1VRUB

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
425
structure length
410
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 109
structure length 410
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vruB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruB03
2JEJA 1S1UA 4IFVA 4KB7A 4RW8A 4IG3B 4KV8A 3QZ7A 2YKMA 4ID5A 4O4GA 5KFWA 3KHHA 3IGVA 4NLUA 1MMLA 3GIMA 4O3SA 3OL8A 1DTTB 5DQIA 4IRKA 3C6UB 3JYTB 3UPFA 5J2PB 2XI3A 3GV5B 1D1UA 1JLBA 1JLCB 1ZTTA 1JLGA 5D3GB 4M95A 5KG4A 3MR6A 2W9BA 3DMJB 5I42A 4RW4B 1K1SA 4LSLA 1R0AB 4MIAA 4O3QA 4DL5A 1IKVA 3RB4A 1JX4A 1DTQB 3M8QB 3HVTB 1JLQB 1QAIA 1RT6B 3ISND 1RAJA 3KJVA 2C2DA 1KHVA 3V4IA 3I0RB 3LALA 3LP2B 4I7FA 5L1LA 4Q45A 1TL3B 2O5DA 3TAMB 1SUQA 3CDEA 2R2TA 3NAIA 4YR3A 5T14A 4TYAA 4ZMMA 3DLKB 2WOMA 3LAMA 4NLOA 2QE5A 1N6QA 4R8UA 2HWIA 5KFMA 4RNMA 3EZUA 4EBEA 4ECVA 1S9FA 3RBEA 3MEDA 1Z4UA 3GIIA 4F50A 3H40A 2IM0A 5DLGA 3KLIA 4IQXA 2VA3A 4K4VA 2HMIA 4IKAA 3QLHB 2GIRA 1TV6A 4MK7A 5KFGA 5DG8A 3H4BA 4QWCA 2D3ZA 3IS9A 2ZE2A 2BRLA 3DM2B 2HNZB 4YQWA 4J9LA 5EUHA 5KG2A 3CDWA 2ILZA 3KLVA 5KFVA 2E9ZA 3H4DA 1EP4B 3Q8PB 1RT7B 1S1TA 1LW0A 3KK3B 1HQUA 3DYAB 4MKBA 3KLGA 5KT4A 3KLHA 4IDKB 3DRRA 1NHVA 5KG6A 5J2NA 4ICLB 2AU0A 1S0MA 3DRPB 2OPPA 3OSNA 1S9EA 3PW0A 2BANB 2B6AB 1N5YB 1S9GB 5C42B 3I5BA 4KHRA 4NLPA 3GV8B 3BQ1A 1S0NA 3DLGA 4KHMA 3DLEA 5K14B 2VG5A 1RT4A 4KKOB 3MFHA 2B5JB 3IG1A 2YNGB 1HYSB 1NHUA 1LWFB 1JLEA 3KK2B 3NAHA 2IM1A 1CSJA 3DOKB 5KFSA 5L1IA 2RDJA 2ZD1B 3HVAA 3BSNA 2UVUA 1GX6A 3C6UA 5JXSA 4PWDB 1TKZB 2E9TA 3KLFB 2FLPA 2R2UA 1C1BB 4MFBA 2ASDA 1R0AA 4KFBA 5DQHA 3T5LA 3QO9B 1S1UB 4IFVB 2D41A 4RW8B 5KFQA 4KV8B 1RT6A 1I6JA 4ID5B 2UVVA 2HWHA 2BQRA 2JEIA 2W9AA 2XWYA 1ZETA 3H2LA 3MECB 2IAJA 4QWAA 4Q43A 2E9RX 4F4XA 5DLFA 1JLBB 3FFIB 1QUVA 1JLGB 4I2PA 5HLFA 2RDIA 1S1WA 3BGRA 5I42B 5KT3A 2W9BB 3ICLA 4LSLB 3E01B 1T94A 4X2BA 1T05A 3CWJA 4TQSA 2BQ3A 2WHOA 1S6PA 2I5JA 3M9NB 3KJVB 1TP7A 5HBMA 3CDUA 4NLXA 4Y2CA 3V4IB 3G6VA 4WXOA 1S0OA 2RF2A 4KE5A 2R2RA 1RTJA 1SUQB 1SH3A 2FLNA 4NCGA 2WOMB 3CJ2A 3OHBA 2C22A 1N6QB 3CJ3A 4R8UB 3MTKA 1C0UB 4TY8A 4QW9A 1RT5A 2W7OA 4ECWA 1EP4A 3FSIA 1RYRA 3MEDB 1LWCA 1K1QA 2D3UA 4ZPCA 3KLIB 5HROA 5EWEA 4NYZA 4LQ9A 4FBUA 2HMIB 1RA6A 3BSCA 3IRXA 1TV6B 2XI2A 2FVRA 3FDSA 3CJ4A 4NLYA 3Q8RB 3EPIA 1FKOA 2YNIA 2ZE2B 4I2QA 2W9CA 3OSPA 4MK8A 5F8MA 1C1CB 2B5JA 1S1TB 1LW0B 1KLMA 5C25A 1T03B 4LSNA 1HQUB 4PQUA 3MR5A 3KLGB 4NZ0A 3KLHB 3DRRB 5J2NB 3T5HA 4FS2A 2OPPB 2JC0A 5KFLA 4ECXA 1RDRA 5KFRA 4QPXA 3UQSA 3DLGB 3DLEB 1XR6A 2VG5B 4ZP8A 4O3OA 4J9MA 4IH6A 3D28A 3IG1B 3RAXA 3D5MA 1JLEB 3QO9A 4XPEA 2FLLA 4URGA 1C2PA 3H5UA 4RW7A 4QW8A 2AX0A 5F8JA 2CKWA 3MECA 4WZQA 3IN5A 2AX1A 3FFIA 2JEGA 3PW5A 3I5AA 4MFBB 2YNFA 1DLOB 3E01A 2GC8A 1HNVA 1VRUB 1RTIB 4KFBB 4MK9A 4JV2A 3V6HA 2XC9A 5J1EA 3OL7A 2IJNA 2DPJA 1QE1A 2F8EX 3GILA 1RYSA 4J9PA 4ZVFA 4ECTA 5KG3A 2IAJB 5I3UA 4ECYA 2BRKA 1LW2B 3DDKA 3SFGA 4K4TA 5HLFB 4I2PB 4QWDA 1T3NA 1S1WB 3BGRB 4Q0BA 5KFBA 3PW7A 5KFAA 1QAJA 3KMQA 1C0UA 1RT1A 1T05B 3QZ8A 3KMSA 1S6PB 2I5JB 5FDLA 2AWZA 2CJQA 5HBMB 4K4ZA 4WZMA 2RKIA 1BQMA 4ZHRB 3KLEA 1W25A 3HKWA 3H5XA 2RF2B 5C24A 3M9OB 3CIZA 5DGBA 1RTJB 1S6QA 2IC3A 3BREA 4GC6A 4NCGB 3KHRA 4K4SA 3H59A 1RTDA 5J2QA 2IJFA 4TY8B 5EWFA 1C1CA 1RT5B 2UVWA 3RB3A 1LWCB 5HP1A 2FJWA 1T03A 5HROB 3GYNA 4K4XA 5F8LA 3CO9A 1TQLA 3RB0A 3IRXB 3JSMA 4QWEA 4EYHB 2R8KA 2BE2A 1FKOB 2YNIB 4I2QB 2YNHA 2B43A 2W9CB 3NMAA 4URSA 4RU9A 5KFJA 4TN2A 2WB4A 3MR2A 2W7PA 5C25B 1KLMB 4PQUB 4LSNB 5KFEA 4O3NA 2J6SA 3UDLA 4K4UA 3G6YA 4ZVEA 3TQ1A 2EC0A 4PUOA 5F8NA 2VG7A 4EO8A 2JLEA 1JXLA 3CVKA 4IFYA 4OL8A 5KG5A 2WTFA 3T1AA 4ECUA 1RT2A 1DLOA 1U09A 1VRUA 2UUTA 1RTIA 4DL7A 2J6UA 5KFKA 3OLAA 4IR1A 4F4YA 3MEGA 4YP3A 1RTHA 4IH5A 3BQ2A 4EEYA 3DI6A 2HNDA 5KFDA 5F9NA 4RW7B 4TY9A 3OL6A 3H5SA 3V6DB 1XR5A 4ED6A 1HNIA 1LW2A 4H54A 4M94A 4NLWA 3GIJA 3PVXA 2C2EA 2YNFB 4WE1A 1HNVB 2IM3A 4TXSA 3DOLA 4RNFA 4NLDA 1S4FA 5KFNA 3PZPA 5KFFA 5J1EB 1QE1B 4ECZA 1EETA 4DG1A 1S48A 1SH0A 4DEZA 4ZHRA 4NRTA 3TVKA 5I3UB 4Y2AA 3NGDA 1IKYA 1JKHA 2FJXA 4Q0BB 3BSAA 2HNYA 4WFYA 4RW6A 3BSOA 2R8IA 4K50A 1RT1B 2W8KA 5F9LA 5KFZA 4Y34A 4DL4A 5FDLB 5KG7A 3LP0A 2RKIB 1BQMB 5KFYA 3BJYA 5DG7A 3KLEB 3V6KA 3ITHA 1FKPA 4J9KA 2R8GA 5C24B 4LQ3A 1S6QB 2IC3B 4O44B 3PHEA 5KT5A 4ZP6A 2BR0A 4J9QA 1RTDB 2D7SA 5KG0A 4J9SA 1JLFA 5J2QB 5C5JA 3OHAA 4O3PA 5F8GA 4WYWA 3N6NA 5HP1B 1TVRA 3M8PA 2DPIA 3N6MA 4RUAA 1J5OA 5L1KA 3C6TA 3V81B 1VRTA 3JSMB 4KO0A 4ZPAA 3LP1A 2ASJA 1IKWA 2BE2B 3KHLA 2YNHB 2OPRA 4YMEA 1TKTA 4ED8A 1RA7A 2GIQA 5KFHA 3HVWA 2C28A 4QWBA 5KT2A 4GC7A 5CYMA 1N56A 3NBPA 2ZKUA 4ED7A 4PUOB 4ECSA 5KFXA 2VG7B 3N6LA 4EYIB 1C0TA 2W8LA 3V6DA 2V4QA 1LWEB 1S1XB 1IM4A 3VQSA 1HPZA 3H5YA 1KHWA 3CJ0A 4IFYB 4ED0A 3PW2A 2C2RA 2YKNB 3T5JA 2XGQA 3MFIA 5KFOA 4H4OA 1RT2B 4DL2A 3UR0A 5DG9A 4IRCA 3MR3A 4YR0A 4IRDA 1MU2A 3I0SA 4DL6A 3MEGB 3RAQA 1RTHB 1N4LA 3DI6B 2HNDB 5KFUA 2J6TA 4ED3A 3QGIA 4NLGA 3RB6A 1REVA 1SV5A 4O4RA 4NLRA 4EO6A 5KFPA 1HNIB 4Q44A 1N48A 3RBDA 3FRZA 3QIDA 4WXWA 2IM2A 4WE1B 4RW9A 4R0EA 