1V3RA

Crystal structure of tt1020 from thermus thermophilus hb8
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
92
Chain Sequence
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
total genus 20
structure length 92
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1v3rA00
2Z0GA 1UL3A 1HWUA 4AFFA 4NYOA 4OZJA 4CO0A 4RWWA 3X3UA 3AA8A 4CO2A 4RWXA 5D4NA 1NH8A 1QY7A 2NUHA 4YB5A 4USJC 1J2VA 4C3KA 2RD5C 2EG1A 3AHPA 4CO1A 4CO4A 4RX6A 4CNYA 3AA9A 2XZWA 4WK3A 4USHA 2PIIA 5DS7A 2NUUG 1NH7A 2GNKA 4D3GA 4D3HA 3AH6A 2GX8A 3NCPA 3M05A 2XG8A 2J9DE 1P1LA 4YB7A 4YB6A 2DCLA 3DFEA 1NAQA 3CE8A 2O67A 2J9EA 4OZNA 4NYPA 2V5HG 2EG2A 1NZAA 1H3DA 3T9ZA 3O5TB 5D4LA 2ZOMA 4USIA 4E98A 1UFLA 2GW8A 4WK1A 3GSDA 3LF0A 2J9CA 3O8WA 2VD3A 4Y6IA 1O5JA 4CO3A 5L9NA 2J9DA 4IYQA 5D4OA 4OZLA 3TA1A 1O51A 2NS1B 1UKUA 1V3RA 4RLEA 4CNZA 2E66A 1GNKA 2JJ4D 2ZFHA 2O66A 5DRKA 1OSCA 3OPKA 1V3SA 1VHFA 3L7PA 3MHYA 1PILA 4C3LA 1Q1KA 2XBPA 1UMJA 1V9OA 4ZK7M 3HLUA 2CZ4A 3NCQA 1KR4A 4Y65A 3NCRA 3N5BA 1VFJA 1XK8A 4CO5A 4R25A 3TA2A 4C3MA 3TA0A 5D4PA 2XULA 3BZQA 1V6HA
chains in the Genus database with same CATH superfamily
1IWGA 4IH5A 2CQDA 2EBGA 5KFGA 4AL5A 3H40A 1X4HA 2KFNA 1T9TA 3CNQP 2N4CA 3OL6A 3RAQA 2EFNA 4TLRA 1K44A 1IBMJ 3KKFA 2MZJA 2RHSB 4M1KA 2OFGX 5AT1B 4LT6A 5GAEI 2XMAA 5A6PA 4CO2A 4X4QA 1SL1A 4Q0BA 5D8HB 1JXEA 1GMUA 2AJ4A 1U48A 2L9WA 2VPXB 2YKMA 3CCWA 3BJYA 5L46A 1AROP 3H7HB 3TZWA 5LSLA 3A3PB 4FNHA 4L6V3 3ZZZA 4FF1A 4LMZA 3QLHB 4O0IA 1WHXA 1FVQA 4WWSA 4DWIA 4DR4F 3EXYA 4GO5X 4Z7YA 5ETMA 5EHHA 3AA9A 2HQGA 1H7XA 5IQQA 4WK3A 3SSQA 3ULHA 4ZHRB 3G6XA 1KN6A 2ZM6J 2ZBPA 4M95A 4F36A 1A7GE 2DKOB 2PIIA 2GV1A 3DM2B 1RWXB 3VAJA 1NXIA 3UR0A 2WVBA 1VQ9S 4FBUA 2XB2D 2FJXA 3EGZA 2OPPB 3TEHB 2GX8A 1NPPA 2LEAA 1EQMA 2D69A 1S1WA 2V6AA 2HHTA 4FVCA 2V9KA 4TYBA 4DHVA 2FJWA 1OPZA 1NNDA 4GRSA 1KFSA 2MB0B 2DIUA 4UZCA 1R0AA 2ZH4A 1T3OA 1T03A 1NHKL 2V68A 2M52A 1BWEA 1M1GA 2J6UA 1SXLA 4H4OA 2O67A 3H5YA 2B8QA 3CJ5A 5IWAF 3CUNA 4LRFA 3WX4A 1SQEA 5F8JA 3C6UB 2BA9A 3DYAA 1JLAB 3TI0A 1AT1B 3D0HE 4G1QB 5B0CA 4B9SA 5J1EB 3WHIA 5D4LA 3C19A 2D41A 2IRUA 1RT7A 3K89A 2ZE2B 3OR2B 3VAHA 4DL2A 3M2VA 3AQOA 3NS7B 2MY7A 4OYZA 3P45B 5E3AA 2YNGA 2A2DA 3RG6A 4C98A 2XTJP 3ZZYA 5T7LA 1BWVA 2YX4A 5C24A 2YH1A 4WK1A 1JJ2R 2DNKA 4O3QA 1U1NA 2B9WA 3GFXA 1YTYA 2I0XA 3FEXB 3PYEA 5D0HA 2HHPA 4DUZF 4DR1J 3ZO7A 4AQYJ 1PKUA 1RWVB 3EICA 3R5GA 3PJXA 3M32B 3AODA 1YJUA 2QL9B 4CO3A 5DDPC 3H2LA 3QZ8A 2RKIA 5I42A 1U0HA 4I2QB 4QYZK 2W7OA 2J9DA 2CDRB 2RT3A 3FRYA 4KYZA 3OLAA 3MUVP 1VQ6S 2AEMA 2U2FA 2JVOA 2GA7A 4NMLA 4DBQA 5BYSA 2OTLS 3QAUA 1HIYA 2O5DA 2PE8A 5K8MA 2KM8C 1XNRF 1XIQA 3C15A 5CCMA 2VIHA 3KNGA 2OJ3A 2M8HA 1NSQA 3VGVA 4J9OA 2E66A 5RUBA 1ELOA 3DRPA 2IVMA 2LDYA 3SBMA 4Q8FA 2A18A 1UFKA 1UZDA 4ZIVA 5CHCB 3VR1A 3MOJB 4JI4J 1C4AA 2GJFA 4Y2AA 4RO0A 3MEDB 4MFBB 2K3IA 1I6JA 1HQEA 3DN9A 2VBYA 4EU0A 1XC9A 1S1VB 1UVLA 3KJVA 4RW9A 2GMLA 5K8OA 2VQFJ 1F9EB 1RT3A 1GQEA 1Q1KA 2LEPA 1T05B 4CLKA 3PZPA 4NOHA 5SZTA 4S0MA 2IAJA 2K8GA 4QU6A 1S12A 1ITPA 4DSIA 3C14A 4MYUA 1WEZA 1KR4A 2MHNA 1HHQA 1FWPA 3HZEA 3N01A 4OQJA 1VC6A 2A10A 2ALYB 1HNXF 1CVJA 2JVRA 4HACA 5DZ6A 4DUYJ 2QSWA 2UUAF 4WZQA 1FFSB 4EZ6A 4EBDA 5GMEA 1RTHA 4ZS6A 3H8YA 3GYXB 4JI3F 3KJFB 3EXCX 2QIFA 3KNAA 2HBRB 4P73A 3IRWP 3K5OA 2HHVA 2NSBA 1KVKA 2EK1A 3H5SA 2WONB 1LWFA 3M8PB 2ZJQQ 4JI6F 1NSKL 1JMTA 3MMAB 4WE1A 1FTRA 2HGMA 4C0BA 2ATCB 1N36F 1ZAXA 2QL5B 4AE5A 2DNQA 1VRUA 1N0UA 2DGTA 3DXBA 4PXEA 4ZP7A 1EZZB 4RWXA 4M5GA 3O44A 3DRPB 4EBEA 3W62A 1RABB 1UPPA 3OTOJ 3CD7A 3T1YJ 4RBTA 5B7WA 3OJSA 4B3OB 1FXDA 2AJQA 2BX6A 2PGCA 3CF5Q 3AHPA 4F3QA 1F9HA 2VZ9A 3EYZA 4FXDA 1CS4B 4R8UA 3RB3A 1FXLA 2PEBA 4KHMA 1N54B 3O3LA 1S59A 3C6TB 4DFPA 2VODA 4LF1A 1VQSA 2HLTA 4C9DA 3LW5C 3ITHA 4X4VA 3M2UA 3DCAA 5I42B 1BE4A 2CQ1A 1QAXA 2GNKA 3A1YG 3MEEB 3HHLC 4AXJA 4OV1A 2KVQE 1TKZB 1TKZA 5T14A 1JLGB 4Q44A 4OX9F 3K7RA 2FLPA 4B3MJ 3QQCD 5D3GB 5H1SV 1YITS 2WK4A 1IKXB 3AT1B 2Q6CA 3CT9A 3ITHB 5KFMA 2AP6A 2CQ2A 4NA3A 2CWXA 3UPFA 3VAFA 2L9NA 2KXHA 1RTIA 2MYFA 3FC9A 4GVBA 5F8NA 5J1EA 1YIJS 2MJUA 1N6QB 1YJNS 1FHTA 3PIOQ 4RBVA 3EM1A 4X62F 1F2HA 1YKWA 3T5JA 3ZZUA 3CJ8A 1UP1A 3EDRB 3J80Y 2R2UA 3VAIA 1HMVA 2HS4A 2U1AA 4L72B 3GPAA 4IUFA 4LQ3A 2K3KA 1TL1A 1NKCA 1VRUB 2YTCA 3CMQA 3U1MA 2KT3A 1EB0A 3NAHA 2E1RA 3UD5A 4N41A 5A8RA 1NPRA 3CJKA 5HVFA 4LFAJ 1QVFR 2J9CA 3MTJA 4W90B 1SJ3P 4OYIA 4Y6IA 3MEEA 1KQFB 1NUEA 1TR0A 4USWA 2W2QP 3N4WA 5GADI 3QATA 3CDWA 4HI1A 4P2FA 4H4MB 4N47A 3CCMS 4V1Ak 5HMZA 2JLEA 3DI6A 3FBCA 4F04B 2H1YA 2YWGA 1JNZB 1YJTA 4ZVGA 2RF2A 3T9NA 1FJCA 2PN6A 4F0HA 4MIAA 5F9NA 2JEJA 2LP4A 3DOKB 3MD1A 2BE2A 4M5NA 4X84A 3TZXA 3W9JA 2R2RA 3L7UA 2OGUA 3T3FA 2FVPA 1JWWA 2I6WA 4DL0C 3JTPA 2JC1A 4FYYB 1YGYA 4QJVA 3I9V9 2IAJB 2B9XA 4FN5A 2I1RA 5CCLA 2ZFHA 4FNIA 1WUUA 4FBTA 2DNZA 4USKA 3HM9A 2F3JA 2UV8G 1C0UA 2W2MP 3GFYA 3UDLA 5HQLA 4OYPA 3ADAC 4P75A 1GXUA 4YP3A 3J80U 3CD6S 1R43A 4HHJA 3DKDA 3KFWX 2DR7A 2W1BA 1VRQC 3ZXWA 3DRYA 3ISZA 1H2VZ 2E5HA 5M2RA 3RBEA 4IR1A 2HSEB 5L1IA 1AW0A 4BS2A 1RTHB 5KT6A 1JLEB 4NRUA 