4Y2IA

Gold ion bound to golb
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
GMQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal-binding transport protein
publication title Structural Insights and the Surprisingly Low Mechanical Stability of the Au-S Bond in the Gold-Specific Protein GolB
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Metal transport
total genus 18
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y2iA00
3LGMA 2JDJA 2W4PA 1RJJA 4Y2IA 2LDIA 1WD6A 2FB0A 3BM7A 3MCSA 2IYGA 4OJHA 3DXSX 3I9ZA 3CJKA 1FVSA 2PGCA 1W2IA 4U9RA 2BYCA 5T7LA 4A48A 3HF5A 3HHLC 4A46A 1APSA 5IXUA 2HLTA 1Y9OA 1X8DA 1MWZA 3BN7A 2IYIA 1Q8LA 4FNHA 4YDXA 3CJKB 2FIUA 3WDOA 3FRYA 3K7RA 1N5VA 5T7LB 1LQ9A 5B0AA 3FGVA 3IWXA 4DPOA 4DL0C 2HIQA 2KT2A 3HHLB 1FE4A 1VQSA 4YEAA 2OFHX 2QIFA 3DCAA 1TZ0A 1JK9B 2BBEA 2ACYA 3HDSA 1YG0A 1YJRA 2RILA 2W4DA 3LGNA 1YJVA 2CRLA 2HLUA 2K2PA 5B0BA 4QOTA 1X0PA 1N5SA 1S6UA 1Q53A 1TL5A 1URRA 3TRGA 1Q8BA 2HFNA 4ZA1A 4F67A 3VTIA 4NL5A 2OP5A 4Y2MA 3GZ7A 1OQ3A 1AFIA 2RU9A 3BGUA 2OKQA 3KG1A 1QUPA 3BDEA 3T9NA 5F0WA 3HHLA 2W4CA 4HH0A 1IUJA 4HI2A 3TOQA 1CPZA 2GGPA 1AFJA 1Q4RA 1KVIA 2RMLA 4A47A 1TUVA 3IWLA 5B08A 1OSDA 3F44A 1GXUA 3QGPA 2K7JA 5F0UA 2GGPB 1R6YA 1P6TA 2VV5A 4A4JA 5A6PA 2XMWA 2OD4A 1FVQA 2K1RA 2XMTA 2N4DA 3KNGA 3MZIA 4Y2KA 1YJTA 3BR8A 4OJGA 2K7KA 5K9FA 2BJDA 2AJ1A 1K0VA 2XMMA 1SQEA 2OMOA 2VH7A 2ZDPA 2K1RB 5B09A 2AP6A 2ZDOA 2LQ9A 2ROPA 2PD1A 3BB5A 2EW9A 2G9OA 2XMKA 5B0FA 2QLXA 3HFKA 5B0DA 4OIXA 5A6WA 3HHLD 1XBWA 4NPOA 3KKFA 5B0GA 1JWWA 4HL9A 1OPZA 3QMQA 2QYCA 4Q2LA 2N7YA 2GCFA 2HFOA 2QLWA 4OJ1A 3TNVA 1CC8A 1FD8A 5B0CA 4HH1A 2IFXA 1U7LA 2AJ0A 1N5QA 1X7VA 3BF4A 3FMBA 2ROGA 5KAKA 2L3MA 2XMUA 1S6OA 2XMJA 3KG0A 1Y3JA 2RSQA 2BJEA 2FHMA 4OJ3A 1SB6A 1Y0HA 2KYZA 4ZOSA 2N4CA 2AW0A 1GXTA 1FESA 1FE0A 1N5TA 2KT3A 4DN9A 4HI1A 2GA7A 2Q3PA 2ROEA 1ULRA 1VQYA 2FTRA 2KKHA 2LXFA 4Q2MA 2ASYA 1AW0A 1MWYA 2BUNA 3UDCA 1OQ6A 1TL4A 2OFGX 3LO3A 2OAUA 1CC7A 2LQBA 3E8OA 2GV1A 2OD6A 1Y3KA 2XMVA 4EFAC 2GO8A 1V3ZA 2HQIA 1YJUA 1KVJA 3HX9A 1P8GA 1SI9A 4FNIA 1KQKA 5B0EA 1FEEA 1YRXA 2GFFA 1TR0A
chains in the Genus database with same CATH superfamily
4FN5A 1SC1B 1V3RA 2W9AA 2XSJA 2IYIA 4B02A 3P5BP 4ZLPA 2B4VA 1ZZNA 3MM9A 1BWVA 1YJRA 4PABA 1DHMA 5E7OB 3GG0A 2K3IA 1Q16B 2RQKA 3QT7A 5J2PA 4CWBA 1DQ8A 1IKXB 1RAOA 3EVWA 2J7KA 5C7PA 2ZKUA 2HHPA 3RBEA 4OYZA 3M9OB 1X5TA 2R7OA 1DQAA 2MJNA 2FC9A 4LF9F 2DH7A 2U2FA 1TMMA 1HD0A 4M5DB 3C14B 2XY6A 4CH1A 2GZOA 4RNOA 1PILA 3ET6A 4LFAF 3JTOA 2LCWA 1C4AA 2IA6A 1CQMA 4RW6B 1S6QA 2RF2A 2HVIA 2UXDF 2JDJA 1XMOJ 4DLGA 3V6KA 3TVKA 1U48A 4RUBA 1R27B 3HSGA 2AJFE 1B0TA 5A8RA 2V69A 4K4WA 3FRYA 3FNNA 1I3OB 2CJ9A 4R5PB 4DU7A 4O23A 3ETOA 2IIHA 3Q22A 4YS2A 4MIAA 2HK3A 3GG1A 4ES3A 3CD7A 5C2GA 3H90A 3I55S 3OSPA 4TLQA 1T7PA 4NOHA 3JS9A 1JLEA 3O1LA 3MEDA 2ATCB 1UVJA 3G8QA 3Q24A 1NHUA 2XMMA 5KFQA 1REVB 4UZBA 2C42A 1T3NA 1JWWA 2JWNA 1FRJA 1FERA 2DR6A 2RSQA 5L1LA 2MY7A 3ADAC 1VIOA 1D3WA 1NAQA 4JI1J 4QJVA 2BDPA 2IM1A 4PQUA 7FDRA 4OLOA 3RW7A 2CKWA 3PEJA 2NREA 4IQXA 4QIWD 4UF4A 4RW4B 4ZP7A 4YB5A 1UAWA 5HROB 3UN5A 3RB4A 5A8KA 4JP8A 2MQPA 4DPOA 2CA9A 1YHQS 4NCAA 1MN9A 1WF1A 1TFYA 4ECYA 1HQEB 4ELTA 4QU6A 5CYQA 5E3CA 2QA4G 1RWNB 3FBBA 4NL5A 4ZLNA 1Y5IB 3G82B 2J8SA 3HHLA 2JEJA 4CLTA 5FLXY 1X5SA 4HKQA 4S0MA 2HWHA 1SQEA 1YWXA 1SIWB 3PRVA 3PM9A 4X4QA 1KKHA 5J2MA 1U0HA 2CFXA 5HQLA 1TP7A 4LMZA 1IQZA 2C3UA 3PYEA 1AUSL 2J9DA 4RNNA 2FHJA 2CPDA 1N32F 1F9FA 1HNIA 2LXFA 2NXCA 3TJ8A 3ZZRA 2HHUA 1ZH5A 3V81A 3KJVA 3GV8B 2XS7A 2BKPA 3JB9k 4F0HA 1KS2A 4YDDB 4B9TA 1RJJA 4H4OB 1WD6A 4JBCA 1NDLA 4USVA 2UXCF 4N56A 2X1FA 4OYXA 2VPXB 3I5AA 3CJ2A 5DM6Q 3M8YA 5HJXA 4IG0B 1FFSB 1HHTP 1FT8A 3SYZA 3GYGA 3PIOQ 4C8KA 2QL9B 4K5SA 4ID5A 3D3BJ 4PWWA 3K58A 9ATCB 1MW7A 1HNXJ 1RCOB 3KTQA 4QIVA 4OX8A 3B4MA 1FNMA 2IY5B 4DCPB 2MDAA 4DR4J 4LR9A 3OV7A 3EM1A 2DO0A 4PWUA 2W7OA 2RRAA 4CDIA 4MAKA 1J27A 4B3RF 4K2JA 3QRRA 2YKMB 2VFUA 2VG6B 3FQKA 4RWWA 3T5LA 2NUHA 3DHXA 3I96A 4Q0BA 1QY7A 3HCXA 4RUHA 5CZXA 4FYVB 4KQZA 4WZQA 1R89A 2WRMA 2RKIB 5AXKA 2YNGA 4DPUA 2V50A 2DXFA 1V3ZA 2I5JB 3OLAA 1XR5A 2HQ3A 1YJ9S 5EUHA 1YRXA 1WELA 2IRXA 3O8WA 4CO4A 3DLHA 2YNFB 4FNHA 3V6DB 4K0KF 1SV5B 2NXUA 1N5SA 3T41A 3G8TA 3TVZA 4DPXA 1Z2LA 1NK8A 3G4SS 4GKJJ 1IUJA 1VGYA 5IWAJ 2XQCA 2UU9J 3C8YA 5ETPA 3IA0A 3M8QB 1UKUA 4HHUA 2OPRA 3M2VA 2ZJPQ 3C16B 3I4PA 5D15A 4QPTA 4WXOA 1FX4A 2NYHA 3PW4A 3M30A 3TEHB 3WX4A 3W64A 5F9NA 1HWIA 1OPZA 5A2QU 2LMIA 8ATCB 4RBVA 3J7ZT 1Y3JA 2JEIA 2EXUA 4I2PB 3HHNB 4JI3F 4HACA 4CYUA 2R7TA 1TVRA 2OEKA 1S72S 1EZZB 3LALA 3RRKA 3NWRA 4Y3CA 2E1RA 3DDKA 4U96A 1RT5A 5EWFA 3NKYA 3Q2TC 2O66A 4R8UB 4ECUA 2RHQB 5E2QA 2Q66A 5HO4A 4YN3B 5ETRA 1LQ9A 3KK1B 3HFZB 2B7CB 2CJXB 4C4WA 1X5OA 3K5NA 1LWEA 4P2XA 3VGVA 1KQSR 4QYZJ 2YPYA 2EKNA 5THWA 5DDOC 1QTNB 4JI6J 2ZOMA 2EFQA 1NKCA 5AXLA 1I51B 1S6PB 3IG1A 2AEJA 1RHJB 2AGPA 1RSCA 2E29A 2ZD1B 4KHRA 3VGSA 2IAJA 4X66J 4DBQA 4Q2LA 1F1BB 2F4FA 2GW8A 2XYGB 4E8UA 2XSFA 3KDNA 1UMJA 1Y0HA 2GX8A 4F36A 2DNKA 1RDRA 1VQYA 4XO0A 4X4OA 2ZJQQ 2QRRA 4ED0A 1HI1A 1LXNA 