1NSPA

Mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
149
Chain Sequence
b'VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGSDSVESANREIALWFKPEELLTEVKPNPNLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Mechanism of phosphate transfer by nucleoside diphosphate kinase: X-ray structures of the phosphohistidine intermediate of the enzymes from Drosophila and Dictyostelium.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 43
structure length 149
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1995-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nspA00
1BUXA 2VU5A 3VGSA 3FKBA 1HHQA 3R9LA 3NGUA 3Q8UA 1LEOA 1HIYA 1NDKA 2BEFA 1WKLA 3ELHA 4DI6A 3VGTA 4ENOA 3PRVA 3ZTPA 4C6AA 1K44A 3BH7B 1S57A 3EVWA 3Q83A 3MPDA 2DXDA 3DKDA 5C7PA 1S5ZA 2DXEA 2DYAA 3EM1A 1PAEX 1NDLA 3FBFA 1NB2A 1KDNA 1ZS6A 4O0NA 1B99A 5CAAA 3WX8A 3ZTOA 4FKYA 4W98A 4UOGA 2AZ1A 3GP9A 2DXFA 2CWKA 3BBFA 1MN7A 1EHWA 2NCKL 1W7WA 3Q8YA 3FBEA 2HVDA 3VGUA 4ANCA 3FBCA 4CP5A 3G2XA 3JS9A 2B8QA 3BBBA 4WBFA 3ZTRA 1F3FA 1HLWA 2HVEA 3EVOA 3EMTA 3FCWA 2B8PA 1XIQA 3ENAA 3BBCA 4HR2A 4KPCA 1NUEA 2DY9A 3GPAA 4F4AA 5IOLA 1B4SA 1F6TA 1BE4A 1NSQA 3NGSA 1UCNA 1NSPA 4DZ6A 3FCVA 4UOFA 4F36A 1WKKA 3FBBA 1PKUA 5CABA 3Q8VA 3BH6B 3VGVA 2BX6A 1S59A 2ZUAA 3NGRA 5BXIA 4ANDA 1VYAA 3EICA 4DUTA 3VVTA 4S0MA 4EK2A 1NPKA 1NHKL 1NDPA 3EJMA 3EVMA 3PJ9A 3NGTA 2AZ3A 3DDIA 3ZTSA 1NDCA 3L7UA 1NCLA 4ANEA 3Q89A 3ETMA 3Q86A 3B54A 1NSKL 4UOHA 4FKXA 1U8WA 1LWXA 3ZTQA 3B6BA 1MN9A 2HURA 3EE3A 1NLKL 1JXVA 3VVUA 1WKJA 3FC9A 1XQIA 1BHNA
chains in the Genus database with same CATH superfamily
4BC9A 3AXKA 2F63A 2KYXA 5ETNA 3CC4S 2WVCA 4C6AA 1VRTB 3ULHA 2I8EA 4EBCA 1HBNA 2R7VA 4JI4F 3HSZA 1YJVA 2E44A 4JI2J 1B99A 2WSEC 1SKWA 2RB7A 3LUYA 1CJUA 1HPZA 4IG3A 1ICEB 5K5MA 5KFUA 2DT9A 1CJTB 5KG7A 1G7CB 2NYHA 3OVSA 1S0MA 1T7PA 1CS4B 4I1TA 3NMAA 2B7BB 3MPVA 3M2VA 4ZIVA 4M1KA 2AP6A 3KNGA 2DNOA 3KLIA 4QZVB 5DG9A 2HKEA 4WFZA 2V4RA 4C0BA 2Q6BA 2GA7A 3TR5A 5IWAJ 4F7VA 5HP1A 2Y8YA 2DNGA 1RP5A 5K8OA 3N28A 1ZZFA 2JDJA 2WRMA 2ADBA 4JI1J 4CLLA 2HHHF 1JXVA 2WBMA 1XWLA 4QWAA 2CQ0A 5F0WA 2DPIA 2VPYB 1U7LA 3Q8UA 3CJ8A 1GX5A 3I82A 5I3QA 5J2QB 4OZ2A 3R7BB 3DN9A 1HQUA 5JMNA 2M4MA 1YKWA 2N7YA 3PO4A 3QT7A 1WWHA 3M2UB 4ALZA 3F56A 1SH2A 3SCLE 4LVNP 3RB6A 3K5MA 3NBPB 1X60A 2OP5A 1GFWB 2H51B 3LWLA 2EEYA 3G96A 3M6VA 2MSTA 1IKXB 4Y00A 3CJKA 2GHVC 2W2MP 1YBAA 1WC4A 1C4AA 2C2MB 2ASYA 2IBOA 2MLZA 1UJ5A 2HMIA 2M7SA 3A3PB 2ZKUA 3JXOA 5HAOA 3K89A 5C25A 2YVSA 3DDKA 2D7SA 1X7VA 2GGPB 1KLNA 1RA7A 2HHUA 4DFMA 3MPUB 4JI6J 2BJ8A 3IG1B 3KLEB 3R6GB 4BHQA 3I5BA 1U02A 4GMKA 4NPOA 1XMOJ 2HGLA 3BEGB 5MAOA 3LALA 3CIMA 2I5JB 3D67A 4EUVA 1NB7A 1HWLA 3PR4A 2AX1A 2DYAA 4DN9A 1EP4B 1SH3A 4DR2F 4DV4F 3LANA 4M5DB 3DRYA 4U8YA 2KKHA 3C6UB 2CWKA 4P7TA 4PWWA 2H9ZA 4NYPA 2C3UA 1R31A 2M70A 4A4JA 2ZH4A 2ATLA 4DV6J 1V3SA 1RTZA 2ROEA 1WG1A 1VBYA 3W5XA 2UU9F 3H98A 5C24B 1YJ7A 1JJCB 2IDLA 3M6WA 1FO1A 1X5OA 4HKQA 1JLGB 2AYBA 4RBUA 2F4VJ 1EX8A 1HBMB 1RT3A 3PXGa 1VK3A 4BC7A 3RG6A 4DR6F 3KMQA 3U02A 2E29A 2C28A 2W4PA 4FF3A 3J7ZT 2ZHBA 4X64J 4DPWA 1TKXA 1TAQA 4O23A 2VASA 5JVHQ 1GNKA 5FJ4A 2L48A 1WOSA 3J7YI 2UXCF 2QEXS 2F40A 3SCIE 2MTLA 2IYIA 4R5PB 4Y2CA 3LF0A 3GIMA 2N3OA 2DH7A 3H5UA 3TJ8A 4GVBB 4X4RA 3HFVA 1HNXF 4HACB 4N41A 2WOMB 1U2RA 1IJEB 1HLWA 1QTMA 5K14B 3UR3C 3T19A 3MFHA 1EQ0A 3UN2A 3P8BB 3GPAA 3QNWB 2BJEA 3ISNC 2VJVA 3NGSA 1B3TA 2ILZA 4DFPA 4DPUA 2FY8A 1NKCA 3W66A 2Q6CA 1VYAA 4ILLA 1KD1T 3GYNA 4IQMA 2BKPA 3CJTA 5C5JA 3BM7A 3PRDA 1S1TA 2DNHA 5B0CA 2XC9A 1XMQJ 2V94A 1RJJA 3E01B 3W5ZA 5LXRA 3HD1A 2YXLA 1SIWB 3HVWA 4P2MA 1H38A 4OYAA 2QMUB 1WI6A 2GO9A 2JSXA 3GQCA 1VQ6S 1FDNA 5CH7B 3J7A1 5A2QY 2OEKA 2F4FA 2FHOB 1CULA 3NWRA 1NH8A 3GR0A 2DITA 3H5YA 3NOGA 3P5TL 3T3FA 2LFVA 4C9DA 4TY8B 3R1LA 3CCES 2HSEB 1JLCB 2C3MA 4OL8A 4TNOA 2QLXA 2UUAJ 2Z2LA 3DU6A 5B0BA 2LKZA 1FKOA 4CRJA 4RX6A 2V5HG 2HRUA 4KKOB 3W62A 1JLFB 4YB7A 5D0GA 2ZZNA 2HEKA 2O5DA 4QJVA 3PIOQ 4DR7F 4DPYA 1WTFA 4RW9B 4ZLLA 1Y5NB 1T0TV 2DK2A 3VZHA 1U48A 3BH6B 1RBLA 2W9CB 1PO6A 3TVYA 1PGZA 2H5JB 1IQTA 4NEYA 1AW0A 2BOAA 2VV5A 4UY85 3TAMB 1QE1B 2QYGA 1JQGA 1KHVA 2WW8A 4DV2F 7AT1B 3B6BA 2G0IA 2OO4A 2LXFA 1VISA 2VU5A 4KC5A 3IRXA 1VQLS 5L9XA 4YMEA 4Y34A 1TFWA 4HT5A 2MQPA 1QAIA 1WEYA 1LXJA 4LQ9A 3GSIA 3LPEA 4UT4A 1FFGB 2G2YA 3GIRA 2NUHA 5ETMA 1HBUA 3N5BA 4TQRA 3PYGA 2HQ3A 3IGNA 5GAHI 2LQJA 4Q8FA 1BQNB 1Q81T 1C4CA 2ZH1A 5IOLA 1VBXA 1JX4A 2HNYA 4EWTA 4OX6A 2B4UA 3PX4A 2QRRA 3L9ZA 3VGVA 4E2FB 3DOLB 3S01A 3CC7S 2I2YA 1TKTA 3D28A 3L95X 1XERA 2HNDA 4OJHA 3PJ9A 4A47A 2QMXA 5ETPA 1BWEA 3H25A 1F9HA 2FZGB 2AD9A 2FLPA 2FVSA 2NSCA 3Q89A 3ETMA 4EBEA 3AD8C 2AQ4A 4M5JA 5IC4B 2X1GA 2MKSA 1U0HA 4KJIA 4ZJLA 1NAQA 3T5LA 4OZ5A 1E6YA 4RU9A 3HF5A 2F7VA 2VQFJ 4O3RA 4OI1A 3LH2S 1MMLA 1FKPA 5KFHA 4C48A 2GO8A 3DLGA 4LMZA 3Q24A 1N36J 4DR5J 2HQGA 4NLUA 2MMYA 4KT0C 2J0SD 3KK1A 5A2QU 1RZMA 2HHWA 1RA6A 1HQEB 5K8PA 3BN4A 2IVYA 5HQ8A 1DAXA 1KBRA 2KI2A 4PG6A 4RUAA 4J9PA 3SYZA 2E5HA 2BJDA 2PMHA 3OFGA 3HVAA 4LF9J 2ZH9A 1OPIA 1YWXA 2AEJA 3KG4A 1SCJB 4RW6A 5A8WA 2RRAA 4WKYA 1KOOA 4LJMA 3KJFB 1XTZA 4X66F 2RH3A 3D0HE 2JH3A 5DGAA 4JI3F 5D3GB 3K7RA 3BV8A 1RAIB 4JI8F 2C2NA 1VLOA 2XZWA 1VBKA 3QIPA 1KWMA 1NKEA 3NS6A 4DF8A 2PD1A 1DQ9A 5J1PA 1Y3JA 1S10A 1WC6A 4ED3A 5CA5A 3KTQA 3IR5B 1H6KX 2F9DA 1H7XA 2AKWB 5GMKa 2WVDA 3DDNA 3AH6A 4PRFA 1MMNA 3CD0A 4QIGA 4EI2A 5CD4H 3S1TA 2QV6A 4K4VA 1WF2A 2DY9A 4NEZA 1B4SA 3ET6A 3WC2A 2XGPA 2A18A 5J1EB 3NRBA 3LGNA 1RTHB 1WDDA 5KFQA 4A8SA 1YI2S 3AD7C 3MGJA 1VHIA 2JLFA 3W64A 2FTRA 1FRMA 2J9DA 4YB1P 4ZP7A 3LP1A 5KFNA 1FT8A 3J81j 2V8VA 4EZ6A 1F1BB 2DB1A 3EXYA 2MKIA 3CCZA 4XK8C 4ZCLA 3CCTA 5HL7Q 2Z2MA 1WKJA 2V50A 3PY8A 3IR6B 2AJ1A 2GIFA 5DDQC 2HRYA 2K1RB 2P2CB 1K44A 2HVIA 3IS9A 3PHEA 4PG4A 5KFCA 4F0KA 1SPBP 2V8PA 4YOEA 1RE1B 2JL9A 1HA1A 2GMLA 4QIWD 3KFWX 3TAPA 5FIIA 3GP9A 3TJ9A 2HAFA 2QSFA 2WB1D 4CNYA 4B3SF 3VGUA 2VFUA 4QU7A 2GVDB 4RNHA 4OZJA 4ECXA 3JYTB 3SCJE 4A8KA 1TFYA 3ENAA 3MUVP 1URRA 2JEIA 1FNXH 4RNOA 1TL7A 4QYZJ 1IUJA 2XLIA 4PG5A 3ISZA 4L73A 3SSQA 4R0JA 5DO2A 3DMJB 3HCXA 2YQ1A 3M8SA 2XLKA 4NLYA 4L76A 3C6TB 3IXQA 5KFAA 1SH0A 1H2UX 2CQDA 1ZPVA 2XWYA 1N6QA 2QLWA 4HH1A 3K58A 3QIDA 1VC0A 2PFDA 4WK3A 1KSPA 4JUZA 2CVIA 5HVHA 3R9LA 2MQQA 5AXNA 4LBIA 2CQ4A 2D3UA 3GE9A 4ETXA 4F50A 3SFUA 3R5GA 2MGZA 4LVOP 3FEXB 2KDOA 3GG0A 4WP9A 2D69A 2H3EB 4TU7A 4I7FA 3SV4A 4ERDA 3PW7A 4W98A 2ZM6J 4NLOA 4WFAQ 4EO6A 3KKFA 1NJYA 3OBIA 2XMKA 4DUZJ 4KB7A 3KLHA 2YKNA 3I9V9 3PCOB 2HWTA 3CDBA 3IA0A 2EFGA 1HNZJ 1GK8A 5E3CA 4EO8A 1S77D 4JBCA 4P52A 3UR0A 1F5AA 2VFSA 5AJ3J 4NWBA 2DHAA 3CDUA 3OJSA 3GFYA 3BPDA 1S1XA 4U7UD 1YJTA 1F2HA 2LLZA 1QSLA 2F3JA 3N79A 4WE1A 2AT1B 4AQYF 2FJDB 1BGXT 1VC5A 3EGZA 1DBDA 1D9FA 4ELTA 1CJVB 1ZM9A 5E5NA 4BWMA 1D09B 1D9AA 1VQSA 3GCXP 1N34J 2OMLA 5F8GA 4M5HA 1ELOA 2LA4A 2P9EA 3HI9A 4CO3A 2KU7A 3HX9A 1Q5YA 5KFYA 3OTOF 2VDIA 4ECTA 4O4GA 4CLPA 4NYOA 3MEEB 2BXJA 3PKMA 2MZQA 4NCGA 2EC2A 1NJIT 3OT9A 2QIFA 2WVEA 1RWXB 3IWLA 1RLCL 4EEYA 2MY7A 1HD1A 4JYAJ 4CIOA 3UFCX 3QT5A 3TP2A 3UD5A 2G4BA 3AJ2A 4WCEQ 1IN0A 4R25A 2DR6A 3KLFA 4OJ1A 1Q5VA 2XMVA 3TNVA 2YX4A 2BQUA 2CQPA 4C3LA 1MLAA 1W2IA 4V19X 2VA3A 4Q44A 3MM7A 5SUHA 3DOMB 2ZH2A 4HHUA 3A8EA 2YKMB 2NQPA 4IDKB 2R2SA 1SKUB 2YQ0A 1S1VA 4I0WA 4N56A 1I94F 1RTIA 1N0VC 4J37A 3VCDA 1XR7A 2CPFA 3I87A 3SQGA 1UVIA 4XDCA 2DNPA 4DUYJ 1FJCA 2E1PA 1L3TA 1NUEA 4ZDNA 4UOFA 5B09A 5BXIA 1XNRJ 1TAUA 3QGHA 4C8YA 3A12A 4O3SA 3X3UA 3M30A 2NPFA 1UEUA 2KVIA 1TP7A 5EDWA 1UETA 4RUHA 1H98A 3DYAB 1BQMA 1JJHA 1MN9A 2DHXA 2W4DA 4K4TA 4MKYA 2SXLA 4NRTA 4P10A 4FBUA 3BGOP 5LMUF 4UQGA 3FGVA 3EZ5A 1C0UA 2YBVA 1GTEA 3QJJA 2W9BA 4PYAA 1S9GB 1QM9A 4USJC 1DFDA 2F9JA 1KC8T 4Z7YA 3GJQB 3H4BA 3VAJA 3V6DA 4IQXA 4USVA 1FDDA 3Q8YA 4ZHRA 2UUWA 3DFEA 3TA2A 2LYVA 1HL6A 3S8SA 1N54B 2HFSA 1AXQA 1RTDA 3PVXA 2CPYA 3DC2A 1FFWB 1BMQB 2DISA 4DQPA 2G0CA 2BJ9A 5B08A 1RT7A 1O5JA 2DNRA 1RWWB 4JI7J 2KJVA 3MCSA 3NGDA 2MZRA 2J9CA 4JI0J 1TMJA 2V2KA 2XTJP 3NCPA 4PQUA 1U6ZA 1T9XA 4F4KA 2ZVIA 1YX2A 3P4UB 2ZBIA 3CCVS 4F3MA 3THVA 1F9FA 3M9OB 3M8PB 4ID5A 3TZXA 2R2RA 1TK0A 5LOQA 1ZETA 2QFIA 3UVJB 1AFIA 2BW2A 4MKAA 4KHMA 5KOWA 3MPDA 4IG0A 2DXDA 4DV0F 1S5ZA 1SV5A 2KFYA 3D66A 3G8TA 1FVQA 3CDWA 4ZVHA 3TUIC 4J9QA 2RUGA 4OI3A 1ZPWX 2DCUB 5A8RB 2BANB 3DOKB 1JLEA 4QYZK 4TLQA 4ED2A 2X1BA 5K8NA 3CB4A 4DPOA 3V2UC 3G82A 3ITHA 3I31A 1GEHA 2DEIA 4FYVB 1UWBB 3PX6A 3C46A 3LQVA 3ILJA 4CH1A 2FC8A 1QAXA 1M0SA 1ZBTA 5T7LA 4J7CA 4ES1A 2XSJB 4X4PA 1HW8A 4CM2A 2CQCA 5GMDA 1TV6A 4KO0B 1S12A 2B4VA 2UVVA 3IMQJ 4CTAB 4CLTA 1UL3A 3B82A 4GKJJ 4YHHF 3SDEA 3A8JA 4RKUC 1QSSA 1FFSB 2CADA 4BLGA 2H65B 4LF8F 5IQQA 3ZC4A 2VPWB 2BABA 4FVMA 2C1EB 2UXBJ 3R5DA 5L38A 1S9EA 3HPOA 3W3SA 2UV8G 1CLFA 4IH7A 4G1IA 4JI2F 2PIIA 2YKOA 2FJXA 3O6QA 2CG8A 3C2PA 1KEKA 1RWOB 2R2TA 1FXDA 5EWEA 2ZH5A 1U4BA 2BYCA 1S76D 1CG2A 3RB4A 4DWIA 1RAFB 4KY3A 3VAHA 3EYZA 1KOHA 1CS4A 2P6SA 4EZ9A 4F36A 1C1BB 1AROP 1LFPA 2OPSA 1H2TZ 2JEFA 4I2QA 3BPSP 3OL9A 3BREA 3TQEA 1I6JA 4C2MA 2XZDB 3NG8A 3B8HA 2ALZA 1ZM2A 4ZVUB 4GKKJ 4X4SA 1LWXA 4I4BA 3V6HA 2LQBA 3J81U 5KT7A 1G6BA 4JI1F 1PCAA 3I96A 5IC6B 2OSRA 1T03B 1REVB 2BA9A 2IC3B 3C14A 4FXWA 2VFRA 2FC9A 1RHUB 1RQ0A 4DV7J 3KOAA 5HANA 4KPYA 2ZUGA 5J2QA 1N32J 1ZTWA 4LF5F 2EK6A 2NXJA 4QW9A 2BKNA 2JWNA 4M8LA 1WHWA 3KLGB 2IFXA 1OY9A 4TYBA 1SIZA 4QPTA 3RBDA 4OI6A 1RXOB 3EMTA 3JQMA 4I2PA 3HDSA 2B5JB 2E7VA 1RUSA 3DGVA 1TMMA 2J0WA 4P74A 4M5MA 3GFXA 4X4UA 4E8UA 1J5EF 3GTYX 4LSNB 3K0JA 3AJ1A 2MKHA 5C42A 2KZMA 4IR1A 4JI6F 1UEKA 3TA0A 2VQEF 2VG5A 2BRKA 3KLEA 1HWUA 5E0OA 4QWBA 1Y3KA 2QMWA 3RZAA 1S6PB 3V4MA 4M5NA 1R8AA 2JC1A 5IV3A 1XMOF 1YHQS 1U1OA 3GCWP 4C7QA 4LF4J 1OMSA 3VF0B 3FSIA 4DV1J 1IXKA 1H3DA 1QDUB 5FD1A 4NLQA 2OJ3A 4I68A 4M5DA 2FHKA 2B56A 1H73A 1YG0A 1M90T 3MOZA 5E3PA 3KJNB 2NXNA 1KNZA 3CSKA 1JXEA 4URGA 2Z58B 2ZDOA 3GIKA 1UA1A 4G1PA 2COLA 1GMWD 5C24A 1AZSA 2BE2B 4ZVOB 4M5IA 1JLGA 2B6AB 4IFYB 2FJWA 2F4VF 4ID8A 1HBMA 2VFTA 1PYTA 1X4HA 1VQ7S 4F2SA 3W9HA 1N5YB 1FRKA 3IM9A 5L39A 3QWPA 4PG8A 5HO4A 4KAIA 4X64F 4NZ6A 4WP8A 5AXLA 1TKZB 4USIA 3UDCA 3HHKA 1QAYA 2W7PA 3JQJA 2AF6A 2J9DE 3MUMP 3FEYB 2NREA 5CYQB 3MM9B 1IR1A 3BH7B 2QO3A 4ECYA 4R5PA 1ZAVA 4ZP6A 3R2CJ 2HHSA 1F2GA 4ED8A 2FJAB 5EWGA 4EFAC 2V0NA 4GVBA 1WF1A 4LFBJ 5T41A 1O6XA 4O3NA 2ZH6A 2WOMA 2AMCB 2VZ9A 3R3TA 4QPXA 4HLBA 5K14A 3QQCD 1IKYB 4DR4J 3M8YA 2DY1A 3GIJA 2O66A 2ZWOA 1Y4ZB 3FCVA 1RWUA 4NYZA 2UXDJ 3MD1A 2JHEA 3J80Y 2EKYA 4S0MA 1NDPA 2BE9B 5A8KB 5KFEA 2QL7B 4DS5A 2DH9A 3E51A 3L7UA 2PC6A 4AD6A 4U7UK 2C2ZB 1U1QA 