4K0KJ

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4k0kJ00
1N32J 1HR0J 4X65J 3J81U 4PWWA 2KL8A 4JI5J 4DR4J 1XNQJ 4LFAJ 5FLXU 2MEWA 2VQEJ 1J5EJ 3W1YC 2UXBJ 5LM7E 2MQ8A 5AJ3J 3J80U 5IWAJ 4LFCJ 4DR7J 4LF5J 4LF6J 1IBLJ 4KYZA 4GKJJ 4HHUA 4JI6J 3OTOJ 2UUCJ 4X66J 4NXMJ 4KHPJ 3R2DJ 4YHHJ 4LFBJ 4LF4J 4DV5J 4JI1J 1N33J 4V1Ak 1HNZJ 2MTLA 3D3BJ 1I94J 4JI4J 1HNWJ 4B3SJ 4DUZJ 3J7AN 4K0KJ 3R2CJ 4OX9J 3JAMU 4JV5J 4DV3J 2UXDJ 4DR5J 4DUYJ 4KY3A 4JI2J 4B3TJ 2KVQE 4JI3J 1XMQJ 2ZM6J 4YY3J 4B3MJ 4X62J 4DV7J 2E5LJ 4RJVA 2F4VJ 4JI8J 3T1YJ 2UUAJ 1N36J 4DV4J 4JI7J 1XMOJ 4NXNJ 1XNRJ 4NEYA 4DV1J 1HNXJ 3IMQJ 4LF7J 4NEZA 1IBKJ 5BR8J 1N34J 4DV0J 2UU9J 4LF8J 4DR3J 5A2QU 4DR1J 5LMUJ 4DV2J 4X64J 4JYAJ 2HHHJ 4DR6J 4JI0J 4GKKJ 4DR2J 4DV6J 4LF9J 5IT9U 4B3RJ 2VQFJ 3D3CJ 2UUBJ 1FJGJ 2UXCJ 1IBMJ 3T1HJ 5LMNJ 4AQYJ
chains in the Genus database with same CATH superfamily
3FRZA 4QIGA 3BJYA 1DURA 2GV1A 3D54A 5DDOC 1G2EA 3NL0A 3ELHA 3VAMA 3UDLA 1FI4A 3DLKA 4ECSA 2RS2A 2D41A 1RT4B 2QYGA 4DV3F 3MD3A 3R7BB 1FJEB 3VCDA 4YB1P 1ZYQA 4DS4A 4DPYA 3G8SA 3ULHA 4OHZA 1PYOB 2NREA 2JOQA 3GJTB 4MJKA 3MMBB 3N28A 2F40A 3TVKA 2BA9A 2IJRA 4ZPDA 1UL3A 3S01A 2XI3A 4B9MA 2XSJA 5D4OA 5DZ7A 2CNNB 2ZM6J 4B3MJ 5HMZA 4LR8A 2BR0A 1FRHA 3D1QA 2H5IB 2UUAJ 3H40A 3W61A 2LCWA 3FGVA 1JK9B 4X2BA 3DYAB 3MM5B 4USVA 2A1BA 1UCNA 2M7SA 3QLHA 1AFIA 3ET6B 3I4PA 2YH1A 2CPIA 3GIKA 3RGIA 2DVIA 2QMWA 3TA0A 4PWDA 4DF4A 1MN9A 3R5AA 2GVZA 2ZUAA 4DSFA 3JYTB 5T7LB 1RSCA 1NBEB 2XULA 1Z2ZA 2K7JA 2IC3B 2F8EX 1HHSA 3DLJA 1F9HA 1RTDB 1AUSL 1FKPB 1X5PA 1DY3A 3J80Y 2POKA 4HHUA 4UOCA 4NXMJ 1TU0B 3AXMA 2VG6B 2DR8A 1F3VA 3CSKA 2QX0A 4DV5J 3NGUA 4QZVB 2AYGA 1RADB 