1VRUB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
425
structure length
410
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 109
structure length 410
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vruB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB03
2IJNA 2YKNB 2BRKA 3TVKA 3OSPA 4ECQA 2B6AB 2JC1A 3CVKA 5HBMB 4ZP8A 3DLEA 2OPQB 3V6KA 2GIRA 2W9AA 4WZMA 3M8PB 2FVRA 5DG9A 2WONA 5KFGA 3OSNA 1RT7B 3V6DA 4K4TA 3G86A 2E9TA 5KG0A 3RB4A 2E9RX 3BSAA 1S4FA 3NKYA 4KBIA 5DLGA 3DRRA 3MF5A 1SUQA 4NLTA 3LP2B 1RTHA 1S1VA 4IH5A 4URGA 5KFHA 3MFIA 2YNGA 2FVCA 1IM4A 5D3GB 2IAJA 3JSMB 1SH0A 2RDIA 4I7FA 2F8EX 1S9EB 4RW6A 1RT2B 1IKVB 4I2QB 4WFXA 4LSNB 2VA3A 2RKIA 1Z4UA 2JEJA 1T03A 4RNHA 4IFVB 1ZTWA 2R2UA 2J6UA 4JV0A 4KV8B 5KG4A 5L1JA 3KNAA 3CJ2A 1S48A 4RW6B 2AX1A 4WYWA 1S9GB 2WTFA 1MMLA 3V4IB 2D3ZA 2IAJB 3JSMA 4MKBA 2C2DA 5F8IA 2V9WA 4QWBA 4WFZA 4Q8FA 1IKXB 3I0SA 3KLGA 4TQRA 3PHEA 4ZVEA 4NLRA 2BRLA 3HVAA 2HNZA 2OPSA 4URSA 5KG3A 5EDWA 3BSCA 3BREA 1RT5B 1DTQA 4IRDA 4KV8A 1TL3A 4FBUA 1RA7A 4WFYA 1RAJA 2R8HA 4KKOB 5C42B 3MECA 3DOLA 3H4BA 4IH7A 3G6YA 2JC0A 4HKQA 1SH3A 1HQEB 3HVWA 3MR2A 2UVWA 3CJ4A 5KFVA 5KFFA 5KT5A 2C22A 2VA2A 5KG7A 3KHRA 3QYYA 3DI6B 4RZRA 1TKXB 2IM3A 5KFZA 2D3UA 3CIZA 4EBCA 1QE1B 4ECZA 4KAIA 3OL9A 3H2LA 3PW7A 1HYSA 4K4VA 3V6DB 3KLFB 1S1TA 3FRZA 4ICLB 3GYNA 3OLAA 5DGAA 3RB6A 3H98A 4LQ9A 4ECRA 3KK1A 3QZ8A 3LP1B 1C0TB 4NLOA 2WONB 1T03B 3DMJA 5I3UA 1N6QA 4ECXA 4QW8A 5KFBA 4JV2A 3KHLA 2FLNA 1LWCA 2HAIA 5J2QB 1JKHB 3MEEA 4ED6A 1S1UB 2XI2A 4TYBA 4O3RA 2IMWP 3DOKB 5KG2A 4EBDA 4NCGA 1REVA 3M8QA 4WE1A 4YR0A 5C24A 5J2MB 3V81A 3T19A 4KB7A 3MEGB 1C1BA 1SV5A 2B5JA 2VG7A 3IS9B 4JUZA 5DQHA 4IKAA 1LWCB 2FJWA 1WNEA 2IM2A 5KG5A 1VRUB 5KFJA 5EUHA 4IRKA 5FDLA 1C0UB 4KSEB 2I1RA 1R0AA 2XGQA 4DL2A 3MR6A 4EBEA 3IGNA 4ECUA 3V6JA 1J5OA 5HLFB 2B6AA 3RBDA 1LW0B 4RW9B 4URQU 3OL8A 2W7PA 4G1QB 1C1BB 1SV5B 2VG7B 3LANA 5HROB 5KFXA 3D5MA 3EZUA 5F9LA 5EWFA 4Q43A 3BQ1A 3TAMB 3HHKA 4NRUA 2JEFA 3FFIB 3RB3A 4WXOA 3PR4A 3PZPA 3CDWA 3H4DA 4RUCA 1IKYB 1N48A 1FKPA 4M94A 1S0MA 3KOAA 1XR5A 3KLEA 1RT1A 5HP1B 1LWFB 2ASDA 2B5JB 1DTTB 1LW2A 3ICLA 5KFUA 3QIPA 1HARA 3KLHA 5F8NA 4NLQA 4MK7A 1S1UA 2AWZA 1N56A 1KHVA 2UUTA 4PQUA 3PVXA 3Q8PB 4R8UB 3DM2B 4RW7B 3DLKA 1JLFA 1RT3B 4RW8B 3DMJB 1N6QB 5J2NA 2WOMB 1DLOB 2HNDB 2R2TA 5J2PA 1C1CB 1JLBB 2XWYA 3FQLA 3QGIA 4XO0A 3I5BA 3MECB 5KFIA 2IM1A 2RDJA 1IKVA 4I2QA 2XI3A 5T14A 2FJXA 5JXSA 3V81B 3GIKA 1S97A 1S49A 4ED8A 4MIAA 2R2SA 5KG1A 3LP2A 3DI6A 4ZHRB 3DLGB 1RT6B 4I2PB 4IG0B 4IG3B 3E01A 5C25B 1N4LA 2V0NA 3IRXB 1T05A 4ZP7A 4M95A 2ILZA 4KHRA 4RNNA 1BQMA 3IN5A 2UVRA 3QO9A 4J9NA 4IR9A 3LP1A 3OLBA 3GV8B 2R8GA 3NBPA 3H5XA 2CKWA 5KFWA 1DTQB 4ZPDA 4ZVGA 1JLFB 1RT3A 4NLYA 4TQSA 3BQ2A 4RNMA 3MFHA 5F8GA 2WB4A 1JLAB 2FJVA 5KT7A 4DG1B 3MR5A 4QWAA 4DL3A 3PJXA 4RU9A 4O3SA 4PUOB 3PR5B 4YP3A 2CJQA 5EWGA 4KFBB 4F4XA 4B3OA 5DG7A 1KLMA 3DOLB 5J2PB 2IC3A 4KKOA 1UWBB 1EETA 5F8JA 3I0RA 3KLIA 3DM2A 4RW7A 1W25A 3IGVA 2XCPA 2VG6A 3KK2B 4R5PB 4O3QA 4TY8B 4U7CA 2AX0A 2OH2A 2YNFB 4RNOA 4PWDB 4NLUA 5KFYA 2QV6A 4MK9A 4NLPA 5F8MA 4NLWA 3FFIA 2UUWA 3QLHA 2VG5B 1JLCB 2E9ZA 4MIBA 1YVFA 4O3NA 4DL4A 3FSIA 2JLEA 3CJ0A 3DRPB 3JYTA 1T3NA 3HVTB 5KFSA 1VRTA 2W9BA 4K4ZA 3IG1A 3DLEB 1GX5A 3PW4A 4J9QA 4R0EA 1IKYA 1HNIA 1QAIA 1U09A 5KT2A 4QWDA 3GQCA 2WCXA 1JLGA 4H4MB 3DRSA 3EPIA 2YKNA 4OL8A 2BQUA 2FVSA 4ECYA 3NL0A 4IQXA 4LSLB 2XCAA 2ZKUA 4PWDA 4KE5A 2R8JA 2FVQA 3V6HA 4K50A 1J5OB 2V4RA 3CJ3A 3CO9A 3DRSB 1JLGB 4H4MA 3MTKA 1VRUA 4YMEA 5KFMA 3TQ1A 2DPIA 1HPZA 4NLVA 4IR1A 3LP0A 3G6XA 4ICLA 4EO6A 3KLFA 1C2PA 4O3OA 4O3PA 1K1SA 4GC6A 2ASLA 1JX4A 2BANA 2BE2A 3NGDA 4NLSA 5KFKA 4QWCA 3T5HA 2JEIA 1T94A 5J2QA 4Q45A 3M9MB 1S9FA 5I42B 4TYAA 5K14A 4R5PA 3M9NB 1S0OA 4KO0B 3KK1B 4IH6A 4O4RA 1TKTA 5KFQA 4ECVA 3H5YA 2IBKA 1D1UA 4YQWA 2BQRA 5DG8A 3CDUA 1RTDB 4IRCA 3DLGA 2VG5A 4O4GB 2IM0A 3N6MA 1TL1B 4U6PA 1HNVA 1QE1A 3ISND 4HYKA 2ZD1B 5EWEA 4DL5A 2ZE2A 5F8HA 1HQEA 4EYHB 2ASJA 2EC0A 4QWEA 3OL6A 3MR3A 4ZVHA 5C5JA 3PJWA 1UWBA 3H5UA 1FK9B 4TN2A 5KT4A 1KLMB 4IFVA 2W9CB 2AGOA 5J2NB 4J9PA 1S1TB 4F50A 1S0NA 5KFCA 4QW9A 2UVUA 1RT4B 1RT2A 4J9OA 1OS5A 3PW0A 4XPEA 3KLGB 3SI8A 4TY9A 5KFOA 3GV5B 3GV7B 5JUMA 4ED3A 1EP4B 2WHOA 1I6JA 1SUQB 3QIDA 3BSOA 4J9RA 3T5JA 4ZPBA 2IA6A 2AGPA 1JLEA 2GC8A 3QIPB 4H54A 3OHAA 2O5DA 2W9CA 1LW2B 2QE5A 2WRMA 3LALA 1S6QB 3C6TA 3C6UA 3UPFA 3KLEB 1BQMB 2YKMA 5HP1A 5F8LA 4DL6A 3KMSA 1S9EA 1ZETA 4KFBA 2OPRB 1RT5A 4ZP6A 3QGGA 1JLEB 3VQSA 5D3GA 4NZ0A 3OL7A 2C28A 4R8UA 5I42A 3NAHA 3BGRB 4F4ZA 4IFYB 1S10A 4DG1A 2ATLA 1S1WB 3ISNC 4DL7A 3RAXA 4H4OA 1MU2B 2HMIA 3RBEA 1RTIB 5J1EA 5HROA 1IKWB 4Y2CA 3DYAB 2V4QA 4IDKB 3FQKA 1RTDA 1TKTB 1D0EA 1DTTA 3KJVA 4KHMA 4ED7A 4Y2AA 3M8PA 2WOMA 1LWEB 4XPCA 3SFGA 5DQIA 3E01B 2ZD1A 4Y3CA 4Q8EA 1RDRA 3M9OB 2HNYA 1HNVB 1RTHB 1S1VB 4TXSA 3M8QB 4WE1B 2BE2B 2R8IA 1TKZB 3SFUA 2C2RA 4ED1A 3DRRB 1NNDA 2OPPA 1HQUA 2W7OA 1RYSA 4O44B 2GIQA 1S6PB 3E51A 4ID5A 4FBTA 1HNIB 4KO0A 2RF2A 1KHWA 4ZMMA 2W8LA 4NLXA 1C0TA 1BQNA 3ITHA 1NHVA 