2OUGA

Crystal structure of the rfah transcription factor at 2.1a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
141
Chain Sequence
QSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYKKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for converting a general transcription factor into an operon-specific virulence regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Transcriptional activator rfaH
total genus 29
structure length 141
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2ougA00
4ZN1A 4ZN3A 3P8BB 3EWGA 3LPEA 1M1GA 2XHCA 2K06A 3H7HB 2OUGA 1NPRA 1NPPA 2EXUA 2LQ8A 3QQCD 1M1HA 1NZ8A
chains in the Genus database with same CATH superfamily
2BRKA 1KWMA 3MUMP 4OZNA 1FXLA 4OI6A 1HW9A 3CUNA 1NJXA 2DHAA 3KDNA 1E6VA 2NZCA 1RACB 3DN9A 1TL7A 3CCMS 3WDOA 3VAIA 3BR8A 5MAOA 2Y3YA 2Z57B 5EGYA 4KC5A 3FQKA 5RUBA 4J9RA 1L3KA 4NLQA 4WZQA 2E66A 4HHHA 4FF1A 4UUXA 2A18A 2OFHX 2E7VA 3M2VA 4M94A 4NCBA 3EM1A 4NLYA 2P6SA 1KNZA 2HFSA 3NMRA 5IC6B 2CDQA 1IJFB 3UR3C 2O3DA 3NOGA 2MJUA 3U1MA 5M2PA 5F8LA 2AYGA 3EVWA 2KL8A 1CLFA 2WBMA 2J6UA 4DHVA 1YJ7A 5J2MB 1Z2LA 4KV8A 2B43A 3NGTA 4B9LA 4MTPA 4ZPWR 1FDDA 1FEEA 3I0SA 2QMXA 3ZZYA 1X4AA 4ZLNA 1M5VC 1S5ZA 2CYYA 5H9EJ 2KU7A 4OZJA 1U2RA 2R4FA 4WFXA 3SXLA 5KFOA 4JI0J 2PFFB 4OYOA 1GTHA 2HQCA 3JSYA 1F60B 3SIPB 3DLHA 4C11B 1KONA 1HBMA 3W8PA 3I9V9 5HATA 3ONQA 2HQDA 4L76A 3RRGA 2BJ3A 4FYYB 3M8QA 3PW5A 3CCLS 1VI7A 5EX0A 1YRTA 2ZOFA 5AXLA 2H4YB 4ANCA 4ED8A 5DM6Q 3LGNA 2CQPA 3OR2A 3FBEA 3JTNA 5DJBA 1N52B 2FHJA 2FC9A 4M5DA 1REVA 5BR8F 1VHIA 2K3KA 1YITS 3DFEA 1JWWA 2OELA 1R8BA 3I4PA 5GADU 1E6VB 1U6FA 2MXYA 3TAMB 4FBTA 1RB0A 1PAEX 1BHNA 2R9LA 2HK3A 5D3GB 2GFFA 4NMLA 1VQPS 2QEXS 5ETTA 4F0KA 2DO0A 2JH3A 2NZ4A 1HARA 2ZBPA 3G82A 1CC7A 5K14A 2UV8A 3D66A 1AROP 3UCZP 2YX4A 5IV3A 1UCNA 4B9VA 1MW7A 5L46A 3QAEA 2ZBRA 4RPFA 4QR1A 4C0BA 4DV2J 4CO2A 4I6YA 3J7Z5 2K1RB 2W2OP 3ZZPA 2J6TA 2L48A 4ZHRB 1VQMS 4EI2A 2OPSB 4OZ5A 2YKNB 4ZPAA 3W8GA 4QWDA 3BQ1A 1HYSB 1RBAA 1LNQA 5E5NA 5FD1A 3MM6B 1Z1ZA 3BM7A 1U8WA 1NSQA 4YFUA 1WTBA 2LDYA 2IBOA 2AZ3A 3VVUA 4ATNA 4PAAA 1TFWA 4GKJF 3CNQP 4I4BA 5AE3A 2RSQA 3A13A 2HVIA 1R8CA 4DCPB 1RAOA 1SC3B 1V3ZA 3B54A 4FYXB 1F2GA 2NLWA 4WFZA 1TUVA 2H65B 1OY9A 1ZZFA 2EBGA 3W5XA 3Q2SC 4CT9A 5F8MA 4DV2F 4F50A 3M32B 1R0AB 1NK4A 4LFAF 3CIMA 4RWXA 2VDHA 1T11A 2WVFA 1K9MT 1Q5VA 1X4HA 2A10A 1AZSA 3LALA 4DSKA 4M95A 4RO0A 1IR0A 2V68A 1Y00A 4X4QA 3EPIA 2GA7A 1QLNA 2HIYA 1G2EA 1RT3B 2V69A 2VODA 4DUZJ 4FVMA 3BR9A 2ZEJA 3NG8A 3VWSA 2CVEA 1LQ9A 2YNGB 4ZOSA 2DY9A 1TKTB 2MY8A 2NYHA 5KFQA 4I7FA 4DFPA 3MM7B 3CJ0A 4MYTA 1TAQA 2KXHA 2M52A 5GAEU 4NYOA 4OHVA 4OHZA 1B99A 1RDRA 3G6ES 3I5CA 4ZVQB 4FS2A 1X8DA 2BJEA 1CJTA 3D67A 3GLJA 4I64A 4WKYA 1HR0F 3UFCX 2V8HA 2XSFA 3FCHA 4PG4A 5KG1A 4RU2A 1PBAA 4MAKA 2MKKA 2CPIA 4KGZB 4KYZA 2M7SA 4GKKF 2CNNB 2X3GA 1PIEA 3K2YA 1TL1A 2Z0GA 1KEKA 1NXIA 1WHWA 2GS8A 4PG8A 3KJVB 2HVHA 3KMSA 1HLWA 2VFTA 3DU6A 3X3UA 4K7QA 4BBYA 1K1QA 2BW7A 1X4EA 1JLBB 1RTJB 3D9BA 2HHVA 3CJ5A 3L9ZA 3MPDA 4HKQA 1IUJA 4XAKA 4O3SA 1X5SA 2P9GA 3LAMA 1I5OB 1XR5A 3H2LA 3NKYA 4N7TA 2OGUA 1W26A 4X66J 2NPIA 5JVGQ 3BGUA 4UY8T 4U95A 1M1GA 4OHXA 2J6SA 2B6AB 3TVYA 3C2PA 2DPJA 3HCXA 3WIUA 3UDCA 3BZQA 3V6JA 1S0MA 4DR1F 2RUSA 3W5ZA 3KLIA 1EB0A 2PN6A 2VASA 5DS7A 5KG6A 3DGPB 4TY8B 3DM2B 2PC6A 1M5OC 2XSJB 1IBKJ 2YQ1A 2AF6A 2PIIA 4W98A 3D68A 1UVLA 1AT1B 4EGLA 3KHHA 2IIHA 1UEVA 2PT0A 4Z7CA 4PUOA 2BM1A 3HT3A 4JV2A 4ETZA 5D4NA 3SQOP 2B9XA 2ZNZA 3OSPA 1N56A 4WFNQ 2AP6A 3DLBA 5G4DA 2ZBQA 1N4LA 4DPXA 4LRCA 2Q6CA 1EKRA 4OZ1A 3KK3A 4X65F 3NS6A 2XHCA 1QAYA 3K59A 1AFIA 4WCEQ 1WSRA 2XGPA 4MKVA 1HNWF 2BXJA 3UN3A 1X4DA 2J9DA 2QLWA 2LQ5A 1ZM2A 1CJUA 2Z30B 2DT9A 2HURA 2MHNA 3J7YI 3ETMA 4OYMA 2BJ8A 4FP9A 1UETA 4M5HA 4YB6A 2RRAA 4ZVGA 3AD9C 3H90A 3A12A 1NDPA 2BE9B 2W1BA 3BBCA 5CZXA 1I51B 3M7VA 4J9QA 1XMOF 3JYTA 1RJJA 1JXVA 2VF3A 1B0TA 1EP4B 2AW0A 1P8GA 2LDIA 2BV3A 4PG7A 3QSIA 4CLZA 3P49B 3ZXWA 5KT6A 1I94J 2XLIA 5C2GA 3N79A 5CHCB 4DUYF 4NXMJ 4LFBF 1QD1A 2WONA 2QYCA 2XI2A 2Z2MA 3POTB 4ZA1A 3OL6A 1L5UA 1VQ8S 1NKCA 3PRBA 3WBZA 4C8MA 1X5OA 3TUPA 1E6YA 1RQ0A 3THVA 1DBDA 2B4PA 3O2IA 4CO1A 2RDJA 1OPZA 3VAMA 4IQXA 2ZVIA 2Z56B 1SVDA 1TL3A 2P9CA 4O44B 5C24B 4EWTA 2HS0A 1TK5A 3GFYA 1HHTP 1KRPA 3Q2TC 4QWAA 4KTQA 1FRJA 1W2IA 3FKBA 3AB4B 2HFOA 2V2VA 3BPSP 4OI4A 4UT4A 1VCTA 2XZDB 3QJJA 2NREA 1J5EJ 4OZLA 1JMTA 1HBNA 1KP6A 2ZC4A 5J2PA 3BH7B 2B6AA 3ZNJ1 4IOCQ 4ED4A 4KPYA 4IOAQ 1IKXB 2WK4A 1UWBB 2W4DA 3ENAA 2Y1IA 3JB9k 2G4BA 1RCXB 3CVKA 3AT1B 2I5JA 3CTRA 3GFHA 3HSGA 2JFKA 3MM9A 3NCRA 2YNFB 1DURA 1UJ5A 2JFDA 4KKOB 2QMWA 2XMMA 5K14B 2VC0A 4O44A 4RNFA 2NXCA 4K4XA 4H4OB 2R7VA 2M8HA 2CPEA 1ITPA 4G3IA 2AHOB 1RT4A 2HVDA 1F9EB 2WB1D 3PVXA 1NHKL 3QSYB 3NBPA 3DXBA 3LP2A 5ETNA 3H5YA 4N8OA 2O1PA 4PQUA 3CJRA 1ZH5A 2BX6A 5D0GA 1IKVA 1NEEA 4Y2AA 2CFXA 4ED6A 3E51A 1VMBA 3PYEA 5U47A 2W9BB 1CJTB 4LF6J 2RIJA 1XC9A 1H0HB 2MQMA 3DYAB 4ZVSB 1JLAB 2ZZTA 1GXLA 1OSCA 2WAQD 1EQ0A 3JSRA 2OFGX 4ZP6A 3ZZOA 2GJ2A 2VQFJ 2YVSA 5I3UA 5CCMA 4PABA 2QLJB 1T3NA 2UVWA 2I0XA 3QQCD 3EZ5A 5KFTA 3KLIB 2ASDA 1DQ8A 1SJ3P 5IXUA 3IA0A 3PHEA 3HZEA 2QL7B 5K8MA 2MYFA 1AZSB 4X62J 3BO4A 3QJPA 5DGBA 4KGMA 3OVSA 2QMUB 2ROPA 3GJSB 3CSKA 2EG1A 3QIPA 4DX5A 4B3OB 1V9OA 4K4SA 3M8YA 1RGVA 3KLFB 3FMBA 4P2XA 2XO6A 3R2CJ 1VRTB 5KTQA 4DS4A 2VOPA 2HHXA 1IBLF 3OTOJ 3RGIA 1S49A 3QATA 2C28A 1SKWA 2DRAA 2VOOA 3FK4A 3TAPA 3N5BA 4DJBA 4DV1J 1IBCB 2B0GA 2FGOA 2UVRA 3GFZA 1DRZA 1VQ4S 5KFNA 1OQ3A 3BJYA 3OW2R 2OPRA 3GYGA 3LF0A 2RUGA 5GMEA 4TY8A 1T05B 4D3HA 2BDPA 3QBCA 2G0IA 2VPXB 3HX9A 5KT4A 3M1VA 1T03A 6AT1B 1OO0B 1DTQA 3ZTOA 8RUCA 1U1QA 3VTIA 1Q7YT 4CYUB 2UUCJ 4WIIA 4DUZF 3PW4A 1FF2A 2J9EA 3CJKA 1CSJA 1HR0J 2ZE2A 1UPPA 4LR7A 1JLEB 3H59A 3OFHA 5E0OA 4I0WA 3SFGA 4LF7F 3KMQA 1H38A 1YJNS 2UXBF 2H51B 3K58A 3H25A 1R8PA 2CAJA 3P4UB 2KT5A 5KFZA 2UZAA 2DNLA 1RAAB 4Y65A 2FY1A 2P8IA 1X0FA 1AA1B 1RT5B 3DI6A 1IBMF 4L72B 4U67Q 2C3PA 4YR0A 1ZETA 5F9LA 2JLEA 4CO3A 2WSEC 5I42B 1HL6A 1JK9B 4P75A 4EO6A 3PW2A 3NBPB 5E2QA 1RT4B 2AEMA 2G0JA 3ZTPA 4LIWA 2AJ4A 4LVOP 4RW4B 4RNHA 1F9HA 1PC4A 2DEIA 4ED2A 1HD1A 2R7TA 4IR1A 5HBMB 2AKWB 1F1BB 3R5AA 2ZBCA 3FVYA 4DXLA 1HHQA 3FUYA 2HMIB 4X4UA 5KOXA 1Y0HA 1R0BG 3RR8A 5IQQA 4XDDA 3F0NA 5AT1B 4C0OC 4DLEA 2F3JA 2J7WA 5E3PA 5L9XA 2MZJA 1J5OB 3PJXA 2XMJA 2HW3A 4NXNJ 3SSQA 2OPQB 1YI2S 4R25A 2YWEA 4QU6A 3RAMA 3T5LA 4DN0A 2AJ1A 2G9OA 3C14B 3BQ2A 4USUA 5KAKA 4MK7A 2VFRA 3NLCA 4QR0A 2RRNA 4CLSA 1WOOA 3M1VB 5J1PA 3CF5Q 5J2MA 5B09A 2HMIA 1S77D 3G4SS 2W7OA 2UVVA 1V6HA 5GAGU 4FF2A 5KFIA 3HZGA 4L3NA 3SQGB 4ECYA 1RHJB 1KLMB 1YRUA 4WXWA 3VGVA 3MR6A 1PYSB 2BKOA 2DR6A 2WZ1A 2UUCF 4DSJA 1RTIB 2V67A 1IQZA 1S48A 1RBLA 3O3LA 4UOFA 5B0DA 2VV5A 5KFBA 2DNMA 5D4PA 2C2DA 1N48A 5B7WA 4LVNP 1K8AT 3X1LB 1XR7A 4HVZA 4OYWA 5KG7A 1VQNS 3BREA 5LJ3Y 3C16B 2NYIA 3FEZA 2FQQB 4PZVA 3OUYB 1VYAA 3PX6A 3NS5A 1LW0A 1HFEL 5F8HA 2KYZA 3OFFA 2J7KA 1TKTA 1NM2A 4ZCIA 1VRUB 2BKPA 3R6LB 5G0RB 3GONA 3K5NA 3V6DA 1TVRA 3C6TA 4ECVA 3BBFA 4DR3F 1H2UX 1FTRA 1TQLA 4QYRA 2DYAA 4MMOA 1RAGB 2A0FB 3R5CA 3UR0A 3R27A 2HHTA 2CPHA 3RBDA 2QFIA 3PYFA 4PKDB 3ADAC 1FRHA 4KHMA 1RI7A 3D5MA 2L41A 2W9BA 1HBNB 2GQQA 4ES1A 5IFMA 2ZH2A 1Z2ZA 2HWTA 3SV3A 3B78A 4PYDA 2YX1A 1SKUB 2H48B 3AD7C 7AT1B 5HL7Q 3DRPB 2CJ9A 2JHEA 3BKFA 2XLJA 3EPGA 4JV5J 4EZ6A 2Y9HA 5A8WB 3QLHA 4YOEA 2NS1B 2D7SA 2HKEA 3HO1A 4CQ1A 1O5JA 1FCAA 2PI5A 3ISNC 3P3DA 2E5JA 1M1HA 2AYEA 5IOLA 5SUHA 3HJFA 3GCXP 1RE1B 2KH9A 3CGIA 4CH0S 3T5HA 1FRLA 3WC0A 1U4BA 1FKPB 2RE1A 2ATCB 3OD2A 3KTQA 3AY0A 3ETOA 3QGHA 4F4ZA 2B5JA 2E1RA 4LRAA 3I9ZA 4FKXA 2VBZA 2ASYA 1EIYB 1NJWA 1U1OA 4USIA 2XGQA 2HNYB 2HVZA 3SBMA 1OMSA 3CJ2A 3NAIA 1WHXA 5IT0A 3KOAA 1KQSR 1WF1A 3HSZA 1JXLA 1R27B 2PFDA 3S7RA 2RU3A 2JEFA 3BPDA 4CRJA 3PKMA 5B0GA 3MDFA 3UN2A 3DRRA 1BQNA 3ZZTA 4EEYA 2BANA 2L9WA 2VC1A 2VD3A 1N5SA 2IJFA 3K17A 1NH7A 1H7WA 2W4PA 2QO3A 4Z37A 2FVQA 2KT3A 3AJDA 4ZCKA 5K8NA 4DL6A 3QRQA 1WHYA 2JVOA 4LBIA 3MM8B 5JMNA 1RWUA 2HGLA 3AH6A 3ULHA 3TEGA 1QSLA 2YY3A 1OQ6A 1GT8A 3CCQS 2XY7A 1TMJA 4F02A 1S0OA 3EDQB 1VQ6S 3L7OA 3CCVS 4K4ZA 4FXWA 4DR2F 5LXYA 4M5JA 2B51A 2QTWA 2R2TA 1C4AA 2H4WB 2W2MP 4CIOA 2IDEA 2V50A 2W7PA 3NXZA 4LRDA 1NJIT 4B9UA 3S6EA 4XK8C 1YBTA 1AW0A 2BABA 4KHPJ 2ADBA 1G4CA 3A3PB 2V63A 1T9VA 3MMBB 4USKA 3TX8A 3V6HA 3R5JB 3SDEB 1VFJA 3T1YJ 2R7UA 1JKHA 4B3MF 2GJIA 2QRRA 5KFFA 2PMZD 4GKJJ 5CCLA 1NPPA 4Q8EA 2E5IA 1FDAA 5CZVA 3HFVA 5GAEI 3UW1A 1YK9A 4C0HA 1ZM4A 5T7LB 2Z8QA 5EWGA 1RWOB 1BWVA 2IC3B 1B64A 3MM6A 4IH5A 4ERDA 4QPTA 1FE0A 1EAYC 4DR4J 2FJDB 2RQKA 1HQUA 3ZTSA 2XG8A 4M5MA 3CC2S 2XULA 5LOQA 1MMLA 1P1LA 2HBQB 4NZ0A 1TKZA 4OJ1A 3UWTA 2L3MA 5KFAA 3DOLA 3M8PA 2QSFA 1YGYA 3EDRB 3EUNA 1R6VA 1D8ZA 3GU0A 4Y2CA 4EFAC 4ZIWA 2Q66A 1K0TA 2I5JB 1YWXA 3I5BA 2KZZA 3DOKA 3M6VA 5ETLA 3TR5A 3OV7A 3QT8A 1JLAA 3M8SA 1U1NA 2ABYA 1RTHA 4NWBA 3NWGA 2BW2A 2KJWA 3NNCA 2HK2A 1C0UB 2CJYB 1SH0A 2KN4A 3QFHA 4KB7A 1WTFA 2NQPA 4MYUA 1S4EA 4NLRA 5CYJA 3J80U 1EKSA 1S1VA 3W65A 1RT1A 2MJNA 4JV0A 4ZCLA 5ETQA 4K59A 1VS3A 2X1GA 3DLGA 4MH8A 2F7VA 2NXUA 2BANB 1TL3B 2XMKA 3IBFB 4OYXA 4ZVRB 1RUSA 1YRXA 2DGWA 4DU7A 1IWAA 3GMGA 5CYMB 5C25A 4JI4F 2B56A 1Q79A 2DH8A 4RW7A 3WX4A 1FA0A 4ELVA 2ZH4A 3PYGA 2RNEA 4J9MA 2M2BA 3H7HB 1IR2A 1D8YA 1HWUA 1FTCA 4QWBA 1HNVB 2DXEA 8ATCB 1S1WB 2F8MA 3BKTA 2NSCA 2BQ3A 5C42A 1CULA 2XZTB 2H3EB 1ACMB 3BV8A 3QGIA 3KDOA 4Y6IA 4NL5A 4F0MA 3I0RA 4H54A 2U2FA 1HI8A 3I87A 4KV8B 2XQCA 4ZKAA 1P27B 3L09A 2B8PA 3DDKA 4A8KA 4B17A 5D4OA 1LV5A 1H73A 2CXEA 5HMZA 3DOLB 4FVCA 1JJCB 2H9ZA 1RP5A 2Y1LB 5FJ4A 1B7YB 2CPFA 2EC0A 4IG3A 1FDNA 2R2RA 1R0AA 4U96A 4OL8A 3LH2S 3BBBA 2M70A 2OO4A 4KH1B 2VBWA 4M1KA 1DTTB 4HT7A 4FN5A 8AT1B 1D1UA 2Q3PA 1X0PA 4QIVA 3QO9A 1SXLA 1CJVA 4P2FA 4IG0A 3EGWB 1IM6A 1W7WA 1Q8IA 4I1TA 2DNOA 2EKYA 2EFQA 2XCPA 2XBPA 5CAAA 2KM8B 2DR7A 4NLDA 3NGSA 1GMUA 2WW4A 3LPEA 3BSNA 1FEHA 1IKWA 1TKXA 4A8OA 2QL9B 3AJ2A 3VZHA 3LANA 3IO1A 1PAUB 2C42A 3CD5A 4OLPA 3BSAA 3DCAA 5D78A 5DDRC 1Q86T 4DR6J 3DLEA 3AD8C 4P10A 1JLCA 3C6UB 