4OL8A 2BOPA 1NJZA 2DXFA 2QGFB 2CVIA 2KFYA 1C1BB 2XQCA 3SMZA 3MMAA 1UVKA 2D3UA 4ZDNA 3ETOA 3VVUA 3IRXA 1GXUA 3E01A 4PG8A 5J2PA 2H51B 2DNKA 3W5YA 4RX6A 3R5JB 1U09A 1JKHA 3J7Z5 1FD2A 2WONB 1VHFA 3CJ0A 4P7VA 1Z1ZA 3OSNA 5I3UB 1FXLA 1QJHA 3WHIA 2R42A 2RJZA 4RBVA 4O0NA 4OV1A 3T1HJ 4IFVA 2NPFA 4D3HA 5ETLA 3T5HA 1N8RT 1H2TZ 3QGIA 2B3TB 2HHQA 3KK2A 3HFVA 3KK3A 3ZTPA 1FWKA 1K8AT 1RWVB 2J8SA 3HF5A 2COLA 1XMOF 2ROGA 2C42A 4IOCQ 1WC1A 3W2WA 1RTIB 1AA1B 3PRBA 1RAHB 1SBRA 2MLXA 4B3TF 1PJ7A 3DRSA 1N5VA 3BH6B 1JLGA 2VG7B 2M4MA 4B02A 3OTDA 1KD1T 3OFFA 1WTFA 2HQIA 4P2XA 2WCXA 4J9UE 3K89A 3P5TL 3LO3A 1BHNA 3UR3C 2NXNA 2ZNYA 1L3KA 1RTZA 1S76D 3AJDA 1YJTA 2W9CA 2BJ7A 4LR7A 2R7UA 5A6WA 4M5DB 3DRXA 2SXLA 1PC5A 4ZJOA 2VB6A 4HHJA 1B7FA 2BJ8A 2O3DA 2ZH5A 2XHCA 1HQUB 1WI8A 5ETQA 1D8YA 4JP8A 3KHLA 1GMWA 1MU2B 2E1CA 4O4GB 4Q43A 1U1QA 3D2WA 1RWOB 4ZJLA 2W7AA 4EBDA 3T9ZA 2VFVA 4IRKA 2Y8WA 2V67A 4J5OA 3V4MA 4HACB 4M5LA 4PEOA 2YQ1A 4LSLB 4QWAA 1L3TA 1U2CA 1Q1KA 4A8YA 1ELOA 3C2PA 2HHSA 1WC6A 1PO6A 2CG8A 3IWXA 4WIQA 2VOOA 2IBKA 3DGPB 1SH2A 3LTOA 2E5LF 1TFYA 2MQPA 2ZH4A 3VAJA 2PN6A 3GIIA 2DHGA 4G1IA 4Q2LA 4DSEA 2JZ5A 3C3LA 1S7IA 2FJWA 3GYNA 4MKAA 2CQPA 2EFQA 4I7FA 2XMWA 2GA7A 5GAEI 2V9WA 2WTFA 2NLWA 4WU3A 3NMRA 1B0TA 1EX8A 3FK4A 3M8PA 3MUMP 5IS2A 4I69A 4OMFG 2LLZA 2RUGA 4P2SA 4MAKA 3M9NB 5CD4A 4X4TA 3IBCB 4K0KF 4A8QA 2W2MP 2YKQA 4ED5A 2RAQA 2HS3A 2BV3A 1WEZA 2MY7A 3GIJA 4FNHA 2CPEA 1X4DA 1TUGB 2D3OR 2BYCA 3VGVA 1EQ0A 4PWUA 4DPWA 1ZBTA 4X66J 1SKRA 2H9ZA 5AE3A 3HVTB 1YZ7A 2ZBIA 4M5HA 3PW5A 2LDYA 5F8GA 2RNEA 3Q23A 3K2YA 1WOPA 2DISA 4AXJA 3MR2A 4ECRA 4ZVQB 5KFEA 4I2QA 5HAOA 3GMGA 4DR6F 4OZ2A 5LT5A 4WPAA 