1NSPA

Mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
149
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of phosphate transfer by nucleoside diphosphate kinase: X-ray structures of the phosphohistidine intermediate of the enzymes from Drosophila and Dictyostelium.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 43
structure length 149
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1995-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nspA00
1NB2A 1BE4A 3EVWA 1WKKA 1NCLA 2HVEA 1PKUA 4DUTA 3NGUA 2BEFA 3ETMA 4FKYA 2VU5A 3JS9A 1B4SA 4UOGA 3ELHA 1NDKA 1HIYA 1NDLA 1MN7A 3ZTQA 1LEOA 4UOHA 1JXVA 1NSPA 3VGTA 4C6AA 3BH7B 2HURA 3PJ9A 3Q8YA 3L7UA 1NSQA 1NSKL 1NHKL 4F4AA 1F3FA 3MPDA 3FBBA 3Q89A 3Q8VA 3Q8UA 2CWKA 2B8QA 3FBFA 3ZTSA 3FKBA 2DXFA 2NCKL 1MN9A 2AZ3A 1S5ZA 5CAAA 5CABA 3WX8A 2DY9A 1S57A 4S0MA 3VVUA 4EK2A 1S59A 4UOFA 3VGVA 4F36A 3EJMA 4CP5A 5C7PA 3FCWA 3Q83A 3VVTA 1ZS6A 3VGUA 1UCNA 1WKJA 3BBCA 3VGSA 3GP9A 3G2XA 3ZTOA 1WKLA 2DXEA 2ZUAA 1NDCA 1U8WA 3Q86A 3NGRA 5IOLA 3ENAA 3ZTPA 4ANDA 1F6TA 5BXIA 3EVOA 4WBFA 4KPCA 1W7WA 4DI6A 1BUXA 3FBEA 3PRVA 4W98A 4ENOA 3EMTA 4O0NA 3R9LA 1NDPA 4HR2A 3B6BA 1EHWA 1HLWA 3EM1A 3EE3A 3BH6B 3GPAA 2DXDA 3NGSA 2HVDA 3FCVA 1BHNA 1HHQA 2AZ1A 4ANEA 1K44A 1XIQA 3DDIA 1VYAA 1LWXA 1NLKL 4ANCA 3EICA 3BBBA 3ZTRA 1NPKA 2BX6A 3NGTA 1NUEA 3B54A 3EVMA 3DKDA 2DYAA 1B99A 1PAEX 3FC9A 1KDNA 2B8PA 1XQIA 4DZ6A 4FKXA 3BBFA 3FBCA
chains in the Genus database with same CATH superfamily
3M8QA 5D3GA 2NR0A 2FJXA 4O3SA 1CJUB 4PYAA 3BO3A 2GHVC 3FRZA 1R0AB 1Q8IA 3MR3A 3KNAA 1ZPWX 4J9QA 2C2NA 3BPDA 4NLYA 2KO1A 3NGUA 1ZBTA 1SH3A 4TXSA 4ZN3A 1YITS 2FHJA 3OR2B 4DFJA 4FYDA 2HGMA 1UTAA 1FJGJ 2HQIA 2JEJA 1FDBA 3T19A 1G4CA 2HWTA 3AJ2A 4UOGA 5DDOC 2YKQA 4KV8B 4ZJQA 1HR0F 3CW2C 1RQ0A 4DLEA 3R2DJ 5L9XA 4O23A 1VJWA 4MIAA 4ATNA 2MMYA 2YVSA 4YR0A 2ZH2A 3CUNA 2B4VA 4C8LA 1FTCA 2KDOA 2ZEJA 4F0MA 4UZBA 1U4BA 2V9WA 3HZEA 2ALYB 3ZZOA 2U1AA 1ELOA 2BV3A 1N5YA 4F02A 1Q53A 1Z4UA 3FSIA 4I67A 1P9YA 2FZGB 1MWZA 3C14A 2R7TA 1RUSA 1SC4B 1FJEB 1AXQA 3BKUA 1TL1B 1WF1A 5SZTA 2NXUA 4UY85 2KHCA 3T1YF 2BXJA 5EX3A 1NAQA 4OHYA 3F0NA 2G4BA 1JNRB 2EG2A 5J1NA 1HHSA 3A3PB 5CAAA 3MM7A 2IM0A 1QE1A 4HI2A 4U8VA 1RT5B 2CWXA 2YQ3A 2HHSA 4NX9A 2ZM6J 5IQQA 1VS3A 2OPRA 4CP5A 4KGXB 2J6SA 4L75A 4FF2A 1QM9A 1TKTB 2F5GA 3NCPA 3N4WA 4IUFA 4B3OB 4RW9B 1F5BA 3PJXA 5M2UA 3PW0A 3CJQA 3HHNB 4Y34A 1HW9A 5IM0B 1UVNA 5CQGA 1FF2A 2HNYA 5E3CA 5ITHA 2DKOB 4PWDB 2R42A 2G2YA 3Q86A 4FP9A 2AT1B 3KK3A 3MEEA 1TELA 3HO1A 3TP2A 3L3CA 2B4OA 3MUTP 4F4KA 4LF7F 1U47A 2UXDF 2EFQA 2BKNA 2HPUA 3MPYA 6FD1A 1E6YB 1XNRF 4ED5A 4ED2A 4JI4J 1NK6A 1SQEA 1HQUA 1XR7A 4AFFA 4LUBA 4I4BA 2LVWA 4FZVA 2RF2A 1BUXA 3DOKB 4CYUA 2AEMA 3H25A 1CG2A 4NYPA 5J1EA 3CCJS 1NH8A 1UJ4A 4ENOA 4R5PA 1NK9A 1B7FA 5JMNA 4Y0FA 2MGZB 4JV2A 2YNGB 3R7BB 4EI2A 4WZMA 3CO0P 3K5OA 4RKUC 2GMLA 2ZBQA 2HHHF 3MMCB 4WXWA 5CH7B 1X9MA 2V2KA 5HP1B 1S1UA 1SV5B 1DFDA 1S10A 1RBOB 4EU0A 4DSKA 2HVDA 4DR7F 2IA0A 3GFYA 4PZVA 4YB1P 3PHEA 3SYZA 4A8KA 2EXUA 2VJVA 4LF4F 1HHQA 3W1YC 4PG6A 4URGA 5HMYA 1JLEA 4B3TF 1VYAA 2G0CA 3RRGA 1YJRA 3DXSX 3IS9B 1Z2ZA 3MAAB 3PNIA 4RW4B 5DG8A 2VIHA 5L39A 3ILJA 3QSYB 5HN0A 1S1VB 2Z2MA 2BW2A 2DB1A 4DV7J 1VI7A 2WVCA 1XQIA 1BQNB 4F50A 2DHAA 3EXCX 1F0XA 4IOBA 1FRMA 3FBCA 4KB7A 3SXLA 1VRUA 2HGNA 4NWBA 2NYHA 4Y2KA 2D74B 2KKHA 3UN5A 2W2MP 1WI6A 1WDTA 3D1HA 3K2YA 3J80Y 2ZBPA 2GS8A 1CJVA 5H9FK 1I51B 4CT9A 3H4DA 3M8YA 4AD6A 3DNCA 4O44B 3TI0A 3CDWA 3R5GA 4Y2MA 3BKTA 1HBOA 3CF5Q 3G6ES 2FLNA 1R6VA 2YTCA 4NLTA 1SUQA 1X4HA 4E8UA 1U0SA 4WE1B 5DG9A 5KFEA 2HWIA 1RADB 3QQCD 2HNZB 3P8BB 2BZ2A 5C24A 4QWBA 1CJUA 1PC4A 4I6AA 3QNWB 4I6WA 3H98A 2CNNB 2VPYB 3LWMA 2JLGA 1APSA 3PVXA 1FX2A 2GVDA 2ZE2B 1HBOB 1RCOB 2Y1RI 4ZPDA 4WFXA 5CCLA 3M30A 1MWYA 4NA1A 4EEYA 4B9LA 3J7A1 4J90A 4Q2MA 4B9NA 2Y0SD 1TK8A 4WK1A 3W62A 1U09A 5BYRA 3TUZC 1FKAF 4WF9Q 1NM2A 2RE1A 2CQPA 4QWAA 3UD4P 2FY1A 2DY1A 2MSSA 1IKVB 1BWVA 4DPTA 4JI2F 2BJEA 1KQFB 3FBBA 4B9SA 1S4EA 2RHQB 2M9KA 1YZ6A 2DNHA 2B8QA 4QJVA 4DX6A 1RTDB 5J2QA 4LREA 3T6JA 2MQLA 3QZ8A 3MTJA 2XM3A 3BN7A 1S5ZA 3H90A 1MW7A 1YDLA 2HBZB 4I64A 2YH0A 5CABA 3Q8RB 4HLBA 1WHXA 3M4XA 2D9PA 3LP2B 4ZCLA 1YLXA 1G2EA 2DITA 4NMXA 2Y8YA 1H3DA 1VRTB 1NH7A 3TOQA 1CEZA 3Q83A 2IRXA 5DM7Q 3AOBA 3TAQA 1M1GA 1ZZFA 3GJTB 4WCEQ 3AB4B 3M1VB 3R27A 4ICLA 2XMJA 3PFEA 2IJNA 3N0VA 4DEZA 2MXYA 3MM6B 3MPWA 4CLKA 1Q4RA 3CE8A 1SUQB 2HEKA 4U7CA 2HVZA 5F8HA 4W92B 4O4RA 3TJ8A 1SC6A 3UQSA 4DSJA 1FI4A 2CPDA 1PBAA 1UP1A 3R5JB 3KDOA 2FHKA 4NCGB 1S97A 2MLYA 4ALZA 2GJIA 2JX2A 3LA0A 3OV7A 4NMLA 3V6DB 1WSVA 2K7JA 3GJRB 4Z7YA 2OPSA 3B82A 5KFAA 2EBGA 2CPHA 4J9VA 4RUAA 1IR1A 4QWCA 5HLFA 1D9AA 4MK9A 3AB2B 3NS6A 4DFPA 2AJFE 3CDAA 4GRSA 2DNOA 5EWGA 4A8SA 1HNIB 3C6UA 2OFHX 4W98A 2V50A 2UXDJ 2PMHA 3DRSA 3IWXA 4KE5A 4NEZA 5HMXA 1DTTB 3TVKA 3WIVA 4LF4J 1CS4B 4EYHB 3W66A 4A8YA 3Q0AA 3DM2B 2X3DA 3JSBA 4USWA 2ROPA 2VBZA 4DU7A 3FUYA 3BH6B 2EFGA 4I2QB 5JVGQ 2A6MA 3DLBA 2LMIA 2QA4G 4IFYB 1JLEB 5B0AA 2X7IA 3HHLA 1WEZA 1IUJA 2DIVA 4DS4A 5BYSA 4DX8H 2HMIB 4ILLA 1KQGB 4PRFA 4B02A 1YKWA 5A6WA 1SCJB 1AW0A 2IVMA 2ILYA 2CNOB 1RTIB 2AJ0A 2FYXA 3LTOA 5EWFA 2UVRA 1WORA 4LF8J 4DUYF 1HI1A 4X84A 1RLDA 3AHPA 3BBBA 2W9CB 3EVMA 2M3DA 4H4OA 1HQEA 4DV5F 1VQ6S 1QVGR 3J7YI 4FXWA 1NHVA 2IRUA 4ZVUB 1OY9A 1U1QA 3KHHA 2H1YA 1YIJS 1Y4ZB 3MM8B 2FY8A 4B17A 1XMOF 2RF2B 1YBTA 3DOKA 3GB0A 4M5JA 2UUTA 4K2XA 4ZCMA 5MAOA 4DL0C 1YRTA 2QA1A 3PEJA 4KBIA 4OI1A 1EP4B 3KLEB 2FVSA 3PX6A 4LMZA 3UVJA 2R2RA 3M8ZA 2MLXA 3CMAS 2AEJA 2BBEA 3D3BJ 4G1QA 2DT9A 2X1AA 1WG1A 2DNQA 1PYSB 1VISA 2M2BA 2MPUA 3ILLA 3MEEB 3QO9B 4IYQA 3KK3B 2ZZNA 1I94J 2C2KB 4HDHA 1T03A 4NCAA 2CPJA 2VU5A 1R31A 5KFTA 3PY8A 2XSFA 3R1HA 2B56A 2KG1A 3CSKA 1ZA1B 4M5LA 4I6YA 1SQFA 4CLWA 1OQ3A 2QYGA 2FB0A 2KVIA 3MAQA 1W2BR 1QAYA 1JXVA 2KYZA 2LFVA 2D3ZA 3QSIA 4F3QA 2WOMA 1QUVA 3RBEA 2IYGA 2M7SA 2RD5C 2F4VF 2UVWA 1GNKA 3KJNB 3QJLA 2CPFA 2BE2B 2W01A 1HR0J 2HS4A 2WTFA 3AA8A 1IKVA 4A4JA 3FZ2A 1K8AT 1FVQA 3HSGA 3MMAA 2PEBA 4B9VA 4RO0A 3UD5A 1YJVA 4F4AA 1WUUA 3Q22A 2W2PP 1HWKA 3GR0A 3RAQA 1O8BA 3M30B 3C14B 3ZNJ1 4LF6J 1U25A 1PCAA 1X7VA 1HWJA 2GGPA 1M5SA 2H5IB 2UXCF 4O3NA 2EG1A 3ZZTA 3T9NA 1FRKA 1RWUA 4UOCA 2G0JA 4DR1F 3N9UC 1KN6A 2KJVA 2W1BA 2W9AA 2LCWA 2C3PA 3GJQB 4DR3F 1RDRA 1WC1A 3BGRB 5A0YB 4ECRA 1IBKF 2VDIA 1D1UA 5CYMB 2CPXA 1U2FA 2Z57B 2MZSA 3N79A 5ETRA 3OLAA 3OPKA 3UDEA 5LSRA 2ZBCA 1ACMB 2ZH4A 1WHYA 2PC6A 3GE9A 3SCKE 1RWPB 3RBXA 4B3OA 1KRPA 4UTGA 2IBOA 4DMZA 3JSMA 3D2WA 5J2PA 4ELUA 3O1LA 1NMEB 3TAMB 2MKIA 2Y1LB 2ZC3A 2HBQB 2B3TB 3ENAA 4LRDA 4KPYA 3SSQA 3HP6A 3KUEA 5LM7E 4KJIA 2OI2A 4CNZA 3NL0A 2VF3A 4KPCA 1WC0A 5FDLB 5E3QA 3HKWA 2JJ4D 1Q8KA 4KT0C 3DLKA 4P72A 2RILA 2DGSA 3DU5A 1UW4A 3B6BA 2KH9A 1YK9A 1VBXA 2MKHA 2MKSA 3MR7A 5AXMA 1FFWB 2IHR1 2W4PA 4U96A 3TUJC 4RUHA 2W2OP 2V8VA 3EE3A 1RGVA 3L7OA 5L1IA 4A8XA 5L38A 3GYGA 1GTHA 2NXEA 1N34J 4DR3J 1S79A 1FHTA 1TL5A 3LH2S 2X51A 1I6JA 5F0UA 1EETB 3DLHA 4W90B 5IWAJ 1QSYA 2OUGA 1ZAVA 2H3EB 3IXQA 2A3JA 1PAUB 3J81U 4UZCA 1I1GA 3CJTA 3HVAA 3C66A 1H2UX 2ZH1A 4JI1J 5D6GA 4QIGA 4YHHJ 1T9VA 1TV6B 4Y2AA 2KJWA 3PX4A 2XS5A 5T7LA 2CFXA 1VQ5S 1SJ1A 1BQMB 2R7RA 3UCZP 1K1SA 3TX0A 1JLGB 3PKMA 1KVJA 2F4FA 2LP4A 1CJTB 2O3DA 5KG3A 2P5VA 4RWXA 2HVEA 1D9FA 1GT8A 1Y11A 4JV0A 1RE1B 5KFHA 3LQVA 4DR7J 1N32J 3QRPA 4C7QA 1PGZA 1T9UA 3GIJA 4OI3A 5IT4A 4GKKF 2R8IA 2DHHA 4N8OA 1X4DA 3JQJA 2NLWA 1Q8LA 4WFZA 5DZ6A 2C22A 4EGLA 5GAHU 2IMOA 5KOWA 4PXEA 2APOA 4USMA 5JJBA 2EI5A 3CCWA 2BACA 2B6AA 1AUDA 1JJ2R 3ISND 6AT1B 1HYSA 4H4OB 1IKWA 4USHA 4GC7A 1HBUA 4X66F 4UQGA 2AGOA 2X3GA 2DCLA 1LK7A 1X4AA 2ZZMA 2ZVSA 4X4SA 2J0SD 4J9RA 4AT1B 1WDDA 2PD1A 1FD8A 3I82A 1VMBA 3RYLA 2VQEJ 3VALA 4FS2A 2AYMA 3A8JA 1U7LA 3PKYA 1UA1A 3WHIA 5DDQC 3T5JA 3HFVA 3V6JA 4MJKA 2OEJA 1HBUB 1S4FA 2EC2A 2VBXA 4KH1B 3TQEA 1Y00A 4M5DB 3J7YU 4DV3J 3PM9A 3G8SA 3WX8A 2BRKA 1S6OA 2DY9A 5HAOA 3RRHA 5J2QB 5A2QU 2XY5A 1RAOA 3VGVA 2ZOFA 2JNJA 3G6YA 3MECB 3EJMA 2ZM6F 3M6WA 1VBYA 2EK1A 2JWNA 3IBCB 4F25A 3T5LA 1RWVB 2RVJA 3CMES 3KHGA 5KFWA 3MMBA 4WFBQ 5L1JA 4LR8A 2QC3A 3G2XA 4DR1J 3EDRB 3SQGA 1S72S 4B9MA 3C3LA 2E9RX 2C3UA 2AYGA 4M95A 2XS7A 1T9XA 2CXEA 2Q43A 5KFYA 5GADU 3M8PB 2C2RA 3NGRA 2J9CA 1D8YA 4ZPCA 2IJRA 4FNIA 4WIIA 2PE8A 3PW4A 2C2EA 1WWHA 1LOUA 3QJJA 4ZCKA 2VQFJ 3U02A 3JAMY 4YS2A 2Q1LA 3HMJG 4F4WA 2KVQE 3CO9A 2E66A 4AXIA 5KFOA 4G6VB 2DISA 3MAHA 5LMUJ 5CYQA 3I0SA 5BXIA 2DHSA 1W7WA 5HJYA 2M52A 4K59A 4IO9Q 1VQLS 3LPYA 1O5JA 4EBDA 3G6XA 4HACA 3PRVA 3VQTA 6FDRA 3EMTA 1B0VA 4OQJA 3MF5A 5DZ7A 2XTJP 3VQSA 3QFHA 1B64A 3PR4A 1SBRA 5D0EA 5KFVA 4MTPA 3KG4A 1NJWA 2IMWP 5DO2A 1JMTA 5CYJA 3R1LA 3PTWA 1U1OA 2QRRA 1FE4A 2CPIA 1OIAA 2C2OB 2LXUA 3AODA 2XO6A 3KUHA 1KS2A 2D41A 2WSCC 1RHJB 4NLPA 4FS1A 3RR8A 2ZITA 4ANEA 1N6QB 1S1WA 2HAFA 4WWSA 3X3UA 1OS5A 2DHXA 5KG0A 2M5YA 1NK7A 3R5CA 3POTB 1S76D 2E7WA 1CQMA 2BOAA 5B09A 2HZVA 3P6YC 5HVFA 1NUEA 3HHDA 3B54A 5ETQA 1Z2LA 4A46A 3BREA 2K06A 2P9EA 4LFAF 1LWEB 2M8HA 2PA3A 2A2DA 3DLKB 3NS5A 5KFFA 3SQOP 3I4PA 3W2VA 1XC9A 1YJNS 3A8IA 3PYFA 5LMNF 1K47A 2A0FB 3M8PA 3NCRA 1CC7A 4LFCJ 3QRRA 1BLUA 4DV5J 4DQSA 3UI3A 2H65B 3EVWA 3T1AA 2QLXA 1VQ9S 4DHVA 2DGXA 2DR7A 3BO4A 3N6NA 1MSWD 4DL5A 1X4BA 3Q8SB 2D9OA 3KLIA 4ZITA 4K5RA 1TKZB 4P2FA 4PKDB 5JVHQ 1RWNB 3TAMA 2DH7A 2XCPA 4J9LA 2GX8A 1RAJA 1S7IA 2NUUG 3PIPQ 1DQAA 4WK3A 1QVFR 1RT5A 2RT3A 1N54B 3AD8C 2CPZA 4M63A 3VV2B 1MN7A 1RKJA 3W8GA 4LT6A 4Y2IA 4UOHA 4ERDA 4ZHRB 4F2RA 2PA8D 4Y3CA 1N48A 2BQRA 1JLAA 1H6KX 4F04B 1N5TA 1FXDA 2GIRA 3AY0A 3MM9B 5DQGA 5KFNA 5EDWA 1N36F 5LOQA 2QG9B 3O2IA 3KMSA 3BQ1A 1S1VA 1UAWA 1U6ZA 1V3ZA 2B43A 1KP6A 3DRXA 4M5IA 4UW2A 3ET6A 2JFDA 4LBIA 5E3AA 4JI6J 1PYTA 1UMJA 2A2CA 4RUBA 3W61A 3NGKA 3GCXP 1S9EA 1WOOA 2KT2A 1O6XA 2WRMA 3SCJE 3PCOB 4FN5A 2W8KA 4JI1F 2GQ2A 4LFAJ 3QJPA 1T9YA 2IIHA 4NXNF 3C2PA 5CHCB 2XQCA 1RAGB 3A8KA 4O3PA 3UCGA 3OT9A 2FJVA 2WVEA 2JEGA 2UXCJ 2B6AB 1XMQJ 5FDLA 3HFKA 1CULA 4O44A 4A8MP 4IKAA 4KGZB 5F0WA 4AE5A 4CO5A 2AV5A 3O3LA 1TUVA 3D7SB 1KBRA 1X0FA 3DOMB 4D3GA 4DQPA 2VFTA 2L08A 1C0TB 3D0IE 1RT1A 1RT7B 3HD1A 4LQ9A 1TFYA 2KZMA 1TL7A 2ZDOA 1TL1A 2CQCA 4ED6A 2RDIA 5HROB 1ZAWA 4CLYA 1SC1B 4YOEA 3Q2TC 1Q8BA 4DG1A 4DV3F 4DV2J 3CJRA 1WKJA 1IJEB 1RBLA 3BBCA 3CEDA 1PJ6A 1RAAB 4CRJA 5HMZA 1CJTA 2C1EB 4JI3J 1WKLA 4M5DA 3GFZA 5K8MA 1TMMA 2QV6A 1NDCA 4DBQA 2LA4A 1M5HA 4IG0B 4R8UA 4A8QA 2C3OA 2ZHAA 3TQ1A 1PSDA 4X4TA 2ZVIA 2B9XA 3G6VA 2OPRB 4GVBB 1UKUA 1FRJA 1FEEA 2O66A 4P7VA 1TAUA 1ZAXA 3I5CA 1NXIA 3NBPB 3MOJB 3TRGA 2DGTA 1QE1B 