3ILJA

Crystal structure of e. coli hppk(d95a) in complex with mgampcpp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
158
structure length
158
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLALDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3iljA00
1G4CA 1HKAA 3HCXA 3KUEA 4M5NA 5ETNA 5ETVA 3UDEA 3MCNA 4M5HA 1EQ0A 2F63A 1HQ2A 5ETRA 4M5GA 5ETKA 3ILLA 3HSJA 3HSGA 2QX0A 1CBKA 3KUGA 1RTZA 5ETMA 5ETQA 3HD1A 3UDVA 4CYUB 4M5KA 4AD6A 4M5LA 3ILIA 4CWBA 3QBCA 3IP0A 3HSDA 1RU2A 3UD5A 4M5IA 3HT0A 1TMMA 5ETTA 1F9HA 4M5MA 1IM6A 4PZVA 5ETLA 1TMJA 1EQMA 1Q0NA 1DY3A 5ETSA 3ILJA 1RB0A 2BMBA 1KBRA 3ILOA 3HSZA 1RAOA 3MCOA 4CYUA 3KUHA 3MCMA 5ETOA 3HD2A 1RU1A 1EX8A 4M5JA 2F65A 5ETPA 4CRJA 2CG8A 4F7VA
chains in the Genus database with same CATH superfamily
2BVZA 5IT4A 1BXNA 2OIHA 1LW0B 2GGPA 3SV4A 2J76E 3F73A 1RACB 2YXLA 1LWFB 4ED8A 2HHSA 4ZPCA 2XSJB 4DZDA 2PA3A 2UVVA 4MKBA 2XWYA 5ETKA 3I82A 2DNLA 4DCOB 4NMXA 1WUUA 1GMVA 3RRHA 1RTIB 3C6UA 4RLEA 1DFDA 4B9UA 1AT1B 4OHVA 1TL5A 4CYUB 2HNYB 3WBZA 4P2SA 4F0MA 1EQMA 1T11A 3CCJS 4QR1A 4TLRA 5J1EA 4XAKA 1T9VA 1JJCB 2RHSB 5HROA 4CRJA 3ITHB 1T0TV 2DIUA 4Q8EA 2HRTA 3K5OA 2X3DA 4JI3J 5E0OA 2WTFA 1UFLA 2O3DA 2Z58B 1VFJA 4G1PA 3POTB 1HYSB 4RW9B 3M2VB 2BRLA 3BGRB 3VAMA 2MQLA 4JI5F 1FE4A 4ER8A 4GVBB 2C2RA 2CG4A 3N79A 1R8BA 3DGVA 2HFSA 3JQJA 3IS9A 3OL9A 4LF7J 5E3RA 2P8IA 3IG1A 2HAIA 3DI6B 3PM9A 5K14B 2BV3A 2VL1A 4F0KA 3S01A 3EVMA 1ZOTA 3K2YA 2YWKA 4E8UA 3A3NB 3SCKE 3IBWA 4B3MF 2MZTA 3R2DJ 1MSWD 3QIPB 4NZ6A 2KJVA 1N5YA 1HBUA 1AB8A 5F8HA 2JEJA 1H73A 2M52A 2VBWA 4V19X 2ZEJA 1S6QB 1VHFA 3JTOA 4JP8A 1B99A 2CPHA 3RB4A 5LMNF 5D0EA 3BPSP 4GKJJ 1WF1A 1KOHA 3Q8YA 1W26A 2RILA 5HBMA 5HO4A 1TKXB 4ZLJA 1CJKA 3GSDA 2QYCA 1U26A 2H3EB 1KD1T 3DLEB 3FVYA 1R31A 1F5AA 1Y4ZB 3GFZA 3AJ1A 2G0IA 2ZOMA 3T1YF 1SXLA 4K4XA 4X66F 1UP1A 2CNOB 4ZJLA 4R5PB 1YJVA 3CCSS 1O5JA 2MZ1A 3TA1A 4L74A 5A76A 1R0AB 3UDEA 1PAUB 4J9KA 4NMLA 3MMAA 2AKWB 1VK3A 1XR7A 1S9FA 3IRXB 1JB0C 4Y6IA 3PCOB 1VQMS 3W2WA 1UPMB 3KLEA 1VQ7S 4BC9A 2MQNA 4ZLLA 4OZ0A 1HBOA 3RYLA 2AYBA 2R7UA 4O4GA 3UFCX 3FBEA 3CF5Q 2GIFA 3CNQP 4DR2J 2HK3A 4OYOA 1VC5A 4ZCMA 3IGVA 4LRAA 1RTDB 3Q0AA 3D67A 4ZP8A 2A3JA 1S6PA 2FZCB 3R5JB 3RAXA 2NS1B 1U1KA 2WCXA 3KMSA 3W8PA 1EP4A 4A8SA 4U7CA 3QJJA 1G2EA 3B82A 1IBCB 2O5DA 3C19A 3C16B 3HHDA 1M90T 4JI2J 3FCWA 1RT3B 2HK2A 3G6VA 2UU9F 4KC5A 2QMWA 3V4IA 2R7QA 2W7PA 5EX3A 2QYGA 4CLUA 2IYGA 4M94A 1TL1A 2XWXA 2DH9A 3N0VA 5GAHU 1OQ6A 2G1HA 4MT1A 2HBZB 5CYQA 2AF6A 2XZDB 2C22A 4NX9A 4NLTA 2ZHAA 5D4LA 5C7PA 2FHJD 4H4KC 3M6UA 1S0MA 2B4VA 1FWKA 4HHUA 3DHWC 4LR9A 4OZNA 1T94A 1UZHA 2APOA 1VBZA 2CWXA 1WOOA 5KFTA 2K7KA 4WU2A 5EUHA 3A8JA 4HR2A 3P4UB 3KUEA 2NXEA 2EFVA 4C8NA 4FNHA 3MM6A 4QIFA 5KFSA 3TX8A 2CJQA 2ZC3A 1HMVA 4BWJA 1P1LA 2E7WA 1H38A 2UUBJ 2XLJA 2ZH3A 4NXMF 3F44A 2LXIA 3HFZB 3BR8A 5E2QA 3AY0A 4C48A 2OJ3A 3SV3A 1J27A 2IA6A 1BMQB 1F9FA 3IWLA 4X4PA 4NA3A 1QTNB 2VJVA 2ZZMA 3PO4A 2ZD1A 4LBIA 3BGUA 4EFAC 2MGZB 2BR0A 2IJNA 1BQNB 1S1XA 2EG2A 4ED2A 4YR2A 4B9TA 2CQ1A 2BJ1A 1J5OB 4FPIA 1JLFA 2V5HG 3C14A 3V81B 2FVQA 3TI0A 2AGQA 2AEFA 4ZVRB 2W8LA 2HPUA 1HBNA 1QAYA 2BJ7A 3OJSA 1H98A 2KDOA 4ZVPB 3J7AN 2R7OA 4DSFA 3QZ7A 2VV5A 3QT6A 3DU5A 4IQXA 3KG4A 2ACYA 3G6ES 2Z56B 1JQGA 2OEMA 5KFHA 2E9TA 2W2QP 3V6KA 1OSDA 2BZ2A 3HFKA 3KLGA 1HWIA 1FESA 4TQRA 2KHCA 4FKYA 3CGIA 3Q86A 3KDOA 3WQPA 1PJ5A 1BQMB 1PGZA 2WK4A 2F7VA 2YNHA 1MROB 2F40A 4LFBJ 2ZH4A 5KG7A 5LJ3Y 2Q6CA 1LNQA 4NLSA 1ZM3A 2M4MA 1U2FA 1LW2A 1ZAWA 2GAHC 4F36A 4ELVA 2E7XA 3PJWA 4GC7A 1IWAA 2AJ0A 5CAAA 2F63A 4NEYA 4EK2A 3M8YA 2B7CB 4M1KA 5HAOA 1GXUA 2GIRA 3G9CA 3TZWA 4DL4A 3EPIA 2JFDA 3EVWA 2DPJA 2CWKA 4Q0BA 4LFAJ 4M5KA 2QE5A 2NSBA 3NNHA 3M32A 1P9YA 4LBHA 1F6TA 4YOEA 3FZ2A 4K4UA 2CZ4A 1Q86T 1Q8LA 3ZNJ1 1QAXA 2YKMB 3DKDA 2CQGA 1N32J 1YK9A 1SC4B 2WW4A 3J7YU 4YN3B 4NCGA 3KK2A 1Q8IA 1CJVB 2WRMA 4LF8F 2Q66A 5HJYA 2HQFA 5CCMA 3D6HB 1GX5A 2OPPB 2ZVSA 4IH7A 5D3GA 1R6VA 3MMBA 2DRDA 1O0PA 2KU7A 3B4DA 4P74A 3DU6A 4JYAJ 2W7AA 3IR6B 2K8GA 2UXDF 4DFPA 3CVKA 4PABA 2UXBF 2VG5A 2IDEA 3UDLA 2GZOA 3WDOA 2DITA 1X9MA 3O6QA 4DZ6A 4CO4A 2HHVA 3HVAA 2YWHA 1BWEA 4HTIA 5M2UA 1TUWA 3GCXP 1FRJA 2GNKA 3HLUA 4U8YA 4TVAB 3PW5A 2FYXA 1RP5A 3W62A 1UJ4A 3ZTRA 3Q8PB 1OS5A 3BJYA 2HBQB 4KQZA 1X4EA 2NUUG 2J6SA 4QW9A 5K8PA 4DPTA 4F4ZA 4USVA 3I0SA 4K8RA 2OFHX 3HHKA 1IR0A 2H5IB 3OFFA 5H9EJ 3LWMA 3K89A 1U1LA 3CCZA 4URSA 3QGGA 4DL5A 5ETRA 4NLPA 1SJ3P 4RW4A 4Q2MA 4PWWA 1RT7A 4HYKA 2BKNA 2MKYA 3V2UC 4WFNQ 4KO0B 1FD8A 1R89A 2F8HA 5KFFA 2ZOGA 4ZCKA 2YY3A 5A0YA 1YG0A 1H0HB 2DD8S 1K0TA 2YWGA 3AB4B 3QAUA 3SSRA 2WSFC 3OL8A 4LF5F 2KZMA 2EFOA 2FLLA 4DL2A 1GXTA 3ZZTA 4ECVA 3FC9A 4DF4A 5HJXA 3DDKA 4X62F 3QWUA 2P2CB 1UCNA 1K1SA 4B3RJ 2Y0BB 2YX7A 3CCUS 1R7IA 2QT7A 2ROPA 3D1OA 4NLYA 3FBFA 3MMJA 4A8MP 3BPDA 3EXCX 4DU7A 1D9AA 3NG8A 4HT5A 4JI7F 1OYEA 2HLUA 3VAFA 5L38A 4ZVHA 1HR0J 2CPYA 1UVJA 2XMMA 3MUVP 4NPOA 1ZZNA 5FJ4A 2Z8QA 4DQQA 2FZGB 4KPCA 1Y11A 2XBPA 1SJ1A 3D6FB 1V3SA 3DLLQ 2POKA 5F8JA 1T7PA 4FXDA 4B02A 2IRYA 3SQGA 1DRZA 1XMOF 1JLBB 3KK3A 2LQ9A 4A8OA 2XTJP 2NPFA 5KG2A 3ULHA 3I31A 4PEOA 4IG0B 2BXJA 2EFNA 1M1GA 4ZK7M 1SV5A 4TY8B 3GR1A 3I5CA 3OFHA 4G6VB 2CDQA 2VQEJ 4U9RA 4W4MA 5L1LA 4TU9A 3CJKB 3GV7B 2WB4A 4WPAA 3VHQA 1D3WA 1LWFA 2PGCA 1SL0A 1Z2LA 4NRUA 2LQ5A 1Y0HA 1M5SA 2XSJA 3GJQB 3A4TA 5DDOC 3D66A 3B8HA 5AE3A 1XNRJ 2VFVA 2WSCC 4C3MA 2C2EA 1HIYA 1KVJA 4IYQA 1RTIA 5HANA 2UZAA 2WOMB 2P9CA 4CLWA 1X4GA 1R0CB 3O1LA 1RWVB 3SI8A 3SSSA 4CYUA 3KUHA 1R43A 2KFNA 2AYEA 2A10A 3KDNA 3DLKB 3C2PA 4IDKB 3U7JA 1U48A 5ETQA 3T41A 4RPFA 1NXIA 2FVSA 3QBCA 2RMLA 5ETTA 3IXQA 4OI0A 2DPIA 2JRSA 3SFGA 1RI7A 3VAKA 3SZ2A 1WELA 3V4MA 4LVOP 3DRYA 2DNKA 3ITHA 3H59A 2RDIA 6FD1A 3P45B 4NLGA 4E98A 5HVFA 3BKUA 4XDCA 2MQQA 2N7YA 1OWXA 2IIHA 4YP3A 4L75A 2GQQA 2RQCA 5J2NB 2Z4PA 1RAHB 3POTA 1HYSA 4RW9A 1GH8A 2VC1A 3M6WA 4NEZA 1SH0A 3M2VA 3OPKA 4JV5J 4JI3F 4KSEB 3HFVA 3H4BA 1S57A 3GFHA 3HHLB 3WC0A 2FQQB 1NSPA 4GVBA 3I4HX 4P6QA 5KG0A 1F2HA 3FJ2A 4U7UD 1OMSA 1HI1A 3DI6A 4B3OA 3CT9A 5K14A 2YKQA 1AFIA 3T9ZA 2C28A 1MMLA 3MEGB 1QUVA 1T03B 3ZXWA 4DR1F 3MPVA 4CO2A 4LF7F 5JUMA 3QIPA 5KFVA 3R1HA 3LA0A 2HGMA 4OX9J 3H4DA 3WHIA 1WC6A 5F3ZA 3V6DB 2WAQD 1LEOA 3E3XA 1X4BA 4NA2A 3EZOA 1WHYA 2DKOB 1S59A 2FY8A 1S6QA 2V4JB 1YQHA 2CG8A 1VDHA 2VOPA 4FYDA 3NGUA 1X8DA 3Q22A 5D8HB 1SJQA 2DR9A 1TKXA 4OZLA 2KZZA 5AXKA 3OR2B 4RU2A 4PXDA 3QO9B 4FYYB 4Q7AA 2MLXA 1JLCA 3BSNA 3W5XA 3RBXA 4GKJF 5KFDA 4CIOA 3CO0P 3PX4A 4FBUA 2KXFA 2M3DA 3TA0A 5K9FA 2GMHA 3FKBA 4R5PA 1Q4RA 3P3DA 3S6EA 3UD5A 2FLNA 1R0AA 1URNA 3HPOA 5A6WA 3TWZA 4ZPDA 3OR1B 4XO0A 1C1CB 4I4BA 1RAAB 3KMQA 2KKHA 3SSQA 4EYHB 1RDRA 3IRXA 3EGNA 1D9FA 1QLNA 2V68A 1CEZA 2J9DE 3PW7A 2YQ0A 2K7JA 1GTHA 3SQOP 1FKAF 1CVJA 2IRXA 2CZVC 3R9LA 5DM6Q 2QJ3A 3HT3A 5IT9Y 3RUBL 1FFGB 3D7SB 1RTDA 3NNCA 2MY7A 2DRBA 1HW9A 4LRCA 1UPPA 4FYVB 3EE3A 1IQTA 4DR2F 4NXNJ 1VRUB 3H42A 1SQFA 3TVYA 1UVKA 1YWXA 1TV6B 4OHXA 4ZN3A 3D1HA 4JI1J 1WDDA 3C16A 2CPZA 1IXKA 1Q1KA 4KBIA 5K8NA 1RT3A 2D9OA 3U1MA 2ZBPA 4QZVB 5ETOA 3DXBA 1IKXB 4ICLB 3CJ8A 3NXZA 4R8UA 2Y1LB 1NBEB 3DDNA 3MECB 1HWJA 2AIRB 3IWNC 2OEJA 2R7XA 4P72A 2N82B 5DDPC 2MTLA 2X1FA 4OZ1A 4KT0C 3NWRA 1VGYA 2W9AA 4IRKA 1KQKA 3J81Y 4I6WA 4DL3A 1IKWA 2R8KA 1RXOB 2UUTA 4OIXA 2AMCB 2DYAA 3LO3A 3MDFA 5KT3A 5SUHA 3DCAA 2NREA 2VF3A 4NYZA 4ZPWR 1NU4A 4CO5A 3UQSA 6FDRA 1JXLA 4FXWA 3AXMA 1U2CA 3UR0A 3R5AA 4WIQA 2WB1D 4P7TA 2NZCA 1JXEA 2RF2B 5L1IA 2VC0A 2RUSA 1L3TA 3LPYA 3M1VB 3KWMA 5HK4A 2YKOA 2XS5A 4Q44A 2R7WA 2UUBF 2V9WA 2F4VJ 1MMNA 2Z57B 2IM2A 1TKTB 1RTJB 2MGZA 1RWXB 3AH6A 2KO1A 5MLCV 1BQNA 1CJUB 2EW9A 2XMKA 3K5LA 4F2SA 2J5AA 2E5GA 1H7XA 2VBZA 2HFNA 4MYTA 2IDLA 1J5OA 1SCJB 4CI0B 1B4SA 3V81A 5GAEI 4WKYA 5KG6A 3HF5A 1A6LA 2JWNA 2M9KA 1ROFA 1AXQA 4TYAA 4V1Ak 1UWBB 3AAWB 2KT3A 2ZKUA 2X1GA 1FVQA 2D69A 1T9TA 3K5PA 4CM2A 1K73T 5DQGA 3QFHA 1TL3B 4ZA1A 3C15B 2CJAA 4QJVA 3HD1A 3J7A1 2YH0A 3H25A 4DU8A 1L3KA 3GG1A 1V5VA 1VK8A 2FJWA 1ULRA 2AZ1A 2FLPA 2C3YA 3WIVA 1KVIA 4DPWA 1RZMA 2FJVA 2LQBA 2KI2A 3MCNA 1U6ZA 1BQMA 4I68A 4A46A 2XMUA 3L7OA 4LR8A 4OHWA 4N8OA 4KFBA 1MROA 2ZBQA 4RNFA 1LWCB 3NLCA 2F8MA 2UUAJ 1WC5A 2OH2A 2QA4G 2FVCA 5BXIA 2HNZB 1NSQA 4AE5A 4M95A 2L9DA 3OUYB 1VQLS 2AX0A 2NPIA 2VODA 3DRRB 2BDPA 4RU9A 3RW6A 1Q16B 2CPEA 2ZHOA 5JMNA 1S0OA 1SKWA 2UVWA 2OEKA 4UY85 4KHMA 2LXFA 1IM4A 4ZITA 4DR7J 4H4MB 3P49B 1BY9A 2HEKA 3CIZA 2NXCA 1FVSA 4NZ7A 4RO0A 3TUIC 4KAIA 2MHNA 2Z0GA 3IP0A 3B6BA 5L46A 1VR6A 2YKMA 3AHPA 3UCZP 5IWAJ 2HS3A 4ECZA 4LFAF 4P52A 1NDLA 5EGYA 1U2RA 1RBOB 4A8FA 4WTOB 3HVRA 1GTEA 5KT5A 3UE2A 1WKKA 2OMOA 5KG3A 1A9NB 1N32F 2UXCJ 2OPPA 4PG4A 2DISA 2DR8A 2OTLS 3F41A 5DQHA 2KRBA 5B0DA 3OHBA 1RT5B 3MM7A 2ZOFA 1N5VA 4K4TA 2H48B 4KV8B 3I0RA 2AP6A 3ZZUA 2ZKTA 1EARA 4LSLB 1CS4A 1FRMA 1YVFA 2WVCA 1F5CA 4OYIA 4FYWB 4XPCA 2XHCA 5B08A 2NR0A 1LWXA 4JYAF 1EKRA 4B9NA 5IQ6A 4ECUA 1FT8A 3TVZA 2DXEA 2DTJA 3UCUP 2FC9A 5IT9U 1N36J 2YNFB 1VBYA 2QN6B 4I7FB 2RD5C 5CQGA 2GS8A 3AD7C 1EB0A 4CO3A 2C2MB 4H4OB 4LFCJ 3KG1A 3L7PA 4HKQA 3G71S 1V3RA 2F4FA 1NO8A 4C4WA 3A12A 2HRUA 2QZ8A 2CUYA 1YSJA 2H1YA 3LP2B 3R7SB 4J91A 4R0EA 3IN5A 4ID8A 1OYDA 2HFZA 4KGXB 2Y0SD 4F4WA 2IM0A 4WFZA 2JDJA 2ILZA 2BQRA 1S6UA 3IGNA 3J81U 3QRQA 2PMWA 2QX0A 4DLGA 3TOQA 2MQOA 5E3QA 4KO0A 2MZRA 3OBIA 3RRGA 2B4OA 4N56A 1GAOA 1N5TA 5M2RA 3OHAA 1IJFB 3NCRA 3BO4A 3CD0A 2H51B 4MH8A 5IFMA 5DLGA 4RNNA 4PWDB 2R8IA 3FRZA 1QVFR 3H5YA 1YZ7A 3D0GE 5C25B 3V6HA 4MYUA 2CQ4A 2J0SD 2AT1B 5DLFA 1E6YB 4LQ9A 2GA7A 3ILLA 4RW8B 4ANEA 2KM8B 1NDKA 3DC2A 4DV5J 1RJJA 5FDLA 2XGQA 1K8AT 5KOXA 1N5QA 4NCAA 3HZGA 2DT9A 4ZIVA 5LMNJ 1S48A 4WBFA 5GMDA 3LAKA 2G4BA 2CPFA 2FTRA 3SYZA 4LUBA 4DPOA 4B3RF 5IT0A 1PJ7A 3GIJA 2IC3B 4X64J 4TQSA 1KEKA 2XHWA 4Q5VA 3F0NA 3CB4A 4LBPA 2W2PP 1F1BB 3KXDA 2J9CA 3KLHB 3F56A 4MIWA 4X66J 3MEEA 1D9DA 1CQNA 4DSIA 3CSKA 1HR0F 2CPXA 4P9SA 3UR3C 4B9LA 4G1QB 3BZQA 1JLBA 2MLZA 2QLXA 3TZZA 4IG0A 9ATCB 4UUXA 3IR7B 4EYIB 4TY8A 4X4UA 3RJMB 4KJIA 4X84A 3TJAA 1ZAVA 1DTQB 3I87A 1L3SA 2WBMA 3I9ZA 4CM0A 2LCWA 4C8MA 2GHVC 2FJDB 3IAM9 1BWVA 3CCES 1N4LA 1SKSA 1ZM2A 2QEXS 1P8GA 3CJKA 3BV8A 4DUZJ 4C8KA 2W7OA 3T9NA 3I5AA 1UETA 4X4VA 3M4XA 2WVDA 1FDDA 3W2VB 1N48A 1X7VA 3BQ0A 2JVRA 3MPUB 