3FC9A

Crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
b'LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fc9A00
1VYAA 3B6BA 1JXVA 5IOLA 1S5ZA 1ZS6A 1NPKA 4F4AA 3G2XA 3Q86A 3ZTPA 3BBFA 4C6AA 1S57A 1PKUA 1F6TA 5CAAA 4FKXA 1S59A 1NSPA 4W98A 1NDPA 3B54A 3DKDA 4DI6A 1PAEX 2HVEA 3JS9A 1HHQA 3NGTA 3Q89A 2B8QA 3FC9A 3BH7B 2VU5A 1B4SA 3MPDA 3VGUA 2B8PA 3DDIA 2DXFA 3ENAA 4UOGA 3Q8YA 4F36A 3BBCA 3Q83A 1WKJA 1NLKL 1NDKA 4ENOA 1KDNA 3Q8VA 1BHNA 2CWKA 3ELHA 3NGRA 2HURA 3VGVA 1NSQA 3EJMA 3EVOA 2AZ1A 3BH6B 3GPAA 3GP9A 3R9LA 4ANCA 1F3FA 3ETMA 1NSKL 3FBCA 1XQIA 4S0MA 1LEOA 4HR2A 1K44A 4ANEA 3VGTA 3FCVA 3EVWA 2BEFA 3ZTQA 1U8WA 4WBFA 4EK2A 3FBBA 3PJ9A 3Q8UA 4CP5A 5C7PA 3FKBA 3ZTOA 3EVMA 1EHWA 3EM1A 2AZ3A 4DZ6A 1NCLA 1BUXA 1NHKL 5CABA 4DUTA 2ZUAA 4FKYA 3PRVA 2DXEA 3FBEA 1NDLA 1UCNA 3ZTSA 3WX8A 1NDCA 1BE4A 3EICA 4O0NA 1HIYA 1NB2A 3EMTA 3VGSA 3FCWA 3VVUA 1XIQA 2DY9A 1W7WA 1LWXA 2DXDA 2BX6A 4UOHA 3ZTRA 1MN9A 3NGSA 4KPCA 4ANDA 2NCKL 1HLWA 4UOFA 3VVTA 1NUEA 1WKLA 2DYAA 3NGUA 3BBBA 1B99A 1MN7A 2HVDA 3EE3A 5BXIA 1WKKA 3FBFA 3L7UA
chains in the Genus database with same CATH superfamily
1HNIA 2DB1A 4N47A 1VJQA 1PSDA 5KTQA 2K1RB 4QZVB 2QL7B 1F9HA 4ED3A 5KFWA 2XNRA 1K0VA 3D68A 3GG0A 3GFXA 2XMVA 4LF4J 1T03A 3MM7B 1S6OA 3AOCA 3DOKA 1RYRA 4NLOA 2A1BA 2VB6A 3E51A 4Y2IA 2QC3A 3Q8YA 4CO3A 1HR0J 2KZMA 2CQIA 1PG5B 2HHHJ 3U7JA 3G86A 4P2XA 2A0FB 1AUSL 2CWKA 3N5BA 1LW0A 4IOAQ 3EGVA 2GVDB 5AXKA 4RW4B 4OYOA 2UUTA 2DIUA 4PXEA 2YY3A 1EHWA 4IKAA 5AE1A 4M5LA 4F3OA 3T9NA 3NOCA 4JYAJ 3FSXA 3R6LB 1X4FA 3PEJA 3VVUA 3K2YA 3HJFA 3F56A 1J2VA 4RWWA 2RAQA 2M9KA 2PN6A 3OTOJ 3SFUA 4DCJB 3A4TA 2OFGX 1RWVB 3PR5B 3DLKA 2L9DA 1F9FA 2HRTA 2JOQA 2AJ0A 1RTHB 1F60B 4K59A 4C3LA 1NK9A 2F1FA 1KQFB 4LSZB 1DQAA 3PYEA 4HKQA 2H51B 4DL2A 2E29A 1U1KA 2N7CA 2XY6A 1S99A 3MAAA 2MKSA 2CQ0A 2YWEA 4FZVA 2WCXA 1FJGJ 3M2UA 1RTIB 4M5NA 3OVSA 3TEHB 1RA6A 1FWKA 2V50A 2HYIB 4DN9A 1T0TV 4I2PA 4ECYA 1B7FA 1RAIB 2K7JA 2KN4A 3M8QB 2ZHOA 5IV3A 5EWFA 5U47A 2XMAA 4NXNF 3FK4A 3UD5A 2ZVSA 1YTYA 2P6TA 4U67Q 1B7YB 3UO0A 2XCPA 2YNGB 2BQ3A 1D9AA 3J81U 4KGVB 4F0KA 2IC3B 5KFCA 3MTJA 5CH7B 4I64A 4J9VA 1M0SA 1HKAA 3QIPB 4U9RA 4WE1B 4O0IA 3IR7B 3EE3A 3KDNA 3PJWA 3CCTA 1Y0HA 4NZ6A 5D4LA 5EHHA 2Z2LA 3BBFA 3U1MA 2QGFB 1DAXA 4WIIA 4DV2F 3LUYA 2WHOA 4KH1B 4A4JA 1N36J 4NYPA 1HBUA 5E2QA 5DDPC 3F44A 1T05B 1WJ9A 4ED0A 1QTMA 1CLFA 2C22A 3HMJG 2FLNA 4HEA9 3OBIA 2MLXA 4J5OA 4LRBA 1UFWA 2PDAA 2QLJB 3QWPA 2XB2D 2AT1B 1Q16B 3UD3P 2XLJA 2CQHA 3QGIA 1JLGB 3AJDA 4BWJA 2YNHA 4JV0A 3A3NB 1JLFB 3MFIA 3MR5A 4ZA1A 2C2NA 4IH6A 2HFNA 3QLHA 3I4HX 3EICA 1FK9A 2KVQE 3R2DJ 2AMCB 2VASA 1REVA 2MTLA 1DY3A 2HNYA 4B3RF 4DSIA 1XMOJ 3TOQA 3KHRA 3WX4A 2WB1D 4BC9A 2CJBA 1Y00A 2MQNA 3TJ8A 3KYLA 2K7KA 1QUVA 1T3NA 4U8VA 1TL1B 3OW2R 1WKKA 3ISZA 2I5JB 4CLYA 3RB0A 1JWWA 3THPA 4OQJA 2YNFA 1CULB 1F6TA 3AJ1A 2MGZA 3K7RA 4A8YA 2IY5B 4ILRA 4WZQA 3K5OA 2DVIA 2I1RA 3DHWC 1R6VA 3S1TA 2W2QP 2X1BA 4FPRA 1KTVA 1FXDA 5J1PA 2XS2A 3I0SB 2OSQA 4ICLB 4I7FB 2W8LA 1JQGA 1FRXA 2B4PA 3QSYB 1KLMB 3JSMA 3WHIA 3AXKA 4ECSA 5A8KA 2UUCF 3I96A 4G1QA 3CCMS 5F8NA 3KLFB 4QR0A 2XBPA 4DPYA 4Q0BB 2OPPA 2EBGA 1SL1A 4LVOP 3ZTOA 3TNVA 2DK2A 2W7PA 2JH3A 1BUXA 1YX2A 3ZNUA 2CQ2A 4GVBA 5THWA 2R2UA 4KE5A 4DSLA 2MZRA 1U2CA 2BR0A 1RCXB 1RA7A 7FDRA 3MOJB 2DNRA 1MN9A 1GXTA 1PILA 4E98A 2DIVA 2E1PA 3LP0B 1FX4A 4NA2A 4P74A 4NLDA 2DNLA 4CLLA 1N5SA 4J37A 3M8YA 2HQDA 2GNKA 1VBZA 3DI6B 1T9VA 1MW7A 3R27A 1IVZA 2BJDA 3MGJA 1S57A 3ILIA 3BDPA 1S59A 5F3ZA 4ZVPB 4FYVB 2V2ZA 3W2VA 4ILLA 2MHEA 4IG3B 4DU7A 2QLFB 3KLIB 4DR5J 2KFNA 3ISNC 1SJFA 4K0KJ 2CPIA 4PG8A 4I2QA 1BHNA 5FLXU 3GIRA 4Y2MA 3UN3A 2XWXA 1F3FA 4X65J 3HD1A 3QYYA 3PR4A 5L9XA 4OX7A 3QQCD 2QL9B 1YJTA 2AEMA 3HSDA 3C14A 3HHEA 2VL1A 1D9FA 5MLCV 3NS5A 3TQEA 4DV5J 1YJVA 4F0HA 4B9VA 2GVZA 5K9FA 4NX9A 4EBDA 1JKHA 1C2PA 2LDYA 1RU2A 3UD4P 1HQUA 1N5YB 2J8AA 2J76E 4K5RA 2O1PA 4IQMA 2F5GA 4U7UD 4I0WA 1TAUA 2X1GA 3CJ4A 1PYSB 3GB0A 3OTOF 4L75A 1IKVB 1KTQA 1TVRB 4HTIA 1I1GA 4ZPWR 1RT4B 2YBVA 2CNLB 2F40A 1R8HA 3LPYA 2XCAA 4AL7A 4KGKA 3KHLA 1JNZB 1VK8A 1WACA 3RAQA 4IRKA 4U8YA 2OGUA 1DFDA 5HSPA 5HATA 2NXNA 2P2CB 2QEXS 2XEXA 3MI7X 2R8HA 3A8EA 3PFEA 3E2EA 3I0RB 4NI2A 2RIJA 5B09A 3BF4A 1WF1A 4O3RA 1VBYA 4B3TJ 1UAWA 2NLWA 3T5KA 5J2NB 4HH1A 4KGMA 2B4OA 3G82A 5GMKa 5CYMA 1Y10A 3ILLA 2ADCA 5LMNJ 4YN3B 4PYDA 4UZBA 2XQCA 4MK9A 1V3ZA 1VC6A 3D1HA 3BSAA 5E3PA 5IC6B 3R2CJ 2LECA 1OY9A 3H5SA 1N36F 1UWBA 3OUYA 4OHYA 3QO9A 4LR7A 1ZYQA 1FWPA 3H25A 2FLOA 2GJIA 3IAM9 2RU3A 4F2SA 3LALA 4TLRA 3OLAA 2DR6A 1WOSA 7FD1A 3FBEA 4FS2A 3DRSA 3BQ0A 3G71S 2R8KA 3QATA 1R7IA 5JVHQ 3LP2B 3GJSB 5F8JA 5D3GB 4DQSA 3KLHB 1R43A 2HZVA 4ED5A 4GKKJ 3D0GE 1VQOS 3KNAA 1NH7A 2E1CA 3PO4A 1LXJA 1VI7A 3L9ZA 4NLPA 1HQEA 5DG9A 4DV4F 4K50A 1RT1A 4HT7A 4XIUA 2XTJP 2MZJA 2WTFA 2FPHX 4LF5F 4O23A 1L3VA 2FZKB 2GGPA 4USTA 1JIHA 2FGCA 3DU5A 1VQ9S 2AJ1A 2HWIA 4ZPCA 2QA4G 2KU7A 4EUVA 1NLKL 2XMKA 1VQSA 1QVGR 4NRUA 4MFBB 1JJHA 4F0MA 4BCAA 3TR5A 1RCOB 4Y28C 3HVTB 1SJRA 2F9DA 2ALYB 4TU9A 3TAPA 3KG0A 2DHAA 2GHWA 2OSRA 3BKUA 3UN5A 4YQWA 2MY8A 2YNIA 1VLOA 2QMUB 1YJRA 2DCLA 4ZCMA 1LOUA 4P52A 2J0SD 2FYXA 1JLAA 2PA3A 3W9HA 1W25A 4IO9Q 4U6PA 1Y3JA 4OI0A 3DDKA 4G6VB 1RWNB 1YJWS 1I6JA 2GZOA 1VK3A 1U1PA 1YHQS 1L3TA 1XR5A 2DNYA 5KFQA 1X5TA 1SJ3P 5CYQB 3GV8B 2VUGA 4DV7J 4I6WA 5KFSA 5IT9Y 4YHHF 1IBLJ 3FEXB 5I3QA 5F0UA 3F0NA 4UOGA 1XBWA 1R89A 4H4OB 2HLTA 5DG7A 1RT7B 3MD3A 1KQKA 3BPDA 4R5PA 1FA0A 1YBAA 3BO2A 1K47A 1X4BA 6FDRA 1JXEA 4DR5F 4Y2KA 4DUZJ 1URNA 5T14A 4F2RA 3NG8A 4ED7A 1RP5A 4ZPDA 2ILZA 4Q45A 1DZ5A 5KFAA 4CH7A 1K1QA 1WDDA 5AJ3J 2F4VJ 2ATLA 4A46A 3GYXB 1O8BA 4LR9A 4OI2A 4ERDA 1CS4B 3MEEB 1GT8A 4ED4A 1UVMA 3DOLA 2CZ4A 2BJ7A 2M70A 5CD4H 1FDDA 3QRQA 4MYUA 3O5TB 1RT6A 2GMJA 2RS8A 3O44A 1X8DA 3AHPA 2W2MP 2MQ8A 4NCGB 1NDPA 4Y3CA 2UV8G 5H9EK 4M94A 4WKYA 2NXEA 1FT8A 2V4QA 1J5EJ 1N8RT 1VHIA 2CPJA 1UKUA 4G1PA 2NPFA 3I5AA 4U7UK 3LP1A 4J9UE 3IS9B 4QOTA 4DG1A 3MUMP 2AZ1A 3GP9A 1NJIT 3ETMA 3PRBA 1Q5YA 1OS5A 2DKOB 3NY0A 4OI3A 5A8WB 1VQYA 4DWIA 5KFRA 2KT5A 3E8OA 4QR1A 5AE2A 1TKXA 3A1YG 4K2XA 3T19A 1U24A 2B43A 4KTQA 1EKSA 5L8RC 1DLOB 1FRMA 5J1NA 3ADAC 3UNYA 5BJRA 2QG9B 1VQ5S 2CIMA 5KFDA 1PGZA 3OHAA 4L6V3 2D9PA 4B3TF 2WAQD 1RE1B 1S48A 2G0IA 1T02A 5HJXA 1NHUA 2OAUA 4CTAA 4J90A 3LO3A 3NNHA 4ER8A 3T6JA 2RB7A 4OZ5A 2MPUA 1RZMA 2R7XA 3DMJA 3H98A 3H20A 5B0GA 4X62J 2AV5A 2N4CA 3MM9B 2PI4A 4DPXA 3V6JA 3FEYB 2VFVA 3PX6A 3CJ2A 4URGA 1QD1A 2LVWA 4HHHA 2DXEA 2BJ9A 2WVDA 4NLVA 1RHJB 2M8DB 3MZIA 2KJWA 2RKIB 4CM2A 5L1IA 1CPZA 1A0OB 3MFHA 2CNNB 3G4SS 1RLCL 1N0VC 2BOPA 1FO1A 1Q8KA 2PC6A 2E7XA 5F41A 5A0YA 1U1OA 3EZOA 4GKKF 1WEXA 1VRQC 2WVFA 3GJTB 4PWDA 1PKUA 1Y4ZB 2RHSB 2OPSA 2BJ3A 4AE5A 3TZYA 3H59A 3UDLA 1U4BA 4OV6A 1U6BA 4IH5A 2VIHA 1R3NA 2XI3A 3PM9A 2MSTA 4EWTA 2ASJA 4PEOA 3R5GA 1HW8A 1M5VC 1EQ0A 3W64A 2M0GB 4EK2A 4ZLNA 1UWAA 1T9WA 2WSEC 2BE2B 2LEPA 4FXVA 4WK1A 2Z8QA 1R0AA 3BDEA 4V19J 5C25B 2FY1A 3EZ5A 4O44B 2K2PA 5EUHA 4DSFA 3NGDA 1QVFR 1C1CB 2GHPA 3DLGB 3T9ZA 4L73A 4FDFA 5KT6A 2MJNA 5I42A 2ZBIA 2DPJA 1Q8LA 1R8CA 4C6AA 1QUPA 2GQCA 2FD2A 1HBMB 5DJBA 4P9SA 1JLEA 3QJJA 2HRUA 5AT1B 4KJIA 1ZPWX 1CJTA 1FKPB 1ACMB 2YWFA 2WBRA 1RTZA 1IQTA 4M5HA 3MCOA 5HLFB 2DEIA 1WELA 4PUOA 4FXWA 1ZTWA 2J5AA 3SV3A 1IKYB 3CWJA 2A3JA 3EPIA 2GMHA 2MHNA 1YI2S 4K4UA 1SC6A 1XMBA 5IWAF 3SCJE 2EG1A 1UEVA 2JNJA 4KO0A 4FNIA 2ZJRQ 1ZA2B 2GIFA 3DRPB 1IQZA 5AJ3F 2J8SA 3H4DA 5IOLA 5DLGA 4XK8C 4MH8A 4J9OA 2HQIA 4DUYJ 2BBEA 1ZAWA 3B54A 5KFFA 2KKHA 3I55S 4LVNP 4PWWA 1H2TZ 3QSIA 3EGWB 2XY5A 1M5KC 2HFVA 1TV6B 2IDEA 5FDLB 5C2GA 1QAIA 1TQLA 5F8MA 2XC9A 3G8TA 2V9KA 4FBUA 2DNPA 4P2SA 1BQMA 3FBCA 2ZHAA 4YB1P 3H5XA 4ZIVA 2UUAJ 4ZP8A 4C11A 3AFGA 2FGOA 2XZDB 4BBYA 3C6TA 2EFPA 4B9SA 5IM0A 5CABA 3KK2B 1S7IA 4NCAA 4CH0S 1UCNA 3D6TB 2BA9A 4TU8A 5DDOC 2WW8A 4ECQA 3IG1B 2CQ3A 3V4MA 4LFCF 1BLUA 4F25A 1D3WA 4IFYA 2Q43A 3GTYX 1XN9A 3P3DA 3RGIA 3H7HB 3JTNA 5D78A 1ZBTA 1E6VB 3DYAA 1P6TA 4YMEA 2NXCA 4M95A 4AXIA 3HHKA 2PFFB 3D6FB 2VQFJ 1TUVA 1UFLA 1KRPA 4HL9A 1S1UA 2IFXA 3TYTA 4ZCKA 2OJ3A 1JLBA 3Q23A 4ZDNA 4TQRA 2JEFA 2ZH4A 1RJJA 4HI2A 4JI6J 5IT9U 3DOMA 2FVRA 3CMQA 2HS4A 3IGVA 1WTBA 1J5OA 1JLCA 2B7BB 3TP2A 5J1EA 1AB8A 1I94F 4CP5A 4X62F 3D9BA 3NLCA 2AKWB 4USUA 3WX8A 3OL9A 2MQOA 2MKHA 1HFEL 2PGCA 3BQ1A 4QWAA 1YJ9S 4H4MA 1F5CA 2WW4A 4C98A 1HBUB 4KPCA 2HHSA 3TA0A 4LR8A 5DDQC 1D0EA 2QFJA 3ENVA 2ZH7A 3QZ8A 5J2QB 5EDWA 1UVKA 2C2MB 1YRUA 1TR0A 3PNIA 4K4XA 2R7QA 3O1LA 1HPZB 2XHWA 3BZQA 5D4OA 2CA9A 2BUNA 2V94A 3O3LA 3M30A 3G8SA 2ZEJA 2IYGA 4RW7A 2Y8WA 4TXSA 2OMOA 4N8OA 4CLSA 3V81B 3R1HA 1VQ8S 2JEIA 4JI2J 1M1HA 1VRTA 3AJ2A 4LF9J 3OVAA 2FHMA 4ZJLA 3M1VA 1S1TA 3DGPB 1N54B 1R8BA 5HBMA 3CMAS 1I3OB 2HSEB 2Q6BA 1PAUB 1HYSA 5DDRC 3GIIA 2FB0A 4B17A 4NA3A 1U2FA 2BX6A 5LM7E 4RX6A 3EZUA 3KK3A 2DJWA 1NKBA 1B99A 3HK2A 4C97A 1H38A 3ILOA 1C4CA 3D67A 2KYXA 4NLYA 1PYOB 2J6UA 3I87A 5CCMA 3FZBA 2KDOA 5A8KB 1RT2B 1ZM9A 4FYWB 3DHXA 4ES1A 4P73A 4CLZA 1MU2B 2VG6B 4YDXA 3ZNJ1 2PEBA 5CD4A 4OYIA 4CH1A 1IKXB 4MAKA 2HRYA 1XQIA 2Z0GA 4OL8A 5ETOA 4DR3F 2CDQA 1CJKA 3MM6B 4IFVA 2QIFA 2WVCA 3RAXA 1GX6A 4FYXB 4PCQA 3A8KA 3NP5A 3TZXA 1TL3A 3M8WA 4LRDA 4CT8A 4CLUA 1NJXA 2I0XA 5D4NA 4J9LA 1FNOA 1MWYA 3VZHA 3AAWB 2F63A 2MQPA 4NWBA 4KSEB 1EP4B 2B56A 4F26A 4ATNA 1XNRJ 2R7SA 1KVKA 5J2PB 5K5MA 3CNQP 1U26A 1KVJA 4WF9Q 1S1XA 3HJVA 3TJAA 1SH0A 1FXRA 4USVA 3OPKA 5KG4A 1WC0A 2H65B 2FJEB 4M8LA 2Y3YA 1VR6A 2CQDA 3MCSA 1AYEA 2HMIA 8AT1B 4BWMA 2B6AA 3C16A 2VU5A 2B9YA 2DY1A 4LBPA 4PZVA 1WHXA 4HHJA 3SMZA 2F8MA 4Q5VA 4HACB 2C3PA 4LSLB 2GAHC 1V5IB 4USKA 1UA1A 3IA0A 4CZCA 3TAMA 2DR9A 1LWFB 4RNMA 2I38A 3GR0A 4WFXA 2ZBPA 3OXLA 3UW1A 1RWPB 1WEZA 2UUAF 5DGBA 1TU0B 1AZSB 2G0CA 4EZ9A 1X4EA 1O6XA 2MKJA 3CJ0A 2CQBA 1S6PA 4X4QA 1T3OA 4J9QA 1WUUA 1XK8A 2EFVA 3KLVA 5DRKA 3C2PA 3IRWP 2HIQA 1RHQB 1OY8A 2M52A 2D9OA 3TVZA 4DFKA 1WG4A 4F4YA 1CJVA 2D7SA 2OEMA 4ZPAA 1MSWD 3PYFA 4EGLA 3MMBA 1U2RA 3RBXA 1TKZB 4WZMA 3TUPA 2MZSA 4NA1A 2KRBA 3PW4A 1S76D 3UI3A 2GV1A 2VJVA 4ELVA 1RWXB 2QTWA 1KEKA 2IIHA 3N5FA 3KNGA 4ENOA 1GTHA 4DR4F 4ZHRB 3S7RA 4RWXA 4JI6F 3IC1A 2X3GA 4WFZA 2L08A 2V4JA 5H9EJ 2VBWA 1FHTA 2ZUAA 2XO6A 4A8FA 3FEZA 1BXNA 1RHMB 3KHHA 2G1DA 1QAYA 3MMAA 4ELTA 2JFKA 1TUWA 1WI6A 2L48A 2QE5A 4LFBF 1SKRA 4FVCA 1H7WA 1H73A 3TANA 3HXMA 2PEHA 2ZOGA 2DNQA 1SXLA 2BE9B 2PIIA 5BR8J 4FF2A 3HULA 4IR9A 5KFXA 4DV3J 4PR6A 4XTTA 4OZ1A 4PRFA 1WOPA 2QA4S 1FJCA 4GVLA 1HBOA 2X1FA 2LXUA 3M6XA 3GQCA 1RAEB 1Q0NA 1O0PA 1WTFA 1VRUA 5IT4A 