3IAM9

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
154
structure length
154
Chain Sequence
YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
total genus 24
structure length 154
sequence length 154
chains with identical sequence G
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
9 PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iam900
2FUG9 4HEA9 3I9V9 3IAM9 3IAS9
chains in the Genus database with same CATH superfamily
1VFJA 3VZHA 1RT2A 1FERA 4C4WA 3GV7B 1U45A 5DDQC 4DPYA 3NMAA 1RHRB 2M3DA 5CD4H 2WONB 1U8WA 4ELVA 4Z37A 1NB2A 1NMEB 3J7YU 1SL0A 1FRKA 2QMUB 4M63A 4Q2MA 3IS9A 3DM2A 2QLXA 2D7SA 3VF0B 2QLBB 4MTPA 3DOKB 1S6QB 3NEKA 4ECYA 5AXNA 4OYPA 2KG1A 4DV1F 3QAUA 3DGPA 4FF3A 1S76D 2D3UA 2MTLA 4AT1B 4JV0A 2X1FA 4EBEA 1U1QA 2XWYA 3N79A 4K0KF 1FESA 2AKWB 3PHTA 5KFVA 3OL7A 4DR1J 4IH6A 1Z2LA 4RW4A 4FF4A 3OL9A 3C6TA 3CO0P 3DI6A 4O3PA 2Z30B 3IBFB 2YQ1A 2BOPA 2ZH4A 3SBMA 3S7RA 1GQEA 3TUIC 1VK3A 1YG0A 4NA2A 4ETZA 1HI8A 2XHWA 4UY8T 2A6OA 1R0AA 4QR2A 2G0CA 4KE5A 1LEOA 1X7VA 2BM0A 3CDUA 5HATA 1XMQF 5K14A 1UEKA 3O3LA 3MEEA 4M5JA 4WU3A 4V19X 1WDDA 3U7JA 1C4CA 3R1HA 4GMKA 1U6BA 5IV4A 1FTCA 2HRUA 5LL6d 3LANA 4HT7A 4WU2A 3FZ2A 1UZHA 2HQ3A 4IFYA 1VK8A 4HDHA 2Z56B 2K3IA 4B3RJ 2GFFA 2DH8A 5CZXA 4X62F 4ZVHA 5G4DA 2ZJRQ 2OPSB 1VRUB 2JVRA 4MKBA 5K8NA 1Y5LB 2W7OA 3KHLA 2NZ4A 3O8WA 3EZ5A 2LQ5A 2MY7A 1PC4A 3KLEA 4PYAA 1BMQB 1Y3JA 1R7IA 3IBWA 1KONA 2WOMB 3Q8QB 2BZ2A 2YBVA 2GCFA 4A8QA 4DS4A 1T95A 4DR7J 1C1BA 1XERA 2VBYA 1X31C 4YHHF 4DV3J 1ZM9A 4N7TA 1C0TB 4C0BA 1N0VC 1HNVB 1CPZA 3W2VA 2C1EB 1KNZA 1UW9A 2B8PA 4Y3CA 5B0DA 2DITA 3HJVA 3AODA 1G6BA 2XQCA 4F3MA 5KFQA 2HNZA 1RTDA 2W8KA 1UA0A 2WSCC 3BDEA 2CNNB 2ATLA 4I2PB 2DGOA 5CYQB 4CNZA 2EXUA 1U1KA 4DV4J 3GJQB 2WHOA 4J37A 3J81j 3VALA 4USWA 4JI1J 3V2UC 3HI9A 1RKIA 3DRYA 2HFVA 1CULB 3KMQA 1TMMA 2HHSA 3ZZOA 1RWWB 2W1BA 3POTA 4O3SA 2VBWA 4C8LA 1HYSB 9ATCB 4DSKA 3K5PA 2J7WA 5K20B 2WVBA 1FVQA 3ETOA 3IM9A 5C7PA 3ICLA 5DZ6A 5L1IA 4I0WA 2M4MA 2CQ0A 2I1RA 4LSNA 2G9OA 3CJ4A 2QA4G 1NHUA 4MFBA 2W9BA 3IRXA 2FJXA 3W2WB 1FK9A 4JI7J 4PXDA 3SQOP 1Q8IA 3PW2A 4YDXA 3TQ1A 4LF8F 2HIYA 4WFBQ 5KT2A 3BQ2A 3D67A 2F9JA 1FO1A 3MUTP 1B0VA 3THPA 2DISA 2OPRA 3QQCD 5KFJA 4QYRA 2QLJB 1TL1B 3VQSA 2QA4S 2IBOA 1RT1A 5HANA 2R2SA 4YFUA 4CTAA 4CM0A 2GQCA 4HHHA 1SUQA 3PO5A 3OBIA 1WKJA 2YPZA 2D3ZA 1PBAA 1WC3A 1I6JA 4LBIA 2G2ZA 1OQ6A 1VQSA 4XTTA 2HNDA 5CXTA 1IKXB 2UV8G 4RW7B 3BGUA 3PEHA 3JSBA 3QWPA 3C8YA 3DGVA 2E1RA 4U9RA 4KHMA 1MROA 2E1CA 2VQEF 4QPXA 3GG1A 3MR3A 4KFBB 2DRBA 2FHKA 3A8JA 3W7BA 3DHWC 2FLLA 1NJYA 3PX4A 3BREA 2NXNA 2NXCA 4RUAA 2R9LA 1F9EB 3AB2B 1S1XB 2BQ3A 3H40A 2HNYA 3EJMA 3H25A 1TKTB 3QGGA 1S1WB 1RUSA 4P7TA 4DV7J 5KFFA 1K47A 4XO0A 1IR0A 5IWAJ 1X8DA 3VV2B 4OX9J 4JV2A 1QDUB 1VI7A 4DQIA 2Q43A 2MSTA 2KT2A 2B9EA 2FJDB 3UCGA 1D9DA 3T5JA 4ECUA 5HROB 1OPZA 4OX7A 1WC4A 3O44A 3MM5B 1SKUB 2CPJA 4KR0B 4MH8A 1F3FA 4Q0BB 4C3LA 2KKHA 1VJWA 4TKTA 4I64A 1U49A 2ZD1B 2RDDA 4B3OB 2XYGB 1RU2A 2EG2A 1DHMA 3IP0A 3R5CA 1YJ9S 1UP1A 3F56A 2X1AA 4WP9A 3D4JA 2UP1A 3E51A 4DV1J 1U1PA 3DOMB 2CQGA 4PQUA 4ZN1A 1VS3A 2CJBA 4UZBA 1IKYB 4ZCMA 2A2DA 2E9TA 1HNZJ 4ZLJA 3OSNA 1IBKJ 1B64A 4GVBB 1WD6A 4B02A 4K0KJ 2F40A 3TAMA 1KS2A 3RG6A 1NSAA 2RD5C 3KOAA 4NWBA 3FBEA 1SKSA 3DLKA 3RYLA 4RW9A 2CQCA 1LK5A 1IQZA 2Z2LA 4DG1B 3C16B 1C0UA 3VVTA 4DUYF 2WAQD 2MHNA 3OV7A 3K5OA 1VQ5S 2KFNA 1RT7B 4F67A 1S0MA 2CQDA 1TL7A 3IAM9 3G6XA 3ISZA 2DNRA 2P9CA 2EFGA 3AHPA 1N5QA 2MHEA 1HQUB 2MQPA 3A8IA 2BM1A 4URGA 2K06A 5I42A 3NMRA 3J80Y 1GTHA 4FYDA 1SL2A 4F7VA 5LSOA 3CCWA 4URSA 3PHEA 2DGVA 4HEA9 4LR8A 3A8EA 4CWBA 4OZ1A 1SJQA 5K8PA 4GC7A 3UCZP 3KG0A 3F73A 4X62J 4O44B 4FDFA 1WELA 4CYUA 1VRQC 3TX8A 4M8LA 3TAQA 3BSOA 1HNIA 1LW2B 4DR5F 4NRTA 4FKXA 1J2VA 3OR2B 3UNYA 4HT5A 3O1LA 5F8GA 4K59A 2DNOA 4RUCA 3UN5A 3V6HA 5J2MA 2JLEA 4P72A 3HMJG 2GO8A 2R7VA 1CQMA 3EGZA 1SJ1A 3P49B 4Q7AA 3I55S 3FC9A 3HFVA 3P4UB 3RAXA 3TJAA 1BUXA 4OFZA 4ECSA 3G6VA 1IWAA 4YHHJ 2M52A 3MAHA 3VAJA 1YZ7A 1KR4A 1SH3A 2UXCF 3W8PA 1Y7PA 2H5JB 4P2MA 3MZIA 3PW7A 3B8HA 2QEXS 1U6FA 3HX9A 1FRIA 2MLYA 5B0FA 1P8GA 4ZMMA 3PYEA 4C8NA 3FUYA 1Y3KA 3V4IB 4Y0FA 2R7OA 3L3CA 2ADCA 5KG6A 2WONA 1JJ4A 3GSIA 1EX8A 3BQ1A 1ZAWA 3R8YA 1IR1A 3DDIA 4D3HA 2PGCA 1MSWD 3PKYA 1TL4A 2HLTA 1CC7A 2GHWA 3CCLS 4EFAC 3KHGA 3DOKA 1K0VA 1S6QA 1XEZA 2DY9A 3ISNC 2VL1A 3SDEB 4ZN3A 5D15A 5LM7E 1KQFB 4UQTA 3CD6S 4DCPB 4EGLA 2ZH1A 4NYZA 3P6YC 5H9FJ 5CCLA 5KAKA 1U02A 5KT5A 2K3KA 4O0NA 4NEZA 2YKOA 4TLRA 4LF8J 2DHSA 4J9NA 5DLGA 3PYFA 2DNMA 3MPYA 1JLCB 4BCAA 1VHFA 2HG4A 1DAXA 3HO1A 4PABA 5M2RA 2UUWA 1HWJA 2HLUA 4AD6A 2Q79A 3FRZA 2X7IA 3TX0A 2AYEA 2ZOGA 1R27B 3H90A 4QIFA 2MZTA 3ENQA 1DBDA 3CF5Q 3M32B 2UU9J 1NKCA 2FYXA 2HURA 3L7UA 1X0PA 3QT7A 2IRUA 2LEAA 3FBBA 2J9DE 4NLXA 2HWTA 4JV5F 5A2QU 5CQGA 2V68A 2EC0A 1NZAA 4BWJA 3MMAB 3H5SA 3RB3A 5A6WA 4YOEA 4Q5VA 4OV1A 3R3TA 5CABA 3ZZZA 2DPIA 3E8OA 5DS7A 4DX5A 4I67A 4PKDB 2VQEJ 2EBGA 2OEMA 1FNXH 2LA6A 4DV0J 2OPSA 2PDAA 1KEKA 1VRUA 5KFMA 4GO7X 1G2EA 2JEFA 3RB6A 3U1LA 2Y9HA 5J2NB 3BGFA 1N0UA 5E3PA 4P52A 4F4YA 4YQWA 