  2HND B;  3D0I E;  1RWX B;  1UVN A;  4N47 A;  2XMA A;  4DUT A;  1U2C A;  2BEF A;  3CW2 C;  4IUF A;  3FZ2 A;  2AD9 A;  1JMT A;  4JV5 F;  1Q53 A;  3IBF B;  3PIP Q;  4FN5 A;  3N28 A;  2FVR A;  4UTG A;  4LF4 J;  1B99 A;  5KFJ A;  4NZ7 A;  3KYL A;  2ZJQ Q;  2VBX A;  2A6O A;  4DX8 H;  4OYW A;  1SC4 B;  1H38 A;  1AA1 B;  1BMQ B;  4CT9 A;  2OIH A;  4FS2 A;  3KJN B;  3JQK A;  4MYU A;  3FQL A;  3OTE A;  5CH7 B;  4GKJ F;  4ZCM A;  4FYY B;  5CD4 H;  3AOA A;  3NGS A;  5HVF A;  4L76 A;  3GSI A;  1H74 A;  3CJ8 A;  1YJN S;  3DHX A;  2LYV A;  1RKI A;  3TW0 A;  4KHR A;  4ELV A;  9ATC B;  1I3O B;  3DOK A;  2GHW A;  3BKU A;  3PX4 A;  4R0E A;  3R5G A;  2OP5 A;  1VHI A;  4UZB A;  3ISZ A;  3OJU A;  5KFK A;  2HNZ B;  3KG4 A;  3TRG A;  3GJS B;  3DOK B;  3TAQ A;  4K8R A;  1XMO F;  4EYI B;  1WC5 A;  1RHR B;  3G4S S;  3DKD A;  2G9O A;  1ZAW A;  1F2G A;  3TYT A;  3AOB A;  4OX9 F;  3M1V A;  5H1S V;  1Y5I B;  4I64 A;  2NXC A;  4CO5 A;  2IJF A;  2PMZ D;  2JOQ A;  3M1V B;  3CB4 A;  4P71 A;  1G4C A;  1I1G A;  2HG4 A;  2ZNY A;  5GAD U;  2VZ9 A;  1TVR A;  2DH8 A;  3G86 A;  2CPZ A;  2BQR A;  1RBA A;  2IJN A;  1T3N A;  1YJR A;  3HFZ B;  1H2V Z;  5HQM A;  1TVR B;  4USH A;  4ZIV A;  3HHD A;  2W9A A;  1SJF A;  5HP1 A;  2W24 A;  4JYA F;  1ZYQ A;  1AXQ A;  3MUT P;  5KG3 A;  2CJY B;  4ZVE A;  5HP1 B;  1VQK S;  3OUY A;  1AUS L;  1ZH5 A;  3LQV A;  4KQZ A;  1PKU A;  3CCT A;  3OUY B;  1RHM B;  1X4A A;  5KFD A;  5C7P A;  3QAU A;  3CPW R;  3D66 A;  3SEO A;  1X4C A;  2FLP A;  2K8G A;  1O6X A;  2VIC A;  1Q8I A;  1SL2 A;  3OXF A;  1PYO B;  3UNG C;  1SH2 A;  4ID8 A;  2APO A;  2HK2 A;  2MQP A;  4WXW A;  4YS2 A;  3NNA A;  3CWJ A;  8AT1 B;  2P9E A;  5CXT A;  1SKW A;  4K5S A;  3GYG A;  3QJP A;  1TUG B;  4DR5 J;  4WWS A;  2AJ4 A;  5DO2 A;  2DNL A;  1T9X A;  2R7O A;  3JAM Y;  2XY6 A;  3N5B A;  2FJA B;  3HX9 A;  2VJU A;  2YPZ A;  1K0T A;  3DLE A;  4ZP9 A;  2QGF B;  4P2S A;  5D0G A;  2B4P A;  4FBT A;  4WYL A;  3AB4 B;  2OJ3 A;  2BKN A;  2HAF A;  1FVQ A;  3DLE B;  5BYQ A;  3W9J A;  3JSB A;  2DHG A;  4USI A;  5KFI