5F9NA 1FKOA 1U47A 1SIZA 3MM5A 4OX8A 1IKWA 1LW2A 2GS8A 4ANCA 1PC4A 2I8EA 1WC6A 2FJVA 1VQ7S 4L76A 4KAIA 1S1WA 2W24A 1RHKB 2ZOFA 3CMES 3CDBA 4X64J 4JP8A 4OI6A 4OYZA 4ZLJA 4DPOA 4JI5J 3Q0AA 1URRA 4RW9B 3ZFVA 5KFMA 3TARA 1U1LA 5K14A 2KB2A 2DO0A 3FBFA 3AQOA 1RISA 4B3OB 2V2VA 2JVRA 3M9MB 2W9CA 1YVFA 3AY0A 3SV4A 2CZ9A 2ZD1A 3Q83A 1HI0P 1IJFB 2KM8C 3EWGA 4UOCA 2ZFHA 4CO4A 1Y5NB 1FEHA 4NRTA 1NSQA 4MK8A 3KFWX 2IYIA 3PO5A 3MEDA 3OR2B 1UTAA 1ZM2A 1KOHA 3G8QA 4RUAA 2V8VA 4WFNQ 1JJ4A 3RR8A 4Z2XA 4LF7J 4AT1B 2YVSA 1PBUA 5DQIA 4F04B 1HWUA 2ZBQA 3CO9A 3DXSX 4YY3F 2H4YB 3QT8A 2F65A 5EX0A 3Q22A 3DLJA 4X4SA 2XHCA 2D3UA 2MQQA 4WU3A 3B4DA 4KH0B 3NBPA 1HNWF 1WC4A 3VHQA 1HMVB 2VA2A 5LOQA 5D4PA 2PSZA 3CF5Q 3PX4A 1HA1A 4TYBA 2N3OA 2C2ZB 1IBKF 4HT5A 1QLNA 1WEYA 4DSEA 4J91A 2NUUG 5HJYA 2HZAA 2O01C 4LQ3A 1CJUB 3TX8A 1H7XA 3H40A 1U0HB 4CT9A 5K20B 3CIZA 4YR3A 2XNQA 1N32J 2HWHA 3EPGA 2FJWA 2F8EX 2B5JB 3VV2B 1T95A 3M2VA 2CZVC 4DCOB 5SUHA 1DJ0A 1RGVA 1HBNB 2HFSA 4DEZA 5FIIA 4ED8A 5GAEU 4WFYA 3ITHB 4ECWA 3EUNA 4B9TA 4AD6A 1NK8A 3RB6A 4OI1A 2KFZA 5B0DA 1H6KX 3L7UA 1FKAF 4DL7A 3PYDA 2AJFE 2W1BA 1ROFA 3CC2S 3ILJA 2OPQB 5DGAA 1U49A 3H2UB 1KR4A 3T5LA 1DURA 4XPEA 2AF6A 1RTJB 2G4BA 2ZZNA 4PXDA 1TMJA 4KV8A 5KFUA 4QIWD 2J7WA 2QLBB 2OEKA 4HI1A 3LF0A 3EX7B 2LU2A 5ETVA 4DFPA 2XSJB 3HFKA 2EK1A 4A8OA 4F67A 1OY6A 5HMZA 3PKMA 1U45A 4O3SA 4EYIB 4ZP7A 2V34A 2CXEA 1Z4UA 2CADA 4DUTA 3BM7A 4M5JA 4MYTA 2EWHA 1AFIA 4BLGA 3SI8A 4YP3A 1ELOA 2MZQA 1T9YA 3QGGA 4A8WA 2J6TA 4Q2MA 1NUEA 4ZN3A 1DTQB 4B9UA 2MY7A 2DEJA 4DL3A 2V8DA 4C8NA 1UMJA 2OFHX 4FS1A 3T1HJ 5RUBA 1LNQA 2IMWP 1A6LA 3K5MA 3J81j 3CJQA 1N6QB 3PTWA 5GAEI 3AB4B 1RWWB 3JS9A 2PA8D 3Q89A 2DRAA 4ID5A 2B7CB 5ETTA 2OTJS 3M7VA 5I3UA 1Y7PA 4DV3F 3N6NA 3C6UA 3VAFA 1NPRA 2XM3A 4A47A 3CDEA 2H54B 1YZ7A 2BJ8A 4ALZA 4QPXA 3KUHA 3JTPA 3C46A 1LK5A 5GAGU 1X4CA 2EG2A 5A0YB 5KFKA 2BQRA 3M8PA 3MECB 2QA1A 4NL5A 5ETKA 1OQ6A 3PZPA 3OFGA 4QCLA 2RILA 1NEEA 4CYUA 2FIUA 3HT0A 3FRYA 1IR2A 1GMWA 2CG8A 2XWYA 2HFZA 3W5ZA 2DYAA 2KYZA 4EBEA 1QAJA 2HQFA 2JEJA 3MMCB 4CLKA 4DX5A 1G1XA 1S9EA 5KG7A 1S6UA 3UVJA 3CO0P 4W98A 3AB2B 4NXNJ 3C3LA 1E6YB 3BGRA 3CJKA 1YG0A 3NGTA 2DNGA 4LJMA 3J80Y 1U25A 2W8KA 1WKJA 5LL6d 3W2WA 1AUDA 2GJFA 4Q43A 4OHWA 4DPTA 1N5QA 1S0VA 1MROA 3Q8QB 3J7Z5 1YBUA 2UV8A 3L7OA 3G87A 1EKRA 4LF6J 4EI2A 2IA6A 1T8EA 4U95A 1KONA 5LMUF 3HO1A 2K1RA 2ZKTA 4DV2J 2XZWA 3MD1A 4WXOA 4X4PA 1JLEB 3MM7A 3LA0A 2CWXA 3CCZA 1VQ6S 4CWBA 2DD8S 3KHGA 4MK7A 3IGNA 2HHVA 3UWTA 1FDAA 2OPRB 5GAGI 4DQQA 3W9IA 1F5BA 4KRWA 4LF7F 1ZM3A 3MWBA 4J9PA 4HYKA 3D4JA 2BV3A 2H5EA 1S9GB 2P8IA 4ZLLA 3PIPQ 5AE3A 1LWEB 2OI2A 1Y3KA 3FSIA 2GVDA 4D3GA 5KFZA 5DS7A 4RW4A 4E2FB 1OPZA 2RDJA 4IOBA 3PCOB 5HMYA 5SZTA 4P10A 4I4BA 1D9DA 3I4PA 1NXIA 2CJYB 1NU4A 5HVGA 1RWKB 4UT4A 2NZ4A 1QTNB 3PYGA 3NNAA 4HDGA 3BGOP 3BJYA 4MKAA 4ZP9A 2HNDB 3W9JA 1SJ4P 4B3RJ 4DLGA 3LTOA 4QU6A 1TK5A 4UY85 5KT4A 3HHLA 4AXJA 3DN9A 4IQXA 3DXBA 3CUNA 5EWGA 2W2PP 4KO0B 3W65A 1WOOA 1TL5A 1BD6A 4NZ7A 3CPWR 1YK9A 4HHUA 2RVJA 2HKEA 2GQ2A 2CJKA 4KKOB 1N32F 4OX9F 2C2DA 1RTHA 1NDCA 4OMFG 1L3UA 4ID8A 2W4PA 3TWZA 1HNVB 2R2TA 3RR7A 1X5SA 1DBDA 1CQMA 2IRUA 2LYVA 3FVYA 2R7VA 1S1VA 2E9ZA 1VYAA 3HDSA 4IDKB 2UUCJ 1N52B 2HNZB 3M8QA 4ZVQB 2E5LJ 2RSQA 3OFFA 3C6TB 1B4SA 3DDIA 2J9DA 4RNHA 3L95X 4OHZA 3P96A 4OHXA 1Q5VA 4LREA 2KXNB 3K5NA 2YNGA 4JI7F 2C2RA 1ZOTA 5L1KA 3BN4A 2ASLA 2FUG9 4QYZK 2IC3A 1D09B 4ZP6A 3MOZA 2HHWA 3M9OB 3QIPA 4WE1A 3CCRS 1A7GE 3IR6B 4TN2A 2MJUA 4C8YA 2AX0A 4M1KA 3DYAB 4O3OA 3IO1A 3BO3A 1T05A 2K06A 3B78A 3GFYA 2ZNZA 3M32B 5GMEA 1AA1B 3JB9k 3UE2A 1VQMS 1HWLA 2M3DA 3DOMB 4P71A 4AQYF 3ZZTA 5HROB 5HAOA 4U7CA 1VBXA 3Q8SB 3C66A 3GYNA 2IVFB 3PHEA 3M8RA 3CCLS 4ED1A 1RB0A 5KFTA 4LRCA 3T1HF 1JLFA 2KG1A 1MLAA 4KY3A 4OJ1A 4LSNB 5LSLA 2LXFA 2CFXA 3OXGA 1RXOB 1YDLA 3WIUA 1SCJB 1FE0A 4PQUB 2DH7A 3NS7B 1P9QC 2NS1B 3D3CJ 3BH6B 2DNHA 1LEOA 3MPYA 5L1JA 3LGMA 4D3HA 2JDJA 2OH2A 1TL1A 3Q8UA 1W2BR 2V2KA 2HG4A 2I5JA 3JXOA 2V2QA 4B02A 6FD1A 2E66A 2HVIA 1NDLA 1CULA 1SBRA 4R8UA 3PVXA 2ERRA 1I51B 2K8GA 3UDCA 3T1AA 3MM8B 2BJEA 4PYAA 1JX4A 3QPIA 1GMUA 3O8WA 4K4ZA 1X9SA 3I0SA 3OV7A 3OTCA 4RW7B 2DITA 4ICLA 4I7FA 4CLWA 1RQ0A 2V4RA 2ZZMA 2KFYA 3G6VA 5K8OA 3A8IA 1GMWD 1KFSA 4LBIA 4UUXA 2HFOA 2ACYA 4WCEQ 4MIBA 4JB8B 3KLFA 2RJZA 4O4GB 3M1VB 3VAHA 1S1TB 4RBVA 2PD1A 3MR7A 4C8KA 4Q0BA 4ECUA 4HH0A 2VICA 1VFJA 1GQEA 3GCXP 5E3AA 4DR1J 3QAEA 2RF2B 2AGPA 2AYGA 3VAMA 2QL5B 4CNZA 2R42A 2D3OR 2PE8A 4NCBA 1VBKA 3DRYA 3HKWA 4HR2A 3LP0A 3CCUS 1XJWB 1VIXA 3Q24A 3DI6A 2ASYA 1C0TB 4LF6F 2YKAA 1NK5A 3N4WA 4Y6IA 1S0OA 4ZVRB 3QT5A 1JLQB 2JRSA 5CZXA 4IG3A 1UW4A 4OZLA 4KGZB 3KLIA 3K58A 4KFBB 2MQMA 1NBEB 1GXLA 5KG1A 2YKNB 1HNZJ 4TQSA 3M6UA 4KHRA 4KGXB 2W25A 5ETMA 1WF0A 1SVDA 5CA5A 2MQLA 4DQIA 1KQSR 3LGHA 2RQMA 3A8JA 2OLWA 1TP7A 5HL7Q 4IFVB 2BM1A 2C42A 2ZC3A 2KH9A 4Y65A 1Q79A 3CD7A 2RRNA 2QYCA 2MLZA 3N28A 1WHYA 1RK8A 2E1MC 5A6WA 2M5YA 1YRXA 2ASDA 3SDEB 3NEKA 3V6DB 2CQGA 1Q8BA 3HCXA 1M90T 4DV4J 5E7OB 2WZ1A 5B7WA 1N5YA 3BYPA 5D0HA 3D2WA 4LF5J 1S1XB 2L3MA 3HHLD 2UZAA 3ETOA 1Q4RA 3EGNA 5GMDA 1SH2A 1XERA 3SEOA 1REGX 2DXDA 1IKVA 1TVRA 2FY8A 5KFJA 4GC6A 3PJXA 4TY8A 1PBAA 3QIDA 1UZHA 3GV5B 4B9MA 1RT4A 5H9FJ 1FRJA 5E33A 2W9BB 1VJWA 3SQGB 3AA9A 5L39A 1U1RA 5KFGA 2MKKA 2WONB 4OYPA 5HP1B 3KJVB 4QBUA 1X4DA 2OD4A 3KJFB 4O3NA 2HWTA 3ZZRA 5KFIA 2W01A 2W9AA 4P7VA 3WZ0A 1H2UX 3FDSA 1C1BB 2AP6A 2R2RA 3I0RA 4NLXA 2E5LF 1RAFB 1MMLA 1RWUA 2VG5B 2DTJA 1B3TA 4OZ2A 3GIKA 5J2NA 1VQKS 2HBRB 1D1UA 1D8YA 1U6ZA 1RT5B 2Z4PA 3KXDA 5KT2A 5F8HA 2JZ5A 1RHUB 1CJVB 4I69A 1YRTA 3POTB 1UL3A 5A2QY 4YHHJ 3MPUB 3C15B 3N6LA 2YX7A 2LLZA 4DV6F 3JSYA 3KLGB 4DX7A 3BQ2A 1HNXJ 2WSCC 4OYAA 3H90A 2RS2A 5BXIA 2ZKUA 5HMXA 2KHDA 4PG5A 4DOZA 2GO9A 3J7ZT 4CM0A 3TJ9A 2ZHBA 2AWZA 3SCKE 2LDIA 2B8PA 2OKQA 1UFKA 3GSDA 5HQLA 2Y8YA 1WSVA 1ZM4A 3LP2A 5D3GA 4M5MA 3KLHA 2A6MA 4DHVA 3DLEB 3NAHA 2LCWA 2EKYA 1SL0A 1VDHA 2VQEF 1OPIA 2ZH9A 4AYBD 3BN7A 2UP1A 5B0AA 3GSIA 5C2CA 3H42A 2HS0A 4NEZA 1NB2A 3RRHA 4MT1A 4PXCA 2U1AA 3FFIA 1BC6A 2Y0SD 1ITPA 3NGKA 4Z7YA 3SFGA 3TQ1A 1QAXA 2UVRA 4QWDA 3B6BA 4MFBA 2ADBA 3UR0A 1DRZA 3IBCB 4UY8T 1P1TA 4RUCA 3ZZYA 3DRRB 3HVTA 1UJ6A 1UP1A 3HF5A 4OZNA 2IAJB 3ZZ0A 4I6YA 4QIVA 5CQGA 1RAGB 4UUWA 4AUKA 2EFGA 2VA3A 1S1WB 2HQ3A 3MAHA 3CCSS 3BBCA 2YKQA 3GZ7A 4QPTA 2NSBA 3Q2SC 5B0EA 4CI0B 4FXDA 1KDNA 3QRRA 5F0WA 2CQCA 3MAQA 3OD2A 4QIFA 4M5GA 4O3QA 5A6PA 3H4BA 2AD9A 4DR1F 3V5RA 3IBFB 5HVHA 1WG1A 2ZVIA 5K14B 3T1YF 4BC7A 3HSGA 1EQMA 1W26A 4PKDB 3M4XA 4FKYA 1IR1A 5CYQA 2KO1A 5CYJA 1ZETA 2ABYA 3HX9A 4DR7F 3ZTRA 4EO8A 1NK0A 3J81Y 1TK0A 2ZD1B 4H4OA 1KC8T 4J9MA 2Z2ZA 1RT7A 4XPCA 3BR9A 2ZM6F 4B08A 1OSCA 1RWMB 3QAUA 3BO4A 3HP6A 2J9EA 4LF8F 1DARA 4EYHB 2IJRA 1HNZF 2HHTA 3R8YA 4M5DB 1M1GA 2F7VA 3DGVA 1R0BG 3MEGB 3ICLA 3D6HB 2QV6A 3VGUA 3AT1B 3BPSP 3HZGA 2YWGA 2CJQA 3JYTB 2F9JA 4R25A 2GHVC 1QE1B 1H98A 5A8RB 2YKMB 4IG0B 3G96A 1TKDA 2GAGC 3NS6A 1CS4A 3MEEA 2YTCA 4ZIWA 2UUWA 3EVWA 2BMBA 4WP3A 4URQU 4JV5J 2VV5A 3QNWB 3S01A 5F8IA 4KHPJ 3GMGA 1X0PA 3VF0B 2GX8A 3HVAA 2VFRA 3NWRA 1EAYC 4NCGA 2BYCA 4U96A 1TL7B 2CRLA 1LWXA 1UJ5A 2PMHA 3K8WA 3K57A 2C28A 2B4UA 4ANDA 2UXCJ 2FHJA 1Q53A 3CXCR 3BBBA 3RAMA 2VHGA 1SUQB 2VPWB 4C8ZA 2ALZA 2MDAA 1DTTB 2MKYA 3LWLA 1NZ8A 3IS9A 2C2KB 2NYIA 4PQAA 1NJZA 2KXFA 3BREA 5B0BA 3KKFA 5A8WA 4NLSA 4RW6B 1FE4A 2JC0A 1VQ4S 4P75A 2QLXA 2J6SA 2FLLA 4A8XA 4AL6A 1IXKA 2QFIA 1OWXA 3MDFA 3CGIA 2ZH2A 4CLPA 2ROGA 4RW8B 1PCAA 1U02A 2PMWA 1DLOA 1VMBA 2CVIA 1NK4A 2V8HA 1C0UB 5IV4A 1SB6A 2BEFA 3D1OA 3ET6B 3H0PA 3PDNA 1FVQA 2E5IA 4B3MF 3ZTSA 2AGOA 3ISND 5L46A 1IWAA 3OFEA 2WVEA 1A9NB 2LP4A 3NGSA 2NXUA 3NMRA 5C42A 5A76A 3KG4A 1QJHA 3IRXB 3TZZA 3BR8A 4RU9A 5E0OA 4F3MA 1H0HB 2V5HG 1JXVA 1N4LA 2XLIA 5CCLA 3GE9A 3AOBA 4ETXA 4EBCA 4JI4F 2ILYA 2KXHA 1HNXF 5K8NA 5LSOA 4Z37A 1X9WA 5M2UA 2AU0A 3MM9A 3SSSA 4EEYA 1XMQJ 1S10A 3MPDA 3P45B 5IWAJ 3D7SB 4JI3F 3OTEA 5HANA 1S6QB 3AODA 1RBLA 4OLOA 4OV1A 3EXYA 5KT5A 5C24B 2XZTB 3E01B 1P8GA 1G3OA 5JVGQ 1Q8IA 2XS7A 2KZZA 4DV0F 4XDDA 1HI1A 1N0UA 4JV1A 4N56A 5DQHA 4X4UA 2EC0A 3A13A 3GIMA 4C3KA 3CJ3A 2E5GA 2IPOB 2R3VA 3V4IB 1NK6A 1NKCA 3O6QA 2D69A 1CVJA 3C19A 3QFWA 1K9MT 1PIEA 2C1EB 3I82A 3IM8A 5EWEA 4QYZJ 1HL6A 4GC7A 1RT3B 1VCTA 3RB3A 4WU2A 2NREA 2AEJA 2H3EB 2AHOB 1KFDA 4YDDB 1YGYA 2XMMA 3TA1A 2O66A 2D1CA 5J2MB 4MJKA 1QSYA 4NOHA 3US5A 4X66F 3NCQA 2E5JA 3P6YC 4C0BA 1UPMB 2BE2A 2L41A 3M8ZA 4C8MA 4TY9A 1FERA 5LT5A 5IZHA 4LFCJ 1TUGB 4PAAA 1B0VA 3EJMA 4IOCQ 2U2FA 4O44A 3L09A 3ENQA 3BGUA 3WDOA 4JI8F 2LEBA 1C1CA 1F3VA 3DLGA 2DNZA 3FZ2A 1FI4A 4ZITA 3AQPA 2Z30B 5KFBA 1VQNS 1R27B 2JC1A 2V6AA 2CQ1A 1HBMA 3CJ8A 2ZDOA 4XO0A 3MUVP 3BB5A 4X4VA 2DGWA 2HBQB 1YWXA 3ZZUA 3R7BB 4A8SA 1HHTP 2W4DA 2HZCA 1FKPA 2Q79A 2AYMA 1OJ4A 2A6OA 4ED2A 2Y1LB 1MROB 2WOMB 1TL4A 5AXLA 5HLFA 3CEDA 1N5TA 2KVIA 2OTLS 1I94J 5CZVA 1NMEB 3QFHA 1UA0A 4OFZA 3ONQA 1FNXH 1T7PA 5ADZA 3SSRA 1IKYA 2MSSA 2XGQA 4GO5X 2DRBA 1BWVA 1G6BA 5JJBA 3KK1B 3K59A 3CB4A 2IBKA 5KAKA 1LXNA 2WK4A 1FDBA 3QBCA 2Y1IA 5E5NA 1TTHB 4DJBA 2Y1RI 2M88A 3DRPA 3VGTA 2LQ8A 3OL6A 2VPZB 2NZCA 3ENWA 3T3FA 2J7UA 5D0RA 1UEUA 2ZE2B 3Q8PB 3E3XA 4LF2A 3FCWA 1S12A 1OMSA 4JV5F 2DGVA 4KB7A 2A2CA 1H74A 4KHPF 2JLFA 1R8PA 1BQNB 2UVUA 5DZ7A 1TV6A 4NLWA 2KHCA 1KWMA 5FDLA 1RBAA 1WC3A 2KG0A 2XY7A 4NLQA 2UUBJ 1CC8A 1EETB 2CYYA 5GVQA 4C7QA 2UXCF 2QN6B 3HHLB 1LWCB 2RQKA 4ZPVR 2JLEA 2FHJD 1SC3B 2DT9A 1RKIA 2LMIA 1SKSA 4DV1F 3KK2A 2I2YA 2QMXA 1Q7YT 2UVVA 4EU0A 2J0XA 4ECVA 2ZC4A 4ZJOA 4G1IA 4Y34A 1PO6A 2P9GA 3IG1A 2COLA 4K4VA 2FC8A 2BANB 4HVZA 3OLBA 2XMWA 3CJTA 1RTDA 4NLGA 3CTRA 2R8GA 1S1VB 2OELA 4I1TA 2V63A 2VOPA 1E6VA 5B08A 3PW5A 2VBXA 2Y1JA 2CPFA 4I6AA 3CVKA 3J7YU 2FZGB 4RNNA 5DQGA 4K4TA 4JI1F 8ATCB 4X4RA 2VFSA 2VF3A 2IVYA 2ZITA 3QZ7A 3GFHA 3I9ZA 1TK8A 1TKTB 2FQQB 2HVDA 5DO2A 4ZMMA 3HM9A 2QZ8A 2VBZA 3OR1A 3TUJC 5T7LB 4DR3J 4ECTA 1TAQA 1N34F 3THTA 3HT3A 5K8MA 1LFPA 3KLEB 3CCES 2GFFA 3AXMA 1EB0A 5ETRA 5G0RB 2QX0A 4KIAA 2GIRA 3KDOA 3ZXWA 2P9EA 1S4EA 2FJDB 2BDPA 4J9RA 3M2RB 2PI5A 1XMQF 1N5VA 4JBCA 1HNIB 1ZH5A 3N79A 3P5TL 4RUBA 2ZJQQ 2V68A 1NSKL 3WIVA 2VKRA 3LOUA 1K44A 1K1SA 1T03B 2IBOA 2N82B 2V9WA 1RI7A 2HGMA 3DOKB 2DNOA 2DNNA 4GO7X 5J2QA 3D0HE 2HVZA 3BEGB 3CC4S 5HO4A 4MKYA 1RAOA 1HIYA 3CDUA 2ZH6A 1HPZA 2VG7A 3VAGA 4G3IA 1FTRA 1LW0B 2P9CA 4QIEA 2BABA 3OHBA 3DRXA 3QMQA 4F4KA 4NASA 1ZZNA 2ACMA 4ZVOB 4WTYA 3V81A 3X3UA 4OYWA 4F4AA 4WFAQ 3G2XA 2NUHA 3J7YI 4M5IA 3L4BC 2MKIA 2C3OA 4NPOA 3OQ2A 3DGPA 1KP6A 3GU0A 5KFYA 4OZJA 3HSZA 