2MKCA 4TLQA 4DL7A 2WOMA 2VUGA 1GK8A 3CJ2A 1LWEB 3CJTA 2BQRA 4NLTA 5HQLA 2IVYA 4NLQA 1VQ8S 1C0TA 2HQCA 2UUBF 1HNVA 5KG1A 1KD1T 2AYGA 4OYMA 2IRYA 5LSRA 1G7CB 2EK1A 3MFIA 1BQNB 1FF2A 2AGOA 3DLEB 4RW8B 2MDAA 2Q6CA 5IT0A 4JOUA 1EAYC 4I2PA 3KWMA 5CYQA 2FJAB 4KC5A 4CO2A 2IJFA 2IYIA 4QCLA 2HZCA 2CG8A 4GKKF 3M7VA 1NHKL 3CJSA 4ZK7M 3N9UC 2V34A 1GFWB 1CULA 1RT6B 4PYDA 3W62A 2DNHA 2GV1A 1M1GA 4ZVRB 1XN9A 1HYSA 2P2CB 4BBYA 2WVEA 3EE3A 3AJ2A 1SVDA 5D77A 3QT6A 5GAEI 3IR7B 3OXGA 1JQGA 1XR5A 1YBAA 3W2WA 4FXVA 3TUZC 4KJIA 2DCUB 2QO3A 5B0GA 4WF9Q 4HACB 4FBTA 4K5SA 3NCPA 4I2QB 1L3SA 1P1LA 1K8AT 4F3OA 2V8HA 3EVMA 2FLPA 5DGAA 1FX4A 1WSRA 4URQU 2ZM6F 3M8PB 2DGSA 2JEGA 4YP3A 2QL9B 2Q66A 5HMXA 1TL1A 3R5BA 1KFSA 4LQ9A 3HDSA 3M1VB 4ZVUB 1IUJA 1APSA 3TA0A 2F8MA 2L48A 1YJ7A 3MPWA 2HGLA 4AE5A 1RAJA 2QG9B 2R7UA 5IT9Y 3OR1B 3HZEA 1IKXA 2H1YA 4IUFA 1EQ0A 2V9WA 4RW7A 3CSKA 2FVPA 2VKZG 3PW4A 3NL0A 5D4NA 3UDEA 2Q3PA 2PSZA 3DMJB 3W61A 1SC3B 5JVHQ 3KUEA 2ZNYA 3D6FB 1FKOB 4WP3A 1YJTA 1RWPB 1D9FA 4KFBA 4I69A 1RHMB 4LFBF 4RBUA 1HW8A 4USUA 4DR5J 4ERDA 4J90A 2VPXB 1S1XA 4FVCA 1TKTA 1S77D 1CQNA 1S1WA 2QA2A 1EQMA 3I32A 4Y2CA 2B8QA 2CPIA 1UPMB 1K73T 4B3SF 2HHTA 2UXDF 3FBFA 4JI8F 3ELHA 5KFNA 2H65B 3BZQA 2YWKA 4I1TA 3E2EA 1AW0A 1FKAF 2RH3A 3PFOA 5HROA 4F0HA 1FXDA 5J1PA 2NZCA 2NQPA 3MM5A 4XIUA 4P75A 1SC6A 1VLOA 2IM0A 4Z7CA 4DPTA 4RZRA 3FMWA 4LIRA 1BQMB 1PSDA 4QU7A 3TUPA 1CS4B 4Q0BA 2KM8B 1NU4A 2ZD1A 4B3OA 1S0OA 1NDPA 3IR5B 1X5OA 4RW6B 1HW9A 4I6YA 3T1HJ 3KMSA 2FC9A 2F7VA 5L46A 1VQ7S 2JVOA 3K5LA 5AJ3F 3I31A 2FZGB 3DOMA 2DNKA 1H3DA 1PYSB 3N6MA 4GKJF 4IH5A 4NXNF 2DO0A 1IKYA 4A4JA 5JVGQ 3QIDA 1HBOA 1HQEB 4GVBA 4X4SA 3JAMU 3PY8A 4OI4A 4P71A 5FLXU 4HYKA 1TR0A 4ED0A 3SZ2A 3DLGB 3LOUA 3GLJA 3PKMA 4ZLPA 3D1QA 2CJ9A 4DG1A 3C16A 2UUAJ 4DV5F 4G1QB 2ZZNA 3I9ZA 2AJ4A 5AXLA 4RL1A 1A6LA 1IR2A 1RHQB 3R27A 2JLGA 1RT7A 1OY9A 3P45B 1YX2A 2GHPA 1SQEA 3GE9A 4KRWA 4G3IA 5DQGA 2XB2D 4CP5A 4UY85 5EN1A 4X4TA 5F41A 1Q78A 3MAAB 3A3NB 1N34J 1HQUA 3PW5A 1M5PC 3A3PB 1Q86T 2FHOB 4KHPJ 3CTRA 4DZDA 4I68A 4L6V3 1T8EA 1N36J 5J1NA 4L3NA 1T11A 3RTVA 3CDAA 4KSEB 1KHVA 2R2RA 1RWXB 4OZJA 3VZIA 4O44A 2KZMA 1NKEA 3C66A 2FDNA 1TV6B 1LW2A 3OR2A 1AZSB 3M6UA 3H4DA 1H2TZ 1LNQA 2N82B 1RAOA 5ETVA 3QO9B 3BKUA 3J7Z5 2CIMA 1R8CA 2DNZA 5RUBA 2EPIA 2IMWP 4PWWA 3CC2S 3JTOA 1UPPA 3BYPA 3VGVA 2UUBJ 1A0OB 4CLLA 2BR0A 1HFEL 2A0FB 1YZ6A 1OO0B 3NGRA 2CPEA 4A48A 1T03B 3QIPB 3MMJA 4KIAA 2FHJD 4YR0A 4DMZA 2MQLA 2DK2A 1HWUA 1UL3A 3V6JA 2LQ8A 2W2MP 2POKA 1X0FA 3V4IA 1Y00A 2BX6A 2CJKA 1U0SA 2QA1A 1GAOA 3VAMA 2VJUA 1QSLA 4LJMA 3NS6A 4PRFA 3ITHB 2VOPA 1RHJB 1OY6A 1ICEB 3OFHA 3MUMP 2DNGA 2CDQA 3RR8A 2LXUA 2XYPB 5E41A 2L9NA 2P8IA 2XO6A 2QFIA 3I6PA 1XR7A 2XWXA 1YHQS 4M5KA 1W2IA 4DPOA 3FSXA 5IC6B 2ZZTA 1JNRB 3BQ0A 1ZOTA 2XLJA 2VC0A 3SDEA 3TUJC 2BKOA 1IXKA 3I5AA 1B0TA 4C7QA 4DBQA 5C42B 1FRHA 2ZWOA 2DR5A 2V50A 2B5JB 2C2OB 3MF5A 4DV2J 4B3MF 4IG3B 1ELOA 3G9CA 4NPOA 1O5JA 2VICA 5ETLA 2BJ8A 1JLCA 3ZC4A 3PZPA 2HKEA 4G1PA 4C11B 4PG7A 4F4ZA 2OD6A 5IV3A 2AV5A 3GU0A 3S6EA 4X66F 4L73A 1RWUA 4GVLA 1TL3B 1FRJA 1N54B 2FZCB 1RQ0A 5C2GA 4P2FA 1VJQA 2DPJA 3M32A 3D0GE 1VQPS 2E1PA 1QSSA 2LU1A 4NLDA 4KGXB 2YKMB 1YJNS 4ZJLA 2VODA 2YXLA 1JXVA 2BJ7A 2MXYA 3RB4A 3WC0A 5A0YB 4M95A 4N8NA 2YKPA 4Q2LA 3MMAA 3QWUA 2VOOA 2HHQA 4KYZA 1WTBA 2QL5B 3MTKA 3OPKA 1XC9A 1GMWA 3NNAA 2E7XA 5C25B 4S0MA 1CJUB 2B6AB 2DT9A 1LK7A 1QM9A 4LFBJ 4F4KA 1L3KA 3TANA 3AD7C 4JI4F 5J2NA 3W9IA 3OHBA 3CVKA 4P2XA 3LALA 5GADI 3OJSA 2EFOA 1CJKB 4ZVEA 2QRRA 5GAHI 2XEXA 3CCRS 1T02A 2MKHA 3EWGA 4LSLB 4USHA 3SV3A 3T6BA 2O1PA 1V6HA 2HWIA 3M8WA 3UDVA 4W98A 5AE1A 1LWEA 4RUBA 4B3SJ 4ZPCA 1BHNA 4JI8J 3M6WA 2HGMA 1OMSA 3CJ3A 2CZVC 4ZP8A 2UV8A 3M9NB 3R7SB 3KDOA 1YLXA 2C3MA 1AUDA 2OTLS 3QATA 1JX4A 3PCOB 1H73A 1BQNA 3FEXB 5BYSA 3DLEA 3AXKA 1SQFA 3LH2S 4RW8A 4ID5B 2ZOMA 1RADB 2W24A 2P9EA 4ANDA 4YN3B 3DRXA 1RWVB 2PIIA 2CYYA 4JP8A 2ZH2A 3PG9A 3H5YA 2XNRA 3KLIB 1M5HA 1DTTB 2IVMA 3AFGA 1PJ7A 1FRXA 2E5HA 1RT6A 2MQOA 3Q8YA 2LCWA 1NSPA 2JOQA 3FSIA 2HZVA 3PX0A 4OYWA 1HBUB 1XJWB 2DH9A 2X1GA 1LWFB 1S10A 4OZ5A 2IDEA 4RPFA 1MWYA 3FDSA 4QZVB 1KN6A 3DRSB 1SKWA 4GO5X 3GG0A 4GKJJ 4NXNJ 3G8QA 4FP9A 4JI6J 3WIVA 2YWWA 3HFZB 1SXLA 4K8RA 1DURA 1WOPA 1FJ7A 2F5GA 3TJ9A 2WZ1A 3TVZA 5L38A 2DEJA 2NXEA 1LW0B 5D0GA 4HACA 5AXMA 2YX1A 3CJRA 4I2QA 4NCAA 2AP6A 1M1HA 1FI4A 4DV5J 3M8PA 4OHZA 2HBYB 3RR7A 3ZZYA 2NPFA 1KBRA 3HP6A 1H6KX 3NOCA 4OZNA 3M1VA 2RS2A 1NB7A 1N32F 2B51A 2YH0A 3LGMA 2QZ8A 1SH0A 4AYBD 4PXEA 3T9ZA 4R0EA 4WCEQ 3HULA 4CT9A 2RUSA 1UA1A 3OR1A 5E3QA 3NGSA 2ABYA 1MMLA 3K89A 4M1KA 4ZP7A 5KT6A 1RAGB 3DXBA 4NA3A 1WHVA 3E01B 5CH7B 3TA1A 1KLNA 3DMJA 2X51A 2JHEA 4DFJA 3TARA 1Q8LA 1MNEA 2OFHX 2JX2A 2LQJA 4OZ2A 1FKOA 2L3MA 2H51B 2KHDA 2LKZA 1ITPA 1VC6A 3GR0A 5KFSA 3S8SA 3T5LA 1OS5A 3T19A 5HQMA 5EX3A 4DF8A 3ENAA 4QU6A 1FCAA 3LGNA 2ASJA 4LF9J 5IQQA 3L95X 4LIWA 4JI3J 2R42A 1S6PB 4TQRA 2NLWA 1WOOA 1ZAVA 3D6HB 3KLHB 3MDFA 4ZVQB 1D0EA 1DLOB 2C2EA 3KLFB 4JI0J 4WFXA 1YWXA 3H42A 5AXKA 2E1MC 2FIUA 3VAFA 4MK7A 4ECRA 4CO0A 2JH3A 1X5TA 3M8RA 2J0QD 