4AL7A

Crystal structure of the csy4-minimal crrna complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
189
structure length
155
Chain Sequence
b'FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQALDLPFVTLRSSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSY4 ENDORIBONUCLEASE
molecule tags Hydrolase/rna
source organism Pseudomonas aeruginosa
publication title Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
pubmed doi rcsb
total genus 31
structure length 155
sequence length 189
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4al7A00
2XLKA 4AL5A 4AL7A 2XLJA 2XLIA 4AL6A
chains in the Genus database with same CATH superfamily
2IJRA 2E9ZA 1CC7A 3CIMA 4USJC 1SJFA 3LP1B 1M1HA 3R3TA 1Y0HA 2XEXA 5GAEI 4DEZA 4ZJOA 1OY9A 2CPXA 3HHNB 3CJ0A 1JX4A 1FK9A 4IO1A 1OYDA 5EUHA 1HQUA 4CLSA 5I42B 1RT4B 4J9UE 1WDDA 2CVIA 2BQRA 5KFHA 1L3UA 2GFFA 2IIHA 4UOFA 5F8LA 1QSYA 2FHKA 1TQLA 1TKZA 2YX1A 1M5KC 1NCLA 2DH8A 1SBRA 3AY0A 4N8OA 1SIWB 3H7HB 1RAFB 3C3LA 2RH3A 4G6VB 4ZS6A 2AKWB 2AD9A 1RT7A 1E6VB 1K8AT 3Q2SC 2M7SA 1M5SA 4E0DA 4LT6A 1U1QA 2ZH8A 4N41A 4OI6A 5HSPA 2LYVA 4EEYA 4F2RA 3IMQJ 4YOEA 3MDFA 4IYQA 5AT1B 5KFVA 2DNGA 4J9LA 3MPDA 2A2CA 3DOKA 3PZPA 3JB9k 1XEZA 1UMJA 3VQTA 3J7AN 2HBQB 2C3MA 3FSXA 4YN3B 3BH6B 5KG3A 3E3XA 4CM0A 4JV5J 2E7XA 4MK9A 4ZPBA 4YB1P 3MURP 4WXWA 2R2TA 2W8KA 4LIWA 2QYGA 5E3RA 2DEIA 3TANA 4PYAA 4K4ZA 4KHPF 2H4WB 3AFGA 2DGWA 3OL9A 3N28A 4WU3A 1Z1ZA 1X5TA 1DQ9A 2CVEA 1EQMA 2ALYB 1Q7LB 4NCGA 5T41A 4J9SA 3QJJA 2HHXA 1ZAWA 3G86A 3IO1A 2BJ9A 4GVBA 5K20B 1J5OB 3H90A 1QJHA 3MPYA 1S0NA 3RRGA 2G4BA 1T9TA 2N4DA 2XI2A 4CNZA 2R8IA 1UEKA 4MH8A 4NLVA 3GIJA 2CJ9A 1BHNA 2HMIB 3JXOA 2DNHA 1CQMA 4A4JA 1KQKA 1T11A 2B9XA 5LMNJ 4CP5A 2CQ3A 2JWNA 1AYEA 4K4VA 2M0GB 5AJ3F 5DM7Q 2EG1A 1JLGA 5F3TA 1OY8A 3EUNA 3DCAA 4DS5A 2NPIA 3DRPA 1HA1A 4KRWA 1Q86T 1X9WA 4ERDA 1ZA1B 1LW0A 2VBYA 3EGNA 2CPIA 1GK8A 2MQNA 2YX7A 2PMWA 2DNRA 2B4PA 4ICLA 3VCDA 4DUZJ 3BGRA 3EZOA 2N3OA 4QU7A 1O6XA 1VBZA 4X4OA 2UUBF 2ZH6A 3DLLQ 2F4FA 2HQCA 1U48A 1BWEA 1SIZA 2ILYA 3SI8A 3DGPB 4B9UA 3GYGA 3QIDA 1KLNA 2E9TA 2QZ8A 1VI7A 1Q8LA 1NSQA 1ZBTA 4PKDB 3CJQA 4AQYF 4FKXA 5IOLA 4N5SA 1RDRA 3IAM9 2V94A 1RWVB 1SKWA 2G2ZA 1NK4A 1JQGA 3T19A 2U1AA 4ED1A 1BQNA 1ELOA 3MMBB 4FXDA 2J6SA 2KDOA 4K8RA 2OFGX 1RLCL 2GC8A 4C48A 3QSYB 3G2XA 3G8SA 2UXCJ 1Q7YT 3N01A 2K1RA 1L3SA 1JJ2R 3VAMA 4F4KA 4FNHA 4LF2A 4OZ0A 1CJTB 2VG5A 1S9GB 1WC3A 3R7SB 2ZH5A 1G1XA 1Y10A 3PW5A 3RRHA 3O44A 4LF6J 2OLWA 3K5NA 2UXBJ 2VF3A 1MLAA 4ELUA 1M5VC 2OELA 3AQOA 3M1VA 3C2PA 3T1AA 2KJVA 5U47A 2VA2A 4C3LA 1PJ6A 2Q1LA 1YSJA 1KOHA 2UZAA 3RW7A 1IWGA 1C4CA 3HHLA 4JI2F 5A2QU 2AYBA 4JI7J 1KKHA 3OVAA 1X5SA 1KP6A 3AA8A 3CSKA 4KBIA 4ZDNA 5KFGA 2V4QA 2Q3PA 1G4CA 5HMXA 2DHAA 2XYGB 5AXLA 1D3WA 2MKYA 1WG1A 5LL6d 2GNKA 2GJFA 2R2RA 4C3KA 4Y3CA 1HQEB 4RZRA 2NS1B 2SXLA 3H5XA 2PDAA 1V3ZA 3C6TA 4Q43A 7FDRA 2CNOB 3OTBA 1RCOB 2V69A 5IZHA 3DLEA 3CD0A 1VLYA 2AJ2A 2YPZA 3M9NB 2VODA 4K59A 3ET6A 2FLPA 2UUAF 1NDCA 2KRBA 3AA9A 4K4WA 5KAKA 2VQFF 5K8NA 1T0TV 2ROEA 1VQ8S 2FZCB 2VH7A 3ITHB 3CCWA 2BE2B 3NP5A 3V6DA 2XNQA 2Z2YB 3I9ZA 2E5GA 2DRDA 3QLHB 3GFZA 3WDOA 1YX2A 4FS1A 2AJ4A 3BKUA 3H59A 1R0BG 1R27B 2NUHA 2ACYA 3DDIA 4HACA 3G6ES 4DSIA 1V3RA 3TJAA 1FK9B 3DLEB 3QO9B 1G7CB 5B0AA 2BJ3A 4YY3J 2HWHA 2HVEA 5D4NA 1KDNA 2LP4A 3UN2A 1MWQA 2ZH2A 1RU1A 3W65A 1HNWF 3D0GE 5IQQA 3KYLA 1KR4A 4CO0A 1KOOA 4E8UA 4DR5J 4YY3F 4JI6J 1RWKB 1CS4B 2C3PA 2Z58B 1NK0A 3O5TB 3BGFA 3AODA 3M32B 3NBPB 4Y28C 3EICA 5GVQA 3M32A 3VF0B 2OIHA 3NGDA 1TMJA 3NGTA 5A6WA 3MEGA 4DV3J 1JLEA 2GAHC 3E8OA 1FTRA 1QUPA 2WW8A 4FDFA 1NMEB 3UW1A 6FD1A 4YR3A 2XMAA 3MAQA 4K4UA 1B4SA 3MWBA 1WNEA 1OPZA 1IR0A 1WF0A 2Z2ZA 1GX5A 2HRYA 1RT2A 2BRLA 1VK8A 2W24A 3R5GA 4WXOA 4ZLPA 4JOUA 4DWIA 4DR4F 4F3OA 1HKAA 4IOAQ 1X9MA 2PFFB 4DR7J 4RWWA 1P8GA 3RRKA 1JJHA 8AT1B 4CTAA 1OMSA 2A6OA 1BE4A 1SC1B 3TARA 3DI6B 3CJSA 3H2UB 3R5DA 3VGTA 4BDPA 4JB8B 2XY6A 4M5DA 4CIOA 4PUOB 1FRKA 1RTHA 1XN9A 3CT9A 1UP1A 4USIA 3RAMA 3SXLA 3VGSA 2EXUA 5IS2A 3CCMS 1REVA 3CPWR 1J5EJ 3DFEA 1TKTA 2QIFA 3DRXA 1WI6A 1WF1A 5HP1A 1T3OA 2Z0GA 2HWIA 3RBXA 4QYZJ 2DRBA 3ISND 3VR1A 1OSDA 4FYDA 2V8HA 1VC0A 3R5AA 2V50A 2HQFA 3LANA 4NLGA 2HNZB 4DR6F 4NXNJ 4LRCA 2ZBIA 4LF7J 3HSGA 1U1MA 1NDLA 2CA9A 2D41A 4O3SA 2GIQA 1H3DA 2C3UA 4KIAA 1YTYA 2DRAA 3H20A 1IKVA 5M2RA 3TJ8A 3KLGA 5ETPA 2H5IB 2GGPB 1NHUA 2H54B 3UCGA 4DR1J 4TYBA 5E3PA 2C2RA 3I0SA 1SJ4P 1EETB 1DZ5A 4FF3A 1BUXA 4QIGA 2H9ZA 2A6MA 4HT5A 3OTOJ 2BW7A 4B3SF 1B0VA 2LCWA 1HLWA 1QY7A 2BUNA 2ZDPA 4ZIWA 1TL1B 2RB7A 3AJ2A 2R4FA 1RTJB 1Q8IA 3Q8UA 4IG3B 4N7TA 2WOMB 3NXZA 5FDLB 5LXRA 4FS2A 4DL3A 2DHXA 3K17A 4FF2A 3R5JB 5L39A 1ZZFA 5ADZA 2MSTA 4URSA 1TKXB 2Q79A 1I51B 1JLBA 2R8KA 2B4UA 2PT0A 2GQQA 2R8JA 2D1CA 3MECB 4MIBA 2W9BB 4K4XA 3B54A 1CJTA 2VG5B 3MUMP 2CKWA 4DV0J 3IFEA 4V19X 1FKOB 1W25A 1NUEA 5LM7E 3SV3A 3NGUA 2HGMA 1S72S 2J6TA 2HS0A 1ZA2B 2CDRB 4J9VA 2AT1B 2FZKB 3KWMA 2V68A 4UUWA 3BJYA 2Y8YA 5D8HB 2RDIA 2JHEA 2OMLA 2VD3A 1ZAXA 3IRXB 4DR2J 1TAUA 4K5RA 3DRRA 3UDLA 1VFJA 5LSLA 2GGPA 1UVNA 1R8AA 3FCHA 3DOKB 3O8WA 3I56S 3MHYA 