4Y2IA

Gold ion bound to golb
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
GMQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSLSAEQIAAALQKAGFPPRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Putative metal-binding transport protein
publication title Structural Insights and the Surprisingly Low Mechanical Stability of the Au-S Bond in the Gold-Specific Protein GolB
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 18
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y2iA00
1VQSA 2ZDOA 3LGMA 5F0UA 5A6WA 1TL5A 2BJEA 2KT2A 2N7YA 4Q2LA 1AW0A 1YJVA 2VV5A 3KG0A 4ZOSA 4HH1A 2ACYA 3IWXA 3TRGA 1Y0HA 4HI1A 2FB0A 2KYZA 2XMVA 4QOTA 1QUPA 4DL0C 3FGVA 3HHLD 1AFIA 2RU9A 4HH0A 2CRLA 1RJJA 2BYCA 2HQIA 2K7KA 1X7VA 1YJTA 3HFKA 2GCFA 4EFAC 1TZ0A 2HLTA 3QGPA 3BN7A 4A46A 1S6OA 2AJ0A 1IUJA 2OD4A 3I9ZA 1MWYA 1YJUA 2FHMA 1JWWA 1W2IA 4NPOA 1S6UA 3HX9A 4Y2IA 2IYIA 2HIQA 3UDCA 2LQ9A 5B09A 2QIFA 4DPOA 4OJHA 3WDOA 1KVIA 1ULRA 3KNGA 2OKQA 3LO3A 1OQ6A 4DN9A 2ASYA 3MCSA 1LQ9A 3FMBA 4HI2A 2RSQA 1Q8LA 4Y2MA 1P6TA 4YDXA 1YRXA 4Y2KA 5B0DA 3T9NA 2RILA 4NL5A 5B0EA 1TUVA 2FTRA 1YG0A 1N5VA 1SI9A 3KKFA 2AJ1A 2EW9A 1CC8A 1GXTA 2K7JA 2W4PA 3MZIA 5B0AA 4F67A 3BGUA 2XMWA 3VTIA 2FIUA 3K7RA 1CPZA 2ROGA 2IYGA 2OFGX 3BF4A 1URRA 5B0BA 2XMTA 2HLUA 1FVSA 1V3ZA 1VQYA 3BM7A 3BR8A 1Q53A 4OJGA 4FNIA 2LXFA 2L3MA 1FE0A 3HDSA 3QMQA 4A48A 2XMMA 5A6PA 1KVJA 2OFHX 2QLWA 1FVQA 2ZDPA 1N5SA 2LDIA 3KG1A 5T7LB 2ROPA 3GZ7A 2GA7A 4ZA1A 2OMOA 1Y9OA 2PD1A 5T7LA 1U7LA 1OPZA 5B0CA 4A47A 2GGPB 2OD6A 1APSA 2HFOA 1OQ3A 2AW0A 4Q2MA 2KKHA 1K0VA 2G9OA 2OAUA 1R6YA 2GV1A 2K1RB 1OSDA 1WD6A 3HHLC 4YEAA 3FRYA 1Y3JA 2BJDA 5F0WA 2K1RA 5IXUA 3E8OA 1YJRA 1P8GA 1N5TA 2HFNA 3CJKB 4U9RA 1FESA 2K2PA 5K9FA 4OJ3A 1Q8BA 3CJKA 2AP6A 3TOQA 1FEEA 2W4DA 3BDEA 1Y3KA 2XMUA 1SB6A 1TR0A 2GO8A 1FD8A 2Q3PA 2OP5A 2XMJA 3F44A 3HF5A 1Q4RA 1SQEA 2LQBA 2PGCA 4OIXA 1TL4A 3HHLB 2IFXA 3HHLA 5B0FA 2BUNA 2RMLA 5KAKA 2KT3A 1JK9B 1GXUA 3DXSX 4HL9A 2QLXA 4FNHA 2GGPA 1N5QA 3DCAA 4OJ1A 2W4CA 3LGNA 1X0PA 3TNVA 1XBWA 2ROEA 1X8DA 2N4DA 1AFJA 1CC7A 3BB5A 5B08A 2BBEA 2QYCA 2VH7A 2GFFA 2JDJA 2XMKA 5B0GA 1MWZA 1FE4A 3IWLA 2N4CA 4A4JA 1KQKA
chains in the Genus database with same CATH superfamily
1RDRA 3VAMA 4NLXA 2VFRA 2C3YA 4EYIB 5KFEA 5A8KB 3PJWA 1T03B 2YPZA 3H42A 2ZH2A 1NSAA 4P2XA 5HP1A 1U45A 3W61A 4PWDB 2EFQA 2GVZA 3VAGA 2PT0A 1WF2A 2UV8G 4OJHA 1T9XA 1PGZA 2ASYA 4CWBA 1U1NA 3DOLB 2LEPA 2LECA 1TKXB 2RHSB 2Y0BB 1RT7A 4ECZA 4PXCA 3BKFA 3K7RA 4WYLA 3MTKA 2CADA 3CMAS 1QE1A 1JJ4A 3C19A 2HYIB 4CM2A 4FKYA 3W2WB 2AJQA 2DNGA 2BXJA 2O01C 4DLGA 4JV2A 3PKMA 4CNYA 1KKHA 2ZH7A 3FBCA 1MG7A 3GJRB 2AMCB 3RW6A 3FJ2A 3MM9B 1XR7A 2A6MA 1HPZA 3MR6A 1NO8A 4EI2A 2AJFE 4YB7A 3JTNA 1NH7A 4Q0BA 2YKMB 1XR5A 1R27B 2RHQB 2PI4A 2V4QA 4ZP7A 4J91A 1W26A 2JEJA 1TV6B 4V19J 1YJWS 2DY9A 1JLGA 3GE9A 4M5IA 3K2YA 1KHWA 3BO4A 2QC3A 1HMVA 3N9UC 1QLNA 3RBZA 1TL3B 3KHHA 2N3LA 4KIAA 1TFYA 5LM7E 3HXMA 3GIJA 3CMQA 4LF5J 2ZE2A 4ZVFA 4P6QA 1N5VA 1FRJA 1PJ5A 1WC6A 2C1EB 3Q8PB 4DR6J 2BR0A 3BJYA 2KG1A 3BR8A 5E5NA 5AXNA 4ID5A 4I7FB 1SJRA 3FQKA 4KJIA 2PMHA 1OYDA 2YY3A 2QLJB 4ZA1A 2GJ2A 1Q0NA 3KLFB 3ZZUA 1NHUA 2XULA 3D7SB 3TZXA 1J5OA 3KK1B 3GFYA 3C16A 1YJRA 4UUXA 4U9RA 1FESA 2CG8A 4M5LA 4OYBA 4NZ0A 1FDAA 2HFVA 1C4AA 2J9EA 4N41A 2IDEA 4I2PB 1T9WA 1GXUA 2BKNA 2E1RA 2E5JA 4PXBA 5ETNA 2GVZB 5A6WA 2E9TA 4DS5A 2GMHA 1JKHA 1NPKA 4DL0C 1WTBA 2BV3A 3KLIA 4P2SA 2VFVA 1UETA 4OI6A 4KQZA 1MN7A 5GMKa 4UZBA 1KSPA 1LW2A 3FRZA 2ASLA 2P9EA 5KFLA 2GAHC 4JI7J 1UVLA 3R5GA 3W2VA 2V2VA 1GXLA 3IAM9 2BOPA 4X66J 2AEMA 4YUDA 4CH0S 4NCGA 4LF1A 3G9CA 2KN4A 3HDSA 4NLTA 1LW0A 4RZRA 3QJJA 1S76D 4XPEA 5F41A 3G6VA 3MM7B 4KKOB 4L74A 3T1YJ 1V6HA 2E5IA 5A8RA 2HHPA 3QNWB 5DG7A 3LF0A 3CCSS 5E3RA 3ITHB 2IM2A 1PO6A 1DBDA 3M2VA 1EQMA 1HMVB 4K4XA 2AJ4A 1VQNS 3DYAA 2H51B 1JLCB 1H73A 4NXNF 4WBFA 2ZE2B 3SDEA 1SKRA 1U4BA 1JJHA 4DUYJ 3TARA 4HT5A 1RAFB 3FGVA 3VGTA 4ZP8A 1NPPA 3FBEA 1F2GA 3D1QA 3DNCA 4LVNP 4CT8A 2O5DA 4J37A 3S8SA 2W01A 1TK8A 4DXLA 1M90T 4CO3A 1ZM4A 2CPHA 2AJ1A 2KG0A 2QL9B 5KFAA 3C16B 3AY0A 3IO1A 4W4MA 1KLMB 4YP3A 3HSDA 2ZKUA 4LSLA 3AOBA 2OUGA 4ELUA 2C3MA 1YBAA 4ZPVR 4FPRA 2FZKB 2HGNA 2OD6A 4OYAA 4ZLJA 1UZDA 4ES3A 5M2PA 4QIGA 1JKHB 3M9OB 3H2VE 4PQUB 1IVZA 5C42A 2V69A 1O8BA 4JB8B 3PIPQ 5C25A 2ZC3A 4ZS6A 1CS4A 1BHNA 3BSAA 5IQQA 4Q8EA 4EO8A 1RTDA 3TYTA 3PX4A 1NMEB 1VLYA 3N5BA 2K7KA 3UN5A 3NBPB 3CNQP 2D3ZA 2BZ2A 4ICLB 2MY7A 4KGVB 3EX7B 3L7OA 1YVFA 2L08A 4GMKA 5AT1B 4Z2XA 5KG1A 2B4PA 4DHVA 3CSKA 1SJFA 3PJ9A 5A8RB 4IH5A 1RT4B 3BGUA 1UJ6A 3K5OA 2N82B 1GMVA 1JLBA 3IBWA 1M5OC 4FF1A 2M0GB 3US5A 3M2VB 1S9FA 4IDKA 4LMZA 4LRBA 1KC8T 4IH7A 3IG1A 2D69A 4OJ3A 2YQ1A 1RU1A 4B3OB 1JQGA 2DHGA 4JUZA 2BANB 5KFZA 3SYZA 4IFVA 1T94A 3SFGA 1E6YA 5DZ7A 1RE1B 2CYYA 4IFYA 1HYSB 3PG9A 5DDPC 2HGMA 1F5AA 5DGAA 2CRLA 2CQBA 1C1CB 3NGRA 3UFCX 1FK9B 2HHHF 1RABB 4NLVA 3CDBA 4ZLNA 4NPOA 1CJVA 4Z7YA 3MMBB 2J8AA 2OKQA 2W1BA 4DX8H 4X4OA 4ES1A 4HVZA 1HNVB 4ZVSB 3R1LA 5T14A 4MTPA 2HFSA 5I3QA 5CXTA 2RT3A 4ZP6A 3BDPA 1IKWA 4JI1J 1UKUA 3HJFA 4G1PA 1LWEA 4ETZA 