1XMQF 3E01A 3JB9k 2HBQB 1TL3B 1PJ5A 2B0GA 3RB0A 3IFEA 5HMWA 1KHWA 3MDFA 2RNEA 4X4TA 2DNQA 4LSLA 4MTPA 1IBMJ 2ZOFA 2RQ4A 1Q95G 3MM8B 2M5YA 1NEEA 3DRPA 2JX2A 3D7SB 2FZCB 1JLCA 5AXKA 2UUAF 4UOGA 4I67A 5E2QA 1SUQA 3RBEA 4WBFA 4KKOA 2HZVA 3TEGA 3SMZA 3NMRA 2OPRB 3DI6B 3F0NA 1DTQB 3W8PA 3KXDA 4RW9A 3I6PA 1ZM4A 4N8NA 1PYOB 3M1VA 2YNHA 1X5SA 2ZZTA 2ZFHA 5DM7Q 3CJRA 4B3RJ 3LGHA 2W1BA 2M9KA 3SQOP 4RNFA 3B78A 3PYEA 3D6FB 1V6HA 1QE1A 4PYDA 2AWZA 4MIWA 2YNFB 5E3AA 2JEJA 3OD2A 3I4PA 1XQIA 3N6NA 1NRKA 2B43A 1S6QB 1U26A 2YKPA 2O1PA 4X65J 3OR2B 4RNMA 2B9WA 4B9MA 4CZCA 1FDBA 1VRUA 1NZAA 4DBQA 2OPPA 1WG4A 4F67A 4USUA 3I55S 2PGCA 3R7NB 3T5HA 2AJ2A 4MK7A 3KK3B 4ICLA 4CQ1A 4J9LA 4YUDA 4ECSA 3G8QA 2L9NA 4A8MP 1BQNA 2ZNYA 3QRRA 3ICLA 4OMFG 3FZBA 1IM4A 4IOBA 2LU1A 5HN0A 3HT0A 5F41A 2EWHA 4IKAA 1VQYA 3QO9B 3TEHB 5ETVA 1N88A 3D6HB 3M05A 1OSCA 5IV4A 2GJIA 2PT0A 1YZ7A 5IT9U 4WK1A 2Z2ZA 5CCLA 4DSKA 4P2FA 1P1TA 3OFHA 2A6OA 1IKWB 3OL7A 1Q53A 3P45B 3JTNA 1EETA 3OQ2A 2DH8A 3KHHA 3QSYB 1ZTTA 1N36F 5L1LA 4DR5F 3V6JA 4B3OB 2HFVA 2MKJA 5LMNJ 3IWXA 3VALA 1J2VA 1QVFR 1P27B 1HQEA 3OXFA 4LF6J 1HR0J 1BWVA 4LF2A 4NA3A 2RILA 1J5OB 2Y1JA 1YDLA 2V63A 3CCJS 2XHCA 3MR3A 2YX7A 4ZKAA 3HHEA 3SFGA 5IM0B 2OHDA 4RW7B 3OL8A 4LF9F 2XB2D 3IAS9 4ED5A 4PXDA 4ILRA 3EJMA 2HS3A 2ZH8A 1WEZA 2ASLA 3C16A 2Q79A 3CNQP 4NA1A 2V8GA 4KV8A 2LEAA 3DGPB 3KJVB 2IMWP 3MMBB 1T94A 4UZBA 3QZ7A 2RQMA 4HHJA 2G2ZA 2CPJA 1RABB 4OX8A 1BUXA 2JRSA 2VBXA 1RAGB 2X3DA 2N4CA 5A0YA 2PO4A 4J5OA 1HWKA 2BACA 1DLOA 3V4IB 2DGQA 4PQAA 3PEHA 2ROPA 4YR0A 5I42B 2RRBA 3IM8A 2CPXA 1O8BA 2OGUA 2MQLA 3CGIA 2KRRA 1B7FA 3M9NB 2R9LA 2D41A 2CIMA 2ZNZA 5DLGA 3LWMA 2ZBCA 3CD5A 5HJYA 1B64A 3G71S 4BWJA 4RWXA 2CJQA 2OPQA 1Q7YT 4C0HA 3UCUP 1MU2A 1TTHB 4NCBA 3MMCA 3PX0A 4FBTA 3MM6A 2OH2A 2DGOA 5K9FA 3UPFA 3UDEA 2R7WA 4O44B 3PW5A 2KN4A 2Y1LB 4ZLPA 3QSIA 4G1QA 3RR7A 2WAQD 5L1IA 3K5OA 4PWDB 5THWA 1C1CB 3D1QA 3MUTP 1LWEA 4WFBQ 2XYPB 3D6MB 4MAKA 1F3VA 4ZPBA 1GTHA 1SL1A 4ZLNA 3C15A 4I6YA 1KLMB 3NLCA 4OI4A 2HLTA 1PBUA 5B0EA 1KFSA 5M2RA 3MOJB 1AFJA 1SJFA 2IJRA 1TK8A 2DIVA 2DXFA 1QVGR 2VG7B 2UVRA 2FQQB 2ZWPA 1SJ4P 3PW2A 1FE4A 1T3NA 2QLFB 4JB8B 2R42A 1S99A 1S4EA 3BGLA 2DNKA 2QL5B 3MURP 5AE3A 4LBHA 4P71A 1QY7A 1KONA 3MZIA 5DQHA 3EICA 2CPDA 3P49B 4A46A 2IJFA 4DSLA 1RT5A 4PG7A 3KMSA 2HHXA 1P9QC 4ECUA 5LM7E 3C6TA 3THTA 1BC6A 3W9IA 3TZYA 2EC0A 4ZMMA 4RW8A 1URNA 1RAOA 1YK9A 3ZTQA 2ACMA 2J5AA 4ZPAA 1RYSA 4KGMA 1HI0P 1SC3B 1RADB 2K3KA 4CYUB 4NXMJ 4DF4A 3W2VA 1FJEB 4HVZA 2L41A 2EK1A 4K4WA 1J27A 4MYTA 4RJVA 3A4TA 2OAUA 4F4ZA 2EG2A 3A8IA 3UQSA 1FXRA 2BQ3A 4AL5A 2R8IA 1GQEA 3ZTOA 1WTBA 2OTJS 2GJFA 3DRSA 2CNNB 2ZBRA 2ZM6F 1HBNB 1RAAB 2M88A 4JI4J 2C2DA 4OZ1A 2FIUA 3GFHA 4M5LA 3T1HJ 2CNKB 1CJUB 1S6UA 3OL6A 3AB2B 1NKBA 4ZPWR 4IG3B 1HNZF 2I9SA 2YNGB 1NK5A 1N33J 1DQ8A 2XHWA 2RU9A 3GU0A 5AJ3F 1NK7A 4U8VA 5DQGA 2KJWA 3HULA 4LREA 3PG9A 3KLIB 1FRJA 1EQMA 5JVGQ 3QAEA 4FNIA 2UP1A 2CQBA 2L3MA 1G4CA 2XMAA 2CYYA 4RU2A 1N34F 3NXZA 2HS0A 4B9SA 2VBYA 1XK8A 1T3OA 1S1UA 2L08A 2MQMA 5D8HB 4ZJOA 3FDSA 1XN9A 2K7KA 2DPJA 1RKIA 4MK9A 1D0EA 3BBBA 2R2UA 2D1CA 1VQ4S 3U27A 4YDDB 2IA0A 4M63A 4EYIB 3R5CA 1VJQA 4IRKA 2DHSA 4JYAF 2AEFA 1X4GA 3CJKB 3BO3A 1LWCB 1NO8A 3IC1A 4O3OA 1RT1A 4WYLA 4WZQA 1MW7A 5DM6Q 2DCLA 3PEJA 4W92B 2FGOA 2HBYB 3S7RA 5C25B 1YJRA 5E33A 5F8NA 4ZN1A 1F0XA 2DRDA 1D9DA 1S7HA 5F9LA 1HYSA 3PTWA 2V4QA 2YH1A 2BUNA 4LRAA 3BR9A 2D9OA 2YKMA 4B3TJ 4IDKA 2Z56B 1HWJA 1Y00A 1RACB 2C2KB 2JZ5A 2RDIA 3FBEA 3MTKA 4PXCA 1Q8LA 2J6TA 1R43A 1Z2ZA 3KNAA 2MZSA 2QGFB 5ETKA 3NAHA 3H20A 3RGIA 3LAKA 3UD4P 2A3JA 5KT5A 4X4VA 4B17A 4DR1J 5CABA 2BZ2A 1KVKA 1XNRF 1JNRB 4NLXA 4CLYA 2H5IB 4RZRA 1KRPA 2PFFB 3H40A 4NLVA 3CO9A 4R8UA 3VAKA 2DD8S 5BR8J 4ZN3A 1Y5IB 3DYAA 2HQCA 3NEKA 2IBKA 1Y10A 2YWHA 1A7GE 1D8ZA 1GAOA 5KFXA 3TJAA 2C2OB 3VAIA 3HSGA 3EPGA 2J8AA 2L9WA 4OYZA 3PNIA 2VHGA 4ECRA 2E7WA 3A8KA 4WXWA 2YWWA 2EVZA 2C3YA 3CVKA 2DJWA 3MECB 3QFWA 1S9FA 3NWGA 2UXCJ 1EB0A 3BKUA 3TX0A 2RQCA 1SB6A 2CPEA 2QJ3A 2OD6A 4XIUA 1UJ4A 5CXTA 2C2RA 2XS2A 5SZTA 1JLBA 2DIUA 3FCHA 2KTQA 2AGQA 4JI5F 3QMQA 3QGGA 1U6BA 3PR5B 2NXCA 1FJ7A 3DU5A 1YRXA 3NGTA 3M6UA 3RU0A 4KBIA 5DDPC 3NNHA 4JI7F 3KLVA 1SQGA 4JI0F 4NI2B 3D6TB 3JSMA 1UKUA 2WW4A 1KQKA 3PFEA 3FK4A 1U1RA 1L5UA 2GQQA 3MF5A 1S1TB 4DL6A 4HT7A 1WKLA 3PACA 2WSCC 4CO4A 3SCKE 3ZZ0A 4USTA 3UVJA 2ILYA 1REGX 7FDRA 4LF7F 3ZNJ1 1IM6A 1GXUA 2DHHA 3PV8A 1JKHA 4TN2A 1OY8A 4J9KA 1K1QA 2WCXA 4G3IA 3BQ2A 4QWEA 2E66A 4WXOA 3FCWA 2Z30B 2BANA 2IMOA 4RPFA 4H4OB 1FKOB 3L7PA 2JVRA 3WC0A 2HWIA 2VD3A 1VIXA 2FZKB 2BX6A 3W61A 3CD7A 5D0RA 1VS3A 2HFZA 1UWBA 4DUTA 1NHKL 3DLEA 4NMXA 2HFNA 2DRBA 4J9OA 3TWZA 4X2BA 4KGKA 4TU9A 3LP2A 5EGYA 3NS5A 4KO0A 2CPHA 3GJTB 4KH0B 3CCRS 5HVGA 3KHGA 1O0PA 4GKJF 3OTDA 3OTEA 1JNZB 5KFJA 3HD2A 4F3OA 1WHVA 1T8EA 2OFHX 1EAYC 2OUGA 1KTQA 1HIYA 4NE9C 2YWKA 2YNIA 1UEVA 3CMQA 1FRHA 2XYHB 3W2WA 1NJXA 5C7PA 2KT3A 2KHCA 2UXBF 3FBFA 2XMJA 4KSEB 3IRXB 5C2CA 3BQ0A 3FSYA 3WX8A 2KL8A 4L75A 4ZVEA 1PILA 2ASDA 4LIWA 4OHWA 3G86A 2HLUA 2LCWA 4HL9A 3AY0A 5KT6A 1VJWA 2BJ1A 2B9EA 5K8MA 5KT4A 1HBUB 2R7TA 1Y5LB 3FUYA 1HNWJ 3HJFA 8ATCB 3DM2A 1SJRA 1G2EA 1G1XA 2NUUG 4L6V3 2AJ0A 4O0IA 4ZVSB 1EZZB 2JNJA 5KFGA 5KFBA 2HZAA 2MYFA 2GIRA 3N6MA 1KR4A 1TKTB 3FRYA 4PR6A 4HI1A 1SL2A 4ZVFA 2CDRB 4FP9A 1REVA 3JAMU 1T9YA 4DX6A 4DV7F 2E5GA 4K4SA 2K8GA 3DKDA 2DXEA 2HHPA 3R97A 3AQPA 3CW2C 4FKYA 2BBEA 1RCXB 3FEZA 2JEGA 4PXEA 3QT6A 1A6LA 1CVJA 4DSFA 2UUBF 3KK1B 1OQ6A 2X7IA 3DRRA 4NLSA 2B5JA 2LVWA 5CD4A 5B0DA 3ONQA 4H4MA 3T9NA 9RUBA 2VC1A 3NAIA 3N0VA 5KT2A 2PA8D 2CXEA 5CYMA 2ZC4A 2ZE2A 1VLYA 4LSNA 3WIVA 1HFEL 5ETRA 4OZLA 3FQKA 4ETZA 4TXSA 2J0XA 1M5SA 1VIOA 1KN6A 2GVZA 3POTA 4ZS6A 2A2DA 4DL7A 3K5LA 4X66J 3UDLA 1R8CA 4URQU 1HNIA 1U2CA 1ZAWA 3G8SA 1HBOA 2F8HA 3H2LA 4PPDA 1U47A 5AT1B 3BO2A 1ITPA 4QIFA 1SBRA 4B9TA 1W2BR 4CO2A 2V2QA 4LR9A 4IRDA 4LF4F 2BQRA 1UWAA 4CO0A 4DV1F 3VV2B 1M5KC 1BY9A 5BJRA 1Q79A 2RIJA 1W7WA 3CJ4A 5D4LA 1HNVB 1TUVA 4ANCA 5H9EJ 2F8EX 1WC0A 5DDRC 1CJKA 4KHRA 1A9NB 1B7YB 4CLKA 1VR6A 4XAKA 1KVIA 1WKKA 2Y9HA 2OFGX 2MKYA 2M3DA 1OSDA 2NLWA 3THPA 3ZZOA 1U8SA 3DLLQ 3D3BJ 2HQIA 2RAQA 1RDRA 2VKZG 5ETQA 1RU1A 1GMWA 2KZZA 4CT8A 4DG1A 4IFYA 4P73A 1DURA 3R7SB 4PKDB 3CCSS 4B3MJ 2OD4A 1Q82T 4BS2A 2RDDA 2E5LJ 3GFZA 3HSJA 1MMDA 3AXMA 5MLCV 1FD8A 1TKZA 1Z4UA 1OQ3A 4C0OC 2OEJA 4DS4A 3V5RA 4QYRA 2DGXA 2JFDA 5F9NA 1LKZA 3K8VA 3C19A 3M8QB 1RSCA 4K0KJ 4HDGA 2MQOA 3T41A 3GV5B 4WTOB 5KFVA 4CLZA 3IS9B 2ALYB 2CFXA 3SSRA 3VHQA 4DV3J 2M8HA 4LFBF 4Y3CA 2W2NP 5L9NA 1A0OB 2HVZA 5HLFB 1XJWB 2GW8A 2JOQA 1IKYA 2QG9B 2Z2YB 2VONA 4GO7X 4OV1A 4B3SJ 3T1YJ 2DR9A 1SC6A 5KFDA 2FB0A 3N5FA 2ZC3A 2X1AA 2P5VA 4KFBA 1FCAA 3GLJA 1TL7B 2NXEA 4H4KA 3VWSA 2E1CA 1R6VA 4I6AA 1X9SA 3IR7B 3Q8RB 3OR1A 1U1PA 4IH6A 2GAHC 1TL3A 5HATA 4DL3A 5JJBA 3FJ2A 1N6QB 1HHQA 5G4DA 3KDOA 3BSCA 3IBCB 2IM3A 1M1KT 5KT3A 1Q0NA 3V81B 1OWXA 2BVZA 3QZ8A 2YQ3A 1OY6A 1YVFA 5A6PA 5I4MA 2YKQA 3GJRB 2HFUA 5ETSA 5D78A 2GHWA 3AOCA 2ZITA 3H7HB 1P1LA 3OTCA 3M9MB 1NNDA 4ELVA 4HTJA 3PIPQ 2R7SA 3AA8A 4N76A 3ZTRA 4XPCA 1E6VB 2H1YA 4KYZA 2MGZB 5F3TA 3FNNA 3MTJA 4J90A 1MSWD 2IM2A 2ZHAA 1IWGA 3DI6A 4N8OA 4K4ZA 2IDEA 1DTQA 2VDHA 3KK2A 2VL1A 3UN3A 4Q2MA 2DGVA 3R6LB 2Z0GA 2Y1RI 3OLBA 1OO0B 1YBUA 4DSIA 4NMLA 1PJ6A 2N7CA 5KFFA 4B3RF 2EI5A 1QD1A 4YB6A 1FRLA 4DQRA 2IPOB 1X5PA 4WTYA 2VOOA 2KHDA 4MT1A 5F3ZA 1RI7A 1X4CA 1Y11A 5LSLA 2POKA 3LOUA 2W8KA 1S1XB 4QR0A 5DZ6A 4F0HA 2KO1A 4YFUA 3UI3A 4WE1B 3VAFA 1WF0A 2FVCA 4YN3B 2DRAA 3OR2A 4F26A 4ED1A 2AW0A 2WBRA 2VIHA 2WONA 4EU0A 2M2BA 3QBCA 4URSA 3J7Z5 4J9NA 2A6MA 2AZ1A 4LUBA 3KG1A 4P9SA 1R0CB 2R7RA 1Y9OA 2KG0A 4YY3J 1HARA 5HROA 3KK3A 1R8HA 4JV5F 2EG1A 4QIVA 1IKVB 3OTOJ 4KPCA 5KTQA 4OHVA 1F6TA 3DLHA 2RRNA 2H4YB 1NSPA 3N01A 2ZJRQ 1RISA 2LU2A 3BGRB 2ZD1A 1NU4A 4FYYB 1U1NA 3Q8QB 4W90B 1XBWA 3B4MA 1T95A 2O67A 1QSYA 3I0SA 3JQKA 3OHAA 1ACMB 2HG4A 3RAXA 1RTJA 4EGLA 3BDEA 5J2MB 3PW4A 2LXIA 3KDNA 4QR2A 1BHNA 5FLXU 2V4JB 1CQMA 3M8RA 1IBCB 3KLFB 4ED6A 1MROA 3NP5A 3DLKB 5CQGA 2JC0A 3D68A 2H54B 1PAEX 4B3OA 3EZOA 4X62J 4DU8A 4ZIWA 3MM7B 5LMNF 2XSFA 1R6YA 1TELA 5BYSA 4C8KA 2WZ1A 3R5AA 3JS9A 3IN5A 4LF6F 5KG6A 2HWHA 4Y2IA 2QSWA 2DNNA 4RL1A 3OHBA 3OXGA 3UCGA 2UVWA 1RTIB 1UCNA 2DGTA 3FMWA 3HK2A 2RKIA 5AE2A 6FDRA 2C42A 4FF4A 2QE5A 3SQGB 4RWWA 3T1AA 3TVZA 1R0AA 3MEDA 1GX6A 4C97A 3CDEA 3NL0A 4TQSA 3M2RA 4NL5A 4MK8A 4ZPCA 4PZVA 1LW2B 3M30B 3EE3A 2RD5C 1VQNS 2J0QD 1XEZA 1AUDA 3GYXB 1UP1A 1TKDA 2BEFA 3ZTPA 1T05B 4IFVB 3OFFA 1S57A 1NXIA 3EVWA 4P6QA 5DLFA 2HNZA 5LMUJ 3V4IA 5FDLA 3WDOA 2GJ2A 3GR1A 3W60A 3G6ES 1C0UB 1ZZNA 4KRWA 5H9EK 4FPRA 2XNRA 4CLSA 1HD0A 3CO0P 4DL5A 4KGXB 3F73A 4KIAA 3K2YA 1HW9A 4DL2A 3NNCA 3UO0A 3GSDA 4ZHRB 2GIQA 3LTOA 4K59A 3MAQA 1I51B 4K50A 2NZCA 1S1WA 3NS7B 1GXTA 2DR7A 5JXSA 3NOCA 4DOZA 3ILIA 3MPWA 1B70B 2MLYA 2W7AA 1FWPA 1TU0B 4V19J 5KG1A 3GYGA 4QWCA 1U8WA 4RNNA 4HHHA 2P6TA 3VVUA 4WIQA 3FRZA 1FA0A 1TVRB 1VBZA 1QJHA 2Z4PA 4B9LA 2M8DB 2Q43A 4KGZB 5J2NB 5LJ3Y 3EGVA 4M5GA 1LW0B 3BR8A 3G87A 2NCKL 3Q8SB 4A8YA 2I6WA 4IG0B 4OIXA 1SV5B 3VQTA 4ZJQA 1FJGF 2VPXB 4I64A 1S59A 1RT2B 3QLHB 4IOCQ 2XS7A 3I5CA 4NASA 4X4QA 2E5JA 1NPKA 3PFOA 3T6JA 5DJBA 3CMES 2QN6B 4I56A 1W25A 4UQTA 3DXSX 4ED4A 5ETLA 3MMAA 2W4CA 3ENVA 2W01A 4DCPB 4DN0A 1WC1A 2PE8A 2MXYA 3HVTA 4CWBA 3FVYA 4NLWA 1S6OA 1MG7A 1TV6B 4CYUA 1H2VZ 1KFDA 4NXMF 3L09A 4DMZA 1H72C 1RHRB 4R0EA 2ZDPA 1X4BA 5E7OB 4NLTA 2R8GA 2VB6A 2X1FA 3SDEB 3MWBA 1T9WA 2RF2A 2MKCA 1U1LA 5B0FA 4PUOA 2GZOA 3G6XA 2O3DA 4OQJA 1S9EB 3SI8A 4GO5X 4HDHA 2UUCF 4ZLJA 1H0HB 2K2PA 2QA1A 4ZPDA 3UDVA 4ZPTR 1FESA 3TA1A 1FNMA 4P2SA 5HMYA 2IA6A 5IT4A 4DL0C 3TI0A 6AT1B 3GV8B 3T1HF 4JV2A 2PA3A 4WF9Q 4J9UE 3HMJG 4QCLA 1ZAXA 2YNGA 4AUKA 3H5XA 2KB2A 1F5CA 3LP0A 3VQSA 4FF2A 1N33F 4U95A 1IWAA 1LWFB 1TUGB 4K5RA 2NXUA 3HJVA 3HSDA 5I3UA 1Q8BA 3EWGA 3GONA 4OLPA 2OPSB 3A3OB 3H4DA 5A6WA 4I2QB 1LK7A 2HGNA 4WP3A 1S49A 5G0RA 1WELA 2IYGA 3CXCR 1NH7A 1Z2LA 3W9JA 1VQPS 1HHSA 3LO3A 1KQFB 4QOTA 3HFZB 4DHVA 3HP6A 1WC5A 1WOPA 4F2RA 1PIEA 1FWLA 3C14B 2XCAA 1YBTA 4WWSA 2X3GA 4E98A 1M5PC 3BKTA 3MCOA 4OZNA 4UY8T 1X31C 4LF5J 4YP3A 1NJZA 1ROFA 3O2IA 4O3PA 2E9ZA 4YQWA 1RYRA 1XIQA 3BYRA 3GIIA 4USWA 2KVQE 3OSPA 3CJSA 2BJ7A 5E41A 2FHJD 3L4BC 2NR0A 5J1NA 3VTIA 2FJVA 4IRCA 1CC8A 4I2PB 1YQHA 5D6GA 1LWCA 2IVMA 4K2JA 2EPIA 3OVAA 1XNQJ 3HHLD 4XPEA 3OXLA 1B0TA 1X4AA 5B0AA 5CZXA 4FYWB 1J5EJ 2DKOB 3HHLB 1TL5A 4NOHA 3HKZD 4Q0BA 4E0DA 3CJQA 5C42B 3UNYA 2H5EA 1LFWA 1T02A 2D9PA 2HZCA 2J8SA 1JLAA 2WVBA 3RTVA 2VQEJ 2VG5B 4Q5VA 3TUJC 3O8WA 1NBEB 4WPAA 4DJBA 