4YDDB 3BZQA 2X1AA 3HDSA 1U8WA 1HQ2A 2YKNB 1ZAVA 1UZDA 1S49A 4L72B 3W5YA 3MMAA 1WC4A 4DX6A 5KFBA 3K57A 3R9LA 3KJFB 4OZJA 4XTTA 1FJGF 3GZ7A 5AXMA 4I0WA 1LWXA 4QOTA 2ZH7A 3QFWA 2Y1RI 2EW9A 3W63A 4F3MA 1VQ7S 4LFBF 4B9LA 1CLFA 1VJWA 2P9CA 3G4SS 2J76E 1FHTA 4CO4A 2F8HA 4X66F 4IRDA 3LGHA 1EQ0A 2VKZG 5DJBA 1LXJA 2IJNA 4MYTA 4O4GB 1VQ6S 1HBMB 1S6PB 3FBBA 4ECYA 2E1CA 2OD4A 2A2DA 3MR5A 2ROGA 1RI7A 5ETRA 4UZCA 5D15A 5CCLA 2ZHAA 1I1GA 3Q23A 2E9RX 1TP7A 2FHJD 1LNQA 2BOPA 3BBCA 1RT2B 2IM2A 3IGNA 3LPEA 2C42A 2KHDA 4KV8A 5KFKA 4HI1A 4U8VA 1KSPA 3SQGB 4JI0F 2AYGA 4WF9Q 4N76A 4DG1A 5DG9A 3FDSA 1VQKS 3W7BA 3QIPA 1OQ6A 3B4DA 2VC1A 5J2PB 2QL5B 3OT9A 5D4LA 2OPSB 1NEEA 1RT6B 3J7YI 2ZE2A 4QCLA 2XI3A 3V4MA 3UQSA 1AXQA 2QA2A 1Q16B 2KHCA 1FEHA 4CLYA 1PILA 4ZK7M 4CO3A 4CO5A 5J1PA 4MIWA 3M8QA 2RJZA 3CJTA 2CYYA 4RUAA 1U0HA 3DMJA 4OYAA 1MROA 2HGNA 1RT5B 2OD6A 4TU7A 3W9HA 4K4TA 1DBDA 2GMHA 3KHHA 5KT7A 1YJVA 2PN6A 1KNZA 3L7PA 3ZZUA 4DX5A 3WQPA 2AU0A 2AEMA 4DFJA 2YKNA 2DGQA 4ANDA 2DITA 2CZVC 2MZSA 1X60A 3M4XA 1Q8KA 5I4MA 1KVJA 3ENQA 2DT9A 1O5JA 2V2VA 2LQBA 3AHPA 3NWGA 2RUSA 1FE0A 5KFMA 2FIUA 2B8QA 3NG8A 1TK5A 3OSPA 3IG1B 4ECXA 1RHRB 1YBAA 4JI1F 2PC6A 3DXSX 5HJYA 5CZXA 4HR2A 3HI9A 2DD8S 2POKA 3GG1A 3GWCA 3ET6B 4CM2A 5D6GA 5HROA 3ZTPA 1T9XA 1FA0A 1JLQB 1UW9A 4C0OC 5F8IA 1RKJA 3T1HF 2FTRA 2OAUA 3VAHA 3SQGA 3TUJC 4YHHF 2YQ1A 4JV5F 2B9EA 2ZOGA 4KTQA 1CBKA 3HVTA 3QT5A 1MWYA 1VC6A 2VC0A 3EZUA 2YKOA 3K5MA 3BPSP 3KHLA 2CZ9A 4PRFA 3LWLA 3MR3A 3GU0A 4ED0A 2CJQA 3M9MB 3SQOP 4G1PA 1VR6A 3OUYB 4DUYF 2VFSA 3CJKB 4O3RA 2QMXA 4EYHB 4HYKA 3FQLA 2RE1A 3ZTQA 2DYAA 4ES3A 5FLXY 1A7GE 2CJYB 5LOQA 3JS9A 3QWUA 1EZZB 2VPYB 1NKBA 1B3TA 4RNNA 3NS7B 4GMKA 4B08A 1QAXA 2MEWA 4P72A 3F73A 1SL1A 3CJRA 3OXLA 4RW8B 3LAKA 2RVJA 4EO6A 2DNLA 1YQHA 2V8GA 4EUVA 2ILZA 2FQQB 5HANA 2AEJA 4UUXA 3GIIA 3X3UA 3OSNA 4WP3A 3NS5A 2M9KA 3TVZA 3MD3A 4L3KA 3V6KA 1RP5A 4C97A 2W7PA 4TY8B 2FJBB 1FRMA 4FBTA 1KN6A 2QX0A 3BYPA 2VASA 3RUBL 5A0YB 5F8MA 2W7OA 1E6YB 5IC6B 4DLEA 1KS2A 4KT0C 1S48A 4F4ZA 2BXJA 4OHYA 3CJ3A 4PG8A 1X4DA 2EFQA 3TA0A 1SH3A 2DVIA 1IQTA 1N5VA 2CQPA 2FYXA 3T5KA 4ILRA 3M7VA 2D74B 3TAQA 3F56A 3CC7S 4B9TA 2E7WA 4XPEA 2BANB 4BC7A 4OQJA 4C8NA 3C14B 2DGXA 4BWMA 3UDCA 2Y3YA 3D2WA 1VISA 2BKNA 4ES2A 4E2FB 1G6BA 1DHMA 1UVKA 2DCLA 4H54A 4NLSA 2PGCA 2QTWA 3U1NA 3CMES 2FVCA 2UV8A 3MEGB 2HK3A 3MZIA 3FC9A 1MG7A 4Y2MA 3TEHB 3S7RA 4ZKAA 1F6TA 2XCPA 3H4BA 4DV1F 3C66A 4QIEA 2LEAA 3GCXP 2XY7A 4I2PB 1VQPS 5CYQB 5KT6A 5BXIA 1KONA 1Q81T 3KLIA 4DU8A 3HVWA 3I82A 2XO6A 1WHYA 5F0UA 1PJ7A 1S5ZA 3BREA 4DR6J 4A8KA 2ZM6J 2V0NA 4L76A 3GONA 1RXOB 3H5YA 3KHGA 3IM9A 3VAJA 4MKVA 2R8HA 2X3GA 3A1YG 1K44A 4RW9B 4XAKA 4DX7A 1RYRA 4GVBB 3FEYB 4CLLA 3CC2S 3BO2A 3I5BA 4M94A 4B3RJ 3GFYA 3NGSA 1S9FA 4USWA 1S10A 4C8ZA 5DGAA 4TQSA 3TWZA 2PMZD 1N52B 2EKNA 3L9ZA 4KHMA 4P2FA 1EARA 2JZ5A 1IBLJ 3G82B 2MZTA 1SVDA 5AJ3J 4TY9A 5ETNA 4GKKJ 2IVMA 4WCEQ 4KYZA 1GAOA 2CUYA 3TJ9A 2XY5A 4M5DB 4MIAA 1U45A 1RGVA 3AJ1A 2PD1A 2B3TB 4QR2A 3S01A 3VZHA 2EI5A 1OPIA 4N8NA 4WFYA 5JMNA 4DL6A 3Q8VA 4ZVPB 9ATCB 3JQMA 4OX6A 1SV5B 3RB4A 4AYBD 3JYTB 2QLWA 4L74A 1IXKA 3HCXA 2CQGA 3PX4A 2GA7A 1AFJA 4WJBA 2QO3A 3CEDA 1MROB 1FFWB 4LSNB 2DIVA 4JI1J 4LR7A 4KO0B 4DV0F 1L3TA 4ER8A 1N32F 2HIQA 4Y2CA 3CD6S 3QAEA 5SUHA 4R5PA 4QPTA 4NMXA 4ETZA 2CQHA 1VYAA 4LF8F 1JLCA 2B5JA 1WI8A 1T9YA 4URGA 3CCQS 2UU9J 2EBEA 4I2QB 3U1LA 2VJVA 1WHVA 1U25A 3AH6A 4DCOB 1TUWA 4CLTA 2OEJA 2OI2A 1VOMA 5A8WA 4KV8B 4ECQA 4RBVA 1NK8A 4MJKA 1TV6B 4FPRA 5DG7A 3LTOA 1R8HA 4URQU 3W2VA 3VAFA 2HVIA 5B0EA 4HDHA 1FDNA 1QAJA 3BEGB 3V4IB 4KSEB 4DV1J 3LUYA 3UNGC 3BYRA 4CRJA 5KFEA 1JJ4A 3QJPA 4AD6A 5KG6A 2BDPA 3W3SA 4KFBB 4LREA 5KFQA 1NJXA 1CC8A 2E44A 1N0UA 1MSWD 2LQ9A 4ZP7A 4ZPVR 5I3PA 4DPOA 4DR3F 1U1NA 1SB6A 3QGGA 4DN9A 2DR5A 4GKJF 2AV5A 2HAIA 3Q8RB 4FVCA 3DXBA 4ZVQB 2BJ7A 4X62J 1GEHA 2WB4A 4YP3A 1L5UA 1UPPA 4WYWA 2XLKA 2RNEA 4QYRA 3TUIC 4ZP9A 5M2PA 5KFXA 4UZBA 5G4DA 1U6BA 4QYZK 4USHA 1S6QA 3D1OA 3KJVB 4HHHA 4J91A 4P10A 1FWLA 2RS2A 2BQ3A 1IBMJ 2IA0A 4X84A 4ICLB 4ZA1A 2HNDA 4MT1A 5T7LB 2C2NA 4M5MA 4EZ9A 3LP2A 3FZBA 4F7VA 2P9EA 1N36F 1K1QA 3IS9A 1U47A 2UP1A 3MOZA 2J0WA 3EVOA 2B4OA 2CRLA 2GVDA 4RL1A 2IBKA 2UU9F 3WC2A 3PKMA 4ZVUB 4OLPA 2XTJP 3JSBA 2DBBA 3PV8A 1RT3A 3G9CA 4DPYA 1UJ6A 1H2VZ 4A8OA 2IMOA 1S9EA 5KFRA 1IQZA 2PEBA 5K14A 2YH0A 3DLGA 4IOBA 4QIWD 4QWBA 1J5OA 1W2IA 4ZN1A 1VQ9S 4F02A 4ZPAA 3M8WA 3BN4A 3ETMA 3GIMA 1TKDA 1EIYB 1S7HA 1TMMA 2GIRA 2W2NP 4YDXA 1NJIT 1UZHA 1NNDA 3ZZ0A 1RLDA 4ELVA 1B99A 3CCVS 2AMCB 2N3LA 1DY3A 5LSOA 1UCNA 2MQ8A 5C5JA 4JI4J 4F04B 4ZN3A 1X4BA 1FNMA 4I4BA 4LBPA 3SSSA 3R1LA 2BVZA 3VQSA 3AB2B 5E0OA 2QMWA 2W4DA 3O1LA 5J2QA 5HQLA 4A48A 4OYBA 1U2RA 3BN7A 4OLOA 5CXTA 3LO3A 1WC1A 1WKKA 2DK2A 1HWUA 2VG6B 4QWCA 2CQ4A 5HN0A 1WEYA 2EWHA 5J2MA 3C6UA 4DV2F 3OD2A 1R6VA 5E3QA 2W2OP 3DMJB 4PZVA 5JVGQ 4OHZA 3D0IE 3LA0A 4X65F 4MFBA 4C2MA 4LF5J 1RT1B 2OTJS 2GVZA 4XDCA 1CJKA 2DJWA 3EDQB 4LUBA 5C25B 2YNFB 1BLUA 2XLIA 1JLGB 5KFUA 2R3VA 3K59A 3BO3A 4USVA 1Q95G 1XERA 3J81U 1LK7A 1S1WB 2BOAA 1VRTA 3JQJA 3PACA 4LRBA 5K8PA 5LJ5Y 4FN5A 1W7WA 