1VRUB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
425
structure length
410
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 109
structure length 410
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vruB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB03
4ZP9A 3NBPA 3HVWA 4ZVGA 1TKZA 1S1XB 3H2LA 5KFXA 4YR0A 4ZVEA 1RT2A 1S4FA 2HMIB 5KFNA 3EPGA 4RW9B 3LP1B 2WHOA 2RDJA 5K14B 3V4IB 2GC8A 1JKHA 5KFLA 3DMJB 2FVQA 3QIDA 1WNEA 4K4SA 4ED1A 3DI6A 2IAJA 4MKAA 5DQIA 3JYTB 2BANB 4ECYA 1RTDB 2UVVA 1S0OA 5FDLB 3C6TB 3UR0A 4ECSA 1RTJA 2JLEA 2FJWA 4NLGA 4YR3A 3KHRA 1TVRB 3CDEA 3UDLA 2AGPA 4DL7A 4H4OA 3NL0A 4DL3A 2FJXA 4IFYA 3I5CA 3NMAA 1JLCB 3DRRB 2WRMA 4K4VA 2HAIA 3H5YA 1ZTWA 5KFVA 3M9MB 4TYBA 4G3IA 3KHLA 1RT3B 1VRTA 3KK2A 4O3PA 3M9OB 4EBDA 2AWZA 2HNZB 3QGIA 3OL8A 3QO9A 2WONB 3FDSA 4IRCA 4KAIA 1REVA 5CYQA 3KK3A 5HP1B 1DTTA 5F8IA 3KLIB 1IKVA 1HYSA 5EDWA 3ICLA 2WOMB 4NCGA 5KFOA 2C28A 4QW8A 3RB6A 3HVTA 2RF2A 3NAIA 4EBCA 2YNHB 4ID5B 2C2RA 3DRPB 5J2MB 5I3UB 1VRUA 3KLHB 3IS9A 3OL7A 1BQMB 1NNDA 1T05B 1RTIA 4I7FB 5C42A 2JEFA 1QAIA 4JV2A 3BSCA 2ZE2A 3D5MA 4IR1A 3NBPB 1TKZB 5HLFA 3TVKA 4MK7A 3OSNA 2W9CA 1RT2B 4G1QA 4NLQA 3T5LA 3DOKA 4TY9A 5F8HA 4IR9A 4NLOA 2I1RA 2ASDA 3DI6B 2IAJB 3DLEA 2E9RX 2BRLA 2QE5A 2UUTA 5EUHA 3FQLA 3KLFA 4WE1A 1RTJB 4DG1A 3JSMA 3GIIA 2ASJA 3QZ8A 3H4BA 4URSA 3FFIA 2HWIA 4NZ0A 4ECXA 3KLEB 1S1WA 4H4OB 4LSLA 3CJ3A 5KG0A 5KFDA 4IFYB 2JEJA 4IRKA 4K4ZA 3E51A 5KFHA 3G6XA 4O3NA 5J2NA 4QWDA 2IJNA 1VRTB 3KK2B 1S10A 2V9WA 4WXWA 3MTKA 3QZ7A 3QO9B 5KFEA 3IRXA 4IRDA 3OLAA 1REVB 3OHBA 3KOAA 3DLGA 5HROA 5CYQB 1SH3A 3D28A 4KFBA 3KK3B 1XR6A 1DTTB 4KBIA 2AX1A 2AU0A 1IKVB 1TL1A 3DYAA 1HYSB 4NCGB 3QYYA 3V6JA 4NLRA 3HVTB 2RF2B 1I6JA 2ZKUA 4Y2CA 3Q8RB 4DL6A 3N6LA 3CJ4A 4K4WA 4IQXA 2AQ4A 1VRUB 4LQ3A 3ISND 3IS9B 4QPXA 2HMIA 1RTIB 5C42B 3LP1A 5K14A 2BQRA 1UWBA 4WYWA 4ECWA 4ED8A 5J2QA 4MIBA 1IKYA 4ZMMA 5HLFB 4KB7A 1RT1A 1TKTA 4ZP6A 2W9CB 1D1UA 2OPRA 4DEZA 4GC6A 4G1QB 4MIAA 4U6PA 3PVXA 3IGNA 3DOKB 4NLDA 4Q43A 4FBUA 3FSIA 3DM2A 4NLTA 1SH0A 3GILA 3V6DA 4ED3A 3DLEB 3DRRA 2UUWA 1BQNA 5F8GA 3KLFB 4WE1B 5L9XA 3DLKB 4DG1B 3JSMB 1XR7A 2AX0A 3BR9A 5DGAA 4M95A 3FFIB 1S97A 1SV5A 2VG5A 1S1WB 2VG7A 1JLAA 4O3OA 1LWEA 3HKWA 3TAMA 3UQSA 1LWFA 5KT4A 2V4RA 4IG0A 1RYRA 2BRKA 5J2NB 2R2TA 4FBTA 4MK9A 4KV8A 3GIJA 4IOBA 1S1TA 3IRXB 5KT2A 5KFCA 3I5BA 5HROB 4KHMA 2R8IA 4RW7A 4H54A 4K4YA 4KFBB 3KK1A 4RW6B 5F8NA 4RNHA 1TL1B 1RT4A 3DYAB 5KFYA 3IG1A 4IDKA 1S6QA 4Y2AA 1RYSA 3V6KA 4TLRA 3KMSA 3QIPA 3MEDA 5C5JA 3H5SA 5KG4A 3NAHA 3I5AA 2B6AA 3FQKA 1UWBB 3H40A 3ISNC 5KFUA 4TQSA 3HHKA 3KJVA 4K4TA 5J2QB 1IKYB 3T19A 3BSAA 1RT1B 1TKTB 5C25A 1SUQA 4R0EA 2OPRB 2C22A 1XR5A 4Q0BB 4DL2A 4ZVHA 3KHHA 4F4YA 2YNFA 3BGRA 3MR3A 3DM2B 2CJQA 5KG7A 3KLEA 1FKPB 3V6DB 1N4LA 3CDWA 1EETA 3OSPA 4ZHRA 3PW7A 2FVSA 1BQNB 4WXOA 3RB4A 4Y34A 1CSJA 3RBEA 4URGA 4RU9A 3BQ0A 2FVRA 4ECUA 1HQUA 1QAJA 2FVPA 3BJYA 1SV5B 1JLQA 2HNDA 2VG5B 2VG7B 5KFSA 5KT5A 1JLAB 4Y3CA 3KLVA 1LWEB 3BSNA 4J9KA 2R2SA 3TAMB 2WTFA 1LWFB 4NLYA 3E01A 4IG0B 4ICLA 1IKXA 2ILYA 5KFFA 1RTHA 1JIHA 3T5JA 1IKWA 4IH6A 4HKQA 4KV8B 1HQEA 3PR5B 4ECTA 5EWFA 4EEYA 1C2PA 2BQUA 1K1QA 1QUVA 1S1TB 2WB4A 1HNIA 4RW8A 3RB3A 5HBMA 3CIZA 4RW7B 4LQ9A 2J6UA 4NRTA 3KK1B 1RT4B 2R8KA 2YNGA 1EP4A 3IG1B 1S6QB 4IDKB 4RW4A 2R2RA 3CWJA 4FS2A 4O4RA 1FK9A 1N48A 1RT5A 4PUOA 2V0NA 3IN5A 1KLMA 3SFGA 3QIPB 3MEDB 4ED7A 1JLBA 2GIQA 2WCXA 2JC1A 2OPPA 2B6AB 2DPIA 4B3OA 4IH5A 3Q8QB 2W7OA 1LW0A 2R8HA 2E9ZA 3KJVB 1JLEB 1IM4A 5KFBA 1DLOA 1MMLA 4TY8A 5KFJA 5C25B 3EZUA 1SUQB 2RDIA 1U09A 2BQ3A 4RNFA 3MR6A 4WFXA 3DLKA 4EBEA 2AGOA 3EPIA 4K50A 4KE5A 2JEIA 2YNFB 3BGRB 5F8LA 3VQSA 1T03A 4XPCA 1S1VA 2YKNB 4I2QB 5J2PA 2BE2A 1C1BA 1EETB 1K1SA 4ZHRB 1N6QA 3PJXA 3T5HA 5I42A 2I5JA 4YQWA 1LWCA 3CJ2A 3PJWA 1HQUB 1R0AA 2HNDB 1JLQB 5D3GA 4ECRA 1S6PA 4J9RA 3MFHA 3MR2A 4NLSA 3PW4A 3E01B 4ICLB 2ILZA 1IKXB 4EYHB 4RW6A 1RTHB 1IKWB 1D0EA 2OH2A 1S1UA 1OS5A 1S49A 1HQEB 1RDRA 2D41A 3OHAA 3LANA 2QV6A 1Z4UA 1DTQA 2VA2A 4J9PA 3OL9A 4WFZA 4OL8A 1C1CA 1HNIB 4RW8B 4O3SA 5HBMB 4ZPAA 5J1EA 4F4XA 5KFIA 5KFAA 1TL3A 3IGVA 3QGHA 4ED0A 2WK4A 2C2EA 2YNGB 1EP4B 2O5DA 4QWCA 4RW4B 2W9BB 3OL6A 1T3NA 1FK9B 2XGPA 4J9LA 4J9NA 2RKIB 1RT5B 3LP2A 4PUOB 2UVUA 2ALZA 1KLMB 1RAJA 4ECVA 4ZP7A 3G6YA 1JLBB 4MKBA 4Q0BA 2OPPB 1KHWA 2FLPA 4B3OB 4QWBA 2UVWA 1LW0B 3PW0A 2B5JA 1FKPA 3DRSA 4IH7A 1DLOB 4RUAA 4TY8B 2R2UA 1S9EA 4NLXA 2YNIA 3Q8SB 2XCAA 1S0NA 4ECZA 5L1JA 4H4MA 4KO0A 5KFPA 3H4DA 1T03B 1TP7A 4K4UA 1S1VB 1SH2A 4TN2A 4U7CA 1QE1A 2BE2B 1C1BB 5J2PB 1NHUA 1N6QB 4IG3A 4URQU 5DG7A 5I42B 2HWHA 2UVRA 2I5JB 1LWCB 5KFMA 5EWGA 5KG5A 4RNMA 3GV7B 5D3GB 1R0AB 2OPSA 3TQ1A 1S6PB 3QLHA 2XI3A 3PZPA 3RAQA 4IFVA 4LSNA 1LW2A 4O4GA 3LALA 2XGQA 1S1UB 4R5PB 4ZPDA 2J6TA 1DTQB 4IKAA 3GQCA 3M8PA 1C1CB 2AGQA 4I2PA 5J1EB 1T94A 3V81A 4NRUA 1TL3B 4NLWA 4MH8A 2GIRA 3CJ5A 1JLFA 1JLEA 4MK8A 1C0TA 3LP2B 3GYNA 2VG6A 4ED2A 4DL4A 4O44A 4PWDA 3NGDA 1JLGA 4F4ZA 5JUMA 2R8JA 1N5YA 3DOLB 3T1AA 1C0UA 3ITHA 4NYZA 4TXSA 1MU2A 2B5JB 3FRZA 