5B0EA

Polyketide cyclase oac from cannabis sativa, v59m mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIMEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
total genus 28
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b0eA00
1Q53A 4F67A 3HHLA 3KNGA 1JWWA 2AJ0A 1R6YA 2XMMA 2EW9A 2RU9A 2ZDOA 1OSDA 1Q8BA 5F0UA 1SI9A 3KG0A 1N5QA 2KKHA 2FIUA 2VH7A 2ASYA 1K0VA 1N5TA 3E8OA 1TZ0A 2OKQA 3FMBA 4Q2LA 1FVSA 2OD6A 2PD1A 1FE4A 1P8GA 1TUVA 2FB0A 2GV1A 2FTRA 3F44A 1GXTA 3HHLC 3QGPA 3UDCA 1TL5A 2BUNA 1SQEA 2PGCA 4A46A 4OJ3A 1URRA 3GZ7A 4DPOA 4ZOSA 1AW0A 4DN9A 2QYCA 3MZIA 1X0PA 4HI1A 2K2PA 2IYGA 2N4CA 2HFOA 3LGNA 4U9RA 3FGVA 3BM7A 1AFIA 2HLTA 3FRYA 1CC8A 2IYIA 2HIQA 2W4CA 2XMTA 3KG1A 2XMKA 2OAUA 2CRLA 1Y3JA 1MWZA 2Q3PA 1RJJA 1FE0A 3VTIA 4YEAA 1QUPA 2AJ1A 2XMJA 1Q4RA 2IFXA 3IWXA 4YDXA 2OFHX 3HDSA 2AP6A 4OJ1A 5K9FA 1SB6A 5A6PA 2OMOA 3BB5A 1AFJA 3HX9A 1GXUA 3T9NA 4FNHA 1X8DA 2GA7A 4HI2A 2QIFA 2LXFA 1VQSA 2BYCA 2L3MA 4A47A 4Y2MA 1XBWA 5B08A 1YJRA 2LQBA 2OP5A 5B0BA 3HF5A 3BF4A 2OFGX 1YJUA 1FEEA 1MWYA 5B09A 5IXUA 2K7JA 4Q2MA 4NL5A 3DXSX 3IWLA 5B0GA 4QOTA 1ULRA 1KQKA 3CJKB 1IUJA 2VV5A 4ZA1A 5T7LA 2ROGA 3MCSA 1Y3KA 2OD4A 4OIXA 3WDOA 3LO3A 5KAKA 1N5SA 2KT3A 5B0EA 2FHMA 1FD8A 4OJHA 1CPZA 2KT2A 3KKFA 2K7KA 4A4JA 2HLUA 3BGUA 2XMWA 5B0AA 2G9OA 1KVJA 2LDIA 3DCAA 3CJKA 2BJDA 2K1RB 1TL4A 4NPOA 4A48A 2KYZA 4FNIA 1Q8LA 1YJTA 5B0DA 1U7LA 5B0CA 4HH1A 1Y9OA 2GGPB 3TNVA 2AW0A 5T7LB 5F0WA 4Y2IA 3HHLD 1FESA 1LQ9A 2GFFA 4HL9A 2JDJA 2RMLA 2K1RA 1APSA 2N4DA 1FVQA 2ZDPA 3QMQA 1YG0A 5A6WA 2QLWA 1P6TA 1OQ3A 2HFNA 2GCFA 2N7YA 3BN7A 4OJGA 1CC7A 2XMVA 1S6UA 1S6OA 2GGPA 3HFKA 4Y2KA 1X7VA 1VQYA 2ROEA 5B0FA 2W4DA 4EFAC 1OPZA 2XMUA 1TR0A 1WD6A 3BR8A 1OQ6A 3LGMA 1KVIA 2QLXA 1JK9B 1N5VA 2RILA 1YRXA 2HQIA 2ROPA 1YJVA 2RSQA 3HHLB 4HH0A 2GO8A 3TRGA 1W2IA 3TOQA 3BDEA 2W4PA 3I9ZA 2BJEA 4DL0C 2LQ9A 1Y0HA 3K7RA 1V3ZA 2ACYA 2BBEA
chains in the Genus database with same CATH superfamily
4O0NA 3KUEA 4ICLB 3DGPB 3MPWA 2B0GA 1NB7A 2CQ0A 3CCSS 4JI2J 1PIEA 4WFNQ 4QCLA 4KV8B 1G1XA 2DXDA 5KT7A 4O3NA 2I8EA 3A12A 4GKJF 4EBDA 4U8YA 2EBEA 3OLAA 1S1WA 3E01A 3BPDA 4O23A 3KLHB 3OHAA 2XHWA 1LV5A 4JI1J 1QSYA 1TUWA 1WSVA 1WEZA 5KT3A 2OI2A 4WFXA 3D1OA 1PJ6A 4LF4F 3QATA 1AT1B 1EB0A 1CULB 4EEYA 2M70A 4ZN3A 4U95A 3GR1A 4DL2A 2QZ8A 1UTAA 1T03A 2FHMA 1N34J 5HROA 2MB0B 3HI9A 3V4IA 2LXIA 3JSBA 2D1CA 3BO4A 4HKQA 2HHWA 1S6OA 1SCJB 2EK6A 2DY9A 3O3LA 1TVRA 1A0OB 3NGUA 1RT1A 2DNQA 4DWIA 4OI0A 5D0RA 1NPKA 4W90B 3B78A 1U1MA 3M1VA 1JKHB 2LU2A 1NH8A 1TZ0A 2FLPA 1FNOA 3L7PA 2MZQA 1IQTA 5B7WA 2CQIA 3GZ7A 2N3OA 1JLFA 1NZAA 2PFDA 2N4CA 5LJ3Y 2FD2A 3J80Y 3J81Y 2XMKA 3X1LB 1UJ4A 1U02A 2ZBRA 3D67A 2KL8A 1T95A 2H5IB 3GYNA 3H5YA 4IQXA 5KTQA 2HBRB 2DGVA 2QV6A 4RW6B 3NMRA 4Y2MA 4A8YA 1NM2A 3ENVA 2Y1RI 4UT4A 3DM2A 3C19A 3BREA 2H5JB 2ROGA 4N5SA 2A6OA 3DRSB 2HHXA 3F56A 1D09B 3C6UB 3BEGB 1U1NA 3PHTA 4HH1A 1WC0A 3CF5Q 1VRUA 1IXKA 4Y2AA 1VLOA 1R43A 1U6ZA 2BM0A 3MAHA 4WF9Q 2RQCA 1NLKL 3HHLB 5HVFA 3CDBA 1UZDA 2WOMB 2VFRA 2XNRA 3OTOF 2GIRA 1HYSB 1RISA 2YNHA 3BSNA 4DQPA 3WHIA 1FHTA 5CYQA 1RACB 5KFZA 2P9GA 1SJRA 4ECSA 3KHRA 4DR5F 1CEZA 1HBUA 2DISA 4YMEA 1VIOA 4DPOA 3KYLA 4PWDB 2CPJA 5HQMA 5EWFA 4X66F 1RKIA 3PW5A 5JVHQ 3D1QA 2WONB 2GAHC 4GC6A 4LSZB 2KZZA 4F3QA 1E6VA 3PW2A 3D9BA 5EN1A 2XLKA 3T9NA 2L9WA 2IPOB 4WCEQ 2DGWA 4DR4F 1EARA 1YSJA 2VBYA 1TK0A 2AYMA 2BXJA 1T3NA 4Z2XA 1F5BA 4WP9A 1AXQA 3LQVA 3VVUA 3WX8A 3FMWA 2KU7A 4ED0A 3IR7B 2PFFB 5DDOC 3AB4B 2VDIA 4MTPA 4NA3A 4KIAA 4URGA 2ZBPA 5FJ4A 1VFJA 5IM0A 2IAJB 2MJNA 3BSCA 2F4FA 2EC0A 4NOHA 4UUWA 2CJKA 3MEDB 1X5SA 4ZVSB 5F0UA 3AOCA 1PILA 3DRXA 4NYZA 4CLWA 1RT6A 2VOOA 2J8AA 1LW2B 4MFBA 3R5BA 1VJQA 3JSYA 2AIRB 3QBCA 1SQFA 2Y0SD 2EFGA 4J9LA 3LP2B 5D8HB 2GJFA 1ZZFA 3SCIE 3NRBA 2VF3A 3MECA 1N5YB 2VODA 3M32B 2PC6A 4PG5A 1XN9A 4DMZA 3I55S 4QWDA 3HSDA 4DCPB 4JV5F 1X4BA 2KFNA 4Y2CA 3BR9A 3ZNUA 4CTAB 2I9SA 3GIMA 4K4VA 2FJDB 8AT1B 1NJXA 5A2QY 2AJ4A 2VBXA 1UWAA 1K44A 1IBKF 2EBGA 1X5PA 1LWFB 1SPBP 1HW8A 1HWLA 3DLJA 4X4TA 3GSDA 4KHRA 2J0QD 3CPWR 2M7SA 2W25A 4ZITA 3G71S 3QT8A 1S0VA 4QIGA 1K1SA 1QJHA 4O3PA 3HHLC 1SJ1A 2AGPA 2W9BB 2FHJA 3L7UA 3HM9A 4L72B 2YNFB 2MHNA 5HN0A 1RBOB 2DVIA 1P1TA 3RTVA 2AX0A 4F4ZA 2OTLS 1S6PA 2JJ4D 2XYPB 1Y3KA 1RYRA 3DOLB 1IR2A 1M5OC 4QYZJ 1TL4A 2JRSA 4DF4A 5LMNF 3SEOA 3D68A 2RHQB 3QIPA 1TQLA 3PR5B 2GCFA 3UCZP 4PQUB 3SZ2A 3IAS9 2XMUA 4AT1B 1WC5A 5GVQA 5HLFB 3AAWB 3QT6A 4LJMA 4DEZA 4TKTA 3ULHA 1RAGB 3TJ9A 5I3QA 5KFBA 4F4YA 2M2BA 4QR2A 2IRYA 3M8PA 4DL7A 4JV0A 2VG5A 3UNYA 1QDUB 1S1UB 4OX7A 3OFEA 2DCLA 3N0VA 4HI1A 3LPYA 2OH2A 4ZMMA 3FGVA 1H2TZ 3CJRA 1HQUB 1VQ7S 4ID5A 5HO4A 4WBFA 4O4GA 2MKHA 3EXCX 2CZ4A 2OSQA 3FSXA 3UD4P 1PKUA 5EGYA 3DLLQ 1VQSA 5D0HA 1RWVB 3M8RA 2GVZB 4WPAA 1S1VB 3C6TA 2XZWA 2ZH9A 2VL1A 3VAGA 3V6JA 2LKZA 4A8OA 4DV7J 1H7WA 1YK9A 1GMWA 4J91A 3CO9A 4Q45A 4MK9A 3CJKA 4QWCA 4USHA 2N82B 3PKYA 1U0HB 3TA0A 4DOZA 2MY7A 2CJYB 2C3PA 2IBOA 1UW9A 4I7FA 2JDJA 2QL7B 3HKWA 1M5HA 4ZJQA 4LF2A 3GTYX 4TY8B 3OL9A 1SIZA 3JYTB 3I0SA 3H8YA 1RWWB 1XC9A 4IQMA 