2N4DA 4B3TF 2RHQB 4QIEA 1IR0A 4KGVB 1O51A 3OUYA 3T5JA 1WDTA 1RT6B 4C8LA 1SQFA 3K5PA 5BYRA 4Z7CA 2FLOA 2RU3A 3J81Y 2CQHA 2XO6A 4WIIA 3TUZC 1AUSL 4OHZA 2QX0A 4ER8A 2AGPA 2MQ8A 2RVJA 4U67Q 1JWWA 4DR1F 2KFZA 2A1BA 4FDFA 3DCAA 4P72A 4Q2LA 4DQSA 3C3LA 2CZ4A 1WACA 1WSRA 3QRPA 2AJQA 4A8QA 3VR1A 1UFWA 1FK9B 2GMJA 2W24A 1P6TA 4Y2AA 1AZSB 5DRKA 5BR8F 1VQ5S 3QRQA 4RW4B 1Q86T 1AB8A 2CJXB 4NZ0A 4ZITA 9ATCB 3HT3A 4A8WA 3CPWR 4MH8A 2IVFB 4YR3A 2E1MC 3P5BP 3D2WA 5JUMA 2DEJA 2CJ9A 2Y0SD 2Q3PA 5KFRA 5CAAA 1T9UA 4CT9A 1AA1B 3A13A 3MECA 3SZ2A 2CQ3A 5L46A 1OJ4A 3KWMA 2J6SA 2A10A 3Q2SC 4CLFA 3OVBA 3E2EA 3LPYA 2IHR1 3B4DA 3Q0AA 3PJWA 4K8RA 3OPKA 2FJBB 1DTTA 1RWVB 1NPPA 4DR3J 1PG5B 3FBBA 3M32A 2IAJA 4OHYA 3C8YA 4ED0A 1IVZA 1NCLA 1N48A 5KAKA 2XLJA 4AT1B 4NI2A 1VRTA 4X84A 3CJ0A 1KTVA 2AIRB 5AE1A 3J7YU 1VCTA 3VGTA 3M6XA 2CA9A 4LFCJ 2G1DA 1MWYA 1VFJA 1V3RA 5CYJA 4J9MA 2QLJB 4Y65A 1CJTA 2GQ2A 3MM5B 4OJ3A 3BF4A 3QFHA 2E1RA 4TU8A 2BDPA 2MJNA 2CQGA 4F0MA 1FE0A 2QLBB 3IP0A 4OX7A 5KFKA 5DG7A 3P96A 1WORA 4Y0FA 4LSLB 3BBFA 5IXUA 2OSQA 4U96A 1F3FA 4KHPJ 1VQ8S 2FYXA 3KYLA 1C0TB 3DRPB 2XG8A 5IWAF 1L3SA 1NK6A 1L3UA 3RBZA 2EFQA 1YGYA 4GVLA 4H4OA 1SUQB 2J9EA 1WEXA 2PN6A 1UVNA 4IOAQ 2YWGA 2UVUA 3AAWB 3PDNA 2CUYA 3D1HA 2OEMA 4I6WA 1VQOS 1FERA 4B9NA 3M1VB 2YNHB 1LXNA 1F60B 1DQAA 4B9VA 2AYMA 4FYXB 3NKYA 3M2UA 1SVDA 3H2VE 3N6LA 4PEOA 4M94A 4ZVTB 3NBPA 2CWXA 1QLNA 2AHOB 1TL1B 3NNAA 1IKXA 3PYFA 1U49A 3H90A 2CVEA 4OLOA 4DQQA 1N56A 4O4RA 1MWZA 1X9MA 4IYQA 1VRUB 5D4PA 1KKHA 1PAUB 5HSPA 2OPPB 1X4EA 2M52A 2AU0A 2GGPA 1KS2A 2HIYA 1PKUA 4F25A 4FZVA 2VA2A 2V67A 4ICLB 1HNWF 5DG8A 5L1KA 2G2OA 3GV7B 3BDPA 3IG1A 1FRXA 4TVAB 4ZK7M 1WUUA 2GCFA 1LV5A 5IT0A 2B3TB 4F04B 3A1YG 2G1HA 5T14A 2ABYA 2R7XA 2PI4A 2FLLA 3CF5Q 3OSNA 3TQ1A 2I5JA 4F4YA 4FXDA 1EP4A 2Q1LA 2MZ1A 2HQFA 2D3O1 2V2ZA 3RAMA 1SJQA 1YJWS 5HQLA 2FDNA 3C6UA 4X4OA 2QT7A 6FD1A 2HK2A 1WNEA 4K4XA 1Q4RA 3C66A 4DV6F 1EETB 2XZTB 4ELUA 3VAMA 5GAHU 4RR5A 4PPZA 1NK9A 3OFEA 2V6AA 2HVEA 2QZ8A 2KG1A 3GG1A 1S79A 2O01C 3BBCA 3HHLC 3ZZRA 2W2OP 3HHDA 1PJ7A 3MCNA 4UUXA 4USMA 3MFIA 1DY3A 5C2GA 4RUCA 3WBZA 3AOAA 3RYLA 2KH9A 4N5SA 4D3HA 5AXMA 1JB0C 3MR7A 1S72S 1EKSA 4NXNJ 1RAEB 3LAMA 2P8IA 3C16B 1HMVB 3DXBA 2G0JA 3Q23A 2U1AA 4KV8B 2EFOA 4DCOB 3Q22A 5DETA 1RT4B 1IBKJ 4JV0A 3TYTA 4ZA1A 4HACA 2C22A 5CHCB 1CPZA 5KFMA 2R7OA 2DNYA 2I1RA 2LP4A 3HM9A 2HBZB 1SL0A 1SJ3P 3PZPA 3CE8A 2CJBA 1NHUA 5A0YB 1SJ1A 4AXIA 1MN7A 1NPRA 1HNVA 1DLOB 2A2CA 1RHQB 2XO7A 5IT9Y 4OV6A 1GH8A 2RT3A 1NK0A 4G6VB 2MSSA 4DL4A 4LRDA 2V68A 4HH0A 3MHYA 2F1FA 4K4UA 3FFIB 2H48B 2FHMA 2OPQB 4DX5A 4K2XA 4RBTA 2CPZA 1MU2B 4Q8EA 3MMCB 1SI9A 3MM6B 3H59A 4MFBB 4WKRA 1YRUA 3RW7A 1N5SA 3W1YC 4L3KA 2FGCA 2GX8A 4B3MF 1BLUA 4TY8A 2DR8A 1T9VA 4U9RA 4G1QB 5DGBA 4RBVA 2E5LF 2QYCA 4XO0A 3ELHA 1OYDA 5KG2A 2BRLA 2BJ3A 5KG3A 3A3NB 3RB3A 2GFFA 1JLFA 1LWEB 4TLRA 1KQSR 1ZA2B 2XM3A 3CJ2A 3EZUA 1X9WA 2XNQA 1YJ9S 3I9ZA 5CZVA 2XYGB 4CLUA 3M8QA 4K0KF 1WD6A 4Z2XA 3C15B 5F8MA 4ZCIA 4UZCA 2R8HA 2W9CA 4J9SA 2E9RX 4OZ0A 3EVOA 4DV3F 4C11B 1UVKA 3VZIA 1NHVA 2FY1A 1K0TA 2BM0A 5HLFA 3TAMA 3D0GE 5EUHA 1SXLA 3W7BA 1YIJS 5I3PA 3T1YF 1FF2A 4L74A 5IZHA 4EYHB 3M4XA 2MB0B 2FUG9 2KT2A 3TZZA 5LSOA 2Q66A 2K7JA 4IH5A 2JLEA 1U6FA 4UOCA 1RT5B 1R8PA 5IQ6A 4LFAJ 1RWPB 3BZQA 3CEDA 1R8BA 2P9GA 4RW8B 2DTJA 4IUFA 3V81A 3SEOA 5EN1A 4PCQA 2W2QP 2QA4S 2XMWA 4LR8A 5ITHA 3W2VB 5KFOA 4DFJA 3MR5A 1C2PA 2HRTA 3JSRA 5DDOC 1QAJA 2NSBA 3DOLA 1XR5A 3E3XA 2XY7A 4FS1A 3AT1B 5H9FJ 3DNCA 1E6VA 3PRBA 2B8PA 1FEHA 4Y28C 3TW0A 1R3NA 3DRSB 2KXHA 3IGVA 4QQBA 2BE7D 3GMGA 1RLDA 4FNHA 4ILMA 1Q8KA 3W63A 2VOPA 3DDIA 3BSAA 2XBPA 2VQFF 1NDCA 2AJ4A 1UPMB 5IFMA 2HBRB 3CD6S 3PM9A 2ZOGA 2MJUA 1VHFA 4NZ7A 3I0RB 2Z57B 4ZP8A 1U09A 4DFKA 3H8YA 1PBAA 2DNMA 4DV5J 1X4FA 1L3VA 4OI0A 2U2FA 1AYEA 3RW6A 2XS5A 2Y8WA 3IAM9 1UW9A 1QTNB 4LRBA 1UPPA 2ZJPQ 2HW3A 5EX0A 4WJBA 3U7JA 3CJ5A 3RRGA 1S1UB 1UTAA 4LT6A 4NRUA 2XMTA 2GHPA 4YY3F 1S48A 4ZPVR 1CEZA 3MEGB 3G9CA 1IKVA 5HBMB 5F8IA 4ZVGA 2V8DA 5EX3A 3GWCA 4GC6A 2J7UA 5D3GA 1QUPA 3BKFA 3BGRA 3OTBA 3H2UB 5LT5A 5HMXA 4A8XA 1BQXA 1EKRA 3FQLA 1U25A 4DU7A 1NMEB 2IIHA 4LF1A 3UW1A 4WFXA 1IBLJ 1L3KA 5M2UA 4QR1A 5J2MA 2BR0A 2J6UA 4Y6IA 1RT1B 1X0FA 1CQNA 5F0UA 2V4JA 1LOUA 1NDKA 2FD2A 4MIAA 2WK4A 3SIPB 4YS2A 2CPIA 1YJNS 1N8RT 3DLKA 1PSDA 4XTTA 1KDNA 2BMBA 2IRXA 4F4WA 5E3QA 4X62F 1HYSB 2MPUA 2W7OA 1FXLA 3MAAB 3G2XA 3QYYA 5J1EA 1RTHA 5GMEA 1DARA 1JLQB 3QATA 4IO1A 4CH7A 2P9CA 1PC4A 3AA9A 1N4LA 1TZ0A 4N47A 2ZUAA 2XY5A 7FD1A 1ZM3A 3US5A 2KXNB 1N5TA 2MKKA 4AXJA 2C3OA 2ZVSA 1WI8A 4NLRA 1X5TA 1M1GA 5EHHA 1Q78A 2PDAA 3BGFA 1ULRA 2B4PA 2K1RA 2LECA 4F8RA 2GAGC 3RBXA 3WZ0A 1UZHA 2VG6B 1LW2A 3J7AN 3HKWA 4YB5A 3FKBA 4WFNQ 2ACYA 3TOQA 4R8UB 5KFTA 1ZH5A 1B0PA 1DJ0A 3R5JB 1T05A 4ES3A 4K7QA 2GVDA 4IFVA 3JYTA 2D3OR 2PMZD 3QJLA 5KFZA 3KG0A 4CI0B 2CQ2A 3I4HX 3I5AA 4KTQA 5J2PB 2GV1A 2V9KA 3G4SS 5KFWA 4KE5A 1JJ4A 3CTRA 3DMJA 1VOMA 4NA2A 2CQ1A 3BSNA 2WTFA 2YWFA 4YR2A 4OYOA 4OYXA 2WB4A 2B4OA 2CKWA 3EDRB 1P9YA 2XI2A 4ANDA 4RUBA 3VVTA 1RK8A 1JLBB 3L3CA 4OX9J 4WZMA 4ECZA 4A8OA 4JI5J 1GMVA 3SXLA 3PKYA 1ZYQA 4YEAA 4KR0B 1VDHA 1FTRA 2RMLA 3ZZZA 3AOBA 3PHTA 2CQIA 2RUSA 2NYIA 3RR8A 1TVRA 5ETOA 5F8LA 1OPZA 3ZZUA 3NGKA 3JSMB 4EBDA 1K9MT 4DUZF 1YSJA 2V8HA 1FD2A 5J2NA 2WVFA 1HPZB 1U24A 3CUNA 1LW0A 2ATCB 4LF7J 3W65A 4B02A 3CT9A 3HLUA 2R8KA 1RWNB 3M2VB 4AYBD 3QGPA 4GC7A 4DZ6A 3HHNB 1JKHB 4USHA 5GVQA 2XI3A 3UCZP 2VC0A 1RT2A 3QLHA 5HP1B 3JSYA 5KG5A 1K73T 1CJVA 1OS5A 4ANEA 3MR2A 3VAGA 1JIHA 2EFPA 4NLPA 2HHHJ 2VH7A 5K20B 2ZHOA 4P75A 4CDIA 1FHTA 3DLEB 4EMDA 4D3GA 4ZVQB 3D0IE 2A0FB 2BW7A 1D8YA 3D54A 4LR7A 2CAJA 4DI6A 3LP2B 1RWKB 2E5IA 3MEEA 4NLDA 1HQUB 1NM2A 5KFPA 4DLEA 1N52B 4C8ZA 3AFGA 4Z37A 3DLJA 3W5YA 2YNIB 5CCMA 3W2WB 4UUWA 5H9FK 3QWUA 3ZFVA 3CCQS 4H54A 3EGNA 1K0VA 4MKBA 2IJNA 1MNEA 2HGMA 2PEHA 4QU6A 2FVPA 1WSVA 2HMIB 3LA0A 5LL6d 2DVIA 2YTCA 2GS8A 1VGYA 2AX0A 1BD6A 1LWFA 3ZTSA 5KFLA 5KG0A 4NLGA 3DM2B 3DOMA 1TL4A 2BKOA 2FVQA 3H5SA 4UW2A 2I38A 2V9WA 1YTYA 4MJKA 2IY5B 4CNZA 1VQKS 3OLAA 2MEWA 3CC2S 2KT5A 3KUEA 2VFVA 4C3MA 1VK8A 3QJPA 4DR2J 4DV4J 2MHEA 3OV7A 2RS8A 1PYSB 4DUYF 4BDPA 3U1LA 2EBEA 1N5VA 4C8OA 3P3DA 2CDQA 5DZ7A 3IO1A 5GAEI 4LRCA 1I3OB 2KYZA 4QBUA 3CCLS 4OYIA 2UU9J 3TARA 1ZOTA 3MPYA 1NSQA 4ECWA 4DPTA 2E9TA 1F5BA 2HHVA 4RO0A 4DCJB 2UUBJ 1T11A 1S0NA 2APOA 3DLBA 3E8OA 1UVLA 1RT3B 3CJ3A 2FHJA 3DRRB 4DR6J 1K8AT 2YY3A 1RHKB 3CCMS 2ERRA 2YPZA 4P7VA 1PC5A 4H4MB 2G13A 1XNQF 1TKXB 4DDFA 2ZJQQ 4ZVPB 3K8WA 4MIBA 1S9GA 5CYMB 3VGSA 2ZE2B 2ROGA 2KXFA 1QUVA 3HHLA 3QGIA 3NGUA 3PW0A 4ENOA 5GAEU 3RRHA 4OYWA 3WHIA 2GVZB 3POTB 2E7XA 2XY6A 1S4FA 3R1HA 1NK4A 2LQ9A 4G65A 2LEPA 1S97A 1HNIB 1UFLA 1N0UA 3ZZPA 2KM8B 1HBOB 1HNXJ 2XGQA 2AYGA 1SC4B 2C3PA 3JTOA 3ENQA 1RT6A 2AV5A 2B8QA 4BCAA 5ETTA 2W9AA 4OJGA 4OYBA 4AE5A 3IRWP 3SV3A 1D3WA 5HJXA 2LDYA 5KFSA 1M5VC 4CH0S 3JAMY 2QC3A 2Y1IA 1CJKB 3MR6A 1RHMB 2YX1A 2Y0BB 3BYPA 2C2EA 2IRUA 4J9RA 3TVKA 3M8PA 3HXMA 5KOXA 4FYDA 1U2FA 2PSZA 1RHJB 1FK9A 4CCHA 2OTLS 4DLGA 2FJEB 3H42A 4RW4A 1RKJA 5EWFA 3W8GA 4DG1B 1CULB 2YH0A 8AT1B 4PWUA 5GADI 1RGVA 2LDIA 5A8RA 2RDJA 1NDLA 3DOKA 3CULA 2HVHA 1NB2A 3HZEA 4C8MA 2MLXA 4FVCA 3G6VA 2E1AA 1EJ7L 2MZTA 4B9UA 4DSJA 2CNOB 3P6YC 4DR7J 1UFKA 1OYEA 2XSJA 3O44A 4Y2MA 2B51A 2AJFE 2XCPA 4DR3F 2V34A 3NGRA 4CTAA 4ES2A 2UV8A 2OELA 3EVMA 1CBKA 1GXLA 5GADU 4DV2J 2DGUA 4MKVA 4DZDA 2RHSB 2JJ4D 3D4JA 2LQ5A 4TKTA 3TO8A 2DBBA 4NX9A 2W8LA 4KFBB 3FC9A 3LW5C 1U1MA 2VPZB 2HK3A 1TUWA 3F41A 1CC7A 3IBFB 3PRVA 3OR1B 2VBZA 2WSFC 1VMBA 2CRLA 4LFCF 4TYAA 4NCAA 3AB4B 1EARA 1U0SA 4RLEA 1WHXA 1I5OB 3MM5A 2N3LA 1ZS6A 5HI7A 3BQ1A 2B7CB 4KH1B 1RCOB 1OIAA 5IS2A 1C1BA 2ASJA 2HVDA 3FMBA 4KHPF 1FRIA 3KHLA 1C0TA 4U7CA 2HNYB 1Q16B 2EBGA 4XDDA 8RUCA 1NK8A 4GKKF 2HNDB 1RWMB 2CZVC 5HMZA 1X0PA 3CCWA 1UW4A 2VJUA 3KUGA 4L72B 4PAAA 4IR9A 4FF1A 1JXLA 4ZVRB 1T03A 2IC3A 1DHMA 1YLXA 3KK2B 1FKAF 3B54A 3GJSB 3Q2TC 1U0HB 3UN5A 2V69A 4N77A 4M5KA 1E6YB 1N32F 2XEXA 3CIZA 4USKA 1BXNA 3S6EA 4KQZA 4JP8A 1FKPB 3BS9A 1LEOA 4IO9Q 1FWKA 3DLGB 1VRQC 4JOUA 3KLGA 1U1KA 2DNZA 3ILLA 1FNOA 1TL1A 2MDAA 2OLWA 4AFFA 3D1OA 2J7WA 4HI2A 5KG4A 3KUHA 3FZ2A 2WONB 1U45A 1P8GA 1KVJA 3I32A 1R7IA 1GT8A 2CNLB 4RW6B 5A8WB 1EIYB 1XR6A 2LA6A 1KQGB 1RAJA 3KJQB 4OYPA 5HROB 5RUBA 3PJXA 4JV5J 2OMOA 2ZKTA 1M5HA 2LXUA 1TK5A 4Q7AA 2DGSA 4OFZA 3O3LA 1R27B 2D74B 4JI3J 1S6PA 5LXYA 3ZXWA 2ZD1B 4JI8J 1JK9B 3GILA 1V5IB 4BBYA 1NLKL 2J7KA 1SC1B 3QIPB 3IBWA 1VI7A 2DGWA 1KP6A 1HI8A 4WU2A 2DR5A 3R5BA 3I0SB 3T6BA 3J80U 1RTJB 5B7WA 4ECVA 4I69A 3K5NA 3EM1A 2R7QA 1FEEA 3UD3P 3EXCX 1R0BG 4HEA9 1Q7LB 2JLGA 3MEKA 4K4YA 3OW2R 2AYEA 1Z1ZA 1MROB 1UA0A 3JTPA 2BE2A 3TRGA 1YRTA 2BM1A 1JMTA 4F4AA 3K57A 3ET6B 2QA4G 1FX4A 2B6AA 2VICA 2OI2A 2DNLA 5M2PA 3D9BA 1DRZA 3MAHA 3BSOA 3ZO7A 2B9YA 1N5YA 5L1JA 2N82B 2AGOA 1UZDA 4QW8A 3LP1B 3FSXA 4C3KA 2KM8C 2H4WB 2RKIB 1SKSA 2RS2A 3HO1A 4C8NA 4UOHA 3EGWB 3ILOA 5CYQA 3MM9A 3TANA 4J9VA 3AQOA 4Y2KA 2HHQA 4NXNF 2M0GB 1R0AB 4F02A 3MEDB 4N7TA 2RJZA 1HMVA 3MD3A 2I0XA 2B9XA 1RT4A 2W25A 3M2RB 1IBKF 3H0PA 4TY9A 2AEMA 1M5OC 2WHOA 1RB0A 2GNKA 3L7OA 3GZ7A 3AD9C 4DR4F 1WJ9A 4M95A 3KHRA 2HAIA 4PABA 2OIHA 1FI4A 3AODA 4CP5A 2PMWA 1HHTP 2UXDF 1FTCA 2HNZB 4Q45A 2F5GA 2EW9A 3QPIA 5FDLB 1IQZA 2FLNA 1X8DA 2EFNA 3NCQA 5A8KA 1FX2A 4CO1A 1V9OA 5FLXY 4ZP9A 1YITS 4FXVA 1W26A 4O3QA 5HVFA 3N4WA 4YDXA 1WC3A 3BN7A 4GRSA 2FPHX 4OYMA 2D3ZA 3RUBL 3FFIA 3EPIA 5BYQA 1V5VA 3CCUS 1H74A 2XQCA 4MFBA 2GQCA 5D4OA 1S1WB 1IBMF 2ADCA 3MM8A 2PI5A 4A48A 1V3ZA 5D4NA 5A76A 2NPIA 2CZ9A 4LIRA 2VF3A 2ZH7A 4DSEA 4DEZA 4CLWA 1FDAA 4UF4A 4UTGA 5LSRA 1Q1KA 4W4MA 3BB5A 3RJMB 4I7FB 2OPRA 3MCMA 1SKRA 2J76E 3KLHB 3DHXA 1T9TA 2YKNB 4Q43A 2L9DA 5F8JA 2R4FA 2KRBA 4C98A 4DX8H 1LQ9A 4DPXA 3EDQB 4C11A 5D0EA 2R3VA 4FS2A 2YPYA 4H4KC 3JSBA 3HZGA 4ECQA 3EX7B 2YNFA 1GMUA 2V2VA 1K47A 2AZ3A 1FJGJ 3CDAA 3MXHP 2HS4A 4DX7A 3CMAS 1S6QA 2UZAA 4AQYJ 3ENWA 2JFKA 1NSKL 3AJDA 3CWJA 4X65F 1F9EB 3K59A 3MMJA 2QA2A 2YWEA 1B0VA 4LFAF 3MMAB 1MWQA 2NS1B 3PO5A 3Q83A 3PYDA 3HVTB 2FVRA 3U1MA 2X51A 3ZZYA 1Y0HA 1NSAA 2G9OA 4O4GB 4V1Ak 3HFKA 4NCGB 1FVSA 2MHNA 1NJWA 2CG4A 1RAHB 3M7VA 4HYKA 2RF2B 1ZA1B 3QO9A 1BE4A 4ITSA 2K06A 3EUNA 4PUOB 2MQNA 2XULA 4DQIA 2K3IA 2UUCJ 2F65A 1NZ8A 5HK4A 3N9UC 5ADZA 2BOPA 4HTIA 3K17A 2LMIA 5HQMA 1IKWA 1RU2A 4WU3A 4ZCKA 1VQ9S 2NZ4A 3LP0B 3UWTA 3V6KA 1IR2A 5DS7A 1UMJA 2DHGA 3TX8A 2QFJA 4U6PA 3D5MA 5D77A 3M8WA 5I3UB 2HQDA 3I0RA 2BV3A 4DXLA 3UE2A 1HR0F 1HQ2A 2VBWA 1HKAA 1UVJA 4ZOSA 4DV5F 5G0RB 1VC6A 1I1GA 1J5OA 2IM0A 1S1VB 3U1NA 1I94J 5IM0A 4X4NA 2JVOA 4RW7A 4LQ3A 1LNQA 1YZ6A 2GC8A 4OZ3A 5KFIA 4WYWA 4HR2A 3MEGA 4P2XA 5HBMA 4ZCMA 4C4WA 2DO0A 2IRYA 3DGPA 1HI1A 1S0VA 3Q8VA 3KJVA 3MMBA 1H7WA 2EXUA 3R8YA 2Y3YA 1M1HA 3M8ZA 1APSA 4A8FA 2HHTA 3DRXA 4EK2A 2EFVA 3G6YA 2QL9B 1WHYA 1X4DA 5F8HA 3R27A 4FN5A 1S7IA 1BQMB 1G3OA 2VKRA 2HURA 3O1LA 1IBLF 4AL7A 3TAQA 1Q8IA 4ATNA 4WFYA 2EKNA 5I42A 4F4XA 2GMHA 2MY8A 4QWDA 3BO4A 2CJYB 5GAGI 3LGMA 3X1LB 2W9BB 2RSQA 3D3CJ 1IJFB 1AT1B 2RE1A 2ZZMA 2Z8QA 4Q0BB 4F3QA 3V6DB 3ZNUA 5DQIA 1JLAB 3WQPA 3UNGC 1EHWA 2VODA 2QTWA 2XMMA 3WIUA 1UVMA 1K1SA 3HVRA 3MAAA 1TQLA 4LBPA 4O44A 3BGUA 3O5TB 2ZEJA 2LQ8A 2HFOA 5U47A 1JLQA 1RTDB 3RAQA 3I56S 3OUYB 3IWNC 4PWDA 1R89A 3T9ZA 3BJYA 1Y7PA 1RBOB 1XMBA 4L3NA 4MMOA 1C1CA 2YKAA 4K5SA 1TR0A 1RT7B 2IM1A 2ZH3A 3F44A 2RQKA 2W2PP 3ZZTA 2HPUA 3WX4A 5GAGU 2XWXA 2XMUA 4PQUB 3MI7X 1XC9A 2ZBPA 4LRFA 2OKQA 4FKXA 1KLMA 1VQMS 3ISND 4ED7A 3AHPA 2VUGA 5D15A 1UAWA 5H1SV 4J91A 2VG6A 4FPIA 4CM0A 2R7UA 4ID5B 4B08A 3QAUA 4OHXA 1RBAA 3NCRA 5B0GA 2CJAA 4MYUA 1DZ5A 2VG7A 3ADAC 5D0HA 1LK5A 3QT8A 4DV0J 1JJ2R 2CJKA 2MZJA 2LEBA 2UUTA 3Q8PB 4O0NA 5L8RC 1SQEA 3T5KA 1S0OA 3FBCA 4LSZB 3R2DJ 5J2PA 4PXBA 2DO4A 1HWIA 4CO5A 3RRKA 3TUPA 2F8MA 1JLEB 4OI2A 1N5QA 2ZBQA 5LJ5Y 1YJUA 3TZWA 2HIQA 3G82B 1UJ6A 1WG5A 3SBMA 3ITHB 3NY0A 2KFNA 1CSJA 5T7LB 3GB0A 4OX9F 2ZOMA 3SSSA 4JV1A 1DTTB 4AL6A 2PEBA 1WOOA 3ETOA 3Q86A 3M32B 5E3RA 2IAJB 2R8JA 4YHHJ 2HYIB 1D1UA 4LF8J 3OJUA 3DHWC
