3ILJA

Crystal structure of e. coli hppk(d95a) in complex with mgampcpp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
158
structure length
158
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLALDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3iljA00
1EQMA 5ETLA 4M5MA 3MCNA 4M5KA 3HSDA 3HSJA 4PZVA 1CBKA 4CYUB 4M5JA 3ILIA 1RTZA 3HD1A 3KUEA 4F7VA 3KUGA 5ETMA 5ETVA 4M5NA 3UDEA 3HD2A 1F9HA 3IP0A 4CWBA 1KBRA 1RAOA 3HT0A 2CG8A 1HKAA 5ETQA 3UDVA 1EQ0A 1G4CA 3ILLA 5ETNA 3KUHA 1EX8A 1IM6A 2F65A 3HSZA 5ETRA 1DY3A 5ETSA 3ILJA 3QBCA 5ETOA 3HCXA 3MCOA 4AD6A 3ILOA 1Q0NA 1RU2A 3MCMA 4CYUA 4M5LA 4M5GA 1HQ2A 4M5IA 5ETTA 4CRJA 1TMMA 1RU1A 3HSGA 5ETPA 2F63A 5ETKA 1TMJA 2QX0A 2BMBA 1RB0A 3UD5A 4M5HA
chains in the Genus database with same CATH superfamily
2G2OA 2BJ7A 1GH8A 4CLPA 3SCIE 3W9JA 2F9JA 1HIYA 5DGAA 3KLHA 2E1CA 1WSRA 3CDBA 4OL8A 2ZJQQ 3TVKA 1NXIA 4HHJA 4YMEA 4NXMF 1PC4A 3OL7A 2R8HA 2NQPA 2V9WA 1DTTA 1FRIA 5ETMA 3UDEA 2BACA 1JX4A 2HFOA 3FJ2A 4P2MA 4AT1B 2RF2A 1WOPA 4Q5VA 2FHMA 1RXOB 3QRPA 2RQMA 4UT4A 5IQ6A 3Q24A 3NNAA 4DL2A 2FZGB 3QJPA 3UR3C 1J5EJ 5A76A 4WCEQ 3H5UA 1UEKA 1UPPA 3M8PB 3IR5B 1RAJA 2C2MB 3D1HA 2F1FA 1HNXF 4K2XA 1N6QA 3Q8RB 2X1BA 2R2SA 1RT2B 2VH7A 2ZD1B 3U1MA 1SKSA 1U2FA 3Q2SC 1ELOA 1RLCL 2ZH2A 3I0RA 5IOLA 2W9AA 2LQ9A 4OX6A 3GIJA 4JI8F 2IJRA 3HHLC 4GVBA 4DV7J 3TZYA 4LRCA 3DFEA 3IXQA 2KT3A 4HI2A 1KN6A 5LMUJ 3W3SA 2GMHA 2R42A 3BV8A 4OZ5A 3DDNA 3W5ZA 3KLEA 1RT1A 2XTJP 5D3GB 1I94F 1S12A 1S59A 4ZVTB 1UEUA 4PXEA 1D9AA 1TR0A 1VBXA 3V6DA 1YZ6A 5B0CA 4ZLPA 1FWLA 1WOSA 2BOAA 5HQ8A 4F3QA 1JJ2R 4QR1A 4ZHRB 1REGX 1VQSA 3HO1A 2EBEA 1FA0A 2IIHA 5CXTA 1RAFB 2PEHA 4ED3A 3BGRB 4FS1A 3NMRA 3PYGA 3NP5A 1KFDA 4XDCA 1JXLA 5HJYA 4FYVB 1TUWA 2HFSA 1H73A 2GMLA 4F0HA 3VZIA 1QSYA 3GV8B 1WI6A 3N6NA 3MOJB 3PKMA 1YVFA 3BDEA 2L08A 2B56A 3KMSA 2HQFA 4NCGA 3D54A 1T9VA 3EE3A 3T1HF 5F8IA 1SC3B 3AD7C 4CQ1A 1UJ6A 2KG1A 1JLQB 1ICEB 2VQEF 3A1YG 4D3HA 2V2VA 3K5PA 4DQRA 2Y1LB 1WC4A 3TX0A 1CQMA 5THWA 4CO4A 2BA9A 4H4KA 4B17A 3FBEA 3SEOA 4OMFG 4OJ3A 2CWKA 4NRUA 1HW9A 3PDNA 3FKBA 4J9OA 2FIUA 2HRTA 5GAHU 1S7HA 3SQGA 3SMZA 3HK2A 3RYLA 3VR1A 2AYGA 2VV5A 2IA0A 1Q86T 3NMAA 3FGVA 1FFWB 4I6YA 4Y2KA 1RAEB 1N36F 3ILJA 1RP5A 3BKTA 2C2EA 1QAXA 2FJAB 1HBUB 4OQJA 1M0SA 1FDBA 2XHWA 2I8EA 1J27A 1IKYA 2J7UA 2OEKA 3C15A 4HLBA 4Y28C 4U7UD 1IJEB 5LJ5Y 2ASYA 4P6QA 5KFBA 5KG1A 2LA6A 3KNGA 1TKZA 2ZEJA 5DQHA 2MQPA 3D68A 4ZP9A 4O0NA 4CIOA 1RAOA 1ULRA 1GFWB 2CPYA 1U09A 2AJ0A 5DM6Q 1YBUA 1FXLA 1XWLA 2C2ZB 4GC7A 3G86A 2CQ1A 3DMJA 3OQ2A 2JVOA 1FI4A 2AYEA 4JI1F 1X4DA 3HJVA 2ZH4A 1TELA 1K1QA 2GC8A 3GMGA 4W4MA 1HWIA 3T9ZA 3HHDA 1YQHA 2X7IA 1X9MA 2GVZB 1U2RA 2CPEA 2XNQA 3E3XA 2IYGA 1KVIA 3QBCA 2N7CA 4KR0B 1IR0A 4RNFA 1Y11A 1JLEA 4ER8A 4OYMA 4OI3A 2YNGA 1TL7A 3PFOA 1FHTA 2GJ2A 2V34A 3MTKA 3TX8A 3U7JA 3W2WA 3ZZTA 2MKCA 1S9EB 4WZQA 2HRYA 1Q0NA 1D09B 1QAIA 1U0HB 1IBMJ 2RD5C 3BJYA 5HQLA 4DV6J 2FJWA 3GPAA 2BW7A 1SUQA 5ETSA 1U1LA 2IPOB 1BQMB 2YVSA 1RHUB 1PCAA 2DXDA 1S1WA 1RWXB 4NMXA 4DS5A 3GZ7A 2QGFB 4C0OC 3TOQA 1T9TA 5DLFA 1IBCB 1J5OA 1CLFA 2AIRB 1RKJA 2GVDB 2D9OA 2FVQA 4CM0A 3GSDA 5HVFA 3IAM9 2B3TB 4J9NA 3HM9A 4A4JA 3L95X 5IT0A 3QGPA 3KK1A 3IM8A 2I2YA 3DC2A 1NJXA 3DU6A 2BKPA 3TVYA 5IM0A 3LW5C 4O4GB 1UL3A 1FRJA 1TMJA 4NLDA 5DLGA 2ZOMA 2V68A 3DN9A 5KFAA 1YJRA 1FO1A 2EG1A 2EEYA 2VPYB 1LWEB 2HQGA 1Q4RA 4PUOA 4B9VA 3QLHA 4YR0A 1LWFB 2VFTA 4Z7YA 2L41A 1ZA2B 4HEA9 3KHGA 4M1KA 4OZJA 1PBAA 5IWAJ 5F8NA 3OFHA 3NCQA 4DR3J 4B9NA 3H90A 2QLFB 3FQKA 3WDOA 4RBVA 5KFNA 2IYIA 4TQRA 2AHOB 3TUJC 1VHIA 2G4BA 3M8ZA 4IO1A 1U1OA 4FXDA 3CMES 2XY7A 4KBIA 4AQYF 4FPIA 2NUHA 1GNKA 4ENOA 2RMLA 2UVRA 2QZ8A 2K8GA 3WC0A 4KHRA 4KFBB 3ZZPA 2EK6A 2FVCA 1RAGB 3IR7B 1W25A 3Q0AA 4LBHA 2ZHBA 3MMBA 4CT8A 2LQ5A 1X5OA 4HH1A 3TQEA 3GV5B 2AWZA 3RBZA 1KDNA 3VHQA 3JTPA 2HVIA 1X9WA 3BSNA 2ZZMA 2WAQD 5J2PB 1U02A 2GW8A 3GLJA 4ILRA 1CJUA 5HN0A 4DV5F 2IJFA 3R5GA 4DQIA 2LQ8A 2XSFA 4QWEA 1FRLA 4Q43A 2XMAA 1MWQA 2M4MA 3E01B 4DFPA 3C6UB 4WYLA 3DKDA 1NO8A 2DEJA 4IOBA 1Q79A 1NDCA 3MM6A 4B9SA 4Y34A 1R0AB 4X4UA 2MYFA 2JZ5A 1FF2A 5HROB 2KVQE 3B8HA 4O3PA 4DCPB 4UQGA 4I6AA 3K7RA 3MM9A 2DH9A 1FNMA 1XTZA 4F8RA 2PI4A 4I2QB 2HW3A 2Y3YA 1N5SA 5DDOC 5B0BA 5RUBA 3GE9A 2EKNA 1WG1A 4KH1B 1R89A 1N5QA 3MAAB 4IH7A 1Q7YT 3K5NA 1WG4A 2IHR1 3BSCA 1NZAA 2MLXA 2P6TA 4RNHA 4IG3B 4V19J 4DR6J 2HHHF 3DLEA 3H4DA 1VFJA 2MKSA 1NSQA 3A3OB 2DGOA 2AMCB 4ECSA 1H0HB 4RO0A 2YNHA 3OT9A 3RRGA 2KL8A 1Q53A 3EVMA 1EP4B 3ISZA 2VG6B 4K5RA 5HMYA 3NKYA 3NOCA 1M5SA 1RHQB 2H48B 4TU8A 2D74B 3GWCA 2MKYA 1MMNA 2CJQA 4B3OB 5BYQA 4KE5A 3MEEA 2DNNA 3W2VB 1QSSA 2ASJA 4EUVA 2WW4A 1K9MT 3SSSA 3CJQA 3MM8B 1XN9A 2LA4A 3GFYA 3E2EA 1FJGJ 2DGSA 3CC2S 3DGPB 2HVZA 4L72B 3L9ZA 3BQ1A 1JK9B 2KT2A 3QSYB 3DRPA 2VD3A 2ROEA 3R5CA 2RUGA 1TV6A 1E6YA 5C42B 1WTFA 1BHNA 3TYTA 2EFQA 2FJEB 4OZ0A 4YDXA 5BXIA 4F0KA 1RTJA 2F4VF 3G9CA 4ES1A 2DBBA 2M52A 2HNYB 3CNQP 3SDEA 2QC3A 1VQOS 3D6FB 4XTTA 1KBRA 1SL2A 3NL0A 4QW9A 2ZOFA 3ZFVA 3C2PA 2G0CA 3D3CJ 3NS7B 3H4BA 1VI7A 1IKVA 1ZPVA 2XI2A 2LYVA 2QA4S 5C24A 4FF2A 1IM6A 2GQ2A 4IFYB 4I64A 4I6WA 4KKOB 4MYTA 2Y1RI 2APOA 3KJNB 2HHVA 1TZ0A 1AFJA 1DLOA 4OI0A 3EM1A 1U49A 4WTYA 3T5HA 4JI0J 5I3UA 2YX4A 1VC6A 2OPQA 5EUHA 4PQUB 1I3OB 1D9FA 2F9DA 3CT9A 2XMVA 1RTZA 1JLCA 2XMTA 1QTMA 3MHYA 2XMUA 1WEYA 2GS8A 1KTQA 4I2PB 5KG6A 2HNZB 2KRBA 1K0VA 2QFIA 1ZYQA 1JXVA 3M6VA 2HHQA 2B9WA 3THPA 4OYAA 1WI8A 2ZHOA 2NZ4A 2E9ZA 4Y2AA 3W60A 1VJWA 2IC3B 2JNJA 1SVDA 4C3KA 1XR6A 1IKWA 5AE1A 3IN5A 3OXLA 3FNNA 4DR1F 4KAIA 1RT5B 2YKMA 1TUVA 4FP9A 5FDLB 1XERA 2BJ9A 2XMJA 4MFBB 5J1NA 4FPRA 4X4QA 2AX1A 4CO3A 4HT5A 4LFAF 3FFIA 1TAUA 1D8YA 2JFKA 2DNHA 3DRRA 1V6HA 5A8KA 1QVGR 4QYZJ 1VQ6S 1T03A 4WFAQ 4QU6A 4V1Ak 1MMDA 3AOAA 1RT4B 1RT7B 4K7QA 2UU9J 1UZDA 4X65F 4C8KA 3TUIC 4P73A 2JL9A 3DYAB 4OX9F 2KN4A 1DFDA 2C28A 2ZDOA 4DV2F 2HPUA 4P52A 1NB7A 2JH3A 1NKBA 4OX8A 2PO4A 4DWIA 5G0RA 5C25A 3D6MB 5AE3A 2V4JA 3QNWB 2LCWA 2W7OA 5AXLA 3BKUA 2VZ9A 3MURP 1QAYA 1X5PA 4R8UB 4PWDB 2DNLA 1EKRA 3MUMP 3CCRS 1S49A 3DLBA 1C4CA 2CNKB 1RWKB 1VS3A 1Y3KA 2FVPA 4WP9A 2DNKA 5EN1A 1PKUA 3KLIB 4QIFA 3CWJA 4JI6F 2HG4A 3CUNA 3NBPB 3J7YI 2MZ1A 4B3SJ 5D15A 1S48A 1RBAA 1DARA 3MPVA 1NSAA 2VC0A 5K5MA 1N0VC 2D9PA 5B0AA 1E6VB 4O3OA 1JNZB 5L9NA 1EETB 2HHWA 5KFPA 3CO9A 3H7HB 4J9VA 3A8JA 2C3YA 3F56A 3MM7A 3R1LA 2W4PA 1M5PC 4LSNA 2ATCB 4MMOA 3IFEA 2FLNA 2U2FA 2J9DE 1EHWA 2OAUA 3V2UC 2KJVA 3BEGB 3IS9B 4E0DA 3OL8A 2R7XA 1FKAF 4W90B 3BN4A 3O5TB 5GAGI 3AXMA 4WFZA 3DXSX 4ID5A 1KLNA 4ECYA 4K4TA 1AZSB 5CQGA 2VFUA 1HNZF 1U48A 4JV2A 4ETXA 4USTA 1FCAA 3GG1A 2R7QA 2RNEA 1FE0A 3TZXA 1F5BA 1YTYA 2BJEA 2YX7A 1RHKB 4FVMA 3VAGA 3QFWA 3LALA 5DRKA 4DR2J 5KFOA 3EPIA 5A8RB 3OLBA 3Q8VA 4U7CA 2A1BA 2XLIA 3DXBA 1TTHB 2HURA 3HHNB 1JLGB 2Z4PA 1VDHA 3TW0A 4J9LA 3HX9A 2CJYB 5J2NA 2YH1A 5L9XA 1T05A 3CJ8A 4JI3F 2VJVA 4DL4A 4EBDA 2E1MC 5D77A 3I56S 2LEBA 3ZXWA 5HAOA 2WTFA 4E2FB 4CLFA 2YX1A 2Q6CA 1GQEA 2BJ8A 2IDLA 3G96A 2OJ3A 1WC1A 2GIQA 5M2RA 6FD1A 3IBCB 3H40A 3NGUA 1PYTA 4AXIA 2XMMA 1BY9A 2VB6A 3JSRA 4J9UE 1H2TZ 2QMXA 3DHXA 1F9FA 1I5OB 3DNCA 2IVFB 1H6KX 4GMKA 1FFSB 3QO9A 3BQ2A 4B9TA 1HNVA 4DLGA 2LU2A 4PEOA 1VIXA 4CZCA 2MLZA 2N3LA 5J1EB 1UVJA 3RB6A 1Q95G 4DUTA 1LOUA 1HMVA 4O3QA 4KHPF 3BZQA 4JI5F 2G1HA 3ZTPA 5D6GA 2QMUB 4X62J 7FD1A 3IWNC 2UXBF 4M5JA 3D6TB 3MD1A 4DOZA 2ASLA 1AYEA 4NL5A 1HBOB 1OIAA 4HR2A 3MR7A 4BC7A 2HMIB 3I9ZA 3OTBA 2VG7A 4RNNA 3DDIA 1FXRA 1B0VA 1U6BA 2YWKA 1CJTA 3MECA 1LWCB 2Z2LA 4RW9B 3AT1B 4ES3A 3TZWA 4PZVA 2MKIA 1NK6A 1RTHB 3ILLA 2DH7A 1ZETA 3AOBA 2OEJA 5KG5A 3L7UA 2DPIA 3F73A 3C14A 1SB6A 3CGIA 5KFCA 1AW0A 4DU7A 3VAKA 3IBWA 2DR9A 3N6MA 2MY7A 2F8EX 4R5PA 2DR7A 1UZHA 5L1LA 2IBKA 2UZAA 2ZOGA 1FVSA 1WDDA 2RRBA 4X4NA 2GIRA 3HHLA 4DI6A 4J90A 2OD6A 1J5EF 5G4DA 1GX6A 4CDIA 3MR6A 4J9QA 4J9MA 4UW2A 2W7PA 3MMCA 1B7FA 4RW7A 5IXUA 4LF6J 4DCJB 3FBFA 1T02A 4MIBA 3OLAA 2H5EA 3BO3A 1LWXA 4AD6A 4Y2CA 4JI7F 3OTOF 2C2RA 3L3CA 2UXDF 1G3OA 3VVTA 1XMOJ 3N0VA 4MJKA 4NLSA 5CCLA 4LF4F 1S1XB 1A9NB 1HYSA 4ZMMA 2A2CA 3LPYA 2B7BB 3MR3A 3J81U 3C66A 2JRSA 5DDQC 5F0WA 5DM7Q 4QIVA 5AXKA 3R6GB 4PPDA 3TZZA 1Q8KA 1FERA 2MGZA 3Q22A 4NA3A 2UXCJ 2DRBA 2RT3A 4RW6B 4YDDB 2B51A 4DG1B 4M5HA 5CHCB 1CC7A 2XCAA 5HLFB 3W9HA 3LTOA 4Z2XA 1KVKA 2RQKA 2VU5A 4F4ZA 2MB0B 5ETQA 5U47A 3CXCR 5HANA 5GMEA 1TFWA 4GKJJ 4WU3A 1OQ6A 1Q8LA 5EX0A 4OI2A 2HRUA 4L3KA 2CPXA 1LXJA 2Q6BA 2HWIA 3RBDA 3BF4A 3ZNJ1 5JUMA 3P6YC 1YJNS 2YWWA 3N5FA 3FBCA 4GO5X 2XULA 1RTDB 5JJBA 1D3WA 5A6PA 2XSJA 1NHUA 4PXBA 4NEZA 1R6YA 1KLMA 3RBXA 1F0XA 3ILOA 2CJ9A 1CS4A 3GU0A 2CRLA 3S8SA 2PDAA 4MIAA 2GFFA 2F5GA 1MNEA 1GXUA 2Y0SD 3T5KA 3OSNA 4JI2J 3PHEA 2CQHA 4OV1A 4OI1A 2C42A 1S4FA 3HZGA 4IG0B 4DL3A 3KJFB 2RDJA 5FJ4A 1U6FA 2HK2A 5LSRA 3ZTOA 2GGPA 5BR8J 1C0UB 1WJ9A 1HQEA 2JC1A 3PEHA 3FMBA 2BE2A 5E41A 4QWAA 5MLCV 3KHRA 3KLHB 1X4CA 2XS7A 4A47A 2HWHA 2VIHA 1L3SA 3H5SA 4AE5A 3OR1A 3DRYA 1A6LA 1DTTB 3QIPA 4DBQA 2VASA 3I32A 3ZTSA 4C8YA 3ETOA 4ES2A 1N5VA 3BGOP 4DS4A 1K8AT 2Y1IA 3RAMA 2C1EB 3GYGA 5J2QA 2EFVA 4WFXA 1S1TA 3AOCA 4NPOA 4PXDA 4MKYA 2QEXS 1VBZA 1PO6A 2CJKA 3T6JA 4Q2MA 2Q66A 3SBMA 5DO2A 4ZCIA 3EZ5A 1N6QB 4OYPA 2P9EA 2C3UA 1ZM4A 4LSZB 3WBZA 3THVA 2AU0A 1CC8A 2ZH8A 1FRHA 2RIJA 1Y00A 5D0HA 4DF4A 1YJWS 2PN6A 3I0RB 5DQGA 2ZKTA 2HFNA 3MUVP 4IQXA 3HSGA 2N7YA 4HHUA 1LFWA 4GVBB 5ETVA 1EAYC 2V8DA 3CCTA 4DL0C 2NXNA 4DV4J 1RCOB 3IMQJ 2XB2D 3S1TA 1F5CA 1BMQB 4X4VA 5J1PA 2DNQA 1HBNA 3KLEB 1IBMF 2GHWA 1RT1B 2BM1A 2XYGB 5K8NA 2NPFA 3RRHA 3DI6A 1L3VA 1RQ0A 3V6DB 3FZBA 1DY3A 1RLDA 2UUAJ 2E1AA 4P2XA 2W9CA 3AJDA 4YY3F 3HSJA 4NEYA 3PR5B 4YB5A 1BQXA 1HW8A 1YRXA 1N32J 2IMOA 4ZVOB 4YB6A 5ETPA 4LFBF 4JUZA 5ETLA 4M5MA 3VTIA 3PCOB 2FLLA 4NLVA 2UP1A 5SZTA 1KQGB 2ZDPA 4F7VA 3M7VA 2MKKA 1QLNA 3IWLA 1VBYA 2VPWB 2JHEA 4N56A 1SJFA 2UUCJ 3TWZA 4B9MA 4P72A 3KLFA 4IUFA 1Y10A 3D67A 1AXQA 5B7WA 4NCGB 3PY8A 3SFGA 2FLOA 2V4QA 3CCLS 1N33J 3R5BA 1KS2A 2V63A 4DUZF 2B43A 3KKFA 1SH2A 1MROA 4NYPA 3JXOA 4YUDA 2NS1B 2ACYA 3CW2C 4YB7A 1S0NA 2DNZA 5GMKa 4EZ6A 5E5NA 4LREA 4A8MP 1T9YA 3AJ1A 3BSAA 1EJ7L 3GV7B 3SQGB 3I4HX 1R8HA 3J81Y 2YKQA 3A8EA 3T6BA 1PYSB 1NJYA 5A6WA 4ZJLA 3CJ0A 4KV8A 1VOMA 4HDHA 4PPZA 3ENWA 5CYMA 2LKZA 3CEDA 4I69A 3ZTQA 1GT8A 