3DOLB 2JC1A 2R8JA 3EPGA 2ILYA 4HKQA 3ISNC 1EETB 4DG1B 5KFIA 2OH2A 4B3OA 1HQEA 4KSEB 2WCXA 4WFXA 1JLAA 1IKXA 3CJ5A 3SFUA 1IKYB 3G6XA 4O44A 5KFCA 1JKHB 2XCAA 3MEEA 3PR5B 3DRSA 2HNYB 4RNHA 2WONA 4RW6B 4NLQA 4H4MA 3MF5A 5EDWA 2ATLA 3KK1A 5CYQA 2AGOA 3LP0B 1TKXB 4URQU 3ITHB 1FKPB 3V81A 4J9RA 4K4WA 3OLBA 4IG0A 1SH2A 4ZP9A 3Q8SB 3PW4A 2AQ4A 1S1VA 1JLFB 4Q8FA 3T19A 2V0NA 1TL1A 2V4RA 1S10A 3E51A 1BQNA 1RT3B 2BQUA 3Q8QB 2ASLA 4NLTA 1TVRB 3M8PB 4K4YA 4EBCA 5DQGA 3H98A 2HAIA 4EBDA 1J5OB 3C6TB 2FVPA 3QIPA 1VRTB 4MH8A 3BQ0A 1UWBA 4KO0B 3M9MB 1LWEA 1S1XA 5KT6A 3LP1B 4G1QA 1IKWB 2R2SA 4TQRA 4J9OA 2FJVA 5DGAA 4MKAA 5EWGA 2FVSA 2YKNA 2OPRB 1OS5A 1TKTB 2VG6B 3FQKA 2OPSA 4F4WA 4ZVGA 4O3RA 4MIBA 1HARA 5F8IA 2OPQA 1GX5A 5CYMB 2UUWA 1FK9A 3NBPB 1HMVA 4IOBA 3NL0A 4NLSA 4R5PB 1C0TB 4IH7A 4KBIA 1HPZB 2R8HA 5J2MA 3PJXA 4IG3A 4H4OB 4RUCA 3SI8A 2IBKA 4JV0A 2IMWP 4TYBA 1DTTA 1MU2B 3I0SB 3HHKA 3PJWA 4JUZA 4RZRA 4F4ZA 3JYTA 4DL3A 5J2PA 1S49A 1JLCA 4ED1A 5D3GA 2WRMA 4KAIA 3DMJA 4RW4A 1REVB 1SV5B 5KFTA 5L1JA 4YR2A 2FVQA 1DTQA 3M8QA 4J9NA 3HVTA 1JLQA 4XPCA 2YKMB 4O4GB 4ZPBA 2ALZA 4JV1A 3OL9A 4RW9B 2IA6A 4RNOA 3KHGA 4NRUA 3I0RA 3V6JA 3LP2A 4ECRA 3GIKA 2VA2A 3KNAA 3QYYA 1TL3A 3TAMA 4U7CA 4FBTA 4B3OB 1HQEB 1TKXA 3DLKA 1YVFA 5KT7A 3LAKA 1IKVB 1JLAB 1IKXB 3PR4A 1S97A 3MEEB 3DRSB 2FVCA 5KG1A 2WONB 1WNEA 4WYLA 1XR7A 4I7FB 4WFZA 4H4MB 2XCPA 4ECQA 1RT3A 3KK1B 5CYQB 3T5KA 3QLHA 3QGGA 5F8HA 4ZPDA 1D0EA 4U6PA 2JEFA 4IR9A 3DM2A 2HNZA 1NNDA 4Y3CA 3LANA 4IG0B 1RT7A 3I5CA 2XGPA 4Q8EA 3KK3A 1S1VB 3IGNA 2VG6A 3DYAA 3KOAA 1TL1B 4IDKA 3NKYA 2QV6A 2UVRA 1BQNB 4ICLA 1JIHA 3G86A 3DRPA 4HYKA 3GV7B 1ZTWA 2BANA 2AGPA 2B6AA 1N5YA 1S9GA 3BR9A 5C42A 3QGHA 3IS9B 5JUMA 4NLVA 3FQLA 3QIPB 1UWBB 5K14A 4R5PA 4KKOA 4TLRA 2YNGA 4G1QB 1HYSA 1LWFA 3KK2A 4ZVHA 3DOKA 2OPSB 4XO0A 2I1RA 2AGQA 1S9EB 2OPQB 2ZD1A 5L9XA 4FS1A 2V9WA 4ZP7A 4PWDA 1FK9B 1TKZA 3KLFA 4RNNA 1HMVB 3GQCA 2WK4A 1C1BA 1RT4B 4G3IA 4ED2A 5J2MB
chains in the Genus database with same CATH superfamily
4X4NA 2R7TA 3T1YF 2QL9B 3QGPA 3D54A 3DMJB 1U47A 1R0AB 2VPXB 1VS3A 2AZ3A 3Q83A 3LP2B 1MSWD 3NNAA 2CWKA 3ET6B 3PKYA 3LAMA 3RBEA 3MEDA 1PSDA 3U1MA 2MKIA 2E5LF 4LF6F 4PYDA 1PC5A 1RWMB 2H48B 5A0YB 3KLGA 1L3VA 1RWPB 1VGYA 2LMIA 4LRBA 3P6YC 3GV8B 1TL7B 3SXLA 1R7IA 4OYMA 4OZNA 3U1NA 1HYSB 3KK2B 3HVAA 4YOEA 2GS8A 1NU4A 4MFBA 2ASDA 4M8LA 3WZ0A 1FVSA 1UZHA 2UVVA 2BQRA 1O0PA 3MPDA 2W9AA 3N9UC 3FFIB 2VIHA 5I42B 1SKWA 2GA7A 2R4FA 2NR0A 1SH3A 1OMSA 1N6QB 3C14A 1U2FA 3MTKA 2MY8A 4ZPCA 2A2CA 1HBOA 1CS4B 3HD2A 2FPHX 3CCMS 3OSPA 1AW0A 1ZM2A 1LW0B 2X7IA 4DR4F 1Q8BA 3DLEB 1QDUB 4Y6IA 1F9HA 3G8TA 1DY3A 3TR5A 2VDIA 3JTNA 1O51A 3IAM9 3S7RA 4I4BA 4AL5A 1EKRA 2B9YA 1DLOB 4AUKA 2GC8A 1HNVA 4ANDA 2MZQA 2XC9A 2ACYA 4MTPA 3DC2A 2FLOA 1DQ8A 1VQLS 4OI2A 4O0IA 3QZ8A 2FZCB 5FDLA 1X0PA 2LU1A 5DGBA 3IWLA 2K8GA 2DNHA 3H2UB 1ZA2B 1RT5B 4KPCA 3U02A 5DO2A 3C8YA 4KPYA 4PQUB 4LSNB 2VFUA 4F8RA 4JI4J 3AXKA 3WIVA 5CAAA 1WUUA 1UFKA 3IXQA 4GRSA 2WTFA 1WC6A 2J6UA 4IR1A 4YP3A 4OI3A 3MPYA 2BACA 2QMUB 1QD1A 2XB2D 1XR5A 4ED6A 1BHNA 2LEPA 2EFNA 1CJUA 2ADCA 4HTIA 1BWEA 1EETA 3TVKA 2K1RA 1S7IA 3TZZA 1H2UX 1PBUA 1U0HA 1NK5A 3MUTP 5BR8J 5BYRA 2UUBF 2C3UA 4YY3J 1GNKA 2D7SA 1JLFA 3BEGB 4L76A 4O3PA 3F73A 1YJ9S 1IKWA 3I6PA 1E6VA 1OSCA 5KOWA 2J0XA 3VQSA 5DDPC 3CJ0A 4IFYB 1JB0C 5HAOA 2XGQA 2GVZB 5HK4A 2HHTA 3GONA 3RAQA 2HFZA 3M1VA 5KFUA 4U7UD 5AJ3J 1N48A 1V9OA 3HX9A 1X0FA 1QVGR 2G0JA 4QOTA 4C3MA 2AW0A 4QIEA 3NS6A 1K73T 5DDQC 2CADA 2ZWOA 4RNHA 1UA0A 2MZSA 4UTGA 3W2VA 1T9WA 4M5HA 2FGCA 2ZEJA 3SMZA 3L9ZA 1OWXA 1FK9A 1C0TB 3PO5A 2Q6BA 3MAAB 2IMWP 1ZS6A 3BM7A 5A2QY 3OL9A 1R0CB 3AHPA 2IPOB 3A13A 2Z57B 3EGZA 4Y2IA 1MLAA 1FXDA 4C3KA 4A47A 5E3AA 3K17A 4QZVB 2YQ1A 4U8VA 3QGGA 4LF8J 2E5IA 2XNQA 2CQCA 4ZVUB 2Y9HA 3NKYA 1QY7A 2AGPA 3M2VB 3R2CJ 5LMNF 3L7PA 2DNYA 1JXEA 1Q16B 5CH7B 4Y0FA 4KQZA 8RUCA 2R42A 3KLFA 2J76E 1C1BA 2EBGA 2VOPA 4KV8A 2H9ZA 5DQIA 3C6UB 5J2PB 1JLBA 4B17A 1Q82T 2I38A 1ZZNA 4HACA 3BO2A 3HT0A 3I0RB 3ENWA 2HFNA 1SUQA 3NAIA 2V50A 1TKDA 2LFVA 2E7XA 2W25A 1QAYA 5DLGA 5A8KA 2AEMA 2POKA 3DOMA 1T7PA 1WF1A 3CDWA 5KFVA 3MAQA 3QBCA 1HQUA 2XS7A 1NHVA 3PW0A 5C42B 3I5BA 3BQ1A 4WIIA 2VG5A 2HHUA 3NEKA 4FYXB 5GVQA 2RQ4A 4DWIA 5JXSA 3R5CA 2FLPA 2R2UA 1Z2ZA 1NM2A 1P1LA 3QO9B 1S1UB 4IFVB 3GU0A 3FNNA 3OR2B 2LQ5A 1X5OA 1OQ3A 1VQKS 5GAEU 1RADB 1T94A 1REGX 1PJ7A 4A8KA 3ZZPA 2KI2A 1S0OA 3F41A 4GVBB 2FC9A 2ROEA 3CJ3A 1K1QA 2FY1A 4DUYF 1G2EA 1NPPA 3CB4A 3I31A 3CMAS 3DRRB 2V8VA 1PJ5A 4ECXA 4J9MA 3D28A 2BKPA 4Q2LA 1N5TA 4XPEA 3BKUA 2BKNA 3PV8A 5F8JA 1KTVA 3E01A 3OTCA 5CHCB 4NOHA 5B0GA 1TTHB 4LRDA 1IM6A 2KTQA 5I3UA 2ZBRA 3P45B 2WBMA 2KRBA 3UDVA 4DR6J 1W25A 1RTJB 3BREA 5A6WA 2DNOA 5EWFA 2FQQB 1ZH5A 1LWCB 2FJWA 5HROB 3DXSX 2JZ5A 3JSMA 2P9EA 1VQYA 4PPZA 2EKYA 4M5JA 3LTOA 5C25B 3MCOA 4O3NA 4PUOA 1KONA 2QA2A 3CVKA 2VODA 1WG1A 4NWBA 3GIJA 2AEFA 3PZPA 1S4FA 5KFFA 3VR1A 3F0NA 1QTNB 3EXCX 3VF0B 4OLPA 1UL3A 1TK8A 1QLNA 2LA4A 3LP0A 3ITHA 2DRDA 4F3QA 2IC3B 4O44B 3IAS9 2CVEA 2AP6A 1T11A 3FZ2A 3HZEA 4OV1A 