1KDNA 1XR6A 4Y28C 3E2EA 3EGZA 2LP4A 3L7OA 3L3CA 3RB0A 2K8GA 3BM7A 3MM6B 5KFLA 2AGOA 4LBPA 5HMYA 5IZHA 2PO4A 1SC3B 3VAHA 3BR9A 2BOAA 3GCXP 2HMIA 1WEZA 5J1EA 1IBCB 2CRLA 3J7YI 4V19X 2ZH6A 4MIBA 4JV1A 5ETVA 3PX0A 3M8ZA 3PHTA 3BS9A 3C6TB 1S0NA 1QVFR 1U6FA 3O3LA 2HVDA 3R2DJ 2DGUA 1RQ0A 4K4SA 4JI5J 2PFFB 4A4JA 5J2NB 1VBXA 2JSXA 1SXLA 2EC0A 3TX8A 1ZETA 4B3MF 4A8KA 2LQ8A 1ROFA 2HNZB 4KO0A 1HA1A 2HHQA 2HVZA 4DN0A 5DG7A 3FQLA 2DEIA 2N3OA 3DI6A 1M1KT 2QTWA 3FFIB 1DFDA 3KUEA 1Z2ZA 2Y8WA 3MEGA 2WONB 4IO9Q 1YDLA 3IS9A 4F04B 2RDJA 3V6JA 3IWNC 2P9EA 2BYCA 2W8KA 4CM2A 4DV3J 2Y8YA 2C22A 4DX6A 3CC2S 4J9RA 5JUMA 3PV8A 1GFWB 4JI0F 1CJVB 3MTKA 4C0HA 2A10A 3ILOA 4FF3A 1HR0F 1X31C 1XQIA 5F8IA 4ZVQB 3ELHA 3KLVA 2CQBA 2C3MA 4JI4J 4JI8F 1WI8A 4MK8A 3GV5B 2B5JB 2C3PA 3F44A 1G4CA 1MU2B 3MPWA 2J0WA 3I56S 4LSLA 4ELVA 5FJ4A 1NDPA 4RW7A 2AEMA 4DS5A 2DNPA 4IR9A 4UT4A 4J9PA 2IBKA 1WG1A 1MMNA 2DEJA 3MUTP 1WTBA 4H4KC 4OX7A 4H4MB 2CJKA 2XS5A 1ZTTA 2F4VF 4NMLA 3K8WA 3W61A 1U47A 4C97A 1WOSA 3JAMY 4ECTA 4WBFA 4Y34A 1F3VA 5D4PA 2QMWA 3SZ2A 1RT2B 1JLFA 3I87A 2LLZA 1PCAA 3HMJG 5I42B 4UUXA 1RTDA 3FSIA 2CZ4A 2D69A 2Y1JA 4Y65A 1VBZA 2DY1A 1G6BA 3TUZC 2VBWA 5K8NA 4QWDA 2E5IA 2Z8QA 5D3GA 3K2YA 3R7NB 1ITPA 1N5VA 4CO3A 3AXMA 4IFVA 3PX4A 4OHVA 4PAAA 3MPVA 5E3RA 3HDSA 4LRAA 2W25A 2EG2A 3KFWX 2MQ8A 1TKXA 2XYPB 3OXLA 1RT4B 1KRPA 4O3QA 1QAIA 2ZUAA 3M1VB 3K59A 1R0BG 1GMVA 2KB2A 3M2RB 1KNZA 3T6BA 3CCMS 2MZ1A 2G2ZA 3W2VA 4QWBA 1XTZA 3KK3A 3H2UB 4ZP6A 2F1FA 1WHXA 3KMQA 2DPJA 3DXBA 1FKOB 4WK1A 3TA2A 1QDUB 4N7TA 3H59A 3DOLA 3W65A 1FJEB 4LIRA 1TAQA 1S97A 3FEZA 3TA0A 3KLEB 4AXJA 3IMQJ 2POKA 2VFRA 3EVOA 2BE2A 1YRTA 2CWKA 4NCBA 4DV6J 5BYQA 2ALYB 3UR3C 4L76A 3HHLB 2P2CB 2PC6A 1F3FA 4A8SA 1YG0A 3DLKB 5IC6B 5LJ5Y 2IVMA 4ZLJA 2G1HA 3V4IB 3C66A 2LDYA 2V8VA 1FRHA 3D68A 2FJVA 4UY8T 2RU3A 1HYSB 1WJ9A 2DNRA 3W9IA 3P49B 2YWHA 3BZQA 2MXYA 3MR2A 3KNGA 3MMAA 2BX6A 3V6HA 1TL3A 2P9GA 3M7VA 4FBUA 1U1PA 1EKSA 2HFOA 2IRUA 3KJVB 3R1LA 4WWSA 2UUCF 3ZXWA 4AE5A 2AYEA 1FNOA 3QFWA 1HNZF 1MN7A 1WDDA 1TL4A 3ENWA 3QBCA 1Q7LB 1WG5A 4USUA 5ADZA 3A13A 2C2EA 3GFYA 4DCJB 4KRWA 1JLQA 2HFVA 2ASLA 4X64J 1FVSA 4DR3F 4MKVA 2QLFB 4U8VA 3M6VA 4DFKA 1S1VA 2PEHA 3OBIA 1TL1A 3LP1B 2CG8A 1K1SA 2UUBF 2BBEA 1KLMB 2HFUA 1YJVA 3P4UB 3MMCB 4RL1A 1B99A 3OFHA 4MKYA 4QR2A 3LQVA 2DYAA 4TKTA 3OR2B 3RB6A 1C1CB 3HHEA 3L7UA 2FPHX 4LF4J 3CE8A 4WK3A 1P9QC 2HKEA 4LRCA 1SC6A 2YKPA 5MAOA 4DR1F 2OHDA 1YJTA 3I82A 1N33J 4V19J 4TY8A 5E3PA 2OJ3A 2PD1A 1NK6A 4NYZA 4HT5A 3H0PA 1R7IA 2QV6A 3DRRB 1LKZA 2R8KA 4USIA 5LXRA 3FBCA 1JXLA 3THPA 1OIAA 4KHPF 2JVRA 1BQMB 4AQYF 4FYYB 3UDCA 3BPDA 4NLSA 1KFSA 3SFUA 4NX9A 3HT0A 3QIPB 1Q5VA 2MLYA 5H9EK 2MZTA 5B0EA 1JXVA 1N88A 1PBUA 2FUG9 4NRUA 1L3KA 5KT6A 3TWZA 3H5UA 3TANA 4B3TF 3NNHA 3ILJA 4I7FA 4LSNB 2R2RA 3VCDA 4JI7F 3GCWP 2BKOA 2RUSA 4OYIA 2VF3A 3THTA 5L9NA 5EHHA 1F2HA 3BYRA 3WQPA 1PO6A 1QUPA 4NLWA 1Y7PA 3EDRB 3ONQA 5J1PA 3H5SA 1FVQA 3G9CA 3GR0A 2Z2LA 2RRBA 1CBKA 5DJBA 3ZZOA 2YWWA 4HACB 1VOMA 2WAQD 1M5VC 3HSZA 1RT1A 4OZJA 2ZH5A 4UOCA 4CYUB 2V8HA 3TAMA 1TVRB 1E6YB 3LF0A 1UWAA 4ZHRB 2WSCC 4X62F 2GJFA 3GFHA 4DV1J 4A8OA 4FXWA 3LO3A 4XTTA 1B7YB 4L72B 1NK7A 4P52A 1EKRA 1SI9A 1JQGA 1JNZB 1K0TA 3MPUB 3LH2S 1I6JA 1AZSA 1H6KX 1RBOB 2PGCA 2BE9B 1HNWF 3P5TL 1OWXA 5IT4A 2J6TA 1M5PC 2HIQA 1N0VC 4EBCA 4LBHA 1Y5LB 4P2SA 1H7XA 1T03A 2UVVA 1X4EA 3C19A 1MWQA 3GZ7A 5L1IA 1NEEA 3TW0A 2B6AA 4NLUA 3RG6A 4UOHA 2HZVA 1ZYQA 5KFBA 2RH3A 4A8YA 1BD6A 4DPWA 2RE1A 1VCTA 4OV6A 4NLRA 2OPSB 1RKIA 3PY8A 3TVYA 3S8SA 3FEYB 1NK9A 1FEHA 1Q82T 1N34F 2XY5A 5KFRA 5ETKA 2G2OA 2GAGC 2QLBB 3AJ1A 3DOKA 2PDAA 2R8JA 4OYMA 1SPBP 1NPRA 2XZTB 2B7BB 1XNQF 2HMIB 5LL6d 8AT1B 3TUIC 2VB6A 1HBNB 4FYWB 3MUVP 1T9YA 3KOAA 3LPYA 2OI2A 2W9BA 2LXIA 1S1UB 3R7BB 2XM3A 3G6XA 2KN4A 1OJ4A 4DV5J 3SDEB 3VAGA 2K06A 4LFCJ 4UOGA 2V2VA 2XZWA 2C2OB 2RNEA 4KO0B 5A6PA 3HT3A 3UO0A 2MLZA 3PRBA 4OJGA 1NKBA 2QFIA 2MQOA 3ZZPA 2YKAA 3BGRA 1FRLA 5KG6A 5KFFA 4OYPA 4DFMA 4OYAA 2R7SA 3I0RB 3ZO7A 3NRBA 4ENOA 3KJNB 4LF8F 2BVZA 1JJ2R 4A8XA 4MFBA 3D6FB 1JXEA 3N6NA 1OYEA 1WKJA 4R0JA 3PW2A 3MXHP 3QATA 1OSCA 3S6EA 5JVHQ 2GVZB 3D6MB 2QGFB 1Y9OA 3O44A 1D8YA 2C3OA 4J9VA 3FK4A 3BKUA 3FGVA 3MD3A 4RU2A 1XMQF 5KFAA 2RILA 3PFOA 3LGNA 4OV1A 1LW2B 1EQ0A 1RTHB 2FGCA 1TL5A 4AT1B 1C1BB 3VTIA 3SEOA 1SC4B 1BY9A 5SZTA 1T0TV 2YWFA 1PYOB 3VQTA 5KFIA 1OSDA 4U7UD 3VR1A 4RR5A 1BUXA 3ISZA 4PG7A 3OR1B 3EX7B 3NL0A 5KFTA 2R4FA 3IR5B 4MTPA 1WACA 4NPOA 4ID8A 1UW9A 2DO4A 4ZIWA 3TZWA 1IKYB 5GAHU 1CS4B 1S59A 1R0CB 3FBEA 2FHMA 3SXLA 1IQTA 1Z1ZA 2OPPA 1A0OB 2VFSA 2VBYA 2W7PA 3R3TA 4CLUA 3JSBA 1MSWD 2ZKTA 5T14A 1VHFA 3D0HE 3AH6A 1SIZA 1CJUA 5A2QY 3T5JA 4W98A 2MHNA 4ZITA 1GAOA 3CCES 2QFJA 3CCVS 5HVGA 1JMTA 2KM8B 4DQPA 5GMKa 2OFHX 2D3OR 3SSRA 3ULHA 5KFVA 1HLWA 3GJSB 4B9UA 1Q8BA 3W2VB 3MM7B 5GAGI 3CO9A 1VR6A 3J7A1 2ZBRA 4JI2F 1NXIA 4RKUC 1S79A 1F6TA 2J5AA 4F7VA 4ZVRB 2QSFA 1RAEB 2CPYA 1BLUA 3DOLB 2YKNA 3I4HX 4L3KA 3ENAA 1GXTA 4CO1A 4HI1A 2GIQA 1MWYA 3C6UA 1L5UA 2VPYB 1XC9A 3A3NB 3AD7C 5DLGA 2MQNA 3TJ9A 1LWFB 1FDAA 4C11A 1UJ4A 4IR1A 2HBRB 2WSEC 5F8LA 