3FC9A

Crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fc9A00
4DUTA 4UOFA 4S0MA 3VGUA 1NSQA 1UCNA 1W7WA 3VGTA 1NB2A 1XIQA 2NCKL 4ANEA 1BHNA 1NSPA 4FKXA 1B99A 3DKDA 3GPAA 1ZS6A 1S57A 1LWXA 3BBBA 2HVEA 1MN7A 1XQIA 3G2XA 3BBFA 4WBFA 3B6BA 4F4AA 3FCVA 5IOLA 4FKYA 2B8QA 4KPCA 4UOHA 4ANDA 1VYAA 3EMTA 4ANCA 3VGVA 3FKBA 3BBCA 2DXDA 1PKUA 3Q89A 3FCWA 3Q8UA 1JXVA 3NGTA 2AZ3A 1NCLA 4EK2A 3VGSA 1NLKL 3B54A 5CAAA 1B4SA 3NGUA 2VU5A 3ZTQA 2AZ1A 1NDPA 1K44A 3FBCA 2B8PA 1HHQA 3ENAA 2DYAA 3NGSA 3FC9A 1HLWA 4F36A 1BUXA 3DDIA 3FBBA 1S5ZA 1PAEX 1NDKA 4DZ6A 1NUEA 1HIYA 1S59A 4ENOA 3EM1A 3FBEA 4W98A 3ETMA 3GP9A 3Q8YA 2ZUAA 3Q86A 3PRVA 3BH6B 1EHWA 1NHKL 3BH7B 3VVTA 2DXFA 3ZTOA 3FBFA 3L7UA 1U8WA 1NPKA 2BEFA 1LEOA 4O0NA 3VVUA 1WKKA 3EJMA 2DXEA 3EVMA 1WKJA 1NDCA 3Q83A 3WX8A 5BXIA 3MPDA 1KDNA 3ELHA 3Q8VA 4HR2A 3ZTPA 3EVOA 4C6AA 3ZTSA 1MN9A 3NGRA 1F6TA 1WKLA 1NDLA 2HVDA 3EE3A 5CABA 2BX6A 2HURA 3EVWA 2DY9A 4CP5A 2CWKA 3R9LA 3PJ9A 5C7PA 4DI6A 3JS9A 3ZTRA 1F3FA 1BE4A 4UOGA 1NSKL 3EICA
chains in the Genus database with same CATH superfamily
2W9BA 3AA9A 2DGOA 1RAEB 3O1LA 2XWYA 4N7TA 5ETOA 3GR1A 4I6YA 3RUBL 3KLEB 2AJ2A 4HYKA 3AXKA 2AJQA 4AYBD 4MIWA 3UWTA 1H2UX 4ZN3A 2ZJRQ 2IIHA 2AQ4A 5LL6d 2I6WA 3GIMA 4BDPA 1IKXA 3WQPA 2J76E 3NWGA 4WU2A 1HWIA 3PY8A 4B9TA 3EDQB 1WORA 3DKDA 3MPVA 5DZ6A 3OJSA 1IBKF 2RQKA 1SKWA 1K0VA 1TFYA 4R25A 3GILA 3G2XA 5HVHA 5D0GA 1RT6A 2E9ZA 4DL2A 2MKYA 1KFDA 2NSBA 2V8DA 4NLSA 4U9RA 5ETRA 8RUCA 2VJVA 2F63A 2UVRA 1KHWA 3FQKA 3K8VA 5F8NA 3H59A 4A46A 2HRYA 1B0TA 3EWGA 1R27B 3IR6B 4OFZA 4WTYA 1RK8A 3TNVA 1XMQF 1UPMB 5E41A 2O66A 2EG2A 2GCFA 2OPQA 2J8SA 4C48A 5KT7A 3V6DB 2W4PA 3OV7A 3MD3A 2QEXS 2HFUA 2DR9A 1VQYA 2NYHA 4K7QA 4HDHA 3B54A 2MHEA 3CDAA 2E44A 4IFYA 4YR2A 4ZVRB 2RDJA 2RF2B 2GS8A 2L9WA 4ZJLA 1RACB 4RW4A 1TFWA 1UVJA 1YITS 1RLDA 1FFGB 2B8PA 3BSOA 3MHYA 4A8KA 3P3DA 1LW0A 3NS6A 4URQU 4C2MA 3TZZA 3KK1B 4FP9A 3TRGA 2ZNZA 3NGSA 3FC9A 2HLUA 4F8RA 2UP1A 2I5JB 2EPIA 3B8HA 3CMQA 3DDIA 3HSJA 1S5ZA 3MEGB 4YB6A 3JTPA 2XS2A 3MR5A 4C11B 2HVHA 3U7JA 2LU1A 3MPYA 3CJSA 3LW5C 4U6PA 2XS5A 3A1YG 4M1KA 3ILOA 5LSRA 1M5HA 3BO2A 1X4FA 3GP9A 3R5DA 3RB4A 2UXBJ 2FHJD 3M2UA 3H42A 1MWYA 2JC1A 3OFEA 1FJCA 1DJ0A 3QIPB 4D3GA 4JP8A 1CJTB 2GJIA 2NXCA 2NYIA 1J5OB 1P27B 3TUJC 4B3TJ 4NA2A 1SJQA 2M0GB 2UXDJ 3CDWA 2HIYA 3KHHA 2ROPA 3SSQA 3GG0A 4L6V3 2XB2D 1EJ7L 1UA1A 1UJ6A 2X1GA 3C16A 2ZE2A 4LRAA 2N7CA 4DUYF 1BLUA 4O0IA 4DSLA 2YTCA 2C3YA 1PC4A 1FNOA 2VBYA 4KSEB 4ED2A 2Y1RI 2HWIA 3D6MB 4RNNA 4TYBA 5JMNA 1YJNS 5A8KB 4NXMF 1KOHA 1JLEB 2C2OB 3NGRA 2AX0A 3U1MA 4K4SA 2V4QA 4UT4A 3CPWR 2CPXA 1N33F 4X2BA 3CTRA 3VF0B 5H9EK 4DV6J 4ZHRA 2DY9A 3I4HX 3US5A 3TEGA 5D6GA 4F4XA 2DRAA 4ZPBA 3LTOA 4RL1A 3TOQA 2CQ4A 2HNYB 1ZAVA 3W64A 1NJXA 5KFQA 2FVSA 4XPCA 1OYDA 3UDVA 5C2GA 4R5PA 4IRCA 3LPYA 3VQTA 1FXRA 5A0YB 2DGVA 5DLGA 4WIIA 3UDCA 5DDPC 4DV3J 1WHVA 3HVTB 3BPSP 1NH8A 1T7PA 4DV6F 4WFBQ 5L38A 2KTQA 2YKAA 2WVFA 1UJ5A 3HHLB 3MEEB 1S99A 5THWA 2MQOA 2H4WB 3RJMB 1JJ4A 3CDUA 1YWXA 3T9ZA 2KZMA 4ANEA 1N0VC 2W1BA 4Q2MA 1CJUA 2DY1A 4ZS6A 4QR1A 2YKQA 1RTDB 5AE1A 2HRUA 3E8OA 3E51A 4Q0BB 1B7FA 3BBBA 4ES3A 2ASLA 1HHTP 4TVAB 1U6BA 3DRPB 1XQIA 2BYCA 4ICLA 1D8ZA 4J9OA 2CJQA 2OTJS 4I68A 1VK8A 1JLAA 1TL3A 2FGOA 3DRSB 5L1LA 1TUGB 4IG3A 4UQGA 1OWXA 5DM7Q 1AT1B 3LQVA 2CNNB 2V4JB 4IYQA 2I2YA 3JAMU 3T6BA 4FPIA 1O6XA 3MMBA 2HQDA 1DAXA 2HFSA 2DNNA 1OY6A 4LUBA 4W4MA 4ZCMA 4ZKAA 5F8MA 3CC4S 2FHKA 1VC6A 2C2KB 2J8AA 2LMIA 4M94A 2CWXA 4BWMA 4DDFA 3W5YA 2HS0A 1FKOA 1Y3JA 1RZMA 1ICEB 2BKPA 2MKIA 3PIPQ 1SL2A 2UUAF 1F2HA 5C2CA 2N3OA 2LP4A 1HBUA 4I4BA 4LBPA 4ZCLA 3KLHA 3S1TA 4ED0A 4QR2A 3ZXWA 4IOAQ 3R6GB 4GKKJ 4JV5J 4EYIB 4GKJF 4NA1A 1M0SA 1N88A 3MD1A 5HMZA 2L9DA 2AZ1A 2NUUG 4IR1A 1X4CA 3SQGB 2EW9A 2VBXA 4ZLPA 1H72C 3M7VA 4IDKB 4PR6A 5J2PB 1KN6A 1VHFA 3E2EA 1RSCA 4DPWA 2AYGA 2OAUA 2F4VF 1VQSA 4ZCKA 3RB0A 4N76A 1DQ9A 4RBVA 3ET6A 2BANB 2OD4A 4H4KA 2UV8A 1RDRA 1KEKA 4USIA 1JLBB 1NDKA 3N5BA 3MM5B 3TW0A 4ENOA 1IM6A 4Y34A 1RUSA 2QLXA 4NZ7A 5KFGA 4FS2A 1TELA 1HARA 2AJ4A 3AD8C 1X0FA 2HZCA 1CJVB 3PYGA 2HK3A 4H4MA 1CEZA 1TMMA 2A3JA 3DRRA 4KH1B 4Y28C 5G0RA 3T5JA 4PEOA 3P5TL 2CNKB 3Q86A 4YB7A 4K4VA 3GCXP 1TZ0A 5L1IA 2V5HG 1JKHB 4UW2A 4WU3A 1ROFA 5K5MA 1YRUA 1JLGB 2HNDA 3BDEA 3OL7A 3MUTP 1S9EA 3TAMB 2Z2MA 3PX6A 1U8WA 3QLHA 2E1PA 2E9TA 1VQ4S 4B9NA 2B51A 3QGIA 4I7FB 3LF0A 1V3RA 2YPYA 4CM2A 3TI0A 4JI4J 4F4WA 2ZZNA 3BQ0A 3MDFA 1TKXA 1FWKA 1WSVA 4Q8EA 2ZH7A 4A8SA 4J9NA 3OL8A 3RRGA 1M5PC 5H9FJ 1NK9A 1RHMB 3C2PA 1L3KA 4PG6A 1Z1ZA 1FVSA 3D3BJ 2MY8A 2MKJA 3M05A 2W01A 5A8WA 3VAIA 1VQPS 4I67A 1TKZA 4AUKA 3TA0A 1KLMA 1WSRA 1IBMJ 3HSDA 3Q23A 2FTRA 2G0JA 4JI2F 3EVWA 1D8YA 2HMIB 2EFQA 2GJFA 1I94J 4NZ0A 4LVOP 2OLWA 1CJKA 1JB0C 3IGNA 2IDLA 1IKWB 4IUFA 4ZPTR 4JI0F 4JI8J 2AHOB 5KFIA 2ALYB 2D3ZA 2OPRA 5IWAJ 2LEBA 4ERDA 1IKVA 1FRXA 2NZ4A 2PMZD 3B82A 2VODA 2EC2A 2JSXA 3QT5A 1NJYA 1F3FA 2HQFA 4DL3A 3DOMA 1IBMF 1TKZB 4OLOA 3PO4A 4PUOB 4Y2AA 4ATNA 2XI3A 5HN0A 2DPIA 3G6XA 2ABYA 2HHWA 3UD5A 3JQKA 3ZZYA 3HFKA 3IC1A 3M8ZA 2ZH5A 2BQUA 1N33J 1UCNA 5KFZA 4X4RA 2ASJA 2Y1IA 3LOUA 3P45B 1SPBP 4FS1A 4JI3F 3VGTA 3UW1A 3QJLA 2RRNA 1X9MA 1JLEA 1HBNA 4JI5F 4LF5F 4NCAA 1VOMA 4RPFA 3IMQJ 5A0YA 2P6SA 3HZEA 4G1QB 1M90T 1VISA 1YJVA 4UZCA 2UVWA 4B3SF 4KAIA 5H1SV 2V0NA 2XMUA 5BYSA 2YBVA 4EUVA 2E5LF 1FKPA 1MN7A 2KXFA 4O3OA 3G96A 3LGNA 4HEA9 3W9HA 3KLGA 2YWGA 4WWSA 1WHYA 1UPPA 3NEKA 3GR0A 3NS7B 2HS3A 4ETZA 2BM1A 2G0IA 4NLXA 2YNGA 3BQ2A 5B0CA 2WVDA 4NCGB 4M5NA 2MGZB 3FKBA 2XMTA 4O4GB 4U96A 1FERA 2F8HA 4DX5A 1QAYA 5KT2A 1OYEA 1VQLS 4M5DB 3ZZ0A 3DLBA 2VOOA 2DT9A 3OJUA 3NCRA 2PFDA 3AOCA 1BGXT 1YG0A 5KTQA 1F5BA 1E6VB 2OO4A 3OT9A 3OTDA 2QYGA 3M9MB 4DSKA 5SUHA 3TX8A 5KT6A 3L7PA 3GFXA 4CYUB 3AY0A 4IO1A 3H40A 2CXEA 3HZGA 1C0TA 3CJ3A 3KUHA 1S77D 5D3GB 1VCTA 6FDRA 1QDUB 3MPWA 3LP1A 1AZSB 1HBMB 1YLXA 1O8BA 2QL7B 3CW2C 4ID5B 5CD4A 3GFYA 2MSSA 3KLVA 2XCPA 1XJWB 3PNIA 2YKOA 3NL0A 4R0EA 3I9ZA 2HG4A 2DD8S 1CJTA 5F8HA 2BJ3A 3AB4B 2YNFA 4M5KA 3MEGA 1O51A 4C8MA 2FLNA 2QFJA 5B0FA 3JQMA 3CCJS 4Y2MA 2WTFA 3HCXA 2ZVIA 3OR2B 1WDTA 1V3SA 5L9XA 4A8XA 1NJIT 3MM6B 4P10A 5FLXY 4NLWA 3CC7S 2Y9HA 4LFBF 2DGXA 2LU2A 2DGWA 4BCAA 2RKIA 5HLFA 4V19X 3BH6B 3EGZA 2MLXA 3BH7B 1S0OA 5KFHA 1HNZF 4QYRA 2XEXA 1YVFA 4LF9F 1RT2B 2AKWB 5C42A 1ZA1B 3CO9A 1SC1B 1LEOA 1QAXA 3BO4A 4ETXA 2B5JB 2A2DA 2GO9A 1BD6A 5FLXU 1VGYA 1XN9A 2R42A 2DR8A 3N0VA 4DV1F 4NASA 3ZTPA 4DL7A 1JKHA 4ZVEA 4Y65A 4I2QA 4HDGA 4RO0A 1VQ6S 3BGRA 2L9NA 4XDDA 5DETA 4ZP7A 2C3OA 4FVMA 3AJ1A 1T94A 4LF8J 3MM7B 1UVNA 2WW4A 2BJ8A 2UV8G 4H4MB 2IVYA 2DR6A 3HDSA 4OX9J 3PYEA 3TARA 1F9HA 3KLEA 3TA2A 4OYOA 1NMEB 5LJ5Y 2XY5A 2CQBA 1R8BA 3J81Y 4X64F 2W9CB 1IVZA 3BR9A 4KGKA 2P2CB 2MDAA 1HMVB 1HYSA 1RT2A 5C42B 2DPJA 3Q8QB 4E2FB 4R0JA 1R6YA 5IM0A 3IGVA 4L74A 3ZZOA 3UCUP 1WHWA 3BKUA 4K4XA 3HHLD 1FRLA 1KTQA 4I7FA 4CH7A 5EDWA 4OLPA 2COLA 2ZZMA 2HMIA 4KE5A 3D66A 4IQMA 4EGLA 1QAJA 4IO9Q 1HI1A 4L72B 4YHHF 3BKTA 4K8RA 2XLKA 5F8JA 2VG5B 1IKYA 4FDFA 5KFVA 4C3KA 1N54B 3JSMA 1CULB 1UVKA 4IH5A 3ZZPA 3N9UC 2W4DA 4JV0A 1LFPA 1U02A 4M5GA 1HQ2A 1VDHA 1RWXB 1OSCA 2R8KA 4ED5A 2DO0A 3GJRB 3HVAA 3MECB 3CO0P 4U7UK 2QL5B 1ZM4A 4DF4A 3SCIE 3ZNUA 3TUPA 2R7VA 1VK3A 3KLIA 4USMA 2HKEA 2IBKA 2V2VA 1NK0A 1QSLA 2KRRA 2ZBCA 3Q2TC 1N56A 1SJ3P 2ZEJA 4FF2A 4IOCQ 1ZPVA 1GMUA 2CJBA 3AQOA 5IOLA 2FLPA 4FKYA 4NYOA 2VG6B 4DR3F 4M5HA 2HHSA 1K0TA 2AEMA 3BKFA 1JLAB 4PG5A 4AE5A 4FXDA 1S6PA 4MKAA 1RA7A 1U0SA 1WWHA 4KHPF 1TU0B 2R2TA 5B0BA 1UZHA 4YFUA 1Y7PA 1S6OA 3CSKA 1TL5A 1RAFB 4OIXA 2QA4S 3ILJA 4LQ3A 2CJXB 3KK1A 4EK2A 5IT0A 4ECXA 3QATA 2F8EX 3IG1A 2ZKTA 4M95A 2MXYA 1N32F 4WFXA 1NK4A 1CC8A 3TJ9A 1FI4A 1WOSA 5HJYA 3WIVA 3J7YI 5A8RA 1HNZJ 1H7WA 2FHOB 1TKDA 2E7XA 3TWZA 3CD0A 3QWUA 2VC0A 5B0GA 3UVJA 2OPPA 3NCQA 4CO2A 5B09A 3RRKA 1GNKA 4PPZA 1NDPA 3W2VA 2MKKA 1K44A 2CPHA 4UUXA 4O3QA 4QW8A 1FK9B 3CCVS 4YB1P 4NI2B 3GIIA 4C8YA 1H3DA 1JLFA 1RGVA 2V4RA 5K8MA 2DGQA 3VAFA 1NM2A 2KYZA 2RH3A 1NUEA 4G1IA 3DLEA 1SVDA 3IBWA 4CLUA 4CCHA 1KLNA 1KTVA 1TVRA 3FZ2A 2EBGA 4ELUA 1WTBA 2DNKA 2EC0A 2K1RB 2OSRA 1JWWA 1UP1A 2DO4A 3GYNA 1DLOA 4OZ0A 3W62A 4KHPJ 3POTA 2H4YB 5F9NA 2FDNA 2W2QP 4KT0C 4PG4A 3JQJA 1Q95G 4ED4A 5E7OB 3G71S 3IM8A 3T5LA 1DFDA 4N47A 2LXUA 5HQLA 2DJWA 1VIOA 3M32A 3QNWB 3Q8RB 5KFBA 4FYDA 2XNRA 2HNDB 2BZ2A 2OPRB 3FBFA 2PMHA 1GT8A 4BWJA 1HNIA 3DGVA 3W7BA 3UO0A 1PC5A 1LKZA 1NPPA 2VFVA 4WYLA 3MUMP 3HVWA 3LP2B 3DU6A 1QUPA 1S1TB 4X4VA 2WZ1A 4N8OA 2K06A 3OTOF 2RKIB 1RAJA 2IM1A 5J2QA 1X9WA 3PO5A 1FXLA 1D09B 2MZRA 1CPZA 4LT6A 3GE9A 1NZ8A 4U67Q 3M6VA 5AXLA 4O44B 3M1VB 4ED3A 4LF7F 2RUSA 4OYXA 2V94A 3NGDA 1CQMA 3V4IA 3FEXB 3M30A 5I3UA 1NXIA 3V6HA 5GAGI 2U2FA 4HKQA 2FIUA 2VOPA 3X1LB 5CXTA 2HK2A 2ZHAA 2QZ8A 2K7JA 2EI5A 4RWWA 2FZGB 4Z37A 1IWAA 3HI9A 3KJVB 4DN9A 2B7BB 4C8KA 1H0HB 2J7UA 1K1SA 1S6QA 4EYHB 1MMDA 4HLBA 3OLAA 4OYAA 3M6WA 2RQMA 3CCTA 5K14A 4CTAA 4UOGA 1RKIA 4C3MA 4WF9Q 5CCLA 4LF8F 4YOEA 1QAIA 5IC4B 5HATA 2QT7A 3VGUA 3PHTA 4NCGA 1NNDA 2BW2A 4G65A 4QR0A 3CMAS 1CBKA 3BO3A 1W7WA 2F65A 3AH6A 3M32B 4LSLB 3DXSX 3AOBA 4DJBA 2YQ3A 4JV5F 3TZWA 3A3PB 2JNJA 3MAAA 4YEAA 5IM0B 3OFGA 4EZ9A 2KVQE 1VQ9S 2H5EA 1NH7A 4KQZA 4N56A 5ADZA 4PG8A 4HHHA 2D9PA 3MGJA 1S57A 4WZQA 2PFFB 4MK7A 5CYJA 2W9CA 1Y11A 5IV3A 5F8GA 1D1UA 2V9WA 2MZSA 5AJ3J 3GB0A 2YKNB 3CWJA 2LCWA 2ZD1A 1D0EA 3I55S 1EP4B 2I9SA 3RR8A 1IN0A 3PX0A 1B70B 3FRZA 2R2RA 2NR0A 4YUDA 3FFIA 3M8PA 4ZVOB 4EEYA 1DTTB 1PKUA 4O23A 2ZBIA 4RKUC 2ZC4A 1WG4A 1JXVA 3OHAA 2BACA 1ZBTA 4N77A 5FDLB 3ONQA 1S76D 2BW7A 3VGSA 3CNQP 2DNPA 4ZPWR 1EP4A 4JOUA 5CAAA 1AUDA 3MUVP 3A8KA 1RTDA 3ENVA 2NPFA 1EX8A 1U1QA 1VLYA 5SZTA 3K5PA 3KLFB 4K4YA 2QLWA 1X7VA 2HNYA 2VG7B 4DX7A 5J2NA 3QLHB 5K8PA 2L08A 2M9KA 2QA1A 5KFMA 2MHNA 3UD4P 2EEYA 5F8IA 2IM2A 1M1GA 2X1AA 2CPIA 2FQQB 2ZWPA 3OBIA 1XMBA 2WK4A 2DEIA 1N32J 2BJ7A 1O5JA 2GZOA 1JJCB 1RB0A 5D4OA 2V69A 2X1BA 4ED8A 2KXNB 1UAWA 2FZCB 3C6UB 1FE0A 5E3QA 2CDRB 2AJFE 3FSYA 4RWXA 3TVZA 3M8QA 3NP5A 3O8WA 3PJWA 3CUNA 2ZUAA 2GMJA 3H90A 1N0UA 1S6UA 2HEKA 3SEOA 2UUCF 2J9EA 2N7YA 4B02A 4DCPB 1TP7A 3DGPB 4WFNQ 2H5JB 2JDJA 3GFZA 2XM3A 2PSZA 3M6XA 1SKUB 3RBDA 5KFYA 1ZTTA 3P6YC 3L7OA 4O0NA 4HI2A 4EI2A 2UU9J 2QMXA 3MFIA 4MK9A 4F02A 3HHNB 5T7LA 1YBUA 3S7RA 3P49B 2HFOA 2QX0A 2WB1D 2B6AB 4IFVA 2VFTA 3D54A 3HT0A 1Q8IA 1T0TV 4G1PA 2BDPA 1CS4B 3DLKA 1TTHB 2RIJA 1RTIB 2NLWA 4C98A 2EK6A 5EWGA 1JJHA 4HH0A 2VF3A 4OYPA 4PZVA 5KOWA 3QSYB 1YJWS 1FDBA 3D0IE 3KWMA 4WXOA 2CG4A 3UN2A 3S6EA 1K1QA 5GAGU 3AB2B 