1NSPA

Mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
149
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Mechanism of phosphate transfer by nucleoside diphosphate kinase: X-ray structures of the phosphohistidine intermediate of the enzymes from Drosophila and Dictyostelium.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 43
structure length 149
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1995-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nspA00
3WX8A 3PJ9A 1JXVA 3GPAA 3MPDA 3B54A 1WKKA 5BXIA 4UOGA 3GP9A 3VGSA 2HURA 3Q89A 1S5ZA 1W7WA 1NDKA 1K44A 4F4AA 2ZUAA 2VU5A 3Q8UA 3VGTA 1XIQA 3JS9A 3B6BA 3PRVA 1NDLA 4KPCA 4UOFA 1LEOA 3ENAA 4DUTA 1VYAA 1ZS6A 4W98A 1S59A 4DI6A 3ETMA 3FBFA 1U8WA 3FBCA 1F3FA 1MN7A 1WKJA 3DKDA 1BHNA 3ELHA 2DY9A 3VGUA 4C6AA 3EMTA 1NDCA 1BUXA 3EJMA 3EVWA 4HR2A 3ZTRA 1NDPA 4O0NA 3NGTA 4ENOA 1NB2A 3NGRA 1B4SA 1F6TA 1HLWA 3NGSA 3BBBA 3NGUA 2DXDA 2CWKA 4FKYA 4UOHA 2AZ1A 1LWXA 2DXEA 2HVEA 4ANDA 4CP5A 4S0MA 2B8PA 3FCVA 5IOLA 3VVTA 3FBEA 4FKXA 3EVOA 3Q83A 1NLKL 3FBBA 3EE3A 5C7PA 2AZ3A 1NPKA 2DXFA 1WKLA 1EHWA 1NSPA 1MN9A 3BBCA 5CAAA 3EM1A 2NCKL 3G2XA 3DDIA 1HIYA 2DYAA 5CABA 3ZTSA 3L7UA 1NCLA 1S57A 3ZTPA 2BEFA 2HVDA 4ANEA 4ANCA 1HHQA 4EK2A 1PAEX 1B99A 1PKUA 3VVUA 3Q8VA 2B8QA 1BE4A 1NUEA 3FC9A 3BBFA 3BH7B 1NHKL 1XQIA 3BH6B 3Q86A 1NSQA 3FKBA 3Q8YA 3ZTQA 4F36A 1NSKL 3EVMA 3ZTOA 2BX6A 1KDNA 3FCWA 4DZ6A 3EICA 4WBFA 1UCNA 3R9LA 3VGVA
chains in the Genus database with same CATH superfamily
5HQ8A 3AJDA 3MF5A 5E3AA 4MAKA 1YRTA 2Y8WA 1X5TA 4ZLLA 5KT7A 3QWPA 2R7TA 6FD1A 2XMJA 1GXTA 5ADZA 4K8RA 2C2ZB 2EKNA 1M5VC 3LP1B 3DKDA 1VQMS 4OLPA 1S7HA 3ZTRA 1RT4B 2I0XA 1M1KT 4E0DA 3TA0A 1XNQJ 4A4JA 2LQ9A 4OJ1A 4EEYA 1HHTP 4EO8A 4USIA 2JNJA 2GJ2A 3DM2A 1UA1A 1RADB 3KNGA 3UN2A 3KMQA 1QY7A 2YWEA 2OPPA 2DY1A 2VG5B 3R5GA 1XMOJ 1FDDA 1B0VA 2GJFA 5IWAF 3DXSX 4TXSA 2FHOB 6AT1B 4AQYF 3D0GE 3UCZP 1HPZA 5IV4A 1HKAA 4I7FA 4BWMA 2V4QA 1HR0J 1XMOF 4LVOP 3QNWB 4PWUA 2DNNA 3LA0A 2K1RB 4B3MJ 3TJ8A 2CFXA 2MKYA 2AGPA 1N0UA 3RR8A 4MKYA 5GMDA 1JMTA 1FWPA 1WSRA 2VFTA 3JYTA 1TVRA 2BZ2A 1ZS6A 2E1RA 2BA9A 2KHCA 4FDFA 2CNNB 2HHHJ 4JP8A 4OI0A 1RTDB 1HYSA 1R0BG 4LR8A 4Y2AA 5D8HB 1F2GA 3CW2C 2BKOA 1S6QB 1CS4B 3MM5B 1TAUA 5DQGA 5BYRA 4BHQA 3C16B 5DZ6A 4K4SA 1G3OA 3GWCA 1IKVB 2N7YA 3FZ2A 4O3NA 5HBMB 4WFBQ 2KG0A 4PZVA 1WORA 2FVSA 2DCUB 4J9SA 4CLPA 4YDDB 2ILYA 2IY5B 4FXVA 4RR5A 1UVMA 3JTNA 4HDGA 4QBUA 2F5GA 1NSQA 4ECWA 4LRBA 1T03B 2K3IA 2ZKUA 2L9NA 3AB2B 2OLWA 1R6YA 4CLLA 4X4UA 2JEIA 2RKIB 1F9FA 3HSGA 5CA5A 2VBWA 3M9OB 3A13A 1MROA 3SSRA 2CQIA 3W2VB 1UETA 4Y65A 1NDLA 3G6VA 4E8UA 3W62A 3R27A 3M6WA 2HBRB 2FHMA 1SL2A 1QSLA 2DNGA 3I0SB 4OZ2A 1F3FA 5AE3A 2HHQA 2LEPA 2HPUA 2RSQA 4DV3J 1SL1A 2CQCA 3CD0A 5G0RA 2K06A 4GVBB 2LCWA 2QMXA 5L1IA 2HHSA 2HQIA 2IVMA 4PWDB 1QVFR 4KE5A 3BSAA 4CRJA 4KFBA 3HDSA 2OIHA 1HQEA 3IC1A 4C8NA 2CRLA 2VQFJ 2HWTA 4GO7X 3IM8A 2FJBB 1R8CA 4YUDA 1RA7A 2ADCA 2QEXS 1Q5YA 2RF2B 2ATCB 3RW6A 3HVTB 3DDNA 3ENVA 4DSEA 2M8DB 3BH6B 2PIIA 4RUHA 1AZSB 4JOUA 4I6WA 2ROPA 2H5IB 5C24B 2E7VA 4LF8F 2F3JA 1SKUB 2DHSA 4L74A 2HGLA 2CWXA 2IAJB 3IWLA 2R7VA 3NMRA 3TARA 5KFJA 1KRPA 3UNYA 3DRPB 3IAM9 3NWRA 4FF4A 3MHYA 2MQQA 3F44A 3US5A 2JLEA 3DNCA 4NLWA 2OEJA 3SEOA 2W2QP 3LAKA 2FVQA 1H7XA 3HPOA 2W9BA 2XEXA 2ZKTA 4ETXA 2VH7A 5EHHA 2E7XA 3NMAA 1HQUB 4H4KC 2ZD1B 1S72S 4KHRA 2ZNZA 2AYBA 2MJUA 4K4TA 3EE3A 2W8KA 2XY6A 3SCIE 1HNZJ 1WKLA 3PHTA 2XYPB 3DOMB 1CBKA 1UEKA 3VAMA 2YNIB 2LMIA 1HBNA 2RRAA 1RLDA 2DGVA 3C6UA 2BEFA 2HVDA 2AKWB 2W1BA 2HBQB 4J91A 4HVZA 5B0CA 1U2RA 1JJCB 4NMLA 2V94A 4B9MA 4PEOA 2FVPA 2V8PA 1T9VA 2BE2A 4WP9A 1E6YB 5BYQA 2VA2A 2MYFA 4IH7A 4P2MA 1UJ4A 4Y2KA 1HNWJ 5GADI 2H1YA 2V68A 1U02A 3Q8RB 1M5OC 2HLTA 2UXCJ 2KHDA 3VALA 1R8BA 5F0UA 4DS4A 4ZITA 5JUMA 4DCOB 4OJHA 4CWBA 2UXCF 3OTBA 2FZKB 4F2RA 3NOGA 3KLEA 1X60A 2B8PA 1BGXT 3U1MA 5E3QA 5ETMA 2CNKB 1NPKA 3QAEA 4B9SA 2RMLA 3PX4A 1HWKA 4XDCA 3ISNC 4NLXA 4BBYA 5B09A 1Y4ZB 1Z4UA 1U09A 2ILZA 3CNQP 1HBMB 1PKUA 5A8WA 4HKQA 3POTA 3J81j 3NKYA 3B54A 3FEZA 5KG3A 1URNA 2XS7A 3NWGA 1FRMA 3CJ8A 3T1AA 3GYNA 2XTJP 2ZITA 3ILIA 2NQPA 1U0HB 2RHQB 2NS1B 2O66A 3J7ZT 2I2YA 3QSIA 1J27A 1O6XA 1RXOB 3FDSA 1KFDA 3EJMA 1TKXA 1EAYC 4DG1B 4ID5B 4KAIA 1JLBB 3NAHA 2MKHA 2UUTA 1UPMB 3AB4B 3ZZPA 4QJVA 1NHVA 1TKTA 3ET6A 5J1EA 1NB7A 1AA1B 4HH0A 4LIWA 1N8RT 4USMA 1XC9A 2OTJS 3C15A 2J7WA 3AQOA 1N33J 1KBRA 4IUFA 1SH2A 1S9EB 2DO4A 1CJKB 1UW4A 1QUPA 3WIUA 4ATNA 2WVEA 5J2MA 4LF6J 3KLGB 2W7OA 5E7OB 4BDPA 2QMUB 4ZVEA 4DLEA 2N4DA 4KIAA 5D6GA 1HWUA 1RJJA 1YG0A 1VQYA 2JFKA 3BKFA 4ZDNA 2ZJQQ 2Y0SD 3D6MB 3KHHA 4FPRA 3PRVA 3UN3A 1LEOA 1RT7B 4JI5F 3KDOA 1TTHB 3BO3A 3LALA 4LQ9A 3UCGA 2QT7A 4IH6A 3UDVA 4JUZA 1LW2B 1Q7YT 3JAMY 1AUDA 1W25A 4QPXA 3HHEA 4IDKA 2KZZA 1WDTA 5FJ4A 5A8RB 1G6BA 3IRWP 4W4MA 3OLBA 3R1HA 4Q7AA 4R25A 5C25A 3LW5C 4DFKA 4O0IA 2QJ3A 1HIYA 2UU9J 4ED3A 3VAGA 3SBMA 1N48A 4F67A 2DNHA 3CJTA 3Q8VA 2Q6CA 3DGVA 4OYZA 5LXRA 5EWEA 3HT0A 1J5OA 3H90A 4P72A 2EW9A 4DU8A 3J7YU 4P2SA 2DJWA 1FF2A 1V6HA 1JLEA 4PAAA 1N54B 3KJVB 3QJLA 2BW7A 3SXLA 4RW8A 2VPYB 3KLIA 4FF1A 2QE5A 4CLUA 3EGVA 2R2TA 3NGKA 4J7CA 2DPJA 1RWMB 2LU1A 5E2QA 1RTJA 4NA2A 2K2PA 4QWBA 3EXCX 4CO4A 1DRZA 3G96A 1SJ4P 2VFUA 5HP1B 5G4DA 4DR5J 3G8TA 4ZPBA 1TL1B 1FFWB 4B02A 3DOLB 3IRXB 4JI4J 3N79A 1B4SA 3IGVA 2CJXB 2R7WA 3JXOA 4ZA1A 3M8SA 3BSNA 5KFGA 3I5CA 4CLKA 4ZPVR 5J2PA 2QA4G 1SVDA 2ZH9A 3BBCA 5IXUA 5HN0A 2ERRA 5DLFA 1FEEA 3AODA 3NCPA 5E0OA 2D3UA 4USKA 2KM8C 4RUAA 3U27A 3QT7A 4ZPCA 1ZAVA 4A8FA 3HHKA 3AAWB 3Q8YA 2G0CA 5EWGA 3Q0AA 2W9CB 2DNLA 2IRXA 4DZ6A 2DH8A 1UVLA 3IM9A 3CJ5A 1S1UB 1RAIB 2FZCB 2XLJA 5K20B 4FXWA 4NEZA 4F4AA 1WTBA 2HVIA 2Y3YA 3H98A 5MLCV 3OXFA 1RLCL 1X0FA 4HI1A 3GV7B 3I31A 1FKPB 3KUEA 2A2DA 4DPUA 4EFAC 2AJ1A 4Y2MA 1L3SA 3J81Y 1MN7A 2IMWP 2YKNB 2R2UA 1RT4A 4FZVA 3G9CA 2UUCJ 3EDQB 2QN6B 2RU9A 3PHEA 1P1LA 3SCJE 2JVOA 3AH6A 2KJVA 5CYMB 5IOLA 3TAMA 3UDLA 3MM7B 2CNLB 3GIJA 3HULA 2YWFA 1VIXA 1D0EA 1PIEA 2VG5A 2J9EA 3MEDB 3K59A 3MR5A 1NK5A 2VA3A 1U48A 1H72C 1HMVB 2N3OA 5IM0B 3DRYA 1WF0A 1ZZNA 2PI4A 2Y0BB 3GTYX 5L46A 3LQVA 2K1RA 4NWBA 1N32F 2HVZA 1NPPA 1FTCA 1A0OB 5DJBA 2AYGA 2MJNA 3K8VA 1GMVA 1G1XA 2H4YB 2GMJA 4GRSA 5L39A 4Q0BB 3B4DA 3UPFA 1WHYA 3ETMA 1OPZA 2YKAA 2R7RA 1GK8A 2DGSA 4USUA 2G2OA 3R6LB 1RTDA 4J9NA 5KG0A 2V8GA 3X3UA 4UOCA 2CPHA 1X4BA 3CMAS 4XO0A 1S6QA 4FKYA 3ZXWA 1CS4A 3MMAB 4WU3A 3ISND 2UVVA 1H2TZ 4CT9A 1NJXA 3PFOA 2HHPA 3C16A 4YB6A 1ELOA 4Q8EA 1IKVA 5HBMA 2KVIA 1KFSA 2NCKL 1LQ9A 1HW9A 3MURP 4WXWA 4DR3J 5CABA 1QAYA 1V3ZA 3OTEA 1T03A 5CHCB 4K0KJ 1BLUA 4QQBA 4WBFA 5E3PA 2VDHA 2RKIA 2BKNA 2BW2A 3TUIC 2XI3A 4QR1A 2Y9HA 4P7TA 4J90A 1P6TA 2MQNA 4RX6A 1IN0A 2CPJA 3W2VA 2YKOA 3CXCR 1YHQS 5CCMA 1N5QA 3KK1B 4Q43A 4EBCA 4NRUA 2V63A 3I0SA 3CT9A 2RS8A 5ETLA 3G6YA 4I0WA 4PWWA 2VB6A 2ZBCA 4GVBA 4U96A 2FJXA 4UQTA 4PWDA 3CJQA 2IC3A 2IJNA 4L3NA 3OL8A 4LF1A 5D3GB 2IFXA 1K8AT 1FO1A 2X1GA 1SH0A 2GHWA 2M7SA 5K8MA 2ROGA 3MPVA 1VQ8S 3MCSA 2BV3A 2RF2A 3DLGB 2VICA 4O3SA 3EPIA 3RG6A 1PBAA 1H3DA 1S0OA 1DAXA 3M8RA 2MZQA 2CJYB 4N7TA 5EUHA 4F36A 4OI2A 5C24A 4WYLA 4DN0A 3FCHA 1XR5A 5IFMA 4C3LA 2PI5A 2Z2ZA 3T5HA 2IAJA 4NLQA 1NDKA 4CO3A 1HNXF 3CCUS 1XNRJ 3HHNB 1Q81T 1X4GA 1N0VC 3DRPA 5IQ6A 5DG9A 1G7CB 1VYAA 4RBTA 5KTQA 4CM2A 2GQCA 3CDUA 4FVMA 4LBPA 4LF4J 2Q66A 4K2XA 3H4DA 3GSDA 3MEKA 2F8EX 2HFSA 3VGUA 2RDIA 1HQUA 5KFRA 4TQRA 2ZD1A 2QRRA 4LF4F 3P5BP 4QR0A 2ZE2B 2KXHA 3CCSS 2QA4S 2OH2A 2HRYA 5KFQA 2AX1A 3DOMA 3R2CJ 4N8NA 4OX8A 4YHHF 4J9VA 1D9DA 5F8JA 2W9AA 3I9ZA 3TA1A 4OYOA 4M8LA 1U2FA 2F63A 3D1QA 4OX7A 1JK9B 3OR1B 5KFUA 1ULRA 2NUUG 1RTIB 2RUSA 2Q3PA 4K7QA 3H5XA 1E6YA 2DKOB 4U95A 3BSOA 4OHXA 1MLAA 1N56A 1NEEA 4ZVQB 4JBCA 4NA3A 3E51A 3H25A 2BRLA 3KHRA 3VGTA 1CLFA 3TO8A 3B6BA 1FTRA 1D9FA 2KFZA 1NXIA 4LF5J 2RRBA 1T8EA 4CO2A 5BR8F 4XTTA 1S0NA 5HMYA 2ZC4A 2CPIA 1NDCA 2XBPA 3SSQA 1EB0A 3U1LA 3H2UB 4MKVA 4B3RJ 1S1VB 4KH0B 5HLFB 4I2PB 4USTA 4M5JA 3VVTA 2B4VA 2NXCA 3DXBA 4TU8A 5THWA 4UY85 3ITHB 4JV5J 5D78A 5KFWA 2F8MA 4KGXB 3GCWP 2CJKA 4J9RA 2CIMA 4HTJA 2V2ZA 4F4ZA 2WONB 1CJVB 1FRIA 4JV5F 3R7SB 5LSOA 2KYXA 3C46A 4AXIA 4ED5A 2QIFA 4WIQA 5KT6A 3CB4A 1U1LA 1RAHB 2PFDA 2UXBF 4O3RA 3HLUA 3HK2A 2HZCA 3TX0A 4WFNQ 3GONA 4ZPWR 3I55S 1U0HA 1JLAB 1UAWA 2J0QD 4CDIA 3NRBA 4JYAJ 3HSJA 3L7PA 2FJAB 2ASDA 1RWWB 1F5AA 2OPQB 3FFIB 1MNEA 2YH1A 3H20A 2E9ZA 1FNXH 4X2BA 4KHPF 4ZPTR 3CC7S 3KLFA 3FQLA 4DG1A 5EWFA 3CD6S 4ID5A 4ZVGA 2MKCA 1HWLA 3O8WA 1JLBA 3CJ4A 1KVKA 2XMTA 3NGSA 2J5AA 3NGUA 4ZJLA 1WF2A 2KO1A 2RQKA 4ZHRA 5B0DA 5HVFA 3I6PA 2IM3A 4QYZK 4I2QB 2WTFA 5H9FJ 1GTHA 2OTLS 1NNDA 1SQEA 1S9EA 1CJKA 3TJ9A 1ZAXA 4OYIA 4JI7J 3W63A 3KLGA 4TN2A 3GV5B 1Z2LA 1M5KC 1RWVB 1Q4RA 4NYPA 2NXNA 3SCLE 2KZMA 5ETRA 4LMZA 3S01A 3CDBA 4JI7F 1CJTB 1HI0P 3PYGA 4DSIA 4FS2A 5BJRA 1JIHA 4IRCA 2IBOA 4C8LA 4O3PA 2HYIB 4FBTA 3QIDA 3G6XA 2XZWA 2HNZB 1LW2A 1RTZA 2WW4A 1OSCA 2DIVA 2OPSA 5KFIA 5KFTA 5CQGA 5AE1A 1NKCA 5LMNJ 2E5LJ 2DTJA 5A8RA 5U47A 3NGRA 1U25A 5A76A 3IS9A 2E5IA 2AZ1A 3D68A 4LSLA 5I4MA 4R5PB 4F4KA 4YMEA 1FWLA 5ITHA 3MCMA 2MXYA 4NPOA 3V6HA 3UE2A 5E5NA 1FRXA 4F4YA 1L3TA 1TK5A 2BACA 1RT6A 1PC5A 1VC0A 3TOQA 3N5FA 2X3GA 5LL6d 3KJVA 1OS5A 1FX4A 4BC7A 3AOAA 4LJMA 1RU1A 1N52B 3QLHB 3PX6A 4QR2A 2XYHB 3MPWA 2YKQA 4IFVB 4JB8B 1WF1A 4DUYJ 1L3KA 3AQPA 2XMUA 2V8VA 5HP1A 3PR4A 1UEVA 2P2CB 1U47A 4ZJOA 1TL1A 3T1YJ 4CZCA 2F1FA 3DOLA 3IRXA 5LMUJ 1H0HB 1UMJA 2Q6BA 3VV2B 4PRFA 4KKOB 3MM6B 2A18A 3MR7A 4M95A 3CCZA 3H0PA 2V34A 2DHXA 2YWKA 3CJSA 2XO7A 3ENQA 2MKJA 1UA0A 2D41A 4QOTA 3MI7X 1F60B 1T9XA 2FJDB 3JQJA 2DR8A 3DDIA 4C8YA 5J2QB 4TY9A 5GAHI 2I5JB 4ITSA 3PYFA 5K9FA 1RTHB 2W9CA 2Y1JA 1U1QA 2O01C 3C3LA 1XMQF 3WX8A 7AT1B 1FT8A 2GJIA 2HQFA 1U26A 2X1FA 3DRSB 4J9PA 1TV6B 1YI2S 2BMBA 9ATCB 4MIBA 2VFVA 4C2MA 4DR7F 3TZWA 2D7SA 3MMCB 1FKPA 2XY5A 3M8YA 3RB6A 2WOMB 3OQ2A 2YKNA 4R0JA 1RB0A 4Y00A 3I5BA 3CJ3A 2C2NA 1MG7A 5ETSA 4TY8B 5CYMA 2GC8A 3MM7A 2GVDB 2HZVA 1FE0A 3Q83A 4CLWA 3WC2A 1FCAA 4MTPA 4FBUA 1XERA 3KLVA 4TQSA 4HDHA 1P8GA 5HK4A 4DV1J 1XMBA 4DFMA 2HQCA 4L73A 1HMVA 2MMYA 5IM0A 1OJ4A 1JJ4A 1U4BA 2EK1A 1L3VA 2PE8A 4DV1F 4YB1P 4OYXA 3IR7B 1TAQA 4GVLA 3TA2A 4PQAA 3N0VA 4HI2A 5F0WA 3KK3B 4IR9A 1TKZB 1IR0A 1N34J 3OSNA 2OO4A 1WSVA 3MMBB 3D3BJ 3LWMA 4EBEA 3D3CJ 2BQUA 4J5OA 4Q0BA 4Y2IA 3MDFA 2KRBA 4ZPAA 3M05A 2EFNA 2UXDJ 2KXNB 2WCXA 3R6GB 1KLNA 2V5HG 2BJ1A 4QIEA 3OJUA 4NI2B 2BM0A 1WEZA 3G86A 3TVYA 3EYZA 4GC7A 1RT3B 2UXDF 2FLNA 3MMAA 5B0GA 4DR6J 1HI8A 3KXDA 2GHPA 4WU2A 4DV6F 4EU0A 2DNZA 1EHWA 4HYKA 1X4EA 2KT5A 2D69A 