4AL7A

Crystal structure of the csy4-minimal crrna complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
189
structure length
155
Chain Sequence
FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQALDLPFVTLRSSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
molecule keywords CSY4 ENDORIBONUCLEASE
total genus 31
structure length 155
sequence length 189
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4al7A00
2XLIA 4AL6A 4AL7A 4AL5A 2XLKA 2XLJA
chains in the Genus database with same CATH superfamily
1FFSB 3D6HB 1SH2A 1KTVA 4LF1A 4WU2A 3LGMA 1CULB 2GJ2A 2YWWA 4OX9F 3TVYA 3MD3A 3UDEA 1M5OC 1M90T 1JXLA 2HHQA 3WZ0A 4NE9C 4L3KA 4U8VA 1H6KX 1QUPA 1Y11A 4CO0A 2HHHJ 4O3SA 1EX8A 2GX8A 5HL7Q 5DGAA 5KFLA 1KQGB 1JKHA 1SL0A 3QRRA 3S6EA 3ZZ0A 3AQPA 1MU2A 4ZIWA 2WONB 2MZSA 3T5JA 1EJ7L 5C24A 3SV3A 3J81Y 4OZLA 2UUCJ 1QAJA 3TQ1A 2GVZB 1VBZA 1H2VZ 4WPAA 2DY9A 5E41A 2BM1A 1FKPA 5LM7E 1BQMA 3P8BB 3DN9A 4HH1A 3S01A 2W7AA 2HKEA 3PEJA 1NRKA 4JI1F 3CDEA 1SJRA 3C6TB 1UEKA 1SJ4P 4WZMA 1UEVA 1FNOA 1K8AT 4ES1A 4K8RA 4CLLA 1TL3B 4NLPA 2VASA 3T1AA 2KVQE 1OIAA 3MR7A 2MDAA 4P7TA 1U6ZA 2E1PA 2KDOA 4RJVA 2JDJA 4OZJA 1FK9A 1TUGB 2B4VA 4ZCKA 5A76A 1LWEA 3CJ3A 4TQRA 1ZZNA 3JTOA 3BN7A 5AE2A 1WF0A 3SXLA 3GIKA 2RHSB 5LSLA 1HNXF 1S6QA 1WELA 3HO1A 1RWMB 4CLUA 3W62A 4DI6A 4ELVA 3CDWA 2D3OR 1BUXA 3DHXA 4A8QA 2I5JB 4JI8J 2HVDA 5HROA 4LSLB 4ZVPB 3AXMA 3QJJA 2CQBA 2DNZA 4X65F 1J27A 2WB4A 4D3HA 1JJCB 2CPIA 4ED3A 2XMUA 3NAIA 1ZPVA 2R4FA 4DR3J 1RT7A 1RTJB 3B82A 3DLGA 4FF2A 2Y8YA 1EP4B 1HWKA 3C16A 3G71S 1N5SA 1NK0A 1PYTA 3KTQA 2B4UA 2CPZA 3BO2A 2UVVA 1KBRA 2F40A 2OMOA 1X4GA 3CJ0A 4CP5A 1NJIT 1GK8A 3LAMA 3VHQA 1CJVB 1X8DA 1XTZA 4OZNA 4G3IA 2HFVA 3ILJA 3K8WA 3H2VE 1HW9A 1RTJA 4DR6F 3D6MB 2F1FA 2A3JA 4UQGA 2Z2MA 5T7LA 4P75A 3RRKA 5A8KB 4YOEA 1F2GA 2XSFA 1Y10A 1PJ7A 1S4FA 1UCNA 1WG4A 3KKFA 2JEIA 2G0IA 4MYTA 3KYLA 1RACB 1DQAA 4O4GA 1WD6A 1YZ6A 3MPUB 5M2RA 1FRMA 4NYOA 1CPZA 1I51B 4P71A 1MMLA 2FLNA 4AUKA 1CBKA 1WF1A 1JIHA 4OLPA 8ATCB 4RX6A 1XERA 2NSCA 2YWHA 2OPRB 3JQKA 3VVUA 2V69A 2HQFA 1FVQA 2V4JB 4ZN1A 2XBPA 2Q1LA 5ITHA 4DV1J 3KJFB 3HM9A 4J9MA 1DZ5A 2YPZA 3QAEA 3OVAA 3LP0A 1ZZFA 2F65A 2HRYA 2RQMA 3QGHA 2A18A 1FE0A 1X0PA 2BANB 2LECA 3LOUA 3PYEA 4USJC 1CC7A 3KK2A 4O3PA 3LPEA 3SSSA 1WNEA 2UXDF 3HVAA 2MJNA 1UKUA 1JLGB 2C3PA 4LFCF 1IKYA 2IM3A 2DGUA 4B17A 3T5HA 2DR8A 1JLFA 1VLOA 3IM8A 3SQOP 2GVZA 4CZCA 4DSFA 3DU5A 2ZWPA 1X4EA 3HT3A 2RB7A 4I2QA 2RDJA 4EBEA 1RAJA 1D09B 3F0NA 3Q89A 3DOKB 2BVZA 1S5ZA 3ILLA 1FT8A 1H0HB 4FYVB 3KJVA 2PA3A 3DLJA 2LVWA 3BPSP 1KC8T 1VBXA 1NK9A 1QTNB 4QIWD 2H48B 2B8QA 2FHKA 4WKRA 3OFGA 1EZZB 3HF5A 4K4XA 3V4IA 2FJVA 2FIUA 3TA2A 5HP1B 2P9GA 1KLMA 2BX6A 1NSQA 5M2UA 1I94J 4LRFA 2DNHA 2K7JA 2J5AA 3SCIE 1VIXA 1RLCL 3CJ5A 2ZH3A 2PA8D 3J7Z5 1RDRA 3QWUA 3RUBL 1ZAWA 2DXEA 3PJWA 4A8OA 2XLKA 2XMJA 3GYGA 2G9OA 2A1BA 3H20A 1AZSB 1V9OA 2FJDB 3PHTA 2QIFA 5J2PB 2D3UA 1UVIA 5KFIA 4CYUA 3MTKA 4KGMA 3GIJA 5C5JA 2NPFA 1W26A 1VQKS 4PWDB 3DC2A 2D9PA 2OEKA 1S0VA 2N4DA 5KFKA 5AXLA 1S1VA 4KKOB 5CHCB 1TU0B 4HR2A 4USIA 5KFRA 4DPWA 2BRKA 1UEUA 1NPPA 3C14A 4B3TF 3E2EA 4GVBB 3C19A 1Q82T 1M1GA 4K0KF 4GRSA 2C2RA 4OX7A 5CYJA 2X1GA 4MMOA 2NXJA 4RW6B 2HQIA 4O3NA 3ENWA 3I32A 4ZCIA 3TAPA 5J1EA 3HVTB 1PYOB 1R8CA 1T3OA 2GO9A 3ENAA 1FK9B 3H98A 3LPYA 4NI2B 4ZJQA 2BQUA 1VR6A 2VG7A 3GE9A 1IBLF 2KJWA 3T3FA 3MOZA 2CA9A 4UOFA 2IRYA 1RWWB 1KONA 3MM7B 1CLFA 3N6LA 2LEPA 3U02A 3ZZYA 2HGLA 2XZDB 2YWGA 3FKBA 2CNOB 2ABYA 4ANCA 4YS2A 3CULA 3GSIA 1PJ6A 1R3NA 2YNFA 2ZITA 2FJXA 1K1QA 3W8PA 4UF4A 4AXJA 3HVTA 2B7CB 3I31A 5D77A 3D0HE 1TUWA 1WOOA 2PT0A 3L7UA 3R1LA 4AYBD 3HDSA 1SBRA 1GNKA 2XHCA 3SQGA 2C1EB 3R5AA 1OY6A 3FBEA 4NLDA 1T9YA 1JLEB 2CPEA 3C6UB 2EKNA 3T5KA 1Q53A 1OSDA 3UNYA 4QWDA 4K4WA 3US5A 4CI0B 2JEJA 4LIRA 4B9UA 2P9CA 2R8JA 4LRBA 2B9WA 4ZKAA 2QA1A 3M8QB 3DHWC 3NWRA 1C0UA 4Y6IA 2PE8A 3IA0A 3KJQB 2QFJA 1HNWF 1F2HA 1RHRB 1SL1A 2C28A 2ROEA 4JUZA 4JI3F 1N8RT 2QT7A 2BOPA 3X1LB 5BR8F 1U1OA 4K4VA 1GEHA 3CT9A 3MZIA 1UZDA 3DYAB 2VHGA 1SJ3P 3K2YA 2Z4PA 1GXLA 1GX5A 2YQ3A 4WTYA 2ZM6J 4CCHA 1RAEB 3R5GA 1TUVA 2VU5A 2YKMB 1OO0B 4EO6A 3Q8RB 5D8HB 4DV6J 4FYWB 1U2FA 1WI6A 1JXEA 1RTHB 4K5SA 4A48A 5JVGQ 2E66A 3TEHB 2QLFB 5K9FA 1MSWD 2K7KA 1WC0A 4TY9A 5FD1A 1HD0A 2OPQB 2KFNA 1XK8A 4IFYA 4MT1A 1WEYA 1U25A 1LWEB 2H5JB 3AOCA 1KHVA 5FLXU 2HNZB 3PO4A 2YNHA 1HBMA 2IHR1 1HQUB 1WUUA 1YWXA 2KJVA 3J80Y 4ZN3A 4S0MA 4KFBA 2ZD1A 2CJBA 4OHZA 2EPIA 4YR3A 3MUMP 1RP5A 1DAXA 1PSDA 2W1BA 3VQSA 4DCPB 3VAHA 1FRHA 3V6DA 2ADBA 1GTEA 2YVSA 3MI7X 5HMZA 1V3RA 2J0XA 2BKOA 1JLQA 2YX7A 1T05A 2HNDB 1FWLA 1U0HA 2UV8A 1CJUB 3R3TA 1GMWA 2IJFA 3LP2A 4JOUA 3WHIA 3OBIA 4A8XA 4C3LA 3GILA 4EZ6A 1ZYQA 3K5MA 1NLKL 2EK6A 3BKFA 3LQVA 4DUYJ 1NKCA 1RWUA 3E8OA 3D6TB 3G87A 3G82B 1OMSA 3TAMA 4PQUB 4B02A 4HACB 1RTZA 1RISA 5DO2A 3ILOA 1CS4B 2QFIA 3AB2B 4AQYF 1UZHA 2MSSA 1AUSL 5L1KA 1D8ZA 1VHIA 4ZA1A 3H8YA 3OTBA 1H38A 2I2YA 1IVZA 2WCXA 4C11B 5K8MA 1OY8A 2QLXA 1F0XA 2ZE2B 1NH8A 4ERDA 2CUYA 3DLEA 3OR2A 4ID5B 4PG6A 4ZOSA 4ZK7M 5DLGA 5H9FK 4RNHA 1L3UA 5HQLA 1KRPA 4MIBA 