3R7BB

Caspase-2 bound to one copy of ac-dvad-cho
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
95
Chain Sequence
KMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGFHRCKEMSEYCSTLCRHLYLFPGHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-2 subunit p18
publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 95
sequence length 97
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3r7bB00
1NMEB 2CNOB 3D6FB 2CNLB 2H48B 2H4WB 1RWPB 3R7NB 5IC4B 3D6HB 3GJTB 4ZVOB 3D6MB 2C2MB 2H5IB 2QL9B 2CJXB 2CDRB 3R7SB 2QLJB 1PYOB 1RE1B 3IBFB 3R7BB 3QNWB 2QLFB 1SC1B 2C2KB 2XZDB 3SIPB 3IBCB 3RJMB 3GJRB 2Y1LB 1RWOB 1SC3B 4DCOB 1QTNB 4ZVSB 2C2ZB 1PAUB 3KJFB 2HBZB 2HBRB 2P2CB 2XYPB 2C2OB 2H54B 3GJQB 1I3OB 2CNNB 2DKOB 1RHQB 2C1EB 2QL5B 2H4YB 3R6LB 3P45B 4ZVPB 2XYGB 2Y0BB 4JB8B 4DCJB 4ZVQB 1RWKB 1RWWB 1ICEB 3NS7B 3R6GB 3EDRB 4ZVTB 1BMQB 1RHJB 4DCPB 4LSZB 2HBYB 4ZVUB 2QL7B 1IBCB 1GFWB 2CNKB 1RHMB 3KJQB 2XZTB 3KJNB 1RHKB 2HBQB 2H51B 1I51B 3EDQB 2H65B 1F9EB 5K20B 2H5JB 1RWVB 3P4UB 1QDUB 1SC4B 1RHRB 2QLBB 1RWXB 1RWNB 1RWMB 3R5JB 2CJYB 3GJSB 1RHUB 2XYHB 4ZVRB 2FQQB 5IC6B
chains in the Genus database with same CATH superfamily
1XTZA 1IKYA 3HCXA 2PT0A 2G1DA 2J6UA 2BJDA 2BJ8A 2CDRB 2WSFC 4IDKB 3EE3A 5KFVA 3ELHA 4MYTA 1CSJA 2NCKL 2KL8A 2ROPA 2YNFA 3BH7B 3EVWA 4DR5J 5J2NB 4ZPBA 3CTRA 3IWXA 4ZP6A 3HZGA 5J2PB 2G1HA 1R27B 3TEHB 1ZM9A 4IYQA 1VQKS 9RUBA 2HBZB 1NKCA 4U8VA 3QJJA 1C4CA 3UDVA 4QIGA 1T3NA 1RT3A 3RW6A 2MKCA 4RUBA 2ZVIA 1X8DA 1N32J 4TKTA 3KG4A 3DRRB 2MQNA 1FDBA 2YX7A 2V4JB 1JWWA 2OGUA 2JHEA 1FK9B 1OSCA 4WP3A 4LIRA 4WFNQ 4AQYF 3ZO7A 1E6VA 3UWTA 4IFVA 2DRBA 4IO1A 5C7PA 4LF9J 2GIRA 2PC6A 5ETSA 5KFHA 3SYZA 5KFDA 4U67Q 1T3OA 4OYMA 3AOAA 3AHPA 5HL7Q 4NL5A 3ZNUA 4ZVOB 1JJ4A 1K1QA 2X1BA 5CHCB 2W1BA 2ZWOA 4K4SA 2NPFA 2VH7A 3D9BA 4ZK7M 3PW7A 3CWJA 3BJYA 3U1NA 2NUUG 4FVMA 2CPDA 4RU2A 4WE1B 2Y1JA 1HHQA 1RU2A 5A2QY 2YNGA 2J0QD 3E51A 1SKUB 2BOAA 3E01B 4P71A 4ZVFA 4FN5A 3MMAB 2MQOA 2NPIA 2IJRA 1ZM2A 3PYGA 1I6JA 4JV5J 5IZHA 4RUCA 2HHTA 1EHWA 2HHHJ 4NZ7A 2WONA 1NNDA 4LF6F 3H2LA 3KJQB 4WXOA 3KJNB 4ETXA 3ZZRA 3CNQP 4WFAQ 4LRBA 2AEJA 1FESA 3GONA 1LXJA 4OJ1A 4H54A 4MIBA 4CO4A 3PRDA 3LALA 5I42A 1NU4A 2MY7A 3DLBA 4W98A 2HSEB 3VAJA 1VK3A 2UXDJ 1UCNA 4OYOA 3KLFA 3BSAA 2N4DA 1RT1B 1BQNA 3BB5A 4PG8A 1BWEA 3GR0A 2LEPA 1LWCB 3DOLB 3EM1A 1RWOB 2I5JA 1LNQA 1T03A 2ZM6J 4AD6A 4RW4A 4EWTA 3HHEA 1VCTA 2C42A 3KLEB 4PR6A 3RBDA 2MZTA 1IBKJ 3M2RA 4PKDB 2DXFA 2AYGA 4NXMJ 4UQGA 4DR6F 3GZ7A 2PGCA 4IKAA 2HVEA 1N5TA 2DRDA 2BABA 1ZH5A 2MYFA 1AROP 1S59A 2Z2YB 2JEIA 3FDSA 2RQKA 2OMLA 5DDOC 2HHSA 1GNKA 3AD8C 5K20B 1RHRB 5IM0A 2QEXS 4V19X 1R0BG 4EZ9A 2RE1A 3DXSX 4RJVA 3MCOA 4OX6A 4OIXA 1LOUA 4F2SA 4DPXA 5LSLA 2AU0A 3TA0A 3V6DB 1DTTB 2V9WA 1OYDA 4RNNA 3V4IA 2OAUA 2PEHA 4R5PB 1OPIA 3I4PA 4J9UE 3HSGA 3I4HX 1LW0A 1SC3B 4ZJLA 1KFDA 1I94F 4PXCA 3B8HA 1ZYQA 5J2QB 1QY7A 3D0GE 1HI1A 4ZLLA 2BJ7A 1RLCL 2J76E 4WXWA 4DSLA 1N5QA 2BACA 1HFEL 4LFCJ 1FT8A 1S97A 3TAMA 3A3OB 1WD6A 1NXIA 2GJFA 1VI7A 1C1CA 2FY1A 2APOA 3JSRA 3D3BJ 4NEZA 6FDRA 2DJWA 2F9JA 1MLAA 3P5TL 1BGXT 1SC4B 1D8YA 4GRSA 3QBCA 1X4CA 1V3SA 1Y10A 2FLLA 1XMQJ 1X4GA 2IVFB 1AFJA 2EKYA 1U47A 3M8YA 4OYPA 2M8DB 3O3LA 2H1YA 2CVEA 2J0XA 4LVNP 1VQOS 1VK8A 2E9TA 3ET6B 1B99A 3PNIA 2W9CB 1V5IB 3MEEA 3R27A 2WVBA 1HNIB 1YIJS 3KJFB 4X4OA 4HACB 4AE5A 5KFFA 3OLBA 2UVUA 3D1OA 1SPBP 4G1QA 1Y5NB 4KE5A 2DK2A 1BUXA 3VGTA 2RS2A 2YKQA 4PEOA 3UN5A 2CG8A 4GVBA 3BGOP 1YJNS 2AJ4A 3C46A 1UAWA 4CLSA 4EGLA 1T05A 3BYPA 2V8VA 2MKIA 1HARA 1LQ9A 2ZOFA 3PR5B 4F3OA 4ZPWR 2OUGA 3TA1A 1VJWA 3TNVA 3C6UA 1DJ0A 3CCQS 1SL2A 3DOMA 4C98A 3G96A 3UN3A 3VAFA 4R8UB 2GVZB 8AT1B 3C14A 1NSQA 3EZOA 4JUZA 4ZN3A 1K47A 5HAOA 1L3SA 4DZ6A 3MOJB 5T14A 4NLUA 5CZVA 4JOUA 5A8WA 3PW0A 2G2ZA 2AZ1A 4DFPA 5KG5A 5BYSA 2IPOB 3EUNA 1IBMF 4LUBA 1QAIA 1FRMA 4ZIVA 4B9MA 2DEJA 1NAQA 5RUBA 1Y5LB 3UD3P 2QA2A 3G4SS 1F2GA 1RBAA 2WAQD 3PTWA 2E66A 1TL3A 2JLEA 1EAYC 4K5SA 4V19J 2CQ1A 3VVTA 2C3MA 1CJUB 5KFPA 4FS2A 2LMIA 2W01A 2OPPA 1NPRA 1U48A 4KFBA 4A48A 4ZLJA 2GGPA 4B9TA 2ZH1A 2JC0A 1F3FA 1CJKB 3KNGA 1HBNA 4YHHF 1H38A 2CA9A 2P6SA 4KIAA 1NPKA 3R5GA 3GIIA 2NUHA 2B7BB 2QMWA 1K73T 1JLAA 1WOOA 2WW4A 3M8ZA 3UNGC 2AYBA 2CQPA 2V8GA 2VG7A 3JSBA 1C0TB 2J9DA 1FTCA 5G0RA 2L9NA 4EBDA 3LQVA 3SDEB 2UUBJ 2J8AA 2DNYA 3NL0A 2G0IA 4B9UA 5DZ7A 2VB6A 2AEMA 3NMAA 4LT6A 1S0OA 3OVAA 1TL1B 1R89A 2YNIB 1BQXA 1UP1A 3VZHA 3BSOA 2ZE2A 4CTAB 4DX5A 3OL8A 1P27B 1JMTA 4K5RA 5JXSA 3MUVP 1AUSL 5E5NA 2DNQA 3NRBA 3KUGA 1R6YA 2I1RA 2W2OP 2HBQB 2DR5A 1U1RA 4DU8A 1REGX 1SH3A 5B09A 1KVIA 3AQOA 3PXGa 2MLZA 1OO0B 2P9EA 3GLJA 4HKQA 1RT7A 3MR2A 4KGXB 4F3QA 3QGGA 5DLGA 5B08A 2V69A 1VRUB 3ILJA 2AW0A 3PJWA 1NPPA 2DH7A 1X4HA 3QZ7A 2DNMA 2DH9A 1T9YA 1FJ7A 3T41A 4Q44A 1Y7PA 2XB2D 4CH0S 4HDGA 4KH0B 2DGVA 1GK8A 3KLIB 4F02A 3OL6A 1N5YA 4JI4F 1WC1A 3H0PA 2FJDB 3QT7A 2OP5A 4OI4A 1KNZA 3BPDA 3H20A 1TL5A 4DR2J 2UV8A 2IRYA 4M1KA 2WVDA 4P7VA 4ZVQB 2LA4A 2AJ0A 4N56A 4FBUA 3JAMU 4ZVHA 4F50A 1U1NA 2DEIA 4WYLA 2CNKB 1RABB 5K8MA 1ZAVA 3OUYB 2ZH2A 4JI3F 4LF5F 1H0HB 4DL5A 3I6PA 1FKPA 4EBEA 2XMWA 3RAXA 4UW2A 5DZ6A 1Y11A 4CYUB 1M1HA 5AXNA 3QWUA 5IWAF 3PO4A 2EWHA 2Z2LA 3UFCX 4DR7J 4NXNF 4IG3B 3T1AA 4X4QA 2B5JA 5E3AA 2JEGA 1U6FA 3A1YG 4OI6A 1EQMA 2QA4G 1U1QA 2V67A 2V8DA 1PBAA 2RSQA 5DQHA 1CPZA 3M32B 1IXKA 1Q16B 2HGMA 3AT1B 1RT4A 1YVFA 2U2FA 2XI2A 2RRAA 5I3UA 2BE2A 1WKKA 5D3GA 5C24A 2XSJA 3NWRA 1KLMA 3UR0A 2BRLA 4ILRA 3DGPB 3DM2B 4Z2XA 2RUGA 1UFLA 4IQMA 1HQ2A 4LF7F 3SV4A 6FD1A 4M5LA 1AA1B 4USIA 5A0YA 5KG6A 3Q22A 5IV3A 5HP1B 5E3QA 2YWEA 1TKXB 3EX7B 2R2RA 4FZVA 3TVZA 4B3MJ 5LSOA 2G0CA 4KGKA 3T5HA 1EP4B 4ENOA 2YKNA 1NBEB 1F0XA 3HHLC 1HYSB 4TU7A 2Y8WA 4JI1F 4ZPDA 1H74A 1L3TA 2M5YA 1S1XB 1S1UB 4ES3A 3EPIA 5F0UA 1VC6A 3M8QB 2YNHB 4DV5J 2VASA 2RF2A 2FVCA 3I0SB 5FLXY 3MCMA 2FZCB 3VAGA 2LEBA 3ISZA 1ZPVA 5KFJA 5A8RA 2ZC3A 2IJNA 4FNIA 3PRBA 4IOCQ 1JJCB 3SV3A 2DGXA 4J9QA 3OT9A 5B0CA 3RB6A 1B0PA 5ETRA 4I68A 2ZJQQ 1CQMA 3VZIA 2H5EA 3K17A 2MLXA 1XBWA 5EWFA 2BRKA 5EWGA 1VFJA 4I2PA 1T9VA 1BMQB 5F8HA 2EC0A 2EG2A 4UY8T 1D09B 1N33J 4WTOB 1Q78A 3OL7A 1WKLA 2HURA 1JLBA 4C8MA 1T9XA 4A46A 4IG0A 4QIEA 1RWXB 2CJYB 2DHGA 3T5KA 4CLPA 1TVRA 4JI2J 2GFFA 1GXUA 4J37A 4JI0F 1TAUA 3FBCA 2NLWA 2EFOA 2VF3A 4LQ9A 3AAWB 3TUIC 1HR0F 2AMCB 4B3TF 2HIQA 3M6VA 3R5CA 1JLQA 2GVDA 2LXUA 3J7YI 3DNCA 3OR2B 4KO0A 1ZPWX 2AJ1A 4NLDA 2OI2A 4O44A 1PC4A 1DQ9A 2QMUB 3QFWA 2H54B 1XNRJ 3H7HB 2FD2A 1I1GA 1V5VA 2VQEJ 3MMBB 3HMJG 3NS6A 4QW8A 4NLSA 3UVJA 4LF8J 3JS9A 1M1KT 3GE9A 4FPIA 4CQ1A 1Q5YA 4LFBF 1IR0A 5KFAA 1GT8A 7FD1A 1B3TA 4OZ2A 2RNEA 2CQCA 1RGVA 4DUYF 4WBFA 1N36F 1MWZA 4NASA 3I0RA 3T9ZA 4F26A 2FJWA 3HVTA 2BR0A 2Z0GA 3RAQA 2EBEA 3KHGA 3A8IA 4UUXA 1N34F 4OZ1A 1KONA 1FEEA 1VQ7S 1C0UA 4J91A 2C22A 3IWNC 1HBUA 5KG7A 1PJ7A 5I3PA 1N0UA 4GO7X 2VZ9A 2KO1A 4TYBA 4F0MA 1F9HA 2RD5C 3D3CJ 3FUYA 5KFNA 2L9WA 1RT6A 2UVRA 2KYZA 1FRKA 2OFGX 1ZTTA 4Q43A 2LEAA 5ETTA 1C1BA 2M8HA 2EFQA 3J7Z5 2IDLA 2ABYA 1CJVB 3FK4A 5L9NA 3CCZA 2DHSA 3J80Y 2JRSA 1HPZA 3FEYB 4WU2A 4Y00A 3ZZPA 3UI3A 1WHWA 5KFRA 5L46A 3DLKB 4UOFA 1SKWA 1SKRA 1U7LA 2I8EA 2U1AA 5FDLB 1SL1A 4ZPCA 1AUDA 1JIHA 2VG6B 4GMKA 1CS4B 1NJXA 4ECYA 2VC1A 4ED3A 4MTPA 4C8ZA 2KYXA 4QWCA 1JLCA 3TRGA 4NLXA 1FRJA 2CYYA 3MM5B 2IJFA 4OJ3A 3G2XA 2AHOB 3IFEA 2R7RA 5A2QU 1TZ0A 4QIVA 2YQ0A 2MQ8A 4D3GA 4Y2AA 4GKKF 4MFBB 3MZIA 3MM9B 4ED7A 1NK4A 2R8KA 1HWLA 4DSIA 1Q86T 2XEXA 2MKJA 2R2UA 2A18A 2EW9A 4B3OB 4CH7A 2W9BA 3QQCD 5G4DA 3VAHA 2CFXA 4CM0A 5DQGA 1RQ0A 2XCPA 3T6JA 4G1IA 1LW2A 2CPJA 1NKBA 3ZZTA 3MEGB 2PI5A 3DMJA 4ECUA 1NO8A 3EDQB 1KQKA 1R43A 4DX7A 1LWEA 3MR3A 1RWNB 1NK9A 2JJ4D 2FQQB 3CCLS 4RBTA 1NK6A 4K4YA 2P5VA 3D5MA 5L38A 3GCWP 1KLNA 4DQSA 2RKIB 2QT7A 1JXEA 4DV3J 1NSKL 4P73A 4U7UD 3R7BB 3MI7X 1WF0A 2ZH5A 1MMNA 2MKSA 2YKOA 1VC0A 1HA1A 3CB4A 1FXDA 1TQLA 5K8NA 3GJQB 4K4VA 4WCEQ 4DN0A 2RU3A 2XBPA 3CJ2A 3LGMA 3M4XA 2CADA 2XYGB 3QRQA 3W8PA 3OTOJ 2JZ5A 1PAEX 5HBMA 1FXLA 4RW7B 2YKAA 4WTYA 1S1WB 4MT1A 2NXJA 3UO0A 3KG1A 3BKFA 2ZUGA 2IDEA 3O5TB 5HMXA 1RWMB 3QIPB 4YP3A 4Z7CA 1HMVA 3NKYA 3HO1A 3PW4A 1JLFB 2CRLA 3C16A 2RT3A 4E8UA 2IM2A 4DL4A 1RUSA 3LA0A 2F7VA 2J0SD 1OY6A 2VU5A 3VGSA 1VLOA 4ZPVR 1YITS 5GADU 1XMOJ 2N3LA 3M9OB 2CXEA 1S4FA 2XG8A 2AF6A 3MCNA 3M9NB 4CM2A 3I9V9 2DKOB 2QSWA 3GP9A 2OKQA 1U2FA 2O67A 4E98A 2ILYA 4U8YA 2O1PA 2M9KA 4CO5A 3M2VA 2H65B 2AJQA 4OX7A 1RYSA 3N4WA 3RR7A 5BJRA 4J7CA 4D3HA 3TUPA 4A8SA 1Q8IA 1FCAA 3A8EA 3PG9A 4USTA 3P6YC 2HMIA 4J9SA 1IUJA 3B78A 4GVLA 4X4PA 1RBLA 2CPHA 2D3UA 2GA7A 2WBMA 4ILMA 4C11A 3VQTA 3I5AA 1SIWB 2V2QA 2B8QA 4BHQA 2IMWP 2PA3A 2P9CA 2BKPA 1ACMB 2FJBB 5CYJA 1VIOA 2HWIA 3L3CA 2R7WA 4OHYA 4OZ3A 3MMJA 5H9FJ 1NHKL 1R8CA 2UU9F 1S12A 5GAGU 2EI5A 1FFGB 4XIUA 4EEYA 3BREA 2YNFB 2EXUA 3I82A 2BXJA 3NOCA 4DV6F 2J7UA 5T41A 3GFYA 1KQSR 1XN9A 3BS9A 4OI2A 2BOPA 2CNOB 1GXLA 2VODA 1ELOA 4TU8A 1DZ5A 3K8VA 2ILZA 5KFKA 1RT3B 1NHVA 3NAIA 4DQRA 2DXDA 4C97A 4LIWA 2QV6A 3ICLA 4JI6J 1HNZF 3HSZA 2Z2MA 1H2UX 3PW2A 2PMHA 4ALZA 3MECB 2L9DA 3E2EA 1D8ZA 2HBRB 1X4EA 5A6PA 1E6VB 2QGFB 3R97A 1OIAA 4IFVB 1PYSB 1JB0C 2DBBA 4LFAF 5GAEU 4YR3A 5DDQC 2N82B 1FO1A 4KYZA 2BMBA 4K2JA 4C3MA 1TL4A 4LF7J 1GFWB 5DGAA 2Y0SD 2M52A 1S99A 3OJUA 2B56A 2MKYA 5D0HA 3SQGB 3R9LA 2VBXA 3NGRA 1HNVA 4K50A 4WU3A 2OFHX 3CULA 5LMNJ 1VDHA 2VQFF 2ZJRQ 2ROGA 1R7IA 2ZHAA 1U1OA 2E5JA 4OHXA 3SFUA 5HI7A 5KOXA 4ZJQA 1S48A 1VQ9S 3NOGA 2DCLA 3PYEA 1PYTA 1UA1A 3V2UC 1EARA 3GYGA 2HAFA 1WF2A 5AE3A 4ERDA 2RHSB 2GHPA 3LP0A 1SC6A 3TA2A 4X62J 2WONB 3V6KA 4IRKA 3QIDA 2JFDA 1WSRA 3AY0A 2ACYA 1X7VA 2NSBA 4Y65A 4OJHA 1WEZA 2PA8D 4PPZA 1IQTA 1TKDA 4ETZA 1NDCA 1FXRA 5I42B 2IBOA 3FC9A 2UUWA 3Q8VA 1QAJA 2E1MC 2VFRA 4X66F 1PIEA 1SJFA 1CEZA 4L72B 3ENWA 1WOPA 1HNXJ 1SQFA 3ZZYA 5E3RA 2XNQA 3UN2A 3KLFB 4Q8EA 2HBYB 3IR5B 1UEUA 2EG1A 4L74A 1N6QA 3D0IE 4EU0A 1BQNB 4O3RA 4WFYA 4OYWA 2DHXA 2CQ4A 4X4SA 4PYAA 2DGUA 3BQ1A 2I5JB 3KLHB 3Q8RB 1H2TZ 4IH7A 2KFYA 2A6OA 3KFWX 3NP5A 3D67A 3IAS9 3M2RB 4NA2A 3VCDA 1D0EA 4DPUA 1Q82T 1HBOB 4FKYA 2LP4A 2QLFB 4J9RA 1A9NB 2O3DA 3W1YC 1S79A 5DS7A 2UVVA 2BZ2A 3MCSA 1UPMB 1VQLS 1QM9A 4L75A 2DXEA 4PG6A 1ZAWA 2GAGC 4RW6B 5IM0B 4RWXA 2DIVA 3R5DA 4PXEA 4JI8J 2AQ4A 3D68A 1G7CB 3C2PA 2WB4A 3ISNC 5CABA 4S0MA 4Q8FA 2C3UA 4YB5A 4B9NA 2HHXA 1WC5A 4B9LA 5KFMA 4A8XA 2BX6A 3V4IB 4C7QA 2DR9A 5JMNA 5C25A 1RA6A 4DR5F 2QLBB 4JV2A 1ZA2B 2E9ZA 3W2VA 4L73A 