3R7BB

Caspase-2 bound to one copy of ac-dvad-cho
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
95
Chain Sequence
KMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGFHRCKEMSEYCSTLCRHLYLFPGHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-2 subunit p18
total genus 20
structure length 95
sequence length 97
chains with identical sequence D
ec nomenclature ec 3.4.22.55: Caspase-2.
pdb deposition date 2011-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3r7bB00
2Y1LB 1I3OB 4DCJB 1RWOB 2H54B 2H65B 3IBFB 4ZVPB 3D6HB 3EDRB 3NS7B 1IBCB 1RHJB 2QL9B 2XYHB 3KJQB 1RHUB 2C2KB 2CJYB 1NMEB 5K20B 2P2CB 1RHQB 2H4YB 2XYGB 4LSZB 2CNKB 1I51B 2C2OB 3GJRB 2H48B 4DCPB 3D6MB 4ZVSB 1RHKB 3R6LB 4JB8B 3KJNB 1SC3B 1RWNB 2XYPB 2CNOB 4ZVTB 3SIPB 5IC6B 3GJTB 4ZVUB 3R7BB 3GJQB 2CDRB 4DCOB 1SC4B 4ZVOB 5IC4B 1RWWB 1PYOB 2XZDB 2HBYB 2QL5B 2C2ZB 1RWPB 2C2MB 1ICEB 1RE1B 1RWKB 2FQQB 1RWXB 3P4UB 1QDUB 2CJXB 2QL7B 1GFWB 2C1EB 3R6GB 2HBQB 3R7SB 3R7NB 3R5JB 3RJMB 2XZTB 2H5JB 3EDQB 3KJFB 2H5IB 2CNNB 2CNLB 1SC1B 4ZVRB 3IBCB 2QLFB 1QTNB 3D6FB 1F9EB 1RWMB 3QNWB 1RWVB 1PAUB 1BMQB 3P45B 2H4WB 2HBRB 2HBZB 1RHRB 2DKOB 4ZVQB 2Y0BB 3GJSB 1RHMB 2QLJB 2H51B 2QLBB
chains in the Genus database with same CATH superfamily
1OO0B 4RL1A 2C3UA 4FYVB 4ZVGA 2K7JA 2MY7A 2R7QA 3CDUA 3CDWA 4JUZA 3DLBA 3DC2A 5LMNJ 3QIPA 2DH8A 1Q16B 1S76D 3D54A 4X4SA 1B0TA 2ZE2A 4O3RA 5B0CA 5D6GA 2DGWA 3DI6A 2PMZD 2F9JA 1T03B 1S0NA 2QYGA 3GG1A 3FCHA 1BWEA 1F2GA 4PXEA 1ZTWA 2WSEC 3B4MA 1UA1A 4HH0A 2VD3A 3BGUA 3GPAA 2BA9A 1MWQA 2OPQB 2XWXA 4I56A 3BO4A 1VQSA 3G8QA 5KG0A 2C2OB 1UZHA 2DEIA 2LQBA 5HJXA 3OV7A 2RDDA 4LF4J 1S9EB 2JX2A 2MGZA 2OSQA 2UXCF 3J7A1 4ZP6A 2UVVA 4QYZK 1X4DA 3QSIA 3PW7A 3OUYA 4F7VA 2VODA 3R5CA 4DCPB 2CXEA 1PCAA 2FD2A 2V50A 4L76A 5ETRA 1N6QB 3MUVP 2RMLA 4L6V3 1AFJA 2CYYA 4JB8B 4RUCA 2ZH8A 3CCVS 3T6BA 3CIZA 2C2DA 2A1BA 1T9TA 3HK2A 1HYSA 1FWPA 2X1AA 1VC0A 1L3VA 3Q8SB 4O4GA 1CJVB 2B9WA 5AXMA 3BGLA 2RB7A 3KUEA 2J0SD 1CLFA 3V6DA 2MPUA 4Q8EA 2KT3A 3H5SA 4ZHRA 2ACYA 3ITHB 1LWCB 2CDRB 3QMQA 5C42B 1WC3A 3EPIA 2JLGA 2OPPA 2K7KA 3P5TL 4L3NA 4O3PA 2CQ2A 3EUNA 3MEDB 3HULA 4PCQA 2MKIA 5KFMA 3M8WA 5E3AA 1PYTA 5DDPC 4DUYF 1SV5B 1C1CA 1RT5A 5GMEA 4RR5A 3A1YG 5BYQA 1CULB 4Z37A 3KK1A 1SKRA 1ZTTA 1ULRA 2ZHBA 2DO4A 2EKNA 1AA1B 2DNGA 2HFNA 2VFUA 2DHAA 2ZVIA 4RX6A 2NSBA 4NA1A 3SQGB 1LFWA 4YHHF 2IC3A 1J2VA 4DPYA 2VC1A 3RRGA 3RR8A 1N34J 2CUYA 1FEHA 2V34A 1VQPS 3VR1A 3SYZA 3WIVA 1Q1KA 4ZJOA 4PG5A 2E5LJ 1OY9A 1X5PA 4QYRA 1TAUA 3LP1A 1S6OA 4I2QB 1FEEA 4RLEA 1S97A 1ZM3A 2KJWA 4ES1A 3C6TA 4V1Ak 1TK8A 1YK9A 3GYNA 2FY1A 2U1AA 1GH8A 4O3NA 2L48A 5A76A 2PFFB 3PRVA 5KFWA 3HMJG 1HBOB 3MPYA 4WFYA 3N0VA 4NPOA 4ENOA 4D3GA 1HBMA 1YJ7A 5DQHA 1AZSB 1FT8A 1R8CA 3OL9A 2E1PA 5KFYA 4QW9A 2DHGA 5F8HA 2JC0A 3MM5A 1RK8A 1V9OA 3CB4A 3F56A 5FLXY 3CIMA 1X4HA 1R6VA 2KHDA 1O6XA 4DPTA 2F8HA 2LXFA 3OTBA 2CQDA 3AXKA 4KT0C 1KLMB 1WD6A 3ZTOA 4ZK7M 2YXLA 3I4PA 4DV4F 3ZNJ1 1YJRA 4LRFA 3TAMB 4C3KA 4DQQA 5IZHA 5CD4A 1U24A 1EIYB 2O67A 2FUG9 1VIXA 2X3DA 5DRKA 3MGJA 4AQYJ 4JV0A 4ZVQB 1YDLA 1DLOB 4ZP7A 5BYRA 2LXUA 1FJEB 3ENAA 3B54A 4DX6A 1HNZJ 2WONA 3GJSB 4K5RA 4BC9A 2FVRA 3R2CJ 1YX2A 2DNHA 4KGKA 3T3FA 2QLBB 5ETLA 2ZUAA 2G0JA 1UMJA 2CZVC 1VMBA 2HZAA 1EQ0A 4K4YA 4LSLB 1NZAA 4I0WA 1VRUA 4Y28C 2YH1A 1FXRA 1CBKA 2NXNA 3IBFB 4LR7A 2I6WA 1NK8A 2Y3YA 4RW7A 3NG8A 3EGVA 4CLYA 1RT6A 3FZ2A 4L75A 2NYHA 2AF6A 1WWHA 1IJFB 4HI1A 5IXUA 3PTWA 4QIWD 1R7IA 5KT5A 2XHCA 2ZBIA 3OL8A 4DR5J 4RU9A 2ERRA 4IDKB 1GT8A 5GADU 1Q81T 1WC6A 2HNYB 4P10A 4DOZA 2WVDA 3G8SA 2XYGB 2GS8A 2CQBA 3EJMA 3OXLA 1CC8A 3UO0A 1IBLJ 3PRDA 2PA8D 4DV7F 2F4VJ 2BACA 1PJ7A 2ZDOA 5AT1B 5J2MB 1I5OB 3NKYA 4MH8A 3G8TA 3CUNA 2RQKA 4XPCA 4B3SJ 1YI2S 2K3KA 1AW0A 3CD5A 2PE8A 4AD6A 4PXDA 3VALA 1YWXA 3MR5A 3QJLA 5HMWA 4HHHA 3Q22A 4ECTA 1D9AA 3K8WA 5I42A 4QU7A 3DOLB 2IDLA 1FX4A 3R6LB 3NOCA 1HMVA 2RHSB 3CCMS 3KJVA 3T1HJ 3ZXWA 3O3LA 1TKDA 3DKDA 2XO6A 2RRNA 3QLHA 1SQEA 1SJQA 3MF5A 2YNHB 3GJTB 3G6YA 2E9TA 2AYGA 4USMA 3E51A 3QIDA 1RAAB 1WC1A 4NMLA 1SC6A 2RU9A 3QJPA 1JLEA 4WFBQ 4ZITA 4H4OB 5HVHA 2CDQA 4DV3J 4C9DA 1Q78A 4C3MA 1TU0B 1PILA 2KM8C 1XNRF 3H42A 3LTOA 4GO7X 1U2CA 1KSPA 2WCXA 2DNZA 4KPCA 3CE8A 3T1YF 3CO0P 3MURP 3C16A 2CQPA 3DDNA 3VVUA 4PXBA 1TKTA 2XMAA 2DITA 2GJFA 4O3QA 2R7TA 4JYAJ 1KVJA 3RYLA 1EKSA 2NYIA 4ZLJA 3QGPA 2IJNA 1WC0A 1O8BA 3BKFA 2MY8A 2YKQA 2LXIA 3QO9A 4O0NA 1F6TA 2NPFA 5A0YB 4O4GB 4U67Q 4J9QA 1YIJS 3WC0A 2QL7B 2DR6A 4RW4A 5HK4A 2R7OA 4DUYJ 1K9MT 1VQ5S 5EN1A 1TR0A 1KHWA 2J0WA 1RADB 2VG6A 3E3XA 2OH2A 4N76A 2R2TA 4DFPA 3QFWA 3FVYA 2K1RA 4OYIA 4NLQA 5BXIA 3B4DA 4DL0C 4JI8F 2CPZA 1VK3A 2SXLA 1GTHA 4IOBA 4CT8A 3GV8B 4CO4A 4A8FA 3K59A 2UUCF 3HKWA 3QGIA 2F63A 3H8YA 3PVXA 2JNJA 3EDQB 4I1TA 1DARA 4OLOA 4A47A 3TAQA 1RA6A 4LJMA 3M6XA 3BDEA 4C0HA 4KGMA 5GAGU 3S7RA 1IJEB 4QIEA 2VG7B 4FNIA 2EW9A 1MN9A 2V2VA 5KFZA 4JYAF 3HDSA 2MQ8A 2ZH6A 4LQ3A 2VKRA 3AOAA 2N82B 2Y8WA 4X4UA 1L3TA 5BR8F 3BSCA 5KT4A 3PW4A 6FD1A 1GXUA 2AJ2A 3KFWX 1S10A 1RWUA 1K47A 3BS9A 3ETOA 2DIUA 2H4WB 4TKTA 1ZM4A 2KJVA 5D3GA 2CQCA 3BGOP 3VGUA 4KKOA 2UVRA 1P8GA 2GHPA 1TKZB 3MFIA 3CCQS 2WVEA 1IKWB 2H51B 4Q7AA 3FRZA 1ZAXA 2FY8A 3UR3C 1U0HA 1T95A 3UQSA 2GJIA 5F9NA 2Y1JA 1JLAA 2A6OA 3MM5B 1UVKA 4WE1A 3HJVA 4CO1A 4DV7J 1HNXF 4WU2A 1HWKA 4WKYA 3MOZA 3THVA 1S0VA 1TVRA 3MXHP 4LRAA 4PQUB 1KVIA 1WC4A 2LYVA 4JI6F 5HVGA 4NLYA 1OYDA 1RT1A 2ZNYA 3V6DB 4G6VB 4I7FB 4YY3J 3C15A 1V5VA 4LR9A 5D0EA 1X4BA 4TLQA 3U1LA 3DGPA 5L1IA 1RHQB 1TUGB 2O1PA 4M5HA 4WK1A 2HLUA 5KFEA 3PO5A 1LW0A 2HSEB 3H5XA 2X51A 1GMVA 1CJTB 4JOUA 3UDVA 5ADZA 3KLEA 2YWGA 4O3OA 2Q1LA 1AUDA 4B9LA 3OUYB 2N4DA 3VQSA 4V19X 5HMZA 4M1KA 4XAKA 3G96A 1H6KX 3LANA 4GVBB 4IG0B 3U27A 3BBBA 3PJ9A 2W7OA 4NLTA 1FK9B 3HPOA 4CLWA 3KNAA 5ETNA 4U7UK 3KMQA 3L7OA 1XIQA 2E9ZA 2VPZB 3GE9A 4ZVTB 5HSPA 1U45A 1F2HA 1CVJA 1RAGB 2G13A 1N32F 3P49B 2NS1B 5KG4A 1W26A 4CP5A 1UAWA 3FCVA 1NSPA 2GGPB 3BH6B 3DM2B 4OIXA 3HHLB 1NKCA 2XWYA 2GMLA 2BQUA 1OWXA 1VR6A 5KG6A 1VBYA 2ZZNA 2DGVA 1TL5A 1PYOB 3HHEA 3WC2A 3EVMA 1T9WA 4JI3F 1IR2A 4Y2AA 3KDOA 1TTHB 2QL5B 2HRTA 3HFKA 1FI4A 4K0KF 2ZHOA 4KO0B 1S48A 1HA1A 2YWHA 3TRGA 1KEKA 2MKKA 1ZZNA 1BQXA 1Q7YT 3CCZA 3OD2A 3QT5A 4UOFA 1NSKL 1Y5IB 3BR8A 2AEJA 3AJDA 2DNYA 3BBCA 3G6VA 2RT3A 3FSYA 2NQPA 3MD1A 4ED5A 3T1HF 4Q43A 2CJXB 4G65A 5J2PB 4FF2A 4H4KA 5A6PA 3NGUA 3CXCR 1X9WA 3O2IA 1RU1A 2W2NP 2PEHA 2VONA 4HHUA 2E7WA 2IJRA 3H59A 4TU7A 1KS2A 1LKZA 3HD2A 2AX0A 2EFOA 2OPRA 3JSRA 5CXTA 2XZTB 3M2UB 4FNHA 3UW1A 4Y65A 4ILMA 3WHIA 1BHNA 3LF0A 2H5JB 1RT4A 5C25B 2ZH5A 2XLJA 1VC6A 3C8YA 1N34F 2UU9F 1RTDB 3BF4A 4R0JA 1O5JA 3P8BB 2Z2LA 2O01C 4LF8J 3K5LA 1CJKB 4J9OA 4DPOA 2L9DA 4YFUA 3BPDA 2FJVA 4NLGA 2KO1A 4ZOSA 3Q8PB 3OBIA 1XMOJ 4QIFA 2ACMA 3MECB 3QRQA 4B3RJ 2CJBA 5A0YA 4IFVB 2WBRA 3OTEA 3TUZC 2F4FA 5E5NA 5AE2A 5I3UB 4BBYA 1RWMB 3Q23A 1NJIT 2RAQA 2YKNA 2YPYA 4ZIVA 4DV1F 4AL6A 3UVJB 3US5A 3PYDA 1FWKA 4TLRA 1RKJA 1CULA 1FJGJ 3NRBA 2ZKTA 2HKEA 3KWMA 4JP8A 2XG8A 2GGPA 2XEXA 4ZKAA 1C4CA 4K4SA 5K8MA 2VF3A 5DJBA 3M8ZA 2OELA 1S6PA 3MEDA 4AE5A 4CO0A 5LT5A 3K5PA 2B9EA 2DNKA 4TN2A 3I5AA 2CQIA 3QFHA 4I6WA 2R7UA 2P9CA 3CMQA 2R8IA 4ECSA 1SIZA 1TK5A 1ELOA 4JBCA 2ATLA 3OR1B 2IMOA 1RWOB 1WORA 2BANA 5ETPA 5L9NA 1S1VB 1FRXA 3BN4A 2PD1A 3MECA 3I9ZA 3OHAA 4FS2A 4KHPF 4GKKF 1WEZA 3L9ZA 3A12A 3DLGB 4IH5A 3E01A 3UD5A 4F4YA 2V9WA 4B3OB 3MTJA 3DU5A 4EI2A 2VKZG 4ICLB 4KR0B 3Q8RB 3SI8A 4N41A 4Q0BA 2QL9B 3MEKA 3QQCD 1MMLA 1H98A 3C6UA 3KJQB 4B3TF 2G2YA 2J0XA 2EWHA 2FHJD 4A8KA 1H72C 5D4OA 3UNGC 1W7WA 3H7HB 2FVQA 4MAKA 2DB1A 1Q7LB 4IO9Q 2VBYA 5KFSA 2HHHF 3IGVA 1T7PA 4YOEA 1TL3B 4YMEA 3NGRA 1QAYA 3OR2A 1UJ6A 2MQQA 2RKIB 3RAMA 3Q8UA 3AOBA 2JEFA 2Z30B 1T05B 3DDKA 4L74A 1IKYB 2KKHA 1PBUA 3BV8A 4DI6A 3PKYA 1KRPA 1Y3JA 2LEPA 1XR6A 2AQ4A 1JMTA 2KZMA 4KV8B 4PG6A 5E3RA 5DZ7A 3CJ2A 4IQMA 3RRHA 3TW0A 4OHYA 2K06A 3BKTA 3KK2B 2CQ3A 1NJYA 3AQPA 2J6UA 4QWAA 1NU4A 4DR7J 5BJRA 3HSDA 3W8PA 5IFMA 1TL1A 1TV6B 4W92B 1ROFA 1WTFA 3CJRA 4DG1B 4DV0F 4FYDA 2J76E 1NHKL 2BJ1A 2BE7D 1NJXA 4DQPA 4D3HA 3KLFA 5EHHA 1L3SA 1PKUA 2KFNA 3BYPA 1WF1A 3GFHA 4F25A 4F67A 3W9JA 4USJC 3K5OA 2XM3A 2W9CB 1S1UA 1H2VZ 3BQ0A 1P27B 2R8KA 4JI8J 4YB1P 2YX4A 2D3OR 2C2ZB 2AGQA 4J5OA 2DBBA 1RE1B 2IFXA 4F0KA 3TAMA 3NBPB 5F3ZA 3J7YU 2V4QA 2ILZA 3TEHB 2LFVA 3AXMA 4OYPA 3K5MA 3AFGA 3M6UA 4RNOA 3G86A 2LECA 4PKDB 4WU3A 2ZVSA 5KT6A 3AA9A 2I0XA 2YPZA 2RQMA 3JQKA 1IKVB 1HNIA 2EG2A 3QLHB 4C97A 5HMXA 2OKQA 5FDLB 4X2BA 4NE9C 1N36J 1FDNA 2E5HA 4ZCIA 4CTAB 3DN9A 4ER8A 5C7PA 4G1QA 1DY3A 1NH8A 2E1MC 4LF9J 1CC7A 2OAUA 2OUGA 1HNXJ 3EGWB 3I96A 4FBUA 1YSJA 3PIPQ 3EYZA 4O3SA 1RT3B 1FE4A 4OHVA 2IA6A 2BW2A 3KNGA 3JTPA 2FZKB 2Z4PA 1PBAA 2OSRA 2V0NA 4MFBA 4NLXA 4Q2LA 4X66J 3PKMA 1Q5YA 1PO6A 1NRKA 1AROP 3RB4A 3GIRA 4DL2A 3RR7A 2OHDA 3Q8VA 4X4QA 4OYMA 2DNRA 3UCGA 2VA2A 5ETOA 1JJHA 1RCXB 3LGMA 3R1HA 1IKXB 1HPZB 2ZC3A 5MLCV 3ZZUA 3PX4A 2GIFA 4H4OA 1C1CB 5KFJA 2Q3PA 5F41A 2R2UA 1U02A 1YJVA 2VASA 1R8BA 2HHPA 4LIWA 3DLJA 4LSLA 3R9LA 1F5BA 3P3DA 2QGFB 5GAGI 2XCPA 3KLHB 2QN6B 2LKZA 2Z0GA 1QLNA 1UVNA 2RUSA 5GAHI 2FJAB 4R8UA 1RJJA 4CYUB 1RBOB 1WC5A 2XB2D 1UPPA 2XNQA 2IAJA 3M1VB 4JI5F 4MYUA 2VQEJ 2Y1LB 1MWYA 5IWAJ 5K8PA 3EE3A 5CQGA 5B0AA 2Q43A 4WIIA 3GLJA 2ZH4A 1XNQJ 1S1WA 3AHPA 5A8KB 4MIAA 3HFZB 5LSOA 4YR3A 4DWIA 2KU7A 4WK3A 1JXEA 4IOAQ 3AA8A 4DV1J 2ASJA 1OQ3A 1LWXA 2JC1A 4PAAA 2DNQA 1NMEB 4JI1J 5JJBA 5D78A 4ELUA 2P2CB 1G1XA 1WDDA 1B99A 3MMCA 3SSSA 1HW9A 4M5DA 1D9FA 4URGA 1DJ0A 1QE1B 1U1KA 2DIVA 3V6JA 1GX5A 4EO6A 3N01A 2DNNA 2XI2A 1VQKS 2E1RA 1TL4A 3CW2C 4UY85 1X9MA 3FBEA 1XEZA 2D41A 1Y0HA 3FUYA 5J2NB 4NL5A 2M8DB 1UVLA 2RHQB 4DJBA 4PUOB 2GAGC 3DCAA 4B3MF 3MMAA 3RZAA 3DLGA 4WXOA 3TR5A 3ZZ0A 4WFNQ 2XI3A 3MM7B 2UXCJ 1JXLA 4ITSA 1G3OA 2M52A 3SFGA 1G4CA 3H2VE 1TL1B 3SEOA 4DSFA 2VHGA 1FKOA 4Y2MA 1QY7A 1E6VB 4WIQA 5F8IA 1S6QA 1GMUA 1PC4A 3AH6A 2GMHA 2A2CA 2VDIA 4EYHB 4W4MA 3F0NA 2R2SA 3PYFA 3QAEA 3ZNUA 2ZH3A 4TVAB 3GB0A 2FIUA 4M5JA 5LMUJ 1U47A 2HWIA 4YB7A 4IRDA 2XS7A 4OI0A 2HQFA 3KHGA 5THWA 3V2UC 1VQ4S 2AT1B 3K7RA 3AAWB 5B7WA 1X5TA 3UI3A 3FDSA 1U1MA 3FJ2A 1ICEB 1TK0A 2V63A 3M8QB 4FDFA 1KONA 2ZFHA 1HMVB 1IQZA 1VC5A 4A8SA 3JXOA 4OHXA 3VV2B 2DGXA 4J9RA 2J9DE 2LQJA 2EFNA 2QT7A 3PEJA 3ZFVA 4ES3A 2FVSA 4KTQA 3D66A 2BOPA 1RTHA 4P74A 4AXJA 1NO8A 5CYJA 1WTBA 4G1IA 4E98A 1SVDA 3R6GB 3HXMA 1E6VA 2O5DA 4JI0F 4LIRA 4CTAA 3QSYB 1LW0B 