3WZ0A

On archaeal homologs of the human rnase p proteins pop5 and rpp30 in the hyperthermophilic archaeon thermococcus kodakarensis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
NRYIAFQVIGERPFKKDEIKKAVWEASLSALGYLGSARAKPWFIKFDEKSQTGIVRVDRKHVEELRFALTMLTEINGSKVIFRTLGVSGTIKRLKRKFLAEYGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 3
publication title On archaeal homologs of the human RNase P proteins Pop5 and Rpp30 in the hyperthermophilic archaeon Thermococcus kodakarensis.
pubmed doi rcsb
source organism Thermococcus kodakarensis kod1
total genus 25
structure length 104
sequence length 104
chains with identical sequence C
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01900 RNase_P_Rpp14 Rpp14/Pop5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wz0A00
2CZVC 3WZ0A 2AV5A
chains in the Genus database with same CATH superfamily
5DDPC 3K89A 3CCUS 1VQ6S 4ZPCA 1RAAB 3LA0A 4U7UD 3M7VA 3QJJA 3M8ZA 2LA4A 2FJAB 1BHNA 2XG8A 2F9JA 5HANA 1YHQS 4IQMA 5FIIA 3RBEA 2CQGA 5CA5A 1AT1B 3FMWA 3NWRA 2FC9A 1MROB 1B7FA 2QLBB 3UN3A 1RT7A 4JI8F 1DFDA 1HL6A 3NNHA 2UU9J 3CCLS 1XNRF 3ENVA 1OYEA 2LXIA 4IO9Q 2MGZA 3KHHA 2B9WA 1X9MA 4N8OA 1WC1A 4CLSA 5JXSA 3M6VA 5DDQC 2N4DA 1JLFA 4MT1A 3JSYA 2BE2A 1SUQA 2GVZA 5BYRA 3RRHA 4KPCA 3UO0A 1ZM4A 3QIDA 4CYUB 5CZXA 3I0SA 1KVIA 1TL3A 3QPIA 3EZ5A 1TKXB 4WYWA 1UZDA 3Q2SC 2AX0A 2DGTA 4HTIA 3IS9B 5IV4A 3RW6A 3CMAS 1VCTA 1YJNS 4E2FB 2HWHA 5IT9Y 1KFDA 4DSJA 4LF5J 4EBDA 4ZVFA 4GRSA 4DCOB 2RVJA 4ICLA 4A8WA 4IYQA 2DNZA 4TYBA 1RT7B 5GAEI 1HQ2A 3U1NA 3WQPA 3L95X 3OHAA 1TAQA 4R0EA 1R6VA 4ZPWR 4NXMJ 2ZH3A 2Z8QA 5IXUA 2MGZB 2OLWA 2EKNA 2MKSA 4DV7F 2X1FA 4JUZA 1GX5A 2GFFA 3NS6A 3HMJG 5LSRA 4GKKJ 1JLFB 1TV6A 1N56A 1N5SA 2BE2B 2CQPA 5B0GA 2GVZB 1SUQB 3M8WA 2Z2MA 3I0SB 2B9EA 4UT4A 1TL3B 1DLOA 3CJKA 5I3QA 2ZJPQ 2AEJA 3NMRA 1BWVA 1U4BA 3UDVA 2VA2A 2NXJA 3BH6B 1S59A 4ECXA 5KFOA 5GAHU 3FSYA 3I87A 2YX7A 3MCNA 2I8EA 4DUYF 2VOPA 2QL5B 1AUSL 3LF0A 5KFTA 2Z57B 5B7WA 1M1HA 2HWTA 3MFIA 2UZAA 4KGMA 2HBQB 2KL8A 3OL8A 2JWNA 3PEJA 2WAQD 1WI8A 3C6TA 1FO1A 3KJNB 3BS9A 4IOBA 4WFNQ 2KU7A 1JXLA 4V19X 2CQ2A 4XAKA 2XLJA 4ICLB 4LSNA 3RB3A 3D67A 2GHVC 1EETA 3CC2S 3KYLA 3W5XA 2WONA 2WVDA 5DDOC 4J9QA 1Y00A 3V5RA 2CDQA 3W2VA 4MK7A 1KP6A 4IFYA 4IG0A 3KFWX 3GFHA 2CVIA 3DRRA 4EK2A 1TV6B 3TUPA 4DR3F 1MMDA 2MY7A 1HA1A 5KFDA 1CS4A 1RYRA 3EZOA 4TQSA 2OO4A 2ADBA 1DLOB 3CJKB 3ELHA 3TRGA 3NS5A 3G9CA 4HT7A 1X4AA 1QAIA 4B9UA 3GR1A 3P6YC 2AJQA 1N48A 2JJ4D 4WZMA 4LF2A 3IR6B 4ZHRA 4EEYA 2QL7B 1VOMA 4PKDB 2K8GA 4X64F 3BR8A 4CH0S 1NNDA 4DSFA 3VQTA 2UXCJ 2E5GA 2CJQA 2CNLB 3C6TB 3N9UC 2HBYB 3LANA 2FJWA 3KXDA 5L1IA 3FRZA 2CNNB 4I4BA 2WVBA 3ZZTA 2V67A 1EETB 4KBIA 3C8YA 2DXEA 3JQMA 4L75A 5C2CA 3PYEA 4J9OA 2WONB 3MOZA 3M32A 2XGPA 1CQNA 2LU2A 1EJ7L 1I3OB 1ZS6A 2H51B 2V2QA 3CXCR 3W2VB 2NXCA 3TX0A 3DU5A 2R8KA 4IFYB 5BYSA 4IG0B 3DRRB 2XLKA 2M2BA 3MEGA 2YQ0A 2BJ1A 2NPIA 4J9RA 1CS4B 3UNYA 3V4IA 3K5NA 4HT5A 4KRWA 3J7YI 2A10A 2DB1A 5LXYA 1F1BB 3PIOQ 3PXGa 4OX6A 2CZ4A 4CI0B 3D2WA 2QZ8A 3D0IE 3IA0A 2C2RA 1WEYA 1XMOJ 3FCWA 3EJMA 3NMAA 4ZHRB 4DPTA 4QOTA 5DRKA 1F9FA 3EVMA 3GV5B 2HFZA 1B64A 2FJDB 3DDNA 3GIRA 4LF9F 2ATLA 4DQPA 1PG5B 2ERRA 1P9QC 3THPA 1R3NA 4F4WA 2DK2A 1UVMA 5HL7Q 1VQLS 1UPPA 4ECYA 3MMCA 5KT5A 4DL4A 4CO1A 4QYRA 3OBIA 3M32B 4X4SA 2VFVA 2GC8A 5G0RA 4QYZJ 3C46A 2DNPA 2WW4A 2HQ3A 2YNHA 2VKZG 4DSIA 4PQAA 2FLNA 1VQ4S 1OPZA 5CYMA 1IWAA 4KH1B 1I5OB 2V2KA 4G1PA 1MNEA 2HZAA 2ZBIA 3V4IB 2XULA 2J0SD 2XYGB 1WTFA 1NKCA 4N5SA 3O2IA 4LF4J 3MOJB 1QAYA 2CIMA 5JVHQ 2C3PA 1IBKJ 4A8YA 3EDRB 3K17A 1REGX 1OQ3A 2PMWA 3Q0AA 4I2QA 4ELUA 1G2EA 4YB6A 3OXLA 1VQSA 1WC5A 2HQIA 2Q1LA 3E2EA 1XC9A 3NGDA 1XEZA 4N7TA 3BPDA 1NAQA 4RNMA 4NLDA 4ECRA 2Z30B 1TR0A 3L9ZA 1LKZA 1T11A 5KFKA 3TUJC 4ED4A 1RAHB 4Y28C 3MF5A 4PPDA 2CQDA 1WNEA 3MMCB 4BWJA 2HK3A 2MEWA 5GADI 2GHWA 3AQOA 3AB2B 4DV0J 5FDLA 5G0RB 3EICA 3DHWC 2GQQA 1U2CA 5B0BA 2ZWOA 2PEBA 2D3O1 2YNHB 2ILYA 1D8YA 2P9GA 3OSNA 2HS3A 3DXSX 5CYMB 1RWMB 1FKPA 1YTYA 4K50A 9RUBA 4DL5A 3BEGB 2KN4A 2OUGA 1RB0A 4H4KC 3D1HA 2RDJA 1UJ4A 2OELA 1HQEA 4W90B 1M90T 2XYPB 2DGVA 1LXNA 4OZ1A 3NGRA 3BKTA 1WF0A 1T9UA 1RJJA 1F6TA 2R9LA 1NDPA 4AQYJ 2ZHBA 2KRBA 4EO8A 2W2QP 4RZRA 1U49A 4UUWA 1E6YA 4IRCA 5JVGQ 4KGKA 3GV7B 4YFUA 1WHWA 2GMHA 2CJBA 4HHUA 3O1LA 4TVAB 1XMQJ 1BQXA 1WC0A 2Y1LB 3R5AA 2DXDA 3GJTB 1KTVA 4WKRA 2ZH4A 4PRFA 3E51A 3GYGA 5FDLB 2V8HA 4FN5A 4DFPA 1VQKS 5LXRA 4KE5A 1VK8A 3QLHA 1U8WA 4NOHA 2F63A 3Q24A 2MKYA 3KDOA 2C2OB 2HRTA 2MQLA 1IKYA 4KTQA 4FDFA 1KQGB 1VJQA 4DUTA 4USWA 4A8FA 3MM6A 2Y1IA 2FDNA 3B82A 5KFFA 2O67A 5B0CA 2C2NA 4DUZF 4J9VA 4KHPF 2J6UA 2QN6B 4ZIWA 3M30A 2NZCA 2HK2A 1ZOTA 2IY5B 3PV8A 1HQEB 5MAOA 1FJEB 3HVAA 3RG6A 3QT5A 3B54A 2RKIA 1W2BR 4TLRA 4OJ3A 1UFKA 3OXGA 2FIUA 3HXMA 4FP9A 2FZGB 3Q22A 1UETA 3DLEA 2W8LA 4OX9F 1KDNA 4IH5A 3MPVA 2E1MC 3NGKA 4NLRA 4LJMA 3H5YA 1E6YB 5LT5A 4RO0A 2HRYA 4DPXA 1U02A 1N36J 1RISA 1RABB 2ZOMA 2HQGA 2GHPA 2B3TB 1FRMA 3HD2A 3M4XA 3DOLA 1JX4A 1X4GA 3EM1A 4NEZA 4HH0A 2VQEF 2FVPA 2AJ1A 2DNNA 3A12A 2QRRA 1NK6A 4J9NA 2PA3A 3QLHB 4OX8A 3NAHA 4LR8A 1Y9OA 3PRVA 1LQ9A 1X5SA 