1V3RA

Crystal structure of tt1020 from thermus thermophilus hb8
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
92
Chain Sequence
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
total genus 20
structure length 92
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1v3rA00
3AA9A 4CO5A 5D4LA 1Q1KA 1OSCA 2VD3A 2XULA 4OZNA 4CO4A 1O51A 2V5HG 3TA2A 4OZLA 1VHFA 4R25A 1HWUA 4RWWA 2GX8A 3TA0A 2O67A 5DRKA 4C3KA 2J9CA 1NZAA 1P1LA 4CO1A 4CO2A 4YB5A 2DCLA 4CNYA 4C3LA 3NCRA 2JJ4D 2NUUG 1V9OA 4CNZA 3TA1A 2PIIA 3GSDA 2ZOMA 1UL3A 3BZQA 3N5BA 4Y6IA 4USHA 2GNKA 3HLUA 4Y65A 4USJC 2CZ4A 1V3RA 3X3UA 3NCQA 4ZK7M 4NYPA 1UMJA 1PILA 1O5JA 4RWXA 4WK3A 3LF0A 3AHPA 4CO0A 5DS7A 4OZJA 4NYOA 3L7PA 4CO3A 3O5TB 4WK1A 3T9ZA 4AFFA 2EG1A 1UFLA 3AH6A 1XK8A 2RD5C 5D4NA 5L9NA 4YB6A 3O8WA 1H3DA 2XG8A 2J9DE 2O66A 5D4PA 2XZWA 1V6HA 1NH7A 4D3HA 1UKUA 4RLEA 2NUHA 5D4OA 1QY7A 4IYQA 3M05A 2NS1B 1VFJA 3CE8A 2XBPA 2Z0GA 2J9DA 4YB7A 1NAQA 4RX6A 4E98A 3AA8A 3DFEA 2E66A 1GNKA 1NH8A 2J9EA 4C3MA 3NCPA 4D3GA 2ZFHA 1KR4A 2GW8A 4USIA 3OPKA 2EG2A 3MHYA 1V3SA 1J2VA
chains in the Genus database with same CATH superfamily
2W4DA 2RU9A 4DX8H 1EZZB 4PG6A 2DIUA 1IBKF 2DKOB 4O0IA 1EQ0A 2NXJA 5KFXA 3SXLA 3K58A 3VGVA 4DV4J 4ECQA 5IT0A 1G1XA 5JXSA 1TK8A 1UFWA 4AL6A 2HMIA 4USJC 5KG5A 3QYYA 5E0OA 4ETZA 5DZ7A 5IV3A 3IP0A 2N4DA 1IR0A 3JB9k 2MQMA 4CH7A 1EIYB 3M2UA 2HSEB 1H2VZ 4PQUB 1FT8A 1FFGB 2E9TA 3PX0A 4B9SA 3P45B 4JI8F 2J6UA 1WF1A 4WXOA 4B3RF 4LMZA 1HPZA 4PYDA 1R27B 2ZM6F 2ZDPA 1DURA 1S6OA 4PXCA 1VQOS 2K8GA 2VG6A 2QV6A 4X65J 1D8ZA 1KR4A 1NBEB 5DG8A 3MM5B 4DCOB 4F36A 1FHTA 2VJUA 3NS5A 1VC5A 3IMQJ 1R8CA 3TA0A 5KT7A 1HKAA 4C8NA 3R7NB 3CCWA 4WIIA 3UDLA 3DHXA 1KOHA 4Y2KA 1VBYA 3M30A 1O8BA 4U96A 1FJGF 4JI1F 2DNZA 1N5YA 2C3MA 3N5BA 3FBEA 3TAPA 4NWBA 2VFTA 2UUCF 1KBRA 1Z2LA 4ILMA 5IT9Y 3NNCA 1Y5LB 2W1BA 1HNZJ 5DM6Q 3HHLA 4DQPA 1IN0A 1B7FA 2J76E 2NPFA 2FJBB 4JI6J 4WBFA 5D0RA 4UQTA 5FLXY 5IT4A 3DLEB 4OL8A 3EDQB 4QYZK 3UE2A 3GMGA 2HLTA 4ANEA 1B64A 1KQGB 4C3MA 4ZLNA 3MFHA 1S9GA 3P8BB 4WE1A 3ILLA 3JXOA 4ZCIA 2BJDA 3H42A 3MTKA 3ZZPA 1KVKA 1TKTA 3CDWA 2GAHC 3VV2B 2BKPA 3HFKA 2C3PA 3OW2R 1BXNA 1N52B 5CZXA 1JLAA 5F0WA 2YKQA 2UZAA 3R9LA 5D8HB 4F4YA 4P9SA 3BGFA 3R5GA 1YRUA 3LO3A 1YZ6A 4IFVB 2N7CA 1U45A 3ZFVA 2V8VA 4CDIA 4J9LA 2RSQA 3OT9A 1YJNS 2E1AA 2W2MP 1IKWA 3V6JA 1Q7YT 4H4OB 1UWBA 2KN4A 1S97A 3Q86A 3A12A 4UUXA 2AX0A 2HBRB 2CG8A 3CCTA 3KJVA 2XZTB 5SUHA 2E5JA 5A8RB 5D0HA 2KT2A 3GJRB 2BQUA 2CJKA 4DV7J 2B3TB 2J9EA 5A8WB 1S9EB 2YY3A 2UVWA 1BQMB 2YWEA 3D6TB 1V3SA 1MW7A 4DR6J 2LKZA 3EDRB 5KFTA 1VQLS 3CMQA 3MEEA 2IIHA 3LP0B 2Z57B 4C11A 1U24A 3CDUA 3CC7S 4KO0A 1FJCA 2IC3A 2V0NA 2V8PA 1F9HA 6AT1B 2L48A 4LBHA 4DV0J 2XWXA 2R7OA 4O0NA 3BZQA 2DEIA 3UW1A 1H0HB 2VJVA 3PX4A 4DR5J 4V19X 3CPWR 2F1FA 2AWZA 1GAOA 1DTTB 5HP1B 5DS7A 3MUVP 4P7VA 4CO3A 5KFDA 2VZ9A 1X9WA 4MYUA 1TL3B 3QATA 1H3DA 1VK8A 1IXKA 8ATCB 4B3TF 2IY5B 3I6PA 2O3DA 4IDKA 3CJKB 5I4MA 2V2ZA 2NS1B 3GJSB 4W90B 2GIQA 3QT7A 3Q0AA 4NLUA 1KKHA 2Y3YA 3BPSP 4HDHA 3NS7B 4DR7J 3CCJS 3UD3P 4KFBB 3RB0A 3QT6A 4F0HA 3SV4A 2ZE2A 1K9MT 3OTCA 2IMWP 3OFGA 3SFGA 1YZ7A 1Q7LB 3B6BA 5M2RA 1KVIA 1DQ9A 2VC1A 3HD1A 3BQ2A 3R1LA 2RAQA 3Q83A 2XGQA 5IOLA 2RQ4A 3BGUA 3NGTA 1M5KC 2FYXA 5K8NA 4NXNF 3BO3A 4USHA 1A7GE 3BH7B 3H2UB 3O2IA 3W5ZA 3VAFA 4AD6A 3DRSB 3C15A 4C8LA 1RTIA 4O4GB 4IFYB 3PYEA 4KTQA 1Q53A 3TI0A 2ERRA 2V63A 4HDGA 1CJTA 3HHLD 4DPYA 4UOFA 2B6AB 3GG1A 4EO6A 4MK7A 2ZH7A 4JI0J 1TAUA 3OSPA 3H98A 1VQYA 3N79A 3QGPA 1T9WA 1W2IA 2VQEF 3LP2B 1J5EJ 5IS2A 5HATA 2WOMA 3VGUA 2V2KA 5DG9A 3JQJA 2YTCA 4TKTA 1JNZB 3THVA 4O3PA 1TMJA 3BKTA 2XY6A 4F4AA 3PO5A 2GX8A 4L75A 3M2RB 3MAAA 2FJXA 2HQFA 1X31C 4AXJA 2AIRB 3EUNA 4LF6F 4AE5A 4ED8A 3HSZA 2XMKA 1TL4A 2Q43A 1IKYA 2KJVA 1B7YB 4PABA 1HI8A 1SQEA 4IRKA 4TY8A 4LT6A 2WBRA 2O5DA 2NZ4A 3OFHA 1TL7B 2VOOA 2HVEA 2ZHOA 4DS5A 3OLAA 1RWXB 4DX5A 1WC0A 3VALA 4R0JA 4WIQA 3DU6A 4B3OA 3V6DA 1HBNA 1NJYA 1RTJB 3QIDA 2A0FB 4OIXA 4LRAA 2NLWA 5E5NA 3T1YF 3UCUP 1BY9A 2GS8A 2P2CB 2CJQA 4WZQA 1HNXF 3IN5A 2OPQA 1H72C 3HVTB 4DCJB 3Q8VA 2I6WA 1ULRA 3QQCD 1MWQA 1FI4A 4NASA 3FCWA 2MYFA 3BO4A 3KTQA 3H2LA 1FTRA 3GV7B 5J2MB 4X66J 2FVQA 3G86A 1HBOA 2KG1A 2Y1RI 4H4KA 4M5JA 4I68A 2DCLA 3PFOA 4QU6A 2Z58B 3AJ2A 3GFHA 2BJ9A 5CYQA 2LXFA 1KTVA 1OMSA 5FD1A 4Q0BB 4AT1B 4IO9Q 2QLFB 1SJ4P 3OL9A 3LP1B 2UXDJ 4USMA 2VPWB 3L3CA 3IAM9 2HZAA 2DJWA 3FK4A 4MKVA 5KFMA 2CYYA 3UI3A 2RKIB 4P2FA 4RKUC 2H5JB 1Q79A 3FSXA 2ZJRQ 2V8GA 3DI6A 2A3JA 4P75A 5K9FA 2QO3A 5HVGA 1WNEA 1RAFB 2W8KA 2HK2A 3QZ7A 4YB1P 1YBUA 1D09B 3ZZ0A 3C66A 4DG1A 1MN7A 4QIFA 1VJWA 3ZTQA 3UNYA 4C4WA 4DMZA 4KGXB 4XO0A 3KHGA 4U7CA 5ETTA 4W98A 5AE3A 3OTBA 2YH1A 4BCAA 4DFMA 4M63A 4O23A 1N5TA 3MF5A 2OD6A 1XMQJ 2P9EA 3M6XA 1UL3A 1PC5A 3D3BJ 2XYHB 3PRDA 4OI1A 5JUMA 2ADBA 1MG7A 2DO0A 2Z2LA 5DQHA 3HJVA 3DRPB 1N8RT 4JI4F 4PZVA 4A47A 1R7IA 2FZGB 1CC7A 4X4SA 3FBCA 4PRFA 4IOCQ 1CG2A 4QWEA 4BC7A 4ZIVA 5KT5A 3AB4B 3N01A 4X4VA 3EVMA 2W9CB 1J5OA 1UEKA 2AZ1A 1HQUA 2ZH1A 5L8RC 2H5IB 4G1QA 3M4XA 4C97A 2F8EX 1NAQA 3HXMA 4DV4F 1TU0B 