1Q82T 5KG7A 4TU8A 1TTHB 2GX8A 2R7XA 2DHSA 4PR6A 4C7QA 1FERA 2FDNA 3FRYA 3GFXA 3TJAA 1TAUA 1RAHB 2G0JA 2D9OA 4NXNJ 3NL0A 1RTDB 3RAMA 1EX8A 1HBMA 5ADZA 2PSZA 4IOAQ 2FJDB 3AODA 5HROB 2OEMA 2GQQA 4EMDA 2IVYA 2ERRA 2APOA 2W8LA 4RBTA 2GC8A 5HVFA 4DV3J 4UUWA 3EYZA 4H4KC 2D41A 4QIWD 1T9TA 1NKCA 1IUJA 3T19A 2Q1LA 4ZMMA 1JLBB 2QMWA 3OPKA 3M2UA 2ADBA 4KT0C 3J7Z5 2J0SD 1Q95G 2JL9A 3MHYA 1WNEA 3OBIA 1N48A 4C48A 3MPUB 1CBKA 5D8HB 4JBCA 1XK8A 4KFBA 4DFMA 5G4DA 3CD0A 4TYAA 5BYRA 5EX0A 1NB2A 2ADCA 5DDRC 2R9LA 1NUEA 4DSEA 1YZ6A 1VK3A 5DDOC 2MGZA 5CHCB 5ETVA 2GMJA 4RUBA 2K06A 3DRRA 3NMRA 1QDUB 3DRSA 4IH6A 2UP1A 3FEXB 2C42A 2MKKA 3ULHA 4RKUC 1RBAA 4PWWA 2R2RA 4L75A 3V4IA 3GFHA 4JV1A 1ZZFA 4MK8A 4MH8A 1GMWD 2D1CA 4DPWA 1ZA1B 2AYBA 3GMGA 3MEGB 2ATLA 4B9NA 3SEOA 2RJZA 3HZEA 2WONB 4ZVEA 1HWJA 1RB0A 1U2FA 1F9FA 4ZVPB 1K1QA 4O4GB 2WSCC 1MW7A 1UCNA 5DQIA 1WC1A 3G8QA 1ITPA 3QATA 3DMJA 1S1UB 4URSA 1SJ4P 1FEHA 3GWCA 2V8GA 3BM7A 3DLLQ 3PHEA 4YR0A 4O3SA 3C15A 4KAIA 1S1TA 1GX5A 2PA8D 2BM0A 4Q2MA 1RWXB 2CPDA 3PJXA 7FD1A 1S72S 1R0BG 2DHHA 5LL6d 3DM2A 3CJKB 1I6JA 1TUWA 4DSFA 3QT8A 1UTAA 3DN9A 1FRXA 2KTQA 2H9ZA 2AHOB 4KGKA 5B08A 3JSRA 4FZVA 2YWWA 1R31A 1ZTTA 4ECWA 2B3TB 2UVWA 4NLDA 3DLKA 2Z2ZA 4J9UE 2GO9A 4DI6A 1JXLA 3DLGA 2J0WA 2J9DA 1RWOB 3HFKA 3KLEB 4KGMA 3GV8B 3GTYX 1S59A 3DGPA 3DHXA 2HZVA 1KN6A 3HHDA 2BE7D 3W9IA 2R8HA 3F56A 4ZHRB 4WK1A 2ZH6A 4WTOB 1RWKB 1RHQB 1WKJA 3WC2A 3AD7C 3CCTA 1GAOA 4CO0A 2CJQA 4BWJA 3QIPB 2AU0A 1NRKA 1A7GE 1N5SA 3EVWA 1V3RA 2OMOA 4MIBA 2B7CB 4PXDA 2OELA 1IR2A 3GYNA 3POTB 4USKA 1H6KX 1FTCA 3VQSA 2RQCA 4WYWA 2XMUA 1U26A 3A4TA 1KHVA 2J7KA 4ZPTR 4F0HA 3HHLB 3VQTA 8ATCB 1N33J 3HD2A 2W4CA 4DV1J 2MB0B 2ZUGA 2I2YA 4Y65A 5BYSA 3LP0B 2KB2A 2VFSA 1WC3A 1VS3A 1WDTA 3LALA 2XYHB 1WG4A 1OY6A 3SBMA 2HIQA 2LQ9A 2IVFB 2LU2A 5KOWA 2HWHA 4WXWA 3W66A 4P72A 3C6TA 3PKYA 2YWEA 4TU9A 1HQUB 1UWBB 1AA1B 1RT1B 2AYEA 2WVDA 3LOUA 1FE0A 3D54A 5H9EJ 4QCLA 3QFWA 4GVBB 3DOKA 5KG4A 4YEAA 1CULB 2ALYB 3AHPA 1VJWA 3QLHA 2P9GA 5A8WA 4ZVHA 1LEOA 2ZJRQ 4IOCQ 4DR3F 3RB6A 1UP1A 4FYWB 4QBUA 3CJQA 3DGPB 3VR1A 5HMZA 2JDJA 1UL3A 1X9MA 2WSEC 5DO2A 1IQZA 1RCXB 4NLUA 2PI5A 1IM4A 3BQ1A 2AT1B 4M63A 2VFUA 4HH0A 5ETLA 2HLTA 3GLJA 4RW8A 2BRKA 3CW2C 4ZK7M 2W8KA 1TK0A 5SZTA 2HBQB 3HT3A 4CYUB 3FMBA 4NLOA 3IR6B 1UFWA 3Q8VA 2NXUA 1MLAA 3MWBA 3MR3A 1S9EA 4OYMA 2J6TA 2W9AA 2WZ1A 1TL7B 2HLUA 2HVDA 3UD3P 3GSIA 1U1RA 1G6BA 4F4ZA 2P5VA 5D78A 1B0VA 3D0HE 4JYAJ 4CLWA 2B7BB 4DEZA 3RB0A 4OX6A 1D09B 1CQNA 1Q8KA 1U2RA 4K8RA 1YLXA 4BC7A 2MZQA 2NZCA 3I31A 4WZQA 4X65F 3DCAA 1KFDA 3IFEA 2HMIB 4R5PA 4QIEA 5HO4A 2RE1A 1IKVB 3M8WA 1K9MT 3FZBA 4G1QA 2UU9F 4U7UK 2DXEA 1VBXA 4MKVA 2H4WB 1K44A 4B3TF 2A18A 3I55S 2WRMA 4FF2A 3ENQA 3QIDA 5JVHQ 3OQ2A 3D6MB 3L7PA 1QVGR 3DOKB 2B9YA 3PNIA 2VHGA 3HO1A 1T11A 4DSKA 3S01A 2XCAA 4TN2A 2BJ3A 2F9DA 1YBTA 2O1PA 4ZVRB 4OJGA 4FNIA 5D6GA 3K5LA 2HNYB 2DVIA 2UXCF 1RTJA 4P7VA 3M8YA 4CLUA 3G2XA 1C2PA 4FYVB 4M5HA 2LMIA 5DZ6A 1S12A 2YX4A 3CULA 3HVAA 2OAUA 3UD5A 5F8IA 4V19X 3UNGC 3QGGA 2DGUA 2FD2A 3HVTA 2B8QA 3NLCA 4F4KA 3PO4A 3OL6A 4YMEA 5G0RA 5CCMA 5KFFA 2BE2B 2DO0A 3FBFA 2RUGA 2G2YA 3S7RA 4WFZA 3IS9A 4EBCA 2HHTA 1NM2A 1LFWA 3B82A 4ECYA 3C14A 5GADU 3H20A 1T7PA 1G4CA 4RBUA 2Z2MA 3C6UB 5DDQC 3W1YC 4DL5A 1ZH5A 2BEFA 3ELHA 4C8ZA 4F25A 1IR0A 2HRYA 4Y2AA 3TA2A 1HQEB 3W8GA 2V0NA 4ZJQA 3G6XA 2CQ1A 2JOQA 1SH3A 5AE1A 2MLZA 3FFIB 3X1LB 2NR0A 5U47A 5CQGA 1FDDA 3FSIA 4NWBA 4KBIA 2I38A 5I42B 3W63A 2HHQA 1MN9A 2UUWA 4OV1A 3MXHP 2RU3A 2CZVC 4U67Q 1RHUB 1TU0B 4J7CA 1OSCA 5L38A 4E2FB 1H74A 4NMLA 4UTGA 1TL5A 4LF6F 1VRTB 1N8RT 5C7PA 2QA4S 1RT2A 3Q86A 3KK3B 2EKNA 3MR5A 3RBXA 3ZXWA 4KSEB 3A3PB 3SI8A 5BYQA 1Q81T 2BQ3A 2MSSA 3PW5A 3AFGA 3CCRS 3T5HA 3OTOF 5C2CA 3R2CJ 5IT9U 4CLTA 3QO9A 2FTRA 5KT6A 1BQNA 3W65A 2AGPA 1RWNB 2E29A 4TNOA 4DZDA 1X0FA 1WJ9A 1UVKA 2F8HA 3GJQB 3M32B 3QMQA 4G6VB 4NMXA 2VA2A 4X65J 2I5JA 2G13A 2GA7A 2DNNA 4R25A 5T7LA 1U09A 5D0HA 4ZVUB 2F3JA 2DR7A 1BWEA 1KS2A 1FJEB 2HNDA 2ZD1B 4K4ZA 2NYHA 2RD5C 3M6WA 4YY3F 2UUAJ 2XLKA 2YWKA 1JMTA 4MKAA 3OHBA 2CQPA 4RW7B 1Z4UA 2HBZB 4B3TJ 5HJXA 3SCKE 2W2NP 3UCUP 3D4JA 2CG4A 1TVRA 3KDNA 1U6ZA 2XYGB 2NXCA 4JI0F 2H5JB 3J81j 4HI1A 2FJBB 4TLQA 1FX2A 3LH2S 2E1MC 5DLGA 5DLFA 4C11B 4CDIA 2QL5B 3EWGA 4I67A 1KFSA 3T1HJ 2YNHA 3CD7A 2RSQA 4YOEA 2AYMA 3BQ0A 3KLVA 3FZ2A 5RUBA 1DTQB 4DR5J 2B43A 2EFNA 3BGRA 4QWAA 3GYXB 3DOMB 4ILRA 5E3PA 4DV5F 3QGHA 2XO7A 4DS4A 5F8NA 1H0HB 4NLRA 2R7WA 4CLPA 2CJBA 1SH0A 3GU0A 1U1QA 2HFUA 4ENOA 2PMWA 4PKDB 3D0GE 1DURA 3R5CA 3G8TA 2G2OA 4ATNA 4PEOA 5C2GA 4KV8A 4GO7X 3PR5B 1SC4B 1SV5B 2B51A 3DC2A 4LF7J 4NXMJ 5CZXA 1MMNA 4O0NA 3EJMA 1PC5A 1B0TA 4YB1P 2E1CA 4DSLA 2ZITA 1RP5A 3I9V9 3V6DA 4FYYB 3CUNA 3SXLA 1GMUA 2R8GA 1S6QA 2Q6CA 4K2XA 1UZHA 2LEAA 5D3GB 4B3MF 3BH6B 4FKXA 4DV7F 4YDXA 1FJ7A 3UVJA 4OHVA 1D1UA 4ES2A 4J9SA 2M9KA 2BKPA 2H54B 3QJLA 2QG9B 2VJVA 4DFKA 5J2PB 4U7CA 3VAIA 2XMMA 1XERA 3O2IA 3D66A 2CJ9A 5CD4H 3MMCA 2E5LJ 1R6YA 3P3DA 4LVOP 4LF6J 3KWMA 2DNMA 1FFWB 3DI6B 1UEKA 4M5DA 4IRDA 4N8NA 1NK4A 3IP0A 3PY8A 2W2OP 1VRUA 2ZEJA 4ECUA 2Q79A 3OTOJ 2FIUA 2WSFC 