4AL7A

Crystal structure of the csy4-minimal crrna complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
189
structure length
155
Chain Sequence
FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQALDLPFVTLRSSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords CSY4 ENDORIBONUCLEASE
publication title Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 155
sequence length 189
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4al7A00
2XLKA 2XLIA 4AL6A 4AL5A 2XLJA 4AL7A
chains in the Genus database with same CATH superfamily
3G6VA 2QA4S 4UOGA 3EVMA 2IMOA 3GFYA 2X1GA 4USWA 4RW8A 3V6KA 2HHWA 3CMQA 1H7XA 4ECXA 4NI2A 1VGYA 2R7QA 2UUBF 1EETA 4CLSA 5F8JA 3EZUA 3R7NB 2QA4G 1AROP 1U0SA 4Q44A 4YUDA 3HO1A 1ZAVA 1EP4B 4QIVA 1VQ5S 4JI6J 1ZYQA 5CD4A 3MPUB 4DQSA 3DLEB 3W2VB 3BH7B 4C8OA 2BKOA 4KB7A 5DS7A 4HHUA 1T9VA 1EP4A 2JL9A 2HWIA 2BQ3A 2ZD1B 3DLEA 1ZPWX 3RW7A 2LKZA 3AA9A 1KFSA 1VRUB 5CYMB 2VG7B 1TKXB 5IT4A 4MIAA 3UE2A 2VQFJ 1D1UA 4RU9A 3VVTA 2OKQA 4GVBB 1P6TA 1VQ6S 5IXUA 3SCLE 2FIUA 1S57A 2ZD1A 4TLRA 4LF5J 2WB1D 3HHKA 2HHTA 4WFZA 1C1CB 4M5NA 2CQ4A 1VRUA 3E3XA 2VG7A 1TKXA 4DOZA 5I3QA 2ZH7A 5L46A 5GAEI 4GVBA 4X4TA 1SC4B 4O3SA 3AAWB 3KTQA 3H4BA 4K2XA 4ZHRB 2CQHA 4X4OA 2XMJA 1OJ4A 1RP5A 1NXIA 3DHWC 2LDYA 1C1CA 1IR0A 1T9YA 2UVVA 3MECA 4OZ2A 1Y5IB 2W8KA 2DO0A 1IJFB 3AOAA 1YDLA 1NBEB 2BW2A 4NLSA 4ZVSB 2LU2A 1YJTA 1WF2A 1EKSA 1FRJA 3R5GA 4FYXB 2V8PA 2WRMA 5GAEU 2ATLA 4L73A 3GYNA 1R3NA 2HHPA 1YJWS 3HF5A 1U25A 3K0JA 3RW6A 5HATA 1X7VA 1HWJA 1TKTB 1WD6A 2BYCA 3K5NA 1Q16B 3THVA 4RNFA 4ILRA 1QVGR 2CXEA 1GX6A 5LL6d 1S9FA 3H0PA 1FF2A 2CPDA 4PXBA 5D0GA 4K0KF 3I0RB 2QN6B 1TKTA 2FJVA 2R8GA 4U9RA 2ZH4A 2C3OA 1UWBB 3QRPA 4NMXA 2NXNA 4V19J 3OV7A 4ZKAA 1RISA 2YKPA 5DG9A 4JI8F 3DXBA 2HG4A 3VAGA 2CJQA 1M1GA 2IYIA 1X9SA 5D0HA 4JI3J 3VGSA 1UWBA 1VQ7S 3NLCA 5A8RB 4RR5A 3GTYX 2QL5B 3CDWA 2COLA 1MNEA 3F56A 2B4PA 1R31A 2OMLA 2R7OA 2AW0A 2GAHC 4DCPB 1CJVA 2ZC4A 3T5HA 3IR7B 5A8RA 1DZ5A 1KSPA 3T1HF 3RAMA 2C2KB 3QYYA 3JB9k 3W2WB 1T03B 3BREA 3N01A 4EUVA 3A8EA 1DQ9A 4IYQA 3DM2B 5HBMB 2MQNA 3HFVA 3ZZPA 1VRQC 2VD3A 1RQ0A 2IJFA 3MMBA 3NWGA 1T03A 1PKUA 4R0JA 3QSYB 1YJNS 2BE2B 3AFGA 2B56A 1WKKA 1RHJB 3DM2A 2DT9A 5HBMA 5AXNA 1UETA 1Y5LB 3VAKA 2QMXA 3S6EA 2P9EA 2ERRA 2CQPA 2E1CA 3IRWP 2ZH9A 2FVSA 4HVZA 3ILIA 2UXCJ 2BE2A 2BR0A 2MKSA 3O6QA 1EX8A 3ITHB 3M8YA 4HTJA 1Y10A 3ISNC 1VIOA 4J7CA 4ED6A 3K89A 4J9SA 1RBAA 4DBQA 4RO0A 3QMQA 2Z57B 1NZ8A 3BV8A 1YKWA 5IC6B 1X4CA 4ATNA 3CJ5A 2ILZA 2HMIB 3ITHA 2E5LJ 2YWWA 3QGHA 1OPIA 1NU4A 3J81j 5BXIA 1LWFB 3KG4A 1I51B 3JAMY 1B0VA 2E7XA 2C2MB 3HKWA 1ITPA 2L48A 2I0XA 4OHXA 2HMIA 2EFPA 2VFTA 5AXKA 2VFRA 4WFYA 3SV4A 3DOLB 4WU2A 4H4MB 1LWFA 3D1HA 3ENVA 3EPIA 4RJVA 3M1VB 3KNGA 2MXYA 3ZNJ1 3CGIA 4ECRA 2NPIA 2LEAA 3CCTA 4ED4A 3OL6A 2HVHA 2GIQA 3DOLA 1HL6A 5HK4A 4JV5F 4H4MA 4I1TA 2V68A 3M1VA 2B7CB 3C15B 2KVIA 2NYHA 2JWNA 1CJTB 4GMKA 1I94J 3J81Y 2CZ4A 5EX0A 4ZDNA 1U2RA 4LSLB 2DH8A 5KG3A 4I64A 2Q6CA 2PT0A 1TKZB 4MIWA 4B3RJ 2XO7A 2PGCA 1CJTA 1DTTB 1SJQA 2DNOA 2ROPA 3NS5A 4IFYB 3UCUP 2M88A 2XMVA 1UFWA 1TKZA 2APOA 2ZUGA 2AD9A 2MKYA 4P2SA 4DL7A 2PFFB 1DTTA 2VQEF 3UN3A 5IV4A 3GFXA 5HMXA 3R6GB 1U8SA 2MMYA 2RHQB 4KR0B 4E2FB 1S49A 2RQ4A 2V2QA 2MDAA 3T1AA 5H1SV 4UW2A 2JZ5A 3D5MA 5LSOA 2GA7A 4RW9A 4DQIA 1WC5A 2UV8G 4FF2A 2DNMA 1U1KA 3HT0A 4EO6A 1X5PA 4NOHA 4NLQA 2KFNA 4MIBA 3MZIA 5F3ZA 1YX2A 2LYVA 4CIOA 1FXRA 2I8EA 2LLZA 3GU0A 4BLGA 2NXEA 4AL6A 3PW4A 4KH1B 4NXNJ 3NGUA 1EKRA 4PG6A 2G9OA 3E01B 1H7WA 1AUDA 2CJYB 1I5OB 4Z37A 1MMNA 3M8QB 1CC8A 3CDBA 2LEBA 3MEEB 4U96A 3CJ8A 1IM4A 4M63A 2HKEA 2DPJA 4EU0A 3HMJG 2G0IA 1ZZFA 2RDIA 2V69A 1FDDA 1S0MA 2W4CA 2DR9A 3E01A 2EG2A 4HHHA 3GYXB 1X5SA 4XAKA 3M8QA 1HIYA 3MEEA 2VJUA 2HFOA 3M30A 4CNYA 4LIRA 2IAJB 2FDNA 1QAJA 2YPYA 4ECVA 4Y3CA 4DFMA 3W5XA 1SH2A 1P9YA 2RU9A 4FZVA 2DNHA 4OLOA 4I7FB 4D3HA 1FHTA 4ZP6A 1C4AA 4A8KA 1Q5YA 2IAJA 2XNRA 5M2PA 2C3YA 4G1QB 4ECSA 3TVKA 3MEKA 5HMZA 1XQIA 2LEPA 4MFBA 4I7FA 3AQPA 4CO5A 3MCNA 1X9MA 5U47A 1J5EJ 4WKRA 4X62F 2EG1A 5HMYA 1T9WA 4G1QA 3PYFA 2IM1A 2H51B 2UU9J 4DV0F 3TEGA 3IC1A 2JLEA 1Q7YT 4DL0C 4HL9A 5EDWA 1PJ6A 4R0EA 4TXSA 2PC6A 2YXLA 2XYPB 2XWXA 2RF2B 3AB2B 2F1FA 1FERA 5KT6A 2DNPA 1VI7A 1DARA 5HI7A 3KNAA 3BO2A 1KRPA 1BHNA 1B0PA 3LPYA 1FJEB 1X0PA 2F8EX 3V4MA 2E5IA 2RF2A 2OAUA 4DV5F 3Q23A 2W4DA 3E8OA 2QLWA 2OUGA 3EE3A 2EPIA 1HW9A 3NG8A 3H2VE 4DFPA 2IRXA 3VGUA 3U1NA 2CQBA 2HNZB 1QD1A 1Z1ZA 4DPOA 2RILA 2YKOA 2ZBIA 3DDNA 5K8MA 3X1LB 3QT5A 3KHRA 5DQGA 1TUWA 1F2HA 1W25A 3CW2C 5I4MA 1YBAA 2HNZA 4FNHA 1BQNB 3RUBL 5L8RC 1JJ4A 1HI1A 4DR6J 4Y6IA 3U1LA 1P1TA 4OMFG 5J1PA 1RI7A 4RUHA 4YR2A 3L7PA 2OHDA 1LEOA 1BQNA 2UUCJ 2MYFA 3VTIA 4PG7A 2OD6A 4YB6A 4CO0A 1SJ1A 2MQQA 2L9DA 3GCWP 2RRNA 4YDDB 4DV0J 3PFEA 1K8AT 3W3SA 5KG7A 3LWMA 2EKYA 4YDXA 2N4CA 3NS6A 1PC4A 2FTRA 1VDHA 1K0TA 2KYXA 2HS0A 1RE1B 2QEXS 2D41A 4ES1A 5CZVA 3FGVA 4WFAQ 1H2VZ 3OXGA 2H4WB 2AYGA 3PFOA 5JUMA 3IR6B 2IDEA 1R27B 2QSFA 1VQMS 3NAHA 4DR7J 2HQCA 5ETVA 2MLXA 4F8RA 1UTAA 4BC7A 3NGRA 4IQXA 2KH9A 1S77D 3ENQA 4A8WA 3PKMA 4DV1J 3BDPA 3EJMA 1IBKJ 