5B0EA

Polyketide cyclase oac from cannabis sativa, v59m mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
b'AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIMEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 28
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0eA00
2FTRA 1YJTA 1OPZA 2GCFA 2HFOA 2ACYA 1X8DA 1OQ6A 1W2IA 2BBEA 2QLWA 2RSQA 1FE0A 2XMJA 3HHLA 4Y2KA 4HH0A 3TNVA 4A4JA 2ASYA 3UDCA 2AJ1A 2VV5A 1N5VA 1TZ0A 1VQYA 1FD8A 1SQEA 2XMMA 1TL4A 3BN7A 3KNGA 2FIUA 2OAUA 5B09A 1AW0A 3WDOA 2ROGA 1Q8BA 3BDEA 2GGPB 2BJDA 5K9FA 2AJ0A 4DN9A 2KT2A 3FMBA 2Q3PA 3DXSX 1MWYA 2OMOA 2KT3A 2ZDOA 3HHLB 3KKFA 2QIFA 2QLXA 2VH7A 4HI1A 4A48A 2RMLA 1X0PA 5IXUA 1S6UA 2IYGA 1QUPA 2W4PA 3LGMA 3T9NA 2W4CA 1N5TA 2LQBA 2KKHA 1IUJA 4HL9A 3FGVA 4Q2MA 1URRA 2PGCA 2AP6A 2GA7A 1CPZA 1P8GA 1RJJA 1Q53A 2GFFA 1OQ3A 4FNIA 3BB5A 2GO8A 1FE4A 3E8OA 2LQ9A 3QGPA 1CC7A 2W4DA 5F0WA 1APSA 3KG1A 4Y2MA 1SI9A 3CJKA 2OD6A 3LO3A 3QMQA 1YJVA 1TL5A 1Y9OA 3I9ZA 1FVSA 1Q4RA 4YDXA 1KVJA 1YRXA 3KG0A 4OJ3A 3IWLA 1VQSA 2N4DA 4HH1A 2EW9A 2PD1A 2K2PA 3MCSA 1Q8LA 2RU9A 1MWZA 4OJHA 2IYIA 2BUNA 1WD6A 2XMKA 5KAKA 4F67A 2HFNA 2K7KA 2RILA 3BM7A 5A6WA 3DCAA 3IWXA 2ROPA 3LGNA 1X7VA 1KVIA 1OSDA 1JWWA 3CJKB 2OP5A 5B0BA 2FHMA 2N4CA 3HHLD 4A46A 4NL5A 5B0EA 2N7YA 3MZIA 1TR0A 2HLTA 2JDJA 1N5SA 1YG0A 5B0GA 2ZDPA 3HDSA 1R6YA 2XMUA 2KYZA 2CRLA 4ZOSA 1CC8A 4ZA1A 1GXTA 1KQKA 4U9RA 2IFXA 1ULRA 4QOTA 2BJEA 4FNHA 2XMVA 2HIQA 4A47A 3HF5A 5B0DA 3TOQA 5B0FA 4HI2A 4NPOA 1AFIA 3VTIA 2L3MA 4YEAA 3GZ7A 3HHLC 2QYCA 3HFKA 1FESA 5F0UA 1FEEA 4OJ1A 1Y3JA 1GXUA 1Y3KA 2K7JA 2LXFA 5B08A 1YJUA 3HX9A 5B0AA 5A6PA 1XBWA 1P6TA 2AW0A 2K1RA 1N5QA 2LDIA 4OIXA 4DL0C 5T7LA 2OKQA 1K0VA 4Q2LA 2OFGX 1V3ZA 1S6OA 2HLUA 1Y0HA 1LQ9A 1U7LA 2OD4A 3F44A 5B0CA 1JK9B 2OFHX 3TRGA 1SB6A 2XMTA 4EFAC 2ROEA 3BGUA 4OJGA 1YJRA 2GV1A 3BF4A 4DPOA 2FB0A 2HQIA 3FRYA 2G9OA 2K1RB 3K7RA 1AFJA 3BR8A 5T7LB 1TUVA 2GGPA 1FVQA 2BYCA 2XMWA 4Y2IA
chains in the Genus database with same CATH superfamily
2HZAA 5LXYA 2H48B 3C66A 2ZFHA 1CG2A 1DAXA 4W90B 4LQ9A 2Z2MA 4YB1P 1RACB 4O3OA 3RB0A 3MURP 2DGVA 4Y28C 2X7IA 1J5OB 3BBCA 2MKIA 2ZZTA 4URGA 1RI7A 3I56S 3J80U 2B56A 3NG8A 4ED7A 1H74A 3SSSA 3T6BA 3HZGA 2LQ8A 2Z2ZA 4A8MP 1IBMF 1C0UA 4FYXB 4NXNF 3RAQA 2E44A 4ZVUB 3FBCA 1Q1KA 4FYWB 4F36A 2BBEA 2BJ1A 3MUMP 1BQXA 5KG0A 5HN0A 4X4TA 2OAUA 3HD1A 4PAAA 2ROGA 4FBTA 4P71A 1REVB 3FSIA 5KFXA 2B3TB 1EP4A 2RU3A 2JVOA 2RDDA 1G7CB 1OWXA 4H4OA 2M70A 2OLWA 2VQEJ 1S5ZA 4Y65A 3EDQB 5GADU 3FNNA 4YS2A 4X62J 2AQ4A 2GO8A 4F3QA 3E8OA 1N6QA 4FDFA 2UUBJ 3UWTA 1NZAA 1Q16B 4AD6A 2H5EA 3DFEA 4H4MB 3T5HA 1V5IB 2AEJA 1UEKA 2E9RX 3R5DA 1AZSB 2W2QP 3UN5A 1H72C 3ZXWA 1S9FA 3M8QA 1QTMA 3JQJA 2HHQA 3OL7A 1FKPA 5C24A 1HBUB 3J7AN 5DLGA 3OFFA 2JLFA 3FMWA 4NPOA 1FERA 4FS1A 3CDEA 1XNQJ 2O5DA 4RUHA 5B0AA 2AJFE 3ISZA 2EBGA 2LDIA 2HIYA 3TR5A 2QO3A 1HW8A 4M63A 4X4QA 3W5XA 2MQLA 4EFAC 2EG1A 3FRYA 3M8ZA 3TUIC 3PYFA 4J9UE 2UP1A 1LEOA 2XTJP 2QL7B 4U96A 1RHMB 1RE1B 5GAGU 1LK7A 2CQ3A 4IFYB 4LF9J 4U8VA 1H7XA 3BDPA 5M2RA 3N01A 4JYAF 2CQCA 4QWBA 1RK8A 4KIAA 2PO4A 3Q86A 2IAJA 3BSCA 1YJNS 1CJVA 2K3IA 2QZ8A 2DNLA 3G8QA 3W2VA 4GO5X 1CC7A 2AEFA 3GIKA 5EWEA 2RDJA 1NJXA 4CO5A 1XMOF 5I42B 1U0SA 4AL5A 2G2ZA 4CIOA 4M94A 2HG4A 3PJ9A 2YQ1A 4ZPBA 1ZA2B 3W2WB 1VLOA 3HHKA 1KQKA 2C2RA 3DOKA 2KFZA 2ZJRQ 3R5CA 4RNFA 1BD6A 1H38A 4ILMA 4P72A 1Q8IA 1FDNA 2C3MA 3HP6A 4KRWA 2M9KA 1FKOB 1UJ6A 2YX7A 4OX8A 2ROEA 2IPOB 3MM6A 4PRFA 2QRRA 1RYSA 3FZBA 3D4JA 3MAHA 2V8VA 2EC2A 4C3KA 1WWHA 1CQNA 1GFWB 4QR2A 2P9EA 3MM7B 4OHYA 2M88A 4JI6J 4F7VA 3T5LA 1HWIA 3NAHA 1X4DA 2DCUB 2BW7A 4N76A 2IMOA 2V0NA 4V1Ak 1NJYA 3G6YA 5HMYA 2DHSA 4ECYA 1NBEB 2OEMA 3KLGA 4I64A 5AXNA 1LXNA 4ECXA 3V4IA 2P6TA 1PC4A 2UVWA 3H5XA 4RW4A 3W66A 2CPDA 2QYGA 1NSPA 2UUCJ 1AT1B 3CCTA 1IVZA 1QD1A 3R97A 4CLSA 2XMVA 3BGOP 1JXLA 2VOOA 1M90T 4KBIA 3S8SA 1YLXA 3FFIA 1ZPVA 3HLUA 4RNOA 2CQIA 3CJ3A 2Y3YA 2WHOA 2BR0A 2GS8A 1H0HB 2JVRA 4J7CA 4F0MA 2RAQA 4X4PA 1C0UB 1GT8A 1NKBA 2A10A 1KSPA 2I9SA 3VWSA 4A8KA 2YNIA 2FDNA 3KDNA 1U1KA 3POTA 3GTYX 5CD4H 3FMBA 3DXSX 4A48A 4MTPA 3J7YU 2D3ZA 2CJQA 2WSFC 1EP4B 1S4EA 2PEHA 2QLBB 1RUSA 3NS7B 2DO0A 5GVQA 1WUUA 4H4OB 5HANA 3JSMA 3DNCA 2RQKA 4GO7X 4F50A 7AT1B 1IBMJ 3CCQS 4F0KA 4NXNJ 4OZLA 1N6QB 3TJ9A 3I4HX 4CQ1A 4HACA 2OTLS 1HHTP 2Q6CA 2C3OA 4PUOA 5D3GA 4USJC 2E5GA 4ZVFA 4HT7A 4GKKF 5F0UA 5ETVA 1FKPB 5C24B 1FXLA 1VCTA 4IO1A 3SIPB 1KQSR 2VFSA 2FHOB 4ID5A 5GADI 2JEJA 1EHWA 4U7UK 1S1VB 2A3JA 1JKHA 2DKOB 5ETQA 3CCWA 4F4ZA 2CPZA 3G2XA 2AHOB 1UAWA 3TAQA 2Y0SD 4WXWA 2JEFA 4Q44A 3D68A 1VC6A 3CDUA 4I2QB 3C14B 4U67Q 1H2VZ 1KVJA 1OYDA 2N4DA 2WTFA 1CJVB 2VG7A 3W2VB 4A8SA 1QUVA 1GAOA 4WU3A 1UCNA 1U1QA 1Q86T 3HSZA 2B7BB 3DKDA 2RKIA 3K5OA 2BE2A 2V2ZA 5GAGI 3U1MA 2CG8A 1WC0A 4O0NA 2EPIA 4ERDA 2UV8A 1FESA 2WAQD 1NHKL 1HR0F 3N9UC 1PC5A 3N6NA 3DOKB 3VALA 1U6ZA 3QLHB 2DIVA 4JV0A 4JYAJ 1Z1ZA 3KJNB 1ZM2A 1VHFA 4ALZA 3IAM9 2BYCA 1TMMA 4EK2A 2BE7D 1OQ6A 1W2IA 1KEKA 3TNVA 1JJCB 2DGOA 2D7SA 3MM6B 5HSPA 5BYRA 2GAHC 1F9FA 2FLOA 2MDAA 3T1YF 3M2RA 5E2QA 