2OUGA

Crystal structure of the rfah transcription factor at 2.1a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
155
structure length
141
Chain Sequence
QSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLFPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYKKVIITEGAFEGFQAIFTEPDGEARSMLLLNLINKEIKHSVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator rfaH
publication title Structural basis for converting a general transcription factor into an operon-specific virulence regulator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 29
structure length 141
sequence length 155
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 2ougA00
2K06A 3EWGA 1M1GA 3H7HB 3QQCD 1NPRA 2XHCA 2LQ8A 4ZN1A 1NPPA 2OUGA 3P8BB 1M1HA 3LPEA 2EXUA 4ZN3A 1NZ8A
chains in the Genus database with same CATH superfamily
2B4VA 2BV3A 4MKBA 4OYOA 4ECRA 1HKAA 3UWTA 4X4VA 2MY7A 3CCJS 3ZZYA 2Z30B 4CP5A 4JI1J 1FWLA 2E1RA 5HLFB 1JJCB 3HT0A 4TY8B 1WF0A 4IRDA 2V4RA 2XB2D 3NY0A 4OYBA 4B08A 1U25A 1QSSA 3MTKA 2RB7A 5HO4A 3NCQA 2AJ0A 1DTTB 1WOPA 3C6TA 3JYTB 5AJ3F 1IBCB 2QLWA 2BJEA 1RK8A 4DFMA 5THWA 2FZGB 3W9JA 2HGNA 1LK5A 4DL6A 2LQBA 2ZH3A 2CVEA 3H5YA 3R5AA 1R0CB 2ERRA 3HKZD 3GSDA 3C15A 4XPCA 4DMZA 1KC8T 4PCQA 1FT8A 2B5JB 5L1LA 1WTFA 2GNKA 5LMNF 1G7CB 1G2EA 1LW2A 4MAKA 1M5VC 3CCQS 4O0NA 3HJFA 2HHXA 4JOUA 5C2GA 1JLBB 1MWZA 2AX1A 1S6UA 3M6XA 2CA9A 2HG4A 3KNGA 1L3UA 3M8PB 3MMCA 4U7CA 1UMJA 1N0VC 2R3VA 1Q16B 4HEA9 4KB7A 2DR7A 4DS5A 4O23A 1GX6A 1SC4B 2AJ2A 4PABA 3ENWA 4WU3A 5I42A 1F1BB 3I32A 3ICLA 1JLAA 3EZ5A 2GGPB 1S9EA 1CJUA 3QZ8A 2QIFA 4DR6J 4PQUA 3E51A 4A46A 2GC8A 1OMSA 1YBAA 2CPJA 1NJXA 1M0SA 1DHMA 1HYSB 3G6ES 4NRUA 1JQGA 3FMWA 3D66A 5C25B 4LJMA 4XO0A 4DBQA 5D78A 3ZXWA 2FJAB 1UVLA 4J9UE 3MEDA 1RWPB 3K2YA 4GVBB 2BW2A 1S99A 3MM9B 5CH7B 2RHSB 3MF5A 1P9YA 1PYSB 2UXDF 3S6EA 1UJ4A 3I9V9 3KLFA 1SQEA 2IAJB 3MCOA 3GV7B 3Q8RB 2EW9A 3SQGA 1FRJA 2HZVA 3LA0A 2AD9A 2DRAA 2QL5B 1HNWJ 1YIJS 1IR2A 5CCMA 5F8HA 3G9CA 4LFBJ 3X3UA 4F26A 3AH6A 2VODA 4RBTA 2GZOA 1N5YA 2ABYA 3LGHA 3K5NA 3QMQA 2LCWA 2N4DA 2HBZB 3AY0A 4YOEA 4WBFA 4QPTA 2P5VA 2XO7A 4IDKB 3MMBA 2M5YA 3R5GA 4DR3F 2H51B 2DR6A 5KG2A 2DPIA 1A6LA 4FKXA 4QYZK 1TU0B 4RW6A 1DFDA 2G2OA 1U1OA 5LOQA 3V6KA 1BLUA 2EEYA 1KQSR 2HBYB 3HK2A 1FRXA 2QSWA 5CA5A 3DLGB 1KEKA 5J2QA 3BS9A 2ZH8A 3HHLD 1U1NA 3DMJA 2OGUA 2VB6A 2L9NA 1K0TA 1SKSA 3I4HX 4DV7F 4OI6A 4JYAF 1U6FA 2ZFHA 2D3O1 2YNGB 4P2SA 1RSCA 3BR9A 5ADZA 3ZZTA 2EXUA 2XGQA 1PKUA 1UL3A 4FF4A 1N52B 4BDPA 5L46A 5F8GA 1AW0A 3TUJC 4DN0A 3TAMB 1FXLA 1JNZB 3FNNA 3C66A 2Y1RI 1KFDA 2VZ9A 4OX6A 2F3JA 2UXBF 3G6VA 3JQMA 1HPZA 2UV8G 4FYWB 2B7CB 1XNRF 4PUOB 1WF2A 1HW9A 1U7LA 2DNLA 1N88A 3OVBA 5RUBA 3R7SB 1O51A 1QVFR 2BKOA 4R8UB 1FDBA 3HSZA 3A8KA 3KG0A 3E01A 1DLOA 5GADI 4MKAA 1VQOS 1N5VA 3AT1B 1UWAA 3EUNA 4DV4F 4F4XA 3EZOA 4LF4F 3NXZA 1KN6A 3HHDA 4R0EA 2DXDA 1IVZA 3OJSA 3H90A 4F7VA 4MJKA 3QWUA 2EFPA 1RTIA 4WJBA 3Q2TC 3QNWB 4LF8F 1S12A 1FD8A 1WI6A 2R8GA 3D0HE 4U9RA 2Q43A 3C15B 3IWNC 1VK8A 4EGLA 2Z58B 3FSIA 4DI6A 5IV4A 3RGIA 2JFDA 4OL8A 3HI9A 2EFVA 4K4UA 2FVCA 2XSJB 3FCVA 2ZVIA 4P52A 4P72A 4M5DB 3MHYA 5B0GA 2RDIA 4K5RA 2CQ1A 1YJ9S 3SV4A 2AKWB 4RLEA 2R7RA 1RTZA 3BKFA 1F2GA 4X66J 3DI6B 1U1KA 4FYVB 3UN3A 4CO4A 5I42B 2Q6BA 1JLAB 1S9EB 4F3MA 1QAXA 5KT7A 3CD5A 4PQUB 5DGAA 2BANA 4NCGB 5H9EJ 4DR2F 2DY1A 3QRPA 4CLUA 1NKEA 2LXFA 2CPYA 2P6TA 4NZ7A 1Z2ZA 3EX7B 3GIMA 1RI7A 3MOJB 2CQ0A 1RHMB 2M4MA 4FF2A 3GB0A 4RU9A 2C2EA 3VV2B 4CO5A 1NB7A 1T3OA 4G65A 1RBAA 1JLGA 4YMEA 4DV2F 3QJLA 1GXTA 4GRSA 1WC5A 3T9NA 2HAFA 4JI2J 3KLFB 3KJVA 4O44A 4EBDA 2PFFB 3IN5A 3J7YU 1H2VZ 4WFZA 1QSLA 1Z1ZA 2PC6A 4ZP9A 2WAQD 5HQMA 1GX5A 3FDSA 3W64A 2XY7A 3TNVA 1KLMA 5CAAA 3I9ZA 4N5SA 2UUTA 3POTB 4JBCA 1IM4A 2B6AB 2QLXA 2VG7B 1S4EA 1WOSA 1N5YB 4LQ3A 2BE7D 4V19X 4G1QB 2EI5A 5K8OA 2E7WA 4I6AA 1HBUA 5E0OA 2BQRA 2XNRA 1KWMA 3MMBB 4CI0B 2CQGA 4C8ZA 3DHXA 4ZVTB 1KBRA 3MPDA 3CJ0A 3V6DA 4X64J 3DM2B 3UQSA 2V50A 3JTOA 5EX3A 1HARA 1P6TA 3IRWP 2Z2ZA 3VGUA 3AHPA 4H4OA 4NLUA 1TAQA 1HHSA 1Z4UA 3OUYB 3CJ4A 3DKDA 3SEOA 4I1TA 3HD2A 4HI2A 1FJGF 5FJ4A 5F9LA 1NHUA 2DGXA 3OL7A 1S1UB 1N32F 1R43A 3PVXA 3FUYA 4DV5J 2O1PA 2H4YB 5KFPA 1LW0B 3P8BB 3M2RB 3M6UA 5L9NA 3EGVA 4PPDA 1TVRB 4KO0A 2YXLA 1OS5A 4LVOP 3IS9A 2JDJA 2AYMA 1VBZA 3SDEB 4EMDA 1L5UA 1HNZF 1Q7YT 3LPYA 1BXNA 4LR8A 2AGOA 2BRKA 4EYHB 2L9WA 2G9OA 5HP1B 2I6WA 1YLXA 4L3KA 1RWVB 2WK4A 4OJHA 4EBEA 3PFOA 1RU2A 4E8UA 1Y5NB 1WG4A 3TX0A 2W7AA 2QL9B 4ED2A 1TK0A 3BSAA 1HNIA 1S49A 4X84A 5J2PA 3N0VA 3AA9A 2OO4A 3M8QA 1T11A 1RT1A 4K7QA 3PW5A 4YR3A 2JNJA 3QJPA 2ACYA 3UCZP 3VGVA 1X0FA 4BBYA 4YR2A 1HQ2A 2BUNA 1KVKA 1RTIB 3L4BC 3CCUS 3CW2C 2MEWA 3TYTA 4RJVA 2W9CB 3AD7C 3PW7A 3EGWB 5BYRA 4IO1A 4ERDA 3MPYA 3B4DA 1Y11A 3HM9A 4LF9J 2M7SA 3OFEA 1FESA 2EKYA 2IYGA 1WC1A 5B0FA 3KK1B 1SIWB 4PXEA 4C3LA 5KG4A 1GFWB 1LWEA 2W1BA 1DQ9A 1TL1B 3QRQA 1S79A 3JS9A 1SKWA 4V1Ak 2H5JB 5CXTA 3CCES 5IS2A 2HW3A 3I6PA 4IKAA 1GMUA 1VS3A 4J9PA 2W24A 5D77A 3MECB 4WK1A 2HFVA 4UF4A 2AYGA 1R7IA 3HSDA 4Y2MA 3R5CA 4QYRA 3T1YJ 2R8HA 1SV5A 2IRUA 3NNHA 2F40A 2FJEB 2B0GA 2Y0BB 1RCOB 2NYIA 5HBMB 5EDWA 1NK7A 5DG8A 4YFUA 3KWMA 5U47A 4ES2A 4BS2A 2BW7A 3T6JA 2IMWP 4ZN3A 1R8BA 4EWTA 4HVZA 2MZSA 3VCDA 1S59A 2DNRA 3R2CJ 3N28A 3W2WA 5HL7Q 4JI4F 3M1VA 1HNXJ 1OIAA 3B6BA 5BJRA 1Q78A 4I64A 1UVJA 3HT3A 4C7QA 3PACA 1IBMF 4O44B 1FD2A 4CLTA 3GILA 4IYQA 3UD5A 1Q1KA 5CABA 3AD9C 1T03B 1RYRA 5G4DA 1IR0A 4DV1J 1R8PA 1XR7A 2HS4A 4C8LA 3FBCA 2MQOA 3IC1A 3D1QA 4JI3J 3DHWC 1TL7A 4OI2A 1RT3B 4UUWA 4NYOA 2HRTA 3CPWR 4RNFA 2ZITA 5LJ5Y 1SC6A 4ZJQA 1HBUB 1S5ZA 3CJKA 2RVJA 4ZDNA 1IKVB 3W65A 1Y9OA 2V8GA 3KYLA 3MGJA 4ED3A 2G0JA 3RJMB 4XIUA 4C8KA 4S0MA 3C14A 5F9NA 2DNOA 2RE1A 2J9CA 5BR8F 3RRKA 1OSDA 4CT8A 4RW7A 1RT2B 2Q66A 2QMUB 1M5PC 2VD3A 2DR5A 3BBCA 2QMWA 4X4SA 2CG8A 4ZHRB 3HPOA 4QYZJ 1H7WA 1D1UA 4P7TA 4OJ3A 1ICEB 1DBDA 1MWYA 3N6LA 2KZMA 2WTFA 2JWNA 3TA0A 3PW4A 3IRXA 2V4QA 2R4FA 2ZWPA 5T7LA 2YY3A 4ED0A 4ZCMA 3UW1A 2AJ1A 1P27B 1FHTA 1HWIA 3P3DA 1KLNA 3EZUA 5LJ3Y 2CQHA 2XZTB 2NZ4A 3HO1A 3MM5A 2KRRA 4ED1A 4K5SA 4DCPB 2GIFA 2BKNA 1IQZA 2VA2A 2IIHA 2MZTA 1HWUA 4Q5VA 3VZIA 5HVGA 4ZPWR 3DOMA 2MQQA 1E6VB 1T95A 3BREA 4P74A 2YKPA 4AQYF 4BC7A 1AFJA 4CLPA 1HWJA 2C2DA 1RTHA 1RT1B 3CJTA 4NA3A 5LT5A 1RYSA 2M70A 4N8NA 3J81j 3MM8A 4K4TA 4X4TA 2FLNA 4UZCA 5D4LA 3ZZRA 2GCFA 3SSSA 3KHGA 4J9KA 4DR7J 3Q23A 3PYEA 4DS4A 4M5HA 2M52A 3DNCA 2FC8A 2CDRB 2XLKA 4OMFG 2W4DA 4QQBA 1VJQA 4R0JA 2J7UA 5KFGA 3Q22A 2ZH6A 3DLBA 1IBLJ 2XULA 2V8DA 2MQPA 1WEZA 1WACA 2GJFA 1AFIA 1SIZA 4R5PA 4X4OA 2HRUA 4GVLA 4RPFA 1LWXA 3EM1A 3U1NA 1O6XA 3RBXA 2R7XA 4L3NA 2Y8WA 1LWCA 4I7FB 1M1KT 1QM9A 3BQ0A 2PI4A 1SV5B 2G0CA 3H0PA 4W90B 3UR3C 3PNIA 8AT1B 3D6TB 5L39A 3LP1B 1UA0A 5E3CA 4HHHA 1HMVA 2PSZA 1S1TA 2XY5A 1U4BA 2KG0A 4ETZA 2HNDA 2HQDA 4QJVA 4J9RA 2F4VJ 1S6PB 2BXJA 4ZPDA 1N34J 3H59A 1U2CA 2E44A 3QLHA 2DXEA 3G6YA 4URGA 3IR6B 5JJBA 3W2WB 2KH9A 1CC7A 4WU2A 1NDKA 4U96A 5J2NA 4ZP8A 3M9MB 2E1CA 1HBMA 4QIWD 1FKAF 5KFHA 2BACA 1PSDA 2DNHA 3UD3P 4KV8A 3C46A 3RRGA 2RHQB 5GVQA 3R27A 3UFCX 1S0MA 1RWUA 2XWYA 1M1HA 3DXBA 1VIXA 2D41A 1U24A 4PG5A 2R7QA 3O2IA 4C8OA 3DRSA 2ZBPA 3NCRA 3OTEA 2QG9B 4KYZA 4KJIA 2ZVSA 2PIIA 4HLBA 5AXNA 2CPEA 4O4GB 3TOQA 2HWIA 1RWKB 3P96A 4MYTA 1WNEA 1ULRA 4P7VA 1WWHA 1OQ6A 4Z7CA 1MWQA 1J5OB 1U47A 1Q8BA 1AZSA 2APOA 4RW7B 2IYIA 2NXJA 1DARA 2EKNA 2O5DA 3VAFA 1NM2A 3GIRA 2K3KA 1RHJB 2V9WA 2QX0A 2YVSA 2AEJA 3WQPA 1FVSA 4DQQA 3RW7A 2RUSA 1VBXA 4CH7A 4A8WA 1S0NA 2FVRA 4A8MP 4YB1P 2NREA 3KLGA 2D74B 2Z57B 5B7WA 1FK9B 3CCRS 4FXWA 4DQPA 5CZXA 3T41A 1EETB 1CVJA 3LOUA 3NRBA 1XR6A 3TANA 4KH0B 4NLWA 3QFWA 3ADAC 3TEHB 1NPRA 4KC5A 2CQIA 1WSRA 4L75A 2KRBA 3K8VA 2HQIA 2VQEJ 1QY7A 2EG1A 4ZVHA 4ZVOB 3M2UB 3M32A 1VR6A 2ZNZA 1SPBP 2DISA 5K14A 3T5JA 3R5DA 2ZH7A 3F44A 2QN6B 1MROA 3MEGB 5ETQA 4F67A 4EYIB 5C2CA 2Z0GA 4ZS6A 4X4QA 2R7WA 4C8YA 2DGVA 2DIUA 5B0EA 3SYZA 5FDLB 2WZ1A 1URNA 2JL9A 2QLFB 1QLNA 3M2VA 1X5SA 1TL4A 1H38A 4CO1A 3TUPA 2E5LF 5K8PA 2DD8S 5F8NA 1NK0A 3PYDA 4OI1A 3FSXA 2J0QD 2CZ4A 2AP6A 2FLPA 4DSKA 1TKXB 4NWBA 3I55S 2CZ9A 3IG1A 3U1MA 1X0PA 1PC5A 2ASDA 4ED5A 3TZZA 1RA7A 3GV5B 5HJYA 2J9EA 3E8OA 1NK5A 3C3LA 2VHGA 4TKTA 1IJFB 3HVTA 4HKQA 2XWXA 3PX4A 4LIRA 1Y3KA 5HATA 3SZ2A 2VICA 1R8AA 4RW8A 1X5PA 3DRPB 2QYCA 1U0HA 2FYXA 3EWGA 2C1EB 1FFWB 2XEXA 1RT7B 1FRLA 2V67A 3QGHA 5K20B 2OPQA 4DPYA 4RZRA 2EFQA 1IBKJ 3GFZA 3MCSA 3NOCA 1N36F 1B99A 4DZ6A 1LWCB 3G82A 1NK8A 2P2CB 1ZS6A 1C0UA 2CQDA 4UQTA 5H9FK 4BC9A 3VAJA 3HKWA 2DNYA 3A4TA 1B0TA 1V5IB 3S01A 1S9FA 1HMVB 3DN9A 2KL8A 3UVJA 4X62F 4QWCA 4DX7A 1DJ0A 1YBTA 1M5SA 3C2PA 4UY8T 4ZOSA 4KHPF 4A8YA 3MFIA 2W9BA 2HNZA 4QWBA 4LFAF 2XS7A 4UW2A 1H2TZ 3QLHB 1UA1A 2OPSB 3AJ2A 1S10A 4EI2A 2MPUA 1G4CA 4X4PA 4MK8A 2KVIA 4B9LA 5DDOC 3TEGA 2OD4A 4OHZA 3G96A 3W60A 1RUSA 5CHCB 1HBMB 2JJ4D 3G8SA 1FDAA 1JXVA 1UFKA 4HDHA 4CO2A 1JXLA 2CAJA 3D6MB 4ZLJA 1UEVA 1EJ7L 2HSEB 2HURA 1JJ4A 3TUIC 1TAUA 1PBAA 3NLCA 2R8JA 3PRDA 1VHIA 5E3RA 5LSRA 1IKYA 5A8RB 3PJWA 2XMTA 4OI0A 2ZOFA 2RQ4A 2CNOB 4DV6J 4F8RA 1V5VA 2WONA 3EDRB 5FIIA 3SIPB 2HGLA 1SC1B 1YJ7A 3W5XA 1HD0A 2KXHA 1WORA 3BGLA 3NS5A 3VAHA 1VMBA 3MCMA 3I56S 3BO3A 3ZNUA 1VQ9S 3N4WA 4ANCA 5ETLA 4XAKA 1AZSB 4USUA 3FSYA 4IQXA 2QGFB 1XMQF 4A8FA 3T9ZA 1JMTA 2RU9A 2LP4A 1RT4B 2XBPA 2XM3A 1K1SA 1NHVA 3KLGB 4N8OA 3VF0B 4CQ1A 5K8NA 2CUYA 1FERA 1I5OB 3J80Y 1BQNA 4F3OA 4K4YA 2I1RA 4PWDA 2HPUA 4E0DA 3D7SB 1B7FA 1YJUA 2MHNA 5AXLA 3W66A 4JI0F 1JJ2R 2QJ3A 3KUEA 3LP0A 5J2MA 3F41A 2LU2A 5D4NA 4XK8C 2CJQA 3M9OB 5IT9U 1RJJA 4B3OB 1LEOA 4ELUA 1FE4A 2OEMA 4PAAA 4IUFA 2GMJA 5KFKA 4ES3A 4LT6A 2HHQA 2ZD1B 4ECSA 3HD1A 2DK2A 2VFVA 1TZ0A 3DRRB 3GFYA 3OLAA 1MNEA 2FHOB 4BLGA 2EBEA 3QQCD 4G6VB 2HVZA 1SH3A 3EMTA 2LXIA 4PYDA 4HHUA 2WW4A 3OFHA 2SXLA 2LEAA 5IT0A 4CLFA 4KQZA 5BXIA 2HNYB 5DDRC 2B8PA 3AOBA 4DFKA 5ETSA 2RDJA 3D0IE 2BR0A 4JI6J 2VPYB 3FQKA 2NXCA 3OVSA 2YWKA 1S1WA 2OELA 1ZZFA 4C0HA 2MKCA 3GV8B 2BEFA 4JI5F 4OI3A 1YZ6A 1KKHA 2HRYA 2MZRA 3CJ5A 2VUGA 4NX9A 2DGSA 2Z2YB 3DYAB 4DPWA 1JLCA 