2X3DA 2WK4A 1ITPA 4RNOA 3I82A 2W7PA 2HNYB 1SQFA 3BM7A 3WDOA 4CLLA 2GZOA 2YWEA 2CPXA 3DLHA 2KN4A 4DV6J 3K5OA 1XERA 1BQNA 2VODA 3NNAA 3PIPQ 3BGRA 2HLUA 1IKWB 1MWYA 3HCXA 3QT7A 1ZS6A 2B8QA 5H9EK 2GAHC 3BR8A 1VBXA 2ROPA 5EX0A 4MK8A 2UUCJ 1YI2S 3T5JA 1RE1B 4QW9A 1UFKA 2X7IA 3QFHA 2BRLA 2IM3A 5EWGA 3M8YA 3Q0AA 4Z37A 3OJUA 2BKOA 4PYAA 3BYRA 3J7ZT 2KO1A 4BC9A 4LBPA 5A8WA 4PRFA 2J6TA 3UQSA 3O2IA 2FC8A 3PW2A 1LK5A 2KTQA 2PO4A 5F8MA 2IDLA 5D0GA 2C3OA 4Y3CA 2EG2A 1FX2A 2GQ2A 3V4IA 5HP1A 2ZBQA 2R7XA 2X1FA 1YVFA 2J7KA 4P52A 2J9EA 2ZH9A 1Y11A 2E1AA 4YB7A 2H3EB 3B82A 5C5JA 3I9ZA 2LQ5A 4IRDA 1R0AB 2MKIA 1JB0C 3H4BA 3W62A 4GVBB 2J9DA 1NLKL 1UVMA 4MKVA 4OFZA 4C0HA 1HIYA 2E9TA 3KUGA 2DCUB 2DY1A 3BSNA 3D0IE 4NLYA 4WTYA 3PHEA 5C42B 5H9FJ 1KRPA 2VF3A 3P3DA 2QA2A 3KK1A 3T19A 4LREA 3OL7A 2R7RA 2C2DA 2XMMA 1C0TA 2QIFA 1QE1B 4RW4A 2R8JA 3ZZTA 2MKJA 2H1YA 4NOHA 2P2CB 3BKTA 1RYRA 2H4WB 3M9OB 4DI6A 1HNXJ 1K44A 2RS8A 3AT1B 1N56A 1RBLA 1K0VA 1T9YA 1HYSA 5BXIA 4DR1J 4JYAJ 4JI4F 3K17A 2CPDA 4P9SA 4GO5X 2J76E 5KFRA 2OGUA 4PQUB 3CE8A 2XNQA 2IMOA 3PX0A 4Y00A 3D6TB 4AD6A 2OD6A 2QRRA 4ETXA 3C6UA 2R2TA 4O3RA 1FCAA 2V0NA 4ED6A 1FTCA 3MTJA 2DK2A 1XK8A 1HNWJ 4DUZJ 2BJ1A 1QTMA 4Q44A 1FKOA 1VJQA 2DT9A 1RT4A 2Y8YA 1ZPWX 3FSXA 5D15A 3P49B 2CQ2A 1M5KC 3I32A 4CO5A 1VMBA 3FKBA 3JQKA 1YJVA 2W4CA 5CYMB 1TKDA 2YNGB 3MUVP 2ZH6A 3MMBA 2W25A 3MCNA 5B0BA 4F67A 3QT6A 4XTTA 2MHEA 2RKIB 2J7UA 3D6HB 4J9KA 1EARA 5KT3A 1MN7A 5B0EA 1S72S 4CNYA 3FSYA 1NDLA 4DJBA 3OL8A 3C46A 4EYHB 5DG8A 2LYVA 2EKYA 2KH9A 1EETB 3G8TA 3NBPB 1SJ4P 2YQ3A 1LWEB 4Y2CA 4P6QA 3IXQA 1FDDA 5F8HA 4FYDA 3DYAA 3MM5A 2BQRA 1WNEA 1URNA 1PG5B 3ZNJ1 3H0PA 4QIVA 