1URRA 4C8MA 2FJXA 1OS5A 2P9EA 1IKYB 3ZTRA 4BC7A 1O0PA 2IA0A 3OVAA 3MI7X 3MM6B 2JH3A 5DQIA 4GMKA 1Q5VA 1HD1A 3FDSA 3Q8UA 2N82B 4DX7A 3M30B 5EX0A 3I82A 3GILA 1RSCA 4RNOA 5KFUA 2RKIB 3EVOA 5C42A 2CRLA 2R7UA 4WKYA 2F4VJ 2F8EX 1C4CA 3PHTA 2DRBA 4ALZA 1FRXA 4Q2MA 2W25A 2CPHA 2ZHAA 5LSOA 3R97A 1S6QA 2VC1A 1RU2A 4J37A 2FZKB 1TL7A 3I32A 1T3OA 3VV2B 5L1JA 5DDRC 3DOLB 2XY6A 5K9FA 1QM9A 1NMEB 1T9WA 5E41A 1CJTA 3CJ5A 4LIWA 2DRDA 4X4OA 1Y11A 3R1LA 4F0KA 5HJYA 2EBEA 2ZOGA 3TZWA 2AEMA 2BRLA 1O6XA 2B4OA 1B7YB 1TKZA 4Q44A 3MR2A 2F5GA 4WK3A 4XIUA 2FYXA 2HHQA 1NPPA 1OWXA 2O5DA 4K59A 1NDKA 1RLCL 1NPKA 3MPWA 4M94A 1VDHA 4O3QA 2G13A 4JI1J 2NXUA 4ANDA 3UCUP 1CC8A 5KT6A 4F02A 2W8KA 4IDKA 1J27A 3KK2A 1RT5A 2FVQA 2H5JB 4LF5F 2OAUA 4KGVB 1WWHA 4WIIA 5C42B 1B0VA 4C0OC 1X4EA 2DR5A 4NRTA 4Q7AA 5KFPA 4OYAA 3VZHA 3R2DJ 1R8BA 1TK8A 2X3GA 2BDPA 1F5BA 3BO3A 1IJFB 2YPZA 1YK9A 1S6QB 2ZZMA 4NXMF 4L3NA 3P5BP 1F9EB 2YH0A 1TL7B 2CJ9A 3CGIA 1H2UX 3ZZUA 1IN0A 1RK8A 4TNOA 4HLBA 1P9YA 1UFLA 2ACMA 4DQRA 3UVJA 3V6DA 1U47A 5L9XA 4M5LA 2LCWA 1D1UA 2QX0A 1CJTB 1HR0J 4LFBJ 3MFHA 2QGFB 2V63A 2MSSA 4RUCA 2PI4A 1H3DA 3PDNA 3G6XA 1L3SA 2VBXA 1TKZB 2NR0A 2HWIA 3QT6A 2EFVA 3TJAA 3D6HB 3CB4A 3MTJA 3VVUA 2WSFC 2JEGA 2BR0A 2DO0A 3QFHA 4BBYA 3RTVA 1T05A 2VICA 1DQ8A 4IDKB 3KK2B 1RT5B 3BBCA 2LXFA 4QPTA 3CJQA 1OYDA 1KEKA 2XB2D 1M5VC 1SH2A 1YJUA 2V2ZA 4MKBA 3K8VA 3D1QA 4HHHA 3V81A 4JYAJ 3DCAA 5D78A 2ROGA 2DH9A 2I5JA 2XZTB 1SKRA 4RUAA 4JI0J 4CLYA 1WEZA 4CLZA 2ZM6J 2HVZA 3HKWA 2DY9A 4NZ6A 3OTBA 1NHVA 4AFFA 3AJ2A 1WHXA 2NREA 3DLKA 2VG7B 3GYXB 5KFVA 5IT4A 1CPZA 1FERA 3UVJB 3V6DB 5F9NA 2B43A 3PHEA 5KFCA 3J81U 3EPIA 2MKKA 4LR9A 3OL7A 4LRBA 6FDRA 5DLFA 4A8XA 2RT3A 1XERA 4B02A 4FVMA 4I1TA 1C1CA 1YJTA 3D1OA 2RB7A 3OXFA 4FYVB 2OP5A 1V3ZA 3KUGA 1H38A 1WI6A 4LQ9A 3RRKA 2JEIA 2MZQA 2XMTA 3N6LA 1GNKA 4NLVA 4FXWA 1T05B 2AJ4A 1UP1A 4C8ZA 2D1CA 2MQMA 1UKUA 4B3RJ 4XTTA 2NYHA 2KFZA 4P2FA 3Q8QB 3LPEA 1T3NA 4OI6A 3KOAA 2MQ8A 2J9EA 3TP2A 2WW8A 3V81B 2YPYA 3RBDA 3TAMA 1U09A 4NLUA 2VZ9A 4DPWA 2I5JB 3MEEA 2HIQA 3ITHA 2LP4A 5KFWA 3CJSA 4LF6F 1UW4A 3OW2R 5JUMA 3OJUA 5GAGI 1UWAA 3GU0A 3BSNA 3ICLA 1X60A 4RW7A 3DLKB 3O8WA 4P10A 2FHOB 3OQ2A 1NSPA 1YI2S 2CQHA 1X4DA 2IM2A 2IDEA 4TY9A 3OVBA 1S0NA 1NZ8A 2OSRA 4ZJOA 2ROPA 1UL3A 3SEOA 2W7OA 1TUGB 4BCAA 2HFVA 3FK4A 1YITS 5M2PA 5THWA 3AD9C 1SH3A 1C1CB 4ZVHA 2ZZTA 4UQTA 5A8RA 2WVFA 5CD4A 3FFIA 1N32J 3H5UA 2JSXA 2ZE2A 3FEXB 5ETQA 4H4OA 3Q8YA 4JBCA 2MJNA 2ZWPA 3ZNJ1 2KZZA 2VBWA 1SIZA 3GV8B 1XMBA 2BJ9A 2AYMA 3ZZ0A 3G82A 4I56A 3KWMA 4DDFA 2ASYA 2MLXA 1CQMA 1LFWA 2DH7A 4CO4A 1FX4A 2DIVA 1F0XA 4WJBA 4CZCA 3NY0A 3R7NB 2CG8A 1AXQA 2G1DA 1FF2A 4F04B 2XCAA 4UY8T 5F8JA 3JB9k 3WC2A 1DURA 1JLBA 2M7SA 3R1HA 3WIVA 1VMBA 3TAMB 3N6MA 3DRPA 2G2YA 3MEEB 3IR5B 2C22A 3ITHB 1S5ZA 3W7BA 3K5PA 1NEEA 2BM1A 1KVKA 4BS2A 1IJEB 1CVJA 2LDIA 3EXYA 4RW7B 3LALA 1Q8KA 3P8BB 2AGPA 3MM9A 2DNRA 4KAIA 3JSMA 1KSPA 2EC0A 2FGCA 2HHVA 4ECZA 4XK8C 1U7LA 4HTJA 2AZ1A 1TK5A 3D7SB 1VQMS 4NE9C 4ES3A 2XYHB 1FEEA 1FDDA 2QFJA 2IAJA 2UUBJ 4PYDA 5A8RB 1UFWA 3FFIB 4NMLA 1DAXA 2ZE2B 5J2QA 1PYTA 3I55S 4H4OB 2OEMA 2GGPA 1GQEA 2E1RA 1FESA 4TQRA 1FKOA 3TA0A 1JB0C 5KFHA 4CTAA 1Y5LB 2E1CA 2PFDA 1YJVA 3I9V9 1E6VA 3G82B 4DFMA 3KTQA 1EB0A 1HWUA 2V9KA 1NO8A 2CUYA 2BE7D 1KBRA 4IR9A 2W9BA 1YKWA 1AA1B 2YH1A 2NSBA 2PN6A 1JLBB 3DRPB 4DV0F 1NHUA 1U0SA 4K4TA 1NK7A 4DSLA 1IBLJ 3W63A 2XM3A 1HWKA 5LJ5Y 3QGHA 4EBEA 3MM9B 1WG4A 4B9NA 3JSMB 2VFTA 1VGYA 1N5QA 2FJVA 1SH0A 5D4PA 2BRKA 4ECVA 1HI8A 2W01A 3BGOP 2IBKA 2E9TA 7AT1B 4A47A 1JMTA 1DARA 2IAJB 3AOAA 3LP2A 2HIYA 2J9DE 1KC8T 3B4DA 4X4PA 3IBWA 5J2QB 3S1TA 2GGPB 4QWEA 2WOMA 1RWUA 1ZYQA 2VFRA 1U26A 1FKOB 2DITA 4RX6A 3D5MA 1FA0A 2A1BA 4EO6A 1IR1A 5E3AA 3GIIA 3R8YA 1E6VB 1ZZNA 1ZPVA 1JJ4A 2OMLA 4J5OA 4MYTA 4C8YA 1XR5A 3GZ7A 1FVQA 2IJRA 4NCBA 4TYAA 1R31A 1XMQF 4C3LA 2W9BB 2VDHA 1HNXJ 2RHSB 2GJIA 1NU4A 2HLUA 5KFMA 4ILRA 2ZC4A 3Q8PB 4NLPA 2EFNA 3SQGA 2MZJA 5EDWA 2E7VA 5J2PA 3BYPA 3AB4B 2CPDA 2ZH2A 3SSRA 4A8QA 3MCOA 4ZLPA 4DV1J 1NCLA 3QJPA 2J8AA 1YZ7A 1NJIT 1LXJA 3VTIA 3JQJA 3VAGA 1RWVB 3NL0A 1HNIA 1LEOA 3BDPA 3E8OA 5B0DA 3M8SA 1QVFR 2I0XA 2ZEJA 4TN2A 4J9LA 5E0OA 2UUCJ 4ED0A 4YQWA 4X62F 4C48A 3LP2B 3U27A 4USIA 1S9EA 1PIEA 3PYGA 3P4UB 2WZ1A 3BGLA 1VIOA 2E66A 1KWMA 2EEYA 2WSEC 4HH1A 2K1RA 4FS1A 1RWXB 2R7QA 4ZCMA 2HHSA 1EP4A 2HHTA 3GONA 3K57A 1K0VA 2KO1A 4N41A 4F3QA 2OGUA 1HHTP 2V4QA 4GKJJ 4FPRA 2B4UA 5E3RA 1IQTA 2PIIA 3CTRA 1GXLA 2DNGA 2V2VA 4G3IA 3CDEA 3SQGB 5J2PB 3DGVA 4LFAF 1FXLA 3UCGA 2KHCA 5F3TA 1S72S 3H25A 1K1SA 5F8LA 2BACA 4FF4A 5U47A 2B0GA 2UXBF 4F4YA 1H2TZ 1EKSA 1HNIB 1NXIA 4A4JA 2KYXA 4CWBA 2LEBA 5J1PA 4Q43A 3C15A 2Y8WA 2NSCA 1PJ5A 1TL4A 2ZBCA 1WEXA 1NRKA 3D28A 3SI8A 2G2OA 3DHXA 1NDCA 1X8DA 2PI5A 1UZHA 2R3VA 1S9EB 2M0GB 3SCIE 2Q43A 5BYQA 3FSXA 4DV3J 2HHUA 1U0HA 3V6HA 1Q86T 1RKJA 2K1RB 2Z58B 3BKUA 2MKHA 4N8NA 4PPZA 3EX7B 1EP4B 1K47A 3SXLA 3IN5A 2HKEA 5K5MA 3IRXA 1PJ7A 5H1SV 2DR6A 4X2BA 3FBCA 2LEAA 4UOGA 4CLKA 3MURP 1RKIA 1C2PA 5J2MA 1QAJA 4NASA 1ZM3A 2QYCA 5BR8J 1XN9A 1FVSA 5F8IA 4EYIB 1X4CA 4ZP7A 4X4NA 5L1LA 2RSQA 3N01A 5I3PA 2DHSA 5L38A 