3IAM9

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
154
structure length
154
Chain Sequence
YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 24
structure length 154
sequence length 154
chains with identical sequence G
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
9 PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iam900
3I9V9 3IAM9 3IAS9 4HEA9 2FUG9
chains in the Genus database with same CATH superfamily
2FB0A 4K4XA 3O44A 3JSBA 2VG6B 5CQGA 3UVJA 1XC9A 2RAQA 2ZVSA 1NKEA 1NO8A 2JC0A 4ELTA 4O3PA 1JXLA 1DLOA 1RU2A 3G87A 4DMZA 2C2NA 4DSIA 4CWBA 1FD2A 1PBUA 3W2WA 1TKZA 4DR4F 2ZEJA 1BQMB 3EGVA 2OKQA 3HHLA 2MSSA 1UFKA 4N77A 4Y2IA 3IS9A 1F2HA 2ZJRQ 2VDHA 2H3EB 5HL7Q 3ET6B 3M05A 1S9FA 1HNIA 3W64A 3OPKA 4ZP7A 5T7LA 4B3TF 4DR4J 1RE1B 1S79A 2XY7A 4USJC 3KNAA 3HCXA 4Y2AA 3NNCA 1UEUA 1NJIT 1Q53A 2C2ZB 1C1BB 1AUSL 3IFEA 4KJIA 4MIWA 4B3TJ 4LR8A 1ZH5A 1R43A 3A8JA 2R7UA 1TU0B 3GJSB 1M0SA 1CPZA 3KLGB 2RQMA 2E5HA 1P27B 4QIFA 4PWUA 4LF7F 2BACA 1KFSA 1R6YA 1FRKA 1SKRA 3T5HA 4P52A 3OL7A 4OJHA 3NCQA 2P6TA 2XULA 4DL7A 2DGTA 2HS0A 3UCGA 2R7WA 1DURA 4LR7A 2MDAA 3WIVA 2XLIA 4LF7J 1TVRB 2CZ4A 3IM8A 1RWWB 2Z0GA 3ITHA 2HWIA 3TR5A 1QE1A 4QIVA 2CG8A 2KM8C 4EBEA 4L74A 4DR2J 2EKYA 1YDLA 3PJWA 3IG1B 1SH3A 3F73A 2YKQA 1HA1A 4F4ZA 1U45A 3OXGA 2OPPB 2YKPA 4RJVA 4P2MA 4ZA1A 2HPUA 1ZAVA 4MKVA 4NOHA 4XPCA 4JI1F 3CD6S 4QWCA 1MROB 4C48A 4LT6A 4DHVA 2EXUA 1HBUB 1PGZA 4WXWA 4RW6A 3GU0A 3X3UA 4C8ZA 2IM3A 2LDIA 4DN0A 5HP1B 4JI1J 3SYZA 1O6XA 1TL7A 1DTQB 2W2QP 1O51A 3Q24A 3PXGa 2EKNA 4KB7A 2QTWA 1VRUB 2VA2A 4ZPAA 2MQQA 4QIGA 4DV7F 2FJVA 2R7TA 1DARA 5KFTA 1FX4A 2OHDA 3TEHB 2NCKL 3MOJB 3E8OA 4UQTA 4M5DB 3KDOA 4DFJA 6AT1B 4BHQA 3MM9A 3CC4S 4J9PA 4DV7J 3G86A 2MQPA 5D0RA 4IDKA 1VQ4S 3QGPA 1NK8A 5GADI 2A6MA 1BXNA 2PEBA 3QNWB 3PTWA 3ZFVA 3H40A 2PMHA 3RG6A 1FXDA 3UO0A 4N5SA 3DLGB 4M5KA 3L7PA 4ILMA 2UXBF 1SC4B 2K06A 4IO1A 3P45B 1VQMS 4F50A 2EFNA 3OR2B 4ZP6A 4USTA 3Q8VA 3R8YA 3TJ8A 4DXLA 2R7QA 3R2DJ 4B9SA 2CNLB 4FBUA 4K4UA 4LJMA 1HMVB 2FYXA 3LAMA 5ETVA 1S6PA 2CQIA 2UXBJ 2V5HG 4EBCA 5IC4B 4ELVA 4NYOA 1GEHA 4Q2LA 1FFGB 3MD1A 2XMWA 3KJVA 3NS7B 3GCWP 4ANEA 2FDNA 2HWHA 2WB4A 2H4WB 4YUDA 2B4PA 1NHVA 1WKJA 4C8YA 1RWPB 2OTLS 2ERRA 3HSDA 1JLAA 2MXYA 4CO5A 2WSEC 4OJ1A 2BE2A 2CQ2A 2J9CA 3DGVA 3QGHA 3EMTA 4Q8FA 3T1HF 3PJ9A 4F36A 1NXIA 1RUSA 2HK2A 3K8WA 5CCMA 3I96A 5H9FJ 4QW8A 2GO8A 2HQIA 3AB2B 3T9ZA 2MZTA 1HWLA 2X1AA 1Q8LA 5ETNA 1WACA 2UZAA 4OI3A 3KKFA 1T02A 3R2CJ 2C2OB 2N7CA 3PW5A 2BDPA 3T1HJ 3UVJB 3AJ1A 2QMUB 2QA1A 1P9YA 3PVXA 1DLOB 2CJYB 2HNDA 1M5OC 2B4UA 3RAQA 1N5SA 4DSLA 1V6HA 5EGYA 1HIYA 3UN2A 2V8VA 3HHLB 3IS9B 2C2EA 1EP4A 3FCVA 4IOAQ 4N8NA 4DX6A 1VBKA 2EW9A 1HW8A 1HNIB 4ZPBA 4TVAB 4C8LA 5T7LB 1JQGA 2X7IA 1LK5A 5DG8A 3H4DA 2D3UA 3KG4A 1JLFA 2QL9B 3RR7A 1PJ6A 1JLQB 2Y8YA 2KYXA 4UUWA 5B0AA 4O44A 4RUCA 2LQJA 4F67A 3S8SA 1UJ4A 2ZJPQ 2DGVA 3UCUP 3MUVP 4B3SF 2DNMA 4DN9A 4RPFA 3HPOA 4OHVA 3HVTA 4CLUA 3DOMA 2GHPA 3VALA 2AHOB 4UF4A 4NCBA 1IN0A 5K8OA 4DR7F 4B3SJ 3DGPB 2G2YA 1T3NA 2OPRB 3MR2A 1S1UB 2KT2A 1RT1A 1XN9A 1NAQA 4UW2A 3BKUA 1VRTA 1QE1B 2V0NA 5KFUA 3SI8A 1LWCB 2IJFA 2LQ5A 2HMIA 4KPCA 3BKTA 3CB4A 2C42A 3DLJA 3M32A 4N7TA 3AA8A 5LSRA 2JEIA 4M5NA 4P2FA 3FKBA 1QD1A 2RILA 5F8LA 3JSMA 4ED4A 3I9ZA 4OV1A 3HKWA 4B3MF 4RW6B 2PMZD 3G6VA 3O8WA 2JFKA 1BWVA 3SFGA 2ZH6A 2N82B 5DQHA 5FLXU 4QYRA 1U49A 4B3MJ 4DV0F 2O67A 1R0BG 2CQ1A 3J81Y 1TFWA 3I0RB 1LW2B 3MD3A 1VLYA 1NZAA 4M8LA 1RGVA 3TO8A 2ZUAA 4WIIA 2G4BA 1XNRF 2V2KA 2P6SA 1U1RA 4MT1A 3H2UB 2DRAA 4DV0J 1TK8A 1SVDA 3KWMA 1S57A 2BVZA 1KD1T 3MM9B 2KU7A 5DO2A 2E9RX 3ENAA 5LMUF 2OUGA 4MMOA 1GXUA 4I69A 4IDKB 3NBPA 2N4DA 4DX5A 4DQPA 1CJTA 3UDVA 4OLPA 2XS7A 1XNRJ 4ZVGA 3O3LA 3OSNA 5E0OA 1KQFB 5LMUJ 1FNOA 2F65A 3G6XA 1VQ7S 2X1FA 4R8UA 2PE8A 2F9DA 2VA3A 2RRAA 3BSNA 1NKBA 1PYOB 4IH6A 3RUBL 2DRBA 2A3JA 5JMNA 3KK2B 3M8SA 4O3OA 2V8GA 1CJKB 1HW9A 2V9KA 5E41A 3CCTA 4CTAB 4Z37A 2HNZA 3KJVB 3LGNA 5H1SV 3OVSA 3QT8A 1W2IA 3OTEA 3S6EA 3L09A 1X4GA 2D3ZA 3M1VB 2HHPA 2GGPB 2JNJA 1WI6A 4P72A 3ILLA 5E33A 1WHWA 1SH2A 1JLAB 4Z7YA 2DCUB 2ZKUA 3M2UA 2BE2B 4ZN3A 1NSPA 5KT4A 2UXCF 4ICLA 1FRLA 4MK9A 5KFFA 4C9DA 4OX9F 3ILOA 2VD3A 1RTHB 4K4ZA 3J7Z5 4YP3A 4OYOA 5J2QA 1JLEA 4U67Q 2U2FA 1P6TA 1RT3B 4GVLA 2Z2MA 3KG0A 2UXCJ 3GZ7A 1F1BB 4F25A 3T3FA 3CPWR 1N5YA 4OX9J 3P5TL 3TJAA 4ZVQB 1UVMA 2E1PA 4TN2A 1RLCL 3PIPQ 2CZ9A 3CCES 2XCAA 5D3GA 2VODA 4TQSA 3JB9k 4OFZA 1KWMA 3CJKA 3KHLA 4PG7A 4C3LA 3MPWA 1YKWA 4YB5A 3WQPA 5L46A 5E3PA 1WF1A 3MCNA 3M6UA 2QSFA 1U6BA 2OPQB 5ETLA 4ZVTB 1JLFB 4M63A 1WNEA 3IRXB 1T9YA 1NSQA 1QAJA 1HNVA 3QPIA 5FJ4A 4O44B 1RCOB 2CJQA 3DRPB 4USKA 4LRAA 1WEXA 2C2KB 3CC7S 4LIWA 3HVTB 2ZH1A 2C22A 5D77A 3MM5A 2IBKA 2HVDA 3CULA 1XK8A 2B43A 4KY3A 3GLJA 2V4QA 3QATA 1A7GE 2ZKTA 2W2OP 1JLCA 4NXNF 3W61A 4YB1P 5GAGU 1NU4A 5D6GA 5D0HA 1U1PA 1VRTB 2J7UA 5BYQA 2AGQA 5HO4A 2IYIA 3AXMA 1DFDA 1S59A 4O4RA 5KFAA 4LF2A 3LPEA 4DX7A 4L6V3 3IGNA 1PC4A 3M32B 3G4SS 2ZH5A 4NXNJ 3BEGB 2X1GA 2XC9A 1SC3B 2VPXB 4FF3A 1KP6A 1KRPA 1YLXA 3PW0A 1H2VZ 1GFWB 2PEHA 3DN9A 1CLFA 