1VRTB 5KFLA 4JV1A 5KT6A 3CJ5A 3KK3A 5KFTA 1N5YA 4K4YA 4Q0BA 3HKWA 5KFAA 1HQUB 2R8KA 1NHUA 1JXLA 3DOKA 5CYMB 3BGRA 1LW0A 2HNYB 4RW9A 4EEYA 4TY8A 2BR0A 1BQNB 1JKHA 2OPRA 3ITHB 3MEEB 5CYQB 2VG6B 1LWFA 3KK2A 1CSJA 5KFPA 5L1IA 5L9XA 1TVRB 2I5JA 5DGBA 5I3UB 1LWEA 1FKPB 2IC3B 3T5KA 4J9SA 1JLQA 4O44A 4NYZA 3UR0A 2FLPA 3HVTA 3DRPA 3JYTB 1IKWA 5CYMA 1XR7A 1RTIA 5J1EB 4MH8A 4PUOA 3H5SA 4DEZA 4LQ3A 4H4OB 1EP4A 4WXWA 1TQLA 2D7SA 3PW5A 4ZP9A 3QLHB 2IJFA 1HMVB 2W8KA 1FKOA 3MEDB 4YR3A 3KMQA 5DQGA 3BR9A 4J9LA 3KLIB 3I0RB 5FDLB 2YKMB 2W9BB 1EETB 2JEGA 5KFDA 1S6QA 2YNIB 3OHBA 4LSNA 1HYSB 2XC9A 4ZPCA 4B3OB 2FLLA 2AU0A 2WK4A 3IRXA 2OPPB 3T1AA 4X2BA 1S1WA 1REVB 4NCGB 1RTJB 4ED2A 4ZHRA 3G6VA 4IFYA 2J6SA 3D28A 2FVPA 1IKXA 3I0SB 1K1QA 3Q8SB 3EPGA 2HWIA 5KFEA 4MFBB 3V4IA 4MK8A 2R2RA 4Y34A 4WZQA 2YNIA 2AQ4A 5C42A 3NBPB 4RUAA 4FS2A 3KJVB 5KFNA 4NRTA 1TV6A 4ECWA 3KHGA 3QO9B 4IDKA 3KLVA 4Q44A 2C2EA 4MFBA 4EO8A 2HNZB 2OPSB 1RA6A 1JIHA 4J9KA 4PQUB 4I7FB 4FS1A 2D41A 3GIIA 3CDEA 4K4SA 4EYIB 3RAQA 1QUVA 1XR6A 1SH2A 1JLAA 3I5CA 2BQ3A 4K4UA 1S9GA 3KLHB 2HWHA 1ZTTA 4YR2A 1TV6B 3N6LA 4ECTA 1C1CA 1JLBA 3FDSA 3C6UB 3C6TB 3QZ7A 3DLKB 4RW8A 2OPQA 1TL3B 1GX6A 1DLOA 2HNDA 1T05B 3H40A 2ZE2B 1RT6A 1HMVA 4I2PA 4IG3A 4IG0A 5C25A 3MEDA 1S1XB 2B43A 1FKOB 5F9NA 3GILA 4J9MA 4QPXA 3DDKA 1RTJA 4O4GA 3Q8QB 2BANB 2ILYA 3BQ0A 4RW4B 3KHHA 4ZPAA 3BSNA 2AGQA 1RT4A 2DPJA 4GC7A 3NAIA 3LP0B 3CWJA 2J6TA 4ECSA 5DLFA 3GIMA 5HLFA 4K4XA 3UDLA 4F4WA 1HPZB 4RNFA 4ED0A 1R0AB 1FK9A 5CYQA 1C0UA 2RKIB 3IG1B 2I5JB 1QAJA 2ALZA 1TVRA 4ZVFA 2UVVA 5K14B 4F4YA 2YNHA 3MEGA 2YNGB 4IOBA 4NLGA 4RW4A 3NMAA 3TAMA 3BJYA 1TL1A 4G3IA 1TKZA 4NLDA 4LSLA 5KG6A 3LAMA 4G1QA 5L1LA 1N5YB 1S1XA 1TP7A 3I5AA 2YNFA 2XGPA 5L1KA 2YNHB 1RT7A 1JLQB 1RYRA 3KK3B 3RB0A 1RT1B 3LAKA 3QGHA 3T5LA 5KFRA 2RF2B 1S6PA 3N6NA 5HBMA 3IS9A 4MKAA 3UQSA 4ID5B 3GIJA 3Q8RB 5C24B 3DYAA 5J2MA 3PW2A 4TLRA 5KT3A 1MU2A 2HMIB 4K4WA 3H59A 1JLCA 4WYLA 4Q0BB 1TKXA
chains in the Genus database with same CATH superfamily
3Q2SC 1BWVA 1WOPA 2H4YB 2IVMA 4DSFA 4BC9A 2UP1A 4ED5A 1XEZA 3RG6A 3OSPA 3GP9A 1BMQB 4KPYA 4J9KA 4I6YA 1FE0A 2E1MC 2B56A 2X3DA 3GJQB 1UJ4A 4X84A 2W9AA 4WZMA 3JS9A 1V5IB 2DGUA 2E5IA 5HMYA 5DG9A 3OSNA 1RBOB 3EYZA 4DCOB 1OY8A 1Y9OA 1TAUA 1RSCA 2NS1B 1WSRA 3RB4A 1QVGR 2DNZA 3BSAA 4KBIA 1E6VA 3MCNA 3SZ2A 2B8PA 3D67A 1SUQA 1XERA 4NLTA 3MDFA 1RTHA 4AXJA 4IH5A 4DV3J 3TAPA 2IYIA 1R8BA 3ZNJ1 4ERDA 3JSMB 1IQZA 4M8LA 1HBOB 1UPPA 4H4KC 3IBWA 4XDCA 2XYHB 1Z4UA 2MLYA 5IM0B 1Q5YA 4IFVB 4RNHA 1YJVA 2MKSA 3M1VA 5B0CA 2J6UA 1RWUA 2B0GA 4U7UD 2A18A 4DQIA 1S76D 3IA0A 4LMZA 1H7XA 3DKDA 3TP2A 2FJDB 3FVYA 3HHLA 4WYWA 1XK8A 1CLFA 2MJNA 3V5RA 1GMWD 3LA0A 1CJUB 3M30B 4YB7A 4QWBA 1IKXB 3I0SA 3ZZ0A 4Q8FA 3PHEA 4ZS6A 4HT5A 4ZIVA 2BRLA 1KVKA 2HNZA 2OPSA 2GHWA 4OYZA 5KG3A 1KQFB 2YY3A 3MAAA 2V50A 4DWIA 1TL3A 4JV5F 2V9KA 5T7LB 5A8RB 1HL6A 4KKOB 5C42B 3OFHA 4X66J 1XMOJ 4C9DA 2ZOMA 1ULRA 3HT3A 2KO1A 5CCLA 1JJCB 3W1YC 1HQEB 3AJDA 1RP5A 1MMDA 3SSRA 2CJKA 4DR4J 1FHTA 3CJ4A 1ZAWA 4RBUA 2GX8A 5HQMA 3T41A 1NU4A 1SC3B 2XYGB 4X64J 1WG5A 4B9TA 1DFDA 3GFYA 2LFVA 1TKXB 3CIZA 3MAHA 2ZFHA 4MYTA 2IRXA 2EFQA 4HACB 2E1PA 2BBEA 4TU7A 3OLAA 4LF6J 1FERA 2D69A 3H98A 3JAMY 5GAHI 3TWZA 3LP1B 3QZ8A 1TR0A 2VH7A 4LRBA 2G0JA 3HD1A 1VCTA 2UXCF 2DXEA 3SEOA 3KHLA 1HI0P 3R5DA 4HT7A 2J9DE 3MPWA 1AUSL 3K2YA 1S7HA 2M9KA 2XI2A 4RLEA 2FDNA 4USTA 4U8YA 2JRSA 3DOKB 4ANEA 4EBDA 4NCGA 1HLWA 3H0PA 3UW1A 1NMEB 2G1HA 5U47A 3ILOA 5C24A 3V81A 2QC3A 3J81Y 3GR1A 2Y1IA 1WSVA 2RHQB 1C1BA 1SV5A 2J7WA 2XWXA 4M1KA 2IM2A 1FESA 5KG5A 2CG4A 5KFJA 1REGX 2CZ4A 3PACA 1GFWB 4Z2XA 2XO6A 2EWHA 2BXJA 1NZAA 3IGNA 2XGQA 5IV3A 2NQPA 2VPZB 3NGRA 1LW0B 5A8WB 4G1QB 1C1BB 1SV5B 5HROB 3LANA 2HIYA 2HVEA 3D5MA 5EWFA 1SIZA 3A3OB 2ZH6A 4B9SA 1FJGJ 3TAMB 2VDHA 2JEFA 5CA5A 3RB3A 1WKJA 4WXOA 4FYDA 1OPIA 1PKUA 1Q0NA 5ETTA 3PKMA 2KJVA 4ZJQA 1D9AA 4U9RA 3H4DA 1BC6A 1IKYB 4M94A 3GB0A 2RS8A 1RT1A 1TFYA 5DZ6A 2ASDA 2DO4A 3BZQA 3ZZZA 4DUZJ 4DCJB 2CQBA 5KOXA 2UUAJ 1DBDA 5J1PA 3ZTSA 2OMOA 3M32B 2V4JA 3KLHA 4XTTA 1U48A 1CJUA 2J9DA 3LGHA 3M30A 1S1UA 2HHPA 4CH7A 2BACA 1KHVA 1HNZJ 2QA4S 1QDUB 2XHCA 3LPYA 2IVFB 3TOQA 4AUKA 5HATA 3MUTP 4RW7B 2IIHA 1RT3B 3PO4A 5AXMA 1N6QB 1TAQA 5J2NA 3W5ZA 5J2PA 1C1CB 1JLBB 3OJUA 1ZYQA 5CXTA 5HI7A 5B0FA 2C3PA 3I4HX 3EVOA 1IBMF 3FCHA 3R5JB 4DV7J 2HHSA 3KJFB 1WC0A 1T02A 3OW2R 3CTRA 3MUVP 3I6PA 2GQQA 2XYPB 2R2SA 4ID8A 4ELUA 4LFBF 3BS9A 3RBZA 3ZZOA 4OI4A 1MNEA 3DLGB 1RT6B 4I2PB 4IG3B 1HBMA 2PEHA 2V0NA 5D4OA 1SC1B 3B6BA 3JTNA 3EGNA 2DITA 4KHRA 1HNWJ 1BQMA 2HK2A 2QLBB 2D3OR 3LW5C 1U45A 3IN5A 4LF5J 4Y0FA 4IR9A 2HBYB 3M1VB 5A6PA 2R8GA 4M63A 3NBPA 1GQEA 3ETOA 2L08A 1UFWA 2C2ZB 2M2BA 1TUWA 4NLYA 4JI2F 4TQSA 2R7WA 2ERRA 1U02A 4DR2J 1WKKA 2M0GB 2WB4A 4PWUA 3KG0A 2J76E 4WK3A 2HFOA 1KOHA 3MR5A 1KRPA 4YP3A 2PFDA 2W01A 4G6VB 4YOEA 4RBTA 4KFBB 2GS8A 2YKOA 1O6XA 2XS7A 3HSJA 5ETSA 1RHKB 1KLMA 2H54B 2RB7A 3DOLB 5J2PB 2IC3A 1H72C 4HH0A 3HX9A 1SXLA 2CQHA 4HHJA 3I0RA 4F25A 4RW7A 1MN7A 1A6LA 1W25A 1UWAA 3VTIA 4USMA 5JVHQ 2AHOB 