2UUWA 1WC0A 1XN9A 1G2EA 4LBHA 2RHSB 2F9JA 4RW6B 4EYIB 5AE2A 1HARA 5CH7B 3GJTB 3AOBA 1DBDA 2J6SA 3NG8A 3QGIA 1VRUB 4DQIA 4ZCKA 4LT6A 1OO0B 3HI9A 3E2EA 1J2VA 2WSEC 4ZCLA 4IO9Q 2YKMB 2R8KA 4L6V3 1YJUA 2DR9A 1YKWA 1M1GA 1IBCB 1ACMB 2AHOB 2AYEA 5HVHA 2P8IA 3KK1A 4U7UK 2HGMA 1TELA 1XTZA 3C6TA 3HVRA 3I82A 4H4OB 2CADA 4F7VA 3VAFA 1ROFA 2ZNYA 1KOHA 2EBEA 3PEJA 3MCNA 5D3GA 1UJ5A 4ENOA 1X5OA 3D7SB 1RCOB 2B0GA 3M32B 4UOHA 1T02A 3OD2A 3CCWA 2UV8A 4K4VA 3DLGA 2J8AA 2MB0B 1F9EB 5D4OA 4ES2A 3A4TA 2G9OA 3QATA 5EX3A 1VHIA 1RWXB 3ZZUA 3UCUP 3Q8QB 3KG0A 2AP6A 4PG8A 4OHWA 3IBFB 3UNGC 1R0AB 4OX9F 3BEGB 2W25A 2AWZA 2E29A 2J6UA 4OI1A 3UFCX 4JI3J 2FC8A 3DGPB 2KYZA 1SI9A 1REGX 3TAQA 4NA1A 3D6FB 4PQUB 2DHHA 3D0IE 5H9EJ 1SH3A 4LF9F 2G13A 2ZUGA 2HAFA 1NPRA 1WOPA 2GQQA 1Q8KA 1FXRA 2P6TA 4RU9A 5A0YB 4BS2A 3THTA 2DEIA 3DM2B 3NGTA 2ZE2A 2V2KA 1M90T 2FHJA 3QZ7A 4AD6A 3NXZA 1U1KA 1NK7A 4X62J 3BZQA 2X3DA 2E1AA 5LJ5Y 4KB7A 4RW7A 1LXJA 4DCPB 5LXYA 3MMJA 3OR1A 1WEXA 4P2FA 1RTIA 8RUCA 1R7IA 1BMQB 3PVXA 4ZP9A 2B4OA 2BX6A 2CXEA 3U02A 1KEKA 3RUBL 1N5YB 3KOAA 3DLJA 4PABA 3IFEA 4OZ5A 3QJPA 1RUSA 1WKKA 1DURA 2HS4A 2VPZB 3AJ2A 2EFPA 1TVRB 3DLEB 4WZQA 1SKWA 2B9WA 3W64A 3ULHA 2BQRA 1IBLF 3JS9A 1QVGR 2BE9B 4LF7F 1KR4A 4A47A 3MEGB 2Y1RI 3GB0A 1B0TA 1V5VA 4LR9A 4HT5A 3TR5A 3HSZA 4OL8A 2ZBRA 4RNHA 4B3TJ 4KQZA 4RUBA 4A8YA 2EK6A 1S1VA 1C1BB 5HLFA 4I2PA 4YN3B 2Y8YA 1I94F 3GR1A 4P10A 3ITHA 4B3TF 4FF3A 2JEFA 4I1TA 2J9DA 3M9MB 2XG8A 3L09A 1XK8A 5F41A 3P3DA 5F3ZA 5EDWA 3D2WA 5DG7A 2HNYB 3JAMU 2WONA 1CJVA 4NLGA 4WP8A 1REVB 2UUAJ 2B8QA 2LVWA 1BE4A 3W9JA 3VAKA 3FKBA 3JTPA 2ZM6F 1ZTTA 1TL3A 1IBKF 3DI6B 4A48A 1B3TA 3P6YC 4A8XA 4LQ3A 1JLAA 3Q89A 4TYBA 4NLRA 2GIRA 2DGOA 3O5TB 2OPQA 3TAPA 3FFIA 3CULA 2A2CA 1RGVA 4ZOSA 1Q78A 2AT1B 2W4CA 5I3PA 2YX7A 4K2JA 2YH0A 3RB0A 3GMGA 3HHLA 1Q53A 1BWEA 4KFBB 4NLUA 4N47A 3AFGA 4WKYA 3BQ2A 1IM6A 4P6QA 1NDPA 2RUGA 4RNMA 3Q23A 2ALYB 3SIPB 4PUOB 3KK2B 2AU0A 1D1UA 3LTOA 2FIUA 1LWXA 4I2QA 2IDLA 4IFYB 2M3DA 4ZJQA 3T41A 2AMCB 4NEYA 5C2GA 2R2SA 2RQCA 2CPDA 2C22A 4YY3J 2H48B 2J76E 1B7YB 1UCNA 1A9NB 3R5DA 4PXBA 1CJTA 2RIJA 3B82A 3M8ZA 3EZ5A 1AT1B 2HURA 1OY8A 5GAEI 1JX4A 4C8MA 2HWHA 2N82B 1VHFA 1QTMA 5GMEA 4HHUA 1DY3A 1HBOB 2AQ4A 2ZOMA 1RKJA 1YJRA 2HNZA 1Y3KA 2H4WB 2HBYB 2WVBA 1Z2ZA 3SV4A 2W24A 2PEHA 1FE4A 2R4FA 1V5IB 2MHEA 1SKRA 1S6UA 2DO0A 2J6TA 1UJ6A 1FKOB 2C3OA 2VBXA 4OMFG 4DV2J 4R5PA 3OL7A 1S49A 3DYAB 1JLGB 2B5JB 3BQ1A 1ZA2B 3ZZTA 3NEKA 1ZM2A 3CIZA 3GE9A 1XR7A 5E33A 3J81U 3NLCA 1U1PA 2CQDA 4HACA 2K3KA 3A8IA 3OXGA 4HEA9 2DK2A 2WHOA 1RAOA 3QLHA 3OTCA 2WK4A 4RUCA 2QLFB 1LFWA 3QT8A 1DFDA 2KU7A 2JJ4D 4ILMA 5L9NA 1I1GA 3MD1A 3G71S 1F1BB 3UN5A 2VL1A 2QLXA 4LFAJ 1NK9A 4Y3CA 2JLFA 3TZXA 4A8WA 3I0RB 1N4LA 1Q5VA 4ZIWA 4KKOA 4ECXA 3MM6A 3CC4S 4DUZF 4DQQA 1KVJA 3JSBA 3FVYA 4LFAF 4DPXA 1AFIA 1WJ9A 3MR2A 2KVQE 1FDAA 5FDLB 2RE1A 3PW2A 2F40A 2AZ3A 2VONA 4M5LA 3PEHA 5A8WB 5GVQA 1JWWA 5J2QA 2I5JA 3ZO7A 3IAS9 1R43A 2VKRA 3L7UA 1Q16B 4RL1A 3BN4A 1S4FA 4ILLA 4TVAB 3MZIA 2E5HA 3ZTQA 1C0UA 4J9OA 2IA0A 2XULA 5K8NA 5K14A 3KHLA 1YZ6A 1KN6A 1RAEB 1NAQA 3MECB 3DRSA 3W2WB 1TV6A 2GAGC 4C3MA 2UP1A 1VBKA 1NJIT 1RZMA 5DM6Q 3MPUB 1S97A 2K7JA 3MMCA 1Y5LB 3DLHA 4C48A 1X4AA 2MZ1A 3BB5A 4QW9A 2Q43A 4OYAA 2PC6A 4DUTA 2GFFA 4NZ7A 4OV6A 3KLHB 1TUVA 3PV8A 4Q2LA 4G1QB 1EARA 1WC4A 3ET6B 5J1EB 5D0EA 1FX2A 4FN5A 1GX6A 4TY8A 3TP2A 4IRDA 3AOCA 2QGFB 1YBAA 3JSYA 1S12A 3MPYA 1Q8LA 2A6OA 2UZAA 2X51A 2LQ5A 1Q0NA 2V2VA 4M63A 2OEKA 2DNOA 4DX7A 5J2MB 1JLCB 2JX2A 2FLLA 4X66F 1S1XA 3G8QA 3A8KA 3N4WA 3AXMA 3OTOJ 3AXKA 3G82B 2OJ3A 2MQMA 1TKZA 4UOGA 1YDLA 1LFPA 1UP1A 1OSDA 4WE1B 4M5DB 4LRAA 1WHXA 1VQKS 1PSDA 3Q2SC 4WF9Q 2NPIA 3FEYB 1PYSB 4BCAA 2DRBA 1VGYA 4M94A 2HEKA 1RT3A 5CD4H 1S79A 1NK0A 1S77D 2AW0A 5HAOA 2BKPA 1VJQA 2DXDA 3ILJA 5AXMA 2D3OR 3HXMA 4PXDA 2JZ5A 2I9SA 4NX9A 1MWQA 3GQCA 2NUHA 1EX8A 5KFNA 2IM0A 4RW6A 1T94A 1S6PB 4USJC 3OHAA 1B99A 2FTRA 4F3MA 1VRUA 3DDKA 3GJRB 4DOZA 2B7BB 3PACA 5CYJA 2R8IA 5H1SV 2YKMA 3SFGA 1YRUA 3UO0A 3DRRB 3BF4A 1YBTA 3DRXA 2HFVA 1K73T 4DHVA 3A1YG 4Y6IA 4H4OA 3G4SS 2WZ1A 3D9BA 4F2SA 5HMZA 2JRSA 4AYBD 4IRKA 4DI6A 4NXMJ 2VBYA 4NZ6A 1J5EJ 5LJ3Y 1GXUA 2NXEA 2LLZA 4ZVPB 4YR3A 1VQNS 5J2PB 4O0NA 3M32A 2EFVA 1YX2A 2LA6A 4YP3A 4X4NA 2GO9A 2E1CA 3D5MA 4DF8A 5HI7A 2FB0A 3CD5A 4RW9B 4F3QA 2AEFA 1CSJA 3IG1B 2M2BA 3PX0A 1IXKA 1UVIA 3ZFVA 1R0AA 1TL5A 4QWDA 3MGJA 1QE1B 1S0VA 1BQXA 3OT9A 1SL0A 1GNKA 3IWXA 3J80U 5D4NA 1GX5A 3DGPA 1RHRB 4OHVA 1S48A 3PW0A 3GG1A 2FY8A 3H5UA 4PQUA 2YPZA 2HWIA 1MWZA 4NLPA 5ETPA 1L3UA 4DR4J 3H5YA 4DR2J 1ZA1B 3ENAA 4I64A 7FD1A 5A0YA 4J9UE 4ZIVA 1F2HA 2QFIA 4C3KA 1X9SA 3D4JA 4CCHA 1KHWA 3TAMB 4CO1A 4E98A 2MLXA 4DDFA 1XNQF 2G2YA 2BABA 2EBGA 1WG4A 2QLJB 5KT2A 3GFXA 1Q82T 4GKJJ 1V9OA 5EN1A 1U24A 3HJFA 3RRHA 4FXDA 4ICLB 3A3NB 1SJRA 3EXYA 2LEBA 2NYHA 5HQMA 1UKUA 4DQSA 3VZIA 2XS5A 1HR0F 3K8WA 4DL4A 1N5YA 1M1HA 3D0HE 1XJWB 2Z2MA 4DR1J 3PYEA 4B3MF 3SFUA 2XS2A 1T3OA 3DLEA 4WJBA 2BRKA 2GS8A 2MQOA 5IZHA 2I6WA 2FPHX 2PDAA 3GCXP 3DOKA 1TP7A 2QL5B 2CUYA 2MEWA 2OAUA 3C66A 3TUZC 4QIVA 1WELA 1IJFB 3A8JA 3MEGA 2ZOGA 2OPRB 4MH8A 4DBQA 4B3SJ 4O3QA 2HHHF 3S7RA 3PKMA 5L8RC 1WACA 2OP5A 3TNVA 3FUYA 2CZ9A 3GFZA 5GAGU 2J8SA 2V67A 3R1LA 5EX0A 1C1BA 4HR2A 2FJWA 1I5OB 2L9DA 1TUGB 3PRBA 1IKWB 2RQ4A 2VDIA 4JI2J 4RBVA 2NREA 4OI3A 1KD1T 1S76D 5I3QA 3SQGB 1B0PA 2HZAA 4ECQA 3PCOB 2HNYA 4JI2F 3PYDA 1REVA 3OV7A 3OVBA 2NLWA 1AROP 2WSFC 2MQPA 3W3SA 3DI6A 2BJ3A 3WC0A 3ZZZA 1HD1A 1QTNB 1X0PA 4KC5A 1UPPA 3FNNA 4YFUA 3G87A 1W2IA 2FGCA 4ZK7M 2JEJA 4YB7A 4LFBJ 4ELUA 2IC3B 4X4SA 4N56A 2C2OB 4DV3F 3M2UB 3MM8B 3OLAA 2VOOA 4RBUA 4PUOA 3KK2A 4URSA 1NJWA 1ZM3A 2BBEA 3QWUA 4IFYA 4NRTA 1M5SA 5GMKa 3OSPA 2YQ1A 2EG2A 2VQFF 1IM4A 1IQZA 2DXFA 4KJIA 3PZPA 2EI5A 4KBIA 2FDNA 3GIIA 2GZOA 4LVNP 3GIMA 2DYAA 5ETOA 2E5GA 1RAGB 4JI6J 4OYWA 2J7UA 1BQNB 4OYBA 2XI2A 3RW7A 4W90B 1FFGB 4GKKJ 2X1AA 4B9NA 4FPIA 1FJGJ 4QU7A 2M88A 2FUG9 3X1LB 1CQNA 3F41A 3UWTA 5DS7A 3RGIA 1HBOA 1U0SA 3PIOQ 1R3NA 3S8SA 3H40A 3MXHP 2VC0A 3UVJB 2J7KA 1T9YA 4UOFA 1OQ3A 5KT3A 4WZMA 1TKDA 1U8WA 1QLNA 1LWEB 3RRKA 1FKOA 2ZDOA 1IVZA 4F4XA 1NZAA 2CPXA 4N8OA 2J9DE 2PT0A 4R0EA 2C2DA 5DQHA 5D4PA 3DYAA 2RH3A 1HHSA 1JLGA 1OPIA 2B5JA 1HNZF 4ES3A 1AB8A 1Y11A 1IBMJ 3BN7A 3CDEA 2IM1A 2JEGA 4UY8T 1SIWB 3LGHA 3I56S 2E7WA 1LXNA 4G6VB 2BOAA 5KFBA 4DV0J 2RJZA 2IMOA 2LECA 3ZTOA 1GMUA 2PN6A 3R9LA 2YWGA 3KWMA 2IA6A 4QZVB 3RBZA 3W9HA 2DVIA 1HNWF 2HBZB 5CZVA 1FESA 3CCRS 3MFHA 2U2FA 4OZJA 2XMVA 3I0RA 1D09B 2DNRA 2HK2A 4RNOA 1S1WB 1NH7A 3HFKA 4Q45A 3NNAA 2CNOB 5FDLA 4AT1B 1N5TA 3HZGA 2N7CA 1RAFB 1VCTA 3RU0A 1PCAA 2P6SA 5KFKA 2J0SD 4X4TA 3IO1A 4QPTA 1T7PA 1P27B 3PG9A 2GO8A 3D6HB 3UDCA 4RWXA 2LFVA 2EFGA 4OI6A 2OGUA 2OKQA 2VFRA 1VQSA 3LUYA 3MECA 3W2WA 4WCEQ 4MT1A 3UDEA 1T05B 4MK9A 4Y0FA 2CA9A 3I32A 2OELA 1U1OA 1H38A 2C2EA 2D1CA 3GP9A 2R7UA 4C7QA 4ZKAA 5HANA 1FNOA 1JXEA 4TYAA 5F8MA 3KLFB 4FP9A 3FRYA 5AJ3J 3WBZA 2N3LA 3T6BA 1SPBP 3KLHA 1RBAA 4G1QA 1VJWA 1X31C 4Z37A 4ZHRB 4USWA 3V6DB 4CTAB 5ETVA 3HD2A 4ELVA 4KY3A 2NYIA 2HQ3A 5RUBA 1M0SA 2YNHB 3RTVA 2GMLA 2HFUA 1KLMB 3RBEA 3M8PA 2R8GA 4ZP7A 3OVSA 2ATLA 1JLCA 1N33F 2C42A 2IYIA 2VV5A 5AT1B 4Q44A 4U9RA 3PTWA 1RT1B 3W5ZA 2KFYA 2EC2A 1RU2A 4LF6F 5GADU 4ED7A 4ETZA 2LEAA 5DG8A 1NSKL 2M4MA 5FLXU 2VBZA 5AXNA 3G82A 3K58A 3GJSB 3K5MA 5D0GA 3QSYB 4EZ6A 2KB2A 4WFYA 2DGTA 2CJAA 1RBLA 4WE1A 4M5DA 2E44A 2OPSB 3AY0A 1RBOB 5KT5A 2XM3A 1IWAA 3NBPB 2QSFA 2ZUAA 2XNQA 2DNYA 4F50A 4I67A 1FJ7A 4HHHA 3PW7A 1RWPB 2VZ9A 1DARA 3IS9B 4DN9A 2UVWA 3FRZA 1SV5B 4LSLB 4YR2A 1U45A 2DNQA 4M5KA 1FVQA 3EGNA 1YJNS 2UV8G 1DHMA 1G4CA 2VC1A 1KQSR 4BC9A 4IR1A 2GVZB 5IC6B 3BDEA 2ZHAA 3RJMB 2LKZA 5KOWA 4KRWA 3I5AA 2M52A 3NCRA 3M1VB 1RT6B 2UU9F 4YEAA 2L9WA 4L75A 1S6PA 1B70B 1K1SA 3ZTSA 3BQ0A 2AJQA 1PAEX 3OL6A 4UTGA 3GYGA 5DETA 1WDDA 3FCWA 2A6MA 2VIHA 5CZXA 4DSFA 3DRRA 1FKAF 1SB6A 4G3IA 4RW4B 1FRLA 1HQ2A 3MAAB 1NJZA 4RNFA 5B0EA 4DR5F 1H6KX 1PGZA 1D8YA 4MMOA 4F8RA 2ZJRQ 4JI0J 2B4PA 3SSSA 3KKFA 1HD0A 4JI4F 3ELHA 5I42B 4CQ1A 3N28A 2DT9A 2MPUA 8AT1B 4K5RA 3BGUA 3M8QB 3ZZRA 4O4GB 1F6TA 1VRQC 4JI0F 5DDOC 1LWCB 5B08A 2IJFA 5T7LB 2W7AA 3IN5A 1LK7A 2APOA 3N6LA 2ASYA 3CJRA 1GTEA 2F9DA 4RW9A 2RQMA 3IG1A 1DTTB 4ZLNA 3SDEB 2YVSA 3QT6A 1N36J 5KG5A 2NXUA 2WAQD 4K4XA 3EZOA 5F8IA 4JI8J 1S57A 1F5CA 4ECUA 3G6ES 1QE1A 1X4DA 2D74B 3LANA 4PKDB 2EFQA 1APSA 2HSEB 2HLUA 2RB7A 2VASA 3T5KA 3CJ2A 4IG3B 2MLYA 1GMWA 2FC9A 4TU9A 1VI7A 5F8NA 3C19A 2HRTA 1RAAB 1RHJB 2DRAA 2PMZD 5JXSA 3EPGA 1D9AA 4IOBA 1Q8BA 1JXLA 1CULB 2BE7D 2UUCF 4DWIA 4A8OA 2AYMA 2FQQB 1RT2B 1DQ9A 3BJYA 4LFCJ 2DY9A 2HW3A 4JV2A 8ATCB 2DHAA 4NYOA 4NMXA 2KKHA 1Q95G 4HTIA 2CJ9A 2XLKA 1AYEA 3M2RB 4NXNJ 4FYWB 3OFGA 1BWVA 4EBDA 5CCLA 2BQ3A 1T3NA 3FSXA 2XCAA 2JFDA 4CP5A 2JC1A 1Q1KA 5MAOA 2DRDA 4RU2A 5A2QY 1FJCA 4P7VA 2JSXA 2ZH4A 1S4EA 4ICLA 1OY6A 3PRDA 2XSFA 3PR5B 2G4BA 2OI2A 1YITS 3OPKA 2M9KA 4F26A 2R8JA 3R5JB 1XQIA 3A3OB 4DV7J 1HWJA 4U6PA 2HIYA 2HRUA 3VGSA 2Z56B 2W2OP 1NK4A 3QGPA 1SC6A 4EI2A 4DV7F 4O4RA 4ED1A 4V19J 2OPRA 4P52A 4WK3A 3IA0A 4AE5A 1UW9A 2ZH7A 2ZFHA 2YX4A 3EZUA 3W7BA 4IKAA 1NH8A 4D3HA 3H7HB 2PEBA 2KN4A 2LXFA 1A7GE 2CQBA 3NP5A 1IKWA 1U6BA 3V6KA 3P96A 4QWAA 1Y9OA 2Y1IA 2R42A 4DPOA 1RABB 3ETOA 3SQGA 5KFVA 1S6OA 4DR3F 2ASJA 4OX6A 4YDXA 1QJHA 2MTLA 2R7QA 5J1PA 5KFAA 1ZZFA 4K0KF 4YR0A 2PO4A 1AW0A 4X4OA 2FD2A 2Z0GA 1YVFA 2DR5A 3C6TB 4DV5J 4MKBA 4IH5A 2V8DA 1NRKA 2ZZNA 4OYMA 3H42A 3Q22A 1TMJA 3W5YA 1RE1B 2POKA 2LQJA 4CNZA 2HQGA 2H9ZA 4K4ZA 4DV5F 3M9NB 1VS3A 1UL3A 1AUSL 3M2UA 3MM8A 1K0TA 2DGWA 1RCXB 4CI0B 4EZ9A 5F8GA 3BO4A 3BGFA 4M1KA 1U7LA 3HMJG 2AGOA 4QYZJ 1RWNB 2AEJA 4LF2A 1IKYB 2QV6A 3MEEB 4Z2XA 4ED6A 3BGRB 1NLKL 1UFKA 2H65B 2CQ1A 1XEZA 4DPTA 3CSKA 1ICEB 3NY0A 3QO9A 2PGCA 3W66A 4L72B 1BQNA 4WFZA 3ZZYA 2MQLA 3O44A 4NLYA 3K57A 5IWAJ 3QIPA 3PY8A 4AQYJ 5D77A 2IPOB 2ALZA 3GYXB 3E01B 4NLDA 4TNOA 3R97A 3HCXA 2BDPA 2MSTA 1XNRF 2JDJA 3F73A 3UVJA 5E3RA 4LRCA 4W92B 2OFGX 5IV3A 2GCFA 5L9XA 1RI7A 2V6AA 1QD1A 2GA7A 3PXGa 4QIWD 1OYEA 5DGAA 1LWEA 3CJKB 5LT5A 4M5NA 2DITA 2MZJA 4RJVA 2BANB 1Q86T 4KPYA 4K4YA 1XWLA 2C2MB 3IMQJ 1GT8A 1Y0HA 4C0OC 3HKWA 2C2RA 2BYCA 4RW7B 2DEJA 2DXEA 2HVEA 1EETA 2CG4A 4WWSA 4DLGA 4A8MP 3LP2A 1KVIA 4ZP8A 1RWOB 2EXUA 2XHWA 3EUNA 4F3OA 2ZH8A 2R7OA 4QYRA 2OSRA 2QYGA 3W9IA 4CO5A 2C2KB 4P71A 2XWYA 2C3UA 2W2NP 2J9CA 4RO0A 1FJEB 2QLBB 3OFEA 4DMZA 4FYDA 1ZH5A 2RT3A 3IBCB 1R89A 2ZH6A 3DN9A 3HHLC 3BGOP 5HMXA 4LF5F 2O1PA 2FGOA 3GV8B 2XGPA 4KR0B 3J80Y 3Q8PB 1S1WA 4ECRA 3K5PA 4ECSA 4DX8H 3QFHA 1RT5B 4HLBA 