3Q8PB 2YKNA 4I2QA 3DRSB 3I0RA 2IJFA 2W8KA 3HVAA 1S9EB 2XCPA 5F9LA 1RT6A 3PW2A 2YNIB 1TKXA 2IC3A 4H4MB 3MECA 4KO0B 4ZP8A 1HPZA 1QE1B 1W25A 4WZQA 5L1KA 3LP0A 4KKOA 1J5OB 4NLVA 4Q44A 2W7PA 2HNYA 2R8GA 4IG3B 4J9QA 1JX4A 4JV1A 2XC9A 3RB0A 2BR0A 2VA3A 1KHVA 5DLGA 5JXSA 2B43A 1HMVA 2OPSB 5KT3A 4RZRA 5L1LA 4WFYA 3QLHB 3PR4A 3BQ2A 4X2BA 3M8QA 2JEGA 4IFVB 4LSNB 1LW2B 1RT7A 4O4GB 3CJ0A 3N6MA 5KT6A 4EO8A 5DGBA 3CDUA 1ZETA 2EC0A 5CYMA 4XO0A 4ECQA 4TYAA 4R8UA 4QW9A 2FJVA 2W9BA 2RKIA 3M8PB 4PQUA 4I2PB 3RBDA 3V81B 3MFIA 4Q8EA 1HNVA 4O3QA 4GC7A 2FLNA 3GIKA 2ZD1B 3C6UA 4NLPA 4YMEA 1JLFB 5DQHA 4YP3A 1C0TB 2FVCA 2OPQA 2VG6B 3NKYA 5F8JA 5KG2A 4O44B 4PWDB 3PHEA 4ED6A 1JLGB 2V4QA 2ASLA 5C24A 1N5YB 1TV6B 1C0UB 3ITHB 3UPFA 1MU2B 2D3UA 2FLLA 4Q8FA 4KSEB 3I0RB 5KFWA 2IA6A 2J6SA 2IM2A 3H59A 4WYLA 2YKMA 4F50A 4F4WA 1RT6B 4J9SA 4J9OA 3RAXA 2E9TA 3KHGA 2IBKA 1TKXB 2IC3B 2IM3A 3MECB 3CO9A 5DG8A 3BREA 4NLUA 3N6NA 3SFUA 2C2DA 4HYKA 5KFTA 3MEGA 1JKHB 4ZPBA 1HPZB 3LAKA 3BQ1A 3LP0B 4KKOB 3MF5A 5L1IA 3G86A 3KMQA 2HNYB 3MEEA 4RUCA 3GV5B 2ATLA 3H5UA 1RA7A 1S9GA 4R5PA 3KLGA 1GX6A 4ZPCA 1HMVB 2IM1A 3G6VA 3M8QB 4Q45A 3I0SA 1RT7B 5F9NA 3LAMA 1FKOA 5CYMB 5KFKA 4RNOA 4R8UB 3PW5A 3T5KA 2W9AA 5KG1A 4PQUB 3M9NB 4WZMA 3MR5A 3GIMA 1HNVB 2JC0A 3DOLA 4MFBA 3C6UB 1S9FA 5KFRA 3V6HA 2OPQB 5KG6A 1NHVA 2D7SA 5KG3A 1S1XA 1S0MA 4KHRA 2CKWA 4TQRA 3OLBA 5EWEA 5C24B 2F8EX 4O3RA 4RW9A 2IMWP 4QWAA 5F8MA 3V4IA 2D3ZA 2ZE2B 3DMJA 4J9MA 1J5OA 3QGGA 2YKMB 3JYTA 2BANA 1RTDA 5FDLA 3C6TA 4ZVFA 4JV0A 4YR2A 5KFQA 5DG9A 3SI8A 1JXLA 1TQLA 3MEGB 1TVRA 4RNNA 4JUZA 1S48A 3MEEB 4FS1A 3GV8B 1JLCA 3H5XA 1S9GB 3KLGB 4XPEA 1RT3A 1GX5A 4EO6A 2XWYA 4M94A 3H98A 2HNZA 4LSLB 5T14A 3I0SB 2WONA 1ZTTA 3KNAA 1FKOB 4K4XA 5HP1A 2ZD1A 3KLIA 2WOMA 5DQGA 3DDKA 1RA6A 5KT7A 5KFZA 4DL5A 4QWEA 2YNHA 4ID5A 5KFGA 3DRPA 5J2MA 1YVFA 5DLFA 5I3UA 3KLHA 3DLGB 2IM0A 1BQMA 1TV6A 4MFBB 1T05A 2W8LA 4I7FA 1HARA 3CVKA 3BSOA 4EYIB 2DPJA 2XI2A 1N56A
chains in the Genus database with same CATH superfamily
4X65J 4MAKA 1VR6A 1B99A 4OLPA 2EFVA 5A0YA 3UFCX 2L08A 2ZBIA 5HSPA 2WRMA 3KUEA 4IRCA 3CCVS 3BYPA 1VQ4S 2BKOA 2QO3A 1QAXA 2V50A 1OYDA 1EAYC 2B4OA 4USVA 2IYIA 3M30B 2DH9A 2IHR1 4MK7A 1D9FA 4N56A 4V19X 3DLLQ 3TEHB 4CWBA 2VDIA 2CJ9A 2BBEA 1Y00A 4K4ZA 4OIXA 5D4PA 3PFOA 3QZ7A 1HNZF 4BLGA 4LFBF 1SH3A 2PI4A 3V6JA 2WVCA 3UCZP 2UXDJ 1WOOA 2Z58B 3D3BJ 1MROA 2RB7A 4TU9A 1Q81T 1Y4ZB 5SUHA 2J9EA 5F8GA 1FDBA 1XR7A 1SV5A 4MTPA 1VIXA 2R2TA 5E33A 1WF1A 1TZ0A 5HROB 4BS2A 3DYAB 3IG1A 4IDKA 3BYRA 2HQDA 4JV5F 2AP6A 2LXUA 3BF4A 2H1YA 4CTAB 2CQ4A 4L3KA 3V2UC 2UV8A 4G6VB 2W25A 1B0VA 3LUYA 4R0EA 4Q0BB 2Y8WA 5HO4A 5KG7A 3LPYA 3HXMA 4DOZA 2RMLA 1NDCA 1NZ8A 2FVPA 3BJYA 1JLQA 1JLAB 2BYCA 1MWZA 1TMJA 2BOAA 2ILYA 3AODA 2FHJA 4RL1A 5EWFA 2X1BA 2ZHBA 4M63A 1GK8A 2BJ7A 1WWHA 2C2MB 4DU8A 1DY3A 3SV3A 4ES1A 3CXCR 3Q2TC 2LCWA 3DNCA 1N32J 1ZA2B 1IM4A 3FBEA 1AT1B 1U09A 2ZM6J 3EPIA 1SJ1A 2XZDB 2KN4A 2JL9A 2JOQA 3GB0A 3OR1B 2EG1A 2J0QD 2GQCA 3MR2A 1IBLF 3EWGA 1X4AA 3PKMA 1JJCB 1Z4UA 4OYIA 1JWWA 3R5JB 2ZJQQ 3ZZOA 3IGVA 2JLGA 3K5PA 3CCES 4O0NA 1RT5B 4FF4A 1X5TA 3GJSB 3TYTA 2CYYA 4LF9J 5E41A 2K8GA 5HI7A 2XCAA 1RSCA 1NJYA 1ZOTA 3LGNA 4QYZJ 4HHUA 2VQFF 1W2IA 1CJKB 2ADCA 1LWCB 3C66A 3IWLA 3GV7B 4DHVA 2UUCJ 1FDNA 1UEVA 4PAAA 2CG4A 1T94A 3K5OA 2CQ0A 4MH8A 2ADBA 4HEA9 1U0SA 1FDDA 4DL4A 5JUMA 4B08A 1N5YA 3G4SS 3HVAA 2V8HA 5MLCV 2LXFA 1CS4A 2WW4A 5IQ6A 3D6HB 4Y2IA 2AEFA 1G6BA 2BR0A 4CLSA 5KT3A 2VODA 1CQMA 3CDUA 4R8UA 2DHAA 5E3AA 1GMVA 5E5NA 5DQHA 1JLFB 2HQIA 2VG6B 4C98A 2XMWA 3AH6A 2OEKA 1EQMA 5AE1A 2D1CA 2IVMA 1HWLA 2VL1A 3N6NA 4LF4F 2MKIA 2BDPA 1HWKA 4JI4J 2GMHA 3ULHA 2JHEA 1SKWA 5CYMB 4DCPB 1QY7A 2NLWA 2Q6BA 3GU0A 3HD2A 2YXLA 3QFHA 2OTLS 1UPMB 2ZJRQ 3QRPA 4RW9A 2XM3A 1K44A 4ZCMA 1X9SA 1TVRA 3G82A 4B9TA 3ILJA 1JLCA 3CEDA 3M6XA 1U1QA 3H0PA 1S5ZA 3AXKA 5T14A 3W66A 4AT1B 1KR4A 2ZDPA 3DRPA 1YVFA 5I3UA 3POTA 3J81U 3KG4A 3HVWA 5FD1A 3R5DA 2WSEC 1NSQA 3DMJB 1OQ3A 1WNEA 4USIA 4ECYA 2WSFC 2E29A 2K7JA 1RTJA 3D54A 1LWXA 3H7HB 2Y1IA 3GR0A 4FYWB 1T3OA 3EXCX 1U49A 2MKJA 4HDHA 1YKWA 4ZVQB 3NGSA 1W26A 1VQNS 5F8IA 5EDWA 1X4HA 3TRGA 3HVTA 2RF2A 2C2RA 1OYEA 1V5IB 3MCSA 2YTCA 1AZSB 2AT1B 2XNRA 3CCSS 3WC2A 1TKZB 2QL9B 1J27A 1GH8A 1PO6A 3BR8A 5HN0A 3PX4A 4M5KA 3FFIA 2W2OP 4NL5A 4LSLA 2FC9A 1TU0B 3B82A 1WG1A 2V9WA 3OR2B 3W62A 2AIRB 1XJWB 3OLAA 2ZH2A 3D28A 4OZ3A 4KFBA 2AU0A 1HYSB 2H4YB 2VZ9A 2CWKA 1RLCL 2AV5A 2FHOB 4DR2F 1TAUA 2BQRA 4WYWA 1WTFA 2VICA 3NGTA 3OBIA 4G1QB 2UV8G 2I2YA 1UJ4A 3J81j 3V6DA 3DLEB 4OYXA 2GX8A 2ZH9A 3DLKB 4DG1B 4KYZA 2KT5A 2D74B 1JXEA 2BRKA 4HH1A 2NPFA 1PGZA 3CMES 1S1TA 4FP9A 2DH8A 4CH0S 5ETNA 1IM6A 5ETTA 3ISNC 2AJ0A 2DNGA 3I6PA 3BSAA 2C22A 5LOQA 2XEXA 3IXQA 1D8ZA 3K89A 1CEZA 4I64A 1SC6A 3CSKA 4U7UK 5ETLA 8AT1B 4ZPWR 2ZNYA 1RKIA 4NLYA 1ZAXA 5KFFA 2RQCA 1JIHA 1HFEL 1F3VA 3GONA 3IBFB 1S6QB 4DR5F 3TWZA 2M5YA 2CUYA 3ZTSA 5JVGQ 4TY8A 3EZUA 1RWWB 3PG9A 3S01A 4I2QB 2VF3A 3LPEA 2HHSA 1FI4A 4YQWA 2RSQA 3CJ2A 2XG8A 3D1QA 1VCTA 2ZKTA 2R7UA 1HQEB 2XS7A 4DSFA 2HVDA 1OJ4A 