3WZ0A

On archaeal homologs of the human rnase p proteins pop5 and rpp30 in the hyperthermophilic archaeon thermococcus kodakarensis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
NRYIAFQVIGERPFKKDEIKKAVWEASLSALGYLGSARAKPWFIKFDEKSQTGIVRVDRKHVEELRFALTMLTEINGSKVIFRTLGVSGTIKRLKRKFLAEYGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On archaeal homologs of the human RNase P proteins Pop5 and Rpp30 in the hyperthermophilic archaeon Thermococcus kodakarensis.
pubmed doi rcsb
source organism Thermococcus kodakarensis kod1
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 3
total genus 25
structure length 104
sequence length 104
chains with identical sequence C
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01900 RNase_P_Rpp14 Rpp14/Pop5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wz0A00
3WZ0A 2CZVC 2AV5A
chains in the Genus database with same CATH superfamily
2VPZB 4TY9A 5BYSA 5DETA 4F3OA 3K8WA 1S6PA 1RSCA 2BRKA 2W24A 3CEDA 1N4LA 3D1QA 1HNWF 3NG8A 4PG8A 3IR7B 3K5PA 1YDLA 5C25B 4B3MJ 3LPEA 2CJ9A 3GJQB 3CJTA 3THPA 3DCAA 2ZHAA 4F4KA 3NNCA 1OMSA 3QT5A 4DFKA 4U8YA 3OTEA 2AEMA 5KFNA 1FJGJ 4M5GA 3I4HX 1F3FA 4MH8A 4URSA 3KK2B 3IRXA 4QWBA 4ETXA 3MD3A 4ZLLA 1YBUA 4A8FA 2IJNA 2NR0A 2RSQA 5ETTA 1S0MA 3RW6A 1U02A 4H4OB 4NL5A 4QPTA 3HVWA 3T41A 3TX8A 3FDSA 2O01C 1RTIB 2I9SA 1SL2A 4DJBA 1AYEA 1U2RA 2DIVA 2QZ8A 5D77A 1FE0A 5AE1A 2QL9B 1Q5VA 4K5RA 2Y0SD 2P5VA 2IVFB 3EJMA 1UTAA 1UVNA 1HQEB 1EARA 3RRHA 5CCMA 2QSWA 3BSOA 4C7QA 3PJWA 1X31C 2E7XA 5C5JA 2HVIA 3IWXA 3A4TA 4K4WA 3NNHA 1SQFA 1Y11A 2F1FA 4YQWA 1EAYC 4LFCF 4NZ6A 3GJRB 5GMDA 4OZJA 2IRUA 4LSNB 3M2RA 4YHHJ 3PX4A 3TUZC 3NEKA 3M8QA 5I42B 5LMUF 2X1GA 5FD1A 1IBMF 3I87A 3KLGA 3EVWA 4DUYF 1KN6A 5KFIA 2J76E 4Q7AA 1GMVA 1S6OA 1HMVA 1WOOA 4I7FB 3F0NA 5KFAA 4MTPA 4QWEA 3GYNA 1SKRA 1SI9A 2MLYA 3F56A 3KDNA 4O4GB 1T9VA 2D7SA 4NLDA 4C8OA 4MFBB 6FD1A 2V50A 3FZBA 4QIVA 5EUHA 1KC8T 1VISA 2FHOB 5KFDA 2BE7D 2OFHX 2GV1A 1CBKA 3H5UA 1KTVA 1WUUA 1NKCA 3T9NA 2A1BA 4IR9A 1WSVA 4DR1F 2HHWA 1M1GA 3ISND 3OW2R 4NWBA 1X5SA 1TKXA 5HVHA 2RRBA 1FF2A 1RP5A 4FVCA 1WG4A 4M5LA 3HHLC 2N7CA 3ELHA 4G1QA 3EPIA 2VQEF 4ES1A 4ZCKA 2ADBA 2YBVA 4B17A 4DSEA 4C8LA 2FIUA 3HP6A 4LSNA 2OPSA 5IQ6A 1U6FA 3EZUA 4X62F 1RT5A 4LBPA 4JI8F 2IJRA 4WWSA 3SCIE 3FBCA 4BHQA 1N5VA 4EO6A 4F25A 3TZYA 2V8GA 1NSAA 2VUGA 3BH6B 3JSMB 1E6VA 2E7WA 2PSZA 1NKBA 2ZJRQ 2FY1A 2HNZB 2DNNA 4ZIVA 5F3TA 3DMJA 1S6UA 2XGQA 2EFQA 2ZH4A 4LRFA 2ROPA 1IKYA 2F9DA 4A8KA 2OI2A 2CQPA 2HQCA 2ROGA 1U1LA 4QIEA 3HJFA 1TUWA 3U1MA 4DX6A 1RT7A 3ILIA 2CPHA 5D4LA 2EPIA 2HLUA 4PWWA 5F8IA 1DAXA 2A2CA 1LKZA 5B0DA 3K5OA 3QAEA 1EETB 1K47A 4KO0B 3R2CJ 1N32F 2R8KA 2JEIA 2HHHJ 2ZJQQ 4ER8A 1FKOA 1GNKA 1DURA 2A2DA 3FUYA 2DRDA 1TELA 2OEJA 4OZ3A 4ANDA 1Q1KA 2J0XA 2MQNA 1V3SA 4X65J 1S1VB 2ALZA 2DTJA 4RU2A 4K4VA 4JV0A 2QX0A 3MEDA 3JQKA 3HFZB 3PACA 3C15B 4ZVRB 3EXYA 1OQ3A 3D6MB 2Q6CA 4LRCA 5B0FA 5HATA 1VQSA 2AHOB 3R97A 2BKOA 4HTIA 2O3DA 1VIOA 2IM3A 4IUFA 3O44A 1URRA 3TANA 4UUWA 3OFHA 2IVMA 1VQ8S 3NL0A 1KP6A 1ACMB 4WK1A 1MMLA 2R2RA 3SCKE 2BABA 2D9PA 2WZ1A 5CYMB 1GMWD 3MD1A 3PXGa 4Y0FA 2NSBA 2YNGB 4X4QA 3M1VB 4RLEA 3J7Z5 4I1TA 1FX4A 3B54A 4CO5A 3CC2S 1YX2A 1SKSA 2VOOA 3J7A1 4F02A 3QLHA 1S4FA 2P6TA 4QOTA 4RJVA 1VBYA 4AQYJ 1J5OB 3EMTA 2XY5A 5GMKa 1VC0A 1RJJA 3MECA 2AEJA 3BR9A 4IO1A 3VGUA 4H4MA 3W2VB 4B9UA 2NZ4A 1NNDA 3EICA 3W63A 2IM1A 1NM2A 2Z56B 3DLHA 3KKFA 4JP8A 3IP0A 4N56A 4B3RF 2XMMA 2W4CA 1CQMA 4DV7J 2G4BA 1VRTB 3TAQA 2ZZTA 4HH1A 1TK5A 3SSQA 4PYAA 1FK9B 3OTOF 4EUVA 1M5HA 2WBRA 2J8AA 4NLUA 2BA9A 3BO4A 3DOKB 3THVA 2NXCA 1WG1A 1HD1A 2DR6A 2XMTA 1SC4B 3P8BB 1FRHA 3PDNA 2B51A 3C66A 2DGVA 2UV8A 1K9MT 3IFEA 1WEXA 3HDSA 3BH7B 4F04B 2CQCA 2LU1A 3CCES 1QUPA 4DV3F 3QLHB 1M5KC 3PZPA 1W26A 2OPPA 3MMAA 3TA1A 3UDEA 3ISZA 1SUQA 1ZM9A 1NK0A 4CP5A 2ZHBA 1S12A 5KT6A 3TJ9A 4DV2J 2ZWPA 3CIMA 3CVKA 4JUZA 3OVSA 2RDDA 2G13A 2QV6A 3ICLA 4HHUA 2BX6A 4J9NA 4U96A 4P2SA 2NXJA 2EFGA 5A0YB 3HXMA 2Y1JA 1XNQF 4YFUA 1NO8A 2WK4A 2E7VA 2HWTA 1T9UA 2XSJA 3LAKA 3NWRA 5DZ6A 4DL0C 2OSQA 3Q8PB 3OHBA 4EBEA 4PXCA 2YQ1A 1KFSA 2QA4G 3PYGA 2LQJA 4C8KA 2H9ZA 1UA0A 5HROB 2WVCA 2DR9A 1SCJB 3QT7A 1S9EB 3MEKA 2MQOA 4DR3F 1B7FA 2NREA 4LQ3A 2YKNA 3VTIA 2EK1A 2V2KA 3GTYX 4PZVA 1P8GA 3KJVA 1N33F 3DOKA 2UVWA 2DNRA 5E33A 4F0HA 2QT7A 1UETA 1Y5LB 1FKPB 2GIQA 4LIWA 3BYPA 3DRSA 2CNOB 1HNZJ 1VRUA 1WHYA 3ET6B 3DGPA 3VZIA 3OLBA 1RYSA 1JLFA 3N6NA 4NCGB 5MAOA 2AYGA 3UN5A 4ECXA 1O5JA 4KPYA 3SCJE 4YP3A 3IBWA 3PR5B 3L95X 4A8OA 4J5OA 2KG0A 3GU0A 1WSRA 3IO1A 4I2QB 3TW0A 5F8GA 3JYTA 1AUDA 4QJVA 1DTTB 3TARA 2GVZB 2PA3A 3CDUA 5KFGA 3IC1A 4EZ6A 1TTHB 3UD4P 1RT5B 3NGRA 2UU9J 1CC7A 4J9MA 2AU0A 1P1LA 4PR6A 3DFEA 3MPDA 1GX6A 3J7AN 3CCWA 1NLKL 2AIRB 3A1YG 3R6LB 3O8WA 3V4IB 1N6QA 3GB0A 4ZVTB 3SDEB 3TAMA 2XHWA 1T7PA 3D54A 3QT8A 3M1VA 1M1HA 3PW7A 4PQUB 3ULHA 2RQ4A 3BJYA 3SV4A 4HEA9 4B9MA 1Z2LA 3HULA 2KT2A 1H2TZ 1AFIA 3HT3A 1JJCB 3B6BA 1EB0A 4B3RJ 3BQ1A 1FX2A 1JLGA 2VG5B 4LF5J 2LP4A 2C2DA 3D0GE 3A12A 3GIRA 4NYPA 3BGRA 1X4EA 3POTB 4CZCA 1S7HA 4YOEA 4NA3A 4CLPA 1HMVB 3SFGA 1HNXJ 3FSYA 2DHHA 2QA2A 2VBZA 