3FC9A

Crystal structure of the mimivirus ndk +kpn-n62l double mutant complexed with cdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fc9A00
3EICA 4S0MA 1HLWA 4ANCA 3ZTSA 3NGRA 3ZTQA 1JXVA 3FKBA 1NCLA 3VVTA 3L7UA 4KPCA 2AZ1A 2VU5A 4O0NA 2B8QA 2DXEA 1HHQA 2NCKL 3ZTOA 1NSQA 4C6AA 3MPDA 1NDPA 4WBFA 3ZTRA 1BHNA 1NHKL 1ZS6A 2AZ3A 3BBCA 1XIQA 3FBCA 5BXIA 1WKKA 3EVOA 3VGSA 1BE4A 2DYAA 1W7WA 2HVEA 3PJ9A 3BH6B 1B4SA 3WX8A 3BBBA 3FCWA 4DI6A 4W98A 1NSKL 1NDLA 1UCNA 4ENOA 5CABA 1NPKA 4FKXA 4EK2A 1NDKA 1U8WA 4UOFA 3JS9A 3FBFA 1NDCA 2CWKA 3NGSA 3VVUA 1KDNA 4F4AA 3EE3A 1PKUA 3VGTA 1LEOA 3GP9A 3ETMA 3Q8YA 4CP5A 1MN9A 3EVMA 4UOGA 3VGVA 2BX6A 3EMTA 3ENAA 3EJMA 1PAEX 1K44A 4HR2A 2HURA 3VGUA 4F36A 2DY9A 4DUTA 1BUXA 3FC9A 1HIYA 1LWXA 1WKLA 3BH7B 1EHWA 4ANEA 5IOLA 1XQIA 3FBEA 3NGUA 1S59A 3B6BA 3PRVA 1MN7A 1S5ZA 5C7PA 3FBBA 2BEFA 4UOHA 1F6TA 1NUEA 3Q8UA 3ELHA 4FKYA 3GPAA 4ANDA 3ZTPA 3DDIA 1S57A 3Q8VA 2DXDA 2HVDA 4DZ6A 5CAAA 1NSPA 1B99A 3G2XA 3B54A 3DKDA 2DXFA 1NB2A 3BBFA 3Q89A 3NGTA 1WKJA 3EVWA 3Q86A 3R9LA 3FCVA 1F3FA 1VYAA 1NLKL 3EM1A 3Q83A 2B8PA 2ZUAA
chains in the Genus database with same CATH superfamily
1AXQA 3IG1A 6FD1A 1ZPVA 4RNNA 1WOOA 4DSJA 3MEGA 3R5BA 4NE9C 1KHWA 2W4CA 1KLNA 1ZAWA 3FDSA 1FDAA 4B9LA 2DISA 1FXLA 4X66F 3WX8A 4JI6J 2VPXB 2CPIA 2JEJA 1EAYC 5JXSA 1AFJA 1PILA 2CQHA 2LA4A 3IS9B 2QLFB 4WK1A 4RW7B 3KFWX 2BOAA 4GRSA 1XMQJ 4F36A 3EXCX 1QE1A 1XEZA 4O3OA 2RJZA 4OZ3A 4K2JA 2UV8G 2LQ9A 2ZBRA 2UUCJ 3OUYA 1TL1A 2AX0A 3IC1A 1IM4A 2WVDA 2CQDA 3DOKB 9ATCB 3ILIA 4DL2A 4UTGA 3PYEA 2UXDF 4K4TA 2ZDOA 2AX1A 1YRUA 2V94A 3OJSA 4HT7A 2PDAA 1QAIA 1ZTWA 5F41A 2HHQA 2A10A 2BV3A 1L3KA 2JVRA 1V6HA 4WU2A 4BBYA 1DZ5A 4CTAB 3KHGA 3G8SA 3I9V9 1F5BA 1YX2A 2WW8A 4RWXA 2N7YA 1X0PA 1B64A 4EYIB 3MPDA 1NDPA 2XMTA 3J7YI 3BBCA 2N82B 5IZHA 3BGUA 2MZRA 5GMDA 4OV1A 3QQCD 3SFUA 4DF4A 1NDLA 2BQ3A 1DHMA 3CULA 4CH1A 4C98A 5B0CA 1T94A 5G0RA 2YWEA 3FVYA 4NZ0A 2HFOA 4JYAJ 3KG1A 3I82A 1PYSB 3MECB 2DRBA 4H4MA 3DM2B 4NZ6A 5EHHA 3RU0A 1LOUA 3NXZA 1KS2A 1R6YA 1GXLA 2BBEA 2EI5A 1OJ4A 2K1RA 4WYWA 2MMYA 3D1QA 3MD1A 4A46A 4RW6A 4XDDA 5KFFA 1X5SA 2L3MA 1LXNA 5AE2A 3SSSA 5B0EA 4M5LA 4AL7A 2DNHA 1R3NA 1H2VZ 3MDFA 5L1KA 3THPA 2HQ3A 5EX0A 3V4MA 1ZA2B 1EQ0A 1VRUB 1FFSB 1VRTB 3TUPA 2Y1LB 3KG0A 1VLYA 2V8DA 1RI7A 5J2MB 2V2QA 1NK9A 4NLOA 4LRBA 2KL8A 1VQ5S 2O67A 3FSIA 2BACA 3CUNA 1HKAA 2ADCA 1FEHA 1AT1B 4NLDA 3TVYA 2W9CA 3QWPA 2BJDA 2AW0A 1NK0A 1SL0A 3JSRA 3DFEA 1D8YA 3SYZA 1IKVB 1J5OB 4DUZJ 3M2VA 5KT3A 3CIZA 3D6MB 3HT0A 5HROA 1SKRA 2HQDA 3KK3A 2JC0A 2HS3A 4TY8B 4WKRA 3L7OA 4LRAA 4KGZB 2LP4A 3MPWA 5L9XA 1FWPA 3DOMA 4B02A 2M8DB 5D6GA 4QPXA 3R8YA 4M5NA 2IC3A 4PG6A 4LF8J 3HF5A 2X1AA 1YG0A 1YJWS 4RUHA 3ILOA 1O5JA 2M9KA 3VAIA 1XMOJ 1SIWB 2N4CA 2KM8C 1LWFB 1HNVA 3FKBA 1S49A 3C3LA 4USVA 2OGUA 2YQ0A 4LF5J 1FESA 3GFYA 4DV0J 4O3QA 2BW7A 2OMLA 3E01A 4AL6A 2RS8A 4IUFA 2Y9HA 2GAHC 3JQKA 5HSPA 2J6SA 2MPUA 4IO1A 4DR4J 4DQQA 2DITA 1SJ4P 3GFHA 4JP8A 2I9SA 2BKNA 2QFJA 1HD0A 2HVIA 4HKQA 1VQSA 4RW9B 2J0WA 4JI0J 1FK9A 4K4XA 1IR0A 2C42A 3MGJA 5A2QU 1U1MA 1UETA 2ACMA 1QSSA 2DNGA 5J2NB 3IWLA 3SCLE 1UTAA 3IG1B 1Y9OA 3DOLA 3I5AA 4YP3A 1SH3A 1B0VA 4P7TA 2X1FA 2DH7A 4NCGA 1XBWA 2M0GB 3MEGB 4JV5J 4PKDB 3CDWA 4ZVTB 2HRYA 1UFLA 2CQGA 1HNXJ 4ED7A 4D3GA 1UWAA 1FNXH 1BHNA 4PYAA 2CJXB 1QE1B 4NZ7A 2HS0A 1GXTA 1NPKA 4WIQA 1YTYA 5KG6A 2W4PA 4KGVB 4RWWA 3OUYB 3ILLA 4DFPA 4R0EA 1TL1B 4B3OA 3TVZA 2KT2A 6AT1B 2MTLA 3W8PA 2QLWA 4DV5J 3RAXA 3LGNA 5FLXU 3TA0A 3QZ7A 5A0YA 1CJTB 4DSFA 3IBFB 2KFYA 3L4BC 1J5EF 1UAWA 4TN2A 4QWBA 5GMKa 1FKOA 3VAKA 1T9YA 1HW9A 2IBOA 1GEHA 3FQLA 4NOHA 1IBLF 4WCEQ 3CJTA 5DS7A 1IQTA 3AFGA 3Q0AA 4KRWA 3Q8QB 2QIFA 1X7VA 5G0RB 3M6XA 4C2MA 3A13A 3NNHA 2EPIA 4DSEA 4KGKA 1F9FA 4OZ0A 4DV6F 4H4MB 3O6QA 1TK8A 1CC8A 4X64F 2I5JA 3I9ZA 3OFEA 5B0AA 2UXCJ 1O8BA 2QMXA 2DGVA 1XK8A 3UDEA 4YDXA 2DD8S 4C48A 3MOZA 3M30A 3CMAS 5DDQC 3CW2C 3T5HA 1VIXA 3ZZZA 3F44A 2YPYA 3AB4B 2LQJA 4JI5J 1OPIA 4C0HA 3EPGA 2HVDA 5C2GA 2WVFA 3TR5A 1TKTA 1UA0A 4NX9A 2KG1A 4XO0A 5CQGA 1S1TA 4LF1A 3KLGA 4WFNQ 1NAQA 2IHR1 3OTDA 2QE5A 2BJEA 3PJXA 2QT7A 5H9EJ 2NZ4A 2W9CB 1B0TA 3PZPA 2J0XA 2JEFA 3H20A 1OMSA 5EWGA 3ZTOA 3BSCA 5HN0A 5GADU 4BDPA 2QZ8A 3NP5A 4ID8A 4MKAA 1U0HB 3M2VB 4ICLA 1IWGA 3D6FB 3VVUA 5KFJA 5HROB 1FO1A 2YVSA 1CJKB 3KK3B 2PD1A 4KTQA 2YQ1A 2XMKA 2HGNA 2FLOA 3NMRA 2V2KA 3EXYA 1F60B 1HIYA 1RT4A 3DOMB 2BQUA 1B7FA 3ICLA 3KUHA 1JB0C 5CYQA 2FUG9 2XLIA 1JWWA 2V4QA 3OVSA 1I3OB 1HNVB 4LBPA 2EXUA 1RKIA 4LFCJ 2V67A 4OYOA 4Y3CA 3P45B 2GMHA 5KFYA 2DH9A 3E01B 2ZKUA 2KVQE 4ID5A 2V68A 2BYCA 2XNQA 3CIMA 3VVTA 2CVEA 3LOUA 4RX6A 2GQQA 4N5SA 2JHEA 5EDWA 3BPSP 3I56S 3CJKA 3GTYX 1SV5A 1FK9B 3RTVA 4J7CA 2EG2A 3EPIA 1RT2B 1TFWA 1KC8T 3EE3A 1HBNB 2AYEA 3C66A 1U45A 2D3O1 4ED6A 3DOLB 4O3NA 5AJ3F 4U7UD 5GVQA 3TJ9A 1UVLA 4OYZA 1S77D 2QV6A 3HVTA 1I5OB 4ED4A 4AT1B 4OJ3A 2A18A 1NM2A 4LF9F 3IRWP 2W7PA 2H5JB 2Y1JA 4LFBJ 3BS9A 4LF7J 2ZH7A 1QLNA 4Y00A 3H2LA 1S0MA 4N8OA 4B3TJ 3JXOA 1SQFA 1WF0A 4K5SA 3C6TB 4LQ3A 1JLGA 3KXDA 1LW0A 4IOCQ 2CPFA 4KHPJ 3Q2TC 3WIVA 3NGKA 4B3OB 3ISND 1AA1B 5C5JA 4USTA 4WZQA 1EB0A 2J0QD 2B43A 2AEFA 5A0YB 3NAHA 1U48A 5ETQA 2RRAA 2IVMA 2AYGA 3BQ1A 5IT9Y 2QGFB 4UY85 2YPZA 3LP2A 1FKOB 4WP3A 4JOUA 2N7CA 1FERA 5B0FA 2EG1A 1FA0A 4KGXB 1D9FA 3KUGA 4ETXA 1U6BA 1F6TA 3DI6A 1RTDB 2KFNA 1QTMA 3FRYA 1IR2A 2VBYA 2HYIB 2ZVSA 2OFHX 2V8PA 2XY5A 3DLLQ 5LMNJ 3LAMA 2I5JB 5A76A 4DUYJ 2SXLA 1ZPWX 1YJRA 2BJ9A 3BGOP 4F3OA 2AJ4A 1UMJA 4U7UK 1KNZA 4UY8T 3W1YC 5AXMA 2ZD1B 2ILZA 2B7CB 2VH7A 2YWHA 2D3UA 3M30B 1HQUA 2K3KA 3CJ4A 4RNFA 1SI9A 2C2ZB 2KT5A 4F25A 3NRBA 5F9LA 1NJZA 2AJFE 5HO4A 2VASA 5DO2A 4L6V3 3DRYA 2JRSA 2W2OP 2C28A 1TKTB 2B9YA 1NO8A 1G3OA 1S1TB 3AY0A 2A6MA 3NGUA 4N77A 2UU9J 1T9TA 4B9TA 1NNDA 2MHEA 4ZCMA 2JC1A 1UJ6A 4KT0C 2DEIA 4C8KA 1QUPA 2ZWPA 1TL7A 4WFAQ 1RGVA 2FIUA 2CZVC 5GAGI 3P5TL 2W7AA 4NLUA 1MMNA 2DEJA 4ICLB 1KQGB 2C2NA 3AHPA 3RGIA 1ROFA 3U1MA 2MKJA 1JLQA 1VQNS 1CJVA 2FLPA 1KN6A 4DV7F 2WONB 2HNDA 2GHPA 1RTIA 1RT4B 1IR1A 3BQ2A 5EWEA 3CCLS 3NWRA 1JLFA 1C0TB 1RHUB 5CYQB 2GA7A 1SJRA 5D0GA 3QJPA 1MN9A 1N34J 3PIPQ 5CYMA 1LWEB 3QZ8A 1RYSA 3HMJG 2N3LA 1RTHA 4M1KA 4CO4A 1SL2A 2FVCA 2HBRB 3DMJA 2VBWA 4B17A 2GGPA 2CQIA 4JI4J 4ID5B 2EVZA 1HD1A 4LF6J 3Q8VA 4A47A 4KH0B 1XNRF 4CT9A 3D28A 5FDLB 3R6LB 3C2PA 2FHOB 2OMOA 3A8KA 3CJKB 4P71A 2KO1A 3ZZUA 5B08A 3PW2A 3TJ8A 1SV5B 3DLGB 3FZBA 5HQ8A 1T11A 1F5AA 1GMWD 2GIRA 2RQ4A 4LRDA 5LXYA 5DQIA 2R7UA 2UUBF 3MCMA 5D4OA 3M9MB 2PMHA 2P9GA 1V3ZA 5FIIA 5GADI 2DH8A 1HBUA 4TU7A 4P2MA 4AXIA 3HVTB 3CMES 3OHBA 4NASA 4TYAA 4X4QA 8ATCB 4YY3J 2BE7D 3MEKA 3Q8YA 5I4MA 4Q43A 1GMWA 2AWZA 1LXJA 2BX6A 2XWYA 1WTFA 1RHKB 4WTOB 1FKAF 2IRYA 4JB8B 3C19A 2ALYB 1M5OC 1JX4A 3PKYA 3GZ7A 3V6DB 3A3PB 5JMNA 4RUAA 3B54A 4Y6IA 2AF6A 1YSJA 5BYSA 2K7KA 2CIMA 3DRRA 1Q7YT 1VQLS 4OX8A 4DOZA 2JX2A 3UD4P 2K3IA 1IKWA 1A0OB 2V8VA 4IRDA 2NXUA 2DR8A 1KWMA 2DY1A 4F0HA 1RBLA 2FGCA 2HS4A 1N33J 1TKZA 1S6UA 4C6AA 3M6VA 3KLVA 3D1HA 1FRIA 3BZQA 2ZH6A 2XLJA 3LP2B 5GAEU 4UQTA 4EUVA 1HNZF 2AGPA 4DR1F 2NSBA 1R0BG 2R4FA 3MMJA 4EI2A 3NL0A 3DI6B 1SC1B 4NEZA 1JJCB 2QLBB 2H4WB 2HFVA 3EGZA 3FC9A 4P2XA 3IWNC 1T3OA 3HSZA 1FNMA 3PFEA 3PIOQ 5ITHA 2MY8A 3C46A 3M7VA 4DZ6A 2VPZB 5CYJA 4X62J 4QBUA 3IO1A 4PAAA 1YBUA 2J9DE 4K5RA 1NHUA 1HQUB 4Y0FA 2V0NA 2D9OA 1FRXA 1R8BA 1JMTA 1A6LA 3R7BB 3B4MA 1N32J 3TAMA 2FPHX 2UUAJ 4ZP7A 1OSCA 2AEJA 2IRXA 2CQ3A 4DV2J 3VAFA 1L3UA 2CQ0A 1RJJA 4NLGA 1BWEA 3UQSA 2FLLA 2QLXA 5IFMA 1D9AA 3IRXA 2FVSA 3MHYA 3T3FA 3CJ3A 4K8RA 4QPTA 3ET6B 4UOFA 3R5GA 3VF0B 2G0JA 2VG7A 4YB1P 4KY3A 2Q6CA 1VQ9S 3R5JB 3BKTA 1GAOA 1T05A 4DPTA 3IGVA 3BPDA 1SQEA 5M2RA 1ZM2A 2LA6A 1TL7B 4ED2A 1DTTA 4YHHF 3UCZP 2CKWA 5HP1A 4ZKAA 4USWA 1N5QA 3TARA 3R5DA 1WI8A 4RNOA 4LR7A 1BXNA 3MPVA 4M5HA 5IS2A 2XCPA 3KHHA 3SCJE 4F2SA 5LMUF 1OO0B 3Q89A 1GFWB 1JLQB 1IBMF 3BR8A 3NCQA 2IA6A 3N6NA 3BYRA 3A4TA 1NLKL 1YRXA 3IM9A 2W9BA 1MU2A 5A8RA 2HNDB 1RTIB 1S76D 1PBUA 2F63A 1F2HA 1N56A 3P8BB 3T5LA 5CYMB 1N6QA 1RTHB 3J7Z5 4MH8A 2PFDA 2VICA 3MOJB 3A12A 2GGPB 1LFPA 1UJ4A 1RE1B 3W5XA 2BJ1A 1FEEA 2XM3A 3CO0P 3OTOF 2CYYA 1KHVA 1S1XB 2HEKA 1NKBA 1M5SA 4DFMA 3PRBA 2KT3A 5AT1B 4EBDA 1RQ0A 5DM6Q 3HFKA 1Q7LB 4PXEA 1U24A 3OPKA 5ETPA 2ZITA 4PG5A 4FYVB 3D67A 1KSPA 7FD1A 2OO4A 2MKCA 3CEDA 2VIHA 2P6SA 2JSXA 2YX4A 4QIEA 3UW1A 5BJRA 3J7ZT 2M4MA 2YX1A 4ZPVR 2VODA 4YB7A 1SPBP 2XYHB 1HBUB 4NXMF 2HHVA 3IA0A 4DL5A 4YR3A 5SUHA 1RHRB 4B3MF 3PM9A 1NH8A 2K7JA 2OTLS 3OL8A 1K8AT 2ZJRQ 2GVDA 2KN4A 1H73A 1RAHB 3DLHA 2WSCC 3M2UA 1KKHA 5J1EA 2POKA 2RT3A 3RR7A 4ZP8A 3BBBA 4L76A 4ZVEA 2BA9A 3HHDA 1RT5B 1KTQA 4CO3A 4R25A 3M6UA 4OJ1A 4FF1A 3BQ0A 4ZVUB 1G4CA 5DQGA 2B4UA 4RLEA 4ECZA 4Z37A 4FVCA 3VWSA 2P9EA 2ZHBA 1IBKJ 3E51A 5K9FA 3F56A 1QVFR 1RP5A 4DR2J 4AUKA 3MMBA 1RSCA 3DRRB 3MURP 2E66A 1F9HA 3VR1A 5LXRA 1A7GE 1IKWB 4JI6F 1Y5LB 2I8EA 3DNCA 4LBHA 1S57A 1KLMA 2YY3A 2XMMA 4ECWA 3TZYA 3D1OA 1ZM3A 1TKZB 2V6AA 4QR1A 1Y10A 1XMQF 2JFDA 1SQGA 4WFYA 2HLUA 3FQKA 1TUVA 3PW4A 2E5GA 3TAQA 3GV5B 2UUCF 2J8AA 2B7BB 4NL5A 1WF1A 3FBCA 3CB4A 4IRCA 1TMMA 5C42B 4QW8A 1WC0A 3BO2A 3GYGA 5IT9U 2R7SA 3IAM9 1QUVA 1S72S 4ZN1A 1KDNA 4J9SA 1RLDA 4CLZA 1V5IB 2YWKA 4QQBA 3EVMA 4DMZA 3MR3A 3UDCA 3QYYA 3T1AA 3IN5A 3OSNA 1TK0A 1RYRA 3OW2R 3C15A 2F3JA 1YJTA 1VQ6S 1PAUB 3ONQA 1QJHA 3JSYA 2QJ3A 3TAMB 4QWCA 5EGYA 2EKYA 2DCLA 5KFKA 1VQ8S 1WC6A 3NGDA 2XMWA 1YIJS 4JYAF 4FNIA 2Z56B 1EARA 1PO6A 4KKOA 2CQ4A 2W2PP 1R7IA 1SJFA 3MCSA 2ZH4A 1S4EA 1S99A 1SJ3P 2FB0A 3LP1A 1LK7A 2VG7B 1P1TA 2VBXA 2BXJA 4PR6A 2V8HA 5E7OB 5D3GA 1T05B 4OZ5A 3KG4A 5GMEA 1Y00A 2DCUB 1SKUB 2RD5C 5GAEI 2QMWA 4C8OA 3JS9A 4X65F 1DTTB 2FJDB 5I42A 1U1OA 3NS6A 4GKKJ 2PMWA 5HP1B 1R8AA 2LU1A 4CNZA 4JI2J 1C0UA 4ER8A 2F8EX 2M70A 3BM7A 1WDTA 3T41A 3QO9B 2IY5B 2ZBPA 1BGXT 2NPIA 2CDRB 4NXNJ 4FXDA 2W9BB 4F67A 3QPIA 4LIWA 5A8WA 4MIAA 2VL1A 4BS2A 1DARA 3PR4A 2C2KB 3OR1A 1XNQJ 1N6QB 4FS1A 4DUZF 2J7UA 1XR5A 3UVJA 3C16A 4KO0A 5KG3A 3RAQA 1HQEA 4DU8A 3T9ZA 3LGHA 5DLFA 2ACYA 3W2WB 2M2BA 1XR6A 4A8MP 2XO6A 2OPQA 2V4JA 3V81A 2AP6A 2OD4A 4A8QA 4FKXA 4LF8F 5ETLA 4X4UA 4FF4A 2Q79A 3NG8A 3Q24A 2WB1D 2VD3A 1XMOF 2YXLA 4OHZA 3UDVA 2D41A 3EJMA 3VAMA 4LF5F 3VALA 2ZOMA 4DV0F 1OQ3A 1Q79A 2PFFB 4Z7YA 3MCNA 1N48A 2F1FA 1YWXA 4I6AA 1UFKA 1W2BR 5E3PA 4NA3A 4PXCA 2IJNA 4DR4F 2M7SA 2OIHA 1NSPA 3MEEA 4OI3A 3KUEA 2DNMA 2FD2A 5IQQA 1LK5A 1WSVA 4C8ZA 2IDLA 4ILMA 2DNZA 1N5TA 2ZZMA 3M2UB 3VZHA 4JI0F 5J1EB 4RW4A 2MQQA 4QWEA 4OX6A 1JXVA 2OSRA 2VU5A 4TY9A 2RU9A 4RNHA 4HI2A 2MKKA 