1VFJA 2COLA 3BS9A 2ZWPA 4B3RF 3OXLA 2HQDA 4KGKA 1ZPVA 4DV4J 4IO1A 2X7IA 4QW8A 3DHXA 3ENWA 4CT8A 2ZHBA 2WVFA 2RU3A 2V2QA 3R7BB 4DV4F 4I56A 2NPFA 3HFZB 5D0HA 3CCVS 1GFWB 3N5BA 2CQ2A 1TL3B 5KAKA 3VQTA 2VQEJ 1GAOA 3JQMA 5M2UA 3DU5A 4IG0B 2V8HA 1T05A 2HS3A 2Q79A 2L3MA 2HAIA 3OFFA 2LQ8A 3AA8A 3FEXB 2VQEF 4AXJA 2FJVA 2B4UA 2WB4A 2CQGA 4LF8J 4JYAF 1N6QB 3TUJC 4ZS6A 3F0NA 3HHLB 3V4MA 1JLQB 3KJFB 2DH7A 3IR5B 3PW5A 1DLOA 3JSMB 1VQ7S 3R3TA 1EIYB 3FGVA 3V6DA 4LSNB 2BR0A 4CTAA 1VR6A 2EWHA 2AV5A 3UW1A 3BM7A 3UD4P 1QAIA 2AJFE 2YNHA 4NOHA 3TQEA 1UVJA 2Z57B 2F7VA 2WVCA 1KLMA 1HLWA 2L48A 3M2VB 3J7AN 4PG7A 4O3OA 3LPYA 2AJ0A 1FK9B 3I4HX 2GX8A 4RKUC 4UUXA 4I69A 3WQPA 3FBBA 2QL7B 3DLLQ 1VQ9S 4ED8A 2RRNA 1RT1A 1UEUA 2YPYA 1TQLA 1S1TB 2B3TB 3SQOP 1WC6A 4ANEA 3TZZA 1H2UX 5K8PA 2ZVSA 2ZZTA 3GG0A 4OJ3A 2RNEA 1TL4A 3J7A1 4WXOA 3VGVA 2SXLA 3VZHA 3FK4A 3HVAA 4PYAA 4DL3A 3NBPA 5IT4A 2HNDB 1RISA 4TLRA 2V4JB 4GO5X 2YWWA 1Y3JA 2IHR1 1RSCA 5CXTA 2R9LA 1SV5A 3LWLA 5LMNF 3DLKB 2E5LF 2MSSA 5F8HA 4DFPA 2QFJA 1V3RA 3MAHA 3O1LA 5ETKA 3PKYA 2GVZA 3D66A 1KTQA 2DCLA 2ZH5A 2KH9A 4FS1A 4C98A 1UWBA 4OYPA 1VK8A 2D3ZA 1Y5IB 5KFZA 4B08A 2CPFA 2DH9A 3M1VA 4S0MA 3T9NA 4HACB 2KXFA 4ES1A 1HA1A 3H59A 1VC5A 3GR0A 4DL5A 2DPIA 1QDUB 4X4PA 1TMMA 3SI8A 2VFSA 1WOSA 5KFFA 1AXQA 5ETQA 2GMHA 1IR2A 2W7PA 1HNIB 4B9UA 1PAUB 3UR0A 4RW4A 3OFHA 4DUYF 3IXQA 3MAAA 4LREA 3QT5A 4KGZB 3OW2R 4C0BA 2FHJD 2G0JA 2ASLA 3VAJA 1I3OB 5K8OA 3T19A 3T1YF 3ICLA 1B7FA 3A3PB 5LMUF 1FD2A 3J7YI 4KHMA 4R8UB 4YS2A 4A8SA 3UQSA 1TZ0A 4LIRA 4XPEA 3AA9A 1O5JA 5I42A 4DSJA 1RACB 1ZAWA 3KDNA 2MKIA 2CYYA 3M8QA 4O4GA 2HHXA 4A46A 2DHGA 3LO3A 1LWCA 2MZSA 4DL0C 5T7LA 1WI6A 1DTTA 5KFOA 2CPEA 3SDEA 2KT2A 4C11B 4EGLA 3D1OA 1QSYA 1C0UB 2LXUA 3D54A 3MCOA 5K14B 2ZEJA 4DZDA 5JMNA 1RKIA 4H54A 4LBIA 4CM0A 1YLXA 4IG3A 1ZM9A 4V19X 3CCQS 3NS6A 3T9ZA 2FVCA 2OD6A 2MZRA 1VQ6S 3R8YA 1W7WA 1KOOA 2CPZA 5DZ7A 3LGMA 3GLJA 1BQMB 1JKHB 2GQ2A 2O67A 3VTIA 1CULA 4USHA 1RT2A 3R5CA 2FZGB 1C1CB 1KHVA 4JI5J 3VAIA 2ZBIA 3CE8A 2XB2D 2NR0A 2ZBQA 1UZHA 3M2RA 1CQMA 3W8PA 3M8WA 3WIVA 3W1YC 2QL9B 1LV5A 1EKRA 1X4FA 2MKKA 4X4RA 4QIFA 4ZN1A 3RZAA 3FBEA 3ILLA 1CVJA 3PM9A 4JI1J 3CUNA 1KTVA 3RB3A 3RRGA 1S1XB 2CVIA 5AXLA 1O8BA 4IQXA 4K4WA 4JI1F 2XMKA 1K1QA 3LOUA 4AFFA 1IKXB 1WEYA 4UZCA 1RK8A 4DSKA 1PJ6A 3P4UB 4M5GA 1EKSA 3HHLD 4ZLJA 4QWCA 1JXVA 3S6EA 2VKZG 1N34F 2BJDA 3TUPA 2Z8QA 5J2NB 1XIQA 4NZ0A 3ILOA 1S9GB 2F4FA 3TQ1A 2XQCA 1IWGA 2D3O1 1KC8T 1NKBA 1PG5B 2CJQA 2E1MC 3TZYA 5E41A 5HROB 1JNRB 1SC4B 2HMIB 4ZVHA 3U7JA 4DR6F 3QZ8A 2BJ8A 5GAHU 2V4RA 1YIJS 2JL9A 3PO4A 4G1IA 5DDRC 5EGYA 2LDIA 2VUGA 1PYOB 3CCMS 2XY7A 1NJYA 1MMLA 4FNIA 2PA8D 4I6YA 2Z2LA 3Q24A 4GMKA 4NLTA 3ZTPA 2E9RX 3W8GA 3KUHA 1ZPWX 1WUUA 1C4CA 3HSDA 4U7UD 3K17A 3F56A 4WP3A 3PJWA 2ZH2A 1BY9A 2H5EA 4B9VA 3NNHA 1FVSA 2R3VA 2E66A 2WVDA 3CD7A 3HFVA 2E9TA 2NSBA 2IM2A 4CLSA 3AHPA 4PPDA 4U7CA 2JH3A 5FLXY 3HX9A 3P49B 1JLFB 3FMBA 1ZBTA 4U8YA 4EYHB 4UT4A 4B9LA 4HT7A 5E3CA 1EZZB 1IKYA 3VF0B 1VBYA 4NYZA 3MEEA 1DQ8A 2QTWA 2W4DA 2YWHA 2AJ2A 1VMBA 4EUVA 3BGRA 1VQLS 3LP0B 1MWYA 3LP1A 2GGPB 2A1BA 1SXLA 1YK9A 2RDJA 5KG7A 3FSIA 3CC2S 2ZJPQ 4P73A 5KFPA 4DSLA 2P9EA 2MHNA 3QPIA 4X65J 3BH7B 4JI3F 1T9UA 3E01A 3EVMA 2QO3A 2EPIA 2BJ7A 2WRMA 4M5MA 3QGHA 3PJ9A 2Y1LB 4X65F 2UVUA 5HVGA 1KKHA 2KM8B 2RILA 4NASA 1ZOTA 5KFYA 1SJ1A 3HT3A 2N4CA 4AL6A 1H98A 2YX1A 1N32J 1T0TV 2OUGA 3CJKA 2HFOA 2NZ4A 4C9DA 2BANA 2FLOA 2OMOA 3O3LA 4Z7YA 5K5MA 2D9OA 1KWMA 2XZTB 2QMWA 2HIQA 5I3UB 1LWFB 3L4BC 4F0MA 4DS5A 1BUXA 1U1NA 1YJ7A 1L5UA 5C5JA 3SMZA 2KG1A 3M6XA 4ZCMA 4B3OB 4K50A 4X62F 1VQ5S 3BR9A 3GILA 1UVKA 4CH1A 5KFMA 1JQGA 5CAAA 3PDNA 3D67A 5C2CA 3QBCA 1R31A 3KMSA 5JVHQ 2BOPA 4E2FB 1VQ4S 3TEHB 1WC1A 2HHUA 4OHZA 3MM5A 3V4IB 3WHIA 1YJ9S 1GH8A 3DOKB 2K8GA 3PFEA 1K0VA 3W61A 3UD5A 4U8VA 1FD8A 3JB9k 5DDPC 2WSCC 3P45B 3CMQA 1YBUA 4N41A 3RAXA 4BWJA 4NCAA 4Z7CA 3V6JA 2Q1LA 3QJJA 4K4UA 3Q2TC 2ZZMA 1Q8IA 1VC6A 3DC2A 2DGUA 3A12A 1NMEB 5T41A 5M2RA 2QG9B 1RT5A 1TR0A 3V2UC 4M5IA 1JJHA 1TU0B 1PBUA 3QYYA 1P9YA 3RBDA 3TANA 3QQCD 3B78A 4TLQA 4F04B 1Y7PA 1QUVA 4QU6A 2UUBJ 3RAQA 3R5BA 2ZVIA 5KG4A 1OYDA 2DIUA 2M0GB 2ABYA 1VBZA 5HQLA 2NXJA 2UUBF 4OZLA 1LK5A 2UUAF 5IT9Y 1NCLA 4IG0A 1O51A 1XR6A 2RDDA 3Q8SB 3QRQA 2OFHX 2RS2A 1NSAA 3QRPA 2ADBA 2PD1A 4ZPDA 3BDPA 2K7KA 2P9CA 3HVTA 3MPDA 4ED2A 3CIMA 1N6QA 3QRRA 1K9MT 1JLQA 1VOMA 4LRFA 4WKRA 1AZSA 2CDRB 4Q5VA 3JSMA 3CCTA 1RAJA 4KGVB 4URGA 1HNXJ 1DQAA 2XNRA 4MFBB 4ZVOB 3H4BA 3I87A 2VG6B 2IBKA 4LSNA 2QLWA 4Q8FA 3RB4A 3FBCA 2CAJA 3SV3A 4V1Ak 4ID8A 4OQJA 3M2VA 4CH7A 1HBUB 1UTAA 1FK9A 3WZ0A 4KO0B 1YJVA 2FJEB 4HL9A 2B9EA 4J9KA 4C8KA 4PXCA 4ANDA 4FKXA 2RVJA 3M30B 3TEGA 3HO1A 2G1HA 1FA0A 1S1TA 5IQQA 3BGLA 3EX7B 1LW0B 4YHHJ 2EVZA 1WC3A 4YY3F 2IIHA 3HZEA 3DCAA 4B17A 3BR8A 2IRYA 3VVUA 2MLZA 4DX5A 3BBFA 2YNIA 2XSJB 4J9MA 2OSQA 3CCES 1VQOS 2YNFB 1U1MA 2VHGA 2HNDA 2P5VA 3RR7A 2V4JA 2A10A 2JWNA 2MKSA 2XYGB 1UVNA 3L95X 4Y28C 6FDRA 2BJEA 2C3MA 2QSWA 5KFXA 4G65A 3DLKA 1D3WA 1MW7A 3PW4A 2CZVC 4JV0A 1ZM4A 1DZ5A 5LOQA 4OZ1A 2C3YA 3SZ2A 1FWKA 2VPXB 5BR8J 4DV2F 3RAMA 2ACMA 2DR6A 2VD3A 2FY1A 4NL5A 1OMSA 4N5SA 4H4KA 2ZC3A 3W65A 3SCKE 4YQWA 1Z1ZA 1HNIA 1B64A 3PIPQ 5A6WA 2IRUA 2A0FB 4C0HA 3EICA 2F4VJ 3BPSP 2ZWOA 3EWGA 1WHWA 1C4AA 2OMLA 1NK8A 5A2QU 3CGIA 1HBMA 5LM7E 2UXBJ 1MU2B 3D6TB 1KSPA 4ERDA 2MZTA 2F4VF 2VU5A 3K0JA 4R8UA 3BSCA 2AEMA 3E3XA 2YBVA 1XBWA 3FSYA 3H2VE 1Q79A 4KHPJ 4KV8B 3V5RA 1N5SA 3C8YA 4OJGA 3QGGA 1RHUB 2ZDPA 3CCLS 5DLGA 3NOCA 4PCQA 2FLPA 4C11A 1U6ZA 3M6VA 4C8OA 2YNGB 3NS7B 4XDDA 4OLOA 3QMQA 4ALZA 3B4MA 1X8DA 4MIAA 3MOJB 2DGXA 4DEZA 2ZBPA 5GAEU 1E6VB 1KONA 2V9WA 1YTYA 3LGNA 3HHDA 4FF2A 4ED0A 1HNVB 4DPWA 2B51A 2JOQA 2M70A 4OV1A 5KOXA 2D9PA 2F8HA 3M6UA 1BQMA 1JKHA 1F5BA 2XMMA 1CC8A 3J7Z5 5KG1A 1T11A 3O2IA 1C1CA 3TVZA 3K5OA 1YRXA 4W98A 4TU7A 4DL2A 1YWXA 4MYUA 2GNKA 3M8PB 2AGQA 4UZBA 5HJXA 2VPWB 2W2MP 1RT7A 4OZ0A 5KFEA 4P9SA 3MUVP 4ZVTB 4B9TA 3LAMA 1VISA 1NHUA 1M5HA 3A8EA 1UWAA 1WNEA 3QAUA 1IUJA 3C14B 3NS5A 4OZNA 5SZTA 2XHCA 3MD3A 3P5TL 3GFHA 5B0BA 5A8KB 1IKXA 2L08A 4CLZA 1NHKL 3OTOF 3THVA 1KDNA 1OQ6A 5M2PA 4NLOA 4OI4A 1U2CA 2R8HA 5HMWA 4A8KA 5C42B 1ZTWA 2M8HA 2CDQA 3R2DJ 5F9LA 1TFWA 5J2NA 1SBRA 4CIOA 4CO0A 2G0IA 1LNQA 1GXLA 4ELTA 1S9GA 2CQ4A 1RYSA 2FVRA 1ITPA 3KFWX 1VLYA 4K5SA 3JSRA 2VJUA 5HROA 4UQGA 2HMIA 3MM9B 2F65A 4EMDA 3HVWA 3IR6B 4C6AA 1X9WA 4C8ZA 5L1LA 2KI2A 2LXIA 1NB2A 3HP6A 5BYSA 2L41A 1SC3B 5D15A 2XCPA 3TYTA 4DFJA 4MYTA 1NSPA 1A6LA 4I6AA 2WBMA 2YKPA 1R8AA 2MGZB 2PMHA 2EFOA 4PPZA 3S1TA 2MY7A 2R7XA 1RYRA 1RWUA 4XK8C 4XPCA 3OVAA 2Z58B 1DTQB 5D4LA 1XMQJ 5SUHA 1X4HA 1VK3A 5DGBA 1FI4A 3R7NB 2CKWA 1S1UA 2LP4A 4NXMF 1PJ7A 4K59A 1JLFA 1J5EF 4DR7J 1BC6A 4C97A 2HKEA 4WK1A 2HFNA 2O3DA 2JHEA 2J0XA 4ZLPA 2HK3A 3KNAA 1FNMA 4X4QA 3L3CA 3FZBA 1QM9A 3AD8C 3OR2B 4J37A 4NCGB 1IQTA 3LP0A 5KFDA 2VOPA 4O44B 3IP0A 1WC5A 1YZ7A 4RLEA 2GGPA 3I4PA 3L7OA 2CPYA 3O6QA 1H74A 1HW8A 1SJQA 5DDQC 3G2XA 3PJXA 2BVZA 3IGNA 4ECVA 4EO6A 3TW0A 1NU4A 1TL7B 3H5SA 3Q86A 1WHVA 5H9FK 3PNIA 3MEDA 3NAIA 2A3JA 2G1DA 1PO6A 2RAQA 3DMJB 5FIIA 3UI3A 4DL7A 2GW8A 2H51B 3K2YA 2HG4A 3CO0P 4WYWA 4Q2MA 2HS0A 5IC4B 3KHGA 4IYQA 4DR4F 4DR2F 1P9QC 4ZP6A 3K5LA 1KQKA 2Z30B 1VQPS 3NL0A 1QAJA 4DU7A 2CQ3A 1IJEB 5I3UA 1LWFA 4IOAQ 5KFSA 1C0TB 4B3OA 2XZDB 5B7WA 4PG6A 2CWKA 2LDYA 4GKJF 3CDWA 3MR6A 4DL6A 4UW2A 2HHWA 3V81B 3ZNUA 4ECYA 3ZZ0A 1MN9A 2HFZA 5JJBA 4DV6J 2AJ4A 3V4IA 2NZCA 1OWXA 2LYVA 3K5NA 1SUQB 2CVEA 4L76A 3GSIA 1TK0A 2B6AB 4DR1F 1NUEA 3E8OA 2KJWA 3ISZA 1FXLA 1PILA 4FVCA 2KRRA 4J9QA 3KJQB 4RZRA 4H4MB 5IS2A 1RHQB 2X1BA 1CG2A 2UVRA 4B3SF 1H2VZ 3MFIA 1NO8A 4NLSA 1FXDA 4IQMA 1LKZA 1W26A 3HJVA 3GIRA 5F8LA 2JLGA 3U1NA 2J0WA 2PA3A 2EC0A 1ZETA 2E5JA 3NNCA 3D28A 5FD1A 2VG7B 3FJ2A 3HD1A 4KSEB 3NCQA 2AF6A 4A8QA 1F3VA 2DB1A 1UFWA 3EVOA 2XMWA 4P74A 1YJTA 1EP4B 3R5AA 1N5VA 1CJUB 5CYQB 4DF4A 5D0RA 3AD7C 2U1AA 3GJQB 4GC6A 4ECZA 5F9NA 3OUYB 1VRTB 5KG6A 3NGDA 2I8EA 1S9FA 2XLIA 4MK7A 3ADAC 4RNNA 1VDHA 5LSRA 4CH0S 4ZVRB 4CYUB 3LH2S 4OX9J 4DQRA 2VF3A 4WIIA 4USVA 1FRJA 3EGWB 3ZZOA 4F0HA 4LFBF 2HVHA 3MUMP 4MFBA 2G2ZA 2I38A 2VG6A 5AXKA 2CG8A 1TFYA 4OZ3A 2W8LA 4LF9J 1HBUA 3BO2A 3EMTA 4KO0A 4ZN3A 1OIAA 1P1TA 2BXJA 3TRGA 5JVGQ 2EEYA 3QO9B 3CWJA 2HHVA 3M30A 2RD5C 3ZC4A 2KT3A 5C7PA 4UUWA 1LW0A 2EG1A 3BPDA 3DU6A 4JI6F 3QIPB 5HSPA 3EDRB 4TKTA 2OPPB 4PG5A 4ANCA 4GKKF 3QFWA 2XSJA 1FJGF 3VAHA 2YNFA 2IVFB 4DXLA 1HPZB 2PMWA 4I7FB 4LR7A 2M5YA 3KG4A 4CNYA 2MQ8A 2IVYA 9RUBA 3W5XA 4ED4A 2ZH1A 4J9LA 1FDBA 4PR6A 1K44A 1EQ0A 3MOZA 4EWTA 2MDAA 3K89A 1KS2A 2C3PA 2CQ0A 3JQKA 1IBLJ 1WTFA 1S7IA 1HFEL 3JYTB 3KG1A 2V69A 4LF7J 4QIGA 1LOUA 1EETB 5B0FA 3LP2B 3AJ1A 1D8ZA 4KGMA 4QWEA 1S10A 1HYSB 2BM1A 1RWKB 1IBMF 3I96A 1GMWD 4KT0C 1I94J 3G8SA 2DNPA 4DV0F 5KG2A 1TUWA 3BYPA 2HGNA 2OD4A 1IR1A 1SKSA 2ZOFA 2XO6A 2Z4PA 2MY8A 3OL9A 3SYZA 4WPAA 2OHDA 2ACYA 2PSZA 1RHKB 3TWZA 4QCLA 4U67Q 2ZM6J 1MU2A 3N01A 5BXIA 4DQPA 4UF4A 1IBKJ 4F02A 3TI0A 4KH1B 3GZ7A 5DQIA 3AT1B 2XWXA 3FMWA 3Q8UA 1RHMB 3HKZD 1MROB 4AUKA 4NCBA 1M5PC 2FHKA 1CC7A 2GAHC 4KV8A 3IBWA 4F4WA 3DLBA 4CLYA 3LF0A 1HWIA 3BV8A 2QX0A 2GV1A 1ZYQA 5G0RB 1GEHA 1X9MA 1MMDA 2YNGA 2B56A 2YY3A 1FRHA 2R2RA 2NSCA 5KFCA 1HQEB 4BLGA 4OHYA 1MSWD 1E6VA 2QYCA 7FDRA 1Y5NB 3M4XA 2W2PP 4WFXA 2IJRA 4ZCIA 1YGYA 4L3KA 3OBIA 2PFFB 3L9ZA 2QC3A 1PJ5A 3B8HA 4MIWA 3MTJA 1KNZA 3JTOA 3CTRA 4LSZB 4DJBA 1HNVA 1SJFA 3TJAA 1KQFB 4M5HA 2XMAA 1DLOB 3GPAA 1Q7LB 2P9GA 3M7VA 4RWWA 3TX8A 5DRKA 1S5ZA 5HL7Q 5AJ3F 2CQHA 3BKTA 1FDNA 3OJSA 4WTYA 2B9YA 3MTKA 2AX0A 4WFAQ 1V3SA 4KPCA 4JV1A 4O23A 1FRKA 1S0MA 2ZH3A 1VBXA 2C1EB 2H54B 2DISA 3CPWR 4FYXB 5H9EK 4X84A 3EVWA 2BJ9A 3T1HJ 2VJVA 2LQBA 2W9BB 3AD9C 3T5JA 4PG4A 4P2XA 2XGQA 1VLOA 2VODA 2DR7A 2KDOA 3C14A 3T1HF 3TVKA 4WTOB 2JC0A 2V9KA 5A8KA 1PYTA 1WWHA 4CLTA 2GIQA 2C28A 3PO5A 1JNZB 4XAKA 2B9XA 1HBNB 1X4CA 2EKYA 3MWBA 1HHQA 2IDEA 3C6UB 3VHQA 1HI1A 1JB0C 2H3EB 5ETTA 1U1RA 3HF5A 1YSJA 1QSSA 5C42A 1K47A 3ZNJ1 3K7RA 5T14A 4PXEA 2V50A 3EGZA 3VQSA 4HHJA 1TK8A 2BE2B 4ER8A 1R27B 3VWSA 4N77A 1WD6A 1R0CB 1WI8A 3MM9A 3BYRA 1S59A 5DM7Q 4D3GA 4FYYB 4IFVA 1UWBB 1KQGB 1URRA 4P75A 4IOCQ 2AD9A 5HJYA 2W4PA 1KP6A 2B7CB 4DUZJ 3WX4A 4F0KA 3H8YA 1MMNA 1BXNA 2DNMA 1RDRA 3CCJS 4ZVFA 2B43A 3RYLA 3KLEB 3N6MA 4FYVB 2WB1D 2MGZA 3T3FA 2QA1A 2YTCA 3GU0A 3D1HA 1SQFA 4DCJB 3CMES 2Z2YB 4ZMMA 2LU2A 3LPEA 4AL7A 2E1PA 5L1KA 1DTQA 3N6NA 1HL6A 3MUTP 3POTB 1FFSB 4DX6A 1DJ0A 1RTHA 1FERA 4NE9C 2ZHOA 1SIZA 1U49A 3UD3P 2DGQA 2GHVC 4I68A 1UZDA 3IWNC 2WW8A 1GQEA 4ZVUB 4NLVA 1YJWS 4XIUA 5IT0A 4HH1A 5HATA 3VCDA 2W01A 3OR2A 4NCGA 1I51B 2CQPA 5KFHA 2QA2A 4X4VA 1UFLA 4O44A 4C4WA 4CLFA 4URQU 4YB5A 1NK6A 1H73A 2WOMA 1RA6A 1TKXB 2CZ4A 4I4BA 4Y2CA 2OEMA 4X64J 1R8PA 3CEDA 1TKTB 4FNHA 1N36F 4ILRA 1T9TA 1X5SA 3MAQA 1FEHA 2KL8A 2R7SA 3EM1A 4JI8F 5CD4A 3CF5Q 1TL7A 2GVDA 2YXLA 4X64F 3C15B 1SCJB 1R6VA 3KUGA 1YQHA 3KTQA 1NZ8A 4RPFA 3WDOA 3DMJA 3H2LA 1WG1A 4X66J 4ECTA 3BKUA 2V0NA 3BREA 1EQMA 5A6PA 1F0XA 1NKEA 2I1RA 4Y34A 3MR3A 1I6JA 3THPA 5IT9U 1RP5A 1EJ7L 1Y10A 3CO9A 4DPYA 1BD6A 3C2PA 5KT4A 3VR1A 2WBRA 2YQ3A 3KK3A 4LFCF 2YQ0A 1U8SA 1C0TA 3N9UC 1WG5A 3MMBA 3T6JA 1NBEB 3CVKA 2QZ8A 4PYDA 2HHTA 4NXNF 5L38A 1F9HA 4LUBA 3V81A 1R8HA 4MKAA 4IDKB 2XC9A 3FCVA 4NI2A 4F25A 1OY9A 3RBXA 4LRDA 3UR3C 4KTQA 2CJBA 5B0AA 3OHBA 5C25B 5DO2A 1SUQA 1W2BR 3I9V9 2B6AA 2AIRB 1H7WA 3ONQA 1QAXA 2H5JB 2FYXA 4ZVSB 1JJ2R 4EK2A 2KFNA 3KYLA 3FC9A 3HM9A 2BUNA 4OFZA 1AFJA 1U6FA 2DNKA 1PC4A 1WOOA 3CDAA 1J5OB 5ETNA 5J1NA 3DHWC 4MK8A 1O0PA 3GFYA 4H4MA 4YOEA 1JLEB 4MJKA 1CPZA 4G1PA 3DFEA 1SQGA 3KJNB 1T95A 1N88A 4RW8B 3KLIB 3OTDA 4KYZA 4AL5A 2KTQA 3FQKA 1CEZA 1RTJB 5KFLA 3W60A 2ROEA 3FBFA 1WKJA 1BHNA 1Y00A 1C2PA 4OIXA 1X7VA 1SJ3P 4N76A 2DBBA 3T5LA 2VG7A 1T9WA 1SC1B 3CJ0A 3BBBA 2LA4A 2O5DA 1EP4A 5L1JA 1CJUA 5CYQA 3OUYA 1S99A 1FHTA 1VRTA 3GIKA 5GAGI 1X5PA 2DD8S 1VIOA 2IYGA 5F3TA 1NM2A 3P8BB 5HO4A 2JVRA 4CYUA 5LSLA 1RQ0A 2GIFA
