5B0EA

Polyketide cyclase oac from cannabis sativa, v59m mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIMEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 28
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0eA00
4YEAA 3VTIA 1OPZA 2GGPA 3HHLD 3KKFA 2GV1A 1AFJA 1P6TA 3KNGA 3LGMA 4Q2LA 1FEEA 3UDCA 3IWXA 3MCSA 2HFOA 2IFXA 1QUPA 2HFNA 4HI1A 3DXSX 2VV5A 4U9RA 2XMTA 1KQKA 3BN7A 3QGPA 2W4DA 4F67A 2HIQA 1FE0A 3LO3A 4Y2IA 1ULRA 3HX9A 2KT3A 3FMBA 4OJHA 5B0EA 5T7LA 3BM7A 1FESA 3HHLA 2LQBA 1JK9B 1W2IA 2OKQA 5B0FA 4YDXA 4Y2KA 1OQ6A 2OP5A 2GFFA 5B09A 4ZA1A 2OAUA 1KVIA 4FNHA 1WD6A 2KKHA 2FIUA 2FTRA 2OFGX 3K7RA 4HL9A 4OIXA 5A6PA 1YRXA 1Q4RA 2OD6A 2RILA 2AJ1A 2ROEA 2VH7A 1N5TA 1VQSA 4A4JA 1Y0HA 2BJEA 1S6OA 2XMUA 1Q53A 2W4PA 3HF5A 1N5SA 1OQ3A 1SI9A 1X8DA 2KT2A 1N5QA 2OMOA 3HDSA 2HLUA 1S6UA 1URRA 2QLWA 1Y3KA 2LDIA 2AP6A 1GXUA 2KYZA 4Q2MA 2RU9A 3CJKB 1TL5A 3FGVA 3KG0A 2K7JA 4NL5A 1TZ0A 2HQIA 3HHLB 2IYIA 2JDJA 1FD8A 4QOTA 2K1RB 1RJJA 3FRYA 4HH1A 1YJVA 5B08A 2RMLA 4A46A 2RSQA 2N4DA 1YJRA 4OJ3A 1TR0A 2GO8A 2FB0A 2LQ9A 2QLXA 3BR8A 2BYCA 3MZIA 2GGPB 1SB6A 2L3MA 1APSA 1AFIA 1V3ZA 2ZDOA 3BGUA 4ZOSA 3BDEA 3LGNA 1IUJA 3BF4A 2QYCA 3TOQA 2GA7A 5B0BA 2GCFA 2CRLA 3QMQA 2ACYA 1SQEA 3GZ7A 2XMJA 1YG0A 4DPOA 5A6WA 2N4CA 5B0DA 2LXFA 4HI2A 3DCAA 3KG1A 2BBEA 2ROGA 2G9OA 3HHLC 4OJ1A 2ZDPA 2FHMA 5T7LB 3T9NA 1R6YA 5B0CA 1FE4A 1YJUA 2AW0A 3I9ZA 2ASYA 4FNIA 5IXUA 2Q3PA 1KVJA 1X0PA 3BB5A 4NPOA 3TNVA 1XBWA 2QIFA 1FVQA 4DL0C 1MWZA 3F44A 4OJGA 1Y3JA 4HH0A 4A47A 1CPZA 2OD4A 1CC8A 1K0VA 2AJ0A 5B0GA 1FVSA 3TRGA 5F0WA 5K9FA 1P8GA 5KAKA 1Q8BA 2XMKA 1YJTA 5F0UA 1OSDA 1Q8LA 1LQ9A 1VQYA 2BJDA 2EW9A 2OFHX 2PGCA 2PD1A 2K2PA 2BUNA 2IYGA 3CJKA 2HLTA 1TUVA 2W4CA 2XMVA 3WDOA 2K1RA 3IWLA 1U7LA 1GXTA 4DN9A 2XMWA 4A48A 1Y9OA 1JWWA 2ROPA 4EFAC 1X7VA 1TL4A 3E8OA 2N7YA 1MWYA 5B0AA 4Y2MA 2XMMA 1AW0A 3HFKA 2K7KA 1CC7A 1N5VA
chains in the Genus database with same CATH superfamily
4ZVEA 2EKYA 5E5NA 4P73A 2POKA 2B8QA 2UUWA 2A1BA 4LR9A 1I1GA 3I0SA 3QATA 2VFSA 4EZ6A 3OJUA 2HGMA 4XTTA 4KGVB 3R2DJ 4IR1A 1T9WA 1BQMB 2YNHA 2OJ3A 5HL7Q 2R7XA 1YI2S 1OQ3A 3VVTA 2CZ4A 3KMQA 4EO6A 2IYIA 3CD7A 3HHDA 5DGAA 3FRYA 2ZE2A 3TW0A 4C11A 3NLCA 1H38A 5CYMB 4ZMMA 4CLYA 3VVUA 1EJ7L 4F4AA 1D8ZA 2EBGA 2IM3A 1MWZA 3KDNA 1CJTA 1VQ7S 2CQ2A 2WSCC 4RUHA 5I3PA 4CLUA 1VQYA 2KVIA 1H3DA 2R7RA 4A8OA 1SKWA 2IM1A 2E1CA 3NOGA 3CO0P 1FK9B 4DUZF 2B6AB 5BYSA 4USIA 4M5JA 3NAHA 7AT1B 3N5FA 1F5BA 2CPHA 3D6HB 4YFUA 5CD4A 1IKWB 1FFSB 4DFKA 5AJ3F 4ZKAA 2CJXB 5A8RA 1A0OB 1IBMJ 2XB2D 3M6WA 1S9FA 5FLXY 4DR2J 4KGZB 4KV8B 2P9GA 1SH2A 1FWKA 1AA1B 2J0QD 1HQUB 3H25A 3IRWP 1W26A 2ZOFA 1OO0B 4G1QA 3UCZP 1WC4A 1RT2B 1I94J 2EPIA 1H74A 4WIIA 2E7WA 4Q5VA 1VBYA 2KTQA 1P27B 2DBBA 4HLBA 1YIJS 1HI1A 2XZWA 2WW4A 1R3NA 2OIHA 4QR2A 3TANA 1RE1B 4DV5J 2NS1B 2W1BA 4D3GA 2WVDA 3FSYA 4EEYA 4CP5A 3ENWA 1MMLA 2YQ0A 3MD3A 4J9OA 2W25A 1FE0A 4DL3A 4YUDA 4QIWD 3UO0A 2ZZTA 4G1IA 4L72B 5B7WA 2Z30B 1C0UB 2XSJB 5A0YA 4HL9A 2HVEA 4ZPTR 1RXOB 4ED5A 4TU8A 3K8WA 1HWKA 2BJEA 4F2RA 1S79A 5E3PA 5F8JA 4CTAA 1ACMB 4IO1A 2RUSA 3I5AA 1I6JA 1R8AA 2VA2A 4JV2A 2FUG9 1FHTA 4LF8J 1Y10A 4CNZA 1AUDA 1BQNA 1UZDA 3M8SA 2ERRA 1M5VC 4B3SJ 4WK3A 3MOZA 1D1UA 2RB7A 3P3DA 4YB1P 1FTCA 3TNVA 3N6NA 2ZM6J 5ETLA 1XTZA 3UN5A 2MY8A 2UUBF 1D9FA 2DRBA 6AT1B 3KLVA 1S48A 2DTJA 1RWWB 4ZVPB 4DQPA 3T6BA 4JI4J 1XR7A 3QYYA 2YNGA 2K7KA 2VJUA 4RW7B 2ZH1A 4ID8A 4CO1A 3BREA 2BV3A 4WKRA 5KFLA 4X4VA 3PDNA 1FKOB 2DHHA 2KT5A 3H8YA 1D9AA 2H4WB 4P2SA 3LW5C 4DQQA 5KT3A 2HNYB 3BR9A 1VOMA 3DRSA 1V3RA 3CIZA 5KFFA 3G82B 4TY8B 3NWGA 2FJWA 5HI7A 1N8RT 2MZ1A 2HBYB 4CO4A 2Y3YA 3R5DA 3HJFA 2I8EA 3N5BA 5J2QA 3EVWA 2XTJP 4KHRA 1A7GE 4LF4F 1ZZFA 2W2OP 3A1YG 3NGSA 4WP9A 2RHQB 3LQVA 1EB0A 4MKVA 4PG8A 1ROFA 4DL6A 4ZP8A 1LWFB 1J2VA 3K58A 2GS8A 3C6TA 1HBUA 4TVAB 2Z2YB 2MSSA 5CD4H 4OI3A 3CJQA 3DOKB 2F3JA 4F8RA 1RT5A 5U47A 4TY9A 3AFGA 4XK8C 2UU9J 1DTTA 4OX7A 3LP0A 1L3UA 1AFJA 1QAYA 1Y7PA 2HHTA 4M95A 3OT9A 3Q8YA 1S1WB 5IS2A 4O23A 2J0XA 3AJDA 2NPFA 3M8RA 3OTDA 2OKQA 3MUMP 1RKJA 2B4OA 4UQTA 1HBOA 3OFGA 3D68A 2HS0A 1Q4RA 3IBCB 1RTIA 2OPSB 4DV1F 2ZC3A 1BHNA 1LWXA 4U95A 1WSVA 3SV4A 4O44A 3C6UA 5C7PA 2RIJA 2IY5B 1BE4A 4P2FA 1QD1A 1D09B 2CWKA 3SI8A 3I96A 2Y1RI 2M8HA 1RTJB 1RT7B 2OHDA 2M2BA 4M5MA 4DPOA 4P52A 3JYTB 4LF8F 1EZZB 3R5JB 1OY9A 4QW9A 4A8MP 2GNKA 3K5NA 4RU9A 3VQSA 1U1PA 4B3SF 1GMVA 3QLHA 3T6JA 3T5KA 1CULA 3H5SA 2JLEA 3T9ZA 4OYXA 1U1RA 2KRRA 4DF8A 1WF1A 4DV0F 3MEEB 3KLFA 3M8QB 4IRCA 3F56A 1X5TA 2KYXA 3SIPB 2UZAA 4K8RA 1SJ3P 1EHWA 1VGYA 5KT7A 1YITS 3CCLS 1M5PC 1WOOA 4KTQA 2AU0A 3FZBA 1V5VA 2LU2A 4PEOA 3OUYB 3FQLA 1SC1B 4LF9F 1H2VZ 3LF0A 5C42A 3AOCA 3HVRA 4PYDA 5HQLA 1ZM9A 1NSPA 4WP8A 2M70A 4Q2MA 2IPOB 2HS4A 1VBXA 2RSQA 4QIEA 3ZTSA 7FDRA 4OI2A 4EBEA 1YHQS 4PUOB 1PJ6A 3OR2B 5DRKA 3RAMA 1Q95G 5JVGQ 1VK3A 4M94A 3F41A 5KG3A 3KHGA 4AD6A 3DHWC 1VQ9S 3H42A 3ZNUA 2W9CB 1ELOA 3EPIA 1C0TA 3SDEB 3C14A 1KFDA 8ATCB 3HFZB 4BBYA 3GSDA 2XMTA 1A9NB 4B02A 4U7UK 4ED1A 1R0AA 3IS9A 1SKUB 3QZ8A 5A8WA 2F65A 2RAQA 1N33J 4K4SA 3TI0A 