4NI2B 4CM0A 4TLRA 3I55S 3DLJA 2J6TA 3MUVP 1H7WA 5KFGA 1AROP 1NK5A 2CNOB 3DGVA 4JV5F 2VJUA 3MMBB 1S10A 2ZH2A 1VQOS 3K0JA 1QVGR 2BOPA 1NSAA 3EMTA 3TX0A 1HI0P 1HNXF 1KLMB 1K44A 4WPAA 2FC9A 1VISA 2D7SA 3A3OB 2RKIA 5CD4H 1WOPA 3RR8A 4W92B 3HHLD 1FF2A 2V9KA 4PWWA 1UFWA 1KQFB 3EZ5A 3PFOA 3AXKA 4QJVA 3G96A 3OXLA 4U96A 4C0BA 3JQMA 3ULHA 2E5LJ 4KJIA 3G2XA 4NLWA 5H9FJ 2DNRA 4F50A 3RBXA 3VHQA 4ATNA 4NRTA 2J6UA 4P2FA 1SJQA 3HHLA 1TMJA 2OKQA 4DV5F 5G4DA 5IWAJ 4ED0A 1RAJA 3MCOA 4USUA 4IDKA 1OPZA 2Y0SD 2DO4A 2EFPA 4Y34A 2CQ1A 2UVRA 4L72B 5LOQA 2EW9A 4PXDA 2C22A 1NRKA 4KYZA 1Q16B 5CABA 4PRFA 3AQPA 1CVJA 2G9OA 3ZNJ1 2DNNA 3PX4A 2P8IA 1L3VA 4I7FA 1T9XA 3RBDA 3DLBA 4UZCA 4DV3J 2IM2A 4QR0A 4DUTA 1FD8A 4AXJA 4GKJJ 2EFQA 2XWXA 2BRKA 5B0GA 1V3SA 2H65B 4ETZA 1U26A 1HMVA 4LR8A 2ZFHA 2HKEA 2UXCF 2MSSA 4N76A 2Z58B 5E0OA 1MWZA 4O23A 1UPMB 3LP1B 2CJYB 1EKRA 4ZCKA 2XI2A 1EZZB 2PE8A 1RISA 2J7KA 3M2RA 3TW0A 1X5PA 3ZO7A 4OZJA 1RTJA 3Q8PB 4ECVA 1KR4A 4PCQA 2IVYA 3HZEA 3GQCA 4E8UA 5I42B 2ZHAA 3ZFVA 1XWLA 4JI5F 1Q8KA 5HBMA 1S6PA 3GIMA 3HKZD 1C0UB 5LSLA 3GJSB 5E5NA 1LWCB 2ZH1A 2ZUGA 5C25B 2X7IA 1IQZA 5A8WB 4DL3A 3M8RA 1SH0A 4ZIWA 1IXKA 4UUWA 2MSTA 1HBOB 3OR1B 1KTVA 1T3NA 2BR0A 1U25A 3DRXA 2ZH9A 4ZVHA 1VMBA 3NOGA 3UVJB 2HBQB 3IM8A 4KO0B 1PJ6A 5IM0B 2HLTA 2YH1A 4ZLJA 3EGNA 2XGQA 4DPYA 5KFHA 2B9XA 4DN0A 4DCPB 4H4OB 1T95A 3H5SA 2HWHA 3TEGA 1U6FA 1FVQA 2BRLA 2V4JB 5HMXA 1RWVB 3V81B 1X4DA 3NGRA 5L8RC 4RU9A 5DJBA 1UZHA 1KOOA 4O0NA 4NWBA 1X31C 4I6WA 5DDOC 3PXGa 4HACA 1WHYA 4LFCF 3D6HB 3GG0A 4A8OA 3FCWA 5AE1A 1S9FA 2NUHA 1U1NA 1S97A 2HK3A 2I2YA 3WDOA 3PYGA 2EFNA 2G0CA 1TR0A 2NSCA 2PO4A 1T9VA 1TV6A 4J37A 3ENAA 3MEEB 3BKFA 1VC5A 3I87A 1S6QA 1R8CA 3KLFA 4RR5A 3KLHA 2AT1B 3CJ2A 3IR6B 2JLGA 3K58A 5HMWA 3JYTA 1VQKS 2CPJA 7AT1B 4OX7A 3OBIA 4Z7CA 1FVSA 4NLQA 2EK1A 3BO4A 3TWZA 1PC4A 3HDSA 4RBUA 1FT8A 4OJGA 3N6MA 1R8HA 5D4NA 1RBOB 1SIZA 4X84A 2CJBA 3TVKA 2DHHA 2E1MC 2HAFA 4X4VA 4LFBF 2LKZA 3M4XA 1RAIB 1U2CA 4TU8A 2L9NA 4CLFA 4LF7F 2XSJB 3CNQP 3PX0A 2OD6A 2RKIB 2FJAB 2DJWA 4B3TF 3P5BP 4AE5A 3PV8A 1VHIA 4CYUA 4F4AA 1OS5A 1CQMA 3D5MA 3GP9A 2B56A 4ZVPB 5KFWA 2HHPA 4F4YA 2ZZNA 1WI6A 4DFJA 2DGSA 1VQMS 2WOMA 2HSEB 4KHPF 5H9FK 5FD1A 3OLAA 2VDHA 4CO0A 4P74A 4CM2A 2MEWA 4FS2A 3HHLB 3PVXA 3GV7B 2F65A 2A3JA 1Q8BA 3T1HJ 4BC9A 4IDKB 4IR9A 3CJQA 4K4ZA 2VKZG 1H98A 1Z1ZA 4HHUA 3CCWA 1YZ7A 4PQUB 5KT5A 3VV2B 1YJNS 4IRKA 1HWJA 4FXWA 3PNIA 1URRA 4QU6A 3SEOA 2APOA 1MWYA 2J7WA 3LP0B 3ZC4A 3RJMB 4I7FB 3BGRA 1FX2A 2OAUA 1RK8A 2VHGA 4E2FB 2QA4S 5KAKA 2RILA 3KWMA 2R42A 3QIDA 1VGYA 3PCOB 2E29A 5LMNF 1IKXA 2HMIA 1RKJA 4C8MA 1HMVB 3DU5A 4DUYF 8RUCA 4MK7A 3MECA 4RBVA 3DYAA 1DQ8A 2CXEA 4OLPA 2GAGC 1K0TA 3RRHA 3G9CA 1YGYA 3M2RB 4DU7A 4DN9A 1S5ZA 4M63A 2MQOA 4WU3A 1P9YA 3M9OB 3QWUA 3LTOA 4HTIA 1RTJB 3G82A 3AD8C 2XYGB 1NB7A 3R7NB 2XC9A 3HVRA 3UPFA 3N79A 4K4UA 1C1CB 3A8IA 2XCAA 4L73A 5HBMB 3EDRB 2W2NP 1XTZA 1VRUA 2I0XA 2YNHA 5K5MA 5ETRA 5A8KB 2RRNA 1RCOB 4PPDA 2XQCA 4QIFA 4M95A 3D3BJ 5J2MA 2UU9F 3GG1A 2KDOA 3GFZA 2FY8A 2NYHA 1NK4A 4HLBA 1HHTP 2VG6A 4UZBA 1FWLA 3MZIA 1ZOTA 4QWAA 2Z30B 3EZUA 2YKPA 3W66A 4ED3A 1BD6A 4B3SJ 3ETMA 3PO4A 5DRKA 4X2BA 1PC5A 2JJ4D 1FRHA 4JI1J 1IKVA 1KD1T 1B70B 1IN0A 1T7PA 2LEBA 1FNOA 3HSGA 4P2SA 2KXHA 2WW4A 4ZDNA 3SXLA 4ZHRA 4NLVA 5IV4A 3MUMP 5KFDA 3L3CA 1M5HA 3V6HA 1N34F 1WC1A 4O0IA 1MLAA 3IP0A 3NCPA 3IWXA 1X4EA 4F7VA 2PN6A 3HZGA 3ENQA 3LA0A 3CCTA 2H51B 2L48A 2ZKTA 2OPPA 1LWFA 1RHMB 4J9KA 4ZPWR 4JI4F 3K5MA 1W26A 2ZVIA 4NA2A 4LF6F 3GB0A 5CZXA 1TV6B 4LSZB 3I0SA 1BC6A 2E9RX 1K47A 3DXBA 3SI8A 4Q44A 1S6QB 4TKTA 4F4WA 2FZKB 3KLFB 2Y1RI 2F8MA 2MHNA 2ASYA 4F4KA 3FMBA 3KLHB 1AB8A 2VQEJ 2O01C 3MPUB 1DQAA 1ULRA 5ETVA 5J2PA 2DB1A 3GONA 3VGVA 3KMSA 1UWBA 1ZZNA 1Y5NB 2LYVA 1HYSA 4CLTA 1S1WB 2X3DA 4DXLA 1PCAA 4CT8A 1JLAB 1RHJB 2ROGA 3F73A 5J2NA 2HBZB 3TYTA 4I69A 5CCLA 4YY3F 4WP9A 1RA6A 4CNYA 2GQCA 4OI1A 4JV2A 3BBFA 3IR5B 2O3DA 3ADAC 2WVEA 1F5CA 4DEZA 2IJFA 2KB2A 4LMZA 4ZVQB 4M5GA 5EN1A 5IV3A 3W9HA 2R8GA 3D7SB 3P3DA 4GVLA 3AB2B 4PEOA 2HZVA 4CO5A 1YJVA 4CYUB 5KT4A 3WC2A 2ZC3A 5IT0A 2CG8A 1AW0A 1M5KC 2DYAA 2KI2A 2WOMB 4A48A 2AQ4A 1L5UA 5K20B 4J9OA 1UCNA 2Y1IA 3N0VA 2PMZD 3H8YA 1NDCA 1JIHA 4ES3A 2PEHA 3I0RA 4G1PA 4TLQA 4NYPA 3OV7A 1RAEB 2G4BA 1N33F 4NYOA 2R2UA 3PRDA 1GMUA 4DQRA 2ZEJA 4ZVSB 2CJKA 3B6BA 3FFIA 1CJTA 2H5IB 4ZCIA 3QAUA 3HT3A 3I32A 2DPIA 2QG9B 4ECRA 3I4HX 1DY3A 4XPCA 4AYBD 1S0VA 1M1KT 4N47A 3AOCA 3SQGA 5KFIA 3BGRB 4I64A 2ZZTA 5HANA 4ZPCA 5L1IA 5K8PA 1VK3A 4M8LA 1UEVA 5F8IA 1CSJA 1IKXB 3PHEA 2B8QA 2DXEA 2HMIB 4YR2A 2NCKL 2RHSB 2RUGA 2M88A 1IUJA 3JSMB 4LBIA 3DYAB 4X62F 1U1PA 3AA8A 4IH7A 3TEHB 3BR9A 3IBWA 4DBQA 1N32F 3PX6A 2DT9A 3G82B 1UKUA 2DKOB 2UUAF 4BHQA 2XTJP 4FF3A 1YJ9S 4DV2F 1HNWJ 3VGUA 2ILYA 1R6VA 2B4OA 3AOAA 4RW8A 2L9DA 3OFHA 2UXBJ 4FZVA 3CF5Q 1H3DA 3CPWR 4X65J 4P72A 2YNHB 1CS4B 3SCIE 3GYXB 4OYMA 4DFKA 3GIIA 3OXGA 2YWGA 3GSIA 1VS3A 2VG5A 5FJ4A 2J76E 3HP6A 4ELVA 3RRKA 1RWOB 2Y8YA 4NLRA 2YNFA 2KTQA 2F9DA 3US5A 3V5RA 3ZTSA 2C3PA 2VG6B 2W01A 2IMOA 2DHAA 1WJ9A 5K14A 2CPEA 3P4UB 1T03A 4NLSA 1T0TV 2PGCA 2YKOA 2MYFA 5M2PA 2WSFC 3OL6A 3KTQA 1U0HA 1U09A 4ES1A 2E44A 2R7WA 4B9VA 2IVFB 1O6XA 2QL5B 3E2EA 1OWXA 1CJKA 1WHWA 4CP5A 4ZHRB 4IQXA 2JDJA 3KJFB 2XZTB 2XS2A 3UFCX 3OL7A 3R7SB 5RUBA 2CADA 2OPRA 3GCXP 1H2UX 4DCJB 1JLCB 4DJBA 2XY6A 2XZWA 4I56A 2GO9A 3ELHA 4WYLA 2FJWA 1VFJA 2DGTA 4CO1A 2OPPB 5A6PA 4A8WA 3BV8A 3HSJA 3PHTA 4X4TA 2LQ8A 4K4SA 4LJMA 2RB7A 2ATCB 2QL9B 4BCAA 4K50A 3CMQA 4F3QA 4LR9A 1HWLA 3SSRA 1CEZA 3R9LA 3JTOA 4UQGA 3I0SB 2B4PA 5DZ7A 4YB6A 1P8GA 1HWKA 3QJLA 2AJ1A 4I6YA 3T9NA 5I3UA 3AH6A 3TO8A 4G3IA 2DNKA 2HZAA 4URQU 1ZM4A 1JK9B 5J2PB 2ROEA 1MW7A 4ZIVA 2B4VA 2KRRA 4ED5A 4F2RA 1UWBB 5L1LA 1HYSB 3FMWA 1MNEA 1FRJA 1NDKA 1RT2A 3DDKA 1U8SA 2W2MP 2K2PA 1LEOA 1HBNA 3IR7B 2UVWA 2ZNYA 2W25A 1NEEA 1Q8IA 4JI7J 3QRQA 3WBZA 5EUHA 4I2PA 3BEGB 4QR2A 2HHXA 1BMQB 1X4AA 2ADBA 1QM9A 2AU0A 2V9WA 4LF4J 1ACMB 2HQFA 4J9MA 4U95A 3ITHA 1Q8LA 3DKDA 3UD3P 3S6EA 2AV5A 5L39A 1N4LA 3CCES 3M8PA 3D2WA 3QMQA 3CCZA 4DX8H 2AKWB 1IBKF 1IWAA 3M32A 2CA9A 3T6JA 2LMIA 5F0WA 4DR2F 2IYIA 2XS7A 3C6TA 3M8WA 4KAIA 2OEKA 1DTQA 3M9NB 1RT6B 1S9EB 4WWSA 4U6PA 2Y0BB 3HD1A 1YQHA 3I0RB 4RL1A 2LXIA 4HI1A 3RYLA 2BMBA 5HLFA 2HHUA 4WFBQ 1ZYQA 3NEKA 2VV5A 1QSYA 1P6TA 3CD6S 4ZVRB 5KFTA 3FFIB 2PA8D 3G8QA 1M0SA 3B8HA 1RUSA 2P2CB 1FI4A 2CQBA 1E6VA 5HL7Q 1P27B 1MWQA 1ICEB 1RXOB 2IDEA 2PC6A 2VQFJ 2E5IA 4K2XA 4OZ1A 1GH8A 1VQ7S 2WBMA 4WTYA 3OLBA 4R5PA 3SQGB 3N6LA 5GAGU 4H54A 2X3GA 1S59A 4DSKA 4EEYA 2KFZA 1BWVA 2VA2A 1RTDA 5C24A 3K89A 3NNAA 5LL6d 4FPRA 2KYZA 3NGTA 1VOMA 4A4JA 2PSZA 1M5VC 2MKSA 4Y2AA 4ED1A 2G13A 1FJGJ 4EWTA 3L95X 3M1VA 4JV0A 2R7QA 2Z0GA 2FLNA 4NMLA 3G87A 1D09B 1YJUA 2V34A 1RU2A 1KRPA 1SC6A 2WTFA 4N41A 4M5DA 2ZD1A 1XIQA 1JJHA 3LUYA 3J81j 1VRQC 3E3XA 4RW8B 2H3EB 2B5JB 2HW3A 2AYMA 3R2DJ 4B3RJ 4HDHA 1N52B 1QAJA 5KG7A 4QYZK 2MGZB 3ZZRA 4WK3A 3OD2A 4UUXA 4DPUA 1NHVA 3K8VA 3G6ES 3KOAA 3DLKA 4L3NA 4EMDA 1P9QC 1R27B 2VG5B 1OSDA 4P75A 5E3CA 3TANA 3OVAA 2WVCA 5KG4A 1XN9A 3NNCA 2YNFB 4FYXB 2VFRA 2JWNA 1RWNB 4GKKF 1I6JA 2JVOA 5K8NA 5K14B 4JI2F 4P73A 4C3LA 1T03B 1D0EA 1NH7A 4HL9A 3H25A 2GIQA 1DRZA 1V3RA 3KYLA 1RWWB 3PACA 2WK4A 2B6AA 2EEYA 4NXNF 2Q3PA 4KPYA 2PT0A 3DRSB 2V50A 3RG6A 3MR2A 3D68A 3UO0A 3DRPB 5IT4A 1OY9A 5KFQA 2WONA 1XNQF 2OPRB 4UW2A 5KFUA 2QTWA 4JI8J 1C0TA 2VFUA 3BSNA 1N54B 2MY7A 4NPOA 4TU9A 1HQ2A 3PTWA 2V5HG 5HATA 3CD7A 1LWEA 2M5YA 3R6GB 5GAHU 4G65A 1FRLA 2GJ2A 3HFZB 3Q23A 1X4CA 4KC5A 5KG1A 4KHRA 1D8ZA 1X9WA 1NUEA 4AFFA 2AJ0A 3NOCA 5I3UB 1UVNA 2YKQA 3CJRA 1AFIA 4Z2XA 5FDLA 5T41A 3R1LA 2OFGX 1WC5A 5BR8J 1N0UA 3H5XA 2GVZB 2C3UA 4OHYA 1Y11A 2B8PA 2DIVA 4U8YA 3DLGA 2RDIA 3ZXWA 4KV8A 4PQAA 2CNNB 5J1NA 1M1HA 4Q8EA 2MZQA 2HFSA 2FVPA 4Q7AA 1NSKL 4I2PB 4ZVOB 3VQTA 4FDFA 4USMA 3KJVB 1ZAVA 2MZTA 3I4PA 2RHQB 2QC3A 1R0AB 4QCLA 1IJEB 1U49A 3ITHB 1TQLA 1RWKB 2MQNA 1URNA 2E7XA 2XS5A 4RO0A 3M8PB 3SMZA 1XMBA 4XIUA 1VBZA 1JKHA 3M32B 1X5OA 3O44A 4C8NA 1WC3A 3V6DA 1FFWB 4CH7A 1DTQB 1DJ0A 1UW9A 1RT1B 4EBEA 1FXRA 1H6KX 3DGPA 3GMGA 2LU2A 5LSRA 4K59A 4KSEB 5HLFB 1VYAA 1U2FA 3FEXB 3DXSX 4OI0A 3BF4A 1EKSA 3ZZ0A 2CPYA 3ZTQA 2YBVA 5CXTA 3J80Y 1YBAA 1FJ7A 1FTRA 1GMVA 2BJ7A 2DNPA 3BN7A 5KG5A 2AJ2A 1E6VB 2E5LF 2CFXA 3FEYB 3RBZA 2OELA 3OFGA 2HHTA 3N01A 3CCQS 2CUYA 1FDNA 5KFRA 2LXUA 2HNZA 2LDYA 3G86A 4R5PB 4IH6A 2Q6BA 3H4BA 1KOHA 1TZ0A 4YEAA 5IWAF 4XDCA 2C2OB 2XG8A 5D4PA 3RB0A 1NZ8A 1S1UA 1HL6A 1JLEA 1YJ7A 3JQJA 5C24B 1OYEA 5E2QA 2ZH3A 1REGX 2OEMA 2OI2A 1FCAA 1OY8A 2DGOA 4LT6A 4PWUA 4FYDA 4ZLLA 1AUSL 3M1VB 2UUWA 5KFNA 5F3ZA 2ASDA 2DGWA 2DK2A 2FHJD 2CJAA 2EBEA 4M5DB 5LJ3Y 4DV3F 2ERRA 4GKJF 3GJRB 5HJYA 3KNAA 2KG0A 1K1QA 3NWGA 2FHJA 1W25A 1U1LA 2O66A 3K57A 3DLKB 4GC7A 2RRBA 4CH0S 3H5UA 3ZZOA 3ET6A 3MAHA 3DN9A 4USHA 5DDPC 4U67Q 1SBRA 5AXKA 3TA1A 1PYOB 5BYRA 3CCRS 3HM9A 4ZJOA 5D0HA 4C3MA 1FHTA 4DQSA 1JNZB 5KFBA 3H2UB 1RT7A 2HK2A 3PRVA 1X8DA 2YKAA 2B0GA 2DRDA 2DVIA 4UOHA 1T9WA 2F4VJ 5DLGA 5AE3A 4CLKA 4A8SA 4P9SA 3VAJA 2LCWA 3B82A 2XHCA 2B6AB 2NS1B 4YS2A 2K8GA 2DNYA 1RACB 1YRTA 4URSA 4PYDA 1NK6A 2ATLA 2IAJA 2BE2B 2GQ2A 5JVHQ 4GVBA 4QU7A 4DQIA 2C1EB 3W5ZA 5DG8A 1FKPB 3O3LA 5KFPA 1RDRA 3R97A 2ROPA 4PPZA 3LALA 3CJ8A 1NSQA 3ZTRA 5KFSA 2XEXA 4L3KA 4MTPA 2BDPA 3V2UC 3HHEA 4B08A 2FJBB 3LH2S 2CNLB 3KLEA 1N0VC 2NXEA 3N4WA 2VBZA 3VTIA 2GMLA 2CRLA 4QWDA 1LFWA 3CCSS 1E6YB 2BKPA 3TRGA 3W62A 4OHWA 4IR1A 2CVIA 1S1XA 1PAEX 4FP9A 4OZNA 1UVMA 1W2IA 2LECA 1D3WA 3ZNUA 1KP6A 1GTHA 4L74A 2C2DA 3HK2A 1C1BA 4MFBA 5CCMA 4J9PA 4ILLA 2CPDA 3Q8UA 1SC3B 4A8KA 1K9MT 3GV8B 2NPFA 3BYPA 1H0HB 4KFBA 2H54B 4UF4A 3I96A 4Y2CA 2HFUA 3M8YA 4KV8B 1F3FA 3H42A 1KONA 3HO1A 2G1DA 2MQLA 2QSWA 2XYPB 1QAYA 1FJCA 1S1VA 4DR7J 4L75A 1Y3JA 1VJWA 2JFKA 5B0BA 2HZCA 3K7RA 1EX8A 3UE2A 2FC8A 5SZTA 2C3MA 2VFTA 3GIJA 3WC0A 2XBPA 1JXEA 3K5NA 4MKBA 4OL8A 1RT5A 1LW2A 4ECQA 2XY7A 5F9NA 3TUZC 1JKHB 1OY6A 2ZNZA 2AYBA 2HQIA 1QSLA 4DV1J 2GHVC 3DDNA 5GAHI 3DGPB 5K8MA 3POTA 2D69A 5KG0A 5HVFA 1B3TA 3NKYA 3PY8A 1Y5IB 1TK5A 3HX9A 3F41A 4ZJQA 3MD3A 1JJ2R 3RUBL 2W7OA 1R8PA 2DXFA 1NB2A 2YNIB 2KJVA 1UVKA 4AD6A 3MMAA 1NPPA 2U2FA 3EGWB 5LJ5Y 2L9WA 1EETB 1WEYA 2H48B 2HNZB 2J9CA 1OIAA 4Y28C 2Y3YA 4OJHA 3L7UA 3MAAA 4ZMMA 1IVZA 3MM5B 3T1HF 4DHVA 2KXNB 1S1UB 4K0KJ 1JLEB 5BXIA 2RDJA 5CZVA 1EIYB 3FUYA 5C42A 3P96A 3H7HB 3IGNA 4V1Ak 4DQPA 4X4NA 3IXQA 2AD9A 3PW7A 3GFXA 2BKOA 4UOCA 3LPYA 1OYDA 4KH1B 2OSQA 2Z2YB 4ZPTR 2IPOB 3W63A 2RAQA 2JH3A 4IKAA 3D0GE 3HFVA 5U47A 