2OUGA

Crystal structure of the rfah transcription factor at 2.1a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
141
Chain Sequence
b'QSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYKKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator rfaH
publication title Structural basis for converting a general transcription factor into an operon-specific virulence regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 29
structure length 141
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2ougA00
1M1GA 3LPEA 1M1HA 4ZN3A 3P8BB 2EXUA 2LQ8A 4ZN1A 3EWGA 1NZ8A 2XHCA 1NPPA 3H7HB 2K06A 1NPRA 2OUGA 3QQCD
chains in the Genus database with same CATH superfamily
2E9TA 1WG4A 1MLAA 3UVJB 2HVEA 4XTTA 5KFRA 1HHQA 3AB2B 3L3CA 5C24A 4F3QA 4LVOP 1XEZA 1TZ0A 3GIIA 3L7PA 1HNVA 4DFPA 3U27A 3DXBA 4K5SA 3VCDA 5DLFA 2RQKA 5HVGA 3BN7A 1RHMB 2V63A 1GT8A 2ZVSA 3BJYA 2YKMA 4WE1B 1ZOTA 4CO1A 5B0BA 2LEBA 3TQEA 1T9XA 1H2UX 3QJPA 1NBEB 2JHEA 1XNRJ 5F8NA 2GV1A 3DLLQ 2R8JA 1JLEA 1BQNB 4KGXB 3VTIA 3I5CA 2RS2A 1KHVA 2J6UA 4B9UA 2F40A 2DIVA 5KFQA 2CFXA 3LAMA 4CTAB 2LECA 2CNOB 2CQDA 1UZDA 2CJBA 4PEOA 3HJVA 2ERRA 4KH0B 5KG4A 2PA8D 1U02A 4I64A 1NSKL 3ITHA 5HO4A 4I1TA 3AT1B 2FIUA 2WVBA 4DPUA 1VQ8S 3BV8A 5C24B 3GONA 3LO3A 4RBVA 1HNVB 4Z37A 4EZ6A 3HDSA 3TYTA 1T9UA 2AJ2A 4DPXA 2VPWB 1HNZJ 2HGLA 2YKMB 2OLWA 1VK3A 2VKRA 2MJNA 1YZ7A 4ENOA 1HBMA 2IJNA 2VC0A 3EGVA 3NGTA 2GJIA 3MEKA 3W63A 4YB5A 2MYFA 3GYXB 4ZVPB 5J2NA 4DR3J 2AU0A 2NQPA 1XR6A 1XMOF 2YWFA 3M8SA 2FC8A 4C6AA 4DPTA 2Z2MA 1M90T 1Q82T 3J7YI 4NOHA 2VQEJ 2JFKA 5AXNA 1XTZA 3VVUA 1FNOA 2Q1LA 2D9OA 3CXCR 5T14A 4Q8FA 4R5PA 1B0VA 2M0GB 1X9MA 4NASA 2B0GA 4EU0A 3HHLC 4PWDB 2C2DA 4CO2A 1PIEA 1LK5A 2QG9B 2VPXB 3BO2A 2OEJA 3ET6A 4X2BA 4I2QB 4QIEA 2XMUA 3Q8UA 1MU2B 1JXLA 2L9WA 2YX7A 4DZDA 2ASDA 2CNNB 5DO2A 4WIQA 2LXIA 2YQ1A 2YPYA 3OJUA 3V6JA 1S57A 3CEDA 3AFGA 1UMJA 4ZKAA 2HQFA 4O4GA 1HBMB 1P9QC 2B9WA 2C28A 3AD7C 3BR9A 3TZYA 2PDAA 2J76E 3TAQA 3DCAA 4HACB 3OFGA 4DR5F 1JK9B 2CJKA 1DURA 1Q53A 3ENVA 3MF5A 3QRPA 2H5IB 2IVYA 3HFZB 5FLXU 2YKOA 3HZGA 4WTOB 3G86A 2GO8A 1BGXT 5KT2A 1UP1A 1WEXA 3POTA 5IV4A 2KG1A 1ITPA 5IC4B 3R5BA 2XZTB 3HHLA 4MAKA 3MI7X 1OS5A 3DHWC 1CG2A 5DGAA 1SL1A 1EKRA 3ET6B 4PZVA 4YN3B 1H38A 1ZS6A 4NE9C 4OJHA 1TAUA 2E1RA 1XMOJ 5L46A 3GTYX 3KHHA 4KKOA 2Y9HA 4EEYA 4IG0A 2Z4PA 1JJ4A 3CMAS 5CYJA 4ZVQB 3FDSA 3S6EA 5ETSA 4O0NA 1OQ6A 4KO0A 5KFGA 2EXUA 4UOCA 4OX7A 1DARA 2BV3A 1OY8A 4QCLA 1BWEA 3DOMA 2D3UA 1RHKB 2JRSA 1UWAA 3PRVA 1N5SA 1S0MA 4L74A 2Z56B 3THVA 4UTGA 3NMRA 2HNZA 4YB7A 3MPYA 2RILA 2V4JA 3A3PB 2B9YA 4PWUA 4HDHA 3R1HA 2QA4S 3POTB 3O8WA 5RUBA 2YNHB 5DQIA 2LDIA 2XMMA 4LRFA 3TWZA 4DPWA 2WVCA 1TVRA 4RU2A 3FMBA 1B7YB 3TZWA 3S7RA 4J91A 2GVDA 2XYGB 3HVTB 2FHJD 2Y0BB 2G2YA 2XMWA 4KKOB 1E6YA 4DX6A 3GIKA 1VS3A 1S9EA 1PAEX 1T11A 1VRUA 1RAEB 3EVMA 2UUWA 1YK9A 2EK6A 4GKKJ 2EEYA 3DOMB 1IKYA 1S6PA 3KNAA 3C8YA 4NXMF 3CCUS 1CBKA 1QAJA 2UVWA 1XBWA 5G0RA 4O0IA 4OZ0A 2HNZB 3LANA 4CM2A 2A6OA 2AYMA 4I4BA 1KTQA 1Y11A 3HSJA 4PR6A 1TL1B 2J9EA 4OX9J 2WB1D 2CADA 3F41A 1TTHB 4CRJA 2MGZA 2CZVC 5D4PA 5B0DA 2A0FB 1ZAVA 1Q1KA 1XR7A 3UO0A 1VLOA 1OSCA 3A1YG 5KFNA 1RA6A 4BLGA 6AT1B 2R7TA 4I6WA 3NS5A 4A8YA 4IH5A 4C9DA 3MM5A 2JEGA 1TK8A 3R5DA 1S1UA 2DT9A 3UE2A 3GYNA 3FGVA 4CT8A 2ZBRA 3VQSA 4WFXA 3QMQA 4LIRA 1CJTA 4U8VA 1RT7A 1WC5A 3HKZD 5J1NA 3KLEA 5GAEU 1E6YB 3SXLA 2GAHC 4HEA9 3ZTSA 1FK9A 3EMTA 3C66A 4ZJQA 2HMIA 4ELVA 2FHKA 2K1RB 1FFWB 2AJQA 4GMKA 4F3MA 4A47A 5DQGA 1S6PB 1TKDA 2HFSA 3V2UC 4QR0A 3Q2TC 4P52A 3RAQA 5DDPC 4DUZF 1U24A 4DF4A 3W5YA 4WK1A 2D1CA 4DSLA 1MMLA 4OX8A 4LJMA 1U2RA 2MGZB 3EYZA 1VI7A 1HBNB 3UDEA 2DH8A 3P4UB 3L09A 5KFPA 3FQKA 2V8PA 3EVOA 1IKXB 1L3SA 3MM5B 1F2HA 4JV5F 1KS2A 1BQMA 1IM4A 2H54B 5B0EA 4MKBA 1HD0A 4YHHJ 4NXMJ 4HYKA 1FE4A 4EUVA 2HBQB 2V8HA 3A8KA 3KLEB 2W25A 1FCAA 3GJQB 3KFWX 5F0UA 1FK9B 1VQMS 3UQSA 1VBXA 3D9BA 1LW0B 1DQ9A 4LF8F 2YNGA 4YY3F 2KT2A 2LVWA 4OIXA 1D9AA 4P2SA 2ZH3A 4F0HA 4DSKA 4ATNA 2AGPA 2G0JA 3DRRA 2R7WA 3JTOA 3V6DA 4OYIA 4OZ5A 1CC7A 4AL5A 4URQU 3P45B 1PG5B 4ED6A 1NEEA 2O5DA 1EAYC 1B99A 2DCLA 4ZVHA 1GTHA 4X66F 3G8SA 2IPOB 2CVEA 3PYGA 1HW9A 3L7UA 1F2GA 1UVMA 4YR3A 4LR8A 3DOLA 5HMXA 4A8KA 2HRUA 1BQMB 2L9DA 4HL9A 5CZXA 4F50A 3KXDA 2CPIA 3DLEA 3QZ8A 2BJ3A 2VKZG 5CABA 3W2WB 4OLOA 1Q5VA 5IT0A 3W60A 2CJ9A 3IRXA 3FK4A 3TUJC 1FRMA 3QAUA 4DUZJ 1FDAA 1MSWD 3BKTA 5IT4A 4KHPJ 2QYGA 1T0TV 1ZA2B 1WD6A 4DQIA 4K0KF 2GHPA 2EVZA 4CLFA 4P2XA 3UN5A 3TNVA 4MYTA 3R5CA 2ABYA 2IA6A 1Y3JA 2B7BB 4JV5J 2LEAA 2ZBIA 2V4QA 2B56A 2RU9A 2GHVC 3CGIA 1KOHA 5IM0B 3OT9A 3QQCD 3BBFA 3N0VA 5IC6B 3AQOA 1V6HA 2N7YA 2P6TA 2FD2A 1KC8T 1KP6A 1S0NA 3JSRA 2XGPA 1REGX 1S1TA 5C25B 3CJQA 3VGTA 2LP4A 1QE1B 4YY3J 1UVKA 1OSDA 5HQ8A 4RKUC 3DLEB 1SJ1A 4PG4A 2JWNA 1G6BA 1Y00A 3HK2A 2ZH6A 3UCGA 3SBMA 4I0WA 1ZAWA 4WXOA 1IR0A 2K06A 2M88A 1I6JA 2ALZA 4X66J 2V9KA 2ZH9A 3H8YA 3TAPA 3U1MA 3TA2A 1H2TZ 2HFNA 4Z7CA 3BH6B 2VIHA 2YXLA 2IDLA 2OPSA 3PEHA 3PNIA 1VHFA 3KDNA 4ZJLA 3SCJE 3H7HB 4NXNF 3VGVA 3GSDA 3I31A 2E1MC 1S49A 3Q8SB 2ZD1A 3ETMA 1N33F 4LREA 2L41A 2WOMB 3QSYB 1I5OB 4UQTA 3C15A 4QU7A 1S1TB 4X64F 1REVB 4Y34A 1HBOA 4C0BA 2XYPB 2X3DA 3ISND 1NDKA 4A8SA 3H5SA 2VG7B 4KB7A 4DL5A 2ALYB 5KFCA 3BREA 5KOWA 4N76A 2M2BA 1S4FA 1ZPWX 2R8IA 3THPA 2MPUA 1FA0A 4J9NA 2HZCA 5CH7B 2HK2A 4L76A 4NLQA 2W2NP 1KNZA 4IR1A 3O1LA 5L38A 3IWNC 3H98A 4ECRA 2HEKA 3LP0B 2UXCF 2XMKA 2DNYA 2AJFE 4WP9A 3MCOA 1SCJB 3OFEA 2V8GA 2ZE2A 3PX0A 4NZ7A 2RH3A 2M9KA 3ILIA 1LK7A 1ZPVA 3IR7B 4OYXA 4FPIA 4LVNP 2VZ9A 4BDPA 3B82A 2QRRA 3BGUA 3VV2B 3N5BA 1VQPS 2VG5A 2PT0A 2DK2A 3C15B 4RL1A 2J9CA 3QPIA 1HBOB 3SSSA 1QDUB 1QAXA 1FKAF 3RR7A 3ZZYA 4W90B 3HT0A 4IQXA 3LPYA 1NK8A 5L1JA 2ADBA 5DG7A 5B09A 5HI7A 1MG7A 2BQ3A 4OI0A 5HROA 1WC3A 3IO1A 2JC1A 4ZMMA 3MPUB 5L8RC 2ZC4A 3I96A 3SQGA 2IIHA 1Q5YA 3KK1A 3OL6A 2D3O1 5KFOA 1Q95G 3US5A 2HQ3A 3A3NB 1RAIB 3BQ0A 2X1FA 3O3LA 4OHVA 4X64J 2VF3A 1D9FA 1TKZB 2XMJA 5B0GA 2ZBQA 1SJQA 1N5QA 4DWIA 4K50A 4A8QA 2HHPA 4P75A 1SPBP 3NMAA 2WK4A 3OXFA 2XY5A 1IBKF 4B3MJ 3MR6A 3PKMA 1CEZA 4NCAA 2VOPA 2AEMA 2HRTA 3OTEA 2VPYB 2HZAA 1FO1A 2VBXA 1GEHA 2UXCJ 5KFMA 4FYVB 1S1VA 2E7WA 4OV1A 1R0AB 4FZVA 2XMTA 1NK5A 3CF5Q 2C1EB 4JYAJ 1C0UA 2UZAA 4JI3J 1WC6A 3R3TA 5L1IA 2NXJA 2F63A 2YH0A 3OHBA 4DSIA 1VBKA 3KK1B 5D8HB 5HN0A 3T5JA 4WYLA 1LNQA 2OI2A 1UTAA 4JBCA 1I94F 5D4OA 2OPRA 5CYQB 2HPUA 3HP6A 3DNCA 2BA9A 4MK9A 3M8PB 1IXKA 4YB6A 3DU5A 3UDLA 3C14B 2K7JA 3CPWR 1CJKA 2E5HA 2DHHA 3NAHA 4ECZA 1J2VA 2Y1IA 1N0VC 3KLFA 5T7LA 3UD5A 2H4WB 1RYSA 1WI8A 4DFKA 4KBIA 3SIPB 2ATCB 2AEFA 1CS4B 2XSFA 2ZOGA 2CIMA 2JVOA 1U47A 4ZPDA 2OFGX 4DBQA 4WFAQ 2FJVA 2O1PA 2MHNA 3M32A 4F0KA 2XZDB 3GFZA 1C0UB 4FBUA 3F44A 3CWJA 4ZVFA 4Y2AA 4NMXA 1KRPA 3UWTA 4ZVTB 4P7TA 5LMNJ 1Y0HA 1LQ9A 1K73T 1ZZFA 2OKQA 4DMZA 5IV3A 2NZCA 4N5SA 8RUCA 3S01A 3WC0A 5AT1B 1IBKJ 4PXBA 4MT1A 2OGUA 2EFNA 1MW7A 2E5LF 4ICLA 4PQUA 1KSPA 1I51B 5HQMA 3CDUA 2R2RA 5KFBA 2WSCC 2IAJA 2W9AA 3KLFB 1RU1A 4FYWB 4N8NA 2E44A 2B4UA 2ZUGA 3N6MA 1VJWA 3QRRA 3MTJA 4ED7A 2WB4A 2ILZA 2WW4A 1JJ2R 1R3NA 3SQOP 4NLDA 2FJXA 2ZWPA 2IBOA 2HFVA 1IKVA 4I56A 1HIYA 2BANB 4LMZA 2BOAA 2HAIA 1JWWA 1LW2B 2WHOA 3D3CJ 5J1EA 4ED8A 4J9QA 4R0EA 3JQMA 2X7IA 2XLJA 4ZA1A 3BSOA 4KFBB 2MJUA 3R7BB 2DRDA 4EO6A 3I55S 4ED2A 1SC6A 1LOUA 2DR8A 1C0TA 4B17A 2C42A 4RUCA 2IM0A 1AW0A 1CJVA 5D0HA 2QT7A 5DG9A 4PQUB 4FNIA 1OO0B 1DLOB 1LV5A 4RNMA 3ZTPA 1SC1B 2MKSA 4U67Q 3GG1A 2ZH8A 3KHLA 5HQLA 5KAKA 2LA4A 4KPYA 4OHXA 1FXDA 2XCPA 2HLUA 4J5OA 4IDKA 1TL3A 3C6TB 4LF9F 2Y8YA 3ETOA 1KVKA 5C42A 1SIZA 5L1KA 4OYMA 4IOAQ 1Q0NA 4U7UD 2J6SA 4HT7A 5KG0A 2NLWA 4JOUA 1VRQC 4YQWA 4ES3A 3BGFA 3PYDA 2X51A 4K59A 2OTLS 1UW4A 2J8AA 2E5LJ 2B9EA 2ZHBA 3ISZA 1GNKA 2QGFB 1YJ7A 1AZSA 2FTRA 1UPMB 2ACMA 4MIWA 3LP1B 5KT3A 1RTIA 1XR5A 1HYSA 1PC4A 2Z57B 1V9OA 3NRBA 1RWMB 4Y2IA 2DGQA 2M4MA 1U6BA 2KXFA 1S76D 1CJVB 1MN7A 2AZ1A 4NL5A 3AH6A 3HPOA 1S6QA 3M8WA 4ZVRB 2PFDA 4OYWA 2R8HA 3OL8A 4CLUA 4F4KA 2V6AA 3D7SB 2K3KA 4EYHB 2AKWB 1DTTB 3PW0A 1RTDA 3MMAA 4ES1A 2XS2A 1PYSB 5KFJA 3VHQA 4HH0A 3I56S 5C42B 9ATCB 3CJSA 1KQFB 3AODA 3T6BA 1H72C 2HVIA 4ECTA 2XQCA 1KFSA 3RAMA 1NB2A 2W9CA 3IM8A 4HI2A 1BXNA 5K14A 2A18A 4H4OA 2ZHAA 3BH7B 4F25A 2IM3A 4NYPA 2I5JA 5KT5A 3SFGA 3FCWA 1PCAA 2N4DA 3RB4A 4DL4A 2IC3A 4DCPB 4O44A 1RWUA 1WUUA 4HTJA 1A6LA 2HS0A 2NS1B 3LF0A 4B02A 1SL0A 4LF9J 1EETA 4ZIVA 3W1YC 4X4RA 4DQSA 2LKZA 4WU3A 1SJ4P 4JI7F 4ED5A 4C8MA 4DR1F 4FNHA 4U9RA 4PKDB 3WDOA 2CA9A 1QUPA 4WPAA 3MEDB 2I1RA 5E0OA 4YOEA 2FC9A 1X0FA 2VODA 4O3SA 1R0CB 4IH6A 3W7BA 4ALZA 2X3GA 5DQHA 2VH7A 1EJ7L 2G4BA 2VU5A 1RTDB 4F4ZA 3WC2A 2OTJS 2ASYA 4K4UA 3WIUA 4YMEA 1FTCA 2RE1A 3V81A 1P27B 4DL2A 1JQGA 4BWJA 1DFDA 2DRBA 4WKRA 4H4OB 1PJ5A 1SH2A 3E3XA 4UZBA 4ITSA 3M9NB 1RAHB 5IT9U 2IC3B 4O44B 1WORA 3ILLA 2OEMA 2QN6B 4Q45A 5KFFA 1KR4A 4LFAF 3LPEA 2ZH7A 4B9SA 4HLBA 4OZ2A 3OTOJ 4LT6A 2PD1A 4DS4A 2DD8S 1VQ5S 3ZNUA 4JV0A 2VJVA 1TK5A 1FKOA 3J7A1 4DPOA 3PTWA 3NY0A 2LQ8A 1U1PA 2MQNA 4TNOA 4Y3CA 4KQZA 1R43A 5CD4H 4TYAA 4LF6J 5D78A 3AXKA 1C1CA 2A2CA 3SYZA 2CJAA 3I32A 3N9UC 2E5IA 4GKJF 3SCIE 4PUOB 1SXLA 2WVEA 4JI7J 2Y3YA 4DR1J 4JI8J 5GADI 2LXUA 3SZ2A 4JB8B 5AE2A 2MQ8A 2KYXA 2EFPA 4J7CA 3DOKB 3R27A 1YGYA 5F9NA 4YEAA 4LF7F 1B64A 2BR0A 2M8HA 5KFVA 4MYUA 5AE1A 3D1QA 1UJ5A 2EG1A 1NAQA 1JLCA 3QATA 3NS6A 2W2OP 2BE2A 3MHYA 2HZVA 4NLYA 3OSNA 2B8PA 2U1AA 1H6KX 3MTKA 2W4CA 5D4NA 2DKOB 3A13A 1M1KT 2FHJA 3KUGA 2YKNB 5C7PA 3QAEA 1FKOB 2J7UA 1NJIT 4P6QA 1XMQF 2BZ2A 1AFJA 1X5OA 3PZPA 2BJ8A 1OPIA 3UI3A 1TQLA 4B9NA 2LQ5A 3V6HA 3J7ZT 4FYYB 2C22A 2QV6A 1C1CB 1XJWB 1TUWA 5I3UA 2ATLA 3SV4A 4J9UE 4CO3A 4DSEA 4DV3F 3QLHA 1SBRA 2FVCA 3CJ8A 5ETOA 3RG6A 4URSA 1W2BR 5EDWA 2KM8C 4Y2CA 2J7KA 1HLWA 2ASLA 1RT6B 2FLLA 3X1LB 5F8HA 3BYPA 2BE2B 4ELUA 1N34F 1IR2A 1TAQA 2DGXA 1U1MA 3C16B 2MEWA 3L9ZA 2DNKA 3LA0A 2YWWA 4NPOA 2RDIA 1J5OA 2YWHA 4Y2KA 2RJZA 2Z30B 2CDRB 1JJCB 3IAS9 2L48A 2OHDA 4ED0A 1RJJA 4YR0A 3DYAA 2AYBA 3CJ3A 4LF7J 4M5NA 5K8OA 4WP3A 1HHTP 2SXLA 2FDNA 2QMWA 4ECWA 3N79A 