4UOGA 3SXLA 2JEGA 3Q8VA 1Q78A 3BGFA 3TUPA 2AQ4A 1S1UA 2HVHA 4YS2A 2XNQA 5F8GA 2CQ0A 2HSEB 1WC0A 2YNGA 4QR0A 3UI3A 1ZTTA 3HD2A 1AYEA 1S7IA 3CCVS 1C4AA 1N8RT 1RT1B 4J9PA 3W8GA 2GAGC 1XNRF 5L8RC 4OHYA 3DLKA 4IDKA 4Z7CA 4EO8A 1R8AA 1WSRA 3CC4S 3R5CA 3MWBA 5ITHA 5L1KA 1UW4A 3I6PA 1Q5YA 3NBPA 5GAEU 4Q2LA 2EI5A 4USTA 4JI4J 2VA2A 1VHIA 5I3QA 1NSAA 3H2LA 3B78A 1FK9B 2YPYA 2QLFB 2HMIA 4UY8T 2GQ2A 4WP9A 2O01C 1YRUA 5J2NA 2VDHA 3QGIA 2AV5A 1NKEA 4F7VA 3TX0A 1H2UX 2K3IA 3H98A 4MFBB 1K1QA 1GQEA 5E3PA 1O51A 1FJGF 4WZQA 4N77A 3HHLA 1HNVB 4WYLA 3SCIE 3MR7A 3MEKA 1MN7A 3C6TB 1JLQB 3QNWB 2UUCJ 3EM1A 5KFLA 3O8WA 5L1JA 4JI6J 4JV5F 3LP0B 2LEAA 3HZEA 2R8HA 1XBWA 3QZ8A 3IFEA 1G3OA 1UZDA 1VRQC 1T9UA 5D78A 2R42A 2MMYA 4QWCA 4Y2KA 4LSNB 1WKJA 1AROP 1XWLA 3VVUA 3MEGA 4K59A 3FDSA 1T03A 5C24A 3NS6A 1HW8A 3W66A 1FJCA 2X1BA 2Y1IA 3BBFA 1SQEA 4B08A 4NLXA 3CEDA 4KPYA 1N6QB 3MM9B 1S49A 4OHZA 4OYZA 2A1BA 1NJIT 3QRRA 1QJHA 4OI1A 3HCXA 2VKZG 3ISND 4QU6A 2V4JA 4OX9F 2RRNA 3MAQA 1T9WA 1VIOA 3EMTA 3M8QB 3H20A 2RQKA 1EZZB 5B0BA 1IBMJ 4LT6A 2CAJA 2MLYA 5HP1B 1EQ0A 5U47A 4OV6A 2LFVA 4IRDA 3N4WA 5KFIA 2DNRA 1W2IA 4J9VA 4A8WA 1FNMA 4CDIA 3BO3A 5L9XA 3OR2A 1KHWA 3QO9A 5LSOA 4CLFA 2W9CB 2J8AA 3TARA 3MM8A 1TVRA 1VQ5S 3LTOA 5L9NA 1TL4A 3PVXA 3NOGA 4IOAQ 2NUHA 3Q83A 4EUVA 4F4YA 1TAUA 5K20B 2BBEA 2UP1A 4C8ZA 2F65A 1YHQS 3EGVA 3RZAA 1UL3A 4MKAA 2K3KA 1RWOB 3VQTA 3OR1A 1C1CA 4EMDA 4PPDA 1J5EF 1H72C 5JXSA 2BACA 3JQKA 5K8MA 3MR3A 2PI5A 5ETPA 2QC3A 2E1PA 2ZWPA 3W9IA 1S9EB 2OI2A 8RUCA 1SUQB 4NYOA 1R3NA 2N3LA 3O44A 4AUKA 4N7TA 1FEHA 2IY5B 4NYPA 2LDYA 2JSXA 3QGHA 1WACA 2HWIA 3PEHA 3LP1B 2KM8C 1VRUA 1ZM4A 4M5LA 2HHUA 4KYZA 4M5MA 5CYJA 1TV6A 1NZAA 3CWJA 4DS4A 5FIIA 3GYGA 3N5BA 1Q7LB 3PYFA 2F1FA 4NXNF 4J9OA 3PW4A 2V8DA 1IKXA 2R2RA 1RT4B 4AXIA 4JI1F 2XCPA 5I42B 1IR1A 3C46A 3BN4A 1NPPA 5D77A 4KE5A 2UXDJ 4FVCA 2ATCB 3L95X 5EX0A 1G6BA 1RT2B 4ECYA 5K8OA 4DS5A 5GAGI 1AUDA 1K9MT 4DV3J 2ACMA 4KGKA 1C1BB 2P9EA 3CCMS 3B4MA 4OI3A 3ZZOA 1EX8A 2VDIA 2JOQA 2WONA 2O1PA 1CLFA 3M2UB 2RS8A 4ZPTR 3GFXA 4K50A 4DV0J 1F3VA 2VONA 1LFPA 5CXTA 4N47A 2B6AB 4C8OA 3M1VA 4YY3J 3GFYA 4AFFA 4DG1B 3DMJB 1NJZA 3RBZA 4U96A 2E9ZA 4WJBA 1U49A 3TYTA 1TKTA 1RTJA 2D9PA 4NZ0A 4N41A 2LYVA 1CJUA 3CJRA 3CMQA 4BCAA 1PCAA 3THPA 2XEXA 5KFZA 3UN5A 2V8PA 2F4VF 2VU5A 3DLJA 2H9ZA 3AD8C 3OD2A 4RR5A 3N28A 1L3UA 4DV4F 1C0TB 3DRPA 4I2PB 2KFYA 3UVJB 4BBYA 2W2OP 3OFEA 4DBQA 1X0PA 4AL7A 1UWBA 3FEXB 3ELHA 3TAMB 4ZCIA 4OX8A 2HFOA 4DR3J 1RWNB 2AJ4A 3G96A 1JKHB 4AYBD 1SH2A 1FCAA 1WJ9A 1S99A 3EX7B 1E6VB 4DQSA 4DSEA 4JI0F 1SKRA 5D0HA 1F0XA 2MJNA 3H5UA 1ZPVA 2C42A 1IBLJ 3GPAA 2B9EA 1SC1B 3T1AA 1TL3A 4QPXA 1B0PA 3C15A 5GMEA 2H5EA 1RAFB 3E01B 1RSCA 3JXOA 5F9NA 3CMAS 2ASJA 4JI8J 3VGUA 1RLCL 4RNOA 2NCKL 3PACA 2E5IA 3AXKA 3Q23A 2AU0A 1WWHA 4DR4F 1U1OA 5DZ7A 1VC0A 1KQGB 3N6MA 2ZH2A 1PC4A 1PKUA 3D2WA 1LWCA 5A8WB 5AJ3F 3VWSA 2LQ8A 3W61A 2LU2A 1N34J 3CCTA 3G82B 4IO9Q 1WG1A 2DH8A 4YDXA 3DRSA 2HNZA 2Z2ZA 5T7LB 2XY6A 4U67Q 3FFIA 1SL2A 3OUYA 2Q1LA 3LUYA 4ZVTB 2GFFA 3DRRA 1WHWA 2UUAF 1R27B 3T6JA 1SKUB 2AW0A 2JLGA 3SBMA 4UTGA 4YFUA 4KB7A 2DNOA 2EFGA 3VV2B 3G87A 4H4MA 2HGLA 1XQIA 2RT3A 3OVBA 3FQKA 2L9WA 4ZVOB 2BANA 3P5TL 4HACB 3KYLA 3HDSA 2ZBRA 4NE9C 4ATNA 1BUXA 1KQSR 2RVJA 2LP4A 3K8WA 3QSYB 3QYYA 4ES1A 2HQIA 3DNCA 4DR7F 3M7VA 4PAAA 1Y00A 2R2TA 5CCLA 4WK3A 2V67A 3OTEA 4JOUA 2AGPA 2RNEA 4DX8H 4U7UK 5KT2A 4I1TA 1WOPA 2W4DA 4WU3A 1V9OA 1NHUA 5IWAF 3OL7A 5LT5A 2N4CA 2XMJA 1NM2A 1FI4A 3BB5A 5KFBA 3GJRB 2KHDA 2VQFF 3UN2A 3MPDA 1I1GA 3W3SA 1JLEB 2UXCF 5B0CA 4TXSA 4LRDA 1RHUB 1VQKS 5DQIA 3I56S 4FS2A 3UNGC 3CO9A 4CLLA 3JSBA 3DYAB 3LALA 4EGLA 2YH1A 4J37A 3GYXB 4FF1A 3MEDB 2HVIA 4F02A 1WC3A 1LWEA 3P5BP 4AQYF 4HI1A 2GHPA 2VH7A 2DNNA 3NOCA 1XR5A 2GVDB 3A3PB 1NK9A 4C6AA 4DFMA 1VRTB 3BR9A 4HDGA 2K06A 5DG7A 4I7FA 1N0UA 2VPYB 1DARA 2FJXA 2KN4A 4USJC 1RWUA 1U8WA 1Q8KA 2GVZB 1N36F 3OTCA 1XMBA 2JC0A 4H4OA 3R5GA 4DN9A 1PSDA 4S0MA 3JSRA 4RNMA 1TR0A 1WF0A 3HVTA 3GTYX 1YI2S 1ITPA 3M6XA 2BOAA 1FRHA 5CZVA 5KAKA 4BDPA 3NNAA 3LP2A 3M2RB 4LFCF 1RUSA 2L48A 4YDDB 2CNNB 3CULA 2VHGA 2J0QD 2MKHA 3LGNA 1FWLA 4OI4A 1M5VC 3D3CJ 1MG7A 2ZJPQ 1SJFA 3U1NA 2RB7A 2RKIB 5EWFA 3ADAC 2E1AA 3R8YA 5HVGA 2J6TA 4PG6A 1PYSB 1L3VA 2WZ1A 3CDUA 1IUJA 5E41A 2J9EA 2JHEA 4BS2A 2ATLA 1S79A 3CDAA 2AD9A 2FHOB 4BWMA 3L4BC 2GX8A 2HQCA 2C3MA 1S4FA 1XN9A 4K2XA 4NASA 2AGOA 4PWDA 2DGQA 3RBEA 2IVMA 5IM0B 3CD7A 1DTTB 2B5JB 4JUZA 4DR1J 5C25A 1R8HA 4I56A 3H0PA 5F0WA 1NH7A 2XO7A 1VOMA 2F3JA 1E6YA 1XIQA 4RW8A 4DEZA 2BE2A 3NGRA 1CPZA 1RHRB 1NKCA 3VTIA 3KHHA 5AE1A 3LANA 2AYGA 1EIYB 5CYMB 1RLDA 1KLMB 4QWAA 5KT4A 2DB1A 8AT1B 1B7YB 1A7GE 1J2VA 1VQSA 4DV5F 1N0VC 4DFKA 2B3TB 3P8BB 4F25A 3UCGA 2DGXA 3QLHB 2HZAA 5A6PA 2IC3A 1HQUB 1HBMA 2MQ8A 3K0JA 4CT8A 2V50A 3HI9A 1XK8A 3IG1B 1NEEA 4ELUA 1S1WA 1FXDA 3KLHA 3J80Y 3ZO7A 4X64F 1BE4A 4L3NA 4F2RA 4RW7A 2NYHA 2F9JA 1WDTA 4ECSA 1S72S 4WTYA 4J5OA 4FKXA 1N88A 4B9SA 2I0XA 2CNLB 1UEVA 3C66A 3LW5C 1U6FA 4O3PA 4DUTA 4CZCA 2XS7A 1OY8A 1BHNA 3KLIB 4PRFA 1DTQA 1I6JA 3ZTQA 3QT5A 4DPYA 4WK1A 2FIUA 4RZRA 3W2VA 2CNKB 4TYBA 3PR4A 1H2TZ 3K57A 1KKHA 4QIWD 3R7BB 1T02A 2O67A 3CJ3A 2DO0A 4DUZF 4KHRA 1S7HA 5HLFB 2XB2D 4MK9A 4U6PA 2MKKA 5HQMA 5LXRA 1Y9OA 4KH1B 5D4OA 1BC6A 5LSRA 4ZN1A 2IM1A 3DLBA 4IFVB 1RT1A 3PHTA 4KHPJ 2XYHB 5B0EA 5F9LA 2VFTA 3AA8A 2VG6B 5KFYA 3JQMA 4CTAB 4Y0FA 1VYAA 3GJTB 1FXLA 2Y8YA 3LPEA 3NS5A 2G2ZA 2HHXA 2MB0B 3UN3A 1WEYA 3AT1B 3MM5A 4ED4A 1IR2A 2I38A 3RAQA 3R97A 2DR7A 1FK9A 4CLPA 2HRYA 1N54B 4WP3A 1UKUA 1C2PA 1Z1ZA 2BYCA 3TA2A 4JI4F 2FJAB 3FQLA 4DR6F 4DDFA 3C8YA 4MFBA 1RA6A 2ZM6J 5BYSA 3T5JA 4J9SA 3GE9A 2CRLA 1KOOA 5IXUA 3EVOA 1N52B 4B3SJ 4MIAA 4X4SA 4F3MA 1JNRB 4FBTA 1HNVA 1MWYA 2UV8A 4ANCA 3C6TA 5CYQB 1S0VA 2JFKA 2VPWB 1JLQA 1SBRA 2IFXA 3EZUA 3LP0A 5M2PA 5F8MA 1TFWA 2E5LJ 5J2QB 2XO6A 4LSNA 1RAJA 1UJ5A 4OYBA 1YDLA 3AD9C 3TO8A 1FNOA 2UUCF 2PA8D 3TQEA 4DHVA 1OQ3A 4DUYJ 4PR6A 4JI6F 3FK4A 2B43A 1Q8BA 1X4FA 3MOZA 3K59A 1N6QA 4M5GA 5DRKA 3MM9A 2CVIA 1PC5A 2CQIA 2EFPA 2BKPA 2HQDA 3MFHA 4BHQA 3E8OA 5G0RB 3KLFB 3ETMA 3RGIA 2C2OB 1FF2A 3M8QA 2LECA 1LK5A 2EWHA 1FA0A 3CJ0A 2ZITA 3TNVA 3AODA 1YRXA 5HP1A 3MR5A 2Z2MA 1NHKL 4FNIA 5KFJA 1UVMA 3VAHA 2WHOA 4LMZA 1MLAA 1IBMF 3EYZA 2W9CA 3NCPA 3AOCA 3QAEA 1PILA 1IKVA 2GQCA 4MMOA 2W01A 1HHSA 3RR8A 2B9YA 2D3ZA 4DV2J 3UDVA 1T3OA 3OJUA 3RAMA 3C14B 2RU9A 4ZCLA 1RB0A 1U0HB 2CJXB 2LU1A 2NYIA 2ZH8A 2DIVA 3T1HF 3LGHA 2QLWA 2R7SA 2MQPA 3AB2B 1BD6A 3ZFVA 1SQGA 2EBGA 2HFUA 1C4CA 2QV6A 2OTJS 2HURA 3UD4P 1S9EA 1SUQA 1HHTP 2G2YA 3K7RA 4WIIA 2QIFA 4Y65A 1DQAA 4KY3A 1N5SA 3CIMA 2RRAA 1P1TA 2ZWOA 3LP1A 5DS7A 2BMBA 3JYTB 1Q53A 2AHOB 2I6WA 1WHVA 2IRUA 2KFZA 5DM7Q 4PKDB 5HQ8A 3MF5A 2DHGA 4A8KA 4MIBA 1IN0A 4C98A 2XC9A 2YNHB 4EWTA 4DV1J 2MZQA 2A6MA 1S1VB 2N7CA 5KFQA 4B9VA 1RCXB 3OLAA 1LW2B 1RT4A 4ID5B 3T5KA 4K5SA 3J80U 1RTHA 1WF2A 2JEIA 1KS2A 4TNOA 1XNQJ 5CA5A 1KONA 2A18A 2L08A 2GCFA 4HHJA 3DN9A 4O0NA 4QR2A 1XC9A 3ZTSA 4ZP9A 1CG2A 2ZH1A 3ONQA 2E7VA 3SCJE 1YZ6A 2VG7B 3ISNC 4NI2B 1FWPA 2LQJA 4IG3B 3NGDA 3KLVA 1QE1A 1V6HA 4IO1A 3WX4A 2FDNA 1RT2A 5E33A 3PIPQ 3NL0A 3AJDA 2XMAA 5KT6A 4HEA9 4DR5J 3VAJA 3VR1A 5I3PA 2XULA 3U1LA 3CE8A 1C1BA 3FEYB 5J2PB 2NXJA 2YKPA 2DGTA 4UF4A 1EETA 1VC6A 2JX2A 1A0OB 1Y10A 4B17A 2W2MP 4J90A 3MCMA 4DV3F 3M2UA 1VIXA 3PYDA 1QDUB 1U1QA 4L73A 2AJ1A 3W65A 1S9GA 2XM3A 1FEEA 4YHHJ 1N56A 3HHNB 1YJUA 2VUGA 4C8LA 4ED6A 3ZZ0A 1F5BA 2B6AA 2BX6A 5KFGA 3HM9A 3GQCA 3CCLS 1LXJA 2DK2A 2DGWA 3IM9A 4DG1A 3R7NB 3DMJA 1YJ9S 4DV0F 5KFOA 1RWKB 2X7IA 1Q81T 1RABB 4F04B 4DX7A 2B4PA 4HH0A 4YY3F 2XS2A 2R9LA 1YBTA 2QL7B 2CQ2A 2KYZA 4K5RA 4ENOA 1TUVA 2YNIB 1C0TA 3S8SA 1MU2B 4C0BA 2KXNB 4I2PA 2MXYA 1Y3KA 2IPOB 3UVJA 4F4KA 3OXLA 1YKWA 2ILYA 4ECQA 3TAMA 2DEIA 1JKHA 2MSTA 2ZHBA 3D0HE 1E6VA 2DNHA 1NKBA 5BJRA 3C3LA 1VJWA 4LF1A 3HX9A 2R3VA 3MAAB 2DCLA 1D0EA 4DR3F 2VZ9A 1RT6B 2LXUA 4NRTA 4QWBA 3E01A 2P6SA 2QRRA 3D68A 3HSZA 4I6YA 1IBLF 1QTMA 5GAHI 1YGYA 4M5NA 1NZ8A 4O3QA 5AE2A 4DMZA 4WZMA 2NZ4A 4OFZA 2QLJB 1YBAA 4LIRA 5KFNA 4RNHA 4RW4B 5D4NA 4JI8F 1VJQA 2QMXA 2HQ3A 2CPJA 5A8WA 3G82A 3I4PA 2OELA 2F8EX 3TAPA 1RAEB 2ALYB 4RL1A 3RU0A 1X5SA 1KFSA 4WXWA 4ZVSB 2J7KA 4OL8A 1UAWA 2NSCA 2B9WA 1N34F 1SVDA 2LEBA 1NHVA 3MFIA 2LMIA 3TW0A 1XTZA 4RBUA 2K1RA 5DO2A 2NLWA 1NAQA 2ROEA 2EBEA 4RJVA 2VPXB 4HACA 4H4KA 5DDRC 3V5RA 4FS1A 2KH9A 1O6XA 3IO1A 3L3CA 5HN0A 3FSYA 1SH3A 2ZH7A 2LA4A 3HXMA 3G6YA 3R5BA 5DGBA 3SIPB 4QWEA 4NLUA 3IC1A 1ZYQA 3TANA 3TRGA 2LDIA 2EKNA 2O66A 2AEMA 4LREA 2IMWP 2LKZA 1KVKA 4EBEA 1VQYA 2BJEA 2AJQA 2MJUA 5F41A 4OI2A 4FZVA 2XLIA 2WVEA 2OKQA 5LM7E 4DPUA 4O0IA 5B0AA 1U8SA 2MZSA 3BGLA 4DQRA 4PXCA 2FLOA 4RW6B 1JLEA 2Z2LA 1LW0A 4PXEA 4FF2A 2KVQE 3MI7X 1GMUA 2KRRA 2MKJA 3K58A 2ROGA 3DYAA 3K8VA 3PW2A 2F9DA 3SQGB 1HLWA 4ZP7A 1REGX 5GMKa 4X4RA 3MEDA 3DOKB 1NK6A 4PZVA 4OZ5A 4EBCA 1DY3A 4A48A 1FDAA 1KP6A 3KJFB 1OIAA 1VQ4S 4FF3A 1UVIA 2GVDA 3KJVB 3A13A 2JL9A 5C5JA 5KFRA 1GXLA 1VRTA 2QFIA 2XYPB 4Z2XA 3UPFA 2PSZA 4PYAA 5T14A 1ZBTA 2HNYA 3WIUA 3HULA 1KHVA 4R25A 2DNGA 2GVZA 3GV5B 4LR7A 4UZCA 1PG5B 4KGMA 4EO6A 4YQWA 1F9EB 4PG7A 3QT7A 2U2FA 3JB9k 2BJ8A 3VGSA 4B9MA 2BW7A 2I5JB 4QW8A 3U02A 2DY9A 3PRBA 3M2RA 3VVTA 1JMTA 1YJNS 2DNPA 4M5DB 1JX4A 4Q43A 3O3LA 4USHA 1O8BA 1SC6A 4CLSA 3PV8A 2RKIA 2Y1RI 4CT9A 2YQ3A 1FJGJ 1DHMA 1HQ2A 3THVA 4O23A 1X9SA 3GMGA 2UV8G 3D3BJ 3UW1A 1Q82T 1KBRA 3BGRA 1FFWB 2DXDA 4J9QA 3FSIA 3QWPA 2DR5A 5KFAA 3GONA 3OVSA 2QFJA 2CA9A 1WG4A 4RUHA 5IM0A 3J7YI 3N01A 1DTTA 2B5JA 2KVIA 5E7OB 1OPIA 1VLOA 3LOUA 4OJGA 4XK8C 1RGVA 3ET6B 2QO3A 3WC2A 3OVAA 2A2DA 4GO5X 1IVZA 2MQMA 4PWUA 1NSKL 3RBDA 1BLUA 2J8SA 3BSAA 3OW2R 2FGOA 4Q8FA 2X3GA 3TR5A 2DGOA 3FCHA 5CYMA 4RUBA 3MHYA 2ZC4A 1KLMA 2DO4A 2MPUA 4V19J 5AXMA 4C3LA 4DI6A 1LK7A 2QG9B 3KHLA 4WXOA 3EGZA 2W4PA 4UT4A 3H40A 3QLHA 1HQUA 1TU0B 1TKZB 3OL6A 2PN6A 5GVQA 2WBRA 2QA1A 5I3UB 3OLBA 4B3OB 4ECWA 4CQ1A 4YUDA 4KGVB 2AEJA 2E29A 3PFEA 2LEPA 4EEYA 2VKRA 2R7TA 3DLEA 2DR6A 5RUBA 1QUPA 2I2YA 1CQMA 3CMES 2R2SA 1J5EJ 2GO9A 1FRIA 9RUBA 4ZMMA 3FRYA 3PEJA 3KLIA 1WG5A 2OPRB 4L6V3 3H5XA 4C11B 3NCQA 1NUEA 1REVB 3B54A 2HS0A 3OSNA 1HHQA 3IWXA 3TJ9A 2XI3A 2HHWA 3QQCD 4YR3A 3Q89A 2P9GA 1KR4A 4UOHA 2HW3A 2DJWA 