3CVKA 3G87A 3UNYA 4DPXA 2DNRA 2ZJQQ 3TZWA 1AT1B 3H4DA 1U0HB 4NOHA 2WK4A 4OHWA 2ILYA 3DU6A 4EFAC 1RWUA 2P2CB 3Q8UA 4F8RA 3AB4B 3NMAA 2A2DA 4GKJF 1I5OB 4LF2A 5KFQA 3CJ2A 4H4OA 1KVKA 2XNRA 3RG6A 1QTNB 3HSGA 4KV8B 1MROB 2I0XA 2L3MA 4LBPA 4DU8A 4DPTA 2JVRA 1F5CA 4JI4J 2AZ3A 3BGFA 3RJMB 5HQMA 3ZZPA 3HF5A 4NYZA 3KUEA 4N5SA 1A9NB 5KT3A 1YIJS 4ECVA 4O3OA 4FF4A 2X1GA 2P6SA 1S6QB 2DRAA 2N4DA 3TJ8A 5IT9Y 4OHZA 5D4LA 2XM3A 3CCMS 2AGOA 1RLCL 2CQCA 4RW9B 4ZLLA 1NJXA 2UXDF 3B4MA 1NSPA 4WP9A 3GQCA 4USJC 3MTJA 1RTZA 1BLUA 3N6NA 1AXQA 2MQOA 3M6VA 4K4SA 1FNMA 1FRKA 3FCWA 5J2NA 1UJ5A 2LDYA 1TKZB 5L8RC 5KFTA 5LMNJ 4IKAA 4FF3A 4FP9A 1VK8A 2VKRA 3FK4A 2IYGA 3QPIA 4G3IA 4QU6A 3CE8A 2RH3A 3AJ1A 4OZ0A 3OD2A 2LP4A 2G9OA 3HHLC 3M8PB 3I87A 1RTHA 1Z2ZA 3BYRA 2IC3B 4JI8F 3RRGA 4ED4A 2PGCA 1MU2A 3WHIA 2FC9A 4JI6F 3T5JA 4F50A 3U02A 5LSRA 2YQ3A 1DHMA 2B56A 1PBUA 1SVDA 5KFYA 2Z56B 5L9XA 2V94A 4YR2A 2FZGB 2YH1A 4CZCA 2AJ0A 2OTJS 4NLGA 4ZCMA 3I5BA 2R2SA 1R6VA 2KO1A 5KFMA 1QSYA 4K7QA 4IRCA 4IOBA 4XDCA 2WHOA 2CQ2A 1JLQB 4M5MA 3OUYA 1T0TV 1NK5A 3AQPA 1S7IA 4GC6A 1AUDA 1M5HA 3BO3A 1HWKA 1FVQA 3PFOA 1BD6A 1JLAB 2H5EA 1UFKA 2PEHA 1N52B 4KHMA 1N6QB 2R8IA 2F7VA 3DRPA 3J80U 3SSRA 3J7YI 4MYUA 2QFIA 2UVUA 1SPBP 3WX4A 3DHWC 1EJ7L 1VBZA 3M8QA 3HP6A 2EK1A 1T05A 1LWFB 1IWGA 1U02A 2R7RA 3BQ2A 2MZRA 4LREA 2MKSA 1FJGJ 3MCMA 4KY3A 3CB4A 3HK2A 4GKJJ 4ECQA 3A8KA 1EARA 4RW6A 1B7FA 4AXIA 4M5NA 1FRLA 1NZAA 4F0KA 1W2IA 3KJNB 4I69A 5KFKA 4LBHA 2IYIA 1ZS6A 4LR9A 3LWMA 2YWFA 3M1VB 4DPOA 1C0TA 2VBWA 4DZ6A 4OL8A 1CG2A 1FKPB 2XQCA 5KFHA 1VR6A 5F3TA 2CPJA 2CNNB 4USTA 1CC8A 1EKSA 1RTHB 3CO0P 2ZVIA 2ZBCA 4JI2F 2H4YB 5B7WA 3D3CJ 4KGXB 2GW8A 3K5MA 3MR2A 4G65A 1RBLA 5E2QA 2R2TA 2YNFB 2W9CB 4ZIWA 4WE1B 1RKJA 3NY0A 2QA2A 4X4RA 2DK2A 5T41A 4EZ9A 3DDKA 3MM6B 2AIRB 2EKYA 2HFNA 4U6PA 1SUQA 5KFDA 4CLYA 1R8AA 1XNQJ 1KNZA 2XO6A 2QO3A 1NDLA 2UXDJ 1Q4RA 3PYDA 4C0OC 2XC9A 4HDGA 4M8LA 3MPYA 2OPPA 2KRBA 3NOCA 1FKAF 1OY8A 1EHWA 3MD1A 1X8DA 2LCWA 1WORA 1S1XA 4DR1J 1IKYA 3KLGB 2ZBPA 1SIWB 4RBVA 1P1TA 2XZDB 4NRUA 2DJWA 3I0SA 4TLRA 2B9XA 2DKOB 1GT8A 5FIIA 2KM8B 2F63A 4DX5A 1LQ9A 3ETOA 1S0VA 3NNCA 1VLOA 2VBYA 2ZH5A 3O44A 2HS0A 2KRRA 1LNQA 3MFIA 4C98A 3KLHA 1S49A 5EN1A 3PDNA 2BABA 1ZETA 4JI6J 2FUG9 2E7VA 5D0GA 1VHIA 2PFDA 2XYPB 4DR4F 2E7XA 2C2ZB 3CD5A 2GIQA 2HZAA 1RYRA 1U8SA 2MQMA 5HBMA 4P71A 2QE5A 4WWSA 2MZTA 5GAHI 5JMNA 2VKZG 2BBEA 1NU4A 2IVMA 5F8LA 1S0OA 1AW0A 2FHJD 4D3HA 1UMJA 3A1YG 5KG0A 5IWAF 2BE9B 2F8EX 2UUBF 4PYDA 5KFJA 3BSOA 1MMDA 5ETKA 5ETMA 2YKOA 5DETA 2RB7A 1SJ3P 5DS7A 1LWCA 2OMLA 5F9LA 2AD9A 1JB0C 4ZVQB 4MK7A 5CZVA 4JI5F 1YBUA 3V4MA 2DPJA 1V9OA 1NSKL 1GTEA 2ZC4A 1LV5A 2J6SA 3VHQA 5HN0A 1U1OA 3B6BA 3R6LB 2VODA 1YWXA 2OPPB 2CAJA 4X64J 4DV0J 3D6TB 2IRUA 4Y00A 4TYBA 5HVHA 1Y3JA 4N47A 4U96A 3ADAC 2Y1JA 4C8MA 1IKYB 1H2TZ 1SJQA 4OLOA 4F36A 3CWJA 5M2UA 3I0SB 1WWHA 3FCHA 3EICA 3TQ1A 2KL8A 3IRWP 3R1HA 3ZZOA 1KTQA 1C0UA 2CPYA 3L09A 4J9KA 1UPMB 3CIMA 4X4VA 3DLBA 3MUMP 1U1LA 3IBCB 3H7HB 4O3PA 3PW4A 3OTEA 3CO9A 1JXVA 2Z57B 2YQ0A 2ZZMA 4A8YA 4H4KA 4OX9F 2WBMA 4RNMA 3ZNJ1 2ZH9A 1VI7A 3J80Y 1XEZA 2PE8A 1VC0A 2HS3A 2KJWA 3VVTA 2OFGX 3N01A 3KMQA 3M30B 4ZPDA 2N7CA 3EVMA 2ZDPA 4UOCA 4B17A 3IA0A 2HQGA 3MEEA 2IAJA 2ZVSA 4DWIA 1WD6A 2K1RA 3KHGA 4ILLA 1R0AB 4QWCA 4GC7A 2UUCF 3H5XA 1TMJA 4DL4A 5E0OA 5SUHA 1GH8A 1UFLA 2RQKA 4DUZJ 4RU2A 1FNXH 2HHXA 4DV2J 2YKNB 1Q86T 3TNVA 2DGSA 3KJVA 1KQKA 2QZ8A 4HYKA 1IR1A 3OTCA 3VZHA 1HNIB 4OZNA 3E51A 4NLWA 5HLFA 2MHNA 2JWNA 2B6AA 2VICA 4ALZA 1U24A 4DU7A 1NEEA 4ED3A 5B0DA 4OX8A 3DU5A 3MZIA 3GP9A 3MEDA 3UQSA 4I0WA 3ZFVA 1RCOB 2ZHBA 4U95A 3UDVA 1BC6A 4KO0A 1VCTA 1VBKA 1PYSB 1NJIT 2KKHA 2YBVA 2XLJA 4OYXA 3CT9A 4YHHJ 1O51A 5IXUA 3M8SA 2EI5A 4RUAA 3M05A 2W7PA 2W4DA 3VAKA 3Q2SC 3F73A 2ZJPQ 2CPEA 2A1BA 1HNWJ 3TVYA 1RAOA 1VDHA 2Z30B 3NNAA 3R5DA 3PCOB 3BB5A 3UDEA 3U1LA 3HI9A 4EEYA 4YB6A 1YJTA 4ZN1A 5AXLA 1BQMB 2CZ9A 5ETSA 3CDEA 4QR2A 4USMA 4XIUA 4F02A 1VQMS 1Y4ZB 4E98A 4LSNA 1TUVA 8RUCA 2IAJB 2RF2A 2WVEA 3Q2TC 4AFFA 2F8MA 2DB1A 2MY8A 4DX6A 4ECRA 3EM1A 5E33A 3TAQA 1FKOA 4F7VA 3PIOQ 3GCXP 2VASA 2HAFA 5H1SV 2NSBA 3SSQA 3NP5A 3FSXA 3P4UB 2VQFF 2BJDA 3LAKA 2NYIA 4O3RA 3DDNA 2H5IB 1TR0A 1E6VB 2QSFA 4LF9F 1FJCA 1Z1ZA 3V6JA 4DV6F 1TL1B 4A4JA 4URQU 2NXNA 5L46A 5J1PA 5D0RA 1UWAA 2X3GA 4L72B 3K0JA 1UPPA 4IQMA 5GAEI 2VG5B 5A8KA 5CA5A 5K8OA 1X7VA 3JQJA 3ILOA 3H5YA 2R8KA 1RWVB 4N8OA 1BQXA 1TKTB 4WKRA 4PWDA 3S6EA 1XWLA 3BZQA 3B78A 4OZLA 1YRXA 3NWGA 3DOLA 5LMUF 2DR5A 1TKXA 4DG1B 5F8GA 2DNOA 1RA7A 3G96A 3A8IA 4DQPA 4IR9A 2XWXA 1KLNA 2IM3A 1D8ZA 3W2WA 3FBBA 1KR4A 2PD1A 1U47A 4ZLPA 4W98A 2M2BA 2VZ9A 2B4OA 2DPIA 3FNNA 3RRKA 2QSWA 3KNAA 2MTLA 1FRIA 4GRSA 2HHSA 3UN3A 3NGKA 3AOAA 1FD8A 3MM9A 4ZKAA 1RWWB 1OPIA 3PO5A 4IQXA 1XMOJ 2YKMA 1HR0J 3NWRA 3OT9A 1FE4A 2H3EB 4OYZA 1KQSR 2YWHA 1QUVA 3Q24A 1TV6A 1NK9A 3UO0A 2RF2B 3MAAB 2CQ0A 1WSVA 1JJ2R 3IN5A 2W9BB 4DV4F 4KHPF 1WEXA 4LFAJ 1XNRF 2NSCA 1RQ0A 1S6UA 1FKOB 4OI4A 1TL3A 2VBZA 3M7VA 3KNGA 1TUGB 4OYWA 2WAQD 3DDIA 2XSFA 2HVEA 1IWAA 3IR5B 2BX6A 2EW9A 4X62J 2UXBJ 3ICLA 2HEKA 5E7OB 2ZUAA 4QYZJ 