4Y2KA 1F60B 4CM0A 1KVKA 1XMOF 1UEUA 2Q43A 4NA3A 2RKIB 4PUOB 3P5TL 4V19J 4LFCJ 1FKPA 3DRSA 3HULA 3MMJA 1S9EA 3AJDA 3CCMS 3ET6A 1LXNA 4JI2J 1HA1A 3FNNA 4M5JA 2XSFA 1Q7LB 5KFMA 4I69A 4DZ6A 1PILA 1LW2A 4LUBA 3ENVA 1YZ6A 1M1GA 2J6TA 1FFSB 3JAMY 3NCPA 2DITA 1WHVA 1TL3B 3P96A 4QBUA 1JLEA 4MK8A 1PG5B 4DBQA 1H73A 4PWDA 3H20A 3RBXA 1O8BA 2MZJA 5IM0B 3MECA 1WHXA 3NRBA 1SVDA 3OFEA 2XSJB 3W2WA 2HNYA 1AUSL 1PC4A 1UFLA 3O2IA 5JXSA 5L1LA 4YEAA 2M9KA 4LF2A 2IFXA 3P49B 4NMLA 5F0UA 4W4MA 3MAHA 4O44B 3PHEA 2ZHOA 1GTEA 5FJ4A 2BA9A 1M5KC 1YI2S 4J9SA 4L72B 2KT2A 4ZPBA 3BQ1A 5E3PA 1RACB 1X0PA 3M8QB 1NJIT 5F9NA 2HHUA 2H48B 4P6QA 3HSZA 1RAHB 2R7RA 1S9FA 1FRLA 4J91A 1BWVA 3T41A 4K59A 3CT9A 1RWNB 2DRAA 5K5MA 4B3MJ 3CJKB 4KGXB 3M2RB 5KFQA 5DG9A 1OPZA 2KDOA 2LDIA 3MEEB 1DBDA 1G3OA 2AKWB 1GX5A 3I31A 5LMNF 4DV7F 4A8WA 3G8SA 4CQ1A 2HHVA 5HVFA 2F65A 1Z1ZA 3A8IA 3DDKA 4OJ3A 4QWEA 4ID5A 4DF4A 5KFGA 3DLGB 1BQMA 3FKBA 4M5IA 3T1HJ 4NCAA 4YR0A 2LVWA 2LEBA 1PYOB 3TI0A 2UVVA 2DH7A 3GE9A 2V5HG 1FCAA 3HO1A 2AGPA 2K1RA 4DL7A 2EK6A 2MZ1A 1WHWA 3IP0A 3QGIA 1WG4A 1JB0C 2IA0A 3HHLC 3CUNA 3CCLS 1JMTA 3CGIA 3NAIA 2UU9J 3GFHA 5LM7E 3BSCA 1U47A 2YQ0A 4YB1P 3MMCA 1KVIA 1WC1A 1RI7A 2OMOA 1U2CA 3F0NA 5K8PA 1UTAA 2CJKA 2CQHA 5U47A 3Q8UA 1FE0A 1UFWA 5CYQB 4NLGA 4DU7A 4QIFA 3CJ4A 1OMSA 3IS9B 2HMIA 1R8BA 2CZVC 1SQEA 4ED8A 2IIHA 2I0XA 3I4HX 4ED3A 3IR5B 4JI5F 5B0DA 3I96A 2DY9A 1MWQA 1S97A 2WSCC 2HPUA 5KTQA 4RKUC 5LJ5Y 1ZM2A 2F9DA 4OZNA 3OVSA 1RT4A 3KMSA 3TJAA 2Y8YA 2BX6A 3FQKA 4DJBA 2H65B 5J2QB 1IKYB 1SUQA 3LO3A 2KFZA 2YNFA 2Q6CA 3AOCA 1S57A 2FDNA 3A8JA 4K2XA 3EGWB 5IWAJ 4ECUA 4JYAJ 3Q0AA 5AXLA 4DQIA 5HAOA 2RUGA 2CNLB 2YX4A 2E1PA 1ITPA 4NI2A 2DR5A 2BXJA 2HG4A 3DRXA 3D3CJ 4OJHA 3GYXB 5C2GA 3J7A1 2OPPA 3Q8QB 2HSEB 5KFBA 4UTGA 2Y1LB 2GFFA 3CPWR 4KGVB 1NKEA 1KTQA 1EJ7L 4ZHRB 2RIJA 4L3NA 1CJTB 4B17A 1O6XA 1VC6A 4TU8A 4F02A 2VJUA 3OHAA 3LANA 1TUVA 3PYFA 1HHQA 4RW8B 5KFIA 4ED0A 3CJTA 5ETOA 2W9BB 1FK9B 2HVZA 3AA9A 2Y0BB 3MAQA 2ZH8A 2B3TB 5IT4A 1KHWA 4LVOP 3SEOA 3Q22A 3RJMB 2YNIA 1FD8A 4X4UA 1S1VB 3GP9A 4U7CA 4K5RA 4USMA 2BE2B 3AY0A 3MM7B 3JTOA 2HWHA 3TQ1A 2JJ4D 3QLHA 2DYAA 1FNOA 4CI0B 4GKKF 3V81A 1VC0A 1VISA 2LP4A 4B9LA 5DZ6A 4HH0A 4AL5A 1X9WA 1WEXA 4M5DA 3R97A 4DV1F 2OLWA 3T6BA 1KN6A 4ANEA 2F8HA 4ZP8A 1S7HA 2XB2D 1OIAA 5AE2A 1TAQA 5L1KA 2R8GA 4DF8A 1N0UA 3NLCA 2XYPB 3V5RA 2RHQB 1YHQS 5HJXA 3J80U 4QYRA 4EO8A 3MD1A 5IFMA 2VQEF 3CB4A 1HNVA 4O3QA 4A8FA 1Y10A 4YP3A 3K5MA 3NKYA 2H5IB 3HT0A 2J7UA 4UW2A 4ALZA 1U48A 2QA2A 4Q8FA 1H2VZ 5JMNA 3QT8A 1CVJA 1RT6B 2E9TA 1Q0NA 3DOMB 2P9CA 2RRNA 2ATLA 4RUCA 2J76E 1SCJB 2KM8B 2VPYB 2RQMA 1WEYA 2CQGA 1FO1A 3T5KA 4X65F 2W9AA 3NGKA 3MUTP 4Q2MA 4LR9A 5BYRA 2FZKB 2Z57B 4UUWA 5CH7B 4WTYA 1VJWA 3M6UA 1S48A 4PPDA 2RQ4A 4XPEA 3VR1A 1CQNA 4EO6A 4DPWA 3KJNB 2ZD1A 4B9MA 5DQGA 3OTDA 5J2MA 4TKTA 2IM0A 3M6WA 2PA8D 3HZGA 1FWPA 4DUYJ 3HFZB 1BUXA 4P9SA 2VH7A 1YJRA 1XNQF 2GC8A 4MMOA 4Z37A 4ED5A 2EWHA 5T7LB 2CWXA 2ZUGA 2VBWA 4X66F 4ZCKA 3J7YI 2FJWA 2GVDB 4A46A 3FZBA 2W2NP 3KNGA 3KHLA 2QSFA 4EZ6A 3W65A 2UXDF 2PIIA 2DR6A 3R9LA 4FDFA 2WONB 2VBYA 4OYWA 4IUFA 3EYZA 1VRUA 5C42A 3PJ9A 2WVEA 4D3HA 1VQYA 3A4TA 3EZOA 2N82B 1L3UA 1JJHA 2ZH4A 3DI6B 2HVIA 4P74A 4WE1A 3MPVA 3I55S 2B8PA 1YJVA 2ASJA 3GIIA 1DURA 1NXIA 2JEJA 5GAHI 3KYLA 4O3NA 1G1XA 3GIRA 5IT9U 2ZKUA 4DPUA 3N6LA 2C2ZB 1RTIB 4WFAQ 3FBBA 4ECWA 1RHRB 5HQ8A 4PG5A 1TKTA 4ZP6A 2GV1A 3DOKB 3MZIA 4XK8C 4F25A 3W9IA 2GW8A 1WF2A 3DM2A 4WKRA 3DLBA 1BQNA 4N77A 3BR9A 5DGAA 2BUNA 4M95A 3NNHA 1PSDA 2LU2A 2W2PP 3PO4A 4CP5A 4MK9A 1N32F 2CQPA 2WBMA 2UXCJ 4K4YA 1WDTA 2VDHA 1RYSA 2A6MA 2ACYA 3HM9A 3QIPA 1UWBB 2LFVA 5KFUA 1UZDA 3MM8A 1HI1A 1GEHA 1QTMA 1LOUA 3BGRA 4C3LA 3Q8VA 3ILLA 2RS2A 3HHNB 3RB4A 4USWA 2OFHX 2ZBPA 1QAJA 1IKXA 4HI2A 4IH6A 9ATCB 2OTJS 3THPA 4O4RA 3AQPA 4C97A 2KXFA 4F2RA 1LW0A 1UVJA 5C25B 1VQPS 4YN3B 4K50A 2DVIA 3N5BA 2XZTB 3SDEB 1T03A 4XPCA 1NK0A 2LKZA 1VJQA 3T5HA 1SKSA 1HW9A 2WBRA 3EDRB 3UI3A 4ECRA 1RTHB 1NU4A 5DS7A 4MJKA 4O3SA 1J5EF 1KLNA 3WBZA 2XGPA 2W4CA 1KLMB 3ENAA 3N4WA 5A8KA 2QLFB 5IQQA 1DLOB 3VHQA 3Q8SB 2LQ5A 5HQLA 2NXUA 2RD5C 1C1BB 3O6QA 2NZCA 2ROGA 1SL2A 2I5JB 5IV3A 3OXGA 2XS2A 1SBRA 4ILRA 3BDPA 3OTOF 2DT9A 4F4AA 5K8OA 2XMVA 4AFFA 4YY3J 4N76A 5A8RA 3HFVA 4I68A 1H3DA 4PKDB 1FESA 1GXTA 3UDVA 3PYDA 2DK2A 3MM6A 3HPOA 3JXOA 2GO8A 1U1OA 1D9AA 4KTQA 1BGXT 1EKRA 1HPZA 3NGRA 3V4MA 1NH7A 1KHVA 4Y6IA 4DR1J 2QLWA 2O01C 2BOPA 1NPPA 3FBFA 4PQUA 3C8YA 3HMJG 3QJLA 2VBXA 2CPEA 1DQ8A 2H3EB 4ED6A 1JLGB 2FZGB 2Z56B 5C24A 2DHSA 1WELA 2ZJPQ 3GV5B 3A1YG 5K20B 4ATNA 2R7XA 1X5OA 1RT7B 1HI8A 2VFUA 4LT6A 1RWMB 3G96A 1L3VA 2IJRA 2EKNA 4O3RA 1FNXH 2D3ZA 1EX8A 5LXRA 3QMQA 1SL1A 1BLUA 4JV0A 4B3SF 4DR4F 1TQLA 3C16B 4KC5A 2ZBRA 2J8AA 4E2FB 4LMZA 2VIHA 4LSLB 1U02A 4OI4A 2DHXA 2M0GB 2W7AA 4ETXA 2V34A 2BJ9A 3M30A 3I4PA 2HYIB 4CZCA 3JYTB 1U8SA 2C3PA 2V9KA 3I5CA 3NMAA 2BV3A 2QA4G 1K73T 2HLUA 2ZC4A 2HNZB 3SSSA 3ZZ0A 4C48A 4USKA 3RB6A 1VQSA 4C11B 1FEEA 2D9OA 5AT1B 3HJVA 4TY9A 5IS2A 5AXMA 2ZNZA 2UUTA 3EZ5A 3BPDA 2C3OA 1XN9A 2HIQA 2JVRA 