chains in the Genus database with same CATH topology
3WX8A 3PJ9A 1JXVA 3GPAA 3MPDA 3B54A 1WKKA 5BXIA 4UOGA 3GP9A 3VGSA 2HURA 3Q89A 1S5ZA 1W7WA 1NDKA 1K44A 4F4AA 2ZUAA 2VU5A 3Q8UA 3VGTA 1XIQA 3JS9A 3B6BA 3PRVA 1NDLA 4KPCA 4UOFA 1LEOA 3ENAA 4DUTA 1VYAA 1ZS6A 4W98A 1S59A 4DI6A 3ETMA 3FBFA 1U8WA 3FBCA 1F3FA 1MN7A 1WKJA 3DKDA 1BHNA 3ELHA 2DY9A 3VGUA 4C6AA 3EMTA 1NDCA 1BUXA 3EJMA 3EVWA 4HR2A 3ZTRA 1NDPA 4O0NA 3NGTA 4ENOA 1NB2A 3NGRA 1B4SA 1F6TA 1HLWA 3NGSA 3BBBA 3NGUA 2DXDA 2CWKA 4FKYA 4UOHA 2AZ1A 1LWXA 2DXEA 2HVEA 4ANDA 4CP5A 4S0MA 2B8PA 3FCVA 5IOLA 3VVTA 3FBEA 4FKXA 3EVOA 3Q83A 1NLKL 3FBBA 3EE3A 5C7PA 2AZ3A 1NPKA 2DXFA 1WKLA 1EHWA 1NSPA 1MN9A 3BBCA 5CAAA 3EM1A 2NCKL 3G2XA 3DDIA 1HIYA 2DYAA 5CABA 3ZTSA 3L7UA 1NCLA 1S57A 3ZTPA 2BEFA 2HVDA 4ANEA 4ANCA 1HHQA 4EK2A 1PAEX 1B99A 1PKUA 3VVUA 3Q8VA 2B8QA 1BE4A 1NUEA 3FC9A 3BBFA 3BH7B 1NHKL 1XQIA 3BH6B 3Q86A 1NSQA 3FKBA 3Q8YA 3ZTQA 4F36A 1NSKL 3EVMA 3ZTOA 2BX6A 1KDNA 3FCWA 4DZ6A 3EICA 4WBFA 1UCNA 3R9LA 3VGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WX8 A;  3PJ9 A;  1JXV A;  3GPA A;  3MPD A;  3B54 A;  1WKK A;  5BXI A;  4UOG A;  3GP9 A;  3VGS A;  2HUR A;  3Q89 A;  1S5Z A;  1W7W A;  1NDK A;  1K44 A;  4F4A A;  2ZUA A;  2VU5 A;  3Q8U A;  3VGT A;  1XIQ A;  3JS9 A;  3B6B A;  3PRV A;  1NDL A;  4KPC A;  4UOF A;  1LEO A;  3ENA A;  4DUT A;  1VYA A;  1ZS6 A;  4W98 A;  1S59 A;  4DI6 A;  3ETM A;  3FBF A;  1U8W A;  3FBC A;  1F3F A;  1MN7 A;  1WKJ A;  3DKD A;  1BHN A;  3ELH A;  2DY9 A;  3VGU A;  4C6A A;  3EMT A;  1NDC A;  1BUX A;  3EJM A;  3EVW A;  4HR2 A;  3ZTR A;  1NDP A;  4O0N A;  3NGT A;  4ENO A;  1NB2 A;  3NGR A;  1B4S A;  1F6T A;  1HLW A;  3NGS A;  3BBB A;  3NGU A;  2DXD A;  2CWK A;  4FKY A;  4UOH A;  2AZ1 A;  1LWX A;  2DXE A;  2HVE A;  4AND A;  4CP5 A;  4S0M A;  2B8P A;  3FCV A;  5IOL A;  3VVT A;  3FBE A;  4FKX A;  3EVO A;  3Q83 A;  1NLK L;  3FBB A;  3EE3 A;  5C7P A;  2AZ3 A;  1NPK A;  2DXF A;  1WKL A;  1EHW A;  1NSP A;  1MN9 A;  3BBC A;  5CAA A;  3EM1 A;  2NCK L;  3G2X A;  3DDI A;  1HIY A;  2DYA A;  5CAB A;  3ZTS A;  3L7U A;  1NCL A;  1S57 A;  3ZTP A;  2BEF A;  2HVD A;  4ANE A;  4ANC A;  1HHQ A;  4EK2 A;  1PAE X;  1B99 A;  1PKU A;  3VVU A;  3Q8V A;  2B8Q A;  1BE4 A;  1NUE A;  3FC9 A;  3BBF A;  3BH7 B;  1NHK L;  1XQI A;  3BH6 B;  3Q86 A;  1NSQ A;  3FKB A;  3Q8Y A;  3ZTQ A;  4F36 A;  1NSK L;  3EVM A;  3ZTO A;  2BX6 A;  1KDN A;  3FCW A;  4DZ6 A;  3EIC A;  4WBF A;  1UCN A;  3R9L A;  3VGV A; 
#chains in the Genus database with same CATH topology
 5HQ8 A;  3AJD A;  3MF5 A;  5E3A A;  4MAK A;  1YRT A;  2Y8W A;  1X5T A;  4ZLL A;  5KT7 A;  3QWP A;  2R7T A;  6FD1 A;  2XMJ A;  1GXT A;  5ADZ A;  4K8R A;  2C2Z B;  2EKN A;  1M5V C;  3LP1 B;  3DKD A;  1VQM S;  4OLP A;  1S7H A;  3ZTR A;  1RT4 B;  2I0X A;  1M1K T;  4E0D A;  3TA0 A;  1XNQ J;  4A4J A;  2LQ9 A;  4OJ1 A;  4EEY A;  1HHT P;  4EO8 A;  4USI A;  2JNJ A;  2GJ2 A;  3DM2 A;  1UA1 A;  1RAD B;  3KNG A;  3UN2 A;  3KMQ A;  1QY7 A;  2YWE A;  2OPP A;  2DY1 A;  2VG5 B;  3R5G A;  1XMO J;  1FDD A;  1B0V A;  2GJF A;  5IWA F;  3DXS X;  4TXS A;  2FHO B;  6AT1 B;  4AQY F;  3D0G E;  3UCZ P;  1HPZ A;  5IV4 A;  1HKA A;  4I7F A;  4BWM A;  2V4Q A;  1HR0 J;  1XMO F;  4LVO P;  3QNW B;  4PWU A;  2DNN A;  3LA0 A;  2K1R B;  4B3M J;  3TJ8 A;  2CFX A;  2MKY A;  2AGP A;  1N0U A;  3RR8 A;  4MKY A;  5GMD A;  1JMT A;  1FWP A;  1WSR A;  2VFT A;  3JYT A;  1TVR A;  2BZ2 A;  1ZS6 A;  2E1R A;  2BA9 A;  2KHC A;  4FDF A;  2CNN B;  2HHH J;  4JP8 A;  4OI0 A;  1RTD B;  1HYS A;  1R0B G;  4LR8 A;  4Y2A A;  5D8H B;  1F2G A;  3CW2 C;  2BKO A;  1S6Q B;  1CS4 B;  3MM5 B;  1TAU A;  5DQG A;  5BYR A;  4BHQ A;  3C16 B;  5DZ6 A;  4K4S A;  1G3O A;  3GWC A;  1IKV B;  2N7Y A;  3FZ2 A;  4O3N A;  5HBM B;  4WFB Q;  2KG0 A;  4PZV A;  1WOR A;  2FVS A;  2DCU B;  4J9S A;  4CLP A;  4YDD B;  2ILY A;  2IY5 B;  4FXV A;  4RR5 A;  1UVM A;  3JTN A;  4HDG A;  4QBU A;  2F5G A;  1NSQ A;  4ECW A;  4LRB A;  1T03 B;  2K3I A;  2ZKU A;  2L9N A;  3AB2 B;  2OLW A;  1R6Y A;  4CLL A;  4X4U A;  2JEI A;  2RKI B;  1F9F A;  3HSG A;  5CA5 A;  2VBW A;  3M9O B;  3A13 A;  1MRO A;  3SSR A;  2CQI A;  3W2V B;  1UET A;  4Y65 A;  1NDL A;  3G6V A;  4E8U A;  3W62 A;  3R27 A;  3M6W A;  2HBR B;  2FHM A;  1SL2 A;  1QSL A;  2DNG A;  3I0S B;  4OZ2 A;  1F3F A;  5AE3 A;  2HHQ A;  2LEP A;  2HPU A;  2RSQ A;  4DV3 J;  1SL1 A;  2CQC A;  3CD0 A;  5G0R A;  2K06 A;  4GVB B;  2LCW A;  2QMX A;  5L1I A;  2HHS A;  2HQI A;  2IVM A;  4PWD B;  1QVF R;  4KE5 A;  3BSA A;  4CRJ A;  4KFB A;  3HDS A;  2OIH A;  1HQE A;  3IC1 A;  4C8N A;  2CRL A;  2VQF J;  2HWT A;  4GO7 X;  3IM8 A;  2FJB B;  1R8C A;  4YUD A;  1RA7 A;  2ADC A;  2QEX S;  1Q5Y A;  2RF2 B;  2ATC B;  3RW6 A;  3HVT B;  3DDN A;  3ENV A;  4DSE A;  2M8D B;  3BH6 B;  2PII A;  4RUH A;  1AZS B;  4JOU A;  4I6W A;  2ROP A;  2H5I B;  5C24 B;  2E7V A;  4LF8 F;  2F3J A;  1SKU B;  2DHS A;  4L74 A;  2HGL A;  2CWX A;  2IAJ B;  3IWL A;  2R7V A;  3NMR A;  3TAR A;  5KFJ A;  1KRP A;  3UNY A;  3DRP B;  3IAM 9;  3NWR A;  4FF4 A;  3MHY A;  2MQQ A;  3F44 A;  3US5 A;  2JLE A;  3DNC A;  4NLW A;  2OEJ A;  3SEO A;  2W2Q P;  3LAK A;  2FVQ A;  1H7X A;  3HPO A;  2W9B A;  2XEX A;  2ZKT A;  4ETX A;  2VH7 A;  5EHH A;  2E7X A;  3NMA A;  1HQU B;  4H4K C;  2ZD1 B;  1S72 S;  4KHR A;  2ZNZ A;  2AYB A;  2MJU A;  4K4T A;  3EE3 A;  2W8K A;  2XY6 A;  3SCI E;  1HNZ J;  1WKL A;  3PHT A;  2XYP B;  3DOM B;  1CBK A;  1UEK A;  3VAM A;  2YNI B;  2LMI A;  1HBN A;  2RRA A;  1RLD A;  2DGV A;  3C6U A;  2BEF A;  2HVD A;  2AKW B;  2W1B A;  2HBQ B;  4J91 A;  4HVZ A;  5B0C A;  1U2R A;  1JJC B;  4NML A;  2V94 A;  4B9M A;  4PEO A;  2FVP A;  2V8P A;  1T9V A;  2BE2 A;  4WP9 A;  1E6Y B;  5BYQ A;  2VA2 A;  2MYF A;  4IH7 A;  4P2M A;  1UJ4 A;  4Y2K A;  1HNW J;  5GAD I;  2H1Y A;  2V68 A;  1U02 A;  3Q8R B;  1M5O C;  2HLT A;  2UXC J;  2KHD A;  3VAL A;  1R8B A;  5F0U A;  4DS4 A;  4ZIT A;  5JUM A;  4DCO B;  4OJH A;  4CWB A;  2UXC F;  3OTB A;  2FZK B;  4F2R A;  3NOG A;  3KLE A;  1X60 A;  2B8P A;  1BGX T;  3U1M A;  5E3Q A;  5ETM A;  2CNK B;  1NPK A;  3QAE A;  4B9S A;  2RML A;  3PX4 A;  1HWK A;  4XDC A;  3ISN C;  4NLX A;  4BBY A;  5B09 A;  1Y4Z B;  1Z4U A;  1U09 A;  2ILZ A;  3CNQ P;  1HBM B;  1PKU A;  5A8W A;  4HKQ A;  3POT A;  3J81 j;  3NKY A;  3B54 A;  3FEZ A;  5KG3 A;  1URN A;  2XS7 A;  3NWG A;  1FRM A;  3CJ8 A;  3T1A A;  3GYN A;  2XTJ P;  2ZIT A;  3ILI A;  2NQP A;  1U0H B;  2RHQ B;  2NS1 B;  2O66 A;  3J7Z T;  2I2Y A;  3QSI A;  1J27 A;  1O6X A;  1RXO B;  3FDS A;  1KFD A;  3EJM A;  1TKX A;  1EAY C;  4DG1 B;  4ID5 B;  4KAI A;  1JLB B;  3NAH A;  2MKH A;  2UUT A;  1UPM B;  3AB4 B;  3ZZP A;  4QJV A;  1NHV A;  1TKT A;  3ET6 A;  5J1E A;  1NB7 A;  1AA1 B;  4HH0 A;  4LIW A;  1N8R T;  4USM A;  1XC9 A;  2OTJ S;  3C15 A;  2J7W A;  3AQO A;  1N33 J;  1KBR A;  4IUF A;  1SH2 A;  1S9E B;  2DO4 A;  1CJK B;  1UW4 A;  1QUP A;  3WIU A;  4ATN A;  2WVE A;  5J2M A;  4LF6 J;  3KLG B;  2W7O A;  5E7O B;  4BDP A;  2QMU B;  4ZVE A;  4DLE A;  2N4D A;  4KIA A;  5D6G A;  1HWU A;  1RJJ A;  1YG0 A;  1VQY A;  2JFK A;  3BKF A;  4ZDN A;  2ZJQ Q;  2Y0S D;  3D6M B;  3KHH A;  4FPR A;  3PRV A;  3UN3 A;  1LEO A;  1RT7 B;  4JI5 F;  3KDO A;  1TTH B;  3BO3 A;  3LAL A;  4LQ9 A;  3UCG A;  2QT7 A;  4IH6 A;  3UDV A;  4JUZ A;  1LW2 B;  1Q7Y T;  3JAM Y;  1AUD A;  1W25 A;  4QPX A;  3HHE A;  4IDK A;  2KZZ A;  1WDT A;  5FJ4 A;  5A8R B;  1G6B A;  3IRW P;  4W4M A;  3OLB A;  3R1H A;  4Q7A A;  4R25 A;  5C25 A;  3LW5 C;  4DFK A;  4O0I A;  2QJ3 A;  1HIY A;  2UU9 J;  4ED3 A;  3VAG A;  3SBM A;  1N48 A;  4F67 A;  2DNH A;  3CJT A;  3Q8V A;  2Q6C A;  3DGV A;  4OYZ A;  5LXR A;  5EWE A;  3HT0 A;  1J5O A;  3H90 A;  4P72 A;  2EW9 A;  4DU8 A;  3J7Y U;  4P2S A;  2DJW A;  1FF2 A;  1V6H A;  1JLE A;  4PAA A;  1N54 B;  3KJV B;  3QJL A;  2BW7 A;  3SXL A;  4RW8 A;  2VPY B;  3KLI A;  4FF1 A;  2QE5 A;  4CLU A;  3EGV A;  2R2T A;  3NGK A;  4J7C A;  2DPJ A;  1RWM B;  2LU1 A;  5E2Q A;  1RTJ A;  4NA2 A;  2K2P A;  4QWB A;  3EXC X;  4CO4 A;  1DRZ A;  3G96 A;  1SJ4 P;  2VFU A;  5HP1 B;  5G4D A;  4DR5 J;  3G8T A;  4ZPB A;  1TL1 B;  1FFW B;  4B02 A;  3DOL B;  3IRX B;  4JI4 J;  3N79 A;  1B4S A;  3IGV A;  2CJX B;  2R7W A;  3JXO A;  4ZA1 A;  3M8S A;  3BSN A;  5KFG A;  3I5C A;  4CLK A;  4ZPV R;  5J2P A;  2QA4 G;  1SVD A;  2ZH9 A;  3BBC A;  5IXU A;  5HN0 A;  2ERR A;  5DLF A;  1FEE A;  3AOD A;  3NCP A;  5E0O A;  2D3U A;  4USK A;  2KM8 C;  4RUA A;  3U27 A;  3QT7 A;  4ZPC A;  1ZAV A;  4A8F A;  3HHK A;  3AAW B;  3Q8Y A;  2G0C A;  5EWG A;  3Q0A A;  2W9C B;  2DNL A;  2IRX A;  4DZ6 A;  2DH8 A;  1UVL A;  3IM9 A;  3CJ5 A;  1S1U B;  1RAI B;  2FZC B;  2XLJ A;  5K20 B;  4FXW A;  4NEZ A;  4F4A A;  1WTB A;  2HVI A;  2Y3Y A;  3H98 A;  5MLC V;  3OXF A;  1RLC L;  1X0F A;  4HI1 A;  3GV7 B;  3I31 A;  1FKP B;  3KUE A;  2A2D A;  4DPU A;  4EFA C;  2AJ1 A;  4Y2M A;  1L3S A;  3J81 Y;  1MN7 A;  2IMW P;  2YKN B;  2R2U A;  1RT4 A;  4FZV A;  3G9C A;  2UUC J;  3EDQ B;  2QN6 B;  2RU9 A;  3PHE A;  1P1L A;  3SCJ E;  2JVO A;  3AH6 A;  2KJV A;  5CYM B;  5IOL