2R2SA 1ZA1B 5C7PA 4X65J 4M5KA 4DZ6A 1FWKA 4C8KA 3C15B 3UDCA 2D69A 3TZYA 2AGQA 3FSIA 2BABA 2CADA 4RW8A 4JI3F 4L3KA 4I2PA 4ID5A 1H74A 4W92B 2IDLA 5ETNA 1IKXA 1WOOA 4G1IA 1S77D 1RWNB 1FTCA 4LFCJ 1U0HB 4UW2A 1OIAA 1B4SA 2RUSA 2CJXB 4EU0A 3TJ9A 2VB6A 5CXTA 2LFVA 2DRAA 1FRHA 5HAOA 4ZPVR 1RWKB 3JSRA 4MKYA 5DGAA 3TEHB 4OYPA 3UNGC 1R8CA 3E01A 2NZ4A 1CG2A 1IUJA 4PWWA 3IRXB 1HD0A 4QU7A 2ROEA 5K8MA 2DYAA 3EGWB 2RDIA 5J2MB 2AIRB 2KHDA 1HR0F 4LFBF 1CULA 2QV6A 3NBPA 1FNOA 2CAJA 2JC1A 1VQYA 1D9FA 4F7VA 5IV3A 1Z4UA 2HAFA 3GFXA 2YNGA 3DI6A 3HVWA 3W65A 3N79A 1QUPA 4NA3A 3QYYA 2Y1RI 2HNZA 1N33F 2XTJP 5LJ3Y 2RQ4A 4RW8B 4I2PB 4FYXB 4ID5B 4ZPAA 5C25A 1IKXB 3ZZZA 3Q8SB 2HQCA 5KAKA 3QGIA 2ALYB 2B6AA 1U1QA 1WKLA 1HHSA 5L9NA 4CLUA 9ATCB 4OMFG 5K8PA 3DLJA 2AJ0A 4R8UA 3MR7A 1K8AT 5AE3A 2HVHA 4DR2F 1QAXA 1HIYA 1RWWB 2COLA 3E01B 4MYUA 5E3CA 3G8SA 4NLQA 2DCUB 1X4BA 4PG5A 3FQLA 3M9NB 4YB5A 5H9EJ 2MLYA 2PGCA 2GIQA 4OJGA 3M8PA 2KVQE 1PKUA 4XPCA 1CULB 2EFOA 2KKHA 3NBPB 1QSLA 1T03A 1AFIA 1X5OA 3VALA 3VQSA 1PAUB 1L3TA 4QCLA 5ETRA 4C9DA 2HHXA 4CLWA 1BY9A 1RHUB 3EPGA 4FF3A 4PXBA 1VC0A 3BSCA 3ZFVA 2VUGA 2YNGB 4BWMA 1LFPA 1VRQC 1TFWA 3J80Y 2MQNA 5A76A 5HJXA 2HNZB 3OL6A 4I64A 4TKTA 4XO0A 4PG4A 3BM7A 1S10A 1PC4A 4R25A 5C25B 2PDAA 4CLFA 1JLCA 1W26A 3CCSS 2B6AB 2E44A 2CQ1A 3PR4A 4OZ3A 4B3RF 2HG4A 4LVNP 4MFBA 2ASJA 1KOOA 2UV8A 4TXSA 4R8UB 1NSQA 4ZVPB 4ECSA 4I68A 4RW4A 3AXMA 3MAHA 3HSGA 3QATA 3G87A 4TU7A 1IR0A 1DZ5A 2HBRB 1IBCB 2LVWA 4AD6A 2HS4A 4F50A 5KFEA 3PM9A 4DR4F 3HHDA 3M8PB 4JI7J 2Z2ZA 4PYAA 1T03B 3QGGA 4DOZA 2VC0A 2LU1A 2QMWA 1KLNA 4UUXA 3ISZA 3AHPA 2HZCA 2H65B 4NLGA 2WBRA 4Q0BA 4WE1A 2DNQA 4X66J 3CO0P 4NLXA 1X0PA 1HLWA 3FRYA 4OYIA 2NLWA 4ZCIA 4FKYA 3R5GA 3GFYA 5DGBA 3HX9A 5F8NA 1UA1A 4NLWA 1Z2ZA 1RADB 1JLCB 1QLNA 1GXTA 2DNOA 4WP9A 1F5AA 1D9DA 3CJ4A 4H4MA 2QFIA 3LWMA 1RBOB 2XMUA 4MFBB 1VQ5S 4USUA 1KQKA 2CNKB 2VFUA 3JTNA 3CD5A 5IQ6A 4DV6F 2G4BA 3TI0A 2QEXS 1X0FA 2ZNYA 4RW4B 1FT8A 4PZVA 4LF7F 4HHJA 1ELOA 4WK1A 4NRUA 4OQJA 4B3SF 5I3UA 1U48A 2CKWA 4DR6F 3C6UA 2DPIA 2FD2A 3CUNA 4DX8H 3OFEA 2XMVA 4WIQA 2LMIA 4DV2F 1U1OA 4OZ2A 1FRJA 4NCGA 2YKPA 4K5SA 2E9ZA 2LQ8A 2J0QD 3RW7A 1R0BG 2HLTA 2DGUA 1PBAA 2J9CA 3PJ9A 2BJ8A 2GS8A 2VPWB 4WYLA 1RUSA 3KHRA 4Q0BB 4WE1B 5ETKA 3IBFB 2DJWA 1WHVA 2CPJA 3LP1A 2ZDOA 3NAIA 3KG1A 1X4HA 3BPSP 5D8HB 3EGVA 1RT4B 3BJYA 3NOGA 1H6KX 2GO8A 4F26A 3RB6A 2V69A 2MJUA 2X1GA 1T9TA 2MZTA 4H4MB 1J5EF 2Y9HA 5A8KA 3A13A 3AAWB 2D3OR 2HHHJ 5F8MA 3K2YA 3DU6A 4Y34A 3H4BA 3G6ES 4OYMA 3TOQA 2XO6A 3M6UA 2CFXA 4HI2A 4N77A 3O44A 3AA9A 3H98A 3QT7A 5CHCB 2R2UA 1A6LA 4YR0A 2QMUB 4YHHJ 5I3UB 4QIEA 2MKJA 2ZZNA 3GQCA 2OHDA 1WHYA 3T5JA 4DU8A 3C6UB 2XSFA 2RDDA 1MG7A 3A8JA 1UEVA 1UVIA 4NCGB 4O0IA 2LQJA 1VBYA 3ZZOA 5E7OB 1F2GA 2GJFA 1RT6A 4ZVUB 2DBBA 5HQLA 1IWGA 4TLQA 4I67A 4KKOA 2FHMA 2ZJQQ 1FX2A 1Q4RA 3O6QA 2Y0BB 3CCVS 1C0UA 4B17A 4NXNJ 1OY9A 3NGSA 1ZM9A 3RAXA 4LUBA 5CQGA 3LP1B 4AUKA 4PWUA 3CNQP 3MHYA 3ISND 4OI2A 2RS8A 2PEHA 4ZP8A 2E5JA 4PG7A 5EWGA 3G8QA 1LWXA 3L3CA 4UZCA 1HBNA 4NEYA 4O3NA 2MQOA 2KZMA 1HNXF 3IGNA 5A8KB 1L3KA 4QJVA 1ZPWX 4DI6A 2FLOA 1XR7A 1N5TA 2ZVSA 2O1PA 4LRCA 4WTYA 3CMQA 2C2DA 4FPIA 4DV1F 1VBXA 3P3DA 2CQBA 2PMZD 2VU5A 1HBOA 3WDOA 5T7LA 1S4EA 4JI2J 5KG6A 1SC3B 2Y1JA 2DGWA 4IOCQ 4ZLNA 3I6PA 3RRGA 4DR5J 2E1PA 2W7PA 1RT6B 2XNQA 5EX3A 2OEJA 2CXEA 4KKOB 4DV4J 1FKAF 2BJEA 3MD3A 2Z2YB 1C0UB 2BE9B 5DLGA 2RU9A 2GIRA 4OI1A 2C1EB 4CT9A 1VHFA 2MZSA 3HHLD 3DM2A 4UTGA 1VR6A 4B3TJ 3PX6A 4IOAQ 4P52A 1HBNB 5H9EK 4CNYA 4B3MF 4M5IA 2LQBA 1OY6A 5ETTA 4MAKA 2PMHA 5KFQA 3L4BC 4F2RA 4F3OA 2AMCB 2MMYA 3ADAC 3PW7A 1ZAWA 1RTHA 2D41A 1S0VA 2GO9A 4CDIA 1RACB 2R2RA 2P8IA 3LGMA 3LGNA 1KD1T 1U45A 1LK5A 5CD4H 4JV5J 2DGSA 5ITHA 4KSEB 1HBOB 1S99A 5T7LB 2OSQA 4DSEA 3JTPA 1AFJA 2XHCA 1HBMA 1EQMA 4YOEA 3NG8A 3PFEA 4NA1A 2DNHA 4V1Ak 3FC9A 4ZPBA 1HYSA 3HSDA 5GMKa 1G1XA 5KFIA 3CD7A 1Q16B 2XWYA 4M8LA 4E0DA 3ZTPA 5CCLA 3D6FB 3UFCX 1PILA 2BW7A 3KJQB 4O0NA 4ZIVA 3KLFA 3CW2C 1RYSA 1VIXA 2WRMA 2YWWA 3PACA 1X4FA 3V2UC 1DJ0A 3HLUA 3AA8A 2HGLA 4ZKAA 5E5NA 3DM2B 2AJFE 3TX8A 4OJHA 3LWLA 2ADCA 3HDSA 2V50A 2H1YA 3D6TB 3G86A 1S7HA 3AQPA 4P7TA 2NUHA 2J6TA 5DZ7A 1DQAA 2IJFA 2UXDF 2KFYA 3HT0A 3RBZA 1Q7YT 1KKHA 1H7WA 1FE4A 1RTHB 1XQIA 1R6YA 5EGYA 4EYHB 5DG9A 1N34J 1RAFB 4HDGA 4DFJA 5KFLA 3DLGA 3M9OB 3GFZA 3OR2A 4WU2A 1HBMB 2EBGA 2JFKA 3BQ1A 3VAMA 1HYSB 4DZDA 2M8HA 4U8VA 1G7CB 5RUBA 4RLEA 2UVVA 3HZEA 1HMVA 3L09A 1RBAA 2W1BA 1BD6A 2NXEA 1RT2A 1APSA 3DLHA 3R6GB 5A8WA 3GPAA 3JXOA 4LFCF 5C5JA 3LW5C 3KLFB 2VG6A 4CIOA 2J0XA 1S48A 3ONQA 1G3OA 2MQPA 5IFMA 3NP5A 3QZ7A 5CAAA 1RDRA 4YEAA 1L3VA 2QJ3A 4GO5X 1HPZA 5DM6Q 1KQSR 5KG2A 4RNNA 2CG4A 3I4HX 6AT1B 2SXLA 3W1YC 4P71A 1L3UA 5D6GA 1H72C 2U2FA 1R8PA 2QA1A 2MKIA 2FTRA 3TA1A 2UV8G 3FVYA 3W61A 4K4YA 4A48A 1S4FA 1FDNA 5KG7A 4FYDA 5E3PA 2W2PP 4DL2A 2AGOA 3ZZPA 1IR2A 2HHWA 4J9PA 4C0HA 1VYAA 1Y3KA 4ZVEA 1X9SA 4YP3A 2AQ4A 3BGUA 2MXYA 3BH7B 2HW3A 3HVRA 3GSIA 4DV7J 3DLGB 4CQ1A 3OR2B 2IA6A 3NWGA 3CC7S 2HNYA 3TVZA 5AT1B 3W8GA 1LW2A 2IVMA 4DU7A 3SV3A 3HHLA 3HFZB 2ZDPA 5AE2A 1RAEB 1HMVB 1SJ3P 1AW0A 2HFSA 4ZVOB 1C4AA 1RT2B 3J7ZT 