1ZBTA 3AB2B 4LRAA 2C2OB 2DHXA 1J5OA 3D67A 3MM5A 4XDDA 4H4KA 4JI4F 2P5VA 3NAIA 4OI2A 5IZHA 2QSFA 3C14B 1NK6A 1SKRA 1MU2A 1NK0A 5KFKA 5K20B 1VQLS 5L38A 4O3OA 2V2KA 3ILIA 4H4MA 2GQ2A 4IKAA 3SQGA 4ED3A 1AZSB 4FF2A 2C22A 3BGFA 5CYQA 2IFXA 3US5A 1X5OA 1HQEB 2D74B 2YNFB 4AD6A 2DGQA 3UO0A 1RDRA 2EFQA 4WFAQ 5J2PA 1N33F 1AYEA 1TL3A 2B4PA 2BJ7A 4K4ZA 1HMVB 2WSFC 2CADA 3R27A 3PR4A 1KOHA 1REVA 1FNOA 3MM6A 4Y28C 4WIIA 1S10A 2HYIB 2RD5C 3W61A 2DHAA 3BH6B 2GMJA 4OX6A 4ZVFA 4CDIA 1VC0A 3JYTA 4Q2LA 5E0OA 4WKYA 3CJ0A 2NLWA 1DTQB 3TOQA 2XZWA 3HSGA 4BBYA 2V2QA 1BGXT 1SI9A 4ZCLA 4A8WA 1SH2A 2PA8D 2AWZA 4ZPAA 2VKRA 5F8LA 3UR3C 3AH6A 3D3BJ 1JLGA 1YBAA 2RB7A 1HKAA 1S0OA 1GMVA 2EW9A 3CJSA 3IGNA 3BO2A 2EEYA 3EVMA 1IBKF 3GCWP 1NDPA 2ACYA 3CJQA 5D0EA 2ZZTA 4RUAA 2OPRA 4I68A 3M8RA 2CPIA 1DQAA 4CYUA 5FJ4A 4KIAA 2DJWA 2KG1A 1WC3A 5H9FK 1R3NA 1U1PA 1IKYB 4EFAC 2GO8A 4DSEA 1WHVA 4Q5VA 1FA0A 3BPDA 4A47A 2HWHA 3UFCX 5AE3A 1R0AB 2UUCJ 3AXKA 3J7YU 3BQ2A 1YJVA 1S1TA 5HSPA 3MOZA 1FX4A 1K1SA 5LM7E 1NSAA 2ZEJA 3TJ8A 4DG1A 5HVHA 4X64J 4WE1B 1C1BA 5IC6B 1RYRA 2OPPA 3MFIA 2K7KA 4ZDNA 2CQ0A 1M5KC 5G0RA 2JRSA 1LFWA 1SH3A 4IH6A 4FF3A 3N6LA 2AJ2A 3KLEB 3PX4A 1S6PB 3D6MB 4N8NA 1Q8BA 2C3UA 4LBPA 4NEYA 5K8NA 3GJQB 4DV2F 4OZ1A 2ZZMA 4ELUA 2DISA 4Q7AA 2OI2A 4F4KA 1RQ0A 5GVQA 4UY8T 1Q79A 2HNYA 2I8EA 1N88A 3FBEA 4IDKB 5GAGI 1RLCL 2V9WA 1SC6A 1TK5A 2XGPA 4Y2KA 1SL2A 2IBKA 4ZPVR 1ZA1B 1EAYC 2MSSA 2UUBF 4EGLA 3R5JB 1IN0A 2VB6A 4JI0F 3UDCA 5HI7A 3TAMA 2X51A 3EVWA 3ZTPA 3PJ9A 2YQ1A 1PJ5A 1RT3B 4QOTA 4NX9A 2CVEA 1CC7A 3C16A 4JB8B 3MF5A 5A0YB 4RW7A 4QIVA 3L7PA 4C48A 2HRYA 2ZD1B 3BSAA 2LEBA 2JZ5A 4LREA 3MHYA 2IJNA 1RZMA 5E41A 2MEWA 3M6XA 3W7BA 3HMJG 3D7SB 2V4QA 2KHDA 1X4DA 1R7IA 7FDRA 3DRRA 4XDCA 3TAQA 4P74A 4Y2IA 2VHGA 3Q2SC 1LK7A 4Y65A 1OY6A 3OHAA 4ZJLA 1FRKA 3Q8YA 3LQVA 2ZC3A 5F3TA 4CLZA 2WVFA 1HNZJ 3TZYA 2J7KA 3G9CA 3PIPQ 1BY9A 1NHVA 3I82A 3G6YA 1I5OB 4MIWA 4J9RA 3QRRA 4LR7A 1SH0A 4L73A 3DDKA 3KLGB 2V94A 3GONA 2FUG9 1S0MA 5L9XA 4ECVA 2GVZA 1TELA 2XY6A 4DQIA 2NREA 1D3WA 1GTEA 4RNMA 1KD1T 3TRGA 4IQMA 1HWUA 1Y5LB 3T1YF 2RDJA 3JS9A 2V34A 3Q86A 3ET6A 5IV3A 3LA0A 3IR5B 3QJLA 4ED1A 4PWUA 2CPFA 3OL8A 1JX4A 2VKZG 1IKVA 3AA8A 4IG3A 4PCQA 2BQ3A 2QYGA 3FZBA 2UXDF 2W9CB 3SDEA 3LH2S 4P2XA 2C3YA 3KJNB 2RU3A 2MKYA 3GCXP 2E1PA 4WFZA 4ED4A 3VGUA 4QIEA 3UVJA 2HVHA 3UNYA 4DJBA 4OZ2A 1Q95G 3HPOA 1TZ0A 3AJDA 3MZIA 3WIVA 3HJVA 1TKDA 3R1LA 4B3TF 1Y9OA 3KG4A 2VG6B 3DRXA 3QIPB 4TNOA 1KHVA 4DF4A 2FLLA 4J9KA 3PHEA 1P8GA 1C0TA 4TU7A 3OD2A 4JI3J 5L1KA 1Y0HA 4EEYA 4L76A 2I9SA 4ZLPA 3KWMA 1RTDB 1B70B 2DR6A 3PY8A 2R7VA 3D28A 5DLGA 3M05A 4UT4A 1U6BA 1BLUA 2GJ2A 1S1TB 2DHSA 3RZAA 1JB0C 4EO8A 2V2VA 3GZ7A 2IJRA 4KO0A 3EZ5A 2UVVA 1B64A 2DCLA 2MLYA 2LLZA 2ZH7A 1F5CA 3AD8C 1XTZA 1F60B 3BPSP 3QWUA 3W3SA 1ZH5A 3D6FB 4NLVA 3V6HA 3RJMB 3TUIC 3CD0A 3FJ2A 1TUWA 1VISA 2JFKA 2VV5A 1TL7A 1RT4A 2WBMA 2M5YA 5KFXA 5LJ5Y 3RBXA 3HFZB 1WEYA 1TAUA 4ZMMA 4ECUA 2MZQA 3PX6A 2HQFA 4PG6A 5JXSA 2QZ8A 2RDDA 2FTRA 4PKDB 1HPZA 1YZ7A 2PSZA 2MMYA 4M5DA 5LXRA 2ZJRQ 1IKWB 2DR5A 5KFTA 5K5MA 2DK2A 2IA6A 3NNHA 4GKJJ 4FDFA 2ZH2A 4ZVHA 3ISND 1JKHB 3VALA 1TFYA 3WQPA 4IYQA 4OJHA 3QSIA 2BRKA 2WTFA 1W7WA 3HHLA 3IBFB 1RCXB 3DLEA 3JSRA 3M8QB 1CC8A 4P71A 4B3SF 1HA1A 4DPTA 2DH9A 4HT7A 3LP2A 3LPYA 4WJBA 2D9PA 1VBKA 4GKKJ 4W4MA 3DRRB 1S99A 2K1RB 1SJ1A 1WOSA 2Q79A 4ECSA 3L4BC 4IFYA 4NZ0A 2B8PA 3BQ0A 1SV5B 1OSCA 1RBLA 2NSCA 4ZVOB 2UV8A 1N4LA 2D1CA 3MCOA 3HD2A 1T8EA 2D3UA 1YJRA 4HH1A 4PABA 8RUCA 1SCJB 1QUVA 2OPQA 4X4UA 4DCOB 3KXDA 3CD5A 1PILA 3OLBA 4ECQA 4JI6J 3WC2A 3ZFVA 5BXIA 2HWIA 4K4SA 1CJVB 2MLZA 4ECYA 2HVDA 3AJ1A 5F0WA 2E7WA 4OI4A 1P1TA 2C28A 4IFVB 1XWLA 4L3NA 2Q43A 3MPVA 4NYZA 2NQPA 3PACA 4C11A 4YB1P 1YJWS 3HFKA 2W7PA 3DLEB 4CM2A 4Q43A 5GAGU 3G6VA 5ETTA 1QD1A 1QDUB 1F2GA 1V5VA 2MHEA 2MLXA 2XMMA 3BGRA 2CPYA 2CPZA 4NLGA 1IQTA 1DHMA 2XULA 2VQEJ 4LSZB 1FKOA 4MKYA 4DFKA 2Z0GA 3RW6A 3ETMA 1C1BB 4ZPCA 3SCIE 4DX8H 1F9FA 3OW2R 3SCJE 3W8PA 2R7OA 3UD3P 2IC3A 4OLOA 3IO1A 4RWWA 4DSLA 1PC5A 4TY9A 3W60A 4UF4A 3L09A 3OHBA 1NH8A 1RT4B 4BHQA 1HWLA 4YHHJ 3CCES 1EQ0A 1MROA 1B0VA 3IM9A 2BJDA 1VMBA 3A8JA 3GJTB 2XSJA 2FB0A 4TLQA 3JQKA 3G6ES 1WSVA 4DQSA 4MTPA 4UOFA 3CMAS 2MKSA 3LWMA 2YKPA 2LMIA 3MEKA 3PW4A 2MGZA 2L41A 1S6PA 4F4XA 4YOEA 1OS5A 5J1NA 3UCZP 3BGLA 3BYPA 4XO0A 1KFDA 1LWXA 4PQAA 3TNVA 3PKYA 1IM6A 3G8SA 1UA0A 5DDRC 1SUQA 4X65F 1URNA 2DO4A 4HI2A 3AOBA 2BMBA 4URGA 3ETOA 1X5PA 2KRRA 2LXFA 4KT0C 4YY3J 1NK5A 3EPIA 4YB7A 2E7XA 4PPZA 5C5JA 3M9MB 4YDXA 4FF4A 2IRXA 2PO4A 2Z2LA 4TQSA 4ILLA 2DRDA 1KLMA 2XMWA 2RJZA 3BF4A 5IFMA 1HD1A 2K06A 3R5BA 3H42A 4WYWA 2IDLA 1UJ6A 3U1NA 1X4FA 5C42B 4X62J 3VGTA 3KHGA 4PQUA 1H3DA 3UWTA 3WDOA 5DQHA 5JVHQ 4P9SA 1N6QA 2D3O1 1OIAA 3FEYB 3HVAA 5L1LA 1QVGR 1RHQB 2VFTA 2DNNA 4K8RA 3MEGB 2R2SA 1P27B 2VG5B 3DMJA 1IKVB 5KG2A 4URSA 2IYIA 5ETNA 2GW8A 3B78A 2Z2MA 2G0IA 3ET6B 2ZH9A 3PYFA 2J7WA 1WTBA 4NLUA 1LW0A 3BBCA 1HLWA 2VOPA 5KFZA 4BC9A 5K14B 4C4WA 1O5JA 3NY0A 2DEJA 2DXEA 5L9NA 3S7RA 2FVSA 1EP4B 1H2UX 3VZHA 5DG9A 5BYQA 4I64A 5M2PA 1N5YB 