3NG8A 1CJKB 4QIEA 3DI6B 2ZHBA 2XMMA 2E5JA 2GMHA 2ZNYA 2HHHF 5HMXA 1WELA 2Z57B 2BANA 1RT7B 3MUMP 2CNLB 3OPKA 2AHOB 3MM5B 3HKZD 2RUGA 4CO4A 3NBPA 3DOMB 4MYUA 2R7UA 2QTWA 2HW3A 3HDSA 2V2KA 3ZZPA 3FJ2A 3GLJA 3EDQB 3KK1A 1B0PA 5D0GA 1RT5A 1URNA 2QYGA 1NNDA 3OFHA 4G65A 4H54A 2UXBF 2XSFA 3HMJG 1RA6A 3RBZA 3JS9A 1WG5A 4U7CA 5M2UA 3VAJA 3R7NB 3BKUA 3LGHA 1J27A 1FRMA 1RT3B 5BYRA 3O6QA 2EKNA 3H4BA 2ZDOA 3CJ5A 1RXOB 2PMWA 3PKMA 5AXKA 2GHVC 2M9KA 4H4OA 2DNZA 3CW2C 2AWZA 2MQNA 3R5JB 2F9DA 1MROA 2HFOA 2LVWA 5F8IA 3CO0P 2CPXA 3W2WA 1Y3JA 1U09A 2APOA 3TVZA 5LSRA 4DFKA 1XMOJ 2HNZA 5K8NA 4C48A 4OYPA 1HNIA 1S1WB 1TKDA 2F9JA 1S7HA 3PRBA 2VFSA 2QMXA 5ETNA 1QLNA 1BQMA 3L7OA 2V8PA 1RTJA 3W8GA 2E5GA 3GPAA 3BQ1A 4RBTA 1CJTA 2G9OA 5M2PA 5H9FJ 3VQTA 3DLGA 1S9FA 4JI8F 4O44A 4C8ZA 3VF0B 2V8VA 2W9CB 4DV6J 3DNCA 2G0JA 2VG6A 4AD6A 4OQJA 3V4IB 2LDYA 4LFBJ 4F0KA 2CJAA 1W2IA 4ECZA 2W4PA 4K0KF 1X9WA 2BBEA 1C0UA 2J9CA 3T1HF 5F3ZA 3QFWA 3SQOP 4M94A 3P5BP 3AXKA 2ZH1A 4JBCA 4ZIVA 3MMAA 1AROP 1S72S 2OD6A 5CHCB 3HFZB 1YBTA 3Q22A 3FUYA 4X64F 3D2WA 1ZS6A 3UO0A 1S7IA 3ENWA 3G86A 4ILRA 2V6AA 1S1XB 4RUBA 5ETSA 1GXUA 4P10A 3N01A 1IWAA 2LCWA 2MMYA 4TU7A 1XQIA 2JC0A 2UUAJ 4RKUC 1ZETA 4PXCA 2MGZA 2RT3A 3FBCA 1CPZA 3BH7B 4DG1B 4BLGA 2QA4G 4HYKA 4IG0A 4C11A 2MZ1A 3N6MA 4A8MP 3K17A 3W7BA 2P9CA 4J9QA 1VQYA 2QO3A 2ZFHA 3TUZC 3U1NA 2F65A 1VRUB 3VGVA 2DHHA 3D6TB 4P74A 1R6YA 2ASJA 1O5JA 2G0CA 2E9TA 2ATLA 1GAOA 2GVDA 2BOAA 2NXJA 3PY8A 3E8OA 4YN3B 4J9UE 3A3PB 3GFXA 1GXTA 3TAPA 3I4PA 2YNHB 2JEIA 4DX5A 5CYQB 2ZH3A 3Q8PB 2NZCA 1F3VA 4BCAA 1BXNA 3KNAA 1WTFA 5EUHA 4DJBA 2C2KB 3MFHA 5KFUA 1WEYA 5GAGU 4UQGA 4EI2A 1F0XA 4NXMF 1QAJA 4NCGB 1P1LA 2Y0BB 5B0BA 5HP1A 4YR2A 4QQBA 4C97A 2VQFF 4B9UA 4M5KA 5D4LA 2BJ1A 1E6VB 5J2NB 1KEKA 4IR1A 2GNKA 1JLQA 1L3UA 4DV3J 2AEMA 1F9EB 2D3UA 2BW7A 4FF1A 1JXEA 4ZPBA 2HNYA 4QYRA 1IBMJ 1Q78A 3AB2B 4DUYF 1U24A 4GKJJ 1H73A 4TXSA 4USKA 4NYPA 4WE1A 5KFHA 4ES1A 3JSRA 2FGOA 2EWHA 1DTQB 5IM0B 1S5ZA 2R3VA 2HRTA 2A2DA 4LRFA 3G82A 3EGVA 5K20B 1SC1B 3A8KA 4USUA 3OR2A 3JXOA 1YI2S 2XTJP 2MTLA 4CM0A 2E44A 1H98A 1UWBA 1BWEA 5IS2A 4KE5A 1RT6B 4MFBB 2XYHB 4HEA9 2B4PA 3T6BA 1JLBA 1ZTTA 2IFXA 4YDXA 2ERRA 2QA1A 4G1PA 3Q8VA 2BKOA 2DPIA 1KOHA 3T1YF 2RIJA 2BM1A 4FPRA 2FHKA 3DMJB 2HLUA 3M05A 3UI3A 3IRWP 4I6YA 2IA6A 5F8GA 3RAXA 3W9IA 2J9DE 3D0HE 2BRLA 5I4MA 3R97A 1VHFA 4KHMA 4A8KA 1Y5LB 4OFZA 2KXHA 3IRXA 2LEPA 4IR9A 3SIPB 1S9EA 1F2GA 1M1HA 3KG0A 1FK9B 5L1KA 4DBQA 1B3TA 3GIIA 1JJCB 4G1QB 4WK3A 5I3PA 3EX7B 4K8RA 2H54B 2ZH5A 1S97A 1TKZA 2L9DA 4MMOA 4USVA 4HACA 2OAUA 5C42A 2Q3PA 7AT1B 1FE0A 2ADBA 1VQ4S 4B3TJ 5M2RA 4TLRA 3DN9A 3TVYA 1VGYA 5D4OA 3K5NA 4CLZA 1YLXA 2ZBIA 3FSYA 4JI7F 3QO9A 4WKYA 2HYIB 4YB5A 3W63A 1FRKA 3WIUA 1X0FA 3A1YG 4OZLA 4MKVA 1VOMA 5HMWA 5KAKA 2B56A 2I5JB 3THPA 2ZJQQ 4EO8A 2DHGA 1NK9A 2UUBF 2HSEB 3A13A 4CO1A 2M8DB 2GGPB 1S6PB 2KT5A 1ICEB 2EFQA 3PG9A 3CC4S 4QWEA 2XGPA 4XPCA 1TL7A 4OJGA 3P45B 3QPIA 4RW4B 4DZDA 3QT7A 1B7FA 4GVLA 3ETOA 4C8LA 2V8DA 2GAGC 3JSMA 1Q1KA 5HK4A 4MH8A 1FJEB 1YJ7A 5KOWA 4NLPA 3HVTA 3SXLA 2HVEA 2ZOFA 1NDPA 1PAEX 4OI1A 4LQ9A 4IOAQ 2Q43A 2HFUA 4DR4J 2Z56B 1V3SA 2E5IA 4NYOA 2YX1A 3LALA 3AQPA 2Q6BA 4LSLA 3HXMA 1CQMA 3D0IE 3CE8A 2ALZA 2GHWA 5K9FA 2HS3A 2HQDA 2B4UA 4J9RA 1WDDA 4HI2A 4URQU 3A3NB 1S4EA 4DQIA 4P71A 4ID5B 1TL1A 2CQPA 4RL1A 4I6WA 3OW2R 4K4WA 5CCMA 5J2QB 3SQGB 2A18A 1Q5YA 2OD4A 3M30A 2BV3A 3NMAA 4NMLA 2GJ2A 3MPYA 1I5OB 4FPIA 1LK7A 1WF1A 3C6TB 2DR8A 7FDRA 3KLVA 4OZJA 3BH6B 3ZO7A 2KRRA 8RUCA 1VYAA 2NREA 2W7OA 2JHEA 2QLFB 3KLEA 4OHXA 4YHHF 4I7FB 4FYDA 4ECYA 4ZPCA 2CUYA 1UVIA 3TWZA 1BD6A 4QYZK 1EAYC 2K3IA 5DM7Q 1IKXA 4DV1F 5BJRA 1NK0A 3GSIA 1K0TA 4BC9A 4NMXA 5KFXA 2RJZA 2VA2A 5D3GA 3BGLA 5GAHU 4FXVA 3IXQA 4I68A 4JV5J 5J2PB 1CC8A 4PCQA 3HVWA 5KT6A 1K8AT 3MPDA 2IDLA 2Z58B 4LVOP 2CPZA 1SKWA 5KT4A 4A47A 5DG9A 4AL7A 5GADU 2R7OA 4DSLA 3SV4A 2HHSA 4B9LA 3SDEA 4PQAA 1FA0A 2NUUG 3QGHA 4JI5F 3OL7A 5H9EJ 2PEHA 2RAQA 4OJHA 1HL6A 3KK1B 3K8WA 4HHJA 3PV8A 4UQTA 1NDCA 3C2PA 3CDUA 2CDRB 4X4QA 3B6BA 4C98A 3K8VA 3VAHA 1OPZA 1O0PA 2MKIA 1WOOA 2R7QA 1K73T 4ZS6A 2WB4A 4PXEA 2C42A 2HIYA 1U0SA 3J80U 2FB0A 3RW7A 2NSBA 1WI8A 5L8RC 3ZTQA 2HBZB 4DV0F 4QU7A 4KBIA 1CG2A 3T6JA 3EZUA 3GB0A 2XMTA 3P6YC 4H4OB 4IFVA 4R8UA 2W2QP 5LMNJ 4OHVA 4ES2A 2PIIA 2HHVA 3EDRB 2IM2A 4LIWA 3ONQA 1PCAA 3W2WB 3CD0A 3L09A 2F63A 4KTQA 5K14A 5GMEA 2V9KA 4F8RA 3SV3A 1RHKB 3GV8B 1WC6A 2CPYA 4Y6IA 2H1YA 3M2UA 2R7XA 2H5EA 1BQMB 2G2OA 4M5DA 5C2GA 4RBVA 3KJQB 1RTJB 4DR6F 4ED8A 5B0CA 3ZTPA 1YJNS 2K1RA 2V8GA 4J7CA 1P6TA 1VISA 4EYIB 2VOPA 2OPQB 4ZHRB 4URSA 5B0FA 1DBDA 3DLGB 3EVMA 3NGSA 4O44B 2EFNA 4HH0A 2ZVIA 2Z30B 2CNOB 2MQPA 4MJKA 1Q7YT 1QAIA 3J81j 3TANA 4ZVQB 3B54A 2VDHA 1WORA 2HRYA 3DLHA 2GS8A 3AQOA 1NK6A 3M2RA 2IC3A 4OYZA 1T7PA 2AZ3A 4LFAF 2QA2A 3MCOA 3MMAB 1EETB 5HSPA 2CIMA 4K2XA 5KFJA 1BQNA 2J7WA 2VG7A 3V6DB 1H6KX 4K59A 4RUAA 4RWWA 4EO6A 4KSEB 3RW6A 2RRNA 1MLAA 1MU2A 1PYTA 2ZKUA 1IQZA 4UZBA 3BGUA 4ELUA 2VIHA 2W7PA 3BKFA 2HHHJ 2LQ5A 1PJ7A 1IN0A 2H4YB 2MEWA 3MMBA 1QTNB 3AD7C 2P2CB 