4ICLB

Hiv-1 reverse transcriptase with bound fragment at the incoming dntp binding site
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 114
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4iclB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iclB03
5HLFB 1QAJA 3DRRB 1IKWA 2AGPA 1S1VA 4Q0BB 2R2UA 3TAMB 3H4DA 4RW9A 3I0RA 1GX5A 4NLOA 3DI6B 3CJ5A 3DLKA 4I2QA 4K4XA 3ISND 4ED2A 4YR3A 3GIMA 3IG1A 1DLOA 3C6UB 4DG1A 3CJ4A 4URQU 4J9OA 2UUWA 4ZPCA 1IKWB 3UPFA 4HYKA 1S1VB 5J2PB 3Q8SB 4MK9A 5EDWA 2IC3B 5KG3A 1DTTA 4TXSA 2UVUA 4ZPDA 4RW9B 3PJXA 4I2QB 1XR7A 2XWYA 4FBUA 1DLOB 2OPQA 4J9PA 2B5JA 3KJVA 4WYLA 5KFOA 5KFWA 2DPJA 2IM3A 3N6LA 3FDSA 3RB4A 3I0SA 4EBEA 1HPZA 3OL9A 1DTTB 3FSIA 5KFTA 5L1KA 5CYQA 5KFPA 3GIJA 4YR0A 4ZPAA 2W8LA 1S48A 2B5JB 3KJVB 2RF2A 3FFIA 5T14A 2VG7A 3ICLA 5KFQA 2J6UA 2BANB 3I0SB 1HPZB 3KMQA 4NLUA 5KFVA 5CYQB 4F4ZA 5KFCA 1TV6A 4MK7A 5KG1A 2R8GA 3HVTA 4J9MA 1HNVA 4IR9A 4IDKA 1S97A 4MFBA 2C2EA 1RYSA 4O4GA 2RF2B 3FFIB 1N56A 2VG7B 2FVQA 3NAIA 2AU0A 3KLVA 3KMSA 2E9ZA 4KO0A 4JV0A 3IGVA 2ZKUA 1TV6B 2FVCA 2IM2A 2XI2A 3RB6A 2WONA 3CO9A 2FLLA 2UVRA 1HNVB 4RUAA 1S1WA 3EPIA 3LANA 4MFBB 2HWIA 2YNIA 1JKHA 4O44A 4O4GB 2FJWA 5KT5A 3M8QB 4KKOB 4XPCA 1KHWA 5L1JA 3NGDA 3MFIA 2YNGA 5EWEA 5HBMA 4KHMA 2WOMA 4WXOA 2XGPA 5DQIA 4ECYA 2RKIA 3RBEA 1S1WB 3OSPA 1RTHA 4K4WA 3E51A 2YNIB 1EETA 1JKHB 4O44B 1D0EA 4NLYA 4ZVGA 4RNFA 1LW0A 3GV5B 2ASLA 2BE2A 4ECVA 3KLHA 4NYZA 4EYHB 3I5AA 5DLFA 3PW5A 2JEJA 4K4SA 2YNGB 3QZ7A 3PW4A 5HBMB 4JV1A 4Q8EA 3GILA 5HROA 4TN2A 5EWGA 2RKIB 1KLMA 1LWFB 2WRMA 1JLBA 1RTHB 1TVRA 1HNIA 3ITHA 1SH3A 1EETB 2C28A 2BQUA 4ZPBA 1LW0B 2BE2B 5L9XA 3KLHB 3CVKA 2JEIA 4MIAA 4URSA 1T05A 2B43A 4EO8A 4ECZA 4IFVA 5KG5A 3CJ0A 4O4RA 2XGQA 5HROB 4ICLA 1BQNA 1KLMB 5I3UA 4TY9A 1JLBB 1JLQA 3ITHB 1RTIA 1HNIB 4NLDA 3RAQA 2HAIA 2IJNA 4ECXA 4WE1A 3H5XA 1K1QA 1T05B 3BSAA 5KFMA 4R8UA 3DLEA 4IFVB 4O3OA 3V6JA 4H54A 2ASJA 1RT4A 4F4YA 1BQNB 1TKTA 3KK2A 5F9NA 3DOKA 5I3UB 4RNHA 1IKVA 1RTIB 5KFZA 3DOLA 4TQSA 1RT6A 5J2MA 5DG9A 4ED7A 4WE1B 4RW8A 4PWDA 3IN5A 4J9SA 1HMVA 4HKQA 3C6TA 1VRUA 4IG3A 3BGRB 2JLEA 4R8UB 1RA6A 4WZQA 3DLEB 1RT1A 5FDLA 3QLHA 4IKAA 4YQWA 4LQ9A 4F4XA 1TKTB 3KK2B 1W25A 3DOKB 1LW2A 3QGHA 4TLRA 4ZVFA 2BQ3A 4K4UA 1IM4A 4WFYA 3DOLB 3MR3A 4EEYA 1RT6B 5J2MB 5DLGA 5DG7A 1S9FA 2VG5A 4RW8B 4RUCA 2I1RA 1SH2A 1HMVB 1JLFA 2ILZA 3C6TB 3TVKA 1VRUB 4IG3B 4IG0A 2F8EX 1FKOA 4Q0BA 5FDLB 1RT1B 4QWEA 3QLHB 3JYTA 4QWCA 3OLAA 4ECSA 5KT3A 1XR6A 2FJXA 4B3OB 1LW2B 3T5JA 3DDKA 3E01A 2VG5B 3PW7A 5C42A 1JLFB 5KFDA 4EBCA 3BREA 1NHUA 4IG0B 4Q43A 3DM2A 1FKOB 1RTDB 5J2PA 1SH0A 3KHLA 4JUZA 2IC3A 3H5UA 4DL4A 3JYTB 3Q8PB 2V4QA 3QIPA 2ZE2A 2V4RA 2FLPA 1TKZA 2VG6A 1KHVA 4TYBA 5KFRA 5JUMA 4WYWA 2WCXA 1ZTWA 2BRLA 3E01B 4RNNA 3H40A 3QGGA 3BSNA 1JX4A 2WK4A 2XC9A 3NKYA 1FK9A 5C42B 5KT4A 3PHEA 3LAKA 3G6YA 3DM2B 3QIDA 5KG7A 1S4FA 2R8JA 2XI3A 3QIPB 2ZE2B 3GIKA 1TKZB 2VG6B 3KLIA 4ZVEA 1GX6A 4NLXA 1K1SA 2RDIA 4MIBA 4GC6A 3PR4A 1TL1A 1FK9B 4F50A 3EPGA 4KV8A 3V6KA 5KFLA 1S0NA 2BANA 3SI8A 2EC0A 3CDWA 3HVAA 3T5KA 5C25A 3KLIB 5KFXA 4NLRA 1HYSA 4K4VA 3UDLA 1S49A 5KFGA 4M95A 1TL1B 1MU2A 1OS5A 3KK3A 4EO6A 2ATLA 1RT3A 4KV8B 2E9RX 4JV2A 3CJ2A 4DL2A 3FRZA 2O5DA 5C25B 2WHOA 4DEZA 1QUVA 1IKYA 3BQ1A 1HYSB 3UQSA 4IRKA 4ZVHA 2VA2A 3Q8QB 1JLGA 5KFIA 1MU2B 3KK3B 1RT3B 3IGNA 3MTKA 3M8QA 4KKOA 4Y2CA 4RNMA 4J9QA 5K14A 5J2QA 5L1LA 1C0TA 3DLGA 3GYNA 2V0NA 5KFJA 2CKWA 1IKYB 2IJFA 3H98A 5EWFA 4R5PA 3KHRA 4J9LA 3OL6A 1T3NA 1JLGB 4Y2AA 4QPXA 1S1UA 3HKWA 2R8KA 4LQ3A 1REVA 3KK1B 5K14B 4IOBA 4WFXA 2R8HA 5J2QB 3G6XA 1HARA 1C0TB 3DLGB 3KOAA 5KFHA 4Y3CA 1RT2A 4R5PB 2W9AA 1LWFA 5KFBA 1S1UB 3PW0A 3RAXA 4MKBA 5KT7A 1REVB 3V6HA 2HNYA 5KT6A 4IH6A 2J6SA 1ZTTA 3M9OB 1FKPA 5F8NA 4RU9A 1S6QA 4XPEA 4IH7A 4G1QB 1RT2B 3D28A 1HQUA 1C1BA 4WZMA 1UWBA 3BQ0A 2HNYB 4PUOA 3TQ1A 1FKPB 1Z4UA 1S6QB 2C2DA 3DRPA 1N5YA 2OH2A 1JLCA 1HQUB 1C1BB 3G6VA 2IBKA 1UWBB 2D41A 1WNEA 4PUOB 2E9TA 3KNAA 2C22A 1N48A 1SUQA 4KE5A 3MR6A 3MECA 4PQUB 4K4ZA 4IFYA 4RW7A 3BGRA 5I42A 1N6QA 4J9NA 3DRPB 1N5YB 4LSNA 2FVRA 4ECQA 1S9GB 4IRCA 1JLCB 3BSCA 2AWZA 3FQLA 1TQLA 3D5MA 2YNHA 2GIRA 4H4OA 5KG2A 2IA6A 1SUQB 3RB3A 3MECB 4RW4B 2AX1A 2XCPA 3LP1A 4IFYB 4RW7B 1T94A 2WTFA 5I42B 1N6QB 4I7FA 4ED8A 3NL0A 2RDJA 2IAJA 4LSNB 4NLQA 1S1TA 4DL5A 3MFHA 4B3OA 4FS1A 3T5LA 1JLEA 1U09A 2YNHB 4H4OB 1N4LA 3KHGA 3H4BA 2JC0A 1TP7A 3H5SA 1VRTA 3I5CA 4RNOA 3LP1B 2XCAA 2R8IA 4I7FB 2HNDB 1RTDA 5KG4A 4KB7A 3BJYA 2IAJB 2W7OA 2W9BA 1S1TB 2BRKA 1C1CA 1JLAA 2AX0A 3IRXA 1JLEB 1S0MA 3BQ2A 3KLGA 1S10A 1S1XA 1VRTB 1T03A 2YKMA 2ALZA 3MEDA 1QE1A 2W9BB 2AQ4A 1BQMA 2I5JA 3N6NA 4GC7A 5KT2A 4J9RA 1C1CB 1JLAB 2FVSA 2AGOA 5KFAA 3IRXB 3LAMA 3KLGB 5KFSA 1S6PA 4YMEA 4LSLA 4KSEB 4DL6A 1S1XB 1T03B 1CSJA 2YKMB 3RB0A 3M8PA 4IR1A 3MEDB 5JXSA 1LWCA 1QE1B 5CYMA 4OL8A 2YKNA 2UUTA 1BQMB 2I5JB 5KFNA 3KLEA 3V4IA 4KFBA 5F8GA 4Q44A 4QW8A 2W7PA 2BQRA 1RAJA 2GIQA 5KG0A 1S6PB 1EP4A 3HHKA 2OPPA 3QO9A 4LSLB 4U7CA 3BSOA 4URGA 3M8PB 1IKXA 3ISNC 1LWCB 5CYMB 4FS2A 2YKNB 2FLNA 4QW9A 4KAIA 