2DGSA 2NSCA 3IM8A 4DHVA 1FNXH 3DDKA 5KG0A 4MK7A 2ZC4A 3QZ8A 1SKRA 4OI2A 4U7UK 1TL7B 1F9EB 5A8WB 4Q8EA 3C8YA 4I69A 1HNZF 1IKWB 3PDNA 2QLXA 3DC2A 4GO5X 3DOLB 2J0QD 3OR2A 5CHCB 4MAKA 2B5JB 3A3OB 4NPOA 3POTB 3QGPA 1B0PA 5EX0A 3PIOQ 3N6NA 2G0IA 5I3QA 2WSCC 2FLOA 2G13A 1SUQA 1FRIA 3ZZYA 4X4RA 2R7UA 5F8JA 1NSAA 1KHWA 3KHRA 1TL7A 5ETOA 5AE3A 3I5AA 4PPDA 4RUCA 1RACB 4OYXA 3C19A 5D78A 1FXDA 4P74A 3TX8A 3GLJA 2XMWA 4OX8A 3CNQP 3TYTA 4F3QA 3QJLA 2AYMA 1S1WA 2RMLA 4KE5A 4ZVOB 3SDEA 2PI4A 2QLBB 3EXCX 2HMIA 4ZVSB 3V6DB 3MEEA 2ZWPA 5D3GA 4HTIA 1SJQA 1FRLA 1HWIA 1V3SA 1YVFA 3NOCA 4ETXA 3CC4S 2Q66A 1C1BA 4X65J 3PYEA 3C16A 4O3PA 4OZNA 3F44A 3OTEA 4ECUA 1WOSA 4ED8A 4Y65A 3ISZA 3NS6A 4NRUA 1DTQA 5J2NB 2FZGB 4Z7CA 3IA0A 1IVZA 3LP1A 2AX0A 1FX4A 2V4JB 4ZVFA 3A12A 4DZDA 3C6TB 1EAYC 3PRBA 5GADI 3Q8QB 1QVGR 1G2EA 2JEIA 4OZ3A 1R7IA 1ITPA 2Q6BA 2JJ4D 4PXCA 1RWPB 1LFPA 2LKZA 3UCUP 1R0AB 3CULA 4H4KC 1L3VA 1Y3KA 2GQ2A 1RU2A 1D9DA 2Z30B 3D9BA 1NZAA 4I2PA 1U24A 2QE5A 1X5PA 4RW6B 1TZ0A 3SCKE 2WZ1A 4DL0C 5ETTA 1RTZA 5CYMA 1TVRA 3MM7B 1R89A 2EPIA 3R5BA 5JXSA 3UVJB 3VGVA 2OSQA 2YNIA 1FKPB 1JKHB 1XBWA 5A8KA 1SQGA 4X4SA 3Q2TC 3QAUA 1IKXB 1YJTA 2GO8A 1R3NA 2UVUA 5KFOA 5F41A 1S9EB 3KLGB 4J9MA 2KG0A 1Q78A 2RHSB 4TU8A 2ALZA 1IBMF 1CQNA 1IBLF 4C7QA 2HK2A 4YR0A 5A8RB 4PEOA 3DLHA 1NB7A 1PG5B 3N5BA 3BB5A 1MMDA 3UCZP 4KR0B 1GX6A 3PY8A 2L08A 4AXIA 2QYCA 3GMGA 3TO8A 5IM0A 1TKTB 2KRRA 1FDAA 4RNHA 5E33A 3OVSA 4I6AA 2FB0A 2N4CA 2QFJA 1HPZB 1OYEA 2FGCA 4DPXA 1TR0A 1N34J 4JBCA 2IAJA 4ECTA 3UD3P 2E5LJ 1T05A 3KLEA 1X5OA 5KFPA 5FLXU 4B9VA 2Z57B 4NLDA 2WVCA 5DG8A 1XR6A 4LIRA 2FJWA 1OWXA 2UXCF 2C22A 1U02A 4RW8A 1TAQA 2A18A 4LFBJ 2MZRA 1RHUB 2OPQA 5L8RC 1BGXT 3VVUA 5KFLA 5DDQC 2JNJA 1UW4A 4ZVHA 3OLBA 1NJWA 4P2MA 3B4MA 5B0FA 1YZ7A 1T94A 1C0UA 1TVRB 3FCWA 3FK4A 1UJ4A 4WKYA 4DPUA 3EGZA 1FDDA 2JH3A 2W4CA 3K5PA 3LPYA 3NBPA 3O6QA 4U96A 2LECA 1U09A 1WWHA 2XQCA 2MLZA 4C8MA 5D4OA 3MR6A 2ZD1A 3V6HA 3AJDA 3BKFA 1NB2A 2Y0SD 4CO1A 2IC3B 3PFOA 1REGX 2AJ0A 2LVWA 5H1SV 1I3OB 2B9WA 2KYZA 1U7LA 2LQ8A 2VFTA 5A6PA 3HSDA 2D3O1 2VBXA 1R8PA 2IM3A 3WIUA 1HNXF 2PFDA 3CDBA 5K9FA 2DNMA 1KLMB 1S1UA 1FRHA 1U6ZA 2HKEA 4HH1A 4M5JA 4ZCLA 5B7WA 4NLPA 2MGZA 1TL5A 3OL8A 1N5QA 2VICA 1HBOB 1OY6A 2JOQA 2YWFA 3QRRA 2VDHA 3P45B 2V5HG 3DU5A 3FNNA 2BJ1A 4RWXA 4Q0BA 2HBYB 2VG7A 4ZP8A 4BBYA 9RUBA 4PQUA 3MEEB 3I32A 4RJVA 4IQXA 3MTKA 2VQFJ 4B9NA 2K8GA 3MFHA 1S0OA 4UOGA 1HMVA 3PW2A 4RW7B 3VTIA 2F65A 3BBBA 1R8BA 3FMBA 4RPFA 2BABA 3JAMU 4Q44A 2DTJA 2FJEB 1B7YB 3KJNB 3PG9A 3H25A 5EWFA 1W2BR 1KD1T 5DQHA 3UN5A 1N4LA 1RHQB 2VFUA 2QT7A 1SV5A 3FRZA 4O44A 4PWUA 4WYLA 2ZDOA 2XWYA 2K2PA 1M5HA 2LDYA 3BF4A 5KG4A 4F4AA 3MMJA 4DR1F 4OZ2A 2DB1A 2EK6A 1Y11A 3T9NA 3TA2A 1Q8BA 2R7XA 3HKZD 3I55S 2H48B 2R2SA 2NXCA 1GMUA 4IFVB 5KFJA 1RWUA 4OYMA 2BRKA 2EEYA 1N34F 3TUPA 2BKOA 1WSRA 4ZVRB 3THTA 4U6PA 4A8XA 1X4CA 4CQ1A 3OJSA 3C46A 3ELHA 3OXFA 3GE9A 3OTCA 2J8AA 2VBWA 1I94F 4FP9A 1RK8A 1SQEA 3MCSA 2C2MB 5A76A 2LMIA 2YWHA 4JI7F 2IRXA 2VFRA 3GV5B 2DXDA 5HJXA 3V6JA 1SL2A 4O3NA 3KLIB 4DR7F 1UTAA 1A0OB 3PHTA 1YLXA 4J9PA 1HNIA 2YTCA 1HBNA 3WBZA 4X62F 3X1LB 4ZPCA 1PKUA 2YNFA 3KLHB 1T03B 3HD1A 3MI7X 1BC6A 1RBAA 3ZZZA 1RT1A 1HHQA 1KQSR 3U7JA 1VQLS 2DR6A 2IDEA 3UO0A 1ZM2A 2NPFA 4Y2KA 1ZPWX 2HVHA 3GQCA 1OSCA 3Q8PB 3C6UB 2AP6A 2GHPA 5BYRA 4RNMA 3RAQA 3CW2C 2EC0A 1OJ4A 1QM9A 5BYQA 1WTBA 2NREA 2MJNA 3DGPA 1S79A 3GJRB 1ZS6A 5ETVA 3D6HB 4MYUA 4DFMA 1QDUB 2WVDA 4CT8A 5AE1A 2ERRA 2DEJA 1LOUA 2U2FA 3DRRB 1DLOA 2BKPA 3JTPA 3EZ5A 4C9DA 4ED3A 4FF1A 3MGJA 3LAMA 4TN2A 3SCIE 5HVHA 4IRCA 3MOJB 4DQSA 2ROPA 3KK3A 2VPZB 2AGPA 1RWWB 2YX4A 4K4YA 1VGYA 5DM6Q 3MAAA 1NDKA 2XZDB 1TL3A 3PEHA 4OL8A 3EPIA 3TZZA 2HVZA 3GYXB 1U6FA 4LF4J 2GQCA 3I4HX 2YKQA 5L46A 2K3KA 2R9LA 3HF5A 4DUZF 3AOAA 1K47A 3D3BJ 3A13A 3HMJG 3CE8A 2XZTB 2JLFA 4QR1A 2ASLA 3EGVA 1T9UA 3FKBA 2OEMA 3H2LA 4KGZB 3OR1B 5FDLA 2HS4A 3MMCA 4AFFA 3CCJS 4DX8H 3DKDA 1TL1A 3S1TA 3MR7A 5C2CA 4G1QB 1U49A 2FDNA 2RRAA 1D9FA 4KPYA 4WE1A 2IBOA 2X1GA 3NL0A 5ITHA 1LFWA 3P6YC 2ZKTA 4DV7J 4LQ9A 2J6UA 2NXEA 1Q4RA 2YNGA 2DKOB 4JI2J 3W61A 3Q24A 2Q43A 4ID5B 4M63A 1HWJA 1IKYB 4O4RA 2HWTA 2E1MC 2PI5A 3A4TA 2RAQA 5IWAF 2B56A 2M70A 3VWSA 2V9WA 1RADB 1C1BB 1JLAB 2NSBA 3QT7A 4KH0B 1NK7A 3LH2S 1C0TB 1HW8A 4TLRA 5HAOA 5J1EB 5EWGA 1K0VA 5ETLA 4B3OB 1WEZA 3A8EA 1OO0B 3H98A 4X4NA 1Y3JA 4P73A 2FHMA 4RKUC 5IXUA 1T8EA 4CWBA 4IRKA 1J27A 3SMZA 1HNWJ 3W2VB 1RZMA 1HARA 1OQ3A 1UAWA 1WKJA 2W4PA 3P5BP 5KT5A 3V81A 1B64A 3TQEA 4YQWA 4NXMJ 1Z4UA 2ADBA 4QJVA 2BX6A 3V5RA 3TZYA 1JNRB 4M5KA 5K8MA 1GTHA 3W1YC 5I3UB 2ZHBA 4C8LA 2HW3A 1S7IA 1TUVA 1XMBA 3OL7A 2QRRA 2KT3A 1HI8A 4GVLA 2MHEA 4H4KA 4DXLA 1FF2A 3KXDA 2DO0A 3M8PB 4I2QA 4N47A 1WC5A 3MPWA 2ZVSA 3I4PA 3SIPB 3THPA 1Z2LA 1B0TA 2NXNA 3IC1A 2C2KB 4NLQA 5B0BA 2XMMA 2WK4A 3T9ZA 1NKCA 2MKKA 1YZ6A 3PO5A 1K0TA 4RUBA 4KPCA 4V1Ak 2EFVA 4H4MB 4DG1B 3VZIA 4U8YA 1S6OA 1KVIA 5GAGI 2W9CB 2DGOA 3N79A 5D4PA 2F5GA 3CWJA 2Z56B 3NGKA 5CAAA 2BJ8A 2O01C 4CZCA 4DOZA 2N7CA 2CPFA 3GILA 2AJFE 3J7YU 5KFCA 2K7JA 1VIXA 3TZXA 2D7SA 2DNZA 2ZBQA 4O3QA 3HVRA 2AX1A 5E3CA 5ETMA 