1V3RA

Crystal structure of tt1020 from thermus thermophilus hb8
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
92
Chain Sequence
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 20
structure length 92
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1v3rA00
2ZFHA 2NUUG 1OSCA 2XULA 2CZ4A 4IYQA 3AA9A 4NYOA 2J9DA 2O66A 1V3RA 4CO5A 3AHPA 3O5TB 2GX8A 4ZK7M 4YB7A 1UKUA 4YB6A 1QY7A 5D4PA 4WK3A 1NH7A 2NUHA 1O51A 4CO3A 2XBPA 1UFLA 3X3UA 3TA1A 3DFEA 2EG1A 3T9ZA 3NCPA 3AH6A 5D4LA 2XZWA 1UMJA 2VD3A 3L7PA 5DS7A 3AA8A 4YB5A 1UL3A 1Q1KA 2E66A 3GSDA 4AFFA 1J2VA 4OZNA 4CNYA 1H3DA 4CO4A 1KR4A 5D4OA 1VFJA 2ZOMA 2J9CA 4Y6IA 4NYPA 2NS1B 4CO1A 1GNKA 4CO2A 4RLEA 2V5HG 2JJ4D 1O5JA 1VHFA 2XG8A 2GNKA 1XK8A 4RWWA 2GW8A 5D4NA 5DRKA 4OZLA 3LF0A 3CE8A 3BZQA 3MHYA 2J9DE 4CNZA 4D3GA 4CO0A 3M05A 1V6HA 1NAQA 4USIA 2J9EA 2Z0GA 3TA2A 1NZAA 3N5BA 2O67A 4USJC 1P1LA 3NCRA 4C3KA 4C3MA 2EG2A 4Y65A 4D3HA 4RX6A 2RD5C 1PILA 4R25A 3O8WA 4WK1A 4E98A 3OPKA 2PIIA 4OZJA 3HLUA 2DCLA 5L9NA 4RWXA 3TA0A 4USHA 1V3SA 1NH8A 1V9OA 3NCQA 1HWUA 4C3LA
chains in the Genus database with same CATH superfamily
1X4FA 3CDAA 4DQSA 3HD2A 1KQFB 3FDSA 1UWBA 3GFYA 2YWEA 4K8RA 5D4PA 2YNFB 3GIMA 1RA7A 4ZPAA 2PSZA 1DZ5A 2Z58B 3DM2B 1RTDA 4Y3CA 4DOZA 3CJQA 2LU1A 1Q7YT 4KGKA 3NCPA 5HJYA 4ZVRB 1T3NA 2EFPA 3THPA 1Y00A 3PNIA 4KGZB 2E9TA 2PMWA 3ZZUA 3BS9A 4ZDNA 1URNA 2J7KA 2V0NA 1VBZA 1NXIA 5KFGA 1NKEA 3MAHA 2E9RX 2F9DA 5F3ZA 2BR0A 2EK6A 4U95A 4F36A 4BHQA 1G4CA 3IGVA 4NA3A 2D3UA 2CDRB 4WCEQ 4NRTA 2FLNA 4F67A 2DGVA 1LWCA 1U0HB 3QGHA 1IWGA 2B43A 2CWXA 2UUWA 1NDKA 2Y9HA 3LANA 5KT7A 4DR6J 2R7WA 1A9NB 3NGUA 2MKYA 2YKNA 2ZHBA 3I0SB 2WB1D 1H0HB 4ZPWR 4DQPA 1KLMA 1FJCA 1NH7A 3ENWA 4EZ6A 5HLFA 3IA0A 2QSWA 4QIEA 4MK8A 5SZTA 4LF1A 1G1XA 3T9ZA 1VQ5S 2HNDB 3R7SB 4N56A 1HYSA 4M5MA 2ACYA 4I6WA 2CPFA 1EQMA 2D7SA 2GVDB 2FVSA 3OTDA 1TL4A 1ZM3A 1S4FA 4MK9A 1M1HA 5ETOA 5JUMA 1IUJA 1RWNB 3PRDA 3Q2SC 3T5LA 4JOUA 2HHHJ 2DNNA 4ZJQA 3RB0A 1KBRA 2XMWA 2ZNZA 2YPYA 2NXCA 4NWBA 5HMWA 5J1EA 1YLXA 2B8QA 2B51A 3OQ2A 4OFZA 2W4PA 3QLHA 2DR6A 2HFNA 4C0BA 5BYQA 2XMMA 4X4UA 1GH8A 1VQ6S 1SJ3P 3P3DA 2MSTA 2FVPA 3DHXA 2CQIA 4FKYA 3OSNA 3ZNJ1 2AJFE 2RUSA 1Y0HA 1DURA 4JI1F 2DH9A 1U8WA 4QIGA 2KZZA 5F8IA 3TEHB 4DL2A 2ZJRQ 1FF2A 4WFYA 3DLKB 2AMCB 2HEKA 4X2BA 1RWOB 1RT4A 4XDDA 4UW2A 3MR6A 2G0IA 4O0IA 4RW7A 3AFGA 2M5YA 2GW8A 5L39A 1FERA 1SKWA 4PWUA 4QBUA 1VQ4S 3U1LA 4JV1A 1S99A 1WEXA 2BJEA 3MUMP 4B3TF 3W5ZA 2MB0B 3QT8A 2XMTA 3G6YA 4OJ1A 5HI7A 3VWSA 5FDLA 3TOQA 1K1SA 3CPWR 4DR5J 2PC6A 4Y00A 1T9VA 4NMXA 4DV5J 3OFEA 3U1NA 3DOKB 3MM7A 3MM6A 1FNMA 1SL2A 4YHHJ 2X51A 4ITSA 1S79A 3P96A 1H2VZ 3PRBA 2L9DA 1LWEB 3HHDA 1NB7A 2DR5A 5DDQC 4EZ9A 2ZBQA 2CZVC 4DU8A 1TKZA 2LCWA 5HROA 1Q0NA 1RT5B 1SKRA 1Q86T 3WIUA 2QA4S 4X4VA 3WBZA 1PBUA 3IG1A 2AKWB 2GHWA 5C24A 3GJSB 3FCVA 2AGOA 3CEDA 4N77A 4IH7A 3K8VA 3V4IA 3MPYA 4DUYJ 2MGZB 2J0XA 4DJBA 2FZCB 4BWMA 3JAMY 2OKQA 4HI1A 2HLTA 3IAM9 2RQKA 2CAJA 4NXNF 3DRRB 1HWLA 3GYNA 2A6MA 3M9NB 5HMXA 1KWMA 1X5OA 4DR7F 2IM3A 5L46A 5D15A 1RHUB 2DHGA 3AHPA 2I1RA 2RSQA 1WDTA 3L4BC 2MYFA 2KT3A 2H5IB 1TQLA 3Q8SB 1EB0A 2IC3B 2MSSA 1JX4A 5KFKA 4OX9F 5ETRA 4ZCLA 4ZPBA 3GJRB 1UVMA 4AFFA 3H2LA 4L74A 4AT1B 4DSEA 3UW1A 3R5JB 1XR6A 5KFOA 1KLNA 4DV2F 3A8KA 3KLEA 4AXIA 2AEMA 1VHFA 2LKZA 4URSA 3GV7B 3CJ8A 4ZN3A 4YR3A 2NSBA 2MQMA 1XN9A 4CLYA 2HGLA 3PG9A 4PXEA 2UXCJ 3VGVA 4J9UE 1OQ3A 4LSLA 5M2PA 4QJVA 1FVQA 1P1LA 4ILMA 3DU6A 3C19A 3HXMA 1NHKL 3KWMA 3HX9A 4WKYA 2ZKUA 3DXBA 2BE7D 5EHHA 1Q79A 2HWHA 3H2VE 4NLYA 1FDDA 4YR2A 2VV5A 5A6PA 2WOMA 1IBCB 4WE1B 1JLQB 4IG0B 2C3UA 2QA2A 4R5PA 2IJNA 2PEBA 1LKZA 2GGPB 4USTA 2M8HA 1BXNA 5CXTA 4J9LA 3US5A 1S1XA 2A2CA 3ZTRA 5KFMA 4B9TA 1NZ8A 3FEXB 2GC8A 5CYQA 1HHTP 5E0OA 4ID8A 2I9SA 2W9BA 3DGVA 3MPUB 3SYZA 4CDIA 2XTJP 1CC7A 2HBZB 1X4DA 3LF0A 3BZQA 4DXLA 4NEYA 3THTA 1MU2B 1NPPA 2VG6A 1HLWA 5A0YA 2JL9A 4C98A 4DHVA 1RLCL 3PCOB 4MTPA 5L8RC 2VICA 2HMIA 1LK7A 1U8SA 2OPQA 3KG1A 3CDBA 5B0AA 3OFHA 1HA1A 2CYYA 2KVQE 3SZ2A 5EDWA 4IYQA 1MW7A 3KUHA 4QR0A 2DNRA 1N6QA 2X7IA 1H2UX 1ZYQA 5B0GA 2IVMA 1E6VA 1M5SA 4QIVA 1KTVA 1UAWA 1VQNS 1S48A 3G86A 2J6SA 1N56A 2XMKA 1EETB 3D4JA 2CADA 2UUTA 2MEWA 4TXSA 1YGYA 3GQCA 5BJRA 1N5VA 1JLAA 3FQKA 3GJQB 1C1CB 1RAFB 3RGIA 2F8HA 1DY3A 2Y1RI 1R27B 3HT0A 3M05A 4ZPCA 4RBUA 2E1CA 1UA1A 5E3QA 2I5JB 1TKXB 2J8AA 1S97A 3DRPB 3E8OA 5AT1B 4RBVA 1T05B 2VZ9A 1KD1T 3GR0A 3BO2A 4DDFA 3M8QB 4O3QA 4FBUA 4C3LA 4EI2A 1VQKS 1V5IB 2VOPA 1SL1A 5KG7A 3W5XA 1U02A 1CULB 1FWPA 2RJZA 2C2KB 4K7QA 2FJVA 2XBPA 3TA1A 2IRXA 3MMBA 1CJVB 3KJVB 1HNWF 3C8YA 2YKQA 1NDPA 3NL0A 3CF5Q 3JSYA 3ETMA 2OAUA 2QLXA 2WVBA 3S6EA 4HVZA 4NEZA 1N0UA 4DV1F 2XYHB 5HLFB 2F4VF 2ASDA 1W26A 4K4VA 3C16A 1PO6A 1KP6A 3M32B 2RQMA 1B0TA 4UQGA 1K44A 2BACA 3CULA 3LWLA 4FDFA 3MEGA 2QMUB 2HHTA 3GCWP 2OH2A 2ASYA 2JC1A 1DARA 1S0VA 4ZS6A 1CBKA 2VODA 1KTQA 2FPHX 2KN4A 2ZC4A 2CQBA 4RWXA 5AXNA 2MQ8A 3QIPB 2IM2A 2LVWA 2F65A 2CPEA 1T9UA 1NMEB 1OWXA 1M90T 4DX6A 5HL7Q 4IH5A 3TAQA 4K2JA 4RW8B 1HARA 2MZRA 1LW0A 3CXCR 2UU9F 2EBEA 1CJKA 1DTQB 