3FC9A

Crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fc9A00
1LWXA 3L7UA 1K44A 3FC9A 3VGTA 4UOGA 1NB2A 3EM1A 1BE4A 3VGUA 2HVEA 3MPDA 1NSPA 3BBFA 4DZ6A 3Q8UA 2HURA 3NGTA 3BH6B 2BX6A 3JS9A 1B4SA 1PKUA 1XQIA 4ANEA 1NUEA 3ZTPA 4UOHA 3VGSA 5C7PA 2ZUAA 3NGUA 1F3FA 1B99A 4EK2A 3B54A 2DY9A 1XIQA 2DXEA 3EVMA 3Q8VA 3FCVA 1MN7A 1HIYA 3Q83A 1MN9A 1NHKL 5BXIA 3VGVA 4ENOA 2B8QA 1S5ZA 3VVTA 3FBCA 3NGSA 4CP5A 3BBBA 2HVDA 1LEOA 1NPKA 2DXDA 1JXVA 3FCWA 1BHNA 1F6TA 1UCNA 3VVUA 3PJ9A 3FBEA 1WKKA 3PRVA 3Q8YA 2AZ3A 3ZTQA 3GPAA 1NDLA 1W7WA 1PAEX 3EVOA 3EE3A 3EJMA 1BUXA 4FKXA 1NDPA 2B8PA 3ENAA 3NGRA 4WBFA 4HR2A 1NDCA 3R9LA 4F4AA 1WKLA 3DKDA 3FKBA 3ETMA 3BH7B 2DYAA 4F36A 4S0MA 4UOFA 2DXFA 2AZ1A 1ZS6A 3Q89A 4KPCA 3FBFA 3ZTRA 4ANDA 1KDNA 5CAAA 1VYAA 3GP9A 5CABA 1NSKL 1NCLA 3ELHA 3WX8A 1S59A 1NSQA 4FKYA 1HHQA 3ZTSA 1WKJA 3Q86A 4ANCA 1NDKA 2CWKA 2BEFA 5IOLA 3EICA 3EMTA 2VU5A 4C6AA 4O0NA 3BBCA 3EVWA 3FBBA 4DUTA 1NLKL 1U8WA 1HLWA 2NCKL 3B6BA 1S57A 1EHWA 3ZTOA 4W98A 3DDIA 4DI6A 3G2XA
chains in the Genus database with same CATH superfamily
4PXDA 3VGTA 3AAWB 1IBKF 1WF2A 1HWUA 1EETA 2DHAA 1WDDA 2N3OA 1SKUB 3I4HX 2MB0B 1PBAA 4M5IA 4C3LA 1VLOA 2EEYA 4NI2A 2KZMA 3Q2SC 1S1UB 4NLVA 4ED4A 3SSSA 1N33F 2IAJB 1K8AT 1ZTWA 2JLGA 4OHXA 1SL1A 4TNOA 3GYNA 1G4CA 2V2KA 4OLPA 4DL7A 4F26A 3OVBA 3AODA 2DNLA 3AJ1A 3M8QA 4D3GA 4CQ1A 1SUQB 1YX2A 1Q5YA 3CO0P 2NPIA 4K5RA 1GMWA 2OTLS 2V2QA 2G2YA 4NA1A 2ZD1B 3GYXB 1WC3A 1JJHA 1NJIT 3BSNA 4ED2A 1BQNA 4ECRA 1VQMS 2R4FA 1ZM2A 4LF1A 4A47A 5E3QA 2HFSA 4B9VA 5CYMA 3RR7A 1TL5A 1QM9A 2EW9A 4WP8A 3LAMA 3HFZB 5KG6A 4ZVOB 2BKOA 4ZLPA 2ZH3A 3CVKA 3A8KA 2RMLA 5DRKA 3ET6A 4NXNJ 4IG0A 1R0CB 3MMAA 2VV5A 4B08A 2HNZB 3FBCA 3BPSP 1U24A 2I5JB 2E1PA 4B9MA 2AJ4A 3UD5A 1SQFA 5EX0A 2UUBF 2OO4A 4NCBA 1FJGF 1VI7A 3M8PB 1GXTA 2BANB 2ADCA 1AFIA 2GGPB 4A48A 1RBLA 5KFNA 4QBUA 5HL7Q 1KKHA 2ZFHA 4DR2J 4JI4F 1SIWB 2F1FA 3LP1A 2B3TB 1RXOB 2RU9A 1RTHA 2HURA 1WG5A 3I82A 1MROB 2HHHF 3OFGA 5CHCB 2RDJA 4QWEA 4L3KA 1Q7YT 2AJ0A 1C0TB 5J2QA 1L5UA 3M8YA 5BXIA 1R6YA 2M0GB 2RQCA 4AFFA 1XMQJ 2PEHA 5KG5A 2PSZA 2FTRA 4FXDA 1NZ8A 3I55S 5ITHA 4K50A 4P2SA 3UFCX 4LFAJ 5ETQA 1HBNB 1Z4UA 2E66A 3KLGA 3FSYA 4RNMA 2YKPA 1H7XA 3QRQA 1RABB 2BJ8A 5D4NA 4K5SA 1JWWA 4DPWA 4ZHRB 2VDIA 4DBQA 4KH1B 2Y9HA 3QT6A 2MSSA 5DDQC 3R3TA 4L73A 3OHBA 4TY8B 1OPZA 4LFCF 3EMTA 4FBTA 2W9BB 2RQ4A 1KVJA 1J5EJ 3QJLA 3ETOA 4DV7F 2GC8A 2U1AA 2APOA 1C0UB 3R1HA 1GH8A 3MM5A 1SH2A 4PG8A 4OX7A 1WEZA 4NCGA 4X4OA 5HVHA 5BR8J 3H5XA 4KR0B 4DCJB 3PXGa 3S7RA 4BCAA 1S6PB 2D74B 2P6TA 3UW1A 3H5SA 3R5JB 3GFHA 1R31A 4CO0A 2V6AA 1JMTA 4RUBA 2JWNA 2OEMA 2CPEA 1WC0A 3KJVB 1KTQA 3AB2B 1OY8A 1RT7A 3NL0A 3UN5A 3N79A 3OR2B 2A0FB 1MU2A 3CD7A 1U2FA 3K5LA 3M32A 3KK3A 3TAMA 3GP9A 4CNZA 1DTQB 3OUYB 2R9LA 2DRAA 2ZDPA 3NNHA 4OI6A 2ZZNA 4X64F 1P1LA 4U96A 4CZCA 4M5NA 3CJ5A 1LQ9A 2NUUG 4E8UA 2V67A 1LWEB 2KHDA 2W4CA 4X65J 1FD2A 1BE4A 2A10A 3E2EA 2FHMA 2ATCB 4OJHA 2J8AA 1S49A 2DGXA 5KFXA 3HVRA 1HQEB 4A46A 1PBUA 2MKIA 1F9FA 1WC5A 4KKOB 2I8EA 2BJ1A 4YS2A 1NXIA 5CA5A 3KWMA 1BHNA 4LRDA 2VJVA 2MZRA 4ZCMA 5LXYA 2NXJA 3BO2A 3BDEA 5HP1A 4WKRA 1H7WA 2MXYA 3PVXA 2IA6A 1F5AA 2ACYA 4CM2A 2V50A 3W9IA 2KJVA 2DR5A 5C5JA 4LF5F 4P72A 4X84A 1RWOB 2JEGA 2YVSA 4WTYA 2QV6A 2G4BA 1DZ5A 4OZ1A 4RU2A 4PQAA 1AUSL 1VS3A 3OLAA 1I51B 3CJQA 3H20A 3W5ZA 3CDUA 1EJ7L 3P5TL 5K14B 1S1VA 2RUGA 5B0AA 1REGX 2AU0A 1SH3A 2W2OP 5A8KA 2BM0A 1GNKA 5HBMA 4YR3A 1XIQA 1RISA 1W26A 1WI8A 3MZIA 3P49B 5JXSA 1EKSA 3T6JA 2H3EB 4H4KA 1TKXB 1S0NA 2HVHA 2HQ3A 4L72B 4JI1F 2HHWA 2FGOA 4M63A 3QFHA 3W1YC 4OX9F 1F6TA 4KHRA 1LV5A 1FESA 4JI3J 4QR1A 4NLTA 1WC1A 2DO4A 1YRTA 3ZFVA 2BKNA 3ZNUA 1NK5A 2EPIA 1VC6A 4OYZA 3OFFA 4DN0A 3K58A 1EARA 3IM9A 4L3NA 2MKHA 1VYAA 2CPIA 2HWTA 4U6PA 3DC2A 4WP9A 5DQIA 2V4QA 1TL7A 1ZH5A 4MKAA 3KYLA 5J2MA 1T0TV 5HVFA 4B9SA 3MEGB 2PFFB 2QLXA 4P9SA 3IC1A 1TFWA 1FWPA 5H9EK 1KQSR 4PRFA 1NU4A 4DR4J 4O3OA 1YDLA 1DY3A 3FGVA 2M9KA 1HYSA 1NHVA 5IV3A 2CADA 5ETMA 1TV6A 4ZJOA 4C98A 5D3GB 2FY8A 4FF3A 1L3SA 3L9ZA 4USTA 3O3LA 1HI0P 6AT1B 4NLUA 5M2UA 4K4WA 4MKVA 2VQFJ 2A6MA 3I5AA 3J7Z5 2HGLA 4IOAQ 1SPBP 3G82B 3D54A 1TL1B 3R7SB 3QO9A 4DF4A 1UETA 3QPIA 2VG5B 4LT6A 3BQ2A 2HQCA 2CPYA 1RTDB 1S9EA 2E7VA 1XC9A 2I38A 4G1QB 5DG8A 4UUXA 4YN3B 3BJYA 4DWIA 3H90A 4IG3A 3V5RA 1SC6A 1WKJA 4NLRA 2BOPA 5B0EA 2QA4G 4UY8T 2ZEJA 5EWEA 4NLOA 3SYZA 3TA0A 3CJTA 2LMIA 3G86A 4YFUA 3HK2A 3BBCA 2N4CA 1R3NA 1ZPVA 3W64A 2MKSA 3G4SS 3BN7A 2B6AB 4O4GA 4CO1A 2YWEA 2QC3A 2XLJA 4HDHA 4ECXA 3C14A 2FLNA 5LSRA 5AXLA 3DRPA 5A8RA 3BV8A 1IJEB 4OLOA 3EX7B 4P7VA 1QE1A 1VC5A 4PPZA 1B3TA 5GMKa 4BHQA 3GJTB 2O67A 1NB7A 2MZ1A 3KLVA 1T05B 1WDTA 4O44B 1O6XA 1FFWB 3H2VE 1UWBB 4MJKA 2MGZA 2XGPA 3EPIA 1FJ7A 2B8PA 2VUGA 4DU8A 2VF3A 4K0KF 3FKBA 3Q89A 1FT8A 1LWCB 2AJFE 2W25A 1RP5A 4ZVQB 3JXOA 4DU7A 1JLEA 3A3NB 4WK1A 1RWNB 4PWDB 3MR6A 4LFBJ 2Y3YA 3ZZYA 3NP5A 2OPSB 2WONA 2ADBA 2EFGA 2G0JA 1PAUB 4JI8F 5K20B 1T03B 2NYHA 2AQ4A 3FDSA 3VTIA 2ZH5A 2WBRA 1BMQB 2YNGB 1XBWA 3U02A 4Y28C 5FJ4A 3PV8A 2E5IA 4PCQA 4Y65A 1SB6A 2KFZA 1TAQA 4LQ3A 1S12A 5E0OA 1U48A 3CF5Q 4DSIA 1JNRB 2YTCA 1S72S 2DISA 2HLTA 4RW4B 4ID5B 5B09A 3V81B 4OYPA 3HJFA 1TKZA 4ZIWA 3W3SA 1RTJA 2XSJA 4NASA 3G96A 4P2XA 7AT1B 1SV5A 3DI6B 5IWAJ 1U6ZA 5HI7A 3CCVS 3Q23A 3J80U 2WTFA 1ZA2B 3E01B 2Y1LB 4IO1A 4ETZA 1T9TA 3DLKA 4LRCA 3ILLA 2ZUGA 4HKQA 5EX3A 5SZTA 1M5OC 4OYAA 2EXUA 3R2DJ 1RHKB 2HS3A 3JTNA 3Q8UA 4OYBA 2HHSA 3J7AN 4ED1A 1U0SA 1N0VC 2XS7A 1D3WA 2OIHA 1WSRA 2XB2D 3C6UA 4RNOA 4HLBA 4LF9J 3W60A 1T9UA 3BDPA 1CQMA 1SJQA 1VBXA 5F0WA 4WFAQ 3M9OB 1K1SA 2V8DA 4W90B 2DNOA 4CP5A 1WELA 4I67A 2YKMA 3BSOA 4F02A 1PILA 5A8WB 3PNIA 3AA9A 1Q5VA 1HR0J 5KFCA 1VRUB 2HAIA 1BUXA 4UZCA 1X4BA 1RBOB 3L7PA 2ROGA 2HWHA 2PI5A 1VMBA 3MAHA 2Z8QA 4DL0C 2O1PA 2Z58B 1SI9A 2NYIA 2ALYB 1OIAA 3SFGA 4BC9A 1HBUA 1XR6A 2XY5A 1DLOB 2LQ5A 1OJ4A 2K1RB 2RDDA 1VC0A 3DHXA 3LQVA 3CDAA 2EFQA 1FKOA 1ZZFA 2GAGC 4JP8A 1QUVA 2RUSA 4WTOB 2AX0A 2CQIA 1UVJA 1FO1A 3HHNB 1X8DA 4DR6F 2POKA 1B4SA 2QE5A 4G65A 3RGIA 5IQQA 4LF6J 2MKJA 1N5TA 2CXEA 2LU2A 4TU7A 1R8PA 2VHGA 3QLHA 4QWAA 1RAEB 4J90A 2UVRA 1PJ5A 2PA8D 2ZBRA 5HMZA 3DOLA 2HS4A 3B4MA 5KFHA 4DR3F 4B3OB 3QIPB 2UXBF 3KJFB 2CVEA 3TEGA 3K8WA 4NWBA 4K4TA 2YWKA 2ZOGA 3SCJE 5LMUJ 1O51A 2BACA 4NRUA 1BQXA 1MMLA 4S0MA 4QOTA 5CYJA 1FJCA 4JI2J 4UQGA 1YGYA 1HWKA 1RU2A 5HO4A 2XHWA 3FRYA 3PW2A 5GAEI 2ASDA 5E3RA 4OV6A 4QZVB 3CC4S 3R1LA 5K8PA 3CE8A 2UVWA 4DJBA 2ASYA 3DOMB 3QT5A 2NQPA 5B08A 1EP4A 1EX8A 4U7UD 1R0BG 3RB0A 2Y8WA 4CLTA 1XQIA 2P9CA 3C2PA 2ZC3A 3RTVA 2LA4A 4K7QA 2ZBQA 4J37A 1MSWD 4J9KA 4OZJA 2FHKA 3MOJB 3TX0A 3PFOA 5LJ5Y 3P4UB 3JSMA 5GADU 5D78A 2MPUA 2MQ8A 4DX5A 2E9RX 2QL9B 2FLLA 4NLDA 2QSWA 5H9FJ 3SCIE 4PXCA 3G87A 1FXLA 4B3RF 3EGNA 1YKWA 2IM0A 3MM6B 3J7ZT 1HQ2A 3CJ2A 3ENAA 2V68A 4HR2A 5E33A 4M5HA 1NDCA 4FP9A 5CZXA 1U45A 2JDJA 4RKUC 1GXLA 2YH1A 1U2CA 2YQ1A 4FVCA 4OV1A 5AXMA 2V8PA 4D3HA 2K2PA 2NREA 4JYAJ 2YKNB 2DNRA 4RO0A 1DBDA 1HLWA 3HJVA 1AZSB 4YOEA 4B9TA 3C6TA 3THTA 4G3IA 2BJ7A 3S01A 2YNFB 3QRRA 2OPQA 2LKZA 1CULA 2E44A 2VPXB 3H98A 2HFNA 3A12A 4Z37A 5IXUA 2LXFA 4EK2A 4Y2CA 2Q3PA 4GKKF 3CMQA 4DQRA 4CWBA 5ETRA 1N6QA 3PYGA 1KEKA 4ZOSA 2AGQA 3RR8A 3R5DA 3FMBA 1IKYA 2F9DA 3DLBA 2YNHB 3N01A 3DGPB 1HNIB 4CLUA 4K59A 2B43A 6FD1A 3D68A 4DV0F 5JMNA 1X4HA 2RJZA 3HVTA 4PG5A 1JLQB 4F8RA 3H40A 2UUBJ 4NZ7A 3LP2B 2GMHA 4YDXA 5DG9A 2UZAA 4Z7CA 1G3OA 1LK5A 1N5YA 1FJGJ 2DPIA 2J9DA 4K4XA 1MWQA 4I7FA 4TQRA 3K2YA 3AB4B 1RAHB 3MEDA 3ZZPA 2H1YA 3BM7A 3NRBA 5HAOA 3RB4A 2Z2ZA 4M5DB 3RB3A 2R7RA 2C3MA 1ZOTA 4URGA 4EYHB 3W2WB 2C28A 4C4WA 2Z2YB 2OSRA 4JI4J 4H4OA 1RWKB 4ZN3A 3ITHA 1P8GA 2OPPA 2KT3A 3VAHA 1SH0A 4ZVFA 2HHHJ 3CD6S 3LO3A 4O3RA 4RLEA 1Y00A 1TVRA 4ENOA 4HH1A 4W4MA 3PKMA 4V19X 2AP6A 2QSFA 2ZBPA 3AH6A 8ATCB 3PZPA 3CCLS 1LWFA 2DT9A 4TVAB 4ELTA 4CNYA 4OZ3A 5LJ3Y 3IRXA 2XMTA 2KDOA 3B78A 2GQ2A 2ZWOA 1FEHA 1VQ8S 4CH7A 1K1QA 5CABA 2UV8G 1HHQA 2FC9A 4ECUA 2AX1A 4USWA 2CNOB 4QW9A 2DK2A 3RYLA 3VAMA 5LSOA 1WORA 2VZ9A 2YKQA 5T7LB 2J5AA 5IT9U 4U67Q 4R0EA 3DHWC 4A8MP 5HANA 2GJFA 1TUVA 4Q43A 3JQKA 4RPFA 1R8BA 3EPGA 2IAJA 3VGSA 5F8MA 1VQLS 2LDYA 1YJWS 4DF8A 3PDNA 3KKFA 2G13A 3TX8A 3OFEA 1FXDA 1KOOA 1RT2B 4KHPF 1HA1A 2WVFA 4IFYB 3FBEA 1SUQA 3SIPB 1GFWB 2J6TA 5D4PA 1VR6A 2NXNA 2CVIA 4F4AA 1URNA 3TA2A 3M9MB 2ZD1A 1UEUA 2WK4A 3R6LB 3JSBA 1IQTA 1R89A 1VRQC 5AE1A 1VQNS 1SBRA 1CLFA 1U1LA 1E6YB 2DR8A 4KHMA 4K4UA 3J80Y 3PX6A 1WHVA 2DH8A 3PHEA 4CYUB 2QFJA 5LL6d 4X64J 3GLJA 3V4IA 1KRPA 3TO8A 1Z2LA 2NS1B 4HVZA 4JI6F 1F60B 4CLZA 1PC4A 1WOPA 4YHHF 1WNEA 2WSEC 1P1TA 4ECTA 4WE1A 2V8VA 4GKJF 1RSCA 2I5JA 4XPEA 2COLA 2ZM6J 3WDOA 2K3IA 3NNAA 1ZM9A 4YY3J 3UN2A 2HYIB 4GMKA 4PUOB 3Q8YA 3M8PA 1CPZA 2BANA 2HEKA 1SJ4P 1KN6A 1PO6A 3QNWB 4H54A 2DGWA 1MWZA 1TMJA 4RW7B 3TYTA 3LWMA 4FN5A 4ED5A 4HHJA 3TVKA 4Q0BB 4QIFA 2PN6A 2ZH2A 4C11B 1GXUA 3EZ5A 1J5OB 2C3UA 2EFNA 3DOKB 1UEVA 4LF5J 4TLQA 1NH8A 4X2BA 4I6YA 1MROA 2BE2B 4BLGA 5ETPA 2GHWA 3KOAA 2Q1LA 1D1UA 1UFKA 3O8WA 1TL3A 1YZ7A 3CMAS 2QMXA 1C0TA 3HMJG 1AW0A 2RF2B 3THVA 2AJQA 4HL9A 1REVA 1X5OA 2UU9F 2MEWA 2V2VA 2HQDA 1FKAF 2PMZD 1UFWA 2HVIA 1HWJA 2WZ1A 3QT7A 4ZPVR 1HBNA 4MT1A 1VQKS 3KK2B 2MQQA 1X4EA 1RYSA 3F44A 4JI1J 1KTVA 2X3GA 2W24A 1M1GA 3D1OA 1Y5LB 2FGCA 5KFBA 4ZHRA 1D0EA 3SDEA 3C66A 4JV5F 4QU6A 3R6GB 4TY8A 1M1KT 2AZ1A 2XO6A 2K7JA 3FFIB 4CH1A 3BN4A 1Y5IB 4Y2IA 2W9BA 2D41A 1H72C 4CI0B 2WVDA 3Q8RB 3VWSA 4CO4A 5AJ3J 1VHFA 1U6BA 4MYTA 1W2BR 2FVQA 1C0UA 1JLFB 3PEJA 3ENVA 3VF0B 2HQIA 2CKWA 3IWXA 2XYPB 3MECB 5F8NA 2CQDA 3G6VA 1RACB 2AEMA 2E5LJ 1XNRF 3D6TB 1S6PA 3NLCA 4DX7A 1XMBA 4O0IA 4IRDA 2JEJA 1PSDA 5DDRC 1SJFA 3H7HB 4LF8F 3J7YU 4I64A 3KHLA 3IR6B 4AL7A 1GK8A 3HHLD 1VDHA 4E2FB 2D3UA 2QL5B 3OR2A 1U26A 1V3ZA 3H5YA 2J0QD 3W65A 1X0PA 3H59A 3LP0A 1DTQA 3OUYA 4TKTA 3HLUA 4CTAB 2XY6A 2ZWPA 4MK8A 3BYRA 3QATA 3CCUS 2E1AA 3SCKE 1YQHA 3DLGB 4DV2J 2HMIB 4RNHA 2V0NA 1U4BA 5C2CA 2H51B 3JTOA 4IO9Q 4IRCA 3DDIA 3SSRA 3PHTA 5DQGA 2FJWA 3FC9A 3MOZA 4WKYA 4ID8A 2RKIB 4YMEA 1HQEA 2HNDB 2P8IA 1I3OB 5EWGA 3IG1A 4KKOA 2FHJD 2FJBB 2XSFA 5ETSA 2CG4A 1RT1A 1QVFR 3EGWB 1VQPS 2HFZA 1CS4B 4WXOA 2XI2A 4DV6F 2R2UA 2J7WA 3QT8A 4DPXA 1FE0A 4Q45A 4PKDB 2VONA 1Q0NA 4K4SA 4X4TA 2LQ9A 3M4XA 2HGMA 3KLIB 2JHEA 1KD1T 4K4ZA 2VA2A 1BD6A 3NAHA 5KOXA 2BDPA 2KO1A 2BYCA 3VZHA 4F36A 1KC8T 4PEOA 4HYKA 2X1FA 2NPFA 1FTCA 2HRUA 4K0KJ 4RBUA 3O5TB 4ZK7M 3EUNA 2KXHA 2CPZA 1RHMB 2FLOA 4OX8A 3J81Y 4G1IA 1RTZA 1S1TB 5F8IA 2J0XA 1EAYC 1KQFB 1PC5A 3MURP 3HHDA 4B9LA 