3ILJA

Crystal structure of e. coli hppk(d95a) in complex with mgampcpp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLALDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
source organism Escherichia coli
total genus 41
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3iljA00
5ETMA 5ETTA 3IP0A 1F9HA 1CBKA 3HSDA 1EQMA 4M5IA 4CRJA 2F65A 1TMJA 3HCXA 4M5GA 5ETNA 4AD6A 1EX8A 1G4CA 2QX0A 3ILIA 3UDEA 4CWBA 5ETKA 3HSGA 4PZVA 5ETOA 1EQ0A 4M5NA 1RTZA 3UDVA 1HQ2A 1TMMA 1RB0A 1RU1A 1DY3A 3KUHA 5ETPA 3HSZA 4F7VA 1HKAA 4CYUA 3ILJA 4M5JA 3KUEA 3HD1A 5ETRA 3UD5A 5ETVA 1Q0NA 4M5LA 4M5MA 4M5HA 3HSJA 3MCMA 3MCOA 5ETSA 3MCNA 5ETQA 2CG8A 3ILLA 3HT0A 1RU2A 4M5KA 3KUGA 3ILOA 1KBRA 2F63A 3HD2A 3QBCA 1IM6A 5ETLA 4CYUB 2BMBA 1RAOA
chains in the Genus database with same CATH superfamily
2EKNA 3NMRA 4A4JA 2HGNA 4F67A 1UFLA 4G1PA 1S7IA 2HWHA 3KJQB 4PAAA 5I3UA 3ISZA 1LK5A 2HFVA 2BKPA 2OH2A 3R27A 5IC6B 1VIOA 3K8VA 2ERRA 1ZZNA 1QAJA 2J9DE 4QOTA 4NA1A 3T1HJ 4I69A 3NOCA 1HNWF 4DQSA 1GTEA 4PG5A 3S6EA 3OL8A 1UVIA 1F9EB 1B7FA 2DHAA 3T41A 3WIUA 2Q79A 2UZAA 3UQSA 1ZZFA 2ZVSA 2XCAA 2ZH3A 2CQPA 2XMJA 1BQMA 3M8QA 4DR3F 3MZIA 1H3DA 3SYZA 3ZZ0A 4LFAJ 4OYWA 1LWXA 5KFXA 3M8ZA 1X5OA 4U96A 1NZAA 4DSJA 1HYSB 2H5EA 1SL1A 3V6DA 3QO9A 2CQ4A 2SXLA 1LW0A 4C8ZA 3UVJB 3DYAA 1XR6A 1H74A 3HI9A 1X4AA 2EFGA 1FKOB 4YR3A 1W26A 4H4MA 1RT6A 1M5OC 3D9BA 2JSXA 1TAQA 4RR5A 3M6VA 1FD2A 1RAHB 2X3DA 1VBKA 1D1UA 3J7AN 1R27B 2M70A 1M5VC 2HZVA 2B6AB 5F8LA 1YBUA 2RS2A 2HVHA 3QFWA 4GKKJ 4LF5F 3PEJA 4RUHA 1NDPA 3BSCA 4HEA9 4J9KA 2Z58B 5G4DA 2F9JA 4N41A 3MMJA 1HQEB 4JV5F 3PW4A 1U0HA 2DNHA 4EYIB 1R43A 1VK3A 3T1YJ 4DL6A 5JXSA 1WJ9A 2QIFA 4CT9A 2M3DA 3H5YA 4DQRA 2CXEA 4XDCA 4Y0FA 3M32A 2R2TA 1RHMB 1YJTA 2PO4A 1U49A 3KHLA 1M90T 2QL7B 3D3CJ 3CT9A 3KLIB 4FBTA 1VQ6S 4BS2A 1N32J 1J2VA 5D77A 1RAIB 3ENWA 2RUSA 3U1NA 2K1RB 3VAKA 3HZGA 2RJZA 3OBIA 4B9TA 4M63A 4M5NA 1S9EA 2YKPA 4JI2F 2DO0A 5HMWA 1SKWA 3PCOB 1Y0HA 2R7SA 1E6YA 2VBWA 4KC5A 4DR4F 1VHIA 2PC6A 1VQNS 2JFDA 1LWFB 3Q0AA 1NDCA 3W7BA 5IZHA 3QSIA 3LP1A 1FDBA 1CJTB 1IR2A 4WKYA 3LPYA 3VAIA 1KN6A 2Y1RI 4LR8A 4OYZA 4K50A 4F2RA 4C48A 3N4WA 4FF2A 3TQEA 1ZAWA 1FRXA 4IH6A 4O44B 3HFVA 2IVMA 3MPYA 3I5BA 3UDVA 4EBEA 4NEYA 2ASYA 1Z2ZA 3NRBA 4B3OB 5HLFB 1H7WA 5IC4B 3D68A 1U25A 4OHZA 2HMIA 3ZTRA 1K9MT 1DLOA 2QC3A 2XCPA 5GAEU 4ED6A 6AT1B 3JQJA 3Q86A 3ZZUA 4E2FB 1W2IA 3DRSA 3O44A 1N88A 3C2PA 1JWWA 3G86A 2PIIA 2CDRB 2Y1LB 4P2XA 2F3JA 2VG6A 2I5JB 2QX0A 3UCUP 3H4BA 3CCSS 3DRXA 3G6YA 4ED5A 5FIIA 3JXOA 4B3SF 1T05A 1N4LA 2GC8A 2YVSA 3FDSA 2V5HG 1H2VZ 3HVAA 4AL7A 2AKWB 4TU9A 3WHIA 1YZ6A 2NSBA 2MQQA 4DQIA 2B7BB 4JI6F 4DFJA 2JH3A 1VOMA 4C8NA 3GV5B 3NS5A 1YK9A 4WFAQ 3R3TA 4YY3J 5G0RA 3K5PA 1DTQB 1WTBA 1SUQA 5SZTA 2WONB 4MMOA 1D9DA 2QZ8A 4WPAA 4DCPB 2FIUA 3JYTA 1UWBB 1IN0A 4BWMA 2ZUGA 3IGVA 4JI8F 1UL3A 3RBXA 1CC7A 4NLPA 2U2FA 3PYDA 3PFEA 1MMLA 1S6UA 4X2BA 2HLTA 3GYNA 5KT4A 3DU6A 3ZC4A 2LA4A 2L9WA 2C2ZB 1YKWA 2ZE2B 2AW0A 4DX6A 2YWEA 3CDAA 1K8AT 3CJTA 3AT1B 3QBCA 3VALA 3KHHA 2WSFC 4OV1A 2UXBJ 3HZEA 1SC1B 4NASA 4X4OA 3OTBA 3W8PA 5LJ5Y 2FJWA 3CTRA 2MQLA 2H51B 3H40A 1TP7A 1RHJB 3JSYA 4NYPA 1C4AA 2DTJA 3LOUA 3PHTA 2DGVA 3U7JA 3H42A 3CJ5A 3HT3A 4UTGA 2VPYB 5K5MA 4PPDA 2MY7A 2CQBA 4LUBA 4KO0A 5IM0B 4K4TA 3M8WA 2HWIA 2MJUA 2KZZA 2XLIA 5L1KA 1BD6A 1VQSA 4B17A 2CVIA 3TANA 2Y8WA 2QT7A 2V67A 3FEYB 4LR9A 4WWSA 1GXLA 4DSIA 2VASA 1LWEB 1B4SA 4LT6A 2WVCA 1U45A 3QIDA 5A0YB 3IGNA 4LFAF 4DV7J 4QYZK 3TA1A 3PJWA 2B9EA 2HFOA 4DXLA 2GW8A 3KLVA 4EK2A 5ETLA 1HR0J 5LSLA 1M1HA 3A8IA 4ECRA 2DH7A 4IH5A 3D4JA 3SQOP 3DDIA 4OX9J 4Y2MA 4OX7A 2VBYA 3MFIA 1S0VA 2RAQA 4FVMA 2HHUA 2XYHB 1ZA2B 2X1GA 4G65A 2FZCB 2PN6A 2W9BA 2ZD1B 1F9HA 1RT1B 3MEGA 2DEIA 2EK6A 2R7WA 4H4KA 5H9EK 3NWGA 2VFRA 2MQOA 3ZZTA 1TZ0A 3BZQA 5D0GA 2QL9B 4ALZA 2VQFJ 4BWJA 2NYHA 4KAIA 3MM8A 3T1YF 4Y65A 1RU1A 2VBZA 1L3TA 1N5VA 3F44A 2D3ZA 5E3CA 4UT4A 4KT0C 1V5VA 2V8VA 4P9SA 1UKUA 3OXFA 1CG2A 5CHCB 1UVKA 4F4KA 4AQYJ 4PG8A 2GAGC 2F9DA 1N32F 4LF8J 1Q53A 1QSLA 5D0HA 1ZAXA 1N48A 1AT1B 1OY9A 4CO0A 2MHNA 1NJXA 3AOCA 3HT0A 4FXDA 2VG5A 5IV3A 4NL5A 3DOLA 1FKAF 1D0EA 1KLMA 2XTJP 2FVCA 3LP0B 1APSA 4HL9A 1N5YA 1L3SA 2ALYB 5KOWA 2KXNB 1DBDA 3PDNA 1F5BA 4ELTA 4USTA 2UUTA 3FJ2A 1K1QA 4IRCA 1TKDA 4F4WA 2BE7D 4L75A 2MQPA 2R7RA 3DDNA 5K8OA 3J7A1 3BO4A 1OJ4A 4OMFG 4OZ1A 2ATLA 4AD6A 4U8YA 4JI4J 1S79A 4ZPDA 4DR7F 3JQKA 1WDDA 1C0TB 4XPCA 2YWFA 1RADB 1RHKB 4NLSA 4U95A 1D3WA 3RBZA 1KSPA 1S4EA 4O0IA 2DK2A 1RTHA 1FF2A 1IQZA 1S4FA 2E5GA 1FI4A 1RA7A 1VR6A 3HVTB 1SJQA 2MKSA 5IWAJ 4DV6J 3I96A 4ETZA 3ZZYA 3A8JA 1UMJA 2MQNA 5H1SV 1SV5B 2MXYA 2XSJB 3FSXA 3J80Y 3I82A 4WFXA 4DU7A 3RJMB 3M2VB 4UOCA 2RKIA 1WUUA 2CQGA 2GHWA 3U02A 1BE4A 1QY7A 1KHVA 1X5SA 3ET6A 2NREA 1L5UA 2L9NA 1UEUA 3KK1A 1FNMA 3HMJG 5ETTA 1WOSA 2E1MC 1JJ2R 1U8WA 2MKCA 7FD1A 3MR6A 4GKJF 4YB5A 3H7HB 4ZHRB 4X4QA 2Z56B 1TL7B 1KKHA 4NLDA 4IR1A 3ULHA 2FHKA 4QWAA 2R8KA 2FD2A 1ITPA 2GHVC 2A10A 2G2YA 3QQCD 4FYWB 4G1IA 3OPKA 4XTTA 1D8ZA 3S01A 5ITHA 4TNOA 3P5TL 4LREA 4DV5F 2OEKA 4NMXA 4X62J 2GA7A 5CH7B 1CEZA 2E9RX 1WF2A 2VF3A 4TQRA 3DRYA 1PC4A 5L9XA 4A8YA 3W9JA 4RBTA 1RWWB 2CPXA 4NLRA 4URSA 1JLQB 4RO0A 2RQKA 4V1Ak 3QSYB 2OAUA 1DY3A 2DR6A 1LW2A 2ZC3A 1OQ6A 1OPIA 2MZJA 2XS5A 2ZHBA 2FY1A 3O8WA 3KNGA 1NAQA 1RKJA 1CPZA 2MGZB 4YR2A 1VQPS 3CDWA 4RNOA 2MZQA 2FVSA 3TO8A 4LR7A 3KLGB 3PR4A 2C28A 1MWYA 5AE3A 5KFSA 1FVQA 5DG8A 2Q6CA 2OD6A 4B3RJ 3PKYA 1UFWA 3G71S 5C42A 4FN5A 4K4WA 2OPPA 3W5YA 2WBMA 4DR5J 1FWPA 1I5OB 4WIIA 2XMKA 2ZM6F 1HIYA 3C6UB 3TA2A 5HL7Q 1S6QA 1EARA 1J5OA 2RDIA 4K7QA 1GH8A 1XMBA 1AZSA 2BANA 4KH1B 2IY5B 2RU9A 1HPZB 2MZRA 1MROB 4LF4F 2XS7A 4J9SA 1KHWA 3TUPA 1OQ3A 1GMWD 5F8JA 1RYSA 3TAQA 4RW8B 4CZCA 4USJC 1OMSA 4USIA 3HKWA 2FLOA 3NKYA 3FRYA 3N6MA 4RWXA 2WK4A 1QAYA 4QPXA 2BEFA 4DL5A 2M7SA 2YQ1A 3L4BC 1MN9A 3H25A 3FQLA 2ZBQA 3F56A 1XK8A 1VJWA 2PI4A 4ZLJA 3FBFA 2C2RA 5B0EA 3T5LA 1GTHA 3MM9B 3V81B 1HNVA 1KP6A 1I1GA 3NEKA 2J0WA 3NOGA 1BXNA 3H5SA 1GMVA 1Y5LB 3S1TA 1Q8BA 1W25A 4USUA 4B9LA 3P3DA 2MEWA 4ZIVA 1EETA 3OL9A 2ADBA 1B64A 1P9QC 3VAGA 8RUCA 3PEHA 1RAEB 1TL1A 2EC2A 5D8HB 3FSYA 1FEEA 4ZCKA 2DIUA 3DRPB 3D0HE 2VG7A 1X31C 3FCVA 3PW7A 4F02A 3G82A 2J0SD 2CWXA 4K4XA 4CYUB 2UV8G 2AGPA 4LF8F 2HHQA 3K5NA 2IJFA 5KFOA 1KTVA 2WVFA 2EBGA 4LQ3A 1HBMA 5HP1B 2VPWB 1U1PA 3LWMA 4NZ7A 4MTPA 5ETNA 4OLOA 2MTLA 3B4DA 1TTHB 4LBHA 1YWXA 3IM9A 4CLPA 1ZBTA 4ZP8A 2MYFA 3M30A 1RI7A 2V4JB 3AOAA 3EGVA 4X4NA 4W98A 4FNHA 1YG0A 2WZ1A 3QRRA 2VQEJ 3AD9C 2IRUA 1FRKA 4WTOB 1UW9A 1FDAA 4TLQA 2DPIA 3A3NB 4FNIA 4AYBD 4CH0S 1Y10A 1QUVA 2D9OA 4C11B 2IDEA 4IQXA 3P5BP 2P5VA 1SH0A 2BKNA 2I2YA 1OSCA 3DLBA 1P9YA 2N4CA 5D0RA 4PG6A 5J2MA 3TOQA 1SQFA 5IV4A 3BN4A 4CO2A 4FBUA 4QWCA 4RW9A 4R25A 3CW2C 1VQ8S 1RTJA 5I3UB 1WELA 4M8LA 1YGYA 3HULA 1IBLJ 1NBEB 3LGHA 1H2UX 1YJRA 3I9V9 2UUAJ 2DNNA 4U9RA 1U1RA 2C3MA 2KYZA 4K5RA 3MXHP 5A76A 5KFCA 1S0OA 4DV6F 4FYXB 2MQ8A 2YPZA 4AUKA 2E5HA 1GX5A 2LECA 1N6QA 4NRUA 1AA1B 4ZVFA 2GQ2A 3FK4A 4NWBA 3CUNA 2ZBIA 4KB7A 2RF2A 1BLUA 1DURA 3RB4A 2QRRA 2LDYA 2FLNA 2B0GA 3Q2SC 4ITSA 5ETRA 4OZ5A 1C0UA 4QU7A 2HRYA 3FZBA 3KYLA 1N5TA 2AEFA 4ILRA 1BQMB 3M8QB 5FDLA 3CD0A 1NLKL 3CDBA 2FZKB 2GMJA 4LIWA 2BRKA 2DGQA 2RRNA 5HVGA 3W9IA 2IM0A 5CQGA 3OTDA 3BSAA 2W4CA 2FGCA 3V6DB 3QO9B 5GMEA 2GS8A 1LW0B 2PDAA 3DYAB 2OO4A 1G3OA 2LXIA 2L41A 4OV6A 4H4MB 1R3NA 2AHOB 1RT6B 5GVQA 1AB8A 5ETQA 3CJ4A 3NAIA 1JNZB 5A2QU 2OSQA 4OZJA 3KDNA 4O4GA 2AEMA 2QSWA 2WCXA 3TZWA 2MDAA 5DDPC 3DXBA 3J7YU 4W90B 4KHMA 2ZNZA 3AHPA 3VQTA 3CCJS 2O67A 1TVRA 1XMOJ 2EFVA 4GO7X 2KZMA 2NR0A 1QSYA 2X1FA 2IM1A 1U0HB 1VFJA 2B4PA 3W2VA 2UUCJ 1XC9A 1EQMA 2DR5A 4EBCA 3R2DJ 4I7FA 4CM2A 2AGQA 3QRPA 1H6KX 1S6OA 3V6HA 3R9LA 3M32B 3KWMA 5LT5A 2Y0SD 2X1AA 3HHKA 1OSDA 3MUVP 1XMQJ 1Q95G 1WEYA 5KFWA 3SSQA 3MFHA 2D3UA 3GILA 1JXVA 2BV3A 1TUVA 4PABA 1JIHA 3CMQA 4NLQA 1S9EB 3QT6A 2GMLA 4CDIA 1RHRB 2W7OA 2E1AA 2CNLB 4LF1A 3BB5A 2IRXA 2KU7A 5HMYA 3K0JA 4UY85 2HHPA 2M5YA 2E66A 5KFDA 2W2NP 4PYAA 5CAAA 2H48B 1DJ0A 4ES3A 3MR5A 3D1HA 4B3MJ 1IXKA 4ES2A 1TQLA 1YJWS 2QLBB 2AV5A 1ZOTA 1V5IB 3MOJB 3LP1B 1UA1A 4E8UA 3OL7A 4IOBA 1FNOA 2J6TA 2HS0A 2C2NA 1SI9A 5CD4A 1ZM4A 2R2UA 4HHUA 3GTYX 2VFVA 4ECSA 1NXIA 5DM6Q 5K20B 4O3QA 2NUUG 3RB0A 7FDRA 3BDEA 2HMIB 3A8EA 2LQ5A 1JMTA 1DLOB 4YDDB 3HFKA 1Q8LA 4C3MA 2AZ1A 4TQSA 2YKOA 2CQ0A 1DAXA 4IG0A 3KMSA 2W2OP 4OZ0A 4EI2A 4PKDB 3DRSB 2XC9A 2BE9B 4J9QA 2VG6B 3NMAA 4J9PA 2PFDA 4C7QA 4Q5VA 4P75A 3W1YC 2W2PP 1ACMB 3MAAA 2FB0A 2R2RA 3TP2A 4OI0A 3GIMA 2VKRA 1Q7YT 4NMLA 1T05B 4FS2A 4TU7A 3DHWC 3DGVA 1T8EA 4LQ9A 2OPRA 3PJXA 2DNKA 2GGPA 2LEAA 1PO6A 4CT8A 3OTOJ 3EZUA 2J8AA 3MDFA 4FF4A 4PZVA 2PEHA 1IKWA 5KT5A 4EWTA 2XULA 3IFEA 5BYQA 5G0RB 1VMBA 4IFVA 4CTAA 3BSOA 5D4LA 5M2PA 1SUQB 3BDPA 2KXHA 1R6YA 3D5MA 1WG4A 2DH8A 2CFXA 3DXSX 3JYTB 4XAKA 1O5JA 2XLKA 3LGMA 4M5JA 3EXYA 2NXNA 3G6ES 1UWAA 1DQ9A 1NO8A 4U7UK 5L8RC 4WYLA 1TK8A 2XO7A 3H2UB 1HWJA 2BJ9A 1IBKJ 4ZJLA 3PY8A 3QRQA 3GFZA 1N34F 2O66A 2E5LF 5FD1A 2R4FA 3EJMA 2EC0A 3OD2A 4C98A 3RBDA 3RGIA 4UOFA 1U1OA 3BO2A 2CVEA 3KDOA 1U24A 2IPOB 1EZZB 4ZVGA 4QW8A 4QJVA 1HKAA 3KLFA 4RUAA 1Q0NA 3TQ1A 5KFKA 3MM6B 1DQ8A 1RT5A 1ZH5A 3KK2A 4M5IA 2HFZA 4A47A 1HNZJ 4YB7A 4O3RA 5CYJA 4NCAA 3ENQA 1IBLF 1N36J 3HHLC 1HW9A 4J9VA 4JI1J 4KO0B 1FCAA 4X4RA 4A48A 3IC1A 4I1TA 2XI3A 3MPDA 1VCTA 3OJSA 1R8BA 3I0SA 1FWKA 1VRTA 5EX0A 1KTQA 2YPYA 4I2QA 4EYHB 1XR5A 1FRHA 5HJXA 3MMCA 1UZDA 1T95A 1M1GA 2UXDJ 1FJGF 2KI2A 4M5KA 3H5XA 1QUPA 4OI4A 3SFUA 4X4PA 1NDKA 2CQ3A 3AY0A 2ZH8A 1RQ0A 3MHYA 4L76A 3UD4P 1VIXA 2K2PA 2L08A 3MCSA 4CH7A 4Q2LA 3QJPA 2AU0A 1T94A 3LTOA 5L1JA 5AJ3J 4C8MA 1ZM3A 1EAYC 1N56A 2YWGA 1RWNB 1R89A 2DO4A 2ZITA 4KTQA 2G0JA 4DV1J 1RWPB 4NLOA 3TA0A 1UWBA 3DGPA 5CD4H 2XGPA 4RJVA 2IMWP 3KMQA 2BXJA 3MPWA 1U1NA 1FA0A 2ZWPA 2W9BB 1UETA 4KGKA 2DPJA 4JYAF 3IRWP 5J2NA 4CLTA 3MEGB 4ICLA 4ELUA 2QYCA 1YDLA 3M8PA 3CCVS 4DQQA 1XMOF 4LFCJ 2MKJA 4W4MA 4DV4J 3HM9A 2CPEA 3IO1A 3BYRA 4WP3A 2VDIA 1U1QA 3R5BA 3M4XA 1S72S 3ETMA 2GCFA 2V8GA 5AT1B 2KL8A 1B0PA 3MM8B 2R7OA 4G3IA 4RUBA 3HDSA 1NUEA 4ECXA 4GVBA 2C2OB 4IO9Q 2OEMA 1RWVB 2P8IA 4WZQA 3NGRA 4P2MA 3TWZA 3HK2A 2GJIA 3NGDA 3MD3A 2VG5B 2UUBJ 4UOGA 3DOLB 4DPOA 3Q8SB 1KLMB 2QLFB 