4IRKA 4NXMF 4C8LA 1VS3A 2ZZMA 1GX6A 4B3RF 2CZ4A 3OJUA 1KS2A 2RRBA 1B7FA 1U4BA 5L9XA 4PCQA 3W5ZA 4CO3A 2ZHBA 4ID8A 2HWIA 1VRUB 1UPPA 3CO9A 3VGTA 4C11A 4ZP6A 2MQQA 3EMTA 3UO0A 3M2RA 4FPIA 4DBQA 5IV4A 5KFOA 4X4OA 2FHOB 3CC2S 3QLHA 1D0EA 4B3RJ 2DBBA 4ECXA 2F9DA 5GADU 2WTFA 1NUEA 2XYPB 4NEYA 3SSRA 3QATA 4NMLA 5IM0A 3PW2A 5ETSA 2KXHA 2R2UA 4LIWA 3M7VA 2GC8A 2XS5A 2AYEA 3B78A 1V5VA 3VAJA 3HT0A 4ER8A 2YKOA 4ED0A 1F5BA 3LWLA 2JC1A 5D0EA 2B4PA 4OYWA 2VQFJ 2YX4A 1UTAA 2A0FB 2E1MC 3B4MA 1LWCB 3O5TB 4K2XA 1TQLA 4FF3A 4F4XA 2FD2A 3HD1A 1U0HB 1C4AA 4IG3B 1CJKB 2ZBCA 1IKYB 4ZVOB 4QW8A 3KLFA 4JYAJ 3UW1A 2J6UA 4NLVA 5IC4B 2BOAA 1IBKJ 1S9GB 3NS6A 2AD9A 4DWIA 4C2MA 1TELA 2RSQA 2V8HA 2IVMA 5AXMA 1GFWB 1YIJS 2VA3A 4HDGA 4C7QA 4GVBA 1RKJA 3J7YU 2PO4A 4EK2A 4A4JA 4AE5A 2YNHB 5HMXA 3H25A 1RCOB 4ZLPA 2MSTA 1WG1A 4YN3B 1IWGA 1TR0A 3Q8UA 4PWWA 5KFCA 4HI1A 4CIOA 2AW0A 2ZZTA 1YJ7A 3FRZA 4UW2A 3PX6A 2HWTA 4WWSA 1GXTA 3L4BC 2AGPA 4IYQA 2HVHA 2OGUA 1IWAA 5EWEA 1IQTA 2HHVA 1URRA 4DUZJ 1NNDA 2GJIA 2VPWB 5KG4A 3WIVA 2V34A 4G6VB 2AF6A 3FDSA 2XM3A 1F3VA 3V6HA 4PPDA 3IG1B 5A8KA 4HHJA 3QYYA 1YX2A 3MM8A 2DPJA 2BJ7A 3MF5A 4DPYA 1XC9A 3HI9A 2BJ9A 5DDOC 4FYXB 4HTIA 1SJQA 4J9PA 1RYSA 2H5IB 2NUUG 3W5XA 3HKZD 3JQJA 4ZVGA 4RR5A 3GIMA 1SJFA 2DNLA 3QSYB 3U27A 4DSJA 1U6BA 3IR6B 5CABA 2RQ4A 3TA1A 1BD6A 4BWJA 3DM2A 5KT6A 2HHSA 3W9IA 2YKAA 2EI5A 3M32B 4IH6A 4WZQA 1S1TB 2WW8A 1WC4A 1GMVA 4ITSA 2B4OA 4P2FA 1S72S 2OPSA 4ZS6A 3ZZOA 5HK4A 4NZ0A 1K73T 2RDIA 4MK9A 3R97A 3WDOA 4EWTA 4I1TA 5JJBA 5GAHI 1U0SA 4B9TA 4PEOA 4JI7F 1Y7PA 2DT9A 3DRXA 2ZOGA 4OZ3A 4DQQA 1DLOA 1OS5A 2DNNA 2MGZA 3NMAA 4YB5A 3UVJB 1ZTWA 4UOCA 1AYEA 3PIPQ 2CADA 3MM7A 1DRZA 2YWFA 1KKHA 1F5CA 2PMZD 5A2QU 5LMNF 1X9SA 5HVGA 1IKXB 3T9ZA 3KLIB 5I4MA 5M2PA 1HNZJ 1UL3A 3C6UA 4WCEQ 1FXLA 2NCKL 3KK3A 3FSIA 4LF4F 4JI0F 4OYPA 4OYBA 1B0PA 3BSCA 1FRJA 3MHYA 4CT8A 1S1VB 1FEEA 3PM9A 5LMUF 3KMSA 1EAYC 3BH7B 4CTAA 3TUIC 5A6WA 3W5YA 1W2BR 1IBMF 1IBCB 3POTB 4UY8T 3V5RA 1FRIA 4ZVRB 2JFKA 2YKNB 3CJQA 1EETB 3E01A 3TZYA 4PXBA 4K4ZA 3QMQA 1FEHA 1U1KA 3KLHB 4C48A 2V2ZA 3FMBA 3PW0A 1S9GA 1VQLS 3NOCA 3OXLA 5IT4A 4ECUA 4CO5A 5LOQA 3HHLC 3CCSS 3OFFA 1E6VB 3OD2A 4H4KA 1QAYA 2ZC4A 1VBYA 2RT3A 2VPYB 4PYAA 2HMIA 3EGZA 3MAAA 1VMBA 1X31C 3FK4A 4QWAA 2Q3PA 5L1JA 1U1PA 1KD1T 1RTHA 2DITA 2VJUA 2PFDA 2YH1A 2QL9B 3THVA 4M5HA 1R8BA 3G2XA 1X7VA 2LXUA 2J8SA 5DQHA 4UTGA 5T41A 4RW4A 2OFHX 4O4RA 1YHQS 1FJEB 4NLTA 1H2TZ 2OAUA 1ZAVA 1T95A 4UUXA 2J7WA 5ETNA 1KOOA 1FNMA 1NMEB 2DHSA 2KXFA 2V0NA 4CNYA 4ZPBA 4DPTA 3MAAB 1VYAA 2M9KA 3CDUA 4JI2F 3MAHA 3C8YA 4DR5J 3HSGA 3QWPA 1P1TA 2VFSA 2XGPA 3D7SB 5HBMB 1APSA 2OSQA 4MIAA 1JWWA 2CPFA 4LF9F 3MEDA 2BZ2A 2IMOA 4QBUA 1MW7A 2K3IA 3IFEA 4ZPDA 2EG1A 4R8UB 3TWZA 1FXRA 1LK7A 1Y3JA 4FDFA 5B0AA 4TLRA 1VJQA 4KYZA 2DO0A 1N0UA 1T0TV 4IH7A 2MKJA 1N52B 4D3GA 3NMRA 4DR7J 5CH7B 2GVDA 3NEKA 1HQEA 5DZ7A 3UN2A 3ZTPA 4EYIB 1VQMS 4J9RA 1RB0A 1IXKA 2IDLA 4G65A 5I42B 3GV7B 3FNNA 4ECVA 3N01A 1XWLA 1FA0A 3QNWB 1SUQA 1PGZA 5DQIA 3M2UB 1Q79A 4J5OA 1XMQJ 4JV5J 1R27B 4NA2A 3QO9A 2CPXA 2AEMA 2LKZA 4FVCA 1ACMB 4PG4A 1AB8A 2UV8G 4F3QA 2ZJRQ 4F50A 4K4UA 3AY0A 2G1DA 2ASYA 2VBYA 5RUBA 2N4CA 4O4GB 3O3LA 2DNGA 3A4TA 4B3OA 4C8NA 3UWTA 4CH1A 2C2EA 3DI6A 4JI5F 2WONA 2RQCA 3B4DA 1HNXJ 3H5SA 5GMKa 4RUHA 2VC0A 3N6MA 2HNZA 1KQSR 5IV3A 2FVCA 4RLEA 5DGBA 4LUBA 3DKDA 1YKWA 4LFAJ 2KH9A 3OSPA 3TUJC 2MMYA 2UUAJ 2J0SD 3GR0A 1IUJA 2XY7A 1GMUA 1SKRA 1JB0C 3WC2A 3HHNB 1FRXA 4ECSA 1SKUB 2U2FA 2R7WA 2V8VA 4KBIA 4TNOA 2FVSA 1NZ8A 2C3YA 4KR0B 2M8HA 1M5PC 2LXIA 3GJQB 4NCAA 3BSAA 4Q44A 3L9ZA 1U47A 1NM2A 2QSFA 2J6TA 4K4SA 2V2VA 1NPRA 2V9KA 4G1QB 1DARA 4FNIA 2HFZA 4YEAA 4EGLA 1JLBB 4I6WA 4YR0A 1F3FA 3UI3A 1XN9A 3UR0A 3ZTRA 2VC1A 2W7PA 4N41A 2PI4A 1N33F 3DMJA 3PJXA 2RKIA 3KK1B 2DNYA 1LKZA 3IGNA 3ZZRA 2VQEJ 5HBMA 4ELUA 2YKMA 5E7OB 2A6MA 2HQ3A 2E5HA 3DCAA 4TU7A 5H9EJ 2I5JA 3HMJG 2KTQA 1HHTP 1S1TA 4M5LA 2VG6A 1HNIA 1SV5A 1WSRA 3ZXWA 2MYFA 1RAOA 3M1VA 1NPKA 2HFUA 2R7SA 2CVIA 1CQMA 1A9NB 3GFXA 4F04B 3DLEB 1RHQB 3IMQJ 2ILYA 5A0YA 5H9EK 1QJHA 3PTWA 2FC8A 2V8PA 3MECA 2AV5A 2HAFA 3IWXA 3OT9A 4OZ2A 4XAKA 4BHQA 3R1HA 1K0VA 1L5UA 1JMTA 1MMNA 1R0CB 2AJFE 2IM1A 2J76E 3ZZZA 2HS4A 3IRWP 1LFPA 3QIPA 1VDHA 2C3MA 3WX8A 3SYZA 4DFJA 1D8YA 4KQZA 1RGVA 1QAIA 3QT5A 4CLYA 1FDAA 3ZO7A 2RF2A 4X4QA 3EZ5A 2RD5C 3DI6B 1P9YA 3ICLA 4MKAA 4XTTA 3KLGA 3CUNA 2JHEA 3ZZTA 1XNRF 1NKEA 1TKZB 1UJ6A 2MLXA 3BGRB 5E3CA 3H40A 4J9NA 3KNAA 1CVJA 1SC1B 2CJ9A 3NS5A 5HROB 4DFPA 3PW7A 5J2QB 1YJWS 4KY3A 1L3KA 5EHHA 2HZVA 2VKZG 4IFYB 3HXMA 1S0OA 4Q45A 1WHVA 3BF4A 1U1RA 3AT1B 2BJ8A 3KWMA 2PD1A 5IWAF 3MTJA 4JI5J 4PPZA 1KVJA 2X1AA 1IKXA 1MNEA 1Q5VA 4ZVFA 5KFTA 4PUOB 2M7SA 2CQ2A 1C4CA 3BGRA 1FRKA 5B0FA 4DN9A 2XO7A 3IS9A 2Z0GA 3OR1B 4ZVHA 5MAOA 3D1HA 3FJ2A 4DL3A 4LBHA 3ZTQA 1BQMB 4Z37A 5HQ8A 2GQ2A 2MKYA 3N28A 3OL7A 4A8MP 3ISND 3CJKA 2W2PP 3DFEA 2HVEA 4F0HA 2NXUA 1BMQB 3OV7A 3ZNJ1 2K2PA 3H0PA 1DQ9A 3PJ9A 1WDTA 4KKOA 4OYMA 5BJRA 1C1CA 2H51B 2Z57B 1KFSA 2BJ3A 4Y2IA 2L48A 4FNHA 1U2RA 5KFJA 5CD4H 1SXLA 1LWFA 3A1YG 3I0RB 4RBVA 1VHFA 4DX8H 5IT0A 