1VRUB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
425
structure length
410
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 109
structure length 410
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vruB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB03
4QW8A 3ISND 1FK9A 4ZPAA 5JUMA 5I42B 3M9OB 3NBPA 3KLGB 2VA2A 1TL1A 4QWAA 4QWDA 2ZD1A 1RDRA 2FJVA 4MK7A 1VRTB 1ZTWA 2FVQA 3GQCA 4PUOB 2I1RA 4K4VA 4YQWA 4F50A 3DRRB 2XWYA 3BQ2A 1EETA 2CJQA 2RKIB 1LWCB 5T14A 4K4YA 4ZVEA 2WRMA 3EZUA 2I5JB 3C6TA 4MKBA 2YNFA 4DG1A 3C6UA 3JSMB 2FVRA 2E9ZA 1TV6B 4H4OB 5KFMA 3PR4A 4DL4A 2AQ4A 5F8MA 3V4IB 4Q44A 2IA6A 1C1CB 2ILZA 5J2PA 1N6QA 5DLFA 1JLCB 2IC3B 3T1AA 2C2RA 5F8GA 3RB0A 1RT1A 1LWEB 4WE1A 5K14A 1JKHA 1IKWA 1SUQB 4LSNB 4YR2A 2J6TA 1IKVA 4QWCA 1LW2A 2WK4A 1JLEA 3BSNA 2VG7A 2ASLA 4ED1A 2JC0A 5KG6A 3KJVB 1HNIA 5EWGA 4H4MA 4ZVFA 1DTTA 1SH3A 2JEIA 4LSLA 4RZRA 4IFVA 2V9WA 2YKMA 5DG9A 5J2QA 4J9OA 1BQNA 1R0AB 2OPPA 3KK2B 4ECXA 4K4ZA 1HPZA 2CKWA 1U09A 4MIBA 4Y2AA 4XO0A 4KV8B 3IS9A 2IJNA 3RBDA 4ZP7A 1TKZA 1N5YB 3MR5A 4FBTA 3CJ4A 4TYAA 4G3IA 4KSEB 4KO0A 3KMQA 2UVVA 4RUAA 1S1UA 2D3ZA 4FBUA 4RW7B 2JC1A 1C0TB 2HWIA 3H5XA 3V81B 2RF2B 1RTDA 3KLFA 4Q0BA 5DLGA 2R2UA 3DLGA 2W8LA 4EYIB 3KLIA 4U7CA 1W25A 2BANB 3IRXB 4RW9A 1S49A 1JX4A 2IBKA 2BQ3A 2C2EA 1ZETA 2W9BA 3H5YA 1S1TB 3IGVA 3QYYA 1T05A 3LANA 4TN2A 5L9XA 5F8HA 2B6AA 3MF5A 1KHVA 1S1WB 2YNHB 3LP1B 3FRZA 4H54A 5KFNA 4JV2A 3KK1B 5HP1A 4NRTA 3RAXA 1N48A 4B3OB 5F8NA 1S9EA 1TVRA 4ECYA 4QWEA 3HVWA 1S0MA 3H59A 3M8PB 4Q43A 2DPJA 1RT5A 3T19A 4ID5A 4WZQA 1S6PB 3KLEB 5KFHA 1UWBB 4IR9A 4NZ0A 1OS5A 4EYHB 2AGOA 4G1QB 4ZHRA 4IDKA 1S9GB 3BSCA 4URGA 4KHRA 2UVWA 2ILYA 1YVFA 3OLBA 4ECUA 2HNDA 2WONA 3DLKB 4PQUB 2E9RX 2WOMA 5KFGA 2J6SA 2GC8A 3I0SB 5F9NA 2FJWA 3G86A 3OLAA 5HBMA 4RNNA 1T3NA 3IG1A 4RW4A 4KHMA 4YR0A 3HVTA 4TXSA 3TVKA 3KMSA 4MFBB 4OL8A 4WYLA 4DL3A 2R8KA 3KLHA 4WYWA 3Q8QB 5HLFA 3MFIA 3MECA 2UUTA 4NLOA 3V6DA 2XGPA 5FDLA 4R5PB 2FVPA 1RTJB 4R8UB 4RNHA 3D28A 5EDWA 3DI6B 4KFBB 5I3UB 1CSJA 5F8JA 3CJ5A 5KFKA 1RT2B 2E9TA 2HNYB 4LQ9A 3DDKA 3KOAA 4KKOA 1RT3B 2GIQA 3E51A 4RNOA 3DMJB 2QV6A 4K4XA 3KLGA 3CO9A 5KG1A 4J9MA 4ZP8A 5KFIA 4NLPA 2D41A 3MEGB 2XCAA 4RW6B 3ITHB 2W9AA 5D3GA 2XCPA 4NLQA 4IFYA 4HYKA 1NNDA 1MMLA 1VRTA 4TYBA 2W9CA 2YKNB 2YNGA 3DRRA 4I2QB 3NAIA 4NLVA 4XPCA 1HMVB 2FLPA 3MFHA 4NLSA 3JYTB 1TKXA 4I2PA 1C1BB 2VG5B 3OL6A 2V4QA 1JLAB 3JSMA 4O3NA 3HKWA 3QZ7A 4IH7A 1TV6A 5CYMB 5C24B 1T94A 4TY8B 1IKXA 2HWHA 4NRUA 2IM1A 1C1CA 1T03A 4IG0B 4KBIA 3SFUA 3DM2A 2HMIA 3T5LA 1S1XA 1EP4B 3CDUA 4EBDA 1SH0A 3BSAA 1LWEA 5KG0A 3LAKA 1SUQA 4M94A 4LSNA 3I5BA 1QE1B 4KAIA 4GC6A 3MEEB 3LP0B 1J5OB 1S4FA 3FSIA 2HAIA 4JV0A 3H5UA 4X2BA 3UDLA 3MTKA 1N56A 1TL3B 1R0AA 4IKAA 3E01B 1JXLA 3QIPB 5C42B 4J9LA 1I6JA 1HQUA 1DTQB 1SV5B 4NLWA 5JXSA 1N5YA 3KNAA 3KK3B 2JEJA 4RW7A 3PJWA 1C0TA 3RAQA 2RF2A 1D0EA 2HNZA 2OPSA 5KFFA 2WB4A 2IAJB 3PVXA 5L1IA 3IRXA 3MEDA 1IKYB 1QAIA 5KFCA 1D1UA 1XR7A 3FQKA 4KB7A 1NHUA 4ZMMA 3LP2A 4F4ZA 1JLFA 4O4GA 1K1QA 4Y2CA 4RUCA 5HROB 3DOKA 4PWDB 4ECQA 2OPRB 3H98A 1RT7B 4O44A 5EWEA 4B3OA 4URSA 1VRUA 5KFAA 2B5JB 3G6VA 4I7FA 3T5JA 3DLEB 4NLUA 4MIAA 5KFJA 5KG7A 3M9MB 1BQMB 3DOLA 3KLEA 4M95A 3HVAA 1UWBA 2VG6B 3BGRA 4ZP9A 1RA7A 4QWBA 3SI8A 4RU9A 1C0UA 3QLHA 4G1QA 4J9KA 3T5HA 1S9GA 3UPFA 1KLMB 3OSPA 3NBPB 3NKYA 5KFPA 1S48A 3OHBA 1MU2A 3DLKA 4ECSA 4IRDA 2ZD1B 2FLLA 3GV7B 1DLOA 2BR0A 3EPIA 4ECRA 3DYAA 4KE5A 5EWFA 1JLBA 1EETB 4K4UA 4NLDA 4NLYA 5J1EA 3C6TB 4WFZA 2YNFB 4DG1B 3C6UB 3QGIA 4R5PA 3OL9A 4R8UA 1RTHB 5KFZA 5KFDA 1S1VA 3DI6A 5I3UA 4Y34A 4NLRA 5J2PB 1N6QB 1RT2A 5DG7A 5CYQB 4DL7A 1QUVA 4FS1A 3RBEA 4ECZA 1RT1B 4IRCA 3LAMA 3DMJA 4WE1B 3N6MA 5J2NB 1JKHB 1JLGB 5KT5A 1IKWB 4ICLB 3MR3A 2C22A 1IKVB 4RW6A 3PZPA 2VG7B 3LALA 3N6NA 4NLTA 4NYZA 4RW8A 2BQRA 4GC7A 1HNIB 4IOBA 4ZVHA 5C25A 2WHOA 4LSLB 1HYSA 3I0RB 1HQEA 3KHHA 2YKMB 2B43A 5J2QB 2OPQA 1BQNB 4ZPDA 5KG2A 3G6YA 4J9QA 4ECVA 4IRKA 3HHKA 3ICLA 3RB6A 2JEGA 4IG3A 5L1LA 1RT4B 4U6PA 2YNIB 1S6QA 3UR0A 5KT2A 3NL0A 1QAJA 5CYMA 3BREA 4TQSA 4RNFA 4LQ3A 3N6LA 1FKPA 4KO0B 3Q8PB 2ASJA 1S1UB 2W7PA 3GIIA 4IG0A 2IM0A 2AX1A 3G6XA 4K50A 1SH2A 3DRSB 1EP4A 3KLFB 4Q0BB 2IJFA 4J9NA 1RT6B 2AWZA 4O3RA 3M9NB 3GIJA 3KLIB 4ZPCA 4RW9B 5I42A 4J9PA 1S97A 3CDEA 2AX0A 3MEEA 1J5OA 3VQSA 1T05B 3IN5A 2JEFA 3CJ2A 2ALZA 2B6AB 5J2MB 5EUHA 5HP1B 4PUOA 3E01A 5KT4A 3QIPA 1S9EB 5C42A 2R8JA 1S9FA 4DL6A 2RKIA 3PW4A 1LWCA 3OHAA 2I5JA 4EBEA 4DL5A 2R8IA 5KFBA 1RA6A 4H4OA 1TP7A 4ID5B 2WCXA 3FQLA 3V4IA 2V0NA 1JLQB 3PR5B 1JLCA 2IAJA 2IC3A 2FVSA 3H4BA 4ZHRB 3H2LA 4JUZA 3GIMA 2IM3A 4O3SA 3TQ1A 2HNDB 4J9SA 1REVB 1HNVB 2WONB 2XI2A 2ZE2B 2WOMB 5KFTA 1LW0B 2O5DA 5KFQA 3KJVA 4QW9A 3TAMB 4J9RA 3CJ3A 4F4XA 4EBCA 2OPRA 3QO9B 3IG1B 3CJ0A 4RW4B 4ED2A 4Q8EA 1WNEA 3NMAA 3QGHA 3HVTB 3KK2A 2B5JA 3H5SA 4TLRA 3OSNA 4YR3A 3KLHB 4Q45A 1GX6A 5KFOA 3DRPB 4YP3A 4KV8A 3V6DB 1K1SA 5FDLB 1XR5A 4ZPBA 1N4LA 1RTIB 5KG5A 5KFWA 5F8LA 3BQ0A 5KG3A 4DEZA 3V81A 4KKOB 4NCGB 2UVRA 1LWFB 1KLMA 2ZKUA 3I5CA 3KHRA 3FFIB 2BANA 