3ILOA 2LQ8A 3OXGA 2BV3A 3CDWA 2MQNA 2HRYA 3D0HE 3ZZZA 1IJFB 5GMKa 1QVGR 1VGYA 4UOHA 2VC1A 3OFGA 4CNYA 1IBKF 4Q8FA 2MTLA 4PXDA 3M2UB 2GVZA 1JLEB 4ILRA 1UVNA 1N32J 3W60A 3GFXA 3DYAB 2AYGA 4RLEA 3POTB 1S1VB 9ATCB 3ICLA 5LMUJ 1VQSA 2QEXS 5F41A 2YQ0A 1X5TA 3U7JA 1KHVA 4A48A 3K59A 4M95A 2B4UA 3I4HX 4LR8A 1EAYC 1C4AA 2NXEA 4QYRA 1Q8LA 1NSPA 1N5YB 4P9SA 2CQ3A 2ATCB 3GP9A 4IQXA 1KC8T 3QSYB 4J9KA 4OJHA 4XTTA 3CJ2A 3V4MA 4ILLA 4OYOA 1RBLA 1S7IA 4LQ9A 2L3MA 1VQ8S 1TK8A 1IVZA 3NNHA 3MM5B 3AD9C 1BE4A 4LJMA 4LQ3A 2OPPA 1ZAWA 2BABA 3KMQA 2RDJA 4R8UB 3A3PB 4O4GB 5K5MA 3AD8C 2G1HA 2KG1A 1JK9B 3TRGA 2DVIA 3SSRA 2DRBA 4OX9J 1UVLA 4MYUA 1ZM9A 4P6QA 1U09A 4M94A 2ZM6F 1TK5A 1CG2A 1XEZA 1F0XA 1PJ7A 4JI2F 3T5KA 3TVZA 4DV4J 2G9OA 2XNRA 2EG2A 2IM1A 4DV2J 1VC0A 3QRRA 1OY6A 1H7WA 2MPUA 1HWIA 4G3IA 3PY8A 3MFIA 4FYVB 3HHLA 1GMWD 4IUFA 2BJDA 1UJ6A 1X0FA 4O3SA 1JLBA 4AD6A 1IKVA 4B9VA 1CQMA 1F1BB 1U1OA 1J5EF 2BEFA 1KSPA 4CYUA 2LA4A 5DQIA 2CQ2A 2XZWA 2VD3A 3P45B 2UUBF 1FRMA 2V4QA 1RZMA 4NX9A 4OX7A 3PKMA 2E5JA 2EBGA 3FVYA 1CEZA 3J80Y 3OJSA 3EUNA 2BVZA 1HW9A 1DTTB 2F8MA 5J2PA 1LNQA 4TU7A 1VRTB 3M2VB 2CQDA 5IV3A 1MLAA 3LAMA 3V6KA 5CD4H 5JVGQ 2DRAA 3CB4A 5KFWA 3KLVA 3DDKA 3SEOA 4U8VA 1HHQA 4USMA 3HHKA 1U49A 1HNVA 3GWCA 3OR2B 2CPDA 3BR9A 3B82A 2OPSB 3KK3B 1LW2B 3O44A 2ZZTA 2ZH9A 3L7UA 3P4UB 4RPFA 1N36F 1AA1B 2R8HA 3DKDA 1F5BA 3MUVP 3ENAA 1OY8A 2HS3A 1TFYA 3R27A 2BANB 4U67Q 2NPIA 4K4SA 2XZDB 4X4QA 4W90B 2XY7A 4C8NA 1B7YB 3W62A 4ER8A 2DR8A 2XLKA 2E44A 2LDIA 4LF5F 3DNCA 2Q3PA 3F56A 2H48B 5F8MA 3FCWA 4R5PB 4NLGA 2V2QA 4RO0A 2OLWA 2RDDA 4IFVA 5K14A 1YHQS 4G1QB 3U02A 4K4ZA 3UN5A 5C5JA 5IC6B 2DT9A 3SQGA 4ID5A 4AL7A 1UJ5A 3JTOA 2CPJA 3VAMA 3BN4A 3AXMA 4LFAF 1CLFA 4XAKA 2PO4A 2B5JA 1YBTA 2Y1IA 3FJ2A 4X4OA 3LGHA 1RA6A 2DCLA 5KG3A 1OPZA 4MH8A 4GMKA 8RUCA 2GAHC 5A8WB 1WOOA 5GMDA 1I3OB 1OSCA 4PWDA 5G0RA 4K0KF 3UDCA 3BGRA 5HQ8A 1FT8A 1HQEB 3R7BB 5C25A 4ZVSB 1I6JA 2ILZA 3NXZA 1ZAXA 1YJNS 3MAQA 1ZZNA 2O5DA 1TAQA 5FJ4A 3HVTB 3BJYA 3OR1B 4L76A 3KTQA 4H4KA 4DV0J 1FWLA 2BX6A 1NBEB 2KXHA 1UL3A 4KTQA 2ZH4A 3OUYB 2EFNA 2VH7A 4F4WA 3SV3A 1RWXB 2RVJA 4X4SA 1VJWA 3C6TA 5B08A 4ANCA 1AUSL 2ZDOA 4ED0A 3HULA 2MHEA 1PC4A 5HMZA 3EGNA 1HNWJ 3R5BA 2V6AA 3AODA 1HW8A 2DK2A 2HFSA 1V6HA 4V19X 2FHMA 4USIA 1P6TA 2YWKA 3NCRA 2FJWA 2LA6A 1M1GA 5HN0A 1RISA 4JI0F 3BF4A 5KFUA 1RTHA 3ITHB 1U24A 3TX0A 2BKPA 4ECRA 3N0VA 4P75A 1U4BA 2PI5A 2JZ5A 1S6OA 3AY0A 1UTAA 4QYZK 2HK3A 4TQRA 4K4WA 2CFXA 5CCMA 2RKIA 4IG3A 2A18A 2XS7A 4Z7YA 3SCIE 5DGAA 4KO0B 1M5VC 4U9RA 3MOJB 5A8KB 1TL7B 2XNQA 2E7WA 4YEAA 1OY9A 3W2VA 3UVJA 2C3OA 4ED7A 5HANA 4C8KA 1SIWB 4KV8B 3PTWA 4I68A 2UU9J 1H72C 3MPDA 1G3OA 1YJ7A 3HVWA 2GO9A 3J81j 5DG8A 4Z7CA 3G8QA 4ED4A 3TNVA 1D09B 3CNQP 1PCAA 4QQBA 3KK1B 2DHAA 3C3LA 1IBKJ 4TKTA 2MKJA 3A8JA 2V4RA 1N0VC 5KFYA 2PEHA 5F8GA 4R25A 3KK2A 1RLDA 2G2ZA 2JFDA 2NYIA 5KOWA 4BLGA 4CQ1A 1DQ9A 1RK8A 2B9XA 3N6MA 4JI5F 1N34F 1KNZA 4ECWA 4Q0BB 3SCJE 1NSAA 3N79A 1O51A 2WAQD 3RTVA 2IYIA 1I5OB 2IIHA 5IOLA 2VJVA 4DF4A 2K3KA 3ZC4A 4NXMF 4YY3F 2KT2A 2YVSA 1ZZFA 4C0HA 4ZLPA 2WZ1A 1F5AA 3N9UC 4RW6A 3KLFA 1U48A 4JI8F 2HBRB 2D9PA 3MWBA 2W2MP 2JFKA 3DI6B 4OQJA 4RNOA 4Q2LA 1YKWA 4Y2CA 4DL7A 4U7UD 1S7HA 2OMOA 2D3ZA 4WFBQ 1EZZB 5KFFA 4KQZA 3GIRA 2FC9A 1U26A 4OHVA 2HRUA 3OVAA 1FRIA 4EK2A 2ADBA 3HKZD 3D28A 3G82B 4DUTA 5IT9U 3P49B 3CIMA 1RTIB 2VL1A 3T5JA 1HIYA 2R7RA 1IBLF 2V8GA 2W9AA 1RT2A 1UKUA 1QLNA 3JXOA 1SC1B 3H98A 1XMOF 5DLGA 4K4TA 1OPIA 4ZIVA 3AH6A 1WHXA 2VQEF 2QZ8A 1GXLA 5KAKA 2DHXA 2FJDB 1URRA 1X0PA 3MEKA 1FDNA 4LIWA 4OI2A 3OT9A 1J5EJ 3QGGA 3VAJA 4HLBA 4A8OA 3HP6A 5B0CA 4GC6A 5CA5A 2QN6B 3SIPB 4G1IA 4HACB 5A2QU 2HFOA 3A13A 2XM3A 3TJ9A 2HGNA 1EHWA 3UDVA 3ZTQA 4TY8B 2JHEA 2M4MA 2C28A 1K1QA 3TUJC 2CJYB 3O8WA 3BR8A 2M3DA 5T14A 2QLJB 2IMOA 3QYYA 1T02A 4M63A 4OYWA 2W4CA 1RT1A 5BYRA 3TVKA 3W2WB 3M1VA 3TUIC 1HL6A 1HNIA 3FSIA 4FVCA 4I1TA 4RL1A 2EC2A 4B9MA 3QO9A 5DQGA 4NL5A 3HPOA 5GAEI 4DPOA 2M0GB 4F3QA 2GS8A 1F9EB 2EI5A 4DQQA 5GAGI 4P7VA 1FX2A 2DNGA 2FHKA 2MDAA 4DV7F 4I56A 5F8LA 5LJ3Y 2HS4A 4NLRA 1WOPA 2HWIA 4CLFA 4CH1A 3GIKA 4DL0C 2BRKA 5B09A 4NYPA 3M8ZA 4OI4A 1UZDA 4G6VB 3DOLB 2KG0A 3CMAS 4IQMA 3EGWB 2JVRA 5KFAA 3VCDA 1HBOA 3DDNA 1W2BR 1SQGA 3Q89A 4UZBA 2DGWA 3DLEB 3BGFA 4Q43A 4LF5J 4F02A 2F1FA 4ZVQB 2KJVA 2MZ1A 1S10A 3FZBA 1SH0A 2GIRA 2W7PA 1KN6A 3D3CJ 3R3TA 4PZVA 1C0UA 2M8DB 4LBHA 1FE0A 2F9JA 5EWEA 1VMBA 5HQLA 2ZBPA 2U1AA 4N7TA 2MKKA 1H2TZ 2HFVA 4WPAA 4LFAJ 4FP9A 3UWTA 3L09A 1SV5B 1SKUB 5F9NA 1FTRA 1JXVA 2EFVA 1SJQA 2QO3A 2H3EB 1C0TB 4K0KJ 4DUZF 2MKCA 3KG0A 1SJ4P 1HMVA 4Y2MA 3J7A1 4C7QA 2V8HA 3MM8B 4I4BA 5KT4A 3R6GB 3QWPA 4ICLA 1X5SA 2R8GA 3A8IA 3Q24A 2GNKA 3GFHA 2IAJB 1T9WA 4ZCMA 1S76D 2UUCF 2DD8S 5LSLA 4M5DB 5C7PA 1SCJB 4PG4A 4PPZA 2Z0GA 4MMOA 4RR5A 2QV6A 2PGCA 4EGLA 4WF9Q 4H4OB 1KOOA 3OL8A 3UE2A 1RU2A 3TYTA 4WIQA 5KT6A 4DR4F 4YOEA 3D2WA 1SC4B 2VQFF 1R31A 2WVEA 3KLIA 1RKIA 1AXQA 3KLGA 4DFJA 1RAEB 2ZBIA 3BSCA 4ATNA 3J7Z5 3AAWB 2B5JB 4RZRA 1TUWA 1SJFA 2MZJA 3IC1A 3DOMB 4DG1A 3PIPQ 1OSDA 2G2YA 1WF0A 2W2QP 4WU2A 5IFMA 