3CUNA 4EUVA 3EDRB 3H5SA 2DNZA 1KLMB 1Q8KA 4ELUA 2FLLA 3OVBA 1B3TA 4BWJA 1W7WA 4CT9A 3CMES 1YBTA 1S0VA 1MNEA 4RUCA 2DVIA 5HK4A 4MAKA 2AGPA 2C28A 1L3VA 2VBZA 1SQGA 3KLGB 4KGKA 1RTHA 4DSIA 1HFEL 3V4IB 3HT3A 2DK2A 1N4LA 2R7TA 3TA0A 4EYHB 3US5A 1RADB 1GXUA 4UOHA 4OYMA 4ICLA 3M9MB 3KLIA 2HHHF 2JEIA 3NMRA 1U1RA 3FFIB 3U7JA 2FZCB 3TWZA 1RTDA 3VZIA 2MZ1A 1U09A 3P4UB 4EGLA 2ATLA 4PWWA 5KFSA 1N32F 5SZTA 5IXUA 3LGMA 3EWGA 2YNIB 2LQBA 3POTB 4ZVEA 2J6TA 5KFBA 3GJTB 1IM4A 3VZHA 4ZLLA 4YB7A 4Y6IA 1FXRA 1MG7A 4BWMA 3MCNA 4NEZA 2HBRB 4AUKA 4RBVA 1FHTA 3N28A 2JH3A 4CLZA 4ZJOA 4AFFA 2M8HA 3BM7A 4C11A 3HHLD 4R0JA 3OHBA 3JSMB 3BH6B 4S0MA 1UVJA 2WZ1A 1TV6A 4HACB 2GHWA 3I9V9 4DL5A 4K59A 5DGBA 1SH0A 2KZMA 2OIHA 2XO6A 3M30A 1YKWA 3DU5A 2LQJA 3RAXA 2YPYA 3J7YI 1VR6A 3W9JA 1ZOTA 2XYGB 1X0PA 2IIHA 2BQ3A 4DR1F 4ID5B 4E2FB 2EFGA 2HRUA 1NDCA 1Y7PA 2FQQB 1S12A 4N7TA 5GMEA 1WHYA 1HARA 4QW8A 1JKHB 1P9QC 4USHA 1X4FA 2AX1A 2EBEA 1HI0P 1KOOA 4ZK7M 1N33F 1XMQJ 2KI2A 3PG9A 4GKKJ 2W8LA 2YPZA 3DC2A 4K4VA 2V9KA 2MMYA 1SJ4P 3OQ2A 4OLPA 2CAJA 3EE3A 4DQRA 4YDDB 3VAIA 4KGMA 1UVNA 1HL6A 3WQPA 3CDBA 2VG7B 4F2RA 3OJSA 4DSFA 5HMZA 3FCHA 4O3SA 3GYXB 3H40A 3Q2SC 1JLAA 2HQDA 2E9ZA 2RE1A 2HYIB 9RUBA 1FRKA 2BE2B 3AQPA 5HATA 1EAYC 2HRYA 3NNHA 2AD9A 1LV5A 1K47A 5L39A 3T19A 2W2NP 2I6WA 4DOZA 1FDBA 3V6DA 4LFCF 3HHLA 4A8FA 2VDHA 3MR5A 3UQSA 3JQKA 3MM9A 2ZJQQ 2ERRA 4X66F 4WZQA 5BYSA 5IWAF 3LW5C 5CH7B 2LXIA 4TU9A 1IKYB 4M5GA 1S48A 1QAXA 1SH2A 3GFYA 4K5RA 3W63A 4AXJA 3UDEA 1VQMS 3MUVP 1U1PA 1HR0J 4OJ3A 4MIAA 3DRXA 4KKOA 2FGCA 4MJKA 4M1KA 4C0HA 3Q8YA 3OL9A 3M6VA 4KPCA 2E66A 5B0GA 1AB8A 3M6WA 1RAGB 3I6PA 4X65F 1I94F 2KVIA 4N77A 1QTNB 3KUEA 1J2VA 4KV8A 3MPUB 5IV4A 4NZ7A 1NH8A 2BANA 2LLZA 1VQ9S 1RWOB 3I55S 3EPGA 1RTHB 3T1YJ 4Q7AA 3VAGA 3JYTA 4ECSA 1NH7A 4DXLA 5BYQA 1KONA 3RGIA 2OFGX 2VC1A 1X5PA 1WF0A 3L7OA 3ITHA 1VBZA 4IRCA 1O0PA 2H1YA 4OZ5A 4I69A 1TK0A 1EIYB 2N3OA 3CMQA 3OW2R 1BHNA 3X1LB 5D8HB 1AROP 4R0EA 1BQMA 3QZ7A 1H73A 4C98A 3N5FA 4LUBA 1WTBA 1VRUB 2KJWA 4AYBD 1DLOA 2R7RA 5FIIA 4DFPA 2DNYA 4ER8A 3L09A 1FX4A 3H2VE 4RWWA 5LJ5Y 4IFVA 3LP2A 1SV5B 3QFHA 4RW8A 5CYQA 2ZBCA 5E3RA 1FF2A 1YRXA 1T02A 4WKYA 1D3WA 2EW9A 2K2PA 2BUNA 2HHHJ 1QVGR 1UMJA 2E5HA 1UJ5A 3RW7A 2B4OA 2EC0A 4CZCA 4UQTA 4G1PA 1VQPS 3DLHA 4C11B 1DBDA 2VF3A 4DHVA 3QFWA 1RAFB 2WOMA 4YQWA 4P7TA 1N32J 4P2MA 1N36F 3DOMB 2OKQA 1TV6B 4WTOB 2DXEA 2DGWA 1JQGA 1TAQA 3IS9A 3R7SB 3QO9A 5KFYA 4ENOA 3DM2A 4DPYA 4DR4J 2DH7A 1VFJA 1OPZA 1B0TA 1RWVB 2Z2LA 3DDNA 4CLKA 3A4TA 3N6MA 2XHCA 1WHXA 4A4JA 4Z7CA 1B4SA 3MCMA 5J1NA 1GTHA 5HI7A 1OIAA 3T9NA 4F8RA 2AGQA 1FD2A 3SEOA 3BSOA 4HL9A 4V19X 2FJVA 5I3UA 1EJ7L 2HQ3A 3R5JB 3CJKA 5DDOC 4NMXA 4RNHA 4F4XA 2DEIA 5ETTA 3PTWA 2YX4A 1WD6A 3T1HF 2E1AA 2VONA 4NYZA 3O3LA 1T05A 2DCLA 3FBBA 3R6LB 3PYDA 2IMWP 3PVXA 3UD4P 3VGUA 1H98A 4DR1J 2EFQA 1CSJA 2OPQA 1PKUA 4EWTA 1VI7A 3KNAA 3AA8A 2GMHA 1FCAA 3LAKA 3CT9A 1JLAB 2CZ9A 2ZOFA 2HZVA 3BS9A 2MQOA 3BF4A 3I5AA 1NRKA 4L74A 4I6YA 4JI7F 4G1QA 1N33J 4I4BA 5EUHA 1S59A 1B7YB 2K06A 1TL4A 5B09A 1R8HA 2X51A 1RP5A 3BQ1A 2BJDA 5DG9A 2XCPA 3V6DB 3HHLB 3CF5Q 4PQAA 1RAJA 5A8KA 1K9MT 4LBPA 1WKLA 3ZZZA 1EARA 3QGPA 3KJFB 4DX6A 3QMQA 4GVBA 1TUWA 3GJRB 3KHRA 4ZPCA 1J27A 3FVYA 1R0AA 1MWZA 3K89A 1IR1A 4DS4A 5CQGA 2W8KA 2B4PA 2MZRA 4IQXA 1JLFA 1S6PA 1IN0A 4P74A 4LFCJ 3C6TA 1MSWD 2YWFA 1WI6A 4RW9A 1NUEA 4HTJA 1SJFA 1KNZA 4OJ1A 4A8OA 3LWLA 2OPRA 3CJ0A 2MHNA 2IBKA 2HK3A 2XYHB 4MYUA 1U4BA 1NK6A 4KV8B 2P2CB 2BANB 5IWAJ 4LREA 1JK9B 2C3PA 2X3DA 3FEZA 3OV7A 5CZXA 1GNKA 3S6EA 4YHHF 4Q8FA 1YI2S 1NCLA 4O4GA 4DI6A 5J2MA 2VV5A 2ALZA 2WVDA 2YQ3A 3CJRA 4PXEA 2OPPA 1Z4UA 1WKJA 9ATCB 2H51B 2MKJA 5KG3A 5F9LA 3FCWA 1BQMB 2AZ3A 5K8MA 2KJVA 1GMUA 4FYDA 4TVAB 4X65J 1I94J 1WC4A 5L38A 1DLOB 3PYGA 1LWEA 3M05A 3HZEA 2ZOMA 2XB2D 3EGNA 4URQU 4IFVB 4LF7F 3LP2B 4WBFA 5MLCV 4RW8B 5CYQB 1MW7A 3GU0A 2UUTA 3RBXA 3CJ4A 2RJZA 2XWYA 4J9QA 2UV8G 3DLEA 1UWBB 1VBYA 3RYLA 2F7VA 1S1UA 5A8WA 5B08A 1XIQA 4QJVA 1UKUA 1GK8A 3Q83A 4ZPVR 3D0HE 2OFHX 3O8WA 3EGWB 2MXYA 3HVWA 2WOMB 2FJAB 2BQRA 1RKJA 2UXDF 3DI6B 3A13A 3BYRA 3IS9B 3QO9B 4DQPA 3DM2B 4J37A 3J80Y 3NMAA 4ZHRA 4RX6A 2F63A 3I5CA 2APOA 1KHWA 5FJ4A 5K14A 2PT0A 3V6JA 1FFWB 1S1XA 5KOXA 5HMWA 1JNZB 4OYPA 4QU7A 2HHWA 3DRPA 2J0QD 4LR8A 1N36J 2DNQA 4LF8F 5I3UB 1KWMA 4FBUA 2ROPA 1MROA 3CJKB 1GMWA 1PJ6A 4DQSA 4X4OA 5AXKA 5L1KA 4FF1A 4N47A 2KYZA 2XY7A 1U1NA 3K5NA 2OO4A 2BJEA 2HIQA 5FDLA 3JS9A 1T05B 1ZM3A 3MAQA 4P75A 1EETA 1Z2ZA 3BGLA 2BOPA 2CNLB 2JRSA 4A8WA 1CS4A 4WCEQ 2ZD1A 4GKJF 4ES3A 1H3DA 3HSDA 1RT7A 1YK9A 2DRBA 3MMCA 2RNEA 2G9OA 2C2OB 4EBEA 2HHUA 4ZCMA 4PWDA 4NLTA 1S57A 1H6KX 3MR7A 2FIUA 3T1HJ 4LRFA 5D0EA 4YP3A 1G2EA 2VODA 3CC2S 4EEYA 5KFGA 1U6BA 2R8HA 2YKPA 3BH7B 3NKYA 2KN4A 4QQBA 3TO8A 2AJ2A 3HVRA 5A8KB 3LO3A 1FKAF 3I9ZA 3PO4A 1HBOB 1KS2A 2MKHA 1MMLA 2KFYA 4GVBB 4RL1A 4JI7J 2CNNB 3CJ2A 2VFUA 3MXHP 5IT9U 4HHJA 3M8WA 5LT5A 1JLFB 1Y3KA 1S6PB 5KT7A 3ZZ0A 3C6TB 5ETNA 1T0TV 2VPXB 4RR5A 4DSEA 4OI6A 3W9IA 1HMVA 2XNRA 3HHEA 2OPRB 2RT3A 1VHIA 1WF1A 2HFOA 2ZH1A 1RKIA 1TTHB 2XSJA 