5HL7Q 1RT2B 1X4FA 2QEXS 4QYRA 1QLNA 1DQ8A 1RISA 2E5GA 3OR1B 5F3TA 2YNGA 3AT1B 3W9HA 4EO8A 1HFEL 3MECA 4MIWA 4ETXA 4ZJOA 4TKTA 5KFMA 4WFAQ 2D3O1 1LW2A 1HNZF 1OSDA 3TZWA 3DLJA 2E5HA 1DAXA 2V2QA 4IFVA 3M32B 5GAEU 1SL2A 2YKMB 1J5EF 3T5HA 1FNXH 3CCQS 2GIQA 1HQUB 1D0EA 4DN9A 2VG6B 3S8SA 1KHWA 4DL4A 4NLWA 2XULA 3U1LA 2UP1A 1RLCL 1UL3A 3JTPA 1WG5A 2PI4A 4ZIWA 1W25A 2F8MA 2FZCB 5DS7A 4OX8A 1SKUB 2WB4A 1K44A 2ZH9A 1U6BA 1NK4A 1IBMF 4OZ0A 2DH9A 1S0MA 2RMLA 3I87A 4I2QA 4P73A 3M6UA 4K5SA 4NYZA 3UPFA 5EWEA 2AHOB 2HK3A 1WI8A 3CJ0A 2D1CA 4NZ6A 1T8EA 1KHVA 4DL3A 1SIWB 3QGIA 2HQDA 1JLFA 3OVBA 2E1CA 3HFZB 4DPXA 1F5AA 5EHHA 3QO9A 2NXNA 3JSYA 2HHPA 4JI8F 2CQDA 2P6TA 4FPIA 4FBTA 4LQ3A 2Z2LA 3KYLA 5K8OA 4EBEA 2XYGB 2EFVA 4P74A 1RTHA 1N88A 3UO0A 5C25A 2R4FA 2RUGA 1RZMA 1T0TV 1NCLA 2F7VA 2LEAA 2WW4A 3GIRA 2JC1A 1BGXT 1WACA 3RTVA 4DFMA 3J7ZT 1L3SA 4GKJF 1GXLA 2XZWA 2PO4A 3FEXB 1FJGF 3C16B 1OPZA 4OYWA 3SV4A 2YKPA 3AH6A 1HBMA 3I9V9 5IXUA 1RHQB 5E0OA 3G87A 3AQPA 3DC2A 3GZ7A 5ETLA 3R5DA 2BM0A 1RWOB 2DR5A 1HD0A 3M6XA 1RXOB 2V67A 3TJAA 3RZAA 3KNGA 3SMZA 1GTEA 1W26A 1KWMA 4F67A 2LYVA 2JFKA 4CO0A 1NSPA 1R0CB 2ZJQQ 1DHMA 2HBYB 3KG0A 4OX6A 1WTFA 3BH7B 4H4MA 2HFSA 3S6EA 3J81Y 4HL9A 4AUKA 3MI7X 3HT3A 3L7UA 1FDNA 3H5UA 4TU9A 3OTBA 3KJQB 1IBLJ 3UNYA 2VPZB 2CG4A 3RAMA 2VC0A 2XMTA 5B0GA 3CJ8A 3N5BA 4RBTA 1GMWA 2CNKB 4OHVA 2EVZA 3A12A 4L72B 5H9FJ 4ECYA 1N0VC 5KFSA 1U1LA 4LFCF 2DBBA 2Q3PA 2DXFA 1H38A 5AXKA 1CC8A 3MAAA 4I69A 1VQSA 5D78A 1S49A 2KB2A 2ZBIA 4Q0BB 1OY6A 3ENWA 4NI2B 1C4CA 4OZ2A 2QSFA 3RJMB 1MNEA 1IWGA 2CQHA 2SXLA 2J7WA 3W2VB 2ZZTA 3BDEA 5D0HA 3CC7S 9RUBA 1T3OA 3D6HB 3MM6A 3MHYA 1VDHA 4RZRA 2MY8A 4C9DA 3VGSA 1FWKA 2CPYA 1P27B 4XDCA 3IM8A 1E6VA 2AD9A 1HI8A 1ZOTA 3MMBB 3QAUA 5HQ8A 5IC4B 3B78A 5I42B 2G0IA 5EX0A 2AW0A 2ZH5A 2HZAA 3ENVA 2HYIB 4ELTA 5KT3A 1M1KT 3LAKA 4RW8B 3BEGB 4DR5J 1NJYA 1N34F 1GXUA 1UEKA 2OPQB 2VQEF 7AT1B 4P71A 5DGBA 4K4UA 1VQKS 2RRAA 2Y8WA 5T41A 3Q2SC 1IKYB 2CZ9A 2N3LA 2YNFA 2ZOGA 3CIMA 3EVOA 2UUBJ 1A9NB 2PIIA 2D69A 1UFWA 3O5TB 4K4WA 1T94A 2V8GA 4U95A 4X64F 5IFMA 4JYAJ 1RI7A 1U24A 1FT8A 3NAHA 1TR0A 4WFYA 2HQ3A 3HVTA 2YKNA 3OL8A 3LALA 3EM1A 1HBNB 2NXJA 3BB5A 4R0JA 3K59A 5DGAA 4DR4J 4PQUB 5CYMA 1AROP 3JQMA 1QAXA 2CJBA 2XNRA 5RUBA 2XMAA 5GAGU 5AE1A 4ID5B 1R8AA 2G1HA 1NJXA 2ZD1B 1FFSB 3L09A 3DRPA 4R0EA 3H4BA 1HL6A 3W64A 3G82A 3MFHA 4EBCA 1RWKB 1UFLA 2HSEB 2OFGX 2FQQB 5E2QA 4IFVB 1IM6A 3M32A 1M1HA 1QJHA 3NGTA 2IA6A 5D15A 3N5FA 2NZ4A 3HSDA 3MWBA 5L46A 3FC9A 3ZZRA 2W24A 3SBMA 8RUCA 2B8PA 2RKIA 2AWZA 3QT8A 3HPOA 2NUHA 1IBMJ 4ZVFA 4ZVHA 3FK4A 3IR6B 4YHHF 3OVSA 4OI6A 2KU7A 3ZC4A 1P8GA 3RW6A 2OPPA 3QT6A 1NEEA 3JSRA 3SIPB 5C5JA 3NRBA 3V4IB 4X64J 2ZKTA 1U45A 2FLPA 3PDNA 4M8LA 3K58A 2BEFA 2JHEA 4Y6IA 4PQAA 3I4HX 1KFDA 1SC3B 5JUMA 1JLBA 3OW2R 4WKRA 1XWLA 3NCQA 1S1XB 1N5QA 3PG9A 1J5EJ 1XNRJ 3BQ0A 4K0KJ 2DHGA 3SDEA 3I0RB 3LGNA 4YB6A 4DV4J 1IWAA 4LSLA 5LXRA 3PRBA 2I38A 1QTMA 1IM4A 1AUSL 1FWLA 4USUA 2YKNB 3RGIA 2HAIA 2V34A 2XI2A 2X1BA 3DMJA 4PAAA 3PV8A 1DZ5A 4OJ1A 1ZH5A 2R7SA 3OFHA 2XC9A 2NYIA 4OL8A 1S6PB 1KC8T 2FDNA 3LF0A 2WAQD 1LK5A 2W8LA 1L3VA 5LMNJ 1VR6A 1U49A 1NSQA 1NHKL 2C2MB 4NCGA 4OX9J 2UU9J 2MGZA 1UVMA 2UUWA 1PYOB 3V6DA 2HZCA 2QL5B 2NPFA 2VG7B 4O4GB 4X4OA 3KMQA 5LJ3Y 4DR6J 2BOPA 3KFWX 5FIIA 2ILZA 5C2CA 4FF4A 5A6PA 3AXKA 3B8HA 1Y7PA 3TA1A 1MN9A 4ZLNA 3HT0A 4DOZA 3RB6A 1Q86T 3A3NB 3O44A 2QX0A 3RRKA 4I7FA 5J2MB 2MY7A 1UVIA 2DRAA 4DF4A 1SIZA 1LWCA 1FEHA 3CDEA 3AD9C 4JP8A 4LR7A 4QIFA 4RNFA 3OSNA 5E3RA 1KD1T 2ASLA 2YPYA 2DGOA 4O4GA 2Z2YB 4IG3B 4CTAB 4WIQA 5BR8J 1JJHA 2A18A 3HSJA 1GAOA 1JJ4A 2VKZG 3C19A 2YWWA 1D09B 3PW5A 1CVJA 3GFHA 3LP2A 5GADI 2UXBJ 1RA6A 2OEMA 4RX6A 4M5HA 4HHUA 1HARA 1Q78A 3BGOP 1HYSB 1RB0A 4DG1B 4DV6J 2BR0A 1SJ4P 4JI0F 4DQIA 4F4XA 2E5LF 4XDDA 1FRLA 3CB4A 4V19X 4IRCA 2X1FA 3G86A 4ECQA 4Q8FA 2VA3A 3KLIB 1FKPB 2LXIA 4RBUA 5KT7A 1JLFB 1S0VA 3RBZA 4JI3F 5L8RC 4ZJLA 1NU4A 4C3MA 4RL1A 2W7AA 1ITPA 2VL1A 2PT0A 3K8WA 4DZDA 2MSTA 4MK8A 4ZN1A 1M5KC 2YWHA 3K57A 2BUNA 2LQJA 2WVFA 5A0YA 3ZZYA 3KLFB 1UW9A 3SV3A 4ED3A 2HKEA 3QT7A 2XZTB 3CXCR 3CULA 1WD6A 1X4GA 2BMBA 2D3UA 3P4UB 4WYWA 4Q0BA 1HLWA 7FDRA 1GX5A 3LOUA 3POTA 3CNQP 4MK7A 1RTZA 3OBIA 3M9NB 1DTTA 1N33J 4OI0A 2HBRB 5J2PB 3JSMB 5CA5A 5K9FA 2BANA 1RYRA 2L48A 4DPOA 1HNZJ 4KGMA 2VKRA 2V4JB 2WBRA 3QLHA 2R7XA 1YX2A 2MQ8A 3CCMS 4CCHA 5KT5A 1TU0B 4N56A 3MCNA 3TYTA 2XO7A 4YMEA 2RDJA 1S1TA 2QE5A 3DXBA 4QR0A 4ZPTR 1S0NA 2DNZA 1RTIA 2J9DA 2BE2A 2BW7A 2XG8A 1E6YA 3DKDA 2NSBA 4UY8T 4OZ3A 1T05B 3NWRA 3NNHA 2KFNA 4CM2A 3MCSA 3KLVA 1NPPA 2ZD1A 1T95A 1S6UA 4QR2A 5HJXA 2MZQA 2C28A 1M5VC 2B9YA 2I8EA 4P2MA 2CIMA 1KLNA 2HQFA 2R7UA 5FLXU 1UVKA 2HWHA 2MHEA 5C24B 4FVCA 2QO3A 4HVZA 3GQCA 3H5XA 1WKKA 2LEPA 4WPAA 4ZPBA 5SUHA 3W5YA 5DQIA 2BQUA 1MROA 1Y3JA 1S1XA 2GHWA 2ZE2A 3U1NA 3CCUS 1JKHA 1YRUA 4YB7A 1C4AA 5KG4A 4WP9A 3M8SA 3FJ2A 4FF3A 3BGLA 4P10A 3X1LB 4ECUA 4G1QB 4BBYA 1N56A 3LGMA 3KWMA 1NDKA 2OMOA 3DRRB 2R7OA 1FDAA 2ROGA 3MCOA 3B4MA 4NE9C 4CDIA 3KUGA 1RAEB 2H51B 1P1LA 3E8OA 4C97A 3CJ3A 2QLWA 1S6QB 4DU8A 2AU0A 1BY9A 3CC4S 1U0HA 4J9PA 3TR5A 3PZPA 2FUG9 1H98A 1NO8A 4IH5A 3NKYA 4PG5A 1TL3B 4ECWA 2E1PA 4MKBA 2AGPA 4C8KA 5GAGI 2HURA 3LANA 5HQLA 3PJ9A 2VICA 2AYBA 4LF7J 3BS9A 3T9ZA 2MEWA 3M1VA 3BSAA 1NSKL 4P7TA 1EJ7L 4H4MB 2NXCA 1CS4A 2AJ4A 2HGLA 2YWFA 5LL6d 3ICLA 1REGX 1VQOS 3VF0B 1FESA 1NSAA 1JLBB 1VK8A 1WEXA 2Z8QA 3Q8UA 3KG1A 4GO7X 4MYUA 2F8EX 5B7WA 4QW9A 4IFYA 4NXMJ 4NCBA 2CPEA 1RHKB 4DUZJ 3ILOA 1S99A 2AZ3A 2QIFA 3DHWC 4LSNB 1U1PA 1HD1A 2OPSB 3W2WB 2UV8A 3Q24A 5HBMB 2QMXA 3EGWB 4NLQA 4KRWA 4XPEA 1L3KA 1RKIA 2FLOA 3OL7A 1NKCA 4I0WA 5EGYA 2UUAF 2IVYA 3AOCA 2CUYA 3GSIA 1AB8A 3LP0B 4C11A 3W8PA 3OUYA 1VC0A 2CQ2A 1ZS6A 3P3DA 2RNEA 2MKCA 2U2FA 2DH8A 4JI6F 2ASJA 5GMDA 3ZNUA 3DOMA 5D4LA 3MEDA 1R0AA 2VA2A 3MM7B 2KT3A 2FJAB 2R7QA 3G71S 2QGFB 4QYZK 2ZH7A 2J76E 1TUWA 3HHLB 1L3UA 1C2PA 3OR1A 5K14B 2KXNB 1I94F 3DGPB 3LPEA 1EARA 1Q81T 4B3SJ 3CPWR 3SI8A 5F9LA 3SFUA 1U1NA 1FCAA 1HNVB 3W7BA 1DURA 3ETOA 2JZ5A 2QYCA 1KKHA 3CTRA 3MOZA 3ZTPA 4WU3A 4DPWA 4LF5J 1T03B 1S48A 2V2ZA 4CH0S 1KSPA 4AL5A 1N5YB 4PG4A 3M2UA 5G0RB 5GAEI 1B7YB 2ABYA 2F1FA 1F3VA 1RHRB 2F8HA 2FJWA 2AP6A 2XMKA 4BCAA 2BDPA 1MU2A 2LQ9A 4A47A 5ETMA 4K4YA 2I2YA 4U7UD 5HANA 4ETZA 4RNNA 1XEZA 2NSCA 1FRXA 2KM8B 4KY3A 2MKKA 2HHWA 4DV1J 1R7IA 3JB9k 4WP8A 2QMWA 4AYBD 1LFPA 2RQ4A 1I3OB 4QQBA 5I3QA 3DLEB 2E9TA 4JBCA 2FVPA 1JXEA 2M8DB 4PPZA 2L9WA 1KVKA 4FXDA 3DDIA 2ACMA 4V19J 4X4NA 3EICA 2D7SA 3UDLA 1DARA 1OMSA 3G82B 3IC1A 4OZ1A 2CZ4A 4UF4A 3GR1A 4CIOA 1U48A 3L4BC 2V4QA 4O3RA 2B0GA 3A8EA 2L9NA 3I9ZA 2C3YA 3DOLA 3IR5B 3OJUA 4P2SA 2CA9A 3UR0A 1YTYA 1FNMA 1S9EB 4O3QA 2E1AA 2BA9A 1P1TA 1SJQA 4XTTA 4X4VA 5CZXA 2YNIB 4LBHA 1EKSA 4QW8A 4RW9A 4NASA 5HQMA 2ZH3A 3T1HJ 1X5SA 3UFCX 2CDQA 2DCUB 1PKUA 3GG0A 4OZNA 2Y1IA 1QSLA 1XNQF 1F9HA 1UJ5A 3A4TA 4DCPB 3HHLD 3CCLS 1BWEA 2HFOA 3PYEA 2R8GA 4KSEB 4M5GA 2O5DA 3FMBA 2DRDA 3W5ZA 3C15A 3IO1A 3CD5A 4KO0A 4C8NA 2YX7A 2GC8A 4WTYA 4CYUB 3JS9A 4WTOB 4IRDA 2I9SA 3ENQA 2VFVA 2ROEA 1S1TB 2VG5B 1YJUA 3DYAA 5E5NA 1QDUB 1KQSR 5AE2A 4JV1A 1YJTA 2CG8A 2F40A 2MZTA 1C1BA 3H2VE 4ZLJA 1IBKJ 3BGRA 2C2ZB 2YBVA 5I3PA 5KFRA 4DFKA 4CO2A 3FCHA 4WFNQ 2RUSA 3IA0A 3SSRA 3EZ5A 1A7GE 1YHQS 4PWDA 2PFFB 3BGUA 4M5KA 1Q0NA 4ILRA 2L9DA 3UR3C 2BKPA 1Y9OA 4DV0F 1SKRA 3RAXA 4MFBA 3WC2A 3ZTQA 3W9JA 2H4YB 3CJ4A 1JNZB 2VOPA 1RT4B 2AKWB 2OJ3A 3JTOA 3HJFA 3NOCA 2HQCA 3K0JA 3MCMA 1R6YA 2BM1A 3MM5B 5A2QY 4C3KA 3PFOA 2MYFA 3NP5A 1Y5IB 2OGUA 5KFXA 4FXVA 3JQKA 1N5VA 5HI7A 2P2CB 2B7CB 2HHVA 5JXSA 5HSPA 4NLXA 4DV4F 3MURP 1VRUB 1S0OA 3U1MA 3THTA 1RABB 1YVFA 3I5AA 3GG1A 1URRA 2YY3A 1H7WA 1UWBA 1SI9A 2H5JB 1N5SA 2ZJRQ 4OYMA 2BKOA 3TUPA 1AFJA 4TNOA 2ATCB 1LXNA 4UUWA 4OYIA 5KFJA 3J7AN 1JLQB 4W4MA 2B5JB 1IBLF 4GVBA 3D54A 3BSCA 1P9QC 4CNYA 1N32F 4PXCA 4TQRA 1QD1A 1PG5B 4AQYJ 2XCAA 2HG4A 3V4MA 4DR2J 2HW3A 4OJ3A 5DJBA 3V4IA 2XLKA 2GA7A 4HTJA 4DV0J 1T05A 4LFBF 1CPZA 1RSCA 4DR5F 1Y3KA 2Q6CA 1X9WA 3PYGA 4DWIA 5A8WB 2CJAA 3GU0A 3D1QA 2W25A 4N7TA 1FFGB 3RB4A 4LF9J 4IOAQ 3TW0A 4FYXB 2RAQA 1S6QA 2OSQA 4NLOA 5BJRA 2CYYA 4MKYA 1UPPA 1HKAA 2JOQA 3R9LA 4HR2A 2DGVA 1RWMB 2XYHB 4ES2A 3T3FA 1XK8A 2JLFA 2XNQA 3D0HE 4ICLB 2PMZD 3GPAA 1FTRA 1FK9B 1V5IB 4FPRA 3H2UB 3OTOF 4DUYJ 2XS2A 1LWFB 4TU8A 1G3OA 3FQKA 1OY8A 4P9SA 3OHAA 3K5NA 3KLHA 4JI7F 4XK8C 3D4JA 4JI0J 2D3OR 3NGDA 1WHVA 3G8QA 1LWXA 3IBFB 4DV1F 3BJYA 3DM2A 4DXLA 1RBAA 1SH0A 3R7NB 2Q6BA 4ZVOB 5THWA 3W65A 2CRLA 3ZZPA 2W4CA 5IT0A 3H5YA 1B3TA 2OTLS 1Q79A 1TTHB 1PAEX 2AJ1A 2XWYA 3HDSA 1C0TA 3HULA 1ZM4A 4V1Ak 2YH1A 1N36J 2KTQA 1V3SA 1TVRB 1DRZA 5K5MA 4DZ6A 3TZYA 3HK2A 1VQ7S 3LAMA 1BE4A 1TKXB 3QAEA 1UFKA 4RNOA 3M9OB 1K9MT 2RIJA 1WF0A 2N82B 4IOCQ 1ZTTA 1IBCB 5LXYA 4YN3B 1H0HB 1QSSA 2QSWA 4DS5A 1XMQF 3KJVB 2ZWOA 3DLGA 3NNAA 1WOPA 1YI2S 3G9CA 3D9BA 2DNPA 3W2WA 2CJKA 5E33A 2DVIA 2WBMA 4ZVQB 4PCQA 1JLGA 1HIYA 2BJ3A 5AJ3J 2UUCJ 1FKOB 1TAQA 3FVYA 1WC3A 3VTIA 5IV4A 2QLBB 3QIPA 4H4KA 3UDVA 5H1SV 3WC0A 5A8RA 1LV5A 3DOLB 4CZCA 2XMVA 3IRXB 4ECVA 4B3TJ 5C2GA 2FD2A 5KFDA 2VG7A 4YR3A 3MR6A 1VQPS 1M5PC 2BYCA 2LDIA 3KJVA 5M2PA 2DGQA 3GFXA 1O51A 4OYPA 1MMLA 3HHEA 2ACYA 4QIVA 4RBVA 2K1RB 2VB6A 1K0VA 3FMWA 2XWXA 3ZFVA 1H74A 4ED4A 3AD7C 1F3FA 2CDRB 2HK2A 3B4DA 4L3KA 4MT1A 3UN3A 1NK8A 1SL0A 1IKXB 3PO5A 5F8IA 2KXFA 3CWJA 3Q8VA 2UZAA 3C15B 4KO0B 4B3MJ 5D4NA 2HFVA 2W2NP 5J1PA 4DDFA 4OZLA 1U2CA 2MZ1A 2K1RA 2NCKL 1G1XA 4RW4A 2AX1A 2N7YA 3MDFA 5IC6B 2GCFA 2WZ1A 1YGYA 1JJCB 2C42A 3RW7A 1HNWF 1TK0A 3QBCA 5E7OB 4YY3J 1IR2A 2O01C 2F9JA 3O8WA 3UVJB 3RG6A 1NNDA 3IG1B 1KVIA 1HQ2A 4OV6A 1D3WA 2B7BB 3SCLE 2N7CA 2VG6A 3VZHA 1E6VB 2HNDA 2PGCA 2XGPA 2LQBA 1TQLA 4PR6A 5KFUA 1VQMS 3G8TA 3ZTOA 1UVJA 2V8DA 3BR9A 2ZJPQ 1X5PA 4USIA 1U8WA 2JEFA 2EFOA 1HW8A 1EAYC 2DNGA 1UVLA 3C16A 2HVIA 2GHPA 4XO0A 2E5LJ 1FNOA 1TL4A 1GQEA 1IQZA 1CJVB 3M8WA 4UUXA 3K5LA 1RU1A 2QA4S 5IS2A 4RWWA 3VAGA 1VHIA 4ECSA 5I4MA 2EK6A 2GVZB 2OLWA 1F6TA 4X4PA 2J0QD 1X4CA 5HO4A 3QZ7A 4Q2LA 3A3OB 4LR9A 5ETPA 3BGFA 5U47A 4JI8J 2UVUA 2RRNA 1VQ8S 1ZTWA 4B3RJ 1UZHA 1NDPA 2B9EA 4RPFA 4WXOA 5FJ4A 5GAHI 3M2UB 5G0RA 2AGQA 4CLFA 1J5OA 2ADCA 4BLGA 4C8ZA 1C0UA 2F3JA 2CVIA 3JAMU 3HLUA 3ULHA 3I0SB 2HFZA 2KZZA 2QT7A 2JSXA 2CNLB 1TKTA 1J27A 3CVKA 1AZSB 2DNMA 1LWEA 2ZC4A 4DV6F 3P49B 4IQXA 3KLFA 4NA2A 3SCIE 2LEBA 2CQ0A 4ZPWR 2VASA 5AXNA 2AZ1A 4J7CA 1XIQA 4OX7A 3GV5B 4HHJA 1DLOA 1KFSA 4JV5F 1GK8A 3U27A 1A0OB 3VHQA 2KFZA 2W9BA 3KHRA 3NNCA 2IPOB 1Q95G 2PDAA 3VAJA 5AXLA 2I6WA 1IKYA 4DSFA 3NMRA 1FKPA 3CD0A 4ZOSA 1FXLA 1Z1ZA 