1G6BA 1OS5A 3EZ5A 3V6KA 1H3DA 3M8PB 1HBNA 2HFUA 2KB2A 2OFGX 2A2DA 2DRBA 2B7CB 2D3UA 1RTJB 2L3MA 4LR8A 4ZIWA 3BPSP 1FX2A 3CJKA 2NXCA 3L09A 1C1BA 1GQEA 4NASA 5CCLA 5KFVA 3J81U 2DR9A 2KVIA 3GSIA 2DHSA 3M8QA 4CH7A 4EEYA 4BWJA 4DV2F 3LGNA 1CEZA 2V94A 4AQYF 1DZ5A 4LF7F 2AYMA 2J6SA 4NWBA 5ETKA 2ZZMA 3KXDA 3DXBA 1F9EB 3CDAA 2R2RA 1M1GA 2DNPA 3PY8A 4DF8A 2EG1A 2G0CA 5BYSA 2FB0A 2BM1A 3CGIA 2W8LA 2DPJA 2UU9J 4JI6J 4EO8A 2ASLA 2G4BA 4J9KA 2EC0A 3GP9A 4OI4A 2DPIA 4C0BA 3T6JA 1JWWA 2GQ2A 1YQHA 4C4WA 3M30A 3MFHA 4NLRA 4F3OA 4I67A 3D68A 3MMBA 5LSRA 2Q66A 2XY5A 2LEBA 2JEIA 4YS2A 2C22A 5DQGA 3KHHA 1M5PC 5GAHU 2DVIA 4LF5F 3N9UC 4LUBA 3A13A 4CLSA 2VU5A 2ZC4A 1X60A 3TA1A 1X4CA 2V5HG 1REVA 3AD9C 3K0JA 4P2SA 2GO9A 3UDLA 3U7JA 3RB6A 5ETMA 4PXCA 1FDBA 2R7WA 2OPRB 3BQ2A 1HNVB 4XTTA 3SDEB 1FRMA 3G4SS 2UUWA 3C66A 3A8JA 3QATA 4NXMJ 3HSZA 4P73A 3KLGA 4DV6F 5F8JA 3HCXA 2HFSA 1OMSA 2C3PA 4C2MA 5F8GA 3MPVA 2YBVA 1G7CB 2HRUA 1N36F 2RDIA 4OYBA 5IM0B 5K20B 5KFCA 1FVSA 2KFZA 1WOPA 5E3PA 1H7WA 3MDFA 3BSOA 4EGLA 2ZOFA 1RXOB 3B8HA 5B0DA 5KFKA 1H38A 4B08A 5F8MA 2E7XA 4Q0BB 1BWVA 4F2SA 1R8HA 2YNHA 4ZPVR 2B4OA 2N7YA 4WP8A 1RAOA 5AE1A 1P1LA 1JB0C 3T9ZA 3PACA 3PYEA 5HMYA 1EETB 2RQCA 3MHYA 1VQ7S 4ZVFA 1SKWA 4C3LA 1RWNB 2IJFA 4PEOA 5CZVA 4CH0S 2GQQA 3AY0A 1HBUB 3ET6A 2UUAJ 4CYUA 3IR7B 2MZTA 1T9UA 2VFVA 2Z58B 2EXUA 3ISZA 4QWBA 3W61A 4A8MP 2BJ9A 2PMWA 2QLXA 2C28A 4CLKA 3W65A 3BGRB 3GJQB 1UJ4A 2ZZTA 1IR0A 4C8YA 3OVBA 2ALYB 2V8GA 2HHTA 1C0UB 5IC4B 4C0OC 1BXNA 2YKNB 1HHSA 4J9SA 1UVJA 2B8PA 4P52A 5AXNA 3TUPA 3JTOA 4ANEA 4N5SA 4B9MA 2X1FA 5IT9Y 1IUJA 3T1AA 4DV4J 4PWUA 1NSQA 1EAYC 3V5RA 1A9NB 1HWJA 4OV6A 5KFRA 4GRSA 3Q2SC 3ISND 4LT6A 3MCNA 1NM2A 2CZ4A 1QAXA 4DR4J 2JVRA 3JS9A 1V5IB 2VBZA 2I5JA 2M8HA 2IRUA 3I32A 4RJVA 3VAGA 5HBMA 2HVEA 2DK2A 1Y5NB 2QG9B 2JLEA 4FP9A 2YKMA 2W9CA 3IRWP 3J81Y 1KLNA 5E7OB 3HI9A 1HW8A 2YKAA 2G9OA 2WONB 3IO1A 4Y00A 1U1OA 2OMLA 2XLKA 2R7RA 4ECRA 3NEKA 4MKYA 1EQMA 1TV6A 3Q8QB 2ZM6J 2BE9B 3KLHA 2UVUA 1SH2A 3KYLA 2KYXA 3R5DA 4B3MJ 4QBUA 3IS9A 3J81j 3ILIA 4EBDA 3IRXA 3PZPA 4OI6A 2KDOA 4H4KC 3IAS9 2L41A 1S0OA 1J5OA 3FEZA 3SZ2A 2HEKA 1KLMA 1JLGB 1JLQA 3KDNA 2VUGA 3IWNC 2MZSA 1MG7A 2IVYA 2VG6B 3NGKA 3O5TB 2QFJA 1T05A 4JV1A 1SC1B 1TL7B 1XTZA 4EZ6A 1HQUB 4RU2A 3KG1A 1DURA 2PDAA 4DR1F 1QTNB 2A6MA 4KKOB 2ADBA 1B0VA 3TP2A 1M5HA 3RBZA 4N56A 3MEGA 2XS2A 2G0IA 3TX0A 3JSMB 1RT3A 3R3TA 3A3PB 3D5MA 3DRYA 5KT3A 4YR0A 1TKTB 1IXKA 3UN2A 1WF2A 1JLCB 1KWMA 5DDQC 4ZPWR 4Q44A 4W98A 3D9BA 2B3TB 2DKOB 3AB4B 5J2QB 2YQ3A 1FESA 2C3MA 4G3IA 1VJQA 1BUXA 2WOMB 3LUYA 1WOOA 1Q86T 4EU0A 1QSSA 1HPZA 1X0PA 2RS2A 1PSDA 4LFCJ 1J5EJ 2B6AB 2WBMA 4P71A 3V4IB 1CQNA 5L1JA 1M5KC 2G2ZA 2YNFA 3DDIA 4EUVA 1ZETA 2HVHA 2PT0A 3J7YI 4C8OA 3VZIA 1GK8A 3H90A 4TXSA 3D7SB 4PR6A 1SJFA 2BMBA 5ITHA 3HHKA 2D3O1 3GILA 2OD4A 2V9KA 1TL3A 1BQMB 1DBDA 2NUHA 4HVZA 3M6VA 8RUCA 1RAHB 3OSNA 1REGX 3PR5B 4AL7A 2WSFC 4ID5A 3W8GA 3CO9A 3OL6A 2XO7A 3JYTA 2CJYB 1R8AA 4WZQA 3L7PA 1UVMA 2E5GA 2FZGB 1LWCA 2H4YB 2L08A 2XMTA 1H73A 4AUKA 1YZ6A 3MPWA 2DGOA 2PFDA 2XSJA 2IYIA 3TO8A 4DV3F 3MR3A 3NAHA 1V3RA 4ICLA 4IFVA 4PQUA 2NXUA 4BWMA 3F41A 1KOHA 4YUDA 5MAOA 3K89A 1M0SA 3MAAB 4ZJLA 1U8SA 3EZUA 3CD6S 1DTTB 4EBEA 2BANB 1LXJA 1Q8KA 2M9KA 2GHWA 4ZVSB 4WFXA 1D8YA 4Q2MA 4ILRA 2FHJA 4ZCLA 1NAQA 1LNQA 3ADAC 3M8RA 2GV1A 3BO3A 1HARA 1ACMB 4X4RA 3HM9A 5D0GA 1O0PA 2I2YA 2IM1A 3OR2B 2ZH1A 4ECXA 2XS5A 4TQSA 5KTQA 3TJ9A 3IBWA 4ZPDA 4CI0B 2W9AA 2HNDB 3O1LA 3VWSA 4ZLLA 4C8MA 2VFSA 3R7BB 1RA7A 4UOGA 3N28A 4QWCA 1URNA 1S1XA 4XO0A 4F4ZA 1JXVA 2CPEA 3MMCB 1YZ7A 4BLGA 2BBEA 5C42A 3GV5B 1N52B 2EKYA 2I1RA 4NCBA 2VA3A 2LU1A 5E33A 3K2YA 3ZC4A 5LXRA 2W8KA 3CCJS 2IBKA 2HK3A 1VQYA 4J9PA 2UUCJ 1KR4A 2AZ3A 3AD7C 3IXQA 1ZH5A 2FDNA 2VL1A 2DR8A 2ZWPA 4K59A 8ATCB 3IR6B 1KQKA 4A4JA 2QLWA 1WKLA 3QJJA 4DV2J 3UCZP 5IS2A 3K57A 1Q53A 1CS4B 4FS1A 4IRCA 4P2MA 1RQ0A 2CIMA 2Y1IA 4NRTA 1C0UA 2AYBA 2BV3A 4LFAF 3D2WA 2E44A 1I94J 2VPWB 1N4LA 1FD8A 2OFHX 1NJWA 3T41A 4HHJA 4LQ9A 4Y3CA 3R2DJ 1RU2A 3RTVA 2HVDA 4DSLA 3DMJB 1W2BR 4ZDNA 4F4KA 3PIOQ 2DR7A 3BO2A 2BRKA 3SBMA 3C6TB 1D9DA 3VCDA 5GMKa 2MLYA 4MKVA 5SZTA 1U25A 2F65A 3QWUA 3BKUA 4WPAA 5CZXA 4K4VA 1MW7A 2WSCC 5JUMA 2YQ1A 2HNZA 1W25A 5HP1B 3DRRB 1RBLA 3SSRA 2H5EA 1EZZB 4GO5X 5CYQB 1CJTA 1YRUA 2BYCA 3X1LB 3MPUB 3WBZA 2LA6A 1RT4B 2RILA 4QIGA 3UN5A 1JLBB 5C25A 4UZBA 2MSTA 1TELA 3N79A 4DN0A 5IM0A 5HL7Q 2B5JA 2J5AA 5IV3A 5DDOC 4I7FA 3PO4A 2LEAA 2HBRB 2MTLA 4HTIA 2YX1A 4A46A 2ZM6F 2F8MA 1F5AA 3DLKA 2OI2A 2QA2A 1ZAVA 4R25A 3MM9B 2R9LA 3HFVA 3UR0A 2V67A 5EWEA 1TVRB 2Y0BB 4FN5A 1BY9A 1N5TA 1LFPA 3K8VA 4I6AA 3SV3A 5J2PA 1SXLA 3GTYX 1AB8A 3R5AA 4ZPBA 4PYAA 1GXTA 2RH3A 2V6AA 1T8EA 3H5UA 3DRXA 3LALA 3GYXB 2EI5A 3QGHA 1TKXA 4UQTA 3ZZOA 5IT4A 1YJTA 2HWTA 3OFHA 2YKPA 4KPYA 4XIUA 3AODA 4NLOA 2G2OA 1UTAA 5KFXA 3TAPA 2AYEA 1HBNB 2BJ8A 2J9EA 3PW2A 1XC9A 3ETMA 3KLEB 2ASDA 3H2UB 2J0QD 1N88A 2N4CA 4CIOA 1F5CA 2ROEA 4I64A 4CDIA 2FLNA 1NDPA 4QIVA 5JXSA 1FJGF 1E6YB 4NLVA 2HAFA 4YEAA 4X64F 4ED3A 5F8NA 1JLCA 4R5PB 2B0GA 3CD0A 2HNYA 3OT9A 2KG0A 1FFWB 5C24A 3EM1A 2UXBF 3HHLA 2OIHA 4HL9A 1EKRA 1NDCA 1SBRA 2IC3B 2YNGB 1NUEA 4DR3J 4ECQA 2YTCA 1VFJA 2EFPA 3T5LA 4P6QA 4QCLA 3FRYA 5KG2A 1MNEA 2NLWA 4LF8F 5HN0A 3EMTA 3PR4A 2GMJA 2Y0SD 2CVIA 3DYAA 3SFUA 3M9MB 2R8HA 3VAIA 4CLTA 4DL6A 1RYSA 4FYXB 4M5NA 1XMOF 1T9YA 3W63A 2RJZA 3QIPB 4F4AA 5D0HA 2C2EA 1B3TA 1MSWD 2WRMA 2V8HA 2NCKL 1IM4A 4R0EA 4C8LA 2N7CA 2EK1A 4ES2A 1NEEA 2P6TA 4WJBA 4O44A 1T9XA 2E1AA 2CPIA 2HG4A 4DSJA 2ATCB 2Z2ZA 2XMJA 4KFBB 4ZN3A 4DL7A 1U1NA 5FJ4A 1V6HA 4JI2F 4MIWA 3GCXP 4ZMMA 2KZZA 1RWWB 1RABB 2DY9A 2KXNB 2HBYB 1K1QA 2YWWA 4M8LA 2RDJA 1ITPA 1RT7B 2ZH2A 2C2MB 5H1SV 4USWA 3UD4P 1RTIB 2AWZA 2J7KA 1OSDA 3ICLA 3GFZA 4DQIA 3D1HA 3TX8A 3SV4A 1NDLA 3NAIA 1AXQA 1HBMB 2JHEA 3BH7B 4UUWA 2MQPA 3I4HX 1N56A 4WF9Q 5L38A 1H2UX 1AUSL 2LQ5A 4UT4A 1SH3A 2LVWA 4EMDA 1N5VA 3FNNA 1UEVA 2QC3A 3FEXB 1FRLA 3P4UB 3I5BA 2PSZA 1UJ5A 3PX6A 3CJ0A 4DUZJ 1OPIA 4R5PA 2BJ3A 1WACA 1WI8A 2OTLS 2C1EB 2XMWA 2RUGA 1VQ6S 4OLPA 1NJZA 2QMUB 3KUHA 2FJXA 4RBUA 1SKSA 2BXJA 1PIEA 1YJWS 1UL3A 1UEKA 1XMQJ 2H9ZA 4B3OA 2MZJA 1HBUA 3D28A 3ELHA 1FNXH 2B51A 3MMAB 1AYEA 3UVJA 4X84A 4OZ2A 3ZTRA 1H74A 1X4EA 2HRYA 2XC9A 3BQ1A 5AE3A 2VOOA 3A3OB 4X4VA 1EJ7L 2F8EX 3B6BA 3TWZA 2BKOA 1VHIA 4N77A 4NYZA 5A8RB 1H7XA 1D09B 2MJNA 1FFSB 3I0RB 3ZZYA 3IBCB 4WE1B 3RAXA 1S72S 3M7VA 4CLZA 4OZ0A 4ZPTR 1S6PB 2OLWA 2BDPA 2HIYA 5HROA 3JTNA 3TVYA 4DR2J 3W9HA 2ZITA 1JLFB 2O3DA 4YY3F 2M70A 1U26A 7FDRA 1RWVB 3RB3A 2AJ0A 3ZZPA 4DZDA 1XWLA 3RG6A 1H2TZ 2Q79A 3VHQA 4XK8C 5CYMA 1UPMB 3E2EA 2CPDA 4OFZA 2DGUA 5IOLA 4LRBA 1B7YB 2AP6A 2GVDB 2M3DA 1X8DA 5A8KA 1NPKA 3MCMA 1RHMB 3MM6B 2M2BA 2R8JA 5U47A 3PYGA 1U8WA 1MROB 4HH1A 4OX8A 3BN7A 5KT2A 3MPDA 2DTJA 4H4MB 3SCIE 1IBKJ 5IQ6A 3OXFA 3CCES 2E5JA 3BZQA 3JAMY 3RBXA 3GIIA 1F1BB 4KC5A 3KLFB 3M2UA 2N3OA 2B9YA 3EXYA 4KY3A 3HVWA 5EX3A 5IT0A 2NXEA 5HLFA 2PI5A 4QR2A 1LK7A 4I2PB 2KH9A 4IR9A 3S6EA 3JSMA 3I87A 5KT7A 2W4CA 4MMOA 2HNDA 3VZHA 2BE2B 1NHUA 2GFFA 3EPGA 2IM0A 3L7UA 1FE0A 3LH2S 5DO2A 1F9FA 1HL6A 4WTOB 1HQUA 2RVJA 3R1LA 2OEMA 1CJUA 1FRIA 2NZ4A 1VQ9S 2UUAF 4QR1A 2DT9A 4USHA 4ZLNA 1NKEA 3HVAA 2DXEA 3M2RA 4IH7A 2LMIA 1NK4A 4CT9A 4B02A 3HVTA 4QOTA 1LV5A 3KOAA 5B0EA 4P2FA 1YBUA 4DF4A 1DHMA 1FK9A 5GMDA 3KJNB 2BX6A 3VTIA 2V8DA 2W2MP 1DRZA 1N5QA 2MHNA 3UCUP 4HT7A 4RW8A 1F3FA 2B56A 3BM7A 4PPDA 5D4LA 1LOUA 3OQ2A 4CLLA 5LJ3Y 5A2QY 1IWAA 2LLZA 3NWGA 3CCWA 4DL4A 2JH3A 1N33F 1BQNB 2IVFB 1E6YA 1D8ZA 1GEHA 1HD0A 3TARA 2R8GA 3BR9A 3HSGA 3U02A 3G6ES 2O66A 4KHRA 2HGMA 3ZO7A 3DGPB 4C8ZA 4AFFA 3BREA 4HT5A 3K58A 1HNZF 4OYAA 4JI7F 3NNAA 4OQJA 4DR7F 3TOQA 4C98A 1S9FA 2ZJQQ 3KLGB 4N8OA 4IG3B 2Q6CA 2ZNZA 2R7XA 4TYAA 1AZSA 2GIRA 5CAAA 5DM7Q 3G71S 1YJ9S 2IDEA 1Y3KA 5J2QA 2MZQA 4W90B 4DR1J 1VRTA 4FYWB 1HQ2A 2ZHAA 4A8WA 3BDPA 2AX1A 4OV1A 4OHZA 4OX9J 3BGFA 1HI0P 1SKUB 3FFIB 2NREA 3CJSA 1IBMF 2X7IA 4K4UA 4XDDA 4E0DA 4WXWA 1Q8LA 1LWEA 3RAQA 4O44B 2FHOB 3TANA 2MB0B 2JLFA 3NGTA 4A8YA 1EETA 1U2RA 4ZA1A 2WB1D 2VB6A 1KBRA 3QWPA 3R5JB 2WVBA 4NOHA 1PG5B 3TVZA 3IC1A 1LQ9A 3LQVA 3PDNA 1ZOTA 3MAQA 1Q82T 1VQLS 1P6TA 2CPHA 3CMAS 4KB7A 3AJ2A 2KVQE 3LWMA 1NCLA 4RW9B 1NKBA 1U0HB 1VLYA 1VOMA 1X7VA 1NPRA 1N6QA 2E5LF 1VYAA 1WDTA 1FRJA 2X3GA 1HFEL 4OI3A 3V81A 3P6YC 2R7VA 4LFBF 1KKHA 4U9RA 3OVSA 4MKBA 2JRSA 3QT7A 4A8QA 2F4VF 1UZDA 4PG4A 4ZPCA 2JZ5A 4RBTA 1MU2B 1QE1A 4IH6A 3VAFA 3N6MA 7FD1A 1WHVA 2W4DA 1M5VC 4L73A 4U96A 3MMJA 4MTPA 3OHBA 1S5ZA 1RTIA 3Q89A 5IV4A 2GAHC 1U48A 4I2QA 4QJVA 4CNZA 3AD8C 2QMWA 2KN4A 3AT1B 4NEYA 2VQFF 3MTKA 1JX4A 4YN3B 5HO4A 2RNEA 1NK0A 2B4VA 2DH9A 1KFSA 1DTQA 2IM3A 2MJUA 3LP0A 4DR3F 4OX7A 3A3NB 3CCUS 2D9OA 2HVZA 4YR2A 4TU9A 4DFMA 1NK5A 4K2JA 2OTJS 1R6YA 1WG5A 2ILYA 1TKXB 2RSQA 3CSKA 3L95X 3M8YA 4N8NA 4OMFG 3MUMP 3BJYA 3TQ1A 2UUBJ 9RUBA 3WQPA 5HAOA 3POTB 4OZ1A 1PJ6A 3ZTPA 4IFYB 2HIQA 4TY8A 2MQLA 4R8UB 1TUWA 5L39A 1JLFA 2FZCB 2Z56B 1MU2A 2LCWA 1Y9OA 2KT2A 3HT0A 3G2XA 3KTQA 1S79A 3W64A 3VAHA 4JI0J 4ERDA 5KOXA 2CG8A 4IR1A 4IOCQ 2W24A 3RB0A 1WSVA 4EFAC 5K5MA 1HWLA 4RKUC 2DJWA 1HHTP 1F60B 2MQOA 4ED0A 4DEZA 3KMSA 2VQFJ 2HURA 3H20A 3GIMA 3N5BA 4KQZA 2AMCB 2ZBQA 3O44A 4KSEB 4YQWA 2FVCA 2MHEA 1RAFB 1CJKA 1HHQA 2GVZA 2FLPA 1KQSR 2DYAA 3FMBA 3DOLA 4NCGB 3UNYA 2AEFA 5I42B 1SC3B 2DD8S 4X4TA 1NNDA 3K5NA 1NK9A 4CCHA 1T11A 3DRPB 2PIIA 3NXZA 3HHDA 3LAKA 2OP5A 2YH0A 4LVOP 4PG8A 3J80Y 4QWDA 4DFJA 5C2CA 2HHVA 4ID5B 3H40A 4TNOA 5K14A 1UKUA 2OJ3A 4WZMA 4PUOA 1UETA 2BW7A 3JQJA 1RT2B 4FKYA 4DR4F 2ZWOA 4F3QA 2ZBCA 2AV5A 2AIRB 2DO0A 2IBOA 5DGBA 1SPBP 3ZZRA 2XZDB 5B08A 2YWEA 4KGZB 1NLKL 1VHFA 3DI6B 1T03A 1IBMJ 2HHQA 1IKWA 4PABA 1PC5A 1UWBA 1ZM9A 1L3KA 3NBPA 3D1QA 3D1OA 4I6YA 2BJEA 2UP1A 1IN0A 1RWKB 1UFWA 1VIOA 1X5SA 1VRUB 2P9EA 3MMBB 1U1LA 1VBXA 4NCGA 1RISA 5AXLA 3CC7S 2F9DA 1DQ8A 4RWWA 2KRBA 2AKWB 5G4DA 2JEJA 1B4SA 4LF7J 4O23A 1MLAA 1PAEX 4LFAJ 2MZRA 1UW4A 5DQIA 1PGZA 2M4MA 4LFCF 5KFDA 1SCJB 1S1XB 3P5BP 2DHHA 2FGCA 3UDEA 1UFLA 4P9SA 1LW2A 1RDRA 1SH0A 2GIQA 2VPXB 3HZGA 4BCAA 4DX7A 3NGDA 4CNYA 2J7UA 2OPQA 2VBWA 5DGAA 3RJMB 3SDEA 3GCWP 3Q8YA 2HZCA 2UXDF 1APSA 5B0FA 2GO8A 4USUA 3RW6A 3DLEA 2VQEF 2R7SA 4LF6F 1FF2A 2H5IB 2CWKA 2PA3A 3OXGA 4Z7YA 3AOCA 3F73A 4C11B 4OYOA 4UTGA 5IWAF 1TMJA 4USKA 1FA0A 3GSDA 2RIJA 2QLFB 4CM0A 3C2PA 4KHMA 4DV5F 4GC6A 4ED8A 4UOCA 1PJ5A 2AJ4A 2YWFA 1UA0A 1MWZA 3NCRA 4HLBA 