4KGKA 5DZ7A 1LEOA 2DNLA 3PJWA 5C2CA 4KTQA 1M0SA 1UKUA 4EZ9A 3TVYA 4RKUC 3NNCA 3KHRA 3D5MA 3BKUA 1BXNA 4FXWA 3ZNJ1 3KHLA 4B3OA 1F3FA 4G1PA 1WELA 1MMNA 1WG5A 1WG1A 3MAAB 1R8PA 4RNHA 1XMQF 1VQKS 3CCRS 1TK8A 3DHXA 1HHTP 2IM3A 2KJVA 3HVTA 2CQCA 4OYAA 4C0HA 4ED2A 2JJ4D 4OYBA 1VYAA 2L3MA 2NZ4A 4KFBA 4UQTA 5EX0A 3R9LA 1NLKL 2ZNZA 4DS4A 5EN1A 3MR5A 1DFDA 4C2MA 4ZCIA 5J2QA 1CBKA 2KT5A 1LWFB 1OY8A 2J76E 2MQNA 3ENQA 3M8PA 1BQXA 1V9OA 4C6AA 3ZTQA 5KFOA 4KJIA 2UUCF 3M6VA 4U96A 2EKYA 4G3IA 1CPZA 1TVRB 1TUGB 1P9YA 1RI7A 2OP5A 2M7SA 2YWWA 2FZCB 3CJRA 3HDSA 3PRDA 1HNVB 1OO0B 1VDHA 4P7TA 3I5AA 4FKYA 1KRPA 2R42A 5HATA 1FRXA 1E6VB 1E6VA 3LGMA 3TVZA 4M5LA 4K4XA 4DUYF 1XNQJ 1G2EA 2CNKB 1S1XA 2M9KA 2R7WA 3BO3A 1UEVA 2D7SA 4J7CA 4C3MA 4WFNQ 3TA0A 4JV5J 2HHXA 4PYDA 4LUBA 2E5LJ 1SVDA 4ZPBA 2KXFA 1RAAB 5DO2A 3I0RA 3RAXA 1IBCB 4DL6A 1UJ5A 2ATLA 2XWXA 3AAWB 3R6LB 1XEZA 4I1TA 5FD1A 2GGPB 3RAMA 1SQGA 3HVWA 1P6TA 1WKKA 2LU2A 1X60A 4K7QA 4OZJA 3Q2TC 2M2BA 4OYMA 2V8GA 2Z58B 1EETA 1U6FA 3G8QA 3NWGA 1ROFA 1HQUA 4HHHA 3T5LA 4RU2A 2BM1A 3T6BA 3WX8A 5CYMA 1HI1A 2MQQA 2ZWPA 1RP5A 2HK2A 3AFGA 1GX6A 1F5AA 3FUYA 1I51B 1GX5A 4RW6B 5ETRA 1FERA 4CO4A 1SJ4P 3MD3A 2CWKA 4UQGA 1XNRJ 3H5UA 4F3MA 1DY3A 2OEJA 4YS2A 4EBCA 3A8KA 2OPRB 4NPOA 2VICA 2W4CA 2EK6A 2PI4A 1C2PA 1VQ8S 2XMTA 1PAUB 2M88A 3K5MA 3ZTOA 1HWKA 4BC7A 3TX0A 1Q7YT 4P10A 2HFNA 5J1PA 3K59A 4TN2A 2PA3A 3O6QA 3PEJA 2CJAA 1RAFB 1ACMB 1OQ6A 2BVZA 2F7VA 3JAMY 1R8HA 2XG8A 3IG1B 3BREA 1CJTB 1F5BA 4QQBA 4CT9A 3HCXA 3GV5B 3WC0A 5IS2A 1B0TA 2A6MA 2F65A 2M8DB 2FZGB 5DDQC 1FDAA 2Y0BB 1JLFB 1KQGB 1N48A 2V0NA 2XMVA 1MMLA 3GIIA 1RYSA 4LF9J 3U7JA 1JLAA 5C42A 4PQUB 4FYWB 2AU0A 4OI3A 1S1UA 4QIGA 1ZM2A 4YR3A 3NL0A 3K2YA 5CYMB 3FRZA 3OT9A 5IV4A 4G1IA 3GIJA 2QA1A 2HQ3A 3BV8A 2ASDA 4RUCA 4J9MA 4OMFG 2RNEA 3IG1A 4J9NA 2BW2A 3QGIA 2F40A 4Y2MA 1FEHA 1VI7A 3MMAA 1KEKA 2N4DA 1HNWJ 2G9OA 1VBYA 5FLXY 3THPA 2ACMA 3SQGB 4KE5A 1HNIB 5HBMB 2LCWA 1FD2A 1TV6A 2MGZB 2CFXA 2FVRA 5H9FJ 1YBUA 2AYBA 2HG4A 3C6TA 4O3PA 2HGLA 4OZLA 4K4TA 1B99A 2Z2ZA 4ZHRA 2YPZA 1CS4A 3BN4A 4R8UB 1RT1B 4NLDA 2JX2A 3MPUB 4AL6A 3HO1A 3IBWA 3FNNA 3MM5B 3FMBA 3GIRA 3K8WA 5KT3A 1WHWA 2PMWA 2KU7A 2C1EB 2QV6A 4N77A 1KOOA 2YKMB 4NLYA 4NLWA 1W2IA 5ETLA 5F9LA 1PAEX 3N0VA 3W63A 3PKMA 1MSWD 2BW7A 1NDLA 3RW7A 3MURP 4ECZA 2UXCF 4NXNF 1FJGJ 1FFWB 4LVNP 5LMNF 4CTAB 5BR8F 4O0NA 1VHFA 1ZPVA 2ROGA 3GWCA 3CIZA 3SCKE 2AT1B 3OVSA 3H4DA 1U2RA 4UZBA 3JTNA 5GAEU 5IQ6A 4DUZJ 2DVIA 4KFBB 2HHHF 1FNMA 4FS1A 4QIFA 5KT2A 3M1VB 3QJJA 4ANEA 2DY9A 5IOLA 3MR3A 3HLUA 1KBRA 1MWYA 2DNOA 4KH0B 3NBPB 2CZ4A 3FFIA 4K4VA 1IVZA 3IP0A 2LECA 1LWEB 2QO3A 4LFCF 1F1BB 2YWFA 3T5HA 4ZPDA 2YKAA 2JSXA 2Q6BA 4HACB 3QT8A 4OZ5A 3PXGa 4F02A 3ENWA 3EMTA 4IG0A 3K0JA 3G2XA 1HNVA 1SC4B 1IQZA 1YDLA 2WBRA 1MW7A 2B4VA 1XR6A 3PTWA 3PYDA 4M5MA 4NCGB 4Y0FA 5KG5A 2J0XA 1KLNA 2XLIA 4CLYA 4NXMJ 4NLRA 2XC9A 3CEDA 1V6HA 2I5JA 2HBYB 3EVOA 1RJJA 1HBOA 1LW0B 1KNZA 4I69A 2W2PP 3PW0A 3ZZPA 5A2QY 3TAPA 2BJ1A 3BH7B 1N5TA 3FQKA 3UN3A 3P6YC 5HANA 1FJEB 1WC1A 3MDFA 3SV4A 2I2YA 4FZVA 1APSA 3CC4S 1R27B 1IM4A 2WAQD 2V8VA 4CZCA 1YJ7A 3CPWR 2E9TA 3CCLS 3QZ7A 2KH9A 2R9LA 4YUDA 2B9EA 1X4GA 4K4YA 1AUDA 2HZVA 1FRJA 5FIIA 2RRNA 2WVDA 2ZNYA 2DYAA 5A6WA 3PW5A 2UXCJ 3W9IA 1YI2S 3QGPA 4C8MA 3C3LA 2AJ1A 1N52B 4L75A 2R8IA 3N79A 4O44B 2RKIB 3ICLA 1HBNA 2OMLA 5DLFA 3M32A 1IBMF 4U7UD 1XERA 3I9ZA 1DRZA 4M5DB 1T95A 2VPWB 2BE7D 4OHXA 2KZMA 1LW2A 3CCZA 4QR1A 1RT2B 2VONA 1Y00A 1Q86T 4NWBA 3WBZA 2GFFA 1NPKA 5C25A 2VG5A 5IM0A 2XCPA 1LQ9A 1WC0A 2ZH8A 1K73T 2ROEA 3D4JA 4LF5F 2F4VF 2UXBF 2BACA 3CCQS 4ID5A 5KFDA 5ADZA 3D2WA 1FKAF 5IT4A 4G1QA 4DCPB 3FGVA 3ILOA 2KXNB 2BRLA 3C6UA 3DYAB 4WPAA 1PCAA 4WFYA 2QLBB 4A8SA 1HR0J 2KI2A 1Q8IA 2OMOA 2R3VA 4H4OB 2ZWOA 4RW8A 2ZOMA 2HS3A 1HQUB 4MIBA 3ZZOA 3J7ZT 1HWIA 2G0CA 3M4XA 5CH7B 1PJ7A 2LU1A 2MZTA 3TJ9A 2BBEA 3H25A 4NZ6A 1MWQA 4MYTA 4JBCA 4HDHA 1U24A 2J6TA 2VQFF 3LP1B 4WBFA 4QPXA 5KFQA 4A8MP 4C8YA 3IR6B 2OUGA 1RWMB 3TWZA 2DITA 2YX1A 3O8WA 5KFNA 4I7FB 1Y5IB 2E5JA 2ASJA 2GMHA 1B4SA 2C42A 3Q8VA 2XMUA 4ZVSB 1G3OA 2Z57B 5U47A 2ZH5A 1UZHA 2NYIA 3LP0A 2IVFB 1VQPS 4YY3F 1PO6A 3MFHA 3P4UB 3THTA 4GC6A 2DTJA 3LTOA 3P49B 4X65J 2MQPA 4MMOA 2E9RX 1DZ5A 1SQFA 4JI1F 4IO1A 1BUXA 1DQ9A 5DQIA 3KK3B 2XI2A 4UW2A 4JI5F 5E5NA 1HBUB 2V69A 2ERRA 2ZBCA 3LGHA 4XAKA 4JI0J 3W66A 9RUBA 3J81j 4ZJOA 3T1HF 5KFBA 2MZ1A 4IRKA 1AA1B 2WB4A 2PFDA 4PG7A 4DR7F 4ECXA 5HLFA 1D09B 3NXZA 4QWBA 1S6QA 2FHMA 2HQIA 5ETOA 1PGZA 4C3LA 4U8VA 5A8KA 3R5DA 1F6TA 2GHPA 2HHSA 4L74A 4XK8C 3TYTA 2K1RA 2C3OA 1RLDA 1D8ZA 2CJBA 2DXFA 2VASA 1LK5A 1HHSA 4FPRA 4NMXA 5J2NB 5LJ3Y 4DLEA 1HI0P 2CQGA 4RL1A 3SFGA 4AXIA 3CJ4A 1TTHB 3OTDA 4X4PA 1X7VA 3OSPA 2HFVA 2WZ1A 3HVRA 2P9CA 3FDSA 3ISNC 7AT1B 4IFVA 3R5CA 5EGYA 4NEZA 4NLXA 4PUOB 1FDDA 2H5IB 1CULB 3NGUA 3V81A 1AFIA 3Q8RB 3L9ZA 3MMCA 3V2UC 5CABA 2EFPA 1M5OC 3RUBL 3W2WB 1RT5A 2WSEC 1J5EJ 2F4FA 2HVEA 2B51A 2XY5A 1DBDA 2OPQB 4DR6F 2KFZA 2DEIA 2LQJA 2ZD1A 3KUHA 3V4MA 2NPFA 4DL7A 2IY5B 5HL7Q 2XLKA 5A76A 4CO0A 3JQJA 3DLBA 2RH3A 1J5EF 3VWSA 3X3UA 2XS2A 