3ZC4A 2W24A 3G6XA 1X4CA 2BKOA 4C9DA 1H2VZ 2VBYA 3GB0A 3ILOA 4ANDA 1Q5VA 1JLCB 1UJ6A 3SFUA 1UFKA 3NAIA 4NLVA 3HO1A 1RTZA 4WWSA 5HLFA 2C3UA 1N33J 2RRBA 1CULB 4IR9A 2E1CA 4JV0A 4IRCA 3PJ9A 4YB1P 5H9FK 1AZSB 1GEHA 4DFJA 3SCLE 3KK1B 5EWGA 1PYTA 4IFVA 2D3OR 3MPWA 3UNYA 3Q8SB 1X4AA 2HNDB 2FB0A 2VG6A 2RUGA 3W7BA 2RAQA 4Y2AA 4CTAA 2HHHJ 2UUWA 1CC7A 3DDIA 2RQ4A 1HNIB 4KHPF 4U8VA 3HSDA 2HLTA 2QSFA 3AJ2A 3GU0A 3JTPA 3R6LB 1FRKA 2V0NA 1D09B 1AW0A 4Y3CA 2JC1A 4HT7A 3NWGA 2BUNA 4A47A 4URQU 5F0UA 1D8YA 4DSKA 4C8YA 1TK8A 1DBDA 2LVWA 1ZZFA 5E5NA 3T6BA 3G8TA 2LLZA 4HTJA 4TN2A 3QATA 2IVYA 3JSMB 3RG6A 4ERDA 4AL6A 3MMCB 1MW7A 4DX6A 1M0SA 5LSLA 4EI2A 2VASA 1T8EA 4R8UB 1NK8A 2KJWA 3BKTA 4IH6A 4P73A 1UA0A 1VQ6S 2FPHX 2PFDA 1FE0A 5ETNA 4ZPBA 2ZM6F 3HSJA 5L39A 3ZNUA 1WI8A 3GSIA 4Q45A 2G0CA 2SXLA 4B3SF 4HL9A 4TY9A 5J2QA 3G4SS 1IKWB 4Y2MA 3HHLD 2Q43A 1KNZA 6AT1B 3NGKA 2VB6A 4DV4J 3CJSA 4FYXB 1UTAA 2E5LF 4YR0A 3HK2A 3D1QA 3NP5A 4BLGA 1EJ7L 4JV1A 1OY6A 2C2DA 4UOCA 4PQAA 1K0VA 1SB6A 4X4OA 4DUYF 1FD2A 1HARA 1UVLA 1JIHA 5IS2A 4G3IA 3FEZA 3QSIA 5G0RA 3KLFA 4JI0J 3M8SA 1YLXA 2A6OA 1KTVA 1XEZA 3CDBA 1RYSA 5BYRA 1S4EA 3D54A 3W60A 2RH3A 2QA2A 4OZ2A 3BSCA 4RUCA 3OTDA 1NPKA 2CJYB 2VBXA 2H4WB 1S1TB 4X4NA 4DR4J 4ZP6A 1HFEL 4QWDA 1FKOB 4X4QA 3CW2C 3VGVA 4DV7J 5AJ3J 4DL6A 4F26A 4X4TA 2W9BB 1RCOB 2ZBIA 4O3RA 1U0HA 1YX2A 3BSOA 3ZZYA 1B64A 3PYGA 4DV2F 1MWQA 1RBAA 1HNXJ 4L3KA 2ZJRQ 4LF4F 2A2CA 3BF4A 3R27A 4I0WA 3QIDA 4RX6A 3A8EA 5ETLA 4MTPA 2Z2YB 5B0GA 1XMQF 4RBVA 4PUOB 1FJEB 3G86A 5A8RB 3NEKA 5CH7B 1FKPB 1U45A 1U6BA 3JYTA 4GKKJ 5A2QY 1OJ4A 2G9OA 2D74B 5J2MB 2V8VA 2CIMA 4RWXA 1B0TA 2BE7D 4IQMA 4KFBB 2ZDOA 4LRBA 4E0DA 2R8GA 1S1VA 3OTBA 3M8ZA 1FHTA 2XGPA 4FDFA 4ID5A 3FNNA 5KFPA 3QFWA 3W5YA 3CCWA 4DV1F 3KUGA 1CJVA 2VQFJ 2M0GB 3KJQB 2GJ2A 4J7CA 2VG7A 4NI2A 2BQ3A 1LV5A 2CJBA 4IG3A 1XNQF 1T05B 2VFUA 1T9YA 4FPRA 3MD1A 4CLTA 4KRWA 2R7RA 3MD3A 2IMOA 1WD6A 2D3UA 3FSXA 1HWKA 3FUYA 4AQYJ 5HMZA 4FVMA 5J2PA 4A8QA 5KFUA 2V8GA 2HHQA 1TQLA 3O2IA 3W1YC 3US5A 4LJMA 4OJ1A 4DR5F 3MPYA 1ICEB 1UEUA 3ZZPA 1GMWA 4OYMA 3NGTA 3MUMP 3GIIA 3BN7A 1ZPWX 2GJIA 3DOMB 1I51B 3HJVA 1AUSL 1SJRA 7AT1B 1X4HA 1KTQA 3MXHP 1XR6A 3MM7B 3KHGA 4YHHF 4DL7A 5F3TA 2WSEC 2NXNA 3I0RB 3NAHA 4ZHRB 1CS4B 4RKUC 3R3TA 1BGXT 3I32A 3ZTOA 3GJSB 4P75A 4RUAA 3PIOQ 1NJXA 5E3CA 2V94A 2XG8A 5EHHA 2YNIA 4ILRA 3R6GB 1F60B 2G13A 1QY7A 1MU2A 3JAMY 2OLWA 5A8KB 2CDRB 1NK5A 4F67A 3OV7A 1GT8A 4JV2A 2YQ1A 2MSSA 4Y28C 2AJFE 3DM2B 4DQIA 4OV1A 5IV3A 4X2BA 3G8SA 4CNYA 3BGOP 3NS7B 4CH1A 4ZS6A 3EWGA 3S1TA 3MAAA 3Q2SC 4PG5A 1KRPA 2FD2A 2E5HA 1RT6A 1SPBP 2DVIA 4B3TJ 1YJWS 2PO4A 3AOBA 2V4RA 2GW8A 1Q95G 4KGZB 4AD6A 4YB6A 5CD4H 2HKEA 2JLFA 2RQMA 2ZBCA 4C3KA 1TMJA 1G4CA 1S12A 4HDHA 1U1PA 2M5YA 4XIUA 3PHEA 3A8IA 3ISZA 1YJRA 2PT0A 3EGWB 5DDQC 4ES2A 2OGUA 2MY8A 3ZZZA 4CLYA 1T3NA 1MN9A 3MOJB 3ETOA 1QSSA 2HVZA 4DPXA 4I69A 1S97A 4WKRA 2QLBB 1JWWA 3PW0A 2BOPA 4J9LA 2YX1A 2V6AA 2K2PA 1RWPB 2VJUA 3HSGA 1Q7YT 4L76A 1ZAXA 3CJ5A 3VQSA 4ZIWA 4ZPAA 5HMXA 3ENQA 4CWBA 1I94J 2Y1JA 2BJ9A 3KHRA 2RSQA 5D0RA 2QL5B 2HQGA 1U02A 5FDLB 1B7FA 4BC7A 5IV4A 3PX6A 5I4MA 2P6TA 3KG0A 2ADBA 4LF9J 1R6YA 3HT0A 4IUFA 2B8PA 3O5TB 1NDCA 1WC1A 1JK9B 4I6AA 1U09A 4DCPB 3IA0A 1NMEB 2EVZA 4ED5A 4GVLA 4KH0B 1ZH5A 4UZBA 4C0HA 2KT2A 4OZJA 1T95A 3FMWA 1LXNA 3A8KA 4RW6A 2JH3A 3LAMA 1FTRA 3MEEB 5HSPA 3MR2A 4FXVA 4C2MA 5C42B 5KFCA 4LQ3A 3R2CJ 4PG8A 2VIHA 2NQPA 4OYWA 2M88A 3DOKA 5B09A 2YKNB 1SIWB 3J7Z5 4NL5A 3OTOJ 2IAJB 1QSLA 1ZTWA 2M70A 3KKFA 1NLKL 3KJVA 5IQQA 1HPZB 2CPIA 2WOMA 3MCOA 3OQ2A 3LF0A 1CSJA 2BW2A 3CC7S 1DLOB 2I9SA 4A8XA 1G1XA 1VI7A 3WZ0A 2FZKB 3GV8B 4K0KJ 2PIIA 5A2QU 2CPDA 4URGA 2RDJA 2JVOA 5CHCB 1M5HA 2AYMA 1S10A 5F8IA 3Q24A 1NH8A 4Y2IA 2QSWA 4ETXA 2ZZTA 2E9RX 1VCTA 1ZA1B 1IQZA 2I5JA 2L9NA 2DH7A 3BDEA 1JLAB 2OD6A 4D3GA 1GK8A 1NPRA 1S1UB 3Q8RB 3VF0B 2H5JB 2G0JA 1XJWB 4DR6J 2IBOA 1U1RA 1RQ0A 3OXFA 2YNGB 4M5DA 3IAS9 3THTA 5KFXA 4KIAA 4WE1B 1KDNA 3BEGB 1DAXA 4MK8A 3R5DA 2HAFA 4USMA 3ILIA 2ALZA 4MKVA 2KG1A 1RU2A 4QIGA 2OPQB 3HJFA 4RBTA 1V3ZA 2DGSA 1YJTA 4R0JA 1FFSB 2FHJA 4ZJQA 5KFMA 1MMDA 4O4RA 4P10A 2MKSA 2VOOA 2EC2A 1RADB 4KKOB 1WTFA 4F3QA 1HNWJ 5H9FJ 2D7SA 3NBPB 4PXBA 3QT8A 3M30B 5D4PA 3PXGa 2EC0A 1M5KC 4ZVEA 1NCLA 2CQ3A 1HWUA 2RJZA 3ET6A 4IH5A 1GX6A 2AX1A 4J9NA 1CJTB 1VQ8S 2DNQA 1WEZA 4MAKA 1RU1A 2HMIB 2B8QA 4HLBA 4WP8A 3ZTPA 4F4AA 1URRA 1VQ9S 4D3HA 2IJFA 2DGUA 2J0WA 2VFSA 3V6DA 1FRXA 1NRKA 4F3OA 1PO6A 5JVHQ 4QU7A 2MYFA 1VQPS 3J81j 1TUGB 1NJYA 2OSQA 2XYGB 2ZZNA 1TKZA 2C1EB 2W25A 1HI0P 2EG1A 1U47A 3AA9A 5I3UA 3ENVA 3JAMU 2ERRA 4P7VA 4CNZA 1QSYA 4Z7YA 3VGTA 3UD3P 2IVFB 2J7WA 5C24B 1Q0NA 3CJTA 5ETSA 7FDRA 3CD5A 3H90A 4DN0A 2H65B 3LQVA 5FLXY 5HI7A 2XMWA 2N3OA 3T1HJ 4PCQA 3CCRS 3I9V9 4NLOA 2ZE2B 3GILA 2AJ2A 3EDQB 2OPRA 4ECTA 4QIEA 4QIVA 1S6OA 4C11A 4JB8B 3ENWA 1REVA 2VPZB 3QGPA 3DOLB 4I2QB 2RDDA 4LIWA 1B0VA 1JLGB 3PX0A 4K7QA 1QAIA 4QYZK 1U24A 4YB7A 4LF6J 1WI6A 2B51A 1HL6A 5CABA 4CLKA 4I67A 1RHJB 1M1HA 3P96A 1UMJA 2COLA 3MM8B 1TVRB 2CXEA 5KG4A 1CULA 1KLNA 4HHHA 3W64A 2HIYA 1HNZJ 1AZSA 3V6JA 4OLPA 4WYWA 4EZ6A 3KK1A 3DHXA 3SMZA 4O3SA 3PDNA 1ZS6A 1UVNA 5F8LA 5THWA 1JJ2R 1N33F 4IOBA 3TUZC 3KJNB 2HNDA 1H74A 3M6VA 2PE8A 1FDNA 4ICLA 2VD3A 2PC6A 2W8KA 2HYIB 3N6LA 2V2VA 1WEXA 3MECA 1HNIA 1OSCA 1HKAA 3CUNA 3E2EA 4NLWA 2Z30B 1WKLA 1WOSA 2R8JA 5J1PA 5LL6d 2FJEB 4QYRA 3TEHB 1R8PA 2HHHF 3VZHA 2AWZA 2X1AA 4OMFG 3SEOA 3TEGA 5D6GA 1YBUA 2ASYA 3PJXA 2CYYA 4M5IA 5CD4A 3JSMA 1X5OA 3M9OB 1D1UA 3PO5A 3RW7A 3MMCA 4IFYB 3IR5B 2QTWA 2B0GA 1YITS 5BR8J 3N9UC 2FHMA 2DEJA 4JI2F 1HD0A 2RF2A 4TU7A 3DGPB 1FX2A 4P2MA 2JNJA 3X3UA 5K5MA 3MTKA 2OO4A 3SDEB 4DCJB 2BM1A 1H6KX 4IOCQ 2GV1A 4L72B 2YBVA 4J9UE 5LJ5Y 3FZBA 2M8HA 3MURP 2LA6A 2YKAA 2QA4S 2A0FB 1S0NA 3HKZD 2FY1A 2WONB 3DLGB 1DURA 1I5OB 4HVZA 4W98A 3D9BA 3Q8QB 3AFGA 1G7CB 3J7ZT 5IC4B 1SC3B 2WVFA 3MUTP 3IBCB 1IBKJ 3W63A 2BEFA 2BE9B 2OFGX 3PTWA 2C2NA 2OHDA 1C0UB 1IWGA 1HA1A 2OPSB 4K4WA 1S1TA 4USIA 2BABA 2HVDA 1RAOA 4DV6J 1M5OC 5LOQA 2XY5A 4M63A 3K17A 2QGFB 4N76A 4P71A 3N6NA 5D0GA 1FKOA 1JNZB 5BYQA 1F2GA 2BQUA 1HQEB 3DRPB 2W9BA 1TKDA 1FTCA 3RRKA 3W9HA 2ZJQQ 2AZ3A 2GC8A 3D6TB 4DV7F 2RIJA 2FGCA 4FN5A 2JZ5A 1SI9A 5MAOA 1K44A 4PQUB 4X65J 1WORA 3D4JA 1SL1A 1QM9A 2XMTA 1HNXF 1YIJS 1TL7B 4PUOA 5A8RA 1P6TA 3IRWP 1FKPA 3A3OB 5EDWA 7FD1A 1KWMA 3KTQA 2DHSA 4HH1A 3W9JA 5J2MA 2DNMA 1W2BR 1FJ7A 2YWEA 2RE1A 1UFWA 1S76D 2ZFHA 1WTBA 4GKKF 3HHLC 5GADI 3TVKA 2J7UA 1NB7A 2CFXA 5KFWA 1PJ6A 4LVNP 3TP2A 3CDEA 1RA7A 1EHWA 3DRSB 3H5SA 3FFIB 8ATCB 2CJ9A 4E2FB 3UWTA 4O44B 4LFBF 1B3TA 1RAIB 1RE1B 3A1YG 1ZM9A 4OX7A 2W1BA 3LGMA 5AT1B 1T05A 5FLXU 3AQOA 1TTHB 4W92B 3Q8UA 5LMUJ 1GNKA 4K4ZA 1W25A 4EZ9A 1RT5A 2YWFA 4OLOA 2MDAA 1NK0A 4M5JA 4WFXA 4KV8A 1S77D 2BANB 2BA9A 3M8PB 4ELTA 4KR0B 3NMAA 1IKYB 4LSLA 3BM7A 3M9NB 4DXLA 4ED7A 1ZA2B 1YTYA 4YEAA 5ADZA 3W5ZA 5EWEA 1LOUA 1PIEA 5SZTA 3CXCR 2OUGA 2BJ3A 3BH7B 4HI2A 4MK7A 2EKYA 3QJPA 3DOMA 4ECXA 3FGVA 2YNFA 2D1CA 2M7SA 4JBCA 2JEFA 4W90B 1WNEA 4OYAA 4C0OC 1RYRA 2KT5A 1TELA 3T5HA 5B7WA 4Z37A 3M8RA 2GGPB 3EJMA 2IYIA 4OQJA 3X1LB 4ZHRA 3PR5B 2DCUB 1UW9A 2EEYA 2HGNA 2PDAA 2HHTA 4QOTA 4USWA 2R2UA 4GMKA 4ZOSA 3GIRA 2E1MC 1LWEB 1PYOB 2PD1A 5A8KA 2M8DB 3UO0A 2B4UA 3RB6A 3C6UB 2KB2A 2G2OA 3DM2A 2WVBA 2D3O1 3GG0A 1DJ0A 1Y5NB 3CJ2A 4QBUA 4ZVFA 3MTJA 2I1RA 3R1LA 2OD4A 4AL5A 3L7UA 2DNYA 1D8ZA 3ENAA 4YMEA 2EK6A 3HVTB 2L41A 5J1EB 2QMUB 3GR0A 1DZ5A 4ED0A 2FC8A 2EK1A 5DETA 5HROB 2RHQB 3BQ1A 4TKTA 5J1NA 4B3TF 1TZ0A 1P27B 1U1MA 1VQNS 5IOLA 2OMLA 4ZLPA 2Y3YA 3BYPA 3BH6B 4YB5A 3GZ7A 2W4CA 2YX4A 4NA1A 2PMHA 3BREA 4K4VA 1RBLA 1CBKA 2KXHA 2YTCA 2ZUGA 4UQGA 4JI5J 4GRSA 3VAIA 3AQPA 4RWWA 2HVEA 2IJRA 1VLYA 2FJBB 4OYPA 3T19A 2IM3A 4ED3A 1FXRA 3BBBA 4WFAQ 2V34A 3D5MA 2DRAA 2CQCA 4A8YA 4CCHA 2KYXA 4F4XA 1X60A 2Q6BA 1X9WA 4B3MJ 4OX6A 3IS9B 1Z2ZA 5KTQA 3NMRA 3GYNA 2CQHA 3GIMA 1VS3A 1FNXH 1JJ4A 3M05A 4K4SA 2B7BB 2BE2B 2DNZA 1FX4A 5KOWA 2Q79A 5DGAA 4G1QA 2J0XA 1I94F 1FERA 4LRFA 4ZPVR 2HG4A 1N5YB 1HBUB 3CJ4A 3RTVA 1GFWB 5FD1A 1I3OB 1NB2A 3PRVA 4A4JA 1H3DA 2XNRA 1X31C 2VICA 1UEKA 4WFBQ 1OO0B 4LF9F 1HBMB 1TAQA 3CJQA 4PPZA 2KTQA 5GAGU 2CVEA 2P5VA 3M9MB 2ZH6A 2PEBA 3MAHA 3TZYA 1FRLA 3WX8A 1JXVA 2E1RA 1S1WB 3T1YJ 5HBMB 3P6YC 4NLRA 1RKIA 4I64A 1CJKB 1PBUA 5KFEA 4RW7B 5C42A 1X4DA 4Y34A 3NY0A 3MZIA 4GO7X 4O3NA 2NXUA 2KG0A 3H7HB 2ABYA 2YWWA 3K5MA 2YKNA 4F50A 1NNDA 2IAJA 2UVRA 1U4BA 2CZ9A 2C3OA 2MEWA 1HPZA 5HL7Q 3EPGA 3T5LA 1CC8A 1DLOA 3MMAB 4UQTA 3CCQS 1WHXA 2VA3A 3H2UB 5F8NA 3JSYA 1Q79A 3W2WB 3OTOF 2B56A 3KLEB 2FUG9 3T3FA 1KQFB 1DQ8A 2KL8A 1VISA 1HBOB 1U1NA 2XLKA 1HD1A 1S5ZA 5HMYA 2M2BA 3HKWA 2DHHA 2VQEF 4J9MA 3IM8A 4O4GB 3IMQJ 4J9RA 4K0KF 1TP7A 4FF4A 1RHKB 4QCLA 2HBRB 2V2ZA 4MKYA 1JLAA 2V9KA 1NK7A 2HIQA 1S6PB 2OSRA 4Y2CA 1EP4B 5JJBA 4DLEA 3TUJC 3L09A 2UU9J 4WE1A 2G1DA 4NLQA 3HHEA 4ETZA 1Y5LB 2E66A 4QYZJ 2OPQA 4NWBA 1QAJA 3HMJG 2EPIA 2R7VA 3V4IB 1KSPA 1R8CA 3FBBA 2C2KB 1TL1B 5HATA 1Y5IB 1RKJA 4WFYA 1RHMB 4KKOA 4IR1A 3BQ2A 3M30A 1TMMA 2HWTA 5HQLA 2JJ4D 3MM5B 4LF2A 2ZH5A 2HWHA 2H54B 3BYRA 2ASDA 5HMWA 2IBKA 2HZCA 2E5JA 1CJTA 2EFQA 3KNGA 3UDCA 1HNWF 3ICLA 1BQXA 5EN1A 2Y9HA 4DL0C 2PMZD 4G65A 2XCAA 2QL9B 1YRTA 4FP9A 4NXMJ 1HI8A 3PG9A 2V4QA 4P2XA 2XY7A 4DWIA 2OP5A 3EUNA 4KTQA 3MM6B 3I55S 1M1KT 2IHR1 2J6UA 2V63A 3JS9A 1HMVB 3GIKA 2H4YB 4DF8A 4GC6A 1AFJA 4WF9Q 5C2GA 3DLHA 1UA1A 1FO1A 5DZ6A 5T41A 1NJWA 1VQOS 2GO8A 1RAGB 4K2JA 3MR6A 2ZNZA 5GADU 2F5GA 2V8HA 4CH7A 2ZD1B 4XPEA 4USKA 3PFOA 1QD1A 1S1XB 2Y8WA 3IBFB 3RR7A 3MGJA 4DQPA 2DXFA 3RB3A 2U1AA 1MWZA 3G8QA 2GMLA 2MHEA 2J9DA 3NRBA 2ZE2A 1JLFB 4CO1A 3MCSA 2DGVA 1F3FA 1ZETA 4ECRA 4LF4J 4MJKA 2GMJA 1KN6A 1HBNB 4M8LA 4IKAA 3D28A 2GHWA 4CP5A 5ETVA 5KG5A 5LXYA 3JTNA 1SJ4P 3DOLA 4I2QA 4ZVGA 1JLGA 2XQCA 1KFDA 1XMQJ 3ZZRA 1RK8A 2BRKA 3DRXA 4OZ3A 3VALA 4OJ3A 3OT9A 4DX5A 4F0HA 4NLDA 4N5SA 2CQDA 2HS4A 1IKVB 3KLGB 1W7WA 1LFWA 5B0FA 5KFKA 1VMBA 3CPWR 3D6MB 4DSLA 4LF6F 3G2XA 2XI2A 1HWLA 2IA0A 3PYEA 2CADA 2CQPA 1OY9A 2ZVIA 3KOAA 2WW8A 3OFGA 1AA1B 3D0IE 5H1SV 1HNZF 2V2QA 4CLZA 2FVRA 4OJHA 2PFFB 2RS2A 3L9ZA 2XZWA 4DSJA 2VFRA 2PEHA 3CDWA 3DXSX 3PZPA 5I42A 1KC8T 3K5NA 2CJKA 3QMQA 2ZUAA 3FCVA 1Y3JA 3N5FA 1UWAA 3PY8A 1IM6A 