1VRUB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
425
structure length
410
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 109
structure length 410
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vruB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB03
4KE5A 2ASJA 2ZE2A 2BQ3A 2O5DA 5L9XA 4ZVHA 4O44B 4R5PB 4WYWA 2HNDB 1KHVA 3KHGA 4K4TA 1J5OA 3IG1A 2XI2A 4XO0A 1D0EA 3OL8A 1QE1B 2JEGA 5KFPA 4NLPA 5F8NA 3CDWA 3QGHA 4JUZA 4J9PA 1C1BA 3HHKA 3LALA 4IH6A 1QUVA 1T3NA 5D3GB 4NLXA 2XCAA 5J2NA 2FVRA 5L1LA 1VRTA 2UVWA 3PW2A 3JSMB 5HLFA 3IRXB 1N6QB 2RF2A 4QW8A 5KFTA 5DLFA 1N56A 2I1RA 3NL0A 3DRRA 3CVKA 5F8HA 3FQLA 4Q44A 3LP2B 4I2QB 1IKYB 1HPZA 3QO9B 1IKXA 5C24B 3N6NA 2JEFA 5I3UB 2IM0A 4ED8A 1HNIB 5KG0A 3HVTB 3Q8PB 4RW9B 3NBPA 3ISNC 3DI6B 4O3QA 2OPRA 1KLMB 2CJQA 3LP0B 3DOKA 3VQSA 2DPJA 3DOLB 4KKOB 1S48A 1S1UB 4KV8A 4K50A 4ZP7A 4NCGA 4R0EA 1T05B 2YNGA 3CO9A 1TP7A 4Q8EA 5HBMB 1DLOA 1GX5A 5KG3A 3ITHB 1REVB 4QWEA 3MF5A 3DMJB 1T03A 4FBUA 1TKTA 5K14A 2W9BB 4O3NA 1BQMA 4XPEA 1W25A 2AGOA 4URQU 4RW4B 4TXSA 1N48A 2UVUA 4O44A 4R5PA 2ZKUA 2HNDA 5KFZA 1K1QA 3PW4A 1RYRA 1QAIA 3EPGA 4EBCA 5KG1A 3KK3B 4RU9A 1QE1A 1OS5A 2CKWA 1DTTB 4NLQA 3H5UA 5DGBA 1DTQB 3CIZA 5KFMA 3DM2B 5KT2A 3GYNA 2JEJA 5F8LA 4IRKA 1N5YB 5D3GA 1TKXB 4RNMA 3I0SB 3H5YA 3JSMA 3I5AA 1HNVB 1IKVB 1BQNB 3IRXA 1N6QA 2GIRA 4KBIA 4QPXA 4ECXA 1RYSA 1K1SA 3LP2A 4I2QA 5KFDA 5F8IA 1IKYA 2OPQB 2YKMB 3QO9A 5C24A 3MECB 5J2QB 5I3UA 2WCXA 2XWYA 4IH7A 1CSJA 4EEYA 2R8KA 3V81B 3HVTA 2D7SA 4Y3CA 4RW9A 3QIDA 1JLAB 2UUWA 1RTJB 3DI6A 1SH3A 4R8UA 4KSEB 5DQGA 3KMSA 3DLGB 4ECYA 1KLMA 1IM4A 1LW2B 3LP0A 3N6LA 3E01A 3DOLA 2W9CB 5KFBA 1HQUA 4KKOA 3PR5B 1S1UA 1S1TB 1XR7A 4TN2A 1S1WB 2WB4A 1JIHA 3GIMA 1C0TB 1T05A 5KFFA 2FJXA 4MKAA 5HBMA 5KFOA 1Z4UA 3ITHA 1WNEA 3G86A 3DMJA 3Q8RB 4DL4A 1JX4A 5EWGA 2XC9A 2WOMB 2W9BA 4WXOA 4HYKA 3QZ8A 4O4GB 3BQ1A 4ECVA 4EBEA 4U7CA 4RW6B 2YKNB 3CJ5A 2WRMA 3DDKA 2IBKA 4ZP8A 5KT7A 3GILA 3FSIA 1HYSA 3KK3A 2AWZA 2C2DA 3EZUA 1DTTA 4J9RA 4Y34A 2VG6B 3GIJA 5DLGA 1S9GB 4ZPAA 3RB6A 4FBTA 4LSLB 4WZQA 5HROB 1DTQA 2YNHB 3BJYA 3DM2A 3KLGB 4RUAA 3KLVA 5KFKA 3NAIA 3GIIA 2C2RA 1N5YA 2R2TA 1TKXA 2EC0A 4ECQA 5L1IA 4NLOA 3I0SA 1HNVA 1IKVA 1BQNA 3LAKA 4RW8B 4QWAA 4YR3A 3T5JA 1NNDA 2OPQA 3FFIB 2YKMA 5KFEA 1HQEB 3MECA 5J2QA 2J6TA 5C42B 3V81A 2R8HA 1XR5A 4K4UA 1JLAA 4K4SA 1RTJA 1RA7A 4JV0A 3DLGA 5KG4A 3E51A 4NLSA 1LW2A 1RAJA 4IQXA 2W9CA 4EO8A 2AU0A 3H5SA 1BQMB 3KLFB 1ZTTA 1S49A 1S1TA 2FLNA 1S1WA 1T94A 3G6XA 3EPIA 3I0RB 4H4MB 2OPPB 2WONB 1C0TA 3IGNA 3D28A 1S1VB 3GV5B 2ILYA 3CJ4A 2V4RA 3KHRA 3JYTB 3MR2A 3V6HA 2WOMA 3TVKA 4LSNB 2BR0A 4O4GA 5DQHA 5CYQB 4NLWA 4NZ0A 3RBDA 4RW6A 2FVSA 2AX1A 4NLVA 2FJVA 2YKNA 3UQSA 4RUCA 3OLAA 2IC3B 4DL2A 4ZPBA 1MU2B 3LANA 5KFWA 3G6YA 4J9NA 2VG6A 3D5MA 1S9GA 4ZVGA 4WYLA 4LSLA 1S4FA 5HROA 3FQKA 2YNHA 2W8LA 4H4OB 3KLGA 1S97A 4NLTA 3QZ7A 4K4YA 4KB7A 5DG9A 3QIPB 2ATLA 4F4WA 4IRCA 3MR6A 4R8UB 3HVAA 4RW8A 4MH8A 2HWHA 3QLHB 4X2BA 2B6AB 5KG2A 3E01B 3V6DB 1HQUB 2GIQA 4MIBA 2IJNA 2F8EX 3FFIA 4TQSA 1HQEA 4O4RA 3DLKB 5C42A 2RKIB 1TKZB 3KK2B 3CDEA 4ID5B 1HARA 3H2LA 3IS9B 2ZD1B 5K14B 2QE5A 3T19A 3KJVB 1S6PB 5FDLB 1JLGA 3KLFA 1S0NA 4F4XA 3RBEA 4F4YA 2HWIA 4NLRA 3I0RA 4H4MA 3CDUA 3CJ2A 3KNAA 2OPPA 2WONA 2BRLA 4Q0BB 2FJWA 2HAIA 1S1VA 3MEDB 1HYSB 4ZVFA 4NRTA 3JYTA 3DRPB 3BSNA 4DL5A 4Q8FA 2C28A 1RT2B 4LSNA 3BSAA 3FRZA 4FS2A 3M8PB 2WTFA 3MEEB 2V9WA 2XI3A 1TVRB 5CYQA 4ZPDA 3MEGB 4J9LA 5KFLA 4ED2A 2IC3A 4WE1A 4EYIB 1MU2A 2IA6A 2FVPA 3OL6A 4NRUA 3C6TB 5KT5A 2FLLA 1S1XB 5KFHA 3H40A 1S10A 4WFYA 4JV2A 1NHVA 4KHMA 3V6JA 4H4OA 5EUHA 5KG6A 2R8GA 4OL8A 4K4WA 5F8JA 4IOBA 2RDJA 2IM1A 4J9QA 4KAIA 3QIPA 3M8QB 2E9RX 1JLEB 1SUQB 4ZHRB 3CJ3A 3QLHA 3BREA 2B6AA 4RNNA 3V6DA 3GIKA 4KFBB 3KHLA 1S9EB 5C5JA 1RTIB 4TY8B 4WFZA 3OHAA 3NAHA 3OL7A 3PW7A 1JLQB 3DLKA 4Q43A 2RKIA 1TKZA 3KK2A 2E9ZA 2UUTA 1FK9B 2WK4A 3PJXA 4ID5A 4B3OB 1D1UA 4ECUA 1R0AB 4KHRA 3IS9A 4ED6A 2ZD1A 2RDIA 3KJVA 1S6PA 5KT4A 5FDLA 2HMIB 2UVVA 2QV6A 4J9OA 1S9FA 4J9KA 4Q0BA 3MR3A 4ZP9A 3MR5A 4WZMA 3MEDA 3SFUA 3DYAB 4NLDA 3H5XA 4TY9A 4HKQA 4Q45A 3DRPA 2ASLA 1IKWB 1RT2A 5J1EB 5KFUA 3LP1B 1RA6A 3M8PA 3MEEA 4KO0B 3KK1B 3OL9A 5KFNA 1TVRA 2W9AA 4YMEA 5F9LA 3MEGA 4FS1A 3SI8A 1JLCB 4J9MA 3TQ1A 3T5LA 1TV6B 4NLYA 4NLGA 1EP4B 4YP3A 3KLIB 3OHBA 3C6TA 2B5JB 4MFBB 1ZETA 2R2UA 1S1XA 2D41A 2OPSB 1LWCB 5KFCA 4IFVB 4IRDA 1RT4B 4O3OA 1UWBA 3ICLA 3M8QA 3DLEB 1TL3B 2B43A 1JLEA 1SUQA 2YNIB 4G1QB 1RT3B 4ZHRA 5I42B 2HNYB 4MK7A 4EBDA 4KFBA 3HKWA 3SFGA 3NKYA 1JLGB 1S9EA 5DQIA 5F8MA 1RTIA 4TY8A 5KFJA 4DL3A 5HP1B 1RDRA 4J9SA 3G6VA 1RT5B 2AGQA 4ICLB 1S0MA 1JLQA 3OSPA 5KFYA 4ECTA 1FK9A 4DEZA 4EYHB 4ED1A 4B3OA 5F8GA 3IN5A 4GC7A 1C0UB 2BANB 1R0AA 4IH5A 4URGA 3UDLA 3GV7B 3PVXA 4Y2CA 2BRKA 3PJWA 3FDSA 2HMIA 4WFXA 3BQ2A 5EDWA 1RTDB 1RT6B 3KLHB 4WE1B 5KFQA 2FLPA 1JLBB 3H4BA 4IR9A 3H4DA 4ECWA 3DYAA 3H59A 1XR6A 3GV8B 4ECSA 2R8JA 1RT7B 4IG0B 1IKWA 5J1EA 3LP1A 3ISND 4KO0A 3KK1A 5KFRA 3PHEA 2XCPA 2C22A 1LW0B 1JLCA 3CWJA 3RB3A 4K4VA 3RAQA 1TV6A 2W7PA 