3C2PA 4DF8A 1SKUB 2ZM6F 4FYDA 5KAKA 1NDCA 1FTCA 4EO6A 2NXUA 2NXCA 4CQ1A 2EFGA 2AF6A 1RHUB 3A3NB 3UD4P 1PG5B 3M8QA 4G6VB 4DV5J 3GV8B 4HDGA 1KLMB 3A3OB 4H4KC 4XPCA 1SC1B 2EPIA 4RBUA 4ER8A 1Q16B 3EWGA 1RHMB 2K7JA 4JI7J 1U02A 5LL6d 4G65A 4USTA 2J0WA 4KV8A 3H5XA 2HVIA 5G0RB 2RQMA 5HP1B 3BR9A 4J9VA 3K5LA 3TUZC 4N56A 3UW1A 3NMRA 4EUVA 4DR7J 2HFOA 1SBRA 2X1GA 3GB0A 3E3XA 2IMWP 3DOMB 4W98A 1DQ8A 4F0KA 5KT5A 1I1GA 1D1UA 4MK8A 1TFWA 2AYGA 1TL7B 4GVLA 4HVZA 4MKBA 4CLWA 3MI7X 1Z2LA 2RRBA 3FSXA 4I6AA 1TAQA 3UVJB 2OFHX 4HTIA 4IH7A 1Y4ZB 2P9GA 3T9ZA 3HT3A 3K58A 1VQNS 5FLXU 3KDNA 2K2PA 1O6XA 4LF6F 4LR8A 3F73A 2W7AA 4ZIWA 4OLPA 1FESA 2MZSA 1QJHA 4ZPWR 1C1CB 3DU6A 1R8AA 5KFLA 4ENOA 5F8MA 3DRSA 1S77D 2Y8YA 2HNDA 1VK3A 2CRLA 4DV0J 4ZITA 2G2ZA 2VD3A 2NXEA 3KG0A 3QGGA 4O4GA 3CMES 1X4EA 1XR5A 2APOA 1YWXA 2OSQA 2WB1D 1FWLA 2JOQA 3HI9A 1CJKA 4NLQA 4QWDA 5KG4A 3OJUA 2FD2A 2CJYB 2W8LA 4DV4F 2E5GA 3H98A 2VFSA 3N6MA 2VFRA 4FVMA 4KRWA 2AKWB 3I56S 3TA1A 4JYAJ 1RWUA 2FZKB 1RSCA 1WF1A 3MM7A 3FK4A 3Q89A 4NE9C 4DUTA 3TUJC 4YMEA 4CLSA 3G71S 2ZDOA 3W5ZA 3V4IA 3PW7A 4LVOP 1VRTB 3BGUA 3M8SA 2DH7A 1U6ZA 3DU5A 1DURA 2B6AB 4BWJA 4DL5A 2AGQA 2AGOA 1U1RA 1LKZA 3GIMA 2F4VJ 3A4TA 2KB2A 1RE1B 5J2NA 5KT7A 1GNKA 1HI8A 1WD6A 2RE1A 5MLCV 1NJIT 1N34J 3Q22A 2HHQA 3VQTA 2JH3A 1V3SA 1H74A 2XYPB 1HBOB 3D54A 4PAAA 5HROB 4RNOA 3RRHA 1T7PA 1AZSA 3EUNA 4RPFA 3P96A 2YWEA 3FBBA 4WXWA 2YXLA 3QAEA 3MCMA 5CQGA 4QW8A 3M9OB 2OH2A 3KK1A 3V6DA 4LSLB 4LBHA 4PRFA 4F3OA 1K47A 3MTKA 4IOBA 4WXOA 1EHWA 3H2UB 3FCWA 5B0EA 3BQ1A 2XY7A 2JEFA 4DV5F 2D3OR 4FPIA 3EE3A 2Y1JA 2QMXA 1W25A 3JSBA 2XYHB 4IDKA 2KZZA 2CDQA 1XBWA 4NLTA 1RHKB 4BWMA 2VG7B 4JYAF 2Y8WA 1T02A 4WF9Q 1U8SA 3KLHA 4LF4F 5EWFA 3M1VA 3KLEA 1ZM3A 3VGSA 1LXJA 3CDEA 4A4JA 1RHJB 2QGFB 1FRIA 2QX0A 2KO1A 3T1AA 1V5IB 2C3PA 3CDBA 1WKLA 5I3QA 2B0GA 1KWMA 2Y3YA 2JLGA 3D6HB 2CNLB 3OVBA 1IR0A 1HWJA 4CLLA 4KHPJ 1NHUA 1GFWB 1H72C 2J8AA 3GILA 1E6YA 1QY7A 5C2GA 1FRLA 1VIXA 4RW4A 1U49A 3FQLA 3G8TA 1J2VA 3M2RA 1VQMS 1M5HA 2D9OA 1RADB 3QT7A 3R6GB 3K57A 5ETVA 3FBFA 4JI2F 2W8KA 4DR2J 1NM2A 4NRTA 1DTTA 2CJ9A 4BLGA 3D1HA 3V6JA 4OFZA 3KTQA 2AJFE 2KN4A 4KO0B 4OV6A 4DZDA 1X31C 1HNIA 1ZAWA 1CQMA 2C2ZB 2DGWA 4ZVRB 1RT2A 4LQ9A 5HBMA 3EZOA 4M5HA 5K8PA 1S97A 3WIUA 2VOOA 4ZKAA 4ZVQB 2W01A 1RTDA 4DG1B 4LJMA 5LMNJ 3N28A 4WFXA 3FSYA 5KTQA 3T1HJ 2JEGA 2HHWA 1EKRA 2RHQB 2W2NP 2CYYA 2VBWA 1VS3A 2FDNA 1RU1A 1UEKA 2ZVIA 3P8BB 4LR9A 4YB6A 3DFEA 3GQCA 2ZHBA 2BOAA 8AT1B 2E44A 3R1HA 1QAJA 1ZYQA 3LAMA 3IXQA 4EK2A 1VBZA 2OD4A 3N9UC 3I5CA 4NYPA 5B0GA 1N36J 5I3UA 1TKXA 3PHTA 4H54A 3FCVA 1EX8A 2JC0A 1RTIB 3K8VA 2GS8A 4CYUB 1QTNB 2YWKA 4USIA 2QT7A 4M5JA 4E98A 1FO1A 3KYLA 1UFLA 2DO0A 1IKXA 2RU9A 4DFMA 2Q1LA 2KDOA 3GSDA 4DMZA 3H4BA 2O3DA 3IRXA 4LF7J 3HHNB 2YY3A 1TQLA 3AD9C 4XTTA 1L3KA 1YRTA 3Q8UA 2MKHA 4ZLJA 2OLWA 1Z4UA 2ZOGA 3EGVA 4ZVPB 4YDDB 2XO7A 4N5SA 4DSFA 2AV5A 2GVZB 5KG1A 3G82A 3ENAA 1S5ZA 2MQOA 3TR5A 1JJCB 3KK2B 4KSEB 5D4OA 3V81B 5KFHA 2QN6B 3KG1A 5B0FA 1PBAA 4U6PA 2JNJA 5HK4A 1ZS6A 1LOUA 5EDWA 1V3RA 3BO4A 5KFUA 1Q78A 3B4DA 4ES3A 1TUVA 1YRUA 1IR2A 4DN9A 2DNPA 3MM6B 2BKOA 3HJFA 3R2DJ 5E3QA 3E8OA 2Z2YB 3KLIA 4TYAA 3FFIB 4NLOA 1FXRA 9ATCB 3KLFA 2OIHA 2RS8A 4GO7X 4ZA1A 3NOCA 3VF0B 2V8DA 4KGVB 1QE1B 4B3TJ 5CA5A 2H4YB 2YNFA 2PDAA 4KY3A 1DLOA 3DGPA 3J81U 2IM2A 5HMXA 1C0UB 3CWJA 3MCSA 4DV1F 3QT5A 2R7QA 4ED7A 3LGNA 3UN5A 5AJ3F 2Q3PA 2QTWA 4ZK7M 3TAMB 5DG8A 3D0IE 4DU8A 1ZETA 3TUPA 4ERDA 2QLJB 4M5IA 2EXUA 3V5RA 3BYRA 5JMNA 3KK3A 3NCQA 3DOLA 3W9HA 4O3SA 2AYEA 3GMGA 1XMOF 3DLHA 4PWDA 3T6JA 1Q0NA 3FMWA 3BN7A 1OWXA 4HYKA 3FCHA 2WSCC 3PM9A 2FHOB 3DOLB 2BQRA 1X9MA 3GR1A 3LP0B 3CJTA 2VL1A 3DI6B 3QRPA 3TA2A 2XHCA 5D4PA 3BZQA 4R0JA 3GFHA 4DQPA 1UVJA 4I7FA 4Z37A 5HJXA 5DJBA 2D3ZA 2GAGC 2RMLA 1RBAA 2GIQA 3HT0A 1NRKA 2I38A 1IXKA 3LP1A 5KFIA 1B7YB 3J81Y 1BQNB 1CJUA 2QL7B 1NO8A 1D9AA 1FDBA 2E5LF 2DNRA 1S9FA 4ETZA 1FK9B 1U1QA 2B3TB 3R5AA 4HTJA 1OPIA 2V67A 2ZITA 2KL8A 3KLFB 4FYVB 1J5OB 1YLXA 1GXLA 2ZHOA 3RRGA 4ETXA 1ULRA 1VQOS 3PFEA 3NKYA 3D66A 1FKPB 4ECTA 2AQ4A 4LFCJ 2RF2B 4QR2A 1S9GB 4F4ZA 4YN3B 3HSDA 4ID5B 3S8SA 3A8EA 1RUSA 3H0PA 4LIRA 4B17A 4RNNA 1HYSB 2CKWA 2IHR1 4DZ6A 4QPTA 1WF2A 2DD8S 3G82B 4IQXA 4CT8A 1QAIA 1FEEA 1JIHA 1FD8A 2BKPA 4DR4J 1S49A 2OAUA 3TO8A 5DM6Q 2BJ8A 4WP8A 4USVA 4NXNJ 5E7OB 3PFOA 4JI7F 1P1LA 4CH7A 1N8RT 1Q8KA 4IRCA 1PYSB 1RBOB 1N5QA 2J5AA 3EX7B 4OX8A 1J27A 1DTQA 3B8HA 3EJMA 3LAKA 3M8WA 4ZLNA 2BXJA 3J7YI 2PI5A 1JNRB 5I3UB 1KTVA 3QO9B 3QO9A 2HQDA 4X64F 3ZZRA 2CJQA 3CSKA 3EGWB 4U9RA 1IWAA 1ZAVA 2M4MA 4GVBB 4PXCA 6FD1A 3OSNA 1WC5A 1F3VA 4JOUA 4K5SA 2CAJA 2HURA 1KONA 3NS5A 4FXVA 2CUYA 3RYLA 5F8GA 4QWCA 3T5KA 2CQ4A 2QFIA 3L95X 4OHZA 5H9EK 2AYMA 3IWNC 4TU9A 4YR0A 1CJTA 1EARA 1NJXA 2GVDA 4P2MA 4U95A 3MM9A 1GK8A 3OUYA 1S6OA 4C8ZA 1SJQA 4ELTA 3QMQA 2WONA 3BS9A 3I0SB 2E9ZA 2CPDA 1MNEA 4B08A 4CLFA 2H9ZA 3B82A 4AUKA 4YQWA 4OI6A 2J0QD 1CLFA 2AX0A 1IJEB 1XN9A 2AEFA 4ZP9A 4ZLLA 2WHOA 2B56A 1TK0A 3GV7B 1RB0A 4KB7A 3ONQA 3W64A 4CNZA 3U1LA 3CCTA 2X1AA 3HSZA 1KKHA 2ALZA 3NMAA 3EZUA 2XSFA 