3B82A 4I2QB 3DLHA 1FFSB 1UFWA 5KFCA 4XDDA 3VVTA 5AXMA 4E2FB 4DR1F 2MGZB 4YHHJ 1HR0J 1WHVA 1GAOA 4C98A 3PYFA 4UZBA 2V8HA 4CTAA 2W8KA 3GTYX 2VFUA 5E7OB 3R5BA 3HVWA 4LSNB 4OX7A 2EC0A 5DRKA 2OPQB 3K59A 2VFTA 3G82B 4CO3A 4M5IA 4DL3A 3DFEA 1YHQS 4X4UA 3R5JB 2VBYA 3T1HJ 3K5LA 1ZAWA 2RUGA 1NSPA 2BJ9A 4M5JA 4LBPA 3AODA 3J7YI 2DRDA 3IA0A 1Y5LB 2PGCA 3ZC4A 1S0OA 3UVJB 4TQSA 3LWMA 4ECTA 5JVHQ 4PZVA 2KM8B 4JV1A 4MK9A 1SL1A 5I3UB 1F60B 1S76D 2FD2A 4ZVQB 3VR1A 1K8AT 3CCLS 3V5RA 3OFGA 2AZ1A 3IGVA 2XGPA 3ZZ0A 3GSIA 1ELOA 3OSNA 2NPFA 2HFSA 2VFSA 2B43A 4K0KF 5A76A 2XHWA 5AJ3J 2YKNB 3MUTP 3KHRA 1N6QA 2C22A 2VC0A 4I6YA 4TQRA 3LGNA 2R2UA 3QAEA 2JRSA 3CD0A 4DEZA 2W9AA 4LBIA 1VDHA 4I6WA 3EVOA 1IKYB 1CJKB 1U1RA 4DG1A 1L3VA 2D3OR 2VV5A 3QGIA 4L76A 2KKHA 5LMNJ 1VRUA 1JLFA 2C3PA 4QR2A 1AB8A 2FHKA 1HL6A 1J5EF 5DLFA 4NYPA 2IA0A 1ZPVA 3UO0A 3N79A 3PZPA 5A8KA 3FBBA 3U27A 3JTNA 3OTOF 2ASYA 2B4UA 4PG7A 1ZZNA 4Q44A 2K1RA 3WDOA 2P9GA 4A8OA 2HK2A 5D3GA 2W2QP 4EBCA 3N5FA 1REVA 2ZE2A 2HKEA 4JUZA 1UETA 1XBWA 2BABA 2O3DA 1AROP 1LWFA 3IBFB 1B70B 3FZBA 1Q86T 1MU2B 4NI2A 3F0NA 5ETTA 1KOOA 3BQ1A 2BOAA 2E5HA 2YWFA 4M5LA 2PA8D 2V4JB 4UTGA 2OMLA 1X60A 3ZZPA 1RTJB 5DQHA 2X3DA 3PIOQ 1RB0A 3Q8PB 1TUVA 1TL5A 2GVDA 2J7KA 1TKZB 1ITPA 4ZVFA 3OR2A 3W61A 1NU4A 3BZQA 2C42A 2W4PA 1U2FA 2CQCA 1R6YA 1L3KA 3D54A 2XY6A 6FDRA 3CIMA 3QFHA 4UY85 3I0RB 3CCZA 5J2MB 3MMAA 3DGPB 2UXDJ 1C1CA 5SZTA 1APSA 1HBNB 2C2RA 4ELVA 1PC4A 1D9DA 3OTDA 3RB6A 2OAUA 3D67A 1FNXH 3BSOA 1NK6A 2YNHB 2XLIA 4NOHA 4Y65A 2RRAA 3CJ8A 5IQQA 2GO8A 1WHYA 2AYEA 1S1VA 3M4XA 4JV0A 3QO9B 1ZOTA 4QWEA 4K8RA 3M8RA 2UUAF 3VAIA 1WC0A 5J1NA 2M0GB 1H3DA 1HHQA 4DR5F 4O3PA 2H48B 1VHFA 3JXOA 5F8LA 4DR3J 1SQFA 3M6WA 1R0AB 2MKIA 3WIUA 3ET6A 4LBHA 2DGWA 4O3SA 5JVGQ 5KG3A 3QT8A 2DTJA 1MMLA 2ZNYA 3PEHA 2ZHOA 4B3SF 3KK3B 1QTMA 1EP4B 3M30A 2WVCA 3IM8A 4CH0S 4FN5A 1VI7A 5IZHA 4WKRA 4O3RA 1JLCB 5EHHA 1VQMS 3BYRA 2PMWA 4JYAJ 1F5CA 4O4RA 1WG1A 1C1BA 1S6QB 4PG4A 3TX8A 4ZPTR 1KVJA 2FY1A 2HVIA 1VJWA 4N77A 1VYAA 4CTAB 2GV1A 2W7PA 3CDEA 4K4VA 1RACB 3NS7B 3W2VA 2HYIB 2XNQA 2BJ3A 2MDAA 5M2PA 2JZ5A 2DR8A 3PR4A 3D2WA 2VDIA 3FCHA 2P9EA 4KY3A 2F9DA 2IC3A 3RR7A 4L73A 2FC9A 1U1LA 2UXBJ 4TY8A 2YQ3A 3PKYA 1U1QA 3IFEA 1XNRJ 4A8QA 2BOPA 3NWRA 1Y3JA 2LEPA 3X1LB 3LGMA 2Z2MA 2PI5A 4ZVGA 4FPRA 1DTTA 4HACB 1BGXT 1EQMA 3JYTA 1YJTA 4LR9A 1N5QA 1KQGB 2OIHA 3VQSA 2FJDB 2GHPA 2WW8A 1V6HA 5H9FJ 2ZDPA 4DV4J 4LF4J 1FKOB 1O0PA 4X2BA 2IVYA 4DUYF 2OSQA 4LSLB 4OZ2A 2B5JA 2CVIA 4LF8J 2WB4A 4ECUA 1JLBA 4DG1B 2FDNA 2FIUA 2DXFA 3GIKA 1TP7A 3L7OA 1JLFB 3Q8VA 3PXGa 1OY6A 3T3FA 1M5KC 4LF7F 5JXSA 1J27A 1OPIA 1QTNB 3GFXA 2XYPB 1Q0NA 2FHJA 2KHDA 1K73T 3H7HB 2EK1A 1UWBB 3BGOP 4WIQA 1ZH5A 3W9IA 5C5JA 4DQSA 2ADCA 3PV8A 1TV6B 3FFIB 4P75A 3CJ3A 2PO4A 2AHOB 1RBLA 2HHHF 2ROPA 2JC0A 1N33F 4OFZA 5HROB 2CJBA 1JK9B 2F4FA 4Y2CA 2VG5A 4ZJOA 2DHHA 2XCPA 4GO7X 2X1AA 1ZYQA 2WBMA 7AT1B 3DOLB 2G1DA 3I4PA 5AE3A 5C25A 4DR2J 5ETKA 1U6ZA 2GVDB 2WVBA 2UU9F 3CDBA 4GVBA 2YKAA 2H3EB 3MM9A 2GHVC 4EU0A 2QL7B 1U45A 4OX9F 5A8WA 1H6KX 4MFBA 3TJ9A 3Q24A 4TU7A 1PYTA 2AGPA 2AIRB 2IAJA 1O8BA 1X4FA 2RSQA 6FD1A 1R31A 4DV2J 2L9DA 3MMAB 2YQ1A 3P45B 1NDPA 3QGPA 2C3OA 2D9OA 1EQ0A 2MZQA 2PE8A 1YG0A 3VVUA 2NUUG 3ELHA 2RAQA 2UVRA 1JIHA 4WZMA 4IDKA 2W8LA 4I56A 3CCTA 3CMQA 3V4MA 4B9VA 1I94F 1JNRB 2V63A 4EZ6A 1NPKA 3CULA 2NCKL 4P2FA 3DLJA 3ULHA 3W8PA 2UXCF 3DLGA 1B0PA 4WP8A 3FQLA 3QYYA 3CC4S 4Z7YA 4ITSA 3DC2A 4DN9A 4OYMA 3V6HA 1Q8IA 3A1YG 4L6V3 1Q7LB 1VQPS 1HHTP 1CULB 2YNGA 2GVZB 1T9UA 5ITHA 1HI0P 2HLTA 5D4OA 3W5ZA 4TNOA 4AUKA 3J80U 3MXHP 3OBIA 3CDUA 1VQYA 2B7BB 4F0KA 4LFCF 1EARA 1FJGJ 2IJNA 1F3FA 2C2ZB 2XYHB 4USIA 1RAIB 2VOOA 1N32J 3E2EA 1YX2A 3C6UA 4F0MA 3W2VB 1VQSA 2BZ2A 3R6LB 4Q7AA 2XQCA 1ZTTA 2JSXA 4YN3B 5IWAF 3DDIA 2YWGA 1EHWA 4DWIA 4URQU 1F2HA 1X4DA 1K9MT 3HX9A 2QRRA 4PG8A 4PUOA 2ZH9A 1TUWA 1EZZB 3CWJA 3U7JA 5F8JA 2IC3B 4RNMA 2GAGC 1SUQB 4QR1A 1HNZJ 4R8UA 4PXBA 2YBVA 3MM7B 1FRKA 4J90A 2NZCA 4USHA 3C16A 2E7XA 3MPVA 2V8VA 2J8SA 1S9GB 3PO4A 3H2VE 4ID8A 4H4MA 2G2ZA 4WK3A 2E5GA 2BJ8A 2UVWA 1UPPA 4OZJA 4MIBA 1RLDA 4DQRA 1SI9A 1ZPWX 1W26A 4OHXA 1WF1A 2K3IA 3OPKA 2Z8QA 2V68A 1VQ6S 4KIAA 2GMLA 3MEEB 2ALZA 2JEIA 2I5JB 3RBEA 3ILIA 3BDEA 2MYFA 2AF6A 2RS8A 3F56A 4MMOA 2IRXA 3L09A 3TQEA 2KFNA 3VALA 4B3RF 1N5SA 5DDQC 4JI8F 2XSJA 2V69A 3UI3A 4M5DA 2GIRA 1N54B 2IHR1 2E9TA 2JVRA 1TK8A 4U95A 3R8YA 4RW9B 1FE0A 3GR0A 3WHIA 1D8ZA 4H4KA 1B64A 2O66A 3DI6A 4RBUA 3K5MA 4H54A 2NPIA 1IUJA 2GMHA 1DTQB 1XNQF 3GJTB 3IBCB 2HBQB 4KSEB 3O44A 3N5BA 2AU0A 2UUBF 4WFAQ 3D3CJ 3QBCA 4NCGA 4NLTA 2JLEA 3CCSS 1FO1A 2BE2B 3LPEA 2VG5B 2HEKA 3PW2A 2GW8A 4DX6A 1K1QA 1RAOA 1QAJA 2A1BA 1T02A 2MKJA 3SI8A 2CPZA 2DEJA 2W2PP 1PO6A 4KBIA 2AV5A 1SBRA 3O3LA 1HNVB 1NLKL 1F5BA 4Y34A 4CT9A 3JB9k 1VQ5S 2DHAA 2MLYA 2OPPA 1Q8LA 1VRTB 5A8WB 4MFBB 4DCOB 1YWXA 2VG6B 3KLHA 4JI7F 5ETPA 4JI4J 1JLQA 1SJ1A 1MMDA 1QD1A 3M7VA 2JLFA 3ZTOA 5B0AA 4AXIA 3NL0A 1YK9A 2L3MA 1IBMJ 4YB5A 1WHXA 3FK4A 1OY8A 3POTA 4DFPA 4CNZA 2DY9A 2B6AA 4U7UK 2VG7A 4G1QA 4Q8EA 4GKJF 3D6HB 2KYZA 3LP2A 4Y0FA 2PEBA 2CQ4A 2OTLS 2J0XA 2XCAA 2HHUA 5DGBA 5I3QA 4YR0A 1MW7A 1H72C 5DG9A 4JV5F 3K0JA 4HT5A 3DM2A 3H2LA 3FEYB 2OPRA 4JB8B 2C3MA 1KTQA 1CJVB 1NRKA 1YJVA 1RBOB 2U2FA 2Z2LA 1TKDA 2FJBB 2LQJA 5M2RA 9ATCB 5ETNA 3G8QA 3K89A 4I4BA 3OUYA 1GT8A 3Q2SC 2V2ZA 5BR8J 3P5TL 2HVEA 5E33A 3GFHA 3HCXA 4ID5A 3R6GB 5T41A 3CUNA 3PG9A 2KN4A 3BH6B 2I9SA 3I5AA 4KTQA 1S1UA 1NPPA 4NPOA 2JVOA 4HTJA 4O3NA 1VIOA 3GMGA 3ETMA 3EGZA 3EVWA 3HHLA 1LW0A 3LF0A 2HIQA 1FRIA 3BV8A 3M2RA 4OX8A 1RTDB 3A8IA 2V94A 4NXMF 3C6UB 1RCXB 2DR9A 1TVRA 2AZ3A 5KOWA 3R1LA 2JH3A 3SDEA 2MY8A 2X1BA 2VKZG 5HP1A 3D1OA 2OJ3A 3D1HA 2QLJB 3BPDA 1IKWB 4Q2MA 3G6XA 2HS3A 2V34A 1UEKA 2XZDB 2V5HG 4WFYA 3C16B 1MLAA 1B3TA 4ZVUB 1RHUB 3TP2A 3OQ2A 3OSPA 3NGKA 2W2NP 3H5SA 4H4MB 1NK4A 5DQGA 4AQYJ 2XLJA 5KFOA 4B3MF 1AA1B 2F8EX 3ILLA 2XS5A 1TR0A 2EFOA 4GC6A 1UVKA 1LFWA 3KLIA 4ENOA 1KOHA 2W9CA 4RL1A 2R7UA 2HGMA 3KKFA 1S77D 5DS7A 4WZQA 2JEFA 3OLBA 2YQ0A 4DF8A 5IM0B 5C42B 5DJBA 2GO9A 3QT7A 3S1TA 4B02A 3KK1A 2CJAA 4CYUB 4FYXB 2UV8A 2Y8YA 1TL1A 2HHSA 3BSCA 3GLJA 2DBBA 2EBGA 3NMRA 2H5EA 2X1GA 1PCAA 5HK4A 3W62A 2NS1B 2F5GA 4C8NA 3MECA 2YKQA 1S57A 2VIHA 2CPIA 4FXVA 4YEAA 3H25A 4LR7A 2DNQA 3EPGA 2ASLA 2LMIA 4NLPA 2KJWA 1RWWB 2ATCB 5HBMA 2ZUAA 4RUBA 2KXFA 1NKBA 2DHGA 4ATNA 3FBEA 2DHSA 4Y00A 1NB2A 2B8QA 1GEHA 3RZAA 2QA4G 5B0CA 5D0EA 5B0DA 4K4ZA 2OEKA 1NJYA 7FD1A 1RZMA 3PEJA 1Y4ZB 4OLOA 1RU1A 1Y10A 2E9ZA 2BKPA 3QGGA 5E41A 4ICLA 1XJWB 2OPPB 1FEHA 2DCLA 2GFFA 3OL8A 1C0TB 3LQVA 1GQEA 2R2SA 3BN4A 3GIJA 4DPOA 4IR9A 2RT3A 3KLHB 2IM0A 5GMDA 1JLQB 4KFBB 2BVZA 1EKSA 1T03A 2VH7A 3VZHA 2VASA 2ZM6F 2F9JA 4DR4F 1OJ4A 3CNQP 2UZAA 3L9ZA 1HBOA 2XZWA 3RYLA 3H4BA 4B9MA 1GMWA 3MD3A 1B4SA 1RT3A 4U67Q 2VOPA 3LP2B 4QW9A 4OZNA 2YKMB 3EXCX 3KNAA 3OHAA 3BYPA 4PXCA 1IKVA 1FTRA 1S7HA 1W2BR 2VC1A 2DH7A 3HSGA 3IR5B 3RG6A 4FF1A 5IC6B 3DLEA 4RW4B 3ZO7A 1F0XA 1HWLA 4J9VA 3QSYB 3AOCA 2OPRB 2V2VA 4YDXA 2HVDA 1NJZA 1RT2A 1NNDA 2ATLA 4USVA 2BJ7A 4RWWA 4ECQA 4Y3CA 2PFDA 2MKSA 1D0EA 3V4IB 4NE9C 4QIEA 3FGVA 4ZHRA 4AYBD 3HSJA 1E6YA 4ID5B 4OZ1A 4OJGA 3OJUA 1D3WA 4QPXA 3RTVA 1XMOF 3BF4A 4LF6F 3US5A 2R7TA 5F0UA 4I67A 3AB4B 2IRYA 2CNLB 3HHLB 2MZ1A 2HQGA 5D0GA 4NLSA 3KHLA 3U1LA 2DT9A 4OJ1A 4C48A 2RJZA 2F65A 2H9ZA 1Z2LA 3AAWB 1Y5IB 2XMAA 3PFEA 1KONA 2RU3A 2DNKA 2L08A 1XEZA 1E6VA 3EVMA 4TU8A 3BN7A 3IO1A 3KOAA 1EAYC 2B9EA 2MSTA 2ZUGA 1WDDA 1RDRA 2KTQA 4A8SA 4MIAA 2Y1JA 3RBDA 2R8KA 2YNIB 3KTQA 2FZCB 3HDSA 1X9SA 3G71S 5DO2A 2C3YA 2EG2A 4X4RA 4P71A 2E5LJ 3KLIB 4USJC 5BYQA 4J5OA 1N4LA 3CSKA 4LF2A 4IFVB 1Q81T 3IWXA 5D15A 1NHKL 3R97A 3BM7A 3D5MA 4MKYA 1SL2A 3K17A 2X7IA 3CD7A 1JLEB 1MN7A 4ILRA 2CIMA 2D3ZA 2J0WA 4J9QA 5LXYA 2ILYA 4PPZA 2Q3PA 1DRZA 2RF2A 4U8YA 3J7Z5 4QBUA 3A8EA 1FF2A 2KO1A 4LF5F 4IR1A 5L1JA 1ZM4A 5IT4A 2CPDA 4U7UD 3C8YA 3PY8A 1RA6A 2RH3A 2YX7A 3Q83A 1NO8A 2Z56B 3VGTA 1SVDA 1S48A 4FVCA 4NCBA 2BQ3A 2E1AA 2W01A 2VPZB 2E1MC 4I7FA 3G86A 2ZHAA 3BKTA 4OLPA 4DSLA 4G3IA 1G3OA 2ZJQQ 4WTOB 3PO5A 1U48A 3A3NB 2QTWA 3LP1A 1I51B 2W25A 3R2DJ 1LNQA 3EYZA 1N36J 3K7RA 1WUUA 3AD8C 3EICA 3SMZA 3G87A 5HQ8A 2MKYA 5HAOA 4WFBQ 5M2UA 1UJ6A 2IDLA 2B9XA 4FPIA 3SXLA 1H74A 1S6PA 1H7XA 2N4CA 4FBUA 1T3NA 4X62J 1T0TV 1YDLA 1YZ7A 3DLKB 3OL6A 1SH0A 5E5NA 3KHHA 4KHPJ 2XS2A 2HK3A 3TUZC 1EX8A 2X3GA 4ICLB 4LFAJ 2B4PA 2DKOB 2GX8A 1HW8A 3C19A 3TW0A 2AW0A 4NLXA 3A3OB 3HFKA 5CYMA 1T94A 3KUGA 2VJVA 3I87A 4ZVEA 3BDPA 2MXYA 2XMWA 2FJVA 4B9NA 4OYAA 5ETVA 2FPHX 4U8VA 3K8WA 4FBTA 1FJ7A 3MM6B 4J9LA 4RWXA 2ADBA 3GU0A 5KFLA 2JX2A 2CDQA 3BGRB 2ZC4A 5IT9Y 2H1YA 3GJRB 1HBOB 2DGUA 1YBUA 1FJEB 2MTLA 4P9SA 2FJXA 1GK8A 1KQFB 1TKTA 2K7KA 3AOAA 4KRWA 2QFIA 4O4GA 2ZBQA 2YNFA 4KPYA 2MLZA 3DLEB 4YUDA 3PHTA 1WEXA 3A8JA 3S7RA 3KK2B 2PN6A 2J7WA 4RUHA 1J5OA 3DXSX 1Q82T 1K0VA 3CC7S 4Q8FA 2Q79A 4NEYA 3TJ8A 1UP1A 4GO5X 3SSRA 4OYZA 3FJ2A 4NYZA 4J9NA 1CJTA 2V9KA 4B3TF 2GQCA 4YY3F 4ZLPA 4A8XA 4LRAA 4ED6A 1XMQJ 2OUGA 1E6YB 4HI1A 1U26A 1U2RA 3KFWX 3TVKA 1FWKA 3PDNA 1FK9A 3MUMP 1X9MA 2CNNB 3WBZA 2KT5A 4FS1A 4N76A 1EETA 3LH2S 1HQEB 2F7VA 4P2MA 5CYQB 2VL1A 1Q79A 3BGUA 1YTYA 2J6UA 3RBZA 3AXMA 2DJWA 3GCWP 5LMUF 1GNKA 4DU7A 5DQIA 3EDQB 2KM8C 5E3QA 3M2UA 4JI0J 2XO6A 4FS2A 3MOZA 5BYSA 3AJDA 3MEGA 4MT1A 1U6BA 1RWXB 2WHOA 3T19A 2QE5A 1L3SA 2KYXA 4JV2A 5I4MA 1PG5B 4ZA1A 2HFNA 4NA1A 5DLGA 1T9VA 5FDLA 3MR3A 2KB2A 3HZEA 1ZM3A 2JC1A 4OZ5A 1UW9A 2CQ3A 4WE1A 3VAKA 1FX4A 3ISZA 1LV5A 2CJYB 3KLVA 2Y0SD 2BYCA 3QJJA 2HHWA 1F9HA 5KFNA 1TKXA 3M8WA 1FKPA 5J1EB 4KGXB 2FTRA 2ASJA 3WC0A 5MAOA 4IOCQ 4HL9A 3R3TA 2GS8A 1NZ8A 3NKYA 2XSFA 3T5HA 2ZBCA 1RHKB 3GE9A 1UVNA 3TA1A 4PQAA 4JI5J 5LSOA 1XIQA 2WOMB 3DRPA 2PD1A 3AQOA 2RF2B 5G0RA 1SXLA 2GJ2A 3D28A 1Q95G 4XPEA 1AUDA 5GAHU 1RT7A 2FGCA 4F2RA 4RNOA 2K2PA 3QZ7A 4DR1J 2ZDOA 3R1HA 4KKOB 1SB6A 3K57A 1QJHA 4IG0A 1M90T 2PMHA 2YX4A 2MMYA 4L74A 5C7PA 4Q0BB 2PA3A 3OVAA 3PKMA 2HZAA 3O1LA 1RT6B 2H5IB 2KFZA 4G1IA 2N3OA 3G8TA 1VGYA 1BD6A 3BQ2A 1UTAA 1FJCA 1U09A 2PT0A 2FJWA 2QFJA 2RKIA 