2OUGA

Crystal structure of the rfah transcription factor at 2.1a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
141
Chain Sequence
b'QSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYKKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator rfaH
molecule tags Transcription
source organism Escherichia coli
publication title Structural basis for converting a general transcription factor into an operon-specific virulence regulator.
pubmed doi rcsb
total genus 29
structure length 141
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2ougA00
1M1HA 2K06A 2OUGA 2LQ8A 1M1GA 3EWGA 1NPPA 1NZ8A 4ZN3A 3LPEA 3P8BB 1NPRA 4ZN1A 2XHCA 3QQCD 2EXUA 3H7HB
chains in the Genus database with same CATH superfamily
2UVVA 4M5DA 3LWLA 4C6AA 1T0TV 1LWEA 2W9BA 2WONA 3MEEA 2ALYB 2CJYB 4JI0F 3R2CJ 5JXSA 5JVHQ 1RWMB 2JZ5A 4C11A 2YNGB 5CYQA 4HYKA 1NKBA 3TVZA 2V8PA 2DK2A 4YP3A 3CJRA 3V81B 2KL8A 2DYAA 3EVOA 1S0OA 4HACA 1Z2LA 2PO4A 1J5EF 2FB0A 2VA2A 4JI1F 1QTMA 4ICLA 1VI7A 5IQ6A 3NOCA 4ZLNA 3PR4A 5L1LA 5HL7Q 2VG5B 2WVDA 2QTWA 4FBTA 3H5XA 2ZOGA 1TKZA 2CUYA 2D69A 3VZIA 2AYEA 4LF9F 3FMBA 1RHUB 4I2QA 4O3OA 2OTJS 3KK1B 3FCWA 1VIXA 2C2KB 2XMUA 1Y5NB 1FE4A 3N9UC 4KHRA 1NSQA 2XC9A 3KK3B 3H25A 1X0FA 1HNZJ 1BWEA 4URQU 3U02A 1U7LA 3DRPB 5D4PA 1JLQB 2RVJA 4TQRA 2W9CA 1VC6A 3LALA 2KJVA 3W1YC 3VGSA 2W9CB 3V6DA 1H72C 4PR6A 5HROA 5EUHA 1M1KT 4MFBA 4JV5J 5IWAF 4IRDA 2QE5A 1TL1B 4Y2MA 1R0CB 2B5JA 4NA2A 1C4AA 1EB0A 1N5YB 3ISND 1V5IB 1JK9B 2BJ3A 4DZDA 1S1UB 1OYEA 3KWMA 2W4CA 1ZM4A 2RS8A 2WONB 3MEEB 1RDRA 5G4DA 1X4AA 1HI0P 3AQPA 4UUXA 2AJ0A 1Y0HA 4QIVA 2QA2A 3A3NB 3VF0B 2J6SA 2R8GA 4U7UD 2OSRA 4A48A 2NXCA 5LJ3Y 1D9AA 1HMVA 4JI4J 3W3SA 3V81A 3GONA 3W2WB 5DLGA 1U1OA 1UWBB 2BEFA 4RW4B 4F2RA 3I82A 3DLHA 3NAHA 1BQNB 1H7XA 2B7BB 4USHA 3CULA 2OPRB 3ZTQA 2V8GA 3M7VA 2LXUA 4FYYB 4DFJA 3MM7A 4N8OA 4K59A 3ULHA 1ZPVA 2MKKA 2XB2D 1G7CB 3SQOP 4YY3F 3FQKA 4C3KA 4RNFA 4USTA 1MN7A 5A8WB 4CYUA 2CQ2A 4F36A 3T5JA 2J9DA 1ZAVA 4PKDB 1HPZB 4AUKA 4F0HA 3P96A 2G1DA 1F60B 4IYQA 5J2PA 4P7VA 3LGHA 1K9MT 5C2CA 1T9XA 1LQ9A 1VGYA 3ADAC 4Q0BB 5D77A 4I2PB 4QR0A 5H9FK 3OVBA 2XZTB 1CJVB 5AJ3F 3M30B 1RTHA 2XMMA 3GYNA 4KY3A 3SCLE 1LV5A 2M52A 3GCXP 4DSIA 4WF9Q 3LF0A 4ILLA 1RB0A 2AV5A 5K9FA 4WJBA 1PIEA 1ZS6A 3DYAB 4HR2A 4JI8F 3W2VA 1S1VA 4NYPA 3WX4A 3CCRS 2UU9J 1KWMA 3H2UB 4Q2MA 4YN3B 4QYZK 2X3DA 3S6EA 3RB6A 5ETTA 5B0CA 4QU6A 2JJ4D 2VG6A 5HLFB 2CJAA 3U1NA 4U8YA 4CDIA 2HHVA 2V4RA 1FVSA 3POTB 4ED1A 2UUCJ 4A8KA 3H59A 3EPIA 1U1NA 1IKYB 2H4YB 1O6XA 4IOAQ 4EYHB 3KLGA 2M3DA 3NG8A 4IG0B 4J9UE 4GC6A 1RAIB 3IC1A 3PIOQ 5ITHA 3J7Z5 1IKVA 5L1IA 1ZM3A 5E3AA 4LFAF 2DGWA 4OYIA 5C24B 1Q95G 3FBBA 2AYMA 1NKCA 1S57A 4O3SA 2C2MB 1YJ7A 3BBBA 3CCWA 3P5TL 4P2MA 4QR1A 4X4VA 4B3SF 3GIJA 2DY9A 3MMCA 1RQ0A 5KG1A 3NBPA 3KG1A 3ZTRA 1NB2A 4QU7A 4K7QA 2KU7A 2JNJA 1U6ZA 2VU5A 3ZZRA 4CIOA 2BM1A 2HEKA 2MJNA 4J90A 3SFGA 4QIEA 1FJCA 3GILA 2X1AA 2WW8A 3QLHB 3TJ9A 4Q0BA 2DHXA 4FYWB 1N5QA 3B54A 2VKZG 1CJKB 1FTCA 3JAMU 4OI2A 4IO9Q 5K8NA 1GAOA 5G0RA 5LJ5Y 2E1CA 3M05A 5CZVA 2HW3A 1JX4A 3GG0A 2HFOA 4TN2A 1TELA 1Y7PA 3L4BC 4V19X 2IM0A 4IG3A 2JDJA 2VG7B 3KHGA 1RISA 1A7GE 3SIPB 2RU3A 1RGVA 5KFTA 3OXFA 1OMSA 3IN5A 2R2UA 4ECSA 1BC6A 1FX2A 2JEJA 1DTQB 3PEJA 2L9NA 3RYLA 2NLWA 1NDCA 1C0UB 1LXJA 3A1YG 3QIPA 1GX5A 4ZJLA 1GXUA 3WC0A 3HP6A 3LOUA 4K4YA 4NYOA 1QAIA 3EWGA 3R7BB 1VQ4S 2GVZB 2HWIA 2OPQA 1MU2B 2OD6A 3H4DA 4F50A 4FS1A 1NM2A 3DCAA 3PCOB 4IKAA 3GR0A 4P72A 4MKVA 3PX0A 1NSAA 2EWHA 3DM2A 1WOSA 1RT3B 1VQSA 4J9LA 2YX1A 2MQQA 4ES2A 2G4BA 4USKA 3MR6A 2O66A 4Q44A 3DDNA 4IH6A 4U7UK 3DLEB 3GIKA 1BMQB 3GV7B 1GT8A 2JWNA 2HK3A 1VK3A 3W8PA 2N7CA 2JEFA 3TUPA 1N0UA 2OFHX 3IBFB 1Q78A 2CJ9A 1UJ5A 4QW9A 4FF4A 2IBOA 4RL1A 2QIFA 2JSXA 2B5JB 4ECZA 2ASDA 5CYMB 1FJEB 1RBOB 1UETA 2FHOB 2VF3A 2YNHB 2KZMA 5KFRA 4CT8A 1S7IA 5L8RC 4X4QA 1RTDA 2F63A 2COLA 2DB1A 3NS5A 4DR3F 3M4XA 4LR7A 2FTRA 1HBMB 5D0EA 1X8DA 3CJTA 3MZIA 4QCLA 3JYTB 2M70A 1FFGB 3I96A 2XLKA 2KRBA 2MEWA 3QPIA 4OYMA 5AE3A 1IJEB 3PTWA 4RNHA 1U0SA 4RW4A 3C15A 4D3HA 5A76A 4YHHF 2YQ0A 2EC0A 4M63A 3JSMB 5I42A 2Y8WA 4MT1A 5FJ4A 1DURA 5AXKA 5IXUA 1FNXH 4RW7B 1Z4UA 1FD8A 2MZQA 7FD1A 5KFKA 3L7PA 4DL6A 1NCLA 4OX8A 3SQGB 4LVNP 3V4IB 2Q3PA 4ANDA 4ED7A 3R6LB 4U67Q 3CF5Q 5H9EJ 5GMDA 1FKPB 2A2CA 3W9HA 2I2YA 4LF4F 1M0SA 1FA0A 2QLBB 1R8PA 2E1PA 2LQ8A 5D15A 3AXKA 3UR3C 2J0QD 3KJQB 1JLQA 5KFOA 2DGQA 5ETPA 1AUSL 1RT4B 2C1EB 5HROB 2VUGA 2BW7A 1N88A 4OX6A 2POKA 4WE1B 1RWWB 4NLDA 5DG9A 2AT1B 1I94F 5LXYA 3P45B 5DGBA 2R2RA 2DNYA 2Y9HA 1L3UA 2C2OB 5D0GA 4PXBA 2V94A 1CC7A 5IC4B 4QBUA 3T1YJ 4LMZA 2UXBJ 2DHSA 2BQUA 2JC1A 4FN5A 4ZPBA 1S1UA 2V8DA 2CRLA 5B0DA 2DO0A 3TAQA 4N5SA 2ASJA 4RX6A 1KTQA 2DNQA 4TLRA 3MMBA 1P9QC 2MZ1A 4DV0J 4ATNA 1ZETA 1HBOB 1HL6A 1L3KA 1S1XB 3BGOP 3CIMA 4OI6A 2ZM6F 1M5HA 3SCJE 3TANA 4ZDNA 2IM2A 2KI2A 2V50A 3JQKA 4H4OB 1CS4A 3DDKA 3Q86A 2YPYA 1PKUA 1UCNA 4P2FA 4USUA 2GNKA 2LP4A 1NH8A 1H2TZ 3FBEA 5CD4A 1ZOTA 1U09A 2V2ZA 1LWEB 1F9EB 4NCGB 3PIPQ 1V5VA 3HVTB 3GJRB 4FDFA 4IG3B 1B99A 1FKPA 4X65J 1VQ5S 4DR6J 4MAKA 2HZAA 1T05A 2R7TA 2E66A 2B4VA 1I51B 2RH3A 1JLEA 1S9GB 1WHWA 3HHEA 5IOLA 5F9LA 3T5LA 4Y34A 1TQLA 5LOQA 2I5JB 1KHWA 2RKIA 2XWYA 2B9WA 3E01A 2VBWA 2N4DA 4HVZA 2MQLA 1FTRA 1QJHA 2HNYA 3C66A 4WCEQ 3RB3A 2MGZB 1RE1B 4XDDA 3IRXA 4GVLA 4LR9A 3X1LB 3OHBA 3W7BA 3PHTA 3VVTA 4DI6A 2FVQA 2G0CA 1RABB 2E9RX 4F4KA 4RUBA 3NBPB 1B4SA 5EWGA 3HI9A 3GB0A 1WWHA 1YJVA 1YLXA 3CJ0A 1VC0A 4HT7A 1GFWB 1MWZA 2W2OP 4BWMA 2Z56B 3BDEA 2X1FA 4DG1A 3KLEB 4R0JA 2RDIA 3ZTPA 2WBMA 1IWGA 2CA9A 4AL7A 2DNMA 1XC9A 4FNIA 2YWFA 2ZKUA 2J6TA 4ZLJA 2V4JB 1VDHA 3F56A 2BE9B 4P6QA 5E3QA 3RR7A 3DOKA 3NNAA 2CIMA 3SYZA 4LQ9A 4WZQA 2F9DA 2QMWA 2DRDA 3B6BA 3HJFA 1AT1B 2E9ZA 2HHSA 4EZ9A 4DR7F 5D6GA 5D0HA 3OJSA 5F8JA 1YWXA 2BYCA 1HLWA 2HZCA 3S01A 4KR0B 3RBXA 4KKOA 5GADI 2VB6A 3ITHB 4ZPTR 4A8SA 3KLHA 4JI2J 2BW2A 1HWLA 5K8PA 3M8QB 3UN3A 1PC5A 2HVDA 2PA8D 3PDNA 3MCSA 1RP5A 2IRXA 1KLNA 3G82B 1RJJA 4NLUA 2NXEA 1RTIB 3VTIA 2J9CA 2CQCA 4CO4A 1Y3KA 4X4TA 4URGA 2CNOB 2WZ1A 3F44A 5IM0B 2ZH4A 2B4OA 3OL6A 4WP8A 2IC3B 5K14A 1URNA 2AQ4A 3PYFA 2M8DB 1CEZA 4JI7J 2QL5B 3N6LA 2LDYA 1NEEA 3M2RA 4HTJA 2DPIA 1FWKA 3EVWA 2QO3A 1S9EA 3DU6A 3IGVA 1HQUB 1Q8LA 3CW2C 1S49A 4FKYA 1UJ4A 2PMHA 2VQEF 4ZIVA 4JI1J 3M8YA 3JB9k 3C6UA 1WC3A 1UVIA 3ENVA 3IM8A 4FXVA 4DPYA 1HBMA 2ABYA 1NJIT 3SCKE 2ZUAA 4I1TA 3UFCX 2GHWA 1NK5A 1IKWB 1KQFB 2ZWPA 3EVMA 5BJRA 3OL8A 2DEIA 4R0EA 1S4FA 3SV4A 3BH6B 1RAGB 2AKWB 2HNDB 3WZ0A 3LP1B 3MM7B 1F1BB 3R5DA 3LP0B 4CQ1A 2CQDA 3A3PB 3KLIB 5H9EK 5D3GB 2PE8A 2FZGB 1NJXA 4KPYA 4K4UA 2ZH7A 1JXLA 1VJQA 4PQUA 1UW9A 3ZZPA 3RBEA 1OY8A 4DV1F 4IUFA 4GO5X 2IJRA 2XMVA 1L3SA 3H0PA 1MSWD 5E3CA 1U1LA 1RA7A 1BUXA 2ILYA 5I3UB 3MHYA 2H9ZA 1RT7B 3DLJA 1CBKA 4HH0A 1B70B 2PSZA 2KB2A 4XK8C 2VJVA 1OY9A 1REVB 3LAKA 2FC9A 2Z0GA 3DFEA 4IQMA 2O3DA 4CLZA 4EFAC 5KFDA 3VAGA 1EIYB 1HWIA 3HZGA 3QZ7A 2ZBRA 1TKDA 1D8ZA 2D3UA 5KFFA 2H5JB 4I6YA 5FIIA 3FFIB 4DXLA 3BQ2A 2KTQA 4M5GA 4C9DA 1IM4A 1V3SA 3T3FA 2HIQA 4I4BA 3GFHA 2A0FB 3CJ2A 5CCLA 1AROP 1FKOB 1X5OA 4Q43A 2D9OA 3AQOA 1ZPWX 4CH7A 2KKHA 5F9NA 1I1GA 3HT3A 2HG4A 4WTOB 4TU7A 1WELA 2QV6A 1JLBA 5EX0A 2XI3A 4CI0B 2RT3A 1RWPB 3W9JA 3OSNA 1AYEA 1FRIA 3CC4S 3QYYA 4F3MA 2WVCA 3CCUS 3IAS9 4J5OA 4CH1A 3CNQP 2XNRA 1KHVA 1YBTA 1S9GA 2BDPA 4PWWA 3M2VA 2LQ9A 3MM5A 1F9HA 4X66J 3BGRA 1VQ9S 3I0RB 2R8IA 4KHPJ 2BVZA 3MTJA 4GVBB 1SKSA 4Z2XA 2D41A 3JTOA 5GAGI 1XMOF 5IT9Y 4U9RA 3OFFA 1HARA 3I4PA 2VJUA 2VFTA 4QPXA 3PV8A 2HFNA 2M7SA 4USMA 1XNRF 1REVA 3CMES 2CQ1A 1R7IA 2R7SA 2DKOB 3R97A 1XR6A 4C8YA 2CADA 5DQGA 5DRKA 3J80Y 1G3OA 1WSVA 4B9MA 3CD5A 4B9VA 1BQMB 4KYZA 3T1HF 4Y2AA 1IQZA 3ISNC 5THWA 5LMNJ 1WKKA 2DNRA 3ONQA 5AT1B 3B4DA 4ZVSB 3TA2A 4MJKA 3TAMA 3FNNA 4IG0A 5KFCA 1VQYA 3UD5A 5J2QA 5LSRA 2ZITA 2MLXA 1IKYA 2GX8A 1B7FA 2DITA 4LRCA 4JYAF 1JLAB 2LXIA 3IFEA 2DCLA 1F9FA 1YBUA 2FHJD 3CCMS 3TA0A 2ZC3A 5G0RB 3TVYA 4ER8A 2XWXA 5J2NA 3GV5B 2OHDA 3AOCA 3AOBA 2DT9A 6FDRA 1Q7YT 2LVWA 2QC3A 2QN6B 1S99A 2OMLA 3M1VB 1ACMB 1X4EA 2F7VA 3V6KA 2M2BA 1Q79A 2O01C 3D6FB 2QYCA 2WHOA 4H54A 1O5JA 1P27B 3NKYA 2BM0A 4C0BA 1GTHA 3W2VB 4NEYA 3TZZA 2V9WA 1SQFA 9ATCB 2BANA 3M9MB 2VQEJ 1D0EA 1S76D 3K58A 2G9OA 4LSLA 2MGZA 2XMKA 2CVIA 2HGMA 2ZJRQ 2JEIA 4RUCA 3G71S 2CG4A 1Q7LB 2GCFA 2FLOA 3G86A 3UD3P 4X64J 3SCIE 2CZ9A 3R5CA 4DSEA 3VALA 2P9CA 2FVCA 4ZOSA 3ZNUA 1FXRA 2C2DA 4ED4A 2IM1A 1EETB 4RW9B 2XY6A 4V19J 1WDTA 1ZZFA 3FEXB 3H2VE 2HVEA 1FDNA 4X84A 3EDQB 4A8WA 1EZZB 4DG1B 3PW7A 3PX4A 1VCTA 3D0HE 1RTDB 1TL7B 2RSQA 3IS9A 4I7FA 4QYZJ 4QR2A 3G96A 2LEAA 3U1LA 3NGTA 2DHHA 4W98A 5ETMA 3ZO7A 5HVHA 3UR0A 4DR2J 4HTIA 1FRJA 1XERA 1WOPA 3MM6A 4CNYA 3Q8SB 3RW7A 3QBCA 2BQ3A 2GC8A 1HBUB 1HNXF 2FJXA 3ITHA 4R25A 3D1QA 4A46A 4BCAA 4M5IA 2F8HA 3K5LA 3I55S 5E5NA 2A1BA 1QAXA 3QGIA 2J0WA 4DR7J 3UCGA 2DVIA 2YX7A 1EHWA 2W25A 2DNGA 2CPZA 2IRUA 4KTQA 1CLFA 1VRUA 3TRGA 3MDFA 2XMAA 2KJWA 4IFYA 1PAUB 1AFIA 2HRUA 4JV0A 2ZZNA 4ZVQB 1GXTA 4NX9A 2H5EA 1SJ3P 3TZXA 3G82A 4MYUA 2XO7A 1TMMA 3M6VA 1Y3JA 3GCWP 2FZCB 2PMZD 4ES3A 1U1QA 4B9UA 3AD8C 2NSBA 4DF4A 1I3OB 2P2CB 3M8WA 1BE4A 2QMXA 1OO0B 4RUHA 1RHRB 4X4OA 2CQIA 2RB7A 4DL3A 4NZ7A 4D3GA 3THTA 2C3MA 2QLWA 4F8RA 4J9VA 2KVIA 1X4HA 1NK9A 4DQIA 2ZJQQ 4RO0A 1JIHA 3OV7A 1Q5VA 2CQ3A 5LXRA 1R8AA 3NRBA 5FLXU 3WX8A 1SL0A 2KZZA 3O5TB 3W2WA 1RLCL 4HACB 5GMEA 5B0GA 2NPFA 1IM6A 3AODA 2CQGA 2ZH6A 2B43A 3GJTB 3LP0A 5HK4A 4A8QA 1U6BA 1FD2A 3BREA 4R8UA 2D3OR 1CC8A 2QRRA 4NLQA 4OLPA 4DV2F 1Q16B 1U8SA 3ILOA 3OD2A 1MWQA 2OP5A 5GADU 2BV3A 5IWAJ 1NSPA 3M6UA 4ZVFA 3Q22A 3RBDA 3EZ5A 3H5SA 4H4OA 1NK4A 2BOPA 2VFUA 2HVZA 4OIXA 2RDJA 2UUBJ 1RT7A 2HQCA 1N0VC 1RT1B 3A3OB 3C16B 2PC6A 4OYZA 4ZPWR 2MXYA 3BGRB 1RA6A 3FCHA 4G1QB 4OYPA 5KG3A 4DUZF 2IPOB 1KONA 1I94J 3MAAB 3CIZA 1FRXA 1B3TA 3K7RA 1HQUA 3DOMB 3O1LA 5L1JA 2K1RB 2A3JA 1RT2B 5C25B 3MM9A 3PW5A 3THVA 1WG5A 2I5JA 4B17A 2DR8A 4BC9A 2P6SA 4ZVEA 1FDBA 3KMSA 4JI0J 1KFSA 3TW0A 2E7WA 5D4LA 1R27B 2ZBCA 4FKXA 1Q8KA 4R5PA 2PD1A 2QZ8A 2DR5A 4NXNJ 