2W25A 2B9EA 3MM5A 2NUHA 3WX8A 1TZ0A 4U7CA 1X9MA 2YNFB 2L9DA 1HA1A 4PWDB 3A8EA 4NLUA 4OZ3A 2VUGA 2FY1A 4CLYA 1XQIA 5BR8F 3PX4A 3FFIA 1FFWB 1TUVA 2EC2A 1Q8BA 2FLOA 2UUWA 3SXLA 2DNYA 3T9NA 3TJAA 2FQQB 3M2UA 4O3NA 3FC9A 4ES1A 2Y1JA 1Q7YT 1WHVA 2JLEA 3OXFA 3OUYB 1T3NA 2UZAA 2BEFA 5KFSA 3AY0A 2E7VA 2WVCA 3W8GA 3IG1A 2R7VA 5RUBA 1IKYA 1HNIA 4FXVA 4WU2A 2KM8C 1U24A 2WCXA 4H4MB 1F1BB 4NMLA 5CQGA 2XB2D 3EPIA 2B7CB 3M2VA 2GVZB 3CO0P 5HMZA 2AYBA 1I1GA 4ECYA 1IR0A 1BWEA 2KDOA 3JB9k 3NL0A 3BH7B 3HF5A 4LSLB 1B3TA 1X4DA 3NCPA 4WFBQ 3ZTQA 2ZC3A 3NS6A 4WKYA 3O8WA 4P6QA 2XCAA 3VAGA 3CCMS 1WHYA 2LDYA 4EZ9A 5DDOC 3CO9A 3RYLA 2FHJD 2ZNZA 1IWAA 2YTCA 2DPIA 2HFSA 5THWA 2E1AA 1CJTB 4P72A 3CMQA 1F60B 4YN3B 4DZ6A 3LP0A 3POTA 2V8PA 4EO6A 2OEMA 5HQLA 5H9FK 2F7VA 3W60A 2MQNA 1XN9A 2K7JA 4O3PA 2VODA 4L3NA 3MOJB 3GSDA 1J5EJ 4NOHA 1VQOS 2C2KB 2D3O1 3MM7A 1Y4ZB 2QL9B 1NO8A 2EFNA 2XULA 4NLSA 5KFKA 2V69A 3DLJA 5HAOA 3THPA 4Q45A 3NGDA 2JEIA 5I42B 1EARA 1VR6A 2ZDOA 3GIRA 5G0RB 2PSZA 1KTVA 4CT8A 4BS2A 2HEKA 5IQ6A 3BYRA 2B4VA 2QL7B 4E98A 3H5YA 2RDDA 2BQRA 1EZZB 4LFBJ 2OI2A 5HK4A 1RTDB 1ZM3A 1FDNA 5D4LA 2QYGA 1Q8IA 2QRRA 4QPTA 1SL2A 1UVNA 2IM0A 2RNEA 2P9CA 1Q7LB 5F0WA 3RAMA 1FRKA 1R89A 4CLTA 2MKKA 2ZJPQ 2XY7A 4DR5J 1Q1KA 5ETRA 5F8HA 1HQEA 2HQGA 1YBUA 4N8NA 4EYHB 2VB6A 3MR3A 1W2BR 1U6BA 2V8GA 2AYEA 2AYGA 1FK9B 1H7WA 1U0SA 4TNOA 3MD3A 3CJKA 1ZM9A 1KLMB 2HS0A 5DO2A 3LUYA 2ZZTA 1HWIA 4OYAA 8ATCB 2JVRA 2LQ8A 1FWKA 4J9PA 1JXEA 4NWBA 1RT4B 1RT2A 2AEMA 4PYDA 2CPFA 4ED4A 2UUCJ 3M8WA 2AJQA 4XPEA 5DJBA 1U1NA 2BJ8A 3P5TL 3BBCA 3CT9A 5JUMA 1IWGA 3QIDA 4QIVA 3I55S 3QRQA 4L73A 2A1BA 4LFCF 2JFKA 4OJ3A 4RU2A 3F44A 4N47A 3DLLQ 4YUDA 2PMHA 2MKIA 2FB0A 2WRMA 3LALA 4DV5F 2I9SA 2J0QD 3UWTA 2E5LF 5HP1A 1BQMB 1HR0J 3GE9A 3HO1A 1ZETA 4KFBA 2IVYA 4YDXA 1JLEB 2ZH9A 2H5IB 2VFRA 2MKHA 2NYIA 2QA2A 1LWXA 3Q8UA 3NAHA 1HBOA 2GA7A 2XZWA 3QPIA 4R8UA 3J81j 1J5EF 1H3DA 2EEYA 2LP4A 3MWBA 2XS2A 3DRYA 2ATLA 1S5ZA 3RAXA 2W2OP 4PPZA 3OJSA 3PY8A 1MU2B 2HMIA 1KSPA 3WDOA 3G9CA 2QMUB 2QYCA 3I82A 5F0UA 1NK9A 5B0BA 1KQSR 1YJUA 2DO0A 3WIUA 4IUFA 2F1FA 3NMRA 2W7AA 1V3SA 2JOQA 3FZ2A 3EMTA 2MY7A 2F9DA 5JMNA 1LWEB 3CULA 4C8MA 1VDHA 3SFGA 3AT1B 2QL5B 4PXCA 4FNIA 3NOCA 1KLNA 3E2EA 3I87A 4DV0F 2ZD1A 4Y3CA 1RLDA 4DR7J 1WI6A 2ZM6F 2HNYA 2DTJA 1URRA 1S1VB 2VDIA 4TXSA 4CI0B 3M8QB 1DQ9A 3VGVA 3CPWR 3CCUS 2LEBA 5E33A 1HQUA 4LBIA 1YHQS 1RYSA 3A1YG 4OFZA 1S6PB 1YZ6A 2QJ3A 4K5RA 1X9WA 2PGCA 1YG0A 3R7BB 4JOUA 4USJC 4F7VA 5IZHA 4KO0A 3EZOA 1Q4RA 1C0TA 1BQNA 1UETA 2BOAA 1GXUA 5EX0A 4P75A 4ZLNA 4X4RA 3KK3A 2J9EA 2OLWA 3D3BJ 3IWNC 4K4YA 2W8LA 4C4WA 4HHUA 1BXNA 2EW9A 1FNMA 1JNZB 4N41A 4ZPWR 4K0KF 4S0MA 3LF0A 5IS2A 2VICA 3D1QA 1SC4B 1RXOB 2DJWA 2C42A 3HULA 3K0JA 2J5AA 1LW0A 3AOCA 2LXUA 3A3NB 4TY8A 1F5BA 4ATNA 4G3IA 3ZNUA 1MWZA 3BR8A 1ROFA 5L9XA 1ICEB 2I5JA 4P7TA 2HBQB 3VHQA 1JLQA 1L3KA 1NH7A 3G8QA 4J9VA 2ZJQQ 3EVMA 4LREA 4AL5A 1WG4A 4CLSA 4X64F 3J80U 4A48A 3DRPA 1IKWA 2B9YA 2MZTA 5J1EB 3HDSA 5A6WA 4GVBA 4DR1J 3R1LA 2WVEA 4LQ3A 2WBRA 1HBNA 1X4HA 2HQ3A 1TQLA 1QUPA 2ZUGA 4F36A 1LQ9A 1SB6A 3A12A 2MQPA 3R97A 2ZH5A 1R27B 1GMUA 2MZSA 3I96A 4NXNJ 2O01C 4YR3A 3PX6A 4UUWA 4CO0A 4J5OA 1YJNS 3EICA 3KLIB 2V94A 2YKMB 2Z0GA 2HZAA 4PG4A 1UFKA 4A8QA 4OI1A 2V34A 3OVAA 2YNIB 2ZWOA 4P71A 3OHBA 4LSNA 1GTEA 2XC9A 1NKEA 3UN3A 4JI1F 1VBKA 4B3RJ 2AU0A 2WK4A 3IRXA 2OPPB 3CD5A 2WSFC 4USHA 1KTQA 4NCGB 2JVOA 1RTJB 4IFYA 1WEYA 1WC3A 1R8PA 4UT4A 2VIHA 3CDAA 4ITSA 3N28A 3MUMP 3EPGA 5KFEA 4C8NA 3V4IA 3IR6B 4DS5A 3KG1A 3CC2S 5A0YA 1FF2A 2K7KA 2D1CA 3H20A 2YNIA 4QIEA 1KDNA 5C42A 4Y34A 5D15A 5IWAJ 4FS2A 3KJVB 4ZMMA 4NRTA 3B82A 3M2RB 1WI8A 3QO9B 3T9ZA 3UDVA 4ZCMA 5E41A 4P10A 2KG0A 1XMQF 2AJFE 1LXJA 1MW7A 1VS3A 2HNZB 2OPSB 1YRXA 2AJ2A 3IWLA 2CQ3A 4PQUB 3JQKA 4PG5A 4I7FB 2MQLA 2CQ1A 2D41A 3NG8A 3GIIA 1W26A 2XMVA 5IOLA 4WJBA 4JI1J 4K4UA 1YJWS 3U1LA 4DQPA 4UQTA 3UDEA 4DUZF 3MMCB 1YQHA 3AQPA 1NK4A 2JX2A 3FZBA 4F3MA 1UZDA 4OLOA 4OZLA 3O44A 2JSXA 3C6TB 3FDSA 4G1PA 3AOBA 4MMOA 4ZPTR 4RW8A 3VVTA 2OPQA 1TL3B 3ZFVA 5K9FA 1DLOA 2HNDA 1QD1A 2XSJA 2ZE2B 1X4EA 4I6WA 1M5VC 3MEDA 3PRBA 1EQ0A 5F9NA 4DJBA 2MHEA 1RKJA 3KTQA 4OYIA 4C6AA 1VQ5S 2BANB 2B9XA 1YBAA 2V2QA 3DXBA 3LQVA 4HI1A 4NYOA 2BOPA 3KHHA 4JI3J 5AJ3F 3TZYA 1R6VA 2DT9A 2CJ9A 3KG4A 2V2KA 2VBZA 4AYBD 4ES2A 4IO9Q 5HLFA 4K4XA 4ECSA 3SSQA 4JP8A 1FA0A 1V3ZA 1QAJA 1JMTA 2OAUA 1FJEB 1F9FA 1FTCA 1WC5A 4F4YA 4ILRA 2F4VJ 4C0HA 3CCVS 1YZ7A 4RW4A 4N7TA 2MGZA 2IJRA 2EK1A 2PI4A 2HHTA 3BJYA 1TL1A 2YH1A 1NBEB 1SL1A 4HVZA 3LAMA 4CNZA 4PG8A 1N5YB 5D4NA 4M5HA 2V2ZA 3V2UC 1Q79A 1TMJA 1CBKA 3NGSA 1S59A 2G0CA 2R7TA 2UV8G 3RB0A 1F9EB 3LAKA 1FI4A 2XMMA 1L3SA 3GR0A 2RF2B 1B0PA 1HWKA 1OQ6A 3IS9A 2A10A 4ID5B 4P2MA 4BC7A 1KN6A 2AT1B 1IJFB 2V2VA 2CA9A 3PYGA 1U8SA 3BYPA 4TLRA 4PXBA 2EBEA 1MU2A 2HMIB 4NE9C 4NZ0A 2ZM6J 2QSFA 1NK7A 1KKHA 1KQKA 2DEJA 2ZEJA 4B3SJ 4TVAB 2YKNB 3K17A 1B99A 5AE3A 2XSFA 2XO7A 4O0IA 1ZM4A 3VGTA 1FVQA 2OPQB 3GG0A 3J7YI 3BO3A 2GIRA 3ZXWA 2DNMA 3PG9A 3BGUA 3J80Y 3M8PB 1AYEA 2WONA 1N88A 1EB0A 2ZBIA 3BN4A 