4C97A 3NEKA 3T5LA 3CC2S 1T8EA 2IM1A 2V2KA 3FEXB 5HVHA 1T05B 4ZPAA 2OPSA 2OTJS 3CXCR 2BQUA 5KFVA 3KDNA 3LANA 2IJRA 3JQJA 3SSQA 1R8CA 3WZ0A 4QWAA 4J91A 4CDIA 3BH7B 5CYMB 4YQWA 1HQUB 3N9UC 3FMBA 4EK2A 3WX8A 4J9MA 4K0KJ 3JSYA 2YWHA 3UCGA 2POKA 5HMWA 1ZAXA 2HQFA 4EO6A 2ZJPQ 3NMAA 2GIQA 2DGTA 5C24A 1IJEB 5A8RA 3LALA 4CH1A 5HI7A 4IFYA 1FXRA 3NCPA 2G13A 2VFRA 2NR0A 4WYWA 4ILMA 3K5PA 2ZH5A 4PG6A 3SFUA 4NXNF 1KSPA 3O8WA 1VFJA 1D9FA 3CMES 1REGX 3QATA 3UCUP 1TKTB 5JMNA 4B9UA 1W2IA 4RNNA 1OY9A 1ZA2B 3HP6A 2YNFB 3MZIA 1J5EJ 3WX4A 3NBPB 2O01C 1FI4A 1RE1B 1YRTA 4DPXA 3R7BB 3OTOJ 4DSIA 4OYWA 4PXDA 2UUCF 2E7VA 2NYHA 3H40A 1WELA 2UP1A 3O6QA 3TR5A 3TARA 4CLLA 1YJRA 3DDNA 1WKKA 5HSPA 1X9WA 3T6BA 1R6VA 1CJTB 2FVPA 2WVDA 1RT4A 1C4CA 3Q0AA 4QU7A 4UQGA 1BQMA 3RRHA 2K7JA 4DPTA 2LECA 3W9HA 2H4WB 3DRYA 5HJXA 3FCWA 2W4CA 2CJKA 1HLWA 2E1PA 6AT1B 1V3SA 4RX6A 4TXSA 1WG5A 2IM3A 3K5OA 3J7A1 5FLXY 3VAMA 3TA2A 4AFFA 3IAS9 4OYIA 2XG8A 1FRHA 5A2QU 4QIGA 1AT1B 3NGUA 3CDAA 4ZVSB 8RUCA 2OFHX 4B3OA 1WSVA 2CYYA 1CS4A 3IR7B 2QA1A 1TQLA 1NDLA 5D6GA 3C6TB 2RQCA 4OHYA 3KMSA 2ZD1A 2QV6A 2R8IA 2I0XA 1IKXA 3DRRA 2LLZA 2R2TA 4RUAA 4G1PA 4ZCLA 1OO0B 2VPXB 1I3OB 5L38A 2B4OA 1X31C 1UFLA 4WE1B 4PKDB 4NMXA 1BQXA 1P1LA 5CZVA 4ZPBA 4FDFA 2IFXA 2HNYA 2ZC3A 2YX1A 2UUAJ 1AXQA 4IH7A 1LW2B 3H4DA 4CLZA 4QW8A 2IDEA 5CQGA 5KG0A 5CCLA 4DR5J 1NZAA 1FKPB 2K8GA 2ZZMA 1SQGA 2VDHA 2ZKTA 2XTJP 3PM9A 4KHMA 1IR1A 1WTBA 3R7NB 2A18A 3IWLA 3MMCB 3DYAA 1SH2A 4I2QA 4OYPA 1HIYA 4B3SJ 5A0YA 1LK7A 5HMYA 4TVAB 2D7SA 4FF3A 3OFFA 2MGZA 5K8MA 2RD5C 5G0RB 4ZIVA 4DV3F 3KMQA 2RMLA 1CJUB 4LSNA 2J6SA 4RU2A 5K5MA 3L3CA 3BB5A 1RWOB 3AB2B 4IG0B 3THVA 2RNEA 2HHPA 3MAHA 1Q8KA 1HD1A 3BR8A 1P8GA 5F8IA 4OZ3A 3M9NB 4WP3A 3PRVA 4ZPCA 2CFXA 2PMZD 4MKVA 3MEDB 1X8DA 3AQPA 1GMWD 2AWZA 4LUBA 3PIPQ 5KT2A 4ED7A 5I3UA 2IJFA 2RKIB 1GMVA 4HDGA 3SQGB 1Q5YA 2YPZA 4UOHA 4AE5A 5F0WA 2IMOA 3Q8YA 3MURP 2J76E 4KGMA 4I2PA 2QEXS 2VQFF 3G2XA 2G0IA 1O5JA 1Y0HA 1YI2S 2CG4A 2YKNA 5F8MA 2DHXA 4F3QA 2Q6CA 1IN0A 3DU6A 2IBOA 1D8YA 3HVAA 4UT4A 3T5KA 4DV0F 3KG1A 3Q8QB 2OKQA 1XQIA 1R0BG 4DL2A 4DUYJ 5C24B 1CJKA 1Y7PA 1ACMB 3H8YA 1BC6A 3B78A 1WKJA 2DGQA 4RW6B 1RAJA 2W7OA 4IFYB 1ZA1B 3IM9A 3PCOB 5CD4H 4X65F 2HZCA 3GWCA 5J2QB 4DUZF 2MQLA 3DMJB 1A7GE 2ZH4A 2F1FA 3CF5Q 3ISNC 5DDPC 4AL5A 2VA3A 1RHQB 1VBKA 3RU0A 1U02A 4ZP7A 1TUGB 2P8IA 4O3OA 3BEGB 4LF7J 2AX0A 2HS0A 2ZZTA 3OHBA 3ONQA 4K50A 4WXWA 4CLWA 1NCLA 2VBWA 2KJVA 1NBEB 1MU2A 1QDUB 1WEYA 4NLDA 3KLEA 1HWKA 1U8SA 3K58A 2MHEA 3UDVA 2CXEA 3VAGA 2HHHJ 3HHEA 1TK5A 1N33J 2V4JA 1RTJA 1NEEA 4QIFA 5IXUA 3HF5A 3KJFB 1U49A 1BQMB 4NLVA 1TKZA 2QYGA 1IWAA 1LKZA 4JI1F 4C9DA 3HXMA 2AEFA 4LIWA 5L9XA 1HPZB 2XMVA 5KFAA 1X4BA 3UR0A 1U8WA 2UU9J 4MYUA 4LREA 3I0RA 4OX9J 4WFXA 5KFFA 1JX4A 3DGPA 4R25A 1HI8A 4DSEA 3KDOA 1HBNA 4A48A 4F2SA 1SJFA 4OV1A 4GKKJ 1OPZA 2V8PA 4WPAA 1CS4B 2Q1LA 3E01B 1DLOB 4OQJA 4C3MA 4ZCKA 2HAIA 1RAFB 1YVFA 4QZVB 1U1MA 2QSFA 2YNHA 1V3ZA 2FB0A 4DL0C 2OH2A 5A6WA 2ZWOA 4A8KA 2YPYA 3P4UB 1BUXA 5AXKA 3SCJE 1IKXB 3W5YA 3QO9A 1H98A 4CM2A 2Y3YA 2C2OB 4MIWA 3N6MA 4QOTA 4YS2A 3PR5B 1IM6A 3B54A 3MI7X 4BWMA 1CQNA 3I5CA 1RP5A 3A12A 4KGKA 4WF9Q 2MKHA 1R0AA 1I94J 3LWLA 4ZP6A 4KR0B 3GJQB 3V2UC 3OD2A 1HI1A 4M95A 2RIJA 2C28A 2WVFA 1I6JA 1D09B 1ROFA 2UXCJ 3KK3A 1IXKA 1EP4A 1VCTA 3CJQA 2LQ8A 5H1SV 3CCWA 2CPHA 2XHCA 3NGSA 1RXOB 3MR6A 2KZZA 1RISA 1P9QC 4DR6F 4USKA 2RILA 2HFZA 5A0YB 1B0VA 4DHVA 1RQ0A 2O67A 1S6QA 3OL9A 2QLBB 2EC2A 1LXNA 4K59A 4P10A 3DLLQ 5DZ7A 4LRDA 2E9RX 4ZITA 1QVGR 1FNOA 4LFCJ 2BANB 2NXUA 3IBWA 5GAEU 3ZTRA 4IOAQ 2MLXA 3GYXB 5AE2A 5AT1B 3GIIA 1S97A 5LSLA 1X5OA 2LVWA 5IWAJ 1YJNS 1VC0A 1FFGB 3IGNA 3PX0A 1JLGB 2OP5A 1HNWF 3RW6A 4OZ0A 1L3TA 4LFBF 4NASA 4EUVA 3MAAA 3KJVB 4HACA 1SKRA 2BJDA 4JP8A 2ZEJA 5EGYA 2LQ5A 2AJ4A 1KRPA 3NGRA 5KFSA 1MMNA 4I2PB 1S4FA 2I2YA 1H2UX 4I68A 3FZ2A 1KLMB 2DO0A 4UOFA 2KT2A 2OLWA 4IQMA 1FKOA 2MB0B 2C2MB 4DPUA 2HVHA 4ECZA 4M5NA 4Z2XA 4LQ9A 4UOCA 4Y2AA 1NSAA 4EEYA 3DCAA 3RB3A 3MEKA 4LSLA 1T7PA 4N56A 1C4AA 2CRLA 2F63A 1BY9A 4HHJA 2IVMA 5KFEA 1VISA 1AUSL 4TN2A 4QR0A 5LL6d 4USMA 4ZKAA 4ELTA 2CWXA 5KFYA 1PJ7A 1FDNA 3EGNA 3V6DB 5GAGU 1VLOA 2BM0A 1JWWA 2RDDA 2HFOA 4I0WA 3SCKE 4DX8H 2PEHA 2XMKA 1UPMB 2DH8A 4B3RJ 2R7OA 3N6NA 4JI8J 1YGYA 5KFDA 3CCMS 4H4OB 2I38A 1UWBA 1UW4A 4M63A 1S1XA 3W63A 4FZVA 5FD1A 1TV6A 2K06A 3FFIA 3JSRA 4P73A 3UPFA 2KFYA 5D4PA 5KG7A 2CQPA 1IWGA 4FYYB 4NL5A 4ECVA 1EKRA 5HROA 1RAEB 3F73A 1Q4RA 2DNNA 2P6SA 3KLEB 4F50A 2ZJRQ 1T9WA 3SFGA 2LDYA 1XNQJ 3DOLA 3W3SA 2UUBJ 1YJWS 1FCAA 2ZOMA 4HH0A 3A13A 2ZBIA 4IG3A 2B3TB 1TFYA 3TRGA 1RADB 4NLYA 4KO0B 2QZ8A 4FNIA 2KDOA 3IS9B 4U6PA 3QRRA 3FRZA 1DQAA 3CD6S 4ECYA 3KJNB 4TLRA 1KD1T 4DSJA 3EE3A 5KT3A 4M94A 1PIEA 3TVZA 3JTPA 1KP6A 4LRCA 5KFJA 4A4JA 3AXKA 2BX6A 3SBMA 1VK3A 1HNIB 1VRQC 5KG6A 3FKBA 3KG4A 4JI7J 5J2PB 2E5IA 4O3QA 3BO4A 3ETOA 3M8QB 1S6OA 1TFWA 4K2XA 3UE2A 1FRMA 3MR5A 2LQ9A 2J9DA 1WD6A 5KFZA 4DDFA 1OYEA 4CLKA 5SUHA 4E98A 4KPCA 4CZCA 4DLEA 3OXLA 3ENAA 4GKJJ 1GH8A 1RKJA 3E3XA 3I0SA 3EJMA 1NDCA 1GTEA 4ANEA 1S0VA 2CJ9A 4KGZB 3GYNA 4WKYA 4XTTA 3PJ9A 2A2DA 3CJRA 3I96A 2A6MA 1TELA 2COLA 2Y1IA 5D8HB 4UUXA 4JV5J 4NLQA 4WYLA 4K4SA 1LWEB 4K4XA 2MKKA 2CPXA 4EFAC 1GXUA 3M8YA 1CULA 4X66F 5MLCV 3IXQA 2GVZA 4RBVA 4QU6A 1X4AA 2WCXA 2DPJA 3J81Y 4H4KC 4OYXA 1K47A 5F41A 4Y2IA 2CADA 3UN2A 3MDFA 2DO4A 2M3DA 1XMBA 3SQOP 5FLXU 2H65B 1ZETA 4F4ZA 1CG2A 2IA6A 1T9XA 2VJUA 3A3PB 4V19J 2VF3A 3V6JA 2AYBA 3ZTPA 2B9YA 1RAGB 1VBYA 3JAMY 4ZVRB 2C2KB 3GR1A 4NXMJ 4CIOA 4C2MA 3FVYA 1LXJA 2GJIA 2D9PA 3WC2A 2EK6A 1RWMB 4JI2F 1SUQA 1J2VA 5IFMA 1VQ7S 2NXNA 1FWPA 3M1VB 2KVQE 3MM7A 4Y28C 4Q45A 4DSFA 5CYJA 3NAIA 5KG1A 1S9GA 1IQTA 2GQQA 2KT3A 5J1PA 3MAAB 1QSYA 2YKOA 3PJXA 2KG1A 2J9DE 2HBRB 4ER8A 3QSIA 5HANA 3D0GE 4MK7A 3KXDA 2HQCA 4URSA 4F04B 4NZ0A 4FXDA 2UVUA 3MEEA 5LM7E 1HA1A 2I5JA 1TL7B 4B3MJ 1UZHA 4ZIWA 3GQCA 4NRTA 4X64F 4RR5A 5E3PA 2DRBA 4M5MA 3CJKB 1S72S 1KTVA 3BPSP 5LXRA 4KHRA 1A0OB 2NUHA 1NJIT 1FEEA 3C14B 1QAIA 1V3RA 5GMKa 1PILA 3QT5A 3MMJA 4ZPVR 3CO9A 3H2UB 4C6AA 4ZN1A 5EN1A 4ZLNA 1UZDA 4CWBA 3PYGA 1QE1A 4LRFA 3MCNA 4RW9A 3HHKA 1KVIA 2OHDA 4M5GA 1VQLS 1W7WA 1S1XB 4IRCA 1OSCA 1UEUA 2J5AA 4F4KA 3VQTA 2I8EA 3HFZB 4DV5F 1DTQA 3MFHA 2W2OP 1M5OC 4F4YA 3DDKA 3CMAS 4ANDA 4TY9A 3OR1A 3SCLE 1UVMA 2BJ1A 5D0HA 1UAWA 4IH5A 4GC7A 2BE2A 2EWHA 4ZVPB 3PW0A 3ZFVA 3MWBA 4K4WA 1KHVA 3HHLC 2DNPA 1WDTA 3IRXB 2G4BA 1QAYA 5T7LB 5ETRA 1N56A 2YWEA 1LFPA 1XR5A 4IG3B 3RB4A 2MQMA 3W1YC 1HNVA 2ZKUA 1FVQA 2MJNA 2A0FB 4D3GA 1JKHA 4C11A 1F9FA 3MM5B 1VRTA 1PBUA 1URRA 4J9OA 5E2QA 2VG6A 3CEDA 1XWLA 3ILJA 3ZNJ1 4GKKF 1WI8A 1Q53A 4C0BA 2XMMA 4DFJA 3NG8A 4M5KA 3AFGA 3DOMB 2G1HA 2JHEA 2KHCA 2LKZA 3L7PA 3DOKA 5E3AA 2HLUA 2HMIA 3NNCA 4OI4A 1KDNA 1RTHB 2VPWB 2EVZA 1NSQA 2ZM6J 5DM7Q 4PRFA 4DR4J 1JXEA 3RAXA 3CGIA 2R7VA 3MM8B 4C4WA 1M5HA 3N01A 4LF9F 4TLQA 5D0RA 2NSBA 3I0SB 2RRBA 2ZH2A 4EZ9A 3HJVA 4ZMMA 3VTIA 2ROGA 4OHWA 1TTHB 1CJVA 2AJFE 2RS2A 5GAHI 3FEZA 3GZ7A 4HR2A 2U1AA 2CQBA 1C2PA 1PAUB 3BBFA 5KFUA 3SV3A 1G1XA 4R5PB 1TL3A 3T1YF 3TAPA 1DY3A 1CQMA 1SCJB 2DNGA 3LAMA 2EFNA 3D4JA 4X4NA 2ALYB 2AMCB 3ZTSA 4UOGA 3LTOA 4FP9A 5EWEA 2QA2A 1W25A 1ZTWA 4MH8A 1VQ4S 1BMQB 3PTWA 1R8HA 1NSKL 1VLYA 4L72B 4QIVA 1RTDA 4NLOA 4CRJA 2V2QA 1XMOJ 4LF6J 3I82A 4BWJA 4LSZB 2DYAA 1RAAB 1H73A 2FZKB 3GG1A 5KT5A 1S1TB 2C3UA 2DB1A 3TWZA 2HNDB 2NSCA 4DUTA 1HNXF 1NAQA 2ZZNA 1PJ5A 3CB4A 2XMJA 2MZJA 1UKUA 2LEBA 4GMKA 3TI0A 4LMZA 2XI3A 1IKWA 4AL6A 5KT4A 5ETOA 4FYDA 3TQ1A 1FTCA 5J2NB 4C3KA 3RR8A 3I5BA 2RQKA 5L1KA 4NA2A 2FLOA 2GAHC 4DV1F 4O0IA 1LOUA 1RKIA 4ES1A 2OSRA 2DIVA 3MAQA 3Q86A 4KV8B 4JI3F 2XI2A 4PWWA 3ZTQA 4J37A 3CO0P 4PWUA 1SJQA 1YQHA 5GMEA 5GADU 4DCJB 3IAM9 5B0BA 2DCUB 1SC3B 2DNMA 1OWXA 2BRLA 3DRSB 5IM0A 1ZBTA 1B7YB 5C42A 1RWNB 2RRNA 4CCHA 4DL7A 2WB1D 1OYDA 4CYUA 4AD6A 1F3VA 1XTZA 2B51A 2JOQA 3NS6A 2ZBRA 4F25A 2QT7A 2B9WA 3CTRA 2GHWA 4TYBA 3OV7A 3ZZOA 4ECXA 2LA6A 3RUBL 5KFRA 2OI2A 1RAHB 3Q8SB 2J6TA 2WSFC 1QUVA 2LU1A 5F3TA 1QE1B 4ED8A 4LF5J 5IQ6A 2E66A 2W2MP 2BA9A 4P2XA 3RAQA 4ZLLA 3L95X 2MQNA 4QWDA 3RB0A 1DZ5A 2B56A 1XN9A 2VBXA 2E29A 3QT6A 3RAMA 4W4MA 3OR1B 5DM6Q 1EB0A 5F3ZA 2XMUA 4Y2KA 3NWGA 2CZVC 1YRUA 2WVEA 2M2BA 4RUCA 2X51A 3OXGA 2YTCA 1PGZA 3O5TB 3PRBA 3OT9A 3D68A 4DZDA 1BE4A 2Z4PA 4HH1A 3TVYA 1NMEB 4OZLA 4P6QA 3IP0A 1JKHB 3M32B 5K14B 3S8SA 4C11B 1RHRB 3KJQB 1KQKA 1C0TA 2FY8A 1MROB 3ENVA 2AJQA 4WXOA 4KFBA 2DH9A 4IOBA 3GG0A 2AQ4A 1VQNS 2OMOA 2N7YA 3HLUA 4WFNQ 3TAQA 4WWSA 3DOKB 4TU9A 3M2VB 2L48A 3OTBA 2N3LA 2OFGX 3LW5C 1KS2A 2HMIB 2J0SD 3JSMA 4DR7F 4ZJLA 1NH8A 2YKMA 4RNHA 5L1IA 3LO3A 4FVMA 4ED4A 3IG1B 1N0UA 4F0HA 4Y6IA 5KFWA 1F6TA 4RW4A 2CJXB 3MPWA 1ZM9A 1IBLF 2JEJA 3B8HA 5HN0A 1RT5A 3HVTB 5EX0A 3TO8A 3CIZA 2FLLA 4B17A 3J7ZT 4DL5A 3D3BJ 2RQMA 5DETA 5IV3A 1VC6A 4RW8B 1PYOB 1U0HB 1DAXA 1TL3B 3V4IA 2LDIA 4WCEQ 3TJAA 3H20A 4OIXA 1RABB 1M1GA 2XYGB 2N82B 1WJ9A 3HFVA 3Q8UA 4B3TJ 4YY3J 5CD4A 5EUHA 1C0UB 2ZHBA 2BMBA 2JEGA 2DEIA 2ZH1A 3HVRA 1A9NB 2WRMA 2F4VF 1N34F 4NLGA 2R42A 1HFEL 2KU7A 2IBKA 1X4CA 4D3HA 1UJ5A 5LMUJ 1Q5VA 2R9LA 2W9BB 5KFXA 2HNZB 2WBRA 3M8ZA 4W92B 3HZGA 3NOGA 5T14A 2C2NA 3GYGA 4ALZA 2FHMA 2BE9B 1BWVA 4F02A 2A2CA 1CBKA 5ETMA 4B9TA 5IOLA 4USWA 3PX6A 4CLYA 1SJ4P 3V81A 1MSWD 2NXEA 2QA4S 3NGTA 4AXJA 4A47A 5KT6A 2YNIA 9RUBA 4B9SA 3FRYA 2ZOGA 2IVFB 2E5JA 1AYEA 2QC3A 1NUEA 4YP3A 2X1FA 3AJ1A 4CLSA 3H5XA 1FX2A 3L7UA 4IFVA 1GTHA 1H0HB 2YH1A 2WONB 1JLEA 1XK8A 2BDPA 3J81U 3UDEA 5KOXA 3KUHA 3P49B 2NQPA 2WSCC 3BBBA 3QWPA 5B09A 4PR6A 3NNAA 2Y1LB 3QIPA 2QMXA 3WIVA 5HQLA 5EWFA 4OHVA 2MJUA 2VBZA 3GCXP 1SJ3P 3JAMU 1YSJA 1WC3A 2DITA 2LFVA 2IM2A 1N48A 4DX5A 3OXFA 3DRXA 1LQ9A 5DG7A 1R3NA 1RLCL 4RKUC 4LF1A 3Q89A 4OV6A 3VWSA 3ZZUA 2ROEA 3G4SS 1BQNB 4PWDB 3GPAA 2HWHA 2VQEF 2MQ8A 1WC4A 4KGVB 3GP9A 5B08A 1V9OA 1XERA 5AE1A 1F5AA 2NLWA 3LP0B 2LYVA 3DLKA 1SJRA 1Y00A 3CJSA 4TYAA 1CSJA 4W98A 2G2YA 4YDDB 1JJHA 1N8RT 4J9SA 5JUMA 4RO0A 2LA4A 3CT9A 3ISND 5KAKA 4AT1B 4Q43A 3MR7A 2D1CA 1ZM2A 3UNYA 5A2QY 3MM6A 3CCVS 1FDDA 1CEZA 2M9KA 