3S7RA 4FF1A 4NZ7A 1XBWA 4MH8A 3J81j 5I3UA 4NLUA 5F8LA 2R7WA 4X65J 4C3LA 5F8NA 5F9NA 1REVB 3I56S 2QFJA 2AMCB 2RHSB 3D68A 4GVLA 4DV2F 2RS2A 5HBMA 1NB2A 1VC5A 2KXHA 4ECTA 4J9KA 4XPCA 1WTBA 2CJYB 3K8VA 4KGVB 2VV5A 3KKFA 2P6SA 4OJGA 4OLPA 1SKWA 1MG7A 4RW6B 2OEKA 2ZFHA 4FKYA 4LSLB 2MHNA 4PABA 1ULRA 4LRAA 4ES3A 4OLOA 1U1RA 3PHTA 3ELHA 1SXLA 1TP7A 3GIKA 1RT3B 2G9OA 2BABA 1NPRA 2IDEA 1BQMA 2CVEA 2KYXA 4K7QA 4L3NA 4RW7B 1UWBB 2ZH8A 2A6OA 4FNHA 4KR0B 1X9SA 1QAJA 2DR8A 2HHXA 4YFUA 4GO5X 3F41A 1T3NA 4KAIA 2AIRB 1YJWS 3ISNC 3SQGB 4Q45A 1KQKA 3DRRA 4PWUA 1R27B 5ETTA 1JX4A 1RAIB 2BE9B 3H42A 1S9GA 2E5IA 2Y9HA 1CLFA 1OO0B 3QWUA 3HHLC 1DLOB 1LW2B 1NZAA 2OPQA 2YKOA 3D67A 1YG0A 4USTA 1Q1KA 3D3CJ 3KLGA 1BC6A 2C3MA 1CSJA 2GO9A 3HI9A 3IRXA 2OH2A 3V6HA 4L6V3 2O1PA 3P96A 4IDKB 4F4ZA 4QR1A 2G2OA 3D66A 3AQOA 4Q5VA 4J9OA 4C8OA 1X8DA 2HFNA 3KK2B 5KG2A 1LW0A 2CAJA 4HT7A 4IO1A 3GMGA 3HF5A 2NS1B 2ZKUA 3IG1A 1EX8A 4NZ0A 2MDAA 3VVUA 3KJFB 1RAHB 4M5NA 3LWLA 4QOTA 2HNDB 3JXOA 3KXDA 3OFFA 1HWUA 2XMUA 5KFZA 4ZIVA 3KLGB 2M0GB 5L1KA 3IN5A 3BV8A 3V6KA 3CDUA 1JLAB 2AYEA 5KFQA 3ILIA 3HXMA 2XBPA 5IT9U 2IAJB 2KI2A 3D6TB 3D6FB 2P9GA 2DNYA 2KRBA 1TL3A 1TKXA 2LDYA 3T1HF 1IN0A 2FHMA 1HPZA 1WF2A 3BM7A 2MKJA 2DJWA 1TL7B 1SJ3P 1NB7A 3DRYA 2WW8A 4LF1A 2O67A 3IAS9 3FEZA 1H72C 3FDSA 3ISZA 3OQ2A 2DNKA 2OHDA 3QWPA 4NLRA 3DI6B 2GMJA 5GMEA 4ZLLA 1PC5A 4ED7A 2KN4A 2FLLA 3PX0A 3IMQJ 4L76A 2I0XA 3SDEB 4HT5A 5IT9Y 2FGCA 5ETSA 5G4DA 3C6TB 1CULB 2HRUA 1GX6A 1DTQB 3SFGA 1KEKA 4LF5F 2GGPB 3QIPB 4NLGA 1GXTA 4IG3A 2WK4A 2IDLA 4FBUA 4F3OA 1FE0A 2IYIA 1UWAA 2N4DA 3CGIA 2JDJA 1GFWB 3W9IA 3AJ1A 8ATCB 2AX0A 2H4WB 1Q82T 4AL6A 4QU6A 4KH0B 1SVDA 3N01A 4IDKA 3NGSA 4J9UE 2WVBA 4ZVPB 4C8MA 5L9NA 5J2NA 4B9UA 2CKWA 2YNHA 3IFEA 3MR5A 1IKXA 4WU2A 3ADAC 3EUNA 4A8OA 2GZOA 4HHHA 1X5TA 2L3MA 3TARA 1X4EA 4H54A 1VBKA 3L7PA 4R5PB 3GV8B 3FEYB 3EZOA 4QWEA 2PN6A 1RWWB 4ZHRA 1FRIA 3CD7A 3THPA 2JC0A 3CCRS 1PO6A 2DRBA 2GVZA 3M2RA 1Q7YT 1NPKA 1BD6A 4KFBA 2V2VA 2VBWA 5DDRC 1N4LA 4GKJJ 4C4WA 4HACB 3GILA 4F8RA 1RA7A 1MWQA 4RUCA 4JUZA 4DL6A 2YX4A 3BBFA 1RACB 2J8SA 3PXGa 3M05A 3DDKA 3EGNA 3WDOA 2MQQA 2VFSA 3MD1A 3U7JA 2AJ2A 2CZVC 3MPVA 3Q8PB 1NJIT 3NS7B 3C46A 4CI0B 4LVNP 3DU6A 2DTJA 1G6BA 4NEYA 3CDBA 3H8YA 3N6LA 3EPGA 2QL9B 3HD2A 4HTIA 3W63A 1KLMA 1GMUA 4N41A 2M88A 2GJFA 1XR5A 5KAKA 4ZVSB 4F0HA 2RJZA 3SZ2A 1R43A 1NDLA 3TX8A 1HMVA 2YX1A 3OLBA 5F3ZA 3HSZA 1BQXA 3M2VB 2WSFC 3OUYB 5KG6A 3LP0A 4JYAF 4NRTA 4U67Q 2ASDA 5BR8F 2H48B 3AJDA 3OVAA 1QUPA 2UV8G 2OD6A 1VLOA 3VGTA 3IM9A 5F8MA 5D4PA 5A8WA 1SH2A 3CIZA 3R5AA 4TVAB 3I31A 3DMJB 3MEKA 5K8NA 3BSOA 4RU2A 1V9OA 2YXLA 4UT4A 4OMFG 4BC7A 2BJ7A 2ZWPA 3QMQA 2XSJB 5GVQA 3JYTA 3R2CJ 2OTJS 3GTYX 1OPIA 3OTOJ 2VD3A 2R8JA 4J9MA 5HATA 1OJ4A 4B08A 3HVTB 4DR6F 2HLTA 1XNQJ 2ZNYA 5E41A 4LVOP 1R0BG 1TK5A 3D28A 2B4UA 3N6MA 1LWFA 3FKBA 3K89A 3LW5C 3ZTSA 3KK2A 1R89A 4IH6A 2XSJA 2HNZA 3JYTB 4K4ZA 2LQ8A 2V0NA 1L5UA 4ZS6A 5A76A 1TKDA 5D8HB 5I3UB 4N5SA 4F36A 4I1TA 5KFIA 1U0HB 2GFFA 4F3MA 5B0FA 2UXBF 2J7KA 1K1QA 3D0GE 2XGQA 3FCWA 3E2EA 1T02A 4KKOB 3LO3A 4ZP9A 2EFNA 2VUGA 2ZHOA 5HVHA 4RNMA 2N4CA 4HEA9 1ZPVA 3CCES 1VJQA 1RT6A 2W9BB 1VLYA 1T9WA 3E51A 3CD6S 2CQBA 5ETKA 1CBKA 3WX4A 3GJSB 3P5BP 1RTJB 1X31C 2QJ3A 2MQMA 3ZO7A 3BDPA 1HBNA 2ADBA 2HIYA 4EMDA 2BJDA 3DFEA 3H40A 2OELA 3FZBA 3M7VA 1RCXB 1HA1A 4WBFA 1ZYQA 3TVYA 4ZVGA 2XI3A 1CJKB 1RHMB 1A6LA 4YY3F 4TYBA 4G65A 1Y5NB 1RHUB 3VR1A 1S1UB 1SV5A 2J6TA 2IRYA 3RUBL 3SSSA 5KG1A 4PG8A 4X2BA 4TLRA 4OHZA 3WIUA 5CD4H 1WJ9A 3NWGA 4K4TA 3LP1B 1M5OC 4DL7A 4JV5J 2GMHA 2E7VA 5A8KA 4P6QA 4BC9A 3OXFA 4CO4A 1UEVA 3IGNA 4USVA 7FD1A 1RTDA 2HHHJ 1Y5LB 1G7CB 3W60A 2LKZA 3OXLA 4YEAA 4K0KF 5KT6A 1KOOA 3CT9A 3QYYA 2QL7B 1XMBA 3PEHA 3VAMA 1F1BB 2M4MA 3AA9A 2COLA 3G4SS 3EWGA 1FX4A 2BX6A 4Q7AA 2EW9A 3EZUA 3UNGC 2ALZA 1F9EB 3TA2A 1NHUA 2DYAA 2F63A 2AF6A 3TWZA 1RAFB 4NOHA 5CZVA 3DGVA 3OTCA 2VQFF 2HFUA 3AFGA 4LF8F 3I55S 1WOSA 2FVRA 2M70A 3MXHP 2AJQA 1ICEB 2BRLA 3GONA 5B0BA 4Z37A 5ETOA 1M0SA 1WSRA 3HJVA 3ZXWA 4KHPJ 2FGOA 3E01B 3MEDB 1WNEA 4ZVRB 5B0DA 4EUVA 4U6PA 3V81B 3TUIC 4M5MA 4DUTA 3HZGA 2CQ1A 2FJBB 1TFWA 1SL1A 2HVHA 2X1GA 1TVRA 3L95X 2ATLA 1RYSA 1JIHA 3J80U 1YRXA 1FVSA 2FIUA 4YDXA 3VZIA 3G96A 2HIQA 3H7HB 1B4SA 4F4YA 2JL9A 4ZMMA 4QIWD 4JI5F 3MTKA 4KC5A 4Y2CA 2NPIA 2QTWA 2RU3A 2RB7A 1NRKA 2LXFA 3M2RB 2YNIA 2RDDA 2K2PA 1YJ7A 3NBPA 4NPOA 5KG7A 4AL7A 1EETA 2R3VA 2FHOB 2JVRA 2W4DA 1HI0P 1R3NA 3KDNA 3OHBA 2V9KA 3BR8A 2QA2A 4YR2A 2R2UA 5D0GA 4LRCA 3BYPA 3CMQA 4GKKJ 1H7XA 1Y0HA 2V8HA 1VIOA 2IFXA 1QTNB 1JLQA 3KHLA 2IC3A 4X4QA 1DY3A 1S12A 1NK0A 1EKRA 3Q8YA 4J5OA 4U7UK 2XB2D 1RU2A 1V3RA 4DCOB 4PPDA 4DLGA 3NXZA 4KQZA 4DSEA 5C42A 1FERA 1VHFA 3FFIA 3MEGB 4B3SF 2HRYA 4P2XA 2UUBF 4JI7J 2R8KA 4NA3A 4ED0A 3AXMA 2XEXA 4N8NA 4JI2J 1DTQA 1HQEB 1EQMA 4EZ9A 2VFUA 1EQ0A 2GAHC 1UETA 2K7KA 4EO6A 1N6QA 1I5OB 1JB0C 4EK2A 4K4XA 1RTHB 4CO1A 3M9MB 2WOMB 2ZNZA 4URQU 1BQNA 3HM9A 3MZIA 4C0OC 2BJ1A 2DEIA 2G13A 2NREA 4CWBA 3F73A 1JLCA 1UCNA 2RU9A 2EPIA 4ZCIA 5H9EK 4CM0A 3FRYA 3OTEA 2ASYA 2V68A 2ZUAA 2DXEA 2BQ3A 2HHUA 2Y3YA 5GMKa 1RTJA 4FYWB 1OSCA 5MLCV 1R8HA 2V4RA 4BS2A 4LRBA 2RH3A 3A1YG 4M1KA 1DQ9A 3D1OA 4TQSA 1H2TZ 4IRKA 2QZ8A 2CQ4A 1TMJA 2I5JA 2J7UA 2VG5A 3DYAB 5ETNA 1UEUA 5LSLA 4NRUA 2KG0A 1U1KA 1PILA 1UA0A 4ILMA 2CQ3A 1KTVA 1VQYA 2OP5A 4G1IA 3EYZA 3FBEA 1AT1B 3IBWA 2IVFB 4Y00A 4D3HA 2V4JA 5KFPA 3EPIA 4J9SA 2VONA 4O0NA 5DG7A 4QIEA 4GC6A 2H54B 3MGJA 1XERA 1SJRA 2I5JB 4FYVB 4DX5A 2KRRA 2J0WA 1M90T 4WYLA 4ZPAA 4MFBB 5ADZA 2JLEA 2VODA 2KT5A 4K50A 5DETA 2J6UA 3ET6B 1ZM9A 1R8BA 2R2SA 1PIEA 5FD1A 4RR5A 3V5RA 2PI5A 4H4KC 4OZ5A 1C1BB 2R7VA 5A8KB 4OZJA 4ANCA 1NKEA 4PQUA 4A8WA 1ZETA 2BJ9A 3PYDA 3CCTA 1RJJA 3DN9A 5KOXA 4ED1A 2CADA 1JLCB 1GMVA 2CJXB 2PMWA 3NAIA 4MAKA 1KONA 1YSJA 2MQNA 2KM8C 4EYIB 3MM9A 4R25A 3LGHA 3QFWA 4KFBB 1U1MA 2WVDA 3GSDA 2DNRA 1B0TA 2I1RA 2PEHA 5LMUF 5F41A 2GAGC 1U26A 2EBEA 3A13A 4KKOA 4LBPA 4DPUA 3TZXA 2B4PA 2KL8A 4ZKAA 1AYEA 4O0IA 4RW8A 2FJEB 4C11B 3TZZA 1MLAA 2YQ0A 1YQHA 2HQGA 2NZCA 1REVA 4C2MA 2A1BA 2MKYA 1F60B 3ETMA 3TEHB 4QBUA 5I42A 3KK1B 4KTQA 3BN4A 2XLJA 2F9DA 3DHXA 1V6HA 5AT1B 2YWKA 2Q79A 3CJKB 2ERRA 5D77A 5KG5A 3EX7B 4KGKA 3GV7B 2Z4PA 5FLXY 1LEOA 4ZDNA 4ZVEA 3QRQA 3VWSA 4WE1A 5IWAF 1HNVA 1VCTA 2QLJB 2V63A 4OX9F 4EWTA 4PXDA 1KTQA 5BYQA 4CLPA 3MFIA 3HHKA 3KK1A 4IR9A 2B51A 1VFJA 2DK2A 2LU1A 2Y0BB 4OYZA 3I96A 3C6TA 3UW1A 5DLGA 2XLIA 4JI5J 4CT8A 2Y1JA 2FVQA 3GIIA 4KV8A 3TNVA 3HKZD 4N76A 2IM3A 1ZM3A 3LP1A 4QPXA 4DUZF 2E29A 3GWCA 1VC6A 1X60A 4I56A 3EGVA 5EN1A 4PYDA 1RT7A 2MZRA 3TJ9A 1SPBP 3PRDA 3T1YJ 4OJHA 2MQOA 4URSA 3FNNA 4A48A 3FQLA 3NOGA 4CH1A 2MZJA 2WONB 1WEYA 2CWKA 2J9EA 2ZBRA 3E01A 3FBFA 4LFBJ 4ES1A 3M6VA 1O0PA 4ER8A 1TKZA 4XAKA 5L1LA 3QATA 2UUAJ 4LF6F 1FJ7A 5IZHA 3V2UC 1FO1A 1WC6A 4E98A 4KYZA 1VBZA 4OV1A 4ZA1A 2WHOA 1S59A 2FTRA 4UOFA 4X62J 5D3GB 2DPJA 3MEGA 3RU0A 1Q5YA 4DN0A 3FSYA 4M94A 3OD2A 2FC8A 3UD3P 4FDFA 2IC3B 3VCDA 2YKMA 3IR7B 3BF4A 3WBZA 4U8YA 5EUHA 2H5EA 3S1TA 1LXJA 4X66J 2XY6A 3DLEA 5K20B 4DR2F 4OYXA 2B9WA 5B08A 5DLFA 2K3IA 5F8JA 5IOLA 2E44A 3MMAB 1C1CB 4CO3A 1RT6B 4CQ1A 3TAPA 4JI4F 4C8YA 2DD8S 2FPHX 1S77D 3H0PA 1VOMA 3QIDA 4ANDA 3HX9A 3UWTA 2GJ2A 2Z0GA 4F2SA 1XJWB 3ZZUA 2WSEC 5D4OA 4NLDA 3ZZZA 3HVWA 1VGYA 2DR6A 4CTAA 3GIMA 2YNHB 2VDHA 3ONQA 2C2DA 1RP5A 3VAFA 3AAWB 2MTLA 1PBUA 2EWHA 3EXYA 1SB6A 4HH1A 4Y28C 2GNKA 1AZSA 3L9ZA 1U8SA 3F56A 3H59A 4K8RA 5DRKA 4K4VA 1LFWA 2CQGA 1FWPA 1VK3A 2GQCA 2QFIA 3IS9A 4IQMA 2FZKB 5HK4A 1D9DA 1R8PA 2Z2ZA 2IBKA 2DNLA 4USKA 3TANA 2LU2A 1ZM2A 2HS0A 1BHNA 1KOHA 4YUDA 2Z58B 2FC9A 4FYYB 3Q23A 4I7FB 4ED8A 1GMWD 4OHXA 3W3SA 4O3OA 3PR5B 1K73T 3R6GB 4G3IA 2JRSA 4JOUA 1F5CA 1CQNA 3MMCA 4RNHA 4F26A 1GEHA 3I6PA 1S7HA 2RRBA 4UQTA 3CJ2A 2RQKA 4LIWA 4PG7A 4QPTA 1OWXA 2PSZA 2BVZA 3DI6A 4JB8B 3TEGA 3UCUP 1HWIA 5LJ5Y 4Z7CA 1B99A 4WZQA 3K5MA 3ITHA 4HDGA 4AXJA 4K4SA 4DF8A 1HWLA 4L73A 2LA6A 1KLMB 4BHQA 4FKXA 5C42B 4LJMA 2R9LA 4L74A 3VAIA 4MKAA 4TY8B 1HMVB 1MU2B 2ZUGA 2DO0A 1YBAA 3GYNA 4J91A 4CLUA 2UVVA 4ELVA 3R7SB 3THVA 2YPZA 4ITSA 4ID8A 1YBUA 3R3TA 1WC4A 2KFYA 1NKBA 4IH7A 3GCWP 3GLJA 4DQRA 5CYQB 1YWXA 3W5XA 1AFIA 5KFBA 3JTNA 2UUCF 2B5JA 2HMIA 4GMKA 4ID5A 2VH7A 3BSNA 4TY8A 1VRQC 2BE7D 2XY7A 5HVGA 4K2JA 2IJFA 1XR6A 2J5AA 5F8GA 3IRWP 3HVRA 2V94A 2MJNA 1IKWB 2EKNA 2G1DA 3J7Z5 1U02A 2FJDB 1JXLA 1HHTP 2QN6B 5CCMA 2YNFB 4DJBA 3WQPA 1JQGA 4DV7F 3BYRA 3DCAA 2P8IA 3OFGA 2JH3A 4ZP6A 4Y65A 1YJ9S 4EZ6A 5B0CA 5K8PA 4ZK7M 3QGHA 3K7RA 1EZZB 3EGZA 3MM8A 3P5TL 1FXRA 4IR1A 3NMAA 2Q66A 4XIUA 2E7XA 2J0XA 3IGVA 4RU9A 3MPDA 1JKHB 3IAM9 4B3MF 2EC0A 3Q89A 1N8RT 1UPMB 2BANB 1WC5A 2RQCA 4BDPA 1WG4A 4ZLPA 2E1RA 3FFIB 4OYBA 4USJC 1RT2A 3UN2A 3CCZA 3PJWA 1YZ7A 5IV3A 1QAIA 1RT3A 4C98A 4OI2A 4LF9F 2R8HA 1N0UA 1LNQA 1SQGA 1VQNS 1XTZA 1PJ7A 3I32A 4OFZA 4NLVA 3DRSB 3GYXB 4S0MA 5ETVA 3BPSP 4DQQA 3DDNA 3OTDA 2ZDPA 2VOOA 2W2QP 3I5BA 1JWWA 2LLZA 2DIUA 2OO4A 2V69A 5C7PA 5DQHA 3MMJA 4AQYF 4C0HA 1HPZB 1X5OA 2H9ZA 2V6AA 1ROFA 4LF2A 1S9GB 3GP9A 3QGPA 1P6TA 4I2PA 1WHWA 2XHCA 1FJCA 3QLHB 1IXKA 5DM6Q 2DR9A 2YKAA 4OI4A 2F65A 1S6PA 1C1CA 2GO8A 2WCXA 2VFRA 3NLCA 3P45B 4G1PA 4NLSA 1OYDA 3R97A 4PEOA 5HLFB 3MD3A 3OR2A 4CLSA 4QU7A 1RT1B 2WB1D 1CJKA 1FA0A 2WONA 3BZQA 3F44A 4CLLA 1NK5A 1S9FA 1QY7A 2LQ5A 3V81A 4DPYA 4EFAC 5HMWA 2QLFB 3OJSA 4ZP8A 3M8RA 1T7PA 4I68A 4I2PB 4QYZJ 3I0RA 2IAJA 1LW0B 1WELA 3R6LB 3MR2A 3MM5A 1L3TA 4DI6A 5CD4A 4ZP7A 2GQQA 2K8GA 1W2IA 4ZPVR 3S01A 2JEIA 5K14A 1GH8A 1NZ8A 4N77A 4NI2A 2IM2A 4TU7A 2DGWA 2R2TA 2IY5B 1LWCB 5LSOA 1Q7LB 3RR7A 2QMUB 2BJ8A 3PW7A 1EHWA 3KOAA 4WP3A 1JK9B 3CCSS 2CJQA 1XN9A 3D6MB 1J5OB 1HBMB 2HHQA 2E9ZA 2DXDA 5KFGA 1S1WB 2K3KA 3FCVA 2J8AA 4DL2A 1HNIA 3C6UB 2RKIB 1IJFB 3PW2A 2V5HG 4ECXA 3C8YA 3DLGB 4F7VA 3KTQA 3D5MA 5AE3A 4X4UA 2HHTA 4MIBA 2GIFA 3NG8A 2VHGA 3Q8QB 2XMWA 2AEFA 4LSNA 4N47A 9ATCB 2DGUA 3DLLQ 3NY0A 1R8CA 3T6BA 3RB0A 1DJ0A 2EEYA 1RK8A 1KDNA 2XZDB 5A8RB 2YWEA 2MJUA 2VBYA 2L41A 5J2MA 3N28A 4RJVA 1PJ5A 4FVMA 5KFLA 3RBDA 3LUYA 2MQPA 1TUGB 4IG0A 4PXBA 4KHMA 4R8UB 4NXMF 1FKOA 1Q16B 1K0TA 4BWJA 3TVZA 1U2RA 2VPXB 5AJ3F 4OYAA 4KHPF 1F2GA 2VZ9A 3OSPA 2W7OA 4WKYA 1J2VA 3QGGA 3DGPA 4P75A 4ZVTB 4C0BA 5T14A 1RWXB 3CJ5A 5HP1A 1UZDA 3E3XA 3QPIA 1HNXJ 3PO4A 3K17A 3KLHB 3M2VA 3IWLA 4DR4F 4OYOA 1EP4A 3KLEA 1D8ZA 1HNWJ 1N33F 4QZVB 2OIHA 1LKZA 1B0PA 1KNZA 1OYEA 3H5SA 2DEJA 1T9TA 4MKVA 3WZ0A 1LQ9A 4QWDA 2ZH6A 3BO2A 2JVOA 1IVZA 1MMDA 1SJFA 3IP0A 2YQ1A 3FGVA 2XYPB 4B9TA 2Z30B 3EDQB 4RLEA 3UE2A 4HKQA 4RW7A 1MMNA 2V8PA 1FD2A 3TO8A 3MPUB 2MLZA 5DDPC 4C6AA 1Y10A 4MYTA 4TN2A 5C25B 2VPWB 5D0RA 3CCVS 2RQMA 2PFDA 4LRFA 2MB0B 1N52B 2OMLA 5T7LB 5KT2A 1KR4A 3T41A 5LT5A 3BQ2A 4ECZA 4MMOA 4YQWA 3SEOA 2DNNA 4DX7A 2POKA 4NXNJ 4NYOA 1URNA 3H20A 2CJ9A 1Q5VA 3O6QA 3OXGA 4Z2XA 1H2VZ 1EB0A 5IM0A 4PUOB 2EKYA 1BMQB 1H73A 2ZOMA 2N3OA 1S57A 4E0DA 1V5VA 4X65F 2XHWA 1TZ0A 3ITHB 2VC1A 4HI1A 5J1EB 1FDDA 1XMOJ 1HNXF 5M2RA 5KFCA 3AOAA 1F2HA 1FK9A 2XMMA 4OHWA 5J2NB 4CH7A 4E2FB 3VVTA 4J37A 3VGUA 2ZHBA 4YP3A 4KHRA 4HH0A 2NQPA 3FSXA 4LSZB 1FRHA 3DRPB 4PWWA 2VJUA 2HRTA 3US5A 2E1MC 2FHJD 2OSRA 3ZZ0A 5IQ6A 4KIAA 3MUVP 1OQ6A 1U6FA 2HLUA 2OD4A 5KFKA 3R5BA 2HNYB 3OL9A 1EIYB 1T11A 1MROB 4OIXA 5CXTA 1C0UB 2DPIA 2AQ4A 4B3RF 5KTQA 4Q43A 1AA1B 2IM1A 3UDCA 2J9DE 3VAHA 2UU9F 1BXNA 4CLZA 2GW8A 2FVCA 2G2ZA 4RW6A 1NBEB 2KHDA 3CJKA 3PIOQ 3OFEA 1TV6A 1IR0A 4BWMA 4QCLA 2F4VJ 4NL5A 2OAUA 4X62F 1ZZNA 2OPPB 8AT1B 3OL6A 4Q8EA 4DCJB 2DO4A 2RSQA 3BKFA 1F9FA 2HS3A 4J9NA 4X4RA 2RS8A 2A10A 3H2LA 3VAKA 4YDDB 5KT4A 4DSIA 2GV1A 3R8YA 3K5PA 4CLTA 5HROA 4A8FA 4YB5A 1X0PA 4C48A 3PACA 2E5JA 1UJ6A 1VIXA 4TLQA 4TY9A 1RT4A 2W9CA 4PUOA 2OKQA 1NLKL 3QT5A 1SKSA 2GVDB 4TYAA 2EFPA 1B70B 2YWGA 3MUMP 3M8QB 2LECA 5H9EJ 3IWNC 2W7PA 5B0EA 4WJBA 4HYKA 1NJZA 3ZTRA 3RB3A 3T5KA 4P52A 2P9CA 4Q44A 5E3PA 1VQ4S 4U9RA 2Z56B 3CC2S 3CJSA 4DSLA 1ZA2B 2CQIA 4F0KA 3HCXA 1VRTA 3NEKA 4LIRA 1IQTA 1DBDA 3TA0A