2OI2A 4F0MA 5H9FK 2ZH9A 1N5YB 4DUYJ 2ADCA 1S99A 3HHLD 4X64J 2POKA 2CPIA 4NZ0A 3VZHA 4HKQA 2QLXA 4ECVA 2FDNA 3SCJE 1YZ7A 2VJVA 3PACA 3GONA 2CUYA 4A8QA 4B02A 2RUGA 2I6WA 2UXCJ 3KUGA 4F3MA 4RL1A 4ZA1A 2E7WA 1SQEA 3DMJA 4DOZA 5DLGA 5F8GA 1OPZA 3OXLA 2DVIA 1C1BA 2V4QA 2XQCA 3GIJA 2HAFA 4XPEA 2V2ZA 3QYYA 1NSPA 4HT5A 4C3KA 4YB1P 5E41A 2E5JA 2J8SA 1RTHB 5DG7A 4JI7F 3K89A 1NK5A 2GX8A 2MLZA 4AL6A 2DD8S 1QAIA 2CJXB 5B0DA 4DX7A 2E7VA 2CG4A 4QPTA 4X66J 2OD4A 2MLYA 1RJJA 4EUVA 1RZMA 4X65J 1S6PA 3QWUA 4K4SA 2ASJA 1EKSA 1V6HA 3VWSA 4S0MA 3GE9A 1KFDA 4ED8A 4Y2AA 4OI6A 2CJQA 3BQ0A 2CPFA 3L7PA 4BCAA 2RKIB 4C4WA 4I4BA 2P9EA 2UVRA 3CDEA 2J6SA 3O2IA 4J7CA 4C9DA 3ET6B 3KK1B 2DYAA 1N5SA 4WU3A 3QNWB 2DHHA 1FXRA 4MYUA 4N47A 3KXDA 2DJWA 4PYDA 3TW0A 3CJ0A 3MGJA 3IR6B 2KJWA 1TV6A 2HFNA 3IMQJ 1U26A 3EVOA 1NDLA 3HSZA 1SB6A 1HWKA 1FWLA 5C25A 4DF8A 3U1MA 2ZFHA 3DCAA 4NZ6A 4CLLA 4P7TA 4N77A 2W1BA 1S1XA 2B51A 2PMWA 3C46A 2OP5A 3EZOA 2HK2A 2H9ZA 4ELVA 3MI7X 2CYYA 4I2PA 3R5AA 2XYGB 1N8RT 2AEJA 3M8YA 2BX6A 2QV6A 2UVUA 3IR5B 1TU0B 1ROFA 4DWIA 3K5LA 3PNIA 3VGVA 3CNQP 1SC4B 2FLLA 1SC3B 4EO6A 4KGVB 1VHFA 3TRGA 2W4PA 4ZITA 2Q66A 4KPCA 4IFYA 1LW2B 1RE1B 2DGSA 1RWKB 4DL7A 3LALA 1S48A 1Y11A 4EMDA 2V8HA 2DXFA 1OY6A 2ZJPQ 5LOQA 1AUSL 4NLTA 2ZBRA 2RD5C 4DN9A 1FX2A 4PXEA 2ILYA 3SFGA 4OX6A 2BW7A 5C42B 3QWPA 2OPPB 4QIVA 3IBWA 2EK1A 2V50A 5C7PA 1TK0A 3MR2A 1XERA 2V34A 4NXMJ 1FJEB 2LEPA 1HNWJ 1ZTTA 1S6QB 1J5OB 1EQ0A 1BC6A 1WF1A 1AZSB 2BANB 4DR1J 3D6FB 3LAMA 1FJCA 5JVGQ 4ECWA 2RB7A 3GFXA 1TMJA 4CM0A 2OIHA 5CYQA 2FVRA 3K8WA 3VGTA 2FJDB 1X9WA 4DR3J 3KTQA 5LSRA 2N3LA 4IOAQ 4YUDA 2NSCA 5E3PA 3MR3A 5AJ3F 3IN5A 3T1AA 1RBAA 4UQTA 2XMVA 1K47A 1VISA 2GV1A 4I6AA 2M8HA 2RQ4A 4DV1F 1GMWA 2LQBA 1WEZA 1CQNA 1PAEX 1DRZA 1HNVB 4R0JA 1WDTA 4I67A 5GAGU 2V8PA 2R8IA 1S12A 4O0NA 2QL5B 1EETB 4DV4F 4QIGA 1UFKA 2OFHX 4NLVA 3FEXB 1LFWA 4KH0B 4RW4A 1TL1B 3I5CA 3OJUA 2Z8QA 4F4ZA 4LF5J 3GJQB 1U6ZA 4QYRA 1SC6A 3T9ZA 3EWGA 2VG7B 5I42A 2RHSB 1HQUA 3BBFA 4UOHA 1QVGR 3MMAA 3G82B 3DLEA 4LRBA 2BR0A 4JV5J 2HHTA 1XJWB 1FTRA 2XWXA 1FX4A 4JV0A 2HRUA 4Q44A 1SKSA 3LA0A 5KFGA 1HBMB 3FFIA 3I4PA 3TEGA 4F4XA 4NRTA 4ED1A 1UPMB 4IRKA 5E0OA 4OJ3A 4CO5A 2KM8B 4O3SA 2ZH7A 3CGIA 1U7LA 3OXGA 3R6LB 1WG5A 2LVWA 1KBRA 3AD8C 3GLJA 1NPPA 2IDLA 3JAMY 3M30B 4DPTA 5JMNA 2C2EA 2X7IA 2C1EB 1RT2A 3FBBA 3GWCA 4ZVHA 4JI2J 1L3UA 2F5GA 1HW8A 2HNZA 1GK8A 4DR4J 3CJ2A 2FVPA 5I3PA 3PO5A 4TY8A 3CCUS 3W5ZA 5J2MB 3MAHA 2E44A 1GAOA 1WOOA 6FDRA 1N54B 2BA9A 3HSGA 2WSEC 3TZYA 1FXDA 4ED7A 2C2MB 4RW9B 5DZ6A 2XYPB 3JB9k 1RTJB 2HEKA 4WP9A 3M2UA 3OHAA 1DARA 2HHWA 2XS2A 2O3DA 5HJYA 5CYMB 4WFYA 3HSJA 3A3OB 1JJCB 1ZTWA 1F1BB 1FRLA 1UJ4A 1OWXA 3T6JA 2G2ZA 4P72A 1C1CA 4JI5F 2NYIA 4X65F 2DITA 1N6QB 3D1QA 3BV8A 4PG4A 4ANCA 2RF2B 1I94F 2EG2A 3JSMA 5KFBA 2QGFB 4KGMA 2A1BA 1YSJA 4DPXA 1C0UB 1SQGA 5FDLB 2NQPA 2OLWA 2RNEA 4RW7A 2IJRA 4MAKA 2RHQB 3ZNUA 2R9LA 2VFUA 3GG1A 5KFEA 2K06A 3C16A 2BJEA 3CXCR 3LGNA 4WJBA 1XQIA 1AYEA 1B70B 1Y4ZB 3CJ3A 4WK3A 3SEOA 4BDPA 4JI6J 5EHHA 4Q45A 2RSQA 2YNHA 1HQ2A 4P6QA 2LP4A 4O4GB 4DS5A 1AUDA 5D0EA 4LSNA 3E01A 4JI8J 2BOAA 5I4MA 3AXKA 4YEAA 1JLBA 3H59A 3PKMA 3D3BJ 1U02A 2CZVC 2D1CA 1TVRB 3HO1A 3PW0A 1IBMF 4K4UA 4QBUA 3PHEA 2OJ3A 2HS3A 4ZLPA 1ZYQA 2QMXA 1K1SA 3ZZRA 4RNFA 2UU9F 3W2VB 2M4MA 3PFOA 4OYBA 4M5LA 4KYZA 1PKUA 4I7FB 2P9CA 3GMGA 3M2RA 3AODA 3IBCB 2LFVA 5KT6A 5C2CA 3B78A 3FRZA 2DGWA 4DX5A 3MECA 3QZ7A 4KV8A 3TVYA 1KR4A 3GFYA 1S97A 2M2BA 1NSQA 1IVZA 4D3HA 1R0CB 2HG4A 2RRAA 3BBCA 4JB8B 2WW8A 1RLCL 1NM2A 3T9NA 4NXMF 2F8EX 1WC0A 2C42A 2RDJA 1Z1ZA 3DU5A 1X0PA 3TJ9A 4R5PB 2M0GB 5IT4A 3G2XA 3LH2S 1VK8A 4DR1F 2QA1A 4F2SA 1MW7A 1T9VA 3D54A 1RABB 3ENAA 2NS1B 4P2SA 2JC1A 4I64A 4DUZJ 2MKIA 2FZGB 5KT7A 1SKUB 1KVJA 1VJQA 4CRJA 3DLJA 1VLYA 5IT0A 2VV5A 3ZZZA 2HZAA 4PCQA 1Z4UA 3AJDA 1PIEA 3EUNA 5HROB 3QPIA 4DCJB 4ECUA 4XIUA 4K2XA 2ASLA 1JK9B 4FPRA 5EN1A 3NGKA 1FTCA 1J5EJ 3GP9A 4NLXA 6FD1A 2XEXA 2V9KA 2QJ3A 2R2SA 3CJSA 2YQ0A 3V4MA 2M9KA 3EMTA 2CZ9A 4R0EA 3CVKA 3B82A 4GC6A 5B7WA 2AJFE 2EPIA 3VAJA 4YHHF 3N5BA 4RKUC 4IG0B 4NE9C 1DTTA 4IQMA 4MFBA 3QIPA 5HANA 5KFPA 3C8YA 2NXCA 1FERA 5D4OA 2ZH1A 2UUWA 1K0TA 5GAHU 3MAAB 2GVZA 3SMZA 3CC7S 4EGLA 3T5HA 3OHBA 1FJ7A 2AX0A 2OPRB 2GGPB 1XN9A 4JI3F 3PIOQ 3POTA 4EZ6A 5AE1A 1LEOA 1T9YA 1SBRA 1PYTA 1IKWB 3X1LB 2MJNA 3G8SA 5LL6d 4IFVB 4CTAB 3PIPQ 2B9WA 4UY8T 2G4BA 4ZPBA 2B5JA 3GJTB 3VAFA 1X4GA 5KFVA 4LFBJ 2IFXA 4LSLA 2JNJA 1JLFA 1RUSA 4PR6A 4J5OA 4EZ9A 3R5GA 4QWEA 1VRUA 2KN4A 2BM1A 1QJHA 1K0VA 2FHJD 1RTDA 3VAMA 1RHUB 2JJ4D 3VCDA 4ZMMA 1RBLA 1L3KA 4PWDA 5F0UA 2RMLA 4KGZB 1OO0B 1TMMA 2WB4A 1HBUA 3U1LA 4QR1A 4MIBA 4N8NA 5B08A 4ZOSA 1CLFA 1NEEA 4OHVA 1NZ8A 4ZVUB 3KLFB 2AYEA 2DRDA 1U2FA 1XTZA 1Z2LA 3QATA 3BGLA 4IDKA 1RT5B 1HNIA 1RWOB 4DPUA 4USHA 3KK2B 2YNIA 3BH7B 2E1PA 3EICA 1RWMB 4DR7J 3BR9A 2KHDA 4DEZA 2E9TA 1FK9A 2VPXB 4I0WA 2NZ4A 5E2QA 3ZTSA 2B3TB 5CA5A 1JLAB 2BACA 2ACMA 3KJVA 3M6XA 2AJ1A 1AXQA 1WD6A 2QA4G 2R42A 2W7AA 2ZH6A 1N0VC 1IJFB 3DNCA 3Q24A 4DR2F 5AXNA 2IAJA 4WFZA 2GQCA 3DRRA 3HCXA 3C3LA 2PGCA 3OFHA 3I0SB 4BC7A 4B3TF 1VRTB 5JVHQ 2W24A 3EM1A 1VDHA 5BYRA 4I2QB 2A3JA 2FTRA 3DLLQ 4UW2A 3DM2A 4ES1A 1GXTA 3MMCB 4V19X 2PFFB 2XY5A 1VI7A 2FUG9 1A6LA 4CLFA 3EYZA 5L1LA 5KFFA 4Y00A 2PA3A 3FCWA 2RRBA 4NCGA 4MKVA 1PGZA 4CNZA 3PYFA 2RQMA 2LLZA 2Z2ZA 3KFWX 3PXGa 1RSCA 2ZH2A 3O3LA 1W7WA 4OHXA 1YLXA 4QZVB 5F41A 3OVBA 3OR2A 2BRLA 2V69A 4FYDA 4O4RA 2HFSA 5ADZA 1VS3A 4GKJJ 2KT2A 4GRSA 3Q2TC 5JJBA 3DGPB 5GAGI 3V4IA 4DFMA 2RS8A 5DS7A 5J2NB 2DY1A 3TJ8A 1HBOA 2VODA 1TL5A 4ICLB 2XB2D 3ILJA 3J81j 2VONA 2ZH5A 3M8PB 2ASDA 1WC3A 4F04B 4KQZA 3G6VA 4L3KA 4MKAA 1VBYA 4YB6A 2ZZTA 1HBNA 3G9CA 2YQ3A 4DV5J 3VV2B 1M1KT 1YQHA 4K0KJ 5IOLA 3MCNA 1HWLA 3N28A 1XNRJ 1B7YB 3MM6A 2A6OA 1HWUA 4DQPA 4GVBB 2XMUA 4FYYB 2AYBA 4X4VA 2O1PA 3M6UA 4HTJA 2WW4A 3UNGC 2OMOA 3W66A 1NKBA 3PX0A 2GAHC 1WOPA 3H5UA 4NLUA 5ETOA 1N0UA 4Q8EA 2KO1A 2O01C 3H2VE 5KOXA 2Y1IA 7AT1B 1EIYB 3QT7A 5L38A 2QSFA 1T9TA 2RE1A 2XY6A 4KFBA 1HD0A 5EWEA 5B0CA 2IA6A 4JI0J 4Z37A 4A8OA 4F0HA 2AQ4A 2CPJA 2LQ9A 1ZPWX 3GCXP 2ZM6J 4IG3A 4DUZF 4DV0F 3GSIA 2HURA 2B43A 2ZWOA 3D67A 1GT8A 2JLGA 3FZ2A 2CIMA 5LJ3Y 2RQCA 4URGA 3RRGA 4OZNA 4C8LA 2XZWA 4UQGA 3GJSB 3J7ZT 2QA4S 2V8DA 2F8MA 3SSSA 4LF4J 3HHLA 3X3UA 2YKAA 3DMJB 1I51B 1FDNA 1BUXA 1IBCB 1WG1A 2AYGA 2EW9A 2YKNA 1J5EF 1U09A 1F9FA 1C1BB 4M5DA 1KQFB 2ZZMA 4L3NA 1WNEA 5DRKA 3WBZA 3TNVA 2KDOA 2VFTA 2NUHA 3RB6A 2IM3A 4DL0C 1URRA 3OLBA 1N33J 1TK5A 3G96A 4IUFA 1UVNA 3ISNC 4WIQA 5ETSA 3I55S 4WE1A 4ZVOB 1CS4A 1S6PB 1LK7A 4RNNA 2IVFB 3VZIA 3W3SA 4B08A 4FKYA 1ELOA 1RAGB 2E29A 2H3EB 3J81U 4WCEQ 2BQUA 1ZPVA 1MU2A 4DV2J 3UI3A 4ANEA 3OSNA 1Q1KA 2LMIA 5K9FA 2E5IA 3OFGA 3NCPA 2J7WA 2N7YA 4FF1A 2R7VA 3NL0A 2VKZG 1JNRB 5HO4A 3M9OB 3OR1B 2HGLA 5J2PA 1CVJA 1YRUA 1M0SA 1TFWA 2CWKA 2Q6BA 3BEGB 4HDGA 4LFBF 1TV6B 1U6BA 1TELA 3BM7A 2HFUA 2OFGX 3BKUA 2C2KB 2NZCA 1JQGA 1H7XA 2KB2A 5F0WA 2QLJB 4CLKA 4KHPF 2VB6A 5C25B 2XGQA 4TU8A 4F50A 4DLGA 3TZZA 5T14A 3VVUA 2F7VA 1CC8A 2YKMA 2N3OA 2U1AA 1S1XB 1JLEA 3MPVA 1X4EA 3CCLS 4E0DA 3L7UA 2H54B 3C6TA 5J1NA 4LBPA 4I2PB 1NSKL 3PV8A 2ZVIA 1RT3A 4HI2A 1WKLA 3VTIA 1NJYA 3GG0A 4ZVEA 1WI6A 2G0IA 5BJRA 1REVA 3R2CJ 2KFNA 4OJ1A 1MWQA 4DLEA 2YNFA 1RTIA 3ZFVA 2MZSA 2WB1D 4IFYB 4OYOA 2IIHA 2VH7A 1PG5B 2VD3A 3O1LA 3SZ2A 3T5KA 3CDUA 4UUXA 1VQ7S 1Y5IB 4Z2XA 4ILLA 2LQJA 1JKHA 2HYIB 2DNPA 1UVLA 1HI8A 4ZJOA 5DQHA 5GMKa 4NYZA 2IM2A 4DL3A 1UP1A 5HSPA 2CZ4A 2A18A 3CD6S 1PJ5A 4OYAA 5HMZA 2BE2A 1LXJA 2CQIA 1NPRA 5BXIA 4L73A 4RLEA 4LSZB 4C3LA 4LF2A 1HL6A 5IXUA 4DPWA 3QT8A 2DGXA 3A12A 3ISND 1JLCA 3KLEA 4HACA 1PBUA 4OJHA 5KFLA 1V3SA 3N5FA 5CYQB 2RILA 2AP6A 1UEKA 4AE5A 2RH3A 1X8DA 3OV7A 1IR1A 4TKTA 1B0TA 2FVQA 4H54A 1F5AA 4QWBA 2V6AA 1KRPA 3NNCA 2YBVA 3CJQA 4X4UA 3GSDA 2DGUA 1TFYA 3WQPA 4FS1A 1KC8T 2YX7A 1Q8IA 3CPWR 1JB0C 3EE3A 3W60A 4K59A 2CQ2A 2JDJA 3FMWA 3AFGA 4XK8C 1CSJA 3BH6B 2KXFA 3DOMA 4J91A 2DB1A 2IHR1 2WOMA 3PX6A 4HR2A 3C14A 2MSSA 2KKHA 2YNGA 1RP5A 3W2WA 4RW4B 3AA9A 5CABA 4DFPA 2G1DA 4K0KF 2D7SA 1BQXA 1HWIA 3JS9A 2ABYA 5I42B 1HQUB 4WXWA 3MMAB 1FEHA 1XNRF 4NLWA 2Z30B 3DLEB 1B3TA 2OSRA 1NK0A 1RAJA 3ITHA 1WSVA 4RW6A 1E6VA 3FFIB 3NLCA 3DLHA 5KFRA 3TX8A 1NJIT 3Q89A 3PZPA 3W5XA 3MTJA 4AXIA 4HH0A 4NXNF 1NH8A 2BW2A 4C6AA 4USVA 1VQMS 1TL3A 3AOBA 5GADU 1NK4A 2IBKA 3WDOA 3FC9A 4JI0F 2K7KA 3GYXB 1RT2B 3THVA 3QZ8A 1IKYA 2VBXA 1T02A 1S0NA 5HMXA 3GCWP 2XM3A 2HNZB 3RU0A 5D6GA 2HAIA 5E3RA 1CJKA 3CD7A 1HHTP 5A6WA 5BR8J 4TY8B 3HJFA 4QQBA 2PSZA 4OLPA 1URNA 3RBEA 2GHPA 5KFZA 4Y3CA 1NK7A 3R7BB 2BOPA 4TY9A 3CJKA 4N56A 5HVFA 4LVOP 3KHGA 4YDXA 1JXLA 2B9XA 3GFHA 2HHHJ 1RT4B 4V19J 2BJDA 2QFJA 4EEYA 1RCXB 4I68A 3M2UB 4KKOA 3BSNA 3O5TB 2BVZA 2WVEA 1N33F 3EGNA 3EGWB 1WTFA 3CCWA 2OGUA 3CJ8A 2AT1B 3LW5C 4ECTA 1GNKA 4DR6J 3KHRA 1C1CB 2DGTA 2LU1A 5GAEI 3A4TA 1YJ7A 3B4MA 3CEDA 4N5SA 2WRMA 3UR0A 3JSMB 5GMDA 4DV2F 2K7JA 3PRBA 4CNYA 5AE2A 4LMZA 1WORA 5DDQC 1SIWB 4IOCQ 4HYKA 2QLWA 4LRAA 1CJVA 3CMES 4RW7B 5LXRA 3MUMP 5LMNF 5DQIA 4QIFA 1QM9A 1RB0A 3MM7A 1QD1A 4ID8A 3C16B 1WC1A 3ETOA 1RYRA 4J9NA 1F5CA 4A8SA 2V4RA 3E8OA 1QE1A 3QGPA 2KH9A 4Y28C 4WTYA 5E5NA 2CQDA 1FKPA 3D2WA 4N76A 5A8KA 4F25A 1D9AA 3R5JB 2HQGA 2YNHB 2Y8YA 4CQ1A 3BQ1A 1YI2S 2GMHA 2L9DA 4OYPA 2BQ3A 3HJVA 4LSNB 1G6BA 1KWMA 4JP8A 3E01B 1Y5NB 2CQHA 1KS2A 2H4WB 1Q79A 5F8NA 3BGOP 1BQNA 5HQMA 3SCIE 2ZHOA 3CCMS 1JLBB 2DXDA 4KHRA 2AF6A 1YIJS 4AT1B 3RTVA 3JSBA 4WU2A 2JHEA 5ETKA 1N34J 2E5LJ 3TJAA 2QMUB 3SSRA 2OKQA 2QO3A 4DSKA 3UDCA 1RXOB 2D3OR 2KVIA 3WC0A 3L3CA 3IG1A 2XMWA 2XZDB 3M2RB 2ZKUA 3AXMA 5KFIA 2Q43A 1SJFA 2UVVA 4ZK7M 2MY8A 1F0XA 4MYTA 2HVZA 2R8HA 3MECB 1X4HA 2I8EA 2LCWA 3ZXWA 1KONA 3NBPA 2V63A 4KV8B 2A0FB 3THTA 3Q83A 1UPPA 2LQ8A 1CJUA 1NK6A 5DM7Q 3SCLE 2EFOA 2KYXA 3MURP 1RCOB 1LWCA 3N9UC 1AROP 5CYMA 4C8KA 2XY7A 3UDEA 3CC4S 4OYMA 3K2YA 1SJ4P 4JUZA 4ATNA 1YJNS 3SDEA 2APOA 5KFYA 4J9MA 2Z2YB 1LOUA 3IR7B 3BREA 2CJAA 4ZP7A 2KFYA 1VQ9S 1Q82T 2XSFA 2VOOA 3OW2R 4WBFA 1DHMA 2JEGA 1FJGJ 5U47A 1YVFA 1WC4A 1FRJA 2CPZA 1UW4A 4ENOA 4YP3A 5F8HA 2XMAA 3EX7B 2E1CA 2EWHA 2BM0A 5A2QY 1MNEA 4OZ3A 3ZZPA 4A8WA 4OI3A 4DSFA 3OTEA 2FHOB 4GVLA 4OZLA 1P6TA 1Y9OA 2ROEA 1F3VA 1XIQA 1QDUB 3RYLA 2VUGA 1DTTB 