A;  3TAM A;  3UDL A;  3MM7 B;  2CNL B;  3GIJ A;  3HUL A;  2YWF A;  1VIX A;  1D0E A;  1PIE A;  2VG5 A;  2J9E A;  3MED B;  3K59 A;  3MR5 A;  1NK5 A;  2VA3 A;  1U48 A;  1H72 C;  1HMV B;  2N3O A;  5IM0 B;  3DRY A;  1WF0 A;  1ZZN A;  2PI4 A;  2Y0B B;  3GTY X;  5L46 A;  3LQV A;  2K1R A;  4NWB A;  1N32 F;  2HVZ A;  1NPP A;  1FTC A;  1A0O B;  5DJB A;  2AYG A;  2MJN A;  3K8V A;  1GMV A;  1G1X A;  2H4Y B;  2GMJ A;  4GRS A;  5L39 A;  4Q0B B;  3B4D A;  3UPF A;  1WHY A;  3ETM A;  1OPZ A;  2YKA A;  2R7R A;  1GK8 A;  2DGS A;  4USU A;  2G2O A;  3R6L B;  1RTD A;  4J9N A;  5KG0 A;  2V8G A;  3X3U A;  4UOC A;  2CPH A;  1X4B A;  3CMA S;  4XO0 A;  1S6Q A;  4FKY A;  3ZXW A;  1CS4 A;  3MMA B;  4WU3 A;  3ISN D;  2UVV A;  1H2T Z;  4CT9 A;  1NJX A;  3PFO A;  2HHP A;  3C16 A;  4YB6 A;  1ELO A;  4Q8E A;  1IKV A;  5HBM A;  2KVI A;  1KFS A;  2NCK L;  1LQ9 A;  1HW9 A;  3MUR P;  4WXW A;  4DR3 J;  5CAB A;  1QAY A;  1V3Z A;  3OTE A;  1T03 A;  5CHC B;  4K0K J;  1BLU A;  4QQB A;  4WBF A;  5E3P A;  2VDH A;  2RKI A;  2BKN A;  2BW2 A;  3TUI C;  2XI3 A;  4QR1 A;  2Y9H A;  4P7T A;  4J90 A;  1P6T A;  2MQN A;  4RX6 A;  1IN0 A;  2CPJ A;  3W2V A;  2YKO A;  3CXC R;  1YHQ S;  5CCM A;  1N5Q A;  3KK1 B;  4Q43 A;  4EBC A;  4NRU A;  2V63 A;  3I0S A;  3CT9 A;  2RS8 A;  5ETL A;  3G6Y A;  4I0W A;  4PWW A;  2VB6 A;  2ZBC A;  4GVB A;  4U96 A;  2FJX A;  4UQT A;  4PWD A;  3CJQ A;  2IC3 A;  2IJN A;  4L3N A;  3OL8 A;  4LF1 A;  5D3G B;  2IFX A;  1K8A T;  1FO1 A;  2X1G A;  1SH0 A;  2GHW A;  2M7S A;  5K8M A;  2ROG A;  3MPV A;  1VQ8 S;  3MCS A;  2BV3 A;  2RF2 A;  3DLG B;  2VIC A;  4O3S A;  3EPI A;  3RG6 A;  1PBA A;  1H3D A;  1S0O A;  1DAX A;  3M8R A;  2MZQ A;  2CJY B;  4N7T A;  5EUH A;  4F36 A;  4OI2 A;  5C24 A;  4WYL A;  4DN0 A;  3FCH A;  1XR5 A;  5IFM A;  4C3L A;  2PI5 A;  2Z2Z A;  3T5H A;  2IAJ A;  4NLQ A;  1NDK A;  4CO3 A;  1HNX F;  3CCU S;  1XNR J;  3HHN B;  1Q81 T;  1X4G A;  1N0V C;  3DRP A;  5IQ6 A;  5DG9 A;  1G7C B;  1VYA A;  4RBT A;  5KTQ A;  4CM2 A;  2GQC A;  3CDU A;  4FVM A;  4LBP A;  4LF4 J;  2Q66 A;  4K2X A;  3H4D A;  3GSD A;  3MEK A;  2F8E X;  2HFS A;  3VGU A;  2RDI A;  1HQU A;  5KFR A;  4TQR A;  2ZD1 A;  2QRR A;  4LF4 F;  3P5B P;  4QR0 A;  2ZE2 B;  2KXH A;  3CCS S;  2QA4 S;  2OH2 A;  2HRY A;  5KFQ A;  2AX1 A;  3DOM A;  3R2C J;  4N8N A;  4OX8 A;  4YHH F;  4J9V A;  1D9D A;  5F8J A;  2W9A A;  3I9Z A;  3TA1 A;  4OYO A;  4M8L A;  1U2F A;  2F63 A;  3D1Q A;  4OX7 A;  1JK9 B;  3OR1 B;  5KFU A;  1ULR A;  2NUU G;  1RTI B;  2RUS A;  2Q3P A;  4K7Q A;  3H5X A;  1E6Y A;  2DKO B;  4U95 A;  3BSO A;  4OHX A;  1MLA A;  1N56 A;  1NEE A;  4ZVQ B;  4JBC A;  4NA3 A;  3E51 A;  3H25 A;  2BRL A;  3KHR A;  3VGT A;  1CLF A;  3TO8 A;  3B6B A;  1FTR A;  1D9F A;  2KFZ A;  1NXI A;  4LF5 J;  2RRB A;  1T8E A;  4CO2 A;  5BR8 F;  4XTT A;  1S0N A;  5HMY A;  2ZC4 A;  2CPI A;  1NDC A;  2XBP A;  3SSQ A;  1EB0 A;  3U1L A;  3H2U B;  4MKV A;  4B3R J;  1S1V B;  4KH0 B;  5HLF B;  4I2P B;  4UST A;  4M5J A;  3VVT A;  2B4V A;  2NXC A;  3DXB A;  4TU8 A;  5THW A;  4UY8 5;  3ITH B;  4JV5 J;  5D78 A;  5KFW A;  2F8M A;  4KGX B;  3GCW P;  2CJK A;  4J9R A;  2CIM A;  4HTJ A;  2V2Z A;  4F4Z A;  2WON B;  1CJV B;  1FRI A;  4JV5 F;  3R7S B;  5LSO A;  2KYX A;  3C46 A;  4AXI A;  4ED5 A;  2QIF A;  4WIQ A;  5KT6 A;  3CB4 A;  1U1L A;  1RAH B;  2PFD A;  2UXB F;  4O3R A;  3HLU A;  3HK2 A;  2HZC A;  3TX0 A;  4WFN Q;  3GON A;  4ZPW R;  3I55 S;  1U0H A;  1JLA B;  1UAW A;  2J0Q D;  4CDI A;  3NRB A;  4JYA J;  3HSJ A;  3L7P A;  2FJA B;  2ASD A;  1RWW B;  1F5A A;  2OPQ B;  3FFI B;  1MNE A;  2YH1 A;  3H20 A;  2E9Z A;  1FNX H;  4X2B A;  4KHP F;  4ZPT R;  3CC7 S;  3KLF A;  3FQL A;  4DG1 A;  5EWF A;  3CD6 S;  4ID5 A;  4ZVG A;  2MKC A;  1HWL A;  3O8W A;  1JLB A;  3CJ4 A;  1KVK A;  2XMT A;  3NGS A;  2J5A A;  3NGU A;  4ZJL A;  1WF2 A;  2KO1 A;  2RQK A;  4ZHR A;  5B0D A;  5HVF A;  3I6P A;  2IM3 A;  4QYZ K;  4I2Q B;  2WTF A;  5H9F J;  1GTH A;  2OTL S;  1NND A;  1SQE A;  1S9E A;  1CJK A;  3TJ9 A;  1ZAX A;  4OYI A;  4JI7 J;  3W63 A;  3KLG A;  4TN2 A;  3GV5 B;  1Z2L A;  1M5K C;  1RWV B;  1Q4R A;  4NYP A;  2NXN A;  3SCL E;  2KZM A;  5ETR A;  4LMZ A;  3S01 A;  3CDB A;  4JI7 F;  1CJT B;  1HI0 P;  3PYG A;  4DSI A;  4FS2 A;  5BJR A;  1JIH A;  4IRC A;  2IBO A;  4C8L A;  4O3P A;  2HYI B;  4FBT A;  3QID A;  3G6X A;  2XZW A;  2HNZ B;  1LW2 A;  1RTZ A;  2WW4 A;  1OSC A;  2DIV A;  2OPS A;  5KFI A;  5KFT A;  5CQG A;  5AE1 A;  1NKC A;  5LMN J;  2E5L J;  2DTJ A;  5A8R A;  5U47 A;  3NGR A;  1U25 A;  5A76 A;  3IS9 A;  2E5I A;  2AZ1 A;  3D68 A;  4LSL A;  5I4M A;  4R5P B;  4F4K A;  4YME A;  1FWL A;  5ITH A;  3MCM A;  2MXY A;  4NPO A;  3V6H A;  3UE2 A;  5E5N A;  1FRX A;  4F4Y A;  1L3T A;  1TK5 A;  2BAC A;  1RT6 A;  1PC5 A;  1VC0 A;  3TOQ A;  3N5F A;  2X3G A;  5LL6 d;  3KJV A;  1OS5 A;  1FX4 A;  4BC7 A;  3AOA A;  4LJM A;  1RU1 A;  1N52 B;  3QLH B;  3PX6 A;  4QR2 A;  2XYH B;  3MPW A;  2YKQ A;  4IFV B;  4JB8 B;  1WF1 A;  4DUY J;  1L3K A;  3AQP A;  2XMU A;  2V8V A;  5HP1 A;  3PR4 A;  1UEV A;  2P2C B;  1U47 A;  4ZJO A;  1TL1 A;  3T1Y J;  4CZC A;  2F1F A;  3DOL A;  3IRX A;  5LMU J;  1H0H B;  1UMJ A;  2Q6B A;  3VV2 B;  4PRF A;  4KKO B;  3MM6 B;  2A18 A;  3MR7 A;  4M95 A;  3CCZ A;  3H0P A;  2V34 A;  2DHX A;  2YWK A;  3CJS A;  2XO7 A;  3ENQ A;  2MKJ A;  1UA0 A;  2D41 A;  4QOT A;  3MI7 X;  1F60 B;  1T9X A;  2FJD B;  3JQJ A;  2DR8 A;  3DDI A;  4C8Y A;  5J2Q B;  4TY9 A;  5GAH I;  2I5J B;  4ITS A;  3PYF A;  5K9F A;  1RTH B;  2W9C A;  2Y1J A;  1U1Q A;  2O01 C;  3C3L A;  1XMQ F;  3WX8 A;  7AT1 B;  1FT8 A;  2GJI A;  2HQF A;  1U26 A;  2X1F A;  3DRS B;  4J9P A;  1TV6 B;  1YI2 S;  2BMB A;  9ATC B;  4MIB A;  2VFV A;  4C2M A;  4DR7 F;  3TZW A;  2D7S A;  3MMC B;  1FKP A;  2XY5 A;  3M8Y A;  3RB6 A;  2WOM B;  3OQ2 A;  2YKN A;  4R0J A;  1RB0 A;  4Y00 A;  3I5B A;  3CJ3 A;  2C2N A;  1MG7 A;  5ETS A;  4TY8 B;  5CYM A;  2GC8 A;  3MM7 A;  2GVD B;  2HZV A;  1FE0 A;  3Q83 A;  4CLW A;  3WC2 A;  1FCA A;  4MTP A;  4FBU A;  1XER A;  3KLV A;  4TQS A;  4HDH A;  1P8G A;  5HK4 A;  4DV1 J;  1XMB A;  4DFM A;  2HQC A;  4L73 A;  1HMV A;  2MMY A;  5IM0 A;  1OJ4 A;  1JJ4 A;  1U4B A;  2EK1 A;  1L3V A;  2PE8 A;  4DV1 F;  4YB1 P;  4OYX A;  3IR7 B;  1TAQ A;  4GVL A;  3TA2 A;  4PQA A;  3N0V A;  4HI2 A;  5F0W A;  3KK3 B;  4IR9 A;  1TKZ B;  1IR0 A;  1N34 J;  3OSN A;  2OO4 A;  1WSV A;  3MMB B;  3D3B J;  3LWM A;  4EBE A;  3D3C J;  2BQU A;  4J5O A;  4Q0B A;  4Y2I A;  3MDF A;  2KRB A;  4ZPA A;  3M05 A;  2EFN A;  2UXD J;  2KXN B;  2WCX A;  3R6G B;  1KLN A;  2V5H G;  2BJ1 A;  4QIE A;  3OJU A;  4NI2 B;  2BM0 A;  1WEZ A;  3G86 A;  3TVY A;  3EYZ A;  4GC7 A;  1RT3 B;  2UXD F;  2FLN A;  3MMA A;  5B0G A;  4DR6 J;  1HI8 A;  3KXD A;  2GHP A;  4WU2 A;  4DV6 F;  4EU0 A;  2DNZ A;  1EHW A;  4HYK A;  1X4E A;  2KT5 A;  2D69 A;  2UUW A;  1WC0 A;  1XN9 A;  1G2E A;  4LBH A;  2RHS B;  2F9J A;  4RW6 B;  4EYI B;  5AE2 A;  1HAR A;  5CH7 B;  3GJT B;  3AOB A;  1DBD A;  2J6S A;  3NG8 A;  3QGI A;  1VRU B;  4DQI A;  4ZCK A;  4LT6 A;  1OO0 B;  3HI9 A;  3E2E A;  1J2V A;  2WSE C;  4ZCL A;  4IO9 Q;  2YKM B;  2R8K A;  4L6V 3;  1YJU A;  2DR9 A;  1YKW A;  1M1G A;  1IBC B;  1ACM B;  2AHO B;  2AYE A;  5HVH A;  2P8I A;  3KK1 A;  4U7U K;  2HGM A;  1TEL A;  1XTZ A;  3C6T A;  3HVR A;  3I82 A;  4H4O B;  2CAD A;  4F7V A;  3VAF A;  1ROF A;  2ZNY A;  1KOH A;  2EBE A;  3PEJ A;  3MCN A;  5D3G A;  1UJ5 A;  4ENO A;  1X5O A;  3D7S B;  1RCO B;  2B0G A;  3M32 B;  4UOH A;  1T02 A;  3OD2 A;  3CCW A;  2UV8 A;  4K4V A;  3DLG A;  2J8A A;  2MB0 B;  1F9E B;  5D4O A;  4ES2 A;  3A4T A;  2G9O A;  3QAT A;  5EX3 A;  1VHI A;  1RWX B;  3ZZU A;  3UCU P;  3Q8Q B;  3KG0 A;  2AP6 A;  4PG8 A;  4OHW A;  3IBF B;  3UNG C;  1R0A B;  4OX9 F;  3BEG B;  2W25 A;  2AWZ A;  2E29 A;  2J6U A;  4OI1 A;  3UFC X;  4JI3 J;  2FC8 A;  3DGP B;  2KYZ A;  1SI9 A;  1REG X;  3TAQ A;  4NA1 A;  3D6F B;  4PQU B;  2DHH A;  3D0I E;  5H9E J;  1SH3 A;  4LF9 F;  2G13 A;  2ZUG A;  2HAF A;  1NPR A;  1WOP A;  2GQQ A;  1Q8K A;  1FXR A;  2P6T A;  4RU9 A;  5A0Y B;  4BS2 A;  3THT A;  2DEI A;  3DM2 B;  3NGT A;  2ZE2 A;  2V2K A;  1M90 T;  2FHJ A;  3QZ7 A;  4AD6 A;  3NXZ A;  1U1K A;  1NK7 A;  4X62 J;  3BZQ A;  2X3D A;  2E1A A;  5LJ5 Y;  4KB7 A;  4RW7 A;  1LXJ A;  4DCP B;  5LXY A;  3MMJ A;  3OR1 A;  1WEX A;  4P2F A;  1RTI A;  8RUC A;  1R7I A;  1BMQ B;  3PVX A;  4ZP9 A;  2B4O A;  2BX6 A;  2CXE A;  3U02 A;  1KEK A;  3RUB L;  1N5Y B;  3KOA A;  3DLJ A;  4PAB A;  3IFE A;  4OZ5 A;  3QJP A;  1RUS A;  1WKK A;  1DUR A;  2HS4 A;  2VPZ B;  3AJ2 A;  2EFP A;  1TVR B;  3DLE B;  4WZQ A;  1SKW A;  2B9W A;  3W64 A;  3ULH A;  2BQR A;  1IBL F;  3JS9 A;  1QVG R;  2BE9 B;  4LF7 F;  1KR4 A;  4A47 A;  3MEG B;  2Y1R I;  3GB0 A;  1B0T A;  1V5V A;  4LR9 A;  4HT5 A;  3TR5 A;  3HSZ A;  4OL8 A;  2ZBR A;  4RNH A;  4B3T J;  4KQZ A;  4RUB A;  4A8Y A;  2EK6 A;  1S1V A;  1C1B B;  5HLF A;  4I2P A;  4YN3 B;  2Y8Y A;  1I94 F;  3GR1 A;  4P10 A;  3ITH A;  4B3T F;  4FF3 A;  2JEF A;  4I1T A;  2J9D A;  3M9M B;  2XG8 A;  3L09 A;  1XK8 A;  5F41 A;  3P3D A;  5F3Z A;  5EDW A;  3D2W A;  5DG7 A;  2HNY B;  3JAM U;  2WON A;  1CJV A;  4NLG A;  4WP8 A;  1REV B;  2UUA J;  2B8Q A;  2LVW A;  1BE4 A;  3W9J A;  3VAK A;  3FKB A;  3JTP A;  2ZM6 F;  1ZTT A;  1TL3 A;  1IBK F;  3DI6 B;  4A48 A;  1B3T A;  3P6Y C;  4A8X A;  4LQ3 A;  1JLA A;  3Q89 A;  4TYB A;  4NLR A;  2GIR A;  2DGO A;  3O5T B;  2OPQ A;  3TAP A;  3FFI A;  3CUL A;  2A2C A;  1RGV A;  4ZOS A;  1Q78 A;  2AT1 B;  2W4C A;  5I3P A;  2YX7 A;  4K2J A;  2YH0 A;  3RB0 A;  3GMG A;  3HHL A;  1Q53 A;  1BWE A;  4KFB B;  4NLU A;  4N47 A;  3AFG A;  4WKY A;  3BQ2 A;  1IM6 A;  4P6Q A;  1NDP A;  2RUG A;  4RNM A;  3Q23 A;  2ALY B;  3SIP B;  4PUO B;  3KK2 B;  2AU0 A;  1D1U A;  3LTO A;  2FIU A;  1LWX A;  4I2Q A;  2IDL A;  4IFY B;  2M3D A;  4ZJQ A;  3T41 A;  2AMC B;  4NEY A;  5C2G A;  2R2S A;  2RQC A;  2CPD A;  2C22 A;  4YY3 J;  2H48 B;  2J76 E;  1B7Y B;  1UCN A;  1A9N B;  3R5D A;  4PXB A;  1CJT A;  2RIJ A;  3B82 A;  3M8Z A;  3EZ5 A;  1AT1 B;  2HUR A;  1OY8 A;  5GAE I;  1JX4 A;  4C8M A;  2HWH A;  2N82 B;  1VHF A;  1QTM A;  5GME A;  4HHU A;  1DY3 A;  1HBO B;  2AQ4 A;  2ZOM A;  1RKJ A;  1YJR A;  2HNZ A;  1Y3K A;  2H4W B;  2HBY B;  2WVB A;  1Z2Z A;  3SV4 A;  2W24 A;  2PEH A;  1FE4 A;  2R4F A;  1V5I B;  2MHE A;  1SKR A;  1S6U A;  2DO0 A;  2J6T A;  1UJ6 A;  1FKO B;  2C3O A;  2VBX A;  4OMF G;  4DV2 