1KOHA 2BW7A 1VCTA 1HYSA 4YN3B 4LIRA 4DPXA 2FC8A 5BJRA 4BBYA 2CPYA 4EMDA 2HHSA 3POTB 4EEYA 5KG4A 3MCSA 2ZJQQ 4X84A 1GAOA 4U6PA 2DT9A 3W5YA 2D69A 3BYPA 1KSPA 4GKKF 3BKFA 1HI1A 4LSNA 5KFVA 2EEYA 1D0EA 3QLHA 2CJBA 3TARA 4PRFA 1NDPA 2IIHA 5DG9A 2OMLA 3FGVA 3PR4A 4NLSA 1B7FA 1GTHA 1VDHA 3KLFB 2FJAB 1HWKA 2M4MA 1V5IB 2AJ2A 4GKKJ 4DX8H 3FBEA 4R25A 5I3PA 4G3IA 2VIHA 1FRHA 2GJIA 2VZ9A 3NBPB 1CJTB 4P71A 5J2NA 4QYZJ 2ZDPA 1N0UA 5GVQA 1NB2A 3CDAA 1B0TA 1YVFA 3BJYA 1IBCB 2XI3A 1PKUA 1UKUA 2BR0A 1P1LA 2UUAF 4WCEQ 1FE0A 2I5JA 3IWXA 2HVIA 1EB0A 1SPBP 4OJ3A 3PEJA 2Y1RI 5HROB 5D0EA 1IVZA 3R6GB 3Q8QB 3BH7B 2R2UA 3MR3A 2Z4PA 3BBBA 3CDUA 5J2PA 3AOCA 2UUAJ 3FSXA 1U1KA 2QJ3A 5E7OB 3NWGA 1EAYC 4ECRA 2KG1A 3MAQA 1SXLA 4PQUA 4O3NA 2CADA 4TYAA 1ZPWX 4OZNA 3MMCA 2CPZA 1B64A 5IV4A 1MMLA 3C14A 4NZ0A 3HD2A 4ZVPB 2B5JB 3RU0A 4BLGA 3MAAA 7FDRA 2WONA 4Z2XA 4IOCQ 2BQ3A 3GILA 2BV3A 2EPIA 4ICLB 4X66F 4WTOB 2MZ1A 2BEFA 1XR7A 1WKLA 3N6NA 4LBHA 3LOUA 4FPRA 3FEZA 5J2QB 1JLEB 2OSQA 3W9IA 4JOUA 3ZO7A 3AY0A 3NCRA 4X66J 2EC2A 3OUYA 1AFJA 2YY3A 2LA6A 1T05A 3KK3A 1ZS6A 5A6PA 4TQRA 3CCMS 4ZCIA 5D3GB 2HVZA 2EG2A 3PRBA 3W62A 1H38A 4EYIB 1WHXA 3K59A 4NI2A 2MQMA 4M1KA 4DFKA 3W60A 4NLTA 3KDNA 1CG2A 3SZ2A 1FXLA 1MU2A 1AB8A 5KFEA 1QUPA 2AJFE 3Q22A 2MY7A 3AQOA 2RIJA 1RABB 1X9SA 1A0OB 4WP9A 5JVGQ 1HNVB 3T1AA 3FEXB 2KJWA 1G6BA 1SUQA 2AZ3A 3R5GA 5A76A 2AYEA 1SC1B 3SFUA 4RBTA 5EHHA 1HLWA 3MXHP 5IV3A 2LFVA 1HQEB 3MM5B 2D9PA 2QL5B 1YRTA 3CDBA 2VKZG 2HHTA 5CABA 5C2CA 2DO4A 1PJ7A 2QEXS 3VVUA 4MKBA 1WDDA 3G82A 4TNOA 1C4AA 2BJDA 2V8DA 2MZJA 2B56A 2JHEA 2AYBA 1UFWA 2ZOFA 4DOZA 3L3CA 4DG1B 1QLNA 1LFPA 2WW4A 4DBQA 3AAWB 2WVBA 4WYLA 2PFDA 2FPHX 3QWUA 2EFGA 2HFZA 3CW2C 3ZZZA 2UV8G 4DUZF 4WWSA 4I7FB 3GQCA 2Q66A 3FMBA 2XB2D 1KDNA 2CPHA 3NWRA 3CSKA 3A1YG 2DR6A 4NA3A 1HYSB 3EXCX 4YR2A 1SL1A 1G4CA 3CCZA 4UZCA 4TY9A 2BE9B 4DUZJ 1FD8A 4CIOA 1U6FA 3MMJA 1FDBA 1OMSA 5IWAF 2FHOB 3K5LA 3PDNA 1RBOB 2DH9A 2KVIA 3QAEA 1M5HA 3PIOQ 4YQWA 3MM6B 4LSNB 4NZ6A 1XWLA 3QLHB 2YX7A 3PO5A 4J9QA 5IWAJ 1SJRA 4MK7A 4MTPA 5DG7A 2R8KA 1M5SA 1PILA 2E44A 1R8BA 5KFKA 5D8HB 4ED3A 3H8YA 2VHGA 5B0GA 3EUNA 1AT1B 2GMHA 3I82A 2Y1JA 4IG0B 2ACMA 3BM7A 2B8QA 4QBUA 1IKWA 2J7KA 2HQDA 4LFCF 5J2NB 4X4NA 3OTBA 3TX0A 4B9MA 2ASYA 3JQKA 3MM8A 4O3SA 4LR9A 4JI7F 1U1OA 1TELA 5EWFA 4JV5F 2HYIB 1C0TA 2YWHA 4QU7A 3A13A 5C42A 4I67A 4KC5A 1GX5A 4LFCJ 4BWJA 3T41A 1VIXA 2MQLA 2VBZA 3UN5A 3UR3C 4JI7J 5J2PB 3LPYA 3SCLE 4QIEA 4JV5J 1SCJB 2CA9A 8ATCB 4YDDB 4MYUA 5ETOA 2MEWA 4ED2A 3PV8A 2Q1LA 2F5GA 3RBXA 1S12A 4RR5A 3GYXB 4ECWA 2RNEA 4PQUB 3GIJA 3DHXA 2L9WA 1T9XA 2K3IA 3LH2S 3MMCB 3VZIA 2AYMA 4DSKA 3HHLD 2HG4A 2LLZA 3N6MA 1Y10A 1VHFA 2ZBQA 2GVDA 2WONB 2D74B 1U8WA 1DTTA 2OFGX 3P6YC 1D9AA 3CJSA 1GMVA 4WE1A 1FKOB 5JJBA 2F3JA 1TZ0A 2H51B 2QX0A 1T7PA 1MMNA 1RADB 2HFVA 1K1SA 2PMWA 4A8XA 4GO7X 4F4YA 4OI1A 3A8EA 2ASLA 3OUYB 5BXIA 4Q44A 2QFIA 5ETPA 1PG5B 3HHDA 1RA7A 3ISNC 4KO0B 2DITA 1NSKL 5IM0A 3KK3B 1QSLA 2BJEA 4WFYA 5KFWA 1LNQA 2XMMA 1WSVA 4CO0A 2Y0SD 4ER8A 2XI2A 3S01A 5F3TA 2ZITA 1L5UA 4NI2B 5LSLA 2XO6A 3D68A 4F4XA 5A0YB 2MKIA 1MU2B 2CDQA 1H7XA 3KUHA 3R6LB 1N33F 5CZXA 4DEZA 2BABA 4Y00A 4KV8A 4N56A 5CYQA 3H4BA 1FI4A 2Y9HA 5AXLA 1KOOA 2D7SA 2YNFA 4EZ6A 4ECUA 2OD4A 3G8QA 4ZLLA 3CCVS 1N33J 1RAEB 2OH2A 3HHKA 1S7HA 4Q7AA 1RT7A 2GNKA 4WIQA 3H2VE 2PD1A 4DL3A 1WG1A 1NK9A 4LF6F 2RDDA 1FRIA 2EFPA 2OI2A 1R0CB 2YH1A 3I55S 3CT9A 1TUGB 2ZBPA 1L3VA 2MKYA 5L9NA 2GVZA 2L48A 3I5BA 3BB5A 2ZD1A 1IKXA 4LF6J 1S0NA 1H0HB 5E3AA 4OIXA 5CH7B 2EFQA 1HI0P 3SSSA 4FF1A 5KFIA 4KAIA 5J2MA 3RB4A 3KXDA 2GQ2A 4PPZA 4OV6A 4EU0A 1W2BR 3DLKA 1LOUA 1TL4A 4C97A 4OX6A 4IRDA 2V2QA 3I56S 4EBDA 1SH0A 3LANA 1TUWA 2A1BA 2G0CA 1KTQA 2HRUA 4IQXA 2WW8A 2MKHA 3DI6A 3KLEA 2MSTA 4W92B 3VV2B 2FVCA 2OPSB 2KO1A 1G2EA 1T9WA 2CPIA 4CH0S 1S6QA 1NK0A 4DSEA 2M88A 3K5MA 2QLJB 3MI7X 2NZCA 2MLYA 5BYRA 3RJMB 5CZVA 2ZZMA 3CJ2A 2E9TA 2VG5A 4J9VA 4FNIA 3NCPA 2LXIA 2KHCA 1R8PA 2ZVIA 2YWGA 4OHXA 4RW7A 2N3OA 2W24A 4JI6F 2R8HA 2NZ4A 2FGCA 1RHJB 4Y3CA 4TLQA 2G13A 2VG7B 3EWGA 3NGRA 1QAXA 4WZQA 1MSWD 1SJQA 1V5VA 1T0TV 3R7NB 3C19A 3FK4A 2BX6A 2QYCA 3FVYA 5C7PA 4JI6J 1MLAA 2AWZA 3MM8B 4O23A 3KJNB 2V63A 2LU2A 4LSZB 4J5OA 1GNKA 3OR1A 3OTOF 3PX0A 2D3O1 4NLRA 5C42B 4PG5A 2DJWA 3D1QA 4UZBA 4X4VA 2WRMA 4PAAA 1IXKA 2DNZA 4F3OA 4Y2KA 5SUHA 4O3RA 5H9FK 3GIIA 3WIUA 1D09B 3KUEA 3GV7B 2KFNA 2Y3YA 3J81U 3R3TA 1H74A 3OTOJ 1UA1A 2XLJA 1QY7A 1U7LA 4RL1A 1GXTA 2DTJA 2OSRA 1FK9B 4ZP9A 4J37A 1H73A 3P4UB 2RQKA 4U7CA 3R5CA 2YWFA 4MH8A 4IRCA 3FQKA 2XG8A 2OD6A 2G2ZA 2LECA 2YQ1A 3VQTA 2YWWA 4QU6A 3IA0A 3JTOA 1N0VC 4P6QA 4K4YA 4KR0B 4RU2A 2VONA 2MPUA 2HBZB 3W7BA 2DNHA 2GVDB 1KEKA 3NNAA 2YPZA 2WB1D 4L73A 2UXDF 4GC7A 1JMTA 5H9EK 3A3NB 1P1TA 1H72C 2RT3A 4CP5A 1VQOS 5HMYA 3UW1A 1PIEA 2ADCA 2C28A 4AFFA 3K58A 5AXMA 2DB1A 5T41A 4ANDA 2BJ8A 2VFUA 3GIKA 1MN9A 2NR0A 2E1AA 4NX9A 2UXDJ 1UTAA 4AL7A 2KZMA 3ZZRA 4ERDA 2DNRA 1ZOTA 2J9EA 3M8WA 4DSJA 1VBZA 1YZ7A 2AJ0A 3JSRA 2IC3A 4NYZA 4RW9A 4O0NA 4DCOB 4NMLA 3UI3A 2VH7A 5IM0B 2W2NP 4YOEA 3R27A 1W26A 4RW8A 5A8KB 2XMJA 