1RYSA 1ZTTA 3GV8B 1S1TA 5D3GB 3BQ1A 4IFYB 2BE2B 2R8GA 4MK9A 2W9CB 1S1WA 2YNHA 3LP1A 1FKOB 2YNGB 1TKTB 1HARA 3KK1A 4MH8A 4TQRA 2UUWA 1TKXB 4I2PB 3BR9A 4Q8FA 5KFXA 4IR1A 3M8PA 1RTHA 3M8QB 1IKXB 4F4YA 1GX5A 3GV5B 5L1KA 1T03B 2C28A 5CYQA 1S6PA 3DM2B 2HMIB 1S1XB 4URQU 3CWJA 4MKAA 4RNMA 4EEYA 3I5AA 1RYRA 1FK9B 5J2NA 4ED8A 1JLGA 4ICLA 3PJXA 4ED3A 4YMEA 4ED6A 3V6KA 2EC0A 5KT3A 4PQUA 1TL1B 5DQHA 2OH2A 4NLGA 3I0SA 4WFXA 3QGGA 5KT7A 4ED7A 3I0RA 5F8IA 3GYNA 4FS2A 2F8EX 3SFGA 4EO8A 2D7SA 1HQUB 1S0OA 1RT4A 2RDJA 2YNIA 4MFBA 1IM4A 2BQUA 4XPEA 2AGPA 4K4WA 4MK8A 4ED0A 1RTJA 4ZVGA 4KFBA 4JV1A 3DRSA 2HNZB 2OPSB 4NLXA 4K4SA 1RT6A 2HNYA 3UQSA 1TQLA 1RT3A 3KHGA 3MEDB 5K14B 1C2PA 3CVKA 4IQXA 3T5KA 4WXOA 4TY9A 3ISNC 3MEGA 1LW2B 1JLEB 3ITHA 4R0EA 3LP2B 3PW5A 1JLFB 2J6UA 5J2MA 3Q8RB 4O4GB 4O3QA 2W8KA 2ASDA 3DOKB 3QIDA 4H4MB 4O44B 1DTTB 2ATLA 2YKNA 4IFVB 5KFSA 5KT6A 4I2QA 1VRUB 2OPPB 1HMVA 1HPZB 3JYTA 5L1JA 3RB4A 2UVUA 4I7FB 1C1BA 2VG5A 2D3UA 1RAJA 1JLAA 3IS9B 4WZMA 3GIKA 1TKZB 4TY8A 5C24A 4O3OA 2R2TA 2IMWP 3FDSA 1S10A 3DOLB 2V4RA 1JLQA 2DPIA 3BGRB 4IH6A 3D5MA 5KFUA 2BRKA 2AGQA 4ECTA 2FLNA 1RTDB 1C0UB 3QLHB 3DLGB 3PW7A 3H40A 4Y3CA 5KFRA 5DQGA 1REVA 1HNVA 1MU2B 1QE1A 2WTFA 2ZE2A 3H4DA 2W9BB 1LW0A 3LP0A 3TAMA 1DLOB 3QO9A 3DYAB 4HKQA 4WFYA 4F4WA 1Z4UA 2AU0A 1JLBB 1TL3A 5KFEA 3NGDA 1NHVA 4ZP6A 1JIHA 2RDIA 4O3PA 2R8HA 3BJYA 1TVRB 2W7OA 4IH5A 5J1EB 5DQIA 1DTQA 3DRPA 1SV5A 3CDWA 2XGQA 3V6HA 3NAHA 1RTIA 3KLVA 1RT5B 3KK3A 1S1VB 5KFYA 5F9LA 3Q8SB 2C2DA 2R2SA 5DGBA 4NCGA 1LWFA 3RB3A 3GILA 3FFIA 3MR2A 3MR6A 3IGNA 4IDKB 1IKYA 4ECWA 5C5JA 4K4TA 3KHLA 4DL2A 4WXWA 4RW8B 2R2RA 2BE2A 1KHWA 1XR6A 5C25B 3BSOA 5KFLA 3OL8A 3PW2A 5DGAA 1FKOA 5HROA 1HQEB 1HYSB 5HBMB 4PWDA 1TKTA 2OPQB 1RT7A 3CIZA 2BRLA 4EO6A 2XC9A 3PHEA 2QE5A 2JLEA 4IG3B 5KFVA 5KG4A 2FVCA 1S6QB 4O4RA 2FJXA 3V6JA 3M8QA 5HLFB 3MECB 3QZ8A 1FKPB 3DLEA 3OL7A 2GIRA 2IM2A 5DG8A 3PW0A 1BQMA 2VA3A 2XI3A 3EPGA 2VG6A 4QPXA 1S0NA
chains in the Genus database with same CATH superfamily
2IJRA 3CDAA 4QQBA 3TANA 1K47A 2VFSA 3FJ2A 2DNPA 4M5MA 2A2DA 4JP8A 2XZWA 1WKKA 2E9ZA 1FFWB 1WACA 4ANEA 1JKHA 2VBWA 2DGTA 4U95A 2JC0A 2MSSA 2DHSA 3MXHP 2OLWA 2BABA 4ECXA 5HQ8A 2VUGA 2FLOA 2FZGB 3D1HA 4TYAA 4KSEB 3CO0P 4OX9J 1U1PA 1W25A 1YI2S 2CQ1A 3M4XA 2OIHA 3IM8A 1RWWB 2C3UA 4DV5F 4DCJB 2XYPB 3MF5A 1KHVA 4DSKA 4HT5A 4NXMF 3RAXA 1FTRA 2D9PA 3DOMB 4PR6A 3FBBA 1X9SA 2BJ8A 3ET6B 1S6PB 3CJSA 3R2CJ 4KHRA 5D0HA 1T9WA 2E9RX 1IVZA 3SXLA 2DCLA 4S0MA 4FXWA 5GVQA 3SV3A 3Q8QB 2Z58B 2VU5A 4KFBB 1CSJA 2C3PA 3S7RA 3UNYA 2M7SA 3OXLA 1NAQA 3NNAA 2M88A 4KR0B 3KUGA 2LU2A 3EZOA 2NPFA 4OYIA 4IYQA 1LWEA 1WORA 4KAIA 2D3OR 2MLXA 2AEFA 3FSIA 1P9QC 1G3OA 4JI4J 2AJ1A 4OYAA 4PAAA 1GAOA 1HQUA 4EUVA 3HF5A 3KK3B 1YLXA 5BXIA 3GTYX 2N7YA 3IRXA 1D1UA 3LH2S 2V6AA 2IYIA 3H98A 2J8AA 1OYDA 1R0CB 3J7Z5 5E3RA 1N0VC 2VG6B 1T3OA 1MNEA 3OSPA 2WBMA 1X5OA 4A8SA 2ZD1B 2HHHJ 2H48B 4H4KC 5ETQA 1UL3A 5CABA 5J1EA 5T7LB 2ZZMA 1FWLA 3GWCA 4FS1A 4ECZA 1FRLA 1IKVB 2VG7B 1SKUB 3DU6A 2WHOA 3PHTA 4YEAA 4PYDA 2VQEJ 3NWGA 3W5YA 1WELA 4OZLA 4Q2LA 3CCTA 4NI2B 4Q0BB 2IJFA 2W2NP 5IT9Y 2ZH5A 1OIAA 2MKHA 5HATA 1HD1A 1KTVA 2RKIA 1BQXA 3OFHA 2RS2A 4M5NA 1KN6A 1JLQB 1EARA 3H2LA 3SCIE 3POTA 2G1HA 4A8FA 4JI6F 3CJ0A 4DR1J 3J80U 3DRPB 2B9YA 4ETXA 1NK5A 2PT0A 4PZVA 3GV8B 4M5HA 4WBFA 2L9NA 2ZHBA 4ERDA 2DR8A 3OFFA 4M5JA 2DR7A 2CXEA 4Q8FA 2QA4G 4JV5J 2GMJA 3DM2B 4RNMA 4F25A 4KGZB 1WC6A 5E2QA 5KT3A 1KQSR 2NLWA 2DNZA 4WFXA 4ED7A 2GFFA 3C14A 1S0OA 3RG6A 2QT7A 2V4JA 1RT6A 2F7VA 2DHXA 3U1MA 2J0XA 3KHGA 2QL7B 4FVMA 1YBUA 3GJQB 4X65J 1TMMA 3ISNC 2RHQB 3MEGA 3PW5A 4Q2MA 3PEJA 2DGQA 1HBMA 5J1PA 4MKYA 1S7IA 2CPDA 2MMYA 5HMYA 4WZMA 3DLBA 1FRIA 4EMDA 4OI2A 4YS2A 2XBPA 4ZLJA 1H2UX 1GMUA 4DV0F 1RWNB 5LT5A 1SC1B 4LMZA 1B3TA 3NGDA 3E2EA 1W7WA 2L08A 3EX7B 5K8OA 1VQYA 2GHVC 4E8UA 1HIYA 1Q8KA 3VQTA 4L74A 2HZCA 3UCUP 5KFLA 1KTQA 3L95X 3PHEA 3FCHA 2HG4A 2LXUA 1S6QB 8ATCB 1KVKA 1OSCA 2XI3A 3EPGA 1S0NA 3EVMA 2C3MA 5JUMA 1OO0B 1WOSA 1BD6A 3NBPA 1MN7A 3U1LA 1ZTWA 3R7SB 3RRHA 4F50A 2XWYA 1N0UA 3AJ1A 3C6TA 2YNFA 3D0HE 4LF4J 2ACYA 1LXNA 3HI9A 5HI7A 2C2RA 4F0KA 4WTYA 4K8RA 1LWEB 5K14A 1IQZA 1IKWA 3I87A 2ASLA 1FEHA 2HZAA 3MDFA 1RJJA 1ELOA 3MCNA 1RLCL 3C19A 5DLGA 2CPXA 1FRKA 4NXNF 4RW9A 3IRXB 3MAHA 3LANA 3UCZP 2B6AA 1GH8A 1TVRA 2DPJA 1D8YA 2QN6B 2Y1JA 1PGZA 3GMGA 1OS5A 3LF0A 4DQRA 4ZHRA 4IDKA 1IR1A 3OV7A 4URGA 4FF2A 1LWXA 2ILYA 3MCSA 3T1HF 5HBMA 4RBUA 4KGKA 2E5LJ 4OHXA 2Q3PA 4X4VA 2UUTA 1FE4A 1HI8A 5EDWA 3KXDA 4WPAA 4G6VB 2XCAA 1AT1B 5CYJA 3UN5A 2XCPA 3NRBA 2YKNB 2JWNA 2KJWA 3G82A 4P2FA 4ES1A 4CLWA 1S59A 3JYTB 3MUVP 2V4QA 3JSMA 1T94A 4ZVTB 2CPZA 4UZCA 1PSDA 2KVQE 3A8EA 1T03A 4ZVUB 5KG0A 1NBEB 4CLFA 3O6QA 2NPIA 3PM9A 3GCWP 1TL3B 3IWNC 3MHYA 3M2UA 1X0FA 3PACA 3A3PB 1C0TA 3KKFA 4OHZA 3R97A 1RHKB 3PVXA 2F40A 3POTB 1WC1A 4O4GA 4PWDB 2OJ3A 4ZPWR 3ZZ0A 2A18A 2ZJRQ 3QSYB 2KYXA 4KH1B 3SDEA 1MMNA 3PYGA 4LFCJ 4DSJA 1SQEA 2DR6A 2ERRA 3PCOB 4P7TA 1XNRF 2QMXA 4DG1B 3CMAS 1SC6A 3ZZPA 2RNEA 3VGSA 2BW7A 3HSZA 4RWWA 3QAEA 1RAFB 