1U6ZA 4YQWA 4NEZA 2F63A 2CPDA 1VLYA 4WWSA 2NQPA 2FHKA 5CYQB 5IWAJ 1NJYA 3CJKB 3GJRB 4XAKA 2HZAA 1RT3A 1XMQJ 1QJHA 3MWBA 4WK1A 1IBKJ 2X1GA 4PXEA 4I2PB 4CWBA 2GGPB 4OZ0A 1WTFA 4DR6F 2N4CA 2CQ0A 5E33A 2ABYA 4FPRA 4KPYA 1ZTTA 1Y3JA 4LJMA 2ZITA 2AJ4A 5D0GA 1QAXA 2KB2A 2Z2MA 1Q79A 4P75A 2IYGA 1TL4A 1BQMA 4IO9Q 3EX7B 3QQCD 3UDCA 3K0JA 4NYOA 4ECRA 3UW1A 2PE8A 2EVZA 3TYTA 4X65J 2VC0A 1FI4A 4OI0A 3DRXA 2VBWA 3B78A 1KS2A 2BW2A 3CCMS 1HNIB 1P9QC 1I51B 5CYMA 2YWWA 3RUBL 2F8EX 2W2QP 4A4JA 3GCXP 5RUBA 2B9WA 3ITHB 3BSNA 2DHSA 2DH8A 2YH0A 2QX0A 2KHDA 2YQ1A 2V4RA 2JZ5A 5G0RA 1HI0P 3ONQA 4K0KF 1SUQB 4YB6A 2MQPA 4I64A 3BGUA 3R7NB 1TUGB 2ZOMA 2E5LF 1WTBA 1VLOA 4IFYA 4JI2J 1Y00A 4BS2A 2IVMA 4HH0A 3HFVA 3BZQA 2AJ0A 1T05B 5IT9Y 2B6AA 4RNOA 2ZH5A 3OFHA 3KUGA 3SZ2A 1JWWA 4Y6IA 3AODA 1PKUA 2U2FA 3IN5A 1N6QB 1IKWA 1U45A 4C8MA 3HHLD 2BJ8A 4WU3A 5LL6d 1TK5A 3TVKA 2PFDA 3POTB 1XNRJ 3PACA 5K5MA 2G0JA 2WW8A 3DLGB 4KV8A 2RQ4A 4MYUA 1HHTP 1HQUA 5B09A 2FIUA 4AL6A 5MAOA 3NEKA 4DU8A 1X4BA 1UPMB 1DBDA 1PO6A 2OEMA 1S6UA 1RTDB 2KJWA 5J2PB 2LFVA 4IFVB 3R5AA 3SEOA 1EQ0A 4FS2A 1YGYA 3BJYA 4F50A 3CO9A 2R7QA 2X1BA 5IWAF 3RGIA 4S0MA 3D54A 1IBKF 3W61A 3DI6A 3DOLB 2DGVA 3Q8UA 1HNVA 3O8WA 3NS6A 2V6AA 3V81B 1U1OA 5B0GA 1S1XA 2EFQA 3FZ2A 3AD8C 1KQFB 2YTCA 2HHSA 5EWEA 4R5PB 3B4MA 2U1AA 4D3HA 1C0UA 3M9MB 2JEJA 4I6YA 4NXNJ 1QY7A 4LFAF 5MLCV 4YB7A 5JJBA 2VV5A 3ET6B 1RGVA 4B3TJ 4USTA 2ZH6A 2GAHC 4DBQA 1GMUA 3IGNA 1KVIA 2HRTA 3I4PA 3GJTB 3M32B 4UW2A 2CPYA 2DNOA 1NZAA 4ICLB 4QPXA 2XY5A 4LIRA 3TJAA 3GCWP 2YWGA 1UPPA 2W7PA 3FFIB 2YPZA 3GMGA 2JC0A 4PG4A 1YJUA 4G3IA 3DU5A 4KBIA 1IQTA 4DF4A 3QGIA 4JI5F 4R0JA 1HWUA 3DDKA 3CNQP 3CF5Q 2R7WA 1VCTA 3IM9A 4CQ1A 4O3OA 2PDAA 4H4KA 1YKWA 2BE7D 3D67A 4UT4A 2YWFA 3DDNA 1RHJB 1PIEA 3DRPB 1NO8A 3DLKB 3Q8VA 1LXNA 2H65B 4TY8A 1WG4A 1IWAA 4LF7J 1N52B 2SXLA 4ANDA 2J8AA 2HRUA 2CJBA 4GC7A 1N5TA 2J76E 3QWUA 3P8BB 1TKTB 2H5IB 4RWWA 5H9EK 4JBCA 1R31A 4USUA 2AP6A 1DARA 4QYRA 2FC8A 1B7YB 1S7IA 4ECXA 3D3CJ 5T41A 3AB4B 3NCPA 2R7OA 2XCAA 5FLXU 2QYCA 3HXMA 2HFZA 3DOKA 2BQRA 3HI9A 4NLSA 4ZN3A 3OTCA 2GMJA 2DVIA 4G65A 3PRVA 4EWTA 4W4MA 4PCQA 1S1WA 4DV7J 5F9LA 4IG3B 5HQ8A 3J80U 3NOCA 2UVWA 4Q45A 3G6VA 5ETSA 1XK8A 3QFHA 1X4EA 1VJWA 2OPSA 3N28A 2K06A 3L7UA 5GMKa 4QPTA 2IDLA 2Y9HA 4PWDB 1NRKA 4IH5A 1YDLA 2HGNA 2DR8A 2XO7A 3LPEA 2H3EB 1OSCA 1ZA2B 1Q5YA 2B8PA 3PEHA 4NXMF 5AXLA 4X62F 1LWCB 4OLPA 1VQOS 3MR5A 4ED6A 1P1TA 3M8PB 4QOTA 3PEJA 1U8SA 4A46A 2XNQA 2ZKUA 2OUGA 1HNZF 3CT9A 1DQAA 3MEEA 5KFAA 3GG0A 2JLGA 3M8QA 4K5SA 1X4HA 5F8HA 4KGMA 1FVQA 1NZ8A 4DSKA 2CQBA 1LKZA 2VFRA 4RW6A 4OZ3A 2WRMA 2ZH2A 1NK6A 4NLYA 4H4OB 1FJCA 1Q8BA 2HWTA 2BACA 1KLMA 5GMDA 2OMLA 3KLHB 5AE2A 1RHKB 2Z57B 4OHZA 3V6HA 2ROPA 3OUYA 2MHNA 9RUBA 1FEHA 3MMBB 1U49A 2MB0B 3NRBA 1TK0A 3R3TA 4DL2A 3M9OB 4CLFA 1NU4A 3KNAA 2J6SA 1W2IA 1VBZA 3BYRA 2YNFA 2OP5A 3AXKA 5D15A 2CG8A 2ZEJA 2C2RA 3G71S 3M2VA 5J2MA 3OR2A 2VFVA 5DGBA 2JH3A 3AJ1A 2F40A 3IMQJ 5G4DA 2JNJA 2D9OA 1KTVA 2Z4PA 5CZVA 2C3PA 2VC1A 3KFWX 2K7JA 3I5CA 4KY3A 2RS8A 5E7OB 2IAJA 2W8KA 3D3BJ 6FDRA 3Q22A 4Q0BA 4A8KA 4FP9A 4PQUA 4QU7A 1XIQA 1FCAA 3P45B 1BWEA 3V4IB 3R9LA 3QT7A 1HLWA 3T9NA 2R8HA 4DR5F 1NB7A 4NPOA 3OHAA 2DKOB 2OSRA 3CGIA 4XO0A 2Y1IA 2P6TA 4N8OA 1TAUA 4FXWA 2K2PA 5HMXA 4U7UD 3SSSA 2MLXA 2EC2A 2MKSA 2IMWP 4JV5F 2PI5A 1VRUB 1FO1A 3MAAB 3G8SA 2AF6A 4UUWA 3CCQS 2DGOA 2QG9B 4F4WA 3KK2B 4N47A 2OAUA 3QWPA 3E3XA 1LK7A 1SVDA 2W9BB 1KD1T 1TTHB 4Q43A 2LP4A 5J2NB 4UQGA 5KFCA 1S1UA 5C24B 2CQHA 1NNDA 2MEWA 2I6WA 3UNYA 2DY1A 2DR6A 4TQRA 2FVSA 1C4AA 3MTKA 2YX7A 1RHRB 2KO1A 3CW2C 4LT6A 2HK3A 4USKA 1HNWF 3BO2A 1ZPWX 4CRJA 2MZTA 3AQOA 3ZTOA 2NLWA 3BB5A 3T5LA 2BKPA 1M1HA 2XZDB 1NK8A 3GFHA 1XNQJ 2VBXA 2G0CA 2Y1JA 2LQJA 3VV2B 2UXDJ 2H48B 2K1RA 3IWLA 3MR3A 3TUPA 1AZSA 2EK1A 4RZRA 4KQZA 1HNIA 3CC2S 4A8WA 3AD9C 1QM9A 2VZ9A 3T3FA 2DXFA 5AXMA 4P6QA 2KXHA 3R8YA 1REVB 4CO2A 3DLJA 1Q16B 2Z58B 2C1EB 3P4UB 2DK2A 3D1QA 4PWUA 2MZJA 4DV6J 3TP2A 2C2MB 3ZTRA 3CDEA 4TXSA 2MKYA 4JI6J 1PBAA 2HNZB 1C2PA 1T05A 2F5GA 1U4BA 2HQGA 1RU1A 5I4MA 4DPUA 2MQLA 1B4SA 1RT6A 3SCIE 4A8QA 1S7HA 1RWUA 5L46A 1N6QA 2BW7A 5THWA 2C3YA 2RH3A 4MKBA 2MDAA 1S77D 4BHQA 1X4AA 3POTA 3VAKA 5DDPC 3BS9A 1RACB 2D41A 2J5AA 2ACMA 2GC8A 2PGCA 1GQEA 3OBIA 3RB4A 1UEKA 4NZ6A 1FRKA 4WE1B 5SUHA 4JI3J 2ZUAA 3IR7B 1G2EA 2JWNA 1WHXA 3BYPA 1YX2A 1H0HB 4ES3A 5K14B 3NMAA 5J2PA 2BQ3A 4IFVA 4LBIA 5A76A 4I69A 2DNGA 1SV5B 3GYXB 4P72A 2XMUA 2JRSA 1RLDA 1CJUB 4BWMA 5AXNA 3G6XA 2QO3A 2FLPA 1GXUA 2PC6A 3RG6A 1B7FA 1JIHA 3I4HX 1RWOB 3KLIA 3FBEA 4K2XA 4ED8A 4OYBA 3PHTA 4R5PA 1VMBA 1F5AA 2QA4S 1PG5B 2X3GA 2V50A 5KG0A 1LXJA 2ZBIA 3E2EA 1JLAB 5I3UB 3DRRA 3N79A 1R8HA 4NRTA 3H2LA 3HD2A 4PG5A 3ET6A 3EVOA 4W90B 5F0WA 1P8GA 1O51A 3C2PA 2HLTA 2VG5A 2UXBJ 5F8IA 1UVKA 2XG8A 1WEXA 1SH0A 4JP8A 3KJQB 3M32A 1DLOA 2K8GA 3GV7B 4O3NA 4DFJA 2VPZB 3K59A 3CB4A 3A8JA 5LMUJ 2HIQA 4AT1B 4LR7A 2WOMB 2OPPB 4CLLA 4YMEA 4HACB 3BH6B 1C1CB 2WSFC 5A2QY 4O3SA 3KUHA 3S8SA 4RBUA 3W65A 3FFIA 1DURA 3H4BA 2N82B 2DR7A 1IBLJ 4IOCQ 1R0CB 3HULA 4HH1A 