chains in the Genus database with same CATH topology
1BUXA 2VU5A 3VGSA 3FKBA 1HHQA 3R9LA 3NGUA 3Q8UA 1LEOA 1HIYA 1NDKA 2BEFA 1WKLA 3ELHA 4DI6A 3VGTA 4ENOA 3PRVA 3ZTPA 4C6AA 1K44A 3BH7B 1S57A 3EVWA 3Q83A 3MPDA 2DXDA 3DKDA 5C7PA 1S5ZA 2DXEA 2DYAA 3EM1A 1PAEX 1NDLA 3FBFA 1NB2A 1KDNA 1ZS6A 4O0NA 1B99A 5CAAA 3WX8A 3ZTOA 4FKYA 4W98A 4UOGA 2AZ1A 3GP9A 2DXFA 2CWKA 3BBFA 1MN7A 1EHWA 2NCKL 1W7WA 3Q8YA 3FBEA 2HVDA 3VGUA 4ANCA 3FBCA 4CP5A 3G2XA 3JS9A 2B8QA 3BBBA 4WBFA 3ZTRA 1F3FA 1HLWA 2HVEA 3EVOA 3EMTA 3FCWA 2B8PA 1XIQA 3ENAA 3BBCA 4HR2A 4KPCA 1NUEA 2DY9A 3GPAA 4F4AA 5IOLA 1B4SA 1F6TA 1BE4A 1NSQA 3NGSA 1UCNA 1NSPA 4DZ6A 3FCVA 4UOFA 4F36A 1WKKA 3FBBA 1PKUA 5CABA 3Q8VA 3BH6B 3VGVA 2BX6A 1S59A 2ZUAA 3NGRA 5BXIA 4ANDA 1VYAA 3EICA 4DUTA 3VVTA 4S0MA 4EK2A 1NPKA 1NHKL 1NDPA 3EJMA 3EVMA 3PJ9A 3NGTA 2AZ3A 3DDIA 3ZTSA 1NDCA 3L7UA 1NCLA 4ANEA 3Q89A 3ETMA 3Q86A 3B54A 1NSKL 4UOHA 4FKXA 1U8WA 1LWXA 3ZTQA 3B6BA 1MN9A 2HURA 3EE3A 1NLKL 1JXVA 3VVUA 1WKJA 3FC9A 1XQIA 1BHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUX A;  2VU5 A;  3VGS A;  3FKB A;  1HHQ A;  3R9L A;  3NGU A;  3Q8U A;  1LEO A;  1HIY A;  1NDK A;  2BEF A;  1WKL A;  3ELH A;  4DI6 A;  3VGT A;  4ENO A;  3PRV A;  3ZTP A;  4C6A A;  1K44 A;  3BH7 B;  1S57 A;  3EVW A;  3Q83 A;  3MPD A;  2DXD A;  3DKD A;  5C7P A;  1S5Z A;  2DXE A;  2DYA A;  3EM1 A;  1PAE X;  1NDL A;  3FBF A;  1NB2 A;  1KDN A;  1ZS6 A;  4O0N A;  1B99 A;  5CAA A;  3WX8 A;  3ZTO A;  4FKY A;  4W98 A;  4UOG A;  2AZ1 A;  3GP9 A;  2DXF A;  2CWK A;  3BBF A;  1MN7 A;  1EHW A;  2NCK L;  1W7W A;  3Q8Y A;  3FBE A;  2HVD A;  3VGU A;  4ANC A;  3FBC A;  4CP5 A;  3G2X A;  3JS9 A;  2B8Q A;  3BBB A;  4WBF A;  3ZTR A;  1F3F A;  1HLW A;  2HVE A;  3EVO A;  3EMT A;  3FCW A;  2B8P A;  1XIQ A;  3ENA A;  3BBC A;  4HR2 A;  4KPC A;  1NUE A;  2DY9 A;  3GPA A;  4F4A A;  5IOL A;  1B4S A;  1F6T A;  1BE4 A;  1NSQ A;  3NGS A;  1UCN A;  1NSP A;  4DZ6 A;  3FCV A;  4UOF A;  4F36 A;  1WKK A;  3FBB A;  1PKU A;  5CAB A;  3Q8V A;  3BH6 B;  3VGV A;  2BX6 A;  1S59 A;  2ZUA A;  3NGR A;  5BXI A;  4AND A;  1VYA A;  3EIC A;  4DUT A;  3VVT A;  4S0M A;  4EK2 A;  1NPK A;  1NHK L;  1NDP A;  3EJM A;  3EVM A;  3PJ9 A;  3NGT A;  2AZ3 A;  3DDI A;  3ZTS A;  1NDC A;  3L7U A;  1NCL A;  4ANE A;  3Q89 A;  3ETM A;  3Q86 A;  3B54 A;  1NSK L;  4UOH A;  4FKX A;  1U8W A;  1LWX A;  3ZTQ A;  3B6B A;  1MN9 A;  2HUR A;  3EE3 A;  1NLK L;  1JXV A;  3VVU A;  1WKJ A;  3FC9 A;  1XQI A;  1BHN A; 
#chains in the Genus database with same CATH topology
 4BC9 A;  3AXK A;  2F63 A;  2KYX A;  5ETN A;  3CC4 S;  2WVC A;  4C6A A;  1VRT B;  3ULH A;  2I8E A;  4EBC A;  1HBN A;  2R7V A;  4JI4 F;  3HSZ A;  1YJV A;  2E44 A;  4JI2 J;  1B99 A;  2WSE C;  1SKW A;  2RB7 A;  3LUY A;  1CJU A;  1HPZ A;  4IG3 A;  1ICE B;  5K5M A;  5KFU A;  2DT9 A;  1CJT B;  5KG7 A;  1G7C B;  2NYH A;  3OVS A;  1S0M A;  1T7P A;  1CS4 B;  4I1T A;  3NMA A;  2B7B B;  3MPV A;  3M2V A;  4ZIV A;  4M1K A;  2AP6 A;  3KNG A;  2DNO A;  3KLI A;  4QZV B;  5DG9 A;  2HKE A;  4WFZ A;  2V4R A;  4C0B A;  2Q6B A;  2GA7 A;  3TR5 A;  5IWA J;  4F7V A;  5HP1 A;  2Y8Y A;  2DNG A;  1RP5 A;  5K8O A;  3N28 A;  1ZZF A;  2JDJ A;  2WRM A;  2ADB A;  4JI1 J;  4CLL A;  2HHH F;  1JXV A;  2WBM A;  1XWL A;  4QWA A;  2CQ0 A;  5F0W A;  2DPI A;  2VPY B;  1U7L A;  3Q8U A;  3CJ8 A;  1GX5 A;  3I82 A;  5I3Q A;  5J2Q B;  4OZ2 A;  3R7B B;  3DN9 A;  1HQU A;  5JMN A;  2M4M A;  1YKW A;  2N7Y A;  3PO4 A;  3QT7 A;  1WWH A;  3M2U B;  4ALZ A;  3F56 A;  1SH2 A;  3SCL E;  4LVN P;  3RB6 A;  3K5M A;  3NBP B;  1X60 A;  2OP5 A;  1GFW B;  2H51 B;  3LWL A;  2EEY A;  3G96 A;  3M6V A;  2MST A;  1IKX B;  4Y00 A;  3CJK A;  2GHV C;  2W2M P;  1YBA A;  1WC4 A;  1C4A A;  2C2M B;  2ASY A;  2IBO A;  2MLZ A;  1UJ5 A;  2HMI A;  2M7S A;  3A3P B;  2ZKU A;  3JXO A;  5HAO A;  3K89 A;  5C25 A;  2YVS A;  3DDK A;  2D7S A;  1X7V A;  2GGP B;  1KLN A;  1RA7 A;  2HHU A;  4DFM A;  3MPU B;  4JI6 J;  2BJ8 A;  3IG1 B;  3KLE B;  3R6G B;  4BHQ A;  3I5B A;  1U02 A;  4GMK A;  4NPO A;  1XMO J;  2HGL A;  3BEG B;  5MAO A;  3LAL A;  3CIM A;  2I5J B;  3D67 A;  4EUV A;  1NB7 A;  1HWL A;  3PR4 A;  2AX1 A;  2DYA A;  4DN9 A;  1EP4 B;  1SH3 A;  4DR2 F;  4DV4 F;  3LAN A;  4M5D B;  3DRY A;  4U8Y A;  2KKH A;  3C6U B;  2CWK A;  4P7T A;  4PWW A;  2H9Z A;  4NYP A;  2C3U A;  1R31 A;  2M70 A;  4A4J A;  2ZH4 A;  2ATL A;  4DV6 J;  1V3S A;  1RTZ A;  2ROE A;  1WG1 A;  1VBY A;  3W5X A;  2UU9 F;  3H98 A;  5C24 B;  1YJ7 A;  1JJC B;  2IDL A;  3M6W A;  1FO1 A;  1X5O A;  4HKQ A;  1JLG B;  2AYB A;  4RBU A;  2F4V J;  1EX8 A;  1HBM B;  1RT3 A;  3PXG a;  1VK3 A;  4BC7 A;  3RG6 A;  4DR6 F;  3KMQ A;  3U02 A;  2E29 A;  2C28 A;  2W4P A;  4FF3 A;  3J7Z T;  2ZHB A;  4X64 J;  4DPW A;  1TKX A;  1TAQ A;  4O23 A;  2VAS A;  5JVH Q;  1GNK A;  5FJ4 A;  2L48 A;  1WOS A;  3J7Y I;  2UXC F;  2QEX S;  2F40 A;  3SCI E;  2MTL A;  2IYI A;  4R5P B;  4Y2C A;  3LF0 A;  3GIM A;  2N3O A;  2DH7 A;  3H5U A;  3TJ8 A;  4GVB B;  4X4R A;  3HFV A;  1HNX F;  4HAC B;  4N41 A;  2WOM B;  1U2R A;  1IJE B;  1HLW A;  1QTM A;  5K14 B;  3UR3 C;  3T19 A;  3MFH A;  1EQ0 A;  3UN2 A;  3P8B B;  3GPA A;  3QNW B;  2BJE A;  3ISN C;  2VJV A;  3NGS A;  1B3T A;  2ILZ A;  4DFP A;  4DPU A;  2FY8 A;  1NKC A;  3W66 A;  2Q6C A;  1VYA A;  4ILL A;  1KD1 T;  3GYN A;  4IQM A;  2BKP A;  3CJT A;  5C5J A;  3BM7 A;  3PRD A;  1S1T A;  2DNH A;  5B0C A;  2XC9 A;  1XMQ J;  2V94 A;  1RJJ A;  3E01 B;  3W5Z A;  5LXR A;  3HD1 A;  2YXL A;  1SIW B;  3HVW A;  4P2M A;  1H38 A;  4OYA A;  2QMU B;  1WI6 A;  2GO9 A;  2JSX A;  3GQC A;  1VQ6 S;  1FDN A;  5CH7 B;  3J7A 1;  5A2Q Y;  2OEK A;  2F4F A;  2FHO B;  1CUL A;  3NWR A;  1NH8 A;  3GR0 A;  2DIT A;  3H5Y A;  3NOG A;  3P5T L;  3T3F A;  2LFV A;  4C9D A;  4TY8 B;  3R1L A;  3CCE S;  2HSE B;  1JLC B;  2C3M A;  4OL8 A;  4TNO A;  2QLX A;  2UUA J;  2Z2L A;  3DU6 A;  5B0B A;  2LKZ A;  1FKO A;  4CRJ A;  4RX6 A;  2V5H G;  2HRU A;  4KKO B;  3W62 A;  1JLF B;  4YB7 A;  5D0G A;  2ZZN A;  2HEK A;  2O5D A;  4QJV A;  3PIO Q;  4DR7 F;  4DPY A;  1WTF A;  4RW9 B;  4ZLL A;  1Y5N B;  1T0T V;  2DK2 A;  3VZH A;  1U48 A;  3BH6 B;  1RBL A;  2W9C B;  1PO6 A;  3TVY A;  1PGZ A;  2H5J B;  1IQT A;  4NEY A;  1AW0 A;  2BOA A;  2VV5 A;  4UY8 5;  3TAM B;  1QE1 B;  2QYG A;  1JQG A;  1KHV A;  2WW8 A;  4DV2 F;  7AT1 B;  3B6B A;  2G0I A;  2OO4 A;  2LXF A;  1VIS A;  2VU5 A;  4KC5 A;  3IRX A;  1VQL S;  5L9X A;  4YME A;  4Y34 A;  1TFW A;  4HT5 A;  2MQP A;  1QAI A;  1WEY A;  1LXJ A;  4LQ9 A;  3GSI A;  3LPE A;  4UT4 A;  1FFG B;  2G2Y A;  3GIR A;  2NUH A;  5ETM A;  1HBU A;  3N5B A;  4TQR A;  3PYG A;  2HQ3 A;  3IGN A;  5GAH I;  2LQJ A;  4Q8F A;  1BQN B;  1Q81 T;  1C4C A;  2ZH1 A;  5IOL A;  1VBX A;  1JX4 A;  2HNY A;  4EWT A;  4OX6 A;  2B4U A;  3PX4 A;  2QRR A;  3L9Z A;  3VGV A;  4E2F B;  3DOL B;  3S01 A;  3CC7 S;  2I2Y A;  1TKT A;  3D28 A;  3L95 X;  1XER A;  2HND A;  4OJH A;  3PJ9 A;  4A47 A;  2QMX A;  5ETP A;  1BWE A;  3H25 A;  1F9H A;  2FZG B;  2AD9 A;  2FLP A;  2FVS A;  2NSC A;  3Q89 A;  3ETM A;  4EBE A;  3AD8 C;  2AQ4 A;  4M5J A;  5IC4 B;  2X1G A;  2MKS A;  1U0H A;  4KJI A;  4ZJL A;  1NAQ A;  3T5L A;  4OZ5 A;  1E6Y A;  4RU9 A;  3HF5 A;  2F7V A;  2VQF J;  4O3R A;  4OI1 A;  3LH2 S;  1MML A;  1FKP A;  5KFH A;  4C48 A;  2GO8 A;  3DLG A;  4LMZ A;  3Q24 A;  1N36 J;  4DR5 J;  2HQG A;  4NLU A;  2MMY A;  4KT0 C;  2J0S D;  3KK1 A;  5A2Q U;  1RZM A;  2HHW A;  1RA6 A;  1HQE B;  5K8P A;  3BN4 A;  2IVY A;  5HQ8 A;  1DAX A;  1KBR A;  2KI2 A;  4PG6 A;  4RUA A;  4J9P A;  3SYZ A;  2E5H A;  2BJD A;  2PMH A;  3OFG A;  3HVA A;  4LF9 J;  2ZH9 A;  1OPI A;  1YWX A;  2AEJ A;  3KG4 A;  1SCJ B;  4RW6 A;  5A8W A;  2RRA A;  4WKY A;  1KOO A;  4LJM A;  3KJF B;  1XTZ A;  4X66 F;  2RH3 A;  3D0H E;  2JH3 A;  5DGA A;  4JI3 F;  5D3G B;  3K7R A;  3BV8 A;  1RAI B;  4JI8 F;  2C2N A;  1VLO A;  2XZW A;  1VBK A;  3QIP A;  1KWM A;  1NKE A;  3NS6 A;  4DF8 A;  2PD1 A;  1DQ9 A;  5J1P A;  1Y3J A;  1S10 A;  1WC6 A;  4ED3 A;  5CA5 A;  3KTQ A;  3IR5 B;  1H6K X;  2F9D A;  1H7X A;  2AKW B;  5GMK a;  2WVD A;  3DDN A;  3AH6 A;  4PRF A;  1MMN A;  3CD0 A;  4QIG A;  4EI2 A;  5CD4 H;  3S1T A;  2QV6 A;  4K4V A;  1WF2 A;  2DY9 A;  4NEZ A;  1B4S A;  3ET6 A;  3WC2 A;  2XGP A;  2A18 A;  5J1E B;  3NRB A;  3LGN A;  1RTH B;  1WDD A;  5KFQ A;  4A8S A;  1YI2 S;  3AD7 C;  3MGJ A;  1VHI A;  2JLF A;  3W64 A;  2FTR A;  1FRM A;  2J9D A;  4YB1 P;  4ZP7 A;  3LP1 A;  5KFN A;  1FT8 A;  3J81 j;  2V8V A;  4EZ6 A;  1F1B B;  2DB1 A;  3EXY A;  2MKI A;  3CCZ A;  4XK8 C;  4ZCL A;  3CCT A;  5HL7 Q;  2Z2M A;  1WKJ A;  2V50 A;  3PY8 A;  3IR6 B;  2AJ1 A;  2GIF A;  5DDQ C;  2HRY A;  2K1R B;  2P2C B;  1K44 A;  2HVI A;  3IS9 A;  3PHE A;  4PG4 A;  5KFC A;  4F0K A;  1SPB P;  2V8P A;  4YOE A;  1RE1 B;  2JL9 A;  1HA1 A;  2GML A;  4QIW D;  3KFW X;  3TAP A;  5FII A;  3GP9 A;  3TJ9 A;  2HAF A;  2QSF A;  2WB1 D;  4CNY A;  4B3S F;  3VGU A;  2VFU A;  4QU7 A;  2GVD B;  4RNH A;  4OZJ A;  4ECX A;  3JYT B;  3SCJ E;  4A8K A;  1TFY A;  3ENA A;  