1HNWF 3EDQB 1UETA 4M94A 1GX5A 2VDHA 2DGTA 4EK2A 1X4GA 2ZJQQ 3JYTB 2GIQA 5JUMA 1HR0J 2C3UA 2OPPB 2E29A 3F44A 3NKYA 1FDAA 2PFDA 2HHHF 1QE1B 3GFYA 3G86A 1WHXA 2XMUA 3MHYA 2F4VF 2Z57B 1FXLA 3M30B 1BQMA 1F1BB 5IQ6A 1CS4A 3SSSA 2GVZB 4KHRA 4V1Ak 1IWGA 4CLKA 2D69A 3PJWA 2AEFA 3QNWB 2GMJA 4ZLLA 4RW6A 2ZH5A 2M0GB 4NA1A 4BC9A 4BLGA 1K9MT 4DV6F 1S5ZA 3NAIA 1VLYA 3GONA 4EEYA 3BKFA 4X4RA 4HHJA 1SJFA 1YRTA 2CQHA 2ZH3A 2HBZB 2KH9A 2DGWA 3O6QA 3TNVA 1JLGB 1RCXB 1D1UA 4MIWA 3CCVS 1RLCL 2ZOFA 2VFVA 2IDLA 3VGUA 2OFGX 4WZQA 3HT0A 1HQEA 2RU9A 3IA0A 3IBCB 1RGVA 1S7IA 4B3MJ 3OUYB 4F8RA 3DLGA 1FKPB 2Z58B 2HFOA 4RR5A 1RISA 3HJFA 5A8WB 3DKDA 4G1QA 3FEZA 1WC0A 2RQMA 5L1JA 4DCOB 3HM9A 3HVRA 3AD8C 1S72S 4OYAA 2A6MA 1QY7A 1NJWA 2DNLA 1SQGA 3UDLA 4X66J 3BYRA 2IC3B 1WC5A 3T5HA 4ILLA 4ILRA 1V5IB 2PFFB 1PYTA 3MAAA 2B56A 2MLXA 2XGPA 4UQGA 4EO6A 3KLGB 5HVFA 1FWPA 2AYBA 1EB0A 3N0VA 4IFVB 1KLMB 4H4KA 3M8QB 1NJZA 2FJWA 2CAJA 3UNGC 3BN7A 3CE8A 3MR6A 1EKSA 1SJRA 4DFKA 2RQCA 2JLFA 2WB4A 4OZ3A 2R8IA 2R8HA 1RHKB 3AXMA 1TV6A 4N47A 1B4SA 4LSZB 4OHXA 2RAQA 1AZSA 4X4PA 4WIQA 2WRMA 2XZWA 1W7WA 2F3JA 2OMOA 5DDRC 3MAQA 2C2MB 4J9LA 2W01A 3QO9A 4YEAA 3OXFA 2ZJPQ 2ZUGA 4FYWB 3ILJA 4OHVA 4OIXA 4ZVPB 1RWMB 2VONA 5B08A 1F5BA 3CDBA 2C3OA 2YNGB 3AJ1A 3GJSB 2PC6A 2QJ3A 2D9PA 1JK9B 3AD9C 1RTZA 2HZAA 1B7YB 2RF2B 1T03A 3QIPA 4DL6A 1YITS 1LFWA 2MYFA 3EUNA 1NDKA 4IDKB 2L9WA 4DR1F 4TU8A 1L3UA 1S9FA 4CLTA 4NLVA 1WHWA 4E2FB 3ITHA 1JNZB 3GIIA 4FNIA 2MKJA 3W1YC 2IAJB 1FDDA 5KT4A 1UVIA 1OQ3A 4QWAA 1PJ6A 5DO2A 2R7QA 2XI3A 3M8ZA 3UD5A 3K58A 1HWIA 2YNFB 1RA7A 2XMTA 1MWZA 3F41A 3UO0A 2ZZMA 5BR8J 1N33J 4C48A 4EUVA 2C2ZB 4QR1A 5C42A 1Q5YA 4HL9A 2C3PA 1RTIB 1Q53A 5KFAA 4OZ0A 2B5JA 3T5KA 1F9HA 3MURP 4IG3A 5GMEA 3OTCA 2B9XA 4N41A 4OJGA 1YKWA 2A1BA 4RWWA 4DQRA 3C46A 3T1YF 3C6UB 4G65A 4C11A 2G2OA 1JXLA 2IRXA 2BOAA 2LDYA 2CXEA 3VHQA 1N8RT 1U47A 1KQGB 1T9YA 4DX8H 2KJVA 2Y8YA 1WORA 3HKZD 5B0CA 2VHGA 1N32J 1TL3A 1ZM3A 3OQ2A 2UUCF 4H4MB 4ZJQA 2AGQA 4FXDA 1OSDA 4CO4A 1MWQA 1DQ9A 5THWA 2MJUA 3OL8A 4RNOA 3CCTA 1ZETA 5LJ3Y 2YKMA 4V19J 4DV3F 3Q8RB 3BN4A 2BJEA 4FXWA 3W3SA 1TMJA 5A0YA 5DRKA 2WSFC 4Y28C 2K7JA 3PJXA 1FD2A 1MU2B 5I4MA 2Y1RI 7FDRA 3FK4A 1RP5A 4XK8C 4ENOA 2M5YA 4DPXA 5C25A 2Q6BA 4RJVA 1CJUA 2B6AA 4X65J 1T7PA 2R7XA 5M2UA 4B3TF 2XCAA 1L5UA 2V2QA 2GC8A 3UQSA 4X64F 3L7PA 1JLBB 3JSMB 1RDRA 4JI1F 1HNXF 2LFVA 3CD0A 3ILLA 1CJKA 4PAAA 4M5IA 4LSLA 3KXDA 3AB4B 3ULHA 1FT8A 1LWXA 4ZVOB 2N4CA 2VFTA 4ZPAA 4USVA 3J81Y 3RBEA 2CJAA 2IVFB 3Q86A 5KG5A 2MPUA 1HNWJ 1VYAA 3CDWA 3BEGB 2KO1A 2DIUA 5LXRA 1H74A 2ROEA 1Z1ZA 1NK9A 3BO4A 1YQHA 4EBDA 1IKWB 3K8WA 1O51A 4HI2A 4ID5A 4JI7F 3KG1A 3G8TA 4Q44A 2HHHJ 4DSEA 4TU9A 3UD4P 2IA6A 1D8ZA 1FFGB 4LFAJ 4UOGA 3DHXA 3HFKA 4B9TA 3KJNB 4KTQA 4O0IA 4DHVA 4OYZA 4IRDA 3KLIA 3G87A 4HTJA 1DTTA 4F3QA 2HQIA 3MECB 2B3TB 2RRNA 2V4RA 5D4PA 4ECTA 4WYWA 1QAJA 4DV6J 2OPQB 2XMMA 1HBUA 2EI5A 1SL1A 1L3TA 1LWFA 2BEFA 3DRPB 2DY1A 3QRQA 3GILA 5J1EB 4FVMA 3DRSA 3CDEA 2E9RX 3NWRA 1NHVA 1CVJA 1N48A 2ILZA 3N5BA 2HS0A 1R6VA 2HQDA 2U1AA 2GGPB 2FGOA 1IQTA 1F2GA 6FD1A 2H4YB 1LW0A 3FSYA 2PA8D 3KYLA 3IN5A 4OHYA 5F9NA 3V5RA 3VAKA 3KJFB 2A2CA 5T7LB 3RGIA 2J8AA 5J2PB 4C97A 2B4VA 5B0AA 4K4ZA 5KOWA 3LPEA 2OO4A 2Y1JA 3A13A 3OLBA 5SZTA 1U2CA 3MD3A 4UUXA 1BWVA 2KJWA 3BSNA 4ED6A 1VC0A 4LF7J 4DV7F 1P9QC 1WHYA 1UWBB 4LQ3A 1FX2A 5KFGA 1G4CA 2YNHB 1QAIA 2MJNA 3EPIA 4Z7YA 1QTMA 4UF4A 4TVAB 5JJBA 2DB1A 3B54A 5LXYA 3E01A 2KDOA 4ZS6A 4F0KA 5EUHA 3HLUA 3DN9A 2QGFB 2FY1A 1I94F 3PDNA 4CO1A 1V5VA 2O3DA 4ES2A 2YWFA 4DL0C 3CIMA 1X9WA 5IXUA 3OFEA 4KGZB 1S6PA 2DHAA 1RBAA 3DCAA 1OJ4A 4ZHRB 1DLOA 3KLFA 4DL3A 2RDIA 1BY9A 5LJ5Y 2HRTA 5ETSA 4RX6A 1GXLA 5A6PA 2JSXA 3ZO7A 3IO1A 2AGPA 5GAGI 1Y10A 3QRPA 2KT5A 2GX8A 4C6AA 1NBEB 1JLEB 3Q8UA 3JYTA 3CMQA 2RQKA 1HNZF 2OPPA 2W9CB 3QT8A 1EIYB 1IBKF 5GMKa 3CCUS 3I82A 1VGYA 1QE1A 2VA3A 4ECXA 1Q79A 2WCXA 1W2BR 3GP9A 3KHRA 1XBWA 4ZIVA 3M30A 3SI8A 3ISND 2GVZA 2YX4A 4H54A 5KFIA 4WZMA 1LKZA 2OTJS 2QTWA 2AZ3A 2AJ0A 3UPFA 4I56A 4K4YA 6AT1B 1GMVA 4CLPA 2J9EA 1RAAB 5ITHA 3GCWP 1WG1A 3GR1A 3LWMA 5KG2A 2LXIA 4LVNP 2HAFA 1JLGA 3O5TB 1IJFB 3HHNB 3MMCB 2KFYA 4ECVA 3CCZA 5L9XA 1YJVA 2JJ4D 3N6NA 3IG1B 2OIHA 3BKTA 2AEMA 1VHIA 3K59A 2XCPA 4NYPA 5HSPA 5K8OA 3OUYA 2BQUA 3RUBL 3I56S 3H5XA 1FKPA 4P7VA 4IR1A 1YJUA 1NJIT 1L3VA 2NXJA 3T1YJ 3EGWB 4YS2A 5A8WA 1RAIB 3HVAA 5ETOA 3RRHA 3GSDA 4XAKA 2RMLA 2GHVC 3FEYB 3QGHA 2YKAA 3J80U 3CPWR 1UVKA 1VRTB 3N5FA 4R25A 2W2PP 1F0XA 3BR8A 2EFQA 2CVEA 2ZBCA 2ZBRA 2IC3A 2SXLA 2UUCJ 2A18A 4EBCA 2N7CA 4WFAQ 3CC4S 4F04B 3I0SB 4DU7A 2M8DB 4LVOP 2AW0A 2AD9A 2C22A 2R8JA 4RBVA 3KLGA 3FZBA 4DUTA 1VOMA 4ICLB 2DGQA 1XNRJ 2AJ1A 3N6LA 4IFVA 1KLMA 4OMFG 3LF0A 1FWLA 1UJ5A 3M8QA 4PPZA 2UVWA 1NK4A 4FPRA 2GMLA 1R89A 2BDPA 4C0OC 1E6YB 2XMWA 1BLUA 4LR9A 1JLAB 1KFDA 4ZKAA 5GMDA 4B3TJ 2P6SA 1I3OB 1PYOB 3L09A 3VAHA 2GO9A 4X64J 1EETB 3KKFA 3QJPA 3AAWB 2RKIB 4MK9A 3FKBA 2G1DA 1HNXJ 4CLSA 3H2VE 2O66A 1FJGJ 2GQQA 1ZS6A 3EICA 2EG1A 1NK5A 4C8ZA 5DQHA 2VPWB 3AQOA 2QMWA 2IFXA 4UOFA 4QYZJ 3SIPB 4DCJB 4DPWA 1NNDA 3IAS9 