3H42A 1X5TA 3BGRA 3ITHA 4Q2LA 3D9BA 3UD4P 3P5BP 3TZYA 1KR4A 3JSMB 1X4EA 2MSSA 1KHWA 1PAEX 4F4WA 4NCAA 2XC9A 5KTQA 4DQIA 4DXLA 1S1WB 1RGVA 2D3UA 5HMXA 3CE8A 1U1PA 3FBFA 3NP5A 2FVQA 1WHWA 4NXNJ 2CPFA 2HFUA 2F8MA 4ETXA 3BJYA 1P1TA 2AGQA 1UCNA 2AT1B 1X7VA 2IPOB 3KK2A 1RT5B 1I1GA 1WC6A 3H5UA 2JFKA 1YKWA 3M05A 4DV7J 1K44A 3VGSA 2M88A 2KI2A 2D69A 3CJ2A 2Y9HA 5GAEI 2M8DB 3ENQA 4DU8A 2UUCJ 4Z37A 1IBKF 3M6VA 2GQ2A 2H54B 3VHQA 2FQQB 2P9CA 2R7SA 3U02A 4CM0A 4F4AA 4WIIA 2J8AA 4C8MA 3MTJA 3UDLA 4BHQA 3HMJG 1HQEA 5CYQA 3MR2A 2BBEA 2M8HA 5K9FA 2HWTA 5HMZA 3NAHA 3SCIE 2ACMA 3I31A 4LVNP 3P6YC 4HTIA 3THPA 4DF4A 5HLFA 3GONA 4NEZA 2CKWA 1CLFA 5I3PA 1ZAVA 3W8GA 4IRKA 3R9LA 1VQKS 3H98A 4USTA 2A6OA 4ECWA 4XDCA 4ILLA 2FUG9 1TMMA 3THTA 3W7BA 3QIDA 2IY5B 4YB6A 1X4GA 1BHNA 2A3JA 4IO9Q 3BO2A 2VU5A 1OQ3A 4KAIA 3M8SA 1CC8A 4N41A 4LRBA 3NGDA 5KFTA 2CNKB 1N6QB 2HQ3A 3V81B 2LXUA 1NJWA 5GAGI 4HT7A 2FHJD 3CVKA 4NZ6A 4YB7A 1TMJA 4DV6F 1NK9A 4CNYA 3HHNB 1VOMA 1JB0C 4NLRA 2BM1A 5J1EA 4WP9A 2VKRA 2FGOA 1VQ8S 2YH0A 3CDWA 5H9EK 3T1AA 2V6AA 1VRUB 2R2RA 3M8PA 3J7AN 1FXDA 1MN9A 7FDRA 3PHEA 3OW2R 3ZZZA 1NKCA 2OD6A 5A8KB 3ILOA 1QUPA 2K1RB 2WOMA 4KT0C 5KFBA 5D3GB 1WOOA 5KFQA 1FNMA 3FC9A 4ZCIA 1REVB 2ZE2B 2GGPA 3QIPB 2CQ2A 5KFMA 1LWFB 1XC9A 2A10A 1X4HA 3B4MA 3BGFA 1N5TA 4KKOA 4NI2B 4AL7A 1SKUB 5KFIA 5HVFA 4DV3J 1CPZA 1HYSA 3UN5A 2ILZA 4Q0BA 1RT6A 2HHVA 1UVIA 2QO3A 8ATCB 3GJSB 1WKLA 4DOZA 3OR2B 4DJBA 2KXNB 1D9AA 1BWEA 2OEJA 2JLGA 3EXYA 3LUYA 3DU5A 2DVIA 1EIYB 1NH7A 3TZWA 5IC4B 5A6PA 4N47A 2L41A 4CO0A 4PYAA 2HIYA 1VC5A 1T05A 3MPUB 1FA0A 1C1CB 1KFSA 2DGOA 3JSBA 3UDCA 4K2JA 3QPIA 3BSNA 4MTPA 5KG5A 4C0OC 3LAKA 4DL4A 1MG7A 1U0SA 2CWKA 3OTCA 2VQFJ 1T9TA 1HQUA 3TZXA 1S7IA 5DZ6A 1T9YA 1S1VB 4F36A 3IMQJ 1PJ6A 2WSEC 4I69A 4ZK7M 4QCLA 4FKYA 4JI6F 2F8HA 4J7CA 3HULA 1GXLA 2DNZA 2HHTA 3ITHB 4DV0J 1R27B 1YRXA 3DGVA 2PDAA 2AEMA 1DURA 1NXIA 4HYKA 3JQKA 5EWGA 3ET6B 4N7TA 2V0NA 2UVVA 4M1KA 4KE5A 1R89A 3UNGC 2UUWA 4X65J 1KNZA 3NBPA 3MUVP 3M30B 4DUZJ 3BKUA 3MD1A 1G6BA 2EPIA 4YHHF 4EO8A 4KH1B 1HR0F 3EPIA 3D6FB 2FVSA 2GA7A 4WTYA 4M8LA 4BCAA 4IH6A 2YWWA 1C1BB 2N7CA 4NMLA 1YITS 3QAUA 4DLGA 3AA8A 4PEOA 3TAMA 5L8RC 1SL0A 2VONA 4FNHA 3T1HF 2EFGA 1F9EB 1DQ8A
chains in the Genus database with same CATH topology
2K06A 3EWGA 1M1GA 3H7HB 3QQCD 1NPRA 2XHCA 2LQ8A 4ZN1A 1NPPA 2OUGA 3P8BB 1M1HA 3LPEA 2EXUA 4ZN3A 1NZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K06 A;  3EWG A;  1M1G A;  3H7H B;  3QQC D;  1NPR A;  2XHC A;  2LQ8 A;  4ZN1 A;  1NPP A;  2OUG A;  3P8B B;  1M1H A;  3LPE A;  2EXU A;  4ZN3 A;  1NZ8 A; 
#chains in the Genus database with same CATH topology
 2B4V A;  2BV3 A;  4MKB A;  4OYO A;  4ECR A;  1HKA A;  3UWT A;  4X4V A;  2MY7 A;  3CCJ S;  3ZZY A;  2Z30 B;  4CP5 A;  4JI1 J;  1FWL A;  2E1R A;  5HLF B;  1JJC B;  3HT0 A;  4TY8 B;  1WF0 A;  4IRD A;  2V4R A;  2XB2 D;  3NY0 A;  4OYB A;  4B08 A;  1U25 A;  1QSS A;  3MTK A;  2RB7 A;  5HO4 A;  3NCQ A;  2AJ0 A;  1DTT B;  1WOP A;  3C6T A;  3JYT B;  5AJ3 F;  1IBC B;  2QLW A;  2BJE A;  1RK8 A;  4DFM A;  5THW A;  2FZG B;  3W9J A;  2HGN A;  1LK5 A;  4DL6 A;  2LQB A;  2ZH3 A;  2CVE A;  3H5Y A;  3R5A A;  1R0C B;  2ERR A;  3HKZ D;  3GSD A;  3C15 A;  4XPC A;  4DMZ A;  1KC8 T;  4PCQ A;  1FT8 A;  2B5J B;  5L1L A;  1WTF A;  2GNK A;  5LMN F;  1G7C B;  1G2E A;  1LW2 A;  4MAK A;  1M5V C;  3CCQ S;  4O0N A;  3HJF A;  2HHX A;  4JOU A;  5C2G A;  1JLB B;  1MWZ A;  2AX1 A;  1S6U A;  3M6X A;  2CA9 A;  2HG4 A;  3KNG A;  1L3U A;  3M8P B;  3MMC A;  4U7C A;  1UMJ A;  1N0V C;  2R3V A;  1Q16 B;  4HEA 9;  4KB7 A;  2DR7 A;  4DS5 A;  4O23 A;  1GX6 A;  1SC4 B;  2AJ2 A;  4PAB A;  3ENW A;  4WU3 A;  5I42 A;  1F1B B;  3I32 A;  3ICL A;  1JLA A;  3EZ5 A;  2GGP B;  1S9E A;  1CJU A;  3QZ8 A;  2QIF A;  4DR6 J;  4PQU A;  3E51 A;  4A46 A;  2GC8 A;  1OMS A;  1YBA A;  2CPJ A;  1NJX A;  1M0S A;  1DHM A;  1HYS B;  3G6E S;  4NRU A;  1JQG A;  3FMW A;  3D66 A;  5C25 B;  4LJM A;  4XO0 A;  4DBQ A;  5D78 A;  3ZXW A;  2FJA B;  1UVL A;  4J9U E;  3MED A;  1RWP B;  3K2Y A;  4GVB B;  2BW2 A;  1S99 A;  3MM9 B;  5CH7 B;  2RHS B;  3MF5 A;  1P9Y A;  1PYS B;  2UXD F;  3S6E A;  1UJ4 A;  3I9V 9;  3KLF A;  1SQE A;  2IAJ B;  3MCO A;  3GV7 B;  3Q8R B;  2EW9 A;  3SQG A;  1FRJ A;  2HZV A;  3LA0 A;  2AD9 A;  2DRA A;  2QL5 B;  1HNW J;  1YIJ S;  1IR2 A;  5CCM A;  5F8H A;  3G9C A;  4LFB J;  3X3U A;  4F26 A;  3AH6 A;  2VOD A;  4RBT A;  2GZO A;  1N5Y A;  2ABY A;  3LGH A;  3K5N A;  3QMQ A;  2LCW A;  2N4D A;  2HBZ B;  3AY0 A;  4YOE A;  4WBF A;  4QPT A;  2P5V A;  2XO7 A;  4IDK B;  3MMB A;  2M5Y A;  3R5G A;  4DR3 F;  2H51 B;  2DR6 A;  5KG2 A;  2DPI A;  1A6L A;  4FKX A;  4QYZ K;  1TU0 B;  4RW6 A;  1DFD A;  2G2O A;  1U1O A;  5LOQ A;  3V6K A;  1BLU A;  2EEY A;  1KQS R;  2HBY B;  3HK2 A;  1FRX A;  2QSW A;  5CA5 A;  3DLG B;  1KEK A;  5J2Q A;  3BS9 A;  2ZH8 A;  3HHL D;  1U1N A;  3DMJ A;  2OGU A;  2VB6 A;  2L9N A;  1K0T A;  1SKS A;  3I4H X;  4DV7 F;  4OI6 A;  4JYA F;  1U6F A;  2ZFH A;  2D3O 1;  2YNG B;  4P2S A;  1RSC A;  3BR9 A;  5ADZ A;  3ZZT A;  2EXU A;  2XGQ A;  1PKU A;  1UL3 A;  4FF4 A;  1N52 B;  4BDP A;  5L46 A;  5F8G A;  1AW0 A;  3TUJ C;  4DN0 A;  3TAM B;  1FXL A;  1JNZ B;  3FNN A;  3C66 A;  2Y1R I;  1KFD A;  2VZ9 A;  4OX6 A;  2F3J A;  2UXB F;  3G6V A;  3JQM A;  1HPZ A;  2UV8 G;  4FYW B;  2B7C B;  1XNR F;  4PUO B;  1WF2 A;  1HW9 A;  1U7L A;  2DNL A;  1N88 A;  3OVB A;  5RUB A;  3R7S B;  1O51 A;  1QVF R;  2BKO A;  4R8U B;  1FDB A;  3HSZ A;  3A8K A;  3KG0 A;  3E01 A;  1DLO A;  5GAD I;  4MKA A;  1VQO S;  1N5V A;  3AT1 B;  1UWA A;  3EUN A;  4DV4 F;  4F4X A;  3EZO A;  4LF4 F;  3NXZ A;  1KN6 A;  3HHD A;  4R0E A;  2DXD A;  1IVZ A;  3OJS A;  3H90 A;  4F7V A;  4MJK A;  3QWU A;  2EFP A;  1RTI A;  4WJB A;  3Q2T C;  3QNW B;  4LF8 F;  1S12 A;  1FD8 A;  1WI6 A;  2R8G A;  3D0H E;  4U9R A;  2Q43 A;  3C15 B;  3IWN C;  1VK8 A;  4EGL A;  2Z58 B;  3FSI A;  4DI6 A;  5IV4 A;  3RGI A;  2JFD A;  4OL8 A;  3HI9 A;  2EFV A;  4K4U A;  2FVC A;  2XSJ B;  3FCV A;  2ZVI A;  4P52 A;  4P72 A;  4M5D B;  3MHY A;  5B0G A;  2RDI A;  4K5R A;  2CQ1 A;  1YJ9 S;  3SV4 A;  2AKW B;  4RLE A;  2R7R A;  1RTZ A;  3BKF A;  1F2G A;  4X66 J;  3DI6 B;  1U1K A;  4FYV B;  3UN3 A;  4CO4 A;  5I42 B;  2Q6B A;  1JLA B;  1S9E B;  4F3M A;  1QAX A;  5KT7 A;  3CD5 A;  4PQU B;  5DGA A;  2BAN A;  4NCG B;  5H9E J;  4DR2 F;  2DY1 A;  3QRP A;  4CLU A;  1NKE A;  2LXF A;  2CPY A;  2P6T A;  4NZ7 A;  1Z2Z A;  3EX7 B;  3GIM A;  1RI7 A;  3MOJ B;  2CQ0 A;  1RHM B;  2M4M A;  4FF2 A;  3GB0 A;  4RU9 A;  2C2E A;  3VV2 B;  4CO5 A;  1NB7 A;  1T3O A;  4G65 A;  1RBA A;  1JLG A;  4YME A;  4DV2 F;  3QJL A;  1GXT A;  4GRS A;  1WC5 A;  3T9N A;  2HAF A;  4JI2 J;  3KLF B;  3KJV A;  4O44 A;  4EBD A;  2PFF B;  3IN5 A;  3J7Y U;  1H2V Z;  4WFZ A;  1QSL A;  1Z1Z A;  2PC6 A;  4ZP9 A;  2WAQ D;  5HQM A;  1GX5 A;  3FDS A;  3W64 A;  2XY7 A;  3TNV A;  1KLM A;  5CAA A;  3I9Z A;  4N5S A;  2UUT A;  3POT B;  4JBC A;  1IM4 A;  2B6A B;  2QLX A;  2VG7 B;  1S4E A;  1WOS A;  1N5Y B;  4LQ3 A;  2BE7 D;  4V19 X;  4G1Q B;  2EI5 A;  5K8O A;  2E7W A;  4I6A A;  1HBU A;  5E0O A;  2BQR A;  2XNR A;  1KWM A;  3MMB B;  4CI0 B;  2CQG A;  4C8Z A;  3DHX A;  4ZVT B;  1KBR A;  3MPD A;  3CJ0 A;  3V6D A;  4X64 J;  3DM2 B;  3UQS A;  2V50 A;  3JTO A;  5EX3 A;  1HAR A;  1P6T A;  3IRW P;  2Z2Z A;  3VGU A;  3AHP A;  4H4O A;  4NLU A;  1TAQ A;  1HHS A;  1Z4U A;  3OUY B;  3CJ4 A;  3DKD A;  3SEO A;  4I1T A;  3HD2 A;  4HI2 A;  1FJG F;  5FJ4 A;  5F9L A;  1NHU A;  2DGX A;  3OL7 A;  1S1U B;  1N32 F;  1R43 A;  3PVX A;  3FUY A;  4DV5 J;  2O1P A;  2H4Y B;  5KFP A;  1LW0 B;  3P8B B;  3M2R B;  3M6U A;  5L9N A;  3EGV A;  4PPD A;  1TVR B;  4KO0 A;  2YXL A;  1OS5 A;  4LVO P;  3IS9 A;  2JDJ A;  2AYM A;  1VBZ A;  3SDE B;  4EMD A;  1L5U A;  1HNZ F;  1Q7Y T;  3LPY A;  1BXN A;  4LR8 A;  2AGO A;  2BRK A;  4EYH B;  2L9W A;  2G9O A;  5HP1 B;  2I6W A;  1YLX A;  4L3K A;  1RWV B;  2WK4 A;  4OJH A;  4EBE A;  3PFO A;  1RU2 A;  4E8U A;  1Y5N B;  1WG4 A;  3TX0 A;  2W7A A;  2QL9 B;  4ED2 A;  1TK0 A;  3BSA A;  1HNI A;  1S49 A;  4X84 A;  5J2P A;  3N0V A;  3AA9 A;  2OO4 A;  3M8Q A;  1T11 A;  1RT1 A;  4K7Q A;  3PW5 A;  4YR3 A;  2JNJ A;  3QJP A;  2ACY A;  3UCZ P;  3VGV A;  1X0F A;  4BBY A;  4YR2 A;  1HQ2 A;  2BUN A;  1KVK A;  1RTI B;  3L4B C;  3CCU S;  3CW2 C;  2MEW A;  3TYT A;  4RJV A;  2W9C B;  3AD7 C;  3PW7 A;  3EGW B;  5BYR A;  4IO1 A;  4ERD A;  3MPY A;  3B4D A;  1Y11 A;  3HM9 A;  4LF9 J;  2M7S A;  3OFE A;  1FES A;  2EKY A;  2IYG A;  1WC1 A;  5B0F A;  3KK1 B;  1SIW B;  4PXE A;  4C3L A;  5KG4 A;  1GFW B;  1LWE A;  2W1B A;  1DQ9 A;  1TL1 B;  3QRQ A;  1S79 A;  3JS9 A;  1SKW A;  4V1A k;  2H5J B;  5CXT A;  3CCE S;  5IS2 A;  2HW3 A;  3I6P A;  4IKA A;  1GMU A;  1VS3 A;  4J9P A;  2W24 A;  5D77 A;  3MEC B;  4WK1 A;  2HFV A;  4UF4 A;  2AYG A;  1R7I A;  3HSD A;  4Y2M A;  3R5C A;  4QYR A;  3T1Y J;  2R8H A;  1SV5 A;  2IRU A;  3NNH A;  2F40 A;  2FJE B;  2B0G A;  2Y0B B;  1RCO B;  2NYI A;  5HBM B;  5EDW A;  1NK7 A;  5DG8 A;  4YFU A;  3KWM A;  5U47 A;  4ES2 A;  4BS2 A;  2BW7 A;  3T6J A;  2IMW P;  4ZN3 A;  1R8B A;  4EWT A;  4HVZ A;  2MZS A;  3VCD A;  1S59 A;  2DNR A;  3R2C J;  3N28 A;  3W2W A;  5HL7 Q;  4JI4 F;  3M1V A;  1HNX J;  1OIA A;  3B6B A;  5BJR A;  1Q78 A;  4I64 A;  1UVJ A;  3HT3 A;  4C7Q A;  3PAC A;  1IBM F;  4O44 B;  1FD2 A;  4CLT A;  3GIL A;  4IYQ A;  3UD5 A;  1Q1K A;  5CAB A;  3AD9 C;  1T03 B;  1RYR A;  5G4D A;  1IR0 A;  4DV1 J;  1R8P A;  1XR7 A;  2HS4 A;  4C8L A;  3FBC A;  2MQO A;  3IC1 A;  3D1Q A;  4JI3 J;  3DHW C;  1TL7 A;  4OI2 A;  1RT3 B;  4UUW A;  4NYO A;  2HRT A;  3CPW R;  4RNF A;  2ZIT A;  5LJ5 Y;  1SC6 A;  4ZJQ A;  1HBU B;  1S5Z A;  3CJK A;  2RVJ A;  4ZDN A;  1IKV B;  3W65 A;  1Y9O A;  2V8G A;  3KYL A;  3MGJ A;  4ED3 A;  2G0J A;  3RJM B;  4XIU A;  4C8K A;  4S0M A;  3C14 A;  5F9N A;  2DNO A;  2RE1 A;  2J9C A;  5BR8 F;  3RRK A;  1OSD A;  4CT8 A;  4RW7 A;  