3FC9A

Crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 41
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fc9A00
4DUTA 1MN7A 1NDKA 2DYAA 3G2XA 1LWXA 3ZTSA 1WKJA 3FCVA 2CWKA 1NLKL 1PKUA 1BUXA 3DKDA 3FBCA 3NGSA 3JS9A 5IOLA 1WKLA 1S59A 2HVDA 4CP5A 4DI6A 3EVMA 3Q89A 3NGTA 1B99A 3EM1A 4C6AA 2HURA 3EVWA 3ENAA 2HVEA 3MPDA 3L7UA 1NUEA 4UOFA 1K44A 1UCNA 3EJMA 1S5ZA 3B54A 3Q83A 3GP9A 4W98A 3EE3A 3B6BA 2ZUAA 1VYAA 3PRVA 2B8QA 4S0MA 1NDCA 1XIQA 5C7PA 4UOGA 1NSKL 3DDIA 1WKKA 1BHNA 1F3FA 3VGUA 3EICA 4WBFA 1LEOA 2BX6A 3FBFA 4FKYA 3VGVA 3EVOA 1HIYA 3VGTA 4DZ6A 3ZTPA 4F4AA 1XQIA 1NDLA 3FBEA 2DY9A 5CAAA 1U8WA 3NGRA 1NB2A 1HHQA 1KDNA 4ANDA 4FKXA 1JXVA 1PAEX 3Q8YA 3ELHA 3Q8VA 3BBFA 2AZ3A 2DXFA 1EHWA 3WX8A 4EK2A 2B8PA 2DXDA 4KPCA 1NSPA 2NCKL 3Q8UA 1HLWA 4F36A 3PJ9A 3BBBA 3BBCA 3NGUA 2VU5A 3ZTRA 1NSQA 1NCLA 3BH6B 1MN9A 1S57A 5BXIA 4ANCA 1NPKA 3Q86A 1NHKL 3ETMA 4ENOA 2AZ1A 3VVUA 3BH7B 4ANEA 1W7WA 2BEFA 3ZTOA 3FCWA 3R9LA 1NDPA 3ZTQA 1F6TA 3FKBA 3VGSA 1ZS6A 5CABA 3VVTA 1BE4A 2DXEA 1B4SA 3EMTA 4HR2A 4O0NA 4UOHA 3FBBA 3FC9A 3GPAA
chains in the Genus database with same CATH superfamily
2OEMA 3IWLA 4RNOA 3M6VA 2W1BA 4FZVA 4BLGA 3THVA 2HEKA 1X4CA 1WC3A 1BGXT 1S0MA 3FRZA 2CZVC 3DM2B 4DJBA 3D7SB 1IJFB 5FLXU 3CWJA 3DLKA 2OTJS 1QUVA 1MSWD 1NJWA 2IVYA 4GC7A 5ETNA 1XIQA 1BQXA 1CJVA 2EC2A 2XMJA 5ADZA 4XDCA 1LXNA 1YITS 4DPYA 1N5TA 5FDLA 1J5OB 5C2CA 3OFEA 1FRIA 1C2PA 4CLKA 2HHVA 5THWA 4M8LA 4Y2KA 2NXJA 1KTQA 3B4DA 3CCMS 4B3MF 1OPZA 3HHKA 1YKWA 1R0CB 4ZVQB 3KFWX 3DMJB 2ZVIA 3PX6A 3R2CJ 2OSQA 3O8WA 3RRGA 1EZZB 2CVIA 4RW4B 2E1RA 1FHTA 3CC2S 3GPAA 2D3UA 4NZ6A 5DO2A 1SJ3P 1C0UB 2H4YB 4ZK7M 4NEYA 4J9PA 5B0AA 2E9RX 2FLPA 4DI6A 3H0PA 2PGCA 3NCRA 5GMDA 1RHMB 3HM9A 3RZAA 4NXNF 1N36F 1Y5LB 3WBZA 2ZFHA 3PO4A 1GMUA 4WP8A 2AW0A 1X5SA 3BF4A 3ZZRA 3R1LA 2YWFA 4C98A 4KO0B 4FS1A 3VQTA 2R4FA 2ROEA 4J9VA 4QR1A 4AQYJ 2BJEA 2G1DA 3C15B 3MECA 3C8YA 2ZH5A 1FI4A 4PQUA 2KT3A 5CHCB 2R7XA 5ETVA 4QWDA 1UWAA 4RW8B 1C4CA 3KDOA 2W9CA 2BW7A 3SFGA 3A3OB 5ETKA 4N77A 3KWMA 2O01C 2DHSA 3MURP 4IH5A 4QWCA 3DOKA 5D6GA 1ICEB 1P27B 3I9ZA 2NPFA 3OUYB 4JYAJ 5F0WA 2MQPA 1P8GA 4I69A 5F8LA 1RHRB 5C24B 3MM7A 3AOAA 2AEJA 4G1IA 2I6WA 4DV2J 4UY8T 3I55S 1SIZA 5BYRA 4IO9Q 4WIQA 2WVBA 4EZ6A 5D4OA 3PRVA 4IKAA 1NU4A 5GVQA 1FWLA 2PSZA 3V81B 3ZO7A 1FEEA 2B4PA 2KHDA 3VZIA 3M7VA 1HBNB 3VAJA 3RAQA 5K9FA 3IGNA 5EUHA 2G2ZA 4DLEA 2E1AA 2AX1A 4NYPA 4KE5A 2HNZA 1U8WA 4JI4F 1HBMB 1OYDA 5RUBA 5B08A 2K7KA 1T9YA 5DJBA 2Y1JA 4PXBA 3O1LA 4NE9C 4DV7F 4B3TF 5JVHQ 2FC8A 3LTOA 2IDLA 4OI3A 2CADA 4M5DA 3TUIC 2HWTA 4ECYA 2ZHBA 4YR3A 3C16B 4ECVA 1TUWA 4K4VA 2ASDA 1GTEA 3IN5A 4J9KA 5EWFA 4A8MP 2E5HA 5JUMA 2X1GA 4ED5A 5K14A 1XMQF 3OL9A 4NXMJ 2RIJA 1LK7A 3HHLC 3OXFA 2FLLA 2EFOA 5DLFA 2MQQA 2HWHA 5KFHA 4BHQA 3PJXA 3EYZA 2J7UA 1KRPA 2DCUB 4M5JA 4ZPCA 3EVWA 4QBUA 2VPWB 3AJ2A 1RP5A 5HVFA 3KLHB 4Q8FA 3GIJA 1LWEB 1FEHA 3B6BA 4UOCA 3QGGA 2XO6A 1JLCB 1SC3B 1N54B 1WOOA 5LT5A 2ZNYA 3CJ0A 2XLIA 4HH0A 2X3GA 3VGTA 2CQ0A 3ZTPA 4M63A 4MAKA 1I1GA 1XMOJ 4NZ0A 1RTHB 2Z56B 1WD6A 3OVAA 3J7AN 1P1TA 1IKVB 2V0NA 5DETA 1ZTWA 1NCLA 4MJKA 2AKWB 3J81Y 4CLUA 4X4QA 3RBEA 3ET6B 2CQ4A 2CDQA 1VIXA 2JVOA 3W5YA 5T7LA 4M95A 1V3RA 4ID5A 3MXHP 3CJ2A 2IMWP 3OXGA 4I6YA 1F6TA 2ZOMA 2FGCA 3NOCA 4ILMA 2JEIA 4DG1A 2PMZD 4G1PA 1FX4A 2ROGA 1VCTA 3HMJG 4YMEA 1AFJA 1H72C 4NLXA 4PUOA 4PG8A 2IPOB 3M9OB 1HWUA 4DPTA 1U1QA 1UAWA 2AF6A 4RBVA 4PPZA 1EETB 3PG9A 5B0GA 4NLWA 4F7VA 2XYPB 3CC7S 4NL5A 3K5LA 1X9WA 3GR1A 2DD8S 2HSEB 2BOPA 2XMAA 4DQQA 2MJUA 3R6LB 2BJDA 4JV5J 2WW8A 1VQ7S 2RS2A 3GIMA 4A8QA 2R7QA 3GIKA 4QR0A 1GMWD 5DZ7A 1UW9A 3TWZA 5D15A 3I0RA 3ZZPA 4HHHA 2YY3A 4KRWA 2I5JA 2KRBA 4OZ5A 3HKZD 1KWMA 4LQ3A 1F1BB 3WIUA 4TY9A 4L72B 4ANEA 4ZVRB 3IR5B 1TKXB 2OPSA 3C46A 1A6LA 3BGFA 4GRSA 1PYOB 1BE4A 3LPYA 2YKPA 4AL7A 1R8AA 1UVMA 3R8YA 5F8IA 1IKXA 2FJBB 1IBLF 4H4MA 5CCLA 1HQ2A 2JLGA 2HFZA 2HHHJ 4ZDNA 4J37A 4QYZK 2KXNB 2E5GA 2GFFA 3R5AA 3MMCA 4OV1A 4G6VB 3CCRS 2SXLA 3HK2A 5E33A 3VAHA 2XZDB 4B3MJ 4HH1A 3P5TL 3POTA 2HG4A 3NGKA 5F8HA 1TKZA 1SBRA 3HSZA 4I2PB 5AE2A 3RGIA 1D8YA 1NDLA 3DLEA 4UQGA 3AB2B 4DUZF 2KZZA 4I6AA 1UVKA 2DNZA 1FA0A 2ERRA 4FVMA 2I2YA 2DHAA 2VBZA 3CUNA 1S6UA 4HDHA 4H4KA 4CLFA 1FK9B 2F8HA 1JJCB 3FJ2A 2CKWA 1BWVA 3I0SB 5SZTA 3ZNJ1 1KVKA 4NXNJ 1N36J 3MMBA 5I3QA 3LANA 3DI6A 1YBAA 1AB8A 2MKJA 4JB8B 3DLGA 4IG3B 4KGXB 1R0AB 4L74A 1MG7A 2D74B 3SIPB 2DHGA 1SC6A 2GA7A 1RT6A 4ECQA 3UD4P 1HWIA 1Q95G 2VKRA 3A4TA 1U1PA 2QYGA 1VGYA 4ZHRA 2VC0A 4PKDB 4DCJB 2VG6B 1AUSL 2N3LA 5KFNA 2XC9A 4K5RA 1WACA 4O3OA 3A3NB 2EK1A 2K8GA 1SH0A 1RTIB 4QJVA 4NLTA 4KPCA 1W2BR 4ERDA 4XPEA 5HANA 2YVSA 1V9OA 2PDAA 5BXIA 2NYHA 1Y5NB 2N7YA 1H3DA 2C1EB 4IDKA 3HXMA 4OJHA 5B0EA 5KFJA 1B0PA 4L73A 2V9WA 3VR1A 1RT4B 4DFJA 1FRKA 4DUTA 4RW6A 5CH7B 2Q43A 4ECXA 3LW5C 3BQ0A 4WFYA 3NBPB 2CAJA 3W3SA 4KTQA 1ITPA 3G82B 4C0BA 2O1PA 4QR2A 5HAOA 2LU1A 2YH0A 1EKSA 2ZVSA 1KHVA 2YNHB 1XR7A 4JI4J 2HZCA 1YBUA 4QOTA 1XR6A 2YQ0A 2HIQA 2XMUA 3VGUA 1AROP 1R6VA 4LRBA 1S72S 7FDRA 2V8VA 4DV7J 3GLJA 4B3TJ 3QATA 1O5JA 4DPUA 3TO8A 1N5YB 1DHMA 5DDRC 2AGPA 3EZUA 4ZVGA 3ISNC 1BD6A 5BR8F 2HK3A 3SQOP 1WHXA 5J2QB 2KZMA 2DXDA 4KHMA 5HQMA 1FRMA 2HQIA 1XMQJ 3CCSS 1RDRA 4OI6A 4PYDA 3UD3P 2RF2B 3D6MB 4JI8F 2V34A 4WK3A 4RWXA 2ZH6A 1DARA 5L1IA 1D9AA 5HJXA 2M52A 2XB2D 4ZLNA 4FXVA 1V3ZA 3MPDA 5L8RC 2R9LA 3DU5A 2D69A 3CW2C 4C2MA 2CWKA 4OYAA 2GQQA 3I5CA 2UV8G 2HBQB 3IBCB 1CULB 2H4WB 4ICLA 2K3IA 4J9MA 4B9SA 1WC0A 4OZNA 2GVDB 2YNGB 1D09B 4N7TA 4OHYA 4UZCA 1BWEA 2M0GB 2XSJB 2ZZTA 3PKMA 1RU2A 1TL3A 4M1KA 4B08A 2ZWOA 1HNIB 1NSKL 4ZPDA 1NRKA 5E41A 1IXKA 1VQNS 3C66A 3GIIA 3OR1A 2IJFA 1X5OA 1ZPVA 1VQ6S 2DRAA 3RR8A 1XR5A 4M5KA 1E6VA 2VHGA 2AZ3A 3CCWA 1DURA 4EK2A 2IIHA 3GV5B 1C4AA 4NLUA 2LVWA 3BSAA 3E3XA 3OLAA 4USTA 3IM9A 2MKSA 1GAOA 2AGQA 3MI7X 2VG7A 2WVEA 4K4UA 3HHNB 4RR5A 4FVCA 3US5A 2HNDB 2VASA 1RWVB 3JSYA 3OXLA 4CCHA 3CJQA 1T9TA 1BMQB 3MF5A 2A18A 3T19A 1RKJA 2DNQA 2CWXA 4P6QA 3ZNUA 1ZAVA 3HVRA 1MU2A 4J9SA 3LGMA 4QZVB 4HYKA 3GFXA 4MIBA 4ZCMA 5DM7Q 4E0DA 1VQ5S 1O6XA 4IR9A 1RTJA 1ZZNA 3BM7A 2QLBB 2RKIB 4B3OA 4KGZB 3NNHA 5HQ8A 1U25A 3GP9A 2HBRB 2V4RA 4X4VA 2MEWA 3SFUA 2ZHOA 3KHHA 1M1GA 4NZ7A 5ETPA 2VUGA 5KOWA 1CC7A 5CA5A 3W9HA 3M05A 2IM0A 3QFWA 2C2KB 2OPQB 1TUGB 3KJVA 4AXIA 3AAWB 2XGPA 1RT2A 1TK8A 1IKYB 4Q43A 2VPZB 3Q8QB 3DYAA 2IY5B 1CJUA 3DXBA 3W5ZA 3ZZUA 3TQ1A 1FDBA 3CJRA 3LF0A 4ZCLA 1IBLJ 3SEOA 4K5SA 4EGLA 3UVJB 3D1QA 3C6UA 1F2GA 3RJMB 3OPKA 2KFYA 5C25B 5L9XA 2HNYA 3TA1A 1TAQA 4WTYA 3HVWA 5MAOA 2BABA 2C22A 2YPZA 2QX0A 1UVLA 2DGSA 4A46A 3RYLA 3VQSA 4WZMA 3J7ZT 3IM8A 4RW7B 1UMJA 1HQUB 3RB4A 2RE1A 4OZJA 3PZPA 1FWKA 3CIZA 5B09A 2KXHA 2XHCA 3ENAA 2K7JA 2FY1A 5D0GA 1XWLA 4DL2A 3V4IB 3E8OA 3FMBA 5IV3A 3CMES 1G1XA 4DUZJ 3HT3A 5HATA 3MM8B 2QZ8A 2DBBA 3L4BC 3NS6A 2MSTA 4OLPA 1PSDA 3FNNA 5HROA 2VF3A 3IP0A 1W2IA 4B3RF 1YJRA 3GFZA 5F41A 4K4YA 1X4DA 4JBCA 5GAGU 2UV8A 3CULA 4F4ZA 1Q8BA 1Y5IB 3NGUA 1AT1B 3W8GA 2KHCA 3OVSA 2B7CB 4OX8A 5CD4H 3D5MA 2MQOA 3R7SB 3DN9A 4CLPA 2BZ2A 2U1AA 4P9SA 2IVMA 4ES3A 2VJVA 2LEPA 4WFAQ 2JLFA 3MR5A 3O3LA 3M1VB 3RRKA 4TQSA 3O5TB 2FLNA 4DSLA 1U09A 2NXNA 3N79A 3CDUA 1N8RT 1NK9A 4PYAA 4CLZA 3QGPA 2AJ0A 2E7WA 4Y00A 2AYMA 5EGYA 3AXMA 3B82A 5D4PA 3DRSA 2YKMB 3MPYA 1X0PA 1Q86T 3G4SS 4S0MA 1WC1A 4I0WA 2ZBCA 2NXUA 2HPUA 1SJFA 3T41A 5D4NA 1NZ8A 5KFAA 4JP8A 4ER8A 1S1TB 3MPVA 2G2YA 4TN2A 4Y6IA 2WRMA 2JC1A 4O44A 1JXVA 4YB5A 1X31C 2DNRA 2HMIA 2RU9A 1DQAA 5ETTA 1Q5VA 2YX7A 4EWTA 5C2GA 4DX6A 5HQLA 1V5IB 2B9XA 4LR8A 3V4MA 3HO1A 2XBPA 2E5LF 2Z58B 4J9LA 4G1QB 1D9DA 2DGVA 5HP1B 2ZE2B 1G6BA 4NI2B 1S6PB 2K1RB 1T94A 1NPPA 3G8TA 3T5LA 3LGHA 4YUDA 4TU7A 2P8IA 5H9FK 2GAHC 3CO9A 3EJMA 4WYLA 3HX9A 5JXSA 3FMWA 5BR8J 5F8JA 3VAFA 2IC3A 2PFFB 2W8LA 3MMAA 4ID8A 2CQDA 3UW1A 5C42B 3KG1A 4ITSA 3S6EA 4N41A 2V67A 3MEEB 3P96A 4JI8J 3SDEA 2XCPA 5L1JA 4YB6A 4C8YA 1Y4ZB 3ONQA 4Y2AA 2ROPA 3W60A 3IA0A 1ELOA 4O4GB 4OYPA 4QQBA 3BO2A 1URRA 1SC1B 1DLOB 2XMWA 1X4AA 1TUVA 5IQ6A 1DY3A 1F9HA 4P2SA 3OVBA 2GMHA 3TR5A 3QPIA 5K8PA 1FKPA 2OSRA 3PV8A 4DCOB 3K57A 4P75A 3H5SA 3DOMB 4IFYB 4YEAA 3CCUS 3NMRA 3P8BB 1P1LA 1CQMA 1WELA 1T7PA 5KG0A 4OZ2A 5M2RA 2X1BA 3MD1A 2XY6A 1UCNA 3D28A 4M5MA 3B54A 2HAIA 1R7IA 2R8IA 3TX0A 4IG0A 3EDRB 3M8SA 3HHLB 2XYHB 2KG0A 2VB6A 4IRKA 3FZ2A 2Q66A 2GNKA 2RD5C 3OTEA 4I6WA 2GVZB 1VBXA 1HKAA 2XS7A 3BBFA 5JMNA 4ED2A 3U02A 1CJTB 2UP1A 3IWNC 4ELUA 2QLWA 1MN9A 1M5VC 3D3BJ 5LJ3Y 3BH7B 1N0UA 2RU3A 5E5NA 5AXMA 1FRJA 1IVZA 1S49A 2WONB 1N48A 2OPPA 2EFQA 1NK6A 3E01B 3K7RA 2DNOA 4RNMA 4ZP6A 2HVDA 4B9NA 3ZFVA 1IKWA 3HULA 5KAKA 5A6WA 4Y2IA 5KG7A 1UZDA 4OI2A 3GU0A 4RWWA 1WTBA 3UNYA 2QG9B 1VYAA 1RBOB 2OO4A 5IT9U 2WHOA 5B7WA 4MYUA 1S7IA 2LQ8A 4QPTA 3NG8A 2LQ5A 3BGRA 1TTHB 4YS2A 5EWGA 4DV3F 3M8WA 1RHUB 2OELA 1U1RA 1JJHA 2OFGX 3UCUP 4A4JA 1WSRA 1F60B 3A13A 4B9LA 5I3PA 3RUBL 4RW9A 1UA1A 4YB7A 2GX8A 2QN6B 4USJC 3HDSA 1JLAB 3GCXP 3Q8SB 2DKOB 5EDWA 1OS5A 3Q8PB 4QWBA 2ALZA 3M6WA 5KFDA 2GIFA 1UVNA 1T9VA 4TNOA 1WKLA 3BKUA 1ZETA 5DG7A 4B3RJ 1OQ6A 2HLTA 3HVTA 2ATCB 2BE2A 2H1YA 4I7FA 4X65F 2YWWA 3N5BA 4CH1A 1T03A 2J76E 5DG9A 3CD5A 1LW0B 4F4YA 1JLQB 1YI2S 4IFVB 3SCLE 2OUGA 4PG7A 3NAHA 5IM0B 5G0RB 3I5BA 2MLYA 4ZVHA 2DNYA 1OY6A 2DNPA 1M5PC 2IAJA 5IT0A 2HS4A 2QL5B 1S97A 1CSJA 5IXUA 2AHOB 1W7WA 2GGPB 2IJRA 4ZPVR 4X4OA 3TVKA 1F3VA 2L9NA 2FC9A 4TY8A 3RRHA 3BO3A 1HNWF 2Q1LA 3FK4A 2QFIA 1R43A 3MR7A 4USHA 3M8QA 1IR2A 2CPYA 4USUA 2BRKA 1LW2A 1GMWA 4ZVTB 3SQGA 2A10A 3AHPA 2KYXA 2H5EA 1K0VA 1GX5A 4PABA 2IBOA 2BRLA 2G13A 2B9EA 4XIUA 4HL9A 2DNLA 1MMDA 5KFCA 3T9ZA 3W2WB 1KLMB 1YJ9S 3LH2S 5F3ZA 1VQKS 2ACYA 5D8HB 2EXUA 4FKXA 3R1HA 2X51A 1K9MT 2E5LJ 4RKUC 3QT8A 1B0TA 2BKNA 1TL4A 1Q79A 2QT7A 3CE8A 1I6JA 5HMYA 1JLFA 4HLBA 1HYSA 2HHXA 2NREA 5HLFA 1UEVA 4KFBA 4OYBA 5A2QY 1Q4RA 1RAFB 1MMLA 1RTDA 1HFEL 2ZNZA 4DPXA 1WG1A 1PAUB 1TL1B 2MMYA 3GG1A 3J80U 3KLEB 5E3QA 2LECA 2QA2A 1MROB 5J2PB 2KVIA 1HBUB 2R8GA 4X4SA 2D7SA 4WXWA 3ITHA 3RBZA 3DHWC 4CO5A 3BN4A 1IWGA 4ED8A 1NB7A 3MM6B 2V8HA 2UVVA 4UW2A 1V5VA 2CJXB 1OPIA 2HK2A 4KT0C 1X4FA 1NK5A 3MMJA 1KD1T 5HI7A 1X8DA 4RUBA 3VGVA 1RYSA 4C8KA 3TARA 4OJ3A 1FF2A 4F50A 1HQEB 5H9EK 3IG1B 2Q6CA 3ELHA 3GYGA 4EBDA 1EHWA 3NCQA 4YOEA 1LWFA 5IV4A 3GJRB 2KO1A 2RS8A 3R5JB 4OQJA 1Q78A 3FQKA 2XHWA 2HQDA 2BANA 3TEHB 1M0SA 1OIAA 2GZOA 5GADI 4Q7AA 1CJKB 2YX4A 4CT8A 4JV0A 1JK9B 4ES2A 3K5OA 4LUBA 5ITHA 1NDKA 2CJAA 3MEGB 3G2XA 5HVHA 2MKCA 3B4MA 1U0SA 4KQZA 4YY3F 2ZJQQ 5EWEA 2OEJA 4KY3A 1DQ9A 5U47A 3W65A 3RAXA 4X62F 