3VQSA 2LMIA 4K4VA 1IKYB 3C15B 1FWKA 4OHZA 3CCZA 1HQUA 1WHWA 5A8WA 5K9FA 1LW2A 1ZA1B 2ZVIA 4EEYA 3PJXA 4WXOA 1TKZB 1UVIA 5DG7A 3PRBA 4XK8C 5CCMA 4QYZK 3J81j 1C4AA 3G6XA 3PX4A 4OZ1A 3VAFA 2K1RA 4F25A 2AJ2A 2BZ2A 3MR5A 1NDPA 2GJIA 3R2CJ 4XPCA 3CJTA 4FF3A 1MW7A 3DMJB 1G2EA 3EDQB 1IR1A 4RW4B 3G6ES 1HNWJ 1GAOA 4G1PA 4U6PA 3R1HA 3AAWB 3AQPA 4DX7A 5D8HB 4ELVA 2IMWP 1Q82T 1U2CA 4ALZA 3OL9A 3PG9A 4NLXA 3JAMU 2EW9A 1RAIB 3AD8C 1N52B 2NXJA 3GFZA 1JLEB 2IM1A 1OMSA 2BE7D 5KT2A 2YNGB 1TL7B 3M05A 1WF2A 3W2WB 2WBRA 1C1BA 1M5OC 2W1BA 5F8MA 2E9TA 3IWXA 1RJJA 1TL1A 3NGKA 3I96A 3W7BA 1U26A 2FHOB 3M8YA 3MMJA 4DR6F 1WTBA 1SUQB 4BWJA 5E3QA 1P1LA 2AP6A 3OPKA 3TAMB 5C7PA 1PJ6A 1S1WB 2I38A 3PX6A 2VODA 2N82B 2J76E 1VRUA 2CFXA 1WC3A 1J5OB 1YBAA 3KFWX 1YKWA 1JLBA 4N77A 2KH9A 3FCWA 5EWFA 4F4KA 1JLAA 1RHMB 1YWXA 3KK1B 3H5XA 3OFEA 3RR8A 4OI6A 4FF4A 1IN0A 5IM0B 4P75A 2ZUGA 1SQFA 2ZJPQ 1JMTA 3J7YU 3M30A 4TU9A 4EBCA 3OUYA 2CQBA 1NK8A 3OVBA 1S6QA 5T7LA 2LVWA 4G6VB 4R25A 1SL1A 4WYWA 4DQSA 4CT9A 2NR0A 1V3SA 4FYDA 4N5SA 3NGTA 2NPIA 2V67A 3OTDA 3QLHB 1G6BA 2K7JA 4K2JA 3GTYX 1VQLS 1U1QA 4UF4A 1IWGA 5IC6B 2J9DA 4ZCLA 4DSIA 1RWNB 2OD4A 3IRWP 1RGVA 1LEOA 2HLTA 1RAAB 2V8HA 4UUWA 3IR6B 1K1SA 2ROPA 1J2VA 1H3DA 1X0PA 3PW2A 5DQIA 3KDOA 2YQ3A 1Y5LB 4F0MA 5F9NA 4JYAF 4YR2A 2CKWA 4C3LA 1CPZA 5B0DA 2G0IA 3UDCA 4Y65A 3P49B 3G8SA 5KTQA 2B9XA 3CCVS 4R0JA 3MMBB 3PVXA 3MMAA 2WVCA 2RUSA 3C8YA 4DV1J 3M1VA 4CLSA 2OSQA 5BYRA 4DN9A 5DG8A 4IH5A 3MCMA 3M9NB 4A8QA 2E1RA 3M6WA 1IKXA 1CJUB 4LFCF 3CJKA 1UWAA 2CPJA 2VA3A 3PIPQ 1F9HA 3ET6A 3CULA 5D78A 3QAUA 2CPFA 2MSTA 4YHHJ 3SFUA 2FPHX 3D4JA 1S6OA 2CPDA 4BBYA 3EGWB 2HVDA 2B8QA 1N5TA 2QLJB 3TRGA 5D0RA 3M2VA 3LANA 4FBTA 2DVIA 4PG7A 4B3TF 3KUHA 1VC5A 2PFFB 3MM6B 2CQ0A 4YQWA 3PKYA 2X3DA 3R7NB 1KVJA 3IAS9 1QUPA 2LFVA 2VFRA 1S9FA 2DXFA 4C8OA 1YGYA 2UVUA 2W2MP 4IRKA 3MM9B 3EZOA 5KG3A 4ZA1A 1CG2A 5HATA 3ZZ0A 2AGOA 1SH0A 1UFKA 1XNRF 3QZ8A 3R97A 2K7KA 1Y0HA 2RKIA 1AFIA 4LIWA 2Q3PA 3RAQA 5I3PA 1HR0F 3TA0A 1S9GA 2XCPA 3J7AN 5CYQA 2V2KA 1O0PA 2DYAA 1ROFA 4LRAA 3TJAA 2O66A 4W92B 2ZC4A 5BYSA 1G7CB 4AUKA 3G8QA 3DLEB 3HP6A 1UVLA 3QYYA 1VLYA 3TEHB 3AB2B 1SJ1A 4UOGA 3KG1A 5KFXA 2WHOA 4NI2A 3PEJA 2YNHB 5JXSA 1H74A 1UMJA 2JX2A 4X2BA 1IR2A 5CAAA 3ENAA 2DGQA 2DXEA 3CJ4A 4WIIA 3MPWA 3N9UC 1QE1A 1QVFR 2E5HA 5CH7B 2UVWA 2QX0A 1NKCA 3MEEB 2CWXA 2KDOA 2OPSA 2HVHA 2BRKA 3BN7A 3OJSA 1ZAWA 1ZM2A 4G1QA 3G71S 2E66A 4J9KA 3LP1A 2OPPA 5I42A 5IFMA 1M5VC 2A0FB 5J2MA 2DISA 4A8YA 3DRPB 4U95A 1UA0A 1BD6A 3PW7A 3TQ1A 4LBIA 4IFVA 1TV6B 1E6YB 3POTA 2VG5A 3RW6A 5FLXU 3CDUA 4CH1A 1RTJB 4KTQA 4B3SF 1DQAA 1VQ9S 4NXMJ 2QLBB 3HSDA 4LRFA 1H2VZ 3SZ2A 4FXVA 3SDEB 5JVGQ 1QM9A 4DV0F 2MKJA 1F3FA 3L09A 3VVUA 4P2FA 4PQAA 3D5MA 4KT0C 5MAOA 4L74A 3R5AA 1L3KA 2ZHAA 1OO0B 2W8KA 2R7SA 1IKVB 3FSXA 1KHVA 4OYOA 4U8YA 3HHEA 2CQ2A 5C24B 1KWMA 1HHSA 2H54B 3N4WA 2R8IA 1VQMS 3CTRA 1FRMA 1HNXJ 3PFEA 5BJRA 2R4FA 2XC9A 2CZ9A 1TVRA 1YSJA 1YJVA 2WW8A 2GZOA 2JJ4D 3A8KA 1DLOB 4ZPCA 3ETMA 3CCMS 1PGZA 5I3UB 1JXEA 1X4FA 4RX6A 2J6SA 4WIQA 2OPQB 2VOOA 2QLWA 3FK4A 3GG0A 1JLCB 4DX8H 4JI8J 4Z7CA 1M5KC 2EFGA 2CZ4A 1NMEB 3WHIA 1BXNA 3P96A 1URNA 4DX5A 2W2OP 1I94J 3MWBA 2ZUAA 1YIJS 1PG5B 4RW8A 1PAUB 5CA5A 5B09A 1DQ8A 4MYUA 2ZJRQ 1IKWB 3F41A 2NREA 3IG1A 3MM5A 5KT7A 4NLYA 4PKDB 5F3ZA 2MPUA 4CH0S 3NNHA 3KJQB 2YKMB 1TL3A 3DRXA 1KEKA 4F3MA 4LF8F 3UN2A 3TR5A 2FHKA 4MTPA 1P8GA 4TU7A 3FFIB 1WC6A 4TY9A 5A8KB 2AGQA 4C97A 1FD8A 1T03B 5HSPA 3ZZZA 3VCDA 4FYWB 1B4SA 5HP1A 1MN7A 3T1HJ 3R7BB 2VQEJ 1O6XA 4NX9A 4ZP8A 1KOOA 3MPUB 1RWPB 3ELHA 4O44A 3HT3A 3QQCD 4XDDA 2ZNZA 5KOXA 4X66F 3N6LA 4NLTA 5LM7E 1PC5A 5G0RB 2COLA 2BJ1A 5C25B 3AHPA 1XJWB 2V4JB 3AFGA 1TK5A 3M9OB 4B3MF 2UV8A 4LSLA 1S6PA 3QT5A 2VUGA 2YPYA 4RZRA 3LH2S 3MEGA 4GO7X 3Q23A 1BLUA 2WB4A 2QO3A 4KPCA 4M5DA 2I1RA 4UOHA 3RZAA 3VQTA 1N36J 3MTJA 2U1AA 5IT4A 3V81B 1LK7A 4ZPDA 5FD1A 2D3ZA 3SXLA 3H25A 4PG6A 1XBWA 1KC8T 1Q7LB 1JIHA 2BM0A 5K8PA 1RUSA 2IRYA 3NRBA 4H4KC 4ED0A 2Z8QA 4KGMA 1MN9A 2P5VA 4P10A 2DIUA 2BDPA 4M94A 4P9SA 4CM2A 3MM7B 2GCFA 4HT7A 4NXNF 4LSNB 2I6WA 2OGUA 4ZVQB 4AL5A 4IO9Q 2KVIA 2KO1A 3B82A 5EWEA 1KD1T 1P27B 4QZVB 4ZVUB 1UCNA 1FDDA 4LF9F 2PEBA 2DY9A 4F2RA 2IM2A 4ID5B 3UCUP 1LKZA 1SV5A 4I1TA 1W2BR 2ZBQA 2QL9B 4ICLA 5ETOA 2ERRA 4HH0A 1HQ2A 4OYBA 2ZZNA 4URSA 5L1IA 5KFIA 4JBCA 1UFLA 3ICLA 4GVLA 2DGTA 5ETRA 3PJ9A 1U24A 2IJNA 1NK0A 3KYLA 2MZJA 2IAJA 1HNIA 1DJ0A 2H4WB 1HHQA 1TAQA 2AV5A 2V9KA 5J2NB 2FHJA 2AQ4A 1T05B 2KXNB 5AJ3F 5HBMA 1AA1B 2HGNA 4PAAA 1QJHA 3EGNA 3SI8A 5KFRA 3PO4A 2BQUA 2GAGC 3UE2A 2YWEA 1T8EA 4F4YA 4CH7A 5KT3A 4UZBA 4ZPTR 4QWBA 8ATCB 3TAPA 1ZAXA 3CJ3A 4L76A 4M5KA 2OMLA 5FLXY 1EP4A 2B5JA 5D4LA 2Y8WA 4WKYA 4ED5A 4CLWA 1UKUA 1FESA 3QO9B 3L4BC 1K47A 3K89A 2DNPA 1HNVB 4HACA 5GVQA 3M8SA 3G8TA 3S7RA 3JSYA 2CNLB 2BYCA 5GADI 2HIQA 3UD4P 2XMKA 2KHDA 3FBBA 1HMVB 2MZRA 2RAQA 3RBEA 2IFXA 3DGPA 3BH6B 4ZCKA 2HNDA 3KUEA 2XY5A 4WE1A 1UVNA 4OYIA 4KO0B 2AEMA 3MGJA 2YNFA 4NZ0A 4H54A 1U45A 1R8PA 3JS9A 1XIQA 3PO5A 2VG7B 4DPYA 4DN0A 5BR8F 1FFGB 4C98A 1CJTB 3MECB 3CVKA 3DLGA 2OTJS 4TYAA 5CD4H 1PJ5A 2MKHA 3I5BA 1JJ4A 4WKRA 2UUBF 1YDLA 2OKQA 2GJFA 4NCBA 1NEEA 1CBKA 2CVIA 3A3PB 5DJBA 2CUYA 2FYXA 5KFZA 4NRTA 1ZPWX 4O4RA 2RQ4A 2XS5A 8AT1B 1EB0A 4AQYJ 2PGCA 3GYNA 4ZPWR 2JFDA 1Z4UA 5GAHI 4ZPVR 4Q45A 2XLJA 4R5PB 3RGIA 4YB1P 3C16A 2SXLA 4NLOA 3H8YA 3QWPA 4X4SA 2L9DA 2D7SA 1Q78A 3HZEA 2ROGA 5C2GA 3HHLB 3UN3A 4WXWA 4OHXA 2BVZA 5DZ6A 1FDNA 2MZSA 3D7SB 3T1AA 5A0YA 3A13A 1HARA 1OY6A 3H5YA 4CCHA 3UWTA 2WB1D 1TKXA 3MMCB 1ZH5A 2PMWA 1X8DA 4RW7B 5LL6d 3T1YF 2H65B 4DV5J 2EFPA 2W2PP 2R3VA 3N79A 1V5IB 7FDRA 5KFLA 2XS2A 2VHGA 3LF0A 4H4OA 3I4PA 3Q8QB 1H2UX 3NCPA 2HNZA 1HYSB 1F9EB 2OSRA 1LW0A 3UCGA 1CEZA 2FVSA 1HI0P 3H0PA 2F8HA 2YWFA 5F8GA 2HAIA 2EK1A 4PG8A 3OXGA 1VMBA 1C0TA 3CDWA 4DV4F 1C2PA 1ACMB 3ADAC 2MGZB 4FVCA 4IQMA 4YEAA 4Q0BA 2KXFA 4UUXA 4CO2A 3QSIA 1R8BA 3Q8SB 2UV8G 2W25A 1OSCA 4DR7F 4NA2A 5E33A 1X5TA 1Y5IB 1L3UA 3ZZRA 5LOQA 3DOMA 2CADA 1D0EA 1VQ8S 1RSCA 2PE8A 4CLZA 1WWHA 3Q86A 4TN2A 1RWUA 4DZ6A 3HXMA 4BS2A 3HVTA 5L39A 2EI5A 3BYRA 4A8SA 2V50A 4ZOSA 4C6AA 4DCOB 2Y1JA 2QJ3A 1O51A 3X3UA 4IRCA 3K8WA 2XSJB 2HVEA 1NZ8A 4KPYA 2DJWA 3GJTB 3Q8YA 4HVZA 1K0TA 3ISND 3B6BA 2UUCF 3IA0A 3WX8A 2B4UA 1RTIA 4EFAC 1KLMB 4HYKA 2KHCA 1CS4B 4FBUA 1FKPA 2R7TA 1N33F 1UJ5A 3I5AA 1X9SA 3KG4A 3V5RA 5M2PA 3WX4A 3TA1A 3TUZC 4R8UA 1ZZNA 2C3OA 3UVJA 3OTEA 4I7FA 2MTLA 3PRDA 4L75A 2C22A 3OJUA 3BB5A 1KQSR 2E5LF 3CJRA 3P4UB 1SIZA 1SC4B 2NYHA 1PJ7A 2VA2A 4ECVA 4NLUA 3BBCA 3IBFB 1QSLA 1OJ4A 5KFUA 4ZVPB 3QFHA 2GGPB 2VQFJ 3MAHA 2DKOB 3KOAA 1HQEB 1YJ9S 4C11A 2KI2A 2CXEA 3C6TA 1JNRB 1TP7A 2BE2B 3MCOA 5D0EA 4X4OA 2MQOA 2QSWA 2E5GA 3VGUA 3QJLA 4IH6A 3OR1B 1FTRA 1Z2LA 3QIPB 4USKA 3LPEA 3TP2A 2I0XA 4AFFA 2MJUA 2V8GA 1CJKA 4LF7F 2AKWB 3GJSB 3Q8PB 3P5BP 4ZP7A 5KFMA 2PMHA 4V19X 5LT5A 2CA9A 4WK1A 2XZDB 5J2QB 2HEKA 2KM8C 2V4RA 3O8WA 2M3DA 4Y2MA 4LVNP 3AY0A 1S1TB 4BCAA 3PRVA 3UFCX 3P8BB 4OLPA 1FX4A 4I56A 1SI9A 3UR0A 5EWGA 2YNIA 2XWXA 4NASA 2B4OA 2UUTA 2MQNA 4GKKJ 1HNWF 2DO0A 3OVSA 4K5SA 1S4EA 2JVRA 3ENVA 1B64A 2N4DA 4RUBA 2E29A 3NCRA 3IRXA 3KLGA 3KWMA 4KGKA 1N56A 4RL1A 2J9CA 4PXCA 4A48A 2XHCA 2ZC3A 4FF1A 1VLOA 3G2XA 4LRDA 3ENQA 1FT8A 1ZM3A 2LXIA 1HBNB 5E7OB 2JDJA 3VF0B 1OSDA 3DI6B 2ASDA 3R9LA 2MZTA 1SC6A 4WFYA 3W64A 4LFAJ 2P8IA 4J5OA 2W9CB 5F3TA 4ZITA 2FQQB 3CC4S 5KFEA 4BHQA 3KNAA 2HGLA 3BGLA 1UP1A 4NZ6A 2Q1LA 4QBUA 2BOPA 2DB1A 4DR4F 4N41A 4O3RA 3SSRA 2NSBA 1U6ZA 2A3JA 3VAJA 3NGRA 4A8KA 4ED2A 4OX9J 3P3DA 1WEZA 3CPWR 3KLFB 4MIWA 4ZVEA 3THTA 1WKKA 2DITA 2P9CA 3GFXA 1WKLA 3M9MB 1NDKA 4NCAA 1C1CA 3V6KA 2NYIA 1KP6A 2YQ0A 1WHYA 1NJZA 3JQKA 2D3OR 2RH3A 1MROB 1KKHA 1G4CA 1VQKS 1JB0C 4L73A 2J0WA 1JJCB 2RU9A 1SQEA 1XMQJ 4MK7A 2ZZTA 2WONA 4FKXA 3I6PA 5HJXA 1ZS6A 3KG0A 3DCAA 5D0GA 2PIIA 3LGMA 2OO4A 5CYJA 1NCLA 3HHLD 5KFKA 3JTOA 4B08A 2H9ZA 5T14A 1RADB 5LSOA 2HHUA 1QTNB 3NNCA 1RHJB 2RE1A 4K4XA 1G1XA 2O5DA 2OELA 3RR7A 2HZVA 4L6V3 2DR8A 3UDVA 2CQDA 3ZNUA 1GX5A 1D8ZA 3TJ8A 1OYEA 5GMDA 3K57A 2MQLA 2AX0A 4A8OA 3NG8A 4DQPA 2WVFA 3PX0A 1HQUB 2M8HA 4RPFA 3RB3A 1LW2B 1GMWD 2Z58B 2DPJA 2OEMA 4USHA 1FVQA 1GMUA 1S72S 3U27A 2QT7A 2XI3A 4ZLNA 3TAQA 1S0OA 3H2UB 2DGUA 1EARA 1HNZJ 1P9QC 3H98A 3KXDA 2K1RB 4LQ3A 4PR6A 4QWCA 4J9PA 1TMMA 2BMBA 2CQ4A 3HVAA 4OFZA 2M0GB 3KK2A 3SSQA 4HL9A 2V2ZA 2ZFHA 2BANA 5HLFA 1SL0A 2Z56B 2FY1A 2X1AA 3I9V9 4JI3J 2CQ3A 1RWVB 2J6TA 3PNIA 2CQGA 3BSOA 3NGDA 1NLKL 4B3RF 4CO0A 2HSEB 4CLKA 1MU2A 5DGBA 2MHNA 4OYXA 2X51A 1C1BB 1VJQA 4X64F 4ZIWA 1TL1B 4ATNA 3FCVA 2H4YB 2KTQA 2YKOA 5LMNF 3HHKA 2QA1A 3ZTRA 2R7VA 4N76A 4J9RA 2WVDA 3KJVB 5B08A 4C0BA 5HK4A 1Q8IA 1JJHA 3VGTA 3CF5Q 2Z0GA 1VRUB 4D3GA 4KHPJ 4JI5J 1ZOTA 1JLBB 3RB0A 2WVEA 3X1LB 1HWUA 4ZPAA 4TLRA 4OHYA 1JLAB 2W4CA 2YH0A 3CIZA 1Z1ZA 5HI7A 1I6JA 4WTOB 3FEXB 1XK8A 2ACMA 4IG0A 3AH6A 2M7SA 1Y7PA 1DTQA 5L8RC 4KHMA 1U8SA 1M1GA 1JLFA 1CJVA 3UNYA 3GONA 3M30B 2GV1A 1VK3A 3OUYB 1RB0A 3L7OA 3PR4A 5HVGA 4ZJQA 5KFDA 3HFKA 1PSDA 4N8NA 1S6QB 5T7LB 1NAQA 3PW0A 3O3LA 3I0SA 3BREA 3D6HB 4CYUA 4NLGA 1S57A 3FDSA 2V6AA 4ANEA 4O3SA 1V3RA 1S99A 3GIIA 4ZK7M 3IP0A 4HTIA 3PM9A 1IBLF 3OR2A 3PYDA 2KZMA 4K4SA 1NHKL 2B9EA 2P6SA 4PCQA 1IBKF 1F6TA 5B0FA 2FY8A 3W5XA 3M32A 3HJFA 1OYDA 4MKAA 1WF1A 3SCLE 5K14A 2NXUA 1UWBA 2GO8A 2Z2YB 5HQMA 1IWAA 4MK8A 1VQYA 1WG5A 1VK8A 1S1VA 1VQ4S 3QATA 1I1GA 4ZN3A 4WP8A 3QPIA 4N47A 1HBMA 5AXNA 4LF2A 1SJQA 5C2CA 3BO4A 3FRYA 1RA6A 4X4RA 2HQDA 5H1SV 3MMAB 1P6TA 5I4MA 4JI7J 4KGZB 3OTOJ 2UXDJ 3M1VB 2BXJA 2XMWA 2YWGA 1FKOA 2HBZB 4LF4J 4YN3B 1T0TV 3KUGA 3AA9A 1FJ7A 1FTCA 3VAHA 4DQQA 1IKXB 4IKAA 2ZWPA 3CJKB 1WD6A 2DHAA 2GIFA 2DNYA 4OI4A 4JI4F 5KT5A 3ET6B 2QTWA 2WOMA 3K59A 2MMYA 2AEFA 5A2QY 2ZBRA 3AB4B 3CJ5A 3M2VB 1PIEA 3OHAA 4C4WA 2B6AA 3ZZYA 4G3IA 4Q44A 4OJHA 1R0CB 2J7WA 4DPUA 2ADCA 5KG4A 1TL5A 1HPZA 4CLLA 1S1UA 2ZM6F 3GYXB 1FRKA 1T95A 1RBLA 1FEEA 1DQ9A 1UEVA 3UD3P 3M8WA 4PWWA 5GADU 4RUHA 4P71A 2RKIB 3M2RA 4IDKA 5B0GA 5F0UA 3VWSA 1WHXA 2IRXA 3VGVA 4EGLA 5CZXA 2KYXA 1S9GB 1OY8A 3KK3A 5CYQB 1Y5NB 1RZMA 4WK3A 2VC1A 3HFZB 4QIWD 3EXYA 3EVOA 4OZ3A 1V9OA 2RILA 1FJCA 2ZWOA 4G1IA 3LGHA 4IYQA 2N3OA 4H4MA 1NU4A 4NI2B 3EGZA 4O23A 1FXDA 1TK8A 3JQJA 4DU8A 