3LGHA 3OR2B 5DS7A 1QJHA 1NHVA 4M5DA 2QFIA 4BC9A 4OJGA 5L9XA 2DGWA 4O3PA 3OVSA 5C5JA 2K3IA 3K8VA 2R7VA 2CJXB 4DZ6A 3SMZA 2R7OA 2DB1A 3LWMA 1HNWJ 2KI2A 3IMQJ 2GIQA 2Q6CA 2C3PA 3VALA 2Y1LB 3MECB 1J5OB 4WKYA 1FNXH 2ZJPQ 2E5JA 4RUAA 4DV3J 1S99A 1FDNA 4B08A 1VOMA 1LFPA 3DYAB 1JB0C 1VGYA 3W2VB 5EWEA 3G2XA 3GV7B 3JB9k 4FXVA 3MAHA 3LGMA 5E3CA 4K4WA 2EC0A 4C48A 5IQ6A 2MDAA 4OI4A 1GX6A 3E01B 4DUTA 3K59A 1N34J 4WU2A 7AT1B 2N7CA 4CWBA 4DX5A 4LFCJ 3JAMY 4A8WA 2CPZA 3HSGA 2GA7A 5KFEA 3AJ1A 5BYSA 4DL6A 5HL7Q 2I2YA 1TKXA 4JI2F 1F1BB 4AXJA 2MB0B 3MFHA 3I0SB 4A4JA 1TP7A 4L6V3 5A8KA 3AOAA 3OQ2A 5L9NA 2NCKL 2KG0A 1M1HA 3CD5A 1RT3B 2X1GA 1RXOB 3CDEA 3VAHA 1RT5B 4UY8T 4X4PA 2FPHX 3RAXA 2KFYA 4Z7YA 4CH0S 5KFXA 1M5PC 4A8OA 6FD1A 1WOPA 2BRLA 4WWSA 5KG5A 1RUSA 1APSA 1WDTA 1ICEB 1N88A 3T5KA 5E2QA 2CG8A 4Y00A 3IS9B 2IRYA 2JSXA 1P6TA 5I42A 2RSQA 5HBMA 4P10A 4N47A 5KFUA 2AYGA 3MDFA 4DI6A 5EN1A 1RKJA 3SI8A 1RSCA 3PW5A 2Q66A 1GTEA 3IG1A 4RBTA 4BCAA 1DAXA 3CSKA 2VG6B 2GFFA 5A2QY 2WCXA 5JXSA 3KMSA 3AOCA 3GP9A 3EPGA 4LSNB 2GAGC 3V6KA 1V5IB 3ISNC 3C6UA 3VZHA 4DG1A 4IO9Q 5A8KB 1O5JA 1NKCA 1GMVA 3D68A 4ZVOB 4M94A 1N36F 3CUNA 2VBWA 4DL7A 3RTVA 3H2VE 1D1UA 1RTJA 3D6TB 4I67A 1IBLF 3FCVA 3VAMA 2JLFA 1NKEA 2FVPA 1C1BB 4ECQA 3DN9A 3LTOA 4TQSA 4C7QA 3WZ0A 3BF4A 2MKJA 1L3VA 2CPJA 2AJ1A 3JSMB 4OYPA 5HBMB 4ZPVR 1S12A 4C3MA 1U1RA 1QY7A 4X84A 2FHOB 4NLTA 1M5VC 4URGA 4U8YA 2UV8G 4X4OA 3FSXA 3IG1B 4K4XA 2MSTA 4G1PA 3BSAA 1FEHA 4K4YA 4TLQA 3BR8A 3HULA 2OPQB 4QIGA 2DY1A 5E3AA 2AV5A 2F4VF 4IFVA 4D3HA 1D3WA 1NSPA 3EZOA 4P72A 1FFGB 4V19X 4U6PA 1OPZA 1SVDA 1WACA 1HR0F 3G4SS 4IRDA 4EFAC 4DV4F 5SZTA 3Q83A 5KT6A 2KXNB 3SCLE 5I4MA 5DRKA 1HQ2A 4A48A 3OVBA 2VPZB 4LRDA 5D3GB 2IM2A 2W2MP 2H5JB 4TLRA 5EHHA 1JX4A 3M7VA 2A1BA 2R8GA 3CB4A 5LOQA 4HHHA 3MOJB 3R8YA 1Q79A 2QJ3A 3M6VA 1PSDA 3CCZA 5A8RA 2HNYB 4KPCA 3MEGB 3KLIA 5HMWA 3TX0A 2XG8A 1BQXA 1IWAA 1YJNS 3PCOB 3W64A 2ZC3A 3NP5A 3MM9A 1N36J 4KAIA 4NLPA 1ZTTA 2RAQA 4LF5J 3KOAA 4P2FA 2UXDF 4LIWA 1M5OC 1IQZA 3G71S 3FBBA 3Q22A 1HNXJ 1IBLJ 4IFVB 3AAWB 2FLPA 4RX6A 1JLBB 1D8YA 2XI2A 2NUHA 5HVHA 4NA1A 2VA2A 4X4QA 5E5NA 4I7FA 1RBOB 3CO9A 3ZZTA 3MMJA 1WHVA 2JLGA 2FZCB 3D6HB 2CAJA 1VYAA 1JLGA 1B0PA 3OTDA 5F3TA 4AFFA 1RAAB 2OEKA 4A8XA 2ACYA 3CCRS 4ID5A 2F7VA 3GFXA 3J7AN 4DLEA 1DQAA 5J2QA 3T5LA 5ETQA 4A8MP 2CXEA 2FJEB 4CLYA 4IH7A 2F4VJ 1XNQF 3IR5B 4P9SA 4IO1A 4MKYA 2V34A 4WZQA 3HVAA 2CQ2A 5DETA 1RWVB 1HR0J 2MMYA 2YNFA 3OXLA 1NK0A 4EI2A 3OXGA 6FDRA 2JVRA 2YPZA 1Z2LA 1ZH5A 4I2PA 2IRUA 3BPSP 3LH2S 3NLCA 2L08A 3VWSA 3SFUA 3PRBA 1RI7A 1Y5LB 4EMDA 3J81Y 3CVKA 3Q23A 4B3TF 5HMYA 1HFEL 3T1YJ 4WP8A 5AE3A 4WJBA 3HJFA 4I7FB 1EARA 3BM7A 1MWYA 2ZOMA 4J9SA 4DJBA 8AT1B 3DM2B 1SI9A 3VR1A 3TX8A 3GMGA 1F5BA 5LT5A 1G2EA 4GVLA 3M2UB 2PE8A 4OYZA 1H7WA 2RQ4A 1N8RT 1SC3B 2YTCA 3FRYA 2UXDJ 3MD1A 3DRXA 1NRKA 5AJ3J 4WFNQ 5DGBA 1UFKA 3SDEA 5E3RA 2IA0A 1RCOB 4B3OB 2N3LA 3ENWA 3RU0A 5DDQC 4DCOB 2GVZB 2DGTA 3QFHA 4YR2A 5H9EK 1N5YA 1YRTA 1SIWB 2YNFB 2AJ0A 5GVQA 3EGZA 2ZJRQ 5IOLA 2OPPA 2V67A 4JI5F 4I2PB 2CKWA 3GE9A 1NK6A 2JZ5A 3IA0A 4QW9A 1ZYQA 2ZKTA 1KLNA 1F5CA 3H20A 3GSIA 2QLFB 3DLGA 1SC4B 2WRMA 1GX5A 4BS2A 4ZCLA 2BACA 5CYMB 1XNQJ 2XSJA 2BUNA 2EBGA 4RW9B 1V3SA 2DBBA 1FVQA 3P5BP 1T03A 4W4MA 2GIFA 4I69A 3D4JA 2HGNA 2DNGA 3MUTP 2M8DB 2QO3A 4NLWA 2CQ0A 4N77A 3H5XA 1IKWB 2KHCA 2WBRA 1BY9A 2RF2B 1IJFB 1OYEA 3SDEB 1BUXA 3D1HA 3OL9A 4B3TJ 4ZP7A 3ELHA 2QMXA 3TJAA 2OMOA 2XULA 2Z2YB 3M9OB 1RE1B 2F8MA 5KFZA 4KV8A 1SKUB 3HSZA 5HJXA 3MCSA 2ZH1A 2VASA 5B7WA 4NEZA 5KFHA 1YJRA 3FFIA 2UUBF 2PN6A 2OPPB 2R7UA 3BKFA 4QBUA 2D7SA 2G1HA 2GCFA 3RB3A 3NNHA 1TL4A 3OFFA 4F36A 2FGCA 4IFYA 1H98A 2DJWA 3QT6A 4DXLA 4PXDA 4QZVB 3K5OA 2VUGA 3DLGB 1GH8A 5K8MA 4RNNA 3OVAA 5MLCV 4DV7J 3DDIA 4KR0B 1PYOB 2G2ZA 3I5BA 4OJ1A 3OUYB 3EXYA 4C0HA 4MFBA 1T03B 1FX4A 1J27A 2G1DA 2IJRA 3IFEA 4HI1A 3W65A 4H4MB 4A46A 4DV0F 4JI1J 1LXNA 4X4NA 4NI2B 1N56A 4N41A 1TELA 1AUSL 2BEFA 2ZZMA 2OO4A 2YNIB 3W3SA 3MD3A 1S72S 2DGVA 2EPIA 4ANDA 2BJ9A 3M4XA 2B5JB 3M6UA 4ED4A 2F3JA 1UA1A 3QZ7A 1R7IA 1VIXA 1RTZA 3K5NA 2J0WA 4H54A 2C2NA 3RRHA 5F8MA 4IRKA 4L73A 3D5MA 3ICLA 3HXMA 1HHSA 4QIWD 1WOSA 3B8HA 2WZ1A 5LSLA 4X4TA 2R3VA 3RW7A 3ZTRA 4C8LA 4JV1A 3FBEA 3GLJA 3DRPA 2UUBJ 4S0MA 4LFBF 1K47A 2M70A 4C8ZA 2B3TB 1TUGB 2YWKA 3QWPA 3AOBA 1TUVA 3CCMS 1A7GE 3H90A 3QYYA 4KC5A 2PMHA 1S9FA 1UEUA 1SH3A 3M8YA 1ZBTA 5LMUJ 1JLEB 4F2SA 2CJYB 3H59A 2V68A 3K5LA 3UW1A 3FKBA 1MROA 3BDEA 4P74A 3D1OA 4Q7AA 3W5XA 3PY8A 1FWPA 4C11A 5D15A 1JXVA 3K0JA 1FRLA 1S6UA 1S97A 5K8PA 2UV8A 3ITHB 3K8WA 5H9FJ 1UKUA 1UZHA 3Q86A 1FRKA 3RGIA 4Q44A 2CJQA 1NK7A 4LSZB 4RUBA 5EX3A 2WBMA 4QYRA 1X9SA 3RBDA 1URNA 3CCES 5FJ4A 4K4SA 1JLFA 5CAAA 5M2RA 2BBEA 3CMQA 2DGSA 4G65A 5DDRC 4NYZA 4X4SA 2RKIA 2J5AA 2FGOA 2MQOA 5D77A 2C3OA 4IKAA 3HFKA 4GVBA 2PFFB 3TUIC 4LBIA 1ZTWA 5J2NB 3MCMA 3CJTA 5A0YA 2HVDA 2W7AA 2Q43A 2V9WA 2GMHA 1KWMA 3T19A 4IOCQ 3TUPA 4C11B 3OLBA 1T3OA 4LFBJ 2OD6A 5EWGA 2W9BA 1NK4A 4YDXA 4R5PB 2RDJA 3KTQA 1WTFA 4DL0C 1VQYA 3PHTA 4CQ1A 1NSAA 4K8RA 2VD3A 5THWA 1PYTA 2VHGA 1FDBA 5HMZA 3OTCA 3OJSA 1NM2A 4D3GA 4ECVA 2L9NA 2QX0A 3W5ZA 1JLFB 1HQEA 2C3YA 4AT1B 4ZPCA 5DJBA 4FPRA 1T3NA 2OMLA 3GYGA 1E6VA 5KFLA 4RLEA 2KVQE 4O4GB 2LU2A 1R27B 2HIQA 4AYBD 1X5SA 3ADAC 2OIHA 1F0XA 3KK3A 5EGYA 2R7SA 4IQMA 2M3DA 3MM6A 1DHMA 2LFVA 2O01C 4MKVA 5A0YB 1LWFA 3WBZA 1YLXA 2W24A 2G0CA 3NBPA 1F9EB 2CPFA 4J9OA 5F41A 4B3SF 1IR1A 4B9LA 2HBRB 5KFIA 1U8SA 4NCBA 1TL7A 1TMMA 1OMSA 2HBZB 5H1SV 2ZNZA 2FYXA 3QT8A 1HWIA 2MTLA 3GQCA 1KDNA 3B4MA 1S6OA 3IRWP 3BN4A 1TFYA 3NG8A 5D0RA 3HHLB 4MIAA 4N8OA 3CC7S 3R1LA 4FF2A 4JI0F 3VVTA 2XC9A 3BS9A 3CO0P 2MQLA 3BGOP 3I0RA 3JQJA 4M5GA 4NCGA 4YS2A 4K2XA 3M2VA 1HQEB 1RHQB 3PDNA 2RNEA 4DR5J 5EUHA 3P5TL 3NGUA 1UL3A 4IG0B 4BHQA 1RAOA 3PFOA 1YZ6A 4KO0B 4HDGA 2F4FA 1X0PA 3KK3B 4LF4F 5IWAF 3CULA 3BQ2A 4AD6A 2P5VA 1LWFB 2L3MA 5CQGA 1RHUB 4E0DA 5E33A 1NB7A 1C4AA 2J8SA 3NBPB 1BD6A 4AQYF 3DLJA 1ULRA 2ZFHA 2IMWP 1RQ0A 2V4JB 3R9LA 3U1LA 2R8KA 1FFSB 1TL7B 5B0CA 2DR5A 3D66A 2QL5B 4QYZK 4QIVA 3TP2A 4Y0FA 4CH7A 4ANEA 3EM1A 1WC1A 1VBZA 2GHWA 1GXLA 1NO8A 3U1NA 1TVRB 2MKKA 2CWXA 2DR6A 4DF8A 3EGNA 3MR2A 3I0RB 3PX4A 1FVSA 4NCGB 2FVSA 1VQNS 1R8HA 3S1TA 1U2CA 2CPXA 2GVDB 3TEGA 2LXFA 2HQIA 1S9EB 2EBEA 2IHR1 1DRZA 5KT7A 1VRUB 3RJMB 1S5ZA 3DLBA 1U0SA 2BQUA 2B43A 3VGUA 2RMLA 1ZM3A 4GC6A 1IKYB 1AT1B 3QIPA 1J5EF 3UR3C 5G0RB 4X65F 1FI4A 3OSPA 1CQNA 1HW8A 3ZO7A 1N32F 2AIRB 2HS4A 1GQEA 4WFZA 3PIPQ 2E1PA 2A10A 3TZZA 4ZN1A 1WELA 1R8BA 3KLVA 3HLUA 4MK7A 2ZM6F 2YY3A 3H0PA 4OYBA 2MZSA 1RWWB 4PCQA 4FKYA 1S1UB 3RYLA 5IWAJ 1F9HA 3CIMA 1CJTB 1RT7B 2AQ4A 3NGKA 1VLYA 2H3EB 1QSLA 3MMBA 4KGVB 1HMVA 2P9GA 3Q24A 3CC4S 1QTNB 3FEZA 4L3NA 1DY3A 3ULHA 2HMIB 4DR2F 1UEVA 5CD4A 2KYZA 4I6YA 3M30A 3H40A 4NLSA 2MKHA 2BE7D 4UZCA 2I6WA 2E7VA 1NU4A 1WSRA 3QIPB 1HWKA 2Z2ZA 3OR1A 3IN5A 2VDHA 4E8UA 2C3UA 1UVNA 5BYRA 2DHGA 2DHAA 3DLKA 2FJBB 5F0WA 3NGSA 1U48A 2XLKA 2ZVIA 4UW2A 1QUVA 2VC1A 2KB2A 3SCKE 4M95A 4OZ3A 4PPDA 3A12A 2H51B 3K5MA 1SKRA 3ZZOA 1U1LA 2IY5B 1XQIA 3HMJG 4EBDA 1QD1A 3CCTA 1J5EJ 2ROEA 4CYUA 4EYIB 1DJ0A 1H7XA 3MMBB 4USUA 4X65J 1BC6A 1P8GA 5BR8F 1CULA 5K20B 2DGOA 1N32J 1VC6A 3QBCA 3Q8VA 1YJTA 2YNGB 1S1WA 3PYEA 4UUWA 2FVRA 1DBDA 3I9V9 3OR1B 3DRRB 2UUTA 3V6DB 4FP9A 4GRSA 2VONA 1X4AA 2MZ1A 2IMOA 1LFWA 3DMJA 4WFBQ 2MZRA 1A9NB 3DLKB 2IFXA 3H2LA 3ZZ0A 2FVQA 3BGLA 2DXEA 2E5GA 2XWXA 2R7QA 4O3NA 1RWPB 2W4PA 5B08A 3DOLB 4TY9A 1RK8A 3G6XA 4DR2J 4AL6A 2QLBB 3PO5A 4LF8J 3CDAA 3JS9A 1WNEA 1HWLA 1U1QA 3TJ9A 3RRKA 4PABA 2OAUA 3FQLA 1VISA 3IRXB 3EICA 2RHQB 2CVIA 2C3MA 5IZHA 4UT4A 5M2PA 2QA1A 4DCJB 1KOOA 3EDRB 4IG3A 4ERDA 5A6PA 2CQ1A 4DDFA 3FBFA 2I8EA 4DUYF 2BKNA 4EBEA 4NRUA 3PX6A 4P73A 1YTYA 1U7LA 3ENQA 1HL6A 3HT3A 2HSEB 1D09B 1ZETA 5A76A 1RTHA 3CD6S 4LSLA 3WX4A 1F9FA 4LRCA 2PI5A 3DMJB 2RQMA 4LF1A 2KDOA 1WDDA 2VFUA 3QWUA 2NXUA 1FD2A 2RHSB 2HBYB 3FEXB 3QFWA 1KHWA 4N56A 2BJ1A 1RA7A 2W01A 3T9NA 3G6ES 3MWBA 4U95A 2BKPA 2PIIA 3HSDA 3MM8A 5LSOA 5CCMA 4F4YA 1ACMB 4K0KJ 1U09A 5FDLA 2B7CB 2ZH4A 2HVHA 1NHUA 3MMCA 2BKOA 1N0UA 1Z2ZA 1JKHA 1L5UA 4CO5A 4PRFA 4RR5A 4Q0BA 1N4LA 2AMCB 3NGRA 4C8YA 1S0OA 2EI5A 2OSRA 1YKWA 2M5YA 7FDRA 1CQMA 3NL0A 1Q8LA 1NPRA 3M6WA 2DHXA 3N28A 4R0JA 2GS8A 1VIOA 1WEYA 2UVVA 2OPSB 4OHZA 3GZ7A 1RZMA 3CD7A 1LWXA 1Z1ZA 1CJUA 4USMA 3CD0A 3RBXA 2DNQA 1YJWS 2Q79A 3GJSB 2ZD1B 5ETLA 2XYHB 1UAWA 1M5KC 2HHUA 3JXOA 3C3LA 1RACB 3DU6A 3BEGB 2CPHA 2CYYA 5ETTA 4ILLA 1RADB 1WF1A 1X9WA 1AUDA 3R5JB 4F3OA 1F60B 3AB4B 2VA3A 1O51A 1UWBA 2C2OB 2E1CA 4ED3A 4MMOA 2YWEA 2B4OA 3A8JA 1N48A 1HNIA 1RAJA 2EFQA 3Q8RB 2HLTA 3GPAA 4CTAA 4OZ1A 4NXNJ 1JNZB 2JLEA 1WG5A 4EGLA 2VOOA 4CLWA 2XNQA 1N33J 4DS5A 3GR1A 5HAOA 2D74B 4WZMA 4PXCA 2CNLB 2JJ4D 2LCWA 1L3KA 2VQEF 4HR2A 1FXRA 4JUZA 1NJXA 2H4YB 2ZE2B 4G3IA 1CJUB 1OY6A 3E2EA 3SSRA 1Q8KA 2YKAA 1UEKA 3QT5A 3CIZA 1WHXA 3S8SA 1V3RA 1YG0A 4ETZA 4ZHRA 3ZFVA 4WK3A 2VG5B 1GXTA 2W2QP 2EFOA 2EKYA 1WJ9A 1VQKS 3QO9A 2POKA 3Q2SC 3OHAA 3UN2A 1HKAA 2DTJA 4OJ3A 1UWBB 3IP0A 1FEEA 5CA5A 3RBZA 2CQ4A 5HROB 1EIYB 1YBUA 1IQTA 1YDLA 1NKBA 1HNIB 2BDPA 2RDDA 3SQGB 5DDOC 1T9YA 3HI9A 4PWDA 5DM7Q 1K44A 1Q7YT 3TVYA 4CLSA 2W4DA 4I2QA 1XN9A 1B3TA 1L3UA 1G3OA 3HKWA 2V8VA 1HD1A 1MU2A 3J80Y 1C4CA 2UUCF 3MAAA 2KH9A 4RWWA 1Q8IA 4WCEQ 3H5YA 2BVZA 5GAGU 4XPEA 2P9CA 1NZAA 4ZHRB 2MZJA 4CLTA 3KG4A 4EZ9A 4OX6A 2YX4A 3EE3A 2E66A 4DSJA 3QO9B 2IYGA 4HACA 1FX2A 3D0HE 2XWYA 1JNRB 3UDCA 2HRYA 4WYWA 1CPZA 4UOGA 1S1VB 3QGGA 4BBYA 1B70B 4OZJA 5ITHA 3PR4A 4KGKA 2G2OA 3IXQA 2XB2D 4DLGA 1R0BG 1FRIA 4B9MA 1FE0A 2VQFF 3PO4A 2NPIA 3FSIA 1O6XA 2OPRB 1IUJA 2BM1A 2KJWA 4RW4A 5LXYA 4RU9A 2NYIA 2VV5A 4CLZA 3HHEA 3T1AA 2LMIA 3FEYB 4ZVEA 3MAAB 3HVRA 1CJKB 1TU0B 1GAOA 4K2JA 1TFWA 1UPPA 1LEOA 5T7LB 1VC5A 2VDIA 4MJKA 1FJCA 3PKYA 2AX1A 1TMJA 1S48A 1D9DA 2ZBPA 2RD5C 3KYLA 2ZH2A 2FUG9 2J6TA 3PJ9A 4W98A 4ETXA 2G9OA 3D0GE 1KQSR 7FD1A 4TYBA 2DY9A 1I94J 2YWGA 3M32B 1M0SA 2B9XA 4MH8A 1FRJA 3TQ1A 2KTQA 1D8ZA 2KRBA 4J37A 3DC2A 2JEIA 2ZEJA 1T02A 2UUCJ 4GKKF 2YNHA 