2YNGA 4N77A 1B7FA 4DR2J 3VGTA 3C14B 2RF2A 4IG0B 2AHOB 4AXIA 3H7HB 2DR6A 5I3UB 2GAHC 4NLWA 2MZ1A 4C8MA 4IDKA 4G1IA 4A8WA 1NLKL 2HPUA 2WW8A 3NS7B 1IKVB 1RBLA 1XK8A 5GAEU 3BS9A 3RBZA 3M05A 2GJ2A 1OSCA 3OTDA 4G6VB 3MWBA 1NPPA 2I38A 2E9ZA 2CZ4A 2MB0B 3TEHB 1IM6A 4F25A 2PO4A 4HI1A 4PXBA 2M8HA 2FPHX 2XSFA 2IAJA 4DLEA 3U27A 1KDNA 4K7QA 1U8SA 2ZH6A 5AT1B 3SCJE 2WBMA 5EWGA 2ALYB 3CXCR 1NK8A 1BGXT 2UU9F 3HKWA 2YNFA 5FIIA 3HHLB 3NAHA 3CMAS 3LAKA 4U8YA 3MCMA 2N4DA 4DFPA 2KXFA 3OHAA 4NASA 3E3XA 1RTIA 2NSCA 1BD6A 3VVUA 4QIGA 2BRKA 3I4PA 1RLDA 3GQCA 2WK4A 3C6UA 1RWNB 1H72C 1REGX 4DV0F 1HHSA 3OTOJ 1GMUA 4EZ6A 1LV5A 4J9MA 1N5TA 4K4TA 5BYRA 4U67Q 2O01C 4CH0S 3BBFA 3PYDA 1HMVB 3R7BB 5C24B 3D3BJ 4H4MA 2ZDOA 1IJEB 4DR4F 1YVFA 1ZZNA 3HSJA 4TYBA 1TFYA 2CZ9A 1HWKA 1T9XA 2J6SA 3PR5B 5HLFB 3P5TL 1HPZB 2AX1A 3GJTB 2MQNA 2MKIA 2GZOA 2VBXA 3WQPA 3T41A 1FRMA 1U24A 3PACA 1MU2A 1H2UX 3PNIA 3ZZTA 3LQVA 3BPSP 3CT9A 1OPIA 4AQYF 2XYHB 1I94J 2MKSA 2EK6A 7FD1A 2OI2A 2J6UA 3D2WA 3RJMB 5D78A 2OSQA 3GTYX 1OY8A 1JLBA 2HVIA 1IBMF 3JSMA 3M8YA 1DY3A 2ASDA 4EI2A 3Q83A 3SXLA 1SC1B 2XGQA 3CW2C 2ZNZA 4Q8FA 1WEYA 2LP4A 2XMKA 4NLGA 1YGYA 1U2FA 3JQJA 2DXDA 1KQSR 3R6GB 3NCRA 2ZDPA 2ACYA 4IR9A 2RB7A 3EVOA 3OL6A 1R0BG 5DQIA 2O67A 1J5EF 2IHR1 2DIVA 4LF1A 2XZDB 3VWSA 4IRKA 3R6LB 3CNQP 4R8UB 1IKWA 3TI0A 2DCLA 1RBOB 1S1VB 4EZ9A 1RTHB 1Q8BA 2JNJA 1XMOF 3AA9A 2VD3A 1U25A 2XLIA 3M8SA 2EFVA 5KFLA 2HS3A 2V67A 5FJ4A 2RHQB 2F63A 3MECA 4CLUA 1H7WA 4M5MA 2VKRA 3PM9A 4DQSA 4ELTA 1Z2ZA 5IM0B 2OPQA 2RUGA 3DRPA 3WX4A 2BV3A 3QGIA 5J1EA 3HSGA 3DYAB 2R2TA 4ZPTR 3MM9B 1SBRA 3LTOA 3PIPQ 2DR7A 2Y0SD 4IQXA 4EU0A 3DDKA 4ED8A 1QJHA 2I2YA 1U1LA 4YB6A 1XNQF 2GGPA 2ZKTA 2ZH8A 2H48B 3QZ8A 4DL5A 1KOHA 1H2VZ 5SUHA 1EKRA 5LMUF 4HTIA 1T9TA 5HL7Q 3GIKA 5KFTA 4K4WA 1NK0A 2ZC4A 3Q0AA 1U48A 4P10A 5T7LA 3R7NB 5J2PA 4EYHB 3IMQJ 1JJCB 3RAQA 4KT0C 5IT9U 4OJ1A 3QSIA 4NZ6A 5C5JA 4NCGB 5B0EA 8ATCB 2CQ4A 2DXFA 2CQ2A 2FVQA 1UWBA 4KAIA 3HD1A 3W65A 2YNHA 2RIJA 4PXCA 1K44A 3UI3A 4LUBA 1X5SA 2A10A 1TL5A 5E5NA 2HRYA 2BJ1A 1C4AA 3F0NA 2KYXA 3NBPB 3EZOA 4DUZF 3DRRB 2CPYA 3TAPA 1MMNA 4DL4A 1RACB 3BGRB 1MMDA 2KRBA 2KZZA 4IOBA 1U1NA 1SPBP 1UEUA 2OELA 3ZTQA 1JXEA 3EGNA 3GMGA 2OP5A 8AT1B 4WP8A 1JB0C 1NM2A 2KFZA 2ZUAA 4ZHRA 2VG5B 4OI0A 1UVMA 5HBMB 4OJHA 3T1HF 2ILYA 5FD1A 2F8EX 3C3LA 1WSVA 3QZ7A 3QGPA 1URRA 5H1SV 2VFRA 1P6TA 3GFXA 4NI2B 1SKRA 2XMJA 3OLAA 3H2LA 1RAHB 2EBEA 2FLNA 4N8OA 1JLEA 5FDLB 2W9CA 4B9UA 3DFEA 1UJ6A 2W8LA 1ZAXA 1WG5A 1ZZFA 4AUKA 1M0SA 3JTPA 4HHUA 4DPUA 5C2CA 3G82B 2J9DA 4ED3A 2UUAF 2N3LA 4LF5J 4AL5A 1FJEB 3QAEA 4QYZK 1JLQB 1DFDA 1FXRA 1A9NB 2W2QP 1HHTP 3G6YA 4LBHA 1KKHA 1SC4B 2JFKA 1WI8A 1XQIA 1KQKA 2PMHA 4NCBA 1IN0A 1PIEA 4CM2A 4JI2J 3KK1B 4P9SA 1RABB 1FNOA 3EMTA 1H0HB 5MLCV 4A8KA 2HVEA 3KJQB 1VQ6S 1UCNA 1N34F 4LRFA 3Q2TC 3W8GA 2CG4A 3MMCA 4L76A 4QQBA 4KHPF 3IG1A 2JEIA 1N36F 1QUPA 1I5OB 1GTEA 1VQKS 1JWWA 2FZKB 3B78A 3R5DA 2QLWA 3M2VB 4RU9A 4BWMA 3WDOA 4ZA1A 1KC8T 2ROGA 3CJKB 3WBZA 3KK2B 1NEEA 3SYZA 1VRTA 2CFXA 4QIWD 3AOBA 3JSRA 4J9SA 2LA4A 1QTNB 4DR4J 2DYAA 3I0SA 3SFGA 2MMYA 4RU2A 3SCIE 3VAIA 4ICLA 2BACA 2QSWA 5GADU 4CYUB 3RBDA 3D5MA 2HBRB 5GAHU 3LAMA 3LUYA 1UVNA 1REVB 4B9MA 2FJEB 4NMXA 2BJ9A 1S4EA 4XPEA 1LXJA 4DR6F 1E6YA 4AQYJ 2P5VA 5ETRA 4U95A 2MQ8A 5F9LA 3OFGA 2A3JA 1Y5NB 5DJBA 1EETA 1HWLA 1AFJA 1C1CB 4W90B 1RYSA 1IBMJ 2RKIA 1MN7A 1PILA 5KFPA 4MT1A 3UWTA 3IXQA 2NPIA 2LDIA 3FQLA 3I87A 1QLNA 5D4LA 1V3SA 2LYVA 5E3AA 3GJRB 1XTZA 4KH0B 3TYTA 4KGMA 2WSEC 4BHQA 4IOCQ 3JS9A 3CMES 2JRSA 5KOXA 2WTFA 2CNKB 1J5EJ 2B7BB 2OAUA 3C14A 1WF2A 2NCKL 1EARA 4IG0A 1T0TV 3RW6A 2V69A 5I3UA 5CYJA 5HMYA 4DV2F 1WJ9A 3M4XA 1IKVA 1XMOJ 2DRDA 2BANB 3HF5A 3OW2R 1TUGB 3IR6B 5IT4A 1R8BA 4Q45A 4K2JA 4MIBA 3CD5A 3D68A 3SCLE 2RRAA 5LSLA 3Q8SB 1K0TA 1FD8A 1C2PA 2RU3A 3NP5A 5CA5A 2HK3A 2HMIB 5JMNA 1HD0A 2NUHA 2ZBQA 2LMIA 2IYGA 3HHLA 2D9OA 1FVSA 4RBTA 2OLWA 5ETKA 4IQMA 4Y34A 2KVQE 3I4HX 2E66A 2XMVA 2XSJB 5DDOC 3MM7B 3R1LA 1N56A 3TZYA 3Q23A 1R6YA 4X4NA 1XNQJ 1S59A 3MD1A 5HJYA 3TVKA 3I5CA 5LMUJ 2XULA 1FTRA 2VH7A 1X4AA 2VG6B 4C3KA 1FNMA 3EX7B 3MM6B 1HA1A 5HAOA 3NOGA 2GVDB 3FRYA 3QPIA 2AIRB 2B4UA 5GVQA 1HMVA 3IGVA 5C24A 2AT1B 4BDPA 4ED5A 1DQ8A 4Q43A 4ECQA 3H98A 4PQAA 2LQBA 4CO5A 3KJVB 3NGUA 2QYGA 4OYXA 3VQTA 2QYCA 1NCLA 3KTQA 5HLFA 2OKQA 3HK2A 1N5YB 2N3OA 3QLHB 1HPZA 4BS2A 4LF4F 2RT3A 5G0RB 2BE9B 2MZJA 1NUEA 3IWXA 4I4BA 2YWEA 1YTYA 4N56A 2JL9A 2YX7A 5BXIA 4DWIA 1M5VC 1A7GE 2RSQA 4FPIA 4DUZJ 2RJZA 2VZ9A 2HEKA 2XY7A 1KTQA 2VU5A 1X9MA 3J7ZT 2RNEA 4ECZA 1TK8A 2O5DA 1R8HA 4MMOA 3CULA 4O4RA 1K1SA 4A8YA 5E3CA 2L41A 4Q8EA 1ACMB 3BO3A 5A8RB 2WBRA 1X4EA 3EYZA 1S0NA 4ILMA 4B9SA 2CWKA 2HHPA 2ZWPA 1X4FA 4FBUA 3ZZRA 5D0EA 1NDLA 2HQFA 2MQMA 5M2PA 3OJUA 2NYHA 3I96A 2RHSB 2ASLA 1G3OA 2ZE2B 3D6TB 4JI6F 3JTNA 2OEJA 2V4JB 2C2DA 4FN5A 4R8UA 2V4QA 2ZVSA 3ETMA 2V9KA 3MM8B 1ZTWA 2ZKUA 1S1VA 2B4OA 1WWHA 4WXOA 2J0SD 1TUWA 1RTHA 2BA9A 4ED7A 2V0NA 3D3CJ 3R5JB 3W9HA 1E6VB 4KBIA 3OVSA 4OZLA 2V8PA 2C2NA 4CH1A 4Y6IA 4ZITA 2W4PA 4ED4A 5KFRA 1P27B 1XWLA 3N4WA 4C3MA 3M2RB 2MEWA 