5CYMB 1D0EA 4Q44A 1HWLA 5HQLA 1KS2A 1WC6A 4ED0A 1J2VA 5J2PA 2DHSA 1VIXA 4LSNB 1M5PC 5J2QA 5KFIA 2DCUB 3Q23A 2CADA 2MTLA 3VQSA 1WEYA 1W7WA 4NCAA 2WONA 3PJ9A 1VS3A 5IM0B 1HHSA 2VDHA 2Y8YA 2W01A 5DDOC 4J5OA 3V2UC 3DRXA 3BQ0A 3MUMP 2CQ1A 4E8UA 3JTPA 2HQ3A 2V8HA 3CSKA 2IPOB 1QAXA 2E1RA 4EBCA 5KFPA 3IG1B 3E3XA 5A0YA 4UOCA 1RLDA 4X65F 4O44A 2CPYA 5GAHI 2V4JA 3AH6A 3KJNB 3CTRA 2Z2YB 1T7PA 1VJQA 2V9KA 3SDEA 1FFSB 4Q2LA 4ZPVR 1CULB 4YP3A 2CFXA 1KLMB 4B3SJ 2AYMA 3GILA 4F25A 2MKYA 2RF2A 2F40A 2XMJA 1OYEA 1TK5A 3KDNA 1X5SA 1Q82T 3D9BA 1CJUA 1VRQC 1HNZF 1NDCA 4JI5J 3HULA 2HHHF 4IR9A 4X4NA 3ILIA 5E33A 4DL0C 4M8LA 4EFAC 3OFFA 4KQZA 4M5LA 1EARA 3HVAA 4XAKA 1UVNA 5H9FJ 3KLFA 2JLFA 3NAIA 4RJVA 4ANDA 2FDNA 3W9HA 2UP1A 2OKQA 3MMCA 2PMZD 3M8QA 4L72B 1V5VA 2RUGA 3S1TA 2YX7A 2B9WA 3DRRA 3IRWP 4URSA 2YNHB 3W5YA 2E7VA 3G8TA 3QWPA 3TVZA 4Y2MA 5EN1A 2XCAA 3NL0A 2XY5A 5HVFA 3C16B 2JVRA 2B9XA 2MB0B 2CDQA 2VKRA 5J1NA 4M1KA 4UY8T 3ZTPA 4DI6A 2CRLA 4URQU 4I64A 3UDEA 3M2VB 2OPRA 3O44A 1HBUB 2B7CB 3DCAA 3SI8A 1GMWD 3J81U 2DNYA 1AT1B 3A8JA 2EXUA 2M0GB 1PJ7A 1SC6A 2VDIA 4RBUA 1VRTA 5DG7A 1WI8A 2VFSA 5KFJA 2FY1A 2HHVA 2VHGA 4DSIA 4AL5A 4DV7F 1ZTTA 5DETA 2KFNA 3P4UB 4WFYA 1VQSA 2HW3A 5F41A 3IWLA 4DR6F 1N33J 4N56A 4YDDB 3IR5B 4ECXA 1LWXA 2DGWA 2F4FA 2FLPA 2G0IA 2WVBA 4USKA 4ZJQA 2IHR1 3MPVA 3RU0A 4QIEA 5H9EK 2LQ9A 3OHAA 5EX3A 5E2QA 4CCHA 3F0NA 1NMEB 5G4DA 1VQKS 2KYZA 3KUGA 3TQEA 2MQPA 4DV0F 2N82B 4LF1A 2CQ3A 4M5IA 4DR5F 3ZZZA 4YOEA 5LJ3Y 4ECRA 2MKHA 2DH7A 5KAKA 3CJQA 2I0XA 3G4SS 2UUBF 2EC0A 1FD2A 1Q86T 4F26A 2MKJA 2POKA 2HYIB 2EFQA 1NK0A 3MGJA 2B5JA 4FKYA 1DBDA 3UN2A 4C7QA 4DWIA 3CCLS 3RR7A 4U9RA 1CJKA 3EVWA 4FXVA 4HKQA 3HHKA 1T9UA 2G4BA 3M32B 3JS9A 1U2FA 4NCGB 2OEMA 2VPXB 2EG1A 2VB6A 2C2ZB 3NWGA 4DR7F 2HHQA 2CWXA 1YIJS 1HYSA 1FJ7A 4NE9C 1WSVA 2X1GA 5D4PA 4NI2B 3T5JA 3M8RA 3C19A 4OYIA 3H2VE 3KOAA 1S59A 2PE8A 2NYHA 3KLHA 3DGVA 1HD1A 2CNLB 4LF7J 4DPXA 2N3OA 2BANB 4C8KA 2XLJA 2Z30B 3CB4A 3DM2B 3AA9A 1CQNA 3WBZA 2XULA 3CJSA 3HHLC 5B0AA 4ZVTB 2LECA 3NOCA 3SEOA 3MECB 2QYCA 1BQNB 5FLXU 1WORA 3SSSA 5KFGA 1NK9A 2RHSB 5KFQA 4BWMA 1RYSA 3FCVA 5GAEU 6FD1A 3DNCA 4EWTA 3M8ZA 2MSTA 4J9RA 5IFMA 3GP9A 2JC0A 3AOCA 2V34A 1AB8A 4ICLA 1RKIA 1SUQB 4BDPA 1EHWA 2C1EB 1VI7A 3FMWA 3CCRS 1RU1A 1XIQA 1J5EF 2OPSB 3AQPA 4K4ZA 1FF2A 3POTA 4DPOA 2ZH2A 1GTHA 1JJCB 4A8FA 1TL1B 3MM7A 2F63A 2A10A 4DBQA 4EO8A 1PKUA 5AXKA 4C0OC 1XERA 4ZPCA 1O0PA 1PO6A 3UVJA 1UA1A 1JLBB 2ZFHA 3BGRA 1PBUA 1RT3B 3GR1A 1S1XB 5K14B 3NMRA 5C24B 4YMEA 1REVA 2CPJA 1ELOA 4ZVQB 1OWXA 4KV8B 4NLPA 2HAFA 5HROA 2DT9A 2BV3A 4KIAA 4CNYA 2EW9A 1Y3JA 2IYIA 1RTZA 5F8IA 1V9OA 1URRA 2M7SA 3MEDB 5EWFA 1WJ9A 1U0HB 3G6XA 2VG5B 4FS2A 1WKJA 2FLLA 2PFFB 2ASJA 3D4JA 3HMJG 1MWYA 1WC1A 2EWHA 2ZEJA 1X8DA 4E2FB 2KO1A 2VOPA 2XSJA 1TV6A 5EWGA 2B43A 3J7AN 3J7A1 3L7PA 2BM1A 3OR1A 1C1BA 1CS4B 3GR0A 3RBZA 1NJIT 3FSIA 1FO1A 2J7UA 1ZAVA 1NJWA 3QT5A 3KMSA 5GVQA 3HHNB 3CCMS 1JWWA 3BF4A 4ZCLA 3SQGA 4B9TA 1U1LA 1LWEB 3H25A 1XR5A 4LREA 2MJNA 1QE1B 1FRMA 5T14A 4C8YA 3ENWA 5J1EB 1IBCB 2P5VA 3PW2A 1SXLA 2Q3PA 1AFIA 2ZITA 5B08A 1KQSR 1K73T 4Y2AA 2UXDF 2G1HA 5B7WA 5F9LA 2DNPA 2Y0BB 3LANA 2AEJA 2UV8G 3PACA 4FF4A 1RCOB 4OFZA 4OZ5A 4JP8A 1RAJA 3ZTOA 2XWYA 1SCJB 4C2MA 4DPTA 3VQTA 3T3FA 2KHCA 1ZAWA 1S12A 1JXVA 1AUDA 2YQ1A 2LMIA 2ADCA 2WVDA 2XCPA 1VK3A 3Q8PB 1C0UB 1P1TA 2IA0A 1NRKA 4DSEA 1JJ2R 2DY1A 3RJMB 5H9FK 2R3VA 3KK1B 2FJAB 2NREA 4LVOP 3GWCA 2KZMA 3BKUA 4JBCA 1NH8A 1S77D 1Y5NB 3IR7B 2HGNA 4EEYA 1XMQF 1LNQA 1KNZA 4W92B 4CLUA 1MMDA 2XTJP 1GT8A 3OXFA 4DF4A 3PTWA 1U1NA 4NA2A 3T5LA 2CJAA 4OHVA 2HHXA 1FKAF 2JX2A 2PA3A 2YKPA 4K2XA 2J5AA 2CPHA 5B0GA 4GMKA 2GO8A 5F8JA 4G3IA 3BBCA 1TQLA 1U1MA 2KDOA 4ES2A 1RWKB 3K17A 3LF0A 5HN0A 3MM6B 5HI7A 3RB4A 2MLZA 2XM3A 2A18A 3QRQA 4PWDB 2R7XA 5L9NA 2V2QA 4KR0B 4NZ6A 5I3UA 4YY3J 2MZJA 2FHJA 2FHMA 3D1OA 2UV8A 1JB0C 2YQ0A 4Z2XA 3K5LA 3C2PA 1PYTA 5MAOA 1FXDA 4WU2A 4OZ1A 3EXYA 1FRJA 2XO7A 1HLWA 3I5CA 3W60A 4FF2A 3N4WA 2YNFA 3EX7B 1KHWA 3BR9A 4NA3A 5DZ6A 2F8MA 2D3UA 4KC5A 2RRBA 4B02A 2J9CA 3IS9B 3A1YG 2IVFB 5EGYA 1RBAA 2Z4PA 3E51A 2EFPA 2IJRA 4H4MB 1P9YA 4M5HA 1KC8T 4F04B 2QLJB 2VC0A 1VQ4S 4XDCA 4CZCA 2J0WA 3IGNA 1YJUA 1BWVA 2W2QP 4LRCA 2BOPA 4P2SA 4M5GA 4K4UA 5D3GB 3M8SA 3MMBB 4DV2J 1B99A 4DFJA 1R8PA 3GG0A 3LUYA 4PQAA 2F4VJ 3C46A 1SIZA 3MZIA 4B3SF 3C6TA 4OZJA 1MN9A 1S1VA 3IXQA 1RADB 4FYYB 2DGUA 2AX1A 4A4JA 1JLCA 2NYIA 1V6HA 2RJZA 5E7OB 1LW0B 7FDRA 1G6BA 3W2VA 4JI5F 4OI0A 4UOHA 3OQ2A 3ENVA 1Q1KA 2ROEA 3TX8A 3MAQA 2DHHA 3KWMA 4F4ZA 4LR7A 2CQHA 3DOLB 2V8DA 2F5GA 3K5MA 1VC0A 2JOQA 1LWCB 2VONA 4KB7A 4NXMJ 5KFFA 3HSGA 3H4DA 4ZMMA 3IR6B 4DFPA 1APSA 3OUYA 4ZVEA 3GONA 1U47A 5K5MA 3JSMB 2MQNA 4QBUA 5F8MA 5FIIA 1N4LA 4N8OA 1RTDB 1SH3A 2YWKA 4MIBA 4J9OA 1VBZA 4YR2A 2K7JA 2R7QA 3NP5A 3BDEA 4RNNA 1HIYA 1XMOJ 4CQ1A 4C8ZA 3LWMA 1KONA 1Y10A 1NH7A 4X2BA 2NUHA 1HQ2A 3FZBA 4F4XA 2E44A 4JI3J 3PRBA 2FJVA 1KWMA 5IWAJ 1HFEL 2AJ2A 1VQ6S 1U48A 5T41A 4M95A 4C48A 4KY3A 5HBMA 2AYGA 3TP2A 4CO5A 2V6AA 4PG7A 5BYSA 1QTNB 1OSCA 3CULA 1ZM4A 4TN2A 4QCLA 