5A8WB 2UUWA 2N4CA 2D9PA 5HN0A 4GO7X 2RUGA 4LIRA 4Y65A 4KB7A 5FJ4A 3OR1A 2VG6B 4DUYJ 1FFWB 1NZAA 3SBMA 5KG3A 3QJLA 2FVCA 3J7AN 2M8DB 3BBFA 4QIVA 3B6BA 1VQPS 2GVDA 2NCKL 3AT1B 2YVSA 4NZ0A 4BDPA 1HPZB 4W4MA 5F8GA 1GEHA 1S6PA 3W8PA 1FI4A 5CZVA 4RNHA 3T1HF 4C3MA 2XMKA 4Y2CA 1HNWF 4WFZA 2XZDB 3DN9A 4S0MA 5KG5A 2IPOB 2YKAA 3RB0A 1MLAA 1I94F 2IRXA 1FK9A 2M9KA 3C3LA 1M5HA 3OFGA 1KHWA 4KFBB 1LWEA 5D3GA 5KG0A 1YBTA 5HVGA 4XPEA 3QGPA 5KFSA 4ED1A 4O4GA 3T5KA 3KKFA 1H98A 2BOPA 1NLKL 2HNYB 1WOPA 2OFHX 1LW2B 3HHLB 2LLZA 2X51A 3EGNA 1ROFA 3CJ2A 3KNGA 5B09A 3AJ1A 3A4TA 1NJXA 3UN5A 4Y2IA 3PR5B 4DS5A 2AYEA 4N47A 2YKNA 4Z37A 5SUHA 2HHPA 3OR1B 3V6JA 2FY1A 5D15A 3KLVA 1SJ4P 1CJKA 5AJ3F 4KHMA 2E9RX 1NB7A 2GQCA 4RUHA 1N0VC 1RCXB 4NI2A 2GVDB 4O23A 2ASDA 5HK4A 4C4WA 1CC7A 1S6PB 3Q23A 2FQQB 4E8UA 1ACMB 1XIQA 1UAWA 4DR1J 1IKVA 5F0UA 5CCMA 5HO4A 2V8GA 2IFXA 4MK8A 2MB0B 1N0UA 1WTBA 1NHKL 3BN4A 1G6BA 3NEKA 1YBAA 1NDLA 4JI6F 4DR7J 1BQNA 3HKZD 3NXZA 5AXKA 3CVKA 5AXNA 4K0KJ 1DTQA 3GLJA 1FK9B 3PVXA 1X5TA 2OTLS 4CM0A 1LWEB 4M63A 3LP0A 4I0WA 3KK3A 2BX6A 5D3GB 2CDRB 2KB2A 3WX8A 4J7CA 4O4GB 1Q95G 2QT7A 3IG1A 2Z4PA 4OYOA 3L7UA 3D3CJ 2QLWA 3T19A 1AUDA 1YVFA 5KOXA 3CJ8A 3T9ZA 1KHVA 2CQCA 1SC4B 4XDCA 3MXHP 4P74A 2FHJD 2YKNB 2VQFF 2UP1A 4HI1A 2OPRA 2H3EB 1CJKB 1T7PA 1GTHA 4NI2B 1S6OA 1S0MA 4A8OA 5HI7A 1S76D 4IO1A 3IWNC 2DNKA 3OJSA 4ZCKA 4ECQA 2AF6A 1IKVB 3Q86A 3TAQA 4DQQA 3EVWA 2ZOFA 4QU6A 1YWXA 2KJVA 5GAHI 1BQNB 5GMDA 3MM8A 1R0AA 1DTQB 1QSSA 4AL5A 5LMNF 1RLDA 2B9YA 4JV2A 1UJ6A 3EUNA 1FE0A 1M5SA 1HI0P 4FS2A 3LP0B 3KK3B 2HNDA 4LF8F 2K3KA 4DV5F 4ZA1A 3HFKA 3SFGA 4O3OA 1NBEB 2P6TA 3P96A 4NZ7A 3ENWA 3K5MA 5DG8A 3IG1B 2IC3A 2F4FA 1HQUA 4KGZB 1DBDA 4U7CA 3ZC4A 2DD8S 4MKAA 3BDEA 4ZVRB 4P73A 3KG4A 3MMJA 4PWDA 3BF4A 4X4RA 4OV1A 3SDEA 3VVTA 3VGUA 1YG0A 3NCQA 2JX2A 3G71S 3P45B 2OPRB 4C98A 2C2KB 2L08A 2ZHOA 7FDRA 4O3RA 3HHEA 1RTIA 3OTCA 1JLGA 1TZ0A 4DEZA 4IH6A 2J7KA 1Q82T 2V0NA 3ULHA 2OIHA 1WF1A 5BXIA 3AOBA 2HVDA 1C0TA 1SB6A 1MWQA 1FFSB 3FZBA 2EK6A 3BKFA 4RL1A 2U1AA 4OZLA 3MM8B 4EMDA 1R0AB 4IQXA 2RQKA 2APOA 4C6AA 1HI1A 4DLEA 4P2XA 1Q8BA 2VA3A 2DY1A 2I1RA 3BGFA 1XBWA 2Q66A 1JXEA 4CO0A 1H0HB 3LO3A 2HNDB 3SFUA 4GC6A 1PSDA 2OPQA 1S7IA 2ILZA 1NK5A 2VF3A 2P2CB 4NXNF 5IWAJ 3T6JA 4DF4A 4FNIA 2GAGC 4YB1P 3RR7A 2Y8YA 1CLFA 2YWGA 2DGOA 2B7CB 2IC3B 3PJXA 4YMEA 3PZPA 4UOHA 2CJYB 2AP6A 1HQUB 4RU9A 3SSSA 2O01C 3OTOF 4PG8A 4USKA 1PJ6A 2C3OA 3S01A 2VBZA 3WX4A 2VHGA 5HMWA 5CABA 4BC9A 2DCLA 3MWBA 4PWDB 2J5AA 3SDEB 3HSZA 5LM7E 3BV8A 2ZKUA 1V3RA 4K4VA 3V4MA 2QA4S 2K2PA 2QA4G 3ZXWA 5HSPA 5B0EA 1RTIB 1K1QA 1M5KC 3HI9A 1JLGB 1Q78A 3GJQB 1NK9A 2VIHA 1EQ0A 1PCAA 4HEA9 2EFPA 3T1YJ 2V8VA 2Z2LA 4KGXB 3ETOA 4K8RA 4ERDA 3LTOA 2BQ3A 2AYBA 1C0TB 3CCZA 2N3OA 3TAPA 1GFWB 4M5HA 4KY3A 1RBLA 3QBCA 2CVEA 1HNZJ 1Q81T 1RHMB 2WB4A 1GMVA 4OIXA 2HFOA 3H7HB 4GVBA 1GH8A 3IM9A 4DV4F 2OPQB 2FHJA 1IBMF 3I56S 3T1AA 3GIJA 2DGQA 1T8EA 5E33A 4Y3CA 2BKPA 3DKDA 1VQOS 2BA9A 2H9ZA 2A3JA 1QDUB 1ZA2B 2RRBA 4K4ZA 8RUCA 2VD3A 1TMJA 1TAUA 2DR8A 3UR3C 4OL8A 5I42A 3EE3A 5C2GA 4ZPTR 4L76A 3MR6A 2ZH8A 1YLXA 4LF1A 3CCQS 1WG1A 4F4AA 2DR9A 3R5DA 1TTHB 4FBTA 2A6MA 3GCXP 4J9MA 2BZ2A 2KTQA 3VGVA 4CH1A 2KH9A 2UU9F 2L9DA 1WC6A 2EFQA 2MZ1A 1KQFB 1VQ8S 3DLBA 4NPOA 2DHXA 3TZXA 2Q6CA 1F5CA 4A8MP 3L7OA 4P2SA 2VL1A 4HVZA 2IMOA 1UVKA 2EKYA 4QIWD 1Y5IB 1S6UA 2VQEJ 2AX1A 3PKYA 3A8IA 4OYWA 4NWBA 4MMOA 3ZTOA 3HZGA 3GP9A 1U1RA 4OHZA 5EN1A 4AE5A 4R0JA 2HGMA 4ZS6A 4GVBB 1SKWA 4E98A 2VPZB 5HQ8A 2AYGA 2BKOA 4P6QA 1NUEA 1XNQJ 1FRLA 2A2DA 2YQ1A 2D74B 2VONA 4ES2A 1Y5NB 2VODA 3HVTA 5T14A 4B3OA 1RAGB 1JJHA 2FY8A 5I42B 4RWWA 5KFNA 4DXLA 3OL9A 2HSEB 4IG3A 3HP6A 3H90A 2GNKA 2R2TA 4DFKA 1PYSB 3J7YU 3U1LA 1T9XA 4Y2MA 3EGZA 3GTYX 4ZVGA 3U1MA 2F3JA 4PABA 1X7VA 1N34F 1S1UA 3PTWA 2VG7A 3OTEA 4GKKF 4ILMA 1LWFA 5KFXA 3IC1A 1Q53A 3MPYA 2R7TA 3D0GE 4EI2A 2ZUGA 5KTQA 3TVKA 3KLGB 2IM1A 2YX1A 3NOCA 3K58A 3VR1A 1SIWB 2JEJA 3CO9A 3AY0A 3H2UB 1U1LA 4YS2A 2D7SA 1V3SA 3QRQA 2IMWP 1JJ2R 1M1GA 3AFGA 3D68A 1Q1KA 1SQGA 5CYQA 1YBUA 3OPKA 3NS7B 4FNHA 4ZCLA 2DKOB 1IM4A 5GVQA 3CSKA 3HVTB 4C8OA 4CLPA 3FBFA 3ZTQA 4B3OB 2Z56B 2RQCA 2FVSA 2RMLA 1W25A 3TQEA 3VHQA 1Y7PA 3TARA 4OZNA 2MTLA 3W9HA 1VC5A 4IG3B 2V6AA 2YKMA 2AKWB 3MCMA 2XS7A 2Q6BA 2MKCA 3DRXA 4ANEA 3D4JA 2H4YB 3RB4A 4OI3A 2IYGA 1HNVA 1S1UB 4QWCA 1NH7A 2WVCA 2HEKA 3R7BB 3JYTA 2UVRA 1LWFB 3RGIA 3TUIC 2OH2A 4KQZA 1DTTA 5F8HA 3IAM9 1IQZA 1H73A 2A18A 3FBEA 3W9IA 1UCNA 4Q45A 2KFNA 3QZ8A 4NLOA 1R89A 2D3UA 4TY8A 4EUVA 5GADU 4B9LA 4N56A 4EZ6A 2GW8A 5CYQB 2RILA 3HT3A 1VQNS 3K5OA 2HFNA 3C16A 1LW0A 3GB0A 5EUHA 2JLEA 2V94A 4X4UA 2UXCF 4KIAA 4K5RA 1S0OA 2RRNA 3B4MA 1U6BA 2AT1B 2GQ2A 4RR5A 4F4KA 3KNAA 3CC4S 4F3MA 3M8QA 4RNFA 2YTCA 3AD8C 2PSZA 3DDIA 2YKMB 1FEHA 5HMYA 4URQU 4A8SA 1T9YA 1N52B 3RAQA 1FFGB 2FC8A 2LXUA 2W24A 1F3FA 2CJKA 3ILLA 3PW5A 1HW8A 5KG1A 2Q3PA 4FZVA 1HNVB 4HR2A 3PJWA 3OTDA 3JYTB 1QSYA 5SZTA 3P5TL 4FYYB 2B4VA 4YDDB 4IH7A 4XDDA 3EXCX 2UVUA 2QSFA 2MPUA 1DTTB 4YY3J 5FLXY 3CJRA 4O3PA 4I6WA 5DS7A 2WSCC 1U1NA 1RQ0A 3RU0A 4F8RA 3NNCA 1XMOF 4ETZA 4DF8A 1FXRA 4TY8B 2KM8B 2V5HG 3ILOA 4QIGA 1M1KT 