3HDSA 3JSMA 1U2FA 3KFWX 2BABA 3DKDA 3PHEA 2VC1A 3X3UA 4WP9A 3THPA 3KNGA 4PG5A 5DDRC 1IJFB 3BN7A 5CXTA 4ZCIA 3SEOA 2B8QA 2BZ2A 3CJSA 2BJDA 1RAFB 3Q2TC 2FGOA 1UA1A 2XYGB 4DFMA 1VQKS 3FRYA 1NH7A 1IN0A 2JLEA 3N4WA 3B8HA 2B0GA 2GVDB 2YH0A 2E5LF 1RAHB 3KUHA 4ZN3A 4LQ3A 4K4VA 1JKHA 1VBKA 1HHSA 3NAIA 2MKYA 3VAJA 4O4RA 1Q5YA 2KDOA 1PCAA 3BM7A 3IBWA 4L6V3 2NPIA 3L7OA 3C3LA 2Y8YA 1H2UX 1ZAWA 4EO6A 2LQ5A 4EU0A 3TUIC 4G1QA 4BDPA 4KHMA 1YJWS 3R5JB 4MK9A 4NOHA 3OR2A 2FVRA 2ZNZA 3HFZB 3KKFA 4DCJB 5E3PA 3CCLS 4DV6J 3KUEA 5HP1B 5U47A 1EP4A 2MHNA 5T14A 2OH2A 1XBWA 4LSLB 1QVGR 3HSJA 4ZP9A 4FYXB 5KG7A 4KGMA 1GEHA 2V63A 3BBFA 4TQSA 2KN4A 2AEFA 3TZYA 4YOEA 3MPYA 3KLEA 1KVKA 3W61A 1P6TA 3I0SB 3ZXWA 2DXDA 8RUCA 4B3TF 2GJ2A 4AFFA 1T9WA 4ECVA 4RKUC 1WOOA 4OZNA 4EK2A 4OL8A 3HFKA 4M5NA 3PM9A 1RCXB 1YDLA 3BO3A 3QRPA 2VV5A 3IXQA 4MKAA 2NXJA 4L74A 4WTYA 4DX7A 4ERDA 1NDKA 3DXBA 1IBMJ 2MKJA 3OUYA 2YQ1A 3CXCR 1YVFA 2HHHJ 2MHEA 3HCXA 1KFDA 4ENOA 3VGVA 2JVRA 2VG7A 3VQSA 4DX5A 5B09A 2ERRA 5JJBA 3BGFA 2D3ZA 1FRHA 5HAOA 3QGHA 1TK8A 4O3RA 3PFOA 4P73A 2C28A 3ZZTA 4J9NA 1RKJA 2WSCC 3HMJG 3DLKA 3IRWP 2FJAB 1KBRA 1RHJB 1KOOA 2PEHA 4TKTA 3BZQA 2QL7B 2RD5C 2HHQA 3B78A 3QMQA 4KH1B 2D9PA 4MK7A 3GIIA 4K0KJ 2MZRA 1SXLA 2BKNA 2HWHA 4E2FB 2HNZB 4ZKAA 2G13A 3R1LA 1FWPA 2JFKA 1N52B 2VC0A 3B82A 4UTGA 1SKWA 4K4ZA 1RT6B 3TO8A 2HLTA 3IWNC 3G6VA 2W8LA 4DV1J 1NB7A 1HI8A 1F2HA 2J8SA 3OXGA 4DS5A 1HKAA 4MMOA 4V1Ak 5KFNA 1XR7A 4J37A 2YKNB 4HL9A 5A8RB 3CCVS 3OVAA 1U49A 1NZ8A 3DLGB 5DDQC 5KG2A 4QWEA 3R9LA 3VZHA 1TP7A 2F65A 2DIVA 2YNGA 4KBIA 5CYQB 4B3SJ 3CCES 5EX3A 4QWDA 2DNKA 3T5KA 1LW0A 1TVRA 1ZTTA 2W2MP 2I6WA 1BQXA 1R89A 1SKUB 4QIWD 1SC4B 4HH1A 4I6AA 1N5YA 4I6WA 2XSFA 4UQGA 3M1VA 2D3O1 1PJ6A 3OQ2A 4DMZA 3CCJS 4YR2A 3KDOA 1YI2S 1YSJA 4MKBA 4CO5A 2CPJA 4NLRA 3KJVB 2AGPA 5M2RA 3T19A 1F3VA 3HT0A 2J0XA 1TMJA 4P7TA 4DR4F 5C7PA 4ITSA 1VOMA 1NPRA 4IR1A 2N3LA 2QFJA 4DF8A 4IRKA 2ROPA 2YTCA 3WIUA 1NLKL 2F5GA 3NCQA 4PXEA 3H4BA 1BGXT 1HNVB 4NL5A 1K1QA 4IFVA 4KRWA 2UZAA 1M5OC 3OW2R 3EGZA 2B4PA 3PRDA 3KLGB 4J9RA 1HPZA 3D1HA 4XTTA 2ZBPA 3CSKA 3DRYA 4WIQA 4OV1A 5KOWA 5KFXA 4LFCJ 2UXBF 3NXZA 3QT6A 3UDLA 1KLMB 3NGKA 4C97A 3A12A 5I3UA 3HFVA 2W01A 3CD6S 1FO1A 3N28A 1OYDA 4GVBA 1J5EJ 1HD1A 4Y65A 3JSYA 3SBMA 2QA4S 1S9FA 4DV7F 3I87A 4JI3J 3AA9A 5KG4A 3TARA 1NRKA 1Y5LB 3CMQA 4WFYA 4JUZA 3DNCA 1TFYA 4OI3A 3A4TA 3DC2A 1N32F 2A6MA 2HGNA 1APSA 3PR5B 3CC2S 2CKWA 2DNLA 3ICLA 2AJ4A 1NPKA 3UDVA 5HN0A 2QA1A 1TKZB 4DFPA 2CPDA 3R5GA 2ROGA 3L9ZA 4M5LA 1IKWA 3AT1B 1VIOA 1VLYA 1MMDA 2YKQA 4K5SA 2WB1D 5K8OA 1J5OB 4GMKA 4P2XA 5KG0A 1N8RT 2R7VA 3OBIA 4I56A 2EBEA 1NSKL 2DEJA 5J2PB 4RR5A 2KYZA 1SL2A 3W63A 3N01A 2Y0SD 1RT1A 2OD4A 3C16A 5ADZA 5D3GA 4N47A 2W9BB 2MQOA 1TAQA 2HPUA 1Z2ZA 4NLGA 3SDEA 4IH5A 1N56A 2PN6A 2OEKA 3C8YA 3FUYA 4USVA 2G2YA 5AXMA 2DD8S 3BPDA 2MTLA 1HYSB 1X60A 1UVNA 1SV5B 2K3IA 4RNOA 4XO0A 2LU2A 4Z7CA 1DTQA 2E5IA 4HI1A 2FZKB 3QGGA 3H40A 2IMWP 2QLXA 3QWUA 1E6YB 1MWYA 3J7YI 2ZJPQ 2HAFA 1IUJA 3S8SA 1WEZA 2C2ZB 4K50A 1G1XA 1KOHA 5KFZA 1ELOA 5LSOA 1QSYA 5K20B 1JJCB 5I3QA 2W4PA 1NO8A 5HJYA 2HK2A 4MK8A 1VRUB 5KFAA 5L1KA 2UUBF 3EDRB 3PVXA 3E2EA 3CUNA 3OTEA 4DR6F 3C14A 1ZM9A 4M8LA 4QJVA 1L3VA 5CD4H 5AXNA 2A18A 4F0KA 4M5DB 5CQGA 3OL7A 3CPWR 2DR9A 4EGLA 2IVMA 4DR1J 1X4FA 2A2DA 2MY7A 4NMXA 4A47A 1VQ7S 1S7HA 2EPIA 1S10A 2AX0A 3PO4A 3FSXA 2AJQA 3CD7A 2MZSA 2N7YA 4NLXA 1VQPS 1VBZA 1RYRA 3EGWB 1ZBTA 3BR8A 2HHXA 1T9VA 4DDFA 1GQEA 1X9MA 1RTZA 2PT0A 3MPUB 3JTPA 2CJKA 3A8JA 1UVKA 1JQGA 4UZCA 4F26A 1SQGA 3HVAA 4CLTA 3D54A 3QFWA 2YWGA 5IV4A 2XY5A 3PNIA 4OYWA 4OX9J 2UVUA 3FZ2A 1ICEB 2GMLA 3CT9A 3AD7C 5ETQA 4EEYA 2I8EA 3GFYA 3CDBA 3N6NA 1NXIA 3M2UB 3QZ8A 1QE1A 1U0HA 1NJYA 1WC1A 1FEHA 3BF4A 1S5ZA 3H90A 4P2SA 2IDLA 4USIA 3K59A 3UCUP 2P9EA 1D1UA 1VYAA 2BMBA 4O44B 4TLQA 1KRPA 1JWWA 1CQMA 1T3OA 2VOOA 2CFXA 3MMAA 2G0JA 1RT3A 3HHKA 2H65B 3UPFA 2VQFJ 2PFFB 2YPZA 1SC3B 3EGVA 4KSEB 4PZVA 3MURP 1WI8A 3GIRA 4C8ZA 2DISA 4EUVA 3GWCA 4NEZA 1HNWF 4DV4J 3VQTA 3DOLA 2AP6A 2KM8C 3GTYX 4UOGA 2QA4G 1JLCA 1TL7A 1B0TA 4I7FB 1T9TA 1X7VA 3R7SB 2IC3A 5KFYA 1UVJA 4UY8T 4HHHA 5E0OA 3TNVA 1TKTA 3WBZA 3OHAA 2XS7A 2NQPA 4BC7A 3JQMA 3MR2A 4OZJA 5CHCB 5JMNA 2JVOA 2UUWA 7FDRA 3I4HX 4DV4F 2HS0A 1FWLA 2GV1A 2B6AB 2QL9B 4ES1A 1FF2A 1TTHB 5HBMA 5DDPC 4MKYA 2VICA 2HBZB 3KDNA 3CDUA 2XCPA 3CD0A 3PEHA 3QAEA 4KE5A 3QJJA 1RAEB 4CLSA 3I5BA 2CDRB 4HHUA 4B3MF 4UF4A 3C15B 4YDDB 1TK0A 2EFQA 3NMAA 1VR6A 4NCAA 4QPTA 1S6UA 2AYBA 1VBXA 2EK6A 1N36F 3F73A 5LT5A 2XULA 2V2KA 2E5JA 2HGLA 1KR4A 2QG9B 3OFHA 5C2GA 3EXYA 1HNXJ 2OEJA 4KIAA 4F25A 4PUOA 1S0VA 3ZZYA 1S1TB 1YITS 3I0SA 4FYVB 1RT5B 4L76A 1PJ5A 3KLFA 1UPPA 3QO9A 1WI6A 4CRJA 1IVZA 3M8RA 3JSRA 1FE0A 1B0VA 3SDEB 3LUYA 2HHPA 4LSNA 4OJGA 5D78A 5BYQA 1P1TA 5HATA 1NBEB 2NUUG 3MAAA 4F4WA 2J7KA 2RDDA 3EE3A 4EMDA 2FJWA 2U1AA 3R3TA 3L09A 4NLVA 1IBLF 1XR5A 3LWMA 1CPZA 3UE2A 4ILMA 1WORA 2OPPA 5B0EA 4EBDA 1YTYA 1S0NA 4YB1P 4JI6J 1B64A 1N5VA 2Z2ZA 1ZAXA 3AA8A 2R7WA 4ELTA 1VC5A 3NMRA 4UQTA 4F04B 2FY1A 2LA6A 4EBEA 4L72B 1VRTB 4K4TA 2RQMA 4P10A 2AYGA 1WC6A 4F02A 2FDNA 2R3VA 4B9TA 2YVSA 4JP8A 4LBPA 1SUQB 1MW7A 1XIQA 3WIVA 4DN0A 3P8BB 3WC2A 2RHQB 2RJZA 4RPFA 2XGQA 5JVGQ 4JYAJ 2RNEA 3Q8PB 2CQHA 1DLOB 3KK3A 3QSYB 4NXMJ 1WKLA 4WFZA 3ENQA 2MQ8A 4OZ2A 5EHHA 2NSCA 1XNQF 4DX6A 4DL5A 1M5KC 3M8PA 2CJXB 2GAHC 2FVSA 1JKHB 2BJ8A 2H3EB 3W5YA 4DPOA 4L75A 3PW4A 2I9SA 4NA3A 1U24A 4DQRA 4KGZB 4IRCA 4TYAA 2FJBB 1R43A 2BXJA 3Q83A 5L9XA 2Z4PA 2HBYB 1MN9A 2AEJA 1RTHB 3QT5A 1XMBA 1RT2A 2K1RA 2Q43A 5C25A 2YWEA 1HD0A 4ANCA 2CPXA 2Z57B 4DUZJ 2WTFA 1EARA 1UZDA 2ZE2A 3OTOF 3EGNA 2K06A 4Y3CA 5HMYA 2ACMA 3GSDA 3MMBB 5J2MB 1QM9A 2WAQD 4C8LA 3MEGB 3UI3A 4CLUA 3HHLA 4CM0A 1T95A 2AWZA 2Q1LA 2IVFB 5F8IA 3MUMP 1UP1A 3CGIA 4X4NA 1T8EA 2F3JA 2VBYA 2RUSA 4DEZA 2XM3A 2XBPA 2HIYA 2QYGA 4HT5A 1FHTA 1TV6B 3NS6A 3K5NA 4ZITA 5IFMA 2B4UA 1LFWA 5KFBA 1MROB 3R1HA 2XTJP 1GH8A 2EFGA 2FUG9 1YGYA 2ZZTA 1PGZA 4LIRA 5F8NA 4DBQA 3M6XA 1N33J 2O67A 5C42A 1MLAA 3NNHA 4LFCF 2NS1B 3KLVA 2HBRB 5GAEU 2UU9F 5L46A 2C2NA 2JHEA 1SH2A 3FJ2A 3HHLD 2H1YA 3K89A 3SFUA 3H5YA 3V2UC 3M2UA 3MECB 1U45A 3K5PA 3N0VA 4EI2A 2YNFB 1Q53A 1Q8IA 2E1AA 2IA0A 2FGCA 2BR0A 5KFQA 2A6OA 1XQIA 3QJLA 1ZYQA 2HFUA 4S0MA 5AJ3J 1FXLA 3EXCX 2ZEJA 3K57A 2N82B 3DHXA 2EW9A 3R7NB 2GJIA 2RMLA 3E51A 4O0NA 2AZ3A 2EFPA 4KAIA 4ZP7A 4LBHA 3UQSA 2VQFF 3GYGA 2FQQB 2LFVA 2QLFB 2YWWA 2CWXA 2W7AA 3AJ2A 1H74A 2MQMA 3BSCA 1YJ9S 5KT4A 2Z58B 3O2IA 2E29A 4QYRA 4WXWA 1H38A 1HNWJ 3BH7B 3D7SB 3LGNA 1Q8BA 3I6PA 3Q89A 4RBVA 1XTZA 1NHUA 1PYSB 3MPWA 2X1GA 1WUUA 2IBKA 3RAQA 1RLDA 3MEKA 2E1MC 3MF5A 3JYTA 1JJ2R 2B6AA 2DGXA 2V4JA 4OQJA 5KFEA 5I4MA 2ZOFA 3VAFA 2MSTA 1N33F 2PA3A 1RWUA 2FLLA 2XHWA 4F4YA 4AL6A 1TFWA 3MD1A 2OPQB 4CCHA 4PQAA 1FXDA 3MWBA 2Z2YB 1AZSA 1WF1A 4UW2A 2RILA 4R8UB 3TQEA 4NZ6A 1X31C 4X65F 4WYWA 3IP0A 1VS3A 2AHOB 4HDHA 4ZPDA 1HIYA 4KGKA 4ALZA 4CNZA 2KO1A 2PMWA 3P3DA 4OJHA 4TU9A 1U02A 2VASA 2LKZA 3ISZA 3RZAA 4F7VA 3DLGA 4F4ZA 4ELUA 1QUPA 4X2BA 4DV5F 1RU2A 4DWIA 4WWSA 4AYBD 5A0YA 3M2RB 2IA6A 1BD6A 5KFMA 1A6LA 1DQAA 1NHKL 3NY0A 2MQNA 3BPSP 4PG8A 1IBMF 2E44A 1RSCA 4CZCA 4YB6A 1SKRA 4JV1A 4LF5J 3I0RA 1WF2A 4CLYA 1N34J 2V9KA 2WVFA 4DOZA 3O6QA 2H48B 3PACA 1UTAA 1DRZA 2DTJA 5B08A 1RHQB 1K0VA 1YIJS 4DFKA 4WZMA 3EZUA 2B9YA 3QFHA 1NK6A 3MEDB 1M1GA 3M9NB 3HM9A 3G8QA 2AX1A 4OZ0A 1T03B 4OHYA 2Q6BA 2WSEC 3V4IA 8ATCB 3SSRA 2EKNA 2XZWA 4Y0FA 4FF1A 2V2QA 3W5XA 1XMQF 1S48A 3GSIA 2M5YA 3BS9A 3TUZC 4KT0C 1LWCB 3LGMA 3EX7B 1FI4A 1HQ2A 1GMVA 2Y1LB 3H42A 2H51B 3CCSS 4DUYF 4WYLA 4DLEA 1MNEA 2VPZB 3H2LA 1MROA 1LKZA 4IFVB 1XEZA 1JXEA 1M5PC 4N76A 4CYUB 3DLBA 1HWUA 2IIHA 1SL1A 4PUOB 4CO1A 4F67A 3SI8A 2ZFHA 1RBLA 3D66A 3V5RA 4DR3J 2GQ2A 1JLBB 1HBNB 1X0PA 2FJEB 3D1OA 3M32B 4DS4A 1RHMB 4DSKA 1EQMA 2GAGC 1T7PA 3ILLA 4ZVOB 5A0YB 3VAIA 3AH6A 4CLLA 2B8PA 2WOMB 2YKAA 3HF5A 2XZDB 1QVFR 1D3WA 1QUVA 2BACA 3ENAA 1ZH5A 3KHRA 2J8AA 2X1BA 3R27A 1S97A 2M88A 2QFIA 2M9KA 2BOAA 1RAAB 1V3RA 3H98A 3HPOA 3W66A 1SH0A 2ATLA 1S6PB 2AF6A 3T6BA 5BYSA 1IR2A 3AD9C 3HD1A 4OHWA 4DV7J 4F4AA 2L08A 1PBAA 1W7WA 4MH8A 9RUBA 4JI3F 2VKRA 3GJQB 4RWWA 5CYJA 1AA1B 1BWVA 3FBCA 1RAJA 4KB7A 2WRMA 3POTA 4B08A 4ZK7M 2XEXA 1E6VA 3M8PB 2C3OA 2ZH2A 1F6TA 3TQ1A 2J6UA 1FJGF 1H73A 1YRUA 1YZ6A 2BX6A 2QMUB 3HVRA 4DV5J 4ECRA 4ELVA 3PKMA 1X5PA 4UT4A 4DV3J 1K8AT 4ED0A 2APOA 2ALZA 3W60A 3MR5A 3ENWA 2V4QA 5B0AA 2F8MA 5A8WA 4C48A 1S1WB 3DHWC 5LMUJ 4J9QA 2FYXA 3HULA 1HYSA 3G6YA 3GP9A 1UA0A 1C1CB 3FCVA 5J2NB 4C8KA 3OTBA 4ZA1A 2MZTA 2V5HG 3C6UB 2ROEA 3L7UA 2VG5A 3K8WA 1EX8A 2GO9A 1UVMA 2UXCF 3MMAB 2B7CB 3N5FA 4PXCA 2ZUGA 3IG1B 3JQJA 1R6YA 3TAPA 1OQ6A 2DY1A 5F3TA 1RTIA 2JC0A 4CO3A 1TR0A 1OSDA 2YKNA 3D0IE 1YRXA 4NLTA 2F4VJ 2DRBA 5AE2A 1SUQA 3VCDA 2W7PA 2P6TA 1Q1KA 4FVMA 3LPEA 4QQBA 4C4WA 1SJRA 1H7WA 4H4KC 4R5PB 5IT0A 4EYIB 3HHDA 5IT9U 1WF0A 2R42A 5CYMA 3I31A 3QWPA 4A8XA 2JH3A 4AT1B 2FHMA 3T1HJ 5DM7Q 5IM0A 2R9LA 2CNKB 3QQCD 1LK7A 4ECYA 1E6VB 3MR7A 4OX9F 1EETA 5K8MA 3NGDA 4WU3A 2UV8G 3JS9A 1QSLA 5ETLA 2J76E 4LF7J 2HQIA 3NLCA 3J80U 4J9SA 5GAHU 3DI6A 4RW6A 1URRA 2EXUA 3NWGA 2ZDOA 4YEAA 2Z8QA 4DV3F 4JB8B 2IAJA 3CJ8A 5HQMA 2JLGA 3VGTA 3PX6A 1W25A 3KXDA 2UUCF 1F5BA 3IBCB 3PJ9A 4ZVGA 3P49B 2HQGA 4KKOB 3UVJB 2QT7A 5DQIA 1HNVA 2Z2LA 3Q8UA 3RAMA 4OZLA 1SCJB 2EKYA 3FGVA 1GNKA 1DQ8A 1JNRB 2EI5A 3MM8B 2BJ7A 3BKTA 2CQ4A 1W2IA 2RS2A 2YH1A 3VAHA 4O4GB 5D8HB 4L73A 2ASYA 1DLOA 1Q4RA 1FNOA 2FHJA 3CWJA 3OLBA 5GAHI 2YXLA 2RHSB 2W24A 6FD1A 4FPIA 1RACB 3G87A 2KH9A 3TX0A 4M1KA 4JI2F 1DTTA 1TZ0A 2GIFA 3GYXB 3IS9B 4KO0A 4K4SA 1AFJA 3BKUA 3IWXA 4YB5A 5F0UA 1RWKB 2MYFA 3GFZA 2XLJA 1LEOA 3M8ZA 1Y11A 3MCOA 3I5CA 5BYRA 3MD3A 1QY7A 4OYAA 4RNNA 1R0AB 1UW4A 3LW5C 4DPTA 5HMWA 4ICLB 2KFZA 2OSQA 5DLFA 1S12A 2CPHA 2L3MA 4IR9A 4JI8J 2CJBA 2V34A 5HANA 4F3OA 2V69A 4EBCA 2K7KA 4C11B 3FVYA 2DHAA 3KHLA 1FDAA 4RW8B 1J5OA 2VBXA 3H20A 5D0RA 3D3CJ 4F2SA 1K73T 3MEDA 2ACYA 3M9OB 1VRTA 2Z30B 1LFPA 1FRMA 3Q0AA 1TV6A 5DM6Q 5CCMA 2LU1A 3CMAS 2XQCA 4NCGA 1WSRA 1Y9OA 