3BPSP 1BXNA 5IC6B 2BE9B 2HQDA 4BCAA 1R31A 1P9YA 3Q2TC 3I9ZA 1RTDA 3UCZP 4XPCA 4G6VB 4NPOA 1JLGA 2DT9A 3EYZA 1JNRB 3AJ2A 3HVAA 2HEKA 2I2YA 1S1TA 4KV8B 2ZH9A 3MR5A 1N32F 3FEZA 2MJUA 3TAMB 3FZBA 4ECXA 4JI5J 3CO0P 4NI2A 2LQJA 1C1CB 1ZBTA 3UDEA 4EMDA 3AB2B 5IT9Y 2KM8B 2DITA 2PEBA 2FY8A 1RT5A 4KKOA 1PGZA 3FGVA 5SUHA 4A4JA 1QUVA 7FDRA 4J9MA 4ILLA 3TZXA 2MB0B 3M30A 2DY9A 1OY8A 3RG6A 3MD3A 4LF9F 2RDJA 3JXOA 3CCSS 1KWMA 1IKXA 3UD4P 4LSNA 3DKDA 2YPYA 3Q8UA 3W2WB 4P2SA 3HD1A 1DY3A 4NLPA 2PMZD 4O3QA 1Q8LA 1S0VA 4MIAA 2G13A 2DNGA 1RAGB 4DR1F 3N6LA 1QE1B 2AV5A 4R25A 5CD4A 2JFKA 1XR7A 3DLHA 3PEJA 3OL9A 4G1QB 3EVOA 1X9MA 2ZZMA 2CJXB 4FNHA 4FYXB 1JQGA 4Q0BA 3J81U 4GVBB 1R8BA 2GZOA 2EFPA 4OFZA 4KGMA 2Q1LA 5HQ8A 3JQMA 3KKFA 4JV5F 5DJBA 1RKIA 2BEFA 3TO8A 4ZKAA 4Q2LA 3P96A 1T05B 4OL8A 4DJBA 2HHHF 3RU0A 2KXHA 4KTQA 4K2XA 4MKVA 3NLCA 2R2TA 4C4WA 2CNNB 3L95X 4KPCA 4DX8H 2DPJA 2PE8A 4UUWA 2WBRA 3CDUA 2YWWA 4NCAA 4NZ0A 1GX5A 1D9AA 3C14B 4Y2MA 3HSJA 1JJ2R 3H5XA 1OY9A 1WELA 3RB0A 1G3OA 2OPRA 5H9FK 2HAIA 5CCMA 3POTB 5A8WB 2AX1A 3I32A 5CZXA 4U6PA 1WTBA 4MJKA 2KU7A 3THTA 2POKA 1S10A 2HHVA 2K1RA 2O01C 5AJ3J 5K14A 4I0WA 2H4WB 5J1EB 3QLHB 3R7NB 2NS1B 2ZM6F 1T9WA 1J27A 3K7RA 2XM3A 4NRTA 2HHPA 3HHDA 4IO9Q 3W9JA 4F4XA 1IBKF 1M0SA 3NWGA 3W5ZA 5CAAA 4FXWA 4NXMF 5DO2A 1JX4A 3EGWB 1DQAA 2GIQA 8RUCA 2HKEA 3LWLA 2EFGA 4ZCMA 4NZ6A 2OPPB 1GTHA 4LRFA 2MZSA 4KFBB 4UOGA 3IM8A 1R0AA 2GGPB 2AP6A 2R7TA 3BGLA 4XAKA 4J5OA 1JJHA 1FVSA 4JB8B 1NJZA 1P9QC 3U7JA 2E9RX 3F73A 1MG7A 2LA6A 4IDKA 2D3O1 1JLAB 3LO3A 1HI8A 3ZZUA 4NLOA 5J2NA 1RAAB 2XWXA 1RHUB 2J6TA 2HVDA 2LQBA 2VUGA 5M2UA 2AT1B 4CLLA 2DB1A 3MF5A 4OI3A 1VQPS 2ZEJA 1UVMA 2IAJB 1X5PA 3G9CA 3W5YA 2ZE2B 5B0EA 4LFCF 3M8PB 2R8HA 3JSMA 1R8AA 4YFUA 3UPFA 4DLEA 2W7PA 4CDIA 3TOQA 4X4UA 5HMZA 1U6BA 5C5JA 2A2CA 5L9XA 4P6QA 1ZZFA 1Y3JA 3C66A 4LBPA 4IH6A 2VIHA 2C2DA 2C28A 4HHHA 1UJ4A 1XMQF 1U02A 3KXDA 5A8KB 5D8HB 2UUCJ 1RHJB 4C0HA 3CD6S 1IKWA 4DQPA 1YTYA 1I51B 3CIZA 1N56A 3BO3A 4Y6IA 4Y0FA 4IUFA 2ZDOA 3GJSB 3G6ES 2RH3A 5F8GA 4HVZA 1JK9B 1C2PA 2VBWA 2BKOA 5HSPA 3SSRA 4Y34A 2YTCA 2AX0A 4QIWD 4NMXA 1KOOA 5GAHU 1N5YB 1WHYA 5C2CA 5C42A 5A76A 3MMAA 1FF2A 2JX2A 1YRUA 2YWFA 4PG5A 2HQIA 4IOAQ 2Q6BA 2HQFA 2VPZB 2HZAA 3DDNA 3AD9C 2ZH7A 3WBZA 1PAUB 5LMUJ 3OQ2A 2N7CA 4RNFA 2V94A 4I7FB 2MZRA 2HRUA 2C2OB 2JEFA 1RTJA 3PYDA 3M6WA 1IJEB 4UY85 5L1IA 3R6LB 4LMZA 1WORA 2I6WA 3GYXB 7AT1B 1WKJA 1N4LA 4NCBA 4LF4J 5F0WA 2FHKA 1X5TA 4N76A 5IQQA 3J7A1 4ED4A 1XMBA 2W7AA 3VHQA 3V81A 3DRPA 3PRVA 1FI4A 1JKHA 1QDUB 5J1NA 1HW9A 2H3EB 1LWCA 1RB0A 3OFEA 2GQ2A 2UXCJ 3N5FA 3PY8A 5ETKA 2DISA 4ICLB 1SV5A 2ZNYA 3KLEA 5ETLA 2HK3A 2XZWA 1RT4B 5D4OA 5I3UB 2BE2B 2RRNA 5D3GB 5C24B 2R7UA 2XSJB 1UVIA 4K4XA 1HNZJ 1RDRA 3H90A 3EGZA 2NYHA 3O44A 3AA8A 5A0YB 4QOTA 4PRFA 5HLFB 4LRDA 3TAPA 6AT1B 4EI2A 2DVIA 4YR2A 2ZBQA 4O23A 3CC2S 3VR1A 3T5JA 2YKNB 1OQ6A 1HBMB 3M8SA 2Z8QA 1F60B 2B6AA 2F8MA 1RT2A 3V5RA 2HS4A 1EJ7L 4JI7J 3VAKA 3H25A 2VA3A 1IWGA 3V6DA 3DLEA 1DTTA 3NGKA 1DFDA 2DD8S 4G3IA 2W2QP 2RF2B 3B6BA 4TN2A 1KS2A 4N8OA 2X1GA 2WOMB 3ZC4A 2EKNA 2YKMA 3CMQA 4RNHA 2H48B 4KJIA 2X7IA 4Q7AA 1TKZA 2QYGA 2AGOA 2YQ1A 1S6QB 2KKHA 2V8PA 1SJQA 3MAHA 2UUAJ 3WC2A 2A0FB 1MU2A 3DU5A 3RRHA 4ID8A 1SVDA 3QRRA 5J2MA 2Q66A 4NWBA 4I2PB 3GFHA 1UVJA 3MXHP 4TVAB 4ZCLA 4LSLB 4IOBA 3Q24A 2MDAA 4LRCA 2E7XA 4ZHRA 4FBTA 1DTQA 1JLBB 3OTCA 5AXMA 5K5MA 4ECSA 4YY3J 4DV7J 2ZC4A 3H8YA 4NCGA 4EUVA 3CVKA 4DFJA 1F1BB 2J0WA 1F5BA 2MXYA 4P7TA 3G82B 3NY0A 4NYOA 3DHWC 2BDPA 4XDDA 1JLQB 5GADI 2PD1A 4OLOA 3TWZA 1OMSA 2Z2ZA 3K8WA 2YQ3A 4DV1F 4KO0B 1BD6A 4O44B 1HNIA 1RJJA 1Z2ZA 5H9EJ 3MWBA 1R0CB 3PX6A 1W2IA 2UV8G 4HACA 1FWPA 2B9EA 1VISA 4Y2IA 2GQCA 3M1VA 3IBFB 3BN4A 1N8RT 3HT0A 3R5BA 3HP6A 3G6VA 5HQLA 3OLAA 3H5SA 4EBCA 5SZTA 4DR2F 1GMWD 3JTPA 3UDLA 3DC2A 4DU7A 3BO2A 3UCGA 3AXKA 2KJWA 3B54A 4FYDA 3I0RB 3CJ4A 1NSAA 1XNQJ 3HT3A 3HF5A 4N77A 2G9OA 3W5XA 4MK7A 2V50A 2E1CA 1APSA 4LSZB 3NGSA 4DR7F 1HBUB 4WKYA 4NLTA 1IWAA 2XQCA 1LFWA 3SXLA 2RRBA 3IXQA 1TP7A 4DV2F 3EZUA 1HL6A 2XMAA 2HNYB 2NZ4A 3DDKA 2ASYA 2HQGA 3SMZA 2JVOA 4ZCKA 5KFSA 2E7VA 3QATA 4USJC 3F56A 5DETA 1X5SA 2CJBA 2DGOA 1C1BB 5LM7E 2F3JA 1E6YA 3CD0A 3RJMB 5IQ6A 5GAGI 1REVA 4LR7A 4YDDB 2DPIA 2CQDA 3S8SA 1PSDA 3DCAA 2W24A 1RCXB 1HPZB 3CT9A 2C2NA 3WQPA 2ACMA 1YDLA 3ILOA 1K1SA 2N4CA 3T19A 3M8RA 4XDCA 2R8GA 1SJ1A 1S9FA 8ATCB 1FDDA 2VV5A 2DNPA 4B3MF 2E44A 4YS2A 1CJKA 3I5CA 1CJTB 5KFEA 1FHTA 3GIKA 1PKUA 1JLCB 3OXLA 3UR3C 1NK0A 1WI8A 3X1LB 2JSXA 2PI4A 3MEKA 3OHBA 3VALA 4CLTA 1RWVB 5D0GA 4DV5F 3DI6A 2CWKA 2ATCB 5KOWA 1RBOB 1YKWA 4DR1J 4KPYA 2PMWA 1C0TA 1KEKA 2V9KA 3C15B 1U4BA 3JYTB 1T02A 2R7VA 2HVZA 2BM0A 5GAEI 2A2DA 4F4KA 4C48A 4IRCA 2HFVA 4NYPA 3FSXA 3F44A 2B8PA 1IVZA 4CTAA 1PG5B 4RWWA 2FJVA 1FFWB 3NNAA 2P2CB 2IM1A 1LW2B 2BUNA 2FVPA 1N33F 2PFFB 1NUEA 2FB0A 5KFYA 4DUTA 3SCKE 3MTJA 2PIIA 4JI2F 1BC6A 1JLEA 5KG3A 3CIMA 2VKZG 4USHA 1S9GA 3ZZZA 1DRZA 1VBZA 4O3PA 2MY8A 4P2FA 3ZZOA 2K3KA 1X5OA 1NDKA 1B0VA 2XGPA 3PFOA 1Q0NA 3VGVA 4A8MP 4DF4A 3CEDA 2KFZA 1S0MA 2UP1A 4WFXA 3BEGB 3QMQA 1FEHA 1C4AA 3GWCA 4U7UK 4IR1A 4X65J 4NRUA 1XNRF 4ZMMA 3PHTA 3N79A 2VQEF 2A1BA 4QR2A 4LF8F 1NK8A 2RIJA 3TQ1A 1GQEA 2NREA 1TL7A 4DWIA 4ECRA 4OX9F 1SH0A 3MAAB 4ELTA 1HD0A 3GYNA 2VJVA 2DHAA 3L9ZA 2R7QA 3K5NA 1TELA 1UW4A 1RTHB 1NSPA 3HFKA 1TV6A 2HNZA 4CYUA 2R42A 1HMVB 2BANA 5D77A 1U1KA 1RA7A 3CO9A 2LQ9A 4WIQA 2AIRB 1WI6A 3C16B 4J9PA 2C2RA 1V9OA 2GIFA 2ZD1A 2KB2A 2ASLA 2N3OA 1ZM4A 4MIWA 4WJBA 5IXUA 1NB2A 2VPWB 4MMOA 4CO0A 2E29A 4WFBQ 3M32A 4YUDA 1XK8A 3FSYA 1EKSA 1OJ4A 3QYYA 5BYRA 4QIFA 2X3GA 3K57A 4WP8A 3Q0AA 1MNEA 4JP8A 2C2KB 1ZTWA 1R8PA 1AT1B 3B4MA 4HTJA 5I4MA 3DGPA 1U49A 3PZPA 1NK5A 4GKJJ 4AL6A 4RW8A 2JC1A 4ID5A 3KJVA 3M2VB 4X4NA 3T3FA 2QO3A 2KHCA 2BKNA 1HWUA 1EP4A 2QRRA 1AFIA 2W4DA 2CPFA 3N28A 1PO6A 2FLNA 4ES2A 2YPZA 3NS5A 1NRKA 4M94A 5KG0A 2EFVA 1B4SA 2HS3A 2HLUA 1S1XA 1RHMB 1S1UA 2E5GA 2QN6B 3FCWA 4DPTA 2HMIB 3M8QA 5CD4H 2YNHA 1FNOA 3I0SA 5FD1A 5DDPC 4QCLA 4M5KA 1GMUA 1PC5A 3Q2SC 2GMLA 3L7UA 4C11B 1G6BA 3D6MB 2V68A 4ED6A 1MMLA 3Q23A 3KLGA 1UWBA 3AJDA 2HQ3A 4ED5A 1LXNA 2WCXA 1B7YB 5B0GA 3H4DA 1RZMA 3T5LA 1NKEA 2DNKA 4DPOA 2XLKA 2IC3A 4C9DA 5HATA 2FLPA 3RW7A 1RTIB 1WG4A 2X51A 2LDIA 5EGYA 3JB9k 1MW7A 4X4TA 3W60A 1D9DA 2VONA 2DNOA 4TY8B 1FX4A 4QWDA 2HHQA 4QPXA 4B17A 2KI2A 1FE4A 2CVIA 3A8JA 3OFGA 2J5AA 2YVSA 1RHKB 2NXEA 5FJ4A 3LW5C 4L6V3 2VFUA 4DV3F 4HL9A 4OX8A 3OHAA 4X84A 3NBPA 5DDRC 3LOUA 1TKTB 2GMHA 4KY3A 5B0AA 2FJAB 2COLA 4B9SA 2MHNA 4ANEA 1S77D 1WACA 2MJNA 4LVOP 2HFSA 3JQJA 2QL9B 3IS9A 3JTNA 1U26A 3KMQA 3GG0A 3BSCA 4QWEA 2P8IA 1SC1B 3GV8B 2VOPA 1SBRA 1UVLA 1Q5VA 3DYAB 3K5MA 2QC3A 5KFWA 3JQKA 2DGSA 5L1KA 4CLUA 3OTOF 3ENAA 4CLZA 3K89A 3LH2S 2W2MP 3FJ2A 1QTMA 2CPEA 4C6AA 2ROEA 3IO1A 1B0TA 4NLYA 2QL5B 5KFLA 2CZ4A 4CLYA 2ZH3A 1H72C 1SKSA 5AE1A 5EN1A 2F5GA 2V34A 4IQXA 1K44A 4XO0A 1KQGB 3PEHA 5LOQA 2MQPA 5IT4A 2XLIA 4C3KA 1UZHA 3LP0B 1QLNA 3D4JA 1R6VA 1K0TA 1HLWA 1W7WA 3RB3A 3NGDA 1FERA 1XMOF 3EGNA 4QJVA 3D66A 5CYMB 4OYXA 3KK1A 1RKJA 2YX4A 1VQSA 2KT3A 5HVFA 1VOMA 2V2KA 2V4RA 4JYAJ 2K06A 4E2FB 2XMKA 4PZVA 2GCFA 2BM1A 3VTIA 4F4ZA 3BQ2A 2WVFA 2ZDPA 2JLGA 4A8YA 3ULHA 3R5AA 1M5KC 1AXQA 1N6QB 2KVIA 4TQRA 2MQMA 4WP9A 1VC5A 2QX0A 4U96A 2GAHC 2AEFA 1V6HA 2B4OA 5FDLA 1CVJA 3UE2A 2W4CA 1ICEB 2VG6A 4HI2A 2WSEC 1SIZA 3HSDA 4FF1A 1TFYA 3OSNA 2O5DA 2KG1A 2FPHX 4P72A 2DGTA 4DV1J 1XQIA 1FDNA 1VQ5S 3CGIA 4HEA9 3JAMY 2C2MB 2CDQA 4CT8A 2XMJA 1P1LA 2GHWA 2HQCA 1ZZNA 2KRRA 3W9HA 5LXYA 3MFIA 4BWMA 3QAUA 5LT5A 1S76D 4JBCA 2HFUA 2Y3YA 4DXLA 3TVYA 2J6SA 4EO8A 3I5BA 2LCWA 3G8SA 5IT0A 4M95A 4M8LA 1N0VC 1A7GE 4NLWA 4B3SJ 3NGTA 2CQ0A 1FJGJ 4DUZJ 2LU2A 2OTLS 3MEGA 5C25B 4WZMA 1NH8A 1DLOA 4I6AA 3W2VB 2OSRA 2ZOMA 2O66A 3FRZA 2B0GA 2P6TA 2DR8A 5GAHI 1YJRA 1VYAA 1HWKA 1KD1T 1IBLJ 3A8KA 1ZM3A 2LXIA 3SSQA 3OR1A 4ZVTB 3BKTA 4DF8A 2HVHA 2KXNB 4USUA 1S1TB 5F3TA 4DDFA 1KKHA 2FTRA 1F9EB 3QO9A 4YB1P 4K4TA 4JI6F 4ZIWA 1F3VA 2QLXA 4DV2J 4URSA 4M5NA 3CCVS 5EX3A 4C3LA 5JVHQ 3GTYX 2DCUB 4TYAA 3KK3B 5L1LA 1RT5B 4KKOB 3BSNA 1WHVA 2CKWA 3D1HA 3CJ5A 2CQHA 3M30B 3TI0A 3HK2A 3S6EA 2XZDB 4KH1B 2DTJA 2XY7A 1IKXB 1RK8A 1D3WA 1LK5A 3CXCR 2RQCA 3HKZD 2ZITA 5CYQA 3RYLA 3RGIA 2AKWB 1T9TA 4RW7A 1U09A 1N5SA 3TZWA 5K8PA 4I2QA 4PXDA 5L39A 3HX9A 1CC7A 3OPKA 3CD7A 3LP1A 3IRXA 2BYCA 1YJ9S 1VQ8S 2ATLA 2EK6A 3FNNA 1JLFA 3C8YA 4DQIA 5LMNF 4DFMA 3EICA 3ZTPA 1GMWA 4P9SA 2CZVC 3H4BA 4QBUA 4KBIA 4O0IA 2VG5A 3TJAA 4DPWA 3ZNJ1 5AE2A 4DFKA 1QD1A 5IS2A 2IBKA 2CIMA 4X62F 2B43A 2PO4A 2XO6A 1GH8A 1XWLA 2VC0A 2DIUA 2XMMA 1RE1B 4J9LA 2XY5A 3ETMA 1URNA 4WKRA 2K8GA 1TTHB 2L3MA 1FRHA 2IYIA 5HROA 2FHMA 1HNXF 2UVWA 2OPRB 1H7XA 1SCJB 4F0KA 1H6KX 3IM9A 1F5CA 4C8LA 3CD5A 2XC9A 3JTOA 2H4YB 2NYIA 5BYQA 2K1RB 3DRSA 2P9GA 5LSRA 4OJGA 4M5IA 4Q45A 5ETNA 2M3DA 5HMWA 1UA0A 3FFIA 3F0NA 4F7VA 1M90T 2RILA 2R4FA 3W9IA 4MK9A 2GJ2A 3L4BC 4XK8C 4EFAC 2LVWA 2IM3A 1KTQA 2HPUA 2Q3PA 2HG4A 4DSJA 4E0DA 2Q79A 3ADAC 4AFFA 1UFWA 3Q83A 4KHRA 3PO5A 1EX8A 1RAFB 1R0AB 3T1YJ 2J7WA 4WF9Q 4G65A 2WZ1A 2OSQA 2D9OA 3GIJA 4JI8F 2CZ9A 1BQMA 3MAQA 2HZCA 3EZ5A 4OX9J 4ECVA 4QR0A 1VRTA 1P1TA 1SQGA 4KGZB 1VBXA 2B9YA 1YX2A 4B02A 3HPOA 4DS4A 4ZVPB 3V6JA 3HHLB 4DL3A 2W2NP 1T0TV 2OIHA 1FTRA 3IA0A 2YBVA 2IA0A 5B7WA 1FNMA 2E5HA 3PKYA 3ZXWA 4I64A 3NCRA 2OJ3A 3QFHA 2WVCA 2MLYA 4URGA 2E1PA 3QRPA 2H51B 2XMUA 1RADB 2WRMA 2WHOA 4ZDNA 3TZYA 3BR8A 1SH2A 3QJLA 4DOZA 4OZNA 2D41A 3PHEA 3W64A 3JSMB 4JI5F 4A8WA 3MECA 4B3RF 4F3MA 1HQUB 3G86A 4USKA 1FKOA 2CQGA 2OPSA 3N6MA 3PDNA 2J8SA 4PWDA 4LF2A 3U1MA 3HJFA 1S6UA 2FVRA 2ZOGA 4CWBA 2WW8A 5D0RA 2IA6A 3MPUB 5T7LB 2IVMA 2VD3A 1IKWB 1UJ6A 3QGHA 4YEAA 1FD8A 3K5LA 5B0DA 3LPEA 1QSYA 3SQGA 4ELVA 3QT5A 4I1TA 2RDDA 1IKVA 2V2ZA 4H4MB 5C42B 2NXUA 3BF4A 4M5DA 3AD7C 1HIYA 1JNZB 1F2HA 4HTIA 4PAAA 4W92B 2XULA 3A12A 2E5IA 1F5AA 1YJUA 2R7SA 1J5EF 1RYRA 2DNNA 2J9CA 3BN7A 3HKWA 2FUG9 1QVFR 2B9XA 4PYDA 4UF4A 1RTJB 1EETB 2KHDA 5CQGA 4KHPJ 3EGVA 3HM9A 1RTZA 3EXYA 3V6HA 2F63A 2I9SA 3VV2B 1RAOA 2L08A 4DL0C 1VMBA 3I87A 3U02A 1VBKA 3ZTSA 1S57A 1HQEA 3RUBL 1S0NA 4O3SA 2VOOA 2IY5B 5KG1A 3BH6B 3C6TA 5DG9A 3V81B 4BBYA 3CJ0A 2KTQA 1S6PA 4AXJA 3PW5A 1SXLA 3DRPB 1JKHB 2WK4A 1B70B 1FE0A 3NAHA 3KLHA 3IGNA 1Q7LB 1SV5B 5AJ3F 5JUMA 2QSFA 3CCRS 1WTFA 2B9WA 3BBFA 2XWYA 3K2YA 3CDEA 2QLWA 4AYBD 2YXLA 2LQ8A 4NLVA 4K4WA 1HBOA 2M4MA 3AFGA 4L76A 4ATNA 