4URSA 4IFYB 1WG5A 4C0OC 3W61A 3W8GA 3HD1A 4P10A 1BY9A 4NX9A 2F3JA 4BC7A 5HROA 1M0SA 4N5SA 3DYAA 4PG7A 2KZZA 2QL5B 4CTAA 4QPXA 1MNEA 3LP1A 2CAJA 1R89A 1D1UA 2DGOA 3HF5A 4MYTA 5ETRA 2POKA 2ZFHA 3MTJA 1JLAA 5L46A 1JJ4A 2A18A 2VHGA 2WVFA 1PAUB 4DUZF 1HR0F 2DIVA 3OFFA 4KPCA 1TL1B 4CT8A 3V6KA 4XAKA 1JXVA 1S59A 4X4VA 5C5JA 1VQMS 2O67A 2F4FA 3OXLA 3IAS9 1XK8A 4KPYA 1RT1B 2OPRB 2RDDA 3FUYA 3ISZA 1FKPB 1F5BA 2CADA 4Y34A 1UAWA 3OR1A 4Y2MA 2VG5B 1Y5NB 2CPIA 2UVWA 3Q23A 2XLIA 2MJUA 1LWFB 4DR3J 1UW4A 5D0HA 4FKYA 3AA8A 2PFFB 4FS2A 4QPTA 3TUIC 5J1NA 3DGVA 3CD0A 1RT5A 2MZRA 3PM9A 5F3ZA 3EDQB 2B6AB 1JLEB 1MG7A 1MMLA 1WSVA 1SJ4P 5MAOA 2ZH5A 4OV6A 3VQSA 4F3QA 1QDUB 1CJKA 1LWCA 3L7UA 3WZ0A 2EFQA 2QLXA 1S49A 1N34F 1K0VA 4WFZA 5GMKa 5KAKA 1N52B 5GAEI 3VV2B 3F73A 4QIGA 4F4XA 1EP4B 4WFBQ 2FLPA 1FRHA 4YDXA 1HNXJ 2OUGA 2GJIA 1WKLA 2HHTA 3KKFA 5CYJA 4I0WA 5J2PB 2DRDA 1UA1A 3U1LA 3VVTA 2H4WB 1NPKA 1S6PB 2L48A 1FFWB 3PYGA 4ZLNA 1F2HA 2NCKL 2NXNA 3VAFA 4AL6A 2XY6A 4B9UA 4DV5J 2VD3A 1JLFA 4N8NA 2VG6A 2Z8QA 4KY3A 3NGDA 1AROP 1U1KA 5K8NA 1HLWA 1PBAA 1WF0A 3D4JA 4WZQA 4IG3B 3RB0A 1RQ0A 3BQ2A 3QRQA 3M32B 1IQTA 5CYMA 4TYAA 2IMOA 2AW0A 2D3OR 4WK3A 4B3MF 1FRXA 3FGVA 3PEJA 1S4EA 2MDAA 1R7IA 4PR6A 4ZITA 1X31C 4LF8J 3VF0B 4CNZA 3CO9A 3W63A 3OXFA 3G86A 3H5UA 1UJ5A 2BJDA 4R5PA 2MLZA 1B0TA 3AB4B 3QJPA 1UWAA 5IXUA 1NPRA 3T1HF 5KFKA 2DGQA 3PW5A 5FLXU 4M8LA 1YK9A 2AYMA 3RG6A 4ZCLA 3CJSA 3DMJA 5BYQA 1N33J 2DXFA 1APSA 3UNYA 4DI6A 2UU9F 4B9VA 2XWYA 4DV3J 3OD2A 3BS9A 4MKYA 1GMWD 1RAIB 5J1PA 4PWWA 1AZSA 1TV6A 2MPUA 4EYIB 1SPBP 3TA1A 4ZP9A 1TKZA 2FIUA 2HMIB 2WHOA 3BO2A 4FYYB 3FEZA 2YKPA 1TUGB 2BANB 3M8WA 4JI6J 3IR6B 4LF5J 1DAXA 1TK5A 3VCDA 3GFZA 4K4VA 3QAEA 1RT3B 4OHWA 4ANDA 3OR2A 3CCQS 1Z2ZA 3T6JA 2BE7D 1HYSA 1ZM4A 5JVHQ 1SB6A 4F0KA 1GAOA 4CDIA 1R6VA 2K3KA 1H74A 2W2MP 3IFEA 3GFXA 3L7OA 4G1QA 3U7JA 3GCXP 3TX8A 4DCOB 2IDEA 3DLEA 2E9RX 2R7TA 3FMBA 3FQLA 3L9ZA 4DG1A 3QZ8A 2V68A 4NZ0A 1QAYA 5KG0A 1IR2A 1U1RA 2IJNA 4Q2LA 2CXEA 4NXMJ 2CJYB 2E5HA 1U1PA 3LGHA 3CCJS 3L95X 2VB6A 4NLRA 3M6VA 4K4WA 1M1KT 1GXUA 1KEKA 5K14A 3BKTA 3MURP 3QSYB 2W9CB 2OSRA 1LKZA 4U7UD 4QU6A 2D9PA 3CDAA 1RZMA 3EGVA 3CC7S 4M5LA 1P9YA 5A2QU 2ZVSA 1X4EA 3UQSA 2DNRA 3NCQA 2QA4S 4FBTA 4K0KF 4KGZB 3GIJA 2YWKA 1Q4RA 2RJZA 2M88A 3D67A 5EX3A 1F5CA 4RNHA 1S6QA 4ENOA 4DDFA 3T19A 1RHMB 1XERA 3KHHA 1N4LA 2FVSA 2VC0A 1NRKA 2KHDA 1Q5YA 4RU9A 4U95A 4DX8H 2J9DE 4ECZA 4JI1J 2XLJA 5G0RB 4IG0B 4HKQA 4KV8B 1HQEA 1C2PA 4ZVTB 3ELHA 3RB3A 3W60A 5DZ7A 4WP9A 2DO4A 4PUOA 4C6AA 1GQEA 1Y3JA 3MEDB 2R8HA 1RAFB 1OY6A 2BMBA 4RNFA 2JEIA 5F8LA 4QR1A 3HDSA 4CH7A 1NUEA 2QT7A 1HQUB 2XZWA 1T9TA 3P45B 1XMQJ 3HZEA 4ICLB 3TZZA 2V8VA 4DV0J 1OS5A 2KFNA 2Y3YA 4IQMA 1FTCA 1HNIB 5HBMB 1TL3A 2DNQA 2WK4A 4QWCA 1U1LA 1X9MA 1A0OB 2UUAJ 1RBLA 1QJHA 1U0HB 3EXYA 2G4BA 5A6WA 2RE1A 5IM0A 1CULB 4NLXA 2G2YA 5KFPA 2GCFA 2XSJA 1DZ5A 5KG5A 3BPSP 1WC3A 3HHDA 3LALA 1OSDA 3CDBA 2LQ9A 2DCLA 4PYAA 3GTYX 4DZDA 4FKXA 2BJ8A 3P6YC 4O44A 5HJYA 4CIOA 1WDDA 1YBUA 4AQYJ 2AEJA 2VASA 4C8ZA 2OJ3A 3CCTA 4WJBA 2KYXA 2YKAA 1YTYA 3NOGA 1FRKA 2V4JB 2VA3A 5DLGA 2HFUA 1BXNA 3M8QA 4USHA 2FQQB 2HGMA 2Y1JA 1H7XA 3BO3A 3DHXA 5C2CA 2ZD1B 1CPZA 2FVCA 2Q3PA 4C8LA 3SQOP 1MU2B 4USJC 2RRAA 3LWLA 2IM2A 4WYLA 4F4WA 2JLFA 3CJKA 1TKXB 1YZ7A 3M2RA 4GRSA 2PD1A 3MEEA 1FEHA 1X5SA 2HWTA 4UOGA 1GX6A 4ZPCA 1U26A 4ITSA 3S6EA 2VJVA 1U24A 3MR5A 2FJBB 4DR6J 4OZ0A 5KFRA 3K8VA 3PV8A 2IMWP 1SKRA 4LRCA 2G1HA 2YKMB 3D7SB 5AJ3F 4JB8B 4DV2J 2PEHA 3DGPB 1URNA 1NDLA 3QBCA 1R8CA 2X1GA 3KLGB 1KD1T 4M94A 2QFJA 3DLHA 3NEKA 1UVNA 1F9EB 3MUMP 4YDDB 1KS2A 4YHHF 1IN0A 2MTLA 3BSOA 2DPJA 4F2SA 2B51A 3N9UC 4W92B 2CPZA 3QIDA 4K4SA 4ED1A 4OZLA 5DQIA 4WK1A 2JLEA 2YWHA 1B7YB 2E5LJ 2HKEA 3B78A 1ZTWA 4G1PA 2HIYA 3N01A 2QYCA 2YX7A 2F9JA 4QYZK 5CYQA 3KLIB 1X4GA 2WOMB 2CDQA 5KFOA 4ZLJA 3IS9A 1L3TA 2FHJD 4DV4J 2ASDA 3TVZA 4UQTA 1VK8A 3ZTOA 2J8SA 3D6FB 3G71S 1Q5VA 2A1BA 4ECXA 1Q1KA 3CCRS 4LVNP 3ZZYA 3KK2B 1RJJA 4Y28C 4ZLLA 2F4VJ 3BZQA 3QO9B 5KFEA 1Y5LB 4CLKA 3R6GB 1H38A 4UT4A 2VPXB 3NNCA 3EGNA 4X64J 1I94F 5J2QA 3QJJA 1IKYA 2BACA 5HLFB 3VZIA 3SZ2A 4NLDA 1NK4A 1YSJA 2MHNA 1B64A 3DRRA 1RBOB 3J80Y 2JX2A 1S1WB 2MY7A 4ES3A 5J2NB 1SKUB 2HFSA 2QC3A 2MZQA 4NOHA 2XWXA 3IRXB 2EPIA 2BM0A 4AL7A 4OJGA 2YBVA 1AUDA 4Q5VA 2HHHJ 3UWTA 2IRXA 3JQJA 2E5JA 2MKHA 3QAUA 2G0IA 4OZ5A 5CA5A 3WHIA 2MQOA 1IXKA 2OIHA 4R25A 3HHLB 4ZHRA 3PW7A 3ETOA 3UVJB 1CJTA 2C42A 1LWEB 2KKHA 3TAMB 3CMAS 2AYGA 1T9YA 3O3LA 3VAKA 3FSYA 5LMUJ 4RW8A 2CPXA 3CIZA 1FK9A 1WC4A 3IBCB 3SFGA 4OHYA 4IH5A 1NBEB 2Y0SD 5B0GA 1FHTA 1S1VA 2BE2A 2V94A 3VAMA 3S1TA 4YY3F 1IBKF 3MM7A 2RILA 2N4CA 2B8QA 2Z4PA 4EYHB 2OEJA 2KT3A 2QV6A 3OL9A 1XQIA 2F5GA 3UD3P 4OYBA 3UNGC 2YNGB 4F36A 2UVUA 4DMZA 3E3XA 3HI9A 5GAEU 3W5XA 3MEKA 4DR1F 3ZC4A 2CG8A 1SQFA 3BV8A 2XQCA 2EEYA 8RUCA 1RE1B 5I42B 1N88A 3H90A 2ZVIA 2J7KA 1S1UB 1RWPB 1DTQB 3GQCA 1C1CB 2FB0A 1NSAA 5J1EB 3AT1B 2PGCA 3CJ5A 1HNZJ 3DCAA 1PJ7A 2Z30B 4LFBJ 1RUSA 3GR1A 3HT3A 2HQGA 1RT6A 3DOMA 1NKCA 1VS3A 7AT1B 1QE1B 1W25A 1A7GE 4NLVA 2ZUAA 