chains in the Genus database with same CATH topology
1NB2A 1BE4A 3EVWA 1WKKA 1NCLA 2HVEA 1PKUA 4DUTA 3NGUA 2BEFA 3ETMA 4FKYA 2VU5A 3JS9A 1B4SA 4UOGA 3ELHA 1NDKA 1HIYA 1NDLA 1MN7A 3ZTQA 1LEOA 4UOHA 1JXVA 1NSPA 3VGTA 4C6AA 3BH7B 2HURA 3PJ9A 3Q8YA 3L7UA 1NSQA 1NSKL 1NHKL 4F4AA 1F3FA 3MPDA 3FBBA 3Q89A 3Q8VA 3Q8UA 2CWKA 2B8QA 3FBFA 3ZTSA 3FKBA 2DXFA 2NCKL 1MN9A 2AZ3A 1S5ZA 5CAAA 5CABA 3WX8A 2DY9A 1S57A 4S0MA 3VVUA 4EK2A 1S59A 4UOFA 3VGVA 4F36A 3EJMA 4CP5A 5C7PA 3FCWA 3Q83A 3VVTA 1ZS6A 3VGUA 1UCNA 1WKJA 3BBCA 3VGSA 3GP9A 3G2XA 3ZTOA 1WKLA 2DXEA 2ZUAA 1NDCA 1U8WA 3Q86A 3NGRA 5IOLA 3ENAA 3ZTPA 4ANDA 1F6TA 5BXIA 3EVOA 4WBFA 4KPCA 1W7WA 4DI6A 1BUXA 3FBEA 3PRVA 4W98A 4ENOA 3EMTA 4O0NA 3R9LA 1NDPA 4HR2A 3B6BA 1EHWA 1HLWA 3EM1A 3EE3A 3BH6B 3GPAA 2DXDA 3NGSA 2HVDA 3FCVA 1BHNA 1HHQA 2AZ1A 4ANEA 1K44A 1XIQA 3DDIA 1VYAA 1LWXA 1NLKL 4ANCA 3EICA 3BBBA 3ZTRA 1NPKA 2BX6A 3NGTA 1NUEA 3B54A 3EVMA 3DKDA 2DYAA 1B99A 1PAEX 3FC9A 1KDNA 2B8PA 1XQIA 4DZ6A 4FKXA 3BBFA 3FBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB2 A;  1BE4 A;  3EVW A;  1WKK A;  1NCL A;  2HVE A;  1PKU A;  4DUT A;  3NGU A;  2BEF A;  3ETM A;  4FKY A;  2VU5 A;  3JS9 A;  1B4S A;  4UOG A;  3ELH A;  1NDK A;  1HIY A;  1NDL A;  1MN7 A;  3ZTQ A;  1LEO A;  4UOH A;  1JXV A;  1NSP A;  3VGT A;  4C6A A;  3BH7 B;  2HUR A;  3PJ9 A;  3Q8Y A;  3L7U A;  1NSQ A;  1NSK L;  1NHK L;  4F4A A;  1F3F A;  3MPD A;  3FBB A;  3Q89 A;  3Q8V A;  3Q8U A;  2CWK A;  2B8Q A;  3FBF A;  3ZTS A;  3FKB A;  2DXF A;  2NCK L;  1MN9 A;  2AZ3 A;  1S5Z A;  5CAA A;  5CAB A;  3WX8 A;  2DY9 A;  1S57 A;  4S0M A;  3VVU A;  4EK2 A;  1S59 A;  4UOF A;  3VGV A;  4F36 A;  3EJM A;  4CP5 A;  5C7P A;  3FCW A;  3Q83 A;  3VVT A;  1ZS6 A;  3VGU A;  1UCN A;  1WKJ A;  3BBC A;  3VGS A;  3GP9 A;  3G2X A;  3ZTO A;  1WKL A;  2DXE A;  2ZUA A;  1NDC A;  1U8W A;  3Q86 A;  3NGR A;  5IOL A;  3ENA A;  3ZTP A;  4AND A;  1F6T A;  5BXI A;  3EVO A;  4WBF A;  4KPC A;  1W7W A;  4DI6 A;  1BUX A;  3FBE A;  3PRV A;  4W98 A;  4ENO A;  3EMT A;  4O0N A;  3R9L A;  1NDP A;  4HR2 A;  3B6B A;  1EHW A;  1HLW A;  3EM1 A;  3EE3 A;  3BH6 B;  3GPA A;  2DXD A;  3NGS A;  2HVD A;  3FCV A;  1BHN A;  1HHQ A;  2AZ1 A;  4ANE A;  1K44 A;  1XIQ A;  3DDI A;  1VYA A;  1LWX A;  1NLK L;  4ANC A;  3EIC A;  3BBB A;  3ZTR A;  1NPK A;  2BX6 A;  3NGT A;  1NUE A;  3B54 A;  3EVM A;  3DKD A;  2DYA A;  1B99 A;  1PAE X;  3FC9 A;  1KDN A;  2B8P A;  1XQI A;  4DZ6 A;  4FKX A;  3BBF A;  3FBC A; 
#chains in the Genus database with same CATH topology
 3M8Q A;  5D3G A;  2NR0 A;  2FJX A;  4O3S A;  1CJU B;  4PYA A;  3BO3 A;  2GHV C;  3FRZ A;  1R0A B;  1Q8I A;  3MR3 A;  3KNA A;  1ZPW X;  4J9Q A;  2C2N A;  3BPD A;  4NLY A;  2KO1 A;  3NGU A;  1ZBT A;  1SH3 A;  4TXS A;  4ZN3 A;  1YIT S;  2FHJ A;  3OR2 B;  4DFJ A;  4FYD A;  2HGM A;  1UTA A;  1FJG J;  2HQI A;  2JEJ A;  1FDB A;  3T19 A;  1G4C A;  2HWT A;  3AJ2 A;  4UOG A;  5DDO C;  2YKQ A;  4KV8 B;  4ZJQ A;  1HR0 F;  3CW2 C;  1RQ0 A;  4DLE A;  3R2D J;  5L9X A;  4O23 A;  1VJW A;  4MIA A;  4ATN A;  2MMY A;  2YVS A;  4YR0 A;  2ZH2 A;  3CUN A;  2B4V A;  4C8L A;  1FTC A;  2KDO A;  2ZEJ A;  4F0M A;  4UZB A;  1U4B A;  2V9W A;  3HZE A;  2ALY B;  3ZZO A;  2U1A A;  1ELO A;  2BV3 A;  1N5Y A;  4F02 A;  1Q53 A;  1Z4U A;  3FSI A;  4I67 A;  1P9Y A;  2FZG B;  1MWZ A;  3C14 A;  2R7T A;  1RUS A;  1SC4 B;  1FJE B;  1AXQ A;  3BKU A;  1TL1 B;  1WF1 A;  5SZT A;  2NXU A;  4UY8 5;  2KHC A;  3T1Y F;  2BXJ A;  5EX3 A;  1NAQ A;  4OHY A;  3F0N A;  2G4B A;  1JNR B;  2EG2 A;  5J1N A;  1HHS A;  3A3P B;  5CAA A;  3MM7 A;  2IM0 A;  1QE1 A;  4HI2 A;  4U8V A;  1RT5 B;  2CWX A;  2YQ3 A;  2HHS A;  4NX9 A;  2ZM6 J;  5IQQ A;  1VS3 A;  2OPR A;  4CP5 A;  4KGX B;  2J6S A;  4L75 A;  4FF2 A;  1QM9 A;  1TKT B;  2F5G A;  3NCP A;  3N4W A;  4IUF A;  4B3O B;  4RW9 B;  1F5B A;  3PJX A;  5M2U A;  3PW0 A;  3CJQ A;  3HHN B;  4Y34 A;  1HW9 A;  5IM0 B;  1UVN A;  5CQG A;  1FF2 A;  2HNY A;  5E3C A;  5ITH A;  2DKO B;  4PWD B;  2R42 A;  2G2Y A;  3Q86 A;  4FP9 A;  2AT1 B;  3KK3 A;  3MEE A;  1TEL A;  3HO1 A;  3TP2 A;  3L3C A;  2B4O A;  3MUT P;  4F4K A;  4LF7 F;  1U47 A;  2UXD F;  2EFQ A;  2BKN A;  2HPU A;  3MPY A;  6FD1 A;  1E6Y B;  1XNR F;  4ED5 A;  4ED2 A;  4JI4 J;  1NK6 A;  1SQE A;  1HQU A;  1XR7 A;  4AFF A;  4LUB A;  4I4B A;  2LVW A;  4FZV A;  2RF2 A;  1BUX A;  3DOK B;  4CYU A;  2AEM A;  3H25 A;  1CG2 A;  4NYP A;  5J1E A;  3CCJ S;  1NH8 A;  1UJ4 A;  4ENO A;  4R5P A;  1NK9 A;  1B7F A;  5JMN A;  4Y0F A;  2MGZ B;  4JV2 A;  2YNG B;  3R7B B;  4EI2 A;  4WZM A;  3CO0 P;  3K5O A;  4RKU C;  2GML A;  2ZBQ A;  2HHH F;  3MMC B;  4WXW A;  5CH7 B;  1X9M A;  2V2K A;  5HP1 B;  1S1U A;  1SV5 B;  1DFD A;  1S10 A;  1RBO B;  4EU0 A;  4DSK A;  2HVD A;  4DR7 F;  2IA0 A;  3GFY A;  4PZV A;  4YB1 P;  3PHE A;  3SYZ A;  4A8K A;  2EXU A;  2VJV A;  4LF4 F;  1HHQ A;  3W1Y C;  4PG6 A;  4URG A;  5HMY A;  1JLE A;  4B3T F;  1VYA A;  2G0C A;  3RRG A;  1YJR A;  3DXS X;  3IS9 B;  1Z2Z A;  3MAA B;  3PNI A;  4RW4 B;  5DG8 A;  2VIH A;  5L39 A;  3ILJ A;  3QSY B;  5HN0 A;  1S1V B;  2Z2M A;  2BW2 A;  2DB1 A;  4DV7 J;  1VI7 A;  2WVC A;  1XQI A;  1BQN B;  4F50 A;  2DHA A;  3EXC X;  1F0X A;  4IOB A;  1FRM A;  3FBC A;  4KB7 A;  3SXL A;  1VRU A;  2HGN A;  4NWB A;  2NYH A;  4Y2K A;  2D74 B;  2KKH A;  3UN5 A;  2W2M P;  1WI6 A;  1WDT A;  3D1H A;  3K2Y A;  3J80 Y;  2ZBP A;  2GS8 A;  1CJV A;  5H9F K;  1I51 B;  4CT9 A;  3H4D A;  3M8Y A;  4AD6 A;  3DNC A;  4O44 B;  3TI0 A;  3CDW A;  3R5G A;  4Y2M A;  3BKT A;  1HBO A;  3CF5 Q;  3G6E S;  2FLN A;  1R6V A;  2YTC A;  4NLT A;  1SUQ A;  1X4H A;  4E8U A;  1U0S A;  4WE1 B;  5DG9 A;  5KFE A;  2HWI A;  1RAD B;  3QQC D;  2HNZ B;  3P8B B;  2BZ2 A;  5C24 A;  4QWB A;  1CJU A;  1PC4 A;  4I6A A;  3QNW B;  4I6W A;  3H98 A;  2CNN B;  2VPY B;  3LWM A;  2JLG A;  1APS A;  3PVX A;  1FX2 A;  2GVD A;  2ZE2 B;  1HBO B;  1RCO B;  2Y1R I;  4ZPD A;  4WFX A;  5CCL A;  3M30 A;  1MWY A;  4NA1 A;  4EEY A;  4B9L A;  3J7A 1;  4J90 A;  4Q2M A;  4B9N A;  2Y0S D;  1TK8 A;  4WK1 A;  3W62 A;  1U09 A;  5BYR A;  3TUZ C;  1FKA F;  4WF9 Q;  1NM2 A;  2RE1 A;  2CQP A;  4QWA A;  3UD4 P;  2FY1 A;  2DY1 A;  2MSS A;  1IKV B;  1BWV A;  4DPT A;  4JI2 F;  2BJE A;  1KQF B;  3FBB A;  4B9S A;  1S4E A;  2RHQ B;  2M9K A;  1YZ6 A;  2DNH A;  2B8Q A;  4QJV A;  4DX6 A;  1RTD B;  5J2Q A;  4LRE A;  3T6J A;  2MQL A;  3QZ8 A;  3MTJ A;  2XM3 A;  3BN7 A;  1S5Z A;  3H90 A;  1MW7 A;  1YDL A;  2HBZ B;  4I64 A;  2YH0 A;  5CAB A;  3Q8R B;  4HLB A;  1WHX A;  3M4X A;  2D9P A;  3LP2 B;  4ZCL A;  1YLX A;  1G2E A;  2DIT A;  4NMX A;  2Y8Y A;  1H3D A;  1VRT B;  1NH7 A;  3TOQ A;  1CEZ A;  3Q83 A;  2IRX A;  5DM7 Q;  3AOB A;  3TAQ A;  1M1G A;  1ZZF A;  3GJT B;  4WCE Q;  3AB4 B;  3M1V B;  3R27 A;  4ICL A;  2XMJ A;  3PFE A;  2IJN A;  3N0V A;  4DEZ A;  2MXY A;  3MM6 B;  3MPW A;  4CLK A;  1Q4R A;  3CE8 A;  1SUQ B;  2HEK A;  4U7C A;  2HVZ A;  5F8H A;  4W92 B;  4O4R A;  3TJ8 A;  1SC6 A;  3UQS A;  4DSJ A;  1FI4 A;  2CPD A;  1PBA A;  1UP1 A;  3R5J B;  3KDO A;  2FHK A;  4NCG B;  1S97 A;  2MLY A;  4ALZ A;  2GJI A;  2JX2 A;  3LA0 A;  3OV7 A;  4NML A;  3V6D B;  1WSV A;  2K7J A;  3GJR B;  4Z7Y A;  2OPS A;  3B82 A;  5KFA A;  2EBG A;  2CPH A;  4J9V A;  4RUA A;  1IR1 A;  4QWC A;  5HLF A;  1D9A A;  4MK9 A;  3AB2 B;  3NS6 A;  4DFP A;  2AJF E;  3CDA A;  4GRS A;  2DNO A;  5EWG A;  4A8S A;  1HNI B;  3C6U A;  2OFH X;  4W98 A;  2V50 A;  2UXD J;  2PMH A;  3DRS A;  3IWX A;  4KE5 A;  4NEZ A;  5HMX A;  1DTT B;  3TVK A;  3WIV A;  4LF4 J;  1CS4 B;  4EYH B;  3W66 A;  4A8Y A;  3Q0A A;  3DM2 B;  2X3D A;  3JSB A;  4USW A;  2ROP A;  2VBZ A;  4DU7 A;  3FUY A;  3BH6 B;  2EFG A;  4I2Q B;  5JVG Q;  2A6M A;  3DLB A;  2LMI A;  2QA4 G;  4IFY B;  1JLE B;  5B0A A;  2X7I A;  3HHL A;  1WEZ A;  1IUJ A;  2DIV A;  4DS4 A;  5BYS A;  4DX8 H;  2HMI B;  4ILL A;  1KQG B;  4PRF A;  4B02 A;  1YKW A;  5A6W A;  1SCJ B;  1AW0 A;  2IVM A;  2ILY A;  2CNO B;  1RTI B;  2AJ0 A;  2FYX A;  3LTO A;  5EWF A;  2UVR A;  1WOR A;  4LF8 J;  4DUY F;  1HI1 A;  4X84 A;  1RLD A;  3AHP A;  3BBB A;  2W9C B;  3EVM A;  2M3D A;  4H4O A;  1HQE A;  4DV5 F;  1VQ6 S;  1QVG R;  3J7Y I;  4FXW A;  1NHV A;  2IRU A;  4ZVU B;  1OY9 A;  1U1Q A;  3KHH A;  2H1Y A;  1YIJ S;  1Y4Z B;  3MM8 B;  2FY8 A;  4B17 A;  1XMO F;  2RF2 B;  1YBT A;  3DOK A;  3GB0 A;  4M5J A;  2UUT A;  4K2X A;  4ZCM A;  5MAO A;  4DL0 C;  1YRT A;  2QA1 A;  3PEJ A;  4KBI A;  4OI1 A;  1EP4 B;  3KLE B;  2FVS A;  3PX6 A;  4LMZ A;  3UVJ A;  2R2R A;  3M8Z A;  2MLX A;  3CMA S;  2AEJ A;  2BBE A;  3D3B J;  4G1Q A;  2DT9 A;  2X1A A;  1WG1 A;  2DNQ A;  1PYS B;  1VIS A;  2M2B A;  2MPU A;  3ILL A;  3MEE B;  3QO9 B;  4IYQ A;  3KK3 B;  2ZZN A;  1I94 J;  2C2K B;  4HDH A;  1T03 A;  4NCA A;  2CPJ A;  2VU5 A;  1R31 A;  5KFT A;  3PY8 A;  2XSF A;  3R1H A;  2B56 A;  2KG1 A;  3CSK A;  1ZA1 B;  4M5L A;  4I6Y A;  1SQF A;  4CLW A;  1OQ3 A;  2QYG A;  2FB0 A;  2KVI A;  3MAQ A;  1W2B R;  1QAY A;  1JXV A;  2KYZ A;  2LFV A;  2D3Z A;  3QSI A;  4F3Q A;  2WOM A;  1QUV A;  3RBE A;  2IYG A;  2M7S A;  2RD5 C;  2F4V F;  