2LDYA 4ZP8A 3LP2B 3VGTA 3TYTA 4RW4B 5LXYA 2CJ9A 3M4XA 2D7SA 4HDHA 4P72A 3G87A 5EDWA 2VICA 1URRA 4C7QA 2BQRA 2HBZB 5FD1A 4B9VA 5LMUF 1HWIA 4LVNP 2GC8A 4KYZA 4K7QA 4WYLA 4G1PA 4ZJQA 3OFFA 5CHCB 3GIKA 4HI2A 1NHVA 1RCOB 1XJWB 1FJCA 1QUVA 4F0MA 3ZZTA 4P7TA 1M5OC 2GA7A 2LP4A 1OY8A 1HBOA 2FGOA 3D67A 4XDCA 2MXYA 4KH1B 3O8WA 4NI2A 4IUFA 1U6FA 4F50A 2MQMA 4IG0A 4ZP9A 3PRBA 1SQFA 5GAEI 2RE1A 2BUNA 2H65B 5CH7B 2Z57B 2DY1A 4E8UA 1YITS 4ZVPB 3MEEB 2AJQA 5CA5A 4F26A 2KYZA 5BR8J 3KK3B 3VVTA 3DRSB 1EP4A 4Y2CA 4C48A 3KHLA 3PV8A 4QQBA 2DNLA 5L9XA 4B3SF 2JVOA 2NXJA 4YDDB 3LPYA 2I8EA 3C3LA 2KFYA 1DTTA 1RTHB 2AEMA 4MK9A 4HEA9 4ZS6A 1R8PA 1QVFR 1QAJA 4J9NA 3OW2R 2ZJRQ 3H4DA 4DG1A 1CG2A 1S99A 3GG0A 4ZCMA 2N3LA 5HQ8A 3MEGB 3WIUA 2H1YA 4DS4A 2LDIA 1S7IA 4ECZA 1P1TA 4WCEQ 2FHMA 2GNKA 3CJ5A 1Q8IA 4LF1A 1CJVA 1JK9B 3W2WA 3PW0A 3NNHA 3FBCA 3RRKA 4Q8FA 3JYTB 4M5LA 1JLAB 1SQGA 3BSAA 1NSAA 4G1QB 3DMJA 3TZZA 4B9UA 3D0HE 1IKYA 2VC0A 3G82B 4U6PA 2G1HA 2J8AA 3W5XA 2EK6A 4IFYA 2Z2YB 3OLBA 2CQ1A 2NPIA 3IRXB 1IKVA 1HNIB 1QJHA 3ILJA 3W2VA 5HQMA 4XPEA 3J7Z5 1GTEA 2APOA 1Q79A 2E29A 1YBAA 3VF0B 1KNZA 3TJ8A 2B6AA 3V4IA 3D0GE 3IWXA 3PJXA 3QYYA 4NEZA 5FLXU 4A48A 1X31C 4ED7A 1KOOA 2JFKA 3CJQA 1HNVA 4UOHA 3NMRA 5D4PA 4LFBJ 1TQLA 5D8HB 1S7HA 5EWFA 1SC4B 1V3SA 2YKMB 1JIHA 4KBIA 4NLSA 2GQCA 4NLUA 1X5OA 2IAJB 3M1VA 1OIAA 2POKA 1TUVA 2AZ1A 4URQU 5D15A 3QT6A 1C4AA 4KGXB 2F40A 2HPUA 3HHLC 2WZ1A 4KFBA 3CPWR 5HVFA 2BEFA 2FQQB 3HLUA 3M30B 5CYMB 5E0OA 3MR6A 1D1UA 4DSKA 4DBQA 1UEUA 2PMHA 1G2EA 1FRKA 2CZ9A 4OYXA 1FNMA 5DLFA 4ZVHA 4BC7A 1OJ4A 4X66F 1RBAA 1HWUA 1BE4A 4RNFA 1JLEB 2VFTA 2G1DA 2W01A 2DXDA 2XMUA 2A0FB 3MAHA 1CJUB 1VRQC 2F7VA 2C3YA 3M32A 3THTA 3W5ZA 3M8SA 4CZCA 4ELTA 4KHPJ 3TUJC 4JI3J 4GKKJ 2RF2B 2V4RA 5A8WB 1R43A 3OTOJ 1FHTA 1SB6A 4FPRA 2HAIA 1RTZA 1XR5A 2U2FA 4FYYB 5KFQA 1C1BB 1TMMA 4ELVA 1X4FA 1YBTA 2MMYA 3GZ7A 3GR0A 3NOGA 1Q5VA 5IQQA 4AYBD 1Y5LB 2QEXS 1J5EF 3J7ZT 2UV8A 4K4WA 4ZVRB 2LQ9A 3M8PA 1R31A 1Y11A 2HHXA 4PG7A 1VRTB 1S57A 4DU8A 5B09A 5CCMA 4ED6A 1RKIA 1WKJA 1LWFA 3I9V9 4DN9A 4ECUA 2HZVA 5L8RC 1WF0A 1JJ4A 3EVWA 4F36A 3TZYA 3QNWB 1CSJA 4HTJA 1OPZA 1PAUB 2DRAA 1T3NA 3W9IA 1YKWA 2W7PA 1RZMA 2YNFB 4RW6B 2WW4A 2KXFA 3MWBA 1GNKA 3V4MA 3W7BA 3SQGA 3OLAA 1QVGR 3LWLA 1N33J 4CH1A 3TA0A 3CT9A 4BS2A 4RW7B 5T7LA 2KL8A 2Z8QA 4JI5J 3I6PA 3GQCA 1RT5B 3NS5A 2HLTA 2HFZA 4KE5A 2FTRA 3VAMA 3S01A 1P9QC 2DGSA 4PQAA 5G0RA 2F3JA 3PXGa 3QRRA 1KFDA 5KG3A 3MCSA 1HNWJ 1U49A 4CM2A 1IQTA 2NZCA 1S1TA 4WFAQ 4LF4F 3EDRB 3HHNB 4EYIB 1DLOA 3NS7B 1YJNS 3T1YJ 4DU7A 3CJ8A 2NSCA 5J2MA 3PX0A 2BKPA 2D9PA 2WW8A 1Y7PA 2XCAA 4WBFA 2HGLA 4X65J 1KTQA 1WG1A 2J9CA 1F3VA 2BVZA 2B8QA 3C46A 3JSBA 4ATNA 5HP1A 2HFOA 2QSFA 4KRWA 4X62J 3FBFA 4N7TA 2HQDA 3M32B 4FPIA 4C6AA 2QA1A 1A6LA 4OZ3A 4CLFA 2VG5A 2JJ4D 3KG4A 4RNMA 3FSXA 2OO4A 2H48B 5KFLA 3MR2A 1U6BA 2BKNA 2HW3A 4USIA 4BHQA 1ZA2B 3GMGA 3KK3A 3IN5A 4ID8A 5EX0A 1U7LA 5M2RA 1C2PA 2RKIA 1NK6A 3FCWA 1C0TA 5H9FJ 1HR0J 4B3TJ 1MMDA 2GW8A 2ZJPQ 1FDAA 2M88A 1N0UA 3EWGA 3N6LA 3FBBA 5KAKA 4DLGA 4ECYA 2EEYA 3W1YC 4EK2A 3OTCA 4ECVA 1QSYA 4I2PA 4FXDA 2OPPB 4TY8B 3BYRA 4TY9A 4MK8A 1KD1T 2IA0A 3OPKA 4FVCA 1RT7A 1GXLA 2XBPA 4DDFA 4H4MA 5KFTA 3NNCA 1BD6A 3H4BA 4OL8A 5LSLA 3KUGA 4QPTA 3ENQA 1HYSB 2UUTA 1WUUA 2BOAA 4H54A 1HQEA 2QA4G 1SJRA 1ZPWX 5LOQA 2FC8A 3IG1A 2XHWA 2YQ0A 6AT1B 3MUTP 4DHVA 5HANA 3PFEA 3GR1A 5M2PA 1S77D 1I94F 3CCTA 3MM8B 1QUPA 1BC6A 1WOSA 2V4JA 1RT2A 2JEGA 1X4GA 4M63A 1FFGB 5I4MA 1RUSA 4A8XA 3QZ8A 3DLKB 4IYQA 3CC2S 5KFIA 5KG7A 3FMWA 4NZ0A 5LL6d 2MSSA 3BB5A 2W7AA 1N54B 3PHTA 4J90A 2DR5A 2OEJA 3ET6B 4DUTA 2HQIA 4DQSA 1XR7A 4IQXA 3A8EA 1XERA 2RS8A 3QGGA 1O51A 3KHRA 2ZH9A 4ZHRB 1F0XA 4RNHA 1LW2B 2M5YA 5B0GA 3R7SB 4QR0A 5H9EJ 2ZOMA 3ILOA 5F8LA 4C8KA 2VH7A 3WX8A 1A7GE 4CRJA 1S12A 4LREA 3UPFA 5ETVA 1RAIB 5KFPA 2CFXA 5CD4H 4DUZF 2XMMA 3MCOA 4B9NA 2HHUA 1YRXA 1KQGB 4KH0B 3J7AN 2QMXA 5J2NA 3A8IA 1RP5A 2HS4A 3L3CA 2J8SA 2VG7A 3H98A 2MEWA 4Y2IA 4ZVEA 1R0AB 4OZJA 4TYBA 5D77A 3PCOB 5EUHA 4DPWA 1RT1B 1P9YA 2I38A 2YX7A 1Z4UA 2X1GA 1BQMA 3PHEA 4MT1A 3VQTA 4FBTA 2OPSA 4M95A 2MYFA 2DGQA 2GZOA 4J9UE 4V19J 1K0TA 1FKPB 3DHWC 1EX8A 1FKPA 2CWXA 5FDLA 1QD1A 3SMZA 5F9LA 3ENWA 4KAIA 4FF4A 1JNRB 2D3ZA 2K1RB 4MJKA 1YVFA 1QAIA 2VIHA 4RW6A 2VDHA 3I0SB 3UWTA 3W60A 2H3EB 5T41A 5H9EK 2K8GA 4F4WA 3PNIA 4J9MA 1NDKA 2W25A 2WOMA 3DRPA 1TKZA 4NLWA 4OX9F 4B9SA 1JLBA 1KP6A 4HYKA 3T5HA 2ALZA 1I3OB 4I69A 4RNNA 2HQCA 2H54B 5LJ5Y 5DG9A 2D1CA 3TNVA 1JKHA 2CG4A 2BRLA 3IWLA 4M5KA 3ZTQA 1VQ8S 1FRHA 1KVKA 4X4OA 3PG9A 2UXBJ 4A8OA 2OEKA 1YG0A 3RBEA 2XTJP 3W5YA 5L1KA 1S9EA 1ZBTA 1WHXA 2MGZB 4AL5A 3C16B 1IBCB 1TAQA 3CVKA 4RO0A 3DU6A 4RBVA 2C42A 1N8RT 4NXNJ 4IO1A 2LQ8A 1RHUB 2C2KB 3P96A 1NH7A 3GV7B 2V8PA 2JWNA 3GWCA 3HVTB 4DV0J 1UVIA 4NMXA 4HACA 3V81B 3M9NB 2QV6A 4LSZB 1CPZA 1Y00A 1BLUA 1HI8A 2DNOA 1I51B 1Q8BA 2J9DA 3GJRB 3KLIA 2L9WA 2ZE2B 1IVZA 2V69A 2F1FA 1RTJA 1K44A 1LEOA 3MAAA 2KTQA 2UV8G 2DCLA 3GYGA 5KG5A 1R89A 3DXSX 2KHCA 3GFYA 2AW0A 1XN9A 3LO3A 2BM0A 5F0WA 1RHKB 2D69A 3TI0A 1HKAA 1S4FA 2XYPB 4NXMF 2WTFA 1S1TB 5IC6B 2GCFA 3LP0B 4ED2A 2ZEJA 2XGQA 4NLPA 3C6UB 1HR0F 4RPFA 5C2GA 3MD3A 2CQ4A 4ZCKA 1DAXA 5D4NA 2RRBA 3TJAA 2BQ3A 2KT5A 3N4WA 3EXCX 3DGVA 2VPYB 2B4UA 2XZWA 3DHXA 3DOMA 2QX0A 3K17A 4X62F 1L5UA 4F8RA 4OJHA 4ZVOB 4LF5J 2HVIA 5AJ3J 3IAM9 3M9OB 3MM9A 3CJTA 3PEHA 4K0KJ 3I82A 4X4NA 1DQAA 4X65F 4NYPA 1C0TB 1SIWB 1WI6A 3TA2A 2HS0A 3MOJB 1RLDA 2EFGA 1YJUA 4DV5J 1XMBA 1SJ1A 1HNWF 4NZ6A 2IPOB 5C5JA 5D3GB 1I6JA 3Q86A 4MIBA 5ETTA 4GC7A 3MM7A 2CPYA 2QSWA 2XMVA 4TQRA 2W2OP 3LGHA 4DR5F 4TU8A 4JI1F 2XSFA 3A4TA 3H2LA 3SCKE 4O4RA 3WZ0A 3LPEA 3QBCA 2GX8A 1X9SA 2FHKA 1ZM2A 2HS3A 3WDOA 4DSIA 2P6SA 2HBQB 4RZRA 1B70B 2YVSA 4RUAA 1YHQS 1WSRA 2A18A 3VGVA 2CQGA 1RAJA 4J9LA 1Q95G 4EBCA 2VBXA 1UFKA 4URSA 4DR2F 1NPPA 4M5IA 3FQKA 3RW7A 3W66A 4DXLA 5G0RB 2PGCA 4K4XA 1RTDA 1JLGA 1JLQB 2IMWP 2CNNB 4LSNA 1VJWA 1WKKA 2IHR1 2V4JB 3JSYA 2MKHA 3CCSS 3KKFA 3HT3A 1H0HB 2HHWA 2D74B 3VAJA 2AGOA 3HJFA 2HK2A 4UF4A 4GVLA 1S9GA 1CS4A 2DHXA 1M1HA 4UW2A 4Z7CA 2CJQA 4IRKA 1YRTA 3BEGB 1MN7A 2XNRA 2M7SA 4P75A 4USTA 4DPXA 5DS7A 1SJ3P 4ILLA 3ILLA 2ZH7A 2RU3A 2K3IA 1OQ6A 2AGPA 2RQ4A 1M90T 5LM7E 3I56S 3TEGA 1JJCB 1IWGA 3I31A 4LF2A 1RLCL 1VGYA 2AU0A 4F4XA 5KFBA 3UE2A 5EGYA 2ABYA 2GHVC 2E7VA 2QLJB 3T9NA 3LP2A 4KO0A 2EPIA 1KQFB 3SCJE 3RBDA 3Q83A 2IIHA 5ETSA 1D0EA 4X4PA 3PJWA 5K9FA 1NB2A 1R3NA 2JOQA 3DOKB 1U1RA 1UWAA 1U2FA 1UW9A 2FJEB 4GKJF 2Y1RI 1VBZA 1FWLA 3HF5A 4O0IA 1VQNS 2RF2A 4OJGA 5KG1A 1WHWA 2F5GA 3M2RB 5LMNF 1SL0A 2DXFA 2BZ2A 2ZOGA 2ZBPA 4ETZA 4YP3A 4RW9A 2CQ0A 2W2QP 3DLEB 4Z2XA 4UQGA 1IBKF 2ZUGA 2J7WA 3TVKA 2CPFA 4WKRA 1TP7A 2XQCA 2YY3A 4NA2A 5A8RA 1SI9A 2DNMA 1AT1B 4ED4A 3W3SA 2CNKB 2YNGA 3FKBA 4CO5A 1GAOA 4FZVA 2XSJB 3U1NA 1M1KT 2QFIA 2ASYA 5HATA 3PFOA 2C2RA 3NGSA 4Q5VA 2FJWA 2CQHA 4K5SA 4K50A 2V68A 3QZ7A 4CWBA 1B7FA 3DNCA 1Z1ZA 4N47A 2JSXA 1WG4A 3D6MB 4NYOA 3LP1B 2WVFA 3T5JA 3ZZZA 1VISA 2CJAA 3IP0A 1FTCA 3S1TA 1KN6A 2Q6BA 3E01B 3HSJA 4QU6A 3KG0A 2MDAA 3MM6A 4YDXA 5I3PA 5T7LB 4RWXA 4DS5A 4WWSA 2BR0A 2GVDA 3HO1A 3FZBA 2DCUB 4NI2B 4OZLA 3SSQA 3GU0A 3VGSA 4ALZA 2AJFE 2HQGA 2EVZA 2YNIA 1BGXT 4U8YA 1S59A 4HACB 4ETXA 1FNOA 4DSEA 3UN3A 5KFNA 3G82A 4P7VA 4M94A 2IY5B 1GMWD 3CJ3A 5L1LA 2HMIA 4CLUA 4HKQA 1S1UB 4I68A 5K14B 5E3QA 3OTOF 1BQNA 4WTYA 4QYZJ 5M2UA 5KFOA 1R27B 2B5JB 2R3VA 4DL3A 1VCTA 1B64A 3MM8A 2EBEA 3ITHA 1U1QA 5J1EB 2VOPA 3FEYB 2ADCA 3N5FA 4WYWA 2YWKA 2MKCA 4ZN1A 2WAQD 3EX7B 5CYQA 3M2VB 1SL2A 1RWXB 4P2XA 2HHHJ 1HQEB 1W2IA 1IR1A 3KK2A 2EC2A 3VAKA 7AT1B 2C3OA 1DTQB 2CRLA 4ZLPA 5H9FK 1N0VC 4RUBA 4F2RA 6FDRA 3DM2A 2WVCA 1KC8T 1S49A 2L9NA 2ZKUA 2W9BB 5K8OA 1U4BA 1OY6A 1DQ9A 3B78A 2YKOA 3GONA 3H0PA 3MEEA 4PPZA 4QZVB 3MR7A 3OSPA 1Y10A 1NBEB 2P9GA 5A6WA 2IRYA 5FIIA 4FVMA 2XLIA 4ECWA 2QJ3A 3CJKB 5L46A 3Q0AA 4DMZA 4OI2A 5C24B 3UFCX 1XK8A 4S0MA 3ULHA 4IKAA 1IBLF 1LXNA 3SCLE 3BSNA 2COLA 5HBMB 1ZZFA 3NLCA 1L3UA 1QSLA 2I5JB 1XQIA 3IG1B 4GMKA 3KLVA 3HHLD 3JB9k 4DR6J 2QE5A 1FXLA 3QT8A 4DPUA 4LF6J 4FF1A 1YTYA 2HFVA 2KI2A 5KFFA 5E41A 1UWBB 2OMOA 4ED1A 1BMQB 3C14A 4F0HA 2W4PA 1N5YB 3G9CA 2E1CA 1KTVA 4FKXA 2UUBF 1S4EA 4JI7J 2Z2MA 3IM8A 2NR0A 2ZDPA 2NUUG 4K4TA 5F3TA 3ZTSA 3EGZA 3NY0A 2WHOA 4QPXA 4E2FB 2OPSB 4LSNB 3JAMU 3D3CJ 4FF3A 2P8IA 2QO3A 3A8KA 3D3BJ 4LRDA 5F0UA 2ZD1B 2EFVA 4CO3A 2E5IA 3DYAB 4QWEA 3GIJA 3BBFA 3SQOP 4HDGA 1Z2ZA 3SXLA 1VI7A 4DX5A 1T0TV 3HZEA 1NK7A 1B0PA 1HI1A 2FYXA 2CA9A 2KG1A 4K8RA 3CMES 1MMNA 1RHJB 3HP6A 3M6WA 1RACB 1EB0A 2XYHB 1RI7A 5I3QA 4DV6J 2P5VA 1T3OA 1Q4RA 4JI4J 2V2QA 4NCAA 2ROGA 2QIFA 3UDCA 3ENVA 2FJDB 4I4BA 2MKJA 3I5CA 2PO4A 3O6QA 2JDJA 2CAJA 4L3KA 3W62A 2B43A 3S8SA 3J80U 3JQMA 2I9SA 5DM6Q 5SUHA 3DRSA 5HJYA 1U0SA 1Q0NA 2C2NA 2V2KA 3CDEA 5EWGA 3GFXA 3FFIA 3C15B 1SV5A 2DISA 2PEBA 3HKZD 1R0CB 3NCQA 2VV5A 4DX8H 4F04B 3KK1B 4MKAA 1KDNA 4NLDA 1EHWA 2ZD1A 3CC4S 4PWWA 4AT1B 4OYZA 4GKJJ 4M5DB 3T19A 5DLGA 4WP9A 3SIPB 1SJ4P 1ZS6A 2FLLA 4JV5J 1WEYA 1YGYA 2B4PA 2BJ7A 3R27A 4MK7A 4HR2A 4QW8A 4PWDA 1WNEA 3NL0A 1VDHA 3B82A 4ZVUB 3OVAA 1FERA 3HX9A 1T9VA 2AD9A 1SL1A 1REVB 2W9BA 2VJUA 3FQLA 2XMKA 2R4FA 5RUBA 1F9HA 1S1WB 5GVQA 4DCOB 3NMAA 3EGNA 3OFEA 2VFRA 3QO9B 4ANCA 3LOUA 3U1MA 1U09A 2VJVA 2QRRA 1RWPB 3R5BA 1T02A 1ZAWA 4WP3A 4U8VA 5J1NA 3CWJA 4CQ1A 1M5SA 3FK4A 5DETA 3EICA 1UCNA 3M05A 2M0GB 2MKYA 3IMQJ 2MKSA 1FKAF 2V2ZA 2XGPA 3PM9A 3QAUA 3WX4A 5A8WA 5KOWA 4OJ3A 4U7CA 3OJUA 4B9TA 4Q45A 4F02A 3L4BC 1HD1A 3CDBA 3HD1A 3CEDA 2BABA 4NX9A 3OJSA 1K8AT 4EWTA 3E8OA 3RGIA 1IM6A 1GX6A 1JQGA 2CVEA 4OHWA 2OD6A 3R7NB 5B0BA 3TQEA 2E9RX 3AB2B 1J5OB 1OSCA 1K1SA 3POTA 2ROPA 3IS9B 3KJVB 3CULA 1AFIA 2BE2A 1LWFB 4OX6A 2IRXA 3UD3P 4EZ9A 1U1PA 1QTMA 5KFGA 2B9XA 2CNLB 3V6HA 5J1EA 1I1GA 3H25A 1T94A 4MYTA 4F3MA 1NXIA 5CABA 2Y8YA 2CPXA 1NZ8A 2HWHA 1FTRA 3TZWA 4PZVA 4DL5A 4J9VA 4U95A 3I0SA 2PI4A 3QRPA 3EZOA 1FJ7A 2HMIB 2JL9A 2BJDA 1PYSB 1MROA 2GJ2A 3TZXA 1ZYQA 5HLFB 3Q2TC 3DFEA 3P45B 1FDDA 2YNIB 2UZAA 4DLEA 2DH7A 2QTWA 4FXWA 1VLOA 1VQMS 3OR1A 5J1PA 5JVGQ 4BDPA 3LA0A 2ZBRA 4JI2J 1RT6B 4Y34A 2RD5C 2MZ1A 4ZPAA 2W2PP 3ONQA 2QZ8A 4J91A 5KFUA 1IKXA 3I55S 1S6QB 3IGNA 5HI7A 3R8YA 1TFWA 4KJIA 4LRCA 1FKOB 2XULA 4DCJB 2GVZB 1WELA 2JFDA 4YHHJ 4Y0FA 3I0RA 3DRRA 8AT1B 3D6HB 4YB5A 1J27A 3DOMB 3MI7X 4RW8B 4UUXA 3RUBL 1N32J 5D0RA 2HQ3A 4ANDA 4B17A 5IT9U 3D0IE 4CLPA 3FSIA 2KM8B 1Z2LA 5HQLA 4NXNF 2DEJA 