3IAM9

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
154
structure length
154
Chain Sequence
YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 24
structure length 154
sequence length 154
chains with identical sequence G
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
9 PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3iam900
4HEA9 3I9V9 2FUG9 3IAS9 3IAM9
chains in the Genus database with same CATH superfamily
2XBPA 4USTA 4ZJQA 1X9MA 4UZBA 2J8SA 4LR9A 2GNKA 4I6AA 2QZ8A 2LMIA 4GO5X 1X9WA 2RDJA 1U26A 2Y8WA 3NNAA 1RWPB 4XO0A 1SVDA 2Y8YA 2F9JA 5H9FK 2ZH5A 1RWOB 2O5DA 3BSAA 4FBUA 3LP0A 1DFDA 1CPZA 2GJ2A 2GGPA 2CQ1A 4W98A 4DL2A 3KYLA 2QLFB 1VQ8S 4PUOA 3CCTA 2HHTA 3THTA 1QAXA 2B8PA 3CEDA 4LFCF 1GMVA 2YKOA 1UJ4A 1XC9A 2R7WA 5F41A 1YJ9S 4AXIA 3G96A 4USIA 2JFDA 2IM3A 1LW2A 1WSVA 3H4DA 3PKMA 5F8LA 1WC1A 1U1RA 1RYSA 1IKYB 3H2VE 4RLEA 4R8UA 5C25A 4JI3F 2Z30B 4IFVB 4ZJOA 3BBCA 4CH0S 1Z2LA 2V8VA 4J9NA 4DL7A 4M94A 1OYDA 2R2SA 5KFBA 4EEYA 1UVJA 2B9WA 5KG1A 1B0VA 1H7WA 1WOPA 1EP4B 2HS4A 2MZQA 4HHJA 1TL3B 2MSTA 2OEKA 3H25A 1RTIB 1WG4A 2VB6A 3NAHA 1E6YB 1KLNA 3IRXB 3TX8A 5J1EB 2B3TB 1WEYA 3PDNA 1ACMB 1JLEB 1S7HA 5HMYA 3MM8B 2CADA 2X3DA 3H98A 3RR7A 1AZSA 1YDLA 3B8HA 3ISZA 5THWA 2O1PA 2ZD1A 3SQGB 4ECTA 4B3RJ 4C11A 4B3MF 4K2XA 3K89A 4LF8J 3DRRA 3C16A 4OJGA 3HHNB 4A8WA 1U6ZA 2DGOA 1GT8A 2DTJA 3A3PB 1OSCA 2RILA 4ZVQB 3IRWP 4LBPA 2AKWB 2VJUA 4DL5A 2UP1A 3UCZP 1SKWA 3TJ8A 4HACB 2QYGA 3GILA 2JNJA 4PWDB 2OLWA 5DQHA 4YHHF 2OD6A 2HVDA 1N0VC 5D0EA 2HLUA 1S48A 3IWNC 5KFCA 1VK8A 4ECUA 2OUGA 2IRUA 5AJ3J 1VCTA 3G6ES 2HK3A 4CO5A 1HWUA 3C46A 4PQUA 1RLDA 3ET6A 4GMKA 1X5OA 2W4PA 4NYPA 1RI7A 5G0RB 3JTPA 4OI0A 1CULB 3BKFA 1KTQA 2YKNB 4GRSA 2AX1A 3D0IE 1D1UA 1SKUB 5GAEI 1S72S 3D67A 2R2RA 2MY8A 2R3VA 4ES3A 2DH9A 2GJFA 4QWCA 5D8HB 3VGVA 2H3EB 2MLZA 1NSAA 1Y3JA 2KJVA 2QN6B 2ZVIA 3BSNA 1VC0A 2AZ3A 2RNEA 2B56A 2NUUG 4L76A 4UT4A 2V34A 2NREA 2V9WA 3DN9A 2HRYA 3PTWA 3CCQS 3HDSA 3TA1A 3R8YA 2OH2A 2FJEB 3QNWB 4HH1A 5C24B 2ZH3A 3KNAA 1I94F 4LFAJ 3PRVA 2E5IA 2CPYA 1IN0A 2ZD1B 4RO0A 2ZH7A 4B9TA 2O3DA 5B0BA 1RWUA 4NX9A 3Q8SB 3I56S 1Q82T 4LIWA 1GNKA 3GE9A 3IS9A 1CC7A 3T9ZA 4ZPVR 2YH0A 3E3XA 1H7XA 3HZEA 2VG6A 2MSSA 2E5LJ 2NR0A 1JLEA 3KNGA 4PPZA 3KG0A 4PR6A 4HTJA 4UQTA 1UZHA 4CH1A 3D3CJ 4RUBA 4LF7F 2I6WA 4TVAB 3ET6B 4DBQA 5AE3A 4N7TA 3OSNA 1JXEA 3OV7A 5DDQC 1HHTP 1BQXA 4DPYA 3KMSA 3ZNUA 2J0SD 1T9VA 1NH8A 3BM7A 3C14A 4ZK7M 4WFBQ 2HKEA 2ZBQA 5FLXU 2DGVA 1QLNA 2CQ3A 4KGVB 2EBEA 1R8CA 2LA4A 3PEJA 8AT1B 4L72B 2VDIA 3I0SA 3GJSB 4KH1B 3GYNA 3AODA 5LXYA 3MI7X 4C8OA 3HK2A 4O23A 3PCOB 4O4GB 3EZ5A 4DPUA 1ZPVA 2DNRA 4NLTA 4WE1B 3N4WA 2ASYA 4QJVA 2E9TA 2N4DA 4CQ1A 4GVBA 4DR1F 1NDKA 2ZZMA 1DLOA 3D7SB 3MMCA 1K0VA 1OO0B 4LQ9A 2KVIA 2R7QA 5CQGA 5C2GA 2QL7B 4ICLA 3G6VA 1CQNA 2H65B 2MKIA 4X4VA 4BDPA 1HQUA 2RSQA 4PYDA 3IWXA 3NAIA 3QLHB 4CLKA 1FDNA 4EGLA 1FRXA 1EJ7L 2R8KA 2FGOA 2L48A 2NZCA 1SL1A 1KSPA 1UL3A 1EP4A 2BX6A 2UUAJ 2HBZB 2QGFB 1ZETA 2RHSB 2F8MA 3H7HB 4TXSA 1ZPWX 3F56A 1T7PA 2V94A 3H5XA 2RAQA 4ETXA 2IA0A 3D1OA 4XIUA 3MECA 4R8UB 3CDWA 4A8SA 3SZ2A 1YTYA 1M90T 1DTTB 1QDUB 3LGNA 4WKYA 4WIIA 5FD1A 4IH5A 3ZZ0A 3DLGA 4XPEA 1KQFB 5A8KA 5IV3A 3Q8QB 4Z7YA 1L3UA 4K4SA 2QA4S 1Q81T 1OJ4A 1NK6A 1B7FA 4WK1A 1WC0A 5IQ6A 1WI6A 2NS1B 2NXEA 2PMHA 4LBIA 3OR1B 4RKUC 4RW7A 5KFVA 2C2NA 4KPYA 2FZGB 5DS7A 1YIJS 4QR1A 2LYVA 1SB6A 1U1KA 3CIZA 1GMWD 2JOQA 5KT4A 2QL9B 3ENWA 4FVCA 4P74A 3LWLA 2KZZA 3FMWA 4NEZA 1PJ5A 2AF6A 1X5TA 4CDIA 3LH2S 1UEVA 4KFBB 4MT1A 4WU2A 4I56A 4K5RA 3KOAA 2FHOB 4JI0J 4U6PA 1VYAA 2KXNB 1REGX 4NLWA 3PR4A 3G6XA 2W2MP 3DFEA 1YHQS 1RAFB 1P1TA 4YEAA 4RW6A 1CJUA 4CYUA 2LVWA 4MTPA 1MN9A 3P45B 2LCWA 3C6TA 3EUNA 4U8VA 4NWBA 2ZDPA 3KLIB 1KQSR 1T9WA 3AXKA 1YJWS 2HQFA 3CSKA 3JQKA 2VQEJ 4U96A 4B9NA 3OTOF 3EMTA 5CYQB 5LMUJ 4C8ZA 5EUHA 5KT2A 2V50A 4DV6J 1DZ5A 2DD8S 2HMIA 2ZNYA 1M5SA 2LQ9A 1LKZA 2OFHX 2OEMA 4YB6A 4AQYJ 5E3CA 3TYTA 4BBYA 3EJMA 2FLLA 1F2GA 1R8PA 4IQMA 5J2QA 2JEFA 4LF5F 3MEEB 3A8JA 1SJ1A 3H2UB 4J9OA 2VC0A 1TL4A 2B43A 3G6YA 1FJEB 4Y34A 5DG7A 2IPOB 3DGPA 3A4TA 4K4WA 3RB4A 1ZOTA 3FRZA 4F67A 4F4ZA 4DV4F 2FLOA 2VKRA 1RAGB 5L38A 3T5JA 4EYIB 5B0AA 4RUAA 3LP1B 4P52A 1N32J 1XK8A 2BM0A 5J2MB 2F8EX 2XNQA 3KLEA 1HPZA 1UWBB 3JAMY 4FZVA 3KLFA 1NJXA 4RWXA 3PR5B 3L3CA 1X0FA 4NEYA 1AYEA 4Q8FA 4MIWA 3KWMA 4RR5A 3NCRA 1U45A 3OL7A 4G3IA 1UAWA 5J2QB 2W2PP 1OY6A 2KYXA 2M52A 3H5SA 2DISA 2JX2A 1MWQA 3Q86A 5DZ7A 1TAUA 4IDKB 1RTDB 2OTJS 4NRTA 3MAAA 3TA0A 2YXLA 3ILOA 3HM9A 3TAQA 4I2PB 2KG1A 1CVJA 2XMMA 1UKUA 3VHQA 3MM7A 4P7TA 3ZTSA 5DQIA 1DJ0A 1YX2A 2ZH2A 2ZHOA 3ZZPA 5AT1B 1FX2A 1BQMB 2AMCB 4C3MA 2EEYA 3WZ0A 4YR0A 1NK5A 2KM8B 2GVDA 4KHRA 2ZH6A 1FVQA 3ETOA 4K0KJ 1HPZB 1UWBA 5KOWA 1KONA 3KHHA 1PYOB 3A1YG 4M5MA 1HYSB 3BYPA 4WP8A 4ED7A 4KB7A 3OSPA 2YNGA 1WORA 1CLFA 2WVDA 1U09A 1UFLA 3AXMA 3R1LA 2LKZA 3IG1A 4RNFA 5B09A 4OX9J 2DHXA 3FCVA 3PRDA 1IBMJ 3IAS9 2E44A 2RE1A 3PEHA 3OUYA 4J9MA 4DSKA 2GS8A 4JI2F 1PO6A 2B9YA 1IJFB 4PG4A 2WB1D 4DQSA 1S6PB 4HEA9 2UVUA 1UTAA 5J2PB 2V9KA 3UVJA 5C42B 3E01B 2EKNA 