1HBNA 3EM1A 3V81B 2KFNA 2YNHB 4QWBA 5T7LA 4DPXA 4ED7A 4EYIB 1Q78A 3H5YA 4C7QA 4C8OA 3GFZA 3I0SA 2EG1A 3RW6A 2HNDB 3EDQB 3GG1A 4MYTA 1SV5A 1S59A 4ANCA 4LF7F 3FRZA 3L7OA 3M8ZA 3PRBA 1X4DA 2H3EB 4PXEA 1W2BR 5KFIA 4DUZF 4AQYF 2ATLA 3KK1A 2EG2A 4PPDA 5B0DA 4J9RA 5A76A 4CO5A 2YPZA 4ZP9A 8ATCB 1FT8A 2HBQB 4OZ5A 3Q8QB 2WAQD 3EGWB 2HVEA 4UOCA 2XHWA 4A46A 3MXHP 1LWEA 2P8IA 1R8HA 4F4WA 5F8IA 3KUHA 2C3YA 1UEKA 2PIIA 4JUZA 4OYXA 2DY1A 2A0FB 2ALZA 2DNRA 3V6JA 2CWXA 1HR0F 1TL3A 3TAMA 2HFUA 5I4MA 1G4CA 3DLKA 2VU5A 5IQQA 4XAKA 1NJYA 4NXNF 1VC6A 3DRSB 3I4PA 2PI4A 3CNQP 1XR7A 4ZPDA 2KZZA 1NNDA 2MMYA 2XGPA 3UCGA 5ETPA 4ICLA 1H2VZ 3GV7B 2C2ZB 4QU7A 3DNCA 1HNWF 1IR2A 3BO3A 3ILLA 4EMDA 3GQCA 2NZ4A 4NCBA 4X65F 2M52A 1S99A 1U48A 1D1UA 1BQXA 2M9KA 1UW9A 3RB4A 1K1SA 1NZAA 1S7HA 2MLXA 1VYAA 4KH0B 3WX8A 1HHSA 3CCWA 3R1HA 4ZMMA 2HHWA 3W60A 2F5GA 2VF3A 2LDIA 3GIIA 4F50A 3H42A 3KLIA 3GCWP 1U6BA 2V8PA 3H4BA 2D3ZA 5EUHA 2PGCA 2E9ZA 1HWJA 4FYWB 3Q8PB 4PABA 4RR5A 3OSNA 5D4OA 4LFBJ 2QL5B 2OUGA 1JLEA 3AA8A 4X62F 5GAEI 1GFWB 3OVBA 4WWSA 4PWDB 2BOAA 3RR8A 3CCZA 2V4JA 1GMWD 3LQVA 1RLDA 9ATCB 3M8SA 5DLFA 2M2BA 3CDBA 2LQ9A 3GP9A 3I87A 4U9RA 2IHR1 1L3SA 2E7VA 3V4IB 2I6WA 3PCOB 4WXOA 2RF2A 2CG4A 3O1LA 1LXJA 2BE9B 4P10A 1WC4A 1R8BA 4LFCF 4J9UE 2X1AA 5EWEA 2HMIB 5LSRA 3D1HA 2CNOB 3CJ4A 2VKZG 4MK8A 2JDJA 1TL5A 3TAPA 2EC2A 3T5HA 3MPWA 4HH0A 2YWGA 1AFIA 4ZP8A 4E0DA 2FLLA 2RAQA 3IN5A 2MHEA 5HQMA 3G2XA 3V5RA 1FNOA 3H0PA 2DPJA 3L4BC 2IJRA 2G13A 2P9CA 5HMYA 1LW2B 4I2PB 2KT5A 1WJ9A 2A3JA 5HVGA 3KMQA 1RT1A 5K9FA 1R3NA 2GMJA 3MCSA 4F3OA 2CNLB 1QSSA 2NXJA 2VQEF 3RB3A 2DGQA 2DCUB 3N5BA 2HIYA 4RJVA 3CO9A 3K5OA 3UE2A 2QO3A 4OYWA 4CLLA 2HG4A 3W9HA 3HT3A 1RT2A 5B0EA 1VRUA 2RS2A 3OLAA 3AY0A 4CLKA 4RW7B 4UOFA 4N76A 1SQGA 3S1TA 1SKSA 5KFNA 1X4BA 2HIQA 3AOCA 1H6KX 1ROFA 3K0JA 4RW6A 1WC3A 2RKIB 2DNLA 1WWHA 3J7AN 4NPOA 1IBMJ 5J2QB 3GPAA 3EVOA 2B7CB 5D0RA 1A0OB 5HJYA 3UCZP 4KO0A 3MMAB 1Q95G 1K0VA 2J0WA 3HVWA 2C28A 4OYAA 4P7TA 1VFJA 1SC3B 4ECSA 2W8LA 1HPZA 1WG4A 3GJRB 2R7SA 4H4OA 1FWKA 1FO1A 3SCIE 3KJFB 3GSDA 1P1TA 4F02A 4X4TA 3P4UB 1DZ5A 1UAWA 1FCAA 2C2OB 3RZAA 3D0GE 2DHGA 2XCAA 3W9IA 1Z1ZA 4ZVPB 4CTAA 1YJNS 4WBFA 3OLBA 4LF4F 4Q8FA 2UXBF 3CCRS 2BQUA 2ASLA 2KB2A 5D77A 3GMGA 4J90A 4ENOA 3PNIA 3LP1B 4LUBA 2EFGA 1Y3JA 4C9DA 1Q86T 4O3RA 4X4QA 1GX5A 3MEKA 2PT0A 1CEZA 1IBLJ 1TMJA 2RS8A 2ALYB 2FUG9 1S49A 1MROB 3DMJA 3X3UA 3T1HF 5LSOA 2QA1A 4A8WA 3LP2A 2AYMA 3GTYX 4EZ9A 3ET6A 1H0HB 3DHWC 2VBWA 3AOBA 1PYSB 3BZQA 4DV7F 3F56A 5CYQB 3UNYA 4L3KA 1B0VA 3FBFA 5A0YA 1NDCA 1RHUB 1YHQS 1TL7A 4EGLA 1UEUA 4YHHF 4JI0J 1HYSA 2MJUA 4CCHA 3KK2A 4ZVHA 1CVJA 3M2RB 1N36J 4WU3A 3D1QA 1I94F 3TAQA 1FXLA 2ZJPQ 5J2MB 4PG8A 1ZPVA 1X60A 1MMLA 4LR7A 5D3GB 4QPTA 5I42A 4MIAA 1KOOA 3UR3C 2XWXA 1CULB 2OEMA 3ZZRA 1N6QA 5LJ3Y 4X66F 3GYXB 4NXMF 2Z58B 3SBMA 1Z4UA 2GQQA 1YG0A 3OFGA 3CD0A 4OI1A 5KG2A 2D69A 4ILMA 3AJ2A 1LW0A 4BBYA 5KT4A 5KG6A 5KOXA 4HT5A 1S9GB 2FZKB 3DLEA 1RT4A 1KP6A 3RW7A 5IT0A 2EK6A 4FF1A 2LEBA 2ZVIA 4AXJA 2V8DA 3H2LA 2VOOA 4M5NA 4F4XA 4ETXA 2AJ1A 3S6EA 2H5IB 1LKZA 5JVGQ 3G6VA 5E7OB 1XC9A 4X64F 3TX0A 3R5JB 2C2KB 2FDNA 4ANEA 1RT5A 3SCLE 4ZVQB 3BSCA 2FVRA 4DFJA 1HD1A 3C3LA 4C8MA 2AD9A 2ZH7A 1V6HA 4PQUA 4LSNA 1TUWA 4OFZA 2MHNA 4ZJLA 4CLYA 2J7WA 4DSLA 5M2UA 3B54A 1FI4A 3CO0P 4KFBB 2XSJB 1F3FA 2F8EX 4GKJF 1RYSA 1F1BB 1OY6A 5CA5A 4HR2A 1F9FA 4K4TA 5HLFB 2QMWA 3C66A 4ZIVA 2QEXS 3JSYA 2ZZTA 2Q66A 5KAKA 2YH0A 1RU2A 3THVA 4H4KC 1N88A 2QZ8A 3N01A 4I2QB 3NMAA 3QJJA 4ZVEA 1UW4A 1D9AA 4ATNA 2N7YA 4IFYA 4C8YA 2GVZA 1RTIA 4IH5A 1GQEA 4FF3A 3VAIA 3FK4A 3QT8A 5L38A 1RLCL 4DSFA 3FBEA 4DEZA 4Y2AA 3IM8A 1N54B 3BSOA 2R8IA 3GG0A 2B4VA 2QN6B 5SUHA 5IT4A 3LWLA 2Z2YB 3Q89A 4FP9A 3M6UA 3EYZA 3D6MB 4PXDA 3B4MA 2DPIA 1MN7A 2XYGB 5L1KA 4LSZB 4LF5J 2CJKA 4DV3F 2ERRA 3M8WA 3IBCB 5KFHA 2CJXB 5M2RA 5E3QA 1FDNA 1C0TA 2EFOA 1KHWA 2HYIB 3MAAA 3TVYA 1X4EA 3W9JA 3C16B 3RB6A 5KFPA 2GMLA 2OIHA 2G0IA 3E8OA 4DLEA 1F2GA 1HW8A 2P2CB 1SIWB 4X4OA 3G6XA 1SB6A 5KFCA 3MM8B 2WBRA 1SL2A 1FKPB 4QIVA 1WTBA 2Y0BB 3PW4A 4LVNP 4PR6A 3T19A 2V0NA 3AT1B 3W7BA 1S10A 3BBBA 1RT3B 1DRZA 4ETZA 4JI8F 3H98A 4EBDA 5J1NA 5HQ8A 1ZA1B 2OPRB 4DV6J 1WI6A 1U1RA 3J7ZT 5CYMB 2E44A 3M6VA 3R3TA 4IH7A 5DETA 2JFDA 4KBIA 2AMCB 4RUCA 3A3NB 3CD6S 5J2PA 1U02A 1H2TZ 5D0HA 2ZHOA 3I0RA 3OXGA 2CZ4A 8AT1B 4FBTA 4JI7J 1TKXA 1FRHA 1S97A 2E66A 2LXIA 3NCRA 3U1LA 3FSYA 1PYTA 2VG6A 1RTZA 4ZCMA 4G6VB 5C42A 1L3KA 3LPEA 4C0BA 1YBAA 4JBCA 2IDEA 4R5PA 5DDOC 3AB2B 2I1RA 2W4DA 4LFAJ 1EKSA 1D8YA 1HMVB 3VVTA 1S1UA 4IFVA 2AEJA 2DGTA 3UPFA 2VFVA 4QIFA 3MCNA 3CCJS 4KTQA 2D3O1 3O44A 5D8HB 5L1LA 2MQ8A 4GVBA 4YR3A 1B64A 3SYZA 1EX8A 2HHQA 3L09A 1YK9A 2GIRA 5CD4H 2R3VA 3KKFA 2GVDB 2L41A 5CQGA 4B08A 2V69A 3DRRA 3PHTA 4JV5J 1JXVA 2CYYA 2MKYA 1I3OB 3UN5A 4XDDA 4B02A 4Y28C 2CQBA 1XBWA 2W9BB 3NXZA 2YWWA 3AXMA 3NOGA 1RU1A 3BF4A 1LFPA 2R2RA 3D4JA 1RTJA 2FLNA 4ERDA 2DGVA 3ZZYA 4LBIA 1EP4A 1RYRA 4D3HA 1LWCA 2D3UA 5HROA 1XMQJ 4Z37A 1NJWA 1RK8A 2JSXA 1FFSB 1VQSA 5AE1A 1U6FA 5C25A 2CQ4A 2LKZA 2HEKA 1R6YA 