3EVOA 2MLZA 2PN6A 4YB6A 3C14B 1N5YA 3N6NA 1VS3A 4J37A 1TL7A 1Y4ZB 3OL7A 4J7CA 4KV8A 3LW5C 4B3RF 2IYGA 1LK5A 5GAEU 1TFYA 2AHOB 1EP4B 1D3WA 4LBHA 5K8NA 3W2VB 1HIYA 2B7BB 1U6ZA 3CJ4A 3MZIA 1ZA1B 2R42A 2CADA 4IDKA 4C8NA 4DZ6A 4IG3A 1JJ2R 3DOKA 3D4JA 3NP5A 3Q24A 1XNQF 1HLWA 5JVHQ 4RUHA 2AJ1A 4K2XA 2HYIB 1VBKA 2PC6A 3FGVA 4DR6F 2CNOB 4OJ1A 4AXIA 1RAEB 2RRAA 4OZNA 1QM9A 4CO2A 1RGVA 3R5GA 5DG8A 1WJ9A 4JV2A 2DRDA 1XBWA 2XY6A 4PRFA 1VQOS 1SUQB 2KXHA 1SUQA 3RU0A 3IM9A 1V3ZA 3G6XA 3AQOA 3NS6A 3TUIC 2J6TA 1X4AA 1UP1A 2CJKA 3ISNC 2XY7A 1JKHB 2FJBB 2K2PA 4JV5F 2UVWA 3THPA 3R97A 3M2VA 1S9GB 5AJ3F 3CD7A 4K4ZA 2CKWA 5GADI 4DQRA 4KIAA 3IFEA 1K73T 4WFZA 1GMWA 1ZPVA 4C11A 1NB7A 1RB0A 2FC9A 3BGRA 4NA3A 1X0FA 1K0VA 1EARA 5KFHA 3NCPA 2A3JA 2VG5B 3OTDA 4LBPA 5HROB 4LF9F 2FLOA 3FC9A 3NWRA 4UY8T 5E2QA 1QDUB 4PWDB 3HVRA 1GFWB 5DG7A 1FCAA 2WK4A 1YLXA 3W2WB 4M5GA 4UZCA 2HGNA 5T14A 4OYWA 1N48A 4MFBB 9ATCB 1FO1A 3LAMA 2LA4A 2VZ9A 4KGVB 4LBIA 1LWEB 3PW5A 4JI4F 2Y9HA 4GVBA 1WEXA 3F44A 1R0BG 2QA4S 4OI1A 3C19A 3CCRS 3CF5Q 5E3CA 1OYEA 2UXDJ 2IVMA 5DZ6A 1VK8A 3KJFB 2EBGA 5A2QU 4DFKA 2WB4A 2V8VA 2QYCA 4USVA 1RSCA 2W1BA 3DLHA 3H5YA 3AJ1A 3CNQP 5DDRC 2HNZB 1KHVA 4NRUA 4Y6IA 1S1VA 4LMZA 2A10A 2E66A 2MLXA 3D6FB 2DGTA 1A0OB 3KLIB 5ETQA 5KFAA 3CCLS 2LU2A 4X64J 2KRRA 1FVQA 1N5SA 1JNZB 2OGUA 1CQMA 4U7UD 4PYDA 2FPHX 2IM2A 1WHYA 3IR5B 3OFGA 5AXKA 4NZ7A 1S6UA 1DFDA 1XMQF 3T5KA 2EFQA 4FXVA 2HHSA 4Y2KA 1RHRB 1R0AA 4OZ5A 1S0MA 2MQNA 1RYRA 2FVPA 3CTRA 3IA0A 1FD2A 3DLLQ 2X1BA 3QPIA 4L72B 4M5MA 3X3UA 5JMNA 5I3UA 1XNRJ 2CPJA 3D6TB 1FXDA 1TZ0A
chains in the Genus database with same CATH topology
2Y1LB 1I3OB 4DCJB 1RWOB 2H54B 2H65B 3IBFB 4ZVPB 3D6HB 3EDRB 3NS7B 1IBCB 1RHJB 2QL9B 2XYHB 3KJQB 1RHUB 2C2KB 2CJYB 1NMEB 5K20B 2P2CB 1RHQB 2H4YB 2XYGB 4LSZB 2CNKB 1I51B 2C2OB 3GJRB 2H48B 4DCPB 3D6MB 4ZVSB 1RHKB 3R6LB 4JB8B 3KJNB 1SC3B 1RWNB 2XYPB 2CNOB 4ZVTB 3SIPB 5IC6B 3GJTB 4ZVUB 3R7BB 3GJQB 2CDRB 4DCOB 1SC4B 4ZVOB 5IC4B 1RWWB 1PYOB 2XZDB 2HBYB 2QL5B 2C2ZB 1RWPB 2C2MB 1ICEB 1RE1B 1RWKB 2FQQB 1RWXB 3P4UB 1QDUB 2CJXB 2QL7B 1GFWB 2C1EB 3R6GB 2HBQB 3R7SB 3R7NB 3R5JB 3RJMB 2XZTB 2H5JB 3EDQB 3KJFB 2H5IB 2CNNB 2CNLB 1SC1B 4ZVRB 3IBCB 2QLFB 1QTNB 3D6FB 1F9EB 1RWMB 3QNWB 1RWVB 1PAUB 1BMQB 3P45B 2H4WB 2HBRB 2HBZB 1RHRB 2DKOB 4ZVQB 2Y0BB 3GJSB 1RHMB 2QLJB 2H51B 2QLBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1L B;  1I3O B;  4DCJ B;  1RWO B;  2H54 B;  2H65 B;  3IBF B;  4ZVP B;  3D6H B;  3EDR B;  3NS7 B;  1IBC B;  1RHJ B;  2QL9 B;  2XYH B;  3KJQ B;  1RHU B;  2C2K B;  2CJY B;  1NME B;  5K20 B;  2P2C B;  1RHQ B;  2H4Y B;  2XYG B;  4LSZ B;  2CNK B;  1I51 B;  2C2O B;  3GJR B;  2H48 B;  4DCP B;  3D6M B;  4ZVS B;  1RHK B;  3R6L B;  4JB8 B;  3KJN B;  1SC3 B;  1RWN B;  2XYP B;  2CNO B;  4ZVT B;  3SIP B;  5IC6 B;  3GJT B;  4ZVU B;  3R7B B;  3GJQ B;  2CDR B;  4DCO B;  1SC4 B;  4ZVO B;  5IC4 B;  1RWW B;  1PYO B;  2XZD B;  2HBY B;  2QL5 B;  2C2Z B;  1RWP B;  2C2M B;  1ICE B;  1RE1 B;  1RWK B;  2FQQ B;  1RWX B;  3P4U B;  1QDU B;  2CJX B;  2QL7 B;  1GFW B;  2C1E B;  3R6G B;  2HBQ B;  3R7S B;  3R7N B;  3R5J B;  3RJM B;  2XZT B;  2H5J B;  3EDQ B;  3KJF B;  2H5I B;  2CNN B;  2CNL B;  1SC1 B;  4ZVR B;  3IBC B;  2QLF B;  1QTN B;  3D6F B;  1F9E B;  1RWM B;  3QNW B;  1RWV B;  1PAU B;  1BMQ B;  3P45 B;  2H4W B;  2HBR B;  2HBZ B;  1RHR B;  2DKO B;  4ZVQ B;  2Y0B B;  3GJS B;  1RHM B;  2QLJ B;  2H51 B;  2QLB B; 
#chains in the Genus database with same CATH topology
 1OO0 B;  4RL1 A;  2C3U A;  4FYV B;  4ZVG A;  2K7J A;  2MY7 A;  2R7Q A;  3CDU A;  3CDW A;  4JUZ A;  3DLB A;  3DC2 A;  5LMN J;  3QIP A;  2DH8 A;  1Q16 B;  1S76 D;  3D54 A;  4X4S A;  1B0T A;  2ZE2 A;  4O3R A;  5B0C A;  5D6G A;  2DGW A;  3DI6 A;  2PMZ D;  2F9J A;  1T03 B;  1S0N A;  2QYG A;  3GG1 A;  3FCH A;  1BWE A;  1F2G A;  4PXE A;  1ZTW A;  2WSE C;  3B4M A;  1UA1 A;  4HH0 A;  2VD3 A;  3BGU A;  3GPA A;  2BA9 A;  1MWQ A;  2OPQ B;  2XWX A;  4I56 A;  3BO4 A;  1VQS A;  3G8Q A;  5KG0 A;  2C2O B;  1UZH A;  2DEI A;  2LQB A;  5HJX A;  3OV7 A;  2RDD A;  4LF4 J;  1S9E B;  2JX2 A;  2MGZ A;  2OSQ A;  2UXC F;  3J7A 1;  4ZP6 A;  2UVV A;  4QYZ K;  1X4D A;  3QSI A;  3PW7 A;  3OUY A;  4F7V A;  2VOD A;  3R5C A;  4DCP B;  2CXE A;  1PCA A;  2FD2 A;  2V50 A;  4L76 A;  5ETR A;  1N6Q B;  3MUV P;  2RML A;  4L6V 3;  1AFJ A;  2CYY A;  4JB8 B;  4RUC A;  2ZH8 A;  3CCV S;  3T6B A;  3CIZ A;  2C2D A;  2A1B A;  1T9T A;  3HK2 A;  1HYS A;  1FWP A;  2X1A A;  1VC0 A;  1L3V A;  3Q8S B;  4O4G A;  1CJV B;  2B9W A;  5AXM A;  3BGL A;  2RB7 A;  3KUE A;  2J0S D;  1CLF A;  3V6D A;  2MPU A;  4Q8E A;  2KT3 A;  3H5S A;  4ZHR A;  2ACY A;  3ITH B;  1LWC B;  2CDR B;  3QMQ A;  5C42 B;  1WC3 A;  3EPI A;  2JLG A;  2OPP A;  2K7K A;  3P5T L;  4L3N A;  4O3P A;  2CQ2 A;  3EUN A;  3MED B;  3HUL A;  4PCQ A;  2MKI A;  5KFM A;  3M8W A;  5E3A A;  1PYT A;  5DDP C;  4DUY F;  1SV5 B;  1C1C A;  1RT5 A;  5GME A;  4RR5 A;  3A1Y G;  5BYQ A;  1CUL B;  4Z37 A;  3KK1 A;  1SKR A;  1ZTT A;  1ULR A;  2ZHB A;  2DO4 A;  2EKN A;  1AA1 B;  2DNG A;  2HFN A;  2VFU A;  2DHA A;  2ZVI A;  4RX6 A;  2NSB A;  4NA1 A;  3SQG B;  1LFW A;  4YHH F;  2IC3 A;  1J2V A;  4DPY A;  2VC1 A;  3RRG A;  3RR8 A;  1N34 J;  2CUY A;  1FEH A;  2V34 A;  1VQP S;  3VR1 A;  3SYZ A;  3WIV A;  1Q1K A;  4ZJO A;  4PG5 A;  2E5L J;  1OY9 A;  1X5P A;  4QYR A;  1TAU A;  3LP1 A;  1S6O A;  4I2Q B;  1FEE A;  4RLE A;  1S97 A;  1ZM3 A;  2KJW A;  4ES1 A;  3C6T A;  4V1A k;  1TK8 A;  1YK9 A;  3GYN A;  2FY1 A;  2U1A A;  1GH8 A;  4O3N A;  2L48 A;  5A76 A;  2PFF B;  3PRV A;  5KFW A;  3HMJ G;  1HBO B;  3MPY A;  4WFY A;  3N0V A;  4NPO A;  4ENO A;  4D3G A;  1HBM A;  1YJ7 A;  5DQH A;  1AZS B;  1FT8 A;  1R8C A;  3OL9 A;  2E1P A;  5KFY A;  4QW9 A;  2DHG A;  5F8H A;  2JC0 A;  3MM5 A;  1RK8 A;  1V9O A;  3CB4 A;  3F56 A;  5FLX Y;  3CIM A;  1X4H A;  1R6V A;  2KHD A;  1O6X A;  4DPT A;  2F8H A;  2LXF A;  3OTB A;  2CQD A;  3AXK A;  4KT0 C;  1KLM B;  1WD6 A;  3ZTO A;  4ZK7 M;  2YXL A;  3I4P A;  4DV4 F;  3ZNJ 1;  1YJR A;  4LRF A;  3TAM B;  4C3K A;  4DQQ A;  5IZH A;  5CD4 A;  1U24 A;  1EIY B;  2O67 A;  2FUG 9;  1VIX A;  2X3D A;  5DRK A;  3MGJ A;  4AQY J;  4JV0 A;  4ZVQ B;  1YDL A;  1DLO B;  4ZP7 A;  5BYR A;  2LXU A;  1FJE B;  3ENA A;  3B54 A;  4DX6 A;  1HNZ J;  2WON A;  3GJS B;  4K5R A;  4BC9 A;  2FVR A;  3R2C J;  1YX2 A;  2DNH A;  4KGK A;  3T3F A;  2QLB B;  5ETL A;  2ZUA A;  2G0J A;  1UMJ A;  2CZV C;  1VMB A;  2HZA A;  1EQ0 A;  4K4Y A;  4LSL B;  1NZA A;  4I0W A;  1VRU A;  4Y28 C;  2YH1 A;  1FXR A;  1CBK A;  2NXN A;  3IBF B;  4LR7 A;  2I6W A;  1NK8 A;  2Y3Y A;  4RW7 A;  3NG8 A;  3EGV A;  4CLY A;  1RT6 A;  3FZ2 A;  4L75 A;  2NYH A;  2AF6 A;  1WWH A;  1IJF B;  4HI1 A;  5IXU A;  3PTW A;  4QIW D;  1R7I A;  5KT5 A;  2XHC A;  2ZBI A;  3OL8 A;  4DR5 J;  4RU9 A;  2ERR A;  4IDK B;  1GT8 A;  5GAD U;  1Q81 T;  1WC6 A;  2HNY B;  4P10 A;  4DOZ A;  2WVD A;  3G8S A;  2XYG B;  2GS8 A;  2CQB A;  3EJM A;  3OXL A;  1CC8 A;  3UO0 A;  1IBL J;  3PRD A;  2PA8 D;  4DV7 F;  2F4V J;  2BAC A;  1PJ7 A;  2ZDO A;  5AT1 B;  5J2M B;  1I5O B;  3NKY A;  4MH8 A;  3G8T A;  3CUN A;  2RQK A;  4XPC A;  4B3S J;  1YI2 S;  2K3K A;  1AW0 A;  3CD5 A;  2PE8 A;  4AD6 A;  4PXD A;  3VAL A;  1YWX A;  3MR5 A;  3QJL A;  5HMW A;  4HHH A;  3Q22 A;  4ECT A;  1D9A A;  3K8W A;  5I42 A;  4QU7 A;  3DOL B;  2IDL A;  1FX4 A;  3R6L B;  3NOC A;  1HMV A;  2RHS B;  3CCM S;  3KJV A;  3T1H J;  3ZXW A;  3O3L A;  1TKD A;  3DKD A;  2XO6 A;  2RRN A;  3QLH A;  1SQE A;  1SJQ A;  3MF5 A;  2YNH B;  3GJT B;  3G6Y A;  2E9T A;  2AYG A;  4USM A;  3E51 A;  3QID A;  1RAA B;  1WC1 A;  4NML A;  1SC6 A;  2RU9 A;  3QJP A;  1JLE A;  4WFB Q;  4ZIT A;  4H4O B;  5HVH A;  2CDQ A;  4DV3 J;  4C9D A;  1Q78 A;  4C3M A;  1TU0 B;  1PIL A;  2KM8 C;  1XNR F;  3H42 A;  3LTO A;  4GO7 X;  1U2C A;  1KSP A;  2WCX A;  2DNZ A;  4KPC A;  3CE8 A;  3T1Y F;  3CO0 P;  3MUR P;  3C16 A;  2CQP A;  3DDN A;  3VVU A;  4PXB A;  1TKT A;  2XMA A;  2DIT A;  2GJF A;  4O3Q A;  2R7T A;  4JYA J;  1KVJ A;  3RYL A;  1EKS A;  2NYI A;  4ZLJ A;  3QGP A;  2IJN A;  1WC0 A;  1O8B A;  3BKF A;  2MY8 A;  2YKQ A;  2LXI A;  3QO9 A;  4O0N A;  1F6T A;  2NPF A;  5A0Y B;  4O4G B;  4U67 Q;  4J9Q A;  1YIJ S;  3WC0 A;  2QL7 B;  2DR6 A;  4RW4 A;  5HK4 A;  2R7O A;  4DUY J;  1K9M T;  1VQ5 S;  5EN1 A;  1TR0 A;  1KHW A;  2J0W A;  1RAD B;  2VG6 A;  3E3X A;  2OH2 A;  4N76 A;  2R2T A;  4DFP A;  3QFW A;  3FVY A;  2K1R A;  4OYI A;  4NLQ A;  5BXI A;  3B4D A;  4DL0 C;  4JI8 F;  2CPZ A;  1VK3 A;  2SXL A;  1GTH A;  4IOB A;  4CT8 A;  3GV8 B;  4CO4 A;  4A8F A;  3K59 A;  2UUC F;  3HKW A;  3QGI A;  2F63 A;  3H8Y A;  3PVX A;  2JNJ A;  3EDQ B;  4I1T A;  1DAR A;  4OLO A;  4A47 A;  3TAQ A;  1RA6 A;  4LJM A;  3M6X A;  3BDE A;  4C0H A;  4KGM A;  5GAG U;  3S7R A;  1IJE B;  4QIE A;  2VG7 B;  4FNI A;  2EW9 A;  1MN9 A;  2V2V A;  5KFZ A;  4JYA F;  3HDS A;  2MQ8 A;  2ZH6 A;  4LQ3 A;  2VKR A;  3AOA A;  2N82 B;  2Y8W A;  4X4U A;  1L3T A;  5BR8 F;  3BSC A;  5KT4 A;  3PW4 A;  6FD1 A;  1GXU A;  2AJ2 A;  3KFW X;  1S10 A;  1RWU A;  1K47 A;  3BS9 A;  3ETO A;  2DIU A;  2H4W B;  4TKT A;  1ZM4 A;  2KJV A;  5D3G A;  2CQC A;  3BGO P;  3VGU A;  4KKO A;  2UVR A;  1P8G A;  2GHP A;  1TKZ B;  3MFI A;  3CCQ S;  2WVE A;  1IKW B;  2H51 B;  4Q7A A;  3FRZ A;  1ZAX A;  2FY8 A;  3UR3 C;  1U0H A;  1T95 A;  3UQS A;  2GJI A;  5F9N A;  2Y1J A;  1JLA A;  2A6O A;  3MM5 B;  1UVK A;  4WE1 A;  3HJV A;  4CO1 A;  4DV7 J;  1HNX F;  4WU2 A;  1HWK A;  4WKY A;  3MOZ A;  3THV A;  1S0V A;  1TVR A;  3MXH P;  4LRA A;  4PQU B;  1KVI A;  1WC4 A;  2LYV A;  4JI6 F;  5HVG A;  4NLY A;  1OYD A;  1RT1 A;  2ZNY A;  3V6D B;  4G6V B;  4I7F B;  4YY3 J;  3C15 A;  1V5V A;  4LR9 A;  5D0E A;  1X4B A;  4TLQ A;  3U1L A;  3DGP A;  5L1I A;  1RHQ B;  1TUG B;  2O1P A;  4M5H A;  4WK1 A;  2HLU A;  5KFE A;  3PO5 A;  1LW0 A;  2HSE B;  3H5X A;  2X51 A;  1GMV A;  1CJT B;  4JOU A;  3UDV A;  5ADZ A;  3KLE A;  2YWG A;  4O3O A;  2Q1L A;  1AUD A;  4B9L A;  3OUY B;  2N4D A;  3VQS A;  4V19 X;  5HMZ A;  4M1K A;  4XAK A;  3G96 A;  1H6K X;  3LAN A;  4GVB B;  4IG0 B;  3U27 A;  3BBB A;  3PJ9 A;  2W7O A;  4NLT A;  1FK9 B;  3HPO A;  4CLW A;  3KNA A;  5ETN A;  4U7U K;  3KMQ A;  3L7O A;  1XIQ A;  2E9Z A;  2VPZ B;  3GE9 A;  4ZVT B;  5HSP A;  