3SBMA 2FPHX 1XR7A 2N3OA 2W2PP 3T1YF 1Y3JA 5LM7E 3KOAA 2FZCB 4MIWA 1KVIA 4U9RA 1G6BA 3JYTA 2MYFA 4NA2A 4RW6A 2DEIA 1IBCB 4F50A 2IC3A 2DEJA 2V50A 3SFUA 4ZIWA 1RTDA 1FKPA 3DFEA 4UUWA 1RISA 2HVIA 2H5EA 4G1QB 1SH3A 1NMEB 3LALA 4DV3J 4KO0B 5I42B 5GVQA 3RTVA 2VG6A 1UTAA 4LRFA 5KFJA 4X4NA 5KFKA 1C1BA 3AH6A 4X4UA 3M4XA 1U26A 1Q7LB 3OUYB 2VASA 2O66A 1M5VC 2HHUA 3D3CJ 1FDNA 3ZXWA 4IOBA 4DZ6A 4V19X 2HZAA 2BRKA 2WONA 1UVLA 5GAEU 1P1TA 1V3RA 4OX6A 5B0CA 5I3UA 4A8KA 3EUNA 1LQ9A 1S12A 3AHPA 3SCIE 4LFCJ 3FQLA 3HT3A 4QPXA 3MR6A 2GIQA 3AA8A 4CI0B 1SL2A 2X1BA 3NGRA 3D3BJ 4QWEA 4DX5A 5J1PA 4UY85 4IH7A 2M8HA 5F0WA 5J2NB 2HYIB 4A8MP 1RTIA 2ASJA 3BQ0A 1UETA 1HNVB 1KKHA 4ZPBA 1X4EA 3BGLA 2D7SA 4X4SA 1KC8T 2VG7A 4H4MB 3CDBA 2XO6A 3WBZA 1IKYB 1WKKA 2IM2A 3TQ1A 2IHR1 4M5DA 4RW8B 2XY6A 2MZSA 1IUJA 5KG4A 4URGA 3DI6B 5IT9Y 2HS0A 1TL1A 4KRWA 4XAKA 2WW4A 3LGNA 3DLEB 1B7YB 1HQUA 4ZP7A 3SSRA 4P75A 2DNNA 1VDHA 3PXGa 3MAAB 4ANCA 1UVIA 1MU2A 5DGBA 4NLGA 3IC1A 3O3LA 4ZPAA 2ZJRQ 2G1HA 4LR9A 4DQSA 3QBCA 3QT8A 2K06A 1UFLA 3MPWA 2CPYA 2DPIA 2PGCA 3PJXA 3G2XA 2HQGA 4HACA 2NXCA 3HK2A 5CCMA 3PDNA 2O5DA 3KJFB 1VQ9S 1EJ7L 1WTBA 3DGPA 4B3TJ 4CYUB 2QN6B 3MM7A 2ZH8A 2CZ4A 2BVZA 2D3O1 2FHJD 4NLTA 1N0UA 4PKDB 2QA4S 3TAMB 3D6FB 1SVDA 3AFGA 5HQMA 1MMDA 4H4OB 4A48A 3RBEA 4OX9F 4CCHA 3IGNA 3QIPB 4TVAB 5CYJA 5CD4H 3M8WA 2RMLA 2E5IA 3I5BA 2FTRA 2XTJP 5LJ3Y 2AYEA 2AHOB 2GC8A 4C6AA 4QW8A 5DDPC 1SQGA 3CNQP 3GLJA 1TKXB 4DUYF 2CADA 2FQQB 3NLCA 3NXZA 4QQBA 5GAGI 3OR2B 1NK8A 1OPIA 3DRPB 2ZBRA 4R5PA 3GP9A 1MWQA 1NK7A 2P9EA 2NXJA 1D9AA 5D4PA 2BJ3A 3LP0B 2HAFA 1RBAA 2DJWA 3HVTA 4CRJA 2M2BA 3JTNA 2E5LJ 4DWIA 3FRYA 2HWHA 3RRKA 3W2VA 1T9TA 