3PJWA 4FYWB 3DDNA 1HBMA 1S6PA 3I87A 4KKOB 2IJFA 4NLOA 2KG1A 2J9DE 1LWFA 4J9RA 4F50A 2AGQA 4B3TJ 3RR8A 2HG4A 2WRMA 3K8WA 2MQLA 1UVLA 2F40A 3ZO7A 1RWXB 1BMQB 1UFKA 3ITHA 5C25A 4IUFA 1NSKL 2MKHA 2G9OA 3KUHA 4EYIB 3G82A 2FLNA 3RB6A 4UW2A 3PCOB 3EXYA 3TZWA 3PX0A 2ASDA 2RF2B 4ZPDA 1LV5A 2QL7B 2IDLA 3G96A 1N33J 2HHHJ 3PYDA 2WTFA 4GC6A 1YJNS 2ZH9A 3EYZA 5E2QA 4RW9A 3G71S 3VGUA 2XMKA 3H5SA 2WVFA 5ETKA 4OZ5A 1PSDA 1AT1B 2V34A 3EDRB 4NMLA 1WC6A 2DXFA 1BY9A 4ZLLA 3W8GA 4X4PA 4DQIA 3CGIA 4OV1A 1NAQA 2C2OB 3TAPA 3R6LB 1X9SA 3V2UC 4C8KA 2X7IA 1YGYA 4B3MJ 3T1HJ 4LQ3A 2HAFA 3LW5C 3TR5A 3G6VA 1MN9A 2XZWA 3HHLC 2IYIA 4KH1B 4JUZA 2RIJA 3ZXWA 2HNYA 1YDLA 2M88A 1F0XA 4KQZA 4USMA 1M1GA 1U4BA 4ED5A 2RS8A 2A0FB 2LQ5A 4N77A 1F2GA 3OHBA 5JVHQ 1YIJS 1HBUB 1EP4B 3OPKA 3TAMB 1FVSA 1NBEB 5KG2A 2NR0A 1C1CA 5K14B 1AW0A 2YWWA 4ZLNA 1KTQA 1HL6A 4ANCA 1JLBB 2EG2A 2OJ3A 1C1CB 4NXMF 2RQMA 4AL7A 1S9GA 3KKFA 1H72C 1QUVA 4K0KF 3B6BA 2BE7D 4E98A 3CJ8A 4M95A 4USUA 4NLYA 3RBZA 1FX2A 4X64F 5E7OB 2ZNYA 4CLKA 3J80Y 2QL9B 3IS9B 3HKWA 4U7UD 2BZ2A 3LP2B 4PPZA 3KK3B 4LMZA 1GXTA 2HZAA 3K58A 4DFPA 1T9VA 1V9OA 1PCAA 2MYFA 2BACA 1H0HB 2DNQA 2DR8A 4LJMA 4NASA 1PO6A 4DL4A 4EFAC 4TY8A 3OTDA 3ZTRA 1VBXA 8RUCA 1UWBB 3NMAA 2CPYA 2CJKA 5FJ4A 2XGPA 1DRZA 4JI5F 2CQ2A 1FFSB 1NM2A 2HLUA 2MTLA 2OFHX 3A8JA 4AL6A 4A8FA 2X1FA 1VRUA 4M5IA 3K89A 3HZGA 1JMTA 2OPRB 1T05B 3M8SA 5KFIA 2E5LF 1SXLA 4DV6J 2Y8WA 1PYSB 3P4UB 4OFZA 1Q0NA 3TRGA 5IM0B 2P8IA 3LALA 1HYSA 3N0VA 1C4AA 4H4OB 1JLFB 2J7KA 1F5AA 3NNHA 3BDPA 3QFHA 4Q45A 1GMWD 3A8IA 4TNOA 2C28A 4PR6A 2HFOA 4AE5A 2HPUA 4HHUA 2P6SA 3DRSA 3NOGA 2PE8A 1CSJA 3ADAC 2C1EB 1NH8A 1TTHB 5KT2A 2YQ0A 4CT9A 3T5JA 2LXUA 3GFXA 2L9NA 2KB2A 3GPAA 2BV3A 3MAHA 3MF5A 2HNYB 2MLYA 2VIHA 1IJFB 5JJBA 3DM2B 1JLCB 1FE4A 3P96A 2XGQA 2HQ3A 5E5NA 3BSOA 4DQRA 3CD5A 4LRAA 1AZSA 3M8PA 4QWAA 4ZJQA 1KC8T 3OQ2A 1QE1A 1EB0A 1VRQC 1TELA 2YVSA 4G65A 4LBIA 4B02A 1V5VA 3MCOA 3TP2A 4YUDA 3CDAA 4ZHRB 3ZTSA 4YHHJ 5I3UA 1R0AA 1XC9A 4QW9A 1Y7PA 4M5GA 1IR1A 3KMSA 2MZJA 4P71A 2CADA 4QR0A 3NEKA 2GS8A 2IA6A 3HO1A 4AUKA 3KOAA 2DPIA 1NJYA 3SEOA 1KQFB 2GX8A 4PWWA 3A8KA 1H73A 3MFIA 2VFVA 3K8VA 4DV4F 1SJ3P 4EWTA 4CNYA 3VAIA 4B3SJ 2A10A 2Q6CA 4MKAA 5KFZA 2XG8A 2RRBA 3H0PA 3OV7A 3ZZRA 3KLFB 2G1DA 2VPXB 4LF7F 3WHIA 2XHCA 2WONB 4ZVTB 1WELA 4RW4B 2XNRA 1U1RA 4A8SA 4ZPWR 5J2PA 1VCTA 2OUGA 1KBRA 1S1TB 3IR6B 4ID5A 3CD7A 5LT5A 1AUSL 2UXDF 4ZCIA 3UWTA 6FDRA 4OI4A 3J7A1 2YNGB 2AWZA 1J2VA 5JUMA 2W7AA 5MLCV 3T1YJ 1RWNB 2V2QA 1FVQA 1JK9B 3I31A 3R97A 5C42B 3OJUA 1XMOF 1SH0A 3RBDA 3FRYA 3MM5A 3MUTP 1NXIA 3KG4A 5AE2A 2LEPA 2OHDA 1IBKJ 5KG1A 3T1YF 1EJ7L 3R2CJ 3ISNC 2KXFA 1F9HA 2YKMB 3Q83A 2KYXA 2CNNB 4CLUA 5KFDA 1HYSB 4OIXA 2QFIA 5HQMA 1U2FA 3RTVA 4X66J 3J7ZT 1I5OB 4FXWA 3AAWB 4QU6A 3GTYX 2CZ4A 1SJ1A 3QRQA 4EU0A 5F8GA 5L1IA 3LWMA 1QVFR 4LF6F 1YJ7A 4WP9A 1WACA 1IJEB 4Y6IA 2KFNA 2ZKUA 1LW2A 1QTNB 1RA7A 2OMOA 4PG6A 1DURA 4BWJA 1SI9A 2AQ4A 1Q53A 2I38A 4Y2AA 2ASJA 3CCZA 4HVZA 2CJBA 2HURA 4EZ6A 2XB2D 4JYAF 2O67A 2ZC3A 4CLZA 1IUJA 4DPTA 4IH5A 5ETQA 5DQIA 3M05A 3W2WA 3MM6B 4LRFA 3JSMB 1DQ8A 1YJRA 2D69A 2VHGA 2Y9HA 3KG0A 3CCTA 2KZZA 5HQ8A 3IRXA 3W9IA 4R0JA 1N6QA 3NNCA 2UUBJ 3ICLA 3IWXA 3PJXA 4C98A 3DLKB 3P5TL 4OHWA 2L41A 3HT3A 1EX8A 1N8RT 1NDPA 2YY3A 3DLJA 2DNKA 4OYWA 2GZOA 2QLJB 3W2WB 2UUAJ 1GXLA 3NMRA 2ADCA 2VBZA 4LVNP 1IKYA 4Y0FA 2MLXA 2F4VF 4NOHA 1LQ9A 2RKIB 3D67A 3W66A 4CH1A 1XR7A 3J80U 3HJVA 1Q5VA 4RX6A 1DJ0A 3L3CA 2ATCB 2BEFA 2DCUB 3CTRA 5A2QY 1FT8A 2I2YA 3ZNUA 4YFUA 3H8YA 1Y5NB 2JLGA 4EBEA 4WPAA 1CJVB 2B7CB 3QSIA 4DQPA 4IH6A 1N32J 4G1QA 3DRPB 2BE9B 1XNQF 1RTJA 1FCAA 2MSSA 1YWXA 3DOMB 3N9UC 4IG3A 1HNIB 3CJKA 3OVBA 2KZMA 1RWOB 2IM1A 2YKMA 3DOMA 2J5AA 3GR1A 3CXCR 2I5JB 4DV5J 4WKRA 4R8UA 2HHHF 1SKSA 4YMEA 4C0HA 4IR1A 3B82A 3NRBA 1Y5LB 2OP5A 4OYOA 4OI1A 5CD4H 1MMNA 1VQ4S 2RQKA 1FERA 4I67A 5KFYA 2Y0BB 4GO7X 2I9SA 2V4JA 3DHWC 2D3ZA 2CPEA 5J1NA 1DTQB 2PA8D 2ZBPA 2KT2A 5DDRC 3I9V9 2MQQA 3LP0B 5J2NA 1JNZB 1U8SA 4IQMA 4ITSA 4UY8T 4F4WA 4PCQA 3I96A 2RF2A 1VBYA 3ENAA 3M9OB 2F9DA 3IWLA 5HO4A 3KDOA 4J37A 3R1HA 2QC3A 1LK5A 3FFIA 2GAGC 2IMWP 3ILJA 3KLFA 4KGXB 5KG5A 1AFIA 5H9FK 3QPIA 1RHMB 3C15B 3MEDA 3QGIA 2R7VA 2YXLA 2YWGA 3ZFVA 2DNPA 4A8MP 2FVRA 5GADU 4NXNF 3H5UA 1ZM9A 2YNHA 3R7BB 2IVFB 4NA2A 3CCUS 1RAJA 1X4EA 2G1HA 4KGVB 4F2SA 1N88A 1Q5YA 4K2JA 3PJ9A 4A46A 3PVXA 1N54B 2PEHA 5G0RB 4EI2A 2QLFB 4F25A 2OSRA 1E6VA 3F41A 3TA1A 2W9CA 5GMDA 3HM9A 1YJ9S 4U7CA 4TQRA 4J9KA 1SUQB 1JLEB 3BS9A 4ENOA 2UVRA 4PQUB 3TQ1A 1HD0A 2KVQE 1H74A 1YG0A 5IT0A 4A8WA 2KKHA 5B09A 3W64A 5HP1B 4AXJA 2GW8A 2HFNA 1TU0B 3UR0A 3H42A 3L4BC 1M90T 1RAEB 1DTTA 2O5DA 1RAGB 3I0RA 1K9MT 2ZFHA 3R8YA 2EFGA 4U9RA 1D9AA 5FIIA 4IG0B 4F26A 3KTQA 2E5JA 2R7SA 4K0KJ 2HQIA 4NLUA 4ECWA 1H7XA 1H98A 1HWKA 2RSQA 3DRYA 2OEKA 4OZLA 4DV5F 4M5HA 1GMVA 3SZ2A 2K3IA 2W2PP 2FHOB 3D28A 4I7FA 5HATA 1XTZA 2O66A 4ZVGA 3TUZC 4AQYJ 1KHVA 3JTOA 4R0EA 3GJTB 3BV8A 2M4MA 4I64A 3UDEA 2XSJA 3OFGA 1X0FA 3FUYA 4IFVA 1N5YA 3QBCA 4O4GA 3EGWB 3G8QA 5DDOC 1YJUA 2V8DA 3QT8A 5AXKA 5F3ZA 1QLNA 4K50A 1S97A 4OYPA 3MXHP 3M6VA 5HVGA 2XYHB 