1ZM9A 3VALA 1IBLJ 2K3IA 2DVIA 2BOPA 1EB0A 1YJTA 4I69A 4K4WA 5F3ZA 4DS5A 2FJEB 3KJNB 1U6FA 1SL1A 4CH0S 5BR8J 1U45A 2R7OA 2E5JA 1EKRA 3DOKA 4OZ3A 3MMCB 1J27A 4K2JA 5L9NA 3ZZUA 1S48A 4IDKA 2YQ1A 2E1RA 2XC9A 1SC3B 3CMES 4ZMMA 4NRUA 3FDSA 4AQYJ 4DX6A 1C1BB 3EDRB 1IBLF 3WIUA 5KOXA 1R43A 3MAHA 2YWEA 1FNMA 2GVDB 1FO1A 2W8LA 1DQAA 2OFGX 2RNEA 3MTKA 5HI7A 1DHMA 2CPZA 2ILYA 3Q24A 5KFSA 1PG5B 1SV5A 1KQSR 2DH7A 2F9JA 1C4CA 4ZVGA 3W9JA 1ELOA 2FZKB 2IRXA 4FKXA 5L1KA 2C3MA 3GPAA 1DBDA 3O44A 5IC6B 3IP0A 4QWEA 1GMVA 1TKXB 5GADI 1HWUA 3DLJA 1C1BA 4ZITA 3C19A 3ADAC 3J80U 1RT5B 3M8RA 3L09A 2F40A 2GVZB 2NS1B 3TAPA 4A4JA 3GJTB 5K9FA 1F2GA 2QMWA 3HJFA 2XYPB 4MYUA 2IA0A 2YX4A 3OXFA 3SZ2A 1BWVA 3EMTA 3UNYA 1SXLA 2XO7A 1J5EJ 1SJFA 2O1PA 4FNIA 2IM3A 2IYGA 1P9QC 4JB8B 3AJDA 2OTLS 2JHEA 1UWAA 4DV2F 2KZZA 4J9KA 2MY7A 3BN4A 4FYVB 2FJVA 2UVVA 1LK7A 3C3LA 4FF1A 3FCWA 4YR0A 2F5GA 4TN2A 2WCXA 4PKDB 4IOBA 1KLMB 4PABA 2DHSA 2R7SA 2ZDPA 5B7WA 5F9LA 3CIMA 4CO4A 3OFHA 1S4FA 2EXUA 5CYQA 3IG1B 5DS7A 2KRBA 4LF9J 4OI1A 2A6OA 1PYSB 5ETLA 3OFFA 5H9FK 4KFBA 2VU5A 5GVQA 1L3VA 2WBMA 3A12A 4Y3CA 4XPEA 3H5YA 3R6LB 2ZH1A 4WE1A 4WJBA 2GHVC 4C8LA 2D9OA 1M5KC 1WOPA 3M8WA 1WF2A 3MEDA 1C1CA 5HROB 1RT7A 2WOMA 3QQCD 1L5UA 4OZLA 4JI6J 2DHHA 3KMSA 2DR5A 1NHVA 3G6ES 1WG1A 4CO1A 1MROA 4ELTA 4HACB 3QIPA 2XQCA 1F60B 1Q53A 3T5HA 3HM9A 2MKHA 4C8NA 3SCJE 1K9MT 3D6HB 2CKWA 2UUAJ 3N5FA 4CLYA 3MM9B 3TANA 3DOLA 2DR7A 5HL7Q 2M8DB 3AD7C 3BSCA 2OIHA 1RT4A 2WW8A 3RU0A 4I0WA 1HL6A 2YWWA 4TQSA 4X64J 2ZZTA 3LP2A 4J9UE 2W2PP 3EXCX 2HHTA 2P9CA 4LBIA 5U47A 1KVIA 2HAIA 1NHKL 1LFWA 2CJ9A 5KAKA 1CG2A 3BF4A 1R0CB 1TKTA 1U1NA 1RT7B 2DHXA 2NPIA 2WOMB 3JXOA 3KG1A 4I56A 5KG1A 5BJRA 2BM0A 1GFWB 3LGHA 2J9DE 4LRCA 3W9IA 1JNZB 3SIPB 5KFJA 1OQ6A 3OSNA 4O3RA 2HHXA 1UFWA 2OUGA 3EGWB 3LUYA 4R8UB 1WC4A 3OXGA 4UF4A 4LF6F 2ZJQQ 1C4AA 3G6YA 2V2ZA 3ZTSA 5EWFA 3EPIA 1IQTA 3QT8A 1S9GB 2EKNA 3EE3A 3AFGA 2SXLA 3MM6A 1BQMB 2HBYB 1SH2A 2GX8A 4PXCA 1T8EA 2G4BA 3C6TB 1M5OC 2MQMA 2F4FA 1H73A 3LWLA 5D15A 1NK8A 1HNXJ 3LP0A 3TZYA 3V4MA 4QWDA 2BE9B 2IVMA 1WF1A 4M5MA 2YX7A 1XNRJ 4X84A 2B4VA 2RSQA 4R5PB 2V2QA 4ZPDA 4ZPVR 2XSFA 2LXFA 4PWDA 3NGKA 4H54A 4UOFA 3CJ0A 3PEJA 3TUZC 1BXNA 2ZBPA 4P72A 1U47A 3UPFA 4Q0BA 4QPXA 1JLGA 1YZ7A 3HHLA 1RTJA 3ZZTA 4ZVTB 1CJUB 2BJDA 2LA6A 1PILA 4CLTA 5B08A 5EX3A 2Y8WA 1KRPA 3DU5A 1GMWD 4ECWA 1HPZB 3PW5A 2O3DA 5CYMA 5EGYA 2F8MA 2YWHA 4FBUA 3I4PA 1CSJA 3HSZA 4L73A 4OI4A 5HBMA 1HD1A 4DN0A 3CJQA 2HQIA 4OYMA 1PJ6A 1N36F 3T1AA 1HQEB 1FDAA 1GMWA 2WAQD 5LMNJ 2R7TA 2W8KA 5HSPA 5GMDA 1NZAA 2QC3A 2W7AA 3DXBA 3FEYB 2JEIA 4ANDA 1DTQB 1PCAA 2OI2A 3CDBA 1WI8A 2OEMA 3EUNA 1GEHA 2P6TA 3GG1A 3I0RB 3VGVA 3PV8A 2B0GA 3UN5A 4KR0B 3MMAB 1Y5LB 1WHXA 1Y10A 4WXWA 1OY8A 1NAQA 1JLBA 3BBCA 3SMZA 3CCMS 4X4UA 3MCMA 1U1RA 4ZJQA 1VRUA 2HBZB 4ECZA 1UEKA 2AZ3A 2EFGA 1U2CA 2BV3A 3U02A 2XMWA 2GC8A 5DQHA 2CAJA 1HBUB 3BS9A 3BGFA 1U24A 2O5DA 4X62F 1RT3A 1UJ4A 2H54B 3D0HE 3KDOA 3AQPA 5KFFA 3V6JA 1MG7A 4JUZA 2J6UA 5GAHI 1EARA 2CQDA 2IMOA 2J0WA 3NXZA 3T1YF 3HK2A 1RBLA 2YH0A 1HYSB 1LWFA 4DQSA 1WG5A 2QSFA 4GKJJ 4OHXA 2JX2A 1X8DA 3VZHA 5KFNA 5IV4A 3J81U 4NXMJ 2B3TB 1Q79A 5J2NB 1HHQA 1D3WA 3NG8A 3MF5A 4DR1F 4DV4J 1RAAB 3WHIA 2EFPA 1S1VB 1X4HA 1RADB 2VQEF 1H74A 1PAEX 2IPOB 3HHKA 3O6QA 4P74A 3H5XA 5LMUJ 2UUWA 1ULRA 3QJJA 2Q6CA 4NCBA 2JLGA 4OV6A 2WHOA 3SV3A 1N34J 1EZZB 3MCSA 1T9WA 1QE1A 2CZ9A 1YBTA 4F0MA 4XIUA 5CYQB 2MGZA 2A6MA 2ZOMA 2ZKUA 5EN1A 1ZAWA 2GV1A 4DL6A 2G1DA 5CD4H 2IAJB 4H4KC 5FIIA 2ADCA 5F0WA 1UL3A 2ACYA 2HHPA 1RJJA 1RAHB 3MEEA 3NBPB 1Q8LA 2CVEA 2AV5A 3D2WA 3GJQB 3NOCA 1LNQA 1NPKA 4X4PA 2AU0A 1FJ7A 4NLTA 1BQXA 2ROGA 1V9OA 1WF0A 2PEBA 1JLFB 1SKRA 1X5OA 2HFVA 4HR2A 3G8SA 2HQCA 3T41A 4NLYA 4MK8A 4OI2A 3J80Y 3BSAA 4UZBA 2VFSA 3C15A 4ECVA 5ETTA 2K1RA 1WKLA 2RQ4A 3V6DA 1HR0F 3MR7A 4I2PA 2VDIA 3QRQA 2YX1A 3GMGA 2C2MB 1SL0A 1N36J 5LMUF 3FEZA 4USHA 4Q45A 4DR7F 4G3IA 1XMOF 5MAOA 5M2PA 4LQ9A 2U1AA 1U1PA 3H4DA 4PQUB 1IQZA 2IA6A 3N28A 2E66A 1MSWD 2DIVA 2OKQA 2Q79A 2F7VA 2YWKA 1A7GE 1FDDA 2G2YA 2J6SA 1UW4A 4HTIA 4DUTA 3C6TA 3CC2S 5LSLA 1FE4A 1M5VC 2ALZA 3KOAA 3MR6A 3OLBA 4TY8B 3D6FB 4A48A 4IG0B 4OX8A 1NB2A 1QJHA 1HFEL 1NKBA 2IRYA 4O44A 4X62J 1V5IB 3BGUA 2B9XA 3FJ2A 4QIFA 2W7PA 1ACMB 2AP6A 3BDPA 5DZ7A 3KK3A 2KU7A 4DR6J 2L41A 4ILRA 3NAIA 3PZPA 3PW7A 1M1KT 1P6TA 1HA1A 4F26A 2ZH2A 2XY6A 2OEKA 4DV5J 2Q6BA 2MMYA 3MM5A 1HNWJ 3H5SA 1AZSA 2FC8A 2XZDB 5FD1A 3B6BA 3AA8A 4F4AA 1Y5IB 4IG0A 3CF5Q 3DM2B 4NLUA 4PQUA 2VFUA 1JMTA 1S79A 2I38A 2BKOA 2GIQA 4QIWD 5MLCV 3JB9k 2C2DA 4DOZA 2KM8C 5GAHU 5E0OA 2X7IA 5E5NA 5G0RB 1FDNA 1JK9B 9ATCB 2GFFA 2A1BA 1RAOA 4K50A 4LSZB 4CDIA 3I32A 3CVKA 1EETA 3DDNA 4TNOA 1J2VA 1YJ9S 1UA0A 5HANA 1QUVA 2XYHB 2BUNA 3V4IB 3P96A 2CQ1A 3M1VA 1MU2B 1U0HA 1NLKL 1J5OA 4MKVA 1TL7B 2CYYA 2Z8QA 3ICLA 5EHHA 2A10A 2VG5A 4H4OB 4P2MA 4RR5A 3AHPA 5C24A 1MLAA 3V5RA 4QW9A 1N5QA 4TLRA 1XBWA 2G1HA 4OX9F 2IJNA 3KK2A 1S1WA 2HAFA 1I51B 4DFMA 4HHJA 1QVGR 3MFHA 1FXDA 2NSCA 4GKKF 4WE1B 1JJ2R 1U6ZA 5IT9Y 3BJYA 1OY9A 3L3CA 3R7SB 2BVZA 2G2ZA 3OPKA 2WBRA 3QO9B 3K59A 5CYMB 2KL8A 4V19J 3AD9C 2IY5B 1NPRA 4EU0A 2FGCA 4ZK7M 2BKNA 5KG4A 1VQ7S 2VHGA 3J7AN 5CH7B 3G86A 2MKCA 2QV6A 1T3NA 2FPHX 1PBUA 1Q5YA 2QLBB 4LFCF 3PJXA 4OI0A 1KS2A 1SH3A 2M2BA 3M4XA 2IJFA 1S1VA 1XTZA 5LJ3Y 2HPUA 2VPXB 4B9SA 3R7NB 2DKOB 3DOKB 1OJ4A 5E3AA 2K8GA 5LSOA 3W8PA 4B3MF 1TAUA 3RTVA 1U25A 1YTYA 3JAMY 1MU2A 4RW7B 1X9SA 4C8ZA 4Y2KA 1RA6A 1VR6A 4QPTA 2QFIA 2RS2A 3C66A 1IBKJ 1WC6A 2KHDA 1R31A 4ECSA 4UY85 1WKJA 2QSWA 3G82A 1VIXA 3MWBA 4J7CA 3DHWC 3RBXA 3SSRA 3VV2B 2IAJA 5CZXA 5KFCA 3GIKA 3I6PA 4E8UA 3ENQA 3DLGA 4KPYA 2XG8A 4O4RA 3CCZA 3CJKB 1JLCA 4EZ6A 4K4ZA 2FLLA 2ZBRA 2A0FB 4DUZF 2HVDA 3THPA 5DLFA 1FT8A 2DHGA 2IC3B 1FESA 3KHRA 3C16B 3IS9A 3IRWP 1CLFA 1RBOB 2OGUA 2MLYA 2V34A 2ZVSA 2NQPA 4OZJA 4RUAA 1RAIB 4F2RA 3SQGA 2YWFA 4G6VB 3P4UB 4FNHA 1OPZA 4KGMA 4F0HA 4ZVHA 1QSYA 1SJ1A 4PQAA 2FVPA 1HKAA 2C1EB 4GO5X 3G8QA 2ZH3A 2XY7A 4JI0J 2MJUA 4NL5A 2JEFA 1URNA 5L8RC 1X5PA 1LK5A 5KFXA 3KLHB 2APOA 3VHQA 2QTWA 4RU9A 3PKYA 4ILMA 3WBZA 1WC5A 2ASDA 3FQLA 1TK8A 2Q3PA 3PR4A 1DARA 1UEVA 4IRDA 2QMUB 3JYTB 1RYSA 1IWGA 2Z30B 2FJAB 2ZH8A 4Y00A 1FF2A 1ZZNA 3VAGA 2CQGA 2LXIA 4ZCIA 4W90B 3M8QB 3BZQA 1B99A 1N5TA 2EFOA 3GWCA 4J9VA 1RHQB 3LO3A 4Y0FA 1NK6A 2HIQA 2IYIA 1GTHA 2GO8A 2MZTA 3T5KA 3IXQA 2FVRA 3NOGA 5K8NA 3S8SA 1VC5A 3HKZD 5KFKA 4KH0B 2OEJA 3BSNA 5B0AA 2GAHC 1VQKS 2CDQA 2AYBA 2RDDA 4JI1F 3VCDA 2UXBF 1YI2S 2VBWA 4UOHA 1N5VA 1VYAA 3FZBA 1FK9A 1T3OA 2K2PA 3W66A 3LWMA 3DYAA 3W5ZA 4ANCA 2VQFJ 2LQBA 2HNZB 1KOOA 3UR3C 4F3OA 1APSA 2B4OA 1RCOB 2CNLB 3KFWX 4NA3A 3CD7A 2OPPB 3H0PA 4USTA 5M2RA 3LAMA 4RW4B 4O3PA 4BHQA 2W4CA 3EPGA 5FJ4A 2MQPA 3NGTA 1U7LA 4ICLB 4OI3A 3ISNC 4OYBA 1SQGA 1Q81T 2E5LJ 4JYAF 1B0VA 3K5OA 2CQ3A 5HQMA 3IR5B 1JXLA 4A47A 3VAHA 5J1PA 2F9DA 4P7VA 3ZTQA 3IBCB 4JI2J 1WOOA 4WYWA 4ZLJA 4DPUA 5C25A 3CCSS 1ZAXA 2OHDA 4KRWA 3KMQA 2RU9A 3KG0A 5A8WB 3PHEA 2B4PA 4MAKA 5A6PA 3B4DA 5DQGA 2VICA 1S72S 1QE1B 4NZ6A 2XZTB 2J9DA 1V3ZA 4LIRA 5G4DA 3R5BA 1Q1KA 1CQNA 4DPTA 5K8OA 3GV8B 1NSAA 1S12A 2HFNA 5D4LA 2BOAA 4PYAA 6FD1A 3I96A 1BUXA 4L76A 5E3CA 2KDOA 4KTQA 4EBCA 4J5OA 1ZM3A 1WACA 3TAQA 3CJTA 3TEHB 4RZRA 3PCOB 3U1NA 1RU1A 1TQLA 3H8YA 2ZH6A 2IJRA 3CJ5A 4HL9A 1HQUB 4B17A 4B3RF 1AFIA 4M5LA 1Y9OA 1Y4ZB 1QY7A 2PGCA 3FRYA 4Q7AA 2DNQA 1RWNB 2HLTA 1L3TA 3RW6A 2V8HA 1NB7A 3M6UA 1JNRB 1RTHA 3HHDA 4J9QA 1FFWB 3KYLA 1MNEA 2WSEC 3C14A 4A8WA 2RVJA 4JYAJ 4LR7A 3MEDB 4PAAA 1F3VA 3MM8B 3GV7B 1UFLA 2N4CA 2DXEA 4J37A 2Y1JA 3D0GE 4RUBA 4DWIA 1FJGJ 2YNIB 1ZOTA 4HACA 2YKMB 4KFBB 2H5IB 4USVA 2BABA 4CLLA 2J6TA 1IKYB 1Y00A 2BRKA 4QBUA 3MPDA 4LIWA 4DL4A 3HKWA 3I82A 5KFLA 5A8KA 3SBMA 1FRJA 1YKWA 2MLZA 4RW9A 2LA4A 5KG3A 2VJUA 5J2PA 5HROA 1FD2A 2GAGC 2VPWB 3FCHA 4TKTA 4E0DA 4DR3J 3D67A 2JLEA 4OJ3A 1N52B 4OYIA 2H3EB 1MW7A 4NLPA 1ZETA 2XGPA 1QD1A 3M30B 1B64A 4J9SA 4AXJA 2HQ3A 4K2XA 5D0HA 4DFJA 3DFEA 2VD3A 2YKPA 1X4AA 1TL1A 2AF6A 2RUGA 5HO4A 2OH2A 3D1OA 4DEZA 4YS2A 4B3RJ 2H1YA 2YQ0A 1YRXA 5DM6Q 3JS9A 1LWCA 2DCUB 3IWXA 5J1NA 5BYQA 4X4SA 2LYVA 2B9YA 4P2SA 4YMEA 3CD6S 1IM4A 1MWQA 2DNLA 4FYWB 1I94F 2XSJA 1X5SA 3D7SB 8ATCB 3OTBA 1XC9A 4AT1B 3N79A 2AGQA 2VKZG 4KO0A 1S1XB 1FRHA 1TMJA 4HT5A 4B3OA 3SCLE 2R7RA 5JJBA 2LFVA 5D0EA 1BHNA 2BRLA 2N3LA 3T1HF 4X4TA 5DO2A 3I87A 4CWBA 4DR4J 4CT8A 3ITHA 1ZS6A 4B9LA 4OHZA 4PWWA 2ACMA 2C3UA 3DCAA 4YY3J 2WSCC 5HLFB 2YNFB 4I2QB 1ZZFA 4KB7A 3ZO7A 9RUBA 1G2EA 1S1WB 1R89A 4WBFA 2WRMA 1TK0A 3D68A 3KUGA 3BV8A 2JFKA 3RBEA 1L3SA 1KSPA 3OL9A 2HZAA 3KHLA 3PVXA 2IMWP 1PYTA 2VPYB 2CPEA 2YH1A 2BE2A 3CCRS 2XSJB 3HD2A 1IKWA 1S7IA 3OHBA 3LP0B 2HWHA 1LWFB 2KFNA 2KFZA 4YY3F 3MZIA 4RBUA 5KFPA 3QT6A 4B9VA 3AODA 4GC7A 4AD6A 4CLFA 1S9GA 2PN6A 5LXRA 2R8IA 5DG7A 1Q82T 4CIOA 1HWLA 1U0HB 2XBPA 2DB1A 3N6LA 4TXSA 3QAUA 4JI6F 4ZOSA 3ZZZA 4X66F 4PCQA 2FVQA 1B4SA 3D3CJ 3I9V9 4ES2A 2DNYA 2ZC3A 3MURP 2YY3A 4B9MA 2OFHX 4LRDA 1E6YA 4ZIVA 1N5SA 3JTNA 2G13A 2GGPA 4Q43A 2YXLA 2XWXA 1R0AA 3ENAA 4DSEA 1SJRA 4KHRA 4DZDA 4WFAQ 3PYDA 4P71A 2PT0A 2M8HA 1Q78A 2HS4A 4J91A 2AMCB 1U09A 2LQ9A 2CPJA 2L3MA 4OV1A 3AAWB 4ALZA 2VB6A 4GVLA 5DGAA 1CULA 5DQIA 4LF2A 2UXDF 2PMWA 2XLIA 4CLWA 4I2PB 3ETMA 3Q8YA 1P1LA 3NCPA 1S1TA 4P6QA 4CLPA 4X4QA 3PW2A 4DR7J 1WEXA 2J9CA 4F3MA 2KH9A 2W9BB 2R2UA 2Q43A 3SFUA 4OHWA 4TU8A 1AFJA 3FSXA 2BMBA 4M5DA 5HBMB 1UFKA 1PIEA 1R3NA 5DGBA 2DXFA 2MQNA 1G6BA 2VPZB 3O3LA 1S6QB 2PD1A 2UUTA 4LSNA 1JLCB 3HFVA 4CLSA 2ERRA 2LLZA 3L7UA 2R7UA 2UXCJ 1IXKA 5F3TA 3VVUA 1VBYA 2F3JA 3GZ7A 2FHMA 3CCQS 3U27A 3IS9B 5EX0A 4AXIA 3KLIB 4J9RA 5KG6A 2HQGA 4OJGA 1VJQA 3Q8PB 2HVIA 4Q8FA 1GH8A 1VFJA 1YZ6A 2XHCA 1MMLA 3HO1A 4HH1A 2D3UA 1T11A 1UW9A 2QL9B 2FY1A 1X4BA 2NXJA 5D77A 2O01C 2ZWOA 3JSBA 3KXDA 4LFCJ 2CZ4A 1OPIA 2GMLA 2QYCA 4PUOA 4QYZJ 3W61A 2HURA 3UCZP 3MOJB 3CCWA 1HNWF 5IS2A 3R5AA 3V6KA 1BY9A 2KKHA 4NLVA 2RHSB 2OPSB 1CJKB 2LQJA 4RW6A 4DR2F 4ECQA 3ISND 5KG2A 4PXEA 1VMBA 2FJXA 5M2UA 2OPQB 1SBRA 5D4PA 2V9KA 1FRIA 4QIVA 2DITA 3MMCA 4M8LA 3VR1A 3ZTRA 3D1HA 3W60A 5BR8F 2R8GA 3R1LA 4HTJA 1KQGB 5ETMA 3RAMA 4USWA 2NXUA 3BYRA 5ETNA 2E29A 2M4MA 4LF6J 4C7QA 5DRKA 2Z2ZA 5LOQA 4O3NA 2H9ZA 2VONA 1EETB 5HAOA 2OPSA 3FUYA 4RW6B 4DUZJ 4EBEA 3NKYA 4FVCA 1DRZA 4ELVA 3W2VB 4AL6A 2HYIB 3V81B 1QTNB 1VJWA 4OHVA 4RLEA 2PE8A 2CA9A 2MQQA 2W7OA 2ADBA 2NZCA 1UZDA 4OJHA 3W3SA 1IJEB 4F04B 5KG5A 4C4WA 3L4BC 4LJMA 5J2MA 2ZUGA 1DTTA 1FWPA 3A8JA 4RX6A 4KKOB 2QE5A 1LWXA 1REVB 1S1UB 1A6LA 2V67A 1F1BB 4ECRA 2FJBB 3L95X 8AT1B 