3CJ3A 1U0SA 3GFHA 2VD3A 1WF0A 2GNKA 3KG0A 3X1LB 3SI8A 2E5GA 3LPEA 3DC2A 2CJ9A 1RHJB 1KBRA 3JB9k 2A10A 2OPPA 4M95A 1NNDA 3LW5C 1RA7A 4QU6A 4U96A 3OFGA 2HNYA 2MKSA 4S0MA 3B8HA 2UVWA 4CLKA 1Y7PA 3D9BA 4RZRA 4OZ1A 3CGIA 2XS2A 4C2MA 3KJVB 3R5GA 3EZOA 1KVKA 1VI7A 1EHWA 1R8PA 1GH8A 1IKWA 4U7UD 2WVCA 2O1PA 3EE3A 4DUTA 2CUYA 3A8EA 1FERA 4QJVA 2VPZB 4UZCA 1RB0A 4WFXA 2OD4A 2VJUA 4NXNF 1E6YB 1UKUA 1UVJA 2E7VA 1GMVA 4LBHA 4O3OA 1Z4UA 4KB7A 1APSA 1KP6A 1OQ6A 4HTIA 2Z8QA 4YDDB 3ADAC 3D6MB 4WTOB 1NSPA 1N36J 4ERDA 3KLVA 1RAAB 3M6WA 1KLNA 2CQGA 1IJFB 4M1KA 1NDPA 1U1OA 1TK0A 3NNCA 1T9UA 2RUSA 2WOMB 1BWVA 3PFOA 3KUEA 2HW3A 4FXDA 2GAGC 3SEOA 4DR6J 3GFXA 1TKTB 2UXBF 1HBMB 3W60A 2FGCA 2BANB 3V6HA 2PC6A 2YH0A 1SKWA 1UWAA 3VGTA 2IYGA 3Q2SC 1LWCB 1N33F 4UY8T 4OIXA 2GGPB 3UR0A 2DITA 3MM9B 4M5GA 2QSFA 1WC4A 1WC5A 3EGWB 3BGUA 2PDAA 3HX9A 1UW4A 1KFSA 1PBAA 3GV8B 4KBIA 1R0AA 4ELTA 3QYYA 2I38A 5M2PA 4ID5A 1ZZNA 4Z7CA 3FMBA 5K8MA 4L3KA 3PW7A 4HTJA 4AQYF 3PRVA 1FFWB 1T05B 3G6XA 3OD2A 4F4KA 3QT5A 5IV4A 5C42A 4A46A 4NA3A 1HARA 3OVAA 2UXCF 1K9MT 4RNNA 2G0IA 1QE1A 3BDEA 1W7WA 5LL6d 5J1EA 1CEZA 2WB1D 4CNZA 5CABA 5ETPA 3MTKA 1TL3B 1JX4A 1BXNA 3OPKA 3A8IA 3NGKA 1N52B 3CDUA 4K4TA 1N32J 3ILIA 4PXEA 3VQTA 1B3TA 1WD6A 2GQQA 1VQLS 3H5SA 3M9MB 1FEHA 4URSA 3JQMA 2LQ9A 1VGYA 3TNVA 4PQUA 2OPSB 4K8RA 2JWNA 4DF8A 2XEXA 2RDDA 3DRYA 3OTEA 1P8GA 5FLXY 3HD2A 5DZ6A 2XGPA 3RG6A 2MHNA 2HG4A 4JUZA 3WQPA 3CC7S 2DGUA 4MT1A 1CC8A 1KONA 3MEGB 4DXLA 2BM1A 4X62J 1I3OB 3AOCA 2MLZA 2WAQD 4HYKA 4RU9A 4GC6A 1U4BA 4I1TA 1XN9A 5KAKA 3M8RA 3KFWX 1CQMA 5CYMA 3J7YU 2YNGA 1PCAA 3IWLA 2WBMA 3UDEA 3A13A 2RKIA 5AJ3F 2AP6A 1RYSA 3EPGA 1R27B 