3C3LA 2A1BA 1HPZA 3T1HF 3ENQA 3A13A 2FY1A 1HNWF 1TKXA 5F0UA 4JI8J 1KLNA 3LANA 4NMLA 1WHWA 1N34F 3AOCA 3HX9A 1MN9A 1L3VA 3ZZOA 5E41A 2E5JA 3BGRB 5EDWA 4USUA 1FRIA 2OGUA 1DHMA 2HHQA 4ZKAA 2YBVA 1I5OB 2KRRA 1H2VZ 2FPHX 3VCDA 1BGXT 3AFGA 5D15A 3NKYA 4OHYA 3PRBA 3MTKA 3CGIA 1T95A 1NDPA 3JAMU 1X9SA 3UR3C 2XGQA 3T5KA 2V5HG 3UI3A 2KHCA 2AYBA 2WW8A 3DCAA 1HNZJ 3L7OA 5D4LA 3OR1B 3W5YA 3R7BB 5L46A 3MEGA 4DL2A 1RDRA 1LW0B 1R8HA 1Q81T 3KK1B 1NM2A 4DUTA 1HQUB 5IT9Y 3GCWP 4TY9A 4U9RA 1RI7A 3CUNA 1UW4A 5GAHU 5D3GA 4J7CA 2BX6A 2LEAA 4K4VA 3M30B 2ZH1A 2M5YA 4DL6A 4DUZF 4HT5A 2F8HA 1HIYA 3G82A 1NBEB 3UCGA 2VG5A 3MWBA 2CQ4A 1RTDA 1T9VA 2M8HA 5BYRA 4G1QA 4P10A 3DM2B 2CJYB 4NE9C 4ED3A 2V4JB 4NYZA 2M4MA 1N32J 3CMES 4A8XA 2XM3A 4ZIVA 1FHTA 4QPTA 1ELOA 3OLBA 4P2FA 1B70B 4ZP7A 4EBEA 4IRKA 1SKWA 3TA1A 3WX8A 4AQYJ 5ETKA 2WB4A 1TZ0A 4F3MA 1VISA 3LPYA 1R0AB 1VBKA 1WI6A 3AD7C 2HWIA 4LJMA 3H25A 5DLGA 2QEXS 2Z30B 2VD3A 2C3YA 3ISND 1NEEA 1ITPA 3NGTA 1PKUA 4C2MA 3ZTPA 5CYQB 2XBPA 1QSYA 1RWWB 1I94F 1AUDA 4DSJA 4DR6J 4QW8A 1V5VA 1NZAA 4WXWA 4OYXA 5C24A 1T05A 2PI4A 3MCNA 4X66F 2B7BB 2XMUA 1UWBA 3VQSA 1RZMA 3LUYA 2F65A 3JQMA 3ZC4A 3IS9B 4NA2A 4L76A 1LWCA 3C15B 3MDFA 1TTHB 1M5PC 1QUPA 2VDHA 3D0GE 4DL5A 3NGKA 3D28A 1UVNA 1FVSA 2DGQA 3MM8B 1SC4B 3MM9B 2DYAA 4WIQA 4DV5F 5CCLA 2UUTA 2C2OB 5HJYA 2OPSA 5GAGU 3W8GA 4M5JA 3H42A 4XTTA 3PIOQ 3ZXWA 1FTRA 3KLEA 3RW7A 1VIXA 1FDDA 1UJ4A 4QYZK 2OD4A 3BEGB 5HQMA 2NCKL 3IWNC 1RE1B 4ATNA 1NJYA 2YNGA 2KN4A 1S6UA 2DNHA 1UEKA 3K57A 3RBXA 4WPAA 2ZKTA 5KG1A 4TYBA 3I32A 2IBKA 4YDDB 4CT8A 2CJXB 2GMLA 2G1HA 3M2RB 3MMCA 4LUBA 2IVFB 4ID5A 2GS8A 2IJFA 4F2SA 3PW4A 4P52A 3G8TA 1R8AA 3NEKA 4YP3A 1F1BB 2LDIA 2FIUA 2W7PA 3CJ3A 3DXBA 5HMYA 4PPDA 1RT5A 3DI6A 2QT7A 2F4FA 3MAAB 5E3PA 1PCAA 4CLFA 5C25B 5BJRA 2CWKA 2DHXA 1B0TA 1LW2A 4RX6A 1OY9A 1EHWA 3FEXB 2CJ9A 2E9ZA 1TKTA 2HQFA 5HMWA 2VC0A 1GQEA 2HSEB 1JJ4A 1U1PA 1SQEA 4UOHA 1X0FA 2BRLA 3B54A 2KVIA 2E5GA 4X4QA 5A8WA 3HHLC 5IT0A 5LMNF 3HULA 1NHKL 4KQZA 2MYFA 2OEJA 3ONQA 3FCWA 4MK7A 1QSLA 3C8YA 1FNMA 3WBZA 3NMRA 2WRMA 3POTA 2BW7A 3ZTQA 4RWWA 3CCQS 1DLOA 1RUSA 5CD4H 2OAUA 4I69A 4P73A 4ANDA 2BR0A 1OSCA 2FC8A 2XZDB 3IO1A 3EGVA 7FD1A 1IKXB 4NOHA 2DO0A 1UPMB 4F2RA 2VBWA 2RRBA 5LT5A 1P6TA 2BKPA 4W98A 4LBIA 4IH7A 3KHHA 1LWXA 2JC1A 3M8QB 4CLPA 3FUYA 5FLXU 2R8JA 2CQ0A 3NGDA 1BQMB 4M95A 1RHRB 3D1HA 5B0DA 5C7PA 3NGUA 4DCOB 5KFJA 4LR7A 2ZITA 4WK3A 4B3OA 2DXEA 3QIPA 2EK6A 2MMYA 1U47A 2NR0A 2W4PA 4ECQA 3DGVA 3BO4A 5CZVA 3LA0A 2OJ3A 2JLEA 4DDFA 3QSYB 2GHVC 3N5FA 4DV1J 4EZ6A 1U8SA 4E98A 1VRTB 1UWAA 4LIWA 3T5LA 3OTOJ 4WBFA 4I0WA 1HWIA 1RYRA 1S1XA 3CNQP 1RHJB 4IG0B 1E6VB 2HHUA 5K9FA 4QIWD 4WIIA 3PR5B 2DNQA 3AQOA 1NRKA 3DOMA 4MKBA 1FERA 3T6BA 2GVDB 4URQU 2DTJA 3OD2A 1XJWB 3P45B 2YX7A 1QSSA 2QA1A 1JX4A 2AD9A 1S0OA 4X62F 5I3UA 1H98A 2LLZA 3DLJA 3ZZRA 3US5A 3LGNA 1XNQF 2UV8A 3DRRB 2P9GA 1Y0HA 4DR5F 1IWGA 2DNKA 1KP6A 2Z4PA 3DMJB 2W2QP 3AJ2A 1CJTB 2N3LA 3F41A 4TXSA 4DV3F 3HFVA 2J9EA 3HXMA 5KFLA 3I9ZA 3LP1B 2WOMA 1CSJA 2N4DA 1C4CA 1RTHB 2VASA 2VIHA 4KHPJ 3JAMY 4JV0A 2YKNA 2K7KA 5J2QB 5KFMA 1KSPA 1SKRA 1AZSA 4TN2A 2H5EA 5JUMA 3SMZA 2QJ3A 2YNFA 2IDLA 3AD9C 5IQ6A 4U95A 4CT9A 3NCPA 4TYAA 3CDWA 1NH7A 4B3MF 3JYTB 3VGUA 4GVBA 4CH0S 5KG7A 2J0SD 4ZLJA 1YHQS 2KH9A 3JS9A 1VQOS 1OYEA 4CO3A 2ERRA 4JI6J 1N5VA 4AYBD 1IM6A 2JX2A 2AWZA 2YNHA 1C4AA 3DGPA 3FCHA 3IFEA 1HNIA 5KG3A 5DGAA 1NNDA 5KFWA 4GKJJ 4ZVHA 3T3FA 5AT1B 1S0MA 3I0RB 2OEKA 3RRKA 1FCAA 1WF1A 4UF4A 4LF7F 2WCXA 3TZXA 2V34A 4C7QA 1J2VA 4LBHA 3MM5B 3DYAB 3I0SB 2DHGA 2Y8YA 3LP2A 2WBMA 1IR0A 5B0CA 4YB6A 5DG7A 5IS2A 2L9DA 2QN6B 2VFUA 4M1KA 2C3PA 4FF1A 3UWTA 4M5DA 4CLSA 2R8GA 1UMJA 4EBDA 1XN9A 2RH3A 2GO8A 2F8EX 4LIRA 1KBRA 3FBBA 1U8WA 4UQTA 2E1RA 4FPRA 5KT5A 1IQZA 1RT7B 3ISNC 1LFWA 2OSQA 1FDAA 3QJJA 3H2UB 3T1YF 1PIEA 5KT4A 4DZ6A 5ETTA 2XMMA 3M32B 3M6WA 3MEEB 3KK3B 3TAMB 3AQPA 4L75A 2XYHB 4ERDA 2XTJP 4DR1J 4F4ZA 1X4DA 5J1PA 1C1CA 5T41A 2LQ8A 3RRGA 2L48A 2MZSA 3RZAA 3W8PA 3UDVA 3KDNA 2UU9J 1QTMA 4FXVA 4KB7A 2R3VA 2GVZA 4NXNF 2K8GA 1V6HA 3RAQA 4IOBA 3TJAA 2C2DA 2GV1A 4DN9A 1WEXA 4C8LA 4A8WA 3TUJC 3R5CA 2WVEA 5DQHA 1VFJA 3O2IA 4NLSA 2VPZB 5IT4A 1QY7A 5H9EJ 2JRSA 3CCJS 4LF2A 3TZYA 4PG6A 2HVZA 2VG6A 1NDKA 4Y6IA 1CJUA 3LH2S 1Q86T 4OI3A 2VKRA 5IOLA 1OS5A 4G6VB 2CNLB 3N4WA 3BPDA 3Q8SB 4KGXB 1RWVB 1ZA1B 2R7TA 4A8OA 1EZZB 2Y1JA 1FI4A 3DU6A 4HTJA 2HVEA 1A6LA 2IPOB 4PG4A 2DITA 2YWGA 3IBWA 1X31C 3PY8A 1ZZNA 2B4UA 2FJVA 2R8KA 2C3OA 3IRWP 1KHWA 2P2CB 3PJWA 3PM9A 1MWYA 1RT2A 3MFHA 3CW2C 3OTEA 2YWHA 4UY85 3MTJA 2UUWA 2M8DB 2DGUA 1NPKA 1KS2A 3I9V9 4J5OA 4LF8J 3LOUA 1MLAA 4PG7A 2YNIB 1S1VB 1XMQF 1G2EA 3P3DA 4DFPA 3PW7A 5D0GA 4ZPDA 2L41A 4KAIA 3QMQA 5KFZA 3U1LA 1D9DA 1FNOA 1D09B 3EZUA 4LFAF 4MFBA 4F67A 3A8IA 4CYUA 3PYDA 3SQGB 5LOQA 3QJPA 2CPDA 2DH7A 3EICA 1DRZA 2O01C 3EVWA 5F3TA 2R8IA 5HATA 2XEXA 4OYOA 3DLLQ 1JQGA 3N6MA 4I2QB 1S4EA 4C3MA 4I68A 2JC0A 1J5EF 2DEIA 5G0RB 2BV3A 3OXFA 1HKAA 4MKYA 3ZZTA 3PX0A 4KGMA 3TQ1A 3R5AA 2ZH6A 2FVCA 1ROFA 3K5NA 3PCOB 2KTQA 1TL7B 1MN7A 5BR8F 4QJVA 4CLLA 3MHYA 1X4FA 4ZP9A 3HSDA 1VQYA 2QRRA 1ZAXA 4RW7A 4C8ZA 2DHHA 3M8WA 4N56A 4C8OA 4B9UA 3GPAA 2DKOB 4DSEA 2PMWA 3RBDA 3W62A 3IAS9 3QSIA 4M5MA 2HGNA 1HYSB 1TV6B 3DOKA 1ACMB 4O3NA 2FVRA 5J2NA 5J1NA 5KAKA 2JL9A 4DLGA 3UD4P 2QL7B 2LXUA 2J6SA 5D8HB 1B64A 3NXZA 4DQSA 3CO9A 2B4OA 3MCOA 4P2MA 2RF2A 2R7SA 3THPA 3C46A 5FLXY 1S9EB 2XG8A 4OHVA 3H0PA 1RGVA 5EHHA 7FDRA 1T02A 2BXJA 1X9WA 3T1HJ 4KV8A 2HPUA 5ETLA 5HROB 1G1XA 2HVDA 4QCLA 1NJZA 2Z0GA 3OJSA 5J2PB 2H48B 3B82A 1IBMJ 2ZHOA 3UE2A 4ZVEA 1S9GB 3A3OB 4Y2KA 3C14B 4ZVTB 1CQNA 5JJBA 5A8RB 1VJWA 3DDNA 3GG1A 4A8SA 1JLFA 4C3KA 2M2BA 4NZ0A 1QE1B 3UDCA 3MECA 1OY6A 3MD3A 1RHQB 2R8HA 2A2CA 3QAEA 5ETOA 3KLHB 2OMLA 4F0HA 4C9DA 4PYAA 2R7WA 3NOCA 2V94A 2CDQA 1T11A 2MGZB 4OZ5A 3W7BA 2FJAB 2EBEA 2GA7A 3TUIC 1RAJA 4FBUA 1W25A 4Y2MA 5I3PA 1RAIB 4JI7J 4MIAA 3SQOP 1NUEA 2ZUAA 1EQ0A 1G7CB 2ZBIA 3ICLA 1N5SA 1TK5A 4ZVGA 4DUZJ 3LGHA 4I1TA 4AXJA 1C1BB 2WONB 4PQUB 2KB2A 1X4AA 2DR7A 3FVYA 3W61A 4CTAA 2VL1A 3CEDA 3DRYA 4OMFG 3B8HA 4RZRA 2DRDA 4RW8B 3DLGA 3BGFA 2HMIA 4UT4A 1QAIA 3OT9A 5B0BA 1HNVB 3EXCX 3KDOA 2V4RA 3HVAA 2JSXA 3MR7A 3RBZA 3N28A 4F3OA 3M2VB 2LYVA 4P71A 3HM9A 1NPPA 1J27A 3TAQA 2CQHA 2GJIA 1CEZA 2HNDA 2XY7A 9ATCB 1JB0C 3K17A 3ZTOA 1GT8A 4KYZA 5A0YB 3V6JA 3MPDA 2ILYA 4LVNP 1ZAVA 1U6FA 1NO8A 1Y9OA 2XSJB 2HHTA 3GR0A 1CS4A 1JK9B 4LMZA 1SV5B 4URSA 2RRAA 3QYYA 2M52A 2ZH8A 2F5GA 2AF6A 1FFGB 4XDDA 2FD2A 1I94J 4AT1B 3G8QA 3KLIA 1NKBA 2BE9B 1UZDA 4ZS6A 4UTGA 1XMOF 1KQGB 2VQFF 3CJRA 4X66J 4ZLLA 4QYRA 3S1TA 2CDRB 1IN0A 3RAXA 3R9LA 1GTEA 4GO5X 2JJ4D 3ILOA 1AXQA 1NCLA 4NRTA 4EGLA 3OHAA 4DQIA 1WUUA 3BKFA 3PRDA 2ZNYA 3OW2R 2BE7D 4WJBA 4C97A 5KT2A 1SKSA 3N5BA 3CJKB 2BVZA 2HW3A 3M6UA 4C8YA 3SV4A 3MMBB 4ZA1A 3HHEA 1LXNA 3MD1A 4OJGA 2CNNB 1S9FA 1RHUB 2C2KB 2QLBB 4BWMA 2VODA 1SL2A 1XR7A 3C19A 4ICLB 4RBVA 2GHPA 4CLWA 1JXVA 3LALA 1YWXA 4BS2A 1FWLA 2G0IA 5DETA 3DRSA 2ZZMA 2YX1A 4M5LA 3GYGA 1IKWB 3CCES 1S0VA 3BYPA 4M8LA 2IM3A 2OH2A 4NXMF 3KK1A 4WCEQ 4N8NA 1DQ9A 4ZPCA 4ILLA 1HQUA 5E5NA 1Y7PA 2R7VA 4XDCA 5D6GA 3SSQA 3OV7A 2M88A 1T94A 4IH6A 1U1RA 3OXLA 2A2DA 2ZE2A 1GMVA 4X4NA 3M30A 1U09A 4NLQA 4LFBF 1HNXF 3H4DA 2BJ9A 4PXBA 2ZH4A 1BC6A 4ZPAA 4N7TA 3KMQA 4MMOA 2FJEB 1HL6A 5HSPA 2B4VA 4BDPA 1JLCB 2IBOA 1S6OA 2V63A 1DTTA 3S8SA 3DM2A 1UKUA 2UUCJ 2V4JA 3GJRB 1Q7LB 2MJUA 5DO2A 1DQAA 2JOQA 2DRBA 2BW2A 4ZP8A 2C2RA 5THWA 1CJKB 1TQLA 1HFEL 2F63A 2V69A 2MZQA 1WKLA 1WTFA 4AL5A 5HK4A 4N41A 2MLZA 4GVLA 3CSKA 2PT0A 1KLMB 1HMVA 4ZN1A 2QX0A 5IWAF 5L1LA 1T9WA 5CYQA 4Y34A 4LSNA 2B9XA 2XS5A 2DNZA 4RJVA 3HT3A 4HTIA 1FDBA 3O1LA 1WOSA 3X3UA 1ZTTA 2HNYB 1RWXB 1JLAB 4RUHA 1Y11A 3OQ2A 2QLJB 1FJEB 5GAEU 4B3SF 3BSCA 1NK6A 4K8RA 2W2MP 1H2UX 3GSDA 4Q7AA 3ZO7A 3C15A 5M2PA 5AE2A 3HHLA 3CTRA 2R7OA 2A18A 2OPQB 1UTAA 1CULB 3IXQA 1T9XA 3DLEB 3VAFA 4ZPBA 4QU7A 3IGNA 2CAJA 1NDLA 1NKEA 1UVKA 1A9NB 1V9OA 5IC6B 3RG6A 4DS5A 5KFIA 2MQMA 4CM0A 2XCPA 5HVGA 1SL0A 2FJDB 1YSJA 3LTOA 2CUYA 4LREA 3MM7B 2EC0A 2OHDA 2G2OA 3NS7B 5K8MA 2Y1RI 3MUTP 1JXEA 1L3TA 1XERA 4OZ0A 4XK8C 4HHUA 1WACA 2AMCB 4QR0A 2UXDJ 3HVTB 1DQ8A 2FDNA 2ZOFA 2M70A 3BBFA 3MR3A 4DXLA 3M2RA 1F9HA 4PWUA 1AROP 1RU1A 4X62J 2FHJA 1F2HA 1QAXA 4DOZA 2H4WB 3LW5C 3EVMA 1K9MT 2QMUB 1B7FA 4LF6F 4YB5A 4GRSA 3GCXP 3ISZA 2XQCA 1M1HA 1BLUA 1WOOA 1HWLA 2ZJRQ 2D69A 1VHIA 3Q8QB 5E3CA 4A8FA 4DV3J 3PJ9A 4QR2A 2EC2A 4OHWA 3ZZZA 2R7XA 4H4OB 3OTCA 1WWHA 1UA0A 2OPPB 1RBAA 2V8GA 5C25A 4WFXA 4MIWA 2BM1A 3ILIA 5ADZA 3HZEA 3MCMA 3CCWA 3NS5A 1FKPA 2XWXA 4B17A 2KRBA 1U1OA 4P7TA 4HDGA 1WC4A 1YZ6A 3BZQA 2PMHA 4MTPA 3IA0A 3A8JA 3NG8A 1LWFB 4BBYA 3K59A 1FNXH 3PJXA 3OL8A 2UUAF 2MHNA 1PGZA 3WC0A 4DEZA 3GZ7A 5J1EA 3BR8A 2BUNA 4RNFA 1VQ6S 5KFKA 3MPVA 3EDQB 5M2RA 3SEOA 4YQWA 4PZVA 2Y1IA 2C42A 1Q8IA 2PDAA 4CLKA 1JJCB 4YR2A 2QTWA 3CJ8A 3I87A 4DFMA 4ELUA 4ECWA 3IP0A 4LF7J 2PFDA 2ZC4A 4NLYA 3GV8B 4I6AA 2WVCA 1IKXA 1NKCA 2ZVIA 4DR7J 1WSVA 3NMAA 2DXFA 5FIIA 3K5OA 5DZ7A 4N8OA 1NSKL 5KFEA 2Y0BB 3ZTSA 4DLEA 2NXUA 5H1SV 2V2ZA 2MQPA 4ZPWR 4BWJA 4ZP6A 3GILA 1NJXA 2RNEA 1IBKJ 4PYDA 1BQMA 3PO4A 3I4PA 1JKHB 4JYAF 1YG0A 1ZETA 4QIGA 3MPUB 5HJXA 4R8UB 1GX5A 1Q79A 1S97A 3QGHA 2PGCA 3FZ2A 3EYZA 4FPIA 5A76A 1AT1B 4A8KA 1VGYA 3NAIA 3T1YJ 1HI1A 1N33J 5B7WA 3BKTA 2MJNA 1U0HB 2F4VF 1TL4A 5L1KA 3P8BB 2IMOA 2NXCA 1VRTA 1NK8A 1QD1A 2BZ2A 1JLBA 2V9WA 2XNRA 3V4IB 2EVZA 2FVPA 1P27B 3I56S 2NUHA 4ILRA 4UOCA 1WKKA 3BQ0A 4ED7A 2KM8B 1E6VA 1V3SA 3NNCA 1CJVB 1Q4RA 4WE1B 2OELA 3M8ZA 2GVDA 4Z7YA 2O66A 1UVMA 1IJFB 1YJRA 5HLFB 1EKRA 2J7UA 3CD5A 2W7AA 1RLCL 2KG1A 1MMNA 4IQXA 4DSKA 2DY1A 3MPYA 3TAPA 4IQMA 3DRRA 2N7CA 2QIFA 2HHPA 4P74A 3DMJA 2GQQA 1RTIB 4I2PB 1GTHA 1CJTA 2J0WA 2QZ8A 2G2ZA 4U7UK 3DRXA 1YI2S 2ZKUA 3D1QA 2RE1A 2V9KA 1RT6B 3CJ0A 2BABA 4DG1B 3AXKA 3NBPB 1S7IA 2KZZA 5F9NA 1OYDA 3OL9A 2H65B 1DJ0A 1Q16B 5DJBA 3RBEA 3LGMA 1TL3B 3D0HE 5DLFA 5KFYA 3J81U 1YJTA 1RT4A 3EJMA 1QLNA 1REVB 1S1WB 3OVSA 2MSTA 4J9UE 2LU1A 3VV2B 3NS6A 3QZ8A 3H2LA 5CQGA 1LKZA 5EUHA 2CPHA 4LVOP 3DDKA 1DARA 4IOCQ 1TK8A 4IFVA 4NX9A 3JYTA 2JEFA 2YKOA 3P96A 4AE5A 4O0NA 1FRKA 4NCAA 4Q8FA 1VQ9S 1IVZA 4XIUA 2KT5A 1WG4A 1NB2A 3WZ0A 2GW8A 3SDEB 4C48A 2W9CA 3MFIA 2AEFA 1LK7A 3ULHA 3UR0A 2B9YA 4NLWA 2W4DA 1FFSB 3I0RA 2ZHBA 2GFFA 5GVQA 2KXNB 4ES3A 1UA1A 3IAM9 2KM8C 3R97A 3CB4A 3S6EA 1B0VA 2ALZA 3DYAA 3I0SA 1FK9A 5L39A 2CQPA 3MF5A 1GEHA 3IR7B 3Q8PB 4KPYA 1RB0A 3M8RA 1ZAWA 3K8VA 5L1JA 1LXJA 4ZMMA 3SV3A 3EE3A 2F7VA 4FVMA 3BF4A 