5A8WB 5F0UA 1YIJS 2J6TA 2B9YA 1HHTP 2IMWP 1Q8KA 3EDRB 2EBEA 2KT3A 2LEPA 1CQMA 4G6VB 3CGIA 4IFYB 4OZ5A 5J1NA 4ECXA 2WSCC 3MUMP 2DR7A 3DM2A 1H3DA 2BJ3A 3GSDA 4Q2MA 2DXEA 1B99A 3MGJA 2CXEA 1X4HA 4OYBA 4M94A 3M9OB 2OAUA 1VOMA 4KV8B 2E5JA 2JRSA 2DGXA 3CD0A 4P75A 4OQJA 4A46A 1RTIA 1ZAXA 3TAMA 3QAUA 3PFOA 3M6VA 1UCNA 1FVSA 3D2WA 1FJCA 4DR5F 4KQZA 1WWHA 3HKZD 3L95X 1RT7B 4ID8A 4USIA 2MZSA 5AE1A 1UVKA 2R9LA 2UUBJ 3R7SB 5CA5A 2OO4A 4P73A 1S99A 2PC6A 3M8PA 4DR5J 3EDQB 1S9GA 2IFXA 3R5JB 4ZKAA 5G0RA 5I3UA 1REGX 1OJ4A 1WSRA 2GW8A 4H4OB 2RUGA 2ZD1B 1IKXB 1J5OA 4DWIA 2POKA 3NL0A 2XGPA 2HHVA 2W01A 5J2MB 4X2BA 4BWMA 3FMWA 1HPZA 2ALYB 2JDJA 1X4CA 2ZC4A 1I51B 4CH7A 3DLKB 1N5QA 5EX3A 1Q78A 3ZTPA 5EN1A 1F6TA 4FS1A 4ZIVA 1OSDA 4X4PA 3FQLA 3HSJA 5F0WA 2R7VA 3CVKA 1OYDA 3MCMA 4A8QA 1CQNA 1FT8A 1WHVA 5KFXA 2UVRA 3SSRA 3K2YA 3EVWA 3DI6B 3KLEB 3PRVA 1Q7LB 1T9VA 4YFUA 3HI9A 3JQMA 4YB7A 2RMLA 1C1CA 5A2QY 1KR4A 5FIIA 1Y4ZB 3KTQA 3FBFA 2CPDA 1B4SA 4G1QA 2M9KA 4DF4A 2VG5B 4TLRA 4LFBF 4KTQA 3OFEA 2ZBRA 2V8PA 2B8PA 3SIPB 1OQ6A 3OW2R 1XMBA 1YSJA 5CYMA 3ENVA 2FQQB 4LFBJ 2J6UA 3K5NA 2K7JA 3TWZA 3SCJE 4NE9C 2C3OA 2MJNA 5KT3A 1Q95G 2H9ZA 3IAS9 1Z4UA 1U6ZA 4CM2A 3GWCA 4HT7A 4RUAA 2O1PA 3D7SB 2B4OA 3MPDA 4J9OA 2LKZA 3VWSA 2YTCA 2D9OA 4LUBA 4G1PA 5A8RA 2B6AB 1S1TA 3NY0A 2HLTA 3RZAA 4LFAF 5B0FA 3FC9A 1NDLA 2EK6A 1RAGB 1OYEA 4FZVA 4O4GA 1EQMA 1HI8A 3UPFA 3HVWA 3ZXWA 3LP1A 2VFSA 4UOHA 1CS4A 4LFAJ 2HWTA 1UVJA 2CQ3A 1TUVA 2R8GA 2WSFC 2FJWA 1S1VA 1DQ9A 5DQIA 1ZA1B 4F8RA 2RUSA 4UY8T 1UL3A 4WYWA 2NLWA 3DRYA 2RRBA 4XTTA 4FYVB 2KL8A 4M5JA 3NS6A 4RLEA 3WC2A 2LA4A 3TANA 1TL5A 5CYJA 2E1RA 1YBAA 2WVCA 2WCXA 1H7WA 3W9JA 2KVQE 4J90A 2KXHA 4ZPCA 3HMJG 4DV6F 4C98A 5DZ6A 1MWZA 2AKWB 4UOFA 2DIVA 1RT6A 4NXMF 3SDEA 2IC3B 3PYGA 4RW9B 3W3SA 4DV6J 3VQSA 1KNZA 3CJ3A 5MLCV 4RW8B 4UOCA 1JK9B 2NUUG 3QRQA 5HI7A 4NXMJ 2YNIA 2BKPA 4ZVRB 1GMWA 3ZZOA 1CEZA 4XO0A 2HHHF 2BANA 4YDXA 4WZMA 3EX7B 4K5RA 1N34F 3QFHA 4GVBA 2G2OA 2D1CA 2HHHJ 1RTIB 2HAFA 2FY8A 3TAMB 1TAQA 3AD8C 3D6TB 2W25A 3RBZA 2LVWA 3PACA 5F9LA 2U1AA 4P9SA 1N34J 2CNNB 2B51A 5B08A 2V2VA 2XMKA 3S1TA 4OYXA 1FESA 3VTIA 3BPSP 1U2CA 3BSAA 2XCPA 4CNZA 1YQHA 1I6JA 2VBWA 4IR9A 2JOQA 1S9GB 2MQNA 3QSIA 1WTBA 5I3UB 5LJ3Y 1VK3A 3EZOA 2WBMA 3N0VA 2IDLA 4UT4A 4ILLA 2FHMA 4P2XA 3UN3A 1MWQA 1FEHA 2BXJA 5KFRA 3CO0P 2B3TB 2MKKA 4QPXA 2HQCA 3EPIA 3IXQA 2I6WA 3CCQS 4DLEA 3ILIA 3SQGB 3P8BB 1EETA 3BBCA 4AE5A 2H1YA 1RB0A 3VAGA 1J5EJ 2GHWA 1RT4A 2YKAA 2C2MB 2ZUGA 4K2JA 4ATNA 4QYZK 2QE5A 3R1LA 1VFJA 3R7BB 3PYFA 3EGNA 5CD4H 3QWPA 2HZCA 3OHBA 1U26A 2ILYA 5RUBA 2MKSA 4JI3F 4LSLA 3IMQJ 2DR9A 1H98A 1SKWA 4G1QB 3THTA 1IR2A 3LP0A 5L38A 2NXUA 4ZCKA 4Q8EA 3IWNC 4A8KA 1IR1A 2GMLA 4ZPWR 1Z2LA 4JI3J 4ZITA 3OL8A 1QSYA 1S0OA 1I5OB 3KMSA 5ETQA 3TZWA 2VPYB 2M2BA 1XMOF 2GIFA 1IM6A 4LQ3A 1ZETA 3A12A 3EGZA 1UZDA 4ZLPA 3O2IA 3RR8A 3FFIB 2AEJA 4HR2A 2C3UA 5HJYA 4QJVA 5KT6A 2C3MA 3E3XA 3R1HA 3QQCD 1VQ9S 1OWXA 2LCWA 2KM8B 4HTIA 1XMOJ 2AV5A 1X5PA 4Q5VA 1S7IA 3CEDA 5DS7A 5A8RB 1C2PA 2FLNA 3I5CA 4CH1A 2OJ3A 4L76A 3G9CA 1S1TB 3GJRB 4FVCA 1Y9OA 3EVOA 4TXSA 1CJVA 4EYHB 1TK0A 2ADBA 1UVLA 4O4GB 1I1GA 2PI4A 2MKCA 3MPUB 4X4UA 3PFEA 3LP1B 3V2UC 3GFYA 1CS4B 4OI6A 3IN5A 1X0FA 1DJ0A 1TL3A 2AEMA 3OJUA 4C2MA 4ZIWA 3VGTA 1HQ2A 3V6HA 4FKYA 2KHDA 4WTYA 2MMYA 1XJWB 5J1EA 1RWKB 4CLPA 2BMBA 3BGOP 1X9WA 2IRXA 3HHEA 1S77D 4DCJB 5KG0A 3M2VA 3HSZA 5KOWA 1B7YB 2D3OR 4RKUC 1E6VB 3GG0A 4PYAA 1CC8A 3FNNA 1DZ5A 5DLGA 3GJTB 3VAFA 5U47A 4CDIA 3GMGA 2ZWPA 1RT6B 3B6BA 1EZZB 3SDEB 4USMA 3MZIA 2XZWA 3NKYA 2RDIA 1HKAA 4Q45A 3W66A 5KG1A 4I2PB 1YJ9S 3RYLA 2QV6A 3OLAA 3MWBA 2J0SD 2VDIA 2ZBIA 3NG8A 1F3VA 1W25A 5E3QA 2ZC3A 2YX1A 3HZEA 1NM2A 3TP2A 3OV7A 2YNIB 2Q3PA 5KG3A 3H98A 1IKYB 3TVYA 3NGKA 4PWDA 3MPVA 3VCDA 2BANB 4H54A 2W1BA 4A8SA 3JTNA 5KG6A 3MEEA 3AXKA 3Q86A 5DGBA 2B4VA 1HBMB 4DL5A 1PSDA 2CYYA 3FCHA 3D66A 3TUIC 1FFWB 3N5BA 3UDEA 4GVBB 2ZFHA 3OL6A 1WHYA 4CT8A 2HGMA 1TKTA 4C3MA 3SMZA 4RUHA 4H4KC 2JVRA 2FZKB 1N32F 4LMZA 1TL1A 5IT0A 3QBCA 4KHPF 1OPIA 1JLBA 3C3LA 4AD6A 1SJ1A 2DBBA 4ZCLA 3W2VB 2W9BB 4OLOA 2C1EB 1O5JA 1RT5A 5C5JA 1Q5VA 2XMAA 1N32J 4PXCA 2AU0A 2PSZA 3G6ES 2NXCA 4K4VA 4KHPJ 3BR8A 4IG3A 1VQ5S 2UUCF 3KMQA 2XEXA 4J9MA 3TZYA 3HF5A 3VGSA 5KFNA 3MTJA 3R9LA 3UE2A 4FPIA 4CO1A 2BQUA 1RBLA 4DR2F 3PX4A 1RP5A 2ROEA 2CNKB 1TP7A 2ZE2A 3G71S 4OZ0A 1RZMA 4OI0A 3WX8A 3UD4P 1EETB 2R8JA 2FJXA 2BRKA 1BQNB 2UUCJ 2KRBA 1K0VA 1U8SA 3M30B 2ZHAA 3EGWB 3MMBB 5KG2A 2QZ8A 5DRKA 3P49B 1ZM9A 4WK3A 5D4NA 2HNYB 3EVMA 5HLFB 4V1Ak 2R42A 3DU5A 4YEAA 2NUHA 9ATCB 1GTEA 1Y3JA 2MGZB 2QRRA 2MLXA 5E5NA 3TX8A 3I6PA 3N6LA 5KT5A 3QJLA 4R5PA 3JTPA 2GO9A 2PN6A 3ELHA 3BGLA 3US5A 1WC6A 2YQ3A 4C3KA 3DYAB 2V6AA 1Y11A 5B0CA 3OLBA 4NMXA 2JJ4D 1RAAB 2E7VA 3AH6A 2CQBA 5K8MA 3B54A 3C16B 4XDCA 4DI6A 2F63A 5IT9Y 1WC5A 2H54B 4X62F 3GFHA 2IAJB 3NGUA 3M6XA 4X64F 1LXNA 4P10A 3B82A 5D4LA 3PYEA 4ZVEA 4RNHA 2N7YA 2M7SA 2VQEF 2F40A 2HVHA 3M9NB 4X62J 2ZOMA 1WC4A 1Q16B 5HBMB 1PCAA 4X64J 4PG4A 4PUOA 2FVQA 3WBZA 2HBYB 3MR5A 1YJRA 2JLEA 1FFSB 2HHUA 3KHGA 1UFLA 2VQEJ 4ZK7M 