1ZETA 1JXEA 2IFXA 2LDIA 2J8SA 2OPRA 4NYZA 1SPBP 2QV6A 1CG2A 2ABYA 4XPCA 2ZJQQ 2UUTA 1FXLA 1GNKA 1AA1B 5J2MB 1NZ8A 3JYTA 1EKRA 3K5LA 5LMNF 3M6XA 5GMEA 2RQ4A 4PWDA 1F9FA 4TXSA 1FWPA 3FZ2A 3O2IA 3KLEB 3MUVP 2ATLA 1N33F 2WSEC 1ZTWA 4RW7A 3C15A 2ASYA 1WTFA 1RISA 3K7RA 1VS3A 4UOHA 2MZQA 4KGKA 2H4YB 3M2VA 4Q0BB 4TLQA 3KK1A 3QRPA 1URNA 3MM8A 2W2MP 3EE3A 4B17A 3NCQA 5HMWA 4P7TA 3T5HA 3SFGA 3KNAA 4ATNA 5A8RA 5D0GA 2MQPA 1S1UB 4FYXB 1KWMA 2GMLA 4WBFA 3M1VB 4F0MA 4DF8A 2WBRA 1QSLA 3MECA 5GAEU 1U1LA 2C2DA 3HXMA 3DRSB 3LQVA 4GKJJ 4X4TA 3GJQB 2B6AB 4OHVA 4QBUA 4DMZA 1PC5A 4G3IA 4TVAB 1RBOB 5DZ6A 3MCNA 5A8KB 1HNZJ 1IM4A 3H40A 3UVJA 2K1RB 2PIIA 4OX9J 1PBAA 2ZOMA 1JLFA 1UWAA 4AT1B 5T14A 2H65B 4FNIA 3GG0A 2FHJA 1H7WA 2CDQA 2MQMA 4IFYB 4RW6A 5D0EA 4F0HA 3KLVA 2R2UA 3P49B 1ULRA 4KAIA 4UOCA 3M2VB 4Z7YA 4YB6A 3U02A 1WUUA 4CI0B 2XMUA 1SC6A 3M2RA 3GIKA 2CQCA 2P5VA 1RHJB 1QAIA 2J9CA 4IH7A 1M5PC 2GO9A 2UXDJ 2VZ9A 1MW7A 1WD6A 3FMWA 1V5IB 2HZCA 2M3DA 1D09B 2AIRB 4JV2A 4PWDB 3AD9C 3OW2R 2FY1A 1CVJA 3Q22A 2JX2A 3L09A 2CPJA 2CPDA 1R6YA 3KDNA 2MHNA 2H51B 2O3DA 3VALA 2XULA 3PIPQ 2LEBA 5BYSA 3J81j 3KJQB 3T5LA 3M8RA 3MEKA 4X4VA 2V2ZA 1SC3B 3D6FB 5EWEA 4DL7A 1XMQF 1N5SA 1WJ9A 4IFYA 3U27A 5EGYA 3MM6A 3FSYA 1WDTA 2C3OA 3DI6A 1ICEB 1N5YB 4WZMA 2KXNB 3H4DA 1WF2A 5KOXA 2UVWA 3V4IA 5KFAA 4U67Q 1PYTA 1QD1A 2QSWA 3AB4B 2H5JB 3U1MA 3BBFA 1UA0A 1LW2B 1S0VA 2V6AA 5HBMB 1R8CA 4HKQA 5LJ3Y 4BCAA 1NK9A 2E5HA 4I68A 4C6AA 2H5EA 5GAHU 4QWEA 1EP4A 2FJVA 4MKYA 2FJXA 1RA6A 4JYAJ 1WKLA 1GH8A 5BJRA 4OI0A 2K06A 3HVAA 4ILMA 1VK3A 2XMJA 5F9LA 5F9NA 1VQOS 2QA4G 2AF6A 2WAQD 4O0NA 3MPVA 4DSLA 2ACMA 1N36J 1TUGB 2JC1A 4FVMA 1VC5A 2YWEA 2GHWA 3DOLA 2FVQA 1ZOTA 1EHWA 4CCHA 1XNRF 3RBEA 4XK8C 1S77D 2FC9A 2PMHA 1ZYQA 2AEFA 4Q8FA 3HVTB 1NPPA 3BQ0A 2NYHA 3BGOP 1BQMA 1UJ5A 3GIRA 1WHXA 2I8EA 3D1HA 2H3EB 4DFKA 4LF4F 2RQCA 1CPZA 1PBUA 3KK2B 3UNYA 1X7VA 4UF4A 3HP6A 2YNHB 3VAGA 1SC4B 2EC2A 3R27A 5C7PA 2ZZMA 2V2KA 3AD8C 3LOUA 4W4MA 3UDVA 1K1SA 2FUG9 1HMVB 2PA3A 2CG8A 2DISA 3MEDB 4M5NA 4RW4A 5H9EK 2CPZA 2ZUAA 1F3FA 3GV7B 3KUEA 1X4HA 4DV6F 1CJKB 1VMBA 3FFIB 5EX3A 3W60A 3WIVA 4DBQA 2HEKA 3QT6A 1BXNA 2B9YA 3VV2B 2HHWA 4NL5A 1LWCB 2HHPA 2XSJB 2HFVA 3PR5B 3CJ4A 4K4SA 4DL5A 5C42A 5KFFA 3KK2A 1S1XA 2OTLS 3HLUA 4OV6A 2G2YA 3BKTA 3MM9A 2BM1A 4P9SA 2HGLA 4OI3A 3PXGa 1X4GA 3KUGA 2ZITA 2BYCA 4BLGA 3RAXA 4J9NA 7AT1B 5IT9U 4CH0S 3NNAA 4ZHRA 3ILIA 4D3GA 2ZUGA 4NYPA 1I94J 4R8UB 1KVKA 2ZD1B 3ZZTA 4Y00A 5IWAJ 1N5TA 3HHLB 2F8MA 4ECVA 3CUNA 4F4YA 4DSKA 3VVTA 3UI3A 1RE1B 3RZAA 1GQEA 1ZPVA 2JRSA 1YKWA 3BDEA 3OFHA 3PEJA 2NLWA 3IBCB 4PG4A 4ED4A 4YB5A 4YS2A 3SSRA 3EX7B 4LR8A 4DV7F 1YRTA 3KNGA 2DXEA 2NUUG 3S8SA 2ZJRQ 1FD2A 2IRYA 4EK2A 4NLXA 1RSCA 2I6WA 3V81B 3K0JA 2BANA 4RU9A 1XWLA 5F8NA 4USTA 3VAKA 3BR8A 4G1IA 3CDEA 1ZZNA 2E1PA 4A8QA 1PIEA 1UVMA 3E01A 1SL0A 1FWKA 2AJQA 2M8HA 2EFPA 1RHKB 1RCXB 3E2EA 1BD6A 2EFNA 3EJMA 2J7WA 2QSFA 1JJCB 2CWKA 2RRNA 4KY3A 3JSMA 2DNYA 1OIAA 2HIYA 5LSRA 1VRUB 2MJUA 3A3PB 1F5CA 3ENWA 1ZM4A 3LP0A 2F7VA 4Y34A 4DUYJ 2VG6A 5K8OA 1NSPA 2LFVA 2NXUA 3FVYA 3MMAB 2MMYA 4ZCMA 2OO4A 2JVOA 5B0GA 1S6UA 1DQAA 2XLJA 4O0IA 2CQBA 3R6GB 2ZH3A 4X4QA 1UA1A 2FGOA 1MU2A 2JFDA 3AXKA 1IKXA 3A3NB 4OHXA 4WE1B 4ANEA 4IDKA 3NLCA 3OL6A 1FKPA 4HLBA 4JI8J 4QIVA 1T03A 3FEZA 1NPRA 2DGVA 1NU4A 1F3VA 2KO1A 4YEAA 4ZPTR 1HBNB 4NEYA 3NKYA 1UKUA 4DSJA 2HS3A 3BPDA 1RBLA 1VDHA 6AT1B 1Y9OA 2CJXB 2HHUA 1VJQA 1FTCA 3OR1A 4NZ7A 2YKAA 3EPGA 2R7WA 1U0SA 2R42A 1JB0C 2W9BA 3DLGB 2M52A 5HI7A 1JXLA 5ETSA 3UN3A 2ZEJA 1D8ZA 1KQGB 1LEOA 3ENVA 3QATA 1FDBA 4ALZA 3L7OA 2ZH4A 2UUWA 4LFAJ 2YBVA 1LKZA 1U1KA 1PYOB 1S1XB 3IGVA 4W98A 4BHQA 4ZMMA 4NCGB 4ZOSA 2N7YA 2Z2LA 1S1TA 2MPUA 3D6TB 3MAAB 4S0MA 4EMDA 3JAMY 1A9NB 2HHTA 2DHSA 2XS7A 3M8YA 2HBZB 5C2GA 3AOBA 3GSDA 5KT4A 5GAHI 1ZH5A 1YITS 3RB3A 3KK1B 1TFWA 4L73A 2E1RA 3FJ2A 2MY7A 4R5PB 1RYSA 2IVYA 5D0HA 3SSQA 1N6QB 1EETA 1FXRA 3M6UA 1YRUA 4NZ6A 5KFWA 3GV8B 4WTOB 1KEKA 3FBCA 4DQQA 3T3FA 3M2UB 1IKVB 2HQGA 3LGMA 3L7UA 3PTWA 2COLA 4NX9A 3KMQA 4J9QA 5M2UA 4NA3A 2LLZA 2K7KA 2WVEA 2PSZA 4RU2A 4OX7A 5D0RA 3ZC4A 3HT0A 4WK1A 1NK5A 1KFSA 3QGHA 4HH0A 1XNRJ 2QN6B 3R5CA 1QE1B 1P6TA 4IO9Q 1VQ5S 1BWVA 1TKZB 4KC5A 4LR9A 2MQOA 2V67A 3DU6A 1HBOA 4PUOA 3SYZA 5CA5A 3HK2A 1X0PA 2GV1A 2MGZB 4A8YA 2HFSA 1HIYA 2CQ1A 3HX9A 2M2BA 3US5A 2GMJA 1TV6A 5CABA 3HJFA 2VDIA 1YRXA 1FRJA 2L3MA 4NI2A 4JI6F 2XC9A 4BC9A 1JIHA 2VJUA 4DR5F 1N48A 3IWNC 3G6XA 2ZH1A 2KJWA 2GJ2A 5B0DA 2A1BA 2KN4A 1WC0A 2V4RA 2R7RA 4JI3F 4HTJA 1FJ7A 2B8PA 1Z2ZA 3IAS9 5HVFA 2BA9A 4DV2J 2Y1JA 3KG1A 1KTVA 2E66A 2QA4S 1XMQJ 2CQIA 5THWA 4R25A 2XWXA 1SQFA 4CH7A 3B8HA 4NZ0A 3Q8SB 4ECZA 4IR9A 4LSLB 3ETOA 4V19J 2BJEA 2FY8A 5K5MA 4F36A 1FKAF 4MFBB 3F0NA 2LQJA 4P52A 3T41A 1CEZA 2FVSA 2QA1A 1TK8A 3CCRS 2J0XA 1RB0A 1N0VC 4IOCQ 1F2HA 3QO9A 2GIFA 2KVIA 4O44B 2NZ4A 3T6BA 3T6JA 2HHQA 3BQ2A 5CD4A 1DARA 3MTJA 2HHSA 1S4EA 2W2QP 1R0CB 3QLHA 2B43A 1WOPA 3DN9A 1W26A 3HHKA 4DCPB 1HHSA 2B51A 3EM1A 2BE2A 1Y4ZB 3BGUA 3WZ0A 3QYYA 1AZSB 5GMKa 1VHIA 1JLAA 5DQGA 4WFXA 5DZ7A 5A0YA 1P1LA 4NE9C 4QZVB 1RTIB 1VQYA 3DM2A 3K2YA 