3MUV P;  1URR A;  2JEI A;  1FNX H;  4RNO A;  1TL7 A;  4QYZ J;  1IUJ A;  2XLI A;  4PG5 A;  3ISZ A;  4L73 A;  3SSQ A;  4R0J A;  5DO2 A;  3DMJ B;  3HCX A;  2YQ1 A;  3M8S A;  2XLK A;  4NLY A;  4L76 A;  3C6T B;  3IXQ A;  5KFA A;  1SH0 A;  1H2U X;  2CQD A;  1ZPV A;  2XWY A;  1N6Q A;  2QLW A;  4HH1 A;  3K58 A;  3QID A;  1VC0 A;  2PFD A;  4WK3 A;  1KSP A;  4JUZ A;  2CVI A;  5HVH A;  3R9L A;  2MQQ A;  5AXN A;  4LBI A;  2CQ4 A;  2D3U A;  3GE9 A;  4ETX A;  4F50 A;  3SFU A;  3R5G A;  2MGZ A;  4LVO P;  3FEX B;  2KDO A;  3GG0 A;  4WP9 A;  2D69 A;  2H3E B;  4TU7 A;  4I7F A;  3SV4 A;  4ERD A;  3PW7 A;  4W98 A;  2ZM6 J;  4NLO A;  4WFA Q;  4EO6 A;  3KKF A;  1NJY A;  3OBI A;  2XMK A;  4DUZ J;  4KB7 A;  3KLH A;  2YKN A;  3I9V 9;  3PCO B;  2HWT A;  3CDB A;  3IA0 A;  2EFG A;  1HNZ J;  1GK8 A;  5E3C A;  4EO8 A;  1S77 D;  4JBC A;  4P52 A;  3UR0 A;  1F5A A;  2VFS A;  5AJ3 J;  4NWB A;  2DHA A;  3CDU A;  3OJS A;  3GFY A;  3BPD A;  1S1X A;  4U7U D;  1YJT A;  1F2H A;  2LLZ A;  1QSL A;  2F3J A;  3N79 A;  4WE1 A;  2AT1 B;  4AQY F;  2FJD B;  1BGX T;  1VC5 A;  3EGZ A;  1DBD A;  1D9F A;  4ELT A;  1CJV B;  1ZM9 A;  5E5N A;  4BWM A;  1D09 B;  1D9A A;  1VQS A;  3GCX P;  1N34 J;  2OML A;  5F8G A;  4M5H A;  1ELO A;  2LA4 A;  2P9E A;  3HI9 A;  4CO3 A;  2KU7 A;  3HX9 A;  1Q5Y A;  5KFY A;  3OTO F;  2VDI A;  4ECT A;  4O4G A;  4CLP A;  4NYO A;  3MEE B;  2BXJ A;  3PKM A;  2MZQ A;  4NCG A;  2EC2 A;  1NJI T;  3OT9 A;  2QIF A;  2WVE A;  1RWX B;  3IWL A;  1RLC L;  4EEY A;  2MY7 A;  1HD1 A;  4JYA J;  4CIO A;  3UFC X;  3QT5 A;  3TP2 A;  3UD5 A;  2G4B A;  3AJ2 A;  4WCE Q;  1IN0 A;  4R25 A;  2DR6 A;  3KLF A;  4OJ1 A;  1Q5V A;  2XMV A;  3TNV A;  2YX4 A;  2BQU A;  2CQP A;  4C3L A;  1MLA A;  1W2I A;  4V19 X;  2VA3 A;  4Q44 A;  3MM7 A;  5SUH A;  3DOM B;  2ZH2 A;  4HHU A;  3A8E A;  2YKM B;  2NQP A;  4IDK B;  2R2S A;  1SKU B;  2YQ0 A;  1S1V A;  4I0W A;  4N56 A;  1I94 F;  1RTI A;  1N0V C;  4J37 A;  3VCD A;  1XR7 A;  2CPF A;  3I87 A;  3SQG A;  1UVI A;  4XDC A;  2DNP A;  4DUY J;  1FJC A;  2E1P A;  1L3T A;  1NUE A;  4ZDN A;  4UOF A;  5B09 A;  5BXI A;  1XNR J;  1TAU A;  3QGH A;  4C8Y A;  3A12 A;  4O3S A;  3X3U A;  3M30 A;  2NPF A;  1UEU A;  2KVI A;  1TP7 A;  5EDW A;  1UET A;  4RUH A;  1H98 A;  3DYA B;  1BQM A;  1JJH A;  1MN9 A;  2DHX A;  2W4D A;  4K4T A;  4MKY A;  2SXL A;  4NRT A;  4P10 A;  4FBU A;  3BGO P;  5LMU F;  4UQG A;  3FGV A;  3EZ5 A;  1C0U A;  2YBV A;  1GTE A;  3QJJ A;  2W9B A;  4PYA A;  1S9G B;  1QM9 A;  4USJ C;  1DFD A;  2F9J A;  1KC8 T;  4Z7Y A;  3GJQ B;  3H4B A;  3VAJ A;  3V6D A;  4IQX A;  4USV A;  1FDD A;  3Q8Y A;  4ZHR A;  2UUW A;  3DFE A;  3TA2 A;  2LYV A;  1HL6 A;  3S8S A;  1N54 B;  2HFS A;  1AXQ A;  1RTD A;  3PVX A;  2CPY A;  3DC2 A;  1FFW B;  1BMQ B;  2DIS A;  4DQP A;  2G0C A;  2BJ9 A;  5B08 A;  1RT7 A;  1O5J A;  2DNR A;  1RWW B;  4JI7 J;  2KJV A;  3MCS A;  3NGD A;  2MZR A;  2J9C A;  4JI0 J;  1TMJ A;  2V2K A;  2XTJ P;  3NCP A;  4PQU A;  1U6Z A;  1T9X A;  4F4K A;  2ZVI A;  1YX2 A;  3P4U B;  2ZBI A;  3CCV S;  4F3M A;  3THV A;  1F9F A;  3M9O B;  3M8P B;  4ID5 A;  3TZX A;  2R2R A;  1TK0 A;  5LOQ A;  1ZET A;  2QFI A;  3UVJ B;  1AFI A;  2BW2 A;  4MKA A;  4KHM A;  5KOW A;  3MPD A;  4IG0 A;  2DXD A;  4DV0 F;  1S5Z A;  1SV5 A;  2KFY A;  3D66 A;  3G8T A;  1FVQ A;  3CDW A;  4ZVH A;  3TUI C;  4J9Q A;  2RUG A;  4OI3 A;  1ZPW X;  2DCU B;  5A8R B;  2BAN B;  3DOK B;  1JLE A;  4QYZ K;  4TLQ A;  4ED2 A;  2X1B A;  5K8N A;  3CB4 A;  4DPO A;  3V2U C;  3G82 A;  3ITH A;  3I31 A;  1GEH A;  2DEI A;  4FYV B;  1UWB B;  3PX6 A;  3C46 A;  3LQV A;  3ILJ A;  4CH1 A;  2FC8 A;  1QAX A;  1M0S A;  1ZBT A;  5T7L A;  4J7C A;  4ES1 A;  2XSJ B;  4X4P A;  1HW8 A;  4CM2 A;  2CQC A;  5GMD A;  1TV6 A;  4KO0 B;  1S12 A;  2B4V A;  2UVV A;  3IMQ J;  4CTA B;  4CLT A;  1UL3 A;  3B82 A;  4GKJ J;  4YHH F;  3SDE A;  3A8J A;  4RKU C;  1QSS A;  1FFS B;  2CAD A;  4BLG A;  2H65 B;  4LF8 F;  5IQQ A;  3ZC4 A;  2VPW B;  2BAB A;  4FVM A;  2C1E B;  2UXB J;  3R5D A;  5L38 A;  1S9E A;  3HPO A;  3W3S A;  2UV8 G;  1CLF A;  4IH7 A;  4G1I A;  4JI2 F;  2PII A;  2YKO A;  2FJX A;  3O6Q A;  2CG8 A;  3C2P A;  1KEK A;  1RWO B;  2R2T A;  1FXD A;  5EWE A;  2ZH5 A;  1U4B A;  2BYC A;  1S76 D;  1CG2 A;  3RB4 A;  4DWI A;  1RAF B;  4KY3 A;  3VAH A;  3EYZ A;  1KOH A;  1CS4 A;  2P6S A;  4EZ9 A;  4F36 A;  1C1B B;  1ARO P;  1LFP A;  2OPS A;  1H2T Z;  2JEF A;  4I2Q A;  3BPS P;  3OL9 A;  3BRE A;  3TQE A;  1I6J A;  4C2M A;  2XZD B;  3NG8 A;  3B8H A;  2ALZ A;  1ZM2 A;  4ZVU B;  4GKK J;  4X4S A;  1LWX A;  4I4B A;  3V6H A;  2LQB A;  3J81 U;  5KT7 A;  1G6B A;  4JI1 F;  1PCA A;  3I96 A;  5IC6 B;  2OSR A;  1T03 B;  1REV B;  2BA9 A;  2IC3 B;  3C14 A;  4FXW A;  2VFR A;  2FC9 A;  1RHU B;  1RQ0 A;  4DV7 J;  3KOA A;  5HAN A;  4KPY A;  2ZUG A;  5J2Q A;  1N32 J;  1ZTW A;  4LF5 F;  2EK6 A;  2NXJ A;  4QW9 A;  2BKN A;  2JWN A;  4M8L A;  1WHW A;  3KLG B;  2IFX A;  1OY9 A;  4TYB A;  1SIZ A;  4QPT A;  3RBD A;  4OI6 A;  1RXO B;  3EMT A;  3JQM A;  4I2P A;  3HDS A;  2B5J B;  2E7V A;  1RUS A;  3DGV A;  1TMM A;  2J0W A;  4P74 A;  4M5M A;  3GFX A;  4X4U A;  4E8U A;  1J5E F;  3GTY X;  4LSN B;  3K0J A;  3AJ1 A;  2MKH A;  5C42 A;  2KZM A;  4IR1 A;  4JI6 F;  1UEK A;  3TA0 A;  2VQE F;  2VG5 A;  2BRK A;  3KLE A;  1HWU A;  5E0O A;  4QWB A;  1Y3K A;  2QMW A;  3RZA A;  1S6P B;  3V4M A;  4M5N A;  1R8A A;  2JC1 A;  5IV3 A;  1XMO F;  1YHQ S;  1U1O A;  3GCW P;  4C7Q A;  4LF4 J;  1OMS A;  3VF0 B;  3FSI A;  4DV1 J;  1IXK A;  1H3D A;  1QDU B;  5FD1 A;  4NLQ A;  2OJ3 A;  4I68 A;  4M5D A;  2FHK A;  2B56 A;  1H73 A;  1YG0 A;  1M90 T;  3MOZ A;  5E3P A;  3KJN B;  2NXN A;  1KNZ A;  3CSK A;  1JXE A;  4URG A;  2Z58 B;  2ZDO A;  3GIK A;  1UA1 A;  4G1P A;  2COL A;  1GMW D;  5C24 A;  1AZS A;  2BE2 B;  4ZVO B;  4M5I A;  1JLG A;  2B6A B;  4IFY B;  2FJW A;  2F4V F;  4ID8 A;  1HBM A;  2VFT A;  1PYT A;  1X4H A;  1VQ7 S;  4F2S A;  3W9H A;  1N5Y B;  1FRK A;  3IM9 A;  5L39 A;  3QWP A;  4PG8 A;  5HO4 A;  4KAI A;  4X64 F;  4NZ6 A;  4WP8 A;  5AXL A;  1TKZ B;  4USI A;  3UDC A;  3HHK A;  1QAY A;  2W7P A;  3JQJ A;  2AF6 A;  2J9D E;  3MUM P;  3FEY B;  2NRE A;  5CYQ B;  3MM9 B;  1IR1 A;  3BH7 B;  2QO3 A;  4ECY A;  4R5P A;  1ZAV A;  4ZP6 A;  3R2C J;  2HHS A;  1F2G A;  4ED8 A;  2FJA B;  5EWG A;  4EFA C;  2V0N A;  4GVB A;  1WF1 A;  4LFB J;  5T41 A;  1O6X A;  4O3N A;  2ZH6 A;  2WOM A;  2AMC B;  2VZ9 A;  3R3T A;  4QPX A;  4HLB A;  5K14 A;  3QQC D;  1IKY B;  4DR4 J;  3M8Y A;  2DY1 A;  3GIJ A;  2O66 A;  2ZWO A;  1Y4Z B;  3FCV A;  1RWU A;  4NYZ A;  2UXD J;  3MD1 A;  2JHE A;  3J80 Y;  2EKY A;  4S0M A;  1NDP A;  2BE9 B;  5A8K B;  5KFE A;  2QL7 B;  4DS5 A;  2DH9 A;  3E51 A;  3L7U A;  2PC6 A;  4AD6 A;  4U7U K;  2C2Z B;  1U1Q A;  1XMQ F;  3E01 A;  3JB9 k;  2HBQ B;  1TL3 B;  1PJ5 A;  2B0G A;  3RB0 A;  3IFE A;  5HMW A;  1KHW A;  3MDF A;  2RNE A;  4X4T A;  2DNQ A;  4LSL A;  4MTP A;  1IBM J;  2ZOF A;  2RQ4 A;  1Q95 G;  3MM8 B;  2M5Y A;  1NEE A;  3DRP A;  2JX2 A;  3D7S B;  2FZC B;  1JLC A;  5AXK A;  2UUA F;  4UOG A;  4I67 A;  5E2Q A;  1SUQ A;  3RBE A;  4WBF A;  4KKO A;  2HZV A;  3TEG A;  3SMZ A;  3NMR A;  2OPR B;  3DI6 B;  3F0N A;  1DTQ B;  3W8P A;  3KXD A;  4RW9 A;  3I6P A;  1ZM4 A;  4N8N A;  1PYO B;  3M1V A;  2YNH A;  1X5S A;  2ZZT A;  2ZFH A;  5DM7 Q;  3CJR A;  4B3R J;  3LGH A;  2W1B A;  2M9K A;  3SQO P;  4RNF A;  3B78 A;  3PYE A;  3D6F B;  1V6H A;  1QE1 A;  4PYD A;  2AWZ A;  4MIW A;  2YNF B;  5E3A A;  2JEJ A;  3OD2 A;  3I4P A;  1XQI A;  3N6N A;  1NRK A;  2B43 A;  1S6Q B;  1U26 A;  2YKP A;  2O1P A;  4X65 J;  3OR2 B;  4RNM A;  2B9W A;  4B9M A;  4CZC A;  1FDB A;  1VRU A;  1NZA A;  4DBQ A;  2OPP A;  1WG4 A;  4F67 A;  4USU A;  3I55 S;  2PGC A;  3R7N B;  3T5H A;  2AJ2 A;  4MK7 A;  3KK3 B;  4ICL A;  4CQ1 A;  4J9L A;  4YUD A;  4ECS A;  3G8Q A;  2L9N A;  4A8M P;  1BQN A;  2ZNY A;  3QRR A;  3ICL A;  4OMF G;  3FZB A;  1IM4 A;  4IOB A;  2LU1 A;  5HN0 A;  3HT0 A;  5F41 A;  2EWH A;  4IKA A;  1VQY A;  3QO9 B;  3TEH B;  5ETV A;  1N88 A;  3D6H B;  3M05 A;  1OSC A;  5IV4 A;  2GJI A;  2PT0 A;  1YZ7 A;  5IT9 U;  4WK1 A;  2Z2Z A;  5CCL A;  4DSK A;  4P2F A;  1P1T A;  3OFH A;  2A6O A;  1IKW B;  3OL7 A;  1Q53 A;  3P45 B;  3JTN A;  1EET A;  3OQ2 A;  2DH8 A;  3KHH A;  3QSY B;  1ZTT A;  1N36 F;  5L1L A;  4DR5 F;  3V6J A;  4B3O B;  2HFV A;  2MKJ A;  5LMN J;  3IWX A;  3VAL A;  1J2V A;  1QVF R;  1P27 B;  1HQE A;  3OXF A;  4LF6 J;  1HR0 J;  1BWV A;  4LF2 A;  4NA3 A;  2RIL A;  1J5O B;  2Y1J A;  1YDL A;  2V63 A;  3CCJ S;  2XHC A;  3MR3 A;  2YX7 A;  4ZKA A;  3HHE A;  3SFG A;  5IM0 B;  2OHD A;  4RW7 B;  3OL8 A;  4LF9 F;  2XB2 D;  3IAS 9;  4ED5 A;  4PXD A;  4ILR A;  3EJM A;  2HS3 A;  2ZH8 A;  1WEZ A;  2ASL A;  3C16 A;  2Q79 A;  3CNQ P;  4NA1 A;  2V8G A;  4KV8 A;  2LEA A;  3DGP B;  3KJV B;  2IMW P;  3MMB B;  1T94 A;  4UZB A;  3QZ7 A;  2RQM A;  4HHJ A;  2G2Z A;  2CPJ A;  1RAB B;  4OX8 A;  1BUX A;  2JRS A;  2VBX A;  1RAG B;  2X3D A;  2N4C A;  5A0Y A;  2PO4 A;  4J5O A;  1HWK A;  2BAC A;  1DLO A;  3V4I B;  2DGQ A;  4PQA A;  3PEH A;  2ROP A;  4YR0 A;  5I42 B;  2RRB A;  3IM8 A;  2CPX A;  1O8B A;  2OGU A;  2MQL A;  3CGI A;  2KRR A;  1B7F A;  3M9N B;  2R9L A;  2D41 A;  2CIM A;  2ZNZ A;  5DLG A;  3LWM A;  2ZBC A;  3CD5 A;  5HJY A;  1B64 A;  3G71 S;  4BWJ A;  4RWX A;  2CJQ A;  2OPQ A;  1Q7Y T;  4C0H A;  3UCU P;  1MU2 A;  1TTH B;  4NCB A;  3MMC A;  3PX0 A;  4FBT A;  3MM6 A;  2OH2 A;  2DGO A;  5K9F A;  3UPF A;  3UDE A;  2R7W A;  4O44 B;  3PW5 A;  2KN4 A;  2Y1L B;  4ZLP A;  3QSI A;  4G1Q A;  3RR7 A;  2WAQ D;  5L1I A;  3K5O A;  4PWD B;  5THW A;  1C1C B;  3D1Q A;  3MUT P;  1LWE A;  4WFB Q;  2XYP B;  3D6M B;  4MAK A;  1F3V A;  4ZPB A;  1GTH A;  1SL1 A;  4ZLN A;  3C15 A;  4I6Y A;  1KLM B;  3NLC A;  4OI4 A;  2HLT A;  1PBU A;  5B0E A;  1KFS A;  5M2R A;  3MOJ B;  1AFJ A;  1SJF A;  2IJR A;  1TK8 A;  2DIV A;  2DXF A;  1QVG R;  2VG7 B;  2UVR A;  2FQQ B;  2ZWP A;  1SJ4 P;  3PW2 A;  1FE4 A;  1T3N A;  2QLF B;  4JB8 B;  2R42 A;  1S99 A;  1S4E A;  3BGL A;  2DNK A;  2QL5 B;  3MUR P;  5AE3 A;  4LBH A;  4P71 A;  1QY7 A;  1KON A;  3MZI A;  5DQH A;  3EIC A;  2CPD A;  3P49 B;  4A46 A;  2IJF A;  4DSL A;  1RT5 A;  4PG7 A;  3KMS A;  2HHX A;  1P9Q C;  4ECU A;  5LM7 E;  3C6T A;  3THT A;  1BC6 A;  3W9I A;  3TZY A;  2EC0 A;  4ZMM A;  4RW8 A;  1URN A;  1RAO A;  1YK9 A;  3ZTQ A;  2ACM A;  2J5A A;  4ZPA A;  1RYS A;  4KGM A;  1HI0 P;  1SC3 B;  1RAD B;  2K3K