5AE3A 2POKA 1CS4A 1SQEA 4O3PA 2WVFA 4NLOA 3E51A 3FSXA 1RB0A 3M32B 2MHEA 1Q8LA 2V69A 3VAMA 4W98A 3D6HB 4LF2A 1EJ7L 3ISND 3SBMA 3NS5A 2DRDA 4B9VA 4DSIA 4H54A 2LDYA 2E44A 3TA2A 2XY7A 4EYIB 2F3JA 3IRXA 5K5MA 2HS0A 4O3SA 1LKZA 2X3DA 4RU2A 3DLBA 2CQBA 4FBTA 2DNMA 4WZQA 4PXEA 4U6PA 3JQJA 1HWKA 3ETMA 3QRPA 1S6QB 2V8PA 3IR6B 1UPPA 1YTYA 2XZWA 1OSCA 2Z57B 1B4SA 2W2MP 2KRRA 3KDNA 3SXLA 4CTAB 4HI1A 4LFAF 3ENQA 1M5HA 2UUCF 4USWA 5KG5A 3X3UA 4DWIA 2MQLA 5E0OA 2ZUGA 5D3GB 3SYZA 1B99A 2O5DA 1U2CA 2MKHA 5J2NA 3D67A 3K59A 1H7XA 3KG0A 3KTQA 1I51B 3HI9A 4J9NA 3KLGA 1GFWB 4DV3J 4MKVA 4DBQA 4H4OB 2V2QA 2G0IA 3V6DB 1A0OB 3EXCX 4DFKA 3SCIE 1JJ2R 3KYLA 3MUTP 3OD2A 1B7YB 3SSQA 1GTHA 4DN0A 1N34F 5IC4B 2FJEB 1HMVA 3MWBA 4E8UA 4LMZA 1SQFA 4HT7A 1WEZA 4PXDA 4OL8A 1TKDA 2BJ7A 4CO3A 4KV8B 4JI1F 2HFVA 2CNKB 4ZVEA 2JC0A 1K1QA 4HR2A 1WOPA 4UUWA 4LF6F 5AXLA 1FD2A 1NLKL 4X65J 4U7UD 3UI3A 4BCAA 3W2VA 2VFVA 4UOFA 1S6QA 1Q5YA 1QAIA 2YQ3A 2Z2LA 2VA2A 2XGQA 2G9OA 2IA0A 3G71S 1HPZA 1KTVA 4KAIA 4NA3A 1KEKA 1TFYA 5IZHA 3KUEA 2PI5A 2E7XA 2NYIA 2RAQA 4UQTA 1U0HB 4OYXA 3QZ7A 3MHYA 4C8ZA 2QMXA 4I1TA 3PTWA 2WBMA 5K20B 4MKAA 3MPWA 2R7UA 1RI7A 5BYQA 1X7VA 4C8OA 1HNWJ 4TYAA 4BC9A 4H4KC 5D0RA 2XCAA 4AFFA 3PKYA 1YQHA 2EKYA 5DQGA 4JV1A 5ETSA 4UF4A 2NZ4A 1S6OA 5KG1A 3EZ5A 2L9WA 3KNGA 3IWXA 1BQMB 2MYFA 3M8ZA 2E7VA 4NCAA 4DX8H 4PXCA 1QVFR 1CPZA 3M8PB 3DRXA 1FERA 3D9BA 5CYMB 1TZ0A 4HTJA 4F4WA 4USVA 5KFVA 1PGZA 1SIWB 4FYYB 2FJXA 2H54B 1APSA 2DY1A 1O0PA 3KLFB 4GMKA 1HI0P 4LFBF 4DU8A 2FPHX 1YIJS 1LK5A 2YQ1A 3HFKA 2DXFA 2DGQA 3RU0A 1PIEA 2Y8YA 2QLFB 2YH1A 2N82B 4C0HA 3V6HA 1N33F 5F9NA 5F9LA 3OFFA 3KHLA 4OI0A 3ZTOA 1QE1A 1QAYA 3F56A 3M30A 4NLRA 1YVFA 5H9FJ 3FKBA 1N6QB 2AWZA 1X9SA 5L9NA 4GVBA 1DTQB 3D4JA 3FCVA 1KONA 3MR6A 2C3YA 2A6OA 1S59A 3NNAA 4CH7A 2OJ3A 2M7SA 3T3FA 1NJZA 2CXEA 4FF4A 3FSIA 2GO8A 1V3SA 4WPAA 2FVRA 2WK4A 1NJYA 4IH6A 2EBGA 2B0GA 3D6TB 3PJWA 4F04B 1WI8A 5L38A 2YKNB 1FDNA 5T14A 2FJDB 1RYRA 2XYGB 1AA1B 1REVA 2VBYA 3P45B 1JMTA 3HSGA 1RAHB 5DM6Q 3BB5A 3M2VB 1RQ0A 2B9YA 4LSNA 3Q23A 2AJ2A 5BYSA 4EMDA 3GILA 4YY3J 1TFWA 1GT8A 3H8YA 4FF3A 2KB2A 5J2MA 5KOXA 4X62J 1S9EA 3TA0A 3JAMY 5HSPA 4DEZA 3H2UB 4G65A 2JLEA 3JSMA 2XLJA 1C0TA 5LSOA 1SJQA 1FD8A 3HCXA 3GJTB 2WSEC 1OMSA 1FFGB 5GMKa 2UUWA 1BQNB 3EM1A 2RRAA 3D66A 2PO4A 5F8NA 4WFNQ 3MCSA 2OI2A 2LDIA 4E2FB 1ZAXA 3FFIA 2DGUA 2LMIA 1P6TA 1UWBB 5ETRA 2JSXA 2FQQB 4B9MA 5A8WA 1RT1A 1F3FA 2AU0A 4Y34A 3FDSA 1RAAB 3JSBA 2ZH4A 1S1XA 1TP7A 1S1UA 3MEDA 3N4WA 1NSPA 2HS3A 3JQMA 2AJ4A 2N4DA 1YWXA 4ZP9A 1RKIA 4ZVOB 2C2NA 3NMAA 4OHZA 1PC4A 1IR1A 5LMNF 4LFAJ 4NLYA 4WFXA 2UUCJ 4LF5F 2XQCA 5IT4A 4F2SA 5C5JA 1HHTP 2HRUA 2CFXA 2J8AA 5HBMA 4YHHF 1LFWA 4PPDA 1QAXA 3AD9C 2QC3A 2KYZA 5HMWA 4M5LA 2HBZB 2LCWA 1Q7LB 4ZVUB 3Q83A 3KXDA 3VHQA 2I8EA 3HJFA 2E29A 4B9UA 1N34J 5H1SV 4FYDA 3H20A 4FYXB 3TJAA 3M2UB 1VBZA 4LRDA 4L76A 2B5JA 1U1KA 3KUHA 4ZPBA 4OMFG 1TMMA 2F8EX 4JI1J 1GEHA 3QAUA 2PMHA 2EI5A 4EYHB 3PJ9A 1B0VA 4NCGA 4MH8A 5HO4A 1RT7A 1C1CB 4C4WA 3QIDA 4LF6J 5KFKA 1JLBA 4CRJA 1N32F 2O66A 1VRTA 2MHNA 3ENWA 2UUTA 3PW0A 1S9GB 1WI6A 1YJTA 4K4WA 3C3LA 2B43A 3PRDA 2CQPA 5AXNA 2V50A 5HMXA 2DR9A 1T9XA 1TVRA 3RB6A 3JYTB 1T8EA 1VBKA 3KJFB 1WF1A 1H2VZ 2C2ZB 3BDPA 1S12A 2DR7A 1H74A 3OL7A 2MXYA 1LWCB 4ZVSB 4WU3A 1R3NA 2W9BA 4ZCIA 2VQEF 1S1VA 2DCLA 1FXRA 1VHFA 1XK8A 2RHQB 3QJJA 4A8KA 2P5VA 3MCOA 3RTVA 2RUGA 3WC2A 2GIRA 5A6PA 5IWAF 1Y0HA 1CJVB 4W92B 2FHKA 3FZBA 5I4MA 3QJLA 5FJ4A 3G96A 3Q86A 5FDLB 2VH7A 1XC9A 3I4HX 3R2DJ 2AZ1A 1T05A 3F41A 1F5AA 2N4CA 1VQYA 2DNGA 3SSRA 2YBVA 1F5CA 4EU0A 4DFPA 3H7HB 2MQNA 2R7SA 2ZC3A 3TW0A 2IVFB 5A8RA 3MTKA 2AX0A 2K3KA 1ZOTA 2F5GA 2F7VA 4R5PA 1F0XA 1KN6A 1KLNA 4N76A 4LFBJ 2WVCA 4C3LA 4RNFA 4LIRA 4I4BA 2NSBA 2Q6BA 4WBFA 3IS9A 2JFDA 4ZJQA 1TL7A 4ECWA 1WF2A 4MMOA 3IRWP 4DUYF 1O8BA 1N33J 2BE9B 1RT5A 3M6UA 1AXQA 2J0QD 4IQXA 1M1KT 3ZZZA 4QIGA 5I3UA 3TUJC 2BE7D 4NRTA 2FVCA 3LGNA 4EI2A 3V6KA 1MMNA 1ZBTA 1IR0A 2WSCC 2JZ5A 4Q44A 3MECB 1DTTA 2DH8A 4GKKF 1VQ9S 4PQUB 4K4XA 3C14A 5CZXA 2QLXA 2ZH7A 4L3NA 4BWJA 4DSJA 2W9CB 3KK3A 3NGTA 2DVIA 2IJNA 3PYGA 2VICA 2VA3A 2FZKB 4EZ9A 2RUSA 1FESA 3DOKB 4QIWD 5H9EJ 3K17A 2VODA 3H5YA 1TKTA 3GJQB 2W01A 3MM7B 4LSZB 2IM2A 4NEZA 1PCAA 3I87A 3AH6A 4KKOA 2C2RA 4ETXA 2OPRA 3KLVA 4HKQA 3MAAA 3JQKA 3OTBA 1WC4A 3N6LA 4DL7A 2XULA 3K5MA 2J6SA 4WWSA 3K5NA 2LFVA 3QSYB 2HNZB 3THPA 3R7NB 3R27A 4HVZA 5J1EA 2A0FB 1SKRA 3EMTA 2J8SA 1U7LA 2YNFA 3MM9A 4DX7A 4DQRA 4PWWA 3NNCA 2NXEA 4M5DB 1C1BA 1S48A 5T41A 3DGVA 3UR3C 4WE1A 3D0HE 3MOZA 2RILA 2C3OA 3G9CA 3PFEA 2UXDF 4D3GA 2WOMA 1GMVA 2IM1A 2FVPA 4ZLPA 2JJ4D 2Y9HA 1HW9A 5K14B 4U7CA 4WF9Q 1QDUB 8RUCA 2ZUAA 4FPIA 3OV7A 1U49A 4M94A 1UVJA 1TV6A 3AOCA 1YRUA 3BPSP 4FNHA 4NYZA 1R0BG 3QLHA 5AE1A 1NB2A 3QYYA 4PG6A 4HACA 5LMNJ 2BA9A 4CO2A 3L7OA 4LF5J 3W8PA 1FFSB 4M5HA 3WQPA 5EX0A 5HN0A 4LREA 4YHHJ 3WHIA 7AT1B 1NHKL 2M88A 2CJQA 3IR7B 1VQOS 3L9ZA 4HI2A 1VDHA 3TZXA 1YBTA 5CABA 3LWMA 1PBAA 4F02A 1MWZA 1EP4A 1ZM9A 1RCOB 3RW6A 1UEKA 3S1TA 5ETLA 4J91A 1YJUA 5T7LB 2DITA 4CLSA 4ID5B 1X4EA 4ZN3A 1EX8A 1Q8KA 3EDQB 1DRZA 4N8NA 3LUYA 2HGLA 3AFGA 3H59A 3S7RA 2V94A 2DGXA 4DG1B 1BXNA 2Z2MA 1AZSA 3DOLA 2ZBRA 4PUOB 5A0YA 1VFJA 4WK1A 3CJSA 3PYFA 3PDNA 2IYGA 1RT3A 4LRAA 3PEJA 2XWYA 3CCLS 4ZN1A 5F0UA 4DV0F 4BBYA 1N32J 4HHJA 1PO6A 3B78A 2NCKL 3N5FA 4RX6A 3R3TA 4P2FA 3JTOA 1KVIA 3VV2B 2VBWA 3PXGa 5DRKA 4OYIA 3KJQB 3A8JA 2YWKA 1S1WA 4PZVA 2OMLA 4XPCA 2Y0SD 4RPFA 1RACB 1KQFB 3MGJA 1U4BA 3I4PA 2RDIA 4EBEA 3I0RB 3H4DA 3HJVA 2P9GA 1M5SA 1OO0B 3W1YC 1WJ9A 2I5JB 2AYGA 4MTPA 5GAGI 3DRPA 4P71A 2GV1A 4CYUA 2VQEJ 1JKHA 2OPSB 4NRUA 1NM2A 2KU7A 2F9DA 1OJ4A 3RR7A 1ZTTA 3ZC4A 5F8GA 5IQQA 1IKXB 1NPRA 1OY9A 2C3UA 3GZ7A 1FDDA 4H4MB 2DO4A 2BJ9A 2CPFA 3N01A 2R7RA 3LALA 2Q79A 4MK7A 2W2PP 3DLHA 3MR2A 1L3TA 3QIPA 1EQMA 2D1CA 3D0IE 3MMCB 2JEJA 1HNVA 3PIOQ 3POTB 1TKZB 2FHJA 2CQIA 2ZM6F 5E3AA 3DLEB 2OP5A 2J6TA 5KT4A 3UDCA 1YZ7A 3FEXB 4A8OA 4DF8A 4Y2CA 5D78A 3P3DA 1UP1A 3KK1A 2P9EA 2IDEA 2MPUA 1VC5A 1FKAF 4DZDA 2IHR1 2I1RA 4IUFA 3H2VE 4OHWA 4MT1A 3LP1A 4X4UA 4URSA 3OFHA 3UE2A 1DQ8A 4KH1B 2OHDA 4DUYJ 2ZD1A 1RAJA 3MMBB 3DI6B 1X4BA 2MGZA 4EO8A 1OWXA 1SL1A 1X0FA 4DXLA 3DLGB 1HL6A 4Q0BA 1RT6B 4LF9F 3LO3A 1PJ7A 4P2XA 2CZ4A 3S01A 2IRYA 3SI8A 1OY8A 2LXIA 3I31A 2XTJP 4F3OA 4N47A 4ZHRB 3ZZOA 1XMBA 4GKKJ 2W2OP 2LEAA 1SH3A 3ISZA 2EFGA 3DC2A 1YX2A 2IM3A 1RWWB 1QSYA 3NWGA 2YKAA 1WEXA 4DV4F 4Y0FA 3TI0A 5KFEA 1RWPB 2LLZA 1RBAA 1JWWA 4IDKB 3QO9A 2J7WA 4DS4A 2C2OB 4FXDA 2R7OA 2OIHA 2FD2A 3KK2A 4RW6B 3NGDA 4PRFA 3M8YA 3GSIA 4C7QA 3KHGA 2B4VA 3W62A 1VISA 1N56A 1XQIA 4NMXA 3CJTA 1UW4A 3DGPA 3OW2R 1T3NA 2WSFC 3BEGB 2APOA 3VWSA 1KP6A 1ULRA 3O44A 1HLWA 2VL1A 1VQPS 3FSYA 4DR3F 1Q81T 3TJ9A 2NR0A 2OGUA 2KFNA 3DFEA 2MY7A 1ROFA 1PJ5A 3NWRA 2NPIA 4ETZA 3NAIA 1UKUA 2C2EA 5GAEU 1X5TA 2HHTA 3ULHA 1JLGA 2UXDJ 2LQJA 3HT0A 1UJ4A 3AY0A 3KMQA 2YWEA 4LIWA 2GQCA 3MCNA 1S10A 3Q89A 4J90A 3TNVA 3CF5Q 3J81U 2GMJA 4OYZA 3BJYA 3M6XA 4DF4A 5M2PA 3CDAA 3EZOA 2DR8A 4U67Q 1KC8T 1NKCA 2W2NP 2BKOA 4FS2A 1Q16B 2VZ9A 4DPOA 2E5IA 2HHSA 3PYDA 2PMWA 2DISA 1WKKA 6FDRA 2V9KA 5K8MA 1RA6A 4ICLB 3BYPA 4F4AA 4ZCKA 1FNXH 1JX4A 4HHUA 3NGRA 2C28A 1BLUA 3I6PA 4ZJOA 2D9OA 2EFVA 2CJ9A 3GV8B 1TL3B 2MTLA 2M3DA 1S57A 2QMWA 4A8XA 1FKOA 5LSRA 2G1HA 3OR1B 4OIXA 4QPXA 3LP2A 2AJQA 3ILIA 2DJWA 2A2DA 2CDRB 1E6VB 1FVSA 1RWOB 3GMGA 2PA8D 1Y7PA 2DO0A 3DHXA 1R8CA 2LQ9A 3TX8A 2FHOB 2CUYA 2BVZA 2VG7B 3EPGA 2AEFA 3I5AA 3BQ1A 2HVEA 3MUVP 3W5XA 3UDLA 4LF4F 3D68A 4HTIA 4F8RA 5DLGA 3CJ8A 5KTQA 3W63A 4DN9A 1MU2B 4DV0J 4K50A 4WYWA 4CO4A 4XAKA 4X64F 1W26A 2DRBA 4ED3A 4TVAB 1NMEB 1RTJB 4OYWA 3UCZP 4B3OB 3G87A 2UVUA 1JLEA 4HEA9 1RWUA 1UVIA 2VOPA 1RWMB 3MAHA 1K1SA 4K8RA 1TK0A 3N28A 2NXCA 4P7TA 1K73T 1GK8A 1TELA 3Q22A 5KG4A 5FLXY 1TR0A 3N0VA 3G8SA 2KXFA 3KJVB 4CLWA 2OMOA 1WF0A 1EB0A 3OR2A 4A47A 3HSJA 1RT2B 3FC9A 4U96A 2CZ9A 1EKRA 1U1MA 3N6NA 2JRSA 3DYAB 1CJUB 3R5DA 4NA2A 1IQTA 1FO1A 2L3MA 5KFLA 5KG6A 3C6UB 3FQLA 3L7PA 5DS7A 1FFWB 1M1HA 3L7UA 5KFBA 2HNYB 3W64A 2RB7A 2PFDA 1Y9OA 4FPRA 2HQFA 6FD1A 2R2RA 1J5EF 4PWDA 4ED7A 5CAAA 4OZ3A 2P2CB 2F4FA 1XN9A 1OQ3A 2DGWA 4U95A 2V68A 3IGVA 1KQGB 2ZM6J 3KLIA 3UN2A 5A8KA 2XZTB 3M4XA 1HA1A 2OFHX 4V19X 2VPYB 2FDNA 5KG2A 2PC6A 5HROB 2QLJB 3OLBA 5AJ3F 4R8UA 1S76D 2V4JA 2GCFA 3PW7A 2PEHA 1YLXA 3OTCA 2VOOA 3A8EA 4DQPA 2FVQA 2AJ1A 3H40A 9RUBA 1ZA1B 1U26A 3R97A 1UETA 1JNZB 2CPIA 3HFZB 2C3PA 3CCZA 2MSSA 1R8BA 2V63A 1XEZA 5HVGA 2XS2A 2ASYA 2FZCB 4LF9J 3HP6A 3TAMA 4GO5X 2YWHA 4ECUA 1FWPA 2VDHA 3GE9A 1SV5A 1NK7A 4MIWA 2OD4A 3M8RA 3DDKA 3X1LB 3DRSB 3WZ0A 3J7A1 2XI2A 3CCQS 5CYQA 2BR0A 3JSRA 2ZZMA 3UNGC 1VOMA 2YNIA 4F26A 4RUCA 3KMSA 4DV4J 5GAHU 4OX7A 4LR9A 4BC7A 1S0NA 4O44B 4CLTA 5LJ5Y 4YR0A 1T11A 2DTJA 2HMIB 1ZS6A 4C11A 2DNHA 4ECZA 1Q82T 1KNZA 3H90A 4CP5A 4I2QA 2EC0A 2BM1A 1Q0NA 1GQEA 5KFPA 1BUXA 5DZ6A 5K8OA 4A8YA 3QFHA 4LVNP 3VAIA 2ZEJA 1YJ7A 2OEKA 4CI0B 2M5YA 2CG8A 3ILOA 1ZH5A 1Z2ZA 3C6TA 3PFOA 3SV4A 1QVGR 5L1KA 2UXCF 1U45A 4IOCQ 2B6AA 1J2VA 1UJ5A 1NAQA 1SL0A 3SMZA 3DRRA 1UFKA 4DR3J 4ZLJA 3H25A 2BW2A 1VC0A 1WG4A 3PW4A 2UXBF 1Q1KA 2HRTA 4GVLA 2HHHF 3J7YI 3IBFB 4O4RA 5I42A 2R8JA 2QYCA 1CG2A 2B3TB 2MZJA 2IC3B 3OTDA 1YZ6A 2XY5A 3MMAB 1E6YA 3T1YF 3BPDA 3UDVA 1RAEB 4RO0A 3D0GE 3BGLA 4AXJA 2XSFA 5KFGA 1RAOA 3SDEB 1D9FA 4LSLA 1N52B 3CMQA 4MFBA 2Y8WA 1HBOA 1KQSR 3K5PA 5L46A 2DIVA 3PX0A 2ZITA 1SJRA 3T5JA 4WXOA 4OJGA 5ETMA 2X1AA 2RHSB 2AP6A 1ACMB 1VRUA 5HMZA 3A8KA 3LP0A 3IAM9 1U48A 3MM5A 1FKPB 1RABB 2J9CA 3CJKA 2B56A 2DNKA 4MK8A 2J9DA 3H2LA 4E98A 4FKYA 4LRCA 2E66A 2V4QA 2H48B 3KG4A 1FNMA 4DR5F 4MKBA 1QLNA 1AFIA 4CIOA 4IG0B 4DR2F 2AMCB 1YSJA 2ILZA 4U7UK 2GW8A 4OZ1A 4IQMA 3BQ2A 1CQNA 2FJAB 4P52A 4RLEA 4TU9A 3QT7A 1NDPA 2IRUA 3DM2A 2L08A 2UU9F 3A8IA 1D8ZA 3MD3A 1F9EB 3CCVS 4OHVA 4DX5A 4LF4J 3DDNA 4LQ9A 4QWEA 1WUUA 2WVDA 1J5OA 3KNAA 3T1HF 3L09A 3FCHA 5G4DA 8ATCB 2KT5A 4X64J 5L39A 5E2QA 2OPPB 3AXKA 2DHHA 3BYRA 3EE3A 3MR3A 2QSFA 2M9KA 2GJFA 1BHNA 3H5XA 2MLXA 3DMJA 2BX6A 1L5UA 5B0DA 3PRBA 1IKWB 2H3EB 3B8HA 5LSLA 3DNCA 3NY0A 2RQCA 5EX3A 4RW4A 3FUYA 2GHWA 5JVGQ 3SSSA 2DEJA 1JXLA 4C8NA 2K06A 2NUHA 1C0UA 3U1LA 8AT1B 2ADCA 4FNIA 3UR0A 4USIA 3BGRB 1VQMS 4RJVA 5E3RA 3BDEA 4AUKA 1YG0A 3BR8A 4NWBA 5LM7E 3JTPA 1PBUA 1MWQA 2MDAA 4WTOB 4KO0A 4F0HA 1ZYQA 4RW9B 3A1YG 2HYIB 1WNEA 1T0TV 1ZZFA 2UVWA 2HURA 3QMQA 2YKOA 2Z8QA 3CC4S 1J5EJ 3BSCA 2WTFA 3C15A 5KFWA 4NOHA 3QAEA 2J9DE 3MUMP 3AA9A 4AL6A 2XMMA 1IBMF 4RW8A 3CVKA 1B64A 1H73A 1HNZF 3FBEA 3IC1A 3JXOA 2DEIA 