4WKYA 2W1BA 2YKMA 4TYBA 3IM9A 4U7CA 3C6TB 2XNQA 4MYTA 2K8GA 2VBZA 3EJMA 3VHQA 3F0NA 4EO8A 4NXNF 2DXFA 4O3NA 2XS5A 5KT3A 2J5AA 4NPOA 1B7YB 1XJWB 1M5VC 3FBFA 1KLMA 1BHNA 4LRDA 1RK8A 2G2ZA 1X9WA 1FESA 1S6QB 2NYIA 2ZE2B 3CJKB 2HNYB 1ROFA 3CCQS 4I2PA 4N56A 2GJFA 3BGUA 2D1CA 1R0AA 2LMIA 4LF6J 2YX4A 4KV8B 5LM7E 1VQLS 3GMGA 3T41A 3GQCA 2KM8B 3G8SA 4RLEA 2B9XA 1KEKA 4ED6A 4LFAJ 4GKKJ 5F8LA 2IYIA 2AJ1A 3ZFVA 2LYVA 4LBIA 5E3RA 4ZS6A 4DU8A 3VAKA 1W2BR 1FDDA 1PYOB 4LJMA 2HQ3A 4BBYA 2UXCJ 1TAUA 4J91A 3HHLC 2YNIA 4NRUA 4AQYF 4URSA 1JLAA 1FX4A 2A10A 1UJ6A 1VHIA 2ZD1A 3D5MA 4OZ1A 4O0IA 3G6ES 1FJGJ 4U95A 1WHXA 4ECTA 2HHHF 2ZVSA 2ZZMA 2E1RA 3M8SA 1JJ4A 3DMJA 3EYZA 4HHJA 1S77D 2GQQA 3IR6B 4TNOA 3KJNB 4A8MP 1X9SA 2KXFA 3C6TA 1T05B 1Y10A 5AXLA 5CH7B 3MXHP 2YQ3A 3MCMA 1JLFB 5B0FA 2EG1A 1U1RA 3QT8A 2KG1A 5IQQA 1YBAA 1EQ0A 1R6VA 3D2WA 2WK4A 3C2PA 4ID8A 3AXMA 5T7LB 3W65A 1AUDA 2AD9A 4JI5F 3HHLB 1E6YA 4LRFA 8AT1B 3SV3A 3RR8A 4I69A 1UMJA 1VISA 1RI7A 3QT7A 4OHXA 2KHDA 2BJEA 1NHVA 3HSZA 3RUBL 2CZVC 4K2XA 2ZDPA 3K0JA 3PO5A 4ECWA 1OPZA 1VLOA 2OKQA 3ELHA 3CE8A 2AIRB 1WC5A 1S6PA 4QOTA 2IMOA 1R0BG 2MMYA 1A0OB 4ZVPB 3ILJA 3U1MA 3DDIA 2BUNA 1NZAA 4DUYJ 2Y3YA 4E8UA 1M5SA 2K3KA 3OJUA 4Y6IA 1FCAA 1NMEB 4YHHJ 1J2VA 4IDKA 4FF3A 2MSSA 1OJ4A 2WVEA 1HNIA 1RADB 2DR6A 3MMJA 2F9JA 2I1RA 2IHR1 2VL1A 2KXHA 3EM1A 3N6MA 4YR3A 2GMHA 3M32A 1PG5B 2RAQA 3PJWA 4PXDA 4C7QA 5HMZA 2N3OA 1NKEA 3EMTA 4YY3J 4DR5J 4NMLA 3MMCB 4N8NA 4PG4A 3KUGA 3S1TA 3OFGA 4KPCA 1OS5A 1N6QA 5ETVA 5F3ZA 2R7QA 2Y1RI 2BJ9A 3SMZA 1SIZA 2RQKA 4J7CA 3DGVA 5FD1A 4X4SA 4AXIA 1YK9A 4LFBF 1BQNA 2X7IA 2ZBIA 3P5BP 4ZCLA 3W8GA 3ZTOA 5ETOA 3ZNJ1 4PYAA 2ATCB 4BWJA 1CJTB 4X62F 1IBCB 2XHCA 2HAIA 1H98A 3HKWA 1IWAA 1H6KX 3A8KA 4OJ1A 3QGPA 1MMLA 3AAWB 3AFGA 3ZC4A 2VPYB 4ZPCA 1SC1B 1R3NA 3IO1A 2XG8A 2VIHA 4CLKA 2FIUA 3TAMB 2FLNA 1HI1A 1CULB 2RF2B 3JSBA 1P9YA 3WDOA 3QLHA 2W2QP 3FZBA 1DARA 1KTVA 5ETKA 2M4MA 3DRSA 5I3PA 1DQ9A 2M0GB 4QWAA 4JI7F 4N41A 4LREA 2GHPA 4RU2A 2YKPA 5KG5A 4X64F 2B56A 2C3YA 1WC0A 4WE1A 3NEKA 1HBUA 1LW0B 1TVRB 1TL3B 4WK3A 2WOMA 3D0GE 3FEZA 4LSZB 4NASA 3WQPA 2BE2B 3MM6B 5KT6A 1WEYA 1FRLA 3T1YF 1PSDA 4ZJQA 3R8YA 4ZCMA 5GMKa 1VQ8S 2P9GA 1UWAA 1Y4ZB 2RU9A 1KQSR 1TUGB 2LXFA 4NLYA 3HSGA 4CP5A 1X4CA 1T02A 3BO4A 3PW0A 4KC5A 4HLBA 4J9KA 1Q81T 2PEBA 4KQZA 4CTAA 4A8FA 4O23A 2FJVA 4ZVTB 3TR5A 3T9NA 1R8HA 5H9FJ 1VMBA 1O51A 1ZA1B 2FPHX 2VG6B 1KD1T 2DBBA 2DNOA 3BJYA 5B0BA 3PZPA 5I42B 1WTBA 4C3MA 3PY8A 5LMNF 5DDOC 2PGCA 1N54B 3DU5A 1RAOA 3P6YC 2AJFE 2RQCA 1TKXB 2B3TB 4UOCA 1RU1A 4WFBQ 5DZ6A 4DLGA 4OFZA 4XPEA 5KFHA 1LWXA 2V6AA 3EZOA 3NOGA 1NK8A 2DCUB 4FNHA 3CCZA 3MOJB 4C2MA 4W4MA 4C0HA 4B3OB 4K4XA 1PC4A 2CJQA 2EG2A 3RB4A 1YJTA 5KFSA 3UWTA 3RJMB 1RUSA 4B9LA 4K0KF 4Z7YA 1OSCA 4ZJOA 1J27A 2CG8A 3SXLA 4B3RJ 1S59A 3JXOA 5KFWA 2KRRA 2ZWOA 2EC2A 4LF1A 3BEGB 1S4EA 3PXGa 1SJ4P 5HBMB 1VK8A 1Y00A 4Y28C 5HJXA 4FXWA 5J2QB 2IY5B 4F3QA 3LP2A 2KG0A 3KNAA 2J9DE 1PILA 2R8KA 3R2DJ 2WW4A 5CA5A 3OR1B 2FJDB 2NZCA 1TUVA 5HVFA 2QLJB 5IT4A 1VQOS 1RT4A 1U6FA 2HNDA 2R7XA 3T5HA 3DGPA 4ZMMA 1KKHA 2L41A 1U48A 1GTEA 3I9ZA 2ZH3A 4EZ6A 1JLFA 2WCXA 1G6BA 3FSIA 4DR5F 4TY8B 3AJDA 5F41A 4NLPA 4Y2CA 4DV6F 4NI2A 2GVDA 4LT6A 5KG6A 3V6JA 1LK5A 2E5LJ 3N79A 4AQYJ 2B51A 4RBTA 2YY3A 3JAMY 2VOPA 2CPIA 2HHTA 2ZOMA 3LPYA 4Y00A 4K4WA 2WB4A 4M5KA 4FBUA 1HMVB 3QAUA 3WHIA 1PO6A 1RZMA 4HDGA 2E5GA 1S79A 4L3NA 1WDDA 3BBCA 1NPPA 1VQMS 2HS4A 1PAEX 7AT1B 2DGUA 3U7JA 1U4BA 2F4FA 5BR8F 1M90T 2EBGA 3CJ5A 2LQJA 3VVUA 1V3ZA 5ETSA 1C4CA 4J9MA 1JMTA 4DQPA 4O3QA 3K17A 2HSEB 2UXDJ 3KHHA 1X4GA 2PIIA 1GK8A 1HFEL 5GAGU 2HYIB 4B9NA 4FP9A 4I67A 2CPEA 4K5RA 1S72S 1SV5A 1HHTP 5C42B 4K8RA 3MFIA 3FMWA 4LR8A 2HMIB 2HHUA 1TK5A 2F8EX 3HX9A 4PYDA 1KN6A 2KT2A 3KJFB 1ZM2A 2V0NA 4ILRA 4LIWA 4Q7AA 2YBVA 4ZIWA 5KFJA 4U8VA 2YKOA 1I5OB 2DGVA 1WTFA 3MTKA 2GS8A 4XIUA 2K2PA 2W2PP 3DOMA 2DR7A 3FRZA 4G3IA 2R8HA 5ETRA 1GMWD 4ZLPA 4M94A 1QAJA 3KG4A 1N6QB 2DIUA 4OI1A 4QZVB 1KQKA 1LW2B 2BANB 3CO0P 3FK4A 3NCPA 1C0UA 5J1PA 1EP4B 2GZOA 1CJTA 1R31A 3R5BA 4PABA 4ETZA 4TU8A 1AW0A 1A9NB 4YB7A 2BJ1A 3VV2B 3V6DB 3LP1A 2ASLA 1WHYA 1CQNA 1U25A 2LA4A 4Z37A 3A8EA 3LAMA 1HWKA 2AW0A 3QO9B 3TEGA 4Q45A 3GV8B 2LEPA 2HS3A 3CJ3A 1K44A 4JOUA 2VFVA 2VDHA 2ADBA 1CULA 2MLYA 1K0TA 1DAXA 1HA1A 2VPXB 2ZBQA 1SIWB 1YJUA 1ZZNA 2OIHA 1WEXA 4MIAA 2KFNA 3A8IA 2NR0A 3ZZOA 1JLGA 1DHMA 4RBUA 5DGAA 1MG7A 3NS7B 2R7OA 3ZTSA 5K14B 1CSJA 1YJRA 3DLKB 4IO1A 2HZVA 4DN9A 1IBKJ 1FK9A 3NL0A 2SXLA 1OWXA 4CO0A 5EWEA 2DXEA 1EKRA 2ZH8A 1PBUA 1UPMB 2CVEA 1QTNB 3I32A 4WU2A 3VWSA 4JBCA 3W64A 1S0MA 2HLUA 4P74A 2W7OA 1IQTA 2L9WA 3A13A 4TY9A 2VZ9A 2LCWA 2ZH1A 4FF2A 3HJVA 3MECA 2ZNYA 2G0IA 4RJVA 5KFPA 5EWFA 2V67A 3FEYB 4HI2A 3PW2A 4FYDA 1EJ7L 3NCRA 4Q8EA 1C0TB 4QWBA 4DL4A 1L5UA 3KOAA 3H5UA 4NLOA 4LRAA 3CB4A 1WG4A 2ZC4A 3ETOA 3O3LA 4DPXA 3GJSB 1W26A 1UL3A 2EFNA 3J7YU 1HR0F 4I68A 2DH9A 4UOFA 1XK8A 2CDQA 5J1EA 5IV3A 3KLIA 3AY0A 3J81U 2XS2A 3Q24A 4YDXA 1S9EB 3G4SS 2AU0A 2BQRA 4LF2A 5SUHA 4UUWA 3QSIA 3BKFA 3E01B 3D6TB 1TKTB 4C0OC 4P71A 3EPGA 1FJ7A 2OMOA 4YMEA 1WHVA 3EICA 3ET6B 1U47A 3MAHA 3KJVA 5KFIA 4GKJJ 1PYTA 3D68A 4GRSA 4PCQA 4DUTA 5BXIA 4XPCA 2DNPA 3I9V9 4DSFA 1RKIA 1ZA2B 3OTCA 5HVGA 2E7XA 4G6VB 4LF5F 4MIWA 3GU0A 2PFDA 4KV8A 2KXNB 4ECQA 3FFIA 2KT5A 1UEVA 2LLZA 3UN2A 1DBDA 3CC7S 2E7VA 4ZVRB 1CS4B 2F40A 2ZHOA 2HRTA 1F2GA 2MKCA 2P8IA 2XMJA 1VRQC 4KGXB 5FDLB 2CYYA 1LXNA 2M8HA 3K8VA 1RYSA 4CLWA 2FD2A 3TA1A 2D7SA 1RXOB 2J9EA 2B9EA 1TL4A 3ILIA 1KNZA 2D74B 2XSJA 5A8RA 4DL2A 2FC8A 2RF2A 5D4NA 1NAQA 1KQGB 5T41A 5A2QU 3MAQA 2EFVA 1IKXB 4PQUB 4TY8A 3KTQA 4ZHRA 3BYPA 2WSFC 5RUBA 2ZM6J 1PJ7A 2CPYA 4YQWA 2NXUA 3AJ1A 4NLSA 1VQ6S 3PKYA 2F1FA 2BE2A 2BKOA 2IDEA 3PG9A 4LUBA 2YNFA 2DJWA 4PPZA 5A8KB 2K7JA 5ETNA 4J9OA 1LW2A 1RCOB 4QIFA 5GVQA 4CH0S 4WIIA 3GE9A 4P75A 5L9NA 4LF4J 5HI7A 4M95A 5DG8A 1RWXB 2OLWA 3HVWA 3D3BJ 4XDCA 3D9BA 4A4JA 4ZP6A 3DRXA 3C46A 5K5MA 3NGRA 2UXDF 1OPIA 3UO0A 2PDAA 4IDKB 3MGJA 3Q23A 3R5AA 4FZVA 1UZHA 2EEYA 4DU7A 2L9DA 1REGX 5M2PA 1YHQS 5BR8J 1HR0J 4PAAA 4N77A 4ZVHA 4ED3A 4KFBA 2AZ1A 4F4XA 1NK0A 2QEXS 1TL3A 1T11A 5HMXA 1F5CA 2W2NP 2OI2A 2CQ0A 2NUHA 3N5BA 1JLEB 4TXSA 3J7A1 2HWTA 2MJUA 1C1CA 4M5HA 4NWBA 3QIPB 2H54B 1U8WA 1XNRJ 2OO4A 2OPSA 4ECUA 2XLIA 1IBLJ 1Q0NA 2OTLS 2PI4A 1F0XA 2VA3A 4C8OA 5F8GA 4ZHRB 5KT5A 4A8YA 3QJPA 3M8QA 4C98A 3BR9A 3O8WA 2C2EA 4QWCA 5HP1A 4KHPF 1HWJA 2CAJA 4L3KA 1HQEA 2MPUA 4CLPA 5KFUA 5IS2A 1OIAA 4PWDA 2GA7A 3BSNA 3RB0A 2ADCA 4PWDB 2Y1IA 4LF8J 2AMCB 3VR1A 3O44A 3QRQA 5E33A 2MB0B 4OYOA 2RRBA 3TVKA 5B7WA 1MMNA 3Q8VA 5E7OB 4F0MA 3BYRA 2C2RA 4N7TA 3CCTA 2NYHA 5EDWA 4BS2A 1TL1A 2V8VA 4DCPB 3OVSA 4DL0C 2VFRA 2O5DA 1FVQA 3JTNA 3HLUA 3R6GB 2DNNA 5KT2A 2Z2MA 4NA1A 2MZJA 2WBRA 3RW6A 2U2FA 4RW8A 3PRVA 3RU0A 1P8GA 3ZZZA 3ET6A 4RUAA 2E9TA 3CEDA 3NGSA 1OQ3A 3GIMA 1HNZF 2DH7A 3J81Y 4CM2A 1WD6A 4DPUA 4WKRA 3BN4A 2LDIA 4GKKF 1C2PA 2I0XA 4LVOP 1K47A 2ZKTA 4YUDA 4OI0A 2MY8A 3DRRA 2HFVA 1WC4A 3DRRB 5KFLA 4BLGA 5J2MA 1UEKA 2GVZA 3GZ7A 1NJWA 2MKHA 4ZN1A 1WKJA 2PI5A 2CQPA 2UP1A 3TP2A 1U26A 3IWLA 4EWTA 5FLXY 3KK2B 3BSOA 2ZVIA 4DHVA 4OZ3A 4I64A 4PWUA 4MTPA 3NNCA 4LSNB 4ZPVR 2DGSA 2Q6CA 2OAUA 1C0TA 2IJFA 1FERA 1JLGB 4ANEA 1NDLA 5E41A 5C5JA 4Y2KA 4M5MA 2W8KA 3AB4B 4UOHA 1HBNA 1KC8T 3BSAA 4U96A 1SJFA 2VODA 3BQ1A 4TVAB 5CZXA 4WK1A 3UD4P 2GHVC 1ITPA 1KSPA 1CG2A 1QAYA 3D6MB 4OV6A 2CNLB 1R8BA 3UCZP 2UVRA 2H5IB 3QNWB 3MI7X 1KVIA 4IOBA 1NDPA 5EN1A 2UUAJ 4DZ6A 4E0DA 1FK9B 2FLPA 5LMUF 2VPWB 3DI6B 1JXVA 1S1XA 1BY9A 3K2YA 1YG0A 2JRSA 3IAM9 4RW6B 3G6XA 4DV2J 4DQQA 3LP2B 1ULRA 1UVLA 1P1LA 2IRYA 3BB5A 1EAYC 3ZZ0A 2VHGA 1SBRA 1LWFA 4ZPAA 1DJ0A 2DNHA 2NREA 4Q8FA 1SJQA 4DSJA 3H7HB 4OI4A 5AE1A 5MLCV 3MFHA 2DRAA 2LQBA 2N4CA 2ZH9A 1I6JA 3HD2A 3J7AN 3MPDA 6AT1B 2BRLA 2JEGA 4I2QB 4DX8H 3DGPB 3OSPA 1S1TA 3VGUA 1X4DA 2CZ4A 1RT6A 1C1BB 1K1SA 1C1BA 2GGPA 3TOQA 2W9AA 4GKJF 4BHQA 3DOLB 2XYPB 4LF6F 1D09B 3OR1A 1X5TA 3BQ0A 1N36J 1DZ5A 3QRRA 3MCNA 4ZP8A 3DLEA 1HHQA 1IXKA 2J7UA 1M1HA 3OFEA 4X62J 3RAXA 4WFXA 1EKSA 2C42A 3CJKA 3RGIA 5C24A 1UKUA 2YWKA 4NRTA 3RTVA 3GG1A 3D28A 3NP5A 5IC6B 4OHZA 3TI0A 1FRKA 1Q82T 3EUNA 4XAKA 5HQ8A 4NI2B 3G2XA 2MQPA 2VONA 3CO9A 3CJ4A 4B3RF 2C3UA 1CJUA 1B0PA 2JX2A 3MOZA 3I56S 3SSSA 2JLFA 3C19A 5KAKA 1Y5IB 4C8NA 5D4OA 5HQLA 3PRBA 4A8OA 4PG7A 2EK1A 4NZ0A 3AHPA 1T03A 2I38A 1FKOA 1U2RA 1D9DA 4X4UA 3BGLA 4WXOA 3TEHB 2BBEA 4CWBA 4YFUA 3DRPA 3VAMA 1GMUA 2XMTA 1VQNS 1TKXA 3GR1A 1IKXA 1F5AA 2GMJA 2G2OA 2AEMA 2XYHB 4PRFA 3LO3A 1IR0A 4KFBB 2XY7A 1DFDA 4DJBA 1L3TA 3H8YA 4DQSA 1IBKF 2QSWA 3ZZUA 2ZHAA 1UAWA 5DG7A 2OELA 3GLJA 4FPRA 5LL6d 4W90B 4NXMF 1GMWA 1QE1B 1U0HB 2MLZA 5IZHA 1XMQJ 2IAJB 3HKZD 3KG0A 4ZVUB 1FEEA 3TJAA 2F4VF 2HBQB 1QDUB 3TUJC 1N34F 2FVPA 1D9FA 4DPWA 3U27A 4YR0A 4H4MB 1OY6A 4AE5A 4ED8A 2OGUA 1FKAF 3IG1A 3IR7B 2LEBA 4USWA 1MU2A 4NLWA 1YZ7A 2E5HA 1BQMA 2VD3A 5DETA 1KS2A 4CT9A 5L39A 2JL9A 3OR2B 2QJ3A 3LA0A 5KTQA 4RNMA 1CJUB 4RW9A 2R7UA 2GO8A 3DRSB 2IJNA 1TU0B 1RWVB 4RU9A 4JV5F 3E3XA 2VDIA 3NGUA 3Q8YA 3T1AA 5CABA 2DPJA 3MUVP 3LH2S 4K2JA 3CVKA 1S6OA 2O1PA 4OYBA 3OTOJ 2RRAA 3TZWA 1N5TA 1HNIB 3AB2B 3FQLA 3GFXA 1H3DA 2RIJA 3UDEA 2HMIA 4DV0F 3MPVA 1KDNA 2UUAF 1KP6A 3Q8RB 3G9CA 2DHGA 2R4FA 2VH7A 5DJBA 2FHKA 1LOUA 1V6HA 5J1NA 2J0SD 4AL5A 4H4KA 4OMFG 2HVHA 1AZSB 5HSPA 4LF9J 3W9IA 1NUEA 2IYGA 5F0WA 4IH7A 4LRBA 4U6PA 4ED5A 1U2CA 4PPDA 1RTJB 1FFSB 2DH8A 2GIQA 3KK1A 2CNNB 1S1VB 5DS7A 2KYXA 1SC6A 2YWHA 3MUTP 2AGQA 2R8JA 3MEGA 2Y1JA 2CQBA 2JOQA 5KFVA 4JV2A 3OL9A 1KVJA 2UV8A 2OEMA 3CDWA 4C8MA 3RBZA 1SH3A 4G1PA 4I0WA 4O4GA 2J7WA 3SQGA 4MIBA 1RBAA 4AXJA 2UVWA 3PFEA 5DO2A 4GC7A 4DL7A 1Z1ZA 4WFNQ 4ID5A 1HQEB 2MKSA 3Q2SC 1T9YA 4OYXA 4W92B 1SB6A 4WPAA 4Q2LA 4ZLLA 3KK2A 1NK7A 3RRGA 3OUYB 2AGOA 1XN9A 1FFWB 1V9OA 3GPAA 1D8YA 3LTOA 2HQFA 2GFFA 3W5ZA 2R7RA 1F3FA 4G1IA 3T9ZA 1VHFA 2X51A 2Q66A 1G2EA 2NZ4A 5J1EB 4OX7A 2YNHA 1S1WA 4OJ3A 3M6WA 4ECXA 4ETXA 2DO4A 3QATA 1N32J 1GX6A 4HEA9 3P4UB 3DOKB 5CAAA 5A8KA 2C3PA 1O8BA 5E2QA 2OPSB 4WFAQ 2QX0A 3OLAA 3ETMA 3V4MA 2LECA 