3KLEB 4DL3A 3V4IB 1R0AA 4KFBB 4Q45A 3MF5A 1EP4B 4ED3A 2OPPB 3QO9B 4NLVA 4K4YA 3CIZA 2OPSA 1IKXB 2W8KA 2YNFA 2CJQA 1C0UA 1JXLA 1RT5A 3I0RB 2J6TA 1C2PA 3DLKB 1R0AB 3OL7A 5DQGA 4QWDA 3PZPA 3DYAA 3OL8A 2D3ZA 3IG1B 4DG1B 5DGAA 3QZ8A 3NBPA 3LP0A 4KBIA 2OPSB 5F9LA 3T19A 3G86A 3RBDA 1I6JA 2YNFB 3KLFA 1C0UB 3KK1A 2HWHA 4ZP8A 1RT5B 4RW6A 4G3IA 3IS9A 5C24A 2IM0A 3H2LA 4K4TA 2GC8A 2V9WA 4IRDA 3N6MA 1RDRA 4R0EA 4ED1A 3DYAB 4NLWA 2OPQB 3LP2A 3NBPB 3LP0B 5J1EA 4QWAA 2JEFA 3JSMA 3CWJA 3KLFB 2FJVA 4RW6B 5KFFA 3IS9B 3DMJA 5C24B 5DQHA 4QWBA 3DRSA 4G1QA 3FQKA 4DL7A 4X2BA 3LP2B 3M9MB 2WB4A 3HVWA 1HQEA 2HNZA 5J1EB 1RA7A 2OPRA 4FBTA 3JSMB 4O3PA 5F8HA 4ZHRA 1XR5A 3DMJB 5J2NA 3H59A 5KFEA 2AGQA 2DPIA 3DRSB 1TL3A 3OLBA 3HVTB 4WXWA 3MEEA 4IDKB 5F8MA 3PVXA 1HQEB 2HNZB 3T1AA 4NLSA 2BR0A 2OPRB 4KO0B 5F8LA 3NAHA 5C5JA 4ZHRB 2R2RA 4ZP6A 4PQUA 4NCGA 5J2NB 4TY8A 1ZETA 2UVWA 1TL3B 2WONB 2ASDA 5L1IA 3SFGA 1S9GA 3PR5B 3MEEB 4Y34A 4NLTA 4NZ0A 2IMWP 4O3QA 4K50A 2D7SA 4IH5A 4RW4A 4NCGB 2QE5A 4YR2A 3MR2A 2WOMB 4TY8B 4XO0A 3SFUA 4F4WA 3T5HA 5KFUA 3KHHA 2JC1A 4NRTA 4J9KA 1YVFA 4ID5A 5KFKA 2R2SA 1J5OA 3OSNA 2FVPA 4U6PA 3CDUA 4YP3A 3BR9A 3GV8B 2B6AA 2HMIA 3VQSA 4IQXA 4NLPA 1QAIA 2HNDA 2ZD1A 4ZP9A 5F8IA 5DGBA 3CDEA 1RYRA 2W9CA 4I2PA 1RTJA 1TVRB 4KHRA 4NRUA 3OHAA 5F8JA 4ID5B 3V81A 1NHVA 1J5OB 2JEGA 4TYAA 2R2TA 4ZP7A 3PW2A 1S0OA 3M9NB 2B6AB 2HMIB 3LALA 4O3NA 4TQRA 4ED6A 4O3SA 4Q8FA 3V6DA 2ZD1B 4ICLB 5KG6A 2W9CB 4ED0A 4I2PB 1TKXA 1JLQB 1DTQA 1RTJB 2D3UA 1D1UA 4O3RA 4EYIB 3V81B 4MK8A 1JIHA 3MEGA 2ILYA 1LWEA 3UR0A 3MR5A 4M94A 3QYYA 3PJWA 4ZMMA 4H4MA 5HP1A 3GV7B 3V6DB 3OHBA 1RT4B 4EBDA 1NNDA 1S9EA 2IM1A 1IKVB 1TKXB 1DTQB 5D3GA 1SV5A 2UVVA 1RT7A 4MKAA 5KFYA 3I5BA 2C2RA 4PWDB 2VA3A 3GIIA 3GQCA 3MEGB 4ECTA 1LWEB 3NMAA 2QV6A 5HLFA 5DG8A 3DRRA 4MH8A 4ECRA 3EZUA 4ECUA 4ECWA 4H4MB 5HP1B 3TAMA 1MMLA 1S9EB 3QGIA 4WFZA 3DI6A 5D3GB 4NLGA 1SV5B 3Q8RB 1RT7B 3CJ3A 3H5YA 4RZRA 5EUHA 3C6UA
chains in the Genus database with same CATH superfamily
3EXYA 4Q0BB 1X9MA 4C11B 3HP6A 5CH7B 1MWZA 2AHOB 1DLOA 4ELVA 3QATA 4L73A 2OPQA 2DPJA 1BC6A 2AMCB 3HCXA 5HVFA 3WX4A 2W8LA 1AXQA 2B5JB 1GMWA 5B0AA 2D9PA 1X8DA 5GAEI 2QRRA 2LEBA 3BO4A 2VJVA 1TV6A 3M2RB 5BR8F 4KTQA 3G8TA 3RBZA 1RYSA 2QLFB 2LFVA 3Q8VA 2VG7B 2J8SA 3O8WA 1S79A 2FVCA 2HIQA 4O4GB 5GAHU 3KUEA 1WWHA 4DR5F 2CVIA 2XGPA 5FD1A 1RGVA 1EETA 3GV5B 2VPXB 3RG6A 3S1TA 3RJMB 2FPHX 2C28A 1S77D 3DLLQ 4ELTA 5DDRC 2QMWA 2MKIA 1BGXT 1MNEA 1JLQA 2DD8S 4RO0A 4F8RA 3M2VA 1R3NA 2C2KB 3DGPB 2DXDA 4H54A 2F5GA 5F9NA 3C14A 4CLTA 4TQSA 1Z2LA 2W1BA 2XMTA 3GP9A 3IC1A 4WZQA 3DLEB 3J80Y 1RHQB 4WFNQ 4K4UA 1SKUB 1LW2A 4TLRA 3WZ0A 4OYBA 1D9FA 1FKOA 3TEHB 4YOEA 5T7LB 1WOSA 2LU2A 1HHTP 1BY9A 4ZK7M 3HFZB 1EHWA 3BSNA 1BXNA 2J9EA 3D2WA 2J7UA 3RR7A 1QLNA 4B3SF 3BYRA 1NEEA 4RBUA 1OS5A 4JI1J 1N5QA 2HFUA 3MUMP 3SV4A 2DNMA 3Q8QB 3CPWR 1ZA2B 2KDOA 2NZ4A 1NH7A 2CKWA 4L3KA 1FJGF 2W2PP 5AT1B 3KK1B 2EVZA 1C0TB 5KFHA 5DZ7A 1REVB 5KT6A 4M5GA 3QWPA 1WDTA 2LXIA 4WZMA 4DZ6A 3SCJE 4CT8A 4K0KF 2HZAA 2IBKA 1SXLA 1Q53A 1QDUB 1TK8A 1M5SA 3AJ2A 4DR4J 3KUHA 5ETPA 4ZA1A 5HK4A 7AT1B 2EFNA 2AJQA 3VCDA 4WKRA 1H72C 4LSNB 1SKWA 2DNQA 3M7VA 4QBUA 2YNHB 3Q24A 3I5CA 2IAJB 1S1TB 1FXDA 1JMTA 2IMOA 1FFGB 3CJKB 3HZEA 2FVSA 2ZNYA 2Y8WA 2PI5A 4HTJA 3PIPQ 3KLGB 1T03B 2MSSA 4YFUA 4USVA 3HHLA 1T7PA 2HKEA 3RR8A 5CXTA 2MEWA 3NNHA 1Y9OA 4Q45A 2UXBF 2YKPA 5BYQA 3MM5B 2BMBA 3G8QA 3IG1B 3FJ2A 3T9NA 3RBDA 5CABA 2AJ0A 3CE8A 2RQKA 3JSMA 5HMXA 4OV6A 1CC7A 2CFXA 4N8OA 3MM9A 4G1QA 1N52B 4F2RA 3AB2B 2IFXA 4RKUC 1IBLF 1IM6A 4KGMA 2AGQA 3PV8A 2MY7A 2K3IA 4ZHRB 2RNEA 3DXBA 2RE1A 4RJVA 2OEJA 2ZDPA 2MQLA 2EFPA 4RW4A 2VASA 3BB5A 1DJ0A 4NXMF 3OSNA 2B8QA 3QQCD 1YJUA 5EN1A 4BS2A 1WDDA 1WC4A 3NGSA 2G2ZA 1VQ8S 3VZHA 1YBAA 4ZVPB 1WEXA 3ULHA 3UD3P 3ZZRA 2IM1A 1FHTA 4DSFA 1N5TA 2KM8B 4ECWA 2XLJA 4HI2A 4NLGA 3MCOA 1G6BA 3A8IA 1H98A 3P5TL 3TANA 2RMLA 4ZPWR 3DI6B 3CJ5A 2AZ1A 1U2CA 2PI4A 2QGFB 2UUWA 5B0DA 2DKOB 1DTTA 1VC5A 1PG5B 1IBMJ 2CQPA 4AQYF 2YPZA 3G4SS 5KFPA 3OD2A 2OMLA 5D6GA 5DETA 2PN6A 1CVJA 1XNRJ 4ENOA 4CWBA 3CT9A 4IDKA 2NUUG 1FEEA 3KYLA 2XI2A 2IM2A 1WOPA 3CO9A 2CG8A 4MFBB 4LF9F 2HHXA 3I6PA 2K3KA 3X1LB 5HBMA 2RKIA 3A8KA 3AJ1A 4UF4A 1JKHB 3TW0A 1QVGR 2RDDA 1K47A 1ULRA 3J7Z5 3J7YU 1TKDA 2QZ8A 2POKA 3W63A 3FCWA 1LW0B 1ZAWA 3GFYA 3R6LB 1IUJA 4IFVA 3OR1A 4USKA 2IJNA 4I6YA 1U2RA 1Q7YT 3BSAA 4C0OC 2P5VA 3IR5B 1RWWB 4WE1B 1HD1A 2ZH5A 3DOKB 3BR8A 1NK7A 2AZ3A 1RT1B 1NK8A 5C7PA 1VBZA 3CJRA 2DGTA 4EBCA 4Q43A 3JSBA 2IPOB 3A3OB 1M1HA 2LA4A 4QIVA 4BCAA 1QVFR 2XI3A 3PX6A 1TKZB 3MZIA 2GW8A 2HG4A 1GX6A 2E1CA 1WC5A 4QOTA 2BANA 4JI3J 1VK8A 2GA7A 3IM8A 3DRXA 2XB2D 1HYSB 4F3QA 3RW7A 1CULB 5KFIA 3IGNA 3MI7X 1DQ9A 1CS4B 5IQ6A 3O3LA 5EWFA 4QPXA 1S1UA 2VKZG 1FVQA 3AXMA 2AEMA 2DNHA 4LFBF 2E5JA 3KOAA 3DOMA 1U47A 1KP6A 2X7IA 2VFUA 1C1BA 2NXCA 2ACYA 1Z4UA 4ETXA 4P7TA 3BPDA 1SUQA 2A6MA 3GYXB 5I42A 5CZVA 5A8KA 4J90A 5KG2A 1RK8A 1OYEA 2DJWA 3B78A 2P6SA 2FY8A 3O1LA 3LPEA 5CYJA 2OEKA 4X62J 4CLWA 3MM8A 2D74B 5ETRA 3ZZ0A 3PO4A 1HD0A 2ALZA 1XMOF 