5M2PA 3WC0A 2HWHA 3GSIA 5E3QA 3PIOQ 2LKZA 5J2MB 1TKXA 2RHQB 3ZC4A 3QRRA 1R8BA 2EG2A 3HHDA 3K59A 3H25A 3IM8A 4IO9Q 3W9HA 3TUZC 4PR6A 4TYAA 4X84A 1FWKA 3I82A 1JWWA 1VIOA 1L3KA 3DDIA 4I68A 1L3UA 5E3PA 3K58A 4YHHJ 1CJUA 4MH8A 5ETPA 1N5YA 1E6VA 3CDAA 3V4MA 4OZ0A 1NJZA 4TYBA 5HQLA 3AB4B 3DLEB 4ZCLA 3THVA 5LJ3Y 2ZVIA 3M2UA 3IG1A 3ZTQA 2H65B 5A8WB 2XNQA 2HQIA 2PDAA 3NY0A 1TFWA 3UN2A 1S1WA 2HNZA 4DPWA 1ZZFA 1FD8A 4LF7J 4DPXA 2YNFA 3R5AA 4ZVRB 4IOCQ 1GTEA 1FJEB 2W4PA 1K44A 4ILRA 2RRNA 4ZHRB 4CLWA 5KFVA 1FT8A 1IBCB 4ZIWA 2QFJA 5IT0A 5K14B 2MB0B 4NLSA 1S1XB 4I56A 2IRYA 3I0RB 4NZ0A 1HNVA 4K2XA 4NLOA 2GVDB 2MSTA 4KSEB 5LL6d 2UXDJ 1U1MA 5LSOA 1N56A 4EI2A 4CP5A 2YKMB 1MROB 2V4RA 4TY8A 4CI0B 1VS3A 1TKDA 2OSRA 4RWXA 2HAFA 1FRHA 1H7WA 2HS4A 2X3GA 3FC9A 4OYZA 1YJRA 1EETB 1RWMB 3H98A 2VG6B 4NLXA 1CS4B 1X4AA 2ZD1B 3HVTA 1ITPA 2QLWA 1QLNA 1RT7B 1JLEA 2LU2A 2M52A 3CMAS 2XMMA 4B9VA 1O5JA 4LF8J 5AT1B 5KFNA 3A8KA 2NQPA 4HT5A 4EO8A 4WFAQ 2W2MP 4ELVA 4DPUA 1OJ4A 2O01C 5LSRA 1T9YA 1YDLA 1VBXA 1Q79A 1JLGA 2OD6A 3HJVA 1WHVA 3PW2A 2EKNA 2VASA 3IR7B 1LWXA 5KG6A 1DTTA 3MCSA 3PR4A 2DHXA 3G71S 2HFNA 3V6HA 1UFLA 4GKJJ 1RQ0A 1WOOA 4B9SA 2XMUA 2HVIA 2GVZB 4M5DA 4R25A 1NLKL 2QLFB 2ASJA 2F1FA 2LP4A 3BQ2A 4C8KA 1GQEA 1S6QB 1CLFA 4WWSA 4OX7A 3U1NA 4KT0C 1DQAA 4HVZA 4ECWA 3GR0A 4CYUB 5D4NA 4Q2LA 3H5UA 4QWDA 2PEBA 2R7WA 3LALA 4QIVA 2HWTA 3PW4A 2PIIA 3L9ZA 3DHWC 3CB4A 1HYSA 2H54B 1HMVB 3GILA 1PILA 4WP8A 2VBYA 2OSQA 1QAYA 2Q3PA 2YXLA 4Q43A 2KT3A 1IKVA 2XSJB 1AA1B 1RAIB 5HP1B 3RR8A 1RAOA 3OLBA 4C8OA 2IM3A 2V2KA 3NCRA 3M2VA 4P73A 1RAEB 4M5JA 2YWHA 3HK2A 3UNGC 3OR2A 2M3DA 3FBEA 2YNHB 2PA3A 4OYAA 3KLVA 1B99A 1U45A 2ABYA 3R8YA 5HROA 2B5JA 4IG3A 1RU1A 1T7PA 3IWXA 4RW7B 3Q24A 1SKSA 1X4BA 4J5OA 2MLZA 4RZRA 1K0TA 3OFGA 3ZZOA 2ZKUA 5IM0A 2ZBIA 3BEGB 2A6OA 2XQCA 3RB4A 2PA8D 1CJUB 3SCLE 1E6VB 2HNYA 2ZZNA 4K5SA 1OYEA 3TZWA 2E5LF 5FLXU 4CO0A 3M2UB 1UEVA 3IG1B 2WBMA 1XNRF 1S1WB 2HNZB 4LRDA 4H4KC 1V3RA 2G0CA 2H4WB 1HQUA 3BB5A 3KXDA 2XY6A 1SI9A 1SL1A 2CJKA 2G1DA 2PD1A 2B9YA 3KTQA 4LR7A 4NLPA 2R2SA 2LA4A 1X7VA 4LVNP 1OSDA 1WDDA 4K4UA 4B3RF 3DRYA 2BABA 2J0WA 2NPIA 5DRKA 1HNVB 3K8WA 5B0DA 5G0RA 5DGAA 4DLGA 3G8SA 2JHEA 2QYCA 4O44A 2K7JA 5T7LA 4ED0A 2CPJA 4TY8B 1NO8A 2ZHOA 5DDPC 2MKSA 1OSCA 3A8IA 2HGLA 2GIFA 2R8KA 2W24A 2OEKA 1UJ4A 2N7CA 3UN3A 1C0TA 3PW7A 3P3DA 4B9UA 2IRUA 3HVTB 5C25A 2FPHX 1JLEB 4FF4A 2VA3A 4U8YA 2ZH9A 1A7GE 4ZLPA 3B6BA 1VRTA 4HEA9 1I5OB 4YDXA 2DNPA 2ZE2B 3AOBA 2A1BA 3KK3A 3C6UB 1FK9A 2X1FA 2GMJA 1TR0A 1G1XA 1W2BR 2MTLA 2CJBA 3D6HB 1DTTB 4QBUA 4LSZB 1TL3A 3GE9A 3H90A 4ZS6A 1LK5A 5JVGQ 2YWGA 1I1GA 2DNKA 4KGXB 4QWAA 4OL8A 3JTOA 1M5VC 1BUXA 2KM8B 4M5DB 4CRJA 3KLHB 4P6QA 1N48A 4CM0A 2A2CA 2V5HG 2YKAA 3MD1A 4OV6A 4P10A 2EVZA 4F2SA 2RHSB 1KQGB 4QPXA 3CD5A 4ED8A 3UVJA 4B3SJ 2NXEA 3WC2A 4NLGA 3MAAA 2FY8A 5C42A 1IUJA 4FNIA 1IKVB 4F4WA 5L46A 1RYRA 4DFJA 3PRVA 1WOPA 2AJQA 3BSNA 4KB7A 3QYYA 1JXEA 1I51B 3T5KA 2DY9A 1SIZA 2X1AA 4KGZB 1L5UA 3RR7A 3OR2B 4QCLA 1RAHB 2BMBA 2KO1A 2CRLA 2B5JB 4IG3B 4UT4A 4O3NA 2QE5A 3ZNUA 2I1RA 4ZP6A 3KWMA 3UR0A 1D9DA 2UZAA 4N5SA 4N8OA 4IR9A 2WRMA 2MKCA 5A76A 4WP3A 2MGZA 5IM0B 4Y00A 5K20B 1DQ9A 4PG7A 3DMJB 4YR2A 1AUDA 3M32B 1FWLA 2FB0A 3VAMA 3K7RA 3WX8A 2Z8QA 3PXGa 3TQ1A 4CT8A 1X60A 1RCXB 4NZ6A 1N5VA 4UUXA 5ETLA 1PG5B 4DFMA 3ZZPA 2IYGA 2K3KA 5KOWA 4CNZA 4AE5A 5BJRA 2AYBA 2JFKA 1Q7YT 3NS6A 2RRAA 4OQJA 1XTZA 3EGVA 2XMAA 2XSFA 3C3LA 1RA7A 5J1EA 1FTCA 1HQUB 2FZKB 1D9AA 2B6AA 5B0BA 3SI8A 4OI1A 4PZVA 2FY1A 3M8PB 2VJUA 2IC3A 4ED4A 2RD5C 3UCZP 2D41A 4FNHA 4G3IA 2HSEB 2IVYA 1YIJS 3J81j 2SXLA 1FEEA 1WJ9A 4FYYB 3MTKA 1RWWB 1XNRJ 2IJNA 4LSLB 4W92B 5C7PA 3D6MB 3D67A 4J9RA 2GNKA 2DJWA 2DIUA 4TLRA 1KHVA 5E3AA 5I3QA 4U95A 2RIJA 3AJ1A 5T7LB 2QA4G 5J2QB 2D3O1 1ZS6A 4DLEA 1KBRA 2DO4A 3OVSA 2NUHA 2JWNA 2XG8A 3WDOA 1SKRA 1JNRB 3RB3A 4U9RA 2JLGA 2W7OA 4JI2F 5F8NA 4B3RJ 8AT1B 1C0TB 2JC0A 1FA0A 3H7HB 4FP9A 3GIJA 1VDHA 5C25B 2HFSA 3KJVA 3RB6A 3HULA 2ZH4A 1YHQS 4AL6A 4X62F 3RBEA 4LSNA 2C2KB 4QWEA 4DEZA 2WVFA 1BY9A 3IRXA 3BO4A 5KFTA 1VRTB 1RDRA 3PYEA 3F0NA 5E3CA 1FTRA 5JJBA 3P49B 2MQPA 3EZOA 2IFXA 2V4QA 2F40A 3KK3B 4DU7A 1FK9B 1TL3B 1JB0C 1PO6A 2E1MC 1XNQF 1K0VA 1NM2A 1VJWA 3QSIA 2OGUA 3UD3P 2GO9A 4M5LA 4DV2F 1Y00A 1CJTB 2Z0GA 4J9KA 5MAOA 2ZH3A 3OL6A 3UFCX 2J8AA 4WJBA 1LW0A 1KLNA 3E01A 2WVBA 2D74B 2Y1JA 2WONA 3PO5A 4LBIA 2WW4A 1GX5A 3ULHA 4FYVB 4X4SA 3UVJB 2KHCA 3MAAB 4K50A 4IUFA 4C7QA 2FJWA 3QIDA 1MU2A 3JB9k 2XZDB 2FHKA 3ZZYA 1VQLS 2OP5A 4JI5F 4DUZF 1SVDA 2HBZB 2C2MB 1NEEA 3MHYA 4OZ1A 3IR5B 2Q43A 2KRBA 2QL5B 2IBOA 4FXWA 3MGJA 2BACA 3NNAA 3KLFB 2LEPA 1Y0HA 4USVA 4QPTA 3TRGA 4L3NA 4RKUC 4IRKA 2HURA 2COLA 4TKTA 2MGZB 4LRAA 5E5NA 3GFZA 2VUGA 2J5AA 1R8CA 2G2YA 2EK1A 2RF2B 3R5GA 3PRBA 2VKRA 3M8SA 2RUSA 5J1PA 3JAMU 2XGPA 4MKVA 4YMEA 1IKXA 1FRJA 2YX1A 3EYZA 3GJSB 4NI2B 4NRTA 3ENQA 4DFKA 4KFBA 3BBFA 2ZNZA 3VF0B 2K7KA 2CXEA 2I38A 3Q22A 3QGHA 3O6QA 2QA1A 3HPOA 5J1EB 2VZ9A 4OZNA 4NE9C 5EX3A 3MOZA 2LQ5A 3U1LA 2B6AB 2ZEJA 1X5TA 2UUCF 4B3OA 3BO3A 2IC3B 4B08A 4DL4A 3MOJB 1Q7LB 