1V3SA 4UZBA 3VAFA 3PY8A 1IR2A 3BS9A 3EDRB 2NYHA 1L3SA 1ULRA 2ALYB 3GV8B 2IYGA 1YG0A 2BW2A 3GB0A 3W7BA 2ZNZA 3BGUA 4FXDA 3DLBA 2FZGB 4NLSA 1PC4A 2MKKA 2R3VA 4OLOA 2PMWA 3BV8A 3QSIA 1G4CA 2FQQB 4OFZA 4C0HA 4FYDA 4F67A 1QSSA 1SQGA 3KLEA 1VQPS 1KFDA 1NJXA 4ES2A 2VICA 1RT3A 1KR4A 1PCAA 7FD1A 2NR0A 2VG6B 5LXYA 5D4OA 3D4JA 5BYRA 2DGWA 1U26A 4MIWA 3CCES 3DRPB 1S76D 4KO0B 4NCGA 4WF9Q 2E1RA 2OD6A 3D1QA 5L9NA 1JJ2R 5C42B 4DR4F 2HBQB 1LWXA 7FDRA 2DVIA 2XS2A 1P1LA 4Y0FA 1FKOA 3R7NB 4DEZA 3W2VA 2HRTA 3G96A 1LQ9A 2F9JA 8RUCA 3N6NA 4O0IA 3ET6A 2EKYA 5DQGA 1GAOA 5HMYA 3PDNA 3CB4A 2YBVA 2J9DE 1HLWA 4RUCA 2QYGA 2Z2YB 3WIUA 1WTFA 3Q86A 2AJ0A 1RWKB 5EWGA 1N32J 2ZBPA 1RU2A 3A8JA 3LO3A 5KFDA 2XS7A 4L6V3 3P45B 2KFYA 3AOBA 3QGIA 3CD7A 4C6AA 3X3UA 5KOXA 1J5EJ 3FCVA 1HI0P 1BLUA 4ZP9A 2QGFB 1D9FA 4FPRA 1S97A 4ZPCA 4CO4A 1QM9A 3N5FA 1N34F 1NSKL 2V8DA 1CJTB 2A2DA 1QUVA 2HQDA 3MFHA 1T9WA 2VZ9A 1EARA 2WOMA 2ZFHA 3U7JA 1KP6A 1RT4A 3BGFA 4MKBA 3VCDA 3QT6A 3ENVA 5E3RA 4DV4F 5IT9Y 2KT5A 1IR0A 1G7CB 2B51A 5CYMB 3OL8A 4DL6A 1D9DA 5KFQA 4PWDA 4R8UA 5GMEA 1HWJA 3RTVA 4X4TA 5KG5A 5DDRC 4Z7YA 1YGYA 4WJBA 1UVLA 3JQMA 5CYQA 1Q8BA 2DKOB 4OHVA 2IRXA 3BREA 3SDEA 3CCUS 1AFIA 4PR6A 4ZVQB 1EIYB 4DSKA 4QIEA 4X64F 4A8WA 3C15B 2MPUA 4RW8B 2UUCF 3V6KA 4ALZA 1RAFB 4RU2A 1Q1KA 3BO4A 4J9OA 1AT1B 1T03B 1PAUB 2EFOA 5CYMA 2C3UA 4ILMA 3MFIA 3I55S 5D6GA 2BBEA 2CVEA 4EUVA 3CXCR 5L1LA 3MXHP 3MCNA 4DX6A 4DXLA 3FEZA 3DNCA 2RU9A 3K5OA 4UUWA 4ZP8A 2HSEB 1EP4A 2V63A 3AH6A 1YTYA 2IRUA 2NREA 1RT5A 2HHTA 4C3MA 3V81A 2P5VA 4YB1P 2K3KA 1F9FA 2JLEA 2OP5A 4DMZA 1U1LA 2C42A 3G82A 2W9AA 4IUFA 3H5UA 4B3OB 1RWOB 2EFQA 4HDHA 1AXQA 1N5VA 1DTTB 3AOAA 2DRBA 3CCRS 1T7PA 4Q8EA 3ENQA 4K59A 2DR5A 4DR4J 3SCJE 2L08A 1GXUA 3LGNA 1JNRB 2KM8B 2FY1A 2NXNA 2XMMA 5DG7A 3A13A 4H4OA 4LJMA 1NK4A 3H5XA 4ECZA 4N56A 2E29A 4X66F 3TVZA 2GFFA 4V19J 4DUYF 2H4YB 3MMJA 4R25A 4RNNA 3W3SA 4U96A 2Y1RI 3JTNA 1U6FA 3CCTA 3PNIA 3IM9A 4R5PB 3KLGB 2HVIA 2CJQA 3TRGA 3J7ZT 1XNQJ 1CC8A 3M30A 2UUAF 2MZJA 1X5SA 1O8BA 2BJDA 4TLQA 4ZPVR 2FGOA 1P27B 3RW7A 2L41A 4LF8J 4RPFA 3UN5A 2BJEA 4OZ0A 2IJRA 4Z7CA 3M8WA 2KYXA 1S1WA 3VQTA 2V4QA 3R9LA 3MEGB 1WG5A 5I3QA 3BSOA 1F5AA 1H7XA 2ZUGA 2YTCA 4C8YA 3OW2R 2NUHA 2GHVC 1F60B 1MWQA 2DNOA 3BGLA 4FKYA 1QE1B 2VPZB 1MLAA 3K89A 4UZCA 1YITS 2R8HA 1U45A 4OI6A 4IFVA 4ETZA 1YJNS 3HFZB 2UUBF 4JI6J 1XMBA 1UW9A 5HSPA 4ZPWR 2I1RA 2U1AA 2IVFB 4YY3F 4WYLA 2RMLA 2W2OP 3UR3C 2XCPA 1S1WB 2XMKA 2DGVA 4NCBA 1U48A 4LSLA 1WHWA 2WB1D 2W2MP 3TI0A 1U1NA 4KH1B 3TUZC 2UUTA 2X7IA 3IR5B 2FLOA 3DRSB 4NRTA 3JS9A 3G6XA 1LV5A 3D2WA 4K4TA 2W4DA 4ILLA 2W4CA 2WSCC 1P8GA 2DO4A 4CH0S 4RW4B 2KM8C 3MPWA 1YJVA 1ZOTA 5H9FJ 4M63A 3E01B 1U24A 3MR2A 1GMWD 2W7OA 1LNQA 1W7WA 3R5JB 3BYPA 2G0CA 1JLFB 4OZ5A 4DL5A 2VOOA 1AROP 4AL6A 4JI1J 2MKHA 4DX7A 1S6PB 1S7IA 3MEEB 3K0JA 2CJKA 5ETKA 2AJ4A 3H5YA 3FGVA 1IBLJ 1TMMA 2K1RB 2YH0A 5G4DA 2OJ3A 4U7UD 2CNLB 4AT1B 2F8EX 1HNVB 1DFDA 3EUNA 1HBOB 2AEJA 5KG1A 2ZH8A 3DGPA 5AXKA 4EEYA 2ZUAA 1N5YB 4HLBA 1OYDA 1UA0A 2XTJP 4HL9A 3SCKE 3RRGA 4XDDA 4I6YA 3RU0A 1FKPB 4F4ZA 1AFJA 3CMES 3M2VA 2E5LF 3UQSA 2AZ3A 3A3NB 3IC1A 4DV7J 5K14A 2MHNA 3FSYA 3BPDA 3BBBA 4OI1A 5CQGA 2KT2A 2B5JB 1HD1A 4P7VA 1UFLA 3KK3B 3D3CJ 3OXGA 3GZ7A 4DQSA 4F4AA 2HGMA 2PI5A 1H2UX 1YJRA 4B9MA 3DM2B 1MN9A 2ROGA 3BBFA 4R0JA 4P10A 1QVGR 3NCQA 2I9SA 5FIIA 3MGJA 1UFKA 3PEHA 2GIFA 4DHVA 4L3NA 5ETOA 5AE3A 3EDQB 1S77D 3JYTB 2DRAA 4B9LA 1UVNA 1SB6A 2VPXB 3FZ2A 4J91A 1KQKA 4IDKA 5ADZA 1CULA 2GA7A 4BS2A 4N76A 1R0BG 4R0EA 4QU7A 1T03A 2CG8A 1RYRA 1SC4B 2YNIB 4IG0B 4N7TA 4AXIA 4YMEA 1PBUA 4I64A 2ILZA 1CJTA 2EW9A 2M4MA 1WEZA 1YDLA 4KGVB 4P6QA 3PX0A 2FLLA 2EC0A 2PFFB 4B08A 3D54A 3JSMB 4DR7F 4K2JA 4HTJA 1GQEA 3HVWA 1MMDA 2WVFA 3RBZA 3T1HJ 2CQIA 2VBWA 3DOMA 4WFXA 4G1QA 1FHTA 1SJ1A 2G2YA 1JLBA 4LFBJ 3NNCA 2KZMA 1VJWA 2ZH4A 3PV8A 3PX4A 2XYGB 4ED5A 2G1HA 1N54B 1RHKB 1ZM3A 3OR2B 4BC7A 4EI2A 3C6TA 4ECTA 1BQNA 1HBUA 2BUNA 1H72C 1CJUA 3I82A 1IN0A 3DOLA 4DG1B 1Z1ZA 2GIQA 1NCLA 4LSNB 2VUGA 4BBYA 2W25A 2MEWA 2QLWA 4WYWA 2APOA 2DTJA 3QGPA 5IFMA 2ZH1A 2HHUA 4HT5A 4QW9A 3L95X 3MUTP 1SCJB 1ZA1B 3BO3A 2HHWA 2XI3A 4ZIVA 3AODA 1XMQF 4I2QB 4C8OA 4LF7F 1FVSA 2MKCA 4JYAF 1RU1A 5LSRA 4K0KJ 3OSNA 4NLYA 1ZTTA 3W60A 3DOLB 4B3SJ 1EKRA 4RW6A 5KG3A 4QYRA 1Y0HA 3IXQA 3NG8A 3LP0B 1VI7A 4ZP7A 4U7CA 3QT7A 4UQTA 4J9VA 1AW0A 1YZ7A 3C14B 3GIRA 1SH0A 2BMBA 1WF2A 5LXRA 1O5JA 1YJUA 4PXEA 5E5NA 3VZHA 3K7RA 1OPZA 1N4LA 5E0OA 1J5OB 4LFAF 2OPRA 2DH8A 1H7WA 1QTMA 4LBIA 3TARA 1C0TA 2MZ1A 4WP3A 4P2SA 4K7QA 2PC6A 3DYAA 1S4EA 4Y65A 5F0UA 5DDQC 2UXCF 1SQEA 5CCMA 3IAS9 1T9VA 1W2IA 1YBUA 2AKWB 1X4HA 1RT2B 1CEZA 5LSOA 5HANA 5HMWA 3MPVA 3P96A 5L46A 2R9LA 5E3AA 4DL2A 3VALA 2JOQA 2YWKA 4N5SA 3HJFA 4NXMJ 3Q83A 1FD2A 6FD1A 3FVYA 1C0TB 1HA1A 4NLRA 2FHJD 1QLNA 5KFMA 5FDLB 3T41A 5HI7A 1WHXA 4LF2A 4P72A 2MKIA 2ZBIA 4F4YA 2VDIA 1BE4A 4OHXA 1C1BB 4ED6A 3KMQA 1KLMB 2R8GA 4JB8B 2E5IA 4DR2F 4I67A 2ZVSA 2XG8A 1S10A 1LOUA 1NBEB 1REVA 3R7BB 3D0GE 3QPIA 5DRKA 3V4MA 3UPFA 3T1HF 3QJPA 2E7XA 3JTPA 1TL7A 1D1UA 1VQ4S 3NGSA 3DMJB 1Y5IB 3QQCD 3FSXA 