1HBOA 2IFXA 4QW8A 3RRHA 3K5OA 2ZHBA 2C22A 1SJ1A 1RTJA 4UY85 3NWRA 2XCAA 3E8OA 2RUGA 1N48A 1N4LA 1AB8A 1LWFB 2OUGA 4GO7X 2DNZA 4IFYB 4NYZA 4Y2IA 2V8HA 3RRKA 3TWZA 3BV8A 3QIDA 3HZEA 5A6PA 3TX8A 1LWCA 2NCKL 3FC9A 3DMJB 1U1KA 2XGPA 4LF8F 4DR2F 2ZH5A 1CJVA 2R2SA 1Q86T 3KYLA 4RWXA 5KT7A 2RE1A 4CO2A 2WVBA 4OHVA 4C3LA 3HHNB 1S6QA 2CXEA 3OXLA 1VBYA 4OLOA 1CVJA 4B3OA 2XO6A 2IVYA 5LSLA 2OFGX 2GIRA 2RKIB 1SVDA 2P5VA 5L38A 4PG6A 4PEOA 3TJ8A 1JB0C 1T94A 2EVZA 5DZ7A 5KFGA 2KFYA 2BA9A 2L48A 3L3CA 3SZ2A 3DXSX 1WACA 5M2UA 2MKIA 4G65A 1IR1A 4DR4J 1JJHA 1O0PA 1U1PA 4X4RA 2OPRA 3L95X 3G8TA 5A6WA 3CDAA 4RW7A 1YRTA 3UW1A 1QSSA 5A2QY 4B9SA 1UWBA 3D4JA 3UNYA 3HK2A 2HVIA 2G1HA 4WP3A 3T6JA 3OTDA 4Q5VA 4NCBA 4DSLA 3B4MA 2NXNA 2XSJB 2ZD1B 3CDEA 3D6HB 4FVCA 4YS2A 4FXDA 1RWNB 2HHWA 4JI4F 1YKWA 3DN9A 2YNIB 3US5A 3K5MA 1NNDA 2CPFA 1XNQJ 3W62A 2W4DA 5F8HA 2FY8A 1NU4A 2Y0BB 2YKMB 1H2VZ 2AJ2A 4NE9C 1H0HB 1RT5A 5HO4A 3J7ZT 2HURA 3KLFB 3HXMA 4FS2A 1QLNA 2GGPB 1UFWA 5F8MA 3OT9A 2V68A 5H1SV 3DLLQ 3IMQJ 3UN5A 3MR3A 1FT8A 1IKVB 5T7LA 4X4PA 3V6HA 4CLFA 4J9PA 2BE7D 4H4MA 1YJNS 3DYAA 1XMOJ 1NJZA 3IRXB 2HNZA 1JNZB 3PYEA 2MDAA 3KLHB 3OPKA 2OPPB 2OJ3A 4DR1F 4JI6F 4X66F 4WBFA 1X5SA 1R8CA 2XMWA 2XI2A 2HRYA 1AXQA 4B02A 1SPBP 1YQHA 1CJKA 4RZRA 4USJC 2IM3A 1LNQA 3C14B 2VFSA 1UEUA 4IQXA 3CJQA 3LQVA 2R2TA 1WNEA 4LFBJ 1XWLA 5SZTA 5FDLA 1U1MA 2DGTA 2QSFA 3AOAA 2HQDA 3UDCA 3UNGC 5DQHA 1DTTB 4KH0B 4KO0B 3Q8QB 3IGNA 4HKQA 2KT3A 1GXLA 1BXNA 4M5JA 1UFKA 1X4BA 3PYDA 1UFLA 4IOCQ 2GW8A 1QD1A 3FKBA 3LANA 3IA0A 1DY3A 2DGOA 4DCOB 3RG6A 1G4CA 2RRNA 2X3GA 3PYGA 4E98A 1TUWA 2EFOA 2RQ4A 3F41A 3J81j 4ED2A 3HO1A 3FDSA 1T9UA 1FNMA 3HVTA 3M30A 1YX2A 1VFJA 4QIGA 1SQEA 4ZCKA 3BDPA 1BLUA 4B3TJ 3UVJA 4KJIA 3SSQA 2GQCA 1SI9A 3M2VB 3MM5B 2H4WB 3PJXA 4B3MJ 1TL5A 4OZ5A 1N5SA 3MM9B 1RWOB 2JFDA 3S7RA 5KOXA 3CTRA 4CTAB 2KVQE 4AD6A 1VJWA 2V2VA 4P52A 5MAOA 5EGYA 3IR5B 4P9SA 4UZBA 2BRKA 4LF7F 1WG1A 4O44A 3BO2A 1ZTWA 3KMQA 4O3PA 4ID5B 3MM8A 4MFBB 4KGVB 3DM2B 5GAEI 5HLFA 2HFZA 1RHKB 1HW9A 2HKEA 2ILZA 2HFSA 1WJ9A 2Q79A 2CWKA 2QGFB 2UUTA 2BKPA 2KHCA 3D67A 1JLCB 3FSYA 3I5AA 1T3NA 4JI5J 3HSDA 3TYTA 5JUMA 1HW8A
chains in the Genus database with same CATH topology
1M1HA 2K06A 2OUGA 2LQ8A 1M1GA 3EWGA 1NPPA 1NZ8A 4ZN3A 3LPEA 3P8BB 1NPRA 4ZN1A 2XHCA 3QQCD 2EXUA 3H7HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1H A;  2K06 A;  2OUG A;  2LQ8 A;  1M1G A;  3EWG A;  1NPP A;  1NZ8 A;  4ZN3 A;  3LPE A;  3P8B B;  1NPR A;  4ZN1 A;  2XHC A;  3QQC D;  2EXU A;  3H7H B; 
#chains in the Genus database with same CATH topology
 2UVV A;  4M5D A;  3LWL A;  4C6A A;  1T0T V;  1LWE A;  2W9B A;  2WON A;  3MEE A;  2ALY B;  2CJY B;  4JI0 F;  3R2C J;  5JXS A;  5JVH Q;  1RWM B;  2JZ5 A;  4C11 A;  2YNG B;  5CYQ A;  4HYK A;  1NKB A;  3TVZ A;  2V8P A;  2DK2 A;  4YP3 A;  3CJR A;  3V81 B;  2KL8 A;  2DYA A;  3EVO A;  1S0O A;  4HAC A;  1Z2L A;  2PO4 A;  1J5E F;  2FB0 A;  2VA2 A;  4JI1 F;  1QTM A;  4ICL A;  1VI7 A;  5IQ6 A;  3NOC A;  4ZLN A;  3PR4 A;  5L1L A;  5HL7 Q;  2VG5 B;  2WVD A;  2QTW A;  4FBT A;  3H5X A;  2ZOG A;  1TKZ A;  2CUY A;  2D69 A;  3VZI A;  2AYE A;  4LF9 F;  3FMB A;  1RHU B;  4I2Q A;  4O3O A;  2OTJ S;  3KK1 B;  3FCW A;  1VIX A;  2C2K B;  2XMU A;  1Y5N B;  1FE4 A;  3N9U C;  4KHR A;  1NSQ A;  2XC9 A;  3KK3 B;  3H25 A;  1X0F A;  1HNZ J;  1BWE A;  4URQ U;  3U02 A;  1U7L A;  3DRP B;  5D4P A;  1JLQ B;  2RVJ A;  4TQR A;  2W9C A;  1VC6 A;  3LAL A;  2KJV A;  3W1Y C;  3VGS A;  2W9C B;  3V6D A;  1H72 C;  4PR6 A;  5HRO A;  5EUH A;  1M1K T;  4MFB A;  4JV5 J;  5IWA F;  4IRD A;  2QE5 A;  1TL1 B;  4Y2M A;  1R0C B;  2B5J A;  4NA2 A;  1C4A A;  1EB0 A;  1N5Y B;  3ISN D;  1V5I B;  1JK9 B;  2BJ3 A;  4DZD A;  1S1U B;  1OYE A;  3KWM A;  2W4C A;  1ZM4 A;  2RS8 A;  2WON B;  3MEE B;  1RDR A;  5G4D A;  1X4A A;  1HI0 P;  3AQP A;  4UUX A;  2AJ0 A;  1Y0H A;  4QIV A;  2QA2 A;  3A3N B;  3VF0 B;  2J6S A;  2R8G A;  4U7U D;  2OSR A;  4A48 A;  2NXC A;  5LJ3 Y;  1D9A A;  1HMV A;  4JI4 J;  3W3S A;  3V81 A;  3GON A;  3W2W B;  5DLG A;  1U1O A;  1UWB B;  2BEF A;  4RW4 B;  4F2R A;  3I82 A;  3DLH A;  3NAH A;  1BQN B;  1H7X A;  2B7B B;  4USH A;  3CUL A;  2OPR B;  3ZTQ A;  2V8G A;  3M7V A;  2LXU A;  4FYY B;  4DFJ A;  3MM7 A;  4N8O A;  4K59 A;  3ULH A;  1ZPV A;  2MKK A;  2XB2 D;  1G7C B;  3SQO P;  4YY3 F;  3FQK A;  4C3K A;  4RNF A;  4UST A;  1MN7 A;  5A8W B;  4CYU A;  2CQ2 A;  4F36 A;  3T5J A;  2J9D A;  1ZAV A;  4PKD B;  1HPZ B;  4AUK A;  4F0H A;  3P96 A;  2G1D A;  1F60 B;  4IYQ A;  5J2P A;  4P7V A;  3LGH A;  1K9M T;  5C2C A;  1T9X A;  1LQ9 A;  1VGY A;  3ADA C;  4Q0B B;  5D77 A;  4I2P B;  4QR0 A;  5H9F K;  3OVB A;  2XZT B;  1CJV B;  5AJ3 F;  3M30 B;  1RTH A;  2XMM A;  3GYN A;  4KY3 A;  3SCL E;  1LV5 A;  2M52 A;  3GCX P;  4DSI A;  4WF9 Q;  3LF0 A;  4ILL A;  1RB0 A;  2AV5 A;  5K9F A;  4WJB A;  1PIE A;  1ZS6 A;  3DYA B;  4HR2 A;  4JI8 F;  3W2V A;  1S1V A;  4NYP A;  3WX4 A;  3CCR S;  2UU9 J;  1KWM A;  3H2U B;  4Q2M A;  4YN3 B;  4QYZ K;  2X3D A;  3S6E A;  3RB6 A;  5ETT A;  5B0C A;  4QU6 A;  2JJ4 D;  2VG6 A;  5HLF B;  2CJA A;  3U1N A;  4U8Y A;  4CDI A;  2HHV A;  2V4R A;  1FVS A;  3POT B;  4ED1 A;  2UUC J;  4A8K A;  3H59 A;  3EPI A;  1U1N A;  1IKY B;  2H4Y B;  1O6X A;  4IOA Q;  4EYH B;  3KLG A;  2M3D A;  3NG8 A;  4IG0 B;  4J9U E;  4GC6 A;  1RAI B;  3IC1 A;  3PIO Q;  5ITH A;  3J7Z 5;  1IKV A;  5L1I A;  1ZM3 A;  5E3A A;  4LFA F;  2DGW A;  4OYI A;  5C24 B;  1Q95 G;  3FBB A;  2AYM A;  1NKC A;  1S57 A;  4O3S A;  2C2M B;  1YJ7 A;  3BBB A;  3CCW A;  3P5T L;  4P2M A;  4QR1 A;  4X4V A;  4B3S F;  3GIJ A;  2DY9 A;  3MMC A;  1RQ0 A;  5KG1 A;  3NBP A;  3KG1 A;  3ZTR A;  1NB2 A;  4QU7 A;  4K7Q A;  2KU7 A;  2JNJ A;  1U6Z A;  2VU5 A;  3ZZR A;  4CIO A;  2BM1 A;  2HEK A;  2MJN A;  4J90 A;  3SFG A;  4QIE A;  1FJC A;  3GIL A;  2X1A A;  2WW8 A;  3QLH B;  3TJ9 A;  4Q0B A;  2DHX A;  4FYW B;  1N5Q A;  3B54 A;  2VKZ G;  1CJK B;  1FTC A;  3JAM U;  4OI2 A;  4IO9 Q;  5K8N A;  1GAO A;  5G0R A;  5LJ5 Y;  2E1C A;  3M05 A;  5CZV A;  2HW3 A;  1JX4 A;  3GG0 A;  2HFO A;  4TN2 A;  1TEL A;  1Y7P A;  3L4B C;  4V19 X;  2IM0 A;  4IG3 A;  2JDJ A;  2VG7 B;  3KHG A;  1RIS A;  1A7G E;  3SIP B;  2RU3 A;  1RGV A;  5KFT A;  3OXF A;  1OMS A;  3IN5 A;  2R2U A;  4ECS A;  1BC6 A;  1FX2 A;  2JEJ A;  1DTQ B;  3PEJ A;  2L9N A;  3RYL A;  2NLW A;  1NDC A;  1C0U B;  1LXJ A;  3A1Y G;  3QIP A;  1GX5 A;  4ZJL A;  1GXU A;  3WC0 A;  3HP6 A;  3LOU A;  4K4Y A;  4NYO A;  1QAI A;  3EWG A;  3R7B B;  1VQ4 S;  2GVZ B;  2HWI A;  2OPQ A;  1MU2 B;  2OD6 A;  3H4D A;  4F50 A;  4FS1 A;  1NM2 A;  3DCA A;  3PCO B;  4IKA A;  3GR0 A;  4P72 A;  4MKV A;  3PX0 A;  1NSA A;  2EWH A;  3DM2 A;  1WOS A;  1RT3 B;  1VQS A;  4J9L A;  2YX1 A;  2MQQ A;  4ES2 A;  2G4B A;  4USK A;  3MR6 A;  2O66 A;  4Q44 A;  3DDN A;  4IH6 A;  4U7U K;  3DLE B;  3GIK A;  1BMQ B;  3GV7 B;  1GT8 A;  2JWN A;  2HK3 A;  1VK3 A;  3W8P A;  2N7C A;  2JEF A;  3TUP A;  1N0U A;  2OFH X;  3IBF B;  1Q78 A;  2CJ9 A;  1UJ5 A;  4QW9 A;  4FF4 A;  2IBO A;  4RL1 A;  2QIF A;  2JSX A;  2B5J B;  4ECZ A;  2ASD A;  5CYM B;  1FJE B;  1RBO B;  1UET A;  2FHO B;  2VF3 A;  2YNH B;  2KZM A;  5KFR A;  4CT8 A;  1S7I A;  5L8R C;  4X4Q A;  1RTD A;  2F63 A;  2COL A;  2DB1 A;  3NS5 A;  4DR3 F;  3M4X A;  4LR7 A;  2FTR A;  1HBM B;  5D0E A;  1X8D A;  3CJT A;  3MZI A;  4QCL A;  3JYT B;  2M70 A;  1FFG B;  3I96 A;  2XLK A;  2KRB A;  2MEW A;  3QPI A;  4OYM A;  5AE3 A;  1IJE B;  3PTW A;  4RNH A;  1U0S A;  4RW4 A;  3C15 A;  4D3H A;  5A76 A;  4YHH F;  2YQ0 A;  2EC0 A;  4M63 A;  3JSM B;  5I42 A;  2Y8W A;  4MT1 A;  5FJ4 A;  1DUR A;  5AXK A;  5IXU A;  1FNX H;  4RW7 B;  1Z4U A;  1FD8 A;  2MZQ A;  7FD1 A;  5KFK A;  3L7P A;  4DL6 A;  1NCL A;  4OX8 A;  3SQG B;  4LVN P;  3V4I B;  2Q3P A;  4AND A;  4ED7 A;  3R6L B;  4U67 Q;  3CF5 Q;  5H9E J;  5GMD A;  1FKP B;  2A2C A;  3W9H A;  2I2Y A;  4LF4 F;  1M0S A;  1FA0 A;  2QLB B;  1R8P A;  2E1P A;  2LQ8 A;  5D15 A;  3AXK A;  3UR3 C;  2J0Q D;  3KJQ B;  1JLQ A;  5KFO A;  2DGQ A;  5ETP A;  1AUS L;  1RT4 B;  2C1E B;  5HRO B;  2VUG A;  2BW7 A;  1N88 A;  4OX6 A;  2POK A;  4WE1 B;  1RWW B;  4NLD A;  5DG9 A;  2AT1 B;  1I94 F;  5LXY A;  3P45 B;  5DGB A;  2R2R A;  2DNY A;  2Y9H A;  1L3U A;  2C2O B;  5D0G A;  4PXB A;  2V94 A;  1CC7 A;  5IC4 B;  4QBU A;  3T1Y J;  4LMZ A;  2UXB J;  2DHS A;  2BQU A;  2JC1 A;  4FN5 A;  4ZPB A;  1S1U A;  2V8D A;  2CRL A;  5B0D A;  2DO0 A;  3TAQ A;  4N5S A;  2ASJ A;  4RX6 A;  1KTQ A;  2DNQ A;  4TLR A;  3MMB A;  1P9Q C;  2MZ1 A;  4DV0 J;  4ATN A;  1ZET A;  1HBO B;  1HL6 A;  1L3K A;  1S1X B;  3BGO P;  3CIM A;  4OI6 A;  2ZM6 F;  1M5H A;  3SCJ E;  3TAN A;  4ZDN A;  2IM2 A;  2KI2 A;  2V50 A;  3JQK A;  4H4O B;  1CS4 A;  3DDK A;  3Q86 A;  2YPY A;  1PKU A;  1UCN A;  4P2F A;  4USU A;  2GNK A;  2LP4 A;  1NH8 A;  1H2T Z;  3FBE A;  5CD4 A;  1ZOT A;  1U09 A;  2V2Z A;  1LWE B;  1F9E B;  4NCG B;  3PIP Q;  1V5V A;  3HVT B;  3GJR B;  4FDF A;  4IG3 B;  1B99 A;  1FKP A;  4X65 J;  1VQ5 S;  4DR6 J;  4MAK A;  2HZA A;  1T05 A;  2R7T A;  2E66 A;  2B4V A;  1I51 B;  2RH3 A;  1JLE A;  1S9G B;  1WHW A;  3HHE A;  5IOL A;  5F9L A;  3T5L A;  4Y34 A;  1TQL A;  5LOQ A;  2I5J B;  1KHW A;  2RKI A;  2XWY A;  2B9W A;  3E01 A;  2VBW A;  2N4D A;  4HVZ A;  2MQL A;  1FTR A;  1QJH A;  2HNY A;  3C66 A;  4WCE Q;  3RB3 A;  2MGZ B;  1RE1 B;  4XDD A;  3IRX A;  4GVL A;  4LR9 A;  3X1L B;  3OHB A;  3W7B A;  3PHT A;  3VVT A;  4DI6 A;  2FVQ A;  2G0C A;  1RAB B;  2E9R X;  4F4K A;  4RUB A;  3NBP B;  1B4S A;  5EWG A;  3HI9 A;  3GB0 A;  1WWH A;  1YJV A;  1YLX A;  3CJ0 A;  1VC0 A;  4HT7 A;  1GFW B;  1MWZ A;  2W2O P;  4BWM A;  2Z56 B;  3BDE A;  2X1F A;  4DG1 A;  3KLE B;  4R0J A;  2RDI A;  3ZTP A;  2WBM A;  1IWG A;  2CA9 A;  4AL7 A;  2DNM A;  1XC9 A;  4FNI A;  2YWF A;  2ZKU A;  2J6T A;  4ZLJ A;  2V4J B;  1VDH A;  3F56 A;  2BE9 B;  4P6Q A;  5E3Q A;  3RR7 A;  3DOK A;  3NNA A;  2CIM A;  3SYZ A;  4LQ9 