5A8KA 3C15B 5D3GA 2D69A 5BYQA 3CDWA 1BWVA 1TU0B 1D8YA 1YG0A 1RADB 2DRDA 2LXFA 4KE5A 3UD5A 4ZIWA 3M05A 3UVJA 4N7TA 3UDLA 3OPKA 1U2FA 4HYKA 4NI2B 4ILLA 5HBMB 3OHBA 3DLKA 3KLGB 2WCXA 3MPYA 2MXYA 2VHGA 2YKNB 5HROB 1SL2A 2RUGA 1N34F 2G13A 1VIOA 2IBOA 4GO5X 1TKTA 2DYAA 1KQKA 1JLGA 5EHHA 3MTJA 1ICEB 3PJ9A 4K4ZA 3KLEB 2Y0SD 4PZVA 2ZKTA 4Z2XA 4QW8A 2V9KA 2N3OA 3UD3P 3MM5A 5IM0A 3BGFA 3GPAA 2VOPA 5DZ7A 2W4PA 1YLXA 3MCNA 2XLJA 2PA8D 3FRZA 2EFVA 4MIAA 1M90T 2ZWPA 4TLRA 2BM0A 2LECA 3GIMA 3OLAA 1OYDA 2CADA 3TUIC 1RU2A 1JLQA 4YHHF 2WAQD 5IV4A 1RP5A 4QCLA 2J9CA 2ADCA 4KH1B 5IOLA 5L1LA 2R8KA 1NMEB 2P8IA 2F4VF 1SL0A 2VQEF 1WOSA 5K8NA 3QO9B 1YJTA 4NCGA 1VC5A 4K4WA 4DDFA 1UZHA 2B7CB 4J9PA 4CO5A 2MQNA 1T3OA 4Y2MA 1CJVB 1Z2LA 5M2RA 1LWCA 1N54B 2QFJA 3O2IA 2BE2A 3AJ2A 5B0FA 3G96A 5LSLA 2GVZA 3ZZOA 3RJMB 4O3PA 2DISA 4OL8A 3P96A 2WZ1A 2WB4A 4C8OA 3DMJA 1RTHA 4UZBA 1MW7A 3V2UC 5EUHA 4DUYJ 4N56A 1BXNA 4E2FB 2UUCJ 1TL5A 4OZLA 4E8UA 4J9KA 3CCJS 3RZAA 2E1MC 4Q7AA 1TKXB 3VZHA 2LQ9A 3NGRA 4H4OA 3BR8A 2XCPA 5D0HA 1NXIA 3KLHA 4ZOSA 2LXUA 4LF6J 2ACYA 2R2UA 3TZYA 3O44A 1N5YB 4WTYA 1X5SA 3D1HA 4CH1A 2FHMA 2CPXA 4PABA 3UD4P 2ASDA 1HBNB 3MMBA 3ENAA 2HFUA 4DFMA 5LMNJ 4B3MJ 2OD4A 4DZ6A 1S97A 2WBMA 3J7ZT 4CH7A 2OH2A 4MK8A 3Q2TC 2RKIB 5EX3A 4OHWA 1FWLA 3D6FB 1X7VA 3TZZA 2AYGA 4Y28C 3V6DA 2KFZA 4QZVB 4HI1A 1VR6A 3UR0A 3LO3A 1GNKA 1WF2A 3M6VA 4RNFA 4KJIA 1KQGB 4EK2A 3OQ2A 1S9GB 3T1YJ 1PSDA 2GMLA 2OD6A 3MM9B 1X4FA 3HZGA 3BKTA 5LT5A 4RW9A 3Q23A 3G2XA 4DV3F 5KFUA 5HP1B 3MDFA 2D74B 1X8DA 3KHHA 4FXDA 5F8MA 1RAFB 4PQAA 2UXCJ 3OJSA 2QLWA 1FD8A 2QGFB 4FZVA 3TJ9A 4ELUA 4TNOA 2AGOA 4IG0A 4USWA 1X9MA 1S0MA 3RRKA 2AJ2A 3N6LA 1B64A 3BKUA 1Y5LB 1JX4A 4F02A 2CVIA 1VRUA 1RWXB 4F2SA 5K9FA 2GHWA 1RI7A 2KXNB 3KK2A 5I42B 2JVOA 4KT0C 3MUVP 2XMMA 3TA2A 4YB5A 1XC9A 1YBAA 1KOOA 3QT5A 2R8IA 2QL5B 2ZH8A 1FKAF 1GMWD 3RR8A 1ZYQA 1ULRA 1HL6A 3QIPA 5C24A 3KG4A 4YDXA 2MQ8A 2XS5A 2WSEC 1XN9A 2XC9A 3K7RA 2CA9A 2GQQA 5HVFA 3TO8A 4JI7F 1AT1B 5C5JA 4ZJLA 3DM2B 4J7CA 3EZOA 4ANCA 3HF5A 4AL5A 2LA4A 5HN0A 1N32J 4XPEA 2HBQB 1LWEB 5D77A 3MXHP 2Y8WA 1N36F 4ZDNA 1SKRA 1TR0A 4AUKA 4N41A 2BQUA 2C2OB 2W2PP 4JYAF 2IA6A 2XS7A 3TR5A 2J8SA 2GVDA 2CQ1A 2FVRA 4NLDA 1FVSA 1CJKA 4KSEB 2C28A 3PO5A 1REVA 5ETVA 3D66A 4DWIA 4I6AA 4RLEA 1VDHA 1FJEB 1YQHA 1OPZA 3PM9A 3KJNB 1TL1B 4LSLA 3JAMU 4M1KA 5EGYA 5L9XA 4DG1A 4ED0A 4TU7A 5AE1A 3M6XA 4C3MA 3WIVA 2BVZA 2HQCA 3S6EA 2HNZA 3PZPA 1FWPA 2KH9A 1CQNA 3PRBA 1U48A 1B3TA 1Y0HA 1BQXA 4LSZB 3W2VB 5KFNA 4LF5F 4OI4A 3T1YF 2HQIA 1QSSA 5JVHQ 2V2KA 2IRXA 3HVTB 3C16A 1E6VB 3WZ0A 1GTEA 4RR5A 2YNIB 4C8LA 2XBPA 1NK0A 4E0DA 2IJFA 5KFYA 1NH7A 4M5DB 4WE1A 3F0NA 4LRAA 2O67A 1M5OC 3C8YA 2VJVA 4NLUA 1K0VA 4BWJA 5K14A 1Q8LA 3R5GA 3MEDB 2OPRB 4DV4J 1QLNA 1S0VA 3FBCA 3LTOA 2D3UA 2W01A 1HW8A 3PIPQ 3BN7A 1CJUA 2BOAA 1R0BG 5L1JA 1SJQA 3CDUA 4DCOB 5H1SV 1U0HA 2XULA 4R0EA 4MMOA 1UVLA 1JLAA 3CCWA 4HTJA 4J9UE 5E41A 4GKJF 2FY8A 2XNRA 5KFXA 3CULA 4N77A 1YK9A 5JMNA 2DH9A 4N76A 1HNXF 5DM7Q 1N32F 2QA4G 2BANA 3QMQA 3IG1A 4X66F 3D1OA 3JTNA 4OYIA 1SIWB 1QE1B 4IDKB 1J27A 5CCMA 3U27A 1VQ8S 3CD0A 4O4GA 3L95X 3GTYX 2BZ2A 3MM7A 2J0SD 4QBUA 4HACA 2CJ9A 2JVRA 1C1CA 3MMCB 3MFHA 3MHYA 5KFQA 4URSA 1SJ4P 4EBCA 3R7BB 1KDNA 4QWDA 5FDLA 4RW8A 3SQOP 2ZD1B 5T7LA 5CZXA 3KWMA 4F0HA 2G1DA 4OX8A 2NXUA 2KKHA 3IBFB 3MM8B 2DD8S 4NZ7A 4YY3F 2EFNA 4OYWA 2KVQE 3A3OB 5JXSA 3S7RA 2CQDA 2HBRB 2KT2A 2MLYA 4USVA 1X4CA 3DLHA 2PN6A 4UTGA 2IIHA 2HVHA 2CNKB 2OEKA 3A8KA 4GKKJ 5HMWA 5HMZA 4USMA 1G1XA 3UCUP 2XYGB 3UPFA 1F2GA 4HEA9 2YKNA 4OI6A 3DLEA 2Z8QA 2G9OA 2L48A 3HHLC 1RK8A 5B0CA 4CM0A 3RBEA 1CPZA 3FCVA 1RB0A 3DGPA 4OX6A 4CT9A 1ZS6A 5F0UA 3KLEA 2DXEA 5CQGA 2E9TA 5EWFA 3NNAA 1UAWA 1P6TA 4DOZA 4PXDA 2DO0A 1U1LA 3GWCA 2VPXB 2BABA 2XSFA 1JK9B 3PCOB 3U7JA 4OIXA 2YQ3A 4LSNB 3T5JA 2J9EA 1Q86T 1F6TA 1T11A 4ZHRB 2M3DA 1J5OB 1J5EF 3KHLA 1MNEA 3M1VB 4ED4A 3TQEA 4E98A 4DV2J 4P9SA 2AT1B 3M2UA 4I4BA 5B08A 3W1YC 4CZCA 1L3TA 3QO9A 3G6ES 1N4LA 1ZAVA 4F4YA 5LJ3Y 2FZKB 3BF4A 1NJWA 1EETA 3L4BC 5CXTA 1CJVA 3V6KA 2V67A 1KC8T 4FDFA 1KVJA 2QIFA 3MURP 3PX0A 4NLTA 4M5IA 4DPYA 1T9VA 2NSBA 2DGXA 1JNZB 3CJ8A 4RKUC 1KTQA 9ATCB 1EP4B 4UY8T 3LP2A 3BO4A 2L9WA 1GMWA 5KOXA 3CCES 3RW7A 2JC1A 4PR6A 1HBMB 4DZDA 4J9MA 4OHXA 2COLA 1HFEL 2V4JB 3HLUA 5CABA 2B43A 1M5HA 1TKXA 3JSMB 2V8PA 4IKAA 4XIUA 2CPJA 1N5YA 4BLGA 3VGTA 3PRDA 1T3NA 4F3QA 4M5KA 1RAOA 1HBNA 3EICA 1CSJA 3QBCA 1TVRB 1QAIA 3TAPA 1IBCB 1NH8A 1WWHA 1LW2B 1ZM2A 3MZIA 2L9NA 2HHHF 2RKIA 4RL1A 4DUZJ 2JFKA 2Q66A 1NPPA 4KYZA 2ASYA 4GKKF 1HA1A 1TV6B 2KZZA 1AXQA 1WHYA 3THTA 3W60A 3HSJA 4AFFA 2N3LA 3KUEA 5AJ3J 4L75A 1OSDA 3W2WB 1AYEA 1SC6A 4RNNA 2XLKA 3HSGA 3SFGA 3RBXA 4KFBB 3D4JA 1PGZA 4UF4A 4WKYA 3MAQA 1U6FA 2FC9A 3SCLE 2ZBPA 2AZ1A 2HIYA 2CXEA 4ZITA 4LFCF 1S6PB 4QWEA 1K44A 2XHWA 1VI7A 4OZJA 2QEXS 1BD6A 3QJJA 4LRDA 3OR1A 1DHMA 2PO4A 2WB1D 1RWKB 4LRFA 3FGVA 4LF1A 2D7SA 3M2RB 1UA1A 5L39A 2QMUB 2VA3A 1UEVA 4J91A 1TL7B 2CNNB 4ED3A 2PEBA 4J37A 3ZZPA 1MU2B 3J81U 5I42A 4LIWA 3D0GE 1SQFA 2VPWB 3CMES 4DN0A 3K5LA 1K8AT 