4ZPVR 1FA0A 2DHAA 2VOPA 3D9BA 1NJWA 3NGKA 3F0NA 3JSMB 3VHQA 1C0TB 4OHWA 3AAWB 4PYDA 3OTOJ 1H0HB 3DRSB 2J8AA 4ZJQA 3CW2C 2Q6CA 1KN6A 2OUGA 4ED4A 2ZH4A 3AHPA 3DGPB 1Y11A 1ZS6A 5HL7Q 2F9JA 1M0SA 1J5EJ 5F3TA 1RT3B 3T19A 4PUOA 1JLAB 2GGPB 3EDQB 3CGIA 1S4FA 3CF5Q 4K4VA 2DD8S 3ZTOA 1ZTWA 2DR5A 2E7VA 3A8IA 3HJVA 2KYZA 4QR0A 3FJ2A 3P96A 2ZHAA 4WP8A 1AYEA 5HN0A 3H20A 1KSPA 2MKCA 1S57A 3PNIA 2UXBF 2MGZB 2SXLA 5D6GA 2DJWA 4P9SA 2OSQA 4O44B 2NLWA 4XPEA 2R9LA 3AFGA 2WVBA 2CQ4A 2VG7B 1XNRJ 3M8PA 2YXLA 1RHQB 1TR0A 2DGSA 3N01A 2LQJA 2OPQB 2U1AA 3I9ZA 3CJKA 5LSRA 4O4GA 2JLFA 2CQDA 2JZ5A 4ANEA 1JX4A 3EJMA 3RUBL 3LAMA 2CQ0A 2HHWA 4WPAA 2CIMA 3DCAA 5DO2A 4CO0A 5D0RA 3TP2A 2YWGA 1UWBA 3CCZA 4CIOA 2QO3A 4UUWA 1TMJA 3KG1A 3HK2A 4L3NA 1HPZB 2KXHA 2L41A 2NUUG 3MAAB 4WP9A 3DRPA 5HP1A 3PZPA 5AXMA 4FS1A 1QE1B 4OX9J 3LUYA 4Q8FA 4FP9A 4YR3A 4KAIA 1TK8A 1RWUA 1DLOA 3J80U 1NZAA 3OL7A 1RA7A 4OJ3A 3M9NB 4NLXA 2D7SA 3ZC4A 4KC5A 4DV2F 4LF1A 4B9NA 1S12A 1YITS 1SUQB 3LA0A 2V0NA 5E41A 2BJ9A 5IC4B 4I56A 2JL9A 2XULA 5K8PA 4LF7J 4QYRA 2LQ5A 4OHXA 2GVDB 2EBEA 2DHHA 4RBUA 2ATLA 2VC0A 2ZFHA 1NPPA 1V9OA 1FK9A 4KKOA 5AE2A 3DKDA 4DHVA 3U7JA 3ZTPA 2M4MA 4ES1A 3ZFVA 2MKJA 1AFJA 4NMXA 1PJ7A 1RT1B 1RT6B 1JLGA 1NH8A 5DDQC 2RAQA 2BXJA 5EX3A 1QD1A 4JB8B 2CZ9A 3OUYB 5LMUF 3GP9A 1D9FA 3CCTA 4AXIA 2C2RA 2XBPA 1XEZA 5IT0A 3UVJB 1AZSB 1H38A 1ZOTA 5LSLA 1FX2A 2MYFA 3UCZP 3NCRA 3E01A 4KGMA 3K5LA 2QE5A 1UEKA 1UETA 4KY3A 3UD4P 4NEZA 1TKTB 4EO8A 2UUTA 4O3RA 3DU5A 2KT5A 4G1IA 3R5AA 2MTLA 2H9ZA 3G8SA 2FVQA 5CYMA 1EP4A 3ZZTA 3TRGA 1YZ7A 5HAOA 2XCPA 2PFDA 4BLGA 1O5JA 4WTOB 1JNRB 1SKUB 2ZITA 3FC9A 2CUYA 1LFWA 4XK8C 1KFDA 3OTDA 2BANA 4NWBA 1LXJA 2QG9B 1JJHA 3V5RA 3CULA 1N36F 4ZKAA 5G0RB 1S1TA 3EZUA 4DPTA 4DV5F 2YY3A 3DMJB 2JRSA 1FJGF 1H2UX 2AKWB 2KTQA 1U1NA 5CD4A 5E33A 4D3GA 2ZUGA 4GKKJ 2A1BA 1VRTA 1A6LA 4A48A 3HF5A 4QYZK 3IN5A 4OZ5A 2VJUA 1JJ4A 2DGXA 3FBFA 1KOOA 1BHNA 1Q0NA 1AXQA 4OHYA 4C6AA 1GMWA 1U2FA 1XJWB 3UW1A 1E6VB 4J9QA 4O3OA 3D28A 2HFNA 4DPYA 1X4GA 3BGUA 1KP6A 2XCAA 2VKZG 1IKXA 4QW9A 1U2CA 1KOHA 4X4NA 1HQ2A 3CNQP 2MKYA 1TKDA 4ZMMA 3MMJA 5IV3A 3EGWB 5DQGA 2V94A 3OTEA 4ED2A 2W2OP 3AQPA 3BEGB 3IAM9 2W9CA 2VHGA 2FLNA 2OSRA 4DQRA 3MGJA 4M5DA 4PCQA 1DRZA 1NLKL 2PT0A 1S7IA 4J7CA 1I5OB 5LJ3Y 3KXDA 3IR6B 3FCVA 4ECSA 3NGDA 2QA4S 1A7GE 3TQEA 2LKZA 1QSSA 4RW6A 2QN6B 5KG7A 5H9FJ 3IFEA 1LK7A 4NLPA 3L9ZA 2CPFA 2UVUA 4AL6A 2ASDA 3K89A 2HHHF 1RA6A 2MQMA 2EFGA 2ASJA 3BBBA 4L74A 5JVGQ 5HMZA 4R5PA 5CHCB 3HI9A 4DUYF 2ZVSA 5AE3A 1UW4A 5KFDA 3R97A 1HBUB 2XWXA 2DRBA 1HHSA 3NCQA 2AZ3A 1L3UA 4NZ0A 4Z7YA 2J7WA 4YUDA 4ZA1A 4LF6F 2LFVA 1FDNA 2GQQA 1O6XA 2B43A 5KFHA 5CH7B 1SH0A 2BKNA 1UVIA 5M2PA 2FZGB 3OLBA 5ETTA 3JYTA 1IJFB 1Q8KA 5BR8J 1REVA 2XLKA 3TZZA 4DX7A 4DL3A 4BC7A 4X65F 1F60B 2PA8D 3CTRA 4CZCA 3CCSS 4HHJA 4J9SA 4F4ZA 3KWMA 5KG2A 2R7VA 2L9NA 4YY3J 5KG4A 2RIJA 4RW4A 1HQUB 4G1QB 5HROA 4QWAA 4K59A 1UTAA 1FKPB 2VQEJ 3DXSX 3A8JA 1MWZA 1LOUA 4DLEA 1F5BA 2KFZA 1HQEA 2I9SA 1U6BA 4CQ1A 1EIYB 3U1LA 2DKOB 3G82A 4ZCLA 1HHQA 1U45A 3LTOA 3J7Z5 4HH0A 1RLDA 4DL4A 2FHKA 2EFVA 2AQ4A 5ETNA 2N4DA 1WHWA 3VF0B 2AYMA 1K8AT 4LF5J 4OIXA 1RHUB 4L73A 2GCFA 5RUBA 3QRPA 3KLHB 2HWTA 2V8PA 4U6PA 1RTJB 3DLJA 2HVHA 5F8NA 4C11B 1VI7A 3N6LA 4CRJA 2V9KA 2A0FB 4NASA 1VQ6S 3DRXA 3LP0B 1YJNS 4URQU 1RT7B 4X4RA 3BSNA 4K4ZA 2KJVA 4WKRA 4H4OA 1VLYA 2DCUB 3ENVA 2F8EX 3CDBA 2DNZA 5D4LA 1VRUB 3NOGA 3WDOA 4IG0A 3OPKA 3QRQA 2IDEA 4BWJA 4CLFA 5KT5A 3QJLA 1KVKA 1BC6A 2DGVA 2OO4A 2RS2A 2VU5A 3GILA 4ED6A 4HTIA 2ZM6F 1H73A 1R8BA 3FVYA 3ZZUA 1T9VA 2XNRA 2I38A 2DNGA 3BREA 2J6SA 1FDBA 2E5LF 3HHKA 1IBKF 5B0GA 2YKMA 2EC2A 2VG6A 2E44A 1NK4A 4UTGA 4C9DA 1VJWA 1WHVA 3WC2A 4IDKB 1O51A 2HAFA 2RKIA 1VQLS 2EFPA 5JXSA 1BMQB 3RBDA 2I5JA 2ZEJA 3QSIA 3MM5B 1T9UA 4K4UA 4ZLLA 4AL7A 1IR2A 2P6TA 2YNFA 4DCOB 2Y1RI 4LVNP 5L9XA 3VZIA 1BE4A 5HQMA 1B7FA 3CCRS 3V6DA 5HLFA 1SV5A 1P9YA 2D74B 4YHHJ 1T11A 4M5IA 3C15B 2OELA 5KFPA 1I1GA 4B17A 3EPIA 5IOLA 2OMLA 5L46A 3OFFA 5C24A 2Z56B 2ZC3A 4PRFA 3M8QA 4HYKA 4NXNF 3RRHA 3QLHB 2PEBA 1NH7A 4KFBB 1QAJA 2WK4A 4RPFA 3Q8RB 2ZZNA 1JJCB 1LK5A 3SFGA 5K9FA 2KYXA 2VH7A 3OQ2A 3TZYA 4IRDA 1RWXB 3RAQA 2EFOA 1S10A 3AB2B 4JYAJ 1YK9A 3ISNC 2QYCA 4DUZF 4F4YA 1N5QA 3PJ9A 4I2PA 4P74A 3LWMA 3QIDA 2E5HA 1TK0A 2ZC4A 3A3OB 2HNYB 2EWHA 2KZMA 2DNOA 2DPIA 2BJ1A 3ETMA 4R8UA 4DSLA 2ZBQA 1OO0B 2ZZTA 3KK1A 4A8QA 1X5PA 1HL6A 3TR5A 3LOUA 3TUPA 4DL0C 3CJQA 2BR0A 2GHVC 4K7QA 2N7CA 1NK0A 1S1WB 1YIJS 2CG4A 4R0EA 2FQQB 2AF6A 4ED8A 3H40A 5BYRA 3PHEA 2V8GA 2YNHB 2CQCA 1XN9A 4DV7F 4PXDA 1X9SA 1S6PA 3R5DA 2WHOA 1DTTB 3F73A 2DTJA 2QEXS 5HVHA 2ZD1A 2BJDA 1O0PA 2OMOA 5HI7A 2YNIB 3ICLA 3RBXA 2XO6A 4DR6J 3UD5A 2WW8A 2I8EA 4UQTA 1BXNA 4QIEA 2V2ZA 4DR7J 4FVMA 2H65B 1ZAXA 3SIPB 4LVOP 1YI2S 4FNIA 2CPHA 3MM6A 3G87A 4Y2IA 1MMDA 3MEKA 4O4RA 3SBMA 1Q81T 4I2QB 4IRCA 3CCUS 2VKRA 5B7WA 2W2NP 1U26A 3CCLS 2G0CA 2FZKB 4HDGA 2RVJA 4JV5F 3KUHA 2C2KB 3N6MA 4TN2A 6FD1A 1R0AB 3ILLA 3C6TA 5DS7A 3TA1A 1YKWA 1Q95G 2B51A 2HRUA 2NXEA 5J2NA 4DV4F 2D3ZA 3CUNA 4XPCA 2E66A 2KU7A 3R6GB 2DT9A 1UJ5A 4USHA 1KTVA 2HNZA 