1HA1A 2HWIA 5L9XA 3PIOQ 1WTFA 2FB0A 5FDLB 3TVYA 5LL6d 3PIPQ 4DL4A 3IP0A 3OR1A 1K47A 1SXLA 4JBCA 4M5JA 3S1TA 4ED2A 1VQYA 3CJ2A 2ADBA 3MOJB 1BLUA 1S1VA 2OSRA 1VRTB 5F9LA 4DLGA 1YBAA 2BABA 2BYCA 4ZP9A 1K73T 3KLIA 3DLGB 4O4RA 2R7TA 3PYEA 5E3QA 1DTTA 3IXQA 3NXZA 4NRUA 5ETLA 1TTHB 1HHQA 3K7RA 3QBCA 2RDDA 3VCDA 4DL0C 1B0TA 1MU2A 5IQQA 3UWTA 1FCAA 4UOCA 3GSIA 2OMOA 2VKZG 4PYAA 1QSSA 4DR4J 3HF5A 4ZVEA 2J0QD 2LLZA 2M2BA 2Y0BB 3B54A 3D0GE 2Y1IA 1UJ5A 2O67A 4KPCA 1RE1B 4QW9A 3IR6B 4F3OA 1EZZB 3ADAC 4MFBB 2JVRA 1SL2A 1GQEA 1KP6A 2ZNZA 5GAGI 3ZFVA 2V6AA 2IRYA 2RQCA 1S49A 2G4BA 3DKDA 2JFKA 1KDNA 1HL6A 1MN7A 3HD2A 3MMAB 1NHUA 5D0GA 4DOZA 3FC9A 3MTJA 5CH7B 1C4AA 3EPGA 3M2VB 1EIYB 3HMJG 5T14A 4JYAJ 1QUPA 1FD8A 2AEMA 3GG0A 1BXNA 4ZP6A 4TQSA 2K7KA 2YNHA 1WKJA 1X7VA 2BRKA 3OTCA 1GAOA 2E5JA 2IVMA 4FN5A 2C3PA 1XEZA 5E41A 1C1CB 1N5YA 1U8WA 2EK1A 2CDQA 3LTOA 3K8WA 1D9AA 4LSNA 5KG3A 5LOQA 3QRRA 5HVHA 1F0XA 1X4BA 1CG2A 1UWAA 2B0GA 2J7WA 3CO0P 3EZOA 3SDEA 1J5OA 2J5AA 2RMLA 2B5JB 1ZH5A 4UQGA 1FXLA 7AT1B 1J2VA 2JH3A 3QIDA 3FQKA 4DWIA 2XLIA 1VFJA 4DV3F 4CI0B 1NPPA 3PVXA 1KFDA 4NYOA 3ISNC 3PX4A 1R31A 3PRBA 3A3NB 4JI5J 2WVBA 4CLPA 2HFSA 4ZP7A 4A8MP 3TUZC 4WFAQ 3GV8B 4C48A 4RNNA 2KFNA 1DLOB 2ROPA 2HQGA 4KT0C 3NWGA 3U1MA 1R8HA 2CZ9A 3IO1A 4CRJA 3KKFA 1HBMA 1YZ7A 5DDPC 4M5HA 4QPXA 3T5LA 3KJFB 2NXNA 4OZ2A 3ULHA 5F8HA 4EK2A 4WP9A 4DN9A 5KFKA 2G0CA 4XK8C 3W5ZA 3OQ2A 4CM2A 2WTFA 2ADCA 2CDRB 1JLQB 3Q8UA 2HGMA 4WYLA 2HAFA 4RW6B 3TVZA 2MKCA 2MQ8A 3SCJE 1FTCA 4Q2LA 3VF0B 1O0PA 4I0WA 3BSOA 1OIAA 3C8YA 3WHIA 1FJCA 4IG3B 2VBWA 1YJVA 4Q2MA 2ZJRQ 3LANA 1QVGR 2RQ4A 5BYSA 4IQXA 1T94A 2CFXA 3M9OB 1NLKL 2LEAA 2VICA 1U1MA 1HYSA 3RW7A 1X5PA 3NLCA 2PMZD 1MSWD 2WSEC 2PGCA 3PYGA 4OI6A 4DN0A 3JAMU 4URGA 2GHPA 4NLGA 3Q2TC 3J7ZT 5IT9U 3MPWA 2QMXA 4J91A 3HFVA 3CC2S 2HHHF 3PW4A 1Y0HA 3HD1A 1S1VB 5CA5A 1FD2A 4FXDA 1GXLA 3MM5B 2RQMA 1T03B 3DOKB 1SH0A 2DR5A 1RISA 1LK5A 3U1LA 1FJ7A 2VFRA 3H90A 5J2PA 5HATA 3BO4A 3ZC4A 4QCLA 3ENAA 2XI3A 5HL7Q 2C1EB 1YRUA 3I5BA 1JLFB 2N7CA 2AYGA 1PGZA 3KLEB 1XIQA 3G4SS 2A6OA 2RUSA 1R0AB 1RT6B 2PFDA 1GXTA 2B7CB 2KDOA 4IFYB 2K2PA 1IVZA 4N8OA 1N33F 1CULA 2R8GA 2P6SA 3CCZA 3F0NA 3I4HX 3T1AA 3DGPB 2DGTA 2DK2A 1LFPA 4OHXA 2ZFHA 3D6HB 4WTOB 5LJ3Y 4D3HA 4PQUB 2LQ5A 4URQU 3AB2B 3OVAA 2QV6A 3PFOA 1NB2A 2OGUA 3S8SA 3KJVA 1XMQF 1M5VC 4LF5J 5F8IA 4OV6A 4N8NA 1B70B 1J5EF 4PWUA 2GC8A 2DKOB 1YKWA 4FPRA 2DT9A 1FRIA 2VUGA 3BGRB 2HFZA 1C1BA 3KFWX 3GIMA 3SYZA 2JHEA 2B8QA 4S0MA 1KC8T 4P10A 4KHPF 1GTHA 2M9KA 4LFAF 4C8NA 2Q6BA 1H73A 3W60A 4BC7A 4F26A 4OYWA 3M8WA 1FA0A 3DOLB 4TYBA 3CC7S 5HP1B 5HMWA 3J81U 4QYRA 5JXSA 1QJHA 2SXLA 2HNDB 1WUUA 2ZOMA 1QTNB 3CO9A 3D6FB 1RDRA 4NLRA 2QO3A 3L7PA 3ZTOA 4KFBA 1I51B 2BEFA 2HNZB 3CJSA 3KDOA 3IRXA 3MR5A 4RW4B 1Y9OA 4LF6F 1RTIA 4F4XA 2E5GA 1WHWA 3VQTA 3K2YA 5HK4A 1JLBA 2GIRA 2NPIA 2Z57B 4KR0B 3DLJA 4E2FB 3EVOA 1OWXA 3NBPB 4OIXA 2FHKA 1KOHA 1WHVA 3D68A 3G8QA 3JTNA 5CYQA 4CP5A 4NL5A 5F3TA 4JI1J 2BJEA 1JIHA 2C3OA 4K8RA 4LF8F 5K8OA 4C8KA 3DYAB 1AXQA 2NXUA 2V67A 2Z8QA 4Y6IA 2LU1A 4CLTA 3IM8A 5C42A 3A3OB 4DR2F 2ALZA 1KFSA 4ZLPA 2XULA 2DNHA 1BGXT 1NDCA 4O3RA 2GX8A 3MR6A 4XPCA 4LMZA 2WAQD 1JMTA 2ASDA 1ZM9A 2UXBJ 1YJNS 4K4VA 3R7BB 4BHQA 1UW9A 4RX6A 2Z56B 2ROEA 3EX7B 2GGPB 5L1KA 1RHQB 3OJUA 5DGAA 1XMOF 2CPJA 4RW9B 2MTLA 4WIQA 3PZPA 1FHTA 1FK9A 1HWJA 4Y2MA 3BEGB 3M6VA 2VC1A 4FYYB 3R97A 3UI3A 1FRKA 1U1LA 1SKRA 5G0RA 1BC6A 1XN9A 3AH6A 3MUMP 1UFKA 3QLHA 3N6MA 3T6JA 4I64A 1M5PC 2VD3A 1ZA1B 1VIXA 4AFFA 2FJXA 1BQMA 5K14B 1C2PA 3J81j 2XCAA 3KDNA 1NSKL 1GFWB 4RW7B 2DIVA 4HACA 4Z7CA 2N3OA 5AXNA 1NK8A 2FJVA 3FBFA 3ILIA 3M2RB 3MAQA 1MW7A 1Z1ZA 2M8DB 4OZ1A 1RTHA 1RZMA 1SQEA 1SV5A 2MZRA 4DR6J 3VQSA 1YBTA 2IVFB 2MZ1A 2ZHAA 2DNQA 5ETSA 3K5NA 3B82A 5F0UA 2V4QA 1U1QA 5KFIA 1HBOA 1WJ9A 1RADB 2KI2A 3O5TB 4CIOA 4YOEA 2UXDF 3NCPA 4KHMA 4NLVA 3VTIA 3P49B 3CJ4A 1TR0A 4A46A 1Z4UA 3KLFB 4O3PA 1EX8A 3CD7A 3UCUP 2W7PA 1YRTA 3N6NA 3V81A 4LQ3A 2DR6A 1YGYA 2AYBA 5KFNA 2ZKTA 3MCOA 1NM2A 1RKIA 1E6VB 2VPXB 4WFXA 4YMEA 5JUMA 4OZLA 4DV0F 2QTWA 2FYXA 5J1EA 4X4NA 2CG4A 2W2OP 5C2CA 4OZ5A 3ZTRA 1S9EA 2R7VA 5DQGA 5DDRC 4DU8A 2HHPA 1RACB 2CJAA 3UNGC 5B0CA 1S1TB 4Q44A 3W5XA 2IMOA 5GADU 1KVKA 2DHHA 2HAIA 2KFYA 4OYBA 1MLAA 3HSGA 2I0XA 4WFZA 1RLCL 4NA2A 2YWHA 1UETA 2QG9B 3AOAA 1IKXB 4NPOA 5K5MA 2N82B 5B0GA 3QGIA 4B3RF 4DQPA 4YY3J 4FF3A 1RP5A 1RTHB 1SV5B 3R5DA 4KY3A 1V3ZA 3J7YI 2RKIB 3PXGa 2PO4A 5D6GA 2RD5C 4RBTA 2K3IA 2W9BB 4R25A 1LXJA 2C22A 3EVMA 3K5LA 4M5KA 2B7BB 2B4PA 4H4OB 2YKNA 1DHMA 4LVNP 3CCMS 3KG1A 1HNZJ 4J9SA 4OI3A 1GX5A 4M1KA 3ZNJ1 1SJRA 3QT6A 4IO1A 6FD1A 2XC9A 1TFYA 3GU0A 3HZGA 1WELA 4USHA 2OFGX 4DR3J 2AGQA 3IN5A 4RW9A 2HURA 4NMLA 2B9XA 1MMNA 2W7AA 4Q7AA 4X62J 3GTYX 4YR3A 1UVLA 2CPDA 2W4DA 4N47A 2HS0A 2V2ZA 2L41A 3CC4S 2RDIA 2BE9B 3GJQB 5KFEA 2XO7A 5M2UA 1KHWA 3MWBA 3PW5A 4LF2A 2IDLA 3QO9A 3QAUA 4NOHA 3ZZOA 5DDOC 3TAMB 2ZZNA 1L3TA 1PBAA 2CRLA 4LREA 2J6SA 2VJVA 4MKYA 1XBWA 4ANCA 1F9FA 1D0EA 3VAHA 2FHMA 3D3BJ 3PX0A 4EZ6A 2Q6CA 4MIAA 4TU7A 1F5AA 2EK6A 4NLYA 3BKTA 3OBIA 4B08A 1VLOA 