5KFBA 3HM9A 4B3OA 2I9SA 3SYZA 3A13A 1VRQC 1TUVA 3TEGA 3W9JA 5ETTA 3BEGB 3AA8A 3GSIA 3E8OA 2N7YA 4WYLA 2DGQA 4CCHA 1S0OA 3DM2A 4DCJB 4YR3A 3MF5A 4FYWB 2BRKA 3KJVB 5KG5A 2E44A 3IFEA 3EDQB 4MFBB 3FKBA 2XO6A 1LWEA 3UE2A 1CS4A 3GU0A 3VAJA 1I5OB 3FUYA 3KYLA 3E01B 2KDOA 4OMFG 3RBDA 2BR0A 2VQFF 1FXRA 2UUBJ 4P74A 4NZ0A 3MPUB 2H5JB 1JMTA 3CPWR 1WC0A 3HVAA 3DFEA 3D2WA 3JS9A 2QT7A 3K2YA 4DR1F 3T1HJ 1DQ9A 3CC7S 2E7XA 2VF3A 2CWXA 2G2YA 4OZ5A 3QJPA 1IR2A 1KKHA 4EYIB 3QGHA 1MROB 2ZDPA 3I9ZA 1WF0A 1NKEA 2ILYA 1B70B 2GAGC 2CJKA 1S5ZA 3THPA 1FERA 3H4DA 1RCXB 2XGQA 4N5SA 3DLLQ 4ZVTB 1VQKS 3X3UA 2E1RA 2IDEA 2HW3A 3PW0A 3ISND 2AYMA 4Q2LA 4RPFA 1U1MA 3TAQA 4MYTA 4IH6A 3OXFA 1B0PA 5BYRA 1RHUB 2HYIB 1PILA 3UN3A 1F5CA 2QMWA 4LF4J 4JI1F 1JLBB 1WKKA 3W66A 3HVTA 2A10A 1URNA 2YNIA 2HQDA 3ZFVA 1MN7A 2HHWA 3PVXA 3W64A 4B3RJ 1NUEA 1HARA 1U1KA 4URQU 2IBKA 2WK4A 4TKTA 2F1FA 3J80Y 4V19X 1EARA 1UVMA 3K89A 1NJZA 4F0KA 1UWBA 2ALYB 3T19A 2WHOA 1F9HA 1BGXT 4KC5A 5GAGU 1UW9A 1FDNA 2DGWA 1FJGF 4ID5B 4C3KA 3MM6B 5K8MA 2HFSA 4IRKA 4DV1J 5KAKA 3GJQB 3ELHA 3ILLA 4ECWA 2RQCA 2X51A 1NK4A 4WJBA 1KHWA 3TJ8A 2R7UA 2IFXA 4A8FA 2QSWA 1TKZB 2D3OR 2RNEA 2LQBA 2DNHA 4HVZA 4PKDB 3LGHA 2H51B 2NZ4A 1HPZA 2QRRA 1DTQA 4K5RA 1RAIB 2MYFA 1QE1A 2VFTA 2VDIA 1WG5A 2DY9A 3G86A 1XQIA 2KU7A 3NS5A 4NASA 4MK9A 4ZPDA 4DV0J 2X1FA 4PAAA 5AXKA 1PYTA 4ETXA 2LA6A 2A6OA 3PYGA 3HSDA 4C8YA 1KP6A 3UR3C 1WG1A 2PFFB 1UA0A 1R8CA 3PR4A 1L3VA 3BDPA 3MMCA 3EE3A 4WZMA 4J9RA 4DQRA 1DFDA 4YOEA 3SSRA 3T1HF 4ECSA 2CQ4A 1F3FA 4JI8F 4LF9J 2BXJA 1RA7A 4LVOP 2E7VA 2HHUA 1FA0A 3TAMB 4K50A 3PNIA 4ILMA 3W7BA 3OTOF 4WFAQ 2HHXA 4AQYF 3EGZA 1D0EA 2BJ9A 2AJQA 1RA6A 2F4FA 3AA9A 2HFNA 4ZIVA 4QWAA 3AT1B 3UDEA 1NSKL 4CDIA 5J1PA 4OJHA 2GQCA 1BY9A 4USJC 1NDCA 4OYOA 1TL3A 4H4MA 4ERDA 2BE9B 2VIHA 4YS2A 2JX2A 4YR0A 2V8DA 1AB8A 3E51A 4YR2A 4F3OA 1SI9A 3NY0A 2UVRA 4X64F 2QA2A 3NS7B 2M88A 1Q1KA 3EGWB 2VFUA 2GO8A 1HWLA 1Z1ZA 3BPDA 1WACA 4B3RF 2VOOA 3M6UA 1Y5NB 3I0SB 3GONA 3DXBA 1FDAA 4ZVHA 2C2EA 2H5EA 3JSBA 2V8VA 2CQ3A 2X3DA 1WEYA 1RYRA 3J7YU 4LR8A 1FFGB 3NAIA 1VISA 2YNHB 1RLCL 4Y2AA 1LQ9A 1OYEA 1YWXA 4Q44A 5KFRA 1X5PA 4DUTA 3U1LA 4LSNA 3IWNC 1JXLA 4L73A 4CYUA 4CIOA 4LRBA 3MCSA 2HBZB 4USHA 2CPZA 4C11B 1U26A 4R25A 3P6YC 3M1VA 2QMXA 2V68A 2B9YA 2KJVA 3LAKA 5LSOA 2BMBA 3EMTA 4DR6J 2UUTA 3W5XA 1VK8A 4KHMA 3CJRA 2IRYA 3W9IA 2IM0A 1CJTB 5DLFA 5IQ6A 3PIOQ 3GIKA 1NSQA 1D9DA 1TK8A 4BCAA 2AGPA 1RJJA 1WC5A 1HQEB 5L8RC 3R5BA 4ETZA 2NREA 4ZLJA 4HHHA 4OYPA 1RT1A 3UCGA 1YRTA 3R1HA 5DG8A 3PW7A 2YKMA 1KQSR 1EP4A 4QR1A 1T02A 3JQKA 3NGTA 4NLPA 2EEYA 3EJMA 2EKNA 1RABB 4CH0S 2JFDA 4K4UA 2MJUA 2VBYA 3ZZYA 2AX0A 3OFEA 3CD5A 1HBMA 2YPYA 2PI4A 1W2BR 2V4JA 4CI0B 1DAXA 1FXLA 4MK7A 3IAM9 5DDOC 4C8ZA 3HO1A 1N5VA 2XYPB 2ATCB 2VU5A 2GV1A 4ZP7A 3CC4S 3HD1A 4K0KJ 1QUPA 1T0TV 3DOMA 3ZTPA 4HR2A 1KEKA 1UJ5A 2HNDB 4G1QB 2E5LJ 1DQ8A 1XR5A 1M1KT 4J9NA 2F9DA 1TVRA 4OZNA 3NP5A 5DQHA 2L41A 3VGVA 4KH0B 2ROEA 3BKFA 4MTPA 2XI2A 3Q89A 5GVQA 2ZH7A 7FD1A 2A0FB 3BPSP 4DJBA 2XYHB 3VWSA 5KT6A 4ES2A 1TV6A 3J7AN 4QQBA 1UL3A 2MLZA 3G8TA 3RBZA 1T9UA 1JJCB 5HJYA 4WBFA 1AFIA 5LSRA 4KFBA 4JI0F 2RQMA 2YKAA 4HT5A 5A0YB 3G8QA 4KHPF 4KAIA 3DN9A 2DEIA 3SSQA 2XWYA 1S6PA 3GE9A 3LALA 3O1LA 5DG7A 1U47A 1LV5A 3CD6S 2B56A 3HP6A 3M2RA 4DS4A 4PXCA 4QYZK 1YRXA 4ELVA 2MQOA 1TMJA 2ZHAA 3MCOA 3LH2S 1S0NA 4LUBA 4XDDA 4Y0FA 5KFDA 2QLFB 2GQ2A 2P5VA 2FD2A 2PMZD 2C2DA 4LFAJ 2B7BB 4L6V3 2DNPA 3PTWA 1Q7YT 4ECQA 4I7FB 2QA1A 4R8UB 2HAFA 2H54B 5F3TA 3ETMA 2CPIA 3PFEA 2NZCA 3RTVA 3KJVA 1H98A 5IC4B 4MFBA 2F9JA 2AGQA 2F7VA 3DRSB 3FDSA 1O0PA 4NOHA 1FJ7A 1MWYA 2WVBA 3E01A 4C0HA 3SXLA 1TAQA 3DLBA 2DR5A 5J2QB 3HHKA 2CFXA 2ZJRQ 3FMBA 2FZGB 3HCXA 3VAMA 3AOBA 2PMHA 3QZ7A 4X4RA 3JTOA 2A6MA 4JI5J 1FKPB 1W25A 3C6TB 2HWHA 4FF2A 2VKZG 3KK3B 1MROA 4DLGA 5CA5A 4U8YA 4MH8A 2CQCA 1RT5B 1FK9A 2DNLA 1DTTB 1WI6A 1UVJA 4G1PA 5FIIA 3PJXA 3ZZTA 2ZZNA 1SQEA 1T95A 4NYPA 2E5HA 5CAAA 1LW0B 3PW4A 5ETNA 2Q3PA 2AKWB 1HBOB 4ILRA 4J9QA 2KXFA 3H20A 4M8LA 1VRTB 3DYAB 1R43A 2EC0A 1YZ6A 1SXLA 4FF3A 1JLBA 4DN9A 1UEUA 4O44B 1UP1A 1CC7A 2AYBA 3NG8A 3FBBA 5HANA 4LQ3A 1O8BA 4TLQA 3L7PA 1HIYA 4AE5A 1RT2A 4I2QB 2FJXA 4X4SA 1FESA 4C9DA 2RDJA 2C42A 2GIQA 3CDBA 2I38A 2ZNYA 3J7A1 3BGLA 2R8GA 4ALZA 1CULB 1R8BA 1EAYC 2YX1A 2DHGA 2GHPA 2YWEA 2DGUA 1SB6A 2MQMA 2O3DA 5HK4A 1QVGR 1AUSL 2XSJA 2LXIA 3TWZA 4J5OA 4FNIA 4KRWA 1HD1A 2DITA 5HVHA 1F0XA 2OTLS 4DFPA 3TX0A 5J1EB 3FBFA 1KLNA 4NXMJ 2I5JB 5ETMA 4X62J 2XMKA 5KFIA 5C42B 2A2DA 3CJ3A 1NBEB 5ETPA 1WEZA 4DSEA 4MAKA 1Z4UA 3OL6A 1JJ2R 2R7TA 4AXIA 1PJ7A 1HNZJ 2FJBB 1IKVB 2CPFA 4O0NA 1JLFB 4OYZA 2KHCA 3CCVS 1U2CA 2UV8A 4DMZA 3D9BA 4C8KA 5A6PA 1YSJA 1KSPA 4CNYA 2EK6A 1ZOTA 4HT7A 2OO4A 2MHEA 1RAEB 1JB0C 2K3KA 2HZCA 5GAEI 1F9FA 2YKOA 1SJ1A 3ILJA 3BGRB 4K7QA 1V3SA 1T7PA 1OY8A 4ZVQB 4RW7A 2RMLA 2LU1A 3C14B 2OI2A 2MKHA 3EZ5A 2M7SA 1A6LA 1FKOA 3DHXA 1RBLA 3TAMA 3N6MA 2W9AA 1SKSA 3OTEA 1R0AB 1NDPA 2KG0A 1WHWA 5IXUA 4F4KA 2V34A 4IQXA 4XDCA 3THVA 1GT8A 2HNYA 1YZ7A 1LOUA 3G82A 1RAAB 2JHEA 5LXYA 2HZVA 1UFKA 1RT3B 