4WXWA 5F8LA 2J0WA 3I4HX 3FQKA 5KFUA 4C4WA 3N0VA 3M8QA 1XR7A 1R6YA 2B9EA 4DN0A 3K59A 1RHMB 3TJ9A 4F0KA 1YQHA 3MAQA 1T9XA 4J9QA 1JJHA 4F2RA 3G6ES 1VC6A 4QR0A 4ZMMA 4U7UK 3IWNC 2RILA 1EETA 3F73A 1CSJA 2H5EA 2NXEA 5FLXY 3A8KA 5D15A 3HHLD 5D4LA 3BEGB 4DCOB 1IBKF 4BWMA 2E1AA 2KRBA 2R7VA 1A0OB 3J80U 1B99A 3M8PB 5J2MB 3K5LA 4P52A 2HHXA 4P2MA 3CEDA 5IXUA 4GO5X 2RIJA 2ZH2A 4XO0A 1S1XB 2ZNYA 3FQLA 4BCAA 1PILA 3V6JA 2GIRA 1Y5NB 3MMCB 2KHDA 4JI4J 1IKWA 5J1EB 4M5IA 2AZ1A 4ILRA 2RF2B 5IWAJ 4I2PA 3RB0A 5EN1A 4ZPTR 2M52A 1KDNA 1K44A 1Q8IA 1NK7A 1R8AA 4G1PA 4QOTA 2BE2A 1Q7LB 2ZKUA 2FLPA 1ZH5A 5DS7A 4DOZA 4CDIA 3DU6A 2FGCA 4J9LA 4CLKA 2JX2A 2X51A 3M6UA 4QQBA 2NSBA 3MUVP 2DCLA 3FRYA 5MLCV 2BKNA 2CG4A 2J9DA 2JC0A 4DR1F 1Q4RA 2MZQA 2AGOA 3C46A 1FFGB 2XWYA 2BRLA 4PZVA 5IC6B 2F8MA 3HZEA 3TAQA 1OJ4A 4J9KA 3NGUA 4Y00A 2DIUA 3N79A 3EJMA 2DEJA 4MK8A 5K20B 1NJWA 2DXDA 5K8NA 3T5LA 4KGZB 2LEAA 2MQMA 2LU2A 1QSYA 1WOPA 3KNGA 5AJ3J 4DQPA 1RCXB 1M5VC 3DLKB 4OIXA 3ZC4A 3RRHA 2NYIA 2HFSA 4QR1A 3WC0A 4RWXA 4ED8A 4URQU 3CCWA 1C2PA 4USTA 2IMWP 2UXBF 3CJ4A 3PW5A 4IFVB 3VTIA 4B9NA 3DGPB 2HIYA 1FJGF 2CFXA 3MCSA 4DX5A 4N8OA 2YX1A 4MYUA 4WU3A 4P2XA 3CMAS 2ASDA 5C7PA 3IRXB 5C2GA 2N82B 2R7UA 4DFMA 1RZMA 3TP2A 3PG9A 1VQ5S 3W64A 4DL0C 2HYIB 1I5OB 4DV1F 1D9AA 1S9EB 3OTEA 3IS9B 2EK1A 1HW8A 3NS7B 2GO8A 4BLGA 5I3UB 4NA3A 5F8JA 3GFZA 2GMHA 2F7VA 1QDUB 3M8YA 3ZZUA 2AHOB 3B8HA 2R2SA 4FS1A 1UW4A 4Q2LA 1P6TA 1EQMA 2WSFC 4DZDA 1Q8KA 2OTJS 3EE3A 3NWGA 3F44A 2IA6A 3Q8VA 3MEDB 2CQ3A 3EPIA 1B0VA 4QPTA 2HW3A 4PXDA 1VQ8S 2YQ0A 1NDKA 1S57A 4CM2A 3EZUA 5L38A 3T6JA 3VF0B 3TZXA 5F9LA 2CZ9A 4RWWA 5DG8A 3P49B 3MEEA 3W63A 2MQ8A 4WTOB 2L9WA 5BYSA 3J81j 1NSPA 2PGCA 3TEGA 3LWMA 4KGXB 1URNA 3VWSA 4DV0J 4NZ7A 2BR0A 1HYSA 2FVPA 1DTQB 2AX1A 3EZOA 3AJ2A 3ILIA 2JEFA 1QVFR 3FBFA 4FKXA 2YKPA 3OHAA 2BKPA 1OY9A 4ZDNA 2R8IA 4RL1A 4H4OB 4TY8B 1H74A 5AXNA 3ITHB 1X4FA 2Z58B 2CRLA 2KL8A 1FTCA 3JAMU 4WK1A 2JFDA 4GMKA 5D4PA 5JVHQ 2CQ0A 2M88A 1VRQC 3MM5B 4Y3CA 1K9MT 2OUGA 2RU3A 4RW7A 2CZVC 4BC9A 2V50A 2DEIA 1A7GE 1HWUA 1GT8A 1UWAA 3P4UB 4OV1A 3RW6A 4JI7J 4L74A 1T11A 3R8YA 4IRDA 4OJGA 3VR1A 2W2QP 2DK2A 4JV1A 2Q6BA 4ID5A 4GKJF 2CQCA 2DR7A 4OL8A 3MM5A 4C0BA 2XB2D 3HJVA 2UZAA 2MHEA 2NXCA 1NK8A 1VQYA 1RHUB 4KIAA 1Z2ZA 5KG2A 1N48A 1E6YB 2V5HG 4IDKB 1N0VC 3KG1A 4URSA 5EDWA 4DSEA 1CQNA 3FEYB 5B0CA 1FE4A 4Y2AA 2UUBJ 4OYXA 2ZWOA 3D9BA 4Z2XA 2ZKTA 2QRRA 2KT3A 2Z56B 4ECWA 5C2CA 2GS8A 4OI4A 3G8QA 4NLOA 4ETXA 4YY3J 1DURA 5KT7A 2ZH5A 1VRTB 1VLYA 3UDVA 4CH7A 4DZ6A 4ED7A 4E8UA 1JQGA 2VFVA 2HFOA 3CVKA 4ANEA 3THTA 2RUSA 4P74A 3A12A 3GWCA 1N5QA 2H3EB 1U02A 2MLZA 3HHLB 5KTQA 3G4SS 3M2VB 2WVCA 4WFAQ 2F8HA 2CXEA 3D0IE 4Y28C 3Q23A 3AB4B 1PIEA 3PRDA 2P9EA 1FWKA 2DNQA 3ZFVA 2NQPA 3UVJA 4ENOA 4RNOA 4O3RA 2DJWA 3J7A1 2N3LA 3GJSB 4L76A 3DLHA 1H3DA 4KFBB 4U95A 4LSNA 4C3KA 5KT4A 2B9YA 2VG7B 2CKWA 3BB5A 1KOHA 5K8OA 1RTDB 2UVRA 2R7TA 4DUZF 4LQ9A 1FCAA 5J2MA 1DLOB 3LF0A 2MGZB 3IAM9 1LK5A 2UXDJ 3EXCX 2QE5A 3UCGA 2BANA 5EX3A 4F26A 1CJKA 4HKQA 4F02A 4JI2J 4H4MA 3I56S 3ZNUA 2HLUA 5HN0A 1RT1B 2HS3A 3TNVA 4CO1A 5BXIA 2WVDA 4H54A 4X65J 3SIPB 2UXCJ 2LP4A 1XJWB 4DU8A 4KHPJ 2BDPA 2A10A 3W9HA 4CYUB 4DR3F 1TKXB 2NPIA 2FTRA 2M8DB 2QSWA 5KT5A 5D0RA 4HVZA 1N36J 3G9CA 4C97A 2EFVA 2VFTA 1PO6A 1PJ5A 3NLCA 3GCWP 2I0XA 2DISA 3TR5A 4IR9A 3DLLQ 2ZM6F 1NB7A 9ATCB 3WQPA 5KT2A 4RZRA 4B3MF 2QJ3A 5D0HA 1UJ4A 2FHMA 2W4PA 4RO0A 4YP3A 4DV6F 4IO9Q 4I68A 1NH7A 1LEOA 2ZJQQ 3MMBA 3CC4S 2E44A 1X60A 1MG7A 3W2VB 9RUBA 1VRUA 4F8RA 6AT1B 1C1BA 1FTRA 1OWXA 4B3MJ 3HK2A 4MFBA 1B64A 2COLA 3KG4A 1UMJA 1FDBA 3I9ZA 2N7CA 4DL7A 2VA2A 1TAUA 4I2PB 4PG7A 1JK9B 1EHWA 2Z2LA 2GNKA 3LTOA 3TQEA 3M30B 4LRCA 5A8WA 4DL4A 4ED4A 1V3ZA 1HL6A 4JI0J 4V1Ak 3MMCA 1Q8LA 3GLJA 3QT8A 3CCVS 4TN2A 3KLHA 2C2NA 1KSPA 1ELOA 2RUGA 1S1UA 1S6OA 4LSZB 2KVIA 3EGVA 4J9UE 3SFUA 2VODA 2HNYA 3FFIA 4OZ1A 4TYBA 1T94A 2D69A 3D28A 5GVQA 4X62J 4WP8A 3AA9A 4RU9A 3SI8A 5ETTA 2FUG9 2P6TA 2OI2A 3M2UA 4QIGA 1FRLA 4EU0A 3CE8A 2ZH9A 4EBCA 1XNQF 3AQOA 5HLFB 4FN5A 3THPA 4CO2A 1TFWA 5IS2A 2F3JA 3SV4A 3RGIA 3I5CA 5GMDA 4JI4F 4IOCQ 3MURP 3KHGA 1HI1A 3CJSA 1KLNA 3IP0A 3OTOJ 5B0DA 1JNZB 2CNNB 2CDQA 2MQLA 4OI3A 4Y2CA 4LF5J 2XEXA 3NOGA 5C25B 2XY5A 2ZC3A 4F0MA 5GAGI 2XHWA 3PKMA 3D6FB 5KOWA 1R6VA 4CRJA 3VVTA 5AT1B 2VD3A 1BHNA 2KZZA 3NNHA 5ETRA 1BQXA 2MLYA 2V6AA 2OELA 3U1MA 2C2KB 1K0TA 1XEZA 1Q7YT 2ZOFA 4KV8A 3G8TA 3GR1A 3VGSA 1NU4A 2ZDPA 4ANDA 4UOGA 2V8GA 3NL0A 3EM1A 4O3QA 1IM6A 3CNQP 4I69A 4ZLLA 4LF9J 2O1PA 3KFWX 5HP1A 2IBKA 3P6YC 1SC3B 2AJ2A 2J7UA 4X4NA 4C8KA 5D78A 2IBOA 1UVKA 3G6VA 2HFNA 1M1KT 2E9RX 1SPBP 4Q0BB 2HG4A 3I5BA 4RUAA 3S8SA 4DFKA 2FZCB 2QMUB 2V67A 2XSJA 3OUYB 2N3OA 2OEJA 4XK8C 1DBDA 1WC6A 3D5MA 4ZHRA 1EKSA 4LVNP 3E51A 5CD4A 3KHHA 2DHHA 1NHUA 5ETPA 1KEKA 1QD1A 3PZPA 4JV5F 1B0TA 3S7RA 7AT1B 2XMVA 4PUOA 3POTA 4G1IA 2B5JA 1TKDA 2VOPA 4ES3A 3EWGA 1S59A 1RWNB 3GYXB 1VK3A 1UJ5A 4EYHB 2KFZA 1VQNS 3AJDA 2IA0A 3KUGA 1N5TA 1TMJA 1OSCA 2VF3A 1BWEA 1MN7A 1YVFA 2GVDB 4Q5VA 2AEFA 1VQOS 3EPGA 3LP1A 5LJ3Y 4AD6A 1RAIB 1DY3A 3M6WA 5KFNA 1S9EA 4J9SA 3RAXA 