4CO0A 2KYZA 5M2UA 4NX9A 1RP5A 1S4EA 1X31C 2GIQA 2P9CA 3JAMU 3M8PB 1HL6A 2UU9F 4DR6J 4R25A 3LQVA 3MPWA 1CJVA 1RSCA 2OPPB 3CCQS 4C2MA 2BA9A 3I0RB 3T6JA 4FZVA 4A8WA 4NEZA 2A3JA 4UW2A 3KLFA 2XEXA 4RW6A 1GMWD 5J1EA 1HBNB 1U49A 1XWLA 4LFCJ 2YWGA 3BH6B 1Y7PA 2ZH4A 2Q1LA 5J2NA 4WXWA 2DNLA 5IFMA 4P9SA 4PEOA 2RU3A 2WONB 4XAKA 1FRIA 3PR5B 3EXCX 4W90B 2WOMB 5E41A 4ID5A 3ILOA 4A8XA 3K5OA 4FF1A 4I69A 6FD1A 4ZP9A 5F8IA 4LF2A 2JEGA 1J5OB 4QU7A 2FTRA 2OFHX 4K7QA 1U1PA 2E5GA 5DDQC 1YZ6A 4HEA9 5IXUA 1YBTA 2ZVIA 4MK8A 1LWEA 3MR5A 4M94A 2QLBB 1FNOA 3ZFVA 3W1YC 2HIYA 1S9EA 3EZOA 1TKXB 2R42A 4DFKA 3X3UA 4GRSA 4OMFG 4XTTA 1MMLA 2FC8A 1RAIB 1TL7A 2VD3A 4K4ZA 3DRRB 3VVUA 3TNVA 3GG0A 1GX5A 2G2YA 4YR3A 4KHPF 3BS9A 4ZPCA 3T1YF 4LF6J 4PG4A 1ROFA 4ANEA 2FQQB 1FJEB 5KFWA 3B4DA 2E7XA 3IA0A 3TUJC 1AFIA 3KJVB 2RF2A 3FFIA 1GEHA 4L76A 4IR9A 3IR6B 2JZ5A 2KXHA 2AU0A 1XIQA 4Q7AA 3SBMA 4LRDA 4BC9A 1VIOA 1IBKJ 2QMXA 4K4WA 2YQ1A 3BDEA 3E51A 4RNFA 4NYZA 5DLFA 4I6WA 1ZAVA 3T6BA 4LBHA 1U26A 1VCTA 4EI2A 5D4OA 2ZC3A 3K8WA 1MN9A 2F9DA 3QWUA 4R8UA 4L75A 2HRTA 1NJWA 1V6HA 2YWHA 2XSJB 5KFZA 2KXNB 3RRKA 4J9SA 3DRYA 2B8PA 2OAUA 1RA6A 3MAHA 3N01A 1W25A 1R27B 3DOLB 2VG5A 1HR0F 1X4AA 3C6TB 1T95A 4Q0BA 2CJKA 4OZ5A 3NS5A 2KM8C 3UDVA 2IRUA 4OJGA 1XMQF 3JYTB 2BXJA 1RADB 3LTOA 4CLKA 2XBPA 1JJ4A 5JUMA 1ZTWA 2BRLA 2ZHBA 2DHXA 2IIHA 4B9NA 4M5IA 4JYAF 3QIPB 2J0XA 3HHLD 2L9NA 3ZZTA 2EFVA 2HBRB 3V6KA 5FLXY 1U1MA 2X1FA 4ZJLA 4KV8B 2PMHA 1KN6A 3MGJA 2JVOA 2O5DA 4UTGA 2VBZA 4AT1B 4Y2CA 2EPIA 2NXNA 2DY1A 3W8GA 2V0NA 2IJFA 4OYXA 1AZSB 2ZH7A 4IOBA 4WFXA 4WJBA 3ENAA 1S6OA 2ROGA 2W9AA 4UY85 2C2MB 2OI2A 5DM6Q 2IHR1 3F44A 3H2UB 1S6QA 4YB6A 3I31A 4KJIA 2AD9A 3DRPA 4IO1A 1HQUB 3ENQA 3A8JA 2RB7A 1F9HA 2AWZA 3GR1A 4F36A 4RUHA 3ZTQA 1N88A 5DDPC 2CWXA 4KH1B 1KQFB 4JI6F 9RUBA 2FZGB 3GZ7A 2VFVA 2BX6A 2HNDB 1NK9A 3DLBA 2BRKA 1JLAA 3IRXA 3BQ2A 3SSRA 4PXEA 4HDHA 1VRTB 4QIFA 1WHXA 4H4KA 4GC7A 5KT2A 2VOOA 3VAIA 2NYHA 4P6QA 4IR1A 1UA0A 2YKNA 4ZLLA 3KLEA 5F8GA 2W7PA 2BQRA 2ZHAA 4ILMA 2V2VA 4YY3F 3GCWP 4KT0C 3ISNC 4FS2A 3ZZOA 2RS8A 1KNZA 4KFBB 2B0GA 2A0FB 2OPSA 1NSPA 1IKXB 3WHIA 3MM6B 5LMUJ 2CRLA 3QZ8A 3LP0A 1E6VA 8AT1B 3KK1A 2X1AA 3U1MA 3OFEA 3D7SB 4DR7J 1JWWA 1HWUA 3OXGA 2DH7A 1VQ7S 4C0HA 1RA7A 1TL5A 1I1GA 1VLOA 4OLOA 1VQSA 2HNZB 4OHYA 3NAHA 5H1SV 3CXCR 3W62A 2R2RA 4X4PA 5HSPA 2UVWA 4HVZA 2GZOA 5GAEU 2W25A 2NPFA 4O3QA 4USHA 1ZZNA 4NYOA 3PG9A 1IBCB 5IT4A 2O67A 1GT8A 2AP6A 3D0GE 1HNZF 2Q6BA 2ZH1A 1NJXA 4DSLA 2R2TA 2C2ZB 2Q6CA 2ZD1B 2XNRA 4YHHJ 3ZTOA 1JIHA 2AJFE 1VQ6S 2GMLA 4TVAB 1OO0B 5A0YB 2CJYB 5HLFA 4YB7A 5HN0A 2IRXA 3TAMA 2MQNA 4P52A 1URRA 5HANA 5EUHA 1BWEA 1O6XA 2PC6A 2G9OA 2NYIA 4KRWA 3W2WA 3IG1A 2A10A 3MMAB 2BJEA 3MPVA 2P6TA 2PFFB 2O01C 1UVIA 3M05A 5KFOA 2HFSA 4LF7J 2NREA 4OI1A 3NGKA 4MYTA 5ETVA 2MHNA 2GFFA 4TKTA 3CMAS 3D6HB 2E9ZA 1FF2A 1X0FA 1NDPA 1HNVB 4RUAA 4O44A 2VPZB 3CB4A 2ROPA 3QJJA 2LDIA 2KH9A 4WXOA 2YX7A 2CQ4A 3R2CJ 1HWLA 4ZVGA 2BE2A 3PW5A 1B70B 2KU7A 4X66F 2KHDA 2B7BB 1JLBA 3CDAA 4PKDB 2MLZA 5GVQA 1ZPWX 2JJ4D 4URSA 2B43A 5KG5A 1XEZA 3M6UA 3RAQA 3P8BB 3MAAB 2D3OR 2DGOA 1TFWA 3G9CA 3KK2A 1D8ZA 2ZEJA 5BR8J 2RH3A 5FDLA 2ADCA 2YKOA 3FC9A 4PXBA 2B9YA 4CLZA 5BYRA 4DR5J 3LPYA 3MPYA 2FLPA 2V4QA 3W3SA 2A2CA 2VV5A 3E01B 3M2UA 1FK9A 4EZ6A 4ZITA 3DM2B 4B9MA 3K5PA 3GIKA 1X4DA 5G0RA 2FUG9 5D4LA 1NAQA 2WVDA 2KXFA 1RU2A 2LMIA 3SYZA 5KFXA 4FF3A 4NLRA 2BYCA 2BUNA 2EI5A 1CJUB 1HFEL 1F3FA 2BV3A 1BE4A 4A48A 4DMZA 1RT3B 4B17A 3OVSA 2XM3A 4OZ1A 4YS2A 2KFNA 4DV0F 1OYDA 1B7FA 3DLGB 2ASYA 5D77A 4FYVB 2QL9B 4F0MA 2ZUGA 2KT3A 3M9OB 2QT7A 3KJQB 2VONA 2H4WB 4K2XA 4ETZA 2X3DA 3EJMA 2XMJA 1JLCA 3QFHA 4B3SJ 2NR0A 3CCMS 3MECA 3AH6A 3W2VB 5LMNJ 3R5AA 2YWEA 2AX1A 1EX8A 2DK2A 4JI8F 1N4LA 3BO3A 4P74A 4DBQA 4YDXA 4JB8B 1FJGJ 3GR0A 2MSTA 3SEOA 2RHQB 1NDKA 3OV7A 1S0MA 4B9VA 3MEDA 4CO3A 3KTQA 1Q81T 2CQ0A 1EIYB 3CTRA 2E29A 5JXSA 3HPOA 5KFNA 2OD6A 2I5JB 2HFOA 4B3RF 4Q44A 1RAJA 1S6PB 3N28A 3ZZPA 4K0KJ 4QW9A 1YSJA 4U9RA 3MMBB 1YJ9S 2RAQA 1R31A 3FK4A 4DI6A 1C0UA 3OL7A 4YB1P 5DGAA 4JV5F 4TU7A 2JWNA 3IS9A 1PKUA 5C24A 2VDIA 2GC8A 4NLWA 1N8RT 5CZXA 4QWAA 4PXDA 4ZJQA 4B02A 4QIEA 3WX8A 1EQMA 2V8GA 3LP2B 6FDRA 1YJ7A 3AOBA 3QFWA 3BN7A 3HVTB 4X4NA 2GAGC 3T1AA 5A76A 5JMNA 2OGUA 2XQCA 4FF2A 4DV5J 3AXKA 2BM0A 2G1HA 2UXBJ 1IN0A 4F4WA 4DCPB 2MKKA 2PEBA 5AE1A 2WVBA 5C2CA 3FBEA 4RLEA 4ED6A 3LALA 1UPPA 2XSFA 2W9CB 2DGXA 2ILYA 1HW8A 4M5DA 4PWUA 4H4MA 1XTZA 4FP9A 3GV7B 4EBDA 4K2JA 2V4JB 1IBLJ 2C2RA 5DG8A 2B4PA 1BQXA 3AJDA 5HP1B 4WFZA 1DAXA 1RBLA 4IYQA 1JK9B 4RZRA 1H6KX 1AT1B 3I0RA 1F0XA 3DDIA 1T8EA 4LF5J 3EDRB 3CJ4A 3Q8SB 5J2PB 2JX2A 1U02A 4RBVA 4A46A 2XNQA 5AXMA 1JJ2R 3HJFA 3FDSA 2DNYA 3TX0A 2GCFA 1F2GA 3QT6A 1HPZB 1RWPB 4F4ZA 1DBDA 3QRRA 1NJYA 2GJFA 1PIEA 1N56A 4HACB 3KMSA 4K5RA 4CCHA 1SKSA 4OX6A 1EJ7L 2WONA 5HMWA 3ILIA 5I3PA 5A8RB 3L9ZA 3SDEB 4ATNA 4WP8A 2YNGA 2WOMA 2DO4A 3K7RA 1XK8A 2OELA 5AXNA 1YX2A 3W61A 3NMAA 3FSXA 2XLKA 4ECVA 2JHEA 2QTWA 3GILA 2CQHA 2H4YB 4PWWA 3H8YA 4ZPBA 5LOQA 3PKMA 4BDPA 1T05A 1KLMB 4AQYJ 2ABYA 1FRKA 