1SIZA 2KB2A 3D66A 3W1YC 4K4TA 1T05B 1IBLF 3GSDA 5IWAF 3NGRA 4WK3A 3A8KA 1XQIA 4NE9C 2WB4A 3BGLA 2XZDB 3MZIA 3IR5B 5DLFA 3SCLE 2V5HG 2V8PA 2CJ9A 3UD5A 2CQBA 4X66F 2QLBB 1IKVB 1Q7LB 5FJ4A 4X65F 2WBMA 4IFVA 2H4YB 2PD1A 5H1SV 4YHHJ 3CCSS 3DOLA 3V5RA 1SQGA 2IM1A 2A10A 1HIYA 2EKYA 3IR7B 3BKUA 3DRRB 1S1WB 4O4GA 1K1QA 2LEBA 2CQGA 2EFNA 2P9EA 1IR0A 2ZZTA 1RT3B 2C3MA 1NCLA 1C1BB 2VBZA 2I5JB 2YNFB 2BXJA 3BH6B 3M30A 3MMJA 2IHR1 2F65A 2E9ZA 4AT1B 2VH7A 1S5ZA 1VGYA 3M8PB 2C2ZB 4OYPA 3RBXA 1IM6A 3QZ8A 4QQBA 4TY9A 1N5QA 2Q3PA 2HLTA 3DI6A 4P2FA 1VRQC 3M8QB 4IRKA 5ADZA 3A8IA 4DS5A 1AA1B 2BW2A 2DB1A 3QYYA 2P9CA 3UDLA 4IR1A 5D4PA 5EN1A 2YKAA 1GXUA 4LF6J 1FWLA 3EGVA 3VVTA 3VAGA 2RS2A 1C4CA 4DFJA 1X4DA 1NJZA 5AJ3F 3IFEA 1SKSA 5HLFA 5T41A 4C0BA 2MZSA 5K8MA 4LRBA 5DRKA 1HW8A 2HYIB 4MAKA 5EHHA 2L9NA 1JLFA 1RHJB 1SPBP 1V6HA 2V2QA 3MAHA 2UUWA 3Q89A 4MIBA 4NA1A 4P75A 4Y28C 1LW2B 5C24A 3W9IA 5GAEU 2AIRB 4UW2A 5L9NA 5LJ5Y 3H42A 1RAOA 1M1HA 3K8VA 1K0TA 2HZAA 2BJ9A 1FDDA 5CHCB 4PG5A 1UA0A 3G86A 1QSLA 1RT7A 2ZKUA 3VZIA 3JSMA 3DMJB 2HSEB 3HSJA 4YB1P 3ZZRA 2BMBA 2P6TA 3AD9C 3OL8A 3IBWA 2IC3A 2QSWA 3V4IB 4C9DA 3LGHA 3MM9B 4K4UA 1DTQA 2FTRA 2K1RA 2EPIA 1F9EB 4M5LA 2GVZB 1KTVA 2UVWA 4FS1A 3H5UA 4EBDA 3KK3B 2QMWA 5D78A 4H4OA 2ZH9A 2FVCA 2XCPA 1D9DA 2GIQA 3ILJA 5AE2A 4FYXB 3NCQA 3QGPA 5CCLA 4X64F 3HKZD 1S77D 1VOMA 1IM4A 4ZDNA 3W2WB 4Y0FA 1VR6A 3MEGB 5AE1A 2W01A 3EWGA 2XS7A 2XHCA 3GR0A 4PG6A 2LQ8A 3HULA 2U2FA 3NS6A 3DRSB 5A8RA 2IYGA 3A13A 5IS2A 2YWWA 1CJKA 3OFHA 3DMJA 1X9SA 5CXTA 3WDOA 5EWGA 2J9EA 2LQBA 2G9OA 4ED3A 2GHVC 2MMYA 5DJBA 1X60A 4B9UA 2VFTA 1TMJA 3FCHA 2WCXA 2HGNA 1TL1B 1IQZA 3UDEA 2HG4A 4A8QA 4RW8A 3OLBA 3GZ7A 2IBOA 4CZCA 1FTRA 3UDCA 2RHQB 1YG0A 5KG0A 1VQPS 2BJ7A 1YZ6A 2R7RA 3RW6A 4G1PA 5B0FA 2W7OA 3WIVA 3UR0A 2XSJA 1G3OA 1L3KA 1S0VA 1NBEB 2ZWOA 3RBDA 3AHPA 1TK5A 1LWEA 4PG8A 1J27A 3H0PA 2EWHA 1ICEB 2CG8A 2VPWB 4LSNB 1IKYA 2I38A 1ZM3A 4DV2F 2UUBF 3MPUB 1RTJB 1LOUA 3NS7B 2AEJA 3W9HA 1EETB 2IM0A 2ZITA 3MCSA 2J0XA 3OTBA 4DPOA 4ECYA 1LV5A 1VQLS 1JKHB 1LK7A 1SC4B 2A18A 2YNIB 3QGGA 5EX0A 2JSXA 1F60B 3Q8RB 1F5CA 4NLXA 1NKCA 3PO5A 1A9NB 3PYDA 3RRGA 3KTQA 2DHSA 1S1WA 4W4MA 1GK8A 1TV6B 3BJYA 4RNMA 3QZ7A 2IM2A 4QOTA 4ECVA 1YI2S 1LWXA 1Q86T 1B3TA 3W7BA 4ZPTR 1G2EA 2PMWA 3ONQA 4WTYA 4JB8B 1URNA 1WHYA 2DO0A 1HBNB 2ACMA 4O0IA 3KJQB 4HI2A 4DV7J 4N77A 5KT3A 1R3NA 3TZYA 4LFBF 1TKXA 1SUQA 2C3YA 3CWJA 1VBKA 2CPXA 2PT0A 4DSEA 2OMLA 3CMES 2BUNA 3MTKA 2WK4A 3ITHB 1M1GA 1MWZA 1NDLA 2A1BA 3I96A 3WBZA 1Q78A 3P6YC 5LMNJ 2ZBIA 3HVAA 3MPDA 1WWHA 3KK2B 1U0HA 3QIPB 6FDRA 2MLXA 3OLAA 2LXIA 3R5JB 2ZM6F 2HVIA 3JYTA 3J7AN 2CIMA 4JV5F 1NSQA 4JI4J 3CJKA 3NWRA 1TP7A 2UZAA 2D3ZA 3POTB 4I2QA 2YKQA 4KHPJ 3M1VA 3F73A 3IMQJ 2UV8G 2XMUA 1HQ2A 3TAMA 1P27B 3MXHP 1R7IA 4IG0A 1HD1A 5FDLA 2KZMA 5ETKA 2C2EA 4NA3A 4JI6J 4LSLB 4URSA 3DLEA 4LUBA 3PKYA 1R8AA 1H2TZ 3UNYA 2RQKA 3GIKA 2W25A 4EYHB 3HHLC 2CPZA 2BOPA 4ED5A 3RAQA 3KK2A 4TY8A 3HO1A 1BWVA 1EAYC 3BN4A 3QAEA 5A76A 2RF2B 2VG7B 4RBUA 1JQGA 3GV5B 2EBGA 4LRDA 3AA8A 4X64J 2CKWA 2VU5A 3W8PA 1FERA 3MR2A 2DJWA 2AJ4A 1JLCB 2XQCA 5I3UA 2XMKA 3DLKA 2APOA 2EG2A 3LWMA 4I7FA 2KH9A 1DY3A 3OXLA 2MXYA 1PKUA 4MJKA 3OHBA 1PC4A 4O44B 3HX9A 5IXUA 3VGTA 4DSJA 3EZUA 2B6AB 1Q8KA 3BPDA 1S6QA 2VFSA 2KN4A 5CCMA 4QU7A 3HVRA 2OO4A 1VRUB 4UOGA 3CULA 2K3KA 4DPXA 4KGMA 4LRAA 2PFFB 3GPAA 2V4JB 2OPRB 4DCJB 2HNYA 4CLSA 3TZXA 2CUYA 4YDDB 1BHNA 1I6JA 4J90A 2DNNA 1RTJA 3AJ1A 3LQVA 3VV2B 4DX7A 1FDAA 4IH6A 4PXEA 4U7CA 3DLHA 1XR5A 2BE2B 1MG7A 2MHEA 4F25A 1WOOA 1RQ0A 2V8GA 3CJ5A 2M8HA 3DOMB 4G1QB 2CQDA 2XG8A 1C0UA 3D0HE 4X66J 5A6PA 2R2TA 5EWEA 2HVHA 2DGWA 4X65J 2FJDB 2MY7A 1P1LA 2UUTA 1Y3KA 3AY0A 1SJFA 2BV3A 3CD5A 3M8YA 2AJFE 2DIUA 4AXJA 4USUA 4YR2A 1TVRA 1RT6A 2V69A 2ZBPA 3ENQA 5ITHA 4AL6A 2OELA 1N33J 3BDEA 4K0KF 1RSCA 3K57A 4MK8A 3HXMA 5ETMA 2FHJD 1N8RT 4B3TJ 2KTQA 2DY1A 1T3OA 1KD1T 2QFIA 3CDBA 1KQKA 5KTQA 1TL1A 3TX0A 2PE8A 4PXCA 2VOPA 1UEUA 3CJ3A 2UU9F 3H2LA 1VC6A 3DRYA 2DHAA 2G1HA 4K5SA 4ZLJA 1AW0A 4LF9J 1SBRA 1VJWA 2CQPA 2FC8A 3HI9A 4P2XA 4QIWD 4DV1J 1DAXA 1IXKA 3EE3A 3D6MB 2X1AA 4E0DA 2FZKB 4PWWA 2MEWA 4NYZA 3NGDA 1KOOA 4NLOA 1NSPA 5I3PA 2YVSA 2BW7A 1YK9A 2DNOA 3D5MA 3O3LA 4DFMA 1D8YA 1BQNA 2G0JA 4V1Ak 2FIUA 1T0TV 4NXMF 4TYAA 4X4RA 4U7UD 1NPKA 2JJ4D 3KHLA 3TOQA 4KO0A 4P73A 2E1MC 1VIOA 5DO2A 4ECQA 2GVZA 4DX6A 2M88A 3O1LA 2FGCA 1FESA 3RB6A 1R6VA 2Q43A 1TQLA 3EYZA 4KV8A 3LP2A 1XERA 5JJBA 3T19A 1RKJA 1B99A 5LM7E 2UVVA 4ZVFA 4ECXA 1RT7B 4N5SA 3PYFA 1RT2B 3AQPA 4QR0A 2EXUA 1KR4A 2X1GA 2H5EA 3PACA 4CO2A 1VBXA 2VG5A 1AROP 2NSCA 4JUZA 2W9CA 3T1HF 4DLEA 2AHOB 3UE2A 3M6UA 1YSJA 2YPZA 1CSJA 3Q24A 2X1BA 4XTTA 5A2QU 2PDAA 3CDAA 3I4PA 3OTEA 1IBMF 2DRDA 4HKQA 1T9TA 4WWSA 1JLBB 2CVEA 3GB0A 3PJXA 2V2KA 3HJFA 5I3QA 2HBQB 2F7VA 4XAKA 4RJVA 1RU1A 4C98A 3HHDA 2FJWA 3H20A 4WXWA 3DRXA 4DQRA 4DX8H 1G4CA 2MKYA 2QA1A 1DQ8A 1N52B 3KLVA 4LFBJ 1PJ6A 1NZAA 3O8WA 4YN3B 5F0WA 4XDCA 3Q8VA 5A8WB 2MQOA 1TK8A 1C1CA 1N5YB 4O3OA 2C2MB 4M8LA 1M5OC 2FVSA 4LF4F 3MMCB 2IIHA 2P9GA 3PJ9A 1TUWA 1AB8A 4M5IA 1D09B 1UP1A 