2ZKUA 2LU1A 3QPIA 3T19A 1NHVA 4DZDA 4O0IA 2J0SD 3CVKA 2DNKA 3GE9A 3K7RA 4LBPA 5B0EA 4LF7J 1LW2B 5B0AA 4FXWA 3J7Z5 2JLGA 3BYRA 3PEHA 1Q53A 2YX7A 1VJQA 3IR5B 2FVRA 1YJRA 3NY0A 1KLMB 4M1KA 2M7SA 3KMSA 2EK6A 4RLEA 2ZITA 4K8RA 2IVMA 1V9OA 1LW2A 1J2VA 4PG8A 2EEYA 1RTDB 2M9KA 1X8DA 2B0GA 3SXLA 3M8WA 5HJYA 2HZCA 2VOOA 2POKA 4DR1J 2CPJA 4MT1A 5HL7Q 2NYIA 3HHDA 1KLMA 3OL8A 3TAPA 4WTYA 2E9ZA 1FJGJ 2DXDA 1KP6A 3R5DA 3N0VA 4NLTA 2VUGA 1WG1A 1RGVA 1RTDA 3RJMB 3KJFB 4XO0A 3D6HB 4PXDA 3ULHA 3BO4A 2CJBA 4ZCKA 1FKOB 4NYOA 3H42A 1TUGB 1ZBTA 5C24B 3HDSA 5CQGA 2OPSB 2RIJA 5L1IA 2X51A 4OYPA 4MK9A 3OLAA 3H5SA 3VAHA 1FKOA 2H54B 2LA4A 2Z2LA 3FEYB 3F44A 1UL3A 1XR7A 1RWWB 4WTOB 4LF9J 5C24A 4C8LA 2OPSA 2KXHA 4I6WA 2J7UA 3UDLA 1N48A 1TK0A 1M5PC 4ETZA 2DHGA 2W2NP 4ANEA 2WAQD 2DEIA 1YG0A 1X31C 4LQ3A 4GVLA 4DR2J 2YVSA 1RWXB 2ZH1A 3GJRB 4HHJA 4DL5A 2ZJPQ 1Q95G 2O66A 2GVDB 3CB4A 2Y9HA 3IMQJ 2UZAA 3CCJS 3EICA 1CULB 4DS4A 2PIIA 3GLJA 1FRMA 1RYSA 1KWMA 1VR6A 5LSLA 3U27A 3NS7B 4RBVA 2GVDA 2V0NA 1IKWB 3US5A 4XK8C 1KQKA 3CPWR 1CULA 3VZHA 5B08A 2CDQA 4DV4J 4Q0BB 1NK7A 3R5CA 3AD8C 3HI9A 4DQQA 3LW5C 3ILJA 4C3KA 4C2MA 1UA0A 1IKWA 3L4BC 3W7BA 1TZ0A 2ROEA 2WK4A 3IBCB 2KXNB 4X4QA 2VF3A 4CM0A 2FJXA 1KLNA 3TUPA 2DHHA 1SC1B 3DLGB 4Q0BA 2J9DA 5AXLA 1O0PA 4JI7F 2MLYA 4HEA9 4F67A 2H5EA 2CWXA 2GHPA 3QLHB 2CYYA 1N52B 3HD2A 1SC3B 4P7VA 2NZ4A 5M2UA 4ZIVA 4QYZK 4XTTA 5D6GA 3DLGA 3PY8A 1YJUA 2MHNA 1FTCA 4DX5A 2RJZA 4S0MA 1DBDA 3UI3A 4ID5B 3TJAA 3TQEA 5RUBA 1UVMA 2DGQA 4ES3A 3N5FA 3CJKB 2K1RB 5E3RA 2RDJA 5HJXA 3LAMA 4E98A 3UFCX 3QLHA 4QWAA 4ZPVR 4XIUA 5CCMA 2F4VF 1D3WA 1UJ4A 4ID5A 2BRKA 3CJKA 2K1RA 4PR6A 4DMZA 2XCPA 5G0RB 3T6BA 2B6AB 3BBFA 1OWXA 1RA7A 4DPUA 5H9FK 4ZJQA 5ETNA 5KFJA 1WHVA 3PV8A 1HBUB 2GJFA 1AT1B 4KYZA 3MR6A 2YKQA 2B6AA 2Q66A 2B9XA 1KBRA 3IA0A 4K4SA 1WDDA 3KYLA 3T9NA 1NH7A 4CM2A 4ZK7M 3G6YA 3GMGA 1HBUA 3OSNA 4J9RA 1XMBA 3P6YC 2ZVSA 4ZIWA 1YJ9S 1RAIB 3ISND 3AOCA 1U26A 4DQPA 1AA1B 1W2IA 4X4NA 3D67A 1TTHB 3OTOJ 1SL1A 2OMOA 1KDNA 2G2YA 3GIKA 1XR5A 1RABB 4M5KA 3SFUA 4JB8B 4UOHA 5T7LB 2E9TA 1Q8LA 3CCES 5IZHA 6FDRA 4QR2A 4ENOA 4F4YA 2C2EA 4GKJF 1GXLA 3CC7S 3KMQA 1F5CA 5A2QU 2NXUA 2DR8A 3SV3A 3QJLA 1QTNB 5T7LA 2YNHB 1SBRA 3ZTQA 4BWJA 1YLXA 3QWPA 2KZMA 2ADBA 3PZPA 4IRDA 2AGOA 5C5JA 1F9HA 3W62A 2DH9A 2R8HA 4R5PA 2YNHA 4U6PA 4K4WA 1UAWA 3JSMA 2O1PA 2XMTA 1L3KA 4RPFA 2JEJA 4AT1B 2CQ3A 4KY3A 4W92B 2JDJA 5KFZA 3KK3B 3R7SB 1JWWA 4USMA 5ETLA 3VHQA 2DHAA 1WC0A 2XS2A 4OYIA 2KN4A 4OYWA 4RWWA 3KLIB 1XNQF 1CC7A 3PR5B 1K9MT 4MK8A 4LFAF 1IKXB 2LXFA 2R8IA 1QAXA 3KK3A 1XNRF 1QAIA 4C7QA 1S97A 3UPFA 1JLQB 2D3ZA 2BM1A 5H9EK 2F8MA 2IM2A 1APSA 5EGYA 5DGAA 1IKXA 1LWCB 1A7GE 5ETMA 4KGKA 2LQ9A 4X66F 4HDHA 3BPSP 4BS2A 4DG1B 1JLQA 1R8HA 3R9LA 4QW9A 1RKJA 2QJ3A 3Q24A 1YHQS 2DGOA 4D3GA 2EVZA 3GB0A 2XLIA 1LWCA 2N7YA 3EZOA 1WI8A 4U7UD 1ZM2A 2J9CA 5E5NA 4ECTA 5BR8J 4OJ1A 4AUKA 2W01A 3TAMB 4DG1A 2CNLB 2LXIA 3PHEA 4ELTA 3QQCD 1TAUA 2DVIA 4MMOA 1U1QA 3FUYA 1TL4A 4NLRA 1S10A 1WEZA 3ZTOA 4RU2A 1T9TA 2AEJA 1QSSA 1RZMA 4CDIA 1BE4A 3QFHA 1OPZA 4UQTA 4NA1A 1K1QA 3TAMA 2YKNB 3BH6B 1SKRA 3J7A1 1V3SA 4FDFA 3PR4A 3U7JA 2GIRA 2R7WA 2V50A 5F0WA 4LIWA 3RTVA 3RR7A 2R2SA 4X4SA 5JMNA 4RKUC 3TRGA 2YKNA 1BY9A 2Z0GA 2DIVA 3K5MA 4DV6F 1WTFA 3CE8A 2HSEB 1AZSA 3CCWA 1NKEA 1LK5A 3C16B 4RUBA 4WIQA 3WZ0A 4JYAJ 1UEVA 3BJYA 3KK2B 3T1YJ 5K20B 2DCUB 2AJQA 3BSNA 5L1LA 4DJBA 2FYXA 5J2QB 1FRXA 3C16A 1WNEA 2WVBA 1VQLS 1S48A 3KK2A 1RHMB 5DQHA 2DNNA 3TW0A 2YH1A 3OD2A 2GO9A 4P52A 4CO2A 1RT2A 4E0DA 1PJ7A 3F73A 2AWZA 1RBLA 5J2QA 1MU2B 2LFVA 1EHWA 3FDSA 4HYKA 1FKAF 2V8GA 1QSLA 4DSLA 1IQTA 3IWXA 1CJKB 1IWAA 2GVZB 2ZJRQ 1Y3JA 1HQUB 3NGTA 1MU2A 1FEHA 3H2LA 1XMQJ 5F8NA 1RWPB 1T95A 2G1HA 2KT3A 2EWHA 2ZZMA 3LP2A 3POTB 1RAJA 3NMAA 2JSXA 4QPTA 1CJKA 4QWDA 2GVZA 5B0CA 1HQUA 4DSIA 2JFDA 2XHWA 2DCLA 2C42A 2VIHA 2A2CA 3HHLC 3PX0A 1NHUA 3QIPB 2MZSA 3MUMP 4RW7A 1JLGB 3V81B 2X3GA 5HAOA 3AB4B 3DRRB 1JXLA 3POTA 3FZBA 4RWXA 2XYGB 3FBEA 2FJDB 3NNHA 1Y0HA 1S72S 4W90B 2HHQA 2L9WA 4U7UK 2VG5B 3QIPA 4J9PA 2VFUA 1GMWD 4QIGA 1JLGA 3V81A 3DRRA 1IBLJ 1OSCA 5F9NA 2WONA 4FF4A 2VG5A 5B0BA 4DCJB 1U1NA 1WC4A 4ZPDA 1MW7A 2FHJD 2O67A 1ZM4A 3I96A 1RAAB 4PWUA 4KPCA 3NCPA 2XSJB 3R1HA 4ECYA 3BGRB 4USJC 4DR4F 2IPOB 1Q86T 4Y2AA 3O8WA 3GQCA 2GJIA 2V8HA 4O3QA 1PYSB 3NCQA 4M5DB 5GAHI 4CO1A 2XSJA 4O3PA 1MWYA 3Q8VA 3BSOA 3BGRA 1FKPA 3R7BB 4QR1A 4Y00A 1RCOB 2ZNZA 1V3RA 2HFSA 4KPYA 5EUHA 1BGXT 1BMQB 2GHWA 1BLUA 2OLWA 2VPZB 4M5DA 5AXMA 1IM6A 2CWKA 4F26A 2WVFA 3HLUA 3RBXA 4KQZA 4XPCA 3GV5B 3HD1A 3B54A 1PIEA 3CD5A 1U6ZA 4PKDB 2R42A 5GAHU 1J5OB 5D0EA 3GG1A 3OFGA 3ZZZA 3FRZA 2B3TB 3RB4A 4H4KA 2UXBF 3ZNUA 3EUNA 3I55S 5F0UA 1Q4RA 3L7UA 3TR5A 3W60A 1J5OA 4O3NA 4H4OB 2KI2A 2J0QD 3T41A 4NLDA 2XLJA 5IT9Y 5A8KB 2RMLA 3R3TA 2HS4A 2Q3PA 1CJUB 5ADZA 2FUG9 5LSRA 2VG6B 3I87A 3CJSA 4PQAA 1N34F 2A3JA 2WW8A 4AD6A 2RUSA 2IBOA 1RDRA 4ZVFA 4H4OA 4LF8F 2W2MP 5A8KA 1U6BA 2YNFA 1CJUA 3TUIC 1IWGA 3KHGA 1BD6A 2HNDB 3M4XA 1GMWA 4ED5A 1TFWA 4P2XA 3KHLA 1B7FA 1NKBA 4WZQA 3MM7B 3GG0A 2FHJA 1VFJA 3CCVS 1OY9A 1RT3B 2HNDA 2XY6A 