4DL5A 4X62F 3UCZP 1HQUB 4PUOB 4NA2A 4O44B 3RBZA 2ROPA 2J9CA 1VQOS 4F4ZA 1YTYA 3LP1A 3RJMB 4P2XA 2C3PA 2AX1A 4OJ3A 1NKCA 4TY9A 1RP5A 2P5VA 2I6WA 3ZZ0A 2WVCA 3D9BA 3LPEA 1C4CA 2VG5B 4CM2A 1WOSA 2RAQA 2KI2A 1Y5IB 4I2PA 1YJRA 3PJ9A 1RBOB 1WHYA 3KHRA 2RF2B 2W4DA 3TX8A 2CQ1A 1GTHA 4B3MF 2Z4PA 2X1AA 4EYIB 1CS4B 2RE1A 3CCZA 3FMWA 5HK4A 1FE4A 2X3DA 1ICEB 2VBYA 4MFBB 1RT7B 1AZSA 4I6YA 3MCMA 2ZJQQ 5DO2A 4LR7A 2MLYA 1FFGB 4YN3B 2KHDA 2M52A 3L7PA 4ZVOB 3BDPA 1VBKA 2Z2LA 2YNHA 1X4GA 2JNJA 1X9WA 4JI5J 4ELUA 4OYIA 1HKAA 1N34J 4IOBA 4LSNA 2M9KA 1FNXH 4LREA 1S1WB 2OTJS 1UPMB 1U7LA 3I96A 3Q8YA 3I32A 2ZZMA 1B4SA 1TUVA 4YY3J 1DHMA 4ZP9A 1F60B 1JIHA 4WBFA 5KT2A 4ECUA 2DCUB 2P9CA 5CZXA 2EEYA 5BR8F 5J2QA 4Q44A 1LOUA 2QL7B 4C3MA 4X4RA 1CQNA 3HSZA 4D3HA 3C6UB 1GAOA 2J7UA 4BS2A 1RUSA 2AZ3A 1RTJA 3K5NA 2YWGA 2ILYA 4LUBA 3MCSA 4OJGA 4DQRA 4RNMA 1A6LA 1V3RA 2B4OA 1RAGB 5KG5A 4QPTA 4WK3A 5J2NB 2E7VA 2KH9A 4N47A 1TU0B 2W9CA 5C2CA 2KM8B 3IRWP 5I3PA 1MROB 2VBWA 4K4YA 2R7SA 1BD6A 2DBBA 1GT8A 1CVJA 1RI7A 1TMMA 5IT9Y 4ZP6A 1CSJA 4JYAF 3NS7B 1WF2A 3HSJA 3ULHA 4URQU 1VC5A 1WKJA 1R43A 4WXWA 4LF6F 4CI0B 3GG1A 4ZLJA 1RHMB 3NGRA 2FVRA 4OX8A 1U1LA 3MEDB 3CO9A 2YNFA 4DBQA 2VQEJ 5DZ6A 2RHQB 1YRTA 5C42B 3LP0B 3MM9B 2XI3A 4M5LA 2PT0A 3DM2A 2AZ1A 2ROEA 3CT9A 3D7SB 5AE3A 3L3CA 4H4MA 4Y2IA 3ONQA 4E2FB 1VBYA 1X4EA 5HSPA 2YXLA 4J9VA 4F8RA 3SSQA 4M5GA 2K06A 1QM9A 3ILJA 4CH7A 4I7FB 1Y7PA 1QY7A 4PR6A 2F7VA 2D3OR 4WZMA 2H4WB 4FYWB 3ISZA 3TQEA 1Y11A 4RU9A 4ECZA 2IDEA 5MAOA 1KEKA 1U0HA 1YRXA 1FD8A 3GILA 4GKKJ 2OIHA 4LF8F 1S5ZA 1REVB 2XI2A 1VLYA 4UUXA 3BREA 3IN5A 4WWSA 5LXRA 5L1IA 2FLLA 4QIWD 3M7VA 2AJ4A 1YVFA 4Y6IA 2HVDA 5IZHA 1QE1B 3CJKB 1TFWA 2E1RA 4DV6F 3KJNB 3I0SA 1IR2A 2RILA 4HTJA 4USWA 3KJFB 4ES1A 1CJTB 1X9MA 1NK4A 5LJ5Y 2HNDA 5ETSA 4TLRA 2Z2YB 1QSSA 3OPKA 1UVKA 2PIIA 2R7TA 4H54A 2I8EA 3BGUA 2R4FA 3NS6A 2HHQA 1S0MA 2GVDA 3QZ7A 2D3O1 2ZH6A 1UW9A 4L75A 1YQHA 1K73T 3OVBA 4Q5VA 4Y2KA 3DFEA 2IJRA 2BW7A 3W8PA 4WTOB 5A8RB 2E5GA 4NLDA 4ZHRB 4Q45A 2P8IA 4F4XA 4ECXA 4ZVFA 2AD9A 5KT5A 4NCGB 3V6JA 3ZTSA 3PXGa 3N5FA 4IKAA 3VALA 4EFAC 2DNKA 4FF3A 2FVQA 1IBMF 4LBIA 4JI4J 4P10A 3BPDA 3OVSA 4LF2A 1NZAA 2OUGA 3L7OA 4NLUA 4LF4F 3BGOP 3UR0A 1X4HA 1TMJA 3SQOP 2X1BA 5KFIA 2W2OP 3DLKA 1EJ7L 2EKNA 1RGVA 4ZPTR 1ZH5A 4KC5A 4ZP7A 2NCKL 3S1TA 3MTJA 1JJ4A 4K4UA 2O66A 2RDIA 1VQPS 2NYHA 3WZ0A 2BXJA 3I87A 3UD3P 3KXDA 1ELOA 1V3ZA 1YBUA 2QC3A 4DR4J 2G0JA 2VQFJ 2OO4A 4DL4A 4ECVA 7AT1B 1YJTA 3R2CJ 4QPXA 1S6UA 2M7SA 3GZ7A 1NK9A 2KDOA 2GJFA 3O3LA 2YBVA 2CPHA 1Q53A 1FRXA 4MKVA 1BWEA 2HHWA 2LQBA 2OMLA 5DRKA 2XMAA 3DOKA 1JWWA 4X62J 5F8HA 6FDRA 3G8TA 2R8JA 1AB8A 4PXBA 1JJCB 2W7OA 5JJBA 1LWEA 1R0BG 4B9LA 5D6GA 3VQTA 4FS2A 1RYRA 2JLEA 1RQ0A 1RT5A 4KFBB 1X7VA 4F4AA 3ZTOA 1WDDA 1SBRA 1YITS 1MN9A 4CCHA 3L9ZA 3UD5A 3VAIA 4H4KC 1VQ7S 4JP8A 4DR1J 1WSVA 4B3MJ 4N5SA 2MGZA 1RSCA 1ZOTA 1SQEA 3TJAA 4YB5A 2ZH2A 1I94F 1H3DA 3DRRA 1DLOB 3EM1A 2ACMA 1FRKA 1HBNB 1AROP 3N6NA 2PA3A 1OMSA 1N48A 5D0EA 2KZMA 2V5HG 3UFCX 2XG8A 3NY0A 2HBQB 3TZYA 5HVGA 3M6UA 4DV3F 4O3OA 2K7JA 3EVMA 1QUVA 1E6YB 1NM2A 3W64A 4ES3A 2OEKA 2IC3A 1ACMB 2YX7A 2HHSA 2ZH5A 1P9QC 2AT1B 1TKTB 4PYDA 3V6HA 4LRFA 3MMAB 4MIWA 2E5LJ 1UWAA 3BQ2A 4KT0C 2Z56B 4PXCA 1HBMB 3H25A 1V5VA 2HAFA 1RCOB 3E3XA 1GX6A 2WHOA 3G8SA 1S1TB 3OLBA 4PG5A 4LR9A 1N54B 2JEJA 4FXVA 1KS2A 2NUHA 3BYPA 3H8YA 3MCNA 2SXLA 2XGPA 2RNEA 3QGPA 3I4PA 1KKHA 4FKXA 4F0KA 2WSCC 3ZZRA 3PM9A 4DWIA 5HP1B 1FHTA 3OTEA 3CCJS 2UV8A 3S7RA 4FXDA 1A0OB 3G96A 3DRSB 1IN0A 2K8GA 1SH2A 5KFNA 5HATA 1LWFB 5HO4A 1MSWD 1DBDA 4WE1A 5F0UA 3RW7A 1JLQA 1ZM4A 4IG0A 1BLUA 1WC3A 3Q8VA 4HDGA 2A3JA 2XMJA 1NK5A 3D6TB 2PFFB 5ETQA 2DHHA 1XBWA 2N4CA 2Q66A 1CPZA 4JYAJ 2GGPA 3B8HA 3FNNA 1H74A 4DR2J 1OS5A 1RBAA 2LFVA 2MQLA 5CYJA 5G4DA 2N3LA 1D9DA 5LSOA 3W7BA 3NAIA 3C66A 1IR0A 4F04B 3CCES 1G6BA 4KH1B 4X84A 2N7CA 1S6PB 4ED6A 3RW6A 3K5PA 2ZE2B 1JNRB 2FC8A 2CRLA 3BH7B 1TVRB 1MU2A 1IM6A 2IFXA 2MMYA 4QYZJ 1OO0B 5DETA 1UMJA 2VPYB 3VF0B 5C2GA 3AJ2A 1KRPA 1KQSR 4KKOB 3ELHA 4CH0S 3DLGB 1JLFB 1FFSB 2LQJA 3X1LB 2DNHA 3E2EA 4ZPDA 4U7UK 2WRMA 5ETPA 2YWHA 4OHYA 4MIBA 3JSMB 1RYSA 2HFUA 1S9EB 2DGXA 1L3TA 3NG8A 3D5MA 1NJYA 3H5XA 4RW4B 5CCLA 3H4BA 1RXOB 4OYAA 2MKHA 2QFJA 2L41A 2JRSA 1U6BA 4C97A 5IQQA 3PX0A 2AU0A 3PX4A 3UN2A 2XB2D 3GR1A 5DDOC 1QUPA 1EETA 2B9EA 4DV6J 2OFHX 1AT1B 4JUZA 3VVUA 4YMEA 2R2TA 1XR5A 2ZFHA 1GTEA 1FI4A 2ZZNA 3KDOA 1Z2ZA 3GIIA 4CWBA 5DM6Q 1F2GA 4H4MB 4MKAA 4NLTA 3ADAC 1C1CA 2W8LA 2FGCA 4KHPF 4OZ1A 4OV6A 4CLPA 3RG6A 3BKTA 2I5JA 1TKXA 3U1MA 3DRPA 1W25A 1T05A 4DN9A 3JQMA 4FF2A 4RW9B 3M8QA 4ETZA 3F44A 4BC7A 2JH3A 2IVFB 1MWYA 1F6TA 1JJHA 2G13A 4Q7AA 1CULA 2BE9B 1Y5NB 3I5BA 3R5DA 1S72S 1BQMB 1QSYA 4C0OC 1CJVA 3KJVA 2MLZA 2VPXB 1Q78A 1FEEA 1NJXA 3IMQJ 2H51B 4XPCA 2VUGA 4X66F 3KLHB 3QIDA 2GV1A 3M32A 4DQIA 4M5NA 3AB2B 5GAEU 4E8UA 4ED1A 1TP7A 2WBRA 4ZK7M 1NK8A 2D69A 4LF4J 5GAGU 1NDCA 4I2QB 3H5UA 4KE5A 2F3JA 3MEEA 6FD1A 1KVKA 2QSFA 5EWFA 1UP1A 2XSFA 3DLJA 4CO4A 1GXUA 3QIPA 3RAMA 1HD0A 5D4OA 4F3MA 2IJFA 4HHHA 3SXLA 5GAHI 3QQCD 4UTGA 