A;  4WZQ A;  2F9D A;  2QMW A;  2DRD A;  3B6B A;  3HJF A;  1AT1 B;  2E9Z A;  2HHS A;  4EZ9 A;  4DR7 F;  5D6G A;  5D0H A;  3OJS A;  5F8J A;  1YWX A;  2BYC A;  1HLW A;  2HZC A;  3S01 A;  4KR0 B;  3RBX A;  4KKO A;  5GAD I;  2VB6 A;  3ITH B;  4ZPT R;  4A8S A;  3KLH A;  4JI2 J;  2BW2 A;  1HWL A;  5K8P A;  3M8Q B;  3UN3 A;  1PC5 A;  2HVD A;  2PA8 D;  3PDN A;  3MCS A;  1RP5 A;  2IRX A;  1KLN A;  3G82 B;  1RJJ A;  4NLU A;  2NXE A;  1RTI B;  3VTI A;  2J9C A;  2CQC A;  4CO4 A;  1Y3K A;  4X4T A;  4URG A;  2CNO B;  2WZ1 A;  3F44 A;  5IM0 B;  2ZH4 A;  2B4O A;  3OL6 A;  4WP8 A;  2IC3 B;  5K14 A;  1URN A;  2AQ4 A;  3PYF A;  2M8D B;  1CEZ A;  4JI7 J;  2QL5 B;  3N6L A;  2LDY A;  1NEE A;  3M2R A;  4HTJ A;  2DPI A;  1FWK A;  3EVW A;  2QO3 A;  1S9E A;  3DU6 A;  3IGV A;  1HQU B;  1Q8L A;  3CW2 C;  1S49 A;  4FKY A;  1UJ4 A;  2PMH A;  2VQE F;  4ZIV A;  4JI1 J;  3M8Y A;  3JB9 k;  3C6U A;  1WC3 A;  1UVI A;  3ENV A;  3IM8 A;  4FXV A;  4DPY A;  1HBM A;  2ABY A;  1NJI T;  3SCK E;  2ZUA A;  4I1T A;  3UFC X;  2GHW A;  1NK5 A;  1IKW B;  1KQF B;  2ZWP A;  3EVM A;  5BJR A;  3OL8 A;  2DEI A;  4R0E A;  1S4F A;  3SV4 A;  3BH6 B;  1RAG B;  2AKW B;  2HND B;  3WZ0 A;  3LP1 B;  3MM7 B;  1F1B B;  3R5D A;  3LP0 B;  4CQ1 A;  2CQD A;  3A3P B;  3KLI B;  5H9E K;  5D3G B;  2PE8 A;  2FZG B;  1NJX A;  4KPY A;  4K4U A;  2ZH7 A;  1JXL A;  1VJQ A;  4PQU A;  1UW9 A;  3ZZP A;  3RBE A;  1OY8 A;  4DV1 F;  4IUF A;  4GO5 X;  2IJR A;  2XMV A;  1L3S A;  3H0P A;  1MSW D;  5E3C A;  1U1L A;  1RA7 A;  1BUX A;  2ILY A;  5I3U B;  3MHY A;  2H9Z A;  1RT7 B;  3DLJ A;  1CBK A;  4HH0 A;  1B70 B;  2PSZ A;  2KB2 A;  4XK8 C;  2VJV A;  1OY9 A;  1REV B;  3LAK A;  2FC9 A;  2Z0G A;  3DFE A;  4IQM A;  2O3D A;  4CLZ A;  4EFA C;  5KFD A;  3VAG A;  1EIY B;  1HWI A;  3HZG A;  3QZ7 A;  2ZBR A;  1TKD A;  1D8Z A;  2D3U A;  5KFF A;  2H5J B;  4I6Y A;  5FII A;  3FFI B;  4DXL A;  3BQ2 A;  2KTQ A;  4M5G A;  4C9D A;  1IM4 A;  1V3S A;  3T3F A;  2HIQ A;  4I4B A;  3GFH A;  2A0F B;  3CJ2 A;  5CCL A;  1ARO P;  1FKO B;  1X5O A;  4Q43 A;  2D9O A;  3AQO A;  1ZPW X;  4CH7 A;  2KKH A;  5F9N A;  1I1G A;  3HT3 A;  2HG4 A;  4WTO B;  4TU7 A;  1WEL A;  2QV6 A;  1JLB A;  5EX0 A;  2XI3 A;  4CI0 B;  2RT3 A;  1RWP B;  3W9J A;  3OSN A;  1AYE A;  1FRI A;  3CC4 S;  3QYY A;  4F3M A;  2WVC A;  3CCU S;  3IAS 9;  4J5O A;  4CH1 A;  3CNQ P;  2XNR A;  1KHV A;  1YBT A;  1S9G A;  2BDP A;  4PWW A;  3M2V A;  2LQ9 A;  3MM5 A;  1F9H A;  4X66 J;  3BGR A;  1VQ9 S;  3I0R B;  2R8I A;  4KHP J;  2BVZ A;  3MTJ A;  4GVB B;  1SKS A;  4Z2X A;  2D41 A;  3JTO A;  5GAG I;  1XMO F;  5IT9 Y;  4U9R A;  3OFF A;  1HAR A;  3I4P A;  2VJU A;  2VFT A;  4QPX A;  3PV8 A;  2HFN A;  2M7S A;  4USM A;  1XNR F;  1REV A;  3CME S;  2CQ1 A;  1R7I A;  2R7S A;  2DKO B;  3R97 A;  1XR6 A;  4C8Y A;  2CAD A;  5DQG A;  5DRK A;  3J80 Y;  1G3O A;  1WSV A;  4B9M A;  3CD5 A;  4B9V A;  1BQM B;  4KYZ A;  3T1H F;  4Y2A A;  1IQZ A;  3ISN C;  5THW A;  5LMN J;  1WKK A;  2DNR A;  3ONQ A;  5AT1 B;  3B4D A;  4ZVS B;  3TA2 A;  4MJK A;  3TAM A;  3FNN A;  4IG0 A;  5KFC A;  1VQY A;  3UD5 A;  5J2Q A;  5LSR A;  2ZIT A;  2MLX A;  1IKY A;  2GX8 A;  1B7F A;  2DIT A;  4LRC A;  4JYA F;  1JLA B;  2LXI A;  3IFE A;  2DCL A;  1F9F A;  1YBU A;  2FHJ D;  3CCM S;  3TA0 A;  2ZC3 A;  5G0R B;  3TVY A;  4ER8 A;  2XWX A;  5J2N A;  3GV5 B;  2OHD A;  3AOC A;  3AOB A;  2DT9 A;  6FDR A;  1Q7Y T;  2LVW A;  2QC3 A;  2QN6 B;  1S99 A;  2OML A;  3M1V B;  1ACM B;  1X4E A;  2F7V A;  3V6K A;  2M2B A;  1Q79 A;  2O01 C;  3D6F B;  2QYC A;  2WHO A;  4H54 A;  1O5J A;  1P27 B;  3NKY A;  2BM0 A;  4C0B A;  1GTH A;  3W2V B;  4NEY A;  3TZZ A;  2V9W A;  1SQF A;  9ATC B;  2BAN A;  3M9M B;  2VQE J;  1D0E A;  1S76 D;  3K58 A;  2G9O A;  4LSL A;  2MGZ A;  2XMK A;  2CVI A;  2HGM A;  2ZJR Q;  2JEI A;  4RUC A;  3G71 S;  2CG4 A;  1Q7L B;  2GCF A;  2FLO A;  3G86 A;  3UD3 P;  4X64 J;  3SCI E;  2CZ9 A;  3R5C A;  4DSE A;  3VAL A;  2P9C A;  2FVC A;  4ZOS A;  3ZNU A;  1FXR A;  2C2D A;  4ED4 A;  2IM1 A;  1EET B;  4RW9 B;  2XY6 A;  4V19 J;  1WDT A;  1ZZF A;  3FEX B;  3H2V E;  2HVE A;  1FDN A;  4X84 A;  3EDQ B;  4A8W A;  1EZZ B;  4DG1 B;  3PW7 A;  3PX4 A;  1VCT A;  3D0H E;  1RTD B;  1TL7 B;  2RSQ A;  3IS9 A;  4I7F A;  4QYZ J;  4QR2 A;  3G96 A;  2LEA A;  3U1L A;  3NGT A;  2DHH A;  4W98 A;  5ETM A;  3ZO7 A;  5HVH A;  3UR0 A;  4DR2 J;  4HTI A;  1FRJ A;  1XER A;  1WOP A;  3MM6 A;  4CNY A;  3Q8S B;  3RW7 A;  3QBC A;  2BQ3 A;  2GC8 A;  1HBU B;  1HNX F;  2FJX A;  3ITH A;  4R25 A;  3D1Q A;  4A46 A;  4BCA A;  4M5I A;  2F8H A;  3K5L A;  3I55 S;  5E5N A;  2A1B A;  1QAX A;  3QGI A;  2J0W A;  4DR7 J;  3UCG A;  2DVI A;  2YX7 A;  1EHW A;  2W25 A;  2DNG A;  2CPZ A;  2IRU A;  4KTQ A;  1CLF A;  1VRU A;  3TRG A;  3MDF A;  2XMA A;  2KJW A;  4IFY A;  1PAU B;  1AFI A;  2HRU A;  4JV0 A;  2ZZN A;  4ZVQ B;  1GXT A;  4NX9 A;  2H5E A;  1SJ3 P;  3TZX A;  3G82 A;  4MYU A;  2XO7 A;  1TMM A;  3M6V A;  1Y3J A;  3GCW P;  2FZC B;  2PMZ D;  4ES3 A;  1U1Q A;  4B9U A;  3AD8 C;  2NSB A;  4DF4 A;  1I3O B;  2P2C B;  3M8W A;  1BE4 A;  2QMX A;  1OO0 B;  4RUH A;  1RHR B;  4X4O A;  2CQI A;  2RB7 A;  4DL3 A;  4NZ7 A;  4D3G A;  3THT A;  2C3M A;  2QLW A;  4F8R A;  4J9V A;  2KVI A;  1X4H A;  1NK9 A;  4DQI A;  2ZJQ Q;  4RO0 A;  1JIH A;  3OV7 A;  1Q5V A;  2CQ3 A;  5LXR A;  1R8A A;  3NRB A;  5FLX U;  3WX8 A;  1SL0 A;  2KZZ A;  3O5T B;  3W2W A;  1RLC L;  4HAC B;  5GME A;  5B0G A;  2NPF A;  1IM6 A;  3AOD A;  2CQG A;  2ZH6 A;  2B43 A;  3GJT B;  3LP0 A;  5HK4 A;  4A8Q A;  1U6B A;  1FD2 A;  3BRE A;  4R8U A;  2D3O R;  1CC8 A;  2QRR A;  4NLQ A;  4OLP A;  4DV2 F;  1Q16 B;  1U8S A;  3ILO A;  3OD2 A;  1MWQ A;  2OP5 A;  5GAD U;  2BV3 A;  5IWA J;  1NSP A;  3M6U A;  4ZVF A;  3Q22 A;  3RBD A;  3EZ5 A;  3H5S A;  4H4O A;  1NK4 A;  2BOP A;  2VFU A;  2HVZ A;  4OIX A;  2RDJ A;  2UUB J;  1RT7 A;  2HQC A;  1N0V C;  1RT1 B;  3A3O B;  3C16 B;  2PC6 A;  4OYZ A;  4ZPW R;  2MXY A;  3BGR B;  1RA6 A;  3FCH A;  4G1Q B;  4OYP A;  5KG3 A;  4DUZ F;  2IPO B;  1KON A;  1I94 J;  3MAA B;  3CIZ A;  1FRX A;  1B3T A;  3K7R A;  1HQU A;  3DOM B;  3O1L A;  5L1J A;  2K1R B;  2A3J A;  1RT2 B;  5C25 B;  3MM9 A;  3PW5 A;  3THV A;  1WG5 A;  2I5J A;  4B17 A;  2DR8 A;  4BC9 A;  2P6S A;  4ZVE A;  1FDB A;  3KMS A;  4JI0 J;  1KFS A;  3TW0 A;  2E7W A;  5D4L A;  1R27 B;  2ZBC A;  4FKX A;  1Q8K A;  4R5P A;  2PD1 A;  2QZ8 A;  2DR5 A;  4NXN J;  3HDS A;  3JSM A;  1U2F A;  3KFW X;  2BAB A;  3DKD A;  3PHE A;  2VC1 A;  3X3U A;  4WP9 A;  3THP A;  3KNG A;  4PG5 A;  5DDR C;  1IJF B;  3BN7 A;  5CXT A;  4ZCI A;  3SEO A;  2B8Q A;  2BZ2 A;  3CJS A;  2BJD A;  1RAF B;  3Q2T C;  2FGO A;  1UA1 A;  2XYG B;  4DFM A;  1VQK S;  3FRY A;  1NH7 A;  1IN0 A;  2JLE A;  3N4W A;  3B8H A;  2B0G A;  2GVD B;  2YH0 A;  2E5L F;  1RAH B;  3KUH A;  4ZN3 A;  4LQ3 A;  4K4V A;  1JKH A;  1VBK A;  1HHS A;  3NAI A;  2MKY A;  3VAJ A;  4O4R A;  1Q5Y A;  2KDO A;  1PCA A;  3BM7 A;  3IBW A;  4L6V 3;  2NPI A;  3L7O A;  3C3L A;  2Y8Y A;  1H2U X;  1ZAW A;  4EO6 A;  2LQ5 A;  4EU0 A;  3TUI C;  4G1Q A;  4BDP A;  4KHM A;  1YJW S;  3R5J B;  4MK9 A;  4NOH A;  3OR2 A;  2FVR A;  2ZNZ A;  3HFZ B;  3KKF A;  4DCJ B;  5E3P A;  3CCL S;  4DV6 J;  3KUE A;  5HP1 B;  5U47 A;  1EP4 A;  2MHN A;  5T14 A;  2OH2 A;  1XBW A;  4LSL B;  1QVG R;  3HSJ A;  4ZP9 A;  4FYX B;  5KG7 A;  4KGM A;  1GEH A;  2V63 A;  3BBF A;  4TQS A;  2KN4 A;  2AEF A;  3TZY A;  4YOE A;  3MPY A;  3KLE A;  1KVK A;  3W61 A;  1P6T A;  3I0S B;  3ZXW A;  2DXD A;  8RUC A;  4B3T F;  2GJ2 A;  4AFF A;  1T9W A;  4ECV A;  4RKU C;  1WOO A;  4OZN A;  4EK2 A;  4OL8 A;  3HFK A;  4M5N A;  3PM9 A;  1RCX B;  1YDL A;  3BO3 A;  3QRP A;  2VV5 A;  3IXQ A;  4MKA A;  2NXJ A;  4L74 A;  4WTY A;  4DX7 A;  4ERD A;  1NDK A;  3DXB A;  1IBM J;  2MKJ A;  3OUY A;  2YQ1 A;  3CXC R;  1YVF A;  2HHH J;  2MHE A;  3HCX A;  1KFD A;  4ENO A;  3VGV A;  2JVR A;  2VG7 A;  3VQS A;  4DX5 A;  5B09 A;  2ERR A;  5JJB A;  3BGF A;  2D3Z A;  1FRH A;  5HAO A;  3QGH A;  1TK8 A;  4O3R A;  3PFO A;  4P73 A;  2C28 A;  3ZZT A;  4J9N A;  1RKJ A;  2WSC C;  3HMJ G;  3DLK A;  3IRW P;  2FJA B;  1KBR A;  1RHJ B;  1KOO A;  2PEH A;  4TKT A;  3BZQ A;  2QL7 B;  2RD5 C;  2HHQ A;  3B78 A;  3QMQ A;  4KH1 B;  2D9P A;  4MK7 A;  3GII A;  4K0K J;  2MZR A;  1SXL A;  2BKN A;  2HWH A;  4E2F B;  2HNZ B;  4ZKA A;  2G13 A;  3R1L A;  1FWP A;  2JFK A;  1N52 B;  2VC0 A;  3B82 A;  4UTG A;  1SKW A;  4K4Z A;  1RT6 B;  3TO8 A;  2HLT A;  3IWN C;  3G6V A;  2W8L A;  4DV1 J;  1NB7 A;  1HI8 A;  1F2H A;  2J8S A;  3OXG A;  4DS5 A;  1HKA A;  4MMO A;  4V1A k;  5KFN A;  1XR7 A;  4J37 A;  2YKN B;  4HL9 A;  5A8R B;  3CCV S;  3OVA A;  1U49 A;  1NZ8 A;  3DLG B;  5DDQ C;  5KG2 A;  4QWE A;  3R9L A;  3VZH A;  1TP7 A;  2F65 A;  2DIV A;  2YNG A;  4KBI A;  5CYQ B;  4B3S J;  3CCE S;  5EX3 A;  4QWD A;  2DNK A;  3T5K A;  1LW0 A;  1TVR A;  1ZTT A;  2W2M P;  2I6W A;  1BQX A;  1R89 A;  1SKU B;  4QIW D;  1SC4 B;  4HH1 A;  4I6A A;  1N5Y A;  4I6W A;  2XSF A;  4UQG A;  3M1V A;  2D3O 1;  1PJ6 A;  3OQ2 A;  4DMZ A;  3CCJ S;  4YR2 A;  3KDO A;  1YI2 S;  1YSJ A;  4MKB A;  4CO5 A;  2CPJ A;  4NLR A;  3KJV B;  2AGP A;  5M2R A;  3T19 A;  1F3V A;  3HT0 A;  2J0X A;  1TMJ A;  4P7T A;  4DR4 F;  5C7P A;  4ITS A;  1VOM A;  1NPR A;  4IR1 A;  2N3L A;  2QFJ A;  4DF8 A;  4IRK A;  2ROP A;  2YTC A;  3WIU A;  1NLK L;  2F5G A;  3NCQ A;  4PXE A;  3H4B A;  1BGX T;  1HNV B;  4NL5 A;  1K1Q A;  4IFV A;  4KRW A;  2UZA A;  1M5O C;  3OW2 R;  3EGZ A;  2B4P A;  3PRD A;  3KLG B;  4J9R A;  1HPZ A;  3D1H A;  4XTT A;  2ZBP A;  3CSK A;  3DRY A;  4WIQ A;  4OV1 A;  5KOW A;  5KFX A;  4LFC J;  2UXB F;  3NXZ A;  3QT6 A;  3UDL A;  1KLM B;  3NGK A;  4C97 A;  3A12 A;  5I3U A;  3HFV A;  2W01 A;  3CD6 S;  1FO1 A;  3N28 A;  1OYD A;  4GVB A;  1J5E J;  1HD1 A;  4Y65 A;  3JSY A;  3SBM A;  2QA4 S;  1S9F A;  4DV7 F;  3I87 A;  4JI3 J;  3AA9 A;  5KG4 A;  3TAR A;  1NRK A;  1Y5L B;  3CMQ A;  