1RT2 B;  2Q66 A;  2QMU B;  1M5P C;  2VD3 A;  2DR5 A;  3BBC A;  2QMW A;  4X4S A;  2CG8 A;  4ZHR B;  3HPO A;  4QYZ J;  1H7W A;  1D1U A;  4P7T A;  4OJ3 A;  1ICE B;  1DBD A;  1MWY A;  3N6L A;  2KZM A;  2WTF A;  2JWN A;  3TA0 A;  3PW4 A;  3IRX A;  2V4Q A;  2R4F A;  2ZWP A;  5T7L A;  2YY3 A;  4ED0 A;  4ZCM A;  3UW1 A;  2AJ1 A;  1P27 B;  1FHT A;  1HWI A;  3P3D A;  1KLN A;  3EZU A;  5LJ3 Y;  2CQH A;  2XZT B;  2NZ4 A;  3HO1 A;  3MM5 A;  2KRR A;  4ED1 A;  4K5S A;  4DCP B;  2GIF A;  2BKN A;  1IQZ A;  2VA2 A;  2IIH A;  2MZT A;  1HWU A;  4Q5V A;  3VZI A;  5HVG A;  4ZPW R;  3DOM A;  2MQQ A;  1E6V B;  1T95 A;  3BRE A;  4P74 A;  2YKP A;  4AQY F;  4BC7 A;  1AFJ A;  4CLP A;  1HWJ A;  2C2D A;  1RTH A;  1RT1 B;  3CJT A;  4NA3 A;  5LT5 A;  1RYS A;  2M70 A;  4N8N A;  3J81 j;  3MM8 A;  4K4T A;  4X4T A;  2FLN A;  4UZC A;  5D4L A;  3ZZR A;  2GCF A;  3SSS A;  3KHG A;  4J9K A;  4DR7 J;  3Q23 A;  3PYE A;  4DS4 A;  4M5H A;  2M52 A;  3DNC A;  2FC8 A;  2CDR B;  2XLK A;  4OMF G;  2W4D A;  4QQB A;  1VJQ A;  4R0J A;  2J7U A;  5KFG A;  3Q22 A;  2ZH6 A;  3DLB A;  1IBL J;  2XUL A;  2V8D A;  2MQP A;  1WEZ A;  1WAC A;  2GJF A;  1AFI A;  1SIZ A;  4R5P A;  4X4O A;  2HRU A;  4GVL A;  4RPF A;  1LWX A;  3EM1 A;  3U1N A;  1O6X A;  3RBX A;  2R7X A;  4L3N A;  2Y8W A;  1LWC A;  4I7F B;  1M1K T;  1QM9 A;  3BQ0 A;  2PI4 A;  1SV5 B;  2G0C A;  3H0P A;  4W90 B;  3UR3 C;  3PNI A;  8AT1 B;  3D6T B;  5L39 A;  3LP1 B;  1UA0 A;  5E3C A;  4HHH A;  1HMV A;  2PSZ A;  1S1T A;  2XY5 A;  1U4B A;  2KG0 A;  4ETZ A;  2HND A;  2HQD A;  4QJV A;  4J9R A;  2F4V J;  1S6P B;  2BXJ A;  4ZPD A;  1N34 J;  3H59 A;  1U2C A;  2E44 A;  3QLH A;  2DXE A;  3G6Y A;  4URG A;  3IR6 B;  5JJB A;  3W2W B;  2KH9 A;  1CC7 A;  4WU2 A;  1NDK A;  4U96 A;  5J2N A;  4ZP8 A;  3M9M B;  2E1C A;  1HBM A;  4QIW D;  1FKA F;  5KFH A;  2BAC A;  1PSD A;  2DNH A;  3UD3 P;  4KV8 A;  3C46 A;  3RRG A;  2RHQ B;  5GVQ A;  3R27 A;  3UFC X;  1S0M A;  1RWU A;  2XWY A;  1M1H A;  3DXB A;  1VIX A;  2D41 A;  1U24 A;  4PG5 A;  2R7Q A;  3O2I A;  4C8O A;  3DRS A;  2ZBP A;  3NCR A;  3OTE A;  2QG9 B;  4KYZ A;  4KJI A;  2ZVS A;  2PII A;  4HLB A;  5AXN A;  2CPE A;  4O4G B;  3TOQ A;  2HWI A;  1RWK B;  3P96 A;  4MYT A;  1WNE A;  1ULR A;  4P7V A;  1WWH A;  1OQ6 A;  4Z7C A;  1MWQ A;  1J5O B;  1U47 A;  1Q8B A;  1AZS A;  2APO A;  4RW7 B;  2IYI A;  2NXJ A;  1DAR A;  2EKN A;  2O5D A;  3VAF A;  1NM2 A;  3GIR A;  2K3K A;  1RHJ B;  2V9W A;  2QX0 A;  2YVS A;  2AEJ A;  3WQP A;  1FVS A;  4DQQ A;  3RW7 A;  2RUS A;  1VBX A;  4CH7 A;  4A8W A;  1S0N A;  2FVR A;  4A8M P;  4YB1 P;  2NRE A;  3KLG A;  2D74 B;  2Z57 B;  5B7W A;  1FK9 B;  3CCR S;  4FXW A;  4DQP A;  5CZX A;  3T41 A;  1EET B;  1CVJ A;  3LOU A;  3NRB A;  1XR6 A;  3TAN A;  4KH0 B;  4NLW A;  3QFW A;  3ADA C;  3TEH B;  1NPR A;  4KC5 A;  2CQI A;  1WSR A;  4L75 A;  2KRB A;  3K8V A;  2HQI A;  2VQE J;  1QY7 A;  2EG1 A;  4ZVH A;  4ZVO B;  3M2U B;  3M32 A;  1VR6 A;  2ZNZ A;  1SPB P;  2DIS A;  5K14 A;  3T5J A;  3R5D A;  2ZH7 A;  3F44 A;  2QN6 B;  1MRO A;  3MEG B;  5ETQ A;  4F67 A;  4EYI B;  5C2C A;  2Z0G A;  4ZS6 A;  4X4Q A;  2R7W A;  4C8Y A;  2DGV A;  2DIU A;  5B0E A;  3SYZ A;  5FDL B;  2WZ1 A;  1URN A;  2JL9 A;  2QLF B;  1QLN A;  3M2V A;  1X5S A;  1TL4 A;  1H38 A;  4CO1 A;  3TUP A;  2E5L F;  5K8P A;  2DD8 S;  5F8N A;  1NK0 A;  3PYD A;  4OI1 A;  3FSX A;  2J0Q D;  2CZ4 A;  2AP6 A;  2FLP A;  4DSK A;  1TKX B;  4NWB A;  3I55 S;  2CZ9 A;  3IG1 A;  3U1M A;  1X0P A;  1PC5 A;  2ASD A;  4ED5 A;  3TZZ A;  1RA7 A;  3GV5 B;  5HJY A;  2J9E A;  3E8O A;  1NK5 A;  3C3L A;  2VHG A;  4TKT A;  1IJF B;  3HVT A;  4HKQ A;  2XWX A;  3PX4 A;  4LIR A;  1Y3K A;  5HAT A;  3SZ2 A;  2VIC A;  1R8A A;  4RW8 A;  1X5P A;  3DRP B;  2QYC A;  1U0H A;  2FYX A;  3EWG A;  2C1E B;  1FFW B;  2XEX A;  1RT7 B;  1FRL A;  2V67 A;  3QGH A;  5K20 B;  2OPQ A;  4DPY A;  4RZR A;  2EFQ A;  1IBK J;  3GFZ A;  3MCS A;  3NOC A;  1N36 F;  1B99 A;  4DZ6 A;  1LWC B;  3G82 A;  1NK8 A;  2P2C B;  1ZS6 A;  1C0U A;  2CQD A;  4UQT A;  5H9F K;  4BC9 A;  3VAJ A;  3HKW A;  2DNY A;  3A4T A;  1B0T A;  1V5I B;  3S01 A;  1S9F A;  1HMV B;  3DN9 A;  2KL8 A;  3UVJ A;  4X62 F;  4QWC A;  4DX7 A;  1DJ0 A;  1YBT A;  1M5S A;  3C2P A;  4UY8 T;  4ZOS A;  4KHP F;  4A8Y A;  3MFI A;  2W9B A;  2HNZ A;  4QWB A;  4LFA F;  2XS7 A;  4UW2 A;  1H2T Z;  3QLH B;  1UA1 A;  2OPS B;  3AJ2 A;  1S10 A;  4EI2 A;  2MPU A;  1G4C A;  4X4P A;  4MK8 A;  2KVI A;  4B9L A;  5DDO C;  3TEG A;  2OD4 A;  4OHZ A;  3G96 A;  3W60 A;  1RUS A;  5CHC B;  1HBM B;  2JJ4 D;  3G8S A;  1FDA A;  1JXV A;  1UFK A;  4HDH A;  4CO2 A;  1JXL A;  2CAJ A;  3D6M B;  4ZLJ A;  1UEV A;  1EJ7 L;  2HSE B;  2HUR A;  1JJ4 A;  3TUI C;  1TAU A;  1PBA A;  3NLC A;  2R8J A;  3PRD A;  1VHI A;  5E3R A;  5LSR A;  1IKY A;  5A8R B;  3PJW A;  2XMT A;  4OI0 A;  2ZOF A;  2RQ4 A;  2CNO B;  4DV6 J;  4F8R A;  1V5V A;  2WON A;  3EDR B;  5FII A;  3SIP B;  2HGL A;  1SC1 B;  1YJ7 A;  3W5X A;  1HD0 A;  2KXH A;  1WOR A;  3BGL A;  3NS5 A;  3VAH A;  1VMB A;  3MCM A;  3I56 S;  3BO3 A;  3ZNU A;  1VQ9 S;  3N4W A;  4ANC A;  5ETL A;  4XAK A;  1AZS B;  4USU A;  3FSY A;  4IQX A;  2QGF B;  1XMQ F;  4A8F A;  3T9Z A;  1JMT A;  2RU9 A;  2LP4 A;  1RT4 B;  2XBP A;  2XM3 A;  1K1S A;  1NHV A;  3KLG B;  4N8O A;  3VF0 B;  4CQ1 A;  5K8N A;  2CUY A;  1FER A;  1I5O B;  3J80 Y;  1BQN A;  4F3O A;  4K4Y A;  2I1R A;  4PWD A;  2HPU A;  4E0D A;  3D7S B;  1B7F A;  1YJU A;  2MHN A;  5AXL A;  3W66 A;  4JI0 F;  1JJ2 R;  2QJ3 A;  3KUE A;  3LP0 A;  5J2M A;  3F41 A;  2LU2 A;  5D4N A;  4XK8 C;  2CJQ A;  3M9O B;  5IT9 U;  1RJJ A;  4B3O B;  1LEO A;  4ELU A;  1FE4 A;  2OEM A;  4PAA A;  4IUF A;  2GMJ A;  5KFK A;  4ES3 A;  4LT6 A;  2HHQ A;  2ZD1 B;  4ECS A;  3HD1 A;  2DK2 A;  2VFV A;  1TZ0 A;  3DRR B;  3GFY A;  3OLA A;  1MNE A;  2FHO B;  4BLG A;  2EBE A;  3QQC D;  4G6V B;  2HVZ A;  1SH3 A;  3EMT A;  2LXI A;  4PYD A;  4HHU A;  2WW4 A;  3OFH A;  2SXL A;  2LEA A;  5IT0 A;  4CLF A;  4KQZ A;  5BXI A;  2HNY B;  5DDR C;  2B8P A;  3AOB A;  4DFK A;  5ETS A;  2RDJ A;  3D0I E;  2BR0 A;  4JI6 J;  2VPY B;  3FQK A;  2NXC A;  3OVS A;  2YWK A;  1S1W A;  2OEL A;  1ZZF A;  4C0H A;  2MKC A;  3GV8 B;  2BEF A;  4JI5 F;  4OI3 A;  1YZ6 A;  1KKH A;  2HRY A;  2MZR A;  3CJ5 A;  2VUG A;  4NX9 A;  2DGS A;  2Z2Y B;  3DYA B;  4DPW A;  1JLC A;  3B82 A;  4I2Q B;  3DLH A;  1FFS B;  1UFW A;  5KFC A;  4XDD A;  3VVT A;  5AXM A;  4E2F B;  4DR1 F;  2MGZ B;  4YHH J;  1HR0 J;  1WHV A;  1GAO A;  4C98 A;  3PYF A;  4UZB A;  2V8H A;  4CTA A;  2W8K A;  3GTY X;  2VFU A;  5E7O B;  3R5B A;  3HVW A;  4LSN B;  4OX7 A;  2EC0 A;  5DRK A;  2OPQ B;  3K59 A;  2VFT A;  3G82 B;  4CO3 A;  4M5I A;  4DL3 A;  3DFE A;  1YHQ S;  4X4U A;  3R5J B;  2VBY A;  3T1H J;  3K5L A;  1ZAW A;  2RUG A;  1NSP A;  2BJ9 A;  4M5J A;  4LBP A;  3AOD A;  3J7Y I;  2DRD A;  3IA0 A;  1Y5L B;  2PGC A;  3ZC4 A;  1S0O A;  3UVJ B;  4TQS A;  3LWM A;  4ECT A;  5JVH Q;  4PZV A;  2KM8 B;  4JV1 A;  4MK9 A;  1SL1 A;  5I3U B;  1F60 B;  1S76 D;  2FD2 A;  4ZVQ B;  3VR1 A;  1K8A T;  3CCL S;  3V5R A;  3OFG A;  2AZ1 A;  3IGV A;  2XGP A;  3ZZ0 A;  3GSI A;  1ELO A;  3OSN A;  2NPF A;  2HFS A;  2VFS A;  2B43 A;  4K0K F;  5A76 A;  2XHW A;  5AJ3 J;  2YKN B;  3MUT P;  3KHR A;  1N6Q A;  2C22 A;  2VC0 A;  4I6Y A;  4TQR A;  3LGN A;  2R2U A;  3QAE A;  2JRS A;  3CD0 A;  4DEZ A;  2W9A A;  4LBI A;  1VDH A;  4I6W A;  3EVO A;  1IKY B;  1CJK B;  1U1R A;  4DG1 A;  1L3V A;  2D3O R;  2VV5 A;  3QGI A;  4L76 A;  2KKH A;  5LMN J;  1VRU A;  1JLF A;  2C3P A;  4QR2 A;  1AB8 A;  2FHK A;  1HL6 A;  1J5E F;  5DLF A;  4NYP A;  2IA0 A;  1ZPV A;  3UO0 A;  3N79 A;  3PZP A;  5A8K A;  3FBB A;  3U27 A;  3JTN A;  3OTO F;  2ASY A;  2B4U A;  4PG7 A;  1ZZN A;  4Q44 A;  2K1R A;  3WDO A;  2P9G A;  4A8O A;  2HK2 A;  5D3G A;  2W2Q P;  4EBC A;  3N5F A;  1REV A;  2ZE2 A;  2HKE A;  4JUZ A;  1UET A;  1XBW A;  2BAB A;  2O3D A;  1ARO P;  1LWF A;  3IBF B;  1B70 B;  3FZB A;  1Q86 T;  1MU2 B;  4NI2 A;  3F0N A;  5ETT A;  1KOO A;  3BQ1 A;  2BOA A;  2E5H A;  2YWF A;  4M5L A;  2PA8 D;  2V4J B;  4UTG A;  2OML A;  1X60 A;  3ZZP A;  1RTJ B;  5DQH A;  2X3D A;  3PIO Q;  1RB0 A;  3Q8P B;  1TUV A;  1TL5 A;  2GVD A;  2J7K A;  1TKZ B;  1ITP A;  4ZVF A;  3OR2 A;  3W61 A;  1NU4 A;  3BZQ A;  2C42 A;  2W4P A;  1U2F A;  2CQC A;  1R6Y A;  1L3K A;  3D54 A;  2XY6 A;  6FDR A;  3CIM A;  3QFH A;  4UY8 5;  3I0R B;  3CCZ A;  5J2M B;  3MMA A;  3DGP B;  2UXD J;  1C1C A;  5SZT A;  1APS A;  1HBN B;  2C2R A;  4ELV A;  1PC4 A;  1D9D A;  3OTD A;  3RB6 A;  2OAU A;  3D67 A;  1FNX H;  3BSO A;  1NK6 A;  2YNH B;  2XLI A;  4NOH A;  4Y65 A;  2RRA A;  3CJ8 A;  5IQQ A;  2GO8 A;  1WHY A;  2AYE A;  1S1V A;  3M4X A;  4JV0 A;  3QO9 B;  1ZOT A;  4QWE A;  4K8R A;  3M8R A;  2UUA F;  3VAI A;  1WC0 A;  5J1N A;  2M0G B;  1H3D A;  1HHQ A;  4DR5 F;  4O3P A;  2H48 B;  1VHF A;  3JXO A;  5F8L A;  4DR3 J;  1SQF A;  3M6W A;  1R0A B;  2MKI A;  3WIU A;  3ET6 A;  4LBH A;  2DGW A;  4O3S A;  5JVG Q;  5KG3 A;  3QT8 A;  2DTJ A;  1MML A;  2ZNY A;  3PEH A;  2ZHO A;  4B3S F;  3KK3 B;  1QTM A;  1EP4 B;  3M30 A;  2WVC A;  3IM8 A;  4CH0 S;  4FN5 A;  1VI7 A;  5IZH A;  4WKR A;  4O3R A;  1JLC B;  5EHH A;  1VQM S;  3BYR A;  2PMW A;  4JYA J;  1F5C A;  4O4R A;  1WG1 A;  1C1B A;  1S6Q B;  4PG4 A;  3TX8 A;  4ZPT R;  1KVJ A;  2FY1 A;  2HVI A;  1VJW A;  4N77 A;  1VYA A;  4CTA B;  2GV1 A;  2W7P A;  3CDE A;  4K4V A;  1RAC B;  3NS7 B;  3W2V A;  2HYI B;  2XNQ A;  2BJ3 A;  2MDA A;  5M2P A;  2JZ5 A;  2DR8 A;  3PR4 A;  3D2W A;  2VDI A;  3FCH A;  2P9E A;  4KY3 A;  2F9D A;  2IC3 A;  3RR7 A;  4L73 A;  2FC9 A;  1U1L A;  2UXB J;  4TY8 A;  2YQ3 A;  3PKY A;  1U1Q A;  3IFE A;  1XNR J;  4A8Q A;  2BOP A;  3NWR A;  1Y3J A;  2LEP A;  3X1L B;  3LGM A;  2Z2M A;  2PI5 A;  4ZVG A;  4FPR A;  1DTT A;  4HAC B;  1BGX T;  1EQM A;  3JYT A;  1YJT A;  4LR9 A;  1N5Q A;  1KQG B;  2OIH A;  3VQS A;  2FJD B;  2GHP A;  2WW8 A;  1V6H A;  5H9F J;  