2OUGA

Crystal structure of the rfah transcription factor at 2.1a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
141
Chain Sequence
QSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYKKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional activator rfaH
publication title Structural basis for converting a general transcription factor into an operon-specific virulence regulator.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 141
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2ougA00
2OUGA 1NPPA 3EWGA 1NZ8A 4ZN1A 2XHCA 3H7HB 3LPEA 3P8BB 2K06A 1NPRA 2LQ8A 4ZN3A 1M1HA 1M1GA 2EXUA 3QQCD
chains in the Genus database with same CATH superfamily
3BN4A 4BCAA 1S1UB 1Y5IB 2OLWA 1T03A 1WHYA 1GK8A 2PO4A 3CXCR 2VFVA 2BQUA 3R7NB 3IRXB 3RBZA 1KVJA 2PE8A 2R2SA 2ROEA 3HT0A 2FIUA 2SXLA 2IM0A 2PFFB 5ETQA 3ISND 3N4WA 5JVHQ 2IM2A 3LANA 4B3OA 3B4DA 1V9OA 2VC0A 4ES2A 4I4BA 3EE3A 4HHJA 4EO8A 2D3O1 5KFKA 3U1LA 1IXKA 2JC1A 2Q3PA 4USMA 3KK2B 2ZH7A 4PQUA 4I6AA 4I2PB 2QMUB 4NZ6A 3PZPA 2D69A 2YNFA 2KB2A 3CJ0A 4OI0A 1PYTA 4GRSA 2AJFE 1RWNB 5KFJA 2RH3A 4I7FB 5DGBA 1P27B 1VIXA 3PJXA 4C98A 1IVZA 4QW9A 2Z58B 2JHEA 3GYXB 2OUGA 1Q4RA 1DJ0A 5ETNA 3KJFB 2OPQB 4K4YA 2R7VA 1VISA 2DNPA 3PRVA 2RJZA 4FNIA 2OMOA 4ILMA 4HI1A 2HSEB 1E6VB 1RISA 1T05B 4KPCA 5D4NA 4TY8B 2V8VA 3MM9A 3ITHA 4LFBF 2R42A 5FLXU 4O3OA 1LWCA 4YP3A 3OSPA 2DGSA 3W62A 3J81U 4IG3B 4X66J 1TFYA 1KR4A 2J5AA 2V2KA 2BW2A 3CJKA 1APSA 5J2NA 2DKOB 1FESA 2ALYB 2LQ9A 2CUYA 1N5SA 2XMMA 4F36A 2YKNA 4NLYA 2AP6A 4JI4J 2AYEA 2AX1A 3ZNUA 2XZWA 1FX2A 1KONA 3R9LA 4ECYA 4C2MA 1U47A 1Q7LB 1OO0B 1RT7A 3IR5B 4DR5J 1QE1B 3AFGA 3OR2B 3CJ5A 2MZRA 2F3JA 1PYOB 1S59A 2X3GA 4KV8B 4PG5A 2V6AA 4H4OA 2MKSA 4FP9A 3VAJA 5SZTA 3KLIA 1VQLS 4F50A 4U9RA 3NKYA 1SCJB 2V8PA 4MAKA 5DS7A 4WF9Q 1TL4A 2HQCA 3DOKA 3DLEB 4USJC 4TLRA 1SXLA 4MK7A 3D3CJ 3WIVA 3G6XA 2MLXA 2BA9A 1XNRJ 3EPIA 4DUYJ 1KNZA 2D74B 3R8YA 1DQ8A 2O66A 2E1CA 4CT9A 3CC7S 2MEWA 4M5KA 2ALZA 2GCFA 3UDLA 1IQTA 3ILLA 3RG6A 3VAKA 3C8YA 1S76D 4OHXA 4YEAA 3CCUS 3O2IA 4ED4A 2Q43A 3PACA 1WOOA 1BC6A 4ECXA 2CQGA 4BHQA 1UPPA 2AZ3A 2JEGA 2VFSA 1WORA 2JH3A 3PHEA 1KFSA 2YNHA 5EWGA 5B7WA 1VQKS 3DI6A 3BQ1A 3L95X 5B09A 1CS4A 3AOBA 1BQXA 1HMVA 2H5JB 1T9VA 2J8SA 3DRSA 2MXYA 4CO3A 1IR2A 2Q66A 3M32B 2RAQA 2YWKA 1DURA 3D67A 4ZPTR 4OYBA 1VIOA 3BQ2A 2X1AA 3GIJA 4OX6A 4W4MA 1F3VA 3RR8A 1T02A 4J9OA 5IC6B 5HO4A 2ZOGA 2BW7A 3G9CA 2HHUA 3W61A 4OYMA 2UVRA 4JI3F 4TU7A 5A6WA 3H5YA 1QY7A 3VAMA 4RBUA 4UQGA 1YJ9S 2VC1A 2PMZD 2OIHA 4ANCA 3MPDA 1TFWA 2YKOA 4F26A 4XAKA 3PW2A 4WK3A 5ETKA 1JLCA 3J7A1 4ZVTB 4LBHA 1YWXA 3MR5A 1HNIA 3AQPA 2AF6A 1DLOA 1FK9B 4NLXA 1UWAA 1WDTA 4PRFA 2PMWA 1O0PA 2QN6B 3POTB 4CNZA 2VV5A 3W64A 2OI2A 3DU6A 4MIWA 5LOQA 3BGOP 1AXQA 3U02A 1JJHA 3M9NB 1S6OA 5CCLA 1X0PA 2HQFA 1J5EF 3CULA 1S6UA 4CNYA 5I3PA 2F4VF 3EZUA 2ZH2A 3T9NA 4ZVUB 4DUZJ 4ED2A 1SKUB 4IUFA 1UMJA 2DRBA 1FHTA 1NDLA 2PA8D 3X3UA 4YN3B 1KTVA 1GMWA 4O3NA 4LSZB 2R7RA 4Q2LA 3GWCA 3BGLA 2POKA 3FZ2A 3TAMB 2V63A 4Q45A 1N8RT 1CJKB 2OPPB 1FJGJ 3FBFA 1JXLA 1RHMB 5FLXY 3I0RB 3J81Y 2DEJA 1L3VA 1ZM3A 3F56A 3OD2A 3OBIA 3M6XA 2MZQA 4M5DA 3AB2B 1S4EA 2NSBA 4USWA 2J6SA 2EWHA 2NXNA 4WU3A 2RVJA 3HM9A 2BKPA 2KZZA 1UZHA 1TL7B 2VFUA 1BY9A 2AJ2A 1TL3A 2DHXA 2J9DA 1NK0A 3GJSB 2F7VA 3SZ2A 4ILRA 5L9XA 3C14B 3RW6A 3DMJA 2CPJA 2PIIA 4JI1F 3P45B 3JSMA 3FBCA 3EYZA 2RUSA 2B9WA 5T7LA 2XYHB 3NNCA 4ECTA 4DPWA 1FNOA 3QT6A 4RW9B 4DX8H 4C48A 5LJ3Y 2VASA 4HYKA 4R8UA 1RWVB 1XIQA 5HP1B 3KUHA 1FWPA 1O5JA 3WBZA 2VFRA 3NLCA 6AT1B 3BSOA 4C8MA 5BXIA 5T14A 3GR0A 1XN9A 3DOLB 3BJYA 1QTMA 5DRKA 5IT0A 5CD4A 1ITPA 2H65B 3FKBA 2IVMA 1F5CA 1I5OB 3M6WA 4RW8A 3MWBA 4LF7F 1X60A 2Q79A 4DV0F 2DCUB 3E01B 4NWBA 1OSCA 5HJYA 3TQ1A 4KKOA 2DNYA 4ED7A 1MU2B 2BJ7A 3D6MB 5C7PA 4L76A 4OLOA 2IC3A 4DFPA 1BLUA 2B9EA 2XWXA 2R9LA 5FDLA 3ZTPA 4U8YA 3NGRA 3NCQA 1H2VZ 2QSFA 3V81B 1SVDA 1UVLA 3QSYB 3RB4A 4F0HA 4ZHRA 4PQAA 4PKDB 3PXGa 1VQPS 3KHLA 2MKIA 4ECZA 4LF6F 3PW7A 4CT8A 4PEOA 3VTIA 4QYRA 1HPZA 5KFRA 2UUWA 2WOMB 3JQKA 3C15A 2NZCA 5B0FA 4GC6A 2AJ0A 3KK3A 1GNKA 4CO1A 5ETPA 1O6XA 2DGQA 2MKHA 4P2FA 2QMWA 1N0UA 4M95A 1S9FA 5E3AA 3CCTA 2CVEA 3FC9A 4MJKA 3OHAA 1GTEA 4FVCA 2KT2A 5F0WA 3D4JA 2EBEA 2DHAA 1NJZA 5E41A 1HHTP 1TUVA 1J2VA 2PD1A 2FY1A 2AEJA 2DNKA 2AZ1A 1U0SA 4KH1B 5D3GB 3TJ9A 1N5YB 2DT9A 4ZIVA 4P73A 5D15A 4KHRA 3A3PB 5M2UA 1H2UX 4O4GA 5HVGA 1VHIA 3Q8SB 2KU7A 1UETA 1HI1A 1S72S 3K5OA 4NXMF 3PO5A 3MMBA 3R5AA 4QWAA 3NWGA 4O0IA 4LF4F 1X0FA 4G6VB 5ADZA 3W65A 3GSIA 4YQWA 4DSIA 1UCNA 3CDEA 3MFIA 2XB2D 3R2CJ 1UJ4A 1U1NA 2ILZA 3BEGB 2DHGA 2B6AB 3TAQA 2FGCA 4CDIA 1HBMA 5GVQA 5F8LA 4RUBA 1IWGA 3CT9A 2ZEJA 2N3OA 5KG2A 4DQPA 4FS2A 1IQZA 4J5OA 1Q0NA 2WSEC 4I1TA 5GAEU 1MG7A 2DGWA 2J7UA 3PHTA 2B9YA 4NYOA 1D9FA 2YVSA 1PILA 3CDAA 4C8LA 4LFBJ 1S6PB 3AQOA 1N5TA 3ETOA 3BO3A 1U6BA 1NSAA 2OMLA 4PXEA 4XPEA 4BLGA 4ZVOB 1TQLA 1U1OA 2W2QP 4ECVA 1IJFB 5EDWA 4MYTA 3CD7A 3FDSA 2W4PA 5KFMA 2EKYA 2QG9B 1RA7A 4DZDA 1EIYB 4TVAB 3PKMA 3IRXA 2V8DA 1GMVA 2C3YA 3CCVS 3K59A 1VJWA 2R8IA 1BQNA 1NK5A 3EDRB 1IKYB 2P6SA 3ZZZA 4DR1F 3LGHA 1OY9A 3NWRA 2LXUA 2ZH9A 4JI0F 4XO0A 5EHHA 4QYZK 1RDRA 3KK2A 2IJNA 1CBKA 4P7TA 3Q86A 2AMCB 2JSXA 3DRYA 4LRFA 2PEBA 2AJ1A 2ZVIA 5HMYA 3CNQP 4I7FA 4PG7A 1F1BB 3J7YU 1DRZA 1S5ZA 3MMCB 3L7OA 3SV3A 4X64J 4DMZA 3MEDB 4RU9A 3J80U 4CH1A 5LSLA 2HZAA 1KQGB 2AJ4A 1HWKA 2D7SA 4HEA9 4IKAA 2QV6A 3HSDA 2OPQA 1RYSA 1G4CA 5LXRA 4ANDA 3GCWP 4KHPF 2HMIB 1ZPWX 2C2OB 3JXOA 2C2DA 4J7CA 5A8WB 1FTRA 5ETVA 3HHEA 4B08A 2CA9A 1XC9A 2VA3A 1R31A 1FRIA 1RKJA 4F2SA 2B4VA 4LRDA 4ZPDA 4AE5A 1T05A 1H6KX 3BS9A 1RAEB 3ICLA 4TY8A 3WHIA 3D6TB 1KP6A 3QWUA 4Y28C 4ZVSB 4DX5A 4CRJA 2YKQA 2XYPB 5C2GA 2IA6A 4EEYA 1U6FA 3L9ZA 4LIWA 3NXZA 4XDCA 2DCLA 4JI3J 4K4SA 3VGSA 2B43A 2VB6A 4N76A 3CVKA 2CQPA 2RMLA 1UEKA 2E66A 2BYCA 1SJ4P 2WBMA 3K89A 5L9NA 1QE1A 1CULB 2LEPA 2YQ3A 5C42B 5K9FA 4LF1A 1SL0A 2YXLA 4KV8A 3FBEA 4RJVA 2ZHBA 4N5SA 5IQQA 2QX0A 5M2RA 2Y0BB 1ELOA 3G6VA 2QLWA 4A48A 4RBTA 3DLEA 2CQCA 3AODA 5KOWA 1C4CA 4ELUA 4YB1P 3GSDA 4PPDA 4CLSA 2B8PA 4PXBA 1VCTA 3IRWP 1NK9A 2XNRA 1W2BR 3G87A 3HT3A 1JLAB 1WC0A 3AXKA 3QAUA 2NUUG 4DV1F 2AQ4A 2LA6A 2LLZA 3S7RA 2JLEA 2ZM6J 2CVIA 2ZNYA 5AE1A 3HXMA 5HLFA 2WCXA 3MM8B 3OT9A 3DRXA 2I38A 4CP5A 5L8RC 2X1BA 3VQTA 2F4FA 2AYGA 3HK2A 2HHPA 1KQKA 5KFYA 3M32A 2RRBA 3MR6A 2G1DA 2CADA 1J27A 2A18A 2Y9HA 2ERRA 2UXBF 1N36F 4FBUA 3JQJA 2QYGA 3D6FB 2U2FA 4EMDA 2F9DA 4LFAF 4HHHA 2O5DA 4MYUA 5KG4A 2RQCA 3US5A 3PX4A 2Y3YA 1YRUA 2Z2YB 2LDIA 1I1GA 3W9HA 1T9WA 4DV2J 2QLFB 1KFDA 3NNHA 2YNGB 2DNMA 4CH7A 4OYOA 1JLEB 3B8HA 1RAJA 2N7CA 5SUHA 4L74A 4L75A 4X4RA 2QE5A 1FJEB 2QJ3A 1TR0A 4X4VA 3MDFA 4GVBB 4F67A 2PGCA 3NBPB 3MZIA 3UDVA 4CI0B 3POTA 4DEZA 1PIEA 3CMES 2WB4A 1M1HA 2ZC3A 5ETMA 1UKUA 1ZZNA 3W8GA 3BKTA 1RACB 1U1MA 1QAXA 4OYIA 3BR9A 2R8HA 1VGYA 3S8SA 3M2RB 1KS2A 3PG9A 1JK9B 1FEHA 1QSYA 2RF2B 1RT3A 4KH0B 3D2WA 3TZWA 1IR0A 4M1KA 1A0OB 2FGOA 3EX7B 1VFJA 4DV0J 5HJXA 2LYVA 5GADU 2WZ1A 2H4WB 4K4ZA 1D8YA 3MMAB 3P3DA 2HRUA 2KRRA 3ZZOA 4PXDA 1DBDA 4MFBB 3TAMA 1EQMA 4JV5J 1F9EB 1CJKA 2OPPA 3KWMA 2DEIA 2J0SD 1Q78A 1XJWB 3I0RA 2J9CA 2BMBA 1T9TA 4OZ5A 1WHVA 2HAIA 2KJWA 3DXBA 1WKLA 1JJ4A 4L73A 1ZA1B 1TK5A 5E5NA 1X5OA 3CJ3A 3NCPA 2VA2A 1TL7A 3HHNB 4X62J 3OHBA 2ASDA 5T41A 4UOCA 3KMSA 2E5JA 1MMDA 2M3DA 1YG0A 2AU0A 3C14A 1E6YB 5CH7B 5KFXA 4QR1A 1NMEB 3MF5A 3GIKA 2VG7B 2CKWA 5J1NA 4DLEA 3H2VE 2JEFA 3NMRA 1FKAF 2MQPA 2QL5B 3CC2S 5C5JA 3VWSA 2L41A 1PC4A 4NLPA 3GFZA 3EXCX 2RQ4A 5HP1A 4OJ1A 3HMJG 2FLNA 1A6LA 3DM2B 1DTQA 2KM8C 3DOLA 4C7QA 5KFSA 3H4BA 3KJQB 2IY5B 2Z30B 5IT4A 2VJVA 4U8VA 1H98A 4AQYF 4YY3F 4F3MA 1FRJA 2GGPB 1S48A 2IPOB 3D0GE 2R8JA 4K4WA 1GQEA 1HFEL 4LF4J 4JI8J 4C9DA 1UZDA 1NJIT 4Y2IA 3C66A 1SJQA 2FZCB 4EZ9A 5KFAA 2ZHAA 4TYBA 3GFYA 2XG8A 4I6YA 4DR3F 4DSLA 2DR6A 1LWEA 1MU2A 1SC6A 3SI8A 3ENVA 4ECSA 2YH1A 2J8AA 3RAXA 2NLWA 4MTPA 3HHDA 1D3WA 5D0EA 2AJQA 3MOZA 1BXNA 1NKBA 1JIHA 2W9CA 5B08A 3MEEB 2H4YB 4DI6A 3D54A 3L4BC 3H40A 3V81A 3MCNA 1YQHA 1WEZA 5IWAF 3GONA 4TYAA 2HRYA 4ER8A 2QEXS 3RB0A 4TNOA 1TMMA 5E3RA 2X51A 1ZTWA 1RHUB 1RTIB 4DV4J 4M63A 2RS8A 3HVAA 4CTAA 2HBZB 3BGUA 2JX2A 4GKKF 1UWBB 4USUA 4F0MA 2FDNA 3OXGA 1GXTA 2ZH8A 1HR0F 5KFVA 2WOMA 1U48A 2BM1A 4K5RA 3QYYA 1RP5A 2H48B 1K1SA 1H72C 4A8FA 4B3SJ 3M6VA 1RLDA 1RCXB 2GA7A 2DR5A 1S1VA 4RNFA 3TUPA 3JTPA 1EQ0A 3A12A 2BUNA 3EMTA 4DL0C 1PG5B 1OIAA 1FDNA 5AE2A 5D3GA 4ZVHA 2HFUA 4WP9A 3TANA 1RWKB 2D41A 4JI0J 3H5XA 1N5YA 3TA1A 1UEUA 1WNEA 2W1BA 2K8GA 3SFGA 1RT4B 4OLPA 3PFEA 1YJUA 2GJ2A 2CPZA 4DF4A 4DS5A 2C3OA 3T5KA 2LECA 1FTCA 1IKWA 4X4OA 1NRKA 4HH0A 2G2OA 2XGPA 3T5JA 2M52A 5KFGA 2EC0A 2RILA 1IBCB 1HKAA 4RPFA 4DSEA 1TUGB 5C25B 4M5GA 3IMQJ 3FMWA 3BN7A 1ZS6A 1WACA 2XWYA 3PIPQ 2DIUA 2AGQA 3MMJA 3NS7B 4C0BA 2VIHA 3LF0A 4ZKAA 5J2PB 3HJFA 5KAKA 3TEGA 3K2YA 2C2EA 1JLBB 1YKWA 1MWYA 1NK4A 3M9MB 4LSLB 3WC2A 2FJAB 3QATA 2L3MA 1NKCA 1Z1ZA 5GAEI 1PCAA 1YRTA 4NLTA 5E33A 1IKVA 1SKSA 1HLWA 3CDBA 3BKUA 4FF4A 3I6PA 3FGVA 3OTOJ 4FYVB 4JBCA 1FXDA 2HPUA 4F8RA 2L9DA 3RRKA 2IYGA 2DISA 3OXLA 1XMQJ 4LREA 3DU5A 5D0RA 2XLJA 2CQ4A 4DSKA 3GP9A 4K2JA 1RCOB 4AT1B 2D3OR 4FF2A 1FVQA 4E2FB 2EFOA 3HD1A 3DLGB 1IKYA 1WWHA 4OJGA 3H7HB 1Q8BA 4P9SA 1BQMA 4DR6J 2F8EX 2AHOB 3SV4A 3GFXA 3ET6A 2J76E 2QL9B 2BEFA 3OL7A 5A2QU 3R2DJ 2O01C 2WVEA 3JYTA 1SH2A 3QZ8A 4O3QA 1YVFA 2HVZA 5IM0B 2KO1A 3LO3A 3C16B 4NLOA 2VG5B 2E7XA 3MMCA 3TNVA 4ZP8A 3G4SS 2Y1RI 4RL1A 4QCLA 3SBMA 4HT5A 3LALA 2IHR1 2HGMA 5DO2A 2QLXA 5A0YB 2OAUA 3J7YI 5KG1A 4IDKA 4DS4A 3UD5A 2HGNA 2GV1A 3K17A 2HMIA 4LUBA 4O44B 3FK4A 5A8WA 1N56A 3I56S 3LA0A 4OI2A 1URRA 2QYCA 1VBKA 4ID5B 3IWXA 2CQ1A 3CD5A 1NKEA 4O0NA 1N36J 2JEJA 3NAIA 4B02A 3O44A 2GJIA 2YPZA 4TU8A 5DZ7A 4GVLA 4JI7J 5HK4A 3M2VB 3D1QA 2PA3A 4OYPA 4Z7YA 2V4RA 2DR9A 3QJJA 1VQMS 2MQQA 2YX1A 2NR0A 4LJMA 4YUDA 3ZTSA 2GJFA 1NCLA 2WVDA 4ERDA 1R6YA 4NLQA 4WZQA 4DOZA 4KIAA 2X1GA 5JMNA 3SIPB 1YI2S 1CULA 5C42A 2ZOFA 1KHVA 2GZOA 4DQQA 1UW4A 4LSNA 5THWA 5LJ5Y 4OHVA 1UPMB 1RB0A 1NEEA 2ZHOA 