1EAYC 5DJBA 1L5UA 4Q0BB 3NKYA 3M32B 2YPZA 1MNEA 4XTTA 2W2NP 4P2FA 4LF8J 2X51A 4IFYA 3LH2S 1RHQB 3GLJA 2YVSA 1NK4A 1FDBA 1RTHB 3U27A 1Y7PA 5DG8A 2XZTB 4M5HA 4NCGB 2CKWA 3KK2B 1TK0A 1V5IB 4TLQA 4ZVUB 3DGPA 5BR8F 5D3GB 2UXBJ 1QE1B 3I96A 3MMBB 3KFWX 1RISA 3SDEA 1QVGR 4AT1B 3H2VE 2I8EA 2ZNYA 2HHPA 3H8YA 2RU3A 2C2ZB 3CD6S 1VBXA 3BBCA 1PBAA 2VG5B 1EETB 3BDPA 3GWCA 4ZDNA 4ILMA 2ADCA 1ACMB 3DLGA 4CO0A 1R0BG 3QJLA 3OXGA 5D15A 1S9GB 3PNIA 4ZKAA 2CQBA 2FHKA 2ZDPA 4ITSA 2Q3PA 2B9XA 1ELOA 2EXUA 3CC2S 1F9HA 5C2CA 2C3PA 3TAQA 4USUA 2ZH9A 1T9XA 1WSVA 2HZVA 3QRPA 1C0UA 3Q2TC 1VBKA 2OPSA 1X0FA 1IBKF 3I0SB 3RB0A 2V69A 3GCWP 4QPTA 1EKSA 3S7RA 2UVUA 4Y00A 3VZIA 4C97A 2BM0A 3VCDA 1HQEA 1B70B 5ETMA 4DV6F 4ZVQB 1APSA 4U95A 2GJFA 2DHAA 1DQ9A 1RWMB 4AXJA 3HVWA 1U25A 2N4DA 4K4YA 3GP9A 3ILJA 1P9QC 1TFYA 2XSFA 2OAUA 2D41A 1RT7B 4UW2A 4OI6A 2MKCA 2GIQA 4OYXA 4PQUA 4LSZB 3BS9A 5IC6B 5AXNA 5T7LA 1PAEX 3TQ1A 1K47A 3E51A 4XDDA 4LF5J 1LKZA 4ZJOA 3PKMA 5A0YB 1XERA 1TL7A 5IZHA 4X62J 3EDRB 4ED1A 4X65F 3CTRA 3VAGA 2ASLA 4TU8A 1SIZA 1U0SA 2XMVA 5JVGQ 3OSPA 1LQ9A 4NOHA 5KT7A 2R4FA 3M8WA 4ILLA 4JI7J 2MKIA 1X5PA 4EU0A 1H7WA 2BJDA 1U7LA 2HFVA 5G4DA 3PKYA 3FMBA 4CH0S 1OPZA 4DJBA 5AXLA 4O44A 4H54A 2V2KA 1TK5A 4UUWA 2L3MA 3TJ8A 5CZXA 2DY1A 3PRDA 1M5PC 3HP6A 3TZXA 2DHXA 4PYDA 1X5TA 4G1IA 4QQBA 2MZJA 2K1RB 1XMOJ 4NCBA 4C7QA 4ZLNA 3EICA 3M8PA 1JJHA 1IKYA 2HBYB 4N8NA 5LMUF 3EXYA 5DG9A 3I5BA 3KK3B 2FVPA 2PI4A 1RWWB 4ES3A 5HVHA 1WC4A 1SV5B 4WCEQ 3FBCA 3DFEA 3BO2A 4EBDA 5E3AA 4ALZA 5H9EK 4O3OA 3QPIA 3BKFA 3NGSA 3AOAA 1IJEB 4F8RA 2E44A 1Z4UA 4DOZA 3EZ5A 1YJ7A 2JLEA 4UOFA 3LWLA 1NDPA 2DBBA 1GMWD 5KG1A 3KNAA
chains in the Genus database with same CATH topology
1G4CA 1HKAA 3HCXA 3KUEA 4M5NA 5ETNA 5ETVA 3UDEA 3MCNA 4M5HA 1EQ0A 2F63A 1HQ2A 5ETRA 4M5GA 5ETKA 3ILLA 3HSJA 3HSGA 2QX0A 1CBKA 3KUGA 1RTZA 5ETMA 5ETQA 3HD1A 3UDVA 4CYUB 4M5KA 4AD6A 4M5LA 3ILIA 4CWBA 3QBCA 3IP0A 3HSDA 1RU2A 3UD5A 4M5IA 3HT0A 1TMMA 5ETTA 1F9HA 4M5MA 1IM6A 4PZVA 5ETLA 1TMJA 1EQMA 1Q0NA 1DY3A 5ETSA 3ILJA 1RB0A 2BMBA 1KBRA 3ILOA 3HSZA 1RAOA 3MCOA 4CYUA 3KUHA 3MCMA 5ETOA 3HD2A 1RU1A 1EX8A 4M5JA 2F65A 5ETPA 4CRJA 2CG8A 4F7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4C A;  1HKA A;  3HCX A;  3KUE A;  4M5N A;  5ETN A;  5ETV A;  3UDE A;  3MCN A;  4M5H A;  1EQ0 A;  2F63 A;  1HQ2 A;  5ETR A;  4M5G A;  5ETK A;  3ILL A;  3HSJ A;  3HSG A;  2QX0 A;  1CBK A;  3KUG A;  1RTZ A;  5ETM A;  5ETQ A;  3HD1 A;  3UDV A;  4CYU B;  4M5K A;  4AD6 A;  4M5L A;  3ILI A;  4CWB A;  3QBC A;  3IP0 A;  3HSD A;  1RU2 A;  3UD5 A;  4M5I A;  3HT0 A;  1TMM A;  5ETT A;  1F9H A;  4M5M A;  1IM6 A;  4PZV A;  5ETL A;  1TMJ A;  1EQM A;  1Q0N A;  1DY3 A;  5ETS A;  3ILJ A;  1RB0 A;  2BMB A;  1KBR A;  3ILO A;  3HSZ A;  1RAO A;  3MCO A;  4CYU A;  3KUH A;  3MCM A;  5ETO A;  3HD2 A;  1RU1 A;  1EX8 A;  4M5J A;  2F65 A;  5ETP A;  4CRJ A;  2CG8 A;  4F7V A; 
#chains in the Genus database with same CATH topology
 2BVZ A;  5IT4 A;  1BXN A;  2OIH A;  1LW0 B;  2GGP A;  3SV4 A;  2J76 E;  3F73 A;  1RAC B;  2YXL A;  1LWF B;  4ED8 A;  2HHS A;  4ZPC A;  2XSJ B;  4DZD A;  2PA3 A;  2UVV A;  4MKB A;  2XWY A;  5ETK A;  3I82 A;  2DNL A;  4DCO B;  4NMX A;  1WUU A;  1GMV A;  3RRH A;  1RTI B;  3C6U A;  4RLE A;  1DFD A;  4B9U A;  1AT1 B;  4OHV A;  1TL5 A;  4CYU B;  2HNY B;  3WBZ A;  4P2S A;  4F0M A;  1EQM A;  1T11 A;  3CCJ S;  4QR1 A;  4TLR A;  5J1E A;  4XAK A;  1T9V A;  1JJC B;  2RHS B;  5HRO A;  4CRJ A;  3ITH B;  1T0T V;  2DIU A;  4Q8E A;  2HRT A;  3K5O A;  2X3D A;  4JI3 J;  5E0O A;  2WTF A;  1UFL A;  2O3D A;  2Z58 B;  1VFJ A;  4G1P A;  3POT B;  1HYS B;  4RW9 B;  3M2V B;  2BRL A;  3BGR B;  3VAM A;  2MQL A;  4JI5 F;  1FE4 A;  4ER8 A;  4GVB B;  2C2R A;  2CG4 A;  3N79 A;  1R8B A;  3DGV A;  2HFS A;  3JQJ A;  3IS9 A;  3OL9 A;  4LF7 J;  5E3R A;  2P8I A;  3IG1 A;  2HAI A;  3DI6 B;  3PM9 A;  5K14 B;  2BV3 A;  2VL1 A;  4F0K A;  3S01 A;  3EVM A;  1ZOT A;  3K2Y A;  2YWK A;  4E8U A;  3A3N B;  3SCK E;  3IBW A;  4B3M F;  2MZT A;  3R2D J;  1MSW D;  3QIP B;  4NZ6 A;  2KJV A;  1N5Y A;  1HBU A;  1AB8 A;  5F8H A;  2JEJ A;  1H73 A;  2M52 A;  2VBW A;  4V19 X;  2ZEJ A;  1S6Q B;  1VHF A;  3JTO A;  4JP8 A;  1B99 A;  2CPH A;  3RB4 A;  5LMN F;  5D0E A;  3BPS P;  4GKJ J;  1WF1 A;  1KOH A;  3Q8Y A;  1W26 A;  2RIL A;  5HBM A;  5HO4 A;  1TKX B;  4ZLJ A;  1CJK A;  3GSD A;  2QYC A;  1U26 A;  2H3E B;  1KD1 T;  3DLE B;  3FVY A;  1R31 A;  1F5A A;  1Y4Z B;  3GFZ A;  3AJ1 A;  2G0I A;  2ZOM A;  3T1Y F;  1SXL A;  4K4X A;  4X66 F;  1UP1 A;  2CNO B;  4ZJL A;  4R5P B;  1YJV A;  3CCS S;  1O5J A;  2MZ1 A;  3TA1 A;  4L74 A;  5A76 A;  1R0A B;  3UDE A;  1PAU B;  4J9K A;  4NML A;  3MMA A;  2AKW B;  1VK3 A;  1XR7 A;  1S9F A;  3IRX B;  1JB0 C;  4Y6I A;  3PCO B;  1VQM S;  3W2W A;  1UPM B;  3KLE A;  1VQ7 S;  4BC9 A;  2MQN A;  4ZLL A;  4OZ0 A;  1HBO A;  3RYL A;  2AYB A;  2R7U A;  4O4G A;  3UFC X;  3FBE A;  3CF5 Q;  2GIF A;  3CNQ P;  4DR2 J;  2HK3 A;  4OYO A;  1VC5 A;  4ZCM A;  3IGV A;  4LRA A;  1RTD B;  3Q0A A;  3D67 A;  4ZP8 A;  2A3J A;  1S6P A;  2FZC B;  3R5J B;  3RAX A;  2NS1 B;  1U1K A;  2WCX A;  3KMS A;  3W8P A;  1EP4 A;  4A8S A;  4U7C A;  3QJJ A;  1G2E A;  3B82 A;  1IBC B;  2O5D A;  3C19 A;  3C16 B;  3HHD A;  1M90 T;  4JI2 J;  3FCW A;  1RT3 B;  2HK2 A;  3G6V A;  2UU9 F;  4KC5 A;  2QMW A;  3V4I A;  2R7Q A;  2W7P A;  5EX3 A;  2QYG A;  4CLU A;  2IYG A;  4M94 A;  1TL1 A;  2XWX A;  2DH9 A;  3N0V A;  5GAH U;  1OQ6 A;  2G1H A;  4MT1 A;  2HBZ B;  5CYQ A;  2AF6 A;  2XZD B;  2C22 A;  4NX9 A;  4NLT A;  2ZHA A;  5D4L A;  5C7P A;  2FHJ D;  4H4K C;  3M6U A;  1S0M A;  2B4V A;  1FWK A;  4HHU A;  3DHW C;  4LR9 A;  4OZN A;  1T94 A;  1UZH A;  2APO A;  1VBZ A;  2CWX A;  1WOO A;  5KFT A;  2K7K A;  4WU2 A;  5EUH A;  3A8J A;  4HR2 A;  3P4U B;  3KUE A;  2NXE A;  2EFV A;  4C8N A;  4FNH A;  3MM6 A;  4QIF A;  5KFS A;  3TX8 A;  2CJQ A;  2ZC3 A;  1HMV A;  4BWJ A;  1P1L A;  2E7W A;  1H38 A;  2UUB J;  2XLJ A;  2ZH3 A;  4NXM F;  3F44 A;  2LXI A;  3HFZ B;  3BR8 A;  5E2Q A;  3AY0 A;  4C48 A;  2OJ3 A;  3SV3 A;  1J27 A;  2IA6 A;  1BMQ B;  1F9F A;  3IWL A;  4X4P A;  4NA3 A;  1QTN B;  2VJV A;  2ZZM A;  3PO4 A;  2ZD1 A;  4LBI A;  3BGU A;  4EFA C;  2MGZ B;  2BR0 A;  2IJN A;  1BQN B;  1S1X A;  2EG2 A;  4ED2 A;  4YR2 A;  4B9T A;  2CQ1 A;  2BJ1 A;  1J5O B;  4FPI A;  1JLF A;  2V5H G;  3C14 A;  3V81 B;  2FVQ A;  3TI0 A;  2AGQ A;  2AEF A;  4ZVR B;  2W8L A;  2HPU A;  1HBN A;  1QAY A;  2BJ7 A;  3OJS A;  1H98 A;  2KDO A;  4ZVP B;  3J7A N;  2R7O A;  4DSF A;  3QZ7 A;  2VV5 A;  3QT6 A;  3DU5 A;  4IQX A;  3KG4 A;  2ACY A;  3G6E S;  2Z56 B;  1JQG A;  2OEM A;  5KFH A;  2E9T A;  2W2Q P;  3V6K A;  1OSD A;  2BZ2 A;  3HFK A;  3KLG A;  1HWI A;  1FES A;  4TQR A;  2KHC A;  4FKY A;  3CGI A;  3Q86 A;  3KDO A;  3WQP A;  1PJ5 A;  1BQM B;  1PGZ A;  2WK4 A;  2F7V A;  2YNH A;  1MRO B;  2F40 A;  4LFB J;  2ZH4 A;  5KG7 A;  5LJ3 Y;  2Q6C A;  1LNQ A;  4NLS A;  1ZM3 A;  2M4M A;  1U2F A;  1LW2 A;  1ZAW A;  2GAH C;  4F36 A;  4ELV A;  2E7X A;  3PJW A;  4GC7 A;  1IWA A;  2AJ0 A;  5CAA A;  2F63 A;  4NEY A;  4EK2 A;  3M8Y A;  2B7C B;  4M1K A;  5HAO A;  1GXU A;  2GIR A;  3G9C A;  3TZW A;  4DL4 A;  3EPI A;  2JFD A;  3EVW A;  2DPJ A;  2CWK A;  4Q0B A;  4LFA J;  4M5K A;  2QE5 A;  2NSB A;  3NNH A;  3M32 A;  1P9Y A;  4LBH A;  1F6T A;  4YOE A;  3FZ2 A;  4K4U A;  2CZ4 A;  1Q86 T;  1Q8L A;  3ZNJ 1;  1QAX A;  2YKM B;  3DKD A;  2CQG A;  1N32 J;  1YK9 A;  1SC4 B;  2WW4 A;  3J7Y U;  4YN3 B;  4NCG A;  3KK2 A;  1Q8I A;  1CJV B;  2WRM A;  4LF8 F;  2Q66 A;  5HJY A;  2HQF A;  5CCM A;  3D6H B;  1GX5 A;  2OPP B;  2ZVS A;  4IH7 A;  5D3G A;  1R6V A;  3MMB A;  2DRD A;  1O0P A;  2KU7 A;  3B4D A;  4P74 A;  3DU6 A;  4JYA J;  2W7A A;  3IR6 B;  2K8G A;  2UXD F;  4DFP A;  3CVK A;  4PAB A;  2UXB F;  2VG5 A;  2IDE A;  3UDL A;  2GZO A;  3WDO A;  2DIT A;  1X9M A;  3O6Q A;  4DZ6 A;  4CO4 A;  2HHV A;  3HVA A;  2YWH A;  1BWE A;  4HTI A;  5M2U A;  1TUW A;  3GCX P;  1FRJ A;  2GNK A;  3HLU A;  4U8Y A;  4TVA B;  3PW5 A;  2FYX A;  1RP5 A;  3W62 A;  1UJ4 A;  3ZTR A;  3Q8P B;  1OS5 A;  3BJY A;  2HBQ B;  4KQZ A;  1X4E A;  2NUU G;  2J6S A;  4QW9 A;  5K8P A;  4DPT A;  4F4Z A;  4USV A;  3I0S A;  4K8R A;  2OFH X;  3HHK A;  1IR0 A;  2H5I B;  3OFF A;  5H9E J;  3LWM A;  3K89 A;  1U1L A;  3CCZ A;  4URS A;  3QGG A;  4DL5 A;  5ETR A;  4NLP A;  1SJ3 P;  4RW4 A;  4Q2M A;  4PWW A;  1RT7 A;  4HYK A;  2BKN A;  2MKY A;  3V2U C;  4WFN Q;  4KO0 B;  1FD8 A;  1R89 A;  2F8H A;  5KFF A;  2ZOG A;  4ZCK A;  2YY3 A;  5A0Y A;  1YG0 A;  1H0H B;  2DD8 S;  1K0T A;  2YWG A;  3AB4 B;  3QAU A;  3SSR A;  2WSF C;  3OL8 A;  4LF5 F;  2KZM A;  2EFO A;  2FLL A;  4DL2 A;  1GXT A;  3ZZT A;  4ECV A;  3FC9 A;  4DF4 A;  5HJX A;  3DDK A;  4X62 F;  3QWU A;  2P2C B;  1UCN A;  1K1S A;  4B3R J;  2Y0B B;  2YX7 A;  3CCU S;  1R7I A;  2QT7 A;  2ROP A;  3D1O A;  4NLY A;  3FBF A;  3MMJ A;  4A8M P;  3BPD A;  3EXC X;  4DU7 A;  1D9A A;  3NG8 A;  4HT5 A;  4JI7 F;  1OYE A;  2HLU A;  3VAF A;  5L38 A;  4ZVH A;  1HR0 J;  2CPY A;  1UVJ A;  2XMM A;  3MUV P;  4NPO A;  1ZZN A;  5FJ4 A;  2Z8Q A;  4DQQ A;  2FZG B;  4KPC A;  1Y11 A;  2XBP A;  1SJ1 A;  3D6F B;  1V3S A;  3DLL Q;  2POK A;  5F8J A;  1T7P A;  4FXD A;  4B02 A;  2IRY A;  3SQG A;  1DRZ A;  1XMO F;  1JLB B;  3KK3 A;  2LQ9 A;  4A8O A;  2XTJ P;  2NPF A;  5KG2 A;  3ULH A;  3I31 A;  4PEO A;  4IG0 B;  2BXJ A;  2EFN A;  1M1G A;  4ZK7 M;  1SV5 A;  4TY8 B;  3GR1 A;  3I5C A;  3OFH A;  4G6V B;  2CDQ A;  2VQE J;  4U9R A;  4W4M A;  5L1L A;  4TU9 A;  3CJK B;  3GV7 B;  2WB4 A;  4WPA A;  3VHQ A;  1D3W A;  1LWF A;  2PGC A;  1SL0 A;  1Z2L A;  4NRU A;  2LQ5 A;  1Y0H A;  1M5S A;  2XSJ A;  3GJQ B;  3A4T A;  5DDO C;  3D66 A;  3B8H A;  5AE3 A;  1XNR J;  2VFV A;  2WSC C;  4C3M A;  2C2E A;  1HIY A;  1KVJ A;  4IYQ A;  1RTI A;  5HAN A;  2UZA A;  2WOM B;  2P9C A;  4CLW A;  1X4G A;  1R0C B;  3O1L A;  1RWV B;  3SI8 A;  3SSS A;  4CYU A;  3KUH A;  1R43 A;  2KFN A;  2AYE A;  2A10 A;  3KDN A;  3DLK B;  3C2P A;  4IDK B;  3U7J A;  1U48 A;  5ETQ A;  3T41 A;  4RPF A;  1NXI A;  2FVS A;  3QBC A;  2RML A;  5ETT