4X62J 1UCNA 4LF8F 3G6YA 3AB4B 1SJ4P 3C14B 4IG3A 1DURA 4DSEA 5KT2A 1QAJA 2V4JB 1L3VA 4L72B 3KLFB 2VHGA 1RT6B 4DQSA 4KYZA 2BW2A 5IC4B 2PEHA 1HR0J 1HBMB 1D3WA 2DKOB 2RE1A 3PW4A 4MYTA 1DZ5A 2NSBA 4EBEA 3MPVA 2JSXA 1JLCA 3PDNA 5A0YA 2HK2A 2CNNB 4DV4F 2I8EA 4D3HA 2EW9A 5KFTA 3AT1B 3KJVA 3CJ3A 1YX2A 2MHNA 3UD5A 2F1FA 4M5DB 3LUYA 4FF1A 4YR3A 5KFOA 3TP2A 5KG5A 2W25A 1CS4B 4CWBA 1XBWA 4KKOB 2GVDA 2J76E 3ZO7A 3HO1A 1N5SA 3LGMA 2VDHA 1KQFB 1OSDA 2W9CB 3A1YG 5HVFA 3WHIA 4ZIVA 4PXCA 3M8PA 1RTHA 3UDEA 3ISZA 5M2UA 1DQ9A 1TR0A 1P6TA 3TJAA 3K5PA 3WC0A 1MWYA 3MMAA 3D9BA 4K0KF 3JS9A 1X31C 3KWMA 4NYOA 1RT4A 2YNIA 4RO0A 2BZ2A 4LF9J 7AT1B 1TQLA 2UXDJ 3VAFA 5LOQA 3ZNJ1 5K14B 1T9XA 3CCWA 3LW5C 1YIJS 2DR9A 2QLXA 5A8RA 1NK8A 4I2QA 1VRUB 3UWTA 1OMSA 1CJVA 3MUTP 3C2PA 2GAHC 4LJMA 4OI4A 3D1QA 2CDRB 3FCVA 1B7YB 1Q86T 2L48A 2LVWA 2ZHOA 1TVRB 2ZBQA 2FJDB 2QX0A 1LWFA 4IDKB 2DY9A 2CJYB 3J7A1 5D15A 5HBMB 3DNCA 2XC9A 2LCWA 1VLOA 2NZ4A 1T11A 4CI0B 2VPWB 1QAYA 2EFNA 1BY9A 3QRRA 3TOQA 2I1RA 4NA3A 1XC9A 3JSMB 4G1IA 4DUZF 2XY6A 4DL4A 2A6OA 3SQGB 1AFIA 2XS2A 2AJFE 4LSLA 1L3UA 1N54B 3M2UB 1YRUA 3MR5A 3M2RA 3CMES 4C97A 4W4MA 2HHTA 1C0TB 3DLGA 5L39A 2K06A 1X4GA 4NEZA 5IXUA 5LMNF 5F0UA 2RSQA 1CJTA 1U2RA 4JI0F 3LP1B 4DR5J 2CJBA 2H51B 1T9VA 3DXBA 5HP1A 4Q43A 3MWBA 2MKIA 2EG2A 1T8EA 4L76A 4WKRA 2KHDA 5F9NA 1M1KT 1N5QA 2MDAA 1FD2A 4LFAJ 2O01C 4AQYJ 2VC1A 1H2TZ 1U02A 3NOCA 2UUCJ 4FP9A 2W9AA 2OSQA 4HYKA 4ZDNA 2AYBA 4ZVQB 1TKXA 3OL6A 1EB0A 1SQFA 2VC0A 4QJVA 2OEJA 1YJWS 3LA0A 4NX9A 3BGLA 3LAKA 5A2QY 3W1YC 1V6HA 2B4PA 2PI5A 2C2MB 1QSSA 4FPRA 5LSLA 1R0AA 4DU7A 4QIWD 3MM7A 3J7YU 3AODA 2AIRB 5KFFA 3RTVA 5A0YB 3JQKA 5DJBA 1RCOB 5AXMA 2NXCA 2HLUA 4ZMMA 5GAHI 2X1AA 4OZJA 4DV1F 2AEMA 3DLEB 1G2EA 3P5TL 1RCXB 3KG4A 2RB7A 2WSCC 4A8XA 4ECSA 4Y6IA 1FF2A 4FYYB 2MQQA 1UWAA 1RTHB 5DDQC 1S1VA 2E1RA 4FF4A 4UOCA 3S01A 1NMEB 2AP6A 2ZBPA 3MR3A 2C22A 3LWMA 4TU9A 2J7UA 3DLHA 2HKEA 1I3OB 2FJEB 3KHHA 3CXCR 3BBBA 2U2FA 1RT4B 2W2PP 2YNIB 1FO1A 2FHJD 3F44A 3QNWB 3NCRA 5DRKA 3MEKA 1AB8A 4OLPA 2HBRB 3VAHA 4J9NA 4ZPCA 4N47A 3KFWX 3VQSA 2AEJA 1BWEA 1E6YA 3OHAA 4CYUA 2YPZA 2R8IA 2KFNA 1RWOB 3H4BA 3TQ1A 2G2YA 5ETSA 4QW9A 4F4XA 4KGXB 4DR4F 3NMAA 4CM2A 3N5BA 2R3VA 4TLRA 1NZAA 2WVDA 4Z7CA 1N4LA 3THPA 4A8QA 3N5FA 1WTFA 2MGZA 6FDRA 4LF1A 4ETZA 1LWFB 3VZIA 2KRRA 5DS7A 1O8BA 2VODA 1JJ4A 1S1TA 2HGNA 1WHXA 2B8QA 2VFVA 2UUBF 3IFEA 3W9IA 1FRHA 2DO0A 3MTJA 2QLWA 3W5ZA 2FY1A 4URQU 2ZOFA 3M6VA 2KXNB 1OY8A 3QGGA 4CLSA 3FVYA 4FS2A 3HK2A 2E1AA 2DXEA 3M32B 1IM4A 5B0FA 5ETVA 1U4BA 1Q5VA 1TL5A 2Z4PA 5AT1B 5D4NA 3ILOA 1ZYQA 5M2PA 3H20A 3LP2B 3Q8RB 3DOKB 5HMZA 1FKAF 2I2YA 1CJKA 9ATCB 1HMVA 2BBEA 4I7FB 2P5VA 2ZH6A 2XS7A 1S10A 1Y3KA 2K7KA 3QLHB 1UPMB 3DLGB 4Y3CA 5KFRA 3VALA 5AXKA 5LL6d 1IBKJ 3CJKA 2R7XA 1NK9A 3QO9A 3P5BP 3RU0A 4ZP6A 4DV7J 2NZCA 1RACB 5DQIA 1NDCA 1SV5A 2XGQA 2JHEA 1DAXA 2OUGA 4NCGA 1NU4A 1IKYA 1U25A 4C9DA 3M8ZA 3HHDA 2LXFA 5D77A 1SL0A 4YB1P 2QC3A 2QE5A 1KRPA 2E5GA 3M8QA 3QZ8A 3OL7A 3KDNA 2H4WB 2QLFB 2DEJA 1G4CA 3ISND 2G0CA 1QSYA 4G65A 5HQLA 4OYBA 2JVRA 4YDXA 4K4VA 2FVQA 3TUPA 2HYIB 2EKNA 4ZVSB 3P4UB 4C8LA 4E98A 2Z2LA 3R5AA 3EJMA 3HX9A 1C4CA 1IN0A 3CULA 2Y0BB 3ZNUA 2E7WA 4C8OA 3BSNA 4DS5A 4LF7J 1BQNA 1R0AB 1X4EA 2CKWA 2EPIA 3OTBA 2CQ0A 1N5VA 2W9BA 1KFSA 1T05A 2Q66A 5DM7Q 2HHXA 2H65B 1RGVA 1BGXT 1YZ7A 4ECYA 2CJKA 4QR2A 1JWWA 4WZQA 3CD0A 2KRBA 1NDLA 5DZ6A 2NREA 2B3TB 2WONA 2DNLA 5KFGA 1UJ5A 4RNNA 1LEOA 2Q43A 3C3LA 3SZ2A 2ZZNA 3EE3A 3FKBA 4LRBA 3OR1A 2B7BB 3D28A 2HNYB 2ZBRA 2CPFA 4ZJQA 1PJ5A 5BYRA 4DV5J 1U48A 4ILRA 3TAQA 2HRYA 2FPHX 3G4SS 3UN3A 4OHWA 1JLAB 2KB2A 2LA6A 2C2NA 2F4VJ 4CH0S 3ZFVA 4EBDA 3ZXWA 4M94A 1Q7YT 1K44A 1F5AA 3AOBA 2ZNYA 3VAMA 1VR6A 1JXVA 2A2CA 3ZTSA 2MQLA 4A8MP 2WB4A 4OIXA 5KFCA 4Y2KA 5LSOA 3D3CJ 2XY5A 4C6AA 4AT1B 5EWEA 3O5TB 2DBBA 1XTZA 1YJRA 3BPDA 3NGTA 3SI8A 1B0PA 1C0UA 1S9GA 3DLKA 2IMOA 5B7WA 1EQ0A 3DYAA 4FNIA 4J90A 3SCJE 4F0MA 3CPWR 3VTIA 3BBCA 3CTRA 4R5PA 1RWUA 1YSJA 1RT2A 3N28A 4RW6A 3N6NA 1GXUA 2RVJA 3CUNA 2CPIA 1Q8LA 4ED8A 2X7IA 2PFDA 4U6PA 3MI7X 2VPYB 4ANDA 2AJQA 3N6LA 1E6VB 1VK8A 1KLNA 3TEHB 3GFHA 4OYMA 2J8SA 3R2DJ 4LR7A 1PYSB 1CJKB 2R8JA 2RQMA 3MMBA 4BCAA 3FQLA 2QMUB 4P52A 2CYYA 2EG1A 2IAJA 5GAGI 5IWAJ 4RBVA 5EHHA 3E8OA 4P9SA 3CJKB 2UXCF 2DVIA 3QO9B 3JXOA 4YDDB 1HNXF 1XR5A 3Q8VA 4DPUA 4NCGB 5B08A 1GMWA 2R7RA 2C3OA 3B54A 3TA1A 3M2VB 2MPUA 4DZ6A 2E5IA 1PO6A 3D4JA 2RRAA 1AYEA 2C2KB 4DV3F 3M8QB 3GV5B 4DLGA 4UZBA 2V2ZA 1EKRA 2JNJA 4F7VA 2KG1A 2GNKA 5H9EJ 4DX6A 1PBAA 4DQPA 4WF9Q 1NB2A 4PQUA 4N7TA 5DQHA 1JXEA 4JI6J 2ADCA 2A0FB 1OY6A 3TI0A 2MY8A 2J0QD 1I5OB 3QMQA 2HNZB 2H5EA 3LPEA 4F3MA 1U6BA 5DZ7A 1EKSA 3N4WA 3MM6A 1YRTA 5ETRA 1JLFB 1D9AA 1DHMA 3K5MA 4B3RJ 3AA8A 5A6PA 2NSCA 4C11B 1NH8A 3HFVA 3DOLB 1UA0A 3H40A 2W9BB 2V63A 1CPZA 3LP0A 4ITSA 5IQQA 5K20B 4UQGA 2MHEA 3J81Y 1JLBB 2RDIA 5L8RC 4ENOA 2DJWA 4W90B 2IRXA 4DF8A 4MKVA 3VF0B 2E1MC 3H25A 1RKJA 2RUSA 2ZM6F 2YH0A 1BQMA 4EGLA 1Z2ZA 2R4FA 2E5HA 1LKZA 2OELA 3M9OB 5LMUJ 1JNZB 5DM6Q 2CFXA 2LA4A 4OX8A 2GMLA 1HNWJ 4YQWA 3CD5A 