4KHPF 2HFOA 2CJKA 1T95A 1S6OA 1SJ1A 1EETA 3IG1A 1ZOTA 2DPJA 3THVA 3NBPA 1Q86T 3HMJG 2B9WA 3J80U 3LH2S 3THPA 4O3SA 1KQFB 5D0HA 4DR5F 3EVOA 2VICA 2X1AA 2WSEC 1QDUB 9RUBA 1Y10A 1AYEA 2IVYA 3SXLA 3DCAA 4KT0C 3CCES 3CJ8A 2OAUA 4ZCKA 2BXJA 4KSEB 1RGVA 3AQOA 5HVHA 4YS2A 5KFFA 3E8OA 4IR9A 1S1UB 3D66A 2Y1IA 1C4AA 5KG1A 3EMTA 3W65A 4G1QA 2N7YA 1D09B 1T94A 3VV2B 5I42A 2B5JB 1JJCB 2UUBF 2MQLA 2HRUA 4CLSA 4YR0A 4X65F 2AWZA 3UCGA 1YJ9S 2MZTA 2JRSA 3GJQB 4X64J 3QSYB 4OI0A 2IRUA 4FYYB 3SSQA 1YG0A 1WI6A 5BYRA 1N0VC 3FEXB 3BEGB 2XMUA 3KMQA 3BDPA 1T03B 1HW9A 5B7WA 2DRAA 2MB0B 4G3IA 1IBLJ 1REVB 3G86A 2VA3A 3FBEA 4JB8B 5HROB 2L9DA 1VLYA 3J81Y 2M52A 2E9RX 1B70B 3DOKB 5J1NA 4R25A 2JEGA 1U6FA 1FRMA 5RUBA 2MSSA 3PHTA 5HJXA 1H72C 3CWJA 3GG1A 4TYAA 1TFWA 1YIJS 5J2NA 3D67A 4E0DA 3W8PA 1O0PA 2WBRA 3ZZRA 1ZM3A 2JVOA 2V2VA 5GAGU 3EXYA 2DRBA 1EP4B 4OZ0A 1HNVA 3ICLA 4I67A 4ZVHA 4IG0B 4ZPTR 4H4MA 4DR3J 4ED7A 1X5SA 2VKZG 4ZS6A 2UUTA 5IC6B 1IKYA 3MMCB 2FVSA 2DH7A 5KFMA 3N9UC 4DSLA 5KT5A 4QYRA 2LVWA 3K59A 3TEGA 4RW8A 1VRTB 5J2MB 1DLOB 5L1JA 1FNMA 1CG2A 3DI6A 4QIWD 2V34A 2B4UA 3U1MA 1VRQC 1UWBB 3CCLS 1KFDA 5L9NA 3V6DB 3D68A 3MAAA 4A8FA 2I9SA 4OHWA 5SUHA 2R8KA 1SKSA 2FLLA 3DMJB 2CJXB 1WSRA 2F8HA 2C1EB 2K8GA 3H2LA 4ZLJA 2UP1A 5GADU 2MGZB 3CJQA 3GG0A 3MEEB 1JLEB 1QLNA 2KRBA 4NWBA 5LMUF 1NUEA 1TKZB 4N8OA 1S1VB 4KR0B 3T3FA 3D4JA 3QJJA 3OW2R 2LA4A 4CYUA 3GONA 4MK7A 4RO0A 1NHVA 3KG1A 2ZOFA 4ED2A 1FNXH 4RR5A 5C24A 1KOOA 3KLEB 4TYBA 4LF5F 1G7CB 3L3CA 1U6ZA 5KFXA 3OLBA 2QLJB 4ATNA 4H4OA 3QIPA 2W01A 2FJDB 1NJXA 2XCPA 2J9CA 1FRIA 2HRTA 4OYIA 3MF5A 3DN9A 6FD1A 1IVZA 2K3IA 2C2KB 3OFEA 3MGJA 3S1TA 2KG1A 4C97A 2B43A 