2RQ4A 3PKYA 3CCQS 4F8RA 2RDDA 1FRLA 3DLKB 3EXCX 3H2VE 4R8UB 4DSKA 1UW9A 2AEFA 2IRXA 2H5IB 2EC2A 2HS3A 3FQLA 1GX5A 3I31A 2CG4A 1KN6A 2X1AA 3UDVA 3N9UC 1U7LA 3MAAB 4PG6A 2B9XA 1TZ0A 3M2UB 5ETSA 4Q8FA 3HZEA 4P2FA 3SSQA 1BE4A 4DU8A 5D6GA 4JI0F 2C2EA 2I9SA 3GJRB 4NLUA 4I2PB 5KFNA 1HLWA 1RT2A 3FMBA 1T11A 2E9RX 1S0NA 4V19X 1P1LA 1MU2A 4IUFA 2VG6A 1NK7A 3SCLE 2DGXA 4DR4J 2YPYA 2CPDA 4UTGA 2UXBF 1IKXA 4CNYA 3DM2A 2G1HA 5IC4B 2AYEA 3NNCA 3U1LA 1FRHA 2LQBA 2LU1A 3IMQJ 4V1Ak 1BQXA 4KQZA 4GKJF 3MM6A 4DF8A 4O4RA 3BV8A 3SYZA 1SIWB 2BJ1A 3BKFA 4K8RA 5KOXA 2CNKB 4LFBJ 2XYHB 4Q2LA 3T6BA 2OHDA 2HVHA 2NYHA 2K3KA 3NL0A 3QT6A 1EP4A 4NYZA 3P8BB 4M5KA 1LQ9A 3VALA 3AH6A 4L3KA 4LF4F 3KOAA 5J2PA 5ETPA 4IRCA 1NPPA 3R5JB 1Q1KA 1EARA 3QJPA 1Y5LB 1G4CA 2YKOA 3IXQA 4O0NA 2X51A 1HR0F 2HHHF 4USWA 4LIWA 1UPPA 3BYRA 5LJ5Y 2MZ1A 5HN0A 4ETZA 2YNHB 3TVYA 4ZCLA 4QQBA 3SQOP 2IJNA 4HACA 1WC1A 4LSLA 2VPYB 2KT2A 4XDCA 3QLHB 1FK9B 3K5PA 1B64A 4JYAF 2Z56B 1G2EA 1REVB 1LWFA 3R7SB 3MR3A 2HVEA 3ZZOA 2HNYB 2DGOA 3W5XA 4C3MA 2DR7A 2UUBF 2HHUA 2R7OA 5I3PA 5GAHU 3WC0A 4CO5A 5IXUA 4WYWA 1AZSA 1G7CB 3HHNB 2YNFB 4OZ3A 3VAKA 4N5SA 4TY8B 3PY8A 2MGZB 5KT7A 1PC5A 2QA2A 2WB4A 1RACB 1FJGF 1RDRA 2HQCA 2BW2A 3JSMB 4DSJA 3UCGA 5DETA 1TKZA 2Q3PA 2JX2A 4OHVA 2CKWA 4OJGA 4ZVGA 4FF1A 4G1QB 1BY9A 2OPPB 1S7HA 3VAIA 2KT3A 1RSCA 2DRDA 4GVBB 2UXDJ 3LW5C 4OIXA 4TNOA 2OP5A 1FWLA 4QWBA 1WI8A 4ZHRA 2LFVA 4YR2A 4G65A 3DFEA 3TEGA 4N8NA 4DDFA 4H4KA 3M9NB 2Q6CA 3OFHA 1RYSA 1T94A 2GC8A 1MWZA 5IS2A 4YY3J 5KT3A 4ECXA 1Z2ZA 1Y11A 3W2VB 5IT0A 1HNWJ 2H1YA 3H5UA 4RL1A 3FKBA 2GA7A 1FF2A 1RBOB 1SC4B 4ECZA 1SQFA 1XR7A 1ICEB 4QWEA 5GAHI 2XSFA 2FJXA 2ATCB 4USHA 3VGSA 9RUBA 4I2QB 1IBKJ 1XC9A 1X4GA 4CIOA 2CNOB 4H4KC 2D41A 4CDIA 2Z58B 4NXMJ 2VFTA 2FHOB 1WKLA 3MXHP 3EYZA 2DPIA 1U0SA 3BGLA 2ZJPQ 3CCWA 3C14B 4ZJQA 5EGYA 2JJ4D 2M7SA 4A8QA 1HWJA 2H4WB 1L3KA 3M6VA 3PFOA 2GVZB 3FC9A 3AA8A 1VGYA 1JKHB 1HD1A 1YQHA 1HQUB 3DU6A 1XMOF 3IN5A 1TFWA 3P5BP 2W2NP 2K3IA 1JJCB 2EFOA 5F3TA 1FX2A 3CJSA 3FFIB 3OL7A 1HARA 4RW9A 3TZWA 2DNMA 4LUBA 5D77A 5B0CA 2ZH3A 4NMXA 1X5PA 4B3OA 4KR0B 3M05A 4ZLPA 3VR1A 5KG2A 4PWUA 1R31A 5EX3A 6AT1B 1B70B 3MPWA 3JQMA 2VPXB 4KPYA 2G2YA 4UZCA 2V8GA 3JSBA 4NZ0A 4DL4A 1MN7A 2IRYA 3I6PA 1NJWA 1BWEA 2MLYA 2CUYA 4WP9A 4NI2B 1WD6A 3W66A 3OR2A 3TA2A 3FQKA 1JB0C 1EX8A 2BRKA 5BYQA 1FDNA 2HAFA 2W7AA 3G82B 3QRPA 1NDKA 2KRRA 2JEGA 5CYMB 3LANA 2VOOA 4WTOB 4FBTA 4N7TA 2B51A 2RQCA 1ULRA 2HW3A 2YPZA 1HMVA 1LKZA 2LXIA 2Q1LA 2AJQA 3DCAA 3W61A 2R2SA 3JAMY 1EZZB 1UWBB 3OUYB 5HVFA 3QO9B 4I56A 1TMMA 1NZAA 2H48B 5HQ8A 4K0KF 3MURP 3KTQA 4NYOA 3GJQB 3I5CA 5DM6Q 3FMWA 1K8AT 1CJUA 4X65F 1U0HA 2DGSA 1KLNA 3JSRA 2E1RA 1Q82T 3D66A 2MB0B 1HI8A 3DRSB 1KD1T 4FNHA 4X4OA 2GIQA 4ZPBA 1L3SA 2BKPA 3CD0A 4C0OC 5KFHA 2QYGA 5ITHA 2B5JA 3UPFA 1SI9A 4DX8H 1FTCA 4DV5F 1YSJA 1IR0A 3D54A 1DQ8A 3S8SA 1F2HA 5E3QA 2XS5A 3HFZB 1AROP 1HQEB 1RT1B 2B3TB 2HQGA 1HBNA 4DR2J 3J7A1 3ELHA 3Q2TC 4P7TA 4M63A 4S0MA 3ITHA 2GGPB 1GFWB 4WBFA 4CO2A 3W63A 2DBBA 3CW2C 3RTVA 4BHQA 5F9LA 2OPQA 3M8SA 1U09A 3MTKA 3K17A 1RTJA 3BS9A 1MG7A 3OSNA 1KOOA 1IUJA 3KMQA 4TKTA 2GQQA 3CJRA 1XWLA 4YR0A 1M5HA 4DBQA 3PG9A 1VQLS 4K5SA 2QRRA 2MZTA 2XSJA 1ZA1B 2YNIB 2E7VA 2Y9HA 1JLAB 1APSA 5LMUJ 4ECRA 2G2OA 3B8HA 2UXDF 4W4MA 1NSAA 4EMDA 2E1AA 2P6SA 1XEZA 2EBEA 2V0NA 5HMWA 1S9FA 3V6HA 3TUZC 3EVOA 3NRBA 1SL2A 2N3LA 5C42B 2IM2A 2RNEA 1DTQA 5LMNF 1LFWA 3JTOA 2VODA 3DDNA 4KHMA 3PJ9A 3W5YA 2W2OP 2IA0A 2JVOA 1VLYA 3NCPA 4F3QA 2DNKA 4R5PB 1N6QA 4FP9A 3BGFA 2V8PA 3WBZA 1F9EB 4ZKAA 3G9CA 1QSSA 3P4UB 1I5OB 3PEHA 4UQGA 2C3YA 3FGVA 1TFYA 1TELA 3VTIA 1LV5A 4QU7A 1M5SA 4DQRA 4NXMF 1N56A 2EK6A 2FHKA 3CD5A 3FNNA 1K73T 4C4WA 1R8AA 2B9EA 3DKDA 1IWGA 5KOWA 3CSKA 4OX9J 3DNCA 2XI2A 3R6GB 2C3MA 4YUDA 3UCUP 3MECA 4LQ9A 3EDQB 4OJHA 1VC0A 1HHSA 3DOLB 4LRFA 4C2MA 4DL0C 4FF4A 1P27B 1HQ2A 2R8JA 2WVBA 1RT6B 3Q8VA 4ZCIA 3KUGA 3I56S 2HGNA 4J7CA 2FTRA 3VCDA 2ZH1A 3EDRB 3WC2A 3FCVA 2QMWA 2R7WA 1CSJA 1T9XA 2C2OB 3MMCA 2JHEA 4BDPA 4NLRA 4R0EA 3HKZD 4CO1A 2R8IA 1S72S 5DZ6A 1R0CB 3CCVS 1N48A 2CPHA 2MEWA 2DH8A 5ETNA 1NKEA 2YWKA 2VONA 1XTZA 3LP1B 3GILA 2Q66A 3SXLA 1W7WA 4USJC 1E6YA 3GR1A 4DG1B 1HWIA 1M5OC 4K4YA 3GIJA 1KHVA 3F73A 3B4MA 4CCHA 3SZ2A 4JI7J 4ITSA 4W92B 2UU9J 1GEHA 5IQ6A 1WORA 4ZVHA 5F8LA 1FVSA 5LSRA 1XNQJ 4RBTA 2DO4A 1TKXB 2CQ4A 2V69A 3T41A 5KG6A 3GG1A 3HFVA 3M6WA 2PT0A 4CQ1A 1BGXT 1RHRB 4C9DA 1GXUA 3W8PA 2HHQA 2OD6A 2HLUA 1IBMJ 2VDIA 3PW0A 2HBYB 2HIYA 2Z2MA 3RBZA 1ZAXA 4BS2A 4PABA 2OPRA 4CTAB 3D3BJ 3I5BA 4AQYJ 1U8WA 4DV7F 3EVMA 1S9GA 1NCLA 5B0FA 2YQ1A 2GO8A 1S4FA 1IBLF 4F4WA 1LWEA 3DMJB 2F4FA 4OYMA 4YS2A 1WHWA 2YX4A 2KTQA 4RBUA 1VS3A 2JWNA 1H72C 2QO3A 3TUIC 1Y9OA 4QYRA 1NO8A 4DUZF 3K89A 5KFVA 3V2UC 2HNDA 2AX1A 3NOGA 4FKXA 4CRJA 1ZPVA 2L9NA 3BSNA 4DLEA 1FXLA 4WFBQ 2F4VF 1YJ7A 1T9UA 2RT3A 2AYBA 3HPOA 1F2GA 4KKOA 1UVNA 3UCZP 5MAOA 2NPIA 3MR2A 1N88A 2ZUGA 4WJBA 3R1LA 1WG5A 1UETA 1HNVA 2NSCA 3VGVA 4PWDB 3DLLQ 2XYGB 3CT9A 4OLPA 4UW2A 2OPSB 3LAMA 3Q8RB 4DR2F 4DX6A 2R9LA 5KFLA 4Y2CA 4IDKA 3OSPA 3K8VA 1J5EF 2I6WA 2CJ9A 1NJYA 4RZRA 2HNZA 2C3UA 3CIMA 3IM9A 5CHCB 4MKVA 4L3NA 1SV5A 1RAJA 4UOFA 4RLEA 3OJUA 2FVPA 2LKZA 1V6HA 2CAJA 4B9LA 3MCMA 3NAIA 1S79A 1EIYB 3CCJS 3W60A 1R0AB 2L9WA 3BSOA 1IM6A 3W62A 5M2RA 4NEYA 2R7TA 1T9TA 1RTDB 3VAJA 4GRSA 2GJ2A 1WDTA 5GADU 5EN1A 3KMSA 2DXFA 2YWHA 3ZO7A 4YB6A 4IR1A 2E7WA 5I4MA 1KBRA 2CPXA 2HHXA 5I42B 5D8HB 3RBEA 2LEAA 1U1MA 4NE9C 1FFSB 1MMNA 1O51A 2NQPA 1MMDA 3GPAA 4RU2A 1IM4A 3M32A 2AQ4A 2XYPB 3RW6A 5KFEA 4JUZA 1EJ7L 3R5BA 3OR1B 5HROA 1CJTB 1KS2A 2A2DA 1XIQA 3JAMU 4PUOB 4ZVSB 2DISA 4LSNA 1GNKA 1VISA 3H2LA 1Q86T 3KG1A 5LXYA 4PQUA 2ZH5A 1X5OA 4YB5A 3HI9A 4DCPB 4DQPA 1S77D 1Y5IB 2AGQA 2Z57B 1FEEA 4B3SJ 5C5JA 3CC7S 2Y0BB 1AT1B 2IM1A 2VG7B 3AD7C 2OMLA 4LF1A 1U8SA 4IH7A 3MM8A 1UEKA 3R9LA 4FYDA 2EKNA 5BYRA 4ANEA 4LBHA 1D8ZA 1F0XA 5KG3A 5GADI 3IFEA 3CJ5A 2QJ3A 4F7VA 1RTIA 5JXSA 1VC5A 3D1QA 1RU1A 4O4GA 3D28A 1BQMB 3IWNC 2IM0A 2VDHA 4C11B 2A10A 2J0QD 2RF2A 4PG7A 3LQVA 4UF4A 5IM0B 1S5ZA 4PG4A 4X2BA 1QSLA 4YEAA 2WSFC 3KJQB 3MUTP 2N7YA 1OSDA 2EW9A 4E8UA 5L1LA 2UU9F 4URSA 3CULA 2RDIA 1DQ9A 2X7IA 3OT9A 1X60A 4CO0A 2QT7A 3D6MB 4IRDA 3CD6S 1GH8A 1KSPA 1XNQF 1YITS 4IFYB 1Q7LB 3UQSA 2IM3A 1C0TA 4J9NA 2BACA 3HHDA 2RU9A 2ZBCA 7AT1B 1RKJA 1NH8A 2HAIA 4DV6J 4C48A 1JLQA 2HURA 3FJ2A 4C0HA 1IBMF 4KFBA 1IN0A 3UN2A 4Y00A 4OX6A 1GK8A 4NMLA 5DM7Q 2YKNA 3WQPA 1RADB 3T5JA 1S1UB 1L5UA 4N76A 3QJLA 3PRDA 2CDRB 1NHKL 1JLBB 2XO7A 3NCRA 3GONA 2OO4A 3DM2B 2BOAA 2MKCA 5D0EA 3EMTA 3JQKA 4OYXA 1X4HA 4FYYB 4Q7AA 1PJ5A 2DHHA 5CXTA 1J5OB 4KBIA 1JLCB 1RAHB 3OJSA 1JLGA 5J1EB 2XLKA 4RO0A 1WWHA 2ZOMA 1M1KT 2PMZD 3BKTA 3D0IE 3ZZZA 3SDEA 5KFPA 4C8OA 4LMZA 3V6DA 2QSFA 3MCNA 3PV8A 2VQEJ 2YX1A 3MHYA 4H4MB 1JK9B 4ZVUB 3FSYA 4USMA 2FVCA 4FN5A 5AXNA 3UNGC 1FFGB 4ZN1A 1MNEA 1YKWA 2ROPA 3MF5A 4ED6A 3M30B 3O2IA 4DUYF 3MR6A 2NR0A 2W9BA 3SQGA 4RNOA 3EM1A 4LFAJ 2WONA 3OTDA 3T5HA 5HP1A 3KJVA 2EXUA 3N6MA 2XGPA 4Q8EA 2VC1A 1S97A 2B9WA 1V5VA 1YJUA 1CQNA 4MIAA 4A8KA 3TO8A 1W2IA 1KLMA 2N4DA 2XMUA 3NXZA 2D74B 3G6ES 1VRTB 4KC5A 1NB7A 3VVTA 1C1BA 4DPWA 2DGTA 1X0FA 3ULHA 4O3PA 4F4XA 2APOA 2VG5A 5HBMB 1NPKA 5L9NA 2ZWPA 4EFAC 5E3CA 3W1YC 5ETLA 1NNDA 3L7PA 1HYSB 2KL8A 3IR5B 1N33J 4DL6A 3V6KA 3T1YJ 1ZTTA 3OTBA 5E41A 1CEZA 1B0TA 1RT5A 4RPFA 3IWXA 5H1SV 1V3SA 4CLTA 1B0PA 2H5JB 3TX0A 2DHGA 3KK3B 3HSJA 1UVLA 3W8GA 4DR7J 3K5LA 1OQ3A 4A48A 3POTA 1JJ2R 1U1NA 4HTJA 4PXBA 3C15A 3UDEA 1FFWB 4FPIA 4H54A 4OZ0A 1CC7A 2B4VA 3KLGA 2E5HA 4P6QA 2ZM6J 2FVSA 2ZDPA 2G13A 4Z7CA 4DR6J 4LF8J 1U6FA 1WNEA 2VQFF 1AXQA 2BKNA 3OVBA 2CPYA 4GMKA 4J9SA 2BW7A 2JFDA 3J7AN 2MYFA 3VZIA 5T41A 3MMJA 3LPEA 2EFQA 3CE8A 4KT0C 3PW7A 2R4FA 1CJKB 5IFMA 2X3DA 2OUGA 3DC2A 1F1BB 2E9TA 1BMQB 5IQQA 1WC5A 4MKBA 1TL3B 3THVA 3MPVA 2YQ0A 2DHXA 2VD3A 3DLEA 2VKZG 4F4ZA 1ZZFA 4OJ3A 3TVKA 3CDWA 1SQGA 5KFOA 3U1NA 2VFUA 4RJVA 4RR5A 2ROEA 2YH0A 4ZVFA 3UFCX 3GLJA 4QW8A 4WIQA 4ZVTB 2HGLA 4RKUC 3NGRA 2VC0A 4B3SF 4DL5A 3VQTA 2POKA 4Y2AA 2HMIB 3CDAA 1PJ6A 1NM2A 2AW0A 2B6AB 2XMJA 3C16B 4FVMA 3DLBA 8RUCA 5HQMA 1R6YA 4TVAB 1S0MA 5AXMA 4ES3A 1RWOB 3DRRA 5ETQA 2CVEA 2IAJA 4CLFA 2NCKL 2A18A 1YJNS 3I9V9 3RYLA 3TAMB 2G2ZA 1SKUB 2J9CA 1NHVA 4JI2F 3BSCA 2HPUA 5M2PA 2BZ2A 2BRLA 3K0JA 1WSRA 4LF9F 2RMLA 5G4DA 4I67A 1NRKA 4J9KA 3HLUA 5E3RA 3P49B 4WPAA 3ZTPA 3F41A 1X9MA 4RNFA 1JMTA 4I68A 2F8HA 5L38A 3J80U 1MWQA 1VQPS 1S6PB 5JUMA 4B3MJ 1CBKA 2R7RA 2BQUA 2PFDA 3ENAA 4NLTA 2ZH8A 1IJEB 2E44A 2GW8A 2IDLA 4JV2A 1RAAB 2P5VA 4DMZA 2J0WA 3I32A 2IVMA 3X1LB 3TAQA 1GTEA 2EFNA 3MMBB 1SPBP 2W4CA 2JLGA 2VZ9A 1GAOA 4JI4J 3GYGA 1VHFA 1X31C 2XG8A 4WK3A 3W3SA 1FRKA 5H9FK 4E0DA 4ZOSA 2PO4A 2DY9A 4M5DA 2R7UA 2EI5A 4JI3J 3MEGA 4YB7A 2W7OA 4ZS6A 3DLHA 3RUBL 2M2BA 4QJVA 3JYTA 2B0GA 2D3O1 2V4JB 5DLFA 4X4TA 3G6XA 1QE1A 5A8RA 2YKMA 4IG0A 4LT6A 5CAAA 2H9ZA 4DV0J 2VJUA 1QM9A 4P72A 3MMAB 2V67A 4LRAA 2CQPA 2RRBA 2HFUA 1KKHA 1SJ1A 2SXLA 1XNRF 2WBMA 3U27A 1TL7A 2CJAA 3RW7A 2RUSA 2BKOA 1S49A 2MXYA 2LQJA 1HD0A 3GV7B 2BE7D 3AD8C 1SH3A 4QIGA 1SUQA 1HBOB 3LGNA 3A3OB 1DTTA 3SIPB 1VOMA 4WXWA 2RHQB 3PRVA 3HD2A 3QGPA 1VRUB 2ZNYA 3RZAA 1FKOB 4Y0FA 3MM5B 4X66J 4ES2A 1IKWB 1LW2B 3R5DA 4RW6A 3HVRA 2DR8A 3FRZA 2LA4A 4LFAF 3TI0A 3RRKA 1RUSA 2YH1A 4QWCA 4ELUA 2HK3A 2LQ9A 1FJ7A 1YIJS 3PX0A 2FLPA 3EGZA 4RW8A 3IWLA 3SCIE 1YBTA 4XAKA 3HVWA 2OEJA 4JI8J 3IBWA 2KM8B 4L72B 1C0UA 3PIOQ 3ET6A 1HHQA 4F02A 3LH2S 2ZBRA 5HK4A 2DCUB 4MIWA 1N33F 3LAKA 3ZZPA 1C4AA 1Q81T 3RU0A 1AW0A 1IBCB 4LIRA 2DHSA 2BXJA 3W7BA 3SBMA 2RE1A 2WRMA 3IRXA 4OI4A 2W9CB 3ZTQA 2YXLA 5C7PA 4WP8A 3RRGA 5K8PA 4DZ6A 2G0JA 5D0GA 1DHMA 3UR3C 4ILMA 2AJ2A 1HW9A 2BVZA 2YKPA 2FVQA 4DR6F 1FJEB 3KJNB 1XR6A 4MTPA 2AJ4A 4X84A 2CPZA 1Z2LA 1KVIA 3MEDB 2GMLA 1S6QA 1SQEA 3PW2A 2RUGA 3GCWP 4DPUA 5C24A 4ZPTR 3U02A 3PHTA 1QDUB 3E01A 3Q86A 2LA6A 4HDHA 3PACA 4B9NA 4TYAA 1F5AA 2RH3A 2HEKA 3NMAA 1KHWA 3RG6A 3BH7B 2F3JA 2JL9A 1H3DA 5KG0A 1YLXA 1PJ7A 4OYBA 1OYEA 5KG5A 3NBPB 1FRIA 3V4IA 2JSXA 4ZVEA 2FC9A 1M5PC 2FZCB 5BR8F 2IJFA 3VWSA 1AFJA 1RT3A 2NXJA 1FNMA 5BYSA 2UVWA 3VQSA 5HI7A 4YOEA 2O3DA 1VIOA 2AZ3A 4N41A 1CG2A 3QT7A 4DS4A 1V9OA 2ZZTA 5J2MA 3R97A 1OYDA 4UOHA 4K4SA 4DV1J 1JXLA 2DGUA 3D5MA 4N77A 4IYQA 3NGUA 3M2VB 4KYZA 4WYLA 1K0TA 1P9YA 3H5YA 1X7VA 1FESA 2CJXB 3TRGA 3KWMA 3R5AA 4DN0A 2DH9A 2IMOA 4DI6A 3MEKA 3FUYA 4X64F 4FF3A 2QLWA 2VBYA 1PAEX 4TLQA 4JI5F 3R5CA 2EVZA 9ATCB 4DZDA 4JI1J 4IO1A 3GWCA 3RJMB 4QW9A 2IHR1 2Z2YB 4UQTA 4L74A 3GFZA 2VH7A 4USIA 1KNZA 3OL8A 3FBBA 4KV8B 2HK2A 3QGHA 3JQJA 1UZDA 1N34J 2WOMA 2BM0A 2J9DE 1H2VZ 4PPDA 1LK7A 1ZAVA 2ZWOA 1QY7A 3IP0A 4AFFA 3TW0A 4PPZA 2O67A 4MMOA 4HLBA 1RLDA 3AOAA 1JNRB 2YQ3A 3A12A 4RUHA 1Z1ZA 1UVJA 4DS5A 3C8YA 3ZC4A 3KK1A 3RBDA 4AL5A 1ZS6A 2FDNA 4DFJA 4W90B 1FD8A 3N01A 4A8MP 4F50A 4WKRA 1NSPA 2RKIA 4X4NA 1SKWA 2M8HA 2EEYA 5D15A 5FLXY 2D3ZA 1KQGB 4F36A 1NAQA 1OIAA 2ZE2A 2FJBB 2G9OA 2HHPA 3QWUA 4C8LA 1WHVA 1U1QA 2YWWA 1Q78A 5FJ4A 2M4MA 1BQNA 2CPEA 3KUEA 4ID5B 2RD5C 5I3UB 4DF4A 1EETA 3S6EA 1LWCA 3C6UB 4QR2A 2J7KA 3RB4A 2LQ5A 2DGQA 4TU7A 2FJAB 3PXGa 1PYTA 1FCAA 1UJ4A 3M8PB 3A3PB 5DG8A 5F8GA 5LXRA 2MMYA 1OO0B 1O5JA 1YZ6A 2GCFA 2BANA 4CYUB 4ZK7M 5C25A 4P2MA 5LJ3Y 2HBZB 1V3RA 1RABB 4JOUA 3NWGA 3OXFA 2B8QA 4DXLA 2RRAA 2KI2A 2O5DA 4JI0J 3HHLC 1Q95G 3B82A 2XMTA 5JMNA 3R7NB 4K2JA 3FCHA 1S9EB 1X4AA 3UVJB 1SV5B 1WF2A 4K4WA 4WWSA 1UVIA 1J27A 1SJQA 1TKTA 2KJVA 3BGRB 3CJKB 2UXBJ 4YFUA 1FD2A 2QSWA 5A2QU 5FD1A 3IAS9 4EO6A 4DFMA 3W2WB 4EZ6A 3L3CA 5T7LA 2DR5A 4R0JA 3LWMA 3KLEA 3R3TA 4GKJJ 1GMVA 3N0VA 1U48A 4K7QA 5G0RA 3G6YA 2OIHA 3NKYA 1HWKA 3H8YA 2AIRB 2XULA 2EPIA 1SC1B 3M2RA 3AD9C 4Q44A