3W2VA 1EETA 3R7BB 1LWCB 4K4YA 2BYCA 2V94A 1T95A 3GR1A 3Q8UA 1N6QA 2IC3B 1FRMA 5D0EA 4LRAA 3BGOP 2J6TA 2ROPA 1VQ9S 1X4DA 2JEIA 4XO0A 2IJNA 3CW2C 1UW4A 2YVSA 4NPOA 3KLIA 2BQ3A 2Z2MA 2FTRA 2D69A 2IRYA 2JJ4D 2F5GA 4H54A 1NSPA 4OJ3A 1Q95G 1F9HA 3KNGA 4J9VA 3H59A 1P1LA 2PA3A 2XSJB 1U45A 1RWKB 4EYHB 5DDPC 1S9GB 2XWXA 3DLKB 1QM9A 3KLHA 3HCXA 3PKYA 4R5PB 3QSIA 3TNVA 3OTDA 4V19J 3CJ5A 1RT2B 4ZITA 4U96A 2QV6A 4TLQA 3OD2A 4AUKA 4RW6B 4P73A 2ZDPA 4I68A 4DFMA 1Q7LB 4ATNA 3O1LA 4WK3A 4NLVA 3QZ7A 1TV6A 4TY8B 1SJ1A 2OHDA 2DGSA 5MLCV 2VKZG 1CBKA 4C8YA 5ETLA 1I6JA 3MMBB 1UJ4A 2IAJB 1VQ5S 3TA2A 4J9UE 4OJGA 3H8YA 4Y2CA 3AB2B 3ULHA 4URSA 5KFAA 3PNIA 1WG5A 2KM8C 3BV8A 3BKTA 3HVAA 1UZHA 4QWBA 2FJAB 3F41A 3CDBA 1SJQA 4QYRA 5EN1A 2K1RA 4LF6J 2CJ9A 3UCGA 5G0RB 2VOOA 5ADZA 4GRSA 1Z1ZA 3QGIA 4LSZB 3CJRA 2NXJA 1UVLA 2HQGA 1U0SA 4DXLA 5J2PB 3R5GA 2ZJQQ 4IRCA 1IWGA 2DT9A 4ZCIA 4IOBA 4ZVHA 2B51A 4ECVA 3RYLA 2Z2YB 4ZN1A 3CCUS 1Q8IA 3D3BJ 4RNFA 1FVSA 1FHTA 4NMXA 1EP4A 2ZFHA 2ZOGA 2MKKA 2N4DA 3E01A 4CT8A 1S9EB 2QLBB 3K5LA 3H7HB 1UAWA 2ZVSA 2O1PA 3R27A 2F63A 2ROGA 1BE4A 4O3SA 3BR8A 1NUEA 1FDBA 3DRYA 2DXFA 1VISA 1K1SA 4B9TA 2LYVA 1R89A 4DEZA 1VQ7S 4C7QA 2VQFJ 4V19X 2BANA 3NXZA 5D3GB 4P10A 4PG4A 4IFYB 4MK9A 2YNHA 1FDNA 3ZZYA 4GKKF 2HHSA 4FXDA 2FJBB 1R43A 1DY3A 2HQCA 4DFPA 4HHUA 4F4YA 2CPJA 2Z8QA 1X4CA 2HBYB 1M5SA 2CPHA 1N5TA 1FVQA 3HD2A 3GYNA 2ZH1A 3SFGA 2QL9B 3D6MB 4MFBA 2DIVA 4C0OC 2BOPA 4DSIA 4DX5A 4LF2A 2M8DB 4R25A 3EGNA 3HHLC 1ZM9A 1M0SA 4O3QA 4O44B 2W01A 1T9TA 3OT9A 3CNQP 1ZPVA 1QE1A 1PG5B 1RAOA 3CC2S 5FJ4A 2OO4A 1Y00A 3CDWA 1RHQB 1P8GA 2L9WA 3MPUB 4CLPA 2QA4S 2QG9B 2CAJA 2OEKA 3MZIA 4Y2MA 2BE2A 5HROA 2OPQB 3QFWA 1FDAA 2BRLA 2CG4A 5AE2A 3A13A 4O4RA 2XMUA 3IWLA 1FKPB 2AZ3A 3M1VA 4WP8A 1KQKA 5AE3A 2GO8A 3NGKA 4KGVB 2LQ5A 3KUEA 4GKJJ 3VVUA 5IT9U 4ZVEA 3DHWC 3EZUA 1J2VA 3TAPA 1TV6B 1ITPA 1H2VZ 3EM1A 1AZSA 4Q44A 2L41A 4YFUA 3VVTA 3TO8A 3M7VA 4CLYA 2N3OA 3NCPA 5C7PA 4RZRA 4PEOA 4DPYA 5CQGA 2V9WA 1UJ6A 3KK2B 2Y9HA 1U09A 1VQMS 2XZTB 4ZP7A 2UVVA 3EWGA 1S1UA 2D3ZA 1X9MA 2EFQA 2GGPB 4AYBD 3ZZZA 1WEZA 1JX4A 4JI1F 1S49A 1ZETA 1M1HA 1S1WB 1KVIA 1NXIA 2LDIA 5IV4A 5A8KA 4K7QA 3T19A 2KT2A 4JI5F 3T41A 1VC6A 4NZ0A 2J6SA 2K1RB 4KHMA 4YR0A 3BB5A 1N34J 4KHPF 2R8KA 2DR5A 5HLFA 3G96A 3MOZA 2KXHA 4YB6A 5F8JA 3DDKA 1RT3B 2GIQA 2KVIA 4IUFA 5LMNJ 4K59A 3C15A 4WU2A 4B3MF 5AJ3F 4JI0J 3QT5A 2P6SA 3N01A 1S6OA 4NLSA 1UVKA 1KP6A 3GP9A 5C24B 2HWHA 1M5PC 1EP4B 2XMMA 4KQZA 4KC5A 1N56A 3F56A 3E01B 3D67A 1KDNA 5JXSA 2QL5B 1GEHA 1N5YA 4TU8A 2XMJA 4RW7A 3H90A 4UW2A 3MEDA 2IDEA 1XR7A 5HK4A 3B4MA 3MR7A 4JI7F 1RT7B 5JVHQ 2GQCA 4CH1A 1SKSA 1XMOF 1F60B 4JI8F 3PYFA 4FXVA 1SQGA 5KG7A 5HJXA 1UWBA 3BGRA 4HACA 3S1TA 4E0DA 2I6WA 4EZ6A 1RTZA 4X66F 3GFXA 4HDGA 4WIQA 3TX8A 4IRDA 3BH7B 4ZJLA 2BR0A 1GMVA 4KE5A 5EWFA 2NCKL 4ZPTR 2BJ7A 5LM7E 2V2VA 2OP5A 3R5DA 4RW8A 3J80Y 4YUDA 1H73A 1HYSA 3R6LB 2VICA 2YKMB 5J2QB 4X2BA 1S79A 3K89A 3ICLA 5HL7Q 3OVBA 1WSVA 3GIIA 5IV3A 3I82A 3PIPQ 4DPTA 2IHR1 3MEEA 1XK8A 1WHWA 2P9CA 1HNZF 4ZVRB 4Y0FA 1K0VA 2EKYA 2XI2A 3UD4P 4EBCA 4Q8EA 3IG1B 3QJJA 1NSQA 3QGHA 3OSNA 3K57A 3NP5A 1MWZA 1RI7A 2O3DA 2KHCA 2Z0GA 5KG3A 2MKSA 2MQOA 1UVJA 5HN0A 1OPIA 2FD2A 1RYSA 2H54B 2UXBF 1RAGB 3Q0AA 2BE2B 2CZ4A 3G6ES 3HULA 4GVBB 2JLFA 2GAGC 2HMIB 1S1XB 4EEYA 2AKWB 4LR9A 3D7SB 5HVHA 4ED3A 3KUHA 2A10A 3TVZA 3CCVS 1NSKL 4AXJA 1C4AA 2D7SA 1X4AA 4B3TF 2AD9A 2QGFB 1NCLA 1RTJA 3FCWA 1VQKS 2P2CB 2A6MA 1VIOA 3MMCA 5C2GA 4NA2A 4OJ1A 4BWJA 2B9EA 1YJNS 2ASDA 2UUBJ 5A8WA 2Y1LB 4HLBA 4CIOA 2L9DA 4CNYA 3RUBL 3VZHA 4ECTA 2MKJA 3PW7A 4P7VA 4BHQA 4ZS6A 1MU2B 2WTFA 2V8VA 1PYOB 3TAMA 3PYDA 1JMTA 1Z4UA 2W7OA 2DGOA 3M8SA 1RSCA 3VGVA 3KLVA 1TUVA 1F2HA 2C2DA 4DV2F 1SKWA 5D4PA 5D0RA 3IGNA 2CNLB 2EK6A 1VLYA 1HHSA 1XR6A 5C25B 3PW2A 3OL8A 4U9RA 1GNKA 2C3YA 3HSDA 5HLFB 1F0XA 4DLEA 3TZWA 2MJUA 4F36A 3JQMA 2UP1A 4G1PA 3BYRA 2D9OA 1RB0A 4V1Ak 3C15B 1OPZA 4A8KA 4QWDA 2EVZA 4OI1A 4USVA 5U47A 3GR0A 3HHLA 2AYGA 2ZHAA 4FVCA 5T14A 3CE8A 2WRMA 1Q16B 4N41A 5KFMA 4QZVB 2BX6A 2R7SA 3C8YA 2XEXA 4YR2A 1RBLA 2WK4A 3HHNB 3K5OA 4I4BA 1HNIA 5EWGA 1DTTA 5DG9A 4ZOSA 1NK7A 2B9WA 1ZS6A 3IS9A 1N5YB 4KO0A 1ZA1B 4RW7B 3CJTA 3KYLA 4EYIB 3JB9k 3FGVA 2H9ZA 3A12A 4NCBA 3D2WA 2M8HA 2R7UA 1GXTA 1UWBB 3DGVA 2AGOA 4XDCA 2LQJA 1HWUA 3W64A 4WYLA 5E3PA 3GYGA 2OD4A 5KOWA 4USUA 2E9TA 2IA0A 3HLUA 4OV1A 3G8TA 1F9EB 5KG1A 3IP0A 1JB0C 2KI2A 1RHMB 2YBVA 4PABA 2RS8A 2R9LA 1C1BB 4CTAA 4IH7A 1FNOA 4DN9A 1IWAA 5I4MA 4NRUA 4OX9F 5E3QA 4GC6A 3MEEB 3ONQA 1S4FA 2VFTA 1SXLA 3J7YI 3B82A 5G4DA 2JEJA 2KM8B 2O67A 1K0TA 3AY0A 1KKHA 2PGCA 1LK5A 1TL7A 3HXMA 1AA1B 3HJVA 3PRDA 4JYAJ 4J9KA 1OQ3A 2YWHA 1LV5A 1KNZA 2V69A 3JQJA 3OVAA 3DKDA 3MAAA 4DL7A 5A76A 2HVIA 3SQOP 1FNMA 5KT5A 1Y3JA 3L9ZA 4I6YA 5CCLA 1IR0A 3N9UC 4JI4F 4LVOP 1HQEA 1KWMA 2YY3A 3KJFB 2FQQB 1YJUA 1HA1A 3MPYA 1PBUA 2K8GA 6AT1B 1S97A 3CDEA 3MM9B 4QYZJ 1RK8A 3CCSS 2CRLA 4DR7F 5A8WB 4PUOA 2V2KA 3HZEA 2ASYA 2M3DA 3RBZA 1HLWA 4ID5B 2FC8A 1B0VA 1FE0A 4WTOB 2G13A 2HNDB 5D8HB 2HHHF 4J9RA 3TAMB 1TAQA 2OPRA 