1YVFA 2D3UA 1EP4A 4URSA 4O3PA 3KLIA 5KFAA 3RB4A 3BSOA 4MFBA 2B5JA 3V6KA 4EO6A 2XGQA 2OPSA 1LWCA 1MMLA 4IFVA 3QGGA 4DL6A 3Q8QB 3BGRA 1RT4A 4M94A 2JLEA 3C6UB 4TYAA 4WXWA 4F4ZA 3MFHA 3DLEA 1TL3A 3KLEB 5L1JA 4G1QA 2YNIA 5I42A 2BQUA 1RT3A 5J2MB 2HNYA 3T5KA 3UPFA 5KFIA 4ZP6A 4MK9A 1LWFA 2FVCA 5HP1A 1RT1B 4I7FB 1RT5A 4ICLA 5J2PB 1HMVB 2J6SA 1I6JA 3LAMA 5L1KA 3GQCA 1C0UA 2BANA 4ED7A 1VRUB 4MIAA 1TL1B 2D3ZA 5DG7A 2VA2A 2AX0A 4DL7A 2C2EA 3V4IB 1C1CB 4RNFA 2OH2A 5CYMB 3IGVA 1RTDA 1ZTWA 1RT6A 4M95A 4G3IA 4IDKB 4IG3A 3KLHA 4I2PB 1JLBA 1SV5B 3BQ0A 3PW5A 3KMQA 3I5BA 4RNOA 2XGPA 1FKOB 5KFVA 1RT7A 4IG0A 2AQ4A 5JXSA 4H54A 1UWBB 4NYZA 1LWEB 3MTKA 1LW0A 3N6MA 3BR9A 2IM2A 1JLFB 4RNHA 2R2RA 4IKAA 4MK8A 3M9MB 2HNZB 1RTHB 5F9NA 5KFXA 4PQUB 3RB0A 2V0NA 3BSCA 3OSNA 4JV1A 2YNFB 1TQLA 5JUMA 2BE2B 3PZPA 4YR2A 2VG7B 3C6UA 1EETB 1NHUA 4YR0A 4RW7B 2I5JB 4Y2AA 3UR0A 5EWEA 3KLEA 4PUOB 2R8IA 3TAMB 3H98A 4YQWA 5J2MA 3M9OB 4PWDB 4XPCA 3NMAA 3PR4A 3DRSB 4ECZA 3Q8SB 2ALZA 4K4ZA 1JKHB 2IAJB 4QWBA 1HNIA 1RT1A 4I7FA 4RZRA 2VG5B 5J2PA 5C25B 1HMVA 4DG1B 4IFYB 2ILZA 5KG5A 3PW0A 2BQRA 2W7OA 1FKPB 4ZPCA 1S6QB 2W8KA 4ZMMA 1VRUA 2ZE2B 1TL1A 4U6PA 2JC0A 1J5OB 3IG1B 3V4IA 1C1CA 2IM3A 4ZVEA 3HVWA 5CYMA 4GC6A 4IR1A 3NGDA 4IDKA 1REVA 4I2PA 2J6UA 1SV5A 4ED0A 2AGPA 3KOAA 1C2PA 2IJFA 1FKOA 5EWFA 4TLRA 4QWCA 2VA3A 4F50A 1C1BB 4RW4A 2FVQA 3QGIA 3BGRB 2JEIA 3KHHA 1LWEA 5J2NB 2UVRA 5DGAA 1VRTB 5KT3A 4O3RA 3M9NB 1JLFA 5HLFB 1S0OA 2RF2B 3T1AA 1U09A 4K4XA 2HNZA 3DRRB 1RTHA 1SH2A 3T5HA 4LQ3A 4PQUA 1GX6A 2DPIA 4MKBA 4ED3A 1HPZB 1IKXB 2YNFA 4TQRA 1LWFB 2IMWP 2BE2A 4NLUA 5T14A 4QWDA 4LQ9A 1KHWA 2VG7A 2GC8A 1EETA 3NBPB 4RW7A 2I5JA 2ASDA 2OPRB 3QYYA 4ECRA 4PUOA 1N4LA 3MFIA 3DOKB 3RAXA 1JXLA 3TAMA 5KT6A 4PWDA 2R2SA 4KV8B 5KFSA 2V4QA 3DRSA 3CJ0A 2WHOA 3OLBA 1JKHA 2IAJA 4NCGB 4TYBA 5KG7A 5KFGA 2YNGB 5DG8A 4QW9A 2JC1A 1SH0A 1DLOB 2VG5A 5C25A 4IG3B 4DG1A 4IFYA 2E9TA 1T03B 4O3SA 3I5CA 1FKPA 1TKTB 1S6QA 1QAJA
chains in the Genus database with same CATH superfamily
5RUBA 2PI5A 2V8HA 2DVIA 4O44B 1BWVA 3D1OA 2EFQA 2WBMA 2WB1D 5F8NA 4JUZA 4K5SA 2EFVA 1N56A 5HN0A 3LP2B 1HPZA 2WZ1A 5C24B 3P5BP 5I3UB 2IM0A 4ERDA 4U67Q 1WDTA 3ISNC 1N5QA 1KLMB 4KV8A 5AXLA 4DOZA 2YNGA 4Q8EA 1VRQC 4WP3A 3CDBA 3PW4A 1T3OA 4QIFA 4PQAA 4EK2A 4DF8A 1I51B 1TKXB 4KBIA 4D3HA 1HWKA 4UOCA 1WEXA 1YZ6A 3MECB 2D7SA 3ZNJ1 3M6VA 1VS3A 4ECYA 3LP0A 3E01A 2PMHA 1HQUA 2VHGA 3TUIC 2KRBA 2W2OP 4LF5J 1NPRA 2HEKA 3Q8RB 3J7ZT 4U7CA 3C14B 2WVCA 3W3SA 5AE2A 1DTQA 4NI2B 3DM2A 3R1HA 4FYWB 5EX0A 4ECQA 4PWUA 2Y1LB 3I56S 2K1RB 3JQMA 5KG4A 4NLSA 1BQMB 5BYSA 1S1TA 3N79A 2PC6A 3W63A 3MR2A 4FVCA 4NLVA 1N34F 3LANA 2N4DA 2DEIA 2ZVSA 3KG4A 3SCKE 1QSYA 5A8KA 3OTOF 2CPZA 3ADAC 2KYXA 4K59A 3D68A 1VC0A 2ZBQA 3Q2SC 1HKAA 4F7VA 2Z2LA 5F3TA 2QGFB 4NXNJ 1CS4A 3GMGA 1T95A 2ZH1A 4NCAA 1W7WA 1YJNS 2FLLA 2CNNB 5A2QY 4ZVQB 1KOHA 2Y1RI 1VK8A 1R8CA 4LUBA 3CJ3A 3BREA 4LF6J 3OHAA 5K8NA 5D4PA 3D67A 1YSJA 4FKXA 4B3OB 4M5LA 4ES3A 4X65J 3ZZRA 4ILRA 1JNRB 5CQGA 4C6AA 1O0PA 3PHTA 1NEEA 2N7YA 3ZFVA 2ROEA 3G82A 3AY0A 1JLCB 1N5TA 3K17A 4WKRA 3C6TA 2B5JB 4MFBB 2FDNA 2YXLA 1FCAA 3I82A 2D9PA 2YWFA 4WTOB 4KGZB 2Q1LA 2FUG9 4F2RA 2AW0A 1JLQA 2NS1B 3CCLS 3QRPA 1F3VA 2AJ0A 2XNRA 2AJFE 1WHYA 2NCKL 3BQ2A 4DR5F 3D4JA 3H4DA 3QRRA 3DYAA 3RGIA 2DBBA 3AD8C 4KO0A 3PHEA 2Y8YA 4JI4J 1WOPA 4O3PA 4EO6A 1LWCA 4DL6A 3GCXP 3MPYA 4HI1A 4M94A 4USTA 3JQJA 2JLEA 4WXWA 5L1JA 3C46A 3F73A 4DV5J 2HNYA 3TZZA 4ZA1A 1D9DA 4C8NA 2M5YA 2ZH9A 2Z57B 2BANA 3DU5A 2Y3YA 3VGUA 2IYIA 4KYZA 4PWWA 2U1AA 2ZZTA 3P5TL 4NYZA 2OTJS 2O1PA 3NMRA 2GO8A 1JLFB 4IKAA 2RRAA 4DQQA 3OSNA 3G8TA 4DSLA 4YR2A 1NK5A 2UXCF 2I38A 2R8IA 2CPYA 4UOFA 1RWVB 3W64A 1UTAA 5CCLA 4U6PA 3PFOA 3BDPA 3QJJA 1S12A 3ZZUA 4F50A 3MAHA 2FYXA 2IMWP 2BJEA 2F7VA 5ETQA 2Q79A 2HW3A 2HHVA 1TZ0A 1JKHA 4NCGB 2HBYB 5KFGA 1FDBA 2J76E 2YQ0A 3H42A 5C25A 4IFYA 2BKPA 2RQKA 1X5PA 1FKPA 4QIGA 3T9ZA 4R5PB 2E1RA 3KYLA 2IFXA 4LBIA 3HDSA 4FF1A 3OL8A 1QUVA 1SL0A 2UXDF 3D9BA 3M6WA 3PW2A 2RF2A 4DCPB 2O67A 3LQVA 1Y7PA 1QSSA 3HM9A 1FESA 2HHSA 4HT7A 4C8OA 2HYIB 1YRUA 4KKOB 2HG4A 3AB2B 2BKOA 4C3LA 2LEAA 4DV4J 1R8BA 3ZNUA 4QR1A 1PGZA 2ZZNA 2G1HA 3WIUA 1UVMA 2HLTA 1VQ5S 5KT2A 1B0TA 2C42A 4IRKA 4PRFA 3MPVA 2DD8S 3JSMA 1HNVB 3IRXA 4J9VA 5J2QB 1LEOA 1NKCA 1T9VA 2J8AA 4JI0F 1Y00A 1KOOA 2KZMA 2MSSA 2DR8A 1YRTA 1VK3A 2JWNA 1FD2A 1QY7A 1RGVA 1Z4UA 1GXTA 3F41A 1Y3JA 1HBUB 2HFZA 4G1PA 4DSJA 4RW6B 4V19X 3VAHA 3GILA 1UWAA 2GHWA 3HSDA 3NGUA 5DLGA 5HROB 3HHDA 3VQTA 5GADI 2C2RA 2ZM6J 5A0YB 4DU7A 2ZH6A 1U2CA 2RS8A 1HBOB 5LOQA 2ZBRA 5CD4H 2DRBA 1UVIA 3BH7B 5BR8F 1RTJA 1U45A 1NJXA 4O23A 4N56A 1X5TA 3CPWR 1O51A 2GVDA 2HHUA 2DXFA 2DB1A 4KIAA 1XMOF 2R7RA 4WIQA 1S4FA 2YNHA 3HVRA 4H4OB 4KB7A 2UUCF 3MR6A 2X1GA 1TK0A 4MIBA 3MAQA 2NUUG 5HI7A 2PSZA 2CXEA 4JI3J 2CPXA 4ID5B 1U26A 2FLOA 2BX6A 1JLGA 2HWIA 3JTNA 4NRTA 3DRPB 1KQSR 3MEEB 1XN9A 3K2YA 4J91A 2UXBF 3NS7B 4A46A 1V5VA 1RLDA 4KHMA 1X5OA 3GIRA 3O6QA 2AJ4A 4J9QA 1U7LA 3QIPA 3U7JA 3R5BA 1JLEB 2EI5A 3DCAA 1VIXA 3JQKA 4DX8H 3M8SA 1V9OA 2PMWA 