1VBXA 3FBCA 2DNLA 2F5GA 2YWHA 2VQEF 5F3TA 4CTAB 3DRRA 3MF5A 3Q89A 3CCJS 4KHPJ 1HFEL 2MEWA 3JQJA 2N7CA 4QYRA 2VF3A 1Y0HA 3M7VA 4R25A 1XWLA 4DFPA 5D3GB 2IAJA 2R4FA 2RDIA 1P9QC 4I7FA 1F6TA 1RABB 1LOUA 1S9EB 4RW6A 1EHWA 2K1RB 1RT2B 1X60A 4I2QB 2YKQA 3B8HA 3DRXA 5M2UA 3N4WA 3G96A 3K59A 3EWGA 1VQ4S 1KR4A 2ZBCA 4DR6J 1T03A 2R3VA 4OX7A 1RAAB 4JV0A 4KV8B 1U25A 2X7IA 4PR6A 2LXIA 4FKXA 2FPHX 1S48A 3EUNA 4GVLA 3D0HE 4AQYJ 2GVDA 1PJ5A 1MMLA 3V4IB 5J1NA 3WX4A 2C2DA 3RR7A 3B4MA 3OR2A 5A76A 3PTWA 3KLGA 4CP5A 2LMIA 1JB0C 2QIFA 4ZVEA 1S79A 2P6SA 3HVAA 5LMNF 2H3EB 4WWSA 3UNGC 1F3VA 1TL4A 2ZOGA 1FWPA 1DTQA 1EAYC 4KV8A 4FBUA 1RA7A 3MTJA 4WFYA 2R8HA 3H4BA 3MECA 3GJTB 3AD7C 2ZVSA 3X3UA 3ENQA 3G6YA 4DR5F 3H2VE 4V19J 2JC0A 4LF2A 2MMYA 1SH3A 2W2QP 3AA9A 3B78A 5JVGQ 2GGPA 4DUYF 3R1HA 2UVWA 3AAWB 3TVZA 3DI6B 2OMLA 4PKDB 3IXQA 4RZRA 1Q86T 4YB1P 3SQOP 3AXKA 4DPWA 4EBCA 4ECZA 2MQ8A 4H4KA 4KAIA 3Q2TC 1HBNB 4CTAA 2DH9A 1VK8A 4ZVTB 4CWBA 2DGSA 3FSXA 1SJFA 2ZC4A 4IOCQ 1MLAA 1D8ZA 3GYNA 1S1TA 3FRZA 3R3TA 4LF1A 4F2RA 4OI0A 4K4VA 5F3ZA 4JV5J 2UXBJ 4LQ9A 4DQQA 3CJRA 1T03B 4DX8H 2MTLA 1NJWA 3DMJA 1Y3JA 2MLXA 3TANA 1U47A 4QW8A 5CAAA 5CCMA 1PAEX 2D9OA 3TQEA 1LWCA 4ETXA 3S8SA 4KRWA 2PN6A 4JV2A 3KFWX 1RBAA 1CULA 2CQDA 5A2QY 4TYBA 4O3RA 1S0VA 1PC4A 3H90A 3HHDA 4KHPF 2IMWP 5LT5A 3J7ZT 1REVA 3SQGA 3H25A 2HVHA 4WE1A 2MQMA 1NUEA 4X62F 3KKFA 2ABYA 4L72B 1S12A 3CXCR 3T19A 2DHXA 2HHQA 3D6TB 4UUXA 2B7BB 2VG7A 2B5JA 3IS9B 4JUZA 2KXHA 5DQHA 2FJWA 3KUGA 4J37A 3TUPA 2CQCA 2FLNA 1R0AA 4ELTA 4EBEA 3RBDA 1J5OA 3HP6A 3G4SS 1TL7B 4BWJA 1LK5A 3WC0A 1L3VA 1ELOA 3EZUA 4I56A 1TK5A 4UTGA 4M5DB 2MQOA 2G1DA 3PRVA 3FFIB 2CPJA 3A8KA 1SJ4P 4C0BA 3VALA 3M8RA 1DQAA 1OIAA 1UCNA 1GXTA 5GADI 3OFEA 2DNOA 8RUCA 4LR9A 4P7VA 2QN6B 1FKPA 3D0IE 3K8WA 3KOAA 5GAGI 5DRKA 2VQEJ 3KLEA 3HMJG 4PQAA 2X1AA 2FYXA 1LWFB 3IBFB 4WU3A 1DURA 1RGVA 1G3OA 2YQ3A 1A0OB 4KYZA 4QR2A 5E3PA 3PXGa 4EU0A 5BR8J 5KTQA 3DU6A 4ZPVR 1RAFB 2NXEA 5F8NA 2DK2A 4DUTA 1PCAA 1UVLA 2AWZA 4OZ2A 2KT3A 1ZZFA 3FNNA 4ZITA 5CABA 2CZVC 3VR1A 4QOTA 4R8UB 3GLJA 5FD1A 3C46A 2HHXA 2WAQD 4RW8B 2ZH2A 4DLEA 3UVJA 4K50A 1NKCA 1IN0A 2WOMB 1R3NA 2QZ8A 4MYUA 3MURP 4GKKJ 2ALYB 3TJ8A 2AP6A 3HPOA 3I5BA 1CJKA 1HD1A 4EZ6A 4F3QA 3MMCA 3GCXP 1QSSA 2IM1A 1IKVA 2IMOA 2DXFA 2RVJA 3FEXB 4LSZB 2FJXA 3KDOA 4RX6A 1L3TA 2BM1A 2CPZA 1GK8A 1K8AT 6FD1A 3NRBA 2RT3A 2BUNA 1SKUB 3CCTA 5KG1A 4MKYA 1VMBA 4HL9A 2W24A 2GJ2A 1N4LA 2H1YA 1R6YA 2O1PA 2QLFB 4NPOA 3P49B 2XSJB 5DM6Q 2GHVC 4DPYA 1SQEA 3ZTRA 4A47A 2UXCJ 3OLBA 3H5XA 3LPEA 3TA0A 2F63A 1N34F 2MSTA 1RT3A 2HLTA 2OO4A 4RNMA 1APSA 4L76A 4IYQA 5F8GA 3NY0A 2HGMA 4OX9F 2Z2ZA 6AT1B 4DG1B 4GMKA 3CW2C 3I4PA 4M5LA 3ZTPA 3GPAA 2XLJA 3PJXA 4DL3A 4F4AA 5D0RA 2DR6A 4HI2A 4OI6A 1NJXA 2COLA 4N8OA 1I94J 2DR7A 2Q43A 1D9FA 2FTRA 4NMXA 2XG8A 2HQDA 1RJJA 4FF3A 1WHWA 2PEBA 2Q79A 1UWBB 3MCSA 3KLIA 3DM2A 2VG6A 2ADCA 1X4CA 2KRRA 3GFZA 4F0KA 1LV5A 4DSLA 2CDRB 1TELA 2QV6A 4MK9A 5AXKA 4UY8T 2VHGA 3FCVA 1DHMA 4L3KA 3QLHA 4CO4A 5B08A 3MD1A 2VG5B 1JLCB 4EMDA 4PXDA 4MIBA 1YVFA 1H38A 1VQ9S 1F2HA 2HHHF 2OUGA 4ES3A 1FXRA 2RAQA 3CJ0A 1T9XA 3HVTB 4LR8A 4KH1B 5HJXA 3T1YJ 1HNXJ 2YWKA 4XK8C 3A3PB 1VRTA 3NLCA 2C1EB 3K5PA 3DLEB 1GX5A 4J9QA 3GQCA 1QAIA 1LFPA 2QG9B 2QX0A 2ZBPA 4KGVB 4NI2B 5D0EA 4DV2J 2G4BA 2VOPA 3ZO7A 3WBZA 3IRWP 5GMDA 5ADZA 1KQGB 2QO3A 4A8FA 2EG2A 1WC6A 1W2IA 2KH9A 2HRYA 3C15A 5GAEI 2ZKUA 2UUCF 2FVQA 1IBLF 3FEYB 2GVZA 4ZOSA 1VBYA 1FEEA 4RBVA 4WPAA 2JZ5A 1QSYA 4H4MA 1VRUA 3S1TA 1N54B 4A8YA 1M90T 1HPZA 1U6ZA 2WZ1A 4LIRA 1M1HA 2HK3A 5ETNA 4CLLA 3VAMA 4IR1A 3UFCX 3HHLD 5K8OA 3FBFA 3EGZA 1XBWA 2ASLA 2DHGA 3R2CJ 1SJRA 8AT1B 3GCWP 2HYIB 4ILLA 2BE2A 4QWCA 4NCBA 2CPEA 3DGPB 3ET6A 4UW2A 4LF4F 5J2QA 3ILLA 2UXDF 1F2GA 4OJGA 4TYAA 5K14A 4Z37A 1RU1A 1RACB 3RZAA 3MM5B 1SPBP 3M9NB 5CH7B 4KO0B 5DZ7A 2FJAB 4IH6A 2P9EA 2KFZA 2BM0A 4ECVA 2IBKA 4YQWA 3KYLA 5ETOA 1HNWF 3GYGA 1CJVA 3J81U 4TU8A 3OR1B 4NL5A 4J90A 4O4GB 3Q8VA 2FIUA 1TL1B 2IRUA 4CLWA 4D3HA 1WTBA 3N0VA 3MMAB 2MGZB 2DYAA 4B3TF 1PIEA 2ZD1B 4OZNA 4Q7AA 1VHFA 5C7PA 4DL5A 3IR5B 3TI0A 2ASJA 4OV6A 4EI2A 5H9EJ 3W2WB 4ZVHA 3BF4A 2NYHA 2QA1A 5T41A 3M4XA 2UU9J 2IDEA 2VONA 1F5AA 1U1MA 4IFVA 5IM0A 1BE4A 1P6TA 2RSQA 2W2NP 5BJRA 2HHUA 4B9NA 2Y8WA 2HSEB 3PW0A 2GMHA 3EDQB 4DUYJ 2CADA 4TY9A 2DEIA 1FWLA 5KFOA 4CH0S 2LQ9A 3BSOA 1SUQB 2O3DA 4ZPBA 2AGPA 1JLEA 1E6VB 2GC8A 2BABA 3IM8A 2ZVIA 2MKCA 2O5DA 3OHAA 2X1GA 4C11A 5H9EK 3FJ2A 4DBQA 4USIA 3C6TA 2V63A 3GZ7A 4DFMA 4WFAQ 1X4BA 1UMJA 1NK5A 3KLEB 1QAXA 3GFHA 4DF8A 3R5CA 3W9IA 3L7OA 3KMSA 4U7UK 2VA2A 2OPRB 1RT5A 3QMQA 2DCUB 4R0JA 4ZP6A 1M5HA 1N0VC 2HFNA 2PMZD 4JI8F 3VQSA 2YBVA 2G13A 3BGRB 3JTPA 3PYFA 4F4ZA 4WP9A 1S10A 1ITPA 1X4FA 1S1WB 3W9HA 1K9MT 1MWYA 5CZXA 3PX0A 4BWMA 1RTIB 2ZWPA 5ETMA 1Y10A 2JFDA 1IXKA 4Y2CA 1TL7A 3FQKA 1CJVB 3AH6A 3N79A 2E5LJ 4M5KA 3KJVA 3MEKA 1HNXF 4Y2AA 2OD6A 3M05A 2AKWB 1WEXA 2LCWA 4OYOA 2EFVA 5DQIA 1S7IA 7FDRA 2N82B 3E01B 4DV5J 4F4KA 4OMFG 4CLKA 3MHYA 1MROA 5DM7Q 2QA4G 4WE1B 2BE2B 2AEFA 3SFUA 2DRAA 3M8ZA 5EN1A 1RQ0A 1RHJB 2OPPA 1NAQA 