2ZDP A;  4DV4 J;  4LF4 J;  1FKO B;  1O0P A;  4X2B A;  2IVY A;  4DUY F;  2OSQ A;  4LSL B;  4OZ2 A;  2B5J A;  2CVI A;  4LF8 J;  2WB4 A;  4ECU A;  1JLB A;  4DG1 B;  2FDN A;  2FIU A;  2DXF A;  3GIK A;  1TP7 A;  3L7O A;  1JLF B;  3Q8V A;  3PXG a;  1OY6 A;  3T3F A;  1M5K C;  4LF7 F;  5JXS A;  1J27 A;  1OPI A;  1QTN B;  3GFX A;  2XYP B;  1Q0N A;  2FHJ A;  2KHD A;  1K73 T;  3H7H B;  2EK1 A;  1UWB B;  3BGO P;  4WIQ A;  1ZH5 A;  3W9I A;  5C5J A;  4DQS A;  2ADC A;  3PV8 A;  1TV6 B;  3FFI B;  4P75 A;  3CJ3 A;  2PO4 A;  2AHO B;  1RBL A;  2HHH F;  2ROP A;  2JC0 A;  1N33 F;  4OFZ A;  5HRO B;  2CJB A;  1JK9 B;  2F4F A;  4Y2C A;  2VG5 A;  4ZJO A;  2DHH A;  2XCP A;  4GO7 X;  2X1A A;  1ZYQ A;  2WBM A;  7AT1 B;  3DOL B;  2G1D A;  3I4P A;  5AE3 A;  5C25 A;  4DR2 J;  5ETK A;  1U6Z A;  2GVD B;  2WVB A;  2UU9 F;  3CDB A;  4GVB A;  2YKA A;  2H3E B;  3MM9 A;  2GHV C;  4EU0 A;  2QL7 B;  1U45 A;  4OX9 F;  5A8W A;  1H6K X;  4MFB A;  3TJ9 A;  3Q24 A;  4TU7 A;  1PYT A;  2AGP A;  2AIR B;  2IAJ A;  1O8B A;  1X4F A;  2RSQ A;  6FD1 A;  1R31 A;  4DV2 J;  2L9D A;  3MMA B;  2YQ1 A;  3P45 B;  1NDP A;  3QGP A;  2C3O A;  2D9O A;  1EQ0 A;  2MZQ A;  2PE8 A;  1YG0 A;  3VVU A;  2NUU G;  3ELH A;  2RAQ A;  2UVR A;  1JIH A;  4WZM A;  4IDK A;  2W8L A;  4I56 A;  3CCT A;  3CMQ A;  3V4M A;  4B9V A;  1I94 F;  1JNR B;  2V63 A;  4EZ6 A;  1NPK A;  3CUL A;  2NCK L;  4P2F A;  3DLJ A;  3ULH A;  3W8P A;  2UXC F;  3DLG A;  1B0P A;  4WP8 A;  3FQL A;  3QYY A;  3CC4 S;  4Z7Y A;  4ITS A;  3DC2 A;  4DN9 A;  4OYM A;  3V6H A;  1Q8I A;  3A1Y G;  4L6V 3;  1Q7L B;  1VQP S;  1HHT P;  1CUL B;  2YNG A;  2GVZ B;  1T9U A;  5ITH A;  1HI0 P;  2HLT A;  5D4O A;  3W5Z A;  4TNO A;  4AUK A;  3J80 U;  3MXH P;  3OBI A;  3CDU A;  1VQY A;  2B7B B;  4F0K A;  4LFC F;  1EAR A;  1FJG J;  2IJN A;  1F3F A;  2C2Z B;  2XYH B;  4USI A;  1RAI B;  2VOO A;  1N32 J;  3E2E A;  1YX2 A;  3C6U A;  4F0M A;  3W2V B;  1VQS A;  2BZ2 A;  3R6L B;  4Q7A A;  2XQC A;  1ZTT A;  2JSX A;  4YN3 B;  5IWA F;  3DDI A;  2YWG A;  1EHW A;  4DWI A;  4URQ U;  1F2H A;  1X4D A;  1K9M T;  3HX9 A;  2QRR A;  4PG8 A;  4PUO A;  2ZH9 A;  1TUW A;  1EZZ B;  3CWJ A;  3U7J A;  5F8J A;  2IC3 B;  4RNM A;  2GAG C;  1SUQ B;  4QR1 A;  1HNZ J;  4R8U A;  4PXB A;  2YBV A;  3MM7 B;  1FRK A;  4J90 A;  2NZC A;  4USH A;  3C16 A;  2E7X A;  3MPV A;  2V8V A;  2J8S A;  1S9G B;  3PO4 A;  3H2V E;  4ID8 A;  4H4M A;  2G2Z A;  4WK3 A;  2E5G A;  2BJ8 A;  2UVW A;  1UPP A;  4OZJ A;  4MIB A;  1RLD A;  4DQR A;  1SI9 A;  1ZPW X;  1W26 A;  4OHX A;  1WF1 A;  2K3I A;  3OPK A;  2Z8Q A;  2V68 A;  1VQ6 S;  4KIA A;  2GML A;  3MEE B;  2ALZ A;  2JEI A;  2I5J B;  3RBE A;  3ILI A;  3BDE A;  2MYF A;  2AF6 A;  2RS8 A;  3F56 A;  4MMO A;  2IRX A;  3L09 A;  3TQE A;  2KFN A;  3VAL A;  4B3R F;  1N5S A;  5DDQ C;  4JI8 F;  2XSJ A;  2V69 A;  3UI3 A;  4M5D A;  2GIR A;  1N54 B;  2IHR 1;  2E9T A;  2JVR A;  1TK8 A;  4U95 A;  3R8Y A;  4RW9 B;  1FE0 A;  3GR0 A;  3WHI A;  1D8Z A;  4H4K A;  1B64 A;  2O66 A;  3DI6 A;  4RBU A;  3K5M A;  4H54 A;  2NPI A;  1IUJ A;  2GMH A;  1DTQ B;  1XNQ F;  3GJT B;  3IBC B;  2HBQ B;  4KSE B;  3O44 A;  3N5B A;  2AU0 A;  2UUB F;  4WFA Q;  3D3C J;  3QBC A;  4NCG A;  4NLT A;  2JLE A;  3CCS S;  1FO1 A;  2BE2 B;  3LPE A;  2VG5 B;  2HEK A;  3PW2 A;  2GW8 A;  4DX6 A;  1K1Q A;  1RAO A;  1QAJ A;  2A1B A;  1T02 A;  2MKJ A;  3SI8 A;  2CPZ A;  2DEJ A;  2W2P P;  1PO6 A;  4KBI A;  2AV5 A;  1SBR A;  3O3L A;  1HNV B;  1NLK L;  1F5B A;  4Y34 A;  4CT9 A;  3JB9 k;  1VQ5 S;  2DHA A;  2MLY A;  2OPP A;  1Q8L A;  1VRT B;  5A8W B;  4MFB B;  4DCO B;  1YWX A;  2VG6 B;  3KLH A;  4JI7 F;  5ETP A;  4JI4 J;  1JLQ A;  1SJ1 A;  1MMD A;  1QD1 A;  3M7V A;  2JLF A;  3ZTO A;  5B0A A;  4AXI A;  3NL0 A;  1YK9 A;  2L3M A;  1IBM J;  4YB5 A;  1WHX A;  3FK4 A;  1OY8 A;  3POT A;  4DFP A;  4CNZ A;  2DY9 A;  2B6A A;  4U7U K;  2VG7 A;  4G1Q A;  4Q8E A;  4GKJ F;  3D6H B;  2KYZ A;  3LP2 A;  4Y0F A;  2PEB A;  2CQ4 A;  2OTL S;  2J0X A;  2XCA A;  2HHU A;  5DGB A;  5I3Q A;  4YR0 A;  1MW7 A;  1H72 C;  5DG9 A;  4JV5 F;  3K0J A;  4HT5 A;  3DM2 A;  3H2L A;  3FEY B;  2OPR A;  4JB8 B;  2C3M A;  1KTQ A;  1CJV B;  1NRK A;  1YJV A;  1RBO B;  2U2F A;  2Z2L A;  1TKD A;  2FJB B;  2LQJ A;  5M2R A;  9ATC B;  5ETN A;  3G8Q A;  3K89 A;  4I4B A;  3OUY A;  1GT8 A;  3Q2S C;  2V2Z A;  5BR8 J;  3P5T L;  2HVE A;  5E33 A;  3GFH A;  3HCX A;  4ID5 A;  3R6G B;  5T41 A;  3CUN A;  3PG9 A;  2KN4 A;  3BH6 B;  2I9S A;  3I5A A;  4KTQ A;  1S1U A;  1NPP A;  4NPO A;  2JVO A;  4HTJ A;  4O3N A;  1VIO A;  3GMG A;  3ETM A;  3EGZ A;  3EVW A;  3HHL A;  1LW0 A;  3LF0 A;  2HIQ A;  1FRI A;  3BV8 A;  3M2R A;  4OX8 A;  1RTD B;  3A8I A;  2V94 A;  4NXM F;  3C6U B;  1RCX B;  2DR9 A;  1TVR A;  2AZ3 A;  5KOW A;  3R1L A;  2JH3 A;  3SDE A;  2MY8 A;  2X1B A;  2VKZ G;  5HP1 A;  3D1O A;  2OJ3 A;  3D1H A;  2QLJ B;  3BPD A;  1IKW B;  4Q2M A;  3G6X A;  2HS3 A;  2V34 A;  1UEK A;  2XZD B;  2V5H G;  4WFY A;  3C16 B;  1MLA A;  1B3T A;  4ZVU B;  1RHU B;  3TP2 A;  3OQ2 A;  3OSP A;  3NGK A;  2W2N P;  3H5S A;  4H4M B;  1NK4 A;  5DQG A;  4AQY J;  2XLJ A;  5KFO A;  4B3M F;  1AA1 B;  2F8E X;  3ILL A;  2XS5 A;  1TR0 A;  2EFO A;  4GC6 A;  1UVK A;  1LFW A;  3KLI A;  4ENO A;  1KOH A;  2W9C A;  4RL1 A;  2R7U A;  2HGM A;  3KKF A;  1S77 D;  5DS7 A;  4WZQ A;  2JEF A;  3OLB A;  2YQ0 A;  4DF8 A;  5IM0 B;  5C42 B;  5DJB A;  2GO9 A;  3QT7 A;  3S1T A;  4B02 A;  3KK1 A;  2CJA A;  4CYU B;  4FYX B;  2UV8 A;  2Y8Y A;  1TL1 A;  2HHS A;  3BSC A;  3GLJ A;  2DBB A;  2EBG A;  3NMR A;  2H5E A;  2X1G A;  1PCA A;  5HK4 A;  3W62 A;  2NS1 B;  2F5G A;  4C8N A;  3MEC A;  2YKQ A;  1S57 A;  2VIH A;  2CPI A;  4FXV A;  4YEA A;  3H25 A;  4LR7 A;  2DNQ A;  3EPG A;  2ASL A;  2LMI A;  4NLP A;  2KJW A;  1RWW B;  2ATC B;  5HBM A;  2ZUA A;  4RUB A;  2KXF A;  1NKB A;  2DHG A;  4ATN A;  3FBE A;  2DHS A;  4Y00 A;  1NB2 A;  2B8Q A;  1GEH A;  3RZA A;  2QA4 G;  5B0C A;  5D0E A;  5B0D A;  4K4Z A;  2OEK A;  1NJY A;  7FD1 A;  1RZM A;  3PEJ A;  1Y4Z B;  4OLO A;  1RU1 A;  1Y10 A;  2E9Z A;  2BKP A;  3QGG A;  5E41 A;  4ICL A;  1XJW B;  2OPP B;  1FEH A;  2DCL A;  2GFF A;  3OL8 A;  1C0T B;  3LQV A;  1GQE A;  2R2S A;  3BN4 A;  3GIJ A;  4DPO A;  4IR9 A;  2RT3 A;  3KLH B;  2IM0 A;  5GMD A;  1JLQ B;  4KFB B;  2BVZ A;  1EKS A;  1T03 A;  2VH7 A;  3VZH A;  2VAS A;  2ZM6 F;  2F9J A;  4DR4 F;  1OJ4 A;  3CNQ P;  2UZA A;  3L9Z A;  1HBO A;  2XZW A;  3RYL A;  3H4B A;  4B9M A;  1GMW A;  3MD3 A;  1B4S A;  1RT3 A;  4U67 Q;  2VOP A;  3LP2 B;  4QW9 A;  4OZN A;  2YKM B;  3EXC X;  3KNA A;  3OHA A;  3BYP A;  4PXC A;  1IKV A;  1FTR A;  1S7H A;  1W2B R;  2VC1 A;  2DH7 A;  3HSG A;  3IR5 B;  3RG6 A;  4FF1 A;  5IC6 B;  3DLE A;  4RW4 B;  3ZO7 A;  1F0X A;  1HWL A;  4J9V A;  3QSY B;  3AOC A;  2OPR B;  2V2V A;  4YDX A;  2HVD A;  1NJZ A;  1RT2 A;  1NND A;  2ATL A;  4USV A;  2BJ7 A;  4RWW A;  4ECQ A;  4Y3C A;  2PFD A;  2MKS A;  1D0E A;  3V4I B;  4NE9 C;  4QIE A;  3FGV A;  4ZHR A;  4AYB D;  3HSJ A;  1E6Y A;  4ID5 B;  4OZ1 A;  4OJG A;  3OJU A;  1D3W A;  4QPX A;  3RTV A;  1XMO F;  3BF4 A;  4LF6 F;  3US5 A;  2R7T A;  5F0U A;  4I67 A;  3AB4 B;  2IRY A;  2CNL B;  3HHL B;  2MZ1 A;  2HQG A;  5D0G A;  4NLS A;  3KHL A;  3U1L A;  2DT9 A;  4OJ1 A;  4C48 A;  2RJZ A;  2F65 A;  2H9Z A;  1Z2L A;  3AAW B;  1Y5I B;  2XMA A;  3PFE A;  1KON A;  2RU3 A;  2DNK A;  2L08 A;  1XEZ A;  1E6V A;  3EVM A;  4TU8 A;  3BN7 A;  3IO1 A;  3KOA A;  1EAY C;  2B9E A;  2MST A;  2ZUG A;  1WDD A;  1RDR A;  2KTQ A;  4A8S A;  4MIA A;  2Y1J A;  3RBD A;  2R8K A;  2YNI B;  3KTQ A;  2FZC B;  3HDS A;  1X9S A;  3G71 S;  5DO2 A;  2C3Y A;  2EG2 A;  4X4R A;  4P71 A;  2E5L J;  3KLI B;  4USJ C;  5BYQ A;  4J5O A;  1N4L A;  3CSK A;  4LF2 A;  4IFV B;  1Q81 T;  3IWX A;  5D15 A;  1NHK L;  3R97 A;  3BM7 A;  3D5M A;  4MKY A;  1SL2 A;  3K17 A;  2X7I A;  3CD7 A;  1JLE B;  1MN7 A;  4ILR A;  2CIM A;  2D3Z A;  2J0W A;  4J9Q A;  5LXY A;  2ILY A;  4PPZ A;  2Q3P A;  1DRZ A;  2RF2 A;  4U8Y A;  3J7Z 5;  4QBU A;  3A8E A;  1FF2 A;  2KO1 A;  4LF5 F;  4IR1 A;  5L1J A;  1ZM4 A;  5IT4 A;  2CPD A;  4U7U D;  3C8Y A;  3PY8 A;  1RA6 A;  2RH3 A;  2YX7 A;  3Q83 A;  1NO8 A;  2Z56 B;  3VGT A;  1SVD A;  1S48 A;  4FVC A;  4NCB A;  2BQ3 A;  2E1A A;  2W01 A;  2VPZ B;  2E1M C;  4I7F A;  3G86 A;  2ZHA A;  3BKT A;  4OLP A;  4DSL A;  4G3I A;  1G3O A;  2ZJQ Q;  4WTO B;  3PO5 A;  1U48 A;  3A3N B;  2QTW A;  3LP1 A;  1I51 B;  2W25 A;  3R2D J;  1LNQ A;  3EYZ A;  1N36 J;  3K7R A;  1WUU A;  3AD8 C;  3EIC A;  3SMZ A;  3G87 A;  5HQ8 A;  2MKY A;  5HAO A;  4WFB Q;  5M2U A;  1UJ6 A;  2IDL A;  2B9X A;  4FPI A;  3SXL A;  1H74 A;  1S6P A;  1H7X A;  2N4C A;  4FBU A;  1T3N A;  4X62 J;  1T0T V;  1YDL A;  1YZ7 A;  3DLK B;  3OL6 A;  1SH0 A;  5E5N A;  3KHH A;  4KHP J;  2XS2 A;  2HK3 A;  3TUZ C;  1EX8 A;  2X3G A;  4ICL B;  4LFA J;  2B4P A;  2DKO B;  2GX8 A;  1HW8 A;  3C19 A;  3TW0 A;  2AW0 A;  4NLX A;  3A3O B;  3HFK A;  5CYM A;  1T94 A;  3KUG A;  2VJV A;  3I87 A;  4ZVE A;  3BDP A;  2MXY A;  2XMW A;  2FJV A;  4B9N A;  4OYA A;  5ETV A;  2FPH X;  4U8V A;  3K8W A;  4FBT A;  1FJ7 A;  3MM6 B;  4J9L A;  4RWX A;  2ADB A;  3GU0 A;  5KFL A;  2JX2 A;  2CDQ A;  3BGR B;  2ZC4 A;  5IT9 Y;  2H1Y A;  3GJR B;  1HBO B;  2DGU A;  1YBU A;  1FJE B;  2MTL A;  4P9S A;  2FJX A;  1GK8 A;  1KQF B;  1TKT A;  2K7K A;  3AOA A;  4KRW A;  2QFI A;  4O4G A;  2ZBQ A;  2YNF A;  4KPY A;  2MLZ A;  3DLE B;  4YUD A;  3PHT A;  1WEX A;  3A8J A;  3S7R A;  3KK2 B;  2PN6 A;  2J7W A;  4RUH A;  1J5O A;  3DXS X;  1Q82 T;  1K0V A;  3CC7 S;  4Q8F A;  2Q79 A;  4NEY A;  3TJ8 A;  1UP1 A;  4GO5 X;  3SSR A;  4OYZ A;  3FJ2 A;  4NYZ A;  4J9N A;  1CJT A;  2V9K A;  4B3T F;  2GQC A;  4YY3 F;  4ZLP A;  4A8X A;  4LRA A;  4ED6 A;  1XMQ J;  2OUG A;  1E6Y B;  4HI1 A;  1U26 A;  1U2R A;  3KFW X;  3TVK A;  1FWK A;  3PDN A;  1FK9 A;  3MUM P;  1X9M A;  2CNN B;  3WBZ A;  2KT5 A;  4FS1 A;  4N76 A;  1EET A;  3LH2 S;  1HQE B;  2F7V A;  