3FZBA 1TKXA 2DNZA 4L76A 2ZVIA 2HGNA 3ZZ0A 3H90A 1RT6B 3OR2A 3DRPA 2G0CA 3OV7A 3HKZD 3M2UB 2A6OA 5LJ5Y 1H73A 4H4KC 3LP0A 4USKA 3KKFA 2J8AA 4PXDA 4Q5VA 2U2FA 1EQMA 3CIZA 5E3AA 2XWYA 1FJGJ 2KXFA 4FPRA 3I0SB 3H20A 2ZM6F 3L4BC 3KJQB 4PPDA 3MOJB 1QSSA 1Q5VA 2J0WA 5AE1A 2MSTA 1GEHA 5F3TA 4QIFA 4GKJJ 1NJWA 1F6TA 1HBUB 4TNOA 2Y1LB 1WSVA 2E1RA 4X4OA 2FZGB 3KJVA 4K5SA 3AA9A 3EX7B 4YMEA 2UV8A 4M5MA 3TZYA 4DUYJ 1QAJA 4FYWB 1W26A 3DU5A 5E3RA 3L7OA 2FGOA 3AD9C 4L3NA 2XY7A 2ACMA 3SFGA 2B7BB 1C2PA 1E6YA 4LF2A 2K1RB 3UPFA 1CJVB 4FN5A 2NSBA 4DQIA 4XO0A 1PYTA 4NLQA 3E2EA 3K0JA 4DV5F 4WBFA 3FCWA 1Q5YA 3M30B 1X9SA 2HHHJ 1S4EA 3D5MA 2W7OA 1P9QC 1SI9A 1PJ5A 2UVVA 3CDWA 3R8YA 2WOMA 2XSJB 2FVCA 2ZD1B 1SQEA 4LF4F 3MR7A 2VL1A 2HVDA 4K2JA 3R6GB 1TKTA 1R0BG 1HBMA 3GSIA 4C9DA 1RTJB 4UOHA 2C2RA 4Q7AA 2R8IA 5KFBA 4ZHRB 4ECWA 3G6ES 3H59A 5IQQA 1W2IA 2GMLA 3MOZA 1FK9B 3SSSA 2PI4A 2C3YA 2VBWA 4AL6A 5MAOA 1LWCA 4MFBA 5L9XA 5KFPA 2HEKA 4AL5A 1NKBA 1YSJA 4P71A 3MM9A 4ZVRB 2OUGA 1X9WA 2QLWA 1RU2A 3GZ7A 1U45A 5IQ6A 2L41A 2EC0A 4K4ZA 1LEOA 2H65B 1ZETA 3SDEB 3Q8UA 1AB8A 2KJWA 2LQ8A 3WIVA 5GMKa 5KT6A 5AXLA 4J37A 4NXNJ 1K47A 3UO0A 2V2KA 3RRHA 1X4CA 4OI2A 3F41A 4ZOSA 5D3GB 1BUXA 3QFWA 1T05A 3HFZB 1NK6A 4P10A 3JTPA 3HVRA 3GYGA 5HVGA 1GK8A 4LSZB 3CJSA 1GFWB 5IOLA 3IRWP 2ERRA 3OTOF 3RBZA 4K50A 4RWWA 2UXBJ 1TL3A 3OFHA 4B3SF 4ZVOB 5J2PB 2AMCB 4CM2A 2CJYB 4KYZA 3NS5A 1VQ7S 2CRLA 2I1RA 1Q0NA 1J2VA 4OI4A 1JXEA 4QWCA 1N33J 2CNKB 1KSPA 2JEFA 4I6WA 3C19A 3J7AN 1R7IA 4O3QA 2GJFA 3V2UC 1S9GB 3CT9A 2OLWA 4CH0S 5CXTA 2OPSA 4KH0B 4ED4A 1VBYA 1MG7A 1SKUB 1ZM4A 5K9FA 5B09A 2ILZA 4PUOB 1VQYA 1OS5A 3S8SA 4ZPVR 3NAHA 3ENAA 2WSCC 1AROP 