2Z2ZA 1FWLA 4CO1A 2X3DA 3KLIB 3ZNJ1 3D7SB 2GGPB 2BMBA 4NLWA 3A4TA 4JI7J 3VVUA 3NCRA 3OL8A 2E5LJ 1QLNA 1MNEA 2MGZA 3GFXA 1N33F 3T6BA 2QLBB 3BSAA 4DR4J 3EJMA 2ZBIA 1HWJA 2VUGA 3FVYA 4ZOSA 2YPZA 2HHTA 1RT5A 5F8HA 3QGGA 2G0CA 1SV5B 4A8KA 3M9NB 4F4WA 1BGXT 2KFZA 2Q6BA 2W9BB 1ZZFA 2XG8A 3CMES 4I69A 2E7XA 4U7UK 2OLWA 2FHJD 4GKJJ 2FC8A 4J9QA 3SFUA 2LXIA 3AXKA 1TUGB 3P6YC 1N6QA 4A8SA 1FK9A 3ONQA 2R8HA 3BM7A 3LPYA 2GCFA 3M7VA 2XQCA 5J2NA 4NEZA 3NLCA 3FJ2A 3TYTA 4KKOA 2FJDB 3ET6A 5CQGA 4K8RA 2K3IA 4TQSA 1XJWB 1QSLA 3CC2S 1RHMB 4LVNP 2QTWA 2RB7A 3HSDA 1QJHA 3FUYA 2GAGC 1TAQA 2ROPA 4GO5X 1JXEA 3BKFA 1R6VA 5ETMA 2HHSA 2VH7A 3BS9A 2QMXA 2HMIB 1ZM9A 2YNIA 3JAMY 5F3TA 4NLYA 1NK4A 5KFVA 5KG7A 3MR5A 2VBYA 4QIWD 4LF7F 3W8PA 1UPPA 1ZYQA 2HFZA 3PG9A 1JQGA 3FSYA 3M2UB 1JJHA 2M9KA 5M2PA 2JFDA 2QN6B 3H20A 3R97A 3KG1A 1UAWA 2X3GA 3CUNA 2DNMA 2DR7A 4WP3A 3MXHP 1HPZB 1HWKA 3AJ1A 2KXFA 2JZ5A 2XHCA 3P96A 2VG6B 3AB2B 4OHWA 3M9MB 2ATCB 2CUYA 1O51A 2D9PA 3I87A 3W1YC 2BE7D 3CJ2A 2E7WA 1U1RA 4ZVGA 4XPCA 1P1LA 1X4GA 1PAUB 3VHQA 5L38A 1NLKL 5GAEI 2N3LA 3W62A 1FRXA 4NZ7A 5A8KA 3K2YA 3M30B 1MMNA 4ELTA 1N5YB 3TUPA 3SZ2A 3VAMA 1V5IB 2DD8S 3ICLA 3UDCA 3MCNA 3L4BC 4F0KA 3MCOA 4L3KA 4OX8A 4F3MA 2ZH8A 3HHLB 1S4FA 1LKZA 4AXIA 3ETMA 4ZVHA 3HD2A 4RW4A 1E6VA 4IG3A 1KDNA 1CLFA 1JNRB 2ZH9A 1MU2A 1RCXB 5KG0A 4J9VA 3NEKA 2D1CA 3AODA 4DU8A 4X62J 2IA6A 1WOOA 4FP9A 1S9GB 2ZBQA 4HI2A 2ZH4A 4FDFA 4WE1B 3RB6A 5BYQA 1W2BR 1OSDA 1TK0A 3J7ZT 1WOSA 1TKTB 1I6JA 2W7PA 1K1QA 4DX7A 2HKEA 2ZWPA 4EBDA 4QZVB 3FGVA 1JLAB 1R6YA 1WDTA 2K06A 3H4BA 3SBMA 3IM8A 1WC4A 2VASA 4JV5F 4ZVSB 4QPXA 3MPYA 2QSWA 1PYSB 2W2OP 1HR0J 1GMVA 1IKWB 2CZ9A 2UUTA 1UWBB 1GMUA 1B0TA 4RLEA 1S0NA 3KJVB 1NSPA 4DL7A 1SL1A 2BA9A 5F0UA 3V81A 4PG5A 1VQ8S 3FQLA 1T0TV 4DQSA 3TJ8A 4FPRA 3TR5A 1WEZA 2GO9A 2QE5A 2BOAA 2P6TA 1BWEA 3D0IE 4EBEA 2UVVA 3CD0A 1NZAA 3MEEB 2RDJA 3UWTA 4F4KA 3OTDA 4C11B 3TJAA 4KO0B 2IC3B 5DLGA 3H5UA 5KFYA 3AD7C 1FWKA 1Y00A 5CD4H 1XR6A 2Y1LB 2HHWA 2QT7A 3HDSA 3MOZA 2HEKA 4DL4A 5C7PA 4DL2A 1WELA 2OPPA 4B9VA 3A8EA 3HHDA 1N48A 5JVHQ 1RWMB 4LSZB 2YWGA 5ETRA 4MIWA 2DY9A 2PMWA 4OJ1A 1BMQB 2ZBCA 4O4GA 4IFYA 3CCSS 1SC4B 1LV5A 5D0GA 1B4SA 2YKOA 2XNQA 1S9FA 4WFXA 3QNWB 4Z7YA 3CD5A 2BRKA 4D3HA 1UKUA 2R8JA 5E3PA 4CLFA 2DGQA 4E98A 1IVZA 4IDKB 1HNIA 2CPIA 2EBEA 3KUHA 2PMHA 3DLLQ 4ZP9A 3QMQA 5HMWA 2Y1JA 3DLKA 4QYZJ 3SCJE 2JHEA 4Z7CA 3PDNA 1M90T 1VDHA 2IBOA 3E01A 2ZE2B 1YJ9S 1Q0NA 3W65A 3HO1A 2BE9B 2R7WA 4ATNA 1RABB 1UJ6A 1GK8A 5HLFA 3W63A 1N54B 4YY3F 3KHLA 4USWA 3UPFA 2APOA 1BQXA 3C15B 1AW0A 1RTIB 2MKIA 2AYBA 4CP5A 1XQIA 3OL6A 4G1IA 1CJTB 2G13A 3T1AA 3CDEA 2J7KA 2P6SA 3L7UA 2RHQB 5GAGU 3VZIA 2YWHA 9ATCB 2H48B 3O6QA 1RBLA 1C2PA 3Q89A 1RHKB 1U1OA 2WOMB 5EDWA 3ITHA 2Q66A 2BYCA 1GXLA 5D4LA 3W3SA 1R8BA 3EPGA 1JKHA 4DV2F 4HEA9 2IJNA 4CM2A 2F4VF 1OJ4A 3MAAB 3OJUA 4CLLA 5HJYA 2OMOA 3PW0A 1RT2A 4ELUA 3GQCA 1IKYB 1Q8BA 2VG7A 1SL0A 1RHQB 4Y0FA 2EKNA 4TY8B 5JVGQ 1U1PA 3IGVA 2KI2A 1VHIA 2FPHX 3UN5A 1WHVA 2M5YA 3J7YU 3QRRA 4WK1A 1Q8LA 3RTVA 4NLRA 4B3OB 3V6DB 1NPRA 1HBNB 5K8PA 4CLTA 1VISA 2IMOA 4HH0A 4K2JA 5DGBA 5A76A 1WG5A 3I5AA 5F8GA 1WKKA 2VPZB 1FE0A 2BKOA 4NXMF 5HMYA 3DFEA 1IUJA 2OH2A 4BBYA 4R8UB 2G1DA 2OPQB 1KQFB 1WACA 1QDUB 2B7BB 2C2KB 3FEYB 2SXLA 3G96A 4OYXA 2YBVA 3N6MA 5MLCV 3NMAA 3TZZA 4TY9A 3G82A 1HBOB 4NOHA 4URGA 1YQHA 3TA1A 1X60A 3H59A 3FRZA 1XMOF 1VLYA 5CYQB 3B4DA 3HX9A 4UZCA 3ZZTA 3GYNA 2WK4A 4CYUA 4JI3F 4WK3A 4ELVA 2QL5B 4NLOA 1XEZA 5IWAF 2L41A 4LF8J 3IRXA 3OBIA 2HK3A 2AQ4A 2XC9A 2WTFA 2DEJA 2HG4A 1I5OB 2R7RA 4ZIWA 2JEIA 2BX6A 1HBMA 3R5BA 3DI6B 3Q2TC 4F02A 1Y0HA 2HZVA 1RAEB 1SQGA 3W61A 1U26A 4JI7F 4PYAA 4P6QA 4DG1B 2J0SD 2E5LF 3QIPA 4IRCA 1Y11A 3GIJA 1WG4A 2H51B 3Q22A 2OGUA 1YHQS 3MD3A 4DR4F 2DXEA 1X4AA 3FEZA 1QSSA 2W4PA 3KJFB 3R1HA 1BE4A 2GC8A 3AXMA 1FD8A 2Z8QA 2Y0SD 3NGKA 4OYOA 4C3LA 1RAIB 1YGYA 5DQIA 4U8YA 1CVJA 1RTHA 4ZP8A 1AUSL 4WF9Q 1IM6A 1NK5A 3DOKA 2OFHX 5C25A 1X4EA 4R0EA 2DBBA 3NXZA 1S72S 3AY0A 1RACB 3VGSA 2VFRA 2JSXA 4WFBQ 2YKMA 4GKJF 2XMVA 3KJQB 2BE2A 2CPZA 2HPUA 1WF2A 4AQYJ 1R0BG 5KFZA 1GQEA 2R7UA 2HVHA 2ZUAA 1LEOA 2J9DE 4HHJA 5AE2A 2AJ0A 1S1UA 2W8LA 2XBPA 1J5OB 1HQUB 1YTYA 1RWOB 4G1QB 4V1Ak 1S1TA 4NL5A 3LTOA 3ZTSA 1N34J 1DRZA 3K5NA 2DISA 2N4CA 1UW4A 3LA0A 5J2PB 1WF0A 1YK9A 2E5GA 2OUGA 2I5JB 1H7WA 5J2QB 4K0KJ 1S99A 1ZAXA 2MZRA 3U7JA 1EX8A 5KOXA 2UVUA 1Y7PA 2WONB 5BXIA 2DR6A 5GAHU 3CT9A 5ADZA 2HWHA 5C42A 3RB3A 5KFKA 4HVZA 4J90A 4RWXA 1T05A 2VU5A 3S6EA 3QGIA 3AAWB 4WXWA 2DGOA 5G0RA 1Y3KA 4MT1A 4OX6A 5A0YB 1IKXA 1D9AA 1NHKL 4WKRA 4O44B 3BR8A 4PPDA 2V4JB 1JLFA 4HH1A 4Q43A 4UZBA 4IYQA 2FVRA 3VCDA 3H0PA 3SDEB 4USUA 2DRDA 1BHNA 3RW6A 3NCPA 1YJRA 1CQMA 1GH8A 2I9SA 2ZC4A 2X51A 2V4QA 2AHOB 2VFVA 2RF2B 1IQTA 1F0XA 2BQRA 3N6LA 3OTOF 1RHRB 3PO4A 2GFFA 1YRTA 2GJ2A 2QC3A 1CJUB 1U8WA 2JL9A 4QJVA 1NB7A 1FEHA 2PIIA 2HFUA 2HHHJ 3PFEA 1UVMA 3D0GE 1ZS6A 2NZCA 3OVBA 4Y3CA 4ZPAA 2W2PP 4DJBA 1Q95G 3KLFB 2A6MA 2KVQE 5IZHA 3EGZA 2OSQA 3DDNA 2FHOB 4Y2IA 3UO0A 2JEFA 3JTNA 4FYWB 3MMCB 1WSRA 4X62F 2OJ3A 4EU0A 3M8QB 2MKSA 