3AOCA 1S49A 4RW8A 3N6LA 1HI1A 3DMJB 4DL6A 4LRCA 2H5EA 1QAJA 1R3NA 1WC6A 5I3QA 2HK2A 3T1AA 1DTQA 2LU2A 4ED3A 4HKQA 2DISA 2XEXA 1YJ9S 3RB3A 3VAKA 2QT7A 4WFAQ 5U47A 1GQEA 2V4JB 1S57A 1HNXJ 1IKWB 4JI3J 3O6QA 3M2UA 1JLEA 3EZ5A 2BE2B 3PHTA 4WYWA 4DPUA 5KFQA 3Q23A 1T95A 1ZS6A 3DYAA 1L3SA 3KMSA 3POTA 4NYOA 1S1VA 5E33A 4YR0A 2CNOB 2K3IA 1GX5A 1S6QB 3PDNA 2DO0A 2C42A 3M2RB 5D3GB 3NGTA 1YZ7A 2BMBA 2UXBF 1RT6B 2M70A 2ZVSA 1N5YA 3GV8B 4ZVTB 1VISA 2KHCA 3Q8PB 1VHIA 2AJ0A 4CT8A 3P5BP 1RJJA 3H42A 3I9V9 4KHMA 4CTAB 4K4XA 2DY9A 3SFGA 1I94J 4USUA 5K9FA 2J9EA 3RAXA 3RBEA 2W01A 3CCRS 4DSJA 2MJUA 4YB1P 1DRZA 4DI6A 3MM5A 4WP3A 2DHSA 4MIAA 2FYXA 2RMLA 2Y3YA 2DXFA 4LRDA 2QA1A 5KFEA 4EBEA 4LFBJ 4DV3J 4R8UA 4O4GA 1R8AA 1CJUA 5KFVA 5L38A 2E5IA 4DFMA 3FCHA 3H90A 4A8WA 1K9MT 1WKKA 1APSA 1T9XA 4L3NA 2CDQA 5KFLA 1RWKB 3T9NA 4XIUA 3MPVA 3GG0A 3MD1A 5DQHA 1FCAA 3H5SA 3N28A 4BCAA 2BUNA 2ZKTA 4JI6F 3H4DA 2K1RB 1Q5VA 3MR7A 2ZD1B 4NMLA 3EE3A 1W7WA 2VFUA 1HWKA 5AE1A 1U2FA 1IKYB 2E1MC 2RS8A 3ET6B 2RQ4A 2VF3A 3CW2C 2EWHA 1UFWA 1YG0A 3HSGA 4LF7F 1N33F 4P2FA 2KFYA 2YNGB 2I2YA 1BHNA 3GE9A 3QRPA 3IS9B 1PILA 4A8MP 2FJBB 1WJ9A 1RT3B 1QVFR 4HT7A 3NCQA 2XLJA 3G6ES 2A6OA 2AW0A 4HDHA 4UY8T 4P73A 2UVRA 2BQ3A 3PHEA 3PW7A 1UVJA 4CO5A 2RRNA 3G2XA 3K89A 4DU7A 1DTTA 4AXJA 1X4CA 2Y1JA 2CPZA 4LF9F 1VRTA 3M2VA 4NLOA 3EZUA 5KG6A 1PKUA 2RU3A 2ZH8A 4B9UA 1Y4ZB 5E2QA 1WC5A 3RRKA 5EX3A 1F2HA 2H1YA 4JV5F 3OR2A 4LT6A 4YDDB 2OPSA 2HNYB 3KK3A 1LW2A 4OLPA 4F0MA 5JVHQ 5E3CA 2MQQA 2Y1LB 4CO1A 1MMLA 4HHJA 3FEZA 2YQ3A 3I82A 4K5RA 2MY7A 3VQSA 2N3OA 1HNZF 4UUWA 1C2PA 2FJAB 5LT5A 1AYEA 3G4SS 3ZO7A 2LP4A 2RUGA 4N8OA 1J5OB 2BANA 3B4MA 2LYVA 4CLZA 3JTNA 4PKDB 1C1BB 2AJ2A 2B6AB 2QGFB 4DCOB 3NNAA 5A76A 5DJBA 1U45A 4PQAA 1ZA1B 1SKSA 1H7XA 2FHOB 1R6YA 4G1QA 5LL6d 5B7WA 2IPOB 5ETNA 4C11B 4PQUB 4DEZA 4WTYA 4B3OB 1BMQB 4W98A 4DPTA 1ZPVA 3MGJA 1M5HA 3TW0A 1FRHA 3AA8A 5CQGA 4L72B 1QAXA 1HPZB 2XY6A 5KFZA 2BRLA 4FNIA 3LA0A 1OYEA 5T7LB 5BYSA 4GVBB 3FGVA 4YFUA 1VFJA 1NJZA 5A8WA 1VJQA 4M5JA 1EARA 1H38A 4KHPJ 3GSIA 1YRUA 2JJ4D 1EKRA 3HJFA 3FEYB 1DJ0A 1TV6B 1HQEA 3PACA 4J9QA 3MHYA 3FFIB 4Z37A 2ZH1A 3HVTA 3LAKA 4USJC 3OR1A 2HSEB 4DCJB 4ZVUB 2CQGA 1U47A 3OUYA 4OZ0A 3K8WA 4RBTA 2KYXA 2QTWA 1TAUA 4ED2A 1KFSA 3FRYA 3N4WA 3Q2TC 3TQ1A 5EGYA 3O5TB 3QFHA 3A12A 4TU8A 3M8PB 5KFSA 5B0FA 1VK8A 3HFKA 1TZ0A 2LQ9A 2WSFC 1LQ9A 2L08A 4X66J 2DR9A 5CAAA 3QSIA 4MKYA 3KHLA 3ITHA 1YIJS 3NS5A 1WG4A 2V9KA 2C2RA 5SUHA 2XS2A 1HQ2A 2ZEJA 1Z4UA 4NA1A 1Q81T 3I0RB 4ALZA 4FS1A 3KUEA 4KO0A 2CPIA 1WHVA 5A8KA 2N82B 4DF8A 4KGVB 1TL7A 2JEGA 4OHWA 4PABA 2VA2A 3CJ4A 2BJ9A 1O8BA 1CC8A 2KFZA 4KV8A 3QFWA 2X3GA 3MAAB 4I0WA 2OJ3A 7FD1A 2KXNB 2X1GA 4C8ZA 2HAIA 2CZ4A 4PG7A 5THWA 2H9ZA 2HIYA 1K0TA 3EDRB 3HCXA 5IC4B 2OD4A 2CUYA 1T11A 1TL1B 1QAYA 4MK7A 3L95X 3KK1A 5E3PA 4P72A 2DIUA 2XC9A 1PSDA 2LLZA 4QWEA 3ZNUA 2QLFB 3Q0AA 3GONA 4YUDA 4JI1J 2DEIA 2DNOA 1S4EA 2WK4A 4FPIA 1VIOA 3K5MA 2B0GA 4ZN1A 1M5OC 3MEEB 1SB6A 2NS1B 4MT1A 2AWZA 4F4YA 3FSYA 3JQKA 3QT6A 2DIVA 5IWAF 3W9IA 3ZZTA 4Q0BA 3R9LA 4QWBA 4PEOA 1KQKA 2UXBJ 3BQ1A 1KOHA 4WFNQ 4L3KA 3LWMA 4TU9A 3NKYA 5KG1A 4OYPA 3GLJA 4K2XA 3VZHA 1XWLA 3I9ZA 1QSLA 4A47A 2IYGA 4KBIA 4A8FA 1N5QA 2WTFA 4B3TJ 3VGUA 4DR5F 1RCXB 5DG9A 1ROFA 3EVOA 3DI6A 4OZ3A 3H0PA 3Q8QB 2QG9B 3NGSA 1XJWB 2A10A 2GX8A 1IJEB 4YHHF 3VZIA 2FY8A 3S01A 3RR7A 2HNZB 1MG7A 5CYMB 2EG1A 4USVA 1FEHA 4NI2B 1HR0F 4ZCKA 1D0EA 2V2VA 3MDFA 4FYDA 3MFHA 1D8YA 1RDRA 2RB7A 4NRUA 3QZ8A 3G82A 3AB4B 1P27B 1RTIA 1VC6A 2IM0A 5IS2A 5J2MB 1JNZB 3PX6A 3K17A 4C6AA 1L3UA 2A0FB 1U2RA 4IO1A 1Y5LB 4J91A 4KSEB 3RZAA 4JI6J 1FNOA 1PYSB 3MMCB 2COLA 2ADCA 2FVCA 2RQCA 4NXNJ 1VLOA 2O1PA 2DITA 2XCPA 2OP5A 2YKMB 3WDOA 3FBCA 3DLLQ 2KVIA 4DR7J 1SI9A 1YZ6A 3BQ0A 5LOQA 4HACA 4J9OA 2YX1A 5DDPC 1CJUB 3BKUA 1DFDA 3UD4P 2I38A 4TY8A 3NAHA 3UN3A 3HHNB 4QCLA 2AJ1A 3D1QA 2XO7A 3EGVA 5CH7B 3MI7X 1FKOB 1ZETA 3W2WA 2CQ0A 2GQCA 1S0OA 2CJQA 4V19J 3V2UC 2ZHOA 1S59A 2V69A 2ASLA 3WC0A 1WWHA 2OI2A 3Q8RB 3AJ1A 2GQQA 4JV5J 3AOAA 3UDEA 4N8NA 1Z1ZA 3ILLA 3EGZA 4ZOSA 2CJ9A 4F25A 4W92B 1VRUB 1HNZJ 2HW3A 1VYAA 1FKPB 2AJQA 2VONA 2AIRB 1R89A 1FXRA 3CJRA 3DOLA 3DLHA 3QJLA 1BQNB 4DPWA 3IRXB 5HBMB 2HRTA 1T8EA 4P2MA 2ASJA 3DLEA 3UNGC 1TL3B 3G87A 3GYGA 4U8YA 1JMTA 2C22A 3QRQA 3QAEA 2BA9A 1S1UB 4NLVA 5ETVA 1WTBA 1OIAA 1Q82T 2NPFA 1JLCB 3RUBL 1R0AB 3HDSA 3OXFA 2CG8A 1YWXA 4B3RF 2B8PA 3EXCX 2VBXA 1WG1A 2OPRB 4ZPVR 2N7YA 1SV5A 2GHVC 3N5BA 3D6FB 2LECA 3H59A 2CJKA 2NXUA 1PC5A 1Q8BA 4QWCA 1C0TA 4CLLA 4ECSA 4OZJA 1PYOB 4O4RA 1FK9B 2B4VA 3MM8A 3C2PA 3CCQS 2NUUG 3PW2A 2VFSA 2IDLA 2J9DA 5K20B 3O2IA 4HR2A 3E01B 2IAJA 2VASA 4ZMMA 2RHSB 4M5DA 3W66A 3D66A 2HURA 4QOTA 3TARA 3NOCA 4YQWA 4QW9A 4AUKA 2JEIA 1NKBA 4H4OA 5L1KA 3T19A 2CQCA 2Y8WA 4ZVGA 4DLGA 1JLGB 5F8NA 2CPXA 2VA3A 4K5SA 4OZ2A 3T6BA 2FLPA 2V2ZA 2C3YA 3JTPA 4XDCA 1ZTTA 3PW0A 2WONB 1ZA2B 2L48A 2KRBA 3LP2B 5L9XA 2BQUA 2HVZA 2MHNA 3RB4A 3BKFA 2HQIA 3HVAA 4N41A 4DPXA 2QLBB 5DLFA 2Q1LA 4CO0A 2ATLA 4LMZA 1RWUA 3DOMA 2OEJA 2ALZA 4WYLA 1WACA 4LFCF 3RB6A 1N5TA 3FBBA 3H40A 1HQUA 