4GKKJ 4L75A 3H25A 3R5GA 3HHLB 1SBRA 1S5ZA 3MECA 1URNA 2Y1JA 4TU9A 1F3VA 5EGYA 3WC2A 4DV0J 4GMKA 4ZVFA 4JP8A 3GSIA 3DDKA 1WEYA 2GZOA 4JI5J 2HVIA 1C0UA 3NGRA 2ZH4A 5HBMB 1UFLA 1VLYA 3HZGA 2IC3A 4GC6A 2DEIA 1NEEA 4TY8B 3US5A 3QT7A 2E5JA 3R5BA 4B3TJ 1XNRJ 1FE4A 3AD9C 2PA8D 1FKOB 2YNHA 3VGVA 3ZZUA 4AL6A 4B9VA 1FNXH 3R6GB 2YVSA 3UDLA 5HQLA 2DR7A 4JI4F 4QYZJ 4H4KA 2M88A 3MM6B 4Y2KA 2UUTA 4IO1A 2HNDA 5KFDA 3JTOA 2F7VA 3OL6A 4M5IA 1U24A 2KG0A 4FYVB 5ADZA 1AUDA 4NRTA 4ZVTB 5T41A 5LJ5Y 4CLTA 1X9MA 4K50A 3K8VA 1RSCA 5DG7A 2FJEB 1LV5A 5BR8F 3SIPB 1I1GA 4KY3A 4YY3F 1XN9A 5C5JA 5HJXA 3PTWA 4FXVA 3D66A 2VPZB 2XG8A 1U25A 1FTCA 3TNVA 1RA7A 1HKAA 4NEYA 4ZLPA 2ZVSA 2DB1A 2JHEA 2DHSA 2VFSA 2V9KA 2WVBA 4IRDA 4IRCA 3MEGB 2YXLA 2J7UA 4Q5VA 4ED3A 2C3PA 5AJ3F 1OPIA 2I0XA 1CJVB 1FJGJ 4WXWA 4X65J 2FC8A 2D9PA 2HZAA 1VC0A 5AT1B 3MOZA 1BWVA 3VGTA 2K2PA 4DF8A 3DRSA 3ZTRA 3K2YA 2KFYA 2W01A 2DNMA 2H65B 3EZOA 2AGOA 3QWPA 1SH2A 3MAHA 4A8QA 3A3OB 2RMLA 2XLIA 2V8GA 1YJTA 3JB9k 2LU2A 4M5LA 4F25A 1XQIA 3MR7A 1R0BG 1S1XA 2R2SA 4HLBA 1V5IB 3MMBB 1UVNA 3S01A 3TW0A 1FRKA 1AZSB 4J91A 3L7UA 2R8HA 3N28A 3G4SS 3SI8A 3T9NA 3FEYB 4K5RA 5JJBA 4CM0A 2XM3A 1GMVA 4RW9B 2IA6A 2I9SA 1U4BA 3W3SA 2AHOB 1YVFA 2MDAA 4EWTA 1FKAF 4EK2A 3OPKA 5E3CA 2DXEA 3A8JA 4LF8F 1C4CA 1FERA 4O0NA 2D74B 4DU7A 2AYBA 2JLFA 1PCAA 2C2NA 2QMXA 2QV6A 1FRJA 5EX3A 2V2ZA 2DH9A 4JI1J 3O2IA 2AGQA 2V9WA 4PWDA 1MG7A 3CCSS 2NZCA 2QFJA 2Y1IA 3HP6A 3J81j 1VRQC 2PSZA 4DL5A 3R7NB 2RRNA 2MXYA 3V4IA 2NUUG 3GJSB 2KYXA 3AA9A 5E5NA 5LM7E 4CO4A 1CJTB 2HMIA 5AXNA 3NMRA 3IS9A 3M30B 1WI8A 3W8GA 1ACMB 3MM5B 4UT4A 2CPXA 3DYAB 3ZTQA 2AU0A 1GTEA 2BANB 3GR0A 3CXCR 2IM1A 1F5CA 3K7RA 2VONA 1CJKB 2XWYA 2OEJA 1QUVA 4I2PA 2RDIA 3I32A 3E01B 3FEXB 5A8WA 2QLBB 3AH6A 3K59A 4QYRA 4M63A 2G4BA 1FNMA 4JI2J 3CMQA 1YQHA 5DM7Q 3A12A 2MGZB 2ZBCA 3EJMA 2JVOA 2DKOB 2CNKB 4PG5A 4RO0A 2FY8A 1X4AA 4QU6A 3THPA 4ELVA 1W26A 2LVWA 7FD1A 3T41A 1S1TB 3C19A 3KLHB 4FS2A 1KEKA 2HQGA 3UQSA 4O3OA 2IYGA 1PJ6A 1C2PA 2DEJA 4RW7A 2DGXA 4RLEA 4B9SA 2GQCA 1FE0A 4MK9A 5K8MA 4K0KF 3GILA 3R5AA 1EJ7L 1T3NA 1SPBP 3PW7A 4DR6F 2RKIA 4ZVRB 3K89A 2XZDB 3H59A 3PYGA 4F2SA 5J2QA 4C8NA 5IS2A 2NPIA 4QWEA 1WEZA 4URSA 1RHKB 4AD6A 1B4SA 1U8WA 4TN2A 2L9DA 3MR2A 4OZ1A 1FDAA 4EO8A 3EVWA 1JXLA 2BKOA 2WW4A 1UEVA 1NH7A 2DR6A 4DPOA 1UWAA 4TY9A 1RCXB 2OTJS 4DV5J 4ZLNA 3QATA 5F3ZA 2NREA 2EWHA 5CCLA 2HBZB 3CEDA 4HL9A 4NYOA 1IN0A 1PC4A 2YKOA 2FJXA 2HHVA 2YWHA 1M5HA 3IP0A 3VTIA 2RSQA 4C11B 2MSSA 2Q6CA 3T9ZA 1A9NB 2CRLA 4KHPJ 1RTDB 1PIEA 5F8GA 2LQJA 2XO6A 3TVZA 1X4CA 3LP1A 2ASJA 4TU7A 3QRRA 4LBHA 2GIQA 1WOPA 3G82B 4NZ7A 1NDLA 4WPAA 4ES1A 4LJMA 1LWEB 1IM4A 4X4UA 3FCVA 3P5BP 1VOMA 5IV4A 4HDHA 2OHDA 4YR0A 3GZ7A 4KH1B 2R7UA 1MROA 2QLJB 1LK7A 4Q44A 1VQPS 4DQQA 2QG9B 4XK8C 2PI5A 2YKQA 3IBFB 4QIGA 4LRFA 5EDWA 5CYQA 1H74A 2JFKA 3SEOA 1HI1A 2Z2ZA 1IUJA 2ZZNA 4K4WA 1SJ1A 4NXMJ 1P8GA 3SQGB 4EZ6A 1TVRB 2JH3A 3JTPA 4TQRA 1NKCA 4MKAA 5D0EA 3FQKA 4UUXA 1TKTB 1NHKL 1TK5A 1HARA 2R7OA 3M2RA 1ZZFA 2Y3YA 5J2MA 2BM1A 2N3OA 4MMOA 1EHWA 1YJUA 4TYBA 2HPUA 4ED1A 5D3GA 3HO1A 4N7TA 4YR2A 2DRBA 1B7FA 1LXNA 1CULA 4JV1A 1SQFA 1TFWA 1TELA 2HVHA 3LAKA 1M5VC 5SZTA 3PR4A 5KTQA 1R8AA 5GAGU 7FDRA 1Q7YT 3HSGA 4P9SA 3T5KA 2F8MA 5F8HA 2UV8G 4GO5X 1R43A 1QJHA 1WG5A 2J9EA 1FESA 2CXEA 2HS4A 3BDEA 4F4KA 3C15B 2OSQA 3L3CA 2J7KA 3LGNA 1S9GA 4RL1A 3MUVP 2DGWA 3FQLA 1H38A 2F3JA 1U1QA 4I0WA 1UWBB 5EX0A 3OQ2A 3IMQJ 3AQPA 1SI9A 2OPQB 4ZP7A 2Z2LA 4DJBA 2MZTA 4G3IA 1QAXA 2CQ3A 4ED2A 5G0RB 2JEJA 1N33J 1S12A 3GIMA 4O3SA 4IRKA 3JYTB 1LWXA 1ZTTA 2KHDA 5D4NA 3A8KA 3M8QB 1WHYA 1JLQB 4YDXA 4YEAA 2ROGA 3OTOJ 2CPEA 1SJ3P 2PN6A 1ZM4A 4UF4A 1RAOA 4ZVOB 3TUJC 2FD2A 2ZITA 4ZS6A 3W5XA 3JSRA 4ZPTR 1QVFR 3DM2B 3W2WB 3JS9A 1OYEA 4MKBA 3BN4A 3BH6B 4P2FA 3MMJA 3OVAA 1LWFB 1WD6A 3LOUA 4AFFA 4GO7X 9RUBA 3QFWA 1KVKA 2J5AA 5HMWA 2CQDA 1R89A 4KFBA 1RWVB 1YJ7A 4OYBA 2XSJA 4LF2A 2YH1A 2FJDB 5HLFA 4USTA 3M8RA 4TQSA 3BV8A 3QNWB 4ELTA 3H90A 4FF4A 1SJQA 3SSQA 5D6GA 3IR5B 4WP9A 5FJ4A 1RAHB 4I2QA 1NPRA 2P5VA 2RU3A 2UV8A 2B5JA 1Y11A 2U1AA 1WHVA 3RAXA 3CSKA 2QFIA 3FEZA 4IH6A 4CZCA 4NL5A 4HHJA 2KVQE 4K2XA 2QYGA 1VRUB 4FZVA 5FLXU 1HHTP 4ZVSB 3CTRA 2IIHA 2IAJB 3TEHB 2VICA 1NJZA 3ENQA 3UDEA 2J9DA 1YGYA 2O66A 2V34A 2X1FA 4I68A 2ZNZA 3R1LA 4MT1A 1HWLA 2MZJA 3J81U 1RKJA 4RX6A 4FDFA 2H54B 4ZITA 2YNIB 5KFJA 3BKFA 2B8PA 2XMVA 2GV1A 1KOHA 1T8EA 1ZAVA 3UN3A 2KXNB 4P75A 1PILA 3BQ2A 1WKKA 2GHWA 3C16A 3CCTA 1UFWA 1FJEB 2HS3A 3FJ2A 3OBIA 4HHHA 1X31C 2YNFB 1KDNA 2MKCA 4ZHRA 2CA9A 2VBYA 3G96A 4Q0BB 3MM8A 5DJBA 4ZLLA 2P9GA 4Z2XA 1WHXA 4DL4A 1YZ7A 2QRRA 3AD7C 1FKPA 5KT5A 1IBMF 4UW2A 2BR0A 3M05A 3NWRA 1TAQA 3OHAA 4QR2A 3OR1B 4WYWA 1HD0A 4N47A 4CTAB 1KSPA 4XIUA 4OJ3A 5BXIA 2OPRA 3H8YA 2MLZA 2AJ2A 3DHXA 2XMTA 5CYMA 2NXCA 2BJ1A 3TYTA 2HVDA 1QTMA 4USIA 1RCOB 2K06A 2QC3A 3QJLA 1NH8A 1RTHB 4FKYA 3WQPA 3RBDA 4FPIA 3EPGA 3SDEB 3ISNC 4JI6J 2R7VA 2CZ9A 4DS5A 1FD8A 3PR5B 1WORA 1WC0A 4BLGA 1XK8A 4DSKA 1X7VA 4LVOP 1IBKJ 2V2QA 1JNRB 2LXFA 3M8PB 1J5OB 1K47A 4OYOA 2CQPA 5J1PA 4J9OA 2FJVA 