4LFBJ 4N8NA 3K7RA 3NMRA 4X4OA 2ZITA 1UKUA 1HBOB 2AIRB 2LDYA 1AXQA 2M5YA 2Y0SD 2Z58B 2ATLA 2YNHB 1AUSL 3FMBA 2C28A 3BREA 2R2SA 5D8HB 3KUEA 2WONA 2Q66A 1R6VA 2DRDA 4QU7A 1FKPB 2NXEA 3GCWP 3SYZA 4FXVA 1YBAA 2GIFA 3FNNA 3JTOA 2ZH4A 1PJ7A 1IR1A 5K20B 4AL7A 4CZCA 1KQKA 4TU9A 3UE2A 5IWAF 3W5XA 5A6WA 3CD5A 4CYUA 1AYEA 4RBTA 3RW7A 1HBOA 4NYPA 1H98A 3KK3B 1GXUA 2F1FA 5T41A 2B9EA 1WNEA 3MM9A 3TX0A 5E3PA 3S01A 3VWSA 2ZOGA 1QM9A 5ETKA 5AXKA 1EIYB 1ZM2A 4FF3A 3RB3A 2ZJPQ 3SXLA 4P7TA 4OZ5A 5DDOC 1VRTB 2DYAA 1YK9A 2DH8A 3AJ2A 3O2IA 1QLNA 1OSDA 1EQMA 1XNRF 2KM8B 3G82B 5LT5A 3HVRA 3R2CJ 2XGQA 1P9YA 2FHJA 4GRSA 2GA7A 2JH3A 3BPDA 1O0PA 3F56A 3R97A 4DZ6A 4QWAA 1HQEA 4M63A 4B3TF 2LEPA 4TYAA 5IQ6A 2DGUA 3K5MA 4E98A 3SV4A 1NK5A 3IO1A 1MWZA 4LF4J 2HSEB 2M52A 3PTWA 4CNYA 5HJXA 1N8RT 4NXNJ 2IRUA 3DI6A 3CDEA 3SDEA 1VQOS 4F0KA 5I3QA 1JLQA 3TP2A 3A8EA 5C5JA 4F7VA 2MQ8A 2FC9A 1OO0B 2ZOFA 3GIRA 4DV0F 4DS4A 4XO0A 3FFIB 3M8PB 5F41A 5HVFA 3LH2S 4WP9A 3PRVA 1EHWA 4R8UA 3VVTA 1FVQA 3OTOJ 3PYFA 3CCES 1KC8T 2B43A 1TUWA 2DNZA 1X0PA 3LGMA 2HGNA 2HGLA 1GTEA 1SCJB 5JVGQ 1GAOA 3EJMA 2A2CA 1S10A 3UN3A 3DRSA 2UVUA 4PPDA 1FX2A 1JLQB 4GVBA 4PXDA 1X4GA 4USUA 5B0EA 1ZTWA 2J0SD 2GVDA 2XTJP 1TL1B 1FNXH 3ELHA 4LMZA 3PW4A 4ZA1A 4XAKA 3ZC4A 2GNKA 4ZVFA 3M9OB 4A8OA 4C6AA 4P2XA 2Z57B 1V5VA 4J9PA 1B0PA 1NDLA 2YKNA 3OTEA 1G4CA 1R8PA 1AW0A 3HX9A 5IQQA 2ATCB 1D9AA 1RWUA 4H4OA 3CIZA 1IR0A 1GXTA 4RNMA 3K57A 3NNHA 1BMQB 4WCEQ 1P8GA 1RWMB 2V2KA 2W2MP 2DK2A 2XMAA 2QIFA 4NXNF 4DCOB 2RD5C 3R5GA 3R1HA 2V6AA 5AXNA 2F4VJ 3UQSA 1TR0A 3RR7A 4C0HA 3F41A 2H51B 5D0RA 2VL1A 5EWEA 3H20A 4OI6A 1YX2A 4TQRA 1YSJA 4P73A 3AT1B 1YIJS 1NSQA 3I5CA 4C8OA 3OUYA 1IBCB 3DGPA 3CT9A 4LSNB 1RU2A 1YGYA 3MI7X 1U2FA 4AQYF 1Q16B 1KBRA 2QA2A 1R0BG 2I8EA 3IM9A 3QFHA 3ULHA 4B08A 4Z2XA 2RU3A 1WI6A 3OL6A 2C2RA 4MT1A 5DDRC 5DJBA 5KFUA 1CVJA 2FYXA 4KGXB 2AT1B 4ZVUB 3C6UA 1H6KX 2CPDA 3R7BB 4Z7YA 3HXMA 3K0JA 5J2QB 4QU6A 1XR6A 4DMZA 2VA2A 1BQNB 4I6WA 4NWBA 1EKSA 4ZLNA 3TR5A 3AXMA 3BGOP 4F4ZA 2D3O1 2E7VA 2BQRA 4JI5J 4LF5J 4K0KF 3H2UB 5D78A 1EQ0A 2Q1LA 1WEZA 2VG6A 1KQFB 2RQCA 2M88A 3T3FA 1W26A 1LOUA 2B8QA 2RRBA 4I1TA 4KPCA 3M9NB 1U1MA 1A9NB 1R8CA 5DG9A 1R0AB 1C0TB 3DLHA 4DG1B 4QJVA 4OZ1A 2JWNA 1B7YB 1UVIA 4LF4F 3M2VB 4RU2A 3ILIA 1FEEA 2FB0A 2XI2A 5C25B 3HULA 2AWZA 2DXDA 4P2FA 3IR7B 5GADU 2GMHA 3W8GA 3U1LA 1FX4A 1VRUB 1FTCA 1TUVA 5ETVA 4K0KJ 2PIIA 1U1LA 5L1JA 3DLLQ 2QO3A 1Q7LB 2HHHF 2CJYB 4NLQA 3JSRA 1D9DA 3MPUB 3KTQA 2FVCA 4Y6IA 1XEZA 1H7XA 3H5UA 4DPOA 4DU8A 1I1GA 1XR5A 4CLZA 2KG0A 1RBAA 4YHHJ 4Q2LA 2DCLA 3V81A 1LW2B 1UWBA 1IR2A 1UMJA 3KDNA 1ZPWX 3FBCA 3GV5B 4FBTA 2XHWA 3QRPA 2R7XA 4WIQA 4IRKA 2DRBA 5J2MB 4U8YA 1BQMA 2VDHA 5A8RB 3R3TA 2MZ1A 3QJPA 4IH7A 3NWRA 2IDEA 2O67A 1KVJA 3DRPA 1T9TA 2GVZA 1T9VA 3SSSA 5KFWA 1S9FA 2P5VA 1IKVB 5A76A 3EM1A 3FBEA 1RHKB 2CQCA 2ZD1B 2KT5A 2VFRA 3C15B 3LALA 4WFZA 4DPXA 1WC3A 2WB4A 3TVYA 4NLDA 3MTJA 1RWKB 2GHWA 1H38A 2DH9A 2XCAA 1R8AA 3EYZA 1GQEA 3M2VA 2OELA 4BS2A 4DV1J 4KC5A 2HBRB 2ZM6J 3G9CA 4DR6F 1X4EA 4MTPA 4DUYJ 1OMSA 4ID8A 4DV7F 2BEFA 2ZE2B 3K5LA 3DYAB 2X51A 3HT3A 4DV5F 3PX4A 3VAKA 1Q0NA 3TUIC 4AFFA 1KNZA 3HSGA 3QGGA 2MKSA 3CE8A 1VQMS 3Q83A 2ROEA 2FLOA 2UZAA 4GC6A 2OSQA 4MJKA 2K3KA 3Q8VA 4TU7A 3T1HJ 3QT7A 3EVOA 5HMYA 2OD6A 1DY3A 2P8IA 1RCXB 2RJZA 4AL5A 1E6VA 1KWMA 4B3OB 4EFAC 2D41A 2VBZA 3K8WA 2Y8YA 5IZHA 4ED6A 1PSDA 2KJVA 2MSTA 4Y2IA 4CO0A 3KJFB 2C22A 1WELA 3M2RA 1WC0A 4FYYB 3GFHA 3I0RA 1GX6A 2A18A 2FD2A 4WTOB 2DISA 2NUHA 3UNGC 3W1YC 3QBCA 1YJ7A 1S9EB 2KVIA 3TZXA 4C9DA 1S97A 3MECA 4GO7X 4ID5A 1H2VZ 5I3UB 1F9EB 3EX7B 3TQ1A 1VQ8S 4Z7CA 1ZH5A 2HHUA 3EICA 1XK8A 3HF5A 4NMXA 1YDLA 3DHXA 3QZ7A 1IJFB 4ECYA 1UTAA 3BM7A 2YNHA 2VA3A 3PACA 1MROB 4KBIA 1KP6A 4N5SA 3X3UA 1KFSA 2BJ1A 1GX5A 1TL4A 2HWTA 3LANA 2IFXA 4I64A 3T1YJ 1NHUA 2GHPA 2RF2A 4LR8A 4ZPCA 1RT4B 4DCJB 3KJVA 4Q44A 1OIAA 4NYZA 4RW9B 3DOLB 2FY8A 3LPEA 4PWUA 2GQ2A 1NSPA 3LA0A 1SC6A 2PDAA 3KKFA 3BGLA 1T05A 1OQ3A 2MQLA 2VZ9A 3PFEA 4NMLA 5HMWA 4ER8A 3R5JB 1HWKA 3B4MA 3OQ2A 5ETSA 3DLGB 3NAHA 2N82B 4DV2J 3C46A 5HK4A 2DBBA 3H4BA 4OL8A 3A4TA 3I0SB 3F44A 4C3LA 3G6VA 1NO8A 1U1OA 4LF7J 1RT1B 3OR1A 2RRAA 4KJIA 3E01A 2UUCJ 1FTRA 3M2UB 4DQQA 3KK2B 1IUJA 2PA3A 3Q89A 1KVKA 4HHUA 3G87A 1RE1B 5KFAA 5GMKa 4ECUA 2RT3A 2RS8A 4J9MA 4IQXA 2UU9F 1PO6A 3FSIA 1RHUB 3Q2SC 4QWBA 2AGOA 5AT1B 2DNHA 1HNVA 5JXSA 1QTMA 5AE3A 3OR1B 4WZMA 3QGPA 3KHGA 4WP8A 2H65B 3NY0A 3JYTA 4DFKA 3VAJA 1R8HA 4ZIWA 4U7CA 1NEEA 2QLJB 4JI7J 5GMEA 3KLFA 2VH7A 5F8LA 1SUQB 4PWDB 1RWVB 5L46A 2CNOB 4ZVPB 4LRBA 4IR9A 1U4BA 1RT1A 1VI7A 2W2OP 4NOHA 3OXLA 4OQJA 2X3DA 3I5BA 1HNVB 3C8YA 2IBOA 4DSJA 3PM9A 3WC0A 1F9FA 3DMJA 1HIYA 3GTYX 1G1XA 5HP1B 2Z4PA 2HRTA 3NLCA 1SC4B 4DR1J 4UY8T 4K4UA 1S1XA 2BXJA 4PXBA 4OHYA 1RHJB 1Q5VA 4UQTA 2CRLA 1U26A 3CB4A 1VS3A 1NKCA 1QVFR 4K5SA 4RJVA 4ZP9A 5AJ3F 3J7YU 2BBEA 3ISZA 1T9YA 2DIUA 2XS7A 4O4GA 2WVBA 3HVTA 3MMAA 4V1Ak 5LM7E 2BANA 4ZHRB 2XMKA 1YQHA 1T95A 2KXHA 4DR4F 5ETQA 1U49A 5D3GA 4F3QA 2GJ2A 4URGA 5KT4A 4RNOA 1RT6B 3GQCA 4I6AA 2V8GA 1BWEA 2ZNYA 5CCMA 3JSMB 2ZDOA 1E6YB 2HGMA 2ZHBA 1FCAA 3UD3P 2KO1A 1S6PB 2AW0A 4KY3A 4RW7A 4ZP6A 2MEWA 1RQ0A 1PJ5A 3BEGB 5T7LB 3ET6B 3HMJG 3K5NA 3Q22A 4C97A 3F73A 2D69A 4DR5J 5BXIA 1AB8A 1FD8A 2QG9B 3WDOA 5J1EB 1RTIA 4YQWA 2VQFF 5HP1A 1C1CB 4DPYA 1REGX 2B56A 2OMOA 2B7CB 2LVWA 2VKRA 4LR9A 2ZM6F 2KYXA 4ZPAA 4CRJA 2CUYA 2G2OA 5CABA 2DNMA 3CGIA 1Y5NB 2POKA 3BQ1A 5H9EJ 4YDXA 3T19A 3EGVA 2AD9A 4X4NA 3F0NA 1C0UA 3K58A 3N6NA 4UTGA 3MR3A 4F50A 1SKSA 2R7QA 4TY8A 4U8VA 4NRTA 3THTA 4BC9A 1LV5A 4QZVB 3C14B 4DI6A 2DNRA 2HHVA 4YN3B 3PR5B 3RB6A 2EG1A 1W2IA 2LKZA 4QYZK 4NLGA 4NI2A 4ITSA 2N4DA 4M5JA 3UDEA 3VQSA 3PKMA 3POTB 2KHCA 1F5AA 2KFYA 1YRTA 1XWLA 2V4JA 5I42A 3BN7A 2QN6B 3D6TB 2MPUA 5KFRA 1MMNA 4UUWA 3WX4A 2C2EA 1FFSB 1UETA 2K7KA 3HD1A 3NBPA 3UVJB 1W2BR 2D1CA 3CULA 2UUBF 1FHTA 1JQGA 3E3XA 2CZVC 3DLEB 4UOCA 1SV5B 3PXGa 3H25A 2VG7A 3SQOP 1VQNS 5LMNF 4DQRA 2WVCA 5LXYA 2J0XA 2JVRA 3R2DJ 4DR5F 3QO9A 1VLOA 3A3NB 4IFYB 7FDRA 2CADA 2Z2YB 2AEJA 4JBCA 5EUHA 1Q7YT 3IBFB 2HVEA 4NE9C 1TK5A 2J0QD 3BBFA 4DSFA 3MCOA 4F4YA 4LF1A 2X3GA 2P9EA 1R7IA 2DNGA 3FCVA 5ITHA 1NRKA 4ECTA 5T14A 1VRTA 4OYZA 5ETPA 1N4LA 1RWWB 1SIZA 2RB7A 1FRKA 3RAQA 4JI1J 4A8QA 3GLJA 5CHCB 4WPAA 2PEHA 4OJ1A 2E7WA 1C0UB 3PDNA 5CZVA 4ZJOA 4CO3A 2LDIA 3IA0A 5HVGA 2V8VA 4YB5A 3TVKA 4LBHA 2AYMA 2NREA 2XULA 1N5YA 2VUGA 1LWCB 2LQ5A 3BB5A 1FJGF 1LQ9A 3BR8A 1WDDA 1X60A 3MOZA 3HP6A 2XLJA 3P5BP 3ENWA 4DV7J 1VC0A 3UI3A 4EO6A 1KD1T 4JI8F 4CO5A 1I3OB 3D5MA 3GONA 4TY9A 2HVZA 2E1MC 3K89A 3QFWA 1RABB 3NGUA 4DLEA 1S4EA 3ZZRA 3GJSB 2AJ0A 5CQGA 3J7ZT 3J81j 1LWEA 2PC6A 4C0OC 1CS4A 2R3VA 2ZBQA 2CPFA 3DLKB 4MFBB 3UFCX 5GAEU 2PA8D 1HI0P 1RI7A 2W2NP 1FWLA 2Y0BB 3K17A 3VAMA 1N34F 1X4DA 2E5IA 3FK4A 2RHQB 3AOAA 2I1RA 3HJVA 5I3PA 5A2QU 2YNIA 2IHR1 2GQCA 2KB2A 1M1HA 5KFDA 2WONB 1REVA 1S1UA 1Z4UA 2OP5A 1UVMA 3OSPA 2CVIA 1AA1B 3IAM9 2VIHA 4O3SA 1HQUA 2D74B 3QMQA 4W98A 2CPYA 1DTQA 1KONA 1BC6A 4MFBA 5KT3A 4L75A 3HLUA 4PG7A 3QYYA 3QSIA 5GAEI 3WC2A 1KR4A 2XNQA 4WKYA 2QGFB 5D4NA 3OVAA 2CQ2A 2JEGA 1SH0A 4NEZA 2I5JA 1XNQJ 2MZJA 2ILZA 4U7UD 1X31C 4KKOA 4CT9A 4CLKA 2CG8A 1DZ5A 2FJDB 4KGVB 1P1TA 3MCNA 1L3UA 2PI4A 2Z56B 2GGPB 3TA1A 1Y3KA 3GIJA 1S0NA 1FKAF 3PG9A 4ZN1A 1HBNB 3DOMB 3H7HB 4DF8A 2OJ3A 3QRRA 3M2RB 1UEUA 1DLOB 1TAQA 2DNOA 2W24A 5E3RA 4KYZA 3HHLC 2WVEA 4WFYA 1HHSA 1M5SA 2R7WA 4A8MP 2UUBJ 1SQFA 2RDIA 2KG1A 1XNQF 3MMBB 4FPRA 1KHVA 1OS5A 3BGRB 3T6JA 4YDDB 3MXHP 1SUQA 1RP5A 1Q8BA 1LXJA 1NU4A 2R8HA 5E33A 3SI8A 1LXNA 2E9RX 4MH8A 3RZAA 1S7HA 3RGIA 3OVSA 3I56S 2BR0A 1U48A 4N41A 3IRXA 4KV8B 1DURA 2V68A 4OX6A 2JOQA 2HNZA 4ZDNA 3OTCA 2PO4A 3PRBA 2JL9A 5IT9U 3BYPA 3W65A 4B3SJ 3DNCA 2ZH9A 3N4WA 4DBQA 4C0BA 2J5AA 4OX7A 2XYGB 4EO8A 2QA4G 1HR0J 2PI5A 4DLGA 2B5JA 2CQIA 1D9FA 1RWOB 1TL7A 2ASYA 4S0MA 1NJZA 2V63A 2C3PA 2Z0GA 5IFMA 2G0CA 1RXOB 2E1CA 2MJNA 4MKBA 2CQHA 4MKYA 2M70A 1T9XA 4NLOA 3DDKA 1XIQA 3B78A 1VBKA 2NCKL 4OZNA 3M8YA 3NS5A 4WP3A 3FVYA 4CM0A 4DXLA 3DRRB 5I4MA 3OW2R 2AJ1A 2NXNA 2FUG9 4IH6A 1RYRA 4DG1A 4MIBA 2BJ9A 1UVLA 4GVBB 2BJEA 1WD6A 4ED7A 3N6MA 1I5OB 2JLFA 3CCLS 3HHEA 3RRHA 2M7SA 2GQQA 3LP1B 1LW2A 1UWBB 3G4SS 1Z2LA 1EAYC 3V2UC 2B9WA 3IAS9 4B3MJ 4FF4A 3LAKA 3I0SA 1CJVA 1VBXA 1KKHA 4DSIA 5JUMA 3ETOA 2DGTA 4HT7A 3HFZB 1PAUB 2DGSA 3CJ8A 2R4FA 1CC7A 1T9UA 2B6AA 3MEKA 2BA9A 2RILA 3P8BB 4FZVA 1VRQC 4IFVB 2IVFB 4BC7A 4DL5A 4QCLA 2C2ZB 3CCUS 3I5AA 2W25A 1NCLA 3L9ZA 4M5IA 3H2VE 4X65F 2AYEA 4DHVA 1SI9A 2C42A 1TV6B 1WC1A 2YPZA 3D28A 3D9BA 4RUHA 3MR2A 1ZA2B 1RHRB 2XO6A 2RE1A 5KG7A 3MMJA 4B9UA 2LQ8A 2YKMA 1T03A 4USKA 4ILLA 4XTTA 1S0VA 3KG4A 1JIHA 1GK8A 2R9LA 1PGZA 2HBQB 2EKYA 2JVOA 3CJKA 5KG0A 2CFXA 4CQ1A 4TLQA 4JV2A 5A2QY 3KNGA 1FKOB 1TL3B 1WTFA 4PYDA 1PYOB 3ILLA 4P52A 4PRFA 2VV5A 1RT3B 1YHQS 1TV6A 3OD2A 3W2WB 1Y0HA 3QGHA 2D3OR 1RAGB 4C11A 1VHIA 2KN4A 1XMOJ 1WEYA 5DG8A 2JEJA 3CEDA 5KFTA 2Z2LA 3T9NA 2J7KA 4DU7A 3I31A 1V6HA 3O5TB 4DX8H 1HMVA 2VASA 2HFZA 4DFPA 4G1QA 4NEYA 1SQEA 4RW8A 1YJRA 3EXYA 2DEJA 3A13A 4A8YA 2E5HA 1S0MA 5BYRA 2WSFC 2MYFA 4RNHA 3VTIA 4FN5A 2HZVA 3J7A1 1PBAA 1N5YB 1U8SA 3PIOQ 3UR0A 4W92B 4WK3A 3ZTOA 2J7WA 4J9LA 2GIRA 1HD0A 2KI2A 3JSYA 1TVRB 4ES1A 2HW3A 4CNZA 4WKRA 1SIWB 3ZFVA 3UCGA 3QAEA 3Q8SB 1XR7A 4USJC 5KFEA 4L3KA 4RW8B 4U95A 2W9AA 5C24B 1H2TZ 1NDCA 3D1QA 2B4UA 2P9GA 4MMOA 3Q0AA 3WX8A 2YVSA 4KIAA 3TJ8A 1KDNA 4NX9A 2BQ3A 3QPIA 1RT5A 3R27A 1JXEA 2AEFA 3R8YA 4QOTA 4DV0J 1RISA 1U2RA 3IWNC 3OVBA 1IKXB 1MN9A 4OYWA 1F6TA 1Q8KA 4LVNP 2BX6A 4NLRA 1DQ8A 1QSSA 4QQBA 3THVA 1NK7A 2V8PA 3GSDA 1FEHA 2EFNA 3EZ5A 3RBZA 3DRYA 2QLFB 3W63A 1FRMA 2DHAA 3GSIA 3R9LA 3QZ8A 3PJ9A 1HBMA 4MYTA 4QIEA 5C7PA 3G8TA 1A0OB 4CH1A 4JV1A 1FJEB 5K14B 2EWHA 5F0UA 2AGPA 4WK1A 4QWCA 5JVHQ 1URRA 3GYXB 3SCKE 5RUBA 4DQPA 1HNXF 1U1KA 1HW8A 1RWPB 1T02A 2EK1A 2QJ3A 2ZHOA 3H98A 1K47A 3PEHA 3H2LA 2RMLA 4J90A 4K59A 1C2PA 4Y2CA 5KFOA 4DL0C 3NNCA 3FGVA 1N6QA 2CQ0A 4JI4F 4X65J 3MAAB 2EVZA 2IM0A 2L48A 1XERA 3MM8A 3PFOA 4ZLLA 4P9SA 1S49A 4D3HA 3KJQB 1RKJA 1XMQJ 1RTHB 2LEAA 2ZFHA 5E2QA 1HW9A 4OZ2A 2VC1A 3RG6A 1TKTB 4KHMA 3IWLA 4XDCA 2XZWA 4P75A 4CTAB 2LECA 1FA0A 4ED1A 1N6QB 4IG3B 2JFDA 2CJAA 3EGNA 4F25A 2BE7D 3QIDA 2RAQA 2DTJA 2XMJA 2MZQA 2EFVA 1NJWA 4MIAA 3PRDA 3QWPA 4F4KA 4A8FA 1ITPA 2JC0A 3Q8UA 2OMLA 2I0XA 3VZIA 3MM7A 2H48B 5L39A 1K73T 2UXCF 1LW0B 2R8JA 1HNIB 3GYGA 3R5CA 3TQEA 2JJ4D 4NPOA 3EZUA 2YNGB 4DV4F 2VQEJ 3OUYB 4K4TA 2GW8A 2MB0B 4FXWA 3J7Z5 1NKEA 1F5CA 4GMKA 5HQ8A 4X66J 3KLGB 1G7CB 3DN9A 1LWEB 3D4JA 4IKAA 4ZVSB 5CA5A 2M3DA 4Q5VA 3IN5A 3TO8A 5FDLA 2AX1A 4JI3J 3DC2A 4OMFG 4EBDA 1HLWA 1HPZA 3CXCR 4F36A 1SB6A 2Y3YA 1VBZA 3FBBA 3CJRA 5AE2A 1JX4A 1I6JA 2KJWA 3A8IA 2HHHJ 1RLCL 1WUUA 3GU0A 7AT1B 1S59A 1RTJB 4LRFA 5B0DA 3NRBA 3TJAA 2C2NA 4KO0B 3DI6B 3SDEB 3UDLA 5DDQC 2V50A 1YJUA 1N48A 2FJWA 4BLGA 1T05B 2MTLA 4EMDA 1J5EF 5IT4A 4F2SA 4EWTA 2CIMA 3N01A 4ZVQB 2BE2B 1AROP 2JRSA 2XMVA 3IRXB 1HWJA 4KV8A 1VQ5S 3W2WA 2D7SA 1RTZA 5J1EA 3A3OB 4CI0B 2CJKA 3CJ4A 3CJ2A 4LSLA 3TAMA 3NNAA 2E5GA 3NMAA 3HPOA 4HVZA 2XMMA 4RNFA 5HMXA 5IXUA 3ZNJ1 3RYLA 2HHQA 3K2YA 1B3TA 3DRXA 4LREA 3E01B 4YR3A 1WKKA 4RUCA 3ITHB 3EVMA 2Y1LB 3M8SA 5AXMA 1Q4RA 2G9OA 4BBYA 1GXLA 4XK8C 2KT2A 4L3NA 1K8AT 3SFGA 4JI7F 4KGZB 1ZYQA 2JZ5A 4FYXB 4DV3F 3OR2A 1F0XA 2IC3A 1T03B 4LFAF 1WJ9A 1G3OA 2EBEA 3DM2A 3MAQA 3RAXA 3KNAA 3WZ0A 5I42B 4DQIA 2E1AA 2QRRA 4QIGA 3TYTA 4YP3A 1SJ4P 3IFEA 2CWKA 4CP5A 1X5TA 4ZP8A 4K5RA 1NBEB 1HI8A 4HI1A 5KT5A 1BQNA 3DMJB 1Z2ZA 3PW0A 1Q86T 2KT3A 1W25A 4URSA 3EZOA 2CQPA 3FMWA 7FD1A 1BE4A 4LFAJ 4DR2J 6AT1B 4F67A 1NSKL 2X1FA