2QYGA 3K5OA 4PUOA 2BQRA 4EEYA 4O44A 2VDHA 2FZGB 2R9LA 4IOCQ 1UA0A 4UY85 1OYDA 5AJ3F 3CCTA 4M5KA 2UP1A 1M1KT 4TVAB 3KUGA 1UCNA 3DU5A 2XHCA 1WC0A 2R7XA 3HKWA 2VG5A 3NMRA 1F3VA 3M8SA 2LXFA 2W25A 1Q1KA 3GSDA 4J37A 4F2SA 2RF2A 3ZZPA 3EVWA 1RACB 5B0BA 3K58A 2M2BA 1HBUB 4CLSA 4IOAQ 1CS4A 1JKHB 4DX8H 4DV1J 2F4VJ 2EC0A 1HI8A 3QNWB 5IM0B 4EO8A 2VPWB 1HI0P 4RWWA 4MFBA 1RT7A 3IP0A 2E7XA 1GXTA 1FDBA 3I5AA 4NYZA 3W8GA 4AYBD 4ZLLA 3SDEB 1AFJA 3C15B 5IWAJ 5DGBA 1RHRB 1S1WA 4FBTA 3KYLA 3LQVA 4AE5A 3IAS9 1RE1B 2EKYA 2EW9A 2XS5A 3TI0A 3OHAA 4DR3F 2YY3A 2YTCA 2BM1A 5ETLA 3TAMB 1PAUB 1KFDA 2MKIA 2WB4A 4DLEA 2WBMA 1YI2S 3V6DB 3CUNA 1NB2A 4OI0A 4DSLA 1EX8A 2CJAA 3C6UA 3H2UB 4I67A 1SJ1A 2DNQA 5GAHU 3UNYA 1N32F 5I42B 2CPYA 2ZOMA 1YBAA 1KHWA 3JSRA 1Q4RA 1U1RA 5LMUF 4UF4A 2YNIB 3C14B 3OL7A 3QJPA 4IDKB 4X4TA 1HR0J 4KY3A 5J2NA 1XC9A 2V63A 4OI1A 2HVIA 2O67A 1AFIA 4NE9C 1MROA 1VQYA 2DH7A 4K59A 3NWGA 3WC2A 3W1YC 3M30B 2KB2A 4E98A 4M5HA 2RRBA 4LIRA 1PG5B 4NLWA 1S9GB 5K8PA 1XMBA 3G6VA 1EP4B 4L6V3 5L1JA 1NPRA 3DGPB 1XERA 1YX2A 3MEDA 5C42A 3LP0A 4EUVA 3EDQB 4CO3A 3RRHA 3MM9A 3DRYA 2M88A 2NSCA 3D6HB 3DCAA 2V50A 4DS4A 4QW8A 1BUXA 1T03B 2ZH3A 4OZNA 3OSPA 2CNLB 2C2EA 3DXSX 2D74B 1VR6A 2FTRA 4IRCA 3DHWC 3NEKA 4NLXA 3LO3A 3R5CA 1M5KC 4UT4A 3P6YC 4I7FA 5KFTA 1YJWS 1WEYA 1VQLS 4IR9A 4DV4F 3NBPB 2W7AA 2VG7B 2DKOB 3V81B 1VK3A 4IRKA 4FPRA 4IFYB 2ZM6J 5H9EJ 3M9OB 2CNKB 1XIQA 4JI2J 1REVA 4CLTA 4FVMA 3BBCA 3LGMA 2H4YB 2XYPB 2CQHA 4F26A 2GHPA 1QE1A 1TUGB 3CJKA 2VDIA 3D67A 4B3SF 4Y2AA 3R8YA 4KIAA 2DY1A 1CJTA 3MECB 1UZHA 5LMNF 1BQXA 2CG4A 3P5TL 3LW5C 3J80U 1WF1A 1NK0A 4F4KA 2EFQA 5ETKA 1YDLA 2YH0A 2UUBJ 3GU0A 4WP9A 1IKXB 1Y10A 3K0JA 5DM7Q 1MWZA 2JDJA 1SUQB 3ZTPA 3UI3A 2JLFA 3CD6S 3PO4A 2CIMA 5A8RA 4QZVB 5I3UB 2HYIB 2P2CB 4ZHRA 5HVFA 4DSFA 3A3NB 1SC6A 2J8SA 2HQ3A 3SCKE 2BYCA 4NCGA 3GB0A 3ENVA 4B3RJ 1FTCA 3BO3A 1T94A 1F5CA 4U96A 1UJ4A 4NLQA 4KHRA 5E3RA 2XSJB 1X4AA 1SIZA 2YKPA 2QL9B 2PI4A 1OQ6A 4ZITA 5D77A 3SSSA 4KB7A 2DPJA 1T3OA 4WJBA 4YB6A 3JYTB 3SV4A 2IA0A 3EWGA 1N36J 2YX4A 1GMUA 2APOA 2IRUA 2N4DA 4U6PA 4C8YA 3UPFA 3R1LA 2JLGA 4FN5A 4KYZA 4N76A 4J9RA 1RAOA 4NOHA 2VFVA 1IM4A 3VVTA 3PJWA 2JWNA 3AD7C 4C4WA 1OJ4A 3FSXA 1FKAF 2KRRA 1UWBB 2X1FA 3B78A 3MF5A 2ZWOA 4C8MA 2Q6CA 3NMAA 2KTQA 4WFZA 2RRAA 1RTDB 2HZCA 2VB6A 1NSQA 3T1YF 1S9FA 1UW4A 1FRJA 2MZQA 2DGUA 3G71S 2B9WA 2VJUA 2YWFA 4BDPA 3MTKA 2UVWA 2NQPA 3EPGA 4OYZA 4A8KA 2GJ2A 4OZ5A 3SFUA 2EXUA 1VQMS 2RT3A 4LFCJ 4NASA 1YJUA 3EPIA 4B17A 2HQDA 2QIFA 4DV0F 3ENQA 1WHWA 2AF6A 4C2MA 1LWCB 1B70B 2IVYA 3HFVA 1LXNA 5AJ3J 4PCQA 5FD1A 2QE5A 3BSAA 4KGMA 4KFBA 1DQ8A 1BGXT 5KFBA 2IBKA 1ULRA 3HHEA 2GMJA 2Q6BA 3CGIA 4DSIA 3DDIA 2YKNB 2XMVA 2LEAA 1VQ9S 1KLMB 1Q5YA 5A6WA 2RS2A 4F50A 1W2IA 4LBPA 3R5AA 1MMNA 4QR1A 3W61A 1HYSB 1JJ2R 2B4PA 1MN7A 5E41A 1SJRA 2IY5B 2V67A 1DLOA 4JI0J 1HBNA 1NH8A 3OFFA 3FRZA 1G2EA 4USKA 1S77D 3OD2A 3RBDA 3QT7A 2RIJA 1X31C 4HH1A 2J6UA 1WI8A 1E6YA 4DMZA 2DNYA 2W8KA 4IH6A 1TKTA 8AT1B 2DGQA 4ELTA 2GAGC 3CCMS 3MMAA 5J1EB 4AL6A 4P74A 4X64F 3QLHB 1WC4A 1NLKL 5LXYA 2GIFA 4DR3J 1HBMA 2QLWA 3OV7A 2DNZA 2WW8A 4ZJOA 3CMQA 1GNKA 3R97A 2XLIA 1S1TA 1XK8A 5KFPA 3CE8A 3F41A 1R8CA 2J9DE 4CNZA 3JSBA 2R8KA 4D3GA 3IBCB 2Y8YA 4KAIA 3ZXWA 1ZAVA 1FO1A 2JC0A 1U1MA 5HVHA 4O3RA 2CZ9A 5HP1A 3Q22A 2MZSA 3DRSA 4B02A 4YS2A 1ZBTA 4AQYF 1LWFA 1RT4B 2KO1A 1F9HA 4RW7B 1U25A 2V9WA 4PAAA 4OYBA 4I6AA 4KJIA 3IGNA 4KPYA 1B3TA 4S0MA 2Q43A 4FF1A 5E7OB 4NXMJ 1N5SA 4AL5A 2YWWA 2A2DA 3BSNA 2ZNYA 2RH3A 3KG4A 2C3MA 3IWNC 1RWMB 1R0CB 2P6SA 5FDLB 5IXUA 1R7IA 3QAUA 4ZVEA 3J7AN 4O23A 4JI8J 4DCPB 2MQOA 4ECTA 1F3FA 3CMES 3OJUA 1S6PA 2W24A 4J9PA 2BOAA 4URGA 1A7GE 2PE8A 2ZE2A 2DGTA 3MM7B 3MM6B 3AQOA 2V8DA 1TVRA 2B7CB 1G7CB 1WORA 3UDLA 5CZVA 4MKBA 4OX6A 4K50A 2PFDA 2DXEA 4KKOA 1KDNA 3M6XA 5L9NA 3TAPA 2OFGX 3DLGA 1JLFA 1U0SA 3J81U 1TKZB 5HROB 4ZKAA 2MLXA 4CRJA 9RUBA 3JSMA 3J7YI 1JXLA 1DQAA 1S9EA 3IG1B 3Q8UA 2KT5A 1IBLJ 4RW4A 5C24B 4EYHB 4E0DA 1HFEL 3PYEA 1WI6A 4UZCA 1EKSA 1LXJA 3V4IB 1IQTA 4HEA9 2HKEA 3T3FA 4M8LA 1XMOJ 4Y34A 3QPIA 4EBDA 5DS7A 1XNRF 2G4BA 1RAAB 3J7ZT 2FD2A 2C2ZB 1BY9A 3CJ0A 4LRAA 4B3SJ 1NO8A 5JMNA 4WIIA 5AE2A 3MURP 2MKSA 3H5YA 3W65A 4P7TA 3I31A 2CVEA 5KFRA 5LMNJ 2DGSA 2VOOA 1JB0C 2V68A 2AEJA 2VBZA 3OTOF 2HS0A 5ETTA 5GADI 1YJVA 2GJIA 3MR2A 1VBXA 4Q8EA 5DZ7A 1FDAA 2D41A 4V1Ak 1BC6A 3V5RA 4NCAA 5A2QY 3HHLD 3VAFA 2G0CA 4PG6A 3G6XA 5ETMA 1LK5A 1K47A 2IHR1 4USHA 4RW9A 3WQPA 3PYDA 2ZUAA 4DFPA 5B0EA 1WELA 4QR2A 3KLEB 3W9JA 1UEVA 5F9LA 4J9NA 2HHVA 1Q95G 3A1YG 5KFHA 3HM9A 4BBYA 2XHWA 2KKHA 2GIQA 2LEBA 4RNNA 1BQMA 1UFLA 3X3UA 4NPOA 3IM9A 4OMFG 4LSLB 1RAJA 2XWYA 1XMQF 2E5HA 3VAGA 3NOGA 3TO8A 3IBWA 2XCAA 3BO4A 2J7WA 2K7KA 4DV7J 3M6WA 3KLHA 2J76E 3ETOA 1RHKB 1SC3B 4C9DA 1FJEB 1UVIA 2WOMB 2VKRA 4CM0A 3HHLC 2HBYB 4I2QA 4X4NA 2Q79A 2C2MB 3PRVA 2E29A 1PBAA 2FJEB 3B54A 1KQGB 4B08A 1TL5A 4QWDA 2Z30B 1LFPA 4HH0A 1S1XB 1RU1A 2BJ1A 2LMIA 5AXKA 5CYQB 1D1UA 4HI2A 1FWKA 3TUZC 2J6TA 2W9BB 2BDPA 2ZBCA 4DFKA 2B3TB 4W4MA 6AT1B 1S12A 5GMEA 3DMJA 2FB0A 4ERDA 3QMQA 3T1YJ 