1SJRA 3M8QA 3JQMA 2JEGA 2RHQB 1TU0B 3CSKA 3HLUA 3DLKA 4HI1A 3K2YA 4ZS6A 4A8FA 1QE1B 4A8XA 2HIYA 1WF0A 4HTJA 4FZVA 1H98A 2OPSB 1FNOA 3MEDA 2LQBA 3BDPA 3Q83A 3B78A 2CJAA 3EJMA 4G1QB 2F8MA 3LP1B 3J7A1 2OIHA 3A8IA 2OPPB 2CZVC 5I42B 3C46A 1HWKA 2Z2ZA 2LU1A 1EIYB 3CD7A 1SPBP 2VBXA 5J2MB 3I31A 3K0JA 4IFVB 2XO6A 4BC9A 3POTB 2VG5B 1NJIT 3G6VA 1WEXA 3CC7S 2J8SA 2ZVSA 2PSZA 1NDLA 3RB4A 1RYRA 3PACA 2MLYA 4USUA 3EICA 2DIVA 4GRSA 2NXCA 4DF8A 1VCTA 1BQNA 1N34J 2KFYA 2D3UA 3MAQA 1GXTA 4ELUA 4WBFA 1SQGA 2HS4A 4DUYJ 4Y3CA 3O44A 2GNKA 2DGWA 1AT1B 1FK9A 2EC0A 4PYAA 2BJ3A 2DT9A 2KRRA 3PW5A 5L38A 4C3MA 4WWSA 2GA7A 5KOWA 1RT6A 2FZCB 4RW4A 1NBEB 1NJWA 4ZIVA 2ZE2A 4OJGA 3NOGA 1R27B 1TVRB 3AXKA 2FD2A 2W9BA 2RSQA 4MK9A 3V4MA 1GMWA 3HKWA 3BYPA 1YHQS 4RLEA 3M8RA 1HI1A 4DL6A 3ITHA 3GIKA 3CD6S 1WDTA 1FE4A 2K3IA 2R9LA 3D0HE 3MDFA 2CJBA 4U8VA 4EK2A 3TNVA 1RACB 2F40A 2V2QA 4DV7F 3D0IE 5LMUF 3P45B 4UY8T 1SXLA 1T9XA 3BQ0A 3PIOQ 2XO7A 1K44A 1Q5VA 4ERDA 2YBVA 4USIA 4RW8B 1Y3JA 2N4CA 2B4VA 4K0KJ 2J8AA 1XC9A 2OH2A 3W61A 2OHDA 3TAMA 4YY3J 2J7KA 2HFVA 3IG1B 3LUYA 4OIXA 3MM5B 2EBGA 1QUVA 1N5YA 3LP2A 3UN5A 3QGIA 1TL3B 3BBBA 4X84A 3IO1A 4LFBJ 2FZKB 3DOLA 1YG0A 3CCES 4ZVRB 4BWMA 2JSXA 2FB0A 4RU2A 4FNIA 3B54A 2FC9A 2VKZG 3GR1A 4DMZA 1U1NA 1L3TA 3Q89A 1XNQJ 4DV3J 2YY3A 2PC6A 2XM3A 5HP1B 1UPMB 4DUZJ 2ZH7A 3WZ0A 4WP3A 4M5IA 4RNOA 2QLXA 4O44B 2MQQA 2CYYA 2ZNYA 1A7GE 3AJ2A 3DLHA 3JSBA 3D9BA 1OS5A 5KFGA 4LSLB 3PTWA 4LF1A 2Y0BB 1R7IA 1S6PB 2BQ3A 4ECXA 3MEGB 3QGHA 1KTVA 2GX8A 3V6HA 2PI5A 1S0MA 4USWA 4M5DB 1U1MA 2F63A 2HQIA 2AD9A 3IGNA 2LECA 2HFUA 3D3BJ 4EBEA 3H2LA 1U25A 2YXLA 3OW2R 2Z57B 5L1KA 2K06A 3WIVA 2VL1A 5SUHA 2KZZA 1WC5A 2PFDA 4RKUC 3FC9A 3QWUA 2RF2B 3DGVA 4J9SA 3PZPA 4ID8A 1X7VA 3JTNA 3SYZA 4ECQA 3B4DA 3K58A 2BBEA 1EZZB 1Y9OA 2CDQA 1WKJA 2FJVA 3M2UA 1B7YB 1RBOB 3V4IA 1M1KT 4DJBA 5EX3A 3I55S 3S6EA 1NHVA 3NS6A 2R8GA 1UW9A 2EPIA 2B8PA 1QD1A 1VRTA 1SV5B 3CE8A 3LAKA 3KHLA 3H59A 5DZ7A 2VBYA 4ICLB 3EMTA 2D1CA 1MMLA 2OFHX 4CTAA 2NZCA 5DETA 4I4BA 5LSLA 4LR7A 2I9SA 2E5JA 4QU7A 2MJNA 4JB8B 5JMNA 4ZVFA 3PYFA 2WCXA 2IAJB 1HNIB 2V94A 1SKUB 4W98A 3BM7A 3TO8A 2WZ1A 4DV6F 4GC6A 1BC6A 5HBMB 1IJFB 3S01A 2WSFC 2I5JA 3MPYA 3FZ2A 2AW0A 2GQQA 2DH8A 3JYTA 1OWXA 3CCSS 4F4WA 3H42A 1RT3A 2HBRB 1WORA 3SQOP 4RU9A 2C3PA 1N4LA 2DR5A 2DHGA 3U1LA 2RS2A 2B5JB 1TKTA 1O8BA 1AB8A 3BGUA 2M88A 3JB9k 2V8PA 4ZKAA 4JOUA 4HACB 2J0XA 3CB4A 4NMLA 1UAWA 2LLZA 2VPZB 5DS7A 2MQ8A 2AT1B 3J7ZT 2CVEA 3GQCA 2HNDB 4C0HA 4ECTA 4NYZA 5C5JA 2HQCA 2GQCA 4WE1B 5IV3A 2CQIA 2ILYA 4QIEA 3QRQA 4DR5J 2V5HG 1CULA 2JLGA 1A0OB 2YNFB 2RRAA 4KH0B 4QJVA 4WJBA 2RRNA 2H5JB 4DFJA 2ALZA 2VQFF 2RJZA 4JP8A 4TY8A 3D2WA 4EYIB 2M9KA 3CMQA 3DLGB 5IWAF 2IBOA 4DR3F 4AL6A 2XNRA 2FUG9 1B99A 2XYHB 3CMAS 2C2KB 2G1DA 1UETA 4U67Q 3ZZUA 1I51B 1X60A 4F26A 2ZH5A 4JYAJ 1R8AA 4IR1A 2QFJA 4J91A 4KIAA 4PG4A 4U7UK 3CIMA 3NWRA 5HMZA 4KQZA 3VAIA 2OPRA 4UQTA 3C16B 2PD1A 3HMJG 2V0NA 3OBIA 3R3TA 1X0FA 1D1UA 1REVA 1YJUA 3G87A 2QL5B 1N88A 4WFNQ 4QYRA 2A18A 3EVWA 1Z2ZA 2F3JA 2LDIA 2XZTB 3T5JA 1NNDA 3DM2A 5A0YB 1P1TA 1HWLA 1NH8A 5B0EA 3DOKA 3GJRB 1TKXB 3K5MA 3EX7B 4LFCJ 4P7VA 4GKKF 3H20A 1SKWA 3AA8A 1KONA 3OSPA 2Y8YA 2E1PA 2MQMA 2IM3A 4F04B 3GSIA 4NYOA 4Y0FA 2Z2MA 4NLRA 1JKHA 4H4OB 1SC1B 1WNEA 5E2QA 2QA4G 2KT5A 2J9EA 4CP5A 4RUAA 1LW0B 3LP0A 1N48A 4B3TJ 2CQCA 1XQIA 2BABA 1L5UA 5E3AA 1JQGA 3QAEA 3ZC4A 4UZCA 3PJWA 1C0TB 1MSWD 1T7PA 3Q2TC 1Y4ZB 1Q5YA 1X4HA 4WZMA 2ZH9A 2YKNA 2JC0A 2H51B 4Q0BB 3TEGA 3MI7X 3W8PA 1BGXT 2W01A 4CO5A 1XNRJ 1TL4A 1OPIA 1GK8A 1WOOA 4IRDA 1HR0J 3MZIA 2A10A 3DOMB 1EKSA 3CD5A 1M1HA 4F02A 4F2SA 3SV3A 1QY7A 4DSEA 4HHHA 1YJTA 3K8VA 4WFBQ 4G65A 2MSSA 3HVTB 4LMZA 3MXHP 2B9YA 1VYAA 4NA1A 3FSYA 4ANCA 4KY3A 3QT7A 1X4EA 3BKFA 3D1OA 3N28A 4A46A 1YX2A 2Q79A 3G82A 2L9NA 4P7TA 1DURA 2HZAA 1RTIB 2DD8S 1NPRA 1F3VA 5F8JA 2YTCA 2HBQB 3FRZA 1FKPB 2C2DA 3A4TA 1GTHA 1IQZA 3CCWA 5KFJA 3JSMA 3CDEA 2ZKUA 1P9YA 3KHHA 1FJGF 3DRSA 1FD2A 1R0BG 5H9EJ 5H9FJ 3UVJB 3VV2B 2MXYA 4I7FB 5HL7Q 4TKTA 2E44A 2KJWA 3T3FA 3W8GA 2E5IA 3LWMA 4TXSA 1RK8A 1CQNA 1XMQF 1RWMB 3OFGA 2QRRA 2NLWA 4YP3A 3V81A 1HKAA 3TANA 4PUOB 1VGYA 4ZVHA 4DL5A 1IVZA 1H72C 3BPSP 4DPWA 2FC8A 3KMQA 3QMQA 3TUPA 4C11B 3J80U 5GAGU 3C6TB 4DV0J 3OTCA 1R8CA 4ED7A 4C7QA 4EO8A 1BE4A 4DSJA 4URGA 2BRLA 3PV8A 4AYBD 2M2BA 3M8PA 3OL6A 4UY85 2D3O1 2L48A 5GAEI 2QYCA 1HLWA 4OX7A 1CJKB 1BWEA 4CLYA 2VJUA 2XLKA 4M5GA 1TQLA 1RT2A 3KDNA 2ZD1A 2J6UA 3WC2A 3M4XA 4LVOP 5EGYA 1H7XA 2FGOA 4F50A 4L3NA 4JI0F 1KNZA 1RABB 2A2DA 1PAEX 2YNIB 2GMJA 4Q8FA 2HYIB 4DFMA 4YS2A 1JWWA 4ZLJA 2FHJD 4BDPA 4KYZA 1LK5A 4LF5J 4DLEA 3K5LA 1FEHA 5D3GA 3FMWA 3IRXB 3KLGB 1YJ7A 1NKEA 1YLXA 1R6VA 2RVJA 3V6JA 2X3GA 2XZWA 2AJFE 3O6QA 2V8VA 2W8LA 4ZHRA 4CLUA 3HDSA 4EI2A 2IRUA 2J0SD 4JV5J 4DFKA 2WSCC 1UVMA 4QR0A 2CJXB 2RS8A 4JV1A 3BGRA 4ZVSB 2FJXA 4ZP6A 1NM2A 3CDAA 4PG5A 2MHEA 5F8LA 4LF8J 2QSFA 2R2UA 2CQPA 1VISA 1K73T 2GHPA 2KYZA 4OZ2A 3HULA 3M6UA 4I68A 3I87A 1DAXA 4ELTA 4RWWA 6AT1B 2JEJA 3AODA 2O01C 1YRUA 2XBPA 2DCLA 2DEIA 2W7AA 5F41A 2G9OA 2UU9F 4ZVGA 2AZ1A 1DRZA 2V69A 5HMWA 1OY9A 1JLQA 2XY6A 2QN6B 3U1NA 4M95A 3MD3A 4KO0A 4Q8EA 2VDIA 1LV5A 3HVRA 2WVBA 1NB2A 4X66J 5F8HA 4I67A 4J7CA 2DTJA 4FYXB 4B3MJ 1C1CB 1RE1B 5K8OA 1RI7A 1EQ0A 3DHWC 3US5A 2C2OB 3FEYB 4YOEA 4FDFA 4KRWA 2EFNA 4I0WA 2ZBPA 3LQVA 4OHWA 2BEFA 2WONB 1HBUA 3W5YA 3GB0A 2X1GA 1W2IA 2MDAA 3ILIA 1SJ4P 5CZVA 3UI3A 3OV7A 2AJQA 2RDIA 3MF5A 4AL7A 2AJ1A 5E0OA 1SIWB 3HKZD 1YI2S 2IA6A 1Q81T 4C8NA 5FIIA 4F4AA 4NXNJ 4XO0A 5HO4A 3OVAA 2FVRA 4C8MA 4KB7A 5LJ3Y 2AYMA 4LF9J 3CCUS 4LUBA 3R7SB 4QW8A 3Q8UA 4LR8A 2NUUG 1WUUA 2JEFA 1WSVA 4OZLA 5KFYA 1OPZA 2RQCA 3PW4A 2L9WA 2BJDA 2GVZA 2VBZA 1TFYA 4DR2F 2ZH1A 3FCHA 4DXLA 4DSLA 2EFOA 1VC0A 3P5TL 2K2PA 1KQFB 3KK2B 2XYPB 4MKVA 2RHSB 5E3RA 3HFVA 1RDRA 3BS9A 1S7IA 4PWUA 2BANB 2VOPA 3HPOA 2IM0A 4ECUA 1S9EA 2VFSA 2DHHA 3EYZA 4OJ1A 1U0HA 4ZDNA 4EWTA 5AJ3J 1T94A 4OLOA 2G2YA 5ETTA 4M8LA 1KHWA 4QOTA 3J7Z5 1BQMA 1MU2B 4ECRA 4DHVA 1SKRA 2YQ1A 1ZTTA 2EKYA 4J37A 4RWXA 1WHVA 1ZZFA 2AEJA 3ZO7A 3OD2A 2VF3A 5KT6A 1X4AA 3EDRB 1UVKA 4EO6A 2GVDA 3PHTA 1HWJA 2JOQA 2A6OA 2H3EB 1RU1A 2CDRB 2BKNA 3J80Y 5KFTA 2QG9B 3DRRB 4O4GA 1B0TA 3GP9A 1N54B 2D69A 2EVZA 1RISA 5I3QA 3QGGA 1T3NA 4X62F 5ETKA 4M5NA 2H1YA 3T5LA 3KTQA 1KR4A 2JLEA 1LWEA 4OHVA 2XWYA 1DTQB 2LXUA 1HI8A 4UOCA 1LWFA 1U8WA 4MKBA 1T3OA 1JLFB 2CNNB 3FSIA 1CJVB 4FXWA 3HF5A 1KSPA 5KG0A 1ZBTA 2ZBIA 5AT1B 4BLGA 2W4DA 3QIDA 2UUBJ 1F1BB 3I0SB 4CYUB 2DHSA 3RRKA 5DG9A 2OTLS 2GO9A 2H5IB 2JEIA 4CNYA 4MT1A 1S10A 4TVAB 4E98A 2E7WA 4Y00A 2CPZA 1NK7A 2Q43A 3ONQA 3OR2B 4KFBA 1GTEA 2OI2A 2AZ3A 1N34F 1UW4A 3M32B 4DUYF 4NLPA 5K14B 2ZH3A 3MEKA 1UWBB 5KFFA 1B0PA 1GMVA 2FTRA 1VBKA 5KFQA 5J2PA 1S1VB 3T19A 4LF6F 1RYSA 1FWPA 4FYYB 4ZCMA 1HBMB 3T1YJ 2PA3A 5KAKA 3FVYA 3RUBL 2ADBA 3BBFA 1X4BA 1F60B 3G6YA 1XMOF 5KT4A 7AT1B 2B7CB 2VONA 3E01A 4JI1J 3C6UA 2WRMA 1HL6A 1NSPA 1FKOB 4NLWA 2BE9B 2VICA 4DPOA 4O0IA 3I5CA 1CSJA 1R0AA 5D4OA 3MFIA 2W24A 4WU2A 2HAFA 5HROA 4FKYA 2P2CB 3GCWP 2WOMB 4X4TA 5F9LA 1PILA 1MLAA 3UPFA 2EC2A 2UXCF 1S76D 3A12A 2CNOB 4I2QA 1PYOB 3VGSA 1IUJA 4B9UA 1X31C 4FNHA 1EQMA 4E8UA 2LEAA 3IGVA 2B6AB 3OXFA 3UCZP 2HHSA 2M5YA 2OMOA 3U02A 4IOAQ 3BO2A 3GIRA 4DR7J 1NK9A 4N7TA 3MAAA 1HPZB 4K0KF 4URQU 3RW7A 4GKJF 1ITPA 1S1UB 2IY5B 4USMA 2R2TA 2OFGX 4XAKA 3FUYA 3DU5A 4IG3A 2O1PA 3GR0A 1WACA 2E7VA 4PYDA 3SV4A 5ETNA 1LQ9A 2M8DB 4M5LA 3M2RB 5IT9U 4KGVB 4IDKB 2BV3A 3SCKE 3HVWA 3KK3B 2YKAA 4RBUA 3UNGC 2VG6A 3TJ9A 4ANDA 3HCXA 4C8ZA 1GXLA 2YWHA 4B3OA 2K3KA 3W2VA 1XNQF 2EXUA 4DV3F 2BR0A 4H4MB 3CCQS 4K50A 4USJC 4RJVA 3OHBA 1KQKA 3MM8A 1W26A 4ZJOA 1RU2A 2HLUA 3M8QB 2KFNA 1VRQC 4NLQA 5IC4B 4JI2F 3GILA 5AXMA 1IXKA 3DLKB 3HD1A 1HFEL 2RB7A 2E5LJ 3HD2A 1N8RT 2R7WA 4PABA 2W2QP 1EX8A 2BKOA 5C42A 4XPEA 4R0EA 3PYEA 3MEDB 4OYZA 2YKPA 1FNXH 2HKEA 1TUGB 1B3TA 2HNYA 2NCKL 1RKIA 2J5AA 4C2MA 4EMDA 1ZM9A 2LEPA 4CLTA 1V3ZA 4CRJA 2Y9HA 2VPXB 2HK3A 2ATLA 4P74A 1BUXA 3C14B 1X4GA 3R5DA 4UTGA 2CPHA 4UOFA 2AF6A 2HGMA 1AUDA 3N5BA 5HVHA 1RA7A 3W9IA 2XGPA 2DCUB 3NY0A 1UA1A 4IFYA 1BQNB 4LF7J 4RUCA 2AJ4A 3O2IA 5E3PA 4X4PA 1IM4A 4KKOA 3SCJE 1S5ZA 2GHVC 1LNQA 4NOHA 1FK9B 2BUNA 3H2VE 4CWBA 4PQUA 3BH7B 3UO0A 3W65A 1RT6B 2LQJA 2MEWA 1F5AA 2ZE2B 5L1JA 3E51A 4ED8A 2WBMA 2R2RA 4IOCQ 4PRFA 1RWOB 2HHTA 2W9BB 4F36A 4U96A 1XEZA 2C2NA 3NS5A 3QT6A 3QZ7A 1F2GA 3BPDA 4I2PA 1RWWB 4YR3A 3VZHA 2OUGA 3ITHB 3O1LA 1XMBA 1TKDA 4RR5A 5KFVA 1RAHB 2KB2A 3K5OA 5H9EK 5H9FK 5KFSA 2IC3A 3NAIA 4LT6A 1YRTA 3HI9A 2LXFA 2DNOA 4ZN1A 4KGXB 1S79A 4QCLA 3BR8A 4QIGA 5LXRA 4K4ZA 2HHPA 4F3OA 1RT5A 2MZQA 5FDLA 1CVJA 2FJDB 2W2NP 3D28A 4MFBA 4K4YA 3EGVA 1RHRB 3UQSA 3C19A 2UUAF 3CD0A 4CO1A 3CJ2A 3TA2A 3QJJA 3MCNA 5KG2A 5T41A 1TK0A 4ECZA 3KJVA 3GFHA 4ED1A 5EDWA 2HHHJ 3D1QA 3W1YC 2F65A 4ZLLA 3N01A 5K20B 1N32F 5AE2A 3W62A 1N5YB 3LP2B 3EPGA 3LA0A 1RT4A 1RT7A 3MUTP 4TNOA 4DR4J 4EZ9A 1VQNS 4Z37A 2X1FA 1F2HA 3RTVA 3DOLB 3GIMA 2RU3A 4NE9C 3DYAA 5E3CA 2QYGA 1UTAA 1KRPA 2F4FA 2HHXA 1APSA 3B4MA 1HA1A 2XEXA 2B0GA 3NEKA 5K8MA 1U1KA 3QRRA 3HSZA 1Q16B 2EG2A 4DPTA 4LR9A 5IQQA 4O3NA 2PA8D 4PWDA 2OP5A 2E9RX 2A6MA 3MPDA 4K8RA 1Q8BA 4DR5F 2GAHC 4LIRA 4HKQA 4Y6IA 4F4XA 3CCJS 3FQLA 1O5JA 3KLIA 2DNGA 4DX6A 1FX2A 1LXNA 3UD5A 2R7UA 3NBPA 4AXJA 3UW1A 2F4VJ 2YPZA 1NUEA 5IS2A 5GAEU 2DRDA 4KC5A 2O67A 3RU0A 2R8JA 3MR2A 4C9DA 2P9GA 4HDGA 1RCXB 1FJEB 3RAXA 1E6VA 1EETA 4DEZA 4B02A 3D66A 3TVZA 2KKHA 1SJ3P 1M90T 2G2ZA 1U47A 5EHHA 3IS9A 1VQ7S 1HD1A 3KLVA 2ABYA 4OZNA 1XR5A 5CD4A 1YITS 1XR7A 3NAHA 1UFWA 2NXEA 1PBUA 1AZSA 3FEZA 3OFFA 3SIPB 1DZ5A 4DSKA 3MFHA 1NH7A 2KFZA 2AGPA 2HBYB 3T41A 4ED4A 3IM9A 4Q7AA 5DDPC 4ED6A 2ALYB 1S77D 3M2UB 6FDRA 4RBTA 1URRA 3NWGA 3V4IB 2LP4A 5IT9Y 1S6UA 4A8WA 1NPPA 5A8RA 1V5VA 1VRTB 2L3MA 5ITHA 1QAJA 2DGXA 3C3LA 1D9DA 1NSKL 1JLGA 2VFVA 2R7OA 2HQ3A 2ZITA 2UUWA 1OQ3A 1U4BA 4CTAB 2QA2A 2NSCA 5CABA 2BQRA 1VQ5S 2QMWA 3HT0A 1MG7A 2C3MA 1KFSA 2BX6A 2JWNA 4B3RJ 2DK2A 3EZUA 2D41A 5IV4A 1NRKA 1H38A 2ZBCA 5KFWA 1IQTA 1W7WA 2XG8A 4K4WA 4K59A 1DBDA 5DDRC 4DR1J 2XQCA 2M70A 4X64J 2QE5A 4XIUA 2I5JB 1WC0A 2UVVA 3CJSA 5LMNJ 4WPAA 2QIFA 4FS2A 3IC1A 3JYTB 4DDFA 1R31A 1YZ7A 1RT3B 1U1PA 2AYBA 2R8KA 3AD9C 3DLLQ 2DRAA 5M2UA 