2ZD1A 3DU6A 4ZCLA 5KT4A 3ETOA 2ZBPA 5ETNA 1SJ4P 3QWPA 2MHNA 3TARA 4CDIA 4Q45A 3QMQA 1TVRA 3UR3C 1SKRA 3H7HB 2Q66A 5HJYA 3JTOA 1NSPA 2BBEA 4DZDA 4DPUA 2E1CA 4ZHRA 5DQIA 2CZ4A 2VQFJ 4RL1A 1R0AA 2BRKA 1CULA 3FCVA 5CCMA 4CM2A 5GMEA 3ISND 2CVIA 4DV2F 2M2BA 2VBYA 2XGQA 1NJYA 4IFVA 4LFAF 5DM6Q 1SQGA 2K06A 3SV3A 1FFGB 4MK9A 1HMVB 4ZJOA 4PG5A 5DO2A 4FYVB 3MM7A 4CP5A 4DL7A 4B9MA 2CQGA 4QPTA 3KLHA 1JLBA 4IG0A 3HFKA 2X3GA 3M32A 4CIOA 3RZAA 2V34A 3M9MB 1HA1A 2CNLB 4YB5A 2KJWA 1UEVA 1NZAA 1NHUA 1LWXA 4B3TJ 1R0BG 3H98A 2J0XA 2RRBA 3QPIA 3OUYB 3FMBA 2IAJB 2KXFA 2XMVA 5HMXA 1HNZF 2QG9B 4L75A 5B0GA 2GVZA 3BKFA 2NPIA 2V4JA 1FT8A 2IY5B 1C2PA 5EWFA 3HSGA 1DBDA 2BJ3A 3QGIA 2ZHBA 2QA4S 2I2YA 3HULA 1C4AA 1HPZB 3ENQA 4DR4F 1ELOA 2W2PP 4NASA 2HRYA 1T0TV 4KV8B 3AA8A 2YNGB 1M90T 2RDDA 4LRAA 4DG1A 3LOUA 3I5CA 4B02A 4NMLA 3OFGA 1PC5A 4NLPA 4OHXA 2V2QA 4Q5VA 2CQ3A 3LALA 3BF4A 2YTCA 5LM7E 5DLFA 2M70A 1XTZA 2VPZB 4F0KA 2H3EB 1UW4A 1IKXA 1FHTA 5KG0A 2AZ1A 2HWTA 1RADB 2IVYA 3LP0B 3PTWA 3HF5A 1NK9A 3EXCX 4OV1A 1A7GE 4J7CA 2RB7A 4F04B 4RW4B 3OXGA 4J5OA 4DPXA 4Z7YA 3AA9A 3EVOA 2EXUA 1DTQB 3DM2B 3KUHA 1S99A 5D3GA 1RWXB 2RQMA 3H5YA 2PDAA 3RAMA 2HZAA 2BACA 5E7OB 4IH7A 3FNNA 3GYGA 3DI6A 2LDIA 3DDIA 4J9UE 3HJFA 1S1TB 1XR7A 4TN2A 2XLIA 3I6PA 2CZ9A 3R7NB 4OMFG 4NEZA 4L3KA 4GKKJ 3JSYA 3VAMA 1N52B 5BXIA 2C3OA 1IR1A 2YX1A 2PI4A 1FXDA 3GIIA 3FBCA 5A8KB 3LAKA 4QWAA 2XMMA 2YKQA 3T5JA 2E29A 3VVUA 2YKMA 5HANA 1JLAA 1VHIA 2XMTA 2VDIA 4OJ3A 4IQXA 5D4LA 3H5SA 4ZVTB 3G6XA 2HIQA 1C0TA 1TELA 2B9WA 2FD2A 1CS4B 3TX0A 3V6HA 3TVKA 4YDXA 4W92B 3BS9A 2AYMA 1Y5NB 1YK9A 2CPJA 1XMQF 4ZVGA 3FQKA 4K7QA 3EE3A 2GIFA 1ZS6A 4MH8A 4P73A 3PO4A 3RJMB 2R7OA 1HARA 3RBEA 4K5RA 1T9TA 2HAIA 3MPDA 1S7HA 3EJMA 2R7QA 1XBWA 3G82B 1TFYA 4FXVA 1KLNA 2EG2A 5HMYA 2RQCA 3C6TB 6FDRA 3CCWA 3F44A 3MMBA 1FE4A 2EEYA 3HSZA 1RK8A 1IR2A 2WVEA 5C5JA 2P9EA 4YB6A 1JLQB 4XAKA 1OQ6A 3CCES 4ANEA 2YY3A 4J9KA 1DQ8A 2XZWA 3DYAB 3H90A 4ATNA 2KFZA 4KO0B 3AOAA 5BJRA 3CJRA 3MTJA 1OJ4A 3EICA 1LWCB 1NH8A 4RJVA 2MKSA 5FLXU 2HNYB 3QRQA 4F4AA 2HFNA 4OQJA 3HPOA 4CLTA 2CPFA 2YVSA 2BANB 2KG0A 4ZS6A 3UDLA 3A3NB 3I4HX 1G6BA 1RKJA 4TNOA 4PR6A 5B09A 3GR0A 5LMNJ 1NK7A 1VFJA 3H59A 2DRDA 4ECSA 3LP1A 5BYRA 3FCHA 3TOQA 1FDAA 2XLKA 4LBPA 2HK2A 4P7VA 4PXCA 5KFIA 4U7UK 1DARA 4UUXA 1WOOA 2IVMA 1S76D 2EBEA 4HDHA 3JSBA 3BQ0A 1U02A 2PE8A 3QBCA 3MTKA 3IWNC 3ENWA 2AEMA 2XNQA 3RB0A 1TQLA 2PO4A 5CZVA 1YX2A 4PYAA 1N0UA 1JKHB 3MHYA 2VF3A 5C25B 4IFYB 1NDPA 1YJUA 2VBWA 1FKPB 1SJQA 2RVJA 1X4DA 2JH3A 3QATA 3OW2R 1RWOB 1UVLA 5SUHA 4QWCA 2HQGA 3BGRB 5KAKA 1H2TZ 2Q3PA 2RF2B 1F2HA 3T5HA 2K8GA 5HVGA 4ED3A 4CLUA 4NLUA 1KHWA 1ZA1B 2ASDA 4CZCA 1JXLA 3HT0A 2L9WA 1Q78A 2K7JA 3OR1B 4JV5F 4NZ6A 2ATCB 3EUNA 3KHGA 3IG1A 2OD4A 1GH8A 2MY8A 1NKBA 1SC1B 2V8DA 4J9PA 1RHRB 5J2NA 4CLPA 1F0XA 3JSMB 2C2KB 1PSDA 3IRXB 5GMKa 2ASYA 5E3CA 4PG6A 4V1Ak 2BJ8A 1TK5A 3Q8PB 5L8RC 4PAAA 2MZ1A 3FJ2A 3VQSA 3MOZA 4UY85 5L39A 4C0BA 2E7WA 3CO9A 2MB0B 3DOMA 1DLOA 4OZNA 2BXJA 1RACB 3EGVA 5IT0A 1QE1A 2Z0GA 3WHIA 1U0HA 2DGUA 4QPXA 3Q23A 5KFDA 5AXNA 3OVSA 4F0HA 3I4PA 1RTJB 1RWNB 4KSEB 4ZPVR 1U49A 3OXLA 2Z58B 2GVDB 3QT8A 4WU3A 1JX4A 4LT6A 3KJNB 2CAJA 4B3MF 3PRBA 3VZIA 3SDEA 4OX7A 3K5OA 3CJ5A 4ZLJA 3FSIA 4EI2A 5HL7Q 4FNIA 1KEKA 4PYDA 1KNZA 1DTTA 4J9RA 1OQ3A 2BJ7A 2YNHB 3KLVA 1RWKB 2IJRA 3MXHP 2EC0A 3CIMA 4KGMA 4DUZJ 3P96A 4G6VB 2VICA 1NNDA 3K7RA 1HWUA 1NO8A 4N47A 2CA9A 2L9NA 2LQBA 1FJGJ 2DR9A 3W2WA 3DKDA 1S49A 1HBNA 5F41A 3MR7A 4ELVA 3D28A 1UETA 1RQ0A 3CJ4A 3D7SB 2VPYB 4DFKA 2YPZA 5HO4A 1MROA 4C8ZA 1T02A 4DL2A 3OLAA 4RPFA 5KFWA 1P1LA 3VAJA 1RAAB 3PNIA 2EC2A 4PEOA 3QIPB 2YX4A 4F4WA 3KXDA 4IRCA 1FJCA 1M1GA 4ZIVA 4ANCA 2EKYA 4AQYJ 2Z4PA 2ZVIA 2F8EX 3PACA 2FHJD 3I9V9 2ZD1B 3FRYA 4B9UA 4H4MA 2GX8A 1SKWA 4U95A 1PKUA 1S1VA 3U1NA 3BH6B 1WD6A 1TL7A 4IYQA 2XYPB 1TVRB 4DV0F 3OBIA 2FVPA 2P2CB 1SBRA 4JV2A 3NNHA 2PIIA 2XYHB 5IWAJ 2KJVA 1FRHA 4ZHRB 4B3SJ 1JB0C 2G0IA 2B4VA 1TKZA 3OVBA 5B7WA 1M0SA 1R0AB 4KHRA 1R27B 1IUJA 4H4KA 1S9FA 2F8HA 3ZZZA 4KH1B 1NB2A 3PX4A 2P5VA 4LR7A 2CQHA 2KXNB 3L7PA 4NLYA 1YITS 3OHBA 2WSCC 4IFVB 4PPDA 2NLWA 3OFFA 2G0CA 3W5YA 4ZCMA 1WG4A 3HKWA 3TAQA 2Y0BB 1WF0A 1S0MA 2DYAA 1FXRA 4ECTA 4GC7A 5AJ3F 3MM7B 4C11A 4WFXA 3J7A1 4X4OA 1PIEA 1RHJB 1WSVA 3KLHB 1XIQA 5KFQA 2ADCA 1JLBB 3GV8B 4IG0B 4OX9F 2W01A 3M32B 1WI6A 2VB6A 1R89A 1XJWB 4UY8T 2OPSA 3Q22A 4DLGA 2CRLA 3CD6S 1RT3A 3THTA 1WG5A 5HP1A 4JI5F 1HHTP 2DHXA 2CQBA 2GVZB 1H72C 2B7BB 4UZBA 2V4JB 4M95A 4ZVOB 4IG3A 4USMA 3B4DA 5LSRA 2XGPA 4DV6F 1N36J 4WK3A 2FC8A 1LW0A 1ZM4A 5IV3A 2OMOA 3D1QA 2M52A 4NA1A 5FJ4A 5U47A 1CC8A 3K5LA 4M5JA 4WCEQ 3M9OB 3WX8A 4QWBA 2RT3A 1RT1A 1OSCA 4DG1B 1X60A 3PY8A 1FNOA 4ZMMA 2QLJB 4ZPWR 2ZWPA 1VGYA 3V4IA 1C1CA 2J0WA 1HD1A 4EGLA 3MOJB 4UOGA 4OIXA 1HFEL 4C8YA 4TLRA 2Z30B 1YGYA 4LBHA 3HHNB 2RU3A 4QU7A 1F9HA 1IKXB 3AODA 1RE1B 2GC8A 1N32J 5F3ZA 2I5JA 4DLEA 3QYYA 1N4LA 2OAUA 1Q7YT 2R2SA 3JS9A 3DRSA 4DQSA 5KG7A 1QSLA 2K7KA 2JC1A 1LK7A 2ZH8A 4YHHF 1IWAA 3X3UA 4URQU 2O5DA 1C4CA 2ZH3A 4K4TA 3G4SS 1LXJA 3QJPA 1D0EA 