2C3YA 2DBBA 1BGXT 1PJ7A 3BYPA 4JYAJ 1OS5A 1YJ9S 4MFBB 3QIPB 4DX8H 1UZHA 3HLUA 4MKYA 2FLPA 4TN2A 2GVZB 4J9RA 3M8SA 2CADA 5T7LA 3RUBL 4RZRA 2L48A 2VU5A 3BGFA 1F6TA 4EFAC 3POTB 2CDQA 4LRDA 4F7VA 2HIQA 4OQJA 2B7CB 1S1VB 3ONQA 1S49A 3TR5A 3M1VA 3JTOA 1KVKA 4FYVB 3HHNB 2B5JB 2RU3A 1QTMA 4NLGA 2D69A 3DLKA 3P8BB 4LSLB 1C2PA 1S1UA 1JLFB 4YR0A 5DZ7A 2DHXA 3D66A 4JV2A 1WHWA 2YWHA 2FGOA 1VRUB 3HSDA 2JFKA 4W92B 1RTDB 2RDDA 3C15A 4TVAB 4R5PA 4YQWA 3WIVA 4PWDB 4H4OA 3W65A 4ER8A 2FC9A 2DR8A 1JJHA 5BR8F 1HBUB 3VGUA 4AFFA 4CLSA 5LMUF 2J0XA 5D78A 1FFSB 5LSOA 3UD3P 2FHJA 3EDRB 4F8RA 2H5JB 1S1TA 4IDKB 2Z2LA 1SXLA 3G87A 1HNIB 5HROA 3B54A 1JX4A 2YNIB 3R7SB 4MK7A 2HHHF 4HI1A 1Y00A 3NGTA 4QIEA 4WP8A 3CE8A 5D3GA 1TKXA 4R8UA 2HK3A 3LWLA 1FK9B 4J9OA 1ZM2A 3I56S 3JSRA 2QN6B 3ENVA 4K8RA 1X4DA 3DHXA 1TUWA 2DCLA 3KJVB 3MTKA 3OTCA 1WC5A 4DR6F 1YHQS 2NPIA 3T1HF 2JZ5A 2IAJB 2M8DB 3DRRB 3CWJA 3BR8A 3MMBA 4JI7J 3VF0B 3HD2A 3R1HA 1IWGA 2HSEB 3T19A 5DO2A 4N8OA 3DM2B 2BJ7A 2DKOB 4C0BA 2BZ2A 3AH6A 1PYOB 2GFFA 1R6VA 5CCLA 3S8SA 3QLHA 2N82B 4X4SA 3E51A 5T41A 1EP4A 1SH2A 2R8JA 3RR7A 1H98A 4B9MA 3A8KA 3OVSA 3MEKA 5KG0A 4O3OA 4NCGB 3IXQA 2ZBCA 4IRDA 3G6XA 2HQFA 2A2CA 2JL9A 1RAFB 2E1RA 1RBOB 2V9WA 3RR8A 2XZTB 2OEJA 2VICA 2OPSA 5HVHA 4N7TA 3OR2B 3QMQA 3ILLA 1H38A 3AAWB 3EVMA 5E3QA 3N6LA 4YMEA 3CCQS 1M5PC 4KIAA 4WKRA 3PX4A 4ZVRB 1T3NA 1TAUA 3KG1A 3E2EA 1S9GA 3V4IB 4P2FA 4CO3A 4P74A 2VC0A 5C24A 3KG4A 1IR0A 1SJ1A 1HBOB 3EXCX 2CPDA 4L74A 5L46A 3CCTA 4GKKF 2F4VJ 4DHVA 2V2VA 4PQUA 2DNRA 3K58A 3BPDA 1S9FA 3M9MB 5E3AA 1HBNB 2R7XA 5KG6A 3MM5A 2IBOA 3SIPB 4CH1A 3FKBA 4OL8A 2AWZA 3RRKA 3TYTA 1HNXJ 3PW2A 4J90A 2CRLA 5HATA 3MWBA 3M8RA 1Q5VA 1YRXA 2QFIA 3HHEA 4G6VB 4O3PA 4FXVA 3BGRA 4DS4A 4UF4A 2PD1A 3TVZA 5J2QA 2I38A 1S77D 4P71A 3I6PA 8ATCB 4LF9J 1NHVA 4UZBA 2JOQA 4G1QA 2OTJS 4JV1A 2QYGA 3CCES 3GV7B 2GO9A 1JLAA 3LO3A 2MHEA 5GADI 3TZXA 5DGAA 2DNMA 2AZ3A 1NNDA 5IQQA 3BPSP 1YITS 3N79A 1VQ5S 4ZIWA 5DG9A 4KFBB 1R8AA 1MSWD 1M5KC 2B4OA 3CSKA 2BMBA 5LM7E 1KQSR 2Z2MA 2UVWA 4IG3B 2F1FA 4ZN3A 2V2KA 4DU8A 3LPEA 3DLGA 1X4BA 4BBYA 3R8YA 3V6JA 1FDDA 3D6TB 2J7KA 3FEZA 5EWGA 4DMZA 5EDWA 3RRHA 5IFMA 3HHLB 1RT7A 5LXYA 1LFPA 2CJBA 2X51A 2WBRA 2MLXA 2YKNB 4ZLNA 1IJEB 4M5DB 5C2GA 4OIXA 5KT2A 3CC2S 1RAOA 2OPQA 1TKZA 3KG0A 4ZP6A 2IC3B 1FRMA 2YX1A 3AB2B 5E7OB 3J7Z5 3UD5A 3QGIA 2ZHAA 4CO1A 4NA2A 3QFHA 2DNGA 1G7CB 1S57A 2F65A 4OJGA 3CB4A 4CCHA 2GZOA 2AMCB 3MR7A 5HBMA 4WE1B 1K73T 1DQAA 2CNOB 3I32A 1CS4B 1N5QA 3PO4A 9RUBA 2H4YB 3EZ5A 2AJQA 2XBPA 2DNLA 3C66A 1MU2B 5IQ6A 2XNQA 1T03A 3JTNA 8AT1B 3IM8A 2AX1A 1B99A 1O51A 1HI0P 3EVWA 3A1YG 3J80U 2M88A 2W9CA 4PXCA 2I1RA 3M05A 2B8PA 2MQMA 5J2PB 2D3O1 1U1MA 2KVQE 2AJ4A 1Y3KA 1U47A 4YFUA 5IT9Y 2GIQA 2BYCA 4YY3F 2XHCA 2QG9B 2X1BA 2IYGA 3EDQB 1NJWA 4NLYA 5J1EA 4FKXA 2ZDOA 1IUJA 4F4AA 4F26A 1EJ7L 2GJ2A 2CNKB 5KAKA 4NI2A 3H4DA 2IVYA 3HPOA 4PWUA 1WACA 1JLGA 1M5HA 4RX6A 2YKMB 3VHQA 1O6XA 1Q81T 4ZLLA 1JLEB 4ECQA 5KFUA 1HMVA 1RU2A 3C6TB 4RU2A 3W63A 3GZ7A 4ZPAA 1PC5A 1TL4A 2LA6A 1K44A 1RT3B 3P49B 5HAOA 2R7QA 2UXBF 1UVJA 2OUGA 3PR5B 2Y0BB 3OFFA 1T9UA 2ZZNA 2J76E 4DCOB 2JEFA 1REVB 2GVDA 2EVZA 3BKTA 2DNYA 3QGGA 2JEIA 4UZCA 2YNFB 1RTIB 3GIRA 2F40A 4LJMA 3UE2A 2ZOGA 3IRXA 5A8WA 5DDRC 2C3UA 1HHSA 2ATCB 2FY8A 1HHQA 1H0HB 2JRSA 1YBAA 4PUOA 1KD1T 4HT7A 1JKHB 3HKZD 3RAMA 5B09A 3SCKE 4J37A 2KHCA 3IWLA 4XDDA 1UEVA 2P6SA 3D6HB 4RBUA 3Q22A 2BE2B 1FVSA 3LP2A 1KQKA 5AXKA 4WFNQ 1X9MA 4DUTA 5KFQA 4JI5J 1R0AA 3I31A 4WZMA 5A8RA 2BJ3A 2D9PA 2WSCC 3W8GA 4Z7YA 4DG1A 1I94J 3IP0A 5CZXA 1JLCB 3KLEB 4HACB 4DV7F 3S7RA 5H9FJ 3G8TA 4KJIA 2MZTA 3CCZA 2FJVA 3IS9A 1CULA 5K14A 1HR0F 4PEOA 3OR1A 1WF0A 2RVJA 1S1WA 4F36A 2HBRB 1MMNA 4FVCA 4C0OC 4OX9F 3HD1A 2CJKA 2FJAB 3QJLA 3W61A 3FVYA 1KFSA 2AD9A 3W9HA 2G0CA 1PILA 2H1YA 5F3TA 3T5JA 3K57A 3N6NA 3KLHA 3UFCX 4ZPTR 4HHJA 4RPFA 3QJJA 2KJVA 3F0NA 4M5HA 1HLWA 2HS4A 3DOMB 2F4VF 1GEHA 3JTPA 2WOMB 3J7YI 3GR1A 1RWXB 4ID5A 1D8YA 3C14B 2YNGB 3L95X 3W2WB 3MD1A 1Y3JA 2RT3A 4CIOA 1X5TA 1AFJA 3H20A 2VQFF 2F63A 2G13A 1HNXF 3I9ZA 1IBMJ 1D9FA 4ED0A 3VGSA 2UU9J 3RW7A 2IMOA 3I0RA 1YX2A 4OX8A 3TVKA 3NXZA 3NGSA 4LF9F 3VR1A 1DZ5A 3GR0A 4DF4A 1S5ZA 3ITHB 4AQYF 4QU6A 4RW6B 1ZA1B 1E6VB 2HNYA 1Q16B 2BQRA 4M95A 4EBDA 3TEHB 5EUHA 1RDRA 2GJFA 1KOHA 3US5A 3UCZP 3I5AA 2LXUA 2B56A 1CBKA 3SBMA 1TL3B 2JEJA 3ILIA 5KT3A 3OUYA 2YXLA 3DDKA 2M52A 2HQDA 5HQ8A 1KQGB 5K8NA 1IKYB 1V9OA 2K8GA 1TKTA 2P9GA 4QR0A 3DN9A 3OVAA 1CJKB 4URQU 4DSEA 5E33A 3SI8A 4JI4F 5CXTA 1FT8A 3TUJC 1P27B 5KG5A 3CJKB 1NMEB 2DCUB 3NGUA 5KFHA 3KUEA 4C8YA 3DOKA 3F73A 1P1LA 2HIYA 2VFSA 3FQKA 2HBYB 2ZEJA 4CLYA 1FFWB 4D3GA 5JUMA 4Z7CA 2W2QP 4DSLA 4B9VA 4GC7A 2HBZB 4B9SA 4DN0A 1GX6A 4OYXA 2AJ2A 2DR7A 3NAHA 4TYAA 4KKOB 1PYSB 2DXEA 4KE5A 2HNDA 5FLXY 2JLFA 5C5JA 1RLDA 3PRVA 2J5AA 1VC5A 2J9EA 1F3FA 2OELA 1UJ6A 3MEEA 2HVEA 1VGYA 5IWAF 2YY3A 3Q8UA 3N0VA 4RUCA 2DIVA 3N01A 4KY3A 1PBAA 4YHHJ 1G1XA 2XMTA 3MPUB 2HHVA 4DV3J 5DLFA 4RBVA 4ETXA 1KDNA 3QT5A 3BBBA 2HVDA 4C97A 3BGUA 4NOHA 2UV8A 5L39A 4PRFA 5F9NA 1CJVB 2W25A 2ZC4A 4NCBA 3ILOA 1T0TV 4ZJQA 3PYEA 2FYXA 3MM7B 1WKJA 3MEDA 4CO4A 2LYVA 2VA3A 3SQGA 3IBFB 4JI3J 4XO0A 1QE1B 4RU9A 1FKPB 2ROGA 4GMKA 4ED2A 4Y34A 3W64A 3RW6A 3U27A 1IKXA 3LUYA 3BO3A 2XNRA 1LKZA 5A8KB 4HLBA 4MK8A 2XO6A 5KG1A 3R97A 4USKA 3ICLA 1BMQB 3Q23A 1B0VA 4MT1A 3BS9A 1IKVA 1KEKA 1BQNB 2IA0A 2WVBA 2DEJA 1KNZA 3KK3A 3GV8B 4DL4A 2VL1A 3AA8A 5ETMA 3CIZA 4MIAA 3WC2A 4M5GA 4LVNP 4C2MA 4X62F 4PXDA 2ZOFA 3TAMA 1G2EA 4Q0BA 3IWNC 3ZTPA 3UO0A 3Q8QB 2VIHA 1RKIA 3IG1B 2JX2A 3GPAA 4HDHA 3L9ZA 4FPIA 2CJ9A 1FXLA 5KG3A 3DI6A 4OI2A 1AFIA 3GB0A 5AXMA 2EXUA 3M6WA 3MCOA 3NBPB 1F60B 2NXJA 1RT4A 2A6MA 1S76D 1U1LA 4GO5X 1CJUB 4A8MP 3NP5A 5KFMA 3UPFA 2G9OA 4QIWD 1LWCB 4DPYA 3D0IE 3LANA 2KT3A 2MKYA 4B3RF 1V3ZA 3AJ1A 3FBCA 3M9NB 3P96A 4DR5F 4DR2J 3H90A 2JC0A 1H2TZ 1OYEA 3SDEB 4KBIA 1RWUA 1I3OB 1ZS6A 4B3TJ 1E6YB 5ETVA 4DFKA 4ANDA 4YN3B 1FE4A 2ZKTA 4KRWA 5F3ZA 3FUYA 1WWHA 1NPKA 2GQQA 2ZJRQ 3BQ2A 3K17A 2DGOA 3VVTA 2QEXS 2FC8A 2XMMA 4NA3A 1OIAA 2CA9A 1EX8A 5EWFA 1Q5YA 5B0FA 1IM4A 4FZVA 4KSEB 1R31A 3P4UB 4P7VA 3AJ2A 4C0HA 3L09A 1HYSA 1A9NB 3EGZA 4NX9A 4K2JA 3UVJA 3UN3A 3B8HA 4TXSA 4O23A 5B0AA 4Y2IA 1FKOA 2DHGA 3IAS9 4ZN1A 1S0MA 1NRKA 2O5DA 3CCRS 5F8MA 3KKFA 3CMAS 4M5MA 4K4YA 1FFGB 4RNMA 1H73A 4DZDA 5I3QA 3H2LA 4ILMA 1PCAA 2B6AA 1ZM9A 1SKRA 1P8GA 4HH1A 3MOZA 4ZCMA 3HFZB 5T7LB 4B9NA 2AIRB 4WYWA 5KG2A 1VQOS 4OZ2A 2V94A 1O8BA 3EPIA 1NSAA 1U2CA 3UW1A 1NHKL 3TUZC 1HQEA 2J7UA 2VC1A 3MUTP 1RAAB 3B6BA 4ZVSB 3Q8YA 4ZKAA 1NK9A 2DY9A 4RNHA 3M1VB 1W2BR 2AYMA 1ZAVA 4K5SA 3BKFA 3KLIA 2FHMA 4MIWA 3UR3C 3DLKB 1VLOA 5KFJA 2HHSA 2HLUA 1S1UB 2BBEA 2K1RA 3OQ2A 4WFBQ 1XEZA 1TUGB 3UN2A 2WHOA 2YKQA 2CQ1A 3C15B 2VQEF 2KRRA 4CLWA 4LRFA 2PI5A 4H4OB 2CPHA 3A3PB 1NK8A 2AGOA 3HX9A 5B0GA 4Y2CA 2HRTA 2LDIA 1SH3A 9ATCB 4DV0J 3NY0A 4IKAA 1LWFA 4U7CA 2EEYA 3SV3A 4AL5A 4HTIA 3TX0A 1QTNB 2PMZD 1S1TB 1VQLS 2R8GA 1U48A 2EFPA 3M7VA 3H0PA 5EX3A 1X0FA 1VQKS 1CJTA 4BHQA 3V5RA 3PYGA 4HVZA 5D3GB 1TKXB 4R8UB 1F2HA 2D74B 1SJRA 1VC6A 1LNQA 2JLEA 4QWDA 4O44A 3K7RA 2UUAF 1VRQC 1SCJB 4U67Q 2HHXA 4F3QA 3AB4B 4ZPVR 3MMBB 2E9ZA 3CF5Q 3E3XA 4B3OA 4WF9Q 5HLFA 3ZTQA 1HFEL 1C4CA 2W2MP 2DRAA 4DV3F 2DT9A 5HN0A 1X4CA 3FCHA 2NLWA 4U6PA 2PMHA 1S59A 3NCRA 3HHDA 2EG1A 1FRIA 1WSRA 3QLHB 3T6BA 2I5JA 1U6FA 1T9XA 5K8PA 1EP4B 1X4FA 1LQ9A 3R5DA 2FQQB 2R7TA 4PXBA 1EHWA 1IM6A 1XNQJ 2JVRA 3CO0P 2QA2A 4H4KC 2KT5A 2FJEB 3P45B 2QTWA 1S1VA 3LF0A 2OPSB 3I87A 1BHNA 1I6JA 3WZ0A 3CJRA 2PT0A 4E98A 4CI0B 1DTQA 4DJBA 3PRDA 2WONA 1F2GA 4BLGA 2OHDA 5MAOA 1RACB 1S9GB 3H98A 2BUNA 1DFDA 5C24B 5CCMA 4ZCIA 3NCQA 4NYOA 4KHPJ 1JJ4A 2XHWA 1R8HA 2V68A 4QW9A 2W7PA 3KNAA 3D1OA 5J1PA 2KG0A 4PQUB 4Q7AA 2ZOMA 1WC6A 3FSIA 4U8VA 5KG4A 2ZE2A 3Q8RB 2DRBA 4BC9A 1VQYA 4CWBA 2ZBPA 1XWLA 1SJ3P 3O6QA 4LF7J 3MM5B 1BWVA 1RK8A 2UUCF 1WHYA 3NS6A 2IYIA 3GJRB 3Q8VA 1RHQB 3BGRB 5DDOC 1G4CA 2GO8A 2KTQA 1ICEB 5J2QB 2P6TA 1X60A 4MJKA 2B4VA 2FJBB 2XWYA 2LEBA 1MMDA 1XMQF 1T11A 2HZCA 4G1QB 2VZ9A 4A8XA 4ZPWR 1TR0A 2GIRA 2PA8D 4MH8A 5FJ4A 3C19A 4M1KA 5IT9U 2MB0B 4I56A 2GIFA 2G2OA 1U8SA 2I0XA 5IM0A 4USWA 3D7SB 3Q8PB 2Q1LA 4K4ZA 1GXUA 2DNOA 3V2UC 3IA0A 2HGMA 2K3IA 3MCMA 3RB3A 4QR2A 4B3MF 3DLGB 3ELHA 3FMBA 1LWEA 2LU2A 5K8MA 4PWWA 2IRYA 1SVDA 2YWKA 2HBQB 4TYBA 3LAKA 1M5SA 3L7OA 5RUBA 5A0YA 3FNNA 5IS2A 1RT7B 3F41A 3OSPA 2HQIA 2N4DA 2CQCA 5DETA 1N52B 2C22A 1P1TA 4C8OA 1RTZA 2K3KA 3LQVA 2OPQB 1REGX 1TKZB 2V0NA 4KR0B 5L1IA 4WK1A 1PSDA 2XI2A 4ECZA 2VOPA 4IO1A 2J6UA 2V2QA 4F0KA 2W8KA 3BN7A 4YS2A 3TI0A 1HD1A 1UAWA 3GIKA 2X3GA 1O0PA 3W62A 3ZZOA 4X4TA 4A8FA 1NJZA 5HBMB 2VA2A 2DISA 3ZO7A 2EI5A 1A0OB 1QLNA 2Y1JA 1WI8A 2ZD1A 2ILZA 4LF6J 1T3OA 1LV5A 4CP5A 2QE5A 1RT1A 3OT9A 1WKKA 2Y3YA 2VDHA 1T03B 3K5OA 2YH0A 4P73A 2C3OA 2YWWA 1Q78A 3TAPA 2HW3A 4DZ6A 2BABA 4ZCLA 2DHSA 2JWNA 4ZP9A 2W9CB 3OTOF 1R8CA 4MK9A 2C3PA 2G1HA 3UNYA 3DFEA 4A8KA 2HWTA 3KUHA 4OHWA 4KGXB 2MKKA 3NS7B 3NWRA 5J1EB 1RISA 1MLAA 4O3NA 4DBQA 2DNQA 3K59A 4FP9A 4I6YA 1EB0A 5HI7A 4LBIA 3VQSA 2YX4A 3UWTA 1WEXA 4NI2B 1ULRA 4JOUA 4NXNJ 3G8QA 1VYAA 2KFZA 2LXFA 2WAQD 5KTQA 1NKCA 4X84A 1JLGB 2F8HA 1GFWB 2FJXA 4PQAA 2MKHA 1IBKF 3LP0A 2B8QA 2OTLS 2BJ1A 2ZUAA 2Q3PA 3TARA 1KLNA 1HMVB 1MN7A 1BWEA 2MPUA 4MKBA 4ZPCA 4DDFA 3WX8A 2Y9HA 4TLRA 4F4YA 3BJYA 2QMWA 1GQEA 2GVDB 5CZVA 1JXEA 4NPOA 5ETPA 4Q8FA 1FESA 2GNKA 4IR9A 3NG8A 1L3VA 3K5MA 1T9WA 3IRXB 5A8WB 3PW5A 4OYIA 1J27A 5F8IA 1HNZF 4AXJA 3R7NB 3IWXA 1NKEA 3P6YC 1C0TA 4PUOB 1N36F 2LKZA 5DGBA 4OI1A 4B9UA 3OFEA 4L72B 5DQGA 2A2DA 2IC3A 4JI1F 2COLA 3GYGA 4CLUA 5SUHA 3KJFB 1WHVA 1FNXH 3UN5A 3D28A 2NPFA 5HQLA 3PVXA 1SPBP 3R6GB 1MWZA 3D0GE 3LP2B 3I4HX 3HVTA 3J81Y 5L9NA 1AW0A 2XG8A 3ZNJ1 3HVRA 1R0AB 2WTFA 1BY9A 1S10A 5A8RB 3G4SS 4L6V3 2UXDF 3HF5A 4DG1B 3PM9A 1SV5A 2KG1A 2XSJA 5MLCV 1XNQF 3AQPA 1T7PA 1Q8KA 2HPUA 2Z57B 1EKRA 2P2CB 1X9SA 3NNAA 2R3VA 4P10A 2W8LA 1Q7LB 3IS9B 4KPYA 3SV4A 2ALZA 5BYSA 1CULB 5K14B 1RGVA 3M2VA 3HP6A 2R7UA 2D41A 5LMNJ 2B9YA 2HQCA 2RIJA 1S1WB 1FO1A 1X5PA 1A7GE 3UCGA 4ZVPB 1NB7A 1UA0A 4PPZA 4FF3A 4J9LA 4QYZJ 3H8YA 2AJ0A 3T3FA 3DKDA 2I9SA 4QCLA 3THPA 2BKOA 3KLHB 2DH9A 2CPYA 4ZHRA 5D4PA 1HI1A 1TL7A 5AXLA 2Z0GA 3QGHA 1U4BA 3R5CA 