3H5SA 2V34A 1U6ZA 1VK3A 2M5YA 2CPZA 1I6JA 4FXDA 1NJYA 3G6YA 3PO4A 4ZJLA 3C16B 1ZBTA 1LW0B 1YJ9S 4QPXA 2XMMA 5IT9U 2R7XA 2EPIA 2OFGX 1YJ7A 2V9WA 4I6AA 4DMZA 4MJKA 3VGTA 3BBBA 1SBRA 3IO1A 3D66A 3A8KA 3MCSA 1ICEB 5KG4A 3M8QB 1S1TA 4DR1F 3A8EA 4ECUA 3OFFA 4YUDA 2HURA 4LSNB 3IAS9 1RTJA 4P75A 1KS2A 5HQMA 4DR7F 3F56A 2V8PA 4K0KF 1KVJA 4K4UA 2AD9A 1Y3JA 5KT3A 3MUVP 4K2JA 2R42A 3MAAA 4LF6J 1O51A 3M2RA 3MECA 1N54B 3H0PA 2B56A 2HQFA 1FJCA 1O8BA 2CPXA 4WTOB 2RNEA 1KONA 1S57A 1AZSA 2DNLA 4WFXA 2JNJA 2G0IA 1H7XA 4LF4F 1ULRA 2L41A 1RXOB 2JDJA 2M70A 3KG0A 2CNOB 4ED7A 1IBKF 3CCMS 2JOQA 1R0CB 1YX2A 2FJBB 3MZIA 5J1EA 3R5JB 4WU3A 4KYZA 2R8IA 4ZK7M 2GJ2A 4D3GA 5L46A 1UA0A 5K8OA 3OSPA 4Y2KA 3BGRA 3QMQA 2QC3A 5ETVA 1I1GA 4NLYA 2D9OA 3M8YA 3ILJA 4ED3A 3HULA 4CO3A 2FUG9 1REVA 4QR1A 1RWPB 3N0VA 3EMTA 1S1TB 3D54A 4DPOA 1CBKA 1S12A 1T0TV 4DLGA 1RTJB 4ZJQA 4G65A 4QW8A 4DL0C 4JV1A 3UI3A 2CQ3A 4FVCA 2W4PA 3W5ZA 4RBUA 4MIWA 1RA6A 2MHNA 2E5IA 2GCFA 4D3HA 3MAAB 2PFFB 4OZ5A 3M2RB 3IWLA 3MECB 2J7WA 2GMJA 3CMES 3HJVA 3CPWR 3MEGB 1RAOA 3AXKA 2XMWA 2V4RA 3QO9A 5CYJA 1PO6A 4QBUA 2B9XA 5HP1A 1YSJA 1AZSB 3C19A 4YB7A 1V5IB 4O44A 2VPYB 2DIUA 4G6VB 4P7VA 2B4PA 2GZOA 3PNIA 3PRDA 1DQ9A 2RJZA 3A3OB 3FEYB 2N7YA 1J5OA 3OFHA 4LSZB 2QMXA 4USMA 4RW9A 4DSKA 1D0EA 4Q8EA 2VJVA 5J1EB 4ZVSB 3KLHA 1RTDA 4AQYF 1N88A 3LGHA 3M1VA 3H5XA 3BGRB 2R7WA 3QRRA 5HLFA 1LNQA 4Z2XA 3G6VA 2RIJA 1MN7A 4J91A 2DNYA 2NUUG 3PFOA 4LBPA 2PA8D 1REVB 1S1XA 1VISA 4Y00A 2JZ5A 4ED2A 2C2EA 4QR2A 3IXQA 4ECTA 2XI2A 3MM5A 4RW6A 3POTA 3G8TA 3CWJA 4ANCA 3VAFA 3HO1A 1NJZA 1JNZB 2WBMA 1F2HA 3IFEA 2MLZA 4RBVA 1S1WA 2ATCB 3CCJS 1U8SA 4AYBD 5IWAF 3QO9B 4ZVTB 5HP1B 1FRKA 3NKYA 1RI7A 4O44B 2A0FB 2UUTA 3CCES 1UTAA 3OT9A 4WWSA 1LK7A 3CJ0A 5IC4B 1J5OB 1K9MT 4U7UK 1ZTTA 2KXFA 4RW9B 7FD1A 3NLCA 2OTJS 4ENOA 1EARA 1SV5A 5B0FA 1HFEL 3KLHB 1RTDB 3M1VB 3KMSA 1TUVA 3M05A 3UE2A 2OMOA 1YJWS 3W5YA 4I2QB 4URGA 5HLFB 4PEOA 2ZBQA 2AEFA 1BC6A 2NS1B 3FGVA 3KDNA 3MEKA 1N36F 5IT0A 3F0NA 3T1YF 4KJIA 3IM8A 1S1XB 1EZZB 3TQ1A 5DO2A 1MWYA 3PW2A 2FJEB 3MM5B 4RW6B 3IBCB 3POTB 2IBOA 4DN9A 2JC0A 2HFUA 2J8SA 1HNZF 2GMLA 3RAMA 2W7AA 1RT1A 1X5PA 4OLOA 3QSYB 2CPYA 1N5YA 1S1WB 2IRUA 1FXDA 1VBZA 4N76A 5ETSA 3KK1A 4RUBA 4JI5J 2DVIA 4PAAA 1FJGJ 3G96A 4LR7A 4CRJA 1FKPB 1PC5A 3CEDA 4DJBA 3UN2A 3I31A 4USJC 5IM0A 2ZH6A 4K2XA 2YWFA 4OI0A 4KHRA 2HVIA 1XK8A 5A2QY 2F9DA 5KFRA 1TELA 1YZ6A 3A1YG 3BSOA 4EFAC 4K4XA 2IM0A 2FLLA 2F4VF 4X62J 4R5PA 2GX8A 2QL9B 1SV5B 1GMWD 4ETXA 2HZVA 1PAEX 3THTA 2VPXB 2JL9A 1TVRA 4C11A 2W2OP 3NRBA 1EKRA 2DHHA 4WPAA 5K14A 4KC5A 4OLPA 1BUXA 4U67Q 3KUHA 4M1KA 2JVRA 2YNFA 3EDQB 1RHQB 2CJAA 2BOAA 1R27B 4F25A 3M2VA 2NYIA 3MPDA 1RT3A 2ZBRA 3AD7C 5KFYA 1GMUA 1B3TA 5G4DA 1YQHA 3R5CA 2H5IB 2OPSA 5F0WA 1YDLA 2E29A 2H4WB 4DBQA 3FJ2A 3HJFA 5B08A 1RT1B 3TNVA 1WC3A 4P9SA 2R7RA 4LFAJ 5A6WA 3CJ3A 1N5YB 4BHQA 2A2CA 2M3DA 2BJDA 2QA2A 1BMQB 2BM0A 2VV5A 2HMIA 3KK1B 1JNRB 1XNQF 4OFZA 4WXWA 3MR5A 2UXBJ 1HKAA 4JI1F 3QWPA 5GAGU 1D8ZA 5IM0B 2L48A 1CSJA 3JS9A 1J2VA 2NQPA 5IS2A 1GTEA 1PYOB 2KT5A 2XO7A 1S9GA 1HBUA 4LMZA 2J76E 1FD8A 4R5PB 2X1AA 2CWXA 3BSAA 3T41A 1V5VA 3MD1A 3VF0B 1WG5A 1R8AA 4M5NA 1TVRB 4C11B 3A3PB 2N3LA 1NK0A 2QO3A 2VBYA 4ER8A 2PD1A 3DLEB 4UOFA 5K14B 1M5OC 1SQFA 2CQIA 1UVLA 2H5EA 4Y0FA 5D4NA 8ATCB 4NYPA 3CJTA 4MK9A 2YNFB 2E7WA 5M2UA 5JJBA 5KT7A 3ZNUA 4WFYA 5EWFA 2JEFA 4F2SA 4UY85 4QZVB 3M2VB 1DRZA 1RT3B 1YRXA 4OHVA 3U02A 1KLMA 4L74A 1NK4A 2OPSB 3W66A 1FDBA 1ZETA 5IQQA 3R7SB 4CNZA 5E2QA 4OHYA 4KV8A 2B7BB 4L72B 2EG2A 4NYZA 5D0HA 4QIFA 1WKJA 4PUOA 2ZKTA 3AODA 2HMIB 4AXJA 3ZZYA 1U2RA 3FKBA 2DTJA 2PC6A 2BEFA 4LBHA 3IR7B 1BQMA 2F7VA 2YWEA 1UEKA 4PCQA 1F60B 3CDAA 1KRPA 2HQDA 3GWCA 3J81j 2ZH9A 4JI3J 1S9GB 1HBUB 3UDLA 3K8WA 4DWIA 2AZ3A 3SQOP 4DQIA 3FUYA 3T5LA 3H20A 3UCZP 4JYAF 2F40A 4WFBQ 4DPUA 5HVHA 1X9WA 1WSVA 5F9LA 3B8HA 2OPPA 4JI0F 2ZM6F 3NGTA 1NKEA 4QYZK 3SV4A 1CEZA 1TK0A 3KJVA 1YRTA 3MAQA 2LDYA 1RZMA 3L7PA 2WB1D 2XEXA 2ZC3A 5JMNA 1ZAXA 4CLLA 1KLMB 1EHWA 4IKAA 2X7IA 4HACA 2RS2A 5ETPA 4LRAA 2KG0A 5GMEA 2VKRA 1RHKB 3BREA 1S97A 1DY3A 3W62A 3E3XA 4KV8B 3AJDA 3TZZA 1OJ4A 2PT0A 1S9FA 3CDWA 3DOKA 3GYNA 3K5LA 3GSDA 2XCPA 1GMWA 4PUOB 2G9OA 8AT1B 2G0CA 1BQMB 2X3DA 4NYOA 1D9AA 4PXDA 3ZTSA 1T95A 1N33J 1VHIA 2P9CA 4K4SA 1FHTA 4PXCA 3BB5A 1U6FA 2V68A 3S6EA 3CCTA 3HHKA 3EZUA 2ZBPA 2RQMA 2I9SA 2J6SA 2YNIA 1BXNA 4FXVA 2G0JA 4EGLA 2FLPA 2BYCA 3W60A 1Q8LA 5MLCV 2OPPB 4PG6A 1Y4ZB 4YN3B 1TU0B 3RBXA 1B99A 3DRYA 2BXJA 4DR2J 3I96A 4NLTA 3KJVB 3M6XA 4L6V3 1T9VA 1MW7A 2E5LJ 4MH8A 3JAMY 4YY3F 2BANA 2CPFA 4H4KA 4OHWA 3GIKA 1W2IA 4HACB 1G4CA 3CCWA 4BLGA 4NLSA 1MMNA 3TYTA 1N5VA 2E5HA 3PY8A 1N32F 4PQUA 4OHXA 1QVGR 2K7JA 3DOKB 2XI3A 1EX8A 1SJFA 4KH0B 1N6QA 1RT4A 1QTNB 4WCEQ 2GA7A 2MYFA 3ISNC 2RU3A 3H2VE 3GR0A 2AWZA 3Q83A 4ZP6A 3OLAA 3ETMA 1QE1A 1SXLA 3KLEA 2PE8A 2ZNZA 3I5BA 4F67A 3PX0A 2YNIB 1AYEA 4FF1A 2P5VA 2DPJA 5D0EA 4RU2A 3UD4P 4ZVQB 3CE8A 3SYZA 4FYWB 3DYAA 3PG9A 5C24A 1KR4A 1IM6A 3VAJA 5HATA 3MGJA 3C2PA 3GJRB 4DN0A 4DPYA 1HW9A 3F44A 5KFBA 3IP0A 1FRIA 2KJWA 2R8GA 4L73A 3LQVA 2BANB 5HBMA 4DR4J 3MM7A 2XQCA 1U1KA 2NPFA 