1VJQA 3HHLD 5DDOC 3HHDA 3TYTA 3HD1A 5AJ3J 2UVRA 2EFPA 1XNQF 3WX4A 3HVTB 2BE2B 4I7FB 2DPIA 1T03B 4C97A 3OUYA 5LXRA 1SJ1A 3UN5A 1R31A 1K0TA 5LL6d 5C24A 1VQ8S 2P9CA 4NCBA 3EUNA 2W4PA 4WKYA 4BDPA 4O0NA 1JJ4A 2IAJB 1SH2A 3VALA 1YHQS 2ZWPA 1X4HA 2R2SA 3PO5A 4WU2A 4DL3A 3V81A 1FTRA 3RBDA 1CLFA 1HBNA 2PN6A 1VS3A 1WG5A 3PEHA 4Z7CA 4TY8B 2F65A 1HBMA 2CQCA 2V2VA 1UPMB 2MZTA 4J5OA 3M8QB 2OH2A 4NLGA 1LW2B 1FRXA 4PR6A 1NXIA 3DLJA 2XMVA 3SQGB 4PEOA 4RBTA 3C16A 2RNEA 4NYOA 2AIRB 2MQ8A 3ZZYA 4DMZA 1U1NA 4QYZJ 3UD5A 1HR0F 1B70B 3HSDA 2RT3A 5KFZA 3BKTA 1XBWA 2BEFA 3QBCA 3CT9A 1CC8A 1IBKF 1GX6A 5IC6B 3VVTA 2CQGA 2YWGA 3VZHA 3KLHA 1LWEA 2JH3A 2B51A 1G4CA 1KS2A 1RK8A 2KT2A 3BV8A 1JLCA 1EIYB 3QWPA 1JLFB 3FBCA 2AT1B 4CWBA 2UXCJ 1HYSB 4DOZA 3AB4B 5HLFB 2CNOB 5KFOA 4KFBB 4OI4A 1RTDB 3T1AA 2ACMA 3WDOA 1RTHA 4A48A 4JI2F 2UUBF 2CQ1A 4JI7F 2QV6A 1IKVA 2UXBJ 4C9DA 1KBRA 1RZMA 4RUHA 4ED1A 4LFCF 3ET6A 4QU7A 4I64A 1RADB 2QIFA 2GJIA 5KT2A 3ITHB 2DY9A 2CQ3A 1G2EA 2V6AA 1GNKA 3TVZA 3T1YJ 1WC6A 2LP4A 1XERA 4KBIA 4ELTA 2XO7A 2JHEA 3DRYA 4L3KA 3G8QA 1H38A 3UFCX 3G6VA 4NLQA 4NASA 1QD1A 5A76A 3EGVA 2CA9A 4M5NA 1EETA 3V6JA 4Y2MA 1H6KX 4URQU 4TLQA 1LWFB 3PX4A 3TJ8A 3MFIA 2ZKTA 2JL9A 3TVYA 4YR2A 1YDLA 4Z2XA 2BANB 1ZM3A 2CPDA 4F25A 2L48A 2WZ1A 1CEZA 2CRLA 2W4CA 4IYQA 1S0OA 4EBCA 4LR7A 1Y3JA 2AGOA 2VQFF 1S7HA 2I38A 3MDFA 2RQKA 4XTTA 4N8OA 3PW5A 4DR5J 2DIUA 2QL7B 2UUAF 3SZ2A 4KYZA 4DR2J 5E7OB 2M2BA 4DHVA 1CS4B 1HIYA 3HLUA 4JOUA 4Q8EA 1TKXA 1RXOB 1DFDA 1F2HA 1UA0A 2W7OA 4DV5F 2VU5A 4I67A 1RWKB 1NSQA 2UU9J 3NOGA 5AXKA 1RWNB 3IRXB 4F4KA 4X4RA 1DJ0A 1EARA 2Y1RI 3V5RA 2ZBQA 3T1HJ 1VQLS 4FF2A 4W4MA 2P6TA 2FY8A 1Y11A 3ETOA 3LOUA 2XI3A 1WKJA 1U2FA 1N5SA 2JOQA 1IWAA 2Z0GA 2MKYA 1TL5A 3CD7A 4I2PA 5LMUF 2CJKA 4WJBA 1LXJA 4UUXA 3G6ES 1LNQA 3CJ4A 3OFGA 2MKKA 4ECRA 1N4LA 4JI0F 3VAKA 2EVZA 2OAUA 1FK9A 5J2NB 2A1BA 1HWJA 3FEYB 1PC5A 1SVDA 3I0SA 4BS2A 4JI5F 3K58A 2CJYB 3KLGB 2HAFA 1L3VA 3T5HA 2HQGA 3NS7B 5D4LA 3BSNA 2IYIA 2LXUA 5KT5A 3PW2A 1KHWA 4DCPB 1QTMA 1NH7A 3GQCA 3QZ8A 4IG3A 1R0AA 1FXLA 1HMVB 3J7YU 2HFUA 2MZ1A 4ZMMA 2BJ1A 2R2UA 4WP3A 4LBPA 2Y1LB 3DKDA 1NEEA 2RRNA 2VG6A 5E3CA 4LT6A 5HK4A 3I82A 4TYBA 1FRLA 4RNNA 2EW9A 1EAYC 1IBMJ 4K0KF 3TZZA 4DPWA 3MEKA 3AJDA 1HNZJ 1QAJA 1T95A 1RTIA 1NDCA 2EWHA 4D3HA 1KOOA 5IFMA 1XNQJ 4A8WA 4OYOA 4ZKAA 3W2VB 3PNIA 1Y00A 3PR4A 1U24A 2ZZNA 2A2CA 2U2FA 1HHQA 2E1CA 1TAUA 2JNJA 4P7VA 1RT4A 3MTJA 2ZH2A 3JB9k 4NMLA 1HPZB 1NPKA 2MQMA 3NBPA 4ZS6A 2KM8C 4TKTA 4X2BA 1Y10A 3UO0A 2H65B 1VBYA 3G82A 4A8SA 1SI9A 2NLWA 4WFZA 3GSDA 2KVQE 5M2UA 2YNHA 2FHMA 1JXEA 4KPYA 2R3VA 3TOQA 2IA6A 4WP9A 1UFLA 4FP9A 1N5YA 4J7CA 2HBYB 3VTIA 3BREA 1M5KC 2Z30B 5J2QA 3QT5A 5A2QU 4FYVB 2GMLA 3PY8A 1NKEA 3DDIA 2CPXA 1DBDA 2FUG9 4OFZA 3ENVA 1H2UX 2E1MC 1HR0J 4OJ1A 5EHHA 2RF2A 3O6QA 2BV3A 1FTCA 5EN1A 1L3UA 2BQ3A 1PAEX 1IJEB 3HZEA 3BN7A 4ED6A 1IBKJ 4QW8A 2ILYA 5E3PA 4DR7F 2RJZA 1MLAA 4Q45A 2HGMA 1CULA 4J9OA 1RCXB 2ALYB 1YRTA 1KFSA 2GVDA 2YNGA 3JTNA 4Y28C 1ZM2A 4I56A 2XSJA 3PVXA 1Y3KA 2V8GA 4ZP8A 3OQ2A 2DYAA 4DU7A 1LWXA 1R8HA 5LOQA 1HNIA 1VMBA 4JI2J 2UUBJ 4JI7J 2DR5A 1QE1B 1H7WA 3M30B 1LFPA 3R5CA 4JI6F 2GJ2A 4LFCJ 1SC4B 2PE8A 5B0FA 3GJSB 1R27B 1NJIT 2RH3A 4GVBB 1RJJA 1D1UA 5F8MA 1URNA 4DL6A 3NXZA 1K8AT 2RQMA 2M4MA 3EVOA 2J6UA 1REGX 2HNDA 2BOAA 3DU6A 4ZOSA 4MIAA 1QY7A 2OLWA 4F36A 1HARA 2NQPA 2VC1A 4LRFA 3MCMA 1FE0A 1HNXF 2RMLA 4RU9A 5D0HA 1M5OC 1FNOA 4PG5A 5KFRA 2ZH8A 2RKIA 1T9UA 1H2TZ 2QEXS 4L6V3 1REVB 3CO0P 3T6JA 2UZAA 4RL1A 3ZTSA 4U8YA 2VQFJ 2FGOA 5DQHA 4LSNB 4NPOA 2VFSA 4YQWA 4ZVFA 1SPBP 4TXSA 1KKHA 4MK9A 4QCLA 2UUAJ 2HZVA 3IXQA 1T3OA 2OPQA 5J2MB 1NK0A 1S9EB 4FDFA 1YJVA 5KFTA 2ZC4A 1UJ6A 1NK4A 4RUAA 1N5QA 3JSMB 2CNNB 1C0TB 1R8PA 1OYEA 1FVQA 1T02A 5GMEA 1IKYA 5CQGA 2F1FA 3WC0A 4YFUA 5CZVA 2HFSA 3CD0A 4DV5J 3CDEA 3HFVA 1RE1B 2F40A 3I96A 2W7PA 1Z1ZA 3FFIB 3UVJA 4P2MA 4N56A 4X4NA 2E1PA 1X60A 5C25A 2HFNA 5KFMA 4WKRA 1L3KA 1SKSA 2H51B 1U1OA 2EEYA 1VK8A 5A8WB 1RT1B 2J9EA 4LF7F 4RW7A 2A3JA 1HQUA 3EGNA 1YK9A 2AV5A 1ZM4A 4DS5A 1A9NB 4KGKA 2QTWA 3VCDA 1S1XB 1J27A 4USKA 1S1UB 2J7KA 5IT9Y 2IRXA 3MEDB 3V4IA 3BKFA 4UOHA 5LMUJ 3D1OA 5SUHA 3CGIA 3PM9A 2G0CA 1KSPA 3MM8A 4DR4F 3UWTA 3T5KA 2KN4A 3PCOB 4XDDA 3FEZA 1JB0C 4JI0J 5BJRA 3AA8A 5HBMB 2HHWA 2JEGA 1RLDA 3PIPQ 2HRYA 1P9YA 4JI5J 2D3O1 4IOAQ 4G3IA 5L1LA 3DCAA 2M8HA 2D9PA 4FBUA 3WIVA 1X4GA 4PWUA 2QA4S 4AD6A 2YTCA 2PIIA 3NKYA 1JIHA 3LQVA 3M1VA 4F4XA 2PD1A 4ES1A 4A8FA 4CLYA 1H0HB 2B5JB 2ZOFA 4CO1A 5KFUA 3IAS9 3D3CJ 2XG8A 3OJUA 1QSLA 4IOBA 1RHJB 4DDFA 1GXUA 3I32A 4BWMA 3OSNA 2DXEA 1JNRB 1WWHA 2CPHA 2EKNA 1KQKA 2YKMA 3VF0B 4YDDB 4K0KJ 4NCGB 4PCQA 4Z37A 1RT7B 4ZA1A 1RLCL 3EXYA 3CNQP 1JLBB 3BSOA 3TRGA 1SB6A 3JS9A 1VRTB 4O3QA 5KFQA 3TUPA 1S1TA 1Q7YT 1S9FA 1VIOA 2DB1A 4K2XA 2NZCA 4NLVA 5C7PA 1TVRB 2AJFE 5DG8A 3OHAA 2C2MB 2JDJA 1X9MA 3RB3A 5CXTA 3GR0A 3QQCD 3PYEA 4RNHA 2M70A 1A7GE 4P74A 4TQRA 4G1QA 4ZPTR 1KVJA 3MZIA 2MLZA 5HP1A 2ZE2A 2W9BB 1RHKB 4M5IA 4LBHA 4NI2A 3BH6B 2XNRA 3CPWR 4UT4A 1S6PA 2VONA 2K1RA 1S1VB 1RAGB 3VVUA 4KB7A 2EBEA 4QU6A 3QGHA 1NHUA 3D6FB 3N9UC 3GONA 2DR6A 1KR4A 2CNLB 1QUPA 5D77A 4B02A 4PQAA 2W9AA 2ZH1A 1FDAA 1AUDA 1U6ZA 3K0JA 2G2OA 1T05B 3NLCA 3EVMA 4QWAA 2R8KA 4J9RA 1LQ9A 5C42A 2QRRA 1WC5A 4WIIA 2DH7A 3MEEA 2WB1D 2HHPA 1BY9A 5A8RB 2R7VA 4UOGA 2Y0BB 4DR7J 3C19A 4K59A 4O4GA 1WTFA 4R5PB 3AD8C 3G6XA 4HDGA 1DLOA 2ASLA 2ADBA 4YDXA 1FXDA 3J80Y 1MWYA 4V1Ak 2N3OA 2D41A 4N5SA 4DSKA 2VFUA 2B8PA 2W2QP 4ATNA 3RBXA 2LEBA 3QT6A 2BQUA 3R5GA 5KG3A 4KR0B 3IS9B 3UDEA 1TL7B 3DOMA 4IFYA 2YPYA 2EFNA 3LWLA 3G86A 2V2KA 1O51A 1RT5B 1SJ4P 2W8KA 4P73A 5I3UB 4FYWB 4NLPA 1UTAA 1U2RA 4R25A 4JI6J 1NBEB 3R7BB 3HHLA 2DNNA 3LPEA 5FIIA 2NSCA 3TEGA 2F63A 4B17A 2GVZA 2B9WA 4QYRA 1DTTB 2KJVA 2O67A 1VC6A 2AQ4A 3C14B 2BACA 1XNRF 2ZKUA 3GIRA 1CJTA 2MJNA 2MZSA 5J1NA 5GAEI 3JAMU 1VLOA 1U6BA 1LEOA 2VJUA 3KK3B 4ILLA 2W4DA 3GV7B 4AL5A 3Q8RB 4K4ZA 3DXSX 1HNXJ 2HVHA 2WONA 4NX9A 1TKTB 2LU2A 3E01A 2QE5A 2VG5B 4ANCA 2GAGC 5F3TA 5B0BA 2R2TA 2HQCA 5KFFA 4DL0C 2Z4PA 4KGVB 2GO9A 2ZDOA 2BJ3A 4KKOB 4X66F 2EG2A 4CO0A 2OPRB 2F8MA 4W90B 2PT0A 1N5VA 3MAAB 4OX6A 1DAXA 4ZP7A 1WSVA 4C8MA 2XEXA 4B3SF 4DR1F 1S0VA 1BC6A 3P5BP 1IM4A 1GH8A 2QSWA 5J1EB 2B7BB 2J0WA 1TU0B 4JI3F 1FE4A 2B4OA 2CG4A 3CXCR 4EO6A 3M9NB 2YNFB 3MM9B 1FJGF 4EEYA 1C1BB 2HIYA 4Y65A 4NA1A 2VIHA 3BGUA 3KOAA 4WE1B 5KT3A 6AT1B 1L3SA 3AD7C 1N0VC 2WOMB 3IBWA 1NJXA 1JLAA 4LF7J 4UY85 4WCEQ 5AT1B 2VKZG 4ELVA 2O3DA 1U47A 1LOUA 1TV6B 5MLCV 5HJYA 3LAKA 1ZA2B 3QRQA 1RISA 1M90T 3O2IA 2C2DA 3QLHB 2HWIA 4DR4J 1SCJB 4HACB 1N88A 2BKPA 3EWGA 2F4VF 3UN3A 2NUUG 4USMA 2QMUB 4RZRA 2GQ2A 3S8SA 3QJPA 5DDPC 2R42A 3CEDA 1Q8IA 4M5GA 1RU1A 4OYMA 1LW0A 2VG5A 1JLQA 2AEMA 4KHPF 2WCXA 4IFVA 4CNYA 3A12A 2KI2A 2LKZA 5IM0A 1K44A 1Z2LA 5G0RA 2LXFA 1RA7A 2JX2A 1SL2A 1F5BA 3TZYA 2HW3A 1EP4B 1WHVA 4ED0A 4C3KA 1WHYA 2FJWA 2FJVA 2B4UA 4NLSA 2Y1IA 2GGPA 3P6YC 5KFIA 2MB0B 1WDDA 4TU8A 2QA4G 1CVJA 4ZPAA 3U7JA 2BBEA 3HD2A 1AZSB 3DOLB 2D3ZA 3BBBA 3THTA 2CQHA 3TP2A 4AE5A 4P72A 1IQZA 5A0YB 2YKQA 2HGNA 4JUZA 3AODA 1RT3B 3AJ1A 3OJSA 3QNWB 4CT9A 4MKYA 4C8LA 4OZ0A 2FVSA 1LV5A 4ZLLA 2W7AA 4K2JA 4ZVPB 3GWCA 1MNEA 3HVAA 3KHRA 4Q2LA 1K47A 3W2WA 1KLMA 1PKUA 1B7FA 3GFYA 2Z2YB 3CDWA 1S1WB 1FRHA 3NP5A 2KJWA 2AYBA 2V2ZA 2WBRA 1ZAWA 3CTRA 4V19J 2WB4A 2Q3PA 3FRYA 2VDIA 3HPOA 1NKBA 2MY8A 4EUVA 3QWUA 2BMBA 3M2RB 1S99A 1WDTA 3DRPB 1B3TA 1I5OB 1AYEA 4CYUB 1QSSA 1UFWA 1JKHB 2ZOGA 4LF8F 1D0EA 2OKQA 1I94F 3NEKA 5LXYA 3N6MA 1KDNA 3H4BA 3D1HA 4KGMA 4KH0B 2CVEA 3PHEA 2KKHA 1TL1A 3I9V9 3ZTRA 3K2YA 2FLOA 1IBCB 3KLEA 4CQ1A 4OI1A 4KJIA 2IBKA 1MROA 5J2PA 1HBUA 4I68A 5D0EA 4O3NA 3LA0A 4DV1F 5KFYA 3CMAS 3L3CA 3QIPB 3ZZTA 2FIUA 2FTRA 3G6YA 2VFRA 3MM6A 3FBBA 1WHWA 1IM6A 3RB0A 4X84A 1HNVB 2HZAA 2HKEA 3HKWA 2CIMA 3CD6S 1HW8A 3CDBA 3NGSA 2KM8B 1X5PA 2DHXA 4YP3A 1NUEA 3EX7B 4DL4A 1HQEA 3KK1B 3NL0A 3H98A 3IG1A 2BJ8A 4MYTA 5GAHI 2AD9A 1UZHA 3H5UA 1TMJA 1JQGA 5IS2A 3UQSA 3GG0A 3LP1B 3ZZ0A 2JFKA 5DGBA 1CJKA 3BO4A 4XO0A 2XMKA 2L9DA 2FHJD 2ASJA 4B9TA 1V6HA 2ZD1B 2FZGB 1RGVA 3Q8UA 2QJ3A 1T9WA 2PEBA 1PJ6A 3MEGA 2MGZB 3OTOF 3V2UC 2C3MA 4DFMA 1KFDA 3OT9A 3PACA 3M2RA 1VR6A 4U8VA 2XMTA 4JV2A 3OBIA 4Q0BB 5CCMA 5KFXA 2V5HG 4F0KA 4DV6F 1R89A 3M32A 3CIMA 2MZQA 2JEFA 4CLLA 4IO1A 1G7CB 4CH0S 2ZJRQ 3HZGA 3GYXB 2WAQD 3MAQA 1XNRJ 4ZJLA 3Q24A 4FF1A 2YX1A 2KL8A 4RBUA 5IWAJ 4J9QA 3BZQA 1HD0A 2FYXA 2QA1A 3AT1B 5ETOA 2FB0A 3BGOP 2LYVA 3FVYA 3E2EA 1U02A 3H42A 2QGFB 4LF1A 3U27A 4F67A 2HVIA 3GTYX 2C42A 3F0NA 3QSIA 3QO9B 1FT8A 3GB0A 2XM3A 3EGZA 4GO7X 3RW7A 1SUQB 2ZHAA 4ED4A 3KK2B 2MZRA 1D3WA 1YGYA 4ZITA 3EGWB 1QJHA 4X66J 1PG5B 1HI8A 4OV6A 4CTAA 3TUZC 1S79A 4U9RA 1SQGA 2Z2ZA 5D3GA 4LBIA 4B3SJ 4DR1J 1UL3A 2J0XA 3DGPB 4ECSA 2LA6A 4AT1B 7FD1A 1VQ4S 4OLOA 4JI3J 1NH8A 4H4OA 4X4PA 1GXLA 1FJGJ 3V6DA 5CYJA 3SV3A 2JVRA 2D3OR 1I3OB 1H98A 4YB1P 4DR6F 1JLGB 4CZCA 1S77D 1NSAA 1WORA 4CM0A 1RTZA 2VFTA 3P4UB 4FN5A 1XJWB 1XTZA 4GKJF 2X1FA 4O0IA 3FBFA 1U6FA 4C48A 2DPJA 4KV8A 3D2WA 3I56S 2XWXA 1FJCA 5B0CA 4CDIA 4OX9F 2BXJA 2QO3A 1RWXB 3WX8A 2XS5A 1VQSA 4PAAA 2E9TA 4L75A 4NLDA 2F4VJ 1PYSB 2DGTA 1VHIA 3TZWA 2XLKA 4DLGA 2VV5A 2P6SA 2ABYA 4KHPJ 2DGOA 1RBLA 1TK5A 1SUQA 1MN7A 4FXWA 2G4BA 1FKOB 4LVOP 5KFSA 2GC8A 1VRQC 2GHVC 1WEYA 2KH9A 4YN3B 2BUNA 3LP2B 2EPIA 2DK2A 1U0HA 2NS1B 5FD1A 3FGVA 4KC5A 2IFXA 1VLYA 3EPIA 2RDDA 3W9IA 2HHQA 2E9ZA 4HT5A 9ATCB 3IO1A 1GXTA 1NO8A 1TQLA 2RDJA 3HHEA 1YJWS 5DDQC 1YJNS 3Q8VA 4KHRA 3IMQJ 4DSFA 2ZBIA 3F44A 1EQ0A 1RHQB 3P49B 3DLLQ 4QIEA 1BQMA 3ADAC 2CYYA 3FCWA 2LQBA 3L95X 3OHBA 2BQRA 1JLEB 2RVJA 4DL5A 2QL9B 4Z7YA 3M8PA 3VGSA 3PHTA 1NHVA 3TQEA 1CBKA 4QIFA 5CYMA 2YXLA 4R0EA 2BDPA 3KUGA 1KOHA 4O23A 1SXLA 3KLFA 2V8DA 2ZH9A 4XK8C 3UPFA 2XNQA 2GS8A 1VJWA 3GCWP 4F2RA 2G0JA 4URGA 3OR2B 4LF8J 1S5ZA 1I94J 2KDOA 2GHPA 4KSEB 1RUSA 3OL6A 4X4TA 2X7IA 4DQSA 2I0XA 2JWNA 4DZ6A 3IFEA 1NK8A 3U1MA 2MKIA 1N6QA 4IRDA 4DV1J 2KFZA 5DGAA 4ZPWR 3K8WA 2HQ3A 4AQYF 1YRXA 3CB4A 1DTQA 3R5BA 4F3MA 4PWDB 2WW4A 1HI1A 2PA3A 1F9FA 3KKFA 1FJEB 1SKUB 3AQOA 2COLA 4DQIA 2J0SD 3KLIB 2Y3YA 5A8KB 4C0OC 3ZXWA 1RSCA 1FX2A 4R8UB 4ZIWA 2H5JB 1VI7A 1HD1A 2M8DB 2V4JB 2R8HA 4UZBA 2YKNA 3M9MB 4WFBQ 3AQPA 5CD4A 4JYAF 2EG1A 4DV2F 3M2VA 1IN0A 3A3PB 3J7Z5 2QFJA 4UTGA 2IMOA 3AOBA 3SCJE 2PI4A 3OTOJ 2ZBPA 2LA4A 4F3QA 1HWLA 2ZJPQ 2N7CA 4IRCA 3W61A 4Y3CA 1FJ7A 2DT9A 3K8VA 1IUJA 2CQ2A 3QRRA 2GIQA 2ZH3A 5KT7A 3TAMB 3Q2SC 2CPJA 4DV6J 1MW7A 1U8SA 1SV5B 4F0MA 4ENOA 4R0JA 1HHSA 1G3OA 1PILA 2W25A 1BQNA 4C3MA 2E5JA 1U1LA 1SKWA 3BR9A 2KG1A 3ZTQA 1S4EA 3R6GB 4GC6A 3ILLA 2BYCA 2RSQA 1Q53A 4CNZA 3F73A 1RAIB 3K89A 3CCTA 4OHXA 5CYQB 1UWBA 2HLUA 2YNIB 2HHUA 4J9UE 5IOLA 3NCPA 3SCKE 3OSPA 4C6AA 3PR5B 3T6BA 3MFHA 4NXMF 3TAPA 4C11B 2J5AA 1PYTA 3J81j 3LAMA 2H5IB 4I2QB 3W66A 1NZAA 1NNDA 3T9NA 5GADU 2A6MA 4AYBD 3EICA 3TANA 2VBXA 1VK3A 2H9ZA 4Q2MA 4IR1A 4PG4A 3VAGA 3BS9A 3ILJA 2R7WA 5J1PA 4ECTA 3C6TB 1UEUA 4P10A 4QW9A 3MOJB 3QGIA 3RAMA 3CJ3A 3Q2TC 3MPUB 3BBCA 1ZPWX 1QTNB 2B6AB 5K8NA 3CCJS 3C2PA 4ILRA 3DRRB 3ICLA 4ZIVA 4DSEA 4ALZA 1XMOF 1Z4UA 2OTLS 1R6YA 3CSKA 3DLKB 5JJBA 5HL7Q 5KT6A 2VD3A 4TLRA 2OD6A 3HF5A 3UCGA 5I42B 4CM2A 4DR6J 1AW0A 4EFAC 2K2PA 4IH7A 1E6YB 3GYNA 1QM9A 3M2UA 4Q5VA 2W24A 2CJBA 4K7QA 4LJMA 4GKJJ 3W7BA 3D54A 3W9JA 2L41A 3U1NA 2BM0A 3CCES 2CPZA 2ZDPA 2VPXB 1DZ5A 4OZLA 4LSLB 2I9SA 3KJNB 4OX9J 2B8QA 1OSDA 4MFBB 1HBOB 4K4SA 1C1CA 2CPEA 2AYEA 4KIAA 3CJ5A 4ANDA 2ATLA 1FCAA 3Q8YA 3Q0AA 1S9GA 2EK6A 2HFOA 1VRUB 3LP0B 1WOSA 2DH9A 4JV5F 3MM5B 3CJKB 2RQ4A 5DQIA 3TAQA 1P9QC 3JYTA 2HVZA 4QIVA 3OL8A 3R9LA 2RRBA 4K4TA 3NRBA 2KTQA 1S4FA 2F9JA 4O3RA 3GFHA 2R7TA 1LWCA 1W25A 5ETQA 3RG6A