3N5BA 4X66J 2L9NA 2V68A 1BGXT 2DH9A 2QN6B 3W9JA 3MR5A 2I38A 5KG0A 5KFXA 4TU8A 2K06A 3TJAA 4F25A 3PRVA 3BR8A 1SUQB 4O44B 2DD8S 2GHPA 2LQ9A 2P2CB 4PWUA 1VGYA 2J9CA 3WBZA 1TKXA 5KFSA 2Z8QA 3SBMA 2CWXA 1SH3A 1SI9A 3NY0A 2M70A 1X5TA 4ECQA 3ETMA 3CWJA 4DV4J 1N33J 3AXKA 1S48A 2A6OA 2QC3A 1VOMA 4MJKA 3RB4A 2Y1IA 3TX0A 2ZH7A 3UD5A 1GTHA 4DPUA 3RR7A 2M0GB 5U47A 3KHLA 4NLGA 2N7YA 4QU6A 3SZ2A 1EQ0A 2F5GA 2NZ4A 4LR9A 1LW0B 3RB6A 3DDIA 1RADB 3PXGa 2JL9A 2I6WA 2VONA 2HMIB 1TVRA 4KH0B 3MMBB 2KKHA 4E0DA 1U1MA 1SC6A 4C8ZA 3GFYA 3I0SA 2ZVIA 4I4BA 4CM0A 2JWNA 5D4NA 2CWKA 5EX0A 2UP1A 2AP6A 3SFGA 3M9OB 2WAQD 4DR2J 3PKYA 2BE9B 3M05A 3HHKA 4X4RA 4DS5A 2ASLA 3VAKA 5IOLA 4MH8A 4XPEA 4ED2A 2GGPB 2ASJA 2PDAA 3H42A 1R0AB 2VH7A 4NRUA 5DLFA 1U1QA 3RJMB 3G8SA 2CIMA 2R7QA 2ROPA 2HBYB 2L3MA 2QYCA 3CGIA 2HBRB 3NCPA 3P3DA 4OX6A 1WC5A 4DDFA 5A6PA 4F2SA 4A8YA 1IKVA 2HPUA 1X5PA 2Q66A 2E9ZA 2GQCA 4V19X 4KHRA 2R2RA 1NB2A 2QA4G 2EVZA 2VV5A 4QYZJ 2LLZA 2BEFA 3BQ2A 3ITHA 2MB0B 1D3WA 3ELHA 3HKWA 3DGVA 2IC3A 3O44A 5DZ6A 1RT2A 2Y3YA 3DRSA 2XGQA 2ADCA 3VZIA 2OTLS 2WVEA 3JB9k 1O51A 4LBPA 3W8GA 3GFHA 1LWCA 5L39A 1KTQA 3NP5A 1R8PA 1JXVA 1S0MA 1N6QB 2KU7A 3IN5A 3RR8A 1TKZA 3EGWB 2VDHA 5B7WA 2R7XA 2LMIA 5JUMA 1R7IA 3H2UB 3IGVA 1PBAA 1B4SA 2MJUA 4Q8FA 1A6LA 2ZBQA 2XI2A 3HHLA 2Y1JA 1NHKL 4X64J 3KHRA 2BACA 3CIZA 3M9NB 1RBOB 2PMHA 5J2NA 4IRCA 4FP9A 2FJBB 3KK2B 1LXJA 3D3BJ 3AAWB 1BWVA 3CCLS 2ZHAA 3T1YF 4TYAA 3PW4A 4YHHF 2HZCA 3PIOQ 2VBXA 1FX2A 1V5IB 5G0RB 3PR5B 5HATA 4WFZA 4AL7A 3RBDA 5B09A 5F9NA 2GMJA 4DJBA 2H9ZA 1E6VA 2QG9B 2VJVA 4LQ3A 1ICEB 1FDDA 2FYXA 4DLEA 2BABA 5T7LB 4OI2A 5C25A 3I5AA 3UFCX 3PO5A 2J0QD 2EEYA 3CD5A 2OKQA 2Q6CA 3CCZA 4ZLJA 4YHHJ 4DS4A 2G2OA 5H1SV 4Q0BA 2JLGA 2LA6A 4JI8F 2E9TA 1UWBA 1H98A 2FJEB 3EXYA 4YDXA 4AL5A 2H4WB 4KB7A 2WBRA 2MY8A 1Q5YA 3AA8A 1BY9A 3KK1A 3Q0AA 5CYQB 1SIZA 2D7SA 4TKTA 1CG2A 2QMXA 3EVMA 3TJ8A 2R7RA 4OX9J 1WEXA 4U67Q 2PIIA 3AD8C 3KXDA 4WFYA 4USMA 5DG9A 2YQ1A 2BQ3A 2G4BA 4GKKJ 4W98A 1RABB 2NZCA 2P8IA 3MM9A 3MMAA 1QE1A 4WKYA 4QCLA 1T9UA 2MKSA 1L3VA 4NASA 1HNZF 1S1UB 3QFWA 5FJ4A 1LW2A 2YXLA 2HBZB 4FBTA 3BKTA 1RA7A 3NNAA 3JSMA 2AGQA 2DHXA 4R5PA 3OTCA 2YY3A 3PFEA 2HNDA 2YKNA 5K14B 4ECRA 1TFYA 3LP2B 2DGQA 5K8PA 4A8SA 1X4AA 3HD2A 4P73A 3KUEA 2V94A 3D68A 2OPSB 3RG6A 3QZ7A 1WWHA 4ECYA 2UU9F 3FC9A 4MFBB 1G1XA 2MQNA 2KB2A 2WOMB 3DXSX 4NYZA 3NGKA 1B7YB 5I42A 2QLBB 2UUWA 1LW2B 1WOSA 2EC2A 2YNGB 3OPKA 2G0JA 2AYMA 4WE1A 2ATCB 3M9MB 3CSKA 5A8WB 2E5LJ 3AD9C 3RAMA 2W9CB 1LXNA 3FBBA 4NA1A 2O01C 2ERRA 1G3OA 1J5EF 1S99A 3AJ1A 3OQ2A 3MR6A 4NI2A 3QJLA 1F1BB 1FF2A 3K17A 4QJVA 4AFFA 4YDDB 3SDEB 4M5MA 2WSEC 2RE1A 3AFGA 4L72B 1NDLA 2F4VJ 1YSJA 5I3PA 2IAJB 1AUDA 1DTTA 1IBMJ 4USKA 3QAUA 2XYHB 4K5RA 4O0NA 4WE1B 5B0BA 1LFWA 1N36F 1ZM2A 4ZJLA 2XLJA 3JSBA 1TK8A 2LA4A 4A46A 1Q95G 2F63A 2CPYA 1WSVA 4IOBA 3T1YJ 5EGYA 4P9SA 2HIQA 3UD3P 2DB1A 3IRXA 4KSEB 4OJHA 1NEEA 3TX8A 3UDLA 2H54B 3D66A 4RNFA 1WHYA 4LF8F 3H4BA 2EBGA 1IQZA 4YB6A 1FXDA 3L7OA 5C24B 2CPHA 1VRTA 2QX0A 1WKKA 3G6YA 3NRBA 4PXCA 3UE2A 4ZLNA 2W9BA 2IJNA 4QIFA 4CWBA 5KT3A 2UXBJ 4Q43A 4LREA 5JMNA 1T9TA 5KFHA 3MMAB 3MM9B 2IYIA 1ZAXA 2C3OA 2O5DA 4OI0A 3BN4A 1Q0NA 3BZQA 2CQ1A 2JVRA 2D74B 2VFRA 3I0RA 1RT7B 2NS1B 4HEA9 3W2WB 2XZWA 1F9EB 5A8RB 4DR6J 5CCLA 2OHDA 3S1TA 1VC5A 3QFHA 1Y00A 5K5MA 4C9DA 3LW5C 4WIIA 4E2FB 1FKOB 2XMWA 3MEKA 3I6PA 1S9FA 4USWA 5F8MA 4JP8A 2XMTA 4QPXA 2YNFB 1RTDA 5A2QY 4UOHA 1HR0F 1XMOJ 1HBNA 3TUPA 1HYSB 4X2BA 3DOKA 3OXFA 2B0GA 2YNGA 5ETQA 1T02A 2E5JA 4M5DA 3TOQA 3TVKA 5KFPA 5KFBA 1J5OA 2O67A 2FVRA 2MY7A 2WK4A 4MKVA 4EFAC 3PYFA 1PAEX 2H1YA 2LDIA 4H4MB 1TV6A 1ZM4A 3EVWA 4QZVB 4LT6A 2UVUA 4B9VA 4DSLA 4DCJB 3U1LA 1X4CA 3EICA 4CLSA 4DSIA 1Y9OA 2GMLA 2CAJA 3GMGA 4HHHA 2XY6A 4KT0C 2OPQA 2G13A 1S0NA 4KPYA 2V9WA 4K4YA 2R7OA 5DJBA 3MCOA 3BYRA 4LRAA 1O6XA 3A3OB 2CQHA 3CDBA 4NWBA 1Z2LA 2VKRA 3Q8QB 1NKBA 1RA6A 1RBLA 5I3UA 4JV0A 3P5TL 2JRSA 3KUHA 1FFWB 3I87A 3K5NA 2Y9HA 2QEXS 1M0SA 2RQKA 3LA0A 2B9XA 3R5BA 3OTDA 4ELTA 1Q81T 1MWZA 1OQ3A 1RHJB 2RDDA 3C66A 2PEBA 3BBCA 4ED1A 1HNWJ 4TU9A 2DNKA 3Q8SB 5KFZA 2Y1LB 4QIVA 2VQEF 2GAHC 3H7HB 2DR9A 4H4KC 5BR8J 4F4KA 2W8KA 4DLGA 1HIYA 1UP1A 2CPJA 2V2KA 5IZHA 1Q78A 3CW2C 1RQ0A 3OL9A 5CZVA 5AE1A 4IQMA 1KVKA 3Q2TC 2HQGA 3QIDA 1I94F 3FCHA 2BYCA 1QSLA 1CS4A 3MR3A 1M1HA 3KLEB 4M94A 5A8RA 3W2WA 5J2NB 2MQOA 4PQUA 2HS0A 1HBUB 3HX9A 4ATNA 3NAHA 3F56A 5GAGU 3OTOF 1BC6A 2D3ZA 2Z30B 1WJ9A 2DGTA 4L73A 4LVOP 3HFVA 5THWA 5L1IA 1RUSA 4NLWA 3ISNC 2HK3A 3CJTA 3JSYA 4KPCA 4DUTA 1X4DA 2JEGA 3A3PB 3V81B 4QR2A 5B0EA 2RAQA 2WRMA 1V6HA 3OL6A 4DR5F 3C16B 4OYOA 3RYLA 1U49A 1SKSA 1FJ7A 1TL5A 4IO1A 4ZITA 4A47A 4RNMA 3VAMA 3BSNA 3IBWA 5E2QA 4E98A 1FI4A 4I7FA 5E3QA 2AJ1A 4YR2A 3M8SA 3V6DB 1B3TA 4JI3J 3OFEA 1JLAA 1UPMB 1YBTA 3RBEA 2QMWA 1FKAF 2V4RA 1UVJA 2KRRA 4ICLA 4IH5A 3HVRA 1Y4ZB 2C2ZB 1OQ6A 1VISA 2GZOA 3NBPB 4DQRA 4KAIA 3AHPA 3OLAA 4WXOA 1JLCB 3HCXA 4YFUA 5KFAA 2C2DA 2RS2A 3IO1A 3CCJS 1U7LA 4GC7A 1RJJA 2XO6A 5F8IA 3M6VA 3UCZP 4OX8A 4DF4A 4ZVSB 2DHAA 3G86A 1JLAB 3LAKA 4OJ1A 3KJNB 5ETMA 1RT4B 1TL4A 3AD7C 1X0FA 