1CULB 1UEVA 3RW6A 2VQFF 5D77A 1R8AA 4FXVA 3CDAA 1X7VA 4J9UE 5A8WB 1HBOB 2BJEA 3WIVA 2IJNA 3BYPA 2AW0A 3FFIA 2NXJA 2G4BA 5GAEU 1HIYA 2HS3A 2QC3A 2WONA 1VRTB 3MTJA 4OZNA 1TKZB 3IR7B 1Q1KA 4ZCKA 3T1YJ 3CT9A 3KLIB 2Y0SD 2X7IA 4UY85 2EG1A 4YDXA 3WX8A 1CJVA 1G1XA 3BBFA 2HFSA 3CMAS 4ZPAA 4L6V3 2J9CA 2VONA 4B08A 3EE3A 3MECB 3PFEA 3IP0A 2B5JA 4EYIB 2W9CB 1T8EA 2L9WA 1MU2A 3FZBA 3QZ8A 1WG4A 1D8ZA 2FJAB 1HI8A 2I6WA 1NM2A 3KDOA 3RZAA 4DU8A 4M5JA 2DR8A 2HQFA 3PJXA 2GMLA 3BKFA 5A6WA 4IRKA 4EI2A 3RGIA 4H4MA 2IMOA 1VHIA 3AA8A 4DG1B 3Q23A 3GB0A 1FESA 4ECXA 2NPIA 1RT2A 5CABA 5I42A 4XDCA 2V5HG 4CP5A 1ELOA 1IKWB 3NS6A 1KONA 3CO0P 2XHCA 4O3SA 3MWBA 2AYBA 2F63A 2GQCA 4DV0J 2F9DA 4ZPTR 4ITSA 3J80Y 2Y1IA 5CZVA 4YB6A 4K5RA 3TAPA 2UUAJ 4AL5A 4IOAQ 3LWLA 2HLTA 3POTB 3OSNA 5CXTA 1ZM9A 4A8FA 1X4BA 4I64A 1KTQA 4IUFA 3OVSA 2J6UA 4FYDA 1RT4A 1GXLA 3WHIA 4RW8B 3PR4A 1Q79A 2RDDA 3AD8C 6AT1B 3JYTB 5HK4A 3M1VA 2F5GA 2FJEB 2RJZA 1GMUA 1Q7YT 3M2RA 2ILZA 2WVFA 2DXEA 3IM8A 1VQMS 3B54A 3OFGA 1R6VA 2HBZB 3KUGA 1VQNS 4LFBF 1KHVA 1RWWB 1T95A 5A76A 2LU2A 4TYBA 1SKWA 3HFKA 1MLAA 1BQNB 4NXMJ 2LYVA 1Y00A 2AJ0A 1FKOA 3KG0A 4RNMA 2HGLA 4PG4A 2COLA 2Z2MA 3RYLA 2CQIA 3UDVA 3H2LA 3KLEA 2V67A 1M5OC 2J9EA 4PR6A 4DL5A 5KTQA 5K14B 2FB0A 3TUJC 4DDFA 3BH6B 3VAKA 3ZTQA 1T9WA 5AJ3J 3DLKA 1EARA 3I5CA 2QIFA 2P9CA 3V4IA 4NZ7A 4PEOA 3CJ0A 2RRNA 3A12A 1Q5YA 2DGOA 2XLJA 4CO2A 1LV5A 1HYSA 1FTCA 3HVTB 4NZ6A 4Q45A 3QJJA 2XMWA 4F2RA 2WZ1A 3QWUA 1IKVB 2DHSA 4EEYA 2G9OA 1U1MA 2AJ4A 3TNVA 3HULA 4MKAA 3J7AN 2ZNYA 3PW7A 3PO5A 4E98A 4ZPWR 3TYTA 1M5SA 5IM0B 2ZE2B 1B64A 2IM3A 4F2SA 1NHVA 4DOZA 2RT3A 5LMNJ 2B9EA 4DR2J 2YQ1A 4U8YA 3CIMA 4BS2A 2VA2A 2R3VA 3H42A 1QVGR 4ZJLA 3I0SB 4LSZB 1FJ7A 1RTIB 3LP1A 1NJZA 1UFKA 3L7PA 1KLMA 4WFNQ 2AMCB 3MMCA 2ZWPA 1UP1A 2HGMA 2W8LA 1PSDA 3OR2A 1C1CA 3MMBB 4F67A 3VVUA 2RU9A 4AUKA 3C46A 4ZVPB 1PIEA 3IO1A 2YQ0A 5DLFA 2KFYA 3ZTSA 2NZ4A 1YGYA 4OI6A 3DRRA 1FCAA 4C0OC 2Z4PA 4Y6IA 2FYXA 1RU2A 3AODA 3D66A 1BQMA 4DR5F 2FVCA 3QIPA 2XB2D 1HWJA 2KVQE 1WC0A 1T05B 4KSEB 2HNDB 2PA3A 1YQHA 1VBKA 2VG5B 2FGOA 1DTQB 5HLFB 3D2WA 4ILRA 3AOAA 2XY7A 5E0OA 2CQPA 1BWEA 3RAXA 2O5DA 3PXGa 4LSNA 1WSVA 5C24B 2NQPA 3CJ8A 4K4YA 2DNQA 3NWGA 4LRBA 4LF9J 1RHRB 3Q0AA 2JLEA 2NSBA 4OQJA 3PO4A 1S9GB 2XG8A 4FF4A 3EPGA 5KFEA 1NNDA 5F8GA 4LFAJ 1KEKA 5AXNA 1R6YA 2VV5A 3MZIA 3I31A 3T1HF 3OVAA 2UXDJ 2HW3A 2BW7A 5AT1B 4G65A 5IFMA 2I0XA 1E6YA 4ZHRA 3S7RA 3J81U 9RUBA 4MK9A 3OL8A 2G0IA 1D09B 1IM6A 4ZJOA 4RNFA 4EU0A 1U09A 3DOMB 4OX6A 3L4BC 1S77D 1HMVB 3FKBA 1VDHA 2MKKA 3JSYA 2AT1B 3FRZA 4HR2A 1I94F 1SL0A 4NLYA 2R8GA 2HS4A 2DIVA 4DJBA 1IWGA 2YWEA 1VC6A 2ZBCA 2BQRA 2KH9A 4WYWA 1ACMB 5KFYA 1RWOB 3ISND 2YX4A 1WF2A 4EZ6A 4NA1A 4NCGB 3GYXB 2R2SA 4JV0A 2HS0A 3H4DA 2UVWA 4ECZA 1X60A 2JEFA 3K0JA 4DFJA 1IBMF 3T3FA 2FJDB 1CEZA 4P10A 5SUHA 2OPSA 2K1RB 4P2MA 4N76A 1GTHA 4OJ1A 3HP6A 3W62A 3UI3A 3BGOP 3R5BA 3BSOA 3H5XA 4M1KA 4DX5A 3PIPQ 2KL8A 3DDNA 1IBLF 1CJKB 1HI0P 4GO5X 5GVQA 2C1EB 1WORA 1KQFB 2Z0GA 1ZA2B 2L48A 1T9TA 1HBNA 1PKUA 2F8HA 3WIUA 4A8WA 4WZMA 1S1UA 1S9FA 2EKYA 2CADA 4C8ZA 3BSCA 5T7LB 1WI6A 4OI4A 3SDEA 4DEZA 3W5YA 2B0GA 1WF0A 1LW0B 3IRWP 4NYPA 1S48A 4ETXA 1FD2A 2EVZA 1N32J 2NYIA 1UFWA 3R5JB 1VQKS 1DBDA 3BBCA 4QWEA 2DIUA 4L75A 2XGQA 1S0MA 4ZCMA 5DZ7A 4B3SJ 4ZPBA 2FJWA 1RU1A 3SCJE 4X4PA 4NA3A 2UXCJ 2H4WB 3I0RA 1S6OA 1N5YB 2BMBA 2B4OA 1OYDA 4ILLA 1PJ6A 2DGWA 4N5SA 3BV8A 3CJ5A 4Q5VA 4W92B 4J91A 5DQIA 1K47A 3CD6S 3W2WB 1HD1A 4ETZA 3NLCA 2F65A 2GVZA 2CJBA 1LNQA 2Z2YB 3JTNA 3G6VA 4NLGA 2BABA 2GMJA 2ADBA 4CT9A 4PG6A 2C2NA 2VIHA 2CNLB 4I6AA 2UV8A 5I3UB 2M9KA 3IWXA 3TARA 1LW2A 1RTHA 3IAS9 4B3RJ 2ABYA 4CH0S 1S0VA 2IC3B 1C1BA 2HRYA 4IG3B 4WFAQ 3BQ0A 2MZSA 4WF9Q 4QWCA 1J5OA 1RHMB 3BDEA 4MH8A 1XMOF 2VODA 2BZ2A 2RMLA 3DM2B 3IBFB 3OR1A 3CB4A 3N28A 2EK6A 1AA1B 3K5PA 1EETB 3RU0A 3W5ZA 3PEHA 1IKYA 1CS4A 2QLWA 4C2MA 1RYSA 4QBUA 1P1LA 3H98A 2X3DA 4ZN1A 4K0KJ 1TTHB 1OQ6A 5K8OA 3GONA 4HHHA 4JV2A 2A6OA 1JLBA 2CAJA 2E9ZA 2MSSA 3G96A 5KFSA 2R8HA 4ED5A 5KT2A 2YKQA 5E3AA 3QGHA 4IO1A 4JI1F 1W7WA 3BGFA 1VYAA 1Q53A 3MM7A 3TAQA 2X1BA 4ZN3A 3HHDA 4FF2A 1S4EA 4JI3J 4RZRA 4LT6A 4HT7A 1UPPA 6FDRA 2D9OA 2IHR1 3LAKA 2PI4A 1TL7B 2K7KA 2O1PA 1Y5NB 4K4TA 1WNEA 5M2UA 3N9UC 5T41A 3N0VA 4GVLA 3AJDA 2KG0A 5H9FK 1S49A 1F9HA 4CNZA 4QU7A 1VQ7S 2ASYA 1LWFA 1WHYA 2M5YA 1VC0A 3U1NA 3MHYA 3W1YC 2RDIA 4FPIA 3HZEA 1RKJA 4ELUA 4U9RA 4YR0A 2R8IA 3JSMA 3QNWB 5GMDA 1NSQA 1C0TA 2B9XA 3UFCX 5A0YB 1TV6A 3DRSA 1VC5A 1CVJA 4ICLB 5E3QA 4F25A 3OXGA 2M88A 2AHOB 1GTEA 3DGPA 2H48B 3CDUA 1RBAA 4TLRA 1UZHA 5KG3A 4PG5A 1HNVB 1RT3A 3K17A 1JLAA 2GGPA 1KC8T 4DQSA 3QGPA 4YR2A 3QYYA 2VASA 2JC1A 4M63A 1R3NA 2AP6A 4DUTA 3DLGB 4N77A 3GIKA 1HBMB 1XBWA 4P75A 4CTAB 3EGNA 1FD8A 3MPYA 1VJQA 1RWKB 3AB4B 3N4WA 1VS3A 4F8RA 1HW8A 1B0PA 3MEEB 1XIQA 2MGZA 1HNXF 2ROEA 5CD4H 2ZVIA 3DNCA 4O44A 4HEA9 2KHCA 1CLFA 5F3ZA 2VG7A 4DR4F 4YB7A 1IJEB 2UUWA 3I6PA 3GJRB 2OPQA 3NAIA 2FDNA 2HQDA 3MR7A 3BSAA 2XHWA 1Q8LA 2WVDA 3BO2A 2HBYB 1SL2A 1QM9A 4B3MJ 1C2PA 5KOWA 2XI3A 5F8HA 3DLEB 3VQSA 4WXWA 2QMXA 3M9MB 3R2CJ 1HPZA 4IOCQ 4LUBA 