chains in the Genus database with same CATH topology
4DUTA 1MN7A 1NDKA 2DYAA 3G2XA 1LWXA 3ZTSA 1WKJA 3FCVA 2CWKA 1NLKL 1PKUA 1BUXA 3DKDA 3FBCA 3NGSA 3JS9A 5IOLA 1WKLA 1S59A 2HVDA 4CP5A 4DI6A 3EVMA 3Q89A 3NGTA 1B99A 3EM1A 4C6AA 2HURA 3EVWA 3ENAA 2HVEA 3MPDA 3L7UA 1NUEA 4UOFA 1K44A 1UCNA 3EJMA 1S5ZA 3B54A 3Q83A 3GP9A 4W98A 3EE3A 3B6BA 2ZUAA 1VYAA 3PRVA 2B8QA 4S0MA 1NDCA 1XIQA 5C7PA 4UOGA 1NSKL 3DDIA 1WKKA 1BHNA 1F3FA 3VGUA 3EICA 4WBFA 1LEOA 2BX6A 3FBFA 4FKYA 3VGVA 3EVOA 1HIYA 3VGTA 4DZ6A 3ZTPA 4F4AA 1XQIA 1NDLA 3FBEA 2DY9A 5CAAA 1U8WA 3NGRA 1NB2A 1HHQA 1KDNA 4ANDA 4FKXA 1JXVA 1PAEX 3Q8YA 3ELHA 3Q8VA 3BBFA 2AZ3A 2DXFA 1EHWA 3WX8A 4EK2A 2B8PA 2DXDA 4KPCA 1NSPA 2NCKL 3Q8UA 1HLWA 4F36A 3PJ9A 3BBBA 3BBCA 3NGUA 2VU5A 3ZTRA 1NSQA 1NCLA 3BH6B 1MN9A 1S57A 5BXIA 4ANCA 1NPKA 3Q86A 1NHKL 3ETMA 4ENOA 2AZ1A 3VVUA 3BH7B 4ANEA 1W7WA 2BEFA 3ZTOA 3FCWA 3R9LA 1NDPA 3ZTQA 1F6TA 3FKBA 3VGSA 1ZS6A 5CABA 3VVTA 1BE4A 2DXEA 1B4SA 3EMTA 4HR2A 4O0NA 4UOHA 3FBBA 3FC9A 3GPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUT A;  1MN7 A;  1NDK A;  2DYA A;  3G2X A;  1LWX A;  3ZTS A;  1WKJ A;  3FCV A;  2CWK A;  1NLK L;  1PKU A;  1BUX A;  3DKD A;  3FBC A;  3NGS A;  3JS9 A;  5IOL A;  1WKL A;  1S59 A;  2HVD A;  4CP5 A;  4DI6 A;  3EVM A;  3Q89 A;  3NGT A;  1B99 A;  3EM1 A;  4C6A A;  2HUR A;  3EVW A;  3ENA A;  2HVE A;  3MPD A;  3L7U A;  1NUE A;  4UOF A;  1K44 A;  1UCN A;  3EJM A;  1S5Z A;  3B54 A;  3Q83 A;  3GP9 A;  4W98 A;  3EE3 A;  3B6B A;  2ZUA A;  1VYA A;  3PRV A;  2B8Q A;  4S0M A;  1NDC A;  1XIQ A;  5C7P A;  4UOG A;  1NSK L;  3DDI A;  1WKK A;  1BHN A;  1F3F A;  3VGU A;  3EIC A;  4WBF A;  1LEO A;  2BX6 A;  3FBF A;  4FKY A;  3VGV A;  3EVO A;  1HIY A;  3VGT A;  4DZ6 A;  3ZTP A;  4F4A A;  1XQI A;  1NDL A;  3FBE A;  2DY9 A;  5CAA A;  1U8W A;  3NGR A;  1NB2 A;  1HHQ A;  1KDN A;  4AND A;  4FKX A;  1JXV A;  1PAE X;  3Q8Y A;  3ELH A;  3Q8V A;  3BBF A;  2AZ3 A;  2DXF A;  1EHW A;  3WX8 A;  4EK2 A;  2B8P A;  2DXD A;  4KPC A;  1NSP A;  2NCK L;  3Q8U A;  1HLW A;  4F36 A;  3PJ9 A;  3BBB A;  3BBC A;  3NGU A;  2VU5 A;  3ZTR A;  1NSQ A;  1NCL A;  3BH6 B;  1MN9 A;  1S57 A;  5BXI A;  4ANC A;  1NPK A;  3Q86 A;  1NHK L;  3ETM A;  4ENO A;  2AZ1 A;  3VVU A;  3BH7 B;  4ANE A;  1W7W A;  2BEF A;  3ZTO A;  3FCW A;  3R9L A;  1NDP A;  3ZTQ A;  1F6T A;  3FKB A;  3VGS A;  1ZS6 A;  5CAB A;  3VVT A;  1BE4 A;  2DXE A;  1B4S A;  3EMT A;  4HR2 A;  4O0N A;  4UOH A;  3FBB A;  3FC9 A;  3GPA A; 
#chains in the Genus database with same CATH topology
 2OEM A;  3IWL A;  4RNO A;  3M6V A;  2W1B A;  4FZV A;  4BLG A;  3THV A;  2HEK A;  1X4C A;  1WC3 A;  1BGX T;  1S0M A;  3FRZ A;  2CZV C;  3DM2 B;  4DJB A;  3D7S B;  1IJF B;  5FLX U;  3CWJ A;  3DLK A;  2OTJ S;  1QUV A;  1MSW D;  1NJW A;  2IVY A;  4GC7 A;  5ETN A;  1XIQ A;  1BQX A;  1CJV A;  2EC2 A;  2XMJ A;  5ADZ A;  4XDC A;  1LXN A;  1YIT S;  4DPY A;  1N5T A;  5FDL A;  1J5O B;  5C2C A;  3OFE A;  1FRI A;  1C2P A;  4CLK A;  2HHV A;  5THW A;  4M8L A;  4Y2K A;  2NXJ A;  1KTQ A;  3B4D A;  3CCM S;  4B3M F;  1OPZ A;  3HHK A;  1YKW A;  1R0C B;  4ZVQ B;  3KFW X;  3DMJ B;  2ZVI A;  3PX6 A;  3R2C J;  2OSQ A;  3O8W A;  3RRG A;  1EZZ B;  2CVI A;  4RW4 B;  2E1R A;  1FHT A;  3CC2 S;  3GPA A;  2D3U A;  4NZ6 A;  5DO2 A;  1SJ3 P;  1C0U B;  2H4Y B;  4ZK7 M;  4NEY A;  4J9P A;  5B0A A;  2E9R X;  2FLP A;  4DI6 A;  3H0P A;  2PGC A;  3NCR A;  5GMD A;  1RHM B;  3HM9 A;  3RZA A;  4NXN F;  1N36 F;  1Y5L B;  3WBZ A;  2ZFH A;  3PO4 A;  1GMU A;  4WP8 A;  2AW0 A;  1X5S A;  3BF4 A;  3ZZR A;  3R1L A;  2YWF A;  4C98 A;  4KO0 B;  4FS1 A;  3VQT A;  2R4F A;  2ROE A;  4J9V A;  4QR1 A;  4AQY J;  2BJE A;  2G1D A;  3C15 B;  3MEC A;  3C8Y A;  2ZH5 A;  1FI4 A;  4PQU A;  2KT3 A;  5CHC B;  2R7X A;  5ETV A;  4QWD A;  1UWA A;  4RW8 B;  1C4C A;  3KDO A;  2W9C A;  2BW7 A;  3SFG A;  3A3O B;  5ETK A;  4N77 A;  3KWM A;  2O01 C;  2DHS A;  3MUR P;  4IH5 A;  4QWC A;  3DOK A;  5D6G A;  1ICE B;  1P27 B;  3I9Z A;  2NPF A;  3OUY B;  4JYA J;  5F0W A;  2MQP A;  1P8G A;  4I69 A;  5F8L A;  1RHR B;  5C24 B;  3MM7 A;  3AOA A;  2AEJ A;  4G1I A;  2I6W A;  4DV2 J;  4UY8 T;  3I55 S;  1SIZ A;  5BYR A;  4IO9 Q;  4WIQ A;  2WVB A;  4EZ6 A;  5D4O A;  3PRV A;  4IKA A;  1NU4 A;  5GVQ A;  1FWL A;  2PSZ A;  3V81 B;  3ZO7 A;  1FEE A;  2B4P A;  2KHD A;  3VZI A;  3M7V A;  1HBN B;  3VAJ A;  3RAQ A;  5K9F A;  3IGN A;  5EUH A;  2G2Z A;  4DLE A;  2E1A A;  2AX1 A;  4NYP A;  4KE5 A;  2HNZ A;  1U8W A;  4JI4 F;  1HBM B;  1OYD A;  5RUB A;  5B08 A;  2K7K A;  1T9Y A;  5DJB A;  2Y1J A;  4PXB A;  3O1L A;  4NE9 C;  4DV7 F;  4B3T F;  5JVH Q;  2FC8 A;  3LTO A;  2IDL A;  4OI3 A;  2CAD A;  4M5D A;  3TUI C;  2HWT A;  4ECY A;  2ZHB A;  4YR3 A;  3C16 B;  4ECV A;  1TUW A;  4K4V A;  2ASD A;  1GTE A;  3IN5 A;  4J9K A;  5EWF A;  4A8M P;  2E5H A;  5JUM A;  2X1G A;  4ED5 A;  5K14 A;  1XMQ F;  3OL9 A;  4NXM J;  2RIJ A;  1LK7 A;  3HHL C;  3OXF A;  2FLL A;  2EFO A;  5DLF A;  2MQQ A;  2HWH A;  5KFH A;  4BHQ A;  3PJX A;  3EYZ A;  2J7U A;  1KRP A;  2DCU B;  4M5J A;  4ZPC A;  3EVW A;  4QBU A;  2VPW B;  3AJ2 A;  1RP5 A;  5HVF A;  3KLH B;  4Q8F A;  3GIJ A;  1LWE B;  1FEH A;  3B6B A;  4UOC A;  3QGG A;  2XO6 A;  1JLC B;  1SC3 B;  1N54 B;  1WOO A;  5LT5 A;  2ZNY A;  3CJ0 A;  2XLI A;  4HH0 A;  2X3G A;  3VGT A;  2CQ0 A;  3ZTP A;  4M63 A;  4MAK A;  1I1G A;  1XMO J;  4NZ0 A;  1RTH B;  2Z56 B;  1WD6 A;  3OVA A;  3J7A N;  1P1T A;  1IKV B;  2V0N A;  5DET A;  1ZTW A;  1NCL A;  4MJK A;  2AKW B;  3J81 Y;  4CLU A;  4X4Q A;  3RBE A;  3ET6 B;  2CQ4 A;  2CDQ A;  1VIX A;  2JVO A;  3W5Y A;  5T7L A;  4M95 A;  1V3R A;  4ID5 A;  3MXH P;  3CJ2 A;  2IMW P;  3OXG A;  4I6Y A;  1F6T A;  2ZOM A;  2FGC A;  3NOC A;  4ILM A;  2JEI A;  4DG1 A;  2PMZ D;  4G1P A;  1FX4 A;  2ROG A;  1VCT A;  3HMJ G;  4YME A;  1AFJ A;  1H72 C;  4NLX A;  4PUO A;  4PG8 A;  2IPO B;  3M9O B;  1HWU A;  4DPT A;  1U1Q A;  1UAW A;  2AF6 A;  4RBV A;  4PPZ A;  1EET B;  3PG9 A;  5B0G A;  4NLW A;  4F7V A;  2XYP B;  3CC7 S;  4NL5 A;  3K5L A;  1X9W A;  3GR1 A;  2DD8 S;  2HSE B;  2BOP A;  2XMA A;  4DQQ A;  2MJU A;  3R6L B;  2BJD A;  4JV5 J;  2WW8 A;  1VQ7 S;  2RS2 A;  3GIM A;  4A8Q A;  2R7Q A;  3GIK A;  4QR0 A;  1GMW D;  5DZ7 A;  1UW9 A;  3TWZ A;  5D15 A;  3I0R A;  3ZZP A;  4HHH A;  2YY3 A;  4KRW A;  2I5J A;  2KRB A;  4OZ5 A;  3HKZ D;  1KWM A;  4LQ3 A;  1F1B B;  3WIU A;  4TY9 A;  4L72 B;  4ANE A;  4ZVR B;  3IR5 B;  1TKX B;  2OPS A;  3C46 A;  1A6L A;  3BGF A;  4GRS A;  1PYO B;  1BE4 A;  3LPY A;  2YKP A;  4AL7 A;  1R8A A;  1UVM A;  3R8Y A;  5F8I A;  1IKX A;  2FJB B;  1IBL F;  4H4M A;  5CCL A;  1HQ2 A;  2JLG A;  2HFZ A;  2HHH J;  4ZDN A;  4J37 A;  4QYZ K;  2KXN B;  2E5G A;  2GFF A;  3R5A A;  3MMC A;  4OV1 A;  4G6V B;  3CCR S;  2SXL A;  3HK2 A;  5E33 A;  3VAH A;  2XZD B;  4B3M J;  4HH1 A;  3P5T L;  3POT A;  2HG4 A;  3NGK A;  5F8H A;  1TKZ A;  1SBR A;  3HSZ A;  4I2P B;  5AE2 A;  3RGI A;  1D8Y A;  1NDL A;  3DLE A;  4UQG A;  3AB2 B;  4DUZ F;  2KZZ A;  4I6A A;  1UVK A;  2DNZ A;  1FA0 A;  2ERR A;  4FVM A;  2I2Y A;  2DHA A;  2VBZ A;  3CUN A;  1S6U A;  4HDH A;  4H4K A;  4CLF A;  1FK9 B;  2F8H A;  1JJC B;  3FJ2 A;  2CKW A;  1BWV A;  3I0S B;  5SZT A;  3ZNJ 1;  1KVK A;  4NXN J;  1N36 J;  3MMB A;  5I3Q A;  3LAN A;  3DI6 A;  1YBA A;  1AB8 A;  2MKJ A;  4JB8 B;  3DLG A;  4IG3 B;  4KGX B;  1R0A B;  4L74 A;  1MG7 A;  2D74 B;  3SIP B;  2DHG A;  1SC6 A;  2GA7 A;  1RT6 A;  4ECQ A;  3UD4 P;  1HWI A;  1Q95 G;  2VKR A;  3A4T A;  1U1P A;  2QYG A;  1VGY A;  4ZHR A;  2VC0 A;  4PKD B;  4DCJ B;  2VG6 B;  1AUS L;  2N3L A;  5KFN A;  2XC9 A;  4K5R A;  1WAC A;  4O3O A;  3A3N B;  2EK1 A;  2K8G A;  1SH0 A;  1RTI B;  4QJV A;  4NLT A;  4KPC A;  1W2B R;  4ERD A;  4XPE A;  5HAN A;  2YVS A;  1V9O A;  2PDA A;  5BXI A;  2NYH A;  1Y5N B;  2N7Y A;  1H3D A;  2C1E B;  4IDK A;  3HXM A;  4OJH A;  5B0E A;  5KFJ A;  1B0P A;  4L73 A;  2V9W A;  3VR1 A;  1RT4 B;  4DFJ A;  1FRK A;  4DUT A;  4RW6 A;  5CH7 B;  2Q43 A;  4ECX A;  3LW5 C;  3BQ0 A;  4WFY A;  3NBP B;  2CAJ A;  3W3S A;  4KTQ A;  1ITP A;  3G82 B;  4C0B A;  2O1P A;  4QR2 A;  5HAO A;  2LU1 A;  2YH0 A;  1EKS A;  2ZVS A;  1KHV A;  2YNH B;  1XR7 A;  4JI4 J;  2HZC A;  1YBU A;  4QOT A;  1XR6 A;  2YQ0 A;  2HIQ A;  2XMU A;  3VGU A;  1ARO P;  1R6V A;  4LRB A;  1S72 S;  7FDR A;  2V8V A;  4DV7 J;  3GLJ A;  4B3T J;  3QAT A;  1O5J A;  4DPU A;  3TO8 A;  1N5Y B;  1DHM A;  5DDR C;  2AGP A;  3EZU A;  4ZVG A;  3ISN C;  1BD6 A;  5BR8 F;  2HK3 A;  3SQO P;  1WHX A;  5J2Q B;  2KZM A;  2DXD A;  4KHM A;  5HQM A;  1FRM A;  2HQI A;  1XMQ J;  3CCS S;  1RDR A;  4OI6 A;  4PYD A;  3UD3 P;  2RF2 B;  3D6M B;  4JI8 F;  2V34 A;  4WK3 A;  4RWX A;  2ZH6 A;  1DAR A;  5L1I A;  1D9A A;  5HJX A;  2M52 A;  2XB2 D;  4ZLN A;  4FXV A;  1V3Z A;  3MPD A;  5L8R C;  2R9L A;  3DU5 A;  2D69 A;  3CW2 C;  4C2M A;  2CWK A;  4OYA A;  2GQQ A;  3I5C A;  2UV8 G;  2HBQ B;  3IBC B;  1CUL B;  2H4W B;  4ICL A;  2K3I A;  4J9M A;  4B9S A;  1WC0 A;  4OZN A;  2GVD B;  2YNG B;  1D09 B;  4N7T A;  4OHY A;  4UZC A;  1BWE A;  2M0G B;  2XSJ B;  2ZZT A;  3PKM A;  1RU2 A;  1TL3 A;  4M1K A;  4B08 A;  2ZWO A;  1HNI B;  1NSK L;  4ZPD A;  1NRK A;  5E41 A;  1IXK A;  1VQN S;  3C66 A;  3GII A;  3OR1 A;  2IJF A;  1X5O A;  1ZPV A;  1VQ6 S;  2DRA