3J7A1 3SFUA 4CCHA 3I0RA 3VWSA 1D8YA 2EK6A 4I7FA 4I2QB 2ROPA 1H2VZ 2ZM6F 1N36F 1CJKB 2VD3A 2OEJA 2MKJA 3KLFA 1CJUB 4I6WA 4OMFG 3FVYA 2F4VF 1OY9A 3KK1A 2PDAA 2DBBA 1A0OB 4O44B 5JJBA 2C3UA 4OYOA 4QPTA 2JVOA 2XEXA 3CJ4A 4DR2J 1N32J 2PC6A 1B64A 2MDAA 3CCLS 4CT9A 3BGLA 4I2PA 2NREA 1BUXA 4ERDA 4TY9A 3BH7B 4WK3A 1F1BB 3EGVA 3BKTA 3TRGA 5J2MB 1S77D 2OD4A 3D28A 1LKZA 1JWWA 1Q7LB 3Q0AA 2Q66A 1LOUA 1WEYA 3Q8QB 2FGOA 3D68A 3EDQB 3W60A 1EETB 3THPA 3IGVA 1X4HA 2XMWA 5EWFA 3UR3C 3JSMB 4Q43A 3BF4A 3TVZA 1Q8IA 1ZAWA 3I6PA 4LF9J 1YK9A 4LFCJ 1YZ7A 2VOPA 4JV5F 3UN2A 4H4MB 2JLGA 2D3UA 3VGUA 3MM7A 4DL3A 1RKIA 5H9EK 4KKOA 3RU0A 1C1BB 4OQJA 4C9DA 1DAXA 4PWUA 4MKBA 4OZ3A 1GK8A 4CI0B 4WFNQ 5ETRA 3MOZA 2B5JB 4CO1A 4X84A 4ELTA 3ITHA 2DNLA 3BSCA 4AQYF 2V8VA 2KVQE 5HSPA 4ELVA 1EB0A 1KQGB 5CYMA 1NDCA 1RT5B 4MKYA 1RTIB 5C24B 4DCPB 4Q2LA 1JLCA 2EBGA 4RJVA 4DR7F 5LMUJ 3UD4P 1YRUA 2XNQA 5KFCA 2R3VA 2AYGA 1CSJA 5D77A 2IIHA 2VPYB 1S1VB 3EZOA 3HHKA 3V81A 3I0RB 4C6AA 3GIMA 1HBOB 4OZJA 3WDOA 2LU1A 4M94A 3RTVA 2KI2A 3GSDA 3M9NB 1PSDA 1EIYB 2ROGA 2XI2A 1KLMA 2FGCA 1EP4B 3RAXA 4DOZA 2LDIA 1VQKS 2RAQA 4LFBF 2E7WA 3ZO7A 2JSXA 2CDRB 4IUFA 1WG1A 4PRFA 2D7SA 2CQIA 1HHSA 1HNZF 4PQUA 1Q16B 3EGZA 5IV3A 1VGYA 1R8HA 4A8MP 2CQ3A 2RQ4A 3C2PA 3H5SA 4PAAA 3DKDA 2EG2A 1TAQA 2U1AA 5HQ8A 1PYOB 2BOAA 5KAKA 4P2FA 2RDIA 2HVIA 4ZJLA 2KM8C 3GCWP 1NHVA 4Q8FA 2GCFA 1BMQB 1FO1A 3NBPA 2IA0A 2KT5A 4ICLA 4ITSA 4C8LA 2GS8A 2GJIA 2IHR1 4P73A 4IRKA 1B4SA 4N7TA 4DN9A 1NB7A 2QA1A 3FEYB 2ZBQA 2J7UA 3K8WA 3H8YA 1RT4A 3TW0A 3QQCD 1IKXA 1FWPA 1V3ZA 1D0EA 3P5TL 3QZ7A 1RI7A 4P74A 3EVOA 2PFFB 5CYMB 1QVFR 3D1HA 3R5AA 2JZ5A 4ED2A 2VG6A 2AX0A 3KYLA 4FN5A 2XMJA 4C97A 4B3OA 4OIXA 1RUSA 3VF0B 2FC8A 2AX1A 2BANA 4YQWA 3OXGA 4FXVA 2DTJA 3V81B 2COLA 4HHJA 4QJVA 3OFEA 3OVSA 3PFEA 1HYSA 3TUIC 3D6HB 2JX2A 3RW7A 4UOFA 1ZPVA 1C1CA 1FK9A 3NRBA 3LQVA 3HX9A 3BBFA 3MMBA 4FPIA 2DH7A 1T8EA 3OL7A 4Z37A 1X4EA 2E66A 1S6PA 1K73T 1J2VA 1HNVA 2YNGB 5AXKA 1I94F 1S10A 1P9QC 1N34F 1I51B 4TXSA 1NXIA 2LXFA 2IY5B 3MPDA 2HNZB 2FHOB 2Y1LB 3MM8B 2GQCA 4XO0A 2XS2A 1OPZA 1NCLA 4K0KF 2AW0A 2OPRB 4J9RA 2CJAA 1OIAA 2F65A 9RUBA 3PACA 4DF4A 4LF4F 2VFTA 2FJXA 3SCLE 4OYIA 3TP2A 5HROA 3TANA 1KTVA 2VH7A 2J0QD 4JOUA 1H3DA 2G0IA 3IGNA 2N7YA 2W2PP 3CCES 4TQSA 5LJ5Y 4IR1A 4NEZA 4LF8F 3LUYA 2YPYA 1UW4A 5IT4A 5BXIA 1IKXB 4GKKF 1L3TA 2DHXA 4HEA9 3UI3A 3TUPA 1V5IB 3MCOA 1Y5NB 4LFBJ 1QAYA 2RDJA 3CDUA 1N5YB 2FQQB 1VC6A 2LXIA 1JX4A 2VG6B 4OI3A 4J5OA 2JFDA 3PXGa 2IA6A 2JC1A 2QLWA 2X7IA 3BO2A 3NCQA 1RHMB 4C0HA 4OV6A 1QD1A 4MT1A 2GV1A 3H4BA 1TMMA 1NLKL 1J5EF 3ZTPA 3CIZA 1UVNA 4UQGA 3V6HA 3WBZA 2MPUA 3EE3A 3R2DJ 3CCJS 1Q78A 1MWZA 3ENAA 3HULA 5AJ3F 4B9SA 2QEXS 1PAEX 1P27B 1S6PB 5HJYA 3EZ5A 2ILZA 1IBKF 3PW0A 5E41A 1DTTB 2BQRA 4O4RA 4LQ9A 1F6TA 2G1DA 1S57A 3MEGA 1P9YA 2HGLA 5IOLA 2WONA 5L1JA 4LRCA 4UZCA 2EFOA 1YTYA 4O4GA 1FDBA 1S79A 4RUCA 2YNIB 5A2QU 1S1UA 3ISND 5CCLA 4CLKA 2X1FA 3K5PA 4BS2A 1UW9A 4WFXA 4BDPA 1L3SA 1VQ8S 3N6LA 2DIVA 1S1WB 4K4VA 3CEDA 1WOSA 2U2FA 1PKUA 2MXYA 3C46A 3G82B 3CJKA 1UEUA 2MZSA 2CPFA 2AF6A 2K3KA 3TWZA 2GGPA 1S99A 2EXUA 4RW4B 2YKQA 4FVMA 3UCGA 2A3JA 1KRPA 3W3SA 1XMQF 3KLEA 1I94J 2HFZA 2WW4A 1G1XA 1SL0A 3A8EA 3ILLA 3W5YA 2MJNA 3HHEA 3MECB 2V50A 2HW3A 4ZHRA 4K0KJ 3R8YA 3CJ3A 3BYPA 2MQPA 2JH3A 4DQSA 2M5YA 4FDFA 4RNOA 5DRKA 4A48A 4C0BA 3OFHA 3QIPA 4DX7A 3QWUA 5FLXU 3IC1A 2VG7B 1WC5A 4AL6A 2DISA 4IO1A 3V6KA 2M4MA 4F26A 1JLFB 2FJEB 3POTA 2R8JA 3IM9A 5HAOA 2DGWA 4E8UA 4DDFA 2OPQB 2YX1A 3OL9A 4KH0B 3PRVA 3IXQA 4LF8J 2HKEA 1FFGB 3HHLA 4M5KA 4GKKJ 2R7SA 1VQSA 2QJ3A 2OO4A 3LP0A 3LAMA 5FD1A 1QY7A 1RBOB 3D0IE 4EBDA 2V4JB 1TZ0A 4HTJA 3KOAA 5KFXA 1D9AA 3QRQA 5LOQA 1F5BA 4CO4A 4K59A 4RNHA 1K1SA 1DQ9A 1HQUA 1UWBA 1Q7YT 1RT1A 4DL6A 4WIIA 3ENWA 3MPVA 2OFHX 2WVBA 3BBBA 5D0EA 3PX6A 2OPSB 1S48A 4WFBQ 4WF9Q 4Q44A 2HHHJ 4GVBA 2GGPB 4HACB 1T3NA 1APSA 2XY7A 1X4GA 2P6TA 4DUTA 3ZZRA 1CULA 1P8GA 3BV8A 3JTOA 2KXNB 2IMWP 3BDEA 2W2MP 4PG5A 1I1GA 1R43A 1MMLA 1WF0A 3FQLA 1RACB 2QYCA 3HPOA 2WW8A 2HQFA 2UUTA 1HBNB 2PMZD 3WQPA 2GAGC 2R7TA 3BSNA 1X60A 5BR8F 2AKWB 1H98A 1U48A 3T6BA 5A0YB 2HBYB 1NK7A 4CYUA 2EWHA 1R89A 4BC9A 2MQ8A 2FLPA 3ZZ0A 2ZWOA 4QW8A 1HBUA 2VOOA 2DXFA 2W25A 2IM0A 3T5LA 3AXKA 1TL7A 2NLWA 4B9TA 5EX3A 4B3SF 4B08A 3THTA 2DRBA 1YITS 3SZ2A 2Q6BA 4Y0FA 3DGVA 1FX4A 3TOQA 3O6QA 3Q8RB 2G2ZA 4L3NA 1IBCB 1R8CA 2MKIA 1O6XA 3OR2A 2MQLA 2HQDA 4LF5F 2M70A 2RMLA 3LP1B 5KFWA 2QLXA 5KFNA 4NX9A 3SSSA 5D4OA 2ZBRA 2HMIA 4DR6F 3RB3A 2CFXA 3QRRA 2EC2A 1HI8A 1IKVA 5HMWA 4LR8A 2W7OA 6FD1A 5A2QY 1RSCA 3N28A 1SCJB 2HWIA 3ZTOA 4WKYA 4X2BA 2VUGA 1CJTB 1OQ6A 2FHKA 3CGIA 2ZOFA 3ENVA 2HIYA 3UR0A 1RGVA 2WVFA 4A8WA 3JSBA 2KFZA 3N79A 4R8UB 2BMBA 3JQMA 4ZN3A 1FWLA 5GAGU 3HJVA 1KVJA 2HNYA 4A47A 3J7YU 4KPYA 4D3GA 1M5VC 4P75A 3CCVS 2RDDA 1M1HA 4HHHA 1SJ1A 1Y5LB 4WFYA 3LPEA 1NDPA 3G86A 7AT1B 3VAFA 2GQ2A 4NZ7A 2JNJA 5CYQB 2PIIA 4NLPA 3K57A 3OJSA 4ED8A 4DSIA 4X66F 2BE2A 3RR7A 2HWTA 5D4PA 1HBUB 3HFZB 3LP2B 2HG4A 4FBUA 3T1YF 3QSIA 4ED5A 2NQPA 1YJNS 5FLXY 4KRWA 4U7UD 2VC1A 4I6YA 2LA6A 3QT7A 2YKAA 3C6UA 2W2QP 5MLCV 3QAUA 