4Q2MA 1X8DA 1URRA 4FYVB 3SV4A 2H1YA 2ZBRA 3DYAA 5CH7B 5DDPC 3HHDA 1HNVB 1YK9A 3CB4A 4ELTA 2KFZA 5IT9Y 2CQDA 3SCJE 4JI0J 2D3UA 3OTOF 2DR9A 2M8DB 3QQCD 2GCFA 4DL2A 1VQSA 2NQPA 2JC0A 3Q89A 1UL3A 4I6YA 4ECSA 5DLGA 5L9NA 3D68A 3G6YA 1OS5A 2ZZNA 1O51A 2YQ3A 1ZTTA 2DHGA 4PXBA 2FLLA 1VQNS 3NY0A 2FVPA 2GVDB 2I5JA 3GR0A 4DLGA 1NJZA 3R2DJ 5CYMB 3BGLA 4Z37A 5CCMA 2GHVC 3CMAS 2E5IA 3CMQA 4M1KA 4Q7AA 3PR4A 4FBUA 2ZWOA 3MMCB 1APSA 1C0UB 2V9KA 1WOOA 2ZVIA 3GJSB 1T02A 5F0WA 4OJGA 1GXUA 1U26A 3I0SB 1S1VA 1SKUB 1FI4A 1XIQA 3D54A 1MU2B 3NAHA 3DHXA 1UEUA 4GRSA 4ZP6A 4CYUA 5D77A 1P27B 2IHR1 4WFAQ 2IYGA 4J9OA 4WZQA 4YB7A 3KJVA 2RKIA 3AOCA 2MY8A 2L9WA 3C14A 5B08A 3IR5B 3QMQA 4Q5VA 7FD1A 2DIUA 4WTYA 4ECRA 1TL3B 2KU7A 4DV4J 1JLQA 1H38A 1EKSA 1UWBA 2G2OA 2VB6A 2KT5A 2GJIA 3G87A 4FZVA 1JXVA 4DR4J 1P1TA 3ONQA 1RUSA 2Y1IA 1WG5A 4KGMA 1HPZA 1E6YA 1X4FA 3UD4P 2YKPA 3SFUA 1RTDB 1FJGJ 3MPUB 4X2BA 2F8EX 5DS7A 1LWFB 4D3HA 2VA3A 4N56A 2C2ZB 5HMZA 3W5ZA 2AYEA 2G0JA 3CJ5A 4PYDA 5CZVA 4UQGA 1F5BA 4JI4F 2VONA 1UVIA 2HBRB 1LWEB 3PKYA 2BJDA 4I7FB 3CCSS 1HNXJ 2FPHX 3PX6A 2VOPA 1WORA 2DNNA 2ZZTA 3KLHA 1D1UA 1RT5A 4DR2F 2MXYA 1SJRA 4C3MA 4XDDA 2WB1D 3UD5A 3PO4A 1NRKA 1V6HA 3CDWA 2KM8C 4C8YA 1JKHA 4OMFG 3Q86A 2D9PA 2XHWA 4H4MA 2JVRA 1DTTB 3I0RB 3HHEA 1HR0J 1XK8A 5L1KA 3RR7A 1S59A 4LFCF 2MKSA 4W92B 1XR5A 1Q1KA 3LF0A 5DRKA 4C4WA 3OUYA 5KOWA 1RQ0A 4PXEA 3OR2B 4QQBA 4CO2A 2MB0B 2E29A 4J5OA 4EBCA 4JI3J 2B4VA 2KXHA 3BH7B 3AXMA 2FJDB 1JWWA 1GMWA 4KO0A 3DLBA 1H6KX 3JQKA 4JV0A 1HHTP 5G0RA 4DSFA 3MM9B 4NLWA 3PYGA 3J7Z5 3D5MA 3FSIA 2HRTA 5H9FJ 1S0MA 2Z2MA 5IC4B 4OJ3A 1HI0P 3D1QA 5HROB 2ZHOA 4QWDA 3PW0A 5DETA 1KRPA 3PNIA 2DY1A 1UFWA 1B7FA 2WONA 2R7TA 5HLFA 3GCWP 4RLEA 2P9GA 1C0TA 1HFEL 5J1EA 3FEXB 3KFWX 2GVZB 5HLFB 1HWLA 3N6LA 4OYZA 3LGNA 2W9AA 3RB0A 3OFEA 3D0HE 3NCPA 5KFNA 4RBUA 1WSVA 2MDAA 5CYJA 1RAAB 3EWGA 1SCJB 5AXNA 5IFMA 2F63A 2YH1A 2EVZA 2EFOA 1T9WA 1VQMS 1IBKF 2VL1A 4TU9A 3MCMA 1BQMB 3Q0AA 1HQEA 1GT8A 4LF1A 3TEGA 1TL4A 1J5EF 2R8GA 1UETA 2V63A 3B78A 3FBFA 4TKTA 5HL7Q 3TVKA 5DGBA 2QMUB 4LF5F 1P9YA 1R43A 2VG7B 5L38A 4USKA 4DI6A 3D3CJ 4RNFA 4FXVA 2BW2A 2AJ1A 3OLAA 3D6MB 3POTA 2APOA 1S99A 2OPSA 2J9EA 4FKYA 3CJ2A 1RT4A 4O3OA 1RAOA 3QIPB 2OH2A 1G3OA 3O3LA 1KLMA 4DU7A 1QAYA 4FF4A 5T7LA 1VLOA 3S6EA 3P8BB 2W25A 3PYFA 3PHEA 4LFAF 4LF9F 4NCAA 5E3AA 3WC0A 2RD5C 3CCLS 1SH2A 4DV3F 1T3NA 1XJWB 2I0XA 5CQGA 1XNQJ 2P6TA 4KJIA 2FJAB 2X51A 2E7VA 2FD2A 3I6PA 3MR2A 1LWEA 2PO4A 4EBDA 3RU0A 4W90B 3DNCA 1R31A 4I56A 4LFCJ 5RUBA 3G8TA 1KFDA 1VRTB 1AUDA 3D4JA 4H4OA 3WX8A 2KI2A 2KTQA 2NYIA 3HFKA 5HMYA 2KM8B 3IBFB 4HL9A 3DLKA 1B70B 4X4UA 1RTDA 3MD1A 3JSRA 3K5OA 4U95A 4KB7A 3SCLE 2ZJPQ 4UY85 4GKKF 1IBCB 3JTNA 3QWPA 2RT3A 2AW0A 2IRUA 2OKQA 2YWKA 4XO0A 4QW8A 3IXQA 4LSZB 3ILOA 5DO2A 3QNWB 2AZ1A 3EMTA 4NA1A 5C24B 5KFSA 2XMTA 3FBEA 2Y1LB 2BM0A 3CIZA 4QPXA 1ROFA 3THVA 4QIFA 4CLFA 2DGTA 3CDUA 2LXFA 2VPWB 4PABA 4CYUB 4DDFA 1FFGB 1NHKL 1NLKL 4NWBA 1S1VB 2CG4A 3P3DA 4KHRA 4P2SA 3W9JA 2MZ1A 4YR2A 4DF4A 1FJEB 2P2CB 2OGUA 5SZTA 2LU2A 3IR7B 4ES1A 2DY9A 5KG7A 3CF5Q 2R7QA 4P7VA 2X1BA 4O23A 4ED7A 1NPKA 2BMBA 3HULA 4J7CA 2CAJA 2BR0A 3W62A 1UEVA 2Z8QA 3TX0A 2QEXS 2V8VA 2XYPB 3AT1B 2VUGA 2XBPA 4JI5J 4KHPJ 1HI1A 4CTAB 1CULA 1FKOA 1Q79A 2CNLB 4ZCKA 2JFKA 2XS5A 2VOOA 1O0PA 3FCVA 2HRUA 3W8PA 4DCJB 2B6AA 2UXBF 1MNEA 1GFWB 4K5SA 1XMOJ 1D8YA 2KH9A 4B3OA 4WWSA 3PM9A 1TKXA 1FRXA 1S57A 1PAUB 2HFUA 4HT7A 3RYLA 3TW0A 2BQUA 4ILLA 4NYOA 1HBUA 3NCRA 3TAMA 4EO8A 1HNVA 2J9DA 2A3JA 2EK1A 2JSXA 4PG7A 4WIIA 4Y2IA 3DYAB 2L9DA 2WOMA 3M30B 3BSAA 2XO7A 3ZTOA 1UVJA 1RKIA 3PFEA 2CWXA 1FO1A 3HPOA 2R7OA 2BBEA 1PGZA 1PC4A 3IG1A 4MK8A 1GTEA 3D7SB 4L75A 2VU5A 4TYAA 1TK0A 1M5OC 4FYYB 4L6V3 2HFZA 2DGUA 4LVOP 4CLPA 2MKIA 3TI0A 4LRDA 2XM3A 1DLOB 1F1BB 2IPOB 4MTPA 4P6QA 5KFTA 4B9SA 1T95A 2XCAA 1YHQS 4ZJLA 1I6JA 4BS2A 3CO0P 2W1BA 4LSNA 4M5LA 2DH7A 5MAOA 3Q8YA 4OJHA 3UE2A 3ZZPA 1MN7A 1S6QB 4PXDA 5LXYA 2VQEJ 2JEFA 2UUCJ 1HR0F 1FJCA 3CCES 4M8LA 5L1JA 3TOQA 2EKYA 3BQ1A 1A6LA 2W01A 2XMVA 3H2VE 4HHJA 5L9XA 3I5CA 1LWCA 4OX9F 4IKAA 4HACB 3UFCX 3M8QB 4B3MF 4OJ1A 4DZ6A 2LU1A 3HHLD 5IV3A 5KTQA 2RU9A 2NZCA 1REVB 8ATCB 2JLEA 1C2PA 4Q2LA 3QZ7A 3AQPA 2HYIB 2ZE2B 2ZBCA 4LBHA 4KFBA 4EGLA 5F8HA 2F4VJ 3RJMB 3SDEB 2WCXA 2E1AA 2NXJA 2F3JA 3SBMA 4C0BA 4F67A 3EVMA 3BR9A 4CDIA 4F0KA 1PJ5A 3GFHA 4DPWA 1CJUA 3ZNJ1 3OFFA 4NEZA 1NKEA 4C8OA 4NLRA 2IC3A 4ID8A 1UPMB 1ZM3A 1YJWS 4IG0A 2DHHA 4I6WA 2HVDA 4CLWA 4GC7A 4OZ1A 1VHFA 2L48A 3M8ZA 1NH7A 5CYQA 3DGVA 5FD1A 4Z2XA 3EVWA 2W8LA 1F60B 2B7BB 1NK6A 1QSSA 2OPPB 3PW4A 4B9MA 1RJJA 3CVKA 2D9OA 1WEXA 2KL8A 4FPIA 4OYIA 2IY5B 3UR3C 2HZVA 2HQDA 3RW6A 2F9JA 1NHVA 3HD2A 4HI2A 2N82B 2JDJA 2CIMA 3HZEA 1M1KT 1RAHB 1U1OA 5BR8F 3OHAA 3IBWA 1HW9A 2F1FA 2J0SD 1IWAA 4MMOA 2DH9A 2M5YA 3M2UA 1M0SA 2QG9B 1Q82T 4B3RF 3D66A 2IM0A 3GYNA 2IAJB 2UUCF 4NCBA 3CO9A 1RWMB 3GB0A 1S76D 2LA4A 2YPYA 3ULHA 3MMBA 4WFBQ 2JL9A 3OXGA 3FQKA 4F8RA 2UV8G 2D3OR 2FC8A 3HFZB 4ZVEA 2ZNZA 2RILA 4LF9J 4NLTA 3N4WA 2DR7A 4WP8A 2MKJA 3RG6A 1HD1A 5IT4A 4DSEA 4HEA9 1H2TZ 3HFVA 2RDDA 4X64J 1NO8A 5H9EJ 1IN0A 2QJ3A 