2UVW A;  1GNK A;  3KJN B;  3QJL A;  2CPF A;  2BE2 B;  2W01 A;  1HR0 J;  2HS4 A;  2WTF A;  3AA8 A;  1IKV A;  4A4J A;  3FZ2 A;  1K8A T;  1FVQ A;  3HSG A;  3MMA A;  2PEB A;  4B9V A;  4RO0 A;  3UD5 A;  1YJV A;  4F4A A;  1WUU A;  3Q22 A;  2W2P P;  1HWK A;  3GR0 A;  3RAQ A;  1O8B A;  3M30 B;  3C14 B;  3ZNJ 1;  4LF6 J;  1U25 A;  1PCA A;  1X7V A;  1HWJ A;  2GGP A;  1M5S A;  2H5I B;  2UXC F;  4O3N A;  2EG1 A;  3ZZT A;  3T9N A;  1FRK A;  1RWU A;  4UOC A;  2G0J A;  4DR1 F;  3N9U C;  1KN6 A;  2KJV A;  2W1B A;  2W9A A;  2LCW A;  2C3P A;  3GJQ B;  4DR3 F;  1RDR A;  1WC1 A;  3BGR B;  5A0Y B;  4ECR A;  1IBK F;  2VDI A;  1D1U A;  5CYM B;  2CPX A;  1U2F A;  2Z57 B;  2MZS A;  3N79 A;  5ETR A;  3OLA A;  3OPK A;  3UDE A;  5LSR A;  2ZBC A;  1ACM B;  2ZH4 A;  1WHY A;  2PC6 A;  3GE9 A;  3SCK E;  1RWP B;  3RBX A;  4B3O A;  1KRP A;  4UTG A;  2IBO A;  4DMZ A;  3JSM A;  3D2W A;  5J2P A;  4ELU A;  3O1L A;  1NME B;  3TAM B;  2MKI A;  2Y1L B;  2ZC3 A;  2HBQ B;  2B3T B;  3ENA A;  4LRD A;  4KPY A;  3SSQ A;  3HP6 A;  3KUE A;  5LM7 E;  4KJI A;  2OI2 A;  4CNZ A;  3NL0 A;  2VF3 A;  4KPC A;  1WC0 A;  5FDL B;  5E3Q A;  3HKW A;  2JJ4 D;  1Q8K A;  4KT0 C;  3DLK A;  4P72 A;  2RIL A;  2DGS A;  3DU5 A;  1UW4 A;  3B6B A;  2KH9 A;  1YK9 A;  1VBX A;  2MKH A;  2MKS A;  3MR7 A;  5AXM A;  1FFW B;  2IHR 1;  2W4P A;  4U96 A;  3TUJ C;  4RUH A;  2W2O P;  2V8V A;  3EE3 A;  1RGV A;  3L7O A;  5L1I A;  4A8X A;  5L38 A;  3GYG A;  1GTH A;  2NXE A;  1N34 J;  4DR3 J;  1S79 A;  1FHT A;  1TL5 A;  3LH2 S;  2X51 A;  1I6J A;  5F0U A;  1EET B;  3DLH A;  4W90 B;  5IWA J;  1QSY A;  2OUG A;  1ZAV A;  2H3E B;  3IXQ A;  2A3J A;  1PAU B;  3J81 U;  4UZC A;  1I1G A;  3CJT A;  3HVA A;  3C66 A;  1H2U X;  2ZH1 A;  4JI1 J;  5D6G A;  4QIG A;  4YHH J;  1T9V A;  1TV6 B;  4Y2A A;  2KJW A;  3PX4 A;  2XS5 A;  5T7L A;  2CFX A;  1VQ5 S;  1SJ1 A;  1BQM B;  2R7R A;  3UCZ P;  1K1S A;  3TX0 A;  1JLG B;  3PKM A;  1KVJ A;  2F4F A;  2LP4 A;  1CJT B;  2O3D A;  5KG3 A;  2P5V A;  4RWX A;  2HVE A;  1D9F A;  1GT8 A;  1Y11 A;  4JV0 A;  1RE1 B;  5KFH A;  3LQV A;  4DR7 J;  1N32 J;  3QRP A;  4C7Q A;  1PGZ A;  1T9U A;  3GIJ A;  4OI3 A;  5IT4 A;  4GKK F;  2R8I A;  2DHH A;  4N8O A;  1X4D A;  3JQJ A;  2NLW A;  1Q8L A;  4WFZ A;  5DZ6 A;  2C22 A;  4EGL A;  5GAH U;  2IMO A;  5KOW A;  4PXE A;  2APO A;  4USM A;  5JJB A;  2EI5 A;  3CCW A;  2BAC A;  2B6A A;  1AUD A;  1JJ2 R;  3ISN D;  6AT1 B;  1HYS A;  4H4O B;  1IKW A;  4USH A;  4GC7 A;  1HBU A;  4X66 F;  4UQG A;  2AGO A;  2X3G A;  2DCL A;  1LK7 A;  1X4A A;  2ZZM A;  2ZVS A;  4X4S A;  2J0S D;  4J9R A;  4AT1 B;  1WDD A;  2PD1 A;  1FD8 A;  3I82 A;  1VMB A;  3RYL A;  2VQE J;  3VAL A;  4FS2 A;  2AYM A;  3A8J A;  1U7L A;  3PKY A;  1UA1 A;  3WHI A;  5DDQ C;  3T5J A;  3HFV A;  3V6J A;  4MJK A;  2OEJ A;  1HBU B;  1S4F A;  2EC2 A;  2VBX A;  4KH1 B;  3TQE A;  1Y00 A;  4M5D B;  3J7Y U;  4DV3 J;  3PM9 A;  3G8S A;  3WX8 A;  2BRK A;  1S6O A;  2DY9 A;  5HAO A;  3RRH A;  5J2Q B;  5A2Q U;  2XY5 A;  1RAO A;  3VGV A;  2ZOF A;  2JNJ A;  3G6Y A;  3MEC B;  3EJM A;  2ZM6 F;  3M6W A;  1VBY A;  2EK1 A;  2JWN A;  3IBC B;  4F25 A;  3T5L A;  1RWV B;  2RVJ A;  3CME S;  3KHG A;  5KFW A;  3MMB A;  4WFB Q;  5L1J A;  4LR8 A;  2QC3 A;  3G2X A;  4DR1 J;  3EDR B;  3SQG A;  1S72 S;  4B9M A;  3C3L A;  2E9R X;  2C3U A;  2AYG A;  4M95 A;  2XS7 A;  1T9X A;  2CXE A;  2Q43 A;  5KFY A;  5GAD U;  3M8P B;  2C2R A;  3NGR A;  2J9C A;  1D8Y A;  4ZPC A;  2IJR A;  4FNI A;  4WII A;  2PE8 A;  3PW4 A;  2C2E A;  1WWH A;  1LOU A;  3QJJ A;  4ZCK A;  2VQF J;  3U02 A;  3JAM Y;  4YS2 A;  2Q1L A;  3HMJ G;  4F4W A;  2KVQ E;  3CO9 A;  2E66 A;  4AXI A;  5KFO A;  4G6V B;  2DIS A;  3MAH A;  5LMU J;  5CYQ A;  3I0S A;  5BXI A;  2DHS A;  1W7W A;  5HJY A;  2M52 A;  4K59 A;  4IO9 Q;  1VQL S;  3LPY A;  1O5J A;  4EBD A;  3G6X A;  4HAC A;  3PRV A;  3VQT A;  6FDR A;  3EMT A;  1B0V A;  4OQJ A;  3MF5 A;  5DZ7 A;  2XTJ P;  3VQS A;  3QFH A;  1B64 A;  3PR4 A;  1SBR A;  5D0E A;  5KFV A;  4MTP A;  3KG4 A;  1NJW A;  2IMW P;  5DO2 A;  1JMT A;  5CYJ A;  3R1L A;  3PTW A;  1U1O A;  2QRR A;  1FE4 A;  2CPI A;  1OIA A;  2C2O B;  2LXU A;  3AOD A;  2XO6 A;  3KUH A;  1KS2 A;  2D41 A;  2WSC C;  1RHJ B;  4NLP A;  4FS1 A;  3RR8 A;  2ZIT A;  4ANE A;  1N6Q B;  1S1W A;  2HAF A;  4WWS A;  3X3U A;  1OS5 A;  2DHX A;  5KG0 A;  2M5Y A;  1NK7 A;  3R5C A;  3POT B;  1S76 D;  2E7W A;  1CQM A;  2BOA A;  5B09 A;  2HZV A;  3P6Y C;  5HVF A;  1NUE A;  3HHD A;  3B54 A;  5ETQ A;  1Z2L A;  4A46 A;  3BRE A;  2K06 A;  2P9E A;  4LFA F;  1LWE B;  2M8H A;  2PA3 A;  2A2D A;  3DLK B;  3NS5 A;  5KFF A;  3SQO P;  3I4P A;  3W2V A;  1XC9 A;  1YJN S;  3A8I A;  3PYF A;  5LMN F;  1K47 A;  2A0F B;  3M8P A;  3NCR A;  1CC7 A;  4LFC J;  3QRR A;  1BLU A;  4DV5 J;  4DQS A;  3UI3 A;  2H65 B;  3EVW A;  3T1A A;  2QLX A;  1VQ9 S;  4DHV A;  2DGX A;  2DR7 A;  3BO4 A;  3N6N A;  1MSW D;  4DL5 A;  1X4B A;  3Q8S B;  2D9O A;  3KLI A;  4ZIT A;  4K5R A;  1TKZ B;  4P2F A;  4PKD B;  5JVH Q;  1RWN B;  3TAM A;  2DH7 A;  2XCP A;  4J9L A;  2GX8 A;  1RAJ A;  1S7I A;  2NUU G;  3PIP Q;  1DQA A;  4WK3 A;  1QVF R;  1RT5 A;  2RT3 A;  1N54 B;  3AD8 C;  2CPZ A;  4M63 A;  3VV2 B;  1MN7 A;  1RKJ A;  3W8G A;  4LT6 A;  4Y2I A;  4UOH A;  4ERD A;  4ZHR B;  4F2R A;  2PA8 D;  4Y3C A;  1N48 A;  2BQR A;  1JLA A;  1H6K X;  4F04 B;  1N5T A;  1FXD A;  2GIR A;  3AY0 A;  3MM9 B;  5DQG A;  5KFN A;  5EDW A;  1N36 F;  5LOQ A;  2QG9 B;  3O2I A;  3KMS A;  3BQ1 A;  1S1V A;  1UAW A;  1U6Z A;  1V3Z A;  2B43 A;  1KP6 A;  3DRX A;  4M5I A;  4UW2 A;  3ET6 A;  2JFD A;  4LBI A;  5E3A A;  4JI6 J;  1PYT A;  1UMJ A;  2A2C A;  4RUB A;  3W61 A;  3NGK A;  3GCX P;  1S9E A;  1WOO A;  2KT2 A;  1O6X A;  2WRM A;  3SCJ E;  3PCO B;  4FN5 A;  2W8K A;  4JI1 F;  2GQ2 A;  4LFA J;  3QJP A;  1T9Y A;  2IIH A;  4NXN F;  3C2P A;  5CHC B;  2XQC A;  1RAG B;  3A8K A;  4O3P A;  3UCG A;  3OT9 A;  2FJV A;  2WVE A;  2JEG A;  2UXC J;  2B6A B;  1XMQ J;  5FDL A;  3HFK A;  1CUL A;  4O44 A;  4A8M P;  4IKA A;  4KGZ B;  5F0W A;  4AE5 A;  4CO5 A;  2AV5 A;  3O3L A;  1TUV A;  3D7S B;  1KBR A;  1X0F A;  3DOM B;  4D3G A;  4DQP A;  2VFT A;  2L08 A;  1C0T B;  3D0I E;  1RT1 A;  1RT7 B;  3HD1 A;  4LQ9 A;  1TFY A;  2KZM A;  1TL7 A;  2ZDO A;  1TL1 A;  2CQC A;  4ED6 A;  2RDI A;  5HRO B;  1ZAW A;  4CLY A;  1SC1 B;  4YOE A;  3Q2T C;  1Q8B A;  4DG1 A;  4DV3 F;  4DV2 J;  3CJR A;  1WKJ A;  1IJE B;  1RBL A;  3BBC A;  3CED A;  1PJ6 A;  1RAA B;  4CRJ A;  5HMZ A;  1CJT A;  2C1E B;  4JI3 J;  1WKL A;  4M5D A;  3GFZ A;  5K8M A;  1TMM A;  2QV6 A;  1NDC A;  4DBQ A;  2LA4 A;  1M5H A;  4IG0 B;  4R8U A;  4A8Q A;  2C3O A;  2ZHA A;  3TQ1 A;  1PSD A;  4X4T A;  2ZVI A;  2B9X A;  3G6V A;  2OPR B;  4GVB B;  1UKU A;  1FRJ A;  1FEE A;  2O66 A;  4P7V A;  1TAU A;  1ZAX A;  3I5C A;  1NXI A;  3NBP B;  3MOJ B;  3TRG A;  2DGT A;  1QE1 B;  5HL7 Q;  1RT2 B;  1X4F A;  2QEX S;  4QYR A;  1QLN A;  1DQ8 A;  1RIS A;  2E5G A;  3OR1 B;  5F3T A;  2YNG A;  3AT1 B;  3W9H A;  4EO8 A;  1HFE L;  3MEC A;  4MIW A;  4ETX A;  4ZJO A;  4TKT A;  5KFM A;  4WFA Q;  2D3O 1;  1LW2 A;  1HNZ F;  1OSD A;  3TZW A;  3DLJ A;  2E5H A;  1DAX A;  2V2Q A;  4IFV A;  3M32 B;  5GAE U;  1SL2 A;  2YKM B;  1J5E F;  3T5H A;  1FNX H;  3CCQ S;  2GIQ A;  1HQU B;  1D0E A;  4DN9 A;  2VG6 B;  3S8S A;  1KHW A;  4DL4 A;  4NLW A;  2XUL A;  3U1L A;  2UP1 A;  1RLC L;  1UL3 A;  3JTP A;  1WG5 A;  2PI4 A;  4ZIW A;  1W25 A;  2F8M A;  2FZC B;  5DS7 A;  4OX8 A;  1SKU B;  2WB4 A;  1K44 A;  2ZH9 A;  1U6B A;  1NK4 A;  1IBM F;  4OZ0 A;  2DH9 A;  1S0M A;  2RML A;  3I87 A;  4I2Q A;  4P73 A;  3M6U A;  4K5S A;  4NYZ A;  3UPF A;  5EWE A;  2AHO B;  2HK3 A;  1WI8 A;  3CJ0 A;  2D1C A;  4NZ6 A;  1T8E A;  1KHV A;  4DL3 A;  1SIW B;  3QGI A;  2HQD A;  1JLF A;  3OVB A;  2E1C A;  3HFZ B;  4DPX A;  1F5A A;  5EHH A;  3QO9 A;  2NXN A;  3JSY A;  2HHP A;  4JI8 F;  2CQD A;  2P6T A;  4FPI A;  4FBT A;  4LQ3 A;  2Z2L A;  3KYL A;  5K8O A;  4EBE A;  2XYG B;  2EFV A;  4P74 A;  1RTH A;  1N88 A;  3UO0 A;  5C25 A;  2R4F A;  2RUG A;  1RZM A;  1T0T V;  1NCL A;  2F7V A;  2LEA A;  2WW4 A;  3GIR A;  2JC1 A;  1BGX T;  1WAC A;  3RTV A;  4DFM A;  3J7Z T;  1L3S A;  4GKJ F;  1GXL A;  2XZW A;  2PO4 A;  3FEX B;  1FJG F;  3C16 B;  1OPZ A;  4OYW A;  3SV4 A;  2YKP A;  3AH6 A;  1HBM A;  3I9V 9;  5IXU A;  1RHQ B;  5E0O A;  3G87 A;  3AQP A;  3DC2 A;  3GZ7 A;  5ETL A;  3R5D A;  2BM0 A;  1RWO B;  2DR5 A;  1HD0 A;  3M6X A;  1RXO B;  2V67 A;  3TJA A;  3RZA A;  3KNG A;  3SMZ A;  1GTE A;  1W26 A;  1KWM A;  4F67 A;  2LYV A;  2JFK A;  4CO0 A;  1NSP A;  1R0C B;  2ZJQ Q;  1DHM A;  2HBY B;  3KG0 A;  4OX6 A;  1WTF A;  3BH7 B;  4H4M A;  2HFS A;  3S6E A;  3J81 Y;  4HL9 A;  4AUK A;  3MI7 X;  3HT3 A;  3L7U A;  1FDN A;  3H5U A;  4TU9 A;  3OTB A;  3KJQ B;  1IBL J;  3UNY A;  2VPZ B;  2CG4 A;  3RAM A;  2VC0 A;  2XMT A;  5B0G A;  3CJ8 A;  3N5B A;  4RBT A;  1GMW A;  2CNK B;  4OHV A;  2EVZ A;  3A12 A;  4L72 B;  5H9F J;  4ECY A;  1N0V C;  5KFS A;  1U1L A;  4LFC F;  2DBB A;  2Q3P A;  2DXF A;  1H38 A;  5AXK A;  1CC8 A;  3MAA A;  4I69 A;  1VQS A;  5D78 A;  1S49 A;  2KB2 A;  2ZBI A;  4Q0B B;  1OY6 A;  3ENW A;  4NI2 B;  1C4C A;  4OZ2 A;  2QSF A;  3RJM B;  1MNE A;  1IWG A;  2CQH A;  2SXL A;  2J7W A;  3W2V B;  2ZZT A;  3BDE A;  5D0H A;  3CC7 S;  9RUB A;  1T3O A;  3D6H B;  3MM6 A;  3MHY A;  1VDH A;  4RZR A;  2MY8 A;  4C9D A;  3VGS A;  1FWK A;  2CPY A;  1P27 B;  4XDC A;  3IM8 A;  1E6V A;  2AD9 A;  1HI8 A;  1ZOT A;  3MMB B;  3QAU A;  5HQ8 A;  5IC4 B;  3B78 A;  5I42 B;  2G0I A;  5EX0 A;  2AW0 A;  2ZH5 A;  2HZA A;  3ENV A;  2HYI B;  4ELT A;  5KT3 A;  1M1K T;  3LAK A;  4RW8 B;  3BEG B;  4DR5 J;  1NJY A;  1N34 F;  1GXU A;  1UEK A;  2OPQ B;  2VQE F;  7AT1 B;  4P71 A;  5DGB A;  4K4U A;  1VQK S;  2RRA A;  2Y8W A;  5T41 A;  3Q2S C;  1IKY B;  2CZ9 A;  2N3L A;  2YNF A;  2ZOG A;  3CIM A;  3EVO A;  2UUB J;  1A9N B;  2PII A;  2D69 A;  1UFW A;  3O5T B;  4K4W A;  1T94 A;  2V8G A;  4U95 A;  4X64 F;  5IFM A;  4JYA J;  1RI7 A;  1U24 A;  1FT8 A;  3NAH A;  1TR0 A;  4WFY A;  2HQ3 A;  3HVT A;  2YKN A;  3OL8 A;  3LAL A;  3EM1 A;  1HBN B;  2NXJ A;  3BB5 A;  4R0J A;  3K59 A;  5DGA A;  4DR4 J;  4PQU B;  5CYM A;  1ARO P;  3JQM A;  1QAX A;  2CJB A;  2XNR A;  5RUB A;  2XMA A;  5GAG U;  5AE1 A;  4ID5 B;  1R8A A;  2G1H A;  1NJX A;  2ZD1 B;  1FFS B;  3L09 A;  3DRP A;  4R0E A;  3H4B A;  1HL6 A;  3W64 A;  3G82 A;  3MFH A;  4EBC A;  1RWK B;  1UFL A;  2HSE B;  