4TXSA 3FZ2A 4J90A 4CDIA 3MR3A 4QIFA 3UPFA 5AXKA 3AD8C 2DR9A 2CUYA 4M5HA 5A8WA 4RW4B 1IBMF 4TN2A 1S9GA 2HHWA 1RT4A 2B8QA 3Q0AA 1G1XA 1H74A 4ICLB 2EFVA 2M52A 3ILOA 4OX9F 3GCXP 4OL8A 3QT7A 2IAJB 3HVTA 2GW8A 5E3QA 4NEYA 5LJ5Y 3Q89A 3NS7B 4LRAA 4E98A 5KFDA 2QL9B 5HLFA 1FERA 1UVLA 4M8LA 1QAIA 3U02A 2V2ZA 1RP5A 2VFVA 3M1VA 1Z4UA 2FJAB 1U1NA 1CLFA 3EZUA 2VQFJ 4ED1A 2HVZA 1IKVB 3DGPA 2AF6A 3Q8YA 4ZN3A 3G9CA 4C2MA 4K4VA 1KONA 4DV6F 2J0QD 5LXRA 5CCLA 5J1EB 1RDRA 3CJ0A 1TL1A 5FIIA 3OD2A 2KFZA 4RWXA 2JEFA 2XS5A 1EB0A 2EG2A 2QFJA 5LJ3Y 4Q2MA 1WTBA 1RKIA 2JL9A 3T41A 2XBPA 3AJ2A 5A8WB 1C0TB 3BBCA 4O3RA 3MR5A 1S9GB 2AD9A 1RT4B 2KKHA 1UFLA 4GC7A 1WSVA 3HHNB 3KG1A 1TV6A 4DQRA 1HI8A 2ZBCA 1T9TA 1SUQA 3OFHA 4CI0B 2QC3A 1FD8A 2CRLA 2KT3A 2J9DA 4ILMA 3A4TA 2HW3A 4IDKB 1TL3B 2VBZA 5HLFB 3SV3A 4YUDA 4B9VA 4PPZA 2R4FA 1QAYA 2K1RA 4R8UA 4Y2MA 3M1VB 1QLNA 4YHHF 5K5MA 1BWVA 3PW4A 3DGPB 2QSWA 2PSZA 3KUEA 2IVMA 3WIVA 1X5PA 2A3JA 3BSCA 5BXIA 1IBMJ 4EBCA 2O67A 3CJKA 3QJJA 4ZK7M 1AZSB 2IDEA 4OI2A 4V19J 2Y8WA 3JTPA 2LQBA 4QWAA 3RBEA 1HBNA 1RTIB 1SKSA 3AA9A 2OP5A 1HYSB 3H2UB 1VRTA 4M1KA 1IN0A 1IKXA 3F56A 3ZZZA 4RNFA 1TV6B 2XM3A 4ZLLA 1SUQB 1FF2A 2FLOA 1S6QB 1FT8A 2FJWA 2P9EA 2CZ4A 4PG7A 4RUHA 3TI0A 5JJBA 3P96A 1P9YA 3PV8A 4DV6J 2FQQB 1NJWA 2OD4A 5FLXY 3MMAB 3K89A 4R8UB 1LW0A 5KFSA 4QWEA 3MUMP 3PYFA 2ZHOA 3D67A 2F8HA 3IAM9 5BYQA 5GAHI 4UOHA 2W9CB 3VGSA 3UFCX 1EKSA 3CJ2A 4EWTA 5K14B 2MKYA 1IM6A 3QGHA 3KG0A 1RGVA 1T7PA 1RU2A 4KTQA 2DNNA 2I5JB 3CJKB 2K8GA 4KHPF 2QMUB 3GIRA 1R8CA 2LDYA 4DOZA 3EJMA 4RJVA 2MZQA 1X7VA 1VRTB 4ZP9A 1EETB 1NPKA 1T9VA 2QLJB 3MR7A 3UNGC 1VQLS 1FJGF 4NYOA 4ZLPA 1Q8BA 4DFJA 1NZ8A 3RUBL 2ZUAA 4JI6F 3W2WA 1AA1B 3EVWA 3T5HA 1XERA 2WW8A 2HG4A 4QW8A 1NK9A 3GIJA 5SUHA 5E7OB 4QWCA 1VQSA 2QIFA 5DM6Q 1S59A 2A2DA 1B7FA 5FD1A 1KN6A 4FXWA 3V81B 1W2IA 1BHNA 4NLGA 1JJHA 2HAFA 3R97A 1WOOA 3L7OA 5T41A 4ZVUB 2DPIA 2IM1A 5F9LA 2F8EX 3K57A 3FUYA 9RUBA 1AROP 2VICA 3KMQA 2W8KA 3HCXA 3X3UA 3R7NB 3TARA 1ZM2A 4OI6A 4XPCA 4CLLA 5IM0A 3HFVA 1S4EA 2PI4A 2Y0SD 2HHVA 2RUGA 3K2YA 2BW2A 1NCLA 2JFDA 3GFYA 5C25A 3QNWB 3LP2A 1QE1A 3JQKA 4DQPA 2AGQA 3JAMU 1NLKL 3ENAA 1KLMA 4L72B 4WTYA 2GJFA 4O3QA 2OSQA 3QSIA 3PHEA 3BPDA 4DFMA 2PMZD 4AL7A 3IBFB 3EPIA 3NOCA 4CLPA 2RT3A 1WC0A 2YH1A 4ZCIA 3TA0A 2KZMA 5I3QA 3JYTA 5M2UA 4KHMA 4C98A 4F04B 4K5RA 2EK1A 3HO1A 4CM0A 1RLCL 3FCHA 4QOTA 4LFAJ 5K9FA 4DR7F 1FJGJ 2P2CB 1GK8A 1N5TA 2BJDA 2DISA 2JEJA 1YIJS 4LF2A 4G1QA 4JI6J 2CPEA 2MQPA 4AUKA 2CPDA 1JLCB 3TAMA 2WOMA 3U7JA 2IJFA 4QWBA 1REVA 3LP2B 2RB7A 1X4HA 4P71A 4LBHA 4TVAB 3NWRA 3CE8A 1KLMB 4GKJJ 3MEEA 2BXJA 1WKJA 2VG7A 4PQAA 4QPXA 4USWA 5A2QU 4UF4A 3FNNA 1FDDA 2PC6A 5J2MA 1RHRB 2K2PA 1URRA 4LUBA 4ZPAA 1PC5A 4ANCA 4IR9A 4EK2A 3JYTB 2LEPA 2DRAA 2DITA 5I3UB 5GMDA 2DO4A 2RRNA 4NLUA 1MWZA 2FHMA 2HHQA 5F8LA 2LA6A 3LP0A 1FWKA 1T94A 2GJ2A 3PJXA 2UUAF 5D4LA 3JSYA 4USKA 3QLHB 2W7OA 4QPTA 4PG8A 2AYEA 3EUNA 2JH3A 5ETKA 4HKQA 2FZKB 3R2DJ 1SJFA 2XI3A 4G1QB 5DG8A 3DFEA 2N3OA 2DNRA 1LXJA 2XO7A 1NSQA 3SSQA 4ZPTR 1XMQJ 4MIBA 3TAMB 1QTMA 2JOQA 4FXDA 2H65B 3EZ5A 3SEOA 2CQGA 3FC9A 4MTPA 3D0IE 4USHA 3ZXWA 5EWFA 2BM0A 3MEEB 4USTA 4U7UK 1KD1T 4DR7J 3IGVA 3BZQA 3LOUA 1VQ7S 5ETMA 4FF3A 2XMAA 5J2MB 3HX9A 2O3DA 4IOBA 2DYAA 1AB8A 4ZDNA 1F5AA 4FYDA 4B3MF 1PILA 4BWMA 3L4BC 3MZIA 3W66A 4UUXA 5KG1A 1YSJA 4KH1B 2KU7A 4M5DB 1T8EA 3TRGA 3GCWP 2AWZA 2CWKA 1JIHA 1TK0A 4DHVA 4JYAF 2HK3A 4JI3F 4O4RA 1WF2A 1ZM9A 3WHIA 4FDFA 1TKZA 4ZJOA 2KM8B 1RAFB 2AJ4A 1Y3KA 4TU7A 2LLZA 2COLA 2HIYA 8ATCB 4YB1P 1U25A 3GIMA 1Q78A 5CZVA 2VFSA 4ZLNA 2RU3A 2WONA 4QR1A 5JUMA 5F8JA 1N54B 1KQKA 1U49A 4HHJA 2GC8A 3CJ4A 1N52B 3P3DA 1R31A 2UUAJ 5IQQA 1R0AA 2DCUB 1V5VA 2V0NA 1YX2A 3MURP 2ZOFA 2XHWA 2B4VA 2HFZA 1FWLA 2WVDA 2VFRA 3VAGA 3BDPA 1NXIA 4NX9A 3ZNJ1 2X1AA 1QSSA 1KQGB 2YQ3A 4LR9A 4OYAA 3CJ5A 1FJ7A 3UD4P 2Y1JA 5CYQA 2D69A 1X4BA 2J0SD 2KN4A 4U7CA 1W25A 1ZA1B 3M8PA 3MOZA 3C14A 1SQEA 4WXWA 5LMNF 2XO6A 4TU8A 3CCLS 3J7YU 5KG3A 3GWCA 1SB6A 1PBUA 5C2GA 4K7QA 3HF5A 2HWHA 2DNZA 4UQGA 4K4TA 4X62F 2R7RA 4FVMA 1TKXB 1CS4A 2AP6A 3I87A 4XDCA 3NNCA 2WONB 3AJDA 3T9ZA 3KJVA 1Q7LB 5LM7E 4CNYA 2W1BA 3CNQP 1H3DA 4HVZA 3CCSS 2I38A 2ZDOA 2IYIA 3W8GA 3J81U 2ZNYA 3Q8QB 2DNMA 2DNPA 3RRGA 1JMTA 1F3VA 3G87A 3EDQB 1SL2A 3DRSA 3KUHA 2C2ZB 4LBPA 4USVA 2QE5A 4ZCKA 4WIIA 1PJ6A 4OQJA 5I3PA 4JI2J 5I42B 1VDHA 4PAAA 1RWKB 1D0EA 2QLWA 4P2MA 4P7VA 2K7KA 4RO0A 3W61A 2V94A 3ZTOA 3KJFB 3JTNA 1RWXB 5KFTA 4DU8A 4YP3A 1VMBA 2CPYA 2W7PA 2F9DA 1GXUA 3HZEA 1S7IA 3EWGA 3PW7A 4C4WA 3C6UB 4DG1B 2U2FA 4WBFA 3KJVB 1O0PA 4Y28C 1R6YA 3KLHA 2BANA 1RTJB 2AEJA 3CW2C 3FMWA 1P1TA 2UP1A 5LL6d 2WAQD 1LW2A 1TL5A 4FS1A 1R6VA 4RBUA 4JP8A 5J2PA 1Q86T 1YVFA 3TVZA 4Q43A 3R5GA 2BX6A 5CXTA 1UFWA 4KFBA 2DEIA 3C2PA 3GR0A 3DRSB 3T3FA 4X62J 1X5TA 2RS8A 2GQCA 2QTWA 2M7SA 1KKHA 1OWXA 2ZZNA 4KSEB 1NDLA 1Y5IB 2BQRA 2CQHA 2RRBA 1DLOA 3VQTA 3TA1A 3TANA 3IGNA 3CC2S 3MPVA 4J9RA 1RABB 5KG6A 4ZCMA 1NHKL 3VAIA 4M63A 1ZM4A 3PG9A 3C6TA 1KTVA 1YHQS 5HANA 2RRAA 3NEKA 1XC9A 1LWCA 3CCQS 2CDQA 3EGWB 1GMWD 1H2VZ 2LYVA 3KKFA 1UJ6A 2DXFA 2YX1A 4F0MA 3KLHB 4ZLJA 3PJWA 4FKXA 1PO6A 2V2KA 2KJVA 4J9MA 4QU6A 5J2PB 1YRUA 4OLPA 2JDJA 2UU9F 3IBCB 4DU7A 5KT4A 2R2SA 3VZIA 2QZ8A 1CC8A 1KBRA 4ILRA 1YBTA 3LP1A 2EFGA 4KY3A 2LQ9A 3KDOA 3MAQA 4Y65A 5A8RB 1EQMA 3R6GB 3KLIB 1WHYA 5ETPA 2HQCA 1RAGB 4OFZA 5B0FA 4WFYA 2XGQA 3FZBA 4XIUA 3GJRB 1TR0A 3MM9B 1MMDA 4ER8A 1MNEA 4QQBA 2ZKUA 4DV4J 2XS7A 3R2CJ 3KHRA 4GO5X 2H1YA 1VFJA 3L95X 2PEBA 1DTTA 1C2PA 2E9ZA 4DPYA 2WSFC 2DPJA 1LWCB 2B6AA 1JLQA 2GX8A 3I4PA 4CO0A 2RIJA 3BO4A 3HHDA 4DR4F 1K0VA 4A8FA 3P6YC 1SKWA 1JLGB 1Q16B 4Q5VA 3IBWA 5B0AA 2EC2A 3WQPA 2R9LA 2ZITA 3MPWA 2HQDA 4LQ3A 4PYDA 2VBYA 3O2IA 1OIAA 2BJEA 3AA8A 2MQMA 3IM9A 4ID5B 1LWEA 2N82B 1G4CA 4TY8A 1VQ6S 5J2QB 1UW9A 4IYQA 2XY7A 2J9DE 3PIOQ 2PA3A 3IWLA 3EX7B 5U47A 4I6AA 1L3TA 2FY8A 3WX8A 3R6LB 1N6QA 1PBAA 4F02A 5GAHU 3MEDA 2MY7A 1VQOS 3H5UA 1AYEA 1X4EA 1R89A 4NZ0A 4DEZA 3CCWA 4L75A 3OTOF 4B9TA 2UU9J 1S77D 2B6AB 2OUGA 1JLQB 2HWTA 4NLXA 1RYRA 2F5GA 3NXZA 1CVJA 1M5SA 3M6XA 1WF0A 3GFHA 3FJ2A 4PWWA 2JNJA 3KK2A 3DI6A 3RW6A 3CCVS 3N4WA 1FJEB 2GIRA 1LWEB 4OZNA 4TY8B 4C8OA 4MKAA 4LF6F 3G82A 3DKDA 4ZVSB 4C8NA 3TR5A 2HWIA 1H73A 2XTJP 3J81j 2D41A 5EX0A 4MK8A 4PG5A 1AXQA 3N6LA 2KFNA 1N5VA 2O66A 4J9KA 2QA2A 4JI8F 5IS2A 1RWOB 2FLNA 1VK8A 1N6QB 5A6WA 3UCUP 2XLIA 1N5YB 3OPKA 2FB0A 4DR4J 3BB5A 1ZAXA 3GU0A 4ES2A 1HWUA 3T1HF 5ETVA 2N4CA 4U96A 3DLHA 1IWGA 4JI4F 4FF1A 2WVFA 4CO4A 2DNHA 4FYXB 5L39A 4RW8A 4DV2F 4DL3A 3AQPA 4PUOA 3TW0A 4DV5F 2XSJB 3H4DA 2BMBA 2DXDA 5KOXA 5E41A 4X4VA 3KK2B 2AT1B 1UVIA 3DI6B 1BLUA 1U26A 3DRYA 3HHLD 2XEXA 1I1GA 1OY9A 3G6VA 2C2MB 3DOKA 1PKUA 2QLXA 3NWGA 3OBIA 2X1BA 2UXBF 3G82B 1VQ4S 3B78A 2P8IA 3W9HA 4JI5J 5HSPA 3NCRA 3FBCA 5CHCB 2NSCA 3O44A 1VC0A 1WWHA 3B6BA 1XK8A 5D0GA 1TKTA 1WG1A 3BGRA 5KFKA 4KV8B 1HI0P 2YKNA 3VAJA 2DH9A 3FFIB 4BC7A 4O3OA 2EKNA 3RR8A 3AY0A 4F4XA 1U45A 2CQPA 2V2QA 1PGZA 4IFYB 4RNHA 2WTFA 1Y5NB 1K1QA 2HHXA 4RW8B 1FKPA 3B4DA 3UR0A 3BBBA 1M1GA 2YKPA 4QWDA 2IRXA 2LU1A 2NXCA 4XAKA 4F26A 3P8BB 5D6GA 3QJLA 3V4MA 4N7TA 4DN0A 4MFBB 1T05A 2DEJA 4NWBA 4KE5A 1DTQA 1OQ3A 1KVIA 1GMUA 5IXUA 1ZZNA 1DZ5A 3ONQA 3T1HJ 3I9ZA 1RT6A 4KYZA 4JI4J 2IVFB 1LKZA 1F6TA 4CT9A 1RLDA 2APOA 5IFMA 2V50A 4R25A 3C16A 2ILYA 1TKTB 2ZH5A 3BGRB 2ROPA 4DX7A 3BO3A 4DV2J 1FTRA 1SQGA 2MXYA 3F73A 2C2KB 4DV5J 1X60A 2BE9B 3KWMA 3IC1A 2FY1A 2LQJA 2ROGA 1X4GA 4F2RA 3VF0B 3A8IA 1HPZA 3LGNA 2HGMA 4KGMA 2NR0A 4RPFA 1B0TA 1HNWF 2DH7A 1FRXA 2R2TA 4KRWA 2UXBJ 3LAKA 1X4FA 3F0NA 1FKPB 1RBLA 3D2WA 2MHEA 3OR2A 1YI2S 1IBCB 3RB0A 3PFEA 1Y9OA 3CDWA 4DV0J 1B4SA 2P6SA 5KTQA 2CQIA 1U1OA 5KG7A 2ASJA 3GILA 2HS3A 4Y6IA 3DXSX 1T05B 3J7Z5 1DTQB 4QJVA 4FVCA 2J0XA 1NH7A 4C3KA 3TUZC 4IUFA 3DRPB 1YJUA 3CCJS 3HHKA 1XMBA 4NLVA 5DZ7A 1S7HA 4CNZA 2HNDA 5E3PA 1K8AT 3QRQA 4HHUA 3DGVA 4CZCA 3C46A 2NPFA 3H25A 3D6FB 2GZOA 3KJNB 3QGPA 5HP1A 3HD1A 1T95A 3D54A 3D28A 1IVZA 4LFCF 3FVYA 4J9LA 1U1KA 3MECA 1W26A 3AD9C 3PEJA 3T6JA 4ECUA 2OH2A 4ZITA 2CQ3A 2KVIA 2HFUA 2NXEA 1H0HB 4M5IA 1MROB 1HPZB 3TVKA 4WF9Q 1VQ9S 2PEHA 4W92B 2AX0A 4XK8C 2R42A 3DDKA 5GAGI 5ETRA 2EW9A 3W2VA 4H4KC 4DV1F 4OYOA 1S0VA 2E1AA 5IT9Y 4K4ZA 3CTRA 4LQ9A 3R5AA 2DNLA 2CG4A 2E7XA 2MKIA 2R2UA 5H9EJ 3E01A 4QR2A 2W8LA 3I4HX 3O5TB 3K7RA 2XCAA 2OELA 3IR6B 3UCZP 1KFDA 2V5HG 2BRKA 2EWHA 2VB6A 1SJRA 2HURA 1G7CB 4C0OC 2HNDB 3QIDA 1FESA 5L1LA 5HP1B 4OHYA 3I0SA 2KXHA 2RKIB 3OLAA 4LR7A 4KIAA 4V1Ak 4NRTA 4GVBB 3M8ZA 1RT3A 3E8OA 2DIUA 1NJYA 2AHOB 1CSJA 4F7VA 1RT5A 4OHWA 3N01A 3GG0A 1RB0A 4XO0A 3LW5C 3ZZRA 5ETNA 1Y7PA 2MSSA 2NYHA 4H4KA 1U0HA 3Q8PB 4OI3A 2W9BB 2QA4G 3EXCX 2C2RA 2DNOA 3PRDA 1EX8A 3UD3P 4DSFA 3IS9A 1FHTA 4OI1A 3W9IA 3G6YA 1XWLA 4ECSA 3MGJA 4RZRA 1QVGR 1X8DA 4F67A 3V5RA 2VG6A 2GQQA 4OZLA 1O8BA 3BSNA 1PAUB 2HQGA 3RZAA 4KHRA 1E6VB 3TEHB 3PR5B 5LSRA 4LSNA 2XHCA 4NLRA 1OYDA 2Q6BA 4XDDA 4DX8H 2GMLA 4DV1J 1HWJA 1WHWA 1UA0A 4FF4A 3ILJA 3MPDA 3MM7A 2F9JA 3H42A 1BE4A 3DHXA 5HATA 2QYCA 3MM6B 1F3FA 2J7WA 2H9ZA 3NCQA 3LALA 1NPPA 4PXEA 4FBTA 1YQHA 1UJ4A 1S1XA 3GV5B 2QEXS 2NZ4A 4B3RF 1C1BA 1U0HB 4NA3A 4KJIA 2MZTA 2D9PA 1X31C 3THTA 4ECYA 1WC4A 4TKTA 3MFIA 2DR7A 4J9VA 3JSMA 4UY85 4TU9A 4ZIWA 4Q8EA 1UCNA 3IWXA 3NGDA 3M05A 3BQ1A 2VFTA 1SQFA 1FNMA 3KLGA 4ELTA 2Q3PA 2RQCA 2MLYA 1U6FA 3M2VB 2OPQA 2H5EA 4USJC 3GV8B 1K9MT 2H48B 3OL7A 4AXIA 4FN5A 2QL7B 5D0EA 2I9SA 4B3SJ 2AGOA 2F65A 3E51A 3I82A 5G4DA 1Y4ZB 3MUVP 1NDPA 3OV7A 2C2EA 3MM7B 1OJ4A 2DO0A 5HVFA 1KEKA 4O23A 2MLZA 2HHTA 4PYAA 4LF5F 2Z2LA 2DGUA 3LUYA 2B51A 1HNXF 2AW0A 2E29A 4JI0J 3CJRA 3K58A 2BOPA 2GO9A 5AXMA 1S1XB 5D3GA 4F4AA 4CIOA 3ZTQA 3M2RA 1NJZA 2A6MA 2B4PA 2KRRA 1MMNA 3QGIA 2HNYA 2YVSA 3MEGA 1KVJA 2XZWA 1U2FA 5F3ZA 1FRHA 4M5MA 2BABA 2E9RX 1X4CA 3W8PA 3UDVA 2BYCA 3KLGB 4LF4J 2Z0GA 3TOQA 3KJQB 5K8NA 2HYIB 1K0TA 1P1LA 2KZZA 1PJ7A 3R7SB 5J1PA 2G0IA 1JLBA 4ZP6A 2YBVA 1VHIA 3K5PA 4AQYJ 2FJDB 5F8GA 1RBAA 3M8QA 3NNAA 4B3RJ 5BJRA 3W9JA 4NA2A 2VJUA 4F8RA 3H4BA 5F8IA 2HHSA 1XIQA 4ZVGA 