4OYXA 1IBMF 1SI9A 3QAUA 3G6ES 3T1HF 3H0PA 1U6ZA 2GJFA 1H73A 5D3GB 5L1LA 1VRTA 1NXIA 2MEWA 1SL1A 4Q44A 2X1BA 4F0MA 3SCLE 4Y2KA 3RTVA 3DI6B 4CO2A 1F1BB 3NNAA 2DPJA 3TANA 3O1LA 4K50A 3QFWA 1GX5A 4TVAB 4O3NA 2HNDA 1IJFB 1WKJA 1KVIA 2G1DA 1M5PC 2XBPA 1X8DA 2BKNA 3UCGA 3KDOA 2HHQA 5M2RA 2QLWA 2GA7A 4NA3A 2YKMB 3AQPA 3HKZD 5K9FA 4Y3CA 4B08A 1JLAB 1SH3A 1FXLA 1X4EA 1WACA 1C0TB 1KD1T 4FPIA 4E8UA 2W25A 1T9YA 1U1NA 5L46A 4CM0A 2BABA 2KXHA 3NP5A 3BJYA 3NCPA 4LIWA 2RU9A 2KFNA 1ITPA 2E7VA 3CCZA 1FTRA 5KFEA 1LV5A 1KVJA 4O0IA 3W2VA 2GW8A 1EB0A 1IBCB 1RU2A 1RAJA 2W9CA 2XZDB 1F5CA 5L9NA 3EPIA 1Y9OA 4JI7F 2ZJPQ 2J9CA 4ZPBA 3IRWP 1B7FA 3T1YJ 4DR1F 3MMBB 4MKYA 2ATLA 1HLWA 2HWHA 2F8MA 2DY9A 3T3FA 1T11A 5G0RA 3H2LA 3FBFA 2IA0A 1HIYA 1WHWA 2UV8A 3KLFA 2V63A 2VFUA 1DY3A 4FF4A 4ZVFA 1JXVA 4OZ0A 3UDCA 3CCTA 1X4BA 2D3O1 3RRHA 4LSNA 5CAAA 5CYQA 4QQBA 2IC3A 1MWZA 2IA6A 3CCSS 4DSEA 3UN5A 5KT5A 5ETTA 1IN0A 1RUSA 3HHEA 4QR2A 2RDJA 4IUFA 2EFPA 2FJBB 3UN3A 3OL7A 1N8RT 4Q43A 3DLKA 1VQPS 2RKIA 5E33A 3M4XA 3UCUP 2UUTA 4J9OA 5IM0A 4WF9Q 1KVKA 3CD5A 4NLDA 3W5XA 3H25A 2KFYA 3LP1B 3HFVA 3M8PA 2E5HA 1FDNA 1U48A 4YMEA 2CUYA 4NLGA 4M5NA 4WU2A 3CCQS 4R0JA 3M2UA 4RUBA 2A18A 2JLGA 3GCWP 3UFCX 1OSDA 4U7UD 1ZAXA 5D77A 3JXOA 2GZOA 1FK9A 1AW0A 3GV7B 1UKUA 2GFFA 2R9LA 4C0OC 2MQQA 2N3OA 1FWKA 2FLPA 4ECWA 3G96A 1Z1ZA 3IBFB 4OI3A 5ETVA 3BGUA 4ELUA 2E1AA 4CCHA 4YFUA 3BSOA 4LF8J 2M8DB 3QGGA 3GJSB 4MT1A 1VQ8S 4DN9A 1HBMA 4WWSA 1I94J 5DETA 1DRZA 3NG8A 1YZ7A 1EKRA 3GPAA 2KVIA 3OR2A 3PEJA 1YQHA 1LWFA 1WTFA 1RT5A 3AD7C 4H4KC 4KGVB 4Y2MA 1NMEB 4LF9J 2OH2A 3FEYB 1SC6A 4X84A 4LF5F 5KFXA 2V0NA 5E5NA 3DXSX 5D15A 4QIWD 2VOPA 3Q8SB 1B0PA 1FFWB 1GT8A 4AE5A 2G2OA 3LGMA 3UW1A 4LRBA 3IG1B 1U1PA 2JEIA 3KHHA 5J2NB 3UDVA 1S0OA 1VQYA 5GAGU 4DWIA 5KOXA 1TAQA 4CLKA 3BGOP 1NSAA 4ZLNA 5LL6d 3DOMB 3CEDA 1DLOB 4YY3F 2D69A 3CIZA 4MAKA 3HLUA 2XI2A 4LSZB 1QE1B 4IO1A 2XMUA 2HHTA 2K3KA 2CQ4A 2B9EA 1UFLA 1U0HB 3NOCA 4NXNF 1VQOS 3VAFA 4QR0A 4NOHA 3OTOJ 2ZNYA 1LXNA 1T03A 5GAHI 1UEUA 3EMTA 1BQMA 4XPEA 2AGOA 3SMZA 1N48A 2UVUA 3SDEB 5KFZA 2O3DA 3CDAA 1MG7A 1CJUA 2CKWA 2AD9A 1DTTB 3Q8VA 2XS2A 3MWBA 2BE9B 4I6WA 2XS7A 4CLFA 3J81j 4ECXA 1R8PA 2HQ3A 3NWRA 1L5UA 3UI3A 1XQIA 3SZ2A 3W2WB 1HBNB 2B4OA 2RSQA 1REGX 4BWMA 4XDDA 2GO9A 3CO0P 1MMNA 2E1MC 1MROB 3KFWX 4WXOA 3S7RA 2MKIA 1R31A 4RBUA 1YJWS 3IR5B 2VD3A 4RUAA 2BUNA 4ZIWA 3GFXA 2DEJA 3EX7B 3I0SA 3DRYA 1UMJA 2AJ2A 2Z2YB 1U1RA 3R2CJ 3HZEA 4JV0A 1F2GA 1ZTTA 4JI4F 4H4MB 1RBAA 1S1VB 4HH0A 1Q7LB 4DZ6A 3IXQA 2QZ8A 3Q86A 1TL7B 5DQHA 4DV5F 3RBDA 2O01C 5E0OA 5FIIA 4FF2A 3VHQA 3KUGA 5SZTA 2HHHJ 4MMOA 4J9NA 5BYQA 3BN4A 1KDNA 2J8SA 1HI0P 2HGLA 2YQ1A 3SQGA 1JK9B 3EGWB 2P9CA 2GJIA 2XY7A 1TKZB 2BZ2A 1UW9A 1R43A 1U6BA 5D4OA 3T19A 3B82A 2DNPA 2F9DA 4NLRA 3R97A 2WONA 4IQMA 3TA2A 3U1MA 1CJTA 3JYTA 3VGTA 1GMUA 2Y9HA 2SXLA 1PBUA 5KFLA 1RJJA 4DR3J 3R5DA 1AT1B 7AT1B 4OL8A 1ROFA 3TP2A 2CWKA 1WORA 3C19A 1HI1A 3GIKA 2IRYA 1KS2A 3JSRA 4ECUA 2VL1A 2UXCJ 4C11B 2VV5A 4C2MA 3FGVA 2V94A 2B4UA 5LJ5Y 2AYGA 1CJVA 1SJ1A 1WC6A 4M1KA 4Y2IA 4JYAF 4FS1A 1JJCB 3M8RA 1B64A 4USHA 2OPSB 4BC9A 2H5IB 5KFCA 2OEMA 1RTZA 1RT3B 3TUJC 4MK7A 2MZRA 2MKYA 5K8PA 3SFGA 2G4BA 4DV7J 1H6KX 1VJQA 5HP1B 5H9EJ 1U0SA 3LUYA 3D1HA 5F8GA 5CD4A 1NHKL 1YJTA 1YLXA 3R6GB 3LPYA 1PYSB 2OHDA 3NRBA 1YJRA 1EQMA 3I9ZA 3W9HA 1MWYA 1XMBA 4AT1B 1LW0B 1Q53A 3QSYB 2D3UA 2OP5A 2M4MA 4ZCIA 4DV4F 4M63A 2QX0A 4F4ZA 1TL3A 3ETMA 1EZZB 1MW7A 1NB7A 4AL6A 1RT1B 4I69A 2OD6A 3CTRA 3GQCA 3ZTPA 5HVFA 5EHHA 3BR8A 2LDYA 3V4IB 1C1CB 2E5LJ 3IGVA 1FVSA 3UD3P 3PW5A 1HWIA 3NOGA 1TR0A 3HO1A 2J0QD 2IDLA 2QA1A 4HHUA 1FX4A 4DQPA 3BSCA 1BE4A 2MGZA 2KU7A 2V8GA 2EG1A 2Z56B 3M05A 2F5GA 3UD5A 3C6UA 2I5JB 3NMAA 3DRSB 3AAWB 1VJWA 2NR0A 1RAIB 4I7FA 2MKKA 1PJ5A 2ZM6F 2W8KA 1VRUA 1TL1A 4ZVEA 2IM3A 1FI4A 4I2PA 3HJVA 2DNNA 2WBRA 4DSKA 2YWHA 4B9NA 3A8JA 3KWMA 2K3IA 4A47A 1VRTB 1QTNB 2VH7A 4X4RA 1RTHA 2DPIA 3A8KA 3C2PA 1EETA 9ATCB 4WKYA 1CJKA 1BY9A 4X66J 2PD1A 5KFSA 1GMWD 2ZJRQ 3KJQB 4HT5A 5GAGI 1DQ9A 2HHXA 2HNDB 5BR8J 2ZNZA 4XO0A 1TMJA 3EGNA 1X4AA 1D9FA 4JI3F 1CC7A 1OWXA 4WIIA 2W2NP 2UVWA 2DXEA 5KFTA 4DPWA 2I1RA 4DS4A 3DRRA 1WEZA 2JEFA 4ED8A 1HNIB 4K0KJ 2AJQA 4HHJA 4L73A 2I9SA 4CLYA 1Q16B 3N01A 2UUCJ 1WSRA 3K59A 1RYRA 3EPGA 4NEYA 3VV2B 3R5JB 2KHDA 3PYDA 1XWLA 4WP9A 1F5BA 1O6XA 3QO9A 2GHPA 2WCXA 3W2VB 2WVFA 3BPSP 2Y1IA 2DH8A 2W9CB 2CIMA 4I56A 1J2VA 1JIHA 1Q5VA 1T05A 5KFOA 3G86A 2FJAB 2W9BA 5D0EA 2DR7A 5DZ6A 4DU8A 2DNYA 2CJ9A 3A4TA 3C66A 2VQFF 1N5YA 2R2TA 3GE9A 4NCBA 4DQRA 1H38A 3R7BB 4ED4A 1LOUA 5G0RB 4C0HA 1BUXA 3DLGA 1LW2A 3KLFB 2EPIA 3R5AA 2F4VJ 2KT3A 2MZTA 2ILYA 2ZOFA 2QO3A 4LSNB 4O4GA 4X4VA 5CYQB 2ALYB 4NLWA 3UQSA 2GMHA 2BW7A 2IC3B 2KHCA 2NXEA 2FHMA 3OFEA 1S9GA 2XZTB 4K2JA 1KTQA 2LFVA 4E0DA 3TUZC 4A8QA 3ILIA 4EZ6A 1N0VC 3A3PB 2VJVA 2JDJA 1WEYA 5B0AA 4ZCKA 3DLKB 2RKIB 1SJRA 3MMCA 2C2MB 4LFAJ 1BC6A 2NUHA 4LR8A 2M88A 1GMVA 5IM0B 3CJ2A 2MDAA 1HYSB 4S0MA 1R0CB 3CJTA 1WC3A 1UZHA 1VR6A 2L3MA 4B3TF 3M8PB 4ED2A 1M1KT 1GNKA 2WVDA 3QAEA 2F63A 2A2CA 3M2UB 4IOBA 