A;  4CYU B;  4NXM J;  4DF4 A;  3W2V A;  1FJE B;  4HVZ A;  2L41 A;  2EK1 A;  4K4W A;  1J27 A;  4MYT A;  4RJV A;  3A4T A;  2OAU A;  4F4Z A;  2EG2 A;  3A8I A;  3UQS A;  1FXR A;  2BQ3 A;  4AL5 A;  2R8I A;  1GQE A;  3ZTO A;  1WTB A;  2OTJ S;  2GJF A;  3DRS A;  2CNN B;  2ZBR A;  2ZM6 F;  1HBN B;  1RAA B;  2M88 A;  4JI4 J;  2C2D A;  4OZ1 A;  2FIU A;  3GFH A;  4M5L A;  3T1H J;  2CNK B;  1CJU B;  1S6U A;  3OL6 A;  3AB2 B;  1NKB A;  4ZPW R;  4IG3 B;  1HNZ F;  2I9S A;  2YNG B;  1NK5 A;  1N33 J;  1DQ8 A;  2XHW A;  2RU9 A;  3GU0 A;  5AJ3 F;  1NK7 A;  4U8V A;  5DQG A;  2KJW A;  3HUL A;  4LRE A;  3PG9 A;  3KLI B;  1FRJ A;  1EQM A;  5JVG Q;  3QAE A;  4FNI A;  2UP1 A;  2CQB A;  2L3M A;  1G4C A;  2XMA A;  2CYY A;  4RU2 A;  1N34 F;  3NXZ A;  2HS0 A;  4B9S A;  2VBY A;  1XK8 A;  1T3O A;  1S1U A;  2L08 A;  2MQM A;  5D8H B;  4ZJO A;  3FDS A;  1XN9 A;  2K7K A;  2DPJ A;  1RKI A;  4MK9 A;  1D0E A;  3BBB A;  2R2U A;  2D1C A;  1VQ4 S;  3U27 A;  4YDD B;  2IA0 A;  4M63 A;  4EYI B;  3R5C A;  1VJQ A;  4IRK A;  2DHS A;  4JYA F;  2AEF A;  1X4G A;  3CJK B;  3BO3 A;  1LWC B;  1NO8 A;  3IC1 A;  4O3O A;  1RT1 A;  4WYL A;  4WZQ A;  1MW7 A;  5DM6 Q;  2DCL A;  3PEJ A;  4W92 B;  2FGO A;  2HBY B;  3S7R A;  5C25 B;  1YJR A;  5E33 A;  5F8N A;  4ZN1 A;  1F0X A;  2DRD A;  1D9D A;  1S7H A;  5F9L A;  1HYS A;  3PTW A;  2V4Q A;  2YH1 A;  2BUN A;  4LRA A;  3BR9 A;  2D9O A;  2YKM A;  4B3T J;  4IDK A;  2Z56 B;  1HWJ A;  1Y00 A;  1RAC B;  2C2K B;  2JZ5 A;  2RDI A;  3FBE A;  3MTK A;  4PXC A;  1Q8L A;  2J6T A;  1R43 A;  1Z2Z A;  3KNA A;  2MZS A;  2QGF B;  5ETK A;  3NAH A;  3H20 A;  3RGI A;  3LAK A;  3UD4 P;  2A3J A;  5KT5 A;  4X4V A;  4B17 A;  4DR1 J;  5CAB A;  2BZ2 A;  1KVK A;  1XNR F;  1JNR B;  4NLX A;  4CLY A;  2H5I B;  4RZR A;  1KRP A;  2PFF B;  3H40 A;  4NLV A;  3CO9 A;  4R8U A;  3VAK A;  2DD8 S;  5BR8 J;  4ZN3 A;  1Y5I B;  3DYA A;  2HQC A;  3NEK A;  2IBK A;  1Y10 A;  2YWH A;  1A7G E;  1D8Z A;  1GAO A;  5KFX A;  3TJA A;  2C2O B;  3VAI A;  3HSG A;  3EPG A;  2J8A A;  2L9W A;  4OYZ A;  3PNI A;  2VHG A;  4ECR A;  2E7W A;  3A8K A;  4WXW A;  2YWW A;  2EVZ A;  2C3Y A;  3CVK A;  2DJW A;  3MEC B;  3QFW A;  1S9F A;  3NWG A;  2UXC J;  1EB0 A;  3BKU A;  3TX0 A;  2RQC A;  1SB6 A;  2CPE A;  2QJ3 A;  2OD6 A;  4XIU A;  1UJ4 A;  5CXT A;  2C2R A;  2XS2 A;  5SZT A;  1JLB A;  2DIU A;  3FCH A;  2KTQ A;  2AGQ A;  4JI5 F;  3QMQ A;  3QGG A;  1U6B A;  3PR5 B;  2NXC A;  1FJ7 A;  3DU5 A;  1YRX A;  3NGT A;  3M6U A;  3RU0 A;  4KBI A;  5DDP C;  3NNH A;  4JI7 F;  3KLV A;  1SQG A;  4JI0 F;  4NI2 B;  3D6T B;  3JSM A;  1UKU A;  2WW4 A;  1KQK A;  3PFE A;  3FK4 A;  1U1R A;  1L5U A;  2GQQ A;  3MF5 A;  1S1T B;  4DL6 A;  4HT7 A;  1WKL A;  3PAC A;  2WSC C;  4CO4 A;  3SCK E;  3ZZ0 A;  4UST A;  3UVJ A;  2ILY A;  1REG X;  7FDR A;  4LF7 F;  3ZNJ 1;  1IM6 A;  1GXU A;  2DHH A;  3PV8 A;  1JKH A;  4TN2 A;  1OY8 A;  4J9K A;  1K1Q A;  2WCX A;  4G3I A;  3BQ2 A;  4QWE A;  2E66 A;  4WXO A;  3FCW A;  2Z30 B;  2BAN A;  2IMO A;  4RPF A;  4H4O B;  1FKO B;  3L7P A;  2JVR A;  3WC0 A;  2HWI A;  2VD3 A;  1VIX A;  2FZK B;  2BX6 A;  3W61 A;  3CD7 A;  5D0R A;  1VS3 A;  2HFZ A;  1UWB A;  4DUT A;  1NHK L;  3DLE A;  4NMX A;  2HFN A;  2DRB A;  4J9O A;  3TWZ A;  4X2B A;  4KGK A;  4TU9 A;  3LP2 A;  5EGY A;  3NS5 A;  4KO0 A;  2CPH A;  3GJT B;  4KH0 B;  3CCR S;  5HVG A;  3KHG A;  1O0P A;  4GKJ F;  3OTD A;  3OTE A;  1JNZ B;  5KFJ A;  3HD2 A;  4F3O A;  1WHV A;  1T8E A;  2OFH X;  1EAY C;  2OUG A;  1KTQ A;  1HIY A;  4NE9 C;  2YWK A;  2YNI A;  1UEV A;  3CMQ A;  1FRH A;  2XYH B;  3W2W A;  1NJX A;  5C7P A;  2KT3 A;  2KHC A;  2UXB F;  3FBF A;  2XMJ A;  4KSE B;  3IRX B;  5C2C A;  3BQ0 A;  3FSY A;  3WX8 A;  2KL8 A;  4L75 A;  4ZVE A;  1PIL A;  2ASD A;  4LIW A;  4OHW A;  3G86 A;  2HLU A;  2LCW A;  4HL9 A;  3AY0 A;  5KT6 A;  1VJW A;  2BJ1 A;  2B9E A;  5K8M A;  5KT4 A;  1HBU B;  2R7T A;  1Y5L B;  3FUY A;  1HNW J;  3HJF A;  8ATC B;  3DM2 A;  1SJR A;  1G2E A;  1G1X A;  2NUU G;  4L6V 3;  2AJ0 A;  4O0I A;  4ZVS B;  1EZZ B;  2JNJ A;  5KFG A;  5KFB A;  2HZA A;  2MYF A;  2GIR A;  3N6M A;  1KR4 A;  1TKT B;  3FRY A;  4PR6 A;  4HI1 A;  1SL2 A;  4ZVF A;  2CDR B;  4FP9 A;  1REV A;  3JAM U;  1T9Y A;  4DX6 A;  4DV7 F;  2E5G A;  4K4S A;  2K8G A;  3DKD A;  2DXE A;  2HHP A;  3R97 A;  3AQP A;  3CW2 C;  4FKY A;  2BBE A;  1RCX B;  3FEZ A;  2JEG A;  4PXE A;  3QT6 A;  1A6L A;  1CVJ A;  4DSF A;  2UUB F;  3KK1 B;  1OQ6 A;  2X7I A;  3DRR A;  4NLS A;  2B5J A;  2LVW A;  5CD4 A;  5B0D A;  3ONQ A;  4H4M A;  3T9N A;  9RUB A;  2VC1 A;  3NAI A;  3N0V A;  5KT2 A;  2PA8 D;  2CXE A;  5CYM A;  2ZC4 A;  2ZE2 A;  1VLY A;  4LSN A;  3WIV A;  1HFE L;  5ETR A;  4OZL A;  3FQK A;  4ETZ A;  4TXS A;  2J0X A;  1M5S A;  1VIO A;  1KN6 A;  2GVZ A;  3POT A;  4ZS6 A;  2A2D A;  4DL7 A;  3K5L A;  4X66 J;  3UDL A;  1R8C A;  4URQ U;  1HNI A;  1U2C A;  1ZAW A;  3G8S A;  1HBO A;  2F8H A;  3H2L A;  4PPD A;  1U47 A;  5AT1 B;  3BO2 A;  1ITP A;  4QIF A;  1SBR A;  4B9T A;  1W2B R;  4CO2 A;  2V2Q A;  4LR9 A;  4IRD A;  4LF4 F;  2BQR A;  1UWA A;  4CO0 A;  4DV1 F;  3VV2 B;  1M5K C;  1BY9 A;  5BJR A;  1Q79 A;  2RIJ A;  1W7W A;  3CJ4 A;  5D4L A;  1HNV B;  1TUV A;  4ANC A;  5H9E J;  2F8E X;  1WC0 A;  5DDR C;  1CJK A;  4KHR A;  1A9N B;  1B7Y B;  4CLK A;  1VR6 A;  4XAK A;  1KVI A;  1WKK A;  2Y9H A;  2OFG X;  2MKY A;  2M3D A;  1OSD A;  2NLW A;  3THP A;  3ZZO A;  1U8S A;  3DLL Q;  3D3B J;  2HQI A;  2RAQ A;  1RDR A;  2VKZ G;  5ETQ A;  1RU1 A;  1GMW A;  2KZZ A;  4CT8 A;  4DG1 A;  4IFY A;  4P73 A;  1DUR A;  3R7S B;  4PKD B;  3CCS S;  4B3M J;  2OD4 A;  1Q82 T;  4BS2 A;  2RDD A;  2E5L J;  3GFZ A;  3HSJ A;  1MMD A;  3AXM A;  5MLC V;  1FD8 A;  1TKZ A;  1Z4U A;  1OQ3 A;  4C0O C;  2OEJ A;  4DS4 A;  3V5R A;  4QYR A;  2DGX A;  2JFD A;  5F9N A;  1LKZ A;  3K8V A;  3C19 A;  3M8Q B;  1RSC A;  4K0K J;  4HDG A;  2MQO A;  3T41 A;  3GV5 B;  4WTO B;  5KFV A;  4CLZ A;  3IS9 B;  2ALY B;  2CFX A;  3SSR A;  3VHQ A;  4DV3 J;  2M8H A;  4LFB F;  4Y3C A;  2W2N P;  5L9N A;  1A0O B;  2HVZ A;  5HLF B;  1XJW B;  2GW8 A;  2JOQ A;  1IKY A;  2QG9 B;  2Z2Y B;  2VON A;  4GO7 X;  4OV1 A;  4B3S J;  3T1Y J;  2DR9 A;  1SC6 A;  5KFD A;  2FB0 A;  3N5F A;  2ZC3 A;  2X1A A;  2P5V A;  4KFB A;  1FCA A;  3GLJ A;  1TL7 B;  2NXE A;  4H4K A;  3VWS A;  2E1C A;  1R6V A;  4I6A A;  1X9S A;  3IR7 B;  3Q8R B;  3OR1 A;  1U1P A;  4IH6 A;  2GAH C;  1TL3 A;  5HAT A;  4DL3 A;  5JJB A;  3FJ2 A;  1N6Q B;  1HHQ A;  5G4D A;  3KDO A;  3BSC A;  3IBC B;  2IM3 A;  1M1K T;  5KT3 A;  1Q0N A;  3V81 B;  1OWX A;  2BVZ A;  3QZ8 A;  2YQ3 A;  1OY6 A;  1YVF A;  5A6P A;  5I4M A;  2YKQ A;  3GJR B;  2HFU A;  5ETS A;  5D78 A;  2GHW A;  3AOC A;  2ZIT A;  3H7H B;  1P1L A;  3OTC A;  3M9M B;  1NND A;  4ELV A;  4HTJ A;  3PIP Q;  2R7S A;  3AA8 A;  4N76 A;  3ZTR A;  4XPC A;  1E6V B;  2H1Y A;  4KYZ A;  2MGZ B;  5F3T A;  3FNN A;  3MTJ A;  4J90 A;  1MSW D;  2IM2 A;  2ZHA A;  1IWG A;  3DI6 A;  4N8O A;  4K4Z A;  2IDE A;  1DTQ A;  2VDH A;  3KK2 A;  2VL1 A;  3UN3 A;  4Q2M A;  2DGV A;  3R6L B;  2Z0G A;  2Y1R I;  3OLB A;  1OO0 B;  1YBU A;  4DSI A;  4NML A;  1PJ6 A;  2N7C A;  5KFF A;  4B3R F;  2EI5 A;  1QD1 A;  4YB6 A;  1FRL A;  4DQR A;  2IPO B;  1X5P A;  4WTY A;  2VOO A;  2KHD A;  4MT1 A;  5F3Z A;  1RI7 A;  1X4C A;  1Y11 A;  5LSL A;  2POK A;  3LOU A;  2W8K A;  1S1X B;  4QR0 A;  5DZ6 A;  4F0H A;  2KO1 A;  4YFU A;  3UI3 A;  4WE1 B;  3VAF A;  1WF0 A;  2FVC A;  4YN3 B;  2DRA A;  3OR2 A;  4F26 A;  4ED1 A;  2AW0 A;  2WBR A;  2VIH A;  2WON A;  4EU0 A;  2M2B A;  3QBC A;  4URS A;  3J7Z 5;  4J9N A;  2A6M A;  2AZ1 A;  4LUB A;  3KG1 A;  4P9S A;  1R0C B;  2R7R A;  1Y9O A;  2KG0 A;  4YY3 J;  1HAR A;  5HRO A;  3KK3 A;  1R8H A;  4JV5 F;  2EG1 A;  4QIV A;  1IKV B;  3OTO J;  4KPC A;  5KTQ A;  4OHV A;  1F6T A;  3DLH A;  2RRN A;  2H4Y B;  1NSP A;  3N01 A;  2ZJR Q;  1RIS A;  2LU2 A;  3BGR B;  2ZD1 A;  1NU4 A;  4FYY B;  1U1N A;  3Q8Q B;  4W90 B;  1XBW A;  3B4M A;  1T95 A;  2O67 A;  1QSY A;  3I0S A;  3JQK A;  3OHA A;  1ACM B;  2HG4 A;  3RAX A;  1RTJ A;  4EGL A;  3BDE A;  5J2M B;  3PW4 A;  2LXI A;  3KDN A;  4QR2 A;  1BHN A;  5FLX U;  2V4J B;  1CQM A;  3M8R A;  1IBC B;  3KLF B;  4ED6 A;  1MRO A;  3NP5 A;  3DLK B;  5CQG A;  2JC0 A;  3D68 A;  2H54 B;  1PAE X;  4B3O A;  3EZO A;  4X62 J;  4DU8 A;  4ZIW A;  3MM7 B;  5LMN F;  2XSF A;  1R6Y A;  1TEL A;  5BYS A;  4C8K A;  2WZ1 A;  3R5A A;  3JS9 A;  3IN5 A;  4LF6 F;  5KG6 A;  2HWH A;  4Y2I A;  2QSW A;  2DNN A;  4RL1 A;  3OHB A;  3OXG A;  3UCG A;  2UVW A;  1RTI B;  1UCN A;  2DGT A;  3FMW A;  3HK2 A;  2RKI A;  5AE2 A;  6FDR A;  2C42 A;  4FF4 A;  2QE5 A;  3SQG B;  4RWW A;  3T1A A;  3TVZ A;  1R0A A;  3MED A;  1GX6 A;  4C97 A;  3CDE A;  3NL0 A;  4TQS A;  3M2R A;  4NL5 A;  4MK8 A;  4ZPC A;  4PZV A;  1LW2 B;  3M30 B;  3EE3 A;  2RD5 C;  1VQN S;  2J0Q D;  1XEZ A;  1AUD A;  3GYX B;  1UP1 A;  1TKD A;  2BEF A;  3ZTP A;  1T05 B;  4IFV B;  3OFF A;  1S57 A;  1NXI A;  3EVW A;  4P6Q A;  5DLF A;  2HNZ A;  5LMU J;  3V4I A;  5FDL A;  3WDO A;  2GJ2 A;  3GR1 A;  3W60 A;  3G6E S;  1C0U B;  1ZZN A;  4KRW A;  5H9E K;  4FPR A;  2XNR A;  4CLS A;  1HD0 A;  3CO0 P;  4DL5 A;  4KGX B;  3F73 A;  4KIA A;  3K2Y A;  1HW9 A;  4DL2 A;  3NNC A;  3UO0 A;  3GSD A;  4ZHR B;  2GIQ A;  3LTO A;  4K59 A;  3MAQ A;  1I51 B;  4K50 A;  2NZC A;  1S1W A;  3NS7 B;  1GXT A;  2DR7 A;  5JXS A;  3NOC A;  4DOZ A;  3ILI A;  3MPW A;  1B70 B;  2MLY A;  2W7A A;  1FWP A;  1TU0 B;  4V19 J;  5KG1 A;  3GYG A;  4QWC A;  1U8W A;  4RNN A;  4HHH A;  2P6T A;  3VVU A;  4WIQ A;  3FRZ A;  1FA0 A;  1TVR B;  1VBZ A;  1QJH A;  2Z4P A;  4B9L A;  2M8D B;  2Q43 A;  4KGZ B;  5J2N B;  5LJ3 Y;  3EGV A;  4M5G A;  1LW0 B;  3BR8 A;  3G87 A;  2NCK L;  3Q8S B;  4A8Y A;  2I6W A;  4IG0 B;  4OIX A;  1SV5 B;  3VQT A;  4ZJQ A;  1FJG F;  2VPX B;  4I64 A;  1S59 A;  1RT2 B;  3QLH B;  4IOC Q;  2XS7 A;  3I5C A;  4NAS A;  4X4Q A;  2E5J A;  1NPK A;  3PFO A;  3T6J A;  5DJB A;  3CME S;  2QN6 B;  4I56 A;  1W25 A;  4UQT A;  3DXS X;  4ED4 A;  5ETL A;  3MMA A;  2W4C A;  3ENV A;  2W01 A;  4DCP B;  4DN0 A;  1WC1 A;  2PE8 A;  2MXY A;  3HVT A;  4CWB A;  3FVY A;  4NLW A;  1S6O A;  1MG7 A;  1TV6 B;  4CYU A;  1H2V Z;  1KFD A;  4NXM F;  3L09 A;  4DMZ A;  1H72 C;  1RHR B;  4R0E A;  2ZDP A;  1X4B A;  5E7O B;  4NLT A;  2R8G A;  2VB6 A;  2X1F A;  3SDE B;  3MWB A;  1T9W A;  2RF2 A;  2MKC A;  1U1L A;  5B0F A;  4PUO A;  2GZO A;  3G6X A;  2O3D A;  4OQJ A;  1S9E B;  3SI8 A;  