2IDEA 3SCLE 1B7FA 2C2MB 1KVIA 1BQMB 1YZ6A 5BJRA 2CQHA 3IMQJ 3N6NA 5IXUA 1CJUB 1BQNA 2LFVA 2QE5A 3CGIA 3Q8SB 4DR3F 2GGPA 1Z2ZA 1GTHA 2LXUA 2XS5A 2HVZA 1S1VA 3DLJA 3KLVA 3HX9A 1JLCA 1VCTA 3ZTRA 2VBZA 4OJGA 5AXNA 4QWEA 5CXTA 3CCSS 4PZVA 3S01A 4U7CA 3IAM9 4QR0A 5JUMA 3CC7S 4N8OA 4QZVB 1N33J 2AD9A 1UVMA 4O4RA 1B3TA 4I2PB 4JI1J 3Q8QB 2CG8A 4F26A 3OVAA 3QYYA 1ICEB 4C11B 1SL0A 2ZH6A 5GADU 3W1YC 1XK8A 3SIPB 5HJYA 1GMWA 2HLUA 1AUSL 4TQRA 2BKNA 1CJVA 2AX1A 4DPYA 4LRBA 2EC2A 2UP1A 3KK1B 3V6DB 3Q24A 3CCVS 3UCUP 2O1PA 2G4BA 1UVNA 1GXTA 3KUEA 1WSRA 2POKA 2ILYA 3OR1B 3KJVB 2FY8A 3P5BP 1OYEA 4CRJA 1U25A 4FS2A 2ZBIA 4IOAQ 1DLOB 2BYCA 3DGPB 2A3JA 1D9FA 3MEDA 4MFBA 3JTOA 3B54A 1RWPB 3D6TB 4JV5F 3NGKA 3D9BA 4JP8A 4EYIB 3MWBA 3TVKA 3A13A 4NA1A 4HLBA 3KOAA 3RR7A 1R0BG 3N5FA 1O8BA 4IRDA 4QYZJ 2KJWA 2EG1A 1YHQS 4LF7F 2HAIA 2DT9A 3JAMU 2N7YA 3L3CA 4CO1A 3MM7B 4CNYA 4P2SA 2DGOA 2CG4A 2KKHA 2DH8A 1U1OA 2Z4PA 3PW2A 1S7IA 2NUUG 3H20A 3OBIA 3OXFA 4I0WA 1BHNA 4KGXB 3TX8A 1LWCB 1SUQB 1VGYA 2H4WB 2H5EA 2PD1A 4D3GA 2HNDB 4D3HA 2ZH1A 1K0TA 3AOCA 3IRXB 3BSCA 4DLGA 1Q5YA 2CZ9A 4F25A 4DX7A 3GSIA 4HH0A 4X4OA 4YR2A 2RQ4A 3PCOB 1RAHB 4HEA9 3AD7C 2BDPA 1DTTB 5D15A 5KT4A 3BGOP 2RUSA 1X4AA 4F4WA 4OZNA 3L7OA 3RB0A 1FJ7A 2UVRA 4ZP8A 3VCDA 3RGIA 1L5UA 2R7XA 5LOQA 4DR3J 4DX5A 4K4UA 1UWBB 5JJBA 1NZAA 1UAWA 3CCJS 1SKSA 3UCGA 2FQQB 4ES1A 3O5TB 2YVSA 2AEJA 4KH1B 4MAKA 3HSJA 5B0BA 1E6YB 1G6BA 1VJQA 2M3DA 2KHCA 2OEMA 3SYZA 1T9UA 2YPYA 4Q0BB 2OO4A 3LWLA 1UA1A 2XO6A 2QJ3A 2DGVA 1H6KX 5F0UA 2B4OA 1PYOB 1X9WA 4GC7A 1K9MT 4FP9A 3GLJA 2CPHA 5IWAJ 1A6LA 3GE9A 4LFBJ 2KRBA 3HFVA 2VA3A 1RWWB 3BBBA 3DGVA 2RSQA 1S7HA 1YRXA 2HIYA 1OY9A 1U8WA 2JLFA 1XR7A 4OX7A 4B3MF 4OX9J 3JSYA 2ZVSA 2RVJA 2FJAB 2N3LA 2X7IA 2DHGA 3BR8A 4URQU 2V8HA 3M2RB 1NB2A 2WRMA 3GU0A 5EUHA 4RW4B 3OTCA 2FHJD 3KJQB 5KOXA 2HZAA 1H38A 2RS2A 3R2CJ 4LF4J 2IC3B 1RTJB 2FJDB 3G4SS 1ZOTA 3NGTA 1HBMA 4DCJB 3D1QA 4UUWA 1GH8A 1HR0F 3HP6A 5DDOC 2GO9A 1RWNB 4USUA 4WKRA 1SV5A 3HZGA 2ZDPA 2C2RA 4RUBA 4IR9A 4OYXA 3R97A 3FZ2A 3KLHB 2Y9HA 2GAHC 2Z30B 2G2OA 1U47A 3KLIB 1ZTTA 2YQ0A 3CDUA 2PFFB 5DGAA 3M6WA 3NCRA 4NLSA 5F41A 4DS5A 2IMOA 4E8UA 4B9TA 1WF0A 4U8YA 3I32A 2BM0A 2QEXS 4B9NA 1ZTWA 3ELHA 2X1BA 4ZN3A 1REGX 3J7AN 1WJ9A 2HMIA 3MMJA 1N5YA 1C4CA 2LVWA 3IAS9 5KFSA 2RUGA 1TL5A 2HPUA 2QRRA 3W2VA 4DXLA 1U45A 2IM1A 2EKNA 1GEHA 1WI8A 2FYXA 2B9YA 3IN5A 1X9SA 1L3VA 1IKWA 2ZC4A 1KHWA 3VQSA 1RWKB 2YKOA 3CVKA 1P9QC 2DY1A 4X4TA 1H7WA 2Y1LB 3VAMA 2UU9J 3R7BB 2WW8A 1KVJA 3THVA 5C24B 3EPGA 1IUJA 2LKZA 2FJBB 2YNGB 4CIOA 2C2EA 1FJGF 4OL8A 4NASA 2F9DA 3AB4B 1SJRA 2QFJA 2QYCA 4DV4J 1XJWB 3R8YA 3FSIA 4WZMA 1U26A 2E29A 1U4BA 2BANB 1HNZF 3HK2A 3M8YA 2W2OP 5GMDA 4NCBA 3H59A 2CA9A 4WU3A 2MJNA 3W5YA 5CD4A 2HQCA 1EJ7L 1FE0A 2H5JB 3I5BA 4KAIA 4USHA 4J9LA 3X1LB 5B08A 2WW4A 1JJ4A 4NXMF 1NSPA 1UTAA 2IA0A 3DOMA 2HNZA 3MECA 5BYRA 3TANA 4TXSA 3BB5A 4UOHA 1S1WB 4J9SA 3NCPA 2BQUA 4E2FB 3IFEA 4RR5A 4A8OA 4K5RA 1UPMB 4EMDA 1YJ9S 3QIDA 1UCNA 2J9DE 1DAXA 5KFJA 3BBFA 1QLNA 1WOOA 2RIJA 1Q5VA 3DLGA 3MMBA 2R8KA 1AB8A 3OL7A 3D0GE 5LSRA 2FHJA 2R4FA 2ZHAA 2FVCA 4ZCKA 3LOUA 4DPWA 2YNHA 1RA7A 5KFCA 1N32F 1MG7A 2EG2A 2HGNA 3DLLQ 2FVQA 4PXBA 4YHHF 3GJRB 3MPWA 4TVAB 1W2BR 1X5SA 3VTIA 2NCKL 2XLJA 5HVGA 3MUMP 5GAHU 4F50A 5DM7Q 3SDEB 1LFPA 2HFZA 2VC0A 3F44A 3MMBB 4HR2A 2W25A 3NS6A 3CTRA 3F56A 3OL9A 2XNQA 1T0TV 1M1HA 5CYJA 1QSLA 2F8MA 3LF0A 1VQ5S 4NCAA 3ENVA 3JB9k 1RHRB 4AL7A 3GTYX 1LWCA 1PC4A 2VFUA 1AFJA 1JQGA 4KV8B 3PV8A 1VOMA 1C0TB 4I67A 1NU4A 1JJHA 2MKKA 2FGCA 2HBZB 5D78A 2VG7A 3QSYB 4K0KF 4PYAA 3IM8A 3C8YA 4E0DA 2CPJA 4KKOB 3UN2A 4DN0A 1Y11A 5EWGA 4N7TA 2JDJA 2VC1A 2CNNB 3EDQB 2R2TA 3U02A 4DL4A 1H73A 3LALA 3M30B 4JV1A 1CQNA 1RACB 4ICLB 1S72S 2V4RA 2PEHA 4X66J 2J7UA 4KR0B 4BCAA 4OZ0A 4QW9A 1JLQA 2BJEA 2MTLA 2W24A 3Q8PB 1HD0A 1SB6A 2H48B 5G4DA 3C46A 2FLNA 4M8LA 3SV3A 4B9MA 4WFBQ 2A0FB 4RW7B 4OYOA 1QM9A 3ILLA 1QSSA 2DRBA 2YNIB 2CNOB 4ALZA 1RT5B 4IOCQ 2FC8A 4ZVTB 2J0SD 3P5TL 2XS7A 3LPEA 3AJ2A 1HBUA 1W26A 2G2YA 1JXVA 1MU2B 4MH8A 3S1TA 3T19A 1CULA 2CXEA 1QSYA 2Y1RI 1I94F 3RB6A 1FX2A 4KQZA 4ZPTR 3M30A 3RBZA 3OFEA 2W9BA 2Z8QA 3JXOA 4WP3A 1JLEA 2L08A 3GJSB 4KKOA 3H2VE 5AXKA 2CQPA 2HIQA 2QMUB 3FVYA 4O23A 3U27A 1NCLA 1Y10A 2R8JA 5KG0A 3NBPA 2L48A 3WZ0A 4DV6J 2OD6A 3CDAA 2RQCA 1MN7A 3IWXA 5D0RA 4DV7J 3PO4A 2E5IA 1JKHA 2HFSA 3JQMA 4CI0B 4JI5J 2LQ8A 1VR6A 3BDPA 2PMHA 2R7SA 2C2NA 3Q83A 2F9JA 3PX0A 2CQBA 2KYXA 4F4YA 5HLFB 1WACA 4C8OA 2JHEA 4NYOA 1QAYA 1OMSA 3CO0P 3M6UA 3OXGA 2KT2A 5A8WA 2BUNA 1WOPA 1RKIA 3OV7A 3DHWC 4PWWA 4YB5A 4PG8A 1WWHA 2HAFA 3QNWB 2VUGA 4K2XA 3R7NB 5A2QU 1RWOB 1ZM4A 1T9WA 1OQ3A 2QC3A 3DOKA 4J90A 4OZ3A 4PR6A 2QA4G 4JV2A 4YFUA 1S48A 1RT1A 3OTBA 4RX6A 1M5VC 5HMWA 3NWRA 4Q45A 1NZ8A 2MDAA 4X2BA 1X8DA 1X0FA 5KFEA 4R5PA 3HULA 3I96A 2IBOA 4KHRA 1D8YA 2DRAA 1ZM9A 3I0SA 2XM3A 4K59A 1LW2B 3MM9B 3OUYB 1T11A 2SXLA 3IWLA 2CJKA 4DOZA 3JSMB 2HKEA 3MCNA 4U67Q 2KFYA 4A8FA 4OI0A 4O44A 3MECB 4BDPA 2AMCB 2XEXA 3UQSA 2QG9B 1TL1B 2AHOB 4ZJQA 4I6WA 1NAQA 3CE8A 2VG6A 4TKTA 1MWZA 4EI2A 