2AMCB 3QNWB 5LT5A 3Q8RB 3FRZA 3IBCB 3M8QB 4PXBA 4R8UA 4OMFG 2CQ2A 3O2IA 2RDDA 4C3KA 4UT4A 3AA9A 2HHSA 4QOTA 4DR3J 3QGGA 4YB5A 2ZUAA 2A6OA 1I94J 3RW6A 3UI3A 3K5OA 2NXCA 1X5TA 1QAXA 4HHHA 2M3DA 3WZ0A 3GR0A 1LKZA 3GIRA 3H59A 4OI4A 2FTRA 1RT7B 1ITPA 4H4KA 4IO9Q 2E9ZA 4O44A 4FXVA 3HJVA 3TZXA 4Y2IA 3SCKE 3A3NB 3AOBA 2OUGA 2BUNA 2R2RA 1ZM9A 2LFVA 5J2QA 3HHLC 2Z8QA 2HNYA 1Q5YA 1RAFB 4B9NA 3QO9A 5JVGQ 2HQCA 4ZVFA 2IAJB 3K2YA 4GVBB 1VCTA 4EYHB 3JB9k 2MKYA 3DDIA 2ZBCA 3LO3A 2R7XA 2W4DA 4B3SF 2EK6A 4X4PA 3PDNA 2J5AA 3N5FA 3CO9A 4JI1F 4ZP6A 1NZAA 1S0OA 3KJQB 2X1GA 3KLEB 2A2CA 2GX8A 1Q53A 3AJ1A 2IJRA 2QL7B 3CD0A 2R9LA 3BREA 3WQPA 1KQKA 5J1PA 1QY7A 2DBBA 3W2WA 5CA5A 5DDRC 1CULA 4P10A 3QLHA 4Q5VA 4FYYB 3MFHA 1EP4A 1C1BB 4MFBB 4A8YA 5KTQA 2RU3A 2PIIA 1Y3KA 2B3TB 2VPWB 3P6YC 4KFBB 2G0IA 2VDIA 1NJIT 3WIUA 2Q1LA 3PJWA 1NPRA 4FPIA 5IOLA 4JV1A 3EUNA 3UN3A 2AGOA 1X4BA 2ZJPQ 3GCWP 4YR0A 4MYUA 1S1VB 1ZAXA 2VQEF 1R89A 1YKWA 3H98A 2R7RA 5K8OA 4EZ6A 2OP5A 3FEZA 4K4WA 4QIWD 5IXUA 2NUUG 3V4IA 1GK8A 3EM1A 1U7LA 1TKXA 2RUSA 3MI7X 4S0MA 1IBCB 2W24A 1I51B 4M5KA 3DLEA 1RWPB 1LW2B 2I38A 1SC4B 1FRMA 4OX9J 2CQCA 1UPPA 2VFSA 3TJAA 8AT1B 4NI2A 4ES2A 2UUTA 1H74A 3BDEA 1Q4RA 2DR5A 4OFZA 1HI8A 2KZZA 1RAAB 5ETMA 1CQNA 2J8SA 3POTB 4M5MA 3S7RA 3FBFA 1M1GA 1RAGB 3T19A 3AD9C 4MYTA 4CLSA 4ECUA 3W9IA 2U1AA 1SB6A 2KXFA 4NLYA 3CDBA 2QYGA 3HCXA 3MMAB 2K1RB 3MM8A 1N5YA 4RW6B 5I3QA 1QD1A 3FCHA 2H1YA 3MAAB 1K1SA 1ZZFA 3J80U 3LGMA 3I6PA 2OJ3A 1JQGA 2BM1A 2VF3A 2LEPA 4I2QA 4WJBA 2HRTA 3NAIA 9RUBA 1HPZA 4Y2MA 1RU1A 1KVKA 2GJFA 2AZ1A 2K06A 3RB3A 2IYGA 3TUIC 1PJ7A 2W1BA 3MM7A 4K4YA 4Y65A 2YH0A 4E0DA 4DPWA 1YLXA 4C4WA 1F3VA 1REVA 2XHWA 4KHMA 3H0PA 2YKMA 4R8UB 2KRBA 3R2CJ 3K8WA 2DR9A 3W3SA 2IM3A 2E5HA 5DG9A 1RHQB 1C4AA 3PW5A 5F8GA 4DR6J 4I4BA 4O3RA 3J81Y 2XGPA 2HAIA 3QGIA 2GO8A 4NLTA 1NU4A 4LFAJ 2FVQA 3D6TB 3CCVS 3N9UC 2F40A 2HG4A 5KT6A 5KT2A 3TI0A 2QFIA 2IC3B 1RBAA 3QIPA 1HNWF 4QW9A 2XLKA 3K17A 2KHCA 4RJVA 3BGLA 4OHVA 3BGFA 1NXIA 3K59A 5ETTA 2UXBF 4ZOSA 4O44B 1GT8A 4Q2MA 3T1YF 1ZS6A 3OTBA 4IFYA 1VLOA 1H72C 5D77A 5J2QB 2OHDA 1UA1A 1B4SA 1LWCA 2HNYB 4P6QA 3G4SS 1U02A 1FDBA 2DNLA 2BW2A 2CPHA 1MMDA 5C25A 1B0PA 1X9SA 4OIXA 2RQMA 3QSIA 1DBDA 2BANA 2YNGA 1HBOA 3JTPA 1N36J 2G2YA 2G2ZA 1HWUA 2OPSA 2MLXA 3KDOA 3TOQA 1Q5VA 3ZTPA 2AHOB 4DL0C 5IM0A 4U9RA 4F4ZA 4MKYA 2G1HA 2QRRA 3UN2A 3ILJA 3GIKA 4NCGB 1WKJA 5B7WA 4H4OA 3EVWA 3NBPA 3A1YG 5IC6B 1A9NB 3Q22A 4DR5J 4E98A 4F04B 1WG1A 3ENWA 4CCHA 3M8SA 3EICA 3LPEA 2H9ZA 1CULB 3QLHB 3FSYA 1EP4B 5L9NA 3UNYA 1DQ9A 1TL4A 3PEHA 4HVZA 4ZPAA 1VBKA 2MLZA 3PJ9A 4CLWA 5JJBA 1WOSA 1B7YB 1WG5A 1S12A 2EFGA 3NGSA 3ZZPA 3R5AA 3LAKA 4G1QA 1S9GA 1UJ5A 2D3OR 1M5PC 3PYDA 4HHJA 1S6OA 1WUUA 3S1TA 1BUXA 4YMEA 1ZH5A 3ZZTA 1MN7A 4USJC 3V4IB 1TKXB 2ZWOA 3ISZA 1Z2LA 5HVGA 3DLEB 3SIPB 3KJNB 5D0EA 6FDRA 3JAMY 5B0DA 5KT7A 3PW0A 3QRPA 3Q8SB 2ABYA 2HWTA 1QDUB 3V6KA 3Q86A 4JI7F 1RA7A 1UEKA 4FBTA 3D4JA 3DHWC 2A0FB 2OTJS 2LXFA 2LVWA 4LF4F 3IAS9 3AJDA 2GV1A 3FGVA 2XSJA 4FNHA 3Q2SC 3K5LA 3SZ2A 2DHGA 2EFOA 3MM8B 3KK2A 1N5YB 4KQZA 4ZLPA 4OYBA 4O4GA 2LDIA 5D15A 1WEXA 2HHHJ 3MF5A 4CWBA 2GC8A 2RE1A 2IM1A 2KYXA 2WCXA 1FRKA 4ECTA 4C8YA 1N5VA 1NK7A 4MJKA 5DGAA 4I2QB 5C7PA 3FBBA 1HPZB 2KZMA 1TUWA 1VC6A 3QATA 5HMZA 4O3SA 3LANA 4HDGA 4IOBA 2XULA 1X4FA 3KLGB 2ASLA 4NMXA 1SKWA 3MM7B 4A8FA 2MJUA 2E5JA 2VQFF 3GWCA 4PQUA 4G1IA 4WE1A 5H9EK 2QMUB 4NA1A 4FBUA 2BJ3A 1FX4A 1F9EB 2HIQA 4C9DA 2VC0A 2FJEB 1D9DA 1CJUA 4MAKA 1REVB 3TUJC 5DZ6A 2V8GA 3LP0A 2YKMB 2MXYA 2VA3A 1WORA 2XZDB 1G7CB 1TELA 1M90T 1G1XA 2NYIA 2XI3A 2YX7A 1PJ5A 4ILRA 2RIJA 1FJGF 3M6WA 1PKUA 2RMLA 3CCMS 5F8JA 3LWMA 3CVKA 2J9DA 4DX7A 2FDNA 2IRUA 2YQ3A 3VCDA 2WB4A 4K7QA 4U7CA 2HURA 3SV3A 2PEBA 5THWA 3MM6A 3QIPB 4IOAQ 4WP8A 1GNKA 3U27A 4AQYJ 3THVA 1UVJA 3GILA 4DV4J 1TTHB 3HD2A 4B3RF 2R8HA 1GX5A 1RB0A 1KFSA 1C1CA 1F0XA 2CQPA 2GHWA 3BN4A 4ZA1A 1SCJB 5MAOA 5HK4A 4JI3J 1T02A 4YQWA 1ZTTA 4IFYB 1U1RA 4USIA 3EX7B 2I6WA 4PG4A 5A8KA 3C14A 2MDAA 1VK8A 2FGOA 2BZ2A 3MXHP 2MLYA 3D0IE 4JUZA 4XAKA 2RF2A 4LRCA 1L3SA 4Q0BA 2GZOA 4CO2A 5HQMA 4DCOB 2QN6B 3UCGA 2DR7A 2BANB 2YNGB 3QGPA 1RWXB 2M8HA 1VI7A 2UP1A 2OPSB 2LEAA 1N8RT 4LREA 4ZS6A 1DFDA 1MSWD 2ZM6J 1V9OA 5KFEA 4URGA 1C4CA 1TU0B 5C2CA 3HVAA 1NJXA 3S8SA 2W9AA 2F4FA 4ZP9A 3DCAA 4ZPDA 2GIFA 2QLJB 2DNQA 3NBPB 5IC4B 1WTBA 3AT1B 3FZ2A 4ANDA 2NQPA 3QT8A 3MTJA 5E41A 4JI8F 4X66J 2AGQA 3HJFA 3I31A 1JLGB 5T7LA 1JXLA 3UR3C 3D66A 3UR0A 1U2RA 2WBRA 3OTCA 4IH5A 3RB6A 1LW0B 1FTCA 4RBTA 5F8HA 4G1QB 3EWGA 1FWKA 3HHKA 1S9GB 2HFZA 4X4RA 3ENVA 1BY9A 4DZDA 4J9NA 1KVIA 3BB5A 1BE4A 2DHXA 1S48A 5F0UA 4QYRA 2JNJA 5BR8F 1HR0F 2UV8A 1T8EA 2UXDJ 1VIOA 3QAEA 4EU0A 3JTNA 4RUBA 3DC2A 2X1BA 5KG2A 5KFAA 5E33A 4OYIA 5JUMA 1S1WA 4DDFA 2RQCA 1YBTA 2MKIA 3GR1A 2NZCA 1R0CB 1JLAA 3W8GA 1TUGB 4CLLA 4DX5A 2DIUA 4X4SA 1EJ7L 2C3OA 2DXDA 4O3PA 3MFIA 4PABA 2HHWA 4TQRA 3GSDA 1WEZA 1WSRA 1YHQS 1KFDA 2H4YB 4USKA 2XNRA 1Z2ZA 2MQ8A 3BKUA 2UVUA 2E7VA 4Q45A 2P5VA 4F0KA 1BQNA 3TZZA 1VBXA 1YI2S 1TAUA 3AAWB 3KK2B 2OEJA 1GX6A 1UZDA 3ETOA 1NKEA 2KM8B 2R7OA 1KVJA 4O4GB 4HYKA 4OV6A 1XC9A 4O4RA 3VGSA 4M5IA 2R7TA 3KHLA 4ZK7M 3CC4S 5KOXA 4EK2A 4J9VA 4HT5A 2CPXA 4KBIA 1VQ4S 4GO5X 4OYXA 5IQ6A 3A8JA 3VQSA 4NCBA 3UN5A 3W9JA 1RCXB 4W90B 4Q8FA 2MKHA 4WE1B 2E7WA 4WIIA 3TP2A 1CLFA 2CNKB 2PA3A 3MM9A 4V19J 2CWXA 1U0SA 1DAXA 1CJUB 3BSAA 3OTEA 1CBKA 5DQHA 1GQEA 4ZVGA 1YDLA 3KK1A 5CD4A 3F0NA 3PG9A 2JOQA 1HLWA 1S7HA 3OHAA 3CGIA 4C7QA 2BQRA 2Q66A 3KLIA 1VDHA 3AXMA 2UZAA 5LM7E 4YFUA 2MB0B 1S7IA 2FVRA 1CJVB 4I68A 2COLA 3JSMA 1RZMA 3R1HA 2IFXA 4WFXA 2BM0A 2YKNA 3MM6B 5ETNA 3AQOA 1JLFB 2FJXA 2EC0A 2EC2A 3LWLA 1VBYA 3OR2A 2CJQA 3J81U 2D3ZA 3DMJB 4DL6A 3BH7B 1FXDA 1BQMA 2Q43A 2C2RA 1PSDA 3X1LB 1TFYA 1TL5A 1CS4A 3MTKA 3C14B 1RWMB 3QT7A 1X9MA 3RZAA 2KVIA 4LVOP 1WWHA 1HW8A 2RF2B 4Q0BB 3MEDA 3GU0A 1AYEA 1YK9A 4RUCA 3KDNA 1WELA 3IFEA 4W4MA 2G2OA 2DR6A 4KPCA 1WG4A 3L7PA 4WZMA 3OL9A 2RS2A 2F4VF 4OYPA 3W64A 4MMOA 1PBAA 1WC4A 3CC2S 3BH6B 2KKHA 3PYFA 2FY1A 2IMWP 3C6UA 4DWIA 2JEIA 2RSQA 3GLJA 3MR5A 3EGVA 4DLGA 1YZ6A 1UEUA 4OLOA 1H7XA 2YTCA 4J9UE 1JLCA 1FDDA 3NS5A 4DSIA 4I1TA 4I67A 3U1LA 5T7LB 3GPAA 3O5TB 2Z4PA 4F4XA 2DGQA 3SFGA 3TNVA 2DRAA 3N5BA 2QEXS 5HAOA 5CAAA 3SDEA 5HMYA 3H5YA 1NMEB 2MZSA 3OT9A 4DL7A 4IFVA 1MMLA 4B9SA 3UNGC 4F8RA 1K0VA 4NEYA 2JEGA 2CG4A 4QIVA 3RRGA 2J9EA 4MT1A 4PUOA 4TYBA 2KH9A 3MAQA 1XJWB 5HI7A 1WD6A 4WBFA 4LRFA 2AZ3A 3EZOA 3TAPA 1TP7A 4CZCA 5KFCA 4TNOA 1J5EJ 2V69A 3H90A 3EYZA 4PWDA 1ELOA 2XMAA 4GMKA 2F8HA 3CWJA 2R3VA 4DR7F 3NCRA 1IBLJ 2BVZA 1SVDA 2WAQD 2JZ5A 2ZBIA 2HGLA 3ZZYA 4AL5A 4EO6A 3BJYA 3PEJA 5KFMA 2NREA 4A8XA 5ETOA 2I1RA 3JAMU 3GJQB 5HJXA 4IG0A 1O51A 2EBGA 4FYWB 2BEFA 3KHRA 4FN5A 1BQNB 4G6VB 4DV6J 1AUDA 1RABB 2FZCB 5AXLA 4CLYA 4X64J 5DGBA 4C0OC 5BYQA 1PG5B 4DV1F 3RBEA 1J2VA 4PG7A 2BE9B 2LQ5A 1R43A 2EKNA 3MUTP 1Q86T 2GMJA 1S79A 4RZRA 1RT6A 3W5YA 1S9EA 4LQ9A 4ALZA 4NRUA 4ZITA 1JLBA 3H40A 2ALZA 2IIHA 5I3PA 3OJUA 4QIGA 1FD2A 2DNOA 3NMAA 3IRXB 1U4BA 3C8YA 4BWMA 4BLGA 5KFZA 4J90A 4N7TA 1Q95G 1U6ZA 3PR5B 2DPJA 4EO8A 4ZJLA 2ZH8A 3BSOA 3VGTA 2VOPA 1HBMA 1N5SA 3W2VA 4ECYA 2Y8WA 1WDDA 3CJ0A 2MZ1A 1X4GA 4RU2A 3MM9B 2J0SD 4KB7A 2R7VA 1HHSA 4K0KF 4CDIA 3KK1B 2V2VA 2FZGB 4IG3A 4HH1A 5KOWA 4DSLA 3R5CA 5ETSA 2W8LA 2ZHOA 1R31A 3KLIB 1HA1A 1T9UA 2ZH5A 4F02A 3O8WA 2JL9A 1LV5A 2C2MB 1Y7PA 3A8EA 2E1AA 4CIOA 1TVRA 5ETKA 2ZOGA 2HVHA 1MU2B 5A8RB 3G6XA 2GW8A 2HIYA 2XB2D 2YKNB 1ZBTA 3U02A 1C2PA 2V2ZA 1RAOA 4DG1A 3OR2B 2XMJA 3GYNA 4DPXA 1W7WA 3QBCA 5E3RA 2B5JA 1BQXA 1BQMB 1NJYA 4OQJA 4CRJA 4DR3F 4QYZJ 3M8ZA 2MGZA 4C11A 4FVMA 3TQEA 3G6VA 1UW4A 1I94F 3W61A 5KFXA 5D4LA 5L1JA 3T1YJ 4DX6A 5E3AA 3D9BA 4ERDA 3MEDB 2C2EA 2B9EA 3M05A 1AZSA 2R8IA 4NYZA 3B4DA 4TVAB 3I5CA 2OH2A 2R8KA 2A1BA 1B99A 2M52A 2HGMA 5D78A 1FE0A 1PGZA 3ISNC 2CDQA 1Q78A 1O0PA 2IA0A 2V4RA 2NLWA 5F3TA 3J7AN 4B9MA 4CQ1A 5HQLA 3C6UB 5AJ3J 4ITSA 4LUBA 1NJWA 4YN3B 2GVDB 1WNEA 3DRSA 3SBMA 4HH0A 1WF2A 3EVOA 4LF9J 1ZA1B 4MK9A 3DRPA 2GCFA 3HVWA 3UD5A 5M2UA 4NCAA 4DL4A 1VR6A 3NY0A 5DG7A 4YOEA 5L38A 1DLOA 3HULA 2CZ4A 4UOGA 3QJJA 1H2TZ 2Z2ZA 3SDEB 2WRMA 1L3TA 2VPYB 4IFVB 1Q1KA 1V5VA 3V6JA 5KFVA 3S01A 1FFGB 1K73T 3J7A1 4PUOB 1RWUA 4OI6A 3GJTB 4M5JA 2XMUA 5EWFA 4ZCLA 4DS4A 2AIRB 2HRUA 3RW7A 3FCVA 3Q83A 2GVZA 1HARA 2RVJA 2CAJA 3OXFA 4OZLA 2QSFA 2FYXA 1MG7A 5DETA 4PWDB 2W8KA 2E1CA 4NLXA 2RQKA 2JLEA 2LQBA 3AODA 3T5KA 1S4FA 1NKCA 1IKYA 1TL3A 1F2GA 2DO0A 2VC1A 1WACA 1P1LA 3QFHA 4IG0B 3KJVA 4RKUC 3THTA 4LF2A 1R0AA 1NBEB 3DU6A 4OX9F 2GNKA 1RLCL 3MMCA 5CH7B 1LWXA 3C15B 3D0HE 1U1KA 2VFVA 2Z57B 4F26A 1SUQA 3KKFA 3G8TA 2E1RA 1UL3A 4TQSA 2X51A 1RT1A 1RTZA 1JLBB 2VONA 4KKOB 4ZN3A 1KQSR 5MLCV 2XSFA 3CDEA 1NK8A 2ZBQA 4HTJA 4P7VA 3UWTA 1RADB 2JLFA 3I5BA 4RPFA 1XERA 1S0NA 3SQOP 4WXWA 1HBMB 2CPZA 3W2VB 4FF2A 5D3GB 5DM7Q 2WVBA 1Q81T 2QA4G 2WSEC 4Y2KA 2NR0A 4DI6A 3QSYB 3U7JA 1CPZA 4LIRA 4IG3B 2DHSA 4ELTA 1MROA 1RT3A 3LQVA 4XPEA 2XO7A 4GC6A 3OFFA 1YITS 3CSKA 3HLUA 2MJNA 1TVRB 4D3HA 5F8LA 2DGUA 3MWBA 4LVNP 1HI1A 2ZE2A 3H4DA 1WHXA 2XMVA 2BABA 4PZVA 1PYTA 3CE8A 3CDUA 2R2TA 4DV7J 5KFLA 4DG1B 3OVBA 3G6YA 2FJVA 2FHKA 4C97A 5EX3A 3TQ1A 5D0RA 2UVVA 5ADZA 3C16B 4MK8A 2H5EA 1HQEB 4DR6F 3HKWA 2GFFA 4DF8A 4C11B 4LFAF 2A2DA 2OPQB 4C8LA 2VZ9A 2YWFA 2HFNA 3T5JA 4ED8A 4DLEA 4R0JA 1XNRJ 1AZSB 4K4VA 4LSLA 3NLCA 2VOOA 4ZLNA 1N88A 4LSNA 4JBCA 1VHFA 3EDQB 1OQ6A 1XQIA 1X60A 4F0MA 2ASJA 2UUBJ 2QO3A 2HPUA 3CC7S 7FDRA 4NLPA 1Q82T 5H1SV 5A2QY 3QT6A 2HQGA 3TZWA 3HXMA 2R8JA 3QFWA 4YDDB 3HI9A 2P9CA 3FJ2A 3R27A 3W7BA 1Z4UA 1Y4ZB 2O5DA 4U8VA 4KR0B 2BE2A 3CDAA 4RW4B 5E3QA 1FE4A 1N36F 2OLWA 1FKPA 1U1QA 3GE9A 1HNIA 1DLOB 3J7YU 1HHQA 3QT5A 3RAMA 5A6WA 4EFAC 4ELUA 1XR7A 4Q2LA 3DHXA 4PG8A 1YVFA 2QX0A 1SKSA 4BWJA 3L09A 3K5PA 2BJ8A 1DURA 2N4DA 1UP1A 3CTRA 2EFVA 4DR5F 1WHVA 2CWKA 3JSBA 1E6YA 1HWIA 2WHOA 2VB6A 2PI4A 3OQ2A 3B78A 4MIBA 4HEA9 1TKDA 2ZDPA 1IJFB 1G6BA 4MIWA 4N8NA 1EHWA 2F7VA 3SSQA 2AEMA 3BDPA 2Z2LA 1HR0J 1F1BB 1SH2A 3RB4A 3IS9A 4RW7A 4WKYA 4KGMA 2GJIA 5FLXY 3LW5C 1Q0NA 4MKVA 2ZOFA 1VC0A 1HNZJ 1VQYA 2B9WA 3CCJS 2O1PA 3FNNA 5HVHA 4DR1J 4H4KC 2QA2A 1IM6A 3LF0A 1IKYB 4V19X 3DOKA 1TL3B 2HWIA 5KFOA 4OYAA 2PI5A 4TXSA 1LQ9A 3QRRA 2KU7A 2W2QP 3WHIA 2HVZA 4DS5A 1VQPS 3CJSA 2F5GA 3CD5A 2FQQB 3UDLA 2L41A 3VAHA 2C3YA 3MMCB 1QTNB 2DTJA 4ENOA 1FJEB 3UCUP 2MQPA 2EWHA 4CLUA 1CG2A 4CTAA 3HHNB 1JJ4A 1VJQA 4XK8C 2V63A 4QZVB 1SUQB 4OYWA 2N3OA 3R3TA 3PO5A 3PKMA 3E8OA 3MR6A 3AD7C 4ZPBA 1SXLA 2DGXA 5F8NA 4EBCA 3IMQJ 3FBEA 1J27A 2KHDA 2MZJA 4ECXA 3FSXA 5CHCB 4IYQA 2CJ9A 3DM2A 2QA1A 1Y0HA 2VUGA 3L9ZA 2YNIA 1I1GA 2MQMA 3T6BA 4N56A 1U47A 5T14A 1EQMA 2KJWA 3MPYA 1UVIA 1SJ1A 2HHHF 3CT9A 1EETA 3N28A 4WF9Q 4ANCA 3NS7B 3TX8A 3KMQA 4KE5A 4CLPA 1APSA 1S6PB 4J9LA 5LSOA 3MM5A 1MROB 1RT3B 2IBKA 4OZ2A 1GXUA 5L46A 4YHHJ 3D3CJ 2HVEA 4J9QA 1VRTA 2LLZA 1U8WA 3MR7A 1KBRA 4J5OA 4B9UA 2ZE2B 3P49B 5LMUJ 3TA2A 2YWWA 4F3MA 1IBMJ 4I0WA 4CI0B 4M94A 4ECSA 2NXNA 4J91A 1GTEA 1WKLA 2P6TA 2AJQA 4OHXA 2NXJA 2CZ9A 4DPOA 3M8QA 1X4HA 4OI2A 2ZC4A 3VZIA 3HPOA 1J5OA 4BC7A 4GO7X 2D74B 2B51A 4IQMA 2E9TA 2GS8A 3G71S 2VJVA 1G2EA 3CXCR 1HFEL 2ZJQQ 2HBYB 1LNQA 1TAQA 5F8MA 3U1NA 3W65A 1JNRB 3VAGA 2R2SA 1NCLA 4KIAA 4XTTA 3WX4A 2D1CA 4TY8A 3OTOJ 4AQYF 4WXOA 3HSDA 4DV4F 4LSLB 1PIEA 1X0FA 2D9PA 4HACB 1NHKL 3W60A 2FHMA 2RNEA 4LSNB 1WKKA 4JI3F 4W98A 2QYCA 3AJ2A 2L08A 3QGHA 2E1PA 2VKRA 1KEKA 3H2VE 5B09A 4YUDA 1D1UA 4HR2A 2RH3A 2IM0A 4WFZA 3OSPA 4X4OA 3X3UA 4NXMJ 2DY9A 2WZ1A 5D8HB 3CCUS 4ANEA 3SV4A 3CJ5A 1CC7A 1BLUA 4B3MJ 2F9JA 3JYTB 1SL1A 2Z2MA 4FKYA 3D54A 4RW9A 5AXNA 1H38A 3FK4A 3O1LA 4J9RA 1HNIB 4RNMA 1ZETA 4EZ9A 3KNGA 3BO3A 4P52A 4EGLA 2ZM6F