3D6FB 4FPRA 4CH0S 1UJ6A 4DF4A 4CRJA 1HMVA 1N32J 1IBLF 2B51A 3PJWA 1FXRA 2OI2A 2XQCA 1T9TA 5GAGI 1N8RT 3QQCD 1T9XA 3SV4A 1ZAWA 3ZC4A 4DXLA 5E0OA 4CYUB 4WYLA 3DN9A 2XCPA 4A8MP 1U2RA 3CC4S 2JEFA 3TZYA 3ZZ0A 3HMJG 4Y3CA 2GVDA 2CJAA 1TL1B 4NLVA 3QIPB 2V94A 2HFOA 4ZDNA 4JI0F 1HNZJ 2VQFJ 3BS9A 3PKMA 4ZCIA 4PG7A 2BJDA 1N36F 1RT4B 3QZ7A 2YKMA 2HFSA 3KHHA 1KNZA 1DTTB 2MB0B 1JLCB 1IWGA 4C0HA 4M95A 5KG4A 2W9BA 3K57A 1JX4A 3CJKB 2C2DA 1Q53A 1R27B 4M5DB 3W62A 3QRPA 4TYAA 2LEAA 2EI5A 2QE5A 3G87A 2CFXA 2GJ2A 2HWIA 1S9FA 3C2PA 3KDOA 1HBMB 1RISA 2PA3A 1UPPA 2NSCA 2CDQA 4DDFA 3FCWA 3MOJB 2DK2A 3KK3B 2KXHA 1T9VA 3J7A1 2XHCA 4IDKB 1Y9OA 1S9EA 1KTQA 5E41A 2CZVC 4W98A 3T3FA 4KKOB 4UZCA 1KQSR 5KFSA 4C3LA 1RHMB 3HHLA 1TKZB 4BC9A 3B6BA 2GFFA 3IRWP 1F5AA 2YQ3A 1I6JA 2HWHA 3RUBL 5GAHU 3CE8A 2BVZA 2YX7A 1CC8A 1U8SA 2Q79A 1FWLA 4M5MA 5HBMA 3CMES 3PFEA 4DR2J 2DXFA 3I55S 1YX2A 3NNCA 4DV2J 2EFQA 4TY8A 1WDTA 2IRUA 3D9BA 1Q8LA 3Q8RB 1FKOA 1VISA 2JOQA 1ZYQA 2YPYA 1X5SA 5KFLA 3VCDA 3MM6A 5KFRA 3ZTPA 1XR6A 4FNHA 2J9DE 1VQ9S 2B9XA 3G71S 3RRKA 2UXCJ 4CLZA 3PW5A 1RTIB 2KU7A 5HATA 1L3TA 4DX6A 4IYQA 3BGRB 3HFKA 3D0IE 3KMSA 1S6PB 1AA1B 4C8KA 4LRAA 4K4SA 2G2YA 1TAUA 3D1OA 1L3UA 3UO0A 1HLWA 1DARA 3JAMY 5HI7A 2R8KA 2E1PA 1YKWA 4FNIA 1GH8A 1N52B 2W7PA 1KLMB 3Q0AA 2VJVA 1OQ6A 1XMOJ 4USKA 3MEGA 3JSBA 1YDLA 1TMMA 4ZA1A 5DRKA 1CJVA 3FMWA 5ETRA 2F4FA 4RNFA 2Q1LA 4NLDA 2ZJRQ 3GIRA 1VIXA 4WFYA 3VAFA 5D15A 5ETOA 3DU5A 4DZ6A 3KLEB 2HQ3A 5HVHA 4OLOA 2RD5C 4DN0A 2R9LA 3Q2SC 2GJFA 2QTWA 3WC0A 4CLPA 4LF5F 1NB7A 2BE2B 3MMBA 1DAXA 1GMUA 4OHVA 3NRBA 2ZKUA 1AZSA 2VG7B 4F26A 3Q8VA 3MFIA 1VQNS 2VZ9A 2RNEA 2DT9A 5EHHA 3CW2C 5E3RA 4EU0A 2DNGA 2XZTB 2M5YA 4RW9A 3IWXA 1SC1B 3AJDA 2CQGA 3MM9B 2VUGA 3TRGA 2HNYB 4F7VA 5IT9Y 2OMOA 5A2QU 1TKXB 2HHHJ 5AE3A 4KGXB 1PO6A 1APSA 1V3ZA 2NYIA 1WF2A 5DGAA 3SZ2A 1M1KT 2VG6B 4DV6F 4B3RJ 3IWNC 4R5PB 3FBCA 3NP5A 2F40A 3D6HB 1QSLA 4Z7CA 1MU2B 4RZRA 2ZUAA 1WC1A 2GAHC 1M0SA 1PG5B 2OFHX 3KHGA 3KNAA 3GFHA 3CUNA 2PMWA 4JI7F 2F8HA 1HQEB 4BWJA 1VBXA 5KT7A 2XY7A 5KG1A 2WONB 4BWMA 1CJTA 3OXLA 4OHYA 3J80Y 2V8HA 3A4TA 3M30A 4X4SA 4IG0B 1LOUA 3MM5A 5EN1A 3DYAA 3U27A 2BANA 4NE9C 3M4XA 2W4PA 4I69A 4OHZA 1RHQB 2WVCA 4LFAF 4BDPA 1NAQA 3QJPA 4U95A 3OUYB 4IG3B 2BABA 1CJKA 5KFWA 2JNJA 4NLUA 4ZIWA 2WW8A 5GADU 2XI3A 2HFVA 1DTQB 5IWAJ 1UMJA 3R2DJ 2EKNA 2XS5A 4K0KJ 3HK2A 1ZPWX 2GO9A 3QPIA 2MGZA 3CDEA 3GB0A 1N0UA 2CG8A 2KYZA 1M5OC 4JOUA 3VAJA 3VVUA 4K4VA 4IKAA 2FHMA 1EAYC 2HNZB 4YQWA 1EP4B 3OFFA 2QLXA 1S1TA 4F2RA 3KLHA 2RB7A 4DUTA 3DRPB 4JV5F 4NLPA 5GAHI 3HCXA 3LO3A 2MKHA 1GTHA 3NAHA 4KRWA 3DOKB 5L1IA 4CLFA 2ZFHA 3FKBA 1GX6A 2E9TA 2JWNA 4OIXA 4AE5A 1T02A 1RT6A 3CULA 3MECB 1ZM9A 3TZXA 4Q43A 4ES3A 1JLGB 2BX6A 1NO8A 2HLTA 4X2BA 3CD7A 2MYFA 3AODA 4F04B 2EPIA 2ZH3A 4KE5A 2GJIA 4PWWA 4R8UB 4YS2A 1C0UB 4DFPA 4I6AA 3K5LA 1XMQF 4X4RA 1M1HA 2CNNB 3FDSA 1SC6A 2GMHA 3MWBA 4GKKF 3NOCA 3DDIA 1OSDA 4Y2MA 3RR7A 1Q5YA 3D3CJ 4A8YA 3Q22A 2E1CA 3GJTB 4TU8A 1H98A 2K7JA 4CIOA 4DR1J 2XY6A 4DV0F 3PRVA 4NA2A 3OV7A 3B4DA 4QWDA 4JI5F 2BJ8A 5KFAA 2UUAJ 5B0FA 4OZ3A 4OZ0A 2CJQA 4C11A 4ZPWR 2ZUGA 1JK9B 1RTDA 5F8LA 1G7CB 2XTJP 3PO4A 4B3TF 1XNRF 3BN7A 3HM9A 1NKEA 1RKIA 3G82A 4K4UA 3DLLQ 3HJFA 1SL0A 1KKHA 3FUYA 2FZGB 1NK6A 1QSYA 5IM0B 4W90B 2ACMA 1UETA 1X5PA 2J9CA 4WTOB 3RRGA 1WKJA 1HW9A 3KUGA 1R8CA 4MKVA 4ECZA 1D9DA 1FJ7A 3TJAA 3VGUA 1NSAA 2W8KA 4RBUA 1RWKB 4B3MJ 5KFYA 3FC9A 3EVMA 5C24B 3W65A 1YLXA 5HMXA 2DGSA 4J9QA 3SQGA 2HK2A 3TUIC 5LSLA 1B99A 2EK1A 1TVRA 3TA1A 4WK1A 4P52A 3KHLA 2MTLA 1TKTA 1Y10A 3ILJA 1NBEB 1UVMA 5KT2A 1H7WA 4DBQA 4O23A 5KFXA 3N6LA 1S1XB 3KYLA 3PW2A 2IRYA 1IWAA 5LOQA 3DI6B 1X4FA 1XWLA 4NLRA 1FJGF 4DV1J 4OZ2A 3NCQA 2JC1A 2OH2A 4WFXA 2KJWA 1IKYB 1JKHB 2H5EA 4HH1A 2V63A 3QMQA 4P2XA 1N5SA 1K0TA 4URQU 1Q7LB 4OI4A 4USHA 3A3PB 2ZDPA 4OX7A 3C15A 1F2HA 5LXRA 2DH7A 4PXBA 1VRTB 1UWBA 1GXUA 2M70A 5EWGA 2ZHAA 2XYPB 1LFWA 2OPQA 3MCMA 3NBPB 1UVJA 1RQ0A 5G0RA 5H9EJ 3THTA 1D3WA 3HHKA 2F9JA 3JYTA 4J37A 3OXFA 2WRMA 2K7KA 4GVLA 4MIWA 3M8QA 2LECA 1JLQA 1TUGB 2HAFA 2OGUA 2AF6A 4NRUA 4DCJB 3DU6A 2RU9A 1SJ4P 1FJCA 4WFZA 1RE1B 4NI2B 4YB7A 1FWPA 3DM2A 3W2WA 2HKEA 3AOAA 4DCOB 3OTBA 3RBXA 3G86A 1KC8T 4C8ZA 3ULHA 2NXNA 5JUMA 3IS9B 3QT5A 1VBKA 5GADI 1LWFA 2MLYA 2ROPA 4JI1F 4FS1A 5BJRA 1C4AA 2WK4A 1G1XA 1M5SA 1WDDA 3KWMA 1RWXB 2QLWA 4QIWD 2BZ2A 1NJIT 3BGLA 2PEBA 5LXYA 3FRYA 1QAIA 5GMDA 4KYZA 1VQ7S 2XMUA 3LUYA 4NLOA 5A8WB 2GNKA 5ETNA 2IVYA 3HHDA 4IOAQ 1U1MA 3NS7B 3DRXA 2CUYA 4B9LA 1TR0A 2FHOB 4PAAA 1VJWA 4V1Ak 1RHRB 2Z0GA 2MSTA 1N34J 4KHRA 1S0NA 3FCHA 1UCNA 1HI0P 2VBZA 2RRAA 4CNYA 1K44A 3ZXWA 1B7YB 1YI2S 2Y8WA 3ZTOA 2DNNA 4ID5B 2RUGA 3HDSA 4C6AA 2E9RX 2IAJA 4QWAA 2H51B 1Y5LB 5L46A 2R7QA 3ICLA 2H4YB 5H9FJ 1VK8A 2WHOA 4JI2F 3M9NB 3KJVB 3GYGA 4Y2CA 4LF9J 3I4HX 1MMDA 1WOOA 2E5GA 2WOMB 1S6OA 5F0WA 3G9CA 3BYRA 2PFFB 3PIPQ 2YNIA 1Y3KA 1WSRA 2BJ9A 3O5TB 3CJ8A 4X4VA 1HWUA 3TA2A 1RDRA 2DIVA 3CCLS 3MTJA 2Y8YA 2VASA 2QGFB 4NA1A 2C42A 3W64A 3CD5A 1AFJA 2A10A 4E98A 4QW8A 1ZBTA 2CKWA 2JEGA 4TVAB 2Q3PA 2YNFA 