4EO8A 2UVUA 1NDCA 3ZZUA 2AZ3A 3TO8A 3NAIA 3OW2R 1VR6A 5DZ6A 2DVIA 2KO1A 1S10A 2KL8A 4RNOA 5GAEI 3G96A 1JXEA 2JX2A 4RW6A 3CT9A 1HBUA 1NH8A 3O6QA 3T1YF 3NOGA 2PMWA 3M2RB 3VAKA 2RUSA 2MY8A 3HVWA 3N6NA 3UNYA 4KT0C 1S79A 3VAFA 1YJ9S 2R7XA 2G13A 5JMNA 2JC0A 1EZZB 1YWXA 4DR6F 1RT1A 5MAOA 2V69A 5C2CA 4NLOA 3JSBA 2ZDPA 1MWQA 5AJ3F 1RWNB 3C19A 1GFWB 1T9WA 1HMVB 3M8QB 3MCNA 3HM9A 4ZS6A 3PACA 1UVJA 2MLXA 2WSEC 4J9PA 2HHHF 3I5AA 1ELOA 3M30B 2HKEA 3NCPA 2W2PP 2GGPA 1A0OB 3OTBA 3V4IA 1V3ZA 3DM2A 2MQQA 4ID8A 1FXLA 1RHJB 3CMES 2XY6A 2ZM6J 2GQ2A 1QSYA 1NNDA 2XMVA 3M2UA 2D3OR 4RW6B 1HBUB 4C3LA 2KHDA 4NZ6A 1HARA 4C97A 1RT2A 2NUUG 3G8QA 5KFAA 2ADCA 4FS2A 4ECXA 4GO7X 4JV2A 3DDNA 3FSYA 5AXLA 2XNRA 1EHWA 4OMFG 1SH0A 4HT5A 3P49B 5GMEA 1SJ3P 4B3OA 5JVHQ 3MXHP 4HH1A 1HQUA 2OFHX 2F1FA 4ZP8A 4DN9A 2GVZA 4ZOSA 5H9FK 3B54A 2CZ9A 1HI1A 5ADZA 1RT1B 4ZPBA 4C8KA 2NREA 1M5HA 4IRCA 3G8TA 4USIA 2Y1RI 2ZWOA 1EP4A 1SV5A 4CYUB 2BJ7A 1Q4RA 1U4BA 2FZGB 2KT5A 4E2FB 3FRZA 1MN9A 4RW7A 1CULB 4L3KA 4NMLA 4G1IA 3RB6A 4KGZB 1YRXA 4Q2LA 3I6PA 2Z8QA 2GGPB 5CYMA 1S1WB 3V4IB 4AE5A 2BW7A 3N5FA 3ZZPA 2CQBA 1QVFR 5KG2A 3AXMA 4RW9A 2UVRA 2OJ3A 3D3BJ 5HK4A 1RISA 4DR6J 2CQCA 1RT2B 4M5LA 1IKWA 1VCTA 1UETA 4DV7F 4X4UA 2VL1A 4CCHA 4TQRA 3M9MB 2RF2A 4F4WA 1WKLA 3PW2A 3UN3A 5BR8J 3LQVA 1HQUB 3AHPA 4UOFA 2CNKB 2HHHJ 3BYRA 4Z2XA 3PM9A 5JVGQ 3J80U 1WKKA 1WI6A 1ROFA 3A3OB 4CLKA 2IBKA 1EP4B 2GNKA 2I0XA 1R8AA 1SV5B 2GMJA 5HJYA 3PVXA 5GMKa 1BMQB 4PG6A 1X4DA 1JLAA 1R8PA 5DLGA 3M8RA 2V4RA 4JI1F 4QYZJ 2NXNA 2PGCA 4RW7B 1HA1A 4HTIA 2QSFA 3BKUA 3D6MB 1DQ8A 1VBYA 3CDBA 1K1SA 4IG3B 5KFWA 1XNRF 3K17A 4M5KA 1VJQA 1YJVA 3TZXA 2NSBA 1I3OB 3OUYA 4ZPWR 3UVJA 3W62A 4DQQA 1RTHB 3KNGA 2PO4A 4LSLB 1U8WA 3TJ8A 2V8DA 1Y10A 3PXGa 4H4MA 1U6ZA 2D3ZA 4WE1A 3HD2A 4NI2A 4M5JA 2Z58B 4CH1A 2HFOA 3MM8B 4LRBA 1W7WA 2YNIA 4G6VB 3ZC4A 2ZJQQ 4DUYJ 1BQNA 5FDLB 2V2VA 5GADU 2B5JA 2DHSA 3A8EA 1HNZF 3MMCB 2MKCA 4YDDB 1WEZA 1JLAB 1YITS 1Q81T 1IJEB 3LWLA 1QM9A 3GB0A 4CP5A 4OV6A 1AFIA 1JKHB 2YQ0A 1EQ0A 1NMEB 1YBAA 3NKYA 1GMWA 3KHGA 4Q0BB 4YFUA 1RCXB 2RVJA 1NUEA 3GJTB 2ZZTA 5LMUF 2YKQA 5KFYA 4I68A 4DR3F
chains in the Genus database with same CATH topology
1M1GA 3LPEA 1M1HA 4ZN3A 3P8BB 2EXUA 2LQ8A 4ZN1A 3EWGA 1NZ8A 2XHCA 1NPPA 3H7HB 2K06A 1NPRA 2OUGA 3QQCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1G A;  3LPE A;  1M1H A;  4ZN3 A;  3P8B B;  2EXU A;  2LQ8 A;  4ZN1 A;  3EWG A;  1NZ8 A;  2XHC A;  1NPP A;  3H7H B;  2K06 A;  1NPR A;  2OUG A;  3QQC D; 
#chains in the Genus database with same CATH topology
 2E9T A;  1WG4 A;  1MLA A;  3UVJ B;  2HVE A;  4XTT A;  5KFR A;  1HHQ A;  3AB2 B;  3L3C A;  5C24 A;  4F3Q A;  4LVO P;  1XEZ A;  1TZ0 A;  3GII A;  3L7P A;  1HNV A;  4DFP A;  3U27 A;  3DXB A;  4K5S A;  3VCD A;  5DLF A;  2RQK A;  5HVG A;  3BN7 A;  1RHM B;  2V63 A;  1GT8 A;  2ZVS A;  3BJY A;  2YKM A;  4WE1 B;  1ZOT A;  4CO1 A;  5B0B A;  2LEB A;  3TQE A;  1T9X A;  1H2U X;  3QJP A;  1NBE B;  2JHE A;  1XNR J;  5F8N A;  2GV1 A;  3DLL Q;  2R8J A;  1JLE A;  1BQN B;  4KGX B;  3VTI A;  3I5C A;  2RS2 A;  1KHV A;  2J6U A;  4B9U A;  2F40 A;  2DIV A;  5KFQ A;  2CFX A;  3LAM A;  4CTA B;  2LEC A;  2CNO B;  2CQD A;  1UZD A;  2CJB A;  4PEO A;  3HJV A;  2ERR A;  4KH0 B;  5KG4 A;  2PA8 D;  1U02 A;  4I64 A;  1NSK L;  3ITH A;  5HO4 A;  4I1T A;  3AT1 B;  2FIU A;  2WVB A;  4DPU A;  1VQ8 S;  3BV8 A;  5C24 B;  3GON A;  3LO3 A;  4RBV A;  1HNV B;  4Z37 A;  4EZ6 A;  3HDS A;  3TYT A;  1T9U A;  2AJ2 A;  4DPX A;  2VPW B;  1HNZ J;  2HGL A;  2YKM B;  2OLW A;  1VK3 A;  2VKR A;  2MJN A;  1YZ7 A;  4ENO A;  1HBM A;  2IJN A;  2VC0 A;  3EGV A;  3NGT A;  2GJI A;  3MEK A;  3W63 A;  4YB5 A;  2MYF A;  3GYX B;  4ZVP B;  5J2N A;  4DR3 J;  2AU0 A;  2NQP A;  1XR6 A;  1XMO F;  2YWF A;  3M8S A;  2FC8 A;  4C6A A;  4DPT A;  2Z2M A;  1M90 T;  1Q82 T;  3J7Y I;  4NOH A;  2VQE J;  2JFK A;  5AXN A;  1XTZ A;  3VVU A;  1FNO A;  2Q1L A;  2D9O A;  3CXC R;  5T14 A;  4Q8F A;  4R5P A;  1B0V A;  2M0G B;  1X9M A;  4NAS A;  2B0G A;  4EU0 A;  3HHL C;  4PWD B;  2C2D A;  4CO2 A;  1PIE A;  1LK5 A;  2QG9 B;  2VPX B;  3BO2 A;  2OEJ A;  3ET6 A;  4X2B A;  4I2Q B;  4QIE A;  2XMU A;  3Q8U A;  1MU2 B;  1JXL A;  2L9W A;  2YX7 A;  4DZD A;  2ASD A;  2CNN B;  5DO2 A;  4WIQ A;  2LXI A;  2YQ1 A;  2YPY A;  3OJU A;  3V6J A;  1S57 A;  3CED A;  3AFG A;  1UMJ A;  4ZKA A;  2HQF A;  4O4G A;  1HBM B;  1P9Q C;  2B9W A;  2C28 A;  3AD7 C;  3BR9 A;  3TZY A;  2PDA A;  2J76 E;  3TAQ A;  3DCA A;  4HAC B;  3OFG A;  4DR5 F;  1JK9 B;  2CJK A;  1DUR A;  1Q53 A;  3ENV A;  3MF5 A;  3QRP A;  2H5I B;  2IVY A;  3HFZ B;  5FLX U;  2YKO A;  3HZG A;  4WTO B;  3G86 A;  2GO8 A;  1BGX T;  5KT2 A;  1UP1 A;  1WEX A;  3POT A;  5IV4 A;  2KG1 A;  1ITP A;  5IC4 B;  3R5B A;  2XZT B;  3HHL A;  4MAK A;  3MI7 X;  1OS5 A;  3DHW C;  1CG2 A;  5DGA A;  1SL1 A;  1EKR A;  3ET6 B;  4PZV A;  4YN3 B;  1H38 A;  1ZS6 A;  4NE9 C;  4OJH A;  1TAU A;  2E1R A;  1XMO J;  5L46 A;  3GTY X;  3KHH A;  4KKO A;  2Y9H A;  4EEY A;  4IG0 A;  2Z4P A;  1JJ4 A;  3CMA S;  5CYJ A;  4ZVQ B;  3FDS A;  3S6E A;  5ETS A;  4O0N A;  1OQ6 A;  4KO0 A;  5KFG A;  2EXU A;  4UOC A;  4OX7 A;  1DAR A;  2BV3 A;  1OY8 A;  4QCL A;  1BWE A;  3DOM A;  2D3U A;  1RHK B;  2JRS A;  1UWA A;  3PRV A;  1N5S A;  1S0M A;  4L74 A;  2Z56 B;  3THV A;  4UTG A;  3NMR A;  2HNZ A;  4YB7 A;  3MPY A;  2RIL A;  2V4J A;  3A3P B;  2B9Y A;  4PWU A;  4HDH A;  3R1H A;  2QA4 S;  3POT B;  3O8W A;  5RUB A;  2YNH B;  5DQI A;  2LDI A;  2XMM A;  4LRF A;  3TWZ A;  4DPW A;  2WVC A;  1TVR A;  4RU2 A;  3FMB A;  1B7Y B;  3TZW A;  3S7R A;  4J91 A;  2GVD A;  2XYG B;  3HVT B;  2FHJ D;  2Y0B B;  2G2Y A;  2XMW A;  4KKO B;  1E6Y A;  4DX6 A;  3GIK A;  1VS3 A;  1S9E A;  1PAE X;  1T11 A;  1VRU A;  1RAE B;  3EVM A;  2UUW A;  1YK9 A;  2EK6 A;  4GKK J;  2EEY A;  3DOM B;  1IKY A;  1S6P A;  3KNA A;  3C8Y A;  4NXM F;  3CCU S;  1CBK A;  1QAJ A;  2UVW A;  1XBW A;  5G0R A;  4O0I A;  4OZ0 A;  2HNZ B;  3LAN A;  4CM2 A;  2A6O A;  2AYM A;  4I4B A;  1KTQ A;  1Y11 A;  3HSJ A;  4PR6 A;  1TL1 B;  2J9E A;  4OX9 J;  2WB1 D;  2CAD A;  3F41 A;  1TTH B;  4CRJ A;  2MGZ A;  2CZV C;  5D4P A;  5B0D A;  2A0F B;  1ZAV A;  1Q1K A;  1XR7 A;  3UO0 A;  1VLO A;  1OSC A;  3A1Y G;  5KFN A;  1RA6 A;  4BLG A;  6AT1 B;  2R7T A;  4I6W A;  3NS5 A;  4A8Y A;  4IH5 A;  4C9D A;  3MM5 A;  2JEG A;  1TK8 A;  3R5D A;  1S1U A;  2DT9 A;  3UE2 A;  3GYN A;  3FGV A;  4CT8 A;  2ZBR A;  3VQS A;  4WFX A;  3QMQ A;  4LIR A;  1CJT A;  4U8V A;  1RT7 A;  1WC5 A;  3HKZ D;  5J1N A;  3KLE A;  5GAE U;  1E6Y B;  3SXL A;  2GAH C;  4HEA 9;  3ZTS A;  1FK9 A;  3EMT A;  3C66 A;  4ZJQ A;  2HMI A;  4ELV A;  2FHK A;  2K1R B;  1FFW B;  2AJQ A;  4GMK A;  4F3M A;  4A47 A;  5DQG A;  1S6P B;  1TKD A;  2HFS A;  3V2U C;  4QR0 A;  3Q2T C;  4P52 A;  3RAQ A;  5DDP C;  4DUZ F;  1U24 A;  4DF4 A;  3W5Y A;  4WK1 A;  2D1C A;  4DSL A;  1MML A;  4OX8 A;  4LJM A;  1U2R A;  2MGZ B;  3EYZ A;  1VI7 A;  1HBN B;  3UDE A;  2DH8 A;  3P4U B;  3L09 A;  5KFP A;  3FQK A;  2V8P A;  3EVO A;  1IKX B;  1L3S A;  3MM5 B;  1F2H A;  4JV5 F;  1KS2 A;  1BQM A;  1IM4 A;  2H54 B;  5B0E A;  4MKB A;  1HD0 A;  4YHH J;  4NXM J;  4HYK A;  1FE4 A;  4EUV A;  2HBQ B;  2V8H A;  3A8K A;  3KLE B;  2W25 A;  1FCA A;  3GJQ B;  3KFW X;  5F0U A;  1FK9 B;  1VQM S;  3UQS A;  1VBX A;  3D9B A;  1LW0 B;  1DQ9 A;  4LF8 F;  2YNG A;  4YY3 F;  2KT2 A;  2LVW A;  4OIX A;  1D9A A;  4P2S A;  2ZH3 A;  4F0H A;  4DSK A;  4ATN A;  2AGP A;  2G0J A;  3DRR A;  2R7W A;  3JTO A;  3V6D A;  4OYI A;  4OZ5 A;  1CC7 A;  4AL5 A;  4URQ U;  3P45 B;  1PG5 B;  4ED6 A;  1NEE A;  2O5D A;  1EAY C;  1B99 A;  2DCL A;  4ZVH A;  1GTH A;  4X66 F;  3G8S A;  2IPO B;  2CVE A;  3PYG A;  1HW9 A;  3L7U A;  1F2G A;  1UVM A;  4YR3 A;  4LR8 A;  3DOL A;  5HMX A;  4A8K A;  2HRU A;  1BQM B;  2L9D A;  4HL9 A;  5CZX A;  4F50 A;  3KXD A;  2CPI A;  3DLE A;  3QZ8 A;  2BJ3 A;  2VKZ G;  5CAB A;  3W2W B;  4OLO A;  1Q5V A;  5IT0 A;  3W60 A;  2CJ9 A;  3IRX A;  3FK4 A;  3TUJ C;  1FRM A;  3QAU A;  4DUZ J;  1FDA A;  1MSW D;  3BKT A;  5IT4 A;  4KHP J;  2QYG A;  1T0T V;  1ZA2 B;  1WD6 A;  4DQI A;  4K0K F;  2GHP A;  2EVZ A;  4CLF A;  4P2X A;  3UN5 A;  3TNV A;  4MYT A;  3R5C A;  2ABY A;  2IA6 A;  1Y3J A;  2B7B B;  4JV5 J;  2LEA A;  2ZBI A;  2V4Q A;  2B56 A;  2RU9 A;  2GHV C;  3CGI A;  1KOH A;  5IM0 B;  3OT9 A;  3QQC D;  3BBF A;  3N0V A;  5IC6 B;  3AQO A;  1V6H A;  2N7Y A;  2P6T A;  2FD2 A;  1KC8 T;  1KP6 A;  1S0N A;  3JSR A;  2XGP A;  1REG X;  1S1T A;  5C25 B;  3CJQ A;  3VGT A;  2LP4 A;  1QE1 B;  4YY3 J;  1UVK A;  1OSD A;  5HQ8 A;  4RKU C;  3DLE B;  1SJ1 A;  4PG4 A;  2JWN A;  1G6B A;  1Y00 A;  3HK2 A;  2ZH6 A;  3UCG A;  3SBM A;  4I0W A;  1ZAW A;  4WXO A;  1IR0 A;  2K06 A;  2M88 A;  1I6J A;  2ALZ A;  4X66 J;  2V9K A;  2ZH9 A;  3H8Y A;  3TAP A;  3U1M A;  3TA2 A;  1H2T Z;  2HFN A;  4Z7C A;  3BH6 B;  2VIH A;  2YXL A;  2IDL A;  2OPS A;  3PEH A;  3PNI A;  1VHF A;  3KDN A;  4ZJL A;  3SCJ E;  3H7H B;  4NXN F;  3VGV A;  3GSD A;  3I31 A;  2E1M C;  1S49 A;  3Q8S B;  2ZD1 A;  3ETM A;  1N33 F;  4LRE A;  2L41 A;  2WOM B;  3QSY B;  1I5O B;  4UQT A;  3C15 A;  4QU7 A;  1S1T B;  4X64 F;  1REV B;  4Y34 A;  1HBO A;  4C0B A;  2XYP B;  2X3D A;  3ISN D;  1NDK A;  4A8S A;  3H5S A;  2VG7 B;  4KB7 A;  4DL5 A;  2ALY B;  5KFC A;  3BRE A;  5KOW A;  4N76 A;  2M2B A;  1S4F A;  1ZPW X;  2R8I A;  3THP A;  2MPU A;  1FA0 A;  4J9N A;  2HZC A;  5CH7 B;  2HK2 A;  4L76 A;  4NLQ A;  2W2N P;  1KNZ A;  4IR1 A;  3O1L A;  5L38 A;  3IWN C;  3H98 A;  4ECR A;  2HEK A;  3LP0 B;  2UXC F;  2XMK A;  2DNY A;  2AJF E;  4WP9 A;  3MCO A;  1SCJ B;  3OFE A;  2V8G A;  2ZE2 A;  3PX0 A;  4NZ7 A;  2RH3 A;  2M9K A;  3ILI A;  1LK7 A;  1ZPV A;  3IR7 B;  4OYX A;  4FPI A;  4LVN P;  2VZ9 A;  4BDP A;  3B82 A;  2QRR A;  3BGU A;  3VV2 B;  3N5B A;  1VQP S;  2VG5 A;  2PT0 A;  2DK2 A;  3C15 B;  4RL1 A;  2J9C A;  3QPI A;  1HBO B;  3SSS A;  1QDU B;  1QAX A;  1FKA F;  