2QA2A 3GFYA 5HAOA 1XNRF 2QLXA 2GMLA 3LO3A 4FNHA 1BD6A 1U2FA 4R5PA 3VAFA 1V9OA 1NUEA 3N6LA 3IAM9 5KFFA 2KRRA 2CPEA 2N7YA 5KG2A 2DGXA 4C97A 1IKVA 3QSIA 1WC3A 2ZWPA 3C15B 4BCAA 3D54A 1FKOB 2IAJB 2D9PA 4NXNJ 1VLYA 3AFGA 4IRCA 3ISND 1X8DA 3SFGA 5A8WA 2HZVA 2LA6A 1GMWA 2G2ZA 2MJUA 4TLQA 1YVFA 1DBDA 2DY9A 2PSZA 5DETA 4YFUA 2Q1LA 1NNDA 1N54B 2V8HA 2MKHA 1WNEA 5IC4B 4PAAA 2JDJA 3QATA 5KT5A 4ALZA 3CD6S 1UMJA 3DHXA 1NXIA 5T7LB 4ZVTB 3CCUS 2WBRA 1ZAWA 3RTVA 3DRPB 4X2BA 1H3DA 3B4MA 1OQ6A 3SCIE 3X3UA 2VL1A 4J9VA 1TKDA 4NI2B 3CT9A 4HDGA 4JI8F 1N0UA 2WZ1A 1F9HA 1XMBA 1NH7A 4PQAA 3TP2A 1MMLA 1GX6A 4YB5A 1HNIA 4C3LA 3V6KA 2C2DA 4DL6A 2ZEJA 3GG1A 3OT9A 4F0KA 4ID8A 1IBKJ 4F2RA 4YP3A 1CC8A 1X0PA 1RAAB 2CNNB 2AW0A 4FXWA 4RBVA 1M0SA 5HQLA 2R2UA 2ZJPQ 2FLPA 4JI7F 2HQCA 2E7VA 2QRRA 1IUJA 1RU2A 1SC6A 3D2WA 4LF1A 4ELVA 1RBAA 1RAHB 1QAYA 1WOSA 1UVKA 3CMQA 3GQCA 2RRNA 2L08A 4DI6A 3LP2B 2BA9A 4MYUA 5GMKa 4USKA 4DS4A 2FJAB 1SL0A 4JI0F 1WG5A 2JVOA 4LT6A 1RABB 1VHIA 4F7VA 3UO0A 2W8KA 1AFJA 4TNOA 2GVDB 4A4JA 4KO0B 3J7A1 4NXNF 1VQSA 4ZPDA 4CNYA 3BGUA 2IJFA 2C2RA 2HW3A 1BWEA 1HD0A 1RA7A 4PWDA 4WCEQ 5J1PA 2HWHA 3HHLA 5D77A 3GJTB 1HNWF 4NLSA 5CD4H 2MQQA 3R2DJ 2E1CA 1FKPB 3S6EA 4OHWA 4DUYF 4DSIA 1U2RA 3KLGA 2JLGA 4L3KA 5HJYA 3KMQA 1MROA 2GHWA 1X31C 1K9MT 3UPFA 1WD6A 1JLAB 1U0SA 3SQGA 4CO3A 5F9NA 3TQ1A 5C5JA 4ZIWA 2PEHA 1S0MA 3CMAS 4F02A 3GP9A 1S1TA 2CPIA 1F1BB 5CYJA 3FKBA 2DNZA 2BBEA 3R5BA 3WC2A 3FGVA 2GQ2A 1Y5NB 2KRBA 3BREA 2LXUA 3EGWB 3FCWA 4G1IA 4ILRA 3VAJA 4X62F 2VHGA 5D4OA 1RT1A 2ATLA 5LSRA 2UUAF 3CJQA 3NKYA 1E6VA 3VZHA 2AGPA 3T1YJ 4IOCQ 4CCHA 4OYOA 2FD2A 2X51A 4FYVB 2ROGA 5HJXA 3CXCR 1OY9A 3NGSA 2E5LF 3H40A 4ZVRB 4DR4F 4UF4A 3IWLA 4OX7A 3OJSA 3FBEA 1JLAA 4LR8A 2H4WB 3KUGA 2YQ1A 2QFJA 2HHWA 1D8ZA 1YBUA 4YUDA 5C25B 3NY0A 4IH7A 3PV8A 2HHVA 2FZCB 5BR8F 1CJTB 1LWFA 2CVIA 3C6UB 3D9BA 1JLGB 5LSOA 4ELTA 3LPYA 3HHLB 9ATCB 4O3QA 2FVRA 2VDHA 1C0TB 3Q0AA 1HNXF 3HT3A 1P8GA 1KNZA 2F4VF 3MMAA 1WF0A 2QMUB 1YJTA 4J7CA 4EWTA 2BJ8A 3U7JA 3L95X 1EKSA 3KUEA 4QWAA 2MYFA 2XMVA 1OYEA 2GAHC 3O6QA 1FNOA 4KV8B 3S7RA 2XO6A 1SCJB 3HKWA 5KG6A 2B4UA 1UFWA 4HI1A 2MLYA 5E33A 3UR3C 3PG9A 4NZ6A 5SUHA 3U27A 2UUCF 1N34J 3K0JA 2GFFA 1NK7A 3R27A 4LRFA 4U7UK 3NNHA 5FIIA 5B7WA 1HFEL 1VMBA 1ZS6A 5HBMB 3CUNA 3SV4A 1HQEA 3HFZB 2W9AA 1Q95G 2GMJA 2ACYA 2UXDJ 5D4LA 1RWWB 2YX7A 3IGVA 4NLUA 5MLCV 1OMSA 1T03A 2WONB 5GMEA 4L74A 4ID5A 4NLDA 1WKKA 3G82A 1CJTA 6AT1B 1W2BR 4PZVA 5B0EA 2CXEA 2QLWA 4OYIA 3TUIC 3NNCA 2HHXA 3I6PA 4CT8A 2DCUB 3B4DA 1WACA 4DR6F 5D3GB 1Q8BA 4JV5J 4K2JA 1NB7A 3DLLQ 5KFYA 3E01A 2Z0GA 5KOXA 4H4MB 4JOUA 4OQJA 1YLXA 2OD4A 4U67Q 2UUCJ 4NZ7A 2XGQA 1P9QC 4K59A 4ZLLA 3D6TB 1TKTA 3FUYA 3V6HA 4RW4A 2OPQA 1M1KT 4J5OA 3FZ2A 1YQHA 3W63A 4KQZA 1X4EA 1TFWA 2IMWP 2BJDA 1FWPA 3ITHA 3VWSA 1RWNB 1TVRB 3M8SA 3W66A 3BR9A 1JB0C 4ICLB 3G71S 2E9RX 3VVUA 2JWNA 1IWGA 2JC1A 1L3SA 1TZ0A 2F9DA 1O6XA 1Y11A 1RT5B 3EPIA 5SZTA 2FVPA 4Q8EA 2M5YA 4G1QA 2DXFA 1FWKA 4Y65A 5KFRA 1S1XB 2MPUA 4H54A 2VQFF 4DUZF 4GC7A 1TKZA 2WSFC 5ETTA 3BS9A 1FKPA 5GMDA 4KKOA 4DV1F 1U49A 1HW9A 1KLMB 2H51B 2LU2A 4LIRA 2WSCC 2ZUAA 4KH0B 1G1XA 2F3JA 3VAKA 3P5TL 4JI8J 1U8SA 3LA0A 1Y00A 3GJRB 2AT1B 2Q79A 4OLOA 4DF4A 4B9MA 1JJHA 3FEXB 1FXDA 2ZC4A 3CJ0A 4QW8A 3SXLA 4A8OA 1NK9A 3Q2SC 3KLHB 4P71A 4C8YA 1RHUB 1UZDA 1Q8IA 2B6AA 2EW9A 2XZTB 4U95A 3FJ2A 2ILZA 2HIQA 5HMXA 1ULRA 3J7YU 3KG4A 1Q5YA 3GWCA 4OX9F 2BKNA 1VQNS 1NKEA 1WC5A 2DRAA 2HHSA 4G65A 2PN6A 3SSQA 2A2CA 3Q23A 2CQ4A 1SJ4P 2J9DA 4WYWA 2ZE2B 2ZHBA 2CQIA 4NZ0A 1RT4B 1JNZB 3CDEA 3O2IA 2MDAA 4OI2A 2LQJA 1ZBTA 3JTOA 2YQ0A 3TEGA 2E5HA 2RJZA 4ECSA 4LF4J 2F5GA 4E8UA 1S6UA 4M95A 3NMRA 2YTCA 2H5IB 4D3GA 1VQKS 3IGNA 5HROB 4QU6A 2POKA 5KG7A 1Y5IB 2BANA 5LMUF 3MEDB 2AZ1A 3NP5A 3KHGA 1N6QB 3FDSA 4GC6A 4NI2A 2CNLB 3TANA 3MMBB 4UOHA 2MGZB 1LWCA 2OPRA 1HNVA 4CNZA 1VQ7S 2QC3A 2XNRA 2OPSB 2J76E 4JI5F 1HBUA 2NYIA 3C6TB 2HFUA 2MJNA 3R5CA 1ZTTA 4KJIA 4PG7A 4IOAQ 4PXDA 2AP6A 1PCAA 3JYTB 1SH3A 4ECRA 3P96A 1WEZA 3QQCD 4KIAA 4RPFA 3BO2A 1HHSA 3MOZA 3QRPA 1LXNA 2I1RA 1RAJA 1RUSA 1T9UA 3R3TA 3BB5A 4TLRA 1RWXB 2XI2A 2ABYA 2NUHA 5I4MA 2ZBRA 3GMGA 1BMQB 2G13A 2VZ9A 5L1IA 4J9QA 1MNEA 4X4QA 1RCXB 2DYAA 1SUQB 3ICLA 2RU3A 5KT7A 3PW0A 2JL9A 1ROFA 4ZPWR 4CO4A 1W7WA 3HFKA 1S76D 3MPYA 1LW0B 1PYSB 4ELUA 4OLPA 1U7LA 2DXDA 3T5HA 4DR2J 1TU0B 3V4IA 1FFWB 1HWLA 4L73A 4KAIA 2XB2D 1BY9A 3D28A 3RUBL 4DV5F 2AJQA 3OTDA 3M2UB 2E7WA 3POTA 2F1FA 4DR5F 5A8KB 3MUTP 1QE1B 2RT3A 1KKHA 2IBKA 4QYZK 1NHKL 5T7LA 4KGKA 2BQUA 4HT7A 1W25A 1X4CA 1U0HB 2BOAA 3TA2A 3BBFA 5EDWA 3A8EA 3BQ1A 3LF0A 1N4LA 2E1PA 2Z58B 2R7OA 1R89A 2KJWA 3W65A 5E3RA 1A7GE 4EI2A 4Y00A 4FYDA 2XSJB 2DPIA 1H2VZ 4HVZA 3VR1A 3BO3A 3KJNB 2OPPA 1M5KC 3QJLA 2F40A 2W1BA 3GONA 5D0RA 3SDEB 4ED1A 1J5OB 2U1AA 2FHJA 3R6GB 2KG0A 3N0VA 4ZITA 1DQAA 2VOOA 4ZA1A 3DOMA 2DGUA 4F0HA 3JXOA 2Y1JA 1TUGB 4HL9A 2BE7D 1WDDA 3GLJA 4E98A 1QSYA 1KVIA 2YKPA 3M32A 3L7UA 2YWFA 1NEEA 4FXVA 5ETRA 4DR7F 3NRBA 3ILLA 3LAMA 3BQ2A 3DU5A 4C7QA 3AJ2A 3TRGA 2YNIA 1TMMA 1G6BA 3M2UA 1IR1A 2HQDA 3Q83A 1FO1A 1IKWA 2YBVA 