2M52A 1U25A 2MQLA 3MAAA 4HI2A 1RWPB 1WC3A 1SJ1A 1QE1A 2HRTA 3PDNA 4WTYA 4EYHB 4PWDB 3A3PB 2V6AA 3QSYB 3M8SA 4HLBA 3SCKE 3HVRA 3QMQA 1T02A 2P8IA 4ECVA 3SI8A 1EB0A 2KHDA 3UR0A 4KV8A 2CPZA 3NMAA 2B8QA 1ZPWX 4TU9A 3KYLA 4JI0J 2GA7A 4RU9A 4GKJF 1SUQA 5IWAF 2VA3A 2UU9F 1WKKA 3K57A 3UN3A 3NAHA 1HR0J 5KFJA 1ZPVA 3RR8A 3PACA 2VDIA 3DLLQ 4JI8J 1EQMA 3HLUA 2IJFA 4EZ9A 3S1TA 3OT9A 4RLEA 1VQPS 2GVDA 4AYBD 3HHLC 4A46A 3CJ3A 4ZCIA 1VQSA 4W4MA 2RQCA 4ZP8A 3AA9A 2HLUA 5B0BA 3GIRA 1FXLA 3KK2A 2E5GA 2Z2ZA 4EBDA 3BJYA 2F4VJ 1RHKB 2QT7A 3CCQS 1F5AA 2PMWA 4MKBA 2J0XA 1S1XB 1REGX 1RT6A 1W25A 1NJYA 3CJ4A 1NO8A 2VOOA 2VC1A 2JC0A 4ER8A 2N3LA 2V8DA 4WFYA 2DNHA 4U67Q 4WE1B 4F0KA 4YOEA 4DF8A 4WFXA 1KLNA 2AGQA 4CLYA 3OUYA 3U1MA 2J7UA 4FBTA 3DRYA 3NP5A 2ROGA 3W7BA 3UVJA 3ILIA 4JI6F 3GJTB 2XC9A 2VPWB 3BQ1A 1KBRA 1U02A 3DHWC 4LF2A 3MM8B 3DU6A 1GK8A 1TKTA 4HVZA 4X66F 4IKAA 4M94A 1RB0A 3M8WA 1D0EA 4AFFA 1ZM3A 1VBYA 2H3EB 2KT2A 4E2FB 3UNGC 4EBEA 4J9KA 3D6HB 1ZM2A 2AD9A 3H25A 5BXIA 3RB3A 1XR7A 3QAUA 3B82A 3QJPA 5J2QB 4CO5A 2AX1A 1FJCA 4X4VA 4URGA 5C25B 3AXKA 2DY9A 4F0MA 3MI7X 2AJQA 5B0FA 1XK8A 4YP3A 4M5GA 3SSSA 1MROB 4ES2A 5GADU 3T5KA 3PJWA 5G0RA 1WOPA 2WB4A 3G2XA 1FWKA 2HBQB 3DMJA 3M2UB 4JI5F 4O0IA 2XI2A 4TNOA 1UVMA 5HSPA 3MPDA 2MKSA 1YRUA 4C8LA 4OZ0A 4NLTA 4B9MA 2GIRA 1V5VA 3PRDA 1YBAA 2XTJP 3OHBA 4IFYB 2ZH8A 3OXFA 4Z37A 2M3DA 4MIWA 5KFKA 4B3OA 2IBOA 1E6VA 1HW9A 2Z58B 3PG9A 2C28A 3NCPA 4B3SF 3CWJA 2E1AA 1DJ0A 4Q7AA 4OFZA 2UUCJ 2R7QA 4OI1A 3S01A 5HBMB 1RACB 1LFPA 4QZVB 1Z4UA 1HNZJ 4GVBB 4CLPA 3BGLA 3ZNUA 2HG4A 2WOMB 4DV3F 1X4DA 2O01C 3MCNA 1JLCB 1YZ6A 3UPFA 2ZZMA 4DR3J 1CC8A 4ECRA 3HPOA 4ZVUB 1PAEX 4EO6A 4RW9B 1SB6A 4JI4F 1JKHB 2XO7A 1QAYA 2UUBJ 2OLWA 2DVIA 3GU0A 5C42B 2DB1A 3GMGA 2LA6A 1UJ6A 3QT6A 4DR1J 1D9AA 2HEKA 2GMHA 1HWUA 1TUGB 4J9LA 1J5OB 4ATNA 3NG8A 5B0AA 1HBUA 1C0UB 3W8GA 1R31A 3J7YU 2J9DE 3VAIA 3B6BA 3KLGB 1YJ7A 5KG1A 1K9MT 2J0QD 4KHPJ 1B3TA 1KWMA 1OQ3A 4WIIA 1U8SA 4Z2XA 4AQYJ 1U1KA 2WVEA 2CVEA 3AT1B 4M5KA 5BJRA 2AZ1A 2MEWA 4OI2A 4URSA 4DL6A 4RWXA 4B3TJ 1CJTA 4PG8A 2JHEA 3D4JA 4YFUA 3T5HA 1NHKL 1SH3A 4JI7J 2XZDB 4Q2MA 3SQGB 1AW0A 1QSYA 1DARA 1JLBB 2OD6A 1HQUA 4G1QA 2A2DA 1FKPA 4PZVA 4OZLA 5GADI 3J81Y 3RJMB 2X1AA 3NGRA 4KH0B 2QX0A 1NB2A 1S5ZA 2XYHB 2CXEA 3UQSA 2HQCA 1QJHA 3OL9A 1NK5A 2JEGA 4DX8H 3B78A 3VV2B 1T3OA 4CLLA 4X62J 3CXCR 3IBCB 1CPZA 1D9DA 4KIAA 1L3TA 3EXCX 4KGZB 4C8MA 4DV6F 3NS7B 1K0VA 4F26A 2FVPA 3KLHA 2NZCA 1RTJA 5D4NA 1HNWJ 1TK5A 3R9LA 2A6MA 4BC9A 2KXNB 4USJC 1PAUB 2HHVA 4FPRA 1SJRA 5IS2A 1NRKA 3LP0A 4AD6A 3PYGA 2PSZA 3M4XA 1N6QB 3DYAB 4CLWA 3X1LB 1RT7A 5IV4A 5L1KA 3CIZA 2CQ3A 3C3LA 1TAUA 2NS1B 3F41A 5FDLB 2YH0A 5C2CA 2GAHC 2E9RX 3WZ0A 3ITHB 2OEJA 1TV6B 2HYIB 2M8DB 2B9WA 4YQWA 2LU1A 3P8BB 2E7XA 3U02A 7AT1B 2GNKA 2LDIA 1VRUA 2RB7A 4NI2B 1UL3A 3CC4S 2G13A 2MB0B 1NDKA 4MJKA 1FRKA 1NBEB 2B4UA 1NJXA 3AJ2A 1ZM4A 3GIJA 1MNEA 2X1GA 1S6UA 1URRA 2DNMA 1N34J 4OYWA 2YX7A 3QO9A 4WCEQ 3JXOA 1VQ9S 2VFTA 4ZDNA 4X64F 4FVCA 2V2KA 3WBZA 1VMBA 5KFUA 3OW2R 2V4JB 1Y10A 1XNQJ 2ZDPA 2BV3A 4DZDA 3KHGA 3HVWA 4ZS6A 4EK2A 4IDKA 2CPEA 3CMQA 5GAHI 3OJUA 3EYZA 3TEGA 3MFIA 1SJ4P 1EJ7L 1F5CA 4LF4F 4DL7A 2DNNA 4KYZA 1N0UA 3MM5A 2R2TA 4D3HA 1UFLA 5LOQA 1M90T 2D1CA 1YJUA 1N33F 2A3JA 2H54B 1RLCL 4ANCA 2HK2A 3GR1A 3MCSA 2KM8C 3D5MA 3Q8QB 3UN2A 4MYUA 4Y2AA 1KR4A 4I6YA 4NLOA 2BQUA 1JB0C 3C15A 2XSJB 3SV4A 2X3GA 4TXSA 3MM9B 4N47A 3QLHA 3MF5A 4TYAA 2DGQA 4KFBA 4LF8J 5LT5A 2VL1A 5J2PB 3T9ZA 4I6WA 5M2RA 4U7CA 1NMEB 4KV8B 4CH7A 4QW8A 1L3SA 3BN4A 2RQMA 2HHSA 4DS4A 1WEYA 3BO3A 4G1PA 1R8CA 5K20B 2V4QA 4M5MA 2Z30B 4ZOSA 3MR6A 1XMQJ 2W2PP 3AQOA 3SMZA 2ZH2A 4NLVA 1UCNA 3ET6B 2XMVA 2HNYA 4ZVFA 5CQGA 5I4MA 1C4CA 1OY9A 2CDQA 5DG8A 1N56A 1IN0A 4NE9C 4Y2MA 4DQIA 3LGMA 4IH5A 1S6QB 1UEUA 2RF2B 3LW5C 1PC4A 3M32A 5LSOA 1AROP 3KK2B 2GJ2A 2B8PA 1S1WA 5A8RB 1RAGB 3US5A 4DV1F 4Y00A 2ACYA 1HARA 2VDHA 2W4DA 2Q43A 2RUGA 2YNHA 5U47A 4I67A 3W66A 2ZBPA 3M6WA 2W4CA 7FD1A 1DTTA 1DZ5A 2L9DA 1PC5A 3E3XA 4NLQA 2GO9A 2BQ3A 3W5XA 1JLEB 3O5TB 3PTWA 3MEDB 3K8VA 4J9NA 2YNIA 1RAJA 2J0SD 3ZZZA 2IMWP 2FC8A 3HHLD 5D78A 4N8OA 3FMBA 2XMJA 3Q8SB 2IJRA 5E5NA 1SCJB 1VQ4S 3TJAA 2WBMA 1PG5B 2BUNA 2H51B 2OFGX 2XGPA 3L95X 4KB7A 5EWEA 4RUAA 4JOUA 5KFOA 5F41A 4PQUB 1PBAA 3FSYA 2FHJD 4JI2J 5ETOA 3GIMA 1NUEA 2AU0A 4I2QA 1SVDA 4QQBA 4WFZA 1GX5A 4ZPCA 2FIUA 5A8KB 1PYSB 5KFXA 1ICEB 4PQAA 5L38A 3CMES 4FZVA 3Q8PB 3EXYA 3QT8A 1R0AA 5HATA 1JIHA 2HZCA 1GX6A 4P71A 4C48A 2CPXA 5CYQB 2W24A 5B08A 5F0UA 1LWXA 1U8WA 2HHTA 2MZRA 1CULA 3NOCA 2ZOGA 3HFVA 4N8NA 3QQCD 3KNAA 2DNLA 3MDFA 3NGUA 3BH7B 5A8WA 2CJAA 1HBOA 2N7YA 2DGTA 3CDWA 2JVOA 4LFCF 4GO7X 4P6QA 1FFWB 1U24A 4GMKA 5J2MB 1U0HB 4CLKA 1ZBTA 4M5HA 1UVKA 2KT3A 1RE1B 2BW2A 1TKZA 1FRMA 2WTFA 1HNIB 3CD0A 2BEFA 2GO8A 1S76D 2H5EA 3Q8VA 5H1SV 3V81B 3KLIA 4IOBA 4I69A 3PYFA 4B3OB 2E1CA 4DF4A 2V4RA 2YH1A 4KH1B 4P7TA 4DSEA 5FIIA 2LEBA 2CVIA 1FO1A 2UV8G 1KD1T 1FI4A 2LVWA 3MECA 1RWMB 1M5HA 3H8YA 1URNA 1NDCA 3VGUA 2ZH7A 3BQ2A 4ID5B 3KG4A 3SV3A 1WWHA 2UXBJ 1GXUA 1M5KC 2WW4A 1BQXA 2E7WA 3D1HA 2XMKA 3FDSA 2BRKA 