3TZXA 3CSKA 5LMUF 1JLBA 4JP8A 3N6LA 1WOSA 2GX8A 4DR6F 4WFNQ 1U47A 1U24A 5CCLA 4DPOA 1DHMA 3MMJA 1S0MA 3IA0A 2HNDA 3AB2B 3IFEA 3IGNA 3KK2A 3HD2A 1O8BA 3OTCA 1Y5IB 5D4PA 3KMSA 1C1BA 1T9TA 1IJFB 1RWKB 2BZ2A 2ZC4A 5CXTA 2BVZA 1TELA 3D6FB 3HMJG 4LF4F 5D0RA 1YWXA 4K4SA 3G8TA 3L7UA 3TVKA 3KK1B 2M4MA 1F9HA 3RW6A 2KDOA 4LIRA 2A6MA 1ZETA 3Q8UA 1P27B 1X31C 4CO4A 2W1BA 1WEYA 4CH7A 3KJVB 3BKUA 2EWHA 4J90A 1D9FA 3MFIA 4JBCA 2ZM6F 2CQGA 2EEYA 3NL0A 3G6ES 2QG9B 1R27B 1C4CA 2QGFB 1XMBA 1RXOB 3NWGA 3G9CA 1URNA 5CCMA 2ZITA 3TVZA 2MY8A 1U26A 4JI2J 2V8PA 4DX5A 4BC7A 5L1LA 1DARA 1NK5A 5B0CA 4EBDA 1Y11A 3W5YA 1OPIA 3ISND 4LFAF 2DR9A 1FJ7A 3EX7B 4ZPDA 1KP6A 3HCXA 4ZVTB 2H5JB 3PFEA 5AE2A 2G13A 1HI1A 4DSJA 2RMLA 5BR8F 4ZITA 2I8EA 3CO0P 2AU0A 3LGHA 4NLQA 3E01B 2BQUA 1OQ3A 2WONB 2CZVC 1BLUA 2F8EX 1M1HA 1KC8T 4CWBA 3CCRS 3SYZA 3DLKA 4NYOA 2PI5A 4PG4A 3ICLA 4A46A 3NGTA 4DV2J 4YB5A 1MU2B 2CG4A 3BR9A 2OI2A 5EGYA 2W2PP 2DNGA 2E1CA 3OXLA 3D3CJ 5HLFA 1T3OA 4LJMA 1NK8A 1XR6A 1EKRA 3MM8A 1N34F 1VBKA 4DX8H 2XLJA 4X4UA 3OSNA 1GH8A 1UW4A 3NGRA 1RT3A 1HBNB 4ES1A 4DDFA 2VG5A 2QC3A 4QU6A 3PIPQ 3QT6A 4BS2A 1YJTA 3P8BB 2D69A 4Y2KA 3CJSA 3VV2B 2ZVSA 4PEOA 4L76A 3AODA 1QSYA 5IT9Y 3RBDA 4TU7A 5J2PA 4WIQA 1NPRA 4JI5J 4DUZJ 1T9XA 3OFEA 3OT9A 1PYSB 2ZWOA 3CD0A 3Q0AA 3DU6A 2ADCA 1N5TA 2DEJA 1RZMA 3NCPA 4WK3A 2IRXA 4DU8A 4TLQA 1I3OB 1M5OC 1QDUB 3GQCA 3CNQP 1IKXB 1TL1A 2JLEA 2BX6A 4QR0A 1C2PA 1TP7A 2LCWA 3QT8A 1Q95G 3F56A 1KOHA 2F3JA 4KFBB 3I4PA 1G3OA 2CQ1A 2V68A 1R0BG 4C3LA 2BKOA 1LKZA 3TEGA 3CULA 2EXUA 1NB7A 3NS5A 4ZPWR 4Q45A 1ZAXA 2QT7A 3EJMA 4B3OB 3BGRA 1F5AA 5L9NA 2IM0A 4ZVPB 4C8NA 4C97A 1JLBB 4L75A 1B64A 3D66A 4R8UA 2BJ8A 5KFHA 3C15A 4HH0A 3Q89A 3H2LA 1HD1A 4USWA 2HNDB 5AXMA 1X5SA 4Y34A 3KK2B 2KT2A 4ITSA 1UWAA 1NK0A 2KG1A 1H2TZ 3EUNA 3EXCX 1T9UA 2R7XA 1C1BB 5FD1A 1G4CA 4K0KF 3I5BA 4Y3CA 5JVHQ 5H9EJ 3SSQA 1RHJB 4QW9A 2NXNA 4HKQA 1TMJA 5LMUJ 3QGIA 3WZ0A 4I7FA 3MEGA 1U1LA 4DR6J 2QJ3A 4C4WA 4JV5F 2YWWA 2NXCA 3GSDA 2V34A 5DG8A 3P5TL 4QOTA 3B54A 3GYNA 4OYBA 2XLKA 3ZNJ1 3LWMA 3MUTP 4U6PA 2D1CA 1K1SA 3LPYA 3LP1A 4J9MA 1Q0NA 5K8NA 4LRCA 4RBUA 5DO2A 4LF4J 5K8PA 4CO1A 1KTQA 4OMFG 2GV1A 4O4RA 4EZ9A 4BDPA 1XEZA 2ZBQA 3MR6A 3G82A 2Z58B 4KTQA 2G1HA 2W4CA 2ZM6J 2QA4S 2LXUA 1WG5A 4EU0A 2V63A 4QIFA 4DV3F 5F0WA 3FCVA 1DQ8A 3SXLA 1R31A 1VRQC 3DLLQ 3LF0A 4ZLNA 4MK7A 2OH2A 1XMQF 2I5JA 3M8QB 4PG6A 2J9DA 1W26A 3PJXA 3NLCA 5B0EA 4LFAJ 4CH1A 3CCLS 3DLKB 4J9NA 4QIGA 3DGVA 4B9MA 2WCXA 3HHNB 3FK4A 5ETMA 2EKYA 3W5ZA 5BR8J 1S6OA 1ZYQA 2ZJPQ 2E29A 4KGVB 1R6VA 3MFHA 2HMIA 1FVQA 1X4CA 4DSLA 2LFVA 4NCGA 2VHGA 2RSQA 3NP5A 1X4GA 4UOGA 2GQQA 5ETRA 2KTQA 2VG5B 2I0XA 1HWJA 3PX4A 2HS0A 2IAJB 3A3PB 1FI4A 3WIUA 4EBCA 1RHRB 1QUPA 1TKZA 2Z56B 2QTWA 4B9TA 2Q66A 1CPZA 2C1EB 2X1BA 3HVAA 5DLFA 2RUGA 4J9PA 3I31A 3W62A 3PHEA 1Y4ZB 1U48A 1N34J 5KFZA 5KFAA 5A6WA 1PJ5A 1OS5A 4NMLA 3KHHA 2HQFA 3IR6B 1HBMA 2OJ3A 1Z2LA 2GMLA 3L4BC 1RSCA 1M1GA 2KU7A 4RW6A 3PACA 4ZIVA 3EPIA 3SQOP 1KR4A 2AJ4A 1AFIA 3N79A 1Y3JA 4C6AA 2DGTA 4ZDNA 4OI2A 2MHEA 4CLUA 1U7LA 2CNOB 3OR1A 3BZQA 1U1OA 5DJBA 3LP0A 3C2PA 3V2UC 2F9JA 2BEFA 1SBRA 2P9GA 3BGRB 2RRBA 4OI4A 1CJKA 3TI0A 3D3BJ 3MCOA 3BDEA 2HAIA 4JI8F 3P96A 4R8UB 5H9FJ 3C15B 4LF2A 4P2XA 4P7VA 3THPA 1QVFR 2WVEA 3PEHA 1GXLA 1BE4A 4KHPF 2XO7A 2J6SA 3GG1A 1IJEB 1KRPA 4UOCA 1D1UA 1G6BA 5IOLA 5FLXY 4RW4B 4OJHA 2XLIA 4DPTA 4PQUA 4H4KA 5IT4A 1B7FA 2OTJS 2CQ0A 5C2CA 1UZHA 4I7FB 1HA1A 1X5OA 1FWPA 4M5KA 3A8JA 5HL7Q 2KT5A 2CPYA 3VR1A 4ZP8A 4GRSA 1WG4A 3PEJA 3P5BP 2E7XA 1V3ZA 1CULA 1RU2A 1PCAA 1Q78A 3IBWA 3RRGA 4K0KJ 3W61A 5I3PA 2RDIA 4Y2IA 1TL7A 1F60B 2W9CA 1LFPA 4Q8EA 1OY9A 4DR4F 2CJXB 4GC7A 2XM3A 1X9SA 1Q8BA 3JXOA 4R5PA 4JV5J 3ZFVA 3HM9A 2ACMA 1XERA 3W64A 2LEBA 3OJUA 2VOPA 2ZC3A 8ATCB 4ANCA 1UFWA 1K73T 5KFJA 2QMUB 4PG5A 3UDLA 4K4YA 3IWLA 1RHQB 4PUOB 2PE8A 4WPAA 2N4CA 5D3GB 1SQFA 1F5CA 2BOAA 2I5JB 3SZ2A 4DV5F 4TNOA 1TAUA 3QIPA 4WYWA 3VAFA 1ZAWA 2CPHA 2B4UA 5F9NA 3HX9A 1UZDA 2W7PA 3FEXB 2HLUA 2YNGA 3F44A 1VJQA 2P5VA 3W7BA 1F3FA 3SV4A 4QYZJ 5A0YA 4DV3J 2FTRA 3M9NB 4QYRA 1JX4A 4DS5A 4DR7F 2DTJA 2MKYA 1BWVA 2F65A 2HMIB 3J81U 2J8SA 4DN0A 1F2HA 3WX4A 5EN1A 4NCGB 5AE3A 2XBPA 4F26A 3IAS9 4B02A 1MN7A 2R7SA 4J9VA 4HHUA 3JSRA 2WSEC 2WB4A 4IH5A 1YJVA 2HHXA 4DV1F 1IBKF 2BJ7A 4DCOB 3M6UA 1SL0A 2G2OA 3SFUA 3V5RA 4FVMA 2VJVA 2GQ2A 1Q82T 1HWLA 2RKIB 2RB7A 3CIMA 1JJHA 2CFXA 3UCUP 2AWZA 3GZ7A 1HBMB 3HFKA 1NSAA 4NLWA 3CIZA 3RG6A 2M0GB 2R8GA 2MZTA 2AV5A 3AT1B 3IGVA 4QWCA 1IM6A 3NWRA 1XC9A 1FRMA 1SC4B 2M2BA 3ZZTA 4RUAA 1BMQB 3M2RB 4MK8A 2VD3A 3VQSA 1WC3A 4IH6A 5K9FA 4NRUA 3K0JA 2NZCA 1CVJA 4IFYA 3CCUS 1CJKB 3DYAA 1UA0A 4ETXA 2YVSA 3HT0A 3KYLA 3DRSA 1UPPA 5IV3A 2DGQA 1FE4A 2VPYB 3H4DA 3TX0A 3M8RA 3LQVA 4Q0BA 3EVMA 3ONQA 3NAIA 1VK8A 3DLBA 2YKQA 3QWPA 3UPFA 4ILLA 4ECQA 4PQUB 2HVZA 2L9NA 1C1CA 2GHPA 4ICLB 3KLIB 5ETKA 3TW0A 1QY7A 4YEAA 2JEGA 1OY8A 4JI8J 1RTDB 3GYGA 1NKEA 1HW9A 1YBAA 2F4VF 4KHPJ 1P1TA 2IA0A 4B3MF 3TZZA 3EMTA 3M6XA 4UOFA 2PSZA 1NDLA 4YB6A 3PX6A 3NBPA 5KFWA 4HDGA 2CIMA 3R27A 5CAAA 2GJ2A 3EGZA 3PR5B 2XYPB 