1IBCB 4DR2F 4USWA 4YHHJ 4KGXB 4O44B 1RWOB 2X3GA 2GIQA 2LYVA 3P8BB 1YITS 2AJ4A 1U2FA 3HHLC 4ZCIA 2KHDA 1KD1T 4LJMA 2RRNA 3RU0A 5GAEU 4NXMF 2J0SD 3CDBA 3ITHA 1VRTB 2CJYB 2CWXA 3OTOF 2HFUA 3LWLA 3R2DJ 2V8VA 4W98A 2EKNA 3VAHA 1NK6A 3N9UC 1ZPWX 3SMZA 3W66A 2HW3A 4Q0BA 3HKWA 5KFAA 3BBBA 3HSDA 3IWXA 1R43A 3L9ZA 2CWKA 4M5MA 3C15B 4OJ1A 3R7SB 3CCSS 4JI5F 2AEJA 2DNHA 3DOKA 1BHNA 4J7CA 1GXLA 2Y1LB 5IQQA 1LK7A 3ITHB 2BR0A 5CYQB 2VG6B 2MPUA 1HIYA 1NDKA 2DNKA 2GZOA 1FRXA 3NS7B 5DGBA 3RBXA 2XNRA 1UVKA 3DHWC 3GTYX 3T5KA 4O44A 4N77A 3HHNB 3UR3C 1DQ8A 2FLPA 3HVTA 1HD0A 2C28A 3M2UB 1AW0A 1TK8A 1SL0A 3MM8A 3H5SA 3O1LA 4H4OB 1EP4A 3MXHP 4Q5VA 4DV4J 4WIIA 3MPDA 4FPIA 4ZP9A 3QLHB 2DHAA 4OHWA 2W8KA 7FD1A 1Q8KA 3EM1A 3TA2A 4JI4F 4OQJA 2VPXB 3M2VB 2B4OA 1CQMA 4ETZA 2J0WA 2M52A 4JI3F 3I0RB 2KM8B 3HJVA 1S57A 3MGJA 2QGFB 4DFJA 2LLZA 2PIIA 4P74A 3I56S 2FGCA 1Z2ZA 1S6QA 4PRFA 2U1AA 1VISA 4ZPCA 1UPMB 2XMTA 2FLLA 2LKZA 3T1AA 4FDFA 1FXLA 2MLZA 2AJ0A 1Y5IB 1S1WA 4E8UA 2ZHBA 1YDLA 3N5BA 1RAGB 1UEUA 2C3OA 4USVA 5L8RC 5HN0A 3TUZC 1IKXA 3I0SB 1UFLA 1VLOA 2PMWA 2QLWA 3Q8SB 2HWIA 1U1PA 4MFBB 3HZEA 2VFSA 3DCAA 3D9BA 3EXCX 4HDGA 2ZZNA 3D68A 3NGUA 2R2RA 2ZJRQ 2KJWA 2AQ4A 4FXWA 4MIWA 5KFNA 1TV6A 1VQSA 3KHGA 2YXLA 1NPRA 3EGWB 3C19A 4EO8A 1RA6A 2M70A 4ZIWA 2NR0A 2RQ4A 3CDEA 4K4SA 3T3FA 3RAQA 3PHTA 3CD0A 1SH2A 3BN7A 3I5CA 3D6FB 5B0GA 4X65J 2V67A 3VAKA 4WCEQ 1IQTA 3AQOA 3RRKA 2W4PA 2CRLA 2QTWA 3DOMA 3VZHA 3HXMA 1F5CA 1TV6B 4Y2MA 4MAKA 3N6LA 3FCWA 4TKTA 2YX1A 1C1CA 1JLBA 4QJVA 1X4GA 5BYSA 3QZ7A 4ECTA 1RWMB 1EIYB 1UZHA 2W4CA 3DLBA 3HD2A 4DXLA 1VHIA 3K5NA 2F65A 2Y1RI 1HBMB 1RT6A 1HMVA 4I2PA 4IG3A 1J2VA 4ED7A 1FNXH 1PSDA 1FKOB 1VQMS 3UI3A 3PYEA 4O4GA 2ZNYA 5SUHA 4TU9A 4RWXA 2ILYA 3RTVA 4JI4J 2EFPA 3BQ0A 4RW4B 1FRMA 2W2PP 3M8SA 2Q6BA 1RT4A 2MYFA 3D3CJ 3HFVA 3TZZA 3CCZA 3BSNA 4EK2A 3CWJA 4NX9A 2J6TA 3Q86A 3CCES 1VJWA 5LMUJ 1CS4B 1LXNA 3UDLA 2NCKL 1R0AB 1FK9A 2R7OA 4GO5X 4LIWA 5ITHA 2ALZA 1TVRA 1JWWA 1XMBA 5K14B 3IO1A 1H6KX 1Y5LB 4LF9J 4I1TA 3JSRA 2YNGB 4NLGA 5BXIA 3TAMA 5ETLA 3Q24A 3FBBA 3TW0A 1TKZA 3MM8B 4M5DA 2B4PA 4G1QA 2DNGA 4DU7A 3I31A 4DX5A 7AT1B 1TP7A 4JI5J 2KZMA 2EK6A 2XGPA 4KGZB 2KFNA 4KTQA 4O23A 2CJAA 2LEAA 3U02A 3VVUA 1RYRA 1D9DA 1EX8A 1RT1B 4ZLJA 5L38A 4RJVA 3PV8A 3N6NA 4P2FA 5FLXY 4DMZA 1RU2A 3SCJE 3GIJA 2Y3YA 4DR7F 2M3DA 3ELHA 2DHHA 4LUBA 4X65F 5C24B 1WF2A 2RD5C 1S77D 1HBUB 1N5QA 3PEHA 3MM7B 4AQYF 2P9GA 2VL1A 3OTDA 1T3OA 4WYLA 2KVIA 4Q0BB 5LXYA 1RK8A 2ROEA 4OHVA 1ZH5A 1SBRA 4MT1A 1WEZA 2BRKA 3TVKA 9RUBA 3NGTA 2JC1A 5F41A 4C48A 2MB0B 5HBMB 3G71S 3DLEA 4A8WA 2GJFA 3V6KA 4AT1B 1KS2A 1MSWD 2UUAF 3I9V9 2OEKA 3DC2A 1RT7B 3OFGA 4ANDA 5A0YB 1IM6A 3UDCA 2E9RX 2DHSA 2RQMA 4CH1A 1RI7A 1S4FA 5GMEA 5DLGA 5B09A 2NXNA 2AYMA 2DGVA 3LO3A 3LP2B 3LTOA 4LF7F 4HDHA 1VFJA 3W63A 4URGA 3LWMA 4L75A 3N6MA 3TX8A 1IM4A 4F02A 2DR8A 4DR3F 4QCLA 1RHMB 4ZCLA 2XEXA 4LSNB 1Q8LA 1WORA 2AMCB 4CDIA 2RKIA 4UF4A 4F0HA 1PC5A 3EZ5A 2JEJA 4JI8J 1WHXA 3GG1A 2R2UA 4B9VA 4HLBA 4JI0J 1FRJA 2DB1A 2V8DA 5LOQA 2MZ1A 2V5HG 3CJ2A 3OUYA 2GFFA 4RW6B 3DLHA 1S9GB 5EGYA 2IAJB 2V9WA 2I2YA 1FDBA 3G2XA 4WFZA 3QT6A 4TQRA 4DLGA 4WK1A 1FJ7A 2CNNB 1PILA 2I8EA 3K7RA 3MCOA 4URSA 5EDWA 1PG5B 3BSCA 3BREA 1RT5B 2EVZA 1IJEB 4B3MJ 1XNRF 3WZ0A 3MI7X 1RAJA 2A3JA 2GQ2A 1WF0A 3E8OA 5BYRA 3JAMU 3P5BP 4K8RA 5FJ4A 3DOLA 1TKDA 4X4NA 3RJMB 1URNA 3MR2A 3W5XA 4C8YA 2MKYA 5D0GA 1AFJA 4Z7YA 5KFVA 3C2PA 4OI3A 3GMGA 2I38A 5KT5A 2RILA 4ANCA 2C22A 2UU9F 5IT9U 3QYYA 2PFFB 1FD8A 2IM3A 2D3UA 1N36F 1QE1B 1AXQA 2HLUA 4B17A 3D6HB 1PBAA 2LQBA 2X1FA 3UCGA 3OL9A 3H2LA 5LJ5Y 1J27A 1WKLA 1HYSA 2XTJP 2Y0BB 3KLFB 5HMXA 4ICLB 4FN5A 1FRIA 5DGAA 1U49A 5M2RA 2DGXA 4Y2KA 2Z8QA 3KK1A 4DV1F 1C0TB 1GMWA 2WONB 1OWXA 1RAOA 4NLOA 4QU6A 1DJ0A 1UW9A 5H1SV 2DISA 4CCHA 3ONQA 1H2UX 3TX0A 4JI0F 3W2WA 1JJ4A 2UXBF 3QSYB 5E5NA 2HAIA 1PBUA 2FC9A 1H74A 3LGNA 2VD3A 1ZZNA 1PJ7A 4ZN3A 3MM9A 1HHSA 1H2VZ 1X5OA 2H5JB 4OYMA 5G4DA 1VIXA 2OHDA 3M8QA 1UP1A 4LF4J 1HQ2A 3OR1A 3C66A 4LF7J 5HANA 4KB7A 2OJ3A 3BEGB 2N3OA 3GFXA 2KI2A 2Z57B 4NZ7A 2XY6A 1X31C 2B9WA 2DNQA 3NGKA 4IKAA 2G2OA 5IT4A 1WNEA 2ZKTA 4E2FB 2RMLA 5EUHA 5FDLA 1T9VA 4CYUB 2MQQA 2RQCA 2GAHC 3T1HF 5HLFB 4JB8B 1QAYA 3AD9C 2VV5A 4RW9B 4JI7J 4I68A 4URQU 3OL8A 2MZJA 1JJHA 5F9LA 2HQCA 4Q43A 4PWWA 3BQ1A 1ZOTA 2KT5A 2MSSA 4F2SA 4QIFA 3RR8A 4K2XA 2XS5A 5D8HB 3EGVA 3VAIA 3H42A 3PR4A 3A4TA 3PZPA 2W4DA 3MMJA 3HT0A 2LU2A 3CDWA 3TEHB 5FLXU 1N48A 2BJDA 3GYXB 3CCLS 4FXDA 5HP1B 1NEEA 3S01A 2CPXA 2B5JB 2DCLA 5KFUA 1EQMA 2FY8A 1GAOA 1FNOA 3ENAA 2P2CB 1WOSA 1O8BA 1HARA 3FBEA 3L4BC 4V19X 2HIQA 1R8AA 4NLQA 3X1LB 3SIPB 4DSIA 1S6UA 1VC6A 4MK7A 2DR9A 1R0CB 5LSLA 1Y3KA 4D3GA 4ILMA 1K47A 2B3TB 2ASYA 4LRDA 4LRFA 3PJ9A 4JI2J 4PQUA 4M5IA 1YSJA 3U7JA 3PVXA 5E2QA 1G2EA 1NH8A 3DLKA 3G82B 4N5SA 3DMJB 3EX7B 1DLOB 2HNDB 3M2RA 3FQLA 3RW7A 5IT0A 2KXNB 1VC0A 3P6YC 1RUSA 3THTA 2LQ5A 1OJ4A 1FKAF 5H9FJ 5KFIA 5K8NA 2RDJA 2BA9A 4WTOB 5JXSA 1W7WA 3V81B 3GU0A 2DGWA 2X51A 4F0MA 3GIKA 1S97A 4C7QA 5B0AA 2J0XA 2AJ1A 4A8OA 1YTYA 4RO0A 3LP2A 3DI6A 