3OL8A 2MY7A 1VQ5S 2WCXA 3M8ZA 4ZVFA 1ZA1B 5HLFA 3FRYA 3IR5B 3PW0A 1ZBTA 1YKWA 2RDIA 2Z2ZA 2X1FA 1B0PA 1RHMB 1J5EF 3FZ2A 4YB7A 1JIHA 2LQ9A 4Y34A 1PJ5A 1F3VA 3N5FA 3Q23A 4DR6F 2L9DA 5HI7A 2HRUA 2UV8G 3CC4S 3B4MA 1C0TA 2FZGB 1VLYA 2IM3A 1VHFA 2OUGA 3OTDA 4RUAA 3LAKA 5KFGA 1HNXJ 1S57A 2C2ZB 3NP5A 3F44A 4L74A 4UQTA 4XTTA 3U1LA 1NDLA 3KLHA 1JNZB 3R2DJ 1K0VA 2K2PA 5A2QU 2UU9J 3HHLC 3MEKA 1M5KC 2AQ4A 3DU5A 2QSWA 1RU2A 4WYWA 4MKAA 1UZHA 1ICEB 4GC6A 1FJGF 2PGCA 2PEHA 1KQGB 1HBUA 3J81j 2VG5B 3EGNA 4LREA 2KT2A 3FJ2A 4DUTA 4ECRA 2MDAA 1NH8A 1U1LA 3KUEA 4JBCA 2V9WA 4DCOB 1YHQS 4DPOA 1MMDA 2V94A 4EYHB 1TKZB 3KLHB 1OY8A 1JXEA 4YY3J 4MFBA 4J9OA 2W8KA 4H4KC 4F36A 4DV3J 1H74A 3IMQJ 3OFEA 2B3TB 3I82A 1WC4A 4IH6A 3RG6A 3W63A 3R1LA 2R7WA 3FNNA 2POKA 1RU1A 2KXNB 1M5PC 5FLXU 1FERA 3FFIA 4RX6A 3MGJA 3RTVA 3ZNUA 1UWAA 1XEZA 3IN5A 1ZM9A 3PTWA 2VONA 3DKDA 1SC1B 5DM7Q 4P9SA 1R43A 4F4WA 2DH9A 2LYVA 4NZ7A 4G1QB 5A8RB 4WK1A 4JYAF 2ZM6J 1UTAA 5KT3A 4NLGA 1O8BA 3GV5B 1N0UA 3I0RB 4NCGB 3GFXA 4F7VA 2BJDA 4OMFG 1T9UA 2I9SA 2KO1A 5C7PA 1SCJB 2CPYA 1FXDA 3DLEB 4KGXB 4F8RA 2C3OA 5DG9A 2RQMA 3R5GA 3N6MA 3GIKA 3KG4A 5DDOC 5A8KB 2HHHF 2VFUA 3GE9A 4USWA 2GJFA 4CH7A 2LCWA 4M5GA 2OPQA 4I68A 1NPRA 3R6GB 2Q43A 3AA8A 3OR1B 3GYXB 4KIAA 2RS2A 5KFKA 4TU8A 2MLZA 4MKBA 3PG9A 4RW8B 1C1CB 2M5YA 4Y2KA 3QPIA 3EXYA 3CDBA 1KN6A 1R6YA 2CQ1A 4FNIA 4GO7X 3DDNA 1PC5A 4FXVA 1GX6A 4MT1A 3F56A 2G1HA 2F5GA 2YWFA 1U1KA 2KHDA 1SL0A 1QE1B 4IFYA 3G6YA 1TR0A 2ZHBA 5FDLA 5F3ZA 1SH3A 1DY3A 4KGKA 4RBTA 2OP5A 3CIZA 4C97A 2QLFB 2QLXA 3IRWP 1G7CB 2APOA 3IC1A 3U1NA 4KH0B 4OI3A 5CABA 3RBXA 4CP5A 2MGZB 2ADCA 4K2XA 3O5TB 4AD6A 1D0EA 4OX9J 4X64J 3GB0A 5KFRA 1KLNA 3EE3A 1C4CA 4HR2A 1HWLA 1VQSA 3AOCA 4ZN1A 3VAGA 2AU0A 1M90T 3G9CA 1KOHA 2ZUAA 1RHKB 1S1TB 3BB5A 3T6JA 3PZPA 4PQUB 3JSMA 4NLPA 3TA2A 4LSLA 4RW6A 5E3CA 4X4RA 1EX8A 3CXCR 4ZLPA 4WP9A 3KLEA 2Y0BB 4E0DA 5LSLA 5HK4A 5DG8A 4O3NA 1G3OA 3JTOA 3NGUA 3HSDA 2MTLA 4C8OA 3H4DA 1NSAA 1WWHA 2X1BA 3TQ1A 3CCJS 1S1VB 3VF0B 2XI3A 3BN4A 4JOUA 5CH7B 1ZZNA 3UPFA 4WFBQ 2DEJA 4XO0A 2YPZA 2FVCA 4DSLA 2I38A 3L7PA 3MCSA 4X4SA 1CPZA 3WZ0A 1WC3A 3KLGB 3T41A 4NCAA 1OS5A 2LFVA 4R8UB 2VDIA 3DMJB 2GQ2A 2KFZA 4OZ3A 1RWMB 3R9LA 4LF5F 1RWNB 1LFWA 1SJ1A 4DL4A 1T9TA 3MAQA 1WACA 2CZVC 2DH7A 4OIXA 4DS5A 1IKWB 5C2CA 4PWDA 4M5NA 2F9JA 3THPA 1HNZF 3PKYA 2HHWA 1X9WA 2W7AA 3H0PA 2CZ9A 4TXSA 5KG2A 1X5PA 1N6QA 4AXIA 5A6WA 4DBQA 1B4SA 1BE4A 4IQMA 3FBCA 1HMVA 1QVGR 1X4GA 2YKAA 1CG2A 1IJEB 1VC0A 3MPWA 4C6AA 4U6PA 3SQGA 5K9FA 4J9NA 3G71S 4O3RA 3HHDA 1SJFA 1IKYA 2I6WA 3UD3P 3HFZB 4LUBA 5ADZA 1U47A 2O01C 2HAIA 4QU7A 1KFDA 1MU2A 4MK8A 4NLWA 2PO4A 4Y2MA 3PX0A 2R7SA 2V6AA 1SPBP 3PACA 2MKIA 2CQIA 4C7QA 5KFMA 4ID8A 4QQBA 3HMJG 3DLJA 3MTKA 2GMJA 2XHWA 2CJXB 4J90A 3MUTP 5BYSA 4OLOA 4G1QA 1N88A 1RCOB 3D6TB 3LGMA 3PCOB 2MPUA 5A8RA 2VG7A 2KXFA 4NX9A 4PEOA 2GVZA 1C1CA 1U26A 3H42A 5HBMA 2VQEF 2ZZMA 4TVAB 4CLUA 2HHPA 3T9NA 3TAQA 4FYDA 3OQ2A 3G8SA 2HRYA 4UQGA 2ILYA 3FEYB 2ZWPA 2LEAA 4LQ3A 2DHHA 2M8DB 2HBZB 3IR6B 4FF4A 3SMZA 1LK5A 3VQTA 3IG1B 4YHHJ 3M9OB 5HJXA 3OVAA 1OJ4A 2BE2A 2VBXA 4N41A 2C2KB 1WELA 2DO4A 3MPVA 2FVSA 4WFAQ 4G1PA 3QWPA 2MZQA 3KLVA 2CQDA 4RKUC 2QFJA 5AXNA 3CPWR 2CADA 3A3OB 5F8GA 4FBUA 2FZCB 3BN7A 2UXBJ 2YH1A 4DL0C 1IKYB 1UZDA 2WOMB 3LP0B 5DZ6A 1WOPA 4I67A 3C3LA 4K4UA 3ENQA 3PRDA 1AUSL 4W92B 4B3TJ 2HAFA 4U9RA 3LWLA 2ZH5A 4O4RA 1JNRB 5EHHA 1RTDB 2B7BB 4LF2A 4ZS6A 2LXFA 4PXBA 2C2EA 2KVQE 3HKWA 2DNQA 5KFSA 4B08A 1XMOJ 1FI4A 2MEWA 3BYRA 2IMWP 4JI1J 2OPPA 1MROB 2N4CA 2X51A 3D3CJ 3U27A 2JDJA 2ZHAA 2HZVA 4ICLB 1N0VC 5ETOA 4DPUA 1RT2B 2MKCA 3VQSA 2UXCJ 1S12A 2CNKB 3FC9A 1RBOB 2GVZB 3M30A 4ZVOB 4N56A 3C8YA 3T5JA 1X9SA 4B3RJ 1NB2A 1UFWA 1ZAWA 1T9XA 1GX5A 4WWSA 4U7CA 3JYTB 1TKDA 2HHUA 2RKIB 1RZMA 4NLUA 1H7XA 2IAJA 3M4XA 1Q95G 4FNHA 4R8UA 2DK2A 3T9ZA 4B02A 1BQMB 2E44A 3PX4A 1UKUA 4K4WA 2IJRA 2YWHA 3D28A 2DNGA 4DQPA 3T1HF 1KC8T 2IVYA 3J7A1 1WDDA 2DITA 1YQHA 1HNIA 5DDPC 3UDEA 3CW2C 1SQEA 4LMZA 2U1AA 3NAHA 4DX7A 1P9YA 3BGLA 1LWFA 2NXJA 3NOCA 2AWZA 4GRSA 3PV8A 4JI5F 1QAIA 3GIMA 2VG6A 5AXKA 4QWEA 1UVNA 4G1IA 4ES3A 2JNJA 2CQHA 4N47A 4YB1P 2ZOMA 3TUZC 4TLQA 2MQQA 5IT9U 1WEYA 2IVMA 2YNHB 4FZVA 2ZH1A 3DRYA 3QGGA 1YSJA 4OX9F 2PE8A 3H5UA 4KBIA 5KT2A 3BSCA 1SJ4P 4H4OA 2YNFA 3R5DA 4DSFA 4ELUA 1T0TV 1FX2A 4LBPA 1WC5A 2HZAA 2K06A 3AFGA 1U09A 4Q2MA 2EFVA 1CJKA 3UI3A 5KFWA 3UN5A 1VQKS 2LU1A 4C8KA 3D1QA 1ZAXA 1LXJA 2QIFA 3VAHA 2XNRA 2PMHA 3HHLD 4IFYB 2ZZNA 1H98A 2ZE2B 3U02A 3IRXB 1F9FA 4P2MA 3OTOF 1LWXA 3IXQA 3OFGA 2IA0A 3E01B 3CCZA 4QW8A 4WE1A 3FZBA 3IAM9 2LQJA 2WSCC 3CDUA 3MCMA 4GO5X 1RAHB 4O23A 1LWCA 3QMQA 4JYAJ 4R5PB 5LM7E 1ULRA 4YB5A 5F0WA 3PEJA 1S1UB 2EVZA 2E1CA 4J9KA 1J27A 3MEDA 1MSWD 3OR1A 3B82A 1OY6A 4J9SA 4B3TF 4JI6J 5F8NA 1M1KT 1JLQB 2OPSA 4NPOA 4IUFA 1U6ZA 3DRPA 3MI7X 3J7AN 2Y0SD 3MEGA 1WD6A 1UJ6A 4Q5VA 4LF8J 5LL6d 1PGZA 3RBEA 2VJVA 1C2PA 2D3ZA 2XLKA 1HKAA 1Q78A 2GW8A 4V19J 1RYRA 4I2QA 2EG2A 1I94F 3KLFA 3Q8PB 4MKYA 2V5HG 3MURP 3QIPB 2EKNA 1ZM3A 3VZIA 5IWAF 2V2ZA 1JJ4A 1Z4UA 1Y7PA 4BDPA 1N32F 3MR7A 1WORA 4XDCA 4BC7A 3ZTQA 4IKAA 4OQJA 3AOAA 3TQEA 1LW2A 1B7FA 5E3RA 2OHDA 3P8BB 2DPIA 1UVMA 2YKQA 5D8HB 2Y1RI 5HQLA 3DRSA 4OV1A 2IDLA 3W9HA 3D6HB 1S6PA 2FLLA 2JLGA 2OJ3A 4F0HA 1HI1A 2W01A 3MMJA 1FHTA 1R7IA 2KB2A 2DNZA 3CMQA 3OHBA 1T05A 2VKRA 1L3UA 1PJ6A 4QZVB 4DFMA 2Y1JA 2FVPA 3PRVA 1SL1A 1KR4A 2RB7A 2C1EB 2V34A 4DCJB 4I6AA 4RR5A 1S1TA 4RNNA 2EFOA 4UZCA 3KJQB 2CRLA 1ZAVA 1RA7A 5KFUA 1QTMA 3OLAA 3GTYX 4RBVA 1A6LA 2F65A 4NA1A 2RF2B 3V5RA 1VRQC 3D6MB 2VKZG 2OEJA 2RRBA 2HFZA 2DNPA 3UE2A 1KTQA 3DM2A 3GJQB 4RUBA 3OLBA 5A8KA 2MLXA 4OYZA 5HQMA 4EBDA 3I0SB 4TQSA 1TFYA 1TL4A 3KG1A 3DLLQ 5KFJA 3M2UB 5J2QB 1D9AA 1TU0B 7FDRA 2N3OA 3Q8SB 3MD3A 1TKXB 4CLFA 3KLGA 1C1BA 1R8HA 2WHOA 1FT8A 3H5SA 1KQKA 5HMYA 1EZZB 2DCLA 3E8OA 3H20A 3SEOA 3QT5A 4YUDA 5DETA 1WUUA 4ZMMA 1T94A 2FUG9 1FJEB 3S1TA 2PEBA 5K8PA 2BUNA 4ED0A 5DGAA 3D4JA 2BE7D 5L1JA 2XMUA 3DXSX 5HP1A 5D0EA 3HVRA 2ATLA 2HPUA 4TU7A 2MQPA 5EWFA 3I56S 3ZZUA 2UUAF 1EQMA 3M6UA 2RHSB 2GC8A 4MK9A 3TP2A 1MWZA 3GG0A 3ICLA 2FGCA 2RD5C 3A8KA 3ET6A 4KAIA 5I3PA 2CVIA 3GYNA 4QBUA 2W8LA 1HNWJ 2QL5B 3KYLA 3VGSA 1DZ5A 4QJVA 2N7YA 1AFJA 2DNHA 3HK2A 3D0IE 2MKJA 3MPUB 5AE2A 3TOQA 2O66A 4P6QA 4D3GA 4IRDA 2MMYA 1HI0P 3KUHA 2HBRB 2R8JA 2E9RX 3OJSA 4AFFA 2F8HA 1FFWB 1G6BA 3MFHA 3KK2B 1HMVB 2BQRA 4DV7J 1RAFB 2WSFC 4DV4F 2IPOB 2V9KA 2HYIB 3MAAB 2ROEA 3DOMA 1NHVA 2YPYA 4LF1A 2CJQA 3SCLE 5I4MA 3IWNC 1HIYA 1NLKL 3UQSA 2QZ8A 4PWWA 4JP8A 2JWNA 2GAGC 4ZP9A 2ACYA 1VLOA 3P5BP 4DV5F 3DLGB 1Y5IB 3EXCX 3R7SB 1F6TA 3Q8RB 1WJ9A 2BBEA 1Y10A 3C15B 4NE9C 4Q2LA 1HBMB 2A2DA 2W2QP 4CZCA 3KKFA 2N7CA 2ZJQQ 9ATCB 4K2JA 5EUHA 3IFEA 1GMVA 3FCWA 3RRKA 2GX8A 1JLCB 2AYMA 2OSRA 1PG5B 1SBRA 2GIRA 2HIQA 3C6UA 2FDNA 2XNQA 2F1FA 3I31A 3NWRA 4NLVA 3SZ2A 4ECXA 1S1WA 2HG4A 5HANA 3I6PA 3AOBA 1N33F 1K44A 3D2WA 2AYBA 1WF0A 2PSZA 1WC0A 1UA1A 1PYTA 2GHPA 2KZMA 4ZJLA 3ZZ0A 2UUTA 1ELOA 1VQYA 3ET6B 3EYZA 1WI8A 2H5EA 3A4TA 4F25A 4OI0A 3OL9A 4E98A 1JQGA 1N36F 4DQSA 3GV8B 1U0HA 1IQTA 4ECTA 5D3GA 2BJ1A 5I3QA 3MFIA 1L3SA 1VQ9S 4B3SJ 2R2SA 4M8LA 3BDEA 2COLA 4R0JA 4KR0B 3QZ7A 1CEZA 2XYHB 2ZJRQ 5BR8J 2VBYA 3HHKA 2XCAA 4URSA 2LA4A 3P45B 1S9GA 4HHJA 2MZSA 1SQGA 1SJQA 2HNYA 3FSYA 3CJ3A 3UNYA 4B9TA 2NUHA 1HYSA 4NEYA 4JV1A 1WC1A 4DR5F 1HD0A 4YEAA 2CPXA 1HPZA 2YNGA 3KNAA 5KT7A 2KTQA 4NMXA 2DTJA 4BWJA 4KPCA 4FDFA 2XS7A 3QJLA 1HWIA 2LA6A 1FWPA 3AB2B 3M05A 4IO1A 3MOZA 1FFGB 2VPYB 1UL3A 4ECWA 1S9FA 2F4VF 1SV5A 5DG7A 1FKOB 4Y3CA 2VQEJ 2WVCA 4X4PA 1OSDA 4LF4J 4HACA 1S9GB 2Q6BA 3D7SB 4KY3A 1NKEA 2NCKL 5D0RA 1N5YB 3AODA 4KHPF 3ZO7A 3J7ZT 4ED3A 2HFUA 3MM5A 4CTAA 1HW8A 2HBYB 4BCAA 1QTNB 3GPAA 4LSNB 4OI2A 2HHQA 1RT2A 3GJRB 3SYZA 3OR2B 2V2KA 3Q86A 2FHKA 4ITSA 3G8TA 4K0KF 1XQIA 2FJXA 2RU9A 2N4DA 3K89A 3NCPA 4KSEB 3T19A 2OEMA 3H4BA 4EYIB 5HLFB 4FPRA 3QLHB 3N6NA 2O5DA 2PA3A 5C5JA 4Q44A 2YKNA 2YQ0A 5T14A 2CZ4A 2QN6B 3JSMB 2RQCA 1C1BB 2ALYB 3JSBA 1NK8A 2DGTA 1UW4A 2VPWB 1XNRJ 3N01A 1X60A 2RAQA 1FJGJ 4KHRA 1S79A 3EVMA 3V2UC 4OFZA 3MECA 1ZPVA 2E5HA 1TV6A 2BJ9A 5ETMA 4LF9F 4DR1J 4O4GA 2CPJA 5J1EA 1YBUA 2CUYA 3PNIA 4P71A 5HVGA 1RT3A 1RWKB 2HFNA 2LKZA 5E3QA 1HPZB 3TZWA 1RTJA 4U8YA 5FIIA 4AQYJ 5HROB 4LQ9A 4NOHA 4ZVUB 1FKAF 1HNZJ 5KFEA 1O0PA 2GMLA 2W24A 1KLMA 4BS2A 1T8EA 2UXCF 1U0HB 3NEKA 1MLAA 2I2YA 1KHVA 4DQRA 1U8SA 3O44A 3DRSB 3K0JA 1LWCB 2ACMA 1VDHA 3CCWA 3M8RA 4JI1F 2MB0B 2HQFA 5L1KA 1FRIA 2GIFA 2JC0A 2MQNA 1SI9A 2IFXA 3CEDA 2CPDA 5J1NA 3W9IA 3CCSS 1RTHB 1NMEB 3G6XA 3MOJB 2UUWA 1DLOB 1T7PA 3MMAB 5K8OA 5DQIA 2R7XA 1HNIB 3TYTA 2ZH3A 1VC6A 2XEXA 2ZH9A 3BS9A 1TK8A 1NK5A 1GH8A 2XB2D 1YZ6A 4LJMA 4I2QB 4UW2A 5LSOA 2V2QA 5DLFA 1XNQJ 2LQ8A 4XPCA 4GKKJ 4JI5J 2HHHJ 2H5IB 4DV4J 2BR0A 5F8JA 1Y5NB 2W2NP 4YN3B 4C3MA 1TK0A 2OLWA 2YWGA 3MF5A 4ZVPB 4CLPA 3KLEB 3ZZRA 2HNZA 2ZNYA 5DZ7A 1E6YB 2ALZA 4C3LA 4DI6A 4IG0B 4EBEA 4E2FB 5ITHA 2E7WA 4X4VA 2V8PA 1SB6A 4CTAB 4WTOB 4A8MP 1U49A 1U1RA 3IM9A 2MZ1A 1HBOA 1XBWA 2B9WA 1F5CA 2J5AA 3OXGA 1WHVA 4ETXA 4MIBA 3T1AA 1PSDA 1LEOA 4WP3A 1WG1A 4MIWA 4PXEA 5LMUF 3HD2A 2FB0A 4FF3A 3IWXA 4F3MA 3GG1A 1UW9A 2CA9A 4PG6A 4WPAA 4AT1B 1B70B 4URGA 2AJ2A 1HQ2A 5IT4A 1LWEA 3NGKA 4IDKA 1VK3A 4KO0A 4OHWA 2E7XA 4B3MJ 3M8PB 4ECQA 2D3OR 1JLFB 2B4UA 1UJ4A 2B5JB 3DHXA 3LPYA 5GAHU 4YQWA 3Q8QB 4H4MA 2DR8A 2L08A 1FRMA 3C16A 1BY9A 4RUCA 4NA3A 3TRGA 4DG1B 5IWAJ 4A8XA 2QG9B 1XERA 2IJNA 3OUYA 2XY5A 3R3TA 2AJ0A 1CJVB 3PJ9A 1REVB 2XMVA 3F73A 2DBBA 4F2SA 3LP2B 3RR7A 2R42A 4K50A 3DRRB 4N77A 3KK1B 1H2VZ 4RW4A 4L6V3 2LXUA 2MKHA 4EMDA 1MN7A 1NK7A 2A3JA 3ITHA 2OSQA 2YWWA 5ETSA 3GP9A 2DIVA 4LR8A 3HVTA 3MEEB 4LSLB 4RW6B 4WE1B 4DLGA 3MM9B 2Z2LA 2GHWA 4DX6A 2ZH6A 3NS7B 4HI2A 3TO8A 3AXMA 3FCVA 3WIVA 5GADI 4DL5A 5KG0A 4UY85 2JRSA 2OD6A 3B4DA 4ZHRA 2FY8A 2HS4A 4DPTA 3KNGA 2ZBIA 5B08A 3QAUA 1NAQA 2EPIA 1WOSA 4ZLLA 2R8HA 3T3FA 3K7RA 3TJ9A 3J81U 1ZA2B 4DV6J 1M5HA 1SC4B 2FYXA 3M6WA 4ZVHA 2JC1A 3HVTB 3MEEA 5HO4A 4DSEA 1IKVB 5J2NA 2IM2A 3BGRB 3DC2A 3DYAA 5KG5A 1RT7A 