4WFY A;  4JUZ A;  3DNC A;  1TFY A;  4OI3 A;  3A4T A;  3DC2 A;  1N32 F;  2A6M A;  2HGN A;  1APS A;  3PR5 B;  3CC2 S;  2CKW A;  2DNL A;  3ICL A;  2AJ4 A;  1NPK A;  3UDV A;  5HN0 A;  2QA1 A;  1TKZ B;  4DFP A;  2CPD A;  3R5G A;  2ROG A;  3L9Z A;  4M5L A;  1IKW A;  3AT1 B;  1VIO A;  1VLY A;  1MMD A;  2YKQ A;  4K5S A;  2WB1 D;  5K8O A;  1J5O B;  4GMK A;  4P2X A;  5KG0 A;  1N8R T;  2R7V A;  3OBI A;  4I56 A;  2EBE A;  1NSK L;  2DEJ A;  5J2P B;  4RR5 A;  2KYZ A;  1SL2 A;  3W63 A;  3N01 A;  2Y0S D;  1RT1 A;  2OD4 A;  3C16 A;  5ADZ A;  5D3G A;  4N47 A;  2W9B B;  2MQO A;  1TAQ A;  2HPU A;  1Z2Z A;  4NLG A;  3SDE A;  4IH5 A;  1N56 A;  2PN6 A;  2OEK A;  3C8Y A;  3FUY A;  4USV A;  2G2Y A;  5AXM A;  2DD8 S;  3BPD A;  2MTL A;  1HYS B;  1X60 A;  1UVN A;  1SV5 B;  2K3I A;  4RNO A;  4XO0 A;  2LU2 A;  4Z7C A;  1DTQ A;  2E5I A;  4HI1 A;  2FZK B;  3QGG A;  3H40 A;  2IMW P;  2QLX A;  3QWU A;  1E6Y B;  1MWY A;  3J7Y I;  2ZJP Q;  2HAF A;  1IUJ A;  3S8S A;  1WEZ A;  2C2Z B;  4K50 A;  1G1X A;  1KOH A;  5KFZ A;  1ELO A;  5LSO A;  1QSY A;  5K20 B;  1JJC B;  5I3Q A;  2W4P A;  1NO8 A;  5HJY A;  2HK2 A;  4MK8 A;  1VRU B;  5KFA A;  5L1K A;  2UUB F;  3EDR B;  3PVX A;  3E2E A;  3CUN A;  3OTE A;  4DR6 F;  3C14 A;  1ZM9 A;  4M8L A;  4QJV A;  1L3V A;  5CD4 H;  5AXN A;  2A18 A;  4F0K A;  4M5D B;  5CQG A;  3OL7 A;  3CPW R;  2DR9 A;  4EGL A;  2IVM A;  4DR1 J;  1X4F A;  2A2D A;  2MY7 A;  4NMX A;  4A47 A;  1VQ7 S;  1S7H A;  2EPI A;  1S10 A;  2AX0 A;  3PO4 A;  3FSX A;  2AJQ A;  3CD7 A;  2MZS A;  2N7Y A;  4NLX A;  1VQP S;  1VBZ A;  1RYR A;  3EGW B;  1ZBT A;  3BR8 A;  2HHX A;  1T9V A;  4DDF A;  1GQE A;  1X9M A;  1RTZ A;  2PT0 A;  3MPU B;  3JTP A;  2CJK A;  3A8J A;  1UVK A;  1JQG A;  4UZC A;  4F26 A;  1SQG A;  3HVA A;  4CLT A;  3D54 A;  3QFW A;  2YWG A;  5IV4 A;  2XY5 A;  3PNI A;  4OYW A;  4OX9 J;  2UVU A;  3FZ2 A;  1ICE B;  2GML A;  3CT9 A;  3AD7 C;  5ETQ A;  4EEY A;  2I8E A;  3GFY A;  3CDB A;  3N6N A;  1NXI A;  3M2U B;  3QZ8 A;  1QE1 A;  1U0H A;  1NJY A;  1WC1 A;  1FEH A;  3BF4 A;  1S5Z A;  3H90 A;  4P2S A;  2IDL A;  4USI A;  3K59 A;  3UCU P;  2P9E A;  1D1U A;  1VYA A;  2BMB A;  4O44 B;  4TLQ A;  1KRP A;  1JWW A;  1CQM A;  1T3O A;  2VOO A;  2CFX A;  3MMA A;  2G0J A;  1RT3 A;  3HHK A;  2H65 B;  3UPF A;  2VQF J;  2PFF B;  2YPZ A;  1SC3 B;  3EGV A;  4KSE B;  4PZV A;  3MUR P;  1WI8 A;  3GIR A;  4C8Z A;  2DIS A;  4EUV A;  3GWC A;  4NEZ A;  1HNW F;  4DV4 J;  3VQT A;  3DOL A;  2AP6 A;  2KM8 C;  3GTY X;  4UOG A;  2QA4 G;  1JLC A;  1TL7 A;  1B0T A;  4I7F B;  1T9T A;  1X7V A;  3R7S B;  2IC3 A;  5KFY A;  1UVJ A;  4UY8 T;  4HHH A;  5E0O A;  3TNV A;  1TKT A;  3WBZ A;  3OHA A;  2XS7 A;  2NQP A;  4BC7 A;  3JQM A;  3MR2 A;  4OZJ A;  5CHC B;  5JMN A;  2JVO A;  2UUW A;  7FDR A;  3I4H X;  4DV4 F;  2HS0 A;  1FWL A;  2GV1 A;  2B6A B;  2QL9 B;  4ES1 A;  1FF2 A;  1TTH B;  5HBM A;  5DDP C;  4MKY A;  2VIC A;  2HBZ B;  3KDN A;  3CDU A;  2XCP A;  3CD0 A;  3PEH A;  3QAE A;  4KE5 A;  3QJJ A;  1RAE B;  4CLS A;  3I5B A;  2CDR B;  4HHU A;  4B3M F;  4UF4 A;  3C15 B;  4YDD B;  1TK0 A;  2EFQ A;  3NMA A;  1VR6 A;  4NCA A;  4QPT A;  1S6U A;  2AYB A;  1VBX A;  2EK6 A;  1N36 F;  3F73 A;  5LT5 A;  2XUL A;  2V2K A;  2E5J A;  2HGL A;  1KR4 A;  2QG9 B;  3OFH A;  5C2G A;  3EXY A;  1HNX J;  2OEJ A;  4KIA A;  4F25 A;  4PUO A;  1S0V A;  3ZZY A;  1S1T B;  1YIT S;  3I0S A;  4FYV B;  1RT5 B;  4L76 A;  1PJ5 A;  3KLF A;  1UPP A;  3QO9 A;  1WI6 A;  4CRJ A;  1IVZ A;  3M8R A;  3JSR A;  1FE0 A;  1B0V A;  3SDE B;  3LUY A;  2HHP A;  4LSN A;  4OJG A;  5D78 A;  5BYQ A;  1P1T A;  5HAT A;  1NBE B;  2NUU G;  3MAA A;  4F4W A;  2J7K A;  2RDD A;  3EE3 A;  4EMD A;  2FJW A;  2U1A A;  3R3T A;  3L09 A;  4NLV A;  1IBL F;  1XR5 A;  3LWM A;  1CPZ A;  3UE2 A;  4ILM A;  1WOR A;  2OPP A;  5B0E A;  4EBD A;  1YTY A;  1S0N A;  4YB1 P;  4JI6 J;  1B64 A;  1N5V A;  2Z2Z A;  1ZAX A;  3AA8 A;  2R7W A;  4ELT A;  1VC5 A;  3NMR A;  4UQT A;  4F04 B;  2FY1 A;  2LA6 A;  4EBE A;  4L72 B;  1VRT B;  4K4T A;  2RQM A;  4P10 A;  2AYG A;  1WC6 A;  4F02 A;  2FDN A;  2R3V A;  4B9T A;  2YVS A;  4JP8 A;  4LBP A;  1SUQ B;  1MW7 A;  1XIQ A;  3WIV A;  4DN0 A;  3P8B B;  3WC2 A;  2RHQ B;  2RJZ A;  4RPF A;  2XGQ A;  5JVG Q;  4JYA J;  2RNE A;  3Q8P B;  2CQH A;  1DLO B;  3KK3 A;  3QSY B;  4NXM J;  1WKL A;  4WFZ A;  3ENQ A;  2MQ8 A;  4OZ2 A;  5EHH A;  2NSC A;  1XNQ F;  4DX6 A;  4DL5 A;  1M5K C;  3M8P A;  2CJX B;  2GAH C;  2FVS A;  1JKH B;  2BJ8 A;  2H3E B;  3W5Y A;  4DPO A;  4L75 A;  3PW4 A;  2I9S A;  4NA3 A;  1U24 A;  4DQR A;  4KGZ B;  4IRC A;  4TYA A;  2FJB B;  1R43 A;  2BXJ A;  3Q83 A;  5L9X A;  2Z4P A;  2HBY B;  1MN9 A;  2AEJ A;  1RTH B;  3QT5 A;  1XMB A;  1RT2 A;  2K1R A;  2Q43 A;  5C25 A;  2YWE A;  1HD0 A;  4ANC A;  2CPX A;  2Z57 B;  4DUZ J;  2WTF A;  1EAR A;  1UZD A;  2ZE2 A;  3OTO F;  3EGN A;  2K06 A;  4Y3C A;  5HMY A;  2ACM A;  3GSD A;  3MMB B;  5J2M B;  1QM9 A;  2WAQ D;  4C8L A;  3MEG B;  3UI3 A;  4CLU A;  3HHL A;  4CM0 A;  1T95 A;  2AWZ A;  2Q1L A;  2IVF B;  5F8I A;  3MUM P;  1UP1 A;  3CGI A;  4X4N A;  1T8E A;  2F3J A;  2VBY A;  2RUS A;  4DEZ A;  2XM3 A;  2XBP A;  2HIY A;  2QYG A;  4HT5 A;  1FHT A;  1TV6 B;  3NS6 A;  3K5N A;  4ZIT A;  5IFM A;  2B4U A;  1LFW A;  5KFB A;  1MRO B;  3R1H A;  2XTJ P;  1GH8 A;  2EFG A;  2FUG 9;  1YGY A;  2ZZT A;  1PGZ A;  4LIR A;  5F8N A;  4DBQ A;  3M6X A;  1N33 J;  2O67 A;  5C42 A;  1MLA A;  3NNH A;  4LFC F;  2NS1 B;  3KLV A;  2HBR B;  5GAE U;  2UU9 F;  5L46 A;  2C2N A;  2JHE A;  1SH2 A;  3FJ2 A;  3HHL D;  2H1Y A;  3K89 A;  3SFU A;  3H5Y A;  3V2U C;  3M2U A;  3MEC B;  1U45 A;  3K5P A;  3N0V A;  4EI2 A;  2YNF B;  1Q53 A;  1Q8I A;  2E1A A;  2IA0 A;  2FGC A;  2BR0 A;  5KFQ A;  2A6O A;  1XQI A;  3QJL A;  1ZYQ A;  2HFU A;  4S0M A;  5AJ3 J;  1FXL A;  3EXC X;  2ZEJ A;  3K57 A;  2N82 B;  3DHX A;  2EW9 A;  3R7N B;  2GJI A;  2RML A;  3E51 A;  4O0N A;  2AZ3 A;  2EFP A;  4KAI A;  4ZP7 A;  4LBH A;  3UQS A;  2VQF F;  3GYG A;  2FQQ B;  2LFV A;  2QLF B;  2YWW A;  2CWX A;  2W7A A;  3AJ2 A;  1H74 A;  2MQM A;  3BSC A;  1YJ9 S;  5KT4 A;  2Z58 B;  3O2I A;  2E29 A;  4QYR A;  4WXW A;  1H38 A;  1HNW J;  3BH7 B;  3D7S B;  3LGN A;  1Q8B A;  3I6P A;  3Q89 A;  4RBV A;  1XTZ A;  1NHU A;  1PYS B;  3MPW A;  2X1G A;  1WUU A;  2IBK A;  3RAQ A;  1RLD A;  3MEK A;  2E1M C;  3MF5 A;  3JYT A;  1JJ2 R;  2B6A A;  2DGX A;  2V4J A;  4OQJ A;  5KFE A;  5I4M A;  2ZOF A;  3VAF A;  2MST A;  1N33 F;  2PA3 A;  1RWU A;  2FLL A;  2XHW A;  4F4Y A;  4AL6 A;  1TFW A;  3MD1 A;  2OPQ B;  4CCH A;  4PQA A;  1FXD A;  3MWB A;  2Z2Y B;  1AZS A;  1WF1 A;  4UW2 A;  2RIL A;  4R8U B;  3TQE A;  4NZ6 A;  1X31 C;  4X65 F;  4WYW A;  3IP0 A;  1VS3 A;  2AHO B;  4HDH A;  4ZPD A;  1HIY A;  4KGK A;  4ALZ A;  4CNZ A;  2KO1 A;  2PMW A;  3P3D A;  4OJH A;  4TU9 A;  1U02 A;  2VAS A;  2LKZ A;  3ISZ A;  3RZA A;  4F7V A;  3DLG A;  4F4Z A;  4ELU A;  1QUP A;  4X2B A;  4DV5 F;  1RU2 A;  4DWI A;  4WWS A;  4AYB D;  5A0Y A;  3M2R B;  2IA6 A;  1BD6 A;  5KFM A;  1A6L A;  1DQA A;  1NHK L;  3NY0 A;  2MQN A;  3BPS P;  4PG8 A;  1IBM F;  2E44 A;  1RSC A;  4CZC A;  4YB6 A;  1SKR A;  4JV1 A;  4LF5 J;  3I0R A;  1WF2 A;  4CLY A;  1N34 J;  2V9K A;  2WVF A;  4DOZ A;  3O6Q A;  2H48 B;  3PAC A;  1UTA A;  1DRZ A;  2DTJ A;  5B08 A;  1RHQ B;  1K0V A;  1YIJ S;  4DFK A;  4WZM A;  3EZU A;  2B9Y A;  3QFH A;  1NK6 A;  3MED B;  1M1G A;  3M9N B;  3HM9 A;  3G8Q A;  2AX1 A;  4OZ0 A;  1T03 B;  4OHY A;  2Q6B A;  2WSE C;  3V4I A;  8ATC B;  3SSR A;  2EKN A;  2XZW A;  4Y0F A;  4FF1 A;  2V2Q A;  3W5X A;  1XMQ F;  1S48 A;  3GSI A;  2M5Y A;  3BS9 A;  3TUZ C;  4KT0 C;  1LWC B;  3LGM A;  3EX7 B;  1FI4 A;  1HQ2 A;  1GMV A;  2Y1L B;  3H42 A;  2H51 B;  3CCS S;  4DUY F;  4WYL A;  4DLE A;  1MNE A;  2VPZ B;  3H2L A;  1MRO A;  1LKZ A;  4IFV B;  1XEZ A;  1JXE A;  1M5P C;  4N76 A;  4CYU B;  3DLB A;  1HWU A;  2IIH A;  1SL1 A;  4PUO B;  4CO1 A;  4F67 A;  3SI8 A;  2ZFH A;  1RBL A;  3D66 A;  3V5R A;  4DR3 J;  2GQ2 A;  1JLB B;  1HBN B;  1X0P A;  2FJE B;  3D1O A;  3M32 B;  4DS4 A;  1RHM B;  4DSK A;  1EQM A;  2GAG C;  1T7P A;  3ILL A;  4ZVO B;  5A0Y B;  3VAI A;  3AH6 A;  4CLL A;  2B8P A;  2WOM B;  2YKA A;  3HF5 A;  2XZD B;  1QVF R;  1D3W A;  1QUV A;  2BAC A;  3ENA A;  1ZH5 A;  3KHR A;  2J8A A;  2X1B A;  3R27 A;  1S97 A;  2M88 A;  2QFI A;  2M9K A;  2BOA A;  1RAA B;  1V3R A;  3H98 A;  3HPO A;  3W66 A;  1SH0 A;  2ATL A;  1S6P B;  2AF6 A;  3T6B A;  5BYS A;  1IR2 A;  3AD9 C;  3HD1 A;  4OHW A;  4DV7 J;  4F4A A;  2L08 A;  1PBA A;  1W7W A;  4MH8 A;  9RUB A;  4JI3 F;  2VKR A;  3GJQ B;  4RWW A;  5CYJ A;  1AA1 B;  1BWV A;  3FBC A;  1RAJ A;  4KB7 A;  2WRM A;  3POT A;  4B08 A;  4ZK7 M;  2XEX A;  1E6V A;  3M8P B;  2C3O A;  2ZH2 A;  1F6T A;  3TQ1 A;  2J6U A;  1FJG F;  1H73 A;  1YRU A;  1YZ6 A;  2BX6 A;  2QMU B;  3HVR A;  4DV5 J;  4ECR A;  4ELV A;  3PKM A;  1X5P A;  4UT4 A;  4DV3 J;  1K8A T;  4ED0 A;  2APO A;  2ALZ A;  3W60 A;  3MR5 A;  3ENW A;  2V4Q A;  5B0A A;  2F8M A;  5A8W A;  4C48 A;  1S1W B;  3DHW C;  5LMU J;  4J9Q A;  2FYX A;  3HUL A;  1HYS A;  3G6Y A;  3GP9 A;  1UA0 A;  1C1C B;  3FCV A;  5J2N B;  4C8K A;  3OTB A;  4ZA1 A;  2MZT A;  2V5H G;  3C6U B;  2ROE A;  3L7U A;  2VG5 A;  3K8W A;  1EX8 A;  2GO9 A;  1UVM A;  2UXC F;  3MMA B;  2B7C B;  3N5F A;  4PXC A;  2ZUG A;  3IG1 B;  3JQJ A;  1R6Y A;  3TAP A;  1OQ6 A;  2DY1 A;  5F3T A;  1RTI A;  2JC0 A;  4CO3 A;  1TR0 A;  1OSD A;  2YKN A;  3D0I E;  1YRX A;  4NLT A;  2F4V J;  2DRB A;  5AE2 A;  1SUQ A;  3VCD A;  2W7P A;  2P6T A;  1Q1K A;  4FVM A;  3LPE A;  4QQB A;  4C4W A;  1SJR A;  1H7W A;  4H4K C;  4R5P B;  5IT0 A;  4EYI B;  3HHD A;  5IT9 U;  1WF0 A;  2R42 A;  5CYM A;  3I31 A;  3QWP A;  4A8X A;  2JH3 A;  4AT1 B;  2FHM A;  3T1H J;  5DM7 Q;  5IM0 A;  2R9L A;  2CNK B;  3QQC D;  1LK7 A;  4ECY A;  1E6V B;  3MR7 A;  4OX9 F;  1EET A;  5K8M A;  3NGD A;  4WU3 A;  2UV8 G;  3JS9 A;  1QSL A;  5ETL A;  2J76 