2B9XA 4HACA 4ZN1A 1CJVB 3RB6A 1FDAA 2I38A 4NCGB 4N41A 3CTRA 1OSCA 3N79A 3KLIA 1KFDA 4CLSA 1U0HA 2VOPA 4PG8A 1HNXF 4A8OA 1MMDA 2GMJA 1TL3B 1UETA 3LA0A 2O3DA 2IA6A 1IUJA 2Q6CA 1N4LA 3KHHA 4PR6A 4UOGA 5KG7A 3SQOP 2A2CA 5J1EB 3AA9A 2VFVA 5HVGA 1HNXJ 2LQ9A 3H42A 4LRBA 1X31C 3K57A 2CZVC 3UD5A 1ZTTA 2QIFA 1HD0A 4OMFG 1JLGA 2FHJA 4QIWD 4ID5A 3U27A 4F0KA 2W2MP 3CJ8A 4L3NA 4KGVB 3I9V9 4UY85 2L08A 3D67A 1DY3A 4Y6IA 4AXJA 2DXFA 3F41A 3J7A1 3PEHA 4OYPA 3MEDA 3PKMA 3D5MA 2ZH3A 2ASJA 1JJCB 2QL7B 5D15A 1CJUA 2V34A 1FDDA 2GQCA 1X4EA 4W98A 1FRMA 2ZHOA 3HXMA 2JWNA 4QWEA 3CCRS 3EE3A 2ZBCA 1FNXH 2YXLA 3CMAS 1OY9A 1PO6A 2CVEA 3MEEB 1T9UA 1RWXB 4NA2A 3W2WB 1TKZB 3CF5Q 1NSAA 3D1HA 4IO9Q 4JV0A 3U7JA 1FJ7A 1VRQC 2DH7A 3ILJA 3VAMA 1X4AA 4H4MA 3AOAA 2G0JA 2HBQB 1AW0A 1N56A 2G1HA 2YNGA 1G1XA 3OHAA 1RT2A 3LALA 3B4DA 2FUG9 4PG6A 3THVA 4P7VA 4ELUA 3NAIA 1K44A 1NJWA 4K4SA 1JLBB 1NCLA 3IC1A 3R97A 1N5VA 1RT5B 2HK3A 2XMVA 3KHRA 4A8FA 1TKDA 4HHUA 3I32A 3TVZA 4JI5F 4I6AA 2DNGA 3JS9A 4IG3B 5IOLA 4K4TA 2FGOA 4HHHA 4RX6A 3C6UA 3QYYA 2EBGA 4FNHA 2HRTA 3C66A 4LVNP 3H5UA 4C7QA 3VVTA 1U1QA 2ZE2B 1P9QC 2DGUA 4JI5J 5CAAA 1BUXA 3ITHB 1XR6A 1XNQF 2DNYA 5FDLA 2OELA 1AUDA 2VBYA 4O3QA 1PYSB 4DPYA 5AJ3F 2JEFA 4DFMA 2KRRA 2KXNB 2XYHB 2K1RA 3GE9A 2A18A 2YWEA 2W7PA 4HH0A 3BDEA 3T5LA 2GAHC 2HLUA 4IQMA 3A8KA 5MAOA 1XNQJ 2V4JA 1UA0A 4IR1A 1M5PC 1IBKF 3KJFB 4PXBA 5AJ3J 5GMKa 1Y3KA 1HFEL 3CDWA 3MMAA 3T6JA 1LEOA 4NLVA 3HVAA 3M8YA 2GJFA 2F1FA 1EKSA 3IP0A 3TA0A 4M5HA 3AD9C 4KE5A 1IBKJ 1TL7B 2AQ4A 2YQ0A 4OYMA 1UEVA 2AEFA 2XMTA 2JEJA 2GS8A 4X65J 3TOQA 3M8RA 3TUPA 2V67A 4OI2A 5GADU 1RXOB 1YJVA 3GONA 1LWFA 1R3NA 4EO8A 3PW7A 3C46A 4OYIA 4F0MA 4PUOB 5A2QU 5G4DA 1RYRA 4YY3F 1I3OB 3QIPA 2HFOA 4WKRA 4HKQA 4AL5A 4ES1A 1V3RA 2Y8WA 1CSJA 3MF5A 2FJDB 1UMJA 1KBRA 1NEEA 1U47A 2HHQA 4YY3J 3A3PB 2RSQA 1U0HB 5ETSA 1TTHB 2VFTA 5IT4A 2XM3A 3ADAC 3FZBA 2J6SA 2V68A 3DRXA 1SB6A 2N4CA 1YJWS 2KN4A 1S6PB 2VG6A 4RUBA 1WG4A 3OBIA 4XAKA 1QVFR 1MG7A 2W9AA 1Q8IA 1HWJA 3KK1A 1BE4A 1XMQF 1F5BA 2VBXA 1LQ9A 2XMUA 2QLFB 3G8TA 1RACB 2OMOA 2J7WA 2XTJP 2AT1B 3EXYA 4X4OA 2IVYA 4NLDA 1Z2ZA 1NPKA 1RWOB 3THPA 4ID5B 1Y5NB 4FXDA 4HH1A 1XMQJ 1UJ6A 1M90T 2DNNA 2V4RA 1NK7A 1HD1A 5GMEA 2OFHX 1GH8A 1N48A 4HHJA 1ULRA 2OIHA 1HL6A 3MEDB 2DEJA 2HAIA 3CCUS 5HMWA 4K4WA 4JUZA 1CJUB 4ZDNA 3D9BA 2E66A 2BJ7A 2FTRA 3ICLA 1ZM4A 1S6OA 2HW3A 2KYZA 3KLGA 2HNDB 1IJFB 5J1PA 1SBRA 1QAYA 4YR3A 2E7XA 4OHZA 2QGFB 2LYVA 2CVIA 3LWMA 2F8MA 2V9WA 1CC7A 3M2RA 1FXRA 1EP4B 1S4FA 4H4MB 1DHMA 5DGAA 1HBOA 4ZJQA 1U25A 3X1LB 1D9FA 3J7YI 1WUUA 4F2SA 2YNGB 1RT2B 2XBPA 3HSGA 4J9UE 2YPYA 1I94F 1S0VA 1AXQA 1N8RT 1BGXT 1JWWA 3D0IE 4I6WA 2XY5A 2HHWA 3PKYA 5K14A 1UEKA 2ATLA 1EHWA 4FYYB 2CQGA 1IQZA 5KFDA 5KFJA 2XYPB 2DNQA 1ZZFA 2HQFA 2H4YB 1CULA 2IM0A 2XGQA 1YG0A 1KC8T 1I94J 3PHTA 2RD5C 1DAXA 4DQRA 4FYWB 2OGUA 1QAIA 2K7KA 3DOMB 1WF2A 4HI1A 2IMOA 4PWWA 4GC6A 1AZSA 2R3VA 1OPZA 5B0EA 1RHMB 2RB7A 4B02A 2RH3A 4AQYF 1S97A 1RT1B 4CNYA 2IA0A 1WF0A 1AROP 3RW6A 1VRUA 4DUYF 2XO7A 5L9XA 4USVA 2QT7A 1Z1ZA 5FDLB 2L9DA 2G0IA 2HMIB 4CLKA 1RAJA 3I0SA 1VQNS 2ZNZA 4KH0B 1REVA 4AQYJ 1YBTA 5A6WA 2BOPA 3UDLA 4AXIA 4DUYJ 2R7RA 4JI8F 3JSMB 4Y34A 2JFDA 1NHKL 4B9TA 1B0VA 3CCSS 3BSCA 3OFHA 3MMAB 1U09A 4I4BA 3DLGA 1GQEA 3TQEA 2ZM6F 1RWMB 1ZBTA 5AE3A 1S72S 4XIUA 3DLBA 3DXSX 3OR2A 3I87A 4JI8J 2KH9A 3WZ0A 1UVIA 1YRXA 1R8CA 2CRLA 5AXKA 2ZM6J 3K5PA 4ENOA 2CUYA 4TKTA 4FF2A 1T3OA 3H59A 2IPOB 1NKCA 2L9NA 3K89A 2DGOA 3F44A 1VK8A 1BD6A 1IJEB 3JYTA 1QVGR 5IQQA 5L39A 1LWFB 3RB3A 3CC2S 3W8PA 4RWWA 1VGYA 3EICA 5K20B 3BGRA 2F9JA 4QW9A 2AGOA 3QIPB 1S9EA 4OZ3A 4WF9Q 3MR7A 1N6QA 3LUYA 5F8IA 3C6TA 3M6WA 1MW7A 3NGTA 2LEBA 4OL8A 4R8UB 5KT2A 3UWTA 4ZOSA 3TZZA 1RYSA 2W4CA 1K9MT 5IFMA 3NNHA 3CCJS 2Y1IA 4TY8A 1V9OA 3HX9A 3LWLA 3D6FB 3D3CJ 3KK1B 1DRZA 5KFOA 4NCAA 4MAKA 4CLZA 1FTCA 1GMWD 2BA9A 3PYDA 2HNZB 1U1LA 5HMXA 2J8SA 2FVRA 2ZOGA 1Y7PA 2VOOA 1NDCA 2AJQA 5E3CA 5M2RA 2Z2ZA 4N76A 5F8JA 3K5OA 4KRWA 3D0HE 2LXFA 4C0HA 4DS4A 2NYHA 2YNHA 1YZ6A 2PA8D 3M2UB 2DPIA 1L3KA 4O0IA 4HT5A 1TV6A 2CQPA 3ENWA 2O66A 3CIMA 1JLQA 2AZ1A 1H2UX 1TMJA 1EKRA 4I64A 5D78A 2BOAA 2O5DA 2W9CA 4OZ2A 3BH6B 4DQQA 1JNRB 3AODA 1YJUA 3SCKE 1N5YB 1C0UA 4DQSA 3NRBA 5HATA 2XHWA 5AT1B 4DJBA 2BM0A 3ZC4A 3J7YU 2EI5A 1IR0A 2RQCA 3DGPA 4CYUA 1R6VA 3DRSA 3BQ0A 2OPRA 2QA4S 3M2RB 3CJKB 1FJEB 1S1UA 2CDRB 4KHRA 1OQ3A 1F5CA 3H90A 4DU8A 2QLXA 1HBOB 2MHNA 3R5AA 4TYBA 2NPIA 3TEGA 2BBEA 2H5IB 4I56A 2ZH2A 3JAMY 1LWCA 2LDYA 2FZCB 3RRGA 5K14B 2QSWA 2SXLA 3G96A 4FN5A 2H65B 1CULB 5DDRC 3RTVA 2GQQA 2DISA 3MOZA 5HQLA 3PM9A 4K2XA 3H2LA 4KYZA 2V2ZA 4NLQA 5KFMA 3NP5A 2DCLA 2FHKA 1AZSB 4X4RA 1RKIA 1FX2A 2YKOA 3TJ9A 1NZ8A 1X0PA 1JLCB 4KGZB 2KI2A 3C2PA 3EJMA 1UW4A 4ZCMA 3NEKA 3I0RA 1FEEA 1LW2A 1WOPA 1B0PA 4YHHF 2F4VF 1J2VA 4NLXA 4RNOA 3I0SB 1QSSA 4LF1A 2HZVA 1M5KC 2X3DA 5L1IA 1RHQB 1U02A 1REVB 2NSCA 2H5JB 1FRXA 3OVBA 2JVOA 1AFIA 2J0XA 4YHHJ 2F4VJ 1RWNB 3DDKA 3CUNA 5D4OA 3GV5B 3W63A 1X4FA 1PBAA 2ABYA 1NRKA 2EC0A 3E2EA 3P96A 2M5YA 3T5JA 3GG1A 3DNCA 4ZP8A 4ZPTR 4DPOA 1FNMA 4HLBA 1JKHA 