3RR7 A;  3ZZY A;  4W90 B;  3HT0 A;  4IQX A;  3LPY A;  1NK8 A;  5L1J A;  2ADB A;  5DG7 A;  5B09 A;  5HI7 A;  1MG7 A;  2BQ3 A;  4OI0 A;  5HRO A;  1WC3 A;  3IO1 A;  2JC1 A;  4ZMM A;  3MPU B;  5L8R C;  2ZC4 A;  3I96 A;  3SQG A;  2IIH A;  1Q5Y A;  3KK1 A;  3OL6 A;  2D3O 1;  5KFO A;  1Q95 G;  3US5 A;  2HQ3 A;  3A3N B;  1RAI B;  3BQ0 A;  2X1F A;  3O3L A;  4OHV A;  4X64 J;  2VF3 A;  1D9F A;  1TKZ B;  2XMJ A;  5B0G A;  2ZBQ A;  1SJQ A;  1N5Q A;  4DWI A;  4K50 A;  4A8Q A;  2HHP A;  4P75 A;  1SPB P;  3NMA A;  2WK4 A;  3OXF A;  2XY5 A;  1IBK F;  4B3M J;  3MR6 A;  3PKM A;  1CEZ A;  4NCA A;  2VOP A;  2AEM A;  2HRT A;  3OTE A;  2VPY B;  2HZA A;  1FO1 A;  2VBX A;  1GEH A;  2UXC J;  5KFM A;  4FYV B;  1S1V A;  2E7W A;  4OV1 A;  1R0A B;  4FZV A;  2XMT A;  1NK5 A;  3CF5 Q;  2C1E B;  4JYA J;  1C0U A;  2UZA A;  4JI3 J;  1WC6 A;  3R3T A;  5L1I A;  2NXJ A;  2F63 A;  2YH0 A;  3OHB A;  4DSI A;  1VBK A;  3KK1 B;  5D8H B;  5HN0 A;  3T5J A;  4WYL A;  1LNQ A;  2OI2 A;  1UTA A;  4JBC A;  1I94 F;  5D4O A;  2OPR A;  5CYQ B;  2HPU A;  3HP6 A;  3DNC A;  2BA9 A;  4MK9 A;  3M8P B;  1IXK A;  4YB6 A;  3DU5 A;  3UDL A;  3C14 B;  2K7J A;  3CPW R;  1CJK A;  2E5H A;  2DHH A;  3NAH A;  4ECZ A;  1J2V A;  2Y1I A;  1N0V C;  3KLF A;  5T7L A;  3UD5 A;  2H4W B;  1RYS A;  1WI8 A;  4DFK A;  4KBI A;  3SIP B;  2ATC B;  2AEF A;  1CS4 B;  2XSF A;  2ZOG A;  2CIM A;  2JVO A;  1U47 A;  4ZPD A;  2OFG X;  4DBQ A;  4WFA Q;  2FJV A;  2O1P A;  2MHN A;  3M32 A;  4F0K A;  2XZD B;  3GFZ A;  1C0U B;  4FBU A;  3F44 A;  3CWJ A;  4ZVF A;  4Y2A A;  4NMX A;  1KRP A;  3UWT A;  4ZVT B;  4P7T A;  5LMN J;  1Y0H A;  1LQ9 A;  1K73 T;  1ZZF A;  2OKQ A;  4DMZ A;  5IV3 A;  2NZC A;  4N5S A;  8RUC A;  3S01 A;  3WC0 A;  5AT1 B;  1IBK J;  4PXB A;  4MT1 A;  2OGU A;  2EFN A;  1MW7 A;  2E5L F;  4ICL A;  4PQU A;  1KSP A;  1I51 B;  5HQM A;  3CDU A;  2R2R A;  5KFB A;  2WSC C;  2IAJ A;  2W9A A;  3KLF B;  1RU1 A;  4FYW B;  4N8N A;  2E44 A;  2B4U A;  2ZUG A;  3N6M A;  1VJW A;  3QRR A;  3MTJ A;  4ED7 A;  2WB4 A;  2ILZ A;  2WW4 A;  1JJ2 R;  1R3N A;  3SQO P;  4NLD A;  2FJX A;  2ZWP A;  2IBO A;  2HFV A;  1IKV A;  4I56 A;  1HIY A;  2BAN B;  4LMZ A;  2BOA A;  2HAI A;  1JWW A;  1LW2 B;  2WHO A;  3D3C J;  5J1E A;  4ED8 A;  4J9Q A;  4R0E A;  3JQM A;  2X7I A;  2XLJ A;  4ZA1 A;  3BSO A;  4KFB B;  2MJU A;  3R7B B;  2DRD A;  4EO6 A;  3I55 S;  4ED2 A;  1SC6 A;  1LOU A;  2DR8 A;  1C0T A;  4B17 A;  2C42 A;  4RUC A;  2IM0 A;  1AW0 A;  1CJV A;  5D0H A;  2QT7 A;  5DG9 A;  4PQU B;  4FNI A;  1OO0 B;  1DLO B;  1LV5 A;  4RNM A;  3ZTP A;  1SC1 B;  2MKS A;  4U67 Q;  3GG1 A;  2ZH8 A;  3KHL A;  5HQL A;  5KAK A;  2LA4 A;  4KPY A;  4OHX A;  1FXD A;  2XCP A;  2HLU A;  4J5O A;  4IDK A;  1TL3 A;  3C6T B;  4LF9 F;  2Y8Y A;  3ETO A;  1KVK A;  5C42 A;  1SIZ A;  5L1K A;  4OYM A;  4IOA Q;  1Q0N A;  4U7U D;  2J6S A;  4HT7 A;  5KG0 A;  2NLW A;  4JOU A;  1VRQ C;  4YQW A;  4ES3 A;  3BGF A;  3PYD A;  2X51 A;  4K59 A;  2OTL S;  1UW4 A;  2J8A A;  2E5L J;  2B9E A;  2ZHB A;  3ISZ A;  1GNK A;  2QGF B;  1YJ7 A;  1AZS A;  2FTR A;  1UPM B;  2ACM A;  4MIW A;  3LP1 B;  5KT3 A;  1RTI A;  1XR5 A;  1HYS A;  1PC4 A;  2Z57 B;  1V9O A;  3NRB A;  1RWM B;  4Y2I A;  2DGQ A;  2M4M A;  1U6B A;  2KXF A;  1S76 D;  1CJV B;  1MN7 A;  2AZ1 A;  4NL5 A;  3AH6 A;  3HPO A;  1S6Q A;  3M8W A;  4ZVR B;  2PFD A;  4OYW A;  2R8H A;  3OL8 A;  4CLU A;  4F4K A;  2V6A A;  3D7S B;  2K3K A;  4EYH B;  2AKW B;  1DTT B;  3PW0 A;  1RTD A;  3MMA A;  4ES1 A;  2XS2 A;  1PYS B;  5KFJ A;  3VHQ A;  4HH0 A;  3I56 S;  5C42 B;  9ATC B;  3CJS A;  1KQF B;  3AOD A;  3T6B A;  1H72 C;  2HVI A;  4ECT A;  2XQC A;  1KFS A;  3RAM A;  1NB2 A;  2W9C A;  3IM8 A;  4HI2 A;  1BXN A;  5K14 A;  2A18 A;  4H4O A;  2ZHA A;  3BH7 B;  4F25 A;  2IM3 A;  4NYP A;  2I5J A;  5KT5 A;  3SFG A;  3FCW A;  1PCA A;  2N4D A;  3RB4 A;  4DL4 A;  2IC3 A;  4DCP B;  4O44 A;  1RWU A;  1WUU A;  4HTJ A;  1A6L A;  2HS0 A;  2NS1 B;  3LF0 A;  4B02 A;  1SL0 A;  4LF9 J;  1EET A;  4ZIV A;  3W1Y C;  4X4R A;  4DQS A;  2LKZ A;  4WU3 A;  1SJ4 P;  4JI7 F;  4ED5 A;  4C8M A;  4DR1 F;  4FNH A;  4U9R A;  4PKD B;  3WDO A;  2CA9 A;  1QUP A;  4WPA A;  3MED B;  2I1R A;  5E0O A;  4YOE A;  2FC9 A;  1X0F A;  2VOD A;  4O3S A;  1R0C B;  4IH6 A;  3W7B A;  4ALZ A;  2X3G A;  5DQH A;  2VH7 A;  1EJ7 L;  2G4B A;  2VU5 A;  1RTD B;  4F4Z A;  3WC2 A;  2OTJ S;  2ASY A;  4K4U A;  3WIU A;  4YME A;  1FTC A;  2RE1 A;  3V81 A;  1P27 B;  4DL2 A;  1JQG A;  4BWJ A;  1DFD A;  2DRB A;  4WKR A;  4H4O B;  1PJ5 A;  1SH2 A;  3E3X A;  4UZB A;  4ITS A;  3M9N B;  1RAH B;  5IT9 U;  2IC3 B;  4O44 B;  1WOR A;  3ILL A;  2OEM A;  2QN6 B;  4Q45 A;  5KFF A;  1KR4 A;  4LFA F;  3LPE A;  2ZH7 A;  4B9S A;  4HLB A;  4OZ2 A;  3OTO J;  4LT6 A;  2PD1 A;  4DS4 A;  2DD8 S;  1VQ5 S;  3ZNU A;  4JV0 A;  2VJV A;  1TK5 A;  1FKO A;  3J7A 1;  4DPO A;  3PTW A;  3NY0 A;  2LQ8 A;  1U1P A;  2MQN A;  4TNO A;  4Y3C A;  4KQZ A;  1R43 A;  5CD4 H;  4TYA A;  4LF6 J;  5D78 A;  3AXK A;  1C1C A;  2A2C A;  3SYZ A;  2CJA A;  3I32 A;  3N9U C;  2E5I A;  4GKJ F;  3SCI E;  4PUO B;  1SXL A;  2WVE A;  4JI7 J;  2Y3Y A;  4DR1 J;  4JI8 J;  5GAD I;  2LXU A;  3SZ2 A;  4JB8 B;  5AE2 A;  2MQ8 A;  2KYX A;  2EFP A;  4J7C A;  3DOK B;  3R27 A;  1YGY A;  5F9N A;  4YEA A;  4LF7 F;  1B64 A;  2BR0 A;  2M8H A;  5KFV A;  4MYU A;  5AE1 A;  3D1Q A;  1UJ5 A;  2EG1 A;  1NAQ A;  1JLC A;  3QAT A;  3NS6 A;  2W2O P;  2BE2 A;  3MHY A;  2HZV A;  4NLY A;  3OSN A;  2B8P A;  2U1A A;  1H6K X;  3MTK A;  2W4C A;  5D4N A;  2DKO B;  3A13 A;  1M1K T;  2FHJ A;  3KUG A;  2YKN B;  5C7P A;  3QAE A;  1FKO B;  2J7U A;  1NJI T;  4P6Q A;  1XMQ F;  2BZ2 A;  1AFJ A;  1X5O A;  3PZP A;  2BJ8 A;  1OPI A;  3UI3 A;  1TQL A;  4B9N A;  2LQ5 A;  3V6H A;  3J7Z T;  4FYY B;  2C22 A;  2QV6 A;  1C1C B;  1XJW B;  1TUW A;  5I3U A;  2ATL A;  3SV4 A;  4J9U E;  4CO3 A;  4DSE A;  4DV3 F;  3QLH A;  1SBR A;  2FVC A;  3CJ8 A;  5ETO A;  3RG6 A;  4URS A;  1W2B R;  5EDW A;  2KM8 C;  4Y2C A;  2J7K A;  1HLW A;  2ASL A;  1RT6 B;  2FLL A;  3X1L B;  5F8H A;  3BYP A;  2BE2 B;  4ELU A;  1N34 F;  1IR2 A;  1TAQ A;  2DGX A;  1U1M A;  3C16 B;  2MEW A;  3L9Z A;  2DNK A;  3LA0 A;  2YWW A;  4NPO A;  2RDI A;  1J5O A;  2YWH A;  4Y2K A;  2RJZ A;  2Z30 B;  2CDR B;  1JJC B;  3IAS 9;  2L48 A;  2OHD A;  4ED0 A;  1RJJ A;  4YR0 A;  3DYA A;  2AYB A;  3CJ3 A;  4LF7 J;  4M5N A;  5K8O A;  4WP3 A;  1HHT P;  2SXL A;  2FDN A;  2QMW A;  4ECW A;  3N79 A;  3LGH A;  3OR2 B;  5DS7 A;  1QJH A;  1NHV A;  4M5D A;  2QFI A;  4BC9 A;  4OJG A;  5L9X A;  2DGW A;  4O3P A;  3OVS A;  5C5J A;  2K3I A;  3K8V A;  2R7V A;  2CJX B;  4DZ6 A;  3SMZ A;  2R7O A;  2DB1 A;  3LWM A;  1HNW J;  2KI2 A;  3IMQ J;  2GIQ A;  2Q6C A;  2C3P A;  3VAL A;  2Y1L B;  3MEC B;  1J5O B;  4WKY A;  1FNX H;  2ZJP Q;  2E5J A;  4RUA A;  4DV3 J;  1S99 A;  1FDN A;  4B08 A;  1VOM A;  1LFP A;  3DYA B;  1JB0 C;  1VGY A;  3W2V B;  5EWE A;  3G2X A;  3GV7 B;  3JB9 k;  4FXV A;  3MAH A;  3LGM A;  5E3C A;  4K4W A;  2EC0 A;  4C48 A;  5IQ6 A;  2MDA A;  4OI4 A;  1GX6 A;  3E01 B;  4DUT A;  3K59 A;  1N34 J;  4WU2 A;  7AT1 B;  2N7C A;  4CWB A;  4DX5 A;  4LFC J;  3JAM Y;  4A8W A;  2CPZ A;  3HSG A;  2GA7 A;  5KFE A;  3AJ1 A;  5BYS A;  4DL6 A;  5HL7 Q;  2I2Y A;  1TKX A;  4JI2 F;  1F1B B;  4AXJ A;  2MB0 B;  3MFH A;  3I0S B;  4A4J A;  1TP7 A;  4L6V 3;  5A8K A;  3AOA A;  3OQ2 A;  5L9N A;  2NCK L;  2KG0 A;  1M1H A;  3CD5 A;  1RT3 B;  2X1G A;  1RXO B;  3CDE A;  3VAH A;  1RT5 B;  4UY8 T;  4X4P A;  2FPH X;  3RAX A;  2KFY A;  4Z7Y A;  4CH0 S;  5KFX A;  1M5P C;  4A8O A;  6FD1 A;  1WOP A;  2BRL A;  4WWS A;  5KG5 A;  1RUS A;  1APS A;  1WDT A;  1ICE B;  1N88 A;  3T5K A;  5E2Q A;  2CG8 A;  4Y00 A;  3IS9 B;  2IRY A;  2JSX A;  1P6T A;  5I42 A;  2RSQ A;  5HBM A;  4P10 A;  4N47 A;  5KFU A;  2AYG A;  3MDF A;  4DI6 A;  5EN1 A;  1RKJ A;  3SI8 A;  1RSC A;  3PW5 A;  2Q66 A;  1GTE A;  3IG1 A;  4RBT A;  4BCA A;  1DAX A;  3CSK A;  2VG6 B;  2GFF A;  5A2Q Y;  2WCX A;  5JXS A;  3KMS A;  3AOC A;  3GP9 A;  3EPG A;  4LSN B;  2GAG C;  3V6K A;  1V5I B;  3ISN C;  3C6U A;  3VZH A;  4DG1 A;  4IO9 Q;  5A8K B;  1O5J A;  1NKC A;  1GMV A;  3D68 A;  4ZVO B;  4M94 A;  1N36 F;  3CUN A;  2VBW A;  4DL7 A;  3RTV A;  3H2V E;  1D1U A;  1RTJ A;  3D6T B;  4I67 A;  1IBL F;  3FCV A;  3VAM A;  2JLF A;  1NKE A;  2FVP A;  1C1B B;  4ECQ A;  3DN9 A;  3LTO A;  4TQS A;  4C7Q A;  3WZ0 A;  3BF4 A;  2MKJ A;  1L3V A;  2CPJ A;  2AJ1 A;  3JSM B;  4OYP A;  5HBM B;  4ZPV R;  1S12 A;  4C3M A;  1U1R A;  1QY7 A;  4X84 A;  2FHO B;  4NLT A;  1M5V C;  4URG A;  4U8Y A;  2UV8 G;  4X4O A;  3FSX A;  3IG1 B;  4K4X A;  2MST A;  4G1P A;  3BSA A;  1FEH A;  4K4Y A;  4TLQ A;  3BR8 A;  3HUL A;  2OPQ B;  4QIG A;  2DY1 A;  5E3A A;  2AV5 A;  2F4V F;  4IFV A;  4D3H A;  1D3W A;  1NSP A;  3EZO A;  4P72 A;  1FFG B;  4V19 X;  4U6P A;  1OPZ A;  1SVD A;  1WAC A;  1HR0 F;  3G4S S;  4IRD A;  4EFA C;  4DV4 F;  5SZT A;  3Q83 A;  5KT6 A;  2KXN B;  3SCL E;  5I4M A;  5DRK A;  1HQ2 A;  4A48 A;  3OVB A;  2VPZ B;  4LRD A;  5D3G B;  2IM2 A;  2W2M P;  2H5J B;  4TLR A;  5EHH A;  1JX4 A;  3M7V A;  2A1B A;  2R8G A;  3CB4 A;  5LOQ A;  4HHH A;  3MOJ B;  3R8Y A;  1Q79 A;  2QJ3 A;  3M6V A;  1PSD A;  3CCZ A;  5A8R A;  2HNY B;  4KPC A;  3MEG B;  3KLI A;  5HMW A;  3TX0 A;  2XG8 A;  1BQX A;  1IWA A;  1YJN S;  3PCO B;  3W64 A;  2ZC3 A;  3NP5 A;  3MM9 A;  1N36 J;  4KAI A;  4NLP A;  1ZTT A;  2RAQ A;  4LF5 J;  3KOA A;  4P2F A;  2UXD F;  4LIW A;  1M5O C;  1IQZ A;  3G71 S;  3FBB A;  3Q22 A;  1HNX J;  1IBL J;  4IFV B;  3AAW B;  2FLP A;  4RX6 A;  1JLB B;  1D8Y A;  2XI2 A;  2NUH A;  5HVH A;  4NA1 A;  2VA2 A;  4X4Q A;  5E5N A;  4I7F A;  1RBO B;  3CO9 A;  3ZZT A;  3MMJ A;  1WHV A;  2JLG A;  2FZC B;  3D6H B;  2CAJ A;  1VYA A;  1JLG A;  1B0P A;  3OTD A;  5F3T A;  4AFF A;  1RAA B;  2OEK A;  4A8X A;  2ACY A;  3CCR S;  4ID5 A;  2F7V A;  3GFX A;  3J7A N;  4DLE A;  1DQA A;  5J2Q A;  3T5L A;  