5J1EA 3EWGA 4RNMA 3F0NA 2IVYA 1TKTB 4TQSA 2J0QD 3F44A 2G13A 5LXYA 5A2QU 2XGQA 3PXGa 1S97A 1YK9A 4X65J 3R2DJ 3DLJA 4LRBA 4DV2J 2HFZA 1NPKA 3A3NB 3QT8A 1B70B 4WF9Q 1WELA 5IZHA 2WSEC 9ATCB 1HBOA 3GJQB 2HMIA 2KXHA 2LDYA 2DO4A 3W63A 1KOHA 2MY8A 3R27A 5KG7A 4ITSA 3MOZA 3UDLA 4OV6A 1LWCA 1UJ4A 2F7VA 1MWZA 2FGCA 4RW9A 3W66A 4ZPBA 2KG0A 4ETZA 3DDKA 4TLQA 1RTHA 2DHXA 1VR6A 2QV6A 2B4PA 2DNRA 1VIOA 1AROP 1CULB 2POKA 4KJIA 4EU0A 3MCSA 2HWTA 2QL7B 2IVMA 4F67A 2KM8B 4TY8B 2VDHA 4JI6J 3WIUA 3LAMA 4P2SA 4USVA 3EXCX 1IBLJ 3JAMY 3AQOA 3E8OA 4ILLA 4QPXA 4JV0A 2O3DA 2Z30B 3ULHA 1IBKJ 1T9WA 3ISNC 4ECWA 1NK5A 3LGNA 3R6LB 1R3NA 4QQBA 4KV8B 3ZZOA 5CYMB 3GCXP 4LJMA 2CAJA 2WK4A 4B9LA 4NZ7A 3NGSA 4FN5A 4M63A 1HD0A 1YBTA 4IR9A 2IDEA 2OPRB 2JLFA 3WQPA 4LQ9A 5L46A 1REVB 5A8WB 3VAMA 1LFPA 2R7RA 5HMXA 1FRXA 4DV1F 2CG4A 3R8YA 5D4NA 9RUBA 3K17A 3TARA 3EUNA 2DY1A 4KSEB 3DM2B 1S1XA 3DOKB 1M5HA 4N8OA 1ZAVA 2CPIA 3LOUA 1GEHA 5KFHA 2HZCA 4JI4J 1Q1KA 1N0UA 4YHHF 2HS0A 4TYBA 2FJBB 4LF5F 1T11A 1JKHB 4RW6A 3CO0P 2OLWA 4C8LA 4DSFA 4DG1A 1VQPS 1NK4A 4NWBA 3LP0B 1DHMA 4EYHB 2DGVA 3BGFA 3I82A 5ADZA 4QR2A 2ZM6J 3D0GE 4LBPA 2PT0A 4C48A 1MWYA 1U7LA 1SH3A 4K4UA 2YKNB 1QDUB 4JV5F 3LO3A 2ZH6A 2CIMA 4MAKA 1SBRA 1RTDA 2VBWA 3TI0A 2G0JA 4MH8A 4Q2LA 1X5SA 2FDNA 4QWDA 2KU7A 2BW2A 4CI0B 3BR9A 1ZTWA 1U1RA 2HS3A 1AUSL 4QPTA 1BWVA 1VHFA 1T9UA 3G4SS 2EWHA 2E7XA 2DNMA 1R43A 3M6XA 2RDDA 4YFUA 1SCJB 1HHTP 4S0MA 5JVHQ 2DR6A 5D4PA 2VKRA 3L7PA 2FLPA 2CG8A 3VALA 3G82B 4CNZA 8RUCA 1H7WA 3T9NA 4OYWA 4ILMA 1FDAA 2UXBJ 2PMZD 3NXZA 3RJMB 4DPXA 4DL7A 1U0SA 3JSMB 4U9RA 3R5JB 1S0VA 4DZDA 3NLCA 2ILZA 3LWLA 3RG6A 1C0UA 3DRSB 4Y2IA
chains in the Genus database with same CATH topology
1EQMA 5ETLA 4M5MA 3MCNA 4M5KA 3HSDA 3HSJA 4PZVA 1CBKA 4CYUB 4M5JA 3ILIA 1RTZA 3HD1A 3KUEA 4F7VA 3KUGA 5ETMA 5ETVA 4M5NA 3UDEA 3HD2A 1F9HA 3IP0A 4CWBA 1KBRA 1RAOA 3HT0A 2CG8A 1HKAA 5ETQA 3UDVA 1EQ0A 1G4CA 3ILLA 5ETNA 3KUHA 1EX8A 1IM6A 2F65A 3HSZA 5ETRA 1DY3A 5ETSA 3ILJA 3QBCA 5ETOA 3HCXA 3MCOA 4AD6A 3ILOA 1Q0NA 1RU2A 3MCMA 4CYUA 4M5LA 4M5GA 1HQ2A 4M5IA 5ETTA 4CRJA 1TMMA 1RU1A 3HSGA 5ETPA 2F63A 5ETKA 1TMJA 2QX0A 2BMBA 1RB0A 3UD5A 4M5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQM A;  5ETL A;  4M5M A;  3MCN A;  4M5K A;  3HSD A;  3HSJ A;  4PZV A;  1CBK A;  4CYU B;  4M5J A;  3ILI A;  1RTZ A;  3HD1 A;  3KUE A;  4F7V A;  3KUG A;  5ETM A;  5ETV A;  4M5N A;  3UDE A;  3HD2 A;  1F9H A;  3IP0 A;  4CWB A;  1KBR A;  1RAO A;  3HT0 A;  2CG8 A;  1HKA A;  5ETQ A;  3UDV A;  1EQ0 A;  1G4C A;  3ILL A;  5ETN A;  3KUH A;  1EX8 A;  1IM6 A;  2F65 A;  3HSZ A;  5ETR A;  1DY3 A;  5ETS A;  3ILJ A;  3QBC A;  5ETO A;  3HCX A;  3MCO A;  4AD6 A;  3ILO A;  1Q0N A;  1RU2 A;  3MCM A;  4CYU A;  4M5L A;  4M5G A;  1HQ2 A;  4M5I A;  5ETT A;  4CRJ A;  1TMM A;  1RU1 A;  3HSG A;  5ETP A;  2F63 A;  5ETK A;  1TMJ A;  2QX0 A;  2BMB A;  1RB0 A;  3UD5 A;  4M5H A; 
#chains in the Genus database with same CATH topology
 2G2O A;  2BJ7 A;  1GH8 A;  4CLP A;  3SCI E;  3W9J A;  2F9J A;  1HIY A;  5DGA A;  3KLH A;  2E1C A;  1WSR A;  3CDB A;  4OL8 A;  2ZJQ Q;  3TVK A;  1NXI A;  4HHJ A;  4YME A;  4NXM F;  1PC4 A;  3OL7 A;  2R8H A;  2NQP A;  2V9W A;  1DTT A;  1FRI A;  5ETM A;  3UDE A;  2BAC A;  1JX4 A;  2HFO A;  3FJ2 A;  4P2M A;  4AT1 B;  2RF2 A;  1WOP A;  4Q5V A;  2FHM A;  1RXO B;  3QRP A;  2RQM A;  4UT4 A;  5IQ6 A;  3Q24 A;  3NNA A;  4DL2 A;  2FZG B;  3QJP A;  3UR3 C;  1J5E J;  5A76 A;  4WCE Q;  3H5U A;  1UEK A;  1UPP A;  3M8P B;  3IR5 B;  1RAJ A;  2C2M B;  3D1H A;  2F1F A;  1HNX F;  4K2X A;  1N6Q A;  3Q8R B;  2X1B A;  2R2S A;  1RT2 B;  2VH7 A;  2ZD1 B;  3U1M A;  1SKS A;  1U2F A;  3Q2S C;  1ELO A;  1RLC L;  2ZH2 A;  3I0R A;  5IOL A;  2W9A A;  2LQ9 A;  4OX6 A;  3GIJ A;  4JI8 F;  2IJR A;  3HHL C;  4GVB A;  4DV7 J;  3TZY A;  4LRC A;  3DFE A;  3IXQ A;  2KT3 A;  4HI2 A;  1KN6 A;  5LMU J;  3W3S A;  2GMH A;  2R42 A;  3BV8 A;  4OZ5 A;  3DDN A;  3W5Z A;  3KLE A;  1RT1 A;  2XTJ P;  5D3G B;  1I94 F;  1S12 A;  1S59 A;  4ZVT B;  1UEU A;  4PXE A;  1D9A A;  1TR0 A;  1VBX A;  3V6D A;  1YZ6 A;  5B0C A;  4ZLP A;  1FWL A;  1WOS A;  2BOA A;  5HQ8 A;  4F3Q A;  1JJ2 R;  4QR1 A;  4ZHR B;  1REG X;  1VQS A;  3HO1 A;  2EBE A;  1FA0 A;  2IIH A;  5CXT A;  1RAF B;  2PEH A;  4ED3 A;  3BGR B;  4FS1 A;  3NMR A;  3PYG A;  3NP5 A;  1KFD A;  4XDC A;  1JXL A;  5HJY A;  4FYV B;  1TUW A;  2HFS A;  1H73 A;  2GML A;  4F0H A;  3VZI A;  1QSY A;  3GV8 B;  1WI6 A;  3N6N A;  3MOJ B;  3PKM A;  1YVF A;  3BDE A;  2L08 A;  2B56 A;  3KMS A;  2HQF A;  4NCG A;  3D54 A;  1T9V A;  3EE3 A;  3T1H F;  5F8I A;  1SC3 B;  3AD7 C;  4CQ1 A;  1UJ6 A;  2KG1 A;  1JLQ B;  1ICE B;  2VQE F;  3A1Y G;  4D3H A;  2V2V A;  3K5P A;  4DQR A;  2Y1L B;  1WC4 A;  3TX0 A;  1CQM A;  5THW A;  4CO4 A;  2BA9 A;  4H4K A;  4B17 A;  3FBE A;  3SEO A;  4OMF G;  4OJ3 A;  2CWK A;  4NRU A;  1HW9 A;  3PDN A;  3FKB A;  4J9O A;  2FIU A;  2HRT A;  5GAH U;  1S7H A;  3SQG A;  3SMZ A;  3HK2 A;  3RYL A;  3VR1 A;  2AYG A;  2VV5 A;  2IA0 A;  1Q86 T;  3NMA A;  3FGV A;  1FFW B;  4I6Y A;  4Y2K A;  1RAE B;  1N36 F;  3ILJ A;  1RP5 A;  3BKT A;  2C2E A;  1QAX A;  2FJA B;  1HBU B;  4OQJ A;  1M0S A;  1FDB A;  2XHW A;  2I8E A;  1J27 A;  1IKY A;  2J7U A;  2OEK A;  3C15 A;  4HLB A;  4Y28 C;  4U7U D;  1IJE B;  5LJ5 Y;  2ASY A;  4P6Q A;  5KFB A;  5KG1 A;  2LA6 A;  3KNG A;  1TKZ A;  2ZEJ A;  5DQH A;  2MQP A;  3D68 A;  4ZP9 A;  4O0N A;  4CIO A;  1RAO A;  1ULR A;  1GFW B;  2CPY A;  1U09 A;  2AJ0 A;  5DM6 Q;  1YBU A;  1FXL A;  1XWL A;  2C2Z B;  4GC7 A;  3G86 A;  2CQ1 A;  3DMJ A;  3OQ2 A;  2JVO A;  1FI4 A;  2AYE A;  4JI1 F;  1X4D A;  3HJV A;  2ZH4 A;  1TEL A;  1K1Q A;  2GC8 A;  3GMG A;  4W4M A;  1HWI A;  3T9Z A;  3HHD A;  1YQH A;  2X7I A;  1X9M A;  2GVZ B;  1U2R A;  2CPE A;  2XNQ A;  3E3X A;  2IYG A;  1KVI A;  3QBC A;  2N7C A;  4KR0 B;  1IR0 A;  4RNF A;  1Y11 A;  1JLE A;  4ER8 A;  4OYM A;  4OI3 A;  2YNG A;  1TL7 A;  3PFO A;  1FHT A;  2GJ2 A;  2V34 A;  3MTK A;  3TX8 A;  3U7J A;  3W2W A;  3ZZT A;  2MKC A;  1S9E B;  4WZQ A;  2HRY A;  1Q0N A;  1D09 B;  1QAI A;  1U0H B;  1IBM J;  2RD5 C;  3BJY A;  5HQL A;  4DV6 J;  2FJW A;  3GPA A;  2BW7 A;  1SUQ A;  5ETS A;  1U1L A;  2IPO B;  1BQM B;  2YVS A;  1RHU B;  1PCA A;  2DXD A;  1S1W A;  1RWX B;  4NMX A;  4DS5 A;  3GZ7 A;  2QGF B;  4C0O C;  3TOQ A;  1T9T A;  5DLF A;  1IBC B;  1J5O A;  1CLF A;  2AIR B;  1RKJ A;  2GVD B;  2D9O A;  2FVQ A;  4CM0 A;  3GSD A;  5HVF A;  3IAM 9;  2B3T B;  4J9N A;  3HM9 A;  4A4J A;  3L95 X;  5IT0 A;  3QGP A;  3KK1 A;  3IM8 A;  2I2Y A;  3DC2 A;  1NJX A;  3DU6 A;  2BKP A;  3TVY A;  5IM0 A;  3LW5 C;  4O4G B;  1UL3 A;  1FRJ A;  1TMJ A;  4NLD A;  5DLG A;  2ZOM A;  2V68 A;  3DN9 A;  5KFA A;  1YJR A;  1FO1 A;  2EG1 A;  2EEY A;  2VPY B;  1LWE B;  2HQG A;  1Q4R A;  4PUO A;  4B9V A;  3QLH A;  4YR0 A;  1LWF B;  2VFT A;  4Z7Y A;  2L41 A;  1ZA2 B;  4HEA 9;  3KHG A;  4M1K A;  4OZJ A;  1PBA A;  5IWA J;  5F8N A;  3OFH A;  3NCQ A;  4DR3 J;  4B9N A;  3H90 A;  2QLF B;  3FQK A;  3WDO A;  4RBV A;  5KFN A;  2IYI A;  4TQR A;  2AHO B;  3TUJ C;  1VHI A;  2G4B A;  3M8Z A;  4IO1 A;  1U1O A;  4FXD A;  3CME S;  2XY7 A;  4KBI A;  4AQY F;  4FPI A;  2NUH A;  1GNK A;  4ENO A;  2RML A;  2UVR A;  2QZ8 A;  2K8G A;  3WC0 A;  4KHR A;  4KFB B;  3ZZP A;  2EK6 A;  2FVC A;  1RAG B;  3IR7 B;  1W25 A;  3Q0A A;  4LBH A;  2ZHB A;  3MMB A;  4CT8 A;  2LQ5 A;  1X5O A;  4HH1 A;  3TQE A;  3GV5 B;  2AWZ A;  3RBZ A;  1KDN A;  3VHQ A;  3JTP A;  2HVI A;  1X9W A;  3BSN A;  2ZZM A;  2WAQ D;  5J2P B;  1U02 A;  2GW8 A;  3GLJ A;  4ILR A;  1CJU A;  5HN0 A;  4DV5 F;  2IJF A;  3R5G A;  4DQI A;  2LQ8 A;  2XSF A;  4QWE A;  1FRL A;  4Q43 A;  2XMA A;  1MWQ A;  2M4M A;  3E01 B;  4DFP A;  3C6U B;  4WYL A;  3DKD A;  1NO8 A;  2DEJ A;  4IOB A;  1Q79 A;  1NDC A;  3MM6 A;  4B9S A;  4Y34 A;  1R0A B;  4X4U A;  2MYF A;  2JZ5 A;  1FF2 A;  5HRO B;  2KVQ E;  3B8H A;  4O3P A;  4DCP B;  4UQG A;  4I6A A;  3K7R A;  3MM9 A;  2DH9 A;  1FNM A;  1XTZ A;  4F8R A;  2PI4 A;  4I2Q B;  2HW3 A;  2Y3Y A;  1N5S A;  5DDO C;  5B0B A;  5RUB A;  3GE9 A;  2EKN A;  1WG1 A;  4KH1 B;  1R89 A;  1N5Q A;  3MAA B;  4IH7 A;  1Q7Y T;  3K5N A;  1WG4 A;  2IHR 1;  3BSC A;  1NZA A;  2MLX A;  2P6T A;  4RNH A;  4IG3 B;  4V19 J;  4DR6 J;  2HHH F;  3DLE A;  3H4D A;  1VFJ A;  2MKS A;  1NSQ A;  3A3O B;  2DGO A;  2AMC B;  4ECS A;  1H0H B;  4RO0 A;  2YNH A;  3OT9 A;  3RRG A;  2KL8 A;  1Q53 A;  3EVM A;  1EP4 B;  3ISZ A;  2VG6 B;  4K5R A;  5HMY A;  3NKY A;  3NOC A;  1M5S A;  1RHQ B;  2H48 B;  4TU8 A;  2D74 B;  3GWC A;  2MKY A;  1MMN A;  2CJQ A;  4B3O B;  5BYQ A;  4KE5 A;  3MEE A;  2DNN A;  3W2V B;  1QSS A;  2ASJ A;  4EUV A;  2WW4 A;  1K9M T;  3SSS A;  3CJQ A;  3MM8 B;  1XN9 A;  2LA4 A;  3GFY A;  3E2E A;  1FJG J;  2DGS A;  3CC2 S;  3DGP B;  2HVZ A;  4L72 B;  3L9Z A;  3BQ1 A;  1JK9 B;  2KT2 A;  3QSY B;  3DRP A;  2VD3 A;  2ROE A;  3R5C A;  2RUG A;  1TV6 A;  1E6Y A;  5C42 B;  1WTF A;  1BHN A;  3TYT A;  2EFQ A;  2FJE B;  4OZ0 A;  4YDX A;  5BXI A;  4F0K A;  1RTJ A;  2F4V F;  3G9C A;  4ES1 A;  2DBB A;  2M52 A;  2HNY B;  3CNQ P;  3SDE A;  2QC3 A;  1VQO S;  3D6F B;  4XTT A;  1KBR A;  1SL2 A;  3NL0 A;  4QW9 A;  2ZOF A;  3ZFV A;  3C2P A;  2G0C A;  3D3C J;  3NS7 B;  3H4B A;  1VI7 A;  1IKV A;  1ZPV A;  2XI2 A;  2LYV A;  2QA4 S;  5C24 A;  4FF2 A;  1IM6 A;  2GQ2 A;  4IFY B;  4I64 A;  4I6W A;  4KKO B;  4MYT A;  2Y1R I;  2APO A;  3KJN B;  2HHV A;  1TZ0 A;  1AFJ A;  1DLO A;  4OI0 A;  3EM1 A;  1U49 A;  4WTY A;  3T5H A;  4JI0 J;  5I3U A;  2YX4 A;  1VC6 A;  2OPQ A;  5EUH A;  4PQU B;  1I3O B;  1D9F A;  2F9D A;  3CT9 A;  2XMV A;  1RTZ A;  1JLC A;  2XMT A;  1QTM A;  3MHY A;  2XMU A;  1WEY A;  2GS8 A;  1KTQ A;  4I2P B;  5KG6 A;  2HNZ B;  2KRB A;  1K0V A;  2QFI A;  1ZYQ A;  1JXV A;  3M6V A;  2HHQ A;  2B9W A;  3THP A;  4OYA A;  1WI8 A;  2ZHO A;  2NZ4 A;  2E9Z A;  4Y2A A;  3W60 A;  1VJW A;  2IC3 B;  2JNJ A;  1SVD A;  4C3K A;  1XR6 A;  1IKW A;  5AE1 A;  3IN5 A;  3OXL A;  3FNN A;  4DR1 F;  4KAI A;  1RT5 B;  2YKM A;  1TUV A;  4FP9 A;  5FDL B;  1XER A;  2BJ9 A;  2XMJ A;  4MFB B;  5J1N A;  4FPR A;  4X4Q