3FBFA 2ACYA 3V6DB 2DB1A 1LWEA 1O51A 2FB0A 4OI2A 3ZTQA 2Q43A 2UXBF 3V81A 2VQFF 3QSIA 5DDPC 1R3NA 1WTFA 2R7TA 2M3DA 1NAQA 4R5PA 4YHHF 1RU2A 2G2OA 4DCPB 4DU7A 4ECWA 4LQ9A 4JI3J 2FY8A 2YQ3A 5C42A 2KM8C 1W7WA 2NUUG 3BN7A 4OJ1A 5KFTA 4LT6A 1FTRA 1MU2B 5C2GA 1L3VA 3QRRA 2PO4A 1CJKA 1S0OA 3NS5A 1RAIB 1MROB 3OR2B 5D78A 4UY85 4XK8C 1U1QA 5G0RA 3M30A 2YH0A 4HI2A 3KG4A 3OXGA 8AT1B 1DY3A 1R8HA 1YJNS 2D3O1 3LPYA 4B3SJ 3ET6A 5B7WA 4ILRA 3A8KA 4JYAF 4RR5A 4B3TF 4B9NA 3BGLA 1IR0A 5ETRA 3TUIC 1IBLJ 1VK8A 1UMJA 2KG1A 1QAYA 1RA7A 3MZIA 3J81U 2OH2A 1QE1B 4WP8A 4WYLA 2XMUA 4DUZF 4LREA 2HWIA 5HI7A 1JLAB 1MG7A 2YY3A 4RO0A 2YKNB 4CNZA 4DR7J 2ZOMA 3CMES 5L1JA 2KFNA 3QO9A 2W25A 3M9OB 3ZZOA 4EBCA 1RGVA 2POKA 4DV5F 3POTA 2KFYA 1F9FA 2ZE2B 3QGGA 4IFVA 4OV1A 2R4FA 1B70B 1M90T 2YPZA 3PY8A 4DR2J 3OFEA 1R0CB 3F41A 3KLEB 3PKYA 2GHPA 2R2TA 2V94A 2CQ3A 1S6QB 2HK3A 4CLKA 1G4CA 5KFFA 2CQ4A 2RH3A 3Q8YA 3W8GA 3LP0B 3PW5A 1Q86T 1RT1B 4Y6IA 3PFEA 4QQBA 5KT2A 1S7IA 3I5AA 1N0VC 4CM0A 4ECTA 1JLEA 3UVJA 4DQQA 5GADI 1FNXH 1BWEA 4KV8B 3S1TA 1RUSA 4ZITA 4BC7A 3NWGA 2H3EB 4FPRA 3C19A 4X64F 1F5CA 1QD1A 2J6TA 3OR1B 3VGVA 1XIQA 2K3KA 4P7TA 3T9ZA 1N32J 2B5JB 4KPCA 1B99A 4WF9Q 4NX9A 3R1HA 1G6BA 3IR6B 5I3UB 2LQ5A 4KH1B 4I2QA 1WC3A 3CDEA 3HVTA 3R5AA 3CO0P 3I5CA 4K7QA 1NK4A 4BDPA 2DGTA 3MPYA 3NGKA 4NLXA 1VQPS 3C2PA 4NLPA 4CDIA 4Q2LA 2MLXA 1DARA 1B3TA 1BD6A 4TQRA 5KFRA 3UE2A 3GFXA 4GRSA 3I0SB 2LFVA 4O44A 5KFEA 2W8KA 1U1KA 4ED7A 1E6YA 2XCPA 1S59A 3H4DA 3FMWA 3CCVS 1BXNA 2VV5A 2XI3A 3NS7B 3KJVB 5KT4A 3MAAA 3S8SA 2XO7A 2IMOA 2OP5A 2ADCA 4JI0J 4K0KF 3J7YI 2UXBJ 1MNEA 3HSDA 2ABYA 1S9EA 4FF4A 3ISNC 3RJMB 1WF0A 2DCLA 2BE2A 1IWGA 4IKAA 3THTA 2Z30B 3TJAA 3TWZA 4RNMA 1JX4A 3GJTB 1G2EA 3I9ZA 1QM9A 3KNAA 2FTRA 2CQ2A 4DV4J 1VK3A 1XR5A 1YJRA 1XN9A 3GCWP 3HHDA 3IGNA 2GIFA 3LQVA 1VR6A 3IBCB 4Y2KA 1BQNB 5EWEA 1U2FA 1X4BA 3DKDA 3Q8SB 2VFTA 2K1RB 2JVRA 5ETKA 1C0UA 1YKWA 2BZ2A 1BUXA 3AFGA 3KJQB 1QTMA 3ZXWA 1U6BA 1ZZNA 2K7KA 5LSOA 4Y2IA 3BR8A 4U7UD 3VGSA 2W4DA 1SB6A 4F3QA 5H9EK 5CABA 1S79A 1KQKA 5HMYA 4LF6J 4FF2A 4KFBB 2NPFA 4O0IA 4A8YA 4J37A 1TQLA 4B08A 3TAPA 2BE2B 4OHYA 1REVA 2E5IA 1S0NA 2LQ9A 5M2UA 2CQ1A 2LECA 2E29A 2L9NA 3R6GB 2UXCJ 2ZEJA 1MWZA 1GXLA 4WFXA 5KG6A 4CLSA 4X65F 4N5SA 1SQEA 1TL7A 5LOQA 1C1CA 4OX8A 5L46A 1KVJA 1RWWB 1NU4A 2Y1RI 1T02A 1T8EA 2M5YA 1RT6B 2F7VA 4KGMA 2RT3A 3IA0A 1LK7A 1RAFB 1WG5A 4P2XA 5IOLA 4URGA 4F50A 1Y00A 4OHWA 4IG3B 4W90B 1DJ0A 4LR8A 4WU3A 4DL6A 2DCUB 3NS6A 2OPQB 1I94F 1HLWA 2EBEA 1OWXA 2OD6A 1ZBTA 2R7OA 3G2XA 3PRBA 3W65A 4C0OC 1OO0B 2B3TB 4ECYA 5H9EJ 3BF4A 5D4OA 3L4BC 5A8KB 5C2CA 1IVZA 3GFYA 3L7UA 4N77A 2WSCC 4NLWA 5U47A 4M94A 3W5XA 4HKQA 4UOHA 4YR0A 4O3SA 2W9CA 4N8OA 2D3ZA 1EKRA 2DH7A 2FGCA 3MCMA 1NH7A 3BQ0A 1H38A 2AEFA 3JQMA 3PX0A 3HZEA 3NXZA 4QIGA 1CULA 3MM5B 3ILOA 4MIWA 4K4ZA 4WKRA 4FPIA 1Y5IB 2XMWA 2A0FB 3B8HA 1ZOTA 2KKHA 3M6WA 4DCJB 5J2PB 4QWCA 2BJ1A 1PKUA 4DV0F 2XY7A 1U45A 3H5YA 1YZ6A 3EYZA 4G6VB 2A18A 3G87A 2B8QA 1UKUA 2OUGA 4RW7B 4M5IA 2RU3A 1RWUA 2R7WA 4IFVB 2VA3A 5CA5A 1EKSA 4NEYA 3TVKA 2VICA 2HQIA 1GTEA 5DRKA 3DI6B 4OYPA 2W2PP 4LUBA 1XWLA 1LXJA 5KFVA 3K8VA 2DGSA 5HP1A 5DG8A 1XNRF 1NPRA 3L09A 2IM2A 3PRVA 3NGTA 3QNWB 3RAMA 2M8DB 1X4DA 4WYWA 2VB6A 4ICLA 4TY8A 4X4PA 4ECVA 1XC9A 2NCKL 1FXLA 1RWXB 2W7PA 4LF9J 2UUAJ 1FJ7A 2BMBA 4BWMA 3AD9C 1T9YA 3K2YA 4DX7A 5JVHQ 4FBTA 2D69A 1PC4A 1OY9A 2LXUA 1TKDA 2DXEA 3G8SA 2R7UA 2CQBA 1FCAA 3DMJB 2OPRB 3QJPA 2AGPA 1WNEA 3SSSA 2G2YA 2KVQE 2W2NP 3GIJA 5HMXA 3JSMA 1LXNA 1HL6A 1VCTA 5A8RA 1RZMA 1XMOF 1Q7YT 1NK6A 3UDLA 2V34A 2XNQA 1Y5NB 2BW7A 4TU7A 1MWQA 3AQOA 3CT9A 3SQGA 4QWAA 1HWKA 2CWXA 3DDNA 2OPSB 1HQ2A 3H2UB 5J1NA 2E1CA 1HNXF 1KVKA 4X4OA 2CQIA 2IAJB 3H0PA 5M2RA 4OZNA 3CCSS 1NJWA 1UVMA 1QY7A 4WTOB 1RT4B 1CQNA 4FBUA 4PAAA 2YX4A 4M5JA 4UY8T 2K3IA 3MOJB 2LEPA 1FERA 1FRKA 2ZBCA 2HAFA 3G96A 1RAGB 1HI1A 3HX9A 4P74A 1LOUA 2E1MC 3D6TB 3WHIA 1BHNA 3QGHA 2PMZD 5EGYA 2Q66A 2B9XA 3PO5A 5HMWA 2QSFA 3QBCA 3VAGA 5F3ZA 4DFJA 2CPDA 4Y3CA 4CO3A 2HFZA 1RA6A 4OHXA 5AXMA 2Y0BB 2C2OB 4YR3A 3TUPA 1WF1A 4OLOA 5A8WA 4B3SF 4WJBA 4RW9B 1UCNA 1RHKB 3JQJA 3MMBB 3SIPB 4DMZA 2AWZA 4K4XA 1FJGF 3RR7A 4NZ0A 1IBKJ 2YNFB 2J6SA 1UPPA 3UQSA 4ZPDA 1FFWB 1NSQA 3UI3A 2UXDJ 2RF2A 3SBMA 2PC6A 3MM9B 3G8TA 2OSRA 2CAJA 2MHEA 4MJKA 3MM8A 4ZHRB 2XNRA 4HHJA 2CFXA 4ECUA 1O6XA 4F8RA 2OTJS 5H9FJ 2IDEA 4O3NA 1K73T 3ZNUA 2BQUA 3PNIA 3Q8QB 1VLOA 2DXFA 2Z0GA 2G0CA 3DRSB 2DHXA 3KLIB 5K9FA 1RHJB 2MSTA 3A8IA 4LF1A 3OXFA 1I5OB 2CJAA 4HLBA 1S1TB 3C46A 1XR7A 3W61A 3M8SA 2Z8QA 3H8YA 1TMMA 2VQFJ 4I69A 5BYRA 2VKRA 3T5HA 2NYHA 2XG8A 3BSAA 1NPPA 3AB2B 3DDKA 1BQMA 5E3AA 1GAOA 1U24A 2IAJA 2UUWA 4U9RA 3CD7A 4ZVOB 1T3NA 4DR4J 2O67A 4F0KA 1S6PB 1CJVB 3MR5A 4G65A 3BKTA 4QW9A 4ED8A 2ZFHA 4USWA 1KNZA 1IKVA 1IUJA 2HGNA 4IG0A 3CF5Q 5JVGQ 2FLPA 4HR2A 2FUG9 3UCGA 4HYKA 1FDDA 3MM7A 4CTAB 2AV5A 2DEJA 2J7WA 2AKWB 3QWUA 3CJ3A 2WVEA 1UWBA 1YZ7A 3MM8B 1LQ9A 5KOWA 2MYFA 4DUZJ 2ATCB 1M0SA 4KT0C 2ZKTA 5A2QU 1RTJA 2R7VA 2ZH9A 4L3NA 4AD6A 5KFUA 4ZA1A 1N5TA 1HYSA 1T9WA 1U7LA 1PSDA 3H25A 1FI4A 2X3DA 3D67A 2VD3A 1ZA1B 4ZP6A 4GC6A 4O3OA 2R42A 3MMJA 2HFUA 3E8OA 5DQIA 