2MZJA 4KFBB 2DCUB 3T9NA 5F41A 1TUWA 4IUFA 4LFCJ 2VBZA 1RCXB 4B3TF 2RILA 4YB7A 3IGVA 3OSNA 2CZ9A 2K06A 2UVUA 1S1UA 4DV7J 3N0VA 2DPJA 4TQSA 4JV2A 2HAFA 3RJMB 3MEEA 2D7SA 4JV1A 3LP0B 3GIJA 3I31A 4EWTA 2JZ5A 1VIOA 1Q8BA 2U2FA 4ECVA 2H5JB 2A3JA 1FRMA 3U1MA 2J7KA 2WAQD 4DFKA 4J9LA 5KFAA 1KWMA 1I1GA 1PYTA 4I4BA 5RUBA 2I0XA 2HZCA 3Q8VA 2E9TA 4PXEA 1ZBTA 4B02A 1ZM4A 3D5MA 1PJ6A 2ZM6F 4HI1A 3HD1A 2DNMA 2AIRB 4YY3F 3UVJB 4DSLA 5C42B 2LP4A 3IG1B 2MY7A 2VBXA 3NGRA 2VKZG 3GFXA 1RT1B 2MHEA 4R5PB 2C2NA 2KYZA 2VFSA 1RT3B 3JSRA 2IC3B 3ELHA 3HFKA 2D9OA 4DFJA 3TEHB 1HD0A 5AE3A 2NSCA 1WJ9A 4NLXA 2IY5B 2HNZA 3UNYA 5KG0A 3KXDA 3W9JA 3WHIA 1O0PA 4EFAC 3UDLA 3I6PA 3JTPA 4OHZA 3R5BA 2GIRA 4YR0A 1GMUA 1JNZB 3HZGA 3MAQA 1MMDA 1WTBA 1OO0B 4N5SA 5CD4A 3D3CJ 4AL6A 2YWWA 2ZJPQ 1HBMB 1X5SA 1Y10A 2BMBA 4P6QA 2YNIA 4F4YA 1RKJA 2HK3A 2GGPA 4H4MB 1MW7A 4ECZA 3VALA 2CYYA 4IKAA 4Y2AA 1HPZB 2K3KA 1NAQA 1WG1A 2DCLA 5KG2A 3W2VB 3SQGA 1YJNS 4QWCA 2ZH9A 1KDNA 4KO0B 1JXLA 1SCJB 3G71S 3RRHA 2X1BA 3G6YA 5A2QU 4WZMA 1Q78A 4KJIA 1AB8A 5GMEA 3V6DB 4O3PA 3HSZA 4I2QA 1A0OB 5DS7A 1XK8A 1N48A 5HN0A 3CC7S 5G0RA 3B6BA 1IUJA 1T8EA 1JJ2R 4ED0A 5AJ3F 3HO1A 3P5BP 4J9MA 1UZHA 2GZOA 4J9VA 3OTBA 2ZBCA 3VR1A 4RUAA 3BH6B 4KH0B 3I5BA 5F8GA 2UXCF 2PEBA 1B99A 2E5LF 5I42B 1U02A 2MKKA 4OX9J 5LSLA 3GONA 3Q83A 3HF5A 1Y3KA 3AHPA 1HHTP 2AT1B 2G9OA 2VPYB 1B0PA 4USJC 4TU8A 5D0HA 4NPOA 3TQEA 1PYSB 2P5VA 2B7CB 4HACB 2HZAA 3HSJA 3I5CA 5KG4A 4KTQA 2KJWA 2MY8A 1XMOJ 2IIHA 1T3NA 5I4MA 1NK7A 3L3CA 2BJEA 2XMKA 4QYZJ 1BY9A 2DGOA 1FX4A 2XZWA 3FBFA 2IVYA 3CT9A 1K0TA 8RUCA 3PW0A 2JNJA 4ZPTR 4NA3A 2LQBA 4WZQA 1PJ7A 4NLGA 3ZZ0A 3FQLA 3F0NA 1S76D 2E1CA 4DV2F 3ILJA 1F3VA 1S4FA 2H5IB 2X3DA 2HLUA 4C0BA 2CPJA 1W2IA 3BSAA 1UP1A 1H2TZ 5G4DA 4QWBA 3KJVA 1RQ0A 4PABA 3UDEA 3A4TA 3PFEA 5HROA 1F3FA 2DJWA 4Y0FA 5A6PA 1VQ4S 3Q2TC 1R43A 2HZVA 5J2PA 4ZJLA 2IFXA 4OYIA 4JB8B 1S9GA 4U7CA 3OJUA 3HSGA 4K2JA 1KR4A 3JSYA 3M9NB 2YQ3A 3IWLA 2BJ3A 2MTLA 3HKWA 1FEEA 3QZ7A 2KXFA 2BJDA 1LWEA 2RDIA 3IBFB 4FYXB 2JVOA 3CWJA 2KG0A 3GWCA 4ES2A 2W2PP 4KPCA 2UP1A 5IM0B 2RU3A 4J9QA 3KLHA 2CWXA 5C24B 3GU0A 5T14A 4NXMJ 2KKHA 3J7A1 4Z2XA 3UO0A 1XTZA 4IH5A 2IYIA 1MNEA 5KFRA 3KG4A 3KFWX 3BGUA 2E29A 1HNXJ 1RA7A 5DDPC 2CQGA 1QTNB 5L8RC 2SXLA 3E3XA 3NY0A 5DM6Q 1C1BA 4PQUA 3T19A 3BR9A 3KLFB 3D6MB 3KLEB 1IXKA 3MI7X 4NEYA 1YIJS 3PR4A 3NGSA 3DFEA 1X9MA 1ZYQA 1Z2ZA 4RW8A 5I3QA 1VOMA 2RB7A 2CQ2A 4OZLA 3BGLA 3CCSS 1HNVA 1RWMB 4IYQA 2XMVA 5K14A 3TUZC 3G6ES 3M2VA 2LEPA 4B9NA 3TVZA 1FF2A 2BQUA 3MMCB 3V4MA 2Z2LA 4OZ2A 1FE4A 1H73A 4Q2LA 5IFMA 4ANCA 3KG1A 2QLWA 1HNZF 2XULA 5A0YA 3CC2S 2BA9A 2I2YA 3U27A 1X7VA 1KVKA 2QMWA 4X4RA 2Q6CA 1M5VC 1N4LA 1VQ7S 1K44A 4WFNQ 2RQKA 2HRTA 3UCZP 4DUYF 1RT5B 3U1NA 2CPFA 4N77A 3GFYA 4KIAA 4WWSA 2W8LA 3VAKA 1R8CA 1VLYA 1F2GA 3R2CJ 1SXLA 2OPRB 2WSCC 8AT1B 3JQJA 2CA9A 1LW2B 1ICEB 2CNKB 3M1VB 2M3DA 3C16B 4B3SJ 1TKTB 2FYXA 3BREA 3GJSB 1S99A 2D3ZA 1NK9A 1GAOA 1IKVB 4J9NA 1HBOB 3I96A 3DKDA 2HFOA 4DQQA 5L9NA 4F50A 4RW9B 3AD8C 1GMWD 1RWPB 1N32F 1XWLA 1YBUA 4IR9A 3DXSX 4JOUA 5KFOA 3CJKA 4AQYF 1MG7A 5KTQA 3MMBA 3POTB 2ASJA 1UJ6A 2VQEF 1TL1A 1JLGB 1YJ9S 3G9CA 4ICLA 2MKCA 4P75A 2JFKA 4KY3A 5K8NA 2RQMA 2YY3A 3WIVA 4Q5VA 3M2UB 4LSLB 3O44A 5KFTA 1C2PA 5KFGA 2DVIA 3FSIA 5D4OA 2VG7B 4F0MA 3PO5A 2YH0A 4DMZA 1IKWA 5IV4A 1NK4A 1UCNA 2IVMA 5SUHA 4F0KA 1N5QA 1ZM3A 3FZBA 2MLXA 4UW2A 2EKNA 2EKYA 2AGPA 3HP6A 1U1KA 1AFJA 4I6WA 2B6AA 1N52B 1K0VA 4EYIB 4ZLNA 4A8QA 4YUDA 2AKWB 4HT7A 1RCOB 4N47A 1SC1B 2N7YA 4M5KA 1VK8A 1K73T 4GO7X 3D6HB 1PG5B 4EUVA 3L7UA 2IHR1 3RU0A 1JLCA 4ZCIA 4O44A 2GIFA 2CJQA 4N76A 2G0CA 1S1XB 1NHUA 2VJUA 4USMA 4V19J 2UUAJ 1N36F 4DR3J 1U2RA 2UXBJ 2AYEA 1NJWA 2HIQA 4Y3CA 1CJKA 4FF4A 2GCFA 4PWDA 4R0JA 1L3UA 2RHQB 2P9EA 4NEZA 3TNVA 5I3UB 2AHOB 3UPFA 4O3SA 3TJ8A 5AXNA 1NMEB 2EFVA 4EU0A 1T03A 3AOAA 3CCRS 3PW5A 1FX2A 3ETMA 5F8HA 4JI5F 1KLMA 1RAAB 3BB5A 4WU3A 3RUBL 3GMGA 3FMWA 5F3ZA 2IRUA 1QVGR 1QAYA 1S6QB 2A6OA 2ATLA 1NSAA 5A2QY 2H4YB 2DR6A 1UAWA 3VHQA 1I6JA 2WOMB 4ZVUB 1KHVA 4DL3A 1YJUA 3W5XA 2HNYA 2AJ1A 1Q1KA 4KRWA 3MPWA 5LXRA 3GJQB 3TWZA 1JLAA 4RW4A 3KUHA 3R27A 3V81A 2KFYA 1U1MA 1Q95G 5KFVA 1N54B 2IYGA 4OL8A 3GFZA 3QBCA 4LR8A 2YPYA 2J76E 3CPWR 3DLEA 3BO3A 2HS0A 2B5JB 4RW6B 4B3RJ 4ZJQA 1OQ6A 2GAHC 1Q8LA 4LRBA 2F4VJ 3E01A 4GVBB 1BWEA 1SJRA 2VH7A 4X4UA 5F8LA 3O6QA 3MM7A 4KGZB 3HHKA 1QDUB 5FDLB 2XYGB 3P6YC 2Z57B 2RT3A 4ZVRB 2I9SA 2EBGA 2FHOB 4RL1A 3GIKA 2RS8A 3M05A 1F9EB 3MGJA 4J9SA 3KJQB 4IDKB 2W01A 5KT6A 3U7JA 4KGVB 2I1RA 1KOHA 4BC7A 1TU0B 2D9PA 2PA3A 2HK2A 4XAKA 2VOPA 2YXLA 3M8SA 4GKKJ 2NZ4A 1YRXA 4L74A 1VRUA 1YJ7A 4MIBA 1R7IA 1VQ5S 3D0IE 2D3OR 1EETB 4DV4F 2DBBA 3QWUA 3K0JA 3FCVA 5KFQA 3TZZA 1U25A 4NI2B 2K1RA 2YKAA 3GG0A 3FSXA 4DV0J 2LECA 3R5GA 1FRHA 2JH3A 2GJ2A 3B4DA 2FZGB 1HARA 4JI0F 2I6WA 3T1AA 1LFPA 1PAEX 3ADAC 4PAAA 3PG9A 1RKIA 2ZHAA 4FNHA 4DV1F 3TJ9A 3EXYA 4UOFA 3A1YG 1C1CB 4KGKA 2ASLA 4CO2A 1X5PA 4O23A 5D77A 3OTOF 2JLFA 3RW6A 2PIIA 1UVIA 1TR0A 4MH8A 2GVZB 2JVRA 4NL5A 3TARA 3GTYX 5GADI 2YQ0A 2MQNA 3DU5A 5D0EA 2MLYA 4ED8A 3L95X 1UVLA 2XLKA 2BRKA 4ZVSB 5L1IA 3NOGA 1SC3B 1BQNB 2OD6A 4ZVPB 2M7SA 5CYMB 4DHVA 2DNNA 2VG6B 4WU2A 1CJUB 2CZ4A 3Q0AA 1DFDA 3K7RA 1N56A 4OZNA 4LR9A 4KSEB 4U8VA 3ET6B 5HMXA 1D9AA 3MMAB 3AXMA 3CD0A 3RB6A 3NWGA 2AZ3A 2PO4A 3HD2A 1OQ3A 1YJVA 2XMJA 2HBZB 2UVVA 2KL8A 3UQSA 3D2WA 2DNPA 2VB6A 3E8OA 1JKHA 3CCZA 2CQBA 4R8UA 1WHXA 2ZJQQ 2IDEA 2LFVA 1H38A 4B3TJ 1S57A 5E7OB 3UNGC 2ROPA 5DDOC 2WW4A 4M5GA 1UFLA 3MR5A 3NWRA 3HVWA 5K8OA 4ZITA 2GNKA 3N6LA 2DR9A 2VFRA 3CDBA 5D0RA 1U0HA 4HHHA 4F25A 2XWYA 2ACMA 3MM6A 2LEBA 4MFBB 2MQLA 3SBMA 2WB1D 2FJXA 4FDFA 2AEJA 3GQCA 2VPWB 3BS9A 2KU7A 2B8QA 3BBBA 3H8YA 2AW0A 1RAOA 1CJVA 3VZIA 4X4PA 3PRVA 4J91A 3MXHP 3ENWA 2RSQA 3TANA 4QWDA 4NYOA 3GSIA 5HLFA 4LF4F 3OVAA 5AXKA 5F9LA 4FYDA 3SFUA 2WVBA 3GIMA 4JUZA 4C8KA 3KLGB 2R7QA 2DNYA 2R42A 1IBLF 1LOUA 2X51A 2BEFA 2HBQB 5HQLA 4K2XA 1RTIA 4I2PA 4USVA 2J9CA 2EFOA 3V6KA 4QIVA 4F4WA 5KFUA 4YHHJ 2QYGA 1RT6A 4DG1A 2LA6A 4QQBA 3FK4A 2W9AA 3NBPA 4DPUA 1H3DA 1Q82T 3AJDA 5J2NB 2OMOA 1FDNA 3KTQA 2CFXA 1JLQA 3AT1B 3FRZA 2CJBA 2CQ1A 5EGYA 3OPKA 4NCGB 5LM7E 4DX8H 3BQ1A 3L4BC 4MYUA 4DR1F 2C1EB 2J9DE 1LEOA 3TI0A 1HW8A 3E51A 2DNGA 1S1WA 2IMWP 2FLPA 2GIQA 2E1MC 3M7VA 3GB0A 3D67A 1WC6A 4I56A 1IWAA 1VCTA 4ELVA 3V6HA 3EVOA 4F7VA 3W2WA 2YWFA 4KV8B 4FS2A 3K5PA 2VFVA 3CXCR 2HFUA 4FKYA 1OWXA 5H9FK 2KVQE 4G1PA 1MU2B 3VAJA 1X4CA 2IJNA 1LNQA 4OI4A 3QFWA 5KT7A 2EG2A 2OLWA 2P6SA 1NSPA 2B51A 3EDRB 1O5JA 5IZHA 3FQKA 4OX6A 2E7WA 4OI1A 5U47A 3KG0A 2AYMA 5CH7B 4LRAA 3ZNJ1 4AUKA 3H5UA 4FNIA 2W7OA 3NCQA 4R25A 1CC8A 4UZBA 1KONA 2DIUA 2E5HA 2UXCJ 1VBYA 3PYEA 1B7YB 2HHVA 4QPXA 3EWGA 1H74A 5T7LA 4KFBA 4WYWA 4JV5J 2DGVA 3UD3P 3TW0A 5KOWA 2QLFB 5CCMA 3L09A 3AA8A 3GE9A 3KJNB 2GX8A 3CJSA 3PACA 5HP1B 5GMDA 2RIJA 2IJRA 4DR2F 2DHSA 5ETVA 1Z1ZA 2E7XA 3IM8A 3G8SA 2PD1A 4FYWB 3A3PB 1SQGA 4WP3A 5ETNA 4L6V3 1D8ZA 2QA4S 2XO7A 1IR2A 1XNRJ 5KFDA 3IR5B 2CJKA 4E0DA 3FJ2A 3HCXA 4IFYA 3W9HA 1IBCB 2ZNZA 2L9WA 4WYLA 3W63A 4RBTA 3TOQA 1YBAA 1OSDA 1H6KX 4OI2A 1RA6A 2ZDOA 4MAKA 5KFSA 5A8KB 4C0OC 3UVJA 5C42A 1E6YA 1F5BA 5HBMB 1FXRA 2HHXA 1V3RA 3QGIA 5HQ8A 4R5PA 3CCMS 1RT3A 1TAUA 2IC3A 1ZPWX 2RS2A 2EFPA 3D9BA 3WX4A 1RK8A 2Q43A 2VC1A 4C0HA 4ECYA 4WFYA 4DZDA 4CCHA 3M6VA 2Q66A 2CQCA 1M5KC 1S59A 4FS1A 2C2ZB 4FYYB 2PC6A 4C6AA 2R2SA 2MZTA 2L9NA 4PUOA 1HBMA 2DB1A 2FB0A 4K4YA 5J2MB 5B0GA 1Q53A 2NLWA 2N82B 4O3QA 2X1AA 1APSA 3TUPA 2DEJA 4DV6J 4H4MA 5F8JA 3WC2A 2OKQA 1TP7A 2C22A 2H54B 4RUCA 4V1Ak 4EBCA 1TKDA 4Q0BA 2DD8S 4C11A 1HW9A 3VVTA 1U1NA 1J5OA 2NXEA 3HT0A 3KMSA 3AOBA 3UCUP 2HQGA 3W2VA 3Q22A 4W92B 4DS4A 2BE2A 4KE5A 4HEA9 4DQPA 1ULRA 4KO0A 2JEIA 3D66A 3OTDA 1DAXA 2OI2A 4OI0A 4RNNA 1YK9A 1IBMF 1X5TA 3V6DA 1R27B 2AJ2A 2HIYA 3QO9B 3CULA 5CXTA 2ILZA 4EI2A 2C2MB 4NZ6A 3Q86A 2HFVA 3PYFA 3J7YI 2IRXA 5L38A 4X65F 4IG3B 4OJ1A 2VU5A 2HBRB 2FUG9 3DRSB 1NLKL 1HI8A 3QWPA 5IC4B 3D6FB 4WFZA 3KK2A 5MLCV 1HNWJ 4J9RA 1M90T 3FEZA 1WHYA 4JBCA 5I42A 1N8RT 1VQSA 1N34J 2R2RA 2OP5A 3DLHA 2ZZTA 2QO3A 4DUYJ 3MEKA 4H4KC 3KHRA 3HKZD 1T3OA 4O4GB 4RWXA 3FFIA 4Q8EA 2L08A 4JI7F 2XHCA 2RVJA 1Y5NB 4GC6A 1YVFA 4HACA 4ED6A 2ZE2B 2B9WA 1URRA 3DRPB 1G6BA 1FA0A 2EI5A 2QGFB 3WQPA 1TUGB 3CDEA 2KYXA 2RHSB 4OYWA 4DL4A 2C2EA 1FVQA 4FKXA 1SVDA 1VJQA 4OJ3A 1M0SA 1O8BA 1RAGB 1DTTB 3KNAA 3EGZA 4ECSA 3MUMP 4FYVB 2ZH7A 3AY0A 2W1BA 1VK3A 2FZCB 2GO9A 1TK0A 1WD6A 4OQJA 3LPEA 3D3BJ 1D9FA 2VICA 4A8YA 1RAFB 4ZCKA 4FZVA 4FXWA 1JLEB 3G2XA 1SJ1A 3GR1A 3QGPA 5B0FA 4DSFA 4USHA 5JVGQ 4RU9A 2IRYA 3F56A 3X1LB 1EB0A 3F73A 4OIXA 4DX6A 4ANEA 2VQEJ 4NMXA 4CLYA 2PE8A 1S79A 1U7LA 1S48A 2DH9A 2OUGA 3FNNA 4KT0C 2BQRA 1PYOB 1KFSA 1CC7A 1Q8KA 1HMVB 1Y4ZB 5FD1A 1EIYB 4JI3F 1NPRA 1CG2A 4XO0A 2EG1A 3PIPQ 4CDIA 4LSNB 2Z56B 3BKUA 3VVUA 4ES1A 4PWWA 1IR1A 5C2GA 4KC5A 5IM0A 4HH0A 1CBKA 1S7HA 5MAOA 4F4XA 3QQCD 1UJ5A 2F3JA 2RKIA 3M6XA 3CIMA 3TZWA 2CRLA 4ETXA 3SZ2A 3TP2A 2R7UA 1FWKA 5CAAA 1S77D 1YITS 2D3O1 3TVYA 1TKZB 2IM2A 1M5HA 1BXNA 3OL6A 1X4GA 1EQMA 1F0XA 2DIVA 5KFFA 3SCLE 3N9UC 2CG8A 1RTJB 3HHLB 3PX4A 3K5MA 4F4KA 1U49A 3GIRA 4X4SA 2B56A 4USKA 2X1GA 3DN9A 4F3QA 4WF9Q 3LF0A 2O3DA 2YX4A 2AGOA 4DR4F 4XPCA 3KLFA 3DLKB 3NCRA 5E3AA 1A7GE 2B0GA 3R7NB 4NLPA 4M94A 2QG9B 2DY9A 5BYQA 4Q44A 3QGGA 1RJJA 1OPIA 4IR1A 3OBIA 1N36J 4ALZA 4YEAA 3C6UB 2D1CA 2DXDA 5EWFA 2J6UA 2WSFC 2GMJA 1S1TA 2KFNA 4TU9A 2XI3A 1N88A 4DV5J 3HDSA 3GV5B 2V8HA 2YKMB 2LCWA 3KHGA 5GAHI 4F04B 3EZOA 4OFZA 2VOOA 2AYGA 4CO5A 2J8SA 2EWHA 1AYEA 2QFIA 2F9JA 4JI5J 4C8MA 4EO8A 2VFTA 5K5MA 4ITSA 3BGRA 4EZ9A 3CCTA 1HBUB 1YLXA 1FRXA 4QIEA 2FQQB 2OFHX 1RADB 4GC7A 3QRPA 2OPRA 3IMQJ 2FVSA 4Q2MA 2O5DA 1FKOB 2XS2A 4PR6A 3M1VA 1S10A 1KVIA 2XCAA 3C16A 4CRJA 1FKPB 3OR1A 3UN3A 3PEHA 1UL3A 3VGVA 1Y3JA 3IN5A 2IA0A 1P9QC 2W8KA 1KFDA 2HBYB 1IKVA 1LW0A 4LBPA 2CPXA 1HBOA 3QLHB 4DPTA 3MMJA 4U8YA 3GV7B 2UUCF 2JFDA 5JVHQ 2GQCA 4RW9A 5DGBA 1FD8A 4Y00A 3DOLB 2G1DA 1YRUA 3DNCA 3PKYA 3VQTA 5J1EB 3TRGA 6FDRA 3R8YA 1K47A 2RAQA 2QA2A 3QAUA 3LWLA 1VBZA 1NSQA 1H0HB 2BOAA 5L9XA 2LXIA 5DM7Q 1FRLA 3SI8A 4AD6A 1JLGA 1TMMA 2KI2A 2B9EA 1JIHA 4J9PA 4UOGA 3EM1A 3Q24A 2MDAA 4X4VA 3W66A 1OMSA 4YB1P 1KQKA 2IM1A 3M2UA 4LSLA 3VAIA 1IM4A 2ROEA 5LMNJ 2B4PA 4TLRA 2VG7A 1EP4B 2WHOA 2XC9A 2RD5C 3CIZA 5GAGI 2Q6BA 2YPZA 2OTJS 2BBEA 1S5ZA 3JB9k 4DV4J 4EEYA 1D8YA 1R0AA 1TFYA 4UUWA 4CIOA 1R6VA 4ZCLA 3JSMB 2H9ZA 1X60A 1W7WA 3T41A 2XNQA 3GIIA 4WFBQ 4C8NA 1KNZA 4MK9A 4AXIA 5E2QA 3SXLA 4JI0J 3ZTRA 1N0UA 2XMWA 1T7PA 2NZCA 1TELA 3D4JA 2CQ3A 1JLBB 3V2UC 1WEYA 4ZDNA 3RAMA 2Y0SD 1GX6A 1HD1A 3K89A 2DGSA 2HG4A 2Z2MA 1NK0A 3IS9A 2VBYA 4EO6A 4LF9F 2UXDF 4A4JA 3WIUA 3C6TB 2KT2A 3MM8A 3MM9A 2W2NP 2LVWA 3PTWA 1SIZA 4LQ9A 4ER8A 2F40A 4LSZB 2F8MA 2MQOA 4KBIA 2BQ3A 2R2TA 2CJAA 1UW9A 3MR2A 1HR0F 3OL7A 1N6QB 1XR5A 3MUVP 5DZ6A 3QIDA 1YTYA 3A8EA 3T9ZA 5KFPA 4DPOA 1IKYB 4HI2A 1S6QA 4RR5A 1BWVA 1L3KA 4O4RA 4NYPA 3D7SB 3T5HA 3IBCB 2CZVC 2HRYA 4DCPB 1CVJA 2ABYA 2Q79A 3OXGA 2ZVSA 1SJ3P 1U1QA 3KUEA 1F5CA 3CJ4A 1XEZA 1N5YB 3OSPA 1XNQJ 1QAJA 3KUGA 4DPYA 2DGTA 1UPPA 1RT4B 4I7FB 2X7IA 3BGOP 4DR5J 1YBTA 3MEDB 4ILMA 1RWUA 2QYCA 3G6XA 5EN1A 3MCSA 2CIMA 1M5SA 3VAGA 1V5IB 1FRJA 3OFHA 2B5JA 4RW6A 3LAKA 4IFVB 3MAAA 3ITHB 4J9OA 2LQJA 3J81j 2AV5A 1RLDA 1DURA 3KNGA 2L3MA 5FDLA 5A6WA 5LMUF 1P9YA 5BYSA 1TVRB 1QJHA 1WF0A 2OFGX 3ZZUA 4EMDA 4USIA 2W9CB 4JI2F 2ZOMA 3T5JA 9RUBA 4LRFA 2MKYA 3BH7B 2FZKB 2XZTB 1ZS6A 4IDKA 3TR5A 1HHSA 1AA1B 3HPOA 4OYMA 4FF2A 1T9YA 4DR7F 1FK9B 3H4BA 2RRNA 3N6NA 4LF4J 3FEYB 4B3MJ 2EK1A 3HI9A 3IRXB 5KT3A 2NSBA 2HKEA 2XMAA 2XLIA 1IBLJ 4DI6A 2VA3A