2UUBF 2UUAJ 3US5A 4LREA 4PQUB 3VZIA 2IVYA 3EYZA 2KG1A 1VI7A 2M88A 3T3FA 4OZ0A 1JLQA 2L9WA 3MUTP 2D3ZA 4ED6A 3MDFA 4J90A 4ZOSA 3UPFA 1N6QB 3I0RA 4Q5VA 3MPUB 5EHHA 3VAHA 1H2VZ 2VH7A 2ZFHA 3FNNA 1UVJA 3Q89A 4OYXA 4QWBA 3TUZC 2KVIA 3HHLC 4ECWA 3I9ZA 3D3BJ 1MU2A 3IMQJ 4AT1B 3RZAA 4C0BA 4OX7A 1LV5A 3PIPQ 5LSLA 5EWEA 1QE1B 3GG0A 3MEDA 1VLOA 3KLEB 1Y0HA 4CM2A 4JP8A 1F3VA 4Z7CA 2EK1A 2CPEA 4UQGA 2AU0A 1Q8IA 1W7WA 4RWXA 5H9FJ 2E7XA 3GG1A 2J0WA 3M9MB 4ES1A 1K44A 1XTZA 2KT2A 4F0MA 1IBLF 2QE5A 3DYAB 1WC4A 2DH8A 5C24B 4DV6J 4FKXA 4PXEA 4DL3A 4LF7J 4U96A 2CQ0A 3BQ0A 3TR5A 4B3SJ 1FTRA 4I6YA 1U1MA 1P27B 3IRWP 3F41A 2W2NP 1XR6A 2HPUA 1SKUB 4ZN3A 4DR6J 5HBMB 3DOMA 2W9CA 3TJ8A 3MM7B 5LMUJ 3BYRA 2XS2A 1QUVA 1XJWB 4AL6A 3FCVA 4DV2J 1I51B 5DZ6A 2L9NA 2K3IA 3N5FA 1KNZA 4A8KA 1Q79A 1NH8A 4ZN1A 3WC0A 5KFJA 1A9NB 2Q79A 2E1AA 3NCPA 1UVNA 1JLQB 3FCHA 4OYBA 2ZVIA 1RWOB 1Q5YA 1WUUA 5D0GA 3I0RB 3R3TA 2OEKA 1SC1B 1IXKA 2XC9A 4DL6A 3FQKA 2C42A 4ITSA 4LVOP 1RCOB 5DJBA 2Y0SD 3V6KA 2ZITA 1SJRA 1MU2B 3UD3P 4P2MA 3LPYA 1RA7A 3MEDB 4G1QA 1R7IA 1U1PA 1TL1A 4I69A 4WP3A 4DHVA 4WXOA 5DETA 3WIUA 5J2NA 3CIMA 1J5EJ 2BV3A 2DNMA 3G4SS 1B0TA 2MHEA 3AOCA 2O66A 2BUNA 2XMJA 3PCOB 1ZH5A 1O5JA 2BJ3A 1PGZA 2HAIA 1QY7A 2YXLA 3N4WA 4EZ9A 4OI4A 3Q8VA 4HDHA 4NCAA 1WKKA 1FCAA 3BZQA 2DHGA 4RKUC 3DOMB 2W9CB 4ATNA 2BQUA 2KYZA 2UUCF 3U7JA 2I6WA 5FLXU 3SSQA 2YBVA 3CT9A 2LKZA 2V4JA 3FBBA 1ZTWA 3EWGA 1GX6A 1UEUA 2BQRA 1KN6A 4QWAA 2I2YA 1B0PA 1IKWA 4M5GA 5I4MA 1U25A 3CDUA 3UWTA 1FNXH 2BJ7A 2YY3A 4CTAB 3ZZRA 4KO0A 2CPIA 4LSLA 2O3DA 1WSRA 3VAIA 4ZITA 4NA2A 2R7VA 4GKJF 2MZRA 2XSJA 4LBIA 1B70B 3W64A 4G1QB 2JLGA 2QYGA 1VS3A 1TL1B 1F9HA 4UF4A 1KOHA 2AW0A 5J2NB 1ZM2A 4Q8FA 4ZLLA 2YWKA 2DEIA 1TFYA 1A0OB 4CCHA 4C3KA 3WBZA 1KTQA 5ETOA 4MIBA 1FNMA 3FMBA 2XGQA 2LA6A 2DO4A 4JI4J 3QSIA 3PYDA 2RRAA 3PYFA 4DL7A 3W3SA 4A46A 1TKDA 1P6TA 4JI5F 4M5JA 1FJGF 2W4CA 1NSKL 2CWKA 3PW4A 3R9LA 1NPRA 1JXVA 3JSBA 3QAEA 2MSTA 3K59A 2V4JB 5M2RA 3ZO7A 3MMAA 4DV3F 1UWBA 4HL9A 2HBZB 5E3QA 1IKWB 2Y3YA 1OY8A 5AE1A 1VRUA 2WOMB 3KLIA 3NNAA 2YX4A 2DXFA 3W9JA 4KO0B 2BVZA 2FGOA 4LSLB 3QWUA 2P6SA 5KOWA 4LRDA 2XSJB 3MR3A 1ZAVA 2FHKA 4X4TA 2FZCB 1NM2A 1RAIB 4B3MJ 3W2WA 4OZJA 4DX6A 5BR8F 2XHWA 3UDEA 5HMXA 3GE9A 4JI8J 4KT0C 3T9NA 3M2UA 3HCXA 5KFAA 3SCKE 1XNRJ 3OUYA 3I5CA 5D4LA 4I7FA 4C8NA 4X65F 2F8HA 5IC6B 2WCXA 4HKQA 1UMJA 3SCLE 4MIAA 1OPIA 1DHMA 4TU9A 4EBCA 1FWPA 2IM3A 3HSJA 5LOQA 2JFDA 5D4OA 2C3UA 1TL5A 2WTFA 4ZDNA 3R6LB 4CP5A 1JK9B 2F65A 1WDTA 4USHA 1TQLA 3MMAB 4M95A 1UWBB 1MN9A 4B9VA 2QSWA 1SL1A 2YQ3A 1RGVA 2JRSA 4EWTA 2WVEA 2NXNA 2W2MP 1JWWA 3QAUA 2LECA 1AB8A 3T6BA 1VRUB 1Q7LB 3KLIB 1SKSA 2BW2A 1SVDA 1TKTA 4IFVA 4WFAQ 1JLEA 2HS0A 4UZBA 2XWXA 4OYZA 3WZ0A 2POKA 3LOUA 2EVZA 3TW0A 2ASLA 4CO2A 4F36A 2A6OA 3WHIA 3X1LB 3UW1A 2YKQA 3HPOA 5DQHA 2XS5A 5KT4A 3W2WB 5D0RA 1QJHA 4TU8A 2VFSA 2UVWA 3K0JA 2JHEA 2UXDJ 3R27A 1IVZA 4JB8B 1RU1A 3M2UB 3OUYB 4KFBA 3IGVA 3OVSA 4ID8A 1MMLA 5CH7B 3TO8A 2AV5A 4C2MA 4I7FB 1VLYA 1VRTA 4ZLJA 2K06A 3DDKA 4HYKA 3MTKA 3SZ2A 5KFGA 4JV0A 4WZQA 4B9TA 5A6PA 3D6MB 4OV6A 3GJSB 3GCWP 2KDOA 1NK8A 1SPBP 1Z1ZA 2RF2A 1WACA 4U8YA 2KRRA 3PO5A 2H48B 4H54A 4J9SA 4MKVA 5H9FK 3X3UA 1WELA 4ZP9A 2CYYA 3QNWB 1WDDA 3OD2A 3QT8A 2F1FA 1MWZA 1LOUA 1KFSA 2VJUA 4O4RA 4J9KA 3IWXA 2MQQA 1TKTB 4IFVB 1JLEB 4QR0A 5ETLA 2V8DA 4O3SA 3DFEA 5DG7A 2KXHA 4RJVA 1GK8A 1SC6A 2DISA 2AJ2A 5DM7Q 2VG5A 4NX9A 2EXUA 1SCJB 2RAQA 4LT6A 4Z7YA 2ZH7A 1OSDA 3TWZA 4K7QA 1L5UA 2MDAA 3MUMP 3C66A 3I4PA 1WOSA 3FEZA 3TANA 3CDBA 1HWIA 4ILLA 1VRTB 1UJ5A 3UQSA 2XNRA 2GV1A 3PKMA 1FDAA 2FB0A 2VDIA 4ZMMA 4URSA 4QWDA 4DR3J 1AROP 3H8YA 1P8GA 1NJWA 2M52A 1VC6A 2C3MA 5ETMA 1GXUA 1A7GE 2RF2B 4C8LA 3FZ2A 1JLAA 4QW9A 2RE1A 4USVA 3CIZA 5A2QU 3ENAA 3LAKA 3DRSA 3SMZA 1ITPA 1BGXT 2HVEA 5HMZA 2KT3A 2IYIA 4LQ3A 3DLLQ 4MTPA 3QFWA 1FWLA 4X64J 1T94A 3RYLA 3Q8RB 3M6WA 4QQBA 4GVLA 3BN7A 1QD1A 2XZWA 3SCJE 1YRUA 3CF5Q 2VG5B 2I38A 2E5LF 1RAJA 3LH2S 2WHOA 3CCRS 2EI5A 4DQSA 1NB2A 4JI7F 1VQ7S 3B78A 1HWLA 3A3NB 3T1HJ 2B51A 5IZHA 3TEGA 4DG1A 1HARA 3C14A 1HNWJ 2OJ3A 1M0SA 4Y2AA 5F3ZA 2J9DA 2IJNA 5K20B 5L8RC 3RJMB 1I94J 1JQGA 2BBEA 4OJ1A 4WBFA 3O5TB 1TMMA 5ADZA 5AXMA 2CZVC 4X66F 1HHQA 1BLUA 2J7UA 5HVFA 4U9RA 1VJWA 2VOOA 3DI6B 4RBTA 3BQ2A 5BJRA 1UPMB 4WF9Q 1ZZFA 3R2CJ 3BR9A 3DGPA 1JLAB 1OQ6A 3N6NA 2B8QA 3DRSB 4P72A 2B8PA 3R5BA 1U2FA 3UD5A 3H4DA 1X31C 1N4LA 1QTMA 1GT8A 1V6HA 4DCJB 4IUFA 1OSCA 3P49B 1RE1B 1TP7A 3T5HA 4LF9J 4KR0B 5AJ3J 4Y6IA 2CZ9A 1OMSA 1EIYB 2ZH5A 1NKBA 4CO5A 1YIJS 2XY5A 2QTWA 3HD1A 4Q2LA 2BKNA 5D77A 5DQGA 4DX5A 3MMBA 2L3MA 3TA2A 5A0YA 1YJRA 2C2MB 4DG1B 1N8RT 1MSWD 5LL6d 1M5PC 2DEJA 3DMJA 3C14B 2XLIA 2LEPA 3SIPB 2ABYA 3NGUA 4ELVA 4JI6J 3QQCD 2UUAF 1CJVA 4U95A 2IHR1 3HHNB 2RH3A 1WORA 3D9BA 1NSAA 4WP8A 3KMQA 2W9AA 2OKQA 2EWHA 2PO4A 1SJQA 3DC2A 1RHJB 5AXLA 3BO2A 4C7QA 4DS4A 3DGPB 2BMBA 3G2XA 4F0HA 3JTOA 2X1BA 2IRYA 1SJ1A 3D0HE 2KM8C 2YWHA 2YKOA 1EAYC 2QLXA 2HHHF 3QRPA 4YR2A 1VQ9S 1D3WA 2VQFJ 2ZJRQ 1LWCA 2DT9A 1CJUA 2G2ZA 2EG1A 4YHHF 5F41A 1JKHA 4IR1A 3ET6A 4W98A 1C1BA 2OD6A 1Z2LA 4CT8A 3GIMA 3ENQA 2ALZA 3PX4A 1WJ9A 1S1VA 3MMBB 3OHBA 