4QWBA 1KHVA 4KKOB 5KFVA 2YVSA 1T03B 2LEBA 3NXZA 4ZVSB 5B0EA 4J90A 8RUCA 2LVWA 5KG4A 1EX8A 3RB3A 1X31C 3V4MA 3QFWA 2QFIA 1LWFA 4DR5J 3R1LA 4EI2A 3QRPA 3TZXA 1Y4ZB 1PCAA 3FCWA 3Q2SC 1KVKA 2PIIA 1N88A 2ZFHA 5KFSA 2IMOA 5HMYA 1RZMA 4X4TA 1FX2A 3ADAC 4JV5J 4C48A 2ZZMA 4WXWA 4HKQA 1S4FA 4N8NA 3P5BP 3KG1A 2ROGA 2B5JB 4ZPWR 1XMOF 2P9EA 2AEFA 5D0EA 1VQ4S 3C46A 2NXEA 4W92B 2NCKL 3WC0A 3IAS9 2MGZB 1RTJA 4OHYA 5G0RB 1RT7A 2BM1A 4F4ZA 3WX4A 3U1NA 3QAUA 3HX9A 2ASJA 3JYTA 2QLBB 3GJSB 4DR3F 4ES1A 4UZCA 1HQEA 3PHEA 1HNWJ 5BR8F 4LMZA 4IFYB 1YJ7A 4ZJOA 1EKRA 2AHOB 4ECUA 3KMSA 5F8GA 2RD5C 4O0IA 1N5QA 4DHVA 2RDDA 4UOHA 4B08A 2MKJA 3MEGB 4RO0A 3K57A 3BO3A 5LOQA 2CYYA 5KFGA 2W7OA 3QPIA 3U02A 2CRLA 2LKZA 4ECYA 1JKHB 4AYBD 3JAMY 3GR0A 2HVDA 3G6YA 4I0WA 1K0TA 4BC9A 4Q8FA 3KHRA 3GG1A 2G4BA 1YJ9S 4ZPBA 3J81j 1WI8A 2XY6A 2HSEB 2FJDB 2DNQA 4DR4F 2Z2ZA 4X4QA 2OFHX 3CJ4A 5HLFB 2HNDA 3WBZA 1HI8A 2ASLA 1X4DA 2ZJQQ 5EX0A 2ZOGA 4GRSA 4PUOA 3VTIA 4B9UA 3KNGA 5D4PA 2MY7A 3Q8PB 2Z2LA 5KT5A 3MR2A 1SH3A 3FMWA 3Q8QB 3DI6B 2NXNA 3H5XA 3MGJA 1HNVB 3OW2R 1MMNA 1IWGA 3OL8A 2W9CA 5LJ5Y 3PX6A 2MKIA 1S1XB 3A3NB 2OMOA 2CNLB 4NCAA 3SDEA 1VQMS 5BJRA 1OJ4A 2KZMA 4ZLNA 5I3QA 3CEDA 4WF9Q 2VUGA 1BLUA 1U24A 2EXUA 4Y00A 4CLPA 3DNCA 3NGUA 4OYAA 3FVYA 5KFKA 3CJ0A 3OL9A 1FE4A 4NLGA 2B3TB 3A12A 4X4OA 1C1BB 3BQ2A 2QYGA 5J1NA 3TVYA 3PYEA 2XI3A 3EGNA 2AX1A 5CYQA 1OPIA 4FXVA 3ZZUA 2GIRA 3CJKA 1M0SA 3HSZA 3CMAS 1BC6A 1QSYA 3W5ZA 1AROP 1VC6A 3AAWB 4C3LA 4I2PA 3RAQA 2K3IA 1WHVA 3TX8A 1VIXA 2GGPA 3OTBA 2CG4A 3LGMA 5KG1A 1D3WA 2AQ4A 3EDRB 2W4DA 2A3JA 3NBPB 1NDLA 3NCQA 2G2OA 3TARA 4I67A 4J9LA 3ZTQA 4DPTA 3BSCA 1HKAA 3UWTA 2IJRA 2V8HA 4LQ9A 1RUSA 2C2KB 2FVPA 4I7FA 1JJHA 1URRA 1Y3KA 1VYAA 4P10A 2AMCB 3V6JA 2ZJPQ 3KOAA 1ZAXA 4QIVA 3PG9A 4R8UA 3VR1A 3EPGA 4DSLA 3SCJE 1GXLA 1QDUB 5K8PA 1YJRA 4RUCA 4QYZJ 1O6XA 4C7QA 3GYGA 3KDOA 4DU7A 3BQ1A 4WU2A 1PC5A 3EGVA 3SFUA 2FJAB 2FJVA 1Y5IB 2J7UA 1U1NA 3IO1A 2ALZA 3OVAA 3ITHA 3ZZZA 3TRGA 3L3CA 1IBMF 2PD1A 1U8WA 1N0VC 2BUNA 2HMIB 2HGLA 2XMVA 4DR2F 3QRRA 1GXTA 2FGOA 3ISZA 2JJ4D 1SUQA 2ZH3A 4BC7A 1FKPA 3IR5B 4FBTA 5IV3A 3FK4A 3KK3A 1I94F 3IR6B 4V19J 3GQCA 2XM3A 5KFPA 5E3CA 1S1VB 5L38A 3BBFA 1WDDA 2XY7A 1Q82T 4ECZA 1S99A 4DV5F 1LW0A 2GMHA 2RU9A 2Q6CA 1NDKA 3I87A 2Q43A 1UMJA 4V1Ak 2RQKA 4C6AA 1N34J 2EFGA 4DR7J 2RRNA 2VG7B 1VRTA 3DYAA 3DLGA 2GA7A 2J0WA 4F04B 4L3KA 2ZNZA 1Y11A 4FBUA 1K9MT 2NYIA 2RF2B 1ZZNA 4I2QA 1RTDA 2HK2A 3LANA 1SCJB 1NHUA 3TEHB 2FY1A 1UFWA 5E3QA 2HHVA 5KFHA 5D8HB 5DDQC 2YX4A 1L5UA 2RVJA 3W8GA 3HZEA 4TYBA 1ZTWA 5AE3A 4YHHJ 3DOLA 2OPQB 2B9XA 2ZM6F 2HHPA 2GFFA 4ZA1A 4ELTA 5DDRC 3VAFA 3V81A 1N56A 2CAJA 3LP1B 3D6TB 3B4DA 4P7VA 2F4VJ 1ZBTA 4ZN1A 5H9FK 4RW6B 2VQEJ 1N5SA 4LF2A 4NX9A 3AY0A 2HURA 1JJ4A 1KLMB 4JI4F 3OV7A 2GHVC 2FJEB 3CJ2A 2KM8C 3EUNA 2LDYA 3N01A 3HT0A 5J1EA 2V0NA 2I5JA 2M5YA 2VG6B 4ZLPA 1S1TB 4AL7A 5GADI 3K5PA 1K1QA 1V9OA 3TOQA 2YY3A 3FSIA 3DCAA 1FX4A 5FJ4A 1KWMA 5CHCB 4M5NA 3B6BA 1UTAA 2VICA 4DI6A 2YNFB 4DL0C 1PYSB 3L9ZA 3B82A 1XMBA 4NE9C 2CUYA 3M2VB 5J2MB 3R27A 1XR6A 2HS3A 4ICLA 1IKVA 1JLFA 4TYAA 3WX8A 1ZH5A 1PAEX 2AJFE 2IAJB 2NR0A 3EXCX 1VQ6S 4Q0BB 1RISA 4PPDA 1EQMA 3SBMA 3RAXA 5T14A 4PQUB 2IA0A 5KT2A 3BGRA 3CIMA 4MKYA 4ZCLA 4IYQA 4FNHA 1WD6A 3MI7X 4K4XA 2P9CA 3ZXWA 2V69A 1R8PA 2QE5A 2LEPA 1QSLA 4WFXA 3HHLB 2UU9F 1UVIA 4OV6A 1YJVA 3DRPA 4FKYA 3KK1B 4ED7A 4ZVGA 1RTZA 3ISNC 5HQMA 1WC1A 5BXIA 1WELA 3Q83A 2J9DA 4DR7F 3IC1A 1R27B 1YBTA 3NKYA 4KKOA 3NGKA 1T03A 3HJVA 1HWJA 4DV3J 4U67Q 1HYSB 1L3SA 1CLFA 1X9SA 3HFKA 1S1UB 3RRGA 3ZNJ1 4RBTA 1IQZA 4Y2IA 1G3OA 2V5HG 5IT0A 1I3OB 2OEJA 3J81Y 4J9SA 1EKSA 4LRCA 5L1KA 2VKRA 1NSAA 1C4CA 2IVFB 4IG3A 3QNWB 4C8NA 2UVVA 2CVEA 3GFYA 2HG4A 3SQGB 4NYZA 4HDGA 1QUVA 2B5JA 2K1RB 1NEEA 5E2QA 4I56A 1AZSB 4ZVFA 3GFXA 1IKYB 1NPKA 4PWDA 1JXVA 1X60A 3H5YA 3QRQA 3CDAA 2HHQA 3CXCR 1RBOB 4Z7YA 2MGZA 4JV1A 1SJFA 2OTJS 4DQSA 4JI7J 5IFMA 5DETA 3JSYA 5GAHI 4WTOB 3R97A 3M8PA 3V5RA 2CZ9A 1U7LA 2QL9B 1T94A 1TKDA 2R4FA 3WQPA 5KFTA 1N36J 4EYHB 2HKEA 3QGPA 4IQMA 2VB6A 1RT6B 3M8WA 2W2NP 3ENQA 5F8LA 3MEGA 4JYAJ 3VF0B 1IR1A 3AOAA 1S6OA 3W62A 1JKHA 2NXJA 1L3KA 1Q78A 3JB9k 3KJFB 1UFLA 3I56S 4DSFA 4ZVRB 4CLKA 3FCHA 3VHQA 3T1AA 5HLFA 2HQFA 2RE1A 4C98A 3RU0A 4F3MA 4HDHA 1N33F 2AW0A 3WC2A 3VZIA 4DX6A 3AH6A 2Q6BA 3AXMA 4DX8H 3VAGA 4UUXA 2DIUA 1XMQF 4LF5J 2V8GA 4FYDA 2BRLA 2RS2A 4DQIA 1OWXA 2PSZA 1WC6A 3SCKE 3KLIB 3HVWA 3Q8SB 3V4IA 3B8HA 4CT8A 4ZCMA 4F26A 4OQJA 3US5A 1S6QB 3K17A 4IOAQ 4F7VA 5ADZA 2CQPA 3DRRB 5IQQA 1OY6A 4YP3A 4URGA 2AJ1A 1GX5A 2E5IA 5F3ZA 3A8EA 1GK8A 1VHIA 5KT4A 5KG6A 2KYZA 3MCMA 2VG5B 3F73A 4NL5A 3DRYA 1C1BA 6FD1A 1NAQA 3MMJA 3PR5B 4KR0B 3MAAA 3ILIA 3BH7B 1DLOB 3DC2A 3MR6A 4X65F 3CCSS 3EM1A 5A6WA 5KFEA 3C3LA 4FF1A 2E9ZA 5KFWA 1RAJA 2XS2A 1RAGB 3BQ0A 2VL1A 2W9BA 1S4EA 1RKIA 1X9WA 4QJVA 3NBPA 2FDNA 5J2NA 1Q7LB 1FNOA 2OSQA 2XMWA 4PYAA 4GKJJ 2IHR1 5ETQA 3NNHA 2QN6B 2CJQA 2C3MA 3PFOA 4FF4A 1Q81T 3OVBA 2HVIA 3RB6A 1RQ0A 4NLOA 5A8KB 4LBPA 1MWQA 2E29A 1DJ0A 5D3GB 1HNXJ 3IA0A 3DKDA 4JI2F 2GZOA 1FF2A 3GV5B 1GFWB 