1BE4A 4IG0B 1V9OA 1SJFA 5KT5A 2ZZNA 2CG4A 4C2MA 3AODA 1KWMA 3SCLE 1VQMS 3SBMA 4JI4F 3SMZA 2HFSA 3EZ5A 1FDNA 2B9YA 3R5AA 1XNRF 2KH9A 4LBPA 3H42A 3VAIA 1XR7A 4LSNB 4QWBA 2CQCA 1LWCB 1RI7A 3HSZA 4FBTA 3MZIA 2FDNA 3HCXA 1WSRA 4CH1A 4CLKA 2B5JB 1HBNA 3BYRA 3JB9k 1GT8A 4I0WA 2I1RA 2MKCA 4QJVA 4CIOA 2BE2A 1IJFB 4QIVA 4A8WA 5A2QU 4PPDA 4J37A 1D1UA 2XMWA 3MEGA 5HP1B 4ZJLA 1Y9OA 3WIVA 4CO0A 4EWTA 1JLQB 4PWWA 2V4JA 1I1GA 1OJ4A 1KQSR 4WYWA 5HATA 2E66A 3MOJB 4CH0S 5J1PA 4AYBD 2ZE2A 5BR8F 2DPJA 2VHGA 3MMJA 3K7RA 1V3ZA 3OR1B 2OHDA 3BF4A 1JWWA 5EHHA 4F25A 4NLGA 4V19J 2J0WA 3IO1A 4Z7YA 2GQ2A 1VBZA 1C4CA 1JMTA 4JI2F 4NCBA 3RAMA 1P27B 1SC3B 2CNNB 3OXGA 2IYIA 3MCNA 4NLQA 4CLTA 3OL8A 1SKRA 1TK5A 4JI1F 4KH1B 4ETZA 1UWBB 1VQNS 5ETVA 2YPYA 5ETTA 2DITA 2ZH2A 2C22A 4F50A 4ECRA 3HF5A 5KFFA 1JLBB 5DLGA 5IXUA 4CLFA 2I0XA 2VZ9A 4OHYA 1HI1A 1ZBTA 3GR0A 5JVGQ 3DRPA 4ZVTB 4NCAA 4K0KJ 3VZHA 3TUJC 3T1HJ 2KM8B 1FKOA 2CPHA 1Z2ZA 2B3TB 3TNVA 3TQEA 3K2YA 2HWTA 3MEKA 4KT0C 3NGDA 2IMWP 2UXDF 3W61A 5C7PA 3UD5A 2YWFA 3PYFA 1FERA 3A8JA 4X64J 5HVGA 1Q8IA 2XULA 2V8HA 5F9NA 1Y5IB 4IG3A 4NX9A 1OPIA 4NLYA 2IMOA 3CCES 1N5QA 1U6FA 4IFYA 3UDLA 1VK8A 2DR6A 2PI5A 2FY8A 3EGNA 2XYGB 4C0HA 3I82A 2MZRA 1S9EB 1YX2A 3FCWA 4ZPVR 2CJQA 3JQMA 5GMKa 4X4RA 2EPIA 4Z7CA 3AJ1A 1RABB 2HAIA 1IJEB 3VGUA 3C15A 4RU2A 2BW2A 3Q8YA 1TKZB 1LWEA 2HWIA 1QVFR 3D5MA 1D9FA 4ZLPA 1D9DA 4HACB 5C42B 3CCUS 1IKYA 1GNKA 4CI0B 1MMLA 5DLFA 3G8TA 3NKYA 1KTVA 1LW0A 3THVA 3QO9B 3QAEA 5K8MA 3LANA 2O3DA 3O5TB 1HWUA 1Y5NB 1EX8A 3TYTA 1S6UA 2YKNA 3M8SA 4KGZB 1FRXA 3V81B 1YITS 1NDLA 5KFNA 5F8HA 4DPWA 2V2QA 4B08A 2XGQA 2DR7A 4Y3CA 4Q2LA 4PUOA 2MKYA 1RUSA 2QRRA 3HVTB 2VQFJ 1RWXB 1RK8A 1S9GA 4YQWA 5F3TA 1LK5A 1HBOA 1HARA 1RT4B 3KLIA 2ILYA 2W9AA 1SL2A 4DFMA 3BDPA 4DU8A 3GJSB 2HNDB 2EG2A 5E3PA 4DV5J 3ZZYA 2IY5B 4PG6A 4UF4A 2ZUAA 1UL3A 2BJ7A 1I51B 3M30B 1VHIA 2QLWA 2KJWA 3KJFB 5HQLA 4L3NA 2R7SA 3U27A 1C1CA 2RSQA 4UY85 4LRDA 3D1HA 3TOQA 5FLXU 2KM8C 3G6XA 2VJUA 4J90A 3MTKA 3KJVA 1O51A 1T05A 1Y11A 1DY3A 2LMIA 4LMZA 2VH7A 4USJC 4Y28C 2D3ZA 3BKTA 1R0AA 3EGZA 4CDIA 3GONA 5AE1A 1RGVA 4K4ZA 1YBAA 1IKXB 3D6FB 3G8QA 2P9EA 5FIIA 3VTIA 1S1TA 2V2VA 3QSIA 3NEKA 3UWTA 4F04B 2BX6A 2X3GA 3IAM9 1X4FA 4PG8A 4QIWD 2OTJS 4B9MA 1NJWA 1PBUA 4E8UA 5SUHA 1KRPA 3KWMA 4WTOB 4AQYJ 4I2PB 5A8WA 2FVRA 4X4NA 4FF2A 1UA0A 3DFEA 3MUVP 4RW8A 5B0AA 1U25A 4BHQA 2HPUA 1L3SA 3GG0A 1TKXB 1HI0P 3SDEB 5K8PA 3QLHA 1FKPA 2PSZA 2PMZD 3H5UA 4KB7A 3D7SB 5H1SV 2H9ZA 1CLFA 1X7VA 1NXIA 2G13A 3AY0A 4B9VA 2Y1JA 3AT1B 2RD5C 2LLZA 3C16B 1CBKA 2LA4A 4YB6A 2FHJD 4DQSA 1VQ9S 3D28A 4DQQA 4QR0A 3PW4A 2CVIA 4LT6A 4XIUA 4O4RA 1B99A 2JX2A 2KHCA 4ZLLA 1NK5A 4OI4A 5D77A 2J5AA 2WK4A 4ZP7A 2OEJA 4CNYA 1J2VA 2ZOMA 1FD2A 1MMDA 2UUBJ 2MPUA 1BGXT 2GC8A 1L3KA 3KDNA 3ETMA 4Q8FA 2GA7A 1NSKL 4IFVB 3M6XA 2AD9A 3I87A 3Q89A 1FI4A 1KN6A 4QOTA 3OUYA 4J9MA 3A4TA 2JNJA 1OY8A 2HVHA 4KR0B 1WDTA 4JB8B 2BA9A 3CEDA 2ZBQA 3ITHA 5K14B 3MM6A 1F6TA 4F02A 5HMZA 4AXIA 2DB1A 2UVVA 4Y2KA 4M5GA 1UETA 2XC9A 2HGLA 1U2FA 1XJWB 5H9EK 1JLGA 1B0VA 2U1AA 3ZZZA 2YQ0A 3K5OA 4J9PA 1XNQF 1IKWA 1RHQB 4XPEA 2KKHA 2J7UA 1N5TA 1M5PC 1P9YA 2DNRA 4A8QA 2XQCA 1N33J 5LT5A 3Q2SC 3PACA 4KO0A 1GMWD 2OFHX 5F9LA 2AP6A 1RHJB 2JL9A 3N6NA 4OJ1A 5CZXA 3G8SA 3DDNA 4AFFA 2YKMB 2C3MA 3K57A 1BQNB 2WVCA 4DR3J 1CJUA 1RTDA 4ANEA 4KY3A 2B4OA 3QRQA 2VG7B 2F8EX 1VBXA 4C8KA 1IR1A 2EK1A 3PO5A 4DPTA 3ADAC 1HBMB 1KS2A 1APSA 3FEXB 2N7YA 5IT0A 2PA8D 5GMDA 2B6AB 3R5CA 1X4DA 4UW2A 1YJVA 3MMBB 5CYJA 2L9NA 3MM8A 4P2XA 3IWNC 2WSFC 2VONA 4NE9C 3LAMA 1WJ9A 1FX2A 1ZPWX 4OL8A 3AD8C 2UUTA 4PRFA 1VC0A 2VFVA 3ISND 3UDCA 3FFIA 4DUTA 4I1TA 2X1AA 3GJQB 2CYYA 1HLWA 2FZGB 2Z2ZA 5E33A 1FDAA 5L9XA 3I56S 1C0TA 1SH2A 4WKRA 1KLNA 4ILLA 4DFJA 1FEEA 4ED1A 2QN6B 3DLKA 2DEJA 1HBNB 2XS2A 2G0IA 2KT3A 3W65A 2ZUGA 2BVZA 3WBZA 1U7LA 3OT9A 2X1BA 1LEOA 1JJ4A 2OPRA 3MEGB 3KDOA 2F5GA 1NHVA 3T9ZA 4YDDB 3MEEA 1ACMB 2V4JB 4LF6J 4U96A 3AHPA 1HR0J 4J5OA 1DHMA 1HNWJ 2W01A 3EJMA 4M1KA 2YQ3A 2C2EA 5E2QA 4M63A 4Q0BB 5IZHA 2R2UA 5A0YA 3M2VA 4IO1A 1PYOB 2VBZA 1PGZA 3E3XA 4DR6J 3UN3A 2IJRA 5CXTA 2QSFA 1S59A 2E5HA 4Q7AA 4NA1A 1MSWD 4FS2A 3H25A 5DRKA 1NBEB 4HHHA 3PX4A 4K4SA 3CUNA 3H5XA 1R0CB 2LDIA 2ZD1A 2WBRA 3UW1A 2JFKA 4FF4A 4JI6J 2HVIA 1Q81T 2X3DA 5L1IA 4RW7A 1UMJA 4DL4A 4CLLA 4DV6F 1FX4A 2W4DA 2BRKA 1HNZF 2OO4A 1PO6A 4IDKA 4LFBF 4LFAJ 3R1LA 2RDDA 4L6V3 3J7Z5 1RBLA 2KG0A 3VR1A 3KLFA 1NCLA 2IA0A 3POTA 1QSSA 2E5LJ 2FLNA 4LF9F 3M4XA 1TL5A 1T9YA 5DQHA 2A10A 4P72A 4IFYB 1I6JA 2FJXA 4C8YA 2NXCA 2V94A 2Z8QA 2HIQA 2AKWB 3ILLA 2FZKB 1FFSB 1IR0A 4MAKA 2DEIA 1RLDA 2DIUA 4ATNA 4DI6A 3CCRS 3MHYA 5DDRC 2OSRA 4CLSA 5CYMA 2CA9A 3BS9A 3SCJE 4RZRA 3V2UC 5J2MA 2HEKA 1H2VZ 4ECXA 1N88A 2UUAF 3T5JA 2K7KA 1B64A 4NLOA 3Q8SB 3RJMB 4JI4J 2QFIA 3EVOA 2R8GA 3TARA 3US5A 3HVAA 1WG4A 1NAQA 2HFNA 3BN7A 3FVYA 3HFKA 2HBYB 1HWKA 4DV4J 1KVIA 3AA9A 3TA1A 2U2FA 2NYHA 4C7QA 3H20A 1UVMA 3MR7A 3UN5A 5CD4H 2ZOGA 5FDLB 2KZMA 4LR8A 4PABA 5E3AA 2J76E 4DPUA 2NR0A 1UA1A 1SI9A 2UU9J 4B3RF 4QPXA 1XR6A 4USMA 4P7VA 4MKYA 2BEFA 2QYCA 