5E3QA 4N47A 5KFIA 4EK2A 3BH6B 3U27A 4B9SA 1NXIA 1WEYA 1S9EB 1FRMA 3K7RA 4OL8A 4Q0BB 1QAJA 2EK1A 4ZVFA 1GX6A 2CG4A 1HQEB 2I6WA 1YIJS 1UJ5A 2IIHA 3H5UA 2R7SA 1DQAA 2ZBQA 3LP0B 3V6KA 2FVCA 5KG3A 5BJRA 4OHWA 4OZ3A 5B0EA 2LU1A 2NYHA 2FJVA 4KR0B 1RWUA 4KQZA 3UN2A 5FJ4A 2AW0A 3MM8A 1B0VA 2LCWA 2NREA 4JP8A 3VF0B 1S1TB 1BGXT 2RKIB 5IQ6A 4R5PB 1C0TB 3TZYA 2COLA 2M7SA 1A9NB 1FD8A 5H9FK 4ZJOA 3NY0A 4DLGA 3G6YA 3KFWX 1SC4B 4TQSA 2ILYA 3GV7B 1AYEA 4ZVGA 4CLZA 1GX5A 2MQMA 1TMJA 2X3DA 4AFFA 3CJKB 2AIRB 5DDQC 4LVNP 4OZ1A 5H1SV 1N34F 1XNQF 1SH0A 3GIMA 2FVPA 2XQCA 1OQ3A 2NCKL 3WZ0A 3GTYX 1Q5YA 3KLFA 2YNGA 2P9EA 2HVHA 1Q8LA 4OYWA 1T8EA 3LP1B 1JLEA 1X4GA 2GQQA 3TUZC 3BO4A 4F4ZA 4ZCKA 5A2QY 4DG1B 3MD1A 1EARA 3NBPA 1U8WA 4AD6A 3KLIB 5KFUA 4Y3CA 4V19J 3EGZA 1ZM2A 2VBXA 2ZUAA 3IG1B 4NRTA 2XS2A 3H5SA 4LFCJ 2U1AA 5I42A 2DHSA 2Z2MA 2CNNB 3BDEA 4A8WA 1NK8A 1FXLA 3BV8A 1YZ7A 1PSDA 4QIFA 3QT7A 2RF2A 2V9KA 3RBDA 1DTTB 4YY3J 4FNHA 2HK3A 4ZVRB 2YNIA 3MR2A 2DNZA 4KSEB 2XC9A 1YX2A 4FKYA 2IAJB 2NXUA 5IT9Y 4OZ0A 3KNGA 2DBBA 3MMAA 2VQEF 1ZTTA 4NI2B 2ZITA 1XR6A 1FDDA 3D28A 4LRBA 4MFBA 3DOMB 3KLEB 3MOJB 5GADI 2ZBCA 2LU2A 3K5NA 5F8JA 4FYXB 2KKHA 4WTOB 2E7VA 3DYAB 2F63A 1R3NA 2AX0A 2FLOA 3IGNA 1WEXA 2EFPA 4K8RA 5LM7E 1FXRA 3OFHA 5IWAJ 4X66F 4KHMA 4P2MA 3TOQA 1M5SA 2IA0A 2KDOA 4MKBA 1WTFA 5ETRA 3DHXA 4RLEA 3I87A 4GC7A 3NG8A 4QPXA 4IH6A 4PG4A 4C6AA 3M9OB 4FN5A 3GQCA 2W2MP 1E6YA 4JI4F 1NJWA 4RU2A 4ZS6A 1X4EA 3UO0A 4X84A 1REVB 4N7TA 1WOSA 4WK1A 1U1LA 3CJRA 4DR5F 2OELA 1VRUA 2OD6A 1DLOB 1X8DA 2ZNZA 5HVFA 4PYAA 3EWGA 5D77A 3IO1A 3BKFA 4QWBA 3UNGC 1S12A 4KO0A 2XM3A 4U7UD 4QBUA 2BANB 3B54A 2H54B 2R7TA 2ACYA 3UCGA 1TKDA 2VKRA 3DM2A 2QTWA 3FVYA 5LMNF 1XNRF 1RTJB 3CIMA 3DLBA 3OFEA 1QM9A 2GQ2A 2GGPA 4IRDA 5HROB 2KXHA 5HVHA 2OFHX 4GKJJ 5B0BA 4NL5A 4DUTA 1YDLA 1BD6A 2MMYA 3AOAA 3GR1A 4GO5X 2FHOB 1S99A 3PJ9A 2DXDA 3K8VA 1CVJA 4DL6A 2FHJD 1JJ2R 1Y0HA 1EB0A 2LQ8A 3GV8B 2BKNA 4PXCA 1KDNA 1NZ8A 3U1MA 1YHQS 3RB6A 4RUCA 5B0AA 3D0HE 3SXLA 3PY8A 3MUMP 2LA4A 1PO6A 3LW5C 4A8OA 1EZZB 4OFZA 4B17A 3KYLA 2L08A 1WKKA 3PKYA 2W2NP 5D4PA 3MM5A 2I8EA 3PDNA 3VR1A 3BPDA 1KVIA 1RTIA 4AYBD 1FVSA 2JDJA 2DIVA 4CO0A 1C2PA 4UT4A 1MROB 2BKOA 2L48A 3CJSA 5C24B 3EGWB 2HNZA 1F0XA 2XZTB 4EYHB 2UUBF 3K0JA 1UA0A 3UI3A 1KTQA 1IWAA 1H3DA 1SQFA 1HHQA 2RQMA 1HW9A 2QLBB 4R8UB 3M1VB 1NM2A 1SV5B 3I55S 4C8YA 2CXEA 2O1PA 1ZAWA 3OR1B 2MLYA 2XMKA 1UJ6A 3VAFA 2EEYA 4ZITA 4M8LA 4OZNA 1HQUB 1B64A 3RAQA 4ZLLA 4DUZF 1Q7YT 4U6PA 1Z2ZA 4WFNQ 1TUWA 3SEOA 5LMUJ 2JWNA 3MXHP 5CABA 1UVJA 2IC3B 3ISNC 3ZXWA 4XK8C 2EPIA 4YR0A 4ATNA 2I9SA 4UZCA 3CCMS 1FJGF 3IAS9 2HIYA 2XO6A 1XTZA 2L9NA 1OPZA 5FDLB 1YITS 2OTLS 3OTEA 4TU9A 1IBKJ 5K20B 3JQMA 2C2MB 1HBUB 5C25A 1YLXA 3O3LA 4PWDB 3FZBA 1FRHA 1EETB 4B3TF 3JB9k 5A6PA 3HX9A 1Y11A 4DXLA 4KT0C 5J2PA 3QQCD 4NA2A 3W66A 2LXFA 4LSLA 2FJBB 3AJ1A 3WDOA 4G65A 1QLNA 3ZZRA 3T6JA 2M4MA 5HMXA 2N7YA 2QFIA 3BZQA 2VPYB 3D68A 4RWWA 1PBUA 1JKHB 3OJSA 3A8IA 2FD2A 2K7JA 2JC0A 4WFYA 2ZZNA 1KVKA 2FJXA 4BWMA 1BMQB 5BR8F 4WFAQ 2ZD1B 1GTHA 1FO1A 3R1HA 3P5BP 1CEZA 5EX3A 2GNKA 3K5MA 3PJWA 3DLGA 3PYFA 4DR7J 1SBRA 4AL6A 4OV1A 3KG1A 2FHKA 1HL6A 4X4SA 3CD0A 1HNXF 1RHKB 2DJWA 4O4GB 2CYYA 1RBAA 3LWLA 3MEGB 4G1IA 4IYQA 1G1XA 5KG7A 4LF2A 1SQEA 5BYSA 4NA1A 5IM0A 3QRPA 1FJ7A 1FRXA 3QRRA 3GLJA 1LXJA 4B3RJ 2BRKA 3C16A 1WHXA 2VBZA 3W5ZA 1SC3B 2VG5A 3RAMA 1VOMA 3KG4A 1ROFA 4Q43A 4A8MP 4E0DA 4FF1A 2K1RB 3UR0A 4ZDNA 1UVIA 2CPEA 1QAIA 5A0YA 5J1EB 3SCJE 3PNIA 4I68A 1X4BA 3GJRB 3GIRA 1DHMA 2CDRB 4O44A 3KG0A 1K8AT 2ZKTA 3VVUA 2GC8A 1TKTB 1NH8A 4ID5A 1CQNA 3PYDA 4AUKA 1IBLJ 2ZE2B 1HARA 4K4XA 7FD1A 1KSPA 2VU5A 2C3UA 4S0MA 2CQ0A 1D1UA 4WFXA 1T9XA 2KG0A 1ICEB 2B5JB 2YX7A 5KFHA 3M2VA 2FB0A 1R43A 2C2KB 3NOGA 2F9JA 2VHGA 1WI8A 1QDUB 4X2BA 1N34J 1YJTA 4NOHA 2YWHA 1SJFA 2R8GA 1B0PA 4V19X 2W9BA 1VC5A 2CFXA 2MHEA 3LP2A 1G6BA 4NLUA 3MPUB 5GMKa 1F3FA 1HNWJ 1BQNB 3F73A 2V5HG 1KQFB 1F6TA 3SQOP 4A8KA 2FTRA 1YJNS 1V5VA 3IXQA 3QNWB 3BDPA 4FS1A 3N5FA 4BC9A 2XYGB 4FDFA 3UWTA 5C2CA 5KFFA 4KYZA 1N54B 2IBOA 3OVAA 1S9EA 3A8EA 4Q0BA 1HBNB 4RNOA 3TX8A 1ZM9A 2ZOMA 1HQEA 4C3LA 1P9QC 5DDOC 2HAFA 3CW2C 2AGPA 3A8JA 2CZVC 4DN9A 3W5XA 2E5IA 5J2QA 4ZLJA 3JTNA 2LEAA 3LP0A 1HQ2A 3MGJA 1URNA 4QIEA 5CYJA 1RYRA 2VQEJ 4X4PA 4TQRA 1RHJB 5HQ8A 1S97A 5ETSA 4L6V3 2XHCA 4USHA 3IBFB 1NDCA 4LQ9A 4CLFA 1S1TA 5E3CA 1VC6A 2M0GB 4L3KA 2RKIA 2HLUA 4R5PA 1TL5A 1C0TA 2WONB 3MD3A 4F02A 1HNVB 4USVA 3W9IA 4CYUB 5H9EJ 4QWCA 1XMBA 4K2XA 4KGXB 3N6MA 1RWPB 4P52A 7FDRA 1U45A 1XR7A 2XMVA 1X4AA 1AUDA 1FDBA 1FI4A 2VODA 2G2YA 4M5LA 2ZJPQ 1G3OA 2EFVA 3LPEA 1C1BB 5HSPA 4C0HA 1F5BA 2CJ9A 5HMWA 5KG6A 3R27A 1S0MA 1GFWB 3LP1A 2HKEA 4WZMA 2KM8B 4DZ6A 4EFAC 3RB3A 1WDDA 2OEMA 4RKUC 4DG1A 2R7WA 5G0RB 1VQYA 2R7QA 1HWUA 1KQSR 5F41A 1KEKA 1VLYA 1U09A 1PKUA 1G7CB 1N0VC 3IG1A 2GQCA 1RAFB 1Y7PA 2ZC4A 6FDRA 2WW4A 4MK9A 2CZ9A 2ZFHA 5LMNJ 2CPFA 4PR6A 4JI6J 3VCDA 5A76A 4ZJLA 1DTTA 3KJNB 2GMJA 1LK5A 4ELTA 4X64F 3KOAA 2IAJA 1KD1T 1UL3A 5HAOA 3QIDA 5GMDA 3H2UB 5HLFB 3FSXA 4NI2A 1RT5B 2AT1B 1U1KA 3DOMA 4RO0A 3W9JA 2MZJA 3KLEA 1MN7A 2XS5A 3CWJA 2ZBIA 3JS9A 4DSJA 2GIFA 3I5CA 3DYAA 3V6DB 4IFVB 2UU9J 1HBOA 3NGUA 3QMQA 2H51B 1FKOB 4EI2A 3THVA 2HFVA 3BYPA 4OI4A 4KJIA 3F41A 2RNEA 5FIIA 1OYDA 3ILOA 3TO8A 3BBCA 2CQHA 3N28A 4ZLPA 3GG0A 3QGGA 1M5HA 4OX8A 5F8HA 3BB5A 4RX6A 1CC8A 3TUJC 1B3TA 3PM9A 4IG0B 4PCQA 6FD1A 1Y3JA 1NB7A 4DN0A 1WC6A 1REVA 1VRTB 2UUBJ 1BHNA 3LWMA 3ZZUA 2LXIA 3TRGA 4BC7A 2NXCA 3T6BA 3BSAA 4ZPVR 3I31A 2KXNB 2FHMA 1WG5A 3LGMA 4AXJA 2OH2A 2BANA 1EJ7L 4I67A 1FWLA 2EBGA 2KHDA 1U2FA 3HSJA 3FFIB 4ZN1A 1RT3B 1RTJA 1TKXB 1D9AA 3G8QA 2DR7A 5HROA 5KT2A 2W24A 4B9VA 3BBBA 3NS6A 2ZM6F 3UVJB 5B0CA 1BE4A 1S4FA 2QC3A 4LR7A 4DL2A 1LV5A 3THPA 1TV6B 4JV1A 3D66A 4UY85 4UUWA 1XBWA 3FNNA 3SCKE 1RAAB 3D9BA 2ZH3A 3S1TA 2WAQD 1RT1B 1X7VA 4LMZA 3F44A 4X65F 4B3TJ 2DH9A 2Z2LA 3MUVP 2V8HA 3SCLE 1UVMA 2MZ1A 1CPZA 1VQ4S 4EUVA 1VLOA 4QOTA 5M2PA 2GAGC 2DK2A 3OVSA 2WSCC 3AHPA 4FXDA 5L38A 2HEKA 1MROA 1JLGA 4DV2F 1NSPA 1D8ZA 3AB4B 1TZ0A 5C24A 5F8NA 3UE2A 2HVDA 1RWXB 1DZ5A 1LKZA 4NLVA 2C3MA 1NJYA 2QLJB 4LF8F 2Z2ZA 5CZXA 5BR8J 4LF5J 1LOUA 3VZIA 1HWLA 4IQMA 2OPRB 3LQVA 2ZH4A 5F3TA 1KWMA 3M1VA 2RSQA 1SV5A 1UFWA 3TARA 3AAWB 3ZZPA 5AXKA 2XI2A 3IWLA 4CO4A 1NDKA 4IR9A 5ETTA 3OR1A 2VBYA 4P7VA 3TJAA 1CJUB 3ZO7A 5CCMA 1DTQB 3H90A 1U1PA 2GS8A 1HNXJ 1G2EA 2BV3A 2YH0A 3C6UB 1F9HA 4YHHJ 4QW8A 3KUEA 3RW7A 1HQUA 2VH7A 2LP4A 1IBMJ 4KE5A 3BO2A 5KFDA 2YKAA 1YJ7A 2A2DA 3UW1A 2R7XA 2L9WA 5AT1B 4ZCMA 5DZ6A 1GXLA 2RUGA 1N33J 1SPBP 3QJLA 5F0UA 2ZJRQ 4TXSA 2G0JA 2H5IB 3D7SB 1LWEB 2KFZA 4C4WA 4RR5A 1T11A 4JI5J 3QJPA 2DYAA 4MKYA 4JV5F 4RW7B 2DNOA 2R7UA 4WIQA 2LQJA 2W9CB 5K8MA 1HBUA 3O5TB 4ITSA 4M5MA 4PWDA 1I51B 1EETA 4WE1A 1FE4A 2BX6A 1IN0A 1QJHA 3JSRA 1CQMA 4USKA 4H54A 5GAGU 2BACA 4NZ0A 3UFCX 4X62F 1FRLA 4CTAB 3T3FA 2ADCA 4CM0A 4CLKA 1WKJA 1A7GE 2C3PA 1NZAA 3W8PA 4F3OA 1JKHA 2UZAA 1Z2LA 4AXIA 2DH8A 2ADBA 4HH1A 2UUAF 5AJ3J 1JB0C 4MKAA 1RGVA 1XK8A 2DGXA 1S1VB 5IV4A 3GILA 1LNQA 2ZD1A 2HZVA 2B7BB 2FC9A 2V2VA 1OSDA 2RDJA 9ATCB 2HFOA 1MLAA 5A8RB 3MM6A 4WXWA 1QSSA 4F4KA 2HS3A 1GT8A 2I2YA 1X4CA 2EG2A 4OMFG 1QUVA 2E44A 2C22A 3HHLD 3OXFA 3MEGA 3A8KA 4YDDB 3AT1B 4NEYA 2JVRA 4K0KF 3RTVA 3PFOA 3M8SA 5MLCV 4JI8F 1IKWB 5DGAA 1B99A 3TUIC 2G1HA 1L3TA 2DVIA 4ANEA 4FKXA 2KI2A 3I32A 4RWXA 5KOXA 1U2RA 3B78A 2PI5A 1KLMA 2K1RA 2Z8QA 4OI6A 4P10A 2JZ5A 2PMHA 1QVGR 1FT8A 1QUPA 2VF3A 3RR7A 5IOLA 5J1EA 4MKVA 3GB0A 4Q8EA 3VZHA 4X4UA 1TAUA 3LOUA 3NAHA 4G1QB 2HBQB 2MPUA 1KC8T 1N6QA 4F2RA 1P1LA 2V8GA 4ZK7M 1TKTA 1U6ZA 4MIBA 3W2VB 2ZE2A 2KVIA 4YOEA 2HS0A 3DRRB 3Q8PB 1JXEA 2NXEA 4DPYA 4DV4F 2HNYB 2B5JA 4O3RA 2MDAA 5IZHA 2XTJP 1IKVB 2UXCF 3PYGA 4DJBA 3OW2R 2RRAA 3TAPA 3HKZD 3G71S 2OO4A 1HYSB 2C1EB 1CSJA 3HI9A 2P9GA 2DPJA 2EI5A 1WC4A 2LKZA 4B3SF 4PWUA 1WG1A 3HPOA 2HBYB 3Q2TC 3CSKA 1KBRA 1P8GA 2ZWOA 2XMWA 5IXUA 1VRQC 3K57A 2XY6A 2YTCA 1W7WA 1RT6B 3G96A 4EU0A 1BQMB 2MGZB 2F65A 1FDAA 4DV5J 3ET6B 4U7CA 1FNMA 1N48A 2Z56B 2AWZA 1JLFA 1HWIA 3TVKA 1BWEA 3H25A 2ZBPA 3ETMA 2LEBA 3P8BB 2XCPA 2R3VA 3T1HJ 3JYTB 3CCZA 1HBNA 3VAHA 4UY8T 2HVEA 1T3NA 5KFTA 1Y10A 2D3UA 3P96A 4A46A 3H59A 2MZTA 2LDYA 2OGUA 3I9V9 3IR7B 4J9VA 1R8PA 2CJBA 4ZN3A 4ECWA 3J81j 4YMEA 3QFWA 1XQIA 4I56A 2B4UA 2MTLA 2ZWPA 1RUSA 4ILLA 7AT1B 4DV3F 1FNXH 2EK6A 2CPDA 4IDKB 1JQGA 3DN9A 3HVTB 1M1GA 2EFNA 3UR3C 2ROPA 1YTYA 3I82A 5DM7Q 2XHWA 4OJHA 2HHHJ 2EC2A 1QAYA 1OWXA 3FCVA 2WONA 4UZBA 2MLZA 1MWZA 4H4KA 1HNVA 4CYUA 4WKRA 1N4LA 3RYLA 1S7IA 1UW9A 2J0XA 4C0OC 3FEYB 9RUBA 3D0IE 1X9WA 3BSCA 2CJXB 3KK1B 3RRHA 1T95A 2UXDJ 1PAEX 4PAAA 3IBCB 3B6BA 2MYFA 3OTOF 3QRQA 1K44A 4OYAA 3QSIA 3Q8UA 1C1BA 4PG8A 1XMQF 1NLKL 2EKNA 1WSRA 2FC8A 1YRXA 2LQ5A 5KFCA 1CJVB 2GVDB 3QGPA 2YKPA 1AZSB 5K5MA 1HD0A 4LSNB 2E9ZA 1YJWS 3Q89A 1IJEB 2F8HA 2GHPA 2QSWA 5G0RA 2HQDA 4DR6F 4DWIA 2CWKA 3NP5A 1RWWB 2HQGA 1HHSA 4I2QB 2VFTA 1DFDA 1R89A 2FJWA 1PGZA 2BXJA 1VBZA 4FPIA 2A2CA 3CCWA 3MM7B 4ZP6A 5EGYA 3FCHA 1C1CA 1AFIA 2PDAA 4CZCA 1FEEA 2HHSA 4QYZJ 3N5BA 4IH7A 2AEMA 1IKXB 1KOOA 3EVWA 3IP0A 1NNDA 1GMUA 3O1LA 2DPIA 4HI2A 3G82B 3T5LA 4OYXA 4OQJA 2HURA 4KGZB 2FVQA 2Y8YA 2HWIA 2XLKA 1RT5A 4NCAA 1FFWB 5B0DA 4C97A 3DFEA 4FZVA 5HQLA 4HDGA 1LW0B 3QGIA 4ENOA 1EKRA 4KC5A 3MUTP 2BBEA 3CMQA 3GCXP 3V6DA 1EKSA 4IFVA 4X65J 3MPYA 4YDXA 2GHVC 1FKOA 1BWVA 1U4BA 3R7SB 3HP6A 1S7HA 4JI7F 5DG7A 1Q86T 3AJDA 1WTBA 2Q1LA 1XMOJ 4K5SA 2MQNA 4XPCA 4EZ6A 2EFGA 2V4JB 5LL6d 4IO9Q 3KLFB 1YSJA 1WOPA 4IG0A 1VRTA 1VJQA 3T5HA 1Q82T 3FBBA 4LF8J 2XBPA 2VDHA 2NPFA 2UV8A 4L72B 3C6TB 2KZMA 3E51A 1C4AA 3IS9B 3CCSS 5IFMA 4KFBB 1TKZB 2NZ4A 3A4TA 4DR2J 1H0HB 2Z0GA 3RBXA 4R0EA 5I42B 3FEXB 1W2IA 3T1YF 3NGSA 2HK2A 4USTA 1KLNA 1QD1A 2GX8A 4NE9C 1FRKA 3FFIA 3J80Y 1GEHA 1RAHB 1VR6A 1XERA 1TKXA 5CHCB 4O3PA 4HLBA 1NBEB 3ISZA 2YNIB 4ZMMA 1V3RA 4LBIA 1TTHB 1UFKA 5HL7Q 4J9PA 2UUCF 4J9LA 1IM4A 3ZTRA 4JI2J 1S0NA 3UVJA 1M5OC 2ZZMA 4E8UA 5KT3A 1Y3KA 2HHWA 3GIIA 1TV6A 1W26A 2OEJA 3MPWA 2UUTA 1RK8A 2V9WA 4KPYA 1FE0A 3DLJA 