1H7WA 2DNMA 1V6HA 4X66J 3R6LB 2FLOA 2DNKA 2WVFA 3T41A 3UVJB 4OYMA 1UWAA 2QLJB 1Q53A 3FQKA 1UJ6A 3RB0A 3HKZD 1NCLA 1VHFA 4H4KC 2N4DA 1XNRF 1SJRA 1HHSA 1APSA 1V3ZA 2HMIA 3CSKA 3IRXB 1Q5VA 1JLGB 1IM4A 4NLQA 3A8IA 3MR7A 4FPIA 4OJ1A 2R2RA 2O01C 2BKNA 1TFYA 1XBWA 3MM5B 5IM0B 2YWHA 2JL9A 4YY3J 3J7Z5 4K4YA 5B0AA 4X4UA 1E6YB 1S1VA 4PXBA 1DRZA 4NLWA 3UDVA 3OFFA 4RUAA 4DPXA 2O5DA 1JLQB 5KG7A 1XEZA 2G1HA 1FRHA 5M2UA 3M30B 4OZ2A 3B54A 1M5SA 4ZCKA 2MZQA 2VG7A 4B9NA 5HATA 5EN1A 4NCGB 4NXNF 1KRPA 1WSRA 5K8OA 3I55S 4RJVA 4EMDA 3G9CA 2HQ3A 4OJ3A 2YXLA 1FRIA 4B3TF 2RF2A 2BYCA 4KGKA 1B0VA 2O66A 5L9NA 2L3MA 4TQSA 2YKQA 3TUJC 1X5OA 2BDPA 4RNMA 2VASA 4RX6A 2BE2B 4QIGA 4K4TA 1SV5A 4ER8A 1FD2A 2GVZB 2RJZA 1IN0A 3DMJB 1RTHB 2OPQA 5GAGI 1J5EJ 2NPIA 3JQJA 2VONA 4WZQA 4GC6A 3LP1A 3FEYB 4EGLA 3TA0A 3KKFA 1VQPS 4RWXA 4TN2A 3JXOA 2RT3A 5IC6B 4I6WA 5I3UA 3I0RB 1IKXB 3PYDA 5FD1A 1DY3A 3N4WA 4JV0A 3LWMA 2HPUA 2VG6A 1S1TA 3CWJA 4B9VA 1XJWB 2HEKA 4UOGA 3BBBA 1T9YA 2ZVIA 3D0IE 5DS7A 3V6DB 4EUVA 2WOMA 4LF7F 2J7KA 2OPPA 2IVYA 3R7SB 5H9FJ 2R7VA 2O1PA 1S12A 1U02A 4J9VA 3OD2A 2IRUA 1WUUA 4RU2A 1VC0A 3VALA 4RW9B 2D9PA 4JB8B 3UNGC 1XWLA 3D6MB 5E3RA 3LWLA 4LREA 3Q86A 3OXLA 2UUAJ 1CBKA 1RDRA 2MKCA 4B9SA 3MD1A 3EXYA 2CNOB 3C15A 4YEAA 2KG1A 1H2TZ 2V94A 1LEOA 1FRXA 4IG0B 1SL1A 2HHHJ 1B0TA 5KG2A 3HHLA 1UETA 2BOPA 4A8XA 5IZHA 2I2YA 3Q0AA 4NI2A 5HBMA 3KK1A 2D3O1 1RSCA 4DV7F 4ZCIA 4NA1A 3KLGA 1PC4A 1KOHA 2I0XA 4TU9A 3I32A 3ETOA 2OGUA 1REGX 5HROA 4WFNQ 3CCZA 1TZ0A 4ZJQA 1SBRA 2JDJA 4JUZA 2F8HA 4DS5A 2PA3A 3M8YA 4OV1A 1QAJA 4DCPB 5D4NA 5C25B 1H6KX 3ICLA 3NCRA 1HYSA 2GJFA 1FNMA 1FFWB 3HHNB 2GW8A 3ENVA 3LA0A 3QIPB 4ZP9A 4EO8A 4LFCJ 2DIVA 5AT1B 2R9LA 1LK5A 2X1AA 2H4YB 1TUWA 1OIAA 2E1AA 2RHSB 3PW5A 4X4PA 4EFAC 2L08A 1HD0A 4OI1A 3J7YI 2DR9A 5ITHA 2HAIA 2H1YA 3MMAB 2J6UA 2R7SA 2UP1A 4F36A 2MTLA 3SQGA 1NK7A 2VODA 2MZSA 3CCRS 1IKYA 2FVQA 2PMWA 3AD7C 4NA3A 2GVDB 1CJKB 3HDSA 1JNRB 2QL7B 2QSFA 4NWBA 2JOQA 4XPCA 4DSJA 1XERA 5ETRA 3AQPA 2FHJD 1FDDA 4DX5A 2D3ZA 1ZPVA 4CO3A 1K47A 1Q0NA 2AWZA 2ZDOA 3MFIA 4LSLB 5B0BA 1CEZA 2DHAA 4FVCA 4DG1B 2ATLA 3VAHA 1GH8A 1FRJA 4KGXB 4OFZA 3CE8A 2KL8A 4HHJA 4C97A 1WJ9A 1P9YA 5D6GA 1W7WA 5ETKA 3W8PA 4DL5A 1Q8IA 2V2ZA 2APOA 2VQFJ 1RWMB 2PT0A 2FPHX 4ZVOB 1S10A 1N48A 2X7IA 1S59A 4JOUA 2ZBCA 3MECB 2MQQA 3C16B 1KR4A 4DR1J 1FT8A 2UUAF 4Z7CA 2G0IA 2VPYB 2BJ7A 5C2CA 2L9DA 1NHKL 2AIRB 4Y65A 3M4XA 1U25A 3CCUS 4O4RA 1VS3A 4QIFA 4KIAA 1MN9A 3HK2A 4X4NA 3M9NB 5E0OA 3LOUA 1H73A 1S9GA 2EFOA 2Q79A 4ZLLA 4U6PA 2BJ3A 4JI1J 3MM9A 1EIYB 4YDDB 3IGVA 3C19A 3QIDA 5HP1A 1MSWD 2JEGA 2NUUG 1U0HB 4PRFA 1S6QA 2FYXA 1MLAA 3H2VE 3SMZA 3A3PB 4FS1A 2D1CA 3GIJA 2ZH4A 2IJNA 2BANB 4DXLA 3IG1B 4PWWA 1X4GA 5DQIA 4PPZA 1RAHB 1FJGJ 3ULHA 1XNQF 2R42A 2LLZA 4O4GB 4C0OC 2UXDF 4RW4B 3MM7B 2HLUA 5GAEU 5DQGA 3H0PA 3TZWA 2HWIA 4L76A 1OMSA 5L1IA 1B99A 2C2NA 2B51A 1KONA 1R89A 5FDLB 4RW8B 3I6PA 5T7LB 2IM2A 1VBKA 1V5IB 3QAEA 5JUMA 4A47A 4DV6F 1IVZA 1WOPA 1DZ5A 1UW4A 4JI6F 3OXGA 4UY85 2ZH9A 2W8LA 1RWVB 3IWXA 2RU3A 3AHPA 4CO0A 4F67A 2QC3A 1G6BA 1FNXH 1T9XA 3NGDA 1YVFA 1F1BB 2OELA 4B9LA 2M0GB 4Y2KA 3DLEB 5IT9U 3OVSA 2AEJA 3O5TB 2BA9A 2H9ZA 2VH7A 5HO4A 2QV6A 3DGPB 3IRXA 2HRYA 2HFVA 4JI8J 2MKKA 2LDIA 4WFZA 5GMEA 4NMXA 4OZ1A 4JI3F 2E9RX 1TL1A 4KO0B 1IXKA 5IT4A 3GP9A 1HW9A 3OTOJ 2QLXA 1KBRA 3GYNA 4AQYJ 4NEYA 2R8JA 1UJ4A 1LFPA 5F8NA 1IUJA 4CLSA 1NK5A 1VQLS 2CPEA 3D5MA 1E6YA 3IP0A 2ZUGA 1RBAA 4X2BA 3F44A 3UN2A 2YKPA 1HMVB 4BDPA 2YH1A 3W2VA 2J7WA 2GJ2A 5HAOA 2DHXA 2DNRA 2UVUA 3M30A 1U2RA 3IM8A 5H9EJ 4FYYB 1WC3A 4X64J 1E6VA 1JXEA 2KFYA 4A8YA 4ZP6A 3M2UB 4MKAA 2M4MA 1IR0A 3VCDA 2J9DE 4ENOA 4M5DA 3BSOA 1EETB 2WVEA 2CQGA 2E5JA 3M8ZA 1RT4B 1MMDA 1WDTA 4EU0A 4IR9A 4MIBA 3MEDA 2OPRA 4FYVB 2UXBF 1TP7A 1SPBP 4HTIA 2CQIA 1U0SA 3C66A 3JSRA 3QSIA 4NLRA 5KFOA 3VAIA 2WONB 3LP2B 4LBHA 3H7HB 2LMIA 2M8DB 5LMUF 2EFPA 3PV8A 2DH7A 1JLEB 2IC3B 2G2ZA 4M5LA 3BDEA 1NHVA 4NCBA 3PO4A 4B9TA 3GZ7A 3D7SB 4WIQA 2VD3A 2GJIA 3W3SA 4Y34A 4OJGA 3GFZA 1NB2A 1SC4B 3VGSA 2DPJA 2DNNA 5KTQA 2LYVA 1IBLF 3I0RA 1Z2ZA 2CDRB 4GVBB 4MJKA 4P71A 5KFMA 1IKXA 1KNZA 5DZ6A 2DCLA 4M63A 4C0BA 3M7VA 4QR0A 1H2UX 2C2ZB 4ZK7M 4IDKA 3CJTA 1OQ6A 5K20B 1FRMA 4OHVA 1NJIT 1RWNB 5LM7E 3WHIA 4ATNA 3U1MA 2Y0BB 2FHJA 2B4PA 2B9EA 4MT1A 3EVMA 1TELA 1S9EB 2NSCA 4AXJA 3H40A 5HJXA 1NK9A 2UV8G 5DM6Q 2Y8YA 2GIFA 1VFJA 4FN5A 2EG1A 1RWPB 2W24A 3PW2A 2ZD1A 4FVMA 4IRDA 2GCFA 3FEZA 4WFBQ 1YJWS 3MM8A 5E3AA 4O3QA 3QJLA 3LUYA 4GMKA 1Q8KA 2BKOA 1M1GA 4DSIA 2C3UA 4DL7A 4C2MA 4MIWA 3OR1B 2CIMA 4LFBJ 3BN4A 4NA2A 1IJFB 4ITSA 1NKCA 2FGCA 4W98A 2PEHA 8AT1B 2CJAA 5EDWA 4YN3B 2FVCA 3KTQA 3AB2B 4DL4A 2XWXA 4U8VA 1JLCB 2RRBA 4A8SA 4JI0J 4QWCA 3GB0A 1HWIA 2VBZA 5DG9A 5C25A 3A4TA 2XMAA 3EYZA 5CH7B 4B3OB 4KHPJ 4NRUA 3NWRA 2JLFA 2ZWOA 2CKWA 5SZTA 1SQGA 1O5JA 5C2GA 3H2UB 3R2CJ 2XEXA 3DU6A 2E5GA 4HHUA 1K73T 1YBUA 1HHQA 1T8EA 3EWGA 1HR0J 3BSAA 4G6VB 4DLEA 4ZPVR 1CS4B 3MMAA 4H54A 2XQCA 2ZE2B 4DUYF 4ZHRA 4DEZA 1J5OA 4QU6A 2ZVSA 5DJBA 3GILA 4NLVA 2AEMA 2JSXA 2UUCF 1R7IA 1AW0A 2LQ5A 1M5KC 