4RO0A 4DFMA 5IZHA 2N7YA 3AH6A 4IO9Q 1T9VA 5IM0A 2HS4A 4RWXA 3W64A 1KVKA 1Z4UA 3MR7A 1BWEA 4LFCF 2VJVA 1R3NA 5H9FK 2G2YA 4JYAJ 3GIJA 5J2QB 1VR6A 1RT5B 3DYAA 3MM9A 2GJIA 2BUNA 2KYZA 3NS5A 3BB5A 5D3GB 3THTA 2Y0BB 1N4LA 1N5VA 2VDIA 2UVRA 3PFEA 4DF4A 3QJLA 4WJBA 1X4HA 3AT1B 3H5UA 2V8DA 1I1GA 1Q5VA 3B82A 2CPFA 1M5SA 3ILIA 2XY5A 2BVZA 1S1TB 4EO8A 4UOCA 5ETMA 4HDGA 2P6TA 2HHXA 2G4BA 2DTJA 4LRAA 4NCGA 2FLOA 4ETXA 1DRZA 2Z0GA 3QFHA 4LF9F 2C3YA 4JI3F 2VV5A 2AJFE 4QWCA 1PCAA 1UFLA 3KFWX 3KUHA 4JI0F 1RHUB 2Z4PA 1D3WA 1GT8A 1SV5B 4DJBA 4ZIWA 3DLHA 4PUOB 1UEVA 4DI6A 2MKKA 3ZTRA 4TY9A 4J9QA 2DH7A 4WPAA 3NBPA 5HK4A 4DS5A 3MPVA 2J8SA 2OSRA 1PG5B 1XIQA 3D1HA 1NKBA 3DRRA 1HR0F 2CQPA 1J5OB 2EFPA 5LMNJ 2OD4A 3BGRA 3ZXWA 5HI7A 4DR6J 3TOQA 1YDLA 3CCSS 3QBCA 2OJ3A 1UW4A 4LMZA 1N5SA 2E44A 2F1FA 2VBZA 2IPOB 3HXMA 4F4AA 5F3ZA 2I8EA 4X4OA 2YVSA 2BE2B 3DC2A 2VG5A 3EGVA 4L72B 5HBMA 2Y8WA 2HFNA 4OQJA 1GMWD 2K2PA 1OWXA 2E1AA 3W66A 2KG0A 1ZPVA 4NI2A 1T9WA 3S1TA 1D8YA 3R5GA 2AQ4A 2XBPA 1RYRA 4KGKA 4ZP6A 4HLBA 1B70B 5FDLA 1O8BA 1EP4B 4H4OB 4RNFA 2AF6A 1TUVA 3TA2A 2DVIA 1S7HA 4MYUA 2C2KB 5B0BA 3G82A 1Q82T 1O6XA 2XTJP 5E3RA 3EM1A 1F6TA 1S48A 2DHGA 1JLQA 1HHQA 4ATNA 2UXBF 5KFZA 2FTRA 2DEIA 4QW9A 1NSQA 1TTHB 2E5GA 4QW8A 3FBCA 4DN9A 3KK1A 2VPZB 3Q24A 3K5MA 3PO4A 2W4DA 1HBOB 3NGDA 2FC8A 1FDNA 1NO8A 2FVCA 1WACA 3HHKA 2UUTA 3TW0A 3DOLB 4P74A 4CI0B 2OGUA 2B9YA 2J6TA 2KXNB 1BE4A 4K4SA 1S9EB 1CG2A 1S49A 3HVTB 4OYBA 2L9DA 4CZCA 1UVLA 2CNLB 2RS8A 3M2VA 4K50A 1DTQB 2KB2A 5L1KA 5CYMB 3TP2A 3CJKA 3LP1B 1XMQJ 3KK2A 2HVDA 4QIEA 2ZHOA 4TXSA 3L4BC 4O23A 2G1HA 4LBPA 3HCXA 1B0PA 3BPDA 2LU2A 4DSFA 2AYMA 3HHLC 1YBTA 4DR3F 4NLUA 3JSYA 3IC1A 1VBYA 4QIVA 2QC3A 3VTIA 2GJFA 2P9GA 4LF4J 5IOLA 1UMJA 1U6ZA 4XDDA 3MI7X 1WI6A 3G8SA 1FFWB 3LP2B 4F4XA 3K8VA 4ZCLA 2ZH7A 2B7CB 1REVA 3LP0B 4CLZA 1MW7A 5HO4A 1AXQA 2CVIA 3Q2SC 3NWGA 2G0JA 4HR2A 5AE3A 2QMXA 2YH1A 2NR0A 1C1CA 4PG8A 2VQFF 4J9RA 4L75A 1TKXB 4YB1P 3PRDA 3FQKA 3NXZA 1S1UB 2YKNB 1QD1A 1CSJA 4MYTA 3H59A 1WF0A 4U6PA 1RT4B 3PIOQ 5E7OB 7AT1B 3J7YI 4RNHA 2CADA 2E7WA 3KDNA 5F8NA 3MR2A 5BR8F 2CQBA 1N33F 2YQ3A 5D6GA 2IM2A 4YR3A 4IYQA 4KO0B 1IBCB 4ANEA 5EWFA 3NGKA 3ENVA 2QIFA 5F8MA 4X4UA 3P96A 2EWHA 2AJQA 2ZHBA 3NRBA 2ZH9A 5HMZA 2BANA 2IMOA 4J9VA 1IM4A 2GQ2A 3MCSA 1TZ0A 3CCMS 3UN3A 2LVWA 3SMZA 3D9BA 1SIZA 4QJVA 3TJ8A 4M5HA 3M6XA 2PMWA 2YWHA 2FD2A 3AA8A 2BJ3A 4LFCJ 1M90T 4OI2A 1R8AA 4F4WA 2HMIA 4YUDA 5IS2A 1FHTA 4NYOA 1X9SA 3MMBB 2VA2A 5T14A 2C42A 2XSJA 2MSSA 3MM7A 4B08A 5KT7A 3Q22A 1FDBA 2J0XA 3BDPA 3FGVA 1YIJS 1X4BA 4OI3A 3W5ZA 2NSBA 1NK7A 4JB8B 4C98A 2VG6A 3IWNC 2YTCA 2Z2YB 2PI5A 4X65F 3GFHA 3MM6A 1XMBA 2APOA 4JUZA 2DGXA 1RU1A 2XY6A 1S79A 4GRSA 2GVDA 1IVZA 3UD3P 2JC0A 3W5XA 2RILA 4BC7A 3FMBA 1EZZB 3A12A 1VBZA 3UDCA 3GB0A 3VAGA 4YY3F 2OMLA 4B9NA 3KJVA 4L3KA 2GMHA 2QN6B 2YY3A 4ZP9A 4J9PA 4NE9C 4YR2A 1B99A 5A76A 1N5YA 3QLHA 4O3RA 2KTQA 5G0RA 3PJ9A 3K17A 2QV6A 4W92B 1ZTTA 3JQKA 4ITSA 3BO2A 2F9DA 3WIUA 1X4DA 1JKHB 1X60A 1WEXA 3ADAC 2XS5A 4USTA 4WTYA 1IBLF 2D1CA 5DLFA 2EFNA 4USMA 2BJDA 5GAGU 3J81U 2DGUA 4F50A 2PEHA 4LFAF 2GS8A 4KV8B 3BM7A 4F26A 3ONQA 2BW7A 3D28A 3A4TA 5A8RA 4MK8A 5D8HB 4TU7A 2I5JB 3RB0A 2F8HA 4ZLNA 2HWHA 2FVSA 3T1AA 1GH8A 5KFDA 4X84A 4IRCA 1TAQA 4NLSA 3CCJS 4ANCA 4TQSA 4PWUA 4XPCA 4WIIA 5U47A 4QPTA 1RI7A 1UAWA 2G0IA 4PEOA 1CLFA 4U8VA 5K5MA 1F5AA 2ZE2A 2AZ1A 2Y3YA 1D09B 2V4JA 4WE1B 1HBMB 5F8JA 4NLOA 4P2SA 2FY8A 2E7VA 3MM8A 1ULRA 3LGHA 4NMLA 4YB7A 3TZWA 1HIYA 4Y2AA 1Q8KA 1VIOA 2CKWA 4K4UA 4MJKA 1E6VA 3PXGa 3P5BP 2J76E 3KG4A 4DXLA 4CLFA 5KTQA 1U09A 2WVFA 4HVZA 3LWLA 2PE8A 1HD1A 3TRGA 2BMBA 3M2RA 4WKRA 3K7RA 3IFEA 2HSEB 5BJRA 1KTVA 3R5AA 4DQPA 1R8PA 3QYYA 1FE4A 3HT3A 2UXBJ 2R7WA 2LEPA 2VFSA 2CA9A 3VCDA 4U7UK 4LF7F 1UFKA 2EVZA 5J2QA 1RT5A 1PJ5A 4KB7A 5D3GA 1JMTA 3D0IE 4NX9A 5DDPC 2E5LF 3TWZA 3FCVA 5ADZA 3KHHA 2IJNA 1BQXA 3CJ5A 2V8GA 2AU0A 3BH6B 3BF4A 4DUYJ 2MGZB 2M70A 2V2ZA 2YPYA 3A8KA 5DM7Q 1T3OA 4WK1A 2R7TA 4JI5F 4J7CA 3FFIB 4WXWA 1S1TA 1W25A 2XG8A 3R9LA 4A8OA 3GIMA 5D0HA 1CC8A 4NXMF 4M5DB 2FHMA 4RNMA 4CH7A 4LT6A 5H9EJ 4OLPA 1JLFB 4PWDB 1QSYA 4U96A 1DZ5A 1LWCB 3ILOA 4CQ1A 2B9WA 1RT3B 4PPDA 3MEDB 1VQ4S 5HP1B 4FZVA 3OTEA 3CO9A 4UZCA 2W9AA 4DR3J 1TVRB 5ETNA 3AOCA 2M9KA 4IKAA 1VQOS 1SV5A 1P9YA 1SJ3P 1CJTB 2D74B 3QFWA 1O0PA 4K2XA 4PUOA 1FRLA 4ZOSA 1NZ8A 3ZNJ1 4FNHA 4WYLA 3P8BB 3GV8B 3QT5A 1GXTA 3T6JA 1J5OA 1YRUA 2ACMA 2X3DA 4X4QA 3GCXP 3X3UA 5DGBA 1Q1KA 3SSRA 2LLZA 1GX6A 1VMBA 1S4FA 4WFNQ 4PR6A 2VQFJ 2H54B 4K5RA 5K8MA 2BE2A 1BC6A 4TY8B 2UXCJ 4DDFA 5F8LA 1TK5A 4FF2A 1Q7LB 2WB1D 1Y4ZB 1EJ7L 4IH7A 1HI1A 3BBBA 2DNPA 2ZITA 4DQQA 4OI6A 2BXJA 1EP4A 4H4OA 1T05B 4DSIA 4ALZA 4J5OA 5ETPA 4A46A 2DR9A 3X1LB 3EXCX 2DKOB 3MTJA 5D0RA 1N6QB 1WC6A 4F2RA 2R2UA 2NS1B 3THVA 2VF3A 1U7LA 2DO4A 3V6KA 3D66A 5I3QA 1AROP 4U7CA 1QAXA 2GIRA 2KT3A 3K5NA 3DLJA 3OSPA 3CC7S 2HAIA 4KY3A 2GA7A 3RW7A 3K57A 4WFZA 1ZM2A 4AFFA 1WEZA 4MIAA 4DOZA 4UW2A 3DOLA 2IY5B 1S6OA 3TZZA 1KSPA 2GIFA 4O4GB 1XNRF 4UTGA 4C8OA 1S9EA 2KRRA 3HVTA 3UVJB 4MKYA 1WTFA 3ZTSA 5A2QY 3MUVP 2UVVA 