3B54A 3JSBA 4WTYA 5C25B 2EFOA 3OXLA 3SBMA 1IBKF 5KAKA 3W9JA 3IRXB 1T05A 3MPYA 4C3LA 4RNNA 4W4MA 2BJ9A 3CNQP 2K2PA 4A8XA 3QO9A 4BLGA 4J9NA 3LP1A 1DY3A 3HSZA 2NSBA 4ZJLA 1DTQB 3IR7B 4ZVGA 1JLFB 3BQ2A 3MMBB 3ZZYA 3DGVA 4K0KJ 2CJBA 5FIIA 4F3OA 2XMWA 3OQ2A 3H2UB 1ZPVA 3AB4B 4AXIA 3O3LA 5MLCV 1SIWB 1EKRA 2J8SA 4ENOA 4WFNQ 4U67Q 3PR5B 1JJ2R 4O3SA 2KKHA 4MJKA 2F3JA 2Z4PA 1T11A 3BKFA 2DH7A 5HJYA 3K8VA 5EWGA 2PD1A 3D54A 3J7AN 4W90B 5DG7A 3U1MA 2CPHA 3KUEA 2LECA 3T6BA 1QTNB 4FVMA 4KKOA 3KNGA 4RL1A 3QAEA 5E7OB 1KWMA 4R5PB 3CIMA 4TY8B 2OH2A 1WELA 3BB5A 2OELA 4ZN1A 4LVNP 5F8MA 4NLPA 4GKKF 3OBIA 2PA8D 3HSGA 2JH3A 4EGLA 1AROP 2KYZA 4KGMA 4Y65A 1WC4A 4B9LA 1V3RA 2WW8A 3FSIA 1ZA1B 2OSQA 4NA1A 2DY9A 4DPOA 1X7VA 2UUBF 3DRPB 3NXZA 1YI2S 3GSIA 2ROPA 1HHTP 1D3WA 3DU5A 1YJ9S 2W9BA 1Q82T 1GNKA 1HWUA 4I0WA 3K5LA 1YRUA 2LA4A 4R0EA 4QWDA 3PW4A 1VQ7S 1NJIT 4AE5A 1CS4A 1ZS6A 2H4WB 3SDEB 1JLGA 4HH1A 3BGFA 3A13A 3T1YF 4IQMA 2DGTA 2XZDB 2YKNA 4PG7A 2FVSA 3FEZA 4DHVA 2Q6CA 2HGLA 2OFGX 3BO4A 4X4TA 3BPSP 1HR0F 4PWDA 5AXLA 3V6HA 3AJ1A 3FUYA 2OIHA 2XMKA 3AD8C 2EG1A 3DRSB 2KG1A 1HKAA 3AODA 2A6OA 3MTKA 5M2PA 2HHWA 2F8MA 4RKUC 2Z30B 1N5VA 3NS5A 3W5YA 4CYUA 4JBCA 5KFMA 2RRBA 2E29A 4NLVA 3TQ1A 1UA1A 2BW2A 3QJLA 4OYPA 1OPZA 5IFMA 5MAOA 4ZA1A 1VLYA 1WOOA 1C2PA 4YB6A 4O3OA 1ZAVA 2WSCC 4GC6A 1SQFA 3W62A 2FZGB 2LXFA 2W1BA 1AT1B 2KTQA 3K5OA 1M1KT 1BY9A 1S9FA 2E66A 4B3RF 2K8GA 1NLKL 1DARA 1B0VA 1YK9A 2GV1A 4KPCA 3W2VA 1NB7A 1QY7A 1A7GE 3KK1B 1TKTA 1TUGB 1XIQA 5KFQA 1OYDA 1SI9A 1D1UA 4NXMJ 4FYYB 2HURA 3CDUA 3MCMA 3SYZA 2MZRA 4K5SA 1KOOA 4AD6A 1KFSA 3DOMB 3PIPQ 4IRCA 3DLGA 4B02A 4NXNF 1U7LA 2M88A 4U6PA 1UAWA 2QMWA 3S6EA 1QE1A 2QLXA 4RUBA 4HYKA 2VU5A 1CQNA 5EWEA 1F0XA 4LF6F 2ZE2A 4DZDA 2BKNA 4OYWA 5D77A 2EC0A 1VQ8S 1AA1B 5C5JA 3PJWA 3H5UA 5HVHA 4TN2A 3KJQB 1Q78A 2QLJB 2XM3A 1RWXB 2HVDA 2W9CB 2AGOA 5J2NB 2RU3A 1D8YA 2D9PA 1S1TB 2ATCB 4WBFA 3UN5A 4F50A 1S0NA 4LF9F 3IMQJ 3QRPA 4IOAQ 4J9OA 1N32F 1T9TA 1QTMA 4FPRA 3BDEA 1NDPA 2HS3A 3SI8A 1G4CA 2FC8A 2GQCA 3SCKE 1X5PA 5I4MA 3GV5B 3GV7B 2QSWA 1EP4B 2JL9A 1AB8A 4YDDB 4J9RA 2Y9HA 3W61A 2DRBA 2LDIA 3MMBA 2IA6A 2GGPB 1WTFA 2IRYA 2CQPA 2VFVA 3TZWA 4NYPA 2ADBA 1N33F 2HPUA 3OTCA 5E3CA 1S6QB 3C6UA 3UPFA 2VJUA 2CG8A 1YX2A 1YJTA 2FJEB 4LBHA 4OV1A 1T8EA 5GADU 1SJQA 3FGVA 5F8LA 1FE4A 3KMQA 2OD4A 5G0RA 2CQIA 5D78A 1GMVA 1P8GA 1N33J 1BD6A 4LRCA 5I42A 2WW4A 2WBMA 2C3YA 3D1HA 3ILIA 3TUJC 4IFYB 2HRUA 2AZ1A 3UCZP 4DL7A 1YBTA 2DIVA 3T1HJ 2FGOA 2PI5A 4LFAJ 4H4OA 3AOAA 2HBZB 2CAJA 2IBOA 2LEPA 4QQBA 5HROA 3CF5Q 2XMAA 3DYAB 2CJXB 4CNYA 2FJBB 4IDKB 2V4QA 4JYAJ 1RTDA 4WP3A 4F04B 1VQ6S 1D0EA 3BH6B 1DTTA 2OKQA 2OP5A 4KHMA 5HMWA 4DV3F 4F26A 1L5UA 3C14B 2L3MA 3VAFA 2BW7A 2O67A 1ZM2A 2GMLA 2IFXA 4XDDA 2HKEA 2PO4A 3W64A 4CO1A 4EUVA 3P3DA 1RDRA 3VQTA 5DETA 3M9OB 1T0TV 5CHCB 1HNVB 1X0PA 4X4OA 4DV6J 4JI7F 1FTRA 3B4DA 1FD2A 3K89A 4MKVA 2C2RA 5L9NA 4U95A 2YX4A 3HHEA 2K3IA 3DRRB 5C2GA 5L39A 2BMBA 2FUG9 2Q1LA 3W8PA 1D09B 5EHHA 4LF8F 2K06A 2SXLA 2YWFA 3E51A 1OY6A 2DY1A 5ETVA 2IPOB 1HNIB 3WC2A 1KHWA 1Q16B 3A8JA 4NLXA 1NHVA 4F67A 1H2TZ 1U2RA 3BPDA 4KT0C 2CNLB 4P2SA 1V9OA 2KHCA 3CJ5A 4YY3F 4LFCJ 2WB1D 1LFWA 4M5JA 1M5SA 2P6TA 4ZDNA 1V6HA 2UV8A 3NWRA 2OFHX 4HTJA 4FF4A 4ER8A 4KH0B 2R7XA 1JXLA 1AUDA 5CYMB 3BGRA 1XNQJ 1HI8A 4RW9A 1MROB 3OTEA 4P2XA 2DGOA 2XLKA 4EEYA 3R8YA 1BQNB 1JKHA 2OPRA 3MEEB 4LF5F 2L41A 4YS2A 1TVRB 5I3UB 1DAXA 2BV3A 2CPIA 2F4FA 2IC3B 1KBRA 5A8RA 2YPZA 2XMJA 5AT1B 2IA0A 1KEKA 2C2MB 1XR7A 3L09A 4RR5A 1RTIA 2YQ1A 4MH8A 3SCLE 2H65B 4DEZA 1M5PC 1T9YA 4WXWA 4DV7F 4C3MA 2PT0A 3PW5A 1I5OB 1FFGB 3MM9B 4RUHA 3VZIA 1HMVB 1SQGA 3RRGA 1U0HB 1FKOA 3HFKA 2IHR1 1RTZA 4K2JA 3P4UB 4Q2LA 4PAAA 4J9LA 4DR3J 2ACYA 2HRTA 5FDLB 1VI7A 2D74B 2V8HA 1UVJA 3C3LA 4A8KA 1C4CA 3R5GA 2JEGA 1F9HA 4DQSA 1KFDA 1B70B 1HYSB 4C11B 3OTOJ 2M8HA 5ETKA 4X2BA 3ENVA 3JTOA 4UY85 4M5NA 3P45B 2J6SA 3D28A 1UTAA 2ZHOA 2NREA 3D6MB 3UO0A 1Z1ZA 4JI6J 3PCOB 1Y5NB 2BJ3A 4EWTA 5A8KB 3LH2S 1FFSB 4WZQA 2HAFA 1AFIA 1RAEB 3QT5A 3HM9A 3NBPB 4ECWA 2ACMA 6FDRA 3CCRS 2V68A 3KLVA 2CVEA 2GIFA 2C2EA 2A2DA 4MFBA 3N01A 4KC5A 2M8DB 1JIHA 4DN0A 2DNNA 1CG2A 4EYIB 1XR6A 4C8KA 4C2MA 2VFUA 1Y7PA 1JLAA 3OV7A 1S9GA 3KJNB 1FCAA 3KLHB 4L6V3 2PE8A 2VKZG 2ZH7A 4I4BA 2XZTB 3CB4A 1R8CA 2R7SA 1NK8A 4UOGA 3NCRA 5HQ8A 4B9UA 2BE9B 4WIQA 2KXFA 3RRHA 3MPUB 1GX6A 4HR2A 5LM7E 2J9CA 4IG0A 3CJ8A 3DNCA 2ZH8A 2X1BA 1S1XB 2EKYA 4QYZK 4QPXA 3FRYA 1RTJA 4CLPA 2ZDPA 1LNQA 3Q8QB 3ULHA 2CFXA 1NSQA 2VC0A 4OHZA 2M7SA 2V4JB 4OI2A 4USKA 3H7HB 3UE2A 2DPJA 4PCQA 2ZUAA 1UW4A 3NAIA 4GO7X 2P5VA 1X4AA 1WACA 3CE8A 3GIMA 3UCUP 1HPZB 1XC9A 4X4VA 4RNFA 3LOUA 2GO8A 5CYQA 1FEHA 2RKIB 3ETMA 4X4PA 2U2FA 2VPWB 2UVVA 4AL6A 1HW8A 3PIOQ 3IP0A 1JNRB 4FKYA 1R0BG 2YNHA 1Y00A 1IR1A 3ISZA 4IOBA 3NMAA 1RB0A 3BM7A 2DNPA 2POKA 3M6XA 4GVBB 1HBUA 4WKRA 1SKWA 2QFJA 3NNAA 1U2CA 5LMUF 5L1KA 3OXGA 2YNHB 1RT7A 2APOA 1JLQB 2JLFA 4OX6A 5A8WA 1S72S 3SSSA 1Q5VA 2AD9A 3QJJA 3OT9A 4DV1J 3T5LA 2RJZA 1SKSA 3CGIA 1NB2A 5HBMA 4QYZJ 3O2IA 2DKOB 4NEYA 4DL2A 2N4DA 3QJPA 2LU1A 