4P2M A;  5CYQ B;  2VL1 A;  1Q79 A;  3BGU A;  1YTY A;  2J6U A;  3RBZ A;  3AXM A;  2DJW A;  3GCW P;  5LMU F;  1GNK A;  4DU7 A;  5DQI A;  3EDQ B;  2KM8 C;  5E3Q A;  3M2U A;  4JI0 J;  2XO6 A;  4FS2 A;  3MOZ A;  5BYS A;  3AJD A;  3MEG A;  4MT1 A;  1U6B A;  1RWX B;  2WHO A;  3T19 A;  2QE5 A;  1L3S A;  2KYX A;  4JV2 A;  5I4M A;  1PG5 B;  4ZA1 A;  2HFN A;  4NA1 A;  5DLG A;  1T9V A;  5FDL A;  3MR3 A;  2KB2 A;  3HZE A;  1ZM3 A;  2JC1 A;  4OZ5 A;  1UW9 A;  2CQ3 A;  4WE1 A;  3VAK A;  1FX4 A;  3ISZ A;  1LV5 A;  2CJY B;  3KLV A;  2Y0S D;  2BYC A;  3QJJ A;  2HHW A;  1F9H A;  5KFN A;  1TKX A;  3M8W A;  1FKP A;  5J1E B;  4KGX B;  2FTR A;  2ASJ A;  3WC0 A;  5MAO A;  4IOC Q;  4HL9 A;  3R3T A;  2GS8 A;  1NZ8 A;  3NKY A;  2XSF A;  3T5H A;  2ZBC A;  1RHK B;  3GE9 A;  1UVN A;  3TA1 A;  4PQA A;  4JI5 J;  5LSO A;  1XIQ A;  2WOM B;  3DRP A;  2PD1 A;  3AQO A;  2RF2 B;  5G0R A;  1SXL A;  2GJ2 A;  3D28 A;  1Q95 G;  4XPE A;  1AUD A;  5GAH U;  1RT7 A;  2FGC A;  4F2R A;  4RNO A;  2K2P A;  3QZ7 A;  4DR1 J;  2ZDO A;  3R1H A;  4KKO B;  1SB6 A;  3K57 A;  1QJH A;  4IG0 A;  1M90 T;  2PMH A;  2YX4 A;  2MMY A;  4L74 A;  5C7P A;  4Q0B B;  2PA3 A;  3OVA A;  3PKM A;  2HZA A;  3O1L A;  1RT6 B;  2H5I B;  2KFZ A;  4G1I A;  2N3O A;  3G8T A;  1VGY A;  1BD6 A;  3BQ2 A;  1UTA A;  1FJC A;  1U09 A;  2PT0 A;  2FJW A;  2QFJ A;  2RKI A;  4C97 A;  3NEK A;  3T5L A;  3CC2 S;  1T8E A;  2IM1 A;  2V2K A;  3FEX B;  5HVH A;  1T05 B;  4ZPA A;  2OPS A;  2OTJ S;  3CXC R;  2BQU A;  5KFV A;  3KDN A;  3LAN A;  2IJR A;  3JQJ A;  3SSQ A;  1R8C A;  3WZ0 A;  4QWA A;  4J91 A;  4CDI A;  3BH7 B;  5CYM B;  4YQW A;  1HQU B;  3N9U C;  3FMB A;  4EK2 A;  3WX8 A;  4J9M A;  4K0K J;  3JSY A;  2YWH A;  3UCG A;  2POK A;  5HMW A;  1ZAX A;  2HQF A;  4EO6 A;  2ZJP Q;  3NMA A;  2GIQ A;  2DGT A;  5C24 A;  1IJE B;  5A8R A;  3LAL A;  4CH1 A;  5HI7 A;  4IFY A;  1FXR A;  3NCP A;  2G13 A;  2VFR A;  2NR0 A;  4WYW A;  4ILM A;  3K5P A;  2ZH5 A;  4PG6 A;  3SFU A;  4NXN F;  1KSP A;  3O8W A;  1VFJ A;  1D9F A;  3CME S;  1REG X;  3QAT A;  3UCU P;  1TKT B;  5JMN A;  4B9U A;  1W2I A;  4RNN A;  1OY9 A;  1ZA2 B;  3HP6 A;  2YNF B;  3MZI A;  1J5E J;  3WX4 A;  3NBP B;  2O01 C;  1FI4 A;  1RE1 B;  1YRT A;  4DPX A;  3R7B B;  3OTO J;  4DSI A;  4OYW A;  4PXD A;  2UUC F;  2E7V A;  2NYH A;  3H40 A;  1WEL A;  2UP1 A;  3O6Q A;  3TR5 A;  3TAR A;  4CLL A;  1YJR A;  3DDN A;  1WKK A;  5HSP A;  1X9W A;  3T6B A;  1R6V A;  1CJT B;  2FVP A;  2WVD A;  1RT4 A;  1C4C A;  3Q0A A;  4QU7 A;  4UQG A;  1BQM A;  3RRH A;  2K7J A;  4DPT A;  2LEC A;  3W9H A;  2H4W B;  3DRY A;  5HJX A;  3FCW A;  2W4C A;  2CJK A;  1HLW A;  2E1P A;  6AT1 B;  1V3S A;  4RX6 A;  4TXS A;  1WG5 A;  2IM3 A;  3K5O A;  3J7A 1;  5FLX Y;  3VAM A;  3TA2 A;  4AFF A;  3IAS 9;  4OYI A;  2XG8 A;  1FRH A;  5A2Q U;  4QIG A;  1AT1 B;  3NGU A;  3CDA A;  4ZVS B;  8RUC A;  2OFH X;  4B3O A;  1WSV A;  2CYY A;  1CS4 A;  3IR7 B;  2QA1 A;  1TQL A;  1NDL A;  5D6G A;  3C6T B;  2RQC A;  4OHY A;  3KMS A;  2ZD1 A;  2QV6 A;  2R8I A;  2I0X A;  1IKX A;  3DRR A;  2LLZ A;  2R2T A;  4RUA A;  4G1P A;  4ZCL A;  1OO0 B;  2VPX B;  1I3O B;  5L38 A;  2B4O A;  1X31 C;  1UFL A;  4WE1 B;  4PKD B;  4NMX A;  1BQX A;  1P1L A;  5CZV A;  4ZPB A;  4FDF A;  2IFX A;  2HNY A;  2ZC3 A;  2YX1 A;  2UUA J;  1AXQ A;  4IH7 A;  1LW2 B;  3H4D A;  4CLZ A;  4QW8 A;  2IDE A;  5CQG A;  5KG0 A;  5CCL A;  4DR5 J;  1NZA A;  1FKP B;  2K8G A;  2ZZM A;  1SQG A;  2VDH A;  2ZKT A;  2XTJ P;  3PM9 A;  4KHM A;  1IR1 A;  1WTB A;  3R7N B;  2A18 A;  3IWL A;  3MMC B;  3DYA A;  1SH2 A;  4I2Q A;  4OYP A;  1HIY A;  4B3S J;  5A0Y A;  1LK7 A;  5HMY A;  4TVA B;  2D7S A;  4FF3 A;  3OFF A;  2MGZ A;  5K8M A;  2RD5 C;  5G0R B;  4ZIV A;  4DV3 F;  3KMQ A;  2RML A;  1CJU B;  4LSN A;  2J6S A;  4RU2 A;  5K5M A;  3L3C A;  3BB5 A;  1RWO B;  3AB2 B;  4IG0 B;  3THV A;  2RNE A;  2HHP A;  3MAH A;  1Q8K A;  1HD1 A;  3BR8 A;  1P8G A;  5F8I A;  4OZ3 A;  3M9N B;  4WP3 A;  3PRV A;  4ZPC A;  2CFX A;  2PMZ D;  4MKV A;  3MED B;  1X8D A;  3AQP A;  1GMW D;  2AWZ A;  4LUB A;  3PIP Q;  5KT2 A;  4ED7 A;  5I3U A;  2IJF A;  2RKI B;  1GMV A;  4HDG A;  3SQG B;  1Q5Y A;  2YPZ A;  4UOH A;  4AE5 A;  5F0W A;  2IMO A;  3Q8Y A;  3MUR P;  2J76 E;  4KGM A;  4I2P A;  2QEX S;  2VQF F;  3G2X A;  2G0I A;  1O5J A;  1Y0H A;  1YI2 S;  2CG4 A;  2YKN A;  5F8M A;  2DHX A;  4F3Q A;  2Q6C A;  1IN0 A;  3DU6 A;  2IBO A;  1D8Y A;  3HVA A;  4UT4 A;  3T5K A;  4DV0 F;  3KG1 A;  3Q8Q B;  2OKQ A;  1XQI A;  1R0B G;  4DL2 A;  4DUY J;  5C24 B;  1CJK A;  1Y7P A;  1ACM B;  3H8Y A;  1BC6 A;  3B78 A;  1WKJ A;  2DGQ A;  4RW6 B;  1RAJ A;  2W7O A;  4IFY B;  1ZA1 B;  3IM9 A;  3PCO B;  5CD4 H;  4X65 F;  2HZC A;  3GWC A;  5J2Q B;  4DUZ F;  2MQL A;  3DMJ B;  1A7G E;  2ZH4 A;  2F1F A;  3CF5 Q;  3ISN C;  5DDP C;  4AL5 A;  2VA3 A;  1RHQ B;  1VBK A;  3RU0 A;  1U02 A;  4ZP7 A;  1TUG B;  2P8I A;  4O3O A;  3BEG B;  4LF7 J;  2AX0 A;  2HS0 A;  2ZZT A;  3OHB A;  3ONQ A;  4K50 A;  4WXW A;  4CLW A;  1NCL A;  2VBW A;  2KJV A;  1NBE B;  1MU2 A;  1QDU B;  1WEY A;  4NLD A;  3KLE A;  1HWK A;  1U8S A;  3K58 A;  2MHE A;  3UDV A;  2CXE A;  3VAG A;  2HHH J;  3HHE A;  1TK5 A;  1N33 J;  2V4J A;  1RTJ A;  1NEE A;  4QIF A;  5IXU A;  3HF5 A;  3KJF B;  1U49 A;  1BQM B;  4NLV A;  1TKZ A;  2QYG A;  1IWA A;  1LKZ A;  4JI1 F;  4C9D A;  3HXM A;  2AEF A;  4LIW A;  5L9X A;  1HPZ B;  2XMV A;  5KFA A;  1X4B A;  3UR0 A;  1U8W A;  2UU9 J;  4MYU A;  4LRE A;  3I0R A;  4OX9 J;  4WFX A;  5KFF A;  1JX4 A;  3DGP A;  4R25 A;  1HI8 A;  4DSE A;  3KDO A;  1HBN A;  4A48 A;  4F2S A;  1SJF A;  4OV1 A;  4GKK J;  1OPZ A;  2V8P A;  4WPA A;  1CS4 B;  2Q1L A;  3E01 B;  1DLO B;  4OQJ A;  4C3M A;  4ZCK A;  2HAI A;  1RAF B;  1YVF A;  4QZV B;  1U1M A;  2QSF A;  2YNH A;  1V3Z A;  2FB0 A;  4DL0 C;  2OH2 A;  5A6W A;  2ZWO A;  4A8K A;  2YPY A;  3P4U B;  1BUX A;  5AXK A;  3SCJ E;  1IKX B;  3W5Y A;  3QO9 A;  1H98 A;  4CM2 A;  2Y3Y A;  2C2O B;  4MIW A;  3N6M A;  4QOT A;  4YS2 A;  3PR5 B;  1IM6 A;  3B54 A;  3MI7 X;  4BWM A;  1CQN A;  3I5C A;  1RP5 A;  3A12 A;  4KGK A;  4WF9 Q;  2MKH A;  1R0A A;  1I94 J;  3LWL A;  4ZP6 A;  4KR0 B;  3GJQ B;  3V2U C;  3OD2 A;  1HI1 A;  4M95 A;  2RIJ A;  2C28 A;  2WVF A;  1I6J A;  1D09 B;  1ROF A;  2UXC J;  3KK3 A;  1IXK A;  1EP4 A;  1VCT A;  3CJQ A;  2LQ8 A;  5H1S V;  3CCW A;  2CPH A;  2XHC A;  3NGS A;  1RXO B;  3MR6 A;  2KZZ A;  1RIS A;  1P9Q C;  4DR6 F;  4USK A;  2RIL A;  2HFZ A;  5A0Y B;  1B0V A;  4DHV A;  1RQ0 A;  2O67 A;  1S6Q A;  3OL9 A;  2QLB B;  2EC2 A;  1LXN A;  4K59 A;  4P10 A;  3DLL Q;  5DZ7 A;  4LRD A;  2E9R X;  4ZIT A;  1QVG R;  1FNO A;  4LFC J;  2BAN B;  2NXU A;  3IBW A;  5GAE U;  3ZTR A;  4IOA Q;  2MLX A;  3GYX B;  5AE2 A;  5AT1 B;  3GII A;  1S97 A;  5LSL A;  1X5O A;  2LVW A;  5IWA J;  1YJN S;  1VC0 A;  1FFG B;  3IGN A;  3PX0 A;  1JLG B;  2OP5 A;  1HNW F;  3RW6 A;  4OZ0 A;  1L3T A;  4LFB F;  4NAS A;  4EUV A;  3MAA A;  3KJV B;  4HAC A;  1SKR A;  2BJD A;  4JP8 A;  2ZEJ A;  5EGY A;  2LQ5 A;  2AJ4 A;  1KRP A;  3NGR A;  5KFS A;  1MMN A;  4I2P B;  1S4F A;  2I2Y A;  1H2U X;  4I68 A;  3FZ2 A;  1KLM B;  2DO0 A;  4UOF A;  2KT2 A;  2OLW A;  4IQM A;  1FKO A;  2MB0 B;  2C2M B;  4DPU A;  2HVH A;  4ECZ A;  4M5N A;  4Z2X A;  4LQ9 A;  4UOC A;  4Y2A A;  1NSA A;  4EEY A;  3DCA A;  3RB3 A;  3MEK A;  4LSL A;  1T7P A;  4N56 A;  1C4A A;  2CRL A;  2F63 A;  1BY9 A;  4HHJ A;  2IVM A;  5KFE A;  1VIS A;  1AUS L;  4TN2 A;  4QR0 A;  5LL6 d;  4USM A;  4ZKA A;  4ELT A;  2CWX A;  5KFY A;  1PJ7 A;  1FDN A;  3EGN A;  3V6D B;  5GAG U;  1VLO A;  2BM0 A;  1JWW A;  2RDD A;  2HFO A;  4I0W A;  3SCK E;  4DX8 H;  2PEH A;  2XMK A;  1UPM B;  2DH8 A;  4B3R J;  2R7O A;  3N6N A;  4JI8 J;  1YGY A;  5KFD A;  3CCM S;  4H4O B;  2I38 A;  1UWB A;  1UW4 A;  4M63 A;  1S1X A;  3W63 A;  4FZV A;  5FD1 A;  1TV6 A;  2K06 A;  3FFI A;  3JSR A;  4P73 A;  3UPF A;  2KFY A;  5D4P A;  5KG7 A;  2CQP A;  1IWG A;  4FYY B;  4NL5 A;  4ECV A;  1EKR A;  5HRO A;  1RAE B;  3F73 A;  1Q4R A;  2DNN A;  2P6S A;  3KLE B;  4F50 A;  2ZJR Q;  1T9W A;  3SFG A;  2LDY A;  1XNQ J;  3DOL A;  3W3S A;  2UUB J;  1YJW S;  1FCA A;  2ZOM A;  4HH0 A;  3A13 A;  2ZBI A;  4IG3 A;  2B3T B;  1TFY A;  3TRG A;  1RAD B;  4NLY A;  4KO0 B;  2QZ8 A;  4FNI A;  2KDO A;  3IS9 B;  4U6P A;  3QRR A;  3FRZ A;  1DQA A;  3CD6 S;  4ECY A;  3KJN B;  4TLR A;  1KD1 T;  4DSJ A;  3EE3 A;  5KT3 A;  4M94 A;  1PIE A;  3TVZ A;  3JTP A;  1KP6 A;  4LRC A;  5KFJ A;  4A4J A;  3AXK A;  2BX6 A;  3SBM A;  1VK3 A;  1HNI B;  1VRQ C;  5KG6 A;  3FKB A;  3KG4 A;  4JI7 J;  5J2P B;  2E5I A;  4O3Q A;  3BO4 A;  3ETO A;  3M8Q B;  1S6O A;  1TFW A;  4K2X A;  3UE2 A;  1FRM A;  3MR5 A;  2LQ9 A;  2J9D A;  1WD6 A;  5KFZ A;  4DDF A;  1OYE A;  4CLK A;  5SUH A;  4E98 A;  4KPC A;  4CZC A;  4DLE A;  3OXL A;  3ENA A;  4GKJ J;  1GH8 A;  1RKJ A;  3E3X A;  3I0S A;  3EJM A;  1NDC A;  1GTE A;  4ANE A;  1S0V A;  2CJ9 A;  4KGZ B;  3GYN A;  4WKY A;  4XTT A;  3PJ9 A;  2A2D A;  3CJR A;  3I96 A;  2A6M A;  1TEL A;  2COL A;  2Y1I A;  5D8H B;  4UUX A;  4JV5 J;  4NLQ A;  4WYL A;  4K4S A;  1LWE B;  4K4X A;  2MKK A;  2CPX A;  4EFA C;  1GXU A;  3M8Y A;  1CUL A;  4X66 F;  5MLC V;  3IXQ A;  2GVZ A;  4RBV A;  4QU6 A;  1X4A A;  2WCX A;  2DPJ A;  3J81 Y;  4H4K C;  4OYX A;  1K47 A;  5F41 A;  4Y2I A;  2CAD A;  3UN2 A;  3MDF A;  2DO4 A;  2M3D A;  1XMB A;  3SQO P;  5FLX U;  2H65 B;  1ZET A;  4F4Z A;  1CG2 A;  2IA6 A;  1T9X A;  2VJU A;  3A3P B;  4V19 J;  2VF3 A;  3V6J A;  2AYB A;  3ZTP A;  2B9Y A;  1RAG B;  1VBY A;  3JAM Y;  4ZVR B;  2C2K B;  3GR1 A;  4NXM J;  4CIO A;  4C2M A;  3FVY A;  1LXJ A;  2GJI A;  2D9P A;  3WC2 A;  2EK6 A;  1RWM B;  4JI2 F;  1SUQ A;  1J2V A;  5IFM A;  1VQ7 S;  2NXN A;  1FWP A;  3M1V B;  2KVQ E;  3MM7 A;  4Y28 C;  4Q45 A;  4DSF A;  5CYJ A;  3NAI A;  5KG1 A;  1S9G A;  1IQT A;  2GQQ A;  2KT3 A;  5J1P A;  3MAA B;  1QSY A;  2YKO A;  3PJX A;  2KG1 A;  2J9D E;  2HBR B;  4ER8 A;  3QSI