1B7YB 3TUIC 5I3QA 5KFMA 2WBMA 4O3OA 1RTIB 2E5IA 5DG9A 3D3BJ 2XY7A 3G96A 5J2MB 3RRGA 1VRUB 3GIRA 5JVHQ 1N36F 3T5JA 4ZCKA 1T0TV 1UETA 4C8OA 2HAFA 2H9ZA 3VAFA 1RTDB 2EXUA 4JUZA 4WP9A 5GAGI 2WK4A 3PEHA 3W9IA 1TMMA 3KLIA 1LXNA 3W60A 2XO7A 1NK5A 2EC0A 2CVEA 1VQNS 2RRBA 2WW8A 3JQJA 5D0HA 1Y00A 5D0RA 5BXIA 1SI9A 2E9RX 1NU4A 1KFDA 3MD3A 1QUVA 4ZLNA 4RWWA 2EG2A 4OHVA 3QJPA 5J2QA 3A4TA 3GYNA 1JLGB 2R8KA 2HHSA 2IRYA 1Y0HA 2BZ2A 1H38A 3WDOA 2LLZA 3PW0A 1B3TA 2HEKA 4CM0A 2XHWA 2J6SA 2DRBA 3QSYB 4GKKF 1HKAA 4F0KA 4PZVA 4Y2MA 3G82B 4PUOA 4OI6A 3DHWC 2U2FA 1TAUA 3R7SB 1WNEA 1OPZA 2CQGA 1N48A 4RW7A 1PAEX 4J9NA 3IWXA 2VJUA 4ZVQB 3R1HA 2QA1A 3NNCA 4UQTA 2OLWA 3MCNA 2BJDA 4TU8A 4DSEA 4LSZB 3NL0A 4U7UD 4NLQA 2ROEA 1RKIA 2M4MA 1FI4A 1R7IA 1NJZA 1X60A 3A13A 4CO5A 2M0GB 4EFAC 2XYGB 3KDNA 3BGFA 4OFZA 5FJ4A 1OMSA 1I3OB 2YKMA 2GMJA 2YBVA 4ZPVR 4WKYA 2IMWP 4OI2A 2PMWA 2P8IA 3OTEA 1WHVA 5KT7A 5CYMA 2R7UA 1OQ3A 3OXLA 4LSLB 2W4CA 1GXUA 4F02A 4OYMA 1NPRA 2CIMA 1PYOB 1X4EA 3DLKB 4MKYA 4M5LA 3KG1A 3T19A 2KVIA 3MMCA 1VLYA 3CGIA 2IM0A 2YKQA 2DNOA 2RT3A 2Z56B 4DHVA 2YTCA 2HBZB 3BPSP 3PTWA 3CO0P 4PG6A 2QO3A 1XMOJ 1NPPA 3CCLS 3L3CA 1WACA 3H59A 3TA2A 3OLBA 1UCNA 3BO2A 5F8LA 4O23A 1WF0A 1RAHB 4OI3A 3R5GA 2UU9J 4J91A 2BVZA 5IV4A 2OTJS 3LUYA 1UFLA 2HBQB 4TY8B 2FZKB 2RQMA 3SFUA 3T5HA 2WSEC 4OYAA 2GNKA 1G2EA 4WBFA 2HNDA 3OFHA 5F8JA 2CPEA 1FTCA 4O3SA 2CPZA 3THTA 4I2PB 3C16B 3CULA 2F7VA 4F26A 4G6VB 3HULA 1QTMA 4ITSA 3I5BA 2VF3A 2G0IA 3LH2S 4ECUA 1M0SA 1NM2A 1N0VC 1YJNS 4FF4A 5L39A 3R8YA 3EWGA 5AXKA 4I2QA 3C6UB 3HVRA 1D9AA 2CWKA 4TXSA 2HFZA 3PJXA 3S01A 3QPIA 4CTAB 4PYAA 4AFFA 2B4VA 2C2NA 4ZPAA 4ID8A 2WVCA 5A2QY 1S97A 1VK3A 4C6AA 4NWBA 4NA2A 1KS2A 1S59A 1SC1B 1S1WA 1RABB 2XMVA 3JSYA 4KR0B 4C48A 2FHMA 3MFIA 3DNCA 3OSPA 3M1VA 1D0EA 2ASLA 3KLHA 5CCLA 4KHPJ 1RHMB 1RWKB 3T1YJ 2E44A 3HHEA 3NY0A 3CVKA 3VHQA 4JI0F 2JEIA 3CJ0A 5HROB 1BWVA 1H0HB 2HSEB 4ECXA 2C3YA 5HMZA 4DR6F 1UPMB 1K1QA 2DRAA 3K5LA 2V8VA 2LCWA 3MM7B 1E6YB 4RNHA 1UEVA 1LQ9A 4X4VA 1RT6A 5A0YA 4Y65A 4RW8A 3PXGa 3J7ZT 4ZLPA 1TKTB 3PACA 2WB1D 2ILZA 1FKAF 2F8EX 2IYIA 1TUWA 3QLHB 3M6VA 4UUXA 3LWLA 5FLXU 1BMQB 4DJBA 1ITPA 4LFCF 5C42A 2ERRA 3MMAA 1Z1ZA 2QX0A 1FJ7A 5LXYA 1WD6A 1WI8A 2VUGA 3QIDA 2FHKA 1TUGB 1WEYA 1U0SA 1VMBA 1U6ZA 5E3QA 5K5MA 1IR2A 5KFGA 1BLUA 4K59A 1J2VA 2CNKB 5C25B 5E33A 2J0WA 4QR0A 1DQAA 2MY8A 1HR0J 2GJ2A 4YEAA 1BHNA 1YRTA 2HVDA 2QJ3A 4I67A 3J81Y 3G6XA 4NA3A 4ZN3A 1WTFA 1N0UA 2RQ4A 5F8NA 3R5BA 1RWUA 1VYAA 4UOGA 2HNYB 3TQ1A 1IQTA 2BABA 3C15B 1M1KT 3H2VE 2ZZMA 2QSWA 3U1LA 3BZQA 5HAOA 1VQ4S 1X4CA 3QT8A 3D5MA 2MLXA 1LWXA 3AODA 2R3VA 7FD1A 3KHGA 3R7NB 3LP1B 1ZM9A 4E8UA 3ET6A 4EZ9A 1S1XA 3EVOA 3SZ2A 1QE1A 2CUYA 4AL5A 3M8WA 3NWGA 1RBOB 3Q22A 3RB0A 2NXUA 3V4IA 5H9EK 3CW2C 3IBCB 5FIIA 2IJRA 4DL3A 2GQ2A 2RU9A 4L3NA 3H90A 4ED3A 1URNA 4IQMA 1R0AB 3HF5A 1KQSR 1F2HA 4JI6J 4PAAA 1S57A 3KUGA 3TUPA 1CJTB 3NBPB 3MOZA 1QSYA 4QWBA 2H5JB 4CDIA 2J0QD 1WHYA 1HQEA 3MUTP 2A6OA 2DH8A 3TYTA 2B3TB 4F3OA 2MQPA 1WI6A 1TL3A 5F8MA 4P75A 3R2DJ 4KO0B 3K59A 3TJ9A 4YY3J 3SIPB 3K89A 3W2VA 4Y34A 1FDAA 4YR2A 2WVFA 4GVBB 4XO0A 4C3LA 5K8NA 3UDCA 2Z2LA 3TUZC 2PGCA 2AKWB 2K1RA 3BH7B 2B4UA 1FXLA 1N33J 3VF0B 1X5OA 1S0OA 2EK6A 3V6DA 3BF4A 4ED0A 1DTQA 1R8AA 3DCAA 4CO2A 3QYYA 1QUPA 2LA6A 4I68A 3ISZA 5RUBA 4UOHA 4DCJB 1CJKA 2QYCA 4M5KA 2Y1RI 3MMBA 4L74A 1FTRA 4FPIA 2WW4A 3H4DA 2FB0A 3GFHA 5IV3A 2VBWA 4URQU 1IKWB 1S1VB 3UI3A 1U24A 5ETLA 2JLGA 4RBTA 1HNZJ 1NK4A 3L7PA 3N6LA 3ZZZA 2Y1JA 3I0SA 5JJBA 2BJ1A 1UW9A 2Y1IA 2UUCF 5T14A 3ICLA 2VDHA 5CYQB 3HVTA 1KR4A 2OSQA 3I32A 3JQKA 1VRQC 1X5TA 2VL1A 5HJYA 4JI7J 3RB6A 1RWMB 2ZH2A 3TEGA 4LT6A 2HLTA 4A47A 4ECYA 3MPUB 4FN5A 2GS8A 3NMRA 2JFDA 3NGTA 3ZTPA 4JV1A 1LWFB 1L3VA 1HNIA 1HBOB 2H3EB 4MIAA 4QR1A 4OHZA 3Q2SC 5KOXA 5IM0A 2AF6A 3BEGB 3AA9A 5B0CA 3OFGA 4USIA 2ASJA 1UEKA 2L3MA 2V4JA 3OR2B 4DSKA 3PKYA 1VBXA 2X1GA 3IN5A 1HMVA 5LMUF 4P72A 2IDEA 4JI2F 4YQWA 3FUYA 3BGLA 3QGHA 4P7VA 1SH2A 2VPWB 2HQDA 1UVMA 2RIJA 1KVKA 4ECSA 1M90T 4ZKAA 1NO8A 2JVRA 1JLFB 1Q95G 4A4JA 5J2PA 3Q8PB 2ZE2A 5ETKA 2XULA 1RLCL 2WCXA 3K17A 4X84A 4X66J 3G6YA 3WC0A 5CD4A 4C8KA 1YJRA 2DYAA 1K1SA 1TL1A 3EPGA 4NI2B 2VOPA 1VHIA 1Y5IB 2DHAA 2ZOMA 3M30B 5B0FA 1NKCA 4EO6A 1X4GA 3IM9A 3GTYX 1U8WA 4JV2A 2I8EA 1RBAA 4HTIA 4A8FA 2GQCA 2HS4A 2L9DA 1PC4A 5A8RA 5L1LA 4X64J 1UVKA 4LQ3A 2LQ8A 4W4MA 5K14B 1R89A 3M32A 1Y4ZB 3CD5A 3SCLE 1RT2A 4R5PB 3RAXA 3V5RA 1FKPA 3CJQA 4XPEA 3FCVA 2I2YA 5LSRA 4U67Q 2LXUA 4ANDA 5IC6B 2RRAA 5ETMA 1N5YA 5KOWA 4ES1A 2J8AA 4LIRA 3EX7B 3UVJB 4KE5A 4PQUB 4FYWB 4NZ6A 4DV7J 4UY8T 2XCPA 4IFYB 3OTDA 2CG4A 2Z2MA 2R7XA 2APOA 3Q8YA 2V34A 2KRBA 4G1IA 1RTDA 4KB7A 2W9BA 2DGSA 4DV0J 1Q8IA 2V8HA 4AD6A 4OZ3A 1M5OC 1LK5A 3DN9A 5JVGQ 1RQ0A 1LWCA 3UCGA 1BQMB 3N79A 3BBCA 2F65A 2MKSA 1H2VZ 2VQEJ 2NCKL 3P45B 4ED5A 2FJDB 4C97A 3HMJG 1LKZA 2AYBA 2OKQA 1YJVA 4GKJF 1T9UA 3DYAA 2D3ZA 4LVNP 5E0OA 3G86A 3Q86A 3OTOF 2PFDA 4JI8J 3LF0A 2KZZA 5E5NA 4ED1A 4LF4J 2JH3A 4CO4A 3UR3C 3DRSA 1RCOB 4X2BA 3HVWA 2E5LF 2OPRA 1VISA 1XR5A 1TK0A 2HPUA 