1LFPA 3TQEA 4DBQA 2Y8WA 4LIRA 4QR2A 3VALA 1RTHA 2CQBA 3QBCA 4ZJQA 1RT1A 3ILJA 3WX8A 2BJ1A 2OSRA 4J9QA 3HD2A 1OY6A 4WU2A 1S10A 2ATCB 1ZBTA 2ASJA 1Q5VA 2E5HA 2W7AA 2CWXA 2G9OA 5D6GA 4M5NA 2P6TA 3TA0A 1MSWD 4H4KC 4RNMA 4LRCA 3ZZTA 4DFJA 1FA0A 2CPYA 1AB8A 2G0IA 3M2UB 3N6NA 5LSRA 2GFFA 4U67Q 2UUAJ 1U7LA 2PSZA 1VRUB 5I3UB 4HTIA 5DDPC 1EP4A 2RU9A 2M2BA 4LVOP 5GMEA 2JFDA 3HVRA 2OPRA 2E9RX 4WYWA 2QA4G 4KO0B 4QR0A 4LRAA 1N88A 5GAHU 3Q8QB 2E1MC 3OLAA 1WD6A 2IDEA 5K14B 2H9ZA 3DNCA 3DLLQ 4LFCF 3PR4A 1CJUA 2VD3A 3CJ4A 5IC4B 3FSIA 2HQ3A 1Q8KA 2NYIA 3C6UA 4HACB 3QZ7A 3BGRB 2UVVA 4HKQA 3HDSA 4K0KJ 2P8IA 2Y1JA 4Z7CA 1NPPA 2WB1D 2MJNA 3IBWA 2M8DB 3B4MA 4A47A 2Y0SD 3LUYA 3R97A 4WTYA 1RSCA 4URQU 1S0OA 2V0NA 2VZ9A 5L46A 2AGOA 4ALZA 3CJQA 4NX9A 4RW7A 2BJ9A 2BVZA 1K0TA 1KOHA 2DY1A 2RT3A 3JSYA 3AH6A 1UVNA 5ETLA 1TL1A 2GIQA 5IS2A 2DTJA 4N8NA 3LTOA 1Q53A 2CJYB 4ED3A 4FXWA 3I0SB 1ZH5A 2CJQA 2QO3A 4C8OA 3R5DA 4RZRA 2BJ3A 3SFUA 5ETOA 3MM5B 2ZUGA 4WKYA 2Z4PA 2QZ8A 3G2XA 2YWFA 5KFQA 1U0HB 3QT5A 4ZLNA 3E8OA 4CO2A 2Q6CA 4EBEA 1MN9A 3K58A 5AXNA 2BZ2A 3PX0A 2UXCJ 4KBIA 4UQTA 4CH0S 4J9UE 4Y00A 1KHWA 5KT6A 4EBCA 2HNZB 1T9UA 5GAGI 5LSOA 5KFEA 1X5TA 1H2TZ 5J2MA 3V5RA 4WP3A 4HHUA 2FUG9 1T7PA 3S01A 1R27B 2YBVA 3MECA 1N52B 1VQSA 3MFHA 2B7CB 2O3DA 3V2UC 1WC1A 3NMAA 3M8ZA 5D4LA 1RBOB 3R6LB 4OV6A 5A8RA 2VPWB 2CNOB 3TVZA 1U24A 4AL5A 3W3SA 3UPFA 3IN5A 1NPRA 1O8BA 1R8BA 5HBMB 3HF5A 2XLIA 3L09A 3UN5A 4YB7A 3ELHA 4ZVQB 5D8HB 2HNDB 3TW0A 2HS4A 2HW3A 4KGMA 5DETA 3Q22A 4NASA 4GKJF 4DL7A 4C8KA 2DY9A 4DR4F 3ADAC 2WBRA 3KJVB 2I1RA 3I4HX 3TZXA 4NMXA 2XS7A 2XULA 4NYZA 5DJBA 4DV3J 5CYMA 4OX9J 1SUQA 2N3LA 3X1LB 4C3MA 1GAOA 2J6TA 3CDWA 3W7BA 4X4TA 5L39A 2VICA 4LT6A 3CF5Q 5HANA 2K7KA 1VQ6S 4PG6A 4W90B 1VI7A 1Y9OA 4G1QA 4BBYA 3GE9A 4ED5A 3MURP 5D0HA 1ACMB 4Q2MA 5CXTA 3CE8A 4YB6A 5KT7A 2R4FA 3W2VA 2G4BA 3K5PA 2HFNA 3DRRA 4ZP9A 4M5HA 3CD6S 4DQSA 2DRDA 2FHJA 2FZKB 2HNYA 4CLUA 2HFZA 2QGFB 1JLQB 2WVCA 4PYDA 2IBKA 1HYSA 2DNNA 4IOCQ 2KL8A 3R1LA 2BOAA 1DAXA 5JVGQ 3Q8VA 4YR2A 1M90T 2AV5A 2QA1A 1VC0A 1B4SA 3CJ2A 3OVBA 1QVFR 3C2PA 4HVZA 2PFDA 1ZETA 1NDPA 3A3OB 3LPYA 2UV8G 4U96A 3K8WA 1RT6A 2XI3A 3Q24A 1SKWA 3GJTB 1NHKL 1ZM4A 4WWSA 2MGZA 2X1FA 1LXNA 4NLDA 4DFMA 2GIRA 1AT1B 1LWFB 5KFNA 1M5VC 4U95A 3HZGA 2HZCA 4URGA 1L3KA 3NGKA 1ZAXA 5E0OA 1ZZFA 3I5BA 4K4UA 4FYYB 4DL3A 1B70B 3EXYA 2GHWA 2HQIA 1FF2A 5LMUF 1MMLA 4FYDA 4IOBA 4XIUA 1IM6A 2JVOA 1WF0A 2LMIA 1D0EA 3MAAB 1ZPVA 1FKPB 3AD9C 3NCRA 2V67A 4U7UK 4KGVB 4DU8A 3CGIA 1NJXA 5F3ZA 3M05A 4TKTA 3HVTA 2XY5A 1RLCL 1IBKF 4DQIA 3BR8A 1VQNS 3OFGA 2MKYA 3OPKA 3MTJA 1Q95G 5AXMA 2RS2A 3M8QB 5ITHA 4WIIA 1AROP 3R7BB 3KK1A 2CJKA 1U2CA 1TK0A 5E7OB 2XY7A 3QWPA 3R6GB 3HO1A 3WX4A 2PN6A 2N4DA 2W9BB 1ULRA 2R8KA 2HHVA 3MCOA 3LP2B 3M30B 3TZZA 1HWJA 2A6OA 3VQSA 1NUEA 5F8IA 1B7FA 2J0WA 1U1RA 1CJVA 2GVDA 2MKKA 4NRUA 1AZSA 5F8GA 4A8XA 4XDDA 1HW8A 4UOFA 4DR7F 1RHRB 4ETXA 1YJVA 1B0TA 2AYBA 4NXNF 4HDHA 4DHVA 1CLFA 4I2QA 3NEKA 3Q83A 1S9GA 4CLWA 3T1YJ 1S1UA 2DNGA 3V6HA 1R6VA 4DCPB 3SSSA 3MM7A 3I96A 1P6TA 2QA2A 4WPAA 2N82B 2HHQA 5KFWA 4B3RF 2ASYA 2NUHA 1IKXA 5J2QB 2EVZA 2JFKA 4A4JA 2IM3A 4ZA1A 3KUGA 4OX7A 2OPSB 2J9DE 2UUCJ 3G82A 2RRNA 4IRKA 3MR7A 4LF9F 3UD3P 3HHLB 2MJUA 2KFYA 1S1WB 4P74A 4L3NA 2HBRB 3W2WB 3LGNA 4I2PA 1LW0A 2YX4A 2M9KA 2WRMA 4N56A 1VQ7S 4OI1A 4IQXA 1I94F 2J7WA 3GFHA 1UFLA 2OEKA 1IBLF 1TU0B 4JYAF 4JB8B 2R2UA 3KLGB 2WVFA 4HR2A 1SIWB 4TLQA 3VGVA 3NL0A 1OJ4A 8AT1B 5KFBA 2APOA 1SKRA 4Y0FA 2E5LF 1Q81T 3H8YA 1Q1KA 4QIVA 2R2TA 1PJ7A 4OJ3A 5CZVA 1VK3A 4TN2A 2HHTA 2V4JA 1RADB 3DKDA 3FRZA 3CTRA 4HL9A 4J9MA 1E6VA 4N8OA 2PI4A 5A8KB 5AE3A 1SQGA 2E1RA 2CG8A 1H7XA 2XSJB 5DDRC 1HNWF 1R8HA 1R0BG 1SH3A 2JJ4D 2RU3A 4B9UA 1CC7A 3R5BA 3RRGA 4IG3A 2ZZTA 2FJDB 3J7Z5 4J9SA 3A13A 2MKCA 3JSBA 4ZOSA 4DSFA 3C6TA 3PW4A 3DGPB 4CLPA 3IS9A 1RHQB 4KFBA 1WF2A 1TKZA 5HATA 4RBVA 3QIPB 3SCIE 1DY3A 1HIYA 3M8PB 3Q0AA 3KKFA 1L5UA 4YS2A 2BJ8A 2QRRA 3D1OA 2QMXA 2KTQA 2J0QD 3DLKB 1VDHA 2CAJA 3CCQS 3IM8A 5F9LA 3CCJS 5CYQB 3MCSA 2ZKUA 3OR2A 3GV5B 3E2EA 2ACMA 3A3NB 1NAQA 1XWLA 2D3ZA 4OHZA 4ECRA 5K8NA 1GMWD 3DXSX 5K8OA 1JWWA 3W60A 3G8TA 1TP7A 3SQGB 1P9YA 5DQIA 2KH9A 1J5EJ 4CM2A 5HQMA 2F4VJ 1Y00A 5CQGA 3BSNA 3A1YG 1HBOB 2EW9A 1NSKL 4W98A 1MW7A 1JNZB 2CQDA 3HLUA 2K3KA 4C8ZA 1Z4UA 2HFSA 4MH8A 3HFVA 3IAM9 2O67A 4MK8A 5H9FJ 3TEHB 3VAGA 2W8KA 2B3TB 2IDLA 2Z57B 3G86A 3EUNA 3U1NA 4CQ1A 3OJUA 4J9RA 4HT7A 4QZVB 1F60B 2B4PA 5AXLA 2CIMA 5MAOA 2D1CA 3M2UA 4WCEQ 4OZ2A 4NCGB 1K73T 2DHHA 3M8RA 2VOPA 3EZ5A 5I3UA 4ZVEA 3HVWA 3M8YA 2BQ3A 1VS3A 5IV3A 2E5GA 2DNRA 1L3UA 1NH7A 1KKHA 3CCLS 1S6QB 4WXOA 3T9ZA 5K8PA 3W1YC 4B3MF 1NK7A 5HI7A 2FVRA 4B9MA 4JV2A 3V4IB 3FUYA 2FVSA 4Y2CA 1PBAA 1V3ZA 1VHFA 5K14A 1U02A 5I4MA 2P5VA 4QIGA 1QTNB 4AL7A 2B56A 4DV7F 4JI1J 4HACA 2NPIA 4JI6F 5CA5A 3ONQA 3BGRA 5GAHI 5EUHA 2KXFA 3IA0A 2YWEA 4RW4B 5KFOA 1FK9A 3AXMA 2DGVA 2YQ0A 3NNAA 3PIOQ 1FCAA 1TK8A 3PVXA 3ZZ0A 4DR4J 4Q44A 2B8QA 3KLHB 1H38A 5KT5A 3HSZA 1NB2A 1R0AB 5LXYA 1M1KT 4URSA 1NHUA 3F0NA 3MCMA 1SI9A 4NA3A 3RBEA 4LF7J 2UU9F 1JJCB 4ID8A 4IR1A 4F4YA 2XMTA 2RIJA 3I0SA 2MB0B 4R25A 2GO9A 3FRYA 2JRSA 1SJ1A 3KHRA 4LBPA 3HULA 3HZEA 3MPVA 3BQ0A 2EFQA 2WSFC 3Q8YA 1U0HA 1HNZF 1P1TA 2JLGA 4P2SA 1WHWA 1RABB 2YQ1A 1ZA2B 1JLGB 3HHKA 4KGKA 2YKMB 3P5TL 4B9TA 2M88A 2DD8S 3HSGA 1SJRA 1V3SA 1VQ8S 5EX0A 1F2HA 3EPGA 1LK7A 3SDEB 4OIXA 3EICA 3R3TA 2V94A 2P2CB 4H4MB 4NCBA 4OZJA 3OTBA 1U26A 2JL9A 5KFPA 4LF6J 1FX4A 4ZPCA 2WW8A 1N32F 1LFWA 3CIZA 2CPHA 3SMZA 4DQRA 3CMAS 3CB4A 2ATLA 1YBUA 4C11B 3CUNA 3SSRA 2UP1A 4A8SA 1AUSL 5HBMA 3CCES 2KRBA 3RU0A 3LAMA 3PRDA 3P4UB 2HNDA 2VPZB 2IMWP 4RW9A 2RB7A 4DF8A 4V1Ak 5KG5A 3K5LA 3SSQA 1YBTA 1OYEA 3KJVA 4QWEA 2RDIA 4K50A 3IR6B 3QFHA 1FFSB 4ZIWA 2E29A 3W63A 4NXMJ 2V50A 3BREA 2AYMA 1FJCA 1U8SA 5BYQA 4WE1B 4IH5A 3IWNC 5RUBA 1M0SA 1XR5A 2IRXA 3E01A 2W7OA 2XMAA 1TVRB 2OHDA 1UAWA 1M5KC 3OQ2A 1ZOTA 3N79A 1LQ9A 3LH2S 2W9AA 3FJ2A 2IFXA 4NEZA 4PWWA 4K4TA 2V4QA 2W4CA 4ELVA 2RD5C 4WFZA 1X31C 3J7ZT 1JLQA 5E2QA 2OJ3A 1RTDB 4ZPAA 4F4AA 1RE1B 3AA8A 3C46A 2A3JA 4I0WA 5DQHA 2GVZB 3VHQA 4UF4A 1RAGB 4PABA 4LF5F 3V4MA 5D0GA 4QU6A 4QJVA 1RBLA 1WUUA 4KAIA 3CDUA 4C3KA 3KNAA 2ROGA 4IRCA 1RTZA 3OV7A 4B9LA 1PJ6A 3UD4P 1S79A 2KG1A 2ZH5A 3MM6B 1YJRA 3AD8C 1EHWA 2C2RA 1SC1B 4ICLB 1LEOA 2HGLA 3OUYB 4JV0A 3PW5A 4PUOB 5DQGA 4NXNJ 3VAIA 1LWFA 4DPXA 4QIWD 2GMLA 4YHHF 3TA2A 5CD4H 2C2NA 1IBMF 1CJTB 1YBAA 4J37A 2W4DA 3L7PA 2VOOA 2VG6B 1N5QA 2ZBRA 1N33F 4X4NA 1IUJA 2NXJA 4FF3A 3PO4A 2ZJQQ 3E3XA 2WHOA 3H20A 5EWEA 3Q2SC 2V2QA 3G8SA 3I9ZA 3R5CA 4DR1J 3MAAA 1FKPA 1S1XB 1KLMB 4RW6B 2OD4A 4JI5F 2V2ZA 4FYWB 2BE2B 2W25A 3UCZP 4LF9J 1Y5NB 3BGFA 1U1QA 3D6HB 3TJ8A 2VONA 3KXDA 1H74A 5F9NA 2BE7D 1N6QB 1O51A 1I94J 3KHHA 3W5YA 2B4OA 2PC6A 4NLSA 3MAHA 1M5PC 2E1PA 4JYAJ 3UNYA 5EN1A 1D09B 4A8YA 1L3SA 3NRBA 2BE9B 2WK4A 3M8QA 3C3LA 4KRWA 3L3CA 1C0UB 4NLRA 2F40A 2KHCA 2B6AA 2CNKB 3QGHA 2P9CA 2HIQA 3GJQB 3GU0A 4J9KA 5DLGA 2E5LJ 4KHPJ 4Q5VA 1X4FA 2XO7A 4DPTA 2IRUA 4LQ3A 5AJ3F 3EJMA 4K4VA 2DXFA 3PTWA 1TELA 2MQLA 4P72A 4EO6A 3D1HA 2NS1B 3H0PA 3M30A 3QO9B 1FWKA 3GPAA 4Q8FA 1AA1B 1GXUA 1S6PA 2B51A 1J5OB 3O6QA 1R0CB 1Q8IA 4M94A 4PPZA 3THTA 3NS5A 2JOQA 1U25A 4P71A 1JLFB 2XGQA 2IVYA 3NGTA 2I5JB 2HHXA 2KYZA 3VVTA 2J7KA 5FD1A 1Q16B 4B9NA 5L1IA 2I0XA 3TR5A 1XEZA 1R7IA 1VQ5S 4F0KA 3KMQA 5KG0A 4IFYB 2EXUA 3JAMU 4YR3A 1OQ6A 1EX8A 3OSNA 1OPIA 5L1KA 2YY3A 4GO7X 2IYIA 2OPSA 5E3PA 4RNNA 1PJ5A 1RWOB 1RXOB 1H7WA 4IO1A 3HHLA 1S1WA 2QL7B 3W2WA 2FYXA 3JTOA 1WG4A 4OYZA 1LW2B 1R8AA 2KN4A 3KTQA 2UVWA 4XTTA 5CAAA 2VQFF 4Y34A 3ULHA 3KLGA 3MEDA 2AD9A 4DV1J 2NQPA 3ZFVA 2JLFA 4NMLA 4ZCIA 2CRLA 3DGVA 2BR0A 2BOPA 1PYSB 3OTDA 3WQPA 4P6QA 2H1YA 2IM1A 4FBTA 2D9OA 4EBDA 1WSVA 3DRPB 5KT4A 2M8HA 5IT9U 3QLHB 2MZSA 4ES1A 3ENAA 2A1BA 1S0VA 2LQBA 3DLHA 1WC3A 4DV6F 3HFZB 3MTKA 4CLLA 2UXBJ 2OTJS 5A8KA 2FLLA 3RZAA 2F5GA 3VGUA 2XSJA 3D3BJ 5G4DA 2DO0A 2MHNA 3T1AA 1RI7A 4Y2MA 2PEHA 4ECQA 1RT2B 4I64A 3AOCA 2DR8A 2FZGB 3GYNA 1MMNA 3CO0P 1LWXA 4B3MJ 4LFAJ 3DGPA 4DV5F 1GH8A 3I5AA 3QIPA 4ED6A 4ZPBA 3M8PA 3AY0A 1MNEA 3T1HF 2BDPA 2MKJA 1T03B 2E9TA 3M4XA 4DV7J 1MWQA 5HN0A 1C1CB 1CG2A 4M5JA 1K0VA 3IFEA 3DLKA 4N77A 5DG9A 4UUXA 4MT1A 3PV8A 4GMKA 1F2GA 4NLWA 5CYQA 3IC1A 3N0VA 4B3OB 2ZDOA 5JUMA 1TAQA 2VDIA 3C19A 4KY3A 3ILIA 1X4DA 2OP5A 2K06A 3CPWR 4KTQA 4C8NA 4O23A 2DRAA 2W2OP 3PEHA 4PQUB 3ZTOA 1I6JA 3N01A 2YNFB 3J7AN 3SQGA 1UA1A 1K1QA 3TI0A 2VKZG 3BPSP 3DDKA 3KLVA 1S77D 3AA9A 4NYPA 3H42A 2HHHF 3Q23A 3OLBA 4CWBA 3BYRA 1JLAA 2B0GA 3EVOA 4R0JA 2BJDA 1VQ9S 3M8WA 3UDEA 2ASLA 1KRPA 4ETZA 2FY8A 2M70A 1HNZJ 2UXDF 5F8MA 4EWTA 4WYLA 2J9EA 4QQBA 4E98A 3B82A 2OFGX 3CJTA 4Z2XA 5JJBA 4F7VA 1RU1A 3MM9B 3ITHB 2GAHC 4NCGA 2YPYA 1LWCB 2IVFB 3CEDA 4CLYA 4UTGA 2C28A 1ZYQA 1IR1A 1NK6A 1S6QA 2XCAA 5J2NB 4DCOB 3CO9A 2C42A 2AKWB 3UDCA 4ES3A 3VV2B 1N32J 3MEKA 1SJ3P 1SL2A 5LT5A 3V4IA 3WC0A 2GW8A 3ENQA 3DC2A 2YKNB 2CNLB 4ZVPB 4TY9A 3JAMY 2KT5A 3NGDA 5DM6Q 3OL8A 1UEVA 1OS5A 2WVBA 1BUXA 4YFUA 1RT7B 1DARA 1T3OA 2ZDPA 4I6WA 5U47A 1Q79A 1FFGB 3N9UC 1W25A 4RW4A 2A10A 4GVBA 4H4OB 1JMTA 1Y5LB 2CQ2A 4CCHA 3ZC4A 3P6YC 1I3OB 2E7WA 3BF4A 4I69A 2CPXA 3ZNJ1 3KLHA 3DOKB 2XMJA 2JNJA 2R2RA 4QU7A 1R0AA 2W7PA 2IJRA 3M2RA 1RTHB 2FPHX 4AQYJ 3PEJA 4J90A 3PYEA 2DNLA 3HHLC 1OMSA 1V6HA 2HG4A 1PC5A 2QT7A 3HFKA 4JOUA 1VK8A 3FMBA 2Y1LB 4DR3J 1N5VA 4DX6A 2YNHB 2EG1A 1WELA 2MQ8A 2PT0A 3DI6B 1K9MT 1XMOF 3OTCA 1CS4B 4UOGA 4FXVA 1HMVB 2RQKA 2X7IA 3DRSB 2DITA 3NOCA 2YKMA 8RUCA 2XNQA 3MHYA 1VMBA 1FD2A 3UCUP 1NU4A 1VBYA 2M5YA 4USIA 3EGNA 2WTFA 3SDEA 3MAQA 1EP4B 3FSYA 1HI8A 3PW0A 1H73A 1NO8A 2FQQB 1WJ9A 3P49B 3QPIA 4H4MA 3CC4S 3CJ8A 2IJFA 2CJAA 3V6JA 2NSCA 3H2LA 4D3HA 3OFFA 4GKKJ 4DR2F 2DB1A 4NPOA 2RDDA 4BWJA 3EZOA 4G1PA 1ZAVA 1HR0J 2DNHA 5KFLA 1NHVA 2HVIA 3EM1A 4C11A 4PZVA 1Y4ZB 2KT3A 4CO5A 1JLCB 2VG7A 4X4QA 2LVWA 1NPKA 2KVQE 1HNIB 1K47A 2VUGA 2VL1A 2MY7A 1X9SA 3TP2A 3T41A 4D3GA 1X9MA 4YB5A 5L1LA 2Q6BA 4JI2F 3Q8RB 2CQ3A 2IRYA 3ZTQA 4DPUA 5J1PA 2ZVSA 3H98A 2HRTA 4Y65A 2E1AA 