4O4GB 5HSPA 2IA0A 4NZ7A 4ZVRB 2R7XA 4OYZA 3Q83A 1RWKB 2ACYA 2CPZA 1RT3A 1WACA 8AT1B 4K4ZA 3M05A 1S4FA 4O4GA 1NK5A 4G3IA 1O8BA 2HNYB 3M9MB 4ILLA 2P9GA 1H38A 4F0KA 4NXMJ 4I2QB 2IRYA 1Q79A 4QJVA 4WP3A 3TWZA 2YWFA 2HNYA 1JX4A 2BJ8A 5A8WB 1WHWA 2XQCA 7FD1A 1FJ7A 2BABA 2VBXA 1NHKL 1QSYA 1VLYA 2HGNA 4KHPJ 3OPKA 2HVEA 4I2QA 9ATCB 2V6AA 3TAQA 1N34J 2QLBB 5A8WA 4NRTA 4P2MA 3K8VA 2C2RA 2PE8A 1ZTWA 3QGGA 3BR8A 1Q8BA 5D4PA 1HI8A 4B3SJ 1DTQB 2R3VA 3V5RA 4DUYF 4ZN1A 4K59A 4IH7A 2OJ3A 1VRTA 1S12A 1FCAA 1R8CA 2QLXA 4MTPA 4GRSA 3PRBA 1A9NB 3D6FB 4I69A 1DTQA 4QIEA 1UVLA 3AQOA 4TKTA 5J2MB 2WTFA 2RQCA 1ZOTA 1M5HA 3C14B 1JLAB 2VBZA 4MKVA 2JEFA 2DD8S 3G96A 4AXIA 4NRUA 3T9ZA 3EZ5A 1K1SA 2ZJQQ 3QRRA 5LMNJ 3LGMA 1PC5A 5J2MA 1N5YA 2JVOA 4X4RA 2WBMA 1WUUA 3N9UC 5DETA 4BCAA 3CXCR 1JLAA 1D8YA 4MAKA 4J9LA 1RLCL 4B9LA 3J7YI 4F36A 2BE7D 2FY1A 4CLWA 1HQ2A 5A76A 1PCAA 3CSKA 3GJQB 2HAFA 3K5OA 4PG4A 4JV1A 1D0EA 4I0WA 2EBGA 2IMWP 1MWZA 4P2FA 1ZS6A 2CQIA 1VQ9S 1EB0A 2VONA 4Q43A 2AYMA 1IUJA 1H3DA 4MYTA 2E1RA 4N47A 1NJZA 1TQLA 2DKOB 4L3NA 3TA0A 3E51A 4B08A 5M2RA 4OX9F 3UR3C 3J7AN 4PPZA 1DLOB 3J7YU 4DV7F 3QGIA 1Q0NA 1XJWB 2GCFA 1S79A 3PW2A 1LKZA 2QYCA 2Z58B 3N6NA 2WCXA 1DLOA 1NM2A 3OLBA 4DSKA 1UEKA 4CH7A 3G82B 5KFLA 1S1WB 2WZ1A 1R7IA 2VU5A 2O01C 4JI0J 1ZETA 1U2FA 4KV8A 3AA8A 2RKIA 4P9SA 1KQGB 2K3KA 3G82A 2B9WA 4MKAA 4Y34A 2RT3A 3A13A 1S1WA 1D9DA 4N76A 3LA0A 5BJRA 1SJFA 1NB2A 5KG6A 2R7RA 3Q86A 3MURP 4P71A 3SZ2A 2VC0A 3I4PA 5KFHA 1VCTA 3TQ1A 1RACB 4AFFA 3CD7A 3RBDA 2R7TA 4X4VA 2MKKA 3KK1B 1M5VC 2MGZB 1WC6A 2AMCB 4DL4A 5E3AA 1HR0F 3ZZOA 2YWHA 2ZEJA 3KK1A 2MGZA 2VV5A 2VKRA 3MD1A 1O51A 4PXCA 2M52A 1FDNA 2B5JB 3WDOA 3HJFA 1DJ0A 4LBHA 5IC4B 2BJDA 5IQQA 4B3TJ 2U1AA 5I3UB 4J9OA 2XLKA 1SH0A 1X4GA 2CJXB 3OVAA 3MHYA 2RH3A 1Y9OA 4B9MA 2JNJA 2YQ3A 2B5JA 3MOJB 1VBYA 1I3OB 4AL7A 4LF6J 2JC1A 4DF4A 4JI1F 5G4DA 3MR2A 3JTNA 5I3UA 1WOOA 4IO1A 1GNKA 3PRDA 3MR5A 3O2IA 2HQDA 3TEHB 4GC7A 1Q5VA 3GCXP 3JSBA 2AV5A 1KQSR 1NJXA 1BWEA 4CLUA 4C0OC 3BQ2A 1SIWB 1V5IB 4EYIB 4USUA 5E2QA 4OI6A 3MPYA 1HARA 2BA9A 3LP0B 1VBZA 4KGVB 1N36F 4ECZA 3E2EA 4NLYA 5HROB 2D3O1 1LOUA 2DGSA 3BF4A 3UDCA 5D78A 3LP0A 3S01A 3PIPQ 2MPUA 3MAQA 5JVHQ 4YY3J 1HR0J 4URSA 1QJHA 4LSNB 5HROA 1RA6A 3D7SB 2VPYB 1WI6A 1PSDA 1F5AA 2HURA 4M5LA 2LQBA 2DNZA 2UUAJ 4DPTA 4PG5A 2HHSA 1FRKA 3HKZD 3M6UA 3HFZB 1WC3A 3UWTA 2MQPA 1DURA 4ERDA 4LSNA 2GO8A 2OSQA 1L3UA 2VODA 3VVUA 3PO4A 3VAMA 3IAM9 2AJ0A 1HHQA 2BJ1A 2KTQA 3BYPA 2Y1JA 2H3EB 2P9CA 2Z56B 3C6TB 2FHOB 1V5VA 1RB0A 2BM0A 1PO6A 1UP1A 3FVYA 5IQ6A 3SSQA 3HVAA 3OQ2A 3ADAC 4WE1B 5D77A 2F7VA 3GFHA 3TP2A 3FZ2A 3TJ9A 5KFAA 3C6TA 2H48B 3I4HX 4OI2A 3TUZC 1JJ2R 3HSGA 3A8JA 3IXQA 2DK2A 1FWKA 3RR8A 2HFVA 3EGVA 4NLWA 2IDLA 3PJWA 4KIAA 4P72A 4I6YA 4WE1A 2CZVC 3L9ZA 3O44A 5L9NA 2JVRA 2RU3A 3W1YC 2YWEA 3D0HE 2CUYA 3OBIA 3THTA 1U09A 3FCHA 4YS2A 5HQ8A 5KT5A 3GYGA 2RAQA 1HNXF 3QAUA 3GR0A 3J80Y 5KFIA 1KHVA 5F41A 4UQGA 4RNMA 4C0HA 5I42A 4CLZA 1ZPVA 3AD9C 3DOKB 3DMJB 4LRFA 2AHOB 2KT2A 2MQLA 2BQRA 2N3OA 2KO1A 3VGVA 2JC0A 2G4BA 4PYAA 4LFCJ 3DOKA 4EO8A 3DMJA 4UY8T 4DF8A 3AJ2A 2MQMA 2ATCB 1EQMA 2I5JB 4HT7A 5F3TA 3R2DJ 3HHLD 1F0XA 2WSCC 4B3MF 1DQAA 1RTHA 4QQBA 3DN9A 3DNCA 3W9HA 5L39A 2Y0BB 4P74A 1U02A 2ZVIA 2I5JA 3VAFA 1QAYA 3V4IB 4M5IA 3SSSA 4WYWA 4YR3A 1U7LA 2YY3A 1FESA 2WVDA 1YIJS 1XC9A 1YSJA 3DRSB 1NSQA 2L9NA 3U02A 2KJWA 2FLPA 1RAGB 4JI5F 2IM0A 5E0OA 2MY7A 3ZZ0A 3V4IA 1WOPA 4WPAA 2V9WA 2D74B 1ICEB 2VICA 3DRSA 3M6VA 4RUAA 1RAFB 2QMUB 2Q6BA 1S6PA 4WKYA 5EWGA 2QO3A 1T9XA 3A3NB 3DXSX 3RRKA 2FHMA 5A6PA 1SB6A 3X3UA 1WG4A 4DR5J 4DWIA 2CPEA 4AL5A 4TU7A 3DLKB 2C2NA 2CPIA 2XC9A 1DQ8A 4FYVB 2J6SA 3FBCA 8ATCB 4EYHB 1FT8A 1LFPA 5HVHA 2HIQA 2C3PA 2WSEC 2Y1IA 2EC2A 3DLKA 1NUEA 4A8QA 1Z4UA 1FXLA 4KKOB 4UOCA 2HRUA 3I5BA 4U7CA 2IJRA 1S76D 2XCAA 1EETB 3JAMU 4X2BA 2CNKB 3DLBA 4NCGB 1GT8A 4KKOA 1S0NA 2JLFA 3BEGB 3RB6A 1RT1B 2Z2YB 3FQKA 3M2UB 2AP6A 4WZMA 3P3DA 4WXWA 1DHMA 4RL1A 1TUVA 1TAQA 3S8SA 2F63A 4F4XA 3IWLA 3ZFVA 4J9KA 3HHLB 3MM9B 2ZDOA 4NCGA 3LQVA 1HNWF 2JJ4D 4IRKA 2Z4PA 2E1PA 3Q8UA 4QWBA 2GS8A 1RT1A 2ZOFA 1X4HA 3M2UA 5ETRA 2QMWA 1XMOF 1UFKA 2XMAA 1KFDA 2B9EA 5KFFA 1BXNA 3HHLA 3MM9A 4DUZJ 3NGKA 4FPIA 3FMBA 3J81U 2OPRB 4ITSA 4KHRA 2ZBRA 3CUNA 3D1QA 3PACA 5KOWA 1NSKL 2AEFA 3R5JB 3QT6A 4Y2KA 1EAYC 2W8LA 3CJ4A 5F8LA 3K57A 1NRKA 4AXJA 3DFEA 2OPRA 5CCLA 3NWRA 5AE2A 3LP1B 2HW3A 1B4SA 2C2ZB 4Y2CA 2E5JA 4YHHF 2D9PA 5C42B 1X4AA 5CABA 1M1KT 3P45B 4JI2F 1CVJA 3MECB 3IN5A 1NDLA 2QRRA 2SXLA 3CO0P 4AQYJ 2GV1A 1RHQB 2H4YB 2Q1LA 2CQGA 1QM9A 3Q8PB 2OGUA 3LP1A 1U1MA 2J8SA 4ED7A 5C42A 2A2DA 1GTEA 1SXLA 3TX8A 5GADI 1URNA 4KFBA 3DDIA 2GQQA 2FVQA 1C0TB 3W8PA 3D0GE 2QA2A 3Q8RB 2VPWB 3EDQB 2JX2A 1UA1A 4O3RA 2KHDA 1N0UA 4NLUA 2F8HA 1S1TA 1U1RA 3PKYA 3UNGC 3QNWB 2UUBJ 2UVRA 4KBIA 2RD5C 2DXEA 1M90T 1C0TA 6AT1B 1U45A 5DM6Q 3ET6B 3CCZA 4K7QA 4M95A 3CDUA 4ZCLA 2W9BB 3M6XA 4Z7YA 1RLDA 4JUZA 2CNOB 3B78A 5GADU 5HVGA 3PW0A 2BMBA 4ZVHA 3ET6A 2X1FA 3RGIA 2HBZB 3OXLA 1VHFA 2FQQB 2LCWA 4A48A 5SUHA 2NZCA 5ITHA 2W9BA 2HK3A 3CDEA 1HNZF 2F65A 2W2PP 3A4TA 3MTKA 4DR3F 