3FMWA 2OPSB 4HT5A 2B9WA 2ABYA 5IT9Y 2EC0A 1RB0A 3VTIA 4Q8EA 5IOLA 3MFIA 3D66A 2VFTA 4NLPA 1C0TB 2V4QA 3CCWA 4JV5J 3D0GE 3PIPQ 1XEZA 2DEJA 3MF5A 3WX8A 2A2CA 1CG2A 3UCUP 2ZOMA 2ZHAA 2E7XA 1X4BA 4NMXA 5IC4B 1V3RA 2MHEA 2KG0A 2AYBA 3SSQA 3BB5A 2NUUG 4HR2A 3V6HA 4RBVA 1S0MA 4FPIA 2HLTA 4CYUB 4DXLA 1UA0A 2GAGC 2MZTA 1KP6A 4QWAA 3JQKA 5T7LA 2GQQA 4AXJA 3MEGB 2GVDA 3MOJB 1RABB 2WONA 1ZTTA 4K4XA 1FVQA 1RA6A 3I87A 3R5BA 1IBLJ 3QWPA 2W8LA 3CVKA 3TJ8A 4QR0A 2MGZB 2XTJP 4WKYA 6FDRA 1NB2A 1IR0A 3LP1B 1FTRA 2FVQA 3DI6A 2B7CB 3PTWA 5F3TA 4IO1A 2EW9A 4FNHA 3KHRA 4EWTA 1RXOB 3M9MB 5A8WB 4NYPA 4O3PA 2VQFJ 3F56A 1OY9A 2KI2A 4KAIA 4WF9Q 4QIVA 3TJ9A 1VQ9S 1RTIA 4X62J 1HBOB 2QFIA 3J7Z5 3MMAB 4DS5A 3DOKA 3PX0A 2LQ8A 5DM6Q 2FJAB 5EUHA 1N5QA 3H4BA 2FJEB 3WQPA 2X7IA 2MQNA 3E51A 2DB1A 1MWYA 4WXWA 1N5VA 1AYEA 2DGWA 3VGUA 4GO5X 3KK3B 1LFPA 3I56S 4NCGB 2FZCB 3C15B 2HS4A 1HBNB 2D69A 5BYSA 1UWBA 1NDKA 1FF2A 2LEPA 2RVJA 4DR3F 5D15A 3LGMA 4RBTA 2H5JB 3BBBA 4TU7A 2W01A 4LF4J 4LIRA 3UO0A 4AYBD 3GJTB 4OI6A 4DWIA 4EZ9A 2HRYA 1PBUA 4EK2A 3NAHA 5B7WA 2YH1A 5C25A 1NK5A 2OO4A 3SCKE 4A8SA 3MR3A 3SDEA 1UEKA 3R1LA 3MM5B 4RPFA 1CSJA 1WEZA 4URGA 2GZOA 3BQ0A 3OJSA 4JI0F 4LBIA 2IVYA 1RTHA 2B0GA 1BWEA 2F7VA 1BHNA 1HNXF 4OZ1A 2KTQA 2R2RA 3VZHA 5HMZA 2NSCA 3CWJA 5HANA 3IA0A 1HD1A 1VC5A 1KC8T 1KLMA 1NLKL 1P1TA 2JC1A 4XDDA 1DLOA 1M5PC 3OVBA 4ID8A 3CD5A 2HQ3A 2DD8S 3RRHA 1UCNA 3D2WA 1C1BA 5H9FJ 2I5JA 2DNHA 4J9RA 2XMMA 3PW4A 2RH3A 3OTCA 2OH2A 1RDRA 2D41A 3BN4A 4CM2A 4J9PA 2CFXA 2JWNA 1NJXA 3QGHA 4P75A 4RW4B 4JP8A 3KFWX 1S0VA 3TNVA 3AD8C 4FYXB 1U2FA 4IH7A 2R2UA 4DX7A 4DFPA 1F6TA 3DDIA 4U9RA 2HS0A 1NHUA 3IR7B 2A3JA 1S79A 3LQVA 1P1LA 4R5PB 4ZPDA 2RNEA 2QLJB 1A6LA 2E1MC 1Y11A 4NLWA 1X7VA 3LP2B 1HBMB 2Z2YB 3R2CJ 1JLGA 1Q7YT 3T1AA 4NYZA 4TXSA 1TL7A 3FRZA 1SXLA 4DR2J 5F9LA 3QPIA 2MYFA 3PW2A 3R2DJ 1DQ9A 4J9QA 5ETSA 1E6VB 2RUSA 4WFYA 5L39A 4IFVB 4W98A 2EFOA 1RT7A 4O4GB 2VC1A 1VQOS 4OHZA 1R6YA 5F8JA 2GGPB 3FK4A 1TV6B 4AXIA 2QJ3A 2D3UA 2G13A 2FLLA 3I0RB 4IOCQ 4S0MA 3NGUA 3QFWA 3RR7A 4NLUA 4HYKA 4DQSA 3C16A 3KMQA 4P7VA 5CCMA 5I3QA 5K8MA 4LFAF 1H2UX 1SC3B 2BVZA 1YG0A 5KG1A 1YJTA 1FX2A 5EGYA 4TVAB 1YIJS 1KFDA 5B0BA 3DOLA 2W4DA 2MSSA 4JI6F 4QIEA 4RUHA 1H2TZ 4LF5F 4DSLA 3SBMA 3KJQB 2U2FA 4RJVA 2NR0A 2IDLA 3LF0A 2V2QA 1NMEB 3NY0A 1J5OA 3JYTA 1FXRA 1LK7A 3R7SB 2HW3A 4FXVA 2PMWA 1S9GB 3MMBB 5CD4A 2HNZA 3M8ZA 2OMLA 4C11A 1UKUA 3C14B 4WCEQ 2GHWA 4C8MA 1R43A 5SZTA 1XMOJ 1LEOA 2COLA 3CE8A 5K14B 5A76A 2QEXS 3ZFVA 5FDLB 4OFZA 4YR3A 3UDLA 1DFDA 2ZITA 4IFYA 1S99A 4DR7J 1M5SA 2O66A 1M1HA 4DSIA 3MXHP 2OHDA 2JFDA 3A3PB 1S6UA 3D5MA 4PG6A 3M05A 4ZVSB 4NLOA 3E2EA 1KVJA 1N5SA 2WZ1A 2HFZA 2D3O1 1WJ9A 1WI8A 3DFEA 1ZH5A 4QWDA 1VRTB 3MTKA 4A8OA 2GJFA 4ZK7M 1TL1A 1FJGF 3QYYA 4LQ3A 3NCRA 2V69A 1HIYA 4FVMA 1YJWS 1WI6A 1QSSA 2HURA 4ZMMA 1RT1A 4GC6A 1OY8A 2OPRA 4U6PA 2QL7B 5I3PA 1FRMA 3KLFB 3JSMB 4ZVPB 2E1CA 2VG5A 1XIQA 1LWFA 2DRBA 1MN9A 4KHMA 2H54B 2HS3A 3OUYB 5KFYA 5AXKA 3QQCD 4LF6J 3ZNUA 1F5AA 2CQDA 1RLDA 2G0JA 5D78A 2B6AA 3K17A 3A3NB 1Y0HA 3EVMA 4RX6A 1RGVA 2XMTA 3P5BP 4F3MA 3UCGA 4F4YA 4ERDA 3C3LA 2MLXA 1VGYA 3CW2C 5GAGI 2HFOA 2KL8A 2P6SA 5FLXY 1SIWB 2UUAF 4C0HA 2BQUA 2KG1A 1K1QA 4USTA 4RW7B 2L9DA 1BMQB 1EP4A 4KGKA 4GMKA 3CC4S 3EUNA 3TEGA 3KG0A 2E9ZA 5LJ3Y 4KRWA 1SC4B 4E0DA 3FEYB 4DSKA 3TUZC 3IM9A 5J2PA 3NG8A 1RAAB 5H9EJ 1FA0A 1YGYA 2DGXA 3D0IE 3QNWB 1S6PA 1N5TA 1U45A 2ILZA 1IKWB 4ZVUB 1RAOA 3H2UB 2VA2A 3FBCA 2YKOA 4OL8A 2IBOA 2EC2A 1NSPA 3ADAC 1PKUA 1KKHA 2WB1D 4RR5A 1J2VA 5H1SV 4B3OB 2MQ8A 2DTJA 4RUAA 2MLYA 3AFGA 3RRKA 1WC6A 1TP7A 1JNZB 2QYGA 4IG3A 2J7WA 1E6YB 1VQKS 1R0AB 2XLKA 4CO2A 4C8YA 3M32A 2CPYA 1LNQA 4KH0B 4IKAA 2XHCA 5T41A 2AGQA 2UUBF 4B3TJ 2HK3A 3ILIA 3GYNA 5E7OB 4ED4A 3DU6A 4H4MB 2I38A 3DLJA 3R7BB 2AZ1A 2V8DA 1ZM9A 1N36F 4JV1A 2XC9A 1V3ZA 2AEMA 3H25A 3D1HA 3SSRA 2PI5A 3M8PB 1X4DA 2ZC3A 1V3SA 3DU5A 2HBYB 2RU9A 3ITHB 2JNJA 4ZLPA 3AB2B 5KFWA 4LRDA 5A2QY 4F50A 3RAXA 3JS9A 4AUKA 2EBEA 2IM3A 3BREA 3SFUA 1RA7A 2ZBCA 3M1VB 1ULRA 4E8UA 5G4DA 2MEWA 1T9XA 2OAUA 2BW7A 3WDOA 4DFKA 1YRXA 4KIAA 2LU1A 3M9NB 5DM7Q 3GIMA 3RTVA 3UW1A 3C6UB 2FD2A 2OPQB 2DISA 4C9DA 2CKWA 1W2BR 1F3FA 1UVKA 1NK8A 2BANA 5M2PA 4XIUA 2DNZA 4X4NA 4DX6A 1SIZA 1RT3A 1U25A 2ZH6A 1FKOB 4ZOSA 3MM9B 2XMAA 1ZA1B 1KQGB 2I6WA 2GAHC 4M5HA 1HWJA 2XI2A 5ETKA 3AXMA 2DGTA 2BEFA 3K59A 4ZVEA 3IMQJ 3V4IB 5EN1A 4PCQA 7FD1A 4J7CA 2XMJA 1S0OA 1U4BA 1MSWD 3DRRB 2HAIA 1S72S 2HHPA 3U27A 4EBDA 3KG1A 3TW0A 1K9MT 3AD9C 5D0GA 4PQAA 4I7FB 1H98A 4GKKJ 4PG8A 1ZZFA 2W9CA 2HHQA 4LJMA 4C8NA 2IAJB 1QSLA 1AW0A 4PXBA 2HWIA 4H4OB 1PYSB 5M2UA 2LA4A 1HNWF 1DTTB 4KBIA 1IKVB 1HWUA 1DRZA 1Q8BA 3D68A 2IYGA 2NXJA 2CQBA 4F04B 2VQEJ 1NEEA 3PNIA 5BXIA 3L4BC 2KFYA 3S7RA 1U2RA 4OI0A 1B70B 4HL9A 2Y9HA 3ZTRA 5ITHA 3HKWA 5G0RA 2V4RA 1KBRA 4IG0A 3N79A 4ZJLA 4BBYA 5IC6B 4KV8A 2ASYA 4BCAA 3K0JA 2BJ3A 4WU3A 4MKVA 4Y2AA 5HMWA 1FKAF 3MEDA 4LF7J 2WW8A 5IV4A 4ZVRB 4DL2A 1VHIA 1G2EA 4YB6A 3N5FA 2Y1RI 1HQUA 4GKJF 4P2MA 1OWXA 4ICLA 1PJ5A 2AF6A 1XNRF 4ECTA 1HNIA 1H72C 2AJ1A 