chains in the Genus database with same CATH topology
4DUTA 4UOFA 4S0MA 3VGUA 1NSQA 1UCNA 1W7WA 3VGTA 1NB2A 1XIQA 2NCKL 4ANEA 1BHNA 1NSPA 4FKXA 1B99A 3DKDA 3GPAA 1ZS6A 1S57A 1LWXA 3BBBA 2HVEA 1MN7A 1XQIA 3G2XA 3BBFA 4WBFA 3B6BA 4F4AA 3FCVA 5IOLA 4FKYA 2B8QA 4KPCA 4UOHA 4ANDA 1VYAA 3EMTA 4ANCA 3VGVA 3FKBA 3BBCA 2DXDA 1PKUA 3Q89A 3FCWA 3Q8UA 1JXVA 3NGTA 2AZ3A 1NCLA 4EK2A 3VGSA 1NLKL 3B54A 5CAAA 1B4SA 3NGUA 2VU5A 3ZTQA 2AZ1A 1NDPA 1K44A 3FBCA 2B8PA 1HHQA 3ENAA 2DYAA 3NGSA 3FC9A 1HLWA 4F36A 1BUXA 3DDIA 3FBBA 1S5ZA 1PAEX 1NDKA 4DZ6A 1NUEA 1HIYA 1S59A 4ENOA 3EM1A 3FBEA 4W98A 3ETMA 3GP9A 3Q8YA 2ZUAA 3Q86A 3PRVA 3BH6B 1EHWA 1NHKL 3BH7B 3VVTA 2DXFA 3ZTOA 3FBFA 3L7UA 1U8WA 1NPKA 2BEFA 1LEOA 4O0NA 3VVUA 1WKKA 3EJMA 2DXEA 3EVMA 1WKJA 1NDCA 3Q83A 3WX8A 5BXIA 3MPDA 1KDNA 3ELHA 3Q8VA 4HR2A 3ZTPA 3EVOA 4C6AA 3ZTSA 1MN9A 3NGRA 1F6TA 1WKLA 1NDLA 2HVDA 3EE3A 5CABA 2BX6A 2HURA 3EVWA 2DY9A 4CP5A 2CWKA 3R9LA 3PJ9A 5C7PA 4DI6A 3JS9A 3ZTRA 1F3FA 1BE4A 4UOGA 1NSKL 3EICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUT A;  4UOF A;  4S0M A;  3VGU A;  1NSQ A;  1UCN A;  1W7W A;  3VGT A;  1NB2 A;  1XIQ A;  2NCK L;  4ANE A;  1BHN A;  1NSP A;  4FKX A;  1B99 A;  3DKD A;  3GPA A;  1ZS6 A;  1S57 A;  1LWX A;  3BBB A;  2HVE A;  1MN7 A;  1XQI A;  3G2X A;  3BBF A;  4WBF A;  3B6B A;  4F4A A;  3FCV A;  5IOL A;  4FKY A;  2B8Q A;  4KPC A;  4UOH A;  4AND A;  1VYA A;  3EMT A;  4ANC A;  3VGV A;  3FKB A;  3BBC A;  2DXD A;  1PKU A;  3Q89 A;  3FCW A;  3Q8U A;  1JXV A;  3NGT A;  2AZ3 A;  1NCL A;  4EK2 A;  3VGS A;  1NLK L;  3B54 A;  5CAA A;  1B4S A;  3NGU A;  2VU5 A;  3ZTQ A;  2AZ1 A;  1NDP A;  1K44 A;  3FBC A;  2B8P A;  1HHQ A;  3ENA A;  2DYA A;  3NGS A;  3FC9 A;  1HLW A;  4F36 A;  1BUX A;  3DDI A;  3FBB A;  1S5Z A;  1PAE X;  1NDK A;  4DZ6 A;  1NUE A;  1HIY A;  1S59 A;  4ENO A;  3EM1 A;  3FBE A;  4W98 A;  3ETM A;  3GP9 A;  3Q8Y A;  2ZUA A;  3Q86 A;  3PRV A;  3BH6 B;  1EHW A;  1NHK L;  3BH7 B;  3VVT A;  2DXF A;  3ZTO A;  3FBF A;  3L7U A;  1U8W A;  1NPK A;  2BEF A;  1LEO A;  4O0N A;  3VVU A;  1WKK A;  3EJM A;  2DXE A;  3EVM A;  1WKJ A;  1NDC A;  3Q83 A;  3WX8 A;  5BXI A;  3MPD A;  1KDN A;  3ELH A;  3Q8V A;  4HR2 A;  3ZTP A;  3EVO A;  4C6A A;  3ZTS A;  1MN9 A;  3NGR A;  1F6T A;  1WKL A;  1NDL A;  2HVD A;  3EE3 A;  5CAB A;  2BX6 A;  2HUR A;  3EVW A;  2DY9 A;  4CP5 A;  2CWK A;  3R9L A;  3PJ9 A;  5C7P A;  4DI6 A;  3JS9 A;  3ZTR A;  1F3F A;  1BE4 A;  4UOG A;  1NSK L;  3EIC A; 
#chains in the Genus database with same CATH topology
 2W9B A;  3AA9 A;  2DGO A;  1RAE B;  3O1L A;  2XWY A;  4N7T A;  5ETO A;  3GR1 A;  4I6Y A;  3RUB L;  3KLE B;  2AJ2 A;  4HYK A;  3AXK A;  2AJQ A;  4AYB D;  4MIW A;  3UWT A;  1H2U X;  4ZN3 A;  2ZJR Q;  2IIH A;  2AQ4 A;  5LL6 d;  2I6W A;  3GIM A;  4BDP A;  1IKX A;  3WQP A;  2J76 E;  3NWG A;  4WU2 A;  1HWI A;  3PY8 A;  4B9T A;  3EDQ B;  1WOR A;  3DKD A;  3MPV A;  5DZ6 A;  3OJS A;  1IBK F;  2RQK A;  1SKW A;  1K0V A;  1TFY A;  4R25 A;  3GIL A;  3G2X A;  5HVH A;  5D0G A;  1RT6 A;  2E9Z A;  4DL2 A;  2MKY A;  1KFD A;  2NSB A;  2V8D A;  4NLS A;  4U9R A;  5ETR A;  8RUC A;  2VJV A;  2F63 A;  2UVR A;  1KHW A;  3FQK A;  3K8V A;  5F8N A;  3H59 A;  4A46 A;  2HRY A;  1B0T A;  3EWG A;  1R27 B;  3IR6 B;  4OFZ A;  4WTY A;  1RK8 A;  3TNV A;  1XMQ F;  1UPM B;  5E41 A;  2O66 A;  2EG2 A;  2GCF A;  2OPQ A;  2J8S A;  4C48 A;  5KT7 A;  3V6D B;  2W4P A;  3OV7 A;  3MD3 A;  2QEX S;  2HFU A;  2DR9 A;  1VQY A;  2NYH A;  4K7Q A;  4HDH A;  3B54 A;  2MHE A;  3CDA A;  2E44 A;  4IFY A;  4YR2 A;  4ZVR B;  2RDJ A;  2RF2 B;  2GS8 A;  2L9W A;  4ZJL A;  1RAC B;  4RW4 A;  1TFW A;  1UVJ A;  1YIT S;  1RLD A;  1FFG B;  2B8P A;  3BSO A;  3MHY A;  4A8K A;  3P3D A;  1LW0 A;  3NS6 A;  4URQ U;  4C2M A;  3TZZ A;  3KK1 B;  4FP9 A;  3TRG A;  2ZNZ A;  3NGS A;  3FC9 A;  2HLU A;  4F8R A;  2UP1 A;  2I5J B;  2EPI A;  3B8H A;  3CMQ A;  3DDI A;  3HSJ A;  1S5Z A;  3MEG B;  4YB6 A;  3JTP A;  2XS2 A;  3MR5 A;  4C11 B;  2HVH A;  3U7J A;  2LU1 A;  3MPY A;  3CJS A;  3LW5 C;  4U6P A;  2XS5 A;  3A1Y G;  4M1K A;  3ILO A;  5LSR A;  1M5H A;  3BO2 A;  1X4F A;  3GP9 A;  3R5D A;  3RB4 A;  2UXB J;  2FHJ D;  3M2U A;  3H42 A;  1MWY A;  2JC1 A;  3OFE A;  1FJC A;  1DJ0 A;  3QIP B;  4D3G A;  4JP8 A;  1CJT B;  2GJI A;  2NXC A;  2NYI A;  1J5O B;  1P27 B;  3TUJ C;  4B3T J;  4NA2 A;  1SJQ A;  2M0G B;  2UXD J;  3CDW A;  2HIY A;  3KHH A;  2ROP A;  3SSQ A;  3GG0 A;  4L6V 3;  2XB2 D;  1EJ7 L;  1UA1 A;  1UJ6 A;  2X1G A;  3C16 A;  2ZE2 A;  4LRA A;  2N7C A;  4DUY F;  1BLU A;  4O0I A;  4DSL A;  2YTC A;  2C3Y A;  1PC4 A;  1FNO A;  2VBY A;  4KSE B;  4ED2 A;  2Y1R I;  2HWI A;  3D6M B;  4RNN A;  4TYB A;  5JMN A;  1YJN S;  5A8K B;  4NXM F;  1KOH A;  1JLE B;  2C2O B;  3NGR A;  2AX0 A;  3U1M A;  4K4S A;  2V4Q A;  4UT4 A;  3CPW R;  2CPX A;  1N33 F;  4X2B A;  3CTR A;  3VF0 B;  5H9E K;  4DV6 J;  4ZHR A;  2DY9 A;  3I4H X;  3US5 A;  3TEG A;  5D6G A;  4F4X A;  2DRA A;  4ZPB A;  3LTO A;  4RL1 A;  3TOQ A;  2CQ4 A;  2HNY B;  1ZAV A;  3W64 A;  1NJX A;  5KFQ A;  2FVS A;  4XPC A;  1OYD A;  3UDV A;  5C2G A;  4R5P A;  4IRC A;  3LPY A;  3VQT A;  1FXR A;  5A0Y B;  2DGV A;  5DLG A;  4WII A;  3UDC A;  5DDP C;  4DV3 J;  1WHV A;  3HVT B;  3BPS P;  1NH8 A;  1T7P A;  4DV6 F;  4WFB Q;  5L38 A;  2KTQ A;  2YKA A;  2WVF A;  1UJ5 A;  3HHL B;  3MEE B;  1S99 A;  5THW A;  2MQO A;  2H4W B;  3RJM B;  1JJ4 A;  3CDU A;  1YWX A;  3T9Z A;  2KZM A;  4ANE A;  1N0V C;  2W1B A;  4Q2M A;  1CJU A;  2DY1 A;  4ZS6 A;  4QR1 A;  2YKQ A;  1RTD B;  5AE1 A;  2HRU A;  3E8O A;  3E51 A;  4Q0B B;  1B7F A;  3BBB A;  4ES3 A;  2ASL A;  1HHT P;  4TVA B;  1U6B A;  3DRP B;  1XQI A;  2BYC A;  4ICL A;  1D8Z A;  4J9O A;  2CJQ A;  2OTJ S;  4I68 A;  1VK8 A;  1JLA A;  1TL3 A;  2FGO A;  3DRS B;  5L1L A;  1TUG B;  4IG3 A;  4UQG A;  1OWX A;  5DM7 Q;  1AT1 B;  3LQV A;  2CNN B;  2V4J B;  4IYQ A;  2I2Y A;  3JAM U;  3T6B A;  4FPI A;  1O6X A;  3MMB A;  2HQD A;  1DAX A;  2HFS A;  2DNN A;  1OY6 A;  4LUB A;  4W4M A;  4ZCM A;  4ZKA A;  5F8M A;  3CC4 S;  2FHK A;  1VC6 A;  2C2K B;  2J8A A;  2LMI A;  4M94 A;  2CWX A;  4BWM A;  4DDF A;  3W5Y A;  2HS0 A;  1FKO A;  1Y3J A;  1RZM A;  1ICE B;  2BKP A;  2MKI A;  3PIP Q;  1SL2 A;  2UUA F;  1F2H A;  5C2C A;  2N3O A;  2LP4 A;  1HBU A;  4I4B A;  4LBP A;  4ZCL A;  3KLH A;  3S1T A;  4ED0 A;  4QR2 A;  3ZXW A;  4IOA Q;  3R6G B;  4GKK J;  4JV5 J;  4EYI B;  4GKJ F;  4NA1 A;  1M0S A;  1N88 A;  3MD1 A;  5HMZ A;  2L9D A;  2AZ1 A;  2NUU G;  4IR1 A;  1X4C A;  3SQG B;  2EW9 A;  2VBX A;  4ZLP A;  1H72 C;  3M7V A;  4IDK B;  4PR6 A;  5J2P B;  1KN6 A;  1VHF A;  3E2E A;  1RSC A;  4DPW A;  2AYG A;  2OAU A;  2F4V F;  1VQS A;  4ZCK A;  3RB0 A;  4N76 A;  1DQ9 A;  4RBV A;  3ET6 A;  2BAN B;  2OD4 A;  4H4K A;  2UV8 A;  1RDR A;  1KEK A;  4USI A;  1JLB B;  1NDK A;  3N5B A;  3MM5 B;  3TW0 A;  4ENO A;  1IM6 A;  4Y34 A;  1RUS A;  2QLX A;  4NZ7 A;  5KFG A;  4FS2 A;  1TEL A;  1HAR A;  2AJ4 A;  3AD8 C;  1X0F A;  2HZC A;  1CJV B;  3PYG A;  2HK3 A;  4H4M A;  1CEZ A;  1TMM A;  2A3J A;  3DRR A;  4KH1 B;  4Y28 C;  5G0R A;  3T5J A;  4PEO A;  3P5T L;  2CNK B;  3Q86 A;  4YB7 A;  4K4V A;  3GCX P;  1TZ0 A;  5L1I A;  2V5H G;  1JKH B;  4UW2 A;  4WU3 A;  1ROF A;  5K5M A;  1YRU A;  1JLG B;  2HND A;  3BDE A;  3OL7 A;  3MUT P;  1S9E A;  3TAM B;  2Z2M A;  3PX6 A;  1U8W A;  3QLH A;  2E1P A;  2E9T A;  1VQ4 S;  4B9N A;  2B51 A;  3QGI A;  4I7F B;  3LF0 A;  1V3R A;  2YPY A;  4CM2 A;  3TI0 A;  4JI4 J;  4F4W A;  2ZZN A;  3BQ0 A;  3MDF A;  1TKX A;  1FWK A;  1WSV A;  4Q8E A;  2ZH7 A;  4A8S A;  4J9N A;  3OL8 A;  3RRG A;  1M5P C;  5H9F J;  1NK9 A;  1RHM B;  3C2P A;  1L3K A;  4PG6 A;  1Z1Z A;  1FVS A;  3D3B J;  2MY8 A;  2MKJ A;  3M05 A;  2W01 A;  5A8W A;  3VAI A;  1VQP S;  4I67 A;  1TKZ A;  4AUK A;  3TA0 A;  1KLM A;  1WSR A;  1IBM J;  3HSD A;  3Q23 A;  2FTR A;  2G0J A;  4JI2 F;  3EVW A;  1D8Y A;  2HMI B;  2EFQ A;  2GJF A;  1I94 J;  4NZ0 A;  4LVO P;  2OLW A;  1CJK A;  1JB0 C;  3IGN A;  2IDL A;  1IKW B;  4IUF A;  4ZPT R;  4JI0 F;  4JI8 J;  2AHO B;  5KFI A;  2ALY B;  2D3Z A;  2OPR A;  5IWA J;  2LEB A;  4ERD A;  1IKV A;  1FRX A;  2NZ4 A;  2PMZ D;  3B82 A;  2VOD A;  2EC2 A;  2JSX A;  3QT5 A;  1NJY A;  1F3F A;  2HQF A;  4DL3 A;  3DOM A;  1IBM F;  1TKZ B;  4OLO A;  3PO4 A;  4PUO B;  4Y2A A;  4ATN A;  2XI3 A;  5HN0 A;  2DPI A;  3G6X A;  2ABY A;  2HHW A;  3UD5 A;  3JQK A;  3ZZY A;  3HFK A;  3IC1 A;  3M8Z A;  2ZH5 A;  2BQU A;  1N33 J;  1UCN A;  5KFZ A;  4X4R A;  2ASJ A;  2Y1I A;  3LOU A;  3P45 B;  1SPB P;  4FS1 A;  4JI3 F;  3VGT A;  3UW1 A;  3QJL A;  2RRN A;  1X9M A;  1JLE A;  1HBN A;  4JI5 F;  4LF5 F;  4NCA A;  1VOM A;  4RPF A;  3IMQ J;  5A0Y A;  2P6S A;  3HZE A;  4G1Q B;  1M90 T;  1VIS A;  1YJV A;  4UZC A;  2UVW A;  4B3S F;  4KAI A;  5H1S V;  2V0N A;  2XMU A;  5BYS A;  2YBV A;  4EUV A;  2E5L F;  1FKP A;  1MN7 A;  2KXF A;  4O3O A;  3G96 A;  3LGN A;  4HEA 9;  3W9H A;  3KLG A;  2YWG A;  4WWS A;  1WHY A;  1UPP A;  3NEK A;  3GR0 A;  3NS7 B;  2HS3 A;  4ETZ A;  2BM1 A;  2G0I A;  4NLX A;  2YNG A;  3BQ2 A;  5B0C A;  2WVD A;  4NCG B;  4M5N A;  2MGZ B;  3FKB A;  2XMT A;  4O4G B;  4U96 A;  1FER A;  2F8H A;  4DX5 A;  1QAY A;  5KT2 A;  1OYE A;  1VQL S;  4M5D B;  3ZZ0 A;  3DLB A;  2VOO A;  2DT9 A;  3OJU A;  3NCR A;  2PFD A;  3AOC