J;  4R5P A;  3OL7 A;  1S49 A;  3DYA B;  1JLG B;  2B5J B;  3BQ1 A;  1ZA2 B;  3ZZT A;  3NEK A;  1ZM2 A;  3CIZ A;  3GE9 A;  1XR7 A;  5E33 A;  3J81 U;  3NLC A;  1U1P A;  2CQD A;  4HAC A;  2K3K A;  3A8I A;  3OXG A;  4HEA 9;  2DK2 A;  2WHO A;  1RAO A;  3QLH A;  3OTC A;  2WK4 A;  4RUC A;  2QLF B;  1LFW A;  3QT8 A;  1DFD A;  2KU7 A;  2JJ4 D;  4ILM A;  5L9N A;  1I1G A;  3MD1 A;  3G71 S;  1F1B B;  3UN5 A;  2VL1 A;  2QLX A;  4LFA J;  1NK9 A;  4Y3C A;  2JLF A;  3TZX A;  4A8W A;  3I0R B;  1N4L A;  1Q5V A;  4ZIW A;  4KKO A;  4ECX A;  3MM6 A;  3CC4 S;  4DUZ F;  4DQQ A;  1KVJ A;  3JSB A;  3FVY A;  4LFA F;  4DPX A;  1AFI A;  1WJ9 A;  3MR2 A;  2KVQ E;  1FDA A;  5FDL B;  2RE1 A;  3PW2 A;  2F40 A;  2AZ3 A;  2VON A;  4M5L A;  3PEH A;  5A8W B;  5GVQ A;  1JWW A;  5J2Q A;  2I5J A;  3ZO7 A;  3IAS 9;  1R43 A;  2VKR A;  3L7U A;  1Q16 B;  4RL1 A;  3BN4 A;  1S4F A;  4ILL A;  4TVA B;  3MZI A;  2E5H A;  3ZTQ A;  1C0U A;  4J9O A;  2IA0 A;  2XUL A;  5K8N A;  5K14 A;  3KHL A;  1YZ6 A;  1KN6 A;  1RAE B;  1NAQ A;  3MEC B;  3DRS A;  3W2W B;  1TV6 A;  2GAG C;  4C3M A;  2UP1 A;  1VBK A;  1NJI T;  1RZM A;  5DM6 Q;  3MPU B;  1S97 A;  2K7J A;  3MMC A;  1Y5L B;  3DLH A;  4C48 A;  1X4A A;  2MZ1 A;  3BB5 A;  4QW9 A;  2Q43 A;  4OYA A;  2PC6 A;  4DUT A;  2GFF A;  4NZ7 A;  4OV6 A;  3KLH B;  1TUV A;  3PV8 A;  4Q2L A;  4G1Q B;  1EAR A;  1WC4 A;  3ET6 B;  5J1E B;  5D0E A;  1FX2 A;  4FN5 A;  1GX6 A;  4TY8 A;  3TP2 A;  4IRD A;  3AOC A;  2QGF B;  1YBA A;  3JSY A;  1S12 A;  3MPY A;  1Q8L A;  2A6O A;  2UZA A;  2X51 A;  2LQ5 A;  1Q0N A;  2V2V A;  4M63 A;  2OEK A;  2DNO A;  4DX7 A;  5J2M B;  1JLC B;  2JX2 A;  2FLL A;  4X66 F;  1S1X A;  3G8Q A;  3A8K A;  3N4W A;  3AXM A;  3OTO J;  3AXK A;  3G82 B;  2OJ3 A;  2MQM A;  1TKZ A;  4UOG A;  1YDL A;  1LFP A;  1UP1 A;  1OSD A;  4WE1 B;  4M5D B;  4LRA A;  1WHX A;  1VQK S;  1PSD A;  3Q2S C;  4WF9 Q;  2NPI A;  3FEY B;  1PYS B;  4BCA A;  2DRB A;  1VGY A;  4M94 A;  2HEK A;  1RT3 A;  5CD4 H;  1S79 A;  1NK0 A;  1S77 D;  2AW0 A;  5HAO A;  2BKP A;  1VJQ A;  2DXD A;  3ILJ A;  5AXM A;  2D3O R;  3HXM A;  4PXD A;  2JZ5 A;  2I9S A;  4NX9 A;  1MWQ A;  3GQC A;  2NUH A;  1EX8 A;  5KFN A;  2IM0 A;  4RW6 A;  1T94 A;  1S6P B;  4USJ C;  3OHA A;  1B99 A;  2FTR A;  4F3M A;  1VRU A;  3DDK A;  3GJR B;  4DOZ A;  2B7B B;  3PAC A;  5CYJ A;  2R8I A;  5H1S V;  2YKM A;  3SFG A;  1YRU A;  3UO0 A;  3DRR B;  3BF4 A;  1YBT A;  3DRX A;  2HFV A;  1K73 T;  4DHV A;  3A1Y G;  4Y6I A;  4H4O A;  3G4S S;  2WZ1 A;  3D9B A;  4F2S A;  5HMZ A;  2JRS A;  4AYB D;  4IRK A;  4DI6 A;  4NXM J;  2VBY A;  4NZ6 A;  1J5E J;  5LJ3 Y;  1GXU A;  2NXE A;  2LLZ A;  4ZVP B;  4YR3 A;  1VQN S;  5J2P B;  4O0N A;  3M32 A;  2EFV A;  1YX2 A;  2LA6 A;  4YP3 A;  4X4N A;  2GO9 A;  2E1C A;  3D5M A;  4DF8 A;  5HI7 A;  2FB0 A;  3CD5 A;  4RW9 B;  4F3Q A;  2AEF A;  1CSJ A;  3IG1 B;  2M2B A;  3PX0 A;  1IXK A;  1UVI A;  3ZFV A;  1R0A A;  1TL5 A;  4QWD A;  3MGJ A;  1QE1 B;  1S0V A;  1BQX A;  3OT9 A;  1SL0 A;  1GNK A;  3IWX A;  3J80 U;  5D4N A;  1GX5 A;  3DGP A;  1RHR B;  4OHV A;  1S48 A;  3PW0 A;  3GG1 A;  2FY8 A;  3H5U A;  4PQU A;  2YPZ A;  2HWI A;  1MWZ A;  4NLP A;  5ETP A;  1L3U A;  4DR4 J;  3H5Y A;  4DR2 J;  1ZA1 B;  3ENA A;  4I64 A;  7FD1 A;  5A0Y A;  4J9U E;  4ZIV A;  1F2H A;  2QFI A;  4C3K A;  1X9S A;  3D4J A;  4CCH A;  1KHW A;  3TAM B;  4CO1 A;  4E98 A;  2MLX A;  4DDF A;  1XNQ F;  2G2Y A;  2BAB A;  2EBG A;  1WG4 A;  2QLJ B;  5KT2 A;  3GFX A;  1Q82 T;  4GKJ J;  1V9O A;  5EN1 A;  1U24 A;  3HJF A;  3RRH A;  4FXD A;  4ICL B;  3A3N B;  1SJR A;  3EXY A;  2LEB A;  2NYH A;  5HQM A;  1UKU A;  4DQS A;  3VZI A;  2XS5 A;  1HR0 F;  3K8W A;  4DL4 A;  1N5Y A;  1M1H A;  3D0H E;  1XJW B;  2Z2M A;  4DR1 J;  3PYE A;  4B3M F;  3SFU A;  2XS2 A;  1T3O A;  3DLE A;  4WJB A;  2BRK A;  2GS8 A;  2MQO A;  5IZH A;  2I6W A;  2FPH X;  2PDA A;  3GCX P;  3DOK A;  1TP7 A;  2QL5 B;  2CUY A;  2MEW A;  2OAU A;  3C66 A;  3TUZ C;  4QIV A;  1WEL A;  1IJF B;  3A8J A;  3MEG A;  2ZOG A;  2OPR B;  4MH8 A;  4DBQ A;  4B3S J;  4O3Q A;  2HHH F;  3S7R A;  3PKM A;  5L8R C;  1WAC A;  2OP5 A;  3TNV A;  3FUY A;  2CZ9 A;  3GFZ A;  5GAG U;  2J8S A;  2V67 A;  3R1L A;  5EX0 A;  1C1B A;  4HR2 A;  2FJW A;  1I5O B;  2L9D A;  1TUG B;  3PRB A;  1IKW B;  2RQ4 A;  2VDI A;  4JI2 J;  4RBV A;  2NRE A;  4OI3 A;  1KD1 T;  1S76 D;  5I3Q A;  3SQG B;  1B0P A;  2HZA A;  4ECQ A;  3PCO B;  2HNY A;  4JI2 F;  3PYD A;  1REV A;  3OV7 A;  3OVB A;  2NLW A;  1ARO P;  2WSF C;  2MQP A;  3W3S A;  3DI6 A;  2BJ3 A;  3WC0 A;  3ZZZ A;  1HD1 A;  1QTN B;  1X0P A;  4KC5 A;  1UPP A;  3FNN A;  4YFU A;  3G87 A;  1W2I A;  2FGC A;  4ZK7 M;  2JEJ A;  4YB7 A;  4LFB J;  4ELU A;  2IC3 B;  4X4S A;  4N56 A;  2C2O B;  4DV3 F;  3M2U B;  3MM8 B;  3OLA A;  2VOO A;  4RBU A;  4PUO A;  3KK2 A;  4URS A;  1NJW A;  1ZM3 A;  2BBE A;  3QWU A;  4IFY A;  4NRT A;  1M5S A;  5GMK a;  3OSP A;  2YQ1 A;  2EG2 A;  2VQF F;  1IM4 A;  1IQZ A;  2DXF A;  4KJI A;  3PZP A;  2EI5 A;  4KBI A;  2FDN A;  3GII A;  2GZO A;  4LVN P;  3GIM A;  2DYA A;  5ETO A;  2E5G A;  1RAG B;  4JI6 J;  4OYW A;  2J7U A;  1BQN B;  4OYB A;  2XI2 A;  3RW7 A;  4W90 B;  1FFG B;  4GKK J;  2X1A A;  4B9N A;  4FPI A;  1FJG J;  4QU7 A;  2M88 A;  2FUG 9;  3X1L B;  1CQN A;  3F41 A;  3UWT A;  5DS7 A;  3RGI A;  1HBO A;  1U0S A;  3PIO Q;  1R3N A;  3S8S A;  3H40 A;  3MXH P;  2VC0 A;  3UVJ B;  2J7K A;  1T9Y A;  4UOF A;  1OQ3 A;  5KT3 A;  4WZM A;  1TKD A;  1U8W A;  1QLN A;  1LWE B;  3RRK A;  1FKO A;  2ZDO A;  1IVZ A;  4F4X A;  1NZA A;  2CPX A;  4N8O A;  2J9D E;  2PT0 A;  4R0E A;  2C2D A;  5DQH A;  5D4P A;  3DYA A;  2RH3 A;  1HHS A;  1JLG A;  1OPI A;  2B5J A;  1HNZ F;  4ES3 A;  1AB8 A;  1Y11 A;  1IBM J;  3BN7 A;  3CDE A;  2IM1 A;  2JEG A;  4UY8 T;  1SIW B;  3LGH A;  3I56 S;  2E7W A;  1LXN A;  4G6V B;  2BOA A;  5KFB A;  4DV0 J;  2RJZ A;  2IMO A;  2LEC A;  3ZTO A;  1GMU A;  2PN6 A;  3R9L A;  2YWG A;  3KWM A;  2IA6 A;  4QZV B;  3RBZ A;  3W9H A;  2DVI A;  1HNW F;  2HBZ B;  5CZV A;  1FES A;  3CCR S;  3MFH A;  2U2F A;  4OZJ A;  2XMV A;  3I0R A;  1D09 B;  2DNR A;  2HK2 A;  4RNO A;  1S1W B;  1NH7 A;  3HFK A;  4Q45 A;  3NNA A;  2CNO B;  5FDL A;  4AT1 B;  1N5T A;  3HZG A;  2N7C A;  1RAF B;  1VCT A;  3RU0 A;  1PCA A;  2P6S A;  5KFK A;  2J0S D;  4X4T A;  3IO1 A;  4QPT A;  1T7P A;  1P27 B;  3PG9 A;  2GO8 A;  3D6H B;  3UDC A;  4RWX A;  2LFV A;  2EFG A;  4OI6 A;  2OGU A;  2OKQ A;  2VFR A;  1VQS A;  3LUY A;  3MEC A;  3W2W A;  4WCE Q;  4MT1 A;  3UDE A;  1T05 B;  4MK9 A;  4Y0F A;  2CA9 A;  3I32 A;  2OEL A;  1U1O A;  1H38 A;  2C2E A;  2D1C A;  3GP9 A;  2R7U A;  4C7Q A;  4ZKA A;  5HAN A;  1FNO A;  1JXE A;  4TYA A;  5F8M A;  3KLF B;  4FP9 A;  3FRY A;  5AJ3 J;  3WBZ A;  2N3L A;  3T6B A;  1SPB P;  3KLH A;  1RBA A;  4G1Q A;  1VJW A;  1X31 C;  4Z37 A;  4ZHR B;  4USW A;  3V6D B;  4CTA B;  5ETV A;  3HD2 A;  4ELV A;  4KY3 A;  2NYI A;  2HQ3 A;  5RUB A;  1M0S A;  2YNH B;  3RTV A;  2GML A;  2HFU A;  1KLM B;  3RBE A;  3M8P A;  2R8G A;  4ZP7 A;  3OVS A;  2ATL A;  1JLC A;  1N33 F;  2C42 A;  2IYI A;  2VV5 A;  5AT1 B;  4Q44 A;  4U9R A;  3PTW A;  1RT1 B;  3W5Z A;  2KFY A;  2EC2 A;  1RU2 A;  4LF6 F;  5GAD U;  4ED7 A;  4ETZ A;  2LEA A;  5DG8 A;  1NSK L;  2M4M A;  5FLX U;  2VBZ A;  5AXN A;  3G82 A;  3K58 A;  3GJS B;  3K5M A;  5D0G A;  3QSY B;  4EZ6 A;  2KB2 A;  4WFY A;  2DGT A;  2CJA A;  1RBL A;  4WE1 A;  4M5D A;  2E44 A;  2OPS B;  3AY0 A;  1RBO B;  5KT5 A;  2XM3 A;  1IWA A;  3NBP B;  2QSF A;  2ZUA A;  2XNQ A;  2DNY A;  4F50 A;  4I67 A;  1FJ7 A;  4HHH A;  3PW7 A;  1RWP B;  2VZ9 A;  1DAR A;  3IS9 B;  4DN9 A;  2UVW A;  3FRZ A;  1SV5 B;  4LSL B;  4YR2 A;  1U45 A;  2DNQ A;  4M5K A;  1FVQ A;  3EGN A;  1YJN S;  2UV8 G;  1DHM A;  1G4C A;  2VC1 A;  1KQS R;  4BC9 A;  4IR1 A;  2GVZ B;  5IC6 B;  3BDE A;  2ZHA A;  3RJM B;  2LKZ A;  5KOW A;  4KRW A;  3I5A A;  2M52 A;  3NCR A;  3M1V B;  1RT6 B;  2UU9 F;  4YEA A;  2L9W A;  4L75 A;  1S6P A;  1B70 B;  1K1S A;  3ZTS A;  3BQ0 A;  2AJQ A;  1PAE X;  3OL6 A;  4UTG A;  3GYG A;  5DET A;  1WDD A;  3FCW A;  2A6M A;  2VIH A;  5CZX A;  4DSF A;  3DRR A;  1FKA F;  1SB6 A;  4G3I A;  4RW4 B;  1FRL A;  1HQ2 A;  3MAA B;  1NJZ A;  4RNF A;  5B0E A;  4DR5 F;  1H6K X;  1PGZ A;  1D8Y A;  4MMO A;  4F8R A;  2ZJR Q;  4JI0 J;  2B4P A;  3SSS A;  3KKF A;  1HD0 A;  4JI4 F;  3ELH A;  5I42 B;  4CQ1 A;  3N28 A;  2DT9 A;  2MPU A;  8AT1 B;  4K5R A;  3BGU A;  3M8Q B;  3ZZR A;  4O4G B;  1F6T A;  1VRQ C;  4JI0 F;  5DDO C;  1LWC B;  5B08 A;  2IJF A;  5T7L B;  2W7A A;  3IN5 A;  1LK7 A;  2APO A;  3N6L A;  2ASY A;  3CJR A;  1GTE A;  2F9D A;  4RW9 A;  2RQM A;  3IG1 A;  1DTT B;  4ZLN A;  3SDE B;  2YVS A;  3QT6 A;  1N36 J;  5KG5 A;  2NXU A;  2WAQ D;  4K4X A;  3EZO A;  5F8I A;  4JI8 J;  1S57 A;  1F5C A;  4ECU A;  3G6E S;  1QE1 A;  1X4D A;  2D74 B;  3LAN A;  4PKD B;  2EFQ A;  1APS A;  2HSE B;  2HLU A;  2RB7 A;  2VAS A;  3T5K A;  3CJ2 A;  4IG3 B;  2MLY A;  1GMW A;  2FC9 A;  4TU9 A;  1VI7 A;  5F8N A;  3C19 A;  2HRT A;  1RAA B;  1RHJ B;  2DRA A;  2PMZ D;  5JXS A;  3EPG A;  1D9A A;  4IOB A;  1Q8B A;  1JXL A;  1CUL B;  2BE7 D;  2UUC F;  4DWI A;  4A8O A;  2AYM A;  2FQQ B;  1RT2 B;  1DQ9 A;  3BJY A;  4LFC J;  2DY9 A;  2HW3 A;  4JV2 A;  8ATC B;  2DHA A;  4NYO A;  4NMX A;  2KKH A;  1Q95 G;  4HTI A;  2CJ9 A;  2XLK A;  1AYE A;  3M2R B;  4NXN J;  4FYW B;  3OFG A;  1BWV A;  4EBD A;  5CCL A;  2BQ3 A;  1T3N A;  3FSX A;  2XCA A;  2JFD A;  4CP5 A;  2JC1 A;  1Q1K A;  5MAO A;  2DRD A;  4RU2 A;  5A2Q Y;  1FJC A;  4P7V A;  2JSX A;  2ZH4 A;  1S4E A;  4ICL A;  1OY6 A;  3PRD A;  2XSF A;  3PR5 B;  2G4B A;  2OI2 A;  1YIT S;  3OPK A;  2M9K A;  4F26 A;  2R8J A;  3R5J B;  1XQI A;  3A3O B;  4DV7 J;  1HWJ A;  4U6P A;  2HIY A;  2HRU A;  3VGS A;  2Z56 B;  2W2O P;  1NK4 A;  3QGP A;  1SC6 A;  4EI2 A;  4DV7 F;  4O4R A;  4ED1 A;  4V19 J;  2OPR A;  4P52 A;  4WK3 A;  3IA0 A;  4AE5 A;  1UW9 A;  2ZH7 A;  2ZFH A;  2YX4 A;  3EZU A;  3W7B A;  4IKA A;  1NH8 A;  4D3H A;  3H7H B;  2PEB A;  2KN4 A;  2LXF A;  1A7G E;  2CQB A;  3NP5 A;  1IKW A;  1U6B A;  3V6K A;  3P96 A;  4QWA A;  1Y9O A;  2Y1I A;  2R42 A;  4DPO A;  1RAB B;  3ETO A;  3SQG A;  5KFV A;  1S6O A;  4DR3 F;  2ASJ A;  4OX6 A;  4YDX A;  1QJH A;  2MTL A;  2R7Q A;  5J1P A;  5KFA A;  1ZZF A;  4K0K F;  4YR0 A;  2PO4 A;  1AW0 A;  4X4O A;  2FD2 A;  2Z0G A;  1YVF A;  2DR5 A;  3C6T B;  4DV5 J;  4MKB A;  4IH5 A;  2V8D A;  1NRK A;  2ZZN A;  4OYM A;  3H42 A;  3Q22 A;  