2WVBA 5HK4A 5LMUJ 2DO4A 3R7NB 2CFXA 1FEEA 4DS4A 3PRVA 3PW7A 4ED6A 4JV1A 3JSYA 2RDJA 1BQXA 5J2QB 4DR3J 4DN0A 3BO4A 1IM6A 3N5FA 3BGRB 2CPHA 2UVVA 4DUTA 3FGVA 3M2RB 1WG4A 4C11A 2DNOA 1MMLA 2YNIB 3BM7A 2Z4PA 4HDGA 4RO0A 2CQ0A 1X4AA 1LXNA 1XQIA 3L95X 3MM7A 3UPFA 4MKBA 5LMUF 1TFYA 1FESA 1RABB 4AL5A 2CNKB 1YI2S 4LF8J 4RR5A 2RU3A 1CJUB 5IV4A 5L1LA 2QGFB 3M30A 2O1PA 1L3KA 3TNVA 1CJVA 5KT3A 4XIUA 4C11B 4IDKB 4K2XA 1X31C 4JI8F 5GAGU 3BSNA 4F4XA 2CJAA 2C2EA 2VV5A 1S12A 2OPQB 2WHOA 2XSFA 3NWRA 4WK3A 2NCKL 1H2UX 2G0CA 4I1TA 4WFZA 2J7UA 2B0GA 1RT3B 3IP0A 1T7PA 3ZZOA 2AZ3A 2WW4A 4ZITA 4PQAA 3GSIA 1CULB 1FD8A 2HNZA 3TVYA 2HSEB 2HLTA 4UTGA 5BR8J 3W5XA 3VHQA 1FNOA 1AB8A 4NRTA 1DAXA 5EHHA 1RTIA 1YBUA 2RUGA 5DLFA 3C16B 3MM8B 4L3NA 2JEGA 1U1PA 3GP9A 2HNDB 1BQNB 5D3GB 3M6WA 3NAIA 1DFDA 2VKRA 3E01B 3NGRA 1RTHB 1VIOA 4J90A 1D0EA 2JEJA 4P75A 5B0CA 4B3TF 2XS2A 4JP8A 1VBKA 4KKOA 2AHOB 2WBMA 3WX4A 5EN1A 2EBGA 5IQ6A 2ZOFA 2WSFC 4ZLJA 2RHQB 4RUHA 3AD7C 1QTMA 5C24A 4UT4A 4PG5A 3BSCA 3IRWP 1U2CA 2MKCA 1U0HB 3OBIA 2DPJA 1S4FA 4ED2A 1WHWA 1RT7B 2V8PA 1O8BA 4A47A 3IN5A 2ZM6F 1RAIB 3HSJA 4K7QA 4UQTA 4DJBA 1YBTA 1LW0B 1N56A 4RNOA 4LSLA 1K73T 4ZIVA 3RGIA 2C3YA 4WIQA 2I1RA 1RT6A 2OPPA 3N6MA 1AROP 2CXEA 3J81Y 5E41A 1UFLA 5HBMA 2AGOA 1Y5IB 1HQUB 5I42A 1PAEX 1MWZA 1CS4A 1Y00A 3ILLA 3E51A 2LA6A 4WU2A 4RBTA 4WFNQ 2VQEF 1IKWA 4PAAA 5EDWA 2X3DA 1P9QC 3MM5B 4P2XA 3PRDA 2HHVA 2LXIA 2KFYA 4NI2B 3HSZA 1ACMB 1IR2A
chains in the Genus database with same CATH topology
2E9ZA 1CC7A 3CIMA 4USJC 1SJFA 3LP1B 3R3TA 1Y0HA 2XEXA 5GAEI 4DEZA 2CPXA 3HHNB 3CJ0A 1JX4A 1FK9A 4IO1A 5EUHA 2BQRA 1HQUA 5I42B 1RT4B 2CVIA 5KFHA 1L3UA 2GFFA 1QSYA 5F8LA 2FHKA 1TQLA 1TKZA 2YX1A 1M5KC 2DH8A 1SBRA 3AY0A 4N8OA 1SIWB 3C3LA 2RH3A 4G6VB 4ZS6A 2AD9A 1RT7A 1E6VB 1K8AT 3Q2SC 2M7SA 1M5SA 4E0DA 4LT6A 1U1QA 2ZH8A 4N41A 4OI6A 2LYVA 4EEYA 4F2RA 4YOEA 3MDFA 4IYQA 5KFVA 2DNGA 4J9LA 2A2CA 3DOKA 3PZPA 3JB9k 1XEZA 1UMJA 3VQTA 5KG3A 2C3MA 3FSXA 3E3XA 2E7XA 4MK9A 4ZPBA 4YB1P 3MURP 4WXWA 2R2TA 2W8KA 4LIWA 5E3RA 3TANA 4K4ZA 4KHPF 2DGWA 3OL9A 3N28A 4WU3A 1Z1ZA 1X5TA 1DQ9A 2CVEA 5T41A 4NCGA 1Q7LB 4J9SA 3QJJA 2HHXA 1ZAWA 3G86A 3IO1A 1J5OB 1QJHA 3MPYA 1S0NA 3RRGA 2G4BA 2XI2A 2N4DA 4CNZA 2R8IA 4MH8A 4NLVA 3GIJA 2CJ9A 2DNHA 1CQMA 4A4JA 1KQKA 2B9XA 2CQ3A 2JWNA 4K4VA 2M0GB 2FJWA 5DM7Q 2EG1A 1JLGA 5F3TA 3EUNA 4DS5A 3DCAA 1Q86T 2NPIA 3DRPA 1HA1A 4KRWA 4ERDA 1X9WA 1LW0A 2VBYA 3EGNA 2CPIA 2MQNA 4ICLA 2YX7A 5T7LA 2DNRA 2B4PA 3VCDA 3PO5A 3BGRA 2N3OA 4QU7A 1VBZA 2UUBF 4X4OA 2ZH6A 3DLLQ 1U48A 1BWEA 1SIZA 2ILYA 3SI8A 4B9UA 3QIDA 1KLNA 2E9TA 2QZ8A 1VI7A 1Q8LA 1ZBTA 4PKDB 4AQYF 4N5SA 1RDRA 3IAM9 2V94A 1SKWA 1NK4A 3T19A 2U1AA 4ED1A 1BQNA 1ELOA 3MMBB 2J6SA 2KDOA 2OFGX 2GC8A 3G8SA 1Q7YT 3N01A 2K1RA 1L3SA 1JJ2R 3VAMA 4FNHA 4OZ0A 2VG5A 1S9GB 1G1XA 2ZH5A 3PW5A 3RRHA 3O44A 2OLWA 3K5NA 4ELUA 1M5VC 3M1VA 3AQOA 3C2PA 3T1AA 2KJVA 5U47A 2VA2A 4C3LA 2Q1LA 1YSJA 1KOHA 2UZAA 3RW7A 3HHLA 1C4CA 4JI2F 2AYBA 3OVAA 1X5SA 3AA8A 3CSKA 4KBIA 4ZDNA 2V4QA 5KFGA 2Q3PA 5HMXA 2DHAA 5AXLA 1D3WA 5LL6d 1WG1A 2GNKA 2R2RA 4C3KA 4Y3CA 1HQEB 4RZRA 2NS1B 2SXLA 3H5XA 3C6TA 1V3ZA 2PDAA 4Q43A 7FDRA 3OTBA 5IZHA 3DLEA 3CD0A 1VLYA 3M9NB 2VODA 4K59A 2FLPA 2KRBA 3AA9A 4K4WA 5KAKA 2VQFF 5K8NA 2ROEA 1VQ8S 2VH7A 3ITHB 3CCWA 2BE2B 3NP5A 3V6DA 2XNQA 3I9ZA 4O3SA 2E5GA 3WDOA 3QLHB 3GFZA 4FS1A 2AJ4A 3H59A 1R27B 2NUHA 2ACYA 3G6ES 4DSIA 1V3RA 1FK9B 3DLEB 3QO9B 1G7CB 5B0AA 2HWHA 5D4NA 2ZH2A 1HNWF 3D0GE 5IQQA 3KYLA 1KR4A 4CO0A 1KOOA 4E8UA 4YY3F 2C3PA 1NK0A 3O5TB 3BGFA 3M32B 3NBPB 4Y28C 5GVQA 3M32A 3VF0B 2OIHA 3NGDA 5A6WA 3MEGA 1JLEA 3E8OA 1FTRA 1QUPA 2WW8A 6FD1A 3MAQA 3UW1A 4YR3A 4K4UA 3MWBA 1OPZA 1IR0A 1WF0A 4FXDA 1GX5A 2HRYA 1RT2A 2BRLA 1VK8A 2W24A 4WXOA 4ZLPA 4DWIA 4JOUA 4DR4F 4IOAQ 4F3OA 2PFFB 1X9MA 4RWWA 1P8GA 3RRKA 1JJHA 4CTAA 3TARA 3DI6B 3H2UB 3R5DA 4BDPA 4PUOB 2XY6A 4M5DA 4CIOA 1FRKA 1RTHA 1XN9A 3CT9A 1UP1A 4USIA 3RAMA 3SXLA 5IS2A 3CCMS 1REVA 3CPWR 3DFEA 1TKTA 2QIFA 3DRXA 1WI6A 1WF1A 5HP1A 1T3OA 2Z0GA 2HWIA 4QYZJ 2DRBA 3ISND 3VR1A 1OSDA 4FYDA 2V8HA 3R5AA 4DR6F 4NLGA 3LANA 2HNZB 2ZBIA 1U1MA 2D41A 2GIQA 1H3DA 2C3UA 4KIAA 1YTYA 2DRAA 3H20A 1IKVA 5M2RA 3KLGA 2C2RA 2GGPB 1NHUA 3UCGA 1SJ4P 4TYBA 5E3PA 1DZ5A 3I0SA 4FF3A 1EETB 4QIGA 2H9ZA 4HT5A 4B3SF 1B0VA 2LCWA 2ZDPA 1QY7A 2BUNA 1TL1B 2RB7A 3AJ2A 2R4FA 1RTJB 1Q8IA 4IG3B 2WOMB 5FDLB 5LXRA 4FS2A 4DL3A 2DHXA 4FF2A 5L39A 1ZZFA 5ADZA 2MSTA 4URSA 2Q79A 1TKXB 1JLBA 2R8KA 2B4UA 2PT0A 2GQQA 2R8JA 2D1CA 3MECB 4MIBA 2W9BB 4K4XA 3MUMP 2VG5B 2CKWA 3IFEA 4V19X 1FKOB 1W25A 3SV3A 2HGMA 1S72S 2J6TA 2HS0A 5D8HB 3KWMA 4UUWA 3BJYA 2RDIA 2JHEA 2OMLA 2VD3A 1ZAXA 3IRXB 1TAUA 4K5RA 3DRRA 3UDLA 1VFJA 5LSLA 2GGPA 1UVNA 1R8AA 3FCHA 3DOKB 3O8WA 3I56S 3MHYA 4YDDB 3BZQA 2X1AA 3HDSA 2YKNB 2BDPA 4L72B 1ZAVA 5KFBA 1S49A 3K57A 4IQXA 3MMAA 4OZJA 1FJGF 3GZ7A 5AXMA 4I0WA 4QOTA 2ZH7A 2Y1RI 2EW9A 4F3MA 1VQ7S 4LFBF 4B9LA 1CLFA 1VJWA 2P9CA 3G4SS 2J76E 1FHTA 4CO4A 2F8HA 4X66F 4IRDA 2VKZG 5DJBA 1LXJA 2IJNA 4MYTA 4O4GB 1VQ6S 1HBMB 1S6PB 4ECYA 2E1CA 2OD4A 2A2DA 3MR5A 2ROGA 1RI7A 5CCLA 2ZHAA 3Q23A 2E9RX 