5ETQ A;  4A8M P;  2CXE A;  2FJE B;  4CLY A;  4IH7 A;  2F4V J;  1XNQ F;  3IR5 B;  4P9S A;  4IO1 A;  4MKY A;  2V34 A;  4WZQ A;  3HVA A;  2CQ2 A;  5DET A;  1RWV B;  1HR0 J;  2MMY A;  2YNF A;  3OXL A;  1NK0 A;  4EI2 A;  3OXG A;  6FDR A;  2JVR A;  2YPZ A;  1Z2L A;  1ZH5 A;  4I2P A;  2IRU A;  3BPS P;  3LH2 S;  3NLC A;  2L08 A;  3VWS A;  3SFU A;  3PRB A;  1RI7 A;  1Y5L B;  4EMD A;  3J81 Y;  3CVK A;  3Q23 A;  4B3T F;  5HMY A;  1HFE L;  3T1Y J;  4WP8 A;  5AE3 A;  4WJB A;  3HJF A;  4I7F B;  1EAR A;  3BM7 A;  1MWY A;  2ZOM A;  4J9S A;  4DJB A;  8AT1 B;  3DM2 B;  1SI9 A;  3VR1 A;  3TX8 A;  3GMG A;  1F5B A;  5LT5 A;  1G2E A;  4GVL A;  3M2U B;  2PE8 A;  4OYZ A;  1H7W A;  2RQ4 A;  1N8R T;  1SC3 B;  2YTC A;  3FRY A;  2UXD J;  3MD1 A;  3DRX A;  1NRK A;  5AJ3 J;  4WFN Q;  5DGB A;  1UFK A;  3SDE A;  5E3R A;  2IA0 A;  1RCO B;  4B3O B;  2N3L A;  3ENW A;  3RU0 A;  5DDQ C;  4DCO B;  2GVZ B;  2DGT A;  3QFH A;  4YR2 A;  5H9E K;  1N5Y A;  1YRT A;  1SIW B;  2YNF B;  2AJ0 A;  5GVQ A;  3EGZ A;  2ZJR Q;  5IOL A;  2OPP A;  2V67 A;  4JI5 F;  4I2P B;  2CKW A;  3GE9 A;  1NK6 A;  2JZ5 A;  3IA0 A;  4QW9 A;  1ZYQ A;  2ZKT A;  1KLN A;  1F5C A;  3H20 A;  3GSI A;  2QLF B;  3DLG A;  1SC4 B;  2WRM A;  1GX5 A;  4BS2 A;  4ZCL A;  2BAC A;  5CYM B;  1XNQ J;  2XSJ A;  2BUN A;  2EBG A;  4RW9 B;  1V3S A;  2DBB A;  1FVQ A;  3P5B P;  1T03 A;  4W4M A;  2GIF A;  4I69 A;  3D4J A;  2HGN A;  2DNG A;  3MUT P;  2M8D B;  2QO3 A;  4NLW A;  2CQ0 A;  4N77 A;  3H5X A;  1IKW B;  2KHC A;  2WBR A;  1BY9 A;  2RF2 B;  1IJF B;  1OYE A;  3SDE B;  1BUX A;  3D1H A;  3OL9 A;  4B3T J;  4ZP7 A;  3ELH A;  2QMX A;  3TJA A;  2OMO A;  2XUL A;  2Z2Y B;  3M9O B;  1RE1 B;  2F8M A;  5KFZ A;  4KV8 A;  1SKU B;  3HSZ A;  5HJX A;  3MCS A;  2ZH1 A;  2VAS A;  5B7W A;  4NEZ A;  5KFH A;  1YJR A;  3FFI A;  2UUB F;  2PN6 A;  2OPP B;  2R7U A;  3BKF A;  4QBU A;  2D7S A;  2G1H A;  2GCF A;  3RB3 A;  3NNH A;  1TL4 A;  3OFF A;  4F36 A;  2FGC A;  4IFY A;  1H98 A;  2DJW A;  3QT6 A;  4DXL A;  4PXD A;  4QZV B;  3K5O A;  2VUG A;  3DLG B;  1GH8 A;  5K8M A;  4RNN A;  3OVA A;  5MLC V;  4DV7 J;  3DDI A;  4KR0 B;  1PYO B;  2G2Z A;  3I5B A;  4OJ1 A;  3OUY B;  3EXY A;  4C0H A;  4MFB A;  1T03 B;  1FX4 A;  1J27 A;  2G1D A;  2IJR A;  3IFE A;  4HI1 A;  3W65 A;  4H4M B;  4A46 A;  4DV0 F;  4JI1 J;  1LXN A;  4X4N A;  4NI2 B;  1N56 A;  4N41 A;  1TEL A;  1AUS L;  2BEF A;  2ZZM A;  2OO4 A;  2YNI B;  3W3S A;  3MD3 A;  1S72 S;  2DGV A;  2EPI A;  4AND A;  2BJ9 A;  3M4X A;  2B5J B;  3M6U A;  4ED4 A;  2F3J A;  1UA1 A;  3QZ7 A;  1R7I A;  1VIX A;  1RTZ A;  3K5N A;  2J0W A;  4H54 A;  2C2N A;  3RRH A;  5F8M A;  4IRK A;  4L73 A;  3D5M A;  3ICL A;  3HXM A;  1HHS A;  4QIW D;  1WOS A;  3B8H A;  2WZ1 A;  5LSL A;  4X4T A;  2R3V A;  3RW7 A;  3ZTR A;  4C8L A;  4JV1 A;  3FBE A;  3GLJ A;  3DRP A;  2UUB J;  4S0M A;  4LFB F;  1K47 A;  2M70 A;  4C8Z A;  2B3T B;  1TUG B;  2YWK A;  3QWP A;  3AOB A;  1TUV A;  3CCM S;  1A7G E;  3H90 A;  3QYY A;  4KC5 A;  2PMH A;  1S9F A;  1UEU A;  1SH3 A;  3M8Y A;  1ZBT A;  5LMU J;  1JLE B;  4F2S A;  2CJY B;  3H59 A;  2V68 A;  3K5L A;  3UW1 A;  3FKB A;  1MRO A;  3BDE A;  4P74 A;  3D1O A;  4Q7A A;  3W5X A;  3PY8 A;  1FWP A;  4C11 A;  5D15 A;  1JXV A;  3K0J A;  1FRL A;  1S6U A;  1S97 A;  5K8P A;  2UV8 A;  3ITH B;  3K8W A;  5H9F J;  1UKU A;  1UZH A;  3Q86 A;  1FRK A;  3RGI A;  4Q44 A;  2CJQ A;  1NK7 A;  4LSZ B;  4RUB A;  5EX3 A;  2WBM A;  4QYR A;  1X9S A;  3RBD A;  1URN A;  3CCE S;  5FJ4 A;  4K4S A;  1JLF A;  5CAA A;  5M2R A;  2BBE A;  3CMQ A;  2DGS A;  4G65 A;  5DDR C;  4NYZ A;  4X4S A;  2RKI A;  2J5A A;  2FGO A;  2MQO A;  5D77 A;  2C3O A;  4IKA A;  3HFK A;  4GVB A;  2PFF B;  3TUI C;  4LBI A;  1ZTW A;  5J2N B;  3MCM A;  3CJT A;  5A0Y A;  2HVD A;  2W7A A;  2Q43 A;  2V9W A;  2GMH A;  1KWM A;  3T19 A;  4IOC Q;  3TUP A;  4C11 B;  3OLB A;  1T3O A;  4LFB J;  2OD6 A;  5EWG A;  2W9B A;  1NK4 A;  4YDX A;  4R5P B;  2RDJ A;  3KTQ A;  1WTF A;  4DL0 C;  1VQY A;  3PHT A;  4CQ1 A;  1NSA A;  4K8R A;  2VD3 A;  5THW A;  1PYT A;  2VHG A;  1FDB A;  5HMZ A;  3OTC A;  3OJS A;  1NM2 A;  4D3G A;  4ECV A;  2L9N A;  2QX0 A;  3W5Z A;  1JLF B;  1HQE A;  2C3Y A;  4AT1 B;  4ZPC A;  5DJB A;  4FPR A;  1T3N A;  2OML A;  3GYG A;  1E6V A;  5KFL A;  4RLE A;  2KVQ E;  4O4G B;  2LU2 A;  1R27 B;  2HIQ A;  4AYB D;  1X5S A;  3ADA C;  2OIH A;  1F0X A;  3KK3 A;  5EGY A;  2R7S A;  4IQM A;  2M3D A;  3MM6 A;  1DHM A;  2LFV A;  2O01 C;  4MKV A;  5A0Y B;  1LWF A;  3WBZ A;  1YLX A;  2W24 A;  2G0C A;  3NBP A;  1F9E B;  2CPF A;  4J9O A;  5F41 A;  4B3S F;  1IR1 A;  4B9L A;  2HBR B;  5KFI A;  1U8S A;  4NCB A;  1TL7 A;  1TMM A;  1OMS A;  2HBZ B;  5H1S V;  2ZNZ A;  2FYX A;  3QT8 A;  1HWI A;  2MTL A;  3GQC A;  1KDN A;  3B4M A;  1S6O A;  3IRW P;  3BN4 A;  1TFY A;  3NG8 A;  5D0R A;  3HHL B;  4MIA A;  4N8O A;  3CC7 S;  3R1L A;  4FF2 A;  4JI0 F;  3VVT A;  2XC9 A;  3BS9 A;  3CO0 P;  2MQL A;  3BGO P;  3I0R A;  3JQJ A;  4M5G A;  4NCG A;  4YS2 A;  4K2X A;  3M2V A;  1HQE B;  1RHQ B;  3PDN A;  2RNE A;  4DR5 J;  5EUH A;  3P5T L;  3NGU A;  1UL3 A;  4IG0 B;  4BHQ A;  1RAO A;  3PFO A;  1YZ6 A;  4KO0 B;  4HDG A;  2F4F A;  1X0P A;  3KK3 B;  4LF4 F;  5IWA F;  3CUL A;  3BQ2 A;  4AD6 A;  2P5V A;  1LWF B;  2L3M A;  5CQG A;  1RHU B;  4E0D A;  5E33 A;  1NB7 A;  1C4A A;  2J8S A;  3NBP B;  1BD6 A;  4AQY F;  3DLJ A;  1ULR A;  2ZFH A;  2IMW P;  1RQ0 A;  2V4J B;  3R9L A;  3U1L A;  2R8K A;  1FFS B;  1TL7 B;  5B0C A;  2DR5 A;  3D66 A;  2QL5 B;  4QYZ K;  4QIV A;  3TP2 A;  4Y0F A;  4CH7 A;  4ANE A;  3EM1 A;  1WC1 A;  1VBZ A;  2GHW A;  1GXL A;  1NO8 A;  3U1N A;  1TVR B;  2MKK A;  2CWX A;  2DR6 A;  4DF8 A;  3EGN A;  3MR2 A;  3I0R B;  3PX4 A;  1FVS A;  4NCG B;  2FVS A;  1VQN S;  1R8H A;  3S1T A;  1U2C A;  2CPX A;  2GVD B;  3TEG A;  2LXF A;  2HQI A;  1S9E B;  2EBE A;  2IHR 1;  1DRZ A;  5KT7 A;  1VRU B;  3RJM B;  1S5Z A;  3DLB A;  1U0S A;  2BQU A;  2B43 A;  3VGU A;  2RML A;  1ZM3 A;  4GC6 A;  1IKY B;  1AT1 B;  3QIP A;  1J5E F;  3UR3 C;  5G0R B;  4X65 F;  1FI4 A;  3OSP A;  1CQN A;  1HW8 A;  3ZO7 A;  1N32 F;  2AIR B;  2HS4 A;  1GQE A;  4WFZ A;  3PIP Q;  2E1P A;  2A10 A;  3TZZ A;  4ZN1 A;  1WEL A;  1R8B A;  3KLV A;  3HLU A;  4MK7 A;  2ZM6 F;  2YY3 A;  3H0P A;  4OYB A;  2MZS A;  1RWW B;  4PCQ A;  4FKY A;  1S1U B;  3RYL A;  5IWA J;  1F9H A;  3CIM A;  1CJT B;  1RT7 B;  2AQ4 A;  3NGK A;  1VLY A;  2H3E B;  1QSL A;  3MMB A;  4KGV B;  1HMV A;  2P9G A;  3Q24 A;  3CC4 S;  1QTN B;  3FEZ A;  4L3N A;  1DY3 A;  3ULH A;  2HMI B;  4DR2 F;  1UEV A;  5CD4 A;  2KYZ A;  4I6Y A;  3M30 A;  3H40 A;  4NLS A;  2MKH A;  2BE7 D;  4UZC A;  2I6W A;  2E7V A;  1NU4 A;  1WSR A;  3QIP B;  1HWK A;  2Z2Z A;  3OR1 A;  3IN5 A;  2VDH A;  4E8U A;  2C3U A;  1UVN A;  5BYR A;  2DHG A;  2DHA A;  3DLK A;  2FJB B;  5F0W A;  3NGS A;  1U48 A;  2XLK A;  2ZVI A;  4UW2 A;  1QUV A;  2VC1 A;  2KB2 A;  3SCK E;  4M95 A;  4OZ3 A;  4PPD A;  3A12 A;  2H51 B;  3K5M A;  1SKR A;  3ZZO A;  1U1L A;  2IY5 B;  1XQI A;  3HMJ G;  4EBD A;  1QD1 A;  3CCT A;  1J5E J;  2ROE A;  4CYU A;  4EYI B;  1DJ0 A;  1H7X A;  3MMB B;  4USU A;  4X65 J;  1BC6 A;  1P8G A;  5BR8 F;  1CUL A;  5K20 B;  2DGO A;  1N32 J;  1VC6 A;  3QBC A;  3Q8V A;  1YJT A;  2YNG B;  1S1W A;  3PYE A;  4UUW A;  2FVR A;  1DBD A;  3I9V 9;  3OR1 B;  3DRR B;  2UUT A;  3V6D B;  4FP9 A;  4GRS A;  2VON A;  1X4A A;  2MZ1 A;  2IMO A;  1LFW A;  3DMJ A;  4WFB Q;  2MZR A;  1A9N B;  3DLK B;  2IFX A;  3H2L A;  3ZZ0 A;  2FVQ A;  3BGL A;  2DXE A;  2E5G A;  2XWX A;  2R7Q A;  4O3N A;  1RWP B;  2W4P A;  5B08 A;  3DOL B;  4TY9 A;  1RK8 A;  3G6X A;  4DR2 J;  4AL6 A;  2QLB B;  3PO5 A;  4LF8 J;  3CDA A;  3JS9 A;  1WNE A;  1HWL A;  1U1Q A;  3TJ9 A;  3RRK A;  4PAB A;  2OAU A;  3FQL A;  1VIS A;  3IRX B;  3EIC A;  2RHQ B;  2CVI A;  2C3M A;  5IZH A;  4UT4 A;  5M2P A;  2QA1 A;  4DCJ B;  1KOO A;  3EDR B;  4IG3 A;  4ERD A;  5A6P A;  2CQ1 A;  4DDF A;  3FBF A;  2I8E A;  4DUY F;  2BKN A;  4EBE A;  4NRU A;  3PX6 A;  4P73 A;  1YTY A;  1U7L A;  3ENQ A;  1HL6 A;  3HT3 A;  2HSE B;  1D09 B;  1ZET A;  5A76 A;  1RTH A;  3CD6 S;  4LSL A;  3WX4 A;  1F9F A;  4LRC A;  2PI5 A;  3DMJ B;  2RQM A;  4LF1 A;  2KDO A;  1WDD A;  2VFU A;  3QWU A;  2NXU A;  1FD2 A;  2RHS B;  2HBY B;  3FEX B;  3QFW A;  1KHW A;  4N56 A;  2BJ1 A;  1RA7 A;  2W01 A;  3T9N A;  3G6E S;  3MWB A;  4U95 A;  2BKP A;  2PII A;  3HSD A;  3MM8 A;  5LSO A;  5CCM A;  4F4Y A;  1ACM B;  4K0K J;  1U09 A;  5FDL A;  2B7C B;  2ZH4 A;  2HVH A;  1NHU A;  3MMC A;  2BKO A;  1N0U A;  1Z2Z A;  1JKH A;  1L5U A;  4CO5 A;  4PRF A;  4RR5 A;  4Q0B A;  1N4L A;  2AMC B;  3NGR A;  4C8Y A;  1S0O A;  2EI5 A;  2OSR A;  1YKW A;  2M5Y A;  7FDR A;  1CQM A;  3NL0 A;  1Q8L A;  1NPR A;  3M6W A;  2DHX A;  3N28 A;  4R0J A;  2GS8 A;  1VIO A;  1WEY A;  2UVV A;  2OPS B;  4OHZ A;  3GZ7 A;  1RZM A;  3CD7 A;  1LWX A;  1Z1Z A;  1CJU A;  4USM A;  3CD0 A;  3RBX A;  2DNQ A;  1YJW S;  2Q79 A;  3GJS B;  2ZD1 B;  5ETL A;  2XYH B;  1UAW A;  1M5K C;  2HHU A;  3JXO A;  3C3L A;  1RAC B;  3DU6 A;  3BEG B;  2CPH A;  2CYY A;  5ETT A;  4ILL A;  1RAD B;  1WF1 A;  1X9W A;  1AUD A;  3R5J B;  4F3O A;  1F60 B;  3AB4 B;  2VA3 A;  1O51 A;  1UWB A;  2C2O B;  2E1C A;  4ED3 A;  4MMO A;  2YWE A;  2B4O A;  3A8J A;  1N48 A;  1HNI A;  1RAJ A;  2EFQ A;  3Q8R B;  2HLT A;  3GPA A;  4CTA A;  4OZ1 A;  4NXN J;  1JNZ B;  2JLE A;  1WG5 A;  4EGL A;  2VOO A;  4CLW A;  2XNQ A;  1N33 J;  4DS5 A;  3GR1 A;  5HAO A;  2D74 B;  4WZM A;  4PXC A;  2CNL B;  2JJ4 D;  2LCW A;  1L3K A;  2VQE F;  4HR2 A;  1FXR A;  4JUZ A;  1NJX A;  2H4Y B;  2ZE2 B;  4G3I A;  1CJU B;  1OY6 A;  3E2E A;  3SSR A;  1Q8K A;  2YKA A;  1UEK A;  3QT5 A;  3CIZ A;  1WHX A;  3S8S A;  1V3R A;  1YG0 A;  4ETZ A;  4ZHR A;  3ZFV A;  4WK3 A;  2VG5 B;  1GXT A;  2W2Q P;  2EFO A;  2EKY A;  1WJ9 A;  1VQK S;  3QO9 A;  2POK A;  3Q2S C;  3OHA A;  3UN2 A;  1HKA A;  2DTJ A;  4OJ3 A;  1UWB B;  3IP0 A;  