1AYEA 2G2YA 2GMHA 3JXOA 2YXLA 3EZOA 2D9PA 3R8YA 1MN9A 1NO8A 3F41A 4K5RA 5I42A 1N8RT 1F5BA 1HBOB 2YBVA 3KJFB 3KK2A 4C98A 2JX2A 2PMWA 3GJTB 1S6PB 4IFVA 2CKWA 4IR9A 3I4HX 1RKJA 3V81A 4A8FA 2HEKA 3R7BB 3Q8UA 5DO2A 3G96A 1KOOA 3PIPQ 3EJMA 4DR2J 5CQGA 4QYZJ 3W2WA 2OI2A 2J0XA 2CPZA 3A3NB 3MM7A 2GHVC 3AJ1A 3I96A 3CJKB 3VGTA 2V4JA 3IS9B 2ERRA 1VBXA 1JLEA 4IDKB 4KO0B 1S7HA 4F3QA 4X4NA 3C6TB 1Q16B 2IYGA 2J9CA 5HN0A 4PPDA 2NUUG 3N6LA 3EWGA 4ELTA 4ZITA 5GMKa 5AJ3J 4F2RA 3TNVA 3MZIA 2X3DA 2ZD1B 2AJFE 2JOQA 1AUDA 5D0HA 4U8VA 1GFWB 2HRTA 5M2RA 3PM9A 3TVKA 2BZ2A 2M88A 4HH1A 4DR3J 2LP4A 4HTJA 2Y8YA 2UUAJ 2DHXA 4J91A 2DR9A 4WP8A 2OKQA 3HSJA 1KHWA 3DGVA 1RA6A 4X84A 2LEPA 1VBZA 5CYMA 2NXEA 5C25B 4AQYF 3KK1A 3C66A 3OT9A 4PYAA 1BQNB 1JJ2R 4NEZA 2WVBA 1XK8A 2K7JA 2VZ9A 5IM0A 3TEHB 2KG0A 4DV0J 4B3OA 4WF9Q 2XMWA 5BJRA 2ZJPQ 5D77A 4RWWA 2DISA 3D54A 2CJAA 2HQGA 2WVEA 4M5IA 4HTIA 2E5LJ 1WG4A 3NGRA 2CJBA 4YR3A 3R97A 3C14A 2IRYA 1UVKA 4AL6A 1VRUA 4FPIA 4H4MB 3CO9A 2NR0A 2FIUA 2ZDOA 3EZUA 5F41A 4O3OA 4J9LA 2DGVA 2RT3A 2FPHX 4LT6A 3UCUP 2YWKA 2DGOA 5GMDA 3UDVA 5CXTA 4IRKA 3WQPA 1T95A 4ED7A 4QYZK 1EHWA 1EARA 3AXKA 4CYUA 1D3WA 4MIAA 4F04B 2JL9A 4OV6A 1T03B 3K8VA 1QSYA 3Q8YA 2ZM6F 4ED1A 4K0KJ 1VK8A 3LA0A 3HVAA 2BOAA 4TYAA 4DQQA 1KFSA 1RTIA 2YQ3A 1CVJA 4DU8A 3QYYA 1ZTTA 4AYBD 1DTTA 1LK7A 9RUBA 2E29A 4B9NA 5LXRA 4I6WA 3PDNA 4UF4A 2QA1A 1TAUA 2J8AA 4EO8A 5LMUJ 4QCLA 2OTJS 2XSJA 3UCGA 3RB4A 4J37A 3DGPA 1RT5A 3DI6B 4A48A 1JLGA 2HNZB 2NSBA 3PEHA 4F4AA 2RS8A 3CMAS 3CC7S 1SUQB 3FDSA 3FRZA 3J81Y 3VHQA 1BD6A 1Q8KA 6FD1A 3I55S 3RRHA 2E9TA 3IRXA 1L3VA 5ETPA 4PR6A 4YMEA 1VBYA 1UFLA 1SV5B 1FKPA 2C22A 1Q81T 5B0BA 1QUVA 2FLOA 3HI9A 1UVJA 3C19A 2DJWA 4OZ0A 3NRBA 4USVA 3C15A 4CNZA 4ZP7A 1UPMB 3GCWP 2E9ZA 4QW9A 3TANA 4P2SA 4JI2J 2H54B 4P52A 4DPWA 3TI0A 1Q7LB 3QFWA 4KE5A 4DSIA 3QRPA 4EZ9A 1TUWA 4CLWA 1T02A 2YKOA 4LF7J 5A8WA 1TL1B 3ZFVA 3W64A 1VIOA 1ZTWA 3GSIA 1Q8BA 4CM0A 4CDIA 3KUGA 1FNMA 1ROFA 1FD2A 3HHLB 3IP0A 4IFVB 1RXOB 5KFLA 4TN2A 1RT1B 2IVFB 4X66F 4N76A 1U25A 1YG0A 4RW8A 1EP4A 1WC6A 3AHPA 2OTLS 1VQLS 4LFCJ 3WX8A 4A47A 2RMLA 3BEGB 4HT5A 1NCLA 2P9EA 4ZJOA 2I8EA 5JXSA 3BDPA 1YIJS 4QIGA 2A2CA 3HXMA 1P1TA 1VIXA 2KI2A 2QV6A 2XWYA 1V3SA 2ZOGA 4WK3A 1WKLA 4RLEA 1CS4A 5A0YB 3RAXA 3MR5A 1V5IB 1QJHA 2VPZB 3I32A 2IM1A 4KKOA 5ETRA 4ZLJA 2MSSA 1GEHA 1WSVA 4ILMA 1HBUB 2UXDJ 1LW0B 3CDAA 2EFNA 2XMAA 1U48A 2PDAA 4QIFA 3G87A 1DARA 4EK2A 5HMWA 4ZPBA 2IYIA 2AX1A 1F2HA 4XPEA 3HVWA 1S9EB 2FHOB 3AAWB 4RZRA 4ID5B 4YDDB 1XMQF 3GWCA 3MCOA 1NBEB 3EICA 2FHMA 3ILLA 3KXDA 4WBFA 3TX0A 3NGDA 3TA1A 4CO0A 3W66A 2KFYA 1JKHB 4DV7F 1NDKA 4USTA 3LQVA 1S0NA 2EFPA 3VAKA 2Z58B 4HACB 2AT1B 2WONB 5BXIA 1N54B 4WU2A 2R7QA 3M2UA 5J2QA 4DDFA 3A1YG 4HI1A 5B0EA 1NJZA 3QT7A 4JV5F 5GAHI 1NKBA 3LP0A 3R7NB 4NLXA 4LF6F 5LMNJ 4OJGA 2VICA 3BGFA 2MQOA 4ED5A 3DOKB 4ILRA 5T41A 4B3RF 1S72S 3L95X 3UVJA 1PYOB 1LWEB 1Q4RA 4DV6F 1N34F 4NRUA 1R3NA 2B4VA 3IS9A 5F8IA 3Q24A 4NA2A 1DQ9A 2F4VJ 2BQUA 1I1GA 1FESA 4Z2XA 4RNOA 4I69A 2IMOA 3RW6A 3BO2A 2A6MA 2UUBF 2P2CB 2ZHOA 2CNLB 3QO9B 1RTZA 2HWHA 1IM4A 3L7UA 3ENVA 4OYPA 1FE4A 4DFKA 4DR7F 1YJVA 4YS2A 3ILIA 1DAXA 3UVJB 2VQFF 2OH2A 2AIRB 1VRTA 4DEZA 1R0CB 4WJBA 4LF9J 3VAJA 4ZJQA 2FD2A 1A0OB 3HF5A 4NLOA 3OJUA 1U02A 5J2PB 4TU9A 5CYQA 3FSIA 4UOGA 1CULB 4XIUA 2PA8D 3EMTA 3Q8VA 2GGPA 5E33A 3GIJA 4FS1A 3RB3A 4LFBJ 2GO9A 3NMAA 5H9EK 3VAFA 3SV4A 3QT6A 1HQEA 1RHUB 2AEFA 3HKZD 4A46A 1S76D 3QRRA 3MR2A 3RAQA 2DRBA 1O51A 4K4YA 2E1MC 4ANEA 3M30B 1SC6A 3DOMB 2LEBA 4EBCA 1WNEA 2FZKB 3LOUA 1CC8A 1HWKA 3CCTA 4CLKA 2XS2A 1IXKA 4X64F 1OWXA 3GR1A 4RNMA 2LVWA 1N5YA 3WC2A 2UXDF 1S6UA 1T9WA 1TL5A 5B0CA 2EW9A 5LT5A 1KVKA 2ZWOA 4DR4F 3KJVA 4WU3A 4NLSA 3D3BJ 3W61A 1LFPA 1S7IA 4RW9B 1I3OB 2N3LA 3OTBA 1JLFA 1S99A 4ECUA 2Z2YB 3MMCA 1Y5LB 4C8LA 2HNDA 2EBEA 4NI2B 1GMWD 1U7LA 2WB4A 3H40A 1ZYQA 3P5TL 3M9NB 1O6XA 4DMZA 1QAJA 2CQCA 4DG1A 3CD7A 2GCFA 1IWGA 2HGNA 4DZDA 1FK9B 1FNOA 5L38A 2VHGA 2FJWA 5LJ5Y 3W2WB 3HDSA 2DGXA 3DMJA 2VG5A 1RSCA 3OSNA 4JI4J 2J9DE 2MKYA 4LF8F 2QGFB 5D15A 1HQUB 2DIUA 1QE1A 5KG3A 3ZTRA 5L9NA 1RLDA 3MECB 1YLXA 2VFVA 2CWKA 3OVBA 2UU9F 1HNVA 1AB8A 3OTEA 2H1YA 2AX0A 2F40A 2V8DA 1OYDA 5D4LA 5FDLB 2NPFA 4ECZA 2CDRB 3BF4A 2C3UA 2HFVA 3CB4A 3FMWA 3PHTA 4OZ2A 3N9UC 1S0VA 1REGX 2VL1A 5GAGI 2JLFA 1T9YA 3BQ0A 4NXMF 3BKUA 5T7LA 5F0UA 4DL2A 2FTRA 1BUXA 3TUIC 1YX2A 5A76A 2EI5A 1Q82T 1V5VA 2AMCB 4LRBA 2KFNA 4WTYA 3PO5A 2DCUB 2V4QA 4LF5J 1D9FA 1S9EA 1YJWS 2LMIA 1NZAA 2UUBJ 3SSRA 1VJWA 2RVJA 5CYQB 4PPZA 1F0XA 1CBKA 4JI8F 3NNAA 2DNYA 4FYVB 4PCQA 2ZITA 3K5MA 3IWLA 4DF8A 3RYLA 4Y28C 3W62A 1UVIA 2CG8A 3TWZA 2AEJA 4K4TA 4L75A 2GGPB 2J7UA 1U45A 2HLTA 3JQJA 2VA2A 4CCHA 2DHSA 3HPOA 3W3SA 3OXLA 3MMCB 2UVUA 1CS4B 5A0YA 1JLQA 3S01A 2MLYA 3KWMA 5KFXA 5KOWA 4URQU 3T1YF 4HDGA 3RU0A 3UNGC 2KDOA 1K47A 2RJZA 3DLKA 4W4MA 4Q43A 2YKMA 2IM0A 4BHQA 3LWMA 5MLCV 3TAMA 2UP1A 3GSDA 5HJYA 2DB1A 4GVLA 3CT9A 2ZH7A 3J80Y 6FDRA 4DL7A 2CQGA 3PIOQ 4CH1A 1RADB 4ZN3A 4OHYA 1TL7B 2K8GA 3PJWA 1UP1A 2BMBA 2C2OB 2VIHA 1KBRA 1BWEA 2AJQA 1JJHA 3ILJA 5DQHA 2FJBB 1FJ7A 2DGSA 3MD1A 1TV6B 1YVFA 2V8VA 1KTVA 4NLTA 2HLUA 4ES2A 5CA5A 3GIIA 4NRTA 1U1PA 2OAUA 3KG0A 1Q53A 2HNDB 4NI2A 2VU5A 4YDXA 4O4GB 4U7UK 5J1EB 4CWBA 3E2EA 2VA3A 4AL5A 2G1DA 5SZTA 4OYIA 3G86A 2GIQA 4K4VA 3HP6A 2MZTA 1C0TB 2NXNA 1YJTA 2VFSA 4RUHA 3IGVA 5L8RC 3W2VA 2JEIA 1IVZA 4Q7AA 2ZC3A 2EWHA 4OX6A 1B0VA 2XYGB 2O67A 3KHLA 3HLUA 1M5SA 2G0CA 1SKRA 5BYRA 2J0SD 3CDWA 4O3QA 4BC9A 4LFCF 2KJVA 4FKYA 2KRBA 4U7UD 3GILA 1LXNA 4ZVEA 3DDIA 4YR2A 3K8WA 5EDWA 2OMLA 1A7GE 2XMTA 3GZ7A 3MAAA 3MHYA 4OJ3A 3W5YA 3RB6A 2GAHC 2ASLA 4P7VA 2YX7A 1RYSA 4KGVB 3W7BA 1QUPA 3N28A 3VALA 1U2FA 3B6BA 3NL0A 4F4YA 2YKPA 4EU0A 4B3SF 4DQIA 3W9JA 3E3XA 1TVRB 2H5JB 3H98A 2A6OA 4C8YA 4X4OA 1H6KX 2ILZA 2DY1A 3G82B 2QC3A 3IAS9 1MNEA 2DHGA 3MAHA 2W4CA 7FD1A 3ISZA 4TLRA 3MM8A 4LR9A 4KFBA 1VR6A 1UEKA 4F67A 1U2CA 4A4JA 1XMQJ 2FHJD 5HAOA 1KDNA 1U0SA 1KS2A 1JB0C 1F5AA 1N5QA 2DGUA 1W25A 1WKJA 1R89A 1XN9A 2AZ1A 2RDDA 3M2RA 2LU2A 3OBIA 1KQFB 4OJHA 4ENOA 5JJBA 1ZOTA 3HM9A 2ZFHA 1BXNA 2DNRA 3K57A 3R1HA 4C4WA 2KKHA 1NNDA 5HROA 3ILOA 1QSSA 1TMMA 3BGRA 1CQMA 2YNIA 3GQCA 2PI4A 2W25A 4LF4F 1IR1A 4DFJA 1B3TA 3P6YC 1K1SA 1SIWB 1QM9A 2WTFA 3MMBA 2WOMA 3SDEA 4I2PB 4YY3F 4DV3F 3H5XA 2XY6A 1KVIA 4DWIA 2DKOB 3D1HA 3OL7A 1RT6A 3M8QB 4G65A 1S6OA 3IR7B 2DD8S 5GVQA 1WDTA 4QPXA 2QLBB 3L4BC 3AQOA 3OHAA 5L1IA 4KQZA 3CMES 3MTJA 3BO3A 2CQ4A 2DRDA 1MMNA 4RW9A 2F8EX 2V4RA 3QZ8A 1IBKF 4Y0FA 3HULA 5I3UB 4ILLA 1YDLA 2YTCA 3TZYA 1NB7A 4F3OA 4WKRA 4LBHA 3TJ8A 2I1RA 3CJ8A 2GQCA 5HVFA 2XO7A 1HHSA 1FRXA 2MZRA 1GXUA 4J9VA 4NASA 1NSKL 4O0NA 4RW7B 3V4MA 3VR1A 5AE1A 1OPIA 3KHRA 1F3FA 2K7KA 1A9NB 5E3AA 2FJVA 1GTEA 1YJUA 2M0GB 4R5PA 4KT0C 4DR7J 5DDQC 2BKNA 1WF2A 1EETA 2P6TA 2KG1A 4C8ZA 1S1XA 1NK9A 2ZUGA 2B4OA 2VH7A 2Z4PA 4DV0F 4HH0A 4C8NA 3RZAA 4HLBA 4J9UE 2D1CA 3QWUA 3TVZA 1DFDA 4JI7F 2OD4A 4FXDA 3M8WA 4H4KA 3K5LA 5KFYA 1NDCA 1TZ0A 4RJVA 5J2NB 1RWPB 1FO1A 4QWCA 1NHUA 3BH6B 1S97A 4X4TA 2F63A 1RTDA 2YH0A 3TARA 4OYAA 2QE5A 1X9MA 3RJMB 3MWBA 2IAJB 2J0WA 3KHGA 3DNCA 2KRRA 2YNHA 2KHCA 2MSTA 5A2QY 1KD1T 2QA4S 4X62F 1Q5YA 5C42B 4JI3F 4N5SA 1X4FA 2AGPA 3QIDA 4Q8FA 5M2UA 2V8GA 2ZKTA 1H2TZ 3RW7A 1VISA 1XMBA 3IBCB 1X7VA 4ZPCA 1R31A 1U1MA 1IBMJ 4KRWA 2QA2A 2OPRB 2RHQB 2EC2A 2VG7B 3A8EA 3G6VA 1XNQF 2F4FA 4PUOB 2OPPB 4JB8B 4ZDNA 1FWKA 1LWFB 3L3CA 2EEYA 4OYBA 3ENWA 5KFVA 5A6PA 1XNRF 2IY5B 2QT7A 1RLCL 2D9OA 2DXDA 4LFAJ 3RBZA 2G2ZA 3JQMA 3N0VA 1CQNA 3AQPA 4NYZA 3T1HJ 4ID5A 2VB6A 2E5LF 3ZC4A 2BA9A 4CO5A 4ZPDA 3H8YA 1FKOA 2LQBA 2ZD1A 2RKIA 5HVHA 1HWJA 4JI8J 2GV1A 4IRCA 3LP1B 4USHA 2R3VA 1HQEB 5E7OB 1GQEA 3VV2B 2FLNA 5ETKA 1J5OA 1DLOA 1IBLJ 3HHEA 3LUYA 1SUQA 5KT5A 3Q89A 2PD1A 2XYPB 4DV1F 1Y4ZB 3H2VE 3D6FB 1RK8A 4O3PA 1RWWB 4CO4A 3CWJA 3JAMU 3V6DB 4AL7A 3D0HE 4I56A 3UD5A 3GV7B 3CULA 2E5GA 1WEZA 1FDBA 1JLBA 1SJRA 2EFGA 3A8JA 3VCDA 2IRXA 3DRXA 4Q0BA 3HFKA 2IA6A 5IT9Y 1SIZA 3EVOA 2RF2A 1N34J 5H9FK 1KKHA 3AA9A 2CIMA 5EWEA 2LLZA 1MG7A 2L9NA 3P96A 3NCQA 4L73A 3PR4A 4F4KA 3CJSA 2Q79A 1H3DA 3POTA 4DN9A 5IS2A 3LGHA 5ETVA 5KFDA 3CCRS 2IBKA 1U6BA 2CNOB 3K5OA 4ZPVR 5H9FJ 4QOTA 1PILA 2BEFA 3GR0A 4PWDB 1FJCA 5CD4H 4UOCA 4KFBB 5K5MA 1WEXA 3DLKB 4R0EA 1LKZA 4PG5A 2AGQA 2AGOA 4RU9A 3W1YC 1P6TA 4HHUA 4TNOA 1FK9A 3FQLA 4WYLA 4OI1A 5E41A 5HP1B 3KJNB 2MGZA 4JI2F 4L3KA 5HMXA 2DXFA 4YHHF 3D1OA 2FJEB 3MPYA 1DQAA 2XC9A 2HWIA 1VJQA 4QIWD 1D9DA 1FRKA 4AE5A 4EUVA 2V4JB 1HA1A 2XWXA 4A8WA 1FX4A 4HYKA 1ZS6A 3ZZZA 1PCAA 1FVSA 3H2UB 2C2MB 2M3DA 3M32A 4ER8A 2MQ8A 5L39A 1MWQA 1N33J 4FYWB 2QA4G 4P72A 1WI6A 4CLLA 1Y3KA 1RHRB 1RAIB 1JLGB 2SXLA 4M5LA 3TZXA 3A8IA 5THWA 2GZOA 5KFCA 3M9MB 3CCUS 4A8QA 4IYQA 3MM5B 4TYBA 1BMQB 1I6JA 3PY8A 3MEDB 1QY7A 3G2XA 4Z7YA 5FLXY 2BJ7A 2BRLA 2HGMA 5IC4B 4NZ6A 4CI0B 5IQ6A 2LXIA 3W2VB 5LSRA 1Q1KA 1N32J 5JVHQ 4Q0BB 3M2RB 4PXCA 4ZK7M 1SH2A 4MFBB 4RBUA 3LO3A 1PKUA 2N82B 3PFEA 3T5KA 2ZH8A 2R7RA 2FC8A 3K5PA 2GO8A 3QGPA 4DZ6A 4B9SA 2P5VA 4IOBA 1NUEA 2RQ4A 1BLUA 2FJAB 4BWMA 2XZWA 4P74A 1GAOA 3ELHA 5B0AA 2W9CA 4LSZB 1VQ7S 1PO6A 1SL2A 2A1BA 1FXRA 3FBFA 3RB0A 4JI6F 3CE8A 3JTPA 1M0SA 4ZP8A 3MR3A 4ZIVA 2DNKA 4I2PA 3TA0A 1H72C 2KM8C 4JI3J 1GNKA 1VBKA 3IG1A 4JUZA 1UA0A 2BE2B 4S0MA 2HZCA 5DRKA 1NK0A 1YTYA 3EX7B 4DUYJ 1X4BA 2RILA 3HHLA 2VG6B 2CG4A 5K20B 2HQ3A 1HNXF 1FD8A 4O0IA 1VOMA 4LIRA 4OX8A 4PRFA 4LRFA 1RT7B 2R8KA 2CQ2A 1XJWB 4AXJA 2DR5A 4ANDA 1S1UA 1RWXB 2BM0A 2QX0A 4C3KA 4JI7J 2X7IA 3O1LA 4P73A 1OYEA 5HSPA 2VJUA 4C9DA 4UTGA 3PR5B 1G1XA 1RWVB 3V6KA 1UWBA 2C2RA 4NXNF 4TY9A 4A8SA 2D3O1 1BQXA 2V0NA 2QJ3A 3PO4A 2DNNA 3LP1A 4CLTA 1TP7A 1JX4A 5KFHA 4KJIA 1DHMA 3FEXB 3DHWC 4X65J 2BVZA 1GK8A 1PBUA 4HEA9 2B7CB 2CQBA 4W90B 4E8UA 3S8SA 1GXTA 1DTQB 1X31C 2G13A 2EK6A 2EK1A 1XTZA 2B9EA 2JZ5A 3N4WA 4NYPA 4C48A 4Q45A 3PW7A 3ITHB 4NCGA 3FSXA 2JVRA 1YZ7A 3UO0A 2MHEA 3OPKA 3VVTA 3C46A 1KVJA 1RAEB 4WXOA 2HQIA 3CDEA 1R8AA 1NPKA 4MJKA 2E1AA 5D6GA 1UMJA 3SCJE 1XR6A 1XWLA 2HS3A 1S10A 2JEGA 5BYQA 3RUBL 4ECSA 