1DARA 2CJXB 5KG3A 2ZBPA 1DTQA 3PRVA 5CYMA 1F5CA 2CUYA 2E5IA 1YBUA 1U0HB 5LOQA 3LP1A 2XZTB 5CAAA 1TP7A 3DU5A 4CLYA 2H3EB 4OJ3A 2DNNA 3C15B 4O3QA 4Y00A 5F0WA 4YY3J 2R4FA 4JV5J 4OHWA 1FJGF 2XI2A 2XM3A 3M2UB 4W4MA 5EHHA 3NCQA 3W60A 1YJWS 2V8VA 1R31A 1KHWA 3LW5C 2R8KA 1TELA 4OLOA 1YK9A 4DR2F 3I9V9 3LP2A 1PC5A 3BBCA 4A8FA 4J9KA 3LP0A 4K4XA 2ZHAA 5DM6Q 4MKVA 3EVWA 2D41A 1IBLJ 5I3PA 1Y9OA 1S99A 5EGYA 2VB6A 4WTOB 5L9NA 3N28A 3TVYA 3CJ0A 3M6VA 2HHUA 2IA0A 2K7KA 4ZPVR 4WWSA 3MEKA 1GEHA 5ETTA 4ED2A 4ED1A 4R0JA 4YB5A 2ADBA 1TKXA 4QOTA 3U02A 3KLVA 1RAEB 1WF1A 1UWAA 1S1UA 2YKNA 1F3VA 2DJWA 4M5LA 2MZQA 1RT4A 1T3NA 2HBQB 1JIHA 1TKZB 2YQ0A 1G1XA 3FJ2A 1Q4RA 2JC1A 4R5PB 2B4PA 3IWLA 3FCHA 3AY0A 4LRCA 3SQGB 2JDJA 4KO0A 3CIZA 4TNOA 3TZXA 2XHCA 5EWEA 1R43A 3C2PA 1Q7YT 3HZGA 1NPKA 4QBUA 4E0DA 3MXHP 3OTBA 2MY8A 4GKKJ 4F0MA 4LRBA 1CEZA 2DD8S 4EMDA 5F8HA 1RTJB 1BXNA 2GAGC 3KK3B 2BABA 4M5NA 3G96A 2KM8C 1PKUA 1RXOB 2J5AA 2M7SA 3FNNA 2H4WB 1KVJA 3L9ZA 5HVHA 1QUVA 1MLAA 3OTOF 2QFJA 2XO7A 3MCNA 3SV4A 2KHCA 4ZPWR 2Y1LB 1GXUA 2R8GA 2CWXA 3PR4A 3L7OA 1VBXA 4CRJA 3MMBA 5KFCA 5E33A 4ZJOA 3PVXA 4ZCKA 3D0HE 2I6WA 2CRLA 4DU8A 2E5LJ 4ZPDA 2CPXA 3K0JA 2K1RB 5L1LA 5B7WA 2HIQA 3NGTA 2ZM6J 3UFCX 3BGOP 4I6WA 5HJXA 3D54A 3CJ8A 4JI5J 2HFUA 2IIHA 2DNQA 3LPYA 4WKYA 1JJ2R 2FHJA 1MN9A 5E0OA 3G4SS 4NXMJ 4J91A 4I6AA 3UR3C 2HK2A 4DZ6A 2R7SA 3KLHA 1K1QA 2PT0A 3QJJA 5CCMA 4JBCA 2YWGA 4JV1A 2J7UA 5CZVA 3V4MA 4U7UD 3OVBA 3T9NA 2XC9A 3BJYA 1N52B 1S57A 3V6DB 5A8KB 3CB4A 3ZZPA 3PEJA 4H4KC 1PAEX 1S12A 4AL7A 1JKHA 1AYEA 2BKNA 4NLPA 3H0PA 3W63A 2HQGA 3GYGA 4L74A 2YNIB 2ERRA 5H9EK 2CJYB 4FS1A 3V81B 2L08A 2BE7D 3U1MA 4C8YA 4DLGA 2VG7B 1RCOB 2V2KA 1UVJA 3BH7B 4KV8A 3B4DA 4ZCIA 2UXDJ 4DSJA 3Q89A 2I5JA 3LA0A 3MEGB 4ZVFA 3J7A1 5EDWA 2DR8A 2ZVIA 2M2BA 4C2MA 3DLBA 3CEDA 3RZAA 2NUUG 4D3GA 3I0RB 4QWEA 1HBNB 1W26A 3MFHA 1V3ZA 5HVGA 1DJ0A 2R3VA 4NZ0A 5KFHA 2VASA 2F65A 1KOOA 2HW3A 4NRUA 2BKPA 4WE1A 1HBMA 2X1BA 2QT7A 3D1OA 2ZC3A 4NEYA 1R0CB 4MAKA 2WVCA 3TQEA 1H7XA 1UZDA 1NPRA 4O3NA 3JAMY 4LF2A 2LXFA 5FLXY 4AL6A 3I5BA 4XDCA 3TR5A 1PGZA 1URNA 2HHWA 5AJ3J 1YI2S 3PTWA 3GWCA 1HARA 4C0HA 2DXEA 4KPCA 5KFEA 4DL2A 2W4CA 2HFSA 2PD1A 4PZVA 1UJ4A 4B9LA 3VR1A 2KL8A 2QL7B 3D7SB 1Y5IB 1U1RA 1U2RA 1HQ2A 1NH8A 1SB6A 4LF6F 5K9FA 4OL8A 2EC2A 3ET6B 2Z2MA 5KG4A 2G13A 4CO3A 3Q8VA 2XLKA 1HLWA 2JZ5A 1RK8A 3H2UB 3SFUA 1T9UA 3Q8PB 3CGIA 2EKNA 1U1OA 2MGZA 1ZBTA 2IM3A 2VIHA 1CJVB 4ZVTB 2HVZA 3DLLQ 3FFIA 4WFYA 1S9GB 2WVDA 4F36A 4FS2A 3UN2A 2DHXA 1HKAA 2I9SA 2OEKA 1WKLA 3NY0A 4ECWA 1H38A 2KVIA 4Z2XA 2AEJA 4M5DA 1ZYQA 1FEEA 2GNKA 5F3TA 1JLFA 1ZH5A 4PWDA 2CPHA 2K8GA 4OX8A 3BSCA 2CDRB 1LWCA 2RDJA 1NK6A 1RT3A 1AT1B 2WW4A 3R2DJ 3MEDA 1RE1B 4KKOB 2MZRA 5HP1A 2CNOB 2HVHA 3UCUP 3JXOA 1XR6A 1TVRA 3OXLA 4I7FB 2W7AA 4Y2KA 1CJTA 1RT2B 3ZZ0A 4CDIA 4HH0A 1PO6A 1FE0A 4ZPBA 1LQ9A 1TAUA 5HN0A 1OYEA 1KRPA 1LFPA 2JFDA 5D4OA 2RE1A 2RQ4A 4B17A 3DU6A 3NNHA 2IBKA 1VC5A 3HVWA 4RLEA 1S6UA 4LR7A 3IS9B 3DM2B 5DETA 4X4VA 1RB0A 3SCKE 3AOAA 1PBUA 4LF5F 4LREA 3DGPB 4TY8A 1VQMS 2XNQA 3MPUB 1TU0B 4C8KA 4JI2F 2Y1IA 2NREA 4OV6A 1NXIA 2XMAA 4UOHA 1J27A 4YDDB 3GZ7A 2FQQB 2U2FA 4MKAA 4DX7A 4RW4B 3HHEA 1WOSA 3C6TB 2B43A 3DI6B 1T05A 2W7PA 1SJ4P 4USIA 4QWDA 5ETQA 4GC6A 2I0XA 3TO8A 2V2VA 3G6ES 4WK3A 1LOUA 3FVYA 4NOHA 5DG7A 1ZA1B 1R0AB 5F0UA 5CD4A 1N6QA 2DNYA 2X3GA 3J7AN 1Q16B 2HFZA 4CCHA 5E2QA 5K14B 2LECA 1MG7A 1VDHA 2XS7A 3MEEB 2CJQA 3DNCA 5F8IA 3W9JA 2J9CA 2MQQA 4F02A 3GFZA 4ZVGA 3H20A 4IFYB 2PEBA 1NRKA 3CCQS 3RRGA 1OIAA 2MLZA 2ZFHA 4O4GA 3EZUA 9RUBA 3IGNA 1FFSB 3UVJA 2Z8QA 1VQ9S 2AJ2A 1UTAA 4CNYA 2FUG9 2H5IB 4P6QA 5KFXA 4USKA 1WKKA 1NDCA 2PA3A 1HI0P 3WX8A 2W2NP 2PI4A 3RAMA 3KLEB 2B0GA 4OYIA 5KFWA 1U0HA 4FYYB 2MKYA 1NAQA 1KWMA 3K2YA 4PG5A 2KN4A 3O2IA 1C1BB 2VFUA 5KFYA 3CD7A 4KQZA 5DG9A 3FCWA 1Y0HA 3C15A 3GYNA 1Q81T 2QSFA 3W2VB 5L39A 2CQIA 3C19A 3M2UA 3KUGA 2KI2A 3EPGA 1ZM4A 2DBBA 3H4BA 2V94A 1VIXA 1QVGR 1TQLA 4NL5A 5LT5A 1WDTA 5DZ7A 2HNZB 1RTDB 3UW1A 5KFOA 3AJDA 2V63A 1YSJA 2J0WA 4PG4A 3CWJA 4JI4J 1X4CA 5DG8A 3RBXA 3HPOA 2EEYA 3M9MB 5B09A 2FVRA 1YRXA 2KXHA 4UT4A 1Q95G 3OVAA 5IC4B 1U26A 4ZVSB 1NH7A 1RZMA 2BRLA 3KNGA 4ID8A 3POTB 1JJHA 3MPDA 1NJXA 3N01A 1FA0A 4CT8A 3DDNA 4IO1A 4FKYA 1H98A 1QVFR 3PRBA 3BSAA 4QWBA 2D3OR 1SIWB 4RNNA 1SCJB 2VC1A 1TKZA 3OT9A 2LQ9A 4LSNB 3G2XA 4R5PA 4MFBB 2W9BB 3IRXB 5KG7A 2ROPA 1FK9B 1F60B 2V6AA 4KH1B 3UR0A 2BYCA 3P3DA 3SQGA 2FB0A 2J7KA 2QLFB 3H8YA 3JQMA 3NG8A 5L8RC 4Y65A 4F2SA 2OPRB 1VISA 2KU7A 5KFBA 3ZNUA 1KP6A 2CPDA 2OUGA 1RTJA 2DRAA 3KK3A 3S01A 2CQ3A 1V3RA 3PYGA 1RT1B 3EXYA 3IM8A 4P73A 4CTAB 1SUQB 2HGNA 3MCOA 1RJJA 1B3TA 2IJRA 5KFUA 1S0VA 4AXJA 5KT3A 3T3FA 2PN6A 5CHCB 2W2OP 2HNDB 1CBKA 4NZ7A 5IFMA 3PV8A 2JWNA 2ZBIA 2FJVA 1YJRA 3CCES 3SEOA 2Q1LA 4K4VA 1AUSL 2VPYB 4PG6A 4LF6J 3W5YA 2CPZA 4RUHA 4B3RF 1QAYA 3HHDA 3GPAA 1MROB 4O3OA 3D6MB 1RSCA 2K1RA 3EDRB 4FYVB 3US5A 1RWOB 2QX0A 2C28A 2R7RA 4EWTA 4NLYA 2HNYB 3M9OB 4B9VA 2ALZA 1Q0NA 2W25A 3MOZA 1GNKA 2FJBB 3HD2A 5T41A 3KNAA 4Y2IA 4DR7F 1SH2A 4OI1A 3ZTOA 4CIOA 3IRWP 3MR5A 3BV8A 2HYIB 1PAUB 