A;  3RR8 A;  1XR5 A;  4M5K A;  1E6V A;  2VHG A;  2AZ3 A;  3CCW A;  1DUR A;  4EK2 A;  2IIH A;  3GV5 B;  1C4A A;  4NLU A;  2LVW A;  3BSA A;  3E3X A;  3OLA A;  4UST A;  3IM9 A;  2MKS A;  1GAO A;  2AGQ A;  3MI7 X;  2VG7 A;  2WVE A;  4K4U A;  3HHN B;  4RR5 A;  4FVC A;  3US5 A;  2HND B;  2VAS A;  1RWV B;  3JSY A;  3OXL A;  4CCH A;  3CJQ A;  1T9T A;  1BMQ B;  3MF5 A;  2A18 A;  3T19 A;  1RKJ A;  2DNQ A;  2CWX A;  4P6Q A;  3ZNU A;  1ZAV A;  3HVR A;  1MU2 A;  4J9S A;  3LGM A;  4QZV B;  4HYK A;  3GFX A;  4MIB A;  4ZCM A;  5DM7 Q;  4E0D A;  1VQ5 S;  1O6X A;  4IR9 A;  1RTJ A;  1ZZN A;  3BM7 A;  2QLB B;  2RKI B;  4B3O A;  4KGZ B;  3NNH A;  5HQ8 A;  1U25 A;  3GP9 A;  2HBR B;  2V4R A;  4X4V A;  2MEW A;  3SFU A;  2ZHO A;  3KHH A;  1M1G A;  4NZ7 A;  5ETP A;  2VUG A;  5KOW A;  1CC7 A;  5CA5 A;  3W9H A;  3M05 A;  2IM0 A;  3QFW A;  2C2K B;  2OPQ B;  1TUG B;  3KJV A;  4AXI A;  3AAW B;  2XGP A;  1RT2 A;  1TK8 A;  1IKY B;  4Q43 A;  2VPZ B;  3Q8Q B;  3DYA A;  2IY5 B;  1CJU A;  3DXB A;  3W5Z A;  3ZZU A;  3TQ1 A;  1FDB A;  3CJR A;  3LF0 A;  4ZCL A;  1IBL J;  3SEO A;  4K5S A;  4EGL A;  3UVJ B;  3D1Q A;  3C6U A;  1F2G A;  3RJM B;  3OPK A;  2KFY A;  5C25 B;  5L9X A;  2HNY A;  3TA1 A;  1TAQ A;  4WTY A;  3HVW A;  5MAO A;  2BAB A;  2C22 A;  2YPZ A;  2QX0 A;  1UVL A;  2DGS A;  4A46 A;  3RYL A;  3VQS A;  4WZM A;  3J7Z T;  3IM8 A;  4RW7 B;  1UMJ A;  1HQU B;  3RB4 A;  2RE1 A;  4OZJ A;  3PZP A;  1FWK A;  3CIZ A;  5B09 A;  2KXH A;  2XHC A;  3ENA A;  2K7J A;  2FY1 A;  5D0G A;  1XWL A;  4DL2 A;  3V4I B;  3E8O A;  3FMB A;  5IV3 A;  3CME S;  1G1X A;  4DUZ J;  3HT3 A;  5HAT A;  3MM8 B;  2QZ8 A;  2DBB A;  3L4B C;  3NS6 A;  2MST A;  4OLP A;  1PSD A;  3FNN A;  5HRO A;  2VF3 A;  3IP0 A;  1W2I A;  4B3R F;  1YJR A;  3GFZ A;  5F41 A;  4K4Y A;  1X4D A;  4JBC A;  5GAG U;  2UV8 A;  3CUL A;  4F4Z A;  1Q8B A;  1Y5I B;  3NGU A;  1AT1 B;  3W8G A;  2KHC A;  3OVS A;  2B7C B;  4OX8 A;  5CD4 H;  3D5M A;  2MQO A;  3R7S B;  3DN9 A;  4CLP A;  2BZ2 A;  2U1A A;  4P9S A;  2IVM A;  4ES3 A;  2VJV A;  2LEP A;  4WFA Q;  2JLF A;  3MR5 A;  3O3L A;  3M1V B;  3RRK A;  4TQS A;  3O5T B;  2FLN A;  4DSL A;  1U09 A;  2NXN A;  3N79 A;  3CDU A;  1N8R T;  1NK9 A;  4PYA A;  4CLZ A;  3QGP A;  2AJ0 A;  2E7W A;  4Y00 A;  2AYM A;  5EGY A;  3AXM A;  3B82 A;  5D4P A;  3DRS A;  2YKM B;  3MPY A;  1X0P A;  1Q86 T;  3G4S S;  4S0M A;  1WC1 A;  4I0W A;  2ZBC A;  2NXU A;  2HPU A;  1SJF A;  3T41 A;  5D4N A;  1NZ8 A;  5KFA A;  4JP8 A;  4ER8 A;  1S1T B;  3MPV A;  2G2Y A;  4TN2 A;  4Y6I A;  2WRM A;  2JC1 A;  4O44 A;  1JXV A;  4YB5 A;  1X31 C;  2DNR A;  2HMI A;  2RU9 A;  1DQA A;  5ETT A;  1Q5V A;  2YX7 A;  4EWT A;  5C2G A;  4DX6 A;  5HQL A;  1V5I B;  2B9X A;  4LR8 A;  3V4M A;  3HO1 A;  2XBP A;  2E5L F;  2Z58 B;  4J9L A;  4G1Q B;  1D9D A;  2DGV A;  5HP1 B;  2ZE2 B;  1G6B A;  4NI2 B;  1S6P B;  2K1R B;  1T94 A;  1NPP A;  3G8T A;  3T5L A;  3LGH A;  4YUD A;  4TU7 A;  2P8I A;  5H9F K;  2GAH C;  3CO9 A;  3EJM A;  4WYL A;  3HX9 A;  5JXS A;  3FMW A;  5BR8 J;  5F8J A;  3VAF A;  2IC3 A;  2PFF B;  2W8L A;  3MMA A;  4ID8 A;  2CQD A;  3UW1 A;  5C42 B;  3KG1 A;  4ITS A;  3S6E A;  4N41 A;  2V67 A;  3MEE B;  3P96 A;  4JI8 J;  3SDE A;  2XCP A;  5L1J A;  4YB6 A;  4C8Y A;  1Y4Z B;  3ONQ A;  4Y2A A;  2ROP A;  3W60 A;  3IA0 A;  1ELO A;  4O4G B;  4OYP A;  4QQB A;  3BO2 A;  1URR A;  1SC1 B;  1DLO B;  2XMW A;  1X4A A;  1TUV A;  5IQ6 A;  1DY3 A;  1F9H A;  4P2S A;  3OVB A;  2GMH A;  3TR5 A;  3QPI A;  5K8P A;  1FKP A;  2OSR A;  3PV8 A;  4DCO B;  3K57 A;  4P75 A;  3H5S A;  3DOM B;  4IFY B;  4YEA A;  3CCU S;  3NMR A;  3P8B B;  1P1L A;  1CQM A;  1WEL A;  1T7P A;  5KG0 A;  4OZ2 A;  5M2R A;  2X1B A;  3MD1 A;  2XY6 A;  1UCN A;  3D28 A;  4M5M A;  3B54 A;  2HAI A;  1R7I A;  2R8I A;  3TX0 A;  4IG0 A;  3EDR B;  3M8S A;  3HHL B;  2XYH B;  2KG0 A;  2VB6 A;  4IRK A;  3FZ2 A;  2Q66 A;  2GNK A;  2RD5 C;  3OTE A;  4I6W A;  2GVZ B;  1VBX A;  1HKA A;  2XS7 A;  3BBF A;  5JMN A;  4ED2 A;  3U02 A;  1CJT B;  2UP1 A;  3IWN C;  4ELU A;  2QLW A;  1MN9 A;  1M5V C;  3D3B J;  5LJ3 Y;  3BH7 B;  1N0U A;  2RU3 A;  5E5N A;  5AXM A;  1FRJ A;  1IVZ A;  1S49 A;  2WON B;  1N48 A;  2OPP A;  2EFQ A;  1NK6 A;  3E01 B;  3K7R A;  2DNO A;  4RNM A;  4ZP6 A;  2HVD A;  4B9N A;  3ZFV A;  1IKW A;  3HUL A;  5KAK A;  5A6W A;  4Y2I A;  5KG7 A;  1UZD A;  4OI2 A;  3GU0 A;  4RWW A;  1WTB A;  3UNY A;  2QG9 B;  1VYA A;  1RBO B;  2OO4 A;  5IT9 U;  2WHO A;  5B7W A;  4MYU A;  1S7I A;  2LQ8 A;  4QPT A;  3NG8 A;  2LQ5 A;  3BGR A;  1TTH B;  4YS2 A;  5EWG A;  4DV3 F;  3M8W A;  1RHU B;  2OEL A;  1U1R A;  1JJH A;  2OFG X;  3UCU P;  4A4J A;  1WSR A;  1F60 B;  3A13 A;  4B9L A;  5I3P A;  3RUB L;  4RW9 A;  1UA1 A;  4YB7 A;  2GX8 A;  2QN6 B;  4USJ C;  3HDS A;  1JLA B;  3GCX P;  3Q8S B;  2DKO B;  5EDW A;  1OS5 A;  3Q8P B;  4QWB A;  2ALZ A;  3M6W A;  5KFD A;  2GIF A;  1UVN A;  1T9V A;  4TNO A;  1WKL A;  3BKU A;  1ZET A;  5DG7 A;  4B3R J;  1OQ6 A;  2HLT A;  3HVT A;  2ATC B;  2BE2 A;  2H1Y A;  4I7F A;  4X65 F;  2YWW A;  3N5B A;  4CH1 A;  1T03 A;  2J76 E;  5DG9 A;  3CD5 A;  1LW0 B;  4F4Y A;  1JLQ B;  1YI2 S;  4IFV B;  3SCL E;  2OUG A;  4PG7 A;  3NAH A;  5IM0 B;  5G0R B;  3I5B A;  2MLY A;  4ZVH A;  2DNY A;  1OY6 A;  2DNP A;  1M5P C;  2IAJ A;  5IT0 A;  2HS4 A;  2QL5 B;  1S97 A;  1CSJ A;  5IXU A;  2AHO B;  1W7W A;  2GGP B;  2IJR A;  4ZPV R;  4X4O A;  3TVK A;  1F3V A;  2L9N A;  2FC9 A;  4TY8 A;  3RRH A;  3BO3 A;  1HNW F;  2Q1L A;  3FK4 A;  2QFI A;  1R43 A;  3MR7 A;  4USH A;  3M8Q A;  1IR2 A;  2CPY A;  4USU A;  2BRK A;  1LW2 A;  1GMW A;  4ZVT B;  3SQG A;  2A10 A;  3AHP A;  2KYX A;  2H5E A;  1K0V A;  1GX5 A;  4PAB A;  2IBO A;  2BRL A;  2G13 A;  2B9E A;  4XIU A;  4HL9 A;  2DNL A;  1MMD A;  5KFC A;  3T9Z A;  3W2W B;  1KLM B;  1YJ9 S;  3LH2 S;  5F3Z A;  1VQK S;  2ACY A;  5D8H B;  2EXU A;  4FKX A;  3R1H A;  2X51 A;  1K9M T;  2E5L J;  4RKU C;  3QT8 A;  1B0T A;  2BKN A;  1TL4 A;  1Q79 A;  2QT7 A;  3CE8 A;  1I6J A;  5HMY A;  1JLF A;  4HLB A;  1HYS A;  2HHX A;  2NRE A;  5HLF A;  1UEV A;  4KFB A;  4OYB A;  5A2Q Y;  1Q4R A;  1RAF B;  1MML A;  1RTD A;  1HFE L;  2ZNZ A;  4DPX A;  1WG1 A;  1PAU B;  1TL1 B;  2MMY A;  3GG1 A;  3J80 U;  3KLE B;  5E3Q A;  2LEC A;  2QA2 A;  1MRO B;  5J2P B;  2KVI A;  1HBU B;  2R8G A;  4X4S A;  2D7S A;  4WXW A;  3ITH A;  3RBZ A;  3DHW C;  4CO5 A;  3BN4 A;  1IWG A;  4ED8 A;  1NB7 A;  3MM6 B;  2V8H A;  2UVV A;  4UW2 A;  1V5V A;  2CJX B;  1OPI A;  2HK2 A;  4KT0 C;  1X4F A;  1NK5 A;  3MMJ A;  1KD1 T;  5HI7 A;  1X8D A;  4RUB A;  3VGV A;  1RYS A;  4C8K A;  3TAR A;  4OJ3 A;  1FF2 A;  4F50 A;  1HQE B;  5H9E K;  3IG1 B;  2Q6C A;  3ELH A;  3GYG A;  4EBD A;  1EHW A;  3NCQ A;  4YOE A;  1LWF A;  5IV4 A;  3GJR B;  2KO1 A;  2RS8 A;  3R5J B;  4OQJ A;  1Q78 A;  3FQK A;  2XHW A;  2HQD A;  2BAN A;  3TEH B;  1M0S A;  1OIA A;  2GZO A;  5GAD I;  4Q7A A;  1CJK B;  2YX4 A;  4CT8 A;  4JV0 A;  1JK9 B;  4ES2 A;  3K5O A;  4LUB A;  5ITH A;  1NDK A;  2CJA A;  3MEG B;  3G2X A;  5HVH A;  2MKC A;  3B4M A;  1U0S A;  4KQZ A;  4YY3 F;  2ZJQ Q;  5EWE A;  2OEJ A;  4KY3 A;  1DQ9 A;  5U47 A;  3W65 A;  3RAX A;  4X62 F;  5AE3 A;  2POK A;  1CS4 A;  1SQE A;  4O3P A;  2WVF A;  4NLO A;  3E51 A;  3FSX A;  1RB0 A;  3M32 B;  2MHE A;  1Q8L A;  2V69 A;  3VAM A;  4W98 A;  3D6H B;  4LF2 A;  1EJ7 L;  3ISN D;  3SBM A;  3NS5 A;  2DRD A;  4B9V A;  4DSI A;  4H54 A;  2LDY A;  2E44 A;  3TA2 A;  2XY7 A;  4EYI B;  2F3J A;  3IRX A;  5K5M A;  2HS0 A;  4O3S A;  1LKZ A;  2X3D A;  4RU2 A;  3DLB A;  2CQB A;  4FBT A;  2DNM A;  4WZQ A;  4PXE A;  4U6P A;  3JQJ A;  1HWK A;  3ETM A;  3QRP A;  1S6Q B;  2V8P A;  3IR6 B;  1UPP A;  1YTY A;  2XZW A;  1OSC A;  2Z57 B;  1B4S A;  2W2M P;  2KRR A;  3KDN A;  3SXL A;  4CTA B;  4HI1 A;  4LFA F;  3ENQ A;  1M5H A;  2UUC F;  4USW A;  5KG5 A;  3X3U A;  4DWI A;  2MQL A;  5E0O A;  2ZUG A;  5D3G B;  3SYZ A;  1B99 A;  2O5D A;  1U2C A;  2MKH A;  5J2N A;  3D67 A;  3K59 A;  1H7X A;  3KG0 A;  3KTQ A;  1I51 B;  3HI9 A;  4J9N A;  3KLG A;  1GFW B;  4DV3 J;  4MKV A;  4DBQ A;  4H4O B;  2V2Q A;  2G0I A;  3V6D B;  1A0O B;  3EXC X;  4DFK A;  3SCI E;  1JJ2 R;  3KYL A;  3MUT P;  3OD2 A;  1B7Y B;  3SSQ A;  1GTH A;  4DN0 A;  1N34 F;  5IC4 B;  2FJE B;  1HMV A;  3MWB A;  4E8U A;  4LMZ A;  1SQF A;  4HT7 A;  1WEZ A;  4PXD A;  4OL8 A;  1TKD A;  2BJ7 A;  4CO3 A;  4KV8 B;  4JI1 F;  2HFV A;  2CNK B;  4ZVE A;  2JC0 A;  1K1Q A;  4HR2 A;  1WOP A;  4UUW A;  4LF6 F;  5AXL A;  1FD2 A;  1NLK L;  4X65 J;  4U7U D;  3UI3 A;  4BCA A;  3W2V A;  2VFV A;  4UOF A;  1S6Q A;  1Q5Y A;  1QAI A;  2YQ3 A;  2Z2L A;  2VA2 A;  2XGQ A;  2G9O A;  2IA0 A;  3G71 S;  1HPZ A;  1KTV A;  4KAI A;  4NA3 A;  1KEK A;  1TFY A;  5IZH A;  3KUE A;  2PI5 A;  2E7X A;  2NYI A;  2RAQ A;  4UQT A;  1U0H B;  4OYX A;  3QZ7 A;  3MHY A;  4C8Z A;  2QMX A;  4I1T A;  3PTW A;  2WBM A;  5K20 B;  4MKA A;  3MPW A;  2R7U A;  1RI7 A;  5BYQ A;  1X7V A;  4C8O A;  1HNW J;  4TYA A;  4BC9 A;  4H4K C;  5D0R A;  2XCA A;  4AFF A;  3PKY A;  1YQH A;  2EKY A;  5DQG A;  4JV1 A;  5ETS A;  4UF4 A;  2NZ4 A;  1S6O A;  5KG1 A;  3EZ5 A;  2L9W A;  3KNG A;  3IWX A;  1BQM B;  2MYF A;  3M8Z A;  2E7V A;  4NCA A;  4DX8 H;  4PXC A;  1QVF R;  1CPZ A;  3M8P B;  3DRX A;  1FER A;  3D9B A;  5CYM B;  1TZ0 A;  4HTJ A;  4F4W A;  4USV A;  5KFV A;  1PGZ A;  1SIW B;  4FYY B;  2FJX A;  2H54 B;  1APS A;  2DY1 A;  1O0P A;  3KLF B;  4GMK A;  1HI0 P;  4LFB F;  4DU8 A;  2FPH X;  1YIJ S;  1LK5 A;  2YQ1 A;  3HFK A;  2DXF A;  2DGQ A;  3RU0 A;  1PIE A;  2Y8Y A;  2QLF B;  2YH1 A;  2N82 B;  4C0H A;  3V6H A;  1N33 F;  5F9N A;  5F9L A;  3OFF A;  3KHL A;  4OI0 A;  3ZTO A;  1QE1 A;  1QAY A;  3F56 A;  3M30 A;  4NLR A;  1YVF A;  5H9F J;  3FKB A;  1N6Q B;  2AWZ A;  1X9S A;  5L9N A;  4GVB A;  1DTQ B;  3D4J A;  3FCV A;  1KON A;  3MR6 A;  2C3Y A;  2A6O A;  1S59 A;  3NNA A;  4CH7 A;  2OJ3 A;  2M7S A;  3T3F A;  1NJZ A;  2CXE A;  4FF4 A;  3FSI A;  2GO8 A;  1V3S A;  4WPA A;  2FVR A;  2WK4 A;  1NJY A;  4IH6 A;  2EBG A;  2B0G A;  3D6T B;  3PJW A;  4F04 B;  1WI8 A;  5L38 A;  2YKN B;  1FDN A;  5T14 A;  2FJD B;  1RYR A;  2XYG B;  1AA1 B;  1REV A;  2VBY A;  3P45 B;  1JMT A;  3HSG A;  1RAH B;  5DM6 Q;  3BB5 A;  3M2V B;  1RQ0 A;  2B9Y A;  4LSN A;  3Q23 A;  2AJ2 A;  5BYS A;  4EMD A;  3GIL A;  4YY3 J;  1TFW A;  1GT8 A;  3H8Y A;  4FF3 A;  2KB2 A;  5J2M A;  5KOX A;  4X62 J;  1S9E A;  3TA0 A;  3JAM