4OHYA 1PAUB 1KVIA 5FLXU 5D4NA 4ID5B 2EFQA 1H72C 2XLJA 2KM8C 1WHXA 4LFCF 4J9UE 4LF7F 4RWWA 3JQMA 1IQTA 1QAXA 4NEZA 3GQCA 1OYDA 2CAJA 3MF5A 3CO9A 1XR7A 2NXUA 3AQOA 2CJYB 1NHUA 3PJ9A 4EO8A 1YRTA 3I0RB 5H9EJ 4ZVQB 1JLQA 3UDLA 3A13A 2OMLA 4CLZA 2VPZB 1Y7PA 4A46A 2B4UA 2HNYB 4JBCA 1KOOA 2VHGA 1S7HA 1U0SA 2FPHX 2HQ3A 4ZDNA 2WVDA 2ZDPA 4USMA 1FHTA 1ZETA 4P52A 4WXOA 2J9DA 2UUBF 3HVWA 3IAM9 3WX4A 3DC2A 2MGZA 1D09B 2H5IB 4ED3A 1FE0A 2DNZA 5KFAA 3KLGA 3OUYB 3OL6A 2IJNA 2Z4PA 4DUYF 2J0QD 1HA1A 1R0BG 4X64F 5M2UA 2VJUA 1TKTB 1R8PA 1CQMA 3KJNB 2CG8A 1FD8A 3JAMU 3C6UA 2EKYA 4DL2A 3GU0A 1VBZA 5EGYA 2ROPA 1HPZA 5THWA 1MROA 2UXCF 2L3MA 2E7XA 5A6PA 1SL0A 1NB2A 4HHHA 4ZS6A 3DOKB 1HARA 5HK4A 2W4DA 4IH7A 2ACYA 1UVMA 5F9LA 1NH7A 4ED4A 2W01A 4RW8A 3NNHA 2YTCA 3RAXA 4ERDA 3R1LA 2JVOA 4OFZA 1PJ6A 3HXMA 2ZJQQ 4K4VA 4DI6A 4Q43A 3MAQA 4YOEA 2HNDB 1V3RA 1IWAA 2J9CA 2MMYA 2EFNA 4EU0A 1VC0A 1YJUA 3D6MB 1Q4RA 3MEEB 5M2RA 1YJVA 2ZNYA 4X66F 3MM9A 3V81A 3ZTOA 1U2RA 5KFTA 4LF6F 3EPGA 3SXLA 3FGVA 1LXNA 3TUIC 4LRCA 3OLAA 2C2DA 3AD7C 2HVIA 1VBXA 2ZH4A 3GIIA 4F3OA 3CIMA 5KG7A 4I6WA 2NXEA 5GAHI 5B0BA 2DR9A 4Q2MA 5KFNA 3ADAC 3CD5A 2PE8A 5DJBA 1Q86T 2NCKL 3MEDB 3DRPA 4FXWA 3VAHA 4B3SJ 3SQGB 4Y6IA 5D15A 1UCNA 1YTYA 2BDPA 3BF4A 3PG9A 1X7VA 4CYUA 2CNNB 4IYQA 2UP1A 1VQ4S 4ZVTB 1IKXB 3V6KA 3RZAA 1R7IA 2CKWA 1UTAA 5HP1A 1GMUA 2EBEA 2H65B 2KRBA 3PTWA 3KOAA 4ECYA 1NU4A 2F4FA 1UJ5A 1IKVB 1QSSA 1U1KA 3QAEA 1OY8A 3RG6A 4UUWA 3CULA 1QVFR 3RAQA 1XBWA 2V4JA 3KK3B 4U7UD 1NCLA 2HKEA 4LIRA 1SL2A 2N7CA 3FBEA 1SIZA 2MSTA 3TAMB 2MZ1A 4Q0BB 2BJ8A 1YBTA 1MG7A 4FDFA 1RA6A 3QAUA 4PG7A 4C11A 4Y2KA 5LMUJ 2W9AA 2YH1A 3DI6B 4M94A 2PEBA
chains in the Genus database with same CATH topology
5ETMA 5ETTA 3IP0A 1F9HA 1CBKA 3HSDA 1EQMA 4M5IA 4CRJA 2F65A 1TMJA 3HCXA 4M5GA 5ETNA 4AD6A 1EX8A 1G4CA 2QX0A 3ILIA 3UDEA 4CWBA 5ETKA 3HSGA 4PZVA 5ETOA 1EQ0A 4M5NA 1RTZA 3UDVA 1HQ2A 1TMMA 1RB0A 1RU1A 1DY3A 3KUHA 5ETPA 3HSZA 4F7VA 1HKAA 4CYUA 3ILJA 4M5JA 3KUEA 3HD1A 5ETRA 3UD5A 5ETVA 1Q0NA 4M5LA 4M5MA 4M5HA 3HSJA 3MCMA 3MCOA 5ETSA 3MCNA 5ETQA 2CG8A 3ILLA 3HT0A 1RU2A 4M5KA 3KUGA 3ILOA 1KBRA 2F63A 3HD2A 3QBCA 1IM6A 5ETLA 4CYUB 2BMBA 1RAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETM A;  5ETT A;  3IP0 A;  1F9H A;  1CBK A;  3HSD A;  1EQM A;  4M5I A;  4CRJ A;  2F65 A;  1TMJ A;  3HCX A;  4M5G A;  5ETN A;  4AD6 A;  1EX8 A;  1G4C A;  2QX0 A;  3ILI A;  3UDE A;  4CWB A;  5ETK A;  3HSG A;  4PZV A;  5ETO A;  1EQ0 A;  4M5N A;  1RTZ A;  3UDV A;  1HQ2 A;  1TMM A;  1RB0 A;  1RU1 A;  1DY3 A;  3KUH A;  5ETP A;  3HSZ A;  4F7V A;  1HKA A;  4CYU A;  3ILJ A;  4M5J A;  3KUE A;  3HD1 A;  5ETR A;  3UD5 A;  5ETV A;  1Q0N A;  4M5L A;  4M5M A;  4M5H A;  3HSJ A;  3MCM A;  3MCO A;  5ETS A;  3MCN A;  5ETQ A;  2CG8 A;  3ILL A;  3HT0 A;  1RU2 A;  4M5K A;  3KUG A;  3ILO A;  1KBR A;  2F63 A;  3HD2 A;  3QBC A;  1IM6 A;  5ETL A;  4CYU B;  2BMB A;  1RAO A; 
#chains in the Genus database with same CATH topology
 2EKN A;  3NMR A;  4A4J A;  2HGN A;  4F67 A;  1UFL A;  4G1P A;  1S7I A;  2HWH A;  3KJQ B;  4PAA A;  5I3U A;  3ISZ A;  1LK5 A;  2HFV A;  2BKP A;  2OH2 A;  3R27 A;  5IC6 B;  1VIO A;  3K8V A;  2ERR A;  1ZZN A;  1QAJ A;  2J9D E;  4QOT A;  4NA1 A;  3T1H J;  4I69 A;  3NOC A;  1HNW F;  4DQS A;  1GTE A;  4PG5 A;  3S6E A;  3OL8 A;  1UVI A;  1F9E B;  1B7F A;  2DHA A;  3T41 A;  3WIU A;  2Q79 A;  2UZA A;  3UQS A;  1ZZF A;  2ZVS A;  2XCA A;  2ZH3 A;  2CQP A;  2XMJ A;  1BQM A;  3M8Q A;  4DR3 F;  3MZI A;  1H3D A;  3SYZ A;  3ZZ0 A;  4LFA J;  4OYW A;  1LWX A;  5KFX A;  3M8Z A;  1X5O A;  4U96 A;  1NZA A;  4DSJ A;  1HYS B;  2H5E A;  1SL1 A;  3V6D A;  3QO9 A;  2CQ4 A;  2SXL A;  1LW0 A;  4C8Z A;  3UVJ B;  3DYA A;  1XR6 A;  1H74 A;  3HI9 A;  1X4A A;  2EFG A;  1FKO B;  4YR3 A;  1W26 A;  4H4M A;  1RT6 A;  1M5O C;  3D9B A;  2JSX A;  1TAQ A;  4RR5 A;  3M6V A;  1FD2 A;  1RAH B;  2X3D A;  1VBK A;  1D1U A;  3J7A N;  1R27 B;  2M70 A;  1M5V C;  2HZV A;  2B6A B;  5F8L A;  1YBU A;  2RS2 A;  2HVH A;  3QFW A;  4GKK J;  4LF5 F;  3PEJ A;  4RUH A;  1NDP A;  3BSC A;  4HEA 9;  4J9K A;  2Z58 B;  5G4D A;  2F9J A;  4N41 A;  3MMJ A;  1HQE B;  4JV5 F;  3PW4 A;  1U0H A;  2DNH A;  4EYI B;  1R43 A;  1VK3 A;  3T1Y J;  4DL6 A;  5JXS A;  1WJ9 A;  2QIF A;  4CT9 A;  2M3D A;  3H5Y A;  4DQR A;  2CXE A;  4XDC A;  4Y0F A;  3M32 A;  2R2T A;  1RHM B;  1YJT A;  2PO4 A;  1U49 A;  3KHL A;  1M90 T;  2QL7 B;  3D3C J;  3CT9 A;  3KLI B;  4FBT A;  1VQ6 S;  4BS2 A;  1N32 J;  1J2V A;  5D77 A;  1RAI B;  3ENW A;  2RUS A;  3U1N A;  2K1R B;  3VAK A;  3HZG A;  2RJZ A;  3OBI A;  4B9T A;  4M63 A;  4M5N A;  1S9E A;  2YKP A;  4JI2 F;  2DO0 A;  5HMW A;  1SKW A;  3PCO B;  1Y0H A;  2R7S A;  1E6Y A;  2VBW A;  4KC5 A;  4DR4 F;  1VHI A;  2PC6 A;  1VQN S;  2JFD A;  1LWF B;  3Q0A A;  1NDC A;  3W7B A;  5IZH A;  3QSI A;  3LP1 A;  1FDB A;  1CJT B;  1IR2 A;  4WKY A;  3LPY A;  3VAI A;  1KN6 A;  2Y1R I;  4LR8 A;  4OYZ A;  4K50 A;  4F2R A;  4C48 A;  3N4W A;  4FF2 A;  3TQE A;  1ZAW A;  1FRX A;  4IH6 A;  4O44 B;  3HFV A;  2IVM A;  3MPY A;  3I5B A;  3UDV A;  4EBE A;  4NEY A;  2ASY A;  1Z2Z A;  3NRB A;  4B3O B;  5HLF B;  1H7W A;  5IC4 B;  3D68 A;  1U25 A;  4OHZ A;  2HMI A;  3ZTR A;  1K9M T;  1DLO A;  2QC3 A;  2XCP A;  5GAE U;  4ED6 A;  6AT1 B;  3JQJ A;  3Q86 A;  3ZZU A;  4E2F B;  1W2I A;  3DRS A;  3O44 A;  1N88 A;  3C2P A;  1JWW A;  3G86 A;  2PII A;  2CDR B;  2Y1L B;  4P2X A;  2F3J A;  2VG6 A;  2I5J B;  2QX0 A;  3UCU P;  3H4B A;  3CCS S;  3DRX A;  3G6Y A;  4ED5 A;  5FII A;  3JXO A;  4B3S F;  1T05 A;  1N4L A;  2GC8 A;  2YVS A;  3FDS A;  2V5H G;  1H2V Z;  3HVA A;  4AL7 A;  2AKW B;  4TU9 A;  3WHI A;  1YZ6 A;  2NSB A;  2MQQ A;  4DQI A;  2B7B B;  4JI6 F;  4DFJ A;  2JH3 A;  1VOM A;  4C8N A;  3GV5 B;  3NS5 A;  1YK9 A;  4WFA Q;  3R3T A;  4YY3 J;  5G0R A;  3K5P A;  1DTQ B;  1WTB A;  1SUQ A;  5SZT A;  2WON B;  4MMO A;  1D9D A;  2QZ8 A;  4WPA A;  4DCP B;  2FIU A;  3JYT A;  1UWB B;  1IN0 A;  4BWM A;  2ZUG A;  3IGV A;  4JI8 F;  1UL3 A;  3RBX A;  1CC7 A;  4NLP A;  2U2F A;  3PYD A;  3PFE A;  1MML A;  1S6U A;  4X2B A;  2HLT A;  3GYN A;  5KT4 A;  3DU6 A;  3ZC4 A;  2LA4 A;  2L9W A;  2C2Z B;  1YKW A;  2ZE2 B;  2AW0 A;  4DX6 A;  2YWE A;  3CDA A;  1K8A T;  3CJT A;  3AT1 B;  3QBC A;  3VAL A;  3KHH A;  2WSF C;  4OV1 A;  2UXB J;  3HZE A;  1SC1 B;  4NAS A;  4X4O A;  3OTB A;  3W8P A;  5LJ5 Y;  2FJW A;  3CTR A;  2MQL A;  2H51 B;  3H40 A;  1TP7 A;  1RHJ B;  3JSY A;  4NYP A;  1C4A A;  2DTJ A;  3LOU A;  3PHT A;  2DGV A;  3U7J A;  3H42 A;  3CJ5 A;  3HT3 A;  4UTG A;  2VPY B;  5K5M A;  4PPD A;  2MY7 A;  2CQB A;  4LUB A;  4KO0 A;  5IM0 B;  4K4T A;  3M8W A;  2HWI A;  2MJU A;  2KZZ A;  2XLI A;  5L1K A;  1BD6 A;  1VQS A;  4B17 A;  2CVI A;  3TAN A;  2Y8W A;  2QT7 A;  2V67 A;  3FEY B;  4LR9 A;  4WWS A;  1GXL A;  4DSI A;  2VAS A;  1LWE B;  1B4S A;  4LT6 A;  2WVC A;  1U45 A;  3QID A;  5A0Y B;  3IGN A;  4LFA F;  4DV7 J;  4QYZ K;  3TA1 A;  3PJW A;  2B9E A;  2HFO A;  4DXL A;  2GW8 A;  3KLV A;  4EK2 A;  5ETL A;  1HR0 J;  5LSL A;  1M1H A;  3A8I A;  4ECR A;  2DH7 A;  4IH5 A;  3D4J A;  3SQO P;  3DDI A;  4OX9 J;  4Y2M A;  4OX7 A;  2VBY A;  3MFI A;  1S0V A;  2RAQ A;  4FVM A;  2HHU A;  2XYH B;  1ZA2 B;  2X1G A;  4G65 A;  2FZC B;  2PN6 A;  2W9B A;  2ZD1 B;  1F9H A;  1RT1 B;  3MEG A;  2DEI A;  2EK6 A;  2R7W A;  4H4K A;  5H9E K;  3NWG A;  2VFR A;  2MQO A;  3ZZT A;  1TZ0 A;  3BZQ A;  5D0G A;  2QL9 B;  4ALZ A;  2VQF J;  4BWJ A;  2NYH A;  4KAI A;  3MM8 A;  3T1Y F;  4Y65 A;  1RU1 A;  2VBZ A;  1L3T A;  1N5V A;  3F44 A;  2D3Z A;  5E3C A;  4UT4 A;  4KT0 C;  1V5V A;  2V8V A;  4P9S A;  1UKU A;  3OXF A;  1CG2 A;  5CHC B;  1UVK A;  4F4K A;  4AQY J;  4PG8 A;  2GAG C;  2F9D A;  1N32 F;  4LF8 J;  1Q53 A;  1QSL A;  5D0H A;  1ZAX A;  1N48 A;  1AT1 B;  1OY9 A;  4CO0 A;  2MHN A;  1NJX A;  3AOC A;  3HT0 A;  4FXD A;  2VG5 A;  5IV3 A;  4NL5 A;  3DOL A;  1FKA F;  1D0E A;  1KLM A;  2XTJ P;  2FVC A;  3LP0 B;  1APS A;  4HL9 A;  1N5Y A;  1L3S A;  2ALY B;  5KOW A;  2KXN B;  1DBD A;  3PDN A;  1F5B A;  4ELT A;  4UST A;  2UUT A;  3FJ2 A;  1K1Q A;  4IRC A;  1TKD A;  4F4W A;  2BE7 D;  4L75 A;  2MQP A;  2R7R A;  3DDN A;  5K8O A;  3J7A 1;  3BO4 A;  1OJ4 A;  4OMF G;  4OZ1 A;  2ATL A;  4AD6 A;  4U8Y A;  4JI4 J;  1S79 A;  4ZPD A;  4DR7 F;  3JQK A;  1WDD A;  1C0T B;  4XPC A;  2YWF A;  1RAD B;  1RHK B;  4NLS A;  4U95 A;  1D3W A;  3RBZ A;  1KSP A;  1S4E A;  4O0I A;  2DK2 A;  1RTH A;  1FF2 A;  1IQZ A;  1S4F A;  2E5G A;  1FI4 A;  1RA7 A;  1VR6 A;  3HVT B;  1SJQ A;  2MKS A;  5IWA J;  4DV6 J;  3I96 A;  4ETZ A;  3ZZY A;  3A8J A;  1UMJ A;  2MQN A;  5H1S V;  1SV5 B;  2MXY A;  2XSJ B;  3FSX A;  3J80 Y;  3I82 A;  4WFX A;  4DU7 A;  3RJM B;  3M2V B;  4UOC A;  2RKI A;  1WUU A;  2CQG A;  2GHW A;  3U02 A;  1BE4 A;  1QY7 A;  1KHV A;  1X5S A;  3ET6 A;  2NRE A;  1L5U A;  2L9N A;  1UEU A;  3KK1 A;  1FNM A;  3HMJ G;  5ETT A;  1WOS A;  2E1M C;  1JJ2 R;  1U8W A;  2MKC A;  7FD1 A;  3MR6 A;  4GKJ F;  4YB5 A;  3H7H B;  4ZHR B;  4X4Q A;  2Z56 B;  1TL7 B;  1KKH A;  4NLD A;  4IR1 A;  3ULH A;  2FHK A;  4QWA A;  2R8K A;  2FD2 A;  1ITP A;  2GHV C;  2A10 A;  2G2Y A;  3QQC D;  4FYW B;  4G1I A;  3OPK A;  4XTT A;  1D8Z A;  3S01 A;  5ITH A;  4TNO A;  3P5T L;  4LRE A;  4DV5 F;  2OEK A;  4NMX A;  4X62 J;  2GA7 A;  5CH7 B;  1CEZ A;  2E9R X;  1WF2 A;  2VF3 A;  4TQR A;  3DRY A;  1PC4 A;  5L9X A;  4A8Y A;  3W9J A;  4RBT A;  1RWW B;  2CPX A;  4NLR A;  4URS A;  1JLQ B;  4RO0 A;  2RQK A;  4V1A k;  3QSY B;  2OAU A;  1DY3 A;  2DR6 A;  1LW2 A;  2ZC3 A;  1OQ6 A;  1OPI A;  2MZJ A;  2XS5 A;  2ZHB A;  2FY1 A;  3O8W A;  3KNG A;  1NAQ A;  1RKJ A;  1CPZ A;  2MGZ B;  4YR2 A;  1VQP S;  3CDW A;  4RNO A;  2MZQ A;  2FVS A;  3TO8 A;  4LR7 A;  3KLG B;  3PR4 A;  2C28 A;  1MWY A;  5AE3 A;  5KFS A;  1FVQ A;  5DG8 A;  2Q6C A;  2OD6 A;  4B3R J;  3PKY A;  1UFW A;  3G71 S;  5C42 A;  4FN5 A;  4K4W A;  2OPP A;  3W5Y A;  2WBM A;  4DR5 J;  1FWP A;  1I5O B;  4WII A;  2XMK A;  2ZM6 F;  1HIY A;  3C6U B;  3TA2 A;  5HL7 Q;  1S6Q A;  1EAR A;  1J5O A;  2RDI A;  4K7Q A;  1GH8 A;  1XMB A;  1AZS A;  2BAN A;  4KH1 B;  2IY5 B;  