2XSFA 2H5EA 2DXEA 4DUYF 4OHYA 3OL9A 4Y2AA 3BBFA 1TL1B 4JUZA 4Y2KA 2D9PA 3SYZA 2GO8A 2BRLA 4DDFA 2DGUA 2V69A 3HKWA 3DDNA 2VJUA 1V5IB 1QSLA 1TVRA 4J91A 3RJMB 2XZDB 3FCWA 3H4DA 2B9XA 2YWGA 1UVKA 3FQKA 2CDQA 2RHQB 1HA1A 3QT8A 3HCXA 1VQOS 4MMOA 4F3QA 4P75A 2CQIA 4BDPA 4EGLA 4Y6IA 4M5DB 1RTDA 3RUBL 2MSSA 2OKQA 3MEEA 5J2MB 2RHSB 4A8QA 3TYTA 2GVZA 3M7VA 3TX0A 3MECB 4K59A 1RZMA 4DU7A 3L7UA 4CIOA 3R5GA 4M5IA 1WC5A 1RJJA 1VYAA 4ZPWR 2A0FB 1TL3B 4ECUA 1T9YA 4ED8A 3IGVA 4ICLA 2ZH6A 1UWBA 3PX6A 3OUYA 3DMJB 5B0GA 4CLTA 2MSTA 3EGVA 4PUOA 3JSMB 2DO4A 4MIAA 5T7LB 3BM7A 1CJTA 2RE1A 2G2ZA 5I3QA 2JEIA 3DDIA 1S57A 4KB7A 2VG6A 3WIUA 2OSQA 3PR5B 5BYRA 1AW0A 4NLGA 3FEZA 2UVUA 2BM0A 1S1XA 4RW6A 5CYMB 1SUQB 2Y1IA 2W01A 4DFKA 3VGTA 5L1JA 1UTAA 1S49A 2BE2A 5DG8A 4WJBA 4DX7A 1SB6A 4IOAQ 1B7YB 3D5MA 2HWHA 1YZ6A 2W8LA 2KFNA 4F4WA 4RW8B 1OY8A 1RT4A 3LAKA 4DPOA 2GMHA 2DNQA 2BJEA 4RUHA 2KYXA 4KKOB 3GYGA 2VQFJ 2BQRA 4NZ7A 2YWWA 2LFVA 2XEXA 8ATCB 1C0UA 2K3IA 5KTQA 1T0TV 2BABA 2G13A 5HMZA 2V34A 1HD1A 2C2ZB 4FVMA 3KDNA 4FPRA 2HLTA 1FERA 3G6ES 4G3IA 1X5SA 3TWZA 5EWFA 3ZZYA 4DV6J 1DQ9A 1AFJA 4WFBQ 4ZHRB 3QO9A 3UN3A 1VBXA 1JLBA 4RUAA 1X4HA 2F8MA 2J6UA 5JXSA 4Q7AA 1SIZA 3GZ7A 2XMUA 3R5JB 2V68A 1J5OA 2K2PA 4K7QA 1NSQA 2QFJA 3RGIA 2MQOA 4BS2A 1HPZB 2FLPA 3TVYA 4DL5A 2FJEB 3UQSA 3C15B 3M6UA 2VPXB 1RU2A 1YK9A 3S6EA 1REGX 1R8CA 4ZP7A 2N4CA 5KFZA 3KK3B 3I4PA 4WP8A 4Z37A 2I5JA 3N6LA 4OZLA 4F25A 4OI3A 2HYIB 2QIFA 1YGYA 5DLFA 1X5PA 1JNRB 1EAYC 1RAOA 4IFYA 4RNHA 4EYIB 1WI6A 2HWTA 2KJVA 4UW2A 3GG1A 4HTJA 1JXVA 4P2XA 1RA6A 1F5AA 2IMOA 3DHWC 3AD7C 4O4RA 4OX9F 3MR3A 4QPTA 3U7JA 3O8WA 4F4XA 1RAIB 4F04B 3MI7X 5D78A 2R7OA 3MMBB 4O3SA 1KN6A 3KDOA 1LW2A 3OL6A 1JX4A 2MY8A 4W92B 4DCJB 3GMGA 2CZ4A 4UOHA 1RKIA 2DGOA 3KHGA 3CCRS 5D4OA 4DL4A 1U49A 4QWDA 2G0CA 4ED1A 1HI0P 3ENWA 2DH7A 1HBMB 2ABYA 3T19A 4WBFA 2F1FA 1F9FA 1WF1A 2VBWA 1PAUB 4ZCLA 4LR8A 1D9DA 2H3EB 5H9EK 3DRPA 3QLHA 3QAEA 2ZH1A 2AEFA 4N41A 4J9NA 2W2PP 3EDQB 1RWMB 2A6MA 1UP1A 1SL1A 3FQLA 1RQ0A 4LR9A 1RT2A 3HJVA 1T94A 3EVMA 1XNQJ 3PCOB 2CPIA 2QA4S 2DGTA 3DCAA 4ED0A 3IM9A 3PRBA 3BH7B 1S9GB 3AJ2A
chains in the Genus database with same CATH topology
2OUGA 1NPPA 3EWGA 1NZ8A 4ZN1A 2XHCA 3H7HB 3LPEA 3P8BB 2K06A 1NPRA 2LQ8A 4ZN3A 1M1HA 1M1GA 2EXUA 3QQCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OUG A;  1NPP A;  3EWG A;  1NZ8 A;  4ZN1 A;  2XHC A;  3H7H B;  3LPE A;  3P8B B;  2K06 A;  1NPR A;  2LQ8 A;  4ZN3 A;  1M1H A;  1M1G A;  2EXU A;  3QQC D; 
#chains in the Genus database with same CATH topology
 3BN4 A;  4BCA A;  1S1U B;  1Y5I B;  2OLW A;  1T03 A;  1WHY A;  1GK8 A;  2PO4 A;  3CXC R;  2VFV A;  2BQU A;  3R7N B;  3IRX B;  3RBZ A;  1KVJ A;  2PE8 A;  2R2S A;  2ROE A;  3HT0 A;  2FIU A;  2SXL A;  2IM0 A;  2PFF B;  5ETQ A;  3ISN D;  3N4W A;  5JVH Q;  2IM2 A;  3LAN A;  4B3O A;  3B4D A;  1V9O A;  2VC0 A;  4ES2 A;  4I4B A;  3EE3 A;  4HHJ A;  4EO8 A;  2D3O 1;  5KFK A;  3U1L A;  1IXK A;  2JC1 A;  2Q3P A;  4USM A;  3KK2 B;  2ZH7 A;  4PQU A;  4I6A A;  4I2P B;  2QMU B;  4NZ6 A;  3PZP A;  2D69 A;  2YNF A;  2KB2 A;  3CJ0 A;  4OI0 A;  1PYT A;  4GRS A;  2AJF E;  1RWN B;  5KFJ A;  2RH3 A;  4I7F B;  5DGB A;  1P27 B;  1VIX A;  3PJX A;  4C98 A;  1IVZ A;  4QW9 A;  2Z58 B;  2JHE A;  3GYX B;  2OUG A;  1Q4R A;  1DJ0 A;  5ETN A;  3KJF B;  2OPQ B;  4K4Y A;  2R7V A;  1VIS A;  2DNP A;  3PRV A;  2RJZ A;  4FNI A;  2OMO A;  4ILM A;  4HI1 A;  2HSE B;  1E6V B;  1RIS A;  1T05 B;  4KPC A;  5D4N A;  4TY8 B;  2V8V A;  3MM9 A;  3ITH A;  4LFB F;  2R42 A;  5FLX U;  4O3O A;  1LWC A;  4YP3 A;  3OSP A;  2DGS A;  3W62 A;  3J81 U;  4IG3 B;  4X66 J;  1TFY A;  1KR4 A;  2J5A A;  2V2K A;  2BW2 A;  3CJK A;  1APS A;  5J2N A;  2DKO B;  1FES A;  2ALY B;  2LQ9 A;  2CUY A;  1N5S A;  2XMM A;  4F36 A;  2YKN A;  4NLY A;  2AP6 A;  4JI4 J;  2AYE A;  2AX1 A;  3ZNU A;  2XZW A;  1FX2 A;  1KON A;  3R9L A;  4ECY A;  4C2M A;  1U47 A;  1Q7L B;  1OO0 B;  1RT7 A;  3IR5 B;  4DR5 J;  1QE1 B;  3AFG A;  3OR2 B;  3CJ5 A;  2MZR A;  2F3J A;  1PYO B;  1S59 A;  2X3G A;  4KV8 B;  4PG5 A;  2V6A A;  4H4O A;  2MKS A;  4FP9 A;  3VAJ A;  5SZT A;  3KLI A;  1VQL S;  4F50 A;  4U9R A;  3NKY A;  1SCJ B;  2V8P A;  4MAK A;  5DS7 A;  4WF9 Q;  1TL4 A;  2HQC A;  3DOK A;  3DLE B;  4USJ C;  4TLR A;  1SXL A;  4MK7 A;  3D3C J;  3WIV A;  3G6X A;  2MLX A;  2BA9 A;  1XNR J;  3EPI A;  4DUY J;  1KNZ A;  2D74 B;  3R8Y A;  1DQ8 A;  2O66 A;  2E1C A;  4CT9 A;  3CC7 S;  2MEW A;  4M5K A;  2ALZ A;  2GCF A;  3UDL A;  1IQT A;  3ILL A;  3RG6 A;  3VAK A;  3C8Y A;  1S76 D;  4OHX A;  4YEA A;  3CCU S;  3O2I A;  4ED4 A;  2Q43 A;  3PAC A;  1WOO A;  1BC6 A;  4ECX A;  2CQG A;  4BHQ A;  1UPP A;  2AZ3 A;  2JEG A;  2VFS A;  1WOR A;  2JH3 A;  3PHE A;  1KFS A;  2YNH A;  5EWG A;  5B7W A;  1VQK S;  3DI6 A;  3BQ1 A;  3L95 X;  5B09 A;  1CS4 A;  3AOB A;  1BQX A;  1HMV A;  2H5J B;  1T9V A;  2J8S A;  3DRS A;  2MXY A;  4CO3 A;  1IR2 A;  2Q66 A;  3M32 B;  2RAQ A;  2YWK A;  1DUR A;  3D67 A;  4ZPT R;  4OYB A;  1VIO A;  3BQ2 A;  2X1A A;  3GIJ A;  4OX6 A;  4W4M A;  1F3V A;  3RR8 A;  1T02 A;  4J9O A;  5IC6 B;  5HO4 A;  2ZOG A;  2BW7 A;  3G9C A;  2HHU A;  3W61 A;  4OYM A;  2UVR A;  4JI3 F;  4TU7 A;  5A6W A;  3H5Y A;  1QY7 A;  3VAM A;  4RBU A;  4UQG A;  1YJ9 S;  2VC1 A;  2PMZ D;  2OIH A;  4ANC A;  3MPD A;  1TFW A;  2YKO A;  4F26 A;  4XAK A;  3PW2 A;  4WK3 A;  5ETK A;  1JLC A;  3J7A 1;  4ZVT B;  4LBH A;  1YWX A;  3MR5 A;  1HNI A;  3AQP A;  2AF6 A;  1DLO A;  1FK9 B;  4NLX A;  1UWA A;  1WDT A;  4PRF A;  2PMW A;  1O0P A;  2QN6 B;  3POT B;  4CNZ A;  2VV5 A;  3W64 A;  2OI2 A;  3DU6 A;  4MIW A;  5LOQ A;  3BGO P;  1AXQ A;  3U02 A;  1JJH A;  3M9N B;  1S6O A;  5CCL A;  1X0P A;  2HQF A;  1J5E F;  3CUL A;  1S6U A;  4CNY A;  5I3P A;  2F4V F;  3EZU A;  2ZH2 A;  3T9N A;  4ZVU B;  4DUZ J;  4ED2 A;  1SKU B;  4IUF A;  1UMJ A;  2DRB A;  1FHT A;  1NDL A;  2PA8 D;  3X3U A;  4YN3 B;  1KTV A;  1GMW A;  4O3N A;  4LSZ B;  2R7R A;  4Q2L A;  3GWC A;  3BGL A;  2POK A;  3FZ2 A;  3TAM B;  2V63 A;  4Q45 A;  1N8R T;  1CJK B;  2OPP B;  1FJG J;  3FBF A;  1JXL A;  1RHM B;  5FLX Y;  3I0R B;  3J81 Y;  2DEJ A;  1L3V A;  1ZM3 A;  3F56 A;  3OD2 A;  3OBI A;  3M6X A;  2MZQ A;  4M5D A;  3AB2 B;  1S4E A;  2NSB A;  4USW A;  2J6S A;  2EWH A;  2NXN A;  4WU3 A;  2RVJ A;  3HM9 A;  2BKP A;  2KZZ A;  1UZH A;  1TL7 B;  2VFU A;  1BY9 A;  2AJ2 A;  1TL3 A;  2DHX A;  2J9D A;  1NK0 A;  3GJS B;  2F7V A;  3SZ2 A;  4ILR A;  5L9X A;  3C14 B;  3RW6 A;  3DMJ A;  2CPJ A;  2PII A;  4JI1 F;  3P45 B;  3JSM A;  3FBC A;  3EYZ A;  2RUS A;  2B9W A;  5T7L A;  2XYH B;  3NNC A;  4ECT A;  4DPW A;  1FNO A;  3QT6 A;  4RW9 B;  4DX8 H;  4C48 A;  5LJ3 Y;  2VAS A;  4HYK A;  4R8U A;  1RWV B;  1XIQ A;  5HP1 B;  3KUH A;  1FWP A;  1O5J A;  3WBZ A;  2VFR A;  3NLC A;  6AT1 B;  3BSO A;  4C8M A;  5BXI A;  5T14 A;  3GR0 A;  1XN9 A;  3DOL B;  3BJY A;  1QTM A;  5DRK A;  5IT0 A;  5CD4 A;  1ITP A;  2H65 B;  3FKB A;  2IVM A;  1F5C A;  1I5O B;  3M6W A;  4RW8 A;  3MWB A;  4LF7 F;  1X60 A;  2Q79 A;  4DV0 F;  2DCU B;  3E01 B;  4NWB A;  1OSC A;  5HJY A;  3TQ1 A;  4KKO A;  2DNY A;  4ED7 A;  1MU2 B;  2BJ7 A;  3D6M B;  5C7P A;  4L76 A;  4OLO A;  2IC3 A;  4DFP A;  1BLU A;  2B9E A;  2XWX A;  2R9L A;  5FDL A;  3ZTP A;  4U8Y A;  3NGR A;  3NCQ A;  1H2V Z;  2QSF A;  3V81 B;  1SVD A;  1UVL A;  3QSY B;  3RB4 A;  4F0H A;  4ZHR A;  4PQA A;  4PKD B;  3PXG a;  1VQP S;  3KHL A;  2MKI A;  4ECZ A;  4LF6 F;  3PW7 A;  4CT8 A;  4PEO A;  3VTI A;  4QYR A;  1HPZ A;  5KFR A;  2UUW A;  2WOM B;  3JQK A;  3C15 A;  2NZC A;  5B0F A;  4GC6 A;  2AJ0 A;  3KK3 A;  1GNK A;  4CO1 A;  5ETP A;  1O6X A;  2DGQ A;  2MKH A;  4P2F A;  2QMW A;  1N0U A;  4M95 A;  1S9F A;  5E3A A;  3CCT A;  2CVE A;  3FC9 A;  4MJK A;  3OHA A;  1GTE A;  4FVC A;  2KT2 A;  5F0W A;  3D4J A;  2EBE A;  2DHA A;  1NJZ A;  5E41 A;  1HHT P;  1TUV A;  1J2V A;  2PD1 A;  2FY1 A;  2AEJ A;  2DNK A;  2AZ1 A;  1U0S A;  4KH1 B;  5D3G B;  3TJ9 A;  1N5Y B;  2DT9 A;  4ZIV A;  4P73 A;  5D15 A;  4KHR A;  3A3P B;  5M2U A;  1H2U X;  4O4G A;  5HVG A;  1VHI A;  3Q8S B;  2KU7 A;  1UET A;  1HI1 A;  1S72 S;  3K5O A;  4NXM F;  3PO5 A;  3MMB A;  3R5A A;  4QWA A;  3NWG A;  4O0I A;  4LF4 F;  1X0F A;  4G6V B;  5ADZ A;  3W65 A;  3GSI A;  4YQW A;  4DSI A;  1UCN A;  3CDE A;  3MFI A;  2XB2 D;  3R2C J;  1UJ4 A;  1U1N A;  2ILZ A;  3BEG B;  2DHG A;  2B6A B;  3TAQ A;  2FGC A;  4CDI A;  1HBM A;  5GVQ A;  5F8L A;  4RUB A;  1IWG A;  3CT9 A;  2ZEJ A;  2N3O A;  5KG2 A;  4DQP A;  4FS2 A;  1IQZ A;  4J5O A;  1Q0N A;  2WSE C;  4I1T A;  5GAE U;  1MG7 A;  2DGW A;  2J7U A;  3PHT A;  2B9Y A;  4NYO A;  1D9F A;  2YVS A;  1PIL A;  3CDA A;  4C8L A;  4LFB J;  1S6P B;  3AQO A;  1N5T A;  3ETO A;  3BO3 A;  1U6B A;  1NSA A;  2OML A;  4PXE A;  4XPE A;  4BLG A;  4ZVO B;  1TQL A;  1U1O A;  2W2Q P;  4ECV A;  1IJF B;  5EDW A;  4MYT A;  3CD7 A;  3FDS A;  2W4P A;  5KFM A;  2EKY A;  2QG9 B;  1RA7 A;  4DZD A;  1EIY B;  4TVA B;  3PKM A;  3IRX A;  2V8D A;  1GMV A;  2C3Y A;  3CCV S;  3K59 A;  1VJW A;  2R8I A;  1BQN A;  1NK5 A;  3EDR B;  1IKY B;  2P6S A;  3ZZZ A;  4DR1 F;  3LGH A;  1OY9 A;  3NWR A;  2LXU A;  2ZH9 A;  4JI0 F;  4XO0 A;  5EHH A;  4QYZ K;  1RDR A;  3KK2 A;  2IJN A;  1CBK A;  4P7T A;  3Q86 A;  2AMC B;  2JSX A;  3DRY A;  4LRF A;  2PEB A;  2AJ1 A;  2ZVI A;  5HMY A;  3CNQ P;  4I7F A;  4PG7 A;  1F1B B;  3J7Y U;  1DRZ A;  1S5Z A;  3MMC B;  3L7O A;  3SV3 A;  4X64 J;  4DMZ A;  3MED B;  4RU9 A;  3J80 U;  4CH1 A;  5LSL A;  2HZA A;  1KQG B;  2AJ4 A;  1HWK A;  2D7S A;  4HEA 9;  4IKA A;  2QV6 A;  3HSD A;  2OPQ A;  1RYS A;  1G4C A;  5LXR A;  4AND A;  3GCW P;  4KHP F;  2HMI B;  1ZPW X;  2C2O B;  3JXO A;  2C2D A;  4J7C A;  5A8W B;  1FTR A;  5ETV A;  3HHE A;  4B08 A;  2CA9 A;  1XC9 A;  2VA3 A;  1R31 A;  1FRI A;  1RKJ A;  4F2S A;  2B4V A;  4LRD A;  4ZPD A;  4AE5 A;  1T05 A;  1H6K X;  3BS9 A;  1RAE B;  3ICL A;  4TY8 A;  3WHI A;  3D6T B;  1KP6 A;  3QWU A;  