3VVTA 2VIHA 1RWPB 3US5A 1RT7A 4CH0S 2D69A 3DRRB 4C9DA 1B0PA 1CEZA 1FERA 1UJ4A 2JNJA 2PFDA 1NDPA 1ROFA 4KT0C 4WKYA 4HYKA 2G9OA 2ZBRA 3MEKA 4CT8A 5KG1A 3DDKA 2YKAA 3NGDA 1TKZA 1ZPVA 2F9DA 3M8YA 1S0VA 3PX6A 3JTOA 1CC8A 2UVRA 3MWBA 3LAKA 2OPRB 1FVQA 1HR0F 2JWNA 4PAAA 3H40A 2D7SA 1XTZA 1T03A 4QWBA 2H1YA 4I2QB 1JLQA 4ZK7M 1FKOA 1ZOTA 3FKBA 4PXBA 3D1HA 3R5AA 3DLJA 2RQMA 3VTIA 1VRTB 2AJ1A 3CCVS 4K7QA 4OZ0A 2AEFA 2BJ8A 4B9MA 5T7LA 3G8SA 1UFLA 4USVA 4YHHJ 1S76D 3M32A 2LEPA 2YVSA 5L46A 3K7RA 4IQMA 1RWVB 3TVKA 4OJGA 2AV5A 3MCMA 4F8RA 1AYEA 1WTFA 4UTGA 4FXWA 2BJ3A 1DQAA 3LALA 2WSFC 4CRJA 3K59A 3JAMU 1F1BB 5CCLA 2HQGA 4WCEQ 1JLGA 4X4QA 2HQIA 3CIZA 5DJBA 3P5BP 1UW9A 2UUBJ 4ECSA 4HACA 1NKCA 3BQ1A 1M5SA 1UVIA 1MSWD 5KG6A 1GXTA 4CTAA 2VFUA 3HP6A 2B5JB 2E9RX 4CIOA 3GFYA 5DM7Q 1NXIA 1CJKB 2XMWA 4K59A 2FJWA 2KYXA 4P52A 4ZDNA 3MCSA 4U95A 5B0BA 2FTRA 1FXRA 2HFVA 3IC1A 3B82A 3I31A 1UVKA 1Q5YA 3DMJA 1S5ZA 5EUHA 2OTLS 5I3QA 1HYSB 5L1LA 1K44A 4Q7AA 2OELA 3AA8A 1UJ5A 1FRLA 3MR2A 2DR8A 5BR8J 4XK8C 3KLHB 2LVWA 1PAEX 4I7FA 1N0VC 1R0AA 3W8GA 2DHGA 2P8IA 1FNXH 3UR0A 4NRUA 5KT3A 1UTAA 4K50A 1WKLA 3RAQA 3EVOA 3LOUA 4E0DA 2F3JA 4CLWA 1JLEA 2AW0A 2O1PA 3GIKA 1X4FA 1N5QA 3HF5A 1KRPA 2HVDA 3PYDA 4WWSA 3B4MA 1L3SA 3TAQA 3M6WA 2CNNB 1NPKA 4G65A 1UMJA 1O5JA 4ICLB 5KT6A 3LH2S 1F6TA 5CABA 4V19J 2BW7A 2UXBJ 2LU2A 3POTB 5CH7B 2DVIA 1SH2A 2HNYB 4NCBA 4AL7A 3EMTA 4WFZA 5GAGI 3MM7B 2GV1A 2BUNA 2D41A 3HVRA 1RLCL 1VRUA 4RPFA 1QM9A 3HZGA 2PI4A 4LBPA 1VOMA 4NEYA 2C2RA 1HA1A 3PIOQ 2VICA 1RT1A 3BGRB 4DPUA 1PYOB 3TRGA 1QE1A 1REVB 2PI5A 5H9EJ 2MY7A 3CO9A 1EETA 4EZ9A 5HROB 2M52A 1S6QA 2MQLA 4ZVFA 3P3DA 4I0WA 3DHWC 3NRBA 5HQMA 3EPIA 2C3OA 1IBMJ 4IOAQ 3D68A 4FF1A 4ED2A 4DSLA 1KQKA 1IKVA 2QRRA 3J7YI 2XEXA 2HS4A 5K20B 2IAJA 2XSJB 3W2WA 1TV6B 2QA4S 5HSPA 1WHYA 3OR1B 2XLKA 1C1BB 2JEGA 1VGYA 3L95X 2YNGA 1JX4A 3R5CA 3OHBA 4DX6A 4F7VA 2KKHA 3CE8A 2H4YB 3MPDA 1C1CA 4PKDB 2V94A 3OJSA 2LCWA 1HMVA 4DR3F 3AD8C 3KLGA 4JV1A 3UQSA 1WC5A 4KGVB 4OQJA 5HQ8A 7FD1A 1JK9B 1MMLA 4TYBA 5L1JA 3WQPA 1PGZA 2WAQD 5DDPC 1TFYA 2QL9B 3I5BA 4AYBD 2DIVA 2RNEA 4PXEA 4A8MP 2YWWA 1OY9A 3BSOA 4LF8F 2QFJA 3AQOA 3EYZA 2L3MA 3FC9A 1SC1B 1FKPA 3T6JA 4GVBA 1X9MA 4ECYA 2X7IA 3UNGC 3FBFA 2BRLA 1BD6A 3WHIA 4ZLJA 2DHXA 3EZUA 4M5DA 4LJMA 1U02A 1ZA1B 3MEGA 3RZAA 4MFBA 1NJZA 5LSOA 3FBBA 3BBFA 3DRYA 3KK3A 1X4HA 1RA7A 3TAMA 2D3O1 1RDRA 4LR9A 1WC3A 1OO0B 5L9XA 2E5IA 1K1SA 5AJ3J 3M05A 2CQDA 2Z0GA 2GHWA 2LYVA 2OIHA 2XMAA 1S48A 2COLA 1GMWA 3NS6A 2HZCA 1XBWA 1HHTP 3CNQP 1HWUA 1T94A 4FYVB 1RU2A 4G1PA 4ZCKA 2J6SA 4A8OA 4PEOA 2M4MA 1U4BA 1A9NB 2WZ1A 5AXNA 2IM2A 4AQYF 3IS9A 2ZJQQ 2IVYA 2DK2A 4YFUA 2GMLA 5HMZA 4IG0A 1S6PA 2OTJS 2CJ9A 5THWA 2G2ZA 4I6AA 2DGVA 5ETOA 3BGOP 1PSDA 2X1AA 4CO0A 1N88A 2J7WA 3DN9A 5C2GA 4FBTA 3N0VA 2B4OA 4YQWA 2EK6A 4J37A 1XR7A 4I1TA 2AJQA 4B08A 1H6KX 1N34F 3VZHA 3K5OA 2DNNA 1GXUA 1DFDA 4F3OA 2DPIA 5I3UB 5CXTA 3EE3A 4K0KF 4RUBA 2YX1A 3TNVA 4CLZA 3MI7X 2FLNA 5B0DA 1WD6A 2IJFA 2GW8A 2MZQA 3MURP 3LGHA 3P49B 1LW0A 2LEAA 4QU7A 3MTJA 2XI2A 3N9UC 1NDKA 3CW2C 2YNFB 1G4CA 1TVRA 3E2EA 3MOJB 2B4VA 2KL8A 4I2PA 5AT1B 4L3NA 5CAAA 2JJ4D 2NUUG 2W2NP 4I56A 4LFBJ 2ZD1A 2RILA 2WB1D 4P71A 1YSJA 3HPOA 3K5PA 1RQ0A 5SZTA 2DNKA 4JYAJ 4DUTA 1XWLA 2I8EA 3GSIA 3CD6S 2ZHBA 2PN6A 5A6WA 4NYOA 1RE1B 4ZP6A 4K4XA 3DYAA 4ZITA 1SL2A 3C6TB 4X4OA 3EXCX 1S1VB 3KHRA 4DUYJ 1H7XA 4OLOA 4FNIA 3R6LB 3OV7A 1RWNB 1JLCB 1RXOB 3FNNA 2FVSA 3PEJA 3PYGA 1RWWB 3CJ0A 3VAJA 3W2VB 4OI3A 3R5DA 1B3TA 3U1MA 4L74A 3I9V9 1SKUB 1QVFR 1CJVA 1LXJA 1TR0A 5B09A 2FGCA 1U6BA 4K5RA 4LF5J 4ED1A 1SH0A 2IDLA 3S8SA 3MR6A 3X3UA 2QLXA 4QWDA 3OUYB 2LQBA 3MMAA 3AHPA 5C5JA 5ETNA 4L6V3 1Y5IB 1EKSA 4ZPTR 4W4MA 4YB6A 4YR3A 2BXJA 5FDLA 1NSKL 3M8WA 2EEYA 5HANA 3EZ5A 1SV5A 2VA3A 5KT4A 4EI2A 3J81j 5D4OA 3CCQS 1N56A 3DOMA 3F73A 4KH1B 4F50A 3V4IA 2DNRA 4HI1A 2M8HA 5LMUF 2RQKA 4ANCA 3OD2A 3MM9A 1OS5A 1RAOA 5HBMB 1TKDA 1XNRJ 1ACMB 1WHXA 4Q8FA 3PEHA 1NJXA 3J81Y 4B9UA 2C2NA 1RWUA 4ZKAA 5KFUA 1QD1A 4EMDA 4A8YA 4IO1A 2CAJA 3QSYB 4X4TA 1R0CB 4Q45A 4YHHF 3UDVA 2H9ZA 4LFCJ 1TKXA 3PRVA 2WVFA 2MGZB 2ROGA 4DLEA 3ZZRA 4PWWA 2V69A 1LW2A 5I42A 4DS4A 4JUZA 2PO4A 3CJRA 5ETKA 1NUEA 4OYWA 2MKKA 2C42A 1R8AA 1RT5B 4Y00A 1WOPA 2B4PA 1KSPA 4EGLA 4L76A 3BPDA 3HFZB 2X1BA 1GX5A 4NLGA 5CCMA 4F67A 1X7VA 1AROP 1L3KA 3R2DJ 4YB7A 3TVYA 1FVSA 1Q8IA 3M8PA 4B3MF 2B9EA 4QQBA 5ETPA 2V50A 3BREA 2IYGA 4R5PB 4OLPA 4O3QA 1N6QB 2MZSA 3HHEA 1FK9B 1UZDA 1SJQA 3NWRA 4NYZA 2HWTA 3WIVA 2XZDB 1RAGB 3S01A 3R5JB 4ED6A 5J2NB 2G2YA 2K1RA 3D6HB 4KKOB 3ET6B 4RU9A 1YJVA 3D28A 2CQ0A 5DDQC 4OV6A 2EFGA 2EFVA 1Z1ZA 2KH9A 2HFSA 3D5MA 2JLEA 5GADI 4QR2A 1KD1T 4HTIA 4ENOA 4TQRA 1DHMA 3WC2A 1PILA 2CKWA 4DL3A 4FKXA 2CPFA 4N5SA 2YNIB 3LGMA 4KSEB 1SVDA 1MROA 5BR8F 4PUOA 4A48A 3O5TB 3BH6B 1HNWJ 4NLTA 3C14A 5IT9U 2BR0A 1M1KT 4C98A 5CA5A 2KHDA 3D66A 2XYPB 3SMZA 1QY7A 3FFIA 4FS1A 4ECTA 4J9PA 1H2UX 1F3FA 2HNDA 3ZXWA 3D54A 2CDRB 3SSRA 1PC4A 3QPIA 2CVIA 3FMBA 4NZ0A 3OPKA 2FIUA 4F3QA 2EG2A 3MHYA 3DXBA 1A0OB 1X5OA 2FD2A 3T9NA 3BJYA 4DQQA 3NY0A 1VMBA 2EBGA 