A;  1BGX T;  1YG0 A;  5KTQ A;  1F5B A;  1E6V B;  2OO4 A;  3OT9 A;  3OTD A;  2QYG A;  3M9M B;  4DSK A;  5SUH A;  3TX8 A;  5KT6 A;  3L7P A;  3GFX A;  4CYU B;  3AY0 A;  4IO1 A;  3H40 A;  2CXE A;  3HZG A;  1C0T A;  3CJ3 A;  3KUH A;  1S77 D;  5D3G B;  1VCT A;  6FDR A;  1QDU B;  3MPW A;  3LP1 A;  1AZS B;  1HBM B;  1YLX A;  1O8B A;  2QL7 B;  3CW2 C;  4ID5 B;  5CD4 A;  3GFY A;  2MSS A;  3KLV A;  2XCP A;  1XJW B;  3PNI A;  2YKO A;  3NL0 A;  4R0E A;  3I9Z A;  2HG4 A;  2DD8 S;  1CJT A;  5F8H A;  2BJ3 A;  3AB4 B;  2YNF A;  4M5K A;  3MEG A;  1O51 A;  4C8M A;  2FLN A;  2QFJ A;  5B0F A;  3JQM A;  3CCJ S;  4Y2M A;  2WTF A;  3HCX A;  2ZVI A;  3OR2 B;  1WDT A;  1V3S A;  5L9X A;  4A8X A;  1NJI T;  3MM6 B;  4P10 A;  5FLX Y;  4NLW A;  3CC7 S;  2Y9H A;  4LFB F;  2DGX A;  2LU2 A;  2DGW A;  4BCA A;  2RKI A;  5HLF A;  4V19 X;  3BH6 B;  3EGZ A;  2MLX A;  3BH7 B;  1S0O A;  5KFH A;  1HNZ F;  4QYR A;  2XEX A;  1YVF A;  4LF9 F;  1RT2 B;  2AKW B;  5C42 A;  1ZA1 B;  3CO9 A;  1SC1 B;  1LEO A;  1QAX A;  3BO4 A;  4ETX A;  2B5J B;  2A2D A;  2GO9 A;  1BD6 A;  5FLX U;  1VGY A;  1XN9 A;  2R42 A;  2DR8 A;  3N0V A;  4DV1 F;  4NAS A;  3ZTP A;  4DL7 A;  1JKH A;  4ZVE A;  4Y65 A;  4I2Q A;  4HDG A;  4RO0 A;  1VQ6 S;  3BGR A;  2L9N A;  4XDD A;  5DET A;  4ZP7 A;  2C3O A;  4FVM A;  3AJ1 A;  1T94 A;  4LF8 J;  3MM7 B;  1UVN A;  2WW4 A;  2BJ8 A;  2UV8 G;  4H4M B;  2IVY A;  2DR6 A;  3HDS A;  4OX9 J;  3PYE A;  3TAR A;  1F9H A;  3KLE A;  3TA2 A;  4OYO A;  1NME B;  5LJ5 Y;  2XY5 A;  2CQB A;  1R8B A;  3J81 Y;  4X64 F;  2W9C B;  1IVZ A;  3BR9 A;  4KGK A;  2P2C B;  2MDA A;  1HMV B;  1HYS A;  1RT2 A;  5C42 B;  2DPJ A;  3Q8Q B;  4E2F B;  4R0J A;  1R6Y A;  5IM0 A;  3IGV A;  4L74 A;  3ZZO A;  3UCU P;  1WHW A;  3BKU A;  4K4X A;  3HHL D;  1FRL A;  1KTQ A;  4I7F A;  4CH7 A;  5EDW A;  4OLP A;  2COL A;  2ZZM A;  2HMI A;  4KE5 A;  3D66 A;  4IQM A;  4EGL A;  1QAJ A;  4IO9 Q;  1HI1 A;  4L72 B;  4YHH F;  3BKT A;  4K8R A;  2XLK A;  5F8J A;  2VG5 B;  1IKY A;  4FDF A;  5KFV A;  4C3K A;  1N54 B;  3JSM A;  1CUL B;  1UVK A;  4IH5 A;  3ZZP A;  3N9U C;  2W4D A;  4JV0 A;  1LFP A;  1U02 A;  4M5G A;  1HQ2 A;  1VDH A;  1RWX B;  1OSC A;  2R8K A;  4ED5 A;  2DO0 A;  3GJR B;  3HVA A;  3MEC B;  3CO0 P;  4U7U K;  2QL5 B;  1ZM4 A;  4DF4 A;  3SCI E;  3ZNU A;  3TUP A;  2R7V A;  1VK3 A;  3KLI A;  4USM A;  2HKE A;  2IBK A;  2V2V A;  1NK0 A;  1QSL A;  2KRR A;  2ZBC A;  3Q2T C;  1N56 A;  1SJ3 P;  2ZEJ A;  4FF2 A;  4IOC Q;  1ZPV A;  1GMU A;  2CJB A;  3AQO A;  5IOL A;  2FLP A;  4FKY A;  4NYO A;  2VG6 B;  4DR3 F;  4M5H A;  2HHS A;  1K0T A;  2AEM A;  3BKF A;  1JLA B;  4PG5 A;  4AE5 A;  4FXD A;  1S6P A;  4MKA A;  1RA7 A;  1U0S A;  1WWH A;  4KHP F;  1TU0 B;  2R2T A;  5B0B A;  1UZH A;  4YFU A;  1Y7P A;  1S6O A;  3CSK A;  1TL5 A;  1RAF B;  4OIX A;  2QA4 S;  3ILJ A;  4LQ3 A;  2CJX B;  3KK1 A;  4EK2 A;  5IT0 A;  4ECX A;  3QAT A;  2F8E X;  3IG1 A;  2ZKT A;  4M95 A;  2MXY A;  1N32 F;  4WFX A;  1NK4 A;  1CC8 A;  3TJ9 A;  1FI4 A;  1WOS A;  5HJY A;  3WIV A;  3J7Y I;  5A8R A;  1HNZ J;  1H7W A;  2FHO B;  1TKD A;  2E7X A;  3TWZ A;  3CD0 A;  3QWU A;  2VC0 A;  5B0G A;  3UVJ A;  2OPP A;  3NCQ A;  4CO2 A;  5B09 A;  3RRK A;  1GNK A;  4PPZ A;  1NDP A;  3W2V A;  2MKK A;  1K44 A;  2CPH A;  4UUX A;  4O3Q A;  4QW8 A;  1FK9 B;  3CCV S;  4YB1 P;  4NI2 B;  3GII A;  4C8Y A;  1H3D A;  1JLF A;  1RGV A;  2V4R A;  5K8M A;  2DGQ A;  3VAF A;  1NM2 A;  2KYZ A;  2RH3 A;  1NUE A;  4G1I A;  3DLE A;  1SVD A;  3IBW A;  4CLU A;  4CCH A;  1KLN A;  1KTV A;  1TVR A;  3FZ2 A;  2EBG A;  4ELU A;  1WTB A;  2DNK A;  2EC0 A;  2K1R B;  2OSR A;  1JWW A;  1UP1 A;  2DO4 A;  3GYN A;  1DLO A;  4OZ0 A;  3W62 A;  4KHP J;  3POT A;  2H4Y B;  5F9N A;  2FDN A;  2W2Q P;  4KT0 C;  4PG4 A;  3JQJ A;  1Q95 G;  4ED4 A;  5E7O B;  3G71 S;  3IM8 A;  3T5L A;  1DFD A;  4N47 A;  2LXU A;  5HQL A;  2DJW A;  1VIO A;  3M32 A;  3QNW B;  3Q8R B;  5KFB A;  4FYD A;  2XNR A;  2HND B;  2BZ2 A;  2OPR B;  3FBF A;  2PMH A;  1GT8 A;  4BWJ A;  1HNI A;  3DGV A;  3W7B A;  3UO0 A;  1PC5 A;  1LKZ A;  1NPP A;  2VFV A;  4WYL A;  3MUM P;  3HVW A;  3LP2 B;  3DU6 A;  1QUP A;  1S1T B;  4X4V A;  2WZ1 A;  4N8O A;  2K06 A;  3OTO F;  2RKI B;  1RAJ A;  2IM1 A;  5J2Q A;  1X9W A;  3PO5 A;  1FXL A;  1D09 B;  2MZR A;  1CPZ A;  4LT6 A;  3GE9 A;  1NZ8 A;  4U67 Q;  3M6V A;  5AXL A;  4O44 B;  3M1V B;  4ED3 A;  4LF7 F;  2RUS A;  4OYX A;  2V94 A;  3NGD A;  1CQM A;  3V4I A;  3FEX B;  3M30 A;  5I3U A;  1NXI A;  3V6H A;  5GAG I;  2U2F A;  4HKQ A;  2FIU A;  2VOP A;  3X1L B;  5CXT A;  2HK2 A;  2ZHA A;  2QZ8 A;  2K7J A;  2EI5 A;  4RWW A;  2FZG B;  4Z37 A;  1IWA A;  3HI9 A;  3KJV B;  4DN9 A;  2B7B B;  4C8K A;  1H0H B;  2J7U A;  1K1S A;  1S6Q A;  4EYH B;  1MMD A;  4HLB A;  3OLA A;  4OYA A;  3M6W A;  2RQM A;  3CCT A;  5K14 A;  4CTA A;  4UOG A;  1RKI A;  4C3M A;  4WF9 Q;  5CCL A;  4LF8 F;  4YOE A;  1QAI A;  5IC4 B;  5HAT A;  2QT7 A;  3VGU A;  3PHT A;  4NCG A;  1NND A;  2BW2 A;  4G65 A;  4QR0 A;  3CMA S;  1CBK A;  3BO3 A;  1W7W A;  2F65 A;  3AH6 A;  3M32 B;  4LSL B;  3DXS X;  3AOB A;  4DJB A;  2YQ3 A;  4JV5 F;  3TZW A;  3A3P B;  2JNJ A;  3MAA A;  4YEA A;  5IM0 B;  3OFG A;  4EZ9 A;  2KVQ E;  1VQ9 S;  2H5E A;  1NH7 A;  4KQZ A;  4N56 A;  5ADZ A;  4PG8 A;  4HHH A;  2D9P A;  3MGJ A;  1S57 A;  4WZQ A;  2PFF B;  4MK7 A;  5CYJ A;  2W9C A;  1Y11 A;  5IV3 A;  5F8G A;  1D1U A;  2V9W A;  2MZS A;  5AJ3 J;  3GB0 A;  2YKN B;  3CWJ A;  2LCW A;  2ZD1 A;  1D0E A;  3I55 S;  1EP4 B;  2I9S A;  3RR8 A;  1IN0 A;  3PX0 A;  1B70 B;  3FRZ A;  2R2R A;  2NR0 A;  4YUD A;  3FFI A;  3M8P A;  4ZVO B;  4EEY A;  1DTT B;  1PKU A;  4O23 A;  2ZBI A;  4RKU C;  2ZC4 A;  1WG4 A;  1JXV A;  3OHA A;  2BAC A;  1ZBT A;  4N77 A;  5FDL B;  3ONQ A;  1S76 D;  2BW7 A;  3VGS A;  3CNQ P;  2DNP A;  4ZPW R;  1EP4 A;  4JOU A;  5CAA A;  1AUD A;  3MUV P;  3A8K A;  1RTD A;  3ENV A;  2NPF A;  1EX8 A;  1U1Q A;  1VLY A;  5SZT A;  3K5P A;  3KLF B;  4K4Y A;  2QLW A;  1X7V A;  2HNY A;  2VG7 B;  4DX7 A;  5J2N A;  3QLH B;  5K8P A;  2L08 A;  2M9K A;  2QA1 A;  5KFM A;  2MHN A;  3UD4 P;  2EEY A;  5F8I A;  2IM2 A;  1M1G A;  2X1A A;  2CPI A;  2FQQ B;  2ZWP A;  3OBI A;  1XMB A;  2WK4 A;  2DEI A;  1N32 J;  2BJ7 A;  1O5J A;  2GZO A;  1JJC B;  1RB0 A;  5D4O A;  2V69 A;  2X1B A;  4ED8 A;  2KXN B;  1UAW A;  2FZC B;  3C6U B;  1FE0 A;  5E3Q A;  2CDR B;  2AJF E;  3FSY A;  4RWX A;  3TVZ A;  3M8Q A;  3NP5 A;  3O8W A;  3PJW A;  3CUN A;  2ZUA A;  2GMJ A;  3H90 A;  1N0U A;  1S6U A;  2HEK A;  3SEO A;  2UUC F;  2J9E A;  2N7Y A;  4B02 A;  4DCP B;  1TP7 A;  3DGP B;  4WFN Q;  2H5J B;  2JDJ A;  3GFZ A;  2XM3 A;  2PSZ A;  3M6X A;  1SKU B;  3RBD A;  5KFY A;  1ZTT A;  3P6Y C;  3L7O A;  4O0N A;  4HI2 A;  4EI2 A;  2UU9 J;  2QMX A;  3MFI A;  4MK9 A;  4F02 A;  3HHN B;  5T7L A;  1YBU A;  3S7R A;  3P49 B;  2HFO A;  2QX0 A;  2WB1 D;  2B6A B;  4IFV A;  2VFT A;  3D54 A;  3HT0 A;  1Q8I A;  1T0T V;  4G1P A;  2BDP A;  1CS4 B;  3DLK A;  1TTH B;  2RIJ A;  1RTI B;  2NLW A;  4C98 A;  2EK6 A;  5EWG A;  1JJH A;  4HH0 A;  2VF3 A;  4OYP A;  4PZV A;  5KOW A;  3QSY B;  1YJW S;  1FDB A;  3D0I E;  3KWM A;  4WXO A;  2CG4 A;  3UN2 A;  3S6E A;  1K1Q A;  5GAG U;  3AB2 B;  1ZM9 A;  3VAL A;  1IBL J;  2K3I A;  2DVI A;  2BOP A;  1EB0 A;  1YJT A;  4I69 A;  4K4W A;  5F3Z A;  4DS5 A;  2FJE B;  3KJN B;  1U6F A;  1SL1 A;  4CH0 S;  5BR8 J;  1U45 A;  2R7O A;  2E5J A;  1EKR A;  3DOK A;  4OZ3 A;  3MMC B;  1J27 A;  4K2J A;  5L9N A;  3ZZU A;  1S48 A;  4IDK A;  2YQ1 A;  2E1R A;  2XC9 A;  1SC3 B;  3CME S;  4ZMM A;  4NRU A;  3FDS A;  4AQY J;  4DX6 A;  1C1B B;  3EDR B;  1IBL F;  3WIU A;  5KOX A;  1R43 A;  3MAH A;  2YWE A;  1FNM A;  2GVD B;  1FO1 A;  2W8L A;  1DQA A;  2OFG X;  2RNE A;  3MTK A;  5HI7 A;  1DHM A;  2CPZ A;  2ILY A;  3Q24 A;  5KFS A;  1PG5 B;  1SV5 A;  1KQS R;  2DH7 A;  2F9J A;  1C4C A;  4ZVG A;  3W9J A;  1ELO A;  2FZK B;  2IRX A;  4FKX A;  5L1K A;  2C3M A;  3GPA A;  1DBD A;  3O44 A;  5IC6 B;  3IP0 A;  4QWE A;  1GMV A;  1TKX B;  5GAD I;  1HWU A;  3DLJ A;  1C1B A;  4ZIT A;  3C19 A;  3ADA C;  3J80 U;  1RT5 B;  3M8R A;  3L09 A;  2F40 A;  2GVZ B;  2NS1 B;  3TAP A;  4A4J A;  3GJT B;  5K9F A;  1F2G A;  2QMW A;  3HJF A;  2XYP B;  4MYU A;  2IA0 A;  2YX4 A;  3OXF A;  3SZ2 A;  1BWV A;  3EMT A;  3UNY A;  1SXL A;  2XO7 A;  1J5E J;  1SJF A;  2O1P A;  4FNI A;  2IM3 A;  2IYG A;  1P9Q C;  4JB8 B;  3AJD A;  2OTL S;  2JHE A;  1UWA A;  4DV2 F;  2KZZ A;  4J9K A;  2MY7 A;  3BN4 A;  4FYV B;  2FJV A;  2UVV A;  1LK7 A;  3C3L A;  4FF1 A;  3FCW A;  4YR0 A;  2F5G A;  4TN2 A;  2WCX A;  4PKD B;  4IOB A;  1KLM B;  4PAB A;  2DHS A;  2R7S A;  2ZDP A;  5B7W A;  5F9L A;  3CIM A;  4CO4 A;  3OFH A;  1S4F A;  2EXU A;  5CYQ A;  3IG1 B;  5DS7 A;  2KRB A;  4LF9 J;  4OI1 A;  2A6O A;  1PYS B;  5ETL A;  3OFF A;  5H9F K;  4KFB A;  2VU5 A;  5GVQ A;  1L3V A;  2WBM A;  3A12 A;  4Y3C A;  4XPE A;  3H5Y A;  3R6L B;  2ZH1 A;  4WE1 A;  4WJB A;  2GHV C;  4C8L A;  2D9O A;  1M5K C;  1WOP A;  3M8W A;  1WF2 A;  3MED A;  1C1C A;  5HRO B;  1RT7 A;  2WOM A;  3QQC D;  1L5U A;  4OZL A;  4JI6 J;  2DHH A;  3KMS A;  2DR5 A;  1NHV A;  3G6E S;  1WG1 A;  4CO1 A;  1MRO A;  4ELT A;  4HAC B;  3QIP A;  2XQC A;  1F60 B;  1Q53 A;  3T5H A;  3HM9 A;  2MKH A;  4C8N A;  3SCJ E;  1K9M T;  3D6H B;  2CKW A;  2UUA J;  3N5F A;  4CLY A;  3MM9 B;  3TAN A;  3DOL A;  2DR7 A;  5HL7 Q;  2M8D B;  3AD7 C;  3BSC A;  2OIH A;  1RT4 A;  2WW8 A;  3RU0 A;  4I0W A;  1HL6 A;  2YWW A;  4TQS A;  4X64 J;  2ZZT A;  3LP2 A;  4J9U E;  2W2P P;  3EXC X;  2HHT A;  2P9C A;  4LBI A;  5U47 A;  1KVI A;  2HAI A;  1NHK L;  1LFW A;  2CJ9 A;  5KAK A;  1CG2 A;  3BF4 A;  1R0C B;  1TKT A;  1U1N A;  1RT7 B;  2DHX A;  2NPI A;  2WOM B;  3JXO A;  3KG1 A;  4I56 A;  5KG1 A;  5BJR A;  2BM0 A;  1GFW B;  3LGH A;  2J9D E;  4LRC A;  3W9I A;  1JNZ B;  3SIP B;  5KFJ A;  1OQ6 A;  3OSN A;  4O3R A;  2HHX A;  1UFW A;  2OUG A;  3EGW B;  3LUY A;  4R8U B;  1WC4 A;  3OXG A;  4UF4 A;  4LF6 F;  2ZJQ Q;  1C4A A;  3G6Y A;  2V2Z A;  3ZTS A;  5EWF A;  3EPI A;  1IQT A;  3QT8 A;  1S9G B;  2EKN A;  3EE3 A;  3AFG A;  2SXL A;  3MM6 A;  1BQM B;  2HBY B;  1SH2 A;  2GX8 A;  4PXC A;  1T8E A;  2G4B A;  3C6T B;  1M5O C;  2MQM A;  2F4F A;  1H73 A;  3LWL A;  5D15 A;  1NK8 A;  1HNX J;  3LP0 A;  3TZY A;  3V4M A;  4QWD A;  2BE9 B;  2IVM A;  1WF1 A;  4M5M A;  2YX7 A;  1XNR J;  4X84 A;  2B4V A;  2RSQ A;  4R5P B;  