1RAIB 3L4BC 1KR4A 2XY7A 4UUXA 1RTZA 1SUQA 4ED4A 5ADZA 3BPSP 1XIQA 2NZ4A 3BBFA 5HI7A 3RB3A 2BQ3A 2Z0GA 4DR1F 2X51A 2LYVA 1YHQS 1SV5A 1S9GB 1RAEB 3E51A 2HRUA 3NCPA 3A3OB 4HDHA 4OYMA 3KLIB 1SVDA 4DV3F 3BJYA 3D0GE 2C2ZB 1RU1A 3QMQA 1S49A 4PWUA 2IRXA 2EVZA 1H74A 4K4TA 5DO2A 1TR0A 1GH8A 1YRXA 1V5IB 2WVFA 1IBMF 1UPMB 3BDEA 4B3OB 2LQ9A 3PJXA 4NZ6A 2P6SA 3IFEA 4TVAB 1C1CB 2ASYA 2OUGA 4HR2A 3EMTA 1NZ8A 1FVSA 1FE4A 1TUVA 5JMNA 3CMES 3LP0A 3HHNB 2YWEA 1FT8A 2D7SA 3KJVB 2OPSA 1DQ9A 4F36A 3DOKA 3FQLA 1TMMA 1U2RA 3PVXA 3V6KA 3NS7B 1MN9A 1S0NA 3L3CA 4CRJA 1VRTB 3TO8A 5A6PA 3UR0A 1OSCA 1JXLA 1FWPA 2WB1D 2ATCB 5KFAA 2UXDJ 2HQGA 2FVPA 2MKSA 3R2CJ 3W8PA 1CSJA 1Y10A 3IG1A 2R7VA 2HZVA 1KVJA 2BMBA 3DRYA 1RHRB 1TFYA 4L73A 3PW7A 2MQLA 5A8WB 3OVSA 2WTFA 3MOZA 2BJ3A 1R89A 4ES3A 4KJIA 4ZN1A 5IQQA 3T3FA 1NJZA 3HD2A 1NU4A 3QLHB 4LVNP 1RTIA 3FCVA 1VQ5S 1UEKA 2L48A 2B9WA 3KTQA 4CLUA 3DYAA 2DNMA 1J5EF 2DXEA 1H2UX 3UE2A 1WHXA 3QFHA 1RTHA 2I6WA 5JXSA 2FTRA 1R27B 2FY1A 2OGUA 3DXBA 4O3RA 5A76A 1S12A 2XZDB 5DGAA 3W62A 1EP4B 2F1FA 2XMJA 1UVNA 3QJPA 3D4JA 4B3TF 4LR7A 3MURP 2HQ3A 4K7QA 4G3IA 4RW9A 5G0RB 1MWQA 4RNHA 2OIHA 4JV2A 3TX8A 4QIFA 1DAXA 4I2QA 5CCLA 3P4UB 1F5CA 3W64A 2G1DA 2HFZA 4DU7A 2EXUA 1D8ZA 4CYUA 2F3JA 1H72C 3OUYB 2BKPA 2MDAA 4CO2A 2HZAA 2HMIB 3KK2A 1RU2A 1H7XA 5HL7Q 4GVBB 2PDAA 3F0NA 1AUSL 4NI2B 4JV1A 3VVTA 1DTTA 1JLCA 1UKUA 2F8HA 3M8QA 4IOCQ 2XSJA 2DO0A 5LSLA 2QGFB 3H40A 3DLEA 1U2CA 4KGKA 3MAQA 2YH1A 2E1CA 3CJQA 2NUHA 1JLGB 3F44A 1KOOA 3QGPA 4FBUA 2R4FA 1YRTA 3GIRA 5KFTA 5CA5A 1IM4A 1G2EA 1NUEA 3VQSA 3UDVA 3FRYA 3FZ2A 1KP6A 5AXMA 4ED7A 1VK3A 2ZKTA 2DH9A 2J7KA 2OPPB 3ENAA 1X9MA 2ZITA 3CCTA 4KO0B 3P8BB 1UAWA 2NLWA 3OXLA 4RUHA 4FZVA 4FF3A 4N76A 1ULRA 2VV5A 3PNIA 1S10A 3EM1A 4OZ0A 2R2RA 3QJLA 2W24A 5C24A 1RB0A 4TY9A 3RBXA 1CJUB 1FESA 1LQ9A 1T9XA 4KFBA 5A6WA 4Y34A 3BO3A 3CD5A 5EX3A 2LQ8A 3CCLS 4G1IA 2WRMA 4X65J 1CJVB 1ZM4A 2CQ4A 1KVKA 2BABA 2AT1B 2R8IA 3M6UA 3ET6A 3KHHA 5KFYA 3MM8B 4PXDA 4FXDA 4ICLA 3ILOA 3DGPA 4HT7A 3GCWP 4NLWA 4ZJOA 1OYEA 3CDEA 2F4VJ 3TUIC 2C28A 4OZ2A 2XCAA 2QA4S 2QG9B 5DS7A 2C2OB 4IH6A 2IM3A 4NEYA 4GRSA 4M95A 3C8YA 1U1PA 4YB7A 1Q4RA 4KHPJ 2HK2A 5KG4A 3JTOA 2AMCB 2XO7A 2R9LA 4FXWA 2DHSA 2MQOA 4OYAA 5B0GA 3H7HB 1V6HA 4X4OA 1CULA 2C3OA 3I9V9 3CDWA 2ZH4A 2LECA 4DCJB 4U7UD 4ALZA 3FEYB 4A8FA 2ZM6J 4F3OA 2PA3A 2H65B 1RT2B 2HHTA 4P2FA 2KYXA 2HQIA 4FN5A 2OPRB 2VFTA 4JUZA 4K4YA 2ASDA 1ZTWA 3PJWA 2Y8WA 1HPZA 2V34A 3DC2A 2VB6A 3RB6A 2YH0A 1JKHA 2XBPA 2BUNA 3N9UC 3NOCA 3FDSA 3ZZTA 2CWXA 3NAHA 2DO4A 1Q95G 3I4HX 2ALYB 4MIBA 1RE1B 4DS5A 2W4CA 3NP5A 4R25A 3P5TL 3WC0A 1HHTP 2RKIA 1FJ7A 1R31A 2E7VA 3DHXA 3CC2S 4C9DA 3RRGA 1TMJA 5A0YB 4ZKAA 3M2VB 3HT0A 4ZPDA 3CJ2A 1F3FA 1KONA 3S7RA 2AEJA 3ISZA 2YXLA 3OV7A 4A48A 1YJTA 4KKOB 4DX6A 1XNQJ 3TUPA 1XMBA 3QRPA 3C6UA 1YDLA 5C2CA 3G6ES 1VQ8S 5LSOA 4Q8EA 1OWXA 2V5HG 1IKVB 3MFIA 3HHLA 2HBQB 3Q23A 1WF0A 3SSSA 2EI5A 1S6QA 2FLLA 1UP1A 1G4CA 1HYSA 2RQ4A 1WOSA 3NS6A 3KLFB 4DPYA 5L1LA 3POTB 3R2DJ 5EDWA 2D69A 1V5VA 3TJ8A 1NHKL 2VKRA 4PWDA 2PT0A 3KG4A 1R8CA 2LQBA 4LRAA 2HZCA 5D4PA 1UEUA 3CMAS 2ZH7A 3DDKA 1FD8A 4RBUA 2M4MA 4A4JA 1KQGB 1IBLJ 4UOFA 5CYMB 5IV3A 4FNIA 5C25B 5CD4A 3EZOA 4E98A 2DY1A 1X4EA 5LJ5Y 2GFFA 3C14B 2ZH6A 4IOBA 3AOAA 2J9DA 4ECUA 3NGRA 2GQCA 1SJ3P 5ETKA 1YWXA 3OFFA 1Q0NA 3TRGA 4D3GA 2IAJA 4C3MA 3GP9A 3KHGA 2KO1A 1FDBA 2RVJA 4WFYA 4DSEA 4WP3A 2YVSA 4O3OA 5I3UB 3KHLA 2JH3A 2POKA 3KK3A 4DLGA 3D66A 5KFWA 5HBMA 3AJDA 2J6SA 3OTEA 2VC0A 3ZTOA 2ZJRQ 4NASA 4WFZA 4F4KA 2R42A 3IWXA 3GIJA 1A9NB 2ZEJA 3LP2A 3VCDA 4WU2A 1SUQB 1UFKA 4NLVA 2LEAA 3NLCA 2MXYA 2LFVA 2YWKA 2L08A 2PO4A 4ZIWA 1SV5B 4NWBA 4TLQA 4ZCKA 2XWYA 1Q8LA 1TU0B 5KFKA 1RWOB 2X1GA 2UUCJ 4B3MJ 1T3OA 3OSNA 3ENQA 5GAEI 3HK2A 2KI2A 2LU1A 2EFOA 5FLXY 2HVDA 5E3RA 3KMSA 4OX8A 3S01A 1LWFA 3TQ1A 2V4QA 1FRLA 4OI2A 5IT9U 3PEJA 3N4WA 4MKAA 1Z2LA 2E9RX 4DR2J 1M1KT 2D9PA 5MLCV 2GV1A 3E01B 3RRHA 4A46A 2G2YA 3OSPA 8ATCB 5AE2A 2W9BA 3CD6S 4C8NA 3TEHB 2ZHAA 1SBRA 1L5UA 1W25A 2L41A 2M0GB 4FYYB 2IJFA 1T03B 1Q5VA 4Y0FA 5HROB 1HNZJ 2YNFA 4B9NA 1R8BA 3Q86A 4J9OA 1RZMA 5IC6B 5E7OB 1N52B 3DOLA 3I0RA 4GO7X 1XMQJ 3MPUB 1VBKA 2N4DA 3D3CJ 4F2RA 1RA7A 1TVRB 4ZP9A 1N48A 3J7AN 4LF9J 2AYEA 3Q0AA 1RT1B 3EPIA 3B8HA 2FJBB 4NLTA 3PRVA 4FP9A 3PR4A 3M1VB 2AJ0A 5HLFA 4DX8H 3H2UB 1TAUA 2AV5A 1HNVA 1RTIB 2IVMA 2B51A 4KPCA 4KGVB 4JI0F 3CB4A 1KKHA 3PYEA 1JLFB 3CJSA 1WEXA 5KOXA 1KSPA 4DZ6A 2NQPA 1J5OA 3A8EA 4PG7A 2VPXB 2QL5B 4WXOA 1ZH5A 1G3OA 3J7A1 2GW8A 3DM2B 3TR5A 1KFDA 2CQ1A 1RHMB 2W8KA 4Q5VA 4RW9B 1S1VA 1RWPB 3DDIA 3DCAA 1K9MT 4OZ1A 2OJ3A 4YFUA 2AW0A 3FK4A 4B3RJ 3HD1A 3FKBA 1OQ3A 2RDIA 1QM9A 4CYUB 4RR5A 3G4SS 2Q79A 4TY8A 4DR7F 2CPDA 2OLWA 3RB0A 5T41A 1OY6A 1LXJA 2VC1A 1DTTB 5BXIA 1JLCB 3GU0A 2FC8A 2EKYA 1HBUB 1NMEB 3M8QB 2JLFA 2YTCA 2ZJPQ 4DR1J 4YY3J 2XSJB 4LF7J 2RS8A 1PC5A 1T0TV 3O8WA 5ETOA 1ROFA 1FFWB 3CSKA 1NKBA 3MM5A 1HQEA 4AL5A 2V68A 1QUPA 4RNMA 1WC3A 3DOMA 3MD3A 2UVWA 2MZJA 2YBVA 3QNWB 5DGBA 5CABA 2J6TA 2BJ8A 2B4VA 2LQJA 2M3DA 3NNHA 3CCZA 4WFAQ 1FO1A 3GIKA 3LO3A 