3K89A 5KG3A 5DO2A 5ETQA 5M2UA 3D6MB 4C3KA 2MPUA 1Q5VA 5H1SV 1RZMA 4DDFA 4DV1J 3GTYX 4OHXA 4IQXA 3VAHA 1S4EA 3MM8A 2UXBF 2HRUA 1U0SA 1Q16B 3K8VA 1NNDA 4DSJA 1U2CA 1UFKA 5A8KB 3NG8A 2KRBA 3BYPA 2QMUB 2ZKTA 2HVZA 3I0SA 2LU1A 2BJ1A 1Z4UA 2R2RA 3P5TL 4WFAQ 4RW7A 3D2WA 3FRYA 3WDOA 2ZZNA 2NQPA 2B0GA 3PCOB 2YX4A 1WG1A 2YPYA 5LL6d 1KFSA 3SIPB 3QJJA 4ZPDA 5B0FA 3PXGa 2CPDA 3THTA 2V9WA 3NNHA 4N47A 4OYBA 2IDEA 2ABYA 5HO4A 4RW4B 3OR2A 1E6VB 4IG3B 1EQMA 3GU0A 1AZSA 4OHZA 2VQFJ 1E6YA 2AGQA 3DC2A 4ECZA 1H2TZ 1MU2B 2UXCJ 3ADAC 2AF6A 4OX9J 1PG5B 1IBMF 3JYTA 3AD9C 3M1VA 4TYAA 3PZPA 4TU8A 2PSZA 4RBVA 1FDAA 3AOAA 2M88A 2C2DA 5LM7E 4PCQA 1KN6A 2B8PA 2GHPA 2HQDA 2OEJA 1N0UA 3LPEA 3HZEA 2J0QD 4K4YA 2AJFE 2Y8WA 2DNGA 1U8SA 4I6WA 5EWEA 1X4DA 1RK8A 3KK2A 2IBKA 3BSCA 1P6TA 2DGTA 4JV5J 4DR1J 1VQPS 4PG4A 3B78A 2KZZA 2RD5C 2J8AA 1F9FA 1RYRA 1H73A 1F60B 4KBIA 2OHDA 2HURA 4ZHRA 4DL5A 2DGXA 1R89A 1IWGA 5F8NA 3V81B 4WYLA 3OTEA 2E29A 3SV3A 3BV8A 2GVZA 4CO4A 2RMLA 2ILYA 3WX4A 3KLEA 3DDIA 3H90A 3LQVA 1M5HA 4CO2A 2LQJA 1TP7A 1SKWA 1RI7A 2VV5A 4MTPA 1RISA 1RHJB 4BHQA 2ZDOA 4IH5A 3NKYA 3GSDA 2O01C 1SC3B 1Q4RA 4LIRA 4LF2A 4FVCA 3PJWA 2HNZA 3TWZA 2HBYB 1IBLJ 4P74A 1K47A 5AJ3F 1ZM3A 2OPPB 1UPMB 3QAUA 3G6ES 4ID5A 4N41A 1CPZA 1REGX 3VAGA 5D0EA 5KT2A 5BJRA 1OYDA 1KTQA 2W9AA 1LFWA 4TU9A 4BS2A 3DGPA 2MMYA 1SPBP 1EAYC 2ZH5A 2XS7A 1YBAA 4ZP7A 1T9XA 2YKNA 4D3GA 2GA7A 4GRSA 4ERDA 4S0MA 3HKZD 4YR0A 4MK9A 2W7OA 1HNIB 2DXFA 4HLBA 1X9SA 4RW6A 2ZWOA 3DLKB 1G3OA 3OFEA 1NK7A 2Q6CA 4MIAA 1DQ8A 1S7HA 3RAMA 4KGKA 2RRNA 3L09A 3E01B 3ISND 1HARA 4RUAA 1F5CA 1YKWA 2JLGA 2IM3A 2ZC3A 4U7UD 4NA1A 3GJQB 2IM0A 5CYJA 2NXUA 4OMFG 5HLFB 2KTQA 1YBTA 1U49A 3PNIA 1HQEA 1LWFA 2AT1B 3K0JA 5IXUA 3KFWX 1C0TA 1ZTWA 4B9LA 1T9TA 2W25A 2JH3A 4J9SA 1JXLA 1VLOA 3GPAA 2DO4A 2V67A 3A8IA 4QOTA 1C4CA 5LOQA 2GQQA 2GVDA 1FNMA 5AE1A 4A46A 1I3OB 4UUWA 4LFBF 4AUKA 2ZNYA 4KJIA 3ITHB 3IWNC 4KPCA 1YWXA 4R8UA 2ILZA 4JYAF 1RT4A 1JKHB 2BACA 3UD4P 2LXUA 4FPIA 1Q81T 4GVLA 4J91A 2Y9HA 3R27A 3KMQA 3RG6A 2UUWA 2R2TA 4IH6A 1RGVA 3PY8A 4DV6J 4CLSA 1RT2B 4KE5A 2VG7B 5CZVA 2EFNA 4DUYF 3T5KA 2RS8A 2L9NA 4RUHA 4WTOB 3C3LA 1RT6A 1D8YA 5HK4A 4RW9A 1O6XA 1HWIA 5D4NA 3PKYA 3BDPA 4DUZJ 3RBDA 2O66A 1GX6A 2E5HA 1UETA 5K8MA 1DY3A 2QLWA 1S1WB 3DLGA 4MKAA 3Q2SC 2QZ8A 1N32F 4ECWA 4KHPF 4DCPB 1U1QA 2M70A 5IC4B 1M1GA 3QSIA 4QIGA 3KG4A 3QLHA 3CD7A 4U8VA 4HHHA 5KFBA 4OYMA 1U09A 1URNA 2I2YA 4LF5F 2CQ4A 2VD3A 2GJIA 1YI2S 2DRBA 1RJJA 1DTQA 3G71S 2MEWA 2K3KA 3NNAA 2AKWB 3I0RA 1HHQA 4P2MA 4KAIA 3QO9A 4WU3A 3C8YA 4LRBA 4HT5A 3ELHA 3EWGA 3G82B 4Y6IA 4RW8A 2GMHA 1XNQJ 3OVSA 2QYGA 3Q8RB 2HFNA 4ZJOA 3C6UA 4NLSA 4P7TA 3D3CJ 2F65A 4C8MA 1OY6A 5LT5A 2PDAA 2YXLA 3QRPA 2QL7B 4CYUB 4ZA1A 2XY7A 1N36J 3NBPA 4LSLA 2VODA 1EP4A 1HNVA 1QTMA 4ES3A 1HW9A 1FX4A 3IO1A 1YVFA 4LUBA 1DLOA 3IWXA 3W5XA 3IRXB 1FDNA 1XNRF 3CJ5A 4CI0B 2BJEA 3QT8A 2R7VA 1KEKA 4X4RA 1GNKA 1HBMB 4ZLPA 1R3NA 5A2QY 2NSBA 3TA2A 3QIPB 2HBQB 5E3QA 1Y9OA 2XLIA 4LFCF 3X1LB 1BC6A 3G6YA 3MR3A 3UCZP 3RW7A 2RS2A 2VBWA 3ENQA 3HI9A 1NEEA 1IQZA 4LFAJ 1M0SA 4ZJLA 1QVGR 4KPYA 2R8IA 3CJ3A 2I5JA 3ENAA 3H7HB 1WTBA 1UZHA 1AFJA 8AT1B 1RTHB 3UFCX 2RH3A 1OQ6A 3GIRA 2LP4A 3DOKB 4C8OA 1FESA 5C25B 4PQUA 3TUJC 2IRYA 2DH8A 1N5SA 2YKMB 2C2EA 1VC6A 1TL5A 4O3RA 2HAIA 2BW2A 1SJFA 2BE2B 1WDDA 2GMJA 5KFAA 4X64J 2CZVC 4ECVA 4OJ3A 4K4TA 3TARA 3EICA 3R6GB 3MM5A 1WEXA 1G7CB 3TOQA 1S1UB 2E66A 2XMMA 1LK7A 4N8NA 2G0JA 1S1TB 1SJRA 3OXLA 3SCLE 4MKBA 3LWLA 4Q8EA 2J8SA 7AT1B 1NK8A 1U1KA 3VAKA 3KUEA 3I55S 2EC2A 2K7KA 5C2CA 1HNWF 2XMTA 2LLZA 4C0BA 5ITHA 4DEZA 3ZC4A 4NLQA 4HTJA 4QWAA 2KXHA 5C42B 5KFRA 5E41A 1YLXA 4JI6F 3DLEA 2CWKA 3UD5A 1T05B 1ICEB 1TELA 3BBBA 1NKBA 4RNMA 2Z2MA 4RL1A 4ECUA 3H8YA 5G0RB 3ZTRA 1ZETA 1IKXB 3FCHA 2EK1A 2R2UA 2B9YA 4CT9A 2U1AA 2IRUA 4DN9A 4X84A 1JLFB 4IUFA 3AOBA 4DV1F 2LQ5A 1NKEA 2QIFA 3U27A 2AJ4A 2C3YA 3ULHA 3AFGA 4P2XA 3MR7A 5IC6B 4ZN3A 4NRTA 3OLBA 3UR3C 1VHFA 3S7RA 4IKAA 3BN4A 2H5EA 1NM2A 3RRHA 3OTOJ 4DSFA 5ETSA 4Y34A 4BWJA 3GIMA 4O3NA 4DPWA 3UCGA 1I94J 2QA2A 3CGIA 4UT4A 3FDSA 2L08A 2OP5A 2ZOMA 4IFVA 4TU7A 2BKNA 4F2SA 4Y65A 4UY85 1MWZA 2FVCA 2AGPA 1TUVA 4F0MA 3DLBA 2ZVIA 3G6VA 2H3EB 4OI2A 4OYZA 5KFCA 4UOGA 4H4OA 2CQGA 3GV5B 1R31A 4KGMA 3KNAA 4ZVUB 2HIYA 4I2QA 2C3UA 1SIWB 1QSYA 2A2DA 2VQFF 2DNQA 5A8RA 3W66A 2UXCF 4OX9F 1F5BA 5KFOA 5A8WA 1S9EA 2RRAA 1IWAA 1BQMA 4LRDA 4M5MA 1D1UA 3RBXA 3H5YA 1RT7B 1YITS 2AYEA 4WPAA 2ZH3A 4PPZA 2XB2D 4KH0B 5GMDA 3LP0A 4IR1A 3A8KA 2HGLA 4P72A 4RR5A 2WSEC 1VIOA 4NLVA 2E1MC 1TKZB 3GFZA 5A6PA 2VA2A 2ZVSA 3WZ0A 4DR1F 3BN7A 2WW4A 2BJ7A 2HVIA 3ILJA 2AD9A 4ETXA 2DXDA 1DTTA 1T03B 5HP1A 2CQIA 5KOWA 3JQMA 3H5SA 1UEVA 1JLQB 3RUBL 1IR1A 1FKOB 1XMBA 4O3OA 4FBUA 1TL3A 2GQCA 3CVKA 2ASLA 5J1PA 3SSQA 3TEGA 3VR1A 3CJKA 5T7LB 3LGNA 4TLRA 4U67Q 5E3RA 4RX6A 3NGSA 1UEUA 3IA0A 2RQCA 3EZOA 2NXNA 8RUCA 4KFBA 2XS2A 3PM9A 4CLKA 2R7TA 1PBAA 4OZNA 3A3PB 1CBKA 1JMTA 3N5FA 4O3SA 3Q8YA 4M5NA 1IBLF 5DRKA 1HI0P 3ZZYA 2FQQB 3QJLA 5CD4A 1JLGB 1SBRA 4JI2J 2CQ2A 4ALZA 4JB8B 3MDFA 4DR2J 1Y4ZB 4H54A 2Y1IA 