5HBMA 2BJEA 4OI3A 2V0NA 4ED7A 2KO1A 3JTPA 3CJQA 1U0HA 1CULA 3AOBA 2RS8A 2BW2A 2JZ5A 1K1SA 3DN9A 1XNQJ 5E0OA 1RWVB 4NZ7A 4X66J 4WIIA 1D0EA 3HCXA 3GPAA 4ELUA 1D09B 3ZZRA 4ZPAA 5KFAA 4ZS6A 2C2EA 2HVHA 4J9NA 4QOTA 3G6YA 4HHJA 3IBWA 1FVSA 2IVFB 3S8SA 1S0NA 1WUUA 4JOUA 3TA2A 1VBXA 2C2OB 2YH0A 1N6QB 4URQU 1SJ3P 5B09A 3BGLA 2V4JA 5D3GB 5DO2A 4PABA 3TANA 1NJWA 1Y9OA 2Q79A 1KOOA 1ROFA 2ZZNA 3VAGA 4ED2A 1K8AT 1ZM3A 3MAAA 4UOHA 4CLWA 1MU2A 3CJRA 2VOOA 4OX6A 4PG4A 1TKXA 3I82A 4P2XA 4A48A 2DO0A 1LV5A 3QWUA 1VMBA 4MIWA 2QA1A 4WP8A 1F2GA 4X2BA 5KT6A 2F1FA 1X8DA 3R5CA 4WIQA 2ALYB 3G8TA 1Q53A 3FCVA 2W24A 5DDOC 1S77D 2FHMA 4YMEA 4Y00A 3SIPB 2YKQA 2ASLA 2LEAA 1C0UB 4B3RJ 3QGPA 3UPFA 3D6MB 5GMDA 2J6SA 2YKMA 5F0WA 2HK2A 3O8WA 4OHXA 4NE9C 3LAKA 1QUPA 3DGPA 3LP0B 1YRUA 3KLGA 4Z7CA 4ER8A 4NWBA 3A12A 1LXJA 2CJXB 1NHKL 1QVFR 2YPYA 1TK0A 5KG6A 1NHVA 4NEYA 2H51B 4KHPJ 1NDPA 3OLBA 2F8EX 3OFHA 4J9MA 5GVQA 1RWKB 4ZVFA 4EMDA 3UR3C 3SI8A 3IM8A 1Z2LA 4FS1A 3P8BB 4YB7A 1T9UA 4X62F 4RUBA 3I0SB 4ZN3A 2OSQA 1UMJA 3KLIA 2VFVA 3RBZA 2DY1A 2WOMA 1Q79A 4ES2A 1U1NA 2CPDA 2OP5A 5DLFA 5HK4A 3BH7B 4DPYA 3OTBA 2AYEA 2ZM6F 3Q89A 1J5EJ 4ZCIA 1JKHA 1GMUA 2FPHX 2B7BB 2N3OA 1MMDA 1PIEA 3UR0A 2RT3A 3FZ2A 2FJXA 1RCOB 4GVLA 3G9CA 4TYBA 3EX7B 3KK2A 4JI8J 2F40A 2CPHA 3M8RA 3QO9A 3FDSA 4OYPA 4TLQA 5HP1B 1YQHA 1D8YA 3ICLA 1VQ5S 1FFGB 3OTOJ 2C28A 3P3DA 4QW8A 2CNNB 1SJRA 3KLHB 4LF9F 1N8RT 3AAWB 1T05B 2MQQA 1NM2A 5HLFA 1RHUB 5E3CA 1RT2B 2GO9A 2FTRA 2B4PA 4CLZA 1VRQC 3GG0A 3KDOA 2NYIA 4C2MA 3D9BA 2UUCF 3N0VA 1S1WA 4DN9A 3CJ3A 3PRDA 3G6XA 5J2NA 3BGOP 3IRXA 1GXLA 1LQ9A 4IRDA 1CC8A 1UFKA 1RKJA 2DNOA 3RRGA 4IQXA 1VQ7S 3MGJA 2YX1A 2H9ZA 5CHCB 4BWJA 4OMFG 1VHFA 3HHLA 3UVJA 4GVBB 5GADI 2O1PA 4NZ6A 1LWEA 1DJ0A 4X4TA 3TAMA 5KT4A 4RBUA 5HMYA 1HBUB 2WAQD 3UN5A 4YFUA 4A8MP 4OYAA 2AJ4A 4FYDA 4X84A 4G1IA 1BD6A 1XR5A 4ZVHA 1ZBTA 4ELVA 4OZJA 2CJQA 4JI4F 3K57A 8ATCB 3NWGA 2DNPA 3LOUA 2FJDB 5KT5A 2VG7B 5KFSA 4LR8A 5LSOA 4B3SJ 2WTFA 4DR4J 4ANCA 1TL5A 1KFSA 5GAGU 2FC8A 4NRTA 5ETMA 2M7SA 2R8KA 2YNGA 1EKSA 3W1YC 1N48A 3O44A 3IN5A 1WD6A 4ZKAA 3O5TB 2X3GA 4GO7X 1Q82T 2W7OA 4NA2A 1BE4A 1Q95G 3KJVB 4I1TA 1I1GA 5KFJA 2H5EA 2RDIA 2N4DA 1W7WA 2X1AA 4ILMA 1R8AA 5ETVA 1I3OB 1TL7B 2HGLA 1EETB 2CQIA 2YQ1A 5I42A 3E01B 4RW6A 1S1UA 3OQ2A 1DTQA 4QZVB 1C1CA 3VVUA 5J1EA 3FVYA 3TARA 2O5DA 1RWUA 3IO1A 4J9LA 3B8HA 4ECVA 4ZP7A 1JLBB 4JBCA 4NCBA 4H4KC 4CLPA 1UZHA 3CNQP 2GVZA 1QE1A 1GFWB 4YB5A 3PRBA 2DHGA 2OPSA 3R5AA 2XI3A 3RAQA 3EGZA 4CLYA 2PFDA 3IRWP 2MQMA 1FWKA 2NS1B 3CO0P 2FY8A 1QD1A 4F4KA 3GSDA 3TUPA 3J7AN 1MLAA 1C0TA 1REGX 2OD4A 3ILOA 2R8JA 3DOLB 1NKBA 2B5JB 2YKNA 1X4FA 4FXWA 1IUJA 1NCLA 4KO0B 1AB8A 3FCWA 1J5OB 2HEKA 2SXLA 2UXBJ 4M5NA 3VGSA 4LSNB 4TNOA 3N6MA 2LXIA 3L09A 1P9QC 4NYOA 1MN7A 4I2PB 4IYQA 4DUZJ 1HR0J 4C3KA 2PA3A 1VQLS 4CYUA 1GTHA 2GS8A 3A8EA 4MT1A 5D77A 3KHGA 3PIOQ 3SQGB 2IC3B 3UD4P 5DG8A 3OVAA 3MEGA 4KKOB 2ZWOA 1HMVB 3RW6A 4LF1A 1NJZA 1VLYA 4DN0A 3LAMA 2CQ3A 1NSKL 2F63A 3Q2SC 3M2UB 2N3LA 1FE4A 2MGZA 2MKKA 4A4JA 3ZZPA 4TQRA 3WC0A 4DR7F 2R3VA 1VBZA 2EG2A 4WFNQ 3H5XA 5A8WA 3MCNA 3H98A 5HVGA 3BBFA 2Z0GA 3ENQA 1TELA 2GJ2A 3Q83A 5DDRC 1N34J 1VBKA 4K5SA 3W64A 1HBOA 3MMAA 4ZVGA 2XS5A 3H2LA 1XC9A 5D0RA 2A2DA 3R7NB 5CD4H 1ZPWX 1RTDB 2KJWA 4DSEA 4OX7A 1WOSA 3CD7A 2J5AA 3CDEA 3LH2S 1X60A 5L9NA 2I8EA 3SMZA 3ETMA 2G2OA 5KFVA 1ACMB 1TMMA 3HFKA 3KK3A 4NCGA 1AFJA 3C15A 2YNHB 1P6TA 4LFCF 1HBNA 4OHVA 2JH3A 4R0JA 3QATA 1QAIA 2ZE2A 1PAEX 4JI2F 3NBPB 5ADZA 1RP5A 3T5LA 4IR9A 2VFSA 4RWXA 2YWFA 2LQJA 2CRLA 2PMHA 5KFDA 4LF6F 1B0PA 1S10A 1C4CA 3P4UB 3HX9A 3GCWP 1REVB 2AX1A 1VFJA 5RUBA 4KJIA 3TZWA 2MMYA 2YY3A 4P52A 1RADB 2B9XA 3G6ES 4Z2XA 4Q43A 3J7ZT 3FSIA 4OQJA 2BKNA 4RWWA 4DUTA 3MM5A 2M8HA 2EFNA 4ZPTR 2MKSA 3LWMA 2RQKA 2L9NA 4CRJA 2P2CB 1KQKA 2X51A 3U1NA 3FC9A 4F8RA 1EIYB 5F8NA 1SJQA 1RU1A 1Q8KA 5LSLA 3MDFA 3I5AA 3BM7A 4DS4A 1GT8A 2I9SA 4DCJB 2GHVC 1VQ8S 3HSJA 2BE9B 3BKFA 1B7FA 5B08A 4CH1A 1YX2A 2FVRA 4CLUA 2ATCB 4DV6J 1L3KA 4XTTA 4Y3CA 4J9KA 3TR5A 3ZZUA 4HACB 3DXSX 2QX0A 4LQ9A 3KK1B 3EJMA 3KXDA 4RW4A 1R3NA 1X5PA 1EB0A 4HLBA 3B6BA 2GIQA 3L7PA 3W2VB 2KH9A 3TOQA 1KDNA 1KTVA 2VBZA 2BQ3A 2DR8A 2CIMA 4EBEA 3OTEA 4B3TF 2HNDB 4KH1B 4HHHA 1FRJA 2BZ2A 2LDYA 3Q86A 3PRVA 1Y7PA 2EFPA 2EBGA 3G2XA 5HVHA 1IVZA 3LP2A 2IRYA 5D0EA 1HBMA 2ALZA 2LQBA 1YLXA 2DGVA 2ACMA 4PWUA 3PW0A 1KWMA 5B0EA 1CJVB 4F26A 2CZ9A 1D3WA 4TN2A 4AD6A 2Q1LA 1E6VA 2NYHA 2M70A 2PN6A 1RAEB 4IFVA 4O4GA 2XGQA 3GFYA 3X3UA 4PXCA 3WIUA 2GIRA 4U67Q 2KVIA 3CIMA 2GGPA 2QMXA 2J0WA 3I0RA 2NQPA 2R7OA 2XCPA 4JI3J 1T7PA 1R31A 4CO3A 1QLNA 2W7PA 3PKYA 4P71A 2AHOB 2KRBA 1A9NB 3PR4A 5M2RA 3CJ0A 5DGBA 4XO0A 2HBRB 2CNOB 4K0KJ 9RUBA 2Z2MA 2A6OA 3PYEA 1DQAA 4W90B 1EZZB 2OGUA 2DNMA 4CLTA 2IBKA 2A10A 2HVEA 2M3DA 2MKYA 2V63A 5BR8J 1S9GA 3VGTA 3MMBA 2UP1A 2C2NA 3IWXA 4LRFA 3MPDA 3RGIA 1XWLA 1N54B 4M1KA 3A13A 1Y3KA 3C14A 2D7SA 3EE3A 1RHQB 2DNYA 3M7VA 1CJUA 3UD5A 5IWAF 2MJNA 4XDCA 2HZAA 4JYAF 5E2QA 4LRAA 5FDLA 4YR2A 1L5UA 5DDPC 1NO8A 4RNNA 1VK3A 2M2BA 1S12A 1FJCA 4A8XA 3NS5A 3OPKA 