3DMJB 3R1LA 1ACMB 4B3RJ 3I9V9 4CLPA 1FERA 1HQ2A 2WBRA 4NCGA 4KGZB 4GMKA 3QBCA 4DX6A 3PEJA 3SFGA 1VQMS 1N5SA 2OEMA 4FNHA 1ZPVA 4MYUA 3R6GB 2O1PA 2C2OB 1WUUA 1TFYA 4J9KA 4CO1A 3GV8B 2MGZA 3W65A 3SQGB 4JV5J 4EMDA 4JOUA 2WZ1A 3V81A 2HBYB 4TQRA 1H74A 2VH7A 4G65A 1RTJB 4CLUA 4EK2A 3MEGA 5L38A 4AE5A 1UZDA 3TZXA 1VHFA 5ETQA 4QZVB 1RT7A 3KG0A 3Q2TC 2QV6A 3EGWB 1FDBA 2PE8A 1FVSA 1SV5B 1H7XA 3CJ3A 4AL7A 2V94A 4EWTA 3C19A 3DLKA 5A8WA 1RAOA 3CDBA 4ALZA 1PILA 4F2SA 4HL9A 1DLOB 2AEJA 2IM3A 3WBZA 1K73T 4NCBA 3U27A 3FSIA 2CQDA 1WG4A 1J27A 2ZOFA 4E2FB 4FPRA 1YIJS 4F25A 5LMNF 2PEHA 2GVZA 2BACA 3D0HE 2R8GA 1Z2ZA 2Y8YA 2QSFA 5ADZA 3IGVA 4P2SA 1TAQA 1TV6B 4OJ1A 2UVRA 2FJWA 2JL9A 4KKOB 1KHWA 4N47A 2VPYB 1NBEB 1VGYA 3NCQA 1RTHA 3K0JA 3NG8A 3I5AA 4FDFA 3MAQA 4C8YA 5D78A 2BQUA 1EETB 4DN9A 5F0WA 1JXEA 4Z37A 1LOUA 4OX9F 4NLDA 1V3RA 4X65F 3VGSA 1J5EF 2JFKA 4C7QA 2HQIA 3M2VB 1DRZA 1UWAA 1U0HA 2BKNA 3BGRB 3MOJB 1Q0NA 3C14B 5DZ6A 3LA0A 4IG0A 3ENWA 1R43A 1LW2B 3DDKA 1GMUA 1JNZB 3AHPA 2QA2A 3DGVA 2I6WA 1FRXA 1FKOB 2ZUAA 4NMXA 3E8OA 3PCOB 1OPIA 3FEZA 5LSLA 2W2OP 4QJVA 4HR2A 2FYXA 1X0PA 4I1TA 3TP2A 4DF8A 2O3DA 5B09A 3AT1B 3CCSS 4MKVA 4ZVUB 3HFKA 4DV5F 1UAWA 3T5KA 1EB0A 2F4FA 3WIUA 2ZM6F 4DL2A 2YH1A 1IKYA 2V2ZA 2QN6B 2BKOA 4RNMA 3ONQA 4FYDA 3D6FB 2P2CB 4O0IA 3L09A 3KHRA 3OL6A 1KFSA 2GGPA 1N36J 3TAQA 4F4KA 3H20A 3AOCA 2UXDF 3BN4A 3V6HA 4I64A 4LRBA 2Z4PA 2OO4A 1UWBA 3WQPA 2ADBA 4NZ7A 3P4UB 3L7UA 3MMJA 1RCXB 1M5PC 4OX7A 4LF5F 4LF8F 1OWXA 4DR3F 4M5NA 3C2PA 1Y5LB 2AJ4A 2CDQA 4I7FA 4Z7CA 3DDNA 1VJQA 3H42A 1JLEA 2CZ4A 3N9UC 3PRBA 1WJ9A 1C1CA 2ZJRQ 3D6TB 2UUBJ 2WAQD 3M6XA 2FC9A 1U1RA 4A8YA 4GKKJ 3D1OA 2CAJA 1SIZA 2GO8A 1EP4A 4URGA 2COLA 2FLNA 5G4DA 2M8HA 3HHLB 3CMES 2DT9A 2ZZTA 4K4YA 1NKBA 3W64A 4YDDB 2YKAA 2YNFA 2EFQA 2KFZA 4QWDA 3PZPA 4R0JA 1UFWA 2KG0A 3DXSX 1YRUA 2ZH3A 1F1BB 1S76D 2ZC4A 2V9WA 1GAOA 2DEIA 2X3GA 4HT5A 3QAEA 4DX7A 4DV4F 3JSMB 3OJSA 3MM9B 2QL7B 1YHQS 1RAEB 3MEEA 3EMTA 3CUNA 3MD1A 3R97A 2M88A 2E1MC 2E5HA 2XYPB 4PXCA 4DF4A 2HMIA 1YWXA 4IQXA 4NLPA 4KHRA 2CZ9A 2GAHC 2F8MA 3F73A 4J9VA 1V3ZA 3RU0A 4Q8FA 1KSPA 2LECA 3P5BP 4ICLB 5IOLA 3KXDA 5KG6A 1Q78A 2RSQA 1D1UA 1FFSB 1WKKA 3CSKA 3CC4S 3G6ES 3KNGA 3PJWA 1ZBTA 4KQZA 1NNDA 4MKAA 4PWDB 2PT0A 3KKFA 1TTHB 1ZS6A 3O2IA 3GSDA 4P2MA 4DV2J 4D3HA 1MN7A 4NPOA 2AGPA 1B0TA 1BUXA 3EE3A 4Y6IA 4RW9A 4DPXA 2B9XA 1Q79A 2CPXA 4ED2A 1REGX 4ZJOA 4J9OA 2Z57B 2MMYA 5IC4B 5KG3A 2UVUA 3ZZUA 4V1Ak 2XWYA 4CIOA 5DM7Q 1DTTB 3TAPA 4U8VA 4IOAQ 1IQZA 5MLCV 2OHDA 2R7QA 4LBIA 3JAMY 2U1AA 3SCIE 4ZVRB 1D8YA 2DRDA 2AW0A 1RHJB 3VAHA 4KO0A 1HHSA 2M3DA 2XYHB 4DFMA 2FLLA 4ELUA 2BJ9A 1FDDA 2YNIA 4UQGA 3M8QB 3B54A 1HBUA 2DNPA 2Y1LB 2JRSA 1RB0A 3PYGA 2JEJA 2M8DB 2V2KA 5EX3A 1VDHA 5HBMB 3W9JA 4TN2A 2V8DA 2RKIB 3ITHA 3OUYB 3S7RA 1T3OA 1M1GA 3ILLA 2GVDA 1BQNA 5I3UA 1TU0B 2E66A 3TO8A 4IFVB 1ZM4A 4F4YA 3OR1B 2DCLA 4IG3A 4NYPA 1LFPA 1U45A 1NK6A 4IKAA 2L9WA 3I4HX 4DN0A 2KHCA 2BQ3A 5DG7A 2HURA 2XMWA 1C4AA 2OP5A 1N32J 2VQFF 5KT3A 4B3OB 2C3MA 2HW3A 2DHGA 2KO1A 3VALA 4F7VA 4DL4A 4BWJA 2V4RA 3IR7B 2VG6A 4QYZK 3NKYA 3LAKA 2EK1A 2LEAA 4TLQA 3UN2A 3GCXP 4ZVEA 4JI0J 2RDIA 4F50A 4ANCA 5LT5A 1NHKL 3GU0A 3J81U 4DLGA 3KJNB 3HHDA 3UDLA 1MU2A 3KK3A 2HQFA 1ZM2A 3TJAA 3ZNUA 2YQ0A 2J5AA 3UQSA 2VA2A 4OX8A 2GX8A 4Q2MA 2XWXA 1P9YA 2YVSA 3V2UC 5GMEA 1XQIA 4WFAQ 4Q2LA 2PIIA 4J5OA 3D4JA 1LWFA 1S1UB 3Q83A 1ZTTA 3V4MA 1CQNA 2DR8A 3UNYA 4WIQA 2DEJA 1U2FA 2ZHOA 3D6MB 2UXCF 1C1BB 2E9TA 4C8MA 1W26A 1X9SA 1N6QA 2HZCA 5HJXA 4H4OA 1Q82T 1SUQB 2XHCA 2J76E 5I42B 5A8KB 1GMVA 1L3KA 1V5VA 3H4BA 4UZBA 2R8IA 3IWNC 2V2QA 2W7OA 5L46A 4WK1A 1U4BA 3RYLA 4MTPA 2PD1A 3HSDA 2QFJA 4CYUA 2F8HA 2BOPA 4DZDA 2KFYA 2ZFHA 3MM8B 4L6V3 3MHYA 4DL6A 1CSJA 1WHWA 2L48A 2UUTA 5I4MA 4QW8A 3M30A 3QO9A 4NASA 2D69A 4C8ZA 4KAIA 3DHXA 2FDNA 3GMGA 3QNWB 2Z0GA 3MCMA 1JXLA 1RT5A 4NMLA 1CJVB 2H51B 1MWQA 1IVZA 3VAGA 4KBIA 4HT7A 1U6FA 4G3IA 1RDRA 5T41A 1WC0A 3KLFB 1SC4B 4RW6B 2HVIA 2HHPA 3PYDA 1UEUA 1KONA 3THPA 1FCAA 1VQLS 2DHSA 3M9MB 1H73A 5H9EJ 5J1EB 1PYTA 1TK5A 3BM7A 4CLLA 3EGZA 1Q8BA 2KT2A 5CHCB 4OJ3A 1UZHA 2QLJB 4PQUA 5J2NB 2DNZA 2ASDA 1Q5VA 2ZBIA 1SCJB 4NLTA 2KJVA 1I5OB 1RWNB 3MR2A 1JJHA 1S12A 4ZVTB 5KFUA 3KHHA 2JC1A 1YVFA 2B56A 4B9SA 5ETNA 2R2SA 5IT9U 2B6AA 5A6WA 4ID5B 2NQPA 2R4FA 4ZOSA 4RPFA 4C4WA 2DGUA 5E3CA 3POTA 4RWXA 1MW7A 1L3SA 2HYIB 2XMUA 4ZMMA 5D3GA 3A12A 3HD2A 2EFGA 1RHUB 3GQCA 3P49B 1LWEB 2MKYA 4OZJA 2G0JA 2EKYA 2KYXA 4C11A 4CH1A 3AD9C 1S9EB 3PRDA 1IR0A 2Z30B 3M8YA 1UJ5A 1NMEB 1TL7B 1WSRA 3HHLC 3I4PA 3MWBA 5IWAF 1OSDA 4DFPA 2YX1A 1HWIA 2B5JA 2LQJA 2Q43A 3I82A 3OL9A 2CADA 3TWZA 3M2RA 3C66A 2J6UA 2VG7A 3IAM9 2L41A 2B9WA 2AJ1A 3RW6A 4I0WA 2VODA 2C2EA 4O4GA 2RF2B 3FFIB 3PHTA 1WSVA 1WC3A 4NL5A 3K58A 4AL6A 5EWEA 3UCZP 4Y0FA 2DXEA 1SVDA 4K5SA 2CJAA 8RUCA 2RUSA 4K4SA 4L72B 2K8GA 3FNNA 3CCVS 1HWJA 3M6WA 4RX6A 2CZVC 3DGPA 4ECZA 2YXLA 1XBWA 4AUKA 3OTCA 3DLEA 2UUCJ 5K8MA 2XS2A 1YRXA 4CT9A 1NB2A 4GO5X 3ZTSA 2OSRA 4R8UB 3J81j 4ZVFA 3PY8A 5T7LA 3PYFA 4P73A 3RGIA 3TVKA 2KJWA 2V9KA 3OLAA 1XR6A 