2Q6CA 4KAIA 2W4DA 4DPOA 1P9YA 2EK1A 4P71A 2HBRB 2X1AA 2RHQB 1EARA 4DFMA 1FK9B 3B4MA 1VC5A 1ZM3A 1RABB 1D1UA 2RDIA 3KJVA 5ETMA 4DR2J 2M3DA 1AZSB 3NS6A 3HK2A 4TY9A 4JI6J 1H0HB 1JJHA 1HNZJ 2ZHAA 4XIUA 2R3VA 1WC4A 4JI2J 4PG7A 3T5LA 1Q8BA 5HATA 3S6EA 2N4CA 1HBMB 3KTQA 3OR2B 2MYFA 4EBDA 3TZWA 3MURP 2DGOA 4KRWA 1RT5B 4ED1A 4A4JA 3MMAB 4UUWA 3OUYA 2HMIA 3UVJA 4QIVA 3CCUS 1M5SA 4UOHA 3H4BA 3AT1B 3KK1A 1CEZA 3MEKA 3AXKA 1QVFR 3RB3A 2LXFA 1FWLA 2VPWB 9RUBA 3SCIE 5I42A 3GR1A 1X9SA 1BHNA 2MQPA 1HW9A 2J6SA 3S8SA 3VWSA 1IBLJ 1NPPA 4HLBA 3I5BA 3AH6A 4CTAA 4QCLA 1V3RA 4FP9A 3K8VA 3UCZP 4ER8A 5F9NA 3OT9A 3PIOQ 3OJSA 1MSWD 3M6XA 3R1LA 3WX4A 2GHVC 2VOOA 4A8KA 4YR0A 4GKKF 2C1EB 1TL5A 1HNWJ 4X4SA 1NZ8A 2WAQD 1N33J 2BVZA 3HVWA 2PFFB 4ED0A 2OKQA 4RW4A 1P8GA 2A10A 5DGAA 1TAUA 3T1AA 4ZJLA 4RUHA 3OFHA 1RU1A 4A8WA 2VG7A 3TNVA 3MFIA 1KQFB 4ZDNA 4DXLA 1M5VC 4OYWA 2ZUGA 2QL5B 2JFDA 3FUYA 2W4PA 3FCWA 1YG0A 1T03B 1OMSA 2X3DA 4KE5A 4UQTA 2AJ1A 3P4UB 2Y1JA 5L9XA 4ZVHA 4O0NA 1CJUB 2J0SD 3IWLA 2PMZD 5HLFA 4BHQA 3NNCA 2IBOA 2KI2A 1DFDA 8RUCA 4BWJA 2H4YB 3EVMA 4ID8A 5E3AA 2HURA 3VZHA 4I6YA 2QYCA 2RUGA 1B70B 3FMWA 1QAIA 2C2ZB 1ZAVA 2B9XA 2EFOA 4CRJA 3RUBL 3GYNA 5ITHA 2OI2A 2Y0SD 4CO0A 3I0SB 5AE1A 1NBEB 2MHEA 1FA0A 4I2QA 1FRIA 4ES1A 1CSJA 4X4NA 4LFBJ 1IM4A 4D3GA 4OHYA 1X4GA 3PR5B 3RR7A 3GIMA 3OVAA 2NXCA 4L74A 2Q6BA 4Q2LA 3P8BB 1SC3B 2FZGB 2C2DA 1RISA 3UNGC 3EZUA 1S77D 4ZPAA 3WC0A 4X62J 4FNHA 5C7PA 3QFHA 1MLAA 5B08A 1IKVA 2FHJA 3SQGB 1PJ7A 2H54B 2BDPA 2HK3A 3V81A 3L4BC 2ZBIA 3AFGA 3E51A 4B9LA 3CJKB 1PAUB 2AU0A 4LR9A 2WONB 1CJTB 3JYTB 2L9DA 1Q0NA 1Y5IB 2RE1A 1VISA 2BR0A 6AT1B 4RKUC 2AX1A 3DFEA 1DJ0A 2HVZA 2MZQA 4J90A 1WKKA 4OZ1A 2VG6A 4M5DA 2HPUA 4LSLA 4RX6A 1OYDA 1VHFA 4ANDA 3WBZA 4RW8A 4DX6A 1EHWA 1OO0B 1HD0A 3MM6A 3L3CA 1H7XA 1TK8A 1ZYQA 2M0GB 4F4XA 2R7UA 4CT9A 2XO6A 4BBYA 3WIVA 1CJVB 1Y10A 1KFDA 2WTFA 2NREA 2VFRA 1URNA 4HTJA 1AA1B 2VFSA 4AYBD 3D6MB 3V6JA 5CA5A 5E41A 3B8HA 2DK2A 1L3SA 4F2SA 4OX8A 1FRXA 4WFZA 3UN2A 3ZTRA 4ED6A 1NM2A 2QV6A 3BPDA 2DNOA 4Q0BA 1WHVA 3CW2C 5B0DA 4HKQA 2MJNA 1IXKA 1RKIA 1XEZA 2HRUA 4FF3A 2W9AA 2HZCA 3KG1A 2XMAA 4BS2A 4QYZJ 2D41A 3G8QA 1IR0A 3OTCA 3SSQA 1TL3B 4NXMF 2V68A 2C3PA 1G3OA 4KFBA 2DO4A 2HBZB 2A1BA 2J5AA 4UF4A 4WTYA 2WVBA 2K2PA 4RO0A 5JVHQ 2M9KA 1RAGB 3UD4P 4IR9A 3FK4A 3HZGA 2HZVA 5ADZA 4K4VA 3RB4A 3KLIA 3QJLA 2MGZB 3BGRA 1RT4A 1JMTA 2KL8A 1U2RA 3C6UB 2Z8QA 3DHWC 5AXKA 2ZITA 3DLEA 2B3TB 3T5KA 3NGSA 4WP8A 4I7FB 3BKTA 2HKEA 2DTJA 4NYPA 3K8WA 3EWGA 1I6JA 4UW2A 1C0UA 1VRUB 1TL1B 1WOSA 1RTDA 3OR1A 1RT6A 4I2PB 1D09B 3KJFB 3DHXA 5KFVA 1RT7A 2AQ4A 2GNKA 5JXSA 1VBZA 4RU2A 3N6MA 4ILMA 1GTEA 1RTHB 4PPZA 2VIHA 2F40A 3GZ7A 1EETB 3F0NA 5EWEA 1CJKB 5J2MA 4ECZA 3Q2TC 5HSPA 4QYZK 5IZHA 5J2PA 2W7OA 4DUZF 4Z7CA 2RS2A 2HLUA 2ABYA 3NGDA 2VDHA 4IDKA 4JI8J 2JOQA 3M8YA 1KC8T 2LMIA 1FKOA 3BV8A 2W2QP 1FJGF 1WDDA 1EQ0A 4V19J 3M9NB 4PKDB 1FRLA 4B3MJ 3DRRB 3ZZTA 4B3RJ 6FD1A 4P2MA 1DHMA 2HBQB 5CYJA 3TEGA 1X4FA 5ETRA 1H98A 3MD1A 4P6QA 3GP9A 1XNQF 4QW9A 2CWXA 1GXLA 4EBEA 2DITA 4AFFA 5HK4A 8AT1B 1J5OA 4AQYF 2MXYA 4YB1P 1U25A 1I5OB 2UV8G 4UT4A 3HHKA 2FVRA 3CVKA 1K0TA 3QO9B 1SQFA 3ULHA 1WF2A 2DNRA 2MKCA 2VBZA 2E5GA 3HI9A 2D1CA 3NBPA 3BBBA 1S48A 4NYOA 4ZP7A 3PXGa 2YH1A 1T05B 3D54A 2BM0A 1U4BA 1U24A 4P74A 1TKTA 5D0HA 3I96A 2W9BB 3GJTB 1W25A 2WW8A 3BGLA 4QYRA 3Q0AA 3MM8A 5DJBA 3LF0A 2X7IA 1N5YB 2KN4A 1RAEB 2I0XA 1N6QA 4AUKA 1K1SA 2OFGX 5F8IA 3G6VA 1D8ZA 1ACMB 1UL3A 2R8KA 4DV0J 4P9SA 4RW9A 2ZC3A 1HWJA 5LT5A 3DLGB 2A6MA 1LW2B 3P6YC 1RZMA 1XC9A 5I4MA 1ZOTA 4DL4A 4O4GB 2QL7B 1UFKA 5F0UA 4HR2A 1T9UA 2IBKA 4CO4A 4GO5X 2RHSB 1S9GB 3E2EA 3O2IA 3GYXB 3R9LA 2KG1A 3SBMA 1YBUA 3FC9A 4CLWA 3TW0A 2XHCA 4I6AA 2W7AA 2R8HA 4TU8A 3IWXA 3MMCB 2ZZMA 1KTVA 2CQIA 1YIJS 3T6JA 1S1WA 2B4PA 3IGNA 3VCDA 1CBKA 5DRKA 1UEKA 2AYEA 4ENOA 2RMLA 1Q81T 1VQ7S 2FVSA 1NH7A 5AJ3J 2HFUA 3G6YA 3D5MA 3KLGA 2XM3A 2Y8WA 3QZ7A 2CVEA 4LREA 4OZ5A 3BO4A 2H9ZA 4R8UB 1NJIT 1U1LA 5KG2A 1PO6A 3FFIA 3LPEA 4N76A 1N36F 3BBFA 3M8ZA 2V6AA 3KJVB 1SB6A 5DS7A 4F4YA 2QMWA 2OEJA 4F3MA 5HJXA 4YDDB 4PXBA 2DRAA 4OYBA 2O66A 1S6OA 2HFSA 1Z2LA 3HXMA 1O8BA 3W62A 1MU2A 4NRUA 3GFHA 2AT1B 2VASA 1VMBA 4OHWA 1A0OB 2J7WA 4K4WA 3HD1A 1WWHA 1O5JA 1Q1KA 2ACYA 2MY7A 3QLHA 1TUVA 2UUBF 1H7WA 2HHPA 1UP1A 4DR7F 1SKSA 2HMIB 3UVJB 3DLLQ 3SFUA 3H5XA 1BMQB 2YX7A 4U9RA 3TZXA 3KK1B 1WC0A 1NPKA 3H8YA 4YP3A 2R42A 5K5MA 4WFNQ 1ZETA 2R2UA 4EZ9A 3D6HB 4O3OA 3Q89A 1PC4A 5I42B 3GU0A 3GWCA 3NKYA 2XSFA 4J9SA 1U1OA 4TKTA 4DEZA 4URGA 2UUAJ 3TUPA 4P72A 1H2VZ 4JI1J 4WE1B 2YWKA 5JMNA 2QN6B 2Q43A 4CTAB 2QEXS 2CJKA 5KFRA 1L3VA 1BLUA 1TV6A 1YVFA 3GLJA 4CT8A 4LFCJ 3T1HJ 2MLZA 3CUNA 5E3PA 2LXUA 1NKEA 3D3CJ 4OLPA 5L1KA 2MQMA 5DG7A 2HGMA 4A8MP 1NDKA 1L3KA 4FPRA 4RNOA 4HTIA 2IM2A 4MK8A 3IAM9 2E1PA 3ZTSA 1RWMB 3VAKA 2VG7B 2LEPA 3TJ8A 4F36A 2P9GA 4L72B 3ILJA 4N5SA 2XTJP 3BO3A 1ZPVA 3S01A 2ILZA 3C16A 3N0VA 2QMUB 5A8RA 3I55S 1Y5LB 1NDCA 2ZH2A 4F26A 3EYZA 2VA3A 1W26A 4NWBA 5HLFB 1U09A 3VTIA 1OYEA 1GX6A 4MKBA 1B3TA 3GG0A 5T14A 2YQ3A 1CVJA 4ECRA 