4RW4B 3AOCA 3H5SA 1Y11A 4ZPBA 3QRPA 2NYIA 4D3GA 3ENVA 3BYPA 3BQ1A 5T41A 3NGUA 1HARA 3DDIA 3ZZUA 4RKUC 4DOZA 3BR9A 4YHHF 4IR1A 1IKXB 4MKAA 4NZ6A 3FSXA 3N0VA 2HLTA 1RAIB 2OH2A 2UXCJ 1H6KX 1V3SA 5HVGA 3I0RA 1TK5A 3HHLB 3CD7A 1HNXJ 3IMQJ 4K4WA 4ZVGA 2ACMA 3T5KA 3QT8A 4TY9A 1Q79A 3FUYA 2GJIA 3DC2A 3A3NB 3QJLA 1DTTB 3NWRA 4CLUA 1TFWA 4DR1F 2VG5A 3IS9B 4DV3J 4M5LA 3IBWA 3P8BB 4AL6A 4UY85 1X4FA 2WVFA 5KFUA 3BF4A 4TKTA 4I6AA 5HQMA 3TJ9A 1B7FA 2BACA 4DS4A 2HZVA 4F4WA 3EGVA 1NHVA 2BJEA 2VBZA 3UD3P 4JV5F 1D8ZA 5DGBA 3GILA 2ZC4A 2IY5B 2R2RA 2KT5A 2J9EA 2CQHA 3ETMA 3T1YJ 4OI3A 3MUMP 1XERA 2PMZD 2NXUA 2C42A 3GJTB 2CPEA 4X65F 2RH3A 4PWWA 1IXKA 1R8PA 3VGTA 4FNHA 3BQ2A 5E0OA 4QIEA 2I5JB 3C6UA 4H4OB 4FDFA 5F8MA 3V4IB 2DITA 4LVNP 4Y28C 1RT1A 1X4BA 4WE1A 2XQCA 3WZ0A 1SH3A 3GZ7A 2RQKA 1LQ9A 2GIFA 4K5RA 5D4OA 2EFGA 3CJ4A 4FBUA 1AROP 4N76A 1CULB 4NA1A 3EXYA 2LLZA 1VMBA 3IGVA 5FLXY 3QYYA 2XMWA 2J0SD 1KD1T 1OJ4A 3UR3C 2WBRA 3DFEA 4YY3J 5CXTA 1O51A 2HHQA 2BVZA 3I9V9 1NM2A 1X0PA 2E66A 2X51A 2UVWA 4KY3A 2WOMA 3I0SB 3I56S 4L3KA 4B9UA 3HVTA 3B6BA 4TXSA 4NLOA 1HBOB 4LF4F 4EZ9A 1P27B 3MAAB 3RR7A 5KFKA 4RNOA 3HJFA 4K4XA 4J9MA 1FJCA 3ITHB 3ENAA 4WIIA 3UVJA 1NNDA 2AJ2A 4USIA 3TJ8A 4BDPA 2YNGA 3MCMA 2DNQA 2FLPA 4I2PA 2FZCB 1HWKA 3W7BA 2UV8A 5RUBA 3JSRA 1JK9B 4M5GA 1JJHA 3CDUA 3EVWA 1YKWA 1U1OA 3R9LA 3AXMA 3H5UA 1U1RA 3MTKA 2ZH8A 4B17A 1Y7PA 2ZKTA 3T9NA 1OWXA 1D0EA 1CC7A 2HIYA 1VFJA 1X60A 4RUCA 5DDOC 2OPRB 2E5LF 2BM1A 2U1AA 4A47A 4ZP9A 3T5HA 2WW4A 5KFPA 1XMBA 1KOHA 1CJUA 3GV7B 3EPIA 3D1OA 3OL9A 3F73A 3X3UA 3DI6A 3K58A 2RHSB 2XNRA 1X5SA 1JKHB 2HQDA 2ZNZA 4IOCQ 3VAIA 3I0RB 4J9QA 4IRKA 2DGXA 3UR0A 4KH0B 2FB0A 2ASJA 1S4EA 2W7PA 2AX1A 1FXRA 2J9DA 4O3RA 3M9NB 2B56A 1MW7A 5I42A 2HFZA 1KR4A 1U8SA 4UUWA 3IN5A 1D9FA 4X4PA 2Q6BA 1RZMA 1KEKA 3G87A 2D74B 1IBCB 3WX4A 1VC0A 1HD0A 2CJAA 4DV6J 4LFCF 3NS5A 4CO4A 5H1SV 4KV8A 5GAEU 1ZZNA 3V81A 3VCDA 1KOOA 2UVRA 3I5CA 2GHPA 5F41A 2NUUG 4YB7A 4X62F 3KK1A 3RW6A 4TQRA 5K8PA 3OJUA 2MLZA 2MKCA 5LXYA 4PXBA 4PG5A 4C48A 5L1KA 5CYQA 4BWMA 5D78A 3V5RA 1F3VA 2ROEA 4U8VA 1XMQJ 4Z2XA 4RL1A 1HR0F 1HQUB 3R3TA 4QOTA 2ATCB 4ES2A 3IM9A 4XPEA 4X4NA 1TTHB 3B8HA 2XLKA 2MSTA 4MTPA 2HVHA 1H3DA 2CQCA 3O2IA 4IQXA 4LFBF 2EBEA 4C98A 4DL0C 4IH6A 1DJ0A 4CO5A 3LQVA 1X8DA 2JH3A 2E7XA 3BO2A 2Y1IA 1AUSL 2HQ3A 4ZVPB 4QIGA 5J1EB 1FESA 1DTQA 3V6HA 5FIIA 4CO3A 5CD4A 3OVSA 2YWFA 1EAYC 4LRCA 4EO6A 2CNOB 2FVCA 3SBMA 2ZC3A 1I94J 2LEPA 3HM9A 1NPPA 4LF9F 2K3KA 4CLTA 3W5XA 5GADU 3MGJA 2UXDF 1Q78A 2PMHA 2Z56B 3UVJB 2RKIB 4AL5A 1YK9A 1CLFA 2F4FA 4LBPA 3A8JA 4N8NA 3ZZOA 4O0NA 1QVGR 1MN9A 2CQPA 2M52A 2WW8A 2KL8A 4RU2A 2QRRA 1WSRA 3SYZA 5E33A 4IFVA 4K4ZA 3ZZTA 2VD3A 4N8OA 1G6BA 2DGVA 2ZZTA 1NO8A 2R2UA 1V9OA 2CWKA 1YITS 4ZVOB 1BUXA 3H42A 1RAEB 4TN2A 5L9XA 4ZKAA 1YWXA 2B4OA 3LWLA 1K9MT 4B02A 5KFHA 1WC3A 4TNOA 5CHCB 4Y00A 2X1BA 3OLBA 2GV1A 4F3QA 1CJUB 3LOUA 1S7HA 3KG1A 1YJ7A 2IBOA 2RQCA 4OZ3A 3WIUA 4WYWA 4C0HA 2DIUA 3V6DA 5FDLA 2FHOB 2KN4A 2SXLA 2DNGA 4RNHA 2VPXB 3NOGA 3DI6B 1YTYA 1PC5A 3DLJA 4LQ9A 4RLEA 2X3DA 3E51A 3MEGB 1ZM4A 4N5SA 3BGUA 1FFSB 1QUPA 3MFHA 1BLUA 2XO6A 2WSEC 4LREA 3EICA 3AOAA 1REGX 3SFUA 2HW3A 3MOJB 1S72S 3BSAA 4OZ1A 2APOA 4C3MA 4X64J 3BM7A 3JAMU 3HHEA 4X4SA 2E44A 1VGYA 4DR5F 3GPAA 4DHVA 1R7IA 5IC6B 4NLWA 1IBLF 4P2MA 4DUTA 3J81U 3KJQB 3RAQA 2OPSA 3Q2SC 2MYFA 1UMJA 4B3MJ 5F3ZA 4M8LA 4ECQA 4LFAF 1NDPA 2MB0B 5IT4A 4DN0A 1HBNA 1I51B 3BO3A 2LXIA 3NBPB 4ZCLA 2QA1A 2UUCF 1FERA 4DFJA 2Q6CA 1DLOA 2KFYA 4QU6A 4CZCA 3C6TB 2YNFB 4R8UA 4PXDA 5DG7A 5CYQB 1VBXA 1HW9A 1IKWB 1O5JA 4GC7A 1GXLA 2F8MA 2MQ8A 4KPYA 1XMOJ 4JI8J 1VQ4S 5CYMA 3NGRA 4O0IA 1SH2A 3D0GE 2AWZA 4RW9B 1NKCA 2JEFA 3CJ2A 4WKYA 2B6AB 3CEDA 3QQCD 1PJ6A 3QPIA 1S9FA 2HVZA 1RQ0A 1XNQF 2M5YA 5CAAA 3PR5B 4XAKA 3EVOA 4ZHRB 3A3OB 4J9SA 1N88A 2O5DA 4PRFA 4PG7A 1RP5A 3VAGA 3SV4A 4ZCMA 5KFWA 2XM3A 1VS3A 4WFNQ 3M05A 4TU7A 2R8GA 3G82B 3DOMA 4X84A 1N33J 1APSA 3ET6A 1T03B 4DR6F 2ABYA 1S6PA 3I5AA 1VDHA 2M4MA 1FD8A 3V6KA 3M6WA 2C2ZB 5F3TA 4F67A 2XTJP 2F8EX 4OZ0A 2DEIA 1M5OC 2I38A 2RDJA 2CQ2A 3T6JA 4KFBA 3BN7A 4OLOA 3DRSA 2I0XA 4NLXA 1S0VA 1WUUA 4QIVA 1DQ8A 4ELUA 4P2XA 5IFMA 4O4GB 4F8RA 4IFVB 5KT6A 3GIRA 1TU0B 2KT3A 3R5BA 3RB4A 1WF0A 4KT0C 2D3UA 1RAJA 3UNGC 2M9KA 2RAQA 2PO4A 5E3CA 2RIJA 1NLKL 3U1NA 3SDEB 3ILIA 1HNVA 2ZE2A 2X1FA 3OTEA 7FDRA 4GO7X 5K8MA 4HR2A 3NAHA 4FYWB 3KK3A 3Q8SB 2OMLA 4HDHA 4ZN3A 1RBAA 3W63A 1SC4B 2B9XA 3MR6A 3WC2A 3OXFA 3RRKA 4DX7A 2BDPA 1U49A 2G2OA 1FKOA 1QVFR 4IG3B 3CCJS 2XHCA 2FJXA 3V6JA 5D0GA 3AD8C 2DNKA 5DG8A 1IUJA 2VG6A 4ZPAA 3W65A 5CD4H 2HS0A 3MD3A 2ZD1A 3P3DA 4P2SA 5HMWA 9RUBA 3WQPA 2CJXB 4MYUA 4MKBA 4DZDA 4ZLPA 3PXGa 3SSQA 4DQQA 1JLCB 3T1AA 2J9DE 4XIUA 3I31A 1UTAA 4Z37A 1IKVA 2VG7A 1IBKF 2W1BA 3KJVB 4HT7A 2V34A 4DV7F 4AE5A 3Q83A 2W2QP 1RAHB 3PFEA 1WC0A 4Q0BA 1EJ7L 2GVDB 1UVIA 4FF3A 2IBKA 3PO4A 5BR8J 3FMBA 2QMWA 4JV2A 2DISA 2CPYA 3HVWA 3M8PB 2UU9F 1RT5A 2BJ9A 2GCFA 1VI7A 3QJPA 1S57A 4ECUA 1B70B 2H3EB 3MMAB 2EI5A 3OLAA 3P49B 3EXCX 3TVKA 2DNNA 3K8VA 4OL8A 3ILJA 4USTA 1M1GA 