2OMOA 2J0QD 3H5SA 1KR4A 4IOBA 2RHQB 2YX1A 2HPUA 2DPIA 4IH6A 1YJVA 5BJRA 4RUBA 2GO9A 3VHQA 4DFPA 1ITPA 2ASLA 1KKHA 4H4KC 2ZBIA 3UDCA 3CMAS 5J2QB 3OL6A 4A4JA 1X4HA 3W8PA 3W9IA 4JI7J 2E44A 1OY6A 4WE1A 1FNOA 3QATA 4O0NA 2LLZA 2GVDA 5KFSA 3VV2B 2XQCA 2EW9A 3MECB 3W2VA 5CYQA 4NLSA 2QIFA 3V6JA 2V2VA 1JWWA 3KK3A 4QR1A 5DS7A 4B3MF 4DI6A 2NXEA 4E0DA 3HLUA 4NA1A 2JLGA 2V9WA 1NDKA 2HRYA 4YB1P 1X5OA 4DX5A 3C6UA 3U1NA 3HO1A 5CYQB 4KY3A 1VJQA 1JMTA 2HIQA 2NQPA 1VI7A 1OPIA 4J9UE 4JI2F 2H5IB 4ZP9A 2BVZA 4OYMA 7FD1A 1LW0A 1U1PA 4DF4A 2R7XA 1VC5A 2WONA 4DPYA 5B08A 2DO4A 3NCPA 3UR3C 3QZ7A 1N5YB 3OTDA 1JXLA 3C15A 1Y3JA 1OYEA 3BSNA 4ILLA 2HW3A 2BEFA 2J9DE 2MQ8A 2YVSA 2AJ0A 1F2GA 3M2UA 2YKPA 3FK4A 3ONQA 2Y8YA 4JI5F 1HHTP 2FVQA 1JLQA 3QIDA 2MJNA 4BBYA 4LVNP 3KHHA 1Q82T 1P9QC 1KONA 4PWDB 4Q0BB 5B09A 4Z2XA 4DV4F 1K8AT 1GT8A 5FLXU 8ATCB 1PC5A 3GMGA 4HTJA 4CM2A 2HFSA 2KHCA 3MEEB 2HS4A 1RABB 3MF5A 3U1LA 4F36A 1C4CA 3M8RA 2AD9A 4K4TA 4UTGA 1N5YA 1L5UA 2VBWA 1NSKL 3KUGA 4K8RA 1QAIA 2E1PA 2XS5A 4RBUA 2KO1A 3OPKA 4OI1A 2MGZA 1HARA 3I0RA 2MXYA 3HHNB 4WCEQ 1NK8A 1N34J 4B9LA 4NCBA 2VFRA 2JJ4D 3ZZUA 4KGZB 2J9EA 2OHDA 5LXYA 5KT5A 4I56A 1EJ7L 3TI0A 3OTCA 4M5NA 5C24A 2ZH5A 2J0SD 4GKJJ 4V19J 2Z2ZA 1KQGB 3HF5A 3UDVA 1RADB 1KLMA 2RDJA 5GAGI 4K4UA 2B56A 4QIFA 2OTLS 4DR6F 5I3QA 1Q81T 2QRRA 4O4RA 4FKXA 2E1AA 3CCQS 5F0WA 3GYGA 2EXUA 1TKXB 4MIAA 5A8KA 1PJ5A 2KM8B 2B7CB 2XYGB 4X4VA 1VQMS 2XCAA 2UZAA 1UEKA 5J2NA 1W2BR 3P45B 1RHQB 2CDRB 1X4AA 2F5GA 3HD1A 3GSIA 4HACA 2OPQA 2JLEA 1ULRA 3BZQA 4V1Ak 3QFWA 4O3QA 3RW7A 3ZTPA 3R1LA 4CLYA 2WW4A 3C16B 3CDBA 2X1AA 1YWXA 2IRYA 2EFOA 3HFKA 4ID5A 4MFBA 3RBDA 4AL6A 1VDHA 4N47A 3VQSA 1HHQA 5CQGA 5ETLA 1NJIT 3MR6A 2V6AA 3LP1B 3L7OA 1JJHA 2VFSA 2LA6A 3QQCD 4EI2A 1SJFA 1SKWA 3VAKA 1YI2S 1J5EF 3MM9A 3PR4A 2VODA 1WHXA 2VA2A 3LA0A 1JKHB 1UVIA 1RB0A 1ZS6A 5GMEA 3I6PA 1KOOA 2ZH6A 3PIOQ 4DSLA 1XQIA 4PXEA 3ENAA 1Q0NA 5CYJA 2ZC4A 4IRCA 1YBAA 4ZVUB 5KFXA 3CULA 3X1LB 5A8WB 1FJCA 2FJEB 2XWYA 2CPYA 1VGYA 5KG3A 2XGPA 2GS8A 4CNYA 2CZ9A 1EP4A 1IJEB 4NLRA 2OIHA 2AZ1A 5HMZA 3Q8VA 1FHTA 5AJ3F 4CLZA 1RT2A 4PCQA 4PXDA 5RUBA 5EHHA 2FLLA 2JVOA 3NGSA 4FP9A 3J80Y 4RW8B 4YY3F 3EGNA 3WIVA 3MEGA 4H4OA 2ZD1A 5KFZA 2ZH1A 1TV6B 4I4BA 4K0KJ 2HHTA 1UEVA 2ZUGA 3P96A 2VG7B 4IH5A 4NRUA 4RWXA 2ILYA 4OHZA 3MFIA 4ED0A 2HMIA 4CCHA 1BQMB 1H72C 2CXEA 3E2EA 2CNKB 1GQEA 1TL1A 1SV5B 3SFUA 4WBFA 4I2PA 1U25A 2DNOA 1KLMB 2IDLA 2VG7A 4CO4A 5KFMA 2UUAF 1TV6A 2BACA 1TK8A 2ZUAA 2XM3A 4WFAQ 3MHYA 3KMQA 1APSA 3N4WA 2I1RA 5D4PA 3M8PB 1IKXB 2DKOB 3R7SB 3K59A 2ZH2A 2YKMA 4Z7CA 5IZHA 4FYVB 2YTCA 4MT1A 1BQXA 1NMEB 4USHA 1NPKA 4K59A 2MJUA 4E8UA 6AT1B 4IDKA 2N3OA 4DV7F 2ZVSA 1HW9A 5DM6Q 2V67A 3BS9A 3OHAA 2MKCA 2NPIA 3OTOJ 2RVJA 4L74A 5EWGA 4Q8EA 1YG0A 1S1XA 2VG6A 1UVJA 4JI1F 4NMLA 3CCLS 3GILA 1PAEX 2VU5A 4NI2A 1ZAXA 5BXIA 1IKWB 2LQ8A 5IT4A 4Z37A 2DGWA 4RBVA 3HKWA 3HSGA 1LW2B 3RTVA 1UJ4A 1D9AA 3QJLA 4RW9A 2HHSA 5AT1B 1LWEB 3FFIA 4X84A 4MMOA 1TVRA 4RWWA 3J80U 4DV3J 3LP1A 3LOUA 1EX8A 3QYYA 4GKKJ 1LWCA 1YJWS 4KAIA 4GMKA 2LDYA 2CUYA 4DWIA 1ZPWX 3CJSA 2C2RA 2PA8D 2QMUB 4RW7A 2CNNB 1RKJA 4MKBA 1ZTTA 4DV6F 3M4XA 4PG6A 4ZVQB 1GXUA 2JLFA 2B4OA 2LXIA 4EYHB 2UP1A 1TAQA 3PHTA 4C8ZA 2B9EA 2VFVA 3GCXP 2VIHA 5IFMA 4FS1A 2DNGA 3QO9B 4LRAA 2PI4A 4Y2CA 2B6AB 4L72B 4I6AA 4C9DA 3CDAA 4X2BA 5D0EA 2N4CA 1VBKA 3BDPA 1Y0HA 1U49A 4KGVB 2DY1A 1F6TA 2CVIA 1X8DA 3CCUS 4F4ZA 4YN3B 3ZTSA 2CQGA 4QR0A 4C98A 3VZHA 1M1KT 3EDQB 4DR2F 3DYAB 4IFYA 4K5SA 2F8MA 4Q44A 2H65B 3N01A 2EBGA 2C3OA 5SUHA 5DDQC 1SIWB 1FXDA 2W1BA 3MCSA 3Q2SC 3UWTA 1TP7A 4QBUA 2IHR1 3HHEA 4IG3A 2ZH8A 3KMSA 3VAFA 1QLNA 2DXDA 2BV3A 3SMZA 2HNYA 3KWMA 3MTJA 3U7JA 4X4TA 2CJXB 3MEEA 4PPZA 5ETSA 3RG6A 4F4AA 4DLEA 2HNDB 4CO2A 1V9OA 2B9YA 2IMWP 1WI8A 1HWUA 3I4PA 2PMHA 3VAIA 5HP1B 4DPWA 1B0VA 4ZOSA 3MM6B 1IQZA 3A3OB 2HNDA 1SC1B 3JTPA 2W9AA 2WRMA 1RTJB 5FIIA 2PI5A 5F8MA 1HBOA 2M4MA 3OQ2A 2OLWA 5D0HA 1RAAB 2IPOB 3RB0A 2RILA 3PEJA 2XLIA 3W9HA 4USJC 1K0TA 1FJEB 1ZAVA 4ZK7M 4I0WA 2FHJD 2XEXA 4HHHA 2FZCB 2JRSA 2VFUA 1CS4A 1X7VA 3BGFA 2LU2A 2UV8G 5L8RC 4E2FB 2BOAA 3MPUB 1JLBB 3DYAA 4AYBD 4TU9A 2HVZA 3I9V9 1RQ0A 4OYZA 1AB8A 4FDFA 4RX6A 5KOXA 3C6UB 1QSYA 1H74A 3TO8A 4CRJA 5D15A 1TU0B 2Q79A 2OPPB 3MMAB 3K57A 1D1UA 4JI1J 3W64A 1HBMA 1HBNA 5IWAJ 3M9NB 4HI1A 3K5MA 1UFKA 3R7BB 5K8PA 1CG2A 3W60A 3GFHA 2JC1A 2MKSA 2C22A 2L3MA 3P49B 3IG1B 2GVZA 2RDIA 3G6VA 3RBZA 4KBIA 1FDBA 1NEEA 1DQ8A 4RW8A 2XB2D 2KH9A 2EKNA 2GJ2A 2AZ3A 1UEUA 1JLFB 3M8ZA 3HHLB 3P3DA 1GTHA 3WX4A 3DGPB 4LFAF 5K8NA 5DG9A 4J9SA 4OX7A 4YEAA 3UFCX 2B4VA 5CZVA 3DHXA 3VGTA 2KYXA 1HNIA 2CJYB 2ROEA 2VZ9A 5A6WA 2GAHC 5MLCV 3T5KA 1D8YA 2WSFC 4Q2MA 4ZHRA 2FYXA 3MAHA 2UXCF 1PJ7A 3T1AA 4ECRA 2VKZG 1J27A 4XPEA 1IKWA 1KD1T 2QC3A 5E3RA 2IJFA 2YNFA 3RBXA 2H51B 1PYSB 3HKZD 3M6XA 4JI4J 2C2MB 5M2PA 4DN9A 3R2DJ 1S1XB 5E2QA 4NYOA 4KFBA 1QJHA 3PO4A 3GIIA 1S0VA 2YNGA 3RRGA 3G9CA 2RRNA 3V2UC 1Y7PA 2MEWA 3FEYB 3ZO7A 4P10A 2XSJB 4JBCA 5KFHA 2PE8A 1MW7A 2MQQA 2DITA 2GQ2A 3AXKA 3DOMA 5IT9U 3CB4A 3LGNA 1VQ5S 4DSIA 1ZPVA 2XMVA 3W9JA 1VBXA 3NMRA 3WZ0A 1TKZA 2A6OA 3KLEA 2RIJA 1PJ6A 2C3UA 1HWJA 2GNKA 