4Y28 C;  4ZVS B;  4DX5 A;  4CRJ A;  2YKQ A;  2XYP B;  5C2G A;  2IA6 A;  4EEY A;  1U6F A;  3L9Z A;  4LIW A;  3NXZ A;  4XDC A;  2DCL A;  4JI3 J;  4K4S A;  3VGS A;  2B43 A;  2VB6 A;  4N76 A;  3CVK A;  2CQP A;  2RML A;  1UEK A;  2E66 A;  2BYC A;  1SJ4 P;  2WBM A;  3K89 A;  5L9N A;  1QE1 A;  1CUL B;  2LEP A;  2YQ3 A;  5C42 B;  5K9F A;  4LF1 A;  1SL0 A;  2YXL A;  4KV8 A;  3FBE A;  4RJV A;  2ZHB A;  4N5S A;  5IQQ A;  2QX0 A;  5M2R A;  2Y0B B;  1ELO A;  3G6V A;  2QLW A;  4A48 A;  4RBT A;  3DLE A;  2CQC A;  3AOD A;  5KOW A;  1C4C A;  4ELU A;  4YB1 P;  3GSD A;  4PPD A;  4CLS A;  2B8P A;  4PXB A;  1VCT A;  3IRW P;  1NK9 A;  2XNR A;  1W2B R;  3G87 A;  3HT3 A;  1JLA B;  1WC0 A;  3AXK A;  3QAU A;  2NUU G;  4DV1 F;  2AQ4 A;  2LA6 A;  2LLZ A;  3S7R A;  2JLE A;  2ZM6 J;  2CVI A;  2ZNY A;  5AE1 A;  3HXM A;  5HLF A;  2WCX A;  3MM8 B;  3OT9 A;  3DRX A;  2I38 A;  4CP5 A;  5L8R C;  2X1B A;  3VQT A;  2F4F A;  2AYG A;  3HK2 A;  2HHP A;  1KQK A;  5KFY A;  3M32 A;  2RRB A;  3MR6 A;  2G1D A;  2CAD A;  1J27 A;  2A18 A;  2Y9H A;  2ERR A;  2UXB F;  1N36 F;  4FBU A;  3JQJ A;  2QYG A;  3D6F B;  2U2F A;  4EMD A;  2F9D A;  4LFA F;  4HHH A;  2O5D A;  4MYU A;  5KG4 A;  2RQC A;  3US5 A;  3PX4 A;  2Y3Y A;  1YRU A;  2Z2Y B;  2LDI A;  1I1G A;  3W9H A;  1T9W A;  4DV2 J;  2QLF B;  1KFD A;  3NNH A;  2YNG B;  2DNM A;  4CH7 A;  4OYO A;  1JLE B;  3B8H A;  1RAJ A;  2N7C A;  5SUH A;  4L74 A;  4L75 A;  4X4R A;  2QE5 A;  1FJE B;  2QJ3 A;  1TR0 A;  4X4V A;  3MDF A;  4GVB B;  4F67 A;  2PGC A;  3NBP B;  3MZI A;  3UDV A;  4CI0 B;  3POT A;  4DEZ A;  1PIE A;  3CME S;  2WB4 A;  1M1H A;  2ZC3 A;  5ETM A;  1UKU A;  1ZZN A;  3W8G A;  3BKT A;  1RAC B;  1U1M A;  1QAX A;  4OYI A;  3BR9 A;  2R8H A;  1VGY A;  3S8S A;  3M2R B;  1KS2 A;  3PG9 A;  1JK9 B;  1FEH A;  1QSY A;  2RF2 B;  1RT3 A;  4KH0 B;  3D2W A;  3TZW A;  1IR0 A;  4M1K A;  1A0O B;  2FGO A;  3EX7 B;  1VFJ A;  4DV0 J;  5HJX A;  2LYV A;  5GAD U;  2WZ1 A;  2H4W B;  4K4Z A;  1D8Y A;  3MMA B;  3P3D A;  2HRU A;  2KRR A;  3ZZO A;  4PXD A;  1DBD A;  4MFB B;  3TAM A;  1EQM A;  4JV5 J;  1F9E B;  1CJK A;  2OPP A;  3KWM A;  2DEI A;  2J0S D;  1Q78 A;  1XJW B;  3I0R A;  2J9C A;  2BMB A;  1T9T A;  4OZ5 A;  1WHV A;  2HAI A;  2KJW A;  3DXB A;  1WKL A;  1JJ4 A;  4L73 A;  1ZA1 B;  1TK5 A;  5E5N A;  1X5O A;  3CJ3 A;  3NCP A;  2VA2 A;  1TL7 A;  3HHN B;  4X62 J;  3OHB A;  2ASD A;  5T41 A;  4UOC A;  3KMS A;  2E5J A;  1MMD A;  2M3D A;  1YG0 A;  2AU0 A;  3C14 A;  1E6Y B;  5CH7 B;  5KFX A;  4QR1 A;  1NME B;  3MF5 A;  3GIK A;  2VG7 B;  2CKW A;  5J1N A;  4DLE A;  3H2V E;  2JEF A;  3NMR A;  1FKA F;  2MQP A;  2QL5 B;  3CC2 S;  5C5J A;  3VWS A;  2L41 A;  1PC4 A;  4NLP A;  3GFZ A;  3EXC X;  2RQ4 A;  5HP1 A;  4OJ1 A;  3HMJ G;  2FLN A;  1A6L A;  3DM2 B;  1DTQ A;  2KM8 C;  3DOL A;  4C7Q A;  5KFS A;  3H4B A;  3KJQ B;  2IY5 B;  2Z30 B;  5IT4 A;  2VJV A;  4U8V A;  1H98 A;  4AQY F;  4YY3 F;  4F3M A;  1FRJ A;  2GGP B;  1S48 A;  2IPO B;  3D0G E;  2R8J A;  4K4W A;  1GQE A;  1HFE L;  4LF4 J;  4JI8 J;  4C9D A;  1UZD A;  1NJI T;  4Y2I A;  3C66 A;  1SJQ A;  2FZC B;  4EZ9 A;  5KFA A;  2ZHA A;  4TYB A;  3GFY A;  2XG8 A;  4I6Y A;  4DR3 F;  4DSL A;  2DR6 A;  1LWE A;  1MU2 A;  1SC6 A;  3SI8 A;  3ENV A;  4ECS A;  2YH1 A;  2J8A A;  3RAX A;  2NLW A;  4MTP A;  3HHD A;  1D3W A;  5D0E A;  2AJQ A;  3MOZ A;  1BXN A;  1NKB A;  1JIH A;  2W9C A;  5B08 A;  3MEE B;  2H4Y B;  4DI6 A;  3D54 A;  3L4B C;  3H40 A;  3V81 A;  3MCN A;  1YQH A;  1WEZ A;  5IWA F;  3GON A;  4TYA A;  2HRY A;  4ER8 A;  2QEX S;  3RB0 A;  4TNO A;  1TMM A;  5E3R A;  2X51 A;  1ZTW A;  1RHU B;  1RTI B;  4DV4 J;  4M63 A;  2RS8 A;  3HVA A;  4CTA A;  2HBZ B;  3BGU A;  2JX2 A;  4GKK F;  1UWB B;  4USU A;  4F0M A;  2FDN A;  3OXG A;  1GXT A;  2ZH8 A;  1HR0 F;  5KFV A;  2WOM A;  1U48 A;  2BM1 A;  4K5R A;  3QYY A;  1RP5 A;  2H48 B;  1K1S A;  1H72 C;  4A8F A;  4B3S J;  3M6V A;  1RLD A;  1RCX B;  2GA7 A;  2DR5 A;  1S1V A;  4RNF A;  3TUP A;  3JTP A;  1EQ0 A;  3A12 A;  2BUN A;  3EMT A;  4DL0 C;  1PG5 B;  1OIA A;  1FDN A;  5AE2 A;  5D3G A;  4ZVH A;  2HFU A;  4WP9 A;  3TAN A;  1RWK B;  2D41 A;  4JI0 J;  3H5X A;  1N5Y A;  3TA1 A;  1UEU A;  1WNE A;  2W1B A;  2K8G A;  3SFG A;  1RT4 B;  4OLP A;  3PFE A;  1YJU A;  2GJ2 A;  2CPZ A;  4DF4 A;  4DS5 A;  2C3O A;  3T5K A;  2LEC A;  1FTC A;  1IKW A;  4X4O A;  1NRK A;  4HH0 A;  2G2O A;  2XGP A;  3T5J A;  2M52 A;  5KFG A;  2EC0 A;  2RIL A;  1IBC B;  1HKA A;  4RPF A;  4DSE A;  1TUG B;  5C25 B;  4M5G A;  3IMQ J;  3FMW A;  3BN7 A;  1ZS6 A;  1WAC A;  2XWY A;  3PIP Q;  2DIU A;  2AGQ A;  3MMJ A;  3NS7 B;  4C0B A;  2VIH A;  3LF0 A;  4ZKA A;  5J2P B;  3HJF A;  5KAK A;  3TEG A;  3K2Y A;  2C2E A;  1JLB B;  1YKW A;  1MWY A;  1NK4 A;  3M9M B;  4LSL B;  3WC2 A;  2FJA B;  3QAT A;  2L3M A;  1NKC A;  1Z1Z A;  5GAE I;  1PCA A;  1YRT A;  4NLT A;  5E33 A;  1IKV A;  1SKS A;  1HLW A;  3CDB A;  3BKU A;  4FF4 A;  3I6P A;  3FGV A;  3OTO J;  4FYV B;  4JBC A;  1FXD A;  2HPU A;  4F8R A;  2L9D A;  3RRK A;  2IYG A;  2DIS A;  3OXL A;  1XMQ J;  4LRE A;  3DU5 A;  5D0R A;  2XLJ A;  2CQ4 A;  4DSK A;  3GP9 A;  4K2J A;  1RCO B;  4AT1 B;  2D3O R;  4FF2 A;  1FVQ A;  4E2F B;  2EFO A;  3HD1 A;  3DLG B;  1IKY A;  1WWH A;  4OJG A;  3H7H B;  1Q8B A;  4P9S A;  1BQM A;  4DR6 J;  2F8E X;  2AHO B;  3SV4 A;  3GFX A;  3ET6 A;  2J76 E;  2QL9 B;  2BEF A;  3OL7 A;  5A2Q U;  3R2D J;  2O01 C;  2WVE A;  3JYT A;  1SH2 A;  3QZ8 A;  4O3Q A;  1YVF A;  2HVZ A;  5IM0 B;  2KO1 A;  3LO3 A;  3C16 B;  4NLO A;  2VG5 B;  2E7X A;  3MMC A;  3TNV A;  4ZP8 A;  3G4S S;  2Y1R I;  4RL1 A;  4QCL A;  3SBM A;  4HT5 A;  3LAL A;  2IHR 1;  2HGM A;  5DO2 A;  2QLX A;  5A0Y B;  2OAU A;  3J7Y I;  5KG1 A;  4IDK A;  4DS4 A;  3UD5 A;  2HGN A;  2GV1 A;  3K17 A;  2HMI A;  4LUB A;  4O44 B;  3FK4 A;  5A8W A;  1N56 A;  3I56 S;  3LA0 A;  4OI2 A;  1URR A;  2QYC A;  1VBK A;  4ID5 B;  3IWX A;  2CQ1 A;  3CD5 A;  1NKE A;  4O0N A;  1N36 J;  2JEJ A;  3NAI A;  4B02 A;  3O44 A;  2GJI A;  2YPZ A;  4TU8 A;  5DZ7 A;  4GVL A;  4JI7 J;  5HK4 A;  3M2V B;  3D1Q A;  2PA3 A;  4OYP A;  4Z7Y A;  2V4R A;  2DR9 A;  3QJJ A;  1VQM S;  2MQQ A;  2YX1 A;  2NR0 A;  4LJM A;  4YUD A;  3ZTS A;  2GJF A;  1NCL A;  2WVD A;  4ERD A;  1R6Y A;  4NLQ A;  4WZQ A;  4DOZ A;  4KIA A;  2X1G A;  5JMN A;  3SIP B;  1YI2 S;  1CUL A;  5C42 A;  2ZOF A;  1KHV A;  2GZO A;  4DQQ A;  1UW4 A;  4LSN A;  5THW A;  5LJ5 Y;  4OHV A;  1UPM B;  1RB0 A;  1NEE A;  2ZHO A;  5E3Q A;  4N47 A;  5KFI A;  4EK2 A;  3BH6 B;  3U27 A;  4B9S A;  1NXI A;  1WEY A;  1S9E B;  1FRM A;  3K7R A;  4OL8 A;  4Q0B B;  1QAJ A;  2EK1 A;  4ZVF A;  1GX6 A;  2CG4 A;  1HQE B;  2I6W A;  1YIJ S;  1UJ5 A;  2IIH A;  3H5U A;  2R7S A;  1DQA A;  2ZBQ A;  3LP0 B;  3V6K A;  2FVC A;  5KG3 A;  5BJR A;  4OHW A;  4OZ3 A;  5B0E A;  2LU1 A;  2NYH A;  2FJV A;  4KR0 B;  1RWU A;  4KQZ A;  3UN2 A;  5FJ4 A;  2AW0 A;  3MM8 A;  1B0V A;  2LCW A;  2NRE A;  4JP8 A;  3VF0 B;  1S1T B;  1BGX T;  2RKI B;  5IQ6 A;  4R5P B;  1C0T B;  3TZY A;  2COL A;  2M7S A;  1A9N B;  1FD8 A;  5H9F K;  4ZJO A;  3NY0 A;  4DLG A;  3G6Y A;  3KFW X;  1SC4 B;  4TQS A;  2ILY A;  3GV7 B;  1AYE A;  4ZVG A;  4CLZ A;  1GX5 A;  2MQM A;  1TMJ A;  2X3D A;  4AFF A;  3CJK B;  2AIR B;  5DDQ C;  4LVN P;  4OZ1 A;  5H1S V;  1N34 F;  1XNQ F;  1SH0 A;  3GIM A;  2FVP A;  2XQC A;  1OQ3 A;  2NCK L;  3WZ0 A;  3GTY X;  1Q5Y A;  3KLF A;  2YNG A;  2P9E A;  2HVH A;  1Q8L A;  4OYW A;  1T8E A;  3LP1 B;  1JLE A;  1X4G A;  2GQQ A;  3TUZ C;  3BO4 A;  4F4Z A;  4ZCK A;  5A2Q Y;  4DG1 B;  3MD1 A;  1EAR A;  3NBP A;  1U8W A;  4AD6 A;  3KLI B;  5KFU A;  4Y3C A;  4V19 J;  3EGZ A;  1ZM2 A;  2VBX A;  2ZUA A;  3IG1 B;  4NRT A;  2XS2 A;  3H5S A;  4LFC J;  2U1A A;  5I42 A;  2DHS A;  2Z2M A;  2CNN B;  3BDE A;  4A8W A;  1NK8 A;  1FXL A;  3BV8 A;  1YZ7 A;  1PSD A;  4QIF A;  3QT7 A;  2RF2 A;  2V9K A;  3RBD A;  1DTT B;  4YY3 J;  4FNH A;  2HK3 A;  4ZVR B;  2YNI A;  3MR2 A;  2DNZ A;  4KSE B;  2XC9 A;  1YX2 A;  4FKY A;  2IAJ B;  2NXU A;  5IT9 Y;  4OZ0 A;  3KNG A;  2DBB A;  3MMA A;  2VQE F;  1ZTT A;  4NI2 B;  2ZIT A;  1XR6 A;  1FDD A;  3D28 A;  4LRB A;  4MFB A;  3DOM B;  3KLE B;  3MOJ B;  5GAD I;  2ZBC A;  2LU2 A;  3K5N A;  5F8J A;  4FYX B;  2KKH A;  4WTO B;  2E7V A;  3DYA B;  2F63 A;  1R3N A;  2AX0 A;  2FLO A;  3IGN A;  1WEX A;  2EFP A;  4K8R A;  5LM7 E;  1FXR A;  3OFH A;  5IWA J;  4X66 F;  4KHM A;  4P2M A;  3TOQ A;  1M5S A;  2IA0 A;  2KDO A;  4MKB A;  1WTF A;  5ETR A;  3DHX A;  4RLE A;  3I87 A;  4GC7 A;  3NG8 A;  4QPX A;  4IH6 A;  4PG4 A;  4C6A A;  3M9O B;  4FN5 A;  3GQC A;  2W2M P;  1E6Y A;  4JI4 F;  1NJW A;  4RU2 A;  4ZS6 A;  1X4E A;  3UO0 A;  4X84 A;  1REV B;  4N7T A;  1WOS A;  4WK1 A;  1U1L A;  3CJR A;  4DR5 F;  2OEL A;  1VRU A;  2OD6 A;  1DLO B;  1X8D A;  2ZNZ A;  5HVF A;  4PYA A;  3EWG A;  5D77 A;  3IO1 A;  3BKF A;  4QWB A;  3UNG C;  1S12 A;  4KO0 A;  2XM3 A;  4U7U D;  4QBU A;  2BAN B;  3B54 A;  2H54 B;  2R7T A;  2ACY A;  3UCG A;  1TKD A;  2VKR A;  3DM2 A;  2QTW A;  3FVY A;  5LMN F;  1XNR F;  1RTJ B;  3CIM A;  3DLB A;  3OFE A;  1QM9 A;  2GQ2 A;  2GGP A;  4IRD A;  5HRO B;  2KXH A;  5HVH A;  2OFH X;  4GKJ J;  5B0B A;  4NL5 A;  4DUT A;  1YDL A;  1BD6 A;  2MMY A;  3AOA A;  3GR1 A;  4GO5 X;  2FHO B;  1S99 A;  3PJ9 A;  2DXD A;  3K8V A;  1CVJ A;  4DL6 A;  2FHJ D;  1JJ2 R;  1Y0H A;  1EB0 A;  2LQ8 A;  3GV8 B;  2BKN A;  4PXC A;  1KDN A;  1NZ8 A;  3U1M A;  1YHQ S;  3RB6 A;  4RUC A;  5B0A A;  3D0H E;  3SXL A;  3PY8 A;  3MUM P;  2LA4 A;  1PO6 A;  3LW5 C;  4A8O A;  1EZZ B;  4OFZ A;  4B17 A;  3KYL A;  2L08 A;  1WKK A;  3PKY A;  2W2N P;  5D4P A;  3MM5 A;  2I8E A;  3PDN A;  3VR1 A;  3BPD A;  1KVI A;  1RTI A;  4AYB D;  1FVS A;  2JDJ A;  2DIV A;  4CO0 A;  1C2P A;  4UT4 A;  1MRO B;  2BKO A;  2L48 A;  3CJS A;  5C24 B;  3EGW B;  2HNZ A;  1F0X A;  2XZT B;  4EYH B;  2UUB F;  3K0J A;  1UA0 A;  3UI3 A;  1KTQ A;  1IWA A;  1H3D A;  1SQF A;  1HHQ A;  