2RU9 A;  1HPZ B;  2MZR A;  1MRO B;  4LF4 F;  2XS7 A;  4J9S A;  1KHW A;  3TUP A;  1OQ3 A;  1GMW D;  5F8J A;  1RYS A;  3TAQ A;  4RW8 B;  4CZC A;  4USJ C;  1OMS A;  4USI A;  3HKW A;  2FLO A;  3NKY A;  3FRY A;  3N6M A;  4RWX A;  2WK4 A;  1QAY A;  4QPX A;  2BEF A;  4DL5 A;  2M7S A;  2YQ1 A;  3L4B C;  1MN9 A;  3H25 A;  3FQL A;  2ZBQ A;  3F56 A;  1XK8 A;  1VJW A;  2PI4 A;  4ZLJ A;  3FBF A;  2C2R A;  5B0E A;  3T5L A;  1GTH A;  3MM9 B;  3V81 B;  1HNV A;  1KP6 A;  1I1G A;  3NEK A;  2J0W A;  3NOG A;  1BXN A;  3H5S A;  1GMV A;  1Y5L B;  3S1T A;  1Q8B A;  1W25 A;  4USU A;  4B9L A;  3P3D A;  2MEW A;  4ZIV A;  1EET A;  3OL9 A;  2ADB A;  1B64 A;  1P9Q C;  3VAG A;  8RUC A;  3PEH A;  1RAE B;  1TL1 A;  2EC2 A;  5D8H B;  3FSY A;  1FEE A;  4ZCK A;  2DIU A;  3DRP B;  3D0H E;  2VG7 A;  1X31 C;  3FCV A;  3PW7 A;  4F02 A;  3G82 A;  2J0S D;  2CWX A;  4K4X A;  4CYU B;  2UV8 G;  2AGP A;  4LF8 F;  2HHQ A;  3K5N A;  2IJF A;  5KFO A;  1KTV A;  2WVF A;  2EBG A;  4LQ3 A;  1HBM A;  5HP1 B;  2VPW B;  1U1P A;  3LWM A;  4NZ7 A;  4MTP A;  5ETN A;  4OLO A;  2MTL A;  3B4D A;  1TTH B;  4LBH A;  1YWX A;  3IM9 A;  4CLP A;  1ZBT A;  4ZP8 A;  2MYF A;  3M30 A;  1RI7 A;  2V4J B;  3AOA A;  3EGV A;  4X4N A;  4W98 A;  4FNH A;  1YG0 A;  2WZ1 A;  3QRR A;  2VQE J;  3AD9 C;  2IRU A;  1FRK A;  4WTO B;  1UW9 A;  1FDA A;  4TLQ A;  2DPI A;  3A3N B;  4FNI A;  4AYB D;  4CH0 S;  1Y10 A;  1QUV A;  2D9O A;  4C11 B;  2IDE A;  4IQX A;  3P5B P;  2P5V A;  1SH0 A;  2BKN A;  2I2Y A;  1OSC A;  3DLB A;  1P9Y A;  2N4C A;  5D0R A;  4PG6 A;  5J2M A;  3TOQ A;  1SQF A;  5IV4 A;  3BN4 A;  4CO2 A;  4FBU A;  4QWC A;  4RW9 A;  4R25 A;  3CW2 C;  1VQ8 S;  1RTJ A;  5I3U B;  1WEL A;  4M8L A;  1YGY A;  3HUL A;  1IBL J;  1NBE B;  3LGH A;  1H2U X;  1YJR A;  3I9V 9;  2UUA J;  2DNN A;  4U9R A;  1U1R A;  2C3M A;  2KYZ A;  4K5R A;  3MXH P;  5A76 A;  5KFC A;  1S0O A;  4DV6 F;  4FYX B;  2MQ8 A;  2YPZ A;  4AUK A;  2E5H A;  1GX5 A;  2LEC A;  1N6Q A;  4NRU A;  1AA1 B;  4ZVF A;  2GQ2 A;  3FK4 A;  4NWB A;  3CUN A;  2ZBI A;  4KB7 A;  2RF2 A;  1BLU A;  1DUR A;  3RB4 A;  2QRR A;  2LDY A;  2FLN A;  2B0G A;  3Q2S C;  4ITS A;  5ETR A;  4OZ5 A;  1C0U A;  4QU7 A;  2HRY A;  3FZB A;  3KYL A;  1N5T A;  2AEF A;  4ILR A;  1BQM B;  3M8Q B;  5FDL A;  3CD0 A;  1NLK L;  3CDB A;  2FZK B;  2GMJ A;  4LIW A;  2BRK A;  2DGQ A;  2RRN A;  5HVG A;  3W9I A;  2IM0 A;  5CQG A;  3OTD A;  3BSA A;  2W4C A;  2FGC A;  3V6D B;  3QO9 B;  5GME A;  2GS8 A;  1LW0 B;  2PDA A;  3DYA B;  2OO4 A;  1G3O A;  2LXI A;  2L41 A;  4OV6 A;  4H4M B;  1R3N A;  2AHO B;  1RT6 B;  5GVQ A;  1AB8 A;  5ETQ A;  3CJ4 A;  3NAI A;  1JNZ B;  5A2Q U;  2OSQ A;  4OZJ A;  3KDN A;  4O4G A;  2AEM A;  2QSW A;  2WCX A;  3TZW A;  2MDA A;  5DDP C;  3DXB A;  3J7Y U;  4W90 B;  4KHM A;  2ZNZ A;  3AHP A;  3VQT A;  3CCJ S;  2O67 A;  1TVR A;  1XMO J;  2EFV A;  4GO7 X;  2KZM A;  2NR0 A;  1QSY A;  2X1F A;  2IM1 A;  1U0H B;  1VFJ A;  2B4P A;  3W2V A;  2UUC J;  1XC9 A;  1EQM A;  2DR5 A;  4EBC A;  3R2D J;  4I7F A;  4CM2 A;  2AGQ A;  3QRP A;  1H6K X;  1S6O A;  3V6H A;  3R9L A;  3M32 B;  3KWM A;  5LT5 A;  2Y0S D;  2X1A A;  3HHK A;  1OSD A;  3MUV P;  1XMQ J;  1Q95 G;  1WEY A;  5KFW A;  3SSQ A;  3MFH A;  2D3U A;  3GIL A;  1JXV A;  2BV3 A;  1TUV A;  4PAB A;  1JIH A;  3CMQ A;  4NLQ A;  1S9E B;  3QT6 A;  2GML A;  4CDI A;  1RHR B;  2W7O A;  2E1A A;  2CNL B;  4LF1 A;  3BB5 A;  2IRX A;  2KU7 A;  5HMY A;  3K0J A;  4UY8 5;  2HHP A;  2M5Y A;  2E66 A;  5KFD A;  2W2N P;  4PYA A;  5CAA A;  2H48 B;  1DJ0 A;  4ES3 A;  3MR5 A;  3D1H A;  4B3M J;  1IXK A;  4ES2 A;  1TQL A;  1YJW S;  2QLB B;  2AV5 A;  1ZOT A;  1V5I B;  3MOJ B;  3LP1 B;  1UA1 A;  4E8U A;  3OL7 A;  4IOB A;  1FNO A;  2J6T A;  2HS0 A;  2C2N A;  1SI9 A;  5CD4 A;  1ZM4 A;  2R2U A;  4HHU A;  3GTY X;  2VFV A;  4ECS A;  1NXI A;  5DM6 Q;  5K20 B;  4O3Q A;  2NUU G;  3RB0 A;  7FDR A;  3BDE A;  2HMI B;  3A8E A;  2LQ5 A;  1JMT A;  1DLO B;  4YDD B;  3HFK A;  1Q8L A;  4C3M A;  2AZ1 A;  4TQS A;  2YKO A;  2CQ0 A;  1DAX A;  4IG0 A;  3KMS A;  2W2O P;  4OZ0 A;  4EI2 A;  4PKD B;  3DRS B;  2XC9 A;  2BE9 B;  4J9Q A;  2VG6 B;  3NMA A;  4J9P A;  2PFD A;  4C7Q A;  4Q5V A;  4P75 A;  3W1Y C;  2W2P P;  1ACM B;  3MAA A;  2FB0 A;  2R2R A;  3TP2 A;  4OI0 A;  3GIM A;  2VKR A;  1Q7Y T;  4NML A;  1T05 B;  4FS2 A;  4TU7 A;  3DHW C;  3DGV A;  1T8E A;  4LQ9 A;  2OPR A;  3PJX A;  2DNK A;  2GGP A;  2LEA A;  1PO6 A;  4CT8 A;  3OTO J;  3EZU A;  2J8A A;  3MDF A;  4FF4 A;  4PZV A;  2PEH A;  1IKW A;  5KT5 A;  4EWT A;  2XUL A;  3IFE A;  5BYQ A;  5G0R B;  1VMB A;  4IFV A;  4CTA A;  3BSO A;  5D4L A;  5M2P A;  1SUQ B;  3BDP A;  2KXH A;  1R6Y A;  3D5M A;  1WG4 A;  2DH8 A;  2CFX A;  3DXS X;  3JYT B;  4XAK A;  1O5J A;  2XLK A;  3LGM A;  4M5J A;  3EXY A;  2NXN A;  3G6E S;  1UWA A;  1DQ9 A;  1NO8 A;  4U7U K;  5L8R C;  4WYL A;  1TK8 A;  2XO7 A;  3H2U B;  1HWJ A;  2BJ9 A;  1IBK J;  4ZJL A;  3PY8 A;  3QRQ A;  3GFZ A;  1N34 F;  2O66 A;  2E5L F;  5FD1 A;  2R4F A;  3EJM A;  2EC0 A;  3OD2 A;  4C98 A;  3RBD A;  3RGI A;  4UOF A;  1U1O A;  3BO2 A;  2CVE A;  3KDO A;  1U24 A;  2IPO B;  1EZZ B;  4ZVG A;  4QW8 A;  4QJV A;  1HKA A;  3KLF A;  4RUA A;  1Q0N A;  3TQ1 A;  5KFK A;  3MM6 B;  1DQ8 A;  1RT5 A;  1ZH5 A;  3KK2 A;  4M5I A;  2HFZ A;  4A47 A;  1HNZ J;  4YB7 A;  4O3R A;  5CYJ A;  4NCA A;  3ENQ A;  1IBL F;  1N36 J;  3HHL C;  1HW9 A;  4J9V A;  4JI1 J;  4KO0 B;  1FCA A;  4X4R A;  4A48 A;  3IC1 A;  4I1T A;  2XI3 A;  3MPD A;  1VCT A;  3OJS A;  1R8B A;  3I0S A;  1FWK A;  1VRT A;  5EX0 A;  1KTQ A;  2YPY A;  4I2Q A;  4EYH B;  1XR5 A;  1FRH A;  5HJX A;  3MMC A;  1UZD A;  1T95 A;  1M1G A;  2UXD J;  1FJG F;  2KI2 A;  4M5K A;  3H5X A;  1QUP A;  4OI4 A;  3SFU A;  4X4P A;  1NDK A;  2CQ3 A;  3AY0 A;  2ZH8 A;  1RQ0 A;  3MHY A;  4L76 A;  3UD4 P;  1VIX A;  2K2P A;  2L08 A;  3MCS A;  4CH7 A;  4Q2L A;  3QJP A;  2AU0 A;  1T94 A;  3LTO A;  5L1J A;  5AJ3 J;  4C8M A;  1ZM3 A;  1EAY C;  1N56 A;  2YWG A;  1RWN B;  1R89 A;  2DO4 A;  2ZIT A;  4KTQ A;  2G0J A;  4DV1 J;  1RWP B;  4NLO A;  3TA0 A;  1UWB A;  3DGP A;  5CD4 H;  2XGP A;  4RJV A;  2IMW P;  3KMQ A;  2BXJ A;  3MPW A;  1U1N A;  1FA0 A;  2ZWP A;  2W9B B;  1UET A;  4KGK A;  2DPJ A;  4JYA F;  3IRW P;  5J2N A;  4CLT A;  3MEG B;  4ICL A;  4ELU A;  2QYC A;  1YDL A;  3M8P A;  3CCV S;  4DQQ A;  1XMO F;  4LFC J;  2MKJ A;  4W4M A;  4DV4 J;  3HM9 A;  2CPE A;  3IO1 A;  3BYR A;  4WP3 A;  2VDI A;  1U1Q A;  3R5B A;  3M4X A;  1S72 S;  3ETM A;  2GCF A;  2V8G A;  5AT1 B;  2KL8 A;  1B0P A;  3MM8 B;  2R7O A;  4G3I A;  4RUB A;  3HDS A;  1NUE A;  4ECX A;  4GVB A;  2C2O B;  4IO9 Q;  2OEM A;  1RWV B;  2P8I A;  4WZQ A;  3NGR A;  4P2M A;  3TWZ A;  3HK2 A;  2GJI A;  3NGD A;  3MD3 A;  2VG5 B;  2UUB J;  4UOG A;  3DOL B;  4DPO A;  3Q8S B;  1KLM B;  2QLF B;  2OI2 A;  4F0M A;  5H9F K;  2ZH9 A;  1N5Y B;  4DUY J;  2ADC A;  1S99 A;  3HHL D;  4X64 J;  2POK A;  2CPI A;  4NZ0 A;  3VZH A;  4HKQ A;  2QLX A;  4ECV A;  2FDN A;  3SCJ E;  1YZ7 A;  2VJV A;  3PAC A;  3GON A;  2CUY A;  4A8Q A;  4B02 A;  2RUG A;  2I6W A;  2UXC J;  3KUG A;  4F3M A;  4RL1 A;  4ZA1 A;  2E7W A;  1SQE A;  3DMJ A;  4DOZ A;  5DLG A;  5F8G A;  1OPZ A;  3OXL A;  2DVI A;  1C1B A;  2V4Q A;  2XQC A;  3GIJ A;  2HAF A;  4XPE A;  2V2Z A;  3QYY A;  1NSP A;  4HT5 A;  4C3K A;  4YB1 P;  5E41 A;  2E5J A;  2J8S A;  1RTH B;  5DG7 A;  4JI7 F;  3K89 A;  1NK5 A;  2GX8 A;  2MLZ A;  4AL6 A;  2DD8 S;  1QAI A;  2CJX B;  5B0D A;  4DX7 A;  2E7V A;  2CG4 A;  4QPT A;  4X66 J;  2OD4 A;  2MLY A;  1RJJ A;  4EUV A;  1RZM A;  4X65 J;  1S6P A;  3QWU A;  4K4S A;  2ASJ A;  1EKS A;  1V6H A;  3VWS A;  4S0M A;  3GE9 A;  1KFD A;  4ED8 A;  4Y2A A;  4OI6 A;  2CJQ A;  3BQ0 A;  2CPF A;  3L7P A;  4BCA A;  2RKI B;  4C4W A;  4I4B A;  2P9E A;  2UVR A;  3CDE A;  2J6S A;  3O2I A;  4J7C A;  4C9D A;  3ET6 B;  3KK1 B;  2DYA A;  1N5S A;  4WU3 A;  3QNW B;  2DHH A;  1FXR A;  4MYU A;  4N47 A;  3KXD A;  2DJW A;  4PYD A;  3TW0 A;  3CJ0 A;  3MGJ A;  3IR6 B;  2KJW A;  1TV6 A;  2HFN A;  3IMQ J;  1U26 A;  3EVO A;  1NDL A;  3HSZ A;  1SB6 A;  1HWK A;  1FWL A;  5C25 A;  4DF8 A;  3U1M A;  2ZFH A;  3DCA A;  4NZ6 A;  4CLL A;  4P7T A;  4N77 A;  2W1B A;  1S1X A;  2B51 A;  2PMW A;  3C46 A;  2OP5 A;  3EZO A;  2HK2 A;  2H9Z A;  4ELV A;  3MI7 X;  2CYY A;  4I2P A;  3R5A A;  2XYG B;  1N8R T;  2AEJ A;  3M8Y A;  2BX6 A;  2QV6 A;  2UVU A;  3IR5 B;  1TU0 B;  1ROF A;  4DWI A;  3K5L A;  3PNI A;  3VGV A;  3CNQ P;  1SC4 B;  2FLL A;  1SC3 B;  4EO6 A;  4KGV B;  1VHF A;  3TRG A;  2W4P A;  4ZIT A;  2Q66 A;  4KPC A;  4IFY A;  1LW2 B;  1RE1 B;  2DGS A;  1RWK B;  4DL7 A;  3LAL A;  1S48 A;  1Y11 A;  4EMD A;  2V8H A;  2DXF A;  1OY6 A;  2ZJP Q;  5LOQ A;  1AUS L;  4NLT A;  2ZBR A;  2RD5 C;  4DN9 A;  1FX2 A;  4PXE A;  2ILY A;  3SFG A;  4OX6 A;  2BW7 A;  5C42 B;  3QWP A;  2OPP B;  4QIV A;  3IBW A;  2EK1 A;  2V50 A;  5C7P A;  1TK0 A;  3MR2 A;  1XER A;  2V34 A;  4NXM J;  1FJE B;  2LEP A;  1HNW J;  1ZTT A;  1S6Q B;  1J5O B;  1EQ0 A;  1BC6 A;  1WF1 A;  1AZS B;  2BAN B;  4DR1 J;  3D6F B;  3LAM A;  1FJC A;  5JVG Q;  4ECW A;  2RB7 A;  3GFX A;  1TMJ A;  4CM0 A;  2OIH A;  5CYQ A;  2FVR A;  3K8W A;  3VGT A;  2FJD B;  1X9W A;  4DR3 J;  3KTQ A;  5LSR A;  2N3L A;  4IOA Q;  4YUD A;  2NSC A;  5E3P A;  3MR3 A;  5AJ3 F;  3IN5 A;  3T1A A;  1RBA A;  4UQT A;  2XMV A;  1K47 A;  1VIS A;  2GV1 A;  4I6A A;  2M8H A;  2RQ4 A;  4DV1 F;  1GMW A;  2LQB A;  1WEZ A;  1CQN A;  1PAE X;  1DRZ A;  1HNV B;  4R0J A;  1WDT A;  4I67 A;  5GAG U;  2V8P A;  2R8I A;  1S12 A;  4O0N A;  2QL5 B;  1EET B;  4DV4 F;  4QIG A;  1UFK A;  2OFH X;  4NLV A;  3FEX B;  1LFW A;  4KH0 B;  4RW4 A;  1TL1 B;  3I5C A;  3OJU A;  2Z8Q A;  4F4Z A;  4LF5 J;  3GJQ B;  1U6Z A;  4QYR A;  1SC6 A;  3T9Z A;  3EWG A;  2VG7 B;  5I42 A;  2RHS B;  1HQU A;  3BBF A;  4UOH A;  1QVG R;  3MMA A;  3G82 B;  3DLE A;  4LRB A;  2BR0 A;  4JV5 J;  2HHT A;  1XJW B;  1FTR A;  2XWX A;  1FX4 A;  4JV0 A;  2HRU A;  4Q44 A;  1SKS A;  3LA0 A;  5KFG A;  1HBM B;  3FFI A;  3I4P A;  3TEG A;  4F4X A;  4NRT A;  4ED1 A;  1UPM B;  4IRK A;  5E0O A;  4OJ3 A;  4CO5 A;  2KM8 B;  4O3S A;  2ZH7 