chains in the Genus database with same CATH topology
1VYAA 3B6BA 1JXVA 5IOLA 1S5ZA 1ZS6A 1NPKA 4F4AA 3G2XA 3Q86A 3ZTPA 3BBFA 4C6AA 1S57A 1PKUA 1F6TA 5CAAA 4FKXA 1S59A 1NSPA 4W98A 1NDPA 3B54A 3DKDA 4DI6A 1PAEX 2HVEA 3JS9A 1HHQA 3NGTA 3Q89A 2B8QA 3FC9A 3BH7B 2VU5A 1B4SA 3MPDA 3VGUA 2B8PA 3DDIA 2DXFA 3ENAA 4UOGA 3Q8YA 4F36A 3BBCA 3Q83A 1WKJA 1NLKL 1NDKA 4ENOA 1KDNA 3Q8VA 1BHNA 2CWKA 3ELHA 3NGRA 2HURA 3VGVA 1NSQA 3EJMA 3EVOA 2AZ1A 3BH6B 3GPAA 3GP9A 3R9LA 4ANCA 1F3FA 3ETMA 1NSKL 3FBCA 1XQIA 4S0MA 1LEOA 4HR2A 1K44A 4ANEA 3VGTA 3FCVA 3EVWA 2BEFA 3ZTQA 1U8WA 4WBFA 4EK2A 3FBBA 3PJ9A 3Q8UA 4CP5A 5C7PA 3FKBA 3ZTOA 3EVMA 1EHWA 3EM1A 2AZ3A 4DZ6A 1NCLA 1BUXA 1NHKL 5CABA 4DUTA 2ZUAA 4FKYA 3PRVA 2DXEA 3FBEA 1NDLA 1UCNA 3ZTSA 3WX8A 1NDCA 1BE4A 3EICA 4O0NA 1HIYA 1NB2A 3EMTA 3VGSA 3FCWA 3VVUA 1XIQA 2DY9A 1W7WA 1LWXA 2DXDA 2BX6A 4UOHA 3ZTRA 1MN9A 3NGSA 4KPCA 4ANDA 2NCKL 1HLWA 4UOFA 3VVTA 1NUEA 1WKLA 2DYAA 3NGUA 3BBBA 1B99A 1MN7A 2HVDA 3EE3A 5BXIA 1WKKA 3FBFA 3L7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYA A;  3B6B A;  1JXV A;  5IOL A;  1S5Z A;  1ZS6 A;  1NPK A;  4F4A A;  3G2X A;  3Q86 A;  3ZTP A;  3BBF A;  4C6A A;  1S57 A;  1PKU A;  1F6T A;  5CAA A;  4FKX A;  1S59 A;  1NSP A;  4W98 A;  1NDP A;  3B54 A;  3DKD A;  4DI6 A;  1PAE X;  2HVE A;  3JS9 A;  1HHQ A;  3NGT A;  3Q89 A;  2B8Q A;  3FC9 A;  3BH7 B;  2VU5 A;  1B4S A;  3MPD A;  3VGU A;  2B8P A;  3DDI A;  2DXF A;  3ENA A;  4UOG A;  3Q8Y A;  4F36 A;  3BBC A;  3Q83 A;  1WKJ A;  1NLK L;  1NDK A;  4ENO A;  1KDN A;  3Q8V A;  1BHN A;  2CWK A;  3ELH A;  3NGR A;  2HUR A;  3VGV A;  1NSQ A;  3EJM A;  3EVO A;  2AZ1 A;  3BH6 B;  3GPA A;  3GP9 A;  3R9L A;  4ANC A;  1F3F A;  3ETM A;  1NSK L;  3FBC A;  1XQI A;  4S0M A;  1LEO A;  4HR2 A;  1K44 A;  4ANE A;  3VGT A;  3FCV A;  3EVW A;  2BEF A;  3ZTQ A;  1U8W A;  4WBF A;  4EK2 A;  3FBB A;  3PJ9 A;  3Q8U A;  4CP5 A;  5C7P A;  3FKB A;  3ZTO A;  3EVM A;  1EHW A;  3EM1 A;  2AZ3 A;  4DZ6 A;  1NCL A;  1BUX A;  1NHK L;  5CAB A;  4DUT A;  2ZUA A;  4FKY A;  3PRV A;  2DXE A;  3FBE A;  1NDL A;  1UCN A;  3ZTS A;  3WX8 A;  1NDC A;  1BE4 A;  3EIC A;  4O0N A;  1HIY A;  1NB2 A;  3EMT A;  3VGS A;  3FCW A;  3VVU A;  1XIQ A;  2DY9 A;  1W7W A;  1LWX A;  2DXD A;  2BX6 A;  4UOH A;  3ZTR A;  1MN9 A;  3NGS A;  4KPC A;  4AND A;  2NCK L;  1HLW A;  4UOF A;  3VVT A;  1NUE A;  1WKL A;  2DYA A;  3NGU A;  3BBB A;  1B99 A;  1MN7 A;  2HVD A;  3EE3 A;  5BXI A;  1WKK A;  3FBF A;  3L7U A; 
#chains in the Genus database with same CATH topology
 1HNI A;  2DB1 A;  4N47 A;  1VJQ A;  1PSD A;  5KTQ A;  2K1R B;  4QZV B;  2QL7 B;  1F9H A;  4ED3 A;  5KFW A;  2XNR A;  1K0V A;  3D68 A;  3GG0 A;  3GFX A;  2XMV A;  4LF4 J;  1T03 A;  3MM7 B;  1S6O A;  3AOC A;  3DOK A;  1RYR A;  4NLO A;  2A1B A;  2VB6 A;  3E51 A;  4Y2I A;  2QC3 A;  3Q8Y A;  4CO3 A;  1HR0 J;  2KZM A;  2CQI A;  1PG5 B;  2HHH J;  3U7J A;  3G86 A;  4P2X A;  2A0F B;  1AUS L;  2CWK A;  3N5B A;  1LW0 A;  4IOA Q;  3EGV A;  2GVD B;  5AXK A;  4RW4 B;  4OYO A;  2UUT A;  2DIU A;  4PXE A;  2YY3 A;  1EHW A;  4IKA A;  5AE1 A;  4M5L A;  4F3O A;  3T9N A;  3NOC A;  4JYA J;  3FSX A;  3R6L B;  1X4F A;  3PEJ A;  3VVU A;  3K2Y A;  3HJF A;  3F56 A;  1J2V A;  4RWW A;  2RAQ A;  2M9K A;  2PN6 A;  3OTO J;  3SFU A;  4DCJ B;  3A4T A;  2OFG X;  1RWV B;  3PR5 B;  3DLK A;  2L9D A;  1F9F A;  2HRT A;  2JOQ A;  2AJ0 A;  1RTH B;  1F60 B;  4K59 A;  4C3L A;  1NK9 A;  2F1F A;  1KQF B;  4LSZ B;  1DQA A;  3PYE A;  4HKQ A;  2H51 B;  4DL2 A;  2E29 A;  1U1K A;  2N7C A;  2XY6 A;  1S99 A;  3MAA A;  2MKS A;  2CQ0 A;  2YWE A;  4FZV A;  2WCX A;  1FJG J;  3M2U A;  1RTI B;  4M5N A;  3OVS A;  3TEH B;  1RA6 A;  1FWK A;  2V50 A;  2HYI B;  4DN9 A;  1T0T V;  4I2P A;  4ECY A;  1B7F A;  1RAI B;  2K7J A;  2KN4 A;  3M8Q B;  2ZHO A;  5IV3 A;  5EWF A;  5U47 A;  2XMA A;  4NXN F;  3FK4 A;  3UD5 A;  2ZVS A;  1YTY A;  2P6T A;  4U67 Q;  1B7Y B;  3UO0 A;  2XCP A;  2YNG B;  2BQ3 A;  1D9A A;  3J81 U;  4KGV B;  4F0K A;  2IC3 B;  5KFC A;  3MTJ A;  5CH7 B;  4I64 A;  4J9V A;  1M0S A;  1HKA A;  3QIP B;  4U9R A;  4WE1 B;  4O0I A;  3IR7 B;  3EE3 A;  3KDN A;  3PJW A;  3CCT A;  1Y0H A;  4NZ6 A;  5D4L A;  5EHH A;  2Z2L A;  3BBF A;  3U1M A;  2QGF B;  1DAX A;  4WII A;  4DV2 F;  3LUY A;  2WHO A;  4KH1 B;  4A4J A;  1N36 J;  4NYP A;  1HBU A;  5E2Q A;  5DDP C;  3F44 A;  1T05 B;  1WJ9 A;  4ED0 A;  1QTM A;  1CLF A;  2C22 A;  3HMJ G;  2FLN A;  4HEA 9;  3OBI A;  2MLX A;  4J5O A;  4LRB A;  1UFW A;  2PDA A;  2QLJ B;  3QWP A;  2XB2 D;  2AT1 B;  1Q16 B;  3UD3 P;  2XLJ A;  2CQH A;  3QGI A;  1JLG B;  3AJD A;  4BWJ A;  2YNH A;  4JV0 A;  3A3N B;  1JLF B;  3MFI A;  3MR5 A;  4ZA1 A;  2C2N A;  4IH6 A;  2HFN A;  3QLH A;  3I4H X;  3EIC A;  1FK9 A;  2KVQ E;  3R2D J;  2AMC B;  2VAS A;  1REV A;  2MTL A;  1DY3 A;  2HNY A;  4B3R F;  4DSI A;  1XMO J;  3TOQ A;  3KHR A;  3WX4 A;  2WB1 D;  4BC9 A;  2CJB A;  1Y00 A;  2MQN A;  3TJ8 A;  3KYL A;  2K7K A;  1QUV A;  1T3N A;  4U8V A;  1TL1 B;  3OW2 R;  1WKK A;  3ISZ A;  2I5J B;  4CLY A;  3RB0 A;  1JWW A;  3THP A;  4OQJ A;  2YNF A;  1CUL B;  1F6T A;  3AJ1 A;  2MGZ A;  3K7R A;  4A8Y A;  2IY5 B;  4ILR A;  4WZQ A;  3K5O A;  2DVI A;  2I1R A;  3DHW C;  1R6V A;  3S1T A;  2W2Q P;  2X1B A;  4FPR A;  1KTV A;  1FXD A;  5J1P A;  2XS2 A;  3I0S B;  2OSQ A;  4ICL B;  4I7F B;  2W8L A;  1JQG A;  1FRX A;  2B4P A;  3QSY B;  1KLM B;  3JSM A;  3WHI A;  3AXK A;  4ECS A;  5A8K A;  2UUC F;  3I96 A;  4G1Q A;  3CCM S;  5F8N A;  3KLF B;  4QR0 A;  2XBP A;  4DPY A;  4Q0B B;  2OPP A;  2EBG A;  1SL1 A;  4LVO P;  3ZTO A;  3TNV A;  2DK2 A;  2W7P A;  2JH3 A;  1BUX A;  1YX2 A;  3ZNU A;  2CQ2 A;  4GVB A;  5THW A;  2R2U A;  4KE5 A;  4DSL A;  2MZR A;  1U2C A;  2BR0 A;  1RCX B;  1RA7 A;  7FDR A;  3MOJ B;  2DNR A;  1MN9 A;  1GXT A;  1PIL A;  4E98 A;  2DIV A;  2E1P A;  3LP0 B;  1FX4 A;  4NA2 A;  4P74 A;  4NLD A;  2DNL A;  4CLL A;  1N5S A;  4J37 A;  3M8Y A;  2HQD A;  2GNK A;  1VBZ A;  3DI6 B;  1T9V A;  1MW7 A;  3R27 A;  1IVZ A;  2BJD A;  3MGJ A;  1S57 A;  3ILI A;  3BDP A;  1S59 A;  5F3Z A;  4ZVP B;  4FYV B;  2V2Z A;  3W2V A;  4ILL A;  2MHE A;  4IG3 B;  4DU7 A;  2QLF B;  3KLI B;  4DR5 J;  2KFN A;  3ISN C;  1SJF A;  4K0K J;  2CPI A;  4PG8 A;  4I2Q A;  1BHN A;  5FLX U;  3GIR A;  4Y2M A;  3UN3 A;  2XWX A;  1F3F A;  4X65 J;  3HD1 A;  3QYY A;  3PR4 A;  5L9X A;  4OX7 A;  3QQC D;  2QL9 B;  1YJT A;  2AEM A;  3HSD A;  3C14 A;  3HHE A;  2VL1 A;  1D9F A;  5MLC V;  3NS5 A;  3TQE A;  4DV5 J;  1YJV A;  4F0H A;  4B9V A;  2GVZ A;  5K9F A;  4NX9 A;  4EBD A;  1JKH A;  1C2P A;  2LDY A;  1RU2 A;  3UD4 P;  1HQU A;  1N5Y B;  2J8A A;  2J76 E;  4K5R A;  2O1P A;  4IQM A;  2F5G A;  4U7U D;  4I0W A;  1TAU A;  2X1G A;  3CJ4 A;  1PYS B;  3GB0 A;  3OTO F;  4L75 A;  1IKV B;  1KTQ A;  1TVR B;  4HTI A;  1I1G A;  4ZPW R;  1RT4 B;  2YBV A;  2CNL B;  2F40 A;  1R8H A;  3LPY A;  2XCA A;  4AL7 A;  4KGK A;  3KHL A;  1JNZ B;  1VK8 A;  1WAC A;  3RAQ A;  4IRK A;  4U8Y A;  2OGU A;  1DFD A;  5HSP A;  5HAT A;  2NXN A;  2P2C B;  2QEX S;  2XEX A;  3MI7 X;  2R8H A;  3A8E A;  3PFE A;  3E2E A;  3I0R B;  4NI2 A;  2RIJ A;  5B09 A;  3BF4 A;  1WF1 A;  4O3R A;  1VBY A;  4B3T J;  1UAW A;  2NLW A;  3T5K A;  5J2N B;  4HH1 A;  4KGM A;  2B4O A;  3G82 A;  5GMK a;  5CYM A;  1Y10 A;  3ILL A;  2ADC A;  5LMN J;  4YN3 B;  4PYD A;  4UZB A;  2XQC A;  4MK9 A;  1V3Z A;  1VC6 A;  3D1H A;  3BSA A;  5E3P A;  5IC6 B;  3R2C J;  2LEC A;  1OY9 A;  3H5S A;  1N36 F;  1UWB A;  3OUY A;  4OHY A;  3QO9 A;  4LR7 A;  1ZYQ A;  1FWP A;  3H25 A;  2FLO A;  2GJI A;  3IAM 9;  2RU3 A;  4F2S A;  3LAL A;  4TLR A;  3OLA A;  2DR6 A;  1WOS A;  7FD1 A;  3FBE A;  4FS2 A;  3DRS A;  3BQ0 A;  3G71 S;  2R8K A;  3QAT A;  1R7I A;  5JVH Q;  3LP2 B;  3GJS B;  5F8J A;  5D3G B;  4DQS A;  3KLH B;  1R43 A;  2HZV A;  4ED5 A;  4GKK J;  3D0G E;  1VQO S;  3KNA A;  1NH7 A;  2E1C A;  3PO4 A;  1LXJ A;  1VI7 A;  3L9Z A;  4NLP A;  1HQE A;  5DG9 A;  4DV4 F;  4K50 A;  1RT1 A;  4HT7 A;  4XIU A;  2XTJ P;  2MZJ A;  2WTF A;  2FPH X;  4LF5 F;  4O23 A;  1L3V A;  2FZK B;  2GGP A;  4UST A;  1JIH A;  2FGC A;  3DU5 A;  1VQ9 S;  2AJ1 A;  2HWI A;  4ZPC A;  2QA4 G;  2KU7 A;  4EUV A;  1NLK L;  2XMK A;  1VQS A;  1QVG R;  4NRU A;  4MFB B;  1JJH A;  4F0M A;  4BCA A;  3TR5 A;  1RCO B;  4Y28 C;  3HVT B;  1SJR A;  2F9D A;  2ALY B;  4TU9 A;  3TAP A;  3KG0 A;  2DHA A;  2GHW A;  2OSR A;  3BKU A;  3UN5 A;  4YQW A;  2MY8 A;  2YNI A;  1VLO A;  2QMU B;  1YJR A;  2DCL A;  4ZCM A;  1LOU A;  4P52 A;  2J0S D;  2FYX A;  1JLA A;  2PA3 A;  3W9H A;  1W25 A;  4IO9 Q;  4U6P A;  1Y3J A;  4OI0 A;  3DDK A;  4G6V B;  1RWN B;  1YJW S;  1I6J A;  2GZO A;  1VK3 A;  1U1P A;  1YHQ S;  1L3T A;  1XR5 A;  2DNY A;  5KFQ A;  1X5T A;  1SJ3 P;  5CYQ B;  3GV8 B;  2VUG A;  4DV7 J;  4I6W A;  5KFS A;  5IT9 Y;  4YHH F;  1IBL J;  3FEX B;  5I3Q A;  5F0U A;  3F0N A;  4UOG A;  1XBW A;  1R89 A;  4H4O B;  2HLT A;  5DG7 A;  1RT7 B;  3MD3 A;  1KQK A;  3BPD A;  4R5P A;  1FA0 A;  1YBA A;  3BO2 A;  1K47 A;  1X4B A;  6FDR A;  1JXE A;  4DR5 F;  4Y2K A;  4DUZ J;  1URN A;  5T14 A;  4F2R A;  3NG8 A;  4ED7 A;  1RP5 A;  4ZPD A;  2ILZ A;  4Q45 A;  1DZ5 A;  5KFA A;  4CH7 A;  1K1Q A;  1WDD A;  5AJ3 J;  2F4V J;  2ATL A;  4A46 A;  3GYX B;  1O8B A;  4LR9 A;  4OI2 A;  4ERD A;  1CS4 