2V2Q A;  4ZPD A;  4ZPV R;  2XSF A;  2LXF A;  4PWD A;  3NGK A;  4H54 A;  4UOF A;  3CJ0 A;  3PEJ A;  3TUZ C;  1BXN A;  2ZBP A;  4P72 A;  1U47 A;  3UPF A;  4Q0B A;  4QPX A;  1JLG A;  1YZ7 A;  3HHL A;  1RTJ A;  3ZZT A;  4ZVT B;  1CJU B;  2BJD A;  2LA6 A;  1PIL A;  4CLT A;  5B08 A;  5EX3 A;  2Y8W A;  1KRP A;  3DU5 A;  1GMW D;  4ECW A;  1HPZ B;  3PW5 A;  2O3D A;  5CYM A;  5EGY A;  2F8M A;  2YWH A;  4FBU A;  3I4P A;  1CSJ A;  3HSZ A;  4L73 A;  4OI4 A;  5HBM A;  1HD1 A;  4DN0 A;  3CJQ A;  2HQI A;  4OYM A;  1PJ6 A;  1N36 F;  3T1A A;  1HQE B;  1FDA A;  1GMW A;  2WAQ D;  5LMN J;  2R7T A;  2W8K A;  5HSP A;  5GMD A;  1NZA A;  2QC3 A;  2W7A A;  3DXB A;  3FEY B;  2JEI A;  4AND A;  1DTQ B;  1PCA A;  2OI2 A;  3CDB A;  1WI8 A;  2OEM A;  3EUN A;  1GEH A;  2P6T A;  3GG1 A;  3I0R B;  3VGV A;  3PV8 A;  2B0G A;  3UN5 A;  4KR0 B;  3MMA B;  1Y5L B;  1WHX A;  1Y10 A;  4WXW A;  1OY8 A;  1NAQ A;  1JLB A;  3BBC A;  3SMZ A;  3CCM S;  4X4U A;  3MCM A;  1U1R A;  4ZJQ A;  1VRU A;  2HBZ B;  4ECZ A;  1UEK A;  2AZ3 A;  2EFG A;  1U2C A;  2BV3 A;  3U02 A;  2XMW A;  2GC8 A;  5DQH A;  2CAJ A;  1HBU B;  3BS9 A;  3BGF A;  1U24 A;  2O5D A;  4X62 F;  1RT3 A;  1UJ4 A;  2H54 B;  3D0H E;  3KDO A;  3AQP A;  5KFF A;  3V6J A;  1MG7 A;  4JUZ A;  2J6U A;  5GAH I;  1EAR A;  2CQD A;  2IMO A;  2J0W A;  3NXZ A;  3T1Y F;  3HK2 A;  1RBL A;  2YH0 A;  1HYS B;  1LWF A;  4DQS A;  1WG5 A;  2QSF A;  4GKJ J;  4OHX A;  2JX2 A;  1X8D A;  3VZH A;  5KFN A;  5IV4 A;  3J81 U;  4NXM J;  2B3T B;  1Q79 A;  5J2N B;  1HHQ A;  1D3W A;  3NG8 A;  3MF5 A;  4DR1 F;  4DV4 J;  1RAA B;  3WHI A;  2EFP A;  1S1V B;  1X4H A;  1RAD B;  2VQE F;  1H74 A;  1PAE X;  2IPO B;  3HHK A;  3O6Q A;  4P74 A;  3H5X A;  5LMU J;  2UUW A;  1ULR A;  3QJJ A;  2Q6C A;  4NCB A;  2JLG A;  4OV6 A;  2WHO A;  3SV3 A;  1N34 J;  1EZZ B;  3MCS A;  1T9W A;  1QE1 A;  2CZ9 A;  1YBT A;  4F0M A;  4XIU A;  5CYQ B;  2MGZ A;  2A6M A;  2ZOM A;  2ZKU A;  5EN1 A;  1ZAW A;  2GV1 A;  4DL6 A;  2G1D A;  5CD4 H;  2IAJ B;  4H4K C;  5FII A;  2ADC A;  5F0W A;  1UL3 A;  2ACY A;  2HHP A;  1RJJ A;  1RAH B;  3MEE A;  3NBP B;  1Q8L A;  2CVE A;  2AV5 A;  3D2W A;  3GJQ B;  3NOC A;  1LNQ A;  1NPK A;  4X4P A;  2AU0 A;  1FJ7 A;  4NLT A;  1BQX A;  2ROG A;  1V9O A;  1WF0 A;  2PEB A;  1JLF B;  1SKR A;  1X5O A;  2HFV A;  4HR2 A;  3G8S A;  2HQC A;  3T41 A;  4NLY A;  4MK8 A;  4OI2 A;  3J80 Y;  3BSA A;  4UZB A;  2VFS A;  3C15 A;  4ECV A;  5ETT A;  2K1R A;  1WKL A;  2RQ4 A;  3V6D A;  1HR0 F;  3MR7 A;  4I2P A;  2VDI A;  3QRQ A;  2YX1 A;  3GMG A;  2C2M B;  1SL0 A;  1N36 J;  5LMU F;  3FEZ A;  4USH A;  4Q45 A;  4DR7 F;  4G3I A;  1XMO F;  5MAO A;  5M2P A;  4LQ9 A;  2U1A A;  1U1P A;  3H4D A;  4PQU B;  1IQZ A;  2IA6 A;  3N28 A;  2E66 A;  1MSW D;  2DIV A;  2OKQ A;  2Q79 A;  2F7V A;  2YWK A;  1A7G E;  1FDD A;  2G2Y A;  2J6S A;  1UW4 A;  4HTI A;  4DUT A;  3C6T A;  3CC2 S;  5LSL A;  1FE4 A;  1M5V C;  2ALZ A;  3KOA A;  3MR6 A;  3OLB A;  4TY8 B;  3D6F B;  4A48 A;  4IG0 B;  4OX8 A;  1NB2 A;  1QJH A;  1HFE L;  1NKB A;  2IRY A;  4O44 A;  4X62 J;  1V5I B;  3BGU A;  2B9X A;  3FJ2 A;  4QIF A;  2W7P A;  1ACM B;  2AP6 A;  3BDP A;  5DZ7 A;  3KK3 A;  2KU7 A;  4DR6 J;  2L41 A;  4ILR A;  3NAI A;  3PZP A;  3PW7 A;  1M1K T;  1P6T A;  1HA1 A;  4F26 A;  2ZH2 A;  2XY6 A;  2OEK A;  4DV5 J;  2Q6B A;  2MMY A;  3MM5 A;  1HNW J;  3H5S A;  1AZS A;  2FC8 A;  2XZD B;  5FD1 A;  3B6B A;  3AA8 A;  4F4A A;  1Y5I B;  4IG0 A;  3CF5 Q;  3DM2 B;  4NLU A;  4PQU A;  2VFU A;  1JMT A;  1S79 A;  2I38 A;  2BKO A;  2GIQ A;  4QIW D;  5MLC V;  3JB9 k;  2C2D A;  4DOZ A;  2KM8 C;  5GAH U;  5E0O A;  2X7I A;  5E5N A;  5G0R B;  1FDN A;  1JK9 B;  9ATC B;  2GFF A;  2A1B A;  1RAO A;  4K50 A;  4LSZ B;  4CDI A;  3I32 A;  3CVK A;  1EET A;  3DDN A;  4TNO A;  1J2V A;  1YJ9 S;  1UA0 A;  5HAN A;  1QUV A;  2XYH B;  2BUN A;  3V4I B;  3P96 A;  2CQ1 A;  3M1V A;  1MU2 B;  1U0H A;  1NLK L;  1J5O A;  4MKV A;  1TL7 B;  2CYY A;  2Z8Q A;  3ICL A;  5EHH A;  2A10 A;  2VG5 A;  4H4O B;  4P2M A;  4RR5 A;  3AHP A;  5C24 A;  1MLA A;  3V5R A;  4QW9 A;  1N5Q A;  4TLR A;  1XBW A;  2G1H A;  4OX9 F;  2IJN A;  3KK2 A;  1S1W A;  2HAF A;  1I51 B;  4DFM A;  4HHJ A;  1QVG R;  3MFH A;  1FXD A;  2NSC A;  4GKK F;  4WE1 B;  1JJ2 R;  1U6Z A;  5IT9 Y;  3BJY A;  1OY9 A;  3L3C A;  3R7S B;  2BVZ A;  2G2Z A;  3OPK A;  2WBR A;  3QO9 B;  3K59 A;  5CYM B;  2KL8 A;  4V19 J;  3AD9 C;  2IY5 B;  1NPR A;  4EU0 A;  2FGC A;  4ZK7 M;  2BKN A;  5KG4 A;  1VQ7 S;  2VHG A;  3J7A N;  5CH7 B;  3G86 A;  2MKC A;  2QV6 A;  1T3N A;  2FPH X;  1PBU A;  1Q5Y A;  2QLB B;  4LFC F;  3PJX A;  4OI0 A;  1KS2 A;  1SH3 A;  2M2B A;  3M4X A;  2IJF A;  1S1V A;  1XTZ A;  5LJ3 Y;  2HPU A;  2VPX B;  4B9S A;  3R7N B;  2DKO B;  3DOK B;  1OJ4 A;  5E3A A;  2K8G A;  5LSO A;  3W8P A;  4B3M F;  1TAU A;  3RTV A;  1U25 A;  1YTY A;  3JAM Y;  1MU2 A;  4RW7 B;  1X9S A;  4C8Z A;  4Y2K A;  1RA6 A;  1VR6 A;  4QPT A;  2QFI A;  2RS2 A;  3C66 A;  1IBK J;  1WC6 A;  2KHD A;  1R31 A;  4ECS A;  4UY8 5;  1WKJ A;  2QSW A;  3G82 A;  1VIX A;  3MWB A;  4J7C A;  3DHW C;  3RBX A;  3SSR A;  3VV2 B;  2IAJ A;  5CZX A;  5KFC A;  3GIK A;  3I6P A;  4E8U A;  3ENQ A;  3DLG A;  4KPY A;  2XG8 A;  4O4R A;  3CCZ A;  3CJK B;  1JLC A;  4EZ6 A;  4K4Z A;  2FLL A;  2ZBR A;  2A0F B;  4DUZ F;  2HVD A;  3THP A;  5DLF A;  1FT8 A;  2DHG A;  2IC3 B;  1FES A;  3KHR A;  3C16 B;  3IS9 A;  3IRW P;  1CLF A;  1RBO B;  2OGU A;  2MLY A;  2V34 A;  2ZVS A;  2NQP A;  4OZJ A;  4RUA A;  1RAI B;  4F2R A;  3SQG A;  2YWF A;  4G6V B;  3P4U B;  4FNH A;  1OPZ A;  4KGM A;  4F0H A;  4ZVH A;  1QSY A;  1SJ1 A;  4PQA A;  2FVP A;  1HKA A;  2C1E B;  4GO5 X;  3G8Q A;  2ZH3 A;  2XY7 A;  4JI0 J;  2MJU A;  4NL5 A;  2JEF A;  1URN A;  5L8R C;  1X5P A;  1LK5 A;  5KFX A;  3KLH B;  2APO A;  3VHQ A;  2QTW A;  4RU9 A;  3PKY A;  4ILM A;  3WBZ A;  1WC5 A;  2ASD A;  3FQL A;  1TK8 A;  2Q3P A;  3PR4 A;  1DAR A;  1UEV A;  4IRD A;  2QMU B;  3JYT B;  1RYS A;  1IWG A;  2Z30 B;  2FJA B;  2ZH8 A;  4Y00 A;  1FF2 A;  1ZZN A;  3VAG A;  2CQG A;  2LXI A;  4ZCI A;  4W90 B;  3M8Q B;  3BZQ A;  1B99 A;  1N5T A;  2EFO A;  3GWC A;  4J9V A;  1RHQ B;  3LO3 A;  4Y0F A;  1NK6 A;  2HIQ A;  2IYI A;  1GTH A;  2GO8 A;  2MZT A;  3T5K A;  3IXQ A;  2FVR A;  3NOG A;  5K8N A;  3S8S A;  1VC5 A;  3HKZ D;  5KFK A;  4KH0 B;  2OEJ A;  3BSN A;  5B0A A;  2GAH C;  1VQK S;  2CDQ A;  2AYB A;  2RDD A;  4JI1 F;  3VCD A;  2UXB F;  1YI2 S;  2VBW A;  4UOH A;  1N5V A;  1VYA A;  3FZB A;  1FK9 A;  1T3O A;  2K2P A;  3W66 A;  3LWM A;  3DYA A;  3W5Z A;  4ANC A;  2VQF J;  2LQB A;  2HNZ B;  1KOO A;  3UR3 C;  4F3O A;  1APS A;  2B4O A;  1RCO B;  2CNL B;  3KFW X;  4NA3 A;  3CD7 A;  2OPP B;  3H0P A;  4UST A;  5M2R A;  3LAM A;  4RW4 B;  4O3P A;  4BHQ A;  2W4C A;  3EPG A;  5FJ4 A;  2MQP A;  3NGT A;  1U7L A;  4ICL B;  4OI3 A;  3ISN C;  4OYB A;  1SQG A;  1Q81 T;  2E5L J;  4JYA F;  1B0V A;  3K5O A;  2CQ3 A;  5HQM A;  3IR5 B;  1JXL A;  4A47 A;  3VAH A;  5J1P A;  2F9D A;  4P7V A;  3ZTQ A;  3IBC B;  4JI2 J;  1WOO A;  4WYW A;  4ZLJ A;  4DPU A;  5C25 A;  3CCS S;  1ZAX A;  2OHD A;  4KRW A;  3KMQ A;  2RU9 A;  3KG0 A;  5A8W B;  3PHE A;  2B4P A;  4MAK A;  5A6P A;  3B4D A;  5DQG A;  2VIC A;  1S72 S;  1QE1 B;  4NZ6 A;  2XZT B;  2J9D A;  1V3Z A;  4LIR A;  5G4D A;  3R5B A;  1Q1K A;  1CQN A;  4DPT A;  5K8O A;  3GV8 B;  1NSA A;  1S12 A;  2HFN A;  5D4L A;  2BOA A;  4PYA A;  6FD1 A;  3I96 A;  1BUX A;  4L76 A;  5E3C A;  2KDO A;  4KTQ A;  4EBC A;  4J5O A;  1ZM3 A;  1WAC A;  3TAQ A;  3CJT A;  3TEH B;  4RZR A;  3PCO B;  3U1N A;  1RU1 A;  1TQL A;  3H8Y A;  2ZH6 A;  2IJR A;  3CJ5 A;  4HL9 A;  1HQU B;  4B17 A;  4B3R F;  1AFI A;  4M5L A;  1Y9O A;  1Y4Z B;  1QY7 A;  2PGC A;  3FRY A;  4Q7A A;  2DNQ A;  1RWN B;  2HLT A;  1L3T A;  3RW6 A;  2V8H A;  1NB7 A;  3M6U A;  1JNR B;  1RTH A;  3HHD A;  4J9Q A;  1FFW B;  3KYL A;  1MNE A;  2WSE C;  3C14 A;  4A8W A;  2RVJ A;  4JYA J;  4LR7 A;  3MED B;  4PAA A;  1F3V A;  3MM8 B;  3GV7 B;  1UFL A;  2N4C A;  2DXE A;  4J37 A;  2Y1J A;  3D0G E;  4RUB A;  4DWI A;  1FJG J;  2YNI B;  1ZOT A;  4HAC A;  2YKM B;  4KFB B;  2H5I B;  4USV A;  2BAB A;  4CLL A;  2J6T A;  1IKY B;  1Y00 A;  2BRK A;  4QBU A;  3MPD A;  4LIW A;  4DL4 A;  3HKW A;  3I82 A;  5KFL A;  5A8K A;  3SBM A;  1FRJ A;  1YKW A;  2MLZ A;  4RW9 A;  2LA4 A;  5KG3 A;  2VJU A;  5J2P A;  5HRO A;  1FD2 A;  2GAG C;  2VPW B;  3FCH A;  4TKT A;  4E0D A;  4DR3 J;  3D67 A;  2JLE A;  4OJ3 A;  1N52 B;  4OYI A;  2H3E B;  1MW7 A;  4NLP A;  1ZET A;  2XGP A;  1QD1 A;  3M30 B;  1B64 A;  4J9S A;  4AXJ A;  2HQ3 A;  4K2X A;  5D0H A;  4DFJ A;  3DFE A;  2VD3 A;  2YKP A;  1X4A A;  1TL1 A;  2AF6 A;  2RUG A;  5HO4 A;  2OH2 A;  3D1O A;  4DEZ A;  4YS2 A;  4B3R J;  2H1Y A;  2YQ0 A;  1YRX A;  5DM6 Q;  3JS9 A;  1LWC A;  2DCU B;  3IWX A;  5J1N A;  5BYQ A;  4X4S A;  2LYV A;  2B9Y A;  4P2S A;  4YME A;  3CD6 S;  1IM4 A;  1MWQ A;  2DNL A;  4FYW B;  1I94 F;  2XSJ A;  1X5S A;  3D7S B;  8ATC B;  3OTB A;  1XC9 A;  4AT1 B;  3N79 A;  2AGQ A;  2VKZ G;  4KO0 A;  1S1X B;  1FRH A;  1TMJ A;  4HT5 A;  4B3O A;  3SCL E;  2R7R A;  5JJB A;  2LFV A;  5D0E A;  1BHN A;  2BRL A;  2N3L A;  3T1H F;  4X4T A;  5DO2 A;  3I87 A;  4CWB A;  4DR4 J;  4CT8 A;  3ITH A;  1ZS6 A;  4B9L A;  4OHZ A;  4PWW A;  2ACM A;  2C3U A;  3DCA A;  4YY3 J;  2WSC C;  5HLF B;  2YNF B;  4I2Q B;  1ZZF A;  4KB7 A;  3ZO7 A;  9RUB A;  1G2E A;  1S1W B;  1R89 A;  4WBF A;  2WRM A;  1TK0 A;  3D68 A;  3KUG A;  3BV8 A;  2JFK A;  3RBE A;  1L3S A;  1KSP A;  3OL9 A;  2HZA A;  3KHL A;  3PVX A;  2IMW P;  1PYT A;  2VPY B;  2CPE A;  2YH1 A;  2BE2 A;  3CCR S;  2XSJ B;  3HD2 A;  1IKW A;  1S7I A;  3OHB A;  3LP0 B;  2HWH A;  1LWF B;  2KFN A;  2KFZ A;  4YY3 F;  3MZI A;  4RBU A;  5KFP A;  3QT6 A;  4B9V A;  3AOD A;  4GC7 A;  4AD6 A;  4CLF A;  1S9G A;  2PN6 A;  5LXR A;  2R8I A;  5DG7 A;  1Q82 T;  4CIO A;  1HWL A;  1U0H B;  2XBP A;  2DB1 A;  3N6L A;  4TXS A;  3QAU A;  4JI6 F;  4ZOS A;  3ZZZ A;  4X66 F;  4PCQ A;  2FVQ A;  1B4S A;  3D3C J;  3I9V 9;  4ES2 A;  2DNY A;  2ZC3 A;  3MUR P;  2YY3 A;  4B9M A;  2OFH X;  4LRD A;  1E6Y A;  4ZIV A;  1N5S A;  3JTN A;  2G13 A;  2GGP A;  4Q43 A;  2YXL A;  2XWX A;  1R0A A;  3ENA A;  4DSE A;  1SJR A;  4KHR A;  4DZD A;  4WFA Q;  3PYD A;  4P71 A;  2PT0 A;  2M8H A;  1Q78 A;  2HS4 A;  4J91 A;  2AMC B;  1U09 A;  2LQ9 A;  2CPJ A;  2L3M A;  4OV1 A;  3AAW B;  4ALZ A;  2VB6 A;  4GVL