chains in the Genus database with same CATH topology
3EICA 4S0MA 1HLWA 4ANCA 3ZTSA 3NGRA 3ZTQA 1JXVA 3FKBA 1NCLA 3VVTA 3L7UA 4KPCA 2AZ1A 2VU5A 4O0NA 2B8QA 2DXEA 1HHQA 2NCKL 3ZTOA 1NSQA 4C6AA 3MPDA 1NDPA 4WBFA 3ZTRA 1BHNA 1NHKL 1ZS6A 2AZ3A 3BBCA 1XIQA 3FBCA 5BXIA 1WKKA 3EVOA 3VGSA 1BE4A 2DYAA 1W7WA 2HVEA 3PJ9A 3BH6B 1B4SA 3WX8A 3BBBA 3FCWA 4DI6A 4W98A 1NSKL 1NDLA 1UCNA 4ENOA 5CABA 1NPKA 4FKXA 4EK2A 1NDKA 1U8WA 4UOFA 3JS9A 3FBFA 1NDCA 2CWKA 3NGSA 3VVUA 1KDNA 4F4AA 3EE3A 1PKUA 3VGTA 1LEOA 3GP9A 3ETMA 3Q8YA 4CP5A 1MN9A 3EVMA 4UOGA 3VGVA 2BX6A 3EMTA 3ENAA 3EJMA 1PAEX 1K44A 4HR2A 2HURA 3VGUA 4F36A 2DY9A 4DUTA 1BUXA 3FC9A 1HIYA 1LWXA 1WKLA 3BH7B 1EHWA 4ANEA 5IOLA 1XQIA 3FBEA 3NGUA 1S59A 3B6BA 3PRVA 1MN7A 1S5ZA 5C7PA 3FBBA 2BEFA 4UOHA 1F6TA 1NUEA 3Q8UA 3ELHA 4FKYA 3GPAA 4ANDA 3ZTPA 3DDIA 1S57A 3Q8VA 2DXDA 2HVDA 4DZ6A 5CAAA 1NSPA 1B99A 3G2XA 3B54A 3DKDA 2DXFA 1NB2A 3BBFA 3Q89A 3NGTA 1WKJA 3EVWA 3Q86A 3R9LA 3FCVA 1F3FA 1VYAA 1NLKL 3EM1A 3Q83A 2B8PA 2ZUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIC A;  4S0M A;  1HLW A;  4ANC A;  3ZTS A;  3NGR A;  3ZTQ A;  1JXV A;  3FKB A;  1NCL A;  3VVT A;  3L7U A;  4KPC A;  2AZ1 A;  2VU5 A;  4O0N A;  2B8Q A;  2DXE A;  1HHQ A;  2NCK L;  3ZTO A;  1NSQ A;  4C6A A;  3MPD A;  1NDP A;  4WBF A;  3ZTR A;  1BHN A;  1NHK L;  1ZS6 A;  2AZ3 A;  3BBC A;  1XIQ A;  3FBC A;  5BXI A;  1WKK A;  3EVO A;  3VGS A;  1BE4 A;  2DYA A;  1W7W A;  2HVE A;  3PJ9 A;  3BH6 B;  1B4S A;  3WX8 A;  3BBB A;  3FCW A;  4DI6 A;  4W98 A;  1NSK L;  1NDL A;  1UCN A;  4ENO A;  5CAB A;  1NPK A;  4FKX A;  4EK2 A;  1NDK A;  1U8W A;  4UOF A;  3JS9 A;  3FBF A;  1NDC A;  2CWK A;  3NGS A;  3VVU A;  1KDN A;  4F4A A;  3EE3 A;  1PKU A;  3VGT A;  1LEO A;  3GP9 A;  3ETM A;  3Q8Y A;  4CP5 A;  1MN9 A;  3EVM A;  4UOG A;  3VGV A;  2BX6 A;  3EMT A;  3ENA A;  3EJM A;  1PAE X;  1K44 A;  4HR2 A;  2HUR A;  3VGU A;  4F36 A;  2DY9 A;  4DUT A;  1BUX A;  3FC9 A;  1HIY A;  1LWX A;  1WKL A;  3BH7 B;  1EHW A;  4ANE A;  5IOL A;  1XQI A;  3FBE A;  3NGU A;  1S59 A;  3B6B A;  3PRV A;  1MN7 A;  1S5Z A;  5C7P A;  3FBB A;  2BEF A;  4UOH A;  1F6T A;  1NUE A;  3Q8U A;  3ELH A;  4FKY A;  3GPA A;  4AND A;  3ZTP A;  3DDI A;  1S57 A;  3Q8V A;  2DXD A;  2HVD A;  4DZ6 A;  5CAA A;  1NSP A;  1B99 A;  3G2X A;  3B54 A;  3DKD A;  2DXF A;  1NB2 A;  3BBF A;  3Q89 A;  3NGT A;  1WKJ A;  3EVW A;  3Q86 A;  3R9L A;  3FCV A;  1F3F A;  1VYA A;  1NLK L;  3EM1 A;  3Q83 A;  2B8P A;  2ZUA A; 
#chains in the Genus database with same CATH topology
 1AXQ A;  3IG1 A;  6FD1 A;  1ZPV A;  4RNN A;  1WOO A;  4DSJ A;  3MEG A;  3R5B A;  4NE9 C;  1KHW A;  2W4C A;  1KLN A;  1ZAW A;  3FDS A;  1FDA A;  4B9L A;  2DIS A;  1FXL A;  4X66 F;  3WX8 A;  4JI6 J;  2VPX B;  2CPI A;  2JEJ A;  1EAY C;  5JXS A;  1AFJ A;  1PIL A;  2CQH A;  2LA4 A;  3IS9 B;  2QLF B;  4WK1 A;  4RW7 B;  3KFW X;  2BOA A;  4GRS A;  1XMQ J;  4F36 A;  3EXC X;  1QE1 A;  1XEZ A;  4O3O A;  2RJZ A;  4OZ3 A;  4K2J A;  2UV8 G;  2LQ9 A;  2ZBR A;  2UUC J;  3OUY A;  1TL1 A;  2AX0 A;  3IC1 A;  1IM4 A;  2WVD A;  2CQD A;  3DOK B;  9ATC B;  3ILI A;  4DL2 A;  4UTG A;  3PYE A;  2UXD F;  4K4T A;  2ZDO A;  2AX1 A;  1YRU A;  2V94 A;  3OJS A;  4HT7 A;  2PDA A;  1QAI A;  1ZTW A;  5F41 A;  2HHQ A;  2A10 A;  2BV3 A;  1L3K A;  2JVR A;  1V6H A;  4WU2 A;  4BBY A;  1DZ5 A;  4CTA B;  3KHG A;  3G8S A;  3I9V 9;  1F5B A;  1YX2 A;  2WW8 A;  4RWX A;  2N7Y A;  1X0P A;  1B64 A;  4EYI B;  3MPD A;  1NDP A;  2XMT A;  3J7Y I;  3BBC A;  2N82 B;  5IZH A;  3BGU A;  2MZR A;  5GMD A;  4OV1 A;  3QQC D;  3SFU A;  4DF4 A;  1NDL A;  2BQ3 A;  1DHM A;  3CUL A;  4CH1 A;  4C98 A;  5B0C A;  1T94 A;  5G0R A;  2YWE A;  3FVY A;  4NZ0 A;  2HFO A;  4JYA J;  3KG1 A;  3I82 A;  1PYS B;  3MEC B;  2DRB A;  4H4M A;  3DM2 B;  4NZ6 A;  5EHH A;  3RU0 A;  1LOU A;  3NXZ A;  1KS2 A;  1R6Y A;  1GXL A;  2BBE A;  2EI5 A;  1OJ4 A;  2K1R A;  4WYW A;  2MMY A;  3D1Q A;  3MD1 A;  4A46 A;  4RW6 A;  4XDD A;  5KFF A;  1X5S A;  2L3M A;  1LXN A;  5AE2 A;  3SSS A;  5B0E A;  4M5L A;  4AL7 A;  2DNH A;  1R3N A;  1H2V Z;  3MDF A;  5L1K A;  3THP A;  2HQ3 A;  5EX0 A;  3V4M A;  1ZA2 B;  1EQ0 A;  1VRU B;  1FFS B;  1VRT B;  3TUP A;  2Y1L B;  3KG0 A;  1VLY A;  2V8D A;  1RI7 A;  5J2M B;  2V2Q A;  1NK9 A;  4NLO A;  4LRB A;  2KL8 A;  1VQ5 S;  2O67 A;  3FSI A;  2BAC A;  3CUN A;  1HKA A;  2ADC A;  1FEH A;  1AT1 B;  4NLD A;  3TVY A;  2W9C A;  3QWP A;  2BJD A;  2AW0 A;  1NK0 A;  1SL0 A;  3JSR A;  3DFE A;  1D8Y A;  3SYZ A;  1IKV B;  1J5O B;  4DUZ J;  3M2V A;  5KT3 A;  3CIZ A;  3D6M B;  3HT0 A;  5HRO A;  1SKR A;  2HQD A;  3KK3 A;  2JC0 A;  2HS3 A;  4TY8 B;  4WKR A;  3L7O A;  4LRA A;  4KGZ B;  2LP4 A;  3MPW A;  5L9X A;  1FWP A;  3DOM A;  4B02 A;  2M8D B;  5D6G A;  4QPX A;  3R8Y A;  4M5N A;  2IC3 A;  4PG6 A;  4LF8 J;  3HF5 A;  2X1A A;  1YG0 A;  1YJW S;  4RUH A;  3ILO A;  1O5J A;  2M9K A;  3VAI A;  1XMO J;  1SIW B;  2N4C A;  2KM8 C;  1LWF B;  1HNV A;  3FKB A;  1S49 A;  3C3L A;  4USV A;  2OGU A;  2YQ0 A;  4LF5 J;  1FES A;  3GFY A;  4DV0 J;  4O3Q A;  2BW7 A;  2OML A;  3E01 A;  4AL6 A;  2RS8 A;  4IUF A;  2Y9H A;  2GAH C;  3JQK A;  5HSP A;  2J6S A;  2MPU A;  4IO1 A;  4DR4 J;  4DQQ A;  2DIT A;  1SJ4 P;  3GFH A;  4JP8 A;  2I9S A;  2BKN A;  2QFJ A;  1HD0 A;  2HVI A;  4HKQ A;  1VQS A;  4RW9 B;  2J0W A;  4JI0 J;  1FK9 A;  4K4X A;  1IR0 A;  2C42 A;  3MGJ A;  5A2Q U;  1U1M A;  1UET A;  2ACM A;  1QSS A;  2DNG A;  5J2N B;  3IWL A;  3SCL E;  1UTA A;  3IG1 B;  1Y9O A;  3DOL A;  3I5A A;  4YP3 A;  1SH3 A;  1B0V A;  4P7T A;  2X1F A;  2DH7 A;  4NCG A;  1XBW A;  2M0G B;  3MEG B;  4JV5 J;  4PKD B;  3CDW A;  4ZVT B;  2HRY A;  1UFL A;  2CQG A;  1HNX J;  4ED7 A;  4D3G A;  1UWA A;  1FNX H;  1BHN A;  4PYA A;  2CJX B;  1QE1 B;  4NZ7 A;  2HS0 A;  1GXT A;  1NPK A;  4WIQ A;  1YTY A;  5KG6 A;  2W4P A;  4KGV B;  4RWW A;  3OUY B;  3ILL A;  4DFP A;  4R0E A;  1TL1 B;  4B3O A;  3TVZ A;  2KT2 A;  6AT1 B;  2MTL A;  3W8P A;  2QLW A;  4DV5 J;  3RAX A;  3LGN A;  5FLX U;  3TA0 A;  3QZ7 A;  5A0Y A;  1CJT B;  4DSF A;  3IBF B;  2KFY A;  3L4B C;  1J5E F;  1UAW A;  4TN2 A;  4QWB A;  5GMK a;  1FKO A;  3VAK A;  1T9Y A;  1HW9 A;  2IBO A;  1GEH A;  3FQL A;  4NOH A;  1IBL F;  4WCE Q;  3CJT A;  5DS7 A;  1IQT A;  3AFG A;  3Q0A A;  4KRW A;  3Q8Q B;  2QIF A;  1X7V A;  5G0R B;  3M6X A;  4C2M A;  3A13 A;  3NNH A;  2EPI A;  4DSE A;  4KGK A;  1F9F A;  4OZ0 A;  4DV6 F;  4H4M B;  3O6Q A;  1TK8 A;  1CC8 A;  4X64 F;  2I5J A;  3I9Z A;  3OFE A;  5B0A A;  2UXC J;  1O8B A;  2QMX A;  2DGV A;  1XK8 A;  3UDE A;  4YDX A;  2DD8 S;  4C48 A;  3MOZ A;  3M30 A;  3CMA S;  5DDQ C;  3CW2 C;  3T5H A;  1VIX A;  3ZZZ A;  3F44 A;  2YPY A;  3AB4 B;  2LQJ A;  4JI5 J;  1OPI A;  4C0H A;  3EPG A;  2HVD A;  5C2G A;  2WVF A;  3TR5 A;  1TKT A;  1UA0 A;  4NX9 A;  2KG1 A;  4XO0 A;  5CQG A;  1S1T A;  4LF1 A;  3KLG A;  4WFN Q;  1NAQ A;  2IHR 1;  3OTD A;  2QE5 A;  2BJE A;  3PJX A;  2QT7 A;  5H9E J;  2NZ4 A;  2W9C B;  1B0T A;  3PZP A;  2J0X A;  2JEF A;  3H20 A;  1OMS A;  5EWG A;  3ZTO A;  3BSC A;  5HN0 A;  5GAD U;  4BDP A;  2QZ8 A;  3NP5 A;  4ID8 A;  4MKA A;  1U0H B;  3M2V B;  4ICL A;  1IWG A;  3D6F B;  3VVU A;  5KFJ A;  5HRO B;  1FO1 A;  2YVS A;  1CJK B;  3KK3 B;  2PD1 A;  4KTQ A;  2YQ1 A;  2XMK A;  2HGN A;  2FLO A;  3NMR A;  2V2K A;  3EXY A;  1F60 B;  1HIY A;  1RT4 A;  3DOM B;  2BQU A;  1B7F A;  3ICL A;  3KUH A;  1JB0 C;  5CYQ A;  2FUG 9;  2XLI A;  1JWW A;  2V4Q A;  3OVS A;  1I3O B;  1HNV B;  4LBP A;  2EXU A;  1RKI A;  4LFC J;  2V67 A;  4OYO A;  4Y3C A;  3P45 B;  2GMH A;  5KFY A;  2DH9 A;  3E01 B;  2ZKU A;  2KVQ E;  4ID5 A;  2V68 A;  2BYC A;  2XNQ A;  3CIM A;  3VVT A;  2CVE A;  3LOU A;  4RX6 A;  2GQQ A;  4N5S A;  2JHE A;  5EDW A;  3BPS P;  3I56 S;  3CJK A;  3GTY X;  1SV5 A;  1FK9 B;  3RTV A;  4J7C A;  2EG2 A;  3EPI A;  1RT2 B;  1TFW A;  1KC8 T;  3EE3 A;  1HBN B;  2AYE A;  3C66 A;  1U45 A;  2D3O 1;  4ED6 A;  3DOL B;  4O3N A;  5AJ3 F;  4U7U D;  5GVQ A;  3TJ9 A;  1UVL A;  4OYZ A;  1S77 D;  2QV6 A;  3HVT A;  1I5O B;  4ED4 A;  4AT1 B;  4OJ3 A;  2A18 A;  1NM2 A;  4LF9 F;  3IRW P;  2W7P A;  2H5J B;  2Y1J A;  4LFB J;  3BS9 A;  4LF7 J;  2ZH7 A;  1QLN A;  4Y00 A;  3H2L A;  1S0M A;  4N8O A;  4B3T J;  3JXO A;  1SQF A;  1WF0 A;  4K5S A;  3C6T B;  4LQ3 A;  1JLG A;  3KXD A;  1LW0 A;  4IOC Q;  2CPF A;  4KHP J;  3Q2T C;  3WIV A;  3NGK A;  4B3O B;  3ISN D;  1AA1 B;  5C5J A;  4UST A;  4WZQ A;  1EB0 A;  2J0Q D;  2B43 A;  2AEF A;  5A0Y B;  3NAH A;  1U48 A;  5ETQ A;  2RRA A;  2IVM A;  2AYG A;  3BQ1 A;  5IT9 Y;  2QGF B;  4UY8 5;  2YPZ A;  3LP2 A;  1FKO B;  4WP3 A;  4JOU A;  2N7C A;  1FER A;  5B0F A;  2EG1 A;  1FA0 A;  4KGX B;  1D9F A;  3KUG A;  4ETX A;  1U6B A;  1F6T A;  3DI6 A;  1RTD B;  2KFN A;  1QTM A;  3FRY A;  1IR2 A;  2VBY A;  2HYI B;  2ZVS A;  2OFH X;  2V8P A;  2XY5 A;  3DLL Q;  5LMN J;  3LAM A;  2I5J B;  5A76 A;  4DUY J;  2SXL A;  1ZPW X;  1YJR A;  2BJ9 A;  3BGO P;  4F3O A;  2AJ4 A;  1UMJ A;  4U7U K;  1KNZ A;  4UY8 T;  3W1Y C;  5AXM A;  2ZD1 B;  2ILZ A;  2B7C B;  2VH7 A;  2YWH A;  2D3U A;  3M30 B;  1HQU A;  2K3K A;  3CJ4 A;  4RNF A;  1SI9 A;  2C2Z B;  2KT5 A;  4F25 A;  3NRB A;  5F9L A;  1NJZ A;  2AJF E;  5HO4 A;  2VAS A;  5DO2 A;  4L6V 3;  3DRY A;  2JRS A;  2W2O P;  2C28 A;  