2X3DA 2CQ4A 3W66A 3B54A 2R2TA 2LQJA 3MPDA 2B3TB 5KFYA 1RTIB 1WKJA 4NPOA 4Y34A 1SKWA 5D3GB 1HQUA 2IDEA 2PSZA 3LANA 2C22A 2ZBRA 2EBEA 2HWHA 1KQFB 2QA2A 4IG3A 3KLFB 3TANA 4FF4A 4YB7A 2ZZNA 1T8EA 3I0SB 1S6PA 2KXNB 3KOAA 2CJYB 2IC3B 5J2PA 3PVXA 4EMDA 4GVLA 5IQQA 1RE1B 3GPAA 4F7VA 4A8FA 3C2PA 1ZPWX 1FWPA 1LW0A 2JNJA 2ZHOA 4HYKA 2GJFA 3LP1B 4KE5A 2G2ZA 3CJ8A 1DJ0A 1TL1B 2KN4A 2J6SA 4PYDA 1OYEA 3NKYA 3HSDA 1RXOB 1E6YA 5KFFA 1RAGB 2AIRB 1TTHB 3GYNA 3M1VB 1HKAA 1T3NA 5CAAA 5E33A 4QWBA 1R8HA 1R43A 1S7HA 2XZTB 3H59A 3RAQA 1RKIA 2QL7B 3MECB 1IR1A 2XULA 2GGPA 3MM6A 1WC1A 3SSQA 1HHQA 3W61A 5F8HA 3KJVB 4DV3J 2YKQA 3CJKB 4AQYJ 4LFBF 1TL1A 2BA9A 1HPZB 2B8PA 1NDCA 3IBCB 4U9RA 5B0GA 4N8NA 2AWZA 2GHWA 1Y3KA 3HHEA 1C1CB 3TZZA 4JV2A 4GKJJ 3A8IA 4CT9A 3K5PA 2IY5B 3Q22A 4DPOA 1NK6A 3BM7A 4DV3F 5HJXA 2K1RA 4CTAB 2ZOMA 1S1XA 1QAXA 2QLJB 4BDPA 2M2BA 3QO9B 5KFVA 1T05B 4GO7X 3R27A 4DV2J 4NXNF 3NGTA 4FBUA 2B6AB 2XQCA 1VQ7S 2AMCB 2QL5B 3NXZA 5EUHA 2D1CA 4Y2KA 4N77A 3TAMB 2DR6A 3JXOA 1EB0A 3C3LA 1UVMA 2OPPA 4HI2A 2LYVA 1R0AA 4DV2F 4NXNJ 1TKTA 2HQCA 4LR7A 4PAAA 3HULA 3ZTSA 5DM7Q 2BJ1A 4USVA 3VAGA 3ADAC 4NX9A 3LGHA 2LCWA 4FVMA 3GIIA 2ATLA 1HWLA 3UD4P 1BQNB 2CPDA 2M5YA 2B7BB 4M5DB 1MU2B 2OPPB 4LFCJ 5KFEA 4DV0F 3QRPA 3VGVA 3CJRA 5GAEU 1TV6B 3Q2SC 4M5NA 3T6BA 4PRFA 4XDCA 2DGXA 2DY1A 3ONQA 2HAIA 3W65A 1N32F 1CJVA 2O3DA 4DV5J 1NXIA 4RBTA 3QLHB 4LF6J 2RJZA 1TK5A 4WFBQ 2BXJA 1O0PA 3EGNA 3F41A 3J7AN 3OHBA 1Y5LB 1UWBB 3PFOA 2CDRB 4JI6F 3CF5Q 4A8KA 1IJEB 4HT7A 2GV1A 2ZJPQ 1XQIA 4DV5F 2OSRA 3K57A 4KHPF 3RB3A 2IM2A 2LQBA 2Q43A 5HVFA 4OJ3A 3O1LA 5CA5A 1MWYA 1WI8A 4DR1J 4YUDA 1YRTA 2WW4A 3HSZA 2WZ1A 4I6AA 3UDCA 1HARA 3CO0P 4X84A 4DG1A 2KG1A 3R6LB 3IBFB 1RAHB 3SEOA 3R5DA 2MQPA 1YJ9S 1FO1A 2YNIA 4IG0A 5C42A 4M5GA 1ZM9A 5GADI 1NHVA 1N88A 1JJ4A 4EZ9A 3CCQS 5L8RC 1S12A 3H4DA 2GAGC 2X1FA 4NLXA 2LQ8A 3IWLA 1IM4A 3DLGB 3BR9A 5JXSA 2J8AA 3KLIA 4C98A 1ZA2B 1TL3A 4XIUA 2W9CA 4WFNQ 4LF4J 2RRNA 4IQXA 1NDPA 4Y2MA 1HFEL 3GONA 1YRXA 4RKUC 2JLFA 4O44A 4PQAA 4CNZA 3CCMS 4B3TJ 1YRUA 1SQFA 3EVOA 3PYDA 1X9WA 1UFWA 2Q79A 1HR0J 3N4WA 3SCLE 4GC6A 1I6JA 1ITPA 2OIHA 3IG1A 1OPIA 2HHPA 5B08A 2LU1A 1FX4A 4KHMA 4OMFG 1PKUA 3GCXP 1VQ6S 3J81U 1HQEB 3QBCA 3ZTOA 2F4VF 1HBNB 5F41A 1RT6A 1GH8A 2FB0A 3I9V9 3HHDA 2XCAA 1IKVB 5KFGA 2RRAA 2WVBA 5GAEI 1MROB 2SXLA 4M95A 1JLCA 2CYYA 3MOJB 2D3O1 3GJTB 2RHQB 1H73A 1VBKA 2CQPA 4FZVA 5D0GA 4DPXA 2W9BB 1HNIB 1SV5B 3GG1A 3BDEA 4OV6A 1RI7A 3ISZA 5LT5A 2PN6A 4CLWA 2AYBA 1F6TA 1PYSB 1YK9A 3QGGA 5IT9U 1FERA 1UAWA 2FJAB 1AZSA 3SMZA 5A0YB 1N56A 3O2IA 4J37A 5ETLA 3TA0A 3OLBA 2HRUA 1XR5A 3A8EA 5LMUJ 3CD0A 1I3OB 5ETVA 3BKUA 1RAAB 2C2MB 2W24A 3ETOA 4B9SA 3CD6S 3O6QA 4MK7A 1VQ9S 1HPZA 4Q7AA 2CJAA 4X4UA 2PEHA 1SVDA 3FEXB 2E7WA 2KG0A 2RH3A 1RWPB 1YI2S 4PG5A 1ZBTA 5F0WA 3PRBA 1S6QB 4XPCA 3ULHA 1W25A 2V2QA 5T14A 2D9OA 2EG2A 1VFJA 3EX7B 4MKYA 4F36A 1U8WA 4I56A 2GQQA 1WTBA 3WX4A 3M6XA 4RW7B 5KAKA 5HO4A 2JVOA 3L3CA 2BV3A 2IPOB 5CXTA 3HLUA 3FMWA 1NJZA 5G0RA 2GW8A 1NJYA 5J1PA 2VIHA 2UU9J 5CZXA 4CQ1A 2X1BA 3KG0A 3MWBA 3V4IB 4NOHA 4I0WA 1NZAA 3Q8PB 3HPOA 3MDFA 4KRWA 2ACMA 1HNVA 1JLQB 2EFPA 4NLQA 4DF8A 1L3TA 1FJCA 1WACA 5D3GA 2DGOA 2XWXA 2ACYA 2KHCA 3R6GB 4PABA 4ZVEA 2VFUA 1U8SA 5SUHA 2LQ5A 3D1OA 4U6PA 1RBAA 2LEBA 4JBCA 1I1GA 4FXWA 4TQSA 4LF7J 3IR7B 4X4SA 1JKHB 3N9UC 5LMNJ 4KJIA 2P6SA 2GCFA 4X4VA 3OJSA 4DV7F 1K47A 2AYGA 4OHYA 1Q86T 3NGDA 4N47A 3I4PA 3BJYA 2DGSA 4U8YA 3GQCA 3OR1A 2E1CA 1XBWA 3CTRA 4ICLB 1AA1B 2VBZA 5EWFA 4KTQA 3NBPA 1HWIA 1TZ0A 1RWXB 2E7VA 4W92B 4RW9B 3FUYA 2FJWA 3DDNA 3FBCA 4OQJA 3BDPA 3M8RA 2J9EA 2NLWA 4ZVUB 2LDYA 1VK8A 1HBOA 3E3XA 1N5YA 2MZRA 3HP6A 4URGA 4YQWA 3RBXA 3PHEA 5IQ6A 3Q24A 4J7CA 4QYZK 2VG5A 4EO8A 4W90B 1UETA 3UCUP 4USHA 3TZWA 5E3PA 3OVBA 3GU0A 2CQGA 4F3MA 1HI8A 5F3TA 2FDNA 3GSDA 4O23A 2FVQA 4IR1A 2WBMA 2QV6A 3D67A 4FS2A 1M5KC 4WBFA 1TK0A 1F9HA 3TW0A 3DRRA 5IM0B 4TY8A 1TL7B 3BQ1A 2AX0A 3KLVA 4LMZA 3O8WA 2B6AA 1M5SA 1R31A 1X4BA 1JX4A 4F3OA 3GJRB 4ZVTB 2BW7A 4Q2MA 2ZH6A 2B56A 3UN3A 3R5CA 2KI2A 2XMAA 1J2VA 3SQGB 4ZPAA 3BQ0A 2DNPA 2HZAA 3MEGA 2JZ5A 3VV2B 1DHMA 3CPWR 1NK5A 3UNGC 2JSXA 3K8VA 4X62F 4GKKF 3CMQA 5FDLA 2OO4A 3MM8B 3TO8A 4NYPA 5J2QA 2FZKB 2XNRA 1LWFB 2BM0A 3B6BA 2F4FA 5LL6d 3M8ZA 3L7PA 1XNRJ 2DYAA 2LFVA 1U09A 2EWHA 4WIQA 2BQRA 4KGKA 2OMLA 2MZTA 3DRYA 8AT1B 5DDPC 1N6QA 1DQ8A 1TVRB 4CLFA 5HLFA 4CLZA 2A2CA 3ET6B 1RSCA 2RS8A 2ZEJA 5KG6A 3R2DJ 3CIMA 1XMOF 4K50A 1FD8A 1NAQA 6FDRA 1R89A 2W2NP 2DH7A 3MCMA 4MAKA 5J1NA 3R2CJ 4LF5F 1HMVB 4HACA 4FF1A 1XIQA 3PYGA 2B43A 4OYZA 1YBAA 2EFNA 3L09A 5HJYA 3GG0A 1DTQA 1JLEA 3NCRA 4WK3A 3NGRA 3VGUA 2CQDA 3W1YC 1M5HA 4UT4A 1TAQA 2YWEA 3GV5B 1UA1A 3DRPA 5F8GA 3KDOA 5SZTA 5F3ZA 1FESA 2RVJA 2V4JA 2XLIA 2Y0SD 1KWMA 2FC9A 4QWEA 2DNMA 3M8PA 2DCUB 4IKAA 2FY8A 2VL1A 4KC5A 4LRDA 4FXVA 2XC9A 2BE7D 3JAMY 3GP9A 2OFGX 2H65B 4ZCLA 3U1NA 1HMVA 1WKLA 4ZJOA 5BYQA 4NMXA 3MM6B 4B3SF 2JJ4D 1P9QC 3C15A 3J7YI 2RNEA 1YLXA 1TKTB 4RBUA 3Q8YA 1IKWB 1FNXH 2ZD1B 3HZGA 2POKA 1SL2A 3FZBA 1KVIA 5HVHA 1K1SA 2O66A 4DU7A 1ZETA 2DXFA 3DXBA 1U2CA 2DHGA 3DLKA 3P5BP 