4B3OA 3KK2A 4MKAA 2DGWA 2R2TA 4G65A 1DQ8A 5K8NA 2W8LA 1CJKA 2ZDOA 5HAOA 3NOGA 4JB8B 4TU8A 3JYTB 4CTAA 3EZUA 1Q81T 4J91A 1HHSA 3TRGA 1JJ2R 2YVSA 3BGRB 3M1VA 2E1CA 5KG5A 3V6DA 2GGPA 2UU9F 4F04B 3IM9A 1S9EB 3GPAA 4OHYA 1N6QB 2I1RA 4M95A 3C6TB 1L3SA 3IBCB 2B7BB 4RWXA 4HL9A 2AX1A 2I5JB 5IZHA 2UU9J 4ZVFA 3CJTA 1ZZNA 3RAXA 1VS3A 4WFXA 4KT0C 4QPTA 4M5MA 5F9NA 3MFHA 1RTHA 2X51A 5IT9U 2XLKA 2J9DE 4DF8A 2DHHA 1RT3A 2VV5A 4NRTA 4TY8B 4NLWA 2UUTA 1JJHA 2CJXB 4CO4A 1KVIA 3CCWA 1KLMA 3R5DA 3F0NA 1NH8A 4U7UK 3A8IA 1N88A 1UVNA 5HVHA 1Q1KA 2YBVA 2OLWA 4OX7A 1LKZA 2N3LA 2I0XA 3N9UC 4C8KA 4WFAQ 4WFZA 4MKYA 1FRJA 1OY8A 3C14B 4WPAA 4NZ7A 1S4EA 5HMZA 4BCAA 2YNHB 2ZH7A 2W8KA 2GZOA 2CJAA 5H9EJ 3MAAB 3UQSA 1UZHA 2OPQA 2XNRA 1KONA 1VQLS 2VPZB 3KLVA 1TV6B 4JI4F 4U8VA 1HR0F 2CQ4A 1WKKA 3IRXA 1K1QA 3GIRA 1YJ7A 4YR0A 3HZGA 4ED0A 2VKRA 3DRPA 2W9CB 4DV1F 2RS2A 3BS9A 3GIMA 1XR5A 2K2PA 3BV8A 5HJXA 1Q4RA 5T14A 1BWEA 4PYDA 1X5TA 3PCOB 4JI4J 1HR0J 1C0UB 2FLPA 2E5LF 3ZTQA 3FJ2A 1T05B 5L1KA 2RHQB 1RU1A 2DR5A 4EO6A 2Z30B 4DV1J 2CKWA 1JX4A 4XDDA 1L3TA 3HDSA 2MB0B 2VL1A 2VUGA 4CYUB 3DRSB 2HZAA 1H6KX 3A3OB 1H2TZ 2VU5A 2H48B 2E5LJ 1RWUA 1ZM2A 3DMJA 5L1LA 2QLWA 3UFCX 4F0HA 8AT1B 4HVZA 4DR7J 4IRKA 3J80Y 3VGUA 4WJBA 1FHTA 4JI2F 1KVKA 2WVDA 4PCQA 1BY9A 4B9UA 5GAGI 3OXLA 1VBXA 3BZQA 5DLFA 1SUQB 2AMCB 3HFVA 3P5BP 1HWUA 4ZPVR 1RCXB 4ED5A 4JI2J 2QMWA 3T5KA 4ZJOA 3H0PA 4HYKA 4K5SA 2C3PA 1TR0A 1RHKB 2EG1A 1VHIA 2AW0A 3POTA 2R4FA 3BQ2A 4Y0FA 3G82B 4HDHA 2DEIA 3QIDA 4Q43A 4IFVA 1U1MA 4JYAF 2CPEA 3K0JA 3J7AN 2LQ8A 3VGVA 1KKHA 2B0GA 4DPUA 4OZLA 1JIHA 1S0MA 2JLGA 2DD8S 3IRWP 3KLFA 2B9WA 4JYAJ 2VPWB 2LP4A 2UV8A 2PO4A 2Y0BB 1FDNA 4GMKA 1X8DA 3RRHA 2P8IA 4BC9A 4OYAA 4LVOP 1M1KT 4B9NA 2L41A 5E3RA 3PR5B 1NH7A 5E2QA 2AF6A 5HROA 1UPMB 2BZ2A 1RA6A 4HEA9 2XZDB 3ZZUA 2R8IA 1M1GA 1QUVA 2HQGA 2R7OA 5F41A 1JKHB 4CM0A 4B3OB 2J0WA 4ED7A 2AGPA 2NREA 1WDTA 1FVQA 1RAFB 1PYTA 2W2PP 1JXVA 4OYZA 4ANCA 2PIIA 2LU1A 2FJBB 3BO4A 3BDPA 2E9ZA 3HHLC 4LRCA 2PA3A 5AE2A 2P5VA 2M8HA 4F7VA 2HGNA 4V19J 3FUYA 1RTDA 2Z2LA 3V6DB 2GJ2A 1IKWB 1BQXA 3BSOA 4EK2A 3HJFA 2B5JA 3TYTA 4QR0A 1SKSA 3CJRA 2FHJD 1NK4A 3N01A 4B9VA 4AT1B 3MM7A 1C0TB 4G1IA 3TAQA 4U96A 3T1YF 3MUTP 4DZDA 2I9SA 2VC1A 4QZVB 3QRPA 5KFBA 4ZVOB 1JJ4A 2XWYA 3EM1A 3BGFA 3ZZPA 5LXRA 2WHOA 3Q0AA 2M3DA 3T1YJ 1Q8BA 3FRYA 1QJHA 2IVFB 1KLMB 3OXFA 4NL5A 5I4MA 1UP1A 4E2FB 1AA1B 2DNPA 4KGMA 1BLUA 1TQLA 2Z57B 3EPGA 3TW0A 1QTNB 2IYGA 2DNOA 3OTDA 4W4MA 4J9KA 4GRSA 3NLCA 3HT0A 1U2RA 4CCHA 4DV2F 2CJ9A 4QCLA 1SIZA 2G1DA 1DTTB 4OJGA 1IBMF 3V4MA 4QWAA 4WE1B 3D28A 4QR2A 4Y2CA 1DQAA 5F3ZA 3D6MB 3PW2A 1KQSR 4DV2J 5FD1A 1SV5A 4UQGA 1Y5IB 4MIBA 4M5LA 1IBMJ 1BMQB 2H5EA 2CQ0A 2J9DA 5KTQA 1U24A 3PJXA 1HQEA 3KUGA 3CNQP 2R7XA 1O8BA 4C11A 3LAKA 2MTLA 2MKJA 3RGIA 9RUBA 3CMQA 3ISZA 2RU3A 2P9CA 5L8RC 3DMJB 4C4WA 3MCOA 4DG1A 2DHSA 3BN7A 5C24A 4IYQA 3IO1A 4CRJA 4YB6A 4WKYA 5CYQB 3BPDA 2VJUA 1VR6A 2IVMA 3KJQB 4ECVA 1HNZF 2E5GA 2DO0A 2YNFB 2UUBF 1MNEA 4NPOA 1XERA 3W65A 4RNFA 2BW2A 3V6KA 4I7FA 2YKNA 3RBEA 3MFIA 4L72B 2IJNA 1Y00A 4E98A 1NPPA 2FZGB 1ZTWA 4LF4F 4OZJA 1HNZJ 1C4CA 4CZCA 1VQ6S 2E7WA 3OQ2A 4KGKA 1F9FA 4DL6A 2VASA 4EZ9A 3CO9A 3IBWA 4Y65A 4KSEB 2GVZB 3QJPA 5JVHQ 3AB4B 4IH7A 4RU9A 4LF4J 4IFVB 3GCXP 1RTZA 5HVFA 3AQPA 3CCLS 3GR0A 3MM6A 1RAIB 3WDOA 3AJ2A 3B78A 2DIUA 3PG9A 2CJKA 1Q5YA 5EX0A 4IG0A 2CG4A 3H7HB 1YHQS 4C6AA 4K50A 2DRDA 1M5VC 1YI2S 4AL6A 2C2DA 2F8EX 3QFWA 2HVEA 4H4KA 3KLHA 1TMMA 4DR1F 1PAEX 1S6QB 4CLWA 1S1WA 5LJ5Y 3V4IA 4URSA 1JNZB 2BYCA 4KKOA 3NOCA 2KFZA 4A4JA 2AX0A 4NA1A 2UVVA 1G3OA 3GB0A 2F8HA 4DQIA 4DR1J 1T11A 3FZ2A 4MFBA 1U48A 4RW7B 3NS5A 4DSFA 2RRNA 3CMES 1D9DA 4I2QA 2DKOB 4EGLA 5KFSA 4DL0C 3VR1A 4Y2MA 1RTDB 4K0KF 2FVSA 1SJ3P 2HIQA 5THWA 2LXUA 3I4PA 1V3ZA 4NLYA 4M5IA 3LO3A 5F8MA 3SCIE 3MM7B 3OR1B 5DM7Q 5BR8F 2DVIA 1APSA 1LXJA 3SSQA 3H5XA 4K0KJ 3BQ1A 2Z2YB 3OSPA 2K8GA 4WP8A 2EFOA 2VC0A 5C2GA 3MURP 1FKOA 3HULA 4I68A 3LGHA 4JP8A 1YK9A 2AJ1A 3W5XA 1YITS 3GP9A 3DRRA 2VB6A 3UNGC 5BR8J 5I3QA 5EDWA 2V50A 3B8HA 3BF4A 1KHWA 4DDFA 1RQ0A 1E6YA 4KO0A 1Q86T 3U02A 2DHXA 3L4BC 2XSJA 2V69A 3A4TA 2NXNA 4JI0F 5F8HA 5KFZA 4DCPB 3IR6B 2E5IA 3QZ7A 2DYAA 2XWXA 4WU2A 2DNLA 3N4WA 2JC1A 5A0YA 2QA2A 3QO9A 5IXUA 3BR9A 5D0GA 5DM6Q 1RDRA 5C25A 4FDFA 3HO1A 4JI0J 3I31A 3MR6A 4P7TA 5CXTA 3HFKA 3PNIA 1LWXA 3QGGA 4QWBA 3W8GA 5LSOA 1SV5B 2M0GB 2I2YA 2Q43A 5DDPC 3FBCA 1S6UA 3T6BA 1NUEA 4TU9A 2B9EA 2L3MA 2HFNA 4E0DA 1OY6A 2RKIA 2I8EA 1V3SA 1RJJA 1XEZA 1F9HA 4C11B 1X5OA 5KAKA 1VQPS 3HJVA 2ATCB 1ZAWA 3CE8A 5KFHA 3ISND 3SV4A 1PJ5A 3QZ8A 3I4HX 3DM2B 3O1LA 4NLGA 3NMRA 1UPPA 4CI0B 3FRZA 3DU6A 2FLLA 1L3UA 1P8GA 3NAHA 1VC6A 3Q8RB 5C24B 1ZA2B 1UAWA 2QA4G 2E1MC 5BYSA 2DGSA 3LW5C 4NLOA 1T95A 2LMIA 1W7WA 2R2SA 2J8AA 3L9ZA 2YKNB 1T8EA 2XHCA 3OJSA 3IBFB 2GFFA 2OPSA 2ASDA 2IHR1 4FKXA 4E8UA 1NHUA 2HS4A 2IDEA 3M8PB 1RISA 3DKDA 5G0RB 2XS5A 5B09A 4S0MA 2P9GA 2FJEB 1J5OB 5IS2A 2AJ4A 2ZWOA 3CXCR 3MHYA 1RAHB 1J5EF 3CIZA 1HPZB 3JAMU 3ETMA 2ROGA 3D1OA 2KB2A 2DY9A 5ETTA 4NASA 2QG9B 1XQIA 2ZH8A 2VG7A 3Q8UA 3AT1B 2QC3A 4RBVA 3CD5A 