1TKT B;  2B9Y A;  1NO8 A;  1G3O A;  1S1T B;  3AY0 A;  2A6M A;  3NGU A;  4N77 A;  2UU9 J;  1T9T A;  4B9T A;  1NND A;  2MHE A;  4ZCM A;  2JC1 A;  1UJ6 A;  4KT0 C;  2DEI A;  4C8K A;  1QUP A;  2ZWP A;  1TL7 A;  4WFA Q;  1RGV A;  2FIU A;  2CZV C;  5GAG I;  3P5T L;  2W7A A;  4NLU A;  1MMN A;  2DEJ A;  4ICL B;  1KQG B;  2C2N A;  3AHP A;  3RGI A;  1ROF A;  3U1M A;  2MKJ A;  1JLQ A;  1VQN S;  1CJV A;  2FLP A;  1KN6 A;  4DV7 F;  2WON B;  2HND A;  2GHP A;  1RTI A;  1RT4 B;  1IR1 A;  3BQ2 A;  5EWE A;  3CCL S;  3NWR A;  1JLF A;  1C0T B;  1RHU B;  5CYQ B;  2GA7 A;  1SJR A;  5D0G A;  3QJP A;  1MN9 A;  1N34 J;  3PIP Q;  5CYM A;  1LWE B;  3QZ8 A;  1RYS A;  3HMJ G;  2N3L A;  1RTH A;  4M1K A;  4CO4 A;  1SL2 A;  2FVC A;  2HBR B;  3DMJ A;  2VBW A;  4B17 A;  2GGP A;  2CQI A;  4JI4 J;  4ID5 B;  2EVZ A;  1HD1 A;  4LF6 J;  3Q8V A;  4A47 A;  4KH0 B;  1XNR F;  4CT9 A;  3D28 A;  5FDL B;  3R6L B;  3C2P A;  2FHO B;  2OMO A;  3A8K A;  3CJK B;  4P71 A;  2KO1 A;  3ZZU A;  5B08 A;  3PW2 A;  3TJ8 A;  1SV5 B;  3DLG B;  3FZB A;  5HQ8 A;  1T11 A;  1F5A A;  1GMW D;  2GIR A;  2RQ4 A;  4LRD A;  5LXY A;  5DQI A;  2R7U A;  2UUB F;  3MCM A;  5D4O A;  3M9M B;  2PMH A;  2P9G A;  1V3Z A;  5FII A;  5GAD I;  2DH8 A;  1HBU A;  4TU7 A;  4P2M A;  4AXI A;  3HVT B;  3CME S;  3OHB A;  4NAS A;  4TYA A;  4X4Q A;  8ATC B;  4YY3 J;  2BE7 D;  3MEK A;  3Q8Y A;  5I4M A;  4Q43 A;  1GMW A;  2AWZ A;  1LXJ A;  2BX6 A;  2XWY A;  1WTF A;  1RHK B;  4WTO B;  1FKA F;  2IRY A;  4JB8 B;  3C19 A;  2ALY B;  1M5O C;  1JX4 A;  3PKY A;  3GZ7 A;  3V6D B;  3A3P B;  5JMN A;  4RUA A;  3B54 A;  4Y6I A;  2AF6 A;  1YSJ A;  5BYS A;  2K7K A;  2CIM A;  3DRR A;  1Q7Y T;  1VQL S;  4OX8 A;  4DOZ A;  2JX2 A;  3UD4 P;  2K3I A;  1IKW A;  1A0O B;  2V8V A;  4IRD A;  2NXU A;  2DR8 A;  1KWM A;  2DY1 A;  4F0H A;  1RBL A;  2FGC A;  2HS4 A;  1N33 J;  1TKZ A;  1S6U A;  4C6A A;  3M6V A;  3KLV A;  3D1H A;  1FRI A;  3BZQ A;  2ZH6 A;  2XLJ A;  3LP2 B;  5GAE U;  4UQT A;  4EUV A;  1HNZ F;  2AGP A;  4DR1 F;  2NSB A;  1R0B G;  2R4F A;  3MMJ A;  4EI2 A;  3NL0 A;  3DI6 B;  1SC1 B;  4NEZ A;  1JJC B;  2QLB B;  2H4W B;  2HFV A;  3EGZ A;  3FC9 A;  4P2X A;  3IWN C;  1T3O A;  3HSZ A;  1FNM A;  3PFE A;  3PIO Q;  5ITH A;  2MY8 A;  3C46 A;  3M7V A;  4DZ6 A;  2VPZ B;  5CYJ A;  4X62 J;  4QBU A;  3IO1 A;  4PAA A;  1YBU A;  2J9D E;  4K5R A;  1NHU A;  1HQU B;  4Y0F A;  2V0N A;  2D9O A;  1FRX A;  1R8B A;  1JMT A;  1A6L A;  3R7B B;  3B4M A;  1N32 J;  3TAM A;  2FPH X;  2UUA J;  4ZP7 A;  1OSC A;  2AEJ A;  2IRX A;  2CQ3 A;  4DV2 J;  3VAF A;  1L3U A;  2CQ0 A;  1RJJ A;  4NLG A;  1BWE A;  3UQS A;  2FLL A;  2QLX A;  5IFM A;  1D9A A;  3IRX A;  2FVS A;  3MHY A;  3T3F A;  3CJ3 A;  4K8R A;  4QPT A;  3ET6 B;  4UOF A;  3R5G A;  3VF0 B;  2G0J A;  2VG7 A;  4YB1 P;  4KY3 A;  2Q6C A;  1VQ9 S;  3R5J B;  3BKT A;  1GAO A;  1T05 A;  4DPT A;  3IGV A;  3BPD A;  1SQE A;  5M2R A;  1ZM2 A;  2LA6 A;  1TL7 B;  4ED2 A;  1DTT A;  4YHH F;  3UCZ P;  2CKW A;  5HP1 A;  4ZKA A;  4USW A;  1N5Q A;  3TAR A;  3R5D A;  1WI8 A;  4RNO A;  4LR7 A;  1BXN A;  3MPV A;  4M5H A;  5IS2 A;  2XCP A;  3KHH A;  3SCJ E;  4F2S A;  5LMU F;  1OO0 B;  3Q89 A;  1GFW B;  1JLQ B;  1IBM F;  3BR8 A;  3NCQ A;  2IA6 A;  3N6N A;  3BYR A;  3A4T A;  1NLK L;  1YRX A;  3IM9 A;  2W9B A;  1MU2 A;  5A8R A;  2HND B;  1RTI B;  1S76 D;  1PBU A;  2F63 A;  1F2H A;  1N56 A;  3P8B B;  3T5L A;  5CYM B;  1N6Q A;  1RTH B;  3J7Z 5;  4MH8 A;  2PFD A;  2VIC A;  3MOJ B;  3A12 A;  2GGP B;  1LFP A;  1UJ4 A;  1RE1 B;  3W5X A;  2BJ1 A;  1FEE A;  2XM3 A;  3CO0 P;  3OTO F;  2CYY A;  1KHV A;  1S1X B;  2HEK A;  1NKB A;  1M5S A;  4DFM A;  3PRB A;  2KT3 A;  5AT1 B;  4EBD A;  1RQ0 A;  5DM6 Q;  3HFK A;  1Q7L B;  4PXE A;  1U24 A;  3OPK A;  5ETP A;  2ZIT A;  4PG5 A;  4FYV B;  3D67 A;  1KSP A;  7FD1 A;  2OO4 A;  2MKC A;  3CED A;  2VIH A;  2P6S A;  2JSX A;  2YX4 A;  4QIE A;  3UW1 A;  5BJR A;  3J7Z T;  2M4M A;  2YX1 A;  4ZPV R;  2VOD A;  4YB7 A;  1SPB P;  2XYH B;  1HBU B;  4NXM F;  2HHV A;  3IA0 A;  4DL5 A;  4YR3 A;  5SUH A;  1RHR B;  4B3M F;  3PM9 A;  1NH8 A;  2K7J A;  2OTL S;  3OL8 A;  1K8A T;  2ZJR Q;  2GVD A;  2KN4 A;  1H73 A;  1RAH B;  3DLH A;  2WSC C;  3M2U A;  1KKH A;  5J1E A;  2POK A;  2RT3 A;  3RR7 A;  4ZP8 A;  3BBB A;  4L76 A;  4ZVE A;  2BA9 A;  3HHD A;  1RT5 B;  1KTQ A;  4CO3 A;  4R25 A;  3M6U A;  4OJ1 A;  4FF1 A;  3BQ0 A;  4ZVU B;  1G4C A;  5DQG A;  2B4U A;  4RLE A;  4ECZ A;  4Z37 A;  4FVC A;  3VWS A;  2P9E A;  2ZHB A;  1IBK J;  3E51 A;  5K9F A;  3F56 A;  1QVF R;  1RP5 A;  4DR2 J;  4AUK A;  3MMB A;  1RSC A;  3DRR B;  3MUR P;  2E66 A;  1F9H A;  3VR1 A;  5LXR A;  1A7G E;  1IKW B;  4JI6 F;  1Y5L B;  2I8E A;  3DNC A;  4LBH A;  1S57 A;  1KLM A;  2YY3 A;  2XMM A;  4ECW A;  3TZY A;  3D1O A;  1ZM3 A;  1TKZ B;  2V6A A;  4QR1 A;  1Y10 A;  1XMQ F;  2JFD A;  1SQG A;  4WFY A;  2HLU A;  3FQK A;  1TUV A;  3PW4 A;  2E5G A;  3TAQ A;  3GV5 B;  2UUC F;  2J8A A;  2B7B B;  4NL5 A;  1WF1 A;  3FBC A;  3CB4 A;  4IRC A;  1TMM A;  5C42 B;  4QW8 A;  1WC0 A;  3BO2 A;  3GYG A;  5IT9 U;  2R7S A;  3IAM 9;  1QUV A;  1S72 S;  4ZN1 A;  1KDN A;  4J9S A;  1RLD A;  4CLZ A;  1V5I B;  2YWK A;  4QQB A;  3EVM A;  4DMZ A;  3MR3 A;  3UDC A;  3QYY A;  3T1A A;  3IN5 A;  3OSN A;  1TK0 A;  1RYR A;  3OW2 R;  3C15 A;  2F3J A;  1YJT A;  1VQ6 S;  1PAU B;  3ONQ A;  1QJH A;  3JSY A;  2QJ3 A;  3TAM B;  4QWC A;  5EGY A;  2EKY A;  2DCL A;  5KFK A;  1VQ8 S;  1WC6 A;  3NGD A;  2XMW A;  1YIJ S;  4JYA F;  4FNI A;  2Z56 B;  1EAR A;  1PO6 A;  4KKO A;  2CQ4 A;  2W2P P;  1R7I A;  1SJF A;  3MCS A;  2ZH4 A;  1S4E A;  1S99 A;  1SJ3 P;  2FB0 A;  3LP1 A;  1LK7 A;  2VG7 B;  1P1T A;  2VBX A;  2BXJ A;  4PR6 A;  2V8H A;  5E7O B;  5D3G A;  1T05 B;  4OZ5 A;  3KG4 A;  5GME A;  1Y00 A;  2DCU B;  1SKU B;  2RD5 C;  5GAE I;  2QMW A;  4C8O A;  3JS9 A;  4X65 F;  1DTT B;  2FJD B;  5I42 A;  1U1O A;  3NS6 A;  4GKK J;  2PMW A;  5HP1 B;  1R8A A;  2LU1 A;  4CNZ A;  4JI2 J;  1C0U A;  4ER8 A;  2F8E X;  2M70 A;  3BM7 A;  1WDT A;  3T41 A;  3QO9 B;  2IY5 B;  2ZBP A;  1BGX T;  2NPI A;  2CDR B;  4NXN J;  4FXD A;  2W9B B;  4F67 A;  3QPI A;  4LIW A;  5A8W A;  4MIA A;  2VL1 A;  4BS2 A;  1DAR A;  3PR4 A;  2C2K B;  3OR1 A;  1XNQ J;  1N6Q B;  4FS1 A;  4DUZ F;  2J7U A;  1XR5 A;  3UVJ A;  3C16 A;  4KO0 A;  5KG3 A;  3RAQ A;  1HQE A;  4DU8 A;  3T9Z A;  3LGH A;  5DLF A;  2ACY A;  3W2W B;  2M2B A;  1XR6 A;  4A8M P;  2XO6 A;  2OPQ A;  2V4J A;  3V81 A;  2AP6 A;  2OD4 A;  4A8Q A;  4FKX A;  4LF8 F;  5ETL A;  4X4U A;  4FF4 A;  2Q79 A;  3NG8 A;  3Q24 A;  2WB1 D;  2VD3 A;  1XMO F;  2YXL A;  4OHZ A;  3UDV A;  2D41 A;  3EJM A;  3VAM A;  4LF5 F;  3VAL A;  2ZOM A;  4DV0 F;  1OQ3 A;  1Q79 A;  2PFF B;  4Z7Y A;  3MCN A;  1N48 A;  2F1F A;  1YWX A;  4I6A A;  1UFK A;  1W2B R;  5E3P A;  4NA3 A;  4PXC A;  2IJN A;  4DR4 F;  2M7S A;  2OIH A;  1NSP A;  3MEE A;  4OI3 A;  3KUE A;  2DNM A;  2FD2 A;  5IQQ A;  1LK5 A;  1WSV A;  4C8Z A;  2IDL A;  4ILM A;  2DNZ A;  1N5T A;  2ZZM A;  3M2U B;  3VZH A;  4JI0 F;  5J1E B;  4RW4 A;  2MQQ A;  4QWE A;  4OX6 A;  1JXV A;  2OSR A;  2VU5 A;  4TY9 A;  2RU9 A;  4RNH A;  4HI2 A;  2MKK A;  4NI2 B;  4CM0 A;  4TLR A;  3I55 S;  3DLJ A;  2J6T A;  3MUV P;  1H7W A;  5KFG A;  1ARO P;  1NK5 A;  2CNO B;  3DGV A;  4JV5 F;  2VJU A;  3MMB B;  1S10 A;  2ZH2 A;  1VQO S;  3K0J A;  1QVG R;  2BOP A;  1NSA A;  3EMT A;  3TX0 A;  1HI0 P;  1HNX F;  1KLM B;  1K44 A;  4WPA A;  2FC9 A;  1VIS A;  2D7S A;  3A3O B;  2RKI A;  5CD4 H;  1WOP A;  3RR8 A;  4W92 B;  3HHL D;  1FF2 A;  2V9K A;  4PWW A;  1UFW A;  1KQF B;  3EZ5 A;  3PFO A;  3AXK A;  4QJV A;  3G96 A;  3OXL A;  4U96 A;  4C0B A;  3JQM A;  3ULH A;  2E5L J;  4KJI A;  3G2X A;  4NLW A;  5H9F J;  2DNR A;  4F50 A;  3RBX A;  3VHQ A;  4ATN A;  4NRT A;  2J6U A;  4P2F A;  1SJQ A;  3HHL A;  1TMJ A;  2OKQ A;  4DV5 F;  5G4D A;  5IWA J;  4ED0 A;  1RAJ A;  3MCO A;  4USU A;  4IDK A;  1OPZ A;  2Y0S D;  2DO4 A;  2EFP A;  4Y34 A;  2CQ1 A;  2UVR A;  4L72 B;  5LOQ A;  2EW9 A;  4PXD A;  2C22 A;  1NRK A;  4KYZ A;  1Q16 B;  5CAB A;  4PRF A;  3AQP A;  1CVJ A;  2G9O A;  3ZNJ 1;  2DNN A;  3PX4 A;  2P8I A;  1L3V A;  4I7F A;  1T9X A;  3RBD A;  3DLB A;  4UZC A;  4DV3 J;  2IM2 A;  4QR0 A;  4DUT A;  1FD8 A;  4AXJ A;  4GKJ J;  2EFQ A;  2XWX A;  2BRK A;  5B0G A;  1V3S A;  2H65 B;  4ETZ A;  1U26 A;  1HMV A;  4LR8 A;  2ZFH A;  2HKE A;  2UXC F;  2MSS A;  4N76 A;  2Z58 B;  5E0O A;  1MWZ A;  4O23 A;  1UPM B;  3LP1 B;  2CJY B;  1EKR A;  4ZCK A;  2XI2 A;  1EZZ B;  2PE8 A;  1RIS A;  2J7K A;  3M2R A;  3TW0 A;  1X5P A;  3ZO7 A;  4OZJ A;  1RTJ A;  3Q8P B;  4ECV A;  1KR4 A;  4PCQ A;  2IVY A;  3HZE A;  3GQC A;  4E8U A;  5I42 B;  2ZHA A;  3ZFV A;  1XWL A;  4JI5 F;  1Q8K A;  5HBM A;  1S6P A;  3GIM A;  3HKZ D;  1C0U B;  5LSL A;  3GJS B;  5E5N A;  1LWC B;  2ZH1 A;  2ZUG A;  5C25 B;  2X7I A;  1IQZ A;  5A8W B;  4DL3 A;  3M8R A;  1SH0 A;  4ZIW A;  1IXK A;  4UUW A;  2MST A;  1HBO B;  3OR1 B;  1KTV A;  1T3N A;  2BR0 A;  1U25 A;  3DRX A;  2ZH9 A;  4ZVH A;  1VMB A;  3NOG A;  3UVJ B;  2HBQ B;  3IM8 A;  4KO0 B;  1PJ6 A;  5IM0 B;  2HLT A;  2YH1 A;  4ZLJ A;  3EGN A;  2XGQ A;  4DPY A;  5KFH A;  2B9X A;  4DN0 A;  4DCP B;  4H4O B;  1T95 A;  3H5S A;  2HWH A;  3TEG A;  1U6F A;  1FVQ A;  2BRL A;  2V4J B;  5HMX A;  1RWV B;  3V81 B;  1X4D A;  3NGR A;  5L8R C;  4RU9 A;  5DJB A;  1UZH A;  1KOO A;  4O0N A;  4NWB A;  1X31 C;  4I6W A;  5DDO C;  3PXG a;  4HAC A;  1WHY A;  4LFC F;  3D6H B;  3GG0 A;  4A8O A;  3FCW A;  5AE1 A;  1S9F A;  2NUH A;  1U1N A;  1S97 A;  2HK3 A;  2I2Y A;  3WDO A;  3PYG A;  2EFN A;  2G0C A;  1TR0 A;  2NSC A;  2PO4 A;  1T9V A;  1TV6 A;  4J37 A;  3ENA A;  3MEE B;  3BKF A;  1VC5 A;  3I87 A;  1S6Q A;  1R8C A;  3KLF A;  4RR5 A;  3KLH A;  2AT1 B;  3CJ2 A;  3IR6 B;  2JLG A;  3K58 A;  5HMW A;  3JYT A;  1VQK S;  2CPJ A;  7AT1 B;  4OX7 A;  3OBI A;  4Z7C A;  1FVS A;  4NLQ A;  2EK1 A;  3BO4 A;  3TWZ A;  1PC4 A;  3HDS A;  4RBU A;  1FT8 A;  4OJG A;  3N6M A;  1R8H A;  5D4N A;  1RBO B;  1SIZ A;  4X84 A;  2CJB A;  3TVK A;  2DHH A;  2E1M C;  2HAF A;  4X4V A;  4LFB F;  2LKZ A;  3M4X A;  1RAI B;  1U2C A;  4TU8 A;  2L9N A;  4CLF A;  4LF7 F;  2XSJ B;  3CNQ P;  3PX0 A;  2OD6 A;  2RKI B;  2FJA B;  2DJW A;  4B3T F;  3P5B P;  4AE5 A;  3PV8 A;  1VHI A;  4CYU A;  4F4A A;  1OS5 A;  1CQM A;  3D5M A;  3GP9 A;  2B56 A;  4ZVP B;  5KFW A;  2HHP A;  4F4Y A;  2ZZN A;  1WI6 A;  4DFJ A;  2DGS A;  