2CVIA 2IJNA 2DGUA 1HBUB 2BE7D 4ECTA 2UXDJ 5HL7Q 1S1WB 4Q0BA 3IBWA 2LQ8A 4RBTA 1S6UA 4K4ZA 1X5TA 4CO0A 2OEKA 3PACA 1VQ5S 4NCGB 1HIYA 1SCJB 3TANA 2HGNA 1C1CA 1FEHA 2A6MA 2IFXA 3OR1A 2VFTA 3RB0A 3CJTA 3MUMP 1IXKA 3EXYA 3HHLD 4NMLA 4OZLA 5KG5A 4ECUA 4J7CA 1OJ4A 4EEYA 1RTHA 2J8SA 1S0VA 5F9NA 3H5SA 2ZM6J 4NLWA 3PVXA 1CG2A 4DV5F 1YJWS 3HSJA 3SDEA 1RWWB 1S48A 2J0SD 1YRUA 1T95A 3I56S 5RUBA 2PO4A 3BSAA 1KR4A 4CO1A 4C48A 4Y34A 4PCQA 1FHTA 3Q24A 4KHPF 1SVDA 1NUEA 2UZAA 1U7LA 5HP1B 3M8PA 2NPFA 2QA4G 1J5OA 4ZPAA 4ED8A 1XJWB 3C46A 5K8PA 1FX4A 2PMHA 2N4DA 2YKPA 2V4QA 1YITS 2KXFA 2CPDA 1J2VA 3FBBA 1N4LA 2KZMA 4R25A 1VMBA 1VC5A 1HNIB 3GJQB 3QIDA 1X8DA 2P6TA 2PC6A 3L95X 4WCEQ 2LLZA 4IO9Q 4CYUA 2ZBQA 3TEGA 4MYUA 4A8SA 4DR5J 1RBLA 2PE8A 1NMEB 1QUPA 3HSZA 1TL1A 1J5EJ 3ZZTA 4K4YA 3C6TB 3QIPA 4N77A 4KIAA 3W1YC 4MIBA 5D78A 1F5BA 2UUWA 4DOZA 4ZOSA 3PJXA 2E29A 2KFZA 1DTTA 5M2PA 1JLCA 1VI7A 1RABB 3CJKA 1P9QC 2ZHBA 2VDHA 1RGVA 4CNZA 2DNZA 4M5DA 3VQTA 4L6V3 2D9OA 2V6AA 3Q86A 1U26A 1VCTA 2WVFA 5ETQA 1WNEA 1FTRA 4DU8A 4RWWA 3N4WA 1HBMA 4USJC 3B82A 2B56A 4XDCA 2X1GA 2XMWA 2HBYB 3KK3A 3N0VA 4NMXA 4IDKA 3UI3A 1BQNB 1YBUA 3EWGA 1AUSL 2KT2A 4KKOA 2HZCA 4G1QB 4J9VA 1GXLA 3D7SB 4OYIA 2N4CA 4YB1P 1TKZA 1OPZA 1YBTA 3T6BA 1N33F 3RGIA 1B70B 2MKSA 3QSIA 1UPMB 1IKVA 5D4LA 4X4PA 3DXBA 3ISND 3HKZD 3OTOF 2C1EB 2VPWB 5H9EK 4Q45A 2O5DA 3MHYA 1KD1T 5LMUJ 2NUHA 2W7AA 2MY7A 5IOLA 3UN2A 4DV4J 4OQJA 2MKKA 1YJVA 3QLHB 5DG8A 3HFVA 2ILZA 3KJNB 1NSPA 2G1HA 3R97A 3MMCB 4C8LA 3DDNA 2KJVA 1K8AT 2Y0SD 2B5JB 3G8QA 4S0MA 5E2QA 3BSNA 2E7WA 2YWKA 3HXMA 2AJQA 1G6BA 3B78A 5CCMA 2HHSA 3BGRA 3UD3P 1NK7A 3CCQS 4LSLB 3H2VE 1S6PA 3VAGA 4A4JA 1JJCB 3MZIA 5AXKA 2DR5A 3BPDA 1VLOA 3OHBA 4DR3F 1HWIA 1URRA 1MN9A 3TA0A 4JI3J 2HS0A 1TV6B 2XI2A 3VAHA 3DGVA 1DQ9A 4OHXA 5IZHA 1KLMA 4K7QA 1NSKL 3KUEA 3UVJB 3QWUA 2C2MB 4DCPB 4PG4A 1DURA 3IG1B 2KM8B 3D5MA 1JJ2R 4I67A 1TZ0A 3MM7B 2AX0A 3A1YG 2NSBA 4ZCLA 1VQOS 3M32B 1NB2A 4JV2A 1KQGB 5C2CA 4A48A 1U1NA 3PXGa 4ECYA 2UUCJ 3SFGA 3OJUA 3NNHA 1QAJA 4B3SJ 1T05B 2EEYA 4C98A 4BHQA 2HZVA 2AWZA 4ZHRB 3KLEA 4OX6A 3M9OB 2BJ3A 4DR7J 1VHFA 5H9FK 1O8BA 4Q7AA 4BS2A 2BE2A 2AYEA 4B9MA 1N0VC 4ZJQA 4USVA 2J6SA 4P7VA 2VG7A 2BJEA 1DHMA 2FJAB 3T1AA 1R8PA 1NRKA 2JL9A 2CQIA 2DY9A 4YDDB 4FVCA 4NZ6A 2V68A 2ZNYA 3LGMA 2B4OA 2F4VJ 2IM3A 3Q2TC 5J1EB 1HFEL 1JMTA 3W61A 3MM9A 2BM0A 2HNYA 4CLUA 4B9NA 1B0TA 5F9LA 5KFZA 2G2OA 4HHUA 3TI0A 5CXTA 1BUXA 3JQKA 1S79A 3M6WA 3P96A 1T9YA 1PKUA 4JB8B 4MJKA 3OFEA 4CH1A 3EGNA 1N56A 4OMFG 4DSEA 2R7WA 3V6DA 2C2RA 4CH7A 1MU2A 4DL6A 3RYLA 3LGHA 2DTJA 2QSFA 3P3DA 4WE1B 1S77D 1SIZA 2DO4A 2HHXA 4JI6F 1Y5NB 1HQEA 2BJ7A 2DO0A 4N5SA 2HGMA 1WKLA 1F60B 2WONA 1VQMS 3GWCA 2ADBA 4OX9J 2QYCA 4IG0A 4KGKA 1IBKF 3WBZA 2WZ1A 2EW9A 2IVFB 2HAIA 1Q8IA 2VKRA 5KT6A 3G8SA 2YKNA 2HRUA 2W1BA 4NLSA 1N32F 3OUYA 4IG3A 3VAMA 3NGKA 5L8RC 2BOPA 3OD2A 2FHJA 4F0KA 3X1LB 4L72B 4A8XA 4PEOA 3I96A 1DTQA 1G3OA 2F65A 2YKMB 1NLKL 5CD4A 2B9WA 1MWZA 1AROP 3PYFA 3QYYA 4BC7A 4B3OB 4WIQA 5BYQA 4H4MB 4FN5A 1JQGA 2HNZA 2CPZA 2XZWA 4Q8EA 1NKBA 3IGNA 1PYOB 3DRPA 4ZLJA 1ZTWA 2F1FA 4USUA 1HNZF 4DPTA 4DHVA 2VQFF 4ILRA 3R8YA 3DOKA 1V3RA 3PM9A 4C2MA 1RBOB 1S9EB 4NX9A 4RNNA 2LYVA 1WC5A 4O4GA 4ER8A 1FFGB 1JLGA 4IOCQ 3HVTB 4F0MA 2XEXA 5LT5A 4RKUC 1WTFA 4OV6A 4R8UA 4EBEA 2ZOMA 4ECVA 5AXLA 1MMNA 5IC6B 4LMZA 4PRFA 4QWCA 2ZJQQ 1V5VA 2BRLA 3AD8C 1UVKA 3HF5A 2KL8A 3CJSA 3RG6A 1HL6A 1U2CA 2BUNA 5K14B 4CDIA 3PFOA 5E33A 5IC4B 1IR1A 1RBAA 4E8UA 2W2MP 2ZD1B 3R5DA 2UVUA 3DGPB 3K5NA 1GK8A 2BEFA 1RAGB 2PFDA 3T5LA 4OYZA 5KFQA 3ZNUA 3PIOQ 1E6YB 3EMTA 4Y00A 4UY85 3BGUA 3DFEA 4NLXA 2YX4A 4DR2F 2LA6A 3RJMB 4DV2F 4QW9A 1ELOA 2W7OA 4I6YA 1A6LA 1BE4A 2ZE2B 3TJ8A 1SXLA 2N3LA 3OVSA 3N79A 5IM0A 4QPXA 2FJBB 2ZH2A 2CPJA 2OP5A 4WZQA 2UXCF 2AX1A 1RAFB 1RXOB 1RWUA 2Z4PA 4CP5A 2DISA 1Q81T 3AFGA 3NGSA 1VQ4S 3PX6A 4ZCKA 1XEZA 4CT8A 5GMEA 3TQEA 5A8RB 2CQ0A 4RU2A 1IVZA 4WZMA 2I5JB 3HKWA 2VC1A 5C24A 3BH7B 4JYAJ 3CDAA 1N5QA 1OY9A 3W5YA 1T03A 1Y00A 3IRXB 4EYHB 1FRXA 4WK3A 1IR0A 5CABA 2BA9A 2C3OA 1V3SA 2E1RA 4V19J 5MAOA 3CC7S 4OL8A 1BC6A 3P8BB 1XMOF 2YY3A 3G6ES 2YBVA 2UU9J 3EZ5A 3Q23A 3DI6A 5IXUA 5F0UA 5D0GA 1BY9A 1XNQJ 4H54A 4Q2MA 4WFNQ 3EICA 5L9NA 4TXSA 4OHWA 2HW3A 4UQGA 3HFZB 1SH0A 1OIAA 1IKYA 1F9EB 1JKHA 4OI6A 4PWUA 2V2VA 2HLUA 2NLWA 2RVJA 1H73A 1BQMB 1S6QB 2FIUA 1SL1A 3QFHA 2HQCA 4J9SA 3NS5A 4PXCA 3N6NA 4QQBA 4CO3A 4RUAA 3TUZC 1VRTA 1VK3A 2UP1A 1NDKA 3EGVA 4QCLA 3NBPA 1T9UA 4N8NA 4DL2A 4DZDA 1FDDA 1RAIB 2CQ2A 4N56A 4EO6A 3KDNA 3DOLB 3TZWA 4HKQA 4DG1B 2EFVA 2GW8A 4KSEB 2AV5A 2G0CA 3OJSA 2O01C 3BPSP 3CCVS 2DIUA 4NI2A 3P5TL 3UCUP 2HHHF 2OKQA 1SQEA 1TK0A 2RILA 1FRMA 1RZMA 4NLTA 2RRBA 3JXOA 2AKWB 1UJ4A 1Y0HA 3DCAA 2AZ1A 1OS5A 4FXDA 2QSWA 4ZVGA 4B3RF 3KXDA 4AXIA 2ATCB 3KTQA 4NYPA 4F4ZA 1TUVA 4OJHA 3PX0A 2ZZMA 3VHQA 2RUSA 2FVQA 5L1JA 2BV3A 4F36A 1UZDA 4UOHA 2OD4A 3JQMA 3R7SB 2XLJA 2PEHA 4FYDA 4P74A 3BO4A 1JLAB 2DBBA 3B8HA 2FVCA 3OTEA 7AT1B 1UVIA 3IO1A 1ITPA 4CT9A 1A7GE 2VJUA 1OYDA 1OO0B 1FA0A 3I5CA 2N7CA 2AJ4A 1S1VB 2YQ0A 3TARA 