Y;  5HSP A;  4DEZ A;  3H2U B;  4G65 A;  2JLE A;  3JSM A;  2XLJ A;  1C0T A;  5LSO A;  1SJQ A;  1FD8 A;  3HCX A;  3GJT B;  2WSE C;  1OMS A;  1FFG B;  5GMK a;  2UUW A;  1BQN B;  3EM1 A;  2RRA A;  3D66 A;  2PO4 A;  5F8N A;  4WFN Q;  3MCS A;  2OI2 A;  2LDI A;  4E2F B;  1ZAX A;  3FFI A;  2DGU A;  2LMI A;  1P6T A;  1UWB B;  5ETR A;  2JSX A;  2FQQ B;  4B9M A;  5A8W A;  1RT1 A;  1F3F A;  2AU0 A;  4Y34 A;  3FDS A;  1RAA B;  3JSB A;  2ZH4 A;  1S1X A;  1TP7 A;  1S1U A;  3MED A;  3N4W A;  1NSP A;  2HS3 A;  3JQM A;  2AJ4 A;  2N4D A;  1YWX A;  4ZP9 A;  1RKI A;  4ZVO B;  2C2N A;  3NMA A;  4OHZ A;  1PC4 A;  1IR1 A;  5LMN F;  4LFA J;  4NLY A;  4WFX A;  2UUC J;  4LF5 F;  2XQC A;  5IT4 A;  4F2S A;  5C5J A;  1HHT P;  2HRU A;  2CFX A;  2J8A A;  5HBM A;  4YHH F;  1LFW A;  4PPD A;  1QAX A;  3AD9 C;  2QC3 A;  2KYZ A;  5HMW A;  4M5L A;  2HBZ B;  2LCW A;  1Q7L B;  4ZVU B;  3Q83 A;  3KXD A;  3VHQ A;  2I8E A;  3HJF A;  2E29 A;  4B9U A;  1N34 J;  5H1S V;  4FYD A;  3H20 A;  4FYX B;  3TJA A;  3M2U B;  1VBZ A;  4LRD A;  4L76 A;  2B5J A;  1U1K A;  3KUH A;  4ZPB A;  4OMF G;  1TMM A;  2F8E X;  4JI1 J;  1GEH A;  3QAU A;  2PMH A;  2EI5 A;  4EYH B;  3PJ9 A;  1B0V A;  4NCG A;  4MH8 A;  5HO4 A;  1RT7 A;  1C1C B;  4C4W A;  3QID A;  4LF6 J;  5KFK A;  1JLB A;  4CRJ A;  1N32 F;  2O66 A;  1VRT A;  2MHN A;  3ENW A;  2UUT A;  3PW0 A;  1S9G B;  1WI6 A;  1YJT A;  4K4W A;  3C3L A;  2B43 A;  3PRD A;  2CQP A;  5AXN A;  2V50 A;  5HMX A;  2DR9 A;  1T9X A;  1TVR A;  3RB6 A;  3JYT B;  1T8E A;  1VBK A;  3KJF B;  1WF1 A;  1H2V Z;  2C2Z B;  3BDP A;  1S12 A;  2DR7 A;  1H74 A;  3OL7 A;  2MXY A;  1LWC B;  4ZVS B;  4WU3 A;  1R3N A;  2W9B A;  4ZCI A;  2VQE F;  1S1V A;  2DCL A;  1FXR A;  1VHF A;  1XK8 A;  2RHQ B;  3QJJ A;  4A8K A;  2P5V A;  3MCO A;  3RTV A;  2RUG A;  3WC2 A;  2GIR A;  5A6P A;  5IWA F;  1Y0H A;  1CJV B;  4W92 B;  2FHK A;  3FZB A;  5I4M A;  3QJL A;  5FJ4 A;  3G96 A;  3Q86 A;  5FDL B;  2VH7 A;  1XC9 A;  3I4H X;  3R2D J;  2AZ1 A;  1T05 A;  3F41 A;  1F5A A;  2N4C A;  1VQY A;  2DNG A;  3SSR A;  2YBV A;  1F5C A;  4EU0 A;  4DFP A;  3H7H B;  2MQN A;  2R7S A;  2ZC3 A;  3TW0 A;  2IVF B;  5A8R A;  3MTK A;  2AX0 A;  2K3K A;  1ZOT A;  2F5G A;  2F7V A;  4R5P A;  1F0X A;  1KN6 A;  1KLN A;  4N76 A;  4LFB J;  2WVC A;  4C3L A;  4RNF A;  4LIR A;  4I4B A;  2NSB A;  2Q6B A;  4WBF A;  3IS9 A;  2JFD A;  4ZJQ A;  1TL7 A;  4ECW A;  1WF2 A;  4MMO A;  3IRW P;  4DUY F;  1O8B A;  1N33 J;  2BE9 B;  1RT5 A;  3M6U A;  1AXQ A;  2J0Q D;  4IQX A;  1M1K T;  3ZZZ A;  4QIG A;  5I3U A;  3TUJ C;  2BE7 D;  4NRT A;  2FVC A;  3LGN A;  4EI2 A;  3V6K A;  1MMN A;  1ZBT A;  1IR0 A;  2WSC C;  2JZ5 A;  4Q44 A;  3MEC B;  1DTT A;  2DH8 A;  4GKK F;  1VQ9 S;  4PQU B;  4K4X A;  3C14 A;  5CZX A;  2QLX A;  2ZH7 A;  4L3N A;  4BWJ A;  4DSJ A;  2W9C B;  3KK3 A;  3NGT A;  2DVI A;  2IJN A;  3PYG A;  2VIC A;  2VA3 A;  2FZK B;  4EZ9 A;  2RUS A;  1FES A;  3DOK B;  4QIW D;  5H9E J;  3K17 A;  2VOD A;  3H5Y A;  1TKT A;  3GJQ B;  2W01 A;  3MM7 B;  4LSZ B;  2IM2 A;  4NEZ A;  1PCA A;  3I87 A;  3AH6 A;  4KKO A;  2C2R A;  4ETX A;  2OPR A;  3KLV A;  4HKQ A;  3MAA A;  3JQK A;  3OTB A;  1WC4 A;  3N6L A;  4DL7 A;  2XUL A;  3K5M A;  2J6S A;  4WWS A;  3K5N A;  2LFV A;  3QSY B;  2HNZ B;  3THP A;  3R7N B;  3R27 A;  4HVZ A;  5J1E A;  2A0F B;  1SKR A;  3EMT A;  2J8S A;  1U7L A;  2YNF A;  3MM9 A;  4DX7 A;  4DQR A;  4PWW A;  3NNC A;  2NXE A;  4M5D B;  1C1B A;  1S48 A;  5T41 A;  3DGV A;  3UR3 C;  4WE1 A;  3D0H E;  3MOZ A;  2RIL A;  2C3O A;  3G9C A;  3PFE A;  2UXD F;  4D3G A;  2WOM A;  1GMV A;  2IM1 A;  2FVP A;  4ZLP A;  2JJ4 D;  2Y9H A;  1HW9 A;  5K14 B;  4U7C A;  4WF9 Q;  1QDU B;  8RUC A;  2ZUA A;  4FPI A;  3OV7 A;  1U49 A;  4M94 A;  1UVJ A;  1TV6 A;  3AOC A;  1YRU A;  3BPS P;  4FNH A;  4NYZ A;  1R0B G;  3QLH A;  5AE1 A;  1NB2 A;  3QYY A;  4PG6 A;  4HAC A;  5LMN J;  2BA9 A;  4CO2 A;  3L7O A;  4LF5 J;  3W8P A;  1FFS B;  4M5H A;  3WQP A;  5EX0 A;  5HN0 A;  4LRE A;  4YHH J;  3WHI A;  7AT1 B;  1NHK L;  2M88 A;  2CJQ A;  3IR7 B;  1VQO S;  3L9Z A;  4HI2 A;  1VDH A;  3TZX A;  1YBT A;  5CAB A;  3LWM A;  1PBA A;  4F02 A;  1MWZ A;  1EP4 A;  1ZM9 A;  1RCO B;  3RW6 A;  1UEK A;  3S1T A;  5ETL A;  4J91 A;  1YJU A;  5T7L B;  2DIT A;  4CLS A;  4ID5 B;  1X4E A;  4ZN3 A;  1EX8 A;  1Q8K A;  3EDQ B;  1DRZ A;  4N8N A;  3LUY A;  2HGL A;  3AFG A;  3H59 A;  3S7R A;  2V94 A;  2DGX A;  4DG1 B;  1BXN A;  2Z2M A;  1AZS A;  3DOL A;  2ZBR A;  4PUO B;  5A0Y A;  1VFJ A;  4WK1 A;  3CJS A;  3PYF A;  3PDN A;  2IYG A;  1RT3 A;  4LRA A;  3PEJ A;  2XWY A;  3CCL S;  4ZN1 A;  5F0U A;  4DV0 F;  4BBY A;  1N32 J;  4HHJ A;  1PO6 A;  3B78 A;  2NCK L;  3N5F A;  4RX6 A;  3R3T A;  4P2F A;  3JTO A;  1KVI A;  3VV2 B;  2VBW A;  3PXG a;  5DRK A;  4OYI A;  3KJQ B;  3A8J A;  2YWK A;  1S1W A;  4PZV A;  2OML A;  4XPC A;  2Y0S D;  4RPF A;  1RAC B;  1KQF B;  3MGJ A;  1U4B A;  3I4P A;  2RDI A;  4EBE A;  3I0R B;  3H4D A;  3HJV A;  2P9G A;  1M5S A;  1OO0 B;  3W1Y C;  1WJ9 A;  2I5J B;  2AYG A;  4MTP A;  5GAG I;  3DRP A;  4P71 A;  2GV1 A;  4CYU A;  2VQE J;  1JKH A;  2OPS B;  4NRU A;  1NM2 A;  2KU7 A;  2F9D A;  1OJ4 A;  3RR7 A;  1ZTT A;  3ZC4 A;  5F8G A;  5IQQ A;  1IKX B;  1NPR A;  1OY9 A;  2C3U A;  3GZ7 A;  1FDD A;  4H4M B;  2DO4 A;  2BJ9 A;  2CPF A;  3N01 A;  2R7R A;  3LAL A;  2Q79 A;  4MK7 A;  2W2P P;  3DLH A;  3MR2 A;  1L3T A;  3QIP A;  1EQM A;  2D1C A;  3D0I E;  3MMC B;  2JEJ A;  1HNV A;  3PIO Q;  3POT B;  1TKZ B;  2FHJ A;  2CQI A;  2ZM6 F;  5E3A A;  3DLE B;  2OP5 A;  2J6T A;  5KT4 A;  3UDC A;  1YZ7 A;  3FEX B;  4A8O A;  4DF8 A;  4Y2C A;  5D78 A;  3P3D A;  1UP1 A;  3KK1 A;  2P9E A;  2IDE A;  2MPU A;  1VC5 A;  1FKA F;  4DZD A;  2IHR 1;  2I1R A;  4IUF A;  3H2V E;  4OHW A;  4MT1 A;  3LP1 A;  4X4U A;  4URS A;  3OFH A;  3UE2 A;  1DQ8 A;  4KH1 B;  2OHD A;  4DUY J;  2ZD1 A;  1RAJ A;  3MMB B;  3DI6 B;  1X4B A;  2MGZ A;  4EO8 A;  1OWX A;  1SL1 A;  1X0F A;  4DXL A;  3DLG B;  1HL6 A;  4Q0B A;  1RT6 B;  4LF9 F;  3LO3 A;  1PJ7 A;  4P2X A;  2CZ4 A;  3S01 A;  2IRY A;  3SI8 A;  1OY8 A;  2LXI A;  3I31 A;  2XTJ P;  4F3O A;  4N47 A;  4ZHR B;  3ZZO A;  1XMB A;  4GKK J;  2W2O P;  2LEA A;  1SH3 A;  3ISZ A;  2EFG A;  3DC2 A;  1YX2 A;  2IM3 A;  1RWW B;  1QSY A;  3NWG A;  2YKA A;  1WEX A;  4DV4 F;  4Y0F A;  3TI0 A;  5KFE A;  1RWP B;  2LLZ A;  1RBA A;  1JWW A;  4IDK B;  3QO9 A;  2J7W A;  4DS4 A;  2C2O B;  4FXD A;  2R7O A;  2OIH A;  2FD2 A;  3KK2 A;  4RW6 B;  3NGD A;  4PRF A;  3M8Y A;  3GSI A;  4C7Q A;  3KHG A;  2B4V A;  3W62 A;  1VIS A;  1N56 A;  1XQI A;  4NMX A;  3CJT A;  1UW4 A;  3DGP A;  3OW2 R;  1T3N A;  2WSF C;  3BEG B;  2APO A;  3VWS A;  1KP6 A;  1ULR A;  3O44 A;  1HLW A;  2VL1 A;  1VQP S;  3FSY A;  4DR3 F;  1Q81 T;  3TJ9 A;  2NR0 A;  2OGU A;  2KFN A;  3DFE A;  2MY7 A;  1ROF A;  1PJ5 A;  3NWR A;  2NPI A;  4ETZ A;  3NAI A;  1UKU A;  2C2E A;  5GAE U;  1X5T A;  2HHT A;  3ULH A;  1JLG A;  2UXD J;  2LQJ A;  3HT0 A;  1UJ4 A;  3AY0 A;  3KMQ A;  2YWE A;  4LIW A;  2GQC A;  3MCN A;  1S10 A;  3Q89 A;  4J90 A;  3TNV A;  3CF5 Q;  3J81 U;  2GMJ A;  4OYZ A;  3BJY A;  3M6X A;  4DF4 A;  5M2P A;  3CDA A;  3EZO A;  2DR8 A;  4U67 Q;  1KC8 T;  1NKC A;  2W2N P;  2BKO A;  4FS2 A;  1Q16 B;  2VZ9 A;  4DPO A;  2E5I A;  2HHS A;  3PYD A;  2PMW A;  2DIS A;  1WKK A;  6FDR A;  2V9K A;  5K8M A;  1RA6 A;  4ICL B;  3BYP A;  4F4A A;  4ZCK A;  1FNX H;  1JX4 A;  4HHU A;  3NGR A;  2C28 A;  1BLU A;  3I6P A;  4ZJO A;  2D9O A;  2EFV A;  2CJ9 A;  3GV8 B;  1TL3 B;  2MTL A;  2M3D A;  1S57 A;  2QMW A;  4A8X A;  1FKO A;  5LSR A;  2G1H A;  3OR1 B;  4OIX A;  4QPX A;  3LP2 A;  2AJQ A;  3ILI A;  2DJW A;  2A2D A;  2CDR B;  1E6V B;  1FVS A;  1RWO B;  3GMG A;  2PA8 D;  1Y7P A;  2DO0 A;  3DHX A;  1R8C A;  2LQ9 A;  3TX8 A;  2FHO B;  2CUY A;  2BVZ A;  2VG7 B;  3EPG A;  2AEF A;  3I5A A;  3BQ1 A;  2HVE A;  3MUV P;  3W5X A;  3UDL A;  4LF4 F;  3D68 A;  4HTI A;  4F8R A;  5DLG A;  3CJ8 A;  5KTQ A;  3W63 A;  4DN9 A;  1MU2 B;  4DV0 J;  4K50 A;  4WYW A;  4CO4 A;  4XAK A;  4X64 F;  1W26 A;  2DRB A;  4ED3 A;  4TVA B;  1NME B;  1RTJ B;  4OYW A;  3UCZ P;  4B3O B;  3G87 A;  2UVU A;  1JLE A;  4HEA 9;  1RWU A;  1UVI A;  2VOP A;  1RWM B;  3MAH A;  1K1S A;  4K8R A;  1TK0 A;  3N28 A;  2NXC A;  4P7T A;  1K73 T;  1GK8 A;  1TEL A;  3Q22 A;  5KG4 A;  5FLX Y;  1TR0 A;  3N0V A;  3G8S A;  2KXF A;  3KJV B;  4CLW A;  2OMO A;  1WF0 A;  1EB0 A;  3OR2 A;  4A47 A;  3HSJ A;  1RT2 B;  3FC9 A;  4U96 A;  2CZ9 A;  1EKR A;  1U1M A;  3N6N A;  2JRS A;  3DYA B;  1CJU B;  3R5D A;  4NA2 A;  1IQT A;  1FO1 A;  2L3M A;  5KFL A;  5KG6 A;  3C6U B;  3FQL A;  3L7P A;  5DS7 A;  1FFW B;  1M1H A;  3L7U A;  5KFB A;  2HNY B;  3W64 A;  2RB7 A;  2PFD A;  1Y9O A;  4FPR A;  2HQF A;  6FD1 A;  2R2R A;  1J5E F;  4PWD A;  4ED7 A;  5CAA A;  4OZ3 A;  2P2C B;  2F4F A;  1XN9 A;  1OQ3 A;  2DGW A;  4U95 A;  2V68 A;  3IGV A;  1KQG B;  2ZM6 J;  3KLI A;  3UN2 A;  5A8K A;  2XZT B;  3M4X A;  1HA1 A;  2OFH X;  4V19 X;  2VPY B;  2FDN A;  5KG2 A;  2PC6 A;  5HRO B;  2QLJ B;  3OLB A;  5AJ3 F;  4R8U A;  1S76 D;  2V4J A;  2GCF A;  3PW7 A;  2PEH A;  1YLX A;  3OTC A;  2VOO A;  3A8E A;  4DQP A;  2FVQ A;  2AJ1 A;  3H40 A;  9RUB A;  1ZA1 B;  1U26 A;  3R97 A;  1UET A;  1JNZ B;  2CPI A;  3HFZ B;  2C3P A;  3CCZ A;  2MSS A;  1R8B A;  2V63 A;  1XEZ A;  5HVG A;  2XS2 A;  2ASY A;  2FZC B;  4LF9 J;  3HP6 A;  3TAM A;  4GO5 X;  2YWH A;  4ECU A;  1FWP A;  2VDH A;  3GE9 A;  1SV5 A;  1NK7 A;  4MIW A;  2OD4 A;  3M8R A;  3DDK A;  3X1L B;  3DRS B;  3WZ0 A;  3J7A 1;  2XI2 A;  3CCQ S;  5CYQ A;  2BR0 A;  3JSR A;  2ZZM A;  3UNG C;  1VOM A;  2YNI A;  4F26 A;  4RUC A;  3KMS A;  4DV4 J;  5GAH U;  4OX7 A;  4LR9 A;  4BC7 A;  1S0N A;  4O44 B;  4CLT A;  5LJ5 Y;  4YR0 A;  1T11 A;  2DTJ A;  2HMI B;  1ZS6 A;  4C11 A;  2DNH A;  4ECZ A;  1Q82 T;  1KNZ A;  3H90 A;  4CP5 A;  4I2Q A;  2EC0 A;  2BM1 A;  1Q0N A;  1GQE A;  5KFP A;  1BUX A;  5DZ6 A;  5K8O A;  4A8Y A;  3QFH A;  4LVN P;  3VAI A;  2ZEJ A;  1YJ7 A;  2OEK A;  4CI0 B;  2M5Y A;  2CG8 A;  3ILO A;  1ZH5 A;  1Z2Z A;  3C6T A;  3PFO A;  3SV4 A;  1QVG R;  5L1K A;  2UXC F;  1U45 A;  4IOC Q;  2B6A A;  1J2V A;  1UJ5 A;  1NAQ A;  1SL0 A;  3SMZ A;  3DRR A;  1UFK A;  4DR3 J;  4ZLJ A;  3H25 A;  2BW2 A;  1VC0 A;  1WG4 A;  3PW4 A;  2UXB F;  1Q1K A;  2HRT A;  4GVL A;  2HHH F;  3J7Y I;  3IBF B;  4O4R A;  5I42 A;  2R8J A;  2QYC A;  1CG2 A;  2B3T B;  2MZJ A;  