A;  5DGA A;  1CUL A;  5DQI A;  4LF2 A;  2UXD F;  2PMW A;  2XLI A;  4CLW A;  4I2P B;  3ETM A;  3Q8Y A;  1P1L A;  3NCP A;  1S1T A;  4P6Q A;  4CLP A;  4X4Q A;  3PW2 A;  4DR7 J;  1WEX A;  2J9C A;  4F3M A;  2KH9 A;  2W9B B;  2R2U A;  2Q43 A;  3SFU A;  4OHW A;  4TU8 A;  1AFJ A;  3FSX A;  2BMB A;  4M5D A;  5HBM B;  1UFK A;  1PIE A;  1R3N A;  5DGB A;  2DXF A;  2MQN A;  1G6B A;  2VPZ B;  3O3L A;  1S6Q B;  2PD1 A;  2UUT A;  4LSN A;  1JLC B;  3HFV A;  4CLS A;  2ERR A;  2LLZ A;  3L7U A;  2R7U A;  2UXC J;  1IXK A;  5F3T A;  3VVU A;  1VBY A;  2F3J A;  3GZ7 A;  2FHM A;  3CCQ S;  3U27 A;  3IS9 B;  5EX0 A;  4AXI A;  3KLI B;  4J9R A;  5KG6 A;  2HQG A;  4OJG A;  1VJQ A;  3Q8P B;  2HVI A;  4Q8F A;  1GH8 A;  1VFJ A;  1YZ6 A;  2XHC A;  1MML A;  3HO1 A;  4HH1 A;  2D3U A;  1T11 A;  1UW9 A;  2QL9 B;  2FY1 A;  1X4B A;  2NXJ A;  5D77 A;  2O01 C;  2ZWO A;  3JSB A;  3KXD A;  4LFC J;  2CZ4 A;  1OPI A;  2GML A;  2QYC A;  4PUO A;  4QYZ J;  3W61 A;  2HUR A;  3UCZ P;  3MOJ B;  3CCW A;  1HNW F;  5IS2 A;  3R5A A;  3V6K A;  1BY9 A;  2KKH A;  4NLV A;  2RHS B;  2OPS B;  1CJK B;  2LQJ A;  4RW6 A;  4DR2 F;  4ECQ A;  3ISN D;  5KG2 A;  4PXE A;  1VMB A;  2FJX A;  5M2U A;  2OPQ B;  1SBR A;  5D4P A;  2V9K A;  1FRI A;  4QIV A;  2DIT A;  3MMC A;  4M8L A;  3VR1 A;  3ZTR A;  3D1H A;  3W60 A;  5BR8 F;  2R8G A;  3R1L A;  4HTJ A;  1KQG B;  5ETM A;  3RAM A;  4USW A;  2NXU A;  3BYR A;  5ETN A;  2E29 A;  2M4M A;  4LF6 J;  4C7Q A;  5DRK A;  2Z2Z A;  5LOQ A;  4O3N A;  2H9Z A;  2VON A;  1EET B;  5HAO A;  2OPS A;  3FUY A;  4RW6 B;  4DUZ J;  4EBE A;  3NKY A;  4FVC A;  1DRZ A;  4ELV A;  3W2V B;  4AL6 A;  2HYI B;  3V81 B;  1QTN B;  1VJW A;  4OHV A;  4RLE A;  2PE8 A;  2CA9 A;  2MQQ A;  2W7O A;  2ADB A;  2NZC A;  1UZD A;  4OJH A;  3W3S A;  1IJE B;  4F04 B;  5KG5 A;  4C4W A;  3L4B C;  4LJM A;  5J2M A;  2ZUG A;  1DTT A;  1FWP A;  3A8J A;  4RX6 A;  4KKO B;  2QE5 A;  1LWX A;  1REV B;  1S1U B;  1A6L A;  2V67 A;  1F1B B;  4ECR A;  2FJB B;  3L95 X;  8AT1 B;  4LFB J;  4N8N A;  3K7R A;  3NMR A;  4X4O A;  2ZIT A;  1UKU A;  1HBO B;  2AIR B;  2LDY A;  1AXQ A;  2M5Y A;  2Y0S D;  2Z58 B;  2ATL A;  2YNH B;  1AUS L;  3FMB A;  2C28 A;  3BRE A;  2R2S A;  5D8H B;  3KUE A;  2WON A;  2Q66 A;  1R6V A;  2DRD A;  4QU7 A;  1FKP B;  2NXE A;  3GCW P;  3SYZ A;  4FXV A;  1YBA A;  2GIF A;  3FNN A;  3JTO A;  2ZH4 A;  1PJ7 A;  1IR1 A;  5K20 B;  4AL7 A;  4CZC A;  1KQK A;  4TU9 A;  3UE2 A;  5IWA F;  3W5X A;  5A6W A;  3CD5 A;  4CYU A;  1AYE A;  4RBT A;  3RW7 A;  1HBO A;  4NYP A;  1H98 A;  3KK3 B;  1GXU A;  2F1F A;  5T41 A;  2B9E A;  1WNE A;  3MM9 A;  3TX0 A;  5E3P A;  3S01 A;  3VWS A;  2ZOG A;  1QM9 A;  5ETK A;  5AXK A;  1EIY B;  1ZM2 A;  4FF3 A;  3RB3 A;  2ZJP Q;  3SXL A;  4P7T A;  4OZ5 A;  5DDO C;  1VRT B;  2DYA A;  1YK9 A;  2DH8 A;  3AJ2 A;  3O2I A;  1QLN A;  1OSD A;  1EQM A;  1XNR F;  2KM8 B;  3G82 B;  5LT5 A;  3HVR A;  3R2C J;  2XGQ A;  1P9Y A;  2FHJ A;  4GRS A;  2GA7 A;  2JH3 A;  3BPD A;  1O0P A;  3F56 A;  3R97 A;  4DZ6 A;  4QWA A;  1HQE A;  4M63 A;  4B3T F;  2LEP A;  4TYA A;  5IQ6 A;  2DGU A;  3K5M A;  4E98 A;  3SV4 A;  1NK5 A;  3IO1 A;  1MWZ A;  4LF4 J;  2HSE B;  2M52 A;  3PTW A;  4CNY A;  5HJX A;  1N8R T;  4NXN J;  2IRU A;  3DI6 A;  3CDE A;  3SDE A;  1VQO S;  4F0K A;  5I3Q A;  1JLQ A;  3TP2 A;  3A8E A;  5C5J A;  4F7V A;  2MQ8 A;  2FC9 A;  1OO0 B;  2ZOF A;  3GIR A;  4DV0 F;  4DS4 A;  4XO0 A;  3FFI B;  3M8P B;  5F41 A;  5HVF A;  3LH2 S;  4WP9 A;  3PRV A;  1EHW A;  4R8U A;  3VVT A;  1FVQ A;  3OTO J;  3PYF A;  3CCE S;  1KC8 T;  2B43 A;  1TUW A;  2DNZ A;  1X0P A;  3LGM A;  2HGN A;  2HGL A;  1GTE A;  1SCJ B;  5JVG Q;  1GAO A;  3EJM A;  2A2C A;  1S10 A;  3UN3 A;  3DRS A;  2UVU A;  4PPD A;  1FX2 A;  1JLQ B;  4GVB A;  4PXD A;  1X4G A;  4USU A;  5B0E A;  1ZTW A;  2J0S D;  2GVD A;  2XTJ P;  1TL1 B;  1FNX H;  3ELH A;  4LMZ A;  3PW4 A;  4ZA1 A;  4XAK A;  3ZC4 A;  2GNK A;  4ZVF A;  3M9O B;  4A8O A;  4C6A A;  4P2X A;  2Z57 B;  1V5V A;  4J9P A;  1B0P A;  1NDL A;  2YKN A;  3OTE A;  1G4C A;  1R8P A;  1AW0 A;  3HX9 A;  5IQQ A;  2ATC B;  1D9A A;  1RWU A;  4H4O A;  3CIZ A;  1IR0 A;  1GXT A;  4RNM A;  3K57 A;  3NNH A;  1BMQ B;  4WCE Q;  1P8G A;  1RWM B;  2V2K A;  2W2M P;  2DK2 A;  2XMA A;  2QIF A;  4NXN F;  4DCO B;  2RD5 C;  3R5G A;  3R1H A;  2V6A A;  5AXN A;  2F4V J;  3UQS A;  1TR0 A;  3RR7 A;  4C0H A;  3F41 A;  2H51 B;  5D0R A;  2VL1 A;  5EWE A;  3H20 A;  4OI6 A;  1YX2 A;  4TQR A;  1YSJ A;  4P73 A;  3AT1 B;  1YIJ S;  1NSQ A;  3I5C A;  4C8O A;  3OUY A;  1IBC B;  3DGP A;  3CT9 A;  4LSN B;  1RU2 A;  1YGY A;  3MI7 X;  1U2F A;  4AQY F;  1Q16 B;  1KBR A;  2QA2 A;  1R0B G;  2I8E A;  3IM9 A;  3QFH A;  3ULH A;  4B08 A;  4Z2X A;  2RU3 A;  1WI6 A;  3OL6 A;  2C2R A;  4MT1 A;  5DDR C;  5DJB A;  5KFU A;  1CVJ A;  2FYX A;  4KGX B;  2AT1 B;  4ZVU B;  3C6U A;  1H6K X;  2CPD A;  3R7B B;  4Z7Y A;  3HXM A;  3K0J A;  5J2Q B;  4QU6 A;  1XR6 A;  4DMZ A;  2VA2 A;  1BQN B;  4I6W A;  4NWB A;  1EKS A;  4ZLN A;  3TR5 A;  3AXM A;  3BGO P;  4F4Z A;  2D3O 1;  2E7V A;  2BQR A;  4JI5 J;  4LF5 J;  4K0K F;  3H2U B;  5D78 A;  1EQ0 A;  2Q1L A;  1WEZ A;  2VG6 A;  1KQF B;  2RQC A;  2M88 A;  3T3F A;  1W26 A;  1LOU A;  2B8Q A;  2RRB A;  4I1T A;  4KPC A;  3M9N B;  1U1M A;  1A9N B;  1R8C A;  5DG9 A;  1R0A B;  1C0T B;  3DLH A;  4DG1 B;  4QJV A;  4OZ1 A;  2JWN A;  1B7Y B;  1UVI A;  4LF4 F;  3M2V B;  4RU2 A;  3ILI A;  1FEE A;  2FB0 A;  2XI2 A;  5C25 B;  3HUL A;  2AWZ A;  2DXD A;  4P2F A;  3IR7 B;  5GAD U;  2GMH A;  3W8G A;  3U1L A;  1FX4 A;  1VRU B;  1FTC A;  1TUV A;  5ETV A;  4K0K J;  2PII A;  1U1L A;  5L1J A;  3DLL Q;  2QO3 A;  1Q7L B;  2HHH F;  2CJY B;  4NLQ A;  3JSR A;  1D9D A;  3MPU B;  3KTQ A;  2FVC A;  4Y6I A;  1XEZ A;  1H7X A;  3H5U A;  4DPO A;  4DU8 A;  1I1G A;  1XR5 A;  4CLZ A;  2KG0 A;  1RBA A;  4YHH J;  4Q2L A;  2DCL A;  3V81 A;  1LW2 B;  1UWB A;  1IR2 A;  1UMJ A;  3KDN A;  1ZPW X;  3FBC A;  3GV5 B;  4FBT A;  2XHW A;  3QRP A;  2R7X A;  4WIQ A;  4IRK A;  2DRB A;  5J2M B;  4U8Y A;  1BQM A;  2VDH A;  5A8R B;  3R3T A;  2MZ1 A;  3QJP A;  4IH7 A;  3NWR A;  2IDE A;  2O67 A;  1KVJ A;  3DRP A;  1T9T A;  2GVZ A;  1T9V A;  3SSS A;  5KFW A;  1S9F A;  2P5V A;  1IKV B;  5A76 A;  3EM1 A;  3FBE A;  1RHK B;  2CQC A;  2ZD1 B;  2KT5 A;  2VFR A;  3C15 B;  3LAL A;  4WFZ A;  4DPX A;  1WC3 A;  2WB4 A;  3TVY A;  4NLD A;  3MTJ A;  1RWK B;  2GHW A;  1H38 A;  2DH9 A;  2XCA A;  1R8A A;  3EYZ A;  1GQE A;  3M2V A;  2OEL A;  4BS2 A;  4DV1 J;  4KC5 A;  2HBR B;  2ZM6 J;  3G9C A;  4DR6 F;  1X4E A;  4MTP A;  4DUY J;  1OMS A;  4ID8 A;  4DV7 F;  2BEF A;  2ZE2 B;  3K5L A;  3DYA B;  2X51 A;  3HT3 A;  4DV5 F;  3PX4 A;  3VAK A;  1Q0N A;  3TUI C;  4AFF A;  1KNZ A;  3HSG A;  3QGG A;  2MKS A;  3CE8 A;  1VQM S;  3Q83 A;  2ROE A;  2FLO A;  2UZA A;  4GC6 A;  2OSQ A;  4MJK A;  2K3K A;  3Q8V A;  4TU7 A;  3T1H J;  3QT7 A;  3EVO A;  5HMY A;  2OD6 A;  1DY3 A;  2P8I A;  1RCX B;  2RJZ A;  4AL5 A;  1E6V A;  1KWM A;  4B3O B;  4EFA C;  2D41 A;  2VBZ A;  3K8W A;  2Y8Y A;  5IZH A;  4ED6 A;  1PSD A;  2KJV A;  2MST A;  4Y2I A;  4CO0 A;  3KJF B;  2C22 A;  1WEL A;  3M2R A;  1WC0 A;  4FYY B;  3GFH A;  3I0R A;  1GX6 A;  2A18 A;  2FD2 A;  4WTO B;  2DIS A;  2NUH A;  3UNG C;  3W1Y C;  3QBC A;  1YJ7 A;  1S9E B;  2KVI A;  3TZX A;  4C9D A;  1S97 A;  3MEC A;  4GO7 X;  4ID5 A;  1H2V Z;  5I3U B;  1F9E B;  3EX7 B;  3TQ1 A;  1VQ8 S;  4Z7C A;  1ZH5 A;  2HHU A;  3EIC A;  1XK8 A;  3HF5 A;  4NMX A;  1YDL A;  3DHX A;  3QZ7 A;  1IJF B;  4ECY A;  1UTA A;  3BM7 A;  2YNH A;  2VA3 A;  3PAC A;  1MRO B;  4KBI A;  1KP6 A;  4N5S A;  3X3U A;  1KFS A;  2BJ1 A;  1GX5 A;  1TL4 A;  2HWT A;  3LAN A;  2IFX A;  4I64 A;  3T1Y J;  1NHU A;  2GHP A;  2RF2 A;  4LR8 A;  4ZPC A;  1RT4 B;  4DCJ B;  3KJV A;  4Q44 A;  1OIA A;  4NYZ A;  4RW9 B;  3DOL B;  2FY8 A;  3LPE A;  4PWU A;  2GQ2 A;  1NSP A;  3LA0 A;  1SC6 A;  2PDA A;  3KKF A;  3BGL A;  1T05 A;  1OQ3 A;  2MQL A;  2VZ9 A;  3PFE A;  4NML A;  5HMW A;  4ER8 A;  3R5J B;  1HWK A;  3B4M A;  3OQ2 A;  5ETS A;  3DLG B;  3NAH A;  2N82 B;  4DV2 J;  3C46 A;  5HK4 A;  2DBB A;  3H4B A;  4OL8 A;  3A4T A;  3I0S B;  3F44 A;  4C3L A;  3G6V A;  1NO8 A;  1U1O A;  4LF7 J;  1RT1 B;  3OR1 A;  2RRA A;  4KJI A;  3E01 A;  2UUC J;  1FTR A;  3M2U B;  4DQQ A;  3KK2 B;  1IUJ A;  2PA3 A;  3Q89 A;  1KVK A;  4HHU A;  3G87 A;  1RE1 B;  5KFA A;  5GMK a;  4ECU A;  2RT3 A;  2RS8 A;  4J9M A;  4IQX A;  2UU9 F;  1PO6 A;  3FSI A;  1RHU B;  3Q2S C;  4QWB A;  2AGO A;  5AT1 B;  2DNH A;  1HNV A;  5JXS A;  1QTM A;  5AE3 A;  3OR1 B;  4WZM A;  3QGP A;  3KHG A;  4WP8 A;  2H65 B;  3NY0 A;  3JYT A;  4DFK A;  3VAJ A;  1R8H A;  4ZIW A;  4U7C A;  1NEE A;  2QLJ B;  4JI7 J;  5GME A;  3KLF A;  2VH7 A;  5F8L A;  1SUQ B;  4PWD B;  1RWV B;  5L46 A;  2CNO B;  4ZVP B;  4LRB A;  4IR9 A;  1U4B A;  1RT1 A;  1VI7 A;  2W2O P;  4NOH A;  3OXL A;  4OQJ A;  2X3D A;  3I5B A;  1HNV B;  3C8Y A;  2IBO A;  4DSJ A;  3PM9 A;  3WC0 A;  1F9F A;  3DMJ A;  1HIY A;  3GTY X;  1G1X A;  5HP1 B;  2Z4P A;  2HRT A;  3NLC A;  1SC4 B;  4DR1 J;  4UY8 T;  4K4U A;  1S1X A;  2BXJ A;  4PXB A;  4OHY A;  1RHJ B;  1Q5V A;  4UQT A;  2CRL A;  1U26 A;  3CB4 A;  1VS3 A;  1NKC A;  1QVF R;  4K5S A;  4RJV A;  4ZP9 A;  5AJ3 F;  3J7Y U;  2BBE A;  3ISZ A;  1T9Y A;  2DIU A;  2XS7 A;  4O4G A;  2WVB A;  3HVT A;  3MMA A;  4V1A k;  5LM7 E;  2BAN A;  4ZHR B;  2XMK A;  1YQH A;  1T95 A;  2KXH A;  4DR4 F;  5ETQ A;  1U49 A;  5D3G A;  4F3Q A;  2GJ2 A;  4URG A;  5KT4 A;  4RNO A;  1RT6 B;  3GQC A;  4I6A A;  2V8G A;  1BWE A;  2ZNY A;  5CCM A;  3JSM B;  2ZDO A;  1E6Y B;  2HGM A;  2ZHB A;  1FCA A;  3UD3 P;  2KO1 A;  1S6P B;  2AW0 A;  4KY3 A;  4RW7 A;  4ZP6 A;  2MEW A;  1RQ0 A;  1PJ5 A;  3BEG B;  5T7L B;  3ET6 B;  3HMJ G;  3K5N A;  3Q22 A;  4C97 A;  3F73 A;  2D69 A;  4DR5 J;  5BXI A;  1AB8 A;  1FD8 A;  2QG9 B;  3WDO A;  5J1E B;  1RTI A;  4YQW A;  2VQF F;  5HP1 A;  1C1C B;  4DPY A;  1REG X;  2B56 A;  2OMO A;  2B7C B;  2LVW A;  2VKR A;  4LR9 A;  2ZM6 F;  2KYX A;  4ZPA A;  4CRJ A;  2CUY A;  2G2O A;  5CAB A;  2DNM A;  3CGI A;  1Y5N B;  2POK A;  3BQ1 A;  5H9E J;  4YDX A;  3T19 A;  3EGV A;  2AD9 A;  4X4N A;  3F0N A;  1C0U A;  3K58 A;  3N6N A;  4UTG A;  3MR3 A;  4F50 A;  1SKS A;  2R7Q A;  4TY8 A;  4U8V A;  4NRT A;  3THT A;  4BC9 A;  1LV5 A;  4QZV B;  3C14 B;  4DI6 A;  2DNR A;  2HHV A;  4YN3 B;  3PR5 B;  3RB6 A;  2EG1 A;  1W2I A;  