2VA2A 3GV5B 4HDHA 4QIWD 2W9CB 2Y8WA 4ECZA 2R3VA 3MM7A 1ACMB 3J7Z5 2F8MA 3OBIA 2DHHA 4R5PB 2PGCA 3CCVS 5D0HA 1UL3A 4C8LA 4FF2A 1MWQA 1XK8A 2ZUGA 3CO9A 3W8GA 2XMKA 4PABA 1UVIA 4Z2XA 3D0IE 4KYZA 2ZH2A 2UU9F 3CJ5A 1R89A 3H0PA 5EHHA 1ZA1B 2KHDA 4NEYA 1R8PA 3M30B 3O1LA 2VBXA 4G1IA 4CM2A 1Y10A 3W1YC 2NLWA 3KJQB 1Q81T 1GMVA 4C8ZA 4WXOA 1RHKB 4W98A 3QIPB 2NSCA 3AJ2A 2OD4A 4FS2A 5CD4A 2XMTA 1S9GA 4P9SA 2C42A 2U1AA 1U0HA 2GGPA 2UUWA 2HQGA 2YNGB 1FE0A 2VKZG 2FJDB 2JJ4D 2ASYA 5DZ7A 2POKA 2R42A 3AD8C 3DHXA 3FSYA 5A0YB 3SV3A 2PI4A 2VC0A 3UCGA 1LW2A 2B7CB 1VQOS 4LQ3A 1D09B 4DV5J 5KFDA 2OUGA 2RVJA 2DNRA 4H54A 6FD1A 1Y9OA 1PYOB 4IG0A 3OUYA 1UFKA 5M2UA 2NS1B 2R7QA 1PBAA 2HVHA 1WC5A 3OVAA 2HGNA 3Q2TC 3ZTOA 1FNMA 4DR7J 2B8PA 3W8PA 1WG1A 3LUYA 3J7ZT 4OX9F 3F73A 3PM9A 3UO0A 4B3TF 2J7UA 1UPMB 1B0VA 1JJ4A 2VPWB 2ASLA 2PMWA 4PYDA 3TYTA 4J9OA 2VFTA 3I87A 4M95A 3MI7X 2ZBPA 2Y8YA 1NNDA 2CA9A 6AT1B 1ZTWA 4UTGA 1KQFB 5KT3A 1GX6A 2DHGA 4TY9A 1PJ7A 3MM9B 4DV1J 1IBKJ 3Q23A 2C3UA 4DV4F 2UXCF 4OHWA 4C2MA 4DR3F 1S1VA 2CQ4A 2N82B 4HI1A 2VH7A 4ZVSB 4HLBA 3PHTA 3DOLA 4TN2A 5LMNJ 2J9EA 3GIRA 4N41A 1IKWA 2BKNA 4KKOB 2DISA 3DYAB 3GP9A 4X4VA 1FNOA 1HIYA 3DRSB 3C46A 4I2QA 3C14A 1T3NA 1U8SA 4LF6J 3P6YC 2UVVA 3LOUA 2HQCA 5HAOA 2KXFA 2HLTA 5IQQA 3CGIA 2IJFA 5DZ6A 4Q0BB 3K2YA 1YTYA 3D0GE 3JAMY 2YTCA 4CLLA 4C0BA 3D2WA 3JYTB 5KTQA 3M1VA 4BLGA 2LXFA 3ITHB 3AXKA 1C1CB 4U7UD 4RU9A 4O0IA 3BSAA 3QT5A 1V5VA 3QLHA 1F0XA 4JV1A 4ID8A 2HHTA 4ED6A 2YWEA 5KFCA 5E33A 2QN6B 5KG7A 3QJJA 2CQ2A 3ILJA 4DG1A 3MEDA 3CTRA 2R7VA 3NRBA 2EFPA 1NHUA 5KFIA 1RTIA 2AJ0A 1A9NB 4DN9A 3FZ2A 4IQMA 1LXJA 3R7NB 4JI0F 2MLXA 3NBPB 3AD9C 3EZUA 3PZPA 1QSSA 4PCQA 2BRLA 4C8YA 3KUGA 1NXIA 5ETSA 1CBKA 3HJFA 1NHVA 5H9EK 1KLMA 2UUAF 4DSKA 5D15A 3CCES 2J9DE 3R9LA 4KE5A 5D4OA 4ECVA 1LOUA 3DN9A 5H1SV 2F4VJ 2DB1A 3CPWR 4B3MJ 4UZBA 4K2JA 4WP9A 2AGOA 2CPEA 1H2UX 4XDCA 2BJ9A 4DQQA 3RUBL 1HHQA 5D0GA 1M5KC 3O44A 2DRDA 1QAIA 3W65A 1Q5YA 2RQCA 3JSBA 1R8AA 3BR8A 3P45B 2KB2A 3UE2A 1ZM9A 2CVIA 1S7HA 3CJ8A 5F8LA 2OHDA 1S9GB 3MR3A 1UA1A 1U0HB 4Z7YA 2GGPB 2UU9J 1HHSA 4DBQA 5GAHU 3A12A 4GMKA 3CXCR 3TAPA 3FGVA 1KFSA 4EO6A 4FPRA 5HQ8A 3TA1A 4LFBF 1LW2B 1APSA 4DL3A 1SJ3P 4XDDA 1M5PC 2G0IA 2RU9A 2QSFA 5HVFA 4WF9Q 1JLQA 1XQIA 4FPIA 4DMZA 1VC0A 2VFRA 4X64F 4IG0B 3UD5A 1T8EA 3OUYB 2OPQB 2Z30B 3FSXA 4F04B 5DM6Q 3UDVA 4A47A 2XI3A 2JZ5A 3GCXP 4I6AA 2IM2A 1IWAA 4ZP7A 1F6TA 4ZCIA 2LYVA 3LANA 2B0GA 2V8GA 4ED3A 2IVFB 1RB0A 4G1QB 1RABB 1NZ8A 2FYXA 2J7WA 1YBUA 2QFIA 3GPAA 3QAEA 3GIMA 2XMJA 3DDKA 4LBHA 4XO0A 4PYAA 2D3UA 3IN5A 1EKSA 4F4KA 1KTVA 1UVLA 1S0NA 1S6UA 4J91A 1JIHA 3FQLA 2AT1B 3CC7S 1RAAB 1HNIA 2V50A 1R0AB 1L3SA 3UR3C 3IM9A 2DY1A 4OX9J 1WEZA 5KT6A 3DOLB 1JJ2R 4K4WA 3KG4A 4B3TJ 5DS7A 4C0OC 1IKWB 2DGSA 5IC6B 1WDTA 2BKPA 3OXGA 1YJWS 2DR5A 3MMAA 1YGYA 2KM8C 5HVGA 4RW9B 1GXTA 3AQOA 2ADBA 5E7OB 3R5BA 2DD8S 3QJPA 2ATCB 2H5IB 3JTPA 1IBLF 4NCAA 4DV4J 3LH2S 2L08A 2UXCJ 4WK1A 4DR3J 4OZJA 2O3DA 4RLEA 4OYWA 4DL6A 2VBWA 3IC1A 4YR3A 3M1VB 1AUSL 4URSA 4O4GB 1UETA 3SMZA 4EYIB 2X1GA 2W01A 1TUVA 3BBBA 2OPPB 1F9EB 2Z2YB 2DXDA 1SQEA 4LF5F 2PMZD 2GZOA 5THWA 3CC4S 2D9OA 1D8ZA 1A0OB 5H9FK 4DG1B 2NZ4A 3MEDB 1LWEB 1YJ7A 4P2SA 1RTIB 2CNKB 1SCJB 5E41A 1S10A 1IKYA 3B4DA 1XMOJ 3IP0A 3ILLA 1FVSA 2BW2A 3DRRA 3QAUA 5LXRA 5D78A 2P9CA 2HEKA 4DL7A 1HNZF 1HI8A 2JDJA 4USMA 1S1UB 3PW5A 4JUZA 3OLAA 1T9VA 2F9DA 1V9OA 4OHXA 2VICA 2XY5A 1RBOB 2AF6A 1VQKS 1EZZB 4JI0J 2YWKA 1AYEA 2BV3A 4I1TA 5G4DA 3SCIE 2XMWA 2PN6A 1MMDA 1SUQA 2UUAJ 4LF1A 4KC5A 1S99A 1FEHA 3UDCA 2YBVA 2OELA 2AMCB 1RWPB 4Q5VA 3NXZA 2GJFA 2VL1A 3ET6A 4K8RA 3TEHB 4O3QA 5L8RC 1VRUA 2CQHA 1RTJA 2FVPA 5F8GA 3DRPB 5IFMA 3KG1A 4Y2MA 5HQMA 4NA1A 5KFUA 2YY3A 2WBRA 5CYMA 1SV5A 1T94A 2NUUG 1S7IA 1X9MA 5FDLB 5D77A 3ZZUA 4NXMF 2FVSA 5A2QU 1HNXF 5T14A 4B9LA 1JLQB 3X3UA 5B0FA 4YFUA 2C2ZB 3G6XA 3HO1A 3CCMS 2BJ3A 3GONA 2VB6A 3MMCB 1N5QA 4LRBA 1X9WA 3JTNA 1MMNA 5GAHI 1PIEA 4E98A 1VOMA 2CDRB 2XWXA 4PWDB 3DOMA 2CWXA 3GFXA 5AXLA 2KXHA 4QYZK 4AL7A 4LFBJ 3FRZA 1X8DA 3B4MA 2WB1D 2FLNA 3QT7A 1SPBP 1E6YA 4EMDA 2XGQA 1IXKA 2QLXA 4X64J 2AZ1A 2DH9A 2IM1A 1DZ5A 3G6VA 2V6AA 2L9DA 4FVCA 5KFMA 4B3SF 3OHAA 2FZGB 1NAQA 1YITS 1T11A 2D3OR 2DNMA 2WSCC 4GC6A 1SIWB 3DXBA 5HMXA 2RILA 1HNIB 2MJNA 4WFBQ 1KVIA 2HVDA 2MQMA 4A8QA 3MZIA 5L1IA 2GW8A 3IBCB 1SJQA 4NX9A 2BA9A 2HHVA 3QBCA 4JV2A 3R1HA 4AQYF 1OMSA 1RA6A 3VTIA 3MMAB 4WE1A 4WKRA 3MPYA 5A6PA 5HBMA 1P6TA 2K1RA 2UVRA 4ED1A 3KLEA 3TJ8A 1XR5A 4DX7A 1YZ6A 4WU2A 1IQTA 2ZBRA 4MYTA 3D54A 2E7WA 4NCBA 4LT6A 2LA6A 3ZTSA 5ADZA 3PKMA 1TKXB 3H5YA 3PRDA 3I32A 2B51A 2AYGA 2IHR1 3AAWB 3IBFB 1I6JA 1SC1B 3G87A 4D3GA 2LQ9A 3B78A 1U8WA 4Y2CA 3MR2A 1IBLJ 2R8IA 4ES2A 3BO2A 1U49A 3THTA 2EFOA 3R2DJ 2NREA 4NL5A 1N5YB 2AYEA 5JXSA 1BQNA 4DJBA 2GJIA 1ELOA 4KH0B 1NDPA 4JI1F 3U02A 1S9EA 3DRRB 1NSKL 3A3OB 3CCSS 4A8XA 1S76D 4LF5J 2Y1IA 3K8VA 3SQGA 1V6HA 4HTIA 3LAMA 3QGGA 3R3TA 4DCJB 1OO0B 1Y5LB 2CPFA 2JOQA 2YNFB 1F1BB 3QJLA 4RJVA 3PFOA 2GAGC 2DNNA 4MFBA 4N8NA 3QRQA 1HNZJ 3LA0A 2N3LA 4KHMA 4ANDA 1SUQB 3CWJA 3RAMA 2RQMA 