2UUAJ 2FVPA 4R8UB 3W66A 1YBAA 4ELVA 4IO1A 1KFDA 4IOAQ 2CADA 3M6XA 2C1EB 4DDFA 5A8RB 4USHA 4LF7F 4UF4A 1F3FA 3DRRA 4I2QB 4AL7A 1NJZA 2MKYA 1CJVB 1VCTA 5CYMB 4X4QA 1HQ2A 3DM2A 1FJ7A 1U7LA 2J0WA 1HKAA 2XNQA 3UDLA 1U6ZA 3FK4A 2GO9A 4NE9C 4CQ1A 3PJWA 2IIHA 1WOOA 2RF2A 2YX1A 2AYEA 2CA9A 4KB7A 2IRUA 1NHUA 1M5VC 1A7GE 2H5IB 3K8WA 4PPZA 3I9ZA 2JRSA 2AF6A 3OTOJ 2BOAA 5CCMA 2OD6A 1SI9A 3M9MB 4K2JA 2BKNA 3HT0A 2G2ZA 1T9YA 2MEWA 4USMA 3NKYA 1RWPB 3HD1A 3I55S 2HS4A 1YDLA 4JI3J 4C3LA 3HSJA 1ZAVA 4NLYA 1N32F 3GCXP 2VJVA 5KFZA 4CNZA 5I3UA 3UDCA 2F4VF 3DMJA 1Y5NB 1FX4A 3IR6B 1X5PA 3NS6A 4NYZA 4LSLB 2XLIA 2JEGA 2VPZB 1UFLA 2HHWA 1S6QA 1ZZFA 4LF5J 4F0HA 4TQSA 3M2RB 4LQ3A 3HZGA 3DRSB 4J9PA 1J5EJ 1WG4A 2BV3A 1CJTB 2GHWA 2ALZA 2DTJA 5HP1B 1NK4A 3C46A 2VBYA 2VV5A 1MSWD 1Q0NA 1NRKA 3THTA 2HPUA 2V0NA 1TK0A 2FVSA 2EFPA 3UE2A 1HNVB 2ZE2B 2Z57B 1FJGJ 1FX2A 4WWSA 1YBTA 2HGMA 2J5AA 2XYGB 2QJ3A 3AFGA 4BLGA 2AYMA 4DR7J 1FKOB 2PN6A 1TKXB 1Q82T 2GMHA 3SSRA 1GX5A 3L4BC 4U67Q 4HTJA 3PJXA 2LEBA 2FHMA 4B9VA 5KT7A 1SB6A 1Q8BA 3UO0A 1U1MA 3MM7B 4OZ5A 4FPIA 2EFVA 3MURP 3M30A 5IWAF 2E5JA 4LRDA 4WJBA 1RWXB 3QIDA 4DCPB 2YKNA 2ATLA 2MQNA 3JYTA 5L1JA 3UDVA 4YHHJ 1URRA 3FDSA 5L46A 3US5A 4MT1A 4HH0A 1IBMF 2YWEA 2IVMA 1ZBTA 2AU0A 1TL3A 2JLGA 5K9FA 3DRXA 1LXJA 3OFGA 1G1XA 4ANCA 1RUSA 1RT5B 1S1VB 4I67A 2RMLA 3IAS9 2NQPA 1N52B 3CCMS 4DR2F 1JJ2R 5E41A 3L7OA 5A6WA 4HH1A 4PWDA 4NXMJ 1U8WA 5DETA 2PE8A 2CUYA 2JLEA 5KFVA 5B0BA 3K0JA 4JB8B 1VQOS 2CVEA 4QPXA 1UEVA 1U6FA 1TUGB 3RR8A 1ROFA 1E6YB 4RBTA 3DLLQ 4B3RF 3DRRB 3M8YA 3CD6S 1VK3A 4BC9A 2OAUA 4CYUB 5GMDA 4DG1A 2XMTA 5ETKA 2IFXA 3PR4A 4FZVA 1HHTP 2IA6A 2H1YA 2Z30B 2XULA 4J9OA 4OI6A 3ADAC 1VBKA 2VL1A 4MIBA 4K5SA 4RUAA 2V8GA 2MGZB 3H5XA 2RF2B 4RWXA 3KLFA 4OYPA 3EDQB 2DH9A 4F3OA 1S1TB 5LJ3Y 3W8GA 3FRZA 2MLYA 1KC8T 4QWEA 3HDSA 1EZZB 3D54A 1VJWA 4EWTA 4CP5A 3TEGA 5LMUF 2DNHA 2I9SA 1HNWF 3MPWA 3JTNA 3KMSA 1FDDA 2WVEA 4M5DA 1CEZA 4DL3A 3MFIA 3SIPB 2XGPA 2NXEA 5I3UB 2DGWA 1CS4A 4KKOA 3DMJB 3KLGA 3CO9A 5KFIA 3M8WA 2KYZA 4QR1A 2W9CA 5C2CA 3BO4A 4XPCA 1HMVB 2C2OB 3GONA 4U7UK 4CM0A 5AE1A 1QSLA 4I0WA 1WEXA 1GQEA 4IKAA 2JX2A 3G2XA 1SV5B 4WP9A 3KNAA 1K73T 3J81j 4A48A 1IKYB 3FMWA 2WSFC 3K59A 2HFUA 5B09A 3VR1A 2GVZA 1VRUA 1T02A 5BJRA 2PA8D 4MIAA 4FYDA 1IJFB 1UFKA 3KLEA 2AHOB 4IO9Q 4RU9A 1WG1A 2R7QA 2PDAA 5THWA 5IM0A 4A4JA 1WI8A 4TVAB 2F9JA 2RILA 5KFDA 4EU0A 4Y34A 4B3SF 1AW0A 2BQRA 2EC2A 5D4LA 2OSRA 1BQNB 5KG2A 3HHKA 3ZTQA 4P72A 5MAOA 3ZC4A 2ZVIA 3M30B 2AX0A 1TZ0A 2R7TA 1J5OA 3D68A 1T05B 4GO5X 5EUHA 1N36F 4DL6A 1F9FA 1T0TV 2WCXA 3LO3A 4FN5A 1Z2LA 3SQGA 2WONB 1DARA 5KFQA 2R7WA 4AXIA 2QLJB 4I56A 4LF6F 2B5JA 1WHYA 4YP3A 3OR1B 1NJWA 2BEFA 4DV0J 2NR0A 2QYCA 1KLMA 3PV8A 4P6QA 3LP1A 2VH7A 4ZK7M 3SCLE 2ADBA 3FZ2A 5CZXA 2AMCB 4W98A 1TKDA 2P9GA 4Y65A 3HT3A 3MAQA 4ALZA 4YMEA 1GT8A 2EC0A 4K2XA 2DHAA 2YPYA 1PIEA 3BGFA 5F8IA 4NASA 2HVDA 4IQMA 2W7AA 4HHHA 3I6PA 2VZ9A 2X3GA 1UETA 1Q81T 2VFRA 1U1KA 2CZ9A 3TW0A 3GJSB 2DNOA 1WDTA 5H9FK 1OQ6A 4QCLA 4NL5A 4O3OA 2MZQA 1C0UB 2FHJA 2VQFF 2LKZA 1BMQB 1REVA 1LW0A 2RT3A 3DYAB 4A8WA 3Q2TC 1RTIA 2HWTA 2X1GA 2R2SA 5HMXA 1K8AT 2HGLA 3RB3A 4NXNJ 3FFIA 4ECWA 4LFBJ 1V3RA 2B7CB 3MCOA 4NOHA 1IM6A 4H4KA 3TX0A 4PXEA 3DLEA 3PW0A 1TUWA 3TYTA 3R7NB 4F4KA 4UY8T 3UFCX 3KLGB 1SVDA 3T1HJ 3QBCA 1TL1A 2KFZA 3R8YA 4MK7A 3OXGA 4BS2A 5SUHA 3VWSA 2V2QA 4EK2A 1HWJA 1RHJB 2PSZA 3QATA 4ZPVR 2OTJS 3TUIC 4UQTA 2ZH9A 2O66A 1RU1A 2OPPA 4NEYA 4DPOA 3TUJC 2IPOB 4DUYF 2DRDA 4QU7A 3KMQA 1YZ6A 1FTCA 1VYAA 4U7CA 4EFAC 1R0BG 1NJIT 4OYOA 2K7JA 4M63A 5F8HA 1FEEA 3W60A 5IS2A 2HFNA 4C2MA 4NRTA 5KTQA 3PYEA 2GVZB 2VDIA 4DPXA 2XMVA 3PFOA 2AZ1A 3KLEB 1ZAXA 3U27A 2BKPA 1UKUA 4F26A 1FT8A 3O8WA 4PQUB 5IM0B 4OYXA 1T3NA 4GKJF 3AHPA 1KBRA 4WCEQ 2F3JA 4KTQA 3NY0A 2PFFB 5DO2A 1JQGA 3O44A 4NLPA 2D41A 3MM6B 4RJVA 1MMLA 2WVCA 1XNRJ 2BMBA 2ZDOA 4CRJA 3I96A 1TAUA 1FXLA 3CC7S 3IBCB 1RKIA 1SUQA 4LSNA 3I5BA 3LP0B 1J5OB 3WDOA 4LF8J 2JZ5A 1VQNS 3BPSP 1HI0P 3M32A 2CQIA 3Q86A 1GMWD 3SEOA 1UPPA 1EIYB 5K5MA 3PX6A 4DI6A 2JDJA 1QAIA 3RGIA 1HWIA 1ULRA 1FJEB 1VQSA 3LP2A 2XLJA 3KG0A 3DOKA 1X4HA 2L3MA 2DRAA 2B5JB 1N34F 4I7FA 3T5JA 3I4HX 5AXLA 5KFJA 1BQMB 1KQGB 4M95A 4ZLNA 2HHPA 3OUYA 2WVBA 3QLHA 1KLMB 1FI4A 2K2PA 4USKA 4DV4J 4C4WA 2FLLA 4PG8A 3AD7C 3W2VB 1EETB 3RAMA 3A4TA 1IBLJ 4PG6A 5H9EK 3NLCA 5JJBA 4NLRA 1N6QB 1QUVA 3RBEA 3N6MA 1ZM2A 3LALA 3R5JB 3CT9A 2EXUA 5EX3A 3NL0A 4Q7AA 1J27A 2KZMA 4IG0A 2CQDA 3Q23A 3KLIB 1DFDA 2G1DA 2B4UA 4OX6A 4K0KJ 2CQGA 1NPKA 2BJDA 1QY7A 2DGUA 3QAUA 4ZCKA 1KONA 5FLXU 4FKYA 3W3SA 3NMRA 2IDLA 3DU5A 2F65A 4USWA 4JUZA 2IVYA 1REVB 4C8MA 1LW0B 4ED2A 3BN4A 2PI4A 3KLHB 1F1BB 2LDYA 3BEGB 5GAEI 1RTIB 3PKMA 4CT9A 2XS5A 2VFUA 3FFIB 3BH6B 1VIXA 1S5ZA 5ETMA 1XNQJ 2RD5C 3PJ9A 3J7AN 1QTMA 2BKOA 2KG0A 4ICLA 4ED6A 2RRNA 1TL1B 4NZ7A 3GLJA 3S8SA 3U7JA 4EO8A 3Q22A 2Q79A 5E5NA 3MM5A 1U1LA 2HNYA 4X4UA 3CVKA 3CC4S 3D6FB 1Y5LB 2BUNA 3RJMB 2XMKA 2OPPB 1JLAA 4PWUA 4DUZJ 2ZH7A 2KZZA 1ZAWA 1SPBP 4DR6J 3D5MA 4LBHA 4HVZA 2N3LA 1UW9A 4DMZA 1QD1A 4OV6A 2OFHX 5B0GA 1U1NA 