1NJYA 3PXGa 1MWYA 1NZ8A 1PJ7A 3THTA 3W60A 4GC7A 3V81B 3FFIB 2FVRA 1S6QA 2CQ0A 5EX3A 2FLPA 4OX7A 1MROA 1EJ7L 1YJ9S 2BOPA 1Y9OA 1WG5A 2K3IA 2HVEA 2ZDPA 4WZMA 3O6QA 4P7TA 4ZPTR 4C2MA 2YKMB 4F4XA 2CJKA 4IH7A 3JAMY 3CJQA 1URNA 3FBBA 2D3UA 4DPYA 2M4MA 2JSXA 1QAXA 1SQFA 2R7OA 4QIEA 2XM3A 2W9CB 5EN1A 1ZPWX 2IHR1 3D0GE 4N8NA 1VC5A 1CJUB 1AXQA 4F26A 5IZHA 4UZBA 3JQKA 4WIQA 4PWUA 2C3MA 4J9PA 3VGUA 4J7CA 4B9MA 3HHNB 1RT6B 4M5KA 1APSA 3V4IB 1TTHB 3EGVA 4ZCMA 4K5SA 5F3TA 4DF4A 2IC3A 3MEGB 2Q1LA 4USJC 4K8RA 3O8WA 5AXMA 1V3RA 2YNIB 3PYDA 3QNWB 1Y3JA 4WFYA 4ICLA 1VGYA 1WKKA 5HQ8A 5H1SV 5DQGA 2J0QD 4PQAA 3UD4P 3JS9A 3IM8A 4CNYA 5JUMA 4G6VB 4IG3B 4M63A 3HD1A 1IN0A 3SSSA 5CD4A 5L1LA 3CD6S 3TUJC 1GMWA 4QR2A 2W2PP 4IO9Q 3SI8A 2OMOA 1XIQA 2ASJA 2K1RA 1K73T 2GVDB 2F9DA 1URRA 3E01A 5KFPA 1BC6A 3V4IA 2WRMA 2XS5A 3UDLA 1OIAA 3CD0A 1BQMA 1RABB 3GIRA 3LW5C 3PFOA 3SCKE 3TZZA 2VUGA 3MMAA 1X5TA 3B8HA 4UUWA 4CM2A 1N36J 4V19X 1W2BR 1KSPA 3M6XA 5B0FA 1VQOS 4GVBB 1CJKB 2JEJA 4V1Ak 4JI0F 5G0RA 3CJ4A 3SCIE 2D69A 2X1AA 4J5OA 5IV4A 2C2NA 3CO0P 3LTOA 3TW0A 1FFSB 1UFKA 3M2VB 2B9YA 2CWXA 4GMKA 5IM0B 3KK3B 1S1XB 3MCNA 1DJ0A 3NY0A 4CT8A 2LECA 1EETB 1S6QB 1NRKA 4DV5J 2KYXA 4Y00A 1QVFR 2KVIA 1S59A 4TKTA 3EGZA 2IRUA 2MKSA 1Q8LA 2AD9A 2J8SA 4DL3A 2RH3A 1LOUA 5F9NA 3CJTA 1N5TA 4Y2IA 2HSEB 3I5AA 2D74B 4AUKA 1N5VA 1N6QB 3US5A 4DR5J 3BGOP 2ROGA 2W9AA 2Y8WA 2DGQA 1FWLA 2E1PA 4PXDA 1TUGB 1T3OA 1Y11A 3SFUA 1U24A 4A8YA 2CQ3A 3WHIA 1FNXH 1J2VA 4C11A 3HJVA 2EXUA 1YJRA 5KG4A 4ALZA 1IKXA 1RHQB 2M9KA 3IGNA 5DLGA 3OTCA 2GVDA 2BYCA 4HDHA 2WBRA 2D41A 1L3TA 3MXHP 3Q0AA 3CCES 1UAWA 2MQLA 2QYGA 2XTJP 3IBWA 4TQRA 2GNKA 4DOZA 4CLYA 1YBAA 3T6BA 2DVIA 2WVDA 3OXFA 1RAJA 1D09B 3TJAA 4BLGA 3HT0A 3KFWX 3NNHA 2ZKUA 2JJ4D 4ZVTB 5C24A 4LSNA 1P9QC 1QDUB 3U7JA 2HHSA 2R2UA 2BACA 3FGVA 4M5DB 1X4CA 3Q83A 3R5BA 1NK6A 4HL9A 3J7YU 2OIHA 2AV5A 5AJ3F 4RL1A 1RKIA 4USMA 3Q22A 3ISND 2G2OA 3BYPA 3MUVP 1UEUA 2B8QA 1S4FA 4X2BA 4UOHA 1NSPA 1NU4A 1FVQA 1Q0NA 4DX8H 5LMNF 2R8GA 1MU2B 4YP3A 1C0UA 3G8QA 2WW8A 3BSOA 2C3YA 2R8IA 1LW2B 2ZVSA 2J76E 4GVBA 1BGXT 1TELA 2OEKA 1SKSA 4I7FB 1RISA
chains in the Genus database with same CATH topology
4ZN1A 4ZN3A 3P8BB 3EWGA 3LPEA 1M1GA 2XHCA 2K06A 3H7HB 2OUGA 1NPRA 1NPPA 2EXUA 2LQ8A 3QQCD 1M1HA 1NZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZN1 A;  4ZN3 A;  3P8B B;  3EWG A;  3LPE A;  1M1G A;  2XHC A;  2K06 A;  3H7H B;  2OUG A;  1NPR A;  1NPP A;  2EXU A;  2LQ8 A;  3QQC D;  1M1H A;  1NZ8 A; 
#chains in the Genus database with same CATH topology
 2BRK A;  1KWM A;  3MUM P;  4OZN A;  1FXL A;  4OI6 A;  1HW9 A;  3CUN A;  1NJX A;  2DHA A;  3KDN A;  1E6V A;  2NZC A;  1RAC B;  3DN9 A;  1TL7 A;  3CCM S;  3WDO A;  3VAI A;  3BR8 A;  5MAO A;  2Y3Y A;  2Z57 B;  5EGY A;  4KC5 A;  3FQK A;  5RUB A;  4J9R A;  1L3K A;  4NLQ A;  4WZQ A;  2E66 A;  4HHH A;  4FF1 A;  4UUX A;  2A18 A;  2OFH X;  2E7V A;  3M2V A;  4M94 A;  4NCB A;  3EM1 A;  4NLY A;  2P6S A;  1KNZ A;  2HFS A;  3NMR A;  5IC6 B;  2CDQ A;  1IJF B;  3UR3 C;  2O3D A;  3NOG A;  2MJU A;  3U1M A;  5M2P A;  5F8L A;  2AYG A;  3EVW A;  2KL8 A;  1CLF A;  2WBM A;  2J6U A;  4DHV A;  1YJ7 A;  5J2M B;  1Z2L A;  4KV8 A;  2B43 A;  3NGT A;  4B9L A;  4MTP A;  4ZPW R;  1FDD A;  1FEE A;  3I0S A;  2QMX A;  3ZZY A;  1X4A A;  4ZLN A;  1M5V C;  1S5Z A;  2CYY A;  5H9E J;  2KU7 A;  4OZJ A;  1U2R A;  2R4F A;  4WFX A;  3SXL A;  5KFO A;  4JI0 J;  2PFF B;  4OYO A;  1GTH A;  2HQC A;  3JSY A;  1F60 B;  3SIP B;  3DLH A;  4C11 B;  1KON A;  1HBM A;  3W8P A;  3I9V 9;  5HAT A;  3ONQ A;  2HQD A;  4L76 A;  3RRG A;  2BJ3 A;  4FYY B;  3M8Q A;  3PW5 A;  3CCL S;  1VI7 A;  5EX0 A;  1YRT A;  2ZOF A;  5AXL A;  2H4Y B;  4ANC A;  4ED8 A;  5DM6 Q;  3LGN A;  2CQP A;  3OR2 A;  3FBE A;  3JTN A;  5DJB A;  1N52 B;  2FHJ A;  2FC9 A;  4M5D A;  1REV A;  5BR8 F;  1VHI A;  2K3K A;  1YIT S;  3DFE A;  1JWW A;  2OEL A;  1R8B A;  3I4P A;  5GAD U;  1E6V B;  1U6F A;  2MXY A;  3TAM B;  4FBT A;  1RB0 A;  1PAE X;  1BHN A;  2R9L A;  2HK3 A;  5D3G B;  2GFF A;  4NML A;  1VQP S;  2QEX S;  5ETT A;  4F0K A;  2DO0 A;  2JH3 A;  2NZ4 A;  1HAR A;  2ZBP A;  3G82 A;  1CC7 A;  5K14 A;  2UV8 A;  3D66 A;  1ARO P;  3UCZ P;  2YX4 A;  5IV3 A;  1UCN A;  4B9V A;  1MW7 A;  5L46 A;  3QAE A;  2ZBR A;  4RPF A;  4QR1 A;  4C0B A;  4DV2 J;  4CO2 A;  4I6Y A;  3J7Z 5;  2K1R B;  2W2O P;  3ZZP A;  2J6T A;  2L48 A;  4ZHR B;  1VQM S;  4EI2 A;  2OPS B;  4OZ5 A;  2YKN B;  4ZPA A;  3W8G A;  4QWD A;  3BQ1 A;  1HYS B;  1RBA A;  1LNQ A;  5E5N A;  5FD1 A;  3MM6 B;  1Z1Z A;  3BM7 A;  1U8W A;  1NSQ A;  4YFU A;  1WTB A;  2LDY A;  2IBO A;  2AZ3 A;  3VVU A;  4ATN A;  4PAA A;  1TFW A;  4GKJ F;  3CNQ P;  4I4B A;  5AE3 A;  2RSQ A;  3A13 A;  2HVI A;  1R8C A;  4DCP B;  1RAO A;  1SC3 B;  1V3Z A;  3B54 A;  4FYX B;  1F2G A;  2NLW A;  4WFZ A;  1TUV A;  2H65 B;  1OY9 A;  1ZZF A;  2EBG A;  3W5X A;  3Q2S C;  4CT9 A;  5F8M A;  4DV2 F;  4F50 A;  3M32 B;  1R0A B;  1NK4 A;  4LFA F;  3CIM A;  4RWX A;  2VDH A;  1T11 A;  2WVF A;  1K9M T;  1Q5V A;  1X4H A;  2A10 A;  1AZS A;  3LAL A;  4DSK A;  4M95 A;  4RO0 A;  1IR0 A;  2V68 A;  1Y00 A;  4X4Q A;  3EPI A;  2GA7 A;  1QLN A;  2HIY A;  1G2E A;  1RT3 B;  2V69 A;  2VOD A;  4DUZ J;  4FVM A;  3BR9 A;  2ZEJ A;  3NG8 A;  3VWS A;  2CVE A;  1LQ9 A;  2YNG B;  4ZOS A;  2DY9 A;  1TKT B;  2MY8 A;  2NYH A;  5KFQ A;  4I7F A;  4DFP A;  3MM7 B;  3CJ0 A;  4MYT A;  1TAQ A;  2KXH A;  2M52 A;  5GAE U;  4NYO A;  4OHV A;  4OHZ A;  1B99 A;  1RDR A;  3G6E S;  3I5C A;  4ZVQ B;  4FS2 A;  1X8D A;  2BJE A;  1CJT A;  3D67 A;  3GLJ A;  4I64 A;  4WKY A;  1HR0 F;  3UFC X;  2V8H A;  2XSF A;  3FCH A;  4PG4 A;  5KG1 A;  4RU2 A;  1PBA A;  4MAK A;  2MKK A;  2CPI A;  4KGZ B;  4KYZ A;  2M7S A;  4GKK F;  2CNN B;  2X3G A;  1PIE A;  3K2Y A;  1TL1 A;  2Z0G A;  1KEK A;  1NXI A;  1WHW A;  2GS8 A;  4PG8 A;  3KJV B;  2HVH A;  3KMS A;  1HLW A;  2VFT A;  3DU6 A;  3X3U A;  4K7Q A;  4BBY A;  1K1Q A;  2BW7 A;  1X4E A;  1JLB B;  1RTJ B;  3D9B A;  2HHV A;  3CJ5 A;  3L9Z A;  3MPD A;  4HKQ A;  1IUJ A;  4XAK A;  4O3S A;  1X5S A;  2P9G A;  3LAM A;  1I5O B;  1XR5 A;  3H2L A;  3NKY A;  4N7T A;  2OGU A;  1W26 A;  4X66 J;  2NPI A;  5JVG Q;  3BGU A;  4UY8 T;  4U95 A;  1M1G A;  4OHX A;  2J6S A;  2B6A B;  3TVY A;  3C2P A;  2DPJ A;  3HCX A;  3WIU A;  3UDC A;  3BZQ A;  3V6J A;  1S0M A;  4DR1 F;  2RUS A;  3W5Z A;  3KLI A;  1EB0 A;  2PN6 A;  2VAS A;  5DS7 A;  5KG6 A;  3DGP B;  4TY8 B;  3DM2 B;  2PC6 A;  1M5O C;  2XSJ B;  1IBK J;  2YQ1 A;  2AF6 A;  2PII A;  4W98 A;  3D68 A;  1UVL A;  1AT1 B;  4EGL A;  3KHH A;  2IIH A;  1UEV A;  2PT0 A;  4Z7C A;  4PUO A;  2BM1 A;  3HT3 A;  4JV2 A;  4ETZ A;  5D4N A;  3SQO P;  2B9X A;  2ZNZ A;  3OSP A;  1N56 A;  4WFN Q;  2AP6 A;  3DLB A;  5G4D A;  2ZBQ A;  1N4L A;  4DPX A;  4LRC A;  2Q6C A;  1EKR A;  4OZ1 A;  3KK3 A;  4X65 F;  3NS6 A;  2XHC A;  1QAY A;  3K59 A;  1AFI A;  4WCE Q;  1WSR A;  2XGP A;  4MKV A;  1HNW F;  2BXJ A;  3UN3 A;  1X4D A;  2J9D A;  2QLW A;  2LQ5 A;  1ZM2 A;  1CJU A;  2Z30 B;  2DT9 A;  2HUR A;  2MHN A;  3J7Y I;  3ETM A;  4OYM A;  2BJ8 A;  4FP9 A;  1UET A;  4M5H A;  4YB6 A;  2RRA A;  4ZVG A;  3AD9 C;  3H90 A;  3A12 A;  1NDP A;  2BE9 B;  2W1B A;  3BBC A;  5CZX A;  1I51 B;  3M7V A;  4J9Q A;  1XMO F;  3JYT A;  1RJJ A;  1JXV A;  2VF3 A;  1B0T A;  1EP4 B;  2AW0 A;  1P8G A;  2LDI A;  2BV3 A;  4PG7 A;  3QSI A;  4CLZ A;  3P49 B;  3ZXW A;  5KT6 A;  1I94 J;  2XLI A;  5C2G A;  3N79 A;  5CHC B;  4DUY F;  4NXM J;  4LFB F;  1QD1 A;  2WON A;  2QYC A;  2XI2 A;  2Z2M A;  3POT B;  4ZA1 A;  3OL6 A;  1L5U A;  1VQ8 S;  1NKC A;  3PRB A;  3WBZ A;  4C8M A;  1X5O A;  3TUP A;  1E6Y A;  1RQ0 A;  3THV A;  1DBD A;  2B4P A;  3O2I A;  4CO1 A;  2RDJ A;  1OPZ A;  3VAM A;  4IQX A;  2ZVI A;  2Z56 B;  1SVD A;  1TL3 A;  2P9C A;  4O44 B;  5C24 B;  4EWT A;  2HS0 A;  1TK5 A;  3GFY A;  1HHT P;  1KRP A;  3Q2T C;  4QWA A;  4KTQ A;  1FRJ A;  1W2I A;  3FKB A;  3AB4 B;  2HFO A;  2V2V A;  3BPS P;  4OI4 A;  4UT4 A;  1VCT A;  2XZD B;  3QJJ A;  2NRE A;  1J5E J;  4OZL A;  1JMT A;  1HBN A;  1KP6 A;  2ZC4 A;  5J2P A;  3BH7 B;  2B6A A;  3ZNJ 1;  4IOC Q;  4ED4 A;  4KPY A;  4IOA Q;  1IKX B;  2WK4 A;  1UWB B;  2W4D A;  3ENA A;  2Y1I A;  3JB9 k;  2G4B A;  1RCX B;  3CVK A;  3AT1 B;  2I5J A;  3CTR A;  3GFH A;  3HSG A;  2JFK A;  3MM9 A;  3NCR A;  2YNF B;  1DUR A;  1UJ5 A;  2JFD A;  4KKO B;  2QMW A;  2XMM A;  5K14 B;  2VC0 A;  4O44 A;  4RNF A;  2NXC A;  4K4X A;  4H4O B;  2R7V A;  2M8H A;  2CPE A;  1ITP A;  4G3I A;  2AHO B;  1RT4 A;  2HVD A;  1F9E B;  2WB1 D;  3PVX A;  1NHK L;  3QSY B;  3NBP A;  3DXB A;  3LP2 A;  5ETN A;  3H5Y A;  4N8O A;  2O1P A;  4PQU A;  3CJR A;  1ZH5 A;  2BX6 A;  5D0G A;  1IKV A;  1NEE A;  4Y2A A;  2CFX A;  4ED6 A;  3E51 A;  1VMB A;  3PYE A;  5U47 A;  2W9B B;  1CJT B;  4LF6 J;  2RIJ A;  1XC9 A;  1H0H B;  2MQM A;  3DYA B;  4ZVS B;  1JLA B;  2ZZT A;  1GXL A;  1OSC A;  2WAQ D;  1EQ0 A;  3JSR A;  2OFG X;  4ZP6 A;  3ZZO A;  2GJ2 A;  2VQF J;  2YVS A;  5I3U A;  5CCM A;  4PAB A;  2QLJ B;  1T3N A;  2UVW A;  2I0X A;  3QQC D;  3EZ5 A;  5KFT A;  3KLI B;  2ASD A;  1DQ8 A;  1SJ3 P;  5IXU A;  3IA0 A;  3PHE A;  3HZE A;  2QL7 B;  5K8M A;  2MYF A;  1AZS B;  4X62 J;  3BO4 A;  3QJP A;  5DGB A;  4KGM A;  3OVS A;  2QMU B;  2ROP A;  3GJS B;  3CSK A;  2EG1 A;  3QIP A;  4DX5 A;  4B3O B;  1V9O A;  4K4S A;  3M8Y A;  1RGV A;  3KLF B;  3FMB A;  4P2X A;  2XO6 A;  3R2C J;  1VRT B;  5KTQ A;  4DS4 A;  2VOP A;  2HHX A;  1IBL F;  3OTO J;  3RGI A;  1S49 A;  3QAT A;  2C28 A;  1SKW A;  2DRA A;  2VOO A;  3FK4 A;  3TAP A;  3N5B A;  4DJB A;  4DV1 J;  1IBC B;  2B0G A;  2FGO A;  2UVR A;  3GFZ A;  1DRZ A;  1VQ4 S;  5KFN A;  1OQ3 A;  3BJY A;  3OW2 R;  2OPR A;  3GYG A;  3LF0 A;  2RUG A;  5GME A;  4TY8 A;  1T05 B;  4D3H A;  2BDP A;  3QBC A;  2G0I A;  2VPX B;  3HX9 A;  5KT4 A;  3M1V A;  1T03 A;  6AT1 B;  1OO0 B;  1DTQ A;  3ZTO A;  8RUC A;  1U1Q A;  3VTI A;  1Q7Y T;  4CYU B;  