4RNFA 4ZPWR 4F2RA 3DRSA 4HACB 4ITSA 1RB0A 3F44A 4EK2A 3KG0A 1VR6A 5LSRA 4C0HA 2F9JA 4CTAB 3PYFA 3QWUA 2UUAJ 4LR8A 2BEFA 3I96A 3D0HE 1FEEA 2B6AA 4JV0A 4JOUA 1VQ5S 3V4MA 3THPA 4IOBA 2P9GA 1J27A 4PG8A 3KLVA 3W7BA 4JI0F 4GC6A 2JFKA 3LP2A 5LJ5Y 4I67A 2WSCC 3GIIA 4TLQA 3ISNC 1WWHA 3W9JA 4DQIA 1RUSA 1G2EA 1TTHB 2ZZMA 3DMJB 3RR8A 2CJBA 1VBXA 1R43A 2J0XA 1OPIA 3O1LA 2E9ZA 5B0CA 2EVZA 2HNYA 4DV3J 3GV8B 4DU7A 3M2RA 2V5HG 4I7FB 1R0AB 4MKYA 3R7BB 3N6NA 4ZPBA 1UWAA 4ED7A 3MPWA 2RT3A 5KFLA 2FJEB 1UP1A 2GIFA 4QW9A 3QFWA 4BLGA 3TUZC 1H74A 3A13A 4QW8A 1TL7A 1JLEB 4GKKJ 5KFHA 1U6ZA 2GZOA 5IV4A 1NPPA 5F9NA 3BSNA 1Q8KA 4FN5A 2E1CA 2ASDA 1FRIA 2ZHAA 1RTJA 1HW8A 2NXCA 2HHPA 2VBZA 3OSNA 4NLDA 3MD1A 4OYPA 4ZVOB 2RU3A 1EJ7L 2ZUGA 1OQ3A 3IFEA 3QZ8A 1FDDA 1P27B 3M6UA 2BDPA 1ITPA 2A6OA 2FLOA 2LFVA 3HVTA 2N7YA 3OL7A 1JJ4A 1X4CA 4DSKA 2UU9J 1B70B 1SQFA 1FXLA 1VRUB 2GIRA 1HL6A 4DV6F 3F56A 5J2MA 2M3DA 3R7SB 2ALZA 1T3OA 4X4PA 3T41A 3BO2A 4X66F 3VGTA 1RT1B 2MQ8A 2AU0A 2CQCA 3K57A 4ID8A 2ACMA 1TMMA 1DARA 4K4SA 1UCNA 2MLYA 1YJ7A 3KDOA 1EETB 3ETOA 2KJWA 1S6QB 3T19A 3I4PA 4Q0BA 4DUZF 4X4UA 2MKCA 1EB0A 1KLNA 1DAXA 3LP1A 4WP8A 5LMNJ 2HWIA 1LFPA 4USTA 4KGZB 2XGPA 4I4BA 2AMCB 1NZ8A 4ER8A 1K0TA 3TZYA 5D78A 2IRXA 2RKIA 1YX2A 1N5VA 2JDJA 1IKVB 1QAJA 2OEKA 2DNLA 1XK8A 2IAJB 2L9WA 4WYWA 4OZ2A 3W2WB 2RDIA 1T02A 5U47A 4RNOA 3AJDA 4OI6A 2XNRA 1F5AA 2LQ8A 3NOGA 1VBKA 1QAIA 2YNGB 2HGMA 2DITA 3K8WA 2BQ3A 4JV2A 3JQKA 1C1CB 4YDXA 4DR3J 4OJHA 1RA6A 3J80Y 1HMVB 1XNQF 3KLGB 4N7TA 4FF3A 3U1LA 4UF4A 1NB2A 2MJUA 4J7CA 4NLXA 2NCKL 2ZNZA 3WIUA 1L3TA 5AXLA 4QIVA 1N36F 2CIMA 4YS2A 3DRPA 2C28A 3IBCB 1FKPB 3NCQA 3E8OA 1FNOA 2BZ2A 4GVBB 3HKWA 5LXYA 2KM8C 3TJ9A 5KTQA 3WX8A 1T9YA 4QYRA 3G2XA 1UA0A 2H4WB 2W9CA 4M5DB 2D9OA 1D9DA 2CQBA 3MEGB 3ZZUA 3O8WA 5KFNA 2EKYA 4MFBB 2C2OB 1U2RA 2QA4G 3KK3B 4ZN1A 1I1GA 3TAMB 4PXDA 3CJTA 5CYMA 3N28A 4K4VA 9RUBA 3FZ2A 3CEDA 2C22A 4LBIA 4LFAF 4LSNA 5DDRC 4HR2A 5GMEA 2MXYA 1NCLA 2BM0A 1FTCA 3I4HX 5B0EA 1X5TA 1S57A 5IM0A 1SKRA 1V3ZA 1TUWA 1W25A 1IM4A 2VL1A 3CCZA 4OX7A 1LQ9A 2JVOA 4Y28C 2B8QA 1AA1B 3I56S 3WC0A 1DJ0A 5L1KA 4ZLLA 2KB2A 2R8KA 1H98A 4DLGA 4LRFA 4UW2A 4X64F 3IG1A 3TX0A 3B54A 2A2CA 4MMOA 3KKFA 5EHHA 4IG0B 4J9MA 2WRMA 1S6PB 1NSAA 4ZS6A 2RUSA 1PIEA 4ZVPB 2FGOA 2X1FA 1L3UA 2R4FA 1CULA 1OIAA 3VWSA 2HRYA 5JMNA 2HQCA 2KU7A 1KLMA 2Q1LA 2VBXA 2MQOA 3F41A 1CSJA 2YH0A 4A8WA 4H4KC 2F8HA 3VF0B 4L73A 2CJXB 4LF9J 3W64A 2CJYB 2DB1A 2OD4A 1NU4A 2R9LA 3LW5C 2DR9A 3G8QA 2HIQA 3HK2A 2LA4A 1TVRB 2Q79A 1GEHA 4Q5VA 4I2PB 2L9DA 4TVAB 4DL6A 3GE9A 5HL7Q 2QGFB 3CXCR 3JSYA 3HM9A 2R2SA 2QJ3A 4HT7A 2ZD1B 2F7VA 2NXEA 3O3LA 2ZBPA 3H5XA 5ETLA 4B17A 2MZ1A 2W7AA 2WHOA 2ALYB 3IBFB 4OI4A 1GFWB 2QA1A 2YNHA 3DYAB 1QUPA 4FNHA 1YG0A 3RBEA 1ZPWX 3A3NB 4QPTA 4ES1A 1FX2A 2YWFA 3C16A 3GZ7A 3QGHA 1I94F 3GJTB 4DXLA 3L9ZA 3Q24A 3IBWA 3PHTA 4G6VB 2DHAA 4P73A 2CNKB 2E1PA 2BBEA 3M2VA 2FZCB 3Q8UA 1HBUA 1NHVA 5D6GA 4DN0A 4LF4J 1RHUB 3TQ1A 4DV5J 2B56A 1RAHB 2OFGX 1CJVB 1QUVA 1PCAA 4ILRA 3FQKA 3ZO7A 2CZ4A 2H65B 2XHWA 1OPZA 1EKRA 3NAHA 3TW0A 1KOOA 5A2QU 2PA8D 1S49A 1VQMS 5KFEA 1X0PA 3PKMA 5HMXA 3MFIA 1TFWA 3T9ZA 4AFFA 1F2GA 1FE4A 3MMAB 5E3AA 1AXQA 3D67A 4ZVRB 3SCIE 3PR4A 3I82A 1NK6A 4K5SA 5D77A 2ZOGA 5FDLB 5K8OA 2AZ3A 2QMWA 3ZZOA 3T1HJ 2MQQA 4GC7A 2NPIA 3DOMB 1F3VA 5LMUJ 2DGSA 3V4IB 4IRDA 1XN9A 3MM9B 2VPYB 4RU2A 1ZA2B 1FCAA 3V6KA 2IVMA 4R5PA 4WZMA 2IFXA 1F9EB 2Z56B 2HBZB 4ZCMA 4PWUA 3QFHA 2HS0A 3QJPA 1LXNA 5KFWA 1ZH5A 1D3WA 2ASYA 3OVAA 1IBKJ 3HJFA 3Q8QB 2P9CA 1NHUA 5RUBA 5L1IA 3KHHA 5DGAA 2WVCA 4RBTA 5GMKa 4NCGA 1FA0A 4QR0A 1TKXB 2DYAA 2W24A 4OV1A 1K0VA 1VYAA 3L7OA 3CWJA 2DPJA 1LW2B 5I42B 1NO8A 2B4UA 2MDAA 4XPEA 4NI2A 2MLXA 4CLPA 2KRRA 2JRSA 2A1BA 1B0VA 3FEXB 4Q2MA 3HFVA 4EUVA 1VFJA 2BANA 4B9NA 1S79A 1H38A 2U2FA 4HHUA 3DM2A 2R42A 1PJ5A 2OO4A 4J9UE 4USIA 4JI2F 4B3MJ 4DR2F 3PR5B 1SJ3P 2FY8A 2CPXA 3HVWA 3M8PB 3MECA 3U1NA 1VQNS 4XDDA 4JI8J 1BQNA 5LXRA 2DNOA 3ILOA 4ED3A 4B3RJ 5GADU 4RWWA 2ZM6J 2WVEA 3TUIC 2PT0A 2JEJA 2UUAF 5LSLA 3TO8A 1X4BA 2D3OR 3AT1B 3TZWA 3BGLA 2CQPA 2K1RB 2KFYA 2PC6A 1SUQA 2CNOB 1S6UA 1NDLA 1U6FA 1V3RA 1WI6A 1M5OC 1I51B 3DU5A 2OPSA 2XS5A 3V6HA 3DKDA 1F2HA 4CWBA 1T95A 2FC9A 1FJGJ 3D1QA 1TL1A 4JI1J 3RYLA 4DV3F 2RIJA 4Y2CA 1MROB 2GJFA 4PUOB 4FXDA 1IJFB 2UUCJ 4RZRA 3C14B 2CG4A 3EGNA 4DZ6A 4YUDA 1JLBA 1NSQA 2YQ3A 1RT3A 2V4RA 1IJEB 1S1XA 5K14A 4TXSA 3FFIB 5C24A 5CHCB 3ISZA 2FHKA 3KYLA 2HNDB 1PJ6A 2HFOA 1T9VA 3BB5A 4KV8A 3JSRA 3M6VA 4GKKF 1RAAB 1WHWA 1OY8A 5HVHA 5IQ6A 3NGRA 3TANA 1WUUA 3MEDA 2XYGB 1S0MA 1U0HA 3KXDA 1L5UA 2VG5A 4YN3B 4WJBA 3VAIA 5KG4A 3MM8B 4M94A 1U25A 3G87A 1BUXA 3J7Z5 1DZ5A 3I0SB 1KHVA 2I38A 1CS4A 2UU9F 3W9IA 1RBOB 3MPUB 4OZ3A 3EGVA 4RW7B 1FJEB 2VF3A 3EGWB 3PJXA 1UVLA 2WW8A 3UVJB 4LQ3A 2OI2A 1FDBA 1LWEA 4TNOA 4U6PA 2RE1A 2D74B 2QX0A 3DXSX 3RAXA 2K2PA 3OR2B 4EZ6A 5J1EA 2ZZTA 3KNGA 1AZSB 1C4AA 1E6YB 2PD1A 3MMJA 4R25A 2OSRA 1A6LA 3JYTB 2D3ZA 5LMNF 4CH1A 5AXMA 3M1VB 5HAOA 1L3VA 4DOZA 4GO7X 4WTYA 3RRKA 2XSFA 4PR6A 3B8HA 3GCWP 2GNKA 3HLUA 2RVJA 2HLUA 2XI3A 1IR2A 4J9KA 