1U45 A;  1F2H A;  1CVJ A;  1RAG B;  2G13 A;  1N32 F;  3P49 B;  2NS1 B;  5KG4 A;  1W26 A;  4CP5 A;  1UAW A;  3FCV A;  1NSP A;  2GGP B;  3BH6 B;  3DM2 B;  4OIX A;  3HHL B;  1NKC A;  2XWY A;  2GML A;  2BQU A;  1OWX A;  1VR6 A;  5KG6 A;  1VBY A;  2ZZN A;  2DGV A;  1TL5 A;  1PYO B;  3HHE A;  3WC2 A;  3EVM A;  1T9W A;  4JI3 F;  1IR2 A;  4Y2A A;  3KDO A;  1TTH B;  2QL5 B;  2HRT A;  3HFK A;  1FI4 A;  4K0K F;  2ZHO A;  4KO0 B;  1S48 A;  1HA1 A;  2YWH A;  3TRG A;  1KEK A;  2MKK A;  1ZZN A;  1BQX A;  1Q7Y T;  3CCZ A;  3OD2 A;  3QT5 A;  4UOF A;  1NSK L;  1Y5I B;  3BR8 A;  2AEJ A;  3AJD A;  2DNY A;  3BBC A;  3G6V A;  2RT3 A;  3FSY A;  2NQP A;  3MD1 A;  4ED5 A;  3T1H F;  4Q43 A;  2CJX B;  4G65 A;  5J2P B;  4FF2 A;  4H4K A;  5A6P A;  3NGU A;  3CXC R;  1X9W A;  3O2I A;  1RU1 A;  2W2N P;  2PEH A;  2VON A;  4HHU A;  2E7W A;  2IJR A;  3H59 A;  4TU7 A;  1KS2 A;  1LKZ A;  3HD2 A;  2AX0 A;  2EFO A;  2OPR A;  3JSR A;  5CXT A;  2XZT B;  3M2U B;  4FNH A;  3UW1 A;  4Y65 A;  4ILM A;  3WHI A;  1BHN A;  3LF0 A;  2H5J B;  1RT4 A;  5C25 B;  2ZH5 A;  2XLJ A;  1VC6 A;  3C8Y A;  1N34 F;  2UU9 F;  1RTD B;  3BF4 A;  4R0J A;  1O5J A;  3P8B B;  2Z2L A;  2O01 C;  4LF8 J;  3K5L A;  1CJK B;  4J9O A;  4DPO A;  2L9D A;  4YFU A;  3BPD A;  2FJV A;  4NLG A;  2KO1 A;  4ZOS A;  3Q8P B;  3OBI A;  1XMO J;  4QIF A;  2ACM A;  3MEC B;  3QRQ A;  4B3R J;  2CJB A;  5A0Y A;  4IFV B;  2WBR A;  3OTE A;  3TUZ C;  2F4F A;  5E5N A;  5AE2 A;  5I3U B;  4BBY A;  1RWM B;  3Q23 A;  1NJI T;  2RAQ A;  2YKN A;  2YPY A;  4ZIV A;  4DV1 F;  4AL6 A;  3UVJ B;  3US5 A;  3PYD A;  1FWK A;  4TLR A;  1RKJ A;  1CUL A;  1FJG J;  3NRB A;  2ZKT A;  2HKE A;  3KWM A;  4JP8 A;  2XG8 A;  2GGP A;  2XEX A;  4ZKA A;  1C4C A;  4K4S A;  5K8M A;  2VF3 A;  5DJB A;  3M8Z A;  2OEL A;  1S6P A;  3MED A;  4AE5 A;  4CO0 A;  5LT5 A;  3K5P A;  2B9E A;  2DNK A;  4TN2 A;  3I5A A;  2CQI A;  3QFH A;  4I6W A;  2R7U A;  2P9C A;  3CMQ A;  2R8I A;  4ECS A;  1SIZ A;  1TK5 A;  1ELO A;  4JBC A;  2ATL A;  3OR1 B;  2IMO A;  1RWO B;  1WOR A;  2BAN A;  5ETP A;  5L9N A;  1S1V B;  1FRX A;  3BN4 A;  2PD1 A;  3MEC A;  3I9Z A;  3OHA A;  4FS2 A;  4KHP F;  4GKK F;  1WEZ A;  3L9Z A;  3A12 A;  3DLG B;  4IH5 A;  3E01 A;  3UD5 A;  4F4Y A;  2V9W A;  4B3O B;  3MTJ A;  3DU5 A;  4EI2 A;  2VKZ G;  4ICL B;  4KR0 B;  3Q8R B;  3SI8 A;  4N41 A;  4Q0B A;  2QL9 B;  3MEK A;  3QQC D;  1MML A;  1H98 A;  3C6U A;  3KJQ B;  4B3T F;  2G2Y A;  2J0X A;  2EWH A;  2FHJ D;  4A8K A;  1H72 C;  5D4O A;  3UNG C;  1W7W A;  3H7H B;  2FVQ A;  4MAK A;  2DB1 A;  1Q7L B;  4IO9 Q;  2VBY A;  5KFS A;  2HHH F;  3IGV A;  1T7P A;  4YOE A;  1TL3 B;  4YME A;  3NGR A;  1QAY A;  3OR2 A;  1UJ6 A;  2MQQ A;  2RKI B;  3RAM A;  3Q8U A;  3AOB A;  2JEF A;  2Z30 B;  1T05 B;  3DDK A;  4L74 A;  1IKY B;  2KKH A;  1PBU A;  3BV8 A;  4DI6 A;  3PKY A;  1KRP A;  1Y3J A;  2LEP A;  1XR6 A;  2AQ4 A;  1JMT A;  2KZM A;  4KV8 B;  4PG6 A;  5E3R A;  5DZ7 A;  3CJ2 A;  4IQM A;  3RRH A;  3TW0 A;  4OHY A;  2K06 A;  3BKT A;  3KK2 B;  2CQ3 A;  1NJY A;  3AQP A;  2J6U A;  4QWA A;  1NU4 A;  4DR7 J;  5BJR A;  3HSD A;  3W8P A;  5IFM A;  1TL1 A;  1TV6 B;  4W92 B;  1ROF A;  1WTF A;  3CJR A;  4DG1 B;  4DV0 F;  4FYD A;  2J76 E;  1NHK L;  2BJ1 A;  2BE7 D;  1NJX A;  4DQP A;  4D3H A;  3KLF A;  5EHH A;  1L3S A;  1PKU A;  2KFN A;  3BYP A;  1WF1 A;  3GFH A;  4F25 A;  4F67 A;  3W9J A;  4USJ C;  3K5O A;  2XM3 A;  2W9C B;  1S1U A;  1H2V Z;  3BQ0 A;  1P27 B;  2R8K A;  4JI8 J;  4YB1 P;  2YX4 A;  2D3O R;  2C2Z B;  2AGQ A;  4J5O A;  2DBB A;  1RE1 B;  2IFX A;  4F0K A;  3TAM A;  3NBP B;  5F3Z A;  3J7Y U;  2V4Q A;  2ILZ A;  3TEH B;  2LFV A;  3AXM A;  4OYP A;  3K5M A;  3AFG A;  3M6U A;  4RNO A;  3G86 A;  2LEC A;  4PKD B;  4WU3 A;  2ZVS A;  5KT6 A;  3AA9 A;  2I0X A;  2YPZ A;  2RQM A;  3JQK A;  1IKV B;  1HNI A;  2EG2 A;  3QLH B;  4C97 A;  5HMX A;  2OKQ A;  5FDL B;  4X2B A;  4NE9 C;  1N36 J;  1FDN A;  2E5H A;  4ZCI A;  4CTA B;  3DN9 A;  4ER8 A;  5C7P A;  4G1Q A;  1DY3 A;  1NH8 A;  2E1M C;  4LF9 J;  1CC7 A;  2OAU A;  2OUG A;  1HNX J;  3EGW B;  3I96 A;  4FBU A;  1YSJ A;  3PIP Q;  3EYZ A;  4O3S A;  1RT3 B;  1FE4 A;  4OHV A;  2IA6 A;  2BW2 A;  3KNG A;  3JTP A;  2FZK B;  2Z4P A;  1PBA A;  2OSR A;  2V0N A;  4MFB A;  4NLX A;  4Q2L A;  4X66 J;  3PKM A;  1Q5Y A;  1PO6 A;  1NRK A;  1ARO P;  3RB4 A;  3GIR A;  4DL2 A;  3RR7 A;  2OHD A;  3Q8V A;  4X4Q A;  4OYM A;  2DNR A;  3UCG A;  2VA2 A;  5ETO A;  1JJH A;  1RCX B;  3LGM A;  3R1H A;  1IKX B;  1HPZ B;  2ZC3 A;  5MLC V;  3ZZU A;  3PX4 A;  2GIF A;  4H4O A;  1C1C B;  5KFJ A;  2Q3P A;  5F41 A;  2R2U A;  1U02 A;  1YJV A;  2VAS A;  1R8B A;  2HHP A;  4LIW A;  3DLJ A;  4LSL A;  3R9L A;  1F5B A;  3P3D A;  2QGF B;  5GAG I;  2XCP A;  3KLH B;  2QN6 B;  2LKZ A;  2Z0G A;  1QLN A;  1UVN A;  2RUS A;  5GAH I;  2FJA B;  4R8U A;  1RJJ A;  4CYU B;  1RBO B;  1WC5 A;  2XB2 D;  1UPP A;  2XNQ A;  2IAJ A;  3M1V B;  4JI5 F;  4MYU A;  2VQE J;  2Y1L B;  1MWY A;  5IWA J;  5K8P A;  3EE3 A;  5CQG A;  5B0A A;  2Q43 A;  4WII A;  3GLJ A;  2ZH4 A;  1XNQ J;  1S1W A;  3AHP A;  5A8K B;  4MIA A;  3HFZ B;  5LSO A;  4YR3 A;  4DWI A;  2KU7 A;  4WK3 A;  1JXE A;  4IOA Q;  3AA8 A;  4DV1 J;  2ASJ A;  1OQ3 A;  1LWX A;  2JC1 A;  4PAA A;  2DNQ A;  1NME B;  4JI1 J;  5JJB A;  5D78 A;  4ELU A;  2P2C B;  1G1X A;  1WDD A;  1B99 A;  3MMC A;  3SSS A;  1HW9 A;  4M5D A;  1D9F A;  4URG A;  1DJ0 A;  1QE1 B;  1U1K A;  2DIV A;  3V6J A;  1GX5 A;  4EO6 A;  3N01 A;  2DNN A;  2XI2 A;  1VQK S;  2E1R A;  1TL4 A;  3CW2 C;  4UY8 5;  1X9M A;  3FBE A;  1XEZ A;  2D41 A;  1Y0H A;  3FUY A;  5J2N B;  4NL5 A;  2M8D B;  1UVL A;  2RHQ B;  4DJB A;  4PUO B;  2GAG C;  3DCA A;  4B3M F;  3MMA A;  3RZA A;  3DLG A;  4WXO A;  3TR5 A;  3ZZ0 A;  4WFN Q;  2XI3 A;  3MM7 B;  2UXC J;  1JXL A;  4ITS A;  1G3O A;  2M52 A;  3SFG A;  1G4C A;  3H2V E;  1TL1 B;  3SEO A;  4DSF A;  2VHG A;  1FKO A;  4Y2M A;  1QY7 A;  1E6V B;  4WIQ A;  5F8I A;  1S6Q A;  1GMU A;  1PC4 A;  3AH6 A;  2GMH A;  2A2C A;  2VDI A;  4EYH B;  4W4M A;  3F0N A;  2R2S A;  3PYF A;  3QAE A;  3ZNU A;  2ZH3 A;  4TVA B;  3GB0 A;  2FIU A;  4M5J A;  5LMU J;  1U47 A;  2HWI A;  4YB7 A;  4IRD A;  2XS7 A;  4OI0 A;  2HQF A;  3KHG A;  5THW A;  3V2U C;  1VQ4 S;  2AT1 B;  3K7R A;  3AAW B;  5B7W A;  1X5T A;  3UI3 A;  3FDS A;  1U1M A;  3FJ2 A;  1ICE B;  1TK0 A;  2V63 A;  3M8Q B;  4FDF A;  1KON A;  2ZFH A;  1HMV B;  1IQZ A;  1VC5 A;  4A8S A;  3JXO A;  4OHX A;  3VV2 B;  2DGX A;  4J9R A;  2J9D E;  2LQJ A;  2EFN A;  2QT7 A;  3PEJ A;  3ZFV A;  4ES3 A;  2FVS A;  4KTQ A;  3D66 A;  2BOP A;  1RTH A;  4P74 A;  4AXJ A;  1NO8 A;  5CYJ A;  1WTB A;  4G1I A;  4E98 A;  1SVD A;  3R6G B;  3HXM A;  1E6V A;  2O5D A;  4JI0 F;  4LIR A;  4CTA A;  3QSY B;  1LW0 B;  1G6B A;  1OS5 A;  3EZ5 A;  3V6K A;  1H3D A;  3M8P B;  1HBN A;  2HFU A;  2KB2 A;  2OFG X;  2A2D A;  2DRB A;  2B7C B;  2D3U A;  1RTJ B;  2L3M A;  4LR8 A;  4ZIW A;  3BPS P;  1FX2 A;  3CJK A;  2NXC A;  3L09 A;  1C1B A;  1GQE A;  4NAS A;  5CCL A;  5KFV A;  3J81 U;  2DR9 A;  2KVI A;  3GSI A;  2DHS A;  3M8Q A;  4CH7 A;  4EEY A;  4BWJ A;  4DV2 F;  3LGN A;  1CEZ A;  2V94 A;  4AQY F;  1DZ5 A;  4LF7 F;  2AYM A;  2J6S A;  4NWB A;  5ETK A;  2ZZM A;  3KXD A;  3DXB A;  1F9E B;  3CDA A;  2R2R A;  1M1G A;  2DNP A;  3PY8 A;  4DF8 A;  2EG1 A;  2G0C A;  5BYS A;  2FB0 A;  2BM1 A;  3CGI A;  2W8L A;  2DPJ A;  2UU9 J;  4JI6 J;  4EO8 A;  2ASL A;  2G4B A;  4J9K A;  2EC0 A;  3GP9 A;  4OI4 A;  2DPI A;  4C0B A;  3T6J A;  1JWW A;  2GQ2 A;  1YQH A;  4C4W A;  3M30 A;  3MFH A;  4NLR A;  4F3O A;  4I67 A;  3D68 A;  3MMB A;  5LSR A;  2Q66 A;  2XY5 A;  2LEB A;  2JEI A;  4YS2 A;  2C22 A;  5DQG A;  3KHH A;  1M5P C;  5GAH U;  2DVI A;  4LF5 F;  3N9U C;  4LUB A;  3A13 A;  4CLS A;  2VU5 A;  2ZC4 A;  1X60 A;  3TA1 A;  1X4C A;  2V5H G;  1REV A;  3AD9 C;  3K0J A;  4P2S A;  2GO9 A;  3UDL A;  3U7J A;  3RB6 A;  5ETM A;  4PXC A;  1FDB A;  2R7W A;  2OPR B;  3BQ2 A;  1HNV B;  4XTT A;  3SDE B;  1FRM A;  3G4S S;  2UUW A;  3C66 A;  3A8J A;  3QAT A;  4NXM J;  3HSZ A;  4P73 A;  3KLG A;  4DV6 F;  5F8J A;  3HCX A;  2HFS A;  1OMS A;  2C3P A;  4C2M A;  5F8G A;  3MPV A;  2YBV A;  1G7C B;  2HRU A;  1N36 F;  2RDI A;  4OYB A;  5IM0 B;  5K20 B;  5KFC A;  1FVS A;  2KFZ A;  1WOP A;  5E3P A;  1H7W A;  3MDF A;  3BSO A;  4EGL A;  2ZOF A;  1RXO B;  3B8H A;  5B0D A;  5KFK A;  1H38 A;  4B08 A;  5F8M A;  2E7X A;  4Q0B B;  1BWV A;  4F2S A;  1R8H A;  2YNH A;  4ZPV R;  2B4O A;  2N7Y A;  4WP8 A;  1RAO A;  5AE1 A;  1P1L A;  1JB0 C;  3T9Z A;  3PAC A;  3PYE A;  5HMY A;  1EET B;  2RQC A;  3MHY A;  1VQ7 S;  4ZVF A;  1SKW A;  4C3L A;  1RWN B;  2IJF A;  4PEO A;  5CZV A;  4CH0 S;  2GQQ A;  3AY0 A;  1HBU B;  3ET6 A;  2UUA J;  4CYU A;  3IR7 B;  2MZT A;  1T9U A;  2VFV A;  2Z58 B;  2EXU A;  3ISZ A;  4QWB A;  3W61 A;  4A8M P;  2BJ9 A;  2PMW A;  2QLX A;  2C28 A;  4CLK A;  3W65 A;  3BGR B;  3GJQ B;  1UJ4 A;  2ZZT A;  1IR0 A;  4C8Y A;  3OVB A;  2ALY B;  2V8G A;  2HHT A;  1C0U B;  5IC4 B;  4C0O C;  1BXN A;  2YKN B;  1HHS A;  4J9S A;  1UVJ A;  2B8P A;  4P52 A;  5AXN A;  3TUP A;  3JTO A;  4ANE A;  4N5S A;  4B9M A;  2X1F A;  5IT9 Y;  1IUJ A;  3T1A A;  4DV4 J;  4PWU A;  1NSQ A;  1EAY C;  3V5R A;  1A9N B;  1HWJ A;  4OV6 A;  5KFR A;  4GRS A;  3Q2S C;  3ISN D;  4LT6 A;  3MCN A;  1NM2 A;  2CZ4 A;  1QAX A;  4DR4 J;  2JVR A;  3JS9 A;  1V5I B;  2VBZ A;  2I5J A;  2M8H A;  2IRU A;  3I32 A;  4RJV A;  3VAG A;  5HBM A;  2HVE A;  2DK2 A;  1Y5N B;  2QG9 B;  2JLE A;  4FP9 A;  2YKM A;  2W9C A;  3IRW P;  3J81 Y;  1KLN A;  5E7O B;  3HI9 A;  1HW8 A;  2YKA A;  2G9O A;  2WON B;  3IO1 A;  4Y00 A;  1U1O A;  2OML A;  2XLK A;  2R7R A;  4ECR A;  3NEK A;  4MKY A;  1EQM A;  1TV6 A;  3Q8Q B;  2ZM6 J;  2BE9 B;  3KLH A;  2UVU A;  1SH2 A;  3KYL A;  2KYX A;  3R5D A;  4B3M J;  4QBU A;  3IS9 A;  3J81 j;  3ILI A;  4EBD A;  3IRX A;  3PZP A;  4OI6 A;  2KDO A;  4H4K C;  3IAS 9;  2L41 A;  1S0O A;  1J5O A;  3FEZ A;  3SZ2 A;  2HEK A;  1KLM A;  1JLG B;  1JLQ A;  3KDN A;  2VUG A;  3IWN C;  2MZS A;  1MG7 A;  2IVY A;  2VG6 B;  3NGK A;  3O5T B;  2QFJ A;  1T05 A;  4JV1 A;  1SC1 B;  1TL7 B;  1XTZ A;  4EZ6 A;  1HQU B;  4RU2 A;  3KG1 A;  1DUR A;  2PDA A;  4DR1 F;  1QTN B;  2A6M A;  4KKO B;  2ADB A;  1B0V A;  3TP2 A;  1M5H A;  3RBZ A;  4N56 A;  3MEG A;  2XS2 A;  