3S01A 4LF6F 3L7OA 2WTFA 1IJEB 5D4OA 4U7CA 2XHCA 5LMNF 3RW6A 1F9EB 4B3MF 3FSXA 3FEXB 5ETOA 3WIUA 1U1QA 3H98A 4WXOA 2RILA 3TA1A 1S72S 2FZCB 3GR1A 4WFYA 1SC3B 2A18A 1K1SA 3TVZA 5CYJA 3Q8RB 3MEKA 4UOFA 2V2VA 1G4CA 3DGVA 2ZBRA 2V9WA 5KOWA 1RHMB 4ZPAA 4DX7A 1TQLA 4ED2A 2FQQB 3IXQA 5A8RB 4P7TA 4B17A 4HI2A 4NLXA 4EZ9A 3ZZ0A 4M5GA 3CJSA 1R6YA 2N7CA 3N9UC 3MECA 2C3OA 2MJNA 2OLWA 1IM6A 5F9NA 3JSMA 1U6BA 1R6VA 5LXRA 3DDIA 2UXCF 3ZC4A 2W4CA 2AZ3A 2DGTA 3RR7A 3H59A 2FLNA 4WP3A 2NYHA 1LW2A 4KB7A 1FEEA 4WCEQ 1ZM3A 1YRUA 3GIIA 4GO7X 3SV3A 4LFBF 1UWBB 2ILZA 3BM7A 2WBRA 3MPVA 3QT8A 3OLBA 2OFGX 2ZC4A 4EBDA 4P2XA 3BBCA 2DT9A 3PKMA 3W2WA 2Z56B 2MPUA 3UQSA 4CLWA 1RCOB 1ZAWA 2KI2A 4IH7A 3OSNA 1BUXA 4FYXB 2LQ8A 2AYEA 4ZVUB 2QZ8A 3ZO7A 3O3LA 1JQGA 3I5BA 1GAOA 3GIRA 4ECVA 5GADU 2EWHA 1PJ5A 3GLJA 4IOBA 3CJ5A 4CTAB 2BBEA 2QJ3A 1LNQA 4ANEA 2VDHA 3MOJB 1FTRA 1HR0F 1BQNB 1X0FA 1S57A 2B4VA 1HPZB 1WKJA 3PXGa 1DTQB 2ZHBA 3P5TL 3HPOA 3QSYB 1TL7A 1PBUA 2FHOB 2AV5A 2LEAA 4PG7A 3BGOP 1MU2A 4RW4A 2Z0GA 2MSTA 1FDBA 1T9TA 3R5CA 1GTHA 1S49A 1SIZA 4KPCA 2R2SA 2MMYA 1NKBA 1TMMA 5D4LA 3TQ1A 2YNGB 3G87A 1VQSA 1P1LA 2KRBA 4NMLA 1PYOB 4Q8EA 4O3RA 1LFWA 3N0VA 3PJWA 1ITPA 1BMQB 3OSPA 3GV8B 3R6GB 1VQ5S 2GO9A 3MPWA 2A2CA 1WKLA 4LVNP 2FLLA 2EI5A 2R2TA 1WNEA 3RRHA 1VJQA 2DRAA 3L09A 3VGUA 4Y2CA 2KN4A 2RRAA 1CG2A 2CZVC 4PG6A 1TL3B 3Q24A 4H4MB 2DNZA 5DO2A 1S76D 1KN6A 1CC8A 3HHEA 2C22A 4ECTA 3NMRA 5KFZA 2M9KA 3W5YA 5HSPA 2I1RA 3I31A 1H7XA 1G7CB 3RYLA 4RNHA 5D0RA 4CLZA 2DCUB 3T5HA 3UI3A 4CM2A 3CCTA 2HFOA 1GEHA 1GX6A 5M2PA 3DXSX 1MG7A 1HBUB 1UCNA 4OX9J 4KO0A 2FTRA 1ZM4A 4ZPCA 3MAHA 2CJYB 3LP0B 1NJXA 1VQNS 4M5HA 2NXCA 3K5MA 4WYWA 4DV4F 2XLIA 2NUHA 3MPDA 3KG0A 3HMJG 1F3VA 3H5UA 1HMVA 3BV8A 3IBWA 3EZUA 1F2HA 2FB0A 2BJ1A 1CVJA 1NM2A 1RTIB 3W9HA 4CYUB 3X1LB 3UFCX 1WORA 3K5OA 2XMJA 2DJWA 2RDIA 3FNNA 2DO4A 1RHQB 1ZA1B 3C6UB 4FKXA 1X0PA 1NPRA 2GX8A 3QGGA 3I9V9 2EG2A 1U09A 1YTYA 2BJDA 5GAHU 1UKUA 2W7AA 4K59A 3FJ2A 2WVCA 1RT4A 3QT6A 2JEFA 2M52A 1QVFR 3S1TA 4U9RA 2AD9A 1RT1B 3QLHB 2B0GA 4ID5A 2YKMB 3HKWA 2WONA 2KM8B 3MM6A 2DEJA 4F4XA 3KXDA 2CDQA 3FC9A 3KLFB 1JLEA 1XMOJ 2IC3A 1OS5A 2MZRA 1FXDA 5DLGA 2J6TA 5CCLA 1NLKL 4DPWA 2V63A 3ILOA 3VQTA 2YBVA 4F25A 4P2MA 1FRLA 3LAMA 2DPIA 3I82A 3JQMA 4GVBA 3K8VA 1PAUB 1TKZA 4K4VA 2DXDA 3DOMB 3PKYA 5A2QU 2V4QA 5B0DA 1F60B 5F41A 4L3NA 3MUTP 4DR3J 2ZHOA 2KFNA 2DGSA 2HVZA 4CLTA 5BR8J 4RBVA 4X84A 2EW9A 2E1PA 3CMQA 3WDOA 1YJNS 4GVLA 3NL0A 3PYFA 2DNYA 5D78A 2P6SA 1H72C 1S9EA 4I1TA 1QTMA 2W2MP 4L74A 4Y3CA 2KT3A 1QTNB 2F8MA 2E66A 4ZS6A 2ZBQA 4K2JA 1C0TB 5HVGA 4B9MA 3CUNA 1KFSA 2Q1LA 2DB1A 4OX9F 3D0HE 2ADBA 5KFJA 4OLOA 1RYSA 4DR4J 2BEFA 1CQMA 2R3VA 4WPAA 2B4UA 4Z37A 4U96A 3IS9B 4F0MA 3OL7A 5A8WB 1ZETA 3HT3A 3LPYA 3W63A 2YWKA 3CTRA 2XZTB 3LGNA 2EBEA 3ZZRA 3PX4A 2V2QA 4IUFA 2XGPA 2QTWA 2Y1LB 3CVKA 4I68A 3H90A 3D28A 2BX6A 5EWGA 4DV2F 2P2CB 3G4SS 2LCWA 4UOCA 3JTPA 1TFWA 1UVNA 3NNCA 2JEIA 1HQ2A 4A48A 4C4WA 1Y9OA 3PY8A 1JLCA 1N0UA 3P49B 3O6QA 4RUBA 3TUZC
chains in the Genus database with same CATH topology
4PXBA 4ZVEA 1DRZA 2GV1A 1DLOA 2EKYA 3M32A 2K8GA 4NLWA 4ZP7A 5E5NA 3GV7B 3CC4S 4O3NA 2POKA 4DFJA 1QUPA 2UUWA 2VPZB 3DOMA 2A1BA 3K59A 3CB4A 3OFFA 4RUAA 1I1GA 3I0SA 2HIQA 2O5DA 1JLQB 5KG7A 2WOMB 1XEZA 2OPPB 2VFSA 4EZ6A 1KEKA 1UJ5A 1FRHA 4YMEA 5M2UA 3OJUA 2HNDB 4G1QB 3M30B 2HGMA 1DQ8A 1XR5A 1M1KT 4IR1A 4J9NA 2F9DA 1C1CB 1TVRA 2WSFC 5A2QY 1BQMB 1M5SA 4ZCKA 4O3SA 2MZQA 4OZNA 2YNHA 4RBUA 3S8SA 3NP5A 5DQHA 2VG7A 2L41A 3FFIA 5HL7Q 2OJ3A 1DURA 2R7XA 2ROEA 1YI2S 4MTPA 3H4BA 2XI2A 2N82B 5GVQA 4B9NA 1OQ3A 7FD1A 2ZH7A 2DR7A 4NCGB 4NXNF 2CZ4A 4DJBA 1KRPA 3KMQA 5EN1A 3VWSA 4EO6A 5K8OA 5KT6A 4ES2A 2IYIA 3I55S 1TV6A 4IOCQ 4QQBA 1UL3A 3G8TA 3G9CA 3CD7A 2HQ3A 3HHDA 5DGAA 3FRYA 4HH1A 2ZE2A 3TW0A 4OJ3A 4C11A 5A8KA 1FRIA 3NLCA 4B3TF 1H38A 2RF2A 2BYCA 4KGKA 1B0VA 2O66A 5L9NA 2L3MA 4TQSA 5D3GA 5CYMB 4ZMMA 1AFIA 2YKQA 5BYQA 3CDWA 5LSRA 3TUJC 1D8YA 1X5OA 1YG0A 2BDPA 4RNMA 2VASA 2LXFA 4RX6A 4KE5A 2BE2B 4QIGA 4KFBA 3M05A 1D8ZA 2RQMA 4JI0F 4K4TA 2YKAA 1SV5A 2EBGA 3UDLA 3OPKA 1FD2A 2IM3A 4HT5A 1U2FA 1MWZA 4HYKA 4ILLA 2RJZA 5HBMB 5A0YB 1VQ7S 2CQ2A 2WSCC 3OHBA 1IN0A 4RUHA 3G8QA 5I3PA 3DLKA 4KHPF 4KAIA 3KLGB 3DN9A 1VQYA 2KVIA 1H3DA 2WCXA 3DMJB 3MPYA 1RTHB 2R7RA 2MXYA 2OPQA 5GAGI 2NPIA 2VONA 3SSQA 2XWYA 1S6PA 3GE9A 2YKNB 5HROB 4A8OA 4WZQA 3LALA 3O1LA 1SKWA 4GC6A 5DG7A 2RUGA 1SL2A 3LP1A 2G13A 2IM1A 1U47A 1N34F 3FEYB 2E1CA 4EGLA 3TA0A 1VIOA 2IBOA 3KKFA 4GO5X 1LV5A 1VQPS 4RWXA 4TN2A 1TKTA 3CD6S 1FK9B 1KQKA 2RT3A 2B56A 1JLGA 4DUZF 2B6AB 5BYSA 5EHHA 4I6WA 3HP6A 5I3UA 3MTJA 3I0RB 4K4ZA 3KLEB 3M2RA 4USIA 4DS4A 2Y0SD 2ZKTA 3NAHA 4Z2XA 1IKXB 4QW8A 5FD1A 3N4WA 2V9KA 3N5FA 4JV0A 2N3OA 3LWMA 1F5BA 2CPHA 4PXCA 4YFUA 2HPUA 3UD3P 1YRXA 1IKWB 3MM5A 5IM0A 4DFKA 2VG6A 5AJ3F 1S1TA 4ZKAA 3CWJA 4ELVA 2MQOA 3BGFA 5A8RA 2ZHAA 2VOPA 4B9VA 2W4PA 3LH2S 1S0NA 4LUBA 4XDDA 2XB2D 4Y0FA 2XLJA 2PA8D 5KFDA 2GQ2A 3M6WA 1S9FA 2P5VA 3FRZA 2EFVA 5FLXY 4MIAA 2FD2A 1M90T 2PMZD 2C2DA 4TLRA 4KV8B 2P9GA 2BM0A 1SH2A 2LECA 