3HFZB 4Y2IA 3Q8RB 5J2MA 3DYAA 1NSKL 2BJ1A 3PW2A 5EX3A 3BV8A 2AV5A 1N36J 4K4WA 1VOMA 3ADAC 1Q95G 3KWMA 3OL7A 2B4UA 1JLCA 1WF1A 2B8QA 1G1XA 1TKXA 1VC5A 1TK0A 2E1RA 2CUYA 2IJNA 3TUIC 1T9UA 5AE2A 3ZZRA 1UVMA 4ECQA 2B6AB 5B7WA 1PAUB 1TU0B 3CVKA 2E7XA 1Q53A 3DFEA 3QAUA 4ZP8A 4RWWA 3SV3A 4JYAF 3R7NB 2NPFA 4K4TA 2FVRA 4PXEA 5KFGA 3D7SB 2CNKB 3V6DA 3D66A 5LJ3Y 3G86A 2E9TA 5KG0A 2E1CA 1KP6A 3NKYA 4FF2A 1EKSA 4A4JA 1RCXB 2EI5A 2ZITA 1M5KC 1S1VA 2WVBA 5KFHA 3MFIA 2BX6A 1UEVA 4KGKA 2CIMA 2YNGA 1LEOA 1SH0A 2FVCA 2F8EX 2HHHJ 3HHLB 3EE3A 1IKVB 3PFEA 4WFXA 5L46A 2VA3A 1YIJS 3NNHA 3PM9A 1OY9A 2KFYA 1E6YA 1ZTWA 3TYTA 5KG4A 5L1JA 2Q3PA 3KNAA 1X5SA 3UVJB 4Y00A 4C3KA 1U1QA 1P27B 3QBCA 4DU8A 3CJTA 3QFWA 4DV2F 2AX1A 3WIVA 4DFKA 2WTFA 1SVDA 2D3ZA 3JSMA 2C2NA 4MKBA 3OFFA 5F8IA 1U4BA 2GJIA 1C4AA 2ROGA 3QQCD 3OVSA 1NK0A 5DDPC 3OVBA 2YVSA 1FJGF 4NLRA 4Y28C 1JXVA 1RCOB 2LA6A 3BKUA 4IRDA 4CM0A 3L3CA 4DPTA 4L74A 4TLQA 4Q2MA 1CJKB 4IH7A 1VIOA 2KZZA 2CQ0A 3L7PA 4ELVA 2ZZMA 4HKQA 3HVWA 3EDRB 4LBPA 4PG6A 4CQ1A 5KFFA 1ZBTA 2FHJA 4UZBA 5KG7A 3KHRA 1FJCA 1FX4A 1U0HA 3TJ9A 1RKIA 2GMJA 3US5A 5KFZA 2GAGC 4C8LA 2XBPA 3MMAA 1UEKA 2G2ZA 4OHXA 1WC1A 2VASA 1KNZA 3JXOA 3PW7A 2HQFA 3V6DB 3RB6A 2J8AA 2BE7D 2J7UA 2VBWA 3C16B 3Q23A 4OJHA 4BHQA 1M0SA 3GJSB 1T7PA 1XJWB 4YHHF 2XLIA 4ECRA 2PA3A 1MWQA 2CPYA 3CJKB 2LVWA 1N6QA 5I3UA 5GVQA 1B7YB 4ECXA 3ZZPA 1PO6A 4LRAA 2BYCA 5J2QB 1JKHB 3MEEA 4FVCA 1N34J 2E7WA 1QJHA 4J91A 1S1UB 4UZCA 4ED6A 4ZLLA 1HWJA 2HGNA 3F0NA 2VZ9A 3Q8YA 4X4QA 4DPXA 3RW6A 5KG2A 3QT7A 4V1Ak 1RWVB 1Z2LA 2NSCA 4YR0A 2CDQA 2HZVA 3QFHA 1N8RT 1VQNS 5J2MB 1JQGA 3MEGB 2VKRA 3BGOP 4M5GA 2MDAA 4OZ1A 4YFUA 1LWCB 1FDAA 2MKJA 1S4EA 1ZA2B 2FD2A 1VRUB 2KN4A 2A6MA 4USUA 2KB2A 1XMOF 1C0UB 4KSEB 2I1RA 2MJUA 2NXCA 2WVDA 1RAIB 3M6WA 3MM6B 4KY3A 1G6BA 4ZK7M 3MR6A 2B6AA 4ECUA 3V6JA 3ILJA 2Q66A 2RIJA 3NP5A 2VG7B 5KFXA 2W7PA 2L48A 4UQGA 2HHVA 3L7UA 3HHKA 4NRUA 4CLZA 4UOCA 1BQXA 3QGPA 2FHKA 4QR1A 3CMAS 5CD4A 3UD4P 1GEHA 1SCJB 9ATCB 1OMSA 1CJTA 3OPKA 1NKBA 4ZLPA 1P1LA 3V4MA 4RUCA 3FKBA 1S0MA 1XR5A 4NI2A 4G1IA 2NUUG 3CD6S 1BGXT 3TRGA 2UUBJ 1A9NB 1DTTB 1LW2A 1NSAA 2C2OB 3ICLA 3TA1A 3U1NA 5GAGU 1UA0A 2R42A 3QIPA 1WD6A 2C3MA 1VQYA 3Q83A 1TL5A 3PKYA 2GO9A 4DF4A 3TARA 1UVIA 2HS4A 4OZ0A 1PYTA 2H51B 2HWTA 3OR2B 1KVJA 2YWEA 4FYXB 5A2QU 1N56A 2UUTA 1CEZA 3J7A1 3Q8PB 3DM2B 1JLFA 2I6WA 2XY5A 2K3KA 2IDLA 2R2TA 2XWYA 2MY8A 1NM2A 1TTHB 3QGIA 2M4MA 4N56A 4E0DA 1S6OA 4XO0A 4ZJOA 3MECB 5AE1A 2RRAA 4B9MA 4I2QA 2XI3A 2R7UA 5T14A 2VQFF 2DIUA 1YJRA 3EXYA 1NPKA 1S49A 4MIAA 4ED8A 3M8YA 1NDCA 4A46A 1GH8A 1OO0B 3IBCB 1O0PA 2XNQA 3OTBA 4ZHRB 1M1GA 2AW0A 2DGQA 4PYAA 4UOHA 2PC6A 2DRDA 5JJBA 4IG0B 5LXRA 4ZP7A 1FRHA 3E01A 1VJQA 3WQPA 3BO2A 4M95A 2ILZA 2Z56B 2YPYA 3MPVA 4NASA 2UVRA 4B3TJ 1IBKJ 4IRKA 3GV8B 1RE1B 2CKWA 4LR7A 3VGUA 5KFWA 2BZ2A 2MZQA 4ZPDA 3CJSA 4ZVSB 3S7RA 5E3AA 3PO5A 5I3PA 4LF8J 3MFHA 4C0OC 4DV4F 2R9LA 1JLAB 3BKTA 2FJVA 4UOFA 2DH8A 5E3QA 5KT7A 4KIAA 3G6ES 3VCDA 4QWAA 1N5SA 4LVOP 4DV6F 3R6LB 5IC6B 4RU9A 4PUOB 4DOZA 4K59A 1RADB 3TAQA 2E5JA 2CJQA 4G65A 3O6QA 4F4XA 4B3OA 1NJZA 1IBLJ 2EXUA 3ZC4A 3CMES 1RWKB 4X62J 2EFGA 2ZOFA 1XMQJ 1EETA 3FMBA 5F8JA 1IBMJ 4WF9Q 2JNJA 2V6AA 2N4CA 3IGVA 5AXNA 4PABA 2KU7A 3KK2B 5A8KA 2XCPA 1U8WA 2F8HA 2VQFJ 4O3QA 5IWAF 2DBBA 2AX0A 3IFEA 1R7IA 4NA3A 4YB5A 5BYQA 4RNOA 5KFYA 1Y11A 4LFAF 2FZKB 4NLWA 3H8YA 3W65A 2E9ZA 2RS2A 4DL4A 3DN9A 4PZVA 1H0HB 3HZGA 5LMNJ 2Z2LA 3JYTA 2CPDA 1H98A 2YH0A 3AJ2A 3BBFA 1H73A 4ZVOB 2M5YA 1HWLA 4K4ZA 2RH3A 5D4PA 4OLPA 4PEOA 1IUJA 4U8VA 4WP8A 5KT2A 1RISA 1U09A 2HBRB 2BJ7A 3HK2A 2E5GA 2G9OA 3DRSA 3CC7S 2L9NA 3N5FA 5K8MA 4OL8A 3DGPA 3ET6B 3K58A 2BQUA 1XTZA 5K20B 4IQXA 1YJ7A 5ETPA 1YGYA 3M32A 5DS7A 4AL7A 4MTPA 2HZCA 1KVIA 1MN9A 4KE5A 1QSLA 2R8JA 1N32J 4C8ZA 1FXDA 4BDPA 3PDNA 1J5OB 2V4RA 3PFOA 1RHUB 4ZVUB 3CJ3A 3HKZD 3JQMA 2VJVA 3IAS9 1VQKS 1B7FA 1JLGB 1UKUA 3G87A 1B4SA 3I9ZA 4BBYA 3QWUA 4YMEA 2ZBQA 1VQLS 1N0UA 3CJQA 3AXMA 2NPIA 3VF0B 4CO3A 1PYSB 3D4JA 3J7YU 3MAQA 2MXYA 4QIWD 4EFAC 3G6XA 4ICLA 1BLUA 3AHPA 3KLFA 1OSDA 2HVIA 2GHPA 2N7YA 1K1SA 3KDNA 1JX4A 1NSPA 2BANA 2J7KA 4K7QA 5HL7Q 2CQ4A 3TEGA 3T5HA 2ZBRA 1T94A 3M9MB 2VBXA 4J9UE 2ZH1A 1CULB 1UL3A 4R5PA 4DL0C 1B0TA 1S0OA 1KC8T 4OX8A 2Y8YA 4O4RA 1NPPA 1NXIA 3W7BA 3THVA 1I94F 1FX2A 2N3LA 3IAM9 1U1RA 3TR5A 5DG8A 1MMNA 3TNVA 2CQGA 3RGIA 1PYOB 5CZVA 1NZ8A 2VG5A 1P1TA 2VC1A 1TFWA 1QVFR 1SJ1A 1ACMB 3QSIA 5E0OA 5IC4B 3G8SA 1HNVA 1NCLA 1RWPB 2ZHAA 5AJ3J 3ISND 3I32A 2QEXS 3PRDA 1O51A 1YRTA 1CC8A 3DDNA 5KOWA 2ZH4A 3FMWA 4QWEA 3OL6A 4DV0J 5KT4A 1UWBA 2E44A 2Z2YB 4B3MF 1N5TA 1XNRJ 1NHKL 1RBLA 4A8SA 1MG7A 1V5VA 1HI1A 4QZVB 2F9JA 3F41A 5KFCA 4X66F 4QW9A 2UVUA 4DSJA 4HACA 1K0TA 2YQ0A 1OS5A 3UD3P 3PEJA 4HEA9 3KLGB 2G0IA 3MOZA 3VWSA 3M6UA 4GKJJ 4DPUA 4OYXA 1WDDA 4ED3A 2WHOA 3U27A 1I6JA 5D6GA 2C3UA 3T5JA 3CCWA 1T9WA 3QIPB 4H54A 3CC4S 2W9CA 3MZIA 2OTLS 1LW2B 2QE5A 4QR0A 1G7CB 4CO5A 4OHYA 3DXSX 3F56A 2KRBA 2E5HA 4CLUA 5T7LA 2WVFA 2YKMA 4DL6A 1RHQB 2VBYA 1S9EA 2K1RA 3MAAB 3QGGA 4I6AA 1X8DA 5D3GA 