2D9OA 2C1EB 4P71A 1HR0J 1H6KX 1SUQB 3MEDB 2FHKA 4LBIA 2W7AA 3KDOA 4L3KA 3OSNA 1FFGB 3DXBA 5K8MA 1TZ0A 2V68A 3GLJA 4QYRA 3QJJA 2H5EA 4RW6B 4M1KA 4ILMA 1A9NB 2KT3A 4K2JA 3Q23A 2YH1A 3MAAB 4Y65A 3VF0B 3J7ZT 1T9TA 3Q8RB 1EETA 1TL3A 1S1TA 1WEZA 3KG1A 4KO0A 4P75A 3HK2A 3JAMY 1I1GA 3MEGB 2PEBA 5C24B 3TP2A 2YNHB 3N9UC 2Z2LA 4MAKA 1FK9A 2QJ3A 3R8YA 1LNQA 3VVUA 1VS3A 4QPXA 5IT9Y 4TYBA 3HSJA 4BLGA 4LSZB 3DRYA 2ALYB 1IKYB 4NRTA 3RGIA 4IRKA 4ZMMA 3I0RB 2MZJA 4KB7A 1VQOS 3M9MB 4UQGA 2MGZB 2K7JA 4DFMA 4IYQA 1FFSB 4DDFA 4GKJF 1IR2A 3OL9A 1MWYA 5L1IA 3KHRA 4J9QA 4LF8F 5HK4A 1YRXA 4DR6J 4ICLB 1FXRA 2M88A 4TY8B 4R8UB 4R5PB 2N4DA 1UFWA 1M5VC 2G2ZA 1IM6A 3AQPA 2KN4A 5F8NA 1QTNB 4DEZA 3B82A 4X64J 1X4GA 4PKDB 3QGIA 4DQRA 2KYZA 3IWNC 3CDWA 1S77D 4TN2A 4C4WA 1ROFA 4B9TA 3GSDA 2BANB 3T5JA 3HVAA 1NCLA 1ZZFA 4OL8A 1JNRB 1PBUA 3LP0A 1RT3A 2U2FA 1JLGB 2VG5A 2WVBA 3E01B 1LWXA 4Q8FA 2HFVA 1U8WA 2SXLA 1SH0A 2L48A 1S48A 1X5TA 4J90A 3KUHA 4FYWB 1V5IB 2I38A 4HACB 4PPDA 4ZPTR 1KHWA 2ZE2A 1RBOB 1X0FA 4OHVA 1LV5A 2DEIA 2I8EA 1I51B 2WW8A 3QT6A 1FDNA 4ERDA 2E5LF 4RUAA 3LANA 3OBIA 4HL9A 1OPZA 1W25A 2MKHA 3DU6A 4CH0S 4UT4A 3UPFA 3M8QB 3CCMS 4K4YA 1ELOA 3UN2A 2H54B 2R8HA 1YHQS 1WHVA 2MLZA 3BV8A 3K17A 3SQGB 2MQPA 2FPHX 5KFCA 2H1YA 3W5ZA 4AXIA 2HVHA 3OJSA 2N3LA 1NB2A 2AT1B 1HBUA 3DXSX 3MMCB 4KGKA 4RW4B 4M5HA 4ED3A 1QSLA 1UVLA 1I3OB 3OVBA 2FVCA 5KG1A 3JYTB 1FWLA 2F65A 2RQCA 3K5LA 3CJ4A 1XEZA 1HPZA 2DISA 2XI2A 3FVYA 4P73A 1CJUA 2V2QA 4NCGA 2H5JB 5EX3A 4ENOA 2ZOFA 4NLVA 4Q5VA 5KT3A 1NZ8A 1BY9A 4OQJA 3AAWB 3AH6A 3JB9k 3FEXB 2BJ9A 2QG9B 3MPWA 1TUVA 3CUNA 4DR7F 2I5JB 5B0AA 3MUVP 1SL1A 2KVIA 1X9SA 3SI8A 4O3PA 4B3OA 4Q45A 2LKZA 2W2QP 5EX0A 3EVMA 3OV7A 3FSIA 4LF4F 1DTQA 2F8EX 4LMZA 1RTDB 2GJFA 2CG8A 4NPOA 5K14B 3V6DA 2DRBA 2IA0A 1SXLA 2BJ7A 2DHGA 1PYOB 2C2KB 4ZLPA 3JXOA 5LXRA 2FVRA 3MCNA 1D3WA 3NKYA 2IA6A 2H4WB 2DGQA 2QYCA 2HZVA 2HS0A 3D3CJ 2BJ8A 4ECZA 1GMUA 2K2PA 3H42A 5T7LB 1F5AA 1LWFA 1IKVB 3KLFA 1WWHA 4L76A 2OMLA 3DLEB 3BM7A 5ETPA 1UVKA 4HT7A 2CPIA 2GIRA 4L75A 3ZC4A 3D2WA 2W9CB 5ETMA 5DQGA 2FVPA 4JV2A 4FXVA 1YJUA 3CGIA 2QLWA 2JH3A 2PMWA 3ETMA 1GEHA 1N5SA 1CJTA 3CWJA 3KXDA 3N28A 1D9FA 4F2RA 4N41A 2YWWA 2NZCA 1O0PA 3EWGA 2HIYA 3D68A 3EZOA 5D4NA 2EKYA 3RB6A 1ZYQA 3VAHA 4OYWA 3KNGA 4XIUA 3L3CA 3BO2A 2MTLA 3CCZA 2QEXS 2GC8A 2DHSA 3N79A 1ICEB 1UL3A 1HA1A 4KE5A 2HRTA 2WCXA 2YKOA 3LP2B 3DDIA 3DRPB 4UUXA 3UD5A 7AT1B 1JXEA 1VRUB 3TRGA 2BR0A 2YWFA 4HDHA 1FKPA 1REGX 2GCFA 1RISA 2HQDA 4H54A 4DV1F 3EM1A 1VBZA 3T6JA 3T1HJ 3HI9A 1N36F 2M2BA 2L9DA 2MKKA 2Y8WA 1XK8A 4JB8B 1RWPB 1H2VZ 4KTQA 1DLOB 4WZMA 5KFQA 1NRKA 1TAUA 2BKPA 1OS5A 4L6V3 4JI8J 3IAM9 5C25A 2XLJA 2C3PA 2XLKA 5DO2A 4LRDA 1C2PA 4DSFA 2GAGC 3M2VB 4ES3A 5HJYA 1IXKA 4EFAC 3PHEA 4WZQA 2LXFA 1BWVA 4CTAA 4F26A 2M70A 2V8DA 3RR8A 1VRQC 5JJBA 1PGZA 4RZRA 3GFZA 1H98A 3C6TB 4FZVA 4IG0B 1RAJA 1S6QA 2RHSB 4ZJLA 1BQNA 2CDQA 2D3UA 2EK6A 3FGVA 2EG2A 1IQTA 2VJUA 1B0TA 3UNGC 1C4AA 1YITS 1CJVA 2CNLB 4Y34A 4C2MA 1L3UA 2BJEA 3OTBA 2Q3PA 1WJ9A 2F63A 1S1UA 2B0GA 3D9BA 3HHKA 4ZVEA 2CVEA 1CC8A 3G82B 1WOSA 1RI7A 1VJWA 2NS1B 4YS2A 2DPJA 1GK8A 2VDIA 4M5KA 2R2UA 5FDLB 3C3LA 1KVIA 4ELUA 2AP6A 1VIXA 1E6YB 2M52A 3AOCA 4JI2J 4IOAQ 4I64A 1VMBA 1KWMA 4FYXB 4WFBQ 2ZC3A 1T05A 2DR7A 1XERA 2O5DA 1VRTA 1ZA2B 1SIZA 2FZKB 4OJHA 3TNVA 1GFWB 2NUHA 2OPRA 4M63A 3GR1A 3PVXA 5HVFA 2R2SA 3D6FB 2KRBA 3G4SS 3UW1A 3OR2A 4DUYJ 1WC6A 3FJ2A 2XMKA 1CJKB 4RU9A 1B64A 1E6VB 1QVFR 5ETNA 4O23A 5SZTA 4UZCA 2FJDB 1WC5A 2WVDA 5KFKA 3DLKB 2JZ5A 2ZJPQ 1OSDA 4CH1A 3F44A 3ZFVA 4ZPAA 4OYOA 3O6QA 2H4YB 2AYMA 1XMQF 2UVVA 3SV3A 3ZZPA 1ZM3A 3D0IE 1X4FA 4AQYF 2B6AA 4C6AA 5CYMA 5KFJA 2FHJA 2N82B 3H5XA 2HBRB 3SZ2A 4J91A 3E3XA 5ADZA 4NCAA 2V0NA 5D0GA 1DQAA 5K20B 5G4DA 2LEAA 2HHVA 1X9MA 1NK9A 5L9XA 3R5BA 5AXNA 1DRZA 2QL5B 4BCAA 2QLXA 3NNAA 2VOPA 2P9GA 3IGVA 2KXFA 2HURA 4LIRA 3QRQA 3GG1A 5HSPA 4J9OA 1FRJA 3KOAA 3ZZRA 2HYIB 2YKAA 4UOCA 5K14A 5LM7E 1T0TV 2KZZA 3JSYA 2PGCA 1VYAA 5GAEU 3CD0A 4WXOA 3KFWX 1VQ9S 2FDNA 3CCTA 3K89A 1WD6A 3CE8A 4AE5A 3OL7A 2V4RA 4EEYA 4QCLA 1N5QA 3VAJA 4TXSA 3GV5B 1YLXA 4DN0A 1QAJA 3U02A 3DN9A 4IDKB 1CJUB 4KYZA 1H2UX 4DV2F 3D6HB 4P9SA 2MKIA 4CIOA 1U26A 2FJBB 1BC6A 2YNIA 3CJ0A 3TVZA 1I6JA 4PUOB 2J6UA 3GP9A 1UJ5A 1FEEA 3NAHA 1K1SA 2RJZA 5DJBA 1QVGR 2VC1A 3N5BA 5JXSA 1SC6A 1AZSA 4BS2A 4OZ2A 2V8PA 5T41A 4EMDA 4XDCA 3B78A 4C48A 3X3UA 4DSKA 1TL3B 3I32A 4RNHA 1YSJA 2P2CB 4LF2A 5FDLA 3WC0A 2E5HA 1TL1B 3MCOA 3NRBA 5IV4A 3KK2A 4QYZJ 4EWTA 2AMCB 3CJKA 2Z2MA 3M05A 2LQBA 3OVAA 2X1BA 1N54B 1REVB 1RLDA 1KTQA 2VF3A 2YWKA 1F9EB 4DZ6A 3BGRB 4ZVSB 1HI8A 2ZD1B 4CLLA 3D5MA 2P9EA 2G1HA 2ZBRA 2ZNZA 3F73A 3MTKA 2UUCJ 5LT5A 2GMJA 3CTRA 3DRRA 4MYTA 3C6TA 5J2PA 2MKYA 2J5AA 3CJ8A 1MMDA 1C0UB 5A0YA 2BANA 5IT0A 1A7GE 4OZ1A 1CULB 3MM5A 1Q5YA 2MZRA 3TQ1A 3FBBA 2G0JA 1R0BG 4NA2A 1NJXA 1YGYA 2ZKUA 2DRAA 2R8IA 4PQUA 3QWPA 3OL8A 4ED6A 5I42A 1TUGB 2XSFA 1LFPA 1XJWB 1Q53A 3T6BA 4KHPF 3DLKA 2UU9F 3MXHP 4Y2MA 4DSJA 4DS5A 2IBKA 3VWSA 4A48A 2AQ4A 2KZMA 2HVEA 5I3PA 5AE2A 3HMJG 4DQPA 1DTTA 1FWKA 2KL8A 3EGVA 4ZPBA 2BDPA 4B9SA 4DG1A 5JMNA 3EZ5A 1H7XA 1JLCB 3U27A 1HNIB 1SJ1A 