4MJKA 2ZNZA 5BJRA 2HK3A 1FF2A 4Y2CA 1V5VA 2XBPA 1YI2S 4Q5VA 3CC7S 2KVIA 2V2KA 1NH8A 5EHHA 1HQEA 2W24A 3OR2B 5KFRA 4N76A 1SH2A 1B7YB 2XG8A 1LXJA 4DUYF 5B0CA 3AOCA 2AEFA 2BACA 3FFIA 4DCOB 4AL5A 2HVHA 2Z2LA 2LYVA 3GONA 3T41A 5I42A 2F4FA 5KG2A 2ZKTA 3I32A 3ETMA 5M2RA 2AGQA 5BR8J 4FNHA 1NK8A 3HLUA 4YS2A 4XTTA 2DYAA 3I4PA 1VRTA 4USIA 1X4AA 3I82A 4MFBB 3KK3A 2ZHAA 2EFPA 4X4NA 2LXUA 4B3SJ 4O0IA 3GR0A 1QAIA 3C66A 3E01A 2WB1D 5DM6Q 1VQ9S 1FRHA 3ET6A 4EU0A 1X5TA 2DNQA 1CQMA 2DEIA 2ZH8A 1CPZA 1PJ6A 4C2MA 4CLZA 3M32A 1JIHA 2HQCA 4I68A 2KFNA 2RQMA 1DQ8A 2ZD1A 2MMYA 5GAHU 3K5NA 2VPWB 3M4XA 1JLEB 4WIQA 2IBOA 2A2CA 5CYJA 1WKLA 4RW7A 2LQ8A 3EUNA 1DQAA 1IJEB 4CTAB 3R27A 2GFFA 4OHYA 4DMZA 1URNA 3CXCR 1FFSB 3GILA 4QOTA 2E5HA 5EWGA 2CKWA 3AD9C 5F8MA 5HP1B 4DPUA 1Q5YA 4PZVA 2FVPA 3OLBA 4C11A 1XMBA 4AYBD 1YJ9S 4DR3J 4C8KA 1HD1A 2E5GA 1L3VA 1IJFB 1DLOA 1RT7B 1HHTP 1DTQA 1ZA2B 4U8YA 1H72C 2QL7B 1QE1B 3DOMA 3UDLA 3MURP 3NGTA 4U8VA 5LJ3Y 1JXEA 1QAXA 2VL1A 3ZNUA 4TKTA 5F0WA 4QWEA 2YVSA 1FTRA 1HPZB 5F8JA 1SV5A 4Q45A 1U1MA 5IC4B 4Q0BB 1TFWA 1TQLA 4CQ1A 3PYGA 1F0XA 1OWXA 3DRXA 4LRFA 4JI1F 3E01B 2ACYA 1JLGB 1VRQC 4NI2A 1S9GA 2BYCA 3ET6B 2IDLA 1M1KT 2X51A 3ZTSA 3TX0A 2YX7A 4PG8A 3W8PA 3CPWR 3N4WA 1VMBA 3T1AA 1RAGB 3BS9A 2QMUB 2XS7A 5F9NA 4TVAB 4WU3A 5D3GA 1ULRA 1V3SA 4RWXA 2DT9A 1TELA 3C3LA 3RRHA 2CDQA 4ZVOB 2R7UA 4ED0A 2J0XA 2UU9J 4ID5B 5J2PA 3PRBA 4I6AA 2BJ1A 5IQ6A 2KU7A 4W90B 4DV3F 3FKBA 1J5OB 2O3DA 2LA4A 1VC5A 4PPZA 1MSWD 4K50A 1XQIA 3BPDA 2CJXB 3IRXA 5F3ZA 3DI6A 2ZH4A 2AJ2A 4KC5A 3MUTP 3RBEA 2MKHA 3P5BP 3P49B 3HT0A 1FD2A 3QT6A 4LUBA 1JNRB 1X5OA 2XMKA 1UA0A 2UXCJ 4X4PA 4DFJA 3G6ES 1REVA 1DLOB 3KLIB 1U0HA 5KFGA 4LQ3A 1K47A 2FHMA 3R3TA 4M1KA 4MMOA 1LW2B 2E44A 4DSJA 4BHQA 1NDKA 2KXHA 3U7JA 1FCAA 4J9LA 1YG0A 1M5SA 5GVQA 3W2VB 2L9NA 3DLJA 4QWBA 4QZVB 4UF4A 4CM0A 1WG5A 2KHCA 4NCGB 1Q79A 1LW0B 1MROA 4LT6A 4ED7A 2M52A 3ILIA 2XMAA 2JFKA 1VOMA 2XY6A 3TUJC 2AZ1A 2B4VA 3QRPA 1GEHA 4I4BA 2GVDA 4DF8A 2Y9HA 2DITA 4I56A 2MEWA 2DNKA 2J5AA 3A3OB 1WDDA 4NI2B 3MUVP 1S9GB 3L9ZA 1S7HA 1LWXA 2JRSA 2WCXA 1RAAB 3BEGB 2DR8A 3DYAB 2D3OR 3F0NA 3SDEB 2AV5A 4RW9A 2HK2A 2Z0GA 4CIOA 4WP3A 2ZZTA 5L9NA 3MMAA 4NLSA 5E3CA 4MAKA 4BBYA 2EFVA 3BKUA 3OLAA 1TKZA 3TI0A 3K8VA 2ZNYA 1URRA 5LSOA 3PEHA 4LSLB 1SQGA 3IRXB 3G8SA 2MQQA 5IT0A 4C4WA 5CAAA 3D9BA 1VBYA 1RK8A 5FJ4A 1EQ0A 3PZPA 5EWEA 4UT4A 3M8PA 5C42B 1LK5A 3NGSA 1U25A 3ZC4A 1REVB 2FY1A 2IC3A 3OFGA 1M1GA 2IM1A 5C25B 1NHKL 4UQTA 2IFXA 1XR6A 1CS4B 4HL9A 4RNFA 3RAQA 1XBWA 4RWWA 5GAEU 5ETQA 2DXDA 2X1AA 2VV5A 3IM8A 1FXRA 2QT7A 5KT5A 3A12A 3R5JB 2B8PA 1K8AT 4M95A 1F60B 3WZ0A 4B02A 4YY3J 4Y2IA 1WF1A 2OIHA 4CO2A 1MNEA 4ILMA 2GIRA 1HD0A 1DJ0A 2V8DA 4ANDA 1RZMA 2CQ4A 1XC9A 4RR5A 4ZIVA 1JLQA 1FRMA 2GVDB 1N33F 1VIOA 1PJ7A 3KHRA 2OHDA 4PYAA 4J9VA 2LLZA 4DV1F 1H7XA 4JI0J 2C2MB 2EBEA 1RA6A 4AXJA 2FLOA 1BE4A 2X3DA 4CH1A 4ZP9A 4DQQA 2LQJA 4B9LA 4IDKB 1JLAA 1Q5VA 3N6MA 3IG1B 3NOGA 1SKWA 4ZCIA 1N6QA 1SB6A 3W64A 2GO8A 1NK6A 2CJKA 4DBQA 2FZCB 3MMAB 4BLGA 4IFVB 1KD1T 3H90A 4WPAA 1E6YB 4DV5J 2B0GA 1LWFA 3ZTQA 5A76A 1WEZA 2WB4A 4IFYB 1ZM9A 3L95X 2FY8A 5IC6B 3J81U 1RHRB 1OMSA 1OO0B 4YR3A 3H0PA 2FPHX 4F4YA 1B0PA 4JP8A 5DG8A 1R8BA 3G6YA 4NA3A 1ICEB 2OJ3A 3CJRA 1CJVB 2DEJA 4LRAA 3SV3A 2DGOA 3M1VA 3CJSA 1Q8LA 3IAS9 1FKPA 3NGDA 3MM5A 3E2EA 2XB2D 2V2QA 4PG6A 1IKWB 4ED6A 2EFGA 4N56A 1LWEB 1UA1A 1WKKA 3Q8YA 4QYZK 3I4HX 4A8XA 5DQGA 3QJPA 2CVEA 1PCAA 2QMXA 2YNFA 2W9CA 4WE1A 1ZAXA 4YFUA 4B3MJ 3MM6A 5L1IA 2V4RA 2GMLA 2HBRB 4DV7J 3CCWA 5H9FK 1HBMB 5KT4A 3SQOP 2OP5A 3F44A 2NS1B 3PVXA 1F3FA 1U6BA 2YKPA 3W62A 2Z2YB 2VC0A 1SC6A 2AQ4A 3LANA 3PYFA 3CC2S 5HL7Q 2FJVA 2JJ4D 3UWTA 5KFVA 1W7WA 4ZCKA 3KLGA 4Y6IA 3K17A 4LBIA 1T95A 4A46A 3CDAA 3Q8SB 5KFBA 4JYAF 4OHXA 3M2UB 1M5PC 2I6WA 3PV8A 5KFPA 3GYGA 1TKDA 1WELA 2OGUA 1KOHA 3A13A 5LXYA 4QW9A 4C8NA 3R97A 4GVLA 3RBDA 2W4PA 4KFBB 5GAGI 3NXZA 1M5KC 5HK4A 3DFEA 3SCIE 4TU7A 2VONA 3IWNC 6AT1B 3E3XA 2R4FA 3Q83A 1VQ5S 3HM9A 1HLWA 1FWKA 1N56A 2MGZB 2J7WA 2YXLA 5DGBA 3E8OA 3DRRB 3U1MA 3QWPA 2MSTA 4HR2A 1VJQA 3DRSB 4NLYA 3NNHA 2ZH1A 1ZOTA 2UVVA 2XWYA 3V4IB 4ZPBA 3GJTB 1PC4A 2GHWA 2RS8A 4OYPA 3VCDA 4B9VA 4C3LA 3GIRA 2CNOB 1PYTA 1B99A 4KPCA 1AFIA 1FT8A 3MM5B 4A8KA 2CNLB 1QM9A 1IQTA 3QGPA 4AUKA 4OI1A 1R0CB 4C8OA 1RHKB 2HHUA 3T3FA 2ACMA 1ZTWA 2J8SA 4HI2A 4LIRA 1HL6A 4WJBA 3GR1A 1WACA 2BVZA 5KFUA 1SXLA 3KKFA 3Q23A 4F67A 3DMJB 1O0PA 1REGX 4QR0A 1FVSA 3C15B 4P9SA 1S1TB 3PEJA 1ZAVA 2VDIA 3QSYB 2K3IA 4FBTA 4ZPCA 3HVWA 2DH9A 4KTQA 2LEBA 3DM2B 4EZ6A 1T9YA 2ABYA 2EG1A 2IJNA 2AP6A 2ATCB 3NS6A 3T9ZA 3QBCA 2E9RX 1A6LA 1HHQA 1HFEL 5HMXA 4M5GA 4NE9C 2KDOA 3KJFB 1ROFA 4W92B 2N4CA 2QYGA 3DLKB 4OX7A 4J9QA 3KTQA 3KG0A 1B3TA 1ZYQA 3DLGB 2XMVA 2OLWA 2UVRA 5ETOA 2HS4A 4NZ6A 2IBKA 4JI8J 2BDPA 2CWKA 2DCUB 3P8BB 2ASJA 3TAMA 1VHFA 5E3AA 2VIHA 4R0EA 1FXDA 3DRYA 2OI2A 4PPDA 4EBEA 1K0TA 3RR8A 4C3MA 1U0SA 1T9UA 1QJHA 3M30A 1XIQA 1Y5IB 3PM9A 1M0SA 2ZZNA 3KUHA 3PX0A 3WC0A 3ZZTA 4LSZB 3J81Y 1WSRA 2RUSA 3JS9A 3CMES 3R7NB 1R0AA 3I5AA 1U2CA 2SXLA 4UOGA 1SQEA 1RT6A 2MQNA 1DARA 3LGHA 2G4BA 1N88A 