A;  5HAN A;  3D0G E;  4MK7 A;  3KXD A;  2HQC A;  4URS A;  4F04 B;  4NZ0 A;  4FXD A;  2UVU A;  3MEE A;  5LM7 E;  1HA1 A;  2I5J A;  1TL7 B;  4B3M J;  1UZH A;  4ZIW A;  3GQC A;  4NRT A;  4X64 F;  4RR5 A;  5E3P A;  2DRB A;  4M5M A;  3CJK B;  1S72 S;  1KTV A;  3BPS P;  5LXR A;  4KHR A;  1A0O B;  2NUH A;  1NJI T;  1FEE A;  3C14 B;  1QAI A;  1V3R A;  5GMK a;  1PIL A;  3QT5 A;  3MMJ A;  4ZPV R;  3CO9 A;  3H2U B;  4C6A A;  4ZN1 A;  5EN1 A;  4ZLN A;  1UZD A;  4CWB A;  3PYG A;  1QE1 A;  4LRF A;  3MCN A;  4RW9 A;  3HHK A;  1KVI A;  2OHD A;  4M5G A;  1VQL S;  1W7W A;  1S1X B;  4IRC A;  1OSC A;  1UEU A;  2J5A A;  4F4K A;  3VQT A;  2I8E A;  3HFZ B;  4DV5 F;  1DTQ A;  3MFH A;  2W2O P;  1M5O C;  4F4Y A;  3DDK A;  3CMA S;  4AND A;  4TY9 A;  3OR1 A;  3SCL E;  1UVM A;  2BJ1 A;  5D0H A;  1UAW A;  4IH5 A;  4GC7 A;  2BE2 A;  2EWH A;  4ZVP B;  3PW0 A;  3ZFV A;  3MWB A;  4K4W A;  1KHV A;  3HHL C;  2DNP A;  1WDT A;  3IRX B;  2G4B A;  1QAY A;  5T7L B;  5ETR A;  1N56 A;  2YWE A;  1LFP A;  1XR5 A;  4IG3 B;  3RB4 A;  2MQM A;  3W1Y C;  1HNV A;  2ZKU A;  1FVQ A;  2MJN A;  2A0F B;  4D3G A;  1JKH A;  4C11 A;  1F9F A;  3MM5 B;  1VRT A;  1PBU A;  1URR A;  4J9O A;  5E2Q A;  2VG6 A;  3CED A;  1XWL A;  3ILJ A;  3ZNJ 1;  4GKK F;  1WI8 A;  1Q53 A;  4C0B A;  2XMM A;  4DFJ A;  3NG8 A;  4M5K A;  3AFG A;  3DOM B;  2G1H A;  2JHE A;  2KHC A;  2LKZ A;  3L7P A;  3DOK A;  5E3A A;  2HLU A;  2HMI A;  3NNC A;  4OI4 A;  1KDN A;  1RTH B;  2VPW B;  2EVZ A;  1NSQ A;  2ZM6 J;  5DM7 Q;  4PRF A;  4DR4 J;  1JXE A;  3RAX A;  3CGI A;  2R7V A;  3MM8 B;  4C4W A;  1M5H A;  3N01 A;  4LF9 F;  4TLQ A;  5D0R A;  2NSB A;  3I0S B;  2RRB A;  2ZH2 A;  4EZ9 A;  3HJV A;  4ZMM A;  3VTI A;  2ROG A;  4OHW A;  1TTH B;  1CJV A;  2AJF E;  2RS2 A;  5GAH I;  3FEZ A;  3GZ7 A;  4HR2 A;  2U1A A;  2CQB A;  1C2P A;  1PAU B;  3BBF A;  5KFU A;  3SV3 A;  1G1X A;  4R5P B;  1TL3 A;  3T1Y F;  3TAP A;  1DY3 A;  1CQM A;  1SCJ B;  2DNG A;  3LAM A;  2EFN A;  3D4J A;  4X4N A;  2ALY B;  2AMC B;  3ZTS A;  4UOG A;  3LTO A;  4FP9 A;  5EWE A;  2QA2 A;  1W25 A;  1ZTW A;  4MH8 A;  1VQ4 S;  1BMQ B;  3PTW A;  1R8H A;  1NSK L;  1VLY A;  4L72 B;  4QIV A;  1RTD A;  4NLO A;  4CRJ A;  2V2Q A;  1XMO J;  4LF6 J;  3I82 A;  4BWJ A;  4LSZ B;  2DYA A;  1RAA B;  1H73 A;  2FZK B;  3GG1 A;  5KT5 A;  1S1T B;  2C3U A;  2DB1 A;  3TWZ A;  2HND B;  2NSC A;  4DUT A;  1HNX F;  1NAQ A;  2ZZN A;  1PJ5 A;  3CB4 A;  2XMJ A;  2MZJ A;  1UKU A;  2LEB A;  4GMK A;  3TI0 A;  4LMZ A;  2XI3 A;  1IKW A;  4AL6 A;  5KT4 A;  5ETO A;  4FYD A;  3TQ1 A;  1FTC A;  5J2N B;  4C3K A;  3RR8 A;  3I5B A;  2RQK A;  5L1K A;  4NA2 A;  2FLO A;  2GAH C;  4DV1 F;  4O0I A;  1LOU A;  1RKI A;  4ES1 A;  2OSR A;  2DIV A;  3MAQ A;  3Q86 A;  4KV8 B;  4JI3 F;  2XI2 A;  4PWW A;  3ZTQ A;  4J37 A;  3CO0 P;  4PWU A;  1SJQ A;  1YQH A;  5GME A;  5GAD U;  4DCJ B;  3IAM 9;  5B0B A;  2DCU B;  1SC3 B;  2DNM A;  1OWX A;  2BRL A;  3DRS B;  5IM0 A;  1ZBT A;  1B7Y B;  5C42 A;  1RWN B;  2RRN A;  4CCH A;  4DL7 A;  2WB1 D;  1OYD A;  4CYU A;  4AD6 A;  1F3V A;  1XTZ A;  2B51 A;  2JOQ A;  3NS6 A;  2ZBR A;  4F25 A;  2QT7 A;  2B9W A;  3CTR A;  2GHW A;  4TYB A;  3OV7 A;  3ZZO A;  4ECX A;  2LA6 A;  3RUB L;  5KFR A;  2OI2 A;  1RAH B;  3Q8S B;  2J6T A;  2WSF C;  1QUV A;  2LU1 A;  5F3T A;  1QE1 B;  4ED8 A;  4LF5 J;  5IQ6 A;  2E66 A;  2W2M P;  2BA9 A;  4P2X A;  3RAQ A;  4ZLL A;  3L95 X;  2MQN A;  4QWD A;  3RB0 A;  1DZ5 A;  2B56 A;  1XN9 A;  2VBX A;  2E29 A;  3QT6 A;  3RAM A;  4W4M A;  3OR1 B;  5DM6 Q;  1EB0 A;  5F3Z A;  2XMU A;  4Y2K A;  3NWG A;  2CZV C;  1YRU A;  2WVE A;  2M2B A;  4RUC A;  2X51 A;  3OXG A;  2YTC A;  1PGZ A;  3O5T B;  3PRB A;  3OT9 A;  3D68 A;  4DZD A;  1BE4 A;  2Z4P A;  4HH1 A;  3TVY A;  1NME B;  4OZL A;  4P6Q A;  3IP0 A;  1JKH B;  3M32 B;  5K14 B;  3S8S A;  4C11 B;  1RHR B;  3KJQ B;  1KQK A;  1C0T A;  2FY8 A;  1MRO B;  3ENV A;  2AJQ A;  4WXO A;  4KFB A;  2DH9 A;  4IOB A;  3GG0 A;  2AQ4 A;  1VQN S;  2OMO A;  2N7Y A;  3HLU A;  4WFN Q;  3TAQ A;  4WWS A;  3DOK B;  4TU9 A;  3M2V B;  2L48 A;  3OTB A;  2N3L A;  2OFG X;  3LW5 C;  1KS2 A;  2HMI B;  2J0S D;  3JSM A;  4DR7 F;  4ZJL A;  1NH8 A;  2YKM A;  4RNH A;  5L1I A;  3LO3 A;  4FVM A;  4ED4 A;  3IG1 B;  1N0U A;  4F0H A;  4Y6I A;  5KFW A;  1F6T A;  4RW4 A;  2CJX B;  3MPW A;  1ZM9 A;  1IBL F;  2JEJ A;  3B8H A;  5HN0 A;  1RT5 A;  3HVT B;  5EX0 A;  3TO8 A;  3CIZ A;  2FLL A;  4B17 A;  3J7Z T;  4DL5 A;  3D3B J;  2RQM A;  5DET A;  5IV3 A;  1VC6 A;  4RW8 B;  1PYO B;  1U0H B;  1DAX A;  1TL3 B;  3V4I A;  2LDI A;  4WCE Q;  3TJA A;  3H20 A;  4OIX A;  1RAB B;  1M1G A;  2XYG B;  2N82 B;  1WJ9 A;  3HFV A;  3Q8U A;  4B3T J;  4YY3 J;  5CD4 A;  5EUH A;  1C0U B;  2ZHB A;  2BMB A;  2JEG A;  2DEI A;  2ZH1 A;  3HVR A;  1A9N B;  2WRM A;  2F4V F;  1N34 F;  4NLG A;  2R42 A;  1HFE L;  2KU7 A;  2IBK A;  1X4C A;  4D3H A;  1UJ5 A;  5LMU J;  1Q5V A;  2R9L A;  2W9B B;  5KFX A;  2HNZ B;  2WBR A;  3M8Z A;  4W92 B;  3HZG A;  3NOG A;  5T14 A;  2C2N A;  3GYG A;  4ALZ A;  2FHM A;  2BE9 B;  1BWV A;  4F02 A;  2A2C A;  1CBK A;  5ETM A;  4B9T A;  5IOL A;  4USW A;  3PX6 A;  4CLY A;  1SJ4 P;  3V81 A;  1MSW D;  2NXE A;  2QA4 S;  3NGT A;  4AXJ A;  4A47 A;  5KT6 A;  2YNI A;  9RUB A;  4B9S A;  3FRY A;  2ZOG A;  2IVF B;  2E5J A;  1AYE A;  2QC3 A;  1NUE A;  4YP3 A;  2X1F A;  3AJ1 A;  4CLS A;  3H5X A;  1FX2 A;  3L7U A;  4IFV A;  1GTH A;  1H0H B;  2YH1 A;  2WON B;  1JLE A;  1XK8 A;  2BDP A;  3J81 U;  3UDE A;  5KOX A;  3KUH A;  3P49 B;  2NQP A;  2WSC C;  3BBB A;  3QWP A;  5B09 A;  4PR6 A;  3NNA A;  2Y1L B;  3QIP A;  2QMX A;  3WIV A;  5HQL A;  5EWF A;  4OHV A;  2MJU A;  2VBZ A;  3GCX P;  1SJ3 P;  3JAM U;  1YSJ A;  1WC3 A;  2DIT A;  2LFV A;  2IM2 A;  1N48 A;  4DX5 A;  3OXF A;  3DRX A;  1LQ9 A;  5DG7 A;  1R3N A;  1RLC L;  4RKU C;  4LF1 A;  3Q89 A;  4OV6 A;  3VWS A;  3ZZU A;  2ROE A;  3G4S S;  1BQN B;  4PWD B;  3GPA A;  2HWH A;  2VQE F;  2MQ8 A;  1WC4 A;  4KGV B;  3GP9 A;  5B08 A;  1V9O A;  1XER A;  5AE1 A;  1F5A A;  2NLW A;  3LP0 B;  2LYV A;  3DLK A;  1SJR A;  1Y00 A;  3CJS A;  4TYA A;  1CSJ A;  4W98 A;  2G2Y A;  4YDD B;  1JJH A;  1N8R T;  4J9S A;  5JUM A;  4RO0 A;  2LA4 A;  3CT9 A;  3ISN D;  5KAK A;  4AT1 B;  4Q43 A;  3MR7 A;  2D1C A;  1ZM2 A;  3UNY A;  5A2Q Y;  3MM6 A;  3CCV S;  1FDD A;  1CEZ A;  2M9K A;  3H42 A;  1X5T A;  3BGR A;  3ITH A;  4Q2L A;  3D9B A;  3UD4 P;  3P5B P;  3TZY A;  1KR4 A;  3JSM B;  1X4E A;  2MSS A;  1KHW A;  1PAE X;  4F4W A;  4NCA A;  2XC9 A;  5KTQ A;  4DQI A;  4DXL A;  1S1W B;  1RGV A;  2D3U A;  5HMX A;  3CE8 A;  1U1P A;  3FBF A;  3NP5 A;  2FVQ A;  1WHW A;  4NXN J;  2CPF A;  2HFU A;  2F8M A;  4ETX A;  3BJY A;  1P1T A;  2AGQ A;  1UCN A;  2AT1 B;  1X7V A;  2IPO B;  3KK2 A;  1RT5 B;  1I1G A;  1WC6 A;  3H5U A;  2JFK A;  1YKW A;  3M05 A;  4DV7 J;  1K44 A;  3VGS A;  2M88 A;  2KI2 A;  2D69 A;  3CJ2 A;  2Y9H A;  5GAE I;  2M8D B;  3ENQ A;  4DU8 A;  2UUC J;  4Z37 A;  1IBK F;  3M6V A;  2GQ2 A;  2H54 B;  3VHQ A;  2FQQ B;  2P9C A;  2R7S A;  3U02 A;  4CM0 A;  4F4A A;  4WII A;  2J8A A;  4C8M A;  3MTJ A;  3UDL A;  4BHQ A;  3HMJ G;  1HQE A;  5CYQ A;  3MR2 A;  2BBE A;  2M8H A;  5K9F A;  2HWT A;  5HMZ A;  3NAH A;  3SCI E;  2ACM A;  3I31 A;  4LVN P;  3P6Y C;  4HTI A;  3THP A;  4DF4 A;  5HLF A;  3GON A;  4NEZ A;  2CKW A;  1CLF A;  5I3P A;  1ZAV A;  3W8G A;  4IRK A;  3R9L A;  1VQK S;  3H98 A;  4UST A;  2A6O A;  4ECW A;  4XDC A;  4ILL A;  2FUG 9;  1TMM A;  3THT A;  3W7B A;  3QID A;  2IY5 B;  4YB6 A;  1X4G A;  1BHN A;  2A3J A;  4IO9 Q;  3BO2 A;  2VU5 A;  1OQ3 A;  4KAI A;  3M8S A;  1CC8 A;  4N41 A;  4LRB A;  3NGD A;  5KFT A;  2CNK B;  1N6Q B;  2HQ3 A;  3V81 B;  2LXU A;  1NJW A;  5GAG I;  4HT7 A;  2FHJ D;  3CVK A;  4NZ6 A;  4YB7 A;  1TMJ A;  4DV6 F;  1NK9 A;  4CNY A;  3HHN B;  1VOM A;  1JB0 C;  4NLR A;  2BM1 A;  5J1E A;  4WP9 A;  2VKR A;  2FGO A;  1VQ8 S;  2YH0 A;  3CDW A;  5H9E K;  3T1A A;  2V6A A;  1VRU B;  2R2R A;  3M8P A;  3J7A N;  1FXD A;  1MN9 A;  7FDR A;  3PHE A;  3OW2 R;  3ZZZ A;  1NKC A;  2OD6 A;  5A8K B;  3ILO A;  1QUP A;  2K1R B;  2WOM A;  4KT0 C;  5KFB A;  5D3G B;  1WOO A;  5KFQ A;  1FNM A;  3FC9 A;  4ZCI A;  1REV B;  2ZE2 B;  2GGP A;  3QIP B;  2CQ2 A;  5KFM A;  1LWF B;  1XC9 A;  2A10 A;  1X4H A;  3B4M A;  3BGF A;  1N5T A;  4KKO A;  4NI2 B;  4AL7 A;  1SKU B;  5KFI A;  5HVF A;  4DV3 J;  1CPZ A;  1HYS A;  3UN5 A;  2ILZ A;  4Q0B A;  1RT6 A;  2HHV A;  1UVI A;  2QO3 A;  8ATC B;  3GJS B;  1WKL A;  4DOZ A;  3OR2 B;  4DJB A;  2KXN B;  1D9A A;  1BWE A;  2OEJ A;  2JLG A;  3EXY A;  3LUY A;  3DU5 A;  2DVI A;  1EIY B;  1NH7 A;  3TZW A;  5IC4 B;  5A6P A;  4N47 A;  2L41 A;  4CO0 A;  4PYA A;  2HIY A;  1VC5 A;  1T05 A;  3MPU B;  1FA0 A;  1C1C B;  1KFS A;  2DGO A;  3JSB A;  3UDC A;  4K2J A;  3QPI A;  3BSN A;  4MTP A;  5KG5 A;  4C0O C;  3LAK A;  4DL4 A;  1MG7 A;  1U0S A;  2CWK A;  3OTC A;  2VQF J;  1T9T A;  1HQU A;  3TZX A;  1S7I A;  5DZ6 A;  1T9Y A;  1S1V B;  4F36 A;  3IMQ J;  1PJ6 A;  2WSE C;  4I69 A;  4ZK7 M;  4QCL A;  4FKY A;  4JI6 F;  2F8H A;  4J7C A;  3HUL A;  1GXL A;  2DNZ A;  2HHT A;  3ITH B;  4DV0 J;  1R27 B;  1YRX A;  3DGV A;  2PDA A;  2AEM A;  1DUR A;  1NXI A;  4HYK A;  3JQK A;  5EWG A;  3ET6 B;  4N7T A;  2V0N A;  2UVV A;  4M1K A;  4KE5 A;  1R89 A;  3UNG C;  2UUW A;  4X65 J;  1KNZ A;  3NBP A;  3MUV P;  3M30 B;  4DUZ J;  3BKU A;  3MD1 A;  1G6B A;  2EPI A;  4YHH F;  4EO8 A;  4KH1 B;  1HR0 F;  3EPI A;  3D6F B;  2FVS A;  2GA7 A;  4WTY A;  4M8L A;  4BCA A;  4IH6 A;  2YWW A;  1C1B B;  2N7C A;  4NML A;  1YIT S;  3QAU A;  4DLG A;  3AA8 A;  4PEO A;  3TAM A;  5L8R C;  1SL0 A;  2VON A;  4FNH A;  3T1H F;  2EFG A;  1F9E B;  1DQ8 A; 
#chains in the Genus database with same CATH homology
 2K06 A;  3EWG A;  1M1G A;  3H7H B;  3QQC D;  1NPR A;  2XHC A;  2LQ8 A;  4ZN1 A;  1NPP A;  2OUG A;  3P8B B;  1M1H A;  3LPE A;  2EXU A;  4ZN3 A;  1NZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...