2UUC J;  4WII A;  4DUZ F;  3PW4 A;  1FF2 A;  2J9E A;  3CJK A;  1CSJ A;  1HR0 J;  2ZE2 A;  1UPP A;  4LR7 A;  1JLE B;  3H59 A;  3OFH A;  5E0O A;  4I0W A;  3SFG A;  4LF7 F;  3KMQ A;  1H38 A;  1YJN S;  2UXB F;  2H51 B;  3K58 A;  3H25 A;  1R8P A;  2CAJ A;  3P4U B;  2KT5 A;  5KFZ A;  2UZA A;  2DNL A;  1RAA B;  4Y65 A;  2FY1 A;  2P8I A;  1X0F A;  1AA1 B;  1RT5 B;  3DI6 A;  1IBM F;  4L72 B;  4U67 Q;  2C3P A;  4YR0 A;  1ZET A;  5F9L A;  2JLE A;  4CO3 A;  2WSE C;  5I42 B;  1HL6 A;  1JK9 B;  4P75 A;  4EO6 A;  3PW2 A;  3NBP B;  5E2Q A;  1RT4 B;  2AEM A;  2G0J A;  3ZTP A;  4LIW A;  2AJ4 A;  4LVO P;  4RW4 B;  4RNH A;  1F9H A;  1PC4 A;  2DEI A;  4ED2 A;  1HD1 A;  2R7T A;  4IR1 A;  5HBM B;  2AKW B;  1F1B B;  3R5A A;  2ZBC A;  3FVY A;  4DXL A;  1HHQ A;  3FUY A;  2HMI B;  4X4U A;  5KOX A;  1Y0H A;  1R0B G;  3RR8 A;  5IQQ A;  4XDD A;  3F0N A;  5AT1 B;  4C0O C;  4DLE A;  2F3J A;  2J7W A;  5E3P A;  5L9X A;  2MZJ A;  1J5O B;  3PJX A;  2XMJ A;  2HW3 A;  4NXN J;  3SSQ A;  2OPQ B;  1YI2 S;  4R25 A;  2YWE A;  4QU6 A;  3RAM A;  3T5L A;  4DN0 A;  2AJ1 A;  2G9O A;  3C14 B;  3BQ2 A;  4USU A;  5KAK A;  4MK7 A;  2VFR A;  3NLC A;  4QR0 A;  2RRN A;  4CLS A;  1WOO A;  3M1V B;  5J1P A;  3CF5 Q;  5J2M A;  5B09 A;  2HMI A;  1S77 D;  3G4S S;  2W7O A;  2UVV A;  1V6H A;  5GAG U;  4FF2 A;  5KFI A;  3HZG A;  4L3N A;  3SQG B;  4ECY A;  1RHJ B;  1KLM B;  1YRU A;  4WXW A;  3VGV A;  3MR6 A;  1PYS B;  2BKO A;  2DR6 A;  2WZ1 A;  2UUC F;  4DSJ A;  1RTI B;  2V67 A;  1IQZ A;  1S48 A;  1RBL A;  3O3L A;  4UOF A;  5B0D A;  2VV5 A;  5KFB A;  2DNM A;  5D4P A;  2C2D A;  1N48 A;  5B7W A;  4LVN P;  1K8A T;  3X1L B;  1XR7 A;  4HVZ A;  4OYW A;  5KG7 A;  1VQN S;  3BRE A;  5LJ3 Y;  3C16 B;  2NYI A;  3FEZ A;  2FQQ B;  4PZV A;  3OUY B;  1VYA A;  3PX6 A;  3NS5 A;  1LW0 A;  1HFE L;  5F8H A;  2KYZ A;  3OFF A;  2J7K A;  1TKT A;  1NM2 A;  4ZCI A;  1VRU B;  2BKP A;  3R6L B;  5G0R B;  3GON A;  3K5N A;  3V6D A;  1TVR A;  3C6T A;  4ECV A;  3BBF A;  4DR3 F;  1H2U X;  1FTR A;  1TQL A;  4QYR A;  2DYA A;  4MMO A;  1RAG B;  2A0F B;  3R5C A;  3UR0 A;  3R27 A;  2HHT A;  2CPH A;  3RBD A;  2QFI A;  3PYF A;  4PKD B;  3ADA C;  1FRH A;  4KHM A;  1RI7 A;  3D5M A;  2L41 A;  2W9B A;  1HBN B;  2GQQ A;  4ES1 A;  5IFM A;  2ZH2 A;  1Z2Z A;  2HWT A;  3SV3 A;  3B78 A;  4PYD A;  2YX1 A;  1SKU B;  2H48 B;  3AD7 C;  7AT1 B;  5HL7 Q;  3DRP B;  2CJ9 A;  2JHE A;  3BKF A;  2XLJ A;  3EPG A;  4JV5 J;  4EZ6 A;  2Y9H A;  5A8W B;  3QLH A;  4YOE A;  2NS1 B;  2D7S A;  2HKE A;  3HO1 A;  4CQ1 A;  1O5J A;  1FCA A;  2PI5 A;  3ISN C;  3P3D A;  2E5J A;  1M1H A;  2AYE A;  5IOL A;  5SUH A;  3HJF A;  3GCX P;  1RE1 B;  2KH9 A;  3CGI A;  4CH0 S;  3T5H A;  1FRL A;  3WC0 A;  1U4B A;  1FKP B;  2RE1 A;  2ATC B;  3OD2 A;  3KTQ A;  3AY0 A;  3ETO A;  3QGH A;  4F4Z A;  2B5J A;  2E1R A;  4LRA A;  3I9Z A;  4FKX A;  2VBZ A;  2ASY A;  1EIY B;  1NJW A;  1U1O A;  4USI A;  2XGQ A;  2HNY B;  2HVZ A;  3SBM A;  1OMS A;  3CJ2 A;  3NAI A;  1WHX A;  5IT0 A;  3KOA A;  1KQS R;  1WF1 A;  3HSZ A;  1JXL A;  1R27 B;  2PFD A;  3S7R A;  2RU3 A;  2JEF A;  3BPD A;  4CRJ A;  3PKM A;  5B0G A;  3MDF A;  3UN2 A;  3DRR A;  1BQN A;  3ZZT A;  4EEY A;  2BAN A;  2L9W A;  2VC1 A;  2VD3 A;  1N5S A;  2IJF A;  3K17 A;  1NH7 A;  1H7W A;  2W4P A;  2QO3 A;  4Z37 A;  2FVQ A;  2KT3 A;  3AJD A;  4ZCK A;  5K8N A;  4DL6 A;  3QRQ A;  1WHY A;  2JVO A;  4LBI A;  3MM8 B;  5JMN A;  1RWU A;  2HGL A;  3AH6 A;  3ULH A;  3TEG A;  1QSL A;  2YY3 A;  1OQ6 A;  1GT8 A;  3CCQ S;  2XY7 A;  1TMJ A;  4F02 A;  1S0O A;  3EDQ B;  1VQ6 S;  3L7O A;  3CCV S;  4K4Z A;  4FXW A;  4DR2 F;  5LXY A;  4M5J A;  2B51 A;  2QTW A;  2R2T A;  1C4A A;  2H4W B;  2W2M P;  4CIO A;  2IDE A;  2V50 A;  2W7P A;  3NXZ A;  4LRD A;  1NJI T;  4B9U A;  3S6E A;  4XK8 C;  1YBT A;  1AW0 A;  2BAB A;  4KHP J;  2ADB A;  1G4C A;  3A3P B;  2V63 A;  1T9V A;  3MMB B;  4USK A;  3TX8 A;  3V6H A;  3R5J B;  3SDE B;  1VFJ A;  3T1Y J;  2R7U A;  1JKH A;  4B3M F;  2GJI A;  2QRR A;  5KFF A;  2PMZ D;  4GKJ J;  5CCL A;  1NPP A;  4Q8E A;  2E5I A;  1FDA A;  5CZV A;  3HFV A;  5GAE I;  3UW1 A;  1YK9 A;  4C0H A;  1ZM4 A;  5T7L B;  2Z8Q A;  5EWG A;  1RWO B;  1BWV A;  2IC3 B;  1B64 A;  3MM6 A;  4IH5 A;  4ERD A;  4QPT A;  1FE0 A;  1EAY C;  4DR4 J;  2FJD B;  2RQK A;  1HQU A;  3ZTS A;  2XG8 A;  4M5M A;  3CC2 S;  2XUL A;  5LOQ A;  1MML A;  1P1L A;  2HBQ B;  4NZ0 A;  1TKZ A;  4OJ1 A;  3UWT A;  2L3M A;  5KFA A;  3DOL A;  3M8P A;  2QSF A;  1YGY A;  3EDR B;  3EUN A;  1R6V A;  1D8Z A;  3GU0 A;  4Y2C A;  4EFA C;  4ZIW A;  2Q66 A;  1K0T A;  2I5J B;  1YWX A;  3I5B A;  2KZZ A;  3DOK A;  3M6V A;  5ETL A;  3TR5 A;  3OV7 A;  3QT8 A;  1JLA A;  3M8S A;  1U1N A;  2ABY A;  1RTH A;  4NWB A;  3NWG A;  2BW2 A;  2KJW A;  3NNC A;  2HK2 A;  1C0U B;  2CJY B;  1SH0 A;  2KN4 A;  3QFH A;  4KB7 A;  1WTF A;  2NQP A;  4MYU A;  1S4E A;  4NLR A;  5CYJ A;  3J80 U;  1EKS A;  1S1V A;  3W65 A;  1RT1 A;  2MJN A;  4JV0 A;  4ZCL A;  5ETQ A;  4K59 A;  1VS3 A;  2X1G A;  3DLG A;  4MH8 A;  2F7V A;  2NXU A;  2BAN B;  1TL3 B;  2XMK A;  3IBF B;  4OYX A;  4ZVR B;  1RUS A;  1YRX A;  2DGW A;  4DU7 A;  1IWA A;  3GMG A;  5CYM B;  5C25 A;  4JI4 F;  2B56 A;  1Q79 A;  2DH8 A;  4RW7 A;  3WX4 A;  1FA0 A;  4ELV A;  2ZH4 A;  3PYG A;  2RNE A;  4J9M A;  2M2B A;  3H7H B;  1IR2 A;  1D8Y A;  1HWU A;  1FTC A;  4QWB A;  1HNV B;  2DXE A;  8ATC B;  1S1W B;  2F8M A;  3BKT A;  2NSC A;  2BQ3 A;  5C42 A;  1CUL A;  2XZT B;  2H3E B;  1ACM B;  3BV8 A;  3QGI A;  3KDO A;  4Y6I A;  4NL5 A;  4F0M A;  3I0R A;  4H54 A;  2U2F A;  1HI8 A;  3I87 A;  4KV8 B;  2XQC A;  4ZKA A;  1P27 B;  3L09 A;  2B8P A;  3DDK A;  4A8K A;  4B17 A;  5D4O A;  1LV5 A;  1H73 A;  2CXE A;  5HMZ A;  3DOL B;  4FVC A;  1JJC B;  2H9Z A;  1RP5 A;  2Y1L B;  5FJ4 A;  1B7Y B;  2CPF A;  2EC0 A;  4IG3 A;  1FDN A;  2R2R A;  1R0A A;  4U96 A;  4OL8 A;  3LH2 S;  3BBB A;  2M70 A;  2OO4 A;  4KH1 B;  2VBW A;  4M1K A;  1DTT B;  4HT7 A;  4FN5 A;  8AT1 B;  1D1U A;  2Q3P A;  1X0P A;  4QIV A;  3QO9 A;  1SXL A;  1CJV A;  4P2F A;  4IG0 A;  3EGW B;  1IM6 A;  1W7W A;  1Q8I A;  4I1T A;  2DNO A;  2EKY A;  2EFQ A;  2XCP A;  2XBP A;  5CAA A;  2KM8 B;  2DR7 A;  4NLD A;  3NGS A;  1GMU A;  2WW4 A;  3LPE A;  3BSN A;  1FEH A;  1IKW A;  1TKX A;  4A8O A;  2QL9 B;  3AJ2 A;  3VZH A;  3LAN A;  3IO1 A;  1PAU B;  2C42 A;  3CD5 A;  4OLP A;  3BSA A;  3DCA A;  5D78 A;  5DDR C;  1Q86 T;  4DR6 J;  3DLE A;  3AD8 C;  4P10 A;  1JLC A;  3C6U B;  3OL8 A;  2MY7 A;  1VQ5 S;  2WCX A;  3M8Z A;  4ZVF A;  1ZA1 B;  5HLF A;  3FRY A;  3IR5 B;  3PW0 A;  1ZBT A;  1YKW A;  2RDI A;  2Z2Z A;  2X1F A;  1B0P A;  1RHM B;  1J5E F;  3FZ2 A;  4YB7 A;  1JIH A;  2LQ9 A;  4Y34 A;  1PJ5 A;  1F3V A;  3N5F A;  3Q23 A;  4DR6 F;  2L9D A;  5HI7 A;  2HRU A;  2UV8 G;  3CC4 S;  3B4M A;  1C0T A;  2FZG B;  1VLY A;  2IM3 A;  1VHF A;  2OUG A;  3OTD A;  4RUA A;  3LAK A;  5KFG A;  1HNX J;  1S57 A;  2C2Z B;  3NP5 A;  3F44 A;  4L74 A;  4UQT A;  4XTT A;  3U1L A;  1NDL A;  3KLH A;  1JNZ B;  3R2D J;  1K0V A;  2K2P A;  5A2Q U;  2UU9 J;  3HHL C;  3MEK A;  1M5K C;  2AQ4 A;  3DU5 A;  2QSW A;  1RU2 A;  4WYW A;  4MKA A;  1UZH A;  1ICE B;  4GC6 A;  1FJG F;  2PGC A;  2PEH A;  1KQG B;  1HBU A;  3J81 j;  2VG5 B;  3EGN A;  4LRE A;  2KT2 A;  3FJ2 A;  4DUT A;  4ECR A;  2MDA A;  1NH8 A;  1U1L A;  3KUE A;  4JBC A;  2V9W A;  4DCO B;  1YHQ S;  4DPO A;  1MMD A;  2V94 A;  4EYH B;  1TKZ B;  3KLH B;  1OY8 A;  1JXE A;  4YY3 J;  4MFB A;  4J9O A;  2W8K A;  4H4K C;  4F36 A;  4DV3 J;  1H74 A;  3IMQ J;  3OFE A;  2B3T B;  3I82 A;  1WC4 A;  4IH6 A;  3RG6 A;  3W63 A;  3R1L A;  2R7W A;  3FNN A;  2POK A;  1RU1 A;  2KXN B;  1M5P C;  5FLX U;  1FER A;  3FFI A;  4RX6 A;  3MGJ A;  3RTV A;  3ZNU A;  1UWA A;  1XEZ A;  3IN5 A;  1ZM9 A;  3PTW A;  2VON A;  3DKD A;  1SC1 B;  5DM7 Q;  4P9S A;  1R43 A;  4F4W A;  2DH9 A;  2LYV A;  4NZ7 A;  4G1Q B;  5A8R B;  4WK1 A;  4JYA F;  2ZM6 J;  1UTA A;  5KT3 A;  4NLG A;  1O8B A;  3GV5 B;  1N0U A;  3I0R B;  4NCG B;  3GFX A;  4F7V A;  2BJD A;  4OMF G;  1T9U A;  2I9S A;  2KO1 A;  5C7P A;  1SCJ B;  2CPY A;  1FXD A;  3DLE B;  4KGX B;  4F8R A;  2C3O A;  5DG9 A;  2RQM A;  3R5G A;  3N6M A;  3GIK A;  3KG4 A;  5DDO C;  5A8K B;  2HHH F;  2VFU A;  3GE9 A;  4USW A;  2GJF A;  4CH7 A;  2LCW A;  4M5G A;  2OPQ A;  4I68 A;  1NPR A;  3R6G B;  2Q43 A;  3AA8 A;  3OR1 B;  3GYX B;  4KIA A;  2RS2 A;  5KFK A;  4TU8 A;  2MLZ A;  4MKB A;  3PG9 A;  4RW8 B;  1C1C B;  2M5Y A;  4Y2K A;  3QPI A;  3EXY A;  3CDB A;  1KN6 A;  1R6Y A;  2CQ1 A;  4FNI A;  4GO7 X;  3DDN A;  1PC5 A;  4FXV A;  1GX6 A;  4MT1 A;  3F56 A;  2G1H A;  2F5G A;  2YWF A;  1U1K A;  2KHD A;  1SL0 A;  1QE1 B;  4IFY A;  3G6Y A;  1TR0 A;  2ZHB A;  5FDL A;  5F3Z A;  1SH3 A;  1DY3 A;  4KGK A;  4RBT A;  2OP5 A;  3CIZ A;  4C97 A;  2QLF B;  2QLX A;  3IRW P;  1G7C B;  2APO A;  3IC1 A;  3U1N A;  4KH0 B;  4OI3 A;  5CAB A;  3RBX A;  4CP5 A;  2MGZ B;  2ADC A;  4K2X A;  3O5T B;  4AD6 A;  1D0E A;  4OX9 J;  4X64 J;  3GB0 A;  5KFR A;  1KLN A;  3EE3 A;  1C4C A;  4HR2 A;  1HWL A;  1VQS A;  3AOC A;  4ZN1 A;  3VAG A;  2AU0 A;  1M90 T;  3G9C A;  1KOH A;  2ZUA A;  1RHK B;  1S1T B;  3BB5 A;  3T6J A;  3PZP A;  4PQU B;  3JSM A;  4NLP A;  3TA2 A;  4LSL A;  4RW6 A;  5E3C A;  4X4R A;  1EX8 A;  3CXC R;  4ZLP A;  4WP9 A;  3KLE A;  2Y0B B;  4E0D A;  5LSL A;  5HK4 A;  5DG8 A;  4O3N A;  1G3O A;  3JTO A;  3NGU A;  3HSD A;  2MTL A;  4C8O A;  3H4D A;  1NSA A;  1WWH A;  2X1B A;  3TQ1 A;  3CCJ S;  1S1V B;  3VF0 B;  2XI3 A;  3BN4 A;  4JOU A;  5CH7 B;  1ZZN A;  3UPF A;  4WFB Q;  2DEJ A;  4XO0 A;  2YPZ A;  2FVC A;  4DSL A;  2I38 A;  3L7P A;  3MCS A;  4X4S A;  1CPZ A;  3WZ0 A;  1WC3 A;  3KLG B;  3T41 A;  4NCA A;  1OS5 A;  2LFV A;  4R8U B;  2VDI A;  3DMJ B;  2GQ2 A;  2KFZ A;  4OZ3 A;  1RWM B;  3R9L A;  4LF5 F;  1RWN B;  1LFW A;  1SJ1 A;  4DL4 A;  1T9T A;  3MAQ A;  1WAC A;  2CZV C;  2DH7 A;  4OIX A;  4DS5 A;  1IKW B;  5C2C A;  4PWD A;  