chains in the Genus database with same CATH topology
1LWXA 3L7UA 1K44A 3FC9A 3VGTA 4UOGA 1NB2A 3EM1A 1BE4A 3VGUA 2HVEA 3MPDA 1NSPA 3BBFA 4DZ6A 3Q8UA 2HURA 3NGTA 3BH6B 2BX6A 3JS9A 1B4SA 1PKUA 1XQIA 4ANEA 1NUEA 3ZTPA 4UOHA 3VGSA 5C7PA 2ZUAA 3NGUA 1F3FA 1B99A 4EK2A 3B54A 2DY9A 1XIQA 2DXEA 3EVMA 3Q8VA 3FCVA 1MN7A 1HIYA 3Q83A 1MN9A 1NHKL 5BXIA 3VGVA 4ENOA 2B8QA 1S5ZA 3VVTA 3FBCA 3NGSA 4CP5A 3BBBA 2HVDA 1LEOA 1NPKA 2DXDA 1JXVA 3FCWA 1BHNA 1F6TA 1UCNA 3VVUA 3PJ9A 3FBEA 1WKKA 3PRVA 3Q8YA 2AZ3A 3ZTQA 3GPAA 1NDLA 1W7WA 1PAEX 3EVOA 3EE3A 3EJMA 1BUXA 4FKXA 1NDPA 2B8PA 3ENAA 3NGRA 4WBFA 4HR2A 1NDCA 3R9LA 4F4AA 1WKLA 3DKDA 3FKBA 3ETMA 3BH7B 2DYAA 4F36A 4S0MA 4UOFA 2DXFA 2AZ1A 1ZS6A 3Q89A 4KPCA 3FBFA 3ZTRA 4ANDA 1KDNA 5CAAA 1VYAA 3GP9A 5CABA 1NSKL 1NCLA 3ELHA 3WX8A 1S59A 1NSQA 4FKYA 1HHQA 3ZTSA 1WKJA 3Q86A 4ANCA 1NDKA 2CWKA 2BEFA 5IOLA 3EICA 3EMTA 2VU5A 4C6AA 4O0NA 3BBCA 3EVWA 3FBBA 4DUTA 1NLKL 1U8WA 1HLWA 2NCKL 3B6BA 1S57A 1EHWA 3ZTOA 4W98A 3DDIA 4DI6A 3G2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWX A;  3L7U A;  1K44 A;  3FC9 A;  3VGT A;  4UOG A;  1NB2 A;  3EM1 A;  1BE4 A;  3VGU A;  2HVE A;  3MPD A;  1NSP A;  3BBF A;  4DZ6 A;  3Q8U A;  2HUR A;  3NGT A;  3BH6 B;  2BX6 A;  3JS9 A;  1B4S A;  1PKU A;  1XQI A;  4ANE A;  1NUE A;  3ZTP A;  4UOH A;  3VGS A;  5C7P A;  2ZUA A;  3NGU A;  1F3F A;  1B99 A;  4EK2 A;  3B54 A;  2DY9 A;  1XIQ A;  2DXE A;  3EVM A;  3Q8V A;  3FCV A;  1MN7 A;  1HIY A;  3Q83 A;  1MN9 A;  1NHK L;  5BXI A;  3VGV A;  4ENO A;  2B8Q A;  1S5Z A;  3VVT A;  3FBC A;  3NGS A;  4CP5 A;  3BBB A;  2HVD A;  1LEO A;  1NPK A;  2DXD A;  1JXV A;  3FCW A;  1BHN A;  1F6T A;  1UCN A;  3VVU A;  3PJ9 A;  3FBE A;  1WKK A;  3PRV A;  3Q8Y A;  2AZ3 A;  3ZTQ A;  3GPA A;  1NDL A;  1W7W A;  1PAE X;  3EVO A;  3EE3 A;  3EJM A;  1BUX A;  4FKX A;  1NDP A;  2B8P A;  3ENA A;  3NGR A;  4WBF A;  4HR2 A;  1NDC A;  3R9L A;  4F4A A;  1WKL A;  3DKD A;  3FKB A;  3ETM A;  3BH7 B;  2DYA A;  4F36 A;  4S0M A;  4UOF A;  2DXF A;  2AZ1 A;  1ZS6 A;  3Q89 A;  4KPC A;  3FBF A;  3ZTR A;  4AND A;  1KDN A;  5CAA A;  1VYA A;  3GP9 A;  5CAB A;  1NSK L;  1NCL A;  3ELH A;  3WX8 A;  1S59 A;  1NSQ A;  4FKY A;  1HHQ A;  3ZTS A;  1WKJ A;  3Q86 A;  4ANC A;  1NDK A;  2CWK A;  2BEF A;  5IOL A;  3EIC A;  3EMT A;  2VU5 A;  4C6A A;  4O0N A;  3BBC A;  3EVW A;  3FBB A;  4DUT A;  1NLK L;  1U8W A;  1HLW A;  2NCK L;  3B6B A;  1S57 A;  1EHW A;  3ZTO A;  4W98 A;  3DDI A;  4DI6 A;  3G2X A; 
#chains in the Genus database with same CATH topology
 4PXD A;  3VGT A;  3AAW B;  1IBK F;  1WF2 A;  1HWU A;  1EET A;  2DHA A;  1WDD A;  2N3O A;  1SKU B;  3I4H X;  2MB0 B;  1PBA A;  4M5I A;  4C3L A;  1VLO A;  2EEY A;  4NI2 A;  2KZM A;  3Q2S C;  1S1U B;  4NLV A;  4ED4 A;  3SSS A;  1N33 F;  2IAJ B;  1K8A T;  1ZTW A;  2JLG A;  4OHX A;  1SL1 A;  4TNO A;  3GYN A;  1G4C A;  2V2K A;  4OLP A;  4DL7 A;  4F26 A;  3OVB A;  3AOD A;  2DNL A;  3AJ1 A;  3M8Q A;  4D3G A;  4CQ1 A;  1SUQ B;  1YX2 A;  1Q5Y A;  3CO0 P;  2NPI A;  4K5R A;  1GMW A;  2OTL S;  2V2Q A;  2G2Y A;  4NA1 A;  2ZD1 B;  3GYX B;  1WC3 A;  1JJH A;  1NJI T;  3BSN A;  4ED2 A;  1BQN A;  4ECR A;  1VQM S;  2R4F A;  1ZM2 A;  4LF1 A;  4A47 A;  5E3Q A;  2HFS A;  4B9V A;  5CYM A;  3RR7 A;  1TL5 A;  1QM9 A;  2EW9 A;  4WP8 A;  3LAM A;  3HFZ B;  5KG6 A;  4ZVO B;  2BKO A;  4ZLP A;  2ZH3 A;  3CVK A;  3A8K A;  2RML A;  5DRK A;  3ET6 A;  4NXN J;  4IG0 A;  1R0C B;  3MMA A;  2VV5 A;  4B08 A;  2HNZ B;  3FBC A;  3BPS P;  1U24 A;  2I5J B;  2E1P A;  4B9M A;  2AJ4 A;  3UD5 A;  1SQF A;  5EX0 A;  2UUB F;  2OO4 A;  4NCB A;  1FJG F;  1VI7 A;  3M8P B;  1GXT A;  2BAN B;  2ADC A;  1AFI A;  2GGP B;  4A48 A;  1RBL A;  5KFN A;  4QBU A;  5HL7 Q;  1KKH A;  2ZFH A;  4DR2 J;  4JI4 F;  1SIW B;  2F1F A;  3LP1 A;  2B3T B;  1RXO B;  2RU9 A;  1RTH A;  2HUR A;  1WG5 A;  3I82 A;  1MRO B;  2HHH F;  3OFG A;  5CHC B;  2RDJ A;  4QWE A;  4L3K A;  1Q7Y T;  2AJ0 A;  1C0T B;  5J2Q A;  1L5U A;  3M8Y A;  5BXI A;  1R6Y A;  2M0G B;  2RQC A;  4AFF A;  1XMQ J;  2PEH A;  5KG5 A;  2PSZ A;  2FTR A;  4FXD A;  1NZ8 A;  3I55 S;  5ITH A;  4K50 A;  4P2S A;  3UFC X;  4LFA J;  5ETQ A;  1HBN B;  1Z4U A;  2E66 A;  3KLG A;  3FSY A;  4RNM A;  2YKP A;  1H7X A;  3QRQ A;  1RAB B;  2BJ8 A;  5D4N A;  4K5S A;  1JWW A;  4DPW A;  4ZHR B;  2VDI A;  4DBQ A;  4KH1 B;  2Y9H A;  3QT6 A;  2MSS A;  5DDQ C;  3R3T A;  4L73 A;  3OHB A;  4TY8 B;  1OPZ A;  4LFC F;  3EMT A;  4FBT A;  2W9B B;  2RQ4 A;  1KVJ A;  1J5E J;  3QJL A;  3ETO A;  4DV7 F;  2GC8 A;  2U1A A;  2APO A;  1C0U B;  3R1H A;  1GH8 A;  3MM5 A;  1SH2 A;  4PG8 A;  4OX7 A;  1WEZ A;  4NCG A;  4X4O A;  5HVH A;  5BR8 J;  3H5X A;  4KR0 B;  4DCJ B;  3PXG a;  3S7R A;  4BCA A;  1S6P B;  2D74 B;  2P6T A;  3UW1 A;  3H5S A;  3R5J B;  3GFH A;  1R31 A;  4CO0 A;  2V6A A;  1JMT A;  4RUB A;  2JWN A;  2OEM A;  2CPE A;  1WC0 A;  3KJV B;  1KTQ A;  3AB2 B;  1OY8 A;  1RT7 A;  3NL0 A;  3UN5 A;  3N79 A;  3OR2 B;  2A0F B;  1MU2 A;  3CD7 A;  1U2F A;  3K5L A;  3M32 A;  3KK3 A;  3TAM A;  3GP9 A;  4CNZ A;  1DTQ B;  3OUY B;  2R9L A;  2DRA A;  2ZDP A;  3NNH A;  4OI6 A;  2ZZN A;  4X64 F;  1P1L A;  4U96 A;  4CZC A;  4M5N A;  3CJ5 A;  1LQ9 A;  2NUU G;  4E8U A;  2V67 A;  1LWE B;  2KHD A;  2W4C A;  4X65 J;  1FD2 A;  1BE4 A;  2A10 A;  3E2E A;  2FHM A;  2ATC B;  4OJH A;  2J8A A;  1S49 A;  2DGX A;  5KFX A;  3HVR A;  1HQE B;  4A46 A;  1PBU A;  2MKI A;  1F9F A;  1WC5 A;  4KKO B;  2I8E A;  2BJ1 A;  4YS2 A;  1NXI A;  5CA5 A;  3KWM A;  1BHN A;  4LRD A;  2VJV A;  2MZR A;  4ZCM A;  5LXY A;  2NXJ A;  3BO2 A;  3BDE A;  5HP1 A;  4WKR A;  1H7W A;  2MXY A;  3PVX A;  2IA6 A;  1F5A A;  2ACY A;  4CM2 A;  2V50 A;  3W9I A;  2KJV A;  2DR5 A;  5C5J A;  4LF5 F;  4P72 A;  4X84 A;  1RWO B;  2JEG A;  2YVS A;  4WTY A;  2QV6 A;  2G4B A;  1DZ5 A;  4OZ1 A;  4RU2 A;  4PQA A;  1AUS L;  1VS3 A;  3OLA A;  1I51 B;  3CJQ A;  3H20 A;  3W5Z A;  3CDU A;  1EJ7 L;  3P5T L;  5K14 B;  1S1V A;  2RUG A;  5B0A A;  1REG X;  2AU0 A;  1SH3 A;  2W2O P;  5A8K A;  2BM0 A;  1GNK A;  5HBM A;  4YR3 A;  1XIQ A;  1RIS A;  1W26 A;  1WI8 A;  3MZI A;  3P49 B;  5JXS A;  1EKS A;  3T6J A;  2H3E B;  4H4K A;  1TKX B;  1S0N A;  2HVH A;  2HQ3 A;  4L72 B;  4JI1 F;  2HHW A;  2FGO A;  4M63 A;  3QFH A;  3W1Y C;  4OX9 F;  1F6T A;  4KHR A;  1LV5 A;  1FES A;  4JI3 J;  4QR1 A;  4NLT A;  1WC1 A;  2DO4 A;  1YRT A;  3ZFV A;  2BKN A;  3ZNU A;  1NK5 A;  2EPI A;  1VC6 A;  4OYZ A;  3OFF A;  4DN0 A;  3K58 A;  1EAR A;  3IM9 A;  4L3N A;  2MKH A;  1VYA A;  2CPI A;  2HWT A;  4U6P A;  3DC2 A;  4WP9 A;  5DQI A;  2V4Q A;  1TL7 A;  1ZH5 A;  4MKA A;  3KYL A;  5J2M A;  1T0T V;  5HVF A;  4B9S A;  3MEG B;  2PFF B;  2QLX A;  4P9S A;  3IC1 A;  1TFW A;  1FWP A;  5H9E K;  1KQS R;  4PRF A;  1NU4 A;  4DR4 J;  4O3O A;  1YDL A;  1DY3 A;  3FGV A;  2M9K A;  1HYS A;  1NHV A;  5IV3 A;  2CAD A;  5ETM A;  1TV6 A;  4ZJO A;  4C98 A;  5D3G B;  2FY8 A;  4FF3 A;  1L3S A;  3L9Z A;  4UST A;  3O3L A;  1HI0 P;  6AT1 B;  4NLU A;  5M2U A;  4K4W A;  4MKV A;  2VQF J;  2A6M A;  3I5A A;  3J7Z 5;  2HGL A;  4IOA Q;  1SPB P;  3G82 B;  3D54 A;  1TL1 B;  3R7S B;  3QO9 A;  4DF4 A;  1UET A;  3QPI A;  2VG5 B;  4LT6 A;  3BQ2 A;  2HQC A;  2CPY A;  1RTD B;  1S9E A;  2E7V A;  1XC9 A;  2I38 A;  4G1Q B;  5DG8 A;  4UUX A;  4YN3 B;  3BJY A;  4DWI A;  3H90 A;  4IG3 A;  3V5R A;  1SC6 A;  1WKJ A;  4NLR A;  2BOP A;  5B0E A;  2QA4 G;  4UY8 T;  2ZEJ A;  5EWE A;  4NLO A;  3SYZ A;  3TA0 A;  3CJT A;  2LMI A;  3G86 A;  4YFU A;  3HK2 A;  3BBC A;  2N4C A;  1R3N A;  1ZPV A;  3W64 A;  2MKS A;  3G4S S;  3BN7 A;  2B6A B;  4O4G A;  4CO1 A;  2YWE A;  2QC3 A;  2XLJ A;  4HDH A;  4ECX A;  3C14 A;  2FLN A;  5LSR A;  5AXL A;  3DRP A;  5A8R A;  3BV8 A;  1IJE B;  4OLO A;  3EX7 B;  4P7V A;  1QE1 A;  1VC5 A;  4PPZ A;  1B3T A;  5GMK a;  4BHQ A;  3GJT B;  2O67 A;  1NB7 A;  2MZ1 A;  3KLV A;  1T05 B;  1WDT A;  4O44 B;  1O6X A;  1FFW B;  3H2V E;  1UWB B;  4MJK A;  2MGZ A;  2XGP A;  3EPI A;  1FJ7 A;  2B8P A;  2VUG A;  4DU8 A;  2VF3 A;  4K0K F;  3FKB A;  3Q89 A;  1FT8 A;  1LWC B;  2AJF E;  2W25 A;  1RP5 A;  4ZVQ B;  3JXO A;  4DU7 A;  1JLE A;  3A3N B;  4WK1 A;  1RWN B;  4PWD B;  3MR6 A;  4LFB J;  2Y3Y A;  3ZZY A;  3NP5 A;  2OPS B;  2WON A;  2ADB A;  2EFG A;  2G0J A;  1PAU B;  4JI8 F;  5K20 B;  1T03 B;  2NYH A;  2AQ4 A;  3FDS A;  3VTI A;  2ZH5 A;  2WBR A;  1BMQ B;  2YNG B;  1XBW A;  3U02 A;  4Y28 C;  5FJ4 A;  3PV8 A;  2E5I A;  4PCQ A;  4Y65 A;  1SB6 A;  2KFZ A;  1TAQ A;  4LQ3 A;  1S12 A;  5E0O A;  1U48 A;  3CF5 Q;  4DSI A;  1JNR B;  2YTC A;  1S72 S;  2DIS A;  2HLT A;  4RW4 B;  4ID5 B;  5B09 A;  3V81 B;  4OYP A;  3HJF A;  1TKZ A;  4ZIW A;  3W3S A;  1RTJ A;  2XSJ A;  4NAS A;  3G96 A;  4P2X A;  7AT1 B;  1SV5 A;  3DI6 B;  5IWA J;  1U6Z A;  5HI7 A;  3CCV S;  3Q23 A;  3J80 U;  2WTF A;  1ZA2 B;  3E01 B;  2Y1L B;  4IO1 A;  4ETZ A;  1T9T A;  3DLK A;  4LRC A;  3ILL A;  2ZUG A;  4HKQ A;  5EX3 A;  5SZT A;  1M5O C;  4OYA A;  2EXU A;  3R2D J;  1RHK B;  2HS3 A;  3JTN A;  3Q8U A;  4OYB A;  2HHS A;  3J7A N;  4ED1 A;  1U0S A;  1N0V C;  2XS7 A;  1D3W A;  2OIH A;  1WSR A;  2XB2 D;  3C6U A;  4RNO A;  4HLB A;  4LF9 J;  3W60 A;  1T9U A;  3BDP A;  1CQM A;  1SJQ A;  1VBX A;  5F0W A;  4WFA Q;  3M9O B;  1K1S A;  2V8D A;  4W90 B;  2DNO A;  4CP5 A;  1WEL A;  4I67 A;  2YKM A;  3BSO