2RQM A;  1HW9 A;  2QLB B;  4R8U B;  3M1V B;  1NM2 A;  1SV5 B;  3I55 S;  4C8Y A;  2CXE A;  2O1P A;  1ZAW A;  3OR1 B;  2MLY A;  2XMK A;  1UJ6 A;  3VAF A;  2EEY A;  4ZIT A;  4M8L A;  4OZN A;  1HQU B;  1B64 A;  3RAQ A;  4ZLL A;  4DUZ F;  1Q7Y T;  4U6P A;  1Z2Z A;  4WFN Q;  1TUW A;  3SEO A;  5LMU J;  2JWN A;  3MXH P;  5CAB A;  1UVJ A;  2IC3 B;  3ISN C;  3ZXW A;  4XK8 C;  2EPI A;  4YR0 A;  4ATN A;  2I9S A;  4UZC A;  3CCM S;  1FJG F;  3IAS 9;  2HIY A;  2XO6 A;  1XTZ A;  2L9N A;  1OPZ A;  5FDL B;  1YIT S;  2OTL S;  3OTE A;  4TU9 A;  1IBK J;  5K20 B;  3JQM A;  2C2M B;  1HBU B;  5C25 A;  1YLX A;  3O3L A;  4PWD B;  3FZB A;  1FRH A;  1EET B;  4B3T F;  3JB9 k;  5A6P A;  3HX9 A;  1Y11 A;  4DXL A;  4KT0 C;  5J2P A;  3QQC D;  4NA2 A;  3W66 A;  2LXF A;  4LSL A;  2FJB B;  3AJ1 A;  3WDO A;  4G65 A;  1QLN A;  3ZZR A;  3T6J A;  2M4M A;  5HMX A;  2N7Y A;  2QFI A;  3BZQ A;  2VPY B;  3D68 A;  4RWW A;  1PBU A;  1JKH B;  3OJS A;  3A8I A;  2FD2 A;  2K7J A;  2JC0 A;  4WFY A;  2ZZN A;  1KVK A;  2FJX A;  4BWM A;  1BMQ B;  5BR8 F;  4WFA Q;  2ZD1 B;  1GTH A;  1FO1 A;  3R1H A;  3P5B P;  1CEZ A;  5EX3 A;  2GNK A;  3K5M A;  3PJW A;  3DLG A;  3PYF A;  4DR7 J;  1SBR A;  4AL6 A;  4OV1 A;  3KG1 A;  2FHK A;  1HL6 A;  4X4S A;  3CD0 A;  1HNX F;  1RHK B;  2DJW A;  4O4G B;  2CYY A;  1RBA A;  3LWL A;  3MEG B;  4G1I A;  4IYQ A;  1G1X A;  5KG7 A;  4LF2 A;  1SQE A;  5BYS A;  4NA1 A;  5IM0 A;  3QRP A;  1FJ7 A;  1FRX A;  3QRR A;  3GLJ A;  1LXJ A;  4B3R J;  2BRK A;  3C16 A;  1WHX A;  2VBZ A;  3W5Z A;  1SC3 B;  2VG5 A;  3RAM A;  1VOM A;  3KG4 A;  1ROF A;  4Q43 A;  4A8M P;  4E0D A;  4FF1 A;  2K1R B;  3UR0 A;  4ZDN A;  1UVI A;  2CPE A;  1QAI A;  5A0Y A;  5J1E B;  3SCJ E;  3PNI A;  4I68 A;  1X4B A;  3GJR B;  3GIR A;  1DHM A;  2CDR B;  4O44 A;  3KG0 A;  1K8A T;  2ZKT A;  3VVU A;  2GC8 A;  1TKT B;  1NH8 A;  4ID5 A;  1CQN A;  3PYD A;  4AUK A;  1IBL J;  2ZE2 B;  1HAR A;  4K4X A;  7FD1 A;  1KSP A;  2VU5 A;  2C3U A;  4S0M A;  2CQ0 A;  1D1U A;  4WFX A;  1T9X A;  2KG0 A;  1ICE B;  2B5J B;  2YX7 A;  5KFH A;  3M2V A;  2FB0 A;  1R43 A;  2C2K B;  3NOG A;  2F9J A;  2VHG A;  1WI8 A;  1QDU B;  4X2B A;  1N34 J;  1YJT A;  4NOH A;  2YWH A;  1SJF A;  2R8G A;  1B0P A;  4V19 X;  2W9B A;  1VC5 A;  2CFX A;  2MHE A;  3LP2 A;  1G6B A;  4NLU A;  3MPU B;  5GMK a;  1F3F A;  1HNW J;  1BQN B;  3F73 A;  2V5H G;  1KQF B;  1F6T A;  3SQO P;  4A8K A;  2FTR A;  1YJN S;  1V5V A;  3IXQ A;  3QNW B;  3BDP A;  4FS1 A;  3N5F A;  4BC9 A;  2XYG B;  4FDF A;  3UWT A;  5C2C A;  5KFF A;  4KYZ A;  1N54 B;  2IBO A;  3OVA A;  1S9E A;  3A8E A;  4Q0B A;  1HBN B;  4RNO A;  3TX8 A;  1ZM9 A;  2ZOM A;  1HQE A;  4C3L A;  1P9Q C;  5DDO C;  2HAF A;  3CW2 C;  2AGP A;  3A8J A;  2CZV C;  4DN9 A;  3W5X A;  2E5I A;  5J2Q A;  4ZLJ A;  3JTN A;  2LEA A;  3LP0 A;  1HQ2 A;  3MGJ A;  1URN A;  4QIE A;  5CYJ A;  1RYR A;  2VQE J;  4X4P A;  4TQR A;  1RHJ B;  5HQ8 A;  1S97 A;  5ETS A;  4L6V 3;  2XHC A;  4USH A;  3IBF B;  1NDC A;  4LQ9 A;  4CLF A;  1S1T A;  5E3C A;  1VC6 A;  2M0G B;  4L3K A;  2RKI A;  2HLU A;  4R5P A;  1TL5 A;  1C0T A;  2WON B;  3MD3 A;  4F02 A;  1HNV B;  4USV A;  3W9I A;  4CYU B;  5H9E J;  4QWC A;  1XMB A;  4K2X A;  4KGX B;  3N6M A;  1RWP B;  4P52 A;  7FDR A;  1U45 A;  1XR7 A;  2XMV A;  1X4A A;  1AUD A;  1FDB A;  1FI4 A;  2VOD A;  2G2Y A;  4M5L A;  2ZJP Q;  1G3O A;  2EFV A;  3LPE A;  1C1B B;  5HSP A;  4C0H A;  1F5B A;  2CJ9 A;  5HMW A;  5KG6 A;  3R27 A;  1S0M A;  1GFW B;  3LP1 A;  2HKE A;  4WZM A;  2KM8 B;  4DZ6 A;  4EFA C;  3RB3 A;  1WDD A;  2OEM A;  4RKU C;  4DG1 A;  2R7W A;  5G0R B;  1VQY A;  2R7Q A;  1HWU A;  1KQS R;  5F41 A;  1KEK A;  1VLY A;  1U09 A;  1PKU A;  1G7C B;  1N0V C;  3IG1 A;  2GQC A;  1RAF B;  1Y7P A;  2ZC4 A;  6FDR A;  2WW4 A;  4MK9 A;  2CZ9 A;  2ZFH A;  5LMN J;  2CPF A;  4PR6 A;  4JI6 J;  3VCD A;  5A76 A;  4ZJL A;  1DTT A;  3KJN B;  2GMJ A;  1LK5 A;  4ELT A;  4X64 F;  3KOA A;  2IAJ A;  1KD1 T;  1UL3 A;  5HAO A;  3QID A;  5GMD A;  3H2U B;  5HLF B;  3FSX A;  4NI2 A;  1RT5 B;  2AT1 B;  1U1K A;  3DOM A;  4RO0 A;  3W9J A;  2MZJ A;  3KLE A;  1MN7 A;  2XS5 A;  3CWJ A;  2ZBI A;  3JS9 A;  4DSJ A;  2GIF A;  3I5C A;  3DYA A;  3V6D B;  4IFV B;  2UU9 J;  1HBO A;  3NGU A;  3QMQ A;  2H51 B;  1FKO B;  4EI2 A;  3THV A;  2HFV A;  3BYP A;  4OI4 A;  4KJI A;  3F41 A;  2RNE A;  5FII A;  1OYD A;  3ILO A;  3TO8 A;  3BBC A;  2CQH A;  3N28 A;  4ZLP A;  3GG0 A;  3QGG A;  1M5H A;  4OX8 A;  5F8H A;  3BB5 A;  4RX6 A;  1CC8 A;  3TUJ C;  1B3T A;  3PM9 A;  4IG0 B;  4PCQ A;  6FD1 A;  1Y3J A;  1NB7 A;  4DN0 A;  1WC6 A;  1REV A;  1VRT B;  2UUB J;  1BHN A;  3LWM A;  3ZZU A;  2LXI A;  3TRG A;  4BC7 A;  2NXC A;  3T6B A;  3BSA A;  4ZPV R;  3I31 A;  2KXN B;  2FHM A;  1WG5 A;  3LGM A;  4AXJ A;  2OH2 A;  2BAN A;  1EJ7 L;  4I67 A;  1FWL A;  2EBG A;  2KHD A;  1U2F A;  3HSJ A;  3FFI B;  4ZN1 A;  1RT3 B;  1RTJ A;  1TKX B;  1D9A A;  3G8Q A;  2DR7 A;  5HRO A;  5KT2 A;  2W24 A;  4B9V A;  3BBB A;  3NS6 A;  2ZM6 F;  3UVJ B;  5B0C A;  1BE4 A;  1S4F A;  2QC3 A;  4LR7 A;  4DL2 A;  1LV5 A;  3THP A;  1TV6 B;  4JV1 A;  3D66 A;  4UY8 5;  4UUW A;  1XBW A;  3FNN A;  3SCK E;  1RAA B;  3D9B A;  2ZH3 A;  3S1T A;  2WAQ D;  1RT1 B;  1X7V A;  4LMZ A;  3F44 A;  4X65 F;  4B3T J;  2DH9 A;  2Z2L A;  3MUV P;  2V8H A;  3SCL E;  1UVM A;  2MZ1 A;  1CPZ A;  1VQ4 S;  4EUV A;  1VLO A;  4QOT A;  5M2P A;  2GAG C;  2DK2 A;  3OVS A;  2WSC C;  3AHP A;  4FXD A;  5L38 A;  2HEK A;  1MRO A;  1JLG A;  4DV2 F;  1NSP A;  1D8Z A;  3AB4 B;  1TZ0 A;  5C24 A;  5F8N A;  3UE2 A;  2HVD A;  1RWX B;  1DZ5 A;  1LKZ A;  4NLV A;  2C3M A;  1NJY A;  2QLJ B;  4LF8 F;  2Z2Z A;  5CZX A;  5BR8 J;  4LF5 J;  1LOU A;  3VZI A;  1HWL A;  4IQM A;  2OPR B;  3LQV A;  2ZH4 A;  5F3T A;  1KWM A;  3M1V A;  2RSQ A;  1SV5 A;  1UFW A;  3TAR A;  3AAW B;  3ZZP A;  5AXK A;  2XI2 A;  3IWL A;  4CO4 A;  1NDK A;  4IR9 A;  5ETT A;  3OR1 A;  2VBY A;  4P7V A;  3TJA A;  1CJU B;  3ZO7 A;  5CCM A;  1DTQ B;  3H90 A;  1U1P A;  2GS8 A;  1HNX J;  1G2E A;  2BV3 A;  2YH0 A;  3C6U B;  1F9H A;  4YHH J;  4QW8 A;  3KUE A;  3RW7 A;  1HQU A;  2VH7 A;  2LP4 A;  1IBM J;  4KE5 A;  3BO2 A;  5KFD A;  2YKA A;  1YJ7 A;  2A2D A;  3UW1 A;  2R7X A;  2L9W A;  5AT1 B;  4ZCM A;  5DZ6 A;  1GXL A;  2RUG A;  1N33 J;  1SPB P;  3QJL A;  5F0U A;  2ZJR Q;  4TXS A;  2G0J A;  2H5I B;  3D7S B;  1LWE B;  2KFZ A;  4C4W A;  4RR5 A;  1T11 A;  4JI5 J;  3QJP A;  2DYA A;  4MKY A;  4JV5 F;  4RW7 B;  2DNO A;  2R7U A;  4WIQ A;  2LQJ A;  2W9C B;  5K8M A;  1HBU A;  3O5T B;  4ITS A;  4M5M A;  4PWD A;  1I51 B;  1EET A;  4WE1 A;  1FE4 A;  2BX6 A;  1IN0 A;  1QJH A;  3JSR A;  1CQM A;  4USK A;  4H54 A;  5GAG U;  2BAC A;  4NZ0 A;  3UFC X;  4X62 F;  1FRL A;  4CTA B;  3T3F A;  2ADC A;  4CM0 A;  4CLK A;  1WKJ A;  1A7G E;  2C3P A;  1NZA A;  3W8P A;  4F3O A;  1JKH A;  2UZA A;  1Z2L A;  4AXI A;  2DH8 A;  2ADB A;  4HH1 A;  2UUA F;  5AJ3 J;  1JB0 C;  4MKA A;  1RGV A;  1XK8 A;  2DGX A;  1S1V B;  5IV4 A;  3GIL A;  1LNQ A;  2ZD1 A;  2HZV A;  2B7B B;  2FC9 A;  2V2V A;  1OSD A;  2RDJ A;  9ATC B;  2HFO A;  1MLA A;  5A8R B;  3MM6 A;  4WXW A;  1QSS A;  4F4K A;  2HS3 A;  1GT8 A;  2I2Y A;  1X4C A;  2EG2 A;  4OMF G;  1QUV A;  2E44 A;  2C22 A;  3HHL D;  3OXF A;  3MEG A;  3A8K A;  4YDD B;  3AT1 B;  4NEY A;  2JVR A;  4K0K F;  3RTV A;  3PFO A;  3M8S A;  5MLC V;  4JI8 F;  1IKW B;  5DGA A;  1B99 A;  3TUI C;  2G1H A;  1L3T A;  2DVI A;  4ANE A;  4FKX A;  2KI2 A;  3I32 A;  4RWX A;  5KOX A;  1U2R A;  3B78 A;  2PI5 A;  1KLM A;  2K1R A;  2Z8Q A;  4OI6 A;  4P10 A;  2JZ5 A;  2PMH A;  1QVG R;  1FT8 A;  1QUP A;  2VF3 A;  3RR7 A;  5IOL A;  5J1E A;  4MKV A;  3GB0 A;  4Q8E A;  3VZH A;  4X4U A;  1TAU A;  3LOU A;  3NAH A;  4G1Q B;  2HBQ B;  2MPU A;  1KC8 T;  1N6Q A;  4F2R A;  1P1L A;  2V8G A;  4ZK7 M;  1TKT A;  1U6Z A;  4MIB A;  3W2V B;  2ZE2 A;  2KVI A;  4YOE A;  2HS0 A;  3DRR B;  3Q8P B;  1JXE A;  2NXE A;  4DPY A;  4DV4 F;  2HNY B;  2B5J A;  4O3R A;  2MDA A;  5IZH A;  2XTJ P;  1IKV B;  2UXC F;  3PYG A;  4DJB A;  3OW2 R;  2RRA A;  3TAP A;  3HKZ D;  3G71 S;  2OO4 A;  1HYS B;  2C1E B;  1CSJ A;  3HI9 A;  2P9G A;  2DPJ A;  2EI5 A;  1WC4 A;  2LKZ A;  4B3S F;  4PWU A;  1WG1 A;  3HPO A;  2HBY B;  3Q2T C;  3CSK A;  1KBR A;  1P8G A;  2ZWO A;  2XMW A;  5IXU A;  1VRQ C;  3K57 A;  2XY6 A;  2YTC A;  1W7W A;  1RT6 B;  3G96 A;  4EU0 A;  1BQM B;  2MGZ B;  2F65 A;  1FDA A;  4DV5 J;  3ET6 B;  4U7C A;  1FNM A;  1N48 A;  2Z56 B;  2AWZ A;  1JLF A;  1HWI A;  3TVK A;  1BWE A;  3H25 A;  2ZBP A;  3ETM A;  2LEB A;  3P8B B;  2XCP A;  2R3V A;  3T1H J;  3JYT B;  3CCZ A;  1HBN A;  3VAH A;  4UY8 T;  2HVE A;  1T3N A;  5KFT A;  1Y10 A;  2D3U A;  3P96 A;  4A46 A;  3H59 A;  2MZT A;  2LDY A;  2OGU A;  3I9V 9;  3IR7 B;  4J9V A;  1R8P A;  2CJB A;  4ZN3 A;  4ECW A;  3J81 j;  4YME A;  3QFW A;  1XQI A;  4I56 A;  2B4U A;  2MTL A;  2ZWP A;  1RUS A;  4ILL A;  7AT1 B;  4DV3 F;  1FNX H;  2EK6 A;  2CPD A;  4IDK B;  1JQG A;  3DN9 A;  3HVT B;  1M1G A;  2EFN A;  3UR3 C;  2ROP A;  1YTY A;  3I82 A;  5DM7 Q;  2XHW A;  4OJH A;  2HHH J;  2EC2 A;  1QAY A;  1OWX A;  3FCV A;  2WON A;  4UZB A;  2MLZ A;  1MWZ A;  4H4K A;  1HNV A;  4CYU A;  4WKR A;  1N4L A;  3RYL A;  1S7I A;  1UW9 A;  2J0X A;  4C0O C;  3FEY B;  9RUB A;  3D0I E;  1X9W A;  3BSC A;  2CJX B;  3KK1 B;  3RRH A;  1T95 A;  2UXD J;  1PAE X;  4PAA A;  3IBC B;  3B6B A;  2MYF A;  3OTO F;  3QRQ A;  1K44 A;  4OYA A;  3QSI A;  3Q8U A;  1C1B A;  4PG8 A;  1XMQ F;  1NLK L;  2EKN A;  1WSR A;  2FC8 A;  1YRX A;  2LQ5 A;  5KFC A;  1CJV B;  2GVD B;  3QGP A;  2YKP A;  1AZS B;  5K5M A;  1HD0 A;  4LSN B;  2E9Z A;  1YJW S;  3Q89 A;  1IJE B;  2F8H A;  2GHP A;  2QSW A;  5G0R A;  2HQD A;  4DR6 F;  4DWI A;  2CWK A;  3NP5 A;  1RWW B;  2HQG A;  1HHS A;  4I2Q B;  2VFT A;  1DFD A;  1R89 A;  2FJW A;  1PGZ A;  2BXJ A;  1VBZ A;  4FPI A;  2A2C A;  3CCW A;  3MM7 B;  4ZP6 A;  5EGY A;  3FCH A;  1C1C A;  1AFI A;  2PDA A;  