1YJWS 4DG1A 2R7RA 3W9HA 3BF4A 3GLJA 1QLNA 2N4CA 1K73T 1IKWA 5KFGA 2CZVC 3MCMA 2HGNA 1CC7A 4Q0BB 3ZZ0A 1R43A 4QR1A 4LRDA 2YNGB 1UPMB 2IPOB 4ZVEA 4NA2A 1XERA 5K8MA 2GIFA 1RAFB 1X4FA 1PGZA 1PJ5A 3POTA 5JMNA 2NCKL 2QL5B 1CG2A 2YVSA 4LQ9A 2E5JA 4P73A 5ETQA 1FKAF 3R5GA 3FCWA 1FE4A 3JTPA 4RW8A 3EZOA 5L1JA 2HWIA 3E51A 3N5BA 3GJQB 3H2VE 4NLDA 2JFKA 1DAXA 2CWXA 4DV2J 3T1AA 2V63A 3K5MA 4J9OA 1CJTB 4LREA 2CQHA 1U1OA 1X9MA 1ZAWA 2B3TB 2OPRB 3M2VB 5EN1A 3NXZA 1BQNA 2O67A 4BDPA 3M30B 4CLZA 3NNAA 1Y4ZB 5B0CA 1TUWA 3HJFA 1RZMA 2L3MA 1U0SA 1N48A 4ZVSB 3TQ1A 1F0XA 2W2MP 2D3O1 2B4PA 2YX1A 4C8OA 2QYGA 5KOXA 1VLOA 3QWPA 3MR3A 4K8RA 4IH7A 3O6QA 3D0GE 5DGAA 2W01A 5K14A 2Y1LB 2OD4A 3AOCA 1QSLA 1FRXA 1RP5A 2ZHOA 4OJHA 4X84A 2EI5A 3CJSA 1RT5B 1V6HA 3K5OA 2PMZD 2YKOA 4TU8A 5K5MA 3A1YG 3M8RA 4ZP9A 1WC6A 5LMUJ 2XWYA 1LWEB 2DHXA 3HVTA 4ZIVA 1AFIA 1D1UA 2RHSB 3T9NA 1X0FA 4GC7A 2YBVA 4I4BA 1FXRA 1IKVA 3CPWR 5ETLA 4F4WA 4OZ2A 2YPZA 2KRRA 2VFVA 1AUDA 3IG1B 3BO4A 1WOOA 2W1BA 1RYRA 3OTOF 2IAJB 5IQ6A 3VVTA 5EX0A 2EK1A 3EWGA 4J37A 1T9XA 5IM0A 2ZE2A 3QFHA 2XLIA 1J5EF 1CSJA 3LPEA 4ECWA 4EFAC 2I2YA 1UVLA 1KQKA 3I0SA 3Q89A 3R8YA 2DR7A 1RTIA 1X8DA 3QO9B 1B0VA 4PKDB 4FS2A 4PXBA 2XS2A 5J1EB 3MMBA 2AIRB 2NXNA 4GC6A 4WFBQ 3DN9A 4WJBA 5GAGU 1N36J 1XNRF 2Y3YA 2OKQA 5BYSA 3R5CA 3Q8UA 3PR5B 2FJXA 2IRYA 2PN6A 1OY8A 4LBIA 1YLXA 3J81j 1X4CA 1P6TA 2FY1A 2H1YA 4F02A 4Y2CA 2DHGA 1FJGJ 5DRKA 2XMAA 2AYGA 2Y0BB 1RI7A 4MT1A 1SBRA 1WUUA 2DBBA 1OPIA 2BM0A 1S7HA 4ZVGA 5JJBA 2ZJRQ 3VGTA 3W60A 2MY8A 2CQGA 1FE0A 4DN9A 4FYXB 1T05A 1ULRA 2GQ2A 1FRIA 2HNDA 4IQMA 2CQ2A 2VG5A 1DTQA 2LQBA 3DI6B 4DXLA 4WKYA 3HZGA 2MZJA 3UCGA 1KQGB 3WC0A 2A18A 3MEGB 4OX9F 3LP2A 4UW2A 3IS9B 3G71S 2DRDA 3NS5A 2OH2A 1W2BR 1H3DA 2JFDA 3GV7B 3FZ2A 2IVYA 1O8BA 5DDPC 5KFZA 1GEHA 4F3QA 4ED7A 1JK9B 2FHOB 4LR7A 1S9GA 2BJ7A 3GSDA 5IT9U 3THVA 5MLCV 3TOQA 2CPIA 3V2UC 4NEYA 2UP1A 1NSKL 4LF7F 4RNHA 2GJIA 2H4YB 3NEKA 3GSIA 2WVCA 1H72C 5I3PA 4LSLB 3CCWA 2HHHJ 4RW7B 2WSFC 5KT3A 2HVEA 1U4BA 3DOMA 2J76E 5HQ8A 4DUYJ 2APOA 4M95A 2OEMA 3PW5A 5GMEA 5EWGA 2KKHA 1HMVA 3QZ7A 3M32B 1FFGB 2KZZA 3MD1A 5LXYA 4NYOA 2IA0A 1JLFB 1P8GA 4LF6J 5DGBA 4F4KA 1RTDB 2MPUA 2CNNB 4QIFA 2JOQA 1J2VA 4KPYA 1VRQC 5CAAA 1HWLA 3K7RA 4NCGA 5D3GB 4X65J 3EGVA 4IFVB 3UWTA 3QPIA 2M0GB 3AY0A 1IWAA 3R7SB 3IGVA 1TKXB 1VQ8S 3PCOB 2E1PA 5I3QA 4EUVA 5F0WA 4F3MA 1FTRA 3PW0A 1X4HA 2PI5A 2DNYA 3PX6A 2IDLA 2K1RA 2F8MA 4DSJA 4P2FA 2G1DA 1F9EB 4I0WA 4UZCA 2VBZA 1H7WA 2XEXA 3KHLA 1AT1B 3QAEA 3KK3B 4HH1A 1K1QA 2F40A 2C2MB 4KE5A 1TELA 1PYTA 3I5BA 5HANA 2FZCB 1CJKA 2GV1A 4KJIA 4PXCA 2D9PA 2AX0A 2GFFA 2MKIA 1ZAVA 2NR0A 2BJ8A 1Q78A 1WC5A 5IQQA 3QT5A 5T7LA 2KVIA 4RUCA 2BE2B 1U1LA 3KJQB 1LW0A 4J5OA 4P7VA 1AB8A 1VK3A 1IVZA 5CA5A 2FD2A 2QA1A 2YTCA 4LRFA 1Q86T 1WEXA 4J9MA 3IXQA 1H74A 2GC8A 4OYOA 4A47A 3IWLA 4GKKF 4TY9A 3GIIA 2MJUA 4Y2KA 2HAIA 3W63A 2KG1A 3TX0A 3MMAB 4WU2A 2KJWA 3W8PA 1TL3B 2GHPA 2V2QA 3VALA 2CYYA 2C3YA 4O0NA 1N5YA 2IFXA 4H54A 2XMUA 1OY6A 2MMYA 3UDEA 3JQMA 3HXMA 2DCLA 3B4DA 2P5VA 1SJFA 3GYNA 2MHEA 4CT8A 2NPFA 1NZ8A 3W2WA 3GWCA 4C98A 3CVKA 4W90B 1OS5A 5C5JA 1SH2A 2ZM6J 1FEEA 1LWCA 3DC2A 3IC1A 5F8JA 3JQKA 2QL7B 2YQ3A 1JLQB 5I3UA 2V9WA 2KI2A 2V68A 1MMLA 1QUVA 4C3MA 3V4MA 3PKYA 3KHHA 4TQRA 1VIXA 4ZPDA 2E5LJ 2BRLA 2BACA 3B8HA 1VK8A 2QZ8A 1IBKJ 2IC3A 1IM4A 4IG3A 1NSAA 1S1VB 1TL1B 2ZH1A 4QCLA 3ENQA 2ADCA 4TU7A 3PYDA 4ILMA 3DM2A 5HJYA 4EGLA 1VQOS 1VQ5S 2K7JA 2RQ4A 1EETA 4M5NA 3KLFA 4K4XA 3JSRA 4JUZA 2CJYB 1H98A 2QLJB 1G3OA 2OGUA 4TY8B 3FCHA 3RBZA 4C8YA 5EDWA 3IRXA 4B9LA 4KBIA 4KHMA 3SQOP 2HPUA 3RR7A 1NB7A 1YX2A 4ED3A 5CCMA 2ZHBA 3U27A 1FWLA 1VFJA 2EPIA 4QPXA 4LQ3A 5BR8F 5D0GA 2EFNA 4NXNJ 4USKA 2OTLS 1WC1A 2BJ3A 4KTQA 1ZZFA 2ZNZA 2IM2A 4G6VB 3KMSA 2R7XA 5LM7E 1B70B 1RTZA 4UOFA 2LA4A 4I7FB 2QSWA 3A4TA 5KFNA 4XIUA 2HZAA 3Q8YA 4YY3F 3P6YC 4DUZJ 4F4AA 4YMEA 4C8NA 3TI0A 2FLPA 4IYQA 1WTFA 3ZTRA 1U49A 2MQQA 2VQEF 1TL7A 2HFZA 2XMTA 1S9EA 4PPZA 3O2IA 2FJBB 2OTJS 3D54A 3GTYX 4ED1A 4HL9A 4K50A 2EBGA 4DL2A 4M8LA 4RX6A 1GT8A 5HMXA 1NPKA 3TAMB 2ZOFA 2G2YA 4PPDA 2BA9A 3AOBA 5GAEI 1Y3KA 4FF1A 2VD3A 4ANDA 2C2DA 3FSXA 3G86A 4DV7J 2MZQA 3MFHA 3GE9A 3C2PA 2Q6BA 3KHRA 4LF5F 2HQGA 1EHWA 1W2IA 1NCLA 4KGXB 5A0YA 2ZWOA 5FLXU 4KGKA 4ICLA 4KR0B 2D41A 4KPCA 2NSCA 4TQSA 2ZBIA 1HKAA 5DG9A 3VAFA 1N54B 4B9SA 1FWPA 4QOTA 2QJ3A 2AEFA 1HNVA 3MAQA 3M6UA 1T03B 3PKMA 1NSPA 1WKLA 2B6AB 3M05A 3VZHA 1Q8IA 4OZ3A 3DLGA 1N4LA 1DURA 4LR8A 1HBMA 1FDDA 2WBRA 4CTAA 1RCXB 1RAHB 2F7VA 2LECA 5KAKA 1EAYC 3MEEA 2FVRA 1IR1A 2JLGA 5CCLA 1RAAB 1FNXH 1N5TA 2IM0A 3EICA 3H4BA 4OYBA 5HVFA 2OIHA 4JV5J 1SJ3P 3E8OA 5L39A 5D8HB 4XDDA 3DOKB 5DM7Q 3NBPA 1KVJA 4I68A 2ZH3A 3ZZYA 3H5YA 4DV4J 1OMSA 3G6YA 4ZVTB 3X3UA 4K2XA 3IM9A 4EMDA 4B9VA 2W9BB 4F3OA 4U95A 2R7UA 2E1MC 3MAHA 4N41A 1RBLA 3DLEA 4DWIA 2VQFJ 3RAMA 1CQNA 3MCOA 4UQGA 1GNKA 2JNJA 3H7HB 4MYTA 4O3PA 3DGVA 2UVRA 3FEXB 4PWDA 1EX8A 1TFWA 4RBTA 4WYLA 4XAKA 4Q8EA 1ZA1B 3MOZA 5D4OA 3Q83A 3D7SB 4YHHF 2CDRB 4CLSA 4R25A 5F8MA 3W9JA 3BGRB 4I1TA 4C0BA 3VAMA 2JH3A 1HWKA 2D3UA 1WC4A 1DQ9A 4CCHA 3G6ES 2HIYA 2GHWA 