E;  4LF7 J;  2HQI A;  3NLC A;  3J80 U;  4J9S A;  5GAH U;  3DI6 A;  4RW6 A;  1URR A;  2EXU A;  3NWG A;  2ZDO A;  4YEA A;  2Z8Q A;  4DV3 F;  4JB8 B;  2IAJ A;  3CJ8 A;  5HQM A;  2JLG A;  3VGT A;  3PX6 A;  1W25 A;  3KXD A;  2UUC F;  1F5B A;  3IBC B;  3PJ9 A;  4ZVG A;  3P49 B;  2HQG A;  4KKO B;  3UVJ B;  2QT7 A;  5DQI A;  1HNV A;  2Z2L A;  3Q8U A;  3RAM A;  4OZL A;  1SCJ B;  2EKY A;  3FGV A;  1GNK A;  1DQ8 A;  1JNR B;  2EI5 A;  3MM8 B;  2BJ7 A;  3BKT A;  2CQ4 A;  1W2I A;  2RS2 A;  2YH1 A;  3VAH A;  4O4G B;  5D8H B;  4L73 A;  2ASY A;  1DLO A;  1Q4R A;  1FNO A;  2FHJ A;  3CWJ A;  3OLB A;  5GAH I;  2YXL A;  2RHS B;  2W24 A;  6FD1 A;  4FPI A;  1RAC B;  3G87 A;  2KH9 A;  3TX0 A;  4M1K A;  4JI2 F;  1DTT A;  1TZ0 A;  2GIF A;  3GYX B;  3IS9 B;  4KO0 A;  4K4S A;  1AFJ A;  3BKU A;  3IWX A;  4YB5 A;  5F0U A;  1RWK B;  2MYF A;  3GFZ A;  2XLJ A;  1LEO A;  3M8Z A;  1Y11 A;  3MCO A;  3I5C A;  5BYR A;  3MD3 A;  1QY7 A;  4OYA A;  4RNN A;  1R0A B;  1UW4 A;  3LW5 C;  4DPT A;  5HMW A;  4ICL B;  2KFZ A;  2OSQ A;  5DLF A;  1S12 A;  2CPH A;  2L3M A;  4IR9 A;  4JI8 J;  2CJB A;  2V34 A;  5HAN A;  4F3O A;  2V69 A;  4EBC A;  2K7K A;  4C11 B;  3FVY A;  2DHA A;  3KHL A;  1FDA A;  4RW8 B;  1J5O A;  2VBX A;  3H20 A;  5D0R A;  3D3C J;  4F2S A;  1K73 T;  3MED A;  2ACY A;  3M9O B;  1VRT A;  2Z30 B;  1LFP A;  1FRM A;  3Q0A A;  1TV6 A;  5DM6 Q;  5CCM A;  2LU1 A;  3CMA S;  2XQC A;  4NCG A;  1WSR A;  1Y9O A;  4WKY A;  2W1B A;  2YKM A;  4TYB A;  3IM9 A;  4U7C A;  3C6T B;  2XNQ A;  4MYT A;  2K8G A;  2VBZ A;  3EJM A;  3VHQ A;  3F0N A;  4EO8 A;  4NXN F;  2DXF A;  4O3N A;  2XS5 A;  5KT3 A;  2J5A A;  4NPO A;  1B7Y B;  1XJW B;  1M5V C;  3FBF A;  1KLM A;  1BHN A;  4LRD A;  1RK8 A;  2G2Z A;  1X9W A;  1FES A;  1S6Q B;  2NYI A;  2ZE2 B;  3CJK B;  2HNY B;  1ROF A;  3CCQ S;  4I2P A;  4N56 A;  2GJF A;  3BGU A;  2D1C A;  1R0A A;  2LMI A;  4LF6 J;  2YX4 A;  4KV8 B;  5LM7 E;  1VQL S;  3GMG A;  3T41 A;  3GQC A;  2KM8 B;  3G8S A;  4RLE A;  2B9X A;  1KEK A;  4ED6 A;  4LFA J;  4GKK J;  5F8L A;  2IYI A;  2AJ1 A;  3ZFV A;  2LYV A;  4LBI A;  5E3R A;  4ZS6 A;  4DU8 A;  3VAK A;  1W2B R;  1FDD A;  1PYO B;  4LJM A;  2HQ3 A;  4BBY A;  2UXC J;  1TAU A;  4J91 A;  3HHL C;  2YNI A;  4NRU A;  4AQY F;  4URS A;  1JLA A;  1FX4 A;  2A10 A;  1UJ6 A;  1VHI A;  2ZD1 A;  3D5M A;  4OZ1 A;  4O0I A;  3G6E S;  1FJG J;  4U95 A;  1WHX A;  4ECT A;  2HHH F;  2ZVS A;  2ZZM A;  2E1R A;  3M8S A;  1JJ4 A;  3DMJ A;  3EYZ A;  4HHJ A;  1S77 D;  2GQQ A;  3IR6 B;  4TNO A;  3KJN B;  4A8M P;  1X9S A;  2KXF A;  3C6T A;  1T05 B;  1Y10 A;  5AXL A;  5CH7 B;  3MXH P;  2YQ3 A;  3MCM A;  1JLF B;  5B0F A;  2EG1 A;  1U1R A;  3QT8 A;  2KG1 A;  5IQQ A;  1YBA A;  1EQ0 A;  1R6V A;  3D2W A;  2WK4 A;  3C2P A;  4ID8 A;  3AXM A;  5T7L B;  3W65 A;  1AUD A;  2AD9 A;  4JI5 F;  3HHL B;  1E6Y A;  4LRF A;  8AT1 B;  3SV3 A;  3RR8 A;  4I69 A;  1UMJ A;  1VIS A;  1RI7 A;  3QT7 A;  4OHX A;  2KHD A;  2BJE A;  1NHV A;  3HSZ A;  3RUB L;  2CZV C;  4K2X A;  2ZDP A;  3K0J A;  3PO5 A;  4ECW A;  1OPZ A;  1VLO A;  2OKQ A;  3ELH A;  3CE8 A;  2AIR B;  1WC5 A;  1S6P A;  4QOT A;  2IMO A;  1R0B G;  2MMY A;  1A0O B;  4ZVP B;  3ILJ A;  3U1M A;  3DDI A;  2BUN A;  1NZA A;  4DUY J;  2Y3Y A;  4E8U A;  1M5S A;  2K3K A;  3OJU A;  4Y6I A;  1FCA A;  1NME B;  4YHH J;  1J2V A;  4IDK A;  4FF3 A;  2MSS A;  1OJ4 A;  2WVE A;  1HNI A;  1RAD B;  2DR6 A;  3MMJ A;  2F9J A;  2I1R A;  2IHR 1;  2VL1 A;  2KXH A;  3EM1 A;  3N6M A;  4YR3 A;  2GMH A;  3M32 A;  1PG5 B;  2RAQ A;  3PJW A;  4PXD A;  4C7Q A;  5HMZ A;  2N3O A;  1NKE A;  3EMT A;  4YY3 J;  4DR5 J;  4NML A;  3MMC B;  4N8N A;  4PG4 A;  3KUG A;  3S1T A;  3OFG A;  4KPC A;  1OS5 A;  1N6Q A;  5ETV A;  5F3Z A;  2R7Q A;  2Y1R I;  2BJ9 A;  3SMZ A;  1SIZ A;  2RQK A;  4J7C A;  3DGV A;  5FD1 A;  4X4S A;  4AXI A;  1YK9 A;  4LFB F;  1BQN A;  2X7I A;  2ZBI A;  3P5B P;  4ZCL A;  3W8G A;  3ZTO A;  5ETO A;  3ZNJ 1;  4PYA A;  2ATC B;  4BWJ A;  1CJT B;  4X62 F;  1IBC B;  2XHC A;  2HAI A;  1H98 A;  3HKW A;  1IWA A;  1H6K X;  3A8K A;  4OJ1 A;  3QGP A;  1MML A;  3AAW B;  3AFG A;  3ZC4 A;  2VPY B;  4ZPC A;  1SC1 B;  1R3N A;  3IO1 A;  2XG8 A;  2VIH A;  4CLK A;  2FIU A;  3TAM B;  2FLN A;  1HI1 A;  1CUL B;  2RF2 B;  3JSB A;  1P9Y A;  3WDO A;  3QLH A;  2W2Q P;  3FZB A;  1DAR A;  1KTV A;  5ETK A;  2M4M A;  3DRS A;  5I3P A;  1DQ9 A;  2M0G B;  4QWA A;  4JI7 F;  4N41 A;  4LRE A;  2GHP A;  4RU2 A;  2YKP A;  5KG5 A;  4X64 F;  2B56 A;  2C3Y A;  1WC0 A;  4WE1 A;  3NEK A;  1HBU A;  1LW0 B;  1TVR B;  1TL3 B;  4WK3 A;  2WOM A;  3D0G E;  3FEZ A;  4LSZ B;  4NAS A;  3WQP A;  2BE2 B;  3MM6 B;  5KT6 A;  1WEY A;  1FRL A;  3T1Y F;  1PSD A;  4ZJQ A;  3R8Y A;  4ZCM A;  5GMK a;  1VQ8 S;  2P9G A;  1UWA A;  1Y4Z B;  2RU9 A;  1KQS R;  1TUG B;  2LXF A;  4NLY A;  3HSG A;  4CP5 A;  1X4C A;  1T02 A;  3BO4 A;  3PW0 A;  4KC5 A;  4HLB A;  4J9K A;  1Q81 T;  2PEB A;  4KQZ A;  4CTA A;  4A8F A;  4O23 A;  2FJV A;  4ZVT B;  3TR5 A;  3T9N A;  1R8H A;  5H9F J;  1VMB A;  1O51 A;  1ZA1 B;  2FPH X;  2VG6 B;  1KD1 T;  2DBB A;  2DNO A;  3BJY A;  5B0B A;  3PZP A;  5I42 B;  1WTB A;  4C3M A;  3PY8 A;  5LMN F;  5DDO C;  2PGC A;  1N54 B;  3DU5 A;  1RAO A;  3P6Y C;  2AJF E;  2RQC A;  1TKX B;  2B3T B;  4UOC A;  1RU1 A;  4WFB Q;  5DZ6 A;  4DLG A;  4OFZ A;  4XPE A;  5KFH A;  1LWX A;  2V6A A;  3EZO A;  3NOG A;  1NK8 A;  2DCU B;  4FNH A;  3CCZ A;  3MOJ B;  4C2M A;  4W4M A;  4C0H A;  4B3O B;  4K4X A;  1PC4 A;  2CJQ A;  2EG2 A;  3RB4 A;  1YJT A;  5KFS A;  3UWT A;  3RJM B;  1RUS A;  4B9L A;  4K0K F;  4Z7Y A;  1OSC A;  4ZJO A;  1J27 A;  2CG8 A;  3SXL A;  4B3R J;  1S59 A;  3JXO A;  5KFW A;  2KRR A;  2ZWO A;  2EC2 A;  4LF1 A;  3BEG B;  1S4E A;  3PXG a;  1SJ4 P;  5HBM B;  1VK8 A;  1Y00 A;  4Y28 C;  5HJX A;  4FXW A;  5J2Q B;  2IY5 B;  4F3Q A;  3LP2 A;  2KG0 A;  3KNA A;  2J9D E;  1PIL A;  2R8K A;  3R2D J;  2WW4 A;  5CA5 A;  3OR1 B;  2FJD B;  2NZC A;  1TUV A;  5HVF A;  2QLJ B;  5IT4 A;  1VQO S;  1RT4 A;  1U6F A;  2HND A;  2R7X A;  3T5H A;  3DGP A;  4ZMM A;  1KKH A;  2L41 A;  1U48 A;  1GTE A;  3I9Z A;  2ZH3 A;  4EZ6 A;  1JLF A;  2WCX A;  1G6B A;  3FSI A;  4DR5 F;  4TY8 B;  3AJD A;  5F41 A;  4NLP A;  4Y2C A;  4DV6 F;  4NI2 A;  2GVD A;  4LT6 A;  5KG6 A;  3V6J A;  1LK5 A;  2E5L J;  3N79 A;  4AQY J;  2B51 A;  4RBT A;  2YY3 A;  3JAM Y;  2VOP A;  2CPI A;  2HHT A;  2ZOM A;  3LPY A;  4Y00 A;  4K4W A;  2WB4 A;  4M5K A;  4FBU A;  1HMV B;  3QAU A;  3WHI A;  1PO6 A;  1RZM A;  4HDG A;  2E5G A;  1S79 A;  4L3N A;  1WDD A;  3BBC A;  1NPP A;  1VQM S;  2HS4 A;  1PAE X;  7AT1 B;  2DGU A;  3U7J A;  1U4B A;  2F4F A;  5BR8 F;  1M90 T;  2EBG A;  3CJ5 A;  2LQJ A;  3VVU A;  1V3Z A;  5ETS A;  1C4C A;  4J9M A;  1JMT A;  4DQP A;  4O3Q A;  3K17 A;  2HSE B;  2UXD J;  3KHH A;  1X4G A;  2PII A;  1GK8 A;  1HFE L;  5GAG U;  2HYI B;  4B9N A;  4FP9 A;  4I67 A;  2CPE A;  4K5R A;  1S72 S;  1SV5 A;  1HHT P;  5C42 B;  4K8R A;  3MFI A;  3FMW A;  4LR8 A;  2HMI B;  2HHU A;  1TK5 A;  2F8E X;  3HX9 A;  4PYD A;  1KN6 A;  2KT2 A;  3KJF B;  1ZM2 A;  2V0N A;  4ILR A;  4LIW A;  4Q7A A;  2YBV A;  4ZIW A;  5KFJ A;  4U8V A;  2YKO A;  1I5O B;  2DGV A;  1WTF A;  3MTK A;  2GS8 A;  4XIU A;  2K2P A;  2W2P P;  3DOM A;  2DR7 A;  3FRZ A;  4G3I A;  2R8H A;  5ETR A;  1GMW D;  4ZLP A;  4M94 A;  1QAJ A;  3KG4 A;  1N6Q B;  2DIU A;  4OI1 A;  4QZV B;  1KQK A;  1LW2 B;  2BAN B;  3CO0 P;  3FK4 A;  3NCP A;  1C0U A;  5J1P A;  1EP4 B;  2GZO A;  1CJT A;  1R31 A;  3R5B A;  4PAB A;  4ETZ A;  4TU8 A;  1AW0 A;  1A9N B;  4YB7 A;  2BJ1 A;  3VV2 B;  3V6D B;  3LP1 A;  2ASL A;  1WHY A;  1CQN A;  1U25 A;  2LA4 A;  4Z37 A;  3A8E A;  3LAM A;  1HWK A;  2AW0 A;  3QO9 B;  3TEG A;  4Q45 A;  3GV8 B;  2LEP A;  2HS3 A;  3CJ3 A;  1K44 A;  4JOU A;  2VFV A;  2VDH A;  2ADB A;  1CUL A;  2MLY A;  1K0T A;  1DAX A;  1HA1 A;  2VPX B;  2ZBQ A;  1SIW B;  1YJU A;  1ZZN A;  2OIH A;  1WEX A;  4MIA A;  2KFN A;  3A8I A;  2NR0 A;  3ZZO A;  1JLG A;  1DHM A;  4RBU A;  5DGA A;  1MG7 A;  3NS7 B;  2R7O A;  3ZTS A;  5K14 B;  1CSJ A;  1YJR A;  3DLK B;  4IO1 A;  2HZV A;  4DN9 A;  1IBK J;  1FK9 A;  3NL0 A;  2SXL A;  1OWX A;  4CO0 A;  5EWE A;  2DXE A;  1EKR A;  2ZH8 A;  1PBU A;  1UPM B;  2CVE A;  1QTN B;  3I32 A;  4WU2 A;  3VWS A;  4JBC A;  3W64 A;  1S0M A;  2HLU A;  4P74 A;  2W7O A;  1IQT A;  2L9W A;  3A13 A;  4TY9 A;  2VZ9 A;  2LCW A;  2ZH1 A;  4FF2 A;  3HJV A;  3MEC A;  2ZNY A;  2G0I A;  4RJV A;  5KFP A;  5EWF A;  2V67 A;  3FEY B;  4HI2 A;  3PW2 A;  4FYD A;  1EJ7 L;  3NCR A;  4Q8E A;  1C0T B;  4QWB A;  4DL4 A;  1L5U A;  3KOA A;  3H5U A;  4NLO A;  4LRA A;  3CB4 A;  1WG4 A;  2ZC4 A;  3ETO A;  3O3L A;  4DPX A;  3GJS B;  1W26 A;  1UL3 A;  2EFN A;  3J7Y U;  1HR0 F;  4I68 A;  2DH9 A;  4UOF A;  1XK8 A;  2CDQ A;  5J1E A;  5IV3 A;  3KLI A;  3AY0 A;  3J81 U;  2XS2 A;  3Q24 A;  4YDX A;  1S9E B;  3G4S S;  2AU0 A;  2BQR A;  4LF2 A;  5SUH A;  4UUW A;  3QSI A;  3BKF A;  3E01 B;  3D6T B;  1TKT B;  4C0O C;  4P71 A;  3EPG A;  1FJ7 A;  2OMO A;  4YME A;  1WHV A;  3EIC A;  3ET6 B;  1U47 A;  3MAH A;  3KJV A;  5KFI A;  4GKJ J;  1PYT A;  3D68 A;  4GRS A;  4PCQ A;  4DUT A;  5BXI A;  4XPC A;  2DNP A;  3I9V 9;  4DSF A;  1RKI A;  1ZA2 B;  3OTC A;  5HVG A;  2E7X A;  4G6V B;  4LF5 F;  4MIW A;  3GU0 A;  2PFD A;  4KV8 A;  2KXN B;  4ECQ A;  3FFI A;  2KT5 A;  1UEV A;  2LLZ A;  3UN2 A;  1DBD A;  3CC7 S;  2E7V A;  4ZVR B;  1CS4 B;  2F40 A;  2ZHO A;  2HRT A;  1F2G A;  2MKC A;  2P8I A;  2XMJ A;  1VRQ C;  4KGX B;  5FDL B;  2CYY A;  1LXN A;  2M8H A;  3K8V A;  1RYS A;  4CLW A;  2FD2 A;  3TA1 A;  2D7S A;  1RXO B;  2J9E A;  2B9E A;  1TL4 A;  3ILI A;  1KNZ A;  2D74 B;  2XSJ A;  5A8R A;  4DL2 A;  2FC8 A;  2RF2 A;  5D4N A;  1NAQ A;  1KQG B;  5T41 A;  5A2Q U;  3MAQ A;  2EFV A;  1IKX B;  4PQU B;  4TY8 A;  3KTQ A;  4ZHR A;  3BYP A;  2WSF C;  5RUB A;  2ZM6 J;  1PJ7 A;  2CPY A;  4YQW A;  2NXU A;  3AJ1 A;  4NLS A;  1VQ6 S;  3PKY A;  2F1F A;  