3UW1A 4Q2MA 4U7CA 1U6FA 1TVRA 3ET6B 2EFVA 2NPFA 3MPDA 3SDEA 1B0PA 4DZ6A 3KG0A 4ZCKA 4OFZA 5DG7A 1RTJB 4M5NA 3TA2A 3MM5A 4EZ6A 2FHJD 1WEXA 3HDSA 5CYMB 1FJCA 2V69A 2WK4A 4LVOP 2IVMA 3EM1A 2JFDA 1M5SA 2DXFA 3D7SB 5DM7Q 3WHIA 1TKTA 1RLDA 1P9YA 1LFWA 4TXSA 1U2RA 4N56A 4KAIA 3GIIA 1YVFA 1QE1A 3NGSA 1UWBA 2CJ9A 4I6WA 1RWXB 4I2PA 4P2FA 1KD1T 2FVQA 4NASA 4RO0A 4UZCA 6FDRA 2XCAA 1WSRA 3SCKE 3N0VA 4Z37A 3AHPA 2AEMA 4YR0A 3WIVA 4XPEA 2R2RA 4ZPAA 3DI6A 5HVHA 1NPPA 3BPSP 1NDKA 2HBQB 2FUG9 5GMKa 2E1RA 1S97A 1GEHA 4YN3B 3N4WA 2RS8A 4NXMJ 1HNXJ 1TK8A 1JLGB 2QLJB 3ELHA 7FDRA 1PAUB 3EICA 5SUHA 4LMZA 3RZAA 1WC1A 1E6YB 5L1JA 2KG0A 4PXBA 3QNWB 3MWBA 1TL5A 3ETMA 3PY8A 5KG5A 2DT9A 5KFOA 4KY3A 2W25A 5AE1A 3L95X 3J81Y 1RBAA 4FKYA 2J0SD 2E9TA 2CZ4A 4OHVA 1REGX 3GR1A 5E0OA 3H4BA 1FO1A 4CLTA 1B70B 4L6V3 3PDNA 4F0HA 2H4YB 4FZVA 2E1PA 2ILYA 5KFKA 3VGTA 1NMEB 4MKYA 1HD0A 3RJMB 3TANA 2BM0A 3E3XA 3QATA 4WE1B 1HYSB 3T5JA 2CWKA 5IS2A 5HBMB 4J9SA 3GV7B 2K1RB 2CUYA 3FJ2A 3KLEB 2R7UA 2FHJA 2EFNA 3J7A1 1YJ9S 2WVCA 2YQ0A 2B9WA 1VQYA 4X4RA 3EVWA 3R2CJ 1RLCL 4USKA 3M2VB 5F8HA 2KXNB 4USUA 1F2GA 4M5HA 1MLAA 4ED2A 4G65A 2GA7A 5HROB 3QSYB 3TJAA 4AQYJ 2MJUA 2QEXS 3D5MA 1EQMA 5BXIA 3HFVA 4F4YA 3OFHA 2DPIA 4ZKAA 3LGNA 1HBOA 3D1QA 3O2IA 4JB8B 4F3MA 3NEKA 2U2FA 3IRWP 1YQHA 1JMTA 2ZHAA 4FKXA 1QAJA 3HF5A 5F8MA 5ITHA 2Y9HA 1UW9A 3E51A 1BQNB 1R7IA 2HNYB 3ETOA 4QIEA 2J7KA 1S9EB 2AW0A 3KMQA 2IY5B 2FJEB 2NSBA 1S79A 3DLJA 4IYQA 2B4VA 3BGUA 1SL2A 2H9ZA 3SQGB 3MECA 2DHAA 3GJQB 3NOGA 4O23A 4V19J 4M5IA 3VAJA 2MLYA 3EXYA 4X66J 4KR0B 1TZ0A 2DYAA 4ED5A 4WFZA 4DWIA 1N0VC 5B7WA 2LEAA 2HVEA 2XS7A 4ZVGA 3BJYA 1NPKA 5F3TA 3Q8VA 4DR5F 2E5JA 1IR0A 2UVUA 4JI1J 4MFBB 3Q8PB 2DR8A 1GMWD 1U25A 4F3OA 2ZZMA 1HLWA 3WBZA 2NXUA 1TVRB 1FFGB 1VQ7S 4DV6F 2OEJA 3SDEB 2CJYB 5G0RB 4X4NA 4ZA1A 3VGVA 3FKBA 1FRIA 2VU5A 3MM5B 4O44B 1LWFA 2QA2A 3ENAA 2P6SA 3NGKA 1HNWF 1VYAA 4C48A 4NWBA 3GCWP 3CCJS 4DL0C 1TKTB 1HKAA 1U2CA 2OMLA 3GMGA 1MN9A 4CDIA 4AXIA 1QE1B 1YZ7A 5T41A 3RRKA 3NNCA 2GIQA 4QR1A 2ACYA 3HKWA 4PXCA 4DZDA 4I2PB 3AJDA 1BGXT 3W3SA 1VISA 2Y0BB 3GG0A 3G96A 3PV8A 3CCZA 1IR2A 4UY85 4MK9A 4I67A 2V8DA 3MTJA 5LSLA 4ELTA 3TUJC 3L3CA 1Q4RA 3T3FA 3H8YA 2W7AA 4XK8C 4IOBA 2JL9A 1PBUA 5KT2A 3I0RA 3HFZB 5GMDA 1CC8A 2F8HA 2E5IA 2GVDA 2HHSA 5GAEU 3D28A 3TOQA 4HYKA 3PX0A 1K1QA 4IR1A 2MPUA 2YKMA 1HQEA 4ZVOB 1VC5A 2FJBB 4RNMA 4FF3A 1LQ9A 3JSYA 4OZ3A 2HK2A 4JI3F 1FNXH 2FVRA 1PGZA 5A8RA 1X4EA 2GIRA 3Q8RB 2L41A 2HRTA 2VG6A 2HHPA 5CZVA 1JLCA 5C42B 1VGYA 1WI8A 3NCQA 1V3SA 3DLGA 4F4AA 3AXMA 1RJJA 4NLRA 3BN4A 2Q1LA 4ZLJA 1TU0B 2C2NA 1NSQA 3TZYA 1U2FA 2O1PA 5CHCB 2E7VA 3U27A 2CYYA 3MEEA 1DY3A 3A8EA 1N5SA 4BC9A 2BRKA 1O6XA 3H2UB 2KL8A 3BKFA 2DGUA 3M9OB 4OZ2A 2BDPA 5K8OA 2UXBF 3JQMA 5DETA 4UY8T 2GVZA 3BGFA 1WTFA 2NYHA 2XULA 4ZJQA 3VAHA 2HFVA 3AY0A 1S6QA 4FN5A 1RWUA 4CNYA 1SH3A 5U47A 4CYUA 4OI3A 1AFJA 3OTDA 2XEXA 4RU2A 1FRLA 3LPEA 3HKZD 1RGVA 4NA2A 2Y1LB 3MECB 2MZSA 4FXDA 2XHWA 3KUHA 2ZUAA 2NCKL 1VQNS 2CJAA 3CEDA 1T03A 2V8HA 5EWGA 2AP6A 5HP1A 3C19A 4P52A 3ISNC 1S77D 4ZJLA 3ZO7A 5EX0A 1IQZA 4RPFA 2YNHA 3M4XA 2CQBA 2N7YA 2ZDPA 1TFYA 4LIWA 3H42A 1UVMA 4RW7A 3VCDA 5DQGA 2VFVA 3M8YA 2XS5A 2CQDA 3EVOA 2J76E 3F41A 5KFEA 1QSLA 4OI0A 1JXVA 5KFPA 1QJHA 4DR5J 1LWFB 3MMBA 4CO3A 1FDAA 3QRPA 2Z57B 3TVYA 1DJ0A 4DL2A 2KH9A 4DF8A 3QPIA 3S01A 2ZH8A 3MPVA 2R8JA 2GQCA 2R7OA 3N5BA 2QSWA 2M7SA 4DV6J 1N88A 4ANEA 2DBBA 1URRA 4LSNB 2FJXA 1ZM4A 2W4DA 2J9CA 3IRXB 1HNWJ 4UUWA 3SBMA 4OV1A 1VQSA 4Y2AA 3ZTPA 4UF4A 1Q8LA 1RHUB 4MKAA 1VMBA 3DCAA 3V81A 3SSRA 1YG0A 4NOHA 3OTOF 2DITA 2HZCA 1C4AA 3TX8A 5KFQA 5HO4A 1FFSB 4K4TA 3FEYB 1DRZA 5KT5A 3D6TB 1RT1A 2W9BA 2C2DA 3T1AA 4DQIA 4F25A 1VQ5S 3A1YG 4OYIA 4NLUA 4UW2A 4OJGA 2R4FA 2CDQA 1HQEB 2G0JA 1SC3B 2QL9B 4K4XA 4HHHA 1VQ8S 2QX0A 1LW0B 2PFDA 3HSJA 4DV7F 2FC8A 2DNHA 5J2NA 5A8RB 4L3KA 2L48A 2F5GA 4ZN1A 2O67A 4BCAA 1BC6A 1S1TA 3BV8A 3TUPA 1NU4A 3GLJA 3MDFA 1JLCB 4A8YA 4YY3F 5GAEI 2GFFA 4Y0FA 4JI4F 3FUYA 3K17A 3DLGB 2YH1A 2ASDA 4ZP9A 2M5YA 4RNNA 1EX8A 4F67A 1T95A 1YRTA 3KHLA 5DQIA 2GHVC 1S72S 4JI3J 4DR2F 3CE8A 1SJ1A 2ZE2A 1YX2A 2HGMA 3C6UA 2KFNA 3T6JA 1P1LA 3MEEB 3OTBA 3H20A 1SKUB 1PSDA 4IOAQ 3FBFA 1RT4A 4LR9A 2MKKA 4QZVB 3K5MA 4DV0F 2MQNA 4XPCA 2H3EB 3OD2A 2Z4PA 4KO0A 2VIHA 2WW8A 3PCOB 3KLHA 2B9XA 4C3MA 3R1LA 1RCOB 1S4FA 1BXNA 3A3NB 4CLFA 4RBTA 4B9NA 2DRAA 4K7QA 5KG1A 3K5PA 2KYXA 2CPIA 3D1HA 1O51A 3K5LA 1RBLA 1R43A 3MEKA 2BXJA 1DURA 2ZDOA 2Q6BA 1RT6A 1IWGA 2CPXA 3M7VA 3VAKA 1WF2A 2UXBJ 2MSSA 3FDSA 2NXJA 3CVKA 3AFGA 4L73A 1T03B 2VPZB 3PJWA 3D9BA 1WACA 1ZZNA 4OX6A 3G86A 4OHZA 4MKBA 1DTQA 3GWCA 5IZHA 4KHRA 4ZVQB 3GV8B 3NGDA 3S7RA 2LU1A 5C5JA 2W2OP 2NYIA 1UVKA 3DGPA 3C8YA 2YKNA 1LWCA 4CH0S 1NK4A 3TAMA 1KDNA 1RT5A 2HFUA 3KDOA 4I0WA 2J6UA 2VDIA 5EWFA 2PMHA 3DMJA 5C2GA 3M32A 3MMBB 4ECUA 1XJWB 2V2VA 2DR6A 1WSVA 3AA9A 3OL8A 2XZTB 3QZ8A 2YKOA 3I96A 3KKFA 4MT1A 1EB0A 3KFWX 4NLYA 3EZ5A 1K8AT 1D8YA 4M8LA 1S49A 3G4SS 2LMIA 4M5MA 2O66A 1Q53A 3TP2A 1M0SA 3RU0A 2C22A 3GB0A 2RH3A 5CA5A 1UP1A 4NYPA 2MEWA 1QM9A 1N54B 3HI9A 3NGUA 