4M5N A;  2F9J A;  3THP A;  1HNZ F;  3PKY A;  2HHW A;  1X9W A;  2W7A A;  3H0P A;  2CZ9 A;  4TXS A;  5KG2 A;  1X5P A;  1N6Q A;  4AXI A;  5A6W A;  4DBQ A;  1B4S A;  1BE4 A;  4IQM A;  3FBC A;  1HMV A;  1QVG R;  1X4G A;  2YKA A;  1CG2 A;  1IJE B;  1VC0 A;  3MPW A;  4C6A A;  4U6P A;  3SQG A;  5K9F A;  4J9N A;  3G71 S;  4O3R A;  3HHD A;  1SJF A;  1IKY A;  2I6W A;  3UD3 P;  3HFZ B;  4LUB A;  5ADZ A;  1U47 A;  2O01 C;  2HAI A;  4QU7 A;  1KFD A;  1MU2 A;  4MK8 A;  4NLW A;  2PO4 A;  4Y2M A;  3PX0 A;  2R7S A;  2V6A A;  1SPB P;  3PAC A;  2MKI A;  2CQI A;  4C7Q A;  5KFM A;  4ID8 A;  4QQB A;  3HMJ G;  3DLJ A;  3MTK A;  2GMJ A;  2XHW A;  2CJX B;  4J90 A;  3MUT P;  5BYS A;  4OLO A;  4G1Q A;  1N88 A;  1RCO B;  3D6T B;  3LGM A;  3PCO B;  2MPU A;  5A8R A;  2VG7 A;  2KXF A;  4NX9 A;  4PEO A;  2GVZ A;  1C1C A;  1U26 A;  3H42 A;  5HBM A;  2VQE F;  2ZZM A;  4TVA B;  4CLU A;  2HHP A;  3T9N A;  3TAQ A;  4FYD A;  3OQ2 A;  3G8S A;  2HRY A;  4UQG A;  2ILY A;  3FEY B;  2ZWP A;  2LEA A;  4LQ3 A;  2DHH A;  2M8D B;  2HBZ B;  3IR6 B;  4FF4 A;  3SMZ A;  1LK5 A;  3VQT A;  3IG1 B;  4YHH J;  3M9O B;  5HJX A;  3OVA A;  1OJ4 A;  2BE2 A;  2VBX A;  4N41 A;  2C2K B;  1WEL A;  2DO4 A;  3MPV A;  2FVS A;  4WFA Q;  4G1P A;  3QWP A;  2MZQ A;  3KLV A;  2CQD A;  4RKU C;  2QFJ A;  5AXN A;  3CPW R;  2CAD A;  3A3O B;  5F8G A;  4FBU A;  2FZC B;  3BN7 A;  2UXB J;  2YH1 A;  4DL0 C;  1IKY B;  1UZD A;  2WOM B;  3LP0 B;  5DZ6 A;  1WOP A;  4I67 A;  3C3L A;  4K4U A;  3ENQ A;  3PRD A;  1AUS L;  4W92 B;  4B3T J;  2HAF A;  4U9R A;  3LWL A;  2ZH5 A;  4O4R A;  1JNR B;  5EHH A;  1RTD B;  2B7B B;  4LF2 A;  4ZS6 A;  2LXF A;  4PXB A;  2C2E A;  2KVQ E;  3HKW A;  2DNQ A;  5KFS A;  4B08 A;  1XMO J;  1FI4 A;  2MEW A;  3BYR A;  2IMW P;  4JI1 J;  2OPP A;  1MRO B;  2N4C A;  2X51 A;  3D3C J;  3U27 A;  2JDJ A;  2ZHA A;  2HZV A;  4ICL B;  1N0V C;  5ETO A;  4DPU A;  1RT2 B;  2MKC A;  3VQS A;  2UXC J;  1S12 A;  2CNK B;  3FC9 A;  1RBO B;  2GVZ B;  3M30 A;  4ZVO B;  4N56 A;  3C8Y A;  3T5J A;  1X9S A;  4B3R J;  1NB2 A;  1UFW A;  1ZAW A;  1T9X A;  1GX5 A;  4WWS A;  4U7C A;  3JYT B;  1TKD A;  2HHU A;  2RKI B;  1RZM A;  4NLU A;  1H7X A;  2IAJ A;  3M4X A;  1Q95 G;  4FNH A;  4R8U A;  2DK2 A;  3T9Z A;  4B02 A;  1BQM B;  2E44 A;  3PX4 A;  1UKU A;  4K4W A;  2IJR A;  2YWH A;  3D28 A;  2DNG A;  4DQP A;  3T1H F;  1KC8 T;  2IVY A;  3J7A 1;  1WDD A;  2DIT A;  1YQH A;  1HNI A;  5DDP C;  3UDE A;  3CW2 C;  1SQE A;  4LMZ A;  2U1A A;  3NAH A;  4DX7 A;  1P9Y A;  3BGL A;  1LWF A;  2NXJ A;  3NOC A;  2AWZ A;  4GRS A;  3PV8 A;  4JI5 F;  1QAI A;  3GIM A;  2VG6 A;  5AXK A;  4QWE A;  1UVN A;  4G1I A;  4ES3 A;  2JNJ A;  2CQH A;  4N47 A;  4YB1 P;  2ZOM A;  3TUZ C;  4TLQ A;  2MQQ A;  5IT9 U;  1WEY A;  2IVM A;  2YNH B;  4FZV A;  2ZH1 A;  3DRY A;  3QGG A;  1YSJ A;  4OX9 F;  2PE8 A;  3H5U A;  4KBI A;  5KT2 A;  3BSC A;  1SJ4 P;  4H4O A;  2YNF A;  3R5D A;  4DSF A;  4ELU A;  1T0T V;  1FX2 A;  4LBP A;  1WC5 A;  2HZA A;  2K06 A;  3AFG A;  1U09 A;  4Q2M A;  2EFV A;  1CJK A;  3UI3 A;  5KFW A;  3UN5 A;  1VQK S;  2LU1 A;  4C8K A;  3D1Q A;  1ZAX A;  1LXJ A;  2QIF A;  3VAH A;  2XNR A;  2PMH A;  3HHL D;  4IFY B;  2ZZN A;  1H98 A;  2ZE2 B;  3U02 A;  3IRX B;  1F9F A;  4P2M A;  3OTO F;  1LWX A;  3IXQ A;  3OFG A;  2IA0 A;  3E01 B;  3CCZ A;  4QW8 A;  4WE1 A;  3FZB A;  3IAM 9;  2LQJ A;  2WSC C;  3CDU A;  3MCM A;  4GO5 X;  1RAH B;  4O23 A;  1LWC A;  3QMQ A;  4JYA J;  4R5P B;  5LM7 E;  1ULR A;  4YB5 A;  5F0W A;  3PEJ A;  1S1U B;  2EVZ A;  2E1C A;  4J9K A;  1J27 A;  3MED A;  1MSW D;  3OR1 A;  3B82 A;  1OY6 A;  4J9S A;  4B3T F;  4JI6 J;  5F8N A;  1M1K T;  1JLQ B;  2OPS A;  4NPO A;  4IUF A;  1U6Z A;  3DRP A;  3MI7 X;  3J7A N;  2Y0S D;  3MEG A;  1WD6 A;  1UJ6 A;  4Q5V A;  4LF8 J;  5LL6 d;  1PGZ A;  3RBE A;  2VJV A;  1C2P A;  2D3Z A;  2XLK A;  1HKA A;  1Q78 A;  2GW8 A;  4V19 J;  1RYR A;  4I2Q A;  2EG2 A;  1I94 F;  3KLF A;  3Q8P B;  4MKY A;  2V5H G;  3MUR P;  3QIP B;  2EKN A;  1ZM3 A;  3VZI A;  5IWA F;  2V2Z A;  1JJ4 A;  1Z4U A;  1Y7P A;  4BDP A;  1N32 F;  3MR7 A;  1WOR A;  4XDC A;  4BC7 A;  3ZTQ A;  4IKA A;  4OQJ A;  3AOA A;  3TQE A;  1LW2 A;  1B7F A;  5E3R A;  2OHD A;  3P8B B;  2DPI A;  1UVM A;  2YKQ A;  5D8H B;  2Y1R I;  5HQL A;  3DRS A;  4OV1 A;  2IDL A;  3W9H A;  3D6H B;  1S6P A;  2FLL A;  2JLG A;  2OJ3 A;  4F0H A;  1HI1 A;  2W01 A;  3MMJ A;  1FHT A;  1R7I A;  2KB2 A;  2DNZ A;  3CMQ A;  3OHB A;  1T05 A;  2VKR A;  1L3U A;  1PJ6 A;  4QZV B;  4DFM A;  2Y1J A;  2FVP A;  3PRV A;  1SL1 A;  1KR4 A;  2RB7 A;  2C1E B;  2V34 A;  4DCJ B;  4I6A A;  4RR5 A;  1S1T A;  4RNN A;  2EFO A;  4UZC A;  3KJQ B;  2CRL A;  1ZAV A;  1RA7 A;  5KFU A;  1QTM A;  3OLA A;  3GTY X;  4RBV A;  1A6L A;  2F65 A;  4NA1 A;  2RF2 B;  3V5R A;  1VRQ C;  3D6M B;  2VKZ G;  2OEJ A;  2RRB A;  2HFZ A;  2DNP A;  3UE2 A;  1KTQ A;  3DM2 A;  3GJQ B;  4RUB A;  3OLB A;  5A8K A;  2MLX A;  4OYZ A;  5HQM A;  4EBD A;  3I0S B;  4TQS A;  1TFY A;  1TL4 A;  3KG1 A;  3DLL Q;  5KFJ A;  3M2U B;  5J2Q B;  1D9A A;  1TU0 B;  7FDR A;  2N3O A;  3Q8S B;  3MD3 A;  1TKX B;  4CLF A;  3KLG A;  1C1B A;  1R8H A;  2WHO A;  1FT8 A;  3H5S A;  1KQK A;  5HMY A;  1EZZ B;  2DCL A;  3E8O A;  3H20 A;  3SEO A;  3QT5 A;  4YUD A;  5DET A;  1WUU A;  4ZMM A;  1T94 A;  2FUG 9;  1FJE B;  3S1T A;  2PEB A;  5K8P A;  2BUN A;  4ED0 A;  5DGA A;  3D4J A;  2BE7 D;  5L1J A;  2XMU A;  3DXS X;  5HP1 A;  5D0E A;  3HVR A;  2ATL A;  2HPU A;  4TU7 A;  2MQP A;  5EWF A;  3I56 S;  3ZZU A;  2UUA F;  1EQM A;  3M6U A;  2RHS B;  2GC8 A;  4MK9 A;  3TP2 A;  1MWZ A;  3GG0 A;  3ICL A;  2FGC A;  2RD5 C;  3A8K A;  3ET6 A;  4KAI A;  5I3P A;  2CVI A;  3GYN A;  4QBU A;  2W8L A;  1HNW J;  2QL5 B;  3KYL A;  3VGS A;  1DZ5 A;  4QJV A;  2N7Y A;  1AFJ A;  2DNH A;  3HK2 A;  3D0I E;  2MKJ A;  3MPU B;  5AE2 A;  3TOQ A;  2O66 A;  4P6Q A;  4D3G A;  4IRD A;  2MMY A;  1HI0 P;  3KUH A;  2HBR B;  2R8J A;  2E9R X;  3OJS A;  4AFF A;  2F8H A;  1FFW B;  1G6B A;  3MFH A;  3KK2 B;  1HMV B;  2BQR A;  4DV7 J;  1RAF B;  2WSF C;  4DV4 F;  2IPO B;  2V9K A;  2HYI B;  3MAA B;  2ROE A;  3DOM A;  1NHV A;  2YPY A;  4LF1 A;  2CJQ A;  3SCL E;  5I4M A;  3IWN C;  1HIY A;  1NLK L;  3UQS A;  2QZ8 A;  4PWW A;  4JP8 A;  2JWN A;  2GAG C;  4ZP9 A;  2ACY A;  1VLO A;  3P5B P;  4DV5 F;  3DLG B;  1Y5I B;  3EXC X;  3R7S B;  1F6T A;  3Q8R B;  1WJ9 A;  2BBE A;  1Y10 A;  3C15 B;  4NE9 C;  4Q2L A;  1HBM B;  2A2D A;  2W2Q P;  4CZC A;  3KKF A;  2N7C A;  2ZJQ Q;  9ATC B;  4K2J A;  5EUH A;  3IFE A;  1GMV A;  3FCW A;  3RRK A;  2GX8 A;  1JLC B;  2AYM A;  2OSR A;  1PG5 B;  1SBR A;  2GIR A;  2HIQ A;  3C6U A;  2FDN A;  2XNQ A;  2F1F A;  3I31 A;  3NWR A;  4NLV A;  3SZ2 A;  4ECX A;  1S1W A;  2HG4 A;  5HAN A;  3I6P A;  3AOB A;  1N33 F;  1K44 A;  3D2W A;  2AYB A;  1WF0 A;  2PSZ A;  1WC0 A;  1UA1 A;  1PYT A;  2GHP A;  2KZM A;  4ZJL A;  3ZZ0 A;  2UUT A;  1ELO A;  1VQY A;  3ET6 B;  3EYZ A;  1WI8 A;  2H5E A;  3A4T A;  4F25 A;  4OI0 A;  3OL9 A;  4E98 A;  1JQG A;  1N36 F;  4DQS A;  3GV8 B;  1U0H A;  1IQT A;  4ECT A;  5D3G A;  2BJ1 A;  5I3Q A;  3MFI A;  1L3S A;  1VQ9 S;  4B3S J;  2R2S A;  4M8L A;  3BDE A;  2COL A;  4R0J A;  4KR0 B;  3QZ7 A;  1CEZ A;  2XYH B;  2ZJR Q;  5BR8 J;  2VBY A;  3HHK A;  2XCA A;  4URS A;  2LA4 A;  3P45 B;  1S9G A;  4HHJ A;  2MZS A;  1SQG A;  1SJQ A;  2HNY A;  3FSY A;  3CJ3 A;  3UNY A;  4B9T A;  2NUH A;  1HYS A;  4NEY A;  4JV1 A;  1WC1 A;  4DR5 F;  1HD0 A;  4YEA A;  2CPX A;  1HPZ A;  2YNG A;  3KNA A;  5KT7 A;  2KTQ A;  4NMX A;  2DTJ A;  4BWJ A;  4KPC A;  4FDF A;  2XS7 A;  3QJL A;  1HWI A;  2LA6 A;  1FWP A;  3AB2 B;  3M05 A;  4IO1 A;  3MOZ A;  1FFG B;  2VPY B;  1UL3 A;  4ECW A;  1S9F A;  2F4V F;  1SV5 A;  5DG7 A;  1FKO B;  4Y3C A;  2VQE J;  2WVC A;  4X4P A;  1OSD A;  4LF4 J;  4HAC A;  1S9G B;  2Q6B A;  3D7S B;  4KY3 A;  1NKE A;  2NCK L;  5D0R A;  1N5Y B;  3AOD A;  4KHP F;  3ZO7 A;  3J7Z T;  4ED3 A;  2HFU A;  3MM5 A;  4CTA A;  1HW8 A;  2HBY B;  4BCA A;  1QTN B;  3GPA A;  4LSN B;  4OI2 A;  2HHQ A;  1RT2 A;  3GJR B;  3SYZ A;  3OR2 B;  2V2K A;  3Q86 A;  2FHK A;  4ITS A;  3G8T A;  4K0K F;  1XQI A;  2FJX A;  2RU9 A;  2N4D A;  3K89 A;  3NCP A;  4KSE B;  3T19 A;  2OEM A;  3H4B A;  4EYI B;  5HLF B;  4FPR A;  3QLH B;  3N6N A;  2O5D A;  2PA3 A;  5C5J A;  4Q44 A;  2YKN A;  2YQ0 A;  5T14 A;  2CZ4 A;  2QN6 B;  3JSM B;  2RQC A;  1C1B B;  2ALY B;  3JSB A;  1NK8 A;  2DGT A;  1UW4 A;  2VPW B;  1XNR J;  3N01 A;  1X60 A;  2RAQ A;  1FJG J;  4KHR A;  1S79 A;  3EVM A;  3V2U C;  4OFZ A;  3MEC A;  1ZPV A;  2E5H A;  1TV6 A;  2BJ9 A;  5ETM A;  4LF9 F;  4DR1 J;  4O4G A;  2CPJ A;  5J1E A;  1YBU A;  2CUY A;  3PNI A;  4P71 A;  5HVG A;  1RT3 A;  1RWK B;  2HFN A;  2LKZ A;  5E3Q A;  1HPZ B;  3TZW A;  1RTJ A;  4U8Y A;  5FII A;  4AQY J;  5HRO B;  4LQ9 A;  4NOH A;  4ZVU B;  1FKA F;  1HNZ J;  5KFE A;  1O0P A;  2GML A;  2W24 A;  1KLM A;  4BS2 A;  1T8E A;  2UXC F;  1U0H B;  3NEK A;  1MLA A;  2I2Y A;  1KHV A;  4DQR A;  1U8S A;  3O44 A;  3DRS B;  3K0J A;  1LWC B;  2ACM A;  1VDH A;  3CCW A;  3M8R A;  4JI1 F;  2MB0 B;  2HQF A;  5L1K A;  1FRI A;  2GIF A;  2JC0 A;  2MQN A;  1SI9 A;  2IFX A;  3CED A;  2CPD A;  5J1N A;  3W9I A;  3CCS S;  1RTH B;  1NME B;  3G6X A;  3MOJ B;  2UUW A;  1DLO B;  1T7P A;  3MMA B;  5K8O A;  5DQI A;  2R7X A;  1HNI B;  3TYT A;  2ZH3 A;  1VC6 A;  2XEX A;  2ZH9 A;  3BS9 A;  1TK8 A;  1NK5 A;  1GH8 A;  2XB2 D;  1YZ6 A;  4LJM A;  4I2Q B;  4UW2 A;  5LSO A;  2V2Q A;  5DLF A;  1XNQ J;  2LQ8 A;  4XPC A;  4GKK J;  4JI5 J;  2HHH J;  2H5I B;  4DV4 J;  2BR0 A;  5F8J A;  1Y5N B;  2W2N P;  4YN3 B;  4C3M A;  1TK0 A;  2OLW A;  2YWG A;  3MF5 A;  4ZVP B;  4CLP A;  3KLE B;  3ZZR A;  2HNZ A;  2ZNY A;  5DZ7 A;  1E6Y B;  2ALZ A;  4C3L A;  4DI6 A;  4IG0 B;  4EBE A;  4E2F B;  5ITH A;  2E7W A;  4X4V A;  2V8P A;  1SB6 A;  4CTA B;  4WTO B;  4A8M P;  1U49 A;  1U1R A;  3IM9 A;  2MZ1 A;  1HBO A;  1XBW A;  2B9W A;  1F5C A;  