5H9EK 2PA8D 5DM7Q 2XMAA 4YQWA 4Q0BB 1U02A 1S7IA 3LP0B 4I68A 4WXOA 4KE5A 2RRAA 4IRDA 3QRQA 4USVA 4ZS6A 3SSRA 5LT5A 2AYEA 4L6V3 5KG4A 2Y0SD 1FEEA 4MFBA 8RUCA 4J9KA 3MCNA 1VC5A 5HO4A 3VGUA 4JV1A 5KFUA 2GAGC 5EX3A 1VQOS 4N76A 4P72A 3EVWA 4MKAA 4ZJLA 1Y10A 4GO7X 4B17A 3BZQA 1VISA 1S9GB 1ITPA 1PAUB 2QE5A 3N28A 5H9EJ 1T05A 1S0OA 1XNQF 1FXRA 3W2VA 4FS2A 2IC3B 3QPIA 2M4MA 1R27B 3HVTB 4YDXA 3SFUA 2W9CB 4JI3J 1N5TA 3IS9B 2C2OB 2EFGA 4CLYA 5IFMA 1QE1A 4DG1A 2UXBF 4B3OA 3CTRA 4HH0A 1HNVB 3M1VB 3HPOA 3TJ9A 3PW2A 1RB0A 2ZVSA 2RUGA 1URRA 3NS5A 4WU3A 3MPVA 1TL7A 4WP3A 3FSIA 1S1UA 3MGJA 3H5YA 2KFZA 3BPSP 3D1HA 2AWZA 2J6UA 3I87A 2G0IA 1N32F 2LDIA 2CQ2A 5E3AA 5IT0A 2XMJA 5KFDA 4F3QA 1S9GA 2AX0A 3RYLA 3OUYB 2QYCA 5J2NA 5K9FA 2ILYA 5KFGA 3V6JA 2FJBB 2RS8A 4CT9A 5HLFB 3L7OA 2HQ3A 4DQIA 3OL9A 1CEZA 4CLUA 4PEOA 3G8TA 2RRBA 2YWGA 5A0YA 4C2MA 1S79A 2UV8A 4QYZJ 4M5GA 3FFIB 4KSEB 2RH3A 4J9RA 1C0UB 3MD1A 2W8LA 1N56A 2UXCJ 1UCNA 1NPRA 2G1DA 4B02A 3KLHA 3DI6B 3EGZA 5D0HA 5L1LA 3EDRB 5KFJA 1T95A 1S4FA 1JKHA 3QT7A 1UEKA 2DNGA 4ZMMA 1KVJA 1CS4A 1H2UX 2XS5A 5ETVA 2KHDA 3OTOJ 3C16B 2ZBCA 1KS2A 1PIEA 2CWKA 7FDRA 4GKKJ 3CCWA 3P3DA 5CYMA 1S1XA 1NAQA 1S6QB 3CJTA 3I0RB 3PHTA 4C11B 1Q7YT 4B3TF 4QWDA 4O44A 1S99A 3GCXP 4DDFA 3FFIA 4W92B 2ZM6J 3O44A 5J2MA 4X4PA 4QIGA 2ZE2A 2F63A 1FF2A 3R9LA 2B9EA 2KYZA 2M7SA 4BC9A 1FRJA 1N5SA 1S9EB 5KAKA 4F2SA 4DV7F 4FPIA 4HT5A 3Q8YA 1F3VA 5J2NB 1R8BA 4TY8B 4RU9A 3Q8PB 3EDQB 4C0HA 1XWLA 1XTZA 3DHWC 5IC6B 2VPZB 2JLFA 3WX8A 2GV1A 2IFXA 3CCJS 1HNXJ 5BJRA 4ITSA 4P2MA 1KN6A 1PSDA 3JB9k 4QIVA 3EXCX 3ZZYA 2JEGA 4DUYJ 1WDTA 5E2QA 2VASA 2DXEA 3AQOA 4DF8A 1XNRJ 3IBFB 3OL6A 4DCOB 2XY5A 4JYAF 3J80U 2UU9J 4C8MA 3R2CJ 4OJHA 3G82B 4RWWA 4LFCJ 3BGOP 3AB4B 4ES1A 1NJWA 2XSFA 4DR7J 4IYQA 4X4UA 3VGSA 1U4BA 1LW0A 3L9ZA 2LFVA 3F41A 2OP5A 2YY3A 4CH7A 5A0YB 2D7SA 4DR3F 2V2VA 1V5VA 3QT5A 4ILLA 2KT5A 1JLCA 5HI7A 5GVQA 1YJUA 3FBBA 2EFQA 3M6XA 3SIPB 4BLGA 5I3UB 1YWXA 3UD4P 1WF2A 2I2YA 1XR6A 2FDNA 2ZOGA 2ZH4A 1OS5A 2DGSA 3P4UB 4OZ3A 5J1NA 4IR9A 1NJIT 2NQPA 1WG1A 3ZTPA 4QWEA 1RGVA 2H9ZA 1REVA 1H0HB 1S1UB 4HHUA 4DZ6A 1T9XA 4ANEA 4NCBA 4O3SA 3TUJC 3JSMB 1U6BA 4MH8A 3WX4A 2D9OA 2XTJP 4USJC 2YQ3A 5U47A 3D1QA 4ZKAA 3UFCX 4RL1A 1X4FA 5JVHQ 1RWKB 2CZ4A 1KBRA 4KRWA 3MM6A 3V2UC 2Y3YA 5BXIA 5LXRA 5GAHU 5CABA 3M8ZA 3MFHA 1A6LA 4HHHA 2DRBA 5E5NA 4DV2J 2UUBJ 3CJ8A 4B3MJ 2KT3A 3PO4A 4ED0A 2XLKA 2DO4A 4K4ZA 4I6YA 2OKQA 4LBHA 3OD2A 3BH7B 3F44A 5HBMA 3SMZA 2PIIA 4DU7A 3NGUA 4B9LA 3AAWB 3OPKA 4MK9A 1XR7A 4A47A 1TKXB 1EB0A 3RB3A 5KFTA 1W2IA 3C19A 1DQ9A 3PM9A 1RWMB 3I32A 4KBIA 4WFYA 5C7PA 3FK4A 3J81Y 3BDPA 4B9VA 2GQCA 4OYZA 1HBNA 2DCLA 2CJBA 3H59A 4XDDA 3M9MB 2JLEA 5D4NA 2QA4G 2XYHB 2Z2LA 2M0GB 5CYMB 1HWKA 4Q0BA 3N01A 5ETPA 3TW0A 2K7JA 4A8XA 4JI6F 3BSCA 4YS2A 3M30B 1WI8A 4TKTA 5CD4A 2MQLA 2QSFA 3FMBA 4RUCA 2RIJA 3OR2A 4B3SF 2X1FA 4IO9Q 2V63A 2ASJA 2O66A 2HS3A 2DNMA 3HVWA 4AE5A 4UTGA 2HHUA 4B9SA 2ZDOA 4N41A 5IT9Y 1VJQA 3QFWA 2DH7A 2XYGB 5D15A 2A2DA 3GIRA 4C8LA 5KT6A 1U6FA 2BKPA 2WHOA 1SJ3P 1LWEB 1QTMA 3THVA 2DHGA 5LSLA 1WKLA 2CPHA 1RXOB 4UUWA 3ZZZA 1Q53A 3B78A 2FLNA 2DEIA 3J7Z5 3K58A 3DLBA 4A8FA 2OPPB 4WZQA 3C14B 1FFSB 3HP6A 3KJVB 1TUVA 1LNQA 4FDFA 2C2KB 2VONA 2J9DE 1VQ9S 3CE8A 3D4JA 5A6WA 3FEYB 3KUHA 4OZNA 1RT1B 1DTQB 1NRKA 5BYQA 2XHWA 2ERRA 4RW8B 5K8PA 4C4WA 5FLXY 3SI8A 4JI7J 1HBUB 2LDYA 3NL0A 1TL7B 4LVOP 2Z2MA 4AL7A 1K8AT 2ZJQQ 4F4KA 2CA9A 2HWTA 2JRSA 4FKYA 2DGQA 3LAKA 3HSZA 4F4AA 7FD1A 4Q43A 2L9DA 4OJ1A 1FJGF 1KQGB 4ENOA 4ERDA 5BR8J 4U8YA 4ANDA 4DG1B 5HVGA 2EI5A 1S4EA 2V68A 3R7NB 5HANA 1BE4A 3UDVA 2QEXS 3RBEA 4A8KA 1HNIB 3T6BA 3HVTA 4CM0A 2A6MA 1NDPA 3GCWP 3MDFA 4M5DB 4ZCKA 5F3ZA 3IBCB 3M2RA 3E51A 3DXBA 2CYYA 1AUSL 4AUKA 1IBCB 3QSYB 1L5UA 2D1CA 4FF4A 2KU7A 5CAAA 3FEZA 1RT4A 3ZO7A 2BJ3A 1FE0A 4Q45A 4OMFG 3GV7B 3V6DA 2HHQA 1KHVA 3EGNA 4HLBA 3ELHA 2GCFA 1FRMA 4NASA 2ZC3A 1EQMA 1U24A 1U2CA 1ZAXA 1SIWB 2EFOA 2N4CA 4ZOSA 5JMNA 5DGBA 1T8EA 3MM9A 4H4KC 2HNZA 2V8DA 4KYZA 4OI1A 5DLGA 4V19X 1NO8A 1OY8A 2HBYB 2RVJA 4DZDA 5L1JA 1FI4A 3DU6A 2OPSA 4I69A 2OSQA 1IQTA 4U9RA 1IKWB 4MKVA 2H1YA 1C0TA 4AYBD 2GQQA 1R0CB 2I5JA 2EC2A 2BVZA 5RUBA 1HLWA 2XM3A 2LEPA 4P9SA 4EFAC 4ZN3A 1H98A 1H38A 2HZCA 5AXMA 3DYAA 2N3LA 3M32B 3QMQA 1U1NA 3A12A 3DM2B 2J9CA 4LJMA 1JJ4A 1DRZA 2B51A 4F50A 3N5BA 4ZVSB 4ECZA 1PJ7A 1AZSB 2RU9A 4ED8A 3G8SA 3CCRS 3M05A 1SH2A 1WF1A 1Y7PA 1RA6A 2HRTA 4UOFA 4CLWA 2VA2A 4PPDA 2UXCF 2DNKA 3DGVA 4OJ3A 3I55S 2OAUA 1AUDA 2JEJA 2YKMA 4CO1A 3VAIA 4ZPAA 4ZVHA 2DBBA 2NCKL 4OZJA 3UCGA 4KC5A 2R9LA 2OI2A 1E6YA 4GKJJ 1Y4ZB 1RWVB 1X4AA 2OPQB 1UPPA 1TKTB 4DJBA 1HARA 5IM0A 3M8QA 2H54B 3CVKA 5KFSA 4Z2XA 1YITS 3PFEA 5F8JA 4IFYA 3R1HA 2B5JA 3S01A 1PILA 1Q0NA 4FP9A 1FKOA 2IAJA 3DCAA 2AJ1A 2F4VJ 2PC6A 2DVIA 1RT3A 2YNFA 1WSRA 3BYRA 4DPWA 2LP4A 4F0MA 2BQ3A 4DR1J 1TKZB 2XS2A 1RJJA 2HEKA 3MCMA 3QO9B 4X4SA 2VQFJ 2BKOA 4DMZA 3SSSA 2COLA 2IJNA 4F04B 5L39A 2XEXA 4Y2AA 2EC0A 4OV1A 2V0NA 4HTIA 1JNRB 2KHCA 3BF4A 1FX4A 4JV0A 4PUOB 2R8HA 2AYMA 1R6YA 1U47A 2PI4A 4F4YA 2NZ4A 3MHYA 4FBTA 4LR7A 3GFHA 5LMNF 4JP8A 