4GO5 X;  4HDH A;  2UUC F;  4ZLJ A;  1H0H B;  2K2P A;  2QA1 A;  4ZPD A;  3UDV A;  4ZPT R;  1FES A;  3TA1 A;  1FNM A;  4P2S A;  5HMY A;  2IA6 A;  5IT4 A;  4DL0 C;  3TI0 A;  6AT1 B;  3GV8 B;  3T1H F;  4JV2 A;  2PA3 A;  4WF9 Q;  4J9U E;  3HMJ G;  4QCL A;  1ZAX A;  2YNG A;  4AUK A;  3H5X A;  2KB2 A;  1F5C A;  3LP0 A;  3VQS A;  4FF2 A;  1N33 F;  4U95 A;  1IWA A;  1LWF B;  1TUG B;  4K5R A;  2NXU A;  3HJV A;  3HSD A;  5I3U A;  1Q8B A;  3EWG A;  3GON A;  4OLP A;  2OPS B;  3A3O B;  3H4D A;  5A6W A;  4I2Q B;  1LK7 A;  2HGN A;  4WP3 A;  1S49 A;  5G0R A;  1WEL A;  2IYG A;  3CXC R;  1NH7 A;  1Z2L A;  3W9J A;  1VQP S;  1HHS A;  3LO3 A;  1KQF B;  4QOT A;  3HFZ B;  4DHV A;  3HP6 A;  1WC5 A;  1WOP A;  4F2R A;  1PIE A;  1FWL A;  3C14 B;  2XCA A;  1YBT A;  4WWS A;  2X3G A;  4E98 A;  1M5P C;  3BKT A;  3MCO A;  4OZN A;  4UY8 T;  1X31 C;  4LF5 J;  4YP3 A;  1NJZ A;  1ROF A;  3O2I A;  4O3P A;  2E9Z A;  4YQW A;  1RYR A;  1XIQ A;  3BYR A;  3GII A;  4USW A;  2KVQ E;  3OSP A;  3CJS A;  2BJ7 A;  5E41 A;  2FHJ D;  3L4B C;  2NR0 A;  5J1N A;  3VTI A;  2FJV A;  4IRC A;  1CC8 A;  4I2P B;  1YQH A;  5D6G A;  1LWC A;  2IVM A;  4K2J A;  2EPI A;  3OVA A;  1XNQ J;  3HHL D;  4XPE A;  3OXL A;  1B0T A;  1X4A A;  5B0A A;  5CZX A;  4FYW B;  1J5E J;  2DKO B;  3HHL B;  1TL5 A;  4NOH A;  3HKZ D;  4Q0B A;  4E0D A;  3CJQ A;  5C42 B;  3UNY A;  2H5E A;  1LFW A;  1T02 A;  2D9P A;  2HZC A;  2J8S A;  1JLA A;  2WVB A;  3RTV A;  2VQE J;  2VG5 B;  4Q5V A;  3TUJ C;  3O8W A;  1NBE B;  4WPA A;  4DJB A;  2N4D A;  4B3T F;  2RHQ B;  4QIE A;  1IR0 A;  4KGV B;  1O51 A;  3OUY A;  3T5J A;  1WDT A;  1RT6 B;  4C8L A;  1SQF A;  3K5P A;  5BYR A;  4Z7C A;  2FLO A;  2RU3 A;  3J81 Y;  2CQH A;  2XO6 A;  4WII A;  3TUZ C;  1AUS L;  4OHZ A;  2QX0 A;  4ER8 A;  2AGP A;  2MQ8 A;  2RVJ A;  4U67 Q;  1JWW A;  4DR1 F;  2KFZ A;  2A1B A;  4FDF A;  3DCA A;  4P72 A;  4Q2L A;  4DQS A;  3C3L A;  2CZ4 A;  1WAC A;  1WSR A;  3QRP A;  2AJQ A;  4A8Q A;  3VR1 A;  1UFW A;  1FK9 B;  2GMJ A;  2W24 A;  1P6T A;  4Y2A A;  1AZS B;  5DRK A;  5BR8 F;  1VQ5 S;  3QRQ A;  4RW4 B;  1Q86 T;  1AB8 A;  2CJX B;  4NZ0 A;  4ZIT A;  9ATC B;  3HT3 A;  4A8W A;  3CPW R;  4MH8 A;  2IVF B;  4YR3 A;  2E1M C;  3P5B P;  3D2W A;  5JUM A;  2DEJ A;  2CJ9 A;  2Y0S D;  2Q3P A;  5KFR A;  5CAA A;  1T9U A;  4CT9 A;  1AA1 B;  3A13 A;  3MEC A;  3SZ2 A;  2CQ3 A;  5L46 A;  1OJ4 A;  3KWM A;  2J6S A;  2A10 A;  3Q2S C;  4CLF A;  3OVB A;  3E2E A;  3LPY A;  2IHR 1;  3B4D A;  3Q0A A;  3PJW A;  4K8R A;  3OPK A;  2FJB B;  1DTT A;  1RWV B;  1NPP A;  4DR3 J;  1PG5 B;  3FBB A;  3M32 A;  2IAJ A;  4OHY A;  3C8Y A;  4ED0 A;  1IVZ A;  1NCL A;  1N48 A;  5KAK A;  2XLJ A;  4AT1 B;  4NI2 A;  1VRT A;  4X84 A;  3CJ0 A;  1KTV A;  2AIR B;  5AE1 A;  3J7Y U;  1VCT A;  3VGT A;  3M6X A;  2CA9 A;  4LFC J;  2G1D A;  1MWY A;  1VFJ A;  1V3R A;  5CYJ A;  4J9M A;  2QLJ B;  4Y65 A;  1CJT A;  2GQ2 A;  3MM5 B;  4OJ3 A;  3BF4 A;  3QFH A;  2E1R A;  4TU8 A;  2BDP A;  2MJN A;  2CQG A;  4F0M A;  1FE0 A;  2QLB B;  3IP0 A;  4OX7 A;  5KFK A;  5DG7 A;  3P96 A;  1WOR A;  4Y0F A;  4LSL B;  3BBF A;  5IXU A;  2OSQ A;  4U96 A;  1F3F A;  4KHP J;  1VQ8 S;  2FYX A;  3KYL A;  1C0T B;  3DRP B;  2XG8 A;  5IWA F;  1L3S A;  1NK6 A;  1L3U A;  3RBZ A;  2EFQ A;  1YGY A;  4GVL A;  4H4O A;  1SUQ B;  2J9E A;  1WEX A;  2PN6 A;  1UVN A;  4IOA Q;  2YWG A;  2UVU A;  3AAW B;  3PDN A;  2CUY A;  3D1H A;  2OEM A;  4I6W A;  1VQO S;  1FER A;  4B9N A;  3M1V B;  2YNH B;  1LXN A;  1F60 B;  1DQA A;  4B9V A;  2AYM A;  4FYX B;  3NKY A;  3M2U A;  1SVD A;  3H2V E;  3N6L A;  4PEO A;  4M94 A;  4ZVT B;  3NBP A;  2CWX A;  1QLN A;  2AHO B;  1TL1 B;  3NNA A;  1IKX A;  3PYF A;  1U49 A;  3H90 A;  2CVE A;  4OLO A;  4DQQ A;  1N56 A;  4O4R A;  1MWZ A;  1X9M A;  4IYQ A;  1VRU B;  5D4P A;  1KKH A;  1PAU B;  5HSP A;  2OPP B;  1X4E A;  2M52 A;  2AU0 A;  2GGP A;  1KS2 A;  2HIY A;  1PKU A;  4F25 A;  4FZV A;  2VA2 A;  2V67 A;  4ICL B;  1HNW F;  5DG8 A;  5L1K A;  2G2O A;  3GV7 B;  3BDP A;  3IG1 A;  1FRX A;  4TVA B;  4ZK7 M;  1WUU A;  2GCF A;  1LV5 A;  5IT0 A;  2B3T B;  4F04 B;  3A1Y G;  2G1H A;  5T14 A;  2ABY A;  2R7X A;  2PI4 A;  2FLL A;  3CF5 Q;  3OSN A;  3TQ1 A;  2I5J A;  4F4Y A;  4FXD A;  1EP4 A;  2Q1L A;  2MZ1 A;  2HQF A;  2D3O 1;  2V2Z A;  3RAM A;  1SJQ A;  1YJW S;  5HQL A;  2FDN A;  3C6U A;  4X4O A;  2QT7 A;  6FD1 A;  2HK2 A;  1WNE A;  4K4X A;  1Q4R A;  3C66 A;  4DV6 F;  1EET B;  2XZT B;  4ELU A;  3VAM A;  5GAH U;  4RR5 A;  4PPZ A;  1NK9 A;  3OFE A;  2V6A A;  2HVE A;  2QZ8 A;  2KG1 A;  3GG1 A;  1S79 A;  2O01 C;  3BBC A;  3HHL C;  3ZZR A;  2W2O P;  3HHD A;  1PJ7 A;  3MCN A;  4UUX A;  4USM A;  3MFI A;  1DY3 A;  5C2G A;  4RUC A;  3WBZ A;  3AOA A;  3RYL A;  2KH9 A;  4N5S A;  4D3H A;  5AXM A;  1JB0 C;  3MR7 A;  1S72 S;  1EKS A;  4NXN J;  1RAE B;  3LAM A;  2P8I A;  3C16 B;  1HMV B;  3DXB A;  2G0J A;  3Q23 A;  2U1A A;  4KV8 B;  2EFO A;  4DCO B;  3Q22 A;  5DET A;  1RT4 B;  1IBK J;  4JV0 A;  3TYT A;  4ZA1 A;  4HAC A;  2C22 A;  5CHC B;  1CPZ A;  5KFM A;  2R7O A;  2DNY A;  2I1R A;  2LP4 A;  3HM9 A;  2HBZ B;  1SL0 A;  1SJ3 P;  3PZP A;  3CE8 A;  2CJB A;  1NHU A;  5A0Y B;  1SJ1 A;  4AXI A;  1MN7 A;  1NPR A;  1HNV A;  1DLO B;  2A2C A;  1RHQ B;  2XO7 A;  5IT9 Y;  4OV6 A;  1GH8 A;  2RT3 A;  1NK0 A;  4G6V B;  2MSS A;  4DL4 A;  4LRD A;  2V68 A;  4HH0 A;  3MHY A;  2F1F A;  4K4U A;  3FFI B;  2H48 B;  2FHM A;  2OPQ B;  4DX5 A;  4K2X A;  4RBT A;  2CPZ A;  1MU2 B;  4Q8E A;  3MMC B;  1SI9 A;  3MM6 B;  3H59 A;  4MFB B;  4WKR A;  1YRU A;  3RW7 A;  1N5S A;  3W1Y C;  4L3K A;  2FGC A;  2GX8 A;  4B3M F;  1BLU A;  4TY8 A;  2DR8 A;  1T9V A;  4U9R A;  4G1Q B;  5DGB A;  4RBV A;  2E5L F;  2QYC A;  4XO0 A;  3ELH A;  1OYD A;  5KG2 A;  2BRL A;  2BJ3 A;  5KG3 A;  3A3N B;  3RB3 A;  2GFF A;  1JLF A;  1LWE B;  4TLR A;  1KQS R;  1ZA2 B;  2XM3 A;  3CJ2 A;  3EZU A;  1X9W A;  2XNQ A;  1YJ9 S;  3I9Z A;  5CZV A;  2XYG B;  4CLU A;  3M8Q A;  4K0K F;  1WD6 A;  4Z2X A;  3C15 B;  5F8M A;  4ZCI A;  4UZC A;  2R8H A;  2W9C A;  4J9S A;  2E9R X;  4OZ0 A;  3EVO A;  4DV3 F;  4C11 B;  1UVK A;  3VZI A;  1NHV A;  2FY1 A;  1K0T A;  2BM0 A;  5HLF A;  3TAM A;  3D0G E;  5EUH A;  1SXL A;  3W7B A;  1YIJ S;  5I3P A;  3T1Y F;  1FF2 A;  4L74 A;  5IZH A;  4EYH B;  3M4X A;  2MB0 B;  2FUG 9;  2KT2 A;  3TZZ A;  5LSO A;  2Q66 A;  2K7J A;  4IH5 A;  2JLE A;  1U6F A;  4UOC A;  1RT5 B;  1R8P A;  5IQ6 A;  4LFA J;  1RWP B;  3BZQ A;  3CED A;  1R8B A;  2P9G A;  4RW8 B;  2DTJ A;  4IUF A;  3V81 A;  3SEO A;  5EN1 A;  4PCQ A;  2W2Q P;  2QA4 S;  2XMW A;  4LR8 A;  5ITH A;  3W2V B;  5KFO A;  4DFJ A;  3MR5 A;  1C2P A;  2HRT A;  3JSR A;  5DDO C;  1QAJ A;  2NSB A;  3DOL A;  1XR5 A;  3E3X A;  2XY7 A;  4FS1 A;  3AT1 B;  5H9F J;  3DNC A;  1E6V A;  3PRB A;  2B8P A;  1FEH A;  4Y28 C;  3TW0 A;  1R3N A;  3DRS B;  2KXH A;  3IGV A;  4QQB A;  2BE7 D;  3GMG A;  1RLD A;  4FNH A;  4ILM A;  1Q8K A;  3W63 A;  2VOP A;  3DDI A;  3BSA A;  2XBP A;  2VQF F;  1NDC A;  2AJ4 A;  1UPM B;  5IFM A;  2HBR B;  3CD6 S;  3PM9 A;  2ZOG A;  2MJU A;  1VHF A;  4NZ7 A;  3I0R B;  2Z57 B;  4ZP8 A;  1U09 A;  4DFK A;  3H8Y A;  1PBA A;  2DNM A;  4DV5 J;  1X4F A;  1L3V A;  4OI0 A;  2U2F A;  1AYE A;  3RW6 A;  2XS5 A;  2Y8W A;  3IAM 9;  1UW9 A;  1QTN B;  4LRB A;  1UPP A;  2ZJP Q;  2HW3 A;  5EX0 A;  4WJB A;  3U7J A;  3CJ5 A;  3RRG A;  1S1U B;  1UTA A;  4LT6 A;  4NRU A;  2XMT A;  2GHP A;  4YY3 F;  1S48 A;  4ZPV R;  1CEZ A;  3MEG B;  3G9C A;  1IKV A;  5HBM B;  5F8I A;  4ZVG A;  2V8D A;  5EX3 A;  3GWC A;  4GC6 A;  2J7U A;  5D3G A;  1QUP A;  3BKF A;  3BGR A;  3OTB A;  3H2U B;  5LT5 A;  5HMX A;  4A8X A;  1BQX A;  1EKR A;  3FQL A;  1U25 A;  4DU7 A;  1NME B;  2IIH A;  4LF1 A;  3UW1 A;  4WFX A;  1IBL J;  1L3K A;  5M2U A;  4QR1 A;  5J2M A;  2BR0 A;  2J6U A;  4Y6I A;  1RT1 B;  1X0F A;  1CQN A;  5F0U A;  2V4J A;  1LOU A;  1NDK A;  2FD2 A;  4MIA A;  2WK4 A;  3SIP B;  4YS2 A;  2CPI A;  1YJN S;  1N8R T;  3DLK A;  1PSD A;  4XTT A;  1KDN A;  2BMB A;  2IRX A;  4F4W A;  5E3Q A;  4X62 F;  1HYS B;  2MPU A;  2W7O A;  1FXL A;  3MAA B;  3G2X A;  3QYY A;  5J1E A;  1RTH A;  5GME A;  1DAR A;  1JLQ B;  3QAT A;  4IO1 A;  4CH7 A;  2P9C A;  1PC4 A;  3AA9 A;  1N4L A;  1TZ0 A;  4N47 A;  2ZUA A;  2XY5 A;  7FD1 A;  1ZM3 A;  3US5 A;  2KXN B;  1N5T A;  2MKK A;  4AXJ A;  2C3O A;  2ZVS A;  1WI8 A;  4NLR A;  1X5T A;  1M1G A;  5EHH A;  1Q78 A;  2PDA A;  3BGF A;  1ULR A;  2B4P A;  2K1R A;  2LEC A;  4F8R A;  2GAG C;  3RBX A;  3WZ0 A;  1UZH A;  2VG6 B;  1LW2 A;  3J7A N;  3HKW A;  4YB5 A;  3FKB A;  4WFN Q;  2ACY A;  3TOQ A;  4R8U B;  5KFT A;  1ZH5 A;  1B0P A;  1DJ0 A;  3R5J B;  1T05 A;  4ES3 A;  4K7Q A;  2GVD A;  4IFV A;  3JYT A;  2D3O R;  2PMZ D;  3QJL A;  5KFZ A;  3KG0 A;  4CI0 B;  2CQ2 A;  3I4H X;  3I5A A;  4KTQ A;  5J2P B;  2GV1 A;  2V9K A;  3G4S S;  5KFW A;  4KE5 A;  1JJ4 A;  3CTR A;  3DMJ A;  1VOM A;  4NA2 A;  2CQ1 A;  3BSN A;  2WTF A;  2YWF A;  4YR2 A;  4OYO A;  4OYX A;  2WB4 A;  2B4O A;  2CKW A;  3EDR B;  1P9Y A;  2XI2 A;  4AND A;  4RUB A;  3VVT A;  1RK8 A;  1JLB B;  3L3C A;  4OX9 J;  4WZM A;  4ECZ A;  4A8O A;  4JI5 J;  1GMV A;  3SXL A;  3PKY A;  1ZYQ A;  4YEA A;  4KR0 B;  1VDH A;  1FTR A;  2RML A;  3ZZZ A;  3AOB A;  3PHT A;  2CQI A;  2RUS A;  2NYI A;  3RR8 A;  1TVR A;  5ETO A;  5F8L A;  1OPZ A;  3ZZU A;  3NGK A;  3JSM B;  4EBD A;  1K9M T;  4DUZ F;  1YSJ A;  2V8H A;  1FD2 A;  5J2N A;  2WVF A;  1HPZ B;  1U24 A;  3CUN A;  1LW0 A;  2ATC B;  4LF7 J;  3W65 A;  4B02 A;  3CT9 A;  3HLU A;  2R8K A;  1RWN B;  3M2V B;  4AYB D;  3QGP A;  4GC7 A;  4DZ6 A;  3HHN B;  1JKH B;  4USH A;  5GVQ A;  2XI3 A;  3UCZ P;  2VC0 A;  1RT2 A;  3QLH A;  5HP1 B;  3JSY A;  5KG5 A;  1K73 T;  1CJV A;  1OS5 A;  4ANE A;  3MR2 A;  3VAG A;  1JIH A;  2EFP A;  4NLP A;  2HHH J;  2VH7 A;  5K20 B;  2ZHO A;  4P75 A;  4CDI A;  1FHT A;  3DLE B;  4EMD A;  4D3G A;  4ZVQ B;  3D0I E;  2A0F B;  2BW7 A;  1D8Y A;  3D54 A;  4LR7 A;  2CAJ A;  4DI6 A;  3LP2 B;  1RWK B;  2E5I A;  3MEE A;  4NLD A;  1HQU B;  1NM2 A;  5KFP A;  4DLE A;  1N52 B;  4C8Z A;  3AFG A;  4Z37 A;  3DLJ A;  3W5Y A;  2YNI B;  5CCM A;  3W2W B;  4UUW A;  5H9F K;  3QWU A;  3ZFV A;  3CCQ S;  4H54 A;  3EGN A;  1K0V A;  4MKB A;  2IJN A;  1MNE A;  2HGM A;  2PEH A;  4QU6 A;  2FVP A;  1WSV A;  2HMI B;  3LA0 A;  5LL6 d;  2DVI A;  2YTC A;  2GS8 A;  1VGY A;  2AX0 A;  1BD6 A;  1LWF A;  3ZTS A;  5KFL A;  5KG0 A;  4NLG A;  3DM2 B;  3DOM A;  1TL4 A;  2BKO A;  2FVQ A;  3H5S A;  