2J5A A;  3OXG A;  1WHV A;  4ETX A;  4MIB A;  3T1A A;  1PSD A;  1LEO A;  4WP3 A;  1WG1 A;  4MIW A;  4PXE A;  5LMU F;  3HD2 A;  2FB0 A;  4FF3 A;  3IWX A;  4F3M A;  3GG1 A;  1UW9 A;  2CA9 A;  4PG6 A;  4WPA A;  4AT1 B;  1B70 B;  4URG A;  2AJ2 A;  1HQ2 A;  5IT4 A;  1LWE A;  3NGK A;  4IDK A;  1VK3 A;  4KO0 A;  4OHW A;  2E7X A;  4B3M J;  3M8P B;  4ECQ A;  2D3O R;  1JLF B;  2B4U A;  1UJ4 A;  2B5J B;  3DHX A;  3LPY A;  5GAH U;  4YQW A;  3Q8Q B;  4H4M A;  2DR8 A;  2L08 A;  1FRM A;  3C16 A;  1BY9 A;  4RUC A;  4NA3 A;  3TRG A;  4DG1 B;  5IWA J;  4A8X A;  2QG9 B;  1XER A;  2IJN A;  3OUY A;  2XY5 A;  3R3T A;  2AJ0 A;  1CJV B;  3PJ9 A;  1REV B;  2XMV A;  3F73 A;  2DBB A;  4F2S A;  3LP2 B;  3RR7 A;  2R42 A;  4K50 A;  3DRR B;  4N77 A;  3KK1 B;  1H2V Z;  4RW4 A;  4L6V 3;  2LXU A;  2MKH A;  4EMD A;  1MN7 A;  1NK7 A;  2A3J A;  3ITH A;  2OSQ A;  2YWW A;  5ETS A;  3GP9 A;  2DIV A;  4LR8 A;  3HVT A;  3MEE B;  4LSL B;  4RW6 B;  4WE1 B;  4DLG A;  3MM9 B;  2Z2L A;  2GHW A;  4DX6 A;  2ZH6 A;  3NS7 B;  4HI2 A;  3TO8 A;  3AXM A;  3FCV A;  3WIV A;  5GAD I;  4DL5 A;  5KG0 A;  4UY8 5;  2JRS A;  2OD6 A;  3B4D A;  4ZHR A;  2FY8 A;  2HS4 A;  4DPT A;  3KNG A;  2ZBI A;  5B08 A;  3QAU A;  1NAQ A;  2EPI A;  1WOS A;  4ZLL A;  2R8H A;  3T3F A;  3K7R A;  3TJ9 A;  3J81 U;  1ZA2 B;  4DV6 J;  1M5H A;  1SC4 B;  2FYX A;  3M6W A;  4ZVH A;  2JC1 A;  3HVT B;  3MEE A;  5HO4 A;  4DSE A;  1IKV B;  5J2N A;  2IM2 A;  3BGR B;  3DC2 A;  3DYA A;  5KG5 A;  1RT7 A;  1AYE A;  2G2Y A;  2GMH A;  3JXO A;  2YXL A;  3EZO A;  2D9P A;  3R8Y A;  1MN9 A;  1NO8 A;  3F41 A;  4K5R A;  5I42 A;  1N8R T;  1F5B A;  1HBO B;  2YBV A;  3KJF B;  3KK2 A;  4C98 A;  2JX2 A;  2PMW A;  3GJT B;  1S6P B;  4IFV A;  2CKW A;  4IR9 A;  3I4H X;  1RKJ A;  3V81 A;  4A8F A;  2HEK A;  3R7B B;  3Q8U A;  5DO2 A;  3G96 A;  1KOO A;  3PIP Q;  3EJM A;  4DR2 J;  5CQG A;  4QYZ J;  3W2W A;  2OI2 A;  2J0X A;  2CPZ A;  3A3N B;  3MM7 A;  2GHV C;  3AJ1 A;  3I96 A;  3CJK B;  3VGT A;  2V4J A;  3IS9 B;  2ERR A;  1VBX A;  1JLE A;  4IDK B;  4KO0 B;  1S7H A;  4F3Q A;  4X4N A;  3C6T B;  1Q16 B;  2IYG A;  2J9C A;  5HN0 A;  4PPD A;  2NUU G;  3N6L A;  3EWG A;  4ELT A;  4ZIT A;  5GMK a;  5AJ3 J;  4F2R A;  3TNV A;  3MZI A;  2X3D A;  2ZD1 B;  2AJF E;  2JOQ A;  1AUD A;  5D0H A;  4U8V A;  1GFW B;  2HRT A;  5M2R A;  3PM9 A;  3TVK A;  2BZ2 A;  2M88 A;  4HH1 A;  4DR3 J;  2LP4 A;  4HTJ A;  2Y8Y A;  2UUA J;  2DHX A;  4J91 A;  2DR9 A;  4WP8 A;  2OKQ A;  3HSJ A;  1KHW A;  3DGV A;  1RA6 A;  4X84 A;  2LEP A;  1VBZ A;  5CYM A;  2NXE A;  5C25 B;  4AQY F;  3KK1 A;  3C66 A;  3OT9 A;  4PYA A;  1BQN B;  1JJ2 R;  4NEZ A;  2WVB A;  1XK8 A;  2K7J A;  2VZ9 A;  5IM0 A;  3TEH B;  2KG0 A;  4DV0 J;  4B3O A;  4WF9 Q;  2XMW A;  5BJR A;  2ZJP Q;  5D77 A;  4RWW A;  2DIS A;  3D54 A;  2CJA A;  2HQG A;  2WVE A;  4M5I A;  4HTI A;  2E5L J;  1WG4 A;  3NGR A;  2CJB A;  4YR3 A;  3R97 A;  3C14 A;  2IRY A;  1UVK A;  4AL6 A;  1VRU A;  4FPI A;  4H4M B;  3CO9 A;  2NR0 A;  2FIU A;  2ZDO A;  3EZU A;  5F41 A;  4O3O A;  4J9L A;  2DGV A;  2RT3 A;  2FPH X;  4LT6 A;  3UCU P;  2YWK A;  2DGO A;  5GMD A;  3UDV A;  5CXT A;  4IRK A;  3WQP A;  1T95 A;  4ED7 A;  4QYZ K;  1EHW A;  1EAR A;  3AXK A;  4CYU A;  1D3W A;  4MIA A;  4F04 B;  2JL9 A;  4OV6 A;  1T03 B;  3K8V A;  1QSY A;  3Q8Y A;  2ZM6 F;  4ED1 A;  4K0K J;  1VK8 A;  3LA0 A;  3HVA A;  2BOA A;  4TYA A;  4DQQ A;  1KFS A;  1RTI A;  2YQ3 A;  1CVJ A;  4DU8 A;  3QYY A;  1ZTT A;  4AYB D;  1DTT A;  1LK7 A;  9RUB A;  2E29 A;  4B9N A;  5LXR A;  4I6W A;  3PDN A;  4UF4 A;  2QA1 A;  1TAU A;  2J8A A;  4EO8 A;  5LMU J;  4QCL A;  2OTJ S;  2XSJ A;  3UCG A;  3RB4 A;  4J37 A;  3DGP A;  1RT5 A;  3DI6 B;  4A48 A;  1JLG A;  2HNZ B;  2NSB A;  3PEH A;  4F4A A;  2RS8 A;  3CMA S;  3CC7 S;  1SUQ B;  3FDS A;  3FRZ A;  3J81 Y;  3VHQ A;  1BD6 A;  1Q8K A;  6FD1 A;  3I55 S;  3RRH A;  2E9T A;  3IRX A;  1L3V A;  5ETP A;  4PR6 A;  4YME A;  1VBY A;  1UFL A;  1SV5 B;  1FKP A;  2C22 A;  1Q81 T;  5B0B A;  1QUV A;  2FLO A;  3HI9 A;  1UVJ A;  3C19 A;  2DJW A;  4OZ0 A;  3NRB A;  4USV A;  3C15 A;  4CNZ A;  4ZP7 A;  1UPM B;  3GCW P;  2E9Z A;  4QW9 A;  3TAN A;  4P2S A;  4JI2 J;  2H54 B;  4P52 A;  4DPW A;  3TI0 A;  1Q7L B;  3QFW A;  4KE5 A;  4DSI A;  3QRP A;  4EZ9 A;  1TUW A;  4CLW A;  1T02 A;  2YKO A;  4LF7 J;  5A8W A;  1TL1 B;  3ZFV A;  3W64 A;  1VIO A;  1ZTW A;  3GSI A;  1Q8B A;  4CM0 A;  4CDI A;  3KUG A;  1FNM A;  1ROF A;  1FD2 A;  3HHL B;  3IP0 A;  4IFV B;  1RXO B;  5KFL A;  4TN2 A;  1RT1 B;  2IVF B;  4X66 F;  4N76 A;  1U25 A;  1YG0 A;  4RW8 A;  1EP4 A;  1WC6 A;  3AHP A;  2OTL S;  1VQL S;  4LFC J;  3WX8 A;  4A47 A;  2RML A;  3BEG B;  4HT5 A;  1NCL A;  2P9E A;  4ZJO A;  2I8E A;  5JXS A;  3BDP A;  1YIJ S;  4QIG A;  2A2C A;  3HXM A;  1P1T A;  1VIX A;  2KI2 A;  2QV6 A;  2XWY A;  1V3S A;  2ZOG A;  4WK3 A;  1WKL A;  4RLE A;  1CS4 A;  5A0Y B;  3RAX A;  3MR5 A;  1V5I B;  1QJH A;  2VPZ B;  3I32 A;  2IM1 A;  4KKO A;  5ETR A;  4ZLJ A;  2MSS A;  1GEH A;  1WSV A;  4ILM A;  1HBU B;  2UXD J;  1LW0 B;  3CDA A;  2EFN A;  2XMA A;  1U48 A;  2PDA A;  4QIF A;  3G87 A;  1DAR A;  4EK2 A;  5HMW A;  4ZPB A;  2IYI A;  2AX1 A;  1F2H A;  4XPE A;  3HVW A;  1S9E B;  2FHO B;  3AAW B;  4RZR A;  4ID5 B;  4YDD B;  1XMQ F;  3GWC A;  3MCO A;  1NBE B;  3EIC A;  2FHM A;  3ILL A;  3KXD A;  4WBF A;  3TX0 A;  3NGD A;  3TA1 A;  4CO0 A;  3W66 A;  2KFY A;  1JKH B;  4DV7 F;  1NDK A;  4UST A;  3LQV A;  1S0N A;  2EFP A;  3VAK A;  2Z58 B;  4HAC B;  2AT1 B;  2WON B;  5BXI A;  1N54 B;  4WU2 A;  2R7Q A;  3M2U A;  5J2Q A;  4DDF A;  3A1Y G;  4HI1 A;  5B0E A;  1NJZ A;  3QT7 A;  4JV5 F;  5GAH I;  1NKB A;  3LP0 A;  3R7N B;  4NLX A;  4LF6 F;  5LMN J;  4OJG A;  2VIC A;  3BGF A;  2MQO A;  4ED5 A;  3DOK B;  4ILR A;  5T41 A;  4B3R F;  1S72 S;  3L95 X;  3UVJ A;  1PYO B;  1LWE B;  1Q4R A;  4DV6 F;  1N34 F;  4NRU A;  1R3N A;  2B4V A;  3IS9 A;  5F8I A;  3Q24 A;  4NA2 A;  1DQ9 A;  2F4V J;  2BQU A;  1I1G A;  1FES A;  4Z2X A;  4RNO A;  4I69 A;  2IMO A;  3RW6 A;  3BO2 A;  2A6M A;  2UUB F;  2P2C B;  2ZHO A;  2CNL B;  3QO9 B;  1RTZ A;  2HWH A;  1IM4 A;  3L7U A;  3ENV A;  4OYP A;  1FE4 A;  4DFK A;  4DR7 F;  1YJV A;  4YS2 A;  3ILI A;  1DAX A;  3UVJ B;  2VQF F;  2OH2 A;  2AIR B;  1VRT A;  4DEZ A;  1R0C B;  4WJB A;  4LF9 J;  3VAJ A;  4ZJQ A;  2FD2 A;  1A0O B;  3HF5 A;  4NLO A;  3OJU A;  1U02 A;  5J2P B;  4TU9 A;  5CYQ A;  3FSI A;  4UOG A;  1CUL B;  4XIU A;  2PA8 D;  3EMT A;  3Q8V A;  2GGP A;  5E33 A;  3GIJ A;  4FS1 A;  3RB3 A;  4LFB J;  2GO9 A;  3NMA A;  5H9E K;  3VAF A;  3SV4 A;  3QT6 A;  1HQE A;  1RHU B;  2AEF A;  3HKZ D;  4A46 A;  1S76 D;  3QRR A;  3MR2 A;  3RAQ A;  2DRB A;  1O51 A;  4K4Y A;  2E1M C;  4ANE A;  3M30 B;  1SC6 A;  3DOM B;  2LEB A;  4EBC A;  1WNE A;  2FZK B;  3LOU A;  1CC8 A;  1HWK A;  3CCT A;  4CLK A;  2XS2 A;  1IXK A;  4X64 F;  1OWX A;  3GR1 A;  4RNM A;  2LVW A;  1N5Y A;  3WC2 A;  2UXD F;  1S6U A;  1T9W A;  1TL5 A;  5B0C A;  2EW9 A;  5LT5 A;  1KVK A;  2ZWO A;  4DR4 F;  3KJV A;  4WU3 A;  4NLS A;  3D3B J;  3W61 A;  1LFP A;  1S7I A;  4RW9 B;  1I3O B;  2N3L A;  3OTB A;  1JLF A;  1S99 A;  4ECU A;  2Z2Y B;  3MMC A;  1Y5L B;  4C8L A;  2HND A;  2EBE A;  4NI2 B;  1GMW D;  1U7L A;  2WB4 A;  3H40 A;  1ZYQ A;  3P5T L;  3M9N B;  1O6X A;  4DMZ A;  1QAJ A;  2CQC A;  4DG1 A;  3CD7 A;  2GCF A;  1IWG A;  2HGN A;  4DZD A;  1FK9 B;  1FNO A;  5L38 A;  2VHG A;  2FJW A;  5LJ5 Y;  3W2W B;  3HDS A;  2DGX A;  3DMJ A;  2VG5 A;  1RSC A;  3OSN A;  4JI4 J;  2J9D E;  2MKY A;  4LF8 F;  2QGF B;  5D15 A;  1HQU B;  2DIU A;  1QE1 A;  5KG3 A;  3ZTR A;  5L9N A;  1RLD A;  3MEC B;  1YLX A;  2VFV A;  2CWK A;  3OVB A;  2UU9 F;  1HNV A;  1AB8 A;  3OTE A;  2H1Y A;  2AX0 A;  2F40 A;  2V8D A;  1OYD A;  5D4L A;  5FDL B;  2NPF A;  4ECZ A;  2CDR B;  3BF4 A;  2C3U A;  2HFV A;  3CB4 A;  3FMW A;  3PHT A;  4OZ2 A;  3N9U C;  1S0V A;  1REG X;  2VL1 A;  5GAG I;  2JLF A;  1T9Y A;  3BQ0 A;  4NXM F;  3BKU A;  5T7L A;  5F0U A;  4DL2 A;  2FTR A;  1BUX A;  3TUI C;  1YX2 A;  5A76 A;  2EI5 A;  1Q82 T;  1V5V A;  2AMC B;  4LRB A;  2KFN A;  4WTY A;  3PO5 A;  2DCU B;  2V4Q A;  4LF5 J;  1D9F A;  1S9E A;  1YJW S;  2LMI A;  1NZA A;  2UUB J;  3SSR A;  1VJW A;  2RVJ A;  5CYQ B;  4PPZ A;  1F0X A;  1CBK A;  4JI8 F;  3NNA A;  2DNY A;  4FYV B;  4PCQ A;  2ZIT A;  3K5M A;  3IWL A;  4DF8 A;  3RYL A;  4Y28 C;  3W62 A;  1UVI A;  2CG8 A;  3TWZ A;  2AEJ A;  4K4T A;  4L75 A;  2GGP B;  2J7U A;  1U45 A;  2HLT A;  3JQJ A;  2VA2 A;  4CCH A;  2DHS A;  3HPO A;  3W3S A;  3OXL A;  3MMC B;  2UVU A;  1CS4 B;  5A0Y A;  1JLQ A;  3S01 A;  2MLY A;  3KWM A;  5KFX A;  5KOW A;  4URQ U;  3T1Y F;  4HDG A;  3RU0 A;  3UNG C;  2KDO A;  1K47 A;  2RJZ A;  3DLK A;  4W4M A;  4Q43 A;  2YKM A;  2IM0 A;  4BHQ A;  3LWM A;  5MLC V;  3TAM A;  2UP1 A;  3GSD A;  5HJY A;  2DB1 A;  4GVL A;  3CT9 A;  2ZH7 A;  3J80 Y;  6FDR A;  4DL7 A;  2CQG A;  3PIO Q;  4CH1 A;  1RAD B;  4ZN3 A;  4OHY A;  1TL7 B;  2K8G A;  3PJW A;  1UP1 A;  2BMB A;  2C2O B;  2VIH A;  1KBR A;  1BWE A;  2AJQ A;  1JJH A;  3ILJ A;  5DQH A;  2FJB B;  1FJ7 A;  2DGS A;  3MD1 A;  1TV6 B;  1YVF A;  2V8V A;  1KTV A;  4NLT A;  2HLU A;  4ES2 A;  5CA5 A;  3GII A;  4NRT A;  1U1P A;  2OAU A;  3KG0 A;  1Q53 A;  2HND B;  4NI2 A;  2VU5 A;  4YDX A;  4O4G B;  4U7U K;  5J1E B;  4CWB A;  3E2E A;  2VA3 A;  4AL5 A;  2G1D A;  5SZT A;  4OYI A;  3G86 A;  2GIQ A;  4K4V A;  3HP6 A;  2MZT A;  1C0T B;  2NXN A;  1YJT A;  2VFS A;  4RUH A;  3IGV A;  5L8R C;  3W2V A;  2JEI A;  1IVZ A;  4Q7A A;  2ZC3 A;  2EWH A;  4OX6 A;  1B0V A;  2XYG B;  2O67 A;  3KHL A;  3HLU A;  1M5S A;  2G0C A;  1SKR A;  5BYR A;  2J0S D;  3CDW A;  4O3Q A;  4BC9 A;  4LFC F;  2KJV A;  4FKY A;  2KRB A;  4U7U D;  3GIL A;  1LXN A;  4ZVE A;  3DDI A;  4YR2 A;  3K8W A;  5EDW A;  2OML A;  1A7G E;  2XMT A;  3GZ7 A;  3MAA A;  3MHY A;  4OJ3 A;  3W5Y A;  3RB6 A;  2GAH C;  2ASL A;  4P7V A;  2YX7 A;  1RYS A;  4KGV B;  