1N5SA 4GO5X 2P6TA 5KFRA 4P9SA 3OTBA 4LF8J 4DV5F 1SL0A 4NRTA 3M6WA 4XDDA 3AFGA 1SKUB 5JJBA 2O66A 1U1QA 1NDKA 5J1EA 4PEOA 1RYSA 2ROEA 3GV7B 5KFEA 4L76A 2VKZG 4U67Q 2KB2A 1BWVA 2BJEA 4KFBB 5U47A 1VI7A 4M5IA 3CCVS 3D6HB 4KGMA 1RT3A 1TUGB 2QJ3A 3D3BJ 2NXEA 3W5YA 3QSYB 1F5AA 1X5TA 2MHEA 2C2RA 2VQEJ 1URRA 3RBDA 2V2ZA 3IS9A 2XS5A 3MECB 1AA1B 2BZ2A 4N41A 3LAKA 1JX4A 3H98A 2JC1A 4DL3A 2AJFE 4CLYA 2OMOA 1AFJA 3TJAA 4QU6A 1EQ0A 4AE5A 2E1RA 3GFHA 2KTQA 2HKEA 3MR6A 3NL0A 1YIJS 5LOQA 1TK8A 2RNEA 4AQYF 3WDOA 1SL1A 1N0UA 5E41A 2DGQA 2DGTA 2FJEB 2CZVC 2ZBCA 1J5EJ 2H3EB 3AXMA 4ECTA 2AYBA 4WFBQ 2CZ9A 2ZDPA 3I5AA 5MAOA 3M9OB 1HNXF 3IP0A 4EFAC 2KHDA 2W9CA 4F4AA 1N36J 4UZCA 4F4WA 4ENOA 2FGCA 3I9ZA 1DQAA 2ACYA 3CJ4A 2ZWOA 3DKDA 3UVJA 1GEHA 1TL3A 3KUHA 3PFOA 1VJWA 3IR5B 4X4VA 3BBCA 1R0BG 1HPZB 1NKEA 4J9SA 3UDEA 1YKWA 1JLEA 1DFDA 3AH6A 2W8LA 2IIHA 3J7YI 2YNGA 4W4MA 3WC2A 2CXEA 2DGXA 3WX4A 2RKIB 1S1XA 1MG7A 1DZ5A 3MAAA 4DX7A 3B82A 2JLEA 4YP3A 4AUKA 4ZVEA 4ZDNA 2IJNA 4FDFA 5B0EA 2YX4A 2KT2A 1B0TA 5I42A 4J9NA 3QIPB 4ER8A 2Z2LA 2CWKA 4DG1A 5KFIA 4Q43A 5KFOA 2UV8A 2HHUA 2HGMA 3PDNA 2NSCA 3D54A 4BS2A 3X3UA 4F2SA 1RWUA 4ZVRB 1HD0A 4O3SA 5KFCA 3M8PB 2VG5B 1QE1A 2Y1LB 2RH3A 1B70B 2MQQA 5T14A 3RYLA 3NXZA 3CC7S 2DH7A 1NK7A 1C1BA 1XERA 2HHQA 4NA2A 2P8IA 1TP7A 1SQEA 3H5SA 4IH5A 1S6QB 4O4GB 3CTRA 1Y00A 4DN0A 3MMCA 2A0FB 1N33F 2FZCB 1N32F 2MSSA 4ZVHA 1Q8KA 2LXFA 5A8RA 3VZIA 1F9FA 1DARA 4NCGA 3FSIA 1H0HB 1Q86T 3IWLA 1CS4A 3CJKB 3BGFA 1S79A 5LL6d 5KG3A 4DR3F 3W60A 4KH0B 3T5LA 1BMQB 2XLIA 3MM9A 5J2NA 2GHPA 1FJGF 1FRHA 2JLGA 2B43A 3BZQA 4IKAA 3CCMS 3I0SB 1FVQA 1LFPA 4OYIA 1PJ5A 3N28A 3RBEA 2H51B 1GXLA 4EYHB 1P9QC 2BE9B 1D9AA 3LWLA 2E7XA 2J0SD 1Q16B 2V9WA 2WAQD 2HHPA 2BANB 3IM8A 4I67A 1M0SA 1Q8BA 5EWEA 2AGQA 2NPFA 2M8HA 1W26A 3I32A 5IQ6A 4EZ6A 1DTQA 2YWHA 1RLCL 2A6MA 1O8BA 2XS7A 3HSGA 3NBPB 2BQRA 3IM9A 1UVJA 4TNOA 2XMAA 1BQXA 3KK3B 2JEFA 1QAXA 2AJ1A 5AXNA 2O5DA 4F0HA 5HBMB 3ZTRA 2JEJA 1RT5B 1YRUA 3RR8A 3ZTSA 2H48B 9RUBA 4OX9J 4P73A 1YJUA 2UXCF 2SXLA 5KT2A 3HHDA 3K5LA 3TZYA 1T02A 1TAQA 4F4XA 2D41A 3PHEA 1XWLA 4FYXB 5EWGA 4DUZF 2VPYB 2CVEA 1XR5A 3DMJA 2JVOA 1W7WA 2DIVA 1Z4UA 3QZ7A 3LTOA 1RCOB 4U7UK 5HJXA 1N54B 3OL6A 1PC4A 4LF6F 5KFSA 2C2MB 2M5YA 1U6BA 1HR0F 1MROB 4WIQA 2LEBA 3LH2S 1HNWF 1FK9A 1P8GA 2KRBA 3NNAA 4N7TA 3OD2A 4O3QA 5D4NA 1PSDA 2HS0A 2YKOA 4G1QA 2BKNA 1IWGA 2RB7A 2HNZB 4K2JA 1RWNB 1HNIB 1YTYA 3VWSA 5KFVA 2IHR1 3R3TA 2R2TA 4P2SA 3ICLA 1WUUA 4N47A 2XY6A 1KTQA 2YNIA 3BSOA 1HI8A 1M5KC 1Q7LB 4IRKA 2RUSA 2E7WA 1B7YB 1CJTB 1IUJA 2ZH8A 4F7VA 5AJ3F 2HQFA 5IFMA 2VUGA 2CJXB 4HT5A 4WYLA 4KYZA 2Y3YA 2DNYA 3JQKA 1WC1A 2DNKA 3P3DA 2I5JA 3FCHA 3NCQA 5F0WA 4JI6F 2VG6B 2XHCA 4WP8A 2CPFA 4Z37A 3HSJA 2DR9A 1VCTA 3T19A 2GGPA 4D3HA 3CWJA 2GJIA 4YR3A 4NXNF 1C0UB 2D3OR 2K06A 4W92B 3CDAA 3I0RB 3MCMA 2J0XA 3M6VA 4RW4A 3MUTP 4M5MA 3RG6A 1QUVA 1YJ9S 3PRDA 1RDRA 3HO1A 4FKXA 1U1LA 2E5LF 1HNVB 4DPXA 1AYEA 2CFXA 1AFIA 2CRLA 3UCGA 4J9KA 4B9SA 3UQSA 3TA2A 4FNHA 4WIIA 3QWPA 2QFJA 1J5OB 3W1YC 2MGZB 4EBEA 2OEMA 4RPFA 3R5DA 1M5VC 1EQMA 2CPEA 3ISNC 4ILMA 2O67A 4C11B 2CG8A 2ZHOA 5J2QA 1VQPS 1EKSA 3SQGA 1RAAB 3I31A 1YZ6A 3LF0A 2MQMA 4Y2IA 4C0OC 3P96A 3QT5A 4PPZA 1O6XA 1SH0A 3P49B 2KFYA 3IMQJ 1SQGA 2DRDA 3S6EA 3I5BA 4DV4F 4NZ7A 1DJ0A 4MK8A 4GKKJ 3CJ0A 5J1NA 2GVDB 4EU0A 4LRCA 4NLXA 2UU9F 2ZZMA 3FC9A 3R9LA 4MK7A 2A3JA 2QL9B 4N77A 1TFWA 2W7AA 3UCUP 4H4MA 2PEBA 2XNQA 3FZBA 3BBBA 1JIHA 3HZGA 4OV1A 2B9EA 1X9SA 5J2PA 1YJWS 4LF5J 2XY5A 3HT3A 1Q79A 1WF2A 5B08A 1HQEB 3PW0A 1S48A 1XEZA 4RWXA 2EC2A 4X62J 4PG4A 3G96A 3CULA 3DXSX 3KXDA 3TAQA 2ZC3A 5HAOA 1KC8T 1KHVA 2CQ2A 1QSLA 2FLOA 5KG1A 1C4AA 2LXUA 3VAKA 1N0VC 2HNYB 4B02A 2GO9A 1ZA2B 1PYSB 1UVKA 2GIQA 4CP5A 1RBAA 4WE1B 1UVLA 2KG1A 3OQ2A 1RWKB 4C4WA 4XDCA 5J1EB 4RNOA 4ZVFA 3G82B 1NJYA 2CKWA 2DH8A 3RGIA 3OR2B 4QWAA 3T5KA 2VASA 4CCHA 1TV6A 4ECVA 3SYZA 2V67A 3BM7A 2H4WB 2JSXA 3HZEA 3TVKA 5LXYA 2DGSA 5D6GA 3IS9B 3U02A 2DJWA 3PX6A 2FJAB 5DG7A 2JZ5A 1R7IA 2KN4A 4RNFA 1FRJA 4TYBA 2FJVA 2AQ4A 3OBIA 4UOHA 3TAMA 4PYDA 2NS1B 1GX6A 1U49A 4LUBA 5ETMA 2IM0A 4JI0J 2EG1A 2XMVA 1BLUA 4I56A 2Y1IA 3IRXB 2F40A 4FVCA 1JK9B 1N5VA 2IDEA 2CDQA 1SJQA 2OPQA 4ZHRA 4ZVGA 3OTDA 2VJVA 2MLYA 1Y0HA 1GX5A 3EPGA 4JYAJ 2BACA 2FIUA 4M8LA 1TELA 3W2VA 4FS1A 3HLUA 1YZ7A 1IM6A 1SXLA 2J8SA 3UVJB 2NXNA 1FXDA 1WACA 1TL3B 3NNCA 3MXHP 1RP5A 5KFQA 2QC3A 2DD8S 5F8NA 3NWGA 1JB0C 2PE8A 5IT4A 3W9JA 1GMUA 3GJRB 1EETA 2FVQA 3LPEA 2YKAA 3W5XA 4DL5A 2HURA 2AJ2A 1JLEB 4WZQA 2MKJA 3V6DA 1T9WA 4QR1A 3TZWA 4ED2A 2YNGB 2OELA 4DR7J 1S57A 3R7BB 2AJQA 1X31C 3QZ8A 2KVQE 2HS4A 2AGOA 1M1GA 3MAAB 1TL7B 1A6LA 1FDDA 4M5NA 3VAMA 5E3CA 4ZPAA 3QAUA 5I42B 2R7TA 2Y9HA 2A1BA 4IRDA 3JSMB 1VMBA 5ETLA 1HD1A 3OJUA 4HHUA 1Q53A 3PIPQ 1S76D 3RUBL 1I94F 1ZYQA 3DHWC 3GILA 2EFPA 1QE1B 3ZZ0A 1UFLA 4PKDB 1HQ2A 4LSNA 4LSLB 1VQKS 1BY9A 2XEXA 1LWCA 1C1BB 4FKYA 3CT9A 1SJ4P 2XB2D 4YUDA 1TL1B 2DNPA 2O01C 3BB5A 3MMCB 5HQ8A 2B5JA 4UTGA 2CJ9A 1QY7A 2D74B 3FBBA 4CNZA 3ZZRA 4PR6A 2DRAA 3MPVA 2DNLA 5IWAJ 2WVEA 3TX0A 5A8RB 3UD3P 1CVJA 