2UVRA 3BR9A 3QGHA 3NGTA 5HVFA 3DLJA 2W2PP 2RH3A 2OPSB 2CDRB 3RBZA 4E2FB 4KB7A 4DSJA 4ID5A 1D9FA 3OL8A 3T1YJ 4W92B 2PDAA 2HQIA 2XMAA 1F6TA 2O3DA 5IWAF 1RT6B 2O1PA 2GAGC 3KJVA 2RJZA 4I7FA 2CAJA 1JWWA 2WOMA 1VBYA 2BW7A 4ZKAA 2NQPA 4MK7A 2E5LJ 4LF6J 1R6VA 1NK4A 4AT1B 2BBEA 2KM8C 1GXTA 1FFWB 3ETOA 3H4DA 3VZHA 4CM2A 2MZ1A 2IRXA 2B6AB 1N5YB 3ISZA 4EI2A 4UZBA 2DHXA 4KHMA 3MFHA 2WSEC 3J7YU 2KRRA 1IJEB 2R7RA 1R0AA 1U1KA 4RW8B 2D1CA 5B08A 2JEIA 4DS4A 1HBUA 2AIRB 2CPFA 2G2ZA 4G1PA 5D4PA 1S1WA 2XMKA 2Z30B 1VQ6S 1VIOA 1TP7A 1RUSA 2J0QD 2VBXA 1DQAA 3BB5A 4NCGA 2VC0A 5HSPA 4ECWA 3FSIA 4HDGA 3DKDA 2ASYA 3ZZOA 4NLYA 3S8SA 1UTAA 4LBPA 2MQMA 5J2NB 4DR4J 2OPPB 5C7PA 3VGSA 3VAKA 3DLGB 2VH7A 4G65A 4XTTA 4A8OA 2R7XA 3FFIA 4DR1F 3KG0A 4PG6A 3V6HA 2I2YA 4K59A 3BGFA 4LIWA 4J9PA 4I6WA 2MZRA 4QYZK 2ZH8A 2IVMA 2UUAF 4EUVA 3MD1A 3H5XA 2KKHA 3UDCA 3MDFA 1CS4A 2IJFA 2UVWA 1KVJA 2DHAA 4NA3A 3GR1A 5HP1A 2RDDA 1N5VA 2H5JB 3IM9A 1MWQA 3W5ZA 3DRYA 2W9CB 1JJHA 3HSDA 2MQNA 3MPUB 1D09B 2WB4A 5KFEA 1CLFA 4L3NA 2ZOGA 1DLOA 4DL7A 1NXIA 3KFWX 2HURA 1H3DA 1HNIA 2OLWA 2W2OP 4DX8H 3PJ9A 4U7UK 3WHIA 1QE1B 3IR6B 4M5KA 3HULA 4C97A 3NGDA 1NZ8A 2RQMA 5B0AA 1FF2A 1YZ6A 3POTB 4B3MF 5KG7A 2WSFC 2DGOA 3V6KA 1WSVA 2R8GA 1K9MT 4LQ3A 2DR9A 2UUBJ 2KH9A 2RT3A 3K58A 2M7SA 3Q8UA 4ILLA 1U1OA 2W4CA 3N6MA 3N5FA 3C6TA 2DH8A 2MEWA 1Q8KA 2NXUA 2L9NA 2NS1B 2O67A 2IY5B 3R7BB 3ENAA 4ES2A 4GC7A 3KG4A 2KHCA 1VHIA 4ED0A 1VR6A 1MW7A 4X84A 3UR0A 2CJYB 2J6TA 1XERA 4DPWA 4DV1F 3OW2R 3FZBA 1PAUB 2DNKA 4LR9A 2DD8S 2NXEA 3CJ5A 1EQ0A 1M1GA 3WX4A 4UOGA 1BXNA 3HD1A 3E3XA 2C3MA 2GQ2A 5FIIA 4RUHA 4DX5A 3BGOP 1BQNA 1M5PC 2GGPB 2FVPA 3PRDA 3BQ0A 5LL6d 4G1QA 2FVSA 2QT7A 1UA1A 4USMA 3CGIA 4LRCA 1UVLA 3TP2A 3VZIA 3D0HE 3ADAC 4KGVB 1REVB 2CPHA 1F0XA 4XPCA 1ZAXA 1T3OA 4M5GA 3R27A 4RNOA 4ECRA 1IKXB 2GO8A 3MEEB 4HI2A 5B0BA 3F44A 3QLHA 1D0EA 4IR9A 3UW1A 2BMBA 4DR3J 2W24A 2XY5A 3KOAA 3MMCA 4F3MA 4WKYA 3RTVA 2BYCA 1LNQA 1ICEB 1NPKA 1PGZA 1X4HA 2ZDOA 1HNXF 5LMNJ 2OJ3A 3CJRA 2WVEA 2HQDA 4XO0A 5L9XA 4B9TA 3HLUA 4WTYA 1KFDA 4PZVA 3TX8A 4QR1A 5IFMA 3GV5B 4RW4B 4LSLA 1KFSA 3BBFA 3HVRA 1CQMA 1KHVA 3LALA 3VWSA 3NG8A 4R0JA 3M2UB 4RNMA 3H40A 4U96A 4IQXA 1RJJA 1TV6A 3FVYA 3J7YI 2GHPA 4OYPA 1X4GA 3M2VA 2KDOA 3KLVA 3PY8A 1RT7B 4ALZA 3UVJA 1N34F 1H72C 1BMQB 4MKYA 1NK0A 3O8WA 3FGVA 3IG1A 2YNGB 2FHJD 5H1SV 3MM7A 3ETMA 3BR8A 2FB0A 3C6UA 4KGMA 3M32A 2D41A 4RWXA 2B3TB 5F41A 5DS7A 1WELA 5KT3A 1KQKA 1T05A 3CWJA 3CDUA 4HTJA 5HMZA 2LCWA 4LF9F 1ZOTA 1FD2A 3GFXA 3PYDA 3GLJA 3HJVA 4F0HA 3MEDB 4DUYJ 4NYZA 5ETKA 2YKAA 5F8MA 1C1CB 4P2SA 3KLGB 2L08A 4NZ0A 2HWTA 1OY8A 2EFPA 2L9WA 3E2EA 2OFGX 3QO9A 3GE9A 3SCJE 3OR2A 2VB6A 3I5AA 4F4AA 4MFBB 5ETSA 5J1EA 2UXDF 2BRKA 1EIYB 1NJXA 4OJ1A 1RHJB 3NY0A 2HSEB 3MPVA 3CIZA 5HO4A 2OTLS 2WVDA 1WOSA 3C14B 3NCPA 5ETVA 2X3GA 4ZK7M 4K4XA 1TQLA 1HBOB 3D2WA 2XO7A 2QA4S 4RU9A 4WP8A 1VJQA 4OI0A 1RAAB 1Y4ZB 3TO8A 3G6YA 3RU0A 2Y1RI 2QIFA 2KO1A 2M0GB 2HGLA 2DITA 1U09A 4ZN1A 1SKRA 1SJFA 2V2KA 3M7VA 2M4MA 4OZJA 3OTDA 2ZM6F 5E3PA 1PAEX 4WE1A 1HNVB 2ZWPA 4CLWA 1CC7A 2QL7B 3TOQA 4DQIA 5FDLB 3UNGC 3BJYA 3LF0A 5K20B 3P49B 3IFEA 3DLBA 2FGOA 1YIJS 4ZP6A 5KG0A 2SXLA 3D67A 1WF0A 4DQSA 2AT1B 1EB0A 4YFUA 1TL4A 2WB1D 3O3LA 2CIMA 2ZC3A 1KS2A 3D6TB 2DRAA 2HHPA 3T6JA 4AYBD 1VQ8S 4O4RA 5JVHQ 4LF7J 1CJUB 2IM2A 2F9DA 2LQBA 3NWGA 2R8JA 2MKJA 1EETB 4B3OA 4DUZJ 3H7HB 2K1RB 1Y7PA 4O44A 2XBPA 4AQYJ 1Q5VA 4CWBA 2BDPA 3OFHA 4H4MA 2VPYB 5F3TA 4DR5F 1U0HB 3V4MA 3V81A 5BYSA 3Q8SB 1JLFB 3E51A 2IYIA 1J5EF 4EBCA 4LR8A 3M9MB 3K5PA 1IKWB 3QT6A 1FVQA 2CJBA 1W7WA 4NEZA 5CYJA 4P72A 5B7WA 1CPZA 1E6VB 4ED4A 2LDYA 2IDLA 2RHSB 3ELHA 3FMBA 2IBKA 3ILOA 3UD4P 3M1VB 1YJRA 3OT9A 4KAIA 4WU2A 3LPYA 3UD5A 5C2GA 4YN3B 3HVTA 4D3GA 3I9V9 1DFDA 1KBRA 2W2NP 1RB0A 4P2MA 4CO2A 3GIKA 1HR0J 3KNGA 3CF5Q 2VHGA 1IKVB 4NXNJ 5I3QA 2FTRA 4U8YA 4B9UA 5K8OA 3ZO7A 1EARA 3W2VB 4U6PA 4LIRA 3PEJA 3K8WA 6AT1B 2MQOA 1AXQA 2DJWA 4FF2A 4HYKA 3M8YA 3CIMA 5K14A 1HNWJ 4ITSA 3Q8YA 1TU0B 2JRSA 4YUDA 2ZD1A 3UWTA 3DGPA 2EXUA 4K8RA 1FK9B 1RI7A 4U67Q 3IGVA 1E6YA 2IBOA 3MR6A 2OMLA 4O3QA 5AXMA 2CPIA 2OO4A 1KLNA 5I3PA 2Q43A 5T14A 4YB6A 4HVZA 5LMUF 3EZUA 2IM0A 4DV4F 2VA3A 5KFGA 2ZE2A 1Q4RA 5B09A 4YB5A 2GX8A 1U0SA 1DJ0A 1EZZB 1M5KC 1X9SA 1NHUA 2CPYA 2KT3A 1CSJA 1AT1B 4X62J 3QAEA 2RDJA 3MURP 4P71A 3KLFB 1C1BB 4PYAA 4CLSA 3BDPA 2JVRA 4KV8B 1AB8A 1ZETA 1KVIA 2VL1A 1JLBB 2DCLA 5A8RA 2BQ3A 2OSRA 2I5JA 4HACB 2K3KA 3I9ZA 2B0GA 3VALA 3CPWR 1SUQB 2AJ0A 2KG1A 3CJ2A 2C22A 5U47A 3AQOA 5FD1A 2XYHB 2JLGA 4LFCJ 4LF1A 1YWXA 2RE1A 5A8KB 3H20A 3DOMB 4LQ9A 4JI3F 3IRXA 4WF9Q 2N82B 4DQRA 1O5JA 2V5HG 3W8PA 3ZTSA 5ITHA 1HQUB 2HRYA 2B9EA 2A1BA 4RUBA 4HT7A 2JC0A 1RWOB 2VG5B 4ZJOA 4DFKA 1S4EA 4URGA 2U2FA 3H5UA 2KVIA 2DVIA 3QSYB 3IA0A 3JAMU 4QR0A 2GCFA 4G1IA 5DZ7A 4WFBQ 2F63A 4N41A 1UP1A 5ETMA 4UQTA 3RRHA 3JQJA 4DMZA 5IQ6A 1X9WA 5KG3A 2UUCF 1RWNB 4RBVA 4DFMA 4IUFA 2EVZA 4I56A 4B3SF 1I51B 1W2IA 2P6SA 2CQHA 4KR0B 1BQMA 1S6QA 2QLFB 4I64A 3KHRA 4L73A 4DR7F 2VQEJ 3DLHA 3GCXP 3GYNA 2RIJA 1L5UA 1MWYA 2A6OA 2MPUA 