2YKNA 3HD1A 4USVA 3AH6A 1DFDA 2C2NA 5IV4A 2MKCA 2FLLA 4DCJB 1KEKA 4MYTA 4LIWA 4F2SA 3IWXA 5KG3A 1QUPA 1HNIA 2FJAB 1BWVA 2GNKA 2CQHA 1TK5A 2NXJA 2WOMA 2DIUA 3GPAA 1YJUA 3NAHA 3SCJE 3MPWA 3LW5C 2CZ4A 4J9PA 5KG6A 2VJUA 1CVJA 4PABA 2UUAF 1R8PA 4HLBA 3ZTRA 3C6TB 3AJDA 3HKWA 2YWGA 3TR5A 3VTIA 2XMTA 1P1LA 1KWMA 2VU5A 3QAEA 4MIAA 1HQ2A 4XPCA 1X5PA 3OXFA 3OFFA 4J90A 2CQGA 1H38A 3TQEA 3QLHB 2Z8QA 1RHJB 5A8WB 4L73A 1S4EA 3LWLA 2Q3PA 3TA1A 2ZHOA 4C3KA 4ANCA 3T1HF 2P8IA 3BREA 5KG5A 1DRZA 4DPYA 5DM7Q 1GMWA 3FCVA 1ELOA 2CNKB 4JI2J 1RXOB 4DR5F 1GX6A 1QSSA 3TAMB 4AL7A 1GFWB 1C4CA 2NPFA 2B4UA 4KE5A 3OSPA 1X5SA 5KFSA 4RW8B 3UE2A 4OZ2A 1MWYA 4K4YA 3R7BB 3C8YA 2D3O1 2VB6A 1BQMA 1PILA 2I1RA 3A3NB 4MK9A 3EMTA 2KZZA 2POKA 1W25A 9ATCB 1YKWA 3HZGA 2F5GA 1S9EB 4KHRA 4LF7F 1YDLA 4FS2A 4NXMF 5GMEA 2DCLA 5EDWA 4X4SA 1IN0A 1RT6B 2KXFA 1RWPB 3KG1A 2PO4A 3I96A 3B54A 5KFOA 1VQ4S 4QIVA 2RS2A 3CCUS 3QGIA 4DN0A 3Q22A 3GIKA 4FXDA 1E6VA 5C5JA 2I9SA 2HPUA 2WOMB 1RAEB 3PHTA 1CLFA 2QLBB 5I3UA 4R5PB 4LR7A 1S0NA 2VDHA 3JXOA 4G1QB 5I3PA 1SC1B 1TL1A 4ZOSA 1VFJA 3BBCA 2BW7A 4F2RA 2DGXA 4JI3F 2XLIA 2VG5A 1RU2A 4DR4J 2JHEA 5LXRA 2E5LF 1TKTA 4C8YA 2BW2A 1IBLF 4ZPAA 2C3PA 2G1HA 2RILA 4NL5A 1EKRA 1CEZA 2L9WA 3J7AN 4DG1A 3D1OA 3KUGA 2W7AA 3U27A 3EGWB 5IWAJ 2BJ9A 1RTJB 3I5CA 1U1PA 2UUBJ 3AA9A 1NAQA 5LT5A 3KXDA 3R7SB 3R9LA 1F2HA 1VIXA 4B3RF 3D2WA 4R0JA 4RO0A 3OVAA 4LRDA 4MIWA 2XZTB 2MKYA 2KH9A 4QU7A 3TVKA 4JI5J 1RAJA 2FJWA 2CUYA 2Y3YA 3HVTB 1FXLA 2M3DA 1ZM3A 3W7BA 1KDNA 2CJYB 4E0DA 2WTFA 1O5JA 5G0RB 5B0GA 4RPFA 3MAQA 5F0UA 2HVZA 5AXMA 1FHTA 3IS9B 2KYZA 3NG8A 3MAAA 3C14B 1Q1KA 2W9BA 4JI4F 3L7UA 2LVWA 5KT7A 1WC0A 2HHVA 3CF5Q 3GG1A 3TAPA 4NA1A 4CH7A 4A8OA 2BRLA 3OL8A 5B0BA 1HWIA 1IM6A 1RISA 3H2LA 2BKOA 2GZOA 4I2QA 1X4BA 5I3UB 1X4FA 4HDHA 1CJKA 5CD4A 1CJUA 3GG0A 1FI4A 4B9MA 4OX9J 3B8HA 5K9FA 3D6FB 1FEEA 4O44A 2V34A 4TQRA 3NEKA 1VISA 4KGZB 1WHVA 4AE5A 1D9FA 1TL4A 4KYZA 5LMNF 1NJZA 4F3MA 3TX8A 1GNKA 2M88A 4RX6A 4Y3CA 2XGQA 1RT2B 1VQOS 1VQPS 2FB0A 3AJ2A 1LXNA 5J2MA 4YB5A 4NA2A 4HKQA 1L3UA 1WI8A 2Z58B 1UEVA 1YSJA 3MI7X 1L3KA 2UUCJ 3WIVA 3NCRA 1KVIA 4EUVA 3W5XA 2XGPA 4OI0A 4Y2KA 3QO9B 1EETA 1YQHA 1BQNB 5B0AA 2HRTA 1YGYA 3JSMA 3W9HA 1U1KA 2D9PA 4OZ1A 2HSEB 3AQOA 3OV7A 4CLSA 2I5JB 6FDRA 5T7LB 4ECTA 2XS5A 4H4MA 2E1AA 3JSYA 4ZPWR 4RU9A 2HNDB 1OSDA 1C1BA 1WHWA 3GIIA 1Y7PA 4O3QA 1RYSA 1Y3KA 2B5JA 4JI3J 3AA8A 4WU2A 4NYOA 1TVRB 3CJ8A 3T6JA 1RT5A 2RVJA 1RTIA 5C24A 2BM1A 1BY9A 5K8PA 1IBLJ 2KFYA 4HH1A 2J6UA 3MCNA 3M2RA 2VPXB 4J9NA 2HURA 1S6OA 2DGVA 1S1VA 1S5ZA 2LKZA 2GJFA 1HBOA 1UAWA 2YNHB 3M6XA 2KYXA 1FNOA 3TEGA 3AD8C 2RKIA 3MR7A 3BPSP 5J1EA 4FXWA 4B3RJ 2E1PA 3EGNA 2K8GA 3BGRB 5H9FJ 2CPZA 1Y10A 4NCBA 4GO5X 2QTWA 2CPXA 5AE3A 1T9VA 1EP4A 4PXEA 2C2DA 1FJGF 3WX8A 8AT1B 2QV6A 3LTOA 4K5SA 4ECXA 2RRNA 4BCAA 3PR4A 2M8HA 3NAIA 2KHDA 2Y1RI 5D4NA 1FA0A 1KOOA 5B0FA 3KMSA 2PEBA 3EXCX 4LJMA 1N5QA 2KJVA 3M9MB 1N4LA 4RLEA 3DLHA 3IWLA 4K4UA 2ZDOA 4QIFA 4QQBA 3V6DB 3CD6S 1VYAA 3AXMA 2EEYA 3L4BC 2QFJA 1H2UX 2VQFJ 4UY8T 3HKZD 3GV5B 1GTHA 1HIYA 1S4FA 5IZHA 1F9HA 3KDOA 1XNQF 5KTQA 1OS5A 3UVJB 3F41A 2DGQA 1LFPA 4CP5A 2D74B 4DV6J 4YN3B 5IM0A 4DR1F 4A8FA 5ETPA 4IG3A 1HI0P 4QPXA 2ZOGA 2V68A 3X3UA 3GFZA 3MMCB 3ZZYA 1U7LA 3RZAA 2FVQA 1HW8A 3NGUA 4ZVTB 2HFOA 3VGVA 5AE2A 3MOJB 1F3VA 4WP8A 4OLPA 2EVZA 3M2RB 4IYQA 1JJCB 4M5DB 1T02A 2CWXA 2V9KA 2DNPA 3JYTA 1VRUB 2NPIA 1X0PA 3H98A 1NSQA 2RKIB 1Y00A 2OTLS 1ZZNA 2L48A 3JB9k 2ALZA 3O8WA 2DNZA 3HCXA 5J1EB 3H40A 5HQLA 4HT7A 2JLEA 2QA4G 2GIFA 1HWUA 3I9ZA 2HRUA 1WHXA 4EO6A 2QIFA 4O3NA 4CO5A 2HHWA 4P7TA 2B9EA 1ACMB 2H65B 3I56S 4H4OB 1SIZA 3ILJA 2YNGA 2H1YA 3VZIA 2ZFHA 3CC4S 1G3OA 2HNZA 4DV4J 3JAMU 2QLFB 2OH2A 3MM8A 4KHPJ 1XNRJ 2MZJA 1AB8A 1IXKA 2Y1IA 4DL2A 3QZ8A 2DD8S 2R7QA 4OZ5A 2OPRA 2LFVA 2MLXA 3GB0A 3ZZZA 4FYDA 2CA9A 1RLDA 1TP7A 1SQFA 5HMYA 4A8QA 4IO9Q 1FDNA 2YTCA 2WBRA 2CVIA 3VAHA 4Q7AA 2DGTA 2Y8YA 5DJBA 3VV2B 5DQHA 2KZMA 3EXYA 3TJ9A 2C22A 1PG5B 5MAOA 3KHLA 4P52A 5E3QA 3VGSA 3KK2A 2V8HA 3WIUA 2ZM6J 1N36J 3PW2A 3HHLD 1RJJA 4XDDA 4X64F 2F4VJ 4DV0F 3PTWA 2DHAA 2ZOMA 4KH1B 5IM0B 1EZZB 4A8SA 3UDCA 4IG3B 1WI6A 2V6AA 2BQUA 5J2NB 1HNXF 3QYYA 5HANA 2F40A 4URGA 2YH0A 1N5YA 2JC0A 1YRTA 1AUSL 1X9SA 1RAIB 4PCQA 1PBAA 2QGFB 2GHVC 3JYTB 2A10A 2F9JA 3V5RA 2A6OA 5EUHA 4ZITA 1K0VA 4ZJOA 5HVGA 3HMJG 4K4WA 2HQ3A 5ITHA 3N5FA 2CQDA 2BJ8A 2K2PA 2OSRA 1Q8BA 2XTJP 2IPOB 1KONA 4KR0B 1MU2B 3SMZA 1JK9B 2Y0SD 5KT2A 4Z7CA 4USWA 2AEJA 4F04B 5D15A 2BJEA 5K14A 4JV5J 2BJ7A 2RU9A 4NLQA 2ZBIA 1DTTA 1AZSA 3OXLA 1SL1A 2CXEA 2V9WA 1RWMB 3VAJA 4AQYJ 3OUYB 4ZVGA 4X4QA 3OTDA 4FS1A 3EZUA 4DUZF 4DV2F 3TA0A 4PG7A 2PN6A 1YHQS 4J9OA 2YNIA 1VQYA 4DR7J 3IBFB 3OVBA 1R3NA 3IMQJ 2C3OA 3PW7A 2XSJA 3KFWX 3THVA 1S1WA 3H5UA 4XK8C 3KJQB 4XAKA 3PYEA 3DRPB 3M8ZA 1N5TA 1RT3A 3KK2B 3G82A 5F8HA 3OTBA 3N0VA 5GMDA 3T5KA 1N54B 3MEKA 4WCEQ 2BA9A 3M8QB 1T05B 1G7CB 3G71S 2O66A 2IRYA 4RW4A 5J1NA 1NZ8A 3LGMA 4UOHA 3SQGA 5IFMA 3MGJA 4F3QA 3ISNC 1X4DA 5HI7A 4RW6B 3M6UA 1UVJA 2IJFA 3NS7B 1ZBTA 3CCZA 2XI3A 3ISZA 2EC0A 4YHHF 1HNZJ 3DLEA 2J9CA 1C0TB 1WC4A 1OYEA 2XHCA 