2IC3 B;  3OTD A;  1YZ6 A;  2XY5 A;  3MMA B;  1E6Y A;  3T1Y F;  3BPD A;  3UDV A;  1RAE B;  4RO0 A;  3D0G E;  3BGL A;  4AXJ A;  2XSF A;  5KFG A;  1RAO A;  3SDE B;  1D9F A;  4LSL A;  1N52 B;  3CMQ A;  4MFB A;  2Y8W A;  1HBO A;  1KQS R;  3K5P A;  5L46 A;  2DIV A;  3PX0 A;  2ZIT A;  1SJR A;  3T5J A;  4WXO A;  4OJG A;  5ETM A;  2X1A A;  2RHS B;  2AP6 A;  1ACM B;  1VRU A;  5HMZ A;  3A8K A;  3LP0 A;  3IAM 9;  1U48 A;  3MM5 A;  1FKP B;  1RAB B;  2J9C A;  3CJK A;  2B56 A;  2DNK A;  4MK8 A;  2J9D A;  3H2L A;  4E98 A;  4FKY A;  4LRC A;  2E66 A;  2V4Q A;  2H48 B;  3KG4 A;  1FNM A;  4DR5 F;  4MKB A;  1QLN A;  1AFI A;  4CIO A;  4IG0 B;  4DR2 F;  2AMC B;  1YSJ A;  2ILZ A;  4U7U K;  2GW8 A;  4OZ1 A;  4IQM A;  3BQ2 A;  1CQN A;  2FJA B;  4P52 A;  4RLE A;  4TU9 A;  3QT7 A;  1NDP A;  2IRU A;  3DM2 A;  2L08 A;  2UU9 F;  3A8I A;  1D8Z A;  3MD3 A;  1F9E B;  3CCV S;  4OHV A;  4DX5 A;  4LF4 J;  3DDN A;  4LQ9 A;  4QWE A;  1WUU A;  2WVD A;  1J5O A;  3KNA A;  3T1H F;  3L09 A;  3FCH A;  5G4D A;  8ATC B;  2KT5 A;  4X64 J;  5L39 A;  5E2Q A;  2OPP B;  3AXK A;  2DHH A;  3BYR A;  3EE3 A;  3MR3 A;  2QSF A;  2M9K A;  2GJF A;  1BHN A;  3H5X A;  2MLX A;  3DMJ A;  2BX6 A;  1L5U A;  5B0D A;  3PRB A;  1IKW B;  2H3E B;  3B8H A;  5LSL A;  3DNC A;  3NY0 A;  2RQC A;  5EX3 A;  4RW4 A;  3FUY A;  2GHW A;  5JVG Q;  3SSS A;  2DEJ A;  1JXL A;  4C8N A;  2K06 A;  2NUH A;  1C0U A;  3U1L A;  8AT1 B;  2ADC A;  4FNI A;  3UR0 A;  4USI A;  3BGR B;  1VQM S;  4RJV A;  5E3R A;  3BDE A;  4AUK A;  1YG0 A;  3BR8 A;  4NWB A;  5LM7 E;  3JTP A;  1PBU A;  1MWQ A;  2MDA A;  4WTO B;  4KO0 A;  4F0H A;  1ZYQ A;  4RW9 B;  3A1Y G;  2HYI B;  1WNE A;  1T0T V;  1ZZF A;  2UVW A;  2HUR A;  3QMQ A;  2YKO A;  2Z8Q A;  3CC4 S;  1J5E J;  3BSC A;  2WTF A;  3C15 A;  5KFW A;  4NOH A;  3QAE A;  2J9D E;  3MUM P;  3AA9 A;  4AL6 A;  2XMM A;  1IBM F;  4RW8 A;  3CVK A;  1B64 A;  1H73 A;  1HNZ F;  3FBE A;  3IC1 A;  3JXO A;  2DEI A;  1VJQ A;  3HHL D;  5DDO C;  3HHD A;  3TYT A;  3HD1 A;  5AJ3 J;  2UVR A;  2EFP A;  1XNQ F;  3WX4 A;  3HVT B;  2BE2 B;  4I7F B;  2DPI A;  1T03 B;  4C97 A;  3OUY A;  5LXR A;  1SJ1 A;  3UN5 A;  1R31 A;  1K0T A;  5LL6 d;  5C24 A;  1VQ8 S;  2P9C A;  4NCB A;  3EUN A;  2W4P A;  4WKY A;  4BDP A;  4O0N A;  1JJ4 A;  2IAJ B;  1SH2 A;  3VAL A;  1YHQ S;  2ZWP A;  1X4H A;  2R2S A;  3PO5 A;  4WU2 A;  4DL3 A;  3V81 A;  1FTR A;  3RBD A;  1CLF A;  1HBN A;  2PN6 A;  1VS3 A;  1WG5 A;  3PEH A;  4Z7C A;  4TY8 B;  2F65 A;  1HBM A;  2CQC A;  2V2V A;  1UPM B;  2MZT A;  4J5O A;  3M8Q B;  2OH2 A;  4NLG A;  1LW2 B;  1FRX A;  4PR6 A;  1NXI A;  3DLJ A;  2XMV A;  3SQG B;  4PEO A;  4RBT A;  3C16 A;  2RNE A;  4NYO A;  2AIR B;  2MQ8 A;  3ZZY A;  4DMZ A;  1U1N A;  4QYZ J;  3UD5 A;  1HR0 F;  1B70 B;  3HSD A;  2RT3 A;  5KFZ A;  3BKT A;  1XBW A;  2BEF A;  3QBC A;  3CT9 A;  1CC8 A;  1IBK F;  1GX6 A;  5IC6 B;  3VVT A;  2CQG A;  2YWG A;  3VZH A;  3KLH A;  1LWE A;  2JH3 A;  2B51 A;  1G4C A;  1KS2 A;  1RK8 A;  2KT2 A;  3BV8 A;  1JLC A;  1EIY B;  3QWP A;  1JLF B;  3FBC A;  2AT1 B;  4CWB A;  2UXC J;  1HYS B;  4DOZ A;  3AB4 B;  5HLF B;  2CNO B;  5KFO A;  4KFB B;  4OI4 A;  1RTD B;  3T1A A;  2ACM A;  3WDO A;  1RTH A;  4A48 A;  4JI2 F;  2UUB F;  2CQ1 A;  4JI7 F;  2QV6 A;  1IKV A;  2UXB J;  4C9D A;  1KBR A;  1RZM A;  4RUH A;  4ED1 A;  4LFC F;  3ET6 A;  4QU7 A;  4I64 A;  1RAD B;  2QIF A;  2GJI A;  5KT2 A;  3ITH B;  2DY9 A;  2CQ3 A;  1G2E A;  2V6A A;  1GNK A;  3TVZ A;  3T1Y J;  1WC6 A;  2LP4 A;  1XER A;  4KBI A;  4ELT A;  2XO7 A;  2JHE A;  3DRY A;  4L3K A;  3G8Q A;  1H38 A;  3UFC X;  3G6V A;  4NLQ A;  4NAS A;  1QD1 A;  5A76 A;  3EGV A;  2CA9 A;  4M5N A;  1EET A;  3V6J A;  4Y2M A;  1H6K X;  4URQ U;  4TLQ A;  1LWF B;  3PX4 A;  3TJ8 A;  3MFI A;  2ZKT A;  2JL9 A;  3TVY A;  4YR2 A;  1YDL A;  4Z2X A;  2BAN B;  1ZM3 A;  2CPD A;  4F25 A;  2L48 A;  2WZ1 A;  1CEZ A;  2CRL A;  2W4C A;  4IYQ A;  1S0O A;  4EBC A;  4LR7 A;  1Y3J A;  2AGO A;  2VQF F;  1S7H A;  2I38 A;  3MDF A;  2RQK A;  4XTT A;  4N8O A;  3PW5 A;  4DR5 J;  2DIU A;  2QL7 B;  2UUA F;  3SZ2 A;  4KYZ A;  4DR2 J;  5E7O B;  2M2B A;  4DHV A;  1CS4 B;  1HIY A;  3HLU A;  4JOU A;  4Q8E A;  1TKX A;  1RXO B;  1DFD A;  1F2H A;  1UA0 A;  2W7O A;  4DV5 F;  2VU5 A;  4I67 A;  1RWK B;  1NSQ A;  2UU9 J;  3NOG A;  5AXK A;  1RWN B;  3IRX B;  4F4K A;  4X4R A;  1DJ0 A;  1EAR A;  2Y1R I;  3V5R A;  2ZBQ A;  3T1H J;  1VQL S;  4FF2 A;  4W4M A;  2P6T A;  2FY8 A;  1Y11 A;  3ETO A;  3LOU A;  2XI3 A;  1WKJ A;  1U2F A;  1N5S A;  2JOQ A;  1IWA A;  2Z0G A;  2MKY A;  1TL5 A;  3CD7 A;  4I2P A;  5LMU F;  2CJK A;  4WJB A;  1LXJ A;  4UUX A;  3G6E S;  1LNQ A;  3CJ4 A;  3OFG A;  2MKK A;  4ECR A;  1N4L A;  4JI0 F;  3VAK A;  2EVZ A;  2OAU A;  1FK9 A;  5J2N B;  2A1B A;  1HWJ A;  3FEY B;  1PC5 A;  1SVD A;  3I0S A;  4BS2 A;  4JI5 F;  3K58 A;  2CJY B;  3KLG B;  2HAF A;  1L3V A;  3T5H A;  2HQG A;  3NS7 B;  5D4L A;  3BSN A;  2IYI A;  2LXU A;  5KT5 A;  3PW2 A;  1KHW A;  4DCP B;  1QTM A;  1NH7 A;  3GQC A;  3QZ8 A;  4IG3 A;  1R0A A;  1FXL A;  1HMV B;  3J7Y U;  2HFU A;  2MZ1 A;  4ZMM A;  2BJ1 A;  2R2U A;  4WP3 A;  4LBP A;  2Y1L B;  3DKD A;  1NEE A;  2RRN A;  2VG6 A;  5E3C A;  4LT6 A;  5HK4 A;  3I82 A;  4TYB A;  1FRL A;  4RNN A;  2EW9 A;  1EAY C;  1IBM J;  4K0K F;  3TZZ A;  4DPW A;  3MEK A;  3AJD A;  1HNZ J;  1QAJ A;  1T95 A;  1RTI A;  1NDC A;  2EWH A;  4D3H A;  1KOO A;  5IFM A;  1XNQ J;  4A8W A;  4OYO A;  4ZKA A;  3W2V B;  3PNI A;  1Y00 A;  3PR4 A;  1U24 A;  2ZZN A;  2A2C A;  2U2F A;  1HHQ A;  2E1C A;  1TAU A;  2JNJ A;  4P7V A;  1RT4 A;  3MTJ A;  2ZH2 A;  3JB9 k;  4NML A;  1HPZ B;  1NPK A;  2MQM A;  3NBP A;  4ZS6 A;  2KM8 C;  4TKT A;  4X2B A;  1Y10 A;  3UO0 A;  2H65 B;  1VBY A;  3G82 A;  4A8S A;  1SI9 A;  2NLW A;  4WFZ A;  3GSD A;  2KVQ E;  5M2U A;  2YNH A;  2FHM A;  1JXE A;  4KPY A;  2R3V A;  3TOQ A;  2IA6 A;  4WP9 A;  1UFL A;  4FP9 A;  1N5Y A;  4J7C A;  2HBY B;  3VTI A;  3BRE A;  1M5K C;  2Z30 B;  5J2Q A;  3QT5 A;  5A2Q U;  4FYV B;  2GML A;  3PY8 A;  1NKE A;  3DDI A;  2CPX A;  1DBD A;  2FUG 9;  4OFZ A;  3ENV A;  1H2U X;  2E1M C;  1HR0 J;  4OJ1 A;  5EHH A;  2RF2 A;  3O6Q A;  2BV3 A;  1FTC A;  5EN1 A;  1L3U A;  2BQ3 A;  1PAE X;  1IJE B;  3HZE A;  3BN7 A;  4ED6 A;  1IBK J;  4QW8 A;  2ILY A;  5E3P A;  4DR7 F;  2RJZ A;  1MLA A;  4Q45 A;  2HGM A;  1CUL A;  4J9O A;  1RCX B;  2ALY B;  1YRT A;  1KFS A;  2GVD A;  2YNG A;  3JTN A;  4Y28 C;  1ZM2 A;  4I56 A;  2XSJ A;  3PVX A;  1Y3K A;  2V8G A;  4ZP8 A;  3OQ2 A;  2DYA A;  4DU7 A;  1LWX A;  1R8H A;  5LOQ A;  1HNI A;  1VMB A;  4JI2 J;  2UUB J;  4JI7 J;  2DR5 A;  1QE1 B;  1H7W A;  3M30 B;  1LFP A;  3R5C A;  4JI6 F;  2GJ2 A;  4LFC J;  1SC4 B;  2PE8 A;  5B0F A;  3GJS B;  1R27 B;  1NJI T;  2RH3 A;  4GVB B;  1RJJ A;  1D1U A;  5F8M A;  1URN A;  4DL6 A;  3NXZ A;  1K8A T;  2RQM A;  2M4M A;  3EVO A;  2J6U A;  1REG X;  2HND A;  2BOA A;  3DU6 A;  4ZOS A;  4MIA A;  1QY7 A;  2OLW A;  4F36 A;  1HAR A;  2NQP A;  2VC1 A;  4LRF A;  3MCM A;  1FE0 A;  1HNX F;  2RML A;  4RU9 A;  5D0H A;  1M5O C;  1FNO A;  4PG5 A;  5KFR A;  2ZH8 A;  2RKI A;  1T9U A;  1H2T Z;  2QEX S;  4L6V 3;  1REV B;  3CO0 P;  3T6J A;  2UZA A;  4RL1 A;  3ZTS A;  4U8Y A;  2VQF J;  2FGO A;  5DQH A;  4LSN B;  4NPO A;  2VFS A;  4YQW A;  4ZVF A;  1SPB P;  4TXS A;  1KKH A;  4MK9 A;  4QCL A;  2UUA J;  2HZV A;  3IXQ A;  1T3O A;  2OPQ A;  5J2M B;  1NK0 A;  1S9E B;  4FDF A;  1YJV A;  5KFT A;  2ZC4 A;  1UJ6 A;  1NK4 A;  4RUA A;  1N5Q A;  3JSM B;  2CNN B;  1C0T B;  1R8P A;  1OYE A;  1FVQ A;  1T02 A;  5GME A;  1IKY A;  5CQG A;  2F1F A;  3WC0 A;  4YFU A;  5CZV A;  2HFS A;  3CD0 A;  4DV5 J;  3CDE A;  3HFV A;  1RE1 B;  2F40 A;  3I96 A;  2W7P A;  1Z1Z A;  3FFI B;  3UVJ A;  4P2M A;  4N56 A;  4X4N A;  2E1P A;  1X60 A;  5C25 A;  2HFN A;  5KFM A;  4WKR A;  1L3K A;  1SKS A;  2H51 B;  1U1O A;  2EEY A;  1VK8 A;  5A8W B;  1RT1 B;  2J9E A;  4LF7 F;  4RW7 A;  2A3J A;  1HQU A;  3EGN A;  1YK9 A;  2AV5 A;  1ZM4 A;  4DS5 A;  1A9N B;  4KGK A;  2QTW A;  3VCD A;  1S1X B;  1J27 A;  4USK A;  1S1U B;  2J7K A;  5IT9 Y;  2IRX A;  3MED B;  3V4I A;  3BKF A;  4UOH A;  5LMU J;  3D1O A;  5SUH A;  3CGI A;  3PM9 A;  2G0C A;  1KSP A;  3MM8 A;  4DR4 F;  3UWT A;  3T5K A;  2KN4 A;  3PCO B;  4XDD A;  3FEZ A;  1JB0 C;  4JI0 J;  5BJR A;  3AA8 A;  5HBM B;  2HHW A;  2JEG A;  1RLD A;  3PIP Q;  2HRY A;  1P9Y A;  4JI5 J;  2D3O 1;  4IOA Q;  4G3I A;  5L1L A;  3DCA A;  2M8H A;  2D9P A;  4FBU A;  3WIV A;  1X4G A;  4PWU A;  2QA4 S;  4AD6 A;  2YTC A;  2PII A;  3NKY A;  1JIH A;  3LQV A;  3M1V A;  4F4X A;  2PD1 A;  4ES1 A;  4A8F A;  4CLY A;  1H0H B;  2B5J B;  2ZOF A;  4CO1 A;  5KFU A;  3IAS 9;  3D3C J;  2XG8 A;  3OJU A;  1QSL A;  4IOB A;  1RHJ B;  4DDF A;  1GXU A;  3I32 A;  4BWM A;  3OSN A;  2DXE A;  1JNR B;  1WWH A;  2CPH A;  2EKN A;  1KQK A;  2YKM A;  3VF0 B;  4YDD B;  4K0K J;  4NCG B;  4PCQ A;  4Z37 A;  1RT7 B;  4ZA1 A;  1RLC L;  3EXY A;  3CNQ P;  1JLB B;  3BSO A;  3TRG A;  1SB6 A;  3JS9 A;  1VRT B;  4O3Q A;  5KFQ A;  3TUP A;  1S1T A;  1Q7Y T;  1S9F A;  1VIO A;  2DB1 A;  4K2X A;  2NZC A;  4NLV A;  5C7P A;  1TVR B;  2AJF E;  5DG8 A;  3OHA A;  2C2M B;  2JDJ A;  1X9M A;  3RB3 A;  5CXT A;  3GR0 A;  3QQC D;  3PYE A;  4RNH A;  2M70 A;  1A7G E;  4P74 A;  4TQR A;  4G1Q A;  4ZPT R;  1KVJ A;  3MZI A;  2MLZ A;  5HP1 A;  2ZE2 A;  2W9B B;  1RHK B;  4M5I A;  4LBH A;  4NI2 A;  3BH6 B;  2XNR A;  3CPW R;  4UT4 A;  1S6P A;  2VON A;  2K1R A;  1S1V B;  1RAG B;  3VVU A;  4KB7 A;  2EBE A;  4QU6 A;  3QGH A;  1NHU A;  3D6F B;  3N9U C;  3GON A;  2DR6 A;  1KR4 A;  2CNL B;  1QUP A;  5D77 A;  4B02 A;  4PQA A;  2W9A A;  2ZH1 A;  1FDA A;  1AUD A;  1U6Z A;  3K0J A;  2G2O A;  1T05 B;  3NLC A;  3EVM A;  4QWA A;  2R8K A;  4J9R A;  1LQ9 A;  5C42 A;  2QRR A;  1WC5 A;  4WII A;  2DH7 A;  3MEE A;  2WB1 D;  2HHP A;  1BY9 A;  5A8R B;  2R7V A;  4UOG A;  2Y0B B;  4DR7 J;  3C19 A;  4K59 A;  4O4G A;  1WTF A;  4R5P B;  3AD8 C;  3G6X A;  4HDG A;  1DLO A;  2ASL A;  2ADB A;  4YDX A;  1FXD A;  3J80 Y;  1MWY A;  4V1A k;  2N3O A;  2D41 A;  4N5S A;  4DSK A;  2VFU A;  2B8P A;  2W2Q P;  4ATN A;  3RBX A;  2LEB A;  3QT6 A;  2BQU A;  3R5G A;  5KG3 A;  4KR0 B;  3IS9 B;  3UDE A;  1TL7 B;  3DOM A;  4IFY A;  2YPY A;  2EFN A;  3LWL A;  3G86 A;  2V2K A;  1O51 A;  1RT5 B;  1SJ4 P;  2W8K A;  4P73 A;  5I3U B;  4FYW B;  4NLP A;  1UTA A;  1U2R A;  4R25 A;  4JI6 J;  1NBE B;  3R7B