4AL5A 5KT6A 2V4QA 1FX2A 2WHOA 4TYBA 1NUEA 2QT7A 1WTBA 4HL9A 3ZTQA 4CO3A 1S6QA 3VR1A 1VLYA 1KHVA 3IO1A 1GK8A 2V2VA 5LXYA 4JI7J 2XCAA 4QW8A 5K20B 3FQLA 4I2QB 5IT4A 2XMJA 3CT9A 3VAGA 3PKYA 2OPRA 2OEKA 4QZVB 1BXNA 2HQCA 2POKA 2CPDA 1UPMB 4DF4A 3LWMA 3W7BA 3IBWA 2EFNA 3AOCA 2GV1A 2ZKUA 3N28A 1H2UX 3H5UA 4DDFA 3CCVS 2JEJA 4X4PA 1FJ7A 3I5AA 1IKVB 1UJ4A 3POTA 1BD6A 2DNLA 2M7SA 3V81B 4DR6J 3MD3A 1X7VA 2NYHA 3N6LA 3LW5C 1LNQA 1S0VA 5T41A 1FEEA 3HSJA 4GKJJ 1APSA 2JRSA 2GJ2A 3KUEA 1VBYA 1KQGB 2DXDA 1CLFA 2KB2A 2VG6B 4M5DB 1Q8KA 4LSLB 3L95X 5B0EA 1RLCL 5LSLA 4RW8B 3FSXA 3V4MA 3MM6B 4ES2A 5L38A 5EX3A 2C3UA 4K4SA 1Z2ZA 4LF8F 4DSIA 5H9FK 2E7XA 4DPYA 3GV5B 1I94F 1TKDA 3J80Y 2WOMA 1AB8A 3CD0A 2FJEB 2W8LA 2FGOA 4LF9F 1ZH5A 4DUYF 5B0CA 3SIPB 4KHPF 2F4FA 3MCNA 2FJDB 2GIQA 1HQEA 3ET6A 1M5HA 2F65A 4Q0BB 4LF1A 4FN5A 1K0VA 4Q8FA 1ZAWA 3FRZA 4FS2A 5HMWA 1UJ5A 4PCQA 2UZAA 3A12A 5KFHA 2ERRA 1R7IA 4RBTA 3UE2A 2E9RX 3PFEA 2QFJA 3W8PA 3THPA 1H74A 4KQZA 4F3OA 1PAEX 4KFBB 2IRUA 5GADU 8ATCB 3TI0A 4ZK7M 3OV7A 3GB0A 7FDRA 3AJ1A 4N7TA 2FB0A 4C4WA 4P7TA 4K8RA 2QYGA 3K89A 1FNMA 4LIRA 4W90B 2LYVA 4AL7A 5KFNA 2R7WA 4DCJB 3TQ1A 3GJQB 3KLIB 4USKA 1S1XA 3AQOA 2AZ3A 3CB4A 1RT4B 3M8QA 2EK6A 3DLEB 3AJ2A 4B9VA 3W5ZA 1S9EA 1RTIA 4C8MA 1UJ6A 2N3LA 3J81Y 1C0UB 3CJSA 4IH5A 2WSFC 4C97A 1R8HA 3FVYA 2F3JA 4KR0B 5EDWA 2B51A 1RTDB 1RT6B 4I68A 3D0GE 2HGNA 1YJ9S 1RT7B 5LSOA 1G1XA 2C22A 2LP4A 2RH3A 3PYGA 1VYAA 4NE9C 2HFOA 5HVHA 3CWJA 4YY3J 4JBCA 2GAGC 3Q8QB 2C3YA 3IM8A 1EJ7L 4TYAA 3OTDA 3MFHA 4GMKA 4F4KA 1PG5B 4G1QA 1P1TA 5J2MB 5J2PB 1MWQA 4ETXA 1T9WA 3EDRB 3LAMA 1U8WA 1XNRF 4GO7X 2AX0A 4RLEA 3IBCB 4G3IA 4IDKB 1TUGB 1FKOB 1UWBB 4UQGA 3HCXA 4DBQA 4YB7A 1GMWA 3T41A 4FXWA 2QLBB 5ETPA 4YQWA 4OYOA 3TJAA 3G87A 2BQRA 2IDEA 2OFHX 4HACA 2BJDA 3CCMS 1J5OB 5HQLA 4IR1A 2DIVA 1VQ6S 1SV5A 1W2IA 2NXNA 1D9AA 2R7VA 2HVHA 4UTGA 3CMES 2CQ0A 1SH2A 4OI6A 5T7LA 3SSRA 4NPOA 3TRGA 3NBPB 1TTHB 4FXDA 4RW7A 1Y0HA 1G2EA 4PUOA 2MLYA 4PWDA 2M8HA 2HHHF 3HP6A 1IBKJ 4CNZA 2V50A 3BBCA 1SH0A 4ZVPB 4K2XA 1FFSB 1TKTB 4B9SA 3TVZA 1ZM9A 5IC4B 3MM8B 1TU0B 2RIJA 1X9MA 1WC5A 2MLXA 3T9NA 2YKOA 3WDOA 1N6QB 5F8HA 2FTRA 1Q4RA 2V9KA 1Y11A 2HSEB 2P8IA 4RW9B 2KDOA 2OO4A 3T6BA 1NAQA 4DR3F 2YKPA 1UVNA 2ZOMA 1U8SA 4W4MA 2BM1A 5KG3A 1REVB 1SCJB 1S6UA 1Q8IA 2U2FA 4C8LA 4TXSA 2BYCA 3M2VB 4WPAA 1W2BR 1HNXJ 1RYSA 1XERA 4CLLA 2UU9J 4MTPA 5D8HB 4DHVA 4DSFA 5KFBA 1S79A 1H3DA 3IFEA 4DPTA 3DOLA 3IM9A 2BV3A 1S1WB 5KFFA 1J5EF 3AJDA 4MKAA 2DGXA 3Q83A 2IHR1 4ECVA 4OYAA 4MJKA 1NU4A 2AKWB 4DV7F 2AWZA 3KK3A 4DI6A 2HIYA 3RB6A 3KLGB 1BQXA 4ELTA 5L1IA 1VBKA 4C3KA 2R7TA 3MPUB 1BQNA 4JYAJ 2OPQA 3FFIB 1UA0A 3G9CA 2CFXA 1QVGR 2JX2A 3HMJG 1RA7A 2HVDA 2DNKA 4EO8A 4DL0C 1T94A 2LQJA 1VI7A 4DV3F 3W1YC 5CABA 1GXUA 3ELHA 1F60B 2FJVA 2JFKA 1MU2B 2PN6A 4USVA 4LRFA 1QAYA 2EFGA 3ENVA 4NLTA 5IFMA 4LF4J 2E5LF 2DNMA 2ADBA 3QLHB 2IJNA 4TQSA 1N54B 3QT7A 2QE5A 2E5JA 4M8LA 2H51B 3NEKA 2CNKB 4ZVSB 1TFWA 2VC1A 2RILA 3O3LA 1MNEA 2V9WA 1F5AA 3L7OA 3OL6A 5A2QU 3D3BJ 3AD9C 5EUHA 2R8GA 2IM1A 2NSBA 5CHCB 2MTLA 1IVZA 1NDLA 2V8VA 3IS9A 3TEHB 4EFAC 3K5NA 3CD7A 4OV6A 1NRKA 4OLOA 3LTOA 4JP8A 2AEFA 1IQTA 2CNOB 4Y00A 5KFUA 4X66F 5F9LA 3MEGA 3D2WA 2VQEJ 1TV6B 4R25A 4DV1J 2PT0A 3GSIA 3AHPA 3ZZPA 3ICLA 4WFBQ 1FNXH 2KH9A 3K57A 4X4QA 2AGQA 2IIHA 4ZOSA 3A3OB 3OTBA 2NXJA 4FYXB 4CLSA 3CXCR 4K0KF 1HHQA 3X1LB 4OZJA 2I6WA 1IKWA 2EBGA 3K5MA 4C98A 1K73T 3MUMP 3BKUA 4XTTA 2KYZA 3MAAA 5I3QA 1I3OB 2JJ4D 4MKVA 4L76A 4KY3A 1N88A 2DGQA 4ZJQA 3G8SA 3FEXB 2GQQA 2YKAA 1YJ7A 3C16B 3ONQA 1RSCA 3FZBA 5A8RB 4KGKA 2RNEA 1JWWA 3AXMA 3KMQA 2HVIA 2HQDA 2G9OA 2OJ3A 3M6UA 1P9QC 2X1FA 2V8PA 3V5RA 4LRCA 2DNZA 3GSDA 1IQZA 1UVKA 4Y2AA 2AYBA 3FSYA 3J7AN 1TMMA 4X64J 4XPCA 4HVZA 5C2CA 2X51A 5EGYA 3DLHA 1HNIA 2H4WB 1F3FA 1FEHA 2DGVA 1G4CA 3R6LB 2MQ8A 1S6QB 4EMDA 5ETKA 2ZC4A 4GC6A 4OI2A 2G13A 4ZVRB 4LF7J 3TQEA 1YBAA 1YJVA 2F4VF 2H65B 4PQUA 3CC4S 4UZCA 4Z2XA 2BE2A 1R3NA 2QJ3A 3BYRA 2FY1A 3CMAS 1UFWA 2OPRB 2J7UA 4KPYA 3TAMA 4C7QA 3TAPA 1OPZA 2ZDPA 3TWZA 1CPZA 2E9TA 2EWHA 4O3SA 3LA0A 3EZOA 2ASJA 2ZE2A 4WK1A 3N9UC 4HHHA 4WYWA 1U1QA 1FE0A 1S72S 3TZYA 1WJ9A 2MJUA 1T3NA 2BJ1A 3RW7A 3NL0A 4NA2A 4LMZA 4IOCQ 3POTB 4OFZA 2GMLA 2MMYA 5DDOC 5IV4A 3QSIA 3PX6A 1NLKL 2CJQA 1FDDA 1P6TA 1TP7A 3L9ZA 2NYIA 3NY0A 3FKBA 2PA3A 5LMUF 2JVOA 3L09A 4PABA 4NLQA 2F1FA 3IR7B 4DR2F 2R7SA 1E6YA 2XY6A 2MKJA 1GTHA 2XWYA 4JI6F 4EEYA 1LK5A 3HVTA 1FERA 3MCSA 3JAMY 3KMSA 1G7CB 3BO2A 2LU1A 4JI2F 1HR0F 1QUPA 2WB4A 4ZN3A 4CH1A 2WOMB 3CSKA 2CJAA 2KRRA 3IAS9 3BQ1A 1SVDA 1HYSA 1DQAA 1LQ9A 3MPWA 3V2UC 4YUDA 2ZDOA 1RWPB 5GMDA 3GG1A 3DXBA 4C48A 3SV4A 4A8SA 2EW9A 4MYUA 1HQEB 3W61A 3ET6B 5LJ3Y 1B7YB 3CCJS 1B99A 3WZ0A 2XG8A 1QLNA 3PEHA 3KHRA 4ZVUB 1GAOA 2J9EA 4ZITA 1AZSA 3RG6A 2IPOB 2NXUA 4FZVA 1YWXA 2ROGA 3PO5A 4WFAQ 4K4YA 1IBLF 4IO9Q 1FRJA 3E01B 1HQUB 3ZC4A 2JZ5A 2P6TA 1N5SA 4O4RA 3FEZA 3CDEA 2ROPA 4A8OA 1S0NA 2KVQE 3CDUA 5THWA 3MMAA 1RBLA 4EYIB 3VVTA 1ZBTA 1HNWF 1S1XB 2DGTA 1S10A 5F8JA 5J1PA 4QOTA 2QA4G 3M8QB 2A0FB 1N33F 3CE8A 1LFPA 4WBFA 3KHLA 