A;  3CGI A;  1U7L A;  3OXG A;  3R6L B;  1WG5 A;  2LVW A;  1KBR A;  3AD8 C;  3GLJ A;  1NPP A;  2IDL A;  3JAM Y;  3M30 B;  4DPT A;  5JMN A;  2C2E A;  2X7I A;  2C1E B;  1RT2 A;  3FBB A;  3GWC A;  4ZVH A;  4JI2 J;  1L3U A;  2F5G A;  1HW8 A;  2HNZ A;  1GK8 A;  4DR4 J;  3CJ2 A;  2FVP A;  5I3P A;  3PO5 A;  4TY8 A;  3CCU S;  3W5Z A;  5J2M B;  3MAH A;  2E44 A;  1GAO A;  1WOO A;  6FDR A;  1N54 B;  2BA9 A;  3HSG A;  2WSE C;  3TZY A;  1FXD A;  4ED7 A;  2C2M B;  4RW9 B;  5DZ6 A;  2XYP B;  3JB9 k;  1RTJ B;  2HEK A;  4WP9 A;  3M2U A;  3OHA A;  1DAR A;  2HHW A;  2XS2 A;  2O3D A;  5HJY A;  5CYM B;  4WFY A;  3HSJ A;  3A3O B;  1JJC B;  1ZTW A;  1F1B B;  1FRL A;  1UJ4 A;  1OWX A;  3T6J A;  2G2Z A;  4P72 A;  1C1C A;  4JI5 F;  2NYI A;  4X65 F;  2DIT A;  1N6Q B;  3D1Q A;  3BV8 A;  4PG4 A;  4ANC A;  2RF2 B;  1I94 F;  2EG2 A;  3JSM A;  5KFB A;  2QGF B;  4KGM A;  2A1B A;  1YSJ A;  4DPX A;  1C0U B;  1SQG A;  5FDL B;  2NQP A;  2OLW A;  2RNE A;  4RW7 A;  2IJR A;  4MAK A;  2RHQ B;  3ZNU A;  2R9L A;  2VFU A;  3GG1 A;  5KFE A;  2K06 A;  3C16 A;  2BJE A;  3CXC R;  3LGN A;  4WJB A;  1XQI A;  1AYE A;  1B70 B;  1Y4Z B;  3CJ3 A;  4WK3 A;  3SEO A;  4BDP A;  4JI6 J;  5EHH A;  4Q45 A;  2RSQ A;  2YNH A;  1HQ2 A;  4P6Q A;  2LP4 A;  4O4G B;  4DS5 A;  1AUD A;  5D0E A;  4LSN A;  3E01 A;  4JI8 J;  2BOA A;  5I4M A;  3AXK A;  4YEA A;  1JLB A;  3H59 A;  3PKM A;  3D3B J;  1U02 A;  2CZV C;  2D1C A;  1TVR B;  3HO1 A;  3PW0 A;  1IBM F;  4K4U A;  4QBU A;  3PHE A;  2OJ3 A;  2HS3 A;  4ZLP A;  1ZYQ A;  2QMX A;  1K1S A;  3ZZR A;  4RNF A;  2UU9 F;  3W2V B;  2M4M A;  3PFO A;  4OYB A;  4M5L A;  4KYZ A;  1PKU A;  4I7F B;  2P9C A;  3GMG A;  3M2R A;  3AOD A;  3IBC B;  2LFV A;  5KT6 A;  5C2C A;  3B78 A;  3FRZ A;  2DGW A;  4DX5 A;  3MEC A;  3QZ7 A;  4KV8 A;  3TVY A;  1KR4 A;  3GFY A;  1S97 A;  2M2B A;  1NSQ A;  1IVZ A;  4D3H A;  1R0C B;  2HG4 A;  2RRA A;  3BBC A;  4JB8 B;  2WW8 A;  1RLC L;  1NM2 A;  3T9N A;  4NXM F;  2F8E X;  1WC0 A;  2C42 A;  2RDJ A;  1Z1Z A;  3DU5 A;  1X0P A;  3TJ9 A;  4R5P B;  2M0G B;  5IT4 A;  3G2X A;  3LH2 S;  1VK8 A;  4DR1 F;  2QA1 A;  4F2S A;  1MW7 A;  1T9V A;  3D54 A;  1RAB B;  3ENA A;  2NS1 B;  4P2S A;  2JC1 A;  4I64 A;  4DUZ J;  2MKI A;  2FZG B;  5KT7 A;  1SKU B;  1KVJ A;  1VJQ A;  4CRJ A;  3DLJ A;  1VLY A;  5IT0 A;  2VV5 A;  3ZZZ A;  2HZA A;  4PCQ A;  1Z4U A;  3AJD A;  1PIE A;  3EUN A;  5HRO B;  3QPI A;  4DCJ B;  4ECU A;  4XIU A;  4K2X A;  2ASL A;  1JK9 B;  4FPR A;  5EN1 A;  3NGK A;  1FTC A;  1J5E J;  3GP9 A;  4NLX A;  6FD1 A;  2XEX A;  2V9K A;  2QJ3 A;  2R2S A;  3CJS A;  2YQ0 A;  3V4M A;  2M9K A;  3EMT A;  2CZ9 A;  4R0E A;  3CVK A;  3B82 A;  4GC6 A;  5B7W A;  2AJF E;  2EPI A;  3VAJ A;  4YHH F;  3N5B A;  4RKU C;  4IG0 B;  4NE9 C;  1DTT A;  4IQM A;  4MFB A;  3QIP A;  5HAN A;  5KFP A;  3C8Y A;  2NXC A;  1FER A;  5D4O A;  2ZH1 A;  2UUW A;  1K0T A;  5GAH U;  3MAA B;  2GVZ A;  3SMZ A;  3CC7 S;  4EGL A;  3T5H A;  3OHB A;  1FJ7 A;  2AX0 A;  2OPR B;  2GGP B;  1XN9 A;  4JI3 F;  3PIO Q;  3POT A;  4EZ6 A;  5AE1 A;  1LEO A;  1T9Y A;  1SBR A;  1PYT A;  1IKW B;  3X1L B;  2MJN A;  3G8S A;  5LL6 d;  4IFV B;  4CTA B;  3PIP Q;  2B9W A;  4UY8 T;  2G4B A;  4ZPB A;  2B5J A;  3GJT B;  3VAF A;  1X4G A;  5KFV A;  4LFB J;  2IFX A;  4LSL A;  2JNJ A;  1JLF A;  1RUS A;  4PR6 A;  4J5O A;  4EZ9 A;  3R5G A;  4QWE A;  1VRU A;  2KN4 A;  2BM1 A;  1QJH A;  1K0V A;  2FHJ D;  1RTD A;  3VAM A;  1RHU B;  2JJ4 D;  3VCD A;  4ZMM A;  1RBL A;  1L3K A;  4PWD A;  5F0U A;  2RML A;  4KGZ B;  1OO0 B;  1TMM A;  2WB4 A;  1HBU A;  3U1L A;  4QR1 A;  4MIB A;  4N8N A;  5B08 A;  4ZOS A;  1CLF A;  1NEE A;  4OHV A;  1NZ8 A;  4ZVU B;  3KLF B;  2AYE A;  2DRD A;  1U2F A;  1XTZ A;  1Z2L A;  3QAT A;  3BGL A;  4IDK A;  1RT5 B;  1HNI A;  1RWO B;  4DPU A;  4USH A;  3KK2 B;  2YNI A;  3BH7 B;  2E1P A;  3EIC A;  1RWM B;  4DR7 J;  3BR9 A;  2KHD A;  4DEZ A;  2E9T A;  1FK9 A;  2VPX B;  4I0W A;  2NZ4 A;  5E2Q A;  3ZTS A;  2B3T B;  5CA5 A;  1JLA B;  2BAC A;  2ACM A;  3KJV A;  3M6X A;  2AJ1 A;  1AXQ A;  1WD6 A;  2QA4 G;  2R42 A;  2W7A A;  2ZH6 A;  1N0V C;  1IJF B;  3DNC A;  3Q24 A;  4DR2 F;  5AXN A;  2IAJ A;  4WFZ A;  2GQC A;  3DRR A;  3HCX A;  3C3L A;  2PGC A;  3OFH A;  3I0S B;  4BC7 A;  4B3T F;  1VRT B;  5JVH Q;  2W24 A;  3EM1 A;  1VDH A;  5BYR A;  4I2Q B;  2A3J A;  2FTR A;  3DLL Q;  4UW2 A;  3DM2 A;  4ES1 A;  1GXT A;  3MMC B;  4V19 X;  2PFF B;  2XY5 A;  1VI7 A;  2FUG 9;  1A6L A;  4CLF A;  3EYZ A;  5L1L A;  5KFF A;  4Y00 A;  2PA3 A;  3FCW A;  2RRB A;  4NCG A;  4MKV A;  1PGZ A;  4CNZ A;  3PYF A;  2RQM A;  2LLZ A;  2Z2Z A;  3KFW X;  3PXG a;  1RSC A;  2ZH2 A;  3O3L A;  1W7W A;  4OHX A;  1YLX A;  4QZV B;  5F41 A;  3OVB A;  3OR2 A;  2BRL A;  2V69 A;  4FYD A;  4O4R A;  2HFS A;  5ADZ A;  1VS3 A;  4GKJ J;  2KT2 A;  4GRS A;  3Q2T C;  5JJB A;  3DGP B;  5GAG I;  3V4I A;  4DFM A;  2RS8 A;  5DS7 A;  5J2N B;  2DY1 A;  3TJ8 A;  1HBO A;  2VOD A;  1TL5 A;  4ICL B;  2XB2 D;  3ILJ A;  3J81 j;  2VON A;  2ZH5 A;  3M8P B;  2ASD A;  1WC3 A;  4F04 B;  4KQZ A;  3G6V A;  4L3K A;  4MKA A;  1VBY A;  4YB6 A;  2ZZT A;  1HBN A;  3G9C A;  2YQ3 A;  4DV5 J;  3VV2 B;  1M1K T;  1YQH A;  4K0K J;  5IOL A;  3MCN A;  1HWL A;  3N28 A;  1XNR J;  1B7Y B;  3MM6 A;  2A6O A;  1HWU A;  4DQP A;  4GVB B;  2XMU A;  4FYY B;  2AYB A;  4X4V A;  2O1P A;  3M6U A;  4HTJ A;  2WW4 A;  3UNG C;  2OMO A;  3W66 A;  1NKB A;  3PX0 A;  2GAH C;  1WOP A;  3H5U A;  4NLU A;  5ETO A;  1N0U A;  4Q8E A;  2KO1 A;  2O01 C;  3H2V E;  5KOX A;  2Y1I A;  7AT1 B;  1EIY B;  3QT7 A;  5L38 A;  2QSF A;  1T9T A;  2RE1 A;  2XY6 A;  4KFB A;  1HD0 A;  5EWE A;  5B0C A;  2IA6 A;  4JI0 J;  4Z37 A;  4A8O A;  4F0H A;  2AQ4 A;  2CPJ A;  2LQ9 A;  1ZPW X;  3GCX P;  2ZM6 J;  4IG3 A;  4DUZ F;  4DV0 F;  3GSI A;  2HUR A;  2B43 A;  2ZWO A;  3D67 A;  1GT8 A;  2JLG A;  3FZ2 A;  2CIM A;  5LJ3 Y;  2RQC A;  4URG A;  3RRG A;  4OZN A;  4C8L A;  2XZW A;  4UQG A;  3GJS B;  3J7Z T;  2QA4 S;  2V8D A;  2F8M A;  3SSS A;  4LF4 J;  3HHL A;  3X3U A;  2YKA A;  3DMJ B;  1I51 B;  1FDN A;  1BUX A;  1IBC B;  1WG1 A;  2AYG A;  2EW9 A;  2YKN A;  1J5E F;  1U09 A;  1F9F A;  1C1B B;  4M5D A;  1KQF B;  2ZZM A;  4L3N A;  1WNE A;  5DRK A;  3WBZ A;  3TNV A;  2KDO A;  2VFT A;  2NUH A;  3RB6 A;  2IM3 A;  4DL0 C;  1URR A;  3OLB A;  1N33 J;  1TK5 A;  3G96 A;  4IUF A;  1UVN A;  3ISN C;  4WIQ A;  5ETS A;  3I55 S;  4WE1 A;  4ZVO B;  1CS4 A;  1S6P B;  1LK7 A;  4RNN A;  2IVF B;  3VZI A;  3W3S A;  4B08 A;  4FKY A;  1ELO A;  1RAG B;  2E29 A;  2H3E B;  3J81 U;  4WCE Q;  2BQU A;  1ZPV A;  1MU2 A;  4DV2 J;  3UI3 A;  4ANE A;  3OSN A;  1Q1K A;  2LMI A;  5K9F A;  2E5I A;  3OFG A;  3NCP A;  2J7W A;  2N7Y A;  4FF1 A;  2R7V A;  3NL0 A;  2VKZ G;  1JNR B;  5HO4 A;  3M9O B;  3OR1 B;  2HGL A;  5J2P A;  1CVJ A;  1YRU A;  1M0S A;  1TFW A;  2CWK A;  2Q6B A;  3BEG B;  4HDG A;  4LFB F;  1TV6 B;  1U6B A;  1TEL A;  3BM7 A;  2HFU A;  2OFG X;  3BKU A;  2C2K B;  2NZC A;  1JQG A;  1H7X A;  2KB2 A;  5F0W A;  2QLJ B;  4CLK A;  4KHP F;  2VB6 A;  5C25 B;  2XGQ A;  4TU8 A;  4F50 A;  4DLG A;  3TZZ A;  5T14 A;  3VVU A;  2F7V A;  1CC8 A;  2YKM A;  2N3O A;  2U1A A;  1S1X B;  1JLE A;  3MPV A;  1X4E A;  3CCL S;  4E0D A;  3L7U A;  2H54 B;  3C6T A;  5J1N A;  4LBP A;  4I2P B;  1NSK L;  3PV8 A;  2ZVI A;  1RT3 A;  4HI2 A;  1WKL A;  3VTI A;  1NJY A;  3GG0 A;  4ZVE A;  1WI6 A;  2G0I A;  5BJR A;  1REV A;  3R2C J;  2KFN A;  4OJ1 A;  1MWQ A;  4DLE A;  2YNF A;  1RTI A;  3ZFV A;  2MZS A;  2WB1 D;  4IFY B;  4OYO A;  2IIH A;  2VH7 A;  1PG5 B;  2VD3 A;  3O1L A;  3SZ2 A;  3T5K A;  3CDU A;  4UUX A;  1VQ7 S;  1Y5I B;  4Z2X A;  4ILL A;  2LQJ A;  1JKH A;  2HYI B;  2DNP A;  1UVL A;  1HI8 A;  4ZJO A;  5DQH A;  5GMK a;  4NYZ A;  2IM2 A;  4DL3 A;  1UP1 A;  5HSP A;  2CZ4 A;  2A18 A;  3CD6 S;  1PJ5 A;  4OYA A;  5HMZ A;  2BE2 A;  1LXJ A;  2CQI A;  1NPR A;  5BXI A;  4L73 A;  4RLE A;  4LSZ B;  4C3L A;  4LF2 A;  1HL6 A;  5IXU A;  4DPW A;  3QT8 A;  2DGX A;  3A12 A;  3ISN D;  1JLC A;  3KLE A;  4HAC A;  1PBU A;  4OJH A;  5KFL A;  1V3S A;  3N5F A;  5CYQ B;  2RIL A;  2AP6 A;  1UEK A;  4AE5 A;  2RH3 A;  1X8D A;  3OV7 A;  1IR1 A;  4TKT A;  1B0T A;  2FVQ A;  4H54 A;  1F5A A;  4QWB A;  2V6A A;  1KRP A;  3NNC A;  2YBV A;  3CJQ A;  4X4U A;  3GSD A;  2DGU A;  1TFY A;  3WQP A;  4FS1 A;  1KC8 T;  2YX7 A;  1Q8I A;  3CPW R;  1JB0 C;  3EE3 A;  3W60 A;  4K59 A;  2CQ2 A;  2JDJ A;  3FMW A;  3AFG A;  4XK8 C;  1CSJ A;  3BH6 B;  2KXF A;  3DOM A;  4J91 A;  2DB1 A;  2IHR 1;  2WOM A;  3PX6 A;  4HR2 A;  3C14 A;  2MSS A;  2KKH A;  2YNG A;  1RP5 A;  3W2W A;  4RW4 B;  3AA9 A;  5CAB A;  4DFP A;  2G1D A;  4K0K F;  2D7S A;  1BQX A;  1HWI A;  3JS9 A;  2ABY A;  5I42 B;  1HQU B;  4WXW A;  3MMA B;  1FEH A;  1XNR F;  4NLW A;  2Z30 B;  3DLE B;  1B3T A;  2OSR A;  1NK0 A;  1RAJ A;  3ITH A;  1WSV A;  4RW6 A;  1E6V A;  3FFI B;  3NLC A;  3DLH A;  5KFR A;  3TX8 A;  1NJI T;  3Q89 A;  3PZP A;  3W5X A;  3MTJ A;  4AXI A;  4HH0 A;  4NXN F;  1NH8 A;  2BW2 A;  4C6A A;  4USV A;  1VQM S;  1TL3 A;  3AOB A;  5GAD U;  1NK4 A;  2IBK A;  3WDO A;  3FC9 A;  4JI0 F;  2K7K A;  3GYX B;  1RT2 B;  3THV A;  3QZ8 A;  1IKY A;  2VBX A;  1T02 A;  1S0N A;  5HMX A;  3GCW P;  2XM3 A;  2HNZ B;  3RU0 A;  5D6G A;  2HAI A;  5E3R A;  1CJK A;  3CD7 A;  1HHT P;  5A6W A;  5BR8 J;  4TY8 B;  3HJF A;  4QQB A;  2PSZ A;  4OLP A;  1URN A;  3RBE A;  2GHP A;  5KFZ A;  4Y3C A;  1NK7 A;  3R7B B;  2BOP A;  4TY9 A;  3CJK A;  4N56 A;  5HVF A;  4LVO P;  3KHG A;  4YDX A;  1JXL A;  2B9X A;  3GFH A;  2HHH J;  1RT4 B;  4V19 J;  2BJD A;  2QFJ A;  4EEY A;  1RCX B;  4I68 A;  3M2U B;  4KKO A;  3BSN A;  3O5T B;  2BVZ A;  2WVE A;  1N33 F;  3EGN A;  3EGW B;  1WTF A;  3CCW A;  2OGU A;  3CJ8 A;  2AT1 B;  3LW5 C;  4ECT A;  1GNK A;  4DR6 J;  3KHR A;  1C1C B;  2DGT A;  2LU1 A;  5GAE I;  3A4T A;  1YJ7 A;  3B4M A;  3CED A;  4N5S A;  2WRM A;  3UR0 A;  3JSM B;  5GMD A;  4DV2 F;  2K7J A;  3PRB A;  4CNY A;  5AE2 A;  4LMZ A;  1WOR A;  5DDQ C;  1SIW B;  4IOC Q;  4HYK A;  2QLW A;  4LRA A;  1CJV A;  3CME S;  4RW7 B;  5LXR A;  3MUM P;  5LMN F;  5DQI A;  4QIF A;  1QM9 A;  1RB0 