1VQM S;  2WOM A;  2HSE B;  4KHP F;  5H9F K;  5FD1 A;  3OLA A;  2VDH A;  4CO0 A;  4P74 A;  4CM2 A;  2MEW A;  4FS2 A;  3HHL B;  3PVX A;  3GV7 B;  2F65 A;  2A3J A;  1Q8B A;  3T1H J;  4BC9 A;  4IDK B;  4IR9 A;  3CJQ A;  4K4Z A;  2VKZ G;  1H98 A;  1Z1Z A;  4HHU A;  3CCW A;  1YZ7 A;  4PQU B;  5KT5 A;  3VV2 B;  1YJN S;  4IRK A;  1HWJ A;  4FXW A;  3PNI A;  1URR A;  4QU6 A;  3SEO A;  2APO A;  1MWY A;  2J7W A;  3LP0 B;  3ZC4 A;  3RJM B;  4I7F B;  3BGR A;  1FX2 A;  2OAU A;  1RK8 A;  2VHG A;  4E2F B;  2QA4 S;  5KAK A;  2RIL A;  3KWM A;  2R42 A;  3QID A;  1VGY A;  3PCO B;  2E29 A;  5LMN F;  1IKX A;  2HMI A;  1RKJ A;  4C8M A;  1HMV B;  3DU5 A;  4DUY F;  8RUC A;  4MK7 A;  3MEC A;  4RBV A;  3DYA A;  1DQ8 A;  2CXE A;  4OLP A;  2GAG C;  1K0T A;  3RRH A;  3G9C A;  1YGY A;  3M2R B;  4DU7 A;  4DN9 A;  1S5Z A;  4M63 A;  2MQO A;  4WU3 A;  1P9Y A;  3M9O B;  3QWU A;  3LTO A;  4HTI A;  1RTJ B;  3G82 A;  3AD8 C;  2XYG B;  1NB7 A;  3R7N B;  2XC9 A;  3HVR A;  3UPF A;  3N79 A;  4K4U A;  1C1C B;  3A8I A;  2XCA A;  4L73 A;  5HBM B;  3EDR B;  2W2N P;  1XTZ A;  1VRU A;  2I0X A;  2YNH A;  5K5M A;  5ETR A;  5A8K B;  2RRN A;  1RCO B;  4PPD A;  2XQC A;  4QIF A;  4M95 A;  3D3B J;  5J2M A;  2UU9 F;  3GG1 A;  2KDO A;  3GFZ A;  2FY8 A;  2NYH A;  1NK4 A;  4HLB A;  1HHT P;  2VG6 A;  4UZB A;  1FWL A;  3MZI A;  1ZOT A;  4QWA A;  2Z30 B;  3EZU A;  2YKP A;  3W66 A;  4ED3 A;  1BD6 A;  4B3S J;  3ETM A;  3PO4 A;  5DRK A;  4X2B A;  1PC5 A;  2JJ4 D;  1FRH A;  4JI1 J;  1IKV A;  1KD1 T;  1B70 B;  1IN0 A;  1T7P A;  2LEB A;  1FNO A;  3HSG A;  4P2S A;  2KXH A;  2WW4 A;  4ZDN A;  3SXL A;  4ZHR A;  4NLV A;  5IV4 A;  3MUM P;  5KFD A;  3L3C A;  1M5H A;  3V6H A;  1N34 F;  1WC1 A;  4O0I A;  1MLA A;  3IP0 A;  3NCP A;  3IWX A;  1X4E A;  4F7V A;  2PN6 A;  3HZG A;  3ENQ A;  3LA0 A;  3CCT A;  2H51 B;  2L48 A;  2ZKT A;  2OPP A;  1LWF A;  1RHM B;  4J9K A;  4ZPW R;  4JI4 F;  3K5M A;  1W26 A;  2ZVI A;  4NA2 A;  4LF6 F;  3GB0 A;  5CZX A;  1TV6 B;  4LSZ B;  3I0S A;  1BC6 A;  2E9R X;  1K47 A;  3DXB A;  3SI8 A;  4Q44 A;  1S6Q B;  4TKT A;  4F4W A;  2FZK B;  3KLF B;  2Y1R I;  2F8M A;  2MHN A;  2ASY A;  4F4K A;  3FMB A;  3KLH B;  1AB8 A;  2VQE J;  2O01 C;  3MPU B;  1DQA A;  1ULR A;  5ETV A;  5J2P A;  2DB1 A;  3GON A;  3VGV A;  3KMS A;  1UWB A;  1ZZN A;  1Y5N B;  2LYV A;  1HYS A;  4CLT A;  1S1W B;  2X3D A;  4DXL A;  1PCA A;  4CT8 A;  1JLA B;  1RHJ B;  2ROG A;  3F73 A;  5J2N A;  2HBZ B;  3TYT A;  4I69 A;  5CCL A;  4YY3 F;  4WP9 A;  1RA6 A;  4CNY A;  2GQC A;  4OI1 A;  4JV2 A;  3BBF A;  3IR5 B;  2O3D A;  3ADA C;  2WVE A;  1F5C A;  4DEZ A;  2IJF A;  2KB2 A;  4LMZ A;  4ZVQ B;  4M5G A;  5EN1 A;  5IV3 A;  3W9H A;  2R8G A;  3D7S B;  3P3D A;  4GVL A;  3AB2 B;  4PEO A;  2HZV A;  4CO5 A;  1YJV A;  4CYU B;  5KT4 A;  3WC2 A;  2ZC3 A;  5IT0 A;  2CG8 A;  1AW0 A;  1M5K C;  2DYA A;  2KI2 A;  2WOM B;  4A48 A;  2AQ4 A;  1L5U A;  5K20 B;  4J9O A;  1UCN A;  2Y1I A;  3N0V A;  2PMZ D;  3H8Y A;  1NDC A;  1JIH A;  4ES3 A;  2PEH A;  3I0R A;  4G1P A;  4TLQ A;  4NYP A;  3OV7 A;  1RAE B;  2G4B A;  1N33 F;  4NYO A;  2R2U A;  3PRD A;  1GMU A;  4DQR A;  2ZEJ A;  4ZVS B;  2CJK A;  3B6B A;  3FFI A;  1CJT A;  2H5I B;  4ZCI A;  3QAU A;  3HT3 A;  3I32 A;  2DPI A;  2QG9 B;  4ECR A;  3I4H X;  1DY3 A;  4XPC A;  4AYB D;  1S0V A;  1M1K T;  4N47 A;  3AOC A;  3SQG A;  5KFI A;  3BGR B;  4I64 A;  2ZZT A;  5HAN A;  4ZPC A;  5L1I A;  5K8P A;  1VK3 A;  4M8L A;  1UEV A;  5F8I A;  1CSJ A;  1IKX B;  3PHE A;  2B8Q A;  2DXE A;  2HMI B;  4YR2 A;  2NCK L;  2RHS B;  2RUG A;  2M88 A;  1IUJ A;  3JSM B;  4LBI A;  3DYA B;  4X62 F;  1U1P A;  3AA8 A;  4IH7 A;  3TEH B;  3BR9 A;  3IBW A;  4DBQ A;  1N32 F;  3PX6 A;  2DT9 A;  3G82 B;  1UKU A;  2DKO B;  2UUA F;  4BHQ A;  2XTJ P;  4FF3 A;  1YJ9 S;  4DV2 F;  1HNW J;  3VGU A;  2ILY A;  1R6V A;  2B4O A;  3AOA A;  4RW8 A;  2L9D A;  3OFH A;  2UXB J;  4FZV A;  3CF5 Q;  1H3D A;  3CPW R;  4X65 J;  4P72 A;  2YNH B;  1CS4 B;  3SCI E;  3GYX B;  4OYM A;  4DFK A;  3GII A;  3OXG A;  2YWG A;  3GSI A;  1VS3 A;  2VG5 A;  5FJ4 A;  2J76 E;  3HP6 A;  4ELV A;  3RRK A;  1RWO B;  2Y8Y A;  4NLR A;  2YNF A;  2KTQ A;  2F9D A;  3US5 A;  3V5R A;  3ZTS A;  2C3P A;  2VG6 B;  2W01 A;  2IMO A;  2DHA A;  1WJ9 A;  5K14 A;  2CPE A;  3P4U B;  1T03 A;  4NLS A;  1T0T V;  2PGC A;  2YKO A;  2MYF A;  5M2P A;  2WSF C;  3OL6 A;  3KTQ A;  1U0H A;  1U09 A;  4ES1 A;  2E44 A;  2R7W A;  4B9V A;  2IVF B;  1O6X A;  2QL5 B;  3E2E A;  1OWX A;  1CJK A;  1WHW A;  4CP5 A;  4ZHR B;  4IQX A;  2JDJ A;  3KJF B;  2XZT B;  2XS2 A;  3UFC X;  3OL7 A;  3R7S B;  5RUB A;  2CAD A;  2OPR A;  3GCX P;  1H2U X;  4DCJ B;  1JLC B;  4DJB A;  2XY6 A;  2XZW A;  4I56 A;  2GO9 A;  3ELH A;  4WYL A;  2FJW A;  1VFJ A;  2DGT A;  4CO1 A;  2OPP B;  5A6P A;  4A8W A;  3BV8 A;  3HSJ A;  3PHT A;  4X4T A;  2LQ8 A;  4K4S A;  4LJM A;  2RB7 A;  2ATC B;  2QL9 B;  4BCA A;  4K50 A;  3CMQ A;  4F3Q A;  4LR9 A;  1HWL A;  3SSR A;  1CEZ A;  3R9L A;  3JTO A;  4UQG A;  3I0S B;  2B4P A;  5DZ7 A;  4YB6 A;  1P8G A;  1HWK A;  3QJL A;  2AJ1 A;  4I6Y A;  3T9N A;  5I3U A;  3AH6 A;  3TO8 A;  4G3I A;  2DNK A;  2HZA A;  4URQ U;  1ZM4 A;  1JK9 B;  5J2P B;  2ROE A;  1MW7 A;  4ZIV A;  2B4V A;  2KRR A;  4ED5 A;  4F2R A;  1UWB B;  5L1L A;  1HYS B;  3FMW A;  1MNE A;  1FRJ A;  1NDK A;  1RT2 A;  3DDK A;  1U8S A;  2W2M P;  2K2P A;  1LEO A;  1HBN A;  3IR7 B;  2UVW A;  2ZNY A;  2W25 A;  1NEE A;  1Q8I A;  4JI7 J;  3QRQ A;  3WBZ A;  5EUH A;  4I2P A;  3BEG B;  4QR2 A;  2HHX A;  1BMQ B;  1X4A A;  2ADB A;  1QM9 A;  2AU0 A;  2V9W A;  4LF4 J;  1ACM B;  2HQF A;  4J9M A;  4U95 A;  3ITH A;  1Q8L A;  3DKD A;  3UD3 P;  3S6E A;  2AV5 A;  5L39 A;  1N4L A;  3CCE S;  3M8P A;  3D2W A;  3QMQ A;  3CCZ A;  4DX8 H;  2AKW B;  1IBK F;  1IWA A;  3M32 A;  2CA9 A;  3T6J A;  2LMI A;  5F0W A;  4DR2 F;  2IYI A;  2XS7 A;  3C6T A;  3M8W A;  4KAI A;  2OEK A;  1DTQ A;  3M9N B;  1RT6 B;  1S9E B;  4WWS A;  4U6P A;  2Y0B B;  3HD1 A;  1YQH A;  3I0R B;  4RL1 A;  2LXI A;  4HI1 A;  3RYL A;  2BMB A;  5HLF A;  2HHU A;  4WFB Q;  1ZYQ A;  3NEK A;  2VV5 A;  1QSY A;  1P6T A;  3CD6 S;  4ZVR B;  5KFT A;  3FFI B;  2PA8 D;  3G8Q A;  1M0S A;  3B8H A;  1RUS A;  2P2C B;  1FI4 A;  2CQB A;  1E6V A;  5HL7 Q;  1P27 B;  1MWQ A;  1ICE B;  1RXO B;  2IDE A;  2PC6 A;  2VQF J;  2E5I A;  4K2X A;  4OZ1 A;  1GH8 A;  1VQ7 S;  2WBM A;  4WTY A;  3OLB A;  4R5P A;  3SQG B;  3N6L A;  5GAG U;  4H54 A;  2X3G A;  1S59 A;  4DSK A;  4EEY A;  2KFZ A;  1BWV A;  2VA2 A;  1RTD A;  5C24 A;  3K89 A;  3NNA A;  5LL6 d;  4FPR A;  2KYZ A;  3NGT A;  1VOM A;  4A4J A;  2PSZ A;  1M5V C;  2MKS A;  4Y2A A;  4ED1 A;  2G13 A;  1FJG J;  4EWT A;  3L95 X;  3M1V A;  4JV0 A;  2R7Q A;  2Z0G A;  2FLN A;  4NML A;  3G87 A;  1D09 B;  1YJU A;  2V34 A;  1RU2 A;  1KRP A;  1SC6 A;  2WTF A;  4N41 A;  4M5D A;  2ZD1 A;  1XIQ A;  1JJH A;  3LUY A;  3J81 j;  1VRQ C;  3E3X A;  4RW8 B;  2H3E B;  2B5J B;  2HW3 A;  2AYM A;  3R2D J;  4B3R J;  4HDH A;  1N52 B;  1QAJ A;  5KG7 A;  4QYZ K;  2MGZ B;  3ZZR A;  4WK3 A;  3OD2 A;  4UUX A;  4DPU A;  1NHV A;  3K8V A;  3G6E S;  3KOA A;  3DLK A;  4L3N A;  4EMD A;  1P9Q C;  1R27 B;  2VG5 B;  1OSD A;  4P75 A;  5E3C A;  3TAN A;  3OVA A;  2WVC A;  5KG4 A;  1XN9 A;  3NNC A;  2YNF B;  4FYX B;  2VFR A;  2JWN A;  1RWN B;  4GKK F;  1I6J A;  2JVO A;  5K8N A;  5K14 B;  4JI2 F;  4P73 A;  4C3L A;  1T03 B;  1D0E A;  1NH7 A;  4HL9 A;  3H25 A;  2GIQ A;  1DRZ A;  1V3R A;  3KYL A;  1RWW B;  3PAC A;  2WK4 A;  2B6A A;  2EEY A;  4NXN F;  2Q3P A;  4KPY A;  2PT0 A;  3DRS B;  2V50 A;  3RG6 A;  3MR2 A;  3D68 A;  3UO0 A;  3DRP B;  5IT4 A;  1OY9 A;  5KFQ A;  2WON A;  1XNQ F;  2OPR B;  4UW2 A;  5KFU A;  2QTW A;  4JI8 J;  1C0T A;  2VFU A;  3BSN A;  1N54 B;  2MY7 A;  4NPO A;  4TU9 A;  1HQ2 A;  3PTW A;  2V5H G;  5HAT A;  3CD7 A;  1LWE A;  2M5Y A;  3R6G B;  5GAH U;  4G65 A;  1FRL A;  2GJ2 A;  3HFZ B;  3Q23 A;  1X4C A;  4KC5 A;  5KG1 A;  4KHR A;  1D8Z A;  1X9W A;  1NUE A;  4AFF A;  2AJ0 A;  3NOC A;  5I3U B;  1UVN A;  2YKQ A;  3CJR A;  1AFI A;  4Z2X A;  5FDL A;  5T41 A;  3R1L A;  2OFG X;  1WC5 A;  5BR8 J;  1N0U A;  3H5X A;  2GVZ B;  2C3U A;  4OHY A;  1Y11 A;  2B8P A;  2DIV A;  4U8Y A;  3DLG A;  2RDI A;  3ZXW A;  4KV8 A;  4PQA A;  2CNN B;  5J1N A;  1M1H A;  4Q8E A;  2MZQ A;  2HFS A;  2FVP A;  4Q7A A;  1NSK L;  4I2P B;  4ZVO B;  3VQT A;  4FDF A;  4USM A;  3KJV B;  1ZAV A;  2MZT A;  3I4P A;  2RHQ B;  2QC3 A;  1R0A B;  4QCL A;  1IJE B;  1U49 A;  3ITH B;  1TQL A;  1RWK B;  2MQN A;  1URN A;  2E7X A;  2XS5 A;  4RO0 A;  3M8P B;  3SMZ A;  1XMB A;  4XIU A;  1VBZ A;  1JKH A;  3M32 B;  1X5O A;  3O44 A;  4C8N A;  1WC3 A;  3V6D A;  1FFW B;  4CH7 A;  1DTQ B;  1DJ0 A;  1UW9 A;  1RT1 B;  4EBE A;  1FXR A;  1H6K X;  3DGP A;  3GMG A;  2LU2 A;  5LSR A;  4K59 A;  4KSE B;  5HLF B;  1VYA A;  1U2F A;  3FEX B;  3DXS X;  4OI0 A;  3BF4 A;  1EKS A;  3ZZ0 A;  2CPY A;  3ZTQ A;  2YBV A;  5CXT A;  3J80 Y;  1YBA A;  1FJ7 A;  1FTR A;  1GMV A;  2BJ7 A;  2DNP A;  3BN7 A;  5KG5 A;  2AJ2 A;  1E6V B;  2E5L F;  2CFX A;  3FEY B;  3RBZ A;  2OEL A;  3OFG A;  2HHT A;  3N01 A;  3CCQ S;  2CUY A;  1FDN A;  5KFR A;  2LXU A;  2HNZ A;  2LDY A;  3G86 A;  4R5P B;  4IH6 A;  2Q6B A;  3H4B A;  1KOH A;  1TZ0 A;  4YEA A;  5IWA F;  4XDC A;  2C2O B;  2XG8 A;  5D4P A;  3RB0 A;  1NZ8 A;  1S1U A;  1HL6 A;  1JLE A;  1YJ7 A;  3JQJ A;  5C24 B;  1OYE A;  5E2Q A;  2ZH3 A;  1REG X;  2OEM A;  2OI2 A;  1FCA A;  1OY8 A;  2DGO A;  4LT6 A;  4PWU A;  4FYD A;  4ZLL A;  1AUS L;  3M1V B;  2UUW A;  5KFN A;  5F3Z A;  2ASD A;  2DGW A;  2DK2 A;  2FHJ D;  2CJA A;  2EBE A;  4M5D B;  5LJ3 Y;  4DV3 F;  2ERR A;  4GKJ F;  3GJR B;  5HJY A;  3KNA A;  2KG0 A;  1K1Q A;  3NWG A;  2FHJ A;  1W25 A;  1U1L A;  2O66 A;  3K57 A;  3DLK B;  4GC7 A;  2RRB A;  4CH0 S;  3H5U A;  3ZZO A;  3ET6 A;  3MAH A;  3DN9 A;  4USH A;  5DDP C;  4U67 Q;  1SBR A;  5AXK A;  3TA1 A;  1PYO B;  5BYR A;  3CCR S;  3HM9 A;  4ZJO A;  5D0H A;  4C3M A;  1FHT A;  4DQS A;  1JNZ B;  5KFB A;  3H2U B;  1RT7 A;  2HK2 A;  3PRV A;  1X8D A;  2YKA A;  2B0G A;  2DRD A;  2DVI A;  4UOH A;  1T9W A;  2F4V J;  5DLG A;  5AE3 A;  4CLK A;  4A8S A;  4P9S A;  3VAJ A;  2LCW A;  3B82 A;  2XHC A;  2B6A B;  2NS1 B;  4YS2 A;  2K8G A;  2DNY A;  1RAC B;  1YRT A;  4URS A;  4PYD A;  1NK6 A;  2ATL A;  2IAJ A;  2BE2 B;  2GQ2 A;  5JVH Q;  4GVB A;  4QU7 A;  4DQI A;  2C1E B;  3W5Z A;  5DG8 A;  1FKP B;  3O3L