1FEE A;  5CA5 A;  3RBZ A;  2CQ4 A;  5HRO B;  1EIY B;  1YBU A;  1IQT A;  1YDL A;  1NKB A;  1HNI B;  2BDP A;  2RDD A;  3SQG B;  5DDO C;  1T9Y A;  3HI9 A;  4PWD A;  5DM7 Q;  1K44 A;  1Q7Y T;  3TVY A;  4CLS A;  2W4D A;  4I2Q A;  1XN9 A;  1B3T A;  1L3U A;  1G3O A;  3HKW A;  2V8V A;  1HD1 A;  1MU2 A;  3J80 Y;  1C4C A;  2UUC F;  3MAA A;  2KH9 A;  4RWW A;  1Q8I A;  4WCE Q;  3H5Y A;  2BVZ A;  5GAG U;  4XPE A;  2P9C A;  1NZA A;  4ZHR B;  2MZJ A;  4CLT A;  3KG4 A;  4EZ9 A;  4OX6 A;  2YX4 A;  3EE3 A;  2E66 A;  4DSJ A;  3QO9 B;  2IYG A;  4HAC A;  1FX2 A;  3D0H E;  2XWY A;  1JNR B;  3UDC A;  2HRY A;  4WYW A;  1CPZ A;  4UOG A;  1S1V B;  3QGG A;  4BBY A;  1B70 B;  4OZJ A;  5ITH A;  3PR4 A;  4KGK A;  2G2O A;  3IXQ A;  2XB2 D;  4DLG A;  1R0B G;  1FRI A;  4B9M A;  1FE0 A;  2VQF F;  3PO4 A;  2NPI A;  3FSI A;  1O6X A;  2OPR B;  1IUJ A;  2BM1 A;  2KJW A;  4RW4 A;  5LXY A;  4RU9 A;  2NYI A;  2VV5 A;  4CLZ A;  3HHE A;  3T1A A;  2LMI A;  3FEY B;  4ZVE A;  3MAA B;  3HVR A;  1CJK B;  1TU0 B;  1GAO A;  4K2J A;  1TFW A;  1UPP A;  1LEO A;  5T7L B;  1VC5 A;  2VDI A;  4MJK A;  1FJC A;  3PKY A;  2AX1 A;  1TMJ A;  1S48 A;  1D9D A;  2ZBP A;  2RD5 C;  3KYL A;  2ZH2 A;  2FUG 9;  2J6T A;  3PJ9 A;  4W98 A;  4ETX A;  2G9O A;  3D0G E;  1KQS R;  7FD1 A;  4TYB A;  2DY9 A;  1I94 J;  2YWG A;  3M32 B;  1M0S A;  2B9X A;  4MH8 A;  1FRJ A;  3TQ1 A;  2KTQ A;  1D8Z A;  2KRB A;  4J37 A;  3DC2 A;  2JEI A;  2ZEJ A;  1T02 A;  2UUC J;  4GKK F;  2YNH A;  4TXS A;  3FZ2 A;  4J90 A;  4CDI A;  3MR3 A;  4QIF A;  3UPF A;  5AXK A;  3AD8 C;  2DR9 A;  2CUY A;  4M5H A;  5A8W A;  4RW4 B;  1IBM F;  4TN2 A;  1S9G A;  2HHW A;  1RT4 A;  2B8Q A;  3Q0A A;  1G1X A;  1H74 A;  4ICL B;  2EFV A;  2M52 A;  3ILO A;  4OX9 F;  3GCX P;  4OL8 A;  3QT7 A;  2IAJ B;  3HVT A;  2GW8 A;  5E3Q A;  4NEY A;  5LJ5 Y;  3Q89 A;  3NS7 B;  4LRA A;  4E98 A;  5KFD A;  2QL9 B;  5HLF A;  1FER A;  1UVL A;  4M8L A;  1QAI A;  3U02 A;  2V2Z A;  1RP5 A;  2VFV A;  3M1V A;  1Z4U A;  2FJA B;  1U1N A;  1CLF A;  3EZU A;  2VQF J;  4ED1 A;  2HVZ A;  1IKV B;  3DGP A;  2AF6 A;  3Q8Y A;  4ZN3 A;  3G9C A;  4C2M A;  4K4V A;  1KON A;  4DV6 F;  2J0Q D;  5LXR A;  5CCL A;  5J1E B;  1RDR A;  3CJ0 A;  1TL1 A;  5FII A;  3OD2 A;  2KFZ A;  4RWX A;  2JEF A;  2XS5 A;  1EB0 A;  2EG2 A;  2QFJ A;  5LJ3 Y;  4Q2M A;  1WTB A;  1RKI A;  2JL9 A;  3T41 A;  2XBP A;  3AJ2 A;  5A8W B;  1C0T B;  3BBC A;  4O3R A;  3MR5 A;  1S9G B;  2AD9 A;  1RT4 B;  2KKH A;  1UFL A;  4GC7 A;  1WSV A;  3HHN B;  3KG1 A;  1TV6 A;  4DQR A;  1HI8 A;  2ZBC A;  1T9T A;  1SUQ A;  3OFH A;  4CI0 B;  2QC3 A;  1FD8 A;  2CRL A;  2KT3 A;  2J9D A;  4ILM A;  3A4T A;  2HW3 A;  4IDK B;  1TL3 B;  2VBZ A;  5HLF B;  3SV3 A;  4YUD A;  4B9V A;  4PPZ A;  2R4F A;  1QAY A;  2K1R A;  4R8U A;  4Y2M A;  3M1V B;  1QLN A;  4YHH F;  5K5M A;  1BWV A;  3PW4 A;  3DGP B;  2QSW A;  2PSZ A;  3KUE A;  2IVM A;  3WIV A;  1X5P A;  2A3J A;  3BSC A;  5BXI A;  1IBM J;  4EBC A;  2O67 A;  3CJK A;  3QJJ A;  4ZK7 M;  1AZS B;  2IDE A;  4OI2 A;  4V19 J;  2Y8W A;  3JTP A;  2LQB A;  4QWA A;  3RBE A;  1HBN A;  1RTI B;  1SKS A;  3AA9 A;  2OP5 A;  1HYS B;  3H2U B;  1VRT A;  4M1K A;  1IN0 A;  1IKX A;  3F56 A;  3ZZZ A;  4RNF A;  1TV6 B;  2XM3 A;  4ZLL A;  1SUQ B;  1FF2 A;  2FLO A;  1S6Q B;  1FT8 A;  2FJW A;  2P9E A;  2CZ4 A;  4PG7 A;  4RUH A;  3TI0 A;  5JJB A;  3P96 A;  1P9Y A;  3PV8 A;  4DV6 J;  2FQQ B;  1NJW A;  2OD4 A;  5FLX Y;  3MMA B;  3K89 A;  4R8U B;  1LW0 A;  5KFS A;  4QWE A;  3MUM P;  3PYF A;  2ZHO A;  3D67 A;  2F8H A;  3IAM 9;  5BYQ A;  5GAH I;  4UOH A;  2W9C B;  3VGS A;  3UFC X;  1EKS A;  3CJ2 A;  4EWT A;  5K14 B;  2MKY A;  1IM6 A;  3QGH A;  3KG0 A;  1RGV A;  1T7P A;  1RU2 A;  4KTQ A;  2DNN A;  2I5J B;  3CJK B;  2K8G A;  4KHP F;  2QMU B;  3GIR A;  1R8C A;  2LDY A;  4DOZ A;  3EJM A;  4RJV A;  2MZQ A;  1X7V A;  1VRT B;  4ZP9 A;  1EET B;  1NPK A;  1T9V A;  2QLJ B;  3MR7 A;  3UNG C;  1VQL S;  1FJG F;  4NYO A;  4ZLP A;  1Q8B A;  4DFJ A;  1NZ8 A;  3RUB L;  2ZUA A;  4JI6 F;  3W2W A;  1AA1 B;  3EVW A;  3T5H A;  1XER A;  2WW8 A;  2HG4 A;  4QW8 A;  1NK9 A;  3GIJ A;  5SUH A;  5E7O B;  4QWC A;  1VQS A;  2QIF A;  5DM6 Q;  1S59 A;  2A2D A;  1B7F A;  5FD1 A;  1KN6 A;  4FXW A;  3V81 B;  1W2I A;  1BHN A;  4NLG A;  1JJH A;  2HAF A;  3R97 A;  1WOO A;  3L7O A;  5T41 A;  4ZVU B;  2DPI A;  2IM1 A;  5F9L A;  2F8E X;  3K57 A;  3FUY A;  9RUB A;  1ARO P;  2VIC A;  3KMQ A;  2W8K A;  3HCX A;  3X3U A;  3R7N B;  3TAR A;  1ZM2 A;  4OI6 A;  4XPC A;  4CLL A;  5IM0 A;  3HFV A;  1S4E A;  2PI4 A;  2Y0S D;  2HHV A;  2RUG A;  3K2Y A;  2BW2 A;  1NCL A;  2JFD A;  3GFY A;  5C25 A;  3QNW B;  3LP2 A;  1QE1 A;  3JQK A;  4DQP A;  2AGQ A;  3JAM U;  1NLK L;  3ENA A;  1KLM A;  4L72 B;  4WTY A;  2GJF A;  4O3Q A;  2OSQ A;  3QSI A;  3PHE A;  3BPD A;  4DFM A;  2PMZ D;  4AL7 A;  3IBF B;  3EPI A;  3NOC A;  4CLP A;  2RT3 A;  1WC0 A;  2YH1 A;  4ZCI A;  3TA0 A;  2KZM A;  5I3Q A;  3JYT A;  5M2U A;  4KHM A;  4C98 A;  4F04 B;  4K5R A;  2EK1 A;  3HO1 A;  4CM0 A;  1RLC L;  3FCH A;  4QOT A;  4LFA J;  5K9F A;  4DR7 F;  1FJG J;  2P2C B;  1GK8 A;  1N5T A;  2BJD A;  2DIS A;  2JEJ A;  1YIJ S;  4LF2 A;  4G1Q A;  4JI6 J;  2CPE A;  2MQP A;  4AUK A;  2CPD A;  1JLC B;  3TAM A;  2WOM A;  3U7J A;  2IJF A;  4QWB A;  1REV A;  3LP2 B;  2RB7 A;  1X4H A;  4P71 A;  4LBH A;  4TVA B;  3NWR A;  3CE8 A;  1KLM B;  4GKJ J;  3MEE A;  2BXJ A;  1WKJ A;  2VG7 A;  4PQA A;  4QPX A;  4USW A;  5A2Q U;  4UF4 A;  3FNN A;  1FDD A;  2PC6 A;  5J2M A;  1RHR B;  2K2P A;  1URR A;  4LUB A;  4ZPA A;  1PC5 A;  4ANC A;  4IR9 A;  4EK2 A;  3JYT B;  2LEP A;  2DRA A;  2DIT A;  5I3U B;  5GMD A;  2DO4 A;  2RRN A;  4NLU A;  1MWZ A;  2FHM A;  2HHQ A;  5F8L A;  2LA6 A;  3LP0 A;  1FWK A;  1T94 A;  2GJ2 A;  3PJX A;  2UUA F;  5D4L A;  3JSY A;  4USK A;  3QLH B;  2W7O A;  4QPT A;  4PG8 A;  2AYE A;  3EUN A;  2JH3 A;  5ETK A;  4HKQ A;  2FZK B;  3R2D J;  1SJF A;  2XI3 A;  4G1Q B;  5DG8 A;  3DFE A;  2N3O A;  2DNR A;  1LXJ A;  2XO7 A;  1NSQ A;  3SSQ A;  4ZPT R;  1XMQ J;  4MIB A;  3TAM B;  1QTM A;  2JOQ A;  4FXD A;  2H65 B;  3EZ5 A;  3SEO A;  2CQG A;  3FC9 A;  4MTP A;  3D0I E;  4USH A;  3ZXW A;  5EWF A;  2BM0 A;  3MEE B;  4UST A;  4U7U K;  1KD1 T;  4DR7 J;  3IGV A;  3BZQ A;  3LOU A;  1VQ7 S;  5ETM A;  4FF3 A;  2XMA A;  5J2M B;  3HX9 A;  2O3D A;  4IOB A;  2DYA A;  1AB8 A;  4ZDN A;  1F5A A;  4FYD A;  4B3M F;  1PIL A;  4BWM A;  3L4B C;  3MZI A;  3W66 A;  4UUX A;  5KG1 A;  1YSJ A;  4KH1 B;  2KU7 A;  4M5D B;  1T8E A;  3TRG A;  3GCW P;  2AWZ A;  2CWK A;  1JIH A;  1TK0 A;  4DHV A;  4JYA F;  2HK3 A;  4JI3 F;  4O4R A;  1WF2 A;  1ZM9 A;  3WHI A;  4FDF A;  1TKZ A;  4ZJO A;  2KM8 B;  1RAF B;  2AJ4 A;  1Y3K A;  4TU7 A;  2LLZ A;  2COL A;  2HIY A;  8ATC B;  4YB1 P;  1U25 A;  3GIM A;  1Q78 A;  5CZV A;  2VFS A;  4ZLN A;  2RU3 A;  2WON A;  4QR1 A;  5JUM A;  5F8J A;  1N54 B;  1KQK A;  1U49 A;  4HHJ A;  2GC8 A;  3CJ4 A;  1N52 B;  3P3D A;  1R31 A;  2UUA J;  5IQQ A;  1R0A A;  2DCU B;  1V5V A;  2V0N A;  1YX2 A;  3MUR P;  2ZOF A;  2XHW A;  2B4V A;  2HFZ A;  1FWL A;  2WVD A;  2VFR A;  3VAG A;  3BDP A;  1NXI A;  4NX9 A;  3ZNJ 1;  2X1A A;  1QSS A;  1KQG B;  2YQ3 A;  4LR9 A;  4OYA A;  3CJ5 A;  1FJ7 A;  3UD4 P;  2Y1J A;  5CYQ A;  2D69 A;  1X4B A;  2J0S D;  2KN4 A;  4U7C A;  1W25 A;  1ZA1 B;  3M8P A;  3MOZ A;  3C14 A;  1SQE A;  4WXW A;  5LMN F;  2XO6 A;  4TU8 A;  3CCL S;  3J7Y U;  5KG3 A;  3GWC A;  1SB6 A;  1PBU A;  5C2G A;  4K7Q A;  3HF5 A;  2HWH A;  2DNZ A;  4UQG A;  4K4T A;  4X62 F;  2R7R A;  4FVM A;  1TKX B;  1CS4 A;  2AP6 A;  3I87 A;  4XDC A;  3NNC A;  2WON B;  3AJD A;  3T9Z A;  3KJV A;  1Q7L B;  5LM7 E;  4CNY A;  2W1B A;  3CNQ P;  1H3D A;  4HVZ A;  3CCS S;  2I38 A;  2ZDO A;  2IYI A;  3W8G A;  3J81 U;  2ZNY A;  3Q8Q B;  2DNM A;  2DNP A;  3RRG A;  1JMT A;  1F3V A;  3G87 A;  3EDQ B;  1SL2 A;  3DRS A;  3KUH A;  2C2Z B;  4LBP A;  4USV A;  2QE5 A;  4ZCK A;  4WII A;  1PJ6 A;  4OQJ A;  5I3P A;  4JI2 J;  5I42 B;  1VDH A;  4PAA A;  1RWK B;  1D0E A;  2QLW A;  4P2M A;  4P7V A;  2K7K A;  4RO0 A;  3W61 A;  2V94 A;  3ZTO A;  3KJF B;  3JTN A;  1RWX B;  5KFT A;  4DU8 A;  4YP3 A;  1VMB A;  2CPY A;  2W7P A;  2F9D A;  1GXU A;  3HZE A;  1S7I A;  3EWG A;  3PW7 A;  4C4W A;  3C6U B;  4DG1 B;  2U2F A;  4WBF A;  3KJV B;  1O0P A;  4Y28 C;  1R6Y A;  3KLH A;  2BAN A;  1RTJ B;  2AEJ A;  3CW2 C;  3FMW A;  1P1T A;  2UP1 A;  5LL6 d;  2WAQ D;  1LW2 A;  1TL5 A;  4FS1 A;  1R6V A;  4RBU A;  4JP8 A;  5J2P A;  1Q86 T;  1YVF A;  3TVZ A;  4Q43 A;  3R5G A;  2BX6 A;  5CXT A;  1UFW A;  4KFB A;  2DEI A;  3C2P A;  3GR0 A;  3DRS B;  3T3F A;  4X62 J;  1X5T A;  2RS8 A;  2GQC A;  2QTW A;  2M7S A;  1KKH A;  1OWX A;  2ZZN A;  4KSE B;  1NDL A;  1Y5I B;  2BQR A;  2CQH A;  2RRB A;  1DLO A;  3VQT A;  3TA1 A;  3TAN A;  3IGN A;  3CC2 S;  3MPV A;  4J9R A;  1RAB B;  5KG6 A;  4ZCM A;  1NHK L;  3VAI A;  4M63 A;  1ZM4 A;  3PG9 A;  3C6T A;  1KTV A;  1YHQ S;  5HAN A;  2RRA A;  3NEK A;  1XC9 A;  1LWC A;  3CCQ S;  2CDQ A;  3EGW B;  1GMW D;  1H2V Z;  2LYV A;  3KKF A;  1UJ6 A;  2DXF A;  2YX1 A;  4F0M A;  3KLH B;  4ZLJ A;  3PJW A;  4FKX A;  1PO6 A;  2V2K A;  2KJV A;  4J9M A;  4QU6 A;  5J2P B;  1YRU A;  4OLP A;  2JDJ A;  2UU9 F;  3IBC B;  4DU7 A;  5KT4 A;  2R2S A;  3VZI A;  2QZ8 A;  1CC8 A;  1KBR A;  4ILR A;  1YBT A;  3LP1 A;  2EFG A;  4KY3 A;  2LQ9 A;  3KDO A;  3MAQ A;  4Y65 A;  5A8R B;  1EQM A;  3R6G B;  3KLI B;  1WHY A;  5ETP A;  2HQC A;  1RAG B;  4OFZ A;  5B0F A;  4WFY A;  2XGQ A;  3FZB A;  4XIU A;  3GJR B;  1TR0 A;  3MM9 B;  1MMD A;  4ER8 A;  1MNE A;  4QQB A;  2ZKU A;  4DV4 J;  2XS7 A;  3R2C J;  3KHR A;  4GO5 X;  2H1Y A;  1VFJ A;  3L95 X;  2PEB A;  1DTT A;  1C2P A;  2E9Z A;  4DPY A;  2WSF C;  2DPJ A;  1LWC B;  2B6A A;  1JLQ A;  2GX8 A;  3I4P A;  4CO0 A;  2RIJ A;  3BO4 A;  3HHD A;  4DR4 F;  1K0V A;  4A8F A;  3P6Y C;  1SKW A;  1JLG B;  1Q16 B;  4Q5V A;  3IBW A;  5B0A A;  2EC2 A;  3WQP A;  