2DIVA 2XMAA 4A8SA 4DPUA 2VG5B 3M8RA 2MKCA 3RZAA 3JS9A 3KHLA 4XDDA 5KFRA 3H25A 2XC9A 3EICA 2MTLA 1QJHA 4ZDNA 2DNRA 3PNIA 1UTAA 4GC6A 2ZOGA 2H5EA 4K4VA 2W4DA 2N3OA 4M95A 2XS5A 1SC3B 5E7OB 4LJMA 3IP0A 3CCWA 3MURP 3BQ1A 2FJEB 2AIRB 1WC6A 4JI2J 2M2BA 2FY1A 4KKOA 3F0NA 5B0GA 1C0TA 1N33F 4J9LA 2P9EA 3K8VA 2IYGA 1REVA 3EYZA 3CD7A 2ALYB 4Y28C 5KFBA 2R7SA 5LL6d 2FIUA 4Z2XA 4OYPA 1PSDA 3BQ0A 3T1HJ 1YG0A 4PCQA 1S6QB 1R8CA 4DUTA 2WSFC 1OIAA 2LDYA 2RUGA 3KNAA 1RISA 3BGRA 3G8SA 3DRPB 4LSNA 1S9GB 3FQLA 5E3AA 2YNHA 5DS7A 1T94A 4EU0A 2IAJA 1S1TA 5H9FK 3IWLA 2NZCA 1HNWF 2HVEA 2JC0A 2ZDOA 2F3JA 3H5SA 2VC1A 2G2OA 3CJKA 3BJYA 2ZWOA 2DGWA 3KLGA 3GJTB 1T03A 2AQ4A 4J9RA 1JLAB 1GQEA 3IRXB 3U1NA 1Y5NB 4JI7F 2PA3A 1HA1A 1HLWA 3G71S 4U7CA 1SQFA 4ERDA 2YKNB 2AYEA 3MM5A 3KLEB 3KG4A 2FLOA 4FXDA 3K57A 2EBGA 2DR9A 3IO1A 5D8HB 5DQGA 4IUFA 2OPSB 4PQAA 1I6JA 2VC0A 3W7BA 1FRMA 3LP0B 3TRGA 1ZOTA 1DFDA 1E6VB 3D67A 2RQCA 4ZCIA 5CAAA 4ZVOB 1NH8A 1VQ5S 1S7IA 4ZHRA 1AB8A 5KAKA 2AEFA 3K5NA 4YUDA 1UJ6A 2R7OA 2QL5B 2UP1A 4M5JA 1W7WA 3GJQB 3R5CA 4OI4A 3E3XA 1R0CB 3OPKA 4C98A 4ZCMA 3J80U 4W92B 4DS4A 1W2IA 1RHKB 2K7KA 4MIWA 4GKJJ 4DUZF 1BD6A 4PG7A 4YP3A 4PABA 3LOUA 3VWSA 3P3DA 4TNOA 3OTOJ 1TVRB 3EGNA 3OHAA 1CQMA 2GQQA 1K44A 3PW2A 5ETSA 5M2RA 4O3NA 1QTNB 2DR7A 1SJ3P 3HI9A 2DIUA 3T9ZA 3OHBA 4USTA 2E5LJ 4Q5VA 4QU6A 5KFYA 4X64F 3IAS9 3GIIA 3CD0A 3EZUA 4NXNF 2B4OA 4D3GA 3OFFA 3DI6A 1Q5YA 2HK3A 3IFEA 5HLFB 1QAJA 3TAMB 5HL7Q 3PYEA 3FGVA 4DX5A 3W66A 3HO1A 4K4XA 5LJ5Y 4OZLA 5CD4H 4MK9A 4LBPA 3ZO7A 1PJ7A 3QGPA 3NCPA 3W2WB 4IO9Q 1MWYA 1VIXA 3OXFA 4DV7F 1S48A 2CPHA 2Y9HA 1NPKA 4QYRA 4DQQA 4RR5A 4MK7A 3HT0A 2ATCB 2PDAA 4KH0B 2YWFA 2C1EB 4MFBA 5IQQA 4YB5A 1WOOA 1Q4RA 2R9LA 3UE2A 1HW9A 2B9EA 1NUEA 1JKHA 2CNOB 5D0GA 1V5IB 3R5DA 2I9SA 1WKLA 2FJAB 2XLIA 3RBEA 4O44B 1UMJA 3BV8A 1LW0A 1SJ4P 1N34F 2E7VA 1IWGA 1RWVB 2NS1B 2BE2B 3TR5A 5KTQA 1O51A 4P2XA 4ICLA 1JLBB 3TARA 2VQEF 4WE1A 3H5XA 1APSA 2RRNA 1FT8A 5DDOC 3V6JA 3CJTA 3DOKA 2JSXA 4DR2F 2UV8A 4ES3A 4DQPA 1U1QA 4ED7A 4PWDA 2DTJA 4M63A 2JLEA 1T9VA 1RT1A 2WVEA 4JBCA 4LQ9A 3KK2B 4WFYA 4DPOA 4EEYA 5DLGA 2XG8A 2ACMA 4LF4F 4DR1F 5FDLB 3PW7A 1CG2A 5HQMA 1RJJA 2M9KA 1T9TA 2HFNA 4DQIA 1TKZA 3ZTRA 1U1LA 3H40A 1KOOA 1FJCA 4X4OA 3J7AN 3SXLA 5LJ3Y 4NLXA 4MIBA 4Y2IA 4OX9J 1MROB 3M2UB 1FK9B 3SCKE 1B0PA 5G0RB 1HYSA 3GG1A 4X65J 3GSIA 1J5EJ 1CULA 4ZIWA 3CJ2A 3FRZA 2BE9B 4ZIVA 1CS4A 4IRKA 4I6AA 2EG1A 4FKYA 1SJQA 3MTKA 3M8QA 1XMBA 1HNXF 3I55S 4Y2AA 1FWPA 4ZN1A 1O5JA 2F1FA 2JOQA 3UN3A 1I94F 3OUYA 1S99A 3D28A 2GV1A 4HHJA 3ILJA 4LRCA 5AJ3F 8ATCB 4DQRA 2J9DA 1SKRA 1YBUA 4OYOA 2QA4S 2D41A 3TVYA 1N5VA 2NXEA 3ELHA 1LK7A 4IRCA 1JLCB 2ZM6J 2IA6A 3BKFA 3RB3A 3MECB 2DNGA 4K8RA 4UOFA 1EKSA 1VBKA 1WF2A 4B3OA 4FKXA 1F9EB 2XS7A 1TP7A 3LGHA 4RNOA 4N5SA 2W01A 3FEXB 3KDOA 2G0CA 2HVHA 3JTPA 2UXDJ 2FHJD 2AGOA 4DPTA 3LAMA 2OIHA 5KFSA 3D66A 2CQBA 3M8PA 4DV6J 3MEDB 3JXOA 2BJ7A 2YPYA 1HIYA 1XNQF 2OPPA 2UV8G 3BGOP 4DUYF 4LF8J 3MF5A 1XERA 1FNMA 4DR3J 3JQMA 2HLUA 4Y00A 5GADI 1WEZA 1AYEA 2W4PA 1KEKA 2MKJA 3HX9A 5F9LA 3CF5Q 1HBNA 1C0UB 3W8PA 3EVWA 4LIWA 1HI0P 1NDLA 3IS9B 1U8SA 5C24B 2CPIA 1EZZB 4J9UE 3PX4A 4WPAA 3FQKA 1RACB 3OW2R 2OFGX 3GJRB 1UVNA 1C4CA 4OQJA 4LF1A 2N7CA 4OZ0A 1YZ7A 3MPDA 1RWOB 3R27A 1UJ4A 1O0PA 2HGNA 1RWXB 2L08A 1J5OA 2FVPA 4F0HA 3CMQA 3WC2A 1T11A 2XZWA 1TKXA 4B3MJ 1IXKA 4O3RA 1JXVA 3UCUP 4YN3B 1K0VA 1RT4B 1U1OA 4DV4J 1S0VA 1F5BA 2VA3A 2LU1A 3DRRA 4M5DB 3FBBA 1VBYA 4H4MB 3KFWX 1PC5A 3UD4P 3Q8RB 4H4KC 3H5YA 2Q79A 4C8LA 2ZWPA 3LW5C 1Y3KA 5HQLA 3H0PA 2KN4A 3FZ2A 3GIMA 2VFSA 2OTLS 2JDJA 4OYWA 2IC3B 1DZ5A 1X5PA 1XR7A 5SUHA 2CPDA 4LVOP 3EVMA 4PRFA 3KJVA 4WYLA 3IRWP 4EBEA 5K8OA 3FKBA 4WU2A 3GIJA 4WTOB 1HBMB 1H2UX 4DL0C 2OJ3A 4DQSA 2XY5A 1VQPS 5E3PA 3KMQA 5K20B 4WP3A 4NA1A 2ZZNA 3UWTA 5E2QA 2N82B 3NAIA 1RI7A 2ZKUA 2VIHA 3IBFB 1FDNA 3D68A 4PYDA 1VC6A 2XMMA 3NS7B 2UUBF 4LFAF 2MKHA 2HQ3A 3A3NB 4UT4A 4B3TJ 1SQEA 2F9JA 2YNGB 1Q86T 1RU1A 2LQ5A 1P8GA 2MZJA 1KOHA 3HSJA 2XSJA 2H5IB 2HWTA 2V63A 3GE9A 1KQGB 1Q7LB 1T05B 2MJUA 1YI2S 2Z8QA 4CQ1A 2GIFA 3DOLA 1ZM3A 4DV3F 3C6TA 2HHHF 1N54B 5DO2A 1F3VA 4IOCQ 2ZKTA 1SC6A 3JYTA 4QWCA 4E0DA 1L3TA 2W7AA 3PIOQ 3H5UA 3QIPA 3FEYB 4RNNA 5D4NA 3FSYA 5KT4A 4EUVA 1U25A 3CEDA 5M2PA 2CQ2A 3R5JB 4KV8A 5AE3A 1F60B 1OY9A 5LM7E 3KLIB 1KWMA 1VS3A 3CCZA 3NGRA 5BYSA 4DU8A 2WHOA 3GB0A 4QIWD 3U7JA 4C0BA 2Y0SD 2YWKA 1AZSA 2NXJA 1MG7A 2QYGA 3CNQP 1WTBA 4QYZJ 2D1CA 4FXWA 1T3NA 4LMZA 2VQFJ 2V69A 5J2QB 4F4AA 3VAJA 1Y3JA 1A0OB 4IH6A 2MZ1A 5CA5A 3NRBA 4EGLA 3TOQA 1HQUA 1TUVA 3JB9k 4DV2F 2OH2A 4CH7A 5L8RC 4PUOB 2N7YA 1U1NA 4X4RA 4PPDA 1TQLA 2GIRA 2DGQA 1WC1A 4OYZA 4RW7B 2WTFA 2VFTA 4UOCA 1GNKA 3L7OA 3NNAA 1VRTA 2KL8A 2MQOA 1WORA 1DY3A 5ETOA 3KWMA 1RAFB 5IT0A 3VAKA 2C42A 1YDLA 1GXTA 4KSEB 2YKMB 3ZNJ1 2IVFB 5HI7A 4KFBA 2MZRA 4U8YA 5KG0A 2UXCJ 1IKXA 3QMQA 5CYMB 3TZWA 3MM6A 1MMDA 1RE1B 4NLVA 4HHUA 2VHGA 5B0EA 3N5FA 1C2PA 4XK8C 1UKUA 4DG1B 3G2XA 4ILRA 2CPYA 1Y11A 2HWHA 4ZP8A 3VR1A 2EBEA 3A1YG 4WF9Q 2CA9A 1F9FA 5CQGA 3B8HA 2QLWA 3MMCB 1VQOS 3M8SA 5KFFA 