3C16A 3SCJE 2KVQE 2YH0A 1M1KT 3V81B 2RQ4A 3M8PA 1ZBTA 4IRDA 2M8DB 1RISA 4PPZA 5CABA 2ILZA 4USIA 3MF5A 5D6GA 3H59A 4NLVA 1RT1B 2W9BB 2ZH6A 1W25A 4PKDB 4LSLA 1HWUA 2J0XA 3MPWA 3D1OA 3T41A 2GCFA 3VGSA 4FXVA 5A2QY 2P8IA 3HSGA 1J5EF 3I0SA 2CKWA 2AJ1A 3ZTRA 4WFYA 5J2QA 3BN7A 4ECRA 3BPDA 5D4LA 2AYMA 3E2EA 4CTAA 4PG8A 5L9XA 4DUTA 1VQ6S 3OTOJ 5J2NB 2JSXA 3OTEA 5KFFA 2CVEA 3BYPA 3UNYA 4MMOA 2FLPA 1S1TB 2HWIA 2B8QA 2ZWPA 3UI3A 3AH6A 4C9DA 2IYIA 4B17A 1Y5NB 2OPSA 2ZOGA 3CW2C 1D0EA 1FJGF 3TARA 4CO2A 2ZH7A 5HLFB 2V67A 3RTVA 3MM8B 4DV7J 1LNQA 2I2YA 4L72B 1Q5VA 3S1TA 2CADA 1YJUA 2MQ8A 3CJQA 1RT3B 3T9ZA 2EK6A 4OIXA 2G4BA 5F3ZA 2HPUA 5F41A 3Q8SB 1HQ2A 1N8RT 1RT4B 2VQFF 4YY3J 1RT2A 4JI4J 3VVUA 1WNEA 5J2PB 4AT1B 4KO0B 1ROFA 4DF4A 3CDWA 1R0CB 2DGXA 1ZPWX 1CJTA 4O3PA 2B43A 3B82A 1ZAVA 3IO1A 4DR2J 2LECA 1M5HA 1SJRA 4IDKA 3FQKA 5HJXA 2F4FA 3AD7C 1TL1B 3NOCA 2KRRA 3BQ0A 1RT6B 2FGOA 1KN6A 4DV0J 1ICEB 4ZPTR 2ZH5A 8RUCA 1WKKA 2FHMA 5KFRA 4ZOSA 2LDYA 4KQZA 1ULRA 4NLDA 4PPDA 3PW0A 3IWNC 1HPZA 4HI2A 1DTQB 1VLYA 3CD7A 3HHLC 3AOAA 1KVKA 2QMWA 3OPKA 1TK5A 4KJIA 2IA6A 1FX2A 4W4MA 1ZH5A 1CQMA 2MYFA 3ENVA 4WZMA 3KLFA 3L7PA 5F8IA 3DGPB 2YKNB 4RUBA 1LWCB 4GVLA 5LOQA 5RUBA 2W9AA 3TAMB 2C3YA 2XS2A 2V4JA 4C8MA 4DUYF 1RT5B 4CLPA 3AOCA 1NJWA 2IDEA 1F3VA 2ZKTA 5JMNA 4ETZA 2RF2A 4ZVHA 2CQPA 3R6GB 5AJ3F 2AIRB 3GFHA 1S0OA 2XI2A 7FD1A 2QMXA 1ZTTA 1WC6A 3MEGB 4WFXA 4NA3A 4WTYA 2C2EA 4NI2A 4HH1A 2FC9A 2DH8A 5KAKA 1NKCA 3CD6S 2XC9A 1AXQA 2D9PA 4WIIA 2FVCA 3B8HA 2FD2A 2A18A 1SXLA 3C16B 2DPJA 3LP1B 4MIWA 2L3MA 3QQCD 1XN9A 5KG4A 2PC6A 2A0FB 2A2DA 2ZNYA 2RS2A 2MY7A 1XBWA 1X0FA 2AKWB 2BM1A 4MIBA 2KZZA 4OYOA 2DNOA 2V2QA 2E5LJ 4X2BA 1PYTA 3V6KA 4E8UA 1CEZA 1WELA 1N0UA 3G82B 3RRHA 3IMQJ 4XAKA 1TQLA 1UTAA 5CYJA 5DQHA 1EQ0A 1U02A 4OLOA 1MWYA 1SKWA 1DFDA 2XZWA 2IDLA 3I0SB 1L3TA 5IQ6A 5JUMA 3SFGA 1N52B 3VVTA 2ZHBA 4CTAB 1J5OA 3TQEA 3KK1A 4ATNA 4BHQA 1WORA 4XTTA 4CLYA 5I4MA 4K4ZA 2ALYB 4F02A 1R6YA 2VQEF 2DR7A 3VHQA 1NK7A 4YOEA 4D3HA 5F8JA 4YUDA 2EI5A 2OPSB 3QWUA 3OSPA 4TU8A 2R2UA 1J5EJ 1FDDA 5DDRC 2UUBF 3ILIA 1T9WA 3BKTA 3ZZRA 4ZMMA 2MZJA 2JX2A 3KOAA 1KKHA 3R7BB 1REVA 1SC6A 1F5BA 5DDQC 4PWUA 3KNGA 1AW0A 1RT2B 1TKZB 1FRXA 2AX0A 3ILOA 4HR2A 2OMOA 3CJTA 4WYLA 3BREA 4BBYA 1FJGJ 4IKAA 2V94A 2MZQA 1VQ4S 2KKHA 4H4MA 3W60A 2JC1A 1XWLA 1P8GA 2K8GA 2QV6A 5LMNF 1YRUA 3IXQA 1AZSA 4KPYA 4IDKB 2Y1RI 5EDWA 2HBYB 1NB2A 1WHWA 2R2TA 4LF9F 1HBUA 2Q79A 5HJYA 1TUGB 4RW6B 2BE9B 1OY6A 1NK9A 2VQFJ 3Q8QB 4J9LA 3ENWA 1KFDA 4LF6F 2L9WA 4IH7A 3MD3A 4OYXA 2B9EA 4E0DA 4UQGA 5KFLA 4PXDA 3OR1B 1RWNB 4TQSA 5KT4A 1VK3A 1HPZB 3LP0B 4USTA 4JOUA 3ADAC 3HXMA 1FXDA 3K57A 2V9WA 1BWEA 1HBNA 4CCHA 5KG2A 1XR7A 3KHGA 3RBZA 3VQTA 2QIFA 2V4JB 5IC4B 3LTOA 5K5MA 4XIUA 4G6VB 5I42A 2PFFB 1PAEX 2HKEA 2HW3A 4DCPB 1NJIT 2NR0A 2IJRA 3W2WA 4JI6F 3OXFA 2HS3A 2HFZA 2LVWA 4O3RA 1VIXA 5ETOA 1YSJA 3PNIA 1RTZA 4DUYJ 1FKOA 1X4HA 4ZN3A 4TQRA 2GC8A 4KH1B 1CULB 2R9LA 2MQQA 1R3NA 2JNJA 5LM7E 5AJ3J 1TL7B 1HWKA 3O5TB 1SB6A 3PKYA 1A6LA 1UEUA 4ECTA
chains in the Genus database with same CATH topology
3AHPA 4YR0A 2HFOA 4NCGA 2ZH1A 5LXYA 3C66A 2RSQA 2ZFHA 1CG2A 1RKIA 2XSJA 3NP5A 1X4GA 4XPEA 2R2RA 4ZPAA 3DI6A 5M2PA 2GQQA 2KTQA 2VG5B 2I0XA 3WC0A 1DAXA 1HWJA 2FUG9 2HWHA 5GMKa 4W90B 4LQ9A 2E1RA 5E3QA 3PX4A 1S97A 2Z2MA 2HS0A 2IAJB 3PIOQ 4YB1P 4EBCA 3N4WA 2LKZA 5J2MB 1TKXA 2RS8A 4O3OA 1QUPA 1TKZA 1TK8A 3RB0A 4B9TA 1JLGB 2Q66A 3ZC4A 1R8BA 2EG2A 7FDRA 3MURP 5SUHA 4LMZA 3HHDA 3RZAA 1E6YB 5L1JA 1CPZA 2X1BA 2KG0A 3K59A 4PXBA 2DGVA 3HVAA 3H25A 3MWBA 5DLFA 2RUGA 4J9PA 1TL5A 3I31A 4IO9Q 3PHEA 1Y4ZB 4Y28C 3TUZC 1U48A 4PR6A 4TYAA 3PY8A 5KG5A 4X84A 5KFZA 5KFAA 2DT9A 5A6WA 5KFOA 1J5OB 1OS5A 2W25A 3I82A 5AE1A 1JWWA 3L95X 3J81Y 1VIOA 1L3KA 2MKIA 4NMLA 4I68A 3KHHA 3IR6B 1HBMA 2OJ3A 1Z2LA 1L3UA 2J0SD 2GMLA 4URGA 2E9TA 2CZ4A 4OHVA 5E3PA 2KU7A 3GR1A 5E0OA 3K58A 1RI7A 4RW6A 3I56S 3H4BA 3PACA 3EPIA 2B56A 1FO1A 4MH8A 3NG8A 1N5YA 4ED7A 1KR4A 1E6VA 3SSSA 2AJ4A 3CDAA 4L6V3 3PDNA 3T6BA 3V4MA 1AFIA 3N79A 4OZ0A 4FZVA 3HZGA 1NJZA 2ILYA 1Y3JA 5KFKA 4A8MP 2DGTA 4MKYA 1IBMF 4ZDNA 1HD0A 1C0UA 3TANA 4OI2A 4TYBA 4NXNF 3AB4B 3DLEB 3RAQA 2BM0A 4ZCLA 3THVA 2E44A 2MHEA 1U7LA 5LJ3Y 3OR1A 3E3XA 3M2UA 4WE1B 3BZQA 1HYSB 3IG1A 1U1OA 3T5JA 5A8WB 5IS2A 2XNQA 5HBMB 5DJBA 4J9SA 2HQIA 2PDAA 3GV7B 2K1RB 3FJ2A 3LP0A 3KLEB 3C2PA 1TFWA 2R7UA 1Q1KA 3V2UC 2F9JA 1S1WA 2HNZA 1SBRA 2P9GA 2FHJA 2BBEA 2RRBA 3BGRB 4OI4A 2EFNA 3J7A1 1YJ9S 3MUMP 1BQXA 1ZZFA 5KG0A 2B9WA 1VQYA 1FD8A 5HN0A 4X4RA 3TI0A 4X4TA 2OAUA 2ROGA 2YNFA 4FBTA 3BDEA 1REVB 3FSIA 5KFXA 2HAIA 2B3TB 3R5AA 1EP4A 2RU3A 4IOCQ 4JI8F 3P96A 2JVOA 3M2VB 4R8UB 5F8HA 2KXNB 5H9FJ 1GTEA 1FJEB 1G7CB 1OWXA 4H4OA 2W4PA 2M70A 2OLWA 4P7VA 3THPA 1QVFR 4Y65A 4ILRA 2RRNA 3PEHA 1GXLA 4KHPF 1F2GA 4ZHRB 2XO7A 5KFVA 5GADU 2J6SA 3GG1A 4ED2A 3FNNA 1FT8A 2GA7A 5HROB 2AQ4A 1IJEB 2MJUA 2GO8A 4F3QA 3E8OA 1KRPA 1N6QA 4UOCA 2QFJA 5IT0A 1D1UA 5K14B 3UWTA 2MB0B 4NLSA 1G6BA 1NZAA 1S1XB 4I56A 1Q16B 2QEXS 5FLXY 2H5EA 2IRYA 3D5MA 3DFEA 3I0RB 4RW4B 4H4MB 4OJHA 2XLIA 3T5HA 