1S97A 1AROP 3VVUA 3MECA 3RYLA 1P6TA 4TY8A 5GADI 2C2KB 2RIJA 3OHAA 4RNNA 1XN9A 1HNWF 3K89A 4S0MA 1NNDA 3NS5A 3H25A 1LK7A 2VQEF 1Q53A 1X4CA 4UW2A 2A0FB 4M5JA 2HZCA 1Y9OA 2O67A 1D3WA 2VG7A 2RNEA 4FYXB 3D3BJ 2C2OB 1JLFA 1SUQB 5K14B 2FVCA 3QFHA 3BGOP 2OPQA 1BXNA 4NASA 5K20B 2JEIA 2L41A 4WFAQ 2BUNA 1AZSB 2IMOA 4OJ1A 3LGNA 2C28A 1YX2A 1WHYA 1S1XB 2X1BA 3M8RA 4NCAA 2J9DE 3HHNB 4DQRA 2V5HG 1QSLA 3OJUA 2KT2A 4Y34A 1HNXJ 4PQAA 5ETTA 2CPIA 2C2RA 4ED1A 2V2ZA 7FDRA 4EYHB 2NXEA 3TEHB 2V4JA 2R2UA 2IRXA 4F4WA 3V2UC 3JAMY 1RADB 3MD3A 4RUHA 1S0MA 2XSJB 3LO3A 3TZZA 1HI1A 1DZ5A 3B4DA 2MJUA 4KB7A 4WXOA 4V1Ak 1IBMF 4H54A 3BR9A 1RT3B 3LA0A 3KLHB 3SV4A 4I64A 3EDRB 4ZDNA 2PA3A 3RB4A 3FMWA 4DQIA 4N77A 2OPSA 4USUA 4JV0A 1HARA 4HACA 3QT5A 2XHWA 1NJWA 4ETXA 4L3KA 3O3LA 5K5MA 3FDSA 4X4UA 3FUYA 5EGYA 2V8PA 3SQGB 1SL2A 4BWMA 1U49A 1OJ4A 4OI2A 2OSQA 1VQ7S 3R6GB 2VA3A 4IG0A 3P96A 4EK2A 5HBMB 5L1KA 2GHPA 1HWLA 4WZMA 1SKUB 2ZH3A 4AT1B 4F0MA 3RUBL 1KBRA 2QRRA 3DLEB 2MLYA 1N34J 2FVRA 4G1IA 4PUOA 1VQ6S 4QWDA 2JEGA 1YJVA 4TY8B 3AB2B 3K58A 1HBNA 1G2EA 3TUZC 4FVCA 3FC9A 2R7OA 5K8MA 3MMJA 1LWCB 2Y8WA 1I3OB 3K59A 1U6FA 4LF4J 2H48B 5A0YA 3CCQS 4WTYA 1N0UA 4P2MA 2I8EA 1GXTA 3H59A 1AYEA 1NPRA 2ZWPA 3TZYA 1XMOF 1HR0F 2L9DA 2R42A 3FSYA 2DR9A 3R5BA 1XTZA 5I4MA 1OQ3A 3Q89A 1EAYC 4LFAF 4USHA 2JLFA 3P45B 3HSJA 4DJBA 5K8NA 3CJ0A 4RL1A 1GQEA 3MDFA 4B9UA 2C2EA 1SKSA 2V67A 3UCZP 3U1NA 1SC3B 3LP1A 2Q43A 1CC7A 3GJSB 4X62F 2UXBF 1C0UB 5CH7B 2UV8A 2FVSA 3JTPA 2XY5A 3AAWB 1W2BR 1MWQA 5HATA 3UPFA 5FDLA 1X9WA 1J5EJ 5JUMA 2XCPA 1L5UA 2VQEJ 2NUHA 1PAUB 1CJTA 4K4TA 3D67A 4Y2MA 2MHEA 3T9NA 4DR2F 3CJTA 1HKAA 3L3CA 1N32F 1R7IA 1DY3A 2OEKA 2JEFA 3DXBA 1H7WA 5AJ3J 2DNHA 4R8UA 3HVRA 3D5MA 4IG0B 3EPGA 3CDWA 5KOXA 3J7ZT 1IBKJ 4QR1A 3A8JA 5J2QA 3NKYA 4ID8A 2VPZB 5CABA 3VALA 2DH8A 3H2UB 1BGXT 3MEEB 4CLFA 2K1RB 4F4AA 3BN4A 5KFIA 4PUOB 2EPIA 2FLNA 3HSZA 1HW9A 2UZAA 4NRTA 2F1FA 2HAIA 4OFZA 4EGLA 1QTMA 2VF3A 2LQBA 2Z4PA 2DR6A 4L6V3 3G4SS 2M7SA 5L1LA 1NBEB 4K5RA 3DXSX 3OR1A 1YJ7A 5JVGQ 4DLEA 1SBRA 3ONQA 3KJVB 4HTIA 4ZCLA 5CYQA 1NJYA 2IJRA 4X4TA 2ASDA 2E9ZA 4LFCF 2HQIA 2DNYA 2P9CA 1JNZB 3BN7A 1IBMJ 4HHUA 5HLFB 3LP2A 2B6AB 4QYRA 5L39A 1NK0A 3CTRA 1N0VC 4YDDB 2RRBA 1UJ4A 1J27A 3MCSA 1U8WA 1HA1A 4Y28C 5B0EA 2VBXA 1KQFB 4AD6A 1T03A 1SI9A 3MEDB 3P6YC 2K7JA 1ZPWX 1XJWB 3NCPA 2QN6B 2NCKL 4KO0B 4CRJA 1XMQJ 2WVCA 5IS2A 1WTFA 2N3OA 3JQKA 2M8DB 3TO8A 1D9DA 2FHJA 2RRAA 2G0CA 3O5TB 1VQLS 4ECSA 2QX0A 4UY85 3AT1B 5FDLB 1WUUA 2CIMA 2KT3A 4EWTA 3PRDA 1AFJA 4K2JA 3RGIA 4NEYA 2LQ5A 3KG4A 2R7VA 1Y0HA 4ANEA 2V63A 5JXSA 2DO4A 1Y11A 5DG9A 4MFBA 1NKBA 2DRDA 4PG4A 3OW2R 3OSNA 4J9MA 2MYFA 2FYXA 3O1LA 5B09A 2NZ4A 1PIEA 3MAHA 3MF5A 5J2QB 3FEZA 4LSNB 3MFHA 1KP6A 4CLLA 1QAJA 2MZ1A 1B70B 1WOOA 1ZM2A 2J76E 1WOPA 4DL7A 2XZWA 3EPIA 4F3OA 5A6PA 3S1TA 4NYPA 3CJ5A 1T3OA 3GZ7A 1X31C 4ER8A 3SIPB 3OR1B 4JI7F 4L76A 5LSLA 1UVMA 2AWZA 2NUUG 3UW1A 1F9EB 3IR7B 4DFPA 2DY1A 3GV7B 3LPYA 1JLEA 3HFVA 4P10A 1NKEA 4O23A 1UVIA 4I1TA 2ROEA 5THWA 4CNZA 3W5ZA 3W9JA 4CTAA 1Z2LA 4F4XA 2B9WA
chains in the Genus database with same CATH topology
2WSFC 2MKCA 5AJ3F 3CVKA 4B9SA 2QEXS 1RDRA 2FLLA 1KEKA 3VAMA 4NLXA 4MYTA 2VFRA 2C3YA 4EYIB 1P27B 4LIWA 4F2SA 5KFEA 3IWXA 2DNRA 5A8KB 3PJWA 5KG3A 2ZJQQ 1S6PB 1QUPA 1T03B 3H4DA 2ILZA 3EZ5A 1IBKF 4NOHA 1HNIA 2WK4A 2FJAB 4OHWA 2GNKA 2CQHA 2ILYA 2ZH2A 3PW0A 3DU6A 4EFAC 5E41A 1TK5A 1RWUA 1DTTB 2BQRA 2WOMA 5HP1A 2DIUA 4O4RA 1YJUA 1U45A 3NAHA 4LQ9A 2G1DA 3SCJE 3MPWA 4PWDB 2EFQA 3LW5C 2CZ4A 3VAGA 2PT0A 4J9PA 5KG6A 3MEGA 1WF2A 2UV8G 4F8RA 3AB4B 4OJHA 2HGLA 1CVJA 1PGZA 3NMAA 2ASYA 2UUAF 1U1NA 1R8PA 2A2DA 3DOLB 4HLBA 2WONA 2LEPA 3C6TB 2LECA 5L1JA 1TKXB 4GKJF 2EFOA 5KFQA 3CJ2A 3HKWA 2YWGA 4H4OA 1RT7A 4ECZA 4O4GA 3TR5A 1YTYA 4PXCA 1FDBA 3VTIA 1S79A 4RUCA 2XNRA 3K7RA 4WYLA 2YNIB 3MTKA 1S1UA 3ISND 2XMTA 5CCLA 2X1FA 3K5PA 4KV8B 3CMAS 1QE1A 1JJ4A 1P1LA 1MROB 2HYIB 4BS2A 2I0XA 2L3MA 3QAEA 4MIAA 4WFXA 4BDPA 4XPCA 3W2WB 2AJQA 1X5PA 1L3SA 1VQ8S 3OXFA 3N6LA 2DIVA 3OFFA 2JVRA 1S1WB 2DNGA 2CQGA 1F5CA 2BXJA 1H38A 2O01C 4K4VA 4DLGA 4JV2A 3PKMA 3CEDA 2PI5A 4CNYA 2ZH7A 2U2FA 2MXYA 3BGFA 3C46A 3QLHB 2Z8QA 3RW6A 3CJKA 5A8WB 1UEUA 3FJ2A 2MZSA 3LWLA 3MM9B 1XR7A 2Q3PA 1HPZA 3ZZPA 3HF5A 3TA1A 3MR6A 4NYZA 2ZHOA 4C3KA 3T1HF 3BREA 2CPFA 1NO8A 4N5SA 1A9NB 5KG5A 1DRZA 2AF6A 5KT3A 1YIJS 2K3KA 2AJFE 4YB7A 4ECVA 3JTNA 4O3OA 1NH7A 5DM7Q 4Q0BA 2GGPA 2YKMB 1S99A 4FF4A 1XR5A 1R27B 1ELOA 2P6SA 1S6QB 2X1GA 2DRAA 2N4DA 5IT9Y 4RW4B 2PI4A 4OHZA 4DR5F 2V4QA 5D4LA 1GX6A 2YKQA 1QSSA 4ZP7A 3TAMB 4AL7A 4FVMA 3CCMS 2AGOA 2CQCA 1C4CA 2JEJA 2NPFA 3UCGA 4RW9B 1TV6B 2A3JA 4V19J 2B4UA 1YJWS 1KRPA 1JLGA 1NJXA 2UXDF 4KE5A 3GE9A 3B4MA 3W3SA 3OSPA 1X5SA 5KFSA 3K2YA 1KHWA 1XMQF 3BO4A 1KQSR 3KLEA 3GQCA 4USJC 1HMVA 4RW8B 3MTJA 3UE2A 3N9UC 1MWYA 2NQPA 1BLUA 4K4YA 2HFZA 1G1XA 1QLNA 1SL0A 3C8YA 3N6NA 3A8EA 1AXQA 1TL3B 1BQMA 1PILA 2I1RA 2VB6A 4MK9A 2MQOA 3KHHA 2N3LA 4KIAA 2KZZA 2MJNA 2POKA 1TFYA 3M6VA 3HHEA 3MECB 1W25A 3HXMA 4K4SA 1FNMA 1FRKA 3GIJA 5J2NA 1UJ5A 2LDYA 2ZE2A 1TKZB 2HW3A 5L8RC 5KFTA 4ZHRA 3HZGA 