3EJMA 2HQCA 3NLCA 3M9MB 5AXMA 1U1PA 4UOCA 2QJ3A 4ZA1A 2VG6B 5A0YB 1NJWA 3BBBA 4CZCA 2HQGA 2R8IA 2V4JA 4EO6A 2GMHA 2HMIB 1IKWA 1NEEA 2ZHAA 2AP6A 2OPQB 4DUZJ 4O0NA 2BE2A 1SPBP 2QL5B 3PYGA 3RBXA 1FA0A 3EMTA 4NLSA 1YK9A 2UV8G 2CWKA 2Z8QA 3T1HF 1D9FA 1N6QB 4OZLA 1FFWB 5J1NA 3PKYA 2YH1A 2VHGA 1RAIB 1WG5A 3D6MB 1S6QA 5ADZA 1JQGA 3PR4A 3SI8A 3A8EA 3M2RA 2UUCJ 5KFDA 4J5OA 5D3GA 1E6VB 1REGX 3LTOA 4ANDA 2ZDPA 3F73A 3CVKA 1YSJA 4UOGA 1RT6A 3OBIA 3C46A 3A3OB 2GA7A 4Q2MA 4ED5A 4RUHA 3Q86A 3R7NB 1IR1A 4ENOA 2ZVIA 1WNEA 3T5HA 1L3KA 3I56S 4ZJLA 1X9SA 1JLAB 4LVNP 1VS3A 4CTAA 3HI9A 2DGOA 3K5LA 5HAOA 3K7RA 2H54B 3NNCA 3IR5B 2E1AA 1VIXA 2R2UA 3FBEA 2HQFA 3IFEA 2FDNA 3HO1A 3D68A 4Y28C 3FQLA 2BZ2A 4KRWA 4L73A 5K8MA 4DL3A 1KR4A 3FC9A 5EX0A 5H9FK 3HZGA 3CSKA 1T9YA 3TVYA 3PFEA 3KOAA 2Z2ZA 1TR0A 2W2NP 3MPWA 2JSXA 4DS5A 1NK6A 3MMBB 4X64J 3GCXP 2P9EA 2IRYA 4TYAA 2YPZA 2YKOA 2AV5A 4TN2A 5F0WA 1ITPA 5MLCV 1QTNB 2K1RA 3C16B 3CJ5A 4J9SA 1IXKA 3W63A 3RRGA 3H20A 2ZD1A 3IR6B 3VAHA 3HVRA 2H5JB 4FYXB 3MEGB 5KFXA 2HZVA 4GVLA 1IKYA 3ET6A 2AYEA 4JV0A 1QTMA 3BSOA 1H73A 2R7VA 2YNGA 4ZCIA 4AQYJ 4OI3A 3IS9A 1U1NA 1UEKA 3W3SA 4PG8A 1PIEA 3FKBA 1RT3A 4FXWA 2O3DA 3RU0A 2JVOA 5D0HA 4PWWA 3OLAA 4DZDA 3LOUA 4QU6A 3MXHP 4CO2A 2C2NA 2QYCA 1LW0B 2PD1A 5T41A 1HWJA 4HT5A 3IM8A 1CJKB 1QJHA 2E9ZA 4A8YA 3Q83A 3PEHA 1D9AA 2AHOB 1SQFA 3NP5A 2CJBA 3O1LA 3TUPA 4EU0A 1LV5A 5BR8J 2RD5C 3WIVA 1S0NA 1F9FA 2KXFA 4RUCA 4JBCA 2HNYA 2J5AA 2GVZB 1FD2A 4GKJF 2XULA 1N88A 1VCTA 4ZLNA 1N4LA 1FRLA 3T6JA 4M5IA 1J5OA 5K8NA 2F5GA 3GTYX 4FNHA 2BJ7A 1WC1A 1C1BA 1B0VA 3H7HB 2XGQA 3KHGA 2B6AA 8ATCB 4DX5A 1J2VA 2FHJA 2V2KA 3J81Y 4EBCA 3VR1A 1SL0A 1T7PA 2A1BA 2D9OA 4GRSA 2CXEA 2YKAA 1O5JA 4DX7A 3VV2B 4LF6J 2KM8C 1FX4A 1XNRJ 4PQUA 4C11A 3IO1A 2AX0A 1D3WA 4B3OA 4WP8A 4WZQA 2XY5A 3NGDA 4KR0B 4C3KA 4OYMA 4ELVA 3FBFA 4DSKA 1HPZA 2OPPB 3TANA 3HD1A 5T7LA 3PVXA 4GVBA 4OIXA 4ZVPB 4PPDA 1QD1A 1PJ6A 4KH0B 1HWUA 1NCLA 3OTOJ 4RNHA 4P52A 3HF5A 2NREA 2UUAF 2OTLS 3GYXB 1TV6A 2UXDF 2DJWA 2QX0A 1MNEA 1FXLA 3FFIA 3BV8A 4X65F 1HD1A 1LWXA 3M8WA 3MZIA 4GKKF 2BJ8A 3B6BA 3CCWA 1KONA 4LF8J 1I1GA 4Z2XA 4HYKA 1VRQC 3VHQA 2DO4A 2DR7A 1M5PC 2OELA 5CHCB 3HHLB 3IXQA 1NUEA 1JLBB 1NU4A 2LEPA 1IKVB 1XMQJ 3M8PA 1VI7A 4CT9A 5M2UA 4XPEA 4CYUB 2R7OA 3WX4A 3CWJA 1L3VA 3F0NA 2UZAA 4Y65A 2ZITA 1GK8A 3CDUA 3KFWX 4ECQA 3MD3A 4WK1A 3KHHA 1V9OA 2HZAA 1EQ0A 1FVSA 3I0RA 1UETA 3PIOQ 5FLXU 1Q7LB 2WCXA 3S8SA 5J2PB 2FZKB 1O6XA 3R5GA 3JS9A 2UVUA 5BXIA 2IBOA 2HVEA 1FJ7A 5KTQA 1UPPA 1HNVB 2KFNA 3MAAA 3EXYA 1UFKA 3TZXA 3DC2A 3HSDA 4ETXA 2FIUA 2OD6A 1GMVA 4OHXA 2Y0SD 3PW5A 4G65A 2MJNA 2AQ4A 4JI4F 2Y0BB 5IQ6A 2WW4A 3BH6B 2PMHA 3ISND 5B0DA 1TL1A 3G9CA 1IBMJ 2XYGB 3PR5B 1X4BA 2R42A 3I55S 1IQZA 2EFOA 3D1HA 2ALYB 5LM7E 3T1HJ 4F3OA 1RWVB 4IFVB 4LSZB 1KVIA 5AXLA 5K14B 4MYTA 3UQSA 5L1LA 1FJGF 2HHUA 3CTRA 4WU3A 3SQGB 4ID5B 3MR5A 2KL8A 3ILIA 3M4XA 4FZVA 3KNGA 1H98A 1N52B 2ROGA 4IRDA 1H6KX 5HQMA 4ANEA 5H9EK 2R3VA 5F8JA 3CD0A 2NZCA 2ZOFA 2B9YA 2HHPA 3ISNC 1B99A 1NSKL 5HJXA 1PYTA 1ZM2A 5KFJA 4PWDB 5G0RB 2CVIA 3LUYA 3BGRB 4CP5A 2EFGA 4OL8A 2Z2MA 5C25B 3FK4A 3FMBA 2VU5A 5HMYA 4F0HA 2HNZA 2GZOA 4LRBA 5CYMA 1U6ZA 4ECYA 5FIIA 2LXUA 5ITHA 3CCLS 2JOQA 4NI2A 2CQ4A 3D0GE 2PA8D 4C8OA 4ZVHA 3MMJA 3K2YA 3QT5A 2FY1A 4FYYB 1JXEA 3FUYA 3P8BB 1GFWB 3PW4A 4J9MA 3C6TB 3OW2R 5J2MA 2PMZD 3ZZYA 2DYAA 2POKA 3NRBA 2GMLA 3HT3A 1X60A 3OHBA 3RR8A 5M2RA 2CA9A 4B9NA 2XZTB 4DR1F 4CLKA 2U2FA 2XWXA 3BN7A 4A8SA 3BPSP 2OSQA 1DAXA 3BGLA 2XMUA 1RKJA 3LH2S 3CC2S 3BDEA 3MMCA 4ED8A 3VTIA 2ERRA 1RTHB 1U1QA 1ZTWA 1XTZA 3CCVS 1P8GA 1K8AT 2FLOA 3W5YA 2YKMA 4KPCA 2KU7A 3WX8A 3GV5B 2RKIB 4IG3B 2BW2A 5KFCA 3PZPA 4JI7F 2DXDA 2VFTA 3BM7A 2JEFA 3AT1B 4A4JA 2R2RA 2BOPA 1B7FA 1J27A 2V34A 4NCBA 5KG0A 3W2VB 3CIZA 3UVJB 1ZPWX 3KJQB 3PJXA 3GPAA 3CD5A 2ZH7A 2E5LF 1U6FA 4FF4A 1R8PA 4C8LA 1RAHB 1FKOA 3DN9A 2V8PA 3TZWA 2ZOGA 3CDEA 2ZC3A 4CIOA 3I6PA 1D8ZA 2W2PP 3NWRA 2MQPA 1WD6A 4P71A 1RHJB 1WTFA 1GEHA 1Y3KA 4QU7A 5J1PA 1WEZA 3GFZA 2DRDA 2LDYA 3QBCA 1LFWA 3QJJA 3SMZA 1WSRA 4MAKA 4GKJJ 5K8OA 1VRUA 3KK2B 1PAEX 3PV8A 4TLQA 3GIJA 1FKPA 3QATA 3AXKA 4RKUC 4WFXA 5EWGA 2HPUA 1BQNA 2VFRA 4R0JA 3CC4S 4P2SA 3AOBA 3IRXA 1MWQA 3RYLA 5HBMA 4BC9A 3SBMA 1NAQA 1TL3A 4OV1A 3QWUA 4DR2F 3D1OA 3D3BJ 2DB1A 2OEMA 1U1KA 4LVOP 1SXLA 2Z57B 2I0XA 1S1UA 5JXSA 2RU9A 4RW6B 3KLFB 3MCOA 2C1EB 3TA0A 2CQPA 1V3SA 1JLCA 1R0AA 2EPIA 1HHSA 1U2CA 1TKDA 3LPYA 3TR5A 4A8QA 2OPRA 3HFZB 2H65B 3ZZOA 5H1SV 2ZWPA 4KGXB 3OL9A 5E5NA 3M8RA 2XO6A 2E66A 3N01A 2F63A 2J0QD 2UUAJ 2LQ5A 4EMDA 1XNQF 1VDHA 2UXDJ 2HFZA 1FK9A 4O3PA 3QGIA 4IO9Q 5EN1A 4EWTA 5KOXA 4X65J 3E01A 1NNDA 1RT2B 3I5CA 2YQ1A 3LGNA 4RNFA 2UVVA 3CJ3A 3TWZA 4U7CA 1Q8IA 4JV2A 3OXLA 4NZ0A 2L9NA 4CLUA 2G2OA 5F3TA 2QFIA 3U27A 1VOMA 3EICA 1JLGA 2BM0A 3JB9k 4XO0A 1NHUA 3FZ2A 3IR7B 1NPKA 3J7YU 2FUG9 2FGOA 1AUDA 1RB0A 2WONA 3IWLA 3LP2A 1RABB 5I4MA 4TNOA 2EVZA 3E51A 4F7VA 1TELA 3BEGB 4G1PA 4CLWA 4RUBA 1RT1B 5D8HB 4X4PA 3M1VB 5FLXY 2D1CA 3HJVA 2G1DA 1HNIB 1I51B 3GMGA 3QO9B 1FESA 2GQ2A 4DR6F 5GADU 4Y0FA 2MY8A 3JQJA 