1WDTA 1O6XA 3CW2C 2LU1A 4CO1A 4I4BA 4YMEA 4ZVGA 3O1LA 3G8QA 1H2VZ 1VQ6S 1K0VA 2QMXA 3HHNB 2Q43A 5CCLA 2OEJA 5D4PA 2IHR1 4IFYA 4RW6A 4LR8A 1PBUA 1EKRA 2HW3A 1WOSA 4BS2A 4ZPTR 3IMQJ 4DN9A 3GFZA 1ZOTA 4NLQA 1MSWD 2Z30B 1FJEB 2B6AB 1BY9A 1RT2B 1QTNB 1S7IA 4ED0A 1GXTA 4ZVSB 3EVMA 3DLEB 4O4GB 2FHOB 3HDSA 3C3LA 1X0PA 3HFVA 2XMVA 3CC7S 3FKBA 3OXGA 1LEOA 1Z4UA 3L09A 3PVXA 2RAQA 2W2PP 2YKMB 4RR5A 3CUNA 1KTVA 3D0HE 3IG1B 2NXCA 1RWKB 1X9SA 4EYIB 1TKZB 2HFZA 4RW9A 3SEOA 4KB7A 3Q8YA 1MU2B 3SZ2A 1UWAA 1Q8KA 2EC2A 1NEEA 5ETPA 5J2MB 4KV8A 2KT2A 2M88A 2EK1A 2XMTA 4DV4J 3A3PB 5L8RC 4OQJA 4ZHRB 1YRXA 2J9DE 3CCES 1DTQB 1KVKA 2UXBJ 1T9UA 2GO8A 3IBWA 5U47A 1RXOB 2MSSA 3DOKA 4NCGB 4OHVA 2LQ5A 2B4VA 1EB0A 3IBCB 4J9KA 2IRXA 3FCHA 1AZSA 2MQQA 3AH6A 2KH9A 3W2WA 2UUCF 4RUHA 3MPWA 3PJXA 4ZLPA 4DLGA 3CJKB 3MM8A 4J9VA 3C19A 3S01A 1XJWB 3K5OA 4HI1A 1N48A 1T95A 4DQQA 2HHUA 3MOZA 3M6XA 4RO0A 4DS5A 5D78A 4M5JA 3ETOA 4WYWA 1RI7A 2RDIA 3A3NB 1QE1A 2A6MA 9ATCB 2FIUA 2FJEB 4GO5X 2F8EX 3M1VB 3HZEA 3CCJS 3EPGA 2KDOA 3D2WA 3FEXB 1QJHA 1G4CA 1AYEA 3W65A 2D69A 4I6YA 4HT5A 4ECWA 3AA9A 1U8SA 3M6UA 4FP9A 1CBKA 5M2RA 3GCXP 4TU9A 4ZVRB 3TYTA 1YQHA 1NMEB 1VLYA 3THVA 5GMKa 3FBBA 5LMUF 4DEZA 3PX0A 1UW9A 3GU0A 1IR1A 3N5BA 1EZZB 3MFHA 1UZDA 1NDLA 3R2DJ 4I56A 4L3KA 3CJRA 3CPWR 1Y9OA 2QFJA 2QIFA 3KK2A 1FVQA 3UDCA 4AT1B 1KR4A 4LF4F 1IKYB 3D1QA 2DH8A 1KOHA 3MM7A 3SI8A 3IRWP 1L3VA 3QJPA 4DG1A 3H5YA 4UQTA 3POTA 4DR3F 1RAJA 3BGRA 2UXCF 4PUOA 5J1EA 3QLHA 4FF4A 1W25A 1OS5A 1UTAA 4G1PA 2E5LF 3WX4A 4OYIA 4DHVA 3PYFA 1YBAA 2ZNZA 1N54B 3NCQA 5KAKA 1E6YB 2H5JB 3S7RA 1REVB 2GW8A 5KFCA 4A8QA 3N01A 2C3PA 5ETQA 2F4FA 3OSPA 3IWLA 1YJ7A 2JWNA 3K5PA 5D4LA 1TK8A 3AXMA 3NMRA 4K0KJ 3FRYA 1HHSA 3R2CJ 5KT2A 3HULA 4R0EA 5CA5A 3NNCA 4RNMA 1X4FA 2ZHOA 3DLGA 1VHIA 1HNWJ 4DV0J 4HH0A 4JI7F 2ASJA 4YOEA 4ANCA 2EEYA 3DI6B 1SJ4P 1MROA 2DNHA 3CMES 4UOCA 2W4PA 2K3IA 2I38A 5A6WA 3ITHA 2XY6A 3DGVA 3QT8A 3PM9A 2YNGB 1R8HA 2HFOA 2CG4A 3SSSA 1S6OA 4O0NA 2UUAF 1YK9A 1XEZA 4H4KC 2L41A 2IAJA 1U25A 2UUTA 3QSYB 3M8PA 2HNDA 4XPEA 4KHMA 4ED8A 3W63A 1NZAA 2HYIB 3LWMA 2DO4A 5AXKA 3GR1A 5JJBA 2OELA 4Y2KA 4YY3F 1TUWA 4GC6A 2RJZA 1T8EA 1FFSB 4DV7F 4A8FA 3QPIA 1JLEB 2GS8A 2HZVA 5L1JA 5A8KA 1S9GB 4J90A 3Q8PB 2WTFA 2RMLA 2OEMA 3KMSA 3BDEA 3Q86A 3LF0A 2AWZA 4UZCA 1RAHB 4PCQA 4CI0B 3NGUA 1YJTA 3BZQA 1BLUA 1X31C 1IM4A 1KVJA 4DSFA 2EBGA 3NS7B 1T03B 3I96A 4RW4B 2PDAA 3EWGA 3HI9A 2C3YA 2MTLA 2IRUA 3W61A 4X64F 4DL6A 2R3VA 3HFZB 3GSDA 4WIIA 4V1Ak 1U1MA 5K8OA 2BW2A 1WUUA 3VAMA 1VJQA 2B4UA 2MGZA 4P52A 1Q1KA 1TL7B 3NXZA 3QGPA 2N7YA 4I7FA 4OV1A 3RB4A 2RS8A 3FZ2A 2VDHA 2JEJA 3UW1A 1YJWS 2YKPA 2AJ2A 2F65A 5ADZA 1NJYA 3H2VE 3MURP 2JNJA 1S49A 1TV6B 2ZBIA 2HNZB 1XNQF 2BANB 1U45A 1NLKL 1AB8A 3MUMP 3MEDA 2X3DA 4JV0A 2CJKA 2KVQE 3G6XA 4FPRA 2D9PA 2ZD1B 1BWVA 5D4NA 1S1VA 1O5JA 4USWA 3A4TA 3FBEA 1X4DA 3WIUA 4P2XA 4C8OA 4X2BA 1GMVA 2CPZA 5E3PA 2R7OA 4ICLA 1LW0B 3M8WA 2BA9A 2QTWA 3OVBA 2G4BA 1AW0A 1MN9A 4AXIA 4ELUA 1KHVA 4KR0B 4RZRA 4DMZA 1FJCA 3ZZ0A 2ZH4A 3W62A 5ETMA 3CCUS 1PJ5A 2AD9A 4B9VA 5F8JA 2OMOA 2M7SA 3MMCA 3DHXA 4Y2CA 2B51A 3MD1A 2VFTA 4RW8B 4AQYJ 4ID5B 3KJVB 3DLLQ 4B3RJ 2MZQA 5HLFA 3H42A 4DI6A 4K4UA 1R3NA 4H4OA 3RAMA 2IMOA 1F6TA 3R8YA 1HBMA 5KFBA 4RKUC 3SFGA 1Q8BA 2C3OA 3PV8A 1YBUA 2IYGA 3MPYA 3VQSA 3BO4A 3MTKA 5E0OA 4CT9A 1LWXA 1K8AT 3OXFA 4OI0A 1SB6A 4ZN1A 2MKKA 3BQ0A 1V3ZA 2KN4A 2AGQA 5KTQA 4YDXA 4YN3B 2BVZA 1OYEA 3J81Y 2OPQA 3KDNA 2M0GB 2WOMA 3GIRA 4NMLA 2CQIA 5E41A 4NEYA 4QYZJ 3MEEB 3UD5A 5F9NA 3HVWA 5E7OB 1LWFA 1S6QA 3KLGB 3B4DA 1UWBB 4F0HA 1OQ3A 1SQEA 1EIYB 4CIOA 1M1GA 3SCIE 4CZCA 5FLXU 2LECA 3TJ9A 2ZVSA 1W2BR 1J5EJ 2IC3B 1U1PA 4QPTA 4LSLA 2ADBA 4LF6J 3BR9A 4MKAA 1S9EA 3M9MB 3MM6A 4NA3A 5ETVA 3AOBA 4AL5A 2ZJPQ 1WG5A 2VFSA 4GC7A 3QWPA 1T11A 4FVCA 4DSEA 2DNLA 2G2YA 2KT5A 1SUQA 1SI9A 3C6UB 2VA2A 4NYZA 1H7WA 3DOMB 2HIYA 3G82A 2W7OA 3M2UA 3ENQA 3LUYA 3LGHA 4ES1A 3NBPB 5EDWA 5CXTA 1TU0B 3P45B 2MZJA 2OD6A 3OD2A 2ZKUA 2KFNA 2JVRA 5HN0A 3IS9B 5CH7B 4PQUA 4CRJA 4OI1A 4X65F 2XGQA 1KRPA 2FVQA 3LP2A 2OD4A 3KOAA 2HK2A 5F41A 4OHWA 2E7WA 4I6WA 3GMGA 4DR6J 4ZJOA 1YWXA 4U9RA 4YB7A 3L7OA 4YR0A 3CDBA 2ZHBA 2IIHA 4UZBA 2FC8A 1A0OB 2RUSA 3OFFA 1TL3B 3W8GA 4RX6A 4PWUA 1M5VC 1U0HA 1HHTP 2FZKB 2GX8A 2EFNA 1VQ4S 3ONQA 1S72S 3CF5Q 1CULA 3CJSA 3A13A 3J81j 2IFXA 3RZAA 4RL1A 4CP5A 3EMTA 1MWYA 4M5HA 1KN6A 1J5OA 1WC4A 2CJ9A 1X4AA 1HBNB 1YJVA 3K59A 1HD1A 4ZPAA 2JL9A 4FYYB 2M70A 2FDNA 1ULRA 3SQOP 2HNYA 1I94J 1HI0P 4YQWA 4ECTA 5J2PA 2VG7B 4B08A 2VICA 3KK1B 4K8RA 4F4WA 2ZBRA 3ENVA 4HH1A 3LAMA 5MAOA 3CMAS 1ZA1B 5G0RB 3P5BP 3RBZA 5ETOA 3RBXA 5K9FA 3VAIA 2UZAA 4MH8A 3PX4A 1WC0A 2GO9A 3DRRA 2OTJS 2CNLB 2V4JA 5IC4B 1TMMA 3G87A 4FKXA 1FK9A 4GKJF 2ZKTA 3GILA 1ROFA 1VIXA 4C8NA 4TY9A 3TJ8A 2MEWA 2X1AA 2Y1LB 4OMFG 3HJVA 4ZVEA 1RT7B 4Z37A 1CJTA 1IJFB 2ZWPA 3J80U 3U1LA 4ZLNA 4F2RA 3CDAA 1I3OB 2F9DA 1UVKA 3QSIA 1T7PA 2BQ3A 3KHRA 2I0XA 1U24A 2CAJA 3THPA 3DN9A 5LJ3Y 1RWWB 4TNOA 4WE1A 1NHUA 4CCHA 3C15A 5KG2A 5HANA 3JYTA 4AUKA 3BGUA 3HHLD 3P8BB 4UTGA 3E01A 3SBMA 4UOHA 2RVJA 5F8MA 4W4MA 3DU6A 3FMWA 5KT5A 2W8LA 1PCAA 2G2OA 4IH5A 1FNXH 2QLJB 2QA4S 1DLOB 5KG4A 1KQFB 2QYCA 3OFHA 3TZZA 1UEKA 5IOLA 2OEKA 4LQ3A 1FKPB 4JV1A 1IR2A 2CQ3A 2CPXA 4KGVB 3OR1B 4ZP8A 1TK0A 1U0SA 4EO6A 1UJ5A 4Q2MA 1VQNS 4P10A 1Z2LA 4RBUA 4OZLA 5KT7A 3J7AN 2YY3A 3GFXA 3QO9B 3FCVA 2B5JB 4F8RA 4DR3J 1RT1A 4P75A 2MMYA 1GX6A 5KFUA 2PN6A 3DOLA 3L7PA 1IBMJ 3CC4S 1VBYA 2E5LJ 2CWXA 2XHCA 4HT7A 3LTOA 1ZS6A 2G0JA 4OZJA 3LGNA 2HRYA 2HVIA 5HO4A 3DDIA 1H98A 3R5JB 1D1UA 5KFXA 3TARA 2VPYB 4NOHA 1KLMB 4HR2A 5CYQB 5ITHA 3E8OA 2GJIA 4MKBA 2VFVA 3KNAA 4OV6A 3MAAA 3R7SB 4I2QB 2BJ9A 4RPFA 1SJRA 3LP1B 3IRXB 4A8KA 5D6GA 4O4RA 1RTHA 3SIPB 4LBIA 2OLWA 5HJYA 3OJSA 2CPIA 3FSIA 1VGYA 2MPUA 4YHHJ 2GV1A 4NA1A 3PJ9A 1QAXA 3IR6B 3U27A 3OV7A 2SXLA 2VG5B 2HGLA 2KZMA 2ZBCA 3OTEA 2IVYA 3UQSA 3FQKA 4F25A 1XERA 4R5PA 1UPPA 2YWGA 2HWHA 1WC6A 3NCPA 3QGIA 1YRTA 4ITSA 1RAIB 2B7CB 3MPVA 4KT0C 5A8RB 4U7CA 4QYZK 3IGVA 4IRDA 2M2BA 3CJQA 3DRXA 5DM7Q 5J2QA 3D28A 3P49B 4PWWA 4JYAF 3BKUA 2B3TB 2XLJA 5HROB 2MZ1A 2XCAA 2EVZA 2YWKA 2F8HA 4C0OC 2V4QA 3CCWA 1TK5A 5KFOA 1A6LA 4N41A 4FYWB 1RAEB 1Q53A 2WVEA 3DRSB 5F8NA 4N5SA 3TUJC 4IG0B 4USMA 4DBQA 1TVRB 4TLQA 2KZZA 4HHUA 1YLXA 1CLFA 4DX6A 4KSEB 3FFIB 3W3SA 5EUHA 5MLCV 2XSFA 3UCUP 1MN7A 1WC3A 1Q79A 4DR4F 2MKHA 2X1FA 2Z4PA 4FS1A 4LBHA 5GVQA 1UETA 4QWAA 2GVDB 2W8KA 3ET6A 2BV3A 2W9CA 1Y3KA 2QFIA 2VJUA 5KT4A 2KXFA 3IC1A 4MYUA 1RWUA 4ER8A 3TX0A 1M5OC 1FKAF 2FC9A 1IBCB 2XTJP 4WWSA 4JI4J 1HW8A 2CUYA 4N7TA 2V8HA 3X3UA 4X64J 1UFKA 1TFWA 3UVJB 3HVRA 3DXBA 1ZETA 3RTVA 2RHQB 4ECZA 4CNYA 1U6ZA 1BQMB 3K0JA 1MWQA 3CJTA 1RTIA 4B3SF 1VRTB 1FJGF 4DUZF 4K7QA 4DSKA 4JI3J 4LF5J 1FRLA 3I31A 3KG0A 4HLBA 2XS5A 4CO3A 4TY8A 4X4VA 1UL3A 5IWAJ 3P3DA 3HVTB 1VS3A 1RP5A 1JXLA 4NXNJ 1IBLF 2KRBA 3IN5A 1WJ9A 2D1CA 2K2PA 4R8UA 5HJXA 2GVZA 4WK1A 5IV4A 1C0UB 5DQIA 2RB7A 1YZ6A 2GNKA 2NR0A 1TKTA 3Q8SB 4ZITA 3Q89A 3DFEA 4QW9A 3KLVA 3N9UC 3FBFA 1FKOB 2JOQA 1YSJA 2NQPA 2J7KA 2OPSB 2R8JA 2B4PA 3SCLE 1S5ZA 1RT6B 4M5GA 3TW0A 4PWDB 3LAKA 4J9OA 4L3NA 1X60A 4TXSA 2FHJD 4ZP9A 2CJAA 3DYAA 4K4ZA 1GTEA 2AYEA 5KFGA 4EZ6A 1RWPB 1WWHA 1CJUA 1HWIA 4I67A 4DPYA 3ZTRA 2E1AA 5B0BA 2AZ3A 1IKVB 1L3UA 3ZFVA 1L5UA 5KFQA 2KG0A 5D15A 4JI1J 4NX9A 3R3TA 4M5DB 2XYPB 2DGQA 4NE9C 3GSIA 1CC8A 3JSYA 5M2PA 3WX8A 2F4VF 4IR9A 1RACB 2F1FA 2DO0A 4KAIA 1DURA 5FIIA 4UT4A 2NZCA 1B64A 3T9NA 1YI2S 2R9LA 3R6GB 5BR8F 3KWMA 5CYMA 2NSCA 3OBIA 2KM8C 3OTDA 3KYLA 3H98A 1F9FA 2ZH6A 3G6YA 3SDEA 4U95A 2V2VA 2J9EA 3EXCX 4ED2A 1HQEB 2W9BB 4RU9A 1WF1A 1TL1A 4WPAA 1T94A 1UEVA 3C6TB 2YNIA 3QT6A 2R8IA 2H5IB 1S6PB 1S7HA 2AGPA 4QU6A 1Y0HA 4NLRA 2QG9B 4N47A 3N0VA 3WZ0A 3DMJB 5LL6d 1NCLA 1XIQA 3TR5A 1LWEB 4QU7A 3AJ1A 4JI0J 2R7XA 1YBTA 5DGBA 2VL1A 1K9MT 3RBEA 5HMYA 4OZ0A 3TP2A 2QZ8A 1Y00A 1N5VA 2ALYB 4URQU 1VRUA 3IR7B 4KRWA 1HR0J 4B3TJ 1RHQB 3T1HF 2C1EB 3PIPQ 3WIVA 2D74B 2Y1RI 2VBYA 5DG8A 1BE4A 1ZAXA 4O3NA 5LJ5Y 2QA1A 4BWJA 4ZCIA 4DCPB 4IFYB 3H59A 1DAXA 1WG1A 4ED1A 2XNRA 3KLIA 3MDFA 3OW2R 3HHKA 4Z7YA 3KHHA 1G2EA 3T1YF 1O51A 2XYHB 4LFBJ 3TVKA 1JXVA 5F9LA 1U2RA 3D6HB 2LFVA 4CLKA 2WSCC 1TAQA 5HBMB 4DUYJ 1RLDA 1N36J 3OUYA 2DY1A 1KDNA 1Y5IB 2DHHA 4RW9B 4CLWA 3HLUA 1FD2A 1N34J 2DR7A 3DLJA 2BQUA 2PFDA 2OO4A 3GG1A 4IG3A 5F8IA 1TR0A 4I69A 4FDFA 3CJ8A 3EJMA 2ZZNA 5HK4A 1P6TA 4QZVB 4DCJB 3VVUA 2D3OR 2BBEA 3EDRB 1N88A 2HWTA 3KK3A 1X9WA 3QAEA 5GMEA 4PG4A 2XO7A 4EK2A 1EQ0A 2CQBA 4QYRA 2F40A 3DOKB 3SCJE 2R2SA 4C8KA 2VDIA 1FRIA 4H4KA 1AZSB 1VQMS 3D6TB 3CCTA 4P74A 4F4AA 5HVHA 4TLRA 4MAKA 5KT6A 5IT9U 3DM2A 4LRAA 2RQMA 1WHXA 3MM8B 4LJMA 2DGWA 2ALZA 3WHIA 3D54A 3QNWB 4BLGA 5HP1A 3PKMA 1TKXA 3BBCA 2ASDA 4ZS6A 4DCOB 5E3CA 3O6QA 1M5PC 2LDYA 2HLTA 1QAYA 3PACA 1HYSA 4WZQA 3LPYA 4PG7A 1WEYA 2A10A 4P2MA 2XS2A 2V63A 2K7JA 3DRYA 2FGCA 3CE8A 3GV7B 3I55S 2DNZA 3KUEA 4BC9A 1VHFA 1GAOA 1NB7A 2MSTA 2RU9A 2BJEA 4GKKJ 1TUGB 2H9ZA 1Z1ZA 4KHPF 3FQLA 5BXIA 2L48A 5H9EK 3VF0B 1SJ3P 1PJ6A 3KK2B 1QSLA 4DL2A 1L3KA 4CO2A 1NK7A 2FJXA 3GQCA 4LF1A 1O0PA 2UXDF 1QSSA 1U1LA 3MM7B 1WNEA 2MQLA 4DG1B 1LKZA 3BGRB 1NJWA 3TANA 2V0NA 1CG2A 5HVGA 1DHMA 4PUOB 4HHJA 1KP6A 3ILIA 1FA0A 4PPDA 1U8WA 5C2GA 4OLPA 1XR5A 2YX1A 2ZBPA 1S4EA 1G1XA 3TEGA 3ILLA 4PABA 2D3ZA 1KC8T 1WDDA 4ZA1A 2D7SA 3OR2A 1FWKA 1J2VA 1YG0A 3G71S 2KJVA 1Q95G 2HS0A 1XC9A 3OTBA 4F04B 3MMBA 3MHYA 3DLGB 2Q6CA 4A47A 4PQAA 2BJ3A 3R1LA 3GIMA 1QUPA 2NXNA 3VWSA 4RNOA 4MK8A 1QVGR 2BE7D 4OHZA 3AODA 1PYOB 1FRXA 1MROB 2W25A 1U2CA 1OPZA 4J9NA 4ZP7A 1TMJA 2OHDA 3AQPA 3KTQA 3ITHB 3GJRB 3HHLA 2BW7A 4W90B 3NEKA 1HNVB 2YH0A 5E33A 2EPIA 3GV5B 2VPXB 4XTTA 3HD2A 5KFIA 3PIOQ 4BDPA 1NZ8A 4DL7A 3F41A 3CJ3A 1KSPA 5HQMA 3IAM9 3WC0A 1XR6A 2JDJA 3ISND 4C2MA 5JVGQ 3PCOB 1D9FA 3AOCA 3IP0A 2GQQA 4OYZA 5GMDA 1HKAA 5AT1B 5AXLA 1BHNA 3H5UA 3T6BA 2HNDB 2AYMA 3AB4B 2VKRA 4QR1A 4DV4F 4LREA 1ITPA 3KDOA 1HQUA 1YHQS 2Z58B 3I56S 2UXBF 1NJIT 3FVYA 3O8WA 2IM0A 3P4UB 1P8GA 3KHLA 2CQ2A 5T7LA 2ADCA 1VR6A 1CJVA 5EX0A 5LXRA 5I3QA 1UMJA 1NM2A 1KBRA 3ZTOA 3RR8A 1M5SA 4RLEA 2OH2A 1UVNA 3E3XA 4QQBA 2BQRA 1DBDA 4OZ5A 4WFZA 3DLKA 3ZTQA 5E2QA 1OSDA 1KFSA 1Y4ZB 4H4MA 1PILA 2A3JA 2XHWA 1KHWA 1WSVA 4KC5A 3UNYA 4ZOSA 1GEHA 4MKYA 3PFEA 1CS4A 4M5MA 2Y9HA 4R0JA 5F8LA 4DR4J 5H1SV 3PR4A 2VHGA 1DARA 3MM5A 2MGZB 2GC8A 2Y0BB 3V4MA 1RU1A 2Z56B 1LFPA 2C2EA 3BV8A 4O3OA 3W7BA 3K58A 1EETA 2HRTA 2LXFA 3CDWA 2V5HG 2XZTB 4MFBA 3H40A 3MM9A 3RRGA 3M7VA 1CQNA 3MEDB 4TQSA 4FF3A 4BC7A 1W26A 4A8OA 5DG7A 4B3OA 2YWHA 2UU9J 1S1VB 4OYBA 3B82A 4DV6J 3VGUA 1IN0A 2FVSA 2Y1IA 4OYAA 3N6NA 2QE5A 2DYAA 5KFTA 1IQZA 1YZ7A 1Q4RA 5THWA 5EWEA 1RSCA 2XS7A 1RTDB 3M05A 4HYKA 1JLGB 2MHEA 2RKIA 2FYXA 3BYRA 2QJ3A 4K59A 3BM7A 3MMCB 1FDAA 3MR7A 2ZUAA 3GB0A 4M63A 1IM6A 4NI2B 4C0BA 2ERRA 4ZVUB 2QL7B 4H4OB 4QWBA 3LANA 1VRQC 2LKZA 3BGFA 4USVA 3US5A 2JLFA 4ECQA 4LFAJ 3J7ZT 4HDHA 4N8NA 4K0KF 3OVSA 1M5HA 4CLFA 2E1RA 3MPDA 4C8YA 1O8BA 3D6FB 2HGNA 4ANDA 2AJFE 4LSNB 4O4GA 4YB6A 1HNWF 4DV0F 3GJTB 1FWLA 2FZGB 3W66A 3CCMS 2FGOA 2OPQB 2VBZA 4WK3A 1Q7YT 1S1WA 4X4RA 4FF2A 3IG1A 4FXDA 2HFNA 3QIPA 2VQFJ 2GMJA 1OWXA 2C2ZB 3NG8A 1LWFB 2LLZA 3O2IA 2PSZA 2DNRA 1H3DA 4Q0BB 1LV5A 4Y3CA 2UUBF 5DLFA 2CJQA 1FX2A 2CPYA 4LR9A 2F4VJ 4DZDA 1MMDA 3TAQA 1NH7A 3D7SB 1URRA 3H2UB 3MUTP 4RUAA 3Q8QB 1S9EB 3J7YU 3R1HA 3HXMA 2ZFHA 5BR8J 3MM6B 3FMBA 3CSKA 2HHWA 3MR6A 3TX8A 5D0EA 2XI3A 2BJ1A 1SUQB 3TUZC 5DM6Q 1LK7A 4X66J 3KUHA 2DR6A 2ZH8A 1VQYA 5KFZA 3GPAA 2FLOA 3M2UB 3BDPA 1N52B 4RBVA 3CJKA 1Q81T 4CH1A 4PXBA 1V3RA 1DQ8A 5B0FA 4FYVB 2ZZTA 4NLGA 2V6AA 5K14B 1TUVA 4PQUB 2FHJA 5KT3A 3LP2B 4F67A 2YH1A 4EYHB 1YGYA 3TQEA 2GHVC 3WDOA 1UKUA 3QZ8A 3T1HJ 4F36A 2Y8YA 4FXVA 2RQ4A 2JH3A 3MGJA 2DRAA 1HWJA 2WB1D 4Q5VA 2Z57B 1RCOB 5DRKA 1B7FA 1U0HB 5IFMA 1RISA 4CNZA 1CULB 3BBBA 4KQZA 1NDPA 4F4YA 3NNHA 3S1TA 3G8TA 3RRKA 2LYVA 4Y28C 1I5OB 1X0FA 5F3ZA 4AL7A 1X4BA 1WEXA 1SL0A 2W9AA 5J1PA 1J5OB 1H73A 2K7KA 5EHHA