B;  3MEE B;  1GT8 A;  4ED4 A;  1UVM A;  3DOL A;  2CZ4 A;  2BJ7 A;  2M70 A;  5CD4 H;  1FDD A;  3QRQ A;  4MYU A;  3O5T B;  1RT6 A;  2GMJ A;  2RS8 A;  3O44 A;  1X8D A;  3AHP A;  2W2M P;  2MQ8 A;  4NCG B;  1NDP A;  4Y3C A;  2UV8 G;  5H9E K;  4M94 A;  4WKY A;  2NXE A;  1FT8 A;  2V4Q A;  1J5E J;  1N8R T;  1VHI A;  2CPJ A;  1UKU A;  4G1P A;  2NPF A;  3I5A A;  4U7U K;  3LP1 A;  4J9U E;  3IS9 B;  4QOT A;  4DG1 A;  3MUM P;  2AZ1 A;  3GP9 A;  1NJI T;  3ETM A;  3PRB A;  1Q5Y A;  1OS5 A;  2DKO B;  3NY0 A;  4OI3 A;  5A8W B;  1VQY A;  4DWI A;  5KFR A;  2KT5 A;  3E8O A;  4QR1 A;  5AE2 A;  1TKX A;  3A1Y G;  4K2X A;  3T19 A;  1U24 A;  2B43 A;  4KTQ A;  1EKS A;  5L8R C;  1DLO B;  1FRM A;  5J1N A;  3ADA C;  3UNY A;  5BJR A;  2QG9 B;  1VQ5 S;  2CIM A;  5KFD A;  1PGZ A;  3OHA A;  4L6V 3;  2D9P A;  4B3T F;  2WAQ D;  1RE1 B;  1S48 A;  2G0I A;  1T02 A;  5HJX A;  1NHU A;  2OAU A;  4CTA A;  4J90 A;  3LO3 A;  3NNH A;  4ER8 A;  3T6J A;  2RB7 A;  4OZ5 A;  2MPU A;  1RZM A;  2R7X A;  3DMJ A;  3H98 A;  3H20 A;  5B0G A;  4X62 J;  2AV5 A;  2N4C A;  3MM9 B;  2PI4 A;  4DPX A;  3V6J A;  3FEY B;  2VFV A;  3PX6 A;  3CJ2 A;  4URG A;  1QD1 A;  2LVW A;  4HHH A;  2DXE A;  2BJ9 A;  2WVD A;  4NLV A;  1RHJ B;  2M8D B;  3MZI A;  2KJW A;  2RKI B;  4CM2 A;  5L1I A;  1CPZ A;  1A0O B;  3MFH A;  2CNN B;  3G4S S;  1RLC L;  1N0V C;  2BOP A;  1FO1 A;  1Q8K A;  2PC6 A;  2E7X A;  5F41 A;  5A0Y A;  1U1O A;  3EZO A;  4GKK F;  1WEX A;  1VRQ C;  2WVF A;  3GJT B;  4PWD A;  1PKU A;  1Y4Z B;  2RHS B;  2OPS A;  2BJ3 A;  4AE5 A;  3TZY A;  3H59 A;  3UDL A;  1U4B A;  4OV6 A;  1U6B A;  4IH5 A;  2VIH A;  1R3N A;  2XI3 A;  3PM9 A;  2MST A;  4EWT A;  2ASJ A;  4PEO A;  3R5G A;  1HW8 A;  1M5V C;  1EQ0 A;  3W64 A;  2M0G B;  4EK2 A;  4ZLN A;  1UWA A;  1T9W A;  2WSE C;  2BE2 B;  2LEP A;  4FXV A;  4WK1 A;  2Z8Q A;  1R0A A;  3BDE A;  4V19 J;  5C25 B;  2FY1 A;  3EZ5 A;  4O44 B;  2K2P A;  5EUH A;  4DSF A;  3NGD A;  1QVF R;  1C1C B;  2GHP A;  3DLG B;  3T9Z A;  4L73 A;  4FDF A;  5KT6 A;  2MJN A;  5I42 A;  2ZBI A;  2DPJ A;  1Q8L A;  1R8C A;  4C6A A;  1QUP A;  2GQC A;  2FD2 A;  1HBM B;  5DJB A;  4P9S A;  1JLE A;  3QJJ A;  2HRU A;  5AT1 B;  4KJI A;  1ZPW X;  1CJT A;  1FKP B;  1ACM B;  2YWF A;  2WBR A;  1RTZ A;  1IQT A;  4M5H A;  3MCO A;  5HLF B;  2DEI A;  1WEL A;  4PUO A;  4FXW A;  1ZTW A;  2J5A A;  3SV3 A;  1IKY B;  3CWJ A;  2A3J A;  3EPI A;  2GMH A;  2MHN A;  1YI2 S;  4K4U A;  1SC6 A;  1XMB A;  5IWA F;  3SCJ E;  2EG1 A;  1UEV A;  2JNJ A;  4KO0 A;  4FNI A;  2ZJR Q;  1ZA2 B;  2GIF A;  3DRP B;  1IQZ A;  5AJ3 F;  2J8S A;  3H4D A;  5IOL A;  5DLG A;  4XK8 C;  4MH8 A;  4J9O A;  2HQI A;  4DUY J;  2BBE A;  1ZAW A;  3B54 A;  5KFF A;  2KKH A;  3I55 S;  4LVN P;  4PWW A;  1H2T Z;  3QSI A;  3EGW B;  2XY5 A;  1M5K C;  2HFV A;  1TV6 B;  2IDE A;  5FDL B;  5C2G A;  1QAI A;  1TQL A;  5F8M A;  2XC9 A;  3G8T A;  2V9K A;  4FBU A;  2DNP A;  4P2S A;  1BQM A;  3FBC A;  2ZHA A;  4YB1 P;  3H5X A;  4ZIV A;  2UUA J;  4ZP8 A;  4C11 A;  3AFG A;  2FGO A;  2XZD B;  4BBY A;  3C6T A;  2EFP A;  4B9S A;  5IM0 A;  5CAB A;  3KK2 B;  1S7I A;  4NCA A;  4CH0 S;  1UCN A;  3D6T B;  2BA9 A;  4TU8 A;  5DDO C;  2WW8 A;  4ECQ A;  3IG1 B;  2CQ3 A;  3V4M A;  4LFC F;  1BLU A;  4F25 A;  1D3W A;  4IFY A;  2Q43 A;  3GTY X;  1XN9 A;  3P3D A;  3RGI A;  3H7H B;  3JTN A;  5D78 A;  1ZBT A;  1E6V B;  3DYA A;  1P6T A;  4YME A;  2NXC A;  4M95 A;  4AXI A;  3HHK A;  2PFF B;  3D6F B;  2VQF J;  1TUV A;  1UFL A;  1KRP A;  4HL9 A;  1S1U A;  2IFX A;  3TYT A;  4ZCK A;  2OJ3 A;  1JLB A;  3Q23 A;  4ZDN A;  4TQR A;  2JEF A;  2ZH4 A;  1RJJ A;  4HI2 A;  4JI6 J;  5IT9 U;  3DOM A;  2FVR A;  3CMQ A;  2HS4 A;  3IGV A;  1WTB A;  1J5O A;  1JLC A;  2B7B B;  3TP2 A;  5J1E A;  1AB8 A;  1I94 F;  4CP5 A;  4X62 F;  3D9B A;  3NLC A;  2AKW B;  4USU A;  3WX8 A;  3OL9 A;  2MQO A;  2MKH A;  1HFE L;  2PGC A;  3BQ1 A;  4QWA A;  1YJ9 S;  4H4M A;  1F5C A;  2WW4 A;  4C98 A;  1HBU B;  4KPC A;  2HHS A;  3TA0 A;  4LR8 A;  5DDQ C;  1D0E A;  2QFJ A;  3ENV A;  2ZH7 A;  3QZ8 A;  5J2Q B;  5EDW A;  1UVK A;  2C2M B;  1YRU A;  1TR0 A;  3PNI A;  4K4X A;  2R7Q A;  3O1L A;  1HPZ B;  2XHW A;  3BZQ A;  5D4O A;  2CA9 A;  2BUN A;  2V94 A;  3O3L A;  3M30 A;  3G8S A;  2ZEJ A;  2IYG A;  4RW7 A;  2Y8W A;  4TXS A;  2OMO A;  4N8O A;  4CLS A;  3V81 B;  3R1H A;  1VQ8 S;  2JEI A;  4JI2 J;  1M1H A;  1VRT A;  3AJ2 A;  4LF9 J;  3OVA A;  2FHM A;  4ZJL A;  3M1V A;  1S1T A;  3DGP B;  1N54 B;  1R8B A;  5HBM A;  3CMA S;  1I3O B;  2HSE B;  2Q6B A;  1PAU B;  1HYS A;  5DDR C;  3GII A;  2FB0 A;  4B17 A;  4NA3 A;  1U2F A;  2BX6 A;  5LM7 E;  4RX6 A;  3EZU A;  3KK3 A;  2DJW A;  1NKB A;  1B99 A;  3HK2 A;  4C97 A;  1H38 A;  3ILO A;  1C4C A;  3D67 A;  2KYX A;  4NLY A;  1PYO B;  2J6U A;  3I87 A;  5CCM A;  3FZB A;  2KDO A;  5A8K B;  1RT2 B;  1ZM9 A;  4FYW B;  3DHX A;  4ES1 A;  4P73 A;  4CLZ A;  1MU2 B;  2VG6 B;  4YDX A;  3ZNJ 1;  2PEB A;  5CD4 A;  4OYI A;  4CH1 A;  1IKX B;  4MAK A;  2HRY A;  1XQI A;  2Z0G A;  4OL8 A;  5ETO A;  4DR3 F;  2CDQ A;  1CJK A;  3MM6 B;  4IFV A;  2QIF A;  2WVC A;  3RAX A;  1GX6 A;  4FYX B;  4PCQ A;  3A8K A;  3NP5 A;  3TZX A;  1TL3 A;  3M8W A;  4LRD A;  4CT8 A;  4CLU A;  1NJX A;  2I0X A;  5D4N A;  4J9L A;  1FNO A;  1MWY A;  3VZH A;  3AAW B;  2F63 A;  2MQP A;  4NWB A;  4KSE B;  1EP4 B;  2B56 A;  4F26 A;  4ATN A;  1XNR J;  2R7S A;  1KVK A;  5J2P B;  5K5M A;  3CNQ P;  1U26 A;  1KVJ A;  4WF9 Q;  1S1X A;  3HJV A;  3TJA A;  1SH0 A;  1FXR A;  4USV A;  3OPK A;  5KG4 A;  1WC0 A;  2H65 B;  2FJE B;  4M8L A;  2Y3Y A;  1VR6 A;  2CQD A;  3MCS A;  1AYE A;  2HMI A;  8AT1 B;  4BWM A;  2B6A A;  3C16 A;  2VU5 A;  2B9Y A;  2DY1 A;  4LBP A;  4PZV A;  1WHX A;  4HHJ A;  3SMZ A;  2F8M A;  4Q5V A;  4HAC B;  2C3P A;  4LSL B;  2GAH C;  1V5I B;  4USK A;  1UA1 A;  3IA0 A;  4CZC A;  3TAM A;  2DR9 A;  1LWF B;  4RNM A;  2I38 A;  3GR0 A;  4WFX A;  2ZBP A;  3OXL A;  3UW1 A;  1RWP B;  1WEZ A;  2UUA F;  5DGB A;  1TU0 B;  1AZS B;  2G0C A;  4EZ9 A;  1X4E A;  1O6X A;  2MKJ A;  3CJ0 A;  2CQB A;  1S6P A;  4X4Q A;  1T3O A;  4J9Q A;  1WUU A;  1XK8 A;  2EFV A;  3KLV A;  5DRK A;  3C2P A;  3IRW P;  2HIQ A;  1RHQ B;  1OY8 A;  2M52 A;  2D9O A;  3TVZ A;  4DFK A;  1WG4 A;  4F4Y A;  1CJV A;  2D7S A;  2OEM A;  4ZPA A;  1MSW D;  3PYF A;  4EGL A;  3MMB A;  1U2R A;  3RBX A;  1TKZ B;  4WZM A;  3TUP A;  2MZS A;  4NA1 A;  2KRB A;  3PW4 A;  1S76 D;  3UI3 A;  2GV1 A;  2VJV A;  4ELV A;  1RWX B;  2QTW A;  1KEK A;  2IIH A;  3N5F A;  3KNG A;  4ENO A;  1GTH A;  4DR4 F;  4ZHR B;  3S7R A;  4RWX A;  4JI6 F;  3IC1 A;  2X3G A;  4WFZ A;  2L08 A;  2V4J A;  5H9E J;  2VBW A;  1FHT A;  2ZUA A;  2XO6 A;  4A8F A;  3FEZ A;  1BXN A;  1RHM B;  3KHH A;  2G1D A;  1QAY A;  3MMA A;  4ELT A;  2JFK A;  1TUW A;  1WI6 A;  2L48 A;  2QE5 A;  4LFB F;  1SKR A;  4FVC A;  1H7W A;  1H73 A;  3TAN A;  3HXM A;  2PEH A;  2ZOG A;  2DNQ A;  1SXL A;  2BE9 B;  2PII A;  5BR8 J;  4FF2 A;  3HUL A;  4IR9 A;  5KFX A;  4DV3 J;  4PR6 A;  4XTT A;  4OZ1 A;  4PRF A;  1WOP A;  2QA4 S;  1FJC A;  4GVL A;  1HBO A;  2X1F A;  2LXU A;  3M6X A;  3GQC A;  1RAE B;  1Q0N A;  1O0P A;  1WTF A;  1VRU A;  5IT4 A;  5F9N A;  1FKO A;  1U47 A;  1SIZ A;  3MM5 A;  4OX8 A;  1IKW A;  1LW2 A;  2GS8 A;  4ANC A;  1PC4 A;  2I8E A;  1WC6 A;  2FJV A;  1VQ7 S;  4L76 A;  4KAI A;  1S1W A;  2W24 A;  1RHK B;  2ZOF A;  3CME S;  3CDB A;  4X64 J;  4JP8 A;  4OI6 A;  4OYZ A;  4ZLJ A;  4DPO A;  4JI5 J;  3Q0A A;  1URR A;  4RW9 B;  3ZFV A;  5KFM A;  3TAR A;  1U1L A;  5K14 A;  2KB2 A;  2DO0 A;  3FBF A;  3AQO A;  1RIS A;  4B3O B;  2V2V A;  2JVR A;  3M9M B;  2W9C A;  1YVF A;  3AY0 A;  3SV4 A;  2CZ9 A;  2ZD1 A;  3Q83 A;  1HI0 P;  1IJF B;  2KM8 C;  3EWG A;  4UOC A;  2ZFH A;  4CO4 A;  1Y5N B;  1FEH A;  4NRT A;  1NSQ A;  4MK8 A;  3KFW X;  2IYI A;  3PO5 A;  3MED A;  3OR2 B;  1UTA A;  1ZM2 A;  1KOH A;  3G8Q A;  4RUA A;  2V8V A;  4WFN Q;  1JJ4 A;  3RR8 A;  4Z2X A;  4LF7 J;  4AT1 B;  2YVS A;  1PBU A;  5DQI A;  4F04 B;  1HWU A;  2ZBQ A;  3CO9 A;  3DXS X;  4YY3 F;  2H4Y B;  3QT8 A;  2F65 A;  5EX0 A;  3Q22 A;  3DLJ A;  4X4S A;  2XHC A;  2D3U A;  2MQQ A;  4WU3 A;  3B4D A;  4KH0 B;  3NBP A;  1HNW F;  1WC4 A;  3VHQ A;  1HMV B;  2VA2 A;  5LOQ A;  5D4P A;  2PSZ A;  3CF5 Q;  3PX4 A;  1HA1 A;  4TYB A;  2N3O A;  2C2Z B;  1IBK F;  4HT5 A;  1QLN A;  1WEY A;  4DSE A;  4J91 A;  2NUU G;  5HJY A;  2HZA A;  2O01 C;  4LQ3 A;  1CJU B;  3TX8 A;  1H7X A;  3H40 A;  1U0H B;  4CT9 A;  5K20 B;  3CIZ A;  4YR3 A;  2XNQ A;  1N32 J;  2HWH A;  3EPG A;  2FJW A;  2F8E X;  2B5J B;  3VV2 B;  1T95 A;  3M2V A;  2CZV C;  4DCO B;  5SUH A;  1DJ0 A;  1RGV A;  1HBN B;  2HFS A;  4DEZ A;  5FII A;  4ED8 A;  5GAE U;  4WFY A;  3ITH B;  4ECW A;  3EUN A;  4B9T A;  4AD6 A;  1NK8 A;  3RB6 A;  4OI1 A;  2KFZ A;  5B0D A;  1H6K X;  3L7U A;  1FKA F;  4DL7 A;  3PYD A;  2AJF E;  2W1B A;  1ROF A;  3CC2 S;  3ILJ A;  2OPQ B;  5DGA A;  1U49 A;  3H2U B;  1KR4 A;  3T5L A;  1DUR A;  4XPE A;  2AF6 A;  1RTJ B;  2G4B A;  2ZZN A;  4PXD A;  1TMJ A;  4KV8 A;  5KFU A;  4QIW D;  2J7W A;  2QLB B;  2OEK A;  4HI1 A;  3LF0 A;  3EX7 B;  2LU2 A;  5ETV A;  4DFP A;  2XSJ B;  3HFK A;  2EK1 A;  4A8O A;  4F67 A;  1OY6 A;  5HMZ A;  3PKM A;  1U45 A;  4O3S A;  4EYI B;  4ZP7 A;  2V34 A;  2CXE A;  1Z4U A;  2CAD A;  4DUT A;  3BM7 A;  4M5J A;  4MYT A;  2EWH A;  1AFI A;  4BLG A;  3SI8 A;  4YP3 A;  1ELO A;  2MZQ A;  1T9Y A;  3QGG A;  4A8W A;  2J6T A;  4Q2M A;  1NUE A;  4ZN3 A;  1DTQ B;  4B9U A;  2MY7 A;  2DEJ A;  4DL3 A;  2V8D A;  4C8N A;  1UMJ A;  2OFH X;  4FS1 A;  3T1H J;  5RUB A;  1LNQ A;  2IMW P;  1A6L A;  3K5M A;  3J81 j;  3CJQ A;  1N6Q B;  3PTW A;  5GAE I;  3AB4 B;  1RWW B;  3JS9 A;  2PA8 D;  3Q89 A;  2DRA A;  4ID5 A;  2B7C B;  5ETT A;  2OTJ S;  3M7V A;  5I3U A;  1Y7P A;  4DV3 F;  3N6N A;  3C6U A;  3VAF A;  1NPR A;  2XM3 A;  4A47 A;  3CDE A;  2H54 B;  1YZ7 A;  2BJ8 A;  4ALZ A;  4QPX A;  3KUH A;  3JTP A;  3C46 A;  1LK5 A;  5GAG U;  1X4C A;  2EG2 A;  5A0Y B;  5KFK A;  2BQR A;  3M8P A;  3MEC B;  2QA1 A;  4NL5 A;  5ETK A;  1OQ6 A;  3PZP A;  3OFG A;  4QCL A;  2RIL A;  1NEE A;  4CYU A;  2FIU A;  3HT0 A;  3FRY A;  1IR2 A;  1GMW A;  2CG8 A;  2XWY A;  2HFZ A;  3W5Z A;  2DYA A;  2KYZ A;  4EBE A;  1QAJ A;  2HQF A;  2JEJ A;  3MMC B;  4CLK A;  4DX5 A;  1G1X A;  1S9E A;  5KG7 A;  1S6U A;  3UVJ A;  3CO0 P;  4W98 A;  3AB2 B;  4NXN J;  3C3L A;  1E6Y B;  3BGR A;  3CJK A;  1YG0 