4NI2A 3MR2A 4WU2A 3K5PA 1URRA 3O2IA 4ES2A 2FHKA 3W65A 3JYTB 1S1UB 1FF2A 1YK9A 2LYVA 3IGVA 1RK8A 3AQPA 5KFFA 1X0PA 1WC4A 5DETA 2CPEA 5KFWA 1R8BA 4NA2A 2FLOA 1WHYA 5E33A 3I55S 2EI5A 3NGSA 5ETKA 4F0MA 4RJVA 5KFPA 3ZZ0A 4LFAF 4DU7A 2WOMA 3POTA 1L3SA 2PC6A 4OI1A 3OFGA 3QBCA 4B9LA 2B7CB 4LRCA 1RXOB 1FI4A 2MQLA 2XMKA 3OXLA 5CYQB 4RNFA 4WTOB 2OELA 3OR1A 4ID8A 2VQEF 1TP7A 1HW8A 2ADBA 2I5JB 2QA2A 2DB1A 3ILJA 5KFAA 3SEOA 3W2VB 4CH0S 1VHIA 4DQRA 1SJFA 1U7LA 1UEUA 3KLGA 3PVXA 4OHVA 4AT1B 1KQSR 1LNQA 4NCGA 1G1XA 1HFEL 4PUOA 2NS1B 1IBLJ 1D0EA 4TY8A 4MJKA 2XMJA 4DR2F 2Y1IA 2BEFA 4JI2J 4I56A 4RLEA 1FKPA 4XPEA 2FPHX 5H9EJ 1NB7A 2PT0A 5KFYA 2A6OA 2F63A 2XYGB 4CCHA 1B0PA 1SIWB 4CH1A 4J9QA 3W8GA 2ZKTA 5B0AA 1TL3B 5DG7A 1NKEA 4DR5J 2KG0A 5F3ZA 2JFDA 2Q66A 4KHPF 5CAAA 1K1QA 2MQMA 2P2CB 2DNGA 1G7CB 2VH7A 4F7VA 1S6QB 1KP6A 3HXMA 5D6GA 1HQ2A 5HQ8A 1MN9A 5K9FA 2X3DA 1RCOB 5A0YA 1KQKA 3ZTSA 1HBMB 1D9DA 5HMYA 4ELVA 2W4DA 3C66A 2XBPA 1SIZA 2DGSA 1RTJA 4KGMA 1IBLF 4X4NA 1VC5A 1YX2A 1NK9A 4UY85 1TKTA 1RT6B 1XQIA 3DLKB 1RAIB 3F41A 4WTYA 4XIUA 1S9EA 2OTJS 3MPDA 1Q7LB 2M70A 2COLA 3IS9B 4IG0B 4ZOSA 1LXNA 3Q0AA 1VJWA 3DDNA 1IJFB 1N5SA 2AJ0A 2HNYB 2XHWA 4I4BA 4NL5A 2NPIA 1SKWA 1LWEA 4LF8J 2DIVA 4DDFA 4RZRA 2FJVA 1RT6A 4J9PA 1F0XA 1ZPWX 1S0VA 4GKJF 4CLTA 2HWTA 4Z7CA 1FCAA 1R6VA 1T9YA 5KG6A 2YQ3A 1JLCB 2G13A 5AJ3J 3KMQA 2HHUA 5EWEA 1X4CA 3I4HX 1T9XA 2GVDB 5E3RA 5GAHI 4DR6J 4CTAA 3G86A 3SQOP 1FDNA 4A46A 2QLFB 1IR1A 1BD6A 1K0VA 1DJ0A 3GR0A 4KC5A 5D77A 1FT8A 1FRHA 3MM8A 5HAOA 2IVYA 3TZZA 1RAJA 2QMWA 1HL6A 3Q23A 4RW8B 4P52A 2F8EX 3IR7B 2NUHA 2B7BB 2ZUGA 4USJC 1IKYA 3C15B 2OPSB 2BE2B 4UTGA 1NKBA 2EWHA 4ITSA 2XZTB 3GP9A 2A2CA 5JVGQ 1V3ZA 5SUHA 3UE2A 2EC0A 2N82B 2V63A 4K2JA 4QCLA 1WORA 2V50A 3KK2A 1RKJA 3OFHA 3KHHA 5IM0B 1EP4A 4EWTA 1TV6B 3FKBA 3LANA 2VDHA 4Y00A 1U0HB 2IJFA 1PYTA 4I2QA 2N3OA 2DR9A 2R7TA 4B3RF 5K14A 1UW4A 2GC8A 3IBCB 4PEOA 5L39A 4LF9F 1BMQB 4JUZA 3V6KA 3KDOA 3VAKA 2BR0A 3CJKB 5A8RB 1KC8T 2UUWA 1HBNB 3UI3A 3ZNUA 3NGDA 2G1DA 2R7RA 5DGBA 3I4PA 1NDKA 1RAEB 4B9VA 3HF5A 3PDNA 5FDLA 4ZVUB 3UDVA 4DFJA 2QA4S 3KMSA 3BSOA 1TKXB 5LXYA 5IT9U 2V5HG 5T41A 5IT9Y 3CJ3A 3PEHA 3KUGA 1XMOJ 1REVB 2BOPA 2KVIA 2MSTA 3GFZA 4J5OA 2IRYA 4LIWA 2DHHA 3MM8B 5AXLA 5J2PB 3AOAA 1U0SA 3HHKA 4LF8F 1AXQA 4RUHA 3MGJA 1Y5NB 3DNCA 1NK4A 2FY1A 1PBUA 1TL4A 3DC2A 1JK9B 1FRMA 1X5TA 1U09A 2M0GB 2DNHA 2MKJA 3SSSA 2BV3A 5KFRA 5CZVA 1T9VA 3MR6A 4DV1J 4YEAA 3SFUA 3SZ2A 2LA6A 4V19J 3NOGA 1SPBP 4DSJA 2RRAA 1WDDA 1WEXA 3B6BA 3DM2A 4OHWA 8ATCB 4R5PB 3TARA 1U2FA 2GZOA 3ZZTA 4K50A 4MKAA 4CM0A 2R8HA 3P3DA 4WCEQ 4ANCA 4LF2A 1O51A 1OJ4A 2C3MA 1O0PA 1HARA 5IT0A 1OYDA 1R8CA 2EBEA 1XMBA 2OPSA 4Y34A 1MROB 1BC6A 1YVFA 2GIFA 3IS9A 3UNGC 3SI8A 3NP5A 2B43A 4WIQA 4C8NA 4UOCA 1TVRA 2ZBRA 4DR5F 1VQ7S 4B9UA 1TKTB 2NR0A 1KTQA 3CB4A 1EETB 3QFWA 4ECRA 5DQGA 5THWA 3SMZA 5LMUF 2O66A 2EFOA 4USMA 3RBDA 2ASLA 3T41A 3TQ1A 3DXSX 4RW9B 1N0VC 1N5VA 1WKJA 2H51B 2CZVC 2GHVC 2MZRA 3D68A 3NEKA 4M63A 4P72A 4F2RA 1XNQF 4ILRA 3HHDA 2LQ9A 5HQMA 2UXBJ 4F67A 2GHWA 3I0RB 4IO9Q 4K0KJ 1BQMA 2MQ8A 2NXNA 1H98A 1QUPA 3HVTB 4L3KA 4PXDA 2MPUA 3BGRB 4ZN1A 4N76A 4I6YA 1S1XB 2A1BA 2CVIA 2YKNA 2MY8A 4ED8A 2CQIA 3D1OA 3N5BA 2CJXB 1VFJA 4P6QA 1GT8A 4TY8B 3QRQA 4ZP6A 3H90A 1Y3JA 4PWDB 3IC1A 1RAGB 1G4CA 1S9EB 1WG4A 4J37A 4CWBA 4DV2J 3DLKA 2YKQA 4R25A 5M2UA 2ROPA 3J7A1 1Y3KA 1T05A 4QWAA 2H65B 3GYGA 2Z56B 5EX3A 1I3OB 2DNMA 4PG4A 4F8RA 6FDRA 4O3NA 5J2QB 3E2EA 2ZH3A 1U2CA 1N32J 4X4RA 1YG0A 1VBXA 2GQCA 3MAQA 2WOMB 2HK3A 3POTB 1UVKA 3RR8A 4DV3F 5HN0A 2KM8B 2E1CA 2NZCA 1VIOA 1YQHA 3MPYA 4HL9A 5ETPA 5ITHA 2UXDJ 3CIMA 2ZE2A 3OR2A 3A8IA 5KG3A 5AE2A 1M5SA 1MMDA 2GIRA 2VU5A 3AY0A 3MAAA 4M5KA 3TEGA 4A8YA 4O3RA 2XQCA 2FIUA 2UZAA 3NGRA 1Y7PA 2X3GA 3CO9A 2O01C 5ETQA 2ADCA 2VA2A 2ZZNA 3NNAA 2DCUB 2V8PA 3GYNA 5FDLB 1L3UA 4JV0A 1JLFA 2KYZA 5LMUJ 1OSDA 2IIHA 2IM0A 4A8XA 3CXCR 1Q4RA 2VJVA 3QPIA 4C8KA 1A0OB 2DGUA 1CJKB 4CLPA 1U1MA 2H54B 3DDIA 2VPYB 1NH7A 2RDIA 1KSPA 4JI8J 5D3GA 1WNEA 5KOWA 1M1KT 1RU2A 1T3NA 5LT5A 3OQ2A 2LQBA 1WC6A 4DPXA 1QTMA 3DRSB 3QFHA 2X1FA 3HD1A 3VAGA 2R8GA 2HRTA 3M2UB 4K4WA 3LO3A 5T7LB 2AGPA 1GAOA 1HYSA 2VDIA 3MEGA 4NZ7A 1GMWD 2HHHJ 2DNYA 1N56A 1KS2A 1RT7B 3BDEA 4LF6J 3CULA 3TW0A 3UDEA 1R0CB 5CD4H 1S9GA 2J9EA 2VPZB 4M94A 2XSJB 4RW6A 2CPXA 1S79A 3RU0A 4OIXA 2KTQA 2C2KB 2DBBA 4UUXA 2B4UA 2PMZD 3R7SB 4DEZA 4NI2B 2Y0SD 4DV7F 1IBKJ 1K8AT 5L8RC 5A8WB 1Q8LA 1FK9A 1WDTA 4MK9A 4C97A 4FKXA 4CP5A 1T03B 1UVIA 4PPDA 1TU0B 3PNIA 4F2SA 2UUBJ 4X4SA 2BABA 2VBXA 5L1JA 4ZCMA 4DR1F 4AQYF 3GG0A 3OFFA 2OEKA 2FGOA 2ZUAA 2CIMA 1S57A 3RRKA 3G87A 4MKVA 2LDIA 2HNZB 4A8KA 1N34F 3VV2B 4ILMA 1JXLA 3D3CJ 3M8ZA 2BE9B 4ED0A 3QIPA 2ZKUA 4Z2XA 2ILZA 4OJ1A 2QLWA 1HNWF 2AIRB 5E3CA 1T94A 2UUAJ 3QLHA 4DSKA 1KDNA 1SC3B 1PJ6A 2J8SA 3CJ2A 4Q8EA 1RAOA 3PYGA 2W9AA 3J7Z5 4Y3CA 2GJIA 1WTFA 3GIKA 2W9CA 1FFGB 1VQYA 2VF3A 2R7UA 2YWHA 4LSLA 4ZVEA 3BM7A 2B5JB 3PRVA 2EVZA 1L3TA 1UJ4A 1RGVA 3OPKA 4DQQA 2RQKA 3W5XA 5HROA 4CLUA 5AE1A 4ECWA 1LV5A 4DV0F 4U7UK 1NJWA 2UVWA 1FKOB 3MUTP 1Z1ZA 3K17A 