1ZAVA 4M5JA 1QD1A 1JLAA 3LP1A 2KXFA 1WKJA 1CS4B 1FFGB 4ERDA 3EE3A 2MKKA 4OI6A 3KLEB 5E5NA 4AL6A 1T8EA 2N3LA 3MM9B 1VQ6S 3LW5C 5DG8A 3E2EA 3V5RA 3MI7X 4F67A 4X65F 2MZSA 2ILZA 2E9ZA 3OR1A 5D3GB 4OV6A 4MKBA 1GQEA 3HJVA 1RAHB 1NJIT 3CXCR 1NSPA 3ZZOA 2F4VF 1X0PA 2RE1A 2A2CA 2DGOA 4HDGA 2B7CB 2ZWPA 1YGYA 4DSJA 2R2SA 4QBUA 5KG5A 2UVUA 4LF4J 3UN2A 2FVCA 4KHPF 4AXJA 2L3MA 4DF8A 1HHQA 3U7JA 4K50A 4LIRA 5IOLA 1HNXJ 4LBHA 3Q83A 2V50A 1G7CB 4JOUA 2YKQA 3H4DA 4OYBA 4NPOA 2JEGA 1FWKA 2XZTB 1ZAWA 1SKSA 1RADB 1TTHB 5C5JA 1S0OA 2W2NP 2ZM6F 2AX1A 1JNRB 1SC6A 1M5SA 3UPFA 4W98A 6AT1B 2VPZB 5IT9Y 3M7VA 3KNGA 3G6YA 4ED6A 3VV2B 2QMUB 1X4AA 2RHSB 2K3KA 4CZCA 2VICA 4OHZA 5A8KA 3QGGA 4LQ3A 4MT1A 2WHOA 4DFPA 4R8UB 1U4BA 2CQHA 2WSEC 1FCAA 4BC7A 3RRKA 4KAIA 2V63A 1R8PA 4OZNA 4R0EA 5DM6Q 2KJVA 4I69A 3ILIA 3PTWA 1D0EA 1KD1T 4CLPA 2OP5A 4DV2F 4WJBA 3K5PA 1MWYA 4Q2MA 3M2UB 4M5DB 3IGNA 3QIDA 2YNIB 3T5HA 1VRQC 2NXUA 2K1RB 1HW9A 2J6UA 2F8MA 2R8JA 1NB2A 3MWBA 1U8SA 3HHLD 1OS5A 3OJSA 3GV5B 2YQ1A 4BWMA 1F2HA 1VDHA 3IN5A 1YQHA 3GYGA 3RU0A 2RILA 5GAGI 1X4GA 3OTOJ 5ETPA 3PYGA 4JI3F 4U8VA 2E1MC 1N32J 3V81A 1SIWB 3C66A 3M2RB 2IC3B 2HQCA 4UOGA 4DR5J 1JJHA 4N8NA 4ZVOB 4KPYA 3FQKA 2ZNZA 4X66J 1FRIA 1PG5B 1PAUB 2JFDA 2HLTA 2KDOA 5L46A 1NSQA 2CNKB 1NK8A 2HVZA 3V4MA 1FJGJ 1MU2B 3D6MB 2ASLA 4B17A 2DR5A 1HWIA 3CJTA 4P2MA 4OIXA 2UZAA 1RT4A 3QYYA 1EHWA 1RWMB 1U1KA 2BQUA 1IBLF 2HNDA 5DQGA 1HFEL 1X5OA 1RAOA 1HMVA 1FJCA 4IYQA 3EYZA 4YB1P 4DL0C 2DKOB 5D0EA 1T11A 4USIA 3GCXP 1OSDA 5F8JA 1YVFA 2EFVA 2RRBA 1E6YA 2WW4A 3TW0A 2C1EB 3EVWA 2AF6A 1EJ7L 2PGCA 2UXCJ 3GFYA 1REVA 3KLGA 2CQ3A 3OVBA 1RAJA 4ZVUB 3V6HA 4V19X 4ZK7M 3OVAA 5ETRA 4DUZJ 3CGIA 3KOAA 2BE2B 4H4MB 1Z1ZA 3TI0A 1H3DA 1D8YA 3AA8A 1KFSA 1I3OB 3M9NB 4TN2A 2HFVA 2FPHX 4I2PA 1WTBA 1AUDA 4A8XA 2P5VA 4M5HA 2DGUA 4WU3A 3SSRA 4HL9A 1R8AA 1EIYB 2UUCF 1TKXA 4HTIA 1IBKJ 4B3MF 5HMYA 2ZE2B 2OMLA 4P52A 1WD6A 5THWA 4RUCA 3O2IA 4G6VB 5AE3A 2MZTA 4I64A 3U1LA 2WBMA 4FYVB 4I4BA 1X4CA 3C16A 2RU3A 2LA6A 3IGVA 5HVHA 1LKZA 3JAMY 1H38A 1KHWA 3DU6A 2I2YA 2PD1A 4DR2F 4RLEA 5KFGA 4N8OA 4DN9A 2PI4A 3U1MA 1TV6B 5AJ3J 4IO9Q 5LXRA 5LMUF 3PIOQ 5KFLA 3Q8RB 3J81U 4P6QA 3RZAA 2VPWB 1FEHA 4H4KA 2JWNA 1U45A 2C2NA 3DRPB 3KJNB 1ZPVA 2RF2A 4NXNJ 3AOBA 5T7LA 2WZ1A 1FKOB 2ZC4A 3EICA 3K89A 6FD1A 4QW9A 3HP6A 1WNEA 1HIYA 3ZXWA 2D3O1 2MY8A 1K1QA 1YBUA 2X7IA 4MIAA 3TAMB 1XMQF 2XG8A 3RB4A 4WK1A 4M5LA 3H59A 4IG3B 2AYGA 2GO8A 2C3UA 4ZCMA 2GZOA 4ZP8A 1KQFB 3TZXA 1GFWB 4CO5A 1AB8A 1DURA 2O1PA 2ZZTA 3OXFA 3UR3C 2XCPA 3QGIA 4OI3A 1S99A 3B4DA 2QT7A 2MJUA 5E0OA 1NEEA 3F41A 4ZLNA 2HG4A 5DZ7A 4BDPA 3C15B 2Q66A 3W2VB 4C8MA 2BDPA 2VBWA 1LWEB 2XWXA 3M9MB 3R1HA 2ZVSA 4CH7A 2DHAA 1EZZB 1XTZA 3VAFA 1IKYB 3CCJS 4OHWA 3T41A 2YKPA 4P75A 4LBIA 4KQZA 3N79A 1LW0B 5E3QA 4DCOB 2VA3A 3I96A 3HHKA 2Y8YA 4XAKA 3BGOP 2RS2A 3MTJA 3PX0A 2YKMA 3KKFA 3N5FA 1N4LA 2FJWA 5GAHI 5B0DA 4RJVA 4PYAA 3G9CA 2MLXA 2Z2YB 2YKNB 4HTJA 2E1PA 4PXBA 4EBCA 1CC7A 4X4PA 2K8GA 1HBMA 3QWUA 2B6AA 1T9UA 3HJFA 3KMQA 5GADI 1BHNA 4PUOB 1HKAA 2Z2MA 5K8OA 1FNXH 4C3KA 4MYTA 3Q2TC 1U47A 1LOUA 2CPIA 4YY3F 4LF7F 4FVMA 1AW0A 2HWHA 3GMGA 3LGNA 4K5RA 2GMLA 4TQSA 4CQ1A 3PEHA 2V4RA 5H9FK 3CCWA 4DXLA 1JNZB 1HBOB 3THTA 3WQPA 2BYCA 4LFCF 2G1HA 3C3LA 3M8ZA 3OHBA 2UXBJ 2NPIA 4F3MA 3HFVA 1D3WA 3R5GA 2W2MP 2RRAA 2BJDA 1VLYA 5F41A 3Q24A 4B3SF 4ZP6A 4A8SA 4LF8F 2AZ1A 5AT1B 4DSIA 1JLAB 1BC6A 3W9HA 3LP1B 2WVDA 1ZM9A 3B4MA 2DNHA 2ROPA 3RAQA 3VGTA 4ZPWR 1NPPA 3LOUA 4E2FB 3HPOA 5HJYA 1T05B 3CD7A 2IRUA 1R0AB 2ACMA 1KLMA 4ZLJA 1WG1A 2QE5A 4TU8A 1VQLS 4OMFG 2W1BA 2FQQB 5ETQA 4HVZA 1S1TB 2VQEF 1X4HA 1TKTA 4WWSA 3GQCA 4Q0BA 4TQRA 4ELTA 1UCNA 1SB6A 1N6QA 3O1LA 1X8DA 1U48A 3BQ0A 1XBWA 2GX8A 4ZCLA 4RW8B 2YX7A 2F7VA 3CIMA 5KG2A 1U1OA 3N6LA 3NWRA 3K59A 1FKPB 4JI8J 4USWA 1NO8A 4UOCA 5DJBA 1MNEA 1NK4A 4EZ9A 3PCOB 3MR3A 3MM7A 1GTEA 4KC5A 3DRRA 4TYAA 3BR8A 1OQ6A 3AD9C 1N34F 1N36F 1JJ2R 3MD1A 2CQBA 4OLOA 2B9XA 4NLRA 3BGRA 5D15A 4ELVA 2R8HA 4C0BA 3S8SA 1GK8A 3PZPA 2WCXA 4C8OA 4C6AA 1F1BB 1WKLA 1U26A 2DHXA 4ZOSA 1FNMA 2FUG9 5A8KB 1NPRA 1RQ0A 1VBYA 4ZPTR 4PZVA 3GWCA 1KNZA 5DZ6A 1ZM3A 2XM3A 2K7JA 2YWWA 3R27A 3DU5A 3ITHB 3MM6B 4X4UA 3GG1A 3GFZA 2QMWA 3QQCD 1I94J 4Y00A 3ZFVA 9ATCB 3LGMA 2E29A 3NY0A 1DLOA 1IKWB 4R5PA 1LXNA 1RSCA 5L39A 2MLZA 2UV8G 4LF1A 2YWGA 1ZOTA 5FDLA 4LRBA 1MN7A 3R8YA 4CT8A 4OX6A 2DTJA 3CNQP 1OIAA 1V3RA 3KG1A 3I5CA 4NXMJ 1WI6A 4C3LA 4B9TA 3OLBA 1RTDB 2OFGX 2HK3A 3BQ2A 1ZM2A 3MCSA 1IBCB 1UEVA 1JQGA 5CQGA 4DHVA 4CWBA 2VU5A 3MDFA 1AZSA 2QLBB 3H2LA 1YG0A 1HWJA 2AU0A 4DUYJ 3LUYA 3N5BA 1FWLA 2QEXS 2MQ8A 3PFEA 4KV8A 1R8HA 3I6PA 2BR0A 2WW8A 3BYPA 1WC4A 4KRWA 5KFDA 2VFUA 1HMVB 4B3OA 3WZ0A 3FFIB 1LFWA 3SFGA 4P7TA 1FTCA 3KLHA 2HGNA 2G2ZA 5KFMA 2DYAA 5CZVA 1C0TB 4ED5A 2DNOA 4TU9A 1E6YB 3NCRA 4XTTA 3TZZA 1FKAF 4ANDA 4WXWA 3SI8A 3FRZA 1RJJA 2UP1A 4YEAA 2KVIA 1XK8A 1REVB 3KLGB 1L3TA 2EEYA 4DSKA 4K5SA 1NKCA 3S1TA 3DLKB 1OMSA 1RHUB 3TP2A 1WHWA 3GYXB 3T1YJ 1VRTA 4F26A 1R3NA 4OX9F 1EKRA 3EWGA 4ITSA 4IUFA 4X4SA 1Y4ZB 4IH7A 2RQKA 7FD1A 3Q8UA 1BUXA 4ETXA 