2BE2 A;  2BKO A;  2IDE A;  3PG9 A;  4LUB A;  2YNF A;  2DJW A;  4PPZ A;  5A8K B;  2K7J A;  5ETN A;  4J9O A;  1LW2 A;  1RCO B;  4QIF A;  5GVQ A;  4CH0 S;  4WII A;  3GE9 A;  4P75 A;  5L9N A;  4LF4 J;  5HI7 A;  4M95 A;  5DG8 A;  1RWX B;  2OLW A;  3HVW A;  3D3B J;  4XDC A;  3D9B A;  4A4J A;  4ZP6 A;  3DRX A;  3C46 A;  5K5M A;  3NGR A;  2UXD F;  1OPI A;  3UO0 A;  2PDA A;  4IDK B;  3MGJ A;  3Q23 A;  3R5A A;  4FZV A;  1UZH A;  2EEY A;  4DU7 A;  2L9D A;  1REG X;  5M2P A;  1YHQ S;  5BR8 J;  1HR0 J;  4PAA A;  4N77 A;  4ZVH A;  4ED3 A;  4KFB A;  2AZ1 A;  4F4X A;  1NK0 A;  2QEX S;  1TL3 A;  1T11 A;  5HMX A;  1F5C A;  2W2N P;  2OI2 A;  2CQ0 A;  2NUH A;  3N5B A;  1JLE B;  4TXS A;  3J7A 1;  2HWT A;  2MJU A;  1C1C A;  4M5H A;  4NWB A;  3QIP B;  2H54 B;  1U8W A;  1XNR J;  2OO4 A;  2OPS A;  4ECU A;  2XLI A;  1IBL J;  1Q0N A;  2OTL S;  2PI4 A;  1F0X A;  2VA3 A;  4C8O A;  5F8G A;  4ZHR B;  5KT5 A;  4A8Y A;  3QJP A;  3M8Q A;  4C98 A;  3BR9 A;  3O8W A;  2C2E A;  4QWC A;  5HP1 A;  4KHP F;  1HWJ A;  2CAJ A;  4L3K A;  1HQE A;  2MPU A;  4CLP A;  5KFU A;  5IS2 A;  1OIA A;  4PWD A;  2GA7 A;  3BSN A;  3RB0 A;  2ADC A;  4PWD B;  2Y1I A;  4LF8 J;  2AMC B;  3VR1 A;  3O44 A;  3QRQ A;  5E33 A;  2MB0 B;  4OYO A;  2RRB A;  3TVK A;  5B7W A;  1MMN A;  3Q8V A;  5E7O B;  4F0M A;  3BYR A;  2C2R A;  4N7T A;  3CCT A;  2NYH A;  5EDW A;  4BS2 A;  1TL1 A;  2V8V A;  4DCP B;  3OVS A;  4DL0 C;  2VFR A;  2O5D A;  1FVQ A;  3JTN A;  3HLU A;  3R6G B;  2DNN A;  5KT2 A;  2Z2M A;  4NA1 A;  2MZJ A;  2WBR A;  3RW6 A;  2U2F A;  4RW8 A;  3PRV A;  3RU0 A;  1P8G A;  3ZZZ A;  3ET6 A;  4RUA A;  2E9T A;  3CED A;  3NGS A;  1OQ3 A;  3GIM A;  1HNZ F;  2DH7 A;  3J81 Y;  4CM2 A;  1WD6 A;  4DPU A;  4WKR A;  3BN4 A;  2LDI A;  4GKK F;  1C2P A;  2I0X A;  4LVO P;  1K47 A;  2ZKT A;  4YUD A;  4OI0 A;  2MY8 A;  3DRR A;  2HFV A;  1WC4 A;  3DRR B;  5KFL A;  4BLG A;  5J2M A;  1UEK A;  2GVZ A;  3GZ7 A;  1NJW A;  2MKH A;  4ZN1 A;  1WKJ A;  2PI5 A;  2CQP A;  2UP1 A;  3TP2 A;  1U26 A;  3IWL A;  4EWT A;  5FLX Y;  3KK2 B;  3BSO A;  2ZVI A;  4DHV A;  4OZ3 A;  4I64 A;  4PWU A;  4MTP A;  3NNC A;  4LSN B;  4ZPV R;  2DGS A;  2Q6C A;  2OAU A;  1C0T A;  2IJF A;  1FER A;  1JLG B;  4ANE A;  1NDL A;  5E41 A;  5C5J A;  4Y2K A;  4M5M A;  2W8K A;  3AB4 B;  4UOH A;  1HBN A;  1KC8 T;  3BSA A;  4U96 A;  1SJF A;  2VOD A;  3BQ1 A;  4TVA B;  5CZX A;  4WK1 A;  3UD4 P;  2GHV C;  1ITP A;  1KSP A;  1CG2 A;  1QAY A;  3D6M B;  4OV6 A;  2CNL B;  1R8B A;  3UCZ P;  2UVR A;  2H5I B;  3QNW B;  3MI7 X;  1KVI A;  4IOB A;  1NDP A;  5EN1 A;  2UUA J;  4DZ6 A;  4E0D A;  1FK9 B;  2FLP A;  5LMU F;  2VPW B;  3DI6 B;  1JXV A;  1S1X A;  1BY9 A;  3K2Y A;  1YG0 A;  2JRS A;  3IAM 9;  4RW6 B;  3G6X A;  4DV2 J;  4DQQ A;  3LP2 B;  1ULR A;  1UVL A;  1P1L A;  2IRY A;  3BB5 A;  1EAY C;  3ZZ0 A;  2VHG A;  1SBR A;  1LWF A;  4ZPA A;  1DJ0 A;  2DNH A;  2NRE A;  4Q8F A;  1SJQ A;  4DSJ A;  3H7H B;  4OI4 A;  5AE1 A;  5MLC V;  3MFH A;  2DRA A;  2LQB A;  2N4C A;  2ZH9 A;  1I6J A;  3HD2 A;  3J7A N;  3MPD A;  6AT1 B;  2BRL A;  2JEG A;  4I2Q B;  4DX8 H;  3DGP B;  3OSP A;  1S1T A;  3VGU A;  1X4D A;  2CZ4 A;  1RT6 A;  1C1B B;  1K1S A;  1C1B A;  2GGP A;  3TOQ A;  2W9A A;  4GKJ F;  4BHQ A;  3DOL B;  2XYP B;  4LF6 F;  1D09 B;  3OR1 A;  1X5T A;  3BQ0 A;  1N36 J;  1DZ5 A;  3QRR A;  3MCN A;  4ZP8 A;  3DLE A;  1HHQ A;  1IXK A;  2J7U A;  1M1H A;  3OFE A;  4X62 J;  3RAX A;  4WFX A;  1EKS A;  2C42 A;  3CJK A;  3RGI A;  5C24 A;  1UKU A;  2YWK A;  4NRT A;  3RTV A;  3GG1 A;  3D28 A;  3NP5 A;  5IC6 B;  4OHZ A;  3TI0 A;  1FRK A;  1Q82 T;  3EUN A;  4XAK A;  5HQ8 A;  4NI2 B;  3G2X A;  2MQP A;  2VON A;  3CO9 A;  3CJ4 A;  4B3R F;  2C3U A;  1CJU A;  1B0P A;  2JX2 A;  3MOZ A;  3I56 S;  3SSS A;  2JLF A;  3C19 A;  5KAK A;  1Y5I B;  4C8N A;  5D4O A;  5HQL A;  3PRB A;  4A8O A;  4PG7 A;  2EK1 A;  4NZ0 A;  3AHP A;  1T03 A;  2I38 A;  1FKO A;  1U2R A;  1D9D A;  4X4U A;  3BGL A;  4WXO A;  3TEH B;  2BBE A;  4CWB A;  4YFU A;  3DRP A;  3VAM A;  1GMU A;  2XMT A;  1VQN S;  1TKX A;  3GR1 A;  1IKX A;  1F5A A;  2GMJ A;  2G2O A;  2AEM A;  2XYH B;  4PRF A;  3LO3 A;  1IR0 A;  4KFB B;  2XY7 A;  1DFD A;  4DJB A;  1L3T A;  3H8Y A;  4DQS A;  1IBK F;  2QSW A;  3ZZU A;  2ZHA A;  1UAW A;  5DG7 A;  2OEL A;  3GLJ A;  4FPR A;  5LL6 d;  4W90 B;  4NXM F;  1GMW A;  1QE1 B;  1U0H B;  2MLZ A;  5IZH A;  1XMQ J;  2IAJ B;  3HKZ D;  3KG0 A;  4ZVU B;  1FEE A;  3TJA A;  2F4V F;  2HBQ B;  1QDU B;  3TUJ C;  1N34 F;  2FVP A;  1D9F A;  4DPW A;  3U27 A;  4YR0 A;  4H4M B;  1OY6 A;  4AE5 A;  4ED8 A;  2OGU A;  1FKA F;  3IG1 A;  3IR7 B;  2LEB A;  4USW A;  1MU2 A;  4NLW A;  1YZ7 A;  2E5H A;  1BQM A;  2VD3 A;  5DET A;  1KS2 A;  4CT9 A;  5L39 A;  2JL9 A;  3OR2 B;  2QJ3 A;  3LA0 A;  5KTQ A;  4RNM A;  1CJU B;  4RW9 A;  2R7U A;  2GO8 A;  3DRS B;  2IJN A;  1TU0 B;  1RWV B;  4RU9 A;  4JV5 F;  3E3X A;  2VDI A;  3NGU A;  3Q8Y A;  3T1A A;  5CAB A;  2DPJ A;  3MUV P;  3LH2 S;  4K2J A;  3CVK A;  1S6O A;  2O1P A;  4OYB A;  3OTO J;  2RRA A;  3TZW A;  1N5T A;  1HNI B;  3AB2 B;  3FQL A;  3GFX A;  1H3D A;  2RIJ A;  3UDE A;  2HMI A;  4DV0 F;  3MPV A;  1KDN A;  2UUA F;  1KP6 A;  3Q8R B;  3G9C A;  2DHG A;  2R4F A;  2VH7 A;  5DJB A;  2FHK A;  1LOU A;  1V6H A;  5J1N A;  2J0S D;  4AL5 A;  4H4K A;  4OMF G;  2HVH A;  1AZS B;  5HSP A;  4LF9 J;  3W9I A;  1NUE A;  2IYG A;  5F0W A;  4IH7 A;  4LRB A;  4U6P A;  4ED5 A;  1U2C A;  4PPD A;  1RTJ B;  1FFS B;  2DH8 A;  2GIQ A;  3KK1 A;  2CNN B;  1S1V B;  5DS7 A;  2KYX A;  1SC6 A;  2YWH A;  3MUT P;  2AGQ A;  2R8J A;  3MEG A;  2Y1J A;  2CQB A;  2JOQ A;  5KFV A;  4JV2 A;  3OL9 A;  1KVJ A;  2UV8 A;  2OEM A;  3CDW A;  4C8M A;  3RBZ A;  1SH3 A;  4G1P A;  4I0W A;  4O4G A;  2J7W A;  3SQG A;  4MIB A;  1RBA A;  4AXJ A;  2UVW A;  3PFE A;  5DO2 A;  4GC7 A;  4DL7 A;  1Z1Z A;  4WFN Q;  4ID5 A;  1HQE B;  2MKS A;  3Q2S C;  1T9Y A;  4OYX A;  4W92 B;  1SB6 A;  4WPA A;  4Q2L A;  4ZLL A;  3KK2 A;  1NK7 A;  3RRG A;  3OUY B;  2AGO A;  1XN9 A;  1FFW B;  1V9O A;  3GPA A;  1D8Y A;  3LTO A;  2HQF A;  2GFF A;  3W5Z A;  2R7R A;  1F3F A;  4G1I A;  3T9Z A;  1VHF A;  2X51 A;  2Q66 A;  1G2E A;  2NZ4 A;  5J1E B;  4OX7 A;  2YNH A;  1S1W A;  4OJ3 A;  3M6W A;  4ECX A;  4ETX A;  2DO4 A;  3QAT A;  1N32 J;  1GX6 A;  4HEA 9;  3P4U B;  3DOK B;  5CAA A;  5A8K A;  2C3P A;  1O8B A;  5E2Q A;  2OPS B;  4WFA Q;  2QX0 A;  3OLA A;  3ETM A;  3V4M A;  2LEC A;  1HBO A;  2IFX A;  4QW8 A;  3RRH A;  3K5O A;  2ZHB A;  2C22 A;  1SJ1 A;  1RTJ A;  4UY8 5;  3NWR A;  2XCA A;  3E8O A;  2RUG A;  1N48 A;  1N4L A;  1AB8 A;  1LWF B;  2OUG A;  4GO7 X;  2DNZ A;  4IFY B;  4NYZ A;  4Y2I A;  2V8H A;  3RRK A;  3TWZ A;  3BV8 A;  3QID A;  3HZE A;  5A6P A;  3TX8 A;  1LWC A;  2NCK L;  3FC9 A;  3DMJ B;  1U1K A;  2XGP A;  4LF8 F;  4DR2 F;  2ZH5 A;  1CJV A;  2R2S A;  1Q86 T;  3KYL A;  4RWX A;  5KT7 A;  2RE1 A;  4CO2 A;  2WVB A;  4OHV A;  4C3L A;  3HHN B;  1S6Q A;  2CXE A;  3OXL A;  1VBY A;  4OLO A;  1CVJ A;  4B3O A;  2XO6 A;  2IVY A;  5LSL A;  2OFG X;  2GIR A;  2RKI B;  1SVD A;  2P5V A;  5L38 A;  4PG6 A;  4PEO A;  3TJ8 A;  1JB0 C;  1T94 A;  2EVZ A;  5DZ7 A;  5KFG A;  2KFY A;  2BA9 A;  2L48 A;  3L3C A;  3SZ2 A;  3DXS X;  1WAC A;  5M2U A;  2MKI A;  4G65 A;  1IR1 A;  4DR4 J;  1JJH A;  1O0P A;  1U1P A;  4X4R A;  2OPR A;  3L95 X;  3G8T A;  5A6W A;  3CDA A;  4RW7 A;  1YRT A;  3UW1 A;  1QSS A;  5A2Q Y;  4B9S A;  1UWB A;  3D4J A;  3UNY A;  3HK2 A;  2HVI A;  2G1H A;  4WP3 A;  3T6J A;  3OTD A;  4Q5V A;  4NCB A;  4DSL A;  3B4M A;  2NXN A;  2XSJ B;  2ZD1 B;  3CDE A;  3D6H B;  4FVC A;  4YS2 A;  4FXD A;  1RWN B;  2HHW A;  4JI4 F;  1YKW A;  3DN9 A;  2YNI B;  3US5 A;  3K5M A;  1NND A;  2CPF A;  1XNQ J;  3W62 A;  2W4D A;  5F8H A;  2FY8 A;  1NU4 A;  2Y0B B;  2YKM B;  1H2V Z;  2AJ2 A;  4NE9 C;  1H0H B;  1RT5 A;  5HO4 A;  3J7Z T;  2HUR A;  3KLF B;  3HXM A;  4FS2 A;  1QLN A;  2GGP B;  1UFW A;  5F8M A;  3OT9 A;  2V68 A;  5H1S V;  3DLL Q;  3IMQ J;  3UN5 A;  3MR3 A;  1FT8 A;  1IKV B;  5T7L A;  4X4P A;  3V6H A;  4CLF A;  4J9P A;  2BE7 D;  4H4M A;  1YJN S;  3DYA A;  1XMO J;  1NJZ A;  3IRX B;  2HNZ A;  1JNZ B;  3PYE A;  2MDA A;  3KLH B;  3OPK A;  2OPP B;  2OJ3 A;  4DR1 F;  4JI6 F;  4X66 F;  4WBF A;  1X5S A;  1R8C A;  2XMW A;  2XI2 A;  2HRY A;  1AXQ A;  4B02 A;  1SPB P;  1YQH A;  1CJK A;  4RZR A;  4USJ C;  2IM3 A;  1LNQ A;  3C14 B;  2VFS A;  1UEU A;  4IQX A;  3CJQ A;  3LQV A;  2R2T A;  1WNE A;  4LFB J;  1XWL A;  5SZT A;  5FDL A;  1U1M A;  2DGT A;  2QSF A;  3AOA A;  2HQD A;  3UDC A;  3UNG C;  5DQH A;  1DTT B;  4KH0 B;  4KO0 B;  3Q8Q B;  3IGN A;  4HKQ A;  2KT3 A;  1GXL A;  1BXN A;  4M5J A;  1UFK A;  1X4B A;  3PYD A;  1UFL A;  4IOC Q;  2GW8 A;  1QD1 A;  3FKB A;  3LAN A;  3IA0 A;  1DY3 A;  2DGO A;  4DCO B;  3RG6 A;  1G4C A;  2RRN A;  2X3G A;  3PYG A;  4E98 A;  1TUW A;  2EFO A;  2RQ4 A;  3F41 A;  3J81 j;  4ED2 A;  3HO1 A;  3FDS A;  1T9U A;  1FNM A;  3HVT A;  3M30 A;  1YX2 A;  1VFJ A;  4QIG A;  1SQE A;  4ZCK A;  3BDP A;  1BLU A;  4B3T J;  3UVJ A;  4KJI A;  3SSQ A;  2GQC A;  1SI9 A;  3M2V B;  3MM5 B;  2H4W B;  3PJX A;  4B3M J;  1TL5 A;  4OZ5 A;  1N5S A;  3MM9 B;  1RWO B;  2JFD A;  3S7R A;  5KOX A;  3CTR A;  4CTA B;  2KVQ E;  4AD6 A;  1VJW A;  2V2V A;  4P52 A;  5MAO A;  5EGY A;  3IR5 B;  4P9S A;  4UZB A;  2BRK A;  4LF7 F;  1WG1 A;  4O44 A;  3BO2 A;  1ZTW A;  3KMQ A;  4O3P A;  4ID5 B;  3MM8 A;  4MFB B;  4KGV B;  3DM2 B;  5GAE I;  5HLF A;  2HFZ A;  1RHK B;  1HW9 A;  2HKE A;  2ILZ A;  2HFS A;  1WJ9 A;  2Q79 A;  2CWK A;  2QGF B;  2UUT A;  2BKP A;  2KHC A;  3D67 A;  1JLC B;  3FSY A;  3I5A A;  1T3N A;  4JI5 J;  3HSD A;  3TYT A;  5JUM A;  1HW8 A; 
#chains in the Genus database with same CATH homology
 1M1H A;  2K06 A;  2OUG A;  2LQ8 A;  1M1G A;  3EWG A;  1NPP A;  1NZ8 A;  4ZN3 A;  3LPE A;  3P8B B;  1NPR A;  4ZN1 A;  2XHC A;  3QQC D;  2EXU A;  3H7H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...