4CZC A;  1FEE A;  2HHS A;  4QYZ J;  3N5B A;  4IH7 A;  2AEM A;  1IKX B;  1KOO A;  3EVW A;  3IP0 A;  1NND A;  1GMU A;  3O1L A;  2DPI A;  4HI2 A;  3G82 B;  3T5L A;  4OYX A;  4OQJ A;  2HUR A;  4KGZ B;  2FVQ A;  2Y8Y A;  2HWI A;  2XLK A;  1RT5 A;  4NCA A;  1FFW B;  5B0D A;  4C97 A;  3DFE A;  4FZV A;  5HQL A;  4HDG A;  1LW0 B;  3QGI A;  4ENO A;  1EKR A;  4KC5 A;  3MUT P;  2BBE A;  3CMQ A;  3GCX P;  3V6D A;  1EKS A;  4IFV A;  4X65 J;  3MPY A;  4YDX A;  2GHV C;  1FKO A;  1BWV A;  1U4B A;  3R7S B;  3HP6 A;  1S7H A;  4JI7 F;  5DG7 A;  1Q86 T;  3AJD A;  1WTB A;  2Q1L A;  1XMO J;  4K5S A;  2MQN A;  4XPC A;  4EZ6 A;  2EFG A;  2V4J B;  5LL6 d;  4IO9 Q;  3KLF B;  1YSJ A;  1WOP A;  4IG0 A;  1VRT A;  1VJQ A;  3T5H A;  1Q82 T;  3FBB A;  4LF8 J;  2XBP A;  2VDH A;  2NPF A;  2UV8 A;  4L72 B;  3C6T B;  2KZM A;  3E51 A;  1C4A A;  3IS9 B;  3CCS S;  5IFM A;  4KFB B;  1TKZ B;  2NZ4 A;  3A4T A;  4DR2 J;  1H0H B;  2Z0G A;  3RBX A;  4R0E A;  5I42 B;  3FEX B;  1W2I A;  3T1Y F;  3NGS A;  2HK2 A;  4UST A;  1KLN A;  1QD1 A;  2GX8 A;  4NE9 C;  1FRK A;  3FFI A;  3J80 Y;  1GEH A;  1RAH B;  1VR6 A;  1XER A;  1TKX A;  5CHC B;  4O3P A;  4HLB A;  1NBE B;  3ISZ A;  2YNI B;  4ZMM A;  1V3R A;  4LBI A;  1TTH B;  1UFK A;  5HL7 Q;  4J9P A;  2UUC F;  4J9L A;  1IM4 A;  3ZTR A;  4JI2 J;  1S0N A;  3UVJ A;  1M5O C;  2ZZM A;  4E8U A;  5KT3 A;  1Y3K A;  2HHW A;  3GII A;  1TV6 A;  1W26 A;  2OEJ A;  3MPW A;  2UUT A;  1RK8 A;  2V9W A;  4KPY A;  1FE0 A;  3DLJ A;  1LFP A;  3TQE A;  4DBQ A;  2Y8W A;  4LIR A;  4QR2 A;  3VAL A;  1RTH A;  2CQB A;  3QBC A;  4ZJQ A;  1RT1 A;  3ILJ A;  3WX8 A;  2BJ1 A;  2OSR A;  4J9Q A;  3HD2 A;  1OY6 A;  4WU2 A;  1S10 A;  2ATC B;  1ZBT A;  2ASJ A;  1Q5V A;  2E5H A;  2W7A A;  2CWX A;  2G9O A;  5D6G A;  4M5N A;  2P6T A;  3TA0 A;  1MSW D;  4H4K C;  4RNM A;  4LRC A;  3ZZT A;  4DFJ A;  1FA0 A;  2CPY A;  1AB8 A;  2G0I A;  3M2U B;  3N6N A;  5LSR A;  2GFF A;  4U67 Q;  2UUA J;  1U7L A;  2PSZ A;  1VRU B;  5I3U B;  4HTI A;  5DDP C;  1EP4 A;  2RU9 A;  2M2B A;  4LVO P;  5GME A;  2JFD A;  3HVR A;  2OPR A;  2E9R X;  4WYW A;  2QA4 G;  4KO0 B;  4QR0 A;  4LRA A;  1N88 A;  5GAH U;  3Q8Q B;  2E1M C;  3OLA A;  1WD6 A;  2IDE A;  5K14 B;  2H9Z A;  3DNC A;  3DLL Q;  4LFC F;  3PR4 A;  1CJU A;  2VD3 A;  3CJ4 A;  5IC4 B;  3FSI A;  2HQ3 A;  1Q8K A;  2NYI A;  3C6U A;  4HAC B;  3QZ7 A;  3BGR B;  2UVV A;  4HKQ A;  3HDS A;  4K0K J;  2P8I A;  2Y1J A;  4Z7C A;  1NPP A;  2WB1 D;  2MJN A;  3IBW A;  2M8D B;  3B4M A;  4A47 A;  2Y0S D;  3LUY A;  3R97 A;  4WTY A;  1RSC A;  4URQ U;  1S0O A;  2V0N A;  2VZ9 A;  5L46 A;  2AGO A;  4ALZ A;  3CJQ A;  4NX9 A;  4RW7 A;  2BJ9 A;  2BVZ A;  1K0T A;  1KOH A;  2DY1 A;  2RT3 A;  3JSY A;  3AH6 A;  1UVN A;  5ETL A;  1TL1 A;  2GIQ A;  5IS2 A;  2DTJ A;  4N8N A;  3LTO A;  1Q53 A;  2CJY B;  4ED3 A;  4FXW A;  3I0S B;  1ZH5 A;  2CJQ A;  2QO3 A;  4C8O A;  3R5D A;  4RZR A;  2BJ3 A;  3SFU A;  5ETO A;  3MM5 B;  2ZUG A;  4WKY A;  2Z4P A;  2QZ8 A;  3G2X A;  2YWF A;  5KFQ A;  1U0H B;  3QT5 A;  4ZLN A;  3E8O A;  4CO2 A;  2Q6C A;  4EBE A;  1MN9 A;  3K58 A;  5AXN A;  2BZ2 A;  3PX0 A;  2UXC J;  4KBI A;  4UQT A;  4CH0 S;  4J9U E;  4Y00 A;  1KHW A;  5KT6 A;  4EBC A;  2HNZ B;  1T9U A;  5GAG I;  5LSO A;  5KFE A;  1X5T A;  1H2T Z;  5J2M A;  3V5R A;  4WP3 A;  4HHU A;  2FUG 9;  1T7P A;  3S01 A;  1R27 B;  2YBV A;  3MEC A;  1N52 B;  1VQS A;  3MFH A;  2B7C B;  2O3D A;  3V2U C;  1WC1 A;  3NMA A;  3M8Z A;  5D4L A;  1RBO B;  3R6L B;  4OV6 A;  5A8R A;  2VPW B;  2CNO B;  3TVZ A;  1U24 A;  4AL5 A;  3W3S A;  3UPF A;  3IN5 A;  1NPR A;  1O8B A;  1R8B A;  5HBM B;  3HF5 A;  2XLI A;  3L09 A;  3UN5 A;  4YB7 A;  3ELH A;  4ZVQ B;  5D8H B;  2HND B;  3TW0 A;  2HS4 A;  2HW3 A;  4KGM A;  5DET A;  3Q22 A;  4NAS A;  4GKJ F;  4DL7 A;  4C8K A;  2DY9 A;  4DR4 F;  3ADA C;  2WBR A;  3KJV B;  2I1R A;  3I4H X;  3TZX A;  4NMX A;  2XS7 A;  2XUL A;  4NYZ A;  5DJB A;  4DV3 J;  5CYM A;  4OX9 J;  1SUQ A;  2N3L A;  3X1L B;  4C3M A;  1GAO A;  2J6T A;  3CDW A;  3W7B A;  4X4T A;  5L39 A;  2VIC A;  4LT6 A;  3CF5 Q;  5HAN A;  2K7K A;  1VQ6 S;  4PG6 A;  4W90 B;  1VI7 A;  1Y9O A;  4G1Q A;  4BBY A;  3GE9 A;  4ED5 A;  3MUR P;  5D0H A;  1ACM B;  4Q2M A;  5CXT A;  3CE8 A;  4YB6 A;  5KT7 A;  2R4F A;  3W2V A;  2G4B A;  3K5P A;  2HFN A;  3DRR A;  4ZP9 A;  4M5H A;  3CD6 S;  4DQS A;  2DRD A;  2FHJ A;  2FZK B;  2HNY A;  4CLU A;  2HFZ A;  2QGF B;  1JLQ B;  2WVC A;  4PYD A;  2IBK A;  1HYS A;  2DNN A;  4IOC Q;  2KL8 A;  3R1L A;  2BOA A;  1DAX A;  5JVG Q;  3Q8V A;  4YR2 A;  1M90 T;  2AV5 A;  2QA1 A;  1VC0 A;  1B4S A;  3CJ2 A;  3OVB A;  1QVF R;  3C2P A;  4HVZ A;  2PFD A;  1ZET A;  1NDP A;  3A3O B;  3LPY A;  2UV8 G;  4U96 A;  3K8W A;  1RT6 A;  2XI3 A;  3Q24 A;  1SKW A;  3GJT B;  1NHK L;  1ZM4 A;  4WWS A;  2MGZ A;  2X1F A;  1LXN A;  4NLD A;  4DFM A;  2GIR A;  1AT1 B;  1LWF B;  5KFN A;  1M5V C;  4U95 A;  3HZG A;  2HZC A;  4URG A;  1L3K A;  3NGK A;  1ZAX A;  5E0O A;  1ZZF A;  3I5B A;  4K4U A;  4FYY B;  4DL3 A;  1B70 B;  3EXY A;  2GHW A;  2HQI A;  1FF2 A;  5LMU F;  1MML A;  4FYD A;  4IOB A;  4XIU A;  1IM6 A;  2JVO A;  1WF0 A;  2LMI A;  1D0E A;  3MAA B;  1ZPV A;  1FKP B;  3AD9 C;  3NCR A;  2V67 A;  4U7U K;  4KGV B;  4DU8 A;  3CGI A;  1NJX A;  5F3Z A;  3M05 A;  4TKT A;  3HVT A;  2XY5 A;  1RLC L;  1IBK F;  4DQI A;  3BR8 A;  1VQN S;  3OFG A;  2MKY A;  3OPK A;  3MTJ A;  1Q95 G;  5AXM A;  2RS2 A;  3M8Q B;  5ITH A;  4WII A;  1ARO P;  3R7B B;  3KK1 A;  2CJK A;  1U2C A;  1TK0 A;  5E7O B;  2XY7 A;  3QWP A;  3R6G B;  3HO1 A;  3WX4 A;  2PN6 A;  2N4D A;  2W9B B;  1ULR A;  2R8K A;  2HHV A;  3MCO A;  3LP2 B;  3M30 B;  3TZZ A;  1HWJ A;  2A6O A;  3VQS A;  1NUE A;  5F8I A;  1B7F A;  2J0W A;  1U1R A;  1CJV A;  2GVD A;  2MKK A;  4NRU A;  1AZS A;  5F8G A;  4A8X A;  4XDD A;  1HW8 A;  4UOF A;  4DR7 F;  1RHR B;  4ETX A;  1YJV A;  1B0T A;  2AYB A;  4NXN F;  4HDH A;  4DHV A;  1CLF A;  4I2Q A;  3NEK A;  3Q83 A;  1S9G A;  4CLW A;  3T1Y J;  1S1U A;  2DNG A;  3V6H A;  1R6V A;  4DCP B;  3SSS A;  3MM7 A;  3I96 A;  1P6T A;  2QA2 A;  4WPA A;  2N82 B;  2HHQ A;  5KFW A;  4B3R F;  2ASY A;  2NUH A;  1IKX A;  5J2Q B;  2EVZ A;  2JFK A;  4A4J A;  2IM3 A;  4ZA1 A;  3KUG A;  4OX7 A;  2OPS B;  2J9D E;  2UUC J;  3G82 A;  2RRN A;  4IRK A;  3MR7 A;  4LF9 F;  3UD3 P;  3HHL B;  2MJU A;  2KFY A;  1S1W B;  4P74 A;  4L3N A;  2HBR B;  3W2W B;  3LGN A;  4I2P A;  1LW0 A;  2YX4 A;  2M9K A;  2WRM A;  4N56 A;  1VQ7 S;  4OI1 A;  4IQX A;  1I94 F;  2J7W A;  3GFH A;  1UFL A;  2OEK A;  1IBL F;  1TU0 B;  4JYA F;  4JB8 B;  2R2U A;  3KLG B;  2WVF A;  4HR2 A;  1SIW B;  4TLQ A;  3VGV A;  3NL0 A;  1OJ4 A;  8AT1 B;  5KFB A;  2APO A;  1SKR A;  4Y0F A;  2E5L F;  1Q81 T;  3H8Y A;  1Q1K A;  4QIV A;  2R2T A;  1PJ7 A;  4OJ3 A;  5CZV A;  1VK3 A;  4TN2 A;  2HHT A;  2V4J A;  1RAD B;  3DKD A;  3FRZ A;  3CTR A;  4HL9 A;  4J9M A;  1E6V A;  4N8O A;  2PI4 A;  5A8K B;  5AE3 A;  1SQG A;  2E1R A;  2CG8 A;  1H7X A;  2XSJ B;  5DDR C;  1HNW F;  1R8H A;  1R0B G;  1SH3 A;  2JJ4 D;  2RU3 A;  4B9U A;  1CC7 A;  3R5B A;  3RRG A;  4IG3 A;  2ZZT A;  2FJD B;  3J7Z 5;  4J9S A;  3A13 A;  2MKC A;  3JSB A;  4ZOS A;  4DSF A;  3C6T A;  3PW4 A;  3DGP B;  4CLP A;  3IS9 A;  1RHQ B;  4KFB A;  1WF2 A;  1TKZ A;  5HAT A;  4RBV A;  3QIP B;  3SCI E;  1DY3 A;  1HIY A;  3M8P B;  3Q0A A;  3KKF A;  1L5U A;  4YS2 A;  2BJ8 A;  2QRR A;  3D1O A;  2QMX A;  2KTQ A;  2J0Q D;  3DLK B;  1VDH A;  2CAJ A;  3CCQ S;  3IM8 A;  5F9L A;  3CCJ S;  5CYQ B;  3MCS A;  2ZKU A;  3OR2 A;  3GV5 B;  3E2E A;  2ACM A;  3A3N B;  1NAQ A;  1XWL A;  2D3Z A;  4OHZ A;  4ECR A;  5K8N A;  1GMW D;  3DXS X;  5K8O A;  1JWW A;  3W60 A;  3G8T A;  1TP7 A;  3SQG B;  1P9Y A;  5DQI A;  2KH9 A;  1J5E J;  4CM2 A;  5HQM A;  2F4V J;  1Y00 A;  5CQG A;  3BSN A;  3A1Y G;  1HBO B;  2EW9 A;  1NSK L;  4W98 A;  1MW7 A;  1JNZ B;  2CQD A;  3HLU A;  2K3K A;  4C8Z A;  1Z4U A;  2HFS A;  4MH8 A;  3HFV A;  3IAM 9;  2O67 A;  4MK8 A;  5H9F J;  3TEH B;  3VAG A;  2W8K A;  2B3T B;  2IDL A;  2Z57 B;  3G86 A;  3EUN A;  3U1N A;  4CQ1 A;  3OJU A;  4J9R A;  4HT7 A;  4QZV B;  1F60 B;  2B4P A;  5AXL A;  2CIM A;  5MAO A;  2D1C A;  3M2U A;  4WCE Q;  4OZ2 A;  4NCG B;  1K73 T;  2DHH A;  3M8R A;  2VOP A;  3EZ5 A;  5I3U A;  4ZVE A;  3HVW A;  3M8Y A;  2BQ3 A;  1VS3 A;  5IV3 A;  2E5G A;  2DNR A;  1L3U A;  1NH7 A;  1KKH A;  3CCL S;  1S6Q B;  4WXO A;  3T9Z A;  5K8P A;  3W1Y C;  4B3M F;  1NK7 A;  5HI7 A;  2FVR A;  4B9M A;  4JV2 A;  3V4I B;  3FUY A;  2FVS A;  4Y2C A;  1PBA A;  1V3Z A;  1VHF A;  5K14 A;  1U02 A;  5I4M A;  2P5V A;  4QIG A;  1QTN B;  4AL7 A;  2B56 A;  4DV7 F;  4JI1 J;  4HAC A;  2NPI A;  4JI6 F;  5CA5 A;  3ONQ A;  3BGR A;  5GAH I;  5EUH A;  2KXF A;  3IA0 A;  2YWE A;  4RW4 B;  5KFO A;  1FK9 A;  3AXM A;  2DGV A;  2YQ0 A;  3NNA A;  3PIO Q;  1FCA A;  1TK8 A;  3PVX A;  3ZZ0 A;  4DR4 J;  4Q44 A;  2B8Q A;  3KLH B;  1H38 A;  5KT5 A;  3HSZ A;  1NB2 A;  1R0A B;  5LXY A;  1M1K T;  4URS A;  1NHU A;  3F0N A;  3MCM A;  1SI9 A;  4NA3 A;  3RBE A;  4LF7 J;  2UU9 F;  1JJC B;  4ID8 A;  4IR1 A;  4F4Y A;  2XMT A;  2RIJ A;  3I0S A;  2MB0 B;  4R25 A;  2GO9 A;  3FRY A;  2JRS A;  1SJ1 A;  3KHR A;  4LBP A;  3HUL A;  3HZE A;  3MPV A;  3BQ0 A;  2EFQ A;  2WSF C;  3Q8Y A;  1U0H A;  1HNZ F;  1P1T A;  2JLG A;  4P2S A;  1WHW A;  1RAB B;  2YQ1 A;  1ZA2 B;  1JLG B;  3HHK A;  4KGK A;  2YKM B;  3P5T L;  4B9T A;  2M88 A;  2DD8 S;  3HSG A;  1SJR A;  1V3S A;  1VQ8 S;  5EX0 A;  1F2H A;  3EPG A;  1LK7 A;  3SDE B;  4OIX A;  3EIC A;  3R3T A;  2V94 A;  2P2C B;  4H4M B;  4NCB A;  4OZJ A;  3OTB A;  1U26 A;  2JL9 A;  5KFP A;  4LF6 J;  1FX4 A;  4ZPC A;  2WW8 A;  1N32 F;  1LFW A;  3CIZ A;  2CPH A;  3SMZ A;  4DQR A;  3CMA S;  3CB4 A;  2ATL A;  1YBU A;  4C11 B;  3CUN A;  3SSR A;  2UP1 A;  4A8S A;  1AUS L;  5HBM A;  3CCE S;  2KRB A;  3RU0 A;  3LAM A;  3PRD A;  3P4U B;  2HND A;  2VPZ B;  2IMW P;  4RW9 A;  2RB7 A;  4DF8 A;  4V1A k;  