A;  3IXQ A;  4OI0 A;  2DPI A;  2JRS A;  3SFG A;  1RI7 A;  3VAK A;  3SZ2 A;  1WEL A;  3V4M A;  4LVO P;  3DRY A;  2DNK A;  3ITH A;  3H59 A;  2RDI A;  6FD1 A;  3P45 B;  4NLG A;  4E98 A;  5HVF A;  3BKU A;  4XDC A;  2MQQ A;  2N7Y A;  1OWX A;  2IIH A;  4YP3 A;  4L75 A;  2GQQ A;  2RQC A;  5J2N B;  2Z4P A;  1RAH B;  3POT A;  1HYS A;  4RW9 A;  1GH8 A;  2VC1 A;  3M6W A;  4NEZ A;  1SH0 A;  3M2V A;  3OPK A;  4JV5 J;  4JI3 F;  4KSE B;  3HFV A;  3H4B A;  1S57 A;  3GFH A;  3HHL B;  3WC0 A;  2FQQ B;  1NSP A;  4GVB A;  3I4H X;  4P6Q A;  5KG0 A;  1F2H A;  3FJ2 A;  4U7U D;  1OMS A;  1HI1 A;  3DI6 A;  4B3O A;  3CT9 A;  5K14 A;  2YKQ A;  1AFI A;  3T9Z A;  2C28 A;  1MML A;  3MEG B;  1QUV A;  1T03 B;  3ZXW A;  4DR1 F;  3MPV A;  4CO2 A;  4LF7 F;  5JUM A;  3QIP A;  5KFV A;  3R1H A;  3LA0 A;  2HGM A;  4OX9 J;  3H4D A;  3WHI A;  1WC6 A;  5F3Z A;  3V6D B;  2WAQ D;  1LEO A;  3E3X A;  1X4B A;  4NA2 A;  3EZO A;  1WHY A;  2DKO B;  1S59 A;  2FY8 A;  1S6Q A;  2V4J B;  1YQH A;  2CG8 A;  1VDH A;  2VOP A;  4FYD A;  3NGU A;  1X8D A;  3Q22 A;  5D8H B;  1SJQ A;  2DR9 A;  1TKX A;  4OZL A;  2KZZ A;  5AXK A;  3OR2 B;  4RU2 A;  4PXD A;  3QO9 B;  4FYY B;  4Q7A A;  2MLX A;  1JLC A;  3BSN A;  3W5X A;  3RBX A;  4GKJ F;  5KFD A;  4CIO A;  3CO0 P;  3PX4 A;  4FBU A;  2KXF A;  2M3D A;  3TA0 A;  5K9F A;  2GMH A;  3FKB A;  4R5P A;  1Q4R A;  3P3D A;  3S6E A;  3UD5 A;  2FLN A;  1R0A A;  1URN A;  3HPO A;  5A6W A;  3TWZ A;  4ZPD A;  3OR1 B;  4XO0 A;  1C1C B;  4I4B A;  1RAA B;  3KMQ A;  2KKH A;  3SSQ A;  4EYH B;  1RDR A;  3IRX A;  3EGN A;  1D9F A;  1QLN A;  2V68 A;  1CEZ A;  2J9D E;  3PW7 A;  2YQ0 A;  2K7J A;  1GTH A;  3SQO P;  1FKA F;  1CVJ A;  2IRX A;  2CZV C;  3R9L A;  5DM6 Q;  2QJ3 A;  3HT3 A;  5IT9 Y;  3RUB L;  1FFG B;  3D7S B;  1RTD A;  3NNC A;  2MY7 A;  2DRB A;  1HW9 A;  4LRC A;  1UPP A;  4FYV B;  3EE3 A;  1IQT A;  4DR2 F;  4NXN J;  1VRU B;  3H42 A;  1SQF A;  3TVY A;  1UVK A;  1YWX A;  1TV6 B;  4OHX A;  4ZN3 A;  3D1H A;  4JI1 J;  1WDD A;  3C16 A;  2CPZ A;  1IXK A;  1Q1K A;  4KBI A;  5K8N A;  1RT3 A;  2D9O A;  3U1M A;  2ZBP A;  4QZV B;  5ETO A;  3DXB A;  1IKX B;  4ICL B;  3CJ8 A;  3NXZ A;  4R8U A;  2Y1L B;  1NBE B;  3DDN A;  3MEC B;  1HWJ A;  2AIR B;  3IWN C;  2OEJ A;  2R7X A;  4P72 A;  2N82 B;  5DDP C;  2MTL A;  2X1F A;  4OZ1 A;  4KT0 C;  3NWR A;  1VGY A;  2W9A A;  4IRK A;  1KQK A;  3J81 Y;  4I6W A;  4DL3 A;  1IKW A;  2R8K A;  1RXO B;  2UUT A;  4OIX A;  2AMC B;  2DYA A;  3LO3 A;  3MDF A;  5KT3 A;  5SUH A;  3DCA A;  2NRE A;  2VF3 A;  4NYZ A;  4ZPW R;  1NU4 A;  4CO5 A;  3UQS A;  6FDR A;  1JXL A;  4FXW A;  3AXM A;  1U2C A;  3UR0 A;  3R5A A;  4WIQ A;  2WB1 D;  4P7T A;  2NZC A;  1JXE A;  2RF2 B;  5L1I A;  2VC0 A;  2RUS A;  1L3T A;  3LPY A;  3M1V B;  3KWM A;  5HK4 A;  2YKO A;  2XS5 A;  4Q44 A;  2R7W A;  2UUB F;  2V9W A;  2F4V J;  1MMN A;  2Z57 B;  2IM2 A;  1TKT B;  1RTJ B;  2MGZ A;  1RWX B;  3AH6 A;  2KO1 A;  5MLC V;  1BQN A;  1CJU B;  2EW9 A;  2XMK A;  3K5L A;  4F2S A;  2J5A A;  2E5G A;  1H7X A;  2VBZ A;  2HFN A;  4MYT A;  2IDL A;  1J5O A;  1SCJ B;  4CI0 B;  1B4S A;  3V81 A;  5GAE I;  4WKY A;  5KG6 A;  3HF5 A;  1A6L A;  2JWN A;  2M9K A;  1ROF A;  1AXQ A;  4TYA A;  4V1A k;  1UWB B;  3AAW B;  2KT3 A;  2ZKU A;  2X1G A;  1FVQ A;  2D69 A;  1T9T A;  3K5P A;  4CM2 A;  1K73 T;  5DQG A;  3QFH A;  1TL3 B;  4ZA1 A;  3C15 B;  2CJA A;  4QJV A;  3HD1 A;  3J7A 1;  2YH0 A;  3H25 A;  4DU8 A;  1L3K A;  3GG1 A;  1V5V A;  1VK8 A;  2FJW A;  1ULR A;  2AZ1 A;  2FLP A;  2C3Y A;  3WIV A;  1KVI A;  4DPW A;  1RZM A;  2FJV A;  2LQB A;  2KI2 A;  3MCN A;  1U6Z A;  1BQM A;  4I68 A;  4A46 A;  2XMU A;  3L7O A;  4LR8 A;  4OHW A;  4N8O A;  4KFB A;  1MRO A;  2ZBQ A;  4RNF A;  1LWC B;  3NLC A;  2F8M A;  2UUA J;  1WC5 A;  2OH2 A;  2QA4 G;  2FVC A;  5BXI A;  2HNZ B;  1NSQ A;  4AE5 A;  4M95 A;  2L9D A;  3OUY B;  1VQL S;  2AX0 A;  2NPI A;  2VOD A;  3DRR B;  2BDP A;  4RU9 A;  3RW6 A;  1Q16 B;  2CPE A;  2ZHO A;  5JMN A;  1S0O A;  1SKW A;  2UVW A;  2OEK A;  4UY8 5;  4KHM A;  2LXF A;  1IM4 A;  4ZIT A;  4DR7 J;  4H4M B;  3P49 B;  1BY9 A;  2HEK A;  3CIZ A;  2NXC A;  1FVS A;  4NZ7 A;  4RO0 A;  3TUI C;  4KAI A;  2MHN A;  2Z0G A;  3IP0 A;  3B6B A;  5L46 A;  1VR6 A;  2YKM A;  3AHP A;  3UCZ P;  5IWA J;  2HS3 A;  4ECZ A;  4LFA F;  4P52 A;  1NDL A;  5EGY A;  1U2R A;  1RBO B;  4A8F A;  4WTO B;  3HVR A;  1GTE A;  5KT5 A;  3UE2 A;  1WKK A;  2OMO A;  5KG3 A;  1A9N B;  1N32 F;  2UXC J;  2OPP A;  4PG4 A;  2DIS A;  2DR8 A;  2OTL S;  3F41 A;  5DQH A;  2KRB A;  5B0D A;  3OHB A;  1RT5 B;  3MM7 A;  2ZOF A;  1N5V A;  4K4T A;  2H48 B;  4KV8 B;  3I0R A;  2AP6 A;  3ZZU A;  2ZKT A;  1EAR A;  4LSL B;  1CS4 A;  1FRM A;  1YVF A;  2WVC A;  1F5C A;  4OYI A;  4FYW B;  4XPC A;  2XHC A;  5B08 A;  2NR0 A;  1LWX A;  4JYA F;  1EKR A;  4B9N A;  5IQ6 A;  4ECU A;  1FT8 A;  3TVZ A;  2DXE A;  2DTJ A;  3UCU P;  2FC9 A;  5IT9 U;  1N36 J;  2YNF B;  1VBY A;  2QN6 B;  4I7F B;  2RD5 C;  5CQG A;  2GS8 A;  3AD7 C;  1EB0 A;  4CO3 A;  2C2M B;  4H4O B;  4LFC J;  3KG1 A;  3L7P A;  4HKQ A;  3G71 S;  1V3R A;  2F4F A;  1NO8 A;  4C4W A;  3A12 A;  2HRU A;  2QZ8 A;  2CUY A;  1YSJ A;  2H1Y A;  3LP2 B;  3R7S B;  4J91 A;  4R0E A;  3IN5 A;  4ID8 A;  1OYD A;  2HFZ A;  4KGX B;  2Y0S D;  4F4W A;  2IM0 A;  4WFZ A;  2JDJ A;  2ILZ A;  2BQR A;  1S6U A;  3IGN A;  3J81 U;  3QRQ A;  2PMW A;  2QX0 A;  4DLG A;  3TOQ A;  2MQO A;  5E3Q A;  4KO0 A;  2MZR A;  3OBI A;  3RRG A;  2B4O A;  4N56 A;  1GAO A;  1N5T A;  5M2R A;  3OHA A;  1IJF B;  3NCR A;  3BO4 A;  3CD0 A;  2H51 B;  4MH8 A;  5IFM A;  5DLG A;  4RNN A;  4PWD B;  2R8I A;  3FRZ A;  1QVF R;  3H5Y A;  1YZ7 A;  3D0G E;  5C25 B;  3V6H A;  4MYU A;  2CQ4 A;  2J0S D;  2AT1 B;  5DLF A;  1E6Y B;  4LQ9 A;  2GA7 A;  3ILL A;  4RW8 B;  4ANE A;  2KM8 B;  1NDK A;  3DC2 A;  4DV5 J;  1RJJ A;  5FDL A;  2XGQ A;  1K8A T;  5KOX A;  1N5Q A;  4NCA A;  3HZG A;  2DT9 A;  4ZIV A;  5LMN J;  1S48 A;  4WBF A;  5GMD A;  3LAK A;  2G4B A;  2CPF A;  2FTR A;  3SYZ A;  4LUB A;  4DPO A;  4B3R F;  5IT0 A;  1PJ7 A;  3GIJ A;  2IC3 B;  4X64 J;  4TQS A;  1KEK A;  2XHW A;  4Q5V A;  3F0N A;  3CB4 A;  4LBP A;  2W2P P;  1F1B B;  3KXD A;  2J9C A;  3KLH B;  3F56 A;  4MIW A;  4X66 J;  3MEE A;  1D9D A;  1CQN A;  4DSI A;  3CSK A;  1HR0 F;  2CPX A;  4P9S A;  3UR3 C;  4B9L A;  4G1Q B;  3BZQ A;  1JLB A;  2MLZ A;  2QLX A;  3TZZ A;  4IG0 A;  9ATC B;  4UUX A;  3IR7 B;  4EYI B;  4TY8 A;  4X4U A;  3RJM B;  4KJI A;  4X84 A;  3TJA A;  1ZAV A;  1DTQ B;  3I87 A;  1L3S A;  2WBM A;  3I9Z A;  4CM0 A;  2LCW A;  4C8M A;  2GHV C;  2FJD B;  3IAM 9;  1BWV A;  3CCE S;  1N4L A;  1SKS A;  1ZM2 A;  2QEX S;  1P8G A;  3CJK A;  3BV8 A;  4DUZ J;  4C8K A;  2W7O A;  3T9N A;  3I5A A;  1UET A;  4X4V A;  3M4X A;  2WVD A;  1FDD A;  3W2V B;  1N48 A;  1X7V A;  3BQ0 A;  2JVR A;  3MPU B;  4UOG A;  3SXL A;  2JEG A;  3Q8V A;  1Q78 A;  3BGF A;  3TUP A;  2AQ4 A;  1S1U A;  2HVH A;  4YS2 A;  2XNQ A;  5F8G A;  2CQ0 A;  2HSE B;  1WC0 A;  2YNG A;  4QR0 A;  3UI3 A;  1ZTT A;  3HD2 A;  1AYE A;  1S7I A;  3CCV S;  1C4A A;  1N8R T;  1RT1 B;  4J9P A;  3W8G A;  2GAG C;  1XNR F;  5L8R C;  4OHY A;  3DLK A;  4IDK A;  4Z7C A;  4EO8 A;  1R8A A;  1WSR A;  3CC4 S;  3R5C A;  3MWB A;  5ITH A;  5L1K A;  1UW4 A;  3I6P A;  1Q5Y A;  3NBP A;  5GAE U;  4Q2L A;  2EI5 A;  4UST A;  4JI4 J;  2VA2 A;  1VHI A;  5I3Q A;  1NSA A;  3H2L A;  3B78 A;  1FK9 B;  2YPY A;  2QLF B;  2HMI A;  4UY8 T;  2GQ2 A;  4WP9 A;  2O01 C;  1YRU A;  5J2N A;  2VDH A;  3QGI A;  2AV5 A;  1NKE A;  4F7V A;  3TX0 A;  1H2U X;  2K3I A;  3H98 A;  4MFB B;  1K1Q A;  1GQE A;  5E3P A;  1O51 A;  1FJG F;  4WZQ A;  4N77 A;  3HHL A;  1HNV B;  4WYL A;  3SCI E;  3MR7 A;  3MEK A;  1MN7 A;  3C6T B;  1JLQ B;  3QNW B;  2UUC J;  3EM1 A;  5KFL A;  3O8W A;  5L1J A;  4JI6 J;  4JV5 F;  3LP0 B;  2LEA A;  3HZE A;  2R8H A;  1XBW A;  3QZ8 A;  3IFE A;  1G3O A;  1UZD A;  1VRQ C;  1T9U A;  5D78 A;  2R42 A;  2MMY A;  4QWC A;  4Y2K A;  4LSN B;  1WKJ A;  1ARO P;  1XWL A;  3VVU A;  3MEG A;  4K59 A;  3FDS A;  1T03 A;  5C24 A;  3NS6 A;  1HW8 A;  3W66 A;  1FJC A;  2X1B A;  2Y1I A;  3BBF A;  1SQE A;  4B08 A;  4NLX A;  3CED A;  4KPY A;  1N6Q B;  3MM9 B;  1S49 A;  4OHZ A;  4OYZ A;  2A1B A;  1NJI T;  3QRR A;  1QJH A;  4OI1 A;  3HCX A;  2VKZ G;  3ISN D;  4QU6 A;  2V4J A;  4OX9 F;  2RRN A;  3MAQ A;  1T9W A;  1VIO A;  3EMT A;  3M8Q B;  3H20 A;  2RQK A;  1EZZ B;  5B0B A;  1IBM J;  4LT6 A;  2CAJ A;  2MLY A;  5HP1 B;  1EQ0 A;  5U47 A;  4OV6 A;  2LFV A;  4IRD A;  3N4W A;  5KFI A;  2DNR A;  1W2I A;  4J9V A;  4A8W A;  1FNM A;  4CDI A;  3BO3 A;  5L9X A;  3OR2 A;  1KHW A;  3QO9 A;  5LSO A;  4CLF A;  2W9C B;  2J8A A;  3TAR A;  3MM8 A;  1TVR A;  1VQ5 S;  3LTO A;  5L9N A;  1TL4 A;  3PVX A;  3NOG A;  4IOA Q;  2NUH A;  3Q83 A;  4EUV A;  4F4Y A;  1TAU A;  5K20 B;  2BBE A;  2UP1 A;  4C8Z A;  2F65 A;  1YHQ S;  3EGV A;  3RZA A;  1UL3 A;  4MKA A;  2K3K A;  1RWO B;  3VQT A;  3OR1 A;  1C1C A;  4EMD A;  4PPD A;  1J5E F;  1H72 C;  5JXS A;  2BAC A;  3JQK A;  5K8M A;  3MR3 A;  2PI5 A;  5ETP A;  2QC3 A;  2E1P A;  2ZWP A;  3W9I A;  1S9E B;  2OI2 A;  8RUC A;  1SUQ B;  4NYO A;  1R3N A;  2N3L A;  3O44 A;  4AUK A;  4N7T A;  1FEH A;  2IY5 B;  4NYP A;  2LDY A;  2JSX A;  3QGH A;  1WAC A;  2HWI A;  3PEH A;  3LP1 B;  2KM8 C;  1VRU A;  1ZM4 A;  4M5L A;  2HHU A;  4KYZ A;  4M5M A;  5CYJ A;  1TV6 A;  1NZA A;  3CWJ A;  4DS4 A;  5FII A;  3GYG A;  3N5B A;  1Q7L B;  3PYF A;  2F1F A;  4NXN F;  4J9O A;  3PW4 A;  2V8D A;  1IKX A;  2R2R A;  1RT4 B;  4AXI A;  4JI1 F;  2XCP A;  5I42 B;  1IR1 A;  3C46 A;  3BN4 A;  1NPP A;  5D77 A;  4KE5 A;  2UXD J;  4FVC A;  2ATC B;  3L95 X;  5EX0 A;  1G6B A;  1RT2 B;  4ECY A;  5K8O A;  4DS5 A;  5GAG I;  1AUD A;  1K9M T;  4DV3 J;  2ACM A;  4KGK A;  1C1B B;  2P9E A;  3CCM S;  3B4M A;  4OI3 A;  3ZZO A;  1EX8 A;  2VDI A;  2JOQ A;  2WON A;  2O1P A;  1CLF A;  3M2U B;  2RS8 A;  4ZPT R;  3GFX A;  4K50 A;  4DV0 J;  1F3V A;  2VON A;  1LFP A;  5CXT A;  4N47 A;  2B6A B;  4C8O A;  3M1V A;  4YY3 J;  3GFY A;  4AFF A;  4DG1 B;  3DMJ B;  1NJZ A;  3RBZ A;  4U96 A;  2E9Z A;  4WJB A;  1U49 A;  3TYT