A;  4LF8 F;  1N33 F;  2AW0 A;  2L9D A;  1SCJ B;  4DX7 A;  1HKA A;  4ZVU B;  4EZ6 A;  3PYE A;  2HVZ A;  2RRN A;  2FJV A;  4HEA 9;  5B0G A;  2R8J A;  1G2E A;  1S48 A;  3UE2 A;  5GVQ A;  1HNZ F;  4DSL A;  2P8I A;  5E3A A;  1PSD A;  2E1P A;  5A0Y A;  2ASL A;  3OFG A;  2D3Z A;  1NK7 A;  2QMW A;  2VBY A;  2QSW A;  3P3D A;  5B7W A;  2RIJ A;  2YH1 A;  3ZZT A;  5A0Y B;  3D0H E;  2QZ8 A;  3A4T A;  1T05 A;  5KFX A;  3FDS A;  4KSE B;  1TMM A;  2MMY A;  2IJR A;  2UXC J;  3Q0A A;  4OYO A;  5ITH A;  3L95 X;  1SB6 A;  3HP6 A;  4OZJ A;  5E2Q A;  2P6T A;  4ED1 A;  2EC0 A;  1FD8 A;  2Z2L A;  5GAE I;  1JLF A;  2EVZ A;  2BA9 A;  4CLK A;  3JSM A;  2IMO A;  3GYX B;  2CQG A;  4HTJ A;  3D68 A;  3DLK A;  1JLF B;  5EN1 A;  2C28 A;  1VRU A;  5F9N A;  2H54 B;  1WOR A;  3JSM B;  2V5H G;  3HSJ A;  2DHA A;  2KT2 A;  3BSN A;  4G65 A;  3GMG A;  3W62 A;  1VLY A;  3DLK B;  4ENO A;  4O3R A;  4TLQ A;  1VRU B;  1KBR A;  2NPF A;  1P1L A;  1F60 B;  1JXE A;  2CPY A;  3SQO P;  2MKK A;  1XMQ J;  3PKY A;  1T7P A;  2GIR A;  2VA3 A;  2HGN A;  3C16 A;  4DPX A;  1Q16 B;  2D3U A;  2DY9 A;  3F0N A;  1H2U X;  4M5N A;  3TJA A;  2B4U A;  3I5B A;  1U45 A;  1RU1 A;  2C3M A;  1PYS B;  1M1K T;  4IR1 A;  4I2Q A;  5A2Q U;  2DR8 A;  3AXM A;  4P52 A;  2G0I A;  2JWN A;  5M2P A;  4RWW A;  1NLK L;  5JJB A;  3IS9 A;  2U2F A;  2RKI A;  3M4X A;  4I2Q B;  2B51 A;  5IV3 A;  3GV8 B;  4LFA F;  4QZV B;  2WW4 A;  1VJW A;  1NME B;  3IS9 B;  4QIG A;  5DET A;  1T02 A;  5H9F K;  3D1H A;  1BQM A;  3R7B B;  1WEY A;  3DYA B;  3E01 A;  1YRT A;  4WP3 A;  3D0G E;  1JX4 A;  4F26 A;  2NZC A;  2LLZ A;  4QIE A;  1BQM B;  4BHQ A;  2UUW A;  2W7P A;  1RLD A;  3E01 B;  4EI2 A;  5FD1 A;  3W60 A;  1QSY A;  5CCL A;  2DO4 A;  4QW8 A;  2XCP A;  3KK1 A;  1WSR A;  5E3Q A;  2HUR A;  2BBE A;  3NGD A;  3QFH A;  1CBK A;  5KFP A;  3KK1 B;  4NLG A;  2IBK A;  2BYC A;  2I0X A;  2UP1 A;  1QY7 A;  2VUG A;  5KG1 A;  2EBE A;  4IH7 A;  3RBE A;  3P6Y C;  1TEL A;  3U27 A;  1O51 A;  3GCW P;  3OQ2 A;  4PR6 A;  3M8S A;  1X60 A;  2PA3 A;  2QSF A;  4HAC A;  3CUN A;  2L9W