2OFG X;  2FQQ B;  5E2Q A;  4IFV B;  1IM6 A;  3M32 A;  1M1H A;  1QJH A;  3NGT A;  2IA6 A;  5D15 A;  3N5F A;  2NZ4 A;  3HSD A;  3MWB A;  5L46 A;  3FC9 A;  3ZZR A;  2W24 A;  3SBM A;  8RUC A;  2B8P A;  2RKI A;  2AWZ A;  3QT8 A;  3HPO A;  2NUH A;  1IBM J;  4ZVF A;  4ZVH A;  3FK4 A;  3IR6 B;  4YHH F;  3OVS A;  4OI6 A;  2KU7 A;  3ZC4 A;  1P8G A;  3RW6 A;  2OPP A;  3QT6 A;  1NEE A;  3JSR A;  3SIP B;  5C5J A;  3NRB A;  3V4I B;  4X64 J;  2ZKT A;  1U45 A;  2FLP A;  3PDN A;  4M8L A;  3K58 A;  2BEF A;  2JHE A;  4Y6I A;  4PQA A;  3I4H X;  1KFD A;  1SC3 B;  5JUM A;  1JLB A;  3OW2 R;  4WKR A;  1XWL A;  3NCQ A;  1S1X B;  1N5Q A;  3PG9 A;  1J5E J;  1XNR J;  3BQ0 A;  4K0K J;  2DHG A;  3SDE A;  3I0R B;  3LGN A;  4YB6 A;  4DV4 J;  1IWA A;  4LSL A;  5LXR A;  3PRB A;  2I38 A;  1QTM A;  1IM4 A;  1AUS L;  1FWL A;  4USU A;  2YKN B;  3RGI A;  2HAI A;  2V34 A;  2XI2 A;  2X1B A;  3DMJ A;  4PAA A;  3PV8 A;  1DZ5 A;  4OJ1 A;  1ZH5 A;  2R7S A;  3OFH A;  2XC9 A;  2NYI A;  4OL8 A;  1S6P B;  1KC8 T;  2FDN A;  3LF0 A;  2WAQ D;  1LK5 A;  2W8L A;  1L3V A;  5LMN J;  1VR6 A;  1U49 A;  1NSQ A;  1NHK L;  2C2M B;  4NCG A;  4OX9 J;  2UU9 J;  2MGZ A;  1UVM A;  2UUW A;  1PYO B;  3V6D A;  2HZC A;  2QL5 B;  2NPF A;  2VG7 B;  4O4G B;  4X4O A;  3KMQ A;  5LJ3 Y;  4DR6 J;  2BOP A;  3KFW X;  5FII A;  2ILZ A;  5C2C A;  4FF4 A;  5A6P A;  3AXK A;  3B8H A;  1Y7P A;  3TA1 A;  1MN9 A;  4ZLN A;  3HT0 A;  4DOZ A;  3RB6 A;  1Q86 T;  3A3N B;  3O44 A;  2QX0 A;  3RRK A;  4I7F A;  5J2M B;  2MY7 A;  1UVI A;  2DRA A;  4DF4 A;  1SIZ A;  1LWC A;  1FEH A;  3CDE A;  3AD9 C;  4JP8 A;  4LR7 A;  4QIF A;  4RNF A;  3OSN A;  5E3R A;  1KD1 T;  2ASL A;  2YPY A;  2DGO A;  4O4G A;  2Z2Y B;  4IG3 B;  4CTA B;  4WIQ A;  5BR8 J;  1JJH A;  2A18 A;  3HSJ A;  1GAO A;  1JJ4 A;  2VKZ G;  3C19 A;  2YWW A;  1D09 B;  3PW5 A;  1CVJ A;  3GFH A;  3LP2 A;  5GAD I;  2UXB J;  1RA6 A;  2OEM A;  4RX6 A;  4M5H A;  4HHU A;  1HAR A;  1Q78 A;  3BGO P;  1HYS B;  1RB0 A;  4DG1 B;  4DV6 J;  2BR0 A;  1SJ4 P;  4JI0 F;  4DQI A;  4F4X A;  2E5L F;  4XDD A;  1FRL A;  3CB4 A;  4V19 X;  4IRC A;  2X1F A;  3G86 A;  4ECQ A;  4Q8F A;  2VA3 A;  3KLI B;  1FKP B;  2LXI A;  4RBU A;  5KT7 A;  1JLF B;  1S0V A;  3RBZ A;  4JI3 F;  5L8R C;  4ZJL A;  1NU4 A;  4C3M A;  4RL1 A;  2W7A A;  1ITP A;  2VL1 A;  2PT0 A;  3K8W A;  4DZD A;  2MST A;  4MK8 A;  4ZN1 A;  1M5K C;  2YWH A;  3K57 A;  2BUN A;  2LQJ A;  2WVF A;  5A0Y A;  3ZZY A;  3KLF B;  1UW9 A;  3SV3 A;  4ED3 A;  2HKE A;  3QT7 A;  2XZT B;  3CXC R;  3CUL A;  1WD6 A;  1X4G A;  2BMB A;  2D3U A;  3P4U B;  4WYW A;  4Q0B A;  1HLW A;  7FDR A;  1GX5 A;  3LOU A;  3POT A;  3CNQ P;  4MK7 A;  1RTZ A;  3OBI A;  3M9N B;  1DTT A;  1N33 J;  4OI0 A;  2HBR B;  5J2P B;  3JSM B;  5CA5 A;  5K9F A;  2BAN A;  1RYR A;  2L48 A;  4DPO A;  1HNZ J;  4KGM A;  2VKR A;  2V4J B;  2WBR A;  3QLH A;  2R7X A;  1YX2 A;  2MQ8 A;  3CCM S;  4CCH A;  5KT5 A;  1TU0 B;  4N56 A;  3MCN A;  3TYT A;  2XO7 A;  4YME A;  2RDJ A;  1S1T A;  2QE5 A;  3DXB A;  4QR0 A;  4ZPT R;  1S0N A;  2DNZ A;  1RTI A;  2J9D A;  2BE2 A;  2BW7 A;  2XG8 A;  1E6Y A;  3DKD A;  2NSB A;  4UY8 T;  4OZ3 A;  1T05 B;  3NWR A;  3NNH A;  2KFN A;  4CM2 A;  3MCS A;  3KLV A;  1NPP A;  2ZD1 A;  1T95 A;  1S6U A;  4QR2 A;  5HJX A;  2MZQ A;  2C28 A;  1M5V C;  2B9Y A;  2I8E A;  4P2M A;  2CIM A;  1KLN A;  2HQF A;  2R7U A;  5FLX U;  1UVK A;  2HWH A;  2MHE A;  5C24 B;  4FVC A;  2QO3 A;  4HVZ A;  3GQC A;  3H5X A;  1WKK A;  2LEP A;  4WPA A;  4ZPB A;  5SUH A;  3W5Y A;  5DQI A;  2BQU A;  1MRO A;  1Y3J A;  1S1X A;  2GHW A;  2ZE2 A;  3U1N A;  3CCU S;  1JKH A;  1YRU A;  4YB7 A;  1C4A A;  5KG4 A;  4WP9 A;  3M8S A;  3FJ2 A;  4FF3 A;  3BGL A;  4P10 A;  3X1L B;  4ECU A;  4G1Q B;  4BBY A;  1N56 A;  3LGM A;  3KWM A;  1NDK A;  2OMO A;  3DRR B;  2R7O A;  1FDA A;  2ROG A;  3MCO A;  3B4M A;  4NE9 C;  4CDI A;  3KUG A;  1RAE B;  2H51 B;  1P1L A;  3E8O A;  4C97 A;  3CJ3 A;  2QLW A;  1S6Q B;  4DU8 A;  2AU0 A;  1BY9 A;  3CC4 S;  1U0H A;  4J9P A;  3TR5 A;  3PZP A;  2FUG 9;  1H98 A;  1NO8 A;  4IH5 A;  3NKY A;  4PG5 A;  1TL3 B;  4ECW A;  2E1P A;  4MKB A;  2AGP A;  4C8K A;  5GAG I;  2HUR A;  3LAN A;  5HQL A;  3PJ9 A;  2VIC A;  2AYB A;  4LF7 J;  3BS9 A;  3T9Z A;  2MEW A;  3M1V A;  3BSA A;  1NSK L;  4P7T A;  1EJ7 L;  4H4M B;  2NXC A;  1CS4 A;  2AJ4 A;  2HGL A;  2YWF A;  5LL6 d;  3ICL A;  1REG X;  1VQO S;  3VF0 B;  1FES A;  1NSA A;  1JLB B;  1VK8 A;  1WEX A;  2Z8Q A;  3Q8U A;  3KG1 A;  4GO7 X;  4MYU A;  2F8E X;  5B7W A;  4QW9 A;  4IFY A;  4NXM J;  4NCB A;  2CPE A;  1RHK B;  4DUZ J;  3ILO A;  1S99 A;  2AZ3 A;  2QIF A;  3DHW C;  4LSN B;  1U1P A;  1HD1 A;  2OPS B;  3W2W B;  2UV8 A;  3Q24 A;  5HBM B;  2QMX A;  3EGW B;  4NLQ A;  4KRW A;  4XPE A;  1L3K A;  1RKI A;  2FLO A;  3OL7 A;  1NKC A;  4I0W A;  5EGY A;  2UUA F;  2IVY A;  3AOC A;  2CUY A;  3GSI A;  1AB8 A;  3LP0 B;  4C11 A;  3W8P A;  3OUY A;  1VC0 A;  2CQ2 A;  1ZS6 A;  3P3D A;  2RNE A;  2MKC A;  2U2F A;  2DH8 A;  4JI6 F;  2ASJ A;  5GMD A;  3ZNU A;  3DOM A;  5D4L A;  3MED A;  1R0A A;  2VA2 A;  3MM7 B;  2KT3 A;  2FJA B;  2R7Q A;  3G71 S;  2QGF B;  4QYZ K;  2ZH7 A;  2J76 E;  1TUW A;  3HHL B;  1L3U A;  1C2P A;  3OR1 A;  5K14 B;  2KXN B;  1I94 F;  3DGP B;  3LPE A;  1EAR A;  1Q81 T;  4B3S J;  3CPW R;  3SI8 A;  5F9L A;  3SFU A;  1U1N A;  1FCA A;  1HNV B;  3W7B A;  1DUR A;  3ETO A;  2JZ5 A;  2QYC A;  1KKH A;  3CTR A;  3MOZ A;  3ZTP A;  4WU3 A;  4DPW A;  4LF5 J;  1T03 B;  1S48 A;  2V2Z A;  4CH0 S;  1KSP A;  4AL5 A;  1N5Y B;  4PG4 A;  3M2U A;  5G0R B;  5GAE I;  1B7Y B;  2ABY A;  2F1F A;  1F3V A;  1RHR B;  2F8H A;  2FJW A;  2AP6 A;  2XMK A;  4BCA A;  2BDP A;  1MU2 A;  2LQ9 A;  4A47 A;  5ETM A;  4K4Y A;  2I2Y A;  4U7U D;  5HAN A;  4ETZ A;  4RNN A;  1XEZ A;  2NSC A;  1FRX A;  2KM8 B;  4KY3 A;  2MKK A;  2HHW A;  4DV1 J;  1R7I A;  3JB9 k;  4WP8 A;  2QMW A;  4AYB D;  1LFP A;  2RQ4 A;  1I3O B;  4QQB A;  5I3Q A;  3DLE B;  2E9T A;  4JBC A;  2FVP A;  1JXE A;  2M8D B;  4PPZ A;  2L9W A;  1KVK A;  4FXD A;  3DDI A;  2ACM A;  4V19 J;  4X4N A;  3EIC A;  2D7S A;  3UDL A;  1DAR A;  1OMS A;  3G82 B;  3IC1 A;  4OZ1 A;  2CZ4 A;  4UF4 A;  3GR1 A;  4CIO A;  1U48 A;  3L4B C;  2V4Q A;  4O3R A;  2B0G A;  3A8E A;  2L9N A;  3I9Z A;  2C3Y A;  3DOL A;  3IR5 B;  3OJU A;  4P2S A;  2CA9 A;  3UR0 A;  1YTY A;  1FNM A;  1S9E B;  4O3Q A;  2E1A A;  2BA9 A;  1P1T A;  1SJQ A;  4XTT A;  4X4V A;  5CZX A;  2YNI B;  4LBH A;  1EKS A;  4QW8 A;  4RW9 A;  4NAS A;  5HQM A;  2ZH3 A;  3T1H J;  1X5S A;  3UFC X;  2CDQ A;  2DCU B;  1PKU A;  3GG0 A;  4OZN A;  2Y1I A;  1QSL A;  1XNQ F;  1F9H A;  1UJ5 A;  3A4T A;  4DCP B;  3HHL D;  3CCL S;  1BWE A;  2HFO A;  3PYE A;  2R8G A;  4KSE B;  4M5G A;  2O5D A;  3FMB A;  2DRD A;  3W5Z A;  3C15 A;  3IO1 A;  3CD5 A;  4KO0 A;  4C8N A;  2YX7 A;  2GC8 A;  4WTY A;  4CYU B;  3JS9 A;  4WTO B;  4IRD A;  2I9S A;  3ENQ A;  2VFV A;  2ROE A;  1S1T B;  2VG5 B;  1YJU A;  3DYA A;  5E5N A;  1QDU B;  1KQS R;  5AE2 A;  4JV1 A;  1YJT A;  2CG8 A;  2F40 A;  2MZT A;  1C1B A;  3H2V E;  4ZLJ A;  1IBK J;  3BGR A;  2C2Z B;  2YBV A;  5I3P A;  5KFR A;  4DFK A;  4CO2 A;  3FCH A;  4WFN Q;  2RUS A;  3IA0 A;  3SSR A;  3EZ5 A;  1A7G E;  1YHQ S;  4PWD A;  2PFF B;  3BGU A;  4M5K A;  1Q0N A;  4ILR A;  2L9D A;  3UR3 C;  2BKP A;  1Y9O A;  4DV0 F;  1SKR A;  3RAX A;  4MFB A;  3WC2 A;  3ZTQ A;  3W9J A;  2H4Y B;  3CJ4 A;  1JNZ B;  2VOP A;  1RT4 B;  2AKW B;  2OJ3 A;  3JTO A;  3HJF A;  3NOC A;  2HQC A;  3K0J A;  3MCM A;  1R6Y A;  2BM1 A;  3MM5 B;  5A2Q Y;  4C3K A;  3PFO A;  2MYF A;  3NP5 A;  1Y5I B;  2OGU A;  5KFX A;  4FXV A;  3JQK A;  1N5V A;  5HI7 A;  2P2C B;  2B7C B;  2HHV A;  5JXS A;  5HSP A;  4NLX A;  4DV4 F;  3MUR P;  1VRU B;  1S0O A;  3U1M A;  3THT A;  1RAB B;  1YVF A;  3I5A A;  3GG1 A;  1URR A;  2YY3 A;  1H7W A;  1UWB A;  1SI9 A;  2H5J B;  1N5S A;  2ZJR Q;  4OYM A;  2BKO A;  3TUP A;  1AFJ A;  4TNO A;  2ATC B;  1LXN A;  4UUW A;  4OYI A;  5KFJ A;  3J7A N;  1JLQ B;  4W4M A;  2B5J B;  1IBL F;  4GVB A;  3D54 A;  3BSC A;  1P9Q C;  4CNY A;  1N32 F;  4PXC A;  4TQR A;  1QD1 A;  1PG5 B;  4AQY J;  2XCA A;  2HG4 A;  3V4M A;  4DR2 J;  2HW3 A;  4OJ3 A;  5DJB A;  3V4I A;  2XLK A;  2GA7 A;  4HTJ A;  4DV0 J;  1T05 A;  4LFB F;  1CPZ A;  1RSC A;  4DR5 F;  1Y3K A;  2Q6C A;  1X9W A;  3PYG A;  4DWI A;  5A8W B;  2CJA A;  3GU0 A;  3D1Q A;  2W25 A;  4N7T A;  1FFG B;  3RB4 A;  4LF9 J;  4IOA Q;  3TW0 A;  4FYX B;  2RAQ A;  1S6Q A;  2OSQ A;  4NLO A;  5BJR A;  2CYY A;  4MKY A;  1UPP A;  1HKA A;  2JOQ A;  3R9L A;  4HR2 A;  2DGV A;  1RWM B;  2XYH B;  4ES2 A;  3T3F A;  1XK8 A;  2JLF A;  2XNQ A;  3D0H E;  4ICL B;  2PMZ D;  3GPA A;  1FTR A;  1FK9 B;  1V5I B;  4FPR A;  3H2U B;  3OTO F;  4DUY J;  2XS2 A;  1LWF B;  4TU8 A;  1G3O A;  3FQK A;  1OY8 A;  4P9S A;  3OHA A;  3K5N A;  3KLH A;  4JI7 F;  4XK8 C;  3D4J A;  4JI0 J;  2D3O R;  3NGD A;  1WHV A;  3G8Q A;  1LWX A;  3IBF B;  4DV1 F;  3BJY A;  3DM2 A;  4DXL A;  1RBA A;  1SH0 A;  3R7N B;  2Q6B A;  4ZVO B;  5THW A;  3W65 A;  2CRL A;  3ZZP A;  2W4C A;  5IT0 A;  3H5Y A;  1B3T A;  2OTL S;  1Q79 A;  1TTH B;  1PAE X;  2AJ1 A;  2XWY A;  3HDS A;  1C0T A;  3HUL A;  1ZM4 A;  4V1A k;  2YH1 A;  1N36 J;  2KTQ A;  1V3S A;  1TVR B;  1DRZ A;  5K5M A;  4DZ6 A;  3TZY A;  3HK2 A;  1VQ7 S;  3LAM A;  1BE4 A;  1TKX B;  3QAE A;  1UFK A;  4RNO A;  3M9O B;  1K9M T;  2RIJ A;  1WF0 A;  2N82 B;  4IOC Q;  1ZTT A;  1IBC B;  5LXY A;  4YN3 B;  1H0H B;  1QSS A;  2QSW A;  4DS5 A;  1XMQ F;  3KJV B;  2ZWO A;  3DLG A;  3NNA A;  1WOP A;  1YI2 S;  3G9C A;  3D9B A;  2DNP A;  3W2W A;  2CJK A;  5E33 A;  2DVI A;  2WBM A;  4ZVQ B;  4PCQ A;  1JLG A;  1HIY A;  2BJ3 A;  5AJ3 J;  2UUC J;  1FKO B;  1TAQ A;  3FVY A;  1WC3 A;  3VTI A;  5IV4 A;  2QLB B;  3QIP A;  4H4K A;  3UDV A;  5H1S V;  3WC0 A;  5A8R A;  1LV5 A;  3DOL B;  4CZC A;  2XMV A;  3IRX B;  4ECV A;  4B3T J;  5C2G A;  2FD2 A;  5KFD A;  2VG7 A;  4YR3 A;  3MR6 A;  1VQP S;  1M5P C;  2BYC A;  2LDI A;  3KJV A;  5M2P A;  2DGQ A;  3GFX A;  1O51 A;  4OYP A;  1MML A;  3HHE A;  2ACY A;  4QIV A;  4RBV A;  2K1R B;  2VB6 A;  1K0V A;  3FMW A;  2XWX A;  3ZFV A;  1H74 A;  4ED4 A;  3AD7 C;  1F3F A;  2CDR B;  2HK2 A;  3B4D A;  4L3K A;  4MT1 A;  3UN3 A;  1NK8 A;  1SL0 A;  1IKX B;  3PO5 A;  5F8I A;  2KXF A;  3CWJ A;  3Q8V A;  2UZA A;  3C15 B;  4KO0 B;  4B3M J;  5D4N A;  2HFV A;  2W2N P;  5J1P A;  4DDF A;  4OZL A;  1U2C A;  2MZ1 A;  2K1R A;  2NCK L;  1G1X A;  4RW4 A;  2AX1 