4F04B 3BQ0A 3N5BA 3GSDA 5DDRC 1CJVB 4OIXA 2OP5A 4XDCA 3G2XA 4OI3A 3PCOB 4LF4F 2R8JA 1RWUA 3TNVA 1GXUA 4TY8B 1OSDA 3CMES 4DDFA 4CQ1A 3UD3P 4IG3B 2RS8A 1RSCA 3W9JA 1D8ZA 3GJTB 3T5JA 3MMBB 4HH1A 3I0SB 4IG0B 4E8UA 4HACB 2L41A 4TYAA 4TY8A 2NSCA 3H2UB 1U1PA 3RYLA 3BB5A 4IG3A 1NJIT 2OPPA 4FPRA 3HJVA 1A0OB 4I56A 1X4BA 3D3CJ 3I0SA 4UUXA 1N32F 4IG0A 3WX4A 4HACA 2ZM6F 3BPDA 5H9FJ 1QDUB 4WJBA 2ZH3A 1S6QB 4QZVB 2YWKA 5HQLA 3DLHA 2CFXA 1XIQA 1JQGA 2BJ3A 1KN6A 2MJUA 4K0KJ 1ZAXA 2FZKB 3DRXA 1S6QA 2WHOA 3LOUA 4F2RA 4KT0C 4CLLA 8RUCA 3NNCA 2UXDF 4K4UA 3DYAB 2V4QA 3CC2S 2XM3A 1HNZJ 2YBVA 2DIUA 2KZZA 3FCWA 2WVEA 2BANB 4KJIA 2EW9A 2YTCA 4JI8J 1RTIB 3M8ZA 1OIAA 5ETKA 1NJWA 3EPGA 2XYHB 2ASJA 3DYAA 2FC8A 3PG9A 1LNQA 4ZLLA 2FVCA 2BANA 3P5TL 4CT9A 1RTIA 1WSRA 2KHCA 4O4RA 4DV2F 4Z2XA 2V9KA 2F4FA 3FRYA 5LJ5Y 4DL3A 3T1HJ 2CJKA 1HQEB 2XS7A 2XB2D 4K4VA 4OX6A 1F6TA 4OJGA 1HA1A 5HN0A 1FFWB 1HLWA 4M8LA 2LECA 2CIMA 1N56A 3CJ0A 5D3GB 3IFEA 1HQEA 1SVDA 2DRAA 4YMEA 1GMVA 3MMAB 5DO2A 1R8AA 2HYIB 3JQJA 2CQ2A 4JI4F 4O0NA 2BACA 4J9VA 5D3GA 2KM8C 2GQ2A 2CZ9A 1UVJA 1UMJA 2Z8QA 3BSCA 5E33A 1H0HB 3MMAA 4OLPA 1WKJA 3KG0A 2GC8A 4FYDA 4RW9B 4F25A 1RTZA 2P6SA 5J1NA 2JRSA 1HWKA 2V8VA 1TKDA 1DFDA 2CQDA 3DCAA 5D4OA 2PA3A 3M2VB 1SL2A 2R7SA 1NPRA 4FXDA 3QIDA 3J7ZT 3C2PA 3D6MB 3HX9A 4B17A 2BE9B 4ED8A 1TP7A 4X64F 5B0DA 1AFIA 2J7WA 3M2VA 3ENAA 2QYGA 2AZ3A 2HAIA 3O3LA 4ES2A 4LT6A 1VYAA 4DQRA 1JLEA 2WBRA 2LDIA 2PA8D 4A8XA 2IIHA 3ZZTA 4U95A 1F2GA 4DV3F 2QLJB 1SUQB 4QYRA 4DPWA 4OZJA 1TL1B 2MKIA 3AXMA 5KFDA 2EFNA 4JV5J 2M4MA 4KC5A 3M30B 4IKAA 3DRPB 2BQUA 2WOMA 2WB4A 3B4MA 3UD5A 1SUQA 1TL1A 3G8QA 3Q0AA 3IBWA 3VCDA 2QL7B 4ECWA 2U2FA 3I32A 5IWAF 2K7KA 4CTAA 1YBUA 2XI2A 3DRPA 2MKJA 3D28A 5LMUF 1L3VA 3M32A 4QPXA 2N7CA 1KS2A 3LWLA 3MFIA 3EMTA 3PEJA 3V2UC 5L1JA 1H73A 1MROB 2XWYA 5EN1A 2C1EB 3WX8A 4FVCA 3ILLA 3FKBA 3RBEA 4MFBB 2EBEA 4P75A 2KRRA 4IOBA 3SBMA 1MROA 2VQEJ 4O3OA 2H5JB 2ZH8A 3NRBA 4H4KC 3UW1A 1PGZA 3C66A 2GFFA 4OHYA 1U6FA 1C2PA 1O6XA 1U8WA 1KVKA 2IY5B 2ZBPA 1NO8A 2QA1A 1U49A 2FD2A 5IM0A 3PO5A 4ZLNA 4L75A 2ABYA 3H98A 3M6WA 2J9DE 4MYUA 2Y1RI 2MZQA 3IRXB 3BBBA 4FYYB 4I4BA 2YQ1A 1VQPS 4FKYA 3H40A 3QRQA 4GKKF 3DHXA 3PNIA 4X65F 3IRXA 5HMWA 2GAGC 1N33F 2VFSA 1HD0A 1U24A 2BDPA 4RZRA 3TARA 1S1XB 1EIYB 1QY7A 4DCOB 2ZUAA 1KC8T 3IO1A 5HP1B 1HFEL 4L74A 2D3OR 5KAKA 3HHEA 1GMUA 3MMCB 4PZVA 1TK5A 3CJRA 4K4XA 4BC9A 2CQCA 1S1XA 1GH8A 4ZITA 5HP1A 1VISA 2MY8A 2MB0B 4EZ9A 2B9YA 3MMCA 2V94A 2HHHF 2VA2A 3TX0A 2W7OA 5KFYA 5ETPA 3KFWX 4WFNQ 2A18A 2FGOA 4WCEQ 4C48A 2HS3A 1WWHA 2Y8YA 2QG9B 3BQ1A 5KFTA 4R8UB 4CO3A 4P10A 4DL2A 4DFJA 3VALA 4K2JA 4X62J 1JKHB 3H59A 4TNOA 2HGLA 3H5XA 3KUEA 4R8UA 2LVWA 3PJXA 3MEDB 1HPZB 5C7PA 2HZAA 1UW4A 2KFZA 5CHCB 3P8BB 5HLFA 3BGOP 1JKHA 2H9ZA 4BDPA 1PYOB 2EFVA 3OTBA 2JHEA 1SQEA 4CLTA 2W25A 3W63A 4F50A 3AH6A 1N54B 2VZ9A 3AXKA 1C1BB 3MEDA 1HPZA 2CAJA 1H6KX 5FDLB 2MKCA 1UZDA 4KTQA 4YR0A 2ZWOA 2KG0A 2QTWA 3BGUA 2HBQB 2ZOMA 5K8OA 4DV5J 1VK8A 4LFBF 4G1PA 2NSBA 4OI1A 2NR0A 4WK1A 2AQ4A 2Z2ZA 3T5LA 1C1BA 2DRBA 2XI3A 2IVFB 2VOPA 5FDLA 3HSJA 1KVJA 2J7KA 2HHUA 5T41A 1R6VA 1RUSA 1HI0P 1N88A 4ZPCA 1KD1T 2E44A 4A46A 2HQFA 4DN9A 2ZOGA 3CCLS 3VR1A 4OX7A 2FJAB 2YNGA 4CRJA 1RT4B 5FLXY 1K0VA 5EHHA 4OZLA 3Q22A 1KHWA 1G7CB 1S7IA 3W8GA 4WFXA 1G4CA 3U1MA 4ZN3A 4PEOA 4RNHA 3PYDA 3UVJB 2KDOA 2V63A 3EXCX 1RT4A 2HZVA 3K2YA 3MUVP 3PVXA 5F8MA 4TY9A 2RE1A 1NSPA 2W7AA 5KFBA 3UN5A 5DZ6A 2DH7A 2Y3YA 1OQ6A 2DYAA 4F3OA 4TQRA 4EFAC 3UVJA 4JI6F 2JOQA 5J2NA 4OZ5A 3NXZA 3KUHA 3PDNA 4N8NA 1NEEA 5KTQA 3RAXA 1HYSA 3D68A 1YRUA 1NSAA 1HBOB 4PYDA 3EVWA 4MKYA 3GIMA 1NCLA 1UWAA 4GO5X 4I68A 2EFQA 2P8IA 3ZZYA 1X4EA 4DHVA 3DI6B 5BYSA 4PXEA 3MEGA 3W66A 1HBOA 4PWWA 4Q2LA 2VQFF 3BSAA 4ILMA 3FBFA 3F41A 2V2VA 3R27A 3CJQA 3IWNC 1HHSA 4C8ZA 2HVIA 4B9TA 4LF5F 3JQKA 3DI6A 2GHVC 1HNIB 3K8WA 2DO4A 4LR8A 2KB2A 3BN4A 1TU0B 3G4SS 2R2RA 1QVFR 2HPUA 1LWXA 3SFGA 4A8FA 3QO9B 4OJ3A 3DKDA 3KLFB 1HNIA 3SCJE 4N7TA 4CLYA 2M3DA 2YWGA 3NCRA 1MN7A 1IR2A 2D3UA 5K9FA 2PMWA 3QO9A 1SKUB 4B9UA 4EGLA 5KFWA 3KLFA 4OFZA 2C28A 3HZGA 3C6UA 3D66A 3MAHA 5CAAA 1T05B 1KTQA 5HO4A 3TANA 2AU0A 1B70B 3WBZA 5DG7A 4AYBD 3O1LA 1RBOB 1RADB 4ZPTR 1T05A 4M5MA 2E66A 2DGVA 2VC1A 4J91A 4LR7A 3CCMS 4DU7A 1N5VA 4RW4B 2ASLA 2MZJA 1IR1A 4DL6A 3EXYA 3G6ES 1IQZA 2C3UA 3H20A 2JFKA 1KNZA 3W2VA 4F4AA 3H4DA 2ZHBA 1PBAA 4OV1A 5CH7B 4RW4A 4JI3F 1NH8A 2IC3B 3MWBA 2VA3A 1YZ7A 3BBCA 2A1BA 3TVYA 1WEYA 5CYMA 1IVZA 1YI2S 2J76E 4KAIA 2RUGA 3BKUA 2IC3A 2QGFB 4N77A 5J1EB 5DLFA 3CD6S 2X1AA 1PJ5A 4FN5A 1W2BR 4WIIA 1PILA 2HWTA 1OY6A 2XZDB 2DEJA 2GX8A 1YITS 4ZHRA 5J1EA 2GMHA 4NWBA 3EM1A 4BHQA 3OXFA 1ZM3A 3PTWA 3UCGA 4LVNP 3KLHB 4RNOA 3RRGA 4DSFA 2OSRA 1K47A 5K5MA 4L76A 2UXCF 1U1OA 3I9V9 5IFMA 3NNAA 4OYXA 5E7OB 2B8QA 1RU1A 4USTA 2V4JB 3ZTPA 5ETSA 1BUXA 3D2WA 3HVTB 3GZ7A 3KLHA 2W24A 5CXTA 2DGUA 3M9OB 2E5LF 4EBDA 3LH2S 3HSDA 1K73T 1X0FA 2V4JA 3I0RA 4P6QA 4JI7J 4FVMA 2AGQA 3HVTA 2AT1B 2UV8A 1G3OA 5L38A 1U47A 1YQHA 4WP8A 3RAQA 4CYUB 3MR7A 4J9QA 2C2DA 3S1TA 1UZHA 4YN3B 2CG8A 1KOOA 3TJ8A 2RB7A 4IRCA 3K5LA 4B02A 4R5PB 