3AT1B 4OLPA 4GC7A 5K5MA 4DPOA 4MK7A 1HQUA 5IM0A 2YWGA 4LF7J 3HHLA 2D1CA 2UVRA 1U1RA 3C16A 1RTIA 1LFWA 1OSCA 1RT6A 2MHNA 3ETOA 3TVYA 3H2LA 1OIAA 3H90A 5D6GA 5LSLA 1R6VA 2BQRA 4LF5F 1B0PA 2HHXA 3HVTB 3IRWP 3LGHA 2HQ3A 4P2FA 3SSRA 3M6VA 4EU0A 3BB5A 4H4MB 2V4QA 4DQIA 3AJ2A 2VPYB 3ADAC 3IR5B 1YTYA 4YR2A 1TFWA 2WBMA 3RB4A 3PV8A 1HBMB 3HD2A 4D3HA 3NGDA 2MQMA 2ACMA 1SH2A 2PDAA 5F0UA 5A6PA 5J2MA 2PEHA 2DHAA 3GPAA 1RAHB 1PBAA 1RWMB 2DO0A 1WI6A 2MZTA 3L9ZA 4WU2A 1KQFB 3W1YC 1UAWA 5KFPA 4DHVA 2LEBA 2B4PA 3A13A 3GYXB 2C2EA 3NY0A 2RRAA 2QTWA 1CS4B 3O1LA 4F4YA 5GAHU 3EGWB 3HVRA 3DOMB 2ERRA 3V81B 2ZM6J 4W92B 3DM2A 1F5BA 1WC4A 2CADA 3QIPB 5J1EB 1N56A 4OZLA 2UUBF 1VQ7S 1T3OA 4OX9F 3G6ES 1H73A 2BM1A 3CD5A 2F40A 3HSZA 1WKJA 4FXWA 3CCJS 1A6LA 4B02A 4Q0BA 2A10A 2IBOA 1YBTA 2CPZA 1WKLA 3N6MA 2RUGA 3ILLA 2X7IA 5LL6d 1CSJA 1RBAA 4PG7A 7FDRA 3V6KA 4OZ0A 3NMAA 4K2XA 3M2UB 4NZ7A 2FLOA 1Z2ZA 2Q1LA 5DZ7A 3PJXA 1WEYA 3JSRA 5E3QA 4DV0J 4DV5J 1J2VA 4GVLA 4IQXA 1S72S 5CH7B 1URNA 2VHGA 1SQGA 3MUTP 3BYRA 3M30B 2X51A 1X60A 1XMBA 4ELTA 1MROA 4EGLA 2HNZA 4WIIA 1NDPA 1RCOB 1MU2A 2C3MA 2C2ZB 1PIEA 4AT1B 1Q8IA 2CA9A 2IIHA 5LJ5Y 3EE3A 1WACA 3LAMA 3ITHA 2PT0A 1J5OA 4ELVA 1UW9A 2KTQA 1Q16B 1VOMA 3BN4A 1D8ZA 4WP3A 1GX5A 2DNMA 1NJZA 1ZM2A 3EUNA 3R5DA 3LWLA 3P5TL 2PD1A 2JHEA 3R27A 1U8SA 4KH0B 3HFVA 1JLEB 3BPSP 3KG0A 4I68A 4KC5A 3UVJB 4A47A 1PILA 1X9WA 4ED5A 2CYYA 4TYAA 4F0MA 2XTJP 4DL3A 1SPBP 4QU7A 1B4SA 3DLLQ 1RT1A 2PN6A 3PG9A 4EO8A 2FJVA 5DGAA 3DRRB 2ZDPA 3PJ9A 2R7RA 2AJ1A 3MR7A 1NK7A 2AJFE 2IYGA 3E01A 4KRWA 5HLFB 4CLTA 2KFZA 4Z7YA 4ZCLA 5AJ3J 1Q8KA 4PABA 4Q43A 2E66A 1S1VA 3CC7S 1YVFA 1CEZA 4MKYA 3PW2A 1WC0A 3TR5A 3BBFA 3K7RA 5IWAF 3RAXA 1YJ7A 1DTQB 1RK8A 2BBEA 3PIPQ 4GO7X 1GMWA 2CPFA 1JB0C 3EXCX 3RRKA 1HD0A 1X0PA 2B43A 2HHPA 2MZSA 3SDEA 5I4MA 4ALZA 4NI2B 2I5JA 3S01A 2GJIA 1JJ2R 3GG0A 3WQPA 4J9PA 2AYBA 2YX7A 2HZAA 3DLGB 4LSLB 1RWVB 2W01A 2CQHA 1WTBA 4DZDA 1WC1A 2QN6B 2WHOA 4PUOA 4PXBA 1HPZB 5G0RB 3QSYB 3CSKA 1TL5A 2EWHA 3Q89A 1VHIA 2JEGA 3QFHA 4OFZA 4ZPWR 2HBZB 1QSSA 1HBUB 4ANCA 5ETQA 2BQ3A 2QMWA 2F4VF 2CQDA 1YIJS 3DOLB 2JFKA 4C3KA 1TL4A 1JK9B 4OV6A 5CCLA 5HQ8A 1HI0P 4OX9J 1M5PC 4W4MA 4I2PB 1R8BA 2MQLA 4JI4F 3V4MA 1N6QB 5HJXA 4ZCMA 2I0XA 3MR3A 1P6TA 4DLGA 4ZDNA 1VQ6S 3VQTA 1JNZB 1EQ0A 1S1UB 2EFPA 3M7VA 2J9DA 3H59A 3DNCA 3JSBA 3LALA 3G86A 5BYQA 5LMNF 2X1FA 4LR9A 3WX8A 2IVYA 4RUHA 4WXWA 3NP5A 2D3OR 3L7PA 1RT2B 4I67A 2MZ1A 3ENVA 1FO1A 2DBBA 2FVSA 1HR0F 1R8AA 4O4GA 4JV5F 2V63A 2DNPA 4TU8A 1EIYB 2CWKA 2LMIA 2K06A 2D41A 3MWBA 3AA8A 1HNVA 1BE4A 3CMQA 2C28A 3I5BA 1V6HA 1YQHA 3KLGB 2XWXA 2Q6BA 1N8RT 1IBLF 2OELA 2UUTA 3TAMB 3ZTOA 1ZAWA 1SVDA 3M2RB 4CYUA 4F3MA 5KAKA 3KHGA 3BQ2A 5LMUJ 2DVIA 3BKFA 5HQLA 3ITHB 3KJNB 4PG4A 3JTNA 2E5JA 1Y3KA 4PEOA 3J81j 4LFBF 4KKOA 1FRMA 2XYHB 4M5DB 2QLJB 4MK8A 4CO1A 1MSWD 3AD7C 1R6YA 3EDRB 4OMFG 5IC4B 2AJ4A 3KK1A 1RYRA 2H48B 2KXNB 3PW4A 3TQEA 3O5TB 1NSPA 4DPTA 3AOAA 1U47A 2RKIB 1H3DA 3LP2A 2CKWA 3LW5C 1P9YA 3FQKA 5CD4H 4YMEA 1TR0A 4CQ1A 2AGOA 2CPEA 5CHCB 4AXJA 2JOQA 2OD4A 1NDLA 4C8MA 4UF4A 4EK2A 3A3PB 3KUEA 4U95A 2RS2A 2NYIA 1K0VA 3IRXB 4MIBA 5HAOA 3I96A 3M8WA 2G1DA 1NJYA 2W2MP 4J7CA 2GHWA 2R8GA 4XAKA 4F2SA 4RW6A 3A3NB 1NUEA 1OY8A 2GGPA 2M0GB 4X62J 3PYFA 4X4SA 4I6YA 1XNRJ 4F4XA 1Q95G 2BXJA 1O8BA 2J7KA 3FKBA 2HKEA 3OXLA 3J7YU 2W2OP 3I55S 3C14A 4FYDA 5B0EA 3PW0A 2IY5B 2VL1A 1KSPA 3KTQA 4BC9A 1DBDA 2ZDOA 1IR1A 1U6ZA 4MKVA 1SBRA 4HDGA 1CVJA 2HBYB 3I82A 4DUTA 4LRBA 2HZCA 2QLBB 5F41A 4JI7F 2EFNA 2RMLA 5KFLA 4C11B 3QZ8A 1R0AB 1DZ5A 4LFAJ 9RUBA 5KG2A 3ILJA 1FRLA 5KG0A 5J2MB 2VQEJ 2DK2A 3GR0A 2MPUA 2F4VJ 2HHHF 2XHCA 3UO0A 3Q22A 1U0HB 3N5FA 3H20A 2ATLA 2FJWA 5CXTA 1DLOA 4AL5A 2P9CA 4FKYA 3BPDA 1WKKA 3AOBA 3FMBA 1FKOB 4OI4A 3AY0A 1RWOB 2HFOA 4OX6A 4ZVPB 1JLQB 5THWA 1C1BA 2V4JB 3RYLA 3CPWR 1S57A 2V69A 3FNNA 2DJWA 3Q0AA 2AW0A 3TA0A 4IO9Q 4N76A 2DH8A 3A8EA 4PG5A 4S0MA 4OI0A 4CO0A 4K4SA 2Y1LB 4D3GA 1RT7B 5LMNJ 2HNYB 5BR8F 4NLQA 3ENQA 2QA4S 2HSEB 4WFZA 3TOQA 4RL1A 3KLHB 2JEJA 1ZH5A 1PG5B 3D28A 3FRZA 4KQZA 2WOMA 4ZN1A 2CPJA 2B7BB 5EWFA 1FESA 1VQYA 1V3ZA 5KG4A 1S9FA 1WHWA 4DG1B 3M32B 3JAMU 2KDOA 4JV5J 2FC8A 1RWKB 3MMCA 4RW4A 4ZKAA 1Z4UA 2W4PA 4C97A 2R8JA 3US5A 2RAQA 4ZJOA 1IBKF 1AT1B 4LF6F 4LF4J 1H7WA 1GXTA 2RS8A 2GMHA 1R43A 2ZNYA 1UP1A 2UXDF 3JTOA 2NXNA 5D0RA 3D7SB 1OYDA 3GV8B 2R9LA 3T5LA 5FJ4A 1LEOA 2ASYA 5A2QY 4DF8A 1AXQA 1SJQA 4LFBJ 1HWLA 1LWFB 3KLFB 1F0XA 4U7CA 2XY6A 5F8LA 1RHRB 1U2CA 4TLRA 3W62A 2PFFB 1Q8LA 5C7PA 2FZGB 3LUYA 3KLHA 5AE3A 5D3GB 4WTYA 1RT3B 2KT5A 2OGUA 1TKTA 1HBOB 1LWCB 2DNHA 4A8WA 1NK5A 2LA4A 1S4EA 2LCWA 2WB1D 3LTOA 4X66J 4ATNA 3TEHB 4CWBA 4V19X 1R31A 1RE1B 3MM6A 1FKAF 4LF8J 4LFCJ 4B3OB 4A8XA 2C2NA 4DR5J 3GIKA 3W7BA 4DL2A 3UN3A 2XC9A 2JSXA 1U0HA 2EVZA 4ZCIA 5F9LA 3OJUA 2QL7B 4Y2AA 2VBYA 4OIXA 1XNQJ 2FGOA 4LR7A 4U67Q 1FVQA 3CO9A 3GZ7A 3PEHA 1SC3B 1HQEA 2BYCA 1RTHB 5T14A 1FWPA 2ZZMA 2PIIA 1F2HA 4PRFA 1N88A 1NDCA 2YKMB 4XDDA 2BKNA 5GAHI 2CJKA 1EHWA 4WFNQ 2COLA 2DNQA 2ZBQA 3SCLE 1RHMB 4USUA 2DNKA 3BEGB 2ZWOA 4OJGA 4AL7A 1LK5A 3QPIA 4FVMA 3TYTA 1FD2A 2V9KA 4ID8A 3W3SA 1VQKS 3AHPA 2GHVC 3QMQA 