1TMJ A;  3W5Y A;  1RE1 B;  2POK A;  2LQJ A;  4CNZ A;  2HQG A;  2H9Z A;  4K4Z A;  4DV5 F;  3M9N B;  1VS3 A;  1UL3 A;  1AUS L;  3M2U A;  3MM8 A;  1K0T A;  2DGW A;  1RCX B;  4CI0 B;  4EZ9 A;  5F8G A;  3BO4 A;  3BGF A;  4M1K A;  1U7L A;  3HMJ G;  2AGO A;  4QYZ J;  1RWN B;  2AEJ A;  4LF2 A;  1IKY B;  2QV6 A;  3MEE B;  4Z2X A;  4ED6 A;  3BGR B;  1NLK L;  1UFK A;  2H65 B;  2CQ1 A;  1XEZ A;  4DPT A;  3CSK A;  1ICE B;  3NY0 A;  3QO9 A;  2PGC A;  3W66 A;  4L72 B;  1BQN A;  4WFZ A;  3ZZY A;  2MQL A;  3O44 A;  4NLY A;  3K57 A;  5IWA J;  3QIP A;  3PY8 A;  4AQY J;  5D77 A;  2IPO B;  2ALZ A;  3GYX B;  3E01 B;  4NLD A;  4TNO A;  3R97 A;  3HCX A;  2BDP A;  2MST A;  1XNR F;  2JDJ A;  3F73 A;  3UVJ A;  5E3R A;  4LRC A;  4W92 B;  2OFG X;  5IV3 A;  2GCF A;  5L9X A;  1RI7 A;  2V6A A;  1QD1 A;  2GA7 A;  3PXG a;  4QIW D;  1OYE A;  5DGA A;  1LWE A;  3CJK B;  5LT5 A;  4M5N A;  2DIT A;  2MZJ A;  4RJV A;  2BAN B;  1Q86 T;  4KPY A;  4K4Y A;  1XWL A;  2C2M B;  3IMQ J;  1GT8 A;  1Y0H A;  4C0O C;  3HKW A;  2C2R A;  2BYC A;  4RW7 B;  2DEJ A;  2DXE A;  2HVE A;  1EET A;  2CG4 A;  4WWS A;  4DLG A;  4A8M P;  3LP2 A;  1KVI A;  4ZP8 A;  1RWO B;  2EXU A;  2XHW A;  3EUN A;  4F3O A;  2ZH8 A;  2R7O A;  4QYR A;  2OSR A;  2QYG A;  3W9I A;  4CO5 A;  2C2K B;  4P71 A;  2XWY A;  2C3U A;  2W2N P;  2J9C A;  4RO0 A;  1FJE B;  2QLB B;  3OFE A;  4DMZ A;  4FYD A;  1ZH5 A;  2RT3 A;  3IBC B;  1R89 A;  2ZH6 A;  3DN9 A;  3HHL C;  3BGO P;  5HMX A;  4LF5 F;  2O1P A;  2FGO A;  3GV8 B;  2XGP A;  4KR0 B;  3J80 Y;  3Q8P B;  1S1W A;  4ECR A;  3K5P A;  4ECS A;  4DX8 H;  3QFH A;  1RT5 B;  4HLB A;  1VFJ A;  2COL A;  3BS9 A;  2ZWP A;  4B3R F;  3OXL A;  2HQD A;  4KGK A;  1ZPV A;  4DV4 J;  4IO1 A;  2X7I A;  4QW8 A;  3DHX A;  3ENW A;  4CT8 A;  2ZHB A;  2WVF A;  2RU3 A;  2V2Q A;  3R7B B;  4DV4 F;  4I56 A;  2NPF A;  3HFZ B;  5D0H A;  3CCV S;  1GFW B;  3N5B A;  2CQ2 A;  1TL3 B;  5KAK A;  3VQT A;  2VQE J;  1GAO A;  3JQM A;  5M2U A;  3DU5 A;  4IG0 B;  2V8H A;  1T05 A;  2HS3 A;  2Q79 A;  2L3M A;  2HAI A;  3OFF A;  2LQ8 A;  3AA8 A;  3FEX B;  2VQE F;  4AXJ A;  2FJV A;  2B4U A;  2WB4 A;  2CQG A;  4LF8 J;  4JYA F;  1N6Q B;  3TUJ C;  4ZS6 A;  3F0N A;  3HHL B;  3V4M A;  1JLQ B;  3KJF B;  2DH7 A;  3IR5 B;  3PW5 A;  1DLO A;  3JSM B;  1VQ7 S;  3R3T A;  1EIY B;  3FGV A;  3V6D A;  4LSN B;  2BR0 A;  4CTA A;  1VR6 A;  2EWH A;  2AV5 A;  3UW1 A;  3BM7 A;  3UD4 P;  1QAI A;  2AJF E;  2YNH A;  4NOH A;  3TQE A;  1UVJ A;  2Z57 B;  2F7V A;  2WVC A;  1KLM A;  1HLW A;  2L48 A;  3M2V B;  3J7A N;  4PG7 A;  4O3O A;  3LPY A;  2AJ0 A;  1FK9 B;  3I4H X;  2GX8 A;  4RKU C;  4UUX A;  4I69 A;  3WQP A;  3FBB A;  2QL7 B;  3DLL Q;  1VQ9 S;  4ED8 A;  2RRN A;  1RT1 A;  1UEU A;  2YPY A;  1TQL A;  1S1T B;  2B3T B;  3SQO P;  1WC6 A;  4ANE A;  3TZZ A;  1H2U X;  5K8P A;  2ZVS A;  2ZZT A;  3GG0 A;  4OJ3 A;  2RNE A;  1TL4 A;  3J7A 1;  4WXO A;  3VGV A;  2SXL A;  3VZH A;  3FK4 A;  3HVA A;  4PYA A;  4DL3 A;  3NBP A;  5IT4 A;  2HND B;  1RIS A;  4TLR A;  2V4J B;  4GO5 X;  2YWW A;  1Y3J A;  2IHR 1;  1RSC A;  5CXT A;  2R9L A;  1SV5 A;  3LWL A;  5LMN F;  3DLK B;  2E5L F;  2MSS A;  5F8H A;  4DFP A;  2QFJ A;  1V3R A;  3MAH A;  3O1L A;  5ETK A;  3PKY A;  2GVZ A;  3D66 A;  1KTQ A;  2DCL A;  2ZH5 A;  2KH9 A;  4FS1 A;  4C98 A;  1UWB A;  4OYP A;  1VK8 A;  2D3Z A;  1Y5I B;  5KFZ A;  4B08 A;  2CPF A;  2DH9 A;  3M1V A;  4S0M A;  3T9N A;  4HAC B;  2KXF A;  4ES1 A;  1HA1 A;  3H59 A;  1VC5 A;  3GR0 A;  4DL5 A;  2DPI A;  1QDU B;  4X4P A;  1TMM A;  3SI8 A;  2VFS A;  1WOS A;  5KFF A;  1AXQ A;  5ETQ A;  2GMH A;  1IR2 A;  2W7P A;  1HNI B;  4B9U A;  1PAU B;  3UR0 A;  4RW4 A;  3OFH A;  4DUY F;  3IXQ A;  3MAA A;  4LRE A;  3QT5 A;  4KGZ B;  3OW2 R;  4C0B A;  2FHJ D;  2G0J A;  2ASL A;  3VAJ A;  1I3O B;  5K8O A;  3T19 A;  3T1Y F;  3ICL A;  1B7F A;  3A3P B;  5LMU F;  1FD2 A;  3J7Y I;  4KHM A;  4R8U B;  4YS2 A;  4A8S A;  3UQS A;  1TZ0 A;  4LIR A;  4XPE A;  3AA9 A;  1O5J A;  5I42 A;  4DSJ A;  1RAC B;  1ZAW A;  3KDN A;  2MKI A;  2CYY A;  3M8Q A;  4O4G A;  2HHX A;  4A46 A;  2DHG A;  3LO3 A;  1LWC A;  2MZS A;  4DL0 C;  5T7L A;  1WI6 A;  1DTT A;  5KFO A;  2CPE A;  3SDE A;  2KT2 A;  4C11 B;  4EGL A;  3D1O A;  1QSY A;  1C0U B;  2LXU A;  3D54 A;  3MCO A;  5K14 B;  2ZEJ A;  4DZD A;  5JMN A;  1RKI A;  4H54 A;  4LBI A;  4CM0 A;  1YLX A;  4IG3 A;  1ZM9 A;  4V19 X;  3CCQ S;  3NS6 A;  3T9Z A;  2FVC A;  2OD6 A;  2MZR A;  1VQ6 S;  3R8Y A;  1W7W A;  1KOO A;  2CPZ A;  5DZ7 A;  3LGM A;  3GLJ A;  1BQM B;  1JKH B;  2GQ2 A;  2O67 A;  3VTI A;  1CUL A;  4USH A;  1RT2 A;  3R5C A;  2FZG B;  1C1C B;  1KHV A;  4JI5 J;  3VAI A;  2ZBI A;  3CE8 A;  2XB2 D;  2NR0 A;  2ZBQ A;  1UZH A;  3M2R A;  1CQM A;  3W8P A;  3M8W A;  3WIV A;  3W1Y C;  2QL9 B;  1LV5 A;  1EKR A;  1X4F A;  2MKK A;  4X4R A;  4QIF A;  4ZN1 A;  3RZA A;  3FBE A;  3ILL A;  1CVJ A;  3PM9 A;  4JI1 J;  3CUN A;  1KTV A;  3RB3 A;  3RRG A;  1S1X B;  2CVI A;  5AXL A;  1O8B A;  4IQX A;  4K4W A;  4JI1 F;  2XMK A;  1K1Q A;  3LOU A;  4AFF A;  1IKX B;  1WEY A;  4UZC A;  1RK8 A;  4DSK A;  1PJ6 A;  3P4U B;  4M5G A;  1EKS A;  3HHL D;  4ZLJ A;  4QWC A;  1JXV A;  3S6E A;  2VKZ G;  1N34 F;  2BJD A;  3TUP A;  2Z8Q A;  5J2N B;  1XIQ A;  4NZ0 A;  3ILO A;  1S9G B;  2F4F A;  3TQ1 A;  2XQC A;  1IWG A;  2D3O 1;  1KC8 T;  1NKB A;  1PG5 B;  2CJQ A;  2E1M C;  3TZY A;  5E41 A;  5HRO B;  1JNR B;  1SC4 B;  2HMI B;  4ZVH A;  3U7J A;  4DR6 F;  3QZ8 A;  2BJ8 A;  5GAH U;  2V4R A;  1YIJ S;  2JL9 A;  3PO4 A;  4G1I A;  5DDR C;  5EGY A;  2LDI A;  2VUG A;  1PYO B;  3CCM S;  2XY7 A;  1NJY A;  1MML A;  4FNI A;  2PA8 D;  4I6Y A;  2Z2L A;  3Q24 A;  4GMK A;  4NLT A;  3ZTP A;  2E9R X;  3W8G A;  3KUH A;  1ZPW X;  1WUU A;  1C4C A;  3HSD A;  4U7U D;  3K17 A;  3F56 A;  4WP3 A;  3PJW A;  2ZH2 A;  1BY9 A;  2H5E A;  4B9V A;  3NNH A;  1FVS A;  2R3V A;  2E66 A;  2WVD A;  3CD7 A;  3HFV A;  2E9T A;  2NSB A;  2IM2 A;  4CLS A;  3AHP A;  4PPD A;  4U7C A;  2JH3 A;  5FLX Y;  3HX9 A;  3P49 B;  1JLF B;  3FMB A;  1ZBT A;  4U8Y A;  4EYH B;  4UT4 A;  4B9L A;  4HT7 A;  5E3C A;  1EZZ B;  1IKY A;  3VF0 B;  1VBY A;  4NYZ A;  3MEE A;  1DQ8 A;  2QTW A;  2W4D A;  2YWH A;  2AJ2 A;  1VMB A;  4EUV A;  3BGR A;  1VQL S;  3LP0 B;  1MWY A;  3LP1 A;  2GGP B;  2A1B A;  1SXL A;  1YK9 A;  2RDJ A;  5KG7 A;  3FSI A;  3CC2 S;  2ZJP Q;  4P73 A;  5KFP A;  4DSL A;  2P9E A;  2MHN A;  3QPI A;  4X65 J;  3BH7 B;  4JI3 F;  1T9U A;  3E01 A;  3EVM A;  2QO3 A;  2EPI A;  2BJ7 A;  2WRM A;  4M5M A;  3QGH A;  3PJ9 A;  2Y1L B;  4X65 F;  2UVU A;  5HVG A;  1KKH A;  2KM8 B;  2RIL A;  4NAS A;  1ZOT A;  5KFY A;  1SJ1 A;  3HT3 A;  2N4C A;  4AL6 A;  1H98 A;  2YX1 A;  1N32 J;  1T0T V;  2OUG A;  3CJK A;  2HFO A;  2NZ4 A;  4C9D A;  2BAN A;  2FLO A;  2OMO A;  3O3L A;  4Z7Y A;  5K5M A;  2D9O A;  1KWM A;  2XZT B;  2QMW A;  2HIQ A;  5I3U B;  1LWF B;  3L4B C;  4F0M A;  4DS5 A;  1BUX A;  1U1N A;  1YJ7 A;  1L5U A;  5C5J A;  3SMZ A;  2KG1 A;  3M6X A;  4ZCM A;  4B3O B;  4K50 A;  4X62 F;  1VQ5 S;  3BR9 A;  3GIL A;  1UVK A;  4CH1 A;  5KFM A;  1JQG A;  5CAA A;  3PDN A;  3D67 A;  5C2C A;  3QBC A;  1R31 A;  3KMS A;  5JVH Q;  2BOP A;  4E2F B;  1VQ4 S;  3TEH B;  1WC1 A;  2HHU A;  4OHZ A;  3MM5 A;  3V4I B;  3WHI A;  1YJ9 S;  1GH8 A;  3DOK B;  2K8G A;  3PFE A;  1K0V A;  3W61 A;  3UD5 A;  4U8V A;  1FD8 A;  3JB9 k;  5DDP C;  2WSC C;  3P45 B;  3CMQ A;  1YBU A;  4N41 A;  3RAX A;  4BWJ A;  4NCA A;  4Z7C A;  3V6J A;  2Q1L A;  3QJJ A;  4K4U A;  3Q2T C;  2ZZM A;  1Q8I A;  1VC6 A;  3DC2 A;  2DGU A;  3A12 A;  1NME B;  5T41 A;  5M2R A;  2QG9 B;  1RT5 A;  1TR0 A;  3V2U C;  4M5I A;  1JJH A;  1TU0 B;  1PBU A;  3QYY A;  1P9Y A;  3RBD A;  3TAN A;  3QQC D;  3B78 A;  4TLQ A;  4F04 B;  1Y7P A;  1QUV A;  4QU6 A;  2UUB J;  3RAQ A;  3R5B A;  2ZVI A;  5KG4 A;  1OYD A;  2DIU A;  2M0G B;  2ABY A;  1VBZ A;  5HQL A;  2NXJ A;  2UUB F;  4OZL A;  1LK5 A;  2UUA F;  5IT9 Y;  1NCL A;  4IG0 A;  1O51 A;  1XR6 A;  2RDD A;  3Q8S B;  3QRQ A;  2OFH X;  2RS2 A;  1NSA A;  3QRP A;  2ADB A;  2PD1 A;  4ZPD A;  3BDP A;  2K7K A;  2P9C A;  3HVT A;  3MPD A;  4ED2 A;  3CIM A;  1N6Q A;  3QRR A;  1K9M T;  1JLQ A;  1VOM A;  4LRF A;  4WKR A;  1AZS A;  2CDR B;  4Q5V A;  3JSM A;  3CCT A;  1RAJ A;  4KGV B;  4URG A;  1HNX J;  1DQA A;  2XNR A;  4MFB B;  4ZVO B;  3H4B A;  3I87 A;  2VG6 B;  2IBK A;  4LSN A;  2QLW A;  4Q8F A;  3RB4 A;  3FBC A;  2CAJ A;  3SV3 A;  4V1A k;  4ID8 A;  4OQJ A;  3M2V A;  4CH7 A;  1HBU B;  1UTA A;  1FK9 A;  3WZ0 A;  4KO0 B;  1YJV A;  2FJE B;  4HL9 A;  2B9E A;  4J9K A;  4C8K A;  4PXC A;  4AND A;  4FKX A;  2RVJ A;  3M30 B;  3TEG A;  3HO1 A;  2G1H A;  1FA0 A;  1S1T A;  5IQQ A;  3BGL A;  3EX7 B;  1LW0 B;  4YHH J;  2EVZ A;  1WC3 A;  4YY3 F;  2IIH A;  3HZE A;  3DCA A;  4B17 A;  3BR8 A;  2IRY A;  3VVU A;  2MLZ A;  4DX5 A;  3BBF A;  2YNI A;  2XSJ B;  4J9M A;  2OSQ A;  3CCE S;  1VQO S;  2YNF B;  1U1M A;  2VHG A;  2HND A;  2P5V A;  3RR7 A;  2V4J A;  2A10 A;  2JWN A;  2MKS A;  2XYG B;  1UVN A;  3L95 X;  4Y28 C;  6FDR A;  2BJE A;  2C3M A;  2QSW A;  5KFX A;  4G65 A;  3DLK A;  1D3W A;  1MW7 A;  3PW4 A;  2CZV C;  4JV0 A;  1ZM4 A;  1DZ5 A;  5LOQ A;  4OZ1 A;  2C3Y A;  3SZ2 A;  1FWK A;  2VPX B;  5BR8 J;  4DV2 F;  3RAM A;  2ACM A;  2DR6 A;  2VD3 A;  2FY1 A;  4NL5 A;  1OMS A;  4N5S A;  4H4K A;  2ZC3 A;  3W65 A;  3SCK E;  4YQW A;  1Z1Z A;  1HNI A;  1B64 A;  3PIP Q;  5A6W A;  2IRU A;  2A0F B;  4C0H A;  3EIC A;  2F4V J;  3BPS P;  2ZWO A;  3EWG A;  1WHW A;  1C4A A;  2OML A;  1NK8 A;  5A2Q U;  3CGI A;  1HBM A;  5LM7 E;  2UXB J;  1MU2 B;  3D6T B;  1KSP A;  4ERD A;  2MZT A;  2F4V F;  2VU5 A;  3K0J A;  4R8U A;  3BSC A;  2AEM A;  3E3X A;  2YBV A;  1XBW A;  3FSY A;  3H2V E;  1Q79 A;  4KHP J;  4KV8 B;  3V5R A;  1N5S A;  3C8Y A;  4OJG A;  3QGG A;  1RHU B;  2ZDP A;  3CCL S;  5DLG A;  3NOC A;  4PCQ A;  2FLP A;  4C11 A;  1U6Z A;  3M6V A;  4C8O A;  2YNG B;  3NS7 B;  4XDD A;  4OLO A;  3QMQ A;  4ALZ A;  3B4M A;  1X8D A;  4MIA A;  3MOJ B;  2DGX A;  4DEZ A;  2ZBP A;  5GAE U;  1E6V B;  1KON A;  2V9W A;  1YTY A;  3LGN A;  3HHD A;  4FF2 A;  4ED0 A;  1HNV B;  4DPW A;  2B51 A;  2JOQ A;  2M70 A;  4OV1 A;  5KOX A;  2D9P A;  2F8H A;  3M6U A;  1BQM A;  1JKH A;  1F5B A;  2XMM A;  1CC8 A;  3J7Z 5;  5KG1 A;  1T11 A;  3O2I A;  1C1C A;  3TVZ A;  3K5O A;  1YRX A;  4W98 A;  4TU7 A;  4DL2 A;  1YWX A;  4MYU A;  2GNK A;  3M8P B;  2AGQ A;  4UZB A;  5HJX A;  2VPW B;  2W2M P;  1RT7 A;  4OZ0 A;  5KFE A;  4P9S