3W7B A;  1QUP A;  3N28 A;  3VAL A;  1U2F A;  3B6B A;  3NL0 A;  4F4Y A;  2YKP A;  4EU0 A;  4B3S F;  4DQI A;  3W9J A;  3E3X A;  1TVR B;  2H5J B;  3H98 A;  2A6O A;  4C8Y A;  4X4O A;  1H6K X;  2ILZ A;  2DY1 A;  3G82 B;  2QC3 A;  3IAS 9;  1MNE A;  2DHG A;  3MAH A;  2W4C A;  7FD1 A;  3ISZ A;  4TLR A;  3MM8 A;  4LR9 A;  4KFB A;  1VR6 A;  1UEK A;  4F67 A;  1U2C A;  4A4J A;  1XMQ J;  2FHJ D;  5HAO A;  1KDN A;  1U0S A;  1KS2 A;  1JB0 C;  1F5A A;  1N5Q A;  2DGU A;  1W25 A;  1WKJ A;  1R89 A;  1XN9 A;  2AZ1 A;  2RDD A;  3M2R A;  2LU2 A;  3OBI A;  1KQF B;  4OJH A;  4ENO A;  5JJB A;  1ZOT A;  3HM9 A;  2ZFH A;  1BXN A;  2DNR A;  3K57 A;  3R1H A;  4C4W A;  2KKH A;  1NND A;  5HRO A;  3ILO A;  1QSS A;  1TMM A;  3BGR A;  1CQM A;  2YNI A;  3GQC A;  2PI4 A;  2W25 A;  4LF4 F;  1IR1 A;  4DFJ A;  1B3T A;  3P6Y C;  1K1S A;  1SIW B;  1QM9 A;  2WTF A;  3MMB A;  2WOM A;  3SDE A;  4I2P B;  4YY3 F;  4DV3 F;  3H5X A;  2XY6 A;  1KVI A;  4DWI A;  2DKO B;  3D1H A;  3OL7 A;  1RT6 A;  3M8Q B;  4G65 A;  1S6O A;  3IR7 B;  2DD8 S;  5GVQ A;  1WDT A;  4QPX A;  2QLB B;  3L4B C;  3AQO A;  3OHA A;  5L1I A;  4KQZ A;  3CME S;  3MTJ A;  3BO3 A;  2CQ4 A;  2DRD A;  1MMN A;  4RW9 A;  2F8E X;  2V4R A;  3QZ8 A;  1IBK F;  4Y0F A;  3HUL A;  5I3U B;  4ILL A;  1YDL A;  2YTC A;  3TZY A;  1NB7 A;  4F3O A;  4WKR A;  4LBH A;  3TJ8 A;  2I1R A;  3CJ8 A;  2GQC A;  5HVF A;  2XO7 A;  1HHS A;  1FRX A;  2MZR A;  1GXU A;  4J9V A;  4NAS A;  1NSK L;  4O0N A;  4RW7 B;  3V4M A;  3VR1 A;  5AE1 A;  1OPI A;  3KHR A;  1F3F A;  2K7K A;  1A9N B;  5E3A A;  2FJV A;  1GTE A;  1YJU A;  2M0G B;  4R5P A;  4KT0 C;  4DR7 J;  5DDQ C;  2BKN A;  1WF2 A;  1EET A;  2P6T A;  2KG1 A;  4C8Z A;  1S1X A;  1NK9 A;  2ZUG A;  2B4O A;  2VH7 A;  2Z4P A;  4DV0 F;  4HH0 A;  4C8N A;  3RZA A;  4HLB A;  4J9U E;  2D1C A;  3QWU A;  3TVZ A;  1DFD A;  4JI7 F;  2OD4 A;  4FXD A;  3M8W A;  4H4K A;  3K5L A;  5KFY A;  1NDC A;  1TZ0 A;  4RJV A;  5J2N B;  1RWP B;  1FO1 A;  4QWC A;  1NHU A;  3BH6 B;  1S97 A;  4X4T A;  2F63 A;  1RTD A;  2YH0 A;  3TAR A;  4OYA A;  2QE5 A;  1X9M A;  3RJM B;  3MWB A;  2IAJ B;  2J0W A;  3KHG A;  3DNC A;  2KRR A;  2YNH A;  2KHC A;  2MST A;  5A2Q Y;  1KD1 T;  2QA4 S;  4X62 F;  1Q5Y A;  5C42 B;  4JI3 F;  4N5S A;  1X4F A;  2AGP A;  3QID A;  4Q8F A;  5M2U A;  2V8G A;  2ZKT A;  1H2T Z;  3RW7 A;  1VIS A;  1XMB A;  3IBC B;  1X7V A;  4ZPC A;  1R31 A;  1U1M A;  1IBM J;  4KRW A;  2QA2 A;  2OPR B;  2RHQ B;  2EC2 A;  2VG7 B;  3A8E A;  3G6V A;  1XNQ F;  2F4F A;  4PUO B;  2OPP B;  4JB8 B;  4ZDN A;  1FWK A;  1LWF B;  3L3C A;  2EEY A;  4OYB A;  3ENW A;  5KFV A;  5A6P A;  1XNR F;  2IY5 B;  2QT7 A;  1RLC L;  2D9O A;  2DXD A;  4LFA J;  3RBZ A;  2G2Z A;  3JQM A;  3N0V A;  1CQN A;  3AQP A;  4NYZ A;  3T1H J;  4ID5 A;  2VB6 A;  2E5L F;  3ZC4 A;  2BA9 A;  4CO5 A;  4ZPD A;  3H8Y A;  1FKO A;  2LQB A;  2ZD1 A;  2RKI A;  5HVH A;  1HWJ A;  4JI8 J;  2GV1 A;  4IRC A;  3LP1 B;  4USH A;  2R3V A;  1HQE B;  5E7O B;  1GQE A;  3VV2 B;  2FLN A;  5ETK A;  1J5O A;  1DLO A;  1IBL J;  3HHE A;  3LUY A;  1SUQ A;  5KT5 A;  3Q89 A;  2PD1 A;  2XYP B;  4DV1 F;  1Y4Z B;  3H2V E;  3D6F B;  1RK8 A;  4O3P A;  1RWW B;  4CO4 A;  3CWJ A;  3JAM U;  3V6D B;  4AL7 A;  3D0H E;  4I56 A;  3UD5 A;  3GV7 B;  3CUL A;  2E5G A;  1WEZ A;  1FDB A;  1JLB A;  1SJR A;  2EFG A;  3A8J A;  3VCD A;  2IRX A;  3DRX A;  4Q0B A;  3HFK A;  2IA6 A;  5IT9 Y;  1SIZ A;  3EVO A;  2RF2 A;  1N34 J;  5H9F K;  1KKH A;  3AA9 A;  2CIM A;  5EWE A;  2LLZ A;  1MG7 A;  2L9N A;  3P96 A;  3NCQ A;  4L73 A;  3PR4 A;  4F4K A;  3CJS A;  2Q79 A;  1H3D A;  3POT A;  4DN9 A;  5IS2 A;  3LGH A;  5ETV A;  5KFD A;  3CCR S;  2IBK A;  1U6B A;  2CNO B;  3K5O A;  4ZPV R;  5H9F J;  4QOT A;  1PIL A;  2BEF A;  3GR0 A;  4PWD B;  1FJC A;  5CD4 H;  4UOC A;  4KFB B;  5K5M A;  1WEX A;  3DLK B;  4R0E A;  1LKZ A;  4PG5 A;  2AGQ A;  2AGO A;  4RU9 A;  3W1Y C;  1P6T A;  4HHU A;  4TNO A;  1FK9 A;  3FQL A;  4WYL A;  4OI1 A;  5E41 A;  5HP1 B;  3KJN B;  2MGZ A;  4JI2 F;  4L3K A;  5HMX A;  2DXF A;  4YHH F;  3D1O A;  2FJE B;  3MPY A;  1DQA A;  2XC9 A;  2HWI A;  1VJQ A;  4QIW D;  1D9D A;  1FRK A;  4AE5 A;  4EUV A;  2V4J B;  1HA1 A;  2XWX A;  4A8W A;  1FX4 A;  4HYK A;  1ZS6 A;  3ZZZ A;  1PCA A;  1FVS A;  3H2U B;  2C2M B;  2M3D A;  3M32 A;  4ER8 A;  2MQ8 A;  5L39 A;  1MWQ A;  1N33 J;  4FYW B;  2QA4 G;  4P72 A;  1WI6 A;  4CLL A;  1Y3K A;  1RHR B;  1RAI B;  1JLG B;  2SXL A;  4M5L A;  3TZX A;  3A8I A;  5THW A;  2GZO A;  5KFC A;  3M9M B;  3CCU S;  4A8Q A;  4IYQ A;  3MM5 B;  4TYB A;  1BMQ B;  1I6J A;  3PY8 A;  3MED B;  1QY7 A;  3G2X A;  4Z7Y A;  5FLX Y;  2BJ7 A;  2BRL A;  2HGM A;  5IC4 B;  4NZ6 A;  4CI0 B;  5IQ6 A;  2LXI A;  3W2V B;  5LSR A;  1Q1K A;  1N32 J;  5JVH Q;  4Q0B B;  3M2R B;  4PXC A;  4ZK7 M;  1SH2 A;  4MFB B;  4RBU A;  3LO3 A;  1PKU A;  2N82 B;  3PFE A;  3T5K A;  2ZH8 A;  2R7R A;  2FC8 A;  3K5P A;  2GO8 A;  3QGP A;  4DZ6 A;  4B9S A;  2P5V A;  4IOB A;  1NUE A;  2RQ4 A;  1BLU A;  2FJA B;  4BWM A;  2XZW A;  4P74 A;  1GAO A;  3ELH A;  5B0A A;  2W9C A;  4LSZ B;  1VQ7 S;  1PO6 A;  1SL2 A;  2A1B A;  1FXR A;  3FBF A;  3RB0 A;  4JI6 F;  3CE8 A;  3JTP A;  1M0S A;  4ZP8 A;  3MR3 A;  4ZIV A;  2DNK A;  4I2P A;  3TA0 A;  1H72 C;  2KM8 C;  4JI3 J;  1GNK A;  1VBK A;  3IG1 A;  4JUZ A;  1UA0 A;  2BE2 B;  4S0M A;  2HZC A;  5DRK A;  1NK0 A;  1YTY A;  3EX7 B;  4DUY J;  1X4B A;  2RIL A;  3HHL A;  2VG6 B;  2CG4 A;  5K20 B;  2HQ3 A;  1HNX F;  1FD8 A;  4O0I A;  1VOM A;  4LIR A;  4OX8 A;  4PRF A;  4LRF A;  1RT7 B;  2R8K A;  2CQ2 A;  1XJW B;  4AXJ A;  2DR5 A;  4AND A;  1S1U A;  1RWX B;  2BM0 A;  2QX0 A;  4C3K A;  4JI7 J;  2X7I A;  3O1L A;  4P73 A;  1OYE A;  5HSP A;  2VJU A;  4C9D A;  4UTG A;  3PR5 B;  1G1X A;  1RWV B;  3V6K A;  1UWB A;  2C2R A;  4NXN F;  4TY9 A;  4A8S A;  2D3O 1;  1BQX A;  2V0N A;  2QJ3 A;  3PO4 A;  2DNN A;  3LP1 A;  4CLT A;  1TP7 A;  1JX4 A;  5KFH A;  4KJI A;  1DHM A;  3FEX B;  3DHW C;  4X65 J;  2BVZ A;  1GK8 A;  1PBU A;  4HEA 9;  2B7C B;  2CQB A;  4W90 B;  4E8U A;  3S8S A;  1GXT A;  1DTQ B;  1X31 C;  2G13 A;  2EK6 A;  2EK1 A;  1XTZ A;  2B9E A;  2JZ5 A;  3N4W A;  4NYP A;  4C48 A;  4Q45 A;  3PW7 A;  3ITH B;  4NCG A;  3FSX A;  2JVR A;  1YZ7 A;  3UO0 A;  2MHE A;  3OPK A;  3VVT A;  3C46 A;  1KVJ A;  1RAE B;  4WXO A;  2HQI A;  3CDE A;  1R8A A;  1NPK A;  4MJK A;  2E1A A;  5D6G A;  1UMJ A;  3SCJ E;  1XR6 A;  1XWL A;  2HS3 A;  1S10 A;  2JEG A;  5BYQ A;  3RUB L;  4ECS A;  1NJY A;  3PXG a;  1MWY A;  1NZ8 A;  1PJ7 A;  3THT A;  3W60 A;  4GC7 A;  3V81 B;  3FFI B;  2FVR A;  1S6Q A;  2CQ0 A;  5EX3 A;  2FLP A;  4OX7 A;  1MRO A;  1EJ7 L;  1YJ9 S;  2BOP A;  1Y9O A;  1WG5 A;  2K3I A;  2HVE A;  2ZDP A;  4WZM A;  3O6Q A;  4P7T A;  4ZPT R;  4C2M A;  2YKM B;  4F4X A;  2CJK A;  4IH7 A;  3JAM Y;  3CJQ A;  1URN A;  3FBB A;  2D3U A;  4DPY A;  2M4M A;  2JSX A;  1QAX A;  1SQF A;  2R7O A;  4QIE A;  2XM3 A;  2W9C B;  5EN1 A;  1ZPW X;  2IHR 1;  3D0G E;  4N8N A;  1VC5 A;  1CJU B;  1AXQ A;  4F26 A;  5IZH A;  4UZB A;  3JQK A;  4WIQ A;  4PWU A;  2C3M A;  4J9P A;  3VGU A;  4J7C A;  4B9M A;  3HHN B;  1RT6 B;  4M5K A;  1APS A;  3V4I B;  1TTH B;  3EGV A;  4ZCM A;  4K5S A;  5F3T A;  4DF4 A;  2IC3 A;  3MEG B;  2Q1L A;  4USJ C;  4K8R A;  3O8W A;  5AXM A;  1V3R A;  2YNI B;  3PYD A;  3QNW B;  1Y3J A;  4WFY A;  4ICL A;  1VGY A;  1WKK A;  5HQ8 A;  5H1S V;  5DQG A;  2J0Q D;  4PQA A;  3UD4 P;  3JS9 A;  3IM8 A;  4CNY A;  5JUM A;  4G6V B;  4IG3 B;  4M63 A;  3HD1 A;  1IN0 A;  3SSS A;  5CD4 A;  5L1L A;  3CD6 S;  3TUJ C;  1GMW A;  4QR2 A;  2W2P P;  4IO9 Q;  3SI8 A;  2OMO A;  1XIQ A;  2ASJ A;  2K1R A;  1K73 T;  2GVD B;  2F9D A;  1URR A;  3E01 A;  5KFP A;  1BC6 A;  3V4I A;  2WRM A;  2XS5 A;  3UDL A;  1OIA A;  3CD0 A;  1BQM A;  1RAB B;  3GIR A;  3LW5 C;  3PFO A;  3SCK E;  3TZZ A;  2VUG A;  3MMA A;  1X5T A;  3B8H A;  4UUW A;  4CM2 A;  1N36 J;  4V19 X;  1W2B R;  1KSP A;  3M6X A;  5B0F A;  1VQO S;  4GVB B;  1CJK B;  2JEJ A;  4V1A k;  4JI0 F;  5G0R A;  3CJ4 A;  3SCI E;  2D69 A;  2X1A A;  4J5O A;  5IV4 A;  2C2N A;  3CO0 P;  3LTO A;  3TW0 A;  1FFS B;  1UFK A;  3M2V B;  2B9Y A;  2CWX A;  4GMK A;  5IM0 B;  3KK3 B;  1S1X B;  3MCN A;  1DJ0 A;  3NY0 A;  4CT8 A;  2LEC A;  1EET B;  1S6Q B;  1NRK A;  4DV5 J;  2KYX A;  4Y00 A;  1QVF R;  2KVI A;  1S59 A;  4TKT A;  3EGZ A;  2IRU A;  2MKS A;  1Q8L A;  2AD9 A;  2J8S A;  4DL3 A;  2RH3 A;  1LOU A;  5F9N A;  3CJT A;  1N5T A;  4Y2I A;  2HSE B;  3I5A A;  2D74 B;  4AUK A;  1N5V A;  1N6Q B;  3US5 A;  4DR5 J;  3BGO P;  2ROG A;  2W9A A;  2Y8W A;  2DGQ A;  1FWL A;  2E1P A;  4PXD A;  1TUG B;  1T3O A;  1Y11 A;  3SFU A;  1U24 A;  4A8Y A;  2CQ3 A;  3WHI A;  1FNX H;  1J2V A;  4C11 A;  3HJV A;  2EXU A;  1YJR A;  5KG4 A;  4ALZ A;  1IKX A;  1RHQ B;  2M9K A;  3IGN A;  5DLG A;  3OTC A;  2GVD A;  2BYC A;  4HDH A;  2WBR A;  2D41 A;  1L3T A;  3MXH P;  3Q0A A;  3CCE S;  1UAW A;  2MQL A;  2QYG A;  2XTJ P;  3IBW A;  4TQR A;  2GNK A;  4DOZ A;  4CLY A;  1YBA A;  3T6B A;  2DVI A;  2WVD A;  3OXF A;  1RAJ A;  1D09 B;  3TJA A;  4BLG A;  3HT0 A;  3KFW X;  3NNH A;  2ZKU A;  2JJ4 D;  4ZVT B;  5C24 A;  4LSN A;  1P9Q C;  1QDU B;  3U7J A;  2HHS A;  2R2U A;  2BAC A;  3FGV A;  4M5D B;  1X4C A;  3Q83 A;  3R5B A;  1NK6 A;  4HL9 A;  3J7Y U;  2OIH A;  2AV5 A;  5AJ3 F;  4RL1 A;  1RKI A;  4USM A;  3Q22 A;  3ISN D;  2G2O A;  3BYP A;  3MUV P;  1UEU A;  2B8Q A;  1S4F A;  4X2B A;  4UOH A;  1NSP A;  1NU4 A;  1FVQ A;  1Q0N A;  4DX8 H;  5LMN F;  2R8G A;  1MU2 B;  4YP3 A;  1C0U A;  3G8Q A;  2WW8 A;  3BSO A;  2C3Y A;  2R8I A;  1LW2 B;  2ZVS A;  2J76 E;  4GVB A;  1BGX T;  1TEL A;  2OEK A;  1SKS A;  4I7F B;  1RIS A; 
#chains in the Genus database with same CATH homology
 4ZN1 A;  4ZN3 A;  3P8B B;  3EWG A;  3LPE A;  1M1G A;  2XHC A;  2K06 A;  3H7H B;  2OUG A;  1NPR A;  1NPP A;  2EXU A;  2LQ8 A;  3QQC D;  1M1H A;  1NZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...