A;  2AX1 A;  4CO3 A;  4HT5 A;  4LFA F;  3FFI A;  1TAU A;  1D8Y A;  2JFK A;  2DNH A;  3DRR A;  1V6H A;  5A8K A;  1QVG R;  4QYZ J;  1VQ6 S;  1T03 A;  4WFA Q;  4QU6 A;  4V1A k;  1MMD A;  3AOA A;  1RT4 B;  1RT7 B;  4K7Q A;  2UU9 J;  1UZD A;  4X65 F;  4C8K A;  3TUI C;  4P73 A;  2JL9 A;  3DYA B;  4OX9 F;  2KN4 A;  1DFD A;  2C28 A;  2ZDO A;  4DV2 F;  2HPU A;  4P52 A;  1NB7 A;  2JH3 A;  1NKB A;  4OX8 A;  2PO4 A;  4DWI A;  5G0R A;  5C25 A;  3D6M B;  5AE3 A;  2V4J A;  3QNW B;  2LCW A;  2W7O A;  5AXL A;  3BKU A;  2VZ9 A;  3MUR P;  1QAY A;  1X5P A;  4R8U B;  4PWD B;  2DNL A;  1EKR A;  3MUM P;  3CCR S;  1S49 A;  3DLB A;  1C4C A;  2CNK B;  1RWK B;  1VS3 A;  1Y3K A;  2FVP A;  4WP9 A;  2DNK A;  5EN1 A;  1PKU A;  3KLI B;  4QIF A;  3CWJ A;  4JI6 F;  2HG4 A;  3CUN A;  3NBP B;  3J7Y I;  2MZ1 A;  4B3S J;  5D15 A;  1S48 A;  1RBA A;  1DAR A;  3MPV A;  1NSA A;  2VC0 A;  5K5M A;  1N0V C;  2D9P A;  5B0A A;  1E6V B;  4O3O A;  1JNZ B;  5L9N A;  1EET B;  2HHW A;  5KFP A;  3CO9 A;  3H7H B;  4J9V A;  3A8J A;  2C3Y A;  3F56 A;  3MM7 A;  3R1L A;  2W4P A;  1M5P C;  4LSN A;  2ATC B;  4MMO A;  3IFE A;  2FLN A;  2U2F A;  2J9D E;  1EHW A;  2OAU A;  3V2U C;  2KJV A;  3BEG B;  3IS9 B;  4E0D A;  3OL8 A;  2R7X A;  1FKA F;  4W90 B;  3BN4 A;  3O5T B;  5GAG I;  3AXM A;  4WFZ A;  3DXS X;  4ID5 A;  1KLN A;  4ECY A;  4K4T A;  1AZS B;  5CQG A;  2VFU A;  1HNZ F;  1U48 A;  4JV2 A;  4ETX A;  4UST A;  1FCA A;  3GG1 A;  2R7Q A;  2RNE A;  1FE0 A;  3TZX A;  1F5B A;  1YTY A;  2BJE A;  2YX7 A;  1RHK B;  4FVM A;  3VAG A;  3QFW A;  3LAL A;  5DRK A;  4DR2 J;  5KFO A;  3EPI A;  5A8R B;  3OLB A;  3Q8V A;  4U7C A;  2A1B A;  2XLI A;  3DXB A;  1TTH B;  2HUR A;  3HHN B;  1JLG B;  2Z4P A;  1VDH A;  3TW0 A;  4J9L A;  3HX9 A;  2CJY B;  5J2N A;  2YH1 A;  5L9X A;  1T05 A;  3CJ8 A;  4JI3 F;  2VJV A;  4DL4 A;  4EBD A;  2E1M C;  5D77 A;  3I56 S;  2LEB A;  3ZXW A;  5HAO A;  2WTF A;  4E2F B;  4CLF A;  2YX1 A;  2Q6C A;  1GQE A;  2BJ8 A;  2IDL A;  3G96 A;  2OJ3 A;  1WC1 A;  2GIQ A;  5M2R A;  6FD1 A;  3IBC B;  3H40 A;  3NGU A;  1PYT A;  4AXI A;  2XMM A;  1BY9 A;  2VB6 A;  3JSR A;  4J9U E;  1H2T Z;  2QMX A;  3DHX A;  1F9F A;  1I5O B;  3DNC A;  2IVF B;  1H6K X;  4GMK A;  1FFS B;  3QO9 A;  3BQ2 A;  4B9T A;  1HNV A;  4DLG A;  2LU2 A;  4PEO A;  1VIX A;  4CZC A;  2MLZ A;  2N3L A;  5J1E B;  1UVJ A;  3RB6 A;  1Q95 G;  4DUT A;  1LOU A;  1HMV A;  4O3Q A;  4KHP F;  3BZQ A;  4JI5 F;  2G1H A;  3ZTP A;  5D6G A;  2QMU B;  4X62 J;  7FD1 A;  3IWN C;  2UXB F;  4M5J A;  3D6T B;  3MD1 A;  4DOZ A;  2ASL A;  1AYE A;  4NL5 A;  1HBO B;  1OIA A;  4HR2 A;  3MR7 A;  4BC7 A;  2HMI B;  3I9Z A;  3OTB A;  2VG7 A;  4RNN A;  3DDI A;  1FXR A;  1B0V A;  1U6B A;  2YWK A;  1CJT A;  3MEC A;  1LWC B;  2Z2L A;  4RW9 B;  3AT1 B;  4ES3 A;  3TZW A;  4PZV A;  2MKI A;  1NK6 A;  1RTH B;  3ILL A;  2DH7 A;  1ZET A;  3AOB A;  2OEJ A;  5KG5 A;  3L7U A;  2DPI A;  3F73 A;  3C14 A;  1SB6 A;  3CGI A;  5KFC A;  1AW0 A;  4DU7 A;  3VAK A;  3IBW A;  2DR9 A;  3N6M A;  2MY7 A;  2F8E X;  4R5P A;  2DR7 A;  1UZH A;  5L1L A;  2IBK A;  2UZA A;  2ZOG A;  1FVS A;  1WDD A;  2RRB A;  4X4N A;  2GIR A;  3HHL A;  4DI6 A;  4J90 A;  2OD6 A;  1J5E F;  5G4D A;  1GX6 A;  4CDI A;  3MR6 A;  4J9Q A;  4J9M A;  4UW2 A;  2W7P A;  3MMC A;  1B7F A;  4RW7 A;  5IXU A;  4LF6 J;  4DCJ B;  3FBF A;  1T02 A;  4MIB A;  3OLA A;  2H5E A;  3BO3 A;  1LWX A;  4AD6 A;  4Y2C A;  4JI7 F;  3OTO F;  2C2R A;  3L3C A;  2UXD F;  1G3O A;  3VVT A;  1XMO J;  3N0V A;  4MJK A;  4NLS A;  5CCL A;  4LF4 F;  1S1X B;  1A9N B;  1HYS A;  4ZMM A;  2A2C A;  3LPY A;  2B7B B;  3MR3 A;  3J81 U;  3C66 A;  2JRS A;  5DDQ C;  5F0W A;  5DM7 Q;  4QIV A;  5AXK A;  3R6G B;  4PPD A;  3TZZ A;  1Q8K A;  1FER A;  2MGZ A;  3Q22 A;  4NA3 A;  2UXC J;  2DRB A;  2RT3 A;  4RW6 B;  4YDD B;  2B51 A;  4DG1 B;  4M5H A;  5CHC B;  1CC7 A;  2XCA A;  5HLF B;  3W9H A;  3LTO A;  4Z2X A;  1KVK A;  2RQK A;  2VU5 A;  4F4Z A;  2MB0 B;  5ETQ A;  5U47 A;  3CXC R;  5HAN A;  5GME A;  1TFW A;  4GKJ J;  4WU3 A;  1OQ6 A;  1Q8L A;  5EX0 A;  4OI2 A;  2HRU A;  4L3K A;  2CPX A;  1LXJ A;  2Q6B A;  2HWI A;  3RBD A;  3BF4 A;  3ZNJ 1;  5JUM A;  3P6Y C;  1YJN S;  2YWW A;  3N5F A;  3FBC A;  4GO5 X;  2XUL A;  1RTD B;  5JJB A;  1D3W A;  5A6P A;  2XSJ A;  1NHU A;  4PXB A;  4NEZ A;  1R6Y A;  1KLM A;  3RBX A;  1F0X A;  3ILO A;  2CJ9 A;  1CS4 A;  3GU0 A;  2CRL A;  3S8S A;  2PDA A;  4MIA A;  2GFF A;  2F5G A;  1MNE A;  1GXU A;  2Y0S D;  3T5K A;  3OSN A;  4JI2 J;  3PHE A;  2CQH A;  4OV1 A;  4OI1 A;  2C42 A;  1S4F A;  3HZG A;  4IG0 B;  4DL3 A;  3KJF B;  2RDJ A;  5FJ4 A;  1U6F A;  2HK2 A;  5LSR A;  3ZTO A;  2GGP A;  5BR8 J;  1C0U B;  1WJ9 A;  1HQE A;  2JC1 A;  3PEH A;  3FMB A;  2BE2 A;  5E41 A;  4QWA A;  5MLC V;  3KHR A;  3KLH B;  1X4C A;  2XS7 A;  4A47 A;  2HWH A;  2VIH A;  1L3S A;  3H5S A;  4AE5 A;  3OR1 A;  3DRY A;  1A6L A;  1DTT B;  3QIP A;  4DBQ A;  2VAS A;  3I32 A;  3ZTS A;  4C8Y A;  3ETO A;  4ES2 A;  1N5V A;  3BGO P;  4DS4 A;  1K8A T;  2Y1I A;  3RAM A;  2C1E B;  3GYG A;  5J2Q A;  2EFV A;  4WFX A;  1S1T A;  3AOC A;  4NPO A;  4PXD A;  4MKY A;  2QEX S;  1VBZ A;  1PO6 A;  2CJK A;  3T6J A;  4Q2M A;  2Q66 A;  3SBM A;  5DO2 A;  4ZCI A;  3EZ5 A;  1N6Q B;  4OYP A;  2P9E A;  2C3U A;  1ZM4 A;  4LSZ B;  3WBZ A;  3THV A;  2AU0 A;  1CC8 A;  2ZH8 A;  1FRH A;  2RIJ A;  1Y00 A;  5D0H A;  4DF4 A;  1YJW S;  2PN6 A;  3I0R B;  5DQG A;  2ZKT A;  2HFN A;  3MUV P;  4IQX A;  3HSG A;  2N7Y A;  4HHU A;  1LFW A;  4GVB B;  5ETV A;  1EAY C;  2V8D A;  3CCT A;  4DL0 C;  2NXN A;  4DV4 J;  1RCO B;  3IMQ J;  2XB2 D;  3S1T A;  1F5C A;  1BMQ B;  4X4V A;  5J1P A;  2DNQ A;  1HBN A;  3KLE B;  1IBM F;  2GHW A;  1RT1 B;  2BM1 A;  2XYG B;  5K8N A;  2NPF A;  3RRH A;  3DI6 A;  1L3V A;  1RQ0 A;  3V6D B;  3FZB A;  1DY3 A;  1RLD A;  2UUA J;  2E1A A;  4P2X A;  2W9C A;  3AJD A;  4YY3 F;  3HSJ A;  4NEY A;  3PR5 B;  4YB5 A;  1BQX A;  1HW8 A;  1YRX A;  1N32 J;  2IMO A;  4ZVO B;  4YB6 A;  5ETP A;  4LFB F;  4JUZ A;  5ETL A;  4M5M A;  3VTI A;  3PCO B;  2FLL A;  4NLV A;  2UP1 A;  5SZT A;  1KQG B;  2ZDP A;  4F7V A;  3M7V A;  2MKK A;  1QLN A;  3IWL A;  1VBY A;  2VPW B;  2JHE A;  4N56 A;  1SJF A;  2UUC J;  3TWZ A;  4B9M A;  4P72 A;  3KLF A;  4IUF A;  1Y10 A;  3D67 A;  1AXQ A;  5B7W A;  4NCG B;  3PY8 A;  3SFG A;  2FLO A;  2V4Q A;  3CCL S;  1N33 J;  3R5B A;  1KS2 A;  2V63 A;  4DUZ F;  2B43 A;  3KKF A;  1SH2 A;  1MRO A;  4NYP A;  3JXO A;  4YUD A;  2NS1 B;  2ACY A;  3CW2 C;  4YB7 A;  1S0N A;  2DNZ A;  5GMK a;  4EZ6 A;  5E5N A;  4LRE A;  4A8M P;  1T9Y A;  3AJ1 A;  3BSA A;  1EJ7 L;  3GV7 B;  3SQG B;  3I4H X;  1R8H A;  3J81 Y;  2YKQ A;  3A8E A;  3T6B A;  1PYS B;  1NJY A;  5A6W A;  4ZJL A;  3CJ0 A;  4KV8 A;  1VOM A;  4HDH A;  4PPZ A;  3ENW A;  5CYM A;  2LKZ A;  3CED A;  4I69 A;  3ZTQ A;  1GT8 A;  3VQS A;  2LMI A;  4K4V A;  1IKY B;  3C15 B;  1FWK A;  4OHZ A;  3CCZ A;  1HQU A;  1WHW A;  5A8W A;  5K9F A;  1LW2 A;  1ZA1 B;  2ZVI A;  4EEY A;  3PJX A;  4WXO A;  1TKZ B;  1UVI A;  5DG7 A;  3PRB A;  4XK8 C;  5CCM A;  4QYZ K;  3J81 j;  1C4A A;  3G6X A;  3PX4 A;  4OZ1 A;  3VAF A;  2K1R A;  4F25 A;  2AJ2 A;  2BZ2 A;  3MR5 A;  1NDP A;  2GJI A;  3R2C J;  4XPC A;  3CJT A;  4FF3 A;  1MW7 A;  3DMJ B;  1G2E A;  3EDQ B;  1IR1 A;  4RW4 B;  3G6E S;  1HNW J;  1GAO A;  4G1P A;  4U6P A;  3R1H A;  3AAW B;  3AQP A;  4DX7 A;  5D8H B;  4ELV A;  2IMW P;  1Q82 T;  1U2C A;  4ALZ A;  3OL9 A;  3PG9 A;  4NLX A;  3JAM U;  2EW9 A;  1RAI B;  3AD8 C;  1N52 B;  2NXJ A;  3GFZ A;  1JLE B;  2IM1 A;  1OMS A;  2BE7 D;  5KT2 A;  2YNG B;  1TL7 B;  3M05 A;  1WF2 A;  3W2W B;  2WBR A;  1C1B A;  1M5O C;  2W1B A;  5F8M A;  2E9T A;  3IWX A;  1RJJ A;  1TL1 A;  3NGK A;  3I96 A;  3W7B A;  1U26 A;  2FHO B;  3M8Y A;  3MMJ A;  4DR6 F;  1WTB A;  1SUQ B;  4BWJ A;  5E3Q A;  1P1L A;  2AP6 A;  3OPK A;  3TAM B;  5C7P A;  1PJ6 A;  1S1W B;  2I38 A;  3PX6 A;  2VOD A;  2N82 B;  2J76 E;  1VRU A;  2CFX A;  1WC3 A;  1J5O B;  1YBA A;  3KFW X;  1YKW A;  1JLB A;  4N77 A;  2KH9 A;  3FCW A;  5EWF A;  4F4K A;  1JLA A;  1RHM B;  1YWX A;  3KK1 B;  3H5X A;  3OFE A;  3RR8 A;  4OI6 A;  4FF4 A;  1IN0 A;  5IM0 B;  4P75 A;  2ZUG A;  1SQF A;  2ZJP Q;  1JMT A;  3J7Y U;  3M30 A;  4TU9 A;  4EBC A;  3OUY A;  2CQB A;  1NK8 A;  3OVB A;  1S6Q A;  5T7L A;  2LVW A;  4G6V B;  4R25 A;  1SL1 A;  4WYW A;  4DQS A;  4CT9 A;  2NR0 A;  1V3S A;  4FYD A;  4N5S A;  3NGT A;  2NPI A;  2V67 A;  3OTD A;  3QLH B;  1G6B A;  2K7J A;  4K2J A;  3GTY X;  1VQL S;  1U1Q A;  4UF4 A;  1IWG A;  5IC6 B;  2J9D A;  4ZCL A;  4DSI A;  1RWN B;  2OD4 A;  3IRW P;  1RGV A;  1LEO A;  2HLT A;  1RAA B;  2V8H A;  4UUW A;  3IR6 B;  1K1S A;  2ROP A;  1J2V A;  1H3D A;  1X0P A;  3PW2 A;  5DQI A;  3KDO A;  2YQ3 A;  1Y5L B;  4F0M A;  5F9N A;  4JYA F;  4YR2 A;  2CKW A;  4C3L A;  1CPZ A;  5B0D A;  2G0I A;  3UDC A;  4Y65 A;  3P49 B;  3G8S A;  5KTQ A;  2B9X A;  3CCV S;  4R0J A;  3MMB B;  3PVX A;  3MMA A;  2WVC A;  2RUS A;  3C8Y A;  4DV1 J;  3M1V A;  4CLS A;  2OSQ A;  5BYR A;  4DN9 A;  5DG8 A;  4IH5 A;  3MCM A;  3M9N B;  4A8Q A;  2E1R A;  3M6W A;  1IKX A;  1CJU B;  4LFC F;  3CJK A;  1UWA A;  2CPJ A;  2VA3 A;  3PIP Q;  1F9H A;  3ET6 A;  3CUL A;  5D78 A;  3QAU A;  2CPF A;  2MST A;  4YHH J;  3SFU A;  2FPH X;  3D4J A;  1S6O A;  2CPD A;  4BBY A;  3EGW B;  2HVD A;  2B8Q A;  1N5T A;  2QLJ B;  3TRG A;  5D0R A;  3M2V A;  3LAN A;  4FBT A;  2DVI A;  4PG7 A;  4B3T F;  3KUH A;  1VC5 A;  2PFF B;  3MM6 B;  2CQ0 A;  4YQW A;  3PKY A;  2X3D A;  3R7N B;  1KVJ A;  3IAS 9;  1QUP A;  2LFV A;  2VFR A;  1S9F A;  2DXF A;  4C8O A;  1YGY A;  2UVU A;  2W2M P;  4IRK A;  3MM9 B;  3EZO A;  5KG3 A;  4ZA1 A;  1CG2 A;  5HAT A;  3ZZ0 A;  2AGO A;  1SH0 A;  1UFK A;  1XNR F;  3QZ8 A;  3R97 A;  2K7K A;  1Y0H A;  2RKI A;  1AFI A;  4LIW A;  2Q3P A;  3RAQ A;  5I3P A;  1HR0 F;  3TA0 A;  1S9G A;  2XCP A;  3J7A N;  5CYQ A;  2V2K A;  1O0P A;  2DYA A;  1ROF A;  4LRA A;  3TJA A;  2O66 A;  4W92 B;  2ZC4 A;  5BYS A;  1G7C B;  4AUK A;  3G8Q A;  3DLE B;  3HP6 A;  1UVL A;  3QYY A;  1VLY A;  3TEH B;  3AB2 B;  1SJ1 A;  4UOG A;  3KG1 A;  5KFX A;  2WHO A;  4NI2 