A;  3MUV P;  4ZVT B;  4B9T A;  3LAM A;  1VIS A;  1NHU A;  1M5H A;  3A8E A;  1UWA A;  1WNE A;  3QAU A;  1IUJ A;  3C14 B;  3NS5 A;  4OZN A;  5SZT A;  2XHC A;  3MD3 A;  3P5T L;  3GFH A;  5B0B A;  5A8K B;  1IKX A;  2L08 A;  4CLZ A;  1NHK L;  3OTO F;  3THV A;  1KDN A;  1OQ6 A;  5M2P A;  4NLO A;  4OI4 A;  1U2C A;  2R8H A;  5HMW A;  4A8K A;  5C42 B;  1ZTW A;  2M8H A;  2CDQ A;  3R2D J;  5F9L A;  1TFW A;  5J2N A;  1SBR A;  4CIO A;  4CO0 A;  2G0I A;  1LNQ A;  1GXL A;  4ELT A;  1S9G A;  2CQ4 A;  1RYS A;  2FVR A;  1ITP A;  3KFW X;  1VLY A;  4K5S A;  3JSR A;  2VJU A;  5HRO A;  4UQG A;  2HMI A;  3MM9 B;  2F65 A;  4EMD A;  3HVW A;  3IR6 B;  4C6A A;  1X9W A;  4C8Z A;  5L1L A;  2KI2 A;  2LXI A;  1NB2 A;  3HP6 A;  5BYS A;  2L41 A;  1SC3 B;  5D15 A;  2XCP A;  3TYT A;  4DFJ A;  4MYT A;  1NSP A;  1A6L A;  4I6A A;  2WBM A;  2YKP A;  1R8A A;  2MGZ B;  2PMH A;  2EFO A;  4PPZ A;  3S1T A;  2MY7 A;  2R7X A;  1RYR A;  1RWU A;  4XK8 C;  4XPC A;  3OVA A;  2Z58 B;  1DTQ B;  5D4L A;  1XMQ J;  5SUH A;  1X4H A;  1VK3 A;  5DGB A;  1FI4 A;  3R7N B;  2CKW A;  1S1U A;  2LP4 A;  4NXM F;  1PJ7 A;  4K59 A;  1JLF A;  1J5E F;  4DR7 J;  1BC6 A;  4C97 A;  2HKE A;  4WK1 A;  2HFN A;  2O3D A;  2JHE A;  2J0X A;  4ZLP A;  2HK3 A;  3KNA A;  1FNM A;  4X4Q A;  3L3C A;  3FZB A;  1QM9 A;  3AD8 C;  3OR2 B;  4J37 A;  4NCG B;  1IQT A;  3LP0 A;  5KFD A;  2VOP A;  4O44 B;  3IP0 A;  1WC5 A;  1YZ7 A;  4RLE A;  2GGP A;  3I4P A;  3L7O A;  2CPY A;  3O6Q A;  1H74 A;  1HW8 A;  1SJQ A;  5DDQ C;  3G2X A;  3PJX A;  2BVZ A;  3IGN A;  4ECV A;  4EO6 A;  3TW0 A;  1NU4 A;  1TL7 B;  3H5S A;  3Q86 A;  1WHV A;  5H9F K;  3PNI A;  3MED A;  3NAI A;  2A3J A;  2G1D A;  1PO6 A;  2RAQ A;  3DMJ B;  5FII A;  3UI3 A;  4DL7 A;  2GW8 A;  2H51 B;  3K2Y A;  2HG4 A;  3CO0 P;  4WYW A;  4Q2M A;  2HS0 A;  5IC4 B;  3KHG A;  4IYQ A;  4DR4 F;  4DR2 F;  1P9Q C;  4ZP6 A;  3K5L A;  1KQK A;  2Z30 B;  1VQP S;  3NL0 A;  1QAJ A;  4DU7 A;  2CQ3 A;  1IJE B;  5I3U A;  1LWF A;  4IOA Q;  5KFS A;  1C0T B;  4B3O A;  2XZD B;  5B7W A;  4PG6 A;  2CWK A;  2LDY A;  4GKJ F;  3CDW A;  3MR6 A;  4DL6 A;  4UW2 A;  2HHW A;  3V81 B;  3ZNU A;  4ECY A;  3ZZ0 A;  1MN9 A;  2HFZ A;  5JJB A;  4DV6 J;  2AJ4 A;  3V4I A;  2NZC A;  1OWX A;  2LYV A;  3K5N A;  1SUQ B;  2CVE A;  4L76 A;  3GSI A;  1TK0 A;  2B6A B;  4DR1 F;  1NUE A;  3E8O A;  2KJW A;  3ISZ A;  1FXL A;  1PIL A;  4FVC A;  2KRR A;  4J9Q A;  3KJQ B;  4RZR A;  4H4M B;  5IS2 A;  1RHQ B;  2X1B A;  1CG2 A;  2UVR A;  4B3S F;  1H2V Z;  3MFI A;  1NO8 A;  4NLS A;  1FXD A;  4IQM A;  1LKZ A;  1W26 A;  3HJV A;  3GIR A;  5F8L A;  2JLG A;  3U1N A;  2J0W A;  2PA3 A;  2EC0 A;  1ZET A;  2E5J A;  3NNC A;  3D28 A;  5FD1 A;  2VG7 B;  3FJ2 A;  3HD1 A;  4KSE B;  3NCQ A;  2AF6 A;  4A8Q A;  1F3V A;  2DB1 A;  1UFW A;  3EVO A;  2XMW A;  4P74 A;  1YJT A;  1EP4 B;  3R5A A;  1N5V A;  1CJU B;  5CYQ B;  4DF4 A;  5D0R A;  3AD7 C;  2U1A A;  3GJQ B;  4GC6 A;  4ECZ A;  5F9N A;  3OUY B;  1VRT B;  5KG6 A;  3NGD A;  2I8E A;  1S9F A;  2XLI A;  4MK7 A;  3ADA C;  4RNN A;  1VDH A;  5LSR A;  4CH0 S;  4ZVR B;  4CYU B;  3LH2 S;  4OX9 J;  4DQR A;  2VF3 A;  4WII A;  4USV A;  1FRJ A;  3EGW B;  3ZZO A;  4F0H A;  4LFB F;  2HVH A;  3MUM P;  4MFB A;  2G2Z A;  2I38 A;  2VG6 A;  5AXK A;  2CG8 A;  1TFY A;  4OZ3 A;  2W8L A;  4LF9 J;  1HBU A;  3BO2 A;  3EMT A;  4KO0 A;  4ZN3 A;  1OIA A;  1P1T A;  2BXJ A;  3TRG A;  5JVG Q;  2EEY A;  3QO9 B;  3CWJ A;  2HHV A;  3M30 A;  2RD5 C;  3ZC4 A;  2KT3 A;  5C7P A;  4UUW A;  1LW0 A;  2EG1 A;  3BPD A;  3DU6 A;  4JI6 F;  3QIP B;  5HSP A;  3EDR B;  4TKT A;  2OPP B;  4PG5 A;  4ANC A;  4GKK F;  3QFW A;  2XSJ A;  1FJG F;  3VAH A;  2YNF A;  2IVF B;  4DXL A;  1HPZ B;  2PMW A;  4I7F B;  4LR7 A;  2M5Y A;  3KG4 A;  4CNY A;  2MQ8 A;  2IVY A;  9RUB A;  3W5X A;  4ED4 A;  2ZH1 A;  4J9L A;  1FDB A;  4PR6 A;  1K44 A;  1EQ0 A;  3MOZ A;  4EWT A;  2MDA A;  3K89 A;  1KS2 A;  2C3P A;  2CQ0 A;  3JQK A;  1IBL J;  1WTF A;  1S7I A;  1HFE L;  3JYT B;  3KG1 A;  2V69 A;  4LF7 J;  4QIG A;  1LOU A;  1EET B;  5B0F A;  3LP2 B;  3AJ1 A;  1D8Z A;  4KGM A;  4QWE A;  1S10 A;  1HYS B;  2BM1 A;  1RWK B;  1IBM F;  3I96 A;  1GMW D;  4KT0 C;  1I94 J;  3G8S A;  2DNP A;  4DV0 F;  5KG2 A;  1TUW A;  3BYP A;  2HGN A;  2OD4 A;  1IR1 A;  1SKS A;  2ZOF A;  2XO6 A;  2Z4P A;  2MY8 A;  3OL9 A;  3SYZ A;  4WPA A;  2OHD A;  2ACY A;  2PSZ A;  1RHK B;  3TWZ A;  4QCL A;  4U67 Q;  2ZM6 J;  1MU2 A;  3N01 A;  5BXI A;  4DQP A;  4UF4 A;  1IBK J;  4F02 A;  3TI0 A;  4KH1 B;  3GZ7 A;  5DQI A;  3AT1 B;  2XWX A;  3FMW A;  3Q8U A;  1RHM B;  3HKZ D;  1MRO B;  4AUK A;  4NCB A;  1M5P C;  2FHK A;  1CC7 A;  2GAH C;  4KV8 A;  3IBW A;  4F4W A;  3DLB A;  4CLY A;  3LF0 A;  1HWI A;  3BV8 A;  2QX0 A;  2GV1 A;  1ZYQ A;  5G0R B;  1GEH A;  1X9M A;  1MMD A;  2YNG A;  2B56 A;  2YY3 A;  1FRH A;  2R2R A;  2NSC A;  5KFC A;  1HQE B;  4BLG A;  4OHY A;  1MSW D;  1E6V A;  2QYC A;  7FDR A;  1Y5N B;  3M4X A;  2W2P P;  4WFX A;  2IJR A;  4ZCI A;  1YGY A;  4L3K A;  3OBI A;  2PFF B;  3L9Z A;  2QC3 A;  1PJ5 A;  3B8H A;  4MIW A;  3MTJ A;  1KNZ A;  3JTO A;  3CTR A;  4LSZ B;  4DJB A;  1HNV A;  1SJF A;  3TJA A;  1KQF B;  4M5H A;  2XMA A;  1DLO B;  3GPA A;  1Q7L B;  2P9G A;  3M7V A;  4RWW A;  3TX8 A;  5DRK A;  1S5Z A;  5HL7 Q;  5AJ3 F;  2CQH A;  3BKT A;  1FDN A;  3OJS A;  4WTY A;  2B9Y A;  3MTK A;  2AX0 A;  4WFA Q;  1V3S A;  4KPC A;  4JV1 A;  4O23 A;  1FRK A;  1S0M A;  2ZH3 A;  1VBX A;  2C1E B;  2H54 B;  2DIS A;  3CPW R;  4FYX B;  5H9E K;  4X84 A;  3EVW A;  2BJ9 A;  3T1H J;  2VJV A;  2LQB A;  2W9B B;  3AD9 C;  3T5J A;  4PG4 A;  4P2X A;  2XGQ A;  1VLO A;  2VOD A;  2DR7 A;  2KDO A;  3C14 A;  3T1H F;  3TVK A;  4WTO B;  2JC0 A;  2V9K A;  5A8K A;  1PYT A;  1WWH A;  4CLT A;  2GIQ A;  2C28 A;  3PO5 A;  1JNZ B;  4XAK A;  2B9X A;  1HBN B;  1X4C A;  2EKY A;  3MWB A;  1HHQ A;  2IDE A;  3C6U B;  3VHQ A;  1HI1 A;  1JB0 C;  2H3E B;  5ETT A;  1U1R A;  3HF5 A;  1YSJ A;  1QSS A;  5C42 A;  1K47 A;  3ZNJ 1;  3K7R A;  5T14 A;  4PXE A;  2V50 A;  3EGZ A;  3VQS A;  4HHJ A;  1TK8 A;  2BE2 B;  4ER8 A;  1R27 B;  3VWS A;  4N77 A;  1WD6 A;  1R0C B;  1WI8 A;  3MM9 A;  3BYR A;  1S59 A;  5DM7 Q;  4D3G A;  4FYY B;  4IFV A;  1UWB B;  1KQG B;  1URR A;  4P75 A;  4IOC Q;  2AD9 A;  5HJY A;  2W4P A;  1KP6 A;  2B7C B;  4DUZ J;  3WX4 A;  4F0K A;  3H8Y A;  1MMN A;  1BXN A;  2DNM A;  1RDR A;  3CCJ S;  4ZVF A;  2B43 A;  3RYL A;  3KLE B;  3N6M A;  4FYV B;  2WB1 D;  2MGZ A;  3T3F A;  2QA1 A;  2YTC A;  3GU0 A;  3D1H A;  1SQF A;  4DCJ B;  3CME S;  2Z2Y B;  4ZMM A;  2LU2 A;  3LPE A;  4AL7 A;  2E1P A;  5L1K A;  1DTQ A;  3N6N A;  1HL6 A;  3MUT P;  3POT B;  1FFS B;  4DX6 A;  1DJ0 A;  1RTH A;  1FER A;  4NE9 C;  2ZHO A;  1SIZ A;  1U49 A;  3UD3 P;  2DGQ A;  2GHV C;  4I68 A;  1UZD A;  3IWN C;  2WW8 A;  1GQE A;  4ZVU B;  4NLV A;  1YJW S;  4XIU A;  5IT0 A;  4HH1 A;  5HAT A;  3VCD A;  2W01 A;  3OR2 A;  4NCG A;  1I51 B;  2CQP A;  5KFH A;  2QA2 A;  4X4V A;  1UFL A;  4O44 A;  4C4W A;  4CLF A;  4URQ U;  4YB5 A;  1NK6 A;  1H73 A;  2WOM A;  1RA6 A;  1TKX B;  2CZ4 A;  4I4B A;  4Y2C A;  2OEM A;  4X64 J;  1R8P A;  3CED A;  1TKT B;  4FNH A;  1N36 F;  4ILR A;  1T9T A;  1X5S A;  3MAQ A;  1FEH A;  2KL8 A;  2R7S A;  3EM1 A;  4JI8 F;  5CD4 A;  3CF5 Q;  1TL7 A;  2GVD A;  2YXL A;  4X64 F;  3C15 B;  1SCJ B;  1R6V A;  3KUG A;  1YQH A;  3KTQ A;  1NZ8 A;  4RPF A;  3WDO A;  3DMJ A;  3H2L A;  1WG1 A;  4X66 J;  4ECT A;  3BKU A;  2V0N A;  3BRE A;  1EQM A;  5A6P A;  1F0X A;  1NKE A;  2I1R A;  4Y34 A;  3MR3 A;  1I6J A;  3THP A;  5IT9 U;  1RP5 A;  1EJ7 L;  1Y10 A;  3CO9 A;  4DPY A;  1BD6 A;  3C2P A;  5KT4 A;  3VR1 A;  2WBR A;  2YQ3 A;  3KK3 A;  4LFC F;  2YQ0 A;  1U8S A;  1C0T A;  3N9U C;  1WG5 A;  3MMB A;  3T6J A;  1NBE B;  3CVK A;  2QZ8 A;  4PYD A;  2HHT A;  4NXN F;  5L38 A;  1F9H A;  4LUB A;  3V81 A;  1R8H A;  4MKA A;  4IDK B;  2XC9 A;  3FCV A;  4NI2 A;  4F25 A;  1OY9 A;  3RBX A;  4LRD A;  3UR3 C;  4KTQ A;  2CJB A;  5B0A A;  3OHB A;  5C25 B;  5DO2 A;  1SUQ A;  1W2B R;  3I9V 9;  2B6A A;  2AIR B;  1H7W A;  3ONQ A;  1QAX A;  2H5J B;  2FYX A;  4ZVS B;  1JJ2 R;  4EK2 A;  2KFN A;  3KYL A;  3FC9 A;  3HM9 A;  2BUN A;  4OFZ A;  1AFJ A;  1U6F A;  2DNK A;  1PC4 A;  1WOO A;  3CDA A;  1J5O B;  5ETN A;  5J1N A;  3DHW C;  4MK8 A;  1O0P A;  3GFY A;  4H4M A;  4YOE A;  1JLE B;  4MJK A;  1CPZ A;  4G1P A;  3DFE A;  1SQG A;  3KJN B;  1T95 A;  1N88 A;  4RW8 B;  3KLI B;  3OTD A;  4KYZ A;  4AL5 A;  2KTQ A;  3FQK A;  1CEZ A;  1RTJ B;  5KFL A;  3W60 A;  2ROE A;  3FBF A;  1WKJ A;  1BHN A;  1Y00 A;  1C2P A;  4OIX A;  1X7V A;  1SJ3 P;  4N76 A;  2DBB A;  3T5L A;  2VG7 A;  1T9W A;  1SC1 B;  3CJ0 A;  3BBB A;  2LA4 A;  2O5D A;  1EP4 A;  5L1J A;  1CJU A;  5CYQ A;  3OUY A;  1S99 A;  1FHT A;  1VRT A;  3GIK A;  5GAG I;  1X5P A;  2DD8 S;  1VIO A;  2IYG A;  5F3T A;  1NM2 A;  3P8B B;  5HO4 A;  2JVR A;  4CYU A;  5LSL A;  1RQ0 A;  2GIF A; 
#chains in the Genus database with same CATH homology
 3WX8 A;  3PJ9 A;  1JXV A;  3GPA A;  3MPD A;  3B54 A;  1WKK A;  5BXI A;  4UOG A;  3GP9 A;  3VGS A;  2HUR A;  3Q89 A;  1S5Z A;  1W7W A;  1NDK A;  1K44 A;  4F4A A;  2ZUA A;  2VU5 A;  3Q8U A;  3VGT A;  1XIQ A;  3JS9 A;  3B6B A;  3PRV A;  1NDL A;  4KPC A;  4UOF A;  1LEO A;  3ENA A;  4DUT A;  1VYA A;  1ZS6 A;  4W98 A;  1S59 A;  4DI6 A;  3ETM A;  3FBF A;  1U8W A;  3FBC A;  1F3F A;  1MN7 A;  1WKJ A;  3DKD A;  1BHN A;  3ELH A;  2DY9 A;  3VGU A;  4C6A A;  3EMT A;  1NDC A;  1BUX A;  3EJM A;  3EVW A;  4HR2 A;  3ZTR A;  1NDP A;  4O0N A;  3NGT A;  4ENO A;  1NB2 A;  3NGR A;  1B4S A;  1F6T A;  1HLW A;  3NGS A;  3BBB A;  3NGU A;  2DXD A;  2CWK A;  4FKY A;  4UOH A;  2AZ1 A;  1LWX A;  2DXE A;  2HVE A;  4AND A;  4CP5 A;  4S0M A;  2B8P A;  3FCV A;  5IOL A;  3VVT A;  3FBE A;  4FKX A;  3EVO A;  3Q83 A;  1NLK L;  3FBB A;  3EE3 A;  5C7P A;  2AZ3 A;  1NPK A;  2DXF A;  1WKL A;  1EHW A;  1NSP A;  1MN9 A;  3BBC A;  5CAA A;  3EM1 A;  2NCK L;  3G2X A;  3DDI A;  1HIY A;  2DYA A;  5CAB A;  3ZTS A;  3L7U A;  1NCL A;  1S57 A;  3ZTP A;  2BEF A;  2HVD A;  4ANE A;  4ANC A;  1HHQ A;  4EK2 A;  1PAE X;  1B99 A;  1PKU A;  3VVU A;  3Q8V A;  2B8Q A;  1BE4 A;  1NUE A;  3FC9 A;  3BBF A;  3BH7 B;  1NHK L;  1XQI A;  3BH6 B;  3Q86 A;  1NSQ A;  3FKB A;  3Q8Y A;  3ZTQ A;  4F36 A;  1NSK L;  3EVM A;  3ZTO A;  2BX6 A;  1KDN A;  3FCW A;  4DZ6 A;  3EIC A;  4WBF A;  1UCN A;  3R9L A;  3VGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...