4Y00A 4F67A 2E5LJ 4R25A 3GWCA 3BREA 3QRPA 1QAXA 1AFJA 1X5PA 3DRXA 1X4CA 3B4DA 3MDFA 2OKQA 3JS9A 1SJ4P 1IN0A 1H0HB 1T95A 3FCHA 4KHRA 3M32A 2GVDB 4TVAB 5DDRC 3K58A 1YJTA 1NB7A 2MB0B 4WE1B 1PCAA 3NLCA 4RUCA 5H1SV 2JFDA 3GIMA 3T3FA 2RNEA 4NMXA 3FCVA 2XO6A 2KXHA 3AD8C 4CH7A 4USVA 2RKIA 1EP4B 4YY3J 3D66A 4QZVB 4G1PA 4C8NA 5L1LA 4DOZA 4J9VA 3I56S 4I7FA 4ZVGA 3KLVA 2DGXA 4WIQA 5HN0A 1PO6A 3VALA 3FFIB 4KSEB 2HRUA 4HH0A 3H40A 3Q24A 1VHFA 4UOGA 5L1KA 1AUSL 4DR3J 2EC2A 1S97A 1F60B 3LGMA 4C8YA 1D0EA 2HHUA 2OFGX 4OI6A 2E5GA 5FLXY 1KLNA 1YRTA 3CXCR 3IS9A 4R0EA 1RXOB 2GMLA 3FZ2A 4NASA 2NSCA 3DU5A 1JKHA 4WK3A 1MN9A 4NLYA 4ANEA 2R3VA 2F3JA 4J9RA 3MMBA 3T1YJ 3W2WA 4NLOA 1UWBB 5H9FK 2KJVA 3PYDA 2W7OA 5KFWA 2P6SA 4YDXA 3CIZA 3V6HA 1G1XA 4O3RA 1T11A 4TQSA 4LJMA 1NH8A 4N8NA 4F4WA 5E3PA 2C3YA 1S1WA 2YQ0A 1FA0A 1R7IA 1Y4ZB 2ZOGA 4BWJA 4USTA 2HGMA 1Q4RA 2DYAA 2JX2A 3Q83A 4ETZA 3J81Y 3R5GA 3PYEA 1SV5A 3IG1A 4DPXA 2GGPB 2IRXA 3QAUA 5KFYA 2HAIA 2J8SA 2WAQD 4TLQA 2R7SA 3Q8UA 2JDJA 3TUJC 4X4NA 4JI6F 4JI3F 2WVFA 2AF6A 4CLUA 2FJXA 4DR5F 1UJ6A 2MSSA 5F8JA 1FTCA 2DR8A 1UWAA 2M8HA 3CJQA 4URQU 2JC0A 2RE1A 2D74B 4OI3A 4TKTA 5CD4A 3GJSB 3G6YA 4DV6J 4IRDA 1FRIA 4R0JA 3R5JB 1WDTA 1KOHA 4DL4A 3DGVA 2W9BA 1HIYA 2QA1A 3FCWA 4NE9C 5LSRA 1RTHA 2GFFA 6FDRA 3K0JA 1J5EJ 1N34F 2XULA 1HHSA 2L9WA 3DLGA 1VLYA 3G8QA 4YB5A 5KFBA 1R89A 4KKOB 4UQTA 1G7CB 1KHVA 2RF2B 3VCDA 4JOUA 1N36J 3ZZZA 3GQCA 2YWHA 1RWNB 4KIAA 3PTWA 2LDIA 1WOPA 4AFFA 4PWDA 1NKEA 2G0IA 3NOCA 1UA1A 2FLNA 3ZZ0A 2IC3A 4DR4F 5J1PA 3EPGA 3AA9A 2HLTA 1HFEL 2BRLA 2RU9A 2A3JA 4ITSA 4NXMF 1R27B 1F1BB 2HGLA 2J0WA 4M8LA 2AGQA 3TZWA 4DCOB 1M5SA 2E9RX 3SEOA 2CIMA 3VVTA 4B3TJ 1EZZB 1LW0B 2UVUA 1UW4A 3FBEA 1UPMB 3CJ5A 3FC9A 2B9WA 3AXMA 3BKUA 2YKQA 3PCOB 4USKA 2I6WA 5J2NB 4UZBA 4ED1A 1RCXB 1Q78A 4OJ3A 2BOPA 5GAEI 3G71S 5DLFA 1NZAA 1S9GB 3FSXA 1JIHA 2O66A 3H4BA 4G3IA 4FXDA 1HBNB 4DX8H 4M95A 2LYVA 3OD2A 2GZOA 1Y10A 2AYEA 3S7RA 4ZJQA 1DFDA 3A8JA 5KTQA 5IS2A 2BW2A 5KFOA 5DQHA 4EBDA 4NLGA 1N33J 1TK0A 5A8RB 2OEMA 1JLBA 2E9ZA 4QWDA 1T03A 1XR6A 2ZH3A 3DLJA 2R7QA 2DD8S 3GE9A 4DU8A 1VQ4S 1HNZF 5IV3A 2HFNA 2WOMB 3UNYA 4YUDA 4GVBB 5BR8J 4JV1A 1S5ZA 1PAUB 3WC2A 4LSLA 2EI5A 1FD8A 3HJVA 2BE9B 4NOHA 3OLAA 1F3VA 4A8QA 2W8LA 2VC0A 4JI0F 1Q7LB 4DL7A 2ILZA 1RAOA 4NXNF 1L3TA 1RTDA 1U09A 2QYGA 4OYAA 2DNZA 4YB7A 2YWEA 2F9JA 4DV1J 3NBPA 4PQAA 5F8HA 3IMQJ 2IFXA 3O3LA 2B4UA 2M7SA 3DI6A 4OZ5A 1TMJA 2JEFA 3R3TA 2A6MA 4IQMA 3CNQP 1TKTB 4YB6A 2J7UA 3OUYB 3UD3P 5HROA 5HLFA 3D1HA 1R8CA 5HVGA 3P6YC 5EDWA 5D3GA 2CG4A 5IC6B 3RAQA 5J1EA 4CLFA 2WONB 1K44A 3DM2B 3AODA 1A0OB 2L08A 5DM7Q 3KJFB 2LVWA 2CJQA 3MR2A 3NAIA 2HQFA 4PYDA 5ETVA 5DGBA 3HZGA 4CI0B 3FQLA 4LVOP 1YJ9S 4QU6A 3HT0A 1XBWA 3M8PA 2BJ3A 2YXLA 1UFLA 3FRYA 2VPWB 1DQ9A 3PM9A 4DPUA 3BBBA 3OFGA 9ATCB 2OEKA 4FN5A 4X66F 4A46A 4F7VA 2RB7A 4JI5J 1S9GA 5GADU 2MY7A 4H4KA 1W2IA 2AJQA 2Z58B 4J9LA 2NXUA 3M6UA 3LWMA 1XMQJ 5LJ3Y 2P8IA 2VASA 3PRDA 1IBMJ 2AX0A 3MI7X 5HO4A 1GH8A 1IM4A 3ZTRA 4GKKF 1S49A 3CD6S 2ZBPA 4NXMJ 4P72A 4RBTA 2UUBJ 3FEZA 4YDDB 3TZZA 5IM0B 1HNWJ 2V8VA 3IN5A 1ZM4A 3KK1B 2F8HA 4G1IA 5HBMB 1NHUA 2ZITA 1ZTWA 3RB3A 1VQLS 4C3LA 3EVOA 2IC3B 3LF0A 3ZNJ1 4JYAJ 1TL7B 4DR1J 4M5DA 1U4BA 4QYZK 1MLAA 1UZHA 2E9TA 2DNLA 2V5HG 3AJ1A 2G9OA 3OFFA 1NXIA 4ZIWA 2DY9A 2DGUA 3H7HB 3PX6A 3CW2C 1VC6A 3HPOA 4R8UA 4U8VA 4NLTA 2VONA 1QUVA 4C3MA 3SQOP 3H98A 2EEYA 2FJAB 5A76A 4OYIA 1G3OA 2VG6B 2Y9HA 1OQ6A 2NLWA 2X3GA 3IM9A 4J9KA 1FVSA 3UCZP 2HS3A 1SJRA 1AA1B 2HHQA 1KFDA 2U1AA 3QIPA 2FC9A 4DXLA 3V5RA 4LF9F 1SKUB 2ZM6F 3D1OA 5HL7Q 5E41A 1I94J 2WTFA 1KRPA 3ZZTA 4HT5A 3DLBA 3T19A 1CPZA 3I31A 1U1OA 1NHKL 1KS2A 2V2ZA 4ID5B 4IR1A 1AROP 2EG1A 2YNHA 1ZETA 1F9HA 4WKYA 1S76D 1SH3A 2BUNA 2ZHOA 2QFJA 2EC0A 2VDHA 1VFJA 2HEKA 1MN7A 1UZDA 4HVZA 1BGXT 5AXKA 1KEKA 2MY8A 4EZ9A 2HVDA 4KGXB 3AJDA 2M9KA 5L38A 3CJKB 4XTTA 2C42A 1RT4A 3C8YA 4KHPJ 2FHMA 2Z4PA 4FNHA 1JLAA 1IBCB 4IH7A 3W66A 2HMIB 1FEHA 1XTZA 3DC2A 1QE1A 3NOGA 4E98A 3D3BJ 3D0HE 2HK2A 2AJ2A 1S1WB 3I0SA 3ENWA 4O44B 4RNNA 1TKZB 5L39A 4M5MA 4P6QA 1RACB 4RPFA 2APOA 2BM0A 3OSPA 3PKMA 1DHMA 4RNOA 1HQUB 3BO3A 4ZVFA 5K8OA 2YNIB 1XMOJ 1M5OC 5HANA 4PWUA 4NEZA 4ECQA 2UUCF 4FYYB 2Y3YA 1IJFB 5D8HB 1OJ4A 1JLCA 1FNMA 1RDRA 2RUSA 5I3UA 4LF7F 4FF3A 4TNOA 5F9NA 1RBLA 1Q8BA 3N6LA 2QGFB 5E7OB 3MGJA 2HBQB 1BLUA 1MMNA 3W2WB 2L41A 5C42B 1L3SA 1TFYA 2KRRA 3OUYA 2B5JA 3AB4B 3BSCA 4QW8A 3KYLA 2VJVA 4WPAA 2MMYA 3NBPB 1HW8A 3MAQA 3R7NB 2GA7A 4KV8A 5KG5A 1FT8A 4G1QB 4KR0B 3K5NA 4JI6J 2K8GA 1T9XA 1WDDA 2MZQA 1HNVB 5HBMA 2GX8A 2OO4A 2EFVA 5KT7A 4K50A 5ITHA 3GV7B 2CRLA 4QIWD 2GQCA 1RU1A 4XPCA 1PYTA 4USMA 1JJ4A 4ZLJA 4ZN3A 2QFIA 3H2VE 3R5CA 4GVBA 3R9LA 2V8HA 4ZLNA 5B0BA 1U1MA 4RKUC 1FDAA 3TEGA 1SJ3P 2DR5A 1T94A 4N7TA 3EX7B 2Y1IA 4B9VA 2DT9A 2E1RA 2VBXA 4DBQA 2QMXA 4P7VA 1P1TA 1V5VA 1B7YB 1N0UA 2VPXB 1RTZA 4WFYA 3TJ8A 5JUMA 4FS2A 3NCRA 2XBPA 5AXLA 3T1YF 3IM8A 2B8PA 1U0SA 3DOLA 3LH2S 1KDNA 1AZSB 2QO3A 4Y28C 2JWNA 4CT8A 4ZPCA 2XS2A 4QR2A 5CZXA 5EN1A 1WORA 4IOCQ 3TX0A 2OJ3A 5GVQA 1FE4A 2KHDA 1L3KA 1U1NA 3IXQA 3KHLA 1YK9A 1IWAA 1RKIA 3NGUA 2JL9A 2GO8A 3Q86A 1N48A 5B0CA 2ZZNA 