A;  3NGT A;  2DNG A;  4LJM A;  3J80 Y;  1U25 A;  2W8K A;  1WKJ A;  5LL6 d;  3W2W A;  1AUD A;  2GJF A;  4Q43 A;  4OHW A;  4DPT A;  1N5Q A;  1S0V A;  1MRO A;  3Q8Q B;  3J7Z 5;  1YBU A;  2UV8 A;  3L7O A;  3G87 A;  1EKR A;  4LF6 J;  4EI2 A;  2IA6 A;  1T8E A;  4U95 A;  1KON A;  5LMU F;  3HO1 A;  2K1R A;  2ZKT A;  4DV2 J;  2XZW A;  3MD1 A;  4WXO A;  4X4P A;  1JLE B;  3MM7 A;  3LA0 A;  2CWX A;  3CCZ A;  1VQ6 S;  4CWB A;  2DD8 S;  3KHG A;  4MK7 A;  3IGN A;  2HHV A;  3UWT A;  1FDA A;  2OPR B;  5GAG I;  4DQQ A;  3W9I A;  1F5B A;  4KRW A;  4LF7 F;  1ZM3 A;  3MWB A;  4J9P A;  4HYK A;  3D4J A;  2BV3 A;  2H5E A;  1S9G B;  2P8I A;  4ZLL A;  3PIP Q;  5AE3 A;  1LWE B;  2OI2 A;  1Y3K A;  3FSI A;  2GVD A;  4D3G A;  5KFZ A;  5DS7 A;  4RW4 A;  4E2F B;  1OPZ A;  2RDJ A;  4IOB A;  3PCO B;  5HMY A;  5SZT A;  4P10 A;  4I4B A;  1D9D A;  3I4P A;  1NXI A;  2CJY B;  1NU4 A;  5HVG A;  1RWK B;  4UT4 A;  2NZ4 A;  1QTN B;  3PYG A;  3NNA A;  4HDG A;  3BGO P;  3BJY A;  4MKA A;  4ZP9 A;  2HND B;  3W9J A;  1SJ4 P;  4B3R J;  4DLG A;  3LTO A;  4QU6 A;  1TK5 A;  4UY8 5;  5KT4 A;  3HHL A;  4AXJ A;  3DN9 A;  4IQX A;  3DXB A;  3CUN A;  5EWG A;  2W2P P;  4KO0 B;  3W65 A;  1WOO A;  1TL5 A;  1BD6 A;  4NZ7 A;  3CPW R;  1YK9 A;  4HHU A;  2RVJ A;  2HKE A;  2GQ2 A;  2CJK A;  4KKO B;  1N32 F;  4OX9 F;  2C2D A;  1RTH A;  1NDC A;  4OMF G;  1L3U A;  4ID8 A;  2W4P A;  3TWZ A;  1HNV B;  2R2T A;  3RR7 A;  1X5S A;  1DBD A;  1CQM A;  2IRU A;  2LYV A;  3FVY A;  2R7V A;  1S1V A;  2E9Z A;  1VYA A;  3HDS A;  4IDK B;  2UUC J;  1N52 B;  2HNZ B;  3M8Q A;  4ZVQ B;  2E5L J;  2RSQ A;  3OFF A;  3C6T B;  1B4S A;  3DDI A;  2J9D A;  4RNH A;  3L95 X;  4OHZ A;  3P96 A;  4OHX A;  1Q5V A;  4LRE A;  2KXN B;  3K5N A;  2YNG A;  4JI7 F;  2C2R A;  1ZOT A;  5L1K A;  3BN4 A;  2ASL A;  2FUG 9;  4QYZ K;  2IC3 A;  1D09 B;  4ZP6 A;  3MOZ A;  2HHW A;  3M9O B;  3QIP A;  4WE1 A;  3CCR S;  1A7G E;  3IR6 B;  4TN2 A;  2MJU A;  4C8Y A;  2AX0 A;  4M1K A;  3DYA B;  4O3O A;  3IO1 A;  3BO3 A;  1T05 A;  2K06 A;  3B78 A;  3GFY A;  2ZNZ A;  3M32 B;  5GME A;  1AA1 B;  3JB9 k;  3UE2 A;  1VQM S;  1HWL A;  2M3D A;  3DOM B;  4P71 A;  4AQY F;  3ZZT A;  5HRO B;  5HAO A;  4U7C A;  1VBX A;  3Q8S B;  3C66 A;  3GYN A;  2IVF B;  3PHE A;  3M8R A;  3CCL S;  4ED1 A;  1RB0 A;  5KFT A;  4LRC A;  3T1H F;  1JLF A;  2KG1 A;  1MLA A;  4KY3 A;  4OJ1 A;  4LSN B;  5LSL A;  2LXF A;  2CFX A;  3OXG A;  1RXO B;  1YDL A;  3WIU A;  1SCJ B;  1FE0 A;  4PQU B;  2DH7 A;  3NS7 B;  1P9Q C;  2NS1 B;  3D3C J;  3BH6 B;  2DNH A;  1LEO A;  3MPY A;  5L1J A;  3LGM A;  4D3H A;  2JDJ A;  2OH2 A;  1TL1 A;  3Q8U A;  1W2B R;  2V2K A;  2HG4 A;  2I5J A;  3JXO A;  2V2Q A;  4B02 A;  6FD1 A;  2E66 A;  2HVI A;  1NDL A;  1CUL A;  1SBR A;  4R8U A;  3PVX A;  2ERR A;  1I51 B;  2K8G A;  3UDC A;  3T1A A;  3MM8 B;  2BJE A;  4PYA A;  1JX4 A;  3QPI A;  1GMU A;  3O8W A;  4K4Z A;  1X9S A;  3I0S A;  3OV7 A;  3OTC A;  4RW7 B;  2DIT A;  4ICL A;  4I7F A;  4CLW A;  1RQ0 A;  2V4R A;  2ZZM A;  2KFY A;  3G6V A;  5K8O A;  3A8I A;  1GMW D;  1KFS A;  4LBI A;  4UUX A;  2HFO A;  2ACY A;  4WCE Q;  4MIB A;  4JB8 B;  3KLF A;  2RJZ A;  4O4G B;  3M1V B;  3VAH A;  1S1T B;  4RBV A;  2PD1 A;  3MR7 A;  4C8K A;  4Q0B A;  4ECU A;  4HH0 A;  2VIC A;  1VFJ A;  1GQE A;  3GCX P;  5E3A A;  4DR1 J;  3QAE A;  2RF2 B;  2AGP A;  2AYG A;  3VAM A;  2QL5 B;  4CNZ A;  2R42 A;  2D3O R;  2PE8 A;  4NCB A;  1VBK A;  3DRY A;  3HKW A;  4HR2 A;  3LP0 A;  3CCU S;  1XJW B;  1VIX A;  3Q24 A;  3DI6 A;  2ASY A;  1C0T B;  4LF6 F;  2YKA A;  1NK5 A;  3N4W A;  4Y6I A;  1S0O A;  4ZVR B;  3QT5 A;  1JLQ B;  2JRS A;  5CZX A;  4IG3 A;  1UW4 A;  4OZL A;  4KGZ B;  3KLI A;  3K58 A;  4KFB B;  2MQM A;  1NBE B;  1GXL A;  5KG1 A;  2YKN B;  1HNZ J;  4TQS A;  3M6U A;  4KHR A;  4KGX B;  2W25 A;  5ETM A;  1WF0 A;  1SVD A;  5CA5 A;  2MQL A;  4DQI A;  1KQS R;  3LGH A;  2RQM A;  3A8J A;  2OLW A;  1TP7 A;  5HL7 Q;  4IFV B;  2BM1 A;  2C42 A;  2ZC3 A;  2KH9 A;  4Y65 A;  1Q79 A;  3CD7 A;  2RRN A;  2QYC A;  2MLZ A;  3N28 A;  1WHY A;  1RK8 A;  2E1M C;  5A6W A;  2M5Y A;  1YRX A;  2ASD A;  3SDE B;  3NEK A;  3V6D B;  2CQG A;  1Q8B A;  3HCX A;  1M90 T;  4DV4 J;  5E7O B;  2WZ1 A;  5B7W A;  1N5Y A;  3BYP A;  5D0H A;  3D2W A;  4LF5 J;  1S1X B;  2L3M A;  3HHL D;  2UZA A;  3ETO A;  1Q4R A;  3EGN A;  5GMD A;  1SH2 A;  1XER A;  3SEO A;  1REG X;  2DXD A;  1IKV A;  1TVR A;  2FY8 A;  5KFJ A;  4GC6 A;  3PJX A;  4TY8 A;  1PBA A;  3QID A;  1UZH A;  3GV5 B;  4B9M A;  1RT4 A;  5H9F J;  1FRJ A;  5E33 A;  2W9B B;  1VJW A;  3SQG B;  3AA9 A;  5L39 A;  1U1R A;  5KFG A;  2MKK A;  2WON B;  4OYP A;  5HP1 B;  3KJV B;  4QBU A;  1X4D A;  2OD4 A;  3KJF B;  4O3N A;  2HWT A;  3ZZR A;  5KFI A;  2W01 A;  2W9A A;  4P7V A;  3WZ0 A;  1H2U X;  3FDS A;  1C1B B;  2AP6 A;  2R2R A;  3I0R A;  4NLX A;  2E5L F;  1RAF B;  1MML A;  1RWU A;  2VG5 B;  2DTJ A;  1B3T A;  4OZ2 A;  3GIK A;  5J2N A;  1VQK S;  2HBR B;  1D1U A;  1D8Y A;  1U6Z A;  1RT5 B;  2Z4P A;  3KXD A;  5KT2 A;  5F8H A;  2JZ5 A;  1RHU B;  1CJV B;  4I69 A;  1YRT A;  3POT B;  1UL3 A;  5A2Q Y;  4YHH J;  3MPU B;  3C15 B;  3N6L A;  2YX7 A;  2LLZ A;  4DV6 F;  3JSY A;  3KLG B;  4DX7 A;  3BQ2 A;  1HNX J;  2WSC C;  4OYA A;  3H90 A;  2RS2 A;  5BXI A;  2ZKU A;  5HMX A;  2KHD A;  4PG5 A;  4DOZ A;  2GO9 A;  3J7Z T;  4CM0 A;  3TJ9 A;  2ZHB A;  2AWZ A;  3SCK E;  2LDI A;  2B8P A;  2OKQ A;  1UFK A;  3GSD A;  5HQL A;  2Y8Y A;  1WSV A;  1ZM4 A;  3LP2 A;  5D3G A;  4M5M A;  3KLH A;  2A6M A;  4DHV A;  3DLE B;  3NAH A;  2LCW A;  2EKY A;  1SL0 A;  1VDH A;  2VQE F;  1OPI A;  2ZH9 A;  4AYB D;  3BN7 A;  2UP1 A;  5B0A A;  3GSI A;  5C2C A;  3H42 A;  2HS0 A;  4NEZ A;  1NB2 A;  3RRH A;  4MT1 A;  4PXC A;  2U1A A;  3FFI A;  1BC6 A;  2Y0S D;  1ITP A;  3NGK A;  4Z7Y A;  3SFG A;  3TQ1 A;  1QAX A;  2UVR A;  4QWD A;  3B6B A;  4MFB A;  2ADB A;  3UR0 A;  1DRZ A;  3IBC B;  4UY8 T;  1P1T A;  4RUC A;  3ZZY A;  3DRR B;  3HVT A;  1UJ6 A;  1UP1 A;  3HF5 A;  4OZN A;  2IAJ B;  3ZZ0 A;  4I6Y A;  4QIV A;  5CQG A;  1RAG B;  4UUW A;  4AUK A;  2EFG A;  2VA3 A;  1S1W B;  2HQ3 A;  3MAH A;  3CCS S;  3BBC A;  2YKQ A;  3GZ7 A;  4QPT A;  2NSB A;  3Q2S C;  5B0E A;  4CI0 B;  4FXD A;  1KDN A;  3QRR A;  5F0W A;  2CQC A;  3MAQ A;  3OD2 A;  4QIF A;  4M5G A;  4O3Q A;  5A6P A;  3H4B A;  2AD9 A;  4DR1 F;  3V5R A;  3IBF B;  5HVH A;  1WG1 A;  2ZVI A;  5K14 B;  3T1Y F;  4BC7 A;  3HSG A;  1EQM A;  1W26 A;  4PKD B;  3M4X A;  4FKY A;  1IR1 A;  5CYQ A;  2KO1 A;  5CYJ A;  1ZET A;  2ABY A;  3HX9 A;  4DR7 F;  3ZTR A;  4EO8 A;  1NK0 A;  3J81 Y;  1TK0 A;  2ZD1 B;  4H4O A;  1KC8 T;  4J9M A;  2Z2Z A;  1RT7 A;  4XPC A;  3BR9 A;  2ZM6 F;  4B08 A;  1OSC A;  1RWM B;  3QAU A;  3BO4 A;  3HP6 A;  2J9E A;  4LF8 F;  1DAR A;  4EYH B;  2IJR A;  1HNZ F;  2HHT A;  3R8Y A;  4M5D B;  1M1G A;  2F7V A;  3DGV A;  1R0B G;  3MEG B;  3ICL A;  3D6H B;  2QV6 A;  3VGU A;  3AT1 B;  3BPS P;  3HZG A;  2YWG A;  2CJQ A;  3JYT B;  2F9J A;  4R25 A;  2GHV C;  1QE1 B;  1H98 A;  5A8R B;  2YKM B;  4IG0 B;  3G96 A;  1TKD A;  2GAG C;  3NS6 A;  1CS4 A;  3MEE A;  2YTC A;  4ZIW A;  2UUW A;  3EVW A;  2BMB A;  4WP3 A;  4URQ U;  4JV5 J;  2VV5 A;  3QNW B;  3S01 A;  5F8I A;  4KHP J;  3GMG A;  1X0P A;  3VF0 B;  2GX8 A;  3HVA A;  2VFR A;  3NWR A;  1EAY C;  4NCG A;  2BYC A;  4U96 A;  1TL7 B;  2CRL A;  1LWX A;  1UJ5 A;  2PMH A;  3K8W A;  3K57 A;  2C28 A;  2B4U A;  4AND A;  2UXC J;  2FHJ A;  1Q53 A;  3CXC R;  3BBB A;  3RAM A;  2VHG A;  1SUQ B;  2VPW B;  4C8Z A;  2ALZ A;  2MDA A;  1DTT B;  2MKY A;  3LWL A;  1NZ8 A;  3IS9 A;  2C2K B;  2NYI A;  4PQA A;  1NJZ A;  2KXF A;  3BRE A;  5B0B A;  3KKF A;  5A8W A;  4NLS A;  4RW6 B;  1FE4 A;  2JC0 A;  1VQ4 S;  4P75 A;  2QLX A;  2J6S A;  2FLL A;  4A8X A;  4AL6 A;  1IXK A;  2QFI A;  1OWX A;  3MDF A;  3CGI A;  2ZH2 A;  4CLP A;  2ROG A;  4RW8 B;  1PCA A;  1U02 A;  2PMW A;  1DLO A;  1VMB A;  2CVI A;  1NK4 A;  2V8H A;  1C0U B;  5IV4 A;  1SB6 A;  2BEF A;  3D1O A;  3ET6 B;  3H0P A;  3PDN A;  1FVQ A;  2E5I A;  4B3M F;  3ZTS A;  2AGO A;  3ISN D;  5L46 A;  1IWA A;  3OFE A;  2WVE A;  1A9N B;  2LP4 A;  3NGS A;  2NXU A;  3NMR A;  5C42 A;  5A76 A;  3KG4 A;  1QJH A;  3IRX B;  3TZZ A;  3BR8 A;  4RU9 A;  5E0O A;  4F3M A;  1H0H B;  2V5H G;  1JXV A;  1N4L A;  2XLI A;  5CCL A;  3GE9 A;  3AOB A;  4ETX A;  4EBC A;  4JI4 F;  2ILY A;  2KXH A;  1HNX F;  5K8N A;  5LSO A;  4Z37 A;  1X9W A;  5M2U A;  2AU0 A;  3MM9 A;  3SSS A;  4EEY A;  1XMQ J;  1S10 A;  3MPD A;  3P45 B;  5IWA J;  3D7S B;  4JI3 F;  3OTE A;  5HAN A;  1S6Q B;  3AOD A;  1RBL A;  4OLO A;  4OV1 A;  3EXY A;  5KT5 A;  5C24 B;  2XZT B;  3E01 B;  1P8G A;  1G3O A;  5JVG Q;  1Q8I A;  2XS7 A;  2KZZ A;  4DV0 F;  4XDD A;  1HI1 A;  1N0U A;  4JV1 A;  4N56 A;  5DQH A;  4X4U A;  2EC0 A;  3A13 A;  3GIM A;  4C3K A;  3CJ3 A;  2E5G A;  2IPO B;  2R3V A;  3V4I B;  1NK6 A;  1NKC A;  3O6Q A;  2D69 A;  1CVJ A;  3C19 A;  3QFW A;  1K9M T;  1PIE A;  2C1E B;  3I82 A;  3IM8 A;  5EWE A;  4QYZ J;  1HL6 A;  4GC7 A;  1RT3 B;  1VCT A;  3RB3 A;  4WU2 A;  2NRE A;  2AEJ A;  2H3E B;  2AHO B;  1KFD A;  4YDD B;  1YGY A;  2XMM A;  3TA1 A;  2O66 A;  2D1C A;  5J2M B;  4MJK A;  1QSY A;  4NOH A;  3US5 A;  4X66 F;  3NCQ A;  2E5J A;  3P6Y C;  4C0B A;  1UPM B;  2BE2 A;  2L41 A;  3M8Z A;  4C8M A;  4TY9 A;  1FER A;  5LT5 A;  5IZH A;  4LFC J;  1TUG B;  4PAA A;  1B0V A;  3EJM A;  4IOC Q;  2U2F A;  4O44 A;  3L09 A;  3ENQ A;  3BGU A;  3WDO A;  4JI8 F;  2LEB A;  1C1C A;  1F3V A;  3DLG A;  2DNZ A;  3FZ2 A;  1FI4 A;  4ZIT A;  3AQP A;  2Z30 B;  5KFB A;  1VQN S;  1R27 B;  2JC1 A;  2V6A A;  2CQ1 A;  1HBM A;  3CJ8 A;  2ZDO A;  4XO0 A;  3MUV P;  3BB5 A;  4X4V A;  2DGW A;  2HBQ B;  1YWX A;  3ZZU A;  3R7B B;  4A8S A;  1HHT P;  2W4D A;  2HZC A;  1FKP A;  2Q79 A;  2AYM A;  1OJ4 A;  2A6O A;  4ED2 A;  2Y1L B;  1MRO B;  2WOM B;  1TL4 A;  5AXL A;  5HLF A;  3CED A;  1N5T A;  2KVI A;  2OTL S;  1I94 J;  5CZV A;  1NME B;  3QFH A;  1UA0 A;  4OFZ A;  3ONQ A;  1FNX H;  1T7P A;  5ADZ A;  3SSR A;  1IKY A;  2MSS A;  2XGQ A;  4GO5 X;  2DRB A;  1BWV A;  1G6B A;  5JJB A;  3KK1 B;  3K59 A;  3CB4 A;  2IBK A;  5KAK A;  1LXN A;  2WK4 A;  1FDB A;  3QBC A;  2Y1I A;  5E5N A;  1TTH B;  4DJB A;  2Y1R I;  2M88 A;  3DRP A;  3VGT A;  2LQ8 A;  3OL6 A;  2VPZ B;  2NZC A;  3ENW A;  3T3F A;  2J7U A;  5D0R A;  1UEU A;  2ZE2 B;  3Q8P B;  3E3X A;  4LF2 A;  3FCW A;  1S12 A;  1OMS A;  4JV5 F;  2DGV A;  