1AA1B 3CTRA 1ZYQA 3TA0A 1RHJB 4MFBB 4RU2A 4UY8T 2K06A 1N56A 1YJUA 1S1XB 2G2ZA 1U6FA 2J0SD 5HL7Q 4RLEA 1FDAA 3C6TB 2CVIA 1I5OB 1YBAA 4IO9Q 1IJEB 3AHPA 3M2VB 4H4KA 3H5YA 4HTIA 3G8QA 1VRTA 1M5HA 3OL8A 3VALA 4DQPA 2Z2ZA 3PDNA 3I9ZA 1NNDA 4DPOA 4FNIA 2JRSA 3LA0A 4JV2A 3M8SA 4OX9J 3H2VE 1S6OA 3AD7C 2YVSA 1HHTP 2EFGA 5A0YB 2BRLA 1VI7A 3KLFA 2G1DA 3JSMA 2HGNA 2YWEA 1TL4A 1NK9A 2X3DA 4LF7F 3VWSA 3KOAA 3OHBA 3SV4A 3OUYA 1U6ZA 3Q8RB 3CF5Q 4FYVB 2V67A 4WTOB 1R0BG 4NLTA 3GILA 3LTOA 2XYHB 5L9XA 2VKRA 2R7VA 4O3OA 4X4OA 2HQCA 4D3GA 1TTHB 2E1AA 5GADU 4RW7A 5KOWA 2VONA 1PJ6A 5THWA 3T9NA 1FWLA 3KUGA 2Q66A 3H5SA 5KG4A 2B9EA 2O3DA 3H40A 3K5LA 3HHKA 3RUBL 4K4TA 3ZO7A 2XMUA 3Q8YA 1MROB 2CNKB 5LT5A 5DETA 4I6AA 3RW7A 2G0CA 3KLEA 3CDWA 3TP2A 3BH6B 4WXOA 4NXNJ 3M8YA 1SV5B 5AJ3J 1IWGA 4X4PA 3F41A 3KLVA 5E3QA 4NEZA 1IKWA 4QQBA 3TO8A 3T1YJ 1SI9A 1OSCA 4CO0A 4Z7YA 1NZAA 3IG1B 4IDKB 2R7QA 3MPWA 5FIIA 3PXGa 4ZA1A 3BKUA 3X1LB 4J9VA 2KRRA 2DPIA 4B3OA 4A8KA 4YHHJ 4P2SA 5L38A 4LRBA 4DFJA 3DKDA 2AGOA 3ENWA 3MAAB 4LREA 2PC6A 3B4MA 1HWIA 1E6YA 3TAQA 4FXDA 1IBMJ 3PJWA 1R0AA 1JLQB 1ZAVA 2E7WA 1KQFB 3T9ZA 4LR7A 4C7QA 3KWMA 2C3YA 3D6TB 3OT9A 4DUYF 3UN3A 4OJ1A 2XULA 1NB7A 2G9OA 1RAJA 1JNRB 3SCLE 1R0CB 4OI1A 2PSZA 1CBKA 1SC1B 2DIUA 3RU0A 2Z2LA 1P27B 4H4MA 1TK8A 4HT7A 1U8WA 4HTJA 4EGLA 2CDRB 4DX5A 3EM1A 4A8QA 2L3MA 2MB0B 3PZPA 4L76A 3W5ZA 4F67A 2QMUB 1WSRA 4B3RF 3M8PA 2AJQA 5D4LA 1G7CB 2ZH7A 3CMQA 4B02A 2IRUA 4BC9A 1B4SA 5EX0A 3ITHA 2AD9A 2W8KA 4JI7J 2NXEA 3TX0A 1I94J 1YBTA 1UVLA 3WIVA 5HMXA 1JQGA 5EHHA 3JSBA 3M1VA 1BQXA 2EI5A 4KHPF 4ECQA 3ZTQA 3GMGA 3RBDA 2QLBB 2IPOB 2DGUA 3C6UA 4FPRA 2HHXA 2OPQA 4UZCA 2KYZA 4BWMA 1N5YB 1S76D 2DNNA 4O23A 3FEXB 4OLOA 2R9LA 2MY8A 1CS4B 1Q16B 1ICEB 1JKHB 4LSZB 1FXLA 2WVDA 1KSPA 1RWOB 1EHWA 1U7LA 2UXCF 3EVOA 1KNZA 2BM1A 3D1OA 2CQ2A 1HQ2A 1FKOA 3MM9A 4R8UB 2GMLA 4F0HA 3CC2S 4M5MA 2LMIA 2HBZB 3ZZZA 4WZMA 4KGMA 1X0FA 2GMJA 5I4MA 2VU5A 1L3SA 2QN6B 5B0AA 2PEBA 2V2VA 1RBAA 3HVRA 2CA9A 5CQGA 2NXCA 1OPIA 3V4IA 2HBQB 4OI2A 4JI8F 2VPWB 2V6AA 1RWXB 4EFAC 1IBKJ 3NWRA 2XBPA 1SQGA 1T11A 2AMCB 2PE8A 5H9FK 4DL5A 1H0HB 2BKPA 2LECA 3IWNC 4I7FA 1HARA 3H8YA 5KFXA 3HJFA 5KFNA 4RW9B 3A8KA 4CCHA 4C8KA 2IAJA 1FRIA 5D4NA 4MYUA 3HLUA 2EK1A 1KRPA 1TVRB 3G82B 4UOFA 4H4OA 3QT7A 1V9OA 1JLCB 2GHPA 3NMRA 4G3IA 3C2PA 3K58A 3RR8A 1WHYA 4F7VA 1DTTA 4U8VA 1IKVA 1S7IA 3KJFB 3DRPB 5I3UB 3POTB 4EI2A 4OV1A 2LLZA 3MCOA 1YDLA 2R7SA 2AZ3A 3TVKA 4WWSA 5F8HA 3SYZA 4I4BA 1D9DA 2QE5A 1RTJB 3CJ8A 3QSIA 1UVIA 4YOEA 2HZVA 2MQLA 1P8GA 1WKJA 2ERRA 4BHQA 2K2PA 1I51B 3HVTB 2RF2B 1YJ7A 1ZPVA 2NZ4A 4MIBA 2C1EB 1URRA 3PVXA 2UUWA 3BBCA 4X4QA 4ETZA 3FFIB 2K3IA 1T02A 1DARA 4QU7A 1HL6A 1AFIA 4RO0A 1FT8A 3OW2R 4K7QA 4QJVA 1XMBA 2XY7A 1WTBA 5KFCA 2R8IA 4H54A 4KFBB 2YWGA 4RW6B 1OQ6A 2DGSA 5CZXA 1M90T 2V8PA 4TLRA 2FLOA 3TUJC 4TQSA 4F0MA 4U8YA 4X4SA 3V6DB 4DLGA 2B9YA 3OSPA 1ZZNA 2GVZB 2R4FA 2L9WA 4X4RA 2U1AA 3T5JA 3OJUA 2GNKA 3AOAA 5LXYA 2PDAA 1QUVA 1S1TB 2RU3A 1VYAA 3PCOB 4QR2A 2ZBQA 2AJ2A 5KOXA 2C3UA 2WCXA 4HVZA 1FXDA 1R8PA 3BGUA 4A47A 4CO5A 3EMTA 4ZIVA 2KXNB 1VBYA 3ZZTA 2ZEJA 4WFXA 3JQMA 2YKNB 4CO4A 1N6QA 1WC5A 3PJXA 1R8HA 3QRRA 2MKCA 1TR0A 4UQGA 5D3GA 2JVOA 2RRBA 4NLSA 3BN7A 4AE5A 3NS7B 2R42A 3ZNJ1 1H6KX 1T3NA 4G65A 4UF4A 4Q0BA 3ONQA 3W8PA 2K7KA 4TY8B 3BEGB 3ZXWA 2UXBF 2ROEA 1IWAA 1F9HA 3FSXA 1JK9B 3K8WA 3H4DA 4K4UA 1H7WA 2PO4A 1T95A 3NXZA 2UVRA 2JSXA 4Y0FA 2EXUA 2QGFB 3O1LA 3AJ2A 3GLJA 2DCUB 3R5GA 4F4ZA 4ILLA 1C0UA 3DRSB 3MD3A 2IJFA 2HZCA 1S9EB 3ET6B 1FX4A 1T9VA 4LIWA 2J0XA 3LP0A 2HFVA 2OELA 3PHTA 4RZRA 4NPOA 2DXEA 1KOHA 1LW2B 2VV5A 4DPTA 3UDCA 4OX8A 2FJVA 2PMZD 4DPXA 4LBPA 1YWXA 4B9NA 2GIFA 2DJWA 3R3TA 2CJAA 3EVWA 4PWDB 3U1MA 5ETQA 4J9UE 3SCIE 2IA6A 3HKZD 3MECB 2QTWA 4HDGA 3LW5C 3W2WB 4P73A 2HNYB 2ZH1A 4DQQA 3J81Y 3GJQB 3G6VA 4CLLA 4Q45A 3I0SA 4RNOA 4CO1A 4JI0J 4I67A 2JC0A 1T0TV 1RK8A 1UJ6A 3NOCA 4KT0C 3CD6S 5KG3A 5EWEA 1QVGR 3FJ2A 2KJVA 2ZE2B 4HI1A 2J9CA 3GYGA 2E1RA 1JXLA 2XYGB 1UPPA 4CT9A 3MPYA 2CPFA 5H9EK 5HP1A 1U1MA 1HW8A 1VLOA 2KHCA 3KLHA 1T05A 2CQCA 2XHWA 3PO5A 5ETPA 1RT2A 1S4FA 3SXLA 2DR7A 4DQRA 5KFLA 1N0VC 4FF1A 2OKQA 5HQMA 3MOZA 2DKOB 4OYOA 4DL0C 2E5IA 4PXDA 2AWZA 4L73A 2E66A 3UE2A 1LFWA 3BO4A 3DHWC 1FJEB 3K7RA 4EBCA 4ID5B 4P2FA 3CCZA 1BQMB 3JAMU 4IR1A 4CNYA 3OFGA 2XY5A 1X4CA 2I1RA 5JJBA 2APOA 2DHHA 4GVBA 2K1RB 4IRKA 2P5VA 3W9HA 2YWWA 5KFHA 3DDNA 3N28A 1HBUA 4DV5F 1PCAA 1XR6A 3W7BA 1I6JA 4OZ2A 4Y2CA 4BDPA 1B3TA 5L8RC 2ZWPA 1O51A 4KQZA 2VUGA 2VOPA 4I56A 2RHSB 4DV6F 1DHMA 4DEZA 3HP6A 3GG1A 1Y5IB 2IY5B 2V8GA 3MMCB 1SH0A 2FGCA 5DRKA 3ZTPA 1RAGB 2DR9A 2VG7A 5E3RA 3L3CA 2E7VA 4IOBA 2VPZB 5KT2A 5D4OA 3WX4A 5DJBA 1FD2A 5LL6d 1NK7A 3EICA 4LFAJ 2M4MA 3DC2A 2KB2A 2OI2A 3IC1A 4LF8F 2GQ2A 4I6YA 3KJVA 1QTNB 4P7TA 3AJ1A 1EETA 1NH8A 3RBEA 2ZOGA 1FJ7A 3HK2A 3J7YU 3BSNA 1GNKA 2QZ8A 3PEHA 2MZSA 2R2SA 3E01A 3PR5B 4EEYA 4V1Ak 4FN5A 2J6UA 3TQEA 1RT4B 4PZVA 2P8IA 5CAAA 1JLBA 5DDQC 3OV7A 1N33F 2HFNA 4Q7AA 4IOAQ 1KONA 4ZN1A 1SUQB 2MSTA 3MR6A 3DLKA 2YNFB 3DRYA 4DV3F 4Y65A 1AXQA 