1I1GA 1TP7A 2FHJD 2BOPA 1RT2B 2IM2A 3IGNA 2C42A 2KHDA 4KV8A 5KFKA 4HI1A 1KSPA 3SQGB 4JI0F 2AYGA 4WF9Q 4N76A 4DG1A 5DG9A 3FDSA 1VQKS 3W7BA 3QIPA 1OQ6A 3B4DA 2VC1A 5J2PB 5D4LA 2OPSB 1NEEA 1RT6B 3J7YI 2ZE2A 4QCLA 2XI3A 3V4MA 3UQSA 1AXQA 2QA2A 1Q16B 2KHCA 1FEHA 1PILA 4ZK7M 4CO3A 4CO5A 5J1PA 4MIWA 3M8QA 2RJZA 2CYYA 4RUAA 3DMJA 4K4TA 1MROA 2HGNA 1RT5B 2OD6A 4TU7A 1DBDA 2GMHA 3KHHA 5KT7A 1YJVA 2PN6A 1KNZA 3L7PA 3ZZUA 2AU0A 4DFJA 2YKNA 2DGQA 2DITA 2CZVC 2MZSA 3M4XA 5I4MA 3ENQA 2DT9A 1O5JA 2LQBA 3AHPA 3NWGA 1FE0A 5KFMA 2FIUA 3NG8A 1TK5A 3OSPA 3IG1B 4ECXA 1YBAA 4JI1F 2PC6A 3DXSX 5CZXA 3HI9A 2DD8S 2POKA 3GG1A 3GWCA 5D6GA 5HROA 1FA0A 1JLQB 4C0OC 5F8IA 1RKJA 3T1HF 2FTRA 2OAUA 3VAHA 3SQGA 3TUJC 4YHHF 4JV5F 2ZOGA 4KTQA 3HVTA 1MWYA 2VC0A 3EZUA 2YKOA 3K5MA 3KHLA 4PRFA 3LWLA 3MR3A 4ED0A 2CJQA 3M9MB 4G1PA 3OUYB 4DUYF 2VFSA 3CJKB 4O3RA 2QMXA 4EYHB 4HYKA 3FQLA 2RE1A 4ES3A 5FLXY 1A7GE 3QWUA 1NKBA 2VPYB 4RNNA 4GMKA 4B08A 1QAXA 3F73A 1SL1A 3OXLA 4RW8B 3LAKA 2RVJA 4EO6A 2DNLA 1YQHA 2V8GA 4EUVA 2ILZA 4UUXA 3GIIA 3X3UA 3OSNA 3V6KA 3NS5A 2M9KA 3TVZA 3MD3A 1RP5A 4C97A 2W7PA 4TY8B 2FJBB 1FRMA 4FBTA 1KN6A 2VASA 5A0YB 5F8MA 2W7OA 1E6YB 4DLEA 1KS2A 4KT0C 1S48A 4F4ZA 2BXJA 4OHYA 3CJ3A 4PG8A 1X4DA 2EFQA 3TA0A 1SH3A 2DVIA 1IQTA 1N5VA 2CQPA 3TAQA 3T5KA 4ILRA 3CC7S 2D74B 1WNEA 3F56A 4B9TA 2E7WA 4XPEA 2BANB 4BC7A 4OQJA 4C8NA 4BWMA 2DGXA 3UDCA 3D2WA 4ES2A 1G6BA 1DHMA 1UVKA 2DCLA 4H54A 4NLSA 2PGCA 3U1NA 3CMES 2FVCA 2UV8A 3MEGB 3MZIA 4Y2MA 4ZKAA 2XCPA 3H4BA 3S7RA 4DV1F 3C66A 4QIEA 2LEAA 2XY7A 4I2PB 1VQPS 5CYQB 5KT6A 1Q81T 1KONA 3KLIA 3HVWA 3I82A 1WHYA 5F0UA 3BREA 4A8KA 2V0NA 3H5YA 3KHGA 3VAJA 2R8HA 2X3GA 3A1YG 1RYRA 4RW9B 4XAKA 3FEYB 3CC2S 3BO2A 3I5BA 3GFYA 1S9FA 1S10A 4C8ZA 5DGAA 4TQSA 2PMZD 1N52B 4KHMA 2JZ5A 2MZTA 4TY9A 2IVMA 4WCEQ 1GAOA 2XY5A 4M5DB 4MIAA 1U45A 1RGVA 3AJ1A 2PD1A 2B3TB 4QR2A 3S01A 3VZHA 2EI5A 1OPIA 4N8NA 4WFYA 4DL6A 4OX6A 1SV5B 3RB4A 4AYBD 3JYTB 2QLWA 1IXKA 2CQGA 3PX4A 2GA7A 1AFJA 4WJBA 2QO3A 3CEDA 1MROB 4LSNB 2DIVA 4KO0B 4DV0F 1L3TA 1N32F 2HIQA 4Y2CA 3CD6S 3QAEA 5SUHA 4R5PA 4QPTA 4ETZA 2CQHA 4LF8F 1JLCA 2B5JA 1WI8A 4URGA 3CCQS 2EBEA 4I2QB 3U1LA 1WHVA 1U25A 3AH6A 1VOMA 5A8WA 4KV8B 4ECQA 4RBVA 1NK8A 4MJKA 1TV6B 4FPRA 5DG7A 2HVIA 1R8HA 4URQU 3W2VA 3VAFA 5B0EA 4HDHA 1FDNA 1QAJA 3BEGB 3V4IB 4KSEB 3LUYA 3UNGC 5KFEA 1JJ4A 3QJPA 3W3SA 5KG6A 4KFBB 5KFQA 1NJXA 1CC8A 2E44A 1N0UA 1MSWD 2LQ9A 4ZP7A 4ZPVR 5I3PA 4DPOA 4DR3F 1U1NA 1SB6A 3QGGA 4DN9A 2DR5A 4GKJF 2AV5A 2HAIA 3Q8RB 4FVCA 3DXBA 1L5UA 2WB4A 4YP3A 2XLKA 4WYWA 2RNEA 4QYRA 3TUIC 4ZP9A 5M2PA 5KFXA 1U6BA 5G4DA 4USHA 1S6QA 3D1OA 3KJVB 2BQ3A 2RS2A 2IA0A 4X84A 4ICLB 4ZA1A 2HNDA 5T7LB 4EZ9A 3LP2A 3FZBA 1N36F 2P9EA 1K1QA 3IS9A 1U47A 2UP1A 3MOZA 2J0WA 2B4OA 2CRLA 2IBKA 3WC2A 3PKMA 4OLPA 3JSBA 2DBBA 3PV8A 1RT3A 3G9CA 1UJ6A 1H2VZ 4A8OA 2IMOA 1S9EA 5KFRA 1IQZA 5K14A 2YH0A 3DLGA 4IOBA 4QIWD 4QWBA 1J5OA 1W2IA 1VQ9S 4F02A 4ZPAA 3GIMA 3BN4A 1TKDA 1S7HA 2GIRA 4YDXA 1NJIT 1NNDA 3ZZ0A 4ELVA 3CCVS 2N3LA 5LSOA 5C5JA 1X4BA 1FNMA 4I4BA 3SSSA 3R1LA 2BVZA 3VQSA 3AB2B 5E0OA 2QMWA 2W4DA 3O1LA 5J2QA 4A48A 1U2RA 3BN7A 4OLOA 5CXTA 3LO3A 5J2MA 2DK2A 1HWUA 2VG6B 4QWCA 2CQ4A 5HN0A 1WEYA 2EWHA 3C6UA 4DV2F 5E3QA 3DMJB 5JVGQ 4OHZA 3D0IE 4X65F 4MFBA 4C2MA 1RT1B 2OTJS 4XDCA 4LUBA 2DJWA 5C25B 2YNFB 1BLUA 2XLIA 1JLGB 5KFUA 3K59A 3BO3A 1XERA 1LK7A 1S1WB 3PACA 1VRTA 5LJ5Y 5K8PA 4ED2A 4FN5A 2DGSA 2NSCA 1FNXH 4DHVA 3DDKA 5KG0A 4MK7A 2ZC4A 3QZ8A 1SKRA 4OI2A 4U7UK 5A8WB 4Q8EA 3C8YA 4I69A 1HNZF 1IKWB 3PDNA 2QLXA 3DC2A 4GO5X 3DOLB 2J0QD 3OR2A 5CHCB 4MAKA 2B5JB 4NPOA 3POTB 3QGPA 1B0PA 5EX0A 3PIOQ 3N6NA 5I3QA 2WSCC 2FLOA 2G13A 1SUQA 1FRIA 3ZZYA 4X4RA 2R7UA 5F8JA 1KHWA 3KHRA 5AE3A 3I5AA 4PPDA 4RUCA 5D78A 1FXDA 3TX8A 2XMWA 4OX8A 3TYTA 4F3QA 3QJLA 2AYMA 1S1WA 2RMLA 4KE5A 3SDEA 2PI4A 3EXCX 2HMIA 3V6DB 3MEEA 5D3GA 4HTIA 1SJQA 1FRLA 1HWIA 1V3SA 1YVFA 4ETXA 2Q66A 3CC4S 1C1BA 4O3PA 4OZNA 3F44A 3OTEA 4ECUA 4ED8A 4Y65A 3ISZA 3NS6A 4NRUA 1DTQA 5J2NB 3IA0A 3LP1A 2AX0A 2V4JB 4ZVFA 1QVGR 3C6TB 3PRBA 5GADI 3Q8QB 1G2EA 2JEIA 1R7IA 2Q6BA 2JJ4D 4PXCA 2LKZA 1LFPA 3UCUP 1R0AB 3CULA 4H4KC 1L3VA 1Y3KA 2GQ2A 1D9DA 4F4KA 1NZAA 4I2PA 1U24A 2QE5A 1X5PA 4RW6B 1TZ0A 3SCKE 4DL0C 5CYMA 1TVRA 3MM7B 1R89A 2EPIA 3R5BA 5JXSA 2OSQA 2YNIA 1FKPB 1JKHB 1XBWA 5A8KA 4X4SA 3Q2TC 3QAUA 1IKXB 1YJTA 2GO8A 1R3NA 2UVUA 5KFOA 5F41A 1S9EB 3KLGB 4J9MA 2KG0A 1Q78A 4TU8A 2ALZA 1IBMF 1CQNA 1IBLF 4C7QA 4YR0A 3DLHA 5A8RB 1NB7A 3N5BA 3BB5A 1MMDA 3UCZP 4KR0B 1GX6A 3PY8A 2L08A 4AXIA 2QYCA 3GMGA 3TO8A 5IM0A 1TKTB 2KRRA 1FDAA 4RNHA 5E33A 3OVSA 4I6AA 2FB0A 2N4CA 2QFJA 1HPZB 2FGCA 1TR0A 4JBCA 2IAJA 4ECTA 3UD3P 1T05A 3KLEA 1X5OA 5KFPA 4B9VA 4NLDA 5DG8A 1XR6A 4LIRA 1OWXA 2UXCF 2C22A 4RW8A 1TAQA 2A18A 2MZRA 2OPQA 5L8RC 1BGXT 5KFLA 5DDQC 1UW4A 4ZVHA 3OLBA 1NJWA 3B4MA 5B0FA 1T94A 1C0UA 1TVRB 1UJ4A 4WKYA 3EGZA 1FDDA 2JH3A 2W4CA 3K5PA 3LPYA 3NBPA 3O6QA 2LECA 4X2BA 1U09A 1WWHA 4C8MA 5D4OA 3MR6A 2ZD1A 3V6HA 2Y0SD 4CO1A 2IC3B 3PFOA 2AJ0A 2LVWA 5H1SV 2B9WA 2KYZA 2VFTA 1U7LA 5A6PA 2VBXA 1R8PA 2IM3A 1HNXF 3CDBA 5K9FA 5C42B 1KLMB 1S1UA 2DNMA