5K5MA 4DS4A 2UXDJ 1RHRB 4CRJA 4QBUA 2RE1A 3IC1A 2RUSA 5IXUA 3HLUA 1O5JA 4ZVRB 1OSCA 4DG1A 3ISNC 5LL6d 3EVWA 4DSEA 2DR5A 3FK4A 2BDPA 3RBEA 2CYYA 4ALZA 3GJRB 1PGZA 5J1EA 1IKWB 3L95X 3OD2A 4A8MP 1WG1A 2R7RA 5HVGA 1TKTB 1I51B 2BJEA 5GMKa 3M8PA 2WOMA 4XPCA 5CD4H 4P9SA 4DCPB 5DDRC 2XMUA 2BKPA 1FVSA 4ZKAA 4BCAA 5DDQC 2FHOB 1DZ5A 3G8TA 2AF6A 4Q8EA 2GNKA 3R27A 5LSRA 1RTHB 3NEKA 2R8IA 1TKZB 2W2MP 3Q22A 4ED1A 4NCAA 1NNDA 1K44A 2NLWA 4CIOA 2YWGA 2RHSB 2W7OA 1WJ9A 4F8RA 5SZTA 4DQRA 2OSRA 4HHHA 4ID5A 2DNRA 2H48B 4XAKA 3AFGA 4FBTA 2VOOA 2RF2A 3W2VB 1U1LA 5KFLA 1AZSA 1TMMA 2CQ2A 2I0XA 3JSYA 3WHIA 5KT6A 2H5EA 2RQKA 3C16A 1N5YA 2BKOA 3R5AA 4YEAA 5KFTA 1VQPS 1K73T 1QM9A 3RUBL 5IV4A 2NZ4A 1HQUB 3CEDA 3M6VA 1U26A 2R8KA 2OTJS 1HHQA 1NHUA 2CVIA 2HQIA 1IR2A 1T95A 3QT8A 3PNIA 4RPFA 3QRRA 4GKJF 2YKAA 3E3XA 2HNYB 3GONA 4DR4F 1B64A 1NDLA 3O5TB 4I64A 1AZSB 1DRZA 1CSJA 2L9WA 2KL8A 3HI9A 3KK2A 1LWFA 3C8YA 4OYBA 5KFPA 5L1IA 2HG4A 3KXDA 4DR1F 1LWEA 1FKPB 3LGMA 3EJMA 4NZ6A 4PPDA 1VYAA 5K8PA 4J9SA 3BDPA 2JLGA 4NYZA 5HO4A 3CSKA 3R9LA 3A8IA 3UR0A 1UJ6A 2A2CA 2OEJA 2NZCA 3JYTB 2QMXA 5CYMA 2AIRB 4I69A 3J7Z5 4PUOA 3DDIA 1GTHA 1U1KA 1FO1A 1YKWA 4OX9J 1UJ5A 2D7SA 2PDAA 2YX7A 1YLXA 2YWWA 2F40A 2IJFA 2Y0SD 3K5MA 3SV4A 3R5BA 4CO2A 4KR0B 3KUHA 5B0DA 3MEDB 5DQGA 3BR9A 3NOGA 3SDEA 2F4VF 4OZ5A 3DHXA 4QU7A 1OYEA 5D0HA 5HVFA 4XIUA 4FF1A 5GAHU 1F3FA 2W9BB 1E6YB 2RU9A 1EETB 2G2YA 3HJFA 5IT9Y 5KFDA 1X0FA 1WUUA 1WDTA 1FT8A 3GWCA 3UNYA 3QATA 4B3OB 2KT2A 2KYXA 4ZCKA 2H9ZA 2GW8A 3TZXA 2HVZA 2JDJA 4FP9A 4W92B 3VGSA 1REVB 3SQGB 2A0FB 4ED2A 4ZHRA 3ZZTA 3G6VA 2R7QA 1Q81T 2FVPA 1K1QA 1N52B 2JWNA 3FSYA 4U96A 1RZMA 1FDDA 4LT6A 1HNZF 3NNCA 2XHWA 4P73A 4X4SA 4DR6F 1U6FA 1RWWB 4P52A 1GT8A 4MK8A 1LKZA 4FNHA 2YKPA 4B08A 5HSPA 3ZZUA 3C14A 4DI6A 2KVQE 2DVIA 3CD7A 4B3SF 4RUAA 1EJ7L 1I3OB 1VGYA 1K0VA 1X9SA 4IDKA 3ENWA 4Q44A 4OZJA 2ZH3A 4KJIA 3K57A 3AA8A 2VFTA 4CT9A 3HCXA 3CUNA 1SJ3P 1PJ6A 1ZAXA 4NEZA 4NA2A 4FS1A 3SCIE 1CPZA 4GRSA 1QUVA 4X4UA 2BQ3A 4CM2A 2FZCB 2GVDB 2LQJA 3IM9A 3PYDA 4OIXA 2BVZA 3D2WA 2HWHA 1R8HA 1RWNB 3BGLA 3VV2B 3T6JA 4C98A 1ZTTA 2AZ3A 2DD8S 3NWGA 3D0GE 4YR2A 4JI6F 4CZCA 3C6UB 4O0NA 3QNWB 4CLFA 3DLKB 2Z2MA 3G82A 4AFFA 2EPIA 1KONA 3ZTOA 1T05B 2GCFA 3H40A 3VAJA 2JHEA 1VBZA 1NRKA 5C25A 3R6GB 4FYVB 3GILA 2B43A 2QFIA 4J9MA 4C8OA 2RUGA 2FHMA 3DDKA 3QWPA 1P9YA 2JJ4D 3TO8A 5C2CA 1SC6A 1WWHA 4IO1A 3NCQA 4ZPAA 1FRLA 1HW9A 3TVYA 3CCQS 2AGQA 1NJYA 4N76A 4DN9A 1RLCL 1CVJA 4GC7A 3LP0B 3POTB 4QIGA 2XQCA 3MR7A 4Z7CA 5DLFA 4F4WA 1U1OA 2Z58B 4ED0A 1OQ3A 3Q0AA 1C0UA 3D1OA 3IG1B 3MM6A 2I5JB 2NXUA 1S99A 4ZVFA 5LSOA 2VPYB 1VK3A 2HFVA 1YWXA 3MEGA 4YY3J 2WSEC 3P96A 4Y6IA 1L3UA 2EBGA 3HVRA 4I67A 2OGUA 5KFBA 5I3QA 1RAHB 2P8IA 3AB2B 4NLDA 4DX7A 4LSLA 2CZ9A 5KG6A 4C97A 2QT7A 5L1LA 3W3SA 2CNOB 1S1XA 2O66A 2DXDA 2YNFA 3I5AA 4DSKA 1IVZA 1QLNA 4DDFA 1XNQF 3KK3B 3UN2A 1VRQC 4FZVA 1JK9B 3QGHA 4ZVPB 3UD5A 5KFRA 4DX6A 4JV1A 1S6PA 2IY5B 4MKAA 3UQSA 4ZVQB 5CYJA 2B51A 2HFZA 1SKRA 4HTIA 3F73A 1M5OC 5E3RA 1R31A 2IYGA 5KT3A 1X5TA 4KQZA 5B0EA 4FYWB 1CC7A 2CXEA 2NXJA 3H59A 2MHNA 1BUXA 5ETQA
chains in the Genus database with same CATH topology
3Q2SC 2IVMA 4DSFA 4BC9A 2UP1A 4ED5A 1XEZA 3OSPA 4KPYA 4I6YA 1FE0A 2E1MC 2B56A 1UJ4A 4X84A 2W9AA 4WZMA 2DGUA 2E5IA 5DG9A 5HMYA 3OSNA 3EYZA 1Y9OA 1TAUA 2NS1B 3RB4A 1QVGR 2DNZA 3BSAA 4KBIA 1E6VA 3SZ2A 1SUQA 1XERA 4NLTA 3MDFA 1RTHA 4AXJA 4IH5A 3TAPA 2IYIA 1R8BA 4ERDA 3JSMB 1IQZA 4M8LA 1HBOB 4H4KC 4XDCA 3IBWA 1Z4UA 5IM0B 4RNHA 4IFVB 1YJVA 2MKSA 3M1VA 5B0CA 2J6UA 1RWUA 2B0GA 2A18A 4DQIA 1S76D 3IA0A 4LMZA 1H7XA 3TP2A 2FJDB 3FVYA 3HHLA 4WYWA 1XK8A 1CLFA 2MJNA 3V5RA 4YB7A 3M30B 4QWBA 4Q8FA 1IKXB 3I0SA 3ZZ0A 3PHEA 4ZS6A 4HT5A 2BRLA 2HNZA 2OPSA 2GHWA 5KG3A 1KQFB 2YY3A 4DWIA 1TL3A 2V9KA 5T7LB 5A8RB 1HL6A 4KKOB 5C42B 3OFHA 4C9DA 2ZOMA 1ULRA 3HT3A 2KO1A 5CCLA 2CJKA 1HQEB 3SSRA 1RP5A 1MMDA 1FHTA 3CJ4A 1ZAWA 4RBUA 2GX8A 1NU4A 1WG5A 4B9TA 1DFDA 3GFYA 1TKXB 3CIZA 3MAHA 2ZFHA 4MYTA 2IRXA 2EFQA 2BBEA 4TU7A 3OLAA 1FERA 3H98A 3JAMY 5GAHI 3QZ8A 3LP1B 1TR0A 2VH7A 2UXCF 3KHLA 3SEOA 1HI0P 3R5DA 4HT7A 2J9DE 3MPWA 3K2YA 1S7HA 2M9KA 2XI2A 4RLEA 2FDNA 2JRSA 3DOKB 4EBDA 4NCGA 3UW1A 5U47A 5C24A 3V81A 3J81Y 3GR1A 2Y1IA 1C1BA 1SV5A 2J7WA 2XWXA 4M1KA 2IM2A 1FESA 5KG5A 2CG4A 5KFJA 2CZ4A 3PACA 4Z2XA 2XGQA 2EWHA 2BXJA 1NZAA 3IGNA 2NQPA 2VPZB 1LW0B 5A8WB 4G1QB 1C1BB 1SV5B 5HROB 3LANA 3D5MA 2ZH6A 5EWFA 1SIZA 4B9SA 3TAMB 2JEFA 5CA5A 3RB3A 4WXOA 4FYDA 1OPIA 3PKMA 2KJVA 1D9AA 4U9RA 3H4DA 1BC6A 1IKYB 4M94A 3GB0A 2RS8A 1RT1A 1TFYA 2ASDA 2DO4A 3BZQA 3ZZZA 2CQBA 5KOXA 1DBDA 5J1PA 2OMOA 3M32B 2V4JA 3KLHA 1U48A 3M30A 2J9DA 4CH7A 1S1UA 2HHPA 2BACA 1KHVA 2QA4S 3LPYA 2IVFB 3TOQA 4AUKA 4RW7B 1RT3B 3PO4A 5AXMA 1N6QB 1TAQA 5J2NA 5J2PA 1C1CB 1JLBB 3OJUA 1ZYQA 5CXTA 5HI7A 5B0FA 2C3PA 3I4HX 1IBMF 3FCHA 2HHSA 1T02A 3OW2R 3CTRA 3MUVP 3I6PA 2GQQA 4ID8A 2R2SA 4ELUA 4LFBF 3BS9A 3ZZOA 4OI4A 1MNEA 3DLGB 1RT6B 4I2PB 4IG3B 2PEHA 1HBMA 2V0NA 5D4OA 3JTNA 3EGNA 2DITA 4KHRA 1BQMA 2D3OR 3LW5C 1U45A 3IN5A 4Y0FA 4IR9A 3M1VB