chains in the Genus database with same CATH topology
1NMEB 2CNOB 3D6FB 2CNLB 2H48B 2H4WB 1RWPB 3R7NB 5IC4B 3D6HB 3GJTB 4ZVOB 3D6MB 2C2MB 2H5IB 2QL9B 2CJXB 2CDRB 3R7SB 2QLJB 1PYOB 1RE1B 3IBFB 3R7BB 3QNWB 2QLFB 1SC1B 2C2KB 2XZDB 3SIPB 3IBCB 3RJMB 3GJRB 2Y1LB 1RWOB 1SC3B 4DCOB 1QTNB 4ZVSB 2C2ZB 1PAUB 3KJFB 2HBZB 2HBRB 2P2CB 2XYPB 2C2OB 2H54B 3GJQB 1I3OB 2CNNB 2DKOB 1RHQB 2C1EB 2QL5B 2H4YB 3R6LB 3P45B 4ZVPB 2XYGB 2Y0BB 4JB8B 4DCJB 4ZVQB 1RWKB 1RWWB 1ICEB 3NS7B 3R6GB 3EDRB 4ZVTB 1BMQB 1RHJB 4DCPB 4LSZB 2HBYB 4ZVUB 2QL7B 1IBCB 1GFWB 2CNKB 1RHMB 3KJQB 2XZTB 3KJNB 1RHKB 2HBQB 2H51B 1I51B 3EDQB 2H65B 1F9EB 5K20B 2H5JB 1RWVB 3P4UB 1QDUB 1SC4B 1RHRB 2QLBB 1RWXB 1RWNB 1RWMB 3R5JB 2CJYB 3GJSB 1RHUB 2XYHB 4ZVRB 2FQQB 5IC6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NME B;  2CNO B;  3D6F B;  2CNL B;  2H48 B;  2H4W B;  1RWP B;  3R7N B;  5IC4 B;  3D6H B;  3GJT B;  4ZVO B;  3D6M B;  2C2M B;  2H5I B;  2QL9 B;  2CJX B;  2CDR B;  3R7S B;  2QLJ B;  1PYO B;  1RE1 B;  3IBF B;  3R7B B;  3QNW B;  2QLF B;  1SC1 B;  2C2K B;  2XZD B;  3SIP B;  3IBC B;  3RJM B;  3GJR B;  2Y1L B;  1RWO B;  1SC3 B;  4DCO B;  1QTN B;  4ZVS B;  2C2Z B;  1PAU B;  3KJF B;  2HBZ B;  2HBR B;  2P2C B;  2XYP B;  2C2O B;  2H54 B;  3GJQ B;  1I3O B;  2CNN B;  2DKO B;  1RHQ B;  2C1E B;  2QL5 B;  2H4Y B;  3R6L B;  3P45 B;  4ZVP B;  2XYG B;  2Y0B B;  4JB8 B;  4DCJ B;  4ZVQ B;  1RWK B;  1RWW B;  1ICE B;  3NS7 B;  3R6G B;  3EDR B;  4ZVT B;  1BMQ B;  1RHJ B;  4DCP B;  4LSZ B;  2HBY B;  4ZVU B;  2QL7 B;  1IBC B;  1GFW B;  2CNK B;  1RHM B;  3KJQ B;  2XZT B;  3KJN B;  1RHK B;  2HBQ B;  2H51 B;  1I51 B;  3EDQ B;  2H65 B;  1F9E B;  5K20 B;  2H5J B;  1RWV B;  3P4U B;  1QDU B;  1SC4 B;  1RHR B;  2QLB B;  1RWX B;  1RWN B;  1RWM B;  3R5J B;  2CJY B;  3GJS B;  1RHU B;  2XYH B;  4ZVR B;  2FQQ B;  5IC6 B; 
#chains in the Genus database with same CATH topology
 1XTZ A;  1IKY A;  3HCX A;  2PT0 A;  2G1D A;  2J6U A;  2BJD A;  2BJ8 A;  2CDR B;  2WSF C;  4IDK B;  3EE3 A;  5KFV A;  3ELH A;  4MYT A;  1CSJ A;  2NCK L;  2KL8 A;  2ROP A;  2YNF A;  3BH7 B;  3EVW A;  4DR5 J;  5J2N B;  4ZPB A;  3CTR A;  3IWX A;  4ZP6 A;  3HZG A;  5J2P B;  2G1H A;  1R27 B;  3TEH B;  1ZM9 A;  4IYQ A;  1VQK S;  9RUB A;  2HBZ B;  1NKC A;  4U8V A;  3QJJ A;  1C4C A;  3UDV A;  4QIG A;  1T3N A;  1RT3 A;  3RW6 A;  2MKC A;  4RUB A;  2ZVI A;  1X8D A;  1N32 J;  4TKT A;  3KG4 A;  3DRR B;  2MQN A;  1FDB A;  2YX7 A;  2V4J B;  1JWW A;  2OGU A;  2JHE A;  1FK9 B;  1OSC A;  4WP3 A;  4LIR A;  4WFN Q;  4AQY F;  3ZO7 A;  1E6V A;  3UWT A;  4IFV A;  2DRB A;  4IO1 A;  5C7P A;  4LF9 J;  2GIR A;  2PC6 A;  5ETS A;  5KFH A;  3SYZ A;  5KFD A;  4U67 Q;  1T3O A;  4OYM A;  3AOA A;  3AHP A;  5HL7 Q;  4NL5 A;  3ZNU A;  4ZVO B;  1JJ4 A;  1K1Q A;  2X1B A;  5CHC B;  2W1B A;  2ZWO A;  4K4S A;  2NPF A;  2VH7 A;  3D9B A;  4ZK7 M;  3PW7 A;  3CWJ A;  3BJY A;  3U1N A;  2NUU G;  4FVM A;  2CPD A;  4RU2 A;  4WE1 B;  2Y1J A;  1HHQ A;  1RU2 A;  5A2Q Y;  2YNG A;  2J0Q D;  3E51 A;  1SKU B;  2BOA A;  3E01 B;  4P71 A;  4ZVF A;  4FN5 A;  3MMA B;  2MQO A;  2NPI A;  2IJR A;  1ZM2 A;  3PYG A;  1I6J A;  4JV5 J;  5IZH A;  4RUC A;  2HHT A;  1EHW A;  2HHH J;  4NZ7 A;  2WON A;  1NND A;  4LF6 F;  3H2L A;  3KJQ B;  4WXO A;  3KJN B;  4ETX A;  3ZZR A;  3CNQ P;  4WFA Q;  4LRB A;  2AEJ A;  1FES A;  3GON A;  1LXJ A;  4OJ1 A;  4H54 A;  4MIB A;  4CO4 A;  3PRD A;  3LAL A;  5I42 A;  1NU4 A;  2MY7 A;  3DLB A;  4W98 A;  2HSE B;  3VAJ A;  1VK3 A;  2UXD J;  1UCN A;  4OYO A;  3KLF A;  3BSA A;  2N4D A;  1RT1 B;  1BQN A;  3BB5 A;  4PG8 A;  1BWE A;  3GR0 A;  2LEP A;  1LWC B;  3DOL B;  3EM1 A;  1RWO B;  2I5J A;  1LNQ A;  1T03 A;  2ZM6 J;  4AD6 A;  4RW4 A;  4EWT A;  3HHE A;  1VCT A;  2C42 A;  3KLE B;  4PR6 A;  3RBD A;  2MZT A;  1IBK J;  3M2R A;  4PKD B;  2DXF A;  2AYG A;  4NXM J;  4UQG A;  4DR6 F;  3GZ7 A;  2PGC A;  4IKA A;  2HVE A;  1N5T A;  2DRD A;  2BAB A;  1ZH5 A;  2MYF A;  1ARO P;  1S59 A;  2Z2Y B;  2JEI A;  3FDS A;  2RQK A;  2OML A;  5DDO C;  2HHS A;  1GNK A;  3AD8 C;  5K20 B;  1RHR B;  5IM0 A;  2QEX S;  4V19 X;  1R0B G;  4EZ9 A;  2RE1 A;  3DXS X;  4RJV A;  3MCO A;  4OX6 A;  4OIX A;  1LOU A;  4F2S A;  4DPX A;  5LSL A;  2AU0 A;  3TA0 A;  3V6D B;  1DTT B;  2V9W A;  1OYD A;  4RNN A;  3V4I A;  2OAU A;  2PEH A;  4R5P B;  1OPI A;  3I4P A;  4J9U E;  3HSG A;  3I4H X;  1LW0 A;  1SC3 B;  4ZJL A;  1KFD A;  1I94 F;  4PXC A;  3B8H A;  1ZYQ A;  5J2Q B;  1QY7 A;  3D0G E;  1HI1 A;  4ZLL A;  2BJ7 A;  1RLC L;  2J76 E;  4WXW A;  4DSL A;  1N5Q A;  2BAC A;  1HFE L;  4LFC J;  1FT8 A;  1S97 A;  3TAM A;  3A3O B;  1WD6 A;  1NXI A;  2GJF A;  1VI7 A;  1C1C A;  2FY1 A;  2APO A;  3JSR A;  3D3B J;  4NEZ A;  6FDR A;  2DJW A;  2F9J A;  1MLA A;  3P5T L;  1BGX T;  1SC4 B;  1D8Y A;  4GRS A;  3QBC A;  1X4C A;  1V3S A;  1Y10 A;  2FLL A;  1XMQ J;  1X4G A;  2IVF B;  1AFJ A;  2EKY A;  1U47 A;  3M8Y A;  4OYP A;  2M8D B;  3O3L A;  2H1Y A;  2CVE A;  2J0X A;  4LVN P;  1VQO S;  1VK8 A;  2E9T A;  3ET6 B;  1B99 A;  3PNI A;  2W9C B;  1V5I B;  3MEE A;  3R27 A;  2WVB A;  1HNI B;  1YIJ S;  3KJF B;  4X4O A;  4HAC B;  4AE5 A;  5KFF A;  3OLB A;  2UVU A;  3D1O A;  1SPB P;  4G1Q A;  1Y5N B;  4KE5 A;  2DK2 A;  1BUX A;  3VGT A;  2RS2 A;  2YKQ A;  4PEO A;  3UN5 A;  2CG8 A;  4GVB A;  3BGO P;  1YJN S;  2AJ4 A;  3C46 A;  1UAW A;  4CLS A;  4EGL A;  1T05 A;  3BYP A;  2V8V A;  2MKI A;  1HAR A;  1LQ9 A;  2ZOF A;  3PR5 B;  4F3O A;  4ZPW R;  2OUG A;  3TA1 A;  1VJW A;  3TNV A;  3C6U A;  1DJ0 A;  3CCQ S;  1SL2 A;  3DOM A;  4C98 A;  3G96 A;  3UN3 A;  3VAF A;  4R8U B;  2GVZ B;  8AT1 B;  3C14 A;  1NSQ A;  3EZO A;  4JUZ A;  4ZN3 A;  1K47 A;  5HAO A;  1L3S A;  4DZ6 A;  3MOJ B;  5T14 A;  4NLU A;  5CZV A;  4JOU A;  5A8W A;  3PW0 A;  2G2Z A;  2AZ1 A;  4DFP A;  5KG5 A;  5BYS A;  2IPO B;  3EUN A;  1IBM F;  4LUB A;  1QAI A;  1FRM A;  4ZIV A;  4B9M A;  2DEJ A;  1NAQ A;  5RUB A;  1Y5L B;  3UD3 P;  2QA2 A;  3G4S S;  1F2G A;  1RBA A;  2WAQ D;  3PTW A;  2E66 A;  1TL3 A;  2JLE A;  1EAY C;  4K5S A;  4V19 J;  2CQ1 A;  3VVT A;  2C3M A;  1CJU B;  5KFP A;  4FS2 A;  2LMI A;  2W01 A;  2OPP A;  1NPR A;  1U48 A;  4KFB A;  4A48 A;  4ZLJ A;  2GGP A;  4B9T A;  2ZH1 A;  2JC0 A;  1F3F A;  1CJK B;  3KNG A;  1HBN A;  4YHH F;  1H38 A;  2CA9 A;  2P6S A;  4KIA A;  1NPK A;  3R5G A;  3GII A;  2NUH A;  2B7B B;  2QMW A;  1K73 T;  1JLA A;  1WOO A;  2WW4 A;  3M8Z A;  3UNG C;  2AYB A;  2CQP A;  2V8G A;  2VG7 A;  3JSB A;  1C0T B;  2J9D A;  1FTC A;  5G0R A;  2L9N A;  4EBD A;  3LQV A;  3SDE B;  2UUB J;  2J8A A;  2DNY A;  3NL0 A;  2G0I A;  4B9U A;  5DZ7 A;  2VB6 A;  2AEM A;  3NMA A;  4LT6 A;  1S0O A;  3OVA A;  1TL1 B;  1R89 A;  2YNI B;  1BQX A;  1UP1 A;  3VZH A;  3BSO A;  2ZE2 A;  4CTA B;  4DX5 A;  3OL8 A;  1P27 B;  1JMT A;  4K5R A;  5JXS A;  3MUV P;  1AUS L;  5E5N A;  2DNQ A;  3NRB A;  3KUG A;  1R6Y A;  2I1R A;  2W2O P;  2HBQ B;  2DR5 A;  1U1R A;  4DU8 A;  1REG X;  1SH3 A;  5B09 A;  1KVI A;  3AQO A;  3PXG a;  2MLZ A;  1OO0 B;  2P9E A;  3GLJ A;  4HKQ A;  1RT7 A;  3MR2 A;  4KGX B;  4F3Q A;  3QGG A;  5DLG A;  5B08 A;  2V69 A;  1VRU B;  3ILJ A;  2AW0 A;  3PJW A;  1NPP A;  2DH7 A;  1X4H A;  3QZ7 A;  2DNM A;  2DH9 A;  1T9Y A;  1FJ7 A;  3T41 A;  4Q44 A;  1Y7P A;  2XB2 D;  4CH0 S;  4HDG A;  4KH0 B;  2DGV A;  1GK8 A;  3KLI B;  4F02 A;  3OL6 A;  1N5Y A;  4JI4 F;  1WC1 A;  3H0P A;  2FJD B;  3QT7 A;  2OP5 A;  4OI4 A;  1KNZ A;  3BPD A;  3H20 A;  1TL5 A;  4DR2 J;  2UV8 A;  2IRY A;  4M1K A;  2WVD A;  4P7V A;  4ZVQ B;  2LA4 A;  2AJ0 A;  4N56 A;  4FBU A;  3JAM U;  4ZVH A;  4F50 A;  1U1N A;  2DEI A;  4WYL A;  2CNK B;  1RAB B;  5K8M A;  1ZAV A;  3OUY B;  2ZH2 A;  4JI3 F;  4LF5 F;  1H0H B;  4DL5 A;  3I6P A;  1FKP A;  4EBE A;  2XMW A;  3RAX A;  4UW2 A;  5DZ6 A;  1Y11 A;  4CYU B;  1M1H A;  5AXN A;  3QWU A;  5IWA F;  3PO4 A;  2EWH A;  2Z2L A;  3UFC X;  4DR7 J;  4NXN F;  4IG3 B;  3T1A A;  4X4Q A;  2B5J A;  5E3A A;  2JEG A;  1U6F A;  3A1Y G;  4OI6 A;  1EQM A;  2QA4 G;  1U1Q A;  2V67 A;  2V8D A;  1PBA A;  2RSQ A;  5DQH A;  1CPZ A;  3M32 B;  1IXK A;  1Q16 B;  2HGM A;  3AT1 B;  1RT4 A;  1YVF A;  2U2F A;  2XI2 A;  2RRA A;  5I3U A;  2BE2 A;  1WKK A;  5D3G A;  5C24 A;  2XSJ A;  3NWR A;  1KLM A;  3UR0 A;  2BRL A;  4ILR A;  3DGP B;  3DM2 B;  4Z2X A;  2RUG A;  1UFL A;  4IQM A;  1HQ2 A;  4LF7 F;  3SV4 A;  6FD1 A;  4M5L A;  1AA1 B;  4USI A;  5A0Y A;  5KG6 A;  3Q22 A;  5IV3 A;  5HP1 B;  5E3Q A;  2YWE A;  1TKX B;  3EX7 B;  2R2R A;  4FZV A;  3TVZ A;  4B3M J;  5LSO A;  2G0C A;  4KGK A;  3T5H A;  1EP4 B;  4ENO A;  2YKN A;  1NBE B;  1F0X A;  3HHL C;  1HYS B;  4TU7 A;  2Y8W A;  4JI1 F;  4ZPD A;  1H74 A;  1L3T A;  2M5Y A;  1S1X B;  1S1U B;  4ES3 A;  3EPI A;  5F0U A;  1VC6 A;  3M8Q B;  2YNH B;  