1QE1A 1UMJA 2BZ2A 2YH0A 3A12A 3OTEA 4IFYB 4PG5A 3W2WA 4AYBD 2OSRA 2QLXA 1X4BA 5F8HA 1Q81T 4Q2MA 1R31A 4MT1A 1YSJA 4R0EA 1NMEB 4LSNA 4LFBF 5J2MA 2HZCA 4KBIA 7FD1A 4HKQA 1FWKA 2JL9A 5B09A 2F5GA 3GG1A 1VLOA 4EYHB 2ABYA 2XZDB 2XWYA 2CQ3A 2W9BB 2HW3A 4LSNB 1HW9A 2GCFA 2AZ1A 2YX7A 4QBUA 4ED5A 2XCAA 3NG8A 4DV6F 5GMKa 2LQ5A 2W4PA 4DL3A 2G0JA 2FC9A 2BJ3A 3PR5B 4GKKF 1M5PC 4MK7A 2LXIA 4B3SJ 4O4GB 5ETSA 1NBEB 1HPZB 1UL3A 3K5NA 2ZBQA 4Y2CA 1C1CA 4AFFA 3E01A 1CSJA 2UUTA 3BKFA 1VK8A 3FEZA 5BR8J 3QGHA 1I94J 2E1AA 2XNRA 1JLBA 2DPIA 3DMJB 2AW0A 5D4NA 1M90T 1UFWA 3M2VB 2RILA 5D0GA 4B3RJ 3VHQA 3I87A 1Q82T 2B6AA 4ICLA 2JWNA 1UWAA 3LP2B 4WP9A 4C3KA 1PIEA 3TQEA 1ZZNA 4QU7A 2DGXA 2MKCA 3HKWA 5IC4B 1H0HB 3CCUS 2RAQA 3BEGB 3V4IB 3HHLB 2BJ9A 3IA0A 1YBTA 3HHLD 3VZIA 3PRBA 1TMMA 5DS7A 2V2ZA 4J9UE 4X66F 2E1MC 6AT1B 2J6SA 3JSMA 1S4EA 4LBIA 4C7QA 1ZA2B 4ED6A 3LUYA 4HT5A 1WI6A 3CC2S 5HP1A 2F8HA 2VJUA 1FVSA 2ASYA 2GQQA 1ZZFA 5MAOA 3NLCA 1RTZA 2OKQA 4ANDA 3MAHA 3RTVA 1A9NB 2WVEA 4TU8A 2P6SA 2UU9F 2DXDA 2HS0A 1UWBA 2WCXA 4OYWA 4B02A 3M7VA 4DPUA 3HKZD 1PSDA 4F4AA 3OTOF 2YNHB 2G1HA 3B4MA 3G96A 2UVUA 2ZJPQ 4V19X 5C7PA 2HBQB 4RU9A 3SXLA 3I31A 1DARA 3DLGB 4LF5J 5E3PA 3VVUA 2P8IA 4IG3B 1S76D 1NJYA 5C25B 1JLBB 4KGZB 1XMQJ 3QJPA 3BKTA 3MR7A 2E7VA 4HHUA 5LSOA 3S6EA 1NJZA 4KPCA 1EKSA 1FNXH 2XI3A 2EFVA 2JEIA 4UOGA 1H2TZ 1UW9A 2XGQA 2MXYA 3QWPA 5I3PA 4DX6A 3F0NA 2HRUA 5I4MA 1CEZA 3VVTA 3R3TA 4A48A 1U1LA 2IPOB 2BANA 3TJAA 1R6YA 5CZXA 3EGNA 4W92B 2H3EB 1HNXJ 3BSNA 4DI6A 2OHDA 1TMJA 1U1KA 2HEKA 2YBVA 1NK8A 5KG7A 1NK7A 2V4JA 3HHEA 1VQ4S 3PO5A 4KPYA 4LRDA 4ATNA 1Q53A 2NXJA 5DRKA 4P7VA 5A8KB 3E01B 2YNIA 4WYLA 1R89A 2F1FA 1RA6A 4C0OC 3SSRA 1MLAA 3I6PA 2C2DA 1EIYB 1RISA 1NEEA 3QT6A 4JI8F 3C16B 2IYGA 2NYHA 3MXHP 3AXMA 4C8LA 1FE4A 5F8IA 2AZ3A 4J91A 2VFVA 2B5JA 1JLQB 3MMCB 2V4JB 2DPJA 4NLPA 2P6TA 5E2QA 4QYRA 1UETA 5HO4A 5B0DA 2MKIA 2ZOFA 2HMIB 3PG9A 5AXMA 5KFVA 3M9NB 3CW2C 2L9DA 1VRTA 2P9EA 4A8QA 4GMKA 1VLYA 4OHYA 2YKNB 2LA4A 2DR8A 5J2MB 4I2PA 4CO5A 4DPOA 2FJEB 3O1LA 4FYXB 2N7CA 1S6UA 3NRBA 3TP2A 4DV3J 2WVCA 1S0NA 4QIWD 3ZC4A 3RB4A 3E51A 4OJ3A 2HFUA 1CG2A 1S4FA
chains in the Genus database with same CATH topology
4IH5A 2CQDA 2EBGA 5KFGA 4AL5A 3H40A 1X4HA 2KFNA 2N4CA 3OL6A 3RAQA 2EFNA 4TLRA 3MXHP 3KKFA 2MZJA 4M1KA 2OFGX 4LT6A 5GAEI 1SL1A 5A6PA 4CO2A 4X4QA 4Q0BA 5D8HB 1JXEA 2AJ4A 2L9WA 2VPXB 2YKMA 3CCWA 3BJYA 1AROP 5LSLA 4LMZA 4FNHA 4L6V3 3ZZZA 4FF1A 3QLHB 4O0IA 1WHXA 1FVQA 4DWIA 4DR4F 3EXYA 4GO5X 5EHHA 3AA9A 3SSQA 1H7XA 5IQQA 4WK3A 3ULHA 4ZHRB 3G6XA 1KN6A 4M95A 1A7GE 2PIIA 2GV1A 3DM2B 3VAJA 4FBUA 3UR0A 1VQ9S 2XB2D 2FJXA 2OPPB 2GX8A 2LEAA 1S1WA 2HHTA 4FVCA 2V9KA 4TYBA 4DHVA 2FJWA 1OPZA 1NNDA 1KFSA 2MB0B 2DIUA 1R0AA 2ZH4A 1T3OA 1T03A 2M52A 1BWEA 2J6UA 1SXLA 4H4OA 2O67A 3H5YA 5IWAF 3CJ5A 3CUNA 3WX4A 1SQEA 5F8JA 3C6UB 2BA9A 3DYAA 1JLAB 3TI0A 5B0CA 3D0HE 4G1QB 4B9SA 5J1EB 5D4LA 2D41A 2IRUA 1RT7A 2ZE2B 3OR2B 4DL2A 4B3RF 3M2VA 3AQOA 2MY7A 5E3AA 4C98A 2YNGA 2A2DA 3RTVA 2YH1A 3ZZYA 1JJ2R 5T7LA 2YX4A 5C24A 4K4VA 4WK1A 2DNKA 4O3QA 1U1NA 2B9WA 3GFXA 1YTYA 2I0XA 3FEXB 4DUZF 2HHPA 3PJXA 3M32B 3EGZA 1YJUA 5I42A 4CO3A 5DDPC 3H2LA 3QZ8A 2RKIA 4I2QB 2W7OA 2J9DA 2RT3A 3FRYA 3MUVP 3OLAA 1VQ6S 2U2FA 4NMLA 2JVOA 2GA7A 5BYSA 4DBQA 2OTLS 3QAUA 2O5DA 2PE8A 5K8MA 2KM8C 1XNRF 5CCMA 3KNGA 2OJ3A 2M8HA 4J9OA 2E66A 1ELOA 3DRPA 2IVMA 2LDYA 2A18A 5CHCB 3VR1A 3MOJB 1C4AA 4Y2AA 3MEDB 4MFBB 2K3IA 1I6JA 1HQEA 3DN9A 2VBYA 4EU0A 1XC9A 1S1VB 3KJVA 4RW9A 2GMLA 5K8OA 1RT3A 1GQEA 1Q1KA 2LEPA 1T05B 3PZPA 4NOHA 5SZTA 2IAJA 2K8GA 4QU6A 4DSIA 4MYUA 1WEZA 1KR4A 2MHNA 3HZEA 3N01A 4OQJA 1VC6A 1HNXF 2A10A 1CVJA 2JVRA 4WZQA 2QSWA 2UUAF 4EZ6A 4EBDA 1RTHA 4ZS6A 3H8YA 3GYXB 4JI3F 3EXCX 2QIFA 3KNAA 3IRWP 3K5OA 2HHVA 2NSBA 2EK1A 3H5SA 2WONB 1LWFA 3M8PB 2ZJQQ 4JI6F 1JMTA 3MMAB 4WE1A 1FTRA 2HGMA 4C0BA 1N36F 1ZAXA 4AE5A 2DNQA 1VRUA 1N0UA 2DGTA 3DXBA 4PXEA 4ZP7A 4RWXA 3O44A 3DRPB 4EBEA 3CD7A 4RBTA 5B7WA 3OJSA 4B3OB 1FXDA 2AJQA 2PGCA 3CF5Q 3AHPA 4F3QA 2VZ9A 3EYZA 4FXDA 4R8UA 3RB3A 1FXLA 4KHMA 1N54B 3O3LA 4DFPA 3C6TB 2VODA 1VQSA 2HLTA 4C9DA 3LW5C 3ITHA 3M2UA 3DCAA 5I42B 2GNKA 2CQ1A 1QAXA 3A1YG 3MEEB 4AXJA 3HHLC 5T14A 4OV1A 4Q44A 1TKZB 1TKZA 1JLGB 4OX9F 3K7RA 2FLPA 5D3GB 1YITS 5H1SV 2WK4A 1IKXB 3CT9A 2Q6CA 3ITHB 5KFMA 2AP6A 2CQ2A 4NA3A 3UPFA 3VAFA 2L9NA 2KXHA 1RTIA 2MYFA 1FHTA 5J1EA 1YIJS 2MJUA 1N6QB 1YJNS 3PIOQ 4RBVA 4X62F 3T5JA 3ZZUA 2R2UA 1UP1A 3J80Y 3VAIA 1HMVA 2HS4A 2U1AA 4L72B 4IUFA 4LQ3A 2K3KA 1TL1A 1NKCA 1VRUB 2YTCA 3U1MA 2KT3A 3NAHA 2E1RA 4N41A 5A8RA 3CJKA 1QVFR 2J9CA 3MTJA 4W90B 1SJ3P 4Y6IA 3MEEA 1KQFB 1TR0A 3N4WA 5GADI 3CDWA 4HI1A 4H4MB 4N47A 3CCMS 5HMZA 2JLEA 3DI6A 2YWGA 1JNZB 1YJTA 4ZVGA 2RF2A 3T9NA 1FJCA 2PN6A 4MIAA 5F9NA 2JEJA 3DOKB 3MD1A 2BE2A 4X84A 2R2RA 3T3FA 2FVPA 1JWWA 4DL0C 3JTPA 2JC1A 4QJVA 1YGYA 3I9V9 2IAJB 2B9XA 4FN5A 2I1RA 5CCLA 2ZFHA 4FNIA 4FBTA 2DNZA 3HM9A 2F3JA 2UV8G 1C0UA 3GFYA 3UDLA 1GXUA 4YP3A 3CD6S 1R43A 4HHJA 3KFWX 2DR7A 3DRYA 3ISZA 1H2VZ 2E5HA 5M2RA 3RBEA 4IR1A 5L1IA 1AW0A 4BS2A 1RTHB 5KT6A 