2R42A 3JQJA 2CZVC 4ZP8A 3UW1A 2MB0B 1X4GA 2XGPA 1TL5A 1MMDA 3TZZA 3I31A 4ATNA 4V19J 3N9UC 2LXFA 1ZA2B 2FC9A 1H74A 4K4XA 2AJ2A 1IJEB 1HI8A 2E7XA 5GADI 1RHMB 5F8MA 1BQNB 3RGIA 2QIFA 2RKIA 4F36A 1MU2B 3NMAA 3TUPA 2GMHA 4PKDB 2MHNA 2EFVA 3RJMB 1PAEX 3CCLS 1N6QA 1I94J 2NSBA 4IKAA 3MEDA 2DEJA 3T5KA 3OHAA 2BANB 1S9FA 5HROA 2WW4A 3ETMA 1UW4A 3DOKA 3JQMA 1HR0J 3MM5A 2WVEA 3M7VA 2BR0A 2H48B 2HFOA 3TO8A 5IT4A 4X4TA 4B3SJ 1HQEB 2DR8A 1SC3B 3THPA 1TELA 3GR1A 5M2RA 8ATCB 3DRPA 1ZM4A 5IZHA 3UVJB 4P6QA 1HMVB 5HN0A 4JI4F 4CLFA 1YJ7A 2AV5A 1SI9A 1I5OB 2CJQA 3E8OA 4ZLNA 4PABA 3X1LB 4ER8A 4OYAA 3I5CA 4WKRA 3UN2A 2QT7A 1OPIA 1XJWB 3KK1A 2OTLS 3W3SA 2HPUA 2M70A 1ZZNA 4ZCIA 3OFEA 5HMZA 2I9SA 2NXCA 5DZ6A 5EGYA 2VA3A 5B0DA 1IR2A 4QBUA 2C3UA 2F4FA 1KLMA 3SQOP 1F2HA 1JLGA 1ZAVA 4AQYF 1LWFB 3C6UA 4BS2A 1WC6A 3ZZUA 5KFPA 2WVFA 4ZCLA 1NZ8A 3ZXWA 3TQEA 1HKAA 4DUZJ 4DV5J 3FVYA 3OR2B 4DEZA 2D3O1 5JVGQ 2NLWA 3ENVA 2FQQB 3GFZA 2JEIA 2J6TA 2E29A 4CTAB 2GA7A 4UUXA 2IYIA 4BWJA 1K1SA 3KK1B 2YPYA 5HVFA 3BGFA 4DFPA 1RHRB 3AT1B 1GTEA 3SEOA 3UQSA 2J7KA 1FT8A 3NEKA 4A8YA 4R0JA 4QIFA 3V81B 1HMVA 1IWAA 2D69A 4H4MA 2Z2ZA 3CF5Q 2R7XA 4I1TA 1Q8LA 2HBRB 3HCXA 4HDHA 4MKBA 1LQ9A 3TEHB 2XWXA 4ZHRB 1U48A 3CD0A 4CLLA 1HBOB 2J7UA 4M63A 2CJYB 4QPTA 2X3GA 1RCOB 4MMOA 3LGMA 4DR5J 3G9CA 1LEOA 3C66A 3DDIA 3DC2A 2MQMA 1FFGB 2HFNA 2DNPA 3DLEB 1T11A 2M3DA 3R5AA 2HVEA 2ZUGA 4ID5B 4L3NA 2WONA 3CDUA 4HYKA 4JI1F 4ZVGA 5EWFA 3DXSX 3EICA 4ZVPB 4RZRA 4TU8A 2BDPA 3NBPA 1RT2A 3OVSA 3G87A 4DUTA 4KTQA 2L9WA 3CW2C 5L46A 2GIFA 1HNWJ 1SQFA 3I9ZA 2KXFA 1Q16B 3CB4A 1VQMS 3NGKA 4TU9A 3MUVP 3M8RA 4I67A 1FNXH 1U25A 3PW7A 4JI2J 3HLUA 4DHVA 2ASLA 2WOMB 1FK9B 3TARA 4C3KA 3W61A 2MKJA 5DM6Q 2GZOA 4ZIVA 1NKBA 4NCAA 3FZBA 2VODA 4CLZA 2D41A 2GO8A 5KFAA 2XZWA 5DG9A 4ED4A 1UPMB 2IJRA 3JSYA 4OHZA 5HSPA 4DX5A 5K8NA 2D3OR 1NJYA 4QR2A 4Y2IA 4RUHA 5F8NA 3C15A 1Q4RA 1N5VA 1RAEB 5KFLA 5HP1A 1Q1KA 1ZZFA 5ETQA 3KHRA 4EZ9A 1WTBA 4ETZA 3PX6A 3VAMA 2AGOA 5F8GA 1HR0F 5KFZA 3NOGA 1VQ4S 1TV6A 4Q5VA 3BBBA 1JXVA 3T1HJ 3PJWA 3TJAA 4DQQA 1YJRA 2IDEA 3RU0A 1PBUA 3BGRA 1FDBA 2MQPA 3GYGA 2VBYA 2YWKA 2D74B 4QWBA 1D9FA 4WJBA 1EETA 2E66A 2FUG9 3FBCA 4NLQA 3NGTA 3QJPA 3TWZA 3DDKA 4UY8T 1FKAF 5IM0B 2G2OA 3OVBA 4Y2KA 1U1OA 4MK7A 4R0EA 1N48A 2BACA 1LFWA 5GAGU 4EMDA 1O5JA 4OX6A 1V3SA 2ATCB 4PCQA 4WBFA 3UD3P 1RK8A 2YKMB 1VI7A 2HNDA 1EARA 2OIHA 1NMEB 1KEKA 4DV0J 3EXYA 3AOBA 3GFXA 3TZWA 3W5YA 4RNOA 1FJGJ 3CCES 2DNLA 3K5PA 4IUFA 1P9YA 2AEFA 5KFMA 3RG6A 3US5A 4K50A 1QM9A 2CWXA 3HHLD 4LSZB 1MROB 1SC1B 4R5PB 5IOLA 3KLGB 4NCGB 5KFHA 2NXJA 2FPHX 2MQNA 4ZN1A 3MM7B 2LECA 1KRPA 4LF9F 4WFNQ 5BYRA 5DG8A 1ZM2A 2HIYA 1CS4B 3EM1A 3M2VA 2CNOB 3SCKE 2HHHJ 2V4JA 1HWIA 4KGXB 3DDNA 2Z2YB 1HI1A 1YRXA 1L3VA 3I0SB 4P2SA 4K7QA 1GMUA 1VS3A 3JSRA 5L8RC 3C2PA 1U1PA 4X84A 3LUYA 2DH8A 4O0NA 2R8IA 4WZMA 2IA6A 1F3FA 3RZAA 3DLKB 4TQRA 2VPYB 3V6DB 4ZVUB 1R0AA 4G6VB 2JC0A 3AA9A 5G4DA 4FF2A 4WF9Q 1FVSA 2HFVA 4USWA 1HNZF 2C28A 1APSA 4ILMA 3GIIA 2ZH8A 3FNNA 1JX4A 1VK3A 1JLQA 3LW5C 4M5DA 2HQIA 3U1NA 5KFOA 2VG5B 1T3NA 2FY8A 3I82A 1N36F 1PC5A 3CGIA 1QY7A 3BR8A 2B4OA 4AL5A 3MR3A 3UN3A 1HBMB 1OQ3A 5HQMA 3GIJA 3B6BA 4DV6F 3TAPA 4KGZB 3WIUA 3P8BB 4F4WA 2CJXB 3MD3A 2MKKA 1CJKB 1J5EJ 1S10A 3MF5A 4RNHA 1S6OA 1X5SA 3OXGA 4CYUB 2DPJA 3W64A 1QVFR 1FRLA 3G2XA 3MEGA 3UN5A 3K5OA 1NHVA 3QIPA 1N34F 4ECWA 2OJ3A 5B08A 1O51A 1W26A 4FYWB 2R7UA 3BN7A 2VFUA 3TNVA 3H4BA 3HT0A 1WC4A 4FKXA 3W62A 2EFPA 2HVZA 3LPEA 2BZ2A 2KXHA 4OYXA 2MZTA 3CCVS 2B4VA 4IG3A 4DL3A 3M4XA 1G7CB 3RRHA 4GVLA 3I5AA 5IWAJ 3RAXA 1V5IB 3M6WA 2WW8A 4K4YA 5IV4A 1VBYA 4NXMJ 2A3JA 2J0WA 2GO9A 1HQUB 2IVYA 1JK9B 4YB7A 2CJKA 2K8GA 1NK4A 3AOCA 5ETOA 1BUXA 1K44A 1M5HA 3M8PA 3RRKA 5KFXA 4I2PA 5AXKA 2YNHB 5K20B 2G2YA 5E7OB 2A0FB 1TK0A 4F3MA 4FVMA 2AQ4A 4A48A 4MYTA 4NCGA 2OEJA 4I4BA 3RB0A 2YX1A 1KWMA 3KXDA 4RU2A 1UVIA 3P5BP 4J9LA 3WQPA 2J8AA 3SBMA 4F8RA 3L4BC 3AD8C 4C0OC 3CPWR 1XNQJ 4EO8A 2GW8A 3MEKA 4L75A 3H8YA 4I7FB 4J9PA 3AD7C 3T1YF 1B7YB 2E1RA 2GJIA 2WRMA 4DV3J 4W90B 1CBKA 2KVQE 2CQ0A 1JWWA 1RAIB 3R6LB 4M5NA 9RUBA 4NMXA 2QLJB 4DXLA 3K59A 2UVRA 2ZH1A 1O8BA 1XMOJ 1FRHA 2PEBA 1TL3A 1PG5B 4Z37A 2VG6B 1VDHA 4OHYA 1T9YA 2E1AA 4EBEA 4IOBA 4QZVB 3TR5A 3QWUA 3WC0A 1S97A 4UY85 1VRTA 2FVQA 2KO1A 3JS9A 2HMIB 3GYXB 4B3OB 2P2CB 1D3WA 2HNYB 1QUVA 5A2QY 2V4RA 1ZTWA 1IBKF 4WPAA 3DM2A 2AD9A 2IY5B 1QAJA 3T3FA 2Q66A 2DITA 2VV5A 1S0NA 3PY8A 1RTZA 2CQCA 2PI5A 1S12A 3HJVA 1CJUB 1S6PA 3K17A 5E0OA 3FRYA 3QJJA 1NU4A 1Y5LB 5HQ8A 3OW2R 2K06A 2MZJA 4DCPB 4DPTA 3IC1A 1I3OB 2PA3A 4FNIA 2CPFA 3W2WA 4BWMA 3ZTQA 2FY1A 3PHEA 1UVMA 4ES2A 4UZCA 4PXBA 2YH1A 3NG8A 4C6AA 3HSDA 4OL8A 3KK3A 2WOMA 1AFIA 4OZ0A 1CQMA 2RF2A 2VG7A 5ETNA 2XLJA 1A0OB 3TI0A 3OFGA 3HHKA 2K1RB 2C42A 2BQRA 2O01C 1IBLJ 1B4SA 1CJVB 4OHVA 4TN2A 4Y2CA 2W4CA 3FQLA 4AD6A 2JZ5A 1PYTA 2ZOFA 1B0PA 5KFQA 1GEHA 3CJRA 2KKHA 3HHEA 1R43A 3QT8A 4ZVOB 3LOUA 3U02A 2W9BA 2DR9A 1LWCB 2YWEA 2OHDA 1SJQA 2W24A 3MAAB 1X4HA 3MMBA 3AJDA 3N5FA 4IDKA 5AXLA 2CAJA 2MGZA 1RTDA 2R7SA 1N88A 2KT2A 1FE4A 5CZXA 3CJKB 1IKXA 1VQ5S 1QD1A 4CO0A 