3KTQA 4WFYA 5KFEA 1JIHA 2R8HA 1PILA 3BJYA 4IH5A 4OI0A 3IWXA 1JNRB 5F9LA 4L73A 4OMFG 3D66A 3R1LA 3V4MA 4DSFA 1H72C 1WC4A 2DNYA 2OKQA 2W2MP 1KHWA 2IVFB 4X4TA 3BSOA 1TMJA 5DGAA 3TVYA 4PYAA 3WBZA 2R42A 5GADI 4WU3A 1SKRA 4QW8A 1RHUB 4F02A 2H4YB 5SZTA 4QWAA 1RDRA 2V8PA 3MM8A 1VHFA 2XHWA 4OZNA 2ZWOA 2AQ4A 2KH9A 5JVGQ 5DLFA 5F8GA 3P45B 1SUQB 4LSNB 1FRXA 4JI2F 4QWCA 2DYAA 3CJ8A 4ED1A 5KG6A 4OJHA 4ZVFA 4A8YA 1HPZA 1TKZA 1D09B 1E6VA 2JC1A 4B9NA 5CA5A 2BANB 3CSKA 4B08A 3DDNA 2YNHB 5F8NA 1H38A 4XK8C 1S0MA 4F2RA 1HWLA 4C0BA 1Y5IB 4BC7A 4IR9A 3OUYB 2YH1A 3W61A 3CJQA 3OJSA 1VRQC 4LIWA 2DH8A 2FJWA 4GMKA 5BYQA 4DV1J 3G9CA 4MFBB 2QSFA 2QA2A 3TR5A 1RBOB 3M2VA 1YHQS 4ZA1A 4LBIA 1VRTA 3B4DA 3W2WA 2VIHA 3I32A 3HKWA 2UU9J 3IA0A 1C1CA 4IG0B 4RPFA 2DK2A 1TELA 1QE1B 2AJ4A 4X4OA 5B0AA 4LT6A 2OTLS 1MROA 4Q5VA 3ENQA 5HJYA 4FKXA 2BA9A 1X9WA 2JFKA 1R27B 3NNCA 1UEKA 2HNZA 4DR3F 1TL4A 3FQKA 1WD6A 4W92B 4DU8A 4F4ZA 1JLFA 3QRQA 5HROB 5EX0A 3G6VA 3OBIA 4C11A 3M1VB 5H9FJ 5J1NA 3DOLA 1VQ8S 4MIWA 3CB4A 2JVOA 3PIOQ 3ZTPA 4DR4J 3THVA 1JLBA 4K4UA 1ACMB 3JTPA 2W24A 2AW0A 1AZSB 3CF5Q 2Q1LA 2HFOA 1LK7A 2COLA 4ICLB 3FRYA 2VONA 4UT4A 4CH7A 3BREA 3G8QA 1P1TA 1L3TA 1WC5A 1EHWA 1S1UB 2IM0A 2CQBA 1QLNA 3MM5B 4ED4A 4XDDA 4HTIA 3TUZC 3QIPA 5C42A 1R6YA 2BM0A 1LWCA 1N32J 5A8KB 1PAUB 5KFBA 3D6HB 1X5TA 1TP7A 1PCAA 4C8KA 2IC3A 5M2RA 4JYAF 3R1HA 1XJWB 2E1PA 2KXFA 2DNMA 3HPOA 3LGNA 1VOMA 1SJRA 1CC8A 3NS7B 1GX6A 2J9CA 2HHUA 3BQ0A 4L3NA 3HMJG 2P9EA 1AFJA 1RWVB 3KHRA 3BKUA 1WDDA 2QFJA 3DXSX 5B0DA 2HFSA 1RISA 2XSJA 2C28A 1A0OB 2XMAA 3CWJA 2D1CA 5J2NA 5LXRA 1MLAA 2LQBA 3L7UA 2IYGA 1YJ9S 3MM8B 1NH7A 2BJ3A 2CG8A 2K3IA 3EGWB 2HBZB 2AGPA 3V2UC 1LNQA 3C16A 2Z2ZA 3G8SA 4MJKA 3UQSA 3MEDB 4N56A 4DFKA 2N4CA 4A8OA 1LOUA 2W2OP 1HHQA 3OW2R 1HPZB 3H2UB 3GIKA 1TKZB 1RAAB 4FYXB 4TY8A 3BDEA 3BGRB 4HACB 4CCHA 2BJ1A 2V50A 5DQGA 4I64A 1SCJB 2YWGA 1WKLA 3PO5A 1WJ9A 4O3PA 1UFWA 4A46A 3AAWB 1YJTA 1FWKA 2EFOA 5B0CA 5ETTA 1GK8A 3IXQA 3MR2A 4YB5A 5LJ5Y 4WXWA 4RW8B 2Y8WA 1YRXA 2ZBIA 1HYSB 4BBYA 1TKTA 2WB1D 3NNHA 1A9NB 2DH7A 3QGPA 2IM2A 5HAOA 3X1LB 2ZJPQ 3LGHA 3TARA 3HSGA 2DCUB 1IBMJ 3TZXA 3VAKA 4CLLA 2YX7A 3GQCA 1VRTB 3W2WB 3RZAA 1G7CB 5G0RA 1SJ3P 2CZVC 3A8IA 3PEHA 1C1CB 5J2PA 4ED5A 3VGUA 3RB0A 1VHIA 4DR2J 2AT1B 3D0IE 2HS3A 2MZJA 3FC9A 3UW1A 1UVMA 1MROB 1QAXA 3TZZA 3RBDA 4RX6A 4FBTA 1FA0A 2WAQD 4F04B 2HWIA 2LMIA 1RTDA 2RU3A 4F4AA 2PEBA 2XB2D 4OYZA 1Q4RA 1FWPA 5KFNA 1N48A 1S9EA 3FNNA 4P71A 2HVEA 1SBRA 3KDOA 3CCES 3GU0A 3T1YF 2QO3A 2DD8S 4DJBA 2VJUA 3JAMY 4OHYA 3CCRS 3BSCA 3E3XA 1YVFA 3IBFB 4JBCA 2M0GB 2E1CA 5K8NA 2B4VA 1MMDA 3JSBA 1RTJB 2NUHA 3FBFA 2AJ0A 2FY8A 3MMCB 4RR5A 4KGMA 2LQ8A 1N8RT 5L38A 5D3GA 4NLQA 4IFYA 4TYBA 2VASA 2ZOMA 2BXJA 3NAIA 1ZA2B 2A1BA 1VBZA 1U2FA 2RUGA 4ELTA 2YX4A 4KJIA 1I1GA 1R3NA 3W9HA 1FRJA 5LSRA 3UN2A 2YQ1A 1ZM3A 1B99A 2D3O1 3KJNB 3GSDA 3QIPB 5C42B 3ETOA 4J7CA 3R6GB 1FCAA 4YY3F 1X7VA 2VKRA 3BZQA 3FZBA 4CO2A 1M90T 1TFYA 4O44A 4B3OA 2G0IA 2VQEF 3S6EA 3I4PA 3BDPA 4FYVB 1RA7A 1VJQA 1R6VA 3L3CA 1Y10A 1S48A 2ALYB 4HI1A 3W9JA 1RWMB 1Q1KA 5A2QU 2FC9A 3DN9A 1BWVA 4NLDA 4DSLA 2DNRA 4QIFA 1RADB 1QJHA 3O3LA 3FEYB 2GQ2A 3K17A 2G4BA 4P75A 5J2NB 1UZDA 3WX8A 1HNIB 1RLDA 3FEXB 4RUHA 3B78A 2OPQA 5F0WA 3OPKA 2GX8A 2HQIA 2KDOA 1FNXH 3ZTRA 1FKPA 4KO0B 1U26A 3C16B 3N79A 4DCOB 3G6XA 2RJZA 3MD1A 3GIJA 2E29A 2FUG9 2YWWA 4WK1A 4UOHA 2HSEB 3JTOA 2HAFA 1T9UA 1RA6A 2LP4A 2DHHA 5DDRC 1Y9OA 4LR8A 4B3SJ 2MZRA 2Y8YA 2UV8G 4LUBA 3W8PA 3VHQA 1DRZA 1WNEA 3Q89A 6FD1A 2HBQB 3KK2A 3OFEA 4ID8A 3T3FA 2V67A 2GGPA 3HHLD 2ZKUA 2LECA 3HFKA 1N36J 1S1WA 1TKTB 4MH8A 1SC3B 2UUWA 1URNA 5D6GA 4CTAB 4HL9A 3FSYA 3ENWA 1KS2A 4Y2IA 2AV5A 1WKJA 5FD1A 4I69A 1SL2A 1RYRA 1JLGA 3MMJA 3EUNA 1R8CA 1B0TA 2ZM6J 3UI3A 1YQHA 3EGZA 1DBDA 1RT3A 3OR2A 2XSFA 3L7PA 5J2MA 2W8KA 1F6TA 4M5KA 2FIUA 4DV6F 2HFVA 2MXYA 1GFWB 1TL7B 3DHXA 1UP1A 5C24A 2IMWP 2V4RA 4WFBQ 2BRKA 2FLNA 3J7ZT 3NCQA 1RTDB 3W62A 2QZ8A 4X4RA 3GE9A 2KO1A 3EMTA 2OFGX 2VBXA 2XO7A 1IQTA 3K7RA 1WWHA 3ELHA 2JOQA 1OYEA 3KHLA 4PKDB 4DL2A 4EI2A 4PPDA 4WFAQ 1XMQF 1HQEB 1RT7A 2FYXA 1WOPA 5KG4A 1B64A 3IR5B 1H98A 4OHVA 2GIRA 2XZDB 3K5NA 2OI2A 3IAM9 3PX0A 1O0PA 3F0NA 5ETNA 1H0HB 2VA2A 4NWBA 4MMOA 4PUOB 4PQAA 4NCAA 1NHKL 1AUDA 4JOUA 2F8HA 2OEMA 3IRWP 1LW2A 4C3KA 1NJYA 1VQPS 5I3QA 4H4MA 2YKMA 5J2QA 4NYPA 2V68A 4Y2AA 2FGCA 5ETPA 1WTBA 2W8LA 4B9MA 2MQMA 5KAKA 3GG0A 2P8IA 3H5YA 4B3OB 3GYXB 4CO1A 2HRUA 3QT6A 1I94F 4U8YA 1Y4ZB 3GSIA 4O23A 4B9LA 1NDKA 1VQLS 2GA7A 4XTTA 1HW8A 5L9NA 1CQMA 3G86A 3IG1A 1M5HA 3HVRA 1KVJA 2VF3A 2QTWA 3QT7A 4DUYJ 1V5VA 4F2SA 2Y3YA 3KOAA 2UZAA 1XN9A 4J5OA 3SCKE 4C8NA 2GS8A 3BKFA 4OYWA 4U7UD 2V8DA 1HBUA 2N7CA 4DF4A 4GVBA 1YGYA 2VG5B 4QYZK 2IM1A 4KBIA 2HMIA 3T5LA 1S1XA 1F5BA 1PYTA 4QBUA 2B0GA 4DWIA 4ZJOA 3CCQS 4JV0A 3AJDA 3DGPA 4PCQA 4J9LA 4CDIA 1W26A 4B9SA 3FBCA 2DRBA 2PIIA 5L1IA 2CQ4A 2YKPA 5ITHA 3AQPA 1L3SA 3EYZA 3WIVA 2NS1B 3SSSA 2CDQA 3CGIA 3DCAA 2HHVA 5EGYA 5GAHU 1NZ8A 1CQNA 4NLUA 4OFZA 3HKZD 1WI6A 3QWPA 1LFPA 1HFEL 4G1QA 2BE9B 2JFDA 1MU2A 3T6BA 1XWLA 