1TKXA 2BUNA 1SJFA 3BBFA 1BHNA 1EARA 2IRYA 3QT6A 2CPXA 8RUCA 3VHQA 2MQ8A 4CLYA 4CLTA 4U7UD 3KLHB 4PZVA 4ETXA 3LF0A 4HTJA 1C1CB 4P74A 1S1WB 3P3DA 4N8OA 5JXSA 1EQ0A 3V4IB 2GIQA 3PO4A 4KKOB 3HD1A 2FC9A 2PT0A 1ZYQA 3FSIA 3DOKA 4WFBQ 2KKHA 4EUVA 4MFBB 4RO0A 1S1XA 2FIUA 3DDNA 3KFWX 4LBPA 5KFGA 1FK9A 4DR6F 2XS2A 3JXOA 3WHIA 2CQCA 4I2QB 3WX4A 2WOMA 2J0QD 5CYMB 1EJ7L 2EK1A 1VIOA 5L1JA 4J9NA 4XK8C 3NXZA 4DR6J 3CD7A 2A6OA 2ZH9A 4KHMA 2JZ5A 3HT3A 5DQGA 1R0AA 4ALZA 5KOXA 1F0XA 5ITHA 3K7RA 2BJ9A 3ENQA 2KTQA 2GV1A 3QMQA 1QDUB 3GR1A 3ZTSA 2BE7D 2GA7A 3QSYB 3DLEA 1IWAA 4UTGA 3ZNJ1 3W5ZA 5DETA 4ITSA 2VQFF 3DRRB 5HK4A 2JLFA 2OP5A 1HQUA 2NXEA 2WVEA 1KN6A 4DV3F 2EWHA 2XZTB 1F9EB 2QYGA 1MN7A 1WTFA 1E6YB 1WEZA 1FWKA 4QWDA 4CLFA 1RTJA 2XSJB 1HWIA 4DFPA 5A8KA 2VQFJ 5A8WA 4FS2A 4JV2A 1S1VB 1FF2A 4LF8F 2JL9A 2V94A 4DV3J 4F02A 4KFBA 1WOSA 1TFYA 5GAEI 4IFYA 1URRA 3LQVA 4USWA 2C2RA 3UCZP 2D41A 3W9HA 3QO9B 2NQPA 5C25B 4LF8J 4R0EA 2RE1A 1T03A 1LK7A 1CBKA 4ZVHA 3ZTOA 1FA0A 4WFNQ 2F7VA 3M9MB 2GAGC 1G7CB 2BJ1A 4EWTA 1A6LA 2RHSB 3HP6A 5SZTA 1RI7A 5M2PA 2CPFA 2RKIB 4N47A 3I5AA 2MYFA 1EX8A 3HHNB 4MIAA 1WC3A 3KNGA 4DS5A 3O5TB 4DZ6A 3TVKA 3HLUA 4H4OA 4IKAA 4IH5A 2MLZA 3VF0B 4CQ1A 5CD4A 3H20A 1ITPA 1KHVA 3LGMA 4URGA 1HHQA 3PHEA 4KPYA 2Z56B 1YGYA 4WU3A 2ZHBA 2QFJA 5KT7A 4OI4A 2CAJA 3DOLA 3O6QA 5B0DA 4J9SA 5K5MA 2P2CB 1RWVB 3GFXA 4RNNA 1U2FA 3FEYB 2W7OA 1WEYA 1JB0C 4GO5X 2OEKA 3QGIA 5LM7E 2FD2A 4B3RF 2COLA 5IC6B 2LQBA 2HHXA 2GC8A 4W90B 2GCFA 2BKOA 1J27A 4LF9F 4HI2A 1FKPA 2DK2A 4ED6A 2KJVA 1HBNA 1LW0A 4ECTA 2QLBB 3GJQB 1VQSA 4B3RJ 3J80U 1VQ8S 1VQKS 3OTCA 4RNMA 4NEYA 4C0BA 1SL2A 5DJBA 4HDGA 3DLLQ 2ZZNA 4LF9J 3TUZC 1TKXB 3MEGA 5HANA 4OYWA 2KXFA 1KTVA 1Q0NA 3PX6A 3SBMA 2Q79A 2OEJA 2VF3A 1RT4B 7FD1A 4ZMMA 4M5GA 4CLLA 1SQGA 1K8AT 3IR7B 1LFWA 1Y0HA 2CIMA 2W4PA 4MYTA 2DHAA 3C15A 1WORA 2HKEA 2KFYA 4LSLB 3QRRA 4ES3A 3JQJA 1X9MA 2KT5A 2B6AA 4U9RA 5DDQC 1SKUB 3DOKB 3LP0B 1R8AA 3MDFA 1X7VA 2J76E 4ZHRA 2EFVA 2M8DB 3OFFA 2PI5A 1S1XB 3ETOA 3G6YA 2HQ3A 3WC0A 4ECQA 1QM9A 4LBIA 2KZZA 2WOMB 3C8YA 1IM4A 3V81A 3BN4A 3Q8YA 3Q8PB 1NBEB 1K0TA 2DH8A 3ONQA 4C0OC 4IOBA 2K3KA 1OO0B 4CO2A 4DUTA 2XSFA 2HURA 4K7QA 4QR1A 3L7OA 4ECSA 1RSCA 3MEKA 1R0AB 1SC6A 3J81j 2XQCA 1O0PA 3TUJC 3CWJA 4OHWA 2EVZA 1RAOA 3DLEB 1N36F 2IBOA 4FF4A 3DHWC 3LP2A 3UR0A 4X4TA 1UWAA 1NDKA 1OS5A 6FDRA 1WI8A 3VAHA 1XTZA 4PQAA 2JSXA 1HQUB 1FJGF 2HFUA 1N36J 2CPJA 4IUFA 1YTYA 2A0FB 5K8PA 1D3WA 3NGSA 1X5SA 2IRUA 3MTKA 3IR5B 4PEOA 5GAEU 5ETRA 2AD9A 3T9NA 5F8GA 5LT5A 1RTJB 4RBUA 1XIQA 1YRUA 4F4KA 1FJGJ 2CQHA 1F5AA 3HK2A 2ZNYA 1D8YA 4KFBB 3H25A 4B08A 2CQDA 2KDOA 1K47A 1B3TA 2Z58B 3Q8SB 2R2RA 2IM2A 3VAKA 2ACYA 1FKAF 3MAHA 4GKJF 4USHA 1IKVA 1T03B 3M8QA 1FTRA 3F56A 2ALZA 1TK5A 5LXYA 2O01C 2QN6B 4DV4F 3ULHA 3M2VB 2W7AA 5EUHA 1YJNS 3RRKA 4ECZA 3MECA 4ED1A 3AHPA 1FCAA 2HSEB 3TA1A 2QO3A 2Z8QA 4GKJJ 4FYXB 4WBFA 3T19A 5GAHI 1OIAA 4WXOA 3TI0A 3HM9A 1RLDA 2VICA 3OL9A 4URQU 4DV4J 4LF5F 1Q7YT 2WBRA 3Q89A 3VZHA 1WC0A 3RBDA 5D4PA 4LREA 4L75A 1U1NA 4CT9A 4A48A 1A9NB 2DNKA 4A8WA 4PWDB 3GYNA 1FWPA 3U1LA 3V5RA 4LF5J 1HNWF 2WK4A 4J9RA 2PFFB 4XPEA 3IWLA 3OD2A 4ZVUB 2X1BA 4EFAC 1WELA 4CO3A 1VBYA 5FLXY 4NEZA 3G8SA 4OX8A 3QT5A 3KOAA 1Y5LB 3PRDA 2RVJA 1UW9A 1WOOA 2G9OA 3H5YA 1JXEA 4KIAA 1TKTB 1RBAA 1HNWJ 3RW7A 1GK8A 3SQGA 6FD1A 2ILZA 3DOLB 3D54A 2A10A 1VC0A 4TU7A 4NRUA 5ETKA 1R31A 2CFXA 4NLUA 3SEOA 1XBWA 4FVMA 1TL1B 3E51A 3AFGA 1RKJA 3QJJA 4RZRA 1GT8A 3NMAA 2DY1A 2ZZTA 3OT9A 4BC7A 4RW4A 3D4JA 4NWBA 4USUA 3B4MA 4F3MA 1TAUA 5KFLA 3M4XA 2IM1A 1T9TA 2KG0A 1VQYA 1Q79A 2M52A 4LRDA 1VJQA 1F2GA 1FKPB 4I1TA 1HBNB 1LW0B 1RK8A 2YX4A 1NNDA 2Q6BA 1ROFA 3DCAA 5CCLA 2VFRA 4ZLNA 1FWLA 2PGCA 4C8OA 4Q0BA 4R0JA 2W4DA 3GV8B 2M70A 2NSBA 1YX2A 3MEGB 4FXVA 4WK1A 1N5TA 2HFSA 4B17A 2APOA 4LQ9A 1S48A 3FFIA 4EI2A 4ES2A 3DLHA 3M8ZA 4A8MP 1LWEA 3ZZTA 1LV5A 1VC5A 3C15B 5B7WA 1NJXA 4LRFA 1U4BA 5DDOC 1KQKA 3E01A 4FBTA 2A2DA 3UNYA 1N52B 4BS2A 4R5PB 4D3HA 5LL6d 1UWBA 4X65F 4ZHRB 2YWKA 3ZTRA 2PDAA 3AOBA 3ZNUA 3L7UA 4ED8A 3Q23A 1VI7A 2RDJA 3KG1A 3V81B 1KLNA 2RU9A 4ECYA 4PPDA 1NJYA 4YS2A 1PAUB 7AT1B 1PC5A 2HBRB 3BREA 5EWGA 3VAJA 1N54B 4F26A 3K17A 3PY8A 2JEGA 2YKMA 2NS1B 3Q2SC 1VYAA 1SQEA 2DR8A 4J9LA 4ETZA 4I0WA 1YJTA 4D3GA 1F3FA 1KVJA 2WAQD 3JSYA 2AP6A 4ILRA 4AYBD 4ZS6A 5AXNA 4B9LA 5I42A 2MY8A 1RHRB 3LP2B 4FP9A 1VISA 4A47A 1WJ9A 2RF2A 4HACB 4WP3A 1IBLF 2XY6A 1EIYB 4DL2A 4MJKA 4MK8A 1E6VA 3V6JA 2AYGA 3EZ5A 3BGUA 5F8NA 3U1NA 2UVUA 4ZLJA 3M7VA 3KLIB 2QMXA 2CNOB 2R7SA 4I2PA 4KH1B 2IJRA 1IBLJ 3S7RA 1S49A 4K8RA 5KFCA 1GXLA 3RB0A 4FYDA 1X60A 3HFZB 1ZM3A 3PW4A 1SL0A 1IKYA 2GX8A 1ZPVA 3FDSA 1FE4A 3DFEA 3SXLA 4K59A 2DPJA 2RQ4A 3AD7C 2MQOA 4X4QA 5M2UA 2OTJS 1HBMA 5EWEA 3KYLA 1YBUA 1BQMA 1IKVB 3M8QB 2Y1LB 1JLGB 2BM1A 3CJ0A 4PKDB 3RAMA 5GAHU 2BKNA 4KGXB 4A8YA 4L3KA 4DR3F 3OFGA 4PXDA 5B0BA 3ET6A 5KFPA 1F60B 3MECB 2DXDA 4NLPA 2JH3A 1IWGA 3QT7A 3GYGA 2J5AA 5IQ6A 1S5ZA 3SV3A 1X4DA 2HRYA 2YH0A 3IAM9 5ETMA 4DR3J 1C1BA 5DZ7A 3TQ1A 3W2VA 3D6HB 2W9BA 1UJ5A 4U95A 2HEKA 1VLOA 1SQFA 5K9FA 4OZ1A 2LEAA 4Z7CA 