4DV5 J;  2VAS A;  2RF2 A;  2FVC A;  3I0S B;  5FLX Y;  3MCM A;  2FZC B;  3VAG A;  2LEB A;  3ISZ A;  1ZPV A;  5KFJ A;  5A8R A;  2ZC3 A;  2IJN A;  4FNI A;  3PRB A;  4IOC Q;  1JJC B;  3SV3 A;  2DGX A;  4J9Q A;  3OT9 A;  5B0C A;  3RB6 A;  1B0P A;  5ETR A;  4I68 A;  2ZJQ Q;  1CQM A;  3VZI A;  2H5E A;  3K17 A;  2MLX A;  1XBW A;  5EWF A;  2BRK A;  5EWG A;  1VFJ A;  4I2P A;  1T9V A;  1BMQ B;  5F8H A;  2EC0 A;  2EG2 A;  4UY8 T;  1D09 B;  1N33 J;  4WTO B;  1Q78 A;  3OL7 A;  1WKL A;  2HUR A;  1JLB A;  4C8M A;  1T9X A;  4A46 A;  4IG0 A;  4QIE A;  1RWX B;  2CJY B;  2DHG A;  3T5K A;  4CLP A;  1TVR A;  4JI2 J;  2GFF A;  1GXU A;  4J37 A;  4JI0 F;  1TAU A;  3FBC A;  2NLW A;  2EFO A;  2VF3 A;  4LQ9 A;  3AAW B;  3TUI C;  1HR0 F;  2AMC B;  4B3T F;  2HIQ A;  3M6V A;  3R5C A;  1JLQ A;  2GVD A;  2LXU A;  3J7Y I;  3DNC A;  3OR2 B;  4KO0 A;  1ZPW X;  2AJ1 A;  4NLD A;  2OI2 A;  4O44 A;  1PC4 A;  1DQ9 A;  2QMU B;  3QFW A;  2H54 B;  1XNR J;  3H7H B;  2FD2 A;  1I1G A;  1V5V A;  2VQE J;  3MMB B;  3HMJ G;  3NS6 A;  4QW8 A;  4NLS A;  3UVJ A;  4LF8 J;  3JS9 A;  1M1K T;  3GE9 A;  4FPI A;  4CQ1 A;  1Q5Y A;  4LFB F;  1IR0 A;  5KFA A;  1GT8 A;  7FD1 A;  1B3T A;  4OZ2 A;  2RNE A;  2CQC A;  1RGV A;  4DUY F;  4WBF A;  1N36 F;  1MWZ A;  4NAS A;  3I0R A;  3T9Z A;  4F26 A;  2FJW A;  3HVT A;  2BR0 A;  2Z0G A;  3RAQ A;  2EBE A;  3KHG A;  3A8I A;  4UUX A;  1N34 F;  4OZ1 A;  1KON A;  1FEE A;  1VQ7 S;  1C0U A;  4J91 A;  2C22 A;  3IWN C;  1HBU A;  5KG7 A;  1PJ7 A;  5I3P A;  1N0U A;  4GO7 X;  2VZ9 A;  2KO1 A;  4TYB A;  4F0M A;  1F9H A;  2RD5 C;  3D3C J;  3FUY A;  5KFN A;  2L9W A;  1RT6 A;  2UVR A;  2KYZ A;  1FRK A;  2OFG X;  1ZTT A;  4Q43 A;  2LEA A;  5ETT A;  1C1B A;  2M8H A;  2EFQ A;  3J7Z 5;  2IDL A;  2ABY A;  1CJV B;  3FK4 A;  5L9N A;  3CCZ A;  2DHS A;  3J80 Y;  2JRS A;  1HPZ A;  3FEY B;  4WU2 A;  4Y00 A;  3ZZP A;  3UI3 A;  1WHW A;  5KFR A;  5L46 A;  3DLK B;  4UOF A;  1SKW A;  1SKR A;  1U7L A;  2I8E A;  2U1A A;  5FDL B;  1SL1 A;  4ZPC A;  1AUD A;  1JIH A;  2VG6 B;  4GMK A;  1CS4 B;  1NJX A;  4ECY A;  2VC1 A;  4ED3 A;  4MTP A;  4C8Z A;  2KYX A;  4QWC A;  1JLC A;  3TRG A;  4NLX A;  1FRJ A;  2CYY A;  3MM5 B;  2IJF A;  4OJ3 A;  3G2X A;  2AHO B;  3IFE A;  2R7R A;  5A2Q U;  1TZ0 A;  4QIV A;  2YQ0 A;  2MQ8 A;  4D3G A;  4Y2A A;  4GKK F;  4MFB B;  3MZI A;  3MM9 B;  4ED7 A;  1NK4 A;  2R8K A;  1HWL A;  4DSI A;  1Q86 T;  2XEX A;  2MKJ A;  2R2U A;  2A18 A;  2EW9 A;  4B3O B;  4CH7 A;  2W9B A;  3QQC D;  5G4D A;  3VAH A;  2CFX A;  4CM0 A;  5DQG A;  1RQ0 A;  2XCP A;  3T6J A;  4G1I A;  1LW2 A;  2CPJ A;  1NKB A;  3ZZT A;  3MEG B;  2PI5 A;  3DMJ A;  4ECU A;  1NO8 A;  3EDQ B;  1KQK A;  1R43 A;  4DX7 A;  1LWE A;  3MR3 A;  1RWN B;  1NK9 A;  2JJ4 D;  2FQQ B;  3CCL S;  4RBT A;  1NK6 A;  4K4Y A;  2P5V A;  3D5M A;  5L38 A;  3GCW P;  1KLN A;  4DQS A;  2RKI B;  2QT7 A;  1JXE A;  4DV3 J;  1NSK L;  4P73 A;  4U7U D;  3R7B B;  3MI7 X;  1WF0 A;  2ZH5 A;  1MMN A;  2MKS A;  2YKO A;  1VC0 A;  1HA1 A;  3CB4 A;  1FXD A;  1TQL A;  5K8N A;  3GJQ B;  4K4V A;  4WCE Q;  4DN0 A;  2RU3 A;  2XBP A;  3CJ2 A;  3LGM A;  3M4X A;  2CAD A;  2XYG B;  3QRQ A;  3W8P A;  3OTO J;  2JZ5 A;  1PAE X;  5HBM A;  1FXL A;  4RW7 B;  2YKA A;  4WTY A;  1S1W B;  4MT1 A;  2NXJ A;  3UO0 A;  3KG1 A;  3BKF A;  2ZUG A;  2IDE A;  3O5T B;  5HMX A;  1RWM B;  3QIP B;  4YP3 A;  4Z7C A;  1HMV A;  3NKY A;  3HO1 A;  3PW4 A;  1JLF B;  2CRL A;  3C16 A;  2RT3 A;  4E8U A;  2IM2 A;  4DL4 A;  1RUS A;  3LA0 A;  2F7V A;  2J0S D;  1OY6 A;  2VU5 A;  3VGS A;  1VLO A;  4ZPV R;  1YIT S;  5GAD U;  1XMO J;  2N3L A;  3M9O B;  2CXE A;  1S4F A;  2XG8 A;  2AF6 A;  3MCN A;  3M9N B;  4CM2 A;  3I9V 9;  2DKO B;  2QSW A;  3GP9 A;  2OKQ A;  1U2F A;  2O67 A;  4E98 A;  2ILY A;  4U8Y A;  2O1P A;  2M9K A;  4CO5 A;  3M2V A;  2H65 B;  2AJQ A;  4OX7 A;  1RYS A;  3N4W A;  3RR7 A;  5BJR A;  4J7C A;  4D3H A;  3TUP A;  4A8S A;  1Q8I A;  1FCA A;  3A8E A;  3PG9 A;  4UST A;  3P6Y C;  2HMI A;  4J9S A;  1IUJ A;  3B78 A;  4GVL A;  4X4P A;  1RBL A;  2CPH A;  2D3U A;  2GA7 A;  2WBM A;  4ILM A;  4C11 A;  3VQT A;  3I5A A;  1SIW B;  2V2Q A;  2B8Q A;  4BHQ A;  2IMW P;  2PA3 A;  2P9C A;  2BKP A;  1ACM B;  2FJB B;  5CYJ A;  1VIO A;  2HWI A;  3L3C A;  2R7W A;  4OHY A;  4OZ3 A;  3MMJ A;  5H9F J;  1NHK L;  1R8C A;  2UU9 F;  1S12 A;  5GAG U;  2EI5 A;  1FFG B;  4XIU A;  4EEY A;  3BRE A;  2YNF B;  2EXU A;  3I82 A;  2BXJ A;  3NOC A;  4DV6 F;  2J7U A;  5T41 A;  3GFY A;  1KQS R;  1XN9 A;  3BS9 A;  4OI2 A;  2BOP A;  2CNO B;  1GXL A;  2VOD A;  1ELO A;  4TU8 A;  1DZ5 A;  3K8V A;  2ILZ A;  5KFK A;  1RT3 B;  1NHV A;  3NAI A;  4DQR A;  2DXD A;  4C97 A;  4LIW A;  2QV6 A;  3ICL A;  4JI6 J;  1HNZ F;  3HSZ A;  2Z2M A;  1H2U X;  3PW2 A;  2PMH A;  4ALZ A;  3MEC B;  2L9D A;  3E2E A;  1D8Z A;  2HBR B;  1X4E A;  5A6P A;  1E6V B;  2QGF B;  3R97 A;  1OIA A;  4IFV B;  1PYS B;  1JB0 C;  2DBB A;  4LFA F;  5GAE U;  4YR3 A;  5DDQ C;  2N82 B;  1FO1 A;  4KYZ A;  2BMB A;  4K2J A;  4C3M A;  1TL4 A;  4LF7 J;  1GFW B;  5DGA A;  2Y0S D;  2M52 A;  1S99 A;  3OJU A;  2B56 A;  2MKY A;  5D0H A;  3SQG B;  3R9L A;  2VBX A;  3NGR A;  1HNV A;  4K50 A;  4WU3 A;  2OFH X;  3CUL A;  5LMN J;  1VDH A;  2VQF F;  2ZJR Q;  2ROG A;  1R7I A;  2ZHA A;  1U1O A;  2E5J A;  4OHX A;  3SFU A;  5HI7 A;  5KOX A;  4ZJQ A;  1S48 A;  1VQ9 S;  3NOG A;  2DCL A;  3PYE A;  1PYT A;  1UA1 A;  3V2U C;  1EAR A;  3GYG A;  2HAF A;  1WF2 A;  5AE3 A;  4ERD A;  2RHS B;  2GHP A;  3LP0 A;  1SC6 A;  3TA2 A;  4X62 J;  2WON B;  3V6K A;  4IRK A;  3QID A;  2JFD A;  1WSR A;  3AY0 A;  2ACY A;  1X7V A;  2NSB A;  4Y65 A;  4OJH A;  1WEZ A;  2PA8 D;  4PPZ A;  1IQT A;  1TKD A;  4ETZ A;  1NDC A;  1FXR A;  5I42 B;  2IBO A;  3FC9 A;  2UUW A;  3Q8V A;  1QAJ A;  2E1M C;  2VFR A;  4X66 F;  1PIE A;  1SJF A;  1CEZ A;  4L72 B;  3ENW A;  1WOP A;  1HNX J;  1SQF A;  3ZZY A;  5E3R A;  2XNQ A;  3UN2 A;  3KLF B;  4Q8E A;  2HBY B;  3IR5 B;  1UEU A;  2EG1 A;  4L74 A;  1N6Q A;  3D0I E;  4EU0 A;  1BQN B;  4O3R A;  4WFY A;  4OYW A;  2DHX A;  2CQ4 A;  4X4S A;  4PYA A;  2DGU A;  3BQ1 A;  2I5J B;  3KLH B;  3Q8R B;  1H2T Z;  4IH7 A;  2KFY A;  2A6O A;  3KFW X;  3NP5 A;  3D67 A;  3IAS 9;  3M2R B;  4NA2 A;  3VCD A;  1D0E A;  4DPU A;  1Q82 T;  1HBO B;  4FKY A;  2LP4 A;  2QLF B;  4J9R A;  1A9N B;  2O3D A;  3W1Y C;  1S79 A;  5DS7 A;  2UVV A;  2BZ2 A;  3MCS A;  1UPM B;  1VQL S;  1QM9 A;  4L75 A;  2DXE A;  4PG6 A;  1ZAW A;  2GAG C;  4RW6 B;  5IM0 B;  4RWX A;  2DIV A;  3R5D A;  4PXE A;  4JI8 J;  2AQ4 A;  3D68 A;  1G7C B;  3C2P A;  2WB4 A;  3ISN C;  5CAB A;  4S0M A;  4Q8F A;  2C3U A;  4YB5 A;  4B9N A;  2HHX A;  1WC5 A;  4B9L A;  5KFM A;  4A8X A;  2BX6 A;  3V4I B;  4C7Q A;  2DR9 A;  5JMN A;  5C25 A;  1RA6 A;  4DR5 F;  2QLB B;  4JV2 A;  1ZA2 B;  2E9Z A;  3W2V A;  4L73 A;  3BPS P;  1BXN A;  5IC6 B;  2BE9 B;  2HQD A;  4BCA A;  1R31 A;  1P9Y A;  3Q2T C;  3I9Z A;  1RTD A;  3UCZ P;  4XPC A;  4G6V B;  4NPO A;  1JLG A;  2DT9 A;  3EYZ A;  1JNR B;  3AJ2 A;  3HVA A;  2HEK A;  2I2Y A;  1S1T A;  4KV8 B;  2ZH9 A;  3MR5 A;  1N32 F;  3FEZ A;  2MJU A;  3TAM B;  3FZB A;  4ECX A;  4JI5 J;  3CO0 P;  4NI2 A;  2LQJ A;  1C1C B;  1ZBT A;  3UDE A;  4EMD A;  3AB2 B;  5IT9 Y;  2KM8 B;  2DIT A;  2PEB A;  2FY8 A;  1RT5 A;  4KKO A;  1PGZ A;  3FGV A;  5SUH A;  4A4J A;  1QUV A;  7FDR A;  4J9M A;  4ILL A;  3TZX A;  2MB0 B;  3M30 A;  2DY9 A;  1OY8 A;  3RG6 A;  3MD3 A;  4LF9 F;  2RDJ A;  3JXO A;  3CCS S;  1KWM A;  1IKX A;  3UD4 P;  4LSN A;  3DKD A;  2YPY A;  3Q8U A;  3W2W B;  4P2S A;  3HD1 A;  1DY3 A;  4NLP A;  2PMZ D;  4O3Q A;  1Q8L A;  1S0V A;  4MIA A;  2G13 A;  2DNG A;  1RAG B;  4DR1 F;  3N6L A;  1QE1 B;  2AV5 A;  4R25 A;  5CD4 A;  2JFK A;  1XR7 A;  3DLH A;  3PEJ A;  3OL9 A;  4G1Q B;  3EVO A;  1X9M A;  2ZZM A;  2CJX B;  4FNH A;  4FYX B;  1JQG A;  4Q0B A;  3J81 U;  4GVB B;  1R8B A;  2GZO A;  2EFP A;  4OFZ A;  4KGM A;  2Q1L A;  5HQ8 A;  3JQM A;  3KKF A;  4JV5 F;  5DJB A;  1RKI A;  2BEF A;  3TO8 A;  4ZKA A;  4Q2L A;  3P96 A;  1T05 B;  4OL8 A;  4DJB A;  2HHH F;  3RU0 A;  2KXH A;  4KTQ A;  4K2X A;  4MKV A;  3NLC A;  2R2T A;  4C4W A;  2CNN B;  3L95 X;  4KPC A;  4DX8 H;  2DPJ A;  2PE8 A;  4UUW A;  2WBR A;  3CDU A;  2YWW A;  4NCA A;  4NZ0 A;  1GX5 A;  1D9A A;  3C14 B;  4Y2M A;  3HSJ A;  1JJ2 R;  3H5X A;  1OY9 A;  1WEL A;  3RB0 A;  1G3O A;  2OPR A;  5H9F K;  2HAI A;  5CCM A;  3POT B;  5A8W B;  2AX1 A;  3I32 A;  5CZX A;  4U6P A;  1WTB A;  4MJK A;  2KU7 A;  3THT A;  2POK A;  1S10 A;  2HHV A;  2K1R A;  2O01 C;  5AJ3 J;  5K14 A;  4I0W A;  2H4W B;  5J1E B;  3QLH B;  3R7N B;  2NS1 B;  2ZM6 F;  1T9W A;  1J27 A;  3K7R A;  2XM3 A;  4NRT A;  2HHP A;  3HHD A;  4IO9 Q;  3W9J A;  4F4X A;  1IBK F;  1M0S A;  3NWG A;  3W5Z A;  5CAA A;  4FXW A;  4NXM F;  5DO2 A;  1JX4 A;  3EGW B;  1DQA A;  2GIQ A;  8RUC A;  2HKE A;  3LWL A;  2EFG A;  4ZCM A;  4NZ6 A;  2OPP B;  1GTH A;  4LRF A;  2MZS A;  4KFB B;  4UOG A;  3IM8 A;  1R0A A;  2GGP B;  2AP6 A;  2R7T A;  3BGL A;  4XAK A;  4J5O A;  1JJH A;  1FVS A;  4JB8 B;  1NJZ A;  1P9Q C;  3U7J A;  2E9R X;  3F73 A;  1MG7 A;  2LA6 A;  4IDK A;  2D3O 1;  1JLA B;  3LO3 A;  1HI8 A;  3ZZU A;  4NLO A;  5J2N A;  1RAA B;  2XWX A;  1RHU B;  2J6T A;  2HVD A;  2LQB A;  2VUG A;  5M2U A;  2AT1 B;  4CLL A;  2DB1 A;  3MF5 A;  4OI3 A;  1VQP S;  2ZEJ A;  1UVM A;  2IAJ B;  1X5P A;  3G9C A;  3W5Y A;  2ZE2 B;  5B0E A;  4LFC F;  3M8P B;  2R8H A;  3JSM A;  1R8A A;  4YFU A;  3UPF A;  4DLE A;  2W7P A;  4CDI A;  3TOQ A;  4X4U A;  5HMZ A;  1U6B A;  5C5J A;  2A2C A;  5L9X A;  4P6Q A;  1ZZF A;  1Y3J A;  3C66 A;  4LBP A;  4IH6 A;  2VIH A;  2C2D A;  2C28 A;  4HHH A;  1UJ4 A;  1XMQ F;  1U02 A;  3KXD A;  5A8K B;  5D8H B;  2UUC J;  1RHJ B;  4C0H A;  3CD6 S;  1IKW A;  4DQP A;  1YTY A;  1I51 B;  3CIZ A;  1N56 A;  3BO3 A;  4Y6I A;  4Y0F A;  4IUF A;  2ZDO A;  3GJS B;  3G6E S;  2RH3 A;  5F8G A;  4HVZ A;  1JK9 B;  1C2P A;  2VBW A;  2BKO A;  5HSP A;  3SSR A;  4Y34 A;  2YTC A;  2AX0 A;  4QIW D;  4NMX A;  1KOO A;  5GAH U;  1N5Y B;  1WHY A;  5C2C A;  5C42 A;  5A76 A;  3MMA A;  1FF2 A;  2JX2 A;  1YRU A;  2YWF A;  4PG5 A;  2HQI A;  4IOA Q;  2Q6B A;  2HQF A;  2VPZ B;  2HZA A;  3DDN A;  3AD9 C;  2ZH7 A;  3WBZ A;  1PAU B;  5LMU J;  3OQ2 A;  2N7C A;  4RNF A;  2V94 A;  4I7F B;  2MZR A;  