1DHMA 2J7KA 2CNLB 1FEHA 2HNZA 3TJ8A 2FJBB 4CM2A 4O3PA 5KFEA 2IBOA 4F3MA 1TL4A 1N32F 3OQ2A 4JP8A 1T9WA 2LEPA 4KGKA 1OY6A 1VC0A 1S9GA 4FVCA 4N56A 4NZ0A 3EZ5A 1T02A 3T3FA 4IH5A 3QRQA 4PG5A 1QSSA 1B0VA 4U6PA 1PJ6A 1QAYA 3BR9A 1VJWA 2ZH6A 3VQSA 2ZD1A 1B4SA 4NRUA 4USUA 1SBRA 3M9NB 2KVQE 1R6VA 3QRPA 3GFXA 1F6TA 2VBYA 4E98A 3ETOA 3CC7S 4N77A 3SSQA 4DV1F 3T41A 1U1KA 2UVVA 1Q8LA 3GONA 4ECTA 4ECRA 1SIWB 3QGIA 4XDCA 3VTIA 2BM1A 4FNIA 4HH0A 4CP5A 3ISND 1NLKL 1VQ9S 1KLNA 2QA4G 1GH8A 3UPFA 5EDWA 4HHHA 5F41A 3P6YC 4I2QB 2HHUA 3OT9A 1RUSA 4AYBD 4OHXA 3RB4A 5L1KA 2BW7A 3HXMA 3SQOP 3UO0A 4NLUA 4DPWA 1FWKA 2BJ3A 1VI7A 1HNVA 1XN9A 2EWHA 2DXFA 3KLVA 1ELOA 4UUWA 2OMOA 3EPIA 1NKEA 2FZCB 4XPCA 4QR2A 3NP5A 1KVJA 3NGDA 3R9LA 5DQIA 1S1WB 3FVYA 3O6QA 2GJIA 5EWGA 1TVRA 3M8ZA 3M1VB 5HATA 5IWAJ 3MAAA 2F4VF 3KLHB 2VZ9A 2XGQA 4KY3A 4N8NA 2ZBQA 2BW2A 5K9FA 3HDSA 4QCLA 2MJNA 4ILLA 1RXOB 1YJWS 3Q0AA 5B0BA 1G7CB 1X4FA 2ZBPA 3FCHA 2GHWA 1IM4A 2JEFA 3MR3A 1RT6B 2GMHA 4RW8B 4RUCA 1AUSL 3VQTA 4U7UK 4AXIA 3E01A 2FGOA 3BREA 3PM9A 3DM2A 4BLGA 3TA1A 2BDPA 1NRKA 1ZH5A 5E3RA 5C42B 3PHEA 5KG7A 2HS0A 3CJ8A 1R8BA 4HLBA 4JI4J 5KFLA 3CDWA 1CJUA 3HVAA 1RT3A 4DEZA 3CC2S 4HDGA 2CPJA 3TVZA 4JI5F 2K2PA 5LSOA 3Q89A 3BDPA 3DLGA 4KIAA 3H98A 2UZAA 2OUGA 3DKDA 1B99A 1FRJA 5D4PA 3PRVA 1FESA 1P6TA 1HI8A 2NUHA 3IXQA 2MDAA 2DBBA 2GHVC 1KVIA 2ZJQQ 1NDCA 2H1YA 5EGYA 2WSCC 1W2BR 1VQKS 1AROP 4ZCLA 3B4MA 3H7HB 3TX8A 4I56A 4ECQA 1R8HA 2W24A 5F0UA 1YK9A 1YLXA 4ED8A 4DL5A 2YQ3A 2QEXS 3ZXWA 2UUAF 4WU3A 4Y2KA 2M7SA 4DS5A 1XC9A 2EEYA 2K7JA 2C3PA 2AX0A 3ETMA 3OBIA 1LXJA 3FBFA 3RAMA 2I5JA 3ET6B 4DOZA 3EDQB 1S6PA 4YMEA 1MROA 4X4SA 1S1XB 1NZAA 4C8NA 1ZYQA 3THVA 1P27B 2MPUA 2QFIA 1QE1B 3AOAA 3NXZA 1X4BA 3HHKA 3CCES 3BSOA 1X9WA 1M5HA 1ICEB 1MMNA 5EX0A 2Z2YB 2IVYA 5H9FJ 3TZYA 4HH1A 3V4IB 2HQCA 3A8EA 3CIZA 1ZA1B 5THWA 2CJQA 4CH0S 3LGMA 1DURA 2N3LA 4V19X 2C3OA 3HD1A 1HNWJ 4IRDA 4K4TA 1WKJA 1FE0A 4N7TA 2YH0A 4R0EA 1FXRA 3LP2A 5EHHA 3LO3A 1R0BG 3CWJA 3C3LA 5DQHA 4LR8A 1AFJA 2CQIA 2WB4A 1V3SA 2HS3A 4FVMA 1P1LA 1HQEB 2BR0A 1CLFA 1K9MT 5B08A 1IWAA 3D3CJ 3W5YA 1ZETA 1TL3B 2D7SA 4WCEQ 4U95A 2A2DA 2RHSB 3VV2B 3N0VA 1MSWD 3CDUA 4DSIA 2BBEA 3FBCA 1RYRA 2W9CA 2H54B 2X1BA 3GLJA 2A1BA 2K1RB 4P2FA 2D3UA 4G1PA 5F3ZA 1S7HA 1KKHA 4DWIA 1FFWB 5HP1A 3V6DB 1IKVB 1DTQB 1K8AT 1CBKA 4A8QA 1F5CA 2LVWA 2HGMA 3RRHA 1LEOA 3LGNA 2R7TA 4F67A 1CJKB 1PJ5A 1FA0A 2DCUB 2HGLA 4LREA 4HYKA 2QG9B 2MQQA 3T1HF 3K2YA 4DUZJ 1HWKA 5ETTA 4USJC 4WK3A 1HPZA 1U7LA 2E7WA 2IVMA 5KFTA 2R7VA 5KFQA 4HACA 3I0SB 1JQGA 2XZDB 5AE2A 5KFVA 5KG1A 3AQPA 1FX4A 5L9NA 1EAYC 1PGZA 2FVQA 3SDEA 4JV0A 3O5TB 4NXNJ 3DFEA 5L1JA 1TMJA 4B9LA 4RU2A 3P96A 4NLYA 2KI2A 4WWSA 1JB0C 2CYYA 3QZ7A 3AD7C 1PBAA 1KLMA 2SXLA 1SJ1A 2WRMA 4MJKA 3E2EA 4O4RA 4TY9A 1RTIA 1HNIB 1YITS 4OHWA 2CDRB 2GHPA 4JI1F 1RT4A 5IM0B 4M8LA 2Z2ZA 5J2MA 3GPAA 1GTHA 5IS2A 1VRUA 3MR7A 1RAGB 3SMZA 2I1RA 1HMVB 4CZCA 5MAOA 4QWEA 3QSIA 1RHRB 3W5ZA 3CCUS 1SH0A 2F63A 2IC3A 1X4HA 1YTYA 4TYBA 1N34J 9ATCB 1JX4A 3QGGA 4ZPTR 1S5ZA 3U02A 4NXMJ 2ZE2B 2J9DE 3QT5A 4OZ2A 1HBMA 1EARA 1P9QC 2IY5B 1LNQA 3FZBA 3PO5A 1Y10A 3HKZD 5GAHI 5B7WA 1S49A 1TL1B 2C3UA 4DR4F 2ATLA 2LXFA 2GO9A 1YKWA 4DR2J 3N5BA 2MZTA 1JLGA 2BEFA 2VKRA 2DVIA 1KRPA 1CEZA 1SL0A 4BC7A 4X4UA 1P1TA 3RTVA 3C46A 4DR1J 5ITHA 2R8HA 1HARA 4J7CA 1SQGA 1XJWB 3C8YA 2LKZA 1CC8A 3G82A 4MKBA 5GADU 3M32B 1VFJA 2HRUA 4IH7A 3W5XA 4PR6A 2VFRA 1RT2B 1EKRA 3F56A 4QIGA 1FKPB 3HSZA 2I38A 7FDRA 1QAXA 2KKHA 2QC3A 1N5YB 3HSGA 2EC2A 4C3KA 4N41A 2DHHA 2RDJA 3UN5A 3MFHA 1U09A 1IR1A 1HNXJ 4LF9J 4KGVB 1NZ8A 3UFCX 3US5A 2PMZD 1NSQA 2W9BB 1I94J 1TZ0A 1X5SA 4LUBA 5KFAA 3FMWA 3DC2A 4LSLA 1H2TZ 2G13A 5AJ3J 4OL8A 1GFWB 2KT5A 1LWCB 3QJLA 3J7A1 3W9HA 1FD2A 3OVBA 1L3UA 4HI1A 3MCSA 2MQMA 4CLSA 1VQYA 2AJ2A 2ZH8A 3GWCA 1A6LA 1I51B 4XIUA 3UD5A 1TR0A 1SB6A 3DYAB 3I96A 2OPQB 3HT3A 2R7WA 1OQ6A 4NE9C 5GAGU 2VBXA 2CQ3A 5GMDA 2XY6A 2FJVA 2MXYA 2BOAA 4DL7A 2G4BA 3AD8C 1NB7A 5F8HA 2LYVA 3I87A 4OIXA 2V50A 3DRSB 2YWWA 1AA1B 3PVXA 4LR7A 2OPRB 2CPFA 4A8OA 3I9ZA 1XNQJ 4TY8A 3HJVA 1D09B 2MYFA 1SL2A 4A8MP 4DUYJ 3L95X 4NCGB 1KBRA 5CCMA 4NRTA 2DR6A 5KFKA 2NSBA 2RILA 4ER8A 5DRKA 1RKJA 1IBMF 4I2PA 3C16A 4LRAA 1UL3A 2MQ8A 2MGZB 1JJCB 3DU5A 1JLQB 1XNRF 3V81B 4LFBJ 1NK0A 2QMUB 3UR0A 4RL1A 3GYGA 1RLDA 4OLPA 3MEGB 4X4TA 1WG1A 3SSSA 1RT7B 3C6UA 3FRYA 2N4CA 5HO4A 2G1DA 3VVTA 4F04B 4CTAA 2KG1A 4DG1A 2XZTB 4ZPDA 2W2NP 3NLCA 3AAWB 4J9PA 5A8WB 3QAUA 2CQ1A 2RS2A 2HHVA 2B51A 3UNGC 1WG5A 1PYSB 3VGTA 4WIIA 1KC8T 5KFCA 3MEKA 3M4XA 1CPZA 4J9MA 1T9YA 3DLHA 1OJ4A 2PO4A 1M5KC 2GVZB 2DNNA 3LANA 2HWIA 4M1KA 5KT5A 3N4WA 4KHMA 1X7VA 2HZVA 1Q1KA 2A18A 4Q8EA 1A7GE 5HROA 1PCAA 6AT1B 4DV6F 1RTHB 1SH3A 3PX0A 1U48A 4TU9A 5L9XA 5SZTA 5C2GA 4EO8A 1F5AA 2LQBA 3MM7A 1E6YA 2BKPA 2J0SD 3S8SA 1V9OA 2Q66A 4CNYA 4JI3F 1TKTA 1YJTA 4HKQA 3QLHA 4F4XA 2QIFA 1S9FA 4KC5A 1U0HB 4BHQA 3KJFB 4IG0B 4BBYA 2KZMA 4LFAJ 3PFEA 1KHVA 4C3MA 4WYWA 4FYXB 2D9OA 1NXIA 2M52A 1IJEB 3MXHP 4OZNA 2R7RA 4C9DA 2F40A 2K06A 2P9GA 3PR4A 3GJSB 1S0NA 4M5MA 2HK2A 