3W5YA 1U48A 2RQMA 1Y9OA 3S6EA 1JXVA 2CQ0A 2DH9A 2ZVIA 4OYBA 4U7UK 1C1CB 2V4JA 1NHVA 2HWHA 2IYIA 4MKAA 3WDOA 2XS7A 1CLFA 1EQMA 2KI2A 2BJDA 2O1PA 1FRXA 1QDUB 1AW0A 4X4UA 5GAGU 3SYZA 4RNFA 3G6XA 1K1QA 4DS4A 8RUCA 4P2MA 3DHWC 4OYXA 5DDOC 2FD2A 3NCQA 3WBZA 1D9DA 1RHUB 3RU0A 3UCUP 2J9CA 2VH7A 3IBFB 3CC4S 1P27B 3BBCA 2JNJA 2XZDB 2RD5C 4ES2A 3WIUA 1R0AA 3BGOP 3VR1A 4C11A 2HQGA 4FF1A 1VQNS 1JQGA 3BDEA 3HM9A 1WELA 5DG7A 4WP9A 1T03B 3T1HF 2DGOA 2CZ4A 2K1RA 3N0VA 4IFYB 3RUBL 2WSEC 3HHLD 3LO3A 1HWIA 1YRUA 2WB4A 4FNIA 1HKAA 1KBRA 4CLWA 2CPXA 3C14B 3MPVA 3PFOA 3IWLA 3M2VA 3HCXA 2FQQB 4AUKA 3RBEA 3Q2TC 4A8SA 3UR0A 5IXUA 5HQMA 4ED2A 2IM0A 3SXLA 3V4IA 4NXNJ 4C0HA 3P5BP 3MURP 3KK3B 2XZWA 5IQQA 2N7YA 2OAUA 4C0BA 2CZVC 3CJ2A 1D09B 5L9NA 2PFDA 3QGPA 4A8MP 1R8PA 2ZH7A 4DL5A 2AX1A 4MYUA 2ASDA 2F4FA 1V3RA 2KU7A 4W98A 4ZPVR 4ED4A 3D4JA 4LBHA 1C0TB 2KJWA 1N52B 2Z57B 5B0GA 3B4MA 2I2YA 3CJRA 2HG4A 1Z1ZA 3KLIA 3OT9A 2KB2A 4UW2A 3BGUA 3MFHA 4ECSA 4P52A 5J2QA 3DRPA 4NYZA 2DNYA 3E51A 1T05B 2XMJA 2RQKA 4USIA 4U6PA 4XO0A 3CCRS 3EGZA 5E5NA 2CJBA 1TVRB 1C0TA 2XMAA 3MUMP 1KQSR 4L73A 1C1BB 1Q79A 2MKJA 2QLFB 3IAS9 4GO5X 5E3CA 3TZXA 5DLGA 1LW2A 4X4RA 3GONA 2XZTB 3TA2A 1S10A 1CJTB 3ZZYA 1HYSB 2YPYA 3G82A 1S99A 1BMQB 2Z2YB 3OR1A 4I6WA 3IS9B 4KHMA 3VAMA 4EYIB 4DQSA 4CYUB 4ZP8A 4CT9A 2GQQA 5ETOA 3RZAA 2DIUA 4UOFA 1RLCL 5E0OA 4ZS6A 3DLEA 3P4UB 5KG7A 1NBEB 1SL0A 4KJIA 3MM7B 4ZP7A 1WF2A 5CAAA 2W9BB 1RAEB 4MK9A 5T7LA 2GW8A 3O2IA 2MDAA 4ZVHA 2ASJA 3M8YA 2XYPB 2QE5A 3MOZA 1IKXA
chains in the Genus database with same CATH topology
2VPZB 4TY9A 5BYSA 5DETA 3K8WA 1S6PA 2BRKA 2W24A 3CEDA 1N4LA 1HNWF 3D1QA 3NG8A 4PG8A 3IR7B 3K5PA 5C25B 2ZHAA 2CJ9A 3THPA 4F4KA 3NNCA 3DCAA 4DFKA 3OTEA 5KFNA 3I4HX 4MH8A 4URSA 3KK2B 3IRXA 4QWBA 4ETXA 3MD3A 2NR0A 4A8FA 2IJNA 2RSQA 1S0MA 3RW6A 4H4OB 4NL5A 4QPTA 3HVWA 3TX8A 3FDSA 2O01C 1RTIB 2I9SA 1SL2A 4DJBA 1U2RA 2DIVA 2QZ8A 5D77A 1FE0A 5AE1A 4K5RA 2Y0SD 2P5VA 2IVFB 1UVNA 1HQEB 3RRHA 5CCMA 2QSWA 3BSOA 4C7QA 3PJWA 2E7XA 5C5JA 2HVIA 3IWXA 3NNHA 4K4WA 2F1FA 4YQWA 4LFCF 4NZ6A 4OZJA 2IRUA 4LSNB 3M2RA 3PX4A 3TUZC 3M8QA 5I42B 5LMUF 2X1GA 5FD1A 1IBMF 3I87A 3KLGA 4DUYF 1KN6A 5KFIA 2J76E 4Q7AA 1S6OA 1HMVA 4I7FB 5KFAA 1SKRA 4MTPA 4QWEA 3GYNA 1SI9A 3F56A 4O4GB 2D7SA 4NLDA 4C8OA 4MFBB 6FD1A 5EUHA 3FZBA 4QIVA 1KC8T 2FHOB 5KFDA 2OFHX 2GV1A 3H5UA 1NKCA 1KTVA 4IR9A 3T9NA 2A1BA 2HHWA 4DR1F 3ISND 3OW2R 4NWBA 1X5SA 1TKXA 2RRBA 1FF2A 1RP5A 4FVCA 1WG4A 2N7CA 3HHLC 2VQEF 1N6QA 4G1QA 3EPIA 4C8LA 4ES1A 4ZCKA 2ADBA 4DSEA 4B17A 2FIUA 3HP6A 4LSNA 2OPSA 5IQ6A 1U6FA 3EZUA 4X62F 1RT5A 4JI8F 4EO6A 4F25A 3SCIE 4BHQA 1N5VA 2V8GA 2VUGA 3JSMB 1E6VA 2E7WA 2PSZA 1NKBA 2ZJRQ 2FY1A 2HNZB 2DNNA 5F3TA 3DMJA 1S6UA 2XGQA 2EFQA 2ZH4A 2ROPA 1IKYA 2F9DA 4A8KA 2CQPA 2ROGA 1U1LA 3HJFA 4QIEA 3U1MA 1RT7A 2CPHA 5D4LA 2EPIA 2HLUA 5F8IA 1DAXA 2A2CA 1LKZA 5B0DA 3K5OA 3QAEA 1EETB 4KO0B 1N32F 2R8KA 2JEIA 2ZJQQ 1FKOA 1GNKA 1DURA 2A2DA 1Q1KA 2J0XA 2MQNA 1V3SA 2ALZA 1S1VB 4K4VA 2DTJA 4RU2A 4JV0A 3MEDA 5B0FA 3PACA 3EXYA 1OQ3A 2Q6CA 1VQSA 4HTIA 2O3DA 1VIOA 2IM3A 4IUFA 3O44A 1URRA 3TANA 4UUWA 3OFHA 2IVMA 1VQ8S 3NL0A 4WK1A 1MMLA 2R2RA 3SCKE 2BABA 2D9PA 5CYMB 3MD1A 3PXGa 4Y0FA 4X4QA 2NSBA 2YNGB 3J7Z5 3M1VB 4RLEA 3CC2S 4I1TA 3J7A1 4CO5A 2VOOA 1SKSA 4F02A 3QLHA 1S4FA 2P6TA 4QOTA 1VBYA 1J5OB 2XY5A 5GMKa 1VC0A 1RJJA 3MECA 3BR9A 3W2VB 4IO1A 4B9UA 4H4MA 2NZ4A 1NNDA 2IM1A 3DLHA 3KKFA 4N56A 4B3RF 2XMMA 2W4CA 1CQMA 2G4BA 1VRTB 3TAQA 4HH1A 1TK5A 3SSQA 1FK9B 3OTOF 4EUVA 1M5HA 2WBRA 2J8AA 4NLUA 2BA9A 3BO4A 3DOKB 3THVA 1WG1A 1HD1A 2XMTA 1FRHA 3PDNA 2B51A 3C66A 2DGVA 2UV8A 1K9MT 3IFEA 1WEXA 3HDSA 2CQCA 2LU1A 3CCES 1QUPA 4DV3F 3QLHB 1M5KC 3PZPA 2OPPA 3MMAA 3TA1A 3ISZA 1SUQA 1ZM9A 1NK0A 2ZHBA 5KT6A 3CVKA 3CIMA 4JUZA 3OVSA 4J9NA 4DF8A 2G13A 2QV6A 3ICLA 4IRDA 1XNQF 5A0YB 4P2SA 2EFGA 3HXMA 2Y1JA 4YFUA 1NO8A 2WK4A 2HWTA 2XSJA 3LAKA 4DL0C 2OSQA 3Q8PB 3OHBA 4EBEA 4PXCA 1KFSA 2QA4G 2LQJA 4C8KA 2H9ZA 1UA0A 5HROB 2DR9A 1S9EB 3MEKA 2MQOA 4DR3F 1B7FA 2NREA 4LQ3A 2YKNA 3VTIA 2EK1A 2V2KA 3KJVA 1N33F 1P8GA 3DOKA 2UVWA 2DNRA 5E33A 2QT7A 1UETA 1Y5LB 1FKPB 2GIQA 4LIWA 3DRSA 1VRUA 1WHYA 3DGPA 3VZIA 3OLBA 1JLFA 3N6NA 4NCGB 5MAOA 2AYGA 4ECXA 4KPYA 1O5JA 3SCJE 4YP3A 3IBWA 3PR5B 3L95X 4A8OA 4J5OA 2KG0A 3JYTA 3IO1A 4I2QB 3TW0A 1AUDA 5F8GA 4QJVA 1DTTB 3TARA 2PA3A 3CDUA 5KFGA 3IC1A 4EZ6A 3UD4P 1RT5B 1CC7A 4J9MA 2AU0A 1P1LA 4PR6A 3DFEA 1GH8A 1GX6A 3CCWA 3A1YG 3O8WA 3V4IB 3GB0A 3TAMA 3SDEB 2XHWA 1T7PA 3D54A 3PW7A 3M1VA 4PQUB 3ULHA 2RQ4A 3BJYA 3SV4A 4HEA9 4B9MA 1Z2LA 2KT2A 1H2TZ 1AFIA 3HT3A 3BQ1A 1JLGA 2VG5B 2C2DA 3D0GE 4NYPA 3BGRA 1X4EA 3POTB 4CZCA 1S7HA 4YOEA 4NA3A 1HMVB 3SFGA 3FSYA 2QA2A 2VBZA 3V6DB 2ACYA 2DB1A 1LWEA 1O51A 2FB0A 4OI2A 2UXBF 2Q43A 3V81A 2VQFF 5DDPC 1R3NA 1WTFA 2R7TA 2M3DA 1NAQA 4R5PA 4YHHF 4ECWA 4LQ9A 2YQ3A 5C42A 2KM8C 2NUUG 3BN7A 4OJ1A 5KFTA 4DR4F 4LT6A 1FTRA 1MU2B 1L3VA 2PO4A 1S0OA 3NS5A 3OR2B 1MROB 5D78A 4UY85 4XK8C 1U1QA 5G0RA 3M30A 2YH0A 4HI2A 3KG4A 3OXGA 1R8HA 1YJNS 3LPYA 5B7WA 4ILRA 4JYAF 4B3TF 4B9NA 3BGLA 1IR0A 3TUIC 1VK8A 1UMJA 2KG1A 1QAYA 1RA7A 3MZIA 2OH2A 1QE1B 4WYLA 