2G0I A;  3TX0 A;  3JSM B;  1RT3 A;  3R3T A;  3A3P B;  3D5M A;  3DRY A;  5KT3 A;  4YR0 A;  1TKT B;  1IXK A;  3UN2 A;  1WF2 A;  1JLC B;  1KWM A;  5DDQ C;  4ZPW R;  4Q44 A;  4W98 A;  3D9B A;  2B3T B;  2DKO B;  3AB4 B;  5J2Q B;  2YQ3 A;  1FES A;  2C3M A;  4G3I A;  1VJQ A;  1BUX A;  2WOM B;  3LUY A;  1WOO A;  1Q86 T;  4EU0 A;  1QSS A;  1HPZ A;  1X0P A;  2RS2 A;  1PSD A;  4LFC J;  1J5E J;  2B6A B;  2WBM A;  4P71 A;  3V4I B;  1CQN A;  5L1J A;  1M5K C;  2G2Z A;  2YNF A;  3DDI A;  4EUV A;  1ZET A;  2HVH A;  2PT0 A;  3J7Y I;  4C8O A;  3VZI A;  1GK8 A;  3H90 A;  4TXS A;  3D7S B;  4PR6 A;  1SJF A;  2BMB A;  5ITH A;  3HHK A;  2D3O 1;  3GIL A;  2OD4 A;  2V9K A;  1TL3 A;  1BQM B;  1DBD A;  2NUH A;  4HVZ A;  3M6V A;  8RUC A;  1RAH B;  3OSN A;  1REG X;  3PR5 B;  4AL7 A;  2WSF C;  4ID5 A;  3W8G A;  3CO9 A;  3OL6 A;  2XO7 A;  3JYT A;  2CJY B;  1R8A A;  4WZQ A;  3L7P A;  1UVM A;  2E5G A;  2FZG B;  1LWC A;  2H4Y B;  2L08 A;  2XMT A;  1H73 A;  4AUK A;  1YZ6 A;  3MPW A;  2DGO A;  2PFD A;  2XSJ A;  2IYI A;  3TO8 A;  4DV3 F;  3MR3 A;  3NAH A;  1V3R A;  4ICL A;  4IFV A;  4PQU A;  2NXU A;  4BWM A;  3F41 A;  1KOH A;  4YUD A;  5MAO A;  3K89 A;  1M0S A;  3MAA B;  4ZJL A;  1U8S A;  3EZU A;  3CD6 S;  1DTT B;  4EBE A;  2BAN B;  1LXJ A;  1Q8K A;  2M9K A;  2GHW A;  4ZVS B;  4WFX A;  1D8Y A;  4Q2M A;  4ILR A;  2FHJ A;  4ZCL A;  1NAQ A;  1LNQ A;  3ADA C;  3M8R A;  2GV1 A;  3BO3 A;  1HAR A;  1ACM B;  4X4R A;  3HM9 A;  5D0G A;  1O0P A;  2I2Y A;  2IM1 A;  3OR2 B;  2ZH1 A;  4ECX A;  2XS5 A;  4TQS A;  5KTQ A;  3TJ9 A;  3IBW A;  4ZPD A;  4CI0 B;  2W9A A;  2HND B;  3O1L A;  3VWS A;  4ZLL A;  4C8M A;  2VFS A;  3R7B B;  1RA7 A;  4UOG A;  3N28 A;  4QWC A;  1URN A;  1S1X A;  4XO0 A;  4F4Z A;  1JXV A;  2CPE A;  3MMC B;  1YZ7 A;  4BLG A;  2BBE A;  5C42 A;  3GV5 B;  1N52 B;  2EKY A;  2I1R A;  4NCB A;  2VA3 A;  2LU1 A;  5E33 A;  3K2Y A;  3ZC4 A;  5LXR A;  2W8K A;  3CCJ S;  2IBK A;  2HK3 A;  1VQY A;  4J9P A;  2UUC J;  1KR4 A;  2AZ3 A;  3AD7 C;  3IXQ A;  1ZH5 A;  2FDN A;  2VL1 A;  2DR8 A;  2ZWP A;  4K59 A;  8ATC B;  3IR6 B;  1KQK A;  4A4J A;  2QLW A;  1WKL A;  3QJJ A;  4DV2 J;  3UCZ P;  5IS2 A;  3K57 A;  1Q53 A;  1CS4 B;  4FS1 A;  4IRC A;  4P2M A;  1RQ0 A;  2CIM A;  2Y1I A;  4NRT A;  1C0U A;  2AYB A;  2BV3 A;  4LFA F;  3D2W A;  2E44 A;  1I94 J;  2VPW B;  1N4L A;  1FD8 A;  2OFH X;  1NJW A;  3T41 A;  4HHJ A;  4LQ9 A;  4Y3C A;  3R2D J;  1RU2 A;  3RTV A;  2HVD A;  4DSL A;  3DMJ B;  1W2B R;  4ZDN A;  4F4K A;  3PIO Q;  2DR7 A;  3BO2 A;  2BRK A;  3SBM A;  3C6T B;  1D9D A;  3VCD A;  5GMK a;  2MLY A;  4MKV A;  5SZT A;  1U25 A;  2F65 A;  3QWU A;  3BKU A;  4WPA A;  5CZX A;  4K4V A;  1MW7 A;  2WSC C;  5JUM A;  2YQ1 A;  2HNZ A;  1W25 A;  5HP1 B;  3DRR B;  1RBL A;  3SSR A;  2H5E A;  1EZZ B;  4GO5 X;  5CYQ B;  1CJT A;  1YRU A;  2BYC A;  3X1L B;  3MPU B;  3WBZ A;  2LA6 A;  1RT4 B;  2RIL A;  4QIG A;  3UN5 A;  1JLB B;  5C25 A;  4UZB A;  2MST A;  1TEL A;  3N79 A;  4DN0 A;  5IM0 A;  5HL7 Q;  2B5J A;  2J5A A;  5IV3 A;  5DDO C;  4I7F A;  3PO4 A;  2LEA A;  2HBR B;  2MTL A;  4HTI A;  2YX1 A;  4A46 A;  2ZM6 F;  2F8M A;  1F5A A;  3DLK A;  2OI2 A;  2QA2 A;  1ZAV A;  4R25 A;  3MM9 B;  2R9L A;  3HFV A;  3UR0 A;  2V67 A;  5EWE A;  1TVR B;  2Y0B B;  4FN5 A;  1BY9 A;  1N5T A;  1LFP A;  3K8V A;  4I6A A;  3SV3 A;  5J2P A;  1SXL A;  3GTY X;  1AB8 A;  3R5A A;  4ZPB A;  4PYA A;  1GXT A;  2RH3 A;  2V6A A;  1T8E A;  3H5U A;  3DRX A;  3LAL A;  3GYX B;  2EI5 A;  3QGH A;  1TKX A;  4UQT A;  3ZZO A;  5IT4 A;  1YJT A;  2HWT A;  3OFH A;  2YKP A;  4KPY A;  4XIU A;  3AOD A;  4NLO A;  2G2O A;  1UTA A;  5KFX A;  3TAP A;  2AYE A;  1HBN B;  2BJ8 A;  2J9E A;  3PW2 A;  1XC9 A;  3ETM A;  3KLE B;  2ASD A;  3H2U B;  2J0Q D;  1N88 A;  2N4C A;  4CIO A;  1F5C A;  2ROE A;  4I64 A;  4CDI A;  2FLN A;  1NDP A;  4QIV A;  5JXS A;  1FJG F;  1E6Y B;  4NLV A;  2HAF A;  4YEA A;  4X64 F;  4ED3 A;  5F8N A;  1JLC A;  4R5P B;  2B0G A;  3CD0 A;  2HNY A;  3OT9 A;  2KG0 A;  1FFW B;  5C24 A;  3EM1 A;  2UXB F;  3HHL A;  2OIH A;  4HL9 A;  1EKR A;  1NDC A;  1SBR A;  2IC3 B;  2YNG B;  1NUE A;  4DR3 J;  4ECQ A;  2YTC A;  1VFJ A;  2EFP A;  3T5L A;  4P6Q A;  4QCL A;  3FRY A;  5KG2 A;  1MNE A;  2NLW A;  4LF8 F;  5HN0 A;  3EMT A;  3PR4 A;  2GMJ A;  2Y0S D;  2CVI A;  3DYA A;  3SFU A;  3M9M B;  2R8H A;  3VAI A;  4CLT A;  4DL6 A;  1RYS A;  4FYX B;  4M5N A;  1XMO F;  1T9Y A;  3W63 A;  2RJZ A;  3QIP B;  4F4A A;  5D0H A;  2C2E A;  1B3T A;  1MSW D;  2WRM A;  2V8H A;  2NCK L;  1IM4 A;  4R0E A;  4C8L A;  2N7C A;  2EK1 A;  4ES2 A;  1NEE A;  2P6T A;  4WJB A;  4O44 A;  1T9X A;  2E1A A;  2CPI A;  2HG4 A;  4DSJ A;  2ATC B;  2Z2Z A;  2XMJ A;  4KFB B;  4ZN3 A;  4DL7 A;  1U1N A;  5FJ4 A;  1V6H A;  4JI2 F;  4MIW A;  3GCX P;  4ZMM A;  2KZZ A;  1RWW B;  1RAB B;  2DY9 A;  2KXN B;  2HBY B;  1K1Q A;  2YWW A;  4M8L A;  2RDJ A;  1ITP A;  1RT7 B;  2ZH2 A;  2C2M B;  5H1S V;  4USW A;  3UD4 P;  1RTI B;  2AWZ A;  2J7K A;  1OSD A;  3ICL A;  3GFZ A;  4DQI A;  3D1H A;  3TX8 A;  3SV4 A;  1NDL A;  3NAI A;  1AXQ A;  1HBM B;  2JHE A;  3BH7 B;  4UUW A;  2MQP A;  3I4H X;  1N56 A;  4WF9 Q;  5L38 A;  1H2U X;  1AUS L;  2LQ5 A;  4UT4 A;  1SH3 A;  2LVW A;  4EMD A;  1N5V A;  3FNN A;  1UEV A;  2QC3 A;  3FEX B;  1FRL A;  3P4U B;  3I5B A;  2PSZ A;  1UJ5 A;  3PX6 A;  3CJ0 A;  4DUZ J;  1OPI A;  4R5P A;  2BJ3 A;  1WAC A;  1WI8 A;  2OTL S;  2C1E B;  2XMW A;  2RUG A;  1VQ6 S;  4OLP A;  1NJZ A;  2QMU B;  3KUH A;  2FJX A;  4RBU A;  1SKS A;  2BXJ A;  1PIE A;  1YJW S;  1UL3 A;  1UEK A;  1XMQ J;  2H9Z A;  4B3O A;  2MZJ A;  1HBU A;  3D28 A;  3ELH A;  1FNX H;  2B51 A;  3MMA B;  1AYE A;  3UVJ A;  4X84 A;  4OZ2 A;  3ZTR A;  1H74 A;  1X4E A;  2HRY A;  2XC9 A;  3BQ1 A;  5AE3 A;  2VOO A;  3A3O B;  4X4V A;  1EJ7 L;  2F8E X;  3B6B A;  3TWZ A;  2BKO A;  1VHI A;  4N77 A;  4NYZ A;  5A8R B;  1H7X A;  1D09 B;  2MJN A;  1FFS B;  3I0R B;  3ZZY A;  3IBC B;  4WE1 B;  3RAX A;  1S72 S;  3M7V A;  4CLZ A;  4OZ0 A;  4ZPT R;  1S6P B;  2OLW A;  2BDP A;  2HIY A;  5HRO A;  3JTN A;  3TVY A;  4DR2 J;  3W9H A;  2ZIT A;  1JLF B;  2O3D A;  4YY3 F;  2M70 A;  1U26 A;  7FDR A;  1RWV B;  3RB3 A;  2AJ0 A;  3ZZP A;  4DZD A;  1XWL A;  3RG6 A;  1H2T Z;  2Q79 A;  3VHQ A;  4XK8 C;  5CYM A;  1UPM B;  3E2E A;  2CPD A;  4OFZ A;  2DGU A;  5IOL A;  4LRB A;  1B7Y B;  2AP6 A;  2GVD B;  2M3D A;  1X8D A;  5A8K A;  1NPK A;  3MCM A;  1RHM B;  3MM6 B;  2M2B A;  2R8J A;  5U47 A;  3PYG A;  1U8W A;  1MRO B;  4HH1 A;  4OX8 A;  3BN7 A;  5KT2 A;  3MPD A;  2DTJ A;  4H4M B;  3SCI E;  1IBK J;  5IQ6 A;  3OXF A;  3CCE S;  2E5J A;  3BZQ A;  3JAM Y;  3RBX A;  3GII A;  1F1B B;  4KC5 A;  3KLF B;  3M2U A;  2N3O A;  2B9Y A;  3EXY A;  4KY3 A;  3HVW A;  5EX3 A;  5IT0 A;  2NXE A;  5HLF A;  2PI5 A;  4QR2 A;  1LK7 A;  4I2P B;  2KH9 A;  4IR9 A;  3S6E A;  3JSM A;  3I87 A;  5KT7 A;  2W4C A;  4MMO A;  2HND A;  3VZH A;  2BE2 B;  1NHU A;  2GFF A;  3EPG A;  2IM0 A;  3L7U A;  1FE0 A;  3LH2 S;  5DO2 A;  1F9F A;  1HL6 A;  4WTO B;  1HQU A;  2RVJ A;  3R1L A;  2OEM A;  1CJU A;  1FRI A;  2NZ4 A;  1VQ9 S;  2UUA F;  4QR1 A;  2DT9 A;  4USH A;  4ZLN A;  1NKE A;  3HVA A;  2DXE A;  3M2R A;  4IH7 A;  2LMI A;  1NK4 A;  4CT9 A;  4B02 A;  3HVT A;  4QOT A;  1LV5 A;  3KOA A;  5B0E A;  4P2F A;  1YBU A;  4DF4 A;  1DHM A;  1FK9 A;  5GMD A;  3KJN B;  2BX6 A;  3VTI A;  2V8D A;  2W2M P;  1DRZ A;  1N5Q A;  2MHN A;  3UCU P;  4HT7 A;  4RW8 A;  1F3F A;  2B56 A;  3BM7 A;  4PPD A;  5D4L A;  1LOU A;  3OQ2 A;  4CLL A;  5LJ3 Y;  5A2Q Y;  1IWA A;  2LLZ A;  3NWG A;  3CCW A;  4DL4 A;  2JH3 A;  1N33 F;  1BQN B;  2IVF B;  1E6Y A;  1D8Z A;  1GEH A;  1HD0 A;  3TAR A;  2R8G A;  3BR9 A;  3HSG A;  3U02 A;  3G6E S;  2O66 A;  4KHR A;  2HGM A;  3ZO7 A;  3DGP B;  4C8Z A;  4AFF A;  3BRE A;  4HT5 A;  3K58 A;  1HNZ F;  4OYA A;  4JI7 F;  3NNA A;  4OQJ A;  4DR7 F;  3TOQ A;  4C98 A;  1S9F A;  2ZJQ Q;  3KLG B;  4N8O A;  4IG3 B;  2Q6C A;  2ZNZ A;  2R7X A;  4TYA A;  1AZS A;  2GIR A;  5CAA A;  5DM7 Q;  3G71 S;  1YJ9 S;  2IDE A;  1Y3K A;  5J2Q A;  2MZQ A;  4W90 B;  4DR1 J;  1VRT A;  4FYW B;  1HQ2 A;  2ZHA A;  4A8W A;  3BDP A;  2AX1 A;  4OV1 A;  4OHZ A;  4OX9 J;  3BGF A;  1HI0 P;  1SKU B;  3FFI B;  2NRE A;  3CJS A;  1IBM F;  2X7I A;  4K4U A;  4XDD A;  4E0D A;  4WXW A;  1Q8L A;  1LWE A;  3RAQ A;  4O44 B;  2FHO B;  3TAN A;  2MB0 B;  2JLF A;  3NGT A;  4A8Y A;  1EET A;  1U2R A;  4ZA1 A;  2WB1 D;  2VB6 A;  1KBR A;  3QWP A;  3R5J B;  2WVB A;  4NOH A;  1PG5 B;  3TVZ A;  3IC1 A;  1LQ9 A;  3LQV A;  3PDN A;  1ZOT A;  3MAQ A;  1Q82 T;  1VQL S;  1P6T A;  2CPH A;  3CMA S;  4KB7 A;  3AJ2 A;  2KVQ E;  3LWM A;  1NCL A;  4RW9 B;  1NKB A;  1U0H B;  1VLY A;  1VOM A;  1X7V A;  1NPR A;  1N6Q A;  2E5L F;  1VYA A;  1WDT A;  1FRJ A;  2X3G A;  1HFE L;  4OI3 A;  3V81 A;  3P6Y C;  2R7V A;  4LFB F;  1KKH A;  4U9R A;  3OVS A;  4MKB A;  2JRS A;  3QT7 A;  4A8Q A;  2F4V F;  1UZD A;  4PG4 A;  4ZPC A;  2JZ5 A;  4RBT A;  1MU2 B;  1QE1 A;  4IH6 A;  3VAF A;  3N6M A;  7FD1 A;  1WHV A;  2W4D A;  1M5V C;  4L73 A;  4U96 A;  3MMJ A;  4MTP A;  3OHB A;  1S5Z A;  1RTI A;  3Q89 A;  5IV4 A;  2GAH C;  1U48 A;  4I2Q A;  4QJV A;  4CNZ A;  3AD8 C;  2QMW A;  2KN4 A;  3AT1 B;  4NEY A;  2VQF F;  3MTK A;  1JX4 A;  4YN3 B;  5HO4 A;  2RNE A;  1NK0 A;  2B4V A;  2DH9 A;  1KFS A;  1DTQ A;  2IM3 A;  2MJU A;  3LP0 A;  4DR3 F;  4OX7 A;  3A3N B;  3CCU S;  2D9O A;  2HVZ A;  4YR2 A;  4TU9 A;  4DFM A;  1NK5 A;  4K2J A;  2OTJ S;  1R6Y A;  1WG5 A;  2ILY A;  1TKX B;  2RSQ A;  3CSK A;  3L95 X;  3M8Y A;  4N8N A;  4OMF G;  3MUM P;  3BJY A;  3TQ1 A;  2UUB J;  9RUB A;  3WQP A;  5HAO A;  3POT B;  4OZ1 A;  1PJ6 A;  3ZTP A;  4IFY B;  2HIQ A;  4TY8 A;  2MQL A;  4R8U B;  1TUW A;  5L39 A;  1JLF A;  2FZC B;  2Z56 B;  1MU2 A;  2LCW A;  1Y9O A;  2KT2 A;  3HT0 A;  3G2X A;  3KTQ A;  1S79 A;  3W64 A;  3VAH A;  4JI0 J;  4ERD A;  5KOX A;  2CG8 A;  4IR1 A;  4IOC Q;  2W24 A;  3RB0 A;  1WSV A;  4EFA C;  5K5M A;  1HWL A;  4RKU C;  2DJW A;  1HHT P;  1F60 B;  2MQO A;  4ED0 A;  4DEZ A;  3KMS A;  2VQF J;  2HUR A;  3H20 A;  3GIM A;  3N5B A;  4KQZ A;  2AMC B;  2ZBQ A;  3O44 A;  4KSE B;  4YQW A;  2FVC A;  2MHE A;  1RAF B;  1CJK A;  1HHQ A;  2GVZ A;  2FLP A;  1KQS R;  2DYA A;  3FMB A;  3DOL A;  4NCG B;  3UNY A;  2AEF A;  5I42 B;  1SC3 B;  2DD8 