A;  2N7Y A;  3MDF A;  5IC6 B;  2GCF A;  2WZ1 A;  1YGY A;  1JJC B;  2C42 A;  3RW7 A;  1HNW F;  1TK0 A;  3QBC A;  5E7O B;  4YY3 J;  1IR2 A;  2O01 C;  2F9J A;  3O8W A;  3UVJ B;  3RG6 A;  1NND A;  3IG1 B;  1KVI A;  1HQ2 A;  4OV6 A;  1D3W A;  2B7B B;  3SCL E;  2N7C A;  2VG6 A;  3VZH A;  1E6V B;  2HND A;  2PGC A;  2XGP A;  2LQB A;  1TQL A;  4PR6 A;  5KFU A;  1VQM S;  3G8T A;  3ZTO A;  1UVJ A;  2V8D A;  3BR9 A;  2ZJP Q;  1X5P A;  4USI A;  1U8W A;  2JEF A;  2EFO A;  1HW8 A;  1EAY C;  2DNG A;  1UVL A;  3C16 A;  2HVI A;  2GHP A;  4XO0 A;  2E5L J;  1FNO A;  1TL4 A;  1GQE A;  1IQZ A;  1CJV B;  3M8W A;  4UUX A;  3K5L A;  1RU1 A;  2QA4 S;  5IS2 A;  4RWW A;  3VAG A;  1VHI A;  4ECS A;  5I4M A;  2EK6 A;  2GVZ B;  2OLW A;  1F6T A;  4X4P A;  2J0Q D;  1X4C A;  5HO4 A;  3QZ7 A;  4Q2L A;  3A3O B;  4LR9 A;  5ETP A;  3BGF A;  5U47 A;  4JI8 J;  2UVU A;  2RRN A;  1VQ8 S;  1ZTW A;  4B3R J;  1UZH A;  1NDP A;  2B9E A;  4RPF A;  4WXO A;  5FJ4 A;  5GAH I;  3M2U B;  5G0R A;  2AGQ A;  4CLF A;  1J5O A;  2ADC A;  4BLG A;  4C8Z A;  1C0U A;  2F3J A;  2CVI A;  3JAM U;  3HLU A;  3ULH A;  3I0S B;  2HFZ A;  2KZZ A;  2QT7 A;  2JSX A;  2CNL B;  1TKT A;  1J27 A;  3CVK A;  1AZS B;  2DNM A;  1LWE A;  2ZC4 A;  4DV6 F;  3P49 B;  4IQX A;  3KLF A;  4NA2 A;  3SCI E;  2LEB A;  2CQ0 A;  4ZPW R;  2VAS A;  5AXN A;  2AZ1 A;  4J7C A;  1XIQ A;  4OX7 A;  3GV5 B;  4HHJ A;  1DLO A;  1KFS A;  4JV5 F;  1GK8 A;  3U27 A;  1A0O B;  3VHQ A;  2KFZ A;  2W9B A;  3KHR A;  3NNC A;  2IPO B;  1Q95 G;  2PDA A;  3VAJ A;  5AXL A;  2I6W A;  1IKY A;  4DSF A;  3NMR A;  1FKP A;  3CD0 A;  4ZOS A;  1FXL A;  1Z1Z A;  3S7R A;  4FF1 A;  4NZ7 A;  1XBW A;  4MH8 A;  3J81 j;  5I3U A;  4NLU A;  5F8L A;  2R7W A;  4X65 J;  4C3L A;  5F8N A;  5F9N A;  1REV B;  3I56 S;  2QFJ A;  2AMC B;  2RHS B;  3D68 A;  4GVL A;  4DV2 F;  2RS2 A;  5HBM A;  1NB2 A;  1VC5 A;  2KXH A;  4ECT A;  4J9K A;  4XPC A;  1WTB A;  2CJY B;  3K8V A;  4KGV B;  2VV5 A;  3KKF A;  2P6S A;  4OJG A;  4OLP A;  1SKW A;  1MG7 A;  4RW6 B;  2OEK A;  2ZFH A;  4FKY A;  4LSL B;  2MHN A;  4PAB A;  1ULR A;  4LRA A;  4ES3 A;  4OLO A;  1U1R A;  3PHT A;  3ELH A;  1SXL A;  1TP7 A;  3GIK A;  1RT3 B;  2G9O A;  2BAB A;  1NPR A;  2IDE A;  1BQM A;  2CVE A;  2KYX A;  4K7Q A;  4L3N A;  4RW7 B;  1UWB B;  2ZH8 A;  2A6O A;  4FNH A;  4KR0 B;  1X9S A;  1QAJ A;  2DR8 A;  2HHX A;  4YFU A;  4GO5 X;  3F41 A;  1T3N A;  4KAI A;  2AIR B;  1YJW S;  3ISN C;  3SQG B;  4Q45 A;  1KQK A;  3DRR A;  4PWU A;  1R27 B;  5ETT A;  1JX4 A;  1RAI B;  2BE9 B;  3H42 A;  1S9G A;  2E5I A;  2Y9H A;  1CLF A;  1OO0 B;  3QWU A;  3HHL C;  1DLO B;  1LW2 B;  1NZA A;  2OPQ A;  2YKO A;  3D67 A;  1YG0 A;  4UST A;  1Q1K A;  3D3C J;  3KLG A;  1BC6 A;  2C3M A;  1CSJ A;  2GO9 A;  3HI9 A;  3IRX A;  2OH2 A;  3V6H A;  4L6V 3;  2O1P A;  3P96 A;  4IDK B;  4F4Z A;  4QR1 A;  2G2O A;  3D66 A;  3AQO A;  4Q5V A;  4J9O A;  4C8O A;  1X8D A;  2HFN A;  3KK2 B;  5KG2 A;  1LW0 A;  2CAJ A;  4HT7 A;  4IO1 A;  3GMG A;  3HF5 A;  2NS1 B;  2ZKU A;  3IG1 A;  1EX8 A;  4NZ0 A;  2MDA A;  3VVU A;  3KJF B;  1RAH B;  4M5N A;  3LWL A;  4QOT A;  2HND B;  3JXO A;  3KXD A;  3OFF A;  1HWU A;  2XMU A;  5KFZ A;  4ZIV A;  3KLG B;  2M0G B;  5L1K A;  3IN5 A;  3BV8 A;  3V6K A;  3CDU A;  1JLA B;  2AYE A;  5KFQ A;  3ILI A;  3HXM A;  2XBP A;  5IT9 U;  2IAJ B;  2KI2 A;  3D6T B;  3D6F B;  2P9G A;  2DNY A;  2KRB A;  1TL3 A;  1TKX A;  2LDY A;  3T1H F;  1IN0 A;  2FHM A;  1HPZ A;  1WF2 A;  3BM7 A;  2MKJ A;  2DJW A;  1TL7 B;  1SJ3 P;  1NB7 A;  3DRY A;  2WW8 A;  4LF1 A;  2O67 A;  3IAS 9;  3FEZ A;  1H72 C;  3FDS A;  3ISZ A;  3OQ2 A;  2DNK A;  2OHD A;  3QWP A;  4NLR A;  3DI6 B;  2GMJ A;  5GME A;  4ZLL A;  1PC5 A;  4ED7 A;  2KN4 A;  2FLL A;  3PX0 A;  3IMQ J;  4L76 A;  2I0X A;  3SDE B;  4HT5 A;  5IT9 Y;  2FGC A;  5ETS A;  5G4D A;  3C6T B;  1CUL B;  2HRU A;  1GX6 A;  1DTQ B;  3SFG A;  1KEK A;  4LF5 F;  2GGP B;  3QIP B;  4NLG A;  1GXT A;  4IG3 A;  2WK4 A;  2IDL A;  4FBU A;  4F3O A;  1FE0 A;  2IYI A;  1UWA A;  2N4D A;  3CGI A;  2JDJ A;  1GFW B;  3W9I A;  3AJ1 A;  8ATC B;  2AX0 A;  2H4W B;  1Q82 T;  4AL6 A;  4QU6 A;  4KH0 B;  1SVD A;  3N01 A;  4IDK A;  3NGS A;  4J9U E;  2WVB A;  4ZVP B;  4C8M A;  5L9N A;  5J2N A;  4B9U A;  2CKW A;  2YNH A;  3IFE A;  3MR5 A;  1IKX A;  4WU2 A;  3ADA C;  3EUN A;  4A8O A;  2GZO A;  4HHH A;  1X5T A;  2L3M A;  3TAR A;  1X4E A;  4H54 A;  1VBK A;  3L7P A;  4R5P B;  3GV8 B;  3FEY B;  3EZO A;  4QWE A;  2PN6 A;  1RWW B;  4ZHR A;  1FRI A;  3CD7 A;  3THP A;  2JC0 A;  3CCR S;  1PO6 A;  2DRB A;  2GVZ A;  3M2R A;  1Q7Y T;  1NPK A;  1BD6 A;  4KFB A;  2V2V A;  2VBW A;  5DDR C;  1N4L A;  4GKJ J;  4C4W A;  4HAC B;  3GIL A;  4F8R A;  1RA7 A;  1MWQ A;  4RUC A;  4JUZ A;  4DL6 A;  2YX4 A;  3BBF A;  1RAC B;  2J8S A;  3PXG a;  3M05 A;  3DDK A;  3EGN A;  3WDO A;  2MQQ A;  2VFS A;  3MD1 A;  3U7J A;  2AJ2 A;  2CZV C;  3MPV A;  3Q8P B;  1NJI T;  3NS7 B;  3C46 A;  4CI0 B;  4LVN P;  3DU6 A;  2DTJ A;  1G6B A;  4NEY A;  3CDB A;  3H8Y A;  3N6L A;  3EPG A;  2QL9 B;  3HD2 A;  4HTI A;  3W63 A;  1KLM A;  1GMU A;  4N41 A;  2M88 A;  2GJF A;  1XR5 A;  5KAK A;  4ZVS B;  4F0H A;  2RJZ A;  3SZ2 A;  1R43 A;  1NDL A;  3TX8 A;  1HMV A;  2YX1 A;  3OLB A;  5F3Z A;  3HSZ A;  1BQX A;  3M2V B;  2WSF C;  3OUY B;  5KG6 A;  3LP0 A;  4JYA F;  4NRT A;  4U67 Q;  2ASD A;  5BR8 F;  2H48 B;  3AJD A;  3OVA A;  1QUP A;  2UV8 G;  2OD6 A;  1VLO A;  3VGT A;  3IM9 A;  5F8M A;  5D4P A;  5A8W A;  1SH2 A;  3CIZ A;  3R5A A;  4TVA B;  3I31 A;  3DMJ B;  3MEK A;  5K8N A;  3BSO A;  4RU2 A;  1V9O A;  2YXL A;  4UT4 A;  4OMF G;  4BC7 A;  2BJ7 A;  2ZWP A;  3QMQ A;  2XSJ B;  5GVQ A;  3JYT A;  3R2C J;  2OTJ S;  3GTY X;  1OPI A;  3OTO J;  2VD3 A;  2R8J A;  4J9M A;  5HAT A;  1OJ4 A;  4B08 A;  3HVT B;  4DR6 F;  2HLT A;  1XNQ J;  2ZNY A;  5E41 A;  4LVO P;  1R0B G;  1TK5 A;  3D28 A;  2B4U A;  3N6M A;  1LWF A;  3FKB A;  3K89 A;  3LW5 C;  3ZTS A;  3KK2 A;  1R89 A;  4IH6 A;  2XSJ A;  2HNZ A;  3JYT B;  4K4Z A;  2LQ8 A;  2V0N A;  1L5U A;  4ZS6 A;  5A76 A;  1TKD A;  5D8H B;  5I3U B;  4N5S A;  4F36 A;  4I1T A;  5KFI A;  1U0H B;  2GFF A;  4F3M A;  5B0F A;  2UXB F;  2J7K A;  1K1Q A;  3D0G E;  2XGQ A;  3FCW A;  3E2E A;  1T02 A;  4KKO B;  3LO3 A;  4ZP9 A;  2EFN A;  2VUG A;  2ZHO A;  5HVH A;  4RNM A;  2N4C A;  4HEA 9;  1ZPV A;  3CCE S;  1VJQ A;  1RT6 A;  2W9B B;  1VLY A;  1T9W A;  3E51 A;  3CD6 S;  2CQB A;  5ETK A;  1CBK A;  3WX4 A;  3GJS B;  3P5B P;  1RTJ B;  1X31 C;  2QJ3 A;  2MQM A;  3ZO7 A;  3BDP A;  1HBN A;  2ADB A;  2HIY A;  4EMD A;  2BJD A;  3DFE A;  3H40 A;  2OEL A;  3FZB A;  3M7V A;  1RCX B;  1HA1 A;  4WBF A;  1ZYQ A;  3TVY A;  4ZVG A;  2XI3 A;  1CJK B;  1RHM B;  1A6L A;  4YY3 F;  4TYB A;  4G65 A;  1Y5N B;  1RHU B;  3VR1 A;  1S1U B;  1SV5 A;  2J6T A;  2IRY A;  3RUB L;  3SSS A;  5KG1 A;  4PG8 A;  4X2B A;  4TLR A;  4OHZ A;  3WIU A;  5CD4 H;  1WJ9 A;  3NWG A;  4K4T A;  3LP1 B;  1M5O C;  4DL7 A;  4JV5 J;  2GMH A;  2E7V A;  5A8K A;  4P6Q A;  4BC9 A;  3OXF A;  4CO4 A;  1UEV A;  3IGN A;  4USV A;  7FD1 A;  1RTD A;  2HHH J;  1Y5L B;  1G7C B;  3W60 A;  2LKZ A;  3OXL A;  4YEA A;  4K0K F;  5KT6 A;  1KOO A;  3CT9 A;  3QYY A;  2QL7 B;  1XMB A;  3PEH A;  3VAM A;  1F1B B;  2M4M A;  3AA9 A;  2COL A;  3G4S S;  3EWG A;  1FX4 A;  2BX6 A;  4Q7A A;  2EW9 A;  3EZU A;  3UNG C;  2ALZ A;  1F9E B;  3TA2 A;  1NHU A;  2DYA A;  2F63 A;  2AF6 A;  3TWZ A;  1RAF B;  4NOH A;  5CZV A;  3DGV A;  3OTC A;  2VQF F;  2HFU A;  3AFG A;  4LF8 F;  3I55 S;  1WOS A;  2FVR A;  2M70 A;  3MXH P;  2AJQ A;  1ICE B;  2BRL A;  3GON A;  5B0B A;  4Z37 A;  5ETO A;  1M0S A;  1WSR A;  3HJV A;  3ZXW A;  4KHP J;  2FGO A;  3E01 B;  3MED B;  1WNE A;  4ZVR B;  5B0D A;  4EUV A;  4U6P A;  3V81 B;  3TUI C;  4M5M A;  4DUT A;  3HZG A;  2CQ1 A;  2FJB B;  1TFW A;  1SL1 A;  2HVH A;  2X1G A;  1TVR A;  3L95 X;  2ATL A;  1RYS A;  1JIH A;  3J80 U;  1YRX A;  1FVS A;  2FIU A;  4YDX A;  3VZI A;  3G96 A;  2HIQ A;  3H7H B;  1B4S A;  4F4Y A;  2JL9 A;  4ZMM A;  4QIW D;  4JI5 F;  3MTK A;  4KC5 A;  4Y2C A;  2NPI A;  2QTW A;  2RU3 A;  2RB7 A;  1NRK A;  2LXF A;  3M2R B;  2YNI A;  2RDD A;  2K2P A;  1YJ7 A;  3NBP A;  4NPO A;  5KG7 A;  4AL7 A;  1EET A;  2R3V A;  2FHO B;  2JVR A;  2W4D A;  1HI0 P;  1R3N A;  3KDN A;  3OHB A;  2V9K A;  3BR8 A;  2QA2 A;  4YR2 A;  2R2U A;  5D0G A;  4LRC A;  3BYP A;  3CMQ A;  4GKK J;  1H7X A;  1Y0H A;  2V8H A;  1VIO A;  2IFX A;  1QTN B;  1JLQ A;  3KHL A;  2IC3 A;  4X4Q A;  1DY3 A;  1S12 A;  1NK0 A;  1EKR A;  3Q8Y A;  4J5O A;  4U7U K;  2XB2 D;  1RU2 A;  1V3R A;  4DCO B;  4PPD A;  4DLG A;  3NXZ A;  4KQZ A;  4DSE A;  5C42 A;  1FER A;  1VHF A;  3FFI A;  3MEG B;  4B3S F;  2HRY A;  4P2X A;  2UUB F;  4JI7 J;  2R8K A;  4NA3 A;  4ED0 A;  3AXM A;  2XEX A;  4N8N A;  4JI2 J;  1DTQ A;  1HQE B;  1EQM A;  4EZ9 A;  2VFU A;  1EQ0 A;  2GAH C;  1UET A;  2K7K A;  4EO6 A;  1N6Q A;  1I5O B;  1JB0 C;  4EK2 A;  4K4X A;  1RTH B;  4CO1 A;  3M9M B;  2WOM B;  2ZNZ A;  4URQ U;  1BQN A;  3HM9 A;  3MZI A;  4C0O C;  2BJ1 A;  2DEI A;  2G13 A;  2NRE A;  4CWB A;  3F73 A;  1JLC A;  1UCN A;  2RU9 A;  2EPI A;  4ZCI A;  5H9E K;  4CM0 A;  3FRY A;  3OTE A;  2ASY A;  2V68 A;  2ZUA A;  2DXE A;  2BQ3 A;  2HHU A;  2Y3Y A;  5GMK a;  1RTJ A;  4FYW B;  1OSC A;  5MLC V;  1R8H A;  2V4R A;  4BS2 A;  4LRB A;  2RH3 A;  3A1Y G;  4M1K A;  1DQ9 A;  3D1O A;  4TQS A;  1H2T Z;  4IRK A;  2QZ8 A;  2CQ4 A;  1TMJ A;  2I5J A;  2J7U A;  2VG5 A;  3DYA B;  5ETN A;  1UEU A;  5LSL A;  4NRU A;  2KG0 A;  1U1K A;  1PIL A;  1UA0 A;  4ILM A;  2CQ3 A;  1KTV A;  1VQY A;  2OP5 A;  4G1I A;  3EYZ A;  3FBE A;  1AT1 B;  3IBW A;  2IVF B;  4Y00 A;  4D3H A;  2V4J A;  5KFP A;  3EPI A;  4J9S A;  2VON A;  4O0N A;  5DG7 A;  4QIE A;  4GC6 A;  2H54 B;  3MGJ A;  1XER A;  1SJR A;  2I5J B;  4FYV B;  4DX5 A;  2KRR A;  2J0W A;  1M90 T;  4WYL A;  4ZPA A;  4MFB B;  5ADZ A;  2JLE A;  2VOD A;  2KT5 A;  4K50 A;  5DET A;  2J6U A;  3ET6 B;  1ZM9 A;  1R8B A;  2R2S A;  1PIE A;  5FD1 A;  4RR5 A;  3V5R A;  2PI5 A;  4H4K C;  4OZ5 A;  1C1B B;  2R7V A;  5A8K B;  4OZJ A;  4ANC A;  1NKE A;  4PQU A;  4A8W A;  1ZET A;  2BJ9 A;  3PYD A;  3CCT A;  1RJJ A;  3DN9 A;  5KOX A;  4ED1 A;  2CAD A;  1JLC B;  1GMV A;  2CJX B;  2PMW A;  3NAI A;  4MAK A;  1KON A;  1YSJ A;  2MQN A;  2KM8 C;  4EYI B;  3MM9 A;  4R25 A;  3LGH A;  3QFW A;  4KFB B;  1U1M A;  2WVD A;  3GSD A;  2DNR A;  1B0T A;  2I1R A;  2PEH A;  5LMU F;  5F41 A;  2GAG C;  1U26 A;  2EBE