2B7CB 3TA2A 3Q83A 1VMBA 3FCWA 1U0SA 3VAIA 1GX6A 2DHGA 3U1MA 1NJZA 4F4AA 2DGQA 3CJ5A 4ZJLA 4C8MA 4DLGA 5HQMA 2GHVC 4ZPDA 4BDPA 1NK5A 3R5BA 2NPFA 2HS3A 1NPRA 5HQ8A 3IGVA 1TVRA 3FSYA 3TAPA 1BC6A 3DDIA 1BQNA 1QTMA 2NYIA 3M30A 4PABA 4P2SA 3GSIA 3MMBA 3N28A 2RS8A 5HSPA 1YWXA 2CWXA 2UUWA 4J7CA 2GIRA 3IG1A 3BO2A 2HNYA 3GTYX 2UP1A 2OPPA 1URNA 5HLFA 3BO3A 4RW4B 2IY5B 4UUXA 1SJ4P 4DPTA 2MGZA 1KS2A 1MROA 1RHUB 1S76D 4JBCA 4V19X 1HBUA 5GMDA 1R7IA 2P9EA 2ZH4A 3H5SA 5LOQA 3C6UB 5KFYA 1NB7A 1ACMB 1ELOA 3DYAA 2VJVA 3HVRA 4QOTA 5HP1A 4KBIA 3C16A 1K73T 1R89A 3CDEA 2OEMA 1DTQA 4YMEA 4U8YA 3DC2A 4Q0BB 2MHEA 2IAJA 2MJUA 1X4BA 3FBBA 3N5FA 5HN0A 4JV1A 4C8NA 4M5DA 2F4FA 3ZZYA 2K1RB 4F4WA 3BYRA 1B70B 1LWEB 5HBMA 2WVFA 4QQBA 5CHCB 1D8ZA 3EYZA 3MPYA 2V4JB 3E01B 3PZPA 1R27B 1NMEB 1WC1A 3GFZA 3G2XA 4DU7A 1UWBB 1SIWB 1S10A 4FXWA 2WZ1A 2CWKA 1WD6A 3W1YC 2FLOA 2HGLA 4NCGA 2NXJA 4AUKA 1T94A 1MWYA 1NLKL 2MZQA 1ICEB 2ROPA 5JUMA 1R8HA 4NYPA 4Y28C 3UD3P 3AJDA 3K8VA 1WG5A 3UDCA 1D1UA 3CJ4A 1HMVA 2AIRB 4F2RA 2MZRA 1KQGB 4ZVSB 1Q82T 1DBDA 2YKMB 2JX2A 2WTFA 1M1HA 2HIYA 1NK6A 2C3YA 3LTOA 3D0GE 2V8HA 3ZZ0A 2XYGB 5I42B 4X4SA 4I6YA 2UVWA 3DXBA 2FVPA 3CJQA 3J7ZT 2XNQA 5ADZA 1AYEA 1FO1A 1HARA 3D3BJ 5LMNF 1GMUA 3TNVA 2RF2B 4DV5F 4PXEA 5KFQA 2BRLA 1FERA 3OVAA 4DPWA 3Q2TC 2E29A 3NGDA 3TZXA 1VJWA 4DL4A 2RJZA 2X3GA 4F3QA 1SI9A 2FY1A 5LMNJ 1CVJA 1IQTA 2BQRA 4DV5J
chains in the Genus database with same CATH topology
1D9DA 4I2QA 4O3QA 2FB0A 5AJ3F 3CCVS 2JEFA 4K4XA 3O44A 2OH2A 4EGLA 3HHKA 5KFSA 3JSBA 2VG6B 5CQGA 3VR1A 4DL0C 4DFMA 1S7HA 2KRRA 4Q7AA 4Y2MA 2KXNB 1RTDB 2K1RA 1RT7A 3GE9A 2A18A 2GNKA 2YWEA 3H2VE 1XC9A 2PD1A 2ZVSA 1NKEA 4DL3A 1NO8A 1WG1A 2W7PA 1NK9A 2FVSA 2JC0A 4K0KF 4ELTA 1SJ3P 4LF6F 4HH0A 3BDEA 4O3PA 3T5LA 2HIQA 2HLUA 4IQMA 1JXLA 5THWA 2LXUA 1DLOA 1FRIA 2EFPA 5MAOA 4DMZA 3I4PA 1V3ZA 2V4JA 1UA0A 4IR1A 4NLYA 2YH1A 4DSIA 3I55S 3CT9A 3LO3A 1M5PC 1FD2A 1IBKF 4PXBA 5GMKa 5F8MA 3SCIE 3W2WA 3MM7B 3OR1B 1Y3KA 1TKZA 5DM7Q 4DR4F 1HFEL 1L3VA 1BQMB 3CDWA 3MMAA 3T6JA 5L9NA 5BR8F 2OKQA 3HHLA 4NLVA 3HVAA 2L48A 3I5BA 2DVIA 2MSSA 4N77A 1APSA 1LXJA 3BB5A 3SSQA 4Y2IA 2ZD1A 1IKXA 3IS9A 3H5XA 2ZJRQ 1S0NA 3BQ1A 1H0HB 5E3AA 3OSPA 4OIXA 2K8GA 5CH7B 2EFQA 5HL7Q 2EFOA 2F1FA 2VC0A 1HI0P 3MURP 3SSSA 3TA0A 4FF1A 5KFIA 1FKOA 3M05A 4KAIA 5J2MA 1HNIA 4I68A 3RB4A 4KE5A 1S9FA 3OPKA 2GQ2A 2AJ1A 2AQ4A 4ZP7A 5T7LA 4PPZA 4B3TF 1YITS 4EU0A 1S79A 1W2BR 3DRRA 1UEVA 3DLKA 2VB6A 1LOUA 3UNGC 2XY7A 2XMTA 4USJC 5I3QA 1TL4A 5EDWA 2JEJA 3KNAA 4C97A 4OX6A 4Y2AA 3B8HA 4IRDA 3BF4A 3NNCA 1UEUA 1NJIT 1Q53A 3TOQA 1C1BB 1KHWA 4DDFA 3M8RA 3I56S 1RQ0A 1E6YA 4EBDA 1SH0A 4KO0A 1Q86T 4OI2A 3U02A 3IFEA 5GADU 4KJIA 3LANA 4MIWA 2DHXA 1YJVA 2A1BA 2G0CA 1ZH5A 1R43A 2XSJA 2R7UA 1KTQA 2HRUA 5D3GB 4IQXA 1LWFA 2WW8A 1R3NA 4EO8A 2MKHA 3DI6A 1M0SA 3KLEA 3PW7A 1CPZA 3KLGB 2RQMA 2MSTA 3C46A 2E5HA 4W92B 1P27B 4JI0F 5F8HA 2FVCA 4QIFA 5KFZA 4PUOB 4PWUA 2OPSB 4LF7F 3IR6B 2KO1A 5G4DA 2BACA 2E5IA 4YY3F 3QZ7A 1RYRA 1G2EA 2XWXA 1KFSA 2CPIA 4CH0S 1R6YA 4WU2A 2DNLA 1S6QA 3QIPA 1FRKA 1NK0A 1SKRA 2HFOA 3T5HA 4DSEA 2M88A 3N4WA 2JC1A 5A0YA 2QA2A 3K5MA 4WKRA 4HKQA 4AL5A 4ES1A 3OL7A 4OJHA 3MI7X 3QO9A 3NCQA 5IXUA 2P6TA 5BYRA 2XULA 1V3RA 1CSJA 4DL7A 3BR9A 2DGTA 2HS0A 3MF5A 3UCGA 5CZVA 2R7WA 1DURA 2FJDB 1RDRA 5DM6Q 1UMJA 5C25A 2ZZMA 3CJ2A 2E9TA 3HO1A 2MDAA 1NEEA 2XLIA 1U47A 1TVRB 2VG5A 2HHQA 2CZ4A 3I31A 3MR6A 4P7TA 5CXTA 2Z0GA 3ITHA 2RSQA 2HWIA 3NCPA 4FNIA 3HFKA 3TR5A 2LXIA 1QE1A 2KHCA 1R8PA 3PNIA 2YWGA 4OHXA 4QIVA 4RW7A 2N3OA 2W24A 2KM8C 2VFTA 5IT4A 4JI6F 2R8HA 2NZ4A 3QGGA 4QWBA 2FGCA 5LSOA 3FZBA 2J6SA 4EBEA 3DRXA 1SV5B 1SB6A 4Y3CA 4TLQA 2EKYA 2G13A 2VG7B 2M0GB 2I2YA 1QAXA 2N4CA 2Q43A 5DDPC 4WZQA 3PJWA 3IG1B 1MSWD 1YJWS 2KN4A 1S6PB 2VG6A 1S6UA 3T6BA 1SJQA 1SH3A 1WG4A 4TU9A 2L3MA 3OBIA 4XAKA 2YKQA 3F73A 1HA1A 4F4ZA 1U45A 2HFNA 4E0DA 1QVFR 2W9AA 3OXGA 2OPPB 2RKIA 2I8EA 2YKPA 1Q8IA 4ZA1A 2HPUA 1HWJA 1V3SA 1ZAVA 3KK1A 4NOHA 1RJJA 2QYCA 1XEZA 4XPCA 3FVYA 4C11B 1XMQF 1X5OA 5KAKA 4JI1F 2AWZA 3CD6S 1F5BA 2VBXA 1LQ9A 2XMUA 3MM8B 4QWCA 1MROB 4O23A 3G8TA 4LT6A 4DHVA 1VQPS 2LU2A 1PGZA 1HBUB 4J5OA 4WXWA 2OMOA 1GNKA 1ZAWA 3CE8A 3OR1A 2J7WA 3OTOF 4RW6A 5KFHA 3PX0A 3ISND 3EXYA 4X4OA 3SV4A 2IVYA 4NLDA 3X3UA 4C8ZA 2IM3A 3QZ8A 4NLRA 5C42B 4PG5A 2DJWA 2LDIA 1Z2ZA 3D1QA 3THPA 4ID5B 1Y5NB 2WRMA 4X4VA 3I4HX 4DN0A 1IXKA 3DM2B 4FXDA 3O1LA 2DNZA 5HP1B 4F3OA 4HH1A 4Y2KA 5SUHA 1UJ6A 4NLGA 1M90T 4O3RA 2DNNA 2V4RA 3GIIA 3SYZA 3NMRA 4CI0B 1NK7A 1HD1A 3FRZA 3DU6A 2FLLA 1L3UA 2OFHX 1GH8A 1P8GA 3GV7B 3NAHA 2KFNA 1VC6A 3Q8RB 1DTQB 5C24B 3R3TA 1N48A 1O51A 1UA1A 4HHJA 2XLJA 3Q24A 1QY7A 1ULRA 3PXGa 2OIHA 4KB7A 1HL6A 1UAWA 1U7LA 1VRUB 3MEDB 2QA4G 2VA2A 4ZPAA 1GXTA 2E1MC 5BYSA 2DGSA 2DTJA 2OSRA 2MQQA 2HAIA 4QIGA 4DV7F 1FK9B 4ZP9A 2FJVA 4J37A 2R7TA 3LW5C 2RQKA 3CCUS 1DARA 4NLOA 5KFTA 4U7CA 1T95A 2LMIA 5HMWA 4K4WA 2R2SA 3R5CA 2YWFA 4MH8A 4JUZA 2J8AA 3MOJB 2YKNB 4ZDNA 4IRCA 3E8OA 4UQTA 3FQKA 2E66A 2XG8A 2FTRA 2OD6A 3ICLA 1T8EA 4M5DB 2LECA 3VQTA 1ZM4A 4DFJA 3OJSA 1S6OA 4QU6A 3IA0A 4BHQA 