1S9EB 1RTIB 2CZVC 2HFVA 3KK2A 2R4FA 4I64A 2QC3A 5FDLA 2UVVA 3QT6A 2HS3A 1KN6A 4BDPA 4J37A 2VUGA 1NCLA 2IYGA 1PBAA 3N4WA 1SUQA 4G1QB 3M2RA 2KTQA 3R5GA 4Y65A 3MM5A 4TY8A 4JB8B 4Z37A 3R27A 3QQCD 4Y2CA 4P52A 3FDSA 4Y6IA 1K8AT 2C3MA 3O44A 4DQIA 2VFVA 4BLGA 3V6KA 5A76A 4U96A 4P10A 5HMZA 4FKYA 3OXFA 3CC2S 3QGPA 4ZP6A 1SQEA 2FVCA 1PCAA 2VFTA 1N34J 3DLBA 1RB0A 1NK4A 4HACB 5AT1B 2OSQA 4KGXB 1U2FA 1X5SA 5IT9Y 1SIZA 1SV5B 4A8FA 4LFBF 3THVA 4LF6F 3BR9A 4E98A 3W8GA 3M1VA 4TU7A 1GEHA 1NK6A 5T7LB 4X65F 1OY8A 4PG4A 4RW7B 3KLEA 4PUOB 2BEFA 4PWDB 4P2SA 3BDEA 4X62F 3NWGA 2MZJA 2JC0A 3UDEA 4IOAQ 2DO0A 2AGPA 1D3WA 2IJFA 3EM1A 3D6FB 3VALA 4GVBA 1LWEA 4O3RA 4K4XA 2HNZA 3QWUA 4WJBA 4LQ3A 2QRRA 3RU0A 1FJEB 2ZBCA 4QWDA 4LQ9A 4EUVA 3BYPA 2XB2D 2QFIA 1VQNS 2ZH5A 3HFZB 4OI1A 4MYTA 2JEGA 3IP0A 3KNGA 5I3PA 3JTPA 2IVFB 2H5JB 4DR5J 3D0HE 4OYPA 1OIAA 3FZ2A 4F02A 3Q8YA 2APOA 3DOKA 5ETLA 3DOLB 3ZXWA 5G4DA 2AHOB 3MF5A 5K14A 3CJKA 2EKNA 1AFJA 4ZLLA 3HD2A 3U27A 1FTCA 3KK3B 3IR6B 3QNWB 5KFMA 1F9EB 2B9YA 1CQNA 3DGPA 3Q8UA 3M30A 2MQNA 3ILLA 3LH2S 4DMZA 1BQNB 4HI2A 3S1TA 1IKYA 2OPQB 2NPFA 1X9WA 3QIDA 4ETZA 1KR4A 2FQQB 5HQMA 4C8KA 2BA9A 3ITHA 2COLA 3DMJA 2QLFB 3ZZYA 5EWGA 1HQ2A 2XMWA 3QZ8A 2DJWA 4L6V3 3HT3A 2B56A 5DDRC 5D78A 1QAXA 1YHQS 4YR3A 3NLCA 2VKRA 2J6TA 4ZN1A 1P27B 1NSKL 1V5IB 4HDGA 3K5PA 4M5KA 1DAXA 2YWGA 4NXMJ 2FY8A 2ZUAA 5H1SV 2VPXB 4LVNP 2D9OA 2BJ9A 3ZZOA 2YKNA 3NGRA 1Q79A 5DM7Q 4CH7A 3TO8A 2BOPA 3RW6A 5IOLA 5DZ7A 5DDQC 3HVAA 5HQ8A 2E5IA 5C42A 3IS9B 2UXDJ 1KBRA 3FBBA 3I0RA 2LQ9A 3CCRS 2VONA 3H2UB 2C28A 3BSAA 4OYIA 3MEGB 4FVMA 2HS4A 5IXUA 4DFPA 3H40A 1I1GA 4WFYA 5D6GA 1NHVA 3TA1A 4OJHA 2B6AA 4JI8F 2AIRB 4C9DA 3PW7A 3PJXA 2VODA 4PZVA 3HHLA 4B3RF 3MR3A 2BE7D 4WZMA 3MEDA 3M7VA 1IKWB 1RT2A 4JI0J 4J9MA 1RCXB 4DS5A 1B0VA 3MAAB 3MZIA 3CULA 4IRDA 2B43A 2CDRB 2B8PA 1R6YA 3D66A 4M5GA 1JLGB 1FVQA 1RDRA 5ETOA 5K8OA 4LJMA 1UCNA 3J80U 4TLQA 3IN5A 3Q24A 2XWXA 3RBZA 2CQCA 3W9IA 4NL5A 3R2DJ 4AXIA 1S4EA 4A8XA 4NZ7A 2R8JA 1XNQJ 1N5VA 2XCPA 3PRVA 3TYTA 2OUGA 3RAQA 1IM6A 4FYDA 1EP4A 5KFAA 1SIWB 3PM9A 2VBXA 2VJUA 4CYUA 3IA0A 1XMOJ 2WW4A 3UPFA 2RAQA 1OY6A 2DIUA 5D4NA 2GGPA 3VAIA 2XY5A 1EX8A 3PV8A 2KZZA 1U6FA 1ZTWA 5LXRA 1U1KA 2ZHOA 3N5FA 1AYEA 5A6WA 5C2GA 2MKHA 4H54A 5B0BA 3PYEA 3DC2A 1LKZA 4ED5A 4RNHA 4EWTA 2AF6A 1V3SA 4PQUB 4A48A 2BE2B 2PFDA 4KH0B 1S57A 2MQLA 3TAMB 1ZA2B 4OJ1A 2EVZA 2FHKA 2UXBJ 1CULB 3R3TA 2CJBA 2ZE2B 4X4TA 5A6PA 4KJIA 2LKZA 2DGSA 5CYMA 4CQ1A 1GQEA 1AUSL 2GMJA 5AE3A 2P6SA 3MI7X 2ZH7A 2UVRA 3OQ2A 4OYMA 2DH9A 2HHWA 2YNFA 3MM9A 2JNJA 3J81U 3GONA 2MZSA 1RHMB 1CQMA 3P45B 1E6VA 2KM8C 2BQ3A 2DHHA 1UPPA 2OMLA 4RWWA 4Q7AA 3CDWA 3QGHA 2DHSA 3PJ9A 1C1BA 1Q82T 3RRGA 1E6YB 3DN9A 2B0GA 2QSFA 2CPEA 3HVTB 2IRXA 2XSJA 1M5KC 4USWA 4DV2J 5MLCV 1JNZB 4ALZA 2DH7A 4YEAA 4Y0FA 4QWEA 3P49B 1VQMS 1AROP 3PG9A 3MCOA 5DGBA 2KT5A 4HYKA 2GIRA 4RR5A 1QDUB 3SEOA 2XO7A 2IMOA 1SJFA 5DQGA 4R8UA 1FO1A 1ZZNA 1S1UA 1F6TA 2FJXA 5HBMA 1WNEA 2UUBJ 1AUDA 3DDNA 3NS5A 3DDKA 4DR7J 4LVOP 3CMQA 4RWXA 3RBXA 2AEJA 1PJ6A 5KFKA 2G0JA 4ZKAA 4CO1A 2UUAF 4LF2A 4I0WA 4JI1F 3R5CA 3IMQJ 4DX5A 2ZKTA 2YWEA 1EAYC 2QL9B 1A9NB 3QT5A 2FLNA 2G2YA 1RWWB 5ETSA 4LFCF 4DR4J 4NZ0A 3O8WA 1VQ4S 4USJC 2D3OR 3A13A 5GAHU 4USIA 4WYLA 5A8WA 1S97A 2CPIA 5DG9A 1RHUB 2CADA 4EU0A 2PA8D 3GFZA 1PYTA 2D74B 3NGTA 1RBOB 4U8VA 3KK2B 4I1TA 4DCOB 3PDNA 1M5OC 5FDLB 2ACMA 1YTYA 3KNAA 3SQOP 2OPPA 2BRLA 2FHOB 2CG8A 1TUWA 1RP5A 2DT9A 4DX7A 4OI0A 2XI3A 4WE1A 4TU9A 4CO5A 5KG6A 1HHSA 1RWUA 2LA6A 5FD1A 1SUQB 2CJXB 3M2RB 3MM5B 3V6DA 4TY8B 4XDCA 1R8AA 4W98A 2MQOA 2V69A 1S6PA 1V6HA 2CQPA 3DNCA 4ZP9A 3MR5A 1VBXA 3FBEA 1RA6A 2CQ1A 2KKHA 3SI8A 3EVWA 1QJHA 3EZ5A 3TA0A 3C15A 2JL9A 3P3DA 3B54A 3J7YU 3K0JA 4QJVA 2ZJQQ 1ULRA 2GQ2A 5KFYA 2DKOB 3UO0A 3BGFA 4FDFA 1YRXA 3PJWA 3PCOB 2KM8B 1FWPA 2DR6A 3JB9k 5J1EA 1NJZA 4BC7A 2DISA 3M1VB 2W7PA 4URSA 4CI0B 1MMLA 4OYZA 2OGUA 4CH0S 5CH7B 1Y4ZB 3KLEB 3WQPA 1VQ9S 2LU2A 2YNIA 2BQUA 4ILLA 5GAEU 2OTLS 3RR8A 3HHLC 4ICLA 1Q8LA 2V67A 1XMQJ 2D3ZA 2VA2A 2CQ2A 2C2EA 4DN0A 4MIWA 4RNFA 3U02A 1IJEB 4ZPTR 1UAWA 4DR6F 2KT2A 2VU5A 2LQ5A 4NX9A 1K47A 4GVBB 1LWEB 2HNZB 4GKJF 4JV1A 3PIPQ 3PZPA 2LECA 2ZFHA 3U1LA 1VCTA 1VLOA 2V5HG 4RZRA 3PW0A 3RYLA 4JOUA 3W66A 2L48A 2GQCA 3C3LA 2DR5A 3N5BA 1B4SA 5B0FA 3VF0B 5KT3A 3M8WA 4TQRA 2VZ9A 3DLJA 5EN1A 3DOKB 2Z2ZA 4C3MA 3ZO7A 1J27A 3OLBA 5LMNF 1KWMA 3VGSA 2VG5A 4N8NA 2AMCB 5K14B 1TL4A 2XEXA 3ISZA 4B9TA 1JJ2R 4HEA9 1WG1A 2HQFA 5KFPA 2DHGA 3A1YG 4P75A 3GTYX 3DGPB 4N77A 4B17A 3M30B 4M5IA 5IQQA 4OZ3A 1IKYB 3N6NA 4QU6A 1GFWB 4DUYJ 4R0EA 5AXMA 1U47A 4KHPJ 4YOEA 3ITHB 3DMJB 4FBUA 2LEBA 2J9DA 2V2KA 4O44A 1YKWA 4OZLA 4EBCA 4RU9A 1OS5A 2XMKA 1NSQA 2R7XA 1T9XA 2OIHA 1LFWA 3LP2A 1MMDA 2Z2MA 4OZ2A 5C24A 5I3UA 4F67A 2UUWA 3E3XA 1KLMA 1ZM2A 2XQCA 7FD1A 1WI8A 1Q86T 3EXYA 4PXEA 1RXOB 2YKNB 2RQ4A 3H2VE 5KT7A 2XS5A 1L3TA 4WZQA 3GIJA 3NAIA 2DGWA 1TKXA 4YN3B 1ZPWX 3W65A 2H1YA 4NLOA 1T7PA 2YH0A 4OI4A 3MECA 1M1HA 5C42B 1XR5A 2RJZA 3PRDA 1NK8A 3I0RB 5CXTA 2V4RA 2W1BA 2FGCA 3C14A 4RUCA 3NCRA 4NI2A 