A;  1TKT A;  1RTJ A;  2D9P A;  4NZ0 A;  4N41 A;  2LYV A;  1CJU A;  3CJR A;  3CMQ A;  4BCA A;  1PCA A;  3THP A;  2XEX A;  5KFZ A;  3UN5 A;  2V8P A;  2F4V F;  2VU5 A;  3DLJ A;  2H9Z A;  3AD8 C;  3OD2 A;  4RR5 A;  3N28 A;  1L3U A;  4DV4 F;  1C0T B;  3DRP A;  4I2P B;  2KFY A;  3UVJ B;  4BBY A;  2W2O P;  3OFE A;  4DBQ A;  1X0P A;  4AL7 A;  1UWB A;  3FEX B;  3ELH A;  3TAM B;  4ZCI A;  4OX8 A;  2HFO A;  4DR3 J;  1RWN B;  2AJ4 A;  3G96 A;  1JKH B;  4AYB D;  1SH2 A;  1FCA A;  1WJ9 A;  1S99 A;  3EX7 B;  1E6V B;  4DQS A;  4DSE A;  4JI0 F;  1SKR A;  5D0H A;  1F0X A;  2MJN A;  3H5U A;  1ZPV A;  2C42 A;  1IBL J;  3GPA A;  2B9E A;  1SC1 B;  3T1A A;  1TL3 A;  4QPX A;  1B0P A;  3C15 A;  5GME A;  2H5E A;  1RAF B;  3E01 B;  1RSC A;  3JXO A;  5F9N A;  3CMA S;  2ASJ A;  4JI8 J;  3VGU A;  1RLC L;  4RNO A;  2NCK L;  3PAC A;  2E5I A;  3AXK A;  3Q23 A;  2AU0 A;  1WWH A;  4DR4 F;  1U1O A;  5DZ7 A;  1VC0 A;  1KQG B;  3N6M A;  2ZH2 A;  1PC4 A;  1PKU A;  3D2W A;  1LWC A;  5A8W B;  5AJ3 F;  3VWS A;  2LQ8 A;  3W61 A;  2LU2 A;  1N34 J;  3CCT A;  3G82 B;  4IO9 Q;  1WG1 A;  2DH8 A;  4YDX A;  3DRS A;  2HNZ A;  2Z2Z A;  5T7L B;  2XY6 A;  4U67 Q;  3FFI A;  1SL2 A;  3OUY A;  2Q1L A;  3LUY A;  4ZVT B;  2GFF A;  3DRR A;  1WHW A;  2UUA F;  1R27 B;  3T6J A;  1SKU B;  2AW0 A;  2JLG A;  3SBM A;  4UTG A;  4YFU A;  4KB7 A;  2DNO A;  2EFG A;  3VV2 B;  3G87 A;  4H4M A;  2HGL A;  1XQI A;  2RT3 A;  3OVB A;  3FQK A;  2L9W A;  4ZVO B;  2BAN A;  3P5T L;  4HAC B;  3KYL A;  3HDS A;  2ZBR A;  4NE9 C;  4ATN A;  1BUX A;  1KQS R;  2RVJ A;  2LP4 A;  3K8W A;  3QSY B;  3QYY A;  4ES1 A;  2HQI A;  3DNC A;  4DR7 F;  3M7V A;  4PAA A;  1Y00 A;  2R2T A;  5CCL A;  4WK3 A;  2V67 A;  3OTE A;  4JOU A;  2AGP A;  2RNE A;  4DX8 H;  4U7U K;  5KT2 A;  4I1T A;  1WOP A;  2W4D A;  4WU3 A;  1V9O A;  1NHU A;  5IWA F;  3OL7 A;  5LT5 A;  2N4C A;  2XMJ A;  1NM2 A;  1FI4 A;  3BB5 A;  5KFB A;  3GJR B;  2KHD A;  2VQF F;  3UN2 A;  3MPD A;  1I1G A;  3W3S A;  1JLE B;  2UXC F;  5B0C A;  4TXS A;  4LRD A;  1RHU B;  1VQK S;  5DQI A;  3I56 S;  4FS2 A;  3UNG C;  3CO9 A;  4CLL A;  3JSB A;  3DYA B;  3LAL A;  4EGL A;  2YH1 A;  4J37 A;  3GYX B;  4FF1 A;  3MED B;  2HVI A;  4F02 A;  1WC3 A;  1LWE A;  3P5B P;  4AQY F;  4HI1 A;  2GHP A;  2VH7 A;  2DNN A;  3NOC A;  1XR5 A;  2GVD B;  3A3P B;  1NK9 A;  4C6A A;  4DFM A;  1VRT B;  3BR9 A;  4HDG A;  2K06 A;  5DG7 A;  4I7F A;  1N0U A;  2VPY B;  1DAR A;  2FJX A;  2KN4 A;  4USJ C;  1RWU A;  1U8W A;  1Q8K A;  2GVZ B;  1N36 F;  3OTC A;  1XMB A;  2JC0 A;  4H4O A;  3R5G A;  4DN9 A;  1PSD A;  4S0M A;  3JSR A;  4RNM A;  1TR0 A;  1WF0 A;  3HVT A;  3GTY X;  1YI2 S;  1ITP A;  3M6X A;  2BOA A;  1FRH A;  5CZV A;  5KAK A;  4BDP A;  3NNA A;  3LP2 A;  3M2R B;  4LFC F;  1RUS A;  2L48 A;  4YDD B;  2CNN B;  3CUL A;  2VHG A;  2J0Q D;  2MKH A;  3LGN A;  1FWL A;  4OI4 A;  1M5V C;  3D3C J;  1MG7 A;  2ZJP Q;  1SJF A;  3U1N A;  2RB7 A;  2RKI B;  5EWF A;  3ADA C;  2E1A A;  3R8Y A;  5HVG A;  2J6T A;  4PG6 A;  1PYS B;  1L3V A;  2WZ1 A;  3CDU A;  1IUJ A;  5E41 A;  2J9E A;  2JHE A;  4BS2 A;  2ATL A;  1S79 A;  3CDA A;  2AD9 A;  2FHO B;  4BWM A;  3L4B C;  2GX8 A;  2HQC A;  2C3M A;  1S4F A;  1XN9 A;  4K2X A;  4NAS A;  2AGO A;  4PWD A;  2DGQ A;  3RBE A;  2IVM A;  5IM0 B;  3CD7 A;  1DTT B;  2B5J B;  4JUZ A;  4DR1 J;  5C25 A;  1R8H A;  4I56 A;  3H0P A;  5F0W A;  1NH7 A;  2XO7 A;  1VOM A;  2F3J A;  1E6Y A;  1XIQ A;  4RW8 A;  4DEZ A;  2BE2 A;  3NGR A;  1CPZ A;  1RHR B;  1NKC A;  3VTI A;  3KHH A;  5AE1 A;  3LAN A;  2AYG A;  1EIY B;  5CYM B;  1RLD A;  1KLM B;  4QWA A;  5KT4 A;  2DB1 A;  8AT1 B;  1B7Y B;  1A7G E;  1J2V A;  1VQS A;  4DV5 F;  1N0V C;  4DFK A;  2B3T B;  3P8B B;  4F25 A;  3UCG A;  2DGX A;  3QLH B;  2HZA A;  5A6P A;  2IC3 A;  1HQU B;  1HBM A;  2MQ8 A;  3K0J A;  4CT8 A;  2V50 A;  3HI9 A;  1XK8 A;  3IG1 B;  1NEE A;  4ELU A;  1S1W A;  1FXD A;  3KLH A;  3J80 Y;  3ZO7 A;  4X64 F;  1BE4 A;  4L3N A;  4F2R A;  4RW7 A;  2NYH A;  2F9J A;  1WDT A;  4ECS A;  1S72 S;  4WTY A;  4J5O A;  4FKX A;  1N88 A;  4B9S A;  2I0X A;  2CNL B;  1UEV A;  3C66 A;  3LW5 C;  1U6F A;  4O3P A;  4DUT A;  4CZC A;  2XS7 A;  1OY8 A;  1BHN A;  3KLI B;  4PRF A;  1DTQ A;  1I6J A;  3ZTQ A;  3QT5 A;  4DPY A;  4WK1 A;  2FIU A;  4RZR A;  3W2V A;  2CNK B;  4TYB A;  3PR4 A;  1H2T Z;  3K57 A;  1KKH A;  4QIW D;  3R7B B;  1T02 A;  2O67 A;  3CJ3 A;  2DO0 A;  4DUZ F;  4KHR A;  1S7H A;  5HLF B;  2XB2 D;  4MK9 A;  4U6P A;  2MKK A;  5HQM A;  5LXR A;  1Y9O A;  4KH1 B;  5D4O A;  1BC6 A;  5LSR A;  4ZN1 A;  2IM1 A;  3DLB A;  4IFV B;  1RT1 A;  3PHT A;  4KHP J;  2XYH B;  5B0E A;  5F9L A;  2VFT A;  3AA8 A;  2VG6 B;  5KFY A;  3JQM A;  4CTA B;  4Y0F A;  1VYA A;  3GJT B;  1FXL A;  2Y8Y A;  3LPE A;  3NS5 A;  2G2Z A;  2HHX A;  2MB0 B;  3UN3 A;  1WEY A;  3AT1 B;  3MM5 A;  4ED4 A;  1IR2 A;  2I38 A;  3RAQ A;  3R97 A;  2DR7 A;  1FK9 A;  4CLP A;  2HRY A;  1N54 B;  4WP3 A;  1UKU A;  1C2P A;  1Z1Z A;  2BYC A;  3TA2 A;  4JI4 F;  2FJA B;  3FQL A;  4DR6 F;  4DDF A;  3C8Y A;  4MFB A;  1RA6 A;  2ZM6 J;  5BYS A;  3T5J A;  4J9S A;  3GE9 A;  2CRL A;  1KOO A;  5IXU A;  3EVO A;  1N52 B;  4B3S J;  4MIA A;  4X4S A;  4F3M A;  1JNR B;  4FBT A;  1HNV A;  1MWY A;  2UV8 A;  4ANC A;  3C6T A;  5CYQ B;  1S0V A;  2JFK A;  2VPW B;  1JLQ A;  1SBR A;  2IFX A;  3EZU A;  3LP0 A;  5M2P A;  5F8M A;  1TFW A;  2E5L J;  5J2Q B;  2XO6 A;  4LSN A;  1RAJ A;  1UJ5 A;  4OYB A;  1YDL A;  3AD9 C;  3TO8 A;  1FNO A;  2UUC F;  2PA8 D;  3TQE A;  4DHV A;  1OQ3 A;  4DUY J;  4PR6 A;  4JI6 F;  3FK4 A;  2B43 A;  1Q8B A;  1X4F A;  3MOZ A;  3K59 A;  1N6Q A;  4M5G A;  5DRK A;  3MM9 A;  2CVI A;  1PC5 A;  2CQI A;  2EFP A;  2BKP A;  2HQD A;  3MFH A;  4BHQ A;  3E8O A;  5G0R B;  3KLF B;  3ETM A;  3RGI A;  2C2O B;  1FF2 A;  3M8Q A;  2LEC A;  1LK5 A;  2EWH A;  1FA0 A;  3CJ0 A;  2ZIT A;  3TNV A;  3AOD A;  1YRX A;  5HP1 A;  3MR5 A;  2Z2M A;  1NHK L;  4FNI A;  5KFJ A;  1UVM A;  3VAH A;  2WHO A;  4LMZ A;  1MLA A;  1IBM F;  3EYZ A;  2W9C A;  3NCP A;  3AOC A;  3QAE A;  1PIL A;  1IKV A;  2GQC A;  4MMO A;  2W01 A;  1HHS A;  3RR8 A;  2B9Y A;  2D3Z A;  4DV2 J;  3UDV A;  1T3O A;  3OJU A;  3RAM A;  3C14 B;  2RU9 A;  4ZCL A;  1RB0 A;  1U0H B;  2CJX B;  2LU1 A;  2NYI A;  2ZH8 A;  2DIV A;  3T1H F;  3LGH A;  2QLW A;  2R7S A;  2MQP A;  3AB2 B;  1BD6 A;  3ZFV A;  1SQG A;  2EBG A;  2HFU A;  1C4C A;  2QV6 A;  2OTJ S;  2HUR A;  3UD4 P;  1S9E A;  1SUQ A;  1HHT P;  2G2Y A;  3K7R A;  4WII A;  2QIF A;  4Y65 A;  1DQA A;  4KY3 A;  1N5S A;  3CIM A;  2RRA A;  1P1T A;  2ZWO A;  3LP1 A;  5DS7 A;  2BMB A;  3JYT B;  1Q53 A;  2AHO B;  2I6W A;  1WHV A;  2IRU A;  2KFZ A;  5DM7 Q;  4PKD B;  5HQ8 A;  3MF5 A;  2DHG A;  4A8K A;  4MIB A;  1IN0 A;  4C98 A;  2XC9 A;  2YNH B;  4EWT A;  4DV1 J;  2MZQ A;  2A6M A;  1S1V B;  2N7C A;  5KFQ A;  4B9V A;  1RCX B;  3OLA A;  1LW2 B;  1RT4 A;  4ID5 B;  3T5K A;  4K5S A;  3J80 U;  1RTH A;  1WF2 A;  2JEI A;  1KS2 A;  4TNO A;  1XNQ J;  5CA5 A;  1KON A;  2A18 A;  2L08 A;  2GCF A;  4HHJ A;  3DN9 A;  4O0N A;  4QR2 A;  1XC9 A;  3ZTS A;  4ZP9 A;  1CG2 A;  2ZH1 A;  3ONQ A;  2E7V A;  3SCJ E;  1YZ6 A;  2VG7 B;  3ISN C;  4NI2 B;  1FWP A;  2LQJ A;  4IG3 B;  3NGD A;  3KLV A;  1QE1 A;  1V6H A;  4IO1 A;  3WX4 A;  2FDN A;  1RT2 A;  5E33 A;  3PIP Q;  3NL0 A;  3AJD A;  2XMA A;  5KT6 A;  4HEA 9;  4DR5 J;  3VAJ A;  3VR1 A;  5I3P A;  2XUL A;  3U1L A;  3CE8 A;  1C1B A;  3FEY B;  5J2P B;  2NXJ A;  2YKP A;  2DGT A;  4UF4 A;  1EET A;  1VC6 A;  2JX2 A;  1A0O B;  1Y10 A;  4B17 A;  2W2M P;  4J90 A;  3MCM A;  4DV3 F;  3M2U A;  1VIX A;  3PYD A;  1QDU B;  1U1Q A;  4L73 A;  2AJ1 A;  3W65 A;  1S9G A;  2XM3 A;  1FEE A;  4YHH J;  1N56 A;  3HHN B;  1YJU A;  2VUG A;  4C8L A;  4ED6 A;  3ZZ0 A;  1F5B A;  2B6A A;  2BX6 A;  5KFG A;  3HM9 A;  3GQC A;  3CCL S;  1LXJ A;  2DK2 A;  2DGW A;  3IM9 A;  4DG1 A;  3R7N B;  3DMJ A;  1YJ9 S;  4DV0 F;  5KFO A;  1RWK B;  2X7I A;  1Q81 T;  1RAB B;  4F04 B;  4DX7 A;  2B4P A;  4HH0 A;  4YY3 F;  2XS2 A;  2R9L A;  1YBT A;  2QL7 B;  2CQ2 A;  2KYZ A;  4K5R A;  4ENO A;  1TUV A;  2YNI B;  1C0T A;  3S8S A;  1MU2 B;  4C0B A;  2KXN B;  4I2P A;  2MXY A;  1Y3K A;  2IPO B;  3UVJ A;  4F4K A;  3OXL A;  1YKW A;  2ILY A;  4ECQ A;  3TAM A;  2DEI A;  1JKH A;  2MST A;  2ZHB A;  3D0H E;  1E6V A;  2DNH A;  1NKB A;  5BJR A;  3C3L A;  1VJW A;  4LF1 A;  3HX9 A;  2R3V A;  3MAA B;  2DCL A;  1D0E A;  4DR3 F;  2VZ9 A;  1RT6 B;  2LXU A;  4NRT A;  4QWB A;  3E01 A;  2P6S A;  2QRR A;  3D68 A;  3HSZ A;  4I6Y A;  1IBL F;  1QTM A;  5GAH I;  1YGY A;  4M5N A;  1NZ8 A;  4O3Q A;  5AE2 A;  4DMZ A;  4WZM A;  2NZ4 A;  4OFZ A;  2QLJ B;  1YBA A;  4LIR A;  5KFN A;  4RNH A;  4RW4 B;  5D4N A;  4JI8 F;  1VJQ A;  2QMX A;  2HQ3 A;  2CPJ A;  5A8W A;  3G82 A;  3I4P A;  2OEL A;  2F8E X;  3TAP A;  1RAE B;  2ALY B;  4RL1 A;  3RU0 A;  1X5S A;  1KFS A;  4WXW A;  4ZVS B;  2J7K A;  4OL8 A;  1UAW A;  2NSC A;  2B9W A;  1N34 F;  1SVD A;  2LEB A;  1NHV A;  3MFI A;  2LMI A;  3TW0 A;  1XTZ A;  4RBU A;  2K1R A;  5DO2 A;  2NLW A;  1NAQ A;  2ROE A;  2EBE A;  4RJV A;  2VPX B;  4HAC A;  4H4K A;  5DDR C;  3V5R A;  4FS1 A;  2KH9 A;  1O6X A;  3IO1 A;  3L3C A;  5HN0 A;  3FSY A;  1SH3 A;  2ZH7 A;  2LA4 A;  3HXM A;  3G6Y A;  3R5B A;  5DGB A;  3SIP B;  4QWE A;  4NLU A;  3IC1 A;  1ZYQ A;  3TAN A;  3TRG A;  2LDI A;  2EKN A;  2O66 A;  2AEM A;  4LRE A;  2IMW P;  2LKZ A;  1KVK A;  4EBE A;  1VQY A;  2BJE A;  2AJQ A;  2MJU A;  5F41 A;  4OI2 A;  4FZV A;  2XLI A;  2WVE A;  2OKQ A;  5LM7 E;  4DPU A;  4O0I A;  5B0A A;  1U8S A;  2MZS A;  3BGL A;  4DQR A;  4PXC A;  2FLO A;  4RW6 B;  1JLE A;  2Z2L A;  1LW0 A;  4PXE A;  4FF2 A;  2KVQ E;  3MI7 X;  1GMU A;  2KRR A;  2MKJ A;  3K58 A;  2ROG A;  3DYA A;  3K8V A;  3PW2 A;  2F9D A;  3SQG B;  1HLW A;  4ZP7 A;  1REG X;  5GMK a;  4X4R A;  3MED A;  3DOK B;  1NK6 A;  4PZV A;  4OZ5 A;  4EBC A;  1DY3 A;  4A48 A;  1FDA A;  1KP6 A;  3KJF B;  1OIA A;  1VQ4 S;  4FF3 A;  1UVI A;  2GVD A;  3KJV B;  3A13 A;  2JL9 A;  5C5J A;  5KFR A;  1GXL A;  1VRT A;  2QFI A;  2XYP B;  4Z2X A;  3UPF A;  2PSZ A;  4PYA A;  5T14 A;  1ZBT A;  2HNY A;  