4UY85 3T6JA 3JSMB 5GMKa 3NL0A 4CYUA 4F4ZA 4QIFA 3ETOA 5KOXA 4JV2A 2AGPA 4DSJA 4ZPAA 1QUVA 4J5OA 2F4VJ 1Z2LA 1UJ5A 1N5QA 2FC9A 2FZCB 3VAJA 1TL7B 2XY5A 1I94F 1YWXA 3QFWA 1T9UA 1LXJA 4ZVUB 3W2WA 2OTJS 4WXOA 3H90A 1WF0A 3SQGB 4B3RF 1TL7A 2RRAA 3MGJA 2N3LA 2OD4A 3NOCA 2K3IA 4C8NA 1NPKA 1FTRA 2RQKA 2V5HG 2M2BA 4KH0B 1RT6B 3FEXB 2V2ZA 1OYDA 2FJBB 1Q8KA 4JP8A 3G8SA 4FBTA 3SQGA 3G71S 4TN2A 3ETMA 2MQ8A 4DU8A 4C9DA 1VBXA 1RT6A 3AJDA 3ENWA 2UUTA 1FJCA 3V6DB 4MH8A 1UEUA 5IT9U 4YEAA 5AJ3F 3PRVA 4Y0FA 2BOPA 2MEWA 1FNXH 3HZEA 5A0YB 1WHYA 4GKJJ 3KDNA 3V6DA 1SL0A 1Q1KA 3CJ2A 3RG6A 1X4DA 2V2KA 3KLEB 2ZDPA 4ICLB 3AODA 4NXNF 3G87A 3BS9A 4ID8A 2IBKA 1N4LA 1X5OA 5A0YA 5ETQA 4NZ0A 4NE9C 1AZSB 4DFKA 5KFOA 2P5VA 3KLEA 1IBMF 4ICLA 5IOLA 2R8KA 5KG4A 4X4UA 3OL7A 2PEBA 2NS1B 1XN9A 3Q8SB 4B9VA 2YNIB 4DX6A 3SEOA 2IYGA 3EGZA 4QW8A 3CJ3A 5LXYA 5KFKA 4HLBA 1YRXA 1CQNA 4L6V3 3PJ9A 3C15A 4EWTA 3NKYA 1FDAA 3ZO7A 1U48A 1XNQJ 1RXOB 4LFAJ 2YNIA 3TUJC 2OEJA 1J27A 2QIFA 1RT2B 2GW8A 3D1OA 4L3KA 4LSLA 1XNRJ 3KUGA 2LQ8A 5GAGI 4NL5A 4DN0A 2G2OA 4ZLPA 2CJAA 2GQCA 4M5GA 4IFYA 4LREA 2HFUA 4X66J 2KM8B 3BM7A 1MG7A 2N82B 2CKWA 5E3CA 1J5EF 5AJ3J 3LP2B 2XMKA 4YB5A 1CLFA 1HWLA 4B9NA 1YBTA 2UU9F 3UD4P 3OSPA 1JNZB 5GAGU 4ZVPB 5KFNA 1NZAA 5KFSA 3I56S 2CG4A 4RW7B 4C6AA 2EC0A 3OL9A 1KKHA 2Y0SD 3NOGA 2HWHA 2KXFA 1NK4A 3HT3A 1RWVB 1S6OA 3CJTA 3QSIA 1VJWA 2HGMA 2ILYA 1NDPA 4OZ3A 2CPFA 2AF6A 4LQ9A 3LO3A 3LUYA 3BDEA 1F1BB 3AJ1A 1FRIA 2ZH2A 1S0VA 1IBMJ 4PWDB 4CT8A 4F02A 1VMBA 2WONB 3Q2TC 4OYMA 5E3PA 4DV6J 4A47A 4G1IA 2XS5A 1PAUB 1CSJA 2QT7A 1MN9A 4PWDA 4F2SA 3GFZA 1GAOA 3OW2R 1Q8IA 4IOAQ 2MZTA 4WU3A 2OPQB 1CEZA 2J8AA 4C8YA 3KHHA 1X60A 1EARA 2G1DA 1FKPB 2MLZA 1NK6A 4DR6F 2KVQE 4OHZA 1G1XA 3KKFA 4C0BA 2OPQA 1JK9B 1WF1A 1R8BA 1S59A 1S9EB 3B6BA 2WSFC 4J9MA 3IS9B 1OY8A 2UUCF 2HVDA 3RZAA 2BOAA 2LQ5A 4B9SA 5A6WA 3W65A 3MCMA 3OR1B 3LPEA 2OI2A 4HTIA 4FBUA 2A6OA 3UDEA 4NLXA 1LFWA 1HWIA 1S9EA 2RNEA 3R97A 4CCHA 2E9RX 1FE4A 3IS9A 5EWEA 1FI4A 1CBKA 1U0HB 4LF2A 4URGA 3OR1A 4CP5A 1VHIA 1LW0B 2DGTA 3M8SA 4LRBA 2ASYA 2QC3A 2VBWA 4L72B 5LOQA 3OJUA 2HFNA 1U0HA 2KRBA 4DR7F 4Y65A 1LW0A 1S1UB 5DQIA 4PPDA 4MK7A 1LQ9A 1KEKA 3MAAB 1X5TA 3B8HA 2UVUA 2XMUA 1FNOA 3GIRA 4O23A 1GTHA 2E1MC 2KL8A 4DV1F 4UOFA 3C3LA 1IBKF 2J0XA 2YNFB 5KT4A 4EBEA 1FFSB 2QFIA 2FZGB 1S1UA 5E3QA 3MAAA 3R2CJ 4HR2A 3A8IA 5DM7Q 2HK2A 4F3MA 1B64A 1RCXB 4LF7F 3RBZA 1VQYA 4LR9A 3TZYA 4PCQA 4FF3A 4OZ0A 2M5YA 4ED1A 4CLPA 3IBFB 2R7UA 2K06A 1SQFA 4DR4J 3OFEA 4QU7A 1NDCA 2YKAA 3CCQS 1WKLA 3DC2A 2YH0A 3K58A 3DGVA 3OTCA 3IM9A 4DR1F 5FJ4A 1YJVA 5KFPA 1R89A 4YOEA 1F60B 2NUUG 2NXJA 1FJGF 2FY8A 3EGWB 2C3MA 4TU9A 3OUYB 1B7YB 2Z30B 4RX6A 5DDOC 3GONA 5ETOA 1FA0A 2DITA 2XBPA 1DY3A 1P9QC 3HULA 1L3TA 1VQ4S 3SIPB 3TVZA 3PIOQ 3OUYA 3GILA 2V34A 3WIUA 2CVEA 2AJ1A 4J9UE 4NX9A 1R43A 2FHKA 1Y4ZB 2CA9A 4HI2A 2Q79A 3MCOA 3SYZA 6FD1A 2BJEA 2UXBJ 2PI5A 4DSEA 3Q89A 3KJVB 4CH1A 3Q8QB 4QCLA 4LF9F 2DGWA 4ELVA 4ZJOA 1JXVA 4J90A 4FS1A 2Q43A 2PD1A 3P4UB 5KFEA 4ZP9A 1RJJA 4QOTA 4FYWB 3O5TB 5DRKA 3HVWA 3SDEB 4YB1P 3KJVA 1IN0A 1KONA 4LMZA 1TL3B 1VRTB 4ECUA 4LF8J 4DR2F 4USIA 4DLEA 3SDEA 2HIYA 2AJFE 1AXQA 4OZ1A 2VASA 1Y5NB 3CIZA 3GIJA 4OZNA 1TL3A 3ISZA 2LXUA 2IFXA 1KR4A 3BN7A 3FC9A 1HNVB 3CD0A 3JXOA 3ILOA 4ZA1A 1NB7A 4FF1A 4RNNA 3HCXA 1ROFA 2E7VA 5B09A 5T14A 3MM5B 1N5YB 4C8MA 4N8OA 3QBCA 2BVZA 3DU5A 4DV4F 3D4JA 1HNVA 3DLLQ 1B0TA 2QV6A 2DTJA 3TA2A 1CS4B 3M7VA 3RU0A 3MM5A 1R0AB 2IHR1 1UCNA 1DAXA 3DDKA 2OH2A 3GWCA 1F9EB 1WSVA 2V8DA 1Q7LB 1CS4A 3DLJA 1R0AA 9RUBA 4HI1A 2HQIA 5KFXA 5B0FA 3H5YA 1PYTA 2MZRA 1A6LA 2FGCA 1FFGB 1YK9A 3FSIA 2VDHA 4WYLA 4CNZA 3BO3A 2D69A 1REVB 1O5JA 3TOQA 4ER8A 2AJ4A 2HQGA 3OTDA 1TV6B 1HWUA 1VIXA 3A8KA 4RUCA 1AW0A 2DISA 2D7SA 2W9CB 3L7OA 1I1GA 1REVA 4C97A 3J80U 2E5HA 1TV6A 4DUYJ 3UO0A 4KV8B 3OHAA 2HHXA 2RKIB 4P73A 1JNRB 4K5SA 3P96A 4NCAA 2AJ2A 2W9CA 3HVRA 3PX4A 4TU8A 5FD1A 3W61A 3EVOA 3QZ7A 2Y8WA 3OVSA 4TLQA 2ZKTA 3DGPB 3VQTA 5EWFA 2DGXA 4CWBA 2AIRB 1ZA1B 3UCZP 2VJVA 4U8YA 2NPFA 2HVZA 1HW8A 2UVWA 2P2CB 1KQFB 4QBUA 4F4KA 4CI0B 1FVSA 2BRLA 3HXMA 5KT2A 3DGPA 4XPEA 2RRBA 3HSZA 1T3OA 1Y7PA 3MFHA 1FK9B 4YQWA 3OTOF 4V19X 3QAEA 2CQ0A 4QWCA 4DXLA 2KG1A 1HHTP 1RAEB 4MKBA 3ONQA 4I67A 2XNQA 2GMLA 2XZWA 5LT5A 3B82A 2J6TA 2G0JA 4Q45A 1FK9A 2DB1A 4A8OA 4ZLJA 4ZVEA 1ULRA 1JLCB 4J37A 2J6UA 1L5UA 3SCKE 1FWPA 1T3NA 1WORA 3P5BP 2H5IB 1FO1A 2FPHX 2BW7A 1JLCA 2M0GB 5IT0A 3IAS9 3H25A 4NLGA 4OX9J 2ALYB 4DV7J 1N8RT 2AZ1A 2DJWA 3TO8A 3L95X 4J9NA 2R2TA 2RSQA 3GR1A 1T02A 2HHVA 4USHA 3C46A 1NKCA 1FD8A 1HMVB 2RHSB 2B43A 1VBKA 3G6XA 2W7PA 1WELA 3RB0A 4N56A 3OFFA 5G0RA 4NLPA 1RHUB 2YQ0A 4ZVQB 2GGPB 3JYTB 1HMVA 4UZBA 1E6YB 1ZZNA 4JOUA 4OX8A 1TMJA 2CNNB 2K2PA 2PN6A 2VH7A 4F7VA 3R8YA 2F40A 2GGPA 3JYTA 4ECQA 2GMJA 1TELA 2BXJA 2JEIA 1VOMA 1E6YA 4MJKA 4DEZA 1BQMB 1P27B 3WHIA 2X7IA 4IR1A 5DDQC 1RHRB 5KG2A 3PW7A 4WWSA 4FS2A 4GO7X 1JMTA 4Q8EA 1ACMB 3K59A 5BR8F 2LQJA 1ZAWA 4ELUA 1BQMA 4EZ6A 2B4OA 2I1RA 3QJJA 3FFIB 2E7WA 3M8RA 5DDPC 4FNIA 1DRZA 1RK8A 2W2OP 4G65A 3MI7X 2E1AA 5D8HB 2BEFA 1N5TA 4W98A 5SZTA 4ZJLA 