B;  3HHL A;  2DNN A;  3LPE A;  5FII A;  2NSC A;  3TEG A;  2F63 A;  4B17 A;  2GVZ A;  2B9W A;  4QYR A;  1DTT B;  2KJV A;  2O67 A;  1VC6 A;  2AQ4 A;  3C14 B;  2BAC A;  1XNR F;  2ZKU A;  3GIR A;  1CJT A;  2MJN A;  2MZS A;  5J1N A;  5GAE I;  3JAM U;  1VLO A;  1U6B A;  1LEO A;  2VJU A;  3KK3 B;  4ILL A;  2W4D A;  3GV7 B;  4AL5 A;  3Q8R B;  4K4Z A;  3DXS X;  1HNX J;  2HVH A;  2WON A;  4NX9 A;  1TKT B;  2LU2 A;  3E01 A;  2QE5 A;  2VG5 B;  4ANC A;  2GAG C;  5F3T A;  5B0B A;  2R2T A;  2HQC A;  5KFF A;  4DL0 C;  2Z4P A;  4KGV B;  2GO9 A;  2ZDO A;  2BJ3 A;  4KKO B;  4X66 F;  2EG2 A;  4CO0 A;  2OPR B;  2F8M A;  4W90 B;  2PT0 A;  1N5V A;  3MAA B;  4OX6 A;  1DAX A;  4ZP7 A;  1WSV A;  4C8M A;  2XEX A;  4B3S F;  4DR1 F;  1S0V A;  1BC6 A;  3P5B P;  1IM4 A;  1GH8 A;  2QSW A;  5J1E B;  2B7B B;  2J0W A;  1TU0 B;  4JI3 F;  1FE4 A;  2B4O A;  2CG4 A;  3CXC R;  4EO6 A;  3M9N B;  2YNF B;  3MM9 B;  1FJG F;  4EEY A;  1C1B B;  2HIY A;  4Y65 A;  4NA1 A;  2VIH A;  3BGU A;  3KOA A;  4WE1 B;  5KT3 A;  6AT1 B;  1L3S A;  3AD7 C;  1N0V C;  2WOM B;  3IBW A;  1NJX A;  1JLA A;  4LF7 J;  4UY8 5;  4WCE Q;  5AT1 B;  2VKZ G;  4ELV A;  2O3D A;  1U47 A;  1LOU A;  1TV6 B;  5MLC V;  5HJY A;  3LAK A;  1ZA2 B;  3QRQ A;  1RIS A;  1M90 T;  3O2I A;  2C2D A;  3QLH B;  2HWI A;  4DR4 J;  1SCJ B;  4HAC B;  1N88 A;  2BKP A;  3EWG A;  2F4V F;  3UN3 A;  2NUU G;  4USM A;  2QMU B;  4RZR A;  2GQ2 A;  3S8S A;  3QJP A;  5DDP C;  2R42 A;  3CED A;  1Q8I A;  4M5G A;  1RU1 A;  4OYM A;  1LW0 A;  2VG5 A;  1JLQ A;  2AEM A;  4KHP F;  2WCX A;  4IFV A;  4CNY A;  3A12 A;  2KI2 A;  2LKZ A;  5IM0 A;  1K44 A;  1Z2L A;  5G0R A;  2LXF A;  1RA7 A;  2JX2 A;  1SL2 A;  1F5B A;  3TZY A;  2HW3 A;  1EP4 B;  1WHV A;  4ED0 A;  4C3K A;  1WHY A;  2FJW A;  2FJV A;  2B4U A;  4NLS A;  2Y1I A;  2GGP A;  3P6Y C;  5KFI A;  2MB0 B;  1WDD A;  4TU8 A;  2QA4 G;  1CVJ A;  4ZPA A;  3U7J A;  2BBE A;  3HD2 A;  1AZS B;  3DOL B;  2D3Z A;  3BBB A;  3THT A;  2CQH A;  3TP2 A;  4AE5 A;  4P72 A;  1IQZ A;  5A0Y B;  2YKQ A;  2HGN A;  4JUZ A;  3AOD A;  1RT3 B;  3AJ1 A;  3OJS A;  3QNW B;  4CT9 A;  4MKY A;  4C8L A;  4OZ0 A;  2FVS A;  1LV5 A;  4ZLL A;  2W7A A;  4K2J A;  4ZVP B;  3GWC A;  1MNE A;  3HVA A;  3KHR A;  4Q2L A;  1K47 A;  3W2W A;  1KLM A;  1PKU A;  1B7F A;  3GFY A;  2Z2Y B;  3CDW A;  1S1W B;  1FRH A;  3NP5 A;  2KJW A;  2AYB A;  2V2Z A;  2WBR A;  1ZAW A;  3CTR A;  4V19 J;  2WB4 A;  2Q3P A;  3FRY A;  2VDI A;  3HPO A;  1NKB A;  2MY8 A;  4EUV A;  3QWU A;  2BMB A;  3M2R B;  1S99 A;  1WDT A;  3DRP B;  1B3T A;  1I5O B;  1AYE A;  4CYU B;  1QSS A;  1UFW A;  1JKH B;  2ZOG A;  4LF8 F;  1D0E A;  2OKQ A;  1I94 F;  3NEK A;  5LXY A;  3N6M A;  1KDN A;  3H4B A;  3D1H A;  4KGM A;  4KH0 B;  2CVE A;  3PHE A;  2KKH A;  1TL1 A;  3I9V 9;  3ZTR A;  3K2Y A;  2FLO A;  1IBC B;  3KLE A;  4CQ1 A;  4OI1 A;  4KJI A;  2IBK A;  1MRO A;  5J2P A;  1HBU A;  4I68 A;  5D0E A;  4O3N A;  3LA0 A;  4DV1 F;  5KFY A;  3CMA S;  3L3C A;  3QIP B;  3ZZT A;  2FIU A;  2FTR A;  3G6Y A;  2VFR A;  3MM6 A;  3FBB A;  1WHW A;  1IM6 A;  3RB0 A;  4X84 A;  1HNV B;  2HZA A;  2HKE A;  3HKW A;  2CIM A;  3CD6 S;  1HW8 A;  3CDB A;  3NGS A;  2KM8 B;  1X5P A;  2DHX A;  4YP3 A;  1NUE A;  3EX7 B;  4DL4 A;  1HQE A;  3KK1 B;  3NL0 A;  3H98 A;  3IG1 A;  2BJ8 A;  4MYT A;  5GAH I;  2AD9 A;  1UZH A;  3H5U A;  1TMJ A;  1JQG A;  5IS2 A;  3UQS A;  3GG0 A;  3LP1 B;  3ZZ0 A;  2JFK A;  5DGB A;  1CJK A;  3BO4 A;  4XO0 A;  2XMK A;  2L9D A;  2FHJ D;  2ASJ A;  4B9T A;  1V6H A;  2ZD1 B;  2FZG B;  1RGV A;  3Q8U A;  2QJ3 A;  1T9W A;  2PEB A;  1PJ6 A;  3MEG A;  2MGZ B;  3OTO F;  3V2U C;  2C3M A;  4DFM A;  1KFD A;  3OT9 A;  3PAC A;  3M2R A;  1VR6 A;  4U8V A;  2XMT A;  4JV2 A;  3OBI A;  4Q0B B;  5CCM A;  5KFX A;  2V5H G;  4F0K A;  4DV6 F;  1R89 A;  3M32 A;  3CIM A;  2MZQ A;  2JEF A;  4CLL A;  4IO1 A;  1G7C B;  4CH0 S;  2ZJR Q;  3HZG A;  3GYX B;  2WAQ D;  3MAQ A;  1XNR J;  4ZJL A;  3Q24 A;  4FF1 A;  2YX1 A;  2KL8 A;  4RBU A;  5IWA J;  4J9Q A;  3BZQ A;  1HD0 A;  2FYX A;  2QA1 A;  3AT1 B;  5ETO A;  2FB0 A;  3BGO P;  2LYV A;  3FVY A;  3E2E A;  1U02 A;  3H42 A;  2QGF B;  4LF1 A;  3U27 A;  4F67 A;  2HVI A;  3GTY X;  2C42 A;  3F0N A;  3QSI A;  3QO9 B;  1FT8 A;  3GB0 A;  2XM3 A;  3EGZ A;  4GO7 X;  3RW7 A;  1SUQ B;  2ZHA A;  4ED4 A;  3KK2 B;  2MZR A;  1D3W A;  1YGY A;  4ZIT A;  3EGW B;  1QJH A;  4X66 J;  1PG5 B;  1HI8 A;  4OV6 A;  4CTA A;  3TUZ C;  1S79 A;  4U9R A;  1SQG A;  2Z2Z A;  5D3G A;  4LBI A;  4B3S J;  4DR1 J;  1UL3 A;  2J0X A;  3DGP B;  4ECS A;  2LA6 A;  4AT1 B;  7FD1 A;  1VQ4 S;  4OLO A;  4JI3 J;  1NH8 A;  4H4O A;  4X4P A;  1GXL A;  1FJG J;  3V6D A;  5CYJ A;  3SV3 A;  2JVR A;  2D3O R;  1I3O B;  1H98 A;  4YB1 P;  4DR6 F;  1JLG B;  4CZC A;  1S77 D;  1NSA A;  1WOR A;  4CM0 A;  1RTZ A;  2VFT A;  3P4U B;  4FN5 A;  1XJW B;  1XTZ A;  4GKJ F;  2X1F A;  4O0I A;  3FBF A;  1U6F A;  4C48 A;  2DPJ A;  4KV8 A;  3D2W A;  3I56 S;  2XWX A;  1FJC A;  5B0C A;  4CDI A;  4OX9 F;  2BXJ A;  2QO3 A;  1RWX B;  3WX8 A;  2XS5 A;  1VQS A;  4PAA A;  2E9T A;  4L75 A;  4NLD A;  2F4V J;  1PYS B;  2DGT A;  1VHI A;  3TZW A;  2XLK A;  4DLG A;  2VV5 A;  2P6S A;  2ABY A;  4KHP J;  2DGO A;  1RBL A;  1TK5 A;  1SUQ A;  1MN7 A;  4FXW A;  2G4B A;  1FKO B;  4LVO P;  5KFS A;  2GC8 A;  1VRQ C;  2GHV C;  1WEY A;  2KH9 A;  4YN3 B;  2BUN A;  3LP2 B;  2EPI A;  2DK2 A;  1U0H A;  2NS1 B;  5FD1 A;  3FGV A;  4KC5 A;  2IFX A;  1VLY A;  3EPI A;  2RDD A;  3W9I A;  2HHQ A;  2E9Z A;  4HT5 A;  9ATC B;  3IO1 A;  1GXT A;  1NO8 A;  1TQL A;  2RDJ A;  3HHE A;  1YJW S;  5DDQ C;  1YJN S;  3Q8V A;  4KHR A;  3IMQ J;  4DSF A;  2ZBI A;  3F44 A;  1EQ0 A;  1RHQ B;  3P49 B;  3DLL Q;  4QIE A;  1BQM A;  3ADA C;  2CYY A;  3FCW A;  2LQB A;  3L95 X;  3OHB A;  2BQR A;  1JLE B;  2RVJ A;  4DL5 A;  2QL9 B;  4Z7Y A;  3M8P A;  3VGS A;  3PHT A;  1NHV A;  3TQE A;  1CBK A;  4QIF A;  5CYM A;  2YXL A;  4R0E A;  2BDP A;  3KUG A;  1KOH A;  4O23 A;  1SXL A;  3KLF A;  2V8D A;  2ZH9 A;  4XK8 C;  3UPF A;  2XNQ A;  2GS8 A;  1VJW A;  3GCW P;  4F2R A;  2G0J A;  4URG A;  3OR2 B;  4LF8 J;  1S5Z A;  1I94 J;  2KDO A;  2GHP A;  4KSE B;  1RUS A;  3OL6 A;  4X4T A;  2X7I A;  4DQS A;  2I0X A;  2JWN A;  4DZ6 A;  3IFE A;  1NK8 A;  3U1M A;  2MKI A;  1N6Q A;  4IRD A;  4DV1 J;  2KFZ A;  5DGA A;  4ZPW R;  3K8W A;  2HQ3 A;  4AQY F;  1YRX A;  3CB4 A;  1DTQ A;  3R5B A;  4F3M A;  4PWD B;  2WW4 A;  1HI1 A;  2PA3 A;  1F9F A;  3KKF A;  1FJE B;  1SKU B;  3AQO A;  2COL A;  4DQI A;  2J0S D;  3KLI B;  2Y3Y A;  5A8K B;  4C0O C;  3ZXW A;  1RSC A;  1FX2 A;  4R8U B;  4ZIW A;  2H5J B;  1VI7 A;  1HD1 A;  2M8D B;  2V4J B;  2R8H A;  4UZB A;  2YKN A;  3M9M B;  4WFB Q;  3AQP A;  5CD4 A;  4JYA F;  2EG1 A;  4DV2 F;  3M2V A;  1IN0 A;  3A3P B;  3J7Z 5;  2QFJ A;  4UTG A;  2IMO A;  3AOB A;  3SCJ E;  2PI4 A;  3OTO J;  2ZBP A;  2LA4 A;  4F3Q A;  1HWL A;  2ZJP Q;  2N7C A;  4IRC A;  3W61 A;  4Y3C A;  1FJ7 A;  2DT9 A;  3K8V A;  1IUJ A;  2CQ2 A;  3QRR A;  2GIQ A;  2ZH3 A;  5KT7 A;  3TAM B;  3Q2S C;  2CPJ A;  4DV6 J;  1MW7 A;  1U8S A;  1SV5 B;  4F0M A;  4ENO A;  4R0J A;  1HHS A;  1G3O A;  1PIL A;  2W25 A;  1BQN A;  4C3M A;  2E5J A;  1U1L A;  1SKW A;  3BR9 A;  2KG1 A;  3ZTQ A;  1S4E A;  3R6G B;  4GC6 A;  3ILL A;  2BYC A;  2RSQ A;  1Q53 A;  4CNZ A;  3F73 A;  1RAI B;  3K89 A;  3CCT A;  4OHX A;  5CYQ B;  1UWB A;  2HLU A;  2YNI B;  2HHU A;  4J9U E;  5IOL A;  3NCP A;  3SCK E;  3OSP A;  4C6A A;  3PR5 B;  3T6B A;  3MFH A;  4NXM F;  3TAP A;  4C11 B;  2J5A A;  1PYT A;  3J81 j;  3LAM A;  2H5I B;  4I2Q B;  3W66 A;  1NZA A;  1NND A;  3T9N A;  5GAD U;  2A6M A;  4AYB D;  3EIC A;  3TAN A;  2VBX A;  1VK3 A;  2H9Z A;  4Q2M A;  4IR1 A;  4PG4 A;  3VAG A;  3BS9 A;  3ILJ A;  2R7W A;  5J1P A;  4ECT A;  3C6T B;  1UEU A;  4P10 A;  4QW9 A;  3MOJ B;  3QGI A;  3RAM A;  3CJ3 A;  3Q2T C;  3MPU B;  3BBC A;  1ZPW X;  1QTN B;  2B6A B;  5K8N A;  3CCJ S;  3C2P A;  4ILR A;  3DRR B;  3ICL A;  4ZIV A;  4DSE A;  4ALZ A;  1XMO F;  1Z4U A;  2OTL S;  1R6Y A;  3CSK A;  3DLK B;  5JJB A;  5HL7 Q;  5KT6 A;  2VD3 A;  4TLR A;  2OD6 A;  3HF5 A;  3UCG A;  5I42 B;  4CM2 A;  4DR6 J;  1AW0 A;  4EFA C;  2K2P A;  4IH7 A;  1E6Y B;  3GYN A;  1QM9 A;  3M2U A;  4Q5V A;  2W24 A;  2CJB A;  4K7Q A;  4LJM A;  4GKJ J;  3W7B A;  3D54 A;  3W9J A;  2L41 A;  3U1N A;  2BM0 A;  3CCE S;  2CPZ A;  2ZDP A;  2VPX B;  1DZ5 A;  4OZL A;  4LSL B;  2I9S A;  3KJN B;  4OX9 J;  2B8Q A;  1OSD A;  4MFB B;  1HBO B;  4K4S A;  1C1C A;  2CPE A;  2AYE A;  4KIA A;  3CJ5 A;  4AND A;  2ATL A;  1FCA A;  3Q8Y A;  3Q0A A;  1S9G A;  2EK6 A;  2HFO A;  1VRU B;  3LP0 B;  1WOS A;  2DH9 A;  4JV5 F;  3MM5 B;  3CJK B;  2RQ4 A;  5DQI A;  3TAQ A;  1P9Q C;  3JYT A;  2HVZ A;  4QIV A;  3OL8 A;  3R9L A;  2RRB A;  4K4T A;  3NRB A;  2KTQ A;  1S4F A;  2F9J A;  4O3R A;  3GFH A;  2R7T A;  1LWC A;  1W25 A;  5ETQ A;  3RG6 A; 
#chains in the Genus database with same CATH homology
 4DUT A;  1MN7 A;  1NDK A;  2DYA A;  3G2X A;  1LWX A;  3ZTS A;  1WKJ A;  3FCV A;  2CWK A;  1NLK L;  1PKU A;  1BUX A;  3DKD A;  3FBC A;  3NGS A;  3JS9 A;  5IOL A;  1WKL A;  1S59 A;  2HVD A;  4CP5 A;  4DI6 A;  3EVM A;  3Q89 A;  3NGT A;  1B99 A;  3EM1 A;  4C6A A;  2HUR A;  3EVW A;  3ENA A;  2HVE A;  3MPD A;  3L7U A;  1NUE A;  4UOF A;  1K44 A;  1UCN A;  3EJM A;  1S5Z A;  3B54 A;  3Q83 A;  3GP9 A;  4W98 A;  3EE3 A;  3B6B A;  2ZUA A;  1VYA A;  3PRV A;  2B8Q A;  4S0M A;  1NDC A;  1XIQ A;  5C7P A;  4UOG A;  1NSK L;  3DDI A;  1WKK A;  1BHN A;  1F3F A;  3VGU A;  3EIC A;  4WBF A;  1LEO A;  2BX6 A;  3FBF A;  4FKY A;  3VGV A;  3EVO A;  1HIY A;  3VGT A;  4DZ6 A;  3ZTP A;  4F4A A;  1XQI A;  1NDL A;  3FBE A;  2DY9 A;  5CAA A;  1U8W A;  3NGR A;  1NB2 A;  1HHQ A;  1KDN A;  4AND A;  4FKX A;  1JXV A;  1PAE X;  3Q8Y A;  3ELH A;  3Q8V A;  3BBF A;  2AZ3 A;  2DXF A;  1EHW A;  3WX8 A;  4EK2 A;  2B8P A;  2DXD A;  4KPC A;  1NSP A;  2NCK L;  3Q8U A;  1HLW A;  4F36 A;  3PJ9 A;  3BBB A;  3BBC A;  3NGU A;  2VU5 A;  3ZTR A;  1NSQ A;  1NCL A;  3BH6 B;  1MN9 A;  1S57 A;  5BXI A;  4ANC A;  1NPK A;  3Q86 A;  1NHK L;  3ETM A;  4ENO A;  2AZ1 A;  3VVU A;  3BH7 B;  4ANE A;  1W7W A;  2BEF A;  3ZTO A;  3FCW A;  3R9L A;  1NDP A;  3ZTQ A;  1F6T A;  3FKB A;  3VGS A;  1ZS6 A;  5CAB A;  3VVT A;  1BE4 A;  2DXE A;  1B4S A;  3EMT A;  4HR2 A;  4O0N A;  4UOH A;  3FBB A;  3FC9 A;  3GPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...