2HRU A;  2C2O B;  2JEF A;  1RTJ A;  3PYD A;  3M6W A;  1IJE B;  4UY8 5;  5L1I A;  3R6L B;  4LMZ A;  1WOR A;  2I6W A;  3GYX B;  7AT1 B;  1WKJ A;  1N4L A;  4NCB A;  4LF4 J;  5F0W A;  2FHK A;  1X5T A;  4N76 A;  5IQQ A;  3J7A 1;  4ED4 A;  1XMB A;  2W7A A;  3VHQ A;  3V81 A;  3DRP A;  3PRV A;  1FI4 A;  1JKH A;  1QDU B;  5J1N A;  1HW9 A;  2H3E B;  1LWC A;  1RB0 A;  3OFE A;  2GQ2 A;  2UXC J;  3N5F A;  3PY8 A;  5ETK A;  2DIS A;  4ICL B;  1SV5 A;  2ZNY A;  3KLE A;  5ETL A;  2HK3 A;  2XZW A;  1RT4 B;  5D4O A;  5I3U B;  2BE2 B;  2RRN A;  5D3G B;  5C24 B;  2R7U A;  2XSJ B;  1UVI A;  4K4X A;  1HNZ J;  1RDR A;  3H90 A;  3EGZ A;  2NYH A;  3O44 A;  3AA8 A;  5A0Y B;  4QOT A;  4PRF A;  5HLF B;  4LRD A;  3TAP A;  6AT1 B;  4EI2 A;  2DVI A;  4YR2 A;  2ZBQ A;  4O23 A;  3CC2 S;  3VR1 A;  3T5J A;  2YKN B;  1OQ6 A;  1HBM B;  3M8S A;  2Z8Q A;  1F60 B;  2B6A A;  2F8M A;  1RT2 A;  3V5R A;  2HS4 A;  1EJ7 L;  4JI7 J;  3VAK A;  3H25 A;  2VA3 A;  1IWG A;  3V6D A;  3DLE A;  1DTT A;  3NGK A;  1DFD A;  2DD8 S;  4G3I A;  2W2Q P;  2RF2 B;  3B6B A;  4TN2 A;  1KS2 A;  4N8O A;  2X1G A;  2WOM B;  3ZC4 A;  2EKN A;  2YKM A;  3CMQ A;  4RNH A;  2H48 B;  4KJI A;  2X7I A;  4Q7A A;  1TKZ A;  2QYG A;  2AGO A;  2YQ1 A;  1S6Q B;  2KKH A;  2V8P A;  1SJQ A;  3MAH A;  2UUA J;  3WC2 A;  2A0F B;  1MU2 A;  3DU5 A;  3RRH A;  4ID8 A;  1SVD A;  3QRR A;  5J2M A;  2Q66 A;  4NWB A;  4I2P B;  3GFH A;  1UVJ A;  3MXH P;  4TVA B;  4ZCL A;  4LSL B;  4IOB A;  3Q24 A;  2MDA A;  4LRC A;  2E7X A;  4ZHR A;  4FBT A;  1DTQ A;  1JLB B;  3OTC A;  5AXM A;  5K5M A;  4ECS A;  4YY3 J;  4DV7 J;  2ZC4 A;  3H8Y A;  4NCG A;  4EUV A;  3CVK A;  4DFJ A;  1F1B B;  2J0W A;  1F5B A;  2MXY A;  4P7T A;  3G82 B;  3NY0 A;  4NYO A;  3DHW C;  2BDP A;  4XDD A;  1JLQ B;  5GAD I;  2PD1 A;  4OLO A;  3TWZ A;  1OMS A;  2Z2Z A;  3K8W A;  2YQ3 A;  4DV1 F;  4KO0 B;  1BD6 A;  4O44 B;  1HNI A;  1RJJ A;  1Z2Z A;  5H9E J;  3MWB A;  1R0C B;  3PX6 A;  1W2I A;  2UV8 G;  4HAC A;  1FWP A;  2B9E A;  1VIS A;  4Y2I A;  2GQC A;  3M1V A;  3IBF B;  3BN4 A;  1N8R T;  3HT0 A;  3R5B A;  3HP6 A;  3G6V A;  5HQL A;  3OLA A;  3H5S A;  4EBC A;  5SZT A;  4DR2 F;  1GMW D;  3JTP A;  3UDL A;  3DC2 A;  4DU7 A;  3BO2 A;  3UCG A;  3AXK A;  2KJW A;  3B54 A;  4FYD A;  3I0R B;  3CJ4 A;  1NSA A;  1XNQ J;  3HT3 A;  3HF5 A;  4N77 A;  2G9O A;  3W5X A;  4MK7 A;  2V50 A;  2E1C A;  1APS A;  4LSZ B;  3NGS A;  4DR7 F;  1HBU B;  4WKY A;  4NLT A;  1IWA A;  2XQC A;  1LFW A;  3SXL A;  2RRB A;  3IXQ A;  1TP7 A;  4DV2 F;  3EZU A;  1HL6 A;  2XMA A;  2HNY B;  2NZ4 A;  3DDK A;  2ASY A;  2HQG A;  3SMZ A;  2JVO A;  4ZCK A;  5KFS A;  2E7V A;  3QAT A;  4USJ C;  3F56 A;  5DET A;  1X5S A;  2CJB A;  2DGO A;  1C1B B;  5LM7 E;  2F3J A;  1E6Y A;  3CD0 A;  3RJM B;  5IQ6 A;  5GAG I;  1REV A;  4LR7 A;  4YDD B;  2DPI A;  2CQD A;  3S8S A;  1PSD A;  3DCA A;  2W24 A;  1RCX B;  1HPZ B;  3CT9 A;  2C2N A;  3WQP A;  2ACM A;  1YDL A;  3ILO A;  1K1S A;  2N4C A;  3T19 A;  3M8R A;  4XDC A;  2R8G A;  1SJ1 A;  1S9F A;  8ATC B;  1FDD A;  2VV5 A;  2DNP A;  4B3M F;  2E44 A;  4YS2 A;  1CJK A;  3I5C A;  1CJT B;  5KFE A;  1FHT A;  3GIK A;  1PKU A;  1JLC B;  3OXL A;  3UR3 C;  1NK0 A;  1WI8 A;  3X1L B;  2JSX A;  2PI4 A;  3MEK A;  3OHB A;  3VAL A;  4CLT A;  1RWV B;  5D0G A;  4DV5 F;  3DI6 A;  2CWK A;  2ATC B;  5KOW A;  1RBO B;  1YKW A;  4DR1 J;  4KPY A;  2PMW A;  1C0T A;  1KEK A;  2V9K A;  3C15 B;  1U4B A;  3JYT B;  1T02 A;  2R7V A;  2HVZ A;  2BM0 A;  5GAE I;  2A2D A;  4F4K A;  4C48 A;  4IRC A;  2HFV A;  4NYP A;  3FSX A;  3F44 A;  2B8P A;  1IVZ A;  4CTA A;  1PG5 B;  4RWW A;  2FJV A;  1FFW B;  3NNA A;  2P2C B;  2IM1 A;  1LW2 B;  2BUN A;  2FVP A;  1N33 F;  2PFF B;  1NUE A;  2FB0 A;  5KFY A;  4DUT A;  3SCK E;  3MTJ A;  2PII A;  4JI2 F;  1BC6 A;  1JLE A;  5KG3 A;  3CIM A;  2VKZ G;  4USH A;  1S9G A;  3ZZZ A;  1DRZ A;  1VBZ A;  4O3P A;  2MY8 A;  4P2F A;  3ZZO A;  2K3K A;  1X5O A;  1NDK A;  1B0V A;  2XGP A;  3PFO A;  1Q0N A;  3VGV A;  4A8M P;  4DF4 A;  3CED A;  2KFZ A;  1S0M A;  2UP1 A;  4WFX A;  3BEG B;  3QMQ A;  1FEH A;  1C4A A;  3GWC A;  4U7U K;  4IR1 A;  4X65 J;  4NRU A;  1XNR F;  4ZMM A;  3PHT A;  3N79 A;  2VQE F;  2A1B A;  4QR2 A;  4LF8 F;  1NK8 A;  2RIJ A;  3TQ1 A;  1GQE A;  2NRE A;  1TL7 A;  4DWI A;  4ECR A;  4OX9 F;  1SH0 A;  3MAA B;  4ELT A;  1HD0 A;  3GYN A;  2VJV A;  2DHA A;  3L9Z A;  2R7Q A;  3K5N A;  1TEL A;  1UW4 A;  1RTH B;  1NSP A;  3HFK A;  1TV6 A;  2HNZ A;  4CYU A;  2R42 A;  1HMV B;  2BAN A;  5D77 A;  1U1K A;  1RA7 A;  3CO9 A;  2LQ9 A;  4WIQ A;  2AIR B;  1WI6 A;  3C16 B;  4J9P A;  2C2R A;  1V9O A;  2GIF A;  2ZD1 A;  2KB2 A;  2ASL A;  2N3O A;  1ZM4 A;  4MIW A;  4WJB A;  5IXU A;  1NB2 A;  2VPW B;  4MMO A;  4CO0 A;  2E29 A;  4WFB Q;  3M32 A;  4YUD A;  1XK8 A;  3FSY A;  1EKS A;  1OJ4 A;  3QYY A;  5BYR A;  4QIF A;  2X3G A;  3K57 A;  4WP8 A;  3Q0A A;  1MNE A;  4JP8 A;  2C2K B;  1ZTW A;  1R8P A;  1AT1 B;  3B4M A;  4HTJ A;  5I4M A;  3DGP A;  1U49 A;  3PZP A;  1NK5 A;  4GKJ J;  4AL6 A;  4RW8 A;  2JC1 A;  4ID5 A;  3KJV A;  3M2V B;  4X4N A;  3T3F A;  2QO3 A;  2KHC A;  2BKN A;  1HWU A;  1EP4 A;  2QRR A;  1AFI A;  2W4D A;  2CPF A;  3N28 A;  1PO6 A;  2FLN A;  4ES2 A;  2YPZ A;  3NS5 A;  1NRK A;  4M94 A;  5KG0 A;  2EFV A;  1B4S A;  2HS3 A;  2HLU A;  1S1X A;  1RHM B;  1S1U A;  2E5G A;  2QN6 B;  3FCW A;  4DPT A;  2HMI B;  3M8Q A;  5CD4 H;  2YNH A;  1FNO A;  3I0S A;  5FD1 A;  5DDP C;  4QCL A;  4M5K A;  1GMU A;  1PC5 A;  3Q2S C;  2GML A;  3L7U A;  4C11 B;  1G6B A;  3D6M B;  2V68 A;  4ED6 A;  1MML A;  3Q23 A;  3KLG A;  1UWB A;  3AJD A;  2HQ3 A;  4ED5 A;  1LXN A;  2WCX A;  1B7Y B;  5B0G A;  3H4D A;  1RZM A;  3T5L A;  1NKE A;  2DNK A;  4DPO A;  2XLK A;  2IC3 A;  4C9D A;  5HAT A;  2FLP A;  3RW7 A;  1RTI B;  1WG4 A;  2X51 A;  2LDI A;  5EGY A;  3JB9 k;  1MW7 A;  4X4T A;  3W60 A;  1D9D A;  2VON A;  2DNO A;  4TY8 B;  1FX4 A;  4QWD A;  2HHQ A;  4QPX A;  4B17 A;  2KI2 A;  1FE4 A;  2CVI A;  3A8J A;  3OFG A;  2J5A A;  2YVS A;  1RHK B;  2NXE A;  5FJ4 A;  3LW5 C;  4L6V 3;  2VFU A;  4DV3 F;  4HL9 A;  4OX8 A;  3OHA A;  4X84 A;  3NBP A;  5DDR C;  3LOU A;  1TKT B;  2GMH A;  4KY3 A;  5B0A A;  2FJA B;  2COL A;  4B9S A;  2MHN A;  4ANE A;  1S77 D;  1WAC A;  2MJN A;  4LVO P;  2HFS A;  3JQJ A;  2QL9 B;  3IS9 A;  3JTN A;  1U26 A;  3KMQ A;  3GG0 A;  3BSC A;  4QWE A;  2P8I A;  1SC1 B;  3GV8 B;  2VOP A;  1SBR A;  1UVL A;  1Q5V A;  3DYA B;  3K5M A;  2QC3 A;  5KFW A;  3JQK A;  2DGS A;  5L1K A;  4CLU A;  3OTO F;  3ENA A;  4CLZ A;  3K89 A;  3LH2 S;  2W2M P;  3FJ2 A;  1QTM A;  2CPE A;  4C6A A;  2ROE A;  3IO1 A;  1B0T A;  4NLY A;  2QL5 B;  5KFL A;  2CZ4 A;  4CLY A;  2ZH3 A;  1H72 C;  1SKS A;  5AE1 A;  5EN1 A;  2F5G A;  2V34 A;  4IQX A;  1K44 A;  4XO0 A;  1KQG B;  3PEH A;  5LOQ A;  2MQP A;  5IT4 A;  2XLI A;  4C3K A;  1UZH A;  3LP0 B;  1QLN A;  3D4J A;  1R6V A;  1K0T A;  1HLW A;  1W7W A;  3RB3 A;  3NGD A;  1FER A;  1XMO F;  3EGN A;  4QJV A;  3D66 A;  5CYM B;  4OYX A;  3KK1 A;  1RKJ A;  2YX4 A;  1VQS A;  2KT3 A;  5HVF A;  1VOM A;  2V2K A;  2V4R A;  4JYA J;  2K06 A;  4E2F B;  2XMK A;  4PZV A;  2GCF A;  2BM1 A;  3VTI A;  4F4Z A;  3BQ2 A;  2WVF A;  2ZDP A;  2JLG A;  4A8Y A;  3ULH A;  3R5A A;  1M5K C;  1AXQ A;  1N6Q B;  2KVI A;  4TQR A;  2MQM A;  4WP9 A;  1VC5 A;  2QX0 A;  4U96 A;  2GAH C;  2AEF A;  1V6H A;  2B4O A;  5FDL A;  1CVJ A;  3UE2 A;  2W4C A;  1ICE B;  2VG6 A;  4HI2 A;  2WSE C;  1SIZ A;  3HSD A;  4FF1 A;  1TFY A;  3OSN A;  2O5D A;  2KG1 A;  2FPH X;  4P72 A;  2DGT A;  4DV1 J;  1XQI A;  1FDN A;  1VQ5 S;  3CGI A;  4HEA 9;  3JAM Y;  2C2M B;  2CDQ A;  4CT8 A;  2XMJ A;  1P1L A;  2GHW A;  2HQC A;  1ZZN A;  2KRR A;  3W9H A;  5LXY A;  3MFI A;  4BWM A;  3QAU A;  5LT5 A;  1S76 D;  4JBC A;  2HFU A;  2Y3Y A;  4DXL A;  3TVY A;  2J6S A;  4EO8 A;  3I5B A;  2LCW A;  3G8S A;  5IT0 A;  4M95 A;  4M8L A;  1N0V C;  1A7G E;  4NLW A;  4B3S J;  3NGT A;  2CQ0 A;  1FJG J;  4DUZ J;  2LU2 A;  2OTL S;  3MEG A;  5C25 B;  4WZM A;  1NH8 A;  1DLO A;  4I6A A;  3W2V B;  2OSR A;  2ZOM A;  2O66 A;  3FRZ A;  2B0G A;  2P6T A;  2DR8 A;  5GAH I;  1YJR A;  1VYA A;  1HWK A;  1KD1 T;  1IBL J;  3A8K A;  1ZM3 A;  2LXI A;  3SSQ A;  3OR1 A;  4ZVT B;  3BKT A;  4DF8 A;  2HVH A;  2KXN B;  4USU A;  1S1T B;  5F3T A;  4DDF A;  1KKH A;  2FTR A;  1F9E B;  3QO9 A;  4YB1 P;  4K4T A;  4JI6 F;  4ZIW A;  1F3V A;  2QLX A;  4DV2 J;  4URS A;  4M5N A;  3CCV S;  5EX3 A;  4C3L A;  5JVH Q;  3GTY X;  2DCU B;  4TYA A;  3KK3 B;  5L1L A;  1RT5 B;  4KKO B;  3BSN A;  1WHV A;  2CKW A;  3D1H A;  3CJ5 A;  2CQH A;  3M30 B;  3TI0 A;  3HK2 A;  3S6E A;  2XZD B;  4KH1 B;  2DTJ A;  2XY7 A;  1IKX B;  1RK8 A;  1D3W A;  1LK5 A;  3CXC R;  2RQC A;  3HKZ D;  2ZIT A;  5CYQ A;  3RYL A;  3RGI A;  2AKW B;  1T9T A;  4RW7 A;  1U09 A;  1N5S A;  3TZW A;  5K8P A;  4I2Q A;  4PXD A;  5L39 A;  3HX9 A;  1CC7 A;  3OPK A;  3CD7 A;  3LP1 A;  3IRX A;  2BYC A;  1YJ9 S;  1VQ8 S;  2ATL A;  2EK6 A;  3FNN A;  1JLF A;  3C8Y A;  4DQI A;  5LMN F;  4DFM A;  3EIC A;  3ZTP A;  1GMW A;  4P9S A;  2CZV C;  3H4B A;  4QBU A;  4KBI A;  4O0I A;  2VG5 A;  3TJA A;  4DPW A;  3ZNJ 1;  5AE2 A;  4DFK A;  1QD1 A;  5IS2 A;  2IBK A;  2CIM A;  4X62 F;  2B43 A;  2PO4 A;  2XO6 A;  1GH8 A;  1XWL A;  2VC0 A;  2DIU A;  2XMM A;  1RE1 B;  4J9L A;  2XY5 A;  3ETM A;  1URN A;  4WKR A;  2K8G A;  1TTH B;  2L3M A;  1FRH A;  2IYI A;  5HRO A;  2FHM A;  1HNX F;  2UVW A;  2OPR B;  1H7X A;  1SCJ B;  4F0K A;  1H6K X;  3IM9 A;  1F5C A;  4C8L A;  3CD5 A;  2XC9 A;  3JTO A;  2H4Y B;  2NYI A;  5BYQ A;  2K1R B;  3DRS A;  2P9G A;  5LSR A;  4OJG A;  4M5I A;  4Q45 A;  5ETN A;  2M3D A;  5HMW A;  1UA0 A;  3FFI A;  3F0N A;  4F7V A;  1M90 T;  2RIL A;  2R4F A;  3W9I A;  4MK9 A;  2GJ2 A;  3L4B C;  4XK8 C;  4EFA C;  2LVW A;  2IM3 A;  1KTQ A;  2HPU A;  2Q3P A;  2HG4 A;  4DSJ A;  4E0D A;  2Q79 A;  3ADA C;  4AFF A;  1UFW A;  3Q83 A;  4KHR A;  3PO5 A;  1EX8 A;  1RAF B;  1R0A B;  3T1Y J;  2J7W A;  4WF9 Q;  4G65 A;  2WZ1 A;  2OSQ A;  2D9O A;  3GIJ A;  4JI8 F;  2CZ9 A;  1BQM A;  3MAQ A;  2HZC A;  3EZ5 A;  4OX9 J;  4ECV A;  4QR0 A;  1VRT A;  1P1T A;  1SQG A;  4KGZ B;  1VBX A;  2B9Y A;  1YX2 A;  4B02 A;  3HPO A;  4DS4 A;  4ZVP B;  3V6J A;  3HHL B;  4DL3 A;  2W2N P;  1T0T V;  2OIH A;  1FTR A;  3IA0 A;  2YBV