A;  3PEJ A;  2YNH B;  5JXS A;  1H74 A;  1UMJ A;  2JX2 A;  4X2B A;  1IR2 A;  5CAA A;  3ENA A;  2DGQ A;  2DXE A;  3CJ4 A;  4WII A;  3MPW A;  3N9U C;  1QE1 A;  1QVF R;  2E5H A;  5CH7 B;  2UVW A;  2QX0 A;  1NKC A;  3MEE B;  2CWX A;  2KDO A;  2OPS A;  2HVH A;  2BRK A;  3BN7 A;  3OJS A;  1ZAW A;  1ZM2 A;  4G1Q A;  3G71 S;  2E66 A;  4J9K A;  3LP1 A;  2OPP A;  5I42 A;  5IFM A;  1M5V C;  2A0F B;  5J2M A;  2DIS A;  4A8Y A;  3DRP B;  4U95 A;  1UA0 A;  1BD6 A;  3PW7 A;  3TQ1 A;  4LBI A;  4IFV A;  1TV6 B;  1E6Y B;  3POT A;  2VG5 A;  3RW6 A;  5FLX U;  3CDU A;  4CH1 A;  1RTJ B;  4KTQ A;  4B3S F;  1DQA A;  1VQ9 S;  4NXM J;  2QLB B;  3HSD A;  4LRF A;  1H2V Z;  3SZ2 A;  4FXV A;  3SDE B;  5JVG Q;  1QM9 A;  4DV0 F;  2MKJ A;  1F3F A;  3L09 A;  3VVU A;  4P2F A;  4PQA A;  3D5M A;  4KT0 C;  5MAO A;  4L74 A;  3R5A A;  1L3K A;  2ZHA A;  1OO0 B;  2W8K A;  2R7S A;  1IKV B;  3FSX A;  1KHV A;  4OYO A;  4U8Y A;  3HHE A;  2CQ2 A;  5C24 B;  1KWM A;  1HHS A;  2H54 B;  3N4W A;  2R8I A;  1VQM S;  3CTR A;  1FRM A;  1HNX J;  3PFE A;  5BJR A;  2R4F A;  2XC9 A;  2CZ9 A;  1TVR A;  1YSJ A;  1YJV A;  2WW8 A;  2GZO A;  2JJ4 D;  3A8K A;  1DLO B;  4ZPC A;  3ETM A;  3CCM S;  1PGZ A;  5I3U B;  1JXE A;  1X4F A;  4RX6 A;  2J6S A;  4WIQ A;  2OPQ B;  2VOO A;  2QLW A;  3FK4 A;  3GG0 A;  1JLC B;  4DX8 H;  4JI8 J;  4Z7C A;  1M5K C;  2EFG A;  2CZ4 A;  1NME B;  3WHI A;  1BXN A;  3P96 A;  1URN A;  4DX5 A;  2W2O P;  1I94 J;  3MWB A;  2ZUA A;  1YIJ S;  1PG5 B;  4RW8 A;  1PAU B;  5CA5 A;  5B09 A;  1DQ8 A;  4MYU A;  2ZJR Q;  1IKW B;  3F41 A;  2NRE A;  3IG1 A;  3MM5 A;  5KT7 A;  4NLY A;  4PKD B;  5F3Z A;  2MPU A;  4CH0 S;  3NNH A;  3KJQ B;  2YKM B;  1TL3 A;  3DRX A;  1KEK A;  4F3M A;  4LF8 F;  3UN2 A;  3TR5 A;  2FHK A;  4MTP A;  1P8G A;  4TU7 A;  3FFI B;  1WC6 A;  4TY9 A;  5A8K B;  2AGQ A;  4C97 A;  1FD8 A;  1T03 B;  5HSP A;  3ZZZ A;  3VCD A;  4FYW B;  1B4S A;  5HP1 A;  1MN7 A;  3T1H J;  3R7B B;  2VQE J;  1O6X A;  4NX9 A;  4ZP8 A;  1KOO A;  3MPU B;  1RWP B;  3ELH A;  4O44 A;  3HT3 A;  3QQC D;  4XDD A;  2ZNZ A;  5KOX A;  4X66 F;  3N6L A;  4NLT A;  5LM7 E;  1PC5 A;  5G0R B;  2COL A;  2BJ1 A;  5C25 B;  3AHP A;  1XJW B;  2V4J B;  3AFG A;  1TK5 A;  3M9O B;  4B3M F;  2UV8 A;  4LSL A;  1S6P A;  3QT5 A;  2VUG A;  2YPY A;  4RZR A;  3LH2 S;  3MEG A;  4GO7 X;  3Q23 A;  1BLU A;  2WB4 A;  2QO3 A;  4KPC A;  4M5D A;  2I1R A;  4UOH A;  3RZA A;  3VQT A;  1N36 J;  3MTJ A;  2U1A A;  5IT4 A;  3V81 B;  1LK7 A;  4ZPD A;  5FD1 A;  2D3Z A;  3SXL A;  3H25 A;  4PG6 A;  1XBW A;  1KC8 T;  1Q7L B;  1JIH A;  2BM0 A;  5K8P A;  1RUS A;  2IRY A;  3NRB A;  4H4K C;  4ED0 A;  2Z8Q A;  4KGM A;  1MN9 A;  2P5V A;  4P10 A;  2DIU A;  2BDP A;  4M94 A;  4P9S A;  4CM2 A;  3MM7 B;  2GCF A;  4HT7 A;  4NXN F;  4LSN B;  2I6W A;  2OGU A;  4ZVQ B;  4AL5 A;  4IO9 Q;  2KVI A;  2KO1 A;  3B82 A;  5EWE A;  1KD1 T;  1P27 B;  4QZV B;  4ZVU B;  1UCN A;  1FDD A;  4LF9 F;  2PEB A;  2DY9 A;  4F2R A;  2IM2 A;  4ID5 B;  3UCU P;  1LKZ A;  1SV5 A;  4I1T A;  1W2B R;  2ZBQ A;  2QL9 B;  4ICL A;  5ETO A;  2ERR A;  4HH0 A;  1HQ2 A;  4OYB A;  2ZZN A;  4URS A;  5L1I A;  5KFI A;  4JBC A;  1UFL A;  3ICL A;  4GVL A;  2DGT A;  5ETR A;  3PJ9 A;  1U24 A;  2IJN A;  1NK0 A;  3KYL A;  2MZJ A;  2IAJ A;  1HNI A;  1DJ0 A;  2H4W B;  1HHQ A;  1TAQ A;  2AV5 A;  2V9K A;  5J2N B;  2FHJ A;  2AQ4 A;  1T05 B;  2KXN B;  5AJ3 F;  5HBM A;  1AA1 B;  2HGN A;  4PAA A;  1QJH A;  3EGN A;  3SI8 A;  5KFR A;  3PO4 A;  2BQU A;  2GAG C;  3UE2 A;  2YWE A;  1T8E A;  4F4Y A;  4CH7 A;  5KT3 A;  4UZB A;  4ZPT R;  4QWB A;  8ATC B;  3TAP A;  1ZAX A;  3CJ3 A;  4L76 A;  4M5K A;  2OML A;  5FLX Y;  1EP4 A;  2B5J A;  5D4L A;  2Y8W A;  4WKY A;  4ED5 A;  4CLW A;  1UKU A;  1FES A;  3QO9 B;  3L4B C;  1K47 A;  3K89 A;  2DNP A;  1HNV B;  4HAC A;  5GVQ A;  3M8S A;  3G8T A;  3S7R A;  3JSY A;  2CNL B;  2BYC A;  5GAD I;  2HIQ A;  3UD4 P;  2XMK A;  2KHD A;  3FBB A;  1HMV B;  2MZR A;  2RAQ A;  3RBE A;  2IFX A;  3DGP A;  3BH6 B;  4ZCK A;  2HND A;  3KUE A;  2XY5 A;  4WE1 A;  1UVN A;  4OYI A;  4KO0 B;  2AEM A;  3MGJ A;  2YNF A;  4NZ0 A;  4H54 A;  1U45 A;  1R8P A;  3JS9 A;  1XIQ A;  3PO5 A;  2VG7 B;  4DPY A;  4DN0 A;  5BR8 F;  1FFG B;  4C98 A;  1CJT B;  3MEC B;  3CVK A;  3DLG A;  2OTJ S;  4TYA A;  5CD4 H;  1PJ5 A;  2MKH A;  3I5B A;  1JJ4 A;  4WKR A;  2UUB F;  1YDL A;  2OKQ A;  2GJF A;  4NCB A;  1NEE A;  1CBK A;  2CVI A;  3A3P B;  5DJB A;  2CUY A;  2FYX A;  5KFZ A;  4NRT A;  1ZPW X;  4O4R A;  2RQ4 A;  2XS5 A;  8AT1 B;  1EB0 A;  4AQY J;  2PGC A;  3GYN A;  4ZPW R;  2JFD A;  1Z4U A;  5GAH I;  4ZPV R;  4Q45 A;  2XLJ A;  4R5P B;  3RGI A;  4YB1 P;  3C16 A;  2SXL A;  4NLO A;  3H8Y A;  3QWP A;  4X4S A;  2L9D A;  2D7S A;  1Q78 A;  3HZE A;  2ROG A;  5C2G A;  3HHL B;  3UN3 A;  4WXW A;  4OHX A;  2BVZ A;  5DZ6 A;  1FDN A;  2MZS A;  3D7S B;  3T1A A;  5A0Y A;  3A13 A;  1HAR A;  1OY6 A;  3H5Y A;  4CCH A;  3UWT A;  2WB1 D;  1TKX A;  3MMC B;  1ZH5 A;  2PMW A;  1X8D A;  4RW7 B;  5LL6 d;  3T1Y F;  2H65 B;  4DV5 J;  2EFP A;  2W2P P;  2R3V A;  3N79 A;  1V5I B;  7FDR A;  5KFL A;  2XS2 A;  2VHG A;  3LF0 A;  4H4O A;  3I4P A;  3Q8Q B;  1H2U X;  3NCP A;  2HNZ A;  1HYS B;  1F9E B;  2OSR A;  1LW0 A;  3UCG A;  1CEZ A;  2FVS A;  1HI0 P;  3H0P A;  2F8H A;  2YWF A;  5F8G A;  2HAI A;  2EK1 A;  4PG8 A;  3OXG A;  1VMB A;  1C0T A;  3CDW A;  4DV4 F;  1C2P A;  1ACM B;  3ADA C;  2MGZ B;  4FVC A;  4IQM A;  4YEA A;  4Q0B A;  2KXF A;  4UUX A;  4CO2 A;  3QSI A;  1R8B A;  3Q8S B;  2UV8 G;  2W25 A;  1OSC A;  4DR7 F;  4NA2 A;  5E33 A;  1X5T A;  1Y5I B;  1L3U A;  3ZZR A;  5LOQ A;  3DOM A;  2CAD A;  1D0E A;  1VQ8 S;  1RSC A;  2PE8 A;  4CLZ A;  1WWH A;  3Q86 A;  4TN2 A;  1RWU A;  4DZ6 A;  3HXM A;  4BS2 A;  3HVT A;  5L39 A;  2EI5 A;  3BYR A;  4A8S A;  2V50 A;  4ZOS A;  4C6A A;  4DCO B;  2Y1J A;  2QJ3 A;  1O51 A;  3X3U A;  4IRC A;  3K8W A;  2XSJ B;  2HVE A;  1NZ8 A;  4KPY A;  2DJW A;  3GJT B;  3Q8Y A;  4HVZ A;  1K0T A;  3ISN D;  3B6B A;  2UUC F;  3IA0 A;  3WX8 A;  2B4U A;  1RTI A;  4EFA C;  1KLM B;  4HYK A;  2KHC A;  1CS4 B;  4FBU A;  1FKP A;  2R7T A;  1N33 F;  1UJ5 A;  3I5A A;  1X9S A;  3KG4 A;  3V5R A;  5M2P A;  3WX4 A;  3TA1 A;  3TUZ C;  4R8U A;  1ZZN A;  2C3O A;  3UVJ A;  3OTE A;  4I7F A;  2MTL A;  3PRD A;  4L75 A;  2C22 A;  3OJU A;  3BB5 A;  1KQS R;  2E5L F;  3CJR A;  3P4U B;  1SIZ A;  1SC4 B;  2NYH A;  1PJ7 A;  2VA2 A;  4ECV A;  4NLU A;  3BBC A;  3IBF B;  1QSL A;  1OJ4 A;  5KFU A;  4ZVP B;  3QFH A;  2GGP B;  2VQF J;  3MAH A;  2DKO B;  3KOA A;  1HQE B;  1YJ9 S;  4C11 A;  2KI2 A;  2CXE A;  3C6T A;  1JNR B;  1TP7 A;  2BE2 B;  3MCO A;  5D0E A;  4X4O A;  2MQO A;  2QSW A;  2E5G A;  3VGU A;  3QJL A;  4IH6 A;  3OR1 B;  1FTR A;  1Z2L A;  3QIP B;  4USK A;  3LPE A;  3TP2 A;  2I0X A;  4AFF A;  2MJU A;  2V8G A;  1CJK A;  4LF7 F;  2AKW B;  3GJS B;  3Q8P B;  3P5B P;  4ZP7 A;  5KFM A;  2PMH A;  4V19 X;  5LT5 A;  2CA9 A;  4WK1 A;  2XZD B;  5J2Q B;  2HEK A;  2KM8 C;  2V4R A;  3O8W A;  2M3D A;  4Y2M A;  4LVN P;  3AY0 A;  1S1T B;  4BCA A;  3PRV A;  3UFC X;  3P8B B;  4OLP A;  1FX4 A;  4I56 A;  1SI9 A;  3UR0 A;  5EWG A;  2YNI A;  2XWX A;  4NAS A;  2B4O A;  2UUT A;  2MQN A;  4GKK J;  1HNW F;  2DO0 A;  3OVS A;  4K5S A;  1S4E A;  2JVR A;  3ENV A;  1B64 A;  2N4D A;  4RUB A;  2E29 A;  3NCR A;  3IRX A;  3KLG A;  3KWM A;  4KGK A;  1N56 A;  4RL1 A;  2J9C A;  4PXC A;  4A48 A;  2XHC A;  2ZC3 A;  4FF1 A;  1VLO A;  3G2X A;  4LRD A;  3ENQ A;  1FT8 A;  1ZM3 A;  2LXI A;  1HBN B;  5E7O B;  2JDJ A;  3VF0 B;  1OSD A;  3DI6 B;  2ASD A;  3R9L A;  2MZT A;  1SC6 A;  4WFY A;  3W64 A;  4LFA J;  2P8I A;  4J5O A;  2W9C B;  5F3T A;  4ZIT A;  2FQQ B;  3CC4 S;  5KFE A;  4BHQ A;  3KNA A;  2HGL A;  3BGL A;  1UP1 A;  4NZ6 A;  2Q1L A;  4QBU A;  2BOP A;  2DB1 A;  4DR4 F;  4N41 A;  4O3R A;  3SSR A;  2NSB A;  1U6Z A;  2A3J A;  3VAJ A;  3NGR A;  4A8K A;  4ED2 A;  4OX9 J;  3P3D A;  1WEZ A;  3CPW R;  3KLF B;  4MIW A;  4ZVE A;  3THT A;  1WKK A;  2DIT A;  2P9C A;  3GFX A;  1WKL A;  3M9M B;  1NDK A;  4NCA A;  1C1C A;  3V6K A;  2NYI A;  1KP6 A;  2YQ0 A;  1WHY A;  1NJZ A;  3JQK A;  2D3O R;  2RH3 A;  1MRO B;  1KKH A;  1G4C A;  1VQK S;  1JB0 C;  4L73 A;  2J0W A;  1JJC B;  2RU9 A;  1SQE A;  1XMQ J;  4MK7 A;  2ZZT A;  2WON A;  4FKX A;  3I6P A;  5HJX A;  1ZS6 A;  3KG0 A;  3DCA A;  5D0G A;  2PII A;  3LGM A;  2OO4 A;  5CYJ A;  1NCL A;  3HHL D;  5KFK A;  3JTO A;  4B08 A;  2H9Z A;  5T14 A;  1RAD B;  5LSO A;  2HHU A;  1QTN B;  3NNC A;  1RHJ B;  2RE1 A;  4K4X A;  1G1X A;  2O5D A;  2OEL A;  3RR7 A;  2HZV A;  4L6V 3;  2DR8 A;  3UDV A;  2CQD A;  3ZNU A;  1GX5 A;  1D8Z A;  3TJ8 A;  1OYE A;  5GMD A;  3K57 A;  2MQL A;  2AX0 A;  4A8O A;  3NG8 A;  4DQP A;  2WVF A;  3PX0 A;  1HQU B;  2M8H A;  4RPF A;  3RB3 A;  1LW2 B;  1GMW D;  2Z58 B;  2DPJ A;  2OEM A;  4USH A;  1FVQ A;  1GMU A;  1S72 S;  3U27 A;  2QT7 A;  2XI3 A;  4ZLN A;  3TAQ A;  1S0O A;  3H2U B;  2DGU A;  1EAR A;  1HNZ J;  1P9Q C;  3H98 A;  3KXD A;  2K1R B;  4LQ3 A;  4PR6 A;  4QWC A;  4J9P A;  1TMM A;  2BMB A;  2CQ4 A;  3HVA A;  4OFZ A;  2M0G B;  3KK2 A;  3SSQ A;  4HL9 A;  2V2Z A;  2ZFH A;  2BAN A;  5HLF A;  1SL0 A;  2Z56 B;  2FY1 A;  2X1A A;  3I9V 9;  4JI3 J;  2CQ3 A;  1RWV B;  2J6T A;  3PNI A;  2CQG A;  3BSO A;  3NGD A;  1NLK L;  4B3R F;  4CO0 A;  2HSE B;  4CLK A;  1MU2 A;  5DGB A;  2MHN A;  4OYX A;  2X51 A;  1C1B B;  1VJQ A;  4X64 F;  4ZIW A;  1TL1 B;  4ATN A;  3FCV A;  2H4Y B;  2KTQ A;  2YKO A;  5LMN F;  3HHK A;  2QA1 A;  3ZTR A;  2R7V A;  4N76 A;  4J9R A;  2WVD A;  3KJV B;  5B08 A;  4C0B A;  5HK4 A;  1Q8I A;  1JJH A;  3VGT A;  3CF5 Q;  2Z0G A;  1VRU B;  4D3G A;  4KHP J;  4JI5 J;  1ZOT A;  1JLB B;  3RB0 A;  2WVE A;  3X1L B;  1HWU A;  4ZPA A;  4TLR A;  4OHY A;  1JLA B;  2W4C A;  2YH0 A;  3CIZ A;  1Z1Z A;  5HI7 A;  1I6J A;  4WTO B;  3FEX B;  1XK8 A;  2ACM A;  4IG0 A;  3AH6 A;  2M7S A;  1Y7P A;  1DTQ A;  5L8R C;  4KHM A;  1U8S A;  1M1G A;  1JLF A;  1CJV A;  3UNY A;  3GON A;  3M30 B;  2GV1 A;  1VK3 A;  3OUY B;  1RB0 A;  3L7O A;  3PR4 A;  5HVG A;  4ZJQ A;  5KFD A;  3HFK A;  1PSD A;  4N8N A;  1S6Q B;  5T7L B;  