A;  3MM7 A;  1QD1 A;  4ID8 A;  3C16 B;  1WC1 A;  3ETO A;  1RYR A;  4J9N A;  1F5C A;  4A8S A;  2V4R A;  3E8O A;  1QE1 A;  3QGP A;  2KH9 A;  4Y28 C;  4WTY A;  5E5N A;  2CQD A;  1FKP A;  3D2W A;  4N76 A;  5A8K A;  4F25 A;  1D9A A;  3R5J B;  2HQG A;  2YNH B;  2Y8Y A;  4CQ1 A;  3BQ1 A;  1YI2 S;  2GMH A;  2L9D A;  4OYP A;  2BQ3 A;  3HJV A;  4LSN B;  1G6B A;  1KWM A;  4JP8 A;  3E01 B;  1Y5N B;  2CQH A;  1KS2 A;  2H4W B;  1Q79 A;  5F8N A;  3BGO P;  1BQN A;  5HQM A;  3SCI E;  2ZHO A;  3CCM S;  1JLB B;  2DXD A;  4KHR A;  2AF6 A;  1YIJ S;  4AT1 B;  3RTV A;  3JSB A;  4WU2 A;  2JHE A;  5ETK A;  1N34 J;  2E5L J;  3TJA A;  2QMU B;  3SSR A;  2OKQ A;  2QO3 A;  4DSK A;  3UDC A;  1RXO B;  2D3O R;  2KVI A;  3WC0 A;  3L3C A;  3IG1 A;  2XMW A;  2XZD B;  3M2R B;  2ZKU A;  3AXM A;  5KFI A;  2Q43 A;  1SJF A;  2UVV A;  4ZK7 M;  2MY8 A;  1F0X A;  4MYT A;  2HVZ A;  2R8H A;  3MEC B;  1X4H A;  2I8E A;  2LCW A;  3ZXW A;  1KON A;  3NBP A;  2V63 A;  4KV8 B;  2A0F B;  3THT A;  3Q83 A;  1UPP A;  2LQ8 A;  1CJU A;  1NK6 A;  5DM7 Q;  3SCL E;  2EFO A;  2KYX A;  3MUR P;  1RCO B;  1LWC A;  3N9U C;  1ARO P;  5CYM A;  4C8K A;  2XY7 A;  3UDE A;  3CC4 S;  4OYM A;  3K2Y A;  1SJ4 P;  4JUZ A;  4ATN A;  1YJN S;  3SDE A;  2APO A;  5KFY A;  4J9M A;  2Z2Y B;  1LOU A;  3IR7 B;  3BRE A;  2CJA A;  4ZP7 A;  2KFY A;  1VQ9 S;  1Q82 T;  2XSF A;  2VOO A;  3OW2 R;  4WBF A;  1DHM A;  2JEG A;  1FJG J;  5U47 A;  1YVF A;  1WC4 A;  1FRJ A;  2CPZ A;  1UW4 A;  4ENO A;  4YP3 A;  5F8H A;  2XMA A;  3EX7 B;  2E1C A;  2EWH A;  2BM0 A;  5A2Q Y;  1MNE A;  4OZ3 A;  3ZZP A;  4A8W A;  4OI3 A;  4DSF A;  3OTE A;  2FHO B;  4GVL A;  4OZL A;  1P6T A;  1Y9O A;  2ROE A;  1F3V A;  1XIQ A;  1QDU B;  3RYL A;  2VUG A;  1DTT B;  2C3Y A;  2DBB A;  1BGX T;  1PJ7 A;  3BYP A;  4JYA J;  1OS5 A;  1YJ9 S;  4MFB B;  3QIP B;  4DX8 H;  1UZH A;  3HLU A;  4MKY A;  2FLP A;  4TN2 A;  2GVZ B;  4J9R A;  3M8S A;  2CAD A;  5T7L A;  3RUB L;  4RZR A;  2L48 A;  2VU5 A;  3BGF A;  1F6T A;  4EFA C;  3POT B;  2CDQ A;  4LRD A;  4F7V A;  2HIQ A;  4OQJ A;  2B7C B;  1S1V B;  3ONQ A;  1S49 A;  3TR5 A;  3M1V A;  3JTO A;  1KVK A;  4FYV B;  3HHN B;  2B5J B;  2RU3 A;  1QTM A;  4NLG A;  2D69 A;  3DLK A;  3P8B B;  4LSL B;  1C2P A;  1S1U A;  1JLF B;  4YR0 A;  5DZ7 A;  2DHX A;  3D66 A;  4JV2 A;  1WHW A;  2YWH A;  2FGO A;  1VRU B;  3HSD A;  2JFK A;  4W92 B;  1RTD B;  2RDD A;  3C15 A;  4TVA B;  4R5P A;  4YQW A;  3WIV A;  4PWD B;  4H4O A;  3W65 A;  4ER8 A;  2FC9 A;  2DR8 A;  1JJH A;  5BR8 F;  1HBU B;  3VGU A;  4AFF A;  4CLS A;  5LMU F;  2J0X A;  5D78 A;  1FFS B;  5LSO A;  3UD3 P;  2FHJ A;  3EDR B;  4F8R A;  2H5J B;  1S1T A;  4IDK B;  2Z2L A;  1SXL A;  3G87 A;  1HNI B;  5HRO A;  3B54 A;  1JX4 A;  2YNI B;  3R7S B;  4MK7 A;  2HHH F;  4HI1 A;  1Y00 A;  3NGT A;  4QIE A;  4WP8 A;  3CE8 A;  5D3G A;  1TKX A;  4R8U A;  2HK3 A;  3LWL A;  1FK9 B;  4J9O A;  1ZM2 A;  3I56 S;  3JSR A;  2QN6 B;  3ENV A;  4K8R A;  1X4D A;  3DHX A;  1TUW A;  2DCL A;  3KJV B;  3MTK A;  3OTC A;  1WC5 A;  4DR6 F;  1YHQ S;  2NPI A;  3T1H F;  2JZ5 A;  2IAJ B;  2M8D B;  3DRR B;  3CWJ A;  3BR8 A;  3MMB A;  4JI7 J;  3VF0 B;  3HD2 A;  3R1H A;  1IWG A;  2HSE B;  3T19 A;  5DO2 A;  4N8O A;  3DM2 B;  2BJ7 A;  2DKO B;  4C0B A;  2BZ2 A;  3AH6 A;  1PYO B;  2GFF A;  1R6V A;  5CCL A;  3S8S A;  3QLH A;  2N82 B;  4X4S A;  3E51 A;  5T41 A;  1EP4 A;  1SH2 A;  2R8J A;  3RR7 A;  1H98 A;  4B9M A;  3A8K A;  3OVS A;  3MEK A;  5KG0 A;  4O3O A;  4NCG B;  3IXQ A;  2ZBC A;  4IRD A;  3G6X A;  2HQF A;  2A2C A;  2JL9 A;  1RAF B;  2E1R A;  1RBO B;  2V9W A;  3RR8 A;  2XZT B;  2OEJ A;  2VIC A;  2OPS A;  5HVH A;  4N7T A;  3OR2 B;  3QMQ A;  3ILL A;  1H38 A;  3AAW B;  3EVM A;  5E3Q A;  3N6L A;  4YME A;  3CCQ S;  1M5P C;  4KIA A;  4WKR A;  3PX4 A;  4ZVR B;  1T3N A;  1TAU A;  3KG1 A;  3E2E A;  1S9G A;  3V4I B;  4P2F A;  4CO3 A;  4P74 A;  2VC0 A;  5C24 A;  3KG4 A;  1IR0 A;  1SJ1 A;  1HBO B;  3EXC X;  2CPD A;  4L74 A;  5L46 A;  3CCT A;  4GKK F;  2F4V J;  4DHV A;  2V2V A;  4PQU A;  2DNR A;  3K58 A;  3BPD A;  1S9F A;  3M9M B;  5E3A A;  1HBN B;  2R7X A;  5KG6 A;  3MM5 A;  2IBO A;  3SIP B;  4CH1 A;  3FKB A;  4OL8 A;  2AWZ A;  3RRK A;  3TYT A;  1HNX J;  3PW2 A;  4J90 A;  2CRL A;  5HAT A;  3MWB A;  3M8R A;  1Q5V A;  1YRX A;  2QFI A;  3HHE A;  4G6V B;  4O3P A;  4FXV A;  3BGR A;  4DS4 A;  4UF4 A;  2PD1 A;  3TVZ A;  5J2Q A;  2I38 A;  1S77 D;  4P71 A;  3I6P A;  8ATC B;  4LF9 J;  1NHV A;  4UZB A;  2JOQ A;  4G1Q A;  2OTJ S;  4JV1 A;  2QYG A;  3CCE S;  3GV7 B;  2GO9 A;  1JLA A;  3LO3 A;  2MHE A;  5GAD I;  3TZX A;  5DGA A;  2DNM A;  2AZ3 A;  1NND A;  5IQQ A;  3BPS P;  1YIT S;  3N79 A;  1VQ5 S;  4ZIW A;  5DG9 A;  4KFB B;  1R8A A;  1MSW D;  1M5K C;  2B4O A;  3CSK A;  2BMB A;  5LM7 E;  1KQS R;  2Z2M A;  2UVW A;  4IG3 B;  2F1F A;  4ZN3 A;  2V2K A;  4DU8 A;  3LPE A;  3DLG A;  1X4B A;  4BBY A;  3R8Y A;  3V6J A;  1FDD A;  3D6T B;  2J7K A;  3FEZ A;  5EWG A;  4DMZ A;  5EDW A;  3RRH A;  5IFM A;  3HHL B;  1RT7 A;  5LXY A;  1LFP A;  2CJB A;  2X51 A;  2WBR A;  2MLX A;  2YKN B;  4ZLN A;  1IJE B;  4M5D B;  5C2G A;  4OIX A;  5KT2 A;  3CC2 S;  1RAO A;  2OPQ A;  1TKZ A;  3KG0 A;  4ZP6 A;  2IC3 B;  1FRM A;  2YX1 A;  3AB2 B;  5E7O B;  3J7Z 5;  3UD5 A;  3QGI A;  2ZHA A;  4CO1 A;  4NA2 A;  3QFH A;  2DNG A;  1G7C B;  1S57 A;  2F65 A;  4OJG A;  3CB4 A;  4CCH A;  2GZO A;  2AMC B;  3MR7 A;  5HBM A;  4WE1 B;  1K73 T;  1DQA A;  2CNO B;  3I32 A;  1CS4 B;  1N5Q A;  3PO4 A;  9RUB A;  2H4Y B;  3EZ5 A;  2AJQ A;  2XBP A;  2DNL A;  3C66 A;  1MU2 B;  5IQ6 A;  2XNQ A;  1T03 A;  3JTN A;  8AT1 B;  3IM8 A;  2AX1 A;  1B99 A;  1O51 A;  1HI0 P;  3EVW A;  3A1Y G;  3J80 U;  2M88 A;  2W9C A;  4PXC A;  2I1R A;  3M05 A;  2B8P A;  2MQM A;  5J2P B;  2D3O 1;  1U1M A;  2KVQ E;  2AJ4 A;  1Y3K A;  1U47 A;  4YFU A;  5IT9 Y;  2GIQ A;  2BYC A;  4YY3 F;  2XHC A;  2QG9 B;  2X1B A;  2IYG A;  3EDQ B;  1NJW A;  4NLY A;  5J1E A;  4FKX A;  2ZDO A;  1IUJ A;  4F4A A;  4F26 A;  1EJ7 L;  2GJ2 A;  2CNK B;  5KAK A;  4NI2 A;  3H4D A;  2IVY A;  3HPO A;  4PWU A;  1WAC A;  1JLG A;  1M5H A;  4RX6 A;  2YKM B;  3VHQ A;  1O6X A;  1Q81 T;  4ZLL A;  1JLE B;  4ECQ A;  5KFU A;  1HMV A;  1RU2 A;  3C6T B;  4RU2 A;  3W63 A;  3GZ7 A;  4ZPA A;  1PC5 A;  1TL4 A;  2LA6 A;  1K44 A;  1RT3 B;  3P49 B;  5HAO A;  2R7Q A;  2UXB F;  1UVJ A;  2OUG A;  3PR5 B;  2Y0B B;  3OFF A;  1T9U A;  2ZZN A;  2J76 E;  4DCO B;  2JEF A;  1REV B;  2GVD A;  2EVZ A;  3BKT A;  2DNY A;  3QGG A;  2JEI A;  4UZC A;  2YNF B;  1RTI B;  3GIR A;  2F40 A;  4LJM A;  3UE2 A;  2ZOG A;  3IRX A;  5A8W A;  5DDR C;  2C3U A;  1HHS A;  2ATC B;  2FY8 A;  1HHQ A;  1H0H B;  2JRS A;  1YBA A;  4PUO A;  1KD1 T;  4HT7 A;  1JKH B;  3HKZ D;  3RAM A;  5B09 A;  3SCK E;  4J37 A;  2KHC A;  3IWL A;  4XDD A;  1UEV A;  2P6S A;  3D6H B;  4RBU A;  3Q22 A;  2BE2 B;  1FVS A;  3LP2 A;  1KQK A;  5AXK A;  4WFN Q;  1X9M A;  4DUT A;  5KFQ A;  4JI5 J;  1R0A A;  3I31 A;  4WZM A;  5A8R A;  2BJ3 A;  2D9P A;  2WSC C;  3W8G A;  4Z7Y A;  4DG1 A;  1I94 J;  3IP0 A;  5CZX A;  1JLC B;  3KLE B;  4HAC B;  4DV7 F;  3S7R A;  5H9F J;  3G8T A;  4KJI A;  2MZT A;  3CCZ A;  2FJV A;  3IS9 A;  1CUL A;  5K14 A;  1HR0 F;  4PEO A;  3OR1 A;  1WF0 A;  2RVJ A;  1S1W A;  4F36 A;  2HBR B;  1MMN A;  4FVC A;  4C0O C;  4OX9 F;  3HD1 A;  2CJK A;  2FJA B;  3QJL A;  3W61 A;  3FVY A;  1KFS A;  2AD9 A;  3W9H A;  2G0C A;  1PIL A;  2H1Y A;  5F3T A;  3T5J A;  3K57 A;  3N6N A;  3KLH A;  3UFC X;  4ZPT R;  4HHJ A;  4RPF A;  3QJJ A;  2KJV A;  3F0N A;  4M5H A;  1HLW A;  2HS4 A;  3DOM B;  2F4V F;  1GEH A;  3JTP A;  2WOM B;  3J7Y I;  3GR1 A;  1RWX B;  4ID5 A;  1D8Y A;  3C14 B;  2YNG B;  3L95 X;  3W2W B;  3MD1 A;  1Y3J A;  2RT3 A;  4CIO A;  1X5T A;  1AFJ A;  3H20 A;  2VQF F;  2F63 A;  2G13 A;  1HNX F;  3I9Z A;  1IBM J;  1D9F A;  4ED0 A;  3VGS A;  2UU9 J;  3RW7 A;  2IMO A;  3I0R A;  1YX2 A;  4OX8 A;  3TVK A;  3NXZ A;  3NGS A;  4LF9 F;  3VR1 A;  1DZ5 A;  3GR0 A;  4DF4 A;  1S5Z A;  3ITH B;  4AQY F;  4QU6 A;  4RW6 B;  1ZA1 B;  1E6V B;  2HNY A;  1Q16 B;  2BQR A;  4M95 A;  4EBD A;  3TEH B;  5EUH A;  1RDR A;  2GJF A;  1KOH A;  3US5 A;  3UCZ P;  3I5A A;  2LXU A;  2B56 A;  1CBK A;  3SBM A;  1TL3 B;  2JEJ A;  3ILI A;  5KT3 A;  3OUY A;  2YXL A;  3DDK A;  2M52 A;  2HQD A;  5HQ8 A;  1KQG B;  5K8N A;  1IKY B;  1V9O A;  2K8G A;  1TKT A;  2P9G A;  4QR0 A;  3DN9 A;  3OVA A;  1CJK B;  4URQ U;  4DSE A;  5E33 A;  3SI8 A;  4JI4 F;  5CXT A;  1FT8 A;  3TUJ C;  1P27 B;  5KG5 A;  3CJK B;  1NME B;  2DCU B;  3NGU A;  5KFH A;  3KUE A;  4C8Y A;  3DOK A;  3F73 A;  1P1L A;  2HIY A;  2VFS A;  3FQK A;  2HBY B;  2ZEJ A;  4CLY A;  1FFW B;  4D3G A;  5JUM A;  4Z7C A;  2W2Q P;  4DSL A;  4B9V A;  4GC7 A;  2HBZ B;  4B9S A;  4DN0 A;  1GX6 A;  4OYX A;  2AJ2 A;  2DR7 A;  3NAH A;  4TYA A;  4KKO B;  1PYS B;  2DXE A;  4KE5 A;  2HND A;  5FLX Y;  2JLF A;  5C5J A;  1RLD A;  3PRV A;  2J5A A;  1VC5 A;  2J9E A;  1F3F A;  2OEL A;  1UJ6 A;  3MEE A;  2HVE A;  1VGY A;  5IWA F;  2YY3 A;  3Q8U A;  3N0V A;  4RUC A;  2DIV A;  3N01 A;  4KY3 A;  1PBA A;  4YHH J;  1G1X A;  2XMT A;  3MPU B;  2HHV A;  4DV3 J;  5DLF A;  4RBV A;  4ETX A;  1KDN A;  3QT5 A;  3BBB A;  2HVD A;  4C97 A;  3BGU A;  4NOH A;  2UV8 A;  5L39 A;  4PRF A;  5F9N A;  1CJV B;  2W25 A;  2ZC4 A;  4NCB A;  3ILO A;  1T0T V;  4ZJQ A;  3PYE A;  2FYX A;  3MM7 B;  1WKJ A;  3MED A;  4CO4 A;  2LYV A;  2VA3 A;  3SQG A;  3IBF B;  4JI3 J;  4XO0 A;  1QE1 B;  4RU9 A;  1FKP B;  2ROG A;  4GMK A;  4ED2 A;  4Y34 A;  3W64 A;  3RW6 A;  3U27 A;  1IKX A;  3LUY A;  3BO3 A;  2XNR A;  1LKZ A;  5A8K B;  4HLB A;  4MK8 A;  2XO6 A;  5KG1 A;  3R97 A;  4USK A;  3ICL A;  1BMQ B;  3Q23 A;  1B0V A;  4MT1 A;  3BS9 A;  1IKV A;  1KEK A;  1BQN B;  2IA0 A;  2WVB A;  2DEJ A;  1KNZ A;  3KK3 A;  3GV8 B;  4DL4 A;  2VL1 A;  3AA8 A;  5ETM A;  3CIZ A;  4MIA A;  3WC2 A;  4M5G A;  4LVN P;  4C2M A;  4X62 F;  4PXD A;  2ZOF A;  3TAM A;  1G2E A;  4Q0B A;  3IWN C;  3ZTP A;  3UO0 A;  3Q8Q B;  2VIH A;  1RKI A;  3IG1 B;  2JX2 A;  3GPA A;  4HDH A;  3L9Z A;  4FPI A;  2CJ9 A;  1FXL A;  5KG3 A;  3DI6 A;  4OI2 A;  1AFI A;  3GB0 