A;  4F02 A;  1PIL A;  5A8W B;  3PNI A;  3AA9 A;  1Q5V A;  1HR0 J;  5KFC A;  1VRU B;  2HAI A;  1BUX A;  4UZC A;  1X4B A;  1RBO B;  3L7P A;  2ROG A;  2HWH A;  2PI5 A;  1VMB A;  3MAH A;  2Z8Q A;  4DL0 C;  2O1P A;  2Z58 B;  1SI9 A;  2NYI A;  2ALY B;  1OIA A;  3SFG A;  4BC9 A;  1HBU A;  1XR6 A;  2XY5 A;  1DLO B;  2LQ5 A;  1OJ4 A;  2K1R B;  2RDD A;  1VC0 A;  3DHX A;  3LQV A;  3CDA A;  2EFQ A;  1FKO A;  1ZZF A;  2GAG C;  4JP8 A;  1QUV A;  2RUS A;  4WTO B;  2AX0 A;  2CQI A;  1UVJ A;  1FO1 A;  3HHN B;  1X8D A;  4DR6 F;  2POK A;  1B4S A;  2QE5 A;  4G65 A;  3RGI A;  5IQQ A;  4LF6 J;  2MKJ A;  1N5T A;  2CXE A;  2LU2 A;  4TU7 A;  1R8P A;  2VHG A;  3QLH A;  4QWA A;  1RAE B;  4J90 A;  2UVR A;  1PJ5 A;  2PA8 D;  2ZBR A;  5HMZ A;  3DOL A;  2HS4 A;  3B4M A;  5KFH A;  4DR3 F;  4B3O B;  3QIP B;  2UXB F;  3KJF B;  2CVE A;  3TEG A;  3K8W A;  4NWB A;  4K4T A;  2YWK A;  2ZOG A;  3SCJ E;  5LMU J;  1O51 A;  2BAC A;  4NRU A;  1BQX A;  1MML A;  4S0M A;  4QOT A;  5CYJ A;  1FJC A;  4JI2 J;  4UQG A;  1YGY A;  1HWK A;  1RU2 A;  5HO4 A;  2XHW A;  3FRY A;  3PW2 A;  5GAE I;  2ASD A;  5E3R A;  4OV6 A;  4QZV B;  3CC4 S;  3R1L A;  5K8P A;  3CE8 A;  2UVW A;  4DJB A;  2ASY A;  3DOM B;  3QT5 A;  2NQP A;  5B08 A;  1EP4 A;  1EX8 A;  4U7U D;  1R0B G;  3RB0 A;  2Y8W A;  4CLT A;  1XQI A;  2P9C A;  3C2P A;  2ZC3 A;  3RTV A;  2LA4 A;  4K7Q A;  2ZBQ A;  4J37 A;  1MSW D;  4J9K A;  4OZJ A;  2FHK A;  3MOJ B;  3TX0 A;  3PFO A;  5LJ5 Y;  3P4U B;  3JSM A;  5GAD U;  5D78 A;  2MPU A;  2MQ8 A;  4DX5 A;  2E9R X;  2QL9 B;  2FLL A;  4NLD A;  2QSW A;  5H9F J;  3SCI E;  4PXC A;  3G87 A;  1FXL A;  4B3R F;  3EGN A;  1YKW A;  2IM0 A;  3MM6 B;  3J7Z T;  1HQ2 A;  3CJ2 A;  3ENA A;  2V68 A;  4HR2 A;  5E33 A;  4M5H A;  1NDC A;  4FP9 A;  5CZX A;  1U45 A;  2JDJ A;  4RKU C;  1GXL A;  2YH1 A;  1U2C A;  2YQ1 A;  4FVC A;  4OV1 A;  5AXM A;  2V8P A;  4D3H A;  2K2P A;  2NRE A;  4JYA J;  2YKN B;  2DNR A;  4RO0 A;  1DBD A;  1HLW A;  3HJV A;  1AZS B;  4YOE A;  4B9T A;  3C6T A;  3THT A;  4G3I A;  2BJ7 A;  3S01 A;  2YNF B;  3QRR A;  2OPQ A;  2LKZ A;  1CUL A;  2E44 A;  2VPX B;  3H98 A;  2HFN A;  3A12 A;  4Z37 A;  5IXU A;  2LXF A;  4EK2 A;  4Y2C A;  2Q3P A;  4GKK F;  3CMQ A;  4DQR A;  4CWB A;  5ETR A;  1N6Q A;  3PYG A;  1KEK A;  4ZOS A;  2AGQ A;  3RR8 A;  3R5D A;  3FMB A;  1IKY A;  2F9D A;  3DLB A;  2YNH B;  3N01 A;  3DGP B;  1HNI B;  4CLU A;  4K59 A;  2B43 A;  6FD1 A;  3D68 A;  4DV0 F;  5JMN A;  1X4H A;  2RJZ A;  3HVT A;  4PG5 A;  1JLQ B;  4F8R A;  3H40 A;  2UUB J;  4NZ7 A;  3LP2 B;  2GMH A;  4YDX A;  5DG9 A;  2UZA A;  4Z7C A;  1G3O A;  1LK5 A;  1N5Y A;  1FJG J;  2DPI A;  2J9D A;  4K4X A;  1MWQ A;  4I7F A;  4TQR A;  3K2Y A;  3AB4 B;  1RAH B;  3MED A;  3ZZP A;  2H1Y A;  3BM7 A;  3NRB A;  5HAO A;  3RB4 A;  2Z2Z A;  4M5D B;  3RB3 A;  2R7R A;  2C3M A;  1ZOT A;  4URG A;  4EYH B;  3W2W B;  2C28 A;  4C4W A;  2Z2Y B;  2OSR A;  4JI4 J;  4H4O A;  1RWK B;  4ZN3 A;  3ITH A;  1P8G A;  2OPP A;  2KT3 A;  3VAH A;  1SH0 A;  4ZVF A;  2HHH J;  3CD6 S;  3LO3 A;  4O3R A;  4RLE A;  1Y00 A;  1TVR A;  4ENO A;  4HH1 A;  4W4M A;  3PKM A;  4V19 X;  2AP6 A;  2QSF A;  2ZBP A;  3AH6 A;  8ATC B;  3PZP A;  3CCL S;  1LWF A;  2DT9 A;  4TVA B;  4ELT A;  4CNY A;  4OZ3 A;  5LJ3 Y;  3IRX A;  2XMT A;  2KDO A;  3B78 A;  2GQ2 A;  2ZWO A;  1FEH A;  1VQ8 S;  4CH7 A;  1K1Q A;  5CAB A;  2UV8 G;  1HHQ A;  2FC9 A;  4ECU A;  2AX1 A;  4USW A;  2CNO B;  4QW9 A;  2DK2 A;  3RYL A;  3VAM A;  5LSO A;  1WOR A;  2VZ9 A;  2YKQ A;  5T7L B;  2J5A A;  5IT9 U;  4U67 Q;  4R0E A;  3DHW C;  4A8M P;  5HAN A;  2GJF A;  1TUV A;  4Q43 A;  3JQK A;  4RPF A;  1R8B A;  3EPG A;  2IAJ A;  3VGS A;  5F8M A;  1VQL S;  2LDY A;  1YJW S;  4DF8 A;  3PDN A;  3KKF A;  2G13 A;  3TX8 A;  3OFE A;  1FXD A;  1KOO A;  1RT2 B;  4KHP F;  1HA1 A;  2WVF A;  4IFY B;  3FBE A;  1SUQ A;  3SIP B;  1GFW B;  2J6T A;  5D4P A;  1VR6 A;  2NXN A;  2CVI A;  4F4A A;  1URN A;  3TA2 A;  3M9M B;  2ZD1 A;  1UEU A;  2WK4 A;  3R6L B;  3JSB A;  1IQT A;  1R89 A;  1VRQ C;  5AE1 A;  1VQN S;  1SBR A;  1CLF A;  1U1L A;  1E6Y B;  2DR8 A;  4KHM A;  4K4U A;  3J80 Y;  3PX6 A;  1WHV A;  2DH8 A;  3PHE A;  4CYU B;  2QFJ A;  5LL6 d;  4X64 J;  3GLJ A;  3V4I A;  1KRP A;  3TO8 A;  1Z2L A;  2NS1 B;  4HVZ A;  4JI6 F;  1F60 B;  4CLZ A;  1PC4 A;  1WOP A;  4YHH F;  1WNE A;  2WSE C;  1P1T A;  4ECT A;  4WE1 A;  2V8V A;  4GKJ F;  1RSC A;  2I5J A;  4XPE A;  2COL A;  2ZM6 J;  3WDO A;  2K3I A;  3NNA A;  1ZM9 A;  4YY3 J;  3UN2 A;  2HYI B;  4GMK A;  4PUO B;  3Q8Y A;  3M8P A;  1CPZ A;  2BAN A;  2HEK A;  1SJ4 P;  1KN6 A;  1PO6 A;  3QNW B;  4H54 A;  2DGW A;  1MWZ A;  1TMJ A;  4RW7 B;  3TYT A;  3LWM A;  4FN5 A;  4ED5 A;  4HHJ A;  3TVK A;  4Q0B B;  4QIF A;  2PN6 A;  2ZH2 A;  4C11 B;  1GXU A;  3EZ5 A;  1J5O B;  2C3U A;  2EFN A;  3DOK B;  1UEV A;  4LF5 J;  4TLQ A;  1NH8 A;  4X2B A;  4I6Y A;  1MRO A;  2BE2 B;  4BLG A;  5ETP A;  2GHW A;  3KOA A;  2Q1L A;  1D1U A;  1UFK A;  3O8W A;  1TL3 A;  1YZ7 A;  3CMA S;  2QMX A;  1C0T A;  3HMJ G;  1AW0 A;  2RF2 B;  3THV A;  2AJQ A;  4HL9 A;  1REV A;  1X5O A;  2UU9 F;  2MEW A;  2V2V A;  2HQD A;  1FKA F;  2PMZ D;  1UFW A;  2HVI A;  1HWJ A;  2WZ1 A;  3QT7 A;  4ZPV R;  1HBN A;  4MT1 A;  1VQK S;  3KK2 B;  2MQQ A;  1X4E A;  1RYS A;  3F44 A;  4JI1 J;  1KTV A;  2X3G A;  2W24 A;  1M1G A;  3D1O A;  1Y5L B;  2FGC A;  5KFB A;  4ZHR A;  1D0E A;  3SDE A;  3C66 A;  4JV5 F;  4QU6 A;  3R6G B;  4TY8 A;  1M1K T;  2AZ1 A;  2XO6 A;  2K7J A;  3FFI B;  4CH1 A;  3BN4 A;  1Y5I B;  4Y2I A;  2W9B A;  2D41 A;  1H72 C;  4CI0 B;  2WVD A;  3Q8R B;  3VWS A;  4CO4 A;  5AJ3 J;  1VHF A;  1U6B A;  4MYT A;  1W2B R;  2FVQ A;  1C0U A;  1JLF B;  3PEJ A;  3ENV A;  3VF0 B;  2HQI A;  2CKW A;  3IWX A;  2XYP B;  3MEC B;  5F8N A;  2CQD A;  3G6V A;  1RAC B;  2AEM A;  2E5L J;  1XNR F;  3D6T B;  1S6P A;  3NLC A;  4DX7 A;  1XMB A;  4O0I A;  4IRD A;  2JEJ A;  1PSD A;  5DDR C;  1SJF A;  3H7H B;  4LF8 F;  3J7Y U;  4I64 A;  3KHL A;  3IR6 B;  4AL7 A;  1GK8 A;  3HHL D;  1VDH A;  4E2F B;  2D3U A;  2QL5 B;  3OR2 A;  1U26 A;  1V3Z A;  3H5Y A;  2J0Q D;  3W65 A;  1X0P A;  3H59 A;  3LP0 A;  1DTQ A;  3OUY A;  4TKT A;  3HLU A;  4CTA B;  2XY6 A;  2ZWP A;  4MK8 A;  3BYR A;  3QAT A;  3CCU S;  2E1A A;  3SCK E;  1YQH A;  3DLG B;  4DV2 J;  2HMI B;  4RNH A;  2V0N A;  1U4B A;  5C2C A;  2H51 B;  3JTO A;  4IO9 Q;  4IRC A;  3DDI A;  3SSR A;  3PHT A;  5DQG A;  2FJW A;  3FC9 A;  3MOZ A;  4WKY A;  4ID8 A;  2RKI B;  4YME A;  1HQE A;  2HND B;  2P8I A;  1I3O B;  5EWG A;  3IG1 A;  4KKO A;  2FHJ D;  2FJB B;  2XSF A;  5ETS A;  2CG4 A;  1RT1 A;  1QVF R;  3EGW B;  1VQP S;  2HFZ A;  1CS4 B;  4WXO A;  2XI2 A;  4DV6 F;  2R2U A;  2J7W A;  3QT8 A;  4DPX A;  1FE0 A;  4Q45 A;  4PKD B;  2VON A;  1Q0N A;  4K4S A;  4X4T A;  2LQ9 A;  3M4X A;  2HGM A;  3KLI B;  2JHE A;  1KD1 T;  4K4Z A;  2VA2 A;  1BD6 A;  3NAH A;  5KOX A;  2BDP A;  2KO1 A;  2BYC A;  3VZH A;  4F36 A;  1KC8 T;  4PEO A;  4HYK A;  2X1F A;  2NPF A;  1FTC A;  2HRU A;  4K0K J;  4RBU A;  3O5T B;  4ZK7 M;  3EUN A;  2KXH A;  2CPZ A;  1RHM B;  2FLO A;  4OX8 A;  3J81 Y;  4G1I A;  1RTZ A;  1S1T B;  5F8I A;  2J0X A;  1EAY C;  1KQF B;  1PC5 A;  3MUR P;  3HHD A;  4B9L A;  3C3L A;  2A1B A;  1HPZ A;  3T1H F;  3ENQ A;  3A13 A;  2FY1 A;  1HNW F;  1TKX A;  5F0U A;  4JI8 J;  1KLN A;  3LAN A;  4NML A;  1WHW A;  1N34 F;  3AOC A;  3HX9 A;  1MN9 A;  1L3V A;  3ZZO A;  5E41 A;  2E5J A;  3BGR B;  5EDW A;  4USU A;  1FRI A;  2OGU A;  1DHM A;  2HHQ A;  4ZKA A;  2YBV A;  1I5O B;  2KRR A;  1H2V Z;  2FPH X;  3VCD A;  1BGX T;  3AFG A;  5D15 A;  3NKY A;  4OHY A;  3PRB A;  3MTK A;  3CGI A;  1T95 A;  1NDP A;  3JAM U;  1X9S A;  3UR3 C;  2XGQ A;  3T5K A;  2V5H G;  3UI3 A;  2KHC A;  2AYB A;  2WW8 A;  3DCA A;  1HNZ J;  3L7O A;  5D4L A;  3OR1 B;  3W5Y A;  3R7B B;  5L46 A;  3MEG A;  4DL2 A;  1RDR A;  1LW0 B;  1R8H A;  1Q81 T;  3KK1 B;  1NM2 A;  4DUT A;  1HQU B;  5IT9 Y;  3GCW P;  4TY9 A;  4U9R A;  1RI7 A;  3CUN A;  1UW4 A;  5GAH U;  5D3G A;  4J7C A;  2BX6 A;  2LEA A;  4K4V A;  3M30 B;  2ZH1 A;  2M5Y A;  4DL6 A;  4DUZ F;  4HT5 A;  2F8H A;  1HIY A;  3G82 A;  1NBE B;  3UCG A;  2VG5 A;  3MWB A;  2CQ4 A;  1RTD A;  1T9V A;  2M8H A;  5BYR A;  4G1Q A;  4P10 A;  3DM2 B;  2CJY B;  4NE9 C;  4ED3 A;  2V4J B;  4NYZ A;  2M4M A;  1N32 J;  3CME S;  4A8X A;  2XM3 A;  4ZIV A;  1FHT A;  4QPT A;  1ELO A;  3OLB A;  4P2F A;  1B70 B;  4ZP7 A;  4EBE A;  4IRK A;  1SKW A;  3TA1 A;  3WX8 A;  4AQY J;  5ETK A;  2WB4 A;  1TZ0 A;  4F3M A;  1VIS A;  3LPY A;  1R0A B;  1VBK A;  1WI6 A;  3AD7 C;  2HWI A;  4LJM A;  3H25 A;  5DLG A;  2QEX S;  2Z30 B;  2VD3 A;  2C3Y A;  3ISN D;  1NEE A;  1ITP A;  3NGT A;  1PKU A;  4C2M A;  3ZTP A;  5CYQ B;  2XBP A;  1QSY A;  1RWW B;  1I94 F;  1AUD A;  4DSJ A;  4DR6 J;  4QW8 A;  1V5V A;  1NZA A;  4WXW A;  4OYX A;  5C24 A;  1T05 A;  2PI4 A;  3MCN A;  4X66 F;  2B7B B;  2XMU A;  1UWB A;  3VQS A;  1RZM A;  3LUY A;  2F65 A;  3JQM A;  3ZC4 A;  3IS9 B;  4NA2 A;  4L76 A;  1LWC A;  3C15 B;  3MDF A;  1TTH B;  1M5P C;  1QUP A;  2VDH A;  3D0G E;  4DL5 A;  3NGK A;  3D28 A;  1UVN A;  1FVS A;  2DGQ A;  3MM8 B;  1SC4 B;  3MM9 B;  2DYA A;  4WIQ A;  4DV5 F;  5CCL A;  2UUT A;  2C2O B;  5HJY A;  2OPS A;  5GAG U;  3W8G A;  4M5J A;  3H42 A;  4XTT A;  3PIO Q;  3ZXW A;  1FTR A;  3KLE A;  3RW7 A;  1VIX A;  1FDD A;  1UJ4 A;  4QYZ K;  2OD4 A;  3BEG B;  5HQM A;  2NCK L;  3IWN C;  1RE1 B;  4ATN A;  1NJY A;  2YNG A;  2KN4 A;  1S6U A;  2DNH A;  1UEK A;  3K57 A;  3RBX A;  4WPA A;  2ZKT A;  5KG1 A;  4TYB A;  3I32 A;  2IBK A;  4YDD B;  4CT8 A;  2CJX B;  2GML A;  2G1H A;  3M2R B;  3MMC A;  4LUB A;  2IVF B;  4ID5 A;  2GS8 A;  2IJF A;  4F2S A;  3PW4 A;  4P52 A;  3G8T A;  1R8A A;  3NEK A;  4YP3 A;  1F1B B;  2LDI A;  2FIU A;  2W7P A;  3CJ3 A;  3DXB A;  5HMY A;  4PPD A;  1RT5 A;  3DI6 A;  2QT7 A;  2F4F A;  3MAA B;  5E3P A;  1PCA A;  4CLF A;  5C25 B;  5BJR A;  2CWK A;  2DHX A;  1B0T A;  1LW2 A;  4RX6 A;  1OY9 A;  1EHW A;  3FEX B;  2CJ9 A;  2E9Z A;  1TKT A;  2HQF A;  5HMW A;  2VC0 A;  1GQE A;  2HSE B;  1JJ4 A;  1U1P A;  1SQE A;  4UOH A;  1X0F A;  2BRL A;  3B54 A;  2KVI A;  2E5G A;  4X4Q A;  5A8W A;  3HHL C;  5IT0 A;  5LMN F;  3HUL A;  1NHK L;  4KQZ A;  2MYF A;  2OEJ A;  3ONQ A;  3FCW A;  4MK7 A;  1QSL A;  3C8Y A;  1FNM A;  3WBZ A;  3NMR A;  2WRM A;  3POT A;  2BW7 A;  3ZTQ A;  4RWW A;  3CCQ S;  1DLO A;  1RUS A;  5CD4 H;  