1JLEB 4NRUA 1ZBTA 3AB2B 2DHXA 3MM5A 4XDDA 4H4KA 4JI4F 2P5VA 3NAIA 4OI2A 5IZHA 2QSFA 1NK6A 1SKRA 1MU2A 1NK0A 5KFKA 1VQLS 5L38A 4O3OA 2V2KA 4H4MA 2GQ2A 4IKAA 3SQGA 4ED3A 2C22A 3BGFA 5CYQA 2IFXA 3US5A 1X5OA 1HQEB 2D74B 2YNFB 2DGQA 1RDRA 2EFQA 4WFAQ 5J2PA 1N33F 1TL3A 2B4PA 4K4ZA 1HMVB 2WSFC 3R27A 3PR4A 1KOHA 1REVA 1FNOA 3MM6A 4Y28C 4WIIA 1S10A 2HYIB 2RD5C 1VC0A 2DHAA 4OX6A 2GMJA 4ZVFA 3JYTA 4Q2LA 5E0OA 4WKYA 3CJ0A 2NLWA 1DTQB 3TOQA 2XZWA 4BBYA 1BGXT 1SI9A 4ZCLA 4A8WA 1SH2A 2PA8D 2AWZA 4ZPAA 2VKRA 5F8LA 3UR3C 3AH6A 1JLGA 1YBAA 2RB7A 1S0OA 2EW9A 3BO2A 3IGNA 2ACYA 4RUAA 2OPRA 4I68A 3M8RA 2CPIA 1DQAA 5FJ4A 4KIAA 2DJWA 2KG1A 1R3NA 1U1PA 1IKYB 4EFAC 2GO8A 4DSEA 1WHVA 4Q5VA 1FA0A 4A47A 1R0AB 2HWHA 3UFCX 5AE3A 3J7YU 3BQ2A 1YJVA 1S1TA 3MOZA 1K1SA 4DG1A 4WE1B 1C1BA 1RYRA 2OPPA 3MFIA 2K7KA 4ZDNA 2CQ0A 1M5KC 5G0RA 1LFWA 1SH3A 2JRSA 4IH6A 4FF3A 3N6LA 3KLEB 3PX4A 1S6PB 4N8NA 1Q8BA 2C3UA 5K8NA 4DV2F 4OZ1A 2ZZMA 4ELUA 2DISA 4Q7AA 4F4KA 4UY8T 1RQ0A 5GVQA 3HK2A 1Q79A 2HNYA 2I8EA 1N88A 4IDKB 5GAGI 2V9WA 1SC6A 1TK5A 2XGPA 4Y2KA 1SL2A 2IBKA 4ZPVR 2MSSA 2UUBF 4EGLA 1IN0A 2VB6A 4JI0F 3UDCA 5HI7A 3TAMA 2X51A 1RT3B 4QOTA 4NX9A 2CVEA 1CC7A 5A0YB 3MF5A 4RW7A 4QIVA 3L7PA 2HRYA 2ZD1B 3BSAA 2LEBA 2JZ5A 3MHYA 2IJNA 5E41A 3M6XA 3W7BA 3HMJG 2V4QA 2KHDA 1X4DA 1R7IA 7FDRA 3DRRA 4XDCA 3TAQA 4Y2IA 3Q2SC 1LK7A 4Y65A 3OHAA 1FRKA 3LQVA 2ZC3A 5F3TA 3G9CA 2J7KA 3PIPQ 1BY9A 1NHVA 3I82A 3G6YA 4MIWA 4J9RA 1SH0A 3DDKA 3KLGB 2V94A 2FUG9 1S0MA 5L9XA 4ECVA 2XY6A 4DQIA 2NREA 1D3WA 1GTEA 4RNMA 1KD1T 3TRGA 4IQMA 1HWUA 1Y5LB 3T1YF 2RDJA 3IR5B 3QJLA 4ED1A 4PWUA 2CPFA 3OL8A 1JX4A 2VKZG 1IKVA 3AA8A 4IG3A 4PCQA 2BQ3A 2UXDF 3FZBA 2W9CB 3SDEA 3LH2S 2C3YA 2RU3A 4WFZA 2HVHA 4QIEA 4DJBA 3HPOA 1TZ0A 3MZIA 1TKDA 4B3TF 1Y9OA 3KG4A 2VG6B 3DRXA 3QIPB 4TNOA 1KHVA 4DF4A 2FLLA 4J9KA 3PHEA 1P8GA 1C0TA 4TU7A 5L1KA 1Y0HA 4EEYA 2I9SA 4ZLPA 3KWMA 1RTDB 2R7VA 3PY8A 3D28A 5DLGA 3M05A 1U6BA 1BLUA 2GJ2A 1S1TB 2DHSA 3RZAA 1JB0C 4EO8A 3GZ7A 4KO0A 2UVVA 1B64A 3EZ5A 2DCLA 2LLZA 2ZH7A 1F5CA 3QWUA 1XTZA 1F60B 3W3SA 1ZH5A 3V6HA 3TUIC 3CD0A 3FJ2A 2JFKA 2VV5A 2WBMA 1RT4A 5KFXA 2M5YA 5LJ5Y 1TAUA 1WEYA 4ZMMA 4ECUA 2MZQA 3PX6A 4PG6A 5JXSA 2QZ8A 2FTRA 4PKDB 1HPZA 2PSZA 4M5DA 2MMYA 5LXRA 2ZJRQ 2DR5A 1IKWB 2IA6A 5KFTA 5K5MA 2DK2A 3NNHA 2ZH2A 4ZVHA 3ISND 1JKHB 3VALA 1TFYA 4IYQA 4OJHA 2BRKA 2WTFA 3HHLA 3DLEA 3JSRA 3M8QB 1CC8A 4B3SF 1HA1A 2DH9A 4HT7A 3LP2A 3LPYA 4WJBA 2D9PA 3DRRB 1S99A 2K1RB 1SJ1A 2Q79A 3PKMA 4IFYA 4NZ0A 3BQ0A 1SV5B 1OSCA 2NSCA 1N4LA 2UV8A 2D1CA 1T8EA 2D3UA 1YJRA 4HH1A 4X4UA 1QUVA 2OPQA 3CD5A 1PILA 3OLBA 4ECQA 3WC2A 3ZFVA 2HWIA 4K4SA 4ECYA 3AJ1A 5F0WA 2E7WA 4OI4A 1P1TA 2C28A 4IFVB 1XWLA 4L3NA 2Q43A 3MPVA 4NYZA 2NQPA 3PACA 4C11A 4YB1P 1YJWS 3HFKA 2W7PA 3DLEB 4Q43A 5GAGU 3G6VA 1F2GA 2MHEA 2XMMA 3BGRA 2CPYA 4NLGA 1IQTA 1DHMA 2XULA 1FKOA 4MKYA 4DFKA 2Z0GA 3RW6A 1C1BB 4ZPCA 3SCIE 4DX8H 1F9FA 3OW2R 3SCJE 2R7OA 3UD3P 2IC3A 4OLOA 3IO1A 4RWWA 4DSLA 1PC5A 4TY9A 3L09A 3OHBA 1NH8A 1RT4B 4BHQA 1HWLA 3CCES 1MROA 1B0VA 2BJDA 1VMBA 2XSJA 2FB0A 4TLQA 3G6ES 4DQSA 4MTPA 3CMAS 2MKSA 3LWMA 2YKPA 2LMIA 3MEKA 3PW4A 2MGZA 2L41A 1S6PA 4F4XA 4YOEA 1OS5A 5J1NA 3UCZP 3BGLA 4XO0A 1KFDA 4PQAA 3TNVA 3PKYA 3G8SA 1UA0A 5DDRC 1SUQA 4X65F 1URNA 2DO4A 4HI2A 4URGA 3ETOA 1X5PA 2KRRA 2LXFA 4KT0C 1NK5A 3EPIA 4YB7A 2E7XA 4PPZA 5C5JA 3M9MB 4YDXA 4FF4A 2IRXA 2PO4A 2Z2LA 4TQSA 4ILLA 1KLMA 2XMWA 2RJZA 3BF4A 5IFMA 1HD1A 3R5BA 4WYWA 1UJ6A 3U1NA 1X4FA 5C42B 4PQUA 3KHGA 1H3DA 3UWTA 3WDOA 5DQHA 5JVHQ 1N6QA 2DRAA 1OIAA 3FEYB 3HVAA 5L1LA 1QVGR 2VFTA 2DNNA 2R2SA 3MEGB 1P27B 2VG5B 3DMJA 1IKVB 5KG2A 4URSA 2IYIA 2GW8A 3B78A 2Z2MA 2ZH9A 2J7WA 1WTBA 4NLUA 1LW0A 2VOPA 5KFZA 4BC9A 5K14B 4C4WA 1O5JA 2FVSA 5L9NA 3S7RA 1EP4B 1H2UX 3VZHA 5DG9A 5BYQA 4I64A 5M2PA 1N5YB 4KGKA 3PJWA 2DNLA 4KTQA 1M0SA 1UKUA 4EZ9A 3TVYA 4RKUC 3NNCA 3KHRA 3D5MA 4FXWA 3KHLA 4B3OA 4G1PA 1WELA 1MMNA 1WG5A 1WG1A 4RNHA 1R8PA 1XMQF 1VQKS 3CCRS 1TK8A 3DHXA 1HHTP 2IM3A 2KJVA 3HVTA 2CQCA 4C0HA 4ED2A 2JJ4D 2L3MA 2NZ4A 4KFBA 4UQTA 5EX0A 2ZNZA 4DS4A 5EN1A 3MR5A 1DFDA 4C2MA 4ZCIA 5J2QA 2KT5A 1LWFB 2J76E 2MQNA 3ENQA 3M8PA 5KFOA 1BQXA 1V9OA 4UQGA 3R1LA 4KJIA 2UUCF 3M6VA 4G3IA 2EKYA 1CPZA 1TVRB 3PRDA 2OP5A 1RI7A 3HDSA 2M7SA 4NLVA 4YR3A 4P7TA 1HNVB 1OO0B 3I5AA 1KRPA 1FRXA 1E6VB 1E6VA 3LGMA 3TVZA 4K4XA 4DUYF 1G2EA 1S1XA 2M9KA 2R7WA 3BO3A 1UEVA 2D7SA 4C3MA 4WFNQ 3TA0A 2HHXA 4LUBA 4ZPBA 2KXFA 5DO2A 3I0RA 3RAXA 4DL6A 1UJ5A 2ATLA 2XWXA 3AAWB 1XEZA 4I1TA 5FD1A 2GGPB 3RAMA 3HVWA 1P6TA 2LU2A 4OZJA 2M2BA 2V8GA 1EETA 1U6FA 3G8QA 3NWGA 1ROFA 1HQUA 3T5LA 4RU2A 2BM1A 3T6BA 5CYMA 1HI1A 2MQQA 1RP5A 1GX6A 1F5AA 4RW6B 1SJ4P 1GX5A 4DR6F 4CO4A 1FERA 3MD3A 1FJGF 3H5UA 4F3MA 2J0QD 4EBCA 2OPRB 4NPOA 2W4CA 2EK6A 2PI4A 1C2PA 1VQ8S 2XMTA 2M88A 3K5MA 1HWKA 4BC7A 1Q7YT 2HFNA 5J1PA 3K59A 4TN2A 2PA3A 3O6QA 3PEJA 2CJAA 2BVZA 1OQ6A 2F7VA 3JAMY 1R8HA 2XG8A 3IG1B 3BREA 4QQBA 1F5BA 4CT9A 3GV5B 3WC0A 5IS2A 1B0TA 2M8DB 5DDQC 1FDAA 1JLFB 1KQGB 1N48A 2V0NA 2XMVA 1MMLA 3GIIA 1RYSA 3U7JA 1JLAA 5C42A 4PQUB 2AU0A 4OI3A 1S1UA 4QIGA