2LKZ A;  4QYZ K;  4NLG A;  4NI2 A;  4ITS A;  2N4D A;  4M5J A;  3UDE A;  3VQS A;  3PKM A;  3POT B;  2KHC A;  1F5A A;  2KFY A;  1YRT A;  1XWL A;  2V4J A;  5I42 A;  3BN7 A;  2QN6 B;  3D6T B;  2MPU A;  5KFR A;  1MMN A;  4UUW A;  3WX4 A;  2C2E A;  1FFS B;  1UET A;  2K7K A;  3HD1 A;  3NBP A;  3UVJ B;  1W2B R;  2D1C A;  3CUL A;  2UUB F;  1FHT A;  1JQG A;  3E3X A;  2CZV C;  3DLE B;  4UOC A;  1SV5 B;  3PXG a;  3H25 A;  2VG7 A;  3SQO P;  1VQN S;  5LMN F;  4DQR A;  2WVC A;  5LXY A;  2J0X A;  2JVR A;  3R2D J;  4DR5 F;  3QO9 A;  1VLO A;  3A3N B;  4IFY B;  7FDR A;  2CAD A;  2Z2Y B;  2AEJ A;  4JBC A;  5EUH A;  1Q7Y T;  3IBF B;  2HVE A;  4NE9 C;  1TK5 A;  2J0Q D;  3BBF A;  4DSF A;  3MCO A;  4F4Y A;  4LF1 A;  2X3G A;  2P9E A;  1R7I A;  2DNG A;  3FCV A;  5ITH A;  1NRK A;  4ECT A;  5T14 A;  1VRT A;  4OYZ A;  5ETP A;  1N4L A;  1RWW B;  1SIZ A;  2RB7 A;  1FRK A;  3RAQ A;  4JI1 J;  4A8Q A;  3GLJ A;  5CHC B;  4WPA A;  2PEH A;  4OJ1 A;  2E7W A;  1C0U B;  3PDN A;  5CZV A;  4ZJO A;  4CO3 A;  2LDI A;  3IA0 A;  5HVG A;  2V8V A;  4YB5 A;  3TVK A;  4LBH A;  2AYM A;  2NRE A;  2XUL A;  1N5Y A;  2VUG A;  1LWC B;  2LQ5 A;  3BB5 A;  1FJG F;  1LQ9 A;  3BR8 A;  1WDD A;  1X60 A;  3MOZ A;  3HP6 A;  2XLJ A;  3P5B P;  3ENW A;  4DV7 J;  1VC0 A;  3UI3 A;  4EO6 A;  1KD1 T;  4JI8 F;  4CO5 A;  1I3O B;  3D5M A;  3GON A;  4TY9 A;  2HVZ A;  2E1M C;  3K89 A;  3QFW A;  1RAB B;  3NGU A;  4DLE A;  1S4E A;  3ZZR A;  3GJS B;  2AJ0 A;  5CQG A;  3J7Z T;  3J81 j;  1LWE A;  2PC6 A;  4C0O C;  1CS4 A;  2R3V A;  2ZBQ A;  2CPF A;  3DLK B;  4MFB B;  3UFC X;  5GAE U;  2PA8 D;  1HI0 P;  1RI7 A;  2W2N P;  1FWL A;  2Y0B B;  3K17 A;  3VAM A;  1N34 F;  1X4D A;  2E5I A;  3FK4 A;  2RHQ B;  3AOA A;  2I1R A;  3HJV A;  5I3P A;  5A2Q U;  2YNI A;  2IHR 1;  2GQC A;  2KB2 A;  1M1H A;  5KFD A;  2WON B;  1REV A;  1S1U A;  1Z4U A;  2OP5 A;  1UVM A;  3OSP A;  2CVI A;  1AA1 B;  3IAM 9;  2VIH A;  4O3S A;  1HQU A;  2D74 B;  3QMQ A;  4W98 A;  2CPY A;  1DTQ A;  1KON A;  1BC6 A;  4MFB A;  5KT3 A;  4L75 A;  3HLU A;  4PG7 A;  3QYY A;  3QSI A;  5GAE I;  3WC2 A;  1KR4 A;  2XNQ A;  4WKY A;  2QGF B;  5D4N A;  3OVA A;  2CQ2 A;  2JEG A;  1SH0 A;  4NEZ A;  2I5J A;  1XNQ J;  2MZJ A;  2ILZ A;  4U7U D;  1X31 C;  4KKO A;  4CT9 A;  4CLK A;  2CG8 A;  1DZ5 A;  2FJD B;  4KGV B;  1P1T A;  3MCN A;  1L3U A;  2PI4 A;  2Z56 B;  2GGP B;  3TA1 A;  1Y3K A;  3GIJ A;  1S0N A;  1FKA F;  3PG9 A;  4ZN1 A;  1HBN B;  3DOM B;  3H7H B;  4DF8 A;  2OJ3 A;  3QRR A;  3M2R B;  1UEU A;  1DLO B;  1TAQ A;  2DNO A;  2W24 A;  5E3R A;  4KYZ A;  3HHL C;  2WVE A;  4WFY A;  1HHS A;  1M5S A;  2R7W A;  4A8M P;  2UUB J;  1SQF A;  2RDI A;  2KG1 A;  1XNQ F;  3MMB B;  4FPR A;  1KHV A;  1OS5 A;  3BGR B;  3T6J A;  4YDD B;  3MXH P;  1SUQ A;  1RP5 A;  1Q8B A;  1LXJ A;  1NU4 A;  2R8H A;  5E33 A;  3SI8 A;  1LXN A;  2E9R X;  4MH8 A;  3RZA A;  1S7H A;  3RGI A;  3OVS A;  3I56 S;  2BR0 A;  1U48 A;  4N41 A;  3IRX A;  4KV8 B;  1DUR A;  2V68 A;  4OX6 A;  2JOQ A;  2HNZ A;  4ZDN A;  3OTC A;  2PO4 A;  3PRB A;  2JL9 A;  5IT9 U;  3BYP A;  3W65 A;  4B3S J;  3DNC A;  2ZH9 A;  3N4W A;  4DBQ A;  4C0B A;  2J5A A;  4OX7 A;  2XYG B;  4EO8 A;  2QA4 G;  1HR0 J;  2PI5 A;  4DLG A;  2B5J A;  2CQI A;  1D9F A;  1RWO B;  1TL7 A;  2ASY A;  4S0M A;  1NJZ A;  2V63 A;  2C3P A;  2Z0G A;  5IFM A;  2G0C A;  1RXO B;  2E1C A;  2MJN A;  4MKB A;  2CQH A;  4MKY A;  2M70 A;  1T9X A;  4NLO A;  3DDK A;  1XIQ A;  3B78 A;  1VBK A;  2NCK L;  4OZN A;  3M8Y A;  3NS5 A;  4WP3 A;  3FVY A;  4CM0 A;  4DXL A;  3DRR B;  5I4M A;  3OW2 R;  2AJ1 A;  2NXN A;  2FUG 9;  4IH6 A;  1RYR A;  4DG1 A;  4MIB A;  2BJ9 A;  1UVL A;  4GVB B;  2BJE A;  1WD6 A;  4ED7 A;  3N6M A;  1I5O B;  2JLF A;  3CCL S;  3HHE A;  3RRH A;  2M7S A;  2GQQ A;  3LP1 B;  1LW2 A;  1UWB B;  3G4S S;  1Z2L A;  1EAY C;  3V2U C;  2B9W A;  3IAS 9;  4B3M J;  4FF4 A;  3LAK A;  3I0S A;  1CJV A;  1VBX A;  1KKH A;  4DSI A;  5JUM A;  3ETO A;  2DGT A;  4HT7 A;  3HFZ B;  1PAU B;  2DGS A;  3CJ8 A;  2R4F A;  1CC7 A;  1T9U A;  2B6A A;  3MEK A;  2BA9 A;  2RIL A;  3P8B B;  4FZV A;  1VRQ C;  4IFV B;  2IVF B;  4BC7 A;  4DL5 A;  4QCL A;  2C2Z B;  3CCU S;  3I5A A;  2W25 A;  1NCL A;  3L9Z A;  4M5I A;  3H2V E;  4X65 F;  2AYE A;  4DHV A;  1SI9 A;  2C42 A;  1TV6 B;  1WC1 A;  2YPZ A;  3D28 A;  3D9B A;  4RUH A;  3MR2 A;  1ZA2 B;  1RHR B;  2XO6 A;  2RE1 A;  5KG7 A;  3MMJ A;  4B9U A;  2LQ8 A;  2YKM A;  1T03 A;  4USK A;  4ILL A;  4XTT A;  1S0V A;  3KG4 A;  1JIH A;  1GK8 A;  2R9L A;  1PGZ A;  2HBQ B;  2EKY A;  2JVO A;  3CJK A;  5KG0 A;  2CFX A;  4CQ1 A;  4TLQ A;  4JV2 A;  5A2Q Y;  3KNG A;  1FKO B;  1TL3 B;  1WTF A;  4PYD A;  1PYO B;  3ILL A;  4P52 A;  4PRF A;  2VV5 A;  1RT3 B;  1YHQ S;  1TV6 A;  3OD2 A;  3W2W B;  1Y0H A;  3QGH A;  2D3O R;  1RAG B;  4C11 A;  1VHI A;  2KN4 A;  1XMO J;  1WEY A;  5DG8 A;  2JEJ A;  3CED A;  5KFT A;  2Z2L A;  3T9N A;  2J7K A;  4DU7 A;  3I31 A;  1V6H A;  3O5T B;  4DX8 H;  1HMV A;  2VAS A;  2HFZ A;  4DFP A;  4G1Q A;  4NEY A;  1SQE A;  4RW8 A;  1YJR A;  3EXY A;  2DEJ A;  3A13 A;  4A8Y A;  2E5H A;  1S0M A;  5BYR A;  2WSF C;  2MYF A;  4RNH A;  3VTI A;  4FN5 A;  2HZV A;  3J7A 1;  1PBA A;  1N5Y B;  1U8S A;  3PIO Q;  3UR0 A;  4W92 B;  4WK3 A;  3ZTO A;  2J7W A;  4J9L A;  2GIR A;  1HD0 A;  2KI2 A;  3JSY A;  1TVR B;  4ES1 A;  2HW3 A;  4CNZ A;  4WKR A;  1SIW B;  3ZFV A;  3UCG A;  3QAE A;  3Q8S B;  1XR7 A;  4USJ C;  5KFE A;  4L3K A;  4RW8 B;  4U95 A;  2W9A A;  5C24 B;  1H2T Z;  1NDC A;  3D1Q A;  2B4U A;  2P9G A;  4MMO A;  3Q0A A;  3WX8 A;  2YVS A;  4KIA A;  3TJ8 A;  1KDN A;  4NX9 A;  2BQ3 A;  3QPI A;  1RT5 A;  3R27 A;  1JXE A;  2AEF A;  3R8Y A;  4QOT A;  4DV0 J;  1RIS A;  1U2R A;  3IWN C;  3OVB A;  1IKX B;  1MN9 A;  4OYW A;  1F6T A;  1Q8K A;  4LVN P;  2BX6 A;  4NLR A;  1DQ8 A;  1QSS A;  4QQB A;  3THV A;  1NK7 A;  2V8P A;  3GSD A;  1FEH A;  2EFN A;  3EZ5 A;  3RBZ A;  3DRY A;  2QLF B;  3W63 A;  1FRM A;  2DHA A;  3GSI A;  3R9L A;  3QZ8 A;  3PJ9 A;  1HBM A;  4MYT A;  4QIE A;  5C7P A;  3G8T A;  1A0O B;  4CH1 A;  4JV1 A;  1FJE B;  5K14 B;  2EWH A;  5F0U A;  2AGP A;  4WK1 A;  4QWC A;  5JVH Q;  1URR A;  3GYX B;  3SCK E;  5RUB A;  4DQP A;  1HNX F;  1U1K A;  1HW8 A;  1RWP B;  1T02 A;  2EK1 A;  2QJ3 A;  2ZHO A;  3H98 A;  1K47 A;  3PEH A;  3H2L A;  2RML A;  4J90 A;  4K59 A;  1C2P A;  4Y2C A;  5KFO A;  4DL0 C;  3NNC A;  3FGV A;  1N6Q A;  2CQ0 A;  4JI4 F;  4X65 J;  3MAA B;  2EVZ A;  2IM0 A;  2L48 A;  1XER A;  3MM8 A;  3PFO A;  4ZLL A;  4P9S A;  1S49 A;  4D3H A;  3KJQ B;  1RKJ A;  1XMQ J;  1RTH B;  2LEA A;  2ZFH A;  5E2Q A;  1HW9 A;  4OZ2 A;  2VC1 A;  3RG6 A;  1TKT B;  4KHM A;  3IWL A;  4XDC A;  2XZW A;  4P75 A;  4CTA B;  2LEC A;  1FA0 A;  4ED1 A;  1N6Q B;  4IG3 B;  2JFD A;  2CJA A;  3EGN A;  4F25 A;  2BE7 D;  3QID A;  2RAQ A;  2DTJ A;  2XMJ A;  2MZQ A;  2EFV A;  1NJW A;  4MIA A;  3PRD A;  3QWP A;  4F4K A;  4A8F A;  1ITP A;  2JC0 A;  3Q8U A;  2OML A;  2I0X A;  3VZI A;  3MM7 A;  2H48 B;  5L39 A;  1K73 T;  2UXC F;  1LW0 B;  2R8J A;  1HNI B;  3GYG A;  3R5C A;  3TQE A;  2JJ4 D;  4NPO A;  3EZU A;  2YNG B;  4DV4 F;  2VQE J;  3OUY B;  4K4T A;  2GW8 A;  2MB0 B;  4FXW A;  3J7Z 5;  1NKE A;  1F5C A;  4GMK A;  5HQ8 A;  4X66 J;  3KLG B;  1G7C B;  3DN9 A;  1LWE B;  3D4J A;  4IKA A;  4ZVS B;  5CA5 A;  2M3D A;  4Q5V A;  3IN5 A;  3TO8 A;  5FDL A;  2AX1 A;  4JI3 J;  3DC2 A;  4OMF G;  4EBD A;  1HLW A;  1HPZ A;  3CXC R;  4F36 A;  1SB6 A;  2Y3Y A;  1VBZ A;  3FBB A;  3CJR A;  5AE2 A;  1JX4 A;  1I6J A;  2KJW A;  3A8I A;  2HHH J;  1RLC L;  1WUU A;  3GU0 A;  7AT1 B;  1S59 A;  1RTJ B;  4LRF A;  5B0D A;  3NRB A;  3TJA A;  2C2N A;  4KO0 B;  3DI6 B;  3SDE B;  3UDL A;  5DDQ C;  2V50 A;  1YJU A;  1N48 A;  2FJW A;  4BLG A;  1T05 B;  2MTL A;  4EMD A;  1J5E F;  5IT4 A;  4F2S A;  4EWT A;  2CIM A;  3N01 A;  4ZVQ B;  2BE2 B;  1ARO P;  2JRS A;  2XMV A;  3IRX B;  1HWJ A;  4KV8 A;  1VQ5 S;  3W2W A;  2D7S A;  1RTZ A;  5J1E A;  3A3O B;  4CI0 B;  2CJK A;  3CJ4 A;  3CJ2 A;  4LSL A;  3TAM A;  3NNA A;  2E5G A;  3NMA A;  3HPO A;  4HVZ A;  2XMM A;  4RNF A;  5HMX A;  5IXU A;  3ZNJ 1;  3RYL A;  2HHQ A;  3K2Y A;  1B3T A;  3DRX A;  4LRE A;  3E01 B;  4YR3 A;  1WKK A;  4RUC A;  3ITH B;  3EVM A;  2Y1L B;  3M8S A;  5AXM A;  1Q4R A;  2G9O A;  4BBY A;  1GXL A;  4XK8 C;  2KT2 A;  4L3N A;  1K8A T;  3SFG A;  4JI7 F;  4KGZ B;  1ZYQ A;  2JZ5 A;  4FYX B;  4DV3 F;  3OR2 A;  1F0X A;  2IC3 A;  1T03 B;  4LFA F;  1WJ9 A;  1G3O A;  2EBE A;  3DM2 A;  3MAQ A;  3RAX A;  3KNA A;  3WZ0 A;  5I42 B;  4DQI A;  2E1A A;  2QRR A;  4QIG A;  3TYT A;  4YP3 A;  1SJ4 P;  3IFE A;  2CWK A;  4CP5 A;  1X5T A;  4ZP8 A;  4K5R A;  1NBE B;  1HI8 A;  4HI1 A;  5KT5 A;  1BQN A;  3DMJ B;  1Z2Z A;  3PW0 A;  1Q86 T;  2KT3 A;  1W25 A;  4URS A;  3EZO A;  2CQP A;  3FMW A;  7FD1 A;  1BE4 A;  4LFA J;  4DR2 J;  6AT1 B;  4F67 A;  1NSK L;  2X1F A; 
#chains in the Genus database with same CATH homology
 4DUT A;  4UOF A;  4S0M A;  3VGU A;  1NSQ A;  1UCN A;  1W7W A;  3VGT A;  1NB2 A;  1XIQ A;  2NCK L;  4ANE A;  1BHN A;  1NSP A;  4FKX A;  1B99 A;  3DKD A;  3GPA A;  1ZS6 A;  1S57 A;  1LWX A;  3BBB A;  2HVE A;  1MN7 A;  1XQI A;  3G2X A;  3BBF A;  4WBF A;  3B6B A;  4F4A A;  3FCV A;  5IOL A;  4FKY A;  2B8Q A;  4KPC A;  4UOH A;  4AND A;  1VYA A;  3EMT A;  4ANC A;  3VGV A;  3FKB A;  3BBC A;  2DXD A;  1PKU A;  3Q89 A;  3FCW A;  3Q8U A;  1JXV A;  3NGT A;  2AZ3 A;  1NCL A;  4EK2 A;  3VGS A;  1NLK L;  3B54 A;  5CAA A;  1B4S A;  3NGU A;  2VU5 A;  3ZTQ A;  2AZ1 A;  1NDP A;  1K44 A;  3FBC A;  2B8P A;  1HHQ A;  3ENA A;  2DYA A;  3NGS A;  3FC9 A;  1HLW A;  4F36 A;  1BUX A;  3DDI A;  3FBB A;  1S5Z A;  1PAE X;  1NDK A;  4DZ6 A;  1NUE A;  1HIY A;  1S59 A;  4ENO A;  3EM1 A;  3FBE A;  4W98 A;  3ETM A;  3GP9 A;  3Q8Y A;  2ZUA A;  3Q86 A;  3PRV A;  3BH6 B;  1EHW A;  1NHK L;  3BH7 B;  3VVT A;  2DXF A;  3ZTO A;  3FBF A;  3L7U A;  1U8W A;  1NPK A;  2BEF A;  1LEO A;  4O0N A;  3VVU A;  1WKK A;  3EJM A;  2DXE A;  3EVM A;  1WKJ A;  1NDC A;  3Q83 A;  3WX8 A;  5BXI A;  3MPD A;  1KDN A;  3ELH A;  3Q8V A;  4HR2 A;  3ZTP A;  3EVO A;  4C6A A;  3ZTS A;  1MN9 A;  3NGR A;  1F6T A;  1WKL A;  1NDL A;  2HVD A;  3EE3 A;  5CAB A;  2BX6 A;  2HUR A;  3EVW A;  2DY9 A;  4CP5 A;  2CWK A;  3R9L A;  3PJ9 A;  5C7P A;  4DI6 A;  3JS9 A;  3ZTR A;  1F3F A;  1BE4 A;  4UOG A;  1NSK L;  3EIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...