2OAU A;  4I69 A;  4P73 A;  4AND A;  2BR0 A;  1OSC A;  2FC8 A;  2XZD B;  3IO1 A;  3EGV A;  7FD1 A;  1IKX B;  4NOH A;  2DO0 A;  1UPM B;  4F2R A;  2VBW A;  2RRB A;  5LT5 A;  1P6T A;  2BKP A;  4W98 A;  4LBI A;  4IH7 A;  3KHH A;  1LWX A;  2JC1 A;  3M8Q B;  4CLP A;  3FUY A;  5FLX U;  2R8J A;  2CQ0 A;  3NGD A;  1BQM B;  4M95 A;  1RHR B;  3D1H A;  5B0D A;  5C7P A;  3NGU A;  4DCO B;  5KFJ A;  4LR7 A;  2ZIT A;  4WK3 A;  4B3O A;  2DXE A;  3QIP A;  2EK6 A;  2MMY A;  1U47 A;  2NR0 A;  2W4P A;  4ECQ A;  3DGV A;  3BO4 A;  5CZV A;  3LA0 A;  2OJ3 A;  2JLE A;  4DDF A;  3QSY B;  2GHV C;  3N5F A;  4DV1 J;  4EZ6 A;  1U8S A;  4E98 A;  1VRT B;  1UWA A;  4LIW A;  3T5L A;  3OTO J;  4WBF A;  4I0W A;  1HWI A;  1RYR A;  1S1X A;  3CNQ P;  1RHJ B;  4IG0 B;  1E6V B;  2HHU A;  5K9F A;  4QIW D;  4WII A;  3PR5 B;  2DNQ A;  3AQO A;  1NRK A;  3DOM A;  4MKB A;  1FER A;  3T6B A;  2GVD B;  4URQ U;  2DTJ A;  3OD2 A;  1XJW B;  3P45 B;  2YX7 A;  1QSS A;  2QA1 A;  1JX4 A;  2AD9 A;  1S0O A;  4X62 F;  5I3U A;  1H98 A;  2LLZ A;  3DLJ A;  3ZZR A;  3US5 A;  3LGN A;  1XNQ F;  2UV8 A;  3DRR B;  2P9G A;  1Y0H A;  4DR5 F;  1IWG A;  2DNK A;  1KP6 A;  2Z4P A;  3DMJ B;  2W2Q P;  3AJ2 A;  1CJT B;  2N3L A;  3F41 A;  4TXS A;  4DV3 F;  3HFV A;  2J9E A;  3HXM A;  5KFL A;  3I9Z A;  3LP1 B;  2WOM A;  1CSJ A;  2N4D A;  1C4C A;  1RTH B;  2VAS A;  2VIH A;  4KHP J;  3JAM Y;  4JV0 A;  2YKN A;  2K7K A;  5J2Q B;  5KFM A;  1KSP A;  1SKR A;  1AZS A;  4TN2 A;  2H5E A;  5JUM A;  3SMZ A;  2QJ3 A;  2YNF A;  2IDL A;  3AD9 C;  5IQ6 A;  4U95 A;  4CT9 A;  3NCP A;  4TYA A;  3CDW A;  1NH7 A;  4B3M F;  3JYT B;  3VGU A;  4GVB A;  4CH0 S;  5KG7 A;  2J0S D;  4ZLJ A;  1YHQ S;  2KH9 A;  3JS9 A;  1VQO S;  1OYE A;  4CO3 A;  2ERR A;  4JI6 J;  1N5V A;  4AYB D;  1IM6 A;  2JX2 A;  2AWZ A;  2YNH A;  1C4A A;  3DGP A;  3FCH A;  3IFE A;  1HNI A;  5KG3 A;  5DGA A;  1NND A;  5KFW A;  4GKJ J;  4ZVH A;  3T3F A;  5AT1 B;  1S0M A;  3I0R B;  2OEK A;  3RRK A;  1FCA A;  1WF1 A;  4UF4 A;  4LF7 F;  2WCX A;  3TZX A;  2V34 A;  4C7Q A;  1J2V A;  4LBH A;  3MM5 B;  3DYA B;  3I0S B;  2DHG A;  2Y8Y A;  3LP2 A;  2WBM A;  1IR0 A;  5B0C A;  4YB6 A;  5DG7 A;  5IS2 A;  2L9D A;  2QN6 B;  2VFU A;  4M1K A;  2C3P A;  4FF1 A;  3UWT A;  4M5D A;  4CLS A;  2R8G A;  1UMJ A;  4EBD A;  1XN9 A;  2RH3 A;  2GO8 A;  2F8E X;  4LIR A;  1KBR A;  3FBB A;  1U8W A;  4UQT A;  2E1R A;  4FPR A;  5KT5 A;  1IQZ A;  1RT7 B;  3ISN C;  1LFW A;  2OSQ A;  1FDA A;  3QJJ A;  3H2U B;  3T1Y F;  1PIE A;  5KT4 A;  4DZ6 A;  5ETT A;  2XMM A;  3M32 B;  3M6W A;  3MEE B;  3KK3 B;  3TAM B;  3AQP A;  4L75 A;  2XYH B;  4ERD A;  2XTJ P;  4DR1 J;  4F4Z A;  1X4D A;  5J1P A;  1C1C A;  5T41 A;  2LQ8 A;  3RRG A;  2L48 A;  2MZS A;  3RZA A;  3W8P A;  3UDV A;  3KDN A;  2UU9 J;  1QTM A;  4FXV A;  4KB7 A;  2R3V A;  2GVZ A;  4NXN F;  2K8G A;  1V6H A;  3RAQ A;  4IOB A;  3TJA A;  2C2D A;  2GV1 A;  4DN9 A;  1WEX A;  4C8L A;  4A8W A;  3TUJ C;  3R5C A;  2WVE A;  5DQH A;  1VFJ A;  3O2I A;  4NLS A;  2VPZ B;  5IT4 A;  1QY7 A;  5H9E J;  2JRS A;  3CCJ S;  4LF2 A;  3TZY A;  4PG6 A;  2HVZ A;  2VG6 A;  1NDK A;  4Y6I A;  1CJU A;  3LH2 S;  1Q86 T;  4OI3 A;  2VKR A;  5IOL A;  1OS5 A;  4G6V B;  2CNL B;  3N4W A;  3BPD A;  3Q8S B;  4KGX B;  1RWV B;  1ZA1 B;  2R7T A;  4A8O A;  1EZZ B;  2Y1J A;  1FI4 A;  3DU6 A;  4HTJ A;  2HVE A;  1A6L A;  2IPO B;  4PG4 A;  2DIT A;  2YWG A;  3IBW A;  1X31 C;  3PY8 A;  1ZZN A;  2B4U A;  2FJV A;  2R8K A;  2C3O A;  3IRW P;  1KHW A;  2P2C B;  3PJW A;  3PM9 A;  1MWY A;  1RT2 A;  3MFH A;  3CW2 C;  3OTE A;  2YWH A;  4UY8 5;  3MTJ A;  2UUW A;  2M8D B;  2DGU A;  1NPK A;  1KS2 A;  3I9V 9;  4J5O A;  4LF8 J;  3LOU A;  1MLA A;  4PG7 A;  2YNI B;  1S1V B;  1XMQ F;  1G2E A;  3P3D A;  4DFP A;  3PW7 A;  5D0G A;  4ZPD A;  2L41 A;  4KAI A;  3QMQ A;  5KFZ A;  3U1L A;  1D9D A;  1FNO A;  1D09 B;  3EZU A;  4LFA F;  4MFB A;  4F67 A;  3A8I A;  4CYU A;  3PYD A;  3SQG B;  5LOQ A;  3QJP A;  2CPD A;  2DH7 A;  3EIC A;  1DRZ A;  2O01 C;  3EVW A;  5F3T A;  2R8I A;  5HAT A;  2XEX A;  4OYO A;  3DLL Q;  1JQG A;  3N6M A;  4I2Q B;  1S4E A;  4C3M A;  4I68 A;  2JC0 A;  1J5E F;  2DEI A;  5G0R B;  2BV3 A;  3OXF A;  1HKA A;  4MKY A;  3ZZT A;  3PX0 A;  4KGM A;  3TQ1 A;  3R5A A;  2ZH6 A;  2FVC A;  1ROF A;  3K5N A;  3PCO B;  2KTQ A;  1TL7 B;  1MN7 A;  5BR8 F;  4QJV A;  4CLL A;  3MHY A;  1X4F A;  4ZP9 A;  3HSD A;  1VQY A;  2QRR A;  1ZAX A;  4RW7 A;  4C8Z A;  2DHH A;  3M8W A;  4N56 A;  4C8O A;  4B9U A;  3GPA A;  2DKO B;  4DSE A;  2PMW A;  3RBD A;  3W62 A;  3IAS 9;  3QSI A;  4M5M A;  2HGN A;  1HYS B;  1TV6 B;  3DOK A;  1ACM B;  4O3N A;  2FVR A;  5J2N A;  5J1N A;  5KAK A;  2JL9 A;  4DLG A;  3UD4 P;  2QL7 B;  2LXU A;  2J6S A;  5D8H B;  1B64 A;  3NXZ A;  4DQS A;  3CO9 A;  2B4O A;  3MCO A;  4P2M A;  2RF2 A;  2R7S A;  3THP A;  3C46 A;  5FLX Y;  1S9E B;  2XG8 A;  4OHV A;  3H0P A;  1RGV A;  5EHH A;  7FDR A;  1T02 A;  2BXJ A;  1X9W A;  3T1H J;  4KV8 A;  2HPU A;  5ETL A;  5HRO B;  1G1X A;  2HVD A;  4QCL A;  1NJZ A;  2Z0G A;  3OJS A;  5J2P B;  2H48 B;  3B82 A;  1IBM J;  2ZHO A;  3UE2 A;  4ZVE A;  1S9G B;  3A3O B;  4Y2K A;  3C14 B;  4ZVT B;  1CQN A;  5JJB A;  5A8R B;  1VJW A;  3DDN A;  3GG1 A;  4A8S A;  1JLF A;  4C3K A;  2M2B A;  4NZ0 A;  1QE1 B;  3UDC A;  3MEC A;  1OY6 A;  3MD3 A;  1RHQ B;  2R8H A;  2A2C A;  3QAE A;  5ETO A;  3KLH B;  2OML A;  4F0H A;  4C9D A;  4PYA A;  2R7W A;  3NOC A;  2V94 A;  2CDQ A;  1T11 A;  2MGZ B;  4OZ5 A;  3W7B A;  2FJA B;  2EBE A;  2GA7 A;  3TUI C;  1RAJ A;  4FBU A;  1W25 A;  4Y2M A;  5I3P A;  1RAI B;  4JI7 J;  4MIA A;  3SQO P;  1NUE A;  2ZUA A;  1EQ0 A;  1G7C B;  2ZBI A;  3ICL A;  1N5S A;  1TK5 A;  4ZVG A;  4DUZ J;  3LGH A;  4I1T A;  4AXJ A;  1C1B B;  2WON B;  4PQU B;  2KB2 A;  1X4A A;  2DR7 A;  3FVY A;  3W61 A;  4CTA A;  2VL1 A;  3CED A;  3DRY A;  4OMF G;  3B8H A;  4RZR A;  2DRD A;  4RW8 B;  3DLG A;  3BGF A;  2HMI A;  4UT4 A;  1QAI A;  3OT9 A;  5B0B A;  1HNV B;  3EXC X;  3KDO A;  2V4R A;  3HVA A;  2JSX A;  3MR7 A;  3RBZ A;  3N28 A;  4F3O A;  3M2V B;  2LYV A;  4P71 A;  3HM9 A;  1NPP A;  1J27 A;  3TAQ A;  2CQH A;  2GJI A;  1CEZ A;  2HND A;  2XY7 A;  9ATC B;  1JB0 C;  3K17 A;  3ZTO A;  1GT8 A;  4KYZ A;  5A0Y B;  3V6J A;  3MPD A;  2ILY A;  4LVN P;  1ZAV A;  1U6F A;  1NO8 A;  1Y9O A;  2XSJ B;  2HHT A;  3GR0 A;  1CS4 A;  1JK9 B;  4LMZ A;  1SV5 B;  4URS A;  2RRA A;  3QYY A;  2M52 A;  2ZH8 A;  2F5G A;  2AF6 A;  1FFG B;  4XDD A;  2FD2 A;  1I94 J;  4AT1 B;  3G8Q A;  3KLI A;  1NKB A;  2BE9 B;  1UZD A;  4ZS6 A;  4UTG A;  1XMO F;  1KQG B;  2VQF F;  3CJR A;  4X66 J;  4ZLL A;  4QYR A;  3S1T A;  2CDR B;  1IN0 A;  3RAX A;  3R9L A;  1GTE A;  4GO5 X;  2JJ4 D;  3ILO A;  1AXQ A;  1NCL A;  4NRT A;  4EGL A;  3OHA A;  4DQI A;  1WUU A;  3BKF A;  3PRD A;  2ZNY A;  3OW2 R;  2BE7 D;  4WJB A;  4C97 A;  5KT2 A;  1SKS A;  3N5B A;  3CJK B;  2BVZ A;  2HW3 A;  3M6U A;  4C8Y A;  3SV4 A;  3MMB B;  4ZA1 A;  3HHE A;  1LXN A;  3MD1 A;  4OJG A;  2CNN B;  1S9F A;  1RHU B;  2C2K B;  2QLB B;  4BWM A;  2VOD A;  1SL2 A;  1XR7 A;  3C19 A;  4ICL B;  4RBV A;  2GHP A;  4CLW A;  1JXV A;  3LAL A;  1YWX A;  4BS2 A;  1FWL A;  2G0I A;  5DET A;  3DRS A;  2ZZM A;  2YX1 A;  4M5L A;  3GYG A;  1IKW B;  3CCE S;  1S0V A;  3BYP A;  4M8L A;  2IM3 A;  2OH2 A;  4NXM F;  3KK1 A;  4WCE Q;  4N8N A;  1DQ9 A;  4ZPC A;  4ILL A;  1HQU A;  5E5N A;  1Y7P A;  2R7V A;  4XDC A;  5D6G A;  3SSQ A;  3OV7 A;  2M88 A;  1T94 A;  4IH6 A;  1U1R A;  3OXL A;  2A2D A;  2ZE2 A;  1GMV A;  4X4N A;  3M30 A;  1U09 A;  4NLQ A;  4LFB F;  1HNX F;  3H4D A;  2BJ9 A;  4PXB A;  2ZH4 A;  1BC6 A;  4ZPA A;  4N7T A;  3KMQ A;  4MMO A;  2FJE B;  1HL6 A;  5HSP A;  2B4V A;  4BDP A;  1JLC B;  2IBO A;  1S6O A;  2V63 A;  1DTT A;  3S8S A;  3DM2 A;  1UKU A;  2UUC J;  2V4J A;  3GJR B;  1Q7L B;  2MJU A;  5DO2 A;  1DQA A;  2JOQ A;  2DRB A;  2BW2 A;  4ZP8 A;  2C2R A;  5THW A;  1CJK B;  1TQL A;  1HFE L;  2F63 A;  2V69 A;  2MZQ A;  1WKL A;  1WTF A;  4AL5 A;  5HK4 A;  4N41 A;  2MLZ A;  4GVL A;  3CSK A;  2PT0 A;  1KLM B;  1HMV A;  4ZN1 A;  2QX0 A;  5IWA F;  5L1L A;  1T9W A;  5CYQ A;  4Y34 A;  4LSN A;  2B9X A;  2XS5 A;  2DNZ A;  4RJV A;  3HT3 A;  4HTI A;  1FDB A;  3O1L A;  1WOS A;  3X3U A;  1ZTT A;  2HNY B;  1RWX B;  1JLA B;  4RUH A;  1Y11 A;  3OQ2 A;  2QLJ B;  1FJE B;  5GAE U;  4B3S F;  3BSC A;  1NK6 A;  4K8R A;  2W2M P;  1H2U X;  3GSD A;  4Q7A A;  3ZO7 A;  3C15 A;  5M2P A;  5AE2 A;  3HHL A;  3CTR A;  2R7O A;  2A18 A;  2OPQ B;  1UTA A;  1CUL B;  3IXQ A;  1T9X A;  3DLE B;  3VAF A;  4ZPB A;  4QU7 A;  3IGN A;  2CAJ A;  1NDL A;  1NKE A;  1UVK A;  1A9N B;  1V9O A;  5IC6 B;  3RG6 A;  4DS5 A;  5KFI A;  2MQM A;  4CM0 A;  2XCP A;  5HVG A;  1SL0 A;  2FJD B;  1YSJ A;  3LTO A;  2CUY A;  4LRE A;  3MM7 B;  2EC0 A;  2OHD A;  2G2O A;  3NS7 B;  5K8M A;  2Y1R I;  3MUT P;  1JXE A;  1L3T A;  1XER A;  4OZ0 A;  4XK8 C;  4HHU A;  1WAC A;  2AMC B;  4QR0 A;  2UXD J;  3HVT B;  1DQ8 A;  2FDN A;  2ZOF A;  2M70 A;  3BBF A;  3MR3 A;  4DXL A;  3M2R A;  1F9H A;  4PWU A;  1ARO P;  1RU1 A;  4X62 J;  2FHJ A;  1F2H A;  1QAX A;  4DOZ A;  2H4W B;  3LW5 C;  3EVM A;  1K9M T;  2QMU B;  1B7F A;  4LF6 F;  4YB5 A;  4GRS A;  3GCX P;  3ISZ A;  2XQC A;  1M1H A;  1BLU A;  1WOO A;  1HWL A;  2ZJR Q;  2D69 A;  1VHI A;  3Q8Q B;  5E3C A;  4A8F A;  4DV3 J;  3PJ9 A;  4QR2 A;  2EC2 A;  4OHW A;  3ZZZ A;  2R7X A;  4H4O B;  3OTC A;  1WWH A;  1UA0 A;  2OPP B;  1RBA A;  2V8G A;  5C25 A;  4WFX A;  4MIW A;  2BM1 A;  3ILI A;  5ADZ A;  3HZE A;  3MCM A;  3CCW A;  3NS5 A;  1FKP A;  2XWX A;  4B17 A;  2KRB A;  1U1O A;  4P7T A;  4HDG A;  1WC4 A;  1YZ6 A;  3BZQ A;  2PMH A;  4MTP A;  3IA0 A;  3A8J A;  3NG8 A;  1LWF B;  4BBY A;  3K59 A;  1FNX H;  3PJX A;  3OL8 A;  2UUA F;  2MHN A;  1PGZ A;  3WC0 A;  4DEZ A;  3GZ7 A;  5J1E A;  3BR8 A;  2BUN A;  4RNF A;  1VQ6 S;  5KFK A;  3MPV A;  3EDQ B;  5M2R A;  3SEO A;  4YQW A;  4PZV A;  2Y1I A;  2C42 A;  1Q8I A;  2PDA A;  4CLK A;  1JJC B;  4YR2 A;  2QTW A;  3CJ8 A;  3I87 A;  4DFM A;  4ELU A;  4ECW A;  3IP0 A;  4LF7 J;  2PFD A;  2ZC4 A;  4NLY A;  3GV8 B;  4I6A A;  2WVC A;  1IKX A;  1NKC A;  2ZVI A;  4DR7 J;  1WSV A;  3NMA A;  2DXF A;  5FII A;  3K5O A;  5DZ7 A;  4N8O A;  1NSK L;  5KFE A;  2Y0B B;  3ZTS A;  4DLE A;  2NXU A;  5H1S V;  2V2Z A;  2MQP A;  4ZPW R;  4BWJ A;  4ZP6 A;  3GIL A;  1NJX A;  2RNE A;  1IBK J;  4PYD A;  1BQM A;  3PO4 A;  3I4P A;  1JKH