1NAQ A;  3PW0 A;  3O3L A;  3I0S A;  3BRE A;  3D6H B;  4CYU A;  4NLG A;  1S57 A;  3FDS A;  2V6A A;  4ANE A;  4O3S A;  1V3R A;  1S99 A;  3GII A;  4ZK7 M;  3IP0 A;  4HTI A;  3PM9 A;  1IBL F;  3OR2 A;  3PYD A;  2KZM A;  4K4S A;  1NHK L;  2B9E A;  2P6S A;  4PCQ A;  1IBK F;  1F6T A;  5B0F A;  2FY8 A;  3W5X A;  3M32 A;  3HJF A;  1OYD A;  4MKA A;  1WF1 A;  3SCL E;  5K14 A;  2NXU A;  1UWB A;  2GO8 A;  2Z2Y B;  5HQM A;  1IWA A;  4MK8 A;  1VQY A;  1WG5 A;  1VK8 A;  1S1V A;  1VQ4 S;  3QAT A;  1I1G A;  4ZN3 A;  4WP8 A;  3QPI A;  4N47 A;  1HBM A;  5AXN A;  4LF2 A;  1SJQ A;  5C2C A;  3BO4 A;  3FRY A;  1RA6 A;  4X4R A;  2HQD A;  5H1S V;  3MMA B;  1P6T A;  5I4M A;  4JI7 J;  4KGZ B;  3OTO J;  2UXD J;  3M1V B;  2BXJ A;  2XMW A;  2YWG A;  1FKO A;  2HBZ B;  4LF4 J;  4YN3 B;  1T0T V;  3KUG A;  3AA9 A;  1FJ7 A;  1FTC A;  3VAH A;  4DQQ A;  1IKX B;  4IKA A;  2ZWP A;  3CJK B;  1WD6 A;  2DHA A;  2GIF A;  2DNY A;  4OI4 A;  4JI4 F;  5KT5 A;  3ET6 B;  2QTW A;  2WOM A;  3K59 A;  2MMY A;  2AEF A;  5A2Q Y;  2ZBR A;  3AB4 B;  3CJ5 A;  3M2V B;  1PIE A;  3OHA A;  4C4W A;  2B6A A;  3ZZY A;  4G3I A;  4Q44 A;  4OJH A;  1R0C B;  2J7W A;  4DPU A;  2ADC A;  5KG4 A;  1TL5 A;  1HPZ A;  4CLL A;  1S1U A;  2ZM6 F;  3GYX B;  1FRK A;  1T95 A;  1RBL A;  1FEE A;  1DQ9 A;  1UEV A;  3UD3 P;  3M8W A;  4PWW A;  5GAD U;  4RUH A;  4P71 A;  2RKI B;  3M2R A;  4IDK A;  5B0G A;  5F0U A;  3VWS A;  1WHX A;  2IRX A;  3VGV A;  4EGL A;  5CZX A;  2KYX A;  1S9G B;  1OY8 A;  3KK3 A;  5CYQ B;  1Y5N B;  1RZM A;  4WK3 A;  2VC1 A;  3HFZ B;  4QIW D;  3EXY A;  3EVO A;  4OZ3 A;  1V9O A;  2RIL A;  1FJC A;  2ZWO A;  4G1I A;  3LGH A;  4IYQ A;  2N3O A;  4H4M A;  1NU4 A;  4NI2 B;  3EGZ A;  4O23 A;  1FXD A;  1TK8 A;  3JQJ A;  4DU8 A;  1SJR A;  3M8Q A;  3JQM A;  2JEG A;  2RHQ B;  1TU0 B;  3CSK A;  3HLU A;  3DLK A;  4HI1 A;  3K2Y A;  4ZS6 A;  4A8F A;  1QE1 B;  4A8X A;  2HIY A;  1WF0 A;  4HTJ A;  4FZV A;  1H98 A;  2OPS B;  1FNO A;  3MED A;  2LQB A;  3BDP A;  3Q83 A;  3B78 A;  2CJA A;  3EJM A;  4G1Q B;  2F8M A;  3LP1 B;  3J7A 1;  2OIH A;  3A8I A;  2OPP B;  2CZV C;  5I42 B;  3C46 A;  1HWK A;  2Z2Z A;  2LU1 A;  1EIY B;  3CD7 A;  1SPB P;  2VBX A;  5J2M B;  3I31 A;  3K0J A;  4IFV B;  2XO6 A;  4BC9 A;  3POT B;  2VG5 B;  1NJI T;  3G6V A;  1WEX A;  3CC7 S;  2J8S A;  2ZVS A;  2PSZ A;  1NDL A;  3RB4 A;  1RYR A;  3PAC A;  2MLY A;  4USU A;  3EIC A;  2DIV A;  4GRS A;  2NXC A;  4DF8 A;  1VCT A;  1BQN A;  1N34 J;  2KFY A;  2D3U A;  3MAQ A;  1GXT A;  4ELU A;  4WBF A;  1SQG A;  2HS4 A;  4DUY J;  4Y3C A;  3O44 A;  2GNK A;  2DGW A;  1AT1 B;  1FK9 A;  2EC0 A;  4PYA A;  2BJ3 A;  2DT9 A;  2KRR A;  3PW5 A;  5L38 A;  4C3M A;  4WWS A;  2GA7 A;  5KOW A;  1RT6 A;  2FZC B;  4RW4 A;  1NBE B;  1NJW A;  4ZIV A;  2ZE2 A;  4OJG A;  3NOG A;  1R27 B;  1TVR B;  3AXK A;  2FD2 A;  2W9B A;  2RSQ A;  4MK9 A;  3V4M A;  1GMW A;  3HKW A;  3BYP A;  1YHQ S;  4RLE A;  3M8R A;  1HI1 A;  4DL6 A;  3ITH A;  3GIK A;  3CD6 S;  1WDT A;  1FE4 A;  2K3I A;  2R9L A;  3D0H E;  3MDF A;  2CJB A;  4U8V A;  4EK2 A;  3TNV A;  1RAC B;  2F40 A;  2V2Q A;  4DV7 F;  3D0I E;  5LMU F;  3P45 B;  4UY8 T;  1SXL A;  1T9X A;  3BQ0 A;  3PIO Q;  2XO7 A;  1K44 A;  1Q5V A;  4ERD A;  2YBV A;  4USI A;  4RW8 B;  1Y3J A;  2N4C A;  2B4V A;  4K0K J;  2J8A A;  1XC9 A;  2OH2 A;  3W61 A;  2OHD A;  3TAM A;  4YY3 J;  2J7K A;  2HFV A;  3IG1 B;  3LUY A;  4OIX A;  3MM5 B;  2EBG A;  1QUV A;  1N5Y A;  3LP2 A;  3UN5 A;  3QGI A;  1TL3 B;  3BBB A;  4X84 A;  3IO1 A;  4LFB J;  2FZK B;  3DOL A;  1YG0 A;  3CCE S;  4ZVR B;  4BWM A;  2JSX A;  2FB0 A;  4RU2 A;  4FNI A;  3B54 A;  2FC9 A;  2VKZ G;  3GR1 A;  4DMZ A;  1U1N A;  1L3T A;  3Q89 A;  1XNQ J;  4DV3 J;  2YY3 A;  2PC6 A;  2XM3 A;  5HP1 B;  1UPM B;  4DUZ J;  2ZH7 A;  3WZ0 A;  4WP3 A;  4M5I A;  4RNO A;  2QLX A;  4O44 B;  2MQQ A;  2CYY A;  2ZNY A;  1A7G E;  3AJ2 A;  3DLH A;  3JSB A;  3D9B A;  1OS5 A;  5KFG A;  4LSL B;  3PTW A;  4LF1 A;  2Y0B B;  1R7I A;  1S6P B;  2BQ3 A;  4ECX A;  3MEG B;  3QGH A;  1KTV A;  2GX8 A;  3V6H A;  2PI5 A;  1S0M A;  4USW A;  4M5D B;  1U1M A;  2F63 A;  2HQI A;  2AD9 A;  3IGN A;  2LEC A;  2HFU A;  3D3B J;  4EBE A;  3H2L A;  1U25 A;  2YXL A;  3OW2 R;  2Z57 B;  5L1K A;  2K06 A;  3WIV A;  2VL1 A;  5SUH A;  2KZZ A;  1WC5 A;  2PFD A;  4RKU C;  3FC9 A;  3QWU A;  2RF2 B;  3DGV A;  4J9S A;  3PZP A;  4ID8 A;  1X7V A;  3JTN A;  3SYZ A;  4ECQ A;  3B4D A;  3K58 A;  2BBE A;  1EZZ B;  1Y9O A;  2CDQ A;  1WKJ A;  2FJV A;  3M2U A;  1B7Y B;  1RBO B;  3V4I A;  1M1K T;  4DJB A;  5EX3 A;  3I55 S;  3S6E A;  1NHV A;  3NS6 A;  2R8G A;  1UW9 A;  2EPI A;  2B8P A;  1QD1 A;  1VRT A;  1SV5 B;  3CE8 A;  3LAK A;  3KHL A;  3H59 A;  5DZ7 A;  2VBY A;  4ICL B;  3EMT A;  2D1C A;  1MML A;  2OFH X;  4CTA A;  2NZC A;  5DET A;  4I4B A;  5LSL A;  4LR7 A;  2I9S A;  2E5J A;  4QU7 A;  2MJN A;  4JB8 B;  5JMN A;  4ZVF A;  3PYF A;  2WCX A;  2IAJ B;  1HNI B;  2V94 A;  1SKU B;  4W98 A;  3BM7 A;  3TO8 A;  2WZ1 A;  4DV6 F;  4GC6 A;  1BC6 A;  5HBM B;  1IJF B;  3S01 A;  2WSF C;  2I5J A;  3MPY A;  3FZ2 A;  2AW0 A;  2GQQ A;  2DH8 A;  3JYT A;  1OWX A;  3CCS S;  4F4W A;  3H42 A;  1RT3 A;  2HBR B;  1WOR A;  3SQO P;  4RU9 A;  2C3P A;  1N4L A;  2DR5 A;  2DHG A;  3U1L A;  2RS2 A;  2B5J B;  1TKT A;  1O8B A;  1AB8 A;  3BGU A;  2M88 A;  3JB9 k;  2V8P A;  4ZKA A;  4JOU A;  4HAC B;  2J0X A;  3CB4 A;  4NML A;  1UAW A;  2LLZ A;  2VPZ B;  5DS7 A;  2MQ8 A;  2AT1 B;  3J7Z T;  2CVE A;  3GQC A;  2HND B;  4C0H A;  4ECT A;  4NYZ A;  5C5J A;  2HQC A;  2GQC A;  4WE1 B;  5IV3 A;  2CQI A;  2ILY A;  4QIE A;  3QRQ A;  4DR5 J;  2V5H G;  1CUL A;  2JLG A;  1A0O B;  2YNF B;  2RRA A;  4KH0 B;  4QJV A;  4WJB A;  2RRN A;  2H5J B;  4DFJ A;  2ALZ A;  2VQF F;  2RJZ A;  4JP8 A;  4TY8 A;  3D2W A;  4EYI B;  2M9K A;  3CMQ A;  3DLG B;  5IWA F;  2IBO A;  4DR3 F;  4AL6 A;  2XNR A;  2FUG 9;  1B99 A;  2XYH B;  3CMA S;  2C2K B;  2G1D A;  1UET A;  4U67 Q;  3ZZU A;  1I51 B;  1X60 A;  4F26 A;  2ZH5 A;  4JYA J;  1R8A A;  4IR1 A;  2QFJ A;  4J91 A;  4KIA A;  4PG4 A;  4U7U K;  3CIM A;  3NWR A;  5HMZ A;  4KQZ A;  3VAI A;  2OPR A;  4UQT A;  3C16 B;  2PD1 A;  3HMJ G;  2V0N A;  3OBI A;  3R3T A;  1X0F A;  1D1U A;  1REV A;  1YJU A;  3G87 A;  2QL5 B;  1N88 A;  4WFN Q;  4QYR A;  2A18 A;  3EVW A;  1Z2Z A;  2F3J A;  2LDI A;  2XZT B;  3T5J A;  1NND A;  3DM2 A;  5A0Y B;  1P1T A;  1HWL A;  1NH8 A;  5B0E A;  3DOK A;  3GJR B;  1TKX B;  3K5M A;  3EX7 B;  4LFC J;  4P7V A;  4GKK F;  3H20 A;  1SKW A;  3AA8 A;  1KON A;  3OSP A;  2Y8Y A;  2E1P A;  2MQM A;  2IM3 A;  4F04 B;  3GSI A;  4NYO A;  4Y0F A;  2Z2M A;  4NLR A;  1JKH A;  4H4O B;  1SC1 B;  1WNE A;  5E2Q A;  2QA4 G;  2KT5 A;  2J9E A;  4CP5 A;  4RUA A;  1LW0 B;  3LP0 A;  1N48 A;  4B3T J;  2CQC A;  1XQI A;  2BAB A;  1L5U A;  5E3A A;  1JQG A;  3QAE A;  3ZC4 A;  4UZC A;  3PJW A;  1C0T B;  1MSW D;  1T7P A;  3Q2T C;  1Y4Z B;  1Q5Y A;  1X4H A;  4WZM A;  2ZH9 A;  2YKN A;  2JC0 A;  2H51 B;  4Q0B B;  3TEG A;  3MI7 X;  3W8P A;  1BGX T;  2W01 A;  4CO5 A;  1XNR J;  1TL4 A;  1OPI A;  1GK8 A;  1WOO A;  4IRD A;  1HR0 J;  3MZI A;  2A10 A;  3DOM B;  1EKS A;  3CD5 A;  1M1H A;  4F02 A;  4F2S A;  3SV3 A;  1QY7 A;  4DSE A;  4HHH A;  1YJT A;  3K8V A;  4WFB Q;  4G65 A;  2MSS A;  3HVT B;  4LMZ A;  3MXH P;  2B9Y A;  1VYA A;  4NA1 A;  3FSY A;  4ANC A;  4KY3 A;  3QT7 A;  1X4E A;  3BKF A;  3D1O A;  3N28 A;  4A46 A;  1YX2 A;  2Q79 A;  3G82 A;  2L9N A;  4P7T A;  1DUR A;  2HZA A;  1RTI B;  2DD8 S;  1NPR A;  1F3V A;  5F8J A;  2YTC A;  2HBQ B;  3FRZ A;  1FKP B;  2C2D A;  3A4T A;  1GTH A;  1IQZ A;  3CCW A;  5KFJ A;  3JSM A;  3CDE A;  2ZKU A;  1P9Y A;  3KHH A;  1FJG F;  3DRS A;  1FD2 A;  1R0B G;  5H9E J;  5H9F J;  3UVJ B;  3VV2 B;  2MXY A;  4I7F B;  5HL7 Q;  4TKT A;  2E44 A;  2KJW A;  3T3F A;  3W8G A;  2E5I A;  3LWM A;  4TXS A;  1RK8 A;  1CQN A;  1XMQ F;  1RWM B;  3OFG A;  2QRR A;  2NLW A;  4YP3 A;  3V81 A;  1HKA A;  3TAN A;  4PUO B;  1VGY A;  4ZVH A;  4DL5 A;  1IVZ A;  1H72 C;  3BPS P;  4DPW A;  2FC8 A;  3KMQ A;  3QMQ A;  3TUP A;  4C11 B;  3J80 U;  5GAG U;  3C6T B;  4DV0 J;  3OTC A;  1R8C A;  4ED7 A;  4C7Q A;  4EO8 A;  1BE4 A;  4DSJ A;  4URG A;  2BRL A;  3PV8 A;  4AYB D;  2M2B A;  3M8P A;  3OL6 A;  4UY8 5;  2D3O 1;  2L48 A;  5GAE I;  2QYC A;  1HLW A;  4OX7 A;  1CJK B;  1BWE A;  4CLY A;  2VJU A;  2XLK A;  4M5G A;  1TQL A;  1RT2 A;  3KDN A;  2ZD1 A;  2J6U A;  3WC2 A;  3M4X A;  4LVO P;  5EGY A;  1H7X A;  2FGO A;  4F50 A;  4L3N A;  4JI0 F;  1KNZ A;  1RAB B;  2A2D A;  1PAE X;  2YNI B;  2GMJ A;  4Q8F A;  2HYI B;  4DFM A;  4YS2 A;  1JWW A;  4ZLJ A;  2FHJ D;  4BDP A;  4KYZ A;  1LK5 A;  4LF5 J;  4DLE A;  3K5L A;  1FEH A;  5D3G A;  3FMW A;  3IRX B;  3KLG B;  1YJ7 A;  1NKE A;  1YLX A;  1R6V A;  2RVJ A;  3V6J A;  2X3G A;  2XZW A;  2AJF E;  3O6Q A;  2V8V A;  2W8L A;  4ZHR A;  4CLU A;  3HDS A;  4EI2 A;  2IRU A;  2J0S D;  4JV5 J;  4DFK A;  2WSC C;  1UVM A;  4QR0 A;  2CJX B;  2RS8 A;  4JV1 A;  3BGR A;  4ZVS B;  2FJX A;  4ZP6 A;  1NM2 A;  3CDA A;  4PG5 A;  2MHE A;  5F8L A;  4LF8 J;  2QSF A;  2R2U A;  2CQP A;  1VIS A;  1K73 T;  2GHP A;  2KYZ A;  4OZ2 A;  3HUL A;  3M6U A;  4I68 A;  3I87 A;  1DAX A;  4ELT A;  4RWW A;  6AT1 B;  2JEJ A;  3AOD A;  2O01 C;  1YRU A;  2XBP A;  2DCL A;  2DEI A;  2W7A A;  5F41 A;  2G9O A;  2UU9 F;  4ZVG A;  2AZ1 A;  1DRZ A;  2V69 A;  5HMW A;  1OY9 A;  1JLQ A;  2XY6 A;  2QN6 B;  3U1N A;  4M95 A;  3MD3 A;  4KO0 A;  4Q8E A;  2VDI A;  1LV5 A;  3HVR A;  2WVB A;  1NB2 A;  4X66 J;  5F8H A;  4I67 A;  4J7C A;  2DTJ A;  4FYX B;  4B3M J;  1C1C B;  1RE1 B;  5K8O A;  1RI7 A;  1EQ0 A;  3DHW C;  3US5 A;  2C2O B;  3FEY B;  4YOE A;  4FDF A;  4KRW A;  2EFN A;  4I0W A;  2ZBP A;  3LQV A;  4OHW A;  2BEF A;  2WON B;  1HBU A;  3W5Y A;  3GB0 A;  2X1G A;  1W2I A;  2MDA A;  3ILI A;  1SJ4 P;  5CZV A;  3UI3 A;  3OV7 A;  2AJQ A;  2RDI A;  3MF5 A;  4AL7 A;  2AJ1 A;  5E0O A;  1SIW B;  3HKZ D;  1YI2 S;  2IA6 A;  1Q81 T;  4C8N A;  5FII A;  4F4A A;  4NXN J;  4XO0 A;  5HO4 A;  3OVA A;  2FVR A;  4C8M A;  4KB7 A;  5LJ3 Y;  2AYM A;  4LF9 J;  3CCU S;  4LUB A;  3R7S B;  4QW8 A;  3Q8U A;  4LR8 A;  