3WIU A;  3HUL A;  1KHV A;  4R25 A;  2DNG A;  2GVZ A;  3GV5 B;  4LR7 A;  4UZC A;  1PG5 B;  4KGM A;  4EO6 A;  4YQW A;  1F9E B;  4PG7 A;  3QT7 A;  2U2F A;  3JB9 k;  2BJ8 A;  3VGS A;  4B9M A;  2BW7 A;  2I5J B;  4QW8 A;  3U02 A;  2DY9 A;  3PRB A;  3M2R A;  3VVT A;  1JMT A;  1YJN S;  2DNP A;  4M5D B;  1JX4 A;  4Q43 A;  3O3L A;  4USH A;  1O8B A;  1SC6 A;  4CLS A;  3PV8 A;  2RKI A;  2Y1R I;  4CT9 A;  2YQ3 A;  1FJG J;  1DHM A;  1HQ2 A;  3THV A;  4O23 A;  1X9S A;  3GMG A;  2UV8 G;  3D3B J;  3UW1 A;  1Q82 T;  1KBR A;  3BGR A;  1FFW B;  2DXD A;  4J9Q A;  3FSI A;  3QWP A;  2DR5 A;  5KFA A;  3GON A;  3OVS A;  2QFJ A;  2CA9 A;  1WG4 A;  4RUH A;  5IM0 A;  3J7Y I;  3N01 A;  1DTT A;  2B5J A;  2KVI A;  5E7O B;  1OPI A;  1VLO A;  3LOU A;  4OJG A;  4XK8 C;  1RGV A;  3ET6 B;  2QO3 A;  3WC2 A;  3OVA A;  2A2D A;  4GO5 X;  1IVZ A;  2MQM A;  4PWU A;  1NSK L;  3RBD A;  1BLU A;  2J8S A;  3BSA A;  3OW2 R;  2FGO A;  4Q8F A;  2X3G A;  3TR5 A;  2DGO A;  3FCH A;  5CYM A;  4RUB A;  3MHY A;  2ZC4 A;  1KLM A;  2DO4 A;  2MPU A;  4V19 J;  5AXM A;  4C3L A;  4DI6 A;  1LK7 A;  2QG9 B;  3KHL A;  4WXO A;  3EGZ A;  2W4P A;  4UT4 A;  3H40 A;  3QLH A;  1HQU A;  1TU0 B;  1TKZ B;  3OL6 A;  2PN6 A;  5GVQ A;  2WBR A;  2QA1 A;  5I3U B;  3OLB A;  4B3O B;  4ECW A;  4CQ1 A;  4YUD A;  4KGV B;  2AEJ A;  2E29 A;  3PFE A;  2LEP A;  4EEY A;  2VKR A;  2R7T A;  3DLE A;  2DR6 A;  5RUB A;  1QUP A;  2I2Y A;  1CQM A;  3CME S;  2R2S A;  1J5E J;  2GO9 A;  1FRI A;  9RUB A;  4ZMM A;  3FRY A;  3PEJ A;  3KLI A;  1WG5 A;  2OPR B;  4L6V 3;  3H5X A;  4C11 B;  3NCQ A;  1NUE A;  1REV B;  3B54 A;  2HS0 A;  3OSN A;  1HHQ A;  3IWX A;  3TJ9 A;  2XI3 A;  2HHW A;  3QQC D;  4YR3 A;  3Q89 A;  2P9G A;  1KR4 A;  4UOH A;  2HW3 A;  2DJW A;  3ZC4 A;  2W24 A;  3G6X A;  1X4C A;  2BKO A;  4C9D A;  1H2V Z;  2VBY A;  3GB0 A;  3ILO A;  4AND A;  1Q5V A;  1JLC B;  1UJ6 A;  3SFU A;  1UFK A;  3NAI A;  4NLV A;  3HO1 A;  1RTZ A;  4WWS A;  5HLF A;  2C3U A;  1N33 J;  2RRB A;  1CUL B;  4IR9 A;  2E1C A;  4JV0 A;  4IRC A;  3PJ9 A;  4YB1 P;  5H9F K;  1AZS B;  1GEH A;  4DFJ A;  3SCL E;  3KK1 B;  5EWG A;  1PYT A;  4IFV A;  2D3O R;  3MPW A;  3UNY A;  3Q8S B;  1X4A A;  2HND B;  2FB0 A;  2VG6 A;  2RUG A;  3W7B A;  2RAQ A;  4Y2A A;  4CTA A;  2HHH J;  2UUW A;  1CC7 A;  3DDI A;  2RQ4 A;  1HNI B;  4KHP F;  4U8V A;  3HSD A;  2HLT A;  2QSF A;  3AJ2 A;  3GU0 A;  3JTP A;  3R6L B;  1FRK A;  2V0N A;  1D09 B;  1AW0 A;  4Y3C A;  2JC1 A;  4HT7 A;  3NWG A;  2BUN A;  4A47 A;  4URQ U;  5F0U A;  1D8Y A;  4DSK A;  4C8Y A;  1TK8 A;  1DBD A;  2LVW A;  1ZZF A;  5E5N A;  3T6B A;  3G8T A;  2LLZ A;  4HTJ A;  4TN2 A;  3QAT A;  2IVY A;  3JSM B;  3RG6 A;  4ERD A;  4AL6 A;  3MMC B;  1MW7 A;  4DX6 A;  1M0S A;  5LSL A;  4EI2 A;  2VAS A;  1T8E A;  4R8U B;  1NK8 A;  2KJW A;  3BKT A;  4IH6 A;  4P73 A;  1UA0 A;  1VQ6 S;  2FPH X;  2PFD A;  1FE0 A;  5ETN A;  4ZPB A;  2ZM6 F;  3HSJ A;  5L39 A;  3ZNU A;  1WI8 A;  3GSI A;  4Q45 A;  2G0C A;  2SXL A;  4B3S F;  4HL9 A;  4TY9 A;  5J2Q A;  3G4S S;  1IKW B;  4Y2M A;  3HHL D;  2Q43 A;  1KNZ A;  6AT1 B;  3NGK A;  2VB6 A;  4DV4 J;  3CJS A;  4FYX B;  1UTA A;  2E5L F;  4YR0 A;  3HK2 A;  3D1Q A;  3NP5 A;  4BLG A;  1EJ7 L;  4JV1 A;  1OY6 A;  2C2D A;  4UOC A;  4PQA A;  1K0V A;  1SB6 A;  4X4O A;  4DUY F;  1FD2 A;  1HAR A;  1UVL A;  1JIH A;  5IS2 A;  4G3I A;  3FEZ A;  3QSI A;  5G0R A;  3KLF A;  4JI0 J;  3M8S A;  1YLX A;  2A6O A;  1KTV A;  1XEZ A;  3CDB A;  1RYS A;  5BYR A;  1S4E A;  3D54 A;  3W60 A;  2RH3 A;  2QA2 A;  4OZ2 A;  3BSC A;  4RUC A;  3OTD A;  1NPK A;  2CJY B;  2VBX A;  2H4W B;  1S1T B;  4X4N A;  4DR4 J;  4ZP6 A;  1HFE L;  4QWD A;  1FKO B;  4X4Q A;  3CW2 C;  3VGV A;  4DV7 J;  5AJ3 J;  4DL6 A;  4F26 A;  4X4T A;  2W9B B;  1RCO B;  2ZBI A;  4O3R A;  1U0H A;  1YX2 A;  3BSO A;  3ZZY A;  1B64 A;  3PYG A;  4DV2 F;  1MWQ A;  1RBA A;  1HNX J;  4L3K A;  2ZJR Q;  4LF4 F;  2A2C A;  3BF4 A;  3R27 A;  4I0W A;  3QID A;  4RX6 A;  3A8E A;  5ETL A;  4MTP A;  2Z2Y B;  5B0G A;  1XMQ F;  4RBV A;  4PUO B;  1FJE B;  3G86 A;  5A8R B;  3NEK A;  5CH7 B;  1FKP B;  1U45 A;  1U6B A;  3JYT A;  4GKK J;  5A2Q Y;  1OJ4 A;  2G9O A;  2D74 B;  5J2M B;  2V8V A;  2CIM A;  4RWX A;  1B0T A;  2BE7 D;  4IQM A;  4KFB B;  2ZDO A;  4LRB A;  4E0D A;  2R8G A;  1S1V A;  3OTB A;  3M8Z A;  1FHT A;  2XGP A;  4FDF A;  4ID5 A;  3FNN A;  5KFP A;  3QFW A;  3W5Y A;  3CCW A;  4DV1 F;  3KUG A;  1CJV A;  2VQF J;  2M0G B;  3KJQ B;  2GJ2 A;  4J7C A;  2VG7 A;  4NI2 A;  2BQ3 A;  1LV5 A;  2CJB A;  4IG3 A;  1XNQ F;  1T05 B;  2VFU A;  1T9Y A;  4FPR A;  3MD1 A;  4CLT A;  4KRW A;  2R7R A;  3MD3 A;  2IMO A;  1WD6 A;  2D3U A;  3FSX A;  1HWK A;  3FUY A;  4AQY J;  5HMZ A;  4FVM A;  5J2P A;  4A8Q A;  5KFU A;  2V8G A;  2HHQ A;  1TQL A;  3O2I A;  3W1Y C;  3US5 A;  4LJM A;  4OJ1 A;  4DR5 F;  3MPY A;  1ICE B;  1UEU A;  3ZZP A;  1GMW A;  4OYM A;  3NGT A;  3MUM P;  3GII A;  3BN7 A;  1ZPW X;  2GJI A;  3DOM B;  1I51 B;  3HJV A;  1AUS L;  1SJR A;  7AT1 B;  1X4H A;  1KTQ A;  3MXH P;  1XR6 A;  3MM7 B;  3KHG A;  4YHH F;  4DL7 A;  5F3T A;  2WSE C;  2NXN A;  3I0R B;  3NAH A;  4ZHR B;  1CS4 B;  4RKU C;  3R3T A;  1BGX T;  3I32 A;  3ZTO A;  3GJS B;  4P75 A;  4RUA A;  3PIO Q;  1NJX A;  5E3C A;  2V94 A;  2XG8 A;  5EHH A;  2YNI A;  4ILR A;  3R6G B;  1F60 B;  2G13 A;  1QY7 A;  1MU2 A;  3JAM Y;  2OLW A;  5A8K B;  2CDR B;  1NK5 A;  4F67 A;  3OV7 A;  1GT8 A;  4JV2 A;  2YQ1 A;  2MSS A;  4Y28 C;  2AJF E;  3DM2 B;  4DQI A;  4OV1 A;  5IV3 A;  4X2B A;  3G8S A;  4CNY A;  3BGO P;  3NS7 B;  4CH1 A;  4ZS6 A;  3EWG A;  3S1T A;  3MAA A;  3Q2S C;  4PG5 A;  1KRP A;  2FD2 A;  2E5H A;  1RT6 A;  1SPB P;  2DVI A;  4B3T J;  1YJW S;  2PO4 A;  3AOB A;  2V4R A;  2GW8 A;  1Q95 G;  4KGZ B;  4AD6 A;  4YB6 A;  5CD4 H;  2HKE A;  2JLF A;  2RQM A;  2ZBC A;  4C3K A;  1TMJ A;  1G4C A;  1S12 A;  4HDH A;  1U1P A;  2M5Y A;  4XIU A;  3PHE A;  3A8I A;  3ISZ A;  1YJR A;  2PT0 A;  3EGW B;  5DDQ C;  4ES2 A;  2OGU A;  2MY8 A;  3ZZZ A;  4CLY A;  1T3N A;  1MN9 A;  3MOJ B;  3ETO A;  1QSS A;  2HVZ A;  4DPX A;  4I69 A;  1S97 A;  4WKR A;  2QLB B;  1JWW A;  3PW0 A;  2BOP A;  4J9L A;  2YX1 A;  2V6A A;  2K2P A;  1RWP B;  2VJU A;  3HSG A;  1Q7Y T;  4L76 A;  1ZAX A;  3CJ5 A;  3VQS A;  4ZIW A;  4ZPA A;  5HMX A;  3ENQ A;  4CWB A;  1I94 J;  2Y1J A;  2BJ9 A;  3KHR A;  2RSQ A;  5D0R A;  2QL5 B;  2HQG A;  1U02 A;  5FDL B;  1B7F A;  4BC7 A;  5IV4 A;  3PX6 A;  5I4M A;  2P6T A;  3KG0 A;  2ADB A;  4LF9 J;  1R6Y A;  3HT0 A;  4IUF A;  2B8P A;  3O5T B;  1NDC A;  1WC1 A;  1JK9 B;  4I6A A;  1U09 A;  4DCP B;  3IA0 A;  1NME B;  2EVZ A;  4ED5 A;  4GVL A;  4KH0 B;  1ZH5 A;  4UZB A;  4C0H A;  2KT2 A;  4OZJ A;  1T95 A;  3FMW A;  1LXN A;  3A8K A;  4RW6 A;  2JH3 A;  3LAM A;  1FTR A;  3MEE B;  5HSP A;  3MR2 A;  4FXV A;  4C2M A;  5C42 B;  5KFC A;  4LQ3 A;  3R2C J;  4PG8 A;  2VIH A;  2NQP A;  4OYW A;  2M88 A;  3DOK A;  5B09 A;  2YKN B;  1SIW B;  3J7Z 5;  4NL5 A;  3OTO J;  2IAJ B;  1QSL A;  1ZTW A;  2M70 A;  3KKF A;  1NLK L;  3KJV A;  5IQQ A;  1HPZ B;  2CPI A;  2WOM A;  3MCO A;  3OQ2 A;  3LF0 A;  1CSJ A;  2BW2 A;  3CC7 S;  1DLO B;  2I9S A;  4A8X A;  1G1X A;  1VI7 A;  3WZ0 A;  2FZK B;  3GV8 B;  4K0K J;  2PII A;  5A2Q U;  2CPD A;  4URG A;  2RDJ A;  2JVO A;  5CHC B;  1M5H A;  2AYM A;  1S10 A;  5F8I A;  3Q24 A;  1NH8 A;  4Y2I A;  2QSW A;  4ETX A;  2ZZT A;  2E9R X;  1VCT A;  1ZA1 B;  1IQZ A;  2I5J A;  2L9N A;  2DH7 A;  3BDE A;  1JLA B;  2OD6 A;  4D3G A;  1GK8 A;  1NPR A;  1S1U B;  3Q8R B;  3VF0 B;  2H5J B;  2G0J A;  1XJW B;  4DR6 J;  2IBO A;  1U1R A;  1RQ0 A;  3OXF A;  2YNG B;  4M5D A;  3IAS 9;  3THT A;  5KFX A;  4KIA A;  4WE1 B;  1KDN A;  3BEG B;  1DAX A;  4MK8 A;  3R5D A;  2HAF A;  4USM A;  3ILI A;  2ALZ A;  4MKV A;  2KG1 A;  1RU2 A;  4QIG A;  2OPQ B;  3HJF A;  4RBT A;  1V3Z A;  2DGS A;  1YJT A;  4R0J A;  1FFS B;  2FHJ A;  4ZJQ A;  5KFM A;  1MMD A;  4O4R A;  4P10 A;  2MKS A;  2VOO A;  2EC2 A;  1RAD B;  4KKO B;  1WTF A;  4F3Q A;  1HNW J;  5H9F J;  2D7S A;  3NBP B;  4PXB A;  3QT8 A;  3M30 B;  5D4P A;  3PXG a;  2EC0 A;  1M5K C;  4ZVE A;  1NCL A;  2CQ3 A;  1HWU A;  2RJZ A;  3ET6 A;  4IH5 A;  1GX6 A;  2AX1 A;  4J9N A;  1CJT B;  1VQ8 S;  2DNQ A;  1WEZ A;  4MAK A;  1RU1 A;  2HMI B;  2B8Q A;  4HLB A;  4WP8 A;  3ZTP A;  4F4A A;  1URR A;  1VQ9 S;  4D3H A;  2IJF A;  2DGU A;  2J0W A;  2VFS A;  3V6D A;  1FRX A;  1NRK A;  4F3O A;  1PO6 A;  5JVH Q;  4QU7 A;  2MYF A;  1VQP S;  3J81 j;  1TUG B;  1NJY A;  2OSQ A;  2XYG B;  2ZZN A;  1TKZ A;  2C1E B;  2W25 A;  1HI0 P;  2EG1 A;  1U47 A;  3AA9 A;  5I3U A;  3ENV A;  3JAM U;  2ERR A;  4P7V A;  4CNZ A;  1QSY A;  4Z7Y A;  3VGT A;  3UD3 P;  2IVF B;  2J7W A;  5C24 B;  1Q0N A;  3CJT A;  5ETS A;  7FDR A;  3CD5 A;  3H90 A;  4DN0 A;  2H65 B;  3LQV A;  5FLX Y;  5HI7 A;  2XMW A;  2N3O A;  3T1H J;  4PCQ A;  3CCR S;  3I9V 9;  4NLO A;  2ZE2 B;  3GIL A;  2AJ2 A;  3EDQ B;  2OPR A;  4ECT A;  4QIE A;  4QIV A;  1S6O A;  4C11 A;  4JB8 B;  3ENW A;  1REV A;  2VPZ B;  3QGP A;  3DOL B;  4I2Q B;  2RDD A;  4LIW A;  1B0V A;  1JLG B;  3PX0 A;  4K7Q A;  1QAI A;  4QYZ K;  1U24 A;  4YB7 A;  4LF6 J;  1WI6 A;  2B51 A;  1HL6 A;  5CAB A;  4CLK A;  4I67 A;  1RHJ B;  1M1H A;  3P96 A;  1UMJ A;  2COL A;  3MM8 B;  1TVR B;  2CXE A;  5KG4 A;  1CUL A;  1KLN A;  4HHH A;  3W64 A;  2HIY A;  1HNZ J;  1AZS A;  3V6J A;  4OLP A;  4WYW A;  4EZ6 A;  3KK1 A;  3DHX A;  3SMZ A;  4O3S A;  3PDN A;  1ZS6 A;  1UVN A;  5F8L A;  5THW A;  1JJ2 R;  1N33 F;  4IOB A;  3TUZ C;  3KJN B;  2HND A;  1H74 A;  3M6V A;  2PE8 A;  1FDN A;  4ICL A;  2VD3 A;  2PC6 A;  2W8K A;  2HYI B;  3N6L A;  2V2V A;  1WEX A;  3MEC A;  1HNI A;  1OSC A;  1HKA A;  3CUN A;  3E2E A;  4NLW A;  2Z30 B;  1WKL A;  1WOS A;  2R8J A;  5J1P A;  5LL6 d;  2FJE B;  4QYR A;  3TEH B;  1R8P A;  2HHH F;  3VZH A;  2AWZ A;  2X1A A;  4OMF G;  3SEO A;  3TEG A;  5D6G A;  1YBU A;  2ASY A;  3PJX A;  2CYY A;  4M5I A;  5CD4 A;  3JSM A;  1X5O A;  3M9O B;  1D1U A;  3PO5 A;  3RW7 A;  3MMC A;  4IFY B;  3IR5 B;  2QTW A;  2B0G A;  1YIT S;  5BR8 J;  3N9U C;  2FHM A;  2DEJ A;  4JI2 F;  1HD0 A;  2RF2 A;  4TU7 A;  3DGP B;  