4IUFA 2KJVA 3FFIA 2Y1LB 2CPYA 3T5KA 3AD7C 2HLTA 1YVFA 2OEKA 1T11A 1N0VC 4USKA 4JI1J 1QE1B 2NCKL 2Z2MA 4JYAF 2ACMA 2R9LA 1YTYA 4P7TA 3T1YF 2R2UA 5CYJA 1TK8A 5KFQA 1H2TZ 4BWMA 4ZVOB 1FNMA 3LAKA 3W64A 1QE1A 3QT7A 3I82A 4DS5A 1WDTA 2VL1A 1HKAA 2I2YA 3MMJA 3KLIA 3DU6A 1XR6A 1YZ6A 1R8PA 2XY7A 4Q8FA 3N79A 3UN2A 1H2UX 2VHGA 5DGBA 5JJBA 4DUTA 1WJ9A 1I6JA 3FK4A 5I3PA 5I42B 2PSZA 1N36J 3ZTSA 1HD1A 3MPWA 2DR5A 2O5DA 1Y00A 1S6UA 2DNLA 3IGVA 1RKIA 1U4BA 2HBYB 3CEDA 1XMQF 4UUWA 5E41A 2W2QP 1FWLA 1IKYB 2AKWB 3SQOP 5JVGQ 5CYQB 4EK2A 2DR7A 5IS2A 3TZZA 4IR9A 3HK2A 4GC6A 3KXDA 4QWEA 2M8DB 2DRDA 3CT9A 5KG5A 4ZCMA 1RTHB 2IVYA 4EMDA 5KT3A 1IKYA 1SIZA 1PBUA 1U2CA 5MAOA 1RAOA 1E6VB 5CYQA 2YKMB 4H54A 2FB0A 3R1LA 4CLKA 5KFRA 1EQ0A 2ADCA 2BBEA 3MCSA 2WW4A 5BYQA 3VF0B 3QJPA 1S0OA 5HQMA 1HBNB 1E6VA 2YKMA 1IBLF 2RVJA 3CC4S 2KYZA 3AT1B 4YFUA 3OVBA 1TFYA 1N6QB 1NK0A 1RT5B 4ZPWR 1S6PB 3NEKA 2IJNA 1HBNA 2XGQA 1Q82T 1JIHA 1GXTA 4HKQA 2BJ7A 3GIIA 1WC1A 5KG1A 3D0IE 1V3ZA 3QATA 2ZWPA 1OMSA 1T0TV 2J9EA 2YX1A 3GP9A 1N6QA 2QX0A 1RT5A 2EXUA 4RBUA 2IRUA 1VLOA 2PMHA 5B0GA 1GX5A 1M5OC 2DXFA 1UJ6A 3A12A 3OT9A 1VQSA 1WTBA 2WVCA 1VS3A 4OYBA 3LGHA 2BJ9A 3K17A 2OEMA 1S99A 1HNXJ 4M94A 1NMEB 1S1VB 3BGFA 4LBIA 4NEYA 2XMMA 3PM9A 1JJCB 2EFGA 3NMRA 3D3BJ 4CLFA 1KOHA 2XMWA 3ZXWA 3R5AA 1SJ3P 1REGX 2E29A 2MJNA 4NEZA 3CCRS 3PXGa 1S1VA 1UFLA 2DY9A 5GMEA 5LJ3Y 1UVIA 1P1LA 2NXCA 4LRCA 3G8TA 2PMZD 3RRHA 3PYEA 3M2RB 4B3MJ 3OTEA 2KT5A 2M70A 3V6HA 3QZ8A 4A8YA 1XEZA 1H72C 2HRYA 3M2RA 5MLCV 4CZCA 3N6LA 2GIFA 1NK9A 2DNRA 4JI5J 1QTMA 1UPMB 4PAAA 3EDRB 1AUSL 5A2QY 1ZH5A 2LA6A 1C4CA 2BZ2A 3IM8A 5HANA 3SI8A 4R25A 5LXRA 2OIHA 1G6BA 3MDFA 3L09A 2F9DA 1LV5A 1YJ7A 1XWLA 3GV7B 3SSRA 2MTLA 4V1Ak 1RAHB 4OHWA 3G86A 4DX7A 2OELA 2HLUA 2R7VA 3KJNB 1JJHA 4QIWD 1V6HA 2FLNA 4KGXB 2QFJA 1RWMB 3Q8YA 3WC2A 1FE0A 3MD3A 3JTOA 4F3QA 1M5KC 4K5RA 3I9ZA 2PFDA 4KFBB 4Q2MA 1W7WA 3CCUS 2M8HA 3MM6B 4DPYA 2CRLA 2DPIA 1SC6A 2A6MA 1S1TB 2NLWA 2D1CA 2EFOA 1NDKA 4NA2A 7AT1B 2LP4A 4NXMF 2FVPA 3MM6A 1RHKB 1FRLA 3WC0A 4A8SA 1RT7B 2AYEA 1U1LA 3QGPA 1ZA2B 4USVA 1NNDA 2IA6A 2UUWA 3Q2SC 4KHPF 1N5SA 2XGPA 2QE5A 2FJWA 4ZS6A 1UW9A 1RT7A 4EI2A 1QUPA 3GSIA 1HNWJ 4ZP8A 2EK1A 2XHCA 1VQKS 1JXEA 1XMOJ 2UP1A 1IXKA 2PDAA 4JV0A 2QL9B 4B3SF 2ASDA 3JSRA 1M1HA 2VG6A 3UQSA 4Y2MA 4N41A 4ZVTB 1GEHA 3KWMA 1FVQA 2R4FA 2B4UA 1D9FA 3MTJA 4KSEB 3FCVA 4DZ6A 2BKPA 1FX4A 3P49B 3NBPB 1ZTTA 1MWQA 4ZP7A 1XERA 3ELHA 1RU2A 3IG1B 4C8KA 1FRHA 3EYZA 5D15A 1D09B 1JLFB 5GVQA 3SCIE 3VZIA 4QYZJ 3KJQB 5LM7E 4YHHJ 1Y3KA 2DY1A 2I9SA 1LWEB 2OFGX 3NBPA 4JI2J 3D54A 2ZC3A 5LMNF 1YGYA 3MM7A 3JTPA 4LSZB 1FX2A 2OPPB 3IG1A 3SMZA 4UF4A 2I38A 1JLFA 4OV6A 1D9AA 2V67A 2CPHA 1LWEA 2IM3A 5ETTA 5AE1A 3OHBA 4G6VB 4EEYA 1GK8A 2PEHA 1P8GA 4YP3A 3VV2B 3ICLA 4AE5A 3W5YA 4ETXA 1LXNA 3L3CA 2ZBCA 5KFVA 2DR6A 3T3FA 1VC6A 2NREA 1R0CB 4HT5A 3FNNA 2JEGA 2ALZA 3GJSB 1NK8A 1CPZA 4O44B 2K8GA 1VK3A 2BKNA 3EX7B 1Z2ZA 3PYGA 2PO4A 4TYBA 4UTGA 3MPVA 4OYAA 2W9AA 2MSTA 3FEZA 1ZM9A 1F9FA 1TL5A 3TA1A 1K44A 1PG5B 3MPDA 3HHNB 4O44A 1L3SA 3NGDA 1OS5A 3BGLA 1WEXA 4NASA 5HVFA 1T8EA 4X4PA 3CF5Q 1SKWA 4C4WA 4DR3J 2PI4A 2B4VA 3A1YG 2E5GA 2KU7A 2VBYA 4FP9A 1AB8A 4JI0F 4K50A 4Q5VA 2DNQA 4KHMA 2ZZNA 5F8IA 3PHTA 3PX6A 4LF4J 4OQJA 3FBBA 4TVAB 2DHSA 5L9XA 1SH3A 2G0CA 5C2CA 4KRWA 3WQPA 4NYZA 1OYEA 2W4PA 2X1BA 2C2OB 3C14A 5DZ7A 4UZCA 2FLLA 1VC5A 1FEEA 3MOZA 3CCSS 5KFUA 1GFWB 3NAIA 1S5ZA 1BQXA 4PUOB 4ED0A 3OJSA 3CMAS 1N32J 1VQOS 1B3TA 1X9WA 2ZM6J 1VC0A 3FSXA 1HBMB 2B8PA 2X3DA 4CO4A 1SJ4P 4PUOA 3R5BA 2N4DA 4NZ6A 2ZNYA 1XK8A 4F0HA 2GJ2A 1TMMA 3UNYA 5KFGA 2RQMA 4B3TF 1HBMA 5IV3A 3M9NB 5H9EJ 4DI6A 1F5BA 2CJ9A 2RS2A 2NQPA 4LF6F 2UXDJ 1IBCB 1MSWD 4LUBA 1OO0B 5B7WA 3B4DA 2EI5A 2HQ3A 3CNQP 3KLGB 1EZZB 1IKVB 3HPOA 1JLEB 3ZZUA 3VWSA 1TVRB 2ZBQA 5KT7A 1S9GB 4HH0A 2F9JA 2A10A 2MHEA 4IFVB 3M8PB 5C2GA 3MM8B 2AYBA 1OQ3A 4U8VA 4BBYA 5J2PB 1R0BG 3CWJA 1Q81T 5FLXU 3KLGA 2XTJP 4U67Q 1IKVA 4TQSA 1TVRA 2MKHA 3KLVA 2HFZA 3N6MA 3G9CA 1NPPA 4HDGA 2XSFA 3LGNA 3JS9A 2WOMB 1S9GA 2OTLS 3H5UA 4DV2J 3C19A 4A4JA 3KG1A 4IFVA 3M8PA 3MM8A 5J2PA 5F8HA 1RWOB 2ZHOA 2VB6A 5DLGA 1NJYA 4CTAB 5FIIA 2AX0A 3FMWA 1B99A 4EBCA 3M32B 1H74A 3MR3A 4IDKB 1JLBB 1M0SA 3MF5A 4YY3F 1R6YA 5D4NA 3GPAA 2F5GA 2B51A 2A0FB 2VKZG 4LJMA 3JQMA 3IGNA 3TZXA 1SPBP 4I2PB 2I6WA 4JI4J 3A3OB 2UUAF 3OR2B 1SQGA 4IDKA 1JLBA 2VFVA 3I5AA 4NMLA 2W1BA 2L08A 4OL8A 1T7PA 4C3MA 1Y11A 4UT4A 1LK7A 4Y28C 4I2PA 1AFJA 3TI0A 4OI0A 3K5PA 2O3DA 3OR2A 4ANCA 1C0UB 4ALZA 4K4YA 2DNYA 4IO9Q 1FD2A 2KKHA 7FDRA 5IM0B 3MUTP 2CPXA 3OFHA 3CDAA 5AT1B 3LALA 4B3OB 4ZCIA 1WG5A 3NGSA 2BUNA 2RDDA 1C0UA 2F3JA 4PQUB 1F3VA 2H65B 2DBBA 3D9BA 4PABA 2J5AA 4X64J 1CG2A 2MZ1A 3QT8A 4RW6B 4ZOSA 2G13A 4PRFA 3EGNA 4B3OA 2ZFHA 4FXVA 4IH5A 2HRTA 5KG0A 4WF9Q 2MQOA 2QSWA 3HP6A 2K7JA 1KTVA 4PQUA 5CA5A 2V4RA 3FSYA 4ANDA 3ZTRA 4DV3J 3R6LB 1QLNA 2ZE2B 4RW6A 1T94A 1BC6A 1SV5B 2XO6A 2LMIA 1H98A 3HFKA 3I5CA 2GNKA 2XEXA 2CDRB 2D9OA 4ZVGA 3AY0A 4DX8H 2ZE2A 1SV5A 1SCJB 4ED2A 2MSSA 1MMDA 1S7HA 1TR0A 2XZTB 4C3LA 5F8GA 5JXSA 5BYRA 5IWAJ 2VPXB 2CADA 5LMUJ 3GV8B 1EJ7L 