2R9L A;  2ZIT A;  3MPW A;  2HQD A;  4LQ3 A;  4PYD A;  2VBY A;  3O2I A;  1OIA A;  2BJE A;  3AA8 A;  2MQM A;  3IM9 A;  4ID5 B;  1LWE A;  2N82 B;  1G4C A;  4TY8 A;  1VQ6 S;  5J2Q B;  1UW9 A;  4IYQ A;  2XY7 A;  2J9D E;  3PIO Q;  2PA3 A;  3IWL A;  3EX7 B;  5U47 A;  4I6A A;  1L3T A;  2FY8 A;  3WX8 A;  3R6L B;  1N6Q A;  1PBA A;  4F02 A;  5GAH U;  3MED A;  2MY7 A;  1VQO S;  3H5U A;  1AYE A;  1X4E A;  1R89 A;  4NZ0 A;  4DEZ A;  3CCW A;  4L75 A;  3OTO F;  4B9T A;  2UU9 J;  1S77 D;  2B6A B;  2OUG A;  1JLQ B;  2HWT A;  4NLX A;  1RYR A;  2F5G A;  3NXZ A;  1CVJ A;  1M5S A;  3M6X A;  1WF0 A;  3GFH A;  3FJ2 A;  4PWW A;  2JNJ A;  3KK2 A;  3DI6 A;  3RW6 A;  3CCV S;  3N4W A;  1FJE B;  2GIR A;  1LWE B;  4OZN A;  4TY8 B;  4C8O A;  4MKA A;  4LF6 F;  3G82 A;  3DKD A;  4ZVS B;  4C8N A;  3TR5 A;  2HWI A;  1H73 A;  2XTJ P;  3J81 j;  2D41 A;  5EX0 A;  4MK8 A;  4PG5 A;  1AXQ A;  3N6L A;  2KFN A;  1N5V A;  2O66 A;  4J9K A;  2QA2 A;  4JI8 F;  5IS2 A;  1RWO B;  2FLN A;  1VK8 A;  1N6Q B;  5A6W A;  3UCU P;  2XLI A;  1N5Y B;  3OPK A;  2FB0 A;  4DR4 J;  3BB5 A;  1ZAX A;  3GU0 A;  4ES2 A;  1HWU A;  3T1H F;  5ETV A;  2N4C A;  4U96 A;  3DLH A;  1IWG A;  4JI4 F;  4FF1 A;  2WVF A;  4CO4 A;  2DNH A;  4FYX B;  5L39 A;  4RW8 A;  4DV2 F;  4DL3 A;  3AQP A;  4PUO A;  3TW0 A;  4DV5 F;  2XSJ B;  3H4D A;  2BMB A;  2DXD A;  5KOX A;  5E41 A;  4X4V A;  3KK2 B;  2AT1 B;  1UVI A;  3DI6 B;  1BLU A;  1U26 A;  3DRY A;  3HHL D;  2XEX A;  1I1G A;  1OY9 A;  3G6V A;  2C2M B;  3DOK A;  1PKU A;  2QLX A;  3NWG A;  3OBI A;  2X1B A;  2UXB F;  3G82 B;  1VQ4 S;  3B78 A;  2P8I A;  3W9H A;  4JI5 J;  5HSP A;  3NCR A;  3FBC A;  5CHC B;  2NSC A;  3O44 A;  1VC0 A;  1WWH A;  3B6B A;  1XK8 A;  5D0G A;  1TKT A;  1WG1 A;  3BGR A;  5KFK A;  4KV8 B;  1HI0 P;  2YKN A;  3VAJ A;  2DH9 A;  3FFI B;  4BC7 A;  4O3O A;  2EKN A;  3RR8 A;  3AY0 A;  4F4X A;  1U45 A;  2CQP A;  2V2Q A;  1PGZ A;  4IFY B;  4RNH A;  2WTF A;  1Y5N B;  1K1Q A;  2HHX A;  4RW8 B;  1FKP A;  3B4D A;  3UR0 A;  3BBB A;  1M1G A;  2YKP A;  4QWD A;  2IRX A;  2LU1 A;  2NXC A;  4XAK A;  4F26 A;  3P8B B;  5D6G A;  3QJL A;  3V4M A;  4N7T A;  4DN0 A;  4MFB B;  1T05 A;  2DEJ A;  4NWB A;  4KE5 A;  1DTQ A;  1OQ3 A;  1KVI A;  1GMU A;  5IXU A;  1ZZN A;  1DZ5 A;  3ONQ A;  3T1H J;  3I9Z A;  1RT6 A;  4KYZ A;  4JI4 J;  2IVF B;  1LKZ A;  1F6T A;  4CT9 A;  1RLD A;  2APO A;  5IFM A;  2V50 A;  4R25 A;  3C16 A;  2ILY A;  1TKT B;  2ZH5 A;  3BGR B;  2ROP A;  4DX7 A;  3BO3 A;  4DV2 J;  1FTR A;  1SQG A;  2MXY A;  3F73 A;  2C2K B;  4DV5 J;  1X60 A;  2BE9 B;  3KWM A;  3IC1 A;  2FY1 A;  2LQJ A;  2ROG A;  1X4G A;  4F2R A;  3VF0 B;  3A8I A;  1HPZ A;  3LGN A;  2HGM A;  4KGM A;  2NR0 A;  4RPF A;  1B0T A;  1HNW F;  2DH7 A;  1FRX A;  2R2T A;  4KRW A;  2UXB J;  3LAK A;  1X4F A;  3F0N A;  1FKP B;  1RBL A;  3D2W A;  2MHE A;  3OR2 A;  1YI2 S;  1IBC B;  3RB0 A;  3PFE A;  1Y9O A;  3CDW A;  4DV0 J;  1B4S A;  2P6S A;  5KTQ A;  2CQI A;  1U1O A;  5KG7 A;  2ASJ A;  3GIL A;  2HS3 A;  4Y6I A;  3DXS X;  1T05 B;  3J7Z 5;  1DTQ B;  4QJV A;  4FVC A;  2J0X A;  1NH7 A;  4C3K A;  3TUZ C;  4IUF A;  3DRP B;  1YJU A;  3CCJ S;  3HHK A;  1XMB A;  4NLV A;  5DZ7 A;  1S7H A;  4CNZ A;  2HND A;  5E3P A;  1K8A T;  3QRQ A;  4HHU A;  3DGV A;  4CZC A;  3C46 A;  2NPF A;  3H25 A;  3D6F B;  2GZO A;  3KJN B;  3QGP A;  5HP1 A;  3HD1 A;  1T95 A;  3D54 A;  3D28 A;  1IVZ A;  4LFC F;  3FVY A;  4J9L A;  1U1K A;  3MEC A;  1W26 A;  3AD9 C;  3PEJ A;  3T6J A;  4ECU A;  2OH2 A;  4ZIT A;  2CQ3 A;  2KVI A;  2HFU A;  2NXE A;  1H0H B;  4M5I A;  1MRO B;  1HPZ B;  3TVK A;  4WF9 Q;  1VQ9 S;  2PEH A;  4W92 B;  2AX0 A;  4XK8 C;  2R42 A;  3DDK A;  5GAG I;  5ETR A;  2EW9 A;  3W2V A;  4H4K C;  4DV1 F;  4OYO A;  1S0V A;  2E1A A;  5IT9 Y;  4K4Z A;  3CTR A;  4LQ9 A;  3R5A A;  2DNL A;  2CG4 A;  2E7X A;  2MKI A;  2R2U A;  5H9E J;  3E01 A;  4QR2 A;  2W8L A;  3I4H X;  3O5T B;  3K7R A;  2XCA A;  2OEL A;  3IR6 B;  3UCZ P;  1KFD A;  2V5H G;  2BRK A;  2EWH A;  2VB6 A;  1SJR A;  2HUR A;  1G7C B;  4C0O C;  2HND B;  3QID A;  1FES A;  5L1L A;  5HP1 B;  4OHY A;  3I0S A;  2KXH A;  2RKI B;  3OLA A;  4LR7 A;  4KIA A;  4V1A k;  4NRT A;  4GVB B;  3M8Z A;  1RT3 A;  3E8O A;  2DIU A;  1NJY A;  2AHO B;  1CSJ A;  4F7V A;  1RT5 A;  4OHW A;  3N01 A;  3GG0 A;  1RB0 A;  4XO0 A;  3LW5 C;  3ZZR A;  5ETN A;  1Y7P A;  2MSS A;  2NYH A;  4H4K A;  1U0H A;  3Q8P B;  4OI3 A;  2W9B B;  2QA4 G;  3EXC X;  2C2R A;  2DNO A;  3PRD A;  1EX8 A;  3UD3 P;  4DSF A;  3IS9 A;  1FHT A;  4OI1 A;  3W9I A;  3G6Y A;  1XWL A;  4ECS A;  3MGJ A;  4RZR A;  1QVG R;  1X8D A;  4F67 A;  3V5R A;  2VG6 A;  2GQQ A;  4OZL A;  1O8B A;  3BSN A;  1PAU B;  2HQG A;  3RZA A;  4KHR A;  1E6V B;  3TEH B;  3PR5 B;  5LSR A;  4LSN A;  2XHC A;  4NLR A;  1OYD A;  2Q6B A;  4XDD A;  4DX8 H;  2GML A;  4DV1 J;  1HWJ A;  1WHW A;  1UA0 A;  4FF4 A;  3ILJ A;  3MPD A;  3MM7 A;  2F9J A;  3H42 A;  1BE4 A;  3DHX A;  5HAT A;  2QYC A;  3MM6 B;  1F3F A;  2J7W A;  2H9Z A;  3NCQ A;  3LAL A;  1NPP A;  4PXE A;  4FBT A;  1YQH A;  1UJ4 A;  1S1X A;  3GV5 B;  2QEX S;  2NZ4 A;  4B3R F;  1C1B A;  1U0H B;  4NA3 A;  4KJI A;  2MZT A;  2D9P A;  1X31 C;  3THT A;  4ECY A;  1WC4 A;  4TKT A;  3MFI A;  2DR7 A;  4J9V A;  3JSM A;  4UY8 5;  4TU9 A;  4ZIW A;  4Q8E A;  1UCN A;  3IWX A;  3NGD A;  3M05 A;  3BQ1 A;  2VFT A;  1SQF A;  1FNM A;  3KLG A;  4ELT A;  2Q3P A;  2RQC A;  2MLY A;  1U6F A;  3M2V B;  2OPQ A;  2H5E A;  4USJ C;  3GV8 B;  1K9M T;  2H48 B;  3OL7 A;  4AXI A;  4FN5 A;  2QL7 B;  5D0E A;  2I9S A;  4B3S J;  2AGO A;  2F65 A;  3E51 A;  3I82 A;  5G4D A;  1Y4Z B;  3MUV P;  1NDP A;  3OV7 A;  2C2E A;  3MM7 B;  1OJ4 A;  2DO0 A;  5HVF A;  1KEK A;  4O23 A;  2MLZ A;  2HHT A;  4PYA A;  4LF5 F;  2Z2L A;  2DGU A;  3LUY A;  2B51 A;  1HNX F;  2AW0 A;  2E29 A;  4JI0 J;  3CJR A;  3K58 A;  2BOP A;  2GO9 A;  5AXM A;  1S1X B;  5D3G A;  4F4A A;  4CIO A;  3ZTQ A;  3M2R A;  1NJZ A;  2A6M A;  2B4P A;  2KRR A;  1MMN A;  3QGI A;  2HNY A;  2YVS A;  3MEG A;  1KVJ A;  2XZW A;  1U2F A;  5F3Z A;  1FRH A;  4M5M A;  2BAB A;  2E9R X;  1X4C A;  3W8P A;  3UDV A;  2BYC A;  3KLG B;  4LF4 J;  2Z0G A;  3TOQ A;  3KJQ B;  5K8N A;  2HYI B;  1K0T A;  1P1L A;  2KZZ A;  1PJ7 A;  3R7S B;  5J1P A;  2G0I A;  1JLB A;  4ZP6 A;  2YBV A;  1VHI A;  3K5P A;  4AQY J;  2FJD B;  5F8G A;  1RBA A;  3M8Q A;  3NNA A;  4B3R J;  5BJR A;  3W9J A;  4NA2 A;  2VJU A;  4F8R A;  3H4B A;  5F8I A;  2HHS A;  1XIQ A;  4ZVG A;  4EO8 A;  2UVU A;  1NDC A;  3ZZU A;  2AZ3 A;  3TO8 A;  3NAI A;  3OW2 R;  1VR6 A;  5DZ6 A;  2DVI A;  2KO1 A;  1S10 A;  2KL8 A;  4RNO A;  5GAE I;  3G96 A;  1JXE A;  2JX2 A;  4RW6 A;  3CT9 A;  1HBU A;  1NH8 A;  3O6Q A;  3T1Y F;  3NOG A;  2PMW A;  3M2R B;  3VAK A;  2RUS A;  2MY8 A;  3HVW A;  3N6N A;  3UNY A;  4KT0 C;  1S79 A;  3VAF A;  1YJ9 S;  2R7X A;  2G13 A;  5JMN A;  2JC0 A;  1EZZ B;  1YWX A;  4DR6 F;  1RT1 A;  5MAO A;  2V69 A;  5C2C A;  4NLO A;  3JSB A;  2ZDP A;  1MWQ A;  5AJ3 F;  1RWN B;  3C19 A;  1GFW B;  1T9W A;  1HMV B;  3M8Q B;  3MCN A;  3HM9 A;  4ZS6 A;  3PAC A;  1UVJ A;  2MLX A;  2WSE C;  4J9P A;  2HHH F;  3I5A A;  1ELO A;  3M30 B;  2HKE A;  3NCP A;  2W2P P;  2GGP A;  1A0O B;  3OTB A;  3V4I A;  1V3Z A;  3DM2 A;  2MQQ A;  4ID8 A;  1FXL A;  1RHJ B;  3CME S;  2XY6 A;  2ZM6 J;  2GQ2 A;  1QSY A;  1NND A;  2XMV A;  3M2U A;  2D3O R;  4RW6 B;  1HBU B;  4C3L A;  2KHD A;  4NZ6 A;  1HAR A;  4C97 A;  1RT2 A;  2NUU G;  3G8Q A;  5KFA A;  2ADC A;  4FS2 A;  4ECX A;  4GO7 X;  4JV2 A;  3DDN A;  3FSY A;  5AXL A;  2XNR A;  1EHW A;  4OMF G;  1SH0 A;  4HT5 A;  3P49 B;  5GME A;  1SJ3 P;  4B3O A;  5JVH Q;  3MXH P;  4HH1 A;  1HQU A;  2OFH X;  2F1F A;  4ZP8 A;  4DN9 A;  2GVZ A;  4ZOS A;  5H9F K;  3B54 A;  2CZ9 A;  1HI1 A;  5ADZ A;  1RT1 B;  4ZPB A;  4C8K A;  2NRE A;  1M5H A;  4IRC A;  3G8T A;  4USI A;  2Y1R I;  2ZWO A;  1EP4 A;  1SV5 A;  4CYU B;  2BJ7 A;  1Q4R A;  1U4B A;  2FZG B;  2KT5 A;  4E2F B;  3FRZ A;  1MN9 A;  4RW7 A;  1CUL B;  4L3K A;  4NML A;  4G1I A;  3RB6 A;  4KGZ B;  1YRX A;  4Q2L A;  3I6P A;  2Z8Q A;  2GGP B;  5CYM A;  1S1W B;  3V4I B;  4AE5 A;  2BW7 A;  3N5F A;  3ZZP A;  2CQB A;  1QVF R;  5KG2 A;  3AXM A;  4RW9 A;  2UVR A;  2OJ3 A;  3D3B J;  5HK4 A;  1RIS A;  4DR6 J;  2CQC A;  1RT2 B;  4M5L A;  1IKW A;  1VCT A;  1UET A;  4DV7 F;  4X4U A;  2VL1 A;  4CCH A;  4TQR A;  3M9M B;  2RF2 A;  4F4W A;  1WKL A;  3PW2 A;  3UN3 A;  5BR8 J;  3LQV A;  1HQU B;  3AHP A;  4UOF A;  2CNK B;  2HHH J;  3BYR A;  4Z2X A;  3PM9 A;  5JVG Q;  3J80 U;  1WKK A;  1WI6 A;  1ROF A;  3A3O B;  4CLK A;  2IBK A;  1EP4 B;  2GNK A;  2I0X A;  1R8A A;  1SV5 B;  2GMJ A;  5HJY A;  3PVX A;  5GMK a;  1BMQ B;  4PG6 A;  1X4D A;  1JLA A;  1R8P A;  5DLG A;  3M8R A;  2V4R A;  4JI1 F;  4QYZ J;  2NXN A;  2PGC A;  4RW7 B;  1HA1 A;  4HTI A;  2QSF A;  3BKU A;  3D6M B;  1DQ8 A;  1VBY A;  3CDB A;  1K1S A;  4IG3 B;  5KFW A;  1XNR F;  3K17 A;  4M5K A;  1VJQ A;  1YJV A;  3TZX A;  2NSB A;  1I3O B;  3OUY A;  4ZPW R;  3UVJ A;  3W62 A;  4DQQ A;  1RTH B;  3KNG A;  2PO4 A;  4LSL B;  1U8W A;  3TJ8 A;  2V8D A;  1Y10 A;  3PXG a;  4H4M A;  1U6Z A;  2D3Z A;  4WE1 A;  3HD2 A;  4NI2 A;  4M5J A;  2Z58 B;  4CH1 A;  2HFO A;  3MM8 B;  4LRB A;  1W7W A;  2YNI A;  4G6V B;  3ZC4 A;  2ZJQ Q;  4DUY J;  1BQN A;  5FDL B;  2V2V A;  5GAD U;  2B5J A;  2DHS A;  3A8E A;  1HNZ F;  3MMC B;  2MKC A;  4YDD B;  1WEZ A;  1JLA B;  1YIT S;  1Q81 T;  1IJE B;  3LWL A;  1QM9 A;  3GB0 A;  4CP5 A;  4OV6 A;  1AFI A;  1JKH B;  2YQ0 A;  1EQ0 A;  1NME B;  1YBA A;  3NKY A;  1GMW A;  3KHG A;  4Q0B B;  4YFU A;  1RCX B;  2RVJ A;  1NUE A;  3GJT B;  2ZZT A;  5LMU F;  2YKQ A;  5KFY A;  4I68 A;  4DR3 F; 
#chains in the Genus database with same CATH homology
 1M1G A;  3LPE A;  1M1H A;  4ZN3 A;  3P8B B;  2EXU A;  2LQ8 A;  4ZN1 A;  3EWG A;  1NZ8 A;  2XHC A;  1NPP A;  3H7H B;  2K06 A;  1NPR A;  2OUG A;  3QQC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...