S;  4X4T A;  1NND A;  3K5N A;  1NK9 A;  4CCH A;  1T11 A;  3DRP B;  2PII A;  3NXZ A;  3HHD A;  3LAK A;  2OP5 A;  2YH0 A;  4LVO P;  4PG8 A;  3J80 Y;  4QWD A;  4DFJ A;  5C2C A;  2HHV A;  4ID5 B;  3H40 A;  4TNO A;  5K14 A;  1UKU A;  2OJ3 A;  4WZM A;  4PUO A;  1UET A;  2BW7 A;  3JQJ A;  1RT2 B;  4FKY A;  4DR4 F;  2ZWO A;  4F3Q A;  2ZBC A;  2AV5 A;  2AIR B;  2DO0 A;  2IBO A;  5DGB A;  1SPB P;  3ZZR A;  2XZD B;  5B08 A;  2YWE A;  4KGZ B;  1NLK L;  1VHF A;  3DI6 B;  1T03 A;  1IBM J;  2HHQ A;  1IKW A;  4PAB A;  1PC5 A;  1UWB A;  1ZM9 A;  1L3K A;  3NBP A;  3D1Q A;  3D1O A;  4I6Y A;  2BJE A;  2UP1 A;  1IN0 A;  1RWK B;  1UFW A;  1VIO A;  1X5S A;  1VRU B;  2P9E A;  3MMB B;  1U1L A;  1VBX A;  4NCG A;  1RIS A;  5AXL A;  3CC7 S;  2F9D A;  1DQ8 A;  4RWW A;  2KRB A;  2AKW B;  5G4D A;  2JEJ A;  1B4S A;  4LF7 J;  4O23 A;  1MLA A;  1PAE X;  4LFA J;  2MZR A;  1UW4 A;  5DQI A;  1PGZ A;  2M4M A;  4LFC F;  5KFD A;  1SCJ B;  1S1X B;  3P5B P;  2DHH A;  2FGC A;  3UDE A;  1UFL A;  4P9S A;  1LW2 A;  1RDR A;  1SH0 A;  2GIQ A;  2VPX B;  3HZG A;  4BCA A;  4DX7 A;  3NGD A;  4CNY A;  2J7U A;  2OPQ A;  2VBW A;  5DGA A;  3RJM B;  3SDE A;  3GCW P;  3Q8Y A;  2HZC A;  2UXD F;  1APS A;  5B0F A;  2GO8 A;  4USU A;  3RW6 A;  3DLE A;  2VQE F;  2R7S A;  4LF6 F;  1FF2 A;  2H5I B;  2CWK A;  2PA3 A;  3OXG A;  4Z7Y A;  3AOC A;  3F73 A;  4C11 B;  4OYO A;  4UTG A;  5IWA F;  1TMJ A;  4USK A;  1FA0 A;  3GSD A;  2RIJ A;  2QLF B;  4CM0 A;  3C2P A;  4KHM A;  4DV5 F;  4GC6 A;  4ED8 A;  4UOC A;  1PJ5 A;  2AJ4 A;  2YWF A;  1UA0 A;  1MWZ A;  3NCR A;  4HLB A;  2LDY A;  4ZP8 A;  3LP2 B;  3VGT A;  3TYT A;  4RW4 B;  5LXY A;  2CJ9 A;  3M4X A;  2D7S A;  4HDH A;  4P72 A;  3G87 A;  5EDW A;  2VIC A;  1URR A;  4C7Q A;  2BQR A;  2HBZ B;  5FD1 A;  4B9V A;  5LMU F;  1HWI A;  4LVN P;  2GC8 A;  4KYZ A;  4K7Q A;  4WYL A;  4G1P A;  4ZJQ A;  3OFF A;  5CHC B;  3GIK A;  4HI2 A;  1NHV A;  1RCO B;  1XJW B;  1FJC A;  1QUV A;  4F0M A;  3ZZT A;  4P7T A;  1M5O C;  2GA7 A;  2LP4 A;  1OY8 A;  1HBO A;  2FGO A;  3D67 A;  4XDC A;  2MXY A;  4KH1 B;  3O8W A;  4NI2 A;  4IUF A;  1U6F A;  4F50 A;  2MQM A;  4IG0 A;  4ZP9 A;  3PRB A;  1SQF A;  5GAE I;  2RE1 A;  2BUN A;  2H65 B;  5CH7 B;  2Z57 B;  2DY1 A;  4E8U A;  1YIT S;  4ZVP B;  3MEE B;  2AJQ A;  5CA5 A;  4F26 A;  2KYZ A;  5BR8 J;  3KK3 B;  3VVT A;  3DRS B;  1EP4 A;  4Y2C A;  4C48 A;  3KHL A;  3PV8 A;  4QQB A;  2DNL A;  5L9X A;  4B3S F;  2JVO A;  2NXJ A;  4YDD B;  3LPY A;  2I8E A;  3C3L A;  2KFY A;  1DTT A;  1RTH B;  2AEM A;  4MK9 A;  4HEA 9;  4ZS6 A;  1R8P A;  1QVF R;  1QAJ A;  4J9N A;  3OW2 R;  2ZJR Q;  3H4D A;  4DG1 A;  1CG2 A;  1S99 A;  3GG0 A;  4ZCM A;  2N3L A;  5HQ8 A;  3MEG B;  3WIU A;  2H1Y A;  4DS4 A;  2LDI A;  1S7I A;  4ECZ A;  1P1T A;  4WCE Q;  2FHM A;  2GNK A;  3CJ5 A;  1Q8I A;  4LF1 A;  1CJV A;  1JK9 B;  3W2W A;  3PW0 A;  3NNH A;  3FBC A;  3RRK A;  4Q8F A;  3JYT B;  4M5L A;  1JLA B;  1SQG A;  3BSA A;  1NSA A;  4G1Q B;  3DMJ A;  3TZZ A;  4B9U A;  3D0H E;  1IKY A;  2VC0 A;  3G82 B;  4U6P A;  2G1H A;  2J8A A;  3W5X A;  2EK6 A;  4IFY A;  2Z2Y B;  3OLB A;  2CQ1 A;  2NPI A;  3IRX B;  1IKV A;  1HNI B;  1QJH A;  3ILJ A;  3W2V A;  5HQM A;  4XPE A;  3J7Z 5;  1GTE A;  2APO A;  1Q79 A;  2E29 A;  1YBA A;  3VF0 B;  1KNZ A;  3TJ8 A;  2B6A A;  3V4I A;  3D0G E;  3IWX A;  3PJX A;  3QYY A;  4NEZ A;  5FLX U;  4A48 A;  1X31 C;  4ED7 A;  1KOO A;  2JFK A;  3CJQ A;  1HNV A;  4UOH A;  3NMR A;  5D4P A;  4LFB J;  1TQL A;  5D8H B;  1S7H A;  5EWF A;  1SC4 B;  1V3S A;  2YKM B;  1JIH A;  4KBI A;  4NLS A;  2GQC A;  4NLU A;  1X5O A;  2IAJ B;  3M1V A;  1OIA A;  2POK A;  1TUV A;  2AZ1 A;  4URQ U;  5D15 A;  3QT6 A;  1C4A A;  4KGX B;  2F40 A;  2HPU A;  3HHL C;  2WZ1 A;  4KFB A;  3CPW R;  5HVF A;  2BEF A;  2FQQ B;  3HLU A;  3M30 B;  5CYM B;  5E0O A;  3MR6 A;  1D1U A;  4DSK A;  4DBQ A;  1UEU A;  2PMH A;  1G2E A;  1FRK A;  2CZ9 A;  4OYX A;  1FNM A;  5DLF A;  4ZVH A;  4BC7 A;  1OJ4 A;  4X66 F;  1RBA A;  1HWU A;  1BE4 A;  4RNF A;  1JLE B;  2VFT A;  2G1D A;  2W01 A;  2DXD A;  2XMU A;  2A0F B;  3MAH A;  1CJU B;  1VRQ C;  2F7V A;  2C3Y A;  3M32 A;  3THT A;  3W5Z A;  3M8S A;  4CZC A;  4ELT A;  4KHP J;  3TUJ C;  4JI3 J;  4GKK J;  2RF2 B;  2V4R A;  5A8W B;  1R43 A;  3OTO J;  1FHT A;  1SB6 A;  4FPR A;  2HAI A;  1RTZ A;  1XR5 A;  2U2F A;  4FYY B;  5KFQ A;  1C1B B;  1TMM A;  4ELV A;  1X4F A;  1YBT A;  2MMY A;  3GZ7 A;  3GR0 A;  3NOG A;  1Q5V A;  5IQQ A;  4AYB D;  1Y5L B;  2QEX S;  1J5E F;  3J7Z T;  2UV8 A;  4K4W A;  4ZVR B;  2LQ9 A;  3M8P A;  1R31 A;  1Y11 A;  2HHX A;  4PG7 A;  1VRT B;  1S57 A;  4DU8 A;  5B09 A;  5CCM A;  4ED6 A;  1RKI A;  1WKJ A;  1LWF A;  3I9V 9;  4DN9 A;  4ECU A;  2HZV A;  5L8R C;  1WF0 A;  1JJ4 A;  3EVW A;  4F36 A;  3TZY A;  3QNW B;  1CSJ A;  4HTJ A;  1OPZ A;  1PAU B;  2DRA A;  1T3N A;  3W9I A;  1YKW A;  2W7P A;  1RZM A;  2YNF B;  4RW6 B;  2WW4 A;  2KXF A;  3MWB A;  1GNK A;  3V4M A;  3W7B A;  3SQG A;  3OLA A;  1QVG R;  3LWL A;  1N33 J;  4CH1 A;  3TA0 A;  3CT9 A;  4BS2 A;  4RW7 B;  5T7L A;  2KL8 A;  2Z8Q A;  4JI5 J;  3I6P A;  3GQC A;  1RT5 B;  3NS5 A;  2HLT A;  2HFZ A;  4KE5 A;  2FTR A;  3VAM A;  3S01 A;  1P9Q C;  2DGS A;  4PQA A;  5G0R A;  2F3J A;  3PXG a;  3QRR A;  1KFD A;  5KG3 A;  3MCS A;  1HNW J;  1U49 A;  4CM2 A;  1IQT A;  2NZC A;  1S1T A;  4WFA Q;  4LF4 F;  3EDR B;  3HHN B;  4EYI B;  1DLO A;  3NS7 B;  1YJN S;  3T1Y J;  4DU7 A;  3CJ8 A;  2NSC A;  5J2M A;  3PX0 A;  2BKP A;  2D9P A;  2WW8 A;  1Y7P A;  2XCA A;  4WBF A;  2HGL A;  4X65 J;  1KTQ A;  1WG1 A;  2J9C A;  1F3V A;  2BVZ A;  2B8Q A;  3C46 A;  3JSB A;  4ATN A;  5HP1 A;  2HFO A;  2QSF A;  4KRW A;  4X62 J;  3FBF A;  4N7T A;  2HQD A;  3M32 B;  4FPI A;  4C6A A;  2QA1 A;  1A6L A;  4OZ3 A;  4CLF A;  2VG5 A;  2JJ4 D;  3KG4 A;  4RNM A;  3FSX A;  2OO4 A;  2H48 B;  5KFL A;  3MR2 A;  1U6B A;  2BKN A;  2HW3 A;  4USI A;  4BHQ A;  1ZA2 B;  3GMG A;  3KK3 A;  3IN5 A;  4ID8 A;  5EX0 A;  1U7L A;  5M2R A;  1C2P A;  2RKI A;  1NK6 A;  3FCW A;  1C0T A;  5H9F J;  1HR0 J;  4B3T J;  1MMD A;  2GW8 A;  2ZJP Q;  1FDA A;  2M88 A;  1N0U A;  3EWG A;  3N6L A;  3FBB A;  5KAK A;  4DLG A;  4ECY A;  2EEY A;  3W1Y C;  4EK2 A;  3OTC A;  4ECV A;  1QSY A;  4I2P A;  4FXD A;  2OPP B;  4TY8 B;  3BYR A;  4TY9 A;  4MK8 A;  1KD1 T;  2IA0 A;  3OPK A;  4FVC A;  1RT7 A;  1GXL A;  2XBP A;  4DDF A;  4H4M A;  5KFT A;  3NNC A;  1BD6 A;  3H4B A;  4OL8 A;  5LSL A;  3KUG A;  4QPT A;  3ENQ A;  1HYS B;  2UUT A;  1WUU A;  2BOA A;  4H54 A;  1HQE A;  2QA4 G;  1SJR A;  1ZPW X;  5LOQ A;  2FC8 A;  3IG1 A;  2XHW A;  2YQ0 A;  6AT1 B;  3MUT P;  4DHV A;  5HAN A;  3PFE A;  3GR1 A;  5M2P A;  1S77 D;  1I94 F;  3CCT A;  3MM8 B;  1QUP A;  1BC6 A;  1WOS A;  2V4J A;  1RT2 A;  2JEG A;  1X4G A;  4M63 A;  1FFG B;  5I4M A;  1RUS A;  4A8X A;  3QZ8 A;  3DLK B;  4IYQ A;  3CC2 S;  5KFI A;  5KG7 A;  3FMW A;  4NZ0 A;  5LL6 d;  2MSS A;  3BB5 A;  2W7A A;  1N54 B;  3PHT A;  4J90 A;  2DR5 A;  2OEJ A;  3ET6 B;  4DUT A;  2HQI A;  4DQS A;  1XR7 A;  4IQX A;  3A8E A;  1XER A;  2RS8 A;  3QGG A;  1O51 A;  3KHR A;  2ZH9 A;  4ZHR B;  1F0X A;  4RNH A;  1LW2 B;  2M5Y A;  5B0G A;  3R7S B;  4QR0 A;  5H9E J;  2ZOM A;  3ILO A;  5F8L A;  4C8K A;  2VH7 A;  3WX8 A;  1A7G E;  4CRJ A;  1S12 A;  4LRE A;  3UPF A;  5ETV A;  1RAI B;  5KFP A;  2CFX A;  5CD4 H;  4DUZ F;  2XMM A;  3MCO A;  4B9N A;  2HHU A;  1YRX A;  1KQG B;  4KH0 B;  3J7A N;  2QMX A;  5J2N A;  3A8I A;  1RP5 A;  2HS4 A;  3L3C A;  2J8S A;  2VG7 A;  3H98 A;  2MEW A;  4Y2I A;  4ZVE A;  1R0A B;  4OZJ A;  4TYB A;  5D77 A;  3PCO B;  5EUH A;  4DPW A;  1RT1 B;  1P9Y A;  2I38 A;  2YX7 A;  1Z4U A;  2X1G A;  1BQM A;  3PHE A;  4MT1 A;  3VQT A;  4FBT A;  2OPS A;  4M95 A;  2MYF A;  2DGQ A;  2GZO A;  4J9U E;  4V19 J;  1K0T A;  1FKP B;  3DHW C;  1EX8 A;  1FKP A;  2CWX A;  5FDL A;  1QD1 A;  3SMZ A;  5F9L A;  3ENW A;  4KAI A;  4FF4 A;  1JNR B;  2D3Z A;  2K1R B;  4MJK A;  1YVF A;  1QAI A;  2VIH A;  4RW6 A;  2VDH A;  3I0S B;  3UWT A;  3W60 A;  2H3E B;  5T41 A;  5H9E K;  2K8G A;  4F4W A;  3PNI A;  4J9M A;  1NDK A;  2W25 A;  2WOM A;  3DRP A;  1TKZ A;  4NLW A;  4OX9 F;  4B9S A;  1JLB A;  1KP6 A;  4HYK A;  3T5H A;  2ALZ A;  1I3O B;  4I69 A;  4RNN A;  2HQC A;  2H54 B;  5LJ5 Y;  5DG9 A;  2D1C A;  3TNV A;  1JKH A;  2CG4 A;  2BRL A;  3IWL A;  4M5K A;  3ZTQ A;  1VQ8 S;  1FRH A;  1KVK A;  4X4O A;  3PG9 A;  2UXB J;  4A8O A;  2OEK A;  1YG0 A;  3RBE A;  2XTJ P;  3W5Y A;  5L1K A;  1S9E A;  1ZBT A;  1WHX A;  2MGZ B;  4AL5 A;  3C16 B;  1IBC B;  1TAQ A;  3CVK A;  4RO0 A;  3DU6 A;  4RBV A;  2C42 A;  1N8R T;  4NXN J;  4IO1 A;  2LQ8 A;  1RHU B;  2C2K B;  3P96 A;  1NH7 A;  3GV7 B;  2V8P A;  2JWN A;  3GWC A;  3HVT B;  4DV0 J;  1UVI A;  4NMX A;  4HAC A;  3V81 B;  3M9N B;  2QV6 A;  4LSZ B;  1CPZ A;  1Y00 A;  1BLU A;  1HI8 A;  2DNO A;  1I51 B;  1Q8B A;  2J9D A;  3GJR B;  3KLI A;  2L9W A;  2ZE2 B;  1IVZ A;  2V69 A;  2F1F A;  1RTJ A;  1K44 A;  1LEO A;  3MAA A;  2KTQ A;  2UV8 G;  2DCL A;  3GYG A;  5KG5 A;  1R89 A;  3DXS X;  2KHC A;  3GFY A;  2AW0 A;  1XN9 A;  3LO3 A;  2BM0 A;  5F0W A;  1RHK B;  2D69 A;  3TI0 A;  1HKA A;  1S4F A;  2XYP B;  4NXM F;  2WTF A;  1S1T B;  5IC6 B;  2GCF A;  3LP0 B;  4ED2 A;  2ZEJ A;  2XGQ A;  4NLP A;  3C6U B;  1HR0 F;  4RPF A;  5C2G A;  3MD3 A;  2CQ4 A;  4ZCK A;  1DAX A;  5D4N A;  2RRB A;  3TJA A;  2BQ3 A;  2KT5 A;  3N4W A;  3EXC X;  3DGV A;  2VPY B;  2B4U A;  2XZW A;  3DHX A;  3DOM A;  2QX0 A;  3K17 A;  4X62 F;  1L5U A;  4F8R A;  4OJH A;  4ZVO B;  4LF5 J;  2HVI A;  5AJ3 J;  3IAM 9;  3M9O B;  3MM9 A;  3CJT A;  3PEH A;  4K0K J;  3I82 A;  4X4N A;  1DQA A;  4X65 F;  4NYP A;  1C0T B;  1SIW B;  1WI6 A;  3TA2 A;  2HS0 A;  3MOJ B;  1RLD A;  2EFG A;  1YJU A;  4DV5 J;  1XMB A;  1SJ1 A;  1HNW F;  4NZ6 A;  2IPO B;  5C5J A;  5D3G B;  1I6J A;  3Q86 A;  4MIB A;  5ETT A;  4GC7 A;  3MM7 A;  2CPY A;  2QSW A;  2XMV A;  4TQR A;  2W2O P;  3LGH A;  4DR5 F;  4TU8 A;  4JI1 F;  2XSF A;  3A4T A;  3H2L A;  3SCK E;  4O4R A;  3WZ0 A;  3LPE A;  3QBC A;  2GX8 A;  1X9S A;  2FHK A;  1ZM2 A;  2HS3 A;  3WDO A;  4DSI A;  2P6S A;  2HBQ B;  4RZR A;  1B70 B;  2YVS A;  4RUA A;  1YHQ S;  1WSR A;  2A18 A;  3VGV A;  2CQG A;  1RAJ A;  4J9L A;  1Q95 G;  4EBC A;  2VBX A;  1UFK A;  4URS A;  4DR2 F;  1NPP A;  4M5I A;  3FQK A;  