3V6JA 2NUHA 2YX4A 1MMLA 3FJ2A 1CQMA 4I6AA 1PAEX 1BWVA 4LFCF 2FLOA 5K14B 3F0NA 4RBTA 1VQNS 4LRAA 4IH6A 4NA3A 1YRTA 3VQSA 3LF0A 3WIVA 5C25B 4LF1A 4YB7A 4Y2IA 5EX3A 1X4FA 5K14A 3W9IA 1SI9A 5KFMA 1UPPA 3I6PA 3CULA 3BR9A 5F9LA 4JBCA 5CZXA 3S7RA 5K8PA 3THPA 5HLFB 5C25A 1GQEA 3LTOA 4X84A 4WP9A 3VAIA 3BKFA 1RTJB 4FKXA 2BX6A 1W26A 3KOAA 2B7BB 2L3MA 4KO0B 4Z7CA 3CTRA 1IJEB 2ROGA 4F0MA 1UVNA 3QWUA 2XULA 1XBWA 4F4WA 2FJEB 2AEMA 4XDDA 1G2EA 2ZZTA 1RTJA 2EKNA 1JB0C 2GZOA 4GKKJ 5DJBA 4KO0A 5L1KA 4X65J 4LVOP 4OHVA 1ELOA 2DNGA 3IP0A 4DR5F 3CO9A 1N33J 1RWNB 3TZWA 1Q78A 2HEKA 3UDVA 5DG8A 2QZ8A 2ZHAA 1AYEA 2YNGB 4K4TA 2J0WA 3BZQA 1F3FA 1M5SA 3I31A 4A8MP 3BKTA 1NAQA 3TYTA 1SKSA 2H1YA 4M5HA 5AE3A 2AX1A 4IQMA 2HHHJ 3PW5A 5THWA 4NLVA 4URQU 1URRA 1FDBA 3FQLA 3HM9A 3RB3A 4WBFA 2KFYA 2G2ZA 3AHPA 5J2NB 4IOCQ 1SJRA 3LANA 1WHXA 2P6TA 2CVIA 3AOBA 1RYRA 3H7HB 2OO4A 1HYSB 2ZH5A 4OJHA 3W5ZA 2JH3A 1WOSA 3A3PB 3H8YA 3ZC4A 4QR0A 4C98A 4ZMMA 1S4EA 3EWGA 4C11B 4N5SA 4KGMA 4OYOA 1UKUA 4NCBA 3DRYA 3MEGB 5K8NA 4DPXA 4DUZF 3UR0A 4Q7AA 4KE5A 1VQ8S 2ZH6A 4NYPA 4C11A 2HBRB 1KVIA 1NLKL 1UVKA 4M5JA 3DOMB 3MXHP 3ZZRA 3CIMA 4W4MA 5D0RA 1MLAA 2XG8A 4WFBQ 5GMDA 2YPZA 4LFBJ 4CH0S 2QLFB 3C8YA 4OI4A 4NLOA 5CD4H 2OFHX 3VGTA 2CQ1A 3NP5A 3DOMA 2BV3A 3N28A 1FXDA 4NPOA 4AQYF 2DHXA 5KFCA 2C22A 4LRDA 2VDIA 4ZPBA 1XTZA 3C6UB 4KGZB 3JSYA 3KDOA 4RW8B 3N4WA 3D6TB 4NI2B 4QU6A 4WK3A 4DLGA 5D4LA 4ED3A
chains in the Genus database with same CATH topology
4DSIA 2HAIA 2JFDA 3HVRA 2XHWA 3G6VA 2DCLA 3O3LA 2C42A 4ES2A 2A2CA 4TU8A 2QA4S 3PX4A 5FD1A 4LT6A 2IMOA 3QZ7A 4DQRA 3HHLC 3PX0A 1JLEA 1NHUA 3QIPB 2MZSA 3OVSA 3MUMP 3GFYA 4TLQA 2WBRA 2ZKTA 2LDIA 3VQTA 2X1GA 2PA8D 1JLGB 4RW7A 4RW8A 2X3GA 4A8XA 3AB4B 3V6KA 3V81B 5EWFA 2HHWA 3DRRB 1JXLA 2DGXA 3POTA 1H7XA 3FZBA 3ZZTA 4RWXA 4ECXA 1VGYA 2FJDB 1F2GA 2R7QA 4DV3F 2UUBF 1SUQB 1EETA 4QYRA 3UCZP 3NNHA 1Y0HA 1S72S 4W90B 4OZJA 5F8JA 1TL1B 2L9WA 2NPFA 2HVZA 1HW8A 3EZUA 2HHQA 2QA4G 1AROP 2MKIA 2UVWA 4U7UK 1KQFB 5KFDA 2VG5B 2EFNA 4Q44A 4QBUA 4YUDA 4CI0B 4F4KA 2M4MA 3QIPA 4J9PA 2VFUA 1FVSA 2BRLA 4KC5A 3HXMA 3HO1A 1ZAVA 1EP4B 3M30B 4QIVA 5KT2A 1VQ5S 3DGPA 4QIGA 2BDPA 4XPEA 1JLGA 4IKAA 3V81A 3DRPB 1ZYQA 2RRBA 3DRRA 4DQSA 2BQUA 2WOMA 2WB4A 3DLEB 1OSCA 3B4MA 3W2VB 1T3OA 1Y7PA 3MFHA 1SUQA 1FK9B 4YQWA 3OTOF 4V19X 3QAEA 1TL1A 5F9NA 3G8QA 2WONA 4FF4A 2CQ0A 3Q0AA 3IBWA 3VCDA 4C8OA 4QWCA 2VG5A 5B0BA 2U2FA 4KB7A 4ECWA 1U1NA 4ZPDA 2KG1A 1MW7A 3I32A 1HHTP 2FHJD 5DS7A 5IWAF 2K7KA 4CTAA 4MKBA 1EP4A 2O67A 1ZM4A 3I96A 2JL9A 3ONQA 2XI2A 3DRPA 2HWIA 2MKJA 3D28A 4I67A 2BQ3A 2ZD1B 5LMUF 2XNQA 2GMLA 2XZWA 3DLEA 3M32A 1L3VA 4QPXA 1ZPWX 3RW7A 2N7CA 5LT5A 4PWUA 1KS2A 3LWLA 3B82A 3MFIA 3NCPA 3PEJA 2LKZA 4Q45A 3AA9A 3V2UC 1FK9A 2DB1A 4A8OA 5L1JA 4ZVEA 1ULRA 1KFSA 1JLCB 1MROB 2XSJB 1VRUB 5CYMB 2XWYA 5EN1A 2VG7B 1TKXB 3R1HA 5IT4A 4J37A 4MIAA 2J6UA 3UE2A 4ECYA 3BGRB 1D1UA 4RU9A 2OKQA 4USJC 1P6TA 4DR4F 1L5UA 4FVCA 1Q86T 4Y2AA 1VQ6S 3O8WA 5IXUA 3SCLE 2FIUA 3SCKE 3GQCA 4MFBB 3RBEA 1T3NA 2GJIA 2V8HA 2ZD1A 2EBEA 4TLRA 4O3QA 2WB1D 3HHKA 2KRRA 3NCQA 4M5DB 1FO1A 2FPHX 4IOBA 2HHTA 4WFZA 1JLCA 2M0GB 1C1CB 1MROA 5IT0A 4CO1A 5GAHI 3IAS9 2CQ4A 2XSJA 1VRUA 3E3XA 3H25A 4NLGA 2VG7A 1TKXA 4O3PA 4DOZA 5I3QA 1MWYA 3BSOA 2ZH7A 3BGRA 1FKPA 4O3OA 1N8RT 4QR1A 2DJWA 4Y00A 3TO8A 3L95X 5GAEI 2ZH8A 2ZNZA 1V3RA 3NRBA 4X4TA 4KPYA 5EUHA 4O3SA 4H4KC 3UW1A 1BGXT 3AAWB 1PGZA 4J9NA 3KTQA 2GHWA 3H4BA 2R2TA 2RSQA 3C66A 2GFFA 4K2XA 4ZHRB 2CQHA 1BLUA 2OLWA 4OHYA 1U6FA 2VPZB 4X4OA 3GR1A 2XMJA 1C2PA 4M5DA 5AXMA 1T02A 1RP5A 2HHVA 3DHWC 2LDYA 1NO8A 1C1CA 2QA1A 1IR0A 4F26A 1U49A 2FD2A 4USHA 3C46A 5IM0A 1NKCA 1FD8A 3MECA 2UVVA 3PO5A 1HMVB 2ABYA 2B43A 3HLUA 1Y5IB 3H98A 2W8KA 2DO0A 4KQZA 3M6WA 2W7PA 3G6XA 1IJFB 1WELA 2J9DE 4XPCA 2BW2A 3GV5B 4MYUA 2Y1RI 3RB0A 4NLSA 4N56A 2MZQA 3IRXB 3CD5A 2LU2A 1YJTA 1U6ZA 4PKDB 3OFFA 5G0RA 4NLPA 1WF2A 4I4BA 1FRJA 5GAHU 1J5OB 1VQPS 3GG1A 3OFGA 2WRMA 2GGPB 3JYTB 1HMVA 3ZZZA 3FRZA 2B3TB 3RB4A 4H4KA 3H40A 5GAEU 4GKKF 2ATLA 1E6YB 3GYNA 1R3NA 2HHPA 3DHXA 3PNIA 4JOUA 1ZZNA 1YJWS 3HF5A 1U25A 2UXBF 4X65F 3EUNA 3K0JA 3I55S 3RW6A 1X7VA 4OX8A 1HWJA 1TKTB 3IRXA 1WD6A 2K2PA 2BYCA 2PN6A 2VH7A 3K5NA 5F0UA 1Q4RA 1Q16B 5HMWA 3TR5A 3THVA 4RNFA 1J5OA 1N33F 2VFSA 4O3NA 2F40A 4H4OB 2KI2A 2J0QD 1HD0A 1U24A 4ILRA 2GGPA 4NLDA 4RZRA 3JYTA 2XLJA 4ECQA 1GX6A 2GMJA 5LL6d 3TARA 1S9FA 1QVGR 5IT9Y 5A8KB 2RMLA 1S1XB 1FF2A 2CPDA 1QY7A 2HS4A 2Q3PA 3R3TA 4PXBA 2BXJA 5ADZA 2JEIA 1VOMA 4K0KF 1E6YA 4MJKA 4DEZA 1KC8T 3IO1A 3I0RB 2FUG9 5LSRA 5HP1B 1BQMB 1HFEL 2VG6B 3I87A 1P27B 2D3OR 4IR1A 5DDQC 1TKTA 5KAKA 4PQAA 1N34F 3HHEA 2FJVA 2R8GA 4U9RA 2A3JA 5KG2A 3MMCB 3PW7A 2WW8A 2ZH4A 2C3OA 4GO7X 4FS2A 1UWBB 1TK5A 1JMTA 2IBOA 1RDRA 4Q8EA 4ZVFA 4H4OA 4K4XA 3K59A 4LF8F 5BR8F 4BC9A 5A8KA 2CQCA 1S1XA 2LQJA 4V19J 1U6BA 2YNFA 3OV7A 1ZAWA 3TUIC 4ZKAA 1GH8A 4ELUA 1RISA 5HP1A 1BQMA 2YKPA 5DG9A 4JI8F 4EZ6A 2B4OA 2MY8A 3DXBA 2I1RA 2HG4A 2MB0B 3VAGA 4EZ9A 2CJQA 2B9YA 3QJJA 3MMCA 2IYIA 1BD6A 2HNDB 2V94A 3M4XA 3KHGA 1X9SA 2HHHF 2VA2A 3FFIB 1UWBA 2E7WA 3M8RA 1VQ7S 