A;  3KJF B;  3I31 A;  1JLC B;  3H4D A;  3V5R A;  4FXD A;  3TUZ C;  3QT5 A;  1DY3 A;  4WTO B;  4QWB A;  3A3P B;  4O3P A;  4LFC J;  4HAC B;  1TL3 A;  1CC7 A;  2VPW B;  2XLK A;  4DI6 A;  3QSY B;  4L6V 3;  2KXF A;  2JFD A;  3U1L A;  1TL3 B;  2ZHO A;  3LAL A;  1ZA1 B;  3KNG A;  2V9W A;  4Y65 A;  4URS A;  3W65 A;  2BDP A;  2ALY B;  2HGL A;  2FY8 A;  2ATL A;  4C7Q A;  2ZZT A;  1D9D A;  3BH7 B;  4PUO A;  2E1M C;  2OUG A;  4PZV A;  2D9P A;  2A10 A;  7FDR A;  1A6L A;  1FDD A;  2J9D A;  2EKY A;  2XB2 D;  3GJR B;  3K5P A;  3Q8Y A;  4PUO B;  5BXI A;  3ULH A;  4CIO A;  1Y4Z B;  1FXR A;  1SJ1 A;  1F5C A;  2D3O R;  4LVO P;  5HN0 A;  1X4G A;  4LR7 A;  3GIJ A;  4CP5 A;  5FDL A;  4FPI A;  3BGL A;  4DV2 F;  2GJ2 A;  4KE5 A;  4WF9 Q;  2A0F B;  3FBB A;  3VWS A;  4USM A;  1WJ9 A;  3HJF A;  3AQO A;  5FDL B;  2FQQ B;  1YI2 S;  5D4O A;  2OML A;  3AD9 C;  4MK8 A;  5KFU A;  5C42 B;  5F0W A;  3RRH A; 
#chains in the Genus database with same CATH homology
 1I3O B;  1I51 B;  2C1E B;  2H54 B;  3EDQ B;  1PAU B;  4ZVO B;  3QNW B;  1RWO B;  2XYH B;  3EDR B;  4ZVU B;  2H5I B;  1RWK B;  1RWX B;  2QLJ B;  1RHM B;  1QTN B;  2QL5 B;  2C2K B;  3GJT B;  3GJS B;  2CDR B;  1RHJ B;  3RJM B;  3GJQ B;  4ZVQ B;  2Y0B B;  1RHR B;  4ZVS B;  2HBZ B;  3D6M B;  4DCP B;  4ZVP B;  2H4Y B;  3D6F B;  4JB8 B;  1F9E B;  1SC1 B;  2QL7 B;  1PYO B;  2C2M B;  4LSZ B;  2CNN B;  2XYP B;  3IBF B;  2XZD B;  2H4W B;  3SIP B;  1RHK B;  5IC6 B;  2QLF B;  2C2O B;  2QL9 B;  1RE1 B;  2DKO B;  2CNK B;  2XZT B;  3GJR B;  3IBC B;  3R5J B;  2CNO B;  3R7N B;  2H51 B;  1IBC B;  4ZVR B;  5K20 B;  1SC4 B;  3R6G B;  3R6L B;  1BMQ B;  1RHU B;  2HBQ B;  3KJN B;  4ZVT B;  2QLB B;  2XYG B;  1QDU B;  3P45 B;  4DCJ B;  1SC3 B;  2H5J B;  2P2C B;  1RWM B;  3D6H B;  1RHQ B;  5IC4 B;  2H48 B;  3KJQ B;  2HBR B;  2CJX B;  1NME B;  1RWW B;  3NS7 B;  3P4U B;  2CNL B;  2FQQ B;  1GFW B;  1ICE B;  3KJF B;  2HBY B;  1RWN B;  2Y1L B;  2CJY B;  1RWV B;  2H65 B;  3R7B B;  3R7S B;  2C2Z B;  1RWP B;  4DCO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...