2J0QD 1HQUB 3GIMA 3OLAA 3H25A 2B7BB 3D0IE 3TUIC 3IRWP 4L6V3 2DNPA 5DS7A 3V6DB 1JLQA 4YHHF 4EUVA 2WOMA 2WAQD 1Q7YT 4LF7F 2J7KA 2OPPA 2ZOFA 2IVYA 1RP5A 1OO0B 5H9FJ 4G1QA 2R7VA 4ECQA 4QCLA 3UCZP 4I7FB 2J9CA 1RT2B 2O1PA 2EPIA 2ADCA 4WIIA 2E7WA 5L1LA 2QA1A 4R8UB 2R8KA 4Q5VA 2F4VF 1SL0A 2IRUA 5F3TA 1VBYA 2KTQA 1P27B 2CPIA 2DBBA 2VQEF 3PFEA 4RU2A 4HLBA 3RTVA 5K8NA 3KJVA 3QO9B 1H98A 1VC0A 3VALA 1YJTA 4NCGA 4MFBA 1YIJS 1HI1A 2F9JA 2D9PA 4RW9B 3UNGC 1VC5A 1XWLA 2XZWA 4K4WA 2AGQA 1R3NA 2OIHA 2F7VA 3DRSB 3FDSA 5E3RA 3LWLA 1O0PA 4QR2A 2B7CB 4DDFA 3TANA 4J9PA 4CO5A 3OXLA 4NOHA 2MQNA 1FJ7A 2NS1B 1T3OA 1RDRA 1MWYA 4Y2MA 2MKCA 4D3GA 3MD1A 3EXYA 1Z2LA 4B9SA 5M2RA 4YEAA 3E01A 3FSYA 2KG1A 1H2TZ 1LWCA 2V94A 4EEYA 4C0HA 3SXLA 1FRXA 3ENWA 1TAQA 3DLBA 1MMLA 2DR5A 4IG0B 1SL1A 3MD3A 4J9OA 2W25A 1FE0A 4DL3A 4YUDA 1N54B 5J2QB 3HHKA 2CFXA 3O2IA 4QIWD 3FMBA 2ZJRQ 1B0TA 2BE2A 2QFJA 5KG2A 3HHLA 4G1IA 4L72B 5B7WA 3VAMA 1UETA 2BOPA 4A8XA 5IZHA 3AJ2A 5B0FA 3Q0AA 2PMHA 3QZ7A 3G96A 1C0UB 2I2YA 5LSLA 2XSJB 5HBMA 3ZZOA 5A0YA 4X4RA 3JTOA 4HL9A 3KK1A 4ZPTR 4DV7F 4O3PA 2DISA 4ZCIA 4ED5A 4NA1A 4OL8A 3P96A 4TU8A 3KLGA 2WB4A 1PC4A 4C8OA 3K8WA 3DMJA 1KOHA 1RTHA 1HWKA 1MW7A 2BJEA 5EUHA 3V2UC 1FKPB 4F2RA 1S79A 1W25A 2I0XA 5E3PA 3I32A 4TU9A 5F8JA 3C6TB 3ETOA 2HWHA 4N56A 4CTAA 5HROA 4FF2A 4WFNQ 2VKZG 3KK3B 1MROA 3CCZA 4IO1A 4DLGA 5CA5A 1TL5A 4OZLA 3I5AA 1TZ0A 4E8UA 1SBRA 4J9KA 2JDJA 1I6JA 3CCJS 3RZAA 1R8AA 4MH8A 2VA2A 4JV2A 4JUZA 2E1MC 4Q7AA 2CQCA 2FUG9 2F8HA 4DS5A 1RT5B 1FHTA 2PA3A 1FK9A 1TKXB 2DNLA 3VZHA 1DTTB 2LQ9A 1WI6A 4OV1A 4H4OA 4CNZA 3BR8A 1AUDA 1BQNA 1QAJA 5D4NA 2XCPA 5C25B 1UVJA 4G1PA 3M8SA 3KLHA 4ZOSA 5FIIA 2ERRA 2LXUA 1H6KX 3PJXA 3ZZTA 3ICLA 3NCRA 1M5VC 2ZZNA 1HYSA 2ACYA 1SQEA 2R2UA 3O44A 1FNMA 4WK3A 1N5YB 4WTYA 1X5SA 3D1HA 2GW8A 1T95A 4NYPA 4CH1A 3HHNB 3ENVA 3QIPB 4ZP9A 2E5HA 2FHMA 3MOZA 2CPXA 1LW0B 4EO8A 1D1UA 3PW4A 2RB7A 3P3DA 4YB1P 1FTCA 3UD4P 2ASDA 2Q3PA 1HBNB 2DIVA 3N6NA 3TNVA 3MMBA 4DFMA 2R9LA 1HBOB 2OD4A 1S97A 1XTZA 4ILRA 1LK5A 4J9QA 2X1AA 2MY8A 2KXFA 2UUBF 2WBMA 3H20A 3J7ZT 4CH7A 2OH2A 1D9FA 4M8LA 2DRBA 4MK8A 1OIAA 3Q2TC 1VRTB 3KLVA 1S48A 3DYAB 1R43A 2DTJA 2RKIB 5EX3A 4DQPA 2EC0A 2E1AA 4OHWA 1SXLA 4FF3A 3PW5A 1JLBA 4X4PA 4DN9A 1UEUA 4O44B 4EFAC 1X7VA 1UP1A 1HD0A 2L08A 3T6BA 1XR7A 3QYYA 2YNGA 4OI1A 3J7YI 2DR9A 2K7KA 2AYGA 1CC7A 2AYBA 3NG8A 5ITHA 4Y28C 2HAIA 3V6DA 2KFZA 3MMAB 4RW7B 4LQ3A 1O8BA 4QZVB 2ZH1A 4TLQA 4HI1A 3L7PA 2J6UA 2R7SA 2UP1A 3UR0A 3SQGA 4ID8A 3LO3A 1GNKA 1WF2A 4AE5A 4CO1A 1RT2A 3BREA 2BV3A 3M6VA 4I2QB 4X4SA 1NK7A 2FJXA 1FESA 4RNFA 4WKRA 4KJIA 1KQGB 4C9DA 2VODA 5KFLA 4X4VA 3OQ2A 3PDNA 2RDJA 1FKOB 2C42A 2KT5A 2MZSA 3CCRS 3H8YA 1D9AA 1S9GB 2GIQA 1IKYA 2FVQA 1PSDA 3CDBA 4P2SA 2GMLA 2OD6A 3MM9B 2I38A 4NA3A 1X4FA 3HZGA 3LW5C 2ZNYA 5LT5A 4DQQA 4RW9A 5KT3A 2HNYB 3Q23A 3J7A1 3BR9A 1VOMA 4DV3F 5KFUA 5HP1B 3BGLA 3MDFA 3DRSA 1V3RA 2D74B 1X8DA 3CIZA 3KHHA 2R8GA 4FXDA 5F8MA 3HDSA 4PQAA 4ALZA 5KFFA 3OJSA 2QLWA 1JNRB 2QSFA 1R8BA 3NWGA 4TY8B 2FJWA 4NWBA 5HI7A 2JOQA 4XPCA 4DSJA 1N8RT 1XERA 3AQPA 2MZ1A 1FD8A 2YX1A 2FHJD 1FDDA 2DHGA 4FZVA 2GHPA 4ELUA 2D3ZA 1ZPVA 4TNOA 4CO4A 2AGOA 4CO3A 2YWEA 3R5DA 3HJFA 2AWZA 4IG0A 2I8EA 3N5BA 2DGUA 1SB6A 5J2QA 1X9MA 1S0MA 2MQMA 2O3DA 2ZDOA 3MFIA 4LSLB 4KHRA 1QVGR 5B0BA 1A7GE 1CEZA 2DHAA 4LF4F 1ZZFA 4FVCA 3RRKA 4DG1B 3N6LA 2XSJA 3A1YG 2ATLA 2LXIA 3VAHA 1B64A 1Y5LB 3LQVA 1GH8A 4J5OA 4FNIA 4KRWA 1FRJA 1JX4A 4PG8A 4F02A 2CVIA 4OFZA 3CE8A 4HHJA 1HD1A 4C97A 1VRUA 2DITA 1ROFA 4DL6A 1F0XA 2OTLS 5D6GA 4ZP8A 1LWFB 4DFPA 1J2VA 3K58A 5J1EB 1KLNA 3C6TA 4DL5A 4F2SA 5K9FA 2I5JB 1Q8IA 2XMKA 1HBUA 5KFIA 2GHWA 1RI7A 5C42B 2APOA 2KXNB 3KK2A 2MSSA 5CD4H 4OI3A 5I42B 2JVOA 2PT0A 2FPHX 4KT0C 1S10A 3DOKB 2F3JA 4F8RA 2A2DA 3MUVP 1RT5A 1N48A 3CJ3A 5U47A 1WEZA 2XMMA 4TY9A 3TA2A 4XK8C 4JOUA 4YB5A 1DTTA 4OX7A 1XC9A 3LP0A 2ZBCA 1YBAA 3MECB 4DSEA 1L3UA 1KOOA 4MAKA 2MQQA 1Z4UA 1AFJA 1QAYA 1Y7PA 2R8IA 3OL6A 2HHTA 1KR4A 1JJ2R 4M95A 2ZH8A 1FKAF 2R7TA 1S1WB 4AXIA 5IS2A 3RR8A 4O23A 1FT8A 1ZYQA 1ULRA 1HL6A 2UUAF 3QIPA 2J0XA 2FJBB 2NPFA 5C24A 3M8RA 1IKVB 2CPFA 3OTDA 1JLFB 3CCVS 2KHCA 2OKQA 3KG4A 4YDXA 2VPYB 3MUMP 1RKJA 2XS5A 2UV8A 2B4OA 4UQTA 2WSEC 1XN9A 2L9DA 1HBOA 2XC9A 3K7RA 2GQQA 3OFGA 4DMZA 4C8KA 3TO8A 5A6PA 1YSJA 4JI7F 2HS0A 1Q4RA 1KSPA 1RTIA 2OPSB 4CNYA 4DV1F 2ZC3A 2EK6A 1ZOTA 5C5JA 4HT7A 2OO4A 2MHEA 3DM2B 4Y65A 3M4XA 3HF5A 3SV4A 1U25A 1JB0C 4AL5A 2K3KA 2LA4A 4O44A 3CCUS 2HZCA 5HN0A 5GAEI 1F9FA 2YKOA 3C6UA 4XPEA 1SJ1A 3BGRB 4O4RA 1LWEB 5D77A 1V3SA 1VS3A 1T7PA 2RIJA 3MXHP 4RW7A 1N36F 2RMLA 3SI8A 4ZDNA 2LU1A 1SKRA 3I96A 2Y1RI 1TR0A 2M8HA 1RTJB 4QIFA 4AUKA 2MKHA 3EZ5A 4KIAA 1RT7B 2M7SA 4N41A 2M2BA 2BQUA 3HK2A 4X4NA 3M9NB 4JYAF 1A6LA 1FKOA 3LOUA 3DHXA 5E0OA 3TAMA 4DPOA 2IA6A 3N6MA 3JYTB 2W9AA 1S9GA 2XS7A 2EFOA 2Q79A 4U6PA 1SKSA 3OTEA 1R0AB 2KG0A 1WHWA 5IXUA 4F4KA 4IQXA 4LF8F 3TR5A 3MM9A 4XDCA 3THVA 4YDDB 3IGVA 4QW9A 4A8MP 2GNKA 1GT8A 3K5NA 2HNYA 2CQ1A 2FVRA 4NLDA 4RU9A 3QIDA 5HP1A 3VQSA 1U1PA 1FVSA 4B3SF 1MSWD 1LOUA 4KSEB 2JEGA