3JTOA 1N0VC 4P6QA 2HW3A 2KYZA 3KLGA 3MM9A 2GFFA 4K4YA 4KR0B 3CC4S 4RU2A 2VONA 2MPUA 2HNDB 4J9PA 1IJFB 5J1PA 1SBRA 3G86A 2MQPA 2OPSA 4IDKA 2ASDA 1QAYA 3QGPA 4YR3A 1VQ4S 2IHR1 3W7BA 1NK8A 5GADI 4E8UA 1NHUA 2DNHA 2HS4A 2E7XA 3M8PB 1KEKA 3ZFVA 3NNAA 1RISA 4OHZA 2WB1D 2UXDF 4GC7A 3H40A 2PMHA 1JMTA 5G0RB 2LYVA 2CVIA 1P1TA 3LWMA 5B09A 2XS5A 2RT3A 2F8MA 1FXDA 2P9GA 2FJEB 4N5SA 5HMYA 3DLGB 1VQOS 3UW1A 1CC7A 2V9WA 2ADCA 2C28A 4AFFA 3L7PA 3M2RA 3K58A 1J5OB 4ILMA 5IS2A 1FXRA 1EP4B 2AJ4A 5AXMA 2DB1A 2UXBF 1S4FA 4H4MB 1DHMA 5DGAA 4IO1A 1HBOA 3CXCR 3MHYA 1VQMS 5T41A 1U25A 4F50A 2EFNA 2VFUA 3OR2B 4ZP6A 3X1LB 3GIKA 1D9FA 1J5EF 3CIZA 1HPZB 3J7YI 2NR0A 2ROGA 4F2SA 2E1AA 2YNGB 4NX9A 3D1OA 1RT2B 2KB2A 2R7QA 2XBPA 4AL7A 2KZMA 3ZZRA 4B9SA 2DNRA 4ERDA 1ZOTA 2J9EA 1I94F 4FBUA 1S0VA 1AXQA 4K4UA 1N8RT 1BGXT 2VG7A 2ZH8A 4LJMA 1JWWA 4DSJA 1HMVB 3D0IE 3LAMA 4I6WA 1VBZA 2XY5A 2HHWA 2AJ0A 3PKYA 5K14A 3JSRA 2IC3A 1S6PA 2CQIA 2V5HG 4NYZA 4EBCA 2ATLA 4RW9A 4RBVA 3CD5A 1TKXA 2BUNA 1SJFA 2CQGA 1IQZA 4NMLA 2VH7A 3UI3A 5IM0B 5KFDA 4ELVA 5KFJA 4NYOA 2DNQA 1ZZFA 4YOEA 3R27A 2IM0A 2IRYA 4RW8A 5A8KB 2XMJA 4Q2LA 2XGQA 1YG0A 1KC8T 5A8WB 2CPXA 3MD1A 2XMWA 5F0UA 3KJVA 2RD5C 2FDNA 1YIJS 2J6TA 2B9YA 2HWHA 1HHTP 1DAXA 2IMWP 2WB4A 4DQRA 2EBEA 4YUDA 3KLHB 2KT3A 2LEPA 1QAIA 1CQMA 2K7KA 4G6VB 4ETXA 3CGIA 2B4PA 1WF2A 4IFYB 3LF0A 4HTJA 4OZ5A 1C1CB 5J1NA 4ECXA 1NHVA 2WSCC 1S1WB 3P3DA 4N8OA 4HI1A 5JXSA 3MUMP 4C8YA 2IMOA 2DR7A 3DM2A 2OTLS 4GC6A 1H3DA 2ERRA 1JLAA 3V4IB 2GIQA 3GSDA 2MXYA 4Q2MA 2WSEC 4CO5A 3PO4A 4OJ1A 4KKOB 1OPZA 5B0EA 3MGJA 2FC9A 2PT0A 2BE2A 1ZYQA 1X4HA 2CQ2A 2J9CA 2RB7A 3QGHA 3FSIA 3DOKA 3M9OB 4M94A 4B02A 2OAUA 2RH3A 4Q8FA 1VOMA 3T1HF 4WFBQ 4KV8B 4AQYF 1S97A 1RT1B 4CNYA 2E5JA 2IA0A 1WF0A 2KKHA 2JRSA 1AROP 4EUVA 3K8WA 2DGXA 3I96A 5CCMA 3RW6A 4MFBB 3CD0A 1VRUA 4QW8A 5H9FJ 4DUYF 2GO8A 2XO7A 4OQJA 1S1XA 2FIUA 5L9XA 1RTIA 4A46A 2HQIA 3AB2B 3DDNA 3KFWX 1ZAXA 2MZTA 5KFGA 2QT7A 3T9ZA 3TAMA 1FK9A 1Z1ZA 1HWLA 5FDLB 2X1AA 3QAUA 1Q8LA 3PFOA 3M6VA 4DR6F 2L9DA 1FVSA 1WACA 2XS2A 2HMIB 1RAJA 3D2WA 2UZAA 4OI3A 3I0SA 1FJCA 2CQCA 4I2QB 3KKFA 1T02A 1VQNS 3WX4A 4DR5F 2WOMA 2ZNZA 4KQZA 2N7CA 1WWHA 2J0QD 3HKZD 3PW5A 5CYMB 2BDPA 1REVA 3L95X 3AJ1A 2EK1A 1RT7B 1VIOA 4ID8A 4USIA 2MZSA 5AE1A 5A6WA 2BOPA 5L1JA 3UDLA 4AXIA 2QA1A 1UVKA 2R9LA 3PVXA 1DLOB 2HNDA 1M5OC 2B4UA 3RAQA 4J9NA 4XK8C 2R7RA 1N5SA 5CA5A 2OO4A 3CD7A 4DSLA 1S99A 4JI8F 2ZH9A 4KHMA 1V6HA 2PC6A 2JZ5A 4Y34A 3HT3A 2JFDA 3M8PA 5EGYA 3JSMB 4B9TA 1B0VA 5DQGA 1R0AA 4ALZA 5KOXA 3CCSS 1S9GA 2IFXA 1F0XA 5ITHA 3BSCA 3K7RA 3ENQA 3OFHA 5G0RA 2V8VA 4ZKAA 3MMAB 5I3UA 2KTQA 1U09A 4I4BA 3HHLB 2GV1A 2GW8A 3DLGA 4H4OB 3QMQA 2RUGA 1GQEA 2ZD1B 1IKXB 3IS9B 1J5OA 2ZM6F 4DWIA 3GR1A 2C2EA 1ZBTA 5AE3A 2GA7A 1EP4A 1S72S 3DLEA 2POKA 3NL0A 4IOAQ 2XGPA 4XIUA 3DLBA 2HHVA 4N8NA 2EW9A 1HW8A 3DXSX 5J2MB 1HNIB 4X2BA 3OR2A 3I87A 4ZPBA 4BWMA 3FMWA 2KH9A 1HPZA 4C8LA 5T7LB 2JDJA 3WZ0A 1X4CA 2ZC4A 5DETA 1LK5A 5DG8A 1UVIA 4CH7A 3H4DA 4ITSA 2D3UA 3DRRB 2VQFF 3KG4A 1JLFA 1YRXA 3DLKB 1R8CA 2JLFA 2OP5A 2CRLA 1HQUA 5AXKA 1N5QA 3RR7A 5EX3A 1Q78A 1KN6A 1JLQB 4DV3F 2EWHA 3K5PA 5EN1A 2KYXA 4UUWA 4FS1A 4TKTA 1OSDA 4X4PA 3FQLA 1WTFA 5B0AA 4FF2A 1T3OA 3H59A 4O44A 1NKCA 1E6YB 2L9NA 1WEZA 5F0WA 4RUCA 2DGOA 2LQJA 3F44A 4F67A 2R7VA 3S8SA 3CVKA 1VK8A 1BD6A 4QWDA 1IJEB 3JYTA 1UJ4A 1CQNA 1RTJA 2ZJPQ 2DGVA 4A8QA 1QVGR 2XSJB 3UCUP 3MUVP 4B3SF 1HWIA 1FT8A 5IQQA 4DFPA 2DNMA 5A8KA 5L39A 1LWFB 4DN9A 1WHVA 3CC2S 5KFXA 3RB3A 2UVRA 3SSRA 4RWWA 5A8WA 3K2YA 4FS2A 3DI6B 1VGYA 3KLEB 4JV2A 1S1VB 1FF2A 4LF8F 1Q7LB 2JL9A 2V94A 3HPOA 4YFUA 4OHVA 4F02A 3BGRA 3HVTA 2F9JA 3HI9A 4KFBA 4YB7A 3DOMA 2GHPA 4IFYA 5GAEI 2RMLA 3VALA 1TFYA 1C1CA 5A2QY 4QW9A 2AGOA 4NCBA 1URRA 1KR4A 3QIPB 1IN0A 1S9EA 5K8OA 3LQVA 5FIIA 1Y4ZB 4DR7F 4WF9Q 2C2RA 1N6QA 3LUYA 5F8IA 3UCZP 2D41A 3QO9B 3C6TA 1T3NA 2OPRB 3M6WA 3KTQA 1MW7A 2NQPA 2CPDA 3MR2A 1S1UB 4G1QA 2KT2A 5C25B 4R0EA 2RE1A 2M9KA 1T03A 4DF4A 1LK7A 2LEBA 4ZVHA 1RT1A 4OL8A 4R8UB 1FA0A 2VG5B 5KT2A 4WFNQ 4TLRA 4LFBF 1XN9A 1NAQA 3UWTA 4UW2A 2F7VA 4KTQA 3M9MB 4ZOSA 1VRTA 1QE1B 2V0NA 3OFEA 1RYSA 5KFUA 3SI8A 1G7CB 1LWCB 2W4CA 1K9MT 2IJFA 5IFMA 2LQ5A 2HMIA 4EWTA 3NNHA 1A6LA 3CCJS 1OQ6A 3OW2R 1XMBA 3CB4A 2Y1IA 3HP6A 2C42A 1YSJA 5CYMA 3DLJA 3M32A 3ENVA 5SZTA 4TY8A 1RI7A 3AA8A 5LSRA 1V9OA 2CPFA 3HX9A 5M2PA 2JEIA 3LWLA 2RKIB 4N47A 2J6UA 3I5AA 2MYFA 3KK1B 3K5NA 1DRZA 2K7JA 4MIAA 3HHNB 5KFOA 4NCAA 4MAKA 3SCJE 1FTCA 3KNGA 2BA9A 4DS5A 3O5TB 2C3OA 2MJNA 2HNZB 5KT3A 5HMXA 1U1LA 2FVRA 2H9ZA 3IAS9 3TVKA 2RILA 2ZOGA 5F8LA 3JSMA 1Y7PA 3HLUA 1Z4UA 1U6ZA 2VOOA 3I9ZA 2AJQA 3GWCA 4OV1A 3HKWA 5E3CA 4HT7A 4B3MF 4RW6B 4RUAA 2O1PA 5M2RA 2PMZD 4N76A 5F8JA 3G6VA 2B4OA 3O8WA 4H4OA 3K5OA 4J9OA 2LKZA 3VWSA 2JFKA 4KRWA 3SFGA 2ZH6A 3D0HE 2LXFA 2YTCA 4IKAA 4C0HA 2N82B 4DS4A 4IH5A 2YNHA 2D9OA 2PA8D 3VF0B 4CQ1A 4LUBA 5DQHA 4G1PA 3H20A 5A8RA 2B6AB 4QYRA 3M2UB 2DPIA 1S1TA 2HLTA 3RZAA 1KHVA 4LFAF 3LGMA 5B0FA 4URGA 1L3KA 1U49A 3PHEA 4DV0F 4O0IA 2O67A 1TV6A 2CQ1A 4HT5A 3J81Y 1TFWA 2CQPA 2EK6A 3ENWA 3I0RB 4KPYA