4KB7 A;  2A2C A;  1H74 A;  4KHP F;  2JLF A;  1R8P A;  1BQN B;  2UVU A;  5DZ7 A;  1TV6 A;  4NLW A;  2KHC A;  1KWM A;  5FDL A;  1RBA A;  1WC3 A;  2KG0 A;  2XY7 A;  4NLQ A;  2UUB J;  1CC8 A;  1EET B;  2CYY A;  5GVQ A;  4C7Q A;  2UXC F;  2QN6 B;  3HHL B;  1LWC B;  2RQK A;  4ZPV R;  2JLE A;  2FHJ D;  1SC3 B;  2DT9 A;  1RKI A;  2LMI A;  1SKS A;  4DV1 F;  3KK2 A;  2I2Y A;  2QMX A;  1Q7Y T;  2UVV A;  4EU0 A;  2J0X A;  4ECV A;  2ZC4 A;  4ZJO A;  4G1I A;  4Y34 A;  1PO6 A;  2P9G A;  3IG1 A;  2COL A;  4K4V A;  2FC8 A;  2BAN B;  4HVZ A;  3OLB A;  2XMW A;  3CJT A;  1RTD A;  4NLG A;  3CTR A;  2R8G A;  1S1V B;  2OEL A;  4I1T A;  2V63 A;  2VOP A;  1E6V A;  5B08 A;  3PW5 A;  2VBX A;  2Y1J A;  2CPF A;  4I6A A;  3CVK A;  3J7Y U;  2FZG B;  4RNN A;  5DQG A;  4K4T A;  4JI1 F;  8ATC B;  4X4R A;  2VFS A;  2VF3 A;  2IVY A;  2ZIT A;  3QZ7 A;  3GFH A;  3I9Z A;  1TK8 A;  1TKT B;  2FQQ B;  2HVD A;  5DO2 A;  4ZMM A;  3HM9 A;  2QZ8 A;  2VBZ A;  3OR1 A;  3TUJ C;  5T7L B;  4DR3 J;  4ECT A;  1TAQ A;  1N34 F;  3THT A;  3HT3 A;  5K8M A;  1LFP A;  3KLE B;  3CCE S;  2GFF A;  3AXM A;  1EB0 A;  5ETR A;  5G0R B;  2QX0 A;  4KIA A;  2GIR A;  3KDO A;  3ZXW A;  2P9E A;  1S4E A;  2FJD B;  2BDP A;  4J9R A;  3M2R B;  2PI5 A;  1XMQ F;  1N5V A;  4JBC A;  1HNI B;  1ZH5 A;  3N79 A;  3P5T L;  4RUB A;  2ZJQ Q;  2V68 A;  1NSK L;  3WIV A;  2VKR A;  3LOU A;  1K44 A;  1K1S A;  1T03 B;  2IBO A;  2N82 B;  2V9W A;  1RI7 A;  2HGM A;  3DOK B;  2DNO A;  2DNN A;  4GO7 X;  5J2Q A;  3D0H E;  2HVZ A;  3BEG B;  3CC4 S;  5HO4 A;  4MKY A;  1RAO A;  1HIY A;  3CDU A;  2ZH6 A;  1HPZ A;  2VG7 A;  3VAG A;  4G3I A;  1FTR A;  1LW0 B;  2P9C A;  4QIE A;  2BAB A;  3OHB A;  3DRX A;  3QMQ A;  4F4K A;  4NAS A;  1ZZN A;  2ACM A;  4ZVO B;  4WTY A;  3V81 A;  3X3U A;  4OYW A;  4F4A A;  4WFA Q;  3G2X A;  2NUH A;  3J7Y I;  4M5I A;  3L4B C;  2MKI A;  2C3O A;  4NPO A;  3OQ2 A;  3DGP A;  1KP6 A;  3GU0 A;  5KFY A;  4OZJ A;  3HSZ A;  2RQ4 A;  3PKY A;  3CCQ S;  4F8R A;  2RDD A;  1FRL A;  3DLK B;  3EXC X;  3H2V E;  4R8U B;  4DSK A;  1UW9 A;  2AEF A;  2IRX A;  2H5I B;  2EC2 A;  2HS3 A;  3FQL A;  1GX5 A;  3I31 A;  2CG4 A;  1KN6 A;  2X1A A;  3UDV A;  3N9U C;  1U7L A;  3MAA B;  4PG6 A;  2B9X A;  1TZ0 A;  3M2U B;  5ETS A;  4Q8F A;  3HZE A;  4P2F A;  3SSQ A;  1BE4 A;  4DU8 A;  5D6G A;  4JI0 F;  2C2E A;  2I9S A;  3GJR B;  4NLU A;  4I2P B;  5KFN A;  1HLW A;  1RT2 A;  3FMB A;  1T11 A;  2E9R X;  1S0N A;  4V19 X;  1P1L A;  1MU2 A;  4IUF A;  2VG6 A;  1NK7 A;  3SCL E;  2DGX A;  4DR4 J;  2YPY A;  2CPD A;  4UTG A;  2UXB F;  1IKX A;  4CNY A;  3DM2 A;  2G1H A;  5IC4 B;  2AYE A;  3NNC A;  3U1L A;  1FRH A;  2LQB A;  2LU1 A;  3IMQ J;  4V1A k;  1BQX A;  4KQZ A;  4GKJ F;  3MM6 A;  4DF8 A;  4O4R A;  3BV8 A;  3SYZ A;  1SIW B;  2BJ1 A;  3BKF A;  4K8R A;  5KOX A;  2CNK B;  4LFB J;  2XYH B;  4Q2L A;  3T6B A;  2OHD A;  2HVH A;  2NYH A;  2K3K A;  3NL0 A;  3QT6 A;  1EP4 A;  4NYZ A;  3P8B B;  4M5K A;  1LQ9 A;  3VAL A;  3AH6 A;  4L3K A;  4LF4 F;  3KOA A;  5J2P A;  5ETP A;  4IRC A;  1NPP A;  3R5J B;  1Q1K A;  1EAR A;  3QJP A;  1Y5L B;  1G4C A;  2YKO A;  3IXQ A;  4O0N A;  2X51 A;  1HR0 F;  2HHH F;  4USW A;  4LIW A;  1UPP A;  3BYR A;  5LJ5 Y;  2MZ1 A;  5HN0 A;  4ETZ A;  2YNH B;  3TVY A;  4ZCL A;  4QQB A;  3SQO P;  2IJN A;  4HAC A;  1WC1 A;  4LSL A;  2VPY B;  2KT2 A;  4XDC A;  3QLH B;  1FK9 B;  3K5P A;  1B64 A;  4JYA F;  2Z56 B;  1G2E A;  1REV B;  1LWF A;  3R7S B;  3MR3 A;  2HVE A;  3ZZO A;  2HNY B;  2DGO A;  3W5X A;  4C3M A;  2DR7 A;  2UUB F;  2HHU A;  2R7O A;  5I3P A;  5GAH U;  3WC0 A;  4CO5 A;  5IXU A;  4WYW A;  1AZS A;  1G7C B;  3HHN B;  2YNF B;  4OZ3 A;  3VAK A;  4N5S A;  4TY8 B;  3PY8 A;  2MGZ B;  5KT7 A;  1PC5 A;  2QA2 A;  2WB4 A;  1RAC B;  1FJG F;  1RDR A;  2HQC A;  2BW2 A;  3JSM B;  4DSJ A;  3UCG A;  5DET A;  1TKZ A;  2Q3P A;  2JX2 A;  4OHV A;  2CKW A;  4OJG A;  4ZVG A;  4FF1 A;  4G1Q B;  1BY9 A;  2OPP B;  1S7H A;  3VAI A;  2KT3 A;  1RSC A;  2DRD A;  4GVB B;  2UXD J;  3LW5 C;  4OIX A;  4TNO A;  2OP5 A;  1FWL A;  4QWB A;  1WI8 A;  4ZHR A;  2LFV A;  4YR2 A;  4G65 A;  3DFE A;  3TEG A;  4N8N A;  4DDF A;  4H4K A;  3M9N B;  2Q6C A;  3OFH A;  1RYS A;  1T94 A;  2GC8 A;  1MWZ A;  5IS2 A;  4YY3 J;  5KT3 A;  4ECX A;  1Z2Z A;  1Y11 A;  3W2V B;  5IT0 A;  1HNW J;  2H1Y A;  3H5U A;  4RL1 A;  3FKB A;  2GA7 A;  1FF2 A;  1RBO B;  1SC4 B;  4ECZ A;  1SQF A;  1XR7 A;  1ICE B;  4QWE A;  5GAH I;  2XSF A;  2FJX A;  2ATC B;  4USH A;  3VGS A;  9RUB A;  4I2Q B;  1IBK J;  1XC9 A;  1X4G A;  4CIO A;  2CNO B;  4H4K C;  2D41 A;  4CDI A;  2Z58 B;  4NXM J;  2VFT A;  2FHO B;  1WKL A;  3MXH P;  3EYZ A;  2DPI A;  1U0S A;  3BGL A;  2ZJP Q;  3CCW A;  3C14 B;  4ZJQ A;  5EGY A;  2JJ4 D;  2M7S A;  4A8Q A;  1HWJ A;  2H4W B;  1L3K A;  3M6V A;  3PFO A;  2GVZ B;  3FC9 A;  3AA8 A;  1VGY A;  1JKH B;  1HD1 A;  1YQH A;  1HQU B;  3DU6 A;  1XMO F;  3IN5 A;  1TFW A;  3P5B P;  2W2N P;  2K3I A;  1JJC B;  2EFO A;  5F3T A;  1FX2 A;  3CJS A;  3FFI B;  3OL7 A;  1HAR A;  4RW9 A;  3TZW A;  2DNM A;  4LUB A;  5D77 A;  5B0C A;  2ZH3 A;  4NMX A;  1X5P A;  4B3O A;  4KR0 B;  3M05 A;  4ZLP A;  3VR1 A;  5KG2 A;  4PWU A;  1R31 A;  5EX3 A;  6AT1 B;  1B70 B;  3MPW A;  3JQM A;  2VPX B;  4KPY A;  2G2Y A;  4UZC A;  2V8G A;  3JSB A;  4NZ0 A;  4DL4 A;  1MN7 A;  2IRY A;  3I6P A;  1NJW A;  1BWE A;  2MLY A;  2CUY A;  4WP9 A;  4NI2 B;  1WD6 A;  3W66 A;  3OR2 A;  3TA2 A;  3FQK A;  1JB0 C;  1EX8 A;  2BRK A;  5BYQ A;  1FDN A;  2HAF A;  2W7A A;  3G82 B;  3QRP A;  1NDK A;  2KRR A;  2JEG A;  5CYM B;  3LAN A;  2VOO A;  4WTO B;  4FBT A;  4N7T A;  2B51 A;  2RQC A;  1ULR A;  2HW3 A;  2YPZ A;  1HMV A;  1LKZ A;  2LXI A;  2Q1L A;  2AJQ A;  3DCA A;  3W61 A;  2R2S A;  3JAM Y;  1EZZ B;  1UWB B;  3OUY B;  5HVF A;  3QO9 B;  4I56 A;  1TMM A;  1NZA A;  2H48 B;  5HQ8 A;  4K0K F;  3MUR P;  3KTQ A;  4NYO A;  3GJQ B;  3I5C A;  5DM6 Q;  3FMW A;  1K8A T;  1CJU A;  4X65 F;  1U0H A;  2DGS A;  1KLN A;  3JSR A;  2E1R A;  1Q82 T;  3D66 A;  2MB0 B;  1HI8 A;  3DRS B;  1KD1 T;  4FNH A;  4X4O A;  2GIQ A;  4ZPB A;  1L3S A;  2BKP A;  3CD0 A;  4C0O C;  5KFH A;  2QYG A;  5ITH A;  2B5J A;  3UPF A;  1SI9 A;  4DX8 H;  1FTC A;  4DV5 F;  1YSJ A;  1IR0 A;  3D54 A;  1DQ8 A;  3S8S A;  1F2H A;  5E3Q A;  2XS5 A;  3HFZ B;  1ARO P;  1HQE B;  1RT1 B;  2B3T B;  2HQG A;  1HBN A;  4DR2 J;  3J7A 1;  3ELH A;  3Q2T C;  4P7T A;  4M63 A;  4S0M A;  3ITH A;  2GGP B;  1GFW B;  4WBF A;  4CO2 A;  3W63 A;  2DBB A;  3CW2 C;  3RTV A;  4BHQ A;  5F9L A;  2OPQ A;  3M8S A;  1U09 A;  3MTK A;  3K17 A;  1RTJ A;  3BS9 A;  1MG7 A;  3OSN A;  1KOO A;  1IUJ A;  3KMQ A;  4TKT A;  2GQQ A;  3CJR A;  1XWL A;  4YR0 A;  1M5H A;  4DBQ A;  3PG9 A;  1VQL S;  4K5S A;  2QRR A;  2MZT A;  2XSJ A;  1ZA1 B;  2YNI B;  2E7V A;  2Y9H A;  1JLA B;  1APS A;  5LMU J;  4ECR A;  2G2O A;  3B8H A;  2UXD F;  4W4M A;  1NSA A;  4EMD A;  2E1A A;  2P6S A;  1XEZ A;  2EBE A;  2V0N A;  5HMW A;  1S9F A;  3V6H A;  3TUZ C;  3EVO A;  3NRB A;  1SL2 A;  2N3L A;  5C42 B;  2IM2 A;  2RNE A;  1DTQ A;  5LMN F;  1LFW A;  3JTO A;  2VOD A;  3DDN A;  4KHM A;  3PJ9 A;  3W5Y A;  2W2O P;  2IA0 A;  2JVO A;  1VLY A;  3NCP A;  4F3Q A;  2DNK A;  4R5P B;  1N6Q A;  4FP9 A;  3BGF A;  2V8P A;  3WBZ A;  1F9E B;  4ZKA A;  3G9C A;  1QSS A;  3P4U B;  1I5O B;  3PEH A;  4UQG A;  2C3Y A;  3FGV A;  1TFY A;  1TEL A;  3VTI A;  1LV5 A;  4QU7 A;  1M5S A;  4DQR A;  4NXM F;  1N56 A;  2EK6 A;  2FHK A;  3CD5 A;  3FNN A;  1K73 T;  4C4W A;  1R8A A;  2B9E A;  3DKD A;  1IWG A;  5KOW A;  3CSK A;  4OX9 J;  3DNC A;  2XI2 A;  3R6G B;  2C3M A;  4YUD A;  3UCU P;  3MEC A;  4LQ9 A;  3EDQ B;  4OJH A;  1VC0 A;  1HHS A;  3DOL B;  4LRF A;  4C2M A;  4DL0 C;  4FF4 A;  1P27 B;  1HQ2 A;  2R8J A;  2WVB A;  1RT6 B;  3Q8V A;  4ZCI A;  3KUG A;  3I56 S;  2HGN A;  4J7C A;  2FTR A;  3VCD A;  2ZH1 A;  3EDR B;  3WC2 A;  3FCV A;  2QMW A;  2R7W A;  1CSJ A;  1T9X A;  2C2O B;  3MMC A;  2JHE A;  4BDP A;  4NLR A;  4R0E A;  3HKZ D;  4CO1 A;  2R8I A;  1S72 S;  5DZ6 A;  1R0C B;  3CCV S;  1N48 A;  2CPH A;  2MEW A;  2DH8 A;  5ETN A;  1NKE A;  2YWK A;  2VON A;  1XTZ A;  3LP1 B;  3GIL A;  2Q66 A;  3SXL A;  1W7W A;  4USJ C;  1E6Y A;  3GR1 A;  4DG1 B;  1HWI A;  1M5O C;  4K4Y A;  3GIJ A;  1KHV A;  3F73 A;  3B4M A;  4CCH A;  3SZ2 A;  4JI7 J;  4ITS A;  4W92 B;  2UU9 J;  1GEH A;  5IQ6 A;  1WOR A;  4ZVH A;  5F8L A;  1FVS A;  5LSR A;  1XNQ J;  4RBT A;  2DO4 A;  1TKX B;  2CQ4 A;  2V69 A;  3T41 A;  5KG6 A;  3GG1 A;  3HFV A;  3M6W A;  2PT0 A;  4CQ1 A;  1BGX T;  1RHR B;  4C9D A;  1GXU A;  3W8P A;  2HHQ A;  2OD6 A;  2HLU A;  1IBM J;  2VDI A;  3PW0 A;  2HBY B;  2HIY A;  2Z2M A;  3RBZ A;  1ZAX A;  4BS2 A;  4PAB A;  2OPR A;  4CTA B;  3D3B J;  3I5B A;  4AQY J;  1U8W A;  4DV7 F;  3EVM A;  1S9G A;  1NCL A;  5B0F A;  2YQ1 A;  2GO8 A;  1S4F A;  1IBL F;  4F4W A;  1LWE A;  3DMJ B;  2F4F A;  4OYM A;  4YS2 A;  1WHW A;  2YX4 A;  2KTQ A;  4RBU A;  1VS3 A;  2JWN A;  1H72 C;  2QO3 A;  3TUI C;  1Y9O A;  4QYR A;  1NO8 A;  4DUZ F;  3K89 A;  5KFV A;  3V2U C;  2HND A;  2AX1 A;  3NOG A;  4FKX A;  4CRJ A;  1ZPV A;  2L9N A;  3BSN A;  4DLE A;  1FXL A;  4WFB Q;  2F4V F;  1YJ7 A;  1T9U A;  2RT3 A;  2AYB A;  3HPO A;  1F2G A;  4KKO A;  1UVN A;  3UCZ P;  5MAO A;  2NPI A;  3MR2 A;  1N88 A;  2ZUG A;  4WJB A;  3R1L A;  1WG5 A;  1UET A;  1HNV A;  2NSC A;  3VGV A;  4PWD B;  3DLL Q;  2XYG B;  3CT9 A;  4OLP A;  4UW2 A;  2OPS B;  3LAM A;  3Q8R B;  4DR2 F;  4DX6 A;  2R9L A;  5KFL A;  4Y2C A;  4IDK A;  3OSP A;  3K8V A;  1J5E F;  2I6W A;  2CJ9 A;  1NJY A;  4RZR A;  2HNZ A;  2C3U A;  3CIM A;  3IM9 A;  5CHC B;  4MKV A;  4L3N A;  1SV5 A;  1RAJ A;  4UOF A;  4RLE A;  3OJU A;  2FVP A;  2LKZ A;  1V6H A;  2CAJ A;  4B9L A;  3MCM A;  3NAI A;  1S79 A;  1EIY B;  3CCJ S;  3W60 A;  1R0A B;  2L9W A;  3BSO A;  1IM6 A;  3W62 A;  5M2R A;  4NEY A;  2R7T A;  1T9T A;  1RTD B;  3VAJ A;  4GRS A;  2GJ2 A;  1WDT A;  5GAD U;  5EN1 A;  3KMS A;  2DXF A;  2YWH A;  3ZO7 A;  4YB6 A;  4IR1 A;  2E7W A;  5I4M A;  1KBR A;  2CPX A;  2HHX A;  5I42 B;  5D8H B;  3RBE A;  2LEA A;  1U1M A;  4NE9 C;  1FFS B;  1MMN A;  1O51 A;  2NQP A;  1MMD A;  3GPA A;  4RU2 A;  1IM4 A;  3M32 A;  2AQ4 A;  2XYP B;  3RW6 A;  5KFE A;  4JUZ A;  1EJ7 L;  3R5B A;  3OR1 B;  5HRO A;  1CJT B;  1KS2 A;  2A2D A;  1XIQ A;  3JAM U;  4PUO B;  4ZVS B;  2DIS A;  4LSN A;  1GNK A;  1VIS A;  3H2L A;  1Q86 T;  3KG1 A;  5LXY A;  4PQU A;  2ZH5 