A;  3A13 A;  4KKO A;  4LBP A;  4DPU A;  3TZX A;  2B4P A;  2KL8 A;  4ZKA A;  1AYE A;  4O0I A;  4RW8 A;  2FJE B;  4C11 B;  3TZZ A;  1MLA A;  2YQ0 A;  1YQH A;  2HQG A;  2NZC A;  1REV A;  4C2M A;  2A1B A;  2MKY A;  1F60 B;  3ETM A;  3TEH B;  4QBU A;  5I42 A;  3KK1 B;  4KTQ A;  3BN4 A;  2XLJ A;  2F9D A;  3DHX A;  1V6H A;  5AT1 B;  2YWK A;  2Q79 A;  3CJK B;  2ERR A;  5D77 A;  5KG5 A;  3EX7 B;  4KGK A;  3GV7 B;  2Z4P A;  5FLX Y;  1LEO A;  4ZDN A;  4ZVE A;  3QRQ A;  3VWS A;  4WE1 A;  5IWA F;  1HNV A;  1VCT A;  2QLJ B;  2V63 A;  4OX9 F;  4EWT A;  4PXD A;  1KTQ A;  5BYQ A;  4CLP A;  3MFI A;  3HHK A;  3KK1 A;  4IR9 A;  2B51 A;  1VFJ A;  2DK2 A;  2LU1 A;  2Y0B B;  4OYZ A;  3I96 A;  3C6T A;  3UW1 A;  5DLG A;  2XLI A;  4JI5 J;  4CT8 A;  2Y1J A;  2FVQ A;  3GII A;  4KV8 A;  3TNV A;  3HKZ D;  4N76 A;  2IM3 A;  1ZM3 A;  3LP1 A;  4QPX A;  4DUZ F;  2E29 A;  3GWC A;  1VC6 A;  1X60 A;  4I56 A;  3EGV A;  5EN1 A;  4PYD A;  1RT7 A;  2MZR A;  3TJ9 A;  1SPB P;  3PRD A;  3T1Y J;  4OJH A;  2MQO A;  4URS A;  3FNN A;  4A48 A;  3FQL A;  3NOG A;  4CH1 A;  2MZJ A;  2WON B;  1WEY A;  2CWK A;  2J9E A;  2ZBR A;  3E01 A;  3FBF A;  4LFB J;  4ES1 A;  3M6V A;  1O0P A;  4ER8 A;  1TKZ A;  4XAK A;  5L1L A;  3QAT A;  2UUA J;  4LF6 F;  1FJ7 A;  5IZH A;  3V2U C;  1FO1 A;  1WC6 A;  4E98 A;  4KYZ A;  1VBZ A;  4OV1 A;  4ZA1 A;  2WHO A;  1S59 A;  2FTR A;  4UOF A;  4X62 J;  5D3G B;  2DPJ A;  3MEG A;  3RU0 A;  1Q5Y A;  4DN0 A;  3FSY A;  4M94 A;  3OD2 A;  2FC8 A;  3UD3 P;  4FDF A;  2IC3 B;  3VCD A;  2YKM A;  3IR7 B;  3BF4 A;  3WBZ A;  4U8Y A;  5EUH A;  2H5E A;  3S1T A;  1LXJ A;  4X66 J;  2XY6 A;  3DLE A;  5K20 B;  4DR2 F;  4OYX A;  2B9W A;  5B08 A;  5DLF A;  2K3I A;  5F8J A;  5IOL A;  2E44 A;  3MMA B;  1C1C B;  4CO3 A;  1RT6 B;  4CQ1 A;  3TAP A;  4JI4 F;  4C8Y A;  2DD8 S;  2FPH X;  1S77 D;  3H0P A;  1VOM A;  3QID A;  4AND A;  3HX9 A;  3UWT A;  2GJ2 A;  2Z0G A;  4F2S A;  1XJW B;  3ZZU A;  2WSE C;  5D4O A;  4NLD A;  3ZZZ A;  3HVW A;  1VGY A;  2DR6 A;  4CTA A;  3GIM A;  2YNH B;  2VDH A;  3ONQ A;  2C2D A;  1RP5 A;  3VAF A;  3AAW B;  2MTL A;  1PBU A;  2EWH A;  3EXY A;  1SB6 A;  4HH1 A;  4Y28 C;  2GNK A;  1AZS A;  3L9Z A;  1U8S A;  3F56 A;  3H59 A;  4K8R A;  5DRK A;  4K4V A;  1LFW A;  2CQG A;  1FWP A;  1VK3 A;  2GQC A;  2QFI A;  3IS9 A;  4IQM A;  2FZK B;  5HK4 A;  1D9D A;  1R8P A;  2Z2Z A;  2IBK A;  2DNL A;  4USK A;  3TAN A;  2LU2 A;  1ZM2 A;  2HS0 A;  1BHN A;  1KOH A;  4YUD A;  2Z58 B;  2FC9 A;  4FYY B;  3Q23 A;  4I7F B;  4ED8 A;  1GMW D;  4OHX A;  3W3S A;  4O3O A;  3PR5 B;  1K73 T;  3R6G B;  4G3I A;  2JRS A;  4JOU A;  1F5C A;  1CQN A;  3MMC A;  4RNH A;  4F26 A;  1GEH A;  3I6P A;  1S7H A;  2RRB A;  4UQT A;  3CJ2 A;  2RQK A;  4LIW A;  4PG7 A;  4QPT A;  1OWX A;  2PSZ A;  2BVZ A;  3DI6 A;  4JB8 B;  3TEG A;  3UCU P;  1HWI A;  5LJ5 Y;  4Z7C A;  1B99 A;  4WZQ A;  3K5M A;  3ITH A;  4HDG A;  4AXJ A;  4K4S A;  4DF8 A;  1HWL A;  4L73 A;  2LA6 A;  1KLM B;  4BHQ A;  4FKX A;  5C42 B;  4LJM A;  2R9L A;  4L74 A;  3VAI A;  4MKA A;  4TY8 B;  1HMV B;  1MU2 B;  2ZUG A;  2DO0 A;  1YBA A;  3GYN A;  4J91 A;  4CLU A;  2UVV A;  4ELV A;  3R7S B;  3THV A;  2YPZ A;  4ITS A;  4ID8 A;  1YBU A;  3R3T A;  1WC4 A;  2KFY A;  1NKB A;  4IH7 A;  3GCW P;  3GLJ A;  4DQR A;  5CYQ B;  1YWX A;  3W5X A;  1AFI A;  5KFB A;  3JTN A;  2UUC F;  2B5J A;  2HMI A;  4GMK A;  4ID5 A;  2VH7 A;  3BSN A;  4TY8 A;  1VRQ C;  2BE7 D;  2XY7 A;  5HVG A;  4K2J A;  2IJF A;  1XR6 A;  2J5A A;  5F8G A;  3IRW P;  3HVR A;  2V94 A;  2MJN A;  1IKW B;  2EKN A;  2G1D A;  3J7Z 5;  1U02 A;  2FJD B;  1JXL A;  1HHT P;  2QN6 B;  5CCM A;  2YNF B;  4DJB A;  3WQP A;  1JQG A;  4DV7 F;  3BYR A;  3DCA A;  2P8I A;  3OFG A;  2JH3 A;  4ZP6 A;  4Y65 A;  1YJ9 S;  4EZ6 A;  5B0C A;  5K8P A;  4ZK7 M;  3QGH A;  3K7R A;  1EZZ B;  3EGZ A;  3MM8 A;  3P5T L;  1FXR A;  4IR1 A;  3NMA A;  2Q66 A;  4XIU A;  2E7X A;  2J0X A;  3IGV A;  4RU9 A;  3MPD A;  1JKH B;  3IAM 9;  4B3M F;  2EC0 A;  3Q89 A;  1N8R T;  1UPM B;  2BAN B;  1WC5 A;  2RQC A;  4BDP A;  1WG4 A;  4ZLP A;  2E1R A;  3FFI B;  4OYB A;  4USJ C;  1RT2 A;  3UN2 A;  3CCZ A;  3PJW A;  1YZ7 A;  5IV3 A;  1QAI A;  1RT3 A;  4C98 A;  4OI2 A;  4LF9 F;  2R8H A;  1N0U A;  1LNQ A;  1SQG A;  1VQN S;  1XTZ A;  1PJ7 A;  3I32 A;  4OFZ A;  4NLV A;  3DRS B;  3GYX B;  4S0M A;  5ETV A;  3BPS P;  4DQQ A;  3DDN A;  3OTD A;  2ZDP A;  2VOO A;  2W2Q P;  3I5B A;  1JWW A;  2LLZ A;  2DIU A;  2OO4 A;  2V69 A;  5C7P A;  5DQH A;  3MMJ A;  4AQY F;  4C0H A;  1HPZ B;  1X5O A;  2H9Z A;  2V6A A;  1ROF A;  4LF2 A;  1S9G B;  3GP9 A;  3QGP A;  1P6T A;  4I2P A;  1WHW A;  2XHC A;  1FJC A;  3QLH B;  1IXK A;  5DM6 Q;  2DR9 A;  2YKA A;  4OI4 A;  2F65 A;  1S6P A;  1C1C A;  2GO8 A;  2WCX A;  2VFR A;  3NLC A;  3P45 B;  4G1P A;  4NLS A;  1OYD A;  3R97 A;  4PEO A;  5HLF B;  3MD3 A;  3OR2 A;  4CLS A;  4QU7 A;  1RT1 B;  2WB1 D;  1CJK A;  1FA0 A;  2WON A;  3BZQ A;  3F44 A;  4CLL A;  1NK5 A;  1S9F A;  1QY7 A;  2LQ5 A;  3V81 A;  4DPY A;  4EFA C;  5HMW A;  2QLF B;  3OJS A;  4ZP8 A;  3M8R A;  1T7P A;  4I68 A;  4I2P B;  4QYZ J;  3I0R A;  2IAJ A;  1LW0 B;  1WEL A;  3R6L B;  3MR2 A;  3MM5 A;  1L3T A;  4DI6 A;  5CD4 A;  4ZP7 A;  2GQQ A;  2K8G A;  1W2I A;  4ZPV R;  3S01 A;  2JEI A;  5K14 A;  1GH8 A;  1NZ8 A;  4N77 A;  4NI2 A;  2IM2 A;  4TU7 A;  2DGW A;  2R2T A;  2IY5 B;  1LWC B;  5LSO A;  1Q7L B;  3RR7 A;  2QMU B;  2BJ8 A;  3PW7 A;  1EHW A;  3KOA A;  4WP3 A;  1JK9 B;  3CCS S;  2CJQ A;  1XN9 A;  3D6M B;  1J5O B;  1HBM B;  2HHQ A;  2E9Z A;  2DXD A;  5KFG A;  1S1W B;  2K3K A;  3FCV A;  2J8A A;  4DL2 A;  1HNI A;  3C6U B;  2RKI B;  1IJF B;  3PW2 A;  2V5H G;  4ECX A;  3C8Y A;  3DLG B;  4F7V A;  3KTQ A;  3D5M A;  5AE3 A;  4X4U A;  2HHT A;  4MIB A;  2GIF A;  3NG8 A;  2VHG A;  3Q8Q B;  2XMW A;  2AEF A;  4LSN A;  4N47 A;  9ATC B;  2DGU A;  3DLL Q;  3NY0 A;  1R8C A;  3T6B A;  3RB0 A;  1DJ0 A;  2EEY A;  1RK8 A;  1KDN A;  2XZD B;  5A8R B;  2YWE A;  2MJU A;  2VBY A;  2L41 A;  5J2M A;  3N28 A;  4RJV A;  1PJ5 A;  4FVM A;  5KFL A;  3RBD A;  3LUY A;  2MQP A;  1TUG B;  4IG0 A;  4PXB A;  4KHM A;  4R8U B;  4NXM F;  1FKO A;  1Q16 B;  1K0T A;  4BWJ A;  3TVZ A;  1U2R A;  2VPX B;  5AJ3 F;  4OYA A;  4KHP F;  1F2G A;  2VZ9 A;  3OSP A;  2W7O A;  4WKY A;  1J2V A;  3QGG A;  3DGP A;  4P75 A;  4ZVT B;  4C0B A;  5T14 A;  1RWX B;  3CJ5 A;  5HP1 A;  1UZD A;  3E3X A;  3QPI A;  1HNX J;  3PO4 A;  3K17 A;  3KLH B;  3M2V A;  3IWL A;  4DR4 F;  4OYO A;  1EP4 A;  3KLE A;  1D8Z A;  1HNW J;  1N33 F;  4QZV B;  2OIH A;  1LKZ A;  1B0P A;  1KNZ A;  1OYE A;  3H5S A;  2DEJ A;  1T9T A;  4MKV A;  3WZ0 A;  1LQ9 A;  4QWD A;  2ZH6 A;  3BO2 A;  2JVO A;  1IVZ A;  1MMD A;  1SJF A;  3IP0 A;  2YQ1 A;  3FGV A;  2XYP B;  4B9T A;  2Z30 B;  3EDQ B;  4RLE A;  3UE2 A;  4HKQ A;  4RW7 A;  1MMN A;  2V8P A;  1FD2 A;  3TO8 A;  3MPU B;  2MLZ A;  5DDP C;  4C6A A;  1Y10 A;  4MYT A;  4TN2 A;  5C25 B;  2VPW B;  5D0R A;  3CCV S;  2RQM A;  2PFD A;  4LRF A;  2MB0 B;  1N52 B;  2OML A;  5T7L B;  5KT2 A;  1KR4 A;  3T41 A;  5LT5 A;  3BQ2 A;  4ECZ A;  4MMO A;  4YQW A;  3SEO A;  2DNN A;  4DX7 A;  2POK A;  4NXN J;  4NYO A;  1URN A;  3H20 A;  2CJ9 A;  1Q5V A;  3O6Q A;  3OXG A;  4Z2X A;  1H2V Z;  1EB0 A;  5IM0 A;  4PUO B;  2EKY A;  1BMQ B;  1H73 A;  2ZOM A;  2N3O A;  1S57 A;  4E0D A;  1V5V A;  4X65 F;  2XHW A;  1TZ0 A;  3ITH B;  2VC1 A;  4HI1 A;  5J1E B;  1FDD A;  1XMO J;  1HNX F;  5M2R A;  5KFC A;  3AOA A;  1F2H A;  1FK9 A;  2XMM A;  4OHW A;  5J2N B;  4CH7 A;  4E2F B;  3VVT A;  4J37 A;  3VGU A;  2ZHB A;  4YP3 A;  4KHR A;  4HH0 A;  2NQP A;  3FSX A;  4LSZ B;  1FRH A;  3DRP B;  4PWW A;  2VJU A;  2HRT A;  3US5 A;  2E1M C;  2FHJ D;  2OSR A;  3ZZ0 A;  5IQ6 A;  4KIA A;  3MUV P;  1OQ6 A;  1U6F A;  2HLU A;  2OD4 A;  5KFK A;  3R5B A;  2HNY B;  3OL9 A;  1EIY B;  1T11 A;  1MRO B;  4OIX A;  5CXT A;  1C0U B;  2DPI A;  2AQ4 A;  4B3R F;  5KTQ A;  4Q43 A;  1AA1 B;  2IM1 A;  3UDC A;  2J9D E;  3VAH A;  2UU9 F;  1BXN A;  4CLZ A;  2GW8 A;  2FVC A;  2G2Z A;  4RW6 A;  1NBE B;  2KHD A;  3CJK A;  3PIO Q;  3OFE A;  1TV6 A;  1IR0 A;  4BWM A;  4QCL A;  2F4V J;  4NL5 A;  2OAU A;  4X62 F;  1ZZN A;  2OPP B;  8AT1 B;  3OL6 A;  4Q8E A;  4DCJ B;  2DO4 A;  2RSQ A;  3BKF A;  1F9F A;  2HS3 A;  4J9N A;  4X4R A;  2RS8 A;  2A10 A;  3H2L A;  3VAK A;  4YDD B;  5KT4 A;  4DSI A;  2GV1 A;  3R8Y A;  3K5P A;  4CLT A;  5HRO A;  4A8F A;  4YB5 A;  1X0P A;  4C48 A;  3PAC A;  2E5J A;  1UJ6 A;  1VIX A;  4TLQ A;  4TY9 A;  1RT4 A;  2W9C A;  4PUO A;  2OKQ A;  1NLK L;  3QT5 A;  1SKS A;  2GVD B;  4TYA A;  2EFP A;  1B70 B;  2YWG A;  3MUM P;  3M8Q B;  2LEC A;  5H9E J;  3IWN C;  2W7P A;  5B0E A;  4WJB A;  4HYK A;  1NJZ A;  3ZTR A;  3RB3 A;  3T5K A;  4P52 A;  2P9C A;  4Q44 A;  5E3P A;  1VQ4 S;  4U9R A;  2Z56 B;  3CC2 S;  3CJS A;  4DSL A;  1ZA2 B;  2CQI A;  4F0K A;  3HCX A;  1VRT A;  3NEK A;  4LIR A;  1IQT A;  1DBD A;  3TA0 A; 
#chains in the Genus database with same CATH homology
 1NB2 A;  1BE4 A;  3EVW A;  1WKK A;  1NCL A;  2HVE A;  1PKU A;  4DUT A;  3NGU A;  2BEF A;  3ETM A;  4FKY A;  2VU5 A;  3JS9 A;  1B4S A;  4UOG A;  3ELH A;  1NDK A;  1HIY A;  1NDL A;  1MN7 A;  3ZTQ A;  1LEO A;  4UOH A;  1JXV A;  1NSP A;  3VGT A;  4C6A A;  3BH7 B;  2HUR A;  3PJ9 A;  3Q8Y A;  3L7U A;  1NSQ A;  1NSK L;  1NHK L;  4F4A A;  1F3F A;  3MPD A;  3FBB A;  3Q89 A;  3Q8V A;  3Q8U A;  2CWK A;  2B8Q A;  3FBF A;  3ZTS A;  3FKB A;  2DXF A;  2NCK L;  1MN9 A;  2AZ3 A;  1S5Z A;  5CAA A;  5CAB A;  3WX8 A;  2DY9 A;  1S57 A;  4S0M A;  3VVU A;  4EK2 A;  1S59 A;  4UOF A;  3VGV A;  4F36 A;  3EJM A;  4CP5 A;  5C7P A;  3FCW A;  3Q83 A;  3VVT A;  1ZS6 A;  3VGU A;  1UCN A;  1WKJ A;  3BBC A;  3VGS A;  3GP9 A;  3G2X A;  3ZTO A;  1WKL A;  2DXE A;  2ZUA A;  1NDC A;  1U8W A;  3Q86 A;  3NGR A;  5IOL A;  3ENA A;  3ZTP A;  4AND A;  1F6T A;  5BXI A;  3EVO A;  4WBF A;  4KPC A;  1W7W A;  4DI6 A;  1BUX A;  3FBE A;  3PRV A;  4W98 A;  4ENO A;  3EMT A;  4O0N A;  3R9L A;  1NDP A;  4HR2 A;  3B6B A;  1EHW A;  1HLW A;  3EM1 A;  3EE3 A;  3BH6 B;  3GPA A;  2DXD A;  3NGS A;  2HVD A;  3FCV A;  1BHN A;  1HHQ A;  2AZ1 A;  4ANE A;  1K44 A;  1XIQ A;  3DDI A;  1VYA A;  1LWX A;  1NLK L;  4ANC A;  3EIC A;  3BBB A;  3ZTR A;  1NPK A;  2BX6 A;  3NGT A;  1NUE A;  3B54 A;  3EVM A;  3DKD A;  2DYA A;  1B99 A;  1PAE X;  3FC9 A;  1KDN A;  2B8P A;  1XQI A;  4DZ6 A;  4FKX A;  3BBF A;  3FBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...