3GYXB 2NXUA 3QMQA 4N76A 3U1NA 4KPYA 2MZSA 2DHHA 1U4BA 4KGVB 5EX0A 5A8KA 3V6DA 3LO3A 1SI9A 4HKQA 4HH1A 1S97A 1FEHA 1N88A 1AA1B 4TN2A 4DV4F 2GW8A 2YNIA 1VCTA 2OHDA 4ES3A 3V81A 3ZFVA 1M5OC 2IM1A 3CJQA 2VG7A 1WNEA 3OD2A 3G71S 2EKYA 4N5SA 2HHVA 2M88A 5KFKA 5MAOA 1KVIA 5AE2A 3MEGA 1RA6A 3GIRA 2RVJA 2UVUA 4PQUB 1M5KC 1WC1A 4QR0A 1VQLS 4USJC 5HQ8A 2OH2A 1P1TA 4EYIB 2NYIA 3I0RA 3TEGA 4YMEA 4X2BA 3B6BA 4E98A 3A1YG 4JYAF 1HBNA 1U1MA 3MGJA 1WG4A 4C9DA 1F9FA 4A8MP 3QRRA 2ASYA 3RRKA 3TAMB 2ATCB 4Y2MA 1RWKB 4DN0A 4DSLA 2F4VJ 4DEZA 2BBEA 3HSZA 3DLKB 4RW9B 4A8SA 2AWZA 5HMWA 1C0UB 3AQPA 2BW2A 2H5EA 1V9OA 2Z2ZA 2YKQA 4OYOA 1AFIA 1NSKL 1F2HA 4PCQA 4TYAA 4J9UE 1TL7B 2UZAA 4LRDA 1EHWA 2F4FA 6FDRA 4FYXB 1VQYA 3A3OB 2ZEJA 8RUCA 2RRBA 4E8UA 3JB9k 1I51B 2PMZD 1LXNA 3DXSX 1DQAA 3MOJB 2AX0A 5JXSA 4A47A 2LEBA 5KG0A 5I42B 1ROFA 3HSDA 2XS2A 4RKUC 3ENWA 4ELUA 2AMCB 1RAFB 1ZPWX 3UE2A 1FJCA 1OYDA 3ET6A 3NLCA 3QSYB 2FGCA 3RU0A 4WBFA 2QE5A 3CUNA 2CQ1A 3BGLA 3R97A 1TKDA 2H9ZA 3ZTPA 1TFWA 1HNIB 4J9OA 1HL6A 3BR9A 4A8XA 4ES1A 3GV5B 4NLRA 1TK0A 1VBKA 5LMNF 4IOAQ 5J2MB 1CJVA 1S9GA 1JLAA 2COLA 3HHLD 3VGSA 1VQNS 1D9AA 1M1KT 1Y11A 1UKUA 3WZ0A 1T94A 3WHIA 2C2RA 5IWAF 1WUUA 2V5HG 1RKJA 3PX6A 4OX9F 2E5JA 1AB8A 1ZA2B 1FWKA 3SSQA 3PW0A 4DX6A 3R2CJ 4ER8A 3WC2A 3OFFA 2EW9A 4KKOA 3NNCA 1UFWA 3B4MA 5BYQA 4UUWA 4CLWA 4FF1A 4M5GA 2JEJA 3ZZUA 2D3O1 4ZDNA 1X5PA 4OX6A 4I7FA
chains in the Genus database with same CATH topology
1JLBA 2HVIA 1VFJA 3VZHA 3JSMA 1IBMF 1RT2A 1FERA 4C4WA 1JLCA 3ZC4A 3VCDA 3PZPA 2ASDA 3GV7B 4U7UK 4G1PA 4LF7F 4C11B 2EVZA 3SXLA 4PG7A 1U45A 5J2QA 2XGQA 1RT5A 4F4ZA 2ZNZA 5DDQC 4Q8FA 1WEYA 3NMAA 2OD6A 4KB7A 2XMKA 4NLGA 5D3GA 1YGYA 1U2FA 1JMTA 3D0IE 2M3DA 5CD4H 4NX9A 5DDPC 2E5LF 5ADZA 1KQSR 3KHHA 3NCRA 2IJNA 2WONB 4ELVA 2AV5A 2ZDPA 1BQXA 3CJ5A 3S6EA 4Z37A 2ACYA 4X66F 2V8GA 2AU0A 1RWUA 4IR9A 1TL3B 2RB7A 1FRJA 1N54B 1RQ0A 3BF4A 3J7YU 3OL6A 1SL0A 1FRKA 4M63A 2DPJA 5DQIA 3M32A 3D0GE 4Q2MA 1VQPS 2O67A 3IS9A 1J5EF 2MGZB 2IHR1 2DIVA 3DM2A 2M70A 2QLXA 2D7SA 5DM7Q 1T3OA 4WK1A 1QSSA 2LU1A 4NLDA 3VF0B 3VWSA 2R7TA 2YKMB 4IRKA 4JI5F 1YJNS 4MTPA 2VODA 3DOKB 4R8UB 3FFIB 4WXWA 1IKWA 1S6QB 4ECYA 5AXNA 1S1TA 3TI0A 2DCLA 2MXYA 1S1VB 3RB4A 1W25A 3WC0A 2XG8A 2KG1A 4EZ9A 4DV1F 4A8OA 3QAUA 5A0YB 3GIMA 3DGPA 4M95A 1RTHB 4FF3A 1S76D 1CC8A 1Q8BA 2D3UA 4N8NA 2YKPA 4Q2LA 1XMOF 3AA9A 3MMAA 3QWUA 4M5DB 4NXMF 2VOOA 2FHMA 2HHQA 4JV0A 4RNMA 2VD3A 1WTBA 2X1FA 4CH7A 1U25A 4LT6A 5H9EJ 4EBEA 4OLPA 2XLIA 1JLFB 4PWDB 1QSYA 3M8SA 3MTKA 2EFVA 1DZ5A 3OPKA 1LWCB 1XC9A 4CQ1A 3NNAA 2B9WA 5KFLA 1RT3B 4PPDA 1U1QA 2XWYA 2E7XA 2HS3A 3N79A 5C25B 3MEDB 1VQ4S 5FJ4A 4K0KF 2B6AB 2DT9A 1FESA 5HP1B 4FZVA 3MECA 1LK7A 3OTEA 1QM9A 1H7WA 4F4KA 3CO9A 5KFVA 2VKRA 3OL7A 2W9AA 4IH6A 1L3KA 3TANA 4JI4F 1Z2LA 3PM9A 4DQSA 1TVRB 4ELTA 1Z2ZA 5IM0B 5J2NA 2M9KA 4IKAA 1VQOS 4RW4A 1SV5A 2OPQA 3OHBA 1SJ3P 4FF4A 2D74B 3OL9A 2RUGA 3C6TA 1O0PA 3CVKA 3DI6A 3LALA 4O3PA 5GADI 4K2XA 4PUOA 1FRLA 3OJSA 3DRPA 2EFOA 2BOPA 2ZH4A 3WX4A 4ZOSA 4ZVEA 2QRRA 5GAHI 2BV3A 2XEXA 3CCRS 1T02A 2MKHA 3QGIA 5J1EA 3DYAB 2R2TA 4ZPTR 3MM9B 4FNHA 1SBRA 4LSLB 4USHA 3S7RA 3SV3A 4WYLA 1GQEA 3T6BA 3TUIC 3PIPQ 2O1PA 1V6HA 2HWIA 3GV8B 1VK3A 1YG0A 2DR7A 4NA2A 2Y0SD 4ETZA 1HI8A 4IQXA 4EU0A 2XHWA 3DDKA 1LWEA 5AE1A 1R0AA 1GXTA 4UY8T 4ED8A 1QJHA 3T6JA 1J5OA 2I2YA 1YRUA 4QR2A 4ZPCA 1U1LA 4X4QA 4YB6A 3M6WA 3X3UA 2G0CA 2GGPA 2HGMA 1XNQF 2ZKTA 3CJ3A 2CZVC 4KE5A 5DGBA 2ZH8A 3QZ8A 1Q1KA 4ZP8A 4DL5A 3SSRA 1X7VA 2BM0A 3CDUA 1KOHA 2UV8A 3M9NB 1H2VZ 1XMQF 2LLZA 5K14A 5SUHA 1GX6A 2C3MA 1VMBA 1S4FA 3O3LA 4HTIA 4WFNQ 5LMUF 1AUDA 2OTLS 3MEEA 5HL7Q 3GIKA 5KFTA 4K4WA 1JX4A 1NK0A 2ZC4A 4WU3A 4PR6A 1BQNA 3FEXB 3Q0AA 1U48A 4V19X 3U7JA 5BYSA 3DLEA 1C4CA 3LH2S 3R1HA 4GMKA 5T7LA 1U6BA 4K5RA 1FTCA 5J2PA 4EYHB 5K8MA 4RW8A 2HRUA 4ID5B 2ZOMA 5LL6d 2BE2A 3LANA 4KT0C 3RAQA 2W24A 4HT7A 1BC6A 4WU2A 4TY8B 3FZ2A 2P9EA 4OJ1A 2HQ3A 4DDFA 4NZ6A 4IFYA 5C5JA 4NCGB 1VK8A 4HDHA 5F8LA 2K3IA 3DRXA 1TK5A 2GFFA 4FF2A 2DH8A 5B0EA 5CZXA 2PIIA 4X62F 4ZVHA 2CYYA 5G4DA 2ZH2A 2CQ4A 3H5YA 2XNRA 3KLIB 2ZJRQ 1M5HA 1DTTB 1Q7LB 2CQ2A 2WB1D 2FVQA 1Y4ZB 2OPSB 1UWBA 4KAIA 2IVMA 1VRUB 1FRXA 2JVRA 4MKBA 2E5HA 4IH7A 1RT6A 5K8NA 1HI1A 2YNHA 2RIJA 2MQOA 4PXCA 2LCWA 2DNPA 3UI3A 2ZITA 1Y5LB 4DQQA 4OI6A 2JOQA 4LUBA 1X5SA 3FSIA 2W7OA 3PX0A 2BXJA 1EP4A 1HBUB 3KHLA 2NZ4A 2A10A 3O8WA 3EZ5A 4H4OA 2LQ5A 1T05B 4DSIA 2MY7A 2DH9A 2X1GA 4ALZA 1LWFB 1TL5A 1S10A 4J5OA 1PC4A 5E5NA 3KLEA 4OZ5A 1Y3JA 1R7IA 3IBWA 1MWYA 1KONA 2HRYA 2WOMB 1C4AA 3FDSA 4QZVB 3Q8QB 1KN6A 3DRSB 1SKWA 2KYXA 4GO5X 2BZ2A 3GG0A 4A46A 2GCFA 4A8QA 3NBPB 4DS4A 2DR9A 3X1LB 3EXCX 1T95A 1C1BA 1XERA 3G8QA 4FP9A 4DUZF 3DRRB 2CPYA 3MTJA 2VBYA 3TAPA 1MMNA 4DL4A 4YHHF 1N6QB 1SXLA 3BGRB 1ZM9A 1MMDA 4F2RA 1C0TB 1DURA 4C0BA 2R2UA 2NS1B 2KRBA 3THVA 1N0VC 1HNVB 1CPZA 1FJ7A 2KZZA 1U7LA 2DO4A 4IOBA 1U1NA 3TVZA 3V6KA 5L38A 1UEUA 3W2VA 5I3QA 1LW0B 1KNZA 1AROP 4U7CA 1QAXA 5AXMA 2GIRA 4Y3CA 2YX1A 5B0DA 2KT3A 4I2QA 3K5NA 3DLJA 4NCAA 1JXEA 2DITA 3EGNA 3GMGA 2AP6A 2OP5A 3OSPA 3CC7S 2HAIA 2GA7A 