3RRGA 4EYIB 5HJXA 4WP9A 3KK2B 1SJ1A 1GTEA 1X5PA 4O4RA 3PIPQ 3HT0A 2CA9A 2WBMA 2WB4A 4C6AA 1C0UA 3SQGB 2FB0A 1R8HA 3KK1A 5KFSA 2R8GA 4NMLA 3PHEA 2XZWA 2BVZA 3PW4A 1S10A 3CDAA 2I1RA 3HSJA 2RDDA 2FVPA 3UN3A 2J9DA 4ILLA 2J6TA 4MK8A 3EM1A 3IAS9 4ZHRB 2AGOA 2MY8A 2LDIA 1M5VC 1XC9A 1KVJA 3CMAS 3DLHA 1KFDA 1YDLA 2HHUA 4KYZA 3SQOP 3GLJA 3GYGA 4B3TJ 2KVIA 4A8XA 1RKJA 2OMLA 4KHMA 6FDRA 2EI5A 2ZJPQ 3M9OB 2GVZB 2O67A 4K4WA 1T8EA 3GCXP 2B51A 2EPIA 3CC4S 3KLEB 4DFKA 2ACYA 2QSFA 5ETVA 2NSCA 3SYZA 1U7LA 2EFOA 4J9NA 4NYPA 1LOUA 2PEBA 3MM6A 1RP5A 2HNZB 4FVMA 4PWDA 1Q78A 2CPEA 3A3OB 3PV8A 3R8YA 4CLYA 4NXNJ 3OXGA 2FUG9 4ID5B 4QR1A 2ATLA 1JIHA 1LK5A 2DH9A 3CCES 2PEHA 1ZZNA 4DQRA 4N76A 2AP6A 4CM0A 3R3TA 3DGPB 4KRWA 2GHVC 2GQ2A 4RNHA 3CIMA 2YKNB 4NMXA 5DLFA 2KT5A 4ED5A 2KM8B 2VQEJ 1T11A 4DZDA 3NGUA 1S7IA 2DRAA 4H4MA 3R2CJ 4RW6B 2CXEA 1HI1A 4LQ9A 3TEHB 3V5RA 4RO0A 5D3GA 4RUCA 1FRHA 3HCXA 3MMBA 2DR5A 1SB6A 3MAHA 1ZBTA 5FJ4A 4M5KA 1VQ7S 1BLUA 5L39A 2QFIA 2MZTA 2OAUA 3JSBA 4OHYA 5KG2A 4LF6J 1X0FA 5DQGA 4NX9A 1P9QC 1HQEB 1LWFB 4LIWA 2CVEA 4Z37A 1C0TB 3U02A 4LF9F 1FFWB 4DF8A 3CO0P 2DNHA 2C2MB 1TZ0A 3IM9A 4BC9A 2V2VA 1P8GA 4FZVA 1S0OA 4FYDA 2LEBA 3BEGB 4DHVA 3QAEA 2NR0A 1S1WA 3PVXA 2MHNA 3ZNUA 2GVDB 3DOLA 2ZKUA 3T1YJ 5I3PA 1LWCA 4MAKA 2XO6A 3LAMA 4QWCA 1HNXJ 4YB5A 1RT4B 1Z2ZA 4XTTA 3RGIA 4HL9A 3QBCA 2XMUA 2WCXA 3JSMA 3CCUS 2R7SA 1RTDA 1VCTA 1T3NA 2V68A 1SKSA 5EX0A 1UVJA 3SCKE 3TZXA 3J80U 2DTJA 1K8AT 2VKZG 5E3CA 2KT3A 2KXNB 2BABA 2MSSA 1RT6B 4RW9B 1MLAA 3BYRA 2W4CA 5D15A 4IH7A 1YJWS 5BYRA 1YJTA 1M1HA 4OYAA 1SI9A 3I9ZA 2ZH6A 1N32J 2QG9B 3DLGB 3CJ4A 2M8DB 4KHPJ 4LF4F 3CJ8A 4DV5F 3GYXB 4MJKA 3PW7A 3GB0A 4P10A 4YEAA 5IQQA 3MUTP 3QLHB 5F8LA 2PGCA 4MYTA 2G2OA 4OZLA 3HT3A 3KLIA 4MH8A 4EYHB 2GGPA 3CDBA 1RSCA 1DTQB 2H54B 3G9CA 4ED4A 2MHEA 4CNZA 1HD0A 2JC1A 2AEMA 2HS3A 4UQGA 3I0RB 3QO9B 1KP6A 1ZM2A 1W26A 1YRXA 2LDYA 3D6FB 4RW8B 4N77A 4XIUA 3C6UB 2FZKB 5JJBA 3CF5Q 2M2BA 1FWPA 3I32A 3T1HF 2W9BA 1VQ9S 5F3ZA 2HRTA 4NPOA 4KHRA 1D9FA 2KG0A 4I6YA 2LA6A 2IM1A 3NBPB 4LSLB 1EP4B 1HNVB 3Q8SB 1QAYA 4JI4J 2ZOFA 1DLOB 4WFNQ 3PW5A 4FYXB 3T5HA 4A8QA 2QEXS 1FRKA
chains in the Genus database with same CATH topology
4FF2A 3N4WA 2C2RA 2XB2D 1HA1A 2W4DA 2RU9A 4DX8H 3PIOQ 2YNFA 3LP0A 4IR1A 4PG6A 3EX7B 1KHWA 1RT1A 2HGLA 2DIUA 3BGRB 3BR9A 4NA3A 1IBKF 2F8MA 4O0IA 2D3UA 4KC5A 2RRBA 2WSEC 1VIOA 3TRGA 4NLVA 4B02A 1QE1A 2J9CA 1REVB 2E1MC 2PI5A 1TKZB 3A1YG 3GFZA 3IS9B 5A6PA 5H9EJ 5KFXA 2IVFB 2VA2A 5EGYA 3SXLA 3K58A 2MY7A 2ZVSA 3WZ0A 3CO9A 2Z4PA 1EETA 3E51A 4EZ9A 5HROB 2EFPA 2M52A 4H4MB 1KC8T 4DR1F 1S6QA 4ECQA 2MQLA 5IT0A 4ZVFA 2VC0A 1VQ4S 1G1XA 4XDCA 3P3DA 4CZCA 4I0WA 2J0WA 3IGNA 1YJUA 3DHWC 5JXSA 3NRBA 3BN7A 4P2SA 1TK8A 2BOPA 3EPIA 1UFWA 4K4UA 5D3GB 4AL6A 2C3OA 3M8SA 2HMIA 4IOAQ 3MMBB 4USJC 5KG5A 3QYYA 5E0OA 2HVIA 4FF1A 4DFJA 4ETZA 2AD9A 4ETXA 1DTTA 1T03B 5HP1A 1R8PA 2CQIA 2N4DA 3GG0A 1IR0A 3LUYA 5KOWA 4ED2A 4DSLA 1KQKA 4PQAA 3H5SA 1UEVA 1JLQB 3JB9k 3C46A 1FKOB 1XMBA 4O3OA 2MQMA 4CH7A 1IKVA 1SIZA 2QRRA 3M2UA 3MZIA 4B3SF 4FBUA 1TL3A 3C6TA 2GQCA 3CVKA 4OZJA 1H2VZ 4PQUB 3J7YI 1FT8A 2XEXA 2E9TA 2HS4A 1S1VA 2ASLA 3IXQA 5J1PA 2IAJA 2XSJB 3PX0A 3SSQA 4B9SA 3W2WA 1TV6B 3VR1A 2DGUA 2QA4S 2AX1A 1WHYA 3CJKA 5T7LB 4JI8F 3OR1B 2XLKA 1C1BB 2J6UA 3LGNA 1WF1A 4WXOA 2JEGA 1VGYA 3L95X 4A4JA 4B3RF 1JLCA 2NYIA 2YNGA 1JX4A 1V6HA 4LMZA 1HPZA 3R5CA 4TLRA 3OHBA 4U67Q 5E3RA 2RJZA 5E7OB 1R27B 2ZM6F 2ZDPA 2KKHA 1LW0B 3CE8A 1DURA 1S6OA 4PXCA 7FDRA 1VQOS 2K8GA 1C1CA 4RX6A 4PKDB 1UEUA 2VG6A 1G6BA 2V94A 2QV6A 3IA0A 3OJSA 3W2VA 2RQCA 2LCWA 1D8ZA 4JI5F 1KR4A 5DG8A 4KFBA 4OI0A 3MM5B 1HMVA 4DR3F 2XS2A 3KLGA 4JV1A 3PM9A 1FHTA 3UQSA 3OQ2A 3ENVA 3NS5A 1Q1KA 4OQJA 5HQ8A 7FD1A 2R7TA 2ROEA 1JK9B 3TX8A 3MAQA 4OZNA 1VC5A 1MMLA 3KWMA 4TYBA 5L1JA 4F4ZA 2CQHA 1JMTA 3N5FA 4O3SA 1R8CA 3TA0A 3DOLB 1PGZA 1IBLF 2WAQD 2V8DA 5DRKA 5DDPC 1HI0P 3K5MA 1TFYA 1VC0A 2JOQA 3ZZYA 5KT7A 1LWCB 2VONA 4C8NA 3I5BA 4KB7A 3CCWA 2DIVA 2RNEA 4PXEA 4AYBD 5KFFA 4A8MP 3QJLA 3H4DA 4WIIA 3UDLA 3DHXA 4ZMMA 1JLGB 3BSOA 1KOHA 1SBRA 4Y2KA 1VBYA 3M30A 2CQ2A 4ALZA 1O8BA 3MDFA 4LF8F 2QFJA 3AQOA 1Y4ZB 4H54A 2Y1IA 3EYZA 3IR6B 4RNFA 4DFPA 1FJGF 2L3MA 4JI1F 4ZPWR 4F2RA 1APSA 2DNZA 3DRSA 1FKPA 4ITSA 1N5YA 2C3MA 3N5BA 3OUYA 3F44A 3T6JA 4ZVEA 1X9MA 3TAPA 4NWBA 4ECYA 2VFTA 3KG0A 1U47A 3UNGC 5K5MA 5LSRA 4C0HA 3JSMB 2UUCF 2MQNA 1Z2LA 4QBUA 4ILMA 2F9JA 4CTAB 5F8MA 2BRLA 5FIIA 1N4LA 3QWUA 1BD6A 3NNCA 5IT9Y 4N8OA 1Y5LB 1RTDB 1SH3A 2YWKA 3I96A 4MIBA 3D0HE 1FEEA 2B6AA 4JV0A 4JOUA 1VQ5S 4J9OA 2DHXA 3EZUA 5DM6Q 3HHLA 3V4MA 4M5DA 1VBZA 4DQPA 4LJMA 4YR2A 1IN0A 3THPA 4IOBA 1B7FA 2P9GA 2J76E 2K7JA 2R7QA 3MEGA 2NPFA 2FJBB 3NP5A 3RZAA 4PG8A 4MFBA 4UQTA 3KLVA 3W7BA 1NJZA 5FLXY 4JI0F 5IT4A 5LSOA 3DLEB 4GC6A 3DRYA 3KK3A 3BDEA 2JFKA 3LP2A 4OL8A 1X4HA 5LJ5Y 4RNNA 1RA7A 4I67A 3TAMA 2WSCC 4CQ1A 3GIIA 4C8ZA 1RDRA 3LWMA 3UE2A 4TLQA 1KONA 3ISNC 1WWHA 4DQIA 1G2EA 2ZZMA 1OO0B 5L9XA 1NH7A 2E5IA 4X2BA 1K1SA 3DMJB 2NUHA 3GMGA 2HLTA 3RR8A 3FZBA 2CJBA 4F4XA 2E44A 3M05A 1VBXA 2CQDA 3PRBA 2FJVA 