5DDPC 2W7OA 5KFYA 3NLCA 5A8RB 4FNIA 3KFWX 4WFNQ 1DRZA 4ED5A 1TFWA 3CDWA 1RK8A 2COLA 3KHLA 2A18A 3MI7X 2E1AA 5D8HB 1MNEA 3F56A 1B7FA 2B4PA 2FGOA 1NKBA 1N5TA 4WCEQ 5SZTA 4WZQA 1R31A 2OMLA 2R7OA 2HS3A 4IUFA 2AW0A 3MM7B 2KJVA 3GG0A 1WWHA 1VFJA 2FHJA 2ZC4A 3CCVS 1RT3B 2HNDA 3BQ1A 3FFIA 5KFTA 4R8UB 2XY6A 3T5HA 3IR7B 2CPYA 4O4GB 5A8RA 4CO3A 1DZ5A 3T5KA 1KSPA 4DL2A 3T1HF 2HLTA 4DFJA 1YVFA 3RAMA 3QYYA 2IA0A 3JB9k 3VALA 4NZ7A 3W2WB 1T03B 2R7XA 1JKHB 3BREA 3H59A 3N01A 4EUVA 4TNOA 3A8EA 1DQ9A 1N0VC 2ACYA 2HGLA 4IYQA 3DM2B 5HBMB 2MQNA 1QE1B 2CPZA 1RT3A 3ZZPA 3H5XA 1WACA 4K4ZA 3M05A 2LVWA 2Z2MA 4R8UA 4JYAF 1S4FA 2R9LA 4O4GA 1YTYA 2VD3A 3PJXA 3MEDB 1NK5A 1RQ0A 1HPZB 2IJFA 4G3IA 4P7TA 3T1YF 1O8BA 2R2UA 5CYJA 1TK8A 1UW4A 2KFZA 3MMBA 5CHCB 2HNYB 5KFQA 1H2TZ 3NWGA 3M9MB 5HLFA 1T03A 4BWMA 1JKHA 4ILLA 4R0JA 1YJNS 2BE2B 2P9GA 2H9ZA 2B56A 4BDPA 1FNMA 3LAKA 3OTBA 2EFVA 2JHEA 1H38A 1SQEA 2W25A 3DM2A 2DT9A 5HBMA 1QE1A 4I2QB 3I82A 4DS5A 2VL1A 5AXNA 3AH6A 1N54B 2VZ9A 1UETA 4F50A 2I2YA 2IRYA 3MMJA 1Y5LB 3VAKA 2QMXA 3S6EA 1C1BB 1Q79A 3MEDA 1HPZA 2P9EA 3KLIA 4QJVA 2ERRA 1H6KX 5FDLB 2CQPA 2MKCA 2E1CA 3IRWP 2YWFA 3DU6A 2ZH9A 2HNYA 1XR6A 2FVSA 4KTQA 4HVZA 4YR0A 1R8PA 5A8WB 2XY7A 1JX4A 4Q8FA 1WHWA 3N79A 2KG0A 7FD1A 3BGUA 2BABA 2VBXA 1FJ7A 1H2UX 2BE2A 2MKSA 3O6QA 2ZOMA 1VLYA 3ITHB 5K8OA 5DGBA 2BR0A 1QSYA 5JJBA 4HTJA 1VK8A 2HGNA 4LFBF 4G1PA 2NSBA 3ISNC 3OPKA 1VIOA 4OI1A 2NR0A 4I2QA 4ED6A 1I6JA 4WK1A 2AQ4A 4J9SA 5I3PA 4DBQA 5I42B 2PSZA 3QMQA 1HD1A 3T5LA 1C1BA 3MPWA 2DRBA 2XI3A 3TAQA 2IVFB 2DR5A 2O5DA 1Y00A 5FDLA 2VOPA 1KVJA 2J7KA 1S6UA 2DNLA 5A8WA 1X4CA 4ATNA 2HHUA 3CJ5A 4NRTA 5T41A 2ILZA 2HMIB 3K8VA 3IGVA 2C2RA 2PE8A 1RKIA 3ITHA 3QGGA 1ZTWA 1U4BA 1HI0P 1N88A 3BR8A 3CEDA 4ZPCA 3QGHA 1KD1T 2E44A 1Q8BA 4A46A 1OPIA 4DN9A 1XMQF 4UUWA 2ZOGA 1NU4A 5D4PA 5E41A 1HI8A 1LWFB 3CCLS 3KG4A 1IKYB 1DTQB 3JAMY 1B0VA 5JVGQ 3VR1A 2E7XA 3V5RA 4OX7A 2FJAB 4DUYF 5CYQB 3HKWA 2DR7A 2YNGA 5IS2A 2L48A 1RT4B 4K59A 5FLXY 2I0XA 1K0VA 4OHXA 4IR9A 4IH7A 2OJ3A 1VRTA 3HK2A 2HMIA 4GC6A 4QWEA 5EHHA 2M8DB 2EFPA 3CT9A 4OZLA 1FCAA 3Q22A 1KHWA 1R8CA 2VFTA 1G7CB 5AXKA 2QLXA 4MTPA 5KG5A 2VFRA 4WFXA 1RTHB 2IVYA 4ZCMA 4WFYA 3SV4A 3DOLB 3PRBA 3U1MA 1A9NB 5KT3A 4WU2A 4H4MB 1LWFA 3D1HA 3ENVA 3EPIA 4I69A 1IKYA 1SIZA 4RNHA 1DTQA 5MAOA 3M1VB 3KNGA 2KDOA 4QIEA 1UVLA 2MXYA 3AQOA 4TKTA 3EXCX 1E6VB 5CYQA 2YKMB 5J2MB 1RT4A 4H54A 2FB0A 3K2YA 3CGIA 2WTFA 3R1LA 2RQCA 3MUVP 3PVXA 5KFRA 1ZOTA 4ECRA 5F8MA 2NPIA 4TY9A 1M5HA 1JLAB 2VBZA 2LEAA 2RE1A 3CCTA 2W7AA 5KFBA 2JEFA 2DD8S 3G96A 3OL6A 2HVHA 2GIQA 4AXIA 2ADCA 4NRUA 2BBEA 2DH7A 3DOLA 3MCSA 5BYQA 3VF0B 1HL6A 1OQ6A 3T9ZA 3EZ5A 4H4MA 3QJPA 4JV5F 1S0OA 4F3OA 1K1SA 4I1TA 4TQRA 4EFAC 3M1VA 1HBNB 2B7CB 2ZJQQ 4JI6F 2JOQA 5J2NA 3LGMA 1PC5A 4OZ5A 1E6VA 2YKMA 1IBLF 2RVJA 5J2MA 2KVIA 1N5YA 2JVOA 3PDNA 2WBMA 4X4RA 3CC4S 2KYZA 4N8NA 1NEEA 3N9UC 5KTQA 2JWNA 4YFUA 3RAXA 4GMKA 5DETA 3J81Y 4BCAA 3CXCR 1HYSA 1YRUA 1JLAA 3OVBA 1D8YA 2CZ4A 4MAKA 4J9LA 5EX0A 1HBOB 1TFYA 4B9LA 3J7YI 1N6QB 1NK0A 1RT5B 4ZDNA 4MKYA 3GIMA 4ZPWR 4I68A 4GO5X 1U2RA 4LSLB 2DH8A 2FY1A 5KG3A 2EFQA 1S6PB 4I64A 2IJNA 2Q6CA 1HBNA 2XGQA 3ZZYA 1Q82T 2PT0A 1JIHA 3CSKA 1GXTA 1X4EA 4DHVA 1TKZB 3K5OA 4PG4A 4JV1A 4MIWA 4HKQA 1D0EA 3GIIA 4I0WA 3DI6B 5KG1A 2EBGA 2IMWP 3D0IE 2XO7A 5BYSA 2PGCA 1V3ZA 1DTTB 4PXEA 1MWZA 3MEGA 1SJQA 2DNOA 2CQIA 2ROPA 2J9EA 1HBOA 2YX1A 1VQ9S 4Q2LA 1N6QA 1RT5A 3NS5A 4IFYB 3BSAA 2VQFF 4RBUA 2VONA 4ILMA 3UCUP 2IRUA 2PMHA 2M88A 3F41A 5B0GA 4Q43A 3R27A 2XMVA 2AYMA 3IWNC 1GX5A 1M5OC 1HHSA 1IUJA 4C8ZA 1H3DA 4MYTA 1UFWA 1UJ6A 1TKZA 2APOA 2HVIA 2ZUGA 4B9TA 4LF5F 1VQSA 2E1RA 2AD9A 4N47A 1NJZA 1WTBA 3DI6A 1TQLA 2GHVC 1HNIB 4P2SA 3K8WA 4DL7A 2DO4A 1VS3A 1DTTA 4L3NA 3TA0A 2PFFB 2VQEF 3E51A 4B08A 2KB2A 3GFXA 5HMXA 3BN4A 5M2RA 4OX9F 3UR3C 4PPZA 3G4SS 1DLOB 2R2RA 1S99A 3J7YU 4DV7F 1U8SA 1QVFR 2HPUA 2MMYA 3QGIA 4KR0B 4M94A 1S49A 3SFGA 4A8FA 2RQ4A 2MDAA 3QO9B 2GCFA 3T1AA 1S79A 4OJ3A 5H1SV 1S1VB 3BGFA 4UW2A 2JZ5A 3D5MA 5LSOA 2GA7A 3KLFB 2XMMA 4RW9A 1HNIA 3SCJE 3PM9A 4DQIA 3PW2A 2EFGA 3NMRA 1LKZA 2UV8G 4FF2A 2DNMA 2QYCA 1U1KA 1KOHA 3N6NA 4EO6A 1X5PA 2WCXA 1DLOA 2XMWA 3R5AA 2M3DA 3OLBA 1SJ3P 4NOHA 2YWGA 4NLQA 3NCRA 4DSKA 2E29A 2D3UA 2MJNA 5K9FA 2KFNA 4MIBA 4CH7A 3MZIA 3QO9A 3CCRS 5F3ZA 3PXGa 4B9UA 1S1VA 5KFLA 4EGLA 5KFWA 3KLFA 1UFLA 2LYVA 4OFZA 2C28A 3HZGA 1S1WB 3C6UA 1R7IA 3MAHA 4CIOA 1FXRA 2O01C 5LJ3Y 1T05B 2I8EA 1UVIA 1KTQA 1ZETA 2LLZA 1U2FA 1P1LA 5HO4A 4AL6A 4KV8A 3PW4A 3AA8A 2RKIA 3TANA 2AU0A 3G8TA 2PMZD 1KQGB 3WBZA 3RRHA 4PG6A 2G9OA 3E01B 2K3KA 1H7WA 2B9WA 4MKAA 3M2RB 4Y34A 1AUDA 4Z37A 1MMNA 3M8QB 2RT3A 1CC8A 3CDBA 3OTEA 5DG7A 4AYBD 3O1LA 1S1WA 2LEBA 3MEEB 1D9DA 4ZPTR 4N76A 1IM4A 1T05A 5BJRA 1SJFA 2KT5A 2M70A 3V6HA 4M63A 3QZ8A 2E66A 2DPJA 4EU0A 4A8YA 2DGVA 5KG6A 3HMJG 3MURP 2R7RA 2VC1A 1XEZA 1ZZFA 2HRYA 2RDIA 3CCMS 1S0MA 1FDDA 2DR9A 2W4CA 3E01A 2EG2A 3SZ2A 1N5VA 2VC0A 3I4PA 4RW4B 5KFHA 3TQ1A 3M2RA 2ASLA 3GYXB 4AFFA 2MZJA 5MLCV 1X5SA 4XAKA 3M8QA 3CD7A 3RBDA 4CZCA 4DL6A 3N6LA 3EXYA 3G6ES 1NK9A 3MEEA 2R7TA 4X4VA 2MKKA 3KK1B