1WDTA 3D67A 3LP2B 1RUSA 2OAUA 4PXEA 5AE1A 4C3LA 1RADB 2HQIA 4MFBB 3C14A 1SKSA 4YB1P 2VICA 4JYAF 2IYGA 1RAIB 1RWVB 1S0OA 1NU4A 4E0DA 3IGNA 3L09A 2WB1D 5HMWA 4QIGA 1RK8A 4NRTA 2K2PA 1G7CB 1UZDA 3NGSA 3NMRA 5ETSA 3CSKA 1UA1A 4J90A 1S1XA 1HFEL 3TZXA 3KJFB 4OMFG 1KHWA 5G4DA 1N52B 4WE1A 3CJTA 2ZH9A 4USTA 3M6XA 1SQFA 1FXDA 3NY0A 8RUCA 2MKHA 4U7UK 3D1QA 2ERRA 1NJIT 3OVBA 2MLXA 5B0DA 3SCIE 5KG5A 4WIQA 1T94A 3GFZA 5KFMA 4BWMA 1F2GA 2VJVA 4CI0B 4Z7CA 3MM8A 3EVMA 4FXDA 1S99A 2OPPB 1U2RA 3HKZD 1TQLA 3MURP 4FKXA 3AD9C 1M1GA 2HURA 2G0JA 3A8EA 1CJUB 2M70A 2M8HA 4LJMA 2R2UA 5ETMA 4DR6F 3OL6A 4LFBJ 3HD2A 3HD1A 2VZ9A 5KT4A 1R8PA 2PMHA 3HSDA 3QGIA 1BGXT 3BPSP 4DR7F 2PIIA 3N79A 3EUNA 2DITA 2OP5A 2M2BA 5J2QA 4USWA 2DH9A 4FDFA 5C25A 1DY3A 4X4SA 5KG0A 3HM9A 1NKEA 2AJ1A 3ZNJ1 4ERDA 2DR9A 2ZDOA 4MK7A 3Q86A 3BB5A 2DRAA 3D1OA 1MROA 4DSFA 2AV5A 3IBWA 2K3KA 5D0EA 3UNYA 4DI6A 4WU3A 2YKNB 3M2UA 2JJ4D 4BCAA 4BBYA 1H2TZ 2Q1LA 3LGHA 4A8MP 1IXKA 3T6JA 2Q79A 3C6UB 1G2EA 4Q44A 5D0HA 3N5FA 4IFYA 5KFCA 4LIWA 2KXFA 1YVFA 1APSA 3BN7A 4TVAB 4RJVA 5H9EJ 4C3KA 4PYAA 3DFEA 3CC7S 3HKWA 2ILYA 4OZ1A 5DDRC 2LEPA 2XNQA 3GQCA 2WCXA 2QA2A 3UE2A 4M5LA 4DZ6A 3F56A 1B4SA 5HBMA 2LXUA 3NNCA 3BKTA 4GVBA 1RABB 3W3SA 4OHZA 3T1YF 3PVXA 2WOMA 3P3DA 2A2CA 1JLCA 4ZVHA 4DMZA 2CJQA 4BHQA 4PUOB 4IH6A 4GRSA 1QTMA 2QLXA 2FLOA 2VPZB 4EWTA 4RW9A 1U7LA 5FD1A 1JKHA 1X9WA 3P45B 3R27A 1SQGA 4X4UA 1LWCB 1FHTA 4MMOA 1U1RA 3MOJB 4X4TA 3OTBA 5C42A 2W2QP 1GH8A 1SKRA 1QAXA 3A8KA 2X51A 3M8PB 4G3IA 3RTVA 4FKYA 2R7WA 3SSQA 3CJKB 1C0UA 3SCLE 2H5IB 4HTJA 4O4GB 3LANA 1N8RT 2RD5C 3KLGA 1X0PA 3D0IE 2AWZA 3KLFB 1U1QA 3CDEA 1SL1A 1UWBB 2DH8A 4RO0A 4ZK7M 4DV0F 2HHXA 2ACMA 3GFXA 1YSJA 4DR5J 4ZVOB 3Q2SC 3OHAA 2DISA 1KVIA 2FLLA 3CD5A 3JAMU 1XMBA 3IRXB 2UUAF 3BR8A 1R8HA 3DDIA 1RGVA 3DRPB 5HP1B 2LQ9A 2ROPA 2L08A 3OD2A 3OFEA 2R42A 2CNKB 2AJ2A 5IT9Y 4C7QA 3UD3P 3NGTA 3EZ5A 2KO1A 3JQJA 5F9LA 3D3CJ 2BOPA 3C16A 1DLOB 2O3DA 3SQGA 4OL8A 2W7AA 4ECQA 2P6SA 2ALZA 1UA0A 3EMTA 1XWLA 3CJRA 1P27B 4P72A 2Y9HA 1V5IB 3GPAA 2QMUB 2KFNA 1W26A 2W4PA 3R6LB 4V1Ak 4Y0FA 4NXMF 3UDLA 4DFPA 2BM1A 1LEOA 3QGGA 1SJQA 3T1HJ 4X2BA 1WSRA 4F50A 1RISA 2EEYA 3VAJA 4YEAA 1TZ0A 2IVFB 3UCUP 3I32A 3I9V9 4Q43A 4KT0C 1S9EB 2M7SA 1YBUA 1IR0A 1FK9B 4KKOB 2N82B 1Q4RA 1H2VZ 1MG7A 5ITHA 1A9NB 1I94J 4KGVB 1JLGB 5B09A 3TO8A 5AJ3F 3VWSA 2DXDA 3D6TB 3FUYA 3OTCA 4O3NA 2F3JA 2VUGA 2E9TA 2MSTA 2LEAA 3MUMP 4H4KA 1N6QA 3DYAA 3DLBA 1YTYA 2Q3PA 2FTRA 5FDLA 3ITHA 2CPJA 3HX9A 1YBTA 1VISA 2B56A 3OJSA 3RRGA 4NI2A 1V3SA 1UVNA 2FVSA 5DQHA 1IBMJ 3E01B 5IXUA 1U6ZA 3HVAA 4F4XA 4OI0A 1X4AA 2JX2A 2B9YA 2V34A 4ALZA 4DQQA 2BE7D 1P1TA 3HO1A 2H5JB 2FY8A 5CYMB 5LMNF 4HDHA 1EP4B 4DSIA 4OI3A 4DR2F 2KDOA 3HSJA 1TUVA 4WP3A 2HSEB 2V4JA 1IBLJ 2PE8A 1GMWD 1GQEA 5DZ6A 2KRBA 2GS8A 5CYJA 2Z57B 5KFWA 2VBXA 1TU0B 1L3VA 4OLPA 2C2ZB 3R1HA 3FMWA 5EGYA 4DSKA 2EW9A 5L8RC 3KKFA 2DK2A 2BANB 1K44A 2I1RA 2RS8A 3CCJS 3NBPB 4CM0A 5DETA 5KT7A 5J1NA 1FF2A 3CEDA 1M1HA 1RXOB 2UZAA 1S1TB 3MR5A 4CNYA 4USMA 2YWKA 2CQ1A 2CNOB 3BDPA
chains in the Genus database with same CATH topology
2HS4A 2DIVA 4DJBA 1X4FA 4FN5A 1PGZA 5F8LA 4ZPVR 3POTA 1FA0A 1V3RA 2DHAA 2YWEA 1VC6A 2ZBCA 2W9AA 2BQRA 2VOPA 2XSJA 1NJWA 1CG2A 3NGKA 2IYIA 2KH9A 2YVSA 4WYWA 5KFYA 4B02A 3JSMB 4LQ9A 2E5JA 4ZLPA 2B4VA 3ISND 1FKAF 1ZZNA 1C0TB 2YX4A 1FE4A 1WF2A 3MM9A 4EZ6A 4NA1A 4NCGB 3JTPA 3GYXB 4OHWA 4RW8A 4JV0A 2R2SA 3AAWB 1YJRA 1H0HB 3DRSB 5L1JA 2J8AA 2HWIA 3E51A 1DHMA 5E7OB 2HS0A 2Q6CA 3H4DA 3GG0A 2UVWA 3N5BA 1KN6A 2ZH4A 3H2VE 2K3IA 3AHPA 4NLDA 2JFKA 1DAXA 4ECZA 5HL7Q 1Q16B 2RQKA 5J2PA 2JEFA 2F9JA 1M0SA 3K0JA 3T1AA 5F3TA 1DQ8A 4DFJA 1RT3B 1IBMF 3T3FA 3T19A 1IKXB 4PUOA 2FJDB 1JLAB 2GGPB 1CEZA 3K5MA 4J9OA 2J7KA 2ZKUA 2CQHA 1U1OA 2HHPA 3RBEA 5SUHA 1X9MA 2OPSA 2K1RB 1ZAWA 2B3TB 2OPRB 3M2VB 1X5TA 3M9OB 5EN1A 2R7OA 1DQAA 2MJNA 2FC9A 1BQNA 3CGIA 1S4FA 3CF5Q 4K4VA 2O67A 4BDPA 3M30B 4LF9F 4N76A 2DH7A 2DD8S 1GTHA 2U2FA 3NNAA 1Y4ZB 1ZTWA 2DR5A 4OJ1A 5B0CA 3HP6A 1HD0A 3UI3A 3H5XA 3R5BA 3BSOA 4M5DB 2L3MA 3HJFA 2XY6A 1N48A 4M1KA 4CH1A 2KYZA 4QR0A 3TQ1A 1F0XA 3FJ2A 3P96A 2ZHAA 5HN0A 2B4PA 2YX1A 3H20A 4RNOA 3PIPQ 1PILA 1KSPA 4C8OA 2MKCA 3PNIA 4LFAF 3JTOA 2UXBF 2LCWA 5KOXA 2MGZB 2SXLA 5D6GA 2DJWA 3QWPA 3MR3A 1C4AA 2OSQA 3DDNA 1IBLF 4O44B 1HI0P 2NLWA 3O6QA 4IH7A 4XPEA 3D0GE 2IA6A 4GO5X 5DGAA 1CQMA 2R9LA 5GVQA 4RW6B 2CQ4A 1KQFB 1S6QA 2VG7B 2RF2A 2Z0GA 5K14A 2L48A 3M8PA 2HVIA 1HBNA 2OD4A 1TR0A 2UXDF 2JDJA 4DLGA 1QSLA 1FRXA 1RP5A 2F8HA 2ZHOA 3V6KA 2DGSA 3N01A 2LQJA 2OPQB 4OJHA 2U1AA 3I9ZA 3CJKA 4A8WA 4WZMA 1S1UA 2EI5A 4X84A 5LSRA 1S9FA 3TVKA 1U48A 4O4GA 2EKYA 2JLFA 1R27B 1RT5B 2AJFE 1B0TA 2CQDA 2JZ5A 1V6HA 4C8ZA 5A8RA 3K5OA 4K4WA 3BSCA 3FRYA 2PMZD 1JX4A 5T7LB 3FNNA 1WI6A 2YKOA 4OI4A 3LAMA 2CQ0A 2CJ9A 3SDEA 4DEZA 4TU8A 2HHWA 2CIMA 4R5PB 5K5MA 3A1YG 2B0GA 3M8RA 4ZP9A 4O23A 1WF0A 3DCAA 1LW0B 5DO2A 3ETOA 3Q22A 4CO0A 3IRWP 3TP2A 2YWGA 4NYPA 1UWBA 4MIAA 3CCZA 4CIOA 3GG1A 2QO3A 4ES3A 2XWYA 3CD7A 1LWEB 2DHXA 1S48A 3HVTA 4UUWA 4ETXA 3I55S 1FD2A 2EVZA 3OSPA 1AFIA 3KG1A 3HK2A 4TLQA 1T7PA 