1R43A 2J0XA 2Z0GA 1B64A 1OPIA 3O1LA 2E9ZA 1KQGB 2GHWA 1HFEL 1VQ6S 1U48A 4C3MA 5T41A 5B0CA 4M95A 3MFHA 2LYVA 2EVZA 2HNYA 5HBMA 2OIHA 1S9GA 2AYGA 3TP2A 3GV8B 1S48A 4CO5A 4WE1A 4PG7A 5BYSA 4ZCIA 2BJDA 3MTKA 3M2RA 3ZZPA 1OSCA 2COLA 3CULA 2V5HG 3NS6A 4I7FB 1R0AB 1ZM4A 2HZCA 1XBWA 4MKYA 1HHTP 4TN2A 1HWUA 1T94A 1TKTA 3CDWA 3N6NA 4ZPBA 4G1PA 4ED7A 4QCLA 3MPWA 4ZCKA 3HFKA 2J6SA 2RT3A 5KFLA 4CO1A 3KLIB 2C3PA 2FJEB 3OW2R 1N52B 1UP1A 2GGPB 4NLWA 4A8OA 5CZXA 3NCRA 2M4MA 3OL8A 4QW9A 1U4BA 1JLAA 5F0WA 3TUZC 1A9NB 1QLNA 4QW8A 5AXNA 2IM2A 2YKQA 4AQYF 1MNEA 3IS9A 2ZJQQ 2UZAA 1JLEB 2IVYA 2MGZA 5KFHA 3GFXA 1N33F 3T6BA 2DK2A 4YFUA 1U6ZA 3BSAA 5D8HB 4F4YA 5F9NA 3BSNA 3BGFA 1YRUA 3LO3A 2GMLA 2ZBIA 4IFVB 5HMZA 2N7CA 1HWJA 1U45A 4IG0A 3ZFVA 4FN5A 2E1CA 1S6PA 2V8VA 2VUGA 3FVYA 2CJ9A 2OTJS 5THWA 4ZOSA 1FRIA 2ASDA 4I6AA 4J9LA 2RSQA 2DGVA 1YJNS 2ZHAA 1RTJA 1PSDA 2HHTA 1RT5A 1HW8A 2E1AA 1IKWA 2X1AA 4CO0A 1N88A 2HHPA 2J7WA 5F8HA 3QGGA 3V6JA 2G0CA 2VBZA 1SV5B 3DN9A 3OSNA 4FBTA 4NLDA 3N0VA 3MD1A 2B4OA 4H4OB 1Q7YT 4YQWA 1UWBA 2EK6A 2KN4A 4J37A 2RU3A 1S97A 4A8KA 1XR7A 4I1TA 2ZUGA 3M9NB 4F4WA 2AJQA 4B08A 1H6KX 1OQ3A 3IFEA 3QZ8A 1FDDA 1N34F 4UUXA 1BGXT 2KFZA 2AX0A 2Q6BA 2W9BB 3CCTA 1ZZFA 2XG8A 3VZHA 3K5OA 3KJVA 1P27B 3M6UA 5SUHA 2E5JA 5A8RB 4I69A 3CMES 2E7XA 2KT2A 2BQUA 2DNNA 2BDPA 1GXUA 1DFDA 4F3OA 4U7UK 2CJKA 2OLWA 2DPIA 5I3UB 2FHJD 2FLOA 5CXTA 3HVTA 4K0KF 2FC8A 4J9QA 3SFUA 2YX1A 2LXIA 3TNVA 3MI7X 2B3TB 2FLNA 2J9EA 5A8WB 2N7YA 1S9EB 2YY3A 5B0DA 3OL7A 1JJ4A 1X4CA 2UVWA 4DSKA 1WD6A 2IJFA 2GW8A 2MZQA 1BQMB 3MURP 3P6YC 1N6QA 4A8SA 2YWEA 1V3SA 1MW7A 1FK9A 3ONQA 2R8HA 2LKZA 1FXLA 1VRUB 2GIRA 3BM7A 3P49B 1LW0A 5KFTA 2LEAA 4QU7A 1HL6A 3LPYA 1VQLS 2GCFA 4DV6F 3F56A 3MTJA 5J2MA 2M3DA 2ALZA 2XI2A 3N9UC 5J2NA 3MEEA 1T3OA 4X4PA 3BO2A 4X66F 2YNFB 3LP0B 3E2EA 1TVRA 1RT1B 4C11A 2AU0A 1U24A 3CDUA 3FJ2A 3NLCA 3CC7S 4KO0A 3TYTA 4KKOA 2CQCA 2FJDB 3MOJB 2B4VA 1FJCA 2IC3A 3K57A 4ID8A 2V0NA 4I2PA 1DARA 5CQGA 4TQSA 2K3IA 4K4SA 2L48A 4L3NA 1QSLA 3CC2S 2JJ4D 4LVNP 2NUUG 2RB7A 1EETB 4I56A 1QJHA 2XWXA 2ZD1A 2KJWA 3ETOA 2R7OA 2RILA 1S6QB 3T19A 2WB1D 3BZQA 1YSJA 3I4PA 3HPOA 4Q0BA 3UW1A 1H0HB 1TAQA 4DUZF 2ROPA 4GO5X 3PX4A 3K5PA 1JXEA 4X4UA 2MKCA 1RQ0A 5SZTA 1KLNA 4V19X 2DNKA 2HHSA 1DAXA 3CPWR 2VH7A 3BS9A 2F1FA 2QMXA 3LP1A 1ZM9A 2HMIB 1XWLA 2YNIA 3JAMY 2HWIA 5F3TA 1LFPA 2AWZA 4NLYA 2XGPA 1GAOA 1DTTB 2I8EA 1NK4A 5KFVA 4I4BA 5HP1B 5KG7A 3MR5A 2VBYA 4QIWD 3CD6S 1K0TA 2ZHBA 5DS7A 3MUVP 2PN6A 5D78A 4LF7F 1ZYQA 5A6WA 4NYOA 4P7VA 2HFZA 4CO3A 5KFDA 2IRXA 2RKIA 2VZ9A 3FSYA 4ZP6A 4K4XA 2JDJA 1N5VA 1X9WA 1IKVB 3DYAA 3M2UB 1QAJA 1JJHA 1SL2A 4MYUA 2DNLA 1XK8A 1TL3B 3C6TB 2M9KA 4X4OA 5M2PA 2JFDA 1H3DA 1VK8A 1IXKA 3EXCX 1S1VB 3H20A 2IAJB 2L9WA 1UAWA 3KG1A 2X3GA 4WYWA 3W2WB 3CUNA 3KHRA 4B3TF 2DNMA 2DR7A 2RDIA 3I6PA 2O3DA 1T02A 4IDKA 3CJKB 5U47A 5I4MA 4RNOA 1H7XA 4OLOA 4OI6A 2NS1B 1F5AA 4FNIA 3OV7A 2XNRA 1QAIA 1JLCB 2YNGB 3MXHP 2HGMA 1HPZB 4W90B 2GIQA 1HWKA 3AJ1A 2KXFA 2DITA 3Q0AA 4NLUA 3FNNA 2FVSA 3PEJA 3K8WA 2BQ3A 4JV2A 2JZ5A 1C1CB 4HDHA 3CJ0A 3P96A 2VG6B 3AB2B 3VAJA 4YDXA 4OHWA 3M9MB 3W2VB 3CCJS 4OI3A 3R5DA 3UD3P 4OJHA 1RA6A 4KFBB 3J80Y 3RB0A 1HMVB 1XNQF 1O51A 3SV4A 3KLGB 2D9PA 2ZE2A 4FF3A 1K9MT 3OTCA 2IMWP 3I87A 3OFGA 3U1LA 3SFGA 1Q7LB 3U1MA 5M2RA 1KVIA 3CJ2A 1DQ9A 2E7WA 2MJUA 4NLXA 1U1RA 4ZVGA 2VC1A 4XPCA 1P1LA 3I9V9 3BQ2A 2ZNZA 3R1LA 1X4GA 1QVFR 2XGQA 5L38A 5GAEI 2N3LA 2RQ4A 1FRXA 3BGUA 1LXJA 1L3TA 4NZ7A 1TR0A 5AXLA 1M5KC 5B09A 5A8KA 2FGCA 4QIVA 1U6BA 5K8NA 1N36F 4K5RA 4NXNF 3K2YA 3M30B 4ED1A 3BO3A 1SH0A 2CIMA 1MMNA 4ELTA 3S8SA 4USHA 3DRPA 1A7GE 3H2UB 3O2IA 2C28A 3MR6A 3X3UA 3VAFA 2QLXA 3DRSB 1N5YB 1FKPB 3NCQA 3E8OA 4QWDA 4C8LA 3OUYB 3SZ2A 3VAMA 1FNOA 2BZ2A 2DD8S 1RTIA 3HKWA 4O4GB 2LQBA 4IFYB 3ICLA 3UDCA 5LXYA 4KTQA 2KM8C 1Q53A 3TI0A 5KTQA 2ERRA 4HDGA 3MMAA 3AHPA 5C5JA 4QYRA 4L6V3 3HHLD 1UA0A 2B6AB 1Y5IB 4OX8A 4F3MA 2ZH8A 3GG1A 2W9CA 3HHLB 4M5DB 4ZPTR 1S4FA 1LKZA 2D9OA 4EO6A 1D9DA 4AXIA 2CQBA 4YB6A 4YR3A 3MEGB 4MK7A 2BXJA 3O8WA 3ZZUA 2ZH7A 5FDLA 5KFNA 2EKYA 1TAUA 3OSPA 4MFBB 3H98A 1VQYA 3EZ5A 1U2RA 3N79A 3QGPA 4ZVHA 1SV5A 2QA4G 3KK3B 1W2IA 2VQEF 3LP2B 2VA3A 4RW4A 1E6VA 5KT4A 1I1GA 3TAMB 5D4OA 4PXDA 4IG3A 5CYMA 3CCQS 1CLFA 1N56A 5IS2A 3N28A 1JNRB 2WOMA 4K4VA 3DOMA 3F73A 2V2KA 5DG9A 3FZ2A 4F50A 3CEDA 2C22A 2ZH9A 3V4IA 2DNRA 4HI1A 1MU2A 2M8HA 4LSNA 5KG0A 5LMUF 2YTCA 4LFAF 2RQKA 5DDRC 4TKTA 1JNZB 3THVA 2D1CA 4O3PA 2MXYA 3MM9A 1OS5A 2IA6A 2XY6A 5HBMB 1TKDA 4FP9A 1S9GB 4HI2A 2ZH4A 1WHXA 4Q8FA 4WE1B 2BM0A 1FTCA 3RB6A 5BYQA 3PEHA 2GX8A 3I4HX 1W2BR 3M2RB 3J81Y 1NJXA 2FJXA 3PO5A 4B9UA 1OSDA 5B0EA 1X5TA 4AXJA 1TK0A 1RWUA 4ZKAA 5IM0A 3EUNA 4LF6F 4AE5A 1V3ZA 4ED8A 1SKRA 3J7ZT 1W25A 1TKTB 2XMKA 5KFUA 1TL4A 2Q43A 1I6JA 2W7PA 1IM4A 4A8YA 1IKYA 2KJVA 1K1QA 2VL1A 3CCZA 4IO1A 4OX7A 1LQ9A 1HI8A 2JVOA 1SQEA 4Y28C 3I56S 3WC0A 4IRKA 4X4TA 1DJ0A 4EBDA 4QZVB 3FGVA 4TY8A 5L1KA 4LT6A 4Q45A 2WBRA 1JLAB 2KB2A 2R8KA 1R6YA 2O5DA 1H98A 4YHHF 4DLGA 2NZ4A 2H9ZA 3OFHA 4UW2A 1TKXA 4X64F 2VOOA 3IG1A 2ZHOA 4DS5A 2MGZB