3AD9C 2ZEJA 2CWXA 4ECRA 5B0EA 1ZH5A 1NK6A 2LEAA 4DPWA 2LQ9A 3C6UB 2GJFA 1V3ZA 1R8BA 3GB0A 1RT1B 3LAMA 2P6TA 4HI2A 4WE1B 2B8PA 1JLGB 3R5CA 1BHNA 2OGUA 5CH7B 4X64F 5C25A 4GKKJ 2B43A 1S76D 3SMZA 2W4DA 5L1LA 2JL9A 4K50A 1S99A 1DQAA 1NSAA 3OR2B 5J2MB 4USJC 4WP3A 1B4SA 2YWKA 1BC6A 5KT4A 2FDNA 4ZIWA 4ILMA 3AXKA 4DL5A 1TK8A 2LU1A 8RUCA 2EBGA 3GIMA 2IM3A 4OX7A 1T7PA 2WOMB 2GJ2A 1NEEA 2G0JA 1S6UA 1F2GA 3HVTB 4J91A 2R7VA 2CQ3A 2DB1A 1KSPA 1WF2A 2J7WA 3ILLA 1ZTTA 4C8ZA 1WHVA 2MQPA 2YNGB 2MZSA 4I2PB 5KFXA 3ZTOA 3VV2B 2ZBCA 3P6YC 5GMEA 3D6TB 3LPYA 2ZUGA 4NLGA 2ZH3A 2RQ4A 3OTCA 2V9KA 1SJFA 2QSWA 2N82B 3JSYA 2WZ1A 2HK3A 2BQUA 4ED0A 3RRGA 1RABB 4JV1A 4K4SA 4ILLA 2FZKB 1WEYA 4HEA9 1SIWB 1C2PA 1BXNA 1LW2B 2J6UA 1OY9A 3HFZB 4H4MB 1R31A 4L75A 4LIRA 5KFSA 7FD1A 3H2VE 1CVJA 1NJXA 1FFGB 1W2IA 1C1BA 2ZITA 2R2TA 2ZH2A 3T9ZA 4UOFA 2DPIA 3PX4A 1XEZA 3NG8A 4J37A 2AGQA 1PAEX 1YG0A 1GTEA 2EK1A 3C66A 4HKQA 2BE7D 5JMNA 4DQIA 1WF1A 2DY1A 3L09A 1N33F 4LRFA 2HIQA 3Q24A 2VB6A 1RU2A 1JJCB 4JI1J 2FHKA 3AJ2A 1U47A 4Z7YA 4KIAA 4AD6A 4JI5J 1FK9A 1O6XA 5I42B 2DXDA 2NYHA 3BBFA 2FJVA 2MZTA 1HL6A 1HBUB 2W4PA 4KHPJ 2CJQA 5E3AA 3NEKA 1PC4A 4ER8A 1NKBA 2FVRA 2YKOA 3AH6A 2ILZA 2QEXS 4R0JA 3RW7A 4OZ2A 2FGOA 1JLEA 2POKA 4QPTA 1ZPWX 3LTOA 5AJ3J 2CVIA 1U24A 3PTWA 4E2FB 3DGPB 3FEZA 4KV8B 1MG7A 4G3IA 4AQYF 3V81B 1NPRA 2XY7A 1ICEB 5CZVA 1U0HA 2Y1RI 3GFZA 3MM9A 1FXDA 3M6UA 4HHJA 3IC1A 3KK1B 1AXQA 1Y0HA 3NGSA 3M8RA 4DBQA 2EEYA 4ID5A 1H74A 2J7KA 1EX8A 5IZHA 3PRBA 1NK0A 4G1QB 4UOGA 3IR7B 4JI2J 2HNDA 1SL1A 2XYHB 5IOLA 2HEKA 2GC8A 3MPDA 4JI7J 5ETOA 2A3JA 3G71S 2RRBA 1S12A 4CO0A 4RW4A 4OQJA 3MECA 1UEUA 2XG8A 1VC5A 3QFHA 2KTQA 2GQQA 4X66J 2CNKB 4ZP8A 5BYSA 2DHGA 1S77D 1IR2A 1XIQA 5I3PA 2W4CA 4O3NA 5IT0A 1IKXA 4YOEA 2MJNA 2NXNA 1SH0A 3TQEA 1HI1A 1RHRB 2MZ1A 1VBYA 4MAKA 2M2BA 2HAIA 5BR8F 2E7VA 1D9DA 3GG1A 5HANA 4DX8H 1JXLA 2QFIA 2R7OA 1DTQB 1U1QA 3CMQA 1F5CA 3CCLS 1L3KA 4P74A 2HRTA 3TZYA 2V8HA 4M5IA 2YQ0A 5GMKa 3FBEA 1K1QA 1VQ6S 2YTCA 2YKQA 1HNZJ 2PC6A 2UUAF 1Q5YA 1H7XA 4AFFA 3H0PA 2RDDA 3UPFA 2CIMA 1QTNB 3OHBA 1XQIA 3P96A 2GW8A 4WFZA 3ZZRA 3IO1A 4DR3J 1GTHA 2UXBJ 3PZPA 3EDRB 4NLTA 4CLZA 1L5UA 2C2EA 5KOXA 4ZPDA 3A8KA 1RE1B 3RB6A 3AQOA 3RBXA 5E7OB 3Q8PB 1EQMA 2M70A 8AT1B 5HO4A 2RU9A 2HURA 1Q53A 2KKHA 2YKAA 4B3TJ 3OTOF 1YJVA 2I5JA 2VOPA 1LFWA 4KRWA 4H4OA 2G9OA 3V4IA 3TRGA 3TWZA 1RXOB 1U2CA 4CLKA 3TA0A 5GAGU 4QR0A 5AXNA 2PMWA 4JI3F 1H7WA 3GFYA 4Q45A 3V6DB 5FDLB 1NKEA 5F8LA 3PG9A 1CULA 4NMLA 1PJ7A 3U02A 3OQ2A 4M1KA 4LF5F 1NB7A 5T7LA 2PD1A 4RUBA 4DV2J 1FK9B 4UUXA 1R8HA 4N77A 1CG2A 1J5EF 3VAJA 1W2BR 1ZOTA 1UA1A 3AA9A 5IQ6A 3BS9A 3I0SA 4YN3B 4GVLA 2GZOA 3Q8YA 3GJRB 1QDUB 4I1TA 1HBOA 1PKUA 4MK8A 4NI2A 1V5IB 2OPSB 2V5HG 4ZLLA 2KU7A 4WXOA 1MWQA 2KJVA 3CIMA 2OMOA 1JLEB 3ITHA 4R0EA 1UVNA 2EWHA 1FJGF 2ZH4A 4KPCA 2YXLA 2UVUA 2ZWPA 2ZUAA 1HBNB 1JLQA 2H5JB 4I6WA 1U0HB 3H4DA 1A6LA 4L6V3 1DLOB 2LFVA 1M5KC 3PRVA 1SIZA 2MTLA 2YQ3A 3PY8A 4ES3A 3DRPA 5KFYA 3EZ5A 2QIFA 3CCZA 2DO4A 3QWUA 4UTGA 5C5JA 4K4TA 2MY7A 2F9DA 1IJEB 3CIZA 2Y0SD 1P9YA 2HQFA 3HP6A 5HSPA 3MECB 1R8AA 3K2YA 2QYGA 2VA3A
chains in the Genus database with same CATH topology
1SKRA 4QW8A 5GADU 2UXDF 3MGJA 3M9OB 1Q78A 1JNZB 5DM6Q 2PMHA 2CFXA 4F02A 5SZTA 4QWAA 2LA4A 3CDAA 1RDRA 4OX8A 4QQBA 2GMLA 3TANA 2VFSA 3MM8A 1VHFA 2XHWA 4YQWA 3CD5A 3FJ2A 2DNPA 1EETA 3W2VA 4OZNA 2A2DA 2RKIB 4AL5A 1LWCB 4K4YA 2XZWA 1CLFA 2E9ZA 2BYCA 2V94A 4N8NA 1T95A 3ZZOA 2KH9A 2AQ4A 5JVGQ 3GR1A 1QVGR 1WACA 1N6QA 5DLFA 2IC3B 5F8GA 1FRMA 2CQPA 1JKHA 2M52A 1SUQB 2VBWA 4LSNB 2J6TA 1FRXA 2ROPA 2WW8A 2DGTA 4JI2F 4QWCA 4RU2A 4ED1A 2JC0A 2MSSA 5KG6A 4OJHA 2QRRA 2DHSA 4ZVFA 4A8YA 1X4DA 1VQ9S 3SYZA 3MXHP 5E33A 2OLWA 4IFVA 2JEIA 2BABA 4K4ZA 4ECXA 5HQ8A 1HPZA 3ZZTA 4XO0A 2VD3A 2FLOA 2IJNA 2VUGA 1TKZA 3D1HA 1UW4A 4TYAA 4N8OA 4KSEB 1G6BA 1E6VA 2DGVA 1NO8A 2JC1A 2YVSA 2R2UA 4NPOA 4B9NA 1V9OA 5CA5A 1YITS 3KLIA 1U1PA 1W25A 2BANB 1YI2S 3CSKA 2CQ1A 3M4XA 4B08A 2BQ3A 2OIHA 2Z2MA 2C3UA 4DV5F 4TN2A 2FTRA 5L9XA 3MF5A 3DDNA 1KHVA 2IRYA 2YNHB 2JJ4D 4ZKAA 4H54A 1YWXA 4DSKA 4HT5A 4NXMF 3RAXA 4OJ3A 5F8NA 2B4OA 1FTRA 2D9PA 1H38A 4XK8C 3KNGA 4PR6A 3H59A 3LWLA 1HWLA 4C0BA 1P1LA 1S0MA 1K9MT 2PA3A 4F2RA 1Y5IB 4B02A 4BC7A 1X9SA 2XSJB 1S6PB 1U45A 5KFHA 4IR9A 3OUYB 2YH1A 4EYHB 4TNOA 5DDPC 5CHCB 4Y00A 1S9GB 2X1BA 4KHRA 3OLBA 2GV1A 2XWXA 3DLKB 4F3QA 2E9RX 3OJSA 3LOUA 3SXLA 4LIWA 1S7HA 2DH8A 3KG1A 2FJWA 2DCLA 4FXWA 4GMKA 2IBOA 5BYQA 2RQCA 3G9CA 5GVQA 4MFBB 1QM9A 3SV3A 3KLHA 4WYWA 4C0HA 2QSFA 3Q8QB 2DIUA 2QA2A 3V6DA 3PKYA 5FDLA 4R5PB 2FHOB 2KN4A 3TR5A 2SXLA 2DNGA 4RNHA 2VPXB 3OTDA 3DI6B 4KFBB 1CSJA 1PC5A 3TNVA 3DLJA 1YTYA 3CJ5A 4V19J 1RT2B 2C3PA 4LQ9A 4RLEA 3S7RA 3E51A 2M7SA 2QV6A 4TLQA 4AUKA 3OXLA 3MEGB 3M2VA 4RW6B 1NAQA 1YHQS 1ZM4A 4ZA1A 2ZDPA 4I68A 4DFMA 1Q7LB 1VRTA 3BGUA 4N5SA 4ATNA 3O1LA 3NNAA 3B4DA 4WK3A 2M88A 4KR0B 4NLVA 3W2WA 1QUPA 3MFHA 1BLUA 2LU2A 2WSEC 3I32A 3HKWA 3QZ7A 1TV6A 4TY8B 2NPFA 1SJ1A 3IA0A 1C1CA 4IG0B 3SFUA 2HW3A 3MOJB 1S72S 2DK2A 4IYQA 3BSAA 4OZ1A 1LWEA 2APOA 1QE1B