A;  5KFP A;  1RDR A;  3R97 A;  2ROP A;  4PPZ A;  3LAL A;  3CJ8 A;  1NSQ A;  3ZTR A;  5KFS A;  2XEX A;  4L3K A;  4MTP A;  2BDP A;  3V2U C;  3HHE A;  4B08 A;  2FJB B;  3LH2 S;  2CNL B;  3KLE A;  1N0V C;  2NXE A;  3N4W A;  2VBZ A;  3VTI A;  2GML A;  2CRL A;  4QWD A;  1LFW A;  3CCS S;  1E6Y B;  2BKP A;  3TRG A;  3W62 A;  4OHW A;  4IR1 A;  2CVI A;  1S1X A;  1PAE X;  4FP9 A;  4OZN A;  1UVM A;  1W2I A;  2LEC A;  1D3W A;  3ZNU A;  1KP6 A;  1GTH A;  4L74 A;  2C2D A;  3HK2 A;  1C1B A;  4MFB A;  5CCM A;  4J9P A;  4ILL A;  2CPD A;  3Q8U A;  1SC3 B;  4A8K A;  1K9M T;  3GV8 B;  2NPF A;  3BYP A;  1H0H B;  4KFB A;  2H54 B;  4UF4 A;  3I96 A;  4Y2C A;  2HFU A;  3M8Y A;  4KV8 B;  1F3F A;  3H42 A;  1KON A;  3HO1 A;  2G1D A;  2MQL A;  2QSW A;  2XYP B;  1QAY A;  1FJC A;  1S1V A;  4DR7 J;  4L75 A;  1Y3J A;  1VJW A;  2JFK A;  5B0B A;  2HZC A;  3K7R A;  1EX8 A;  3UE2 A;  2FC8 A;  5SZT A;  2C3M A;  2VFT A;  3GIJ A;  3WC0 A;  2XBP A;  1JXE A;  3K5N A;  4MKB A;  4OL8 A;  1RT5 A;  1LW2 A;  4ECQ A;  2XY7 A;  5F9N A;  3TUZ C;  1JKH B;  1OY6 A;  2ZNZ A;  2AYB A;  2HQI A;  1QSL A;  4DV1 J;  2GHV C;  3DDN A;  5GAH I;  3DGP B;  5K8M A;  3POT A;  2D69 A;  5KG0 A;  5HVF A;  1B3T A;  3NKY A;  3PY8 A;  1Y5I B;  1TK5 A;  3HX9 A;  3F41 A;  4ZJQ A;  3MD3 A;  1JJ2 R;  3RUB L;  2W7O A;  1R8P A;  2DXF A;  1NB2 A;  2YNI B;  2KJV A;  1UVK A;  4AD6 A;  3MMA A;  1NPP A;  2U2F A;  3EGW B;  5LJ5 Y;  2L9W A;  1EET B;  1WEY A;  2H48 B;  2HNZ B;  2J9C A;  1OIA A;  4Y28 C;  2Y3Y A;  4OJH A;  3L7U A;  3MAA A;  4ZMM A;  1IVZ A;  3MM5 B;  3T1H F;  4DHV A;  2KXN B;  1S1U B;  4K0K J;  1JLE B;  5BXI A;  2RDJ A;  5CZV A;  1EIY B;  3FUY A;  5C42 A;  3P96 A;  3H7H B;  3IGN A;  4V1A k;  4DQP A;  4X4N A;  3IXQ A;  2AD9 A;  3PW7 A;  3GFX A;  2BKO A;  4UOC A;  3LPY A;  1OYD A;  4KH1 B;  2OSQ A;  2Z2Y B;  4ZPT R;  2IPO B;  3W63 A;  2RAQ A;  2JH3 A;  4IKA A;  3D0G E;  3HFV A;  5U47 A;  2AMC B;  3QNW B;  5LT5 A;  3Q8R B;  3FRZ A;  3IBC B;  3M8Q B;  4PXB A;  4R8U A;  4OMF G;  2CQ2 A;  3O2I A;  2RDD A;  4C3K A;  4UT4 A;  3AA9 A;  2HHS A;  4QOT A;  4DR3 J;  3QGG A;  4YB5 A;  2ZUA A;  2A6O A;  1I94 J;  3RW6 A;  3UI3 A;  3K5O A;  2NXC A;  1X5T A;  1QAX A;  4HHH A;  2M3D A;  3WZ0 A;  3GR0 A;  1LKZ A;  3GIR A;  3H59 A;  4OI4 A;  2FTR A;  1RT7 B;  1ITP A;  4H4K A;  4IO9 Q;  2E9Z A;  4O44 A;  4FXV A;  3HJV A;  3TZX A;  4Y2I A;  3SCK E;  3A3N B;  3AOB A;  2OUG A;  2BUN A;  2R2R A;  1ZM9 A;  2LFV A;  5J2Q A;  3HHL C;  2Z8Q A;  2HNY A;  1Q5Y A;  1RAF B;  4B9N A;  3QO9 A;  5JVG Q;  2HQC A;  4ZVF A;  2IAJ B;  3K2Y A;  4GVB B;  1VCT A;  4EYH B;  3JB9 k;  2MKY A;  3DDI A;  2ZBC A;  3LO3 A;  2R7X A;  2W4D A;  4B3S F;  2EK6 A;  4X4P A;  3PDN A;  2J5A A;  3N5F A;  3CO9 A;  4JI1 F;  4ZP6 A;  1NZA A;  1S0O A;  3KJQ B;  2X1G A;  3KLE B;  2A2C A;  2GX8 A;  1Q53 A;  3AJ1 A;  2IJR A;  2QL7 B;  3CD0 A;  2R9L A;  3BRE A;  3WQP A;  1KQK A;  5J1P A;  1QY7 A;  2DBB A;  3W2W A;  5CA5 A;  5DDR C;  1CUL A;  4P10 A;  3QLH A;  4Q5V A;  4FYY B;  3MFH A;  1EP4 A;  1C1B B;  4MFB B;  4A8Y A;  5KTQ A;  2RU3 A;  2PII A;  1Y3K A;  2B3T B;  2VPW B;  3P6Y C;  4KFB B;  2G0I A;  2VDI A;  1NJI T;  3WIU A;  2Q1L A;  3PJW A;  1NPR A;  4FPI A;  5IOL A;  4JV1 A;  3EUN A;  3UN3 A;  2AGO A;  1X4B A;  2ZJP Q;  3GCW P;  4YR0 A;  4MYU A;  1S1V B;  1ZAX A;  2VQE F;  1R89 A;  1YKW A;  3H98 A;  2R7R A;  5K8O A;  4EZ6 A;  2OP5 A;  3FEZ A;  4K4W A;  4QIW D;  5IXU A;  2NUU G;  3V4I A;  1GK8 A;  3EM1 A;  1U7L A;  1TKX A;  2RUS A;  3MI7 X;  4S0M A;  1IBC B;  2W24 A;  1I51 B;  4M5K A;  3DLE A;  1RWP B;  1LW2 B;  2I38 A;  1SC4 B;  1FRM A;  4OX9 J;  2CQC A;  1UPP A;  2VFS A;  3TJA A;  8AT1 B;  4NI2 A;  4ES2 A;  2UUT A;  1H74 A;  3BDE A;  1Q4R A;  2DR5 A;  4OFZ A;  1HI8 A;  2KZZ A;  1RAA B;  5ETM A;  1CQN A;  2J8S A;  3POT B;  4M5M A;  3S7R A;  3FBF A;  1M1G A;  1RAG B;  3T19 A;  3AD9 C;  4MYT A;  4CLS A;  4ECU A;  3W9I A;  2U1A A;  1SB6 A;  2KXF A;  4NLY A;  3CDB A;  2QYG A;  3HCX A;  3MMA B;  2K1R B;  3MM8 A;  1N5Y A;  4RW6 B;  5I3Q A;  1QD1 A;  3FCH A;  2H1Y A;  3MAA B;  1K1S A;  1ZZF A;  3J80 U;  3LGM A;  3I6P A;  2OJ3 A;  1JQG A;  2BM1 A;  2VF3 A;  2LEP A;  4I2Q A;  4WJB A;  2HRT A;  3NAI A;  9RUB A;  1HPZ A;  4Y2M A;  1RU1 A;  1KVK A;  2GJF A;  2AZ1 A;  2K06 A;  3RB3 A;  2IYG A;  3TUI C;  1PJ7 A;  2W1B A;  3MM7 A;  4K4Y A;  4Y65 A;  2YH0 A;  4E0D A;  4DPW A;  1YLX A;  4C4W A;  1F3V A;  1REV A;  2XHW A;  4KHM A;  3H0P A;  2YKM A;  4R8U B;  2KRB A;  3R2C J;  3K8W A;  2DR9 A;  3W3S A;  2IM3 A;  2E5H A;  5DG9 A;  1RHQ B;  1C4A A;  3PW5 A;  5F8G A;  4DR6 J;  4I4B A;  4O3R A;  3J81 Y;  2XGP A;  2HAI A;  3QGI A;  2GO8 A;  4NLT A;  1NU4 A;  4LFA J;  2FVQ A;  3D6T B;  3CCV S;  3N9U C;  2F40 A;  2HG4 A;  5KT6 A;  5KT2 A;  3TI0 A;  2QFI A;  2IC3 B;  1RBA A;  3QIP A;  1HNW F;  4QW9 A;  2XLK A;  3K17 A;  2KHC A;  4RJV A;  3BGL A;  4OHV A;  3BGF A;  1NXI A;  3K59 A;  5ETT A;  2UXB F;  4ZOS A;  4O44 B;  1GT8 A;  4Q2M A;  3T1Y F;  1ZS6 A;  3OTB A;  4IFY A;  1VLO A;  1H72 C;  5D77 A;  5J2Q B;  2OHD A;  1UA1 A;  1B4S A;  1LWC A;  2HNY B;  4P6Q A;  3G4S S;  1U02 A;  1FDB A;  2DNL A;  2BW2 A;  2CPH A;  1MMD A;  5C25 A;  1B0P A;  1X9S A;  4OIX A;  2RQM A;  3QSI A;  1DBD A;  2BAN A;  2YNG A;  1HBO A;  3JTP A;  1N36 J;  2G2Y A;  2G2Z A;  1HWU A;  2OPS A;  2MLX A;  3KDO A;  3TOQ A;  1Q5V A;  3ZTP A;  2AHO B;  4DL0 C;  5IM0 A;  4U9R A;  4F4Z A;  4MKY A;  2G1H A;  2QRR A;  3UN2 A;  3ILJ A;  3GIK A;  4NCG B;  1WKJ A;  5B7W A;  4H4O A;  3EVW A;  3NBP A;  3A1Y G;  5IC6 B;  1A9N B;  3Q22 A;  4DR5 J;  4E98 A;  4F04 B;  1WG1 A;  3ENW A;  4CCH A;  3M8S A;  3EIC A;  3LPE A;  2H9Z A;  1CUL B;  3QLH B;  3FSY A;  1EP4 B;  5L9N A;  3UNY A;  1DQ9 A;  1TL4 A;  3PEH A;  4HVZ A;  4ZPA A;  1VBK A;  2MLZ A;  3PJ9 A;  4CLW A;  5JJB A;  1WOS A;  1B7Y B;  1WG5 A;  1S12 A;  2EFG A;  3NGS A;  3ZZP A;  3R5A A;  3LAK A;  4G1Q A;  1S9G A;  1UJ5 A;  2D3O R;  1M5P C;  3PYD A;  4HHJ A;  1S6O A;  1WUU A;  3S1T A;  1BUX A;  4YME A;  1ZH5 A;  3ZZT A;  1MN7 A;  4USJ C;  3V4I B;  1TKX B;  2ZWO A;  3ISZ A;  1Z2L A;  5HVG A;  3DLE B;  3SIP B;  3KJN B;  5D0E A;  6FDR A;  3JAM Y;  5B0D A;  5KT7 A;  3PW0 A;  3QRP A;  3Q8S B;  2ABY A;  2HWT A;  1QDU B;  3V6K A;  3Q86 A;  4JI7 F;  1RA7 A;  1UEK A;  4FBT A;  3D4J A;  3DHW C;  2A0F B;  2OTJ S;  2LXF A;  2LVW A;  4LF4 F;  3IAS 9;  3AJD A;  2GV1 A;  3FGV A;  2XSJ A;  4FNH A;  3Q2S C;  3K5L A;  3SZ2 A;  2DHG A;  2EFO A;  3MM8 B;  3KK2 A;  1N5Y B;  4KQZ A;  4ZLP A;  4OYB A;  4O4G A;  2LDI A;  5D15 A;  1WEX A;  2HHH J;  3MF5 A;  4CWB A;  2GC8 A;  2RE1 A;  2IM1 A;  2KYX A;  2WCX A;  1FRK A;  4ECT A;  4C8Y A;  1N5V A;  1NK7 A;  4MJK A;  5DGA A;  4I2Q B;  5C7P A;  3FBB A;  1HPZ B;  2KZM A;  1TUW A;  1VC6 A;  3QAT A;  5HMZ A;  4O3S A;  3LAN A;  4HDG A;  4IOB A;  2XUL A;  1X4F A;  3KLG B;  2ASL A;  4NMX A;  1SKW A;  3MM7 B;  4A8F A;  2MJU A;  2E5J A;  2VQF F;  3GWC A;  4PQU A;  4G1I A;  4WE1 A;  5H9E K;  2QMU B;  4NA1 A;  4FBU A;  2BJ3 A;  1FX4 A;  1F9E B;  2HIQ A;  4C9D A;  2VC0 A;  2FJE B;  1D9D A;  1CJU A;  4MAK A;  1REV B;  3TUJ C;  5DZ6 A;  2V8G A;  3LP0 A;  2YKM B;  2MXY A;  2VA3 A;  1WOR A;  2XZD B;  1G7C B;  1TEL A;  1M90 T;  1G1X A;  2NYI A;  2XI3 A;  2YX7 A;  1PJ5 A;  4ILR A;  2RIJ A;  1FJG F;  3M6W A;  1PKU A;  2RML A;  3CCM S;  5F8J A;  3LWM A;  3CVK A;  2J9D A;  4DX7 A;  2FDN A;  2IRU A;  2YQ3 A;  3VCD A;  2WB4 A;  4K7Q A;  4U7C A;  2HUR A;  3SV3 A;  2PEB A;  5THW A;  3MM6 A;  3QIP B;  4IOA Q;  4WP8 A;  1GNK A;  3U27 A;  4AQY J;  3THV A;  1UVJ A;  3GIL A;  4DV4 J;  1TTH B;  3HD2 A;  4B3R F;  2R8H A;  1GX5 A;  1RB0 A;  1KFS A;  1C1C A;  1F0X A;  2CQP A;  2GHW A;  3BN4 A;  4ZA1 A;  1SCJ B;  5MAO A;  5HK4 A;  4JI3 J;  1T02 A;  4YQW A;  1ZTT A;  4IFY B;  1U1R A;  4USI A;  3EX7 B;  2I6W A;  4PG4 A;  5A8K A;  3C14 A;  2MDA A;  1VK8 A;  2FGO A;  2BZ2 A;  3MXH P;  2MLY A;  3D0I E;  4JUZ A;  4XAK A;  2RF2 A;  4LRC A;  1L3S A;  4Q0B A;  2GZO A;  4CO2 A;  5HQM A;  4DCO B;  2QN6 B;  3UCG A;  2DR7 A;  2BAN B;  2YNG B;  3QGP A;  1RWX B;  2M8H A;  1VI7 A;  2UP1 A;  2OPS B;  2LEA A;  1N8R T;  4LRE A;  4ZS6 A;  1DFD A;  1MSW D;  2ZM6 J;  1V9O A;  5KFE A;  4URG A;  1C4C A;  1TU0 B;  5C2C A;  3HVA A;  1NJX A;  3S8S A;  2W9A A;  2F4F A;  4ZP9 A;  3DCA A;  4ZPD A;  2GIF A;  2QLJ B;  2DNQ A;  3NBP B;  5IC4 B;  1WTB A;  3AT1 B;  3FZ2 A;  4AND A;  2NQP A;  3QT8 A;  3MTJ A;  5E41 A;  4JI8 F;  4X66 J;  2AGQ A;  3HJF A;  3I31 A;  1JLG B;  5T7L A;  1JXL A;  3UR3 C;  3D66 A;  3UR0 A;  1U2R A;  2WBR A;  3OTC A;  4IH5 A;  3RB6 A;  1LW0 B;  1FTC A;  4RBT A;  5F8H A;  4G1Q B;  3EWG A;  1FWK A;  3HHK A;  1S9G B;  2HFZ A;  4X4R A;  3ENV A;  1BY9 A;  4DZD A;  4J9N A;  1KVI A;  3BB5 A;  1BE4 A;  2DHX A;  1S48 A;  5F0U A;  4QYR A;  2JNJ A;  5BR8 F;  1HR0 F;  2UV8 A;  1T8E A;  2UXD J;  1VIO A;  3QAE A;  4EU0 A;  3JTN A;  4RUB A;  3DC2 A;  2X1B A;  5KG2 A;  5KFA A;  5E33 A;  4OYI A;  5JUM A;  1S1W A;  4DDF A;  2RQC A;  1YBT A;  2MKI A;  3GR1 A;  2NZC A;  1R0C B;  1JLA A;  3W8G A;  1TUG B;  4CLL A;  4DX5 A;  2DIU A;  4X4S A;  1EJ7 L;  2C3O A;  2DXD A;  4O3P A;  3MFI A;  4PAB A;  2HHW A;  4TQR A;  3GSD A;  1WEZ A;  1WSR A;  1YHQ S;  1KFD A;  2H4Y B;  4USK A;  2XNR A;  1Z2Z A;  2MQ8 A;  3BKU A;  2UVU A;  2E7V A;  4Q45 A;  2P5V A;  4F0K A;  1BQN A;  3TZZ A;  1VBX A;  1YI2 S;  1TAU A;  3AAW B;  3KK2 B;  2OEJ A;  1GX6 A;  1UZD A;  3ETO A;  1NKE A;  2KM8 B;  2R7O A;  1KVJ A;  4O4G B;  4HYK A;  4OV6 A;  1XC9 A;  4O4R A;  3VGS A;  4M5I A;  2R7T A;  3KHL A;  4ZK7 M;  3CC4 S;  5KOX A;  4EK2 A;  4J9V A;  4HT5 A;  2CPX A;  4KBI A;  1VQ4 S;  4GO5 X;  4OYX A;  5IQ6 A;  3A8J A;  3VQS A;  4NCB A;  3UN5 A;  3W9J A;  1RCX B;  4W90 B;  4Q8F A;  2MKH A;  4WE1 B;  2E7W A;  4WII A;  3TP2 A;  1CLF A;  2CNK B;  2PA3 A;  3MM9 A;  4V19 J;  2CWX A;  1U0S A;  1DAX A;  1CJU B;  3BSA A;  3OTE A;  1CBK A;  5DQH A;  1GQE A;  4ZVG A;  1YDL A;  3KK1 A;  5CD4 A;  3F0N A;  3PG9 A;  2JOQ A;  1HLW A;  1S7H A;  3OHA A;  3CGI A;  4C7Q A;  2BQR A;  2Q66 A;  3KLI A;  1VDH A;  3AXM A;  2UZA A;  5LM7 E;  4YFU A;  2MB0 B;  1S7I A;  2FVR A;  1CJV B;  4I68 A;  2COL A;  3JSM A;  1RZM A;  3R1H A;  2IFX A;  4WFX A;  2BM0 A;  2YKN A;  3MM6 B;  5ETN A;  3AQO A;  1JLF B;  2FJX A;  2EC0 A;  2EC2 A;  3LWL A;  1VBY A;  3OR2 A;  2CJQ A;  3J81 U;  2D3Z A;  