3CCSS 1IWAA 1FXDA 3UO0A 5IT0A 3KNAA 1N8RT 4WKRA 4ZP8A 3T41A 5EUHA 1HBUA 2DNLA 2K2PA 1BWVA 4PRFA 1X8DA 4C48A 4F2RA 1JKHA 3EYZA 4YP3A 2HHXA 4NZ7A 4PYAA 1Y9OA 5IM0A 2GFFA 1NHVA 2AYMA 1HBOB 4J7CA 1UEUA 3R1HA 1TTHB 3OTBA 3MR3A 2OSRA 3UR3C 1QAIA 2CJXB 2AGQA 5D4LA 3HK2A 2VC0A 3SDEA 4OYXA 2HWTA 2HIQA 1FJGJ 3C15A 2HHHF 3M8YA 2ZBRA 1C0UB 1KVJA 5KG4A 2MXYA 4DN0A 3UCGA 2F8EX 2MZTA 2ZJPQ 5D0RA 3RAQA 4BWJA 5D4NA 2KYZA 2VKZG 2J0SD 2R7QA 3TAMA 2V94A 4I69A 1QDUB 3V6DA 1HNXF 4RX6A 4JI3F 2WVDA 4NZ6A 4OI6A 1WKLA 2LXIA 3HLUA 3OL6A 1SVDA 2C2OB 5I42A 1HMVB 2PN6A 4XK8C 4GC7A 5RUBA 1K0VA 4ICLB 3LALA 3NGKA 7FDRA 3BYRA 2AYBA 3EZOA 2YNIA 3CO0P 3C14A 2WVFA 4UQTA 3BB5A 5LSRA 4IDKA 5E3AA 4UOFA 2DPIA 3HMJG 2P9GA 2E1PA 5CD4A 1PJ5A 1P9YA 4IR1A 3R2DJ 4A8XA 4RU2A 2W1BA 3THVA 2AGPA 5IV4A 3M30A 2BJ3A 5KG2A 2HLUA 3IBFB 2CKWA 1T0TV 4WXOA 2L9WA 1S9GA 3CC7S 2QMXA 3KLIB 2FJXA 3WHIA 1EP4A 3KLGB 3A4TA 1O0PA 4GO7X 4HL9A 3DGPA 1WUUA 3D54A 1RWWB 4ZIWA 1MMDA 2C2DA 3CD7A 4DV5F 2BBEA 4DG1B 3B4DA 1EIYB 1T03A 4HHUA 3PFOA 2HVHA 4JB8B 1TK0A 3AJDA 3DLBA 3M6VA 3CJSA 1Y3JA 4LFBF 2O01C 3PEJA 1XR7A 1LEOA 3TP2A 2WSEC 4JI7J 2DEJA 4QIFA 5IT4A 3KKFA 3GJTB 2J0WA 3LP1B 3VGSA 3TZZA 2DNPA 2XQCA 2P6TA 5GVQA 3DRXA 4YB7A 3MOZA 1NK7A 2DH8A 1AW0A 1R6VA 1Q8KA 2QRRA 1P1TA 3NBPA 3PYFA 2BKNA 5CABA 2VG7A 3V81A 2NR0A 4I2PB 4IFYA 1L5UA 3OTCA 2VPZB 2V8VA 1XQIA 4ES2A 4O3NA 4DUYF 2BKOA 3JAMU 3K57A 1B0PA 1RTZA 4DPYA 1SH3A 1NRKA 1RADB 2R2SA 2NLWA 1B64A 5DDRC 3TJ8A 1AZSB 2GCFA 2CNNB 4MJKA 4R0EA 4TQSA 4A46A 2NZ4A 3MECA 2F4FA 4J90A 4RUAA 2B7BB 1PGZA 1NJIT 2QA4G 4LF7J 2YNHB 1N33J 3MUTP 1NDLA 1GMWA 2GO8A 4LSNB 4QWAA 2ABYA 1IKXA 3PO5A 3EX7B 2OGUA 3AA9A 2HG4A 3CCUS 1SUQA 3IWXA 4HTIA 3TEGA 4B9SA 2IMWP 1RWPB 3KDNA 3R6LB 2DNMA 2PDAA 4LF9J 2NXJA 2B56A 1Z2LA 3SCLE 5J2QB 5I3UA 4TYBA 2F40A 3HZEA 3W9HA 4DZ6A 1T9TA 1Q16B 4OLOA 2UXCF 5KT3A 1RHQB 2ZUGA 4M1KA 4NLPA 1RTJB 1R8BA 2FHJD 2XSJA 3BBFA 3VGTA 5D78A 5DG7A 2OHDA 4OHZA 3UCUP 3JYTA 2VIHA 2NXNA 2AEFA 2FQQB 4YDXA 4RJVA 5H9FJ 2W9CB 3AQPA 3ZFVA 1M0SA 3TA2A 1XNQJ 5D0GA 4GO5X 2QMWA 1R8HA 2IA6A 2JX2A 2EK1A 2KJWA 3CJTA 3D0IE 1X5PA 4I64A 2DTJA 2R7UA 2HGMA
chains in the Genus database with same CATH topology
1X4FA 1SKSA 1H7XA 3CDAA 5B0EA 1WELA 4DQSA 2FHOB 1KQFB 1HL6A 3FDSA 3TUIC 4QR2A 1HNIA 1R6YA 3KLEB 3FSIA 4FVCA 4G1QA 4I1TA 5LL6d 5F9LA 1UEVA 1UWBA 3QO9A 4NL5A 5B7WA 5DQGA 3HPOA 4B9MA 4J9NA 2HHVA 3GFYA 2YWEA 3A1YG 5KFHA 5GAEI 3HM9A 4BBYA 5D4PA 4DPOA 2YNFB 2M0GB 4F3QA 2XHWA 2KKHA 3GIMA 4PQUB 4C11B 2GIQA 2LEBA 2EI5A 1RA7A 4RNNA 1BQMA 1UFLA 4WTYA 4ZPAA 4NPOA 2PSZA 3X3UA 4DEZA 1DZ5A 4DQQA 5GAGI 4P7VA 4B3OB 4OMFG 4LSLB 3DM2B 1RTDA 4Y3CA 4DOZA 2LU1A 1RAJA 1Q7YT 2XWYA 4KGKA 3NCPA 1ZPVA 3MGJA 1XMQF 2E5HA 1M5HA 1T3NA 2DNGA 2EFPA 2FHKA 1Y00A 3PNIA 1FRHA 3THPA 3AA8A 3TW0A 3VAGA 2E9TA 3TO8A 2MDAA 4DV7F 4I56A 5CQGA 3ZZUA 5F8LA 5LJ3Y 4L72B 3IBWA 2HS4A 4NLRA 1QAXA 3BS9A 2XCAA 4ZDNA 1HPZB 2XY6A 2HWIA 2BRLA 5KFZA 2J7WA 4FNIA 3BO4A 1URNA 2K7KA 5T7LB 5BYSA 2J7KA 4CH1A 3GIKA 3FGVA 4YFUA 4DL0C 3M6WA 3KLHA 1VFJA 2J76E 1NJZA 3ETOA 2V0NA 2BRKA 5A8WA 1VBZA 5KFGA 5B09A 4NYPA 1NKEA 4C9DA 4OI4A 1H38A 4G6VB 1FJEB 1YRUA 3DOLB 2JJ4D 2KG0A 3MAHA 3HJFA 1UVIA 3FEYB 1DJ0A 3CMAS 2E9RX 2WOMB 1TV6B 4IQMA 3EGWB 1HQEA 2JVRA 2F9DA 5F3ZA 2BR0A 2EK6A 3PACA 4J9QA 5KFAA 3VCDA 1HBOA 3DDNA 1W2BR 4BHQA 2VKRA 3MHYA 3HHLC 4I2QA 4X4NA 2Q79A 3FFIB 3IGVA 4NA3A 2DGWA 4Z37A 3DLEB 2ZH1A 3BGFA 4Q43A 3HVTA 2D3UA 4WCEQ 2E29A 3LAKA 4NRTA 2FLNA 4USJC 4F67A 3OR1A 2FJEB 4F02A 2F1FA 2DGVA 1LWCA 1KQGB 3QGHA 2KJVA 2B43A 4B08A 2MZ1A 2CQGA 1TL5A 1S10A 3FZBA 1SH0A 4QWDA 2GIRA 1LFPA 4HH0A 2W7PA 1U47A 1S1XB 3OUYA 1KN6A 2UUWA 4OZ0A 3R3TA 3K8WA 2LMIA 4RBTA 5AXKA 2KYXA 3LANA 5CYQB 5KT7A 1C0UA 1D1UA 2M8DB 1TAUA 4ED2A 1FE0A 2F9JA 4HI2A 5EWEA 2R7WA 1VMBA 1A9NB 3TUZC 1KFSA 2W9BB 2J6TA 2ZBCA 2BDPA 4DFKA 3FRYA 3N4WA 3Q2TC 2U1AA 2B3TB 2MKKA 3TQ1A 5EGYA 2YKNA 3O5TB 1H2TZ 2ZHBA 3I0SB 3DMJA 2FB0A 2WB1D 4ERDA 1H0HB 3QMQA 4ZPWR 4TU8A 4DQPA 3NLCA 4FP9A 1KLMA 3M8PB 1FJCA 5KFSA 1NH7A 3UWTA 5B0FA 3M9MB 1VK8A 3L09A 3HFKA 3ENWA 4EZ6A 1SV5B 1TZ0A 5AXMA 5HLFA 3IA0A 1U1PA 4UOCA 2LQ9A 2QSWA 4ZA1A 5F9NA 4QIEA 2VG6B 1LQ9A 2WSFC 5A0YB 4MK8A 5SZTA 1NJWA 1G1XA 3T9ZA 1FTRA 1VQ5S 2L08A 2EFVA 1SJQA 2QO3A 2HNDB 2DR9A 4N56A 1HYSA 4CZCA 2R8IA 1C0TB 2V4JA 4EO6A 2GMHA 4DUZF 4MKYA 2HMIB 3KHLA 2MKCA 2ACYA 1IKWA 1NEEA 3ITHA 3KG0A 2AP6A 4I6WA 2ZHAA 1YIJS 3NS5A 1SJ4P 2OPQB 2CPFA 1HMVA 4Y2MA 1WG4A 3J7A1 2BE2A 2D7SA 2V9KA 4C7QA 2C2RA 2V8HA 5SUHA 3MM8B 4I4BA 5KT4A 2XS2A 3QWPA 4ICLA 1Z4UA 4NA1A 1X5SA 2FVSA 1FA0A 4NLSA 3Q24A 3OTDA 2R8GA 1TL4A 1ZM3A 1Q81T 3I0RB 2UV8G 4ALZA 1S4FA 2GNKA 3GFHA 2IAJB 4MK9A 2Z8QA 3T1HF 1D9FA 1N6QB 4OZLA 4ZCMA 5JUMA 5J1NA 1IUJA 2DD8S 3PKYA 4KO0A 5LSLA 4FS1A 2YH1A 2UUCF 1WG5A 4M5DB 2CPIA 1S6QA 5ADZA 1WHVA 4PG4A 5A8KA 3PRDA 3PR4A 3Q2SC 2N82B 3SI8A 4DF8A 2JEGA 3A8EA 3M2RA 4OHWA 4PPZA 3T5LA 2VA2A 2Z0GA 4JOUA 5KFDA 2DNNA 4J5OA 5D3GA 4MMOA 1E6VB 3CJ4A 2QV6A 2PGCA 2ZDPA 4EGLA 3F73A 3CVKA 3RB0A 2XMWA 1O8BA 1YSJA 4WF9Q 4H4OB 1KOOA 1RT6A 1CC8A 2KFZA 3OBIA 