1G6BA 4F3MA 1JB0C 3RW7A 3K57A 5KFQA 4WFZA 2HNZA 1RTDA 3M8PA 2W8KA 1UA0A 4OHZA 2WSCC 3BDEA 2KFZA 3RR7A 3ZZYA 1ZM2A 4ZHRA 4AFFA 2VG5B 2NPFA 4I2PB 2ATLA 2DGOA 5CYQB 4OI0A 1UVMA 4CNZA 5HBMB 4OJHA 3HP6A 3T1HF 1WEZA 2ILYA 4MIAA 4DOZA 4UW2A 1H6KX 1U1KA 3DOLA 5FD1A 2WHOA 2F8EX 3M1VA 4OZNA 3C3LA 3QZ7A 3QGPA 4J37A 2RS2A 1NB7A 1S6OA 1KSPA 1URRA 3VALA 1N32F 2B51A 5H1SV 2YH0A 2VFRA 3LGMA 4O4GB 1P6TA 1XNRF 2QZ8A 3GFXA 1SH0A 4C8OA 1SKRA 1S9EA 4AYBD 2KRRA 3HVTA 2XMJA 4PXEA 3T9ZA 3V2UC 3HI9A 1WTFA 4MKYA 1RKIA 3OLAA 3DRYA 3KMQA 5A2QY 3H2LA 3MUVP 4R0EA 2EBEA 4WCEQ 2UVVA 2FLNA 1DARA 2HHSA 3ZZOA 4N8OA 1JLEA 4CT9A 5FDLB 1UA1A 3OR1A 5E3QA 3POTA 4O3SA 2W9CA 4B9UA 2VBWA 3DFEA 2ABYA 1MMLA 5KG3A 1UJ6A 1DTQA 2W8LA 4C8LA 1HYSB 4M1KA 5CYMA 4ZP7A 1F5CA 1ZAXA 5KT6A 4DSKA 3DXBA 4NA3A 1WHVA 3K5PA 2J7WA 3E01B 2E5IA 5CH7B 1FVQA 1WG5A 3ETOA 3TA1A 1ZZFA 3LP1A 4AUKA 1M0SA 3JTPA 1KLNA 3ICLA 1TP7A 3DU5A 3DMJA 5L1IA 2X51A 2JHEA 4I0WA 4DFJA 3TARA 1Q8LA 1MNEA 2M4MA 2OFHX 2CQ0A 2JX2A 2I1RA 2LQJA 4LSNA 2J9DA 2G9OA 3CJ4A 2QA4G 1FKOA 1NHUA 4ED3A 2UUAF 4OJ3A 2DNNA 2L3MA 4MFBA 2KHDA 2LKZA 3IRXA 4O3QA 2W9BA 2FJXA 4Y00A 5F0WA 2N3LA 3W2WB 4AL5A 1FJEB 1FK9A 1VC6A 3GR0A 2R4FA 3QAEA 5KFSA 4OHWA 1FJGF 3S8SA 1JLQB 2XI2A 3T5LA 1DFDA 4PXDA 1FXRA 1OS5A 1Q8IA 3PW2A 3T19A 1A9NB 4YDXA 3G6YA 3TQ1A 1HHTP 4LF8F 2JFKA 1KQKA 1WI8A 2PMHA 5EX3A 4DF8A 3M2UB 4NCBA 1IN0A 5EHHA 1FCAA 3LGNA 4WFBQ 4QU6A 3NCQA 2ASJA 5KT2A 3BQ2A 2F9JA 1FO1A 1YJWS 5IQQA 3L95X 2V8VA 4LIWA 3MUTP 1B0VA 3THPA 1R31A 3KK1B 2DISA 1FNOA 2OPRA 1S6PB 4TQRA 1KHWA 2NLWA 3LW5C 2R8KA 5KFJA 1ZAVA 1H0HB 4QYRA 3KLHB 3MDFA 4OLOA 5MLCV 4A8KA 1D0EA 4DR2F 3I9V9 1DLOB 2C2EA 3LP2A 3KLFB 1VQ6S 1PC5A 1N34F 4A8FA 1TL1B 4WFXA 3Q2TC 1YWXA 5AXKA 2CG4A 3MMCA 4J9KA 2E1MC 2FIUA 3VQSA 3LP0A 4QQBA 2QA4S 4K4XA 3VAFA 2ZHAA 5DM6Q 4KHPF 2IBOA 4MK7A 1RT1A 2D41A 2R2SA 5I3PA 1Y9OA 4YFUA 3IG1A 4CO0A 4CTAA 4ECRA 1S99A 2GQCA 5EGYA 2JEIA 1SUQA 2JH3A 2VB6A 1X5TA 3M8RA 1N36F 2J0QD 1HNWF 1QUPA 5L9NA 3PO5A 3N28A 3TVYA 3CJ0A 3OBIA 3M6VA 1UETA 2HHUA 1GTEA 1VQKS 4M94A 1GX5A 2IA0A 2DGTA 2D3ZA 2K7KA 4ZPVR 1I6JA 1JWWA 1OQ6A 1VQSA 3MEKA 3B78A 1X4GA 2ZJQQ 4ED2A 3JYTB 2GIQA 3R5DA 5JUMA 4ED1A 2C3UA 4R0JA 2HNDA 2OPPB 5CXTA 1IKXB 4YB5A 2E29A 3F44A 1TKXA 2QLWA 3M2VB 2UV8G 4QOTA 3U02A 3NKYA 2ADBA 3KLVA 1FDAA 4RW7B 4RU9A 1WF1A 3BGUA 4BWMA 3WDOA 3PEHA 2HHHF 1QE1B 3GFYA 1S1UA 2YKNA 4ZA1A 3G86A 1KC8T 2ROGA 2DJWA 1WHXA 3JSBA 3QWPA 3CJKB 3C8YA 3WBZA 2E1RA 2MZQA 2XMUA 3MHYA 3KK2B 1RT4A 2F4VF 1NEEA 4U9RA 1T3NA 3SYZA 1JIHA 1TKZB 1VRTA 1FXLA 1G1XA 3FJ2A 3M30B 4KHMA 1BQMA 2CFXA 4QIWD 5IQ6A 3SSSA 1Q4RA 4KHRA 1MROA 2JC1A 3JSRA 2E1CA 2VQEF 4R5PB 2B4PA 4QPXA 3GG1A 3MR3A 4KFBB 3IWLA 3PJWA 3FCHA 4J9SA 2DRBA 2LA4A 2GMJA 3AY0A 2FHKA 3W7BA 3DHWC 2FLLA 1NJYA 3PX4A 4RW6A 2ZH5A 3BREA 2M0GB 4NA1A 4BC9A 1K9MT 3SQGB 4RUAA 3I0SA 3SFGA 2MMYA 2R9LA 2JDJA 4KO0A 3CIZA 4TNOA 4DV6F 4RU2A 3NAIA 5EWEA 3C2PA 1R43A 1VLYA 4EEYA 3AB2B 1Q7YT 1S1XB 2BQ3A 3HZGA 3H40A 2HNYA 3H25A 3SCIE 1TKTB 3VAIA 4QBUA 4X4RA 3QGGA 2BACA 4ICLA 4E0DA 3MXHP 4HHJA 3OTBA 1S1WB 2QSWA 5GADU 1SJFA 2MY8A 4P7TA 1YRTA 3RBDA 3D5MA 2CQHA 2ZH3A 1CEZA 2KH9A 5GAHU 2DGWA 5KFFA 2DD8S 4XO0A 1IR0A 3LAMA 3O6QA 1RTJB 3LUYA 3TNVA 1JLGB 5F8HA 1D1UA 1X8DA 4MIWA 4JV2A 1UVNA 1REVB 3KK3B 2BABA 4B9MA 2FJEB 3CCVS 1VI7A 2ZOFA 2VFVA 3G96A 4DQIA 2KM8C 2OFGX 4XPEA 2J5AA 4WZQA 2M7SA 3FNNA 1LXJA 4DR6F 1HQEA 2Q43A 1KVJA 1E6YA 1QUVA 3OTOF 2RU9A 2P5VA 3IA0A 2QFJA 2XO7A 2MSTA 2KT2A 5F9LA 3SV4A 1RGVA 2FJDB 3OUYB 3OFGA 4F8RA 3DLGA 2KHCA 2A3JA 3UCGA 1Y5NB 4ZPWR 1D9DA 1FKPB 5DJBA 1EETA 1HWLA 3T5JA 1AFJA 4ECUA 5HROB 1C1CB 4W90B 1GXUA 2HFOA 1RYSA 2R8GA 2RKIA 1RISA 1PILA 3HJFA 1OPZA 4OX7A 5KFPA 3PR4A 5A8WB 3O44A 4G1QA 3UWTA 3FEZA 3IXQA 2NPIA 2LDIA 3FQLA 3MM5B 2RQMA 3L7OA 3I87A 2CPJA 5L1JA 1VBXA 1QLNA 3HM9A 5KFCA 3MMBA 3HVRA 5D4LA 5E33A 1V3SA 2LYVA 1S72S 3PVXA 5E3AA 4ZCKA 3D0HE 4KR0B 1XTZA 2CRLA 1QY7A 1NJWA 2DNLA 4MH8A 3TYTA 4Q0BB 4ZPDA 4KGMA 3UDLA 2WSEC 2CPXA 4BHQA 4C3LA 2K1RB 5L1LA 5B7WA 2KKHA 1VJWA 4TKTA 3K0JA 2HIQA 2IC3B 4I64A 4IOCQ 1U49A 2ZD1B 3T5HA 4B3OB 3CMES 2EG2A 3UFCX 2JRSA 5KOXA 2WTFA 4ILLA 4ILRA 2PFFB 4I6WA 2B7BB 2B56A 2OAUA 2XGPA 1DHMA 1WF2A 3D54A 4IG0A 4UQGA 3R5CA 4EO6A 1YJ9S 1UP1A 3KLGB 3RW6A 3F56A 2X1AA 5I3UA 2AYBA 2DNQA 3N0VA 3LPYA 5CYJA 4WKYA 2UP1A 5HMYA 4IFVB 1KLMB 4DV2F 1JJ2R 4H4KA 3E51A 2FHJA 3M8QB 1U1PA 1NJZA 2CQGA 4PQUA 2FJWA 3UNGC 5E0OA 1VS3A 3BN7A 3G4SS 3CE8A 1IKVA 3M4XA 2CJBA 4I6AA 3UR3C 2BANB 3MR6A 3HF5A 1IKYB 4DFKA 1SJRA 2RQCA 4ZCMA 3OW2R 2JLFA 2WB4A 2A2DA 3IR6B 5IT4A 2R8IA 2E9TA 2R7SA 2R8HA 1R8BA 4Q45A 3OSNA 3KLHA 1K1QA 2PT0A 3QJJA 1B64A 4MIBA 5CCMA 1WD6A 4B02A 1TV6A 4N47A 2F40A 4JBCA 3TAMA 3CD5A 1KS2A 3SCLE 2YWGA 2RRAA 5LSLA 2J7UA 4JV1A 4OHXA 2RD5C 5CZVA 3KOAA 4NWBA 3V4MA 3Q8SB 1SKSA 3OVBA 3T9NA 2XC9A 1K0TA 3DLKA 1FD8A 4RW9A 3RYLA 3BJYA 4X4PA 2CQCA 1N52B 1LK5A 1C2PA 1IQZA 2WRMA 2RU3A 3V6DB 2XZWA 2Z2LA 5A8KB 2F3JA 2OMOA 3CB4A 3NP5A 3ZZPA 4DG1B 5CA5A 5DDRC 1C0UA 3PEJA 3MAQA 4H4KC 4J9LA 4DUYF 2WAQD 2MHNA 2HMIB 3QO9A 3OV7A 4AL7A 3K5OA 1HD0A 2NUHA 3O