4UW2 A;  2I38 A;  2V9W A;  1YTY A;  4MJK A;  2IY5 B;  4CNZ A;  1VQK S;  3OLA A;  2MEW A;  3CC2 S;  2KT5 A;  3KUE A;  2VFV A;  4C3M A;  1VK8 A;  3QJP A;  4DR2 J;  4DV4 J;  2MHE A;  3OV7 A;  2RS8 A;  1PYS B;  4DUY F;  4BDP A;  3U1L A;  2EBE A;  1N5V A;  4C8O A;  3P3D A;  2CDQ A;  5DZ7 A;  3IO1 A;  5GAE I;  4LRC A;  1I3O B;  2KYZ A;  4QBU A;  3CCL S;  4OYI A;  2UU9 J;  3TAR A;  1ZOT A;  3MPY A;  1NSQ A;  4ECW A;  4DPT A;  2E9T A;  1F5B A;  2HHV A;  4RO0 A;  4DCJ B;  2UUB J;  1T11 A;  1S0N A;  2APO A;  3DLB A;  3E8O A;  1UVL A;  1RT3 B;  3CJ3 A;  2FHJ A;  3DRR B;  4DR6 J;  1K8A T;  2YY3 A;  1RHK B;  3CCM S;  2ERR A;  2YPZ A;  4P7V A;  1PC5 A;  4H4M B;  2G13 A;  1XNQ F;  1TKX B;  4DDF A;  2ZJQ Q;  4ZVP B;  3K8W A;  4MIB A;  1S9G A;  5CYM B;  3VGS A;  2ZE2 B;  2ROG A;  2KXF A;  1QUV A;  3HHL A;  3QGI A;  3NGU A;  3PW0 A;  4ENO A;  5GAE U;  3RRH A;  4OYW A;  3WHI A;  2GVZ B;  3POT B;  2E7X A;  2XY6 A;  1S4F A;  3R1H A;  1NK4 A;  2LQ9 A;  4G65 A;  2LEP A;  1S97 A;  1HNI B;  1UFL A;  1N0U A;  3ZZP A;  2KM8 B;  1HBO B;  1HNX J;  2XGQ A;  2AYG A;  1SC4 B;  2C3P A;  3JTO A;  3ENQ A;  1RT6 A;  2AV5 A;  2B8Q A;  4BCA A;  5ETT A;  2W9A A;  4OJG A;  4OYB A;  4AE5 A;  3IRW P;  3SV3 A;  1D3W A;  5HJX A;  2LDY A;  5KFS A;  1M5V C;  4CH0 S;  3JAM Y;  2QC3 A;  2Y1I A;  1CJK B;  3MR6 A;  1RHM B;  2YX1 A;  2Y0B B;  3BYP A;  2C2E A;  2IRU A;  4J9R A;  3TVK A;  3M8P A;  3HXM A;  5KOX A;  4FYD A;  1U2F A;  2PSZ A;  1RHJ B;  1FK9 A;  4CCH A;  2OTL S;  4DLG A;  2FJE B;  3H42 A;  4RW4 A;  1RKJ A;  5EWF A;  3W8G A;  4DG1 B;  1CUL B;  2YH0 A;  8AT1 B;  4PWU A;  5GAD I;  1RGV A;  2LDI A;  5A8R A;  2RDJ A;  1NDL A;  3DOK A;  3CUL A;  2HVH A;  1NB2 A;  3HZE A;  4C8M A;  2MLX A;  4FVC A;  3G6V A;  2E1A A;  1EJ7 L;  2MZT A;  4B9U A;  4DSJ A;  2CNO B;  3P6Y C;  4DR7 J;  1UFK A;  1OYE A;  2XSJ A;  3O44 A;  4Y2M A;  2B51 A;  2AJF E;  2XCP A;  4DR3 F;  2V34 A;  3NGR A;  4CTA A;  4ES2 A;  2UV8 A;  2OEL A;  3EVM A;  1CBK A;  1GXL A;  5GAD U;  4DV2 J;  2DGU A;  4MKV A;  4DZD A;  2RHS B;  2JJ4 D;  3D4J A;  2LQ5 A;  4TKT A;  3TO8 A;  2DBB A;  4NX9 A;  2W8L A;  4KFB B;  3FC9 A;  3LW5 C;  1U1M A;  2VPZ B;  2HK3 A;  1TUW A;  3F41 A;  1CC7 A;  3IBF B;  3PRV A;  3OR1 B;  2VBZ A;  2WSF C;  1VMB A;  2CRL A;  4LFC F;  4TYA A;  4NCA A;  3AB4 B;  1EAR A;  1U0S A;  4RLE A;  1WHX A;  1I5O B;  3MM5 A;  2N3L A;  1ZS6 A;  5HI7 A;  3BQ1 A;  2B7C B;  4KH1 B;  1RCO B;  1OIA A;  5IS2 A;  1C1B A;  2ASJ A;  2HVD A;  3FMB A;  4KHP F;  1FRI A;  3KHL A;  1C0T A;  4U7C A;  2HNY B;  1Q16 B;  2EBG A;  4XDD A;  8RUC A;  1NK8 A;  4GKK F;  2HND B;  1RWM B;  2CZV C;  5HMZ A;  1X0P A;  3CCW A;  1UW4 A;  2VJU A;  3KUG A;  4L72 B;  4PAA A;  4IR9 A;  4FF1 A;  1JXL A;  4ZVR B;  1T03 A;  2IC3 A;  1DHM A;  1YLX A;  3KK2 B;  1FKA F;  3B54 A;  3GJS B;  3Q2T C;  1U0H B;  3UN5 A;  2V69 A;  4N77 A;  4M5K A;  1E6Y B;  1N32 F;  2XEX A;  3CIZ A;  4USK A;  1BXN A;  3S6E A;  4KQZ A;  4JP8 A;  1FKP B;  3BS9 A;  1LEO A;  4IO9 Q;  1FWK A;  3DLG B;  1VRQ C;  4JOU A;  3KLG A;  1U1K A;  2DNZ A;  3ILL A;  1FNO A;  1TL1 A;  2MDA A;  2OLW A;  4AFF A;  3D1O A;  2J7W A;  4HI2 A;  5KG4 A;  3KUH A;  3FZ2 A;  2WON B;  1U45 A;  1P8G A;  1KVJ A;  3I32 A;  1R7I A;  1GT8 A;  2CNL B;  4RW6 B;  5A8W B;  1EIY B;  1XR6 A;  2LA6 A;  1KQG B;  1RAJ A;  3KJQ B;  4OYP A;  5HRO B;  5RUB A;  3PJX A;  4JV5 J;  2OMO A;  2ZKT A;  1M5H A;  2LXU A;  1TK5 A;  4Q7A A;  2DGS A;  4OFZ A;  3O3L A;  1R27 B;  2D74 B;  4JI3 J;  1S6P A;  5LXY A;  3ZXW A;  2ZD1 B;  4JI8 J;  1JK9 B;  3GIL A;  1V5I B;  4BBY A;  1NLK L;  2J7K A;  1SC1 B;  3QIP B;  3IBW A;  1VI7 A;  2DGW A;  1KP6 A;  1HI8 A;  4WU2 A;  2DR5 A;  3R5B A;  3I0S B;  3T6B A;  3J80 U;  1RTJ B;  5B7W A;  4ECV A;  4I69 A;  3K5N A;  3EM1 A;  2R7Q A;  1FEE A;  3UD3 P;  3EXC X;  1R0B G;  4HEA 9;  1Q7L B;  2JLG A;  3MEK A;  4K4Y A;  3OW2 R;  2AYE A;  1Z1Z A;  1MRO B;  1UA0 A;  3JTP A;  2BE2 A;  3TRG A;  1YRT A;  2BM1 A;  1JMT A;  4F4A A;  3K57 A;  3ET6 B;  2QA4 G;  1FX4 A;  2B6A A;  2VIC A;  2OI2 A;  2DNL A;  5M2P A;  3D9B A;  1DRZ A;  3MAH A;  3BSO A;  3ZO7 A;  2B9Y A;  1N5Y A;  5L1J A;  2N82 B;  2AGO A;  1UZD A;  4QW8 A;  3LP1 B;  3FSX A;  4C3K A;  2KM8 C;  2H4W B;  2RKI B;  1SKS A;  2RS2 A;  3HO1 A;  4C8N A;  4UOH A;  3EGW B;  3ILO A;  5CYQ A;  3MM9 A;  3TAN A;  4J9V A;  3AQO A;  4Y2K A;  2HHQ A;  4NXN F;  2M0G B;  1R0A B;  4F02 A;  3MED B;  4N7T A;  2RJZ A;  1HMV A;  3MD3 A;  2I0X A;  2B9X A;  1RT4 A;  2W25 A;  3M2R B;  1IBK F;  3H0P A;  4TY9 A;  2AEM A;  1M5O C;  2WHO A;  1RB0 A;  2GNK A;  3L7O A;  3GZ7 A;  3AD9 C;  4DR4 F;  1WJ9 A;  4M95 A;  3KHR A;  2HAI A;  4PAB A;  2OIH A;  1FI4 A;  3AOD A;  4CP5 A;  2PMW A;  1HHT P;  2UXD F;  1FTC A;  2HNZ B;  4Q45 A;  2F5G A;  2EW9 A;  3QPI A;  5FDL B;  1IQZ A;  2FLN A;  1X8D A;  2EFN A;  3NCQ A;  5A8K A;  1FX2 A;  4CO1 A;  1V9O A;  5FLX Y;  4ZP9 A;  1YIT S;  4FXV A;  1W26 A;  4O3Q A;  5HVF A;  3N4W A;  4YDX A;  1WC3 A;  3BN7 A;  4GRS A;  2FPH X;  4OYM A;  2D3Z A;  3RUB L;  3FFI A;  3EPI A;  5BYQ A;  1V5V A;  3CCU S;  1H74 A;  2XQC A;  4MFB A;  2GQC A;  5D4O A;  1S1W B;  1IBM F;  2ADC A;  3MM8 A;  2PI5 A;  4A48 A;  1V3Z A;  5D4N A;  5A76 A;  2NPI A;  2CZ9 A;  4LIR A;  2VF3 A;  2ZH7 A;  4DSE A;  4DEZ A;  4CLW A;  1FDA A;  4UF4 A;  4UTG A;  5LSR A;  1Q1K A;  4W4M A;  3BB5 A;  3RJM B;  4I7F B;  2OPR A;  3MCM A;  1SKR A;  2J76 E;  3KLH B;  3DHX A;  1T9T A;  2YKN B;  4Q43 A;  2L9D A;  5F8J A;  2R4F A;  2KRB A;  4C98 A;  4DX8 H;  1LQ9 A;  4DPX A;  3EDQ B;  4C11 A;  5D0E A;  2R3V A;  4FS2 A;  2YPY A;  4H4K C;  3JSB A;  3HZG A;  4ECQ A;  3EX7 B;  2YNF A;  1GMU A;  2V2V A;  1K47 A;  2AZ3 A;  1FJG J;  3CDA A;  3MXH P;  2HS4 A;  4DX7 A;  3CMA S;  1S6Q A;  2UZA A;  4AQY J;  3ENW A;  2JFK A;  1NSK L;  3AJD A;  3CWJ A;  4X65 F;  1F9E B;  3K59 A;  3MMJ A;  2QA2 A;  2YWE A;  1B0V A;  4LFA F;  3MMA B;  1MWQ A;  2NS1 B;  3PO5 A;  3Q83 A;  3PYD A;  3HVT B;  2FVR A;  3U1M A;  2X51 A;  3ZZY A;  1Y0H A;  1NSA A;  2G9O A;  4O4G B;  4V1A k;  3HFK A;  4NCG B;  1FVS A;  2MHN A;  1NJW A;  2CG4 A;  1RAH B;  3M7V A;  4HYK A;  2RF2 B;  1ZA1 B;  3QO9 A;  1BE4 A;  4ITS A;  2K06 A;  3EUN A;  4PUO B;  2MQN A;  2XUL A;  4DQI A;  2K3I A;  2UUC J;  2F65 A;  1NZ8 A;  5HK4 A;  3N9U C;  5ADZ A;  2BOP A;  4HTI A;  3K17 A;  2LMI A;  5HQM A;  1IKW A;  1RU2 A;  4WU3 A;  4ZCK A;  1VQ9 S;  2NZ4 A;  3LP0 B;  3UWT A;  3V6K A;  1IR2 A;  5DS7 A;  1UMJ A;  2DHG A;  3TX8 A;  2QFJ A;  4U6P A;  3D5M A;  5D77 A;  3M8W A;  5I3U B;  2HQD A;  3I0R A;  2BV3 A;  4DXL A;  3UE2 A;  1HR0 F;  1HQ2 A;  2VBW A;  1HKA A;  1UVJ A;  4ZOS A;  4DV5 F;  5G0R B;  1VC6 A;  1I1G A;  1J5O A;  2IM0 A;  1S1V B;  3U1N A;  1I94 J;  5IM0 A;  4X4N A;  2JVO A;  4RW7 A;  4LQ3 A;  1LNQ A;  1YZ6 A;  2GC8 A;  4OZ3 A;  5KFI A;  4WYW A;  4HR2 A;  3MEG A;  4P2X A;  5HBM A;  4ZCM A;  4C4W A;  2DO0 A;  2IRY A;  3DGP A;  1HI1 A;  1S0V A;  3Q8V A;  3KJV A;  3MMB A;  1H7W A;  2EXU A;  3R8Y A;  2Y3Y A;  1M1H A;  3M8Z A;  1APS A;  4A8F A;  2HHT A;  3DRX A;  4EK2 A;  2EFV A;  3G6Y A;  2QL9 B;  1WHY A;  1X4D A;  5F8H A;  3R27 A;  4FN5 A;  1S7I A;  1BQM B;  1G3O A;  2VKR A;  2HUR A;  3O1L A;  1IBL F;  4AL7 A;  3TAQ A;  1Q8I A;  4ATN A;  4WFY A;  2EKN A;  5I42 A;  4F4X A;  2GMH A;  2MY8 A;  4QWD A;  3BO4 A;  2CJY B;  5GAG I;  3LGM A;  3X1L B;  2W9B B;  2RSQ A;  3D3C J;  1IJF B;  1AT1 B;  2RE1 A;  2ZZM A;  2Z8Q A;  4Q0B B;  4F3Q A;  3V6D B;  3ZNU A;  5DQI A;  1JLA B;  3WQP A;  3UNG C;  1EHW A;  2VOD A;  2QTW A;  2XMM A;  3WIU A;  1UVM A;  1K1S A;  3HVR A;  3MAA A;  1TQL A;  4LBP A;  4O44 A;  3BGU A;  3O5T B;  2ZEJ A;  2LQ8 A;  2HFO A;  5U47 A;  1JLQ A;  1RTD B;  3RAQ A;  3I56 S;  3OUY B;  3IWN C;  4PWD A;  1R89 A;  3T9Z A;  3BJY A;  1Y7P A;  1RBO B;  1XMB A;  4L3N A;  4MMO A;  1C1C A;  2YKA A;  4K5S A;  1TR0 A;  1RT7 B;  2IM1 A;  2ZH3 A;  3F44 A;  2RQK A;  2W2P P;  3ZZT A;  2HPU A;  3WX4 A;  5GAG U;  2XWX A;  2XMU A;  4PQU B;  3MI7 X;  1XC9 A;  2ZBP A;  4LRF A;  2OKQ A;  4FKX A;  1KLM A;  1VQM S;  3ISN D;  4ED7 A;  3AHP A;  2VUG A;  5D15 A;  1UAW A;  5H1S V;  4J91 A;  2VG6 A;  4FPI A;  4CM0 A;  2R7U A;  4ID5 B;  4B08 A;  3QAU A;  4OHX A;  1RBA A;  3NCR A;  5B0G A;  2CJA A;  4MYU A;  1DZ5 A;  2VG7 A;  3ADA C;  5D0H A;  1LK5 A;  3QT8 A;  4DV0 J;  1JJ2 R;  2CJK A;  2MZJ A;  2LEB A;  2UUT A;  3Q8P B;  4O0N A;  5L8R C;  1SQE A;  3T5K A;  1S0O A;  3FBC A;  4LSZ B;  3R2D J;  5J2P A;  4PXB A;  2DO4 A;  1HWI A;  4CO5 A;  3RRK A;  3TUP A;  2F8M A;  1JLE B;  4OI2 A;  1N5Q A;  2ZBQ A;  5LJ5 Y;  1YJU A;  3TZW A;  2HIQ A;  3G82 B;  1UJ6 A;  1WG5 A;  3SBM A;  3ITH B;  3NY0 A;  2KFN A;  1CSJ A;  5T7L B;  3GB0 A;  4OX9 F;  2ZOM A;  3SSS A;  4JV1 A;  1DTT B;  4AL6 A;  2PEB A;  1WOO A;  3ETO A;  3Q86 A;  3M32 B;  5E3R A;  2IAJ B;  2R8J A;  4YHH J;  2HYI B;  1D1U A;  4LF8 J;  3OJU A;  3DHW C; 
#chains in the Genus database with same CATH homology
 1BUX A;  2VU5 A;  3VGS A;  3FKB A;  1HHQ A;  3R9L A;  3NGU A;  3Q8U A;  1LEO A;  1HIY A;  1NDK A;  2BEF A;  1WKL A;  3ELH A;  4DI6 A;  3VGT A;  4ENO A;  3PRV A;  3ZTP A;  4C6A A;  1K44 A;  3BH7 B;  1S57 A;  3EVW A;  3Q83 A;  3MPD A;  2DXD A;  3DKD A;  5C7P A;  1S5Z A;  2DXE A;  2DYA A;  3EM1 A;  1PAE X;  1NDL A;  3FBF A;  1NB2 A;  1KDN A;  1ZS6 A;  4O0N A;  1B99 A;  5CAA A;  3WX8 A;  3ZTO A;  4FKY A;  4W98 A;  4UOG A;  2AZ1 A;  3GP9 A;  2DXF A;  2CWK A;  3BBF A;  1MN7 A;  1EHW A;  2NCK L;  1W7W A;  3Q8Y A;  3FBE A;  2HVD A;  3VGU A;  4ANC A;  3FBC A;  4CP5 A;  3G2X A;  3JS9 A;  2B8Q A;  3BBB A;  4WBF A;  3ZTR A;  1F3F A;  1HLW A;  2HVE A;  3EVO A;  3EMT A;  3FCW A;  2B8P A;  1XIQ A;  3ENA A;  3BBC A;  4HR2 A;  4KPC A;  1NUE A;  2DY9 A;  3GPA A;  4F4A A;  5IOL A;  1B4S A;  1F6T A;  1BE4 A;  1NSQ A;  3NGS A;  1UCN A;  1NSP A;  4DZ6 A;  3FCV A;  4UOF A;  4F36 A;  1WKK A;  3FBB A;  1PKU A;  5CAB A;  3Q8V A;  3BH6 B;  3VGV A;  2BX6 A;  1S59 A;  2ZUA A;  3NGR A;  5BXI A;  4AND A;  1VYA A;  3EIC A;  4DUT A;  3VVT A;  4S0M A;  4EK2 A;  1NPK A;  1NHK L;  1NDP A;  3EJM A;  3EVM A;  3PJ9 A;  3NGT A;  2AZ3 A;  3DDI A;  3ZTS A;  1NDC A;  3L7U A;  1NCL A;  4ANE A;  3Q89 A;  3ETM A;  3Q86 A;  3B54 A;  1NSK L;  4UOH A;  4FKX A;  1U8W A;  1LWX A;  3ZTQ A;  3B6B A;  1MN9 A;  2HUR A;  3EE3 A;  1NLK L;  1JXV A;  3VVU A;  1WKJ A;  3FC9 A;  1XQI A;  1BHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...