2YPZA 4O0IA 3SCJE 1YJNS 1RISA 3MFHA 5D6GA 1O0PA 5GAHU 1T9WA 2QSWA 1WKKA 2ZZMA 4NI2B 3JSRA 4ZJOA 5AXNA 3PX6A 4JI3F 4K2JA 3MHYA 3OL6A 4UY85 3R8YA 2KM8C 2OPPB 3HSDA 4QWBA 2B5JA 3MI7X 2W2QP 5CZVA 3BGFA 2HAFA 4PXEA 4KO0A 1SH2A 4DR5J 4K8RA 1WACA 3T3FA 2OEMA 3TAPA 5EWGA 4RNMA 2AJFE 3R27A 3NS6A 4LSNA 2KU7A 4PEOA 5CXTA 1RHKB 4I2PA 3JB9k 2M52A 3NNAA 4NRUA 2EKYA 3K2YA 3RAMA 1VIOA 1FJGJ 5IT0A 2C2KB 5BR8F 3Q8PB 2RAQA 4I2QA 6AT1B 2FYXA 2PT0A 4QCLA 2YNIB 1FERA 3SQGA 2IC3A 6FD1A 1BC6A 1CJUB 4NXMF 4KKOA 1JX4A 2CQ1A 1K0TA 2B43A 3GJRB 1HMVA 1O5JA 3QLHB 3E8OA 1V5VA 2KXHA 4YUDA 4QW9A 1M5VC 2DXDA 2RKIA 3H42A 3M2UA 3V81B 1Q78A 3VAJA 2FLNA 4GC7A 2P9EA 1ELOA 3M4XA 4NASA 3A3OB 5KG2A 2OFGX 4M5DB 2UZAA 1UVMA 1EQ0A 4KSEB 3H59A 3JSYA 4J9OA 3KDNA 2ZZTA 2C2DA 5KFTA 2HRTA 1T8EA 2CZ4A 4LBHA 4ZDNA 5BJRA 2W1BA 4J5OA 2E44A 1UW9A 4EUVA 2KVQE 4DFMA 2HHWA 1HNVB 1Q86T 1UP1A 4WPAA 4WBFA 1VOMA 4UZBA 3C46A 2CPJA 2W4PA 3QT6A 3UDEA 1RU2A 5F8MA 3QGGA 1RTDA 4JI1F 5CCLA 3GV8B 2B56A 2BJ1A 2C3MA 3VAIA 3W5YA 5CABA 3US5A 1Q8IA 1YRTA 4OX9F 3KNAA 2YQ3A 1PC5A 5KFZA 2YNHA 7FDRA 3JTNA 1IJFB 1V6HA 1HD0A 3NBPA 1UL3A 3EPGA 1WC0A 1ZAWA 2RDJA 3B4DA 1OO0B 4ZJQA 1IR1A 4MKAA 1M5OC 1XMQF 4FF2A 4ECSA 3R1HA 4WP3A 4DV0F 4J37A 1NK6A 3NL0A 3GSIA 4DL3A 4KR0B 3R6LB 2VFRA 1CLFA 2X1FA 3M9OB 4C8OA 3AQOA 1REVA 4PYDA 1WORA 1KQSR 2HRUA 2V2ZA 2B4VA 5J2MB 4PPZA 3OL7A 2P6TA 2JEFA 5LMNJ 3TVYA 4DV7J 2UUBJ 4FVCA 2ZOFA 3OSNA 3FCHA 3THVA 4NLQA 4WU2A 5D8HB 1UETA 4J90A 3I9V9 4OYMA 3KLEB 4E98A 1HI0P 1CC7A 1HHSA 1YITS 4DSJA 1N36J 3KTQA 3DLGA 3RZAA 2DNKA 2DBBA 4DL6A 1C4AA 3PACA 5A6PA 4FZVA 3B54A 1VRUB 2AQ4A 4AQYF 3ISND 3VAHA 5C42B 2LA6A 3CCUS 4NXNF 2R7WA 4KB7A 4MIAA 4C0BA 3IGNA 4FBUA 1YJ9S 1RCXB 3T1YF 5IZHA 4WE1B 1EARA 3NP5A 4B9SA 2AX0A 2FGOA 1GMWA 2M8DB 1ZS6A 3IAM9 4UUXA 1RYRA 5C7PA 4C3MA 1IQZA 4HACA 2QIFA 3I5BA 5HATA 3KK1A 2DNLA 4QIWD 1Q8LA 3W2VA 1IBMF 1TKTB 2ZH3A 1NAQA 4FF3A 1HKAA 3DM2B 5K9FA 4L75A 3K5NA 1BQNB 3Q24A 2XO6A 2L41A 4A8YA 4NA1A 2HNDA 2WVBA 4DR6F 4PRFA 3TZXA 4JI5J 2WB4A 2NSBA 1SL0A 1F0XA 3QIPB 1TFWA 1XTZA 2FY1A 2VKZG 4U96A 2HQFA 3MM8B 2F8MA 4DV2F 3GWCA 1CJVA 4KE5A 3BGRB 4EU0A 2JDJA 1FNMA 2JFKA 1IBCB 1JJ2R 3GZ7A 3VQTA 4N41A 5AE3A 4L6V3 1TKDA 1IKXB 5GMEA 4JI7F 4YS2A 1SJFA 2NUHA 2P9GA 4MKBA 3U02A 3TZYA 1F9FA 1LW0B 5F41A 2CJBA 5B0FA 3FRYA 3RYLA 3W9JA 5L1JA 2E5LF 1T03B 2XMKA 1LK5A 5DG7A 4OYZA 1MW7A 3BDEA 2QRRA 3THTA 2BABA 3PFEA 4DV4F 3I32A 2CVEA 4N47A 1HNWJ 5A8KB 4N7TA 1QM9A 3MPUB 4I6WA 1VQ6S 3MUVP 3MR7A 1K47A 4Q44A 3F44A 3KUHA 2F4VF 4C4WA 2N7YA 2XNQA 3PY8A 2JEGA 2XO7A 1ZETA 1WOPA 3MWBA 2W9BA 3UN2A 4X64F 2MXYA 4ELTA 5A8RB 3GIKA 3C19A 2FHKA 4P72A 1PYTA 4N8OA 2EVZA 3MM6B 2A0FB 2NPIA 4M5GA 3HSGA 1F1BB 1R27B 2LYVA 2E5GA 1HPZB 5LSRA 5L1IA 1TFYA 1TUWA 4ZPVR 4F3OA 4DV1J 4CLFA 2IM1A 5B0CA 3VGVA 2QMWA 2J9DA 2ZDOA 4GKJJ 4PQUB 2HHHF 2N7CA 1U6BA 2DEIA 2KZMA 1XNRJ 4MFBA 3CULA 1VDHA 1S1XA 4UOCA 4KHRA 2OD6A 5C24B 2NREA 4DLEA 4L74A 1QSYA 3C6TA 3G87A 3MCMA 2V2KA 3D0HE 2ROPA 4JUZA 2QG9B 3M2VA 3W3SA 5LMUF 3QT5A 2GA7A 2MQPA 3HHEA 3DXBA 3HHLD 1MMNA 1XBWA 4ZIWA 4ZVOB 1RTZA 5KT7A 2B4UA 2FUG9 1G4CA 4USUA
chains in the Genus database with same CATH topology
1YJUA 4C8MA 1R43A 1S1XB 3M30A 5SZTA 1U6FA 2COLA 2J0SD 3I4PA 3CE8A 5K14B 5HL7Q 4MAKA 2HYIB 2QEXS 4RLEA 4CZCA 4OLPA 2EFVA 5A0YA 1FDAA 3JYTB 3ZFVA 3UFCX 5FDLB 3C6TB 2L08A 2ZBIA 4OFZA 2CVIA 1U8SA 1YBAA 2C3PA 4YR3A 4IO9Q 3UDLA 1IJEB 1DFDA 2ZITA 3AHPA 4IFYA 1S99A 2V9KA 2WRMA 3I5CA 2BV3A 3M2VB 4H4KA 3NMAA 3H5YA 1M5SA 2O66A 4HTIA 2QA4G 1K73T 2HLUA 2ZC4A 3G8QA 1VRTA 1M5HA 2HNZB 4DSIA 3SSSA 3ZZ0A 3OL8A 4IRCA 3CCVS 3MXHP 1VQ4S 3VALA 4DQPA 2JFDA 3PDNA 2QO3A 3RB6A 1QAXA 1VQSA 4C11B 1FEEA 3I9ZA 2D9OA 1NNDA 4DPOA 4FNIA 1S6UA 2JRSA 4JV2A 2B4OA 3M8SA 3D5MA 2IYIA 3M30B 2DH9A 4PG6A 3M05A 3H2VE 1S6OA 2IHR1 4MK7A 1D9FA 4TY9A 4N56A 5IS2A 4NLOA 2YVSA 1HHTP 1N5SA 3E2EA 1KVJA 2HFZA 5AXMA 2ZNZA 2EFGA 5A0YB 2BRLA 2UUTA 3EZ5A 1VI7A 3KLFA 4V19X 3DLLQ 2G1DA 2C3OA 1XN9A 2HIQA 3JSMA 2JVRA 2HGNA 4URSA 2CJ9A 2BBEA 2YWEA 1Y00A 1TL4A 4IFYB 4K4ZA 1WI8A 1WG5A 3DFEA 1ZH5A 4OIXA 1NK9A 4C0OC 4QWDA 4LF7F 1VRTB 5D4PA 3PFOA 3MTKA 4A8OA 3QZ7A 1HNZF 3VWSA 1BY9A 3KOAA 4NX9A 2F3JA 4BC7A 3OHBA 3SV4A 5HROA 4LFBF 1SH3A 1M0SA 4N5SA 4ZK7M 3OUYA 1TL1A 3DYAA 2PI4A 1U6ZA 1FJGF 3QYYA 3V6JA 4PG7A 3Q8RB 4LQ3A 2KZZA 4CTAA 4QPXA 3NCRA 1MNEA 3UCZP 3CF5Q 3LP1A 4FVMA 1YJWS 1WI6A 1QSSA 4ZMMA 1R89A 1RT1A 4GC6A 1D1UA 2OPRA 1MROA 4U6PA 2DGOA 2RB7A 3HF5A 4NLTA 4TU9A 1Q81T 3GILA 1Y4ZB 4MYTA 1VQ5S 5SUHA 2POKA 5I3PA 2J9EA 5F8GA 1FDBA 1FRMA 3KLFB 2ZFHA 5L9XA 3JSMB 1XR7A 2E1CA 2VKRA 2R7VA 1SV5A 2VG5A 3MTJA 1JLAA 4O3OA 4X4OA 4MTPA 1VIXA 1LWFA 1JJ4A 2R2TA 2A18A 5E33A 4D3GA 1WF1A 2DRBA 2E1AA 1TZ0A 4DUZF 1HR0F 5GADU 2DIVA 4KHMA 5HROB 4RW7A 2HS3A 5KOWA 4BS2A 3OFFA 2VONA 3OUYB 1TL1B 5KFYA 3DYAB 3IG1A 4IDKA 5THWA 3T9NA 4CT8A 3V6KA 4XAKA 5AXKA 4JV5F 2AP6A 2LXUA 3BF4A 4X4VA 4CTAB 2Q66A 2CQ4A 1F5AA 2CQDA 3H5SA 5KG4A 2O67A 5C5JA 1VQMS 5D78A 2UV8A 2B6AA 4G6VB 3V2UC 2O3DA 3OXLA 3H40A 3K5LA 3IAS9 1XK8A 2W25A 3HHKA 4K4TA 4KPYA 1B0VA