2R8JA 2XWYA 2NPFA 1B64A 1T02A 2QL5B 3Q22A 3BV8A 5CZVA 4ZHRA 1NK0A 3IA0A 2AU0A 4DSLA 1HI0P 2I8EA 1VHFA 4J37A 3IG1B 2HK2A 2WVCA 4EO6A 1JXLA 3T41A 4JV2A 2YNGB 3OFFA 4USMA 4CWBA 3SV3A 5I42B 2MKSA 3RAMA 2Y1RI 2VIHA 1UJ6A 3C3LA 1F5BA 1RBLA 2W2QP 4LF7J 2W2NP 3CNQP 3E2EA 4ZPBA 3I0RA 4NLPA 1I1GA 3R5GA 2BE2A 2XMWA 2YX4A 4CTAA 4PRFA 3IM9A 1JJCB 3V4MA 1VBZA 3RR8A 1H72C 1ZYQA 4GVBB 1Q5VA 2HRUA 4O3NA 2DNYA 4EU0A 3QGHA 4N56A 1OSDA 4WE1A 3DNCA 1WHXA 2XYPB 2HGLA 4Y3CA 4EUVA 3QFHA 3MR7A 4OX8A 2BM1A 4KKOB 4P7VA 5KFWA 2VQEF 3VALA 4X4OA 1UA1A 1F6TA 3M9NB 1VRUA 1RBOB 2EG1A 2X7IA 1FEHA 4EBCA 2XY7A 2KL8A 1N36J 3RBZA 3BQ0A 1MWYA 2Z4PA 1XMQJ 1RT5A 1QAIA 3LALA 4QIEA 1WEXA 3MFIA 1EHWA 1S59A 2QX0A 2XMTA 3LP1A 3FSXA 2BJ1A 1UVNA 1JJ2R 2ALYB 1V3RA 2KM8C 1DARA 2VF3A 3MM8A 1RYRA 2R4FA 4LRCA 1AT1B 2VFVA 3W9JA 3TVKA 2BRLA 1ELOA 2DR7A 4DV4J 5E3PA 4GKJF 3J80Y 2D3UA 3N79A 3W8GA 4ZPCA 2P5VA 5I42A 1FNMA 3MEEA 3PNIA 4ZCMA 1DURA 1R0BG 5KG5A 4FF1A 1H6KX 4LSLA 3QWPA 2F8HA 3T9NA 2CQHA 1TAQA 4IG0B 1EKRA 2QJ3A 4GKKF 3ZZTA 4YY3F 1GH8A 5D3GA 3FSYA 3NOCA 2P8IA 4I2QB 4ED6A 1Q79A 2Y1LB 2H5JB 2AJ0A 5H9FJ 2RB7A 4DSFA 1EQ0A 4HR2A 3DRSA 5A8RB 3MM6B 2L3MA 4OI4A 4OYMA 3L09A 1P6TA 3CIMA 3I9V9 1RHKB 2VBXA 3W2VB 3K5MA 1OPZA 3MURP 1VQ6S 3MECB 3JSBA 3OXFA 4H4KA 3R7SB 2CNKB 2EVZA 5M2PA 2XY6A 4I6WA 5GAHI 2NYHA 4J9UE 1S57A 4OFZA 5K14A 4DFKA 1Z2ZA 2Y9HA 1REVB 5MAOA 2IRXA 1CJVA
chains in the Genus database with same CATH topology
2XBPA 1X9MA 2GNKA 4I6AA 2QZ8A 2LMIA 4GO5X 1X9WA 2RDJA 1U26A 3NNAA 4XO0A 2F9JA 2ZH5A 2O5DA 3BSAA 4FBUA 3LP0A 1DFDA 1CPZA 2GJ2A 2GGPA 2CQ1A 4DL2A 4PUOA 3KYLA 1VQ8S 3CCTA 2HHTA 3THTA 1QAXA 3CEDA 4LFCF 2YKOA 1UJ4A 1XC9A 2R7WA 5F41A 1YJ9S 4AXIA 3G96A 4USIA 2JFDA 2IM3A 1LW2A 3H4DA 3PKMA 5F8LA 1U1RA 1RYSA 1IKYB 3H2VE 4RLEA 4R8UA 5C25A 4JI3F 4IFVB 4CH0S 4DL7A 4M94A 1Z2LA 2V8VA 4J9NA 2R2SA 5KFBA 4EEYA 1UVJA 2B9WA 5KG1A 1B0VA 1H7WA 2HS4A 1EP4B 2MZQA 4HHJA 1TL3B 2MSTA 3H25A 1RTIB 1WG4A 2VB6A 3NAHA 1E6YB 1KLNA 3IRXB 3TX8A 5J1EB 2B3TB 1WEYA 3PDNA 1JLEB 1S7HA 5HMYA 3MM8B 3H98A 3RR7A 3B8HA 3ISZA 5THWA 2O1PA 2ZD1A 3SQGB 4ECTA 4C11A 4B3MF 4K2XA 3DRRA 4OJGA 3HHNB 4A8WA 1U6ZA 2DGOA 1GT8A 2DTJA 1OSCA 2RILA 4DL5A 3IRWP 2UP1A 3UCZP 1SKWA 3GILA 4PWDB 2OLWA 5DQHA 4YHHF 2OD6A 1N0VC 2HLUA 1S48A 3IWNC 5KFCA 1VK8A 4ECUA 3G6ES 2IRUA 4CO5A 1HWUA 3C46A 4PQUA 4GMKA 1X5OA 2W4PA 4NYPA 1RI7A 5G0RB 3JTPA 4OI0A 1KTQA 2YKNB 2AX1A 3D0IE 5GAEI 1S72S 2R2RA 2MY8A 4ES3A 2DH9A 4QWCA 5D8HB 2FLNA 2KJVA 1Y3JA 1VC0A 3BSNA 2RNEA 2B56A 2NUUG 2NREA 2V9WA 3DN9A 2HRYA 3CCQS 3HDSA 3TA1A 2OH2A 2FJEB 4HH1A 5C24B 2ZH3A 3KNAA 1I94F 2E5IA 2CPYA 1IN0A 2ZD1B 2ZH7A 4B9TA 2O3DA 5B0BA 1RWUA 4NX9A 3Q8SB 1Q82T 4LIWA 1GNKA 3GE9A 3IS9A 1CC7A 3T9ZA 4ZPVR 2YH0A 3E3XA 1H7XA 3HZEA 2VG6A 2MSSA 2NR0A 1JLEA 3KNGA 4PPZA 3KG0A 4PR6A 4HTJA 4UQTA 4CH1A 4LF7F 3OV7A 3OSNA 4DBQA 5AE3A 1HHTP 1JXEA 5DDQC 1BQXA 3KMSA 2J0SD 1NH8A 3BM7A 4ZK7M 4WFBQ 2DGVA 1QLNA 2CQ3A 2EBEA 1R8CA 2LA4A 3PEJA 4L72B 3I0SA 3GYNA 5LXYA 3MI7X 4C8OA 3HK2A 4O23A 4O4GB 3EZ5A 1ZPVA 2DNRA 4NLTA 4WE1B 3N4WA 2ASYA 4QJVA 2E9TA 2N4DA 4CQ1A 2ZZMA 4DR1F 1DLOA 3MMCA 1K0VA 1OO0B 4LQ9A 2KVIA 2R7QA 5CQGA 4ICLA 3G6VA 1CQNA 2MKIA 4X4VA 4BDPA 1HQUA 2RSQA 3IWXA 3NAIA 3QLHB 1FDNA 4EGLA 1FRXA 2R8KA 2FGOA 2L48A 1SL1A 1KSPA 1UL3A 1EP4A 2F8MA 4TXSA 1ZPWX 3F56A 1T7PA 2V94A 3H5XA 4XIUA 4ETXA 2IA0A 3D1OA 3MECA 4R8UB 3CDWA 4A8SA 3SZ2A 1YTYA 1M90T 1DTTB 3LGNA 4WKYA 4WIIA 5FD1A 4IH5A 3ZZ0A 3DLGA 4XPEA 1KQFB 5A8KA 3Q8QB 4DR7F 4K4SA 1L3UA 2QA4S 1Q81T 1B7FA 4WK1A 5IQ6A 1WI6A 2NS1B 2PMHA 4RW7A 3OR1B 4RKUC 5KFVA 4KPYA 5DS7A 1YIJS 4QR1A 2LYVA 1SB6A 1U1KA 3CIZA 2JOQA 5KT4A 3ENWA 4FVCA 3LWLA 2KZZA 3FMWA 2AF6A 1X5TA 3LH2S 1UEVA 4KFBB 4WU2A 4I56A 4K5RA 3KOAA 2FHOB 4U6PA 2KXNB 4NLWA 3PR4A 3G6XA 3DFEA 1YHQS 1P1TA 4YEAA 4RW6A 2LVWA 4MTPA 2LCWA 3C6TA 3EUNA 4NWBA 2ZDPA 3KLIB 1YJWS 3CSKA 4C8ZA 4B9NA 3OTOF 5CYQB 5EUHA 5KT2A 1DZ5A 2HMIA 2DD8S 2ZNYA 1M5SA 2LQ9A 1LKZA 2OFHX 4YB6A 5E3CA 3TYTA 4BBYA 2FLLA 1F2GA 1R8PA 4IQMA 5J2QA 2JEFA 4LF5F 3MEEB 4J9OA 1SJ1A 3H2UB 2VC0A 1TL4A 2B43A 3G6YA 1FJEB 4Y34A 5DG7A 3DGPA 4K4WA 3RB4A 1ZOTA 3FRZA 4F67A 4F4ZA 4DV4F 2FLOA 2VKRA 5L38A 3T5JA 4EYIB 5B0AA 4RUAA 3LP1B 1XK8A 2BM0A 5J2MB 2F8EX 2XNQA 3KLEA 1HPZA 1UWBB 3JAMY 4FZVA 3KLFA 1NJXA 4RWXA 3PR5B 3L3CA 1X0FA 4MIWA 3KWMA 1U45A 3NCRA 3OL7A 4G3IA 1UAWA 5J2QB 3H5SA 2KYXA 2M52A 2DISA 2JX2A 1TAUA 4IDKB 1RTDB 2OTJS 4NRTA 3TA0A 3TAQA 3HM9A 4I2PB 2KG1A 1CVJA 2XMMA 1UKUA 3MM7A 4P7TA 5DQIA 1DJ0A 2ZH2A 2ZHOA 3ZZPA 4C3MA 1BQMB 3WZ0A 4YR0A 1NK5A 2KM8B 4KHRA 2ZH6A 1FVQA 3ETOA 1HPZB 1UWBA 5KOWA 1KONA 3KHHA 3A1YG 1HYSB 4ED7A 4KB7A 3OSPA 2YNGA 1CLFA 1U09A 1UFLA 3R1LA 2LKZA 3IG1A 4RNFA 5B09A 2DHXA 3PRDA 3IAS9 2E44A 2RE1A 3PEHA 3OUYA 4J9MA 4DSKA 1PO6A 4JI2F 2B9YA 1IJFB 4PG4A 2WB1D 4DQSA 1S6PB 4HEA9 2UVUA 5J2PB 2V9KA 5C42B 3E01B 1HA1A 2HWIA 5L9XA 3PIOQ 1WTFA 2FB0A 5FDLB 3TVYA 5LL6d 3PIPQ 4DL4A 3OR1A 1SXLA 4JBCA 3S1TA 2ADBA 4ED2A 1VQYA 3CJ2A 3MOJB 4B3OA 1BLUA 1S1VA 2OSRA 1VRTB 5F9LA 4DLGA 1YBAA 2BABA 2BYCA 4ZP9A 1K73T 3KLIA 3DLGB 4O4RA 2R7TA 5E3QA 