B;  4JYA F;  1YG0 A;  1ZET A;  4QIG A;  3MPU B;  5HJX A;  4R8U B;  1GX5 A;  1Q79 A;  1S97 A;  3QGH A;  2PGC A;  3FZ2 A;  3EYZ A;  4FPI A;  5A76 A;  1AT1 B;  4A8K A;  1VGY A;  3NAI A;  3T1Y J;  1HI1 A;  1N33 J;  5B7W A;  3BKT A;  2MJN A;  1U0H B;  2F4V F;  1TL4 A;  5L1K A;  3P8B B;  2IMO A;  2NXC A;  1VRT A;  1NK8 A;  1QD1 A;  2BZ2 A;  1JLB A;  2V9W A;  2XNR A;  3V4I B;  2EVZ A;  2FVP A;  1P27 B;  3I56 S;  2NUH A;  4ILR A;  4UOC A;  1WKK A;  3BQ0 A;  4ED7 A;  2KM8 B;  1E6V A;  1V3S A;  3NNC A;  1CJV B;  1Q4R A;  4WE1 B;  2OEL A;  3M8Z A;  2GVD A;  4Z7Y A;  2O66 A;  1UVM A;  1IJF B;  1YJR A;  5HLF B;  1EKR A;  2J7U A;  3CD5 A;  2W7A A;  1RLC L;  2KG1 A;  1MMN A;  4IQX A;  4DSK A;  2DY1 A;  3MPY A;  3TAP A;  4IQM A;  3DRR A;  2N7C A;  2QIF A;  2HHP A;  4P74 A;  3DMJ A;  2GQQ A;  1RTI B;  4I2P B;  1GTH A;  1CJT A;  2J0W A;  2QZ8 A;  2G2Z A;  4U7U K;  3DRX A;  1YI2 S;  2ZKU A;  3D1Q A;  2RE1 A;  2V9K A;  1RT6 B;  3CJ0 A;  2BAB A;  4DG1 B;  3AXK A;  3NBP B;  1S7I A;  2KZZ A;  5F9N A;  1OYD A;  3OL9 A;  2H65 B;  1DJ0 A;  1Q16 B;  5DJB A;  3RBE A;  3LGM A;  1TL3 B;  3D0H E;  5DLF A;  5KFY A;  3J81 U;  1YJT A;  1RT4 A;  3EJM A;  1QLN A;  1REV B;  1S1W B;  3OVS A;  2MST A;  4J9U E;  2LU1 A;  3VV2 B;  3NS6 A;  3QZ8 A;  3H2L A;  5CQG A;  1LKZ A;  5EUH A;  2CPH A;  4LVO P;  3DDK A;  1DAR A;  4IOC Q;  1TK8 A;  4IFV A;  4NX9 A;  3JYT A;  2JEF A;  2YKO A;  3P96 A;  4AE5 A;  4O0N A;  1FRK A;  4NCA A;  4Q8F A;  1VQ9 S;  1IVZ A;  4XIU A;  2KT5 A;  1WG4 A;  1NB2 A;  3WZ0 A;  2GW8 A;  3SDE B;  4C48 A;  2W9C A;  3MFI A;  2AEF A;  1LK7 A;  3ULH A;  3UR0 A;  2B9Y A;  4NLW A;  2W4D A;  1FFS B;  3I0R A;  2ZHB A;  2GFF A;  5GVQ A;  2KXN B;  4ES3 A;  1UA1 A;  3IAM 9;  2KM8 C;  3R97 A;  3CB4 A;  3S6E A;  1B0V A;  2ALZ A;  3DYA A;  3I0S A;  1FK9 A;  5L39 A;  2CQP A;  3MF5 A;  1GEH A;  3IR7 B;  3Q8P B;  4KPY A;  1RB0 A;  3M8R A;  1ZAW A;  3K8V A;  5L1J A;  1LXJ A;  4ZMM A;  3SV3 A;  3EE3 A;  2F7V A;  4FVM A;  3BF4 A;  2MZJ A;  4KFB B;  2DCU B;  3T9N A;  5F41 A;  1TUW A;  4IUF A;  4LFC J;  2VBZ A;  1RCX B;  4B3T F;  2RIL A;  4YB7 A;  3IGV A;  3OSN A;  2CZ9 A;  2K06 A;  2UVU A;  1S1U A;  4DV7 J;  3N0V A;  2DPJ A;  4TQS A;  4JV2 A;  2HAF A;  3RJM B;  3MEE A;  2D7S A;  4JV1 A;  3LP0 B;  3GIJ A;  3I31 A;  4EWT A;  2JZ5 A;  1VIO A;  1Q8B A;  2U2F A;  4ECV A;  2H5J B;  2A3J A;  1FRM A;  3U1M A;  2J7K A;  2WAQ D;  4DFK A;  4J9L A;  5KFA A;  1KWM A;  1I1G A;  1PYT A;  4I4B A;  5RUB A;  2I0X A;  2HZC A;  3Q8V A;  2E9T A;  4PXE A;  1ZBT A;  4B02 A;  1ZM4 A;  3D5M A;  1PJ6 A;  2ZM6 F;  4HI1 A;  3HD1 A;  2DNM A;  2AIR B;  4YY3 F;  3UVJ B;  4DSL A;  5C42 B;  2LP4 A;  3IG1 B;  2MY7 A;  2VBX A;  3NGR A;  2VKZ G;  3GFX A;  1RT1 B;  2MHE A;  4R5P B;  2C2N A;  2KYZ A;  2VFS A;  1RT3 B;  3JSR A;  2IC3 B;  3ELH A;  3HFK A;  2D9O A;  4DFJ A;  3TEH B;  1HD0 A;  5AE3 A;  2NSC A;  1WJ9 A;  4NLX A;  2IY5 B;  2HNZ A;  3UNY A;  5KG0 A;  3KXD A;  3W9J A;  3WHI A;  1O0P A;  4EFA C;  3UDL A;  3I6P A;  3JTP A;  4OHZ A;  3R5B A;  2GIR A;  4YR0 A;  1GMU A;  1JNZ B;  3HZG A;  3MAQ A;  1MMD A;  1WTB A;  1OO0 B;  4N5S A;  5CD4 A;  3D3C J;  4AL6 A;  2YWW A;  2ZJP Q;  1HBM B;  1X5S A;  1Y10 A;  2BMB A;  4P6Q A;  2YNI A;  4F4Y A;  1RKJ A;  2HK3 A;  2GGP A;  4H4M B;  1MW7 A;  4ECZ A;  3VAL A;  2CYY A;  4IKA A;  4Y2A A;  1HPZ B;  2K3K A;  1NAQ A;  1WG1 A;  2DCL A;  5KG2 A;  3W2V B;  3SQG A;  1YJN S;  4QWC A;  2ZH9 A;  1KDN A;  4KO0 B;  1JXL A;  1SCJ B;  3G71 S;  3RRH A;  2X1B A;  3G6Y A;  5A2Q U;  4WZM A;  1Q78 A;  4KJI A;  1AB8 A;  5GME A;  3V6D B;  4O3P A;  3HSZ A;  4I2Q A;  1A0O B;  5DS7 A;  1XK8 A;  1N48 A;  5HN0 A;  3CC7 S;  5G0R A;  3B6B A;  1IUJ A;  1T8E A;  1JJ2 R;  4ED0 A;  5AJ3 F;  3HO1 A;  3P5B P;  4J9M A;  1UZH A;  2GZO A;  4J9V A;  3OTB A;  2ZBC A;  3VR1 A;  4RUA A;  3BH6 B;  4KH0 B;  3I5B A;  5F8G A;  2UXC F;  2PEB A;  1B99 A;  2E5L F;  5I42 B;  1U02 A;  2MKK A;  4OX9 J;  5LSL A;  3GON A;  3Q83 A;  3HF5 A;  1Y3K A;  3AHP A;  1HHT P;  2AT1 B;  2G9O A;  2VPY B;  1B0P A;  4USJ C;  4TU8 A;  5D0H A;  4NPO A;  3TQE A;  1PYS B;  2P5V A;  2B7C B;  4HAC B;  2HZA A;  3HSJ A;  3I5C A;  5KG4 A;  4KTQ A;  2KJW A;  2MY8 A;  1XMO J;  2IIH A;  1T3N A;  5I4M A;  1NK7 A;  3L3C A;  2BJE A;  2XMK A;  4QYZ J;  1BY9 A;  2DGO A;  1FX4 A;  2XZW A;  3FBF A;  2IVY A;  3CT9 A;  1K0T A;  8RUC A;  3PW0 A;  2JNJ A;  4ZPT R;  4NA3 A;  2LQB A;  4WZQ A;  1PJ7 A;  4NLG A;  3ZZ0 A;  3FQL A;  3F0N A;  1S76 D;  2E1C A;  4DV2 F;  3ILJ A;  1F3V A;  1S4F A;  2H5I B;  2X3D A;  2HLU A;  4C0B A;  2CPJ A;  1W2I A;  3BSA A;  1UP1 A;  1H2T Z;  5G4D A;  4QWB A;  3KJV A;  1RQ0 A;  4PAB A;  3UDE A;  3A4T A;  3PFE A;  5HRO A;  1F3F A;  2DJW A;  4Y0F A;  5A6P A;  1VQ4 S;  3Q2T C;  1R43 A;  2HZV A;  5J2P A;  4ZJL A;  2IFX A;  4OYI A;  4JB8 B;  1S9G A;  4U7C A;  3OJU A;  3HSG A;  4K2J A;  1KR4 A;  3JSY A;  3M9N B;  2YQ3 A;  3IWL A;  2BJ3 A;  2MTL A;  3HKW A;  1FEE A;  3QZ7 A;  2KXF A;  2BJD A;  1LWE A;  2RDI A;  3IBF B;  4FYX B;  2JVO A;  3CWJ A;  2KG0 A;  3GWC A;  4ES2 A;  2W2P P;  4KPC A;  2UP1 A;  5IM0 B;  2RU3 A;  4J9Q A;  3KLH A;  2CWX A;  5C24 B;  3GU0 A;  5T14 A;  4NXM J;  2KKH A;  3J7A 1;  4Z2X A;  3UO0 A;  1XTZ A;  4IH5 A;  2IYI A;  1MNE A;  5KFR A;  3KG4 A;  3KFW X;  3BGU A;  2E29 A;  1HNX J;  1RA7 A;  5DDP C;  2CQG A;  1QTN B;  5L8R C;  2SXL A;  3E3X A;  3NY0 A;  5DM6 Q;  1C1B A;  4PQU A;  3T19 A;  3BR9 A;  3KLF B;  3D6M B;  3KLE B;  1IXK A;  3MI7 X;  4NEY A;  1YIJ S;  3PR4 A;  3NGS A;  3DFE A;  1X9M A;  1ZYQ A;  1Z2Z A;  4RW8 A;  5I3Q A;  1VOM A;  2RB7 A;  2CQ2 A;  4OZL A;  3BGL A;  3CCS S;  1HNV A;  1RWM B;  4IYQ A;  2XMV A;  5K14 A;  3TUZ C;  3G6E S;  3M2V A;  2LEP A;  4B9N A;  3TVZ A;  1FF2 A;  2BQU A;  3MMC B;  3V4M A;  2Z2L A;  4OZ2 A;  1FE4 A;  1H73 A;  4Q2L A;  5IFM A;  4ANC A;  3KG1 A;  2QLW A;  1HNZ F;  2XUL A;  5A0Y A;  3CC2 S;  2BA9 A;  2I2Y A;  3U27 A;  1X7V A;  1KVK A;  2QMW A;  4X4R A;  2Q6C A;  1M5V C;  1N4L A;  1VQ7 S;  1K44 A;  4WFN Q;  2RQK A;  2HRT A;  3UCZ P;  4DUY F;  1RT5 B;  3U1N A;  2CPF A;  4N77 A;  3GFY A;  4KIA A;  4WWS A;  2W8L A;  3VAK A;  1R8C A;  1VLY A;  1F2G A;  3R2C J;  1SXL A;  2OPR B;  2WSC C;  8AT1 B;  3JQJ A;  2CA9 A;  1LW2 B;  1ICE B;  2CNK B;  3M1V B;  2M3D A;  3C16 B;  4B3S J;  1TKT B;  2FYX A;  3BRE A;  3GJS B;  1S99 A;  2D3Z A;  1NK9 A;  1GAO A;  1IKV B;  4J9N A;  1HBO B;  3I96 A;  3DKD A;  2HFO A;  4DQQ A;  5L9N A;  4F50 A;  4RW9 B;  3AD8 C;  1GMW D;  1RWP B;  1N32 F;  1XWL A;  1YBU A;  4IR9 A;  3DXS X;  4JOU A;  5KFO A;  3CJK A;  4AQY F;  1MG7 A;  5KTQ A;  3MMB A;  3POT B;  2ASJ A;  1UJ6 A;  2VQE F;  1TL1 A;  1JLG B;  1YJ9 S;  3G9C A;  4ICL A;  2MKC A;  4P75 A;  2JFK A;  4KY3 A;  5K8N A;  2RQM A;  2YY3 A;  3WIV A;  4Q5V A;  3M2U B;  4LSL B;  3O44 A;  5KFT A;  1C2P A;  5KFG A;  2DVI A;  3FSI A;  5D4O A;  2VG7 B;  4F0M A;  3PO5 A;  2YH0 A;  4DMZ A;  1IKW A;  5IV4 A;  1NK4 A;  1UCN A;  2IVM A;  5SUH A;  4F0K A;  1N5Q A;  1ZM3 A;  3FZB A;  2MLX A;  4UW2 A;  2EKN A;  2EKY A;  2AGP A;  3HP6 A;  1U1K A;  1AFJ A;  4I6W A;  2B6A A;  1N52 B;  1K0V A;  4EYI B;  4ZLN A;  4A8Q A;  4YUD A;  2AKW B;  4HT7 A;  1RCO B;  4N47 A;  1SC1 B;  2N7Y A;  4M5K A;  1VK8 A;  1K73 T;  4GO7 X;  3D6H B;  1PG5 B;  4EUV A;  3L7U A;  2IHR 1;  3RU0 A;  1JLC A;  4ZCI A;  4O44 A;  2GIF A;  2CJQ A;  4N76 A;  2G0C A;  1S1X B;  1NHU A;  2VJU A;  4USM A;  4V19 J;  2UUA J;  1N36 F;  4DR3 J;  1U2R A;  2UXB J;  2AYE A;  1NJW A;  2HIQ A;  4Y3C A;  1CJK A;  4FF4 A;  2GCF A;  4PWD A;  4R0J A;  1L3U A;  2RHQ B;  2P9E A;  4NEZ A;  3TNV A;  5I3U B;  2AHO B;  3UPF A;  4O3S A;  3TJ8 A;  5AXN A;  1NME B;  2EFV A;  4EU0 A;  1T03 A;  3AOA A;  3CCR S;  3PW5 A;  1FX2 A;  3ETM A;  5F8H A;  4JI5 F;  1KLM A;  1RAA B;  3BB5 A;  4WU3 A;  3RUB L;  3GMG A;  3FMW A;  5F3Z A;  2IRU A;  1QVG R;  1QAY A;  1S6Q B;  2A6O A;  2ATL A;  1NSA A;  5A2Q Y;  2H4Y B;  2DR6 A;  1UAW A;  3VHQ A;  1I6J A;  2WOM B;  4ZVU B;  1KHV A;  4DL3 A;  1YJU A;  3W5X A;  2HNY A;  2AJ1 A;  1Q1K A;  4KRW A;  3MPW A;  5LXR A;  3GJQ B;  3TWZ A;  1JLA A;  4RW4 A;  3KUH A;  3R27 A;  3V81 A;  2KFY A;  1U1M A;  1Q95 G;  5KFV A;  1N54 B;  2IYG A;  4OL8 A;  3GFZ A;  3QBC A;  4LR8 A;  2YPY A;  2J76 E;  3CPW R;  3DLE A;  3BO3 A;  2HS0 A;  2B5J B;  4RW6 B;  4B3R J;  4ZJQ A;  1OQ6 A;  2GAH C;  1Q8L A;  4LRB A;  2F4V J;  3E01 A;  4GVB B;  1BWE A;  1SJR A;  2VH7 A;  4X4U A;  5F8L A;  3O6Q A;  3MM7 A;  4KGZ B;  3HHK A;  1QDU B;  5FDL B;  2XYG B;  3P6Y C;  2Z57 B;  2RT3 A;  4ZVR B;  2I9S A;  2EBG A;  2FHO B;  4RL1 A;  3GIK A;  2RS8 A;  3M05 A;  1F9E B;  3MGJ A;  4J9S A;  3KJQ B;  4IDK B;  2W01 A;  5KT6 A;  3U7J A;  4KGV B;  2I1R A;  1KOH A;  4BC7 A;  1TU0 B;  2D9P A;  2PA3 A;  2HK2 A;  4XAK A;  2VOP A;  2YXL A;  3M8S A;  4GKK J;  2NZ4 A;  1YRX A;  4L74 A;  1VRU A;  1YJ7 A;  4MIB A;  1R7I A;  1VQ5 S;  3D0I E;  2D3O R;  1EET B;  4DV4 F;  2DBB A;  3QWU A;  3K0J A;  3FCV A;  5KFQ A;  3TZZ A;  1U25 A;  4NI2 B;  2K1R A;  2YKA A;  3GG0 A;  3FSX A;  4DV0 J;  2LEC A;  3R5G A;  1FRH A;  2JH3 A;  2GJ2 A;  3B4D A;  2FZG B;  1HAR A;  4JI0 F;  2I6W A;  3T1A A;  1LFP A;  1PAE X;  3ADA C;  4PAA A;  3PG9 A;  1RKI A;  2ZHA A;  4FNH A;  4DV1 F;  3TJ9 A;  3EXY A;  4UOF A;  3A1Y G;  1C1C B;  4KGK A;  2ASL A;  4CO2 A;  1X5P A;  4O23 A;  5D77 A;  3OTO F;  2JLF A;  3RW6 A;  2PII A;  1UVI A;  1TR0 A;  4MH8 A;  2GVZ B;  2JVR A;  4NL5 A;  3TAR A;  3GTY X;  5GAD I;  2YQ0 A;  2MQN A;  3DU5 A;  5D0E A;  2MLY A;  4ED8 A;  3L95 X;  1UVL A;  2XLK A;  2BRK A;  4ZVS B;  5L1I A;  3NOG A;  1SC3 B;  1BQN B;  2OD6 A;  4ZVP B;  2M7S A;  5CYM B;  4DHV A;  2DNN A;  2VG6 B;  4WU2 A;  1CJU B;  2CZ4 A;  3Q0A A;  1DFD A;  3K7R A;  1N56 A;  4OZN A;  4LR9 A;  4KSE B;  4U8V A;  3ET6 B;  5HMX A;  1D9A A;  3MMA B;  3AXM A;  3CD0 A;  3RB6 A;  3NWG A;  2AZ3 A;  2PO4 A;  3HD2 A;  1OQ3 A;  1YJV A;  2XMJ A;  2HBZ B;  2UVV A;  2KL8 A;  3UQS A;  3D2W A;  2DNP A;  2VB6 A;  3E8O A;  1JKH A;  3CCZ A;  2CQB A;  4R8U A;  1WHX A;  2ZJQ Q;  2IDE A;  2LFV A;  1H38 A;  4B3T J;  1S57 A;  5E7O B;  3UNG C;  2ROP A;  5DDO C;  2WW4 A;  4M5G A;  1UFL A;  3MR5 A;  3NWR A;  3HVW A;  5K8O A;  4ZIT A;  2GNK A;  3N6L A;  2DR9 A;  2VFR A;  3CDB A;  5D0R A;  1U0H A;  4HHH A;  4F25 A;  2XWY A;  2ACM A;  3MM6 A;  2LEB A;  4MFB B;  2MQL A;  3SBM A;  