1FX2 A;  4P2M A;  2JNJ A;  3X3U A;  5K5M A;  3MTK A;  2OO4 A;  3SDE B;  4DCJ B;  2BM1 A;  1H6K X;  4IOC Q;  2GV1 A;  4L72 B;  2YBV A;  4J9U E;  5LJ5 Y;  3FZB A;  2M8H A;  3MUR P;  2LA6 A;  2YKA A;  2QA4 S;  2A0F B;  1S0N A;  3HKZ D;  2FY1 A;  2WON B;  3DLG B;  1DUR A;  1I5O B;  4HVZ A;  4W98 A;  3D9B A;  3Q8Q B;  3AFG A;  1G7C B;  3J7Z T;  5IC4 B;  1SC3 B;  2WVF A;  3MUT P;  3IBC B;  1IBK J;  3W63 A;  2BEF A;  2BE9 B;  2OFG X;  3PTW A;  2C2N A;  2OHD A;  1C0U B;  1IWG A;  1HA1 A;  2OPS B;  4K4W A;  1S1T A;  4USI A;  2BAB A;  2HVD A;  1RAO A;  4DV6 J;  1M5O C;  5LOQ A;  2XY5 A;  4M63 A;  3K17 A;  2QGF B;  4N76 A;  4P71 A;  3N6N A;  5D0G A;  1FKO A;  1JNZ B;  5BYQ A;  1F2G A;  2BQU A;  1HQE B;  3DRP B;  2W9B A;  1TKD A;  1FTC A;  3RRK A;  3W9H A;  2ZJQ Q;  2AZ3 A;  2GC8 A;  3D6T B;  4DV7 F;  2RIJ A;  2FGC A;  4FN5 A;  2JZ5 A;  1SI9 A;  5MAO A;  1K44 A;  4PQU B;  4X65 J;  1WOR A;  3D4J A;  1SL1 A;  1QM9 A;  2XMT A;  1HNX F;  1YIJ S;  1TL7 B;  4PUO A;  5A8R A;  1P6T A;  3IRW P;  1FKP A;  3A3O B;  5EDW A;  7FD1 A;  1KWM A;  3KTQ A;  2DHS A;  4HH1 A;  3W9J A;  5J2M A;  2DNM A;  1W2B R;  1FJ7 A;  2YWE A;  2RE1 A;  1UFW A;  1S76 D;  2ZFH A;  1WTB A;  4GKK F;  3HHL C;  5GAD I;  3TVK A;  2J7U A;  1NB7 A;  2CFX A;  5KFW A;  1PJ6 A;  4LVN P;  3TP2 A;  3CDE A;  1RA7 A;  1EHW A;  3DRS B;  3H5S A;  3FFI B;  8ATC B;  2CJ9 A;  4E2F B;  3UWT A;  4O44 B;  4LFB F;  1B3T A;  1RAI B;  1RE1 B;  3A1Y G;  1ZM9 A;  4OX7 A;  2W1B A;  3LGM A;  5AT1 B;  1T05 A;  5FLX U;  3AQO A;  1TTH B;  4W92 B;  3Q8U A;  5LMU J;  1GNK A;  4K4Z A;  1W25 A;  4EZ9 A;  1RT5 A;  2YWF A;  4OLO A;  2MDA A;  1NK0 A;  4M5J A;  4WFX A;  4KV8 A;  1S77 D;  2BAN B;  2BA9 A;  3M8P B;  4ELT A;  4KR0 B;  3NMA A;  1IKY B;  4LSL A;  3BM7 A;  3M9N B;  4DXL A;  4ED7 A;  1ZA2 B;  1YTY A;  4YEA A;  5ADZ A;  3W5Z A;  5EWE A;  1LOU A;  1PIE A;  5SZT A;  3CXC R;  2OUG A;  2BJ3 A;  3BH7 B;  4HI2 A;  4MK7 A;  2EKY A;  3QJP A;  3DOM A;  4ECX A;  3FGV A;  2YNF A;  2D1C A;  2M7S A;  4JBC A;  2JEF A;  4W90 B;  1WNE A;  4OYA A;  4C0O C;  1RYR A;  2KT5 A;  1TEL A;  3T5H A;  5B7W A;  4Z37 A;  3M8R A;  2GGP B;  3EJM A;  2IYI A;  4OQJ A;  3X1L B;  4ZHR A;  3PR5 B;  2DCU B;  1UW9 A;  2EEY A;  2HGN A;  2PDA A;  2HHT A;  4QOT A;  4USW A;  2R2U A;  4GMK A;  4ZOS A;  3GIR A;  2E1M C;  1LWE B;  1PYO B;  2PD1 A;  5A8K A;  2M8D B;  3UO0 A;  2B4U A;  3RB6 A;  3C6U B;  2KB2 A;  2G2O A;  3DM2 A;  2WVB A;  2D3O 1;  3GG0 A;  1DJ0 A;  1Y5N B;  3CJ2 A;  4QBU A;  4ZVF A;  3MTJ A;  2I1R A;  3R1L A;  2OD4 A;  4AL5 A;  3L7U A;  2DNY A;  1D8Z A;  3ENA A;  4YME A;  2EK6 A;  3HVT B;  2L41 A;  5J1E B;  2QMU B;  3GR0 A;  1DZ5 A;  4ED0 A;  2FC8 A;  2EK1 A;  5DET A;  5HRO B;  2RHQ B;  3BQ1 A;  4TKT A;  5J1N A;  4B3T F;  1TZ0 A;  1P27 B;  1U1M A;  1VQN S;  5IOL A;  2OML A;  4ZLP A;  2Y3Y A;  3BYP A;  3BH6 B;  4YB5 A;  3GZ7 A;  2W4C A;  2YX4 A;  4NA1 A;  2PMH A;  3BRE A;  4K4V A;  1RBL A;  1CBK A;  2KXH A;  2YTC A;  2ZUG A;  4UQG A;  4JI5 J;  4GRS A;  3VAI A;  3AQP A;  4RWW A;  2HVE A;  2IJR A;  1VLY A;  2FJB B;  4OYP A;  3T19 A;  2IM3 A;  4ED3 A;  1FXR A;  3BBB A;  4WFA Q;  2V34 A;  3D5M A;  2DRA A;  2CQC A;  4A8Y A;  4CCH A;  2KYX A;  4F4X A;  1X60 A;  2Q6B A;  1X9W A;  4B3M J;  4OX6 A;  3IS9 B;  1Z2Z A;  5KTQ A;  3NMR A;  3GYN A;  2CQH A;  3GIM A;  1VS3 A;  1FNX H;  1JJ4 A;  3M05 A;  4K4S A;  2B7B B;  2BE2 B;  2DNZ A;  1FX4 A;  5KOW A;  2Q79 A;  5DGA A;  4G1Q A;  2J0X A;  1I94 F;  1FER A;  4LRF A;  4ZPV R;  2HG4 A;  1N5Y B;  1HBU B;  3CJ4 A;  3RTV A;  1GFW B;  5FD1 A;  1I3O B;  1NB2 A;  3PRV A;  4A4J A;  1H3D A;  2XNR A;  1X31 C;  2VIC A;  1UEK A;  4WFB Q;  1OO0 B;  4LF9 F;  1HBM B;  1TAQ A;  3CJQ A;  4PPZ A;  2KTQ A;  5GAG U;  2CVE A;  2P5V A;  3M9M B;  2ZH6 A;  2PEB A;  3MAH A;  3TZY A;  1FRL A;  3WX8 A;  1JXV A;  2E1R A;  1S1W B;  3T1Y J;  5HBM B;  3P6Y C;  4NLR A;  1RKI A;  4I64 A;  1CJK B;  1PBU A;  5KFE A;  4RW7 B;  5C42 A;  1X4D A;  4Y34 A;  3NY0 A;  3MZI A;  4GO7 X;  4O3N A;  2NXU A;  2KG0 A;  3H7H B;  2ABY A;  2YWW A;  3K5M A;  2YKN A;  4F50 A;  1NND A;  2IAJ A;  2UVR A;  1U4B A;  2CZ9 A;  2C3O A;  2MEW A;  1HPZ A;  5HL7 Q;  3EPG A;  3T5L A;  1CC8 A;  1DLO A;  3MMA B;  4UQT A;  3CCQ S;  1WHX A;  2VA3 A;  3H2U B;  5F8N A;  3JSY A;  1Q79 A;  3W2W B;  3OTO F;  2B56 A;  3KLE B;  2FUG 9;  3T3F A;  1KQF B;  1DQ8 A;  2KL8 A;  1VIS A;  1HBO B;  1U1N A;  2XLK A;  1HD1 A;  1S5Z A;  5HMY A;  2M2B A;  3HKW A;  2DHH A;  2VQE F;  4J9M A;  3IM8 A;  4O4G B;  3IMQ J;  4J9R A;  4K0K F;  1TP7 A;  4FF4 A;  1RHK B;  4QCL A;  2HBR B;  2V2Z A;  4MKY A;  1JLA A;  2V9K A;  1NK7 A;  2HIQ A;  1S6P B;  2OSR A;  4Y2C A;  1EP4 B;  5JJB A;  4DLE A;  3TUJ C;  3L09 A;  2UU9 J;  4WE1 A;  2G1D A;  4NLQ A;  3HHE A;  4ETZ A;  1Y5L B;  2E66 A;  4QYZ J;  2OPQ A;  4NWB A;  1QAJ A;  3HMJ G;  2EPI A;  2R7V A;  3V4I B;  1KSP A;  1R8C A;  3FBB A;  2C2K B;  1TL1 B;  5HAT A;  1Y5I B;  1RKJ A;  4WFY A;  1RHM B;  4KKO A;  4IR1 A;  3BQ2 A;  3M30 A;  1TMM A;  2HWT A;  5HQL A;  2JJ4 D;  3MM5 B;  4LF2 A;  2ZH5 A;  2HWH A;  2H54 B;  3BYR A;  2ASD A;  5HMW A;  2IBK A;  2HZC A;  2E5J A;  1CJT A;  2EFQ A;  3KNG A;  3UDC A;  1HNW F;  3ICL A;  1BQX A;  5EN1 A;  2Y9H A;  4DL0 C;  2PMZ D;  4G65 A;  2XCA A;  2QL9 B;  1YRT A;  4FP9 A;  4NXM J;  1HI8 A;  3PG9 A;  2V4Q A;  4P2X A;  2XY7 A;  4DWI A;  2OP5 A;  3EUN A;  4KTQ A;  3MM6 B;  3I55 S;  1M1K T;  2IHR 1;  2J6U A;  2V63 A;  3JS9 A;  1HMV B;  3GIK A;  2H4Y B;  4DF8 A;  4GC6 A;  1AFJ A;  4WF9 Q;  5C2G A;  3DLH A;  1UA1 A;  1FO1 A;  5DZ6 A;  5T41 A;  1NJW A;  1VQO S;  2GO8 A;  1RAG B;  4K2J A;  3MR6 A;  2ZNZ A;  5GAD U;  2F5G A;  2V8H A;  4CH7 A;  2ZD1 B;  4XPE A;  4USK A;  3PFO A;  1QD1 A;  1S1X B;  2Y8W A;  3IBF B;  3RR7 A;  3MGJ A;  4DQP A;  2DXF A;  3RB3 A;  2U1A A;  1MWZ A;  3G8Q A;  2GML A;  2MHE A;  2J9D A;  3NRB A;  2ZE2 A;  1JLF B;  4CO1 A;  3MCS A;  2DGV A;  1F3F A;  1ZET A;  4ECR A;  4LF4 J;  4MJK A;  2GMJ A;  1KN6 A;  1HBN B;  4M8L A;  4IKA A;  3D28 A;  2GHW A;  4CP5 A;  5ETV A;  5KG5 A;  5LXY A;  3JTN A;  1SJ4 P;  3DOL A;  4I2Q A;  4ZVG A;  1JLG A;  2XQC A;  1KFD A;  1XMQ J;  3ZZR A;  1RK8 A;  2BRK A;  3DRX A;  4OZ3 A;  3VAL A;  4OJ3 A;  3OT9 A;  4DX5 A;  4F0H A;  4NLD A;  4N5S A;  2CQD A;  2HS4 A;  1IKV B;  3KLG B;  1W7W A;  1LFW A;  5B0F A;  5KFK A;  1VMB A;  3CPW R;  3D6M B;  4DSL A;  4LF6 F;  3G2X A;  2XI2 A;  1HWL A;  2IA0 A;  3PYE A;  2CAD A;  2CQP A;  1OY9 A;  2ZVI A;  3KOA A;  2WW8 A;  3OFG A;  1AA1 B;  3D0I E;  5H1S V;  1HNZ F;  2V2Q A;  4CLZ A;  2FVR A;  4OJH A;  2PFF B;  2RS2 A;  3L9Z A;  2XZW A;  4DSJ A;  2VFR A;  2PEH A;  3CDW A;  3DXS X;  3PZP A;  5I42 A;  1KC8 T;  3K5N A;  2CJK A;  3QMQ A;  2ZUA A;  3FCV A;  1Y3J A;  3N5F A;  1UWA A;  3PY8 A;  1IM6 A;  1EAY C;  5DJB A;  1L5U A;  4Q0B B;  3NKY A;  3M32 B;  2YPZ A;  1MNE A;  4XTT A;  2W2N P;  4P2F A;  4LF8 J;  2X51 A;  4IFY A;  3LH2 S;  1RHQ B;  3GLJ A;  2YVS A;  1NK4 A;  1FDB A;  1RTH B;  3U27 A;  1Y7P A;  5DG8 A;  2XZT B;  4M5H A;  4NCG B;  2CKW A;  3KK2 B;  1TK0 A;  1V5I B;  4TLQ A;  4ZVU B;  3DGP A;  5BR8 F;  5D3G B;  2UXB J;  1QE1 B;  3I96 A;  3MMB B;  3KFW X;  1RIS A;  3SDE A;  1QVG R;  4AT1 B;  3H2V E;  2I8E A;  2ZNY A;  2HHP A;  3H8Y A;  2RU3 A;  2C2Z B;  3CD6 S;  1VBX A;  3BBC A;  1PBA A;  2VG5 B;  1EET B;  3BDP A;  3GWC A;  4ZDN A;  4ILM A;  2ADC A;  1ACM B;  3DLG A;  4CO0 A;  1R0B G;  3QJL A;  3OXG A;  5D15 A;  1S9G B;  3PNI A;  4ZKA A;  2CQB A;  2FHK A;  2ZDP A;  4ITS A;  2Q3P A;  2B9X A;  1ELO A;  2EXU A;  3CC2 S;  1F9H A;  5C2C A;  2C3P A;  3TAQ A;  4USU A;  2ZH9 A;  1T9X A;  1WSV A;  2HZV A;  3QRP A;  1C0U A;  3Q2T C;  1VBK A;  2OPS A;  1X0F A;  1IBK F;  3I0S B;  3RB0 A;  2V69 A;  3GCW P;  4QPT A;  1EKS A;  3S7R A;  2UVU A;  4Y00 A;  3VZI A;  4C97 A;  2BM0 A;  3VCD A;  1HQE A;  1B70 B;  5ETM A;  4DV6 F;  4ZVQ B;  1APS A;  4U95 A;  2GJF A;  2DHA A;  1DQ9 A;  1RWM B;  4AXJ A;  3HVW A;  1U25 A;  2N4D A;  4K4Y A;  3GP9 A;  3ILJ A;  1P9Q C;  1TFY A;  2XSF A;  2OAU A;  2D41 A;  1RT7 B;  4UW2 A;  4OI6 A;  2MKC A;  2GIQ A;  4OYX A;  4PQU A;  4LSZ B;  3BS9 A;  5IC6 B;  5AXN A;  5T7L A;  1PAE X;  3TQ1 A;  1K47 A;  3E51 A;  4XDD A;  4LF5 J;  1LKZ A;  4ZJO A;  3PKM A;  5A0Y B;  1XER A;  1TL7 A;  5IZH A;  4X62 J;  3EDR B;  4ED1 A;  4X65 F;  3CTR A;  3VAG A;  2ASL A;  4TU8 A;  1SIZ A;  1U0S A;  2XMV A;  5JVG Q;  3OSP A;  1LQ9 A;  4NOH A;  5KT7 A;  2R4F A;  3M8W A;  4ILL A;  4JI7 J;  2MKI A;  1X5P A;  4EU0 A;  1H7W A;  2BJD A;  1U7L A;  2HFV A;  5G4D A;  3PKY A;  3FMB A;  4CH0 S;  1OPZ A;  4DJB A;  5AXL A;  4O44 A;  4H54 A;  2V2K A;  1TK5 A;  4UUW A;  2L3M A;  3TJ8 A;  5CZX A;  2DY1 A;  3PRD A;  1M5P C;  3HP6 A;  3TZX A;  2DHX A;  4PYD A;  1X5T A;  4G1I A;  4QQB A;  2MZJ A;  2K1R B;  1XMO J;  4NCB A;  4C7Q A;  4ZLN A;  3EIC A;  3M8P A;  1JJH A;  1IKY A;  2HBY B;  4N8N A;  5LMU F;  3EXY A;  5DG9 A;  3I5B A;  3KK3 B;  2FVP A;  2PI4 A;  1RWW B;  4ES3 A;  5HVH A;  1WC4 A;  1SV5 B;  4WCE Q;  3FBC A;  3DFE A;  3BO2 A;  4EBD A;  5E3A A;  4ALZ A;  5H9E K;  4O3O A;  3QPI A;  3BKF A;  3NGS A;  3AOA A;  1IJE B;  4F8R A;  2E44 A;  1Z4U A;  4DOZ A;  3EZ5 A;  1YJ7 A;  2JLE A;  4UOF A;  3LWL A;  1NDP A;  2DBB A;  1GMW D;  5KG1 A;  3KNA A; 
#chains in the Genus database with same CATH homology
 1G4C A;  1HKA A;  3HCX A;  3KUE A;  4M5N A;  5ETN A;  5ETV A;  3UDE A;  3MCN A;  4M5H A;  1EQ0 A;  2F63 A;  1HQ2 A;  5ETR A;  4M5G A;  5ETK A;  3ILL A;  3HSJ A;  3HSG A;  2QX0 A;  1CBK A;  3KUG A;  1RTZ A;  5ETM A;  5ETQ A;  3HD1 A;  3UDV A;  4CYU B;  4M5K A;  4AD6 A;  4M5L A;  3ILI A;  4CWB A;  3QBC A;  3IP0 A;  3HSD A;  1RU2 A;  3UD5 A;  4M5I A;  3HT0 A;  1TMM A;  5ETT A;  1F9H A;  4M5M A;  1IM6 A;  4PZV A;  5ETL A;  1TMJ A;  1EQM A;  1Q0N A;  1DY3 A;  5ETS A;  3ILJ A;  1RB0 A;  2BMB A;  1KBR A;  3ILO A;  3HSZ A;  1RAO A;  3MCO A;  4CYU A;  3KUH A;  3MCM A;  5ETO A;  3HD2 A;  1RU1 A;  1EX8 A;  4M5J A;  2F65 A;  5ETP A;  4CRJ A;  2CG8 A;  4F7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...