2XMUA 4DUZF 2HWIA 5HI7A 1JLAB 2YY3A 4CNZA 2YKNB 2ZOMA 3CMES 5L1JA 2KFNA 3QO9A 2W25A 3M9OB 3ZZOA 4EBCA 1RGVA 2POKA 4DV5F 3POTA 2KFYA 1F9FA 2ZE2B 3QGGA 4IFVA 4OV1A 2R4FA 1M90T 3PY8A 3OFEA 3F41A 3KLEB 3PKYA 2GHPA 2R2TA 2V94A 2CQ3A 1S6QB 5KFFA 2CQ4A 2RH3A 3PW5A 3LP0B 1Q86T 1RT1B 4Y6IA 3PFEA 4QQBA 5KT2A 3I5AA 1N0VC 4ECTA 1JLEA 4DQQA 1FNXH 5GADI 1BWEA 4KV8B 3S1TA 4BC7A 3NWGA 4FPRA 4X64F 1F5CA 2J6TA 3OR1B 2K3KA 4P7TA 3T9ZA 2B5JB 4WF9Q 4NX9A 3R1HA 1G6BA 3IR6B 5I3UB 2LQ5A 4I2QA 3CDEA 3HVTA 3R5AA 3I5CA 4BDPA 1NK4A 3C2PA 2DGTA 3MPYA 3NGKA 4NLXA 1VQPS 4NLPA 4Q2LA 1DARA 1BD6A 4TQRA 5KFRA 3UE2A 3GFXA 3I0SB 4O44A 5KFEA 2W8KA 1U1KA 4ED7A 1E6YA 2XCPA 3H4DA 3CCVS 3FMWA 2VV5A 2XI3A 3KJVB 5KT4A 3S8SA 2XO7A 2IMOA 2OP5A 2ADCA 4K0KF 3J7YI 1MNEA 2ABYA 1S9EA 4FF4A 3ISNC 1WF0A 2DCLA 2BE2A 4IKAA 3THTA 4RNMA 1JX4A 1G2EA 3I9ZA 1QM9A 3KNAA 2FTRA 2CQ2A 1VK3A 1XR5A 1YJRA 1XN9A 3HHDA 3LQVA 3IGNA 1DFDA 5EWEA 4Y2KA 1RYSA 1BQNB 3Q8SB 1U2FA 1X4BA 3KHLA 2VFTA 2JVRA 2K1RB 1C0UA 1QTMA 2BZ2A 1U6BA 1ZZNA 2K7KA 5LSOA 4Y2IA 3BR8A 2W4DA 1SB6A 4F3QA 1S79A 1KQKA 4FF2A 4KFBB 2NPFA 4O0IA 4A8YA 4J37A 1TQLA 4B08A 3TAPA 2BE2B 4OHYA 1REVA 2E5IA 1S0NA 2LQ9A 5M2UA 2CQ1A 2LECA 2E29A 2L9NA 1MWZA 1GXLA 4WFXA 5KG6A 4X65F 4N5SA 1SQEA 1C1CA 4OX8A 1KVJA 2Y1RI 1NU4A 1T02A 1T8EA 2M5YA 1RT6B 2F7VA 4KGMA 2RT3A 3IA0A 1LK7A 1WG5A 4URGA 4F50A 1Y00A 4OHWA 4IG3B 4W90B 1DJ0A 4WU3A 4DL6A 2DCUB 3NS6A 2OPQB 1I94F 2EBEA 1OWXA 2OD6A 2R7OA 1ZBTA 3PRBA 4C0OC 1OO0B 2B3TB 4ECYA 5H9EJ 3BF4A 5D4OA 5A8KB 3GFYA 4NLWA 4N77A 2WSCC 5U47A 4M94A 4HKQA 4YR0A 4O3SA 2W9CA 4N8OA 2D3ZA 2DH7A 2FGCA 1NH7A 3BQ0A 1H38A 3PX0A 3HZEA 4QIGA 3MM5B 4K4ZA 4MIWA 4WKRA 1Y5IB 2XMWA 5J2PB 3B8HA 1ZOTA 2KKHA 3M6WA 2XY7A 4QWCA 4DV0F 1U45A 3H5YA 3EYZA 4G6VB 2A18A 4RW7B 1UKUA 2RU3A 1RWUA 2R7WA 4IFVB 2VA3A 5CA5A 3TVKA 2HQIA 1GTEA 5DRKA 3DI6B 4LUBA 1XWLA 1LXJA 5KFVA 3K8VA 2DGSA 5HP1A 5DG8A 1XNRF 3L09A 2IM2A 3RAMA 2M8DB 1X4DA 4WYWA 2VB6A 4ICLA 4TY8A 4X4PA 4ECVA 1XC9A 1FXLA 2W7PA 1FJ7A 4BWMA 3K2YA 5JVHQ 4FBTA 1PC4A 2R7UA 1TKDA 2LXUA 3G8SA 2CQBA 1FCAA 3DMJB 2OPRB 3QJPA 2AGPA 1WNEA 3SSSA 3GIJA 1XMOF 1Q7YT 5HMXA 3JSMA 1LXNA 1HL6A 5A8RA 1NK6A 3UDLA 2XNQA 1Y5NB 4TU7A 3AQOA 3CT9A 3SQGA 4QWAA 1HWKA 3DDNA 2OPSB 3H2UB 5J1NA 2E1CA 1HNXF 4X4OA 2CQIA 2IAJB 5M2RA 3CCSS 4OZNA 1NJWA 1UVMA 1QY7A 1RT4B 1CQNA 4FBUA 2YX4A 4UY8T 2K3IA 3MOJB 2LEPA 1FERA 1FRKA 2ZBCA 3G96A 1HI1A 3HX9A 1LOUA 2E1MC 5EGYA 2Q66A 3QGHA 2PMZD 2B9XA 3PO5A 5HMWA 2QSFA 3VAGA 5F3ZA 4DFJA 2CPDA 4Y3CA 4CO3A 2HFZA 1RA6A 4OHXA 5AXMA 4YR3A 1WF1A 4OLOA 5A8WA 4B3SF 4WJBA 4RW9B 3MMBB 1FJGF 4DMZA 2AWZA 4K4XA 3RR7A 4NZ0A 2YNFB 2J6SA 3UQSA 4ZPDA 3UI3A 2RF2A 2PC6A 3MM9B 3G8TA 2OSRA 4ZHRB 2MHEA 4MJKA 3MM8A 2XNRA 4HHJA 2CFXA 4ECUA 4F8RA 2OTJS 5H9FJ 4O3NA 1K73T 2BQUA 3PNIA 3Q8QB 3DRSB 2Z0GA 2G0CA 2DHXA 3KLIB 5K9FA 2MSTA 3OXFA 2CJAA 4HLBA 1S1TB 3C46A 1XR7A 3M8SA 2Z8QA 3H8YA 3T5HA 4I69A 5BYRA 2VKRA 2XG8A 3BSAA 3DDKA 3AB2B 1BQMA 5E3AA 1GAOA 1U24A 2IAJA 2UUWA 4U9RA 3CD7A 1T3NA 2O67A 1S6PB 3MR5A 4QW9A 4ED8A 2ZFHA 1KNZA 1IKVA 1IUJA 2HGNA 4IG0A 3CF5Q 5JVGQ 2FLPA 2FUG9 3UCGA 4HYKA 1FDDA 3MM7A 4CTAB 2AV5A 2J7WA 3QWUA 3CJ3A 3MM8B 1UWBA 1LQ9A 5KOWA 2MYFA 1M0SA 4KT0C 2ZKTA 1RTJA 2R7VA 2ZH9A 4L3NA 5KFUA 4ZA1A 1N5TA 1HYSA 1U7LA 1PSDA 3H25A 2VD3A 4ZP6A 4GC6A 4O3OA 3MMJA 3E8OA 5DQIA 2OMOA 2J0QD 3H5SA 1KR4A 4IOBA 2YX1A 2HPUA 2DPIA 4IH6A 1YJVA 5BJRA 2GO9A 4DFPA 4H4KC 2ZBIA 3UDCA 3CMAS 5J2QB 3OL6A 4A4JA 1X4HA 2E44A 4WE1A 1FNOA 2LLZA 5KFSA 2EW9A 3MECB 3W2VA 5CYQA 4NLSA 2QIFA 3V6JA 1JWWA 3KK3A 4QR1A 5DS7A 4B3MF 4E0DA 3HLUA 4NA1A 2JLGA 2V9WA 2HRYA 4YB1P 1X5OA 3C6UA 3U1NA 3HO1A 5CYQB 1JMTA 2HIQA 2NQPA 1VI7A 1OPIA 4JI2F 4ZP9A 2BVZA 7FD1A 1LW0A 1U1PA 4DF4A 2R7XA 1VC5A 2WONA 5B08A 2DO4A 3NCPA 3UR3C 3QZ7A 1N5YB 3OTDA 1JXLA 1Y3JA 3BSNA 4ILLA 2HW3A 2J9DE 2YVSA 2AJ0A 1F2GA 3M2UA 2YKPA 3ONQA 4JI5F 1HHTP 1JLQA 3QIDA 2MJNA 4BBYA 4LVNP 3KHHA 1Q82T 1P9QC 1KONA 4PWDB 4Q0BB 5B09A 4Z2XA 4DV4F 1K8AT 1GT8A 1PC5A 3GMGA 4HTJA 2KHCA 3MEEB 2HS4A 3U1LA 3MF5A 2AD9A 1C4CA 3M8RA 1L5UA 4K4TA 1QAIA 1N5YA 2VBWA 2XS5A 4RBUA 2KO1A 3OPKA 4OI1A 2MGZA 1HARA 3I0RA 2MXYA 3HHNB 4WCEQ 1NK8A 4B9LA 4NCBA 2VFRA 2JJ4D 3ZZUA 5LXYA 2J9EA 3TI0A 5KT5A 4I56A 3OTCA 5C24A 2ZH5A 2J0SD 1KQGB 3HF5A 4K4UA 1KLMA 2RDJA 5GAGI 2B56A 4QIFA 2OTLS 4DR6F 5I3QA 1Q81T 2QRRA 4O4RA 2E1AA 3CCQS 5F0WA 1TKXB 4MIAA 5A8KA 2KM8B 2B7CB 4X4VA 1VQMS 2XCAA 2UZAA 5J2NA 1W2BR 1X4AA 1DZ5A 3RW7A 2OPQA 2JLEA 1ULRA 3BZQA 4O3QA 3R1LA 2X1AA 3CDBA 1YWXA 2IRYA 2EFOA 3HFKA 4ID5A 4MFBA 3RBDA 4AL6A 1G1XA 4N47A 3VQSA 5CQGA 1NJIT 3MR6A 3LP1B 3L7OA 1JJHA 2VFSA 2LA6A 1SKWA 1SJFA 3VAKA 1YI2S 1J5EF 3MM9A 3PR4A 2VODA 1WHXA 2VA2A 1JKHB 1UVIA 3I6PA 1KOOA 2ZH6A 3PIOQ 4DSLA 4PXEA 5CYJA 4IRCA 2ZC4A 1YBAA 5KFXA 3CULA 3X1LB 5A8WB 1FJCA 2FJEB 2XWYA 2CPYA 1VGYA 5KG3A 2XGPA 4CNYA 1EP4A 1IJEB 4NLRA 2OIHA 5HMZA 1FHTA 5AJ3F 1RT2A 4PCQA 4PXDA 5EHHA 2FLLA 2JVOA 4FP9A 3J80Y 4RW8B 4YY3F 3EGNA 3MEGA 4H4OA 2ZD1A 5KFZA 2ZH1A 1TV6B 4I4BA 2HHTA 1UEVA 2ZUGA 3P96A 2VG7B 4IH5A 4NRUA 4RWXA 2ILYA 4OHZA 3MFIA 4ED0A 2HMIA 4CCHA 1BQMB 3E2EA 1GQEA 1TL1A 1SV5B 3SFUA 4I2PA 1U25A 2DNOA 1KLMB 2VG7A