1D1UA 2NYIA 1UFWA 4L3NA 4NOHA 3T9NA 1X0FA 1VQKS 4GC7A 1HPZB 1JLEA 4I4BA 3O1LA 2KXHA 2L41A 3MEDA 1DBDA 2NUUG 4QWEA 1FXRA 2DIUA 1IKVA 3G8QA 3CPWR 2XGQA 1UVJA 3DRPA 5HP1A 3Q24A 3PZPA 4F4WA 1NHUA 1S0MA 2XMMA 2KRRA 5AXMA 2VFVA 4FS1A 1QE1B 4ZCMA 3LUYA 1AUDA 3IG1B 5KFQA 3BO4A 4Q8FA 1REVB 4FP9A 4ZPBA 2FJWA 2C42A 3SCJE 1T3NA 1JWWA 4YR3A 1RYRA 3OTOF 4KAIA 2IAJB 5IQ6A 4X4PA 1TK8A 1RWUA 4NA3A 1DLOA 1NZAA 2JWNA 3I0RA 1FRJA 1S6OA 1FERA 5EX0A 2EK1A 2RSQA 5L1LA 2MY7A 4F4ZA 3OL7A 1RA7A 4OJ3A 1N5YB 3M9NB 4J37A 2B4OA 1VIOA 4NLXA 2D7SA 4ILLA 1D3WA 1NAQA 3ZC4A 2ZE2A 5IM0A 4KC5A 2XLIA 4DV2F 4B9NA 2DGWA 1J5EF 4N5SA 1CSJA 4QJVA 1YITS 2BDPA 2IM1A 4PQUA 1SUQB 4ECWA 7FDRA 3CJ5A 4OLOA 4EFAC 4Q5VA 3RW7A 4W92B 5DQIA 2V0NA 2I2YA 2CKWA 3PEJA 5E41A 3CD6S 1UVLA 2NREA 3W2WB 1HD1A 4ETZA 3NLCA 4I56A 1KQKA 4IQXA 4QIWD 2JL9A 4RW4B 4ZP7A 2XULA 4YB5A 1UAWA 5HROB 5K8PA 2CJBA 3I0SA 3JTNA 3G6VA 4NLGA 2BABA 4QYRA 2GMJA 2DR7A 2ADBA 4CT9A 1RTIA 3RB4A 5A8KA 4PG6A 2LQ5A 1X8DA 4OHXA 4I6AA 2UV8A 3QO9B 5I3UB 2M9KA 2MQPA 3IWXA 2EBEA 4DPOA 1B0VA 4RBUA 3TARA 1YHQS 1LW2A 4PKDB 4NCAA 4FS2A 4PXBA 1WF1A 1TFYA 1RTHA 3IAS9 2ATLA 4ECYA 2ABYA 2XS2A 2VC0A 4CH0S 1HQEB 5J1EB 4ELTA 2ZFHA 3MMBA 1S0VA 4QU6A 5CYQA 2IC3B 1C1BA 5E3CA 4GC6A 2QA4G 2HRYA 4WFBQ 4IG3B 1V9OA 4WFAQ 3BQ0A 3DN9A 1FK9A 4WJBA 4KKOA 5AE2A 5GAGU 2MZSA 4DHVA 3U7JA 4WF9Q 4NL5A 4QWCA 1J5OA 1Y5IB 1XNRF 2OKQA 2M4MA 3BDEA 4MH8A 4ES1A 3HHLA 3ZFVA 5BYSA 3R5CA 2MKJA 3PR5B 2FJXA 1XMOF 2VODA 2IRYA 2BZ2A 1AFJA 2PN6A 2JEJA 2RMLA 3DM2B 5FLXY 1RT1B 1RT6B 1X4CA 1X5SA 4HKQA 1P6TA 3OR1A 1JLGA 3CB4A 3N28A 2EK6A 2FY1A 4F02A 1NH8A 2HWHA 3K5PA 1EETB 4Y2CA 2DHGA 1SQEA 5DRKA 5DDQC 1YWXA 1SIWB 2BXJA 5EX3A 2AYGA 1RI7A 3RU0A 1SBRA 3PEHA 3PM9A 1IKYA 2DBBA 4X4QA 2QLWA 1OPIA 1S7HA 2BM0A 4ZVGA 5JJBA 2CFXA 3OUYB 5LMUF 5J2MA 4C2MA 1TP7A 2ZJRQ 4LMZA 1IQZA 2C3UA 2J9DA 1RYSA 1D9FA 4RNNA 2FHJA 1P1LA 3CCTA 4QBUA 2CPDA 3H98A 4AXIA 2MY8A 2C2RA 2XBPA 2CQGA 1N32F 1FE0A 1F9FA 4DN9A 1XEZA 5IT0A 1T05A 1HNIA 1ULRA 2GQ2A 2LXFA 1FRIA 2HNDA 4IQMA 2CQ2A 1H38A 1ZOTA 5LSLA 2VG5A 1OQ6A 2MYFA 3ZZRA 1DTQA 2LQBA 3DI6B 1ZH5A 2HHUA 4WKYA 3V81A 5K8OA 3KJVA 3GV8B 3HZGA 2MZJA 3UCZP 2XS7A 3UCGA 1KQGB 3WC0A 2A18A 3JB9k 3NCRA 3MEGB 1KS2A 4YDDB 4JV2A 3E01A 4KGMA 3K5LA 4OX9F 2QE5A 4B9TA 1RJJA 1UETA 3LP2A 3UD4P 4H4OB 1WD6A 4UW2A 3IS9B 1JLBA 3NS5A 3G71S 1TKTB 2OH2A 4JBCA 1W2BR 1H3DA 2E9ZA 2MSSA 2UXCF 3G96A 2JFDA 5KFSA 2UUTA 4EO8A 4N56A 2R8HA 2X1FA 4ED5A 3GV7B 5KT2A 2VPXB 3FZ2A 2IVYA 3I5AA 3CJ2A 4O3RA 3DU5A 1O8BA 2KT5A 4G1IA 5DM6Q 2YKQA 5DDPC 5KFZA 5E3AA 4IG0B 4F3QA 3R5AA 3QGHA 1HHTP 4IO1A 4ED7A 2H9ZA 3G8SA 4JI1F 2FVQA 1JK9B 1FT8A 3SYZA 5CYMA 2FHOB 3PIOQ 4C8KA 1S9GA 3BGFA 1EP4A 3GSDA 1Q53A 3MM7A 4K5SA 3ZZTA 3TAQA 4ID5A 3TRGA 2X1BA 3HHDA 3K58A 4FF2A 3THVA 1MW7A 4RZRA 5MLCV 4LT6A 3TOQA 2CPIA 4HT7A 2XCPA 6FDRA 4QIVA 3V2UC 4OX8A 3KTQA 3B4MA 1O5JA 2D9OA 1FNMA 2UP1A 2IHR1 4LF7F 1JNRB 4RNHA 2ZITA 2MDAA 3LAKA 2PI4A 2GJIA 2K7KA 1LFWA 2O1PA 4XK8C 1Y5NB 4K4TA 3OV7A 1KFDA 2DO0A 4PWUA 3OTDA 2W7OA 2RRAA 1WNEA 4MAKA 2BANA 5I3PA 4LSLB 3CCWA 4NWBA 1LXJA 5M2UA 3N9UC 5T41A 4B3RF 3N0VA 1JJHA 4RW7B 2WSFC 3C3LA 5KT3A 3V5RA 3CULA 2YKMB 2VFUA 1U4BA 2VG6B 2KG0A 3FQKA 4RWWA 1S49A 3DOMA 2J76E 5HQ8A 3T5LA 1N36F 2APOA 2NUHA 3DHXA 4M95A 3I96A 4Q0BA 1QY7A 5G0RB 4ZKAA 3PW5A 2KKHA 4CNZA 4RUHA 2ASYA 5EWGA 1S1TA 5CZXA 1HMVA 4KQZA 3EZUA 1VQ7S 4WZQA 1R89A 2WRMA 3QZ7A 1LWFA 2RKIB 5AXKA 2YNGA 3M32B 4DV5F 2YY3A 2KZZA 3MD1A 1WHYA 3DMJB 5LXYA 1V3ZA 2I5JB 4NYOA 2M5YA 2IA0A 1JLFB 3OLAA 1P8GA 1XR5A 2JRSA 3U1NA 1VC0A 1FJGF 2HQ3A 1YJ9S 1H2UX 3MHYA 5EUHA 2KTQA 1YRXA 1WELA 5DGBA 2IRXA 4F4KA 1U1NA 1RTDB 2RDIA 2MPUA 3O8WA 5E33A 3HZEA 4CO4A 1RKJA 4D3GA 3DLHA 4QIFA 4ELUA 2JOQA 2YNFB 2ZUGA 4U9RA 4YR0A 2R8IA 2A1BA 1J2VA 1VRTA 1A6LA 4A48A 3JSMA 4KPYA 3HF5A 4FNHA 3IN5A 4OZ5A 1C0TA 1HWLA 2B9XA 2DGXA 3K7RA 1TV6A 3UFCX 5A0YB 1JJ4A 4NCGA 4FXDA 5D3GB 3DRSA 1VC5A 1CVJA 1KOOA 4ICLB 5E3QA 3V6DB 1AXQA 4F25A 4K0KF 1SV5B 3OXGA 4OHYA 2NXUA 4IFVB 1U2FA 3UW1A 2M88A 1E6VB 1N5SA 1GTEA 3DGPA 3G8TA 4J9QA 3TVZA 3UWTA 4O3OA 3CDUA 2M0GB 3QPIA 3AY0A 3D28A 2HFNA 4TLRA 3IGVA 1TKXB 1VQ8S 1X4GA 1Z2LA 5KG3A 1NK8A 3BGUA 4PG5A 2XCAA 5I3QA 1HNVB 1RT3A 2VKZG 4EUVA 5F0WA 3G4SS 4F3MA 1IUJA 1IKXA 1VGYA 1JLAA 1FTRA 2GGPA 4QW9A 3PW0A 1X4HA 1KOHA 3C8YA 4X4NA 2PI5A 3IA0A 1KC8T 4DQSA 3QGPA 4YR2A 2DNYA 3M8QB 3QYYA 1TKDA 2VASA 1UKUA 3PX6A 2K1RA 2F8MA 4ZMMA 2OPRA 2JC1A 3M2VA 3MMJA 4M63A 1R3NA 2ZJPQ 4DSJA 3I4PA 3EGWB 4QPTA 2G1DA 5DQGA 2V94A 4I0WA 3OTEA 4WXOA 4ED2A 3PW4A 2AP6A 3M30A 2VBZA 3WX4A 3DLGB 4N77A 1H7WA 3AQPA 3GIKA 5F9NA 3BEGB 1HWIA 3IAM9 2XEXA 2W9CA 1HBMB 1XBWA 2FLNA 2OSRA 1OPZA 4DQRA 3MGJA 4M5DA 3KHLA 4PCQA 1DRZA 4CTAB 3QAEA 2LMIA 1FD8A 3EGNA 4HH1A 3KK3B 3MPYA 2PT0A 4RBVA 1K1QA 3AB4B 1Y3JA 2F40A 3N4WA 3J7ZT 2JEIA 5LJ3Y 1VS3A 4F8RA 4KE5A 3IR6B 1HW8A 4I2PB 1B0PA 3HHNB 4ECSA 3MEEB 2MGZA 4JI3F 1HNXF 2ROEA 5CD4H 3NGDA 2QA4S 3I5BA 3DNCA 1A7GE 4O44A 4HEA9 2LKZA 2KHCA 1QSSA 1CLFA 4RW6A 5F3ZA 2GV1A 2R7TA 2VG7A 4DR4F 4YB7A 1TVRA 1IJEB 5KG7A 2UUWA 1S72S 5H9FJ 4KJIA 4PXCA 3IFEA 2D9PA 1LK7A 3I6PA