A;  5AXM A;  2EXU A;  3M6W A;  3MCO A;  3NBP B;  1F60 B;  2NXJ A;  1RT4 A;  2A6M A;  1S76 D;  1U1L A;  4GO5 X;  1CJU B;  4A8M P;  3NP5 A;  5KFM A;  3UPF A;  2G9O A;  4QIW D;  1LWC B;  4DPY A;  3D0I E;  3LAN A;  2KT3 A;  2MKY A;  4B3R F;  1V3Z A;  3AJ1 A;  3FBC A;  3M9N B;  3P96 A;  4DR5 F;  4DR2 J;  3H90 A;  2JC0 A;  1H2T Z;  1OYE A;  3SDE B;  4KBI A;  1RWU A;  1I3O B;  1ZS6 A;  4B3T J;  1E6Y B;  5ETV A;  4DFK A;  4AND A;  4YN3 B;  1FE4 A;  2ZKT A;  4KRW A;  5F3Z A;  3FUY A;  1WWH A;  1NPK A;  2GQQ A;  2ZJR Q;  3BQ2 A;  3K17 A;  2DGO A;  3VVT A;  2QEX S;  2FC8 A;  2XMM A;  4NA3 A;  1OIA A;  2CA9 A;  1EX8 A;  5EWF A;  1Q5Y A;  5B0F A;  1IM4 A;  4FZV A;  4KSE B;  1R31 A;  3P4U B;  4P7V A;  3AJ2 A;  4C0H A;  3L09 A;  1HYS A;  1A9N B;  3EGZ A;  4NX9 A;  4K2J A;  3UVJ A;  3UN3 A;  3B8H A;  4TXS A;  4O23 A;  5B0A A;  4Y2I A;  1FKO A;  2DHG A;  3IAS 9;  4ZN1 A;  1S0M A;  1NRK A;  2O5D A;  3CCR S;  5F8M A;  3KKF A;  3CMA S;  4M5M A;  4K4Y A;  1FFG B;  4RNM A;  1H73 A;  4DZD A;  5I3Q A;  3H2L A;  4ILM A;  1PCA A;  2B6A A;  1ZM9 A;  1SKR A;  1P8G A;  4HH1 A;  3MOZ A;  4ZCM A;  3HFZ B;  5T7L B;  4B9N A;  2AIR B;  4WYW A;  5KG2 A;  1VQO S;  4OZ2 A;  2V94 A;  1O8B A;  3EPI A;  1NSA A;  1U2C A;  3UW1 A;  1NHK L;  3TUZ C;  1HQE A;  2J7U A;  2VC1 A;  3MUT P;  1RAA B;  3B6B A;  4ZVS B;  3Q8Y A;  4ZKA A;  1NK9 A;  2DY9 A;  4RNH A;  3M1V B;  1W2B R;  2AYM A;  1ZAV A;  4K5S A;  3BKF A;  3KLI A;  2FHM A;  4MIW A;  3UR3 C;  3DLK B;  1VLO A;  5KFJ A;  2HHS A;  2HLU A;  1S1U B;  2BBE A;  2K1R A;  3OQ2 A;  4WFB Q;  1XEZ A;  1TUG B;  3UN2 A;  2WHO A;  2YKQ A;  2CQ1 A;  3C15 B;  2VQE F;  2KRR A;  4CLW A;  4LRF A;  2PI5 A;  4H4O B;  2CPH A;  3A3P B;  1NK8 A;  2AGO A;  3HX9 A;  5B0G A;  4Y2C A;  2HRT A;  2LDI A;  1SH3 A;  9ATC B;  4DV0 J;  3NY0 A;  4IKA A;  1LWF A;  4U7C A;  2EEY A;  3SV3 A;  4AL5 A;  4HTI A;  3TX0 A;  1QTN B;  2PMZ D;  1S1T B;  1VQL S;  2R8G A;  1U48 A;  2EFP A;  3M7V A;  3H0P A;  5EX3 A;  1X0F A;  1VQK S;  1CJT A;  4BHQ A;  3V5R A;  3PYG A;  4HVZ A;  5D3G B;  1TKX B;  4R8U B;  1F2H A;  2D74 B;  1SJR A;  1VC6 A;  1LNQ A;  2JLE A;  4QWD A;  4O44 A;  3K7R A;  2UUA F;  1VRQ C;  1SCJ B;  4U67 Q;  2HHX A;  4F3Q A;  3AB4 B;  4ZPV R;  3MMB B;  2E9Z A;  3CF5 Q;  3E3X A;  4B3O A;  4WF9 Q;  5HLF A;  3ZTQ A;  1HFE L;  1C4C A;  2W2M P;  2DRA A;  4DV3 F;  2DT9 A;  5HN0 A;  1X4C A;  3FCH A;  2NLW A;  4U6P A;  2PMH A;  1S59 A;  3NCR A;  3HHD A;  2EG1 A;  1FRI A;  1WSR A;  3QLH B;  3T6B A;  2I5J A;  1U6F A;  1T9X A;  5K8P A;  1EP4 B;  1X4F A;  1LQ9 A;  3R5D A;  2FQQ B;  2R7T A;  4PXB A;  1EHW A;  1IM6 A;  1XNQ J;  2JVR A;  3CO0 P;  2QA2 A;  4H4K C;  2KT5 A;  2FJE B;  3P45 B;  2QTW A;  1S1V A;  3LF0 A;  2OPS B;  3I87 A;  1BHN A;  1I6J A;  3WZ0 A;  3CJR A;  2PT0 A;  4E98 A;  4CI0 B;  1DTQ A;  4DJB A;  3PRD A;  2WON A;  1F2G A;  4BLG A;  2OHD A;  5MAO A;  1RAC B;  1S9G B;  3H98 A;  2BUN A;  1DFD A;  5C24 B;  5CCM A;  4ZCI A;  3NCQ A;  4NYO A;  4KHP J;  1JJ4 A;  2XHW A;  1R8H A;  2V68 A;  4QW9 A;  2W7P A;  3KNA A;  3D1O A;  5J1P A;  2KG0 A;  4PQU B;  4Q7A A;  2ZOM A;  1WC6 A;  3FSI A;  4U8V A;  5KG4 A;  2ZE2 A;  3Q8R B;  2DRB A;  4BC9 A;  1VQY A;  4CWB A;  2ZBP A;  1XWL A;  1SJ3 P;  3O6Q A;  4LF7 J;  3MM5 B;  1BWV A;  1RK8 A;  2UUC F;  1WHY A;  3NS6 A;  2IYI A;  3GJR B;  3Q8V A;  1RHQ B;  3BGR B;  5DDO C;  1G4C A;  2GO8 A;  2KTQ A;  1ICE B;  5J2Q B;  2P6T A;  1X60 A;  4MJK A;  2B4V A;  2FJB B;  2XWY A;  2LEB A;  1MMD A;  1XMQ F;  1T11 A;  2HZC A;  4G1Q B;  2VZ9 A;  4A8X A;  4ZPW R;  1TR0 A;  2GIR A;  2PA8 D;  4MH8 A;  5FJ4 A;  3C19 A;  4M1K A;  5IT9 U;  2MB0 B;  4I56 A;  2GIF A;  2G2O A;  1U8S A;  2I0X A;  5IM0 A;  4USW A;  3D7S B;  3Q8P B;  2Q1L A;  4K4Z A;  1GXU A;  2DNO A;  3V2U C;  3IA0 A;  2HGM A;  2K3I A;  3MCM A;  3RB3 A;  4QR2 A;  4B3M F;  3DLG B;  3ELH A;  3FMB A;  1LWE A;  2LU2 A;  5K8M A;  4PWW A;  2IRY A;  1SVD A;  2YWK A;  2HBQ B;  4TYB A;  3LAK A;  1M5S A;  3L7O A;  5RUB A;  5A0Y A;  3FNN A;  5IS2 A;  1RT7 B;  3F41 A;  3OSP A;  2HQI A;  2N4D A;  2CQC A;  5DET A;  1N52 B;  2C22 A;  1P1T A;  4C8O A;  1RTZ A;  2K3K A;  3LQV A;  2OPQ B;  1REG X;  1TKZ B;  2V0N A;  4KR0 B;  5L1I A;  4WK1 A;  1PSD A;  2XI2 A;  4ECZ A;  2VOP A;  4IO1 A;  2J6U A;  2V2Q A;  4F0K A;  2W8K A;  3BN7 A;  4YS2 A;  3TI0 A;  1HD1 A;  1UAW A;  3GIK A;  2X3G A;  1O0P A;  3W62 A;  3ZZO A;  4X4T A;  4A8F A;  1NJZ A;  5HBM B;  2VA2 A;  2DIS A;  3ZO7 A;  2EI5 A;  1A0O B;  1QLN A;  2Y1J A;  1WI8 A;  2ZD1 A;  2ILZ A;  4LF6 J;  1T3O A;  1LV5 A;  4CP5 A;  2QE5 A;  1RT1 A;  3OT9 A;  1WKK A;  2Y3Y A;  2VDH A;  1T03 B;  3K5O A;  2YH0 A;  4P73 A;  2C3O A;  2YWW A;  1Q78 A;  3TAP A;  2HW3 A;  4DZ6 A;  2BAB A;  4ZCL A;  2DHS A;  2JWN A;  4ZP9 A;  2W9C B;  3OTO F;  1R8C A;  4MK9 A;  2C3P A;  2G1H A;  3UNY A;  3DFE A;  4A8K A;  2HWT A;  3KUH A;  4OHW A;  4KGX B;  2MKK A;  3NS7 B;  3NWR A;  5J1E B;  1RIS A;  1MLA A;  4O3N A;  4DBQ A;  2DNQ A;  3K59 A;  4FP9 A;  4I6Y A;  1EB0 A;  5HI7 A;  4LBI A;  3VQS A;  2YX4 A;  3UWT A;  1WEX A;  4NI2 B;  1ULR A;  4JOU A;  4NXN J;  3G8Q A;  1VYA A;  2KFZ A;  2LXF A;  2WAQ D;  5KTQ A;  1NKC A;  4X84 A;  1JLG B;  2F8H A;  1GFW B;  2FJX A;  4PQA A;  2MKH A;  1IBK F;  3LP0 A;  2B8Q A;  2OTL S;  2BJ1 A;  2ZUA A;  2Q3P A;  3TAR A;  1KLN A;  1HMV B;  1MN7 A;  1BWE A;  2MPU A;  4MKB A;  4ZPC A;  4DDF A;  3WX8 A;  2Y9H A;  4TLR A;  4F4Y A;  3BJY A;  2QMW A;  1GQE A;  2GVD B;  5CZV A;  1JXE A;  4NPO A;  5ETP A;  4Q8F A;  1FES A;  2GNK A;  4IR9 A;  3NG8 A;  1L3V A;  3K5M A;  1T9W A;  3IRX B;  5A8W B;  3PW5 A;  4OYI A;  1J27 A;  5F8I A;  1HNZ F;  4AXJ A;  3R7N B;  3IWX A;  1NKE A;  3P6Y C;  1C0T A;  4PUO B;  1N36 F;  2LKZ A;  5DGB A;  4OI1 A;  4B9U A;  3OFE A;  4L72 B;  5DQG A;  2A2D A;  2IC3 A;  4JI1 F;  2COL A;  3GYG A;  4CLU A;  5SUH A;  3KJF B;  1WHV A;  1FNX H;  3UN5 A;  3D28 A;  2NPF A;  5HQL A;  3PVX A;  1SPB P;  3R6G B;  1MWZ A;  3D0G E;  3LP2 B;  3I4H X;  3HVT A;  3J81 Y;  5L9N A;  1AW0 A;  2XG8 A;  3ZNJ 1;  3HVR A;  1R0A B;  2WTF A;  1BY9 A;  1S10 A;  5A8R B;  3G4S S;  4L6V 3;  2UXD F;  3HF5 A;  4DG1 B;  3PM9 A;  1SV5 A;  2KG1 A;  2XSJ A;  5MLC V;  1XNQ F;  3AQP A;  1T7P A;  1Q8K A;  2HPU A;  2Z57 B;  1EKR A;  2P2C B;  1X9S A;  3NNA A;  2R3V A;  4P10 A;  2W8L A;  1Q7L B;  3IS9 B;  4KPY A;  3SV4 A;  2ALZ A;  5BYS A;  1CUL B;  5K14 B;  1RGV A;  3M2V A;  3HP6 A;  2R7U A;  2D41 A;  5LMN J;  2B9Y A;  2HQC A;  2RIJ A;  1S1W B;  1FO1 A;  1X5P A;  1A7G E;  3UCG A;  4ZVP B;  1NB7 A;  1UA0 A;  4PPZ A;  4FF3 A;  4J9L A;  4QYZ J;  3H8Y A;  2AJ0 A;  3T3F A;  3DKD A;  2I9S A;  4QCL A;  3THP A;  2BKO A;  3KLH B;  2DH9 A;  2CPY A;  4ZHR A;  5D4P A;  1HI1 A;  1TL7 A;  5AXL A;  2Z0G A;  3QGH A;  1U4B A;  3R5C A;  4OHY A;  1PAU B;  1KVI A;  5FLX U;  5D4N A;  4ID5 B;  2EFQ A;  1H72 C;  2XLJ A;  2KM8 C;  1WHX A;  4LFC F;  4J9U E;  4LF7 F;  4RWW A;  3JQM A;  1IQT A;  1QAX A;  4NEZ A;  3GQC A;  1OYD A;  2CAJ A;  3MF5 A;  3CO9 A;  1XR7 A;  2NXU A;  3AQO A;  2CJY B;  1NHU A;  3PJ9 A;  4EO8 A;  1YRT A;  3I0R B;  5H9E J;  4ZVQ B;  1JLQ A;  3UDL A;  3A13 A;  2OML A;  4CLZ A;  2VPZ B;  1Y7P A;  4A46 A;  2B4U A;  2HNY B;  4JBC A;  1KOO A;  2VHG A;  1S7H A;  1U0S A;  2FPH X;  2HQ3 A;  4ZDN A;  2WVD A;  2ZDP A;  4USM A;  1FHT A;  1ZET A;  4P52 A;  4WXO A;  2J9D A;  2UUB F;  3HVW A;  3IAM 9;  3WX4 A;  3DC2 A;  2MGZ A;  1D09 B;  2H5I B;  4ED3 A;  1FE0 A;  2DNZ A;  5KFA A;  3KLG A;  3OUY B;  3OL6 A;  2IJN A;  2Z4P A;  4DUY F;  2J0Q D;  1HA1 A;  1R0B G;  4X64 F;  5M2U A;  2VJU A;  1TKT B;  1R8P A;  1CQM A;  3KJN B;  2CG8 A;  1FD8 A;  3JAM U;  3C6U A;  2EKY A;  4DL2 A;  3GU0 A;  1VBZ A;  5EGY A;  2ROP A;  1HPZ A;  5THW A;  1MRO A;  2UXC F;  2L3M A;  2E7X A;  5A6P A;  1SL0 A;  1NB2 A;  4HHH A;  4ZS6 A;  3DOK B;  1HAR A;  5HK4 A;  2W4D A;  4IH7 A;  2ACY A;  1UVM A;  5F9L A;  1NH7 A;  4ED4 A;  2W01 A;  4RW8 A;  3NNH A;  2YTC A;  3RAX A;  4ERD A;  3R1L A;  2JVO A;  4OFZ A;  1PJ6 A;  3HXM A;  2ZJQ Q;  4K4V A;  4DI6 A;  4Q43 A;  3MAQ A;  4YOE A;  2HND B;  1V3R A;  1IWA A;  2J9C A;  2MMY A;  2EFN A;  4EU0 A;  1VC0 A;  1YJU A;  3D6M B;  1Q4R A;  3MEE B;  5M2R A;  1YJV A;  2ZNY A;  4X66 F;  3MM9 A;  3V81 A;  3ZTO A;  1U2R A;  5KFT A;  4LF6 F;  3EPG A;  3SXL A;  3FGV A;  1LXN A;  3TUI C;  4LRC A;  3OLA A;  2C2D A;  3AD7 C;  2HVI A;  1VBX A;  2ZH4 A;  3GII A;  4F3O A;  3CIM A;  5KG7 A;  4I6W A;  2NXE A;  5GAH I;  5B0B A;  2DR9 A;  4Q2M A;  5KFN A;  3ADA C;  3CD5 A;  2PE8 A;  5DJB A;  1Q86 T;  2NCK L;  3MED B;  3DRP A;  4FXW A;  3VAH A;  4B3S J;  3SQG B;  4Y6I A;  5D15 A;  1UCN A;  1YTY A;  2BDP A;  3BF4 A;  3PG9 A;  1X7V A;  4CYU A;  2CNN B;  4IYQ A;  2UP1 A;  1VQ4 S;  4ZVT B;  1IKX B;  3V6K A;  3RZA A;  1R7I A;  2CKW A;  1UTA A;  5HP1 A;  1GMU A;  2EBE A;  2H65 B;  2KRB A;  3PTW A;  3KOA A;  4ECY A;  1NU4 A;  2F4F A;  1UJ5 A;  1IKV B;  1QSS A;  1U1K A;  3QAE A;  1OY8 A;  3RG6 A;  4UUW A;  3CUL A;  1QVF R;  3RAQ A;  1XBW A;  2V4J A;  3KK3 B;  4U7U D;  1NCL A;  2HKE A;  4LIR A;  1SL2 A;  2N7C A;  3FBE A;  1SIZ A;  2MST A;  3TAM B;  2MZ1 A;  4Q0B B;  2BJ8 A;  1YBT A;  1MG7 A;  4FDF A;  1RA6 A;  3QAU A;  4PG7 A;  4C11 A;  4Y2K A;  5LMU J;  2W9A A;  2YH1 A;  3DI6 B;  4M94 A;  2PEB A; 
#chains in the Genus database with same CATH homology
 5ETM A;  5ETT A;  3IP0 A;  1F9H A;  1CBK A;  3HSD A;  1EQM A;  4M5I A;  4CRJ A;  2F65 A;  1TMJ A;  3HCX A;  4M5G A;  5ETN A;  4AD6 A;  1EX8 A;  1G4C A;  2QX0 A;  3ILI A;  3UDE A;  4CWB A;  5ETK A;  3HSG A;  4PZV A;  5ETO A;  1EQ0 A;  4M5N A;  1RTZ A;  3UDV A;  1HQ2 A;  1TMM A;  1RB0 A;  1RU1 A;  1DY3 A;  3KUH A;  5ETP A;  3HSZ A;  4F7V A;  1HKA A;  4CYU A;  3ILJ A;  4M5J A;  3KUE A;  3HD1 A;  5ETR A;  3UD5 A;  5ETV A;  1Q0N A;  4M5L A;  4M5M A;  4M5H A;  3HSJ A;  3MCM A;  3MCO A;  5ETS A;  3MCN A;  5ETQ A;  2CG8 A;  3ILL A;  3HT0 A;  1RU2 A;  4M5K A;  3KUG A;  3ILO A;  1KBR A;  2F63 A;  3HD2 A;  3QBC A;  1IM6 A;  5ETL A;  4CYU B;  2BMB A;  1RAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...