2WB1 D;  2FJX A;  4FDF A;  2AEJ A;  3GQC A;  2VPW B;  3BS9 A;  2KU7 A;  2B8Q A;  3BBB A;  3H8Y A;  2AW0 A;  1RAO A;  1CJV A;  3VZI A;  4X4P A;  3PRV A;  4J91 A;  3MXH P;  3ENW A;  2RSQ A;  3TAN A;  4QWD A;  4NYO A;  3GSI A;  5HLF A;  4LF4 F;  3OVA A;  5AXK A;  5F9L A;  4FYD A;  3SFU A;  2WVB A;  3GIM A;  4JUZ A;  4C8K A;  3KLG B;  2R7Q A;  2DNY A;  2R42 A;  1IBL F;  1LOU A;  2X51 A;  2BEF A;  2HBQ B;  5HQL A;  4K2X A;  1RTI A;  4I2P A;  4USV A;  2J9C A;  2EFO A;  3V6K A;  4QIV A;  4F4W A;  5KFU A;  4YHH J;  2QYG A;  1RT6 A;  4DG1 A;  2LA6 A;  4QQB A;  3FK4 A;  2W9A A;  3NBP A;  4DPU A;  1H3D A;  1Q82 T;  3AJD A;  5J2N B;  2OMO A;  1FDN A;  3KTQ A;  2CFX A;  1JLQ A;  3AT1 B;  3FRZ A;  2CJB A;  2CQ1 A;  5EGY A;  3OPK A;  4NCG B;  5LM7 E;  4DX8 H;  3BQ1 A;  3L4B C;  4MYU A;  4DR1 F;  2C1E B;  2J9D E;  1LEO A;  3TI0 A;  1HW8 A;  3E51 A;  2DNG A;  1S1W A;  2IMW P;  2FLP A;  2GIQ A;  2E1M C;  3M7V A;  3GB0 A;  3D67 A;  1WC6 A;  4I56 A;  1IWA A;  1VCT A;  4ELV A;  3V6H A;  3EVO A;  4F7V A;  3W2W A;  2YWF A;  4KV8 B;  4FS2 A;  3K5P A;  2VFV A;  3CXC R;  2HFU A;  4FKY A;  1OWX A;  5H9F K;  2KVQ E;  4G1P A;  1MU2 B;  3VAJ A;  1X4C A;  2IJN A;  1LNQ A;  4OI4 A;  3QFW A;  5KT7 A;  2EG2 A;  2OLW A;  2P6S A;  1NSP A;  2B51 A;  3EDR B;  1O5J A;  5IZH A;  3FQK A;  4OX6 A;  2E7W A;  4OI1 A;  5U47 A;  3KG0 A;  2AYM A;  5CH7 B;  4LRA A;  3ZNJ 1;  4AUK A;  3H5U A;  4FNI A;  2W7O A;  3NCQ A;  4R25 A;  1CC8 A;  4UZB A;  1KON A;  2DIU A;  2E5H A;  2UXC J;  1VBY A;  3PYE A;  1B7Y B;  2HHV A;  4QPX A;  3EWG A;  1H74 A;  5T7L A;  4KFB A;  4WYW A;  4JV5 J;  2DGV A;  3UD3 P;  3TW0 A;  5KOW A;  2QLF B;  5CCM A;  3L09 A;  3AA8 A;  3GE9 A;  3KJN B;  2GX8 A;  3CJS A;  3PAC A;  5HP1 B;  5GMD A;  2RIJ A;  2IJR A;  4DR2 F;  2DHS A;  5ETV A;  1Z1Z A;  2E7X A;  3IM8 A;  3G8S A;  2PD1 A;  4FYW B;  3A3P B;  1SQG A;  4WP3 A;  5ETN A;  4L6V 3;  1D8Z A;  2QA4 S;  2XO7 A;  1IR2 A;  1XNR J;  5KFD A;  3IR5 B;  2CJK A;  4E0D A;  3FJ2 A;  3HCX A;  4IFY A;  3W9H A;  1IBC B;  2ZNZ A;  2L9W A;  4WYL A;  3W63 A;  4RBT A;  3TOQ A;  1YBA A;  1OSD A;  1H6K X;  4OI2 A;  1RA6 A;  2ZDO A;  4MAK A;  5KFS A;  5A8K B;  4C0O C;  3UVJ A;  5C42 A;  1E6Y A;  1F5B A;  5HBM B;  1FXR A;  2HHX A;  1V3R A;  3QGI A;  5HQ8 A;  4R5P A;  3CCM S;  1RT3 A;  1TAU A;  2IC3 A;  1ZPW X;  2RS2 A;  2EFP A;  3D9B A;  3WX4 A;  1RK8 A;  2Q43 A;  2VC1 A;  4C0H A;  4ECY A;  4WFY A;  4DZD A;  4CCH A;  3M6V A;  2Q66 A;  2CQC A;  1M5K C;  1S59 A;  4FS1 A;  2C2Z B;  4FYY B;  2PC6 A;  4C6A A;  2R2S A;  2MZT A;  2L9N A;  4PUO A;  1HBM A;  2DB1 A;  2FB0 A;  4K4Y A;  5J2M B;  5B0G A;  1Q53 A;  2NLW A;  2N82 B;  4O3Q A;  2X1A A;  1APS A;  3TUP A;  2DEJ A;  4DV6 J;  4H4M A;  5F8J A;  3WC2 A;  2OKQ A;  1TP7 A;  2C22 A;  2H54 B;  4RUC A;  4V1A k;  4EBC A;  1TKD A;  4Q0B A;  2DD8 S;  4C11 A;  1HW9 A;  3VVT A;  1U1N A;  1J5O A;  2NXE A;  3HT0 A;  3KMS A;  3AOB A;  3UCU P;  2HQG A;  3W2V A;  3Q22 A;  4W92 B;  4DS4 A;  2BE2 A;  4KE5 A;  4HEA 9;  4DQP A;  1ULR A;  4KO0 A;  2JEI A;  3D66 A;  3OTD A;  1DAX A;  2OI2 A;  4OI0 A;  4RNN A;  1YK9 A;  1IBM F;  1X5T A;  3V6D A;  1R27 B;  2AJ2 A;  2HIY A;  3QO9 B;  3CUL A;  5CXT A;  2ILZ A;  4EI2 A;  2C2M B;  4NZ6 A;  3Q86 A;  2HFV A;  3PYF A;  3J7Y I;  2IRX A;  5L38 A;  4X65 F;  4IG3 B;  4OJ1 A;  2VU5 A;  2HBR B;  2FUG 9;  3DRS B;  1NLK L;  1HI8 A;  3QWP A;  5IC4 B;  3D6F B;  4WFZ A;  3KK2 A;  5MLC V;  1HNW J;  4J9R A;  1M90 T;  3FEZ A;  1WHY A;  4JBC A;  5I42 A;  1N8R T;  1VQS A;  1N34 J;  2R2R A;  2OP5 A;  3DLH A;  2ZZT A;  2QO3 A;  4DUY J;  3MEK A;  4H4K C;  3KHR A;  3HKZ D;  1T3O A;  4O4G B;  4RWX A;  3FFI A;  4Q8E A;  2L08 A;  4JI7 F;  2XHC A;  2RVJ A;  1Y5N B;  4GC6 A;  1YVF A;  4HAC A;  4ED6 A;  2ZE2 B;  2B9W A;  1URR A;  3DRP B;  1G6B A;  1FA0 A;  2EI5 A;  2QGF B;  3WQP A;  1TUG B;  3CDE A;  2KYX A;  2RHS B;  4OYW A;  4DL4 A;  2C2E A;  1FVQ A;  4FKX A;  1SVD A;  1VJQ A;  4OJ3 A;  1M0S A;  1O8B A;  1RAG B;  1DTT B;  3KNA A;  3EGZ A;  4ECS A;  3MUM P;  4FYV B;  2ZH7 A;  3AY0 A;  2W1B A;  1VK3 A;  2FZC B;  2GO9 A;  1TK0 A;  1WD6 A;  4OQJ A;  3LPE A;  3D3B J;  1D9F A;  2VIC A;  4A8Y A;  1RAF B;  4ZCK A;  4FZV A;  4FXW A;  1JLE B;  3G2X A;  1SJ1 A;  3GR1 A;  3QGP A;  5B0F A;  4DSF A;  4USH A;  5JVG Q;  4RU9 A;  2IRY A;  3F56 A;  3X1L B;  1EB0 A;  3F73 A;  4OIX A;  4DX6 A;  4ANE A;  2VQE J;  4NMX A;  4CLY A;  2PE8 A;  1S79 A;  1U7L A;  1S48 A;  2DH9 A;  2OUG A;  3FNN A;  4KT0 C;  2BQR A;  1PYO B;  1KFS A;  1CC7 A;  1Q8K A;  1HMV B;  1Y4Z B;  5FD1 A;  1EIY B;  4JI3 F;  1NPR A;  1CG2 A;  4XO0 A;  2EG1 A;  3PIP Q;  4CDI A;  4LSN B;  2Z56 B;  3BKU A;  3VVU A;  4ES1 A;  4PWW A;  1IR1 A;  5C2G A;  4KC5 A;  5IM0 A;  4HH0 A;  1CBK A;  1S7H A;  5MAO A;  4F4X A;  3QQC D;  1UJ5 A;  2F3J A;  2RKI A;  3M6X A;  3CIM A;  3TZW A;  2CRL A;  4ETX A;  3SZ2 A;  3TP2 A;  2R7U A;  1FWK A;  5CAA A;  1S77 D;  1YIT S;  2D3O 1;  3TVY A;  1TKZ B;  2IM2 A;  1M5H A;  1BXN A;  3OL6 A;  1X4G A;  1EQM A;  1F0X A;  2DIV A;  5KFF A;  3SCL E;  3N9U C;  2CG8 A;  1RTJ B;  3HHL B;  3PX4 A;  3K5M A;  4F4K A;  1U49 A;  3GIR A;  4X4S A;  2B56 A;  4USK A;  2X1G A;  3DN9 A;  4F3Q A;  4WF9 Q;  3LF0 A;  2O3D A;  2YX4 A;  2AGO A;  4DR4 F;  4XPC A;  3KLF A;  3DLK B;  3NCR A;  5E3A A;  1A7G E;  2B0G A;  3R7N B;  4NLP A;  4M94 A;  2QG9 B;  2DY9 A;  5BYQ A;  4Q44 A;  3QGG A;  1RJJ A;  1OPI A;  4IR1 A;  3OBI A;  1N36 J;  4ALZ A;  4YEA A;  3C6U B;  2D1C A;  2DXD A;  5EWF A;  2J6U A;  2WSF C;  2GMJ A;  1S1T A;  2KFN A;  4TU9 A;  2XI3 A;  1N88 A;  4DV5 J;  3HDS A;  3GV5 B;  2V8H A;  2YKM B;  2LCW A;  3KHG A;  5GAH I;  4F04 B;  3EZO A;  4OFZ A;  2VOO A;  2AYG A;  4CO5 A;  2J8S A;  2EWH A;  1AYE A;  2QFI A;  2F9J A;  4JI5 J;  4C8M A;  4EO8 A;  2VFT A;  5K5M A;  4ITS A;  3BGR A;  4EZ9 A;  3CCT A;  1HBU B;  1YLX A;  1FRX A;  4QIE A;  2FQQ B;  2OFH X;  1RAD B;  4GC7 A;  3QRP A;  2OPR A;  3IMQ J;  2FVS A;  4Q2M A;  2O5D A;  1FKO B;  2XS2 A;  4PR6 A;  3M1V A;  1S10 A;  1KVI A;  2XCA A;  3C16 A;  4CRJ A;  1FKP B;  3OR1 A;  3UN3 A;  3PEH A;  1UL3 A;  3VGV A;  1Y3J A;  3IN5 A;  2IA0 A;  1P9Q C;  2W8K A;  1KFD A;  2HBY B;  1IKV A;  1LW0 A;  4LBP A;  2CPX A;  1HBO A;  3QLH B;  4DPT A;  3MMJ A;  4U8Y A;  3GV7 B;  2UUC F;  2JFD A;  5JVH Q;  2GQC A;  4RW9 A;  5DGB A;  1FD8 A;  4Y00 A;  3DOL B;  2G1D A;  1YRU A;  3DNC A;  3PKY A;  3VQT A;  5J1E B;  3TRG A;  6FDR A;  3R8Y A;  1K47 A;  2RAQ A;  2QA2 A;  3QAU A;  3LWL A;  1VBZ A;  1NSQ A;  1H0H B;  2BOA A;  5L9X A;  2LXI A;  5DM7 Q;  1FRL A;  3SI8 A;  4AD6 A;  1JLG A;  1TMM A;  2KI2 A;  2B9E A;  1JIH A;  4J9P A;  4UOG A;  3EM1 A;  3Q24 A;  2MDA A;  4X4V A;  3W66 A;  1OMS A;  4YB1 P;  1KQK A;  2IM1 A;  3M2U A;  4LSL A;  3VAI A;  1IM4 A;  2ROE A;  5LMN J;  2B4P A;  4TLR A;  2VG7 A;  1EP4 B;  2WHO A;  2XC9 A;  2RD5 C;  3CIZ A;  5GAG I;  2Q6B A;  2YPZ A;  2OTJ S;  2BBE A;  1S5Z A;  3JB9 k;  4DV4 J;  4EEY A;  1D8Y A;  1R0A A;  1TFY A;  4UUW A;  4CIO A;  1R6V A;  4ZCL A;  3JSM B;  2H9Z A;  1X60 A;  1W7W A;  3T41 A;  2XNQ A;  3GII A;  4WFB Q;  4C8N A;  1KNZ A;  4MK9 A;  4AXI A;  5E2Q A;  3SXL A;  4JI0 J;  3ZTR A;  1N0U A;  2XMW A;  1T7P A;  2NZC A;  1TEL A;  3D4J A;  2CQ3 A;  1JLB B;  3V2U C;  1WEY A;  4ZDN A;  3RAM A;  2Y0S D;  1GX6 A;  1HD1 A;  3K89 A;  2DGS A;  2HG4 A;  2Z2M A;  1NK0 A;  3IS9 A;  2VBY A;  4EO6 A;  4LF9 F;  2UXD F;  4A4J A;  3WIU A;  3C6T B;  2KT2 A;  3MM8 A;  3MM9 A;  2W2N P;  2LVW A;  3PTW A;  1SIZ A;  4LQ9 A;  4ER8 A;  2F40 A;  4LSZ B;  2F8M A;  2MQO A;  4KBI A;  2BQ3 A;  2R2T A;  2CJA A;  1UW9 A;  3MR2 A;  1HR0 F;  3OL7 A;  1N6Q B;  1XR5 A;  3MUV P;  5DZ6 A;  3QID A;  1YTY A;  3A8E A;  3T9Z A;  5KFP A;  4DPO A;  1IKY B;  4HI2 A;  1S6Q A;  4RR5 A;  1BWV A;  1L3K A;  4O4R A;  4NYP A;  3D7S B;  3T5H A;  3IBC B;  2CZV C;  2HRY A;  4DCP B;  1CVJ A;  2ABY A;  2Q79 A;  3OXG A;  2ZVS A;  1SJ3 P;  1U1Q A;  3KUE A;  1F5C A;  3CJ4 A;  1XEZ A;  1N5Y B;  3OSP A;  1XNQ J;  1QAJ A;  3KUG A;  4DPY A;  2DGT A;  1UPP A;  1RT4 B;  4I7F B;  2X7I A;  3BGO P;  4DR5 J;  1YBT A;  3MED B;  4ILM A;  1RWU A;  2QYC A;  3G6X A;  5EN1 A;  3MCS A;  2CIM A;  1M5S A;  3VAG A;  1V5I B;  1FRJ A;  3OFH A;  2B5J A;  4RW6 A;  3LAK A;  4IFV B;  3MAA A;  3ITH B;  4J9O A;  2LQJ A;  3J81 j;  2AV5 A;  1RLD A;  1DUR A;  3KNG A;  2L3M A;  5FDL A;  5A6W A;  5LMU F;  1P9Y A;  5BYS A;  1TVR B;  1QJH A;  1WF0 A;  2OFG X;  3ZZU A;  4EMD A;  4USI A;  2W9C B;  4JI2 F;  2ZOM A;  3T5J A;  9RUB A;  4LRF A;  2MKY A;  3BH7 B;  2FZK B;  2XZT B;  1ZS6 A;  4IDK A;  3TR5 A;  1HHS A;  1AA1 B;  3HPO A;  4OYM A;  4FF2 A;  1T9Y A;  4DR7 F;  1FK9 B;  3H4B A;  2RRN A;  3N6N A;  4LF4 J;  3FEY B;  4B3M J;  2EK1 A;  3HI9 A;  3IRX B;  5KT3 A;  2NSB A;  2HKE A;  2XMA A;  2XLI A;  1IBL J;  4DI6 A;  2VA3 A; 
#chains in the Genus database with same CATH homology
 1LWX A;  3L7U A;  1K44 A;  3FC9 A;  3VGT A;  4UOG A;  1NB2 A;  3EM1 A;  1BE4 A;  3VGU A;  2HVE A;  3MPD A;  1NSP A;  3BBF A;  4DZ6 A;  3Q8U A;  2HUR A;  3NGT A;  3BH6 B;  2BX6 A;  3JS9 A;  1B4S A;  1PKU A;  1XQI A;  4ANE A;  1NUE A;  3ZTP A;  4UOH A;  3VGS A;  5C7P A;  2ZUA A;  3NGU A;  1F3F A;  1B99 A;  4EK2 A;  3B54 A;  2DY9 A;  1XIQ A;  2DXE A;  3EVM A;  3Q8V A;  3FCV A;  1MN7 A;  1HIY A;  3Q83 A;  1MN9 A;  1NHK L;  5BXI A;  3VGV A;  4ENO A;  2B8Q A;  1S5Z A;  3VVT A;  3FBC A;  3NGS A;  4CP5 A;  3BBB A;  2HVD A;  1LEO A;  1NPK A;  2DXD A;  1JXV A;  3FCW A;  1BHN A;  1F6T A;  1UCN A;  3VVU A;  3PJ9 A;  3FBE A;  1WKK A;  3PRV A;  3Q8Y A;  2AZ3 A;  3ZTQ A;  3GPA A;  1NDL A;  1W7W A;  1PAE X;  3EVO A;  3EE3 A;  3EJM A;  1BUX A;  4FKX A;  1NDP A;  2B8P A;  3ENA A;  3NGR A;  4WBF A;  4HR2 A;  1NDC A;  3R9L A;  4F4A A;  1WKL A;  3DKD A;  3FKB A;  3ETM A;  3BH7 B;  2DYA A;  4F36 A;  4S0M A;  4UOF A;  2DXF A;  2AZ1 A;  1ZS6 A;  3Q89 A;  4KPC A;  3FBF A;  3ZTR A;  4AND A;  1KDN A;  5CAA A;  1VYA A;  3GP9 A;  5CAB A;  1NSK L;  1NCL A;  3ELH A;  3WX8 A;  1S59 A;  1NSQ A;  4FKY A;  1HHQ A;  3ZTS A;  1WKJ A;  3Q86 A;  4ANC A;  1NDK A;  2CWK A;  2BEF A;  5IOL A;  3EIC A;  3EMT A;  2VU5 A;  4C6A A;  4O0N A;  3BBC A;  3EVW A;  3FBB A;  4DUT A;  1NLK L;  1U8W A;  1HLW A;  2NCK L;  3B6B A;  1S57 A;  1EHW A;  3ZTO A;  4W98 A;  3DDI A;  4DI6 A;  3G2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...