3DMJ B;  4DL6 A;  3BH7 B;  1FXD A;  1BQM A;  2Q43 A;  2C2R A;  1PSD A;  3X1L B;  1TFY A;  1TL5 A;  1CS4 A;  3MTK A;  3C14 B;  1RWM B;  3QT7 A;  1X9M A;  3RZA A;  2KVI A;  4LVO P;  1WWH A;  1HW8 A;  2RF2 B;  4Q0B B;  3MED A;  3GU0 A;  1AYE A;  1YK9 A;  4RUC A;  3KDN A;  1WEL A;  3IFE A;  4W4M A;  2G2O A;  2DR6 A;  4KPC A;  1WG4 A;  3L7P A;  4WZM A;  3OL9 A;  2RS2 A;  2F4V F;  4OYP A;  3W64 A;  4MMO A;  1PBA A;  1WC4 A;  3CC2 S;  3BH6 B;  2KKH A;  3PYF A;  2FY1 A;  2IMW P;  3C6U A;  4DWI A;  2JEI A;  2RSQ A;  3GLJ A;  3MR5 A;  3EGV A;  4DLG A;  1YZ6 A;  1UEU A;  4OLO A;  1H7X A;  2YTC A;  4J9U E;  1JLC A;  1FDD A;  3NS5 A;  4DSI A;  4I1T A;  4I67 A;  3U1L A;  5T7L B;  3GPA A;  3O5T B;  2Z4P A;  4F4X A;  2DGQ A;  3SFG A;  3TNV A;  2DRA A;  3N5B A;  2QEX S;  5HAO A;  5CAA A;  3SDE A;  5HMY A;  3H5Y A;  1NME B;  2MZS A;  3OT9 A;  4DL7 A;  4IFV A;  1MML A;  4B9S A;  3UNG C;  4F8R A;  1K0V A;  4NEY A;  2JEG A;  2CG4 A;  4QIV A;  3RRG A;  2J9E A;  4MT1 A;  4PUO A;  4TYB A;  2KH9 A;  3MAQ A;  1XJW B;  5HI7 A;  1WD6 A;  4WBF A;  4LRF A;  2AZ3 A;  3EZO A;  3TAP A;  1TP7 A;  4CZC A;  5KFC A;  4TNO A;  1J5E J;  2V69 A;  3H90 A;  3EYZ A;  4PWD A;  1ELO A;  2XMA A;  4GMK A;  2F8H A;  3CWJ A;  2R3V A;  4DR7 F;  3NCR A;  1IBL J;  2BVZ A;  1SVD A;  2WAQ D;  2JZ5 A;  2ZBI A;  2HGL A;  3ZZY A;  4AL5 A;  4EO6 A;  3BJY A;  3PEJ A;  5KFM A;  2NRE A;  4A8X A;  5ETO A;  2I1R A;  3JAM U;  3GJQ B;  5HJX A;  4IG0 A;  1O51 A;  2EBG A;  4FYW B;  2BEF A;  3KHR A;  4FN5 A;  1BQN B;  4G6V B;  4DV6 J;  1AUD A;  1RAB B;  2FZC B;  5AXL A;  4CLY A;  4X64 J;  5DGB A;  4C0O C;  5BYQ A;  1PG5 B;  4DV1 F;  3RBE A;  1J2V A;  4PG7 A;  2BE9 B;  2LQ5 A;  1R43 A;  2EKN A;  3MUT P;  1Q86 T;  2GMJ A;  1S79 A;  4RZR A;  1RT6 A;  3W5Y A;  1S9E A;  4LQ9 A;  4ALZ A;  4NRU A;  4ZIT A;  1JLB A;  3H40 A;  2ALZ A;  2IIH A;  5I3P A;  3OJU A;  4QIG A;  1FD2 A;  2DNO A;  3NMA A;  3IRX B;  1U4B A;  3C8Y A;  4BWM A;  4BLG A;  5KFZ A;  4J90 A;  4N7T A;  1Q95 G;  1U6Z A;  3PR5 B;  2DPJ A;  4EO8 A;  4ZJL A;  2ZH8 A;  3BSO A;  3VGT A;  2VOP A;  1HBM A;  1N5S A;  3W2V A;  4ECY A;  2Y8W A;  1WDD A;  3CJ0 A;  2MZ1 A;  1X4G A;  4RU2 A;  3MM9 B;  2J0S D;  4KB7 A;  2R7V A;  1HHS A;  4K0K F;  4CDI A;  3KK1 B;  2V2V A;  2FZG B;  4IG3 A;  4HH1 A;  5KOW A;  4DSL A;  3R5C A;  5ETS A;  2W8L A;  2ZHO A;  1R31 A;  3KLI B;  1HA1 A;  1T9U A;  2ZH5 A;  4F02 A;  3O8W A;  2JL9 A;  1LV5 A;  2C2M B;  1Y7P A;  3A8E A;  2E1A A;  4CIO A;  1TVR A;  5ETK A;  2ZOG A;  2HVH A;  1MU2 B;  5A8R B;  3G6X A;  2GW8 A;  2HIY A;  2XB2 D;  2YKN B;  1ZBT A;  3U02 A;  1C2P A;  2V2Z A;  1RAO A;  4DG1 A;  3OR2 B;  2XMJ A;  3GYN A;  4DPX A;  1W7W A;  3QBC A;  5E3R A;  2B5J A;  1BQX A;  1BQM B;  1NJY A;  4OQJ A;  4CRJ A;  4DR3 F;  4QYZ J;  3M8Z A;  2MGZ A;  4C11 A;  4FVM A;  3TQE A;  3G6V A;  1UW4 A;  1I94 F;  3W61 A;  5KFX A;  5D4L A;  5L1J A;  3T1Y J;  4DX6 A;  5E3A A;  3D9B A;  4ERD A;  3MED B;  2C2E A;  2B9E A;  3M05 A;  1AZS A;  2R8I A;  4NYZ A;  3B4D A;  4TVA B;  3I5C A;  2OH2 A;  2R8K A;  2A1B A;  1B99 A;  2M52 A;  2HGM A;  5D78 A;  1FE0 A;  1PGZ A;  3ISN C;  2CDQ A;  1Q78 A;  1O0P A;  2IA0 A;  2V4R A;  2NLW A;  5F3T A;  3J7A N;  4B9M A;  4CQ1 A;  5HQL A;  3C6U B;  5AJ3 J;  4ITS A;  4LUB A;  1NJW A;  4YN3 B;  2GVD B;  1WNE A;  3DRS A;  3SBM A;  4HH0 A;  1WF2 A;  3EVO A;  4LF9 J;  1ZA1 B;  4MK9 A;  3DRP A;  2GCF A;  3HVW A;  3UD5 A;  5M2U A;  4NCA A;  4DL4 A;  1VR6 A;  3NY0 A;  5DG7 A;  4YOE A;  5L38 A;  1DLO A;  3HUL A;  2CZ4 A;  4UOG A;  3QJJ A;  1H2T Z;  2Z2Z A;  3SDE B;  2WRM A;  1L3T A;  2VPY B;  4IFV B;  1Q1K A;  1V5V A;  3V6J A;  5KFV A;  3S01 A;  1FFG B;  1K73 T;  3J7A 1;  4PUO B;  1RWU A;  4OI6 A;  3GJT B;  4M5J A;  2XMU A;  5EWF A;  4ZCL A;  4DS4 A;  2AIR B;  2HRU A;  3RW7 A;  3FCV A;  3Q83 A;  2GVZ A;  1HAR A;  2RVJ A;  2CAJ A;  3OXF A;  4OZL A;  2QSF A;  2FYX A;  1MG7 A;  5DET A;  4PWD B;  2W8K A;  2E1C A;  4NLX A;  2RQK A;  2JLE A;  2LQB A;  3AOD A;  3T5K A;  1S4F A;  1NKC A;  1IKY A;  1TL3 A;  1F2G A;  2DO0 A;  2VC1 A;  1WAC A;  1P1L A;  3QFH A;  4IG0 B;  3KJV A;  4RKU C;  3THT A;  4LF2 A;  1R0A A;  1NBE B;  3DU6 A;  4OX9 F;  2GNK A;  1RLC L;  3MMC A;  5CH7 B;  1LWX A;  3C15 B;  3D0H E;  1U1K A;  2VFV A;  2Z57 B;  4F26 A;  1SUQ A;  3KKF A;  3G8T A;  2E1R A;  1UL3 A;  4TQS A;  2X51 A;  1RT1 A;  1RTZ A;  1JLB B;  2VON A;  4KKO B;  4ZN3 A;  1KQS R;  5MLC V;  2XSF A;  3CDE A;  1NK8 A;  2ZBQ A;  4HTJ A;  4P7V A;  3UWT A;  1RAD B;  2JLF A;  3I5B A;  4RPF A;  1XER A;  1S0N A;  3SQO P;  4WXW A;  1HBM B;  2CPZ A;  3W2V B;  4FF2 A;  5D3G B;  5DM7 Q;  2WVB A;  1Q81 T;  2QA4 G;  2WSE C;  4Y2K A;  2NR0 A;  4DI6 A;  3QSY B;  3U7J A;  1CPZ A;  4LIR A;  4IG3 B;  2DHS A;  4ELT A;  1MRO A;  1RT3 A;  3LQV A;  4XPE A;  2XO7 A;  4GC6 A;  3OFF A;  1YIT S;  3CSK A;  3HLU A;  2MJN A;  1TVR B;  4D3H A;  5F8L A;  2DGU A;  3MWB A;  4LVN P;  1HI1 A;  2ZE2 A;  3H4D A;  1WHX A;  2XMV A;  2BAB A;  4PZV A;  1PYT A;  3CE8 A;  3CDU A;  2R2T A;  4DV7 J;  5KFL A;  4DG1 B;  3OVB A;  3G6Y A;  2FJV A;  2FHK A;  4C97 A;  5EX3 A;  3TQ1 A;  5D0R A;  2UVV A;  5ADZ A;  3C16 B;  4MK8 A;  2H5E A;  1HQE B;  4DR6 F;  3HKW A;  2GFF A;  4DF8 A;  4C11 B;  4LFA F;  2A2D A;  2OPQ B;  4C8L A;  2VZ9 A;  2YWF A;  2HFN A;  3T5J A;  4ED8 A;  4DLE A;  4R0J A;  1XNR J;  1AZS B;  4K4V A;  4LSL A;  3NLC A;  2VOO A;  4ZLN A;  1N88 A;  4LSN A;  4JBC A;  1VHF A;  3EDQ B;  1OQ6 A;  1XQI A;  1X60 A;  4F0M A;  2ASJ A;  2UUB J;  2QO3 A;  2HPU A;  3CC7 S;  7FDR A;  4NLP A;  1Q82 T;  5H1S V;  5A2Q Y;  3QT6 A;  2HQG A;  3TZW A;  3HXM A;  2R8J A;  3QFW A;  4YDD B;  3HI9 A;  2P9C A;  3FJ2 A;  3R27 A;  3W7B A;  1Z4U A;  1Y4Z B;  2O5D A;  4U8V A;  4KR0 B;  2BE2 A;  3CDA A;  4RW4 B;  5E3Q A;  1FE4 A;  1N36 F;  2OLW A;  1FKP A;  1U1Q A;  3GE9 A;  1HNI A;  1DLO B;  3J7Y U;  1HHQ A;  3QT5 A;  3RAM A;  5A6W A;  4EFA C;  4ELU A;  1XR7 A;  4Q2L A;  3DHX A;  4PG8 A;  1YVF A;  2QX0 A;  1SKS A;  4BWJ A;  3L09 A;  3K5P A;  2BJ8 A;  1DUR A;  2N4D A;  1UP1 A;  3CTR A;  2EFV A;  4DR5 F;  1WHV A;  2CWK A;  3JSB A;  1E6Y A;  1HWI A;  2WHO A;  2VB6 A;  2PI4 A;  3OQ2 A;  3B78 A;  4MIB A;  4HEA 9;  1TKD A;  2ZDP A;  1IJF B;  1G6B A;  4MIW A;  4N8N A;  1EHW A;  2F7V A;  3SSQ A;  2AEM A;  3BDP A;  2Z2L A;  1HR0 J;  1F1B B;  1SH2 A;  3RB4 A;  3IS9 A;  4RW7 A;  4WKY A;  4KGM A;  2GJI A;  5FLX Y;  3LW5 C;  1Q0N A;  4MKV A;  2ZOF A;  1VC0 A;  1HNZ J;  1VQY A;  2B9W A;  3CCJ S;  2O1P A;  3FNN A;  5HVH A;  4DR1 J;  4H4K C;  2QA2 A;  1IM6 A;  3LF0 A;  1IKY B;  4V19 X;  3DOK A;  1TL3 B;  2HWI A;  5KFO A;  4OYA A;  2PI5 A;  4TXS A;  1LQ9 A;  3QRR A;  2KU7 A;  2W2Q P;  3WHI A;  2HVZ A;  4DS5 A;  1VQP S;  3CJS A;  2F5G A;  3CD5 A;  2FQQ B;  3UDL A;  2L41 A;  3VAH A;  2C3Y A;  3MMC B;  1QTN B;  2DTJ A;  4ENO A;  1FJE B;  3UCU P;  2MQP A;  2EWH A;  4CLU A;  1CG2 A;  4CTA A;  3HHN B;  1JJ4 A;  1VJQ A;  4XK8 C;  2V63 A;  4QZV B;  1SUQ B;  4OYW A;  2N3O A;  3R3T A;  3PO5 A;  3PKM A;  3E8O A;  3MR6 A;  3AD7 C;  4ZPB A;  1SXL A;  2DGX A;  5F8N A;  4EBC A;  3IMQ J;  3FBE A;  1J27 A;  2KHD A;  2MZJ A;  4ECX A;  3FSX A;  5CHC B;  4IYQ A;  2CJ9 A;  3DM2 A;  2QA1 A;  1Y0H A;  2VUG A;  3L9Z A;  2YNI A;  1I1G A;  2MQM A;  3T6B A;  4N56 A;  1U47 A;  5T14 A;  1EQM A;  2KJW A;  3MPY A;  1UVI A;  1SJ1 A;  2HHH F;  3CT9 A;  1EET A;  3N28 A;  4WF9 Q;  4ANC A;  3NS7 B;  3TX8 A;  3KMQ A;  4KE5 A;  4CLP A;  1APS A;  1S6P B;  4J9L A;  5LSO A;  3MM5 A;  1MRO B;  1RT3 B;  2IBK A;  4OZ2 A;  1GXU A;  5L46 A;  4YHH J;  3D3C J;  2HVE A;  4J9Q A;  1VRT A;  2LLZ A;  1U8W A;  3MR7 A;  1KBR A;  4J5O A;  4B9U A;  2ZE2 B;  3P49 B;  5LMU J;  3TA2 A;  2YWW A;  4F3M A;  1IBM J;  4I0W A;  4CI0 B;  4M94 A;  4ECS A;  2NXN A;  4J91 A;  1GTE A;  1WKL A;  2P6T A;  2AJQ A;  4OHX A;  2NXJ A;  2CZ9 A;  4DPO A;  3M8Q A;  1X4H A;  4OI2 A;  2ZC4 A;  3VZI A;  3HPO A;  1J5O A;  4BC7 A;  4GO7 X;  2D74 B;  2B51 A;  4IQM A;  2E9T A;  2GS8 A;  3G71 S;  2VJV A;  1G2E A;  3CXC R;  1HFE L;  2ZJQ Q;  2HBY B;  1LNQ A;  1TAQ A;  5F8M A;  3U1N A;  3W65 A;  1JNR B;  3VAG A;  2R2S A;  1NCL A;  4KIA A;  4XTT A;  3WX4 A;  2D1C A;  4TY8 A;  3OTO J;  4AQY F;  4WXO A;  3HSD A;  4DV4 F;  4LSL B;  1PIE A;  1X0F A;  2D9P A;  4HAC B;  1NHK L;  3W60 A;  2FHM A;  2RNE A;  4LSN B;  1WKK A;  4JI3 F;  4W98 A;  2QYC A;  3AJ2 A;  2L08 A;  3QGH A;  2E1P A;  2VKR A;  1KEK A;  3H2V E;  5B09 A;  4YUD A;  1D1U A;  4HR2 A;  2RH3 A;  2IM0 A;  4WFZ A;  3OSP A;  4X4O A;  3X3U A;  4NXM J;  2DY9 A;  2WZ1 A;  5D8H B;  3CCU S;  4ANE A;  3SV4 A;  3CJ5 A;  1CC7 A;  1BLU A;  4B3M J;  2F9J A;  3JYT B;  1SL1 A;  2Z2M A;  4FKY A;  3D54 A;  4RW9 A;  5AXN A;  1H38 A;  3FK4 A;  3O1L A;  4J9R A;  1HNI B;  4RNM A;  1ZET A;  4EZ9 A;  3KNG A;  3BO3 A;  4P52 A;  4EGL A;  2ZM6 F; 
#chains in the Genus database with same CATH homology
 3EIC A;  4S0M A;  1HLW A;  4ANC A;  3ZTS A;  3NGR A;  3ZTQ A;  1JXV A;  3FKB A;  1NCL A;  3VVT A;  3L7U A;  4KPC A;  2AZ1 A;  2VU5 A;  4O0N A;  2B8Q A;  2DXE A;  1HHQ A;  2NCK L;  3ZTO A;  1NSQ A;  4C6A A;  3MPD A;  1NDP A;  4WBF A;  3ZTR A;  1BHN A;  1NHK L;  1ZS6 A;  2AZ3 A;  3BBC A;  1XIQ A;  3FBC A;  5BXI A;  1WKK A;  3EVO A;  3VGS A;  1BE4 A;  2DYA A;  1W7W A;  2HVE A;  3PJ9 A;  3BH6 B;  1B4S A;  3WX8 A;  3BBB A;  3FCW A;  4DI6 A;  4W98 A;  1NSK L;  1NDL A;  1UCN A;  4ENO A;  5CAB A;  1NPK A;  4FKX A;  4EK2 A;  1NDK A;  1U8W A;  4UOF A;  3JS9 A;  3FBF A;  1NDC A;  2CWK A;  3NGS A;  3VVU A;  1KDN A;  4F4A A;  3EE3 A;  1PKU A;  3VGT A;  1LEO A;  3GP9 A;  3ETM A;  3Q8Y A;  4CP5 A;  1MN9 A;  3EVM A;  4UOG A;  3VGV A;  2BX6 A;  3EMT A;  3ENA A;  3EJM A;  1PAE X;  1K44 A;  4HR2 A;  2HUR A;  3VGU A;  4F36 A;  2DY9 A;  4DUT A;  1BUX A;  3FC9 A;  1HIY A;  1LWX A;  1WKL A;  3BH7 B;  1EHW A;  4ANE A;  5IOL A;  1XQI A;  3FBE A;  3NGU A;  1S59 A;  3B6B A;  3PRV A;  1MN7 A;  1S5Z A;  5C7P A;  3FBB A;  2BEF A;  4UOH A;  1F6T A;  1NUE A;  3Q8U A;  3ELH A;  4FKY A;  3GPA A;  4AND A;  3ZTP A;  3DDI A;  1S57 A;  3Q8V A;  2DXD A;  2HVD A;  4DZ6 A;  5CAA A;  1NSP A;  1B99 A;  3G2X A;  3B54 A;  3DKD A;  2DXF A;  1NB2 A;  3BBF A;  3Q89 A;  3NGT A;  1WKJ A;  3EVW A;  3Q86 A;  3R9L A;  3FCV A;  1F3F A;  1VYA A;  1NLK L;  3EM1 A;  3Q83 A;  2B8P A;  2ZUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...