4EMDA 1UZHA 3PO4A 5IV4A 4UY8T 6FDRA 5SZTA 4XK8C 3MEEB 1S4FA 2C2DA 1C2PA 1GMVA 3AJ2A 4L3KA 4K4UA 3IA0A 3GJTB 4BWJA 3TEGA 4EK2A 3GE9A 4R0JA 4QPTA 2R7RA 4NEZA 5AXLA 5K5MA 1T9VA 2GQQA 2AEFA 4F0MA 4ED3A 1WHYA 2W2OP 4RU9A 2DNNA 4DV2J 3L9ZA 4Q44A 2IYGA 2NYIA 5GAEU 3NS5A 4J9VA 4RW6A 4RX6A 5L38A 1S77D 4DSFA 5BYSA 2FC9A 3DGVA 4JI7J 1EP4A 3DRSA 4JP8A 2QLJB 2QIFA 1Q82T 3BO2A 3CJ8A 1UJ5A 1W2BR 2ADCA 4ECWA 4OYOA 5G0RA 2ZD1B 3ZZUA 3H2VE 4RW7B 2Z4PA 2RF2B 1T9TA 3K5MA 1VR6A 4JI3J 5T7LB 2KFZA 2JVRA 2YY3A 2WOMA 4ID8A 2RMLA 4K4XA 4N56A 3T1AA 4NLSA 4IDKB 2RQMA 2HMIA 4GVBA 1HA1A 1MMNA 4E0DA 4Y65A 4NI2A 2EW9A 1CQNA 2RU9A 5KFPA 2DT9A 3UNGC 1ZZNA 4IRCA 1ITPA 3JQJA 2WONA 1FTRA 1KDNA 1QVGR 1JXVA 3KFWX 1UW4A 3HHEA 1UJ6A 4S0MA 3HULA 1M90T 1WOPA 3G87A 2CQGA 5J2MB 1QAYA 5DDQC 4NLUA 3FEZA 3CIZA 1Y7PA 3CMQA 1X60A 1ZAXA 2OPPA 4NZ0A 5LM7E 3JTPA 3PM9A 3PXGa 3A8IA 4OYXA 2DBBA 3EXYA 3MEDA 1VS3A 4USTA 5ITHA 4YHHJ 3IC1A 2QLXA 2XO6A 4DV7F 1U1RA 2B7BB 1LW2A 4EUVA 2B8PA 2VD3A 2IVFB 4GKKF 3R6LB 4CT9A 4DV1J 3H90A 2W2PP 3IR6B 1CJVA 3SCKE 1R6VA 1K0VA 2CAJA 4OZ5A 3PYDA 2WVBA 3C46A 3G2XA 3G6VA 1UFWA 1N5YA 3K0JA 1REGX 3IBWA 5JUMA 2WSCC 3M32A 5KG0A 3HVRA 2E1AA 1FF2A 4X84A 4FYWB 5L1JA 1G6BA 2I38A 1ELOA 2QX0A 4NRUA 2N7CA 1VC6A 3LA0A 4LF5F 4QW8A 4JI5J 4CTAA 1K47A 2JOQA 4NL5A 3CCQS 2DK2A 4X62F 3ILJA 3CJ3A 4L74A 2KYZA 5F8LA 4CM2A 3R7SB 1NHUA 3BV8A 1OY9A 2DRBA 1DQ8A 5L9NA 3VHQA 3FBFA 5BYQA 2IM1A 1RT2A 4H4KC 2GMJA 2COLA 2OEKA 3BSAA 4ANCA 2KXNB 5LMUJ 3MR2A 2Q6CA 2DCUB 3LP0B 1RAFB 4U6PA 4XO0A 3EUNA 2OKQA 3L95X 2OPSB 2YPZA 3DOKB 3IBFB 1U8WA 3FNNA 4OJ3A 1LWXA 4DV0J 2FVSA 1IVZA 1KLMB 2K2PA 4U9RA 4DDFA 5F8MA 4YOEA 3W3SA 2DNGA 2HAFA 3K58A 4LR9A 2M52A 1MW7A 5FD1A 3PJ9A 1S0MA 4CO3A 1TKTB 3Q8QB 2CADA 4GC7A 4MIWA 3ZNJ1 3SSQA 2C3YA 3IG1B 3KUGA 4L75A 5KG7A 1KQKA 1F60B 5G4DA 1N6QB 3NAIA 3H0PA 5DDPC 4DL6A 1VC5A 1UPPA 2CJBA 4PQUA 3UFCX 2J9EA 2BOPA 5DETA 2CQDA 2M88A 3SFUA 2R7WA 1XMOF 3QJJA 2V69A 2DXFA 3IBCB 5KG6A 2IVYA 3VALA 1N56A 4ZVPB 4YR0A 4DQRA 4KKOA 3MR5A 2PN6A 3CVKA 4KGXB 4HLBA 3DYAB 3MM7B 1HHSA 4YS2A 1WKKA 1L3VA 3DRRB 3LWMA 4EGLA 2B8QA 1IKVA 1S1UA 2R8KA 1RTHB 1F9HA 1RKJA 4JYAF 2D9OA 3M8YA 2XI2A 1NH7A 1QTMA 1RCXB 1ZA1B 3FMBA 1WHVA 1HQUA 5CH7B 3BGRB 3EGWB 1N8RT 4GMKA 4DLEA 4NLDA 1NSAA 2FYXA 1DRZA 1MWZA 2GVZA 1OYDA 3ZC4A 5D78A 2UUWA 2XI3A 1WWHA 1OO0B 4PAAA 5IC4B 3HX9A 1T94A 4WZMA 4I2QB 2XLJA 4DS4A 1U0HA 2UVRA 3ELHA 1SC4B 2IBKA 2LP4A 3W5ZA 1B4SA 5DQIA 4I6AA 3KK2B 3JYTA 3DLBA 1FXLA 4OLPA 3MF5A 3FBEA 5C25A 1CJKA 3DI6A 4RO0A 3NGKA 3C14A 2G4BA 5CAAA 1VIXA 3F73A 3J7YU 3J7ZT 5HANA 1RT7A 3DLEB 3NGTA 4RNNA 3W66A 4WTYA 3MGJA 1XNRJ 3VGSA 1DLOB 4R5PB 3QRRA 1LNQA 3RR7A 4LFCJ 3NOGA 4OYWA 3BN4A 5I3UA 1SH3A 2FHOB 1FXRA 2QSWA 5EX0A 2ABYA 2V0NA 3R6GB 4B3SJ 1PBAA 4ZCIA 2Q1LA 1GTHA 1YJRA 1NRKA 4QZVB 5B09A 4X2BA 2MYFA 2BJ9A 4ZA1A 2GIFA 5C24B 5IWAF 5RUBA 3OTCA 2PMHA 3OFGA 4ECQA 2MSTA 1A7GE 2BE7D 3O44A 4O0IA 1KBRA 4OZ3A 3M8WA 4BBYA 5BR8J 2X1FA 3JTNA 1VQOS 4V1Ak 3JAMU 2RDJA 4LREA 1AZSB 3ET6B 2NCKL
chains in the Genus database with same CATH topology
5IT9Y 3G6YA 3HHLA 3KNGA 4ED6A 1VQMS 3Q23A 4ICLB 1WF0A 4JI4F 3SSSA 3SMZA 1X4AA 3MPWA 2EI5A 3EZ5A 2B0GA 1FDNA 1S6QA 2K3KA 4CZCA 1NB7A 2B9YA 2CQ0A 2FLLA 1UP1A 3R5AA 3CCSS 4OHZA 1XNRF 2KH9A 5A8KA 1HYSA 4WFNQ 2RQ4A 4KV8B 4QCLA 1G1XA 3QGGA 3VAIA 1XR7A 4LSNB 4QWBA 4LQ3A 2CQCA 5KT7A 3NS6A 4O3NA 1LWCB 1RI7A 3KLFB 2I8EA 2WHOA 5L1LA 4GKJF 4EBDA 2EBEA 3POTB 4FBTA 4DFPA 3MZIA 3OLAA 4R8UB 2FDNA 1S1WA 5EDWA 3E01A 1U4BA 2CQHA 4CH1A 2WSEC 1FCAA 2VKRA 4O23A 4BC7A 3OHAA 2XHWA 3KLHB 1LV5A 3RRKA 4PWDA 4KAIA 1QSYA 1WEZA 5KT3A 2PT0A 2B5JB 1HBNA 4WFXA 1R8PA 3D1OA 3KG4A 4OZNA 4R0EA 5DM6Q 1R8CA 2KJVA 4I69A 3JB9k 4LF4F 1GT8A 4I0WA 1D0EA 1KD1T 2I1RA 2MKCA 2LQBA 2OP5A 4EEYA 4DV2F 4WJBA 3K5PA 2M70A 4QJVA 4CIOA 1MWYA 2BE2A 1IJFB 3GR1A 4Q2MA 2HZCA 3M2UB 5D4PA 4M5DB 4QIVA 4DL2A 1UEUA 3IGNA 3CMAS 4A8WA 2ZH7A 3DDKA 2QZ8A 4PPDA 3QIDA 1T03A 2FHMA 1FD8A 4J37A 4RBUA 2M4MA 2YNIB 1D1UA 3T5HA 4A4JA 1KQGB 2NXUA 2XMWA 5HROA 3MEGA 2MB0B 5HP1B 2K1RB 1HW9A 5CYMB 2J6UA 4FNIA 5C25B 3HI9A 3V4IA 4E98A 2F8MA 1X4EA 2LXIA 2R8JA 3MWBA 1Y9OA 1U8SA 3JSBA 4CO0A 3HHLD 2GFFA 5LJ5Y 1OS5A 2ZH6A 3OJSA 3GV5B 2D1CA 4IOBA 4EWTA 2J9DA 4BWMA 3BO4A 4ECUA 3IN5A 1JLQB 1YQHA 4HKQA 2HHWA 1S6OA 2V4JA 1I1GA 2GQCA 1KQSR 3K59A 1SJ3P 4WYWA 2E66A 3RU0A 3MOJB 2RILA 4CH0S 5J1PA 1YWXA 2EK6A 3OFFA 4AYBD 2ZE2A 5BR8F 2DPJA 5GAGI 3O3LA 1TVRA 3MMJA 3TRGA 1X4GA 3K7RA 1V3ZA 3OR1B 3BF4A 4D3GA 2IAJA 1JWWA 5EHHA 1RT1A 4F25A 2DNQA 4DWIA 4NLGA 4OI0A 4C3MA 4V19J 2J0WA 3KHGA 3IO1A 2KO1A 4JI3F 4W90B 3B78A 1U1MA 2E1MC 3V81A 1SIWB 1FDBA 1JKHB 2GQ2A 2RVJA 3C66A 3M1VA 3M2RB 2IC3B 4WFYA 4DSEA 1VBZA 2LU2A 1NH8A 1C4CA 1TZ0A 2YVSA 4O3OA 2FLPA 1FNOA 1JJHA 1JMTA 3L7PA 4JI2F 4N8NA 4NCBA 2MZQA 4KPYA 5I3UB 3KHLA 5B7WA 1IQTA 2JH3A 2POKA 3RAMA 3KK3A 4DLGA 1P27B 3FQKA 2CQIA 2ZNZA 3GZ7A 5KFWA 5HBMA 1JLFA 1NZAA 3OXGA 2N3OA 2N4CA 1FRIA 2J6SA 2JFDA 2HLTA 3OTEA 5LJ3Y 2FD2A 2IYIA 2KDOA 3J80Y 3J81Y 2VC0A 2XMKA 3X1LB 4NLQA 1UJ4A 2ZJRQ 3OL8A 4WFZA 1SKRA 1TK5A 