4M5DA 3QIPA 5LMUF 4DCPB 5A0YB 2DR7A 2DGXA 5KFZA 3NCRA 3DMJB 2VASA 1SQEA 4FBUA 1S79A 2OI2A 4UOCA 2IVFB 4CLTA 2KXNB 3N28A 1CJVB 4B9SA 1RP5A 2R8HA 5LMNJ 3VCDA 3KJFB 5GAEU 2EC2A 1URNA 1VFJA 2MY8A 2QIFA 4LF8J 4DV5J 4F4ZA 5KT2A 3J80U 4ED8A 3HK2A 3TVYA 3H42A 4X84A 2KI2A 1S49A 4FF2A 3KUEA 3KHGA 2C28A 1V9OA 1FD2A 2ZH1A 3S7RA 2FVRA 1SL0A 2XY7A 2JVOA 6FD1A 3O3LA 5L39A 5IOLA 2LYVA 3AH6A 4C97A 3KHLA 3I5AA 1LWCB 1WF2A 4X4QA 4AXIA 1SI9A 2B5JA 1CJUB 5FD1A 2R7SA 4CH7A 1JKHB 2G1HA 3OLBA 3K7RA 5HROA 3ET6B 2EW9A 4NL5A 2HYIB 1P1LA 1BWEA 1C1BB 2C2ZB 2H54B 2XMAA 1K0TA 3OV7A 4J9UE 5J1NA 1RTZA 4JI2F 1S1VB 2ACYA 3HF5A 4M5DB 3LAMA 3JAMU 4M5MA 3QIPB 4ZPDA 1T02A 1R8HA 2HRUA 3HM9A 2XBPA 1D09B 4DR5F 1YGYA 4YR3A 1VBKA 2FPHX 2IIHA 2Z0GA 5L1KA 2EFGA 5B0AA 3VAKA 3F73A 3PW0A 2C3YA 2ZUAA 2ZD1A 1HWJA 1SL2A 4KPYA 3VWSA 4YDXA 2JLFA 3LUYA 2HGNA 1JJCB 4F4XA 4NMXA 3BO4A 3H40A 3GMGA 4AL7A 3VGSA 3M8RA 4DUZJ 4KHPJ 4PR6A 1R43A 4JOUA 4B3TF 3THVA 3RR8A 3J7Z5 4RPFA 4B9MA 3ILIA 1JIHA 2R8JA 4ED5A 3OTOJ 5K8NA 4X4VA 2QG9B 1OO0B 2GIFA 3UR0A 2QLJB 2CQ4A 2LQ5A 1BE4A 1WD6A 2OD4A 1MROA 2AHOB 4GC7A 1FJ7A 4IRDA 4USTA 3CULA 2N7CA 4OX9J 4U6PA 2B5JB 2CA9A 1RHRB 1UW9A 2W4DA 4B08A 3N5BA 1GAOA 5HROB 1XWLA 2R4FA 1P1TA 3H2LA 5T41A 3J7A1 4JV5F 4JI4F 3CD0A 3JQKA 4ELTA 1Y10A 3KLGA 3PRBA 2LQ9A 3J81Y 3DXBA 2WK4A 1K73T 1U24A 3RUBL 4LRFA 2GAHC 2DHAA 4IRKA 4CYUA 4K4WA 2R7OA 3S8SA 1PBUA 2K7KA 1TKXA 1TUWA 3Q2TC 2RD5C 2RHQB 2F8MA 1Q0NA 2ZD1B 4V19J 3H59A 3CD6S 3PEHA 2QLFB 3IS9A 1IBMJ 3HFVA 2M4MA 3DNCA
chains in the Genus database with same CATH topology
4JI6F 5F9LA 3B8HA 2IBKA 2E9TA 1BQNA 3HKZD 2OPPA 4A47A 5DDPC 4JI0F 5AXKA 3CVKA 5AXNA 2ZM6F 3CCUS 1DTQA 1JMTA 1VQ6S 1FK9B 4ZPCA 3PVXA 1NKEA 1X5TA 1DARA 3SV4A 1TK0A 3KJVA 2IAJB 3LP2A 2OTLS 1YRTA 1CEZA 3MAQA 2J9DE 1LWEB 4M63A 1KC8T 3QJJA 2LDYA 3LP0A 3B4DA 4I0WA 2LA4A 3KK3A 5D3GB 4X4PA 2FJAB 2XG8A 3IBWA 2KB2A 2F9JA 3L7PA 2WB1D 2XEXA 1YHQS 4IQMA 5J2QB 5FIIA 2ZC3A 3RBEA 3S1TA 1ZAXA 2GGPB 4QWEA 2CQGA 5CA5A 2WOMA 1RWUA 4O4GB 1KLMB 1ZYQA 3FMWA 2VFRA 1U26A 2FC9A 1FKOB 2DITA 2QT7A 1MROB 3IG1A 2Z4PA 1B7FA 4IKAA 4RX6A 1RT7A 4JI8F 1DFDA 2QLWA 3D5MA 2RS2A 1FA0A 2A1BA 1HL6A 4EO6A 5E3AA 3GIIA 2KG0A 3T19A 1E6VB 2VKRA 1AUDA 1YVFA 3BREA 3CCLS 1S97A 1ZZNA 5KOXA 1XNRF 3NNHA 3T9ZA 1KHVA 3ENVA 1ZPVA 2LXIA 3E3XA 4KV8B 4IO9Q 2MGZA 1JJ4A 2OMLA 4J5OA 4MYTA 4C8YA 2CQCA 3KHHA 4XDCA 2B9WA 1XR5A 1X9MA 2PT0A 4N8OA 3GZ7A 1S9FA 1FVQA 3CDWA 3DOKA 3GYNA 3K5LA 4NCBA 5JXSA 3GSDA 2XCPA 3MXHP 4TYAA 4PUOB 2FHJD 2G9OA 3M6VA 1R31A 5DDQC 1XMQF 2YKNB 4C3LA 2W9BB 2N4DA 2VQFF 1JLFA 2UP1A 4HI1A 2G0CA 3JSYA 1BQMB 2GJIA 2BE2A 1NU4A 2HLUA 5KFMA 2OPRA 1SUQA 4ILRA 4NYOA 1D9AA 4PXDA 2ZC4A 5BYRA 3RRHA 3Q8PB 4NLPA 2EFNA 3SQGA 1T7PA 2MZJA 5EDWA 1ZM4A 1T95A 3QIDA 1GTHA 5J2PA 2P9CA 4K4SA 5CZXA 3AB4B 3I0SA 2CPDA 2ZH2A 1KVIA 1FHTA 4PXCA 1TL3A 3QPIA 1S6OA 3SSRA 1S0MA 4A8OA 5HI7A 1S76D 4IO1A 3IWNC 3EZ5A 1TKXB 4A8QA 3BB5A 1U6FA 3S6EA 2DNKA 4ZLPA 4WYWA 3OJSA 3CCTA 3HHKA 4ZCKA 3Q2SC 2AX0A 4ECQA 3EZUA 2DGTA 3QJPA 2J8AA 1NJIT 2AF6A 1LXJA 1IKVB 3VTIA 2RQMA 4HTIA 3VAGA 3TAQA 2I9SA 2J6SA 3G9CA 2YNIA 3IS9B 4DQQA 3NL0A 3RW6A 1HNIA 4FXVA 4EGLA 2FLPA 3BDPA 3CMAS 2BYCA 1YJNS 2ZOFA 4QU6A 1Q8LA 1YWXA 3E8OA 5B0DA 3M8SA 2KJVA 5GAHI 2HWHA 5IT9Y 1BQNB 5MLCV 2OPPB 4PG6A 1QVFR 2I0XA 1Y4ZB 3MM8A 1R0AA 1DTQB 1QSSA 3DRYA 2BXJA 1KFDA 4TN2A 5E0OA 4J9LA 4AL5A 5LMNF 4ED0A 2B9YA 4JV2A 1UJ6A 4YQWA 3I96A 4NLTA 4X62F 3KJVB 3LP2B 3EUNA 1FE0A 1M5SA 4DSJA 3U27A 1HI0P 3M6XA 4L6V3 4FS2A 4USIA 4EBDA 4ZVFA 3LP0B 1S9EA 3KK3B 2HNDA 4LF8F 2K3KA 4DV5F 1MW7A 2RVJA 3BGLA 4ZA1A 3HFKA 3SFGA 4ICLA 4MH8A 3JAMY 4O3OA 1VIOA 2E66A 2P6TA 4A8WA 3P96A 4YY3F 4NZ7A 3ENWA 2BANA 3K5MA 2WSEC 2CPFA 4HH1A 4IYQA 5DG8A 2DNZA 2K1RA 4H4KA 4TYBA 3IG1B 4OHWA 4FS1A 3GIKA 2R7QA 1W2IA 1RT7B 5GAEI 3CCWA 4ZCMA 3U1NA 3L95X 2HHSA 3OHAA 1TAQA 4NLSA 1MMNA 2IC3A 1EP4A 4R0EA 2HHTA 4ZPWR 3TYTA 1N5VA 1HQUA 2E5HA 2ZH3A 2Z8QA 1DBDA 5IXUA 4U7CA 3K57A 2MGZB 3PY8A 3ZC4A 1K0VA 1N32F 2KO1A 2OLWA 4PQUA 2DD8S 2MKSA 4OHXA 4MKAA 3BDEA 1QVGR 4N41A 2K7JA 4F3QA 4DV7F 1HHTP 3DOKB 2X1FA 2V4QA 3KG4A 4JUZA 1GX5A 3MMJA 2GFFA 4PWDA 3NS6A 2XI3A 3BF4A 5LSRA 3HMJG 4X4RA 4OV1A 3SDEA 1JLFB 1TV6A 4FPRA 1SJFA 1YG0A 2B4UA 5E3RA 3NCQA 2PIIA 2JX2A 1N5SA 2BE2B 3CTRA 2CQPA 3G71S 1N56A 1N6QA 2OPRB 4C98A 1GXLA 2DNGA 5B0GA 1SUQB 4G3IA 2L08A 1UVJA 1RT4A 4WCEQ 3CDEA 2ZHOA 3SQGB 7FDRA 5J2PB 4O3RA 3HHEA 4LFAF 2GA7A 2Z2MA 1RTIA 3I0SB 1FXLA 2MYFA 3ISNC 3OTCA 1JLGA 1TL3B 1TZ0A 2KHCA 3UCGA 4DEZA 5F3TA 2RU3A 1DLOA 3CJKA 4IH6A 2J7KA 5I3QA 2ZJPQ 1Q82T 3NMRA 2V0NA 3H2VE 3GR0A 1U4BA 2AWZA 1S72S 4ZP6A 2VA2A 3H25A 1K1SA 3OLAA 1QE1A 3ULHA 1SXLA 5F8LA 2OIHA 1WF1A 3KLEA 2BACA 2PE8A 4ECXA 4FF4A 5KFOA 5U47A 2B0GA 5GAHU 2ZNZA 2UXBF 4F4YA 1H2TZ 3I5BA 3FSYA 3I87A 2YX7A 4F67A 3PX0A 2I8EA 2YNIB 4DUYF 4FF1A 1HNIB 2P5VA 2DPJA 4A4JA 2VOPA 1C0TA 2KYXA 1SB6A 2LEBA 5J1PA 4RU2A 4Q43A 3FZBA 2NSCA 2EK6A 1TL4A 2U1AA 3UD4P 4OZLA 3LF0A 5KFTA 3CE8A 3MM8B 5B7WA 1R0AB 3SYZA 2RQKA 2ZBCA 4IQXA 2HWTA 3MFIA 2APOA 1WEXA 3DYAA 1NRKA 2UZAA 1HI1A 3D28A 4KGMA 4DLEA 3SI8A 5C24A 1KR4A 1Q8BA 2VA3A 2I1RA 3VAJA 3DHXA 3OL8A 