5KG5 A;  3K5L A;  3SSQ A;  1YBT A;  1OYE A;  3KJV A;  4QWE A;  2RDI A;  4K50 A;  3IR6 B;  3QFH A;  1FFS B;  4ZIW A;  2E29 A;  3W63 A;  4NXM J;  2V50 A;  3BRE A;  2AYM A;  1FJC A;  1U8S A;  5BYQ A;  4WE1 B;  4IH5 A;  3IWN C;  5RUB A;  1M0S A;  1XR5 A;  2IRX A;  3E01 A;  2W7O A;  2XMA A;  1TVR B;  2OHD A;  1UAW A;  1M5K C;  3OQ2 A;  1ZOT A;  3N79 A;  1LQ9 A;  3LH2 S;  2W9A A;  3FJ2 A;  2IFX A;  4NEZ A;  4PWW A;  4K4T A;  2V4Q A;  2W4C A;  4ELV A;  2RD5 C;  4WFZ A;  1X31 C;  3J7Z T;  1JLQ A;  5E2Q A;  2OJ3 A;  1RTD B;  4ZPA A;  4F4A A;  1RE1 B;  3AA8 A;  3C46 A;  2A3J A;  4I0W A;  5DQH A;  2GVZ B;  3VHQ A;  4UF4 A;  1RAG B;  4PAB A;  4LF5 F;  3V4M A;  5D0G A;  4QU6 A;  4QJV A;  1RBL A;  1WUU A;  4KAI A;  3CDU A;  4C3K A;  3KNA A;  2ROG A;  4IRC A;  1RTZ A;  3OV7 A;  4B9L A;  1PJ6 A;  3UD4 P;  1S79 A;  2KG1 A;  2ZH5 A;  3MM6 B;  1YJR A;  3AD8 C;  1EHW A;  2C2R A;  1SC1 B;  4ICL B;  1LEO A;  2HGL A;  3OUY B;  4JV0 A;  3PW5 A;  4PUO B;  5DQG A;  4NXN J;  3VAI A;  1LWF A;  4DPX A;  4QIW D;  2GML A;  4YHH F;  3TA2 A;  5CD4 H;  2C2N A;  1IBM F;  1CJT B;  1YBA A;  4J37 A;  2W4D A;  3L7P A;  2VOO A;  2VG6 B;  1N5Q A;  2ZBR A;  1N33 F;  4X4N A;  1IUJ A;  2NXJ A;  4FF3 A;  3PO4 A;  2ZJQ Q;  3E3X A;  2WHO A;  3H20 A;  5EWE A;  3Q2S C;  2V2Q A;  3G8S A;  3I9Z A;  3R5C A;  4DR1 J;  3MAA A;  1FKP A;  1S1X B;  1KLM B;  4RW6 B;  2OD4 A;  4JI5 F;  2V2Z A;  4FYW B;  2BE2 B;  2W25 A;  3UCZ P;  4LF9 J;  1Y5N B;  3BGF A;  1U1Q A;  3D6H B;  3TJ8 A;  2VON A;  3KXD A;  1H74 A;  5F9N A;  2BE7 D;  1N6Q B;  1O51 A;  1I94 J;  3KHH A;  3W5Y A;  2B4O A;  2PC6 A;  4NLS A;  3MAH A;  1M5P C;  2E1P A;  4JYA J;  3UNY A;  5EN1 A;  1D09 B;  4A8Y A;  1L3S A;  3NRB A;  2BE9 B;  2WK4 A;  3M8Q A;  3C3L A;  4KRW A;  3L3C A;  1C0U B;  4NLR A;  2F40 A;  2KHC A;  2B6A A;  2CNK B;  3QGH A;  2P9C A;  2HIQ A;  3GJQ B;  3GU0 A;  4J9K A;  5DLG A;  2E5L J;  4KHP J;  4Q5V A;  1X4F A;  2XO7 A;  4DPT A;  2IRU A;  4LQ3 A;  5AJ3 F;  3EJM A;  4K4V A;  2DXF A;  3PTW A;  1TEL A;  2MQL A;  4P72 A;  4EO6 A;  3D1H A;  2NS1 B;  3H0P A;  3M30 A;  3QO9 B;  1FWK A;  3GPA A;  4Q8F A;  1AA1 B;  1GXU A;  1S6P A;  2B51 A;  1J5O B;  3O6Q A;  1R0C B;  1Q8I A;  4M94 A;  4PPZ A;  3THT A;  3NS5 A;  2JOQ A;  1U25 A;  4P71 A;  1JLF B;  2XGQ A;  2IVY A;  3NGT A;  2I5J B;  2HHX A;  2KYZ A;  3VVT A;  2J7K A;  5FD1 A;  1Q16 B;  4B9N A;  5L1I A;  2I0X A;  3TR5 A;  1XEZ A;  1R7I A;  1VQ5 S;  4F0K A;  3KMQ A;  5KG0 A;  4IFY B;  2EXU A;  3JAM U;  4YR3 A;  1OQ6 A;  1EX8 A;  3OSN A;  1OPI A;  5L1K A;  2YY3 A;  4GO7 X;  2IYI A;  2OPS A;  5E3P A;  4RNN A;  1PJ5 A;  1RWO B;  1RXO B;  1H7W A;  4IO1 A;  3HHL A;  1S1W A;  2QL7 B;  3W2W A;  2FYX A;  3JTO A;  1WG4 A;  4OYZ A;  1LW2 B;  1R8A A;  2KN4 A;  3KTQ A;  2UVW A;  4XTT A;  5CAA A;  2VQF F;  4Y34 A;  3ULH A;  3KLG A;  3MED A;  2AD9 A;  4DV1 J;  2NQP A;  3ZFV A;  2JLF A;  4NML A;  4ZCI A;  2CRL A;  3DGV A;  2BR0 A;  2BOP A;  1PYS B;  3OTD A;  3WQP A;  4P6Q A;  2H1Y A;  2IM1 A;  4FBT A;  2D9O A;  4EBD A;  1WSV A;  3DRP B;  5KT4 A;  2M8H A;  5IT9 U;  3QLH B;  2MZS A;  4ES1 A;  3ENA A;  2A1B A;  1S0V A;  2LQB A;  3DLH A;  1WC3 A;  4DV6 F;  3HFZ B;  3MTK A;  4CLL A;  2UXB J;  2OTJ S;  5A8K A;  2FLL A;  3RZA A;  2F5G A;  3VGU A;  2XSJ A;  3D3B J;  5G4D A;  2DO0 A;  2MHN A;  3T1A A;  1RI7 A;  4Y2M A;  2PEH A;  4ECQ A;  1RT2 B;  4I64 A;  3AOC A;  2DR8 A;  2FZG B;  3GYN A;  1MMN A;  3CO0 P;  1LWX A;  4B3M J;  4LFA J;  3DGP A;  4DV5 F;  1GH8 A;  3I5A A;  3QIP A;  4ED6 A;  4ZPB A;  3M8P A;  3AY0 A;  1MNE A;  3T1H F;  2BDP A;  2MKJ A;  1T03 B;  2E9T A;  3M4X A;  4DV7 J;  1MWQ A;  5HN0 A;  1C1C B;  1CG2 A;  4M5J A;  1K0V A;  3IFE A;  3DLK A;  4N77 A;  5DG9 A;  4UUX A;  4MT1 A;  3PV8 A;  4GMK A;  1F2G A;  4NLW A;  5CYQ A;  3IC1 A;  3N0V A;  4B3O B;  2ZDO A;  5JUM A;  1TAQ A;  2VDI A;  3C19 A;  4KY3 A;  3ILI A;  1X4D A;  2OP5 A;  2K06 A;  3CPW R;  4KTQ A;  4C8N A;  4O23 A;  2DRA A;  2W2O P;  3PEH A;  4PQU B;  3ZTO A;  1I6J A;  3N01 A;  2YNF B;  3J7A N;  3SQG A;  1UA1 A;  1K1Q A;  3TI0 A;  2VKZ G;  3BPS P;  3DDK A;  3KLV A;  1S77 D;  3AA9 A;  4NYP A;  3H42 A;  2HHH F;  3Q23 A;  3OLB A;  4CWB A;  3BYR A;  1JLA A;  2B0G A;  3EVO A;  4R0J A;  2BJD A;  1VQ9 S;  3M8W A;  3UDE A;  2ASL A;  1KRP A;  4ETZ A;  2FY8 A;  2M70 A;  1HNZ J;  2UXD F;  5F8M A;  4EWT A;  4WYL A;  2J9E A;  4QQB A;  4E98 A;  3B82 A;  2OFG X;  3CJT A;  4Z2X A;  5JJB A;  4F7V A;  1RU1 A;  3MM9 B;  3ITH B;  2GAH C;  4NCG A;  2YPY A;  1LWC B;  2IVF B;  3CED A;  4CLY A;  4UTG A;  2C28 A;  1ZYQ A;  1IR1 A;  1NK6 A;  1S6Q A;  2XCA A;  5J2N B;  4DCO B;  3CO9 A;  2C42 A;  2AKW B;  3UDC A;  4ES3 A;  3VV2 B;  1N32 J;  3MEK A;  1SJ3 P;  1SL2 A;  5LT5 A;  3V4I A;  3WC0 A;  2GW8 A;  3ENQ A;  3DC2 A;  2YKN B;  2CNL B;  4ZVP B;  4TY9 A;  3JAM Y;  2KT5 A;  3NGD A;  5DM6 Q;  3OL8 A;  1UEV A;  1OS5 A;  2WVB A;  1BUX A;  4YFU A;  1RT7 B;  1DAR A;  1T3O A;  2ZDP A;  4I6W A;  5U47 A;  1Q79 A;  1FFG B;  3N9U C;  1W25 A;  4RW4 A;  2A10 A;  4GVB A;  4H4O B;  1JMT A;  1Y5L B;  2CQ2 A;  4CCH A;  3ZC4 A;  3P6Y C;  1I3O B;  2E7W A;  3BF4 A;  4I69 A;  2CPX A;  3ZNJ 1;  3KLH A;  3DOK B;  2XMJ A;  2JNJ A;  2R2R A;  4QU7 A;  1R0A A;  2W7P A;  2IJR A;  3M2R A;  1RTH B;  2FPH X;  4AQY J;  3PEJ A;  4J90 A;  3PYE A;  2DNL A;  3HHL C;  1OMS A;  1V6H A;  2HG4 A;  1PC5 A;  2QT7 A;  3HFK A;  4JOU A;  1VK8 A;  3FMB A;  2Y1L B;  4DR3 J;  1N5V A;  4DX6 A;  2YNH B;  2EG1 A;  1WEL A;  2MQ8 A;  2PT0 A;  3DI6 B;  1K9M T;  1XMO F;  3OTC A;  1CS4 B;  4UOG A;  4FXV A;  1HMV B;  2RQK A;  2X7I A;  3DRS B;  2DIT A;  3NOC A;  2YKM A;  8RUC A;  2XNQ A;  3MHY A;  1VMB A;  1FD2 A;  3UCU P;  1NU4 A;  1VBY A;  2M5Y A;  4USI A;  3EGN A;  2WTF A;  3SDE A;  3MAQ A;  1EP4 B;  3FSY A;  1HI8 A;  3PW0 A;  1H73 A;  1NO8 A;  2FQQ B;  1WJ9 A;  3P49 B;  3QPI A;  4H4M A;  3CC4 S;  3CJ8 A;  2IJF A;  2CJA A;  3V6J A;  2NSC A;  3H2L A;  4D3H A;  3OFF A;  4GKK J;  4DR2 F;  2DB1 A;  4NPO A;  2RDD A;  4BWJ A;  3EZO A;  4G1P A;  1ZAV A;  1HR0 J;  2DNH A;  5KFL A;  1NHV A;  2HVI A;  3EM1 A;  4C11 A;  4PZV A;  1Y4Z B;  2KT3 A;  4CO5 A;  1JLC B;  2VG7 A;  4X4Q A;  2LVW A;  1NPK A;  2KVQ E;  1HNI B;  1K47 A;  2VUG A;  2VL1 A;  2MY7 A;  1X9S A;  3TP2 A;  3T41 A;  4D3G A;  1X9M A;  4YB5 A;  5L1L A;  2Q6B A;  4JI2 F;  3Q8R B;  2CQ3 A;  2IRY A;  3ZTQ A;  4DPU A;  5J1P A;  2ZVS A;  3H98 A;  2HRT A;  4Y65 A;  2E1A A;  2XSF A;  2H5E A;  2DXE A;  4DUY F;  4OHY A;  3OL9 A;  4Y2A A;  3BBF A;  1TL1 B;  4JUZ A;  4Y2K A;  2D9P A;  3SYZ A;  2GO8 A;  2BRL A;  4DDF A;  2DGU A;  2V69 A;  3HKW A;  3DDN A;  2VJU A;  1V5I B;  1QSL A;  1TVR A;  4J91 A;  3RJM B;  2XZD B;  3FCW A;  3H4D A;  2B9X A;  2YWG A;  1UVK A;  3FQK A;  2CDQ A;  2RHQ B;  1HA1 A;  3QT8 A;  3HCX A;  1VQO S;  4MMO A;  4F3Q A;  4P75 A;  2CQI A;  4BDP A;  4EGL A;  4Y6I A;  4M5D B;  1RTD A;  3RUB L;  2MSS A;  2OKQ A;  3MEE A;  5J2M B;  2RHS B;  4A8Q A;  3TYT A;  2GVZ A;  3M7V A;  3TX0 A;  3MEC B;  4K59 A;  1RZM A;  4DU7 A;  3L7U A;  4CIO A;  3R5G A;  4M5I A;  1WC5 A;  1RJJ A;  1VYA A;  4ZPW R;  2A0F B;  1TL3 B;  4ECU A;  1T9Y A;  4ED8 A;  3IGV A;  4ICL A;  2ZH6 A;  1UWB A;  3PX6 A;  3OUY A;  3DMJ B;  5B0G A;  4CLT A;  2MST A;  3EGV A;  4PUO A;  3JSM B;  2DO4 A;  4MIA A;  5T7L B;  3BM7 A;  1CJT A;  2RE1 A;  2G2Z A;  5I3Q A;  2JEI A;  3DDI A;  1S57 A;  4KB7 A;  2VG6 A;  3WIU A;  2OSQ A;  3PR5 B;  5BYR A;  1AW0 A;  4NLG A;  3FEZ A;  2UVU A;  2BM0 A;  1S1X A;  4RW6 A;  5CYM B;  1SUQ B;  2Y1I A;  2W01 A;  4DFK A;  3VGT A;  5L1J A;  1UTA A;  1S49 A;  2BE2 A;  5DG8 A;  4WJB A;  4DX7 A;  1SB6 A;  4IOA Q;  1B7Y B;  3D5M A;  2HWH A;  1YZ6 A;  2W8L A;  2KFN A;  4F4W A;  4RW8 B;  1OY8 A;  1RT4 A;  3LAK A;  4DPO A;  2GMH A;  2DNQ A;  2BJE A;  4RUH A;  2KYX A;  4KKO B;  3GYG A;  2VQF J;  2BQR A;  4NZ7 A;  2YWW A;  2LFV A;  2XEX A;  8ATC B;  1C0U A;  2K3I A;  5KTQ A;  1T0T V;  2BAB A;  2G13 A;  5HMZ A;  2V34 A;  1HD1 A;  2C2Z B;  4FVM A;  3KDN A;  4FPR A;  2HLT A;  1FER A;  3G6E S;  4G3I A;  1X5S A;  3TWZ A;  5EWF A;  3ZZY A;  4DV6 J;  1DQ9 A;  1AFJ A;  4WFB Q;  4ZHR B;  3QO9 A;  3UN3 A;  1VBX A;  1JLB A;  4RUA A;  1X4H A;  2F8M A;  2J6U A;  5JXS A;  4Q7A A;  1SIZ A;  3GZ7 A;  2XMU A;  3R5J B;  2V68 A;  1J5O A;  2K2P A;  4K7Q A;  1NSQ A;  2QFJ A;  3RGI A;  2MQO A;  4BS2 A;  1HPZ B;  2FLP A;  3TVY A;  4DL5 A;  2FJE B;  3UQS A;  3C15 B;  3M6U A;  2VPX B;  1RU2 A;  1YK9 A;  3S6E A;  1REG X;  1R8C A;  4ZP7 A;  2N4C A;  5KFZ A;  3KK3 B;  3I4P A;  4WP8 A;  4Z37 A;  2I5J A;  3N6L A;  4OZL A;  4F25 A;  4OI3 A;  2HYI B;  2QIF A;  1YGY A;  5DLF A;  1X5P A;  1JNR B;  1EAY C;  1RAO A;  4IFY A;  4RNH A;  4EYI B;  1WI6 A;  2HWT A;  2KJV A;  4UW2 A;  3GG1 A;  4HTJ A;  1JXV A;  4P2X A;  1RA6 A;  1F5A A;  2IMO A;  3DHW C;  3AD7 C;  4O4R A;  4OX9 F;  3MR3 A;  4QPT A;  3U7J A;  3O8W A;  4F4X A;  1RAI B;  4F04 B;  3MI7 X;  5D78 A;  2R7O A;  3MMB B;  4O3S A;  1KN6 A;  3KDO A;  1LW2 A;  3OL6 A;  1JX4 A;  2MY8 A;  4W92 B;  4DCJ B;  3GMG A;  2CZ4 A;  4UOH A;  1RKI A;  2DGO A;  3KHG A;  3CCR S;  5D4O A;  4DL4 A;  1U49 A;  4QWD A;  2G0C A;  4ED1 A;  1HI0 P;  3ENW A;  2DH7 A;  1HBM B;  2ABY A;  3T19 A;  4WBF A;  2F1F A;  1F9F A;  1WF1 A;  2VBW A;  1PAU B;  4ZCL A;  4LR8 A;  1D9D A;  2H3E B;  5H9E K;  3DRP A;  3QLH A;  3QAE A;  2ZH1 A;  2AEF A;  4N41 A;  4J9N A;  2W2P P;  3EDQ B;  1RWM B;  2A6M A;  1UP1 A;  1SL1 A;  3FQL A;  1RQ0 A;  4LR9 A;  1RT2 A;  3HJV A;  1T94 A;  3EVM A;  1XNQ J;  3PCO B;  2CPI A;  2QA4 S;  2DGT A;  3DCA A;  4ED0 A;  3IM9 A;  3PRB A;  3BH7 B;  1S9G B;  3AJ2 A; 
#chains in the Genus database with same CATH homology
 2OUG A;  1NPP A;  3EWG A;  1NZ8 A;  4ZN1 A;  2XHC A;  3H7H B;  3LPE A;  3P8B B;  2K06 A;  1NPR A;  2LQ8 A;  4ZN3 A;  1M1H A;  1M1G A;  2EXU A;  3QQC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...