4N8OA 5M2UA 4JV5J 2CG4A 1RCOB 1X4CA 4X2BA 2B6AB 3A8EA 4KC5A 2K1RA 4U8YA 2NZCA 4CLZA 4CWBA 2LVWA 3BEGB 2LCWA 2J9DE 2HVEA 3LWLA 3F56A 3HHLB 2A6OA 1WF1A 4AXJA 1SKUB 2WSEC 3MEDB 1VQKS 1RT2B 1SC4B 4ZPDA 2ZWOA 4J9LA 1DZ5A 1XNRJ 1SL2A 1X4HA 4E2FB 1ICEB 1SXLA 2DNHA 3ILOA 2LQ8A 3JAMU 1FRMA 1X31C 4RNNA 4PXDA 4OX6A 3NAHA 2CYYA 2W2MP 2E9ZA 3TX8A 2WK4A 3SYZA 1RHKB 1DURA 1NK0A 2DY1A 4M5HA 2FPHX 1KQKA 4QIEA 1F9FA 1JQGA 2B7CB 3OL9A 3G2XA 3DRXA 1IBKF 5HAOA 1EP4B 3ZZ0A 3B6BA 2N7CA 1UWBA 4CYUB 2CQDA 5E2QA 3I31A 4X4UA 3W9JA 5F8MA 5KFJA 4QBUA 3PKMA 5IC6B 1RI7A 2DCUB 2GGPB 2ZH4A 4B3OA 2H5EA 2DNGA 2YBVA 3CF5Q 1QTMA 1AFIA 3PVXA 4USUA 1HL6A 3BN7A 1KRPA 3SXLA 2CPHA 2A3JA 3J7YI 1XR6A 2BOAA 2QSWA 1EIYB 5IS2A 3MUVP 4FYYB 3MUTP 1S5ZA 1X0FA 4ZLPA 1JLCA 3K58A 4L3NA 3CJQA 4MFBA 2B5JA 3ENAA 3GJRB 3MCMA 4G65A 5E3RA 5MAOA 3CJ8A 3I87A 1S7IA 5M2PA 1VQSA 2J7KA 3W60A 3TVYA 1HNXF 4MIAA 4DJBA 5KTQA 5CYMB 2UU9F 2MSTA 4KTQA 3EDQB 5IWAF 5GAEI 4B3SF 1UZDA 3BB5A 3R8YA 3AOBA 4GRSA 3KDNA 1MN7A 2YNFB 3MM9B 3E8OA 2VC0A 2B8QA 1CG2A 4PG8A 3ZTOA 3PR4A 2ALZA 4K4ZA 3BZQA 1U1MA 5KG5A 1E6VB 2CDQA 1WELA 4ZPCA 3SCJE 5IQ6A 5JJBA 5DDPC 1BGXT 1REVA 2F9JA 1C1BB 3D6TB 2FVQA 1J5EJ 3C8YA 2HAFA 1JLFA 1FD8A 3M2VA 5D0RA 2YWWA 2OSRA 1AXQA 1RAHB 2XYGB 2XSJB 2HQIA 3RAXA 1KP6A 4DUTA 3SSSA 5DG8A 3MDFA 4IG3B 4LF4F 1WKLA 1OPIA 1QAJA 3OPKA 2JLFA 1URRA 3O5TB 2A2DA 2ZEJA 4G1IA 4IH6A 4DV3J 1EKSA 2PGCA 4NLXA 3UWTA 3LGNA 4OHVA 2LXIA 2PEHA 2QA2A 4Y28C 3CGIA 1WC1A 2C2NA 4O3QA 3OTEA 4OX9J 1S1UB 4NCGA 5IT9U 3RRKA 1UA1A 5HBMB 3IC1A 2H48B 4M5MA 3G71S 3KG0A 4R5PA 1K1QA 1XK8A 3UNYA 4RBVA 5KG1A 1HI8A 3I32A 2JVRA 3B78A 4JI5J 5F8LA 5K8MA 1NJWA 4RNMA 1A6LA 2NQPA 3A8IA 1KKHA 4NMXA 1PYOB 4F25A 4F3QA 2KO1A 4DV6J 1YDLA 2VQEF 2RUSA 4KKOA 4DV1F 4OJGA 2XC9A 5H9EK 2WRMA 4ZP8A 2JSXA 1SJ3P 4Y34A 1N32F 4FBTA 2L08A 5A8WB 2UP1A 2V2ZA 1VOMA 3NGKA 1Q95G 3OJUA 1HNVA 1R6VA 2QTWA 3MGJA 5J2QA 1BWEA 2LA4A 1V3ZA 5CZXA 4K4UA 5FLXY 3LGHA 3EGZA 5E3QA 2OPPB 5JVGQ 3BM7A 2CJYB 1HBUA 4RW6A 2FZKB 2GCFA 1WHXA 3HHLD 2L41A 5HROA 4YHHJ 5A0YA 2XLJA 3MMJA 3NCQA 3V6DB 3R7SB 1HBOA 2QMXA 2RD5C 3TJ9A 1IBMJ 2C2OB 3TR5A 1KFSA 2W4CA 2W24A 2E66A 1S6PB 1MN9A 4YS2A 5D0GA 2I8EA 2FJWA 2HS0A 3CC7S 4DL5A 3BSNA 4P2XA 2QLXA 2AV5A 2PEBA 2FC9A 3H20A 4X64F 1T8EA 1D8YA 3PYFA 2NZ4A 3AB4B 5J1NA 2YPYA 4H4OA 3C15B 2G2ZA 4P2FA 4KT0C 1L3UA 4LF7F 4ID5A 5GVQA 3NXZA 4OHZA 4I4BA 2FIUA 2QIFA 2ASLA 3DRPA 4Q2MA 5J1EB 3MEEA 2GS8A 1RAFB 4N41A 1FF2A 1PILA 1K44A 2XULA 3J7Z5 2GAHC 1YI2S 4I67A 3LO3A 1JLEA 2YNIB 1QM9A 1QD1A 4DL3A 1S59A 4ICLB 4ITSA 3OSPA 1FRKA 4EYHB 4XK8C 2LLZA 3T1YF 1VDHA 3L7UA 2XHWA 3D0IE 1HWLA 1WUUA 1Y3KA 1KONA 1UVJA 4F8RA 3GFYA 2DHAA 2FZCB 5H9FJ 4A8YA 2JHEA 1X0PA 4DR1J 4ED7A 1Q5YA 4BCAA 5KOWA 1FKAF 1HW8A 1SPBP 4LRDA 3KKFA 2DNQA 2BMBA 2OLWA 1JJ4A 1VIOA 2R2RA 1VQLS 5LMUJ 2BW2A 1YBTA 5JUMA 1RAOA 3PX0A 2VKZG 3UR0A 2N82B 2RRNA 2NSCA 5F0WA 2HRTA 1ZZFA 1OY9A 4HH1A 2OELA 1KSPA 2VG5B 1HMVA 2DCLA 4AD6A 2MPUA 2E44A 3VGVA 4CNYA 1HR0J 3CNQP 1K9MT 2J6UA 3US5A 3KOAA 2ZOGA 4KPCA 3OD2A 2AP6A 1JXEA 4DFJA 3WC2A 1IWGA 3HX9A 1LWFB 1RHQB 1VC6A 3DGVA 3CJ0A 2IAJA 4GVLA
chains in the Genus database with same CATH topology
2DITA 2PI5A 2O5DA 4AFFA 2V8HA 1C4CA 2ZH3A 2DVIA 4OI1A 4O44B 4MYTA 4K4TA 1J5OA 3D1OA 2MXYA 4AQYF 2EFQA 4YB1P 1LXJA 3G4SS 3QJPA 1D0EA 2WBMA 2WB1D 2JEGA 1IBMF 1SI9A 3QAUA 3G6ES 3T1HF 5F8NA 1U25A 3KNGA 1U6ZA 2UV8G 4JUZA 5I3PA 3HHKA 3JTPA 2IVFB 5D3GB 4K5SA 2FVRA 2EFVA 5L1LA 1VRTA 1N56A 5HN0A 3CVKA 1SL1A 4Q44A 2X1BA 1K0TA 3LP2B 3D0HE 1HPZA 3QO9B 3SCLE 5C24B 1OIAA 3ULHA 5I3UB 2IM0A 3FZ2A 4Y2KA 4ERDA 1WF2A 4F02A 2DNRA 2MKCA 2VBZA 2E5GA 4U67Q 3HI9A 2D1CA 3NBPA 3ISNC 2APOA 3DI6B 1N5QA 4CO2A 3RTVA 1KLMB 3NNAA 3DOKA 2DPJA 3DOLB 3TANA 1S48A 4KV8A 3O1LA 5AXLA 4NYOA 4K50A 4ZP7A 3PXGa 4DOZA 2YH1A 1T05B 2YNGA 3D54A 2BM0A 4Q8EA 1GX5A 1U4BA 5G4DA 1U24A 3MF5A 3CDBA 1TKTA 5K14A 3I96A 3CJKA 2W9BB 4O3NA 1AFJA 1W25A 2WW8A 3BGLA 3U27A 2HNDA 3PW4A 1T3OA 4QIFA 1IJFB 1FTCA 4QYRA 3Q0AA 3MM8A 3KK3B 1KVIA 2G1DA 1M5PC 4PQAA 5DJBA 2XBPA 1X8DA 3IR6B 4DF8A 3LF0A 5KFMA 3UCGA 2B9YA 1N5YB 1TKXB 2KN4A 1CQNA 3DGPA 2HHQA 5M2RA 2QLWA 3M30A 2I0XA 2MQNA 3LH2S 4DMZA 1N6QA 1BQNB 4KBIA 4D3HA 1HWKA 4UOCA 1WEXA 2GA7A 4HI2A 3S1TA 4AUKA 1K1SA 2OFGX 4NA3A 5F8IA 1IKYA 2OPQB 2YKMB 1D8ZA 3G6VA 3MECB 1UL3A 3AQPA 3HKZD 2NPFA 1X9WA 5K9FA 2R8KA 2D7SA 4Y3CA 4RW9A 3QIDA 1JLAB 4B08A 2ZC3A 1HWJA 4ETZA 1SH3A 1VS3A 1KR4A 1X4EA 3M6VA 5LT5A 3DLGB 4ECYA 1FXLA 1LW2B 3LP0A 1WACA 3E01A 2PMHA 1HQUA 3P6YC 3TUIC 4C8KA 2KRBA 1C0TB 1XC9A 5I4MA 1KD1T 2BA9A 4E8UA 2W25A 3ITHA 2COLA 3DMJA 3ZZYA 1ZOTA 3Q8RB 4DL4A 5EWGA 1U1NA 2XMWA 3QZ8A 4O4GB 3J7ZT 2DJWA 4U7CA 5F0UA 2IBKA 4CO4A 4GO5X 4L6V3 3W3SA 1S9GB 3E2EA 5AE2A 2BABA 2KXHA 1DTQA 3NP5A 3O2IA 3HT3A 3DM2A 3BJYA 2B56A 3GYXB 3R1HA 3NCPA 5DDRC 5EX0A 4ECQA 4LIWA 4PWUA 2RU9A 2KG1A 2KFNA 5D78A 1QAXA 1YHQS 3TW0A 4YR3A 3CCZA 3NLCA 1FTRA 2VKRA 3I56S 5KFEA 2K1RB 2J6TA 4I6AA 1LV5A 1KVJA 4O0IA 2W7AA 3W2VA 2R8HA 2GW8A 4TU8A 1P27B 3IWXA 3MMCB 4HDGA 5KG4A 2ZZMA 4NLSA 1RAJA 1KTVA 2CQIA 2W9CA