A;  2IA0 A;  5B7W A;  1FNM A;  2E5H A;  3PKY A;  3ZXW A;  4I64 A;  3NCR A;  2OJ3 A;  3QFH A;  2WVC A;  2MLY A;  4URG A;  2E1P A;  3QRP A;  2H51 B;  2XMU A;  1RAD B;  2WRM A;  2WHO A;  4ZDN A;  3TZY A;  3BR8 A;  1SH2 A;  3QJL A;  4DOZ A;  4OZN A;  2D41 A;  3PHE A;  3W64 A;  3JSM B;  4JI5 F;  4A8W A;  3MEC A;  4B3R F;  4F3M A;  1HQU B;  3G86 A;  4USK A;  1FKO A;  2CQG A;  2OPS A;  3N6M A;  3PDN A;  2J8S A;  4PWD A;  4LF2 A;  3U1M A;  3HJF A;  1S6U A;  2FVR A;  2ZOG A;  4CWB A;  2WW8 A;  5D0R A;  2IA6 A;  3MPU B;  5T7L B;  2IVM A;  2VD3 A;  1IKW B;  1UJ6 A;  3QGH A;  4YEA A;  1FD8 A;  3K5L A;  5B0D A;  3LPE A;  1QSY A;  3SQG A;  4ELV A;  3QT5 A;  4I1T A;  2RDD A;  1IKV A;  2V2Z A;  4H4M B;  5C42 B;  2NXU A;  3BF4 A;  4M5D A;  3AD7 C;  1HIY A;  1JNZ B;  1F2H A;  4HTI A;  4PAA A;  4W92 B;  2XUL A;  3A12 A;  2E5I A;  1F5A A;  1YJU A;  2R7S A;  1J5E F;  1RYR A;  2DNN A;  2J9C A;  3BN7 A;  3HKW A;  2FUG 9;  1QVF R;  2B9X A;  4PYD A;  4UF4 A;  1RTJ B;  1EET B;  2KHD A;  5CQG A;  4KHP J;  3EGV A;  3HM9 A;  1RTZ A;  3EXY A;  3V6H A;  2F63 A;  2I9S A;  3VV2 B;  1RAO A;  2L08 A;  4DL0 C;  1VMB A;  3I87 A;  3U02 A;  1VBK A;  3ZTS A;  1S57 A;  1HQE A;  3RUB L;  1S0N A;  4O3S A;  2VOO A;  2IY5 B;  5KG1 A;  3BH6 B;  3C6T A;  5DG9 A;  3V81 B;  4BBY A;  3CJ0 A;  2KTQ A;  1S6P A;  4AXJ A;  3PW5 A;  1SXL A;  3DRP B;  1JKH B;  2WK4 A;  1B70 B;  1FE0 A;  3NAH A;  3KLH A;  3IGN A;  1Q7L B;  1SV5 B;  5AJ3 F;  5JUM A;  2QSF A;  3CCR S;  1WTF A;  2B9W A;  3BBF A;  2XWY A;  3K2Y A;  3CDE A;  2QLW A;  4AYB D;  2YXL A;  2LQ8 A;  4NLV A;  4K4W A;  1HBO A;  2M4M A;  3AFG A;  4L76 A;  4ATN A;  1WDT A;  1O6X A;  3CW2 C;  2LU1 A;  4CO1 A;  4I4B A;  4YME A;  4ZVG A;  3O1L A;  3G8Q A;  1H2V Z;  1VQ6 S;  1K0V A;  2QMX A;  3HHN B;  2Q43 A;  5CCL A;  2OEJ A;  5D4P A;  2IHR 1;  4IFY A;  4RW6 A;  4LR8 A;  1PBU A;  1EKR A;  2HW3 A;  1WOS A;  4BS2 A;  4ZPT R;  3IMQ J;  4DN9 A;  3GFZ A;  1ZOT A;  4NLQ A;  1MSW D;  2Z30 B;  1FJE B;  2B6A B;  1BY9 A;  1RT2 B;  1QTN B;  1S7I A;  4ED0 A;  1GXT A;  4ZVS B;  3EVM A;  3DLE B;  4O4G B;  2FHO B;  3HDS A;  3C3L A;  1X0P A;  3HFV A;  2XMV A;  3CC7 S;  3FKB A;  3OXG A;  1LEO A;  1Z4U A;  3L09 A;  3PVX A;  2RAQ A;  2W2P P;  2YKM B;  4RR5 A;  3CUN A;  1KTV A;  3D0H E;  3IG1 B;  2NXC A;  1RWK B;  1X9S A;  4EYI B;  1TKZ B;  2HFZ A;  4RW9 A;  3SEO A;  4KB7 A;  3Q8Y A;  1MU2 B;  3SZ2 A;  1UWA A;  1Q8K A;  2EC2 A;  1NEE A;  5ETP A;  5J2M B;  4KV8 A;  2KT2 A;  2M88 A;  2EK1 A;  2XMT A;  4DV4 J;  3A3P B;  5L8R C;  4OQJ A;  4ZHR B;  1YRX A;  2J9D E;  3CCE S;  1DTQ B;  1KVK A;  2UXB J;  1T9U A;  2GO8 A;  3IBW A;  5U47 A;  1RXO B;  2MSS A;  3DOK A;  4NCG B;  4OHV A;  2LQ5 A;  2B4V A;  1EB0 A;  3IBC B;  4J9K A;  2IRX A;  3FCH A;  1AZS A;  2MQQ A;  3AH6 A;  2KH9 A;  3W2W A;  2UUC F;  4RUH A;  3MPW A;  3PJX A;  4ZLP A;  4DLG A;  3CJK B;  3MM8 A;  4J9V A;  3C19 A;  3S01 A;  1XJW B;  3K5O A;  4HI1 A;  1N48 A;  1T95 A;  4DQQ A;  2HHU A;  3MOZ A;  3M6X A;  4RO0 A;  4DS5 A;  5D78 A;  4M5J A;  3ETO A;  4WYW A;  1RI7 A;  2RDI A;  3A3N B;  1QE1 A;  2A6M A;  9ATC B;  2FIU A;  2FJE B;  4GO5 X;  2F8E X;  3M1V B;  3HZE A;  3CCJ S;  3EPG A;  2KDO A;  3D2W A;  3FEX B;  1QJH A;  1G4C A;  1AYE A;  3W65 A;  2D69 A;  4I6Y A;  4HT5 A;  4ECW A;  3AA9 A;  1U8S A;  3M6U A;  4FP9 A;  1CBK A;  5M2R A;  3GCX P;  4TU9 A;  4ZVR B;  3TYT A;  1YQH A;  1NME B;  1VLY A;  3THV A;  5GMK a;  3FBB A;  5LMU F;  4DEZ A;  3PX0 A;  1UW9 A;  3GU0 A;  1IR1 A;  3N5B A;  1EZZ B;  3MFH A;  1UZD A;  1NDL A;  3R2D J;  4I56 A;  4L3K A;  3CJR A;  3CPW R;  1Y9O A;  2QFJ A;  2QIF A;  3KK2 A;  1FVQ A;  3UDC A;  4AT1 B;  1KR4 A;  4LF4 F;  1IKY B;  3D1Q A;  2DH8 A;  1KOH A;  3MM7 A;  3SI8 A;  3IRW P;  1L3V A;  3QJP A;  4DG1 A;  3H5Y A;  4UQT A;  3POT A;  4DR3 F;  1RAJ A;  3BGR A;  2UXC F;  4PUO A;  5J1E A;  3QLH A;  4FF4 A;  1W25 A;  1OS5 A;  1UTA A;  4G1P A;  2E5L F;  3WX4 A;  4OYI A;  4DHV A;  3PYF A;  1YBA A;  2ZNZ A;  1N54 B;  3NCQ A;  5KAK A;  1E6Y B;  2H5J B;  3S7R A;  1REV B;  2GW8 A;  5KFC A;  4A8Q A;  3N01 A;  2C3P A;  5ETQ A;  2F4F A;  3OSP A;  3IWL A;  1YJ7 A;  2JWN A;  3K5P A;  5D4L A;  1TK8 A;  3AXM A;  3NMR A;  4K0K J;  3FRY A;  1HHS A;  3R2C J;  5KT2 A;  3HUL A;  4R0E A;  5CA5 A;  3NNC A;  4RNM A;  1X4F A;  2ZHO A;  3DLG A;  1VHI A;  1HNW J;  4DV0 J;  4HH0 A;  4JI7 F;  2ASJ A;  4YOE A;  4ANC A;  2EEY A;  3DI6 B;  1SJ4 P;  1MRO A;  2DNH A;  3CME S;  4UOC A;  2W4P A;  2K3I A;  2I38 A;  5A6W A;  3ITH A;  2XY6 A;  3DGV A;  3QT8 A;  3PM9 A;  2YNG B;  1R8H A;  2HFO A;  2CG4 A;  3SSS A;  1S6O A;  4O0N A;  2UUA F;  1YK9 A;  1XEZ A;  4H4K C;  2L41 A;  2IAJ A;  1U25 A;  2UUT A;  3QSY B;  3M8P A;  2HND A;  4XPE A;  4KHM A;  4ED8 A;  3W63 A;  1NZA A;  2HYI B;  3LWM A;  2DO4 A;  5AXK A;  3GR1 A;  5JJB A;  2OEL A;  4Y2K A;  4YY3 F;  1TUW A;  4GC6 A;  2RJZ A;  1T8E A;  1FFS B;  4DV7 F;  4A8F A;  3QPI A;  1JLE B;  2GS8 A;  2HZV A;  5L1J A;  5A8K A;  1S9G B;  4J90 A;  3Q8P B;  2WTF A;  2RML A;  2OEM A;  3KMS A;  3BDE A;  3Q86 A;  3LF0 A;  2AWZ A;  4UZC A;  1RAH B;  4PCQ A;  4CI0 B;  3NGU A;  1YJT A;  3BZQ A;  1BLU A;  1X31 C;  1IM4 A;  1KVJ A;  4DSF A;  2EBG A;  3NS7 B;  1T03 B;  3I96 A;  4RW4 B;  2PDA A;  3EWG A;  3HI9 A;  2C3Y A;  2MTL A;  2IRU A;  3W61 A;  4X64 F;  4DL6 A;  2R3V A;  3HFZ B;  3GSD A;  4WII A;  4V1A k;  1U1M A;  5K8O A;  2BW2 A;  1WUU A;  3VAM A;  1VJQ A;  2B4U A;  2MGZ A;  4P52 A;  1Q1K A;  1TL7 B;  3NXZ A;  3QGP A;  2N7Y A;  4I7F A;  4OV1 A;  3RB4 A;  2RS8 A;  3FZ2 A;  2VDH A;  2JEJ A;  3UW1 A;  1YJW S;  2YKP A;  2AJ2 A;  2F65 A;  5ADZ A;  1NJY A;  3H2V E;  3MUR P;  2JNJ A;  1S49 A;  1TV6 B;  2ZBI A;  2HNZ B;  1XNQ F;  2BAN B;  1U45 A;  1NLK L;  1AB8 A;  3MUM P;  3MED A;  2X3D A;  4JV0 A;  2CJK A;  2KVQ E;  3G6X A;  4FPR A;  2D9P A;  2ZD1 B;  1BWV A;  5D4N A;  1S1V A;  1O5J A;  4USW A;  3A4T A;  3FBE A;  1X4D A;  3WIU A;  4P2X A;  4C8O A;  4X2B A;  1GMV A;  2CPZ A;  5E3P A;  2R7O A;  4ICL A;  1LW0 B;  3M8W A;  2BA9 A;  2QTW A;  3OVB A;  2G4B A;  1AW0 A;  1MN9 A;  4AXI A;  4ELU A;  1KHV A;  4KR0 B;  4RZR A;  4DMZ A;  1FJC A;  3ZZ0 A;  2ZH4 A;  3W62 A;  5ETM A;  3CCU S;  1PJ5 A;  2AD9 A;  4B9V A;  5F8J A;  2OMO A;  2M7S A;  3MMC A;  3DHX A;  4Y2C A;  2B51 A;  3MD1 A;  2VFT A;  4RW8 B;  4AQY J;  4ID5 B;  3KJV B;  3DLL Q;  4B3R J;  2MZQ A;  5HLF A;  3H42 A;  4DI6 A;  4K4U A;  1R3N A;  4H4O A;  3RAM A;  2IMO A;  1F6T A;  3R8Y A;  1HBM A;  5KFB A;  4RKU C;  3SFG A;  1Q8B A;  2C3O A;  3PV8 A;  1YBU A;  2IYG A;  3MPY A;  3VQS A;  3BO4 A;  3MTK A;  5E0O A;  4CT9 A;  1LWX A;  1K8A T;  3OXF A;  4OI0 A;  1SB6 A;  4ZN1 A;  2MKK A;  3BQ0 A;  1V3Z A;  2KN4 A;  2AGQ A;  5KTQ A;  4YDX A;  4YN3 B;  2BVZ A;  1OYE A;  3J81 Y;  2OPQ A;  3KDN A;  2M0G B;  2WOM A;  3GIR A;  4NML A;  2CQI A;  5E41 A;  4NEY A;  4QYZ J;  3MEE B;  3UD5 A;  5F9N A;  3HVW A;  5E7O B;  1LWF A;  1S6Q A;  3KLG B;  3B4D A;  1UWB B;  4F0H A;  1OQ3 A;  1SQE A;  1EIY B;  4CIO A;  1M1G A;  3SCI E;  4CZC A;  5FLX U;  2LEC A;  3TJ9 A;  2ZVS A;  1W2B R;  1J5E J;  2IC3 B;  1U1P A;  4QPT A;  4LSL A;  2ADB A;  4LF6 J;  3BR9 A;  4MKA A;  1S9E A;  3M9M B;  3MM6 A;  4NA3 A;  5ETV A;  3AOB A;  4AL5 A;  2ZJP Q;  1WG5 A;  2VFS A;  4GC7 A;  3QWP A;  1T11 A;  4FVC A;  4DSE A;  2DNL A;  2G2Y A;  2KT5 A;  1SUQ A;  1SI9 A;  3C6U B;  2VA2 A;  4NYZ A;  1H7W A;  3DOM B;  2HIY A;  3G82 A;  2W7O A;  3M2U A;  3ENQ A;  3LUY A;  3LGH A;  4ES1 A;  3NBP B;  5EDW A;  5CXT A;  1TU0 B;  3P45 B;  2MZJ A;  2OD6 A;  3OD2 A;  2ZKU A;  2KFN A;  2JVR A;  5HN0 A;  3IS9 B;  5CH7 B;  4PQU A;  4CRJ A;  4OI1 A;  4X65 F;  2XGQ A;  1KRP A;  2FVQ A;  3LP2 A;  2OD4 A;  3KOA A;  2HK2 A;  5F41 A;  4OHW A;  2E7W A;  4I6W A;  3GMG A;  4DR6 J;  4ZJO A;  1YWX A;  4U9R A;  4YB7 A;  3L7O A;  4YR0 A;  3CDB A;  2ZHB A;  2IIH A;  4UZB A;  2FC8 A;  1A0O B;  2RUS A;  3OFF A;  1TL3 B;  3W8G A;  4RX6 A;  4PWU A;  1M5V C;  1U0H A;  1HHT P;  2FZK B;  2GX8 A;  2EFN A;  1VQ4 S;  3ONQ A;  1S72 S;  3CF5 Q;  1CUL A;  3CJS A;  3A13 A;  3J81 j;  2IFX A;  3RZA A;  4RL1 A;  4CP5 A;  3EMT A;  1MWY A;  4M5H A;  1KN6 A;  1J5O A;  1WC4 A;  2CJ9 A;  1X4A A;  1HBN B;  1YJV A;  3K59 A;  1HD1 A;  4ZPA A;  2JL9 A;  4FYY B;  2M70 A;  2FDN A;  1ULR A;  3SQO P;  2HNY A;  1I94 J;  1HI0 P;  4YQW A;  4ECT A;  5J2P A;  2VG7 B;  4B08 A;  2VIC A;  3KK1 B;  4K8R A;  4F4W A;  2ZBR A;  3ENV A;  4HH1 A;  3LAM A;  5MAO A;  3CMA S;  1ZA1 B;  5G0R B;  3P5B P;  3RBZ A;  5ETO A;  3RBX A;  5K9F A;  3VAI A;  2UZA A;  4MH8 A;  3PX4 A;  1WC0 A;  2GO9 A;  3DRR A;  2OTJ S;  2CNL B;  2V4J A;  5IC4 B;  1TMM A;  3G87 A;  4FKX A;  1FK9 A;  4GKJ F;  2ZKT A;  3GIL A;  1ROF A;  1VIX A;  4C8N A;  4TY9 A;  3TJ8 A;  2MEW A;  2X1A A;  2Y1L B;  4OMF G;  3HJV A;  4ZVE A;  1RT7 B;  4Z37 A;  1CJT A;  1IJF B;  2ZWP A;  3J80 U;  3U1L A;  4ZLN A;  4F2R A;  3CDA A;  1I3O B;  2F9D A;  1UVK A;  3QSI A;  1T7P A;  2BQ3 A;  3KHR A;  2I0X A;  1U24 A;  2CAJ A;  3THP A;  3DN9 A;  5LJ3 Y;  1RWW B;  4TNO A;  4WE1 A;  1NHU A;  4CCH A;  3C15 A;  5KG2 A;  5HAN A;  3JYT A;  4AUK A;  3BGU A;  3HHL D;  3P8B B;  4UTG A;  3E01 A;  3SBM A;  4UOH A;  2RVJ A;  5F8M A;  4W4M A;  3DU6 A;  3FMW A;  5KT5 A;  2W8L A;  1PCA A;  2G2O A;  4IH5 A;  1FNX H;  2QLJ B;  2QA4 S;  1DLO B;  5KG4 A;  1KQF B;  2QYC A;  3OFH A;  3TZZ A;  1UEK A;  5IOL A;  2OEK A;  4LQ3 A;  1FKP B;  4JV1 A;  1IR2 A;  2CQ3 A;  2CPX A;  4KGV B;  3OR1 B;  4ZP8 A;  1TK0 A;  1U0S A;  4EO6 A;  1UJ5 A;  4Q2M A;  1VQN S;  4P10 A;  1Z2L A;  4RBU A;  4OZL A;  5KT7 A;  3J7A N;  2YY3 A;  3GFX A;  3QO9 B;  3FCV A;  2B5J B;  4F8R A;  4DR3 J;  1RT1 A;  4P75 A;  2MMY A;  1GX6 A;  5KFU A;  2PN6 A;  3DOL A;  3L7P A;  1IBM J;  3CC4 S;  1VBY A;  2E5L J;  2CWX A;  2XHC A;  4HT7 A;  3LTO A;  1ZS6 A;  2G0J A;  4OZJ A;  3LGN A;  2HRY A;  2HVI A;  5HO4 A;  3DDI A;  1H98 A;  3R5J B;  1D1U A;  5KFX A;  3TAR A;  2VPY B;  4NOH A;  1KLM B;  4HR2 A;  5CYQ B;  5ITH A;  3E8O A;  2GJI A;  4MKB A;  2VFV A;  3KNA A;  4OV6 A;  3MAA A;  3R7S B;  4I2Q B;  2BJ9 A;  4RPF A;  1SJR A;  3LP1 B;  3IRX B;  4A8K A;  5D6G A;  4O4R A;  1RTH A;  3SIP B;  4LBI A;  2OLW A;  5HJY A;  3OJS A;  2CPI A;  3FSI A;  1VGY A;  2MPU A;  4YHH J;  