4PQUA 2E9RX 4F4YA 3R5DA 3OFHA 4H4KA 2DPIA 5IT4A 4NZ0A 4ZKAA 3LGNA 1HBOA 3D1QA 3O2IA 4F3MA 1HNVA 4K2XA 1B7FA 4NLOA 2U2FA 1S9FA 2MSTA 4KSEB 3M8QA 5LL6d 2OTJS 2CQ0A 3IRWP 1YQHA 1U1MA 5LSOA 1QTMA 1JMTA 2HHQA 4I7FB 2ZHAA 3OL7A 1N56A 1FKPA 1QAJA 5C24A 1HBUB 2YKMB 1HA1A 5DLGA 3OFFA 1X5OA 1MROB 2JLFA 3HF5A 5F8MA 2V4RA 5ITHA 3FMWA 4TY8A 4CI0B 4NPOA 1FERA 4FS1A 3CDEA 3E51A 1VS3A 1TKDA 1BQNB 1R7IA 2HNYB 2O5DA 4RUHA 2OSRA 5B0AA 3ETOA 2AJFE 4QIEA 2J7KA 1S9EB 2KT5A 3ISZA 4RWXA 2AW0A 2CPYA 2EBGA 3VR1A 2LDIA 3KMQA 2FJEB 1FRHA 2NSBA 4ZP8A 1H7WA 1WG4A 3PEJA 2HS4A 2E7XA 3TR5A 1S79A 1V3ZA 2X3GA 2QO3A 3DLJA 1HW8A 4M63A 4X4QA 4IYQA 2B4VA 2MQLA 4EFAC 3BGUA 2EG1A 1YJRA 1SL2A 1Q78A 2H9ZA 3IBWA 1EETB 3SQGB 3H98A 3MECA 2VG6B 3FRYA 3RRGA 5I3PA 2RDIA 4NLXA 2DHAA 3TUIC 4Y2IA 1X4AA 2ZD1B 3HVTA 4O23A 2UP1A 4V19J 1F60B 2QLWA 3VAJA 2W9CA 3EXYA 1RT7B 1QLNA 1LFPA 4Q8EA 1JLEA 4DR4F 2LU2A 5GAGU 1LK7A 2M52A 2CQ3A 1TZ0A 4IFYB 4KR0B 2XMMA 4WFZA 1O5JA 3CMAS 4GC7A 4B9VA 4ED5A 4DWIA 1X9SA 1N0VC 1Q8BA 5B7WA 4R5PA 2LEAA 2XS7A 3ZFVA 1H7XA 4ZVGA 5KFNA 3BJYA 3HM9A 2NQPA 5F3TA 3BDPA 5M2RA 4HT5A 1XERA 4EO8A 3N01A 4WFAQ 4DR5F 4JYAF 4ELVA 2CQCA 4QWBA 1RK8A 2E5JA 4KIAA 2LEBA 2PO4A 3OJUA 2VOPA 1IR0A 2UVUA 4MFBB 2IAJA 2ZC3A 3Q8PB 3BSCA 2O01C 5LSRA 1YJNS 2DR8A 1UFWA 1K73T 2K3IA 1VBXA 2QZ8A 5KFJA 2DNLA 3G8QA 3W2VA 4GO5X 4PG5A 1CC7A 1Q79A 1U25A 3UDLA 1JLGA 2OD6A 3PW2A 1WHVA 4F3OA 2VASA 4K4YA 3IR7B 2ZZMA 3GIKA 5EWEA 3IWLA 2RDJA 5KG6A 1NJXA 1DTTA 3MCSA 3PR4A 2DHXA 3WBZA 3G71S 2NXUA 1TVRB 4CO5A 2HFNA 3V6HA 1XMOF 1UFLA 5I42B 4PUOB 4AL5A 4CIOA 1RQ0A 1VQ7S 2PE8A 2HG4A 4M94A 4DV6F 2N4CA 3SDEB 5D3GB 4B9SA 1F5CA 4ZPBA 5G0RB 2XMUA 4X4NA 3W2WB 3HHKA 4ZA1A 2HVIA 2I5JB 1KQKA 3SZ2A 2C2RA 3DOKA 4M5DA 1FRIA 4R25A 2KFZA 3MM5B 4O44B 4DV5F 2ASJA 4TNOA 2F1FA 2ZJRQ 3BQ2A 4C8KA 1LWFA 3R5CA 1TAUA 2QA2A 1GQEA 2P6SA 3QIPA 4WYWA 3NGKA 4RNFA 1S6QB 3VAFA 1ZAWA 2CPHA 1CLFA 1BD6A 2B4UA 1H38A 1HNWF 4OX7A 4ILMA 4NWBA 5F9NA 3U1NA 3HX9A 4KT0C 1DQAA 2W7PA 3CCJS 1Q8IA 4DL0C 4HVZA 3FEXB 1TKTB 4ECWA 3GR0A 1FDNA 5D4NA 4Q2LA 2C3MA 3H5UA 4QWDA 3HP6A 2HLUA 2YNGA 3F44A 4KRWA 2R7WA 2OMLA 2M9KA 3GMGA 3LALA 4QIVA 2HWTA 1FKOB 1UJ6A 2P5VA 2YX7A 4OX8A 3W7BA 3PW4A 2PIIA 2ROEA 4AXIA 1QE1B 3MM6A 3SV4A 2QRRA 4PRFA 4QYZJ 5T41A 3RRKA 1RYSA 3FZBA 3DHWC 3NNCA 3MAHA 3CB4A 2GIQA 5A0YA 2V8VA 4QR1A 2FTRA 3M9NB 2ACYA 4QYRA 3HKWA 1JX4A 4DS5A 1HYSA 4PXCA 1HMVB 4C3KA 4DR7F 1WWHA 1CQNA 4I2PB 3GILA 1PILA 2DTJA 4QR2A 2HMIB 2P9EA 3MM7B 1BGXT 2M88A 4OHYA 4DN0A 3W3SA 2VBYA 2OSQA 3WX4A 3T5LA 5EN1A 1QAYA 2Q3PA 4NCGB 4Q43A 2KT3A 1IKVA 1HWIA 5AE3A 2XSJB 3GG0A 3NAHA 1X4DA 2XBPA 3G96A 4F26A 3PV8A 2DCUB 3CCZA 3IAS9 5HP1B 3RR8A 4UY85 4MK9A 3OLBA 4N76A 2IMOA 2V0NA 2IM3A 4C8OA 2V2KA 4I67A 4B02A 3NCRA 2V8DA 3M2VA 3MTJA 2R7SA 5LSLA 4ELTA 3TUJC 2YWHA 3JSRA 3HK2A 3UNGC 1NJYA 3G6YA 2WSEC 3OR2A 5HMYA 2WB4A 3L3CA 2M3DA 1YJVA 2DHSA 4IH5A 2HHXA 4ECYA 2YNHB 1Q4RA 2PA3A 1U45A 3KLVA 2ABYA 3T3FA 3H8YA 4DV1F 5HROA 2W7AA 3KLGA 4I64A 5AXNA 1IBKF 2B5JA 4IG3A 4XK8C 1LXNA 4ECXA 3M6UA 4IOBA 1SL0A 1T7PA 3SFUA 2P6TA 3V4IA 3IWXA 4RW7B 4FVMA 3V5RA 3Q24A 1PC4A 2UVWA 2JL9A 2GQ2A 1X4BA 1SKSA 1Q82T 1HWLA 5KT2A 2RKIB 4RW4A 3I0RA 4J5OA 3H5XA 4RZRA 2CPDA 3CCTA 1K0TA 1CC8A 2F8HA 2RB7A 2XMVA 3OFGA 3ZZOA 1JXLA 2E5IA 2ZKUA 3CIMA 5IM0A 5GAEU 3D28A 2HHSA 2VOOA 1JJHA 2CFXA 3TOQA 1M90T 2ZBIA 4KBIA 3BEGB 4HYKA 3UCUP 2AWZA 3PX0A 1K1QA 1HBMB 3GZ7A 3S8SA 4IR1A 3HFKA 2MPUA 3FFIA 3RB4A 2YKMA 1HQEA 1VC5A 2FJBB 2PA8D 4RNMA 4NLWA 3CIZA 1ZPVA 3HLUA 4RNOA 2M0GB 2CQIA 2R8GA 2MZTA 3CJ3A 3SCLE 2AV5A 1E6VB 3IGVA 4QWCA 2HNYA 2WHOA 1LQ9A 2BR0A 4FF3A 3JSYA 2ZZNA 4JI3F 1H0HB 2JVRA 4K5SA 1FNXH 1XC9A 2FVRA 1PGZA 5A8RA 4X4PA 1C0UB 1X4EA 2GIRA 2E5LF 1GT8A 1NKBA 3Q8RB 2A10A 1FRMA 2L41A 4CO0A 1KSPA 2M2BA 3ZZTA 4RUAA 3M2UB 3M2RB 2VG6A 1UEVA 3IG1B 4MK8A 2VD3A 2HHPA 2I9SA 2WBMA 3VWSA 4A8KA 2YNIA 5CZVA 2FDNA 3VQSA 1U1KA 3POTA 4IH6A 1JLCA 5C42B 5K9FA 4NRUA 1VGYA 1WI8A 5CD4H 3NCQA 1XNRF 3K0JA 1S1WB 2HNZB 3DXSX 3FMBA 4A48A 4MTPA 1V3SA 3DLGA 1CVJA 4IFYA 4H4KC 3CCUS 1V3RA 3DYAA 2D3ZA 3J7YU 1UA0A 2G0CA 4ETXA 2YVSA 2CJQA 2WSFC 3KYLA 1HQUA 3DRSA 2DGQA 1EP4B 1RJJA 2PEHA 3BB5A 1FE4A 2VPYB 3H4DA 2XY6A 4NLRA 1SI9A 2DO0A 3BN4A 5GVQA 4H4OB 3M8RA 1SL1A 2Q1LA 3LQVA 2CJKA 3JSMA 3DNCA 2G1DA 2RQKA 2PD1A 4GO7X 4F50A 2B9YA 3CCQS 1U2FA 4Q0BA 3KTQA 2O1PA 5CHCB 3ONQA 4NLPA 4OZLA 2R2SA 2LA4A 1N6QB 3NAIA 1X7VA 4LVNP 1VK8A 1OSDA 2CYYA 3U27A 3I4HX 3MEEA 3DLBA 4K4UA 3A8EA 4CQ1A 1N5SA 2YKQA 3QWPA 4BC9A 2OTLS 1HHTP 4B3RF 2BRKA 3UPFA 4ILLA 3DRYA 2BABA 4ECQA 2J0WA 2Q6CA 4PQUB 2C3OA 2NPIA 4PUOA 2HVZA 3H2UB 2DGUA 3M9OB 5D3GA 5DRKA 2L9NA 1C1CA 4USJC 2BDPA 2GHPA 4ICLB 1HNVB 3K8WA 5K8OA 2E5GA 5B0DA 5G0RA 2UXBF 3KLIB 5DGAA 3TW0A 4DLGA 1QY7A 3G8SA 4UY8T 5DETA 4ZVFA 4YEAA 4HT7A 2JHEA 2QYCA 3BGFA 4GKKF 5F0UA 1WTFA 2JEGA 4O44A 2XULA 3VAHA 2K7JA 1FKPB 5C24B 1FXLA 4IO1A 5T7LA 3AY0A 1RTDB 4ED0A 2CPJA 1S6QA 1NKEA 1KQSR 4FN5A 1HW9A 4TY8B 1NO8A 1RWUA 2VFSA 2FHOB 4ID5A 1YBAA 2F4VF 4CNYA 1P1TA 5GADI 1SH3A 2JEJA 2IA0A 5U47A 4B3MF 4OI3A 2ZHOA 3OTDA 1AFJA 4U7UK