2NUU G;  1WUU A;  2JEF A;  1WSV A;  4OZL A;  5KFY A;  1OPZ A;  2RQC A;  3PW4 A;  2L9W A;  2BJD A;  2GVZ A;  2VBZ A;  1TFY A;  4DR2 F;  2ZH1 A;  3FCH A;  4DXL A;  4DSL A;  2EFO A;  1VC0 A;  3P5T L;  2K2P A;  1KQF B;  3KK2 B;  2XYP B;  4MKV A;  2RHS B;  5E3R A;  3HFV A;  1RDR A;  3BS9 A;  1S7I A;  4PWU A;  2BAN B;  2VOP A;  3HPO A;  2IM0 A;  4ECU A;  1S9E A;  2VFS A;  2DHH A;  3EYZ A;  4OJ1 A;  1U0H A;  4ZDN A;  4EWT A;  5AJ3 J;  1T94 A;  4OLO A;  2G2Y A;  5ETT A;  4M8L A;  1KHW A;  4QOT A;  3J7Z 5;  1BQM A;  1MU2 B;  4ECR A;  4DHV A;  1SKR A;  2YQ1 A;  1ZTT A;  2EKY A;  4J37 A;  4RWX A;  1WHV A;  1ZZF A;  2AEJ A;  3ZO7 A;  3OD2 A;  2VF3 A;  5KT6 A;  1X4A A;  3EDR B;  1UVK A;  4EO6 A;  2GVD A;  3PHT A;  1HWJ A;  2JOQ A;  2A6O A;  2H3E B;  1RU1 A;  2CDR B;  2BKN A;  3J80 Y;  5KFT A;  2QG9 B;  3DRR B;  4O4G A;  1B0T A;  3GP9 A;  1N54 B;  2D69 A;  2EVZ A;  1RIS A;  5I3Q A;  3QGG A;  1T3N A;  4X62 F;  5ETK A;  4M5N A;  2H1Y A;  3T5L A;  3KTQ A;  1KR4 A;  2JLE A;  1LWE A;  4OHV A;  2XWY A;  1DTQ B;  2LXU A;  1HI8 A;  4UOC A;  1LWF A;  1U8W A;  4MKB A;  1T3O A;  1JLF B;  2CNN B;  3FSI A;  1CJV B;  4FXW A;  3HF5 A;  1KSP A;  5KG0 A;  1ZBT A;  2ZBI A;  5AT1 B;  4BLG A;  2W4D A;  3QID A;  2UUB J;  1F1B B;  3I0S B;  4CYU B;  2DHS A;  3RRK A;  5DG9 A;  2OTL S;  2GO9 A;  2H5I B;  2JEI A;  4CNY A;  4MT1 A;  1S10 A;  4TVA B;  4E98 A;  2E7W A;  4Y00 A;  2CPZ A;  1NK7 A;  2Q43 A;  3ONQ A;  3OR2 B;  4KFB A;  1GTE A;  2OI2 A;  2AZ3 A;  1N34 F;  1UW4 A;  3M32 B;  4DUY F;  4NLP A;  5K14 B;  2ZH3 A;  3MEK A;  1UWB B;  5KFF A;  1B0P A;  1GMV A;  2FTR A;  1VBK A;  5KFQ A;  5J2P A;  1S1V B;  3T19 A;  4LF6 F;  1RYS A;  1FWP A;  4FYY B;  4ZCM A;  1HBM B;  3T1Y J;  2PA3 A;  5KAK A;  3FVY A;  3RUB L;  2ADB A;  3BBF A;  1X4B A;  1F60 B;  3G6Y A;  1XMO F;  5KT4 A;  7AT1 B;  2B7C B;  2VON A;  3E01 A;  4JI1 J;  3C6U A;  2WRM A;  1HL6 A;  1NSP A;  1FKO B;  4NLW A;  2BE9 B;  2VIC A;  4DPO A;  4O0I A;  3I5C A;  1CSJ A;  1R0A A;  5D4O A;  3MFI A;  2W24 A;  4WU2 A;  2HAF A;  5HRO A;  4FKY A;  2P2C B;  3GCW P;  2WOM B;  4X4T A;  5F9L A;  1PIL A;  1MLA A;  3UPF A;  2EC2 A;  2UXC F;  1S76 D;  3A12 A;  2CNO B;  4I2Q A;  1PYO B;  3VGS A;  1IUJ A;  4B9U A;  1X31 C;  4FNH A;  1EQM A;  4E8U A;  2LEA A;  3IGV A;  2B6A B;  3OXF A;  3UCZ P;  2HHS A;  2M5Y A;  2OMO A;  3U02 A;  4IOA Q;  3BO2 A;  3GIR A;  4DR7 J;  1NK9 A;  4N7T A;  3MAA A;  1HPZ B;  4K0K F;  4URQ U;  3RW7 A;  4GKJ F;  1ITP A;  1S1U B;  2IY5 B;  4USM A;  2R2T A;  2OFG X;  4XAK A;  3FUY A;  3DU5 A;  4IG3 A;  2O1P A;  3GR0 A;  1WAC A;  2E7V A;  4PYD A;  3SV4 A;  5ETN A;  1LQ9 A;  2M8D B;  4M5L A;  3M2R B;  5IT9 U;  4KGV B;  4IDK B;  2BV3 A;  3SCK E;  3HVW A;  3KK3 B;  2YKA A;  4RBU A;  3UNG C;  2VG6 A;  3TJ9 A;  4AND A;  3HCX A;  4C8Z A;  1GXL A;  2YWH A;  4B3O A;  2K3K A;  3W2V A;  1XNQ F;  2EXU A;  4DV3 F;  2BR0 A;  4H4M B;  3CCQ S;  4K50 A;  4USJ C;  4RJV A;  3OHB A;  1KQK A;  3MM8 A;  1W26 A;  4ZJO A;  1RU2 A;  2HLU A;  3M8Q B;  2KFN A;  1VRQ C;  4NLQ A;  5IC4 B;  4JI2 F;  3GIL A;  5AXM A;  1IXK A;  3DLK B;  3HD1 A;  1HFE L;  2RB7 A;  2E5L J;  3HD2 A;  1N8R T;  2R7W A;  4PAB A;  2W2Q P;  1EX8 A;  2BKO A;  5C42 A;  4XPE A;  4R0E A;  3PYE A;  3MED B;  4OYZ A;  2YKP A;  1FNX H;  2HKE A;  1TUG B;  1B3T A;  2HNY A;  2NCK L;  1RKI A;  2J5A A;  4C2M A;  4EMD A;  1ZM9 A;  2LEP A;  4CLT A;  1V3Z A;  4CRJ A;  2Y9H A;  2VPX B;  2HK3 A;  2ATL A;  4P74 A;  1BUX A;  3C14 B;  1X4G A;  3R5D A;  4UTG A;  2CPH A;  4UOF A;  2AF6 A;  2HGM A;  1AUD A;  3N5B A;  5HVH A;  1RA7 A;  3W9I A;  2XGP A;  2DCU B;  3NY0 A;  1UA1 A;  4IFY A;  1BQN B;  4LF7 J;  4RUC A;  2AJ4 A;  3O2I A;  5E3P A;  4X4P A;  1IM4 A;  4KKO A;  3SCJ E;  1S5Z A;  2GHV C;  1LNQ A;  4NOH A;  1FK9 B;  2BUN A;  3H2V E;  4CWB A;  4PQU A;  3BH7 B;  3UO0 A;  3W65 A;  1RT6 B;  2LQJ A;  2MEW A;  1F5A A;  2ZE2 B;  5L1J A;  3E51 A;  4ED8 A;  2WBM A;  2R2R A;  4IOC Q;  4PRF A;  1RWO B;  2HHT A;  2W9B B;  4F36 A;  4U96 A;  1XEZ A;  2C2N A;  3NS5 A;  3QT6 A;  3QZ7 A;  1F2G A;  3BPD A;  4I2P A;  1RWW B;  4YR3 A;  3VZH A;  2OUG A;  3ITH B;  3O1L A;  1XMB A;  1TKD A;  4RR5 A;  5KFV A;  1RAH B;  2KB2 A;  3K5O A;  5H9E K;  5H9F K;  5KFS A;  2IC3 A;  3NAI A;  4LT6 A;  1YRT A;  3HI9 A;  2LXF A;  2DNO A;  4ZN1 A;  4KGX B;  1S79 A;  4QCL A;  3BR8 A;  4QIG A;  5LXR A;  4K4Z A;  2HHP A;  4F3O A;  1RT5 A;  2MZQ A;  5FDL A;  1CVJ A;  2FJD B;  2W2N P;  3D28 A;  4MFB A;  4K4Y A;  3EGV A;  1RHR B;  3UQS A;  3C19 A;  2UUA F;  3CD0 A;  4CO1 A;  3CJ2 A;  3TA2 A;  3QJJ A;  3MCN A;  5KG2 A;  5T41 A;  1TK0 A;  4ECZ A;  3KJV A;  3GFH A;  4ED1 A;  5EDW A;  2HHH J;  3D1Q A;  3W1Y C;  2F65 A;  4ZLL A;  3N01 A;  5K20 B;  1N32 F;  5AE2 A;  3W62 A;  1N5Y B;  3LP2 B;  3EPG A;  3LA0 A;  1RT4 A;  1RT7 A;  3MUT P;  4TNO A;  4DR4 J;  4EZ9 A;  1VQN S;  4Z37 A;  2X1F A;  1F2H A;  3RTV A;  3DOL B;  3GIM A;  2RU3 A;  4NE9 C;  3DYA A;  5E3C A;  2QYG A;  1UTA A;  1KRP A;  2F4F A;  2HHX A;  1APS A;  3B4M A;  1HA1 A;  2XEX A;  2B0G A;  3NEK A;  5K8M A;  1U1K A;  3QRR A;  3HSZ A;  1Q16 B;  2EG2 A;  4DPT A;  4LR9 A;  5IQQ A;  4O3N A;  2PA8 D;  4PWD A;  2OP5 A;  2E9R X;  2A6M A;  3MPD A;  4K8R A;  1Q8B A;  4DR5 F;  2GAH C;  4LIR A;  4HKQ A;  4Y6I A;  4F4X A;  3CCJ S;  3FQL A;  1O5J A;  3KLI A;  2DNG A;  4DX6 A;  1FX2 A;  1LXN A;  3UD5 A;  2R7U A;  3NBP A;  4AXJ A;  3UW1 A;  2F4V J;  2YPZ A;  1NUE A;  5IS2 A;  5GAE U;  2DRD A;  4KC5 A;  2O67 A;  3RU0 A;  2R8J A;  3MR2 A;  4C9D A;  2P9G A;  4HDG A;  1RCX B;  1FJE B;  3RAX A;  1E6V A;  1EET A;  4DEZ A;  4B02 A;  3D66 A;  3TVZ A;  2KKH A;  1SJ3 P;  1M90 T;  2G2Z A;  1U47 A;  5EHH A;  3IS9 A;  1VQ7 S;  1HD1 A;  3KLV A;  2ABY A;  4OZN A;  1XR5 A;  5CD4 A;  1YIT S;  1XR7 A;  3NAH A;  1UFW A;  2NXE A;  1PBU A;  1AZS A;  3FEZ A;  3OFF A;  3SIP B;  1DZ5 A;  4DSK A;  3MFH A;  1NH7 A;  2KFZ A;  2AGP A;  2HBY B;  3T41 A;  4ED4 A;  3IM9 A;  4Q7A A;  5DDP C;  4ED6 A;  2ALY B;  1S77 D;  3M2U B;  6FDR A;  4RBT A;  1URR A;  3NWG A;  3V4I B;  2LP4 A;  5IT9 Y;  1S6U A;  4A8W A;  1NPP A;  5A8R A;  1V5V A;  1VRT B;  2L3M A;  5ITH A;  1QAJ A;  2DGX A;  3C3L A;  1D9D A;  1NSK L;  1JLG A;  2VFV A;  2R7O A;  2HQ3 A;  2ZIT A;  2UUW A;  1OQ3 A;  1U4B A;  4CTA B;  2QA2 A;  2NSC A;  5CAB A;  2BQR A;  1VQ5 S;  2QMW A;  3HT0 A;  1MG7 A;  2C3M A;  1KFS A;  2BX6 A;  2JWN A;  4B3R J;  2DK2 A;  3EZU A;  2D41 A;  5IV4 A;  1NRK A;  1H38 A;  2ZBC A;  5KFW A;  1IQT A;  1W7W A;  2XG8 A;  4K4W A;  4K59 A;  1DBD A;  5DDR C;  4DR1 J;  2XQC A;  2M70 A;  4X64 J;  2QE5 A;  4XIU A;  2I5J B;  1WC0 A;  2UVV A;  3CJS A;  5LMN J;  4WPA A;  2QIF A;  4FS2 A;  3IC1 A;  3JYT B;  4DDF A;  1R31 A;  1YZ7 A;  1RT3 B;  1U1P A;  2AYB A;  2R8K A;  3AD9 C;  3DLL Q;  2DRA A;  5M2U A;  5J1E A;  3EWG A;  4RNM A;  3F0N A;  2IVY A;  1TKT B;  4TQS A;  2J0Q D;  3F44 A;  2G13 A;  5LXY A;  5A2Q U;  2XGQ A;  3PXG a;  1S97 A;  1YK9 A;  4X65 J;  3R2D J;  3DLJ A;  4LRB A;  4DV2 J;  2HFZ A;  1NPK A;  3A3N B;  3QT8 A;  1B70 B;  4WF9 Q;  1WEL A;  5IZH A;  2WSE C;  9ATC B;  1HBO A;  3GJQ B;  2HMI A;  2KXH A;  2LDY A;  2DO4 A;  3W63 A;  1KOH A;  2MY8 A;  3R27 A;  5KG7 A;  4ITS A;  3MOZ A;  3UDL A;  4OV6 A;  1LWC A;  1UJ4 A;  2F7V A;  1MWZ A;  2FGC A;  4RW9 A;  3W66 A;  4ZPB A;  2KG0 A;  4ETZ A;  3DDK A;  4TLQ A;  1RTH A;  2DHX A;  1VR6 A;  2QV6 A;  2B4P A;  2DNR A;  1VIO A;  1ARO P;  1CUL B;  2POK A;  4KJI A;  4EU0 A;  3MCS A;  2HWT A;  2QL7 B;  2IVM A;  4F67 A;  2KM8 B;  4TY8 B;  2VDH A;  4JI6 J;  3WIU A;  3LAM A;  4P2S A;  4USV A;  3EXC X;  1IBL J;  3JAM Y;  3AQO A;  3E8O A;  4ILL A;  4QPX A;  4JV0 A;  2O3D A;  2Z30 B;  3ULH A;  1IBK J;  1T9W A;  3ISN C;  4ECW A;  1NK5 A;  3LGN A;  3R6L B;  1R3N A;  4QQB A;  4KV8 B;  3ZZO A;  5CYM B;  3GCX P;  4LJM A;  2CAJ A;  2WK4 A;  4B9L A;  4NZ7 A;  3NGS A;  4FN5 A;  4M63 A;  1HD0 A;  1YBT A;  4IR9 A;  2IDE A;  2OPR B;  2JLF A;  3WQP A;  4LQ9 A;  5L46 A;  1REV B;  5A8W B;  3VAM A;  1LFP A;  2R7R A;  5HMX A;  1FRX A;  4DV1 F;  2CG4 A;  3R8Y A;  5D4N A;  9RUB A;  3K17 A;  3TAR A;  3EUN A;  2DY1 A;  4KSE B;  3DM2 B;  1S1X A;  3DOK B;  1M5H A;  4N8O A;  1ZAV A;  2CPI A;  3LOU A;  1GEH A;  5KFH A;  2HZC A;  4JI4 J;  1Q1K A;  1N0U A;  4YHH F;  2HS0 A;  4TYB A;  2FJB B;  4LF5 F;  1T11 A;  1JKH B;  4RW6 A;  3CO0 P;  2OLW A;  4C8L A;  4DSF A;  4DG1 A;  1VQP S;  1NK4 A;  4NWB A;  3LP0 B;  1DHM A;  4EYH B;  2DGV A;  3BGF A;  3I82 A;  5ADZ A;  4QR2 A;  2ZM6 J;  3D0G E;  4LBP A;  2PT0 A;  4C48 A;  1MWY A;  1U7L A;  1SH3 A;  4K4U A;  2YKN B;  1QDU B;  4JV5 F;  3LO3 A;  2ZH6 A;  2CIM A;  4MAK A;  1SBR A;  1RTD A;  2VBW A;  3TI0 A;  2G0J A;  4MH8 A;  4Q2L A;  1X5S A;  2FDN A;  4QWD A;  2KU7 A;  2BW2 A;  4CI0 B;  3BR9 A;  1ZTW A;  1U1R A;  2HS3 A;  1AUS L;  4QPT A;  1BWV A;  1VHF A;  1T9U A;  3G4S S;  2EWH A;  2E7X A;  2DNM A;  1R43 A;  3M6X A;  2RDD A;  4YFU A;  1SCJ B;  1HHT P;  4S0M A;  5JVH Q;  2DR6 A;  5D4P A;  2VKR A;  3L7P A;  2FLP A;  2CG8 A;  3VAL A;  3G82 B;  4CNZ A;  8RUC A;  1H7W A;  3T9N A;  4OYW A;  4ILM A;  1FDA A;  2UXB J;  2PMZ D;  3NXZ A;  3RJM B;  4DPX A;  4DL7 A;  1U0S A;  3JSM B;  4U9R A;  3R5J B;  1S0V A;  4DZD A;  3NLC A;  2ILZ A;  3LWL A;  3RG6 A;  1C0U A;  3DRS B;  4Y2I A; 
#chains in the Genus database with same CATH homology
 1EQM A;  5ETL A;  4M5M A;  3MCN A;  4M5K A;  3HSD A;  3HSJ A;  4PZV A;  1CBK A;  4CYU B;  4M5J A;  3ILI A;  1RTZ A;  3HD1 A;  3KUE A;  4F7V A;  3KUG A;  5ETM A;  5ETV A;  4M5N A;  3UDE A;  3HD2 A;  1F9H A;  3IP0 A;  4CWB A;  1KBR A;  1RAO A;  3HT0 A;  2CG8 A;  1HKA A;  5ETQ A;  3UDV A;  1EQ0 A;  1G4C A;  3ILL A;  5ETN A;  3KUH A;  1EX8 A;  1IM6 A;  2F65 A;  3HSZ A;  5ETR A;  1DY3 A;  5ETS A;  3ILJ A;  3QBC A;  5ETO A;  3HCX A;  3MCO A;  4AD6 A;  3ILO A;  1Q0N A;  1RU2 A;  3MCM A;  4CYU A;  4M5L A;  4M5G A;  1HQ2 A;  4M5I A;  5ETT A;  4CRJ A;  1TMM A;  1RU1 A;  3HSG A;  5ETP A;  2F63 A;  5ETK A;  1TMJ A;  2QX0 A;  2BMB A;  1RB0 A;  3UD5 A;  4M5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...