5C25A 4USWA 2HHQA 1MLAA 4FXVA 4Z7YA 1K0TA 1FX2A 4DV3J 4ZVHA 2HHHJ 2V67A 3J7YI 5KFJA 1IKYB 2N4DA 1QSLA 3HKWA 2H48B 3AQOA 5U47A 4B3MF 4X62F 1RZMA 3B6BA 3WIVA 2GGPB 2HNYA 3UW1A 3PFOA 4MAKA 5J1PA 3SV3A 3C15A 4G1QB 2DGVA 2DO0A 4CI0B 3IMQJ 5GMKa 4J37A 2CXEA 3MTJA 3BBBA 3UDEA 3G6VA 1UWBB 3ADAC 3O44A 2C22A 2W2QP 3BSCA 2MB0B 4RW4B 3NWRA 3LP1A 2ZH9A 1D3WA 4FS1A 3T5LA 4M5HA 1D9DA 2OD4A 2XCAA 4I7FB 5KG4A 1NSAA 1JLEB 2Q3PA 1YQHA 3TA0A 3FMBA 3CCTA 3VGVA 3N6NA 1C1CB 2V8PA 3GFZA 2IDLA 3D0IE 3EGVA 4X4QA 1UP1A 3R3TA 2CJBA 1UA1A 2I0XA 3CIMA 4B3TF 1R0AA 4WTYA 1G4CA 4KPYA 1EP4B 4QQBA 1T9XA 5A2QU 2W8KA 3MDFA 1GTEA 2J6TA 3NS6A 1CJTA 3NBPA 2XTJP 4GVLA 2ZNZA 3PJ9A 4NCAA 2YNFB 2EW9A 3EM1A 2MZSA 4NEYA 4GO7X 2YY3A 2VB6A 5LXRA 3MUVP 4DDFA 2E1RA 1XMQJ 1KQKA 2NPIA 2AYMA 1U6BA 3CCRS 5HVHA 4MMOA 2DPIA 2EFOA 4IDKB 1UW4A 4NLSA 4JYAJ 4A8KA 2BJ8A 5C5JA 4USMA 4ZP6A 4GVBA 3HK2A 3DU6A 1YGYA 1FWLA 3MEEB 1VOMA 4K50A 4B08A 2QE5A 2CJXB 2CQCA 1L5UA 1KTQA 3G87A 5F3TA 3BBFA 3AFGA 4LF6F 1H3DA 2E1PA 3CDEA 2NLWA 4TYAA 4ZP7A 2HMIB 2AT1B 4EYIB 2ZVSA 2O66A 1PAUB 2Y3YA 2DISA 1SJRA 4DLEA 5D15A 2AV5A 5HVGA 4UZCA 1EQ0A 1IBKF 1KDNA 2RJZA 1IKWA 1S1VA 2R2UA 3K5MA 1OY8A 2YX4A 4NLOA 4OV1A 2AYGA 3CCJS 2DB1A 3ZZYA 4N76A 2DY9A 4RW9B 2HRYA 1S6UA 2ZJPQ 3BYPA 1G3OA 2LQ9A 2KB2A 4FBUA 2J9CA 3OTBA 2CNNB 4O0NA 5CYQA 4YR0A 2V6AA 3HHNB 3OJUA 1RTZA 3BGUA 4DX8H 1ZAXA 3BKTA 2BANB 4KPCA 1GXLA 3I56S 4QPTA 4DV1J 3NEKA 2VICA 1LFWA 2MHEA 2MLYA 4FYYB 3JTOA 1FD8A 1HBOA 2YNIB 4ZVSB 4EYHB 1HBUB 4OJHA 3PW4A 1WF1A 3DOMB 5HQ8A 3DLJA 4LRFA 4S0MA 3RUBL 2XMKA 5J1NA 3HM9A 3OR2A 3ITHB 2HAIA 1PBUA 4P10A 3NOCA 4U96A 2GVDB 1BQNB 5I3UB 1IKVA 4AXJA 2HHWA 4I4BA 5IT9Y 1OSCA 1JLFA 4IG3B 4ZS6A 3LWMA 1B64A 4B9UA 2FJXA 1DARA 3NGUA 5KFDA 1NHUA 1A9NB 1UVLA 1FRHA 2FGCA 2W2MP 2ZITA 2MZQA 3TZZA 2Z58B 2V68A 1S4FA 1H7WA 4NI2A 2R8JA 2F4VJ 2VG6B 1GK8A 2M5YA 3EUNA 3SI8A 1FRLA 3JSRA 1WELA 3TI0A 3ENVA 3A3PB 4OI0A 1FE4A 3F41A 4NOHA 4ES2A 1MU2B 3KK3B 4J9QA 3NCRA 5K14A 5A6PA 1QM9A 3RBXA 1UVJA 2JNJA 2DH9A 3CD6S 3L4BC 4R5PA 2DITA 4LR9A 4PPZA 3JTNA 2EKNA 1NSKL 3AY0A 1ZZFA 4Y3CA 2CJ9A 4RU9A 1NJIT 3TQEA 3IBWA 5BJRA 3HFVA 3UVJA 1NCLA 3VZIA 4V19J 2C2DA 4DU7A 3HZGA 2RVJA 1HI1A 2H65B 2V5HG 3MR6A 4IFYA 3QT7A 4W98A 2FVRA 2DNKA 2LP4A 4DPYA 1G1XA 4BWMA 3Q8UA 1QD1A 3R7BB 4JI5J 5D0EA 1N6QB 2ZBRA 3ZC4A 1VR6A 4ZLJA 5IZHA 2HQGA 4H4OB 4DR7F 2PA8D 2E1AA 5K8PA 1O8BA 4DXLA 4PG8A 3NOGA 1S10A 1R8PA 2FHJA 3D1QA 4CRJA 1BQMA 1Q16B 1UFKA 4CYUB 2B7CB 3S6EA 2IA0A 2HHTA 3PDNA 2M70A 2KTQA 2X51A 1KTVA 2BE7D 3QO9B 4DCOB 4ED4A 4P71A 2HFVA 4WFBQ 1AW0A 2DR5A 3OL8A 3CJSA 4CLFA 2HVZA 2UUAJ 1RT5B 3H2LA 1R6YA 3N6MA 4DSJA 3D9BA 4B9TA 4YHHF 2ZBCA 1IJFB 3DMJA 1HHQA 1FNXH 5DJBA 2XO6A 4FBTA 1S72S 4CNZA 3D54A 4KGXB 3Q23A 2JLFA 3OVAA 4CLYA 1Q8KA 3VAMA 2RD5C 3D1HA 1AUDA 5L1IA 3AA8A 4RUBA 1SL1A 3BKUA 3SQGA 1RAAB 2D3O1 1TELA 2J7WA 1QAIA 2Y0BB 5DGBA 4JI4F 4LF7F 1RTJA 2NSCA 1LV5A 3HLUA 1NHVA 2PSZA 2B6AB 4DFJA 1QY7A 4KYZA 5AXLA 2FD2A 3AB4B 1M5VC 1JNRB 3B82A 1DQ8A 4OYIA 5HMYA 2VU5A 1KD1T 2QLXA 1SV5A 3POTB 3VGUA 1FO1A 4MH8A 4MT1A 1SPBP 5D3GB 1PO6A 2FHOB 1SJFA 2KRRA
chains in the Genus database with same CATH topology
1H6KX 2BM1A 3EXYA 1B0TA 4FNIA 4Q0BB 4NPOA 2AGPA 1X9MA 4C11B 3HP6A 4HH0A 4Y6IA 4RW9A 3I0RA 5CH7B 1F0XA 1MWZA 2B9XA 1Q79A 2CPXA 3ISND 4ED2A 1T8EA 1VQ9S 3CJ4A 1DLOA 4J9OA 1KLNA 2QA4G 1GH8A 3UPFA 4ELVA 3Q8SB 5J2PB 2MMYA 5EDWA 5KG3A 2JX2A 2UVUA 5F41A 3P6YC 3ZZUA 4RBVA 4A46A 4I2QB 2HHUA 2XNQA 5AXMA 2XWYA 2OPQA 1JJ2R 2DPJA 1BC6A 4CIOA 4AYBD 3HJFA 4OHXA 5DM7Q 3FDSA 3RB4A 1DTTB 2DNYA 3WX4A 5L1KA 3HXMA 3TAPA 4IOAQ 1IQZA 5MLCV 2R7QA 2W8LA 1AXQA 2GCFA 3JAMY 1F2GA 2B5JB 2U1AA 3SCIE 5B0AA 2D9PA 1HPZB 1X8DA 4NLUA 1D8YA 5GAEI 2QRRA 2LEBA 3BO4A 4F4ZA 1TV6A 1DBDA 3M2RB 5BR8F 4KTQA 1VI7A 2AW0A 3G8TA 1HNVA 1XN9A 1NJYA 1RYSA 2EWHA 1N56A 2VG7B 3VAHA 3KLVA 3O8WA 3KMSA 4KO0A 1HHSA 4K5RA 4CCHA 2M3DA 1S79A 1SKSA 4OX6A 1ELOA 2FVCA 4DFMA 2FLLA 2WONA 4ELUA 5HMWA 4UUWA 1FDDA 2OMOA 2HIQA 3EPIA 1NKEA 2YNIA 4O4GB 5I3PA 5GAHU 4UQGA 3M8QB 5A8RB 4XPCA 4QR2A 3NP5A 1KVJA 3SDEB 4ATNA 3NGDA 1WWHA 4DR5F 1HBUA 2YNGA 2CVIA 2WOMA 2DO4A 3K7RA 1XK8A 2XGPA 5DQIA 2DNPA 5FD1A 5AXNA 1S1WB 1RGVA 1EETA 3GV5B 3NMAA 3FSXA 2JRSA 2VPXB 3C46A 2XLKA 3FVYA 4ECVA 3O6QA 3S1TA 2GJIA 2JHEA 2JEJA 2M8DB 2V2KA 5EX3A 5HBMB 2FPHX 3GILA 2CQHA 4TN2A 5EWGA 2V8DA 2RKIB 3H8YA 1TVRA 3ITHA 3M1VB 2C28A 1S77D 4ZPBA 3OUYB 3DLLQ 3S7RA 1T3OA 2F4VF 3KLHB 4ELTA 3PKMA 5DDRC 4BDPA 1T05A 2QMWA 2VZ9A 2MKIA 2XGQA 1BQNA 1KLMB 5I3UA 1BGXT 1MNEA 1JLQA 2DD8S 4F8RA 2ABYA 3M2VA 4N8NA 1FRKA 2BW2A 2E66A 3TUIC 1R3NA 5I3QA 5KFMA 2WBMA 3TO8A 4IFVB 5K9FA 4O3OA 4H54A 1ZM4A 4F4YA 3HDSA 5F9NA 3OR1B 4QCLA 2MJNA 2DCLA 4ILLA 1RTIB 4TQSA 2E5IA 5DG9A 1YJWS 1Z2LA 3Q0AA 5B0BA 1G7CB 2XMTA 4IG3A 4NYPA 3IC1A 4WZQA 1LFPA 3DLEB 1X4FA 3J80Y 1U45A 4WFNQ 2XY7A 1NK6A 4IKAA 2L9WA 3FCHA 3I4HX 2GHWA 4K4UA 4DN0A 1LW2A 4TLRA 3G96A 2KHCA 2BQ3A 1IM4A 3WZ0A 3MR3A 5DG7A 2JEFA 1RT6B 5J2MB 2XMWA 2GMHA 4RW8B 4RUCA 1D9FA 1C4AA 2OP5A 3VQTA 3RRGA 1VRUB 4U7UK 5JVHQ 1FKOA 4YOEA <