1DTTA 3IXQA 4NRUA 2CJKA 3VCDA 3K7RA 4DL0C 1B0TA 1MU2A 5IQQA 3UWTA 1FCAA 4UOCA 2OMOA 2VKZG 1QSSA 3HF5A 4ZVEA 2J0QD 2LLZA 2M2BA 3D0GE 2Y1IA 1UJ5A 2O67A 4QW9A 3IR6B 4F3OA 4MFBB 2JVRA 1SL2A 1GQEA 2ZNZA 5GAGI 3ZFVA 2IRYA 2RQCA 1S49A 2G4BA 2JFKA 1HL6A 3MMAB 1NHUA 4DOZA 3MTJA 5CH7B 1C4AA 3EPGA 3M2VB 3HMJG 5T14A 1QUPA 1FD8A 3GG0A 4ZP6A 4TQSA 2K7KA 2YNHA 1X7VA 2BRKA 3OTCA 1GAOA 2E5JA 2IVMA 4FN5A 2C3PA 1XEZA 5E41A 1C1CB 1N5YA 2EK1A 2CDQA 3K8WA 1D9AA 4LSNA 5KG3A 1F0XA 1X4BA 1CG2A 2B0GA 2J7WA 3SDEA 1J5OA 2J5AA 2RMLA 2B5JB 1ZH5A 4UQGA 1J2VA 2JH3A 3QIDA 3FQKA 4DWIA 2XLIA 1VFJA 4DV3F 4CI0B 3PVXA 1KFDA 4NYOA 3ISNC 3PX4A 1R31A 3PRBA 4ZP7A 4A8MP 3TUZC 4WFAQ 3GV8B 4RNNA 2KFNA 1DLOB 2ROPA 4KT0C 3NWGA 3U1MA 1R8HA 3IO1A 5DDPC 1T03A 3KKFA 1HBMA 2VA2A 5FJ4A 4QPXA 3T5LA 3ULHA 5F8HA 4DN9A 5KFKA 2G0CA 4XK8C 2WTFA 3OQ2A 2ADCA 1JLQB 2HGMA 4WYLA 4RW6B 3TVZA 2MKCA 3SCJE 1FTCA 4Q2LA 3VF0B 1O0PA 4I0WA 3BSOA 1OIAA 3C8YA 1FJCA 4IG3B 2VBWA 1YJVA 4Q2MA 2ZJRQ 3LANA 1QVGR 2RQ4A 5BYSA 4IQXA 1T94A 2CFXA 3M9OB 2LEAA 1U1MA 1HYSA 3RW7A 1X5PA 3NLCA 2PMZD 1MSWD 2WSEC 2PGCA 4OI6A 4DN0A 4URGA 2GHPA 4NLGA 3Q2TC 3J7ZT 3MPWA 2QMXA 3CC2S 2HHHF 3PW4A 1Y0HA 1S1VB 5CA5A 1FD2A 4FXDA 1GXLA 3MM5B 2RQMA 1T03B 3DOKB 1SH0A 1RISA 1LK5A 3U1LA 1FJ7A 2VFRA 5J2PA 3BO4A 4QCLA 3ZC4A 2XI3A 5HL7Q 1YRUA 3I5BA 1JLFB 2N7CA 2AYGA 1PGZA 3KLEB 3G4SS 1R0AB 1RT6B 1GXTA 2B7CB 2KDOA 4IFYB 2K2PA 4N8OA 1N33F 2R8GA 2P6SA 3CCZA 3I4HX 3T1AA 2DGTA 2DK2A 1LFPA 4OHXA 2ZFHA 5LJ3Y 4D3HA 4PQUB 2LQ5A 4URQU 3AB2B 3OVAA 2QV6A 3PFOA 3S8SA 3KJVA 1XMQF 1M5VC 5F8IA 4N8NA 1J5EF 4PWUA 2GC8A 4FPRA 2DT9A 1FRIA 2VUGA 3BGRB 2HFZA 1C1BA 3KFWX 3GIMA 3SYZA 2JHEA 1KC8T 4KHPF 1GTHA 2M9KA 4LFAF 4C8NA 2Q6BA 4BC7A 4F26A 1FA0A 3DOLB 4TYBA 3CC7S 5HP1B 5HMWA 4QYRA 5JXSA 1QJHA 2SXLA 2HNDB 2ZOMA 3CO9A 4NLRA 1RDRA 2QO3A 3L7PA 4KFBA 2HNZB 3MR5A 3IRXA 4RW4B 1Y9OA 4LF6F 1RTIA 4F4XA 2E5GA 1WHWA 3VQTA 3K2YA 1JLBA 2GIRA 2NPIA 4KR0B 3DLJA 1OWXA 3NBPB 4OIXA 2FHKA 1KOHA 1WHVA 3JTNA 3G8QA 5CYQA 4NL5A 5F3TA 2BJEA 1JIHA 2C3OA 4LF8F 5K8OA 4C8KA 3DYAB 1AXQA 2NXUA 2Z8QA 4Y6IA 2LU1A 5C42A 2ALZA 1KFSA 4DR2F 4ZLPA 2XULA 2DNHA 1BGXT 4O3RA 2GX8A 3MR6A 4XPCA 4LMZA 2WAQD 1JMTA 2ASDA 1ZM9A 1YJNS 4K4VA 4BHQA 4RX6A 2ROEA 3EX7B 2GGPB 5L1KA 3OJUA 5DGAA 1XMOF 2CPJA 4RW9B 3PZPA 1FK9A 1HWJA 4Y2MA 3BEGB 3M6VA 2VC1A 1U1LA 3UI3A 1FRKA 1SKRA 5G0RA 1BC6A 1XN9A 3AH6A 3MUMP 3QLHA 3N6MA 3T6JA 4I64A 1M5PC 2VD3A 1VIXA 4AFFA 1BQMA 5K14B 1C2PA 2XCAA 4RW7B 2N3OA 2DIVA 2FJVA 1NK8A 5AXNA 3M2RB 3MAQA 2M8DB 1MW7A 1Z1ZA 4OZ1A 1RTHA 1SQEA 1SV5A 2MZRA 3VQSA 2ZHAA 2IVFB 2MZ1A 2DNQA 3K5NA 3B82A 5F0UA 2V4QA 1U1QA 5KFIA 1HBOA 2KI2A 4CIOA 3O5TB 4YOEA 2UXDF 3NCPA 4KHMA 4NLVA 3VTIA 3P49B 3CJ4A 1TR0A 4A46A 1Z4UA 3KLFB 4O3PA 3CD7A 3UCUP 2W7PA 1YRTA 3N6NA 3V81A 4LQ3A 1YGYA 2AYBA 5KFNA 2ZKTA 4WFXA 1RKIA 1E6VB 2VPXB 5JUMA 4YMEA 4DV0F 4OZLA 4X4NA 5J1EA 2CG4A 4OZ5A 1S9EA 2R7VA 5DQGA 5DDRC 2HHPA 2CJAA 3UNGC 5B0CA 1S1TB 4Q44A 2IMOA 5GADU 2HAIA 2KFYA 2I0XA 4WFZA 4NA2A 2YWHA 1UETA 4NPOA 1IKXB 5K5MA 2N82B 5B0GA 3QGIA 4B3RF 4DQPA 4FF3A 1RP5A 1RTHB 1SV5B 3R5DA 1V3ZA 3J7YI 2RKIB 3PXGa 2PO4A 5D6GA 2RD5C 4RBTA 2K3IA 2W9BB 4R25A 1LXJA 2C22A 3K5LA 2B7BB 2B4PA 4H4OB 2YKNA 1DHMA 4LVNP 3CCMS 3KG1A 4J9SA 4OI3A 1GX5A 4M1KA 1TFYA 1SJRA 4IO1A 6FD1A 2XC9A 3HZGA 4USHA 1WELA 2OFGX 2AGQA 3IN5A 4RW9A 4NMLA 2B9XA 1MMNA 2W7AA 4Q7AA 4YR3A 1UVLA 2CPDA 2W4DA 4N47A 2HS0A 2L41A 3CC4S 2RDIA 5KFEA 2XO7A 5M2UA 1KHWA 3MWBA 3PW5A 3ZZOA 5DDOC 3QO9A 3QAUA 4NOHA 3TAMB 2ZZNA 1L3TA 2CRLA 2J6SA 4MKYA 1XBWA 1D0EA 1F9FA 3VAHA 2FHMA 3PX0A 4EZ6A 2Q6CA 4MIAA 4TU7A 1F5AA 2EK6A 4NLYA 3OBIA 4B08A 2KB2A 1SIZA 4K4TA 1T05B 1IBLF 3GSDA 5IWAF 4WK3A 2WB4A 3BGLA 3MZIA 3IR5B 5DLFA 3SCLE 2V5HG 2CJ9A 2CQBA 4X66F 1IKVB 1Q7LB 4X65F 2WBMA 4IFVA 2PD1A 5H1SV 3CCSS 3DOLA 3V5RA 2A10A 2IM1A 2EKYA 3IR7B 3DRRB 1S1WB 4O4GA 1K1QA 2LEBA 2CQGA 2EFNA 2P9EA 1IR0A 1RT3B 2C3MA 2VBZA 1C1BB 2YNFB 2I5JB 1ZETA 2BXJA 3M30A 2E9ZA 3MMJA 2IHR1 2VH7A 1VGYA 3M8PB 3QZ8A 4QQBA 4TY9A 1N5QA 2Q3PA 2HLTA 3DI6A 4IRKA 3M8QB 5ADZA 4DS5A 2DB1A 2BW2A 3QYYA 5EN1A 2P9CA 3UDLA 4IR1A 5D4PA 2YKAA 1GXUA 4DFJA 3VAGA 2RS2A 1C4CA 1NJZA 1X4DA 5AJ3F 3IFEA 1SKSA 5HLFA 5T41A 4C0BA 2MZSA 5K8MA 5DRKA 1HW8A 4MAKA 5EHHA 2L9NA 1JLFA 3MAHA 1V6HA 4MIBA 4NA1A 2UUWA 4Y28C 5GAEU 1LW2B 5C24A 5L9NA 4UW2A 5LJ5Y 3K8VA 1K0TA 1FDDA 5CHCB 4PG5A 1UA0A 3G86A 1QSLA 1RT7A 2ZKUA 3VZIA 3JSMA 3DMJB 4YB1P 3ZZRA 3OL8A 2P6TA 3V4IB 3IBWA 2IC3A 2QSWA 4C9DA 3MM9B 4K4UA 1DTQA 2FTRA 2K1RA 2EPIA 1KTVA 2UVWA 4FS1A 3H5UA 4EBDA 3KK3B 2QMWA 5D78A 4H4OA 2ZH9A 2FVCA 2XCPA 1D9DA 2GIQA 5AE2A 5CCLA 4X64F 3NCQA 3QGPA 3HKZD 1S77D 1VOMA 1IM4A 4ZDNA 3W2WB 4Y0FA 3MEGB 5AE1A 2XS7A 3GR0A 4PG6A 5IS2A 2U2FA 3NS6A 3DRSB 5A8RA 2IYGA 2W8LA 5CXTA 1X9SA 2FJXA 3OFHA 3DMJA 3WDOA 5EWGA 2J9EA 2LQBA 2G9OA 4ED3A 2GHVC 2MMYA 5DJBA 4B9UA 2VFTA 3FCHA 2WCXA 2HGNA 1TL1B 1IQZA 2HG4A 4A8QA 4RW8A 3OLBA 3GZ7A 2IBOA 4CZCA 1FTRA 3UDCA 1YG0A 5KG0A 1VQPS 2R7RA 3RW6A 4G1PA 5B0FA 2W7OA 3UR0A 2XSJA 1G3OA 1L3KA 1S0VA 3RBDA 3AHPA 1TK5A 1LWEA 4PG8A 2EWHA 2VPWB 4LSNB 1IKYA 2I38A