2R42A 3BH6B 4M5KA 4NZ6A 2DPIA 2KO1A 4LR8A 1B70B 1S79A 2HGNA 2AT1B 4OHWA 4RW8A 2AJQA 1REVB 2L9DA 3EYZA 2M3DA 3I96A 1BXNA 4O3OA 5F8NA 2MXYA 1RT5B 4L75A 2UVWA 2OH2A 2EXUA 2ALZA 2QO3A 2VG5B 2HVZA 3T19A 4C0OC 4UY85 5DETA 3V2UC 2DNRA 2HK2A 1RT3B 3JYTA 2X3GA 3PR4A 1FJGJ 3H90A 1RT1A 2HHHF 2DRDA 2FHJA 3TYTA 2OLWA 1WORA 3DRRB 2AU0A 4LF6F 3CDAA 2K8GA 1YJTA 1ROFA 2VB6A 3PACA 4X4PA 2RKIB 1X9MA 1ZS6A 1VCTA 4C8MA 1SIWB 1VIOA 3LUYA 1C0UB 2LXFA 4FYYB 2ZDOA 4WP9A 3HFKA 3LALA 4QWCA 1RTIA 3MPYA 4NEZA 5DM6Q 1RWVB 2CNKB 4EBDA 1MROA 2QTWA 1WC3A 3OVSA 5KFWA 3VAIA 2XNQA 2JH3A 4USUA 3HSJA 1RT6B 4PKDB 3QRQA 2HLTA 2AQ4A 2Z2ZA 3CC7S 2IIHA 5GAHU 3KDNA 3BGOP 4RW9A 1QY7A 3QZ8A 4W4MA 2BE2B 2EFGA 4OYIA 1HBMB 2DIVA 4NLUA 4CLPA 4TVAB 1N34J 1TP7A 2CJXB 4J90A 4NL5A 5KG7A 3QIPB 2W8LA 4DQIA 2HEKA 2QZ8A 2Y0BB 4OYAA 3R7SB 1S49A 4KO0A 4NCGB 1Q16B 1RLDA 2FPHX 4ZCMA 4ZHRB 1REGX 3LH2S 3MD1A 1X5OA 2IFXA 2D41A 4HH0A 4M1KA 1G2EA 1S6UA 5LJ5Y 2HURA 3RZAA 1VC0A 2Y8WA 1JLGA 4KV8B 1FDNA 2R8KA 3DDKA 3H2LA 1PG5B 2KYZA 1NO8A 3M4XA 4HHUA 4CLTA 3FCWA 2IM0A 1KN6A 5HAOA 3ZZPA 3JSRA 2HNYB 2WHOA 3FFIB 3M2RB 4M5JA 4MTPA 4F4WA 1RK8A 2J7KA 1VQSA 1NSAA 1IJFB 5AJ3F 2C2OB 3GTYX 3PCOB 2IVYA 1Z4UA 1KNZA 1WDDA 1KHWA 2E5GA 3M32A 2YPYA 4RUBA 3CJ2A 1G6BA 4I7FB 3DOMB 3T9NA 5HQMA 2XSJB 1HQ2A 3OUYA 2OD4A 4TXSA 2OEMA 4M8LA 1HHSA 3K58A 2VQFF 4PG8A 1XR6A 2W01A 4IOAQ 2MTLA 1PC5A 2ZE2A 3OFHA 2I8EA 2QA4S 2IAJA
chains in the Genus database with same CATH topology
1SH2A 1KTVA 4WU2A 3LGMA 2GJ2A 3TVYA 4OX9F 2HHQA 3MD3A 1M5OC 1M90T 1JXLA 3WZ0A 1H6KX 1QUPA 4CO0A 4O3SA 2GX8A 5HL7Q 5DGAA 5KFLA 1KQGB 1JKHA 1SL0A 3S6EA 3ZZ0A 3AQPA 1MU2A 2WONB 2MZSA 3T5JA 5C24A 3SV3A 3J81Y 4OZLA 1QAJA 3TQ1A 1VBZA 1H2VZ 5E41A 2BM1A 1FKPA 1BQMA 4JI1F 3DN9A 4HH1A 3S01A 2W7AA 3PEJA 1NRKA 3CDEA 1SJRA 3C6TB 1SJ4P 4WZMA 1UEVA 1FNOA 1K8AT 4ES1A 1TL3B 4NLPA 2VASA 3T1AA 1OIAA 2MDAA 4P7TA 1U6ZA 2KDOA 2JDJA 4OZJA 1FK9A 2B4VA 4ZCKA 1LWEA 3CJ3A 4TQRA 1ZZNA 3JTOA 3BN7A 5AE2A 1WF0A 3SXLA 3GIKA 1HNXF 5LSLA 1S6QA 1WELA 3HO1A 4ELVA 3CDWA 2D3OR 3DHXA 4A8QA 2I5JB 5HROA 4LSLB 3QJJA 2CQBA 2DNZA 4X65F 4D3HA 2WB4A 2CPIA 4ED3A 2XMUA 3NAIA 1ZPVA 2R4FA 1RT7A 1RTJB 3B82A 3DLGA 4FF2A 1EP4B 1HWKA 3G71S 1N5SA 1NK0A 3KTQA 2B4UA 2CPZA 3BO2A 2UVVA 2F40A 2OMOA 1X4GA 3CJ0A 1NJIT 3LAMA 1X8DA 4OZNA 1XTZA 4G3IA 3K8WA 3H2VE 1HW9A 1RTJA 4DR6F 2F1FA 2A3JA 4UQGA 2Z2MA 5T7LA 5A8KB 3RRKA 4YOEA 1F2GA 2XSFA 2JEIA 1S4FA 3KKFA 1WG4A 4MYTA 3KYLA 1DQAA 4O4GA 1WD6A 5M2RA 1FRMA 4NYOA 1CPZA 1MMLA 2FLNA 4AUKA 1WF1A 1JIHA 4OLPA 4RX6A 1XERA 2NSCA 2YWHA 2OPRB 1FVQA 2V4JB 5ITHA 2XBPA 2Q1LA 3HM9A 4J9MA 1DZ5A 3QAEA 3OVAA 3LP0A 1ZZFA 2HRYA 2RQMA 3QGHA 2A18A 1FE0A 1X0PA 2BANB 2LECA 3LOUA 4USJC 1CC7A 3KK2A 4O3PA 3SSSA 1WNEA 2UXDF 3HVAA 2MJNA 1UKUA 1JLGB 2C3PA 4LFCF 1IKYA 2IM3A 2DGUA 4B17A 3T5HA 2DR8A 1JLFA 4DSFA 4CZCA 3DU5A 3HT3A 1X4EA 2RB7A 4I2QA 2RDJA 4EBEA 1RAJA 3DOKB 2BVZA 1FT8A 1H0HB 3KJVA 2PA3A 3DLJA 2LVWA 1KC8T 1VBXA 1NK9A 4QIWD 2FHKA 4WKRA 3OFGA 3HF5A 4K4XA 3V4IA 2FJVA 2FIUA 3TA2A 5HP1B 2P9GA 1KLMA 5M2UA 2DNHA 2K7JA 2J5AA 3SCIE 1VIXA 3CJ5A 2ZH3A 2PA8D 3J7Z5 1RDRA 3QWUA 1ZAWA 3PJWA 4A8OA 2XLKA 2XMJA 2G9OA 2A1BA 3H20A 1V9OA 5J2PB 2FJDB 2QIFA 2D3UA 1UVIA 5KFIA 1VQKS 3MTKA 4KGMA 3GIJA 5C5JA 2NPFA 4PWDB 3DC2A 2D9PA 1S0VA 2N4DA 5KFKA 5AXLA 1S1VA 4KKOB 5CHCB 4USIA 5KFRA 2BRKA 1UEUA 4B3TF 3E2EA 4K0KF 1Q82T 2C2RA 4OX7A 5CYJA 2X1GA 4MMOA 4RW6B 2HQIA 4O3NA 3ENWA 3I32A 4ZCIA 3TAPA 5J1EA 3HVTB 1R8CA 1T3OA 2GO9A 3H98A 1FK9B 3LPYA 2BQUA 3H5XA 3GE9A 2VG7A 1IBLF 2KJWA 3T3FA 3MOZA 2IRYA 1KONA 3MM7B 1CLFA 3N6LA 2LEPA 3U02A 3ZZYA 2HGLA 2YWGA 3CULA 2ABYA 1R3NA 2YNFA 2ZITA 2FJXA 1K1QA 4AXJA 3HVTA 2B7CB 3I31A 5D77A 3D0HE 1QAIA 2PT0A 3R1LA 4AYBD 3HDSA 1SBRA 1GNKA 3SQGA 3R5AA 4NLDA 1JLEB 2CPEA 3C6UB 3T5KA 1Q53A 1OSDA 4QWDA 4K4WA 3US5A 4CI0B 2JEJA 4LIRA 4B9UA 2P9CA 2R8JA 2B9WA 4ZKAA 2QA1A 3M8QB 3DHWC 1C0UA 4Y6IA 2PE8A 3IA0A 2QFJA 1HNWF 1SL1A 4JI3F 2C28A 2ROEA 4JUZA 1N8RT 2QT7A 2BOPA 3X1LB 5BR8F 1U1OA 4K4VA 3CT9A 3MZIA 3DYAB 1SJ3P 3K2YA 2Z4PA 1GXLA 1GX5A 2YQ3A 4WTYA 1TUVA 2YKMB 4EO6A 1OO0B 3Q8RB 5D8HB 4A48A 1U2FA 1WI6A 1JXEA 1RTHB 4K5SA 5JVGQ 2E66A 5K9FA 1MSWD 2K7KA 4TY9A 5FD1A 1HD0A 2OPQB 2KFNA 1XK8A 4IFYA 1WEYA 1U25A 1LWEB 1KHVA 3PO4A 2HNZB 2YNHA 1HBMA 2IHR1 1HQUB 1YWXA 2KJVA 3J80Y 4KFBA 2ZD1A 2CJBA 4OHZA 2EPIA 4YR3A 3MUMP 1RP5A 1DAXA 1PSDA 3VQSA 3VAHA 3V6DA 1FRHA 2ADBA 1GTEA 2YVSA 3MI7X 5HMZA 1V3RA 2J0XA 1JLQA 2YX7A 4ED5A 2HNDB 2UV8A 3R3TA 5FJ4A 3GILA 2IJFA 3LP2A 4JOUA 4A8XA 3OBIA 4C3LA 4EZ6A 1ZYQA 3K5MA 2EK6A 3LQVA 1NKCA 1RWUA 3E8OA 3TAMA 4PQUB 4B02A 5DO2A 1RISA 3AB2B 4AQYF 2MSSA 1D8ZA 4ZA1A 3H8YA 3OTBA 1H38A 2I2YA 2WCXA 4C11B 5K8MA 2QLXA 1F0XA 2ZE2B 1NH8A 4ERDA 3OR2A 3DLEA 4PG6A 4ID5B 4ZOSA 4ZK7M 5DLGA 4RNHA 1L3UA 1KRPA 4MIBA 4IRKA 4NXMF 4C8LA 1VS3A 2ZZMA 1GX6A 4B3RF 2CZ4A 3OJUA 1KS2A 2RRBA 1B7FA 1U4BA 5L9XA 4PCQA 4CO3A 2ZHBA 4ID8A 2HWIA 1VRUB 3CO9A 4C11A 4ZP6A 2MQQA 4X4OA 3M2RA 4DBQA 5KFOA 2FHOB 3CC2S 3QLHA 1D0EA 2DBBA 4ECXA 2F9DA 5GADU 2WTFA 3SSRA 4NMLA 5IM0A 3PW2A 2R2UA 2KXHA 4LIWA 2GC8A 2XS5A 3B78A 2AYEA 3VAJA 