3RW7 A;  3W66 A;  4DXL A;  5G0R B;  2PGC A;  4K4X A;  1RTD A;  1JLG A;  1JLQ B;  2IMW P;  2CNN B;  4LSN A;  1VJW A;  1WKK A;  2IHR 1;  2V4J B;  3JSY A;  2MKH A;  3CCS S;  3KKF A;  3HT3 A;  1H0H B;  2HHW A;  2D74 B;  3VAJ A;  2AGO A;  3HJF A;  2HK2 A;  4UF4 A;  4GVL A;  1S9G A;  1CS4 A;  2DHX A;  1M1H A;  4UW2 A;  4Z7C A;  2CJQ A;  4IRK A;  1YRT A;  3BEG B;  1MN7 A;  2XNR A;  2M7S A;  4P75 A;  4UST A;  4DPX A;  5DS7 A;  1SJ3 P;  4ILL A;  3ILL A;  2ZH7 A;  2RU3 A;  2K3I A;  1OQ6 A;  2AGP A;  2RQ4 A;  1M90 T;  5LM7 E;  3I56 S;  3TEG A;  1JJC B;  1IWG A;  3I31 A;  4LF2 A;  1RLC L;  1VGY A;  2AU0 A;  4F4X A;  5KFB A;  3UE2 A;  5EGY A;  2ABY A;  2GHV C;  2E7V A;  2QLJ B;  3T9N A;  3LP2 A;  4KO0 A;  2EPI A;  1KQF B;  3SCJ E;  3RBD A;  3Q83 A;  2IIH A;  5ETS A;  1D0E A;  4X4P A;  3PJW A;  5K9F A;  1NB2 A;  1R3N A;  2JOQ A;  3DOK B;  1U1R A;  1UWA A;  1U2F A;  1UW9 A;  2FJE B;  4GKJ F;  2Y1R I;  1VBZ A;  1FWL A;  3HF5 A;  4O0I A;  1VQN S;  2RF2 A;  4OJG A;  5KG1 A;  1WHW A;  2F5G A;  3M2R B;  5LMN F;  1SL0 A;  2DXF A;  2BZ2 A;  2ZOG A;  2ZBP A;  4ETZ A;  4YP3 A;  4RW9 A;  2CQ0 A;  2W2Q P;  3DLE B;  4Z2X A;  4UQG A;  1IBK F;  2ZUG A;  2J7W A;  3TVK A;  2CPF A;  4WKR A;  1TP7 A;  2XQC A;  2YY3 A;  4NA2 A;  5A8R A;  1SI9 A;  2DNM A;  1AT1 B;  4ED4 A;  3W3S A;  2CNK B;  2YNG A;  3FKB A;  4CO5 A;  1GAO A;  4FZV A;  2XSJ B;  3U1N A;  1M1K T;  2QFI A;  2ASY A;  5HAT A;  3PFO A;  2C2R A;  3NGS A;  4Q5V A;  2FJW A;  2CQH A;  4K5S A;  4K50 A;  2V68 A;  3QZ7 A;  4CWB A;  1B7F A;  3DNC A;  1Z1Z A;  4N47 A;  2JSX A;  1WG4 A;  3D6M B;  4NYO A;  3LP1 B;  2WVF A;  3T5J A;  3ZZZ A;  1VIS A;  2CJA A;  3IP0 A;  1FTC A;  3S1T A;  1KN6 A;  2Q6B A;  3E01 B;  3HSJ A;  4QU6 A;  3KG0 A;  2MDA A;  3MM6 A;  4YDX A;  5I3P A;  5T7L B;  4RWX A;  4DS5 A;  4WWS A;  2BR0 A;  2GVD A;  3HO1 A;  3FZB A;  2DCU B;  4NI2 B;  4OZL A;  3SSQ A;  3GU0 A;  3VGS A;  4ALZ A;  2AJF E;  2HQG A;  2EVZ A;  2YNI A;  1BGX T;  4U8Y A;  1S59 A;  4HAC B;  4ETX A;  1FNO A;  4DSE A;  3UN3 A;  5KFN A;  3G82 A;  4P7V A;  4M94 A;  2IY5 B;  1GMW D;  3CJ3 A;  5L1L A;  2HMI A;  4CLU A;  4HKQ A;  1S1U B;  4I68 A;  5K14 B;  5E3Q A;  3OTO F;  1BQN A;  4WTY A;  4QYZ J;  5M2U A;  5KFO A;  1R27 B;  2B5J B;  2R3V A;  4DL3 A;  1VCT A;  1B64 A;  3MM8 A;  2EBE A;  3ITH A;  1U1Q A;  5J1E B;  2VOP A;  3FEY B;  2ADC A;  3N5F A;  4WYW A;  2YWK A;  2MKC A;  4ZN1 A;  2WAQ D;  3EX7 B;  5CYQ A;  3M2V B;  1SL2 A;  1RWX B;  4P2X A;  2HHH J;  1HQE B;  1W2I A;  1IR1 A;  3KK2 A;  2EC2 A;  3VAK A;  7AT1 B;  2C3O A;  1DTQ B;  2CRL A;  4ZLP A;  5H9F K;  1N0V C;  4RUB A;  4F2R A;  6FDR A;  3DM2 A;  2WVC A;  1KC8 T;  1S49 A;  2L9N A;  2ZKU A;  2W9B B;  5K8O A;  1U4B A;  1OY6 A;  1DQ9 A;  3B78 A;  2YKO A;  3GON A;  3H0P A;  3MEE A;  4PPZ A;  4QZV B;  3MR7 A;  3OSP A;  1Y10 A;  1NBE B;  2P9G A;  5A6W A;  2IRY A;  5FII A;  4FVM A;  2XLI A;  4ECW A;  2QJ3 A;  3CJK B;  5L46 A;  3Q0A A;  4DMZ A;  4OI2 A;  5C24 B;  3UFC X;  1XK8 A;  4S0M A;  3ULH A;  4IKA A;  1IBL F;  1LXN A;  3SCL E;  3BSN A;  2COL A;  5HBM B;  1ZZF A;  3NLC A;  1L3U A;  1QSL A;  2I5J B;  1XQI A;  3IG1 B;  4GMK A;  3KLV A;  3HHL D;  3JB9 k;  4DR6 J;  2QE5 A;  1FXL A;  3QT8 A;  4DPU A;  4LF6 J;  4FF1 A;  1YTY A;  2HFV A;  2KI2 A;  5KFF A;  5E41 A;  1UWB B;  2OMO A;  4ED1 A;  1BMQ B;  3C14 A;  4F0H A;  2W4P A;  1N5Y B;  3G9C A;  2E1C A;  1KTV A;  4FKX A;  2UUB F;  1S4E A;  4JI7 J;  2Z2M A;  3IM8 A;  2NR0 A;  2ZDP A;  2NUU G;  4K4T A;  5F3T A;  3ZTS A;  3EGZ A;  3NY0 A;  2WHO A;  4QPX A;  4E2F B;  2OPS B;  4LSN B;  3JAM U;  3D3C J;  4FF3 A;  2P8I A;  2QO3 A;  3A8K A;  3D3B J;  4LRD A;  5F0U A;  2ZD1 B;  2EFV A;  4CO3 A;  2E5I A;  3DYA B;  4QWE A;  3GIJ A;  3BBF A;  3SQO P;  4HDG A;  1Z2Z A;  3SXL A;  1VI7 A;  4DX5 A;  1T0T V;  3HZE A;  1NK7 A;  1B0P A;  1HI1 A;  2FYX A;  2CA9 A;  2KG1 A;  4K8R A;  3CME S;  1MMN A;  1RHJ B;  3HP6 A;  3M6W A;  1RAC B;  1EB0 A;  2XYH B;  1RI7 A;  5I3Q A;  4DV6 J;  2P5V A;  1T3O A;  1Q4R A;  4JI4 J;  2V2Q A;  4NCA A;  2ROG A;  2QIF A;  3UDC A;  3ENV A;  2FJD B;  4I4B A;  2MKJ A;  3I5C A;  2PO4 A;  3O6Q A;  2JDJ A;  2CAJ A;  4L3K A;  3W62 A;  2B43 A;  3S8S A;  3J80 U;  3JQM A;  2I9S A;  5DM6 Q;  5SUH A;  3DRS A;  5HJY A;  1U0S A;  1Q0N A;  2C2N A;  2V2K A;  3CDE A;  5EWG A;  3GFX A;  3FFI A;  3C15 B;  1SV5 A;  2DIS A;  2PEB A;  3HKZ D;  1R0C B;  3NCQ A;  2VV5 A;  4DX8 H;  4F04 B;  3KK1 B;  4MKA A;  1KDN A;  4NLD A;  1EHW A;  2ZD1 A;  3CC4 S;  4PWW A;  4AT1 B;  4OYZ A;  4GKJ J;  4M5D B;  3T19 A;  5DLG A;  4WP9 A;  3SIP B;  1SJ4 P;  1ZS6 A;  2FLL A;  4JV5 J;  1WEY A;  1YGY A;  2B4P A;  2BJ7 A;  3R27 A;  4MK7 A;  4HR2 A;  4QW8 A;  4PWD A;  1WNE A;  3NL0 A;  1VDH A;  3B82 A;  4ZVU B;  3OVA A;  1FER A;  3HX9 A;  1T9V A;  2AD9 A;  1SL1 A;  1REV B;  2W9B A;  2VJU A;  3FQL A;  2XMK A;  2R4F A;  5RUB A;  1F9H A;  1S1W B;  5GVQ A;  4DCO B;  3NMA A;  3EGN A;  3OFE A;  2VFR A;  3QO9 B;  4ANC A;  3LOU A;  3U1M A;  1U09 A;  2VJV A;  2QRR A;  1RWP B;  3R5B A;  1T02 A;  1ZAW A;  4WP3 A;  4U8V A;  5J1N A;  3CWJ A;  4CQ1 A;  1M5S A;  3FK4 A;  5DET A;  3EIC A;  1UCN A;  3M05 A;  2M0G B;  2MKY A;  3IMQ J;  2MKS A;  1FKA F;  2V2Z A;  2XGP A;  3PM9 A;  3QAU A;  3WX4 A;  5A8W A;  5KOW A;  4OJ3 A;  4U7C A;  3OJU A;  4B9T A;  4Q45 A;  4F02 A;  3L4B C;  1HD1 A;  3CDB A;  3HD1 A;  3CED A;  2BAB A;  4NX9 A;  3OJS A;  1K8A T;  4EWT A;  3E8O A;  3RGI A;  1IM6 A;  1GX6 A;  1JQG A;  2CVE A;  4OHW A;  2OD6 A;  3R7N B;  5B0B A;  3TQE A;  2E9R X;  3AB2 B;  1J5O B;  1OSC A;  1K1S A;  3POT A;  2ROP A;  3IS9 B;  3KJV B;  3CUL A;  1AFI A;  2BE2 A;  1LWF B;  4OX6 A;  2IRX A;  3UD3 P;  4EZ9 A;  1U1P A;  1QTM A;  5KFG A;  2B9X A;  2CNL B;  3V6H A;  5J1E A;  1I1G A;  3H25 A;  1T94 A;  4MYT A;  4F3M A;  1NXI A;  5CAB A;  2Y8Y A;  2CPX A;  1NZ8 A;  2HWH A;  1FTR A;  3TZW A;  4PZV A;  4DL5 A;  4J9V A;  4U95 A;  3I0S A;  2PI4 A;  3QRP A;  3EZO A;  1FJ7 A;  2HMI B;  2JL9 A;  2BJD A;  1PYS B;  1MRO A;  2GJ2 A;  3TZX A;  1ZYQ A;  5HLF B;  3Q2T C;  3DFE A;  3P45 B;  1FDD A;  2YNI B;  2UZA A;  4DLE A;  2DH7 A;  2QTW A;  4FXW A;  1VLO A;  1VQM S;  3OR1 A;  5J1P A;  5JVG Q;  4BDP A;  3LA0 A;  2ZBR A;  4JI2 J;  1RT6 B;  4Y34 A;  2RD5 C;  2MZ1 A;  4ZPA A;  2W2P P;  3ONQ A;  2QZ8 A;  4J91 A;  5KFU A;  1IKX A;  3I55 S;  1S6Q B;  3IGN A;  5HI7 A;  3R8Y A;  1TFW A;  4KJI A;  4LRC A;  1FKO B;  2XUL A;  4DCJ B;  2GVZ B;  1WEL A;  2JFD A;  4YHH J;  4Y0F A;  3I0R A;  3DRR A;  8AT1 B;  3D6H B;  4YB5 A;  1J27 A;  3DOM B;  3MI7 X;  4RW8 B;  4UUX A;  3RUB L;  1N32 J;  5D0R A;  2HQ3 A;  4AND A;  4B17 A;  5IT9 U;  3D0I E;  4CLP A;  3FSI A;  2KM8 B;  1Z2L A;  5HQL A;  4NXN F;  2DEJ A;  3EVO A;  2MLZ A;  2PN6 A;  4YB6 A;  3C14 B;  1N5Y A;  3N6N A;  1VS3 A;  4J37 A;  1TL7 A;  1Y4Z B;  3OL7 A;  4J7C A;  4KV8 A;  3LW5 C;  4B3R F;  2IYG A;  1LK5 A;  5GAE U;  1TFY A;  2AHO B;  1EP4 B;  1D3W A;  4LBH A;  5K8N A;  3W2V B;  1HIY A;  2B7B B;  1U6Z A;  3CJ4 A;  3MZI A;  1ZA1 B;  2R42 A;  2CAD A;  4IDK A;  4C8N A;  4DZ6 A;  4IG3 A;  1JJ2 R;  3DOK A;  3D4J A;  3NP5 A;  3Q24 A;  1XNQ F;  1HLW A;  5JVH Q;  4RUH A;  2AJ1 A;  4K2X A;  2HYI B;  1VBK A;  2PC6 A;  3FGV A;  4DR6 F;  2CNO B;  4OJ1 A;  4AXI A;  1RAE B;  2RRA A;  4OZN A;  1QM9 A;  4CO2 A;  1RGV A;  3R5G A;  5DG8 A;  1WJ9 A;  4JV2 A;  2DRD A;  1XBW A;  2XY6 A;  4PRF A;  1VQO S;  1SUQ B;  2KXH A;  1SUQ A;  3RU0 A;  3IM9 A;  1V3Z A;  3G6X A;  3AQO A;  3NS6 A;  3TUI C;  2J6T A;  1X4A A;  1UP1 A;  2CJK A;  3ISN C;  2XY7 A;  1JKH B;  2FJB B;  2K2P A;  4JV5 F;  2UVW A;  3THP A;  3R97 A;  3M2V A;  1S9G B;  5AJ3 F;  3CD7 A;  4K4Z A;  2CKW A;  5GAD I;  4DQR A;  4KIA A;  3IFE A;  1K73 T;  4WFZ A;  1GMW A;  1ZPV A;  4C11 A;  1NB7 A;  1RB0 A;  2FC9 A;  3BGR A;  4NA3 A;  1X0F A;  1K0V A;  1EAR A;  5KFH A;  3NCP A;  2A3J A;  2VG5 B;  3OTD A;  4LBP A;  5HRO B;  4LF9 F;  2FLO A;  3FC9 A;  3NWR A;  4UY8 T;  5E2Q A;  1QDU B;  4PWD B;  3HVR A;  1GFW B;  5DG7 A;  1FCA A;  2WK4 A;  1YLX A;  3W2W B;  4M5G A;  4UZC A;  2HGN A;  5T14 A;  4OYW A;  1N48 A;  4MFB B;  9ATC B;  1FO1 A;  3LAM A;  2LA4 A;  2VZ9 A;  4KGV B;  4LBI A;  1LWE B;  3PW5 A;  4JI4 F;  2Y9H A;  4GVB A;  1WEX A;  3F44 A;  1R0B G;  2QA4 S;  4OI1 A;  3C19 A;  3CCR S;  3CF5 Q;  5E3C A;  1OYE A;  2UXD J;  2IVM A;  5DZ6 A;  1VK8 A;  3KJF B;  2EBG A;  5A2Q U;  4DFK A;  2WB4 A;  2V8V A;  2QYC A;  4USV A;  1RSC A;  2W1B A;  3DLH A;  3H5Y A;  3AJ1 A;  3CNQ P;  5DDR C;  2HNZ B;  1KHV A;  4NRU A;  4Y6I A;  1S1V A;  4LMZ A;  2A10 A;  2E66 A;  2MLX A;  3D6F B;  2DGT A;  1A0O B;  3KLI B;  5ETQ A;  5KFA A;  3CCL S;  2LU2 A;  4X64 J;  2KRR A;  1FVQ A;  1N5S A;  1JNZ B;  2OGU A;  1CQM A;  4U7U D;  4PYD A;  2FPH X;  2IM2 A;  1WHY A;  3IR5 B;  3OFG A;  5AXK A;  4NZ7 A;  1S6U A;  1DFD A;  1XMQ F;  3T5K A;  2EFQ A;  4FXV A;  2HHS A;  4Y2K A;  1RHR B;  1R0A A;  4OZ5 A;  1S0M A;  2MQN A;  1RYR A;  2FVP A;  3CTR A;  3IA0 A;  1FD2 A;  3DLL Q;  2X1B A;  3QPI A;  4L72 B;  4M5M A;  3X3U A;  5JMN A;  5I3U A;  1XNR J;  2CPJ A;  3D6T B;  1FXD A;  1TZ0 A; 
#chains in the Genus database with same CATH homology
 2Y1L B;  1I3O B;  4DCJ B;  1RWO B;  2H54 B;  2H65 B;  3IBF B;  4ZVP B;  3D6H B;  3EDR B;  3NS7 B;  1IBC B;  1RHJ B;  2QL9 B;  2XYH B;  3KJQ B;  1RHU B;  2C2K B;  2CJY B;  1NME B;  5K20 B;  2P2C B;  1RHQ B;  2H4Y B;  2XYG B;  4LSZ B;  2CNK B;  1I51 B;  2C2O B;  3GJR B;  2H48 B;  4DCP B;  3D6M B;  4ZVS B;  1RHK B;  3R6L B;  4JB8 B;  3KJN B;  1SC3 B;  1RWN B;  2XYP B;  2CNO B;  4ZVT B;  3SIP B;  5IC6 B;  3GJT B;  4ZVU B;  3R7B B;  3GJQ B;  2CDR B;  4DCO B;  1SC4 B;  4ZVO B;  5IC4 B;  1RWW B;  1PYO B;  2XZD B;  2HBY B;  2QL5 B;  2C2Z B;  1RWP B;  2C2M B;  1ICE B;  1RE1 B;  1RWK B;  2FQQ B;  1RWX B;  3P4U B;  1QDU B;  2CJX B;  2QL7 B;  1GFW B;  2C1E B;  3R6G B;  2HBQ B;  3R7S B;  3R7N B;  3R5J B;  3RJM B;  2XZT B;  2H5J B;  3EDQ B;  3KJF B;  2H5I B;  2CNN B;  2CNL B;  1SC1 B;  4ZVR B;  3IBC B;  2QLF B;  1QTN B;  3D6F B;  1F9E B;  1RWM B;  3QNW B;  1RWV B;  1PAU B;  1BMQ B;  3P45 B;  2H4W B;  2HBR B;  2HBZ B;  1RHR B;  2DKO B;  4ZVQ B;  2Y0B B;  3GJS B;  1RHM B;  2QLJ B;  2H51 B;  2QLB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...