4F4KA 1NK8A 2HVZA 3IWXA 1T95A 3GYNA 3GIJA 3H5YA 4IQXA 4JI1F 4ETZA 1A9NB 5KTQA 1UWBB 1VQNS 3LP2A 3V4MA 2DGVA 1MU2B 3VCDA 2DITA 2QV6A 2ZH2A 4RW6B 4WU2A 1SUQB 3NMRA 2C22A 2ASLA 4Y2MA 4F50A 4NLVA 4ECRA 2LEAA 3HF5A 4B17A 5KFFA 4A8YA 2DR5A 3NLCA 3ENVA 2MXYA 1JLBB 5DLGA 2Y1RI 2YWKA 5IXUA 2L08A 3DM2A 2PO4A 2I0XA 3BREA 1HWIA 2ROGA 2VZ9A 4N5SA 4OHYA 1HI1A 1ZBTA 4OIXA 3GR0A 1SV5B 2UZAA 3DRSB 1RT4A 3DRPA 3QYYA 5JVGQ 3F56A 4NCAA 2HHXA 4NWBA 3VZHA 4TLQA 4ZCKA 3TUJC 3C6UB 2XWYA 3BEGB 2KM8B 1FKOA 1Q8LA 2CPHA 2BQUA 1U1KA 5KFKA 1U1NA 1IBLF 2X1GA 1Z2ZA 4HH1A 2B3TB 2HNDA 1T3OA 3TNVA 3CF5Q 5DQGA 1HFEL 3OSNA 3ENQA 1VRUA 3K2YA 2HWTA 5GAEI 3MEKA 4KT0C 3NGDA 1X5OA 1IXKA 3HK2A 2KI2A 2IMWP 4Y2AA 2LU1A 1R43A 1U6ZA 2BM0A 2UXDF 2EFOA 3MAHA 2RQCA 4WF9Q 1HMVA 5FLXY 3HHLB 5E3RA 3KMSA 2YWFA 1FERA 3CDBA 1FJCA 1Q8IA 2WOMB 2VFRA 2XULA 4OX8A 4IYQA 2XNRA 2V8HA 3EYZA 5F9NA 4YB1P 4DL0C 1Y5IB 3S01A 4IG3A 1LWFA 4NX9A 1OPIA 3TQ1A 2V4QA 3OTOF 2GIRA 1HYSB 1RISA 4NLYA 2YNHA 4USIA 2IMOA 1OSDA 1FRLA 4OI2A 3BSNA 4DQPA 5F8JA 1FHTA 3CCES 3PEJA 1N5QA 1U6FA 1YVFA 3N4WA 4MKAA 5CYQA 4IFYA 2EFVA 5KFZA 3UDLA 1VK8A 2P9GA 2PI5A 1SJRA 2RRBA 1Z2LA 4ECSA 1E6YA 2E9RX 3KHRA 3EGNA 1M1KT 4C0HA 2D9PA 3I82A 2MZRA 5MLCV 2GV1A 3E01B 3TW0A 4DR5F 3RRHA 2AF6A 1CEZA 1S9EB 2PGCA 4A46A 1HBUA 2DISA 3OSPA 3GFYA 1REVA 4ZPVR 1VIOA 4DPOA 4YMEA 3KLGA 2CQ3A 2CJQA 3KYLA 4PWDB 5GMKa 2CPJA 5EWFA 4X4RA 2EPIA 3OVBA 4X66F 1RAJA 1RKIA 3PW5A 5JVHQ 3AJ1A 5AE2A 3V6HA 4V19X 2W9BA 2HAIA 3D1QA 1IJEB 4ZK7M 3CD6S 3OVAA 4C8NA 2ZHAA 2WONB 3CGIA 2BW2A 4RU2A 3KOAA 1SBRA 1L5UA 4GC6A 2KZZA 1TKZB 1W25A 4F3QA 1E6VA 1LWEA 3PW2A 2BE2B 2HWIA 4H4MB 3D5MA 2L41A 1D9FA 1QVFR 5EN1A 1Z1ZA 3T9NA 2XLKA 2L9WA 4ZLPA 4WCEQ 2M0GB 1D9DA 3TI0A 2DGWA 1H3DA 1D8YA 5C42B 4DR4F 3AA8A 2IJFA 1T03B 1YSJA 2VBYA 3CCUS 1IKYA 1GNKA 4Y0FA 5HROB 4CI0B 1TK0A 1KFSA 1MMLA 2AYMA 2BXJA 2YNFA 5DLFA 4Z2XA 1F5BA 3G8TA 1T3NA 3NKYA 1KTVA 1LW0A 3M9NB 4TN2A 3THVA 4B9NA 1AXQA 3LQVA 1R8BA 3QO9B 3QAEA 3FMWA 2FPHX 5K8MA 4J9OA 2KU7A 4I2PA 1WTBA 4ED0A 3IR7B 3LANA 1AUDA 2O3DA 4A8XA 2P5VA 2PFFB 2DGUA 3O5TB 4WU3A 5E7OB 5DDOC 1N52B 3DOLA 3SSRA 3I0RA 4GO7X 1HWUA 4HL9A 1Y5NB 1R8AA 3AB4B 2UUCF 1TKXA 2N4DA 4HTIA 4MTPA 4B3MF 5HMYA 4NA3A 2ZE2B 4KIAA 3TYTA 4F2RA 4URGA 1RA7A 1TVRB 1S6UA 2OMLA 4ZP9A 1N48A 2YKNA 2AYEA 5FJ4A 3Q0AA 1VFJA 1WD6A 5THWA 5IM0A 2IAJB 2MJNA 3BSCA 4RUCA 1RT1B 3M8SA 3O2IA 4G6VB 3EPIA 3B8HA 2EC0A 4NOHA 5AE3A 2MZTA 4I64A 3U1LA 1FRXA 2FJBB 4NLTA 3V81B 4FP9A 3PR4A 3M1VB 2WBMA 4UUWA 2AJ0A 3MEDB 1X5SA 5KFNA 1YITS 5F8HA 4I4BA 2CJKA 5HLFA 4DX8H 3H2UB 1TAUA 1X4CA 2AV5A 1HNVA 5F0UA 4B08A 2RU3A 1PILA 2LA6A 3DRXA 1RTIB 4NYZA 3IGVA 2XGQA 2IVMA 2DR7A 2B51A 1LKZA 1RT6A 3JAMY 1H38A 2VOOA 4JI0F 1KHWA 2J8AA 3CB4A 3DU6A 1LW2B 4Y3CA 4Q2LA 4MFBA 4PUOA 3R5BA 1JLFB 2I2YA 2PD1A 3JSYA 4DR2F 4RLEA 2Y0SD 2QRRA 1WEXA 3HVTB 5KFGA 4N8OA 4DN9A 5KOXA 3U1MA 2PI4A 1RK8A 2EFGA 1TV6B 4J9LA 1KSPA 1S9GA 2NQPA 3LP2B 1J5OA 3A8EA 4PG7A 5D8HB 4IO9Q 5LXRA 5LMUF 1ZZFA 3SCIE 2VPXB 3NRBA 4YQWA 3PIOQ 5KFLA 3Q8RB 4WXOA 3MECA 1N5YB 1ZH5A 1G3OA 5F3TA 4P6QA 3J7A1 2VODA 1LK5A 2GW8A 3DM2B 3M32B 2PC6A 3RZAA 2VPWB 4PG5A 1XN9A 3TR5A 4DMZA 1FEHA 1HBOA 4H4KA 2JWNA 1HARA 1KFDA 1RT4B 3DRPB 4QWDA 3I55S 1U45A 3KLIA 2CQ1A 1ZPVA 2RF2A 2ILYA 2W9AA 4JV5F 1SL2A 5T7LA 4DFMA 3BDPA 2ZC4A 1FKOB 2W8KA 1X4BA 4Q5VA 2KFNA 4Y2CA 6FD1A 4RW9B 1S1VA 2HNDB 2EG2A 5E3PA 4QW9A 3BR9A 3ZZYA 3DCAA 1K9MT 4OZ1A 3HP6A 1WNEA 4PG6A 2OJ3A 4CTAB 2I9SA 3GIMA 4YFUA 1UL3A 4K4VA 2FJDB 2AW0A 2MY8A 1K1QA 3M30B 1NJXA 5A2QY 4MIAA 2QLWA 2AJ4A 3TAMB 2VBXA 1OQ3A 2KJWA 1XMQF 2XG8A 3RB4A 1IBKF 4WK1A 2RDIA 2EBGA 1X5PA 1QM9A 3H59A 4L3NA 2R7SA 4IG3B 1LWFB 3G4SS 3U27A 1C1CA 2RSQA 4UY85 1HW8A 1HWLA 3DLJA 2AYGA 3D1HA 2Q79A 4TY8A 2GO8A 2C3UA 4DR7F 4ZCMA 4X4TA 3GSDA 3TOQA 4KHRA 4ZP8A 2CPDA 2OLWA 1KQFB 4CO5A 2KM8C 1DURA 3G6XA 3RB0A 2J0QD 3CPWR 2O1PA 5T41A 2M7SA 2W25A 3OXFA 1LXJA 3MTKA 3UR3C 2VC1A 1DTTB 1JLCB 3KJVA 1O51A 2XCPA 3QGIA 3G71S 1T05A 4LMZA 2LMIA 2VH7A 4USJC 4Y28C 2FC8A 2D3ZA 2EKYA 1HBUB 3M8QB 4OI3A 2JLFA 2YTCA 2ZJPQ 1S99A 3B4DA 1S0VA 4QIGA 1K1SA 2QT7A 2MJUA 2XSJB 1R0AA 1QJHA 5E0OA 4O3PA 3EGZA 3HHLC 1NEEA 5AE1A 2RS8A 1RGVA 3F41A 4K4ZA 2HG4A 1SJ1A 1PC5A 2AGPA 1YBAA 2W9BB 2FHJA 1IKXB 3O8WA 4BDPA 1ROFA 2Q66A 3W2VB 4C8MA 2BDPA 2VBWA 3CSKA 1NKBA 3G8QA 1HQEA 1LWEB 2P9EA 2XWXA 3MM5A 3M9MB 5FIIA 3HM9A 3R1HA 4AL5A 3VTIA 2ZVSA 1QUPA 1S1TA 4CH7A 4RNMA 2DHAA 3UWTA 3DOMA 1XTZA 2X3GA 4L72B 3MD3A 3VAFA 3IAM9 1IKYB 1X4FA 2MZJA 3CCJS 2UVWA 4PG8A 4OHWA 4QIWD 2OTJS 2YKPA 4B9MA 2YNFB 2MHNA 1NJWA 5HN0A 5DGBA 2DVIA 4KQZA 3N79A 1LW0B 4E8UA 2J6TA 2B4VA 2LQJA 1P1TA 5E3QA 5SUHA 1KRPA 3I96A 3KWMA 2VA3A 3HHKA 3RTVA 2AX0A 2M3DA 4F4ZA 2OTLS 4XAKA 4I2PB 1S6PA 2JJ4D 5A8WA 2FVRA 3NNHA 3CCZA 4X4NA 2RS2A 4WFAQ 1FO1A 4FF2A 1Y3KA 3MTJA 3GIKA 3PX0A 3LO3A 1UA0A 1N5SA 2YKMA 4GO5X 1RYRA 3DFEA 2P6TA 5KFRA 3KKFA 3N5FA 3MUVP 3DOLB 4RW8A 5B0AA 1N4LA 1U25A 1M5OC 4BHQA 4QYZJ 2FJWA 2HPUA 1TL4A 3GG0A 1L3SA 1TKXB 3OTBA 3SDEB 1HI0P 5GAHI 2JRSA 5K8PA 4DF4A 5B0DA 5LMNF 4DV5F 3QLHA 3G9CA 3SEOA 1SL0A