A;  1X5O A;  4YB5 A;  3HI9 A;  4DCP B;  4DQP A;  1S77 D;  1Y5I B;  2AGQ A;  2Z57 B;  1FEE A;  4B3S J;  5C5J A;  3CC7 S;  2Y0B B;  1AT1 B;  2IM1 A;  2VG7 B;  3AD7 C;  2OML A;  4LF1 A;  1U8S A;  4IH7 A;  3MM8 A;  1UEK A;  3R9L A;  4FYD A;  2EKN A;  5BYR A;  4ANE A;  4LBH A;  1D8Z A;  1F0X A;  5KG3 A;  5GAD I;  3IFE A;  3CJ5 A;  2QJ3 A;  4F7V A;  1RTI A;  5JXS A;  1VC5 A;  3D1Q A;  1RU1 A;  4O4G A;  3D28 A;  1BQM B;  3IWN C;  2IM0 A;  2VDH A;  4C11 B;  2A10 A;  2J0Q D;  2RF2 A;  4PG7 A;  3LQV A;  4UF4 A;  5IM0 B;  1S5Z A;  4PG4 A;  4X2B A;  1QSL A;  4YEA A;  2WSF C;  3KJQ B;  3MUT P;  2N7Y A;  1OSD A;  2EW9 A;  4E8U A;  5L1L A;  2UU9 F;  4URS A;  3CUL A;  2RDI A;  1DQ9 A;  2X7I A;  3OT9 A;  1X60 A;  4CO0 A;  2QT7 A;  3D6M B;  4IRD A;  3CD6 S;  1GH8 A;  1KSP A;  1XNQ F;  1YIT S;  4IFY B;  1Q7L B;  3UQS A;  2IM3 A;  1C0T A;  4J9N A;  2BAC A;  3HHD A;  2RU9 A;  2ZBC A;  7AT1 B;  1RKJ A;  1NH8 A;  2HAI A;  4DV6 J;  4C48 A;  1JLQ A;  2HUR A;  3FJ2 A;  4C0H A;  1IBM F;  4KFB A;  1IN0 A;  3UN2 A;  4Y00 A;  4OX6 A;  1GK8 A;  4NML A;  5DM7 Q;  2YKN A;  3WQP A;  1RAD B;  3T5J A;  1S1U B;  1L5U A;  4N76 A;  3QJL A;  3PRD A;  2CDR B;  1NHK L;  1JLB B;  2XO7 A;  3NCR A;  3GON A;  2OO4 A;  3DM2 B;  2BOA A;  2MKC A;  5D0E A;  3EMT A;  3JQK A;  4OYX A;  1X4H A;  4FYY B;  4Q7A A;  1PJ5 A;  2DHH A;  5CXT A;  1J5O B;  4KBI A;  1JLC B;  1RAH B;  3OJS A;  1JLG A;  5J1E B;  2XLK A;  4RO0 A;  1WWH A;  2ZOM A;  1M1K T;  2PMZ D;  3BKT A;  3D0I E;  3ZZZ A;  3SDE A;  5KFP A;  4C8O A;  4LMZ A;  3V6D A;  2QSF A;  3MCN A;  3PV8 A;  2VQE J;  2YX1 A;  3MHY A;  4H4M B;  1JK9 B;  4ZVU B;  3FSY A;  4USM A;  2FVC A;  4FN5 A;  5AXN A;  3UNG C;  1FFG B;  4ZN1 A;  1MNE A;  1YKW A;  2ROP A;  3MF5 A;  4ED6 A;  3M30 B;  3O2I A;  4DUY F;  3MR6 A;  2NR0 A;  2W9B A;  3SQG A;  4RNO A;  3EM1 A;  4LFA J;  2WON A;  3OTD A;  3T5H A;  5HP1 A;  3KJV A;  2EXU A;  3N6M A;  2XGP A;  4Q8E A;  2VC1 A;  1S97 A;  2B9W A;  1V5V A;  1YJU A;  1CQN A;  4MIA A;  4A8K A;  3TO8 A;  1W2I A;  1KLM A;  2N4D A;  2XMU A;  3NXZ A;  2D74 B;  3G6E S;  1VRT B;  4KC5 A;  1NB7 A;  3VVT A;  1C1B A;  4DPW A;  2DGT A;  1X0F A;  3ULH A;  4O3P A;  4F4X A;  2APO A;  2VG5 A;  5HBM B;  1NPK A;  5L9N A;  2ZWP A;  4EFA C;  5E3C A;  3W1Y C;  5ETL A;  1NND A;  3L7P A;  1HYS B;  2KL8 A;  3IR5 B;  1N33 J;  4DL6 A;  3V6K A;  3T1Y J;  1ZTT A;  3OTB A;  5E41 A;  1CEZ A;  1B0T A;  1RT5 A;  4RPF A;  3IWX A;  5H1S V;  1V3S A;  4CLT A;  1B0P A;  2H5J B;  3TX0 A;  2DHG A;  3KK3 B;  3HSJ A;  1UVL A;  3W8G A;  4DR7 J;  3K5L A;  1OQ3 A;  4A48 A;  3POT A;  1JJ2 R;  1U1N A;  4HTJ A;  4PXB A;  3C15 A;  3UDE A;  1FFW B;  4FPI A;  4H54 A;  4OZ0 A;  1CC7 A;  2B4V A;  3KLG A;  2E5H A;  4P6Q A;  2ZM6 J;  2FVS A;  2ZDP A;  2G13 A;  4Z7C A;  4DR6 J;  4LF8 J;  1U6F A;  1WNE A;  2VQF F;  1AXQ A;  2BKN A;  3OVB A;  2CPY A;  4GMK A;  4J9S A;  2BW7 A;  2JFD A;  3J7A N;  2MYF A;  3VZI A;  5T41 A;  3MMJ A;  3LPE A;  2EFQ A;  3CE8 A;  4KT0 C;  3PW7 A;  2R4F A;  1CJK B;  5IFM A;  2X3D A;  2OUG A;  3DC2 A;  1F1B B;  2E9T A;  1BMQ B;  5IQQ A;  1WC5 A;  4MKB A;  1TL3 B;  3THV A;  3MPV A;  2YQ0 A;  2DHX A;  2VD3 A;  3DLE A;  2VKZ G;  4F4Z A;  1ZZF A;  4OJ3 A;  3TVK A;  3CDW A;  1SQG A;  5KFO A;  3U1N A;  2VFU A;  4RJV A;  4RR5 A;  2ROE A;  2YH0 A;  4ZVF A;  3UFC X;  3GLJ A;  4QW8 A;  4WIQ A;  4ZVT B;  2HGL A;  4RKU C;  3NGR A;  2VC0 A;  4B3S F;  4DL5 A;  3VQT A;  2POK A;  4Y2A A;  2HMI B;  3CDA A;  1PJ6 A;  1NM2 A;  2AW0 A;  2B6A B;  2XMJ A;  3C16 B;  4FVM A;  3DLB A;  8RUC A;  5HQM A;  1R6Y A;  4TVA B;  1S0M A;  5AXM A;  4ES3 A;  1RWO B;  3DRR A;  5ETQ A;  2CVE A;  2IAJ A;  4CLF A;  2NCK L;  2A18 A;  1YJN S;  3I9V 9;  3RYL A;  3TAM B;  2G2Z A;  1SKU B;  2J9C A;  1NHV A;  4JI2 F;  3BSC A;  2HPU A;  5M2P A;  2BZ2 A;  2BRL A;  3K0J A;  1WSR A;  4LF9 F;  2RML A;  5G4D A;  4I67 A;  1NRK A;  4J9K A;  3HLU A;  5E3R A;  3P49 B;  4WPA A;  3ZTP A;  3F41 A;  1X9M A;  4RNF A;  1JMT A;  4I68 A;  2F8H A;  5L38 A;  3J80 U;  1MWQ A;  1VQP S;  1S6P B;  5JUM A;  4B3M J;  1CBK A;  2R7R A;  2BQU A;  2PFD A;  3ENA A;  4NLT A;  2ZH8 A;  1IJE B;  2E44 A;  2GW8 A;  2IDL A;  4JV2 A;  1RAA B;  2P5V A;  4DMZ A;  2J0W A;  3I32 A;  2IVM A;  3X1L B;  3TAQ A;  1GTE A;  2EFN A;  3MMB B;  1SPB P;  2W4C A;  2JLG A;  2VZ9 A;  1GAO A;  4JI4 J;  3GYG A;  1VHF A;  1X31 C;  2XG8 A;  4WK3 A;  3W3S A;  1FRK A;  5H9F K;  4E0D A;  4ZOS A;  2PO4 A;  2DY9 A;  4M5D A;  2R7U A;  2EI5 A;  4JI3 J;  3MEG A;  4YB7 A;  2W7O A;  4ZS6 A;  3DLH A;  3RUB L;  2M2B A;  4QJV A;  3JYT A;  2B0G A;  2D3O 1;  2V4J B;  5DLF A;  4X4T A;  3G6X A;  1QE1 A;  5A8R A;  2YKM A;  4IG0 A;  4LT6 A;  5CAA A;  2H9Z A;  4DV0 J;  2VJU A;  1QM9 A;  4P72 A;  3MMA B;  2V67 A;  4LRA A;  2CQP A;  2RRB A;  2HFU A;  1KKH A;  1SJ1 A;  2SXL A;  1XNR F;  2WBM A;  3U27 A;  1TL7 A;  2CJA A;  3RW7 A;  2RUS A;  2BKO A;  1S49 A;  2MXY A;  2LQJ A;  1HD0 A;  3GV7 B;  2BE7 D;  3AD8 C;  1SH3 A;  4QIG A;  1SUQ A;  1HBO B;  3LGN A;  3A3O B;  1DTT A;  3SIP B;  1VOM A;  4WXW A;  2RHQ B;  3PRV A;  3HD2 A;  3QGP A;  1VRU B;  2ZNY A;  3RZA A;  1FKO B;  4Y0F A;  3MM5 B;  4X66 J;  4ES2 A;  1IKW B;  1LW2 B;  3R5D A;  4RW6 A;  3HVR A;  2DR8 A;  3FRZ A;  2LA4 A;  4LFA F;  3TI0 A;  3RRK A;  1RUS A;  2YH1 A;  4QWC A;  4ELU A;  2HK3 A;  2LQ9 A;  1FJ7 A;  1YIJ S;  3PX0 A;  2FLP A;  3EGZ A;  4RW8 A;  3IWL A;  3SCI E;  1YBT A;  4XAK A;  3HVW A;  2OEJ A;  4JI8 J;  3IBW A;  2KM8 B;  4L72 B;  1C0U A;  3PIO Q;  3ET6 A;  1HHQ A;  4F02 A;  3LH2 S;  2ZBR A;  5HK4 A;  2DCU B;  4MIW A;  1N33 F;  3LAK A;  3ZZP A;  1C4A A;  1Q81 T;  3RU0 A;  1AW0 A;  1IBC B;  4LIR A;  2DHS A;  2BXJ A;  3W7B A;  3SBM A;  2RE1 A;  2WRM A;  3IRX A;  4OI4 A;  2W9C B;  3ZTQ A;  2YXL A;  5C7P A;  4WP8 A;  3RRG A;  5K8P A;  4DZ6 A;  2G0J A;  5D0G A;  1DHM A;  3UR3 C;  4ILM A;  2AJ2 A;  1HW9 A;  2BVZ A;  2YKP A;  2FVQ A;  4DR6 F;  1FJE B;  3KJN B;  1XR6 A;  4MTP A;  2AJ4 A;  4X84 A;  2CPZ A;  1Z2L A;  1KVI A;  3MED B;  2GML A;  1S6Q A;  1SQE A;  3PW2 A;  2RUG A;  3GCW P;  4DPU A;  5C24 A;  4ZPT R;  3U02 A;  3PHT A;  1QDU B;  3E01 A;  3Q86 A;  2LA6 A;  4HDH A;  3PAC A;  4B9N A;  4TYA A;  1F5A A;  2RH3 A;  2HEK A;  3NMA A;  1KHW A;  3RG6 A;  3BH7 B;  2F3J A;  2JL9 A;  1H3D A;  5KG0 A;  1YLX A;  1PJ7 A;  4OYB A;  1OYE A;  5KG5 A;  3NBP B;  1FRI A;  3V4I A;  2JSX A;  4ZVE A;  2FC9 A;  1M5P C;  2FZC B;  5BR8 F;  2IJF A;  3VWS A;  1AFJ A;  1RT3 A;  2NXJ A;  1FNM A;  5BYS A;  2UVW A;  3VQS A;  5HI7 A;  4YOE A;  2O3D A;  1VIO A;  2AZ3 A;  4N41 A;  1CG2 A;  3QT7 A;  4DS4 A;  1V9O A;  2ZZT A;  5J2M A;  3R97 A;  1OYD A;  4UOH A;  4K4S A;  4DV1 J;  1JXL A;  2DGU A;  3D5M A;  4N77 A;  4IYQ A;  3NGU A;  3M2V B;  4KYZ A;  4WYL A;  1K0T A;  1P9Y A;  3H5Y A;  1X7V A;  1FES A;  2CJX B;  3TRG A;  3KWM A;  3R5A A;  4DN0 A;  2DH9 A;  2IMO A;  4DI6 A;  3MEK A;  3FUY A;  4X64 F;  4FF3 A;  2QLW A;  2VBY A;  1PAE X;  4TLQ A;  4JI5 F;  3R5C A;  2EVZ A;  9ATC B;  4DZD A;  4JI1 J;  4IO1 A;  3GWC A;  3RJM B;  4QW9 A;  2IHR 1;  2Z2Y B;  4UQT A;  4L74 A;  3GFZ A;  2VH7 A;  4USI A;  1KNZ A;  3OL8 A;  3FBB A;  4KV8 B;  2HK2 A;  3QGH A;  3JQJ A;  1UZD A;  1N34 J;  2WOM A;  2BM0 A;  2J9D E;  1H2V Z;  4PPD A;  1LK7 A;  1ZAV A;  2ZWO A;  1QY7 A;  3IP0 A;  4AFF A;  3TW0 A;  4PPZ A;  2O67 A;  4MMO A;  4HLB A;  1RLD A;  3AOA A;  1JNR B;  2YQ3 A;  3A12 A;  4RUH A;  1Z1Z A;  1UVJ A;  4DS5 A;  3C8Y A;  3ZC4 A;  3KK1 A;  3RBD A;  4AL5 A;  1ZS6 A;  2FDN A;  4DFJ A;  4W90 B;  1FD8 A;  3N01 A;  4A8M P;  4F50 A;  4WKR A;  1NSP A;  2RKI A;  4X4N A;  1SKW A;  2M8H A;  2EEY A;  5D15 A;  5FLX Y;  2D3Z A;  1KQG B;  4F36 A;  1NAQ A;  1OIA A;  2ZE2 A;  2FJB B;  2G9O A;  2HHP A;  3QWU A;  4C8L A;  1WHV A;  1U1Q A;  2YWW A;  1Q78 A;  5FJ4 A;  2M4M A;  1BQN A;  2CPE A;  3KUE A;  4ID5 B;  2RD5 C;  5I3U B;  4DF4 A;  1EET A;  3S6E A;  1LWC A;  3C6U B;  4QR2 A;  2J7K A;  3RB4 A;  2LQ5 A;  2DGQ A;  4TU7 A;  2FJA B;  3PXG a;  1PYT A;  1FCA A;  1UJ4 A;  3M8P B;  3A3P B;  5DG8 A;  5F8G A;  5LXR A;  2MMY A;  1OO0 B;  1O5J A;  1YZ6 A;  2GCF A;  2BAN A;  4CYU B;  4ZK7 M;  5C25 A;  4P2M A;  5LJ3 Y;  2HBZ B;  1V3R A;  1RAB B;  4JOU A;  3NWG A;  3OXF A;  2B8Q A;  4DXL A;  2RRA A;  2KI2 A;  2O5D A;  4JI0 J;  3HHL C;  1Q95 G;  3B82 A;  2XMT A;  5JMN A;  3R7N B;  4K2J A;  3FCH A;  1S9E B;  1X4A A;  3UVJ B;  1SV5 B;  1WF2 A;  4K4W A;  4WWS A;  1UVI A;  1J27 A;  1SJQ A;  1TKT A;  2KJV A;  3BGR B;  3CJK B;  2UXB J;  4YFU A;  1FD2 A;  2QSW A;  5A2Q U;  5FD1 A;  3IAS 9;  4EO6 A;  4DFM A;  3W2W B;  4EZ6 A;  3L3C A;  5T7L A;  2DR5 A;  4R0J A;  3LWM A;  3KLE A;  3R3T A;  4GKJ J;  1GMV A;  3N0V A;  1U48 A;  4K7Q A;  5G0R A;  3G6Y A;  2OIH A;  3NKY A;  1HWK A;  3H8Y A;  2AIR B;  2XUL A;  2EPI A;  1SC1 B;  3M2R A;  3AD9 C;  4Q44 A; 
#chains in the Genus database with same CATH homology
 1VYA A;  3B6B A;  1JXV A;  5IOL A;  1S5Z A;  1ZS6 A;  1NPK A;  4F4A A;  3G2X A;  3Q86 A;  3ZTP A;  3BBF A;  4C6A A;  1S57 A;  1PKU A;  1F6T A;  5CAA A;  4FKX A;  1S59 A;  1NSP A;  4W98 A;  1NDP A;  3B54 A;  3DKD A;  4DI6 A;  1PAE X;  2HVE A;  3JS9 A;  1HHQ A;  3NGT A;  3Q89 A;  2B8Q A;  3FC9 A;  3BH7 B;  2VU5 A;  1B4S A;  3MPD A;  3VGU A;  2B8P A;  3DDI A;  2DXF A;  3ENA A;  4UOG A;  3Q8Y A;  4F36 A;  3BBC A;  3Q83 A;  1WKJ A;  1NLK L;  1NDK A;  4ENO A;  1KDN A;  3Q8V A;  1BHN A;  2CWK A;  3ELH A;  3NGR A;  2HUR A;  3VGV A;  1NSQ A;  3EJM A;  3EVO A;  2AZ1 A;  3BH6 B;  3GPA A;  3GP9 A;  3R9L A;  4ANC A;  1F3F A;  3ETM A;  1NSK L;  3FBC A;  1XQI A;  4S0M A;  1LEO A;  4HR2 A;  1K44 A;  4ANE A;  3VGT A;  3FCV A;  3EVW A;  2BEF A;  3ZTQ A;  1U8W A;  4WBF A;  4EK2 A;  3FBB A;  3PJ9 A;  3Q8U A;  4CP5 A;  5C7P A;  3FKB A;  3ZTO A;  3EVM A;  1EHW A;  3EM1 A;  2AZ3 A;  4DZ6 A;  1NCL A;  1BUX A;  1NHK L;  5CAB A;  4DUT A;  2ZUA A;  4FKY A;  3PRV A;  2DXE A;  3FBE A;  1NDL A;  1UCN A;  3ZTS A;  3WX8 A;  1NDC A;  1BE4 A;  3EIC A;  4O0N A;  1HIY A;  1NB2 A;  3EMT A;  3VGS A;  3FCW A;  3VVU A;  1XIQ A;  2DY9 A;  1W7W A;  1LWX A;  2DXD A;  2BX6 A;  4UOH A;  3ZTR A;  1MN9 A;  3NGS A;  4KPC A;  4AND A;  2NCK L;  1HLW A;  4UOF A;  3VVT A;  1NUE A;  1WKL A;  2DYA A;  3NGU A;  3BBB A;  1B99 A;  1MN7 A;  2HVD A;  3EE3 A;  5BXI A;  1WKK A;  3FBF A;  3L7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...