3BGFA 2JWNA 3PEJA 2WAQD 3MGJA 1XBWA 2Q66A 1WI8A 1X8DA 1FO1A 1JXEA 3C6TA 1H0HB 4CO0A 2PI5A 3C2PA 3LO3A 1S9EB 2M0GB 3SCIE 4DN0A 2HNDB 2Q43A 3SFUA 4GC6A 3BS9A 4IOBA 4WFNQ 2KU7A 1PSDA 1JXLA 5BYQA 4V19X 2OPQA 2CQ2A 3FSXA 4XAKA 1HW9A 2ILZA 2XLJA 4ICLB 4LSNA 3RB3A 3F44A 2HHUA 5KFBA 1FRIA 1NK5A 2KJWA 2GHVC 3V6HA 1EETA 2R8GA 1Q86T 3LQVA 1RKJA 2BANB 3CC2S 4NXNF 5HBMA 3T6JA 4DF4A 2K1RB 4FNIA 3MM7A 3KYLA 4YB1P 3RR7A 2MKHA 2WONA 4N8NA 4PPZA 1CLFA 2YWGA 2DGOA 5DDOC 2B7CB 2IC3B 3PJXA 4YMEA 3EX7B 4J9QA 1EP4B 3PZPA 1U1KA 1Y00A 3V5RA 2NPFA 2AP6A 1HQUB 2UUBF 4RU9A 3SXLA 3SSSA 2O01C 3US5A 2CDQA 3W2VA 3IN5A 4PQUB 3OTOF 5K5MA 4PG8A 2C3OA 4MK7A 3IRXA 3S01A 2VBZA 3VZIA 4IFYA 2IVYA 3WX4A 5HMWA 3EYZA 5H1SV 4IG0A 4BC9A 3KFWX 3GFHA 1VI7A 2DCLA 3MWBA 2M88A 2CVIA 3DRRA 3T3FA 2J5AA 4PWDB 4OZ0A 1JLQA 2L9WA 3MUTP 2D3ZA 4X2BA 3SDEB 4ED6A 2LEAA 3MDFA 1TV6B 4ZOSA 4DR3F 1MMDA 3UPFA 3MURP 2ZKUA 1N6QB 1RKIA 1C2PA 1V3RA 3I0RA 2MY7A 3V4MA 4Q5VA 2QA4S 4K4VA 1HA1A 5KFDA 5J2MA 1QAJA 2K2PA 2QA4G 1ZM3A 2QYCA 5EHHA 3VAHA 1RYRA 1H2VZ 5B0EA 2VH7A 4TQSA 2ZFHA 1XN9A 3FNNA 1RTIB 2OO4A 1K1QA 1FVSA 1M5KC 2ADBA 3HI9A 1JLGB 1Q78A 4QWBA 5F8IA 4EYIB 1NK9A 3TUZC 2KVIA 1DLOB 1X4CA 3HHLC 3CJKB 4ECWA 3I9ZA 4HEA9 4ZP7A 1MU2A 3TRGA 2EFPA 3RZAA 4C0BA 4OX7A 1LV5A 3NS5A 4X4NA 5L1LA 3PIPQ 2RSQA 5LSLA 3N01A 5I3PA 2DHSA 5EWEA 1QE1B 3GG0A 4HT7A 2V8VA 3MEDA 1X4AA 5L38A 2R2SA 1QAIA 2Z2LA 3KLEB 4B9UA 1Y0HA 3GR1A 3ETOA 3P6YC 2EK1A 2AJQA 2CPEA 4ERDA 1N48A 2JJ4D 4UQGA 2AU0A 4WZMA 2BQ3A 2AYBA 1Q8IA 3IR6B 1C0TB 4RWXA 4ZHRA 5H9FJ 3CCZA 4EEYA 2N3OA 3TAPA 2E7XA 4C8KA 3GG1A 3UDCA 1VOMA 2J0WA 4PKDB 2K8GA 3M9MB 4ES1A 2AGQA 3FSIA 2BABA 2CVEA 1XTZA 2KT2A 3BR8A 4RW8A 4CH0S 4X64F 1IBLF 4JI3F 1NNDA 2QE5A 4I2PA 3DYAB 1Q81T 4DSFA 4ID5A 4W92B 2DH8A 5C24B 2WB4A 4PXEA 3VQTA 2E5GA 4DL3A 1IKXA 4OIXA 2HFOA 2CJQA 3C6TB 3N9UC 2CQ0A 3LANA 2FJWA 4G1IA 1S77D 3BQ0A 3TR5A 5L1IA 3FRZA 1GH8A 4DV4F 4I4BA 1FTCA 2OPQB 1FTRA 2FHJA 4I6YA 1P27B 1U1MA 1IBMF 3I56S 3T1AA 4UW2A 3ZZTA 3IRWP 3GIJA 3F41A 1OIAA 1EETB 4KBIA 2DGQA 3C8YA 1XR6A 1T8EA 5E33A 2HPUA 4Y3CA 4EU0A 5HBMB 3DOMA 2W9CA 3MM7B 3DNCA 2VB6A 5CXTA 4J9OA 1VQOS 2DRAA 1FRHA 1QUVA 4AL6A 2XS2A 2BA9A 2WONB 3MOZA 2H9ZA 2A3JA 4ZPVR 2RRBA 4K4ZA 3JSRA 3M32A 4MKYA 2VD3A 2XGPA 1CQNA 5DGAA 2LU2A 3UNGC 1R8CA 3E01A 2L9NA 2K3IA 3N5FA 1TAUA 2DR8A 2NZ4A 3CXCR 1CG2A 3UR3C 4OL8A 3W2VB 1KNZA 5I42A 1IUJA 3DU5A 2R8KA 3IRXB 1HD0A 4A8KA 4IFYB 1Q79A 4ZPTR 5BYSA 1NH8A 3WC0A 2ROEA 3MR6A 4IG0B 5KFJA 2ZH8A 4QU7A 1A9NB 2Q79A 2E1AA 3DRRB 2XLKA 2M2BA 5K8MA 3NCPA 3MEGA 1UVNA 1JLQB 3CCQS 1WG1A 3EGWB 2DR9A 2RDIA 3FCHA 3R5DA 4FBTA 4J9MA 3I0RB 2NPIA 2BZ2A 4J9RA 2KTQA 3R3TA 5J2MB 4CH1A 1IXKA 2XC9A 2KH9A 4DL6A 2KHDA 1HR0F 2L9DA 3V4IA 2EFQA 2MZ1A 2UU9F 1KQFB 3K5NA 4LFBF 2QV6A 4HT5A 3FQKA 4KRWA 2C42A 3NBPA 4ITSA 1VQ8S 1FNOA 4LVOP 3DLBA 2JC1A 3J7YI 2A10A 2DB1A 5DJBA 2Y0SD 5LXYA 1VQYA 3V6KA 2ZITA 3PIOQ 1SJRA 4NPOA 1MU2B 1D9FA 3PXGa 3UD3P 2DHXA 4OX6A 2CZ4A 4CI0B 3D2WA 2QZ8A 1RA7A 3D0IE 3IA0A 2Q6CA 3LPYA 3MEDB 4G1QA 1F5CA 2C2RA 1WEYA 1Z4UA 4A8MP 3L7OA 4P2SA 1R7IA 1U1PA 2VL1A 4HVZA 1TL1A 2IMOA 3GFXA 2YNGA 1UVKA 3NMAA 3DI6A 4I69A 2EKYA 3HVWA 4DHVA 4WXOA 3N79A 4ZHRB 1QUPA 4NA3A 5DETA 3QYYA 4QIWD 5J2NA 3CIMA 4QOTA 5DRKA 1F9FA 2BV3A 1Y5IB 2Y1RI 2DNMA 2HNZA 1N33F 1S6UA 3GV5B 2HFZA 3G4SS 5LJ3Y 1B0TA 2FJDB 1B64A 2RQ4A 3DDNA 4RW8B 2MHEA 2AX1A 4I2PB 2O66A 3PKYA 4ID5B 4LF9F 2BUNA 2XMJA 4NWBA 4MMOA 2ATLA 3HZGA 4DQPA 1ZH5A 1U1RA 2ERRA 1P9QC 4ZPAA 1O5JA 3THPA 5C25A 1R3NA 4F4WA 4OHZA 1PGZA 5EN1A 1IKXB 4AE5A 4R0JA 2HAIA 3ZZZA 2HGMA 4ZS6A 1QY7A 3Q8SB 3N4WA 5KAKA 4EZ9A 3QGIA 1SKWA 2DK2A 2B6AA 1UVMA 4E98A 5HL7Q 2VPZB 4OI4A 5HQ8A 2AYGA 1VQLS 1U1QA 4P6QA 1HHSA 4HDHA 4NCAA 5L9NA 1FCAA 4ECYA 3BZQA 3MMCA 4OMFG 5K8PA 3DLJA 2DHGA 4RKUC 2AJ0A 2W9CB 5KT5A 1FRLA 4DL4A 4ATNA 4CO1A 2BQUA 4R8UA 4QYRA 1K8AT 2A2DA 2KYZA 3OBIA 2UUCF 2D74B 3U7JA 5AE3A 2VONA 4ES2A 1Y5NB 2HVHA 4DR2F 2VODA 3HVTA 3M32B 1QAXA 5T14A 4B3OA 3SSQA 2COLA 3E01B 4X4SA 2VFVA 2GC8A 5G0RA 4MYUA 5E3CA 3G8SA 1JJHA 4NLQA 4QYZJ 2DCUB 3CT9A 2LKZA 1X4BA 3C46A 5I42B 2V4JA 2DNPA 1ZTWA 4RWWA 1GX6A 5KFNA 1UEUA 4PG5A 2BQRA 3FQLA 1KN6A 3M9NB 2HQ3A 4QWAA 2YNHA 3OL9A 2VKZG 2I2YA 1B0PA 4IG3A 3HP6A 4YB5A 5H9EJ 1IKWA 4DSIA 4PQAA 2FLNA 2GNKA 5I4MA 1VQ4S 1OPZA 1U25A 5CYMA 2PGCA 2R2TA 3CDUA 3UWTA 4DFKA 2GIQA 3J7YU 3U1LA 4OJGA 4Y2MA 2V2KA 3M8PA 1FNXH 3EGZA 4G1PA 4XPCA 1MNEA 2ZBIA 3V4IB 2EFOA 2XULA 2KKHA 2J0SD 2YY3A 3NBPB 4CTAB 3ZZRA 4ZVGA 1NKCA 1WTFA 3U1MA 1QSLA 4N5SA 1T03A 1AFIA 2F3JA 4KO0A 1X7VA 2CPIA 4LSLA 1X5OA 2O3DA 3RB6A 3VAIA 3O2IA 3VALA 1N34F 1S1UA 3VQSA 4NA2A 2R7VA 3MOJB 4GKJF 2MZRA 2XSJA 1L3TA 1QAYA 2VG7A 3OTEA 4G1QB 4QCLA 2JLGA 2CIMA 4C9DA 2HHXA 1BY9A 4GKKF 1VS3A 3EPGA 4ILMA 5JVHQ 1LWFA 5KFXA 4FF3A 4PXBA 3IC1A 1Q53A 3MPYA 3BSCA 1VC0A 2C3PA 4A8YA 1TL1B 2R7TA 3ZFVA 2VUGA 2YNGB 3D0GE 1KOHA 4BWMA 2ZUGA 5KTQA 3TVKA 1LFPA 1TFWA 1OQ3A 2AW0A 5J2NB 3J80Y 2MQNA 3Q0AA 1ZM2A 4I2QA 3KLGB 4ELUA 2IM1A 4Q8FA 1G2EA 4YB6A 2YX1A 2YWKA 2HNZB 3OXLA 1VQSA 3OL6A 2HQIA 3K58A 2Q1LA 3VR1A 3E2EA 4I64A 1XC9A 4TKTA 3NGDA 1XEZA 1TFYA 4XO0A 4PG4A 3BM7A 1S10A 1PC4A 1SIWB