2GV1 A;  4NA1 A;  3PJ9 A;  1QAX A;  3IR6 B;  3U27 A;  3OV7 A;  2SXL A;  2VG5 B;  2HGL A;  2KZM A;  2ZBC A;  3OTE A;  2IVY A;  3UQS A;  3FQK A;  4F25 A;  1XER A;  4R5P A;  1UPP A;  2YWG A;  2HWH A;  1WC6 A;  3NCP A;  3QGI A;  1YRT A;  4ITS A;  1RAI B;  2B7C B;  3MPV A;  4KT0 C;  5A8R B;  4U7C A;  4QYZ K;  3IGV A;  4IRD A;  2M2B A;  3CJQ A;  3DRX A;  5DM7 Q;  5J2Q A;  3D28 A;  3P49 B;  4PWW A;  4JYA F;  3BKU A;  2B3T B;  2XLJ A;  5HRO B;  2MZ1 A;  2XCA A;  2EVZ A;  2YWK A;  2F8H A;  4C0O C;  2V4Q A;  3CCW A;  1TK5 A;  5KFO A;  1A6L A;  4N41 A;  4FYW B;  1RAE B;  1Q53 A;  2WVE A;  3DRS B;  5F8N A;  4N5S A;  3TUJ C;  4IG0 B;  4USM A;  4DBQ A;  1TVR B;  4TLQ A;  2KZZ A;  4HHU A;  1YLX A;  1CLF A;  4DX6 A;  4KSE B;  3FFI B;  3W3S A;  5EUH A;  5MLC V;  2XSF A;  3UCU P;  1MN7 A;  1WC3 A;  1Q79 A;  4DR4 F;  2MKH A;  2X1F A;  2Z4P A;  4FS1 A;  4LBH A;  5GVQ A;  1UET A;  4QWA A;  2GVD B;  2W8K A;  3ET6 A;  2BV3 A;  2W9C A;  1Y3K A;  2QFI A;  2VJU A;  5KT4 A;  2KXF A;  3IC1 A;  4MYU A;  1RWU A;  4ER8 A;  3TX0 A;  1M5O C;  1FKA F;  2FC9 A;  1IBC B;  2XTJ P;  4WWS A;  4JI4 J;  1HW8 A;  2CUY A;  4N7T A;  2V8H A;  3X3U A;  4X64 J;  1UFK A;  1TFW A;  3UVJ B;  3HVR A;  3DXB A;  1ZET A;  3RTV A;  2RHQ B;  4ECZ A;  4CNY A;  1U6Z A;  1BQM B;  3K0J A;  1MWQ A;  3CJT A;  1RTI A;  4B3S F;  1VRT B;  1FJG F;  4DUZ F;  4K7Q A;  4DSK A;  4JI3 J;  4LF5 J;  1FRL A;  3I31 A;  3KG0 A;  4HLB A;  2XS5 A;  4CO3 A;  4TY8 A;  4X4V A;  1UL3 A;  5IWA J;  3P3D A;  3HVT B;  1VS3 A;  1RP5 A;  1JXL A;  4NXN J;  1IBL F;  2KRB A;  3IN5 A;  1WJ9 A;  2D1C A;  2K2P A;  4R8U A;  5HJX A;  2GVZ A;  4WK1 A;  5IV4 A;  1C0U B;  5DQI A;  2RB7 A;  1YZ6 A;  2GNK A;  2NR0 A;  1TKT A;  3Q8S B;  4ZIT A;  3Q89 A;  3DFE A;  4QW9 A;  3KLV A;  3N9U C;  3FBF A;  1FKO B;  2JOQ A;  1YSJ A;  2NQP A;  2J7K A;  2OPS B;  2R8J A;  2B4P A;  3SCL E;  1S5Z A;  1RT6 B;  4M5G A;  3TW0 A;  4PWD B;  3LAK A;  4J9O A;  4L3N A;  1X60 A;  4TXS A;  2FHJ D;  4ZP9 A;  2CJA A;  3DYA A;  4K4Z A;  1GTE A;  2AYE A;  5KFG A;  4EZ6 A;  1RWP B;  1WWH A;  1CJU A;  1HWI A;  4I67 A;  4DPY A;  3ZTR A;  2E1A A;  5B0B A;  2AZ3 A;  1IKV B;  1L3U A;  3ZFV A;  1L5U A;  5KFQ A;  2KG0 A;  5D15 A;  4JI1 J;  4NX9 A;  3R3T A;  4M5D B;  2XYP B;  2DGQ A;  4NE9 C;  3GSI A;  1CC8 A;  3JSY A;  5M2P A;  3WX8 A;  2F4V F;  4IR9 A;  1RAC B;  2F1F A;  2DO0 A;  4KAI A;  1DUR A;  5FII A;  4UT4 A;  2NZC A;  1B64 A;  3T9N A;  1YI2 S;  2R9L A;  3R6G B;  5BR8 F;  3KWM A;  5CYM A;  2NSC A;  3OBI A;  2KM8 C;  3OTD A;  3KYL A;  3H98 A;  1F9F A;  2ZH6 A;  3G6Y A;  3SDE A;  4U95 A;  2V2V A;  2J9E A;  3EXC X;  4ED2 A;  1HQE B;  2W9B B;  4RU9 A;  1WF1 A;  1TL1 A;  4WPA A;  1T94 A;  1UEV A;  3C6T B;  2YNI A;  3QT6 A;  2R8I A;  2H5I B;  1S6P B;  1S7H A;  2AGP A;  4QU6 A;  1Y0H A;  4NLR A;  2QG9 B;  4N47 A;  3N0V A;  3WZ0 A;  3DMJ B;  5LL6 d;  1NCL A;  1XIQ A;  3TR5 A;  1LWE B;  4QU7 A;  3AJ1 A;  4JI0 J;  2R7X A;  1YBT A;  5DGB A;  2VL1 A;  1K9M T;  3RBE A;  5HMY A;  4OZ0 A;  3TP2 A;  2QZ8 A;  1Y00 A;  1N5V A;  2ALY B;  4URQ U;  1VRU A;  3IR7 B;  4KRW A;  1HR0 J;  4B3T J;  1RHQ B;  3T1H F;  2C1E B;  3PIP Q;  3WIV A;  2D74 B;  2Y1R I;  2VBY A;  5DG8 A;  1BE4 A;  1ZAX A;  4O3N A;  5LJ5 Y;  2QA1 A;  4BWJ A;  4ZCI A;  4DCP B;  4IFY B;  3H59 A;  1DAX A;  1WG1 A;  4ED1 A;  2XNR A;  3KLI A;  3MDF A;  3OW2 R;  3HHK A;  4Z7Y A;  3KHH A;  1G2E A;  3T1Y F;  1O51 A;  2XYH B;  4LFB J;  3TVK A;  1JXV A;  5F9L A;  1U2R A;  3D6H B;  2LFV A;  4CLK A;  2WSC C;  1TAQ A;  5HBM B;  4DUY J;  1RLD A;  1N36 J;  3OUY A;  2DY1 A;  1KDN A;  1Y5I B;  2DHH A;  4RW9 B;  4CLW A;  3HLU A;  1FD2 A;  1N34 J;  2DR7 A;  3DLJ A;  2BQU A;  2PFD A;  2OO4 A;  3GG1 A;  4IG3 A;  5F8I A;  1TR0 A;  4I69 A;  4FDF A;  3CJ8 A;  3EJM A;  2ZZN A;  5HK4 A;  1P6T A;  4QZV B;  4DCJ B;  3VVU A;  2D3O R;  2BBE A;  3EDR B;  1N88 A;  2HWT A;  3KK3 A;  1X9W A;  3QAE A;  5GME A;  4PG4 A;  2XO7 A;  4EK2 A;  1EQ0 A;  2CQB A;  4QYR A;  2F40 A;  3DOK B;  3SCJ E;  2R2S A;  4C8K A;  2VDI A;  1FRI A;  4H4K A;  1AZS B;  1VQM S;  3D6T B;  3CCT A;  4P74 A;  4F4A A;  5HVH A;  4TLR A;  4MAK A;  5KT6 A;  5IT9 U;  3DM2 A;  4LRA A;  2RQM A;  1WHX A;  3MM8 B;  4LJM A;  2DGW A;  2ALZ A;  3WHI A;  3D54 A;  3QNW B;  4BLG A;  5HP1 A;  3PKM A;  1TKX A;  3BBC A;  2ASD A;  4ZS6 A;  4DCO B;  5E3C A;  3O6Q A;  1M5P C;  2LDY A;  2HLT A;  1QAY A;  3PAC A;  1HYS A;  4WZQ A;  3LPY A;  4PG7 A;  1WEY A;  2A10 A;  4P2M A;  2XS2 A;  2V63 A;  2K7J A;  3DRY A;  2FGC A;  3CE8 A;  3GV7 B;  3I55 S;  2DNZ A;  3KUE A;  4BC9 A;  1VHF A;  1GAO A;  1NB7 A;  2MST A;  2RU9 A;  2BJE A;  4GKK J;  1TUG B;  2H9Z A;  1Z1Z A;  4KHP F;  3FQL A;  5BXI A;  2L48 A;  5H9E K;  3VF0 B;  1SJ3 P;  1PJ6 A;  3KK2 B;  1QSL A;  4DL2 A;  1L3K A;  4CO2 A;  1NK7 A;  2FJX A;  3GQC A;  4LF1 A;  1O0P A;  2UXD F;  1QSS A;  1U1L A;  3MM7 B;  1WNE A;  2MQL A;  4DG1 B;  1LKZ A;  3BGR B;  1NJW A;  3TAN A;  2V0N A;  1CG2 A;  5HVG A;  1DHM A;  4PUO B;  4HHJ A;  1KP6 A;  3ILI A;  1FA0 A;  4PPD A;  1U8W A;  5C2G A;  4OLP A;  1XR5 A;  2YX1 A;  2ZBP A;  1S4E A;  1G1X A;  3TEG A;  3ILL A;  4PAB A;  2D3Z A;  1KC8 T;  1WDD A;  4ZA1 A;  2D7S A;  3OR2 A;  1FWK A;  1J2V A;  1YG0 A;  3G71 S;  2KJV A;  1Q95 G;  2HS0 A;  1XC9 A;  3OTB A;  4F04 B;  3MMB A;  3MHY A;  3DLG B;  2Q6C A;  4A47 A;  4PQA A;  2BJ3 A;  3R1L A;  3GIM A;  1QUP A;  2NXN A;  3VWS A;  4RNO A;  4MK8 A;  1QVG R;  2BE7 D;  4OHZ A;  3AOD A;  1PYO B;  1FRX A;  1MRO B;  2W25 A;  1U2C A;  1OPZ A;  4J9N A;  4ZP7 A;  1TMJ A;  2OHD A;  3AQP A;  3KTQ A;  3ITH B;  3GJR B;  3HHL A;  2BW7 A;  4W90 B;  3NEK A;  1HNV B;  2YH0 A;  5E33 A;  2EPI A;  3GV5 B;  2VPX B;  4XTT A;  3HD2 A;  5KFI A;  3PIO Q;  4BDP A;  1NZ8 A;  4DL7 A;  3F41 A;  3CJ3 A;  1KSP A;  5HQM A;  3IAM 9;  3WC0 A;  1XR6 A;  2JDJ A;  3ISN D;  4C2M A;  5JVG Q;  3PCO B;  1D9F A;  3AOC A;  3IP0 A;  2GQQ A;  4OYZ A;  5GMD A;  1HKA A;  5AT1 B;  5AXL A;  1BHN A;  3H5U A;  3T6B A;  2HND B;  2AYM A;  3AB4 B;  2VKR A;  4QR1 A;  4DV4 F;  4LRE A;  1ITP A;  3KDO A;  1HQU A;  1YHQ S;  2Z58 B;  3I56 S;  2UXB F;  1NJI T;  3FVY A;  3O8W A;  2IM0 A;  3P4U B;  1P8G A;  3KHL A;  2CQ2 A;  5T7L A;  2ADC A;  1VR6 A;  1CJV A;  5EX0 A;  5LXR A;  5I3Q A;  1UMJ A;  1NM2 A;  1KBR A;  3ZTO A;  3RR8 A;  1M5S A;  4RLE A;  2OH2 A;  1UVN A;  3E3X A;  4QQB A;  2BQR A;  1DBD A;  4OZ5 A;  4WFZ A;  3DLK A;  3ZTQ A;  5E2Q A;  1OSD A;  1KFS A;  1Y4Z B;  4H4M A;  1PIL A;  2A3J A;  2XHW A;  1KHW A;  1WSV A;  4KC5 A;  3UNY A;  4ZOS A;  1GEH A;  4MKY A;  3PFE A;  1CS4 A;  4M5M A;  2Y9H A;  4R0J A;  5F8L A;  4DR4 J;  5H1S V;  3PR4 A;  2VHG A;  1DAR A;  3MM5 A;  2MGZ B;  2GC8 A;  2Y0B B;  3V4M A;  1RU1 A;  2Z56 B;  1LFP A;  2C2E A;  3BV8 A;  4O3O A;  3W7B A;  3K58 A;  1EET A;  2HRT A;  2LXF A;  3CDW A;  2V5H G;  2XZT B;  4MFB A;  3H40 A;  3MM9 A;  3RRG A;  3M7V A;  1CQN A;  3MED B;  4TQS A;  4FF3 A;  4BC7 A;  1W26 A;  4A8O A;  5DG7 A;  4B3O A;  2YWH A;  2UU9 J;  1S1V B;  4OYB A;  3B82 A;  4DV6 J;  3VGU A;  1IN0 A;  2FVS A;  2Y1I A;  4OYA A;  3N6N A;  2QE5 A;  2DYA A;  5KFT A;  1IQZ A;  1YZ7 A;  1Q4R A;  5THW A;  5EWE A;  1RSC A;  2XS7 A;  1RTD B;  3M05 A;  4HYK A;  1JLG B;  2MHE A;  2RKI A;  2FYX A;  3BYR A;  2QJ3 A;  4K59 A;  3BM7 A;  3MMC B;  1FDA A;  3MR7 A;  2ZUA A;  3GB0 A;  4M63 A;  1IM6 A;  4NI2 B;  4C0B A;  2ERR A;  4ZVU B;  2QL7 B;  4H4O B;  4QWB A;  3LAN A;  1VRQ C;  2LKZ A;  3BGF A;  4USV A;  3US5 A;  2JLF A;  4ECQ A;  4LFA J;  3J7Z T;  4HDH A;  4N8N A;  4K0K F;  3OVS A;  1M5H A;  4CLF A;  2E1R A;  3MPD A;  4C8Y A;  1O8B A;  3D6F B;  2HGN A;  4AND A;  2AJF E;  4LSN B;  4O4G A;  4YB6 A;  1HNW F;  4DV0 F;  3GJT B;  1FWL A;  2FZG B;  3W66 A;  3CCM S;  2FGO A;  2OPQ B;  2VBZ A;  4WK3 A;  1Q7Y T;  1S1W A;  4X4R A;  4FF2 A;  3IG1 A;  4FXD A;  2HFN A;  3QIP A;  2VQF J;  2GMJ A;  1OWX A;  2C2Z B;  3NG8 A;  1LWF B;  2LLZ A;  3O2I A;  2PSZ A;  2DNR A;  1H3D A;  4Q0B B;  1LV5 A;  4Y3C A;  2UUB F;  5DLF A;  2CJQ A;  1FX2 A;  2CPY A;  4LR9 A;  2F4V J;  4DZD A;  1MMD A;  3TAQ A;  1NH7 A;  3D7S B;  1URR A;  3H2U B;  3MUT P;  4RUA A;  3Q8Q B;  1S9E B;  3J7Y U;  3R1H A;  3HXM A;  2ZFH A;  5BR8 J;  3MM6 B;  3FMB A;  3CSK A;  2HHW A;  3MR6 A;  3TX8 A;  5D0E A;  2XI3 A;  2BJ1 A;  1SUQ B;  3TUZ C;  5DM6 Q;  1LK7 A;  4X66 J;  3KUH A;  2DR6 A;  2ZH8 A;  1VQY A;  5KFZ A;  3GPA A;  2FLO A;  3M2U B;  3BDP A;  1N52 B;  4RBV A;  3CJK A;  1Q81 T;  4CH1 A;  4PXB A;  1V3R A;  1DQ8 A;  5B0F A;  4FYV B;  2ZZT A;  4NLG A;  2V6A A;  5K14 B;  1TUV A;  4PQU B;  2FHJ A;  5KT3 A;  3LP2 B;  4F67 A;  2YH1 A;  4EYH B;  1YGY A;  3TQE A;  2GHV C;  3WDO A;  1UKU A;  3QZ8 A;  3T1H J;  4F36 A;  2Y8Y A;  4FXV A;  2RQ4 A;  2JH3 A;  3MGJ A;  2DRA A;  1HWJ A;  2WB1 D;  4Q5V A;  2Z57 B;  1RCO B;  5DRK A;  1B7F A;  1U0H B;  5IFM A;  1RIS A;  4CNZ A;  1CUL B;  3BBB A;  4KQZ A;  1NDP A;  4F4Y A;  3NNH A;  3S1T A;  3G8T A;  3RRK A;  2LYV A;  4Y28 C;  1I5O B;  1X0F A;  5F3Z A;  4AL7 A;  1X4B A;  1WEX A;  1SL0 A;  2W9A A;  5J1P A;  1J5O B;  1H73 A;  2K7K A;  5EHH A; 
#chains in the Genus database with same CATH homology
 1NME B;  2CNO B;  3D6F B;  2CNL B;  2H48 B;  2H4W B;  1RWP B;  3R7N B;  5IC4 B;  3D6H B;  3GJT B;  4ZVO B;  3D6M B;  2C2M B;  2H5I B;  2QL9 B;  2CJX B;  2CDR B;  3R7S B;  2QLJ B;  1PYO B;  1RE1 B;  3IBF B;  3R7B B;  3QNW B;  2QLF B;  1SC1 B;  2C2K B;  2XZD B;  3SIP B;  3IBC B;  3RJM B;  3GJR B;  2Y1L B;  1RWO B;  1SC3 B;  4DCO B;  1QTN B;  4ZVS B;  2C2Z B;  1PAU B;  3KJF B;  2HBZ B;  2HBR B;  2P2C B;  2XYP B;  2C2O B;  2H54 B;  3GJQ B;  1I3O B;  2CNN B;  2DKO B;  1RHQ B;  2C1E B;  2QL5 B;  2H4Y B;  3R6L B;  3P45 B;  4ZVP B;  2XYG B;  2Y0B B;  4JB8 B;  4DCJ B;  4ZVQ B;  1RWK B;  1RWW B;  1ICE B;  3NS7 B;  3R6G B;  3EDR B;  4ZVT B;  1BMQ B;  1RHJ B;  4DCP B;  4LSZ B;  2HBY B;  4ZVU B;  2QL7 B;  1IBC B;  1GFW B;  2CNK B;  1RHM B;  3KJQ B;  2XZT B;  3KJN B;  1RHK B;  2HBQ B;  2H51 B;  1I51 B;  3EDQ B;  2H65 B;  1F9E B;  5K20 B;  2H5J B;  1RWV B;  3P4U B;  1QDU B;  1SC4 B;  1RHR B;  2QLB B;  1RWX B;  1RWN B;  1RWM B;  3R5J B;  2CJY B;  3GJS B;  1RHU B;  2XYH B;  4ZVR B;  2FQQ B;  5IC6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...