2YKOA 4ED0A 1F5BA 3LWLA 2JC1A 2B4PA 2YX4A 3B4MA 2E1MC 4FF3A 1LWCB 3O5TB 4K2XA 1TQLA 4F4XA 2FD2A 1C4AA 4IG3B 2ZBCA 3KLFA 1IKYB 4QW8A 3UW1A 2J6UA 4NLVA 1S9GB 3NS6A 2AD9A 4DWIA 4C2MA 2RSQA 2V8HA 2IVMA 5AXMA 1YIJS 2VA3A 4HDGA 4C7QA 1RKJA 3J7YU 2PO4A 4A4JA 4AE5A 2YNHB 5HMXA 3H25A 4ZLPA 2MSTA 1WG1A 4CIOA 4ED2A 1TR0A 1VQOS 5KFCA 4HI1A 2AW0A 3PX6A 3FRZA 4UW2A 2HWTA 1GXTA 2AGPA 4IYQA 2HVHA 5EWEA 1IQTA 2HHVA 1URRA 1NNDA 2GJIA 2VPWB 5KG4A 4G6VB 2AF6A 3FDSA 3V6HA 4PPDA 3IG1B 5A8KA 4HHJA 3QYYA 3MM8A 2DPJA 3MF5A 1XC9A 3HI9A 5DDOC 4HTIA 1SJQA 4J9PA 1RYSA 2NUUG 3HKZD 4ZVGA 3GIMA 1SJFA 2DNLA 3U27A 4DSJA 1U6BA 3IR6B 2RQ4A 3TA1A 1BD6A 4BWJA 3DM2A 5KT6A 2HHSA 2YKAA 2EI5A 3M32B 4IH6A 4WZQA 1S1TB 2WW8A 4ITSA 2B4OA 1S72S 2OPSA 4ZS6A 3ZZOA 4NZ0A 1K73T 2RDIA 4MK9A 3WDOA 4EWTA 4I1TA 5JJBA 5GAHI 4B9TA 4JI7F 1Y7PA 2DT9A 3DRXA 2ZOGA 4DQQA 1DLOA 1OS5A 2DNNA 2MGZA 3NMAA 4YB5A 1ZTWA 4UOCA 3PIPQ 3MM7A 1DRZA 2YWFA 2PMZD 1F5CA 5LMNF 1X9SA 1IKXB 3T9ZA 3KLIB 5I4MA 5M2PA 1UL3A 3C6UA 4WCEQ 1FXLA 3KK3A 3FSIA 4LF4F 4JI0F 1B0PA 3BSCA 1FRJA 3MHYA 4CT8A 1S1VB 1FEEA 3PM9A 5LMUF 3KMSA 4CTAA 3TUIC 5A6WA 1W2BR 1IBMF 3POTB 4UY8T 3V5RA 1FRIA 4K4ZA 2JFKA 2YKNB 3E01A 1EETB 4PXBA 3QMQA 1FEHA 1U1KA 3KLHB 3FMBA 3PW0A 1S9GA 1VQLS 3OXLA 5IT4A 4ECUA 4CO5A 3CCSS 3HHLC 3OFFA 1E6VB 4H4KA 1QAYA 2ZC4A 1VBYA 2RT3A 2VPYB 2HMIA 3EGZA 1VMBA 5L1JA 4QWAA 2Q3PA 1U1PA 1KD1T 1RTHA 2DITA 2YH1A 3THVA 1R8BA 1X7VA 2LXUA 5DQHA 5T41A 4RW4A 2OFHX 4O4RA 1YHQS 1FJEB 4NLTA 1H2TZ 2OAUA 1ZAVA 1T95A 4UUXA 2J7WA 1KOOA 1FNMA 2DHSA 2KXFA 2V0NA 4CNYA 4ZPBA 2M9KA 3CDUA 4JI2F 3MAHA 3C8YA 3QWPA 2XGPA 1P1TA 2VFSA 1APSA 5HBMB 2OSQA 4MIAA 1JWWA 2CPFA 4LF9F 3MEDA 2BZ2A 2IMOA 4QBUA 1MW7A 2K3IA 3IFEA 4ZPDA 2EG1A 4R8UB 1FXRA 1LK7A 1Y3JA 5B0AA 4TLRA 2DO0A 1N0UA 4IH7A 2MKJA 1N52B 4D3GA 3NMRA 5CH7B 1HQEA 4EYIB 1VQMS 4J9RA 1IXKA 3GV7B 5I42B 1PGZA 3FNNA 4ECVA 3N01A 1XWLA 1FA0A 1SUQA 5DQIA 3M2UB 1Q79A 4J5OA 1R27B 4NA2A 3QO9A 2CPXA 4PG4A 2LKZA 4FVCA 2ZJRQ 4F50A 2UV8G 4F3QA 1T05A 4K4UA 3AY0A 2G1DA 2ASYA 2VBYA 2N4CA 4O4GB 3O3LA 2DNGA 4B3OA 4C8NA 3UWTA 4CH1A 2C2EA 3DI6A 4JI5F 2WONA 2RQCA 3B4DA 3H5SA 5GMKa 4RUHA 2VC0A 3N6MA 2HNZA 1KQSR 5DGBA 2FVCA 4RLEA 3OSPA 4LUBA 2KH9A 3CC4S 2HW3A 3TUJC 2MMYA 2J0SD 3GR0A 1IUJA 2XY7A 1SKRA 3WC2A 1JB0C 1FRXA 4ECSA 2R7WA 2U2FA 2V8VA 4KBIA 4TNOA 2FVSA 2C3YA 4KR0B 2M8HA 1M5PC 2LXIA 4NCAA 3BSAA 4Q44A 1U47A 2QSFA 2J6TA 4K4SA 2V9KA 4G1QB 1DARA 4FNIA 2HFZA 4YEAA 4EGLA 1JLBB 4I6WA 4YR0A 3UI3A 1XN9A 3UR0A 4N41A 2VC1A 2W7PA 1N33F 2PI4A 3DMJA 3PJXA 2RKIA 3KK1B 2DNYA 1LKZA 3IGNA 3ZZRA 4ELUA 5HBMA 2YKMA 5E7OB 5H9EJ 2HQ3A 2E5HA 3DCAA 4TU7A 2KTQA 2I5JA 3HMJG 1HHTP 1S1TA 2VG6A 1HNIA 1SV5A 2MYFA 3M1VA 2R7SA 2CVIA 1CQMA 1A9NB 3GFXA 3DLEB 5A0YA 2ILYA 1QJHA 2FC8A 3MECA 4BHQA 2AV5A 3IWXA 4XAKA 3R1HA 1K0VA 1L5UA 1JMTA 1MMNA 2AJFE 2IM1A 2J76E 3ZZZA 2HS4A 3IRWP 1LFPA 3QIPA 2C3MA 1D8YA 3SYZA 4DFJA 4KQZA 1RGVA 1FDAA 2RF2A 4X4QA 3EZ5A 2RD5C 3DI6B 3ICLA 4MKAA 3KLGA 3CUNA 2JHEA 3ZZTA 1XNRF 1NKEA 1TKZB 1UJ6A 3BGRB 5E3CA 4J9NA 3H40A 3KNAA 1CVJA 5HROB 2CJ9A 3NS5A 3PW7A 4DFPA 1YJWS 5J2QB 1L3KA 5EHHA 2VKZG 4IFYB 3HXMA 1S0OA 4Q45A 1WHVA 3BF4A 1U1RA 3KWMA 2PD1A 5IWAF 3MTJA 4PPZA 1KVJA 2X1AA 1IKXA 1MNEA 4ZVFA 5KFTA 4PUOB 2M7SA 2CQ2A 1C4CA 3BGRA 1FRKA 5B0FA 4DN9A 2XO7A 3IS9A 2Z0GA 3OR1B 4ZVHA 5MAOA 3D1HA 3FJ2A 4DL3A 1BQMB 4Z37A 5HQ8A 2GQ2A 3N28A 3OL7A 4A8MP 3ISND 3CJKA 3DFEA 2NXUA 3OV7A 2K2PA 1DQ9A 1KFSA 4KKOA 5BJRA 1C1CA 4Y2IA 2L48A 4FNHA 1U2RA 5KFJA 5CD4H 1SXLA 1LWFA 3A1YG 3I0RB 4RBVA 1VHFA 4DX8H 5IT0A 1V3SA 3VAFA 3PY8A 3BS9A 1L3SA 1ULRA 3GV8B 2IYGA 1YG0A 2BW2A 3GB0A 3W7BA 2ZNZA 3BGUA 4FXDA 3DLBA 4NLSA 1PC4A 2MKKA 4OLOA 4FYDA 4OFZA 4C0HA 4F67A 1QSSA 3KLEA 1VQPS 1KFDA 1NJXA 4ES2A 1RT3A 1KR4A 7FD1A 2NR0A 2VG6B 5LXYA 5D4OA 5BYRA 2DGWA 1U26A 4MIWA 3CCES 3DRPB 1S76D 4KO0B 4NCGA 4WF9Q 2E1RA 2OD6A 3D1QA 5L9NA 1JJ2R 4DR4F 7FDRA 2DVIA 2XS2A 1P1LA 4Y0FA 1FKOA 4DEZA 3W2VA 3G96A 1LQ9A 2F9JA 3N6NA 4O0IA 5DQGA 2EKYA 1GAOA 5HMYA 3PDNA 3CB4A 2J9DE 4RUCA 1WTFA 5EWGA 2AJ0A 3LO3A 5KFDA 2XS7A 4L6V3 2KFYA 3QGIA 1HI0P 3CD7A 5KOXA 3X3UA 1BLUA 4ZP9A 1D9FA 4FPRA 1S97A 4ZPCA 4CO4A 1QM9A 3N5FA 1N34F 2V8DA 2A2DA 1QUVA 3MFHA 2VZ9A 2WOMA 2ZFHA 3U7JA 1RT4A 3BGFA 4MKBA 3VCDA 3ENVA 5E3RA 4DV4F 5IT9Y 2KT5A 1IR0A 1G7CB 2B51A 5CYMB 3OL8A 4DL6A 1D9DA 5KFQA 4PWDA 4R8UA 1HWJA 3RTVA 4X4TA 5KG5A 5DDRC 1YGYA 4WJBA 1UVLA 5CYQA 1Q8BA 4OHVA 2IRXA 3BREA 3SDEA 3CCUS 1AFIA 4PR6A 4DSKA 4QIEA 4X64F 4A8WA 2UUCF 2MPUA 4RW8B 3V6KA 4ALZA 4RU2A 1Q1KA 3BO4A 4J9OA 1T03B 2EFOA 5CYMA 2C3UA 4ILMA 3MFIA 3I55S 5D6GA 2BBEA 2CVEA 4EUVA 3CXCR 5L1LA 3MXHP 3FEZA 3DNCA 2RU9A 3K5OA 4UUWA 4ZP8A 1EP4A 3AH6A 1YTYA 2IRUA 2NREA 1RT5A 2HHTA 4C3MA 2P5VA 4YB1P 2K3KA 1F9FA 2JLEA 2OP5A 4DMZA 1U1LA 2C42A 2W9AA 4IUFA 3H5UA 4B3OB 2EFQA 4HDHA 1AXQA 1N5VA 1DTTB 2DRBA 3CCRS 1T7PA 4Q8EA 3ENQA 4K59A 2DR5A 3SCJE 2L08A 1GXUA 3LGNA 1JNRB 2KM8B 2FY1A 2XMMA 5DG7A 4LJMA 4H4OA 1NK4A 4ECZA 4N56A 2E29A 4X66F 3TVZA 2GFFA 4V19J 4DUYF 3MMJA 4R25A 4RNNA 3W3SA 2Y1RI 3JTNA 1U6FA 3CCTA 3PNIA 4R5PB 3KLGB 2HVIA 2CJQA 3TRGA 3J7ZT 1CC8