4ZVFA 4P6QA 1N5VA 4IKAA 1FRJA 1S9EB 4KHRA 4FF3A 4LF7F 3CJ3A 4FP9A 3Q8PB 4FS2A 4NXMF 1VK8A 2VKRA 2MQPA 2BR0A 2IYGA 3QPIA 3BJYA 2KG1A 2DCLA 2JH3A 4G3IA 4DQSA 3BR8A 5E5NA 5AXNA 2M5YA 4RNOA 4QU6A 4ID5A 5EDWA 4I7FB 4X4SA 5DRKA 1IN0A 1SJRA 4A48A 4C0BA 3OFHA 3FQKA 3QIPA 1RT6B 4KJIA 2PMHA 3CE8A 2KXFA 3QWUA 3KG1A 2PO4A 2YY3A 2RH3A 3AJ1A 3I96A 4ZA1A 2GJ2A 3IC1A 2VG7B 4OZ0A 3KLFB 3ZZUA 1NHUA 5KFOA 4AL6A 1VQ4S 2DISA 2XULA 4QIVA 4IO1A 3V6KA 2M4MA 2RS2A 2G9OA 1J5OA 4F26A 3CCUS 3HHLC 3KK1B 1JLFB 3GFYA 3M8PB 2FJEB 3QGIA 3I87A 3POTA 4DN0A 1RTHA 1YJRA 2R8JA 4UUXA 1Z2ZA 3Q22A 4U9RA 1FESA 2IC3B 2DGWA 4JI8F 4E8UA 4DDFA 3GIKA 2OPQB 4FXDA 2YX1A 3RRGA 4NZ0A 1FDAA 4N41A 1C4AA 1E6VA 2J9EA 2PGCA 3OL9A 1MU2A 3IXQA 5C5JA 2I9SA 2HPUA 2WOMB 3HHLA 2FC9A 4I2PB 4JI6F 1GXUA 5I3UA 1S0NA 4R5PB 1CLFA 2E1RA 2E5JA 3T5JA 4PXBA 4F50A 2R7SA 4F4XA 3U02A 5LSRA 4G1QB 5A6WA 5I3PA 2YQ3A 1VQSA 2E9TA 4DS5A 1TL1A 2GMHA 4ZOSA 1VFJA 1DHMA 1JKHA 2OO4A 2B56A 4F2RA 5KFYA 3LP0A 3LAMA 4DL0C 5FD1A 1WTBA 1QY7A 2DGXA 5L9XA 2BV3A 3D0IE 2XLIA 4EBDA 2V4JB 2VG5A 2V94A 4JI3F 4YR2A 2YH1A 3KLIA 1TZ0A 4CZCA 2AJ0A 2OTJS 4HTJA 3KOAA 4P2SA 2VFVA 4NLGA 5KFXA 1UETA 4OI6A 4ZCMA 3I5BA 2JHEA 5LXRA 2E5LF 4KQZA 1TKTA 5GMKa 2R2SA 1D9AA 1KSPA 1LW2A 2KO1A 3FRZA 5KFMA 1QSYA 4IRCA 4IOBA 4C8YA 2BW2A 1IBLF 2ASLA 2P9EA 2WHOA 2CQ2A 4XDCA 1JLQB 4ZPAA 2C3PA 5KFLA 3OUYA 2RILA 4NL5A 1F5BA 1NK5A 3AQPA 1CEZA 4CO4A 4K59A 2L9WA 4RNHA 1K1SA 4DG1A 1UVLA 3W2VA 4GC6A 1GXLA 1DQ9A 3IAM9 1HQUA 3D1OA 1UWBA 2W7AA 3U27A 1AUDA 1Q7YT 2BOPA 1M5HA 1RT1A 3EGWB 4WIIA 4YUDA 4CH0S 4DL6A 3BO3A 3ENWA 4NCGA 1RTJB 3G9CA 2KN4A 3HDSA 3I5CA 4NLTA 1U1PA 1HWKA 1LW0A 4RZRA 3MPVA 2OFHX 3AA9A 1FVQA 1NAQA 3QJJA 3PFOA 1S76D 4XPEA 3PX6A 2OPSB 1S48A 3MM7B 5F41A 4WFBQ 3G6VA 4WF9Q 5LT5A 1BD6A 1JLAB 4KKOB 4Q44A 2H5EA 2GGPB 1T3NA 1APSA 2PEHA 2XY7A 1V6HA 1X4GA 2P6TA 1VIXA 2E5IA 1N52B 4B3RF 5A8RA 2HHPA 3D2WA 4KHMA 4R0JA 3ZZRA 1N6QB 1P8GA 2R8IA 2F7VA 3OVAA 3DRPA 3JTOA 4MIWA 2KXNB 5DG7A 2IMWP 3LF0A 3BDEA 2KH9A 4QU7A 3TVKA 5E3RA 3CCSS 3ITHB 3SSRA 3J7YI 2IM2A 1RAJA 4MYUA 2FJWA 4PG5A 1I1GA 1PO6A 1DBDA 1R43A 3HVTB 2UVUA 1FXLA 1MMLA 2M3DA 1ZM3A 3W7BA 3M2VA 1WF0A 1HMVB 3WX4A 3DHWC 4E0DA 1VBZA 3FQLA 4K4XA 2AJ4A 3M8QA 3HP6A 2EK1A 2WTFA 1O5JA 1T05A 1LWFB 1VQNS 5G0RB 3DYAA 2QYCA 5B0GA 3HPOA 2R7RA 3MAQA 1JLCB 5F0UA 3BQ2A 2WW8A 2HVZA 2MZRA 5AXMA 2UUTA 4NXNF 1HBNB 2ZE2B 2MKSA 3SDEA 1SKRA 1FHTA 1U4BA 1JJHA 3TARA 3CB4A 3IS9B 4HT5A 2KYZA 3HK2A 3FGVA 4ECQA 2PMZD 4ZP8A 3NG8A 4RW6A 1B7FA 4AXIA 1FRLA 1Q1KA 1F2GA 3D1QA 2W9BA 1NZAA 2R7TA 3BSNA 3DNCA 4LVNP 5BR8F 4JI4F 4CT8A 2LVWA 1W2IA 4I69A 5KFKA 2O5DA 4J37A 3S8SA 2IYIA 5KT7A 1H98A 3LWMA 1U48A 3T6BA 2YWFA 3M1VB 4DPOA 5A0YB 1C0TA 2VBWA 4OL8A 1CG2A 1FKPB 1TK8A 1NK7A 2HHVA 1M90T 3CF5Q 4CO3A 1ZM4A 2EWHA 5KFHA 1R89A 2CPHA 3GG1A 4BC9A 5F3TA 3TAPA 2CPJA 4NA1A 2AJ1A 1CC8A 2FLPA 4CH7A 4A8OA 3ZZ0A 2BRLA 2KG0A 4QW8A 5KFAA 1RTHB 1HBUA 3AY0A 3IO1A 2VOOA 1KLMB 4YP3A 3OL8A 2W25A 5B0BA 1HWIA 2IM0A 2ZBCA 4JI2F 3T5LA 2NLWA 5B7WA 4B9TA 1RISA 2ZKUA 4LSLA 3H2LA 2GW8A 5EX3A 3K5MA 3MR2A 4B3SF 4B08A 4ELUA 2C3MA 1YBAA 3THTA 5E2QA 2R2TA 4I2QA 2YNFB 2W9CB 4ZPVR 4FPRA 1X4BA 4WE1B 5I3UB 1RKJA 2DRBA 2OD6A 1X4FA 2HGNA 4HDHA 2QA2A 1YITS 4X4RA 3SZ2A 2DK2A 5T41A 4EZ9A 2Q6BA 4ES3A 3DDKA 3GG0A 3MM6B 5M2PA 4Y0FA 2EKYA 4B9MA 2HFNA 4U6PA 4QIGA 1SUQA 5KFDA 3B8HA 1JKHB 5K9FA 3H2VE 3TOQA 3M9OB 4PQUB 5C42A 1FEEA 3O6QA 1R8AA 4O44A 3Q8RB 1KNZA 4L3NA 2MKIA 1R8CA 2QO3A 1O8BA 3OR2A 4TQRA 2MQLA 3PIPQ 1Q4RA 4C0OC 2XC9A 1WHVA 4AE5A 5C25A 1D9FA 4HDGA 1TL4A 4M8LA 3MPYA 4LF5F 2OPPA 2M70A 2ZC3A 2KRBA 4ZS6A 2RMLA 1FKAF 3LP1B 5KFWA 2QLXA 5KFNA 5LMNF 4NX9A 3MD1A 1X8DA 3SSSA 5D4OA 1NJZA 3BSAA 2LCWA 5IQQA 2HMIA 4F3MA 1S1XA 4Q8EA 3TX8A 4EO8A 4DR6F 1GNKA 3RB3A 2CFXA 2M88A 1HI8A 1IKVA 4RX6A 5HMWA 4Y3CA 2XGQA 1IKYA 3KLGB 3TYTA 1RTDA 1RT2B 3PX4A 1VQOS 1SIWB 1VQPS 2FB0A 4RBVA 3AJ2A 1P1TA 1LXNA 6FD1A 2W7OA 5A2QY 5J2MA 4YB5A 1VLYA 4NRUA 2DJWA 3I0SA 2K7KA 3N5BA 4NA2A 4HKQA 1L3UA 3N28A 1WI8A 3NBPB 4TLRA 2B9XA 2HWIA 2D3ZA 2BZ2A 1UEVA 4ICLB 4WKYA 1YSJA 3MI7X 4X2BA 2MY7A 1L3KA 3EX7B 1GT8A 2VUGA 3L7OA 3NCRA 5FIIA 2KM8B 1KVIA 1OQ6A 1YVFA 2L08A 2FHKA 4EUVA 4GMKA 2XGPA 1LQ9A 3ETOA 4Z2XA 1S0VA 4OI0A 4Y2KA 5KG1A 3CGIA 2B4PA 2ZOFA 3ENVA 3QO9B 3UR0A 3NNCA 4DHVA 2VBYA 1EETA 3CSKA 1YQHA 1BQNB 3O44A 2ZH5A 1SJFA 5B0AA 1RGVA 2HS0A 5A8RB 4IH5A 1RT4B 4A8WA 3BGUA 1UJ6A 2KRRA 3K5OA 3JSBA 1YGYA 2KFZA 2N82B 3N79A 3JSMA 4R8UB 1U1KA 3MFIA 2D9PA 4C98A 1JLBA 3IBWA 4OZ1A 3AQOA 1M5OC 4FF1A 2M0GB 3KLHA 5GAGU 1S49A 3US5A 1KVJA 3OV7A 2HNYA 2I5JB 6FDRA 5EN1A 5T7LB 3M2VB 4ECTA 3PDNA 2BABA 1ZETA 2XS5A 2FUG9 4A47A 4H4MA 2E1AA 3JSYA 4ZPWR 4RU9A 1S9FA 4IDKA 3J7YU 4LMZA 2HNDB 1OSDA 1C1BA 1KC8T 4KPYA 4D3GA 1WHWA 3GIIA 4DR4F 1M5VC 2E7XA 1Y7PA 4IH7A 4O3QA 3IG1A 3CCVS 4OJ3A 1RYSA 3CD5A 1Y3KA 2GIQA 1RYRA 2B5JA 4B3OB 1U8SA 2MQMA 2DHGA 1SJ1A 5HBMA 4JUZA 2BANB 3AA8A 4WU2A 1Y5LB 2QE5A 2MZTA 5KFZA 5GAHI 4WFYA 1GH8A 3SYZA 4IFVA 4NYOA 1T94A 2VKZG 3SFGA 3G86A 1E6YA 3VAFA 2GQ2A 4NZ7A 1TVRB 2BBEA 3T6JA 5CYQB 1NU4A 2PIIA 2IVMA 4NLPA 5F8LA 1S0OA 1RT5A 3K57A 1