2Z56B 3HPOA 2B43A 4NCAA 2M3DA 3EUNA 3TWZA 5GMKa 2EC0A 5F8NA 1WEXA 5THWA 1KN6A 4DX7A 2GHVC 4DLGA 2X51A 4A8FA 4RPFA 2YWFA 2LXUA 3V6DB 4K5SA 1LW2A 2F4VF 4KC5A 3MI7X 2HQFA 2V67A 2Z8QA 3DOLA 1B3TA 2PMZD 4DG1A 1FRIA 2ABYA 1HI8A 5I3UB 3QRQA 2HVZA 1RACB 2KN4A 4J9KA 2ZBIA 1GEHA 2VV5A 1SKUB 1HQ2A 3JSMB 3V2UC 1NCLA 2XMMA 1MNEA 2EBEA 5IT9U 3QAUA 1LQ9A 4PUOB 4ZPVR 4P73A 1NDPA 3BKTA 2YKNB 5KFOA 2PD1A 2XMJA 3PDNA 2FHKA 5L39A 4IQMA 4DQPA 3GFYA 1NSQA 1H7XA 1YTYA 4C4WA 2WCXA 2E5HA 5DM6Q 1JLAA 1U45A 1DBDA 3SFUA 3BYPA 4NLQA 3ZNJ1 1FX2A 5K5MA 3LP0B 3ITHB 4OX9F 4CI0B 3MMAA 1Z2LA 1ZM3A 3ONQA 3KJQB 3LA0A 1S1VA 4LF4J 3IC1A 1P27B 2UXBJ 1BLUA 3PEHA 1HBNB 5HN0A 4NASA 5DQGA 4FYYB 2MQPA 2X3DA 4OJGA 2OPSA 5G4DA 2K3IA 5T7LB 4DI6A 3O6QA 3TJ9A 3R6LB 3J80U 3NL0A 1O6XA 2YTCA 3I0SB 3CC2S 1NK9A 4Z7YA 1SV5B 4J9NA 3K5MA 3T1HJ 1IQZA 2CQ1A 2YWEA 4O4GB 2XSFA 5B0CA 2VA2A 4L74A 4U7CA 1KRPA 4MAKA 1LK5A 2ZH5A 1HA1A 4DV7J 4KJIA 3KK1B 4F67A 1QM9A 4W4MA 3LANA 1AYEA 2E1MC 3AJ1A 3CJQA 3M6XA 4QJVA 1BD6A 1XIQA 1FDBA 1JIHA 2G9OA 3R9LA 2B6AA 1N5YA 4YHHJ 4HEA9 4ED5A 4FVMA 4PQAA 1FRLA 4DSIA 1KQFB 1XTZA 1I94J 4DN9A 4RW8A 4FXWA 4Y65A 2HRTA 2VD3A 3LW5C 5ETLA 3PYEA 1RAJA 5CZXA 1D8ZA 2AJFE 4TLQA 6FDRA 5MLCV 5DDRC 4PKDB 1YSJA 3FSXA 1TL3B 2ZOFA 3TAMB 3ENVA 2R2TA 3DLKB 5ETTA 1U1PA 4X66J 5KFMA 4KT0C 3SSRA 4ZN3A 2B4UA 4P6QA 1B0PA 2ZC4A 2XNRA 3UFCX 4J9LA 2NCKL 1U1LA 2NYHA 1UJ5A 1P6TA 2XULA 3EE3A 1S0MA 5J2NA 4ICLB 2OPPA 2E1AA 1UKUA 3DLGA 2QX0A 3SQOP 2APOA 1CBKA 3LH2S 2FYXA 1Q0NA 3WDOA 3SV3A 5DZ6A 5DQHA 3CT9A 5IV3A 1Q1KA 2BXJA 2Z2MA 4DPUA 3TQ1A 1KWMA 4QBUA 1SJRA 4C0OC 1RAEB 1WHWA 4UY8T 1T0TV 3U7JA 2B7BB 1TFYA 4X64J 1BGXT 4DPYA 2D3OR 1GAOA 3KLIB 3PG9A 4FBUA 1RA6A 3IR7B 2QJ3A 3EPIA 2W9CA 2L48A 3CCUS 1T03B 2BW2A 3MR5A 1I5OB 2A2DA 4V19X 3LWMA 1JLEB 2JJ4D 2M8HA 2XS2A 2V4JB 1YRTA 3PX4A 3A8IA 3OL7A 4USWA 1Q79A 1QE1A 1XMBA 4GKJJ 4WJBA 4FKXA 1ULRA 4KGZB 5KFBA 1WACA 1LEOA 3POTA 2GIFA 2ZH9A 2RF2B 4JYAF 1P9YA 2HBRB 3TUPA 2RQCA 4I1TA 3HHLC 4N8OA 4LFBF 5FLXY 2HK3A 3EDRB 1IBCB 2JLEA 2VFRA 1HWKA 1GT8A 3BBCA 5KFKA 3RAMA 4F4YA 2UU9F 3W63A 3NGUA 2L3MA 2LP4A 3D68A 1EQMA 1VDHA 1XNQF 4M94A 2C2EA 2OAUA 4ELUA 3J81Y 4HI1A 3CCES 5AE2A 1PBAA 1RT1B 2JX2A 2IMOA 4WFAQ 1SC4B 2DXDA 2RHQB 3A8EA 3PHEA 1RP5A 3SSSA 4LREA 2MQQA 1S72S 1VBZA 4TNOA 2GGPA 4K2JA 2DNQA 2H1YA 2ZKTA 3W66A 1J27A 2Y1LB 4DV3J 2XLKA 4YMEA 3MD3A 3KG1A 5CZVA 1HNXJ 3HHEA 3T5JA 1RT2B 5DG9A 3MR3A 3QGIA 4NLGA 1REVA 4R0EA 4CQ1A 2CJ9A 3EX7B 2ILYA 2I8EA 2ZH1A 1IKXA 2B4PA 2J8AA 4TKTA 1FEEA 3MEEA 4DL0C 4RW6B 2DNPA 1IJFB 3MF5A 4ID8A 2W2QP 2H4WB 2WSCC 2OD6A 5HANA 2AQ4A 2M8DB 4J5OA 2A18A 2V4RA 2OELA 1S76D 1U49A 1S57A 3SCKE 4JI8J 3J7Z5 4MH8A 2MJNA 3HI9A 4KO0B 1JJ4A 2ZBPA 1YRXA 5JMNA 1Y5IB 2DYAA 2MQLA 4IOBA 2ZH6A 4BCAA 3ZFVA 1HPZB 2X1BA 3I82A 4LT6A 4H4OB 4JV0A 4OX8A 2B8QA 4DL3A 4RW4A 1HHQA 5KFTA 1M90T 3ILIA 3NLCA 4ZPBA 4UUWA 2IA0A 3AB4B 1NK8A 1R31A 1GMWA 4WKRA 2G1DA 3M2UA 2AYGA 3D3BJ 4WP3A 5A6PA 3HHNB 4I7FB 4ECQA 1RT3A 3ZZZA 1U6ZA 2DR8A 3AAWB 1RT7A 4M1KA 5K8NA 2COLA 1IQTA 4AL7A 2RQKA 6FD1A 3WIUA 4TLRA 2YNGA 1JNZB 2DHHA 2YX1A 1CQNA 3MGJA 3VV2B 4EFAC
chains in the Genus database with same CATH topology
3OUYB 1S1UA 4IFVA 4KB7A 4IG3B 2BABA 5KFWA 4ID5A 4DSJA 2DGTA 4NLUA 4X4NA 1D9FA 2R7TA 3OL8A 3T1YF 2WW8A 3UPFA 5GADU 2XI3A 4W92B 3QGPA 2PDAA 3D54A 2HQIA 2VFVA 3DMJB 1U47A 1R0AB 2VPXB 1VS3A 4QIFA 1DTQB 2O3DA 5IWAF 3CCJS 1UMJA 4KTQA 1RT6B 2O1PA 2XS5A 3KJVA 2RJZA 3O44A 3HK2A 1ZPWX 5D8HB 4I7FA 3LP2B 5L1LA 1MSWD 2GO9A 3QPIA 1JWWA 3NNAA 2MGZA 3CDEA 4YR3A 3PKYA 2WOMA 3LAMA 3GB0A 1B64A 1VBYA 1N0UA 2KYZA 4ZKAA 3RBEA 1M5OC 3MEDA 4JOUA 2NQPA 3SYZA 2HHQA 3VAJA 3L09A 1PSDA 4K4VA 3U1MA 2MKIA 4IKAA 2GIRA 2FHMA 4MK7A 2E5LF 4LF6F 5CD4H 1NK4A 1PC5A 2HNZB 4YQWA 2BBEA 3KKFA 2KM8C 1GXTA 3ETOA 3H4DA 1EP4B 3VZHA 3OFFA 5CQGA 2QLXA 2L41A 1S1TA 4B08A 5A0YB 4F2RA 3KLGA 3KLHA 1L3VA 3DRRA 1VGYA 2RB7A 2MZ1A 2LMIA 3DRPB 2IRXA 2B6AB 1N5YB 3P6YC 3ISZA 4JV5F 4NLPA 3GV8B 2DHXA 5GAHI 3SXLA 4KHMA 3MFHA 3LO3A 1R7IA 2MKHA 4OZNA 3U1NA 1HYSB 2WSEC 3KK2B 1GTHA 3NAHA 4KRWA 3J7YU 3DOKB 5L1IA 2ZFHA 2KRRA 2CYYA 3HVAA 1GX6A 4YOEA 1IJEB 2E9TA 2R7RA 2JWNA 1NU4A 4OIXA 4MFBA 4AE5A 1R0AA 2ASDA 4M8LA 3WZ0A 4XDDA 4B02A 1FVSA 1U1KA 1T02A 4RW8B 4Y28C 2CQBA 1RT6A 2D1CA 2UVVA 5B08A 2BQRA 2JEIA 1O0PA 4DS4A 2W9AA 1HBUA 3CULA 3MECB 1ZM9A 2CPFA 1XBWA 3N9UC 4ES3A 4Q43A 3FFIB 1JLGB 4G1PA 5D4PA 1S1WA 2XMKA 5I42B 2W9BB 1NO8A 2HLTA 4X2BA 3CD7A 1VIOA 1VQ6S 1SKWA 3BF4A 1LFPA 2MYFA 1TP7A 2J0QD 2EPIA 2VBXA 2ZH3A 2GA7A 1DQAA 4KE5A 2R2RA 2GJIA 2R4FA 2NR0A 1RTJA 1SH3A 3BB5A 2FLNA 4NCGA 1N6QB 4ERDA 4R8UB 1U2FA 1C0UB 2DGVA 2VC0A 3MTKA 4DFPA 3ZZYA 4I6AA 4ECWA 1EP4A 3FSIA 1RYRA 4D3HA 4HDGA 1LWCA 2D3UA 2MY8A 4ZPCA 5HROA 3K5LA 1XMQF 4X4RA 2ASYA 2A2CA 3ZZOA 4Z37A 1HBOA 1NJWA 3FDSA 1RK8A 4NLYA 2JSXA 2FPHX 3CCMS 3OSPA 3S8SA 1AW0A 1SC6A 2GMHA 1VQSA 1ZM2A 5AE1A 1U6FA 2MQMA 1LW0B 5C25A 2CQ4A 3MWBA 4DR4F 5J2NB 2OPPB 2LKZA 1Q8BA 3VAKA 4GKKF 3DLGB 1R6YA 3DLEB 2VH7A 4Y6IA 3G8TA 3TR5A 3JTNA 1OSDA 1O51A 4Y2MA 3RR7A 3H25A 4A8OA 3IAM9 2R7XA <