3C46A 3OL8A 2ZNZA 3UE2A 3TYTA 2GA7A 4NWBA 5HMWA 5J1EA 2B51A 4KV8A 4Q2MA 5KT6A 4ED5A 2X3GA 4RUHA 3OQ2A 4OFZA 4DR4F 2W4PA 3QLHA 4I0WA 4YOEA 3D2WA 2OJ3A 2VQFF 1R31A 7FD1A 2KXNB 2X1GA 4C8ZA 2HAIA 3KLIA 1RKIA 1WNEA 1AXQA 3KLGA 2HFNA 2CZ4A 4PG7A 5THWA 3T5HA 4C0BA 1L3KA 4DFJA 2H9ZA 3I56S 2ZBIA 5BYQA 2XMMA 3BSCA 4X4UA 1K0TA 1X9SA 4ATNA 1JLAB 1GH8A 4LVNP 3J7Z5 1VQ6S 3AAWB 1VS3A 2B5JB 4CTAA 4RZRA 1SJ3P 2OD4A 3P3DA 3HI9A 2DGOA 1TL1B 1QAYA 3K5LA 4MK7A 3L95X 3KK1A 2MSTA 3K7RA 2FVPA 1SJFA 3DHXA 2MZJA 3IC1A 5E3PA 3NNCA 2CQIA 2DIUA 2XC9A 1PSDA 3IR5B 2E1AA 3OSNA 1VIXA 2LLZA 4DG1A 4QWEA 2AJFE 2R2UA 1Y0HA 3PIPQ 1DURA 4JI1F 1OSDA 4WU2A 1WF0A 2DH9A 3IFEA 2FDNA 5IFMA 4DL5A 3HO1A 4Y28C 4X62F 4QIGA 3Q0AA 3FQLA 3UCZP 4YUDA 1HQUB 2BZ2A 2KZZA 4KRWA 2DNOA 4PUOB 4NA2A 2WK4A 4O44B 5F8IA 5K8MA 4DL3A 2ROPA 1KR4A 1VIOA 4DL2A 5EX0A 3K5MA 2ZJRQ 2B0GA 1FF2A 4WFYA 3DLKB 1M5OC 3MEEB 2J9CA 1SB6A 1VQOS 3HZGA 2NS1B 4F4ZA 1YTYA 3CSKA 3LP1A 4X2BA 2AWZA 1RT4A 4F4YA 4XDDA 4UW2A 3FSYA 3MR6A 2C3PA 2AX1A 3TVYA 2DIVA 5IWAF 4OJ3A 1NKCA 4O0IA 3PFEA 4RW7A 3ZZTA 3KOAA 4TY9A 1RP5A 2M5YA 2GW8A 4Q0BA 2P5VA 3ZZ0A 4QWBA 5L39A 1FERA 1SKWA 1TR0A 1KQKA 1C4CA 2VG5B 1KOHA 4WFNQ 3BQ1A 4PWUA 4QBUA 1VQ4S 3MPWA 3LWMA 2JSXA 4TU9A 4DS5A 1NK6A 3NKYA 3MMBB 5KG1A 2KI2A 1Y5IB 4I2PA 4K2XA 1YJRA 3U1LA 4JV1A 3VZHA 1XWLA 2P9EA 3I9ZA 1QSLA 1S99A 1WEXA 2BJEA 2IRYA 4TYAA 4A47A 2IYGA 3MUMP 4B3TF 2YKOA 1WHYA 2AV5A 4KBIA 4TN2A 3KHRA 2MB0B 2RF2B 2XMTA 2W4DA 3TX8A 2CQ1A 4A8FA 5F0WA 1N5QA 2WTFA 3G6YA 4OJ1A 1GTHA 4B3MF 5MLCV 5HI7A 4DR5F 3VWSA 2Z4PA 5DG9A 2X1AA 5FDLA 1ROFA 4EYIB 3TOQA 2K1RA 3DI6A 1K1SA 3CJ5A 3CPWR 3Q8QB 2RE1A 4J9SA 3CCZA 2PC6A 3FMWA 1IXKA 4Y00A 1FE4A 3RRGA 3H20A 2ZD1A 2VBYA 2A10A 2GX8A 3OFEA 3IR6B 4MFBB 3VAHA 1IJEB 1RT7B 3U1NA 3HVRA 4I6YA 4YHHF 3MEGB 3DOKB 3S01A 5KFXA 3VZIA 3MM7A 3MM6A 2ZJQQ 3RR7A 1IKYA 5DO2A 1FNMA 2AYEA 2HNZB 1SL2A 2X51A 4JV0A 5CYMB 2EG1A 4ITSA 1QTMA 1S79A 3P96A 1H2VZ 3PRBA 3BSOA 1FEHA 2KHDA 2R7VA 2M52A 1HR0F 4ZCKA 1D0EA 3L7PA 2L9DA 2YNGA 4ZCIA 1LWEB 3BDPA 4OI3A 3HHDA 2Z2LA 3IS9A 1U1NA 3MDFA 1NB7A 2YNHA 2DR5A 1X4GA 3MFHA 3W3SA 1X9WA 1D8YA 4FYDA 5DDQC 4PG8A 1RDRA 4ELUA 2RB7A 4NRUA 1RT3A 3QZ8A 4EZ9A 4FXWA 4IOBA 4LSNA 2CZVC 2O3DA 3RU0A 2JVOA 3AB4B 2M9KA 1FNXH 1S1WB 1TKZA 1P27B 2LCWA 5HROA 3OLAA 2OTJS 1RTIA 3LOUA 1VC6A 1RT5B 4QU6A 1SKRA 1Q86T 2IM0A 5IS2A 3MXHP 5J2MB 1U7LA 3I96A 4CO2A 2QA4S 1JNZB 3I32A 2ZZMA 4X4VA 3PX6A 2QYCA 3WBZA 1TUVA 3IG1A 1DHMA 1LW0B 2PD1A 4ZP9A 1L3UA 5T41A 2GHWA 1HWJA 4HT5A 1U2RA 4IO1A 5C24A 2AGOA 3CEDA 1QJHA 2E9ZA 1F60B 1Y5LB 4N77A 4IH7A 4A8YA 3K8VA 1JIHA 4KSEB 5KT2A 4ECUA 3PEHA 2DCUB 1D9AA 2P9CA 3V4IA 3MPYA 5CZXA 3NP5A 5BR8F 5J2QA 2CJBA 3O1LA 4Q44A 2MGZB 1LOUA 4C3MA 4EU0A 2J0XA 3RZAA 4DJBA 4X4RA 1CQNA 1FNOA 4D3HA 3C6UB 1GAOA 2RD5C 3MMCB 4BWMA 3JAMY 2OKQA 4HI1A 1LV5A 2J7UA 1S0NA 4BS2A 2COLA 2HLTA 1F9FA 3IAM9 2RQKA 4NXNF 2KXFA 4RUCA 3DRRB 4JBCA 2HNYA 2J5AA 1HWLA 2ADCA 1RTJA 3GYNA 3K5NA 2FVCA 3M9NB 5HMXA 2YWGA 2RQCA 1FD2A 2ILYA 2O1PA 2DITA 1X5OA 4LUBA 4GKJF 3MCSA 4DR7F 2XULA 4OJGA 2IM3A 4DQRA 2XCPA 2OP5A 2YKMB 3WDOA 4RNMA 1A6LA 2DHGA 1V3RA 2B4OA 3DLLQ 1N88A 3AHPA 2I1RA 2KVIA 2RSQA 5KG5A 2MYFA 1SI9A 3BQ0A 4QPTA 4WK3A 1N4LA 5J2NB 1FRLA 2KH9A 3T6JA 4N47A 1J5OA 2KT3A 5K8NA 2W9CA 4J9OA 1TQLA 2YX1A 2KM8B 5DDPC 4FNHA 3IRWP 3Q8SB 2IC3B 2MSSA 1C1BA 1B0VA 1DFDA 5I3PA 2XGQA 3UD4P 1JX4A 2I38A 4TY8A 5KFKA 1MROB 4OX9F 2VBWA 4K4YA 3KHGA 3NAHA 3HHNB 2R7SA 2B6AA 4ZCLA 1BD6A 4QCLA 2DBBA 1GT8A 4ZPBA 1UVMA 4AFFA 3H2LA 2AJ1A 1CVJA 3D1QA 1J2VA 2FHJA 2V2KA 2XO7A 3J81Y 1RI7A 4EBCA 5IT9Y 5CH7B 4ZP6A 1CSJA 3VR1A 4DSEA 1SL0A 1T7PA 4JYAF 1WF2A 3UW1A 1XR6A 5KFOA 1KLNA 3MI7X 1FKOB 3ULHA 4URQU 1ZETA 3W2WA 1VC5A 2A1BA 2CQ0A 2GQCA 4DV2F 2D9OA 1S0OA 2CJQA 2YKAA 4V19J 1R43A 3KLEA 3V2UC 4AXIA 2ZHOA 1O5JA 1VHFA 4WXWA 2LKZA 4URSA 4LF6F 3GV7B 4CI0B 3GG1A 2ASLA 2FVRA 3WC0A 1WWHA 4OX8A 4YR3A 1U1LA 3Q8RB 3MEDB 2NSBA 3CO9A 2MQMA 1XN9A 2YNFA 4DBQA 3AJ1A 2KM8C 1YRTA 2HGLA 3IO1A 4C11A 2GQQA 5C42B 3LP0B 4PXEA 4PQUA 3MM9B 2AX0A 2XI3A 1D3WA 1OQ3A 4B3OA 4WZQA 2PT0A 4LSLA 3DM2A 4N8NA 1Z1ZA 2XY5A 5M2PA 4QJVA 3NGDA 1FVQA 1P1LA 3EGZA 2ROEA 3DU6A 4ILMA 3CT9A 5AE3A 4KR0B 4C3KA 4ELVA 3HXMA 3KWMA 3L3CA 4ZOSA 3HX9A 4DSKA 4WKYA 2ZKUA 4H4MA 4Y2IA 3ONQA 2CJ9A 1VBYA 1X4EA 4F25A 3DXBA 1HPZA 2OPPB 4W92B 3TANA 5EHHA 1Q79A 5T7LA 3PVXA 1VRUB 4OIXA 4F8RA 4PPDA 3SSQA 2HW3A 2HWHA 1HWUA 3H2VE 1FKPB 2AJQA 4NLYA 1QM9A 2VONA 1R89A 4RNHA 1FXRA 3HF5A 1FDDA 2NREA 2UUAF 3DOLA 4YR2A 4CH7A 2OTLS 2VV5A 5A6PA 3GYXB 3DLHA 2WOMA 1TV6A 3QJLA 4WE1B 2UXDF 2DJWA 1BQNB 4I7FB 1JLQB 1MNEA 1Y7PA 4IG0B 1QY7A 2C3UA 2QA2A 4PR6A 2F7VA 2D3OR 3IRXB 1FXLA 4WZMA 5HBMB 3FFIA 1T8EA 3ISZA 4X65F 4R5PA 1HD1A 2ASJA 3DLEA 3MZIA 4RU9A 4ECZA 3UNGC 1TL3B 2IJNA 1LKZA 5MAOA 4GKKF 2GGPB 1KEKA 2M8HA 5CXTA 1YRXA 1FD8A 3GILA 4J9LA 2OIHA 4LF8F 1JMTA 2C22A 3QAEA 1REVB 3US5A 1S1XA 1VLYA 2A2CA 2BA9A 1KONA 2XI2A 3CCWA 1S1UB 4NLVA 3BREA 4UUXA 3IN5A 5KFMA 1WTBA 1OIAA 1Q82T 4B9TA 1I1GA 4Z2XA 5LXRA 3FEXB 2GC8A 5L1IA 5CYQA 2FLLA 4HYKA 2NPFA 4QIWD 2DO4A 2DR7A 1M5P