3TRGA 3VF0B 1S4FA 1SC1B 1J27A 4WFYA 3FQKA 3MEGA 3TANA 5GMEA 5E5NA 4L73A 4PCQA 2NCKL 1QAXA 1IXKA 4PG7A 2LQBA 5AXKA 1U8WA 2UXCJ 4LT6A 1QUVA 3PCOB 1XR6A 4YHHF 5KG0A 3P4UB 1LK7A 4QPTA 2ALYB 2KHCA 4Q2MA 3BN4A 2XZDB 3HJVA 1WORA 5HANA 1U8SA 1HNIA 2FUG9 2AJ0A 1DARA 1FD8A 3NCRA 2V8VA 1UZHA 3L9ZA 2EK1A 3V6JA 4NMLA 3P45B 4LRCA 1A0OB 1IJEB 2EC2A 1K1SA 3TO8A 2P5VA 1H6KX 3MI7X 5KFUA 3BSCA 5F0UA 1IKXB 5F8LA 2F4VJ 3PVXA 2ZKTA 4Y65A 2HBZB 2PSZA 5ETTA 5KFLA 1K0TA 1YRUA 4Y0FA 2HZVA 1XR5A 4JI0F 1S1WB 5HI7A 1HI8A 1FEEA 1T8EA 3W9JA 1S1UA 2NUHA 2FC9A 4M5IA 5KFVA 2HKEA 3FDSA 2R7OA 4HI2A 4JV0A 1T11A 2KVIA 2C3UA 2B5JA 1HD0A 1SUQB 1YDLA 2BACA 1RACB 2HPUA 3TJ8A 2W2OP 3DHWC 4C8OA 5AJ3J 3B54A 1JMTA 1KWMA 4ZN1A 2PMZD 4XPEA 4J9SA 4DCJB 4KHPJ 2IAJA 3IR7B 2FB0A 4ZLNA 4WFBQ 1VQMS 1NKCA 2ACYA 2XHWA 1T03A 3L95X 3RW6A 1U25A 2ZNZA 3HHLC 5BYSA 2MMYA 2EFNA 3UW1A 3UN3A 1U24A 3K5PA 4DR5J 3HT0A 1HBNB 1WHYA 2LKZA 3DLLQ 5HROA 2AD9A 4WIIA 4DV7J 1TVRB 3DOKA 2R7TA 2RDIA 1HWKA 4DV1J 3ILLA 3HPOA 2VZ9A 2JJ4D 1ZAWA 1FRKA 3N79A 2J0XA 3KLIA 3SV4A 7FD1A 4NLPA 4ZMMA 3DM2A 2JLEA 3A4TA 3CC2S 4LFAF 2Q6BA 2A6MA 2AJQA 5IT9U 4URQU 1CJUA 4DLGA 2UUBJ 1EP4A 1S77D 1WC3A 4X65J 4U8VA 2F9JA 1S6PA 2ATCB 4I2QB 2YVSA 4B9SA 4BWMA 1XWLA 2HFVA 1SL0A 1XTZA 1WG5A 4B9UA 3HHLB 2YTCA 1VBKA 1RAJA 3TJAA 4LFBJ 3HVAA 4JI2F 2XS5A 1CJTB 1RKJA 2FY1A 3LA0A 1VRTA 2KHDA 3UN2A 5J2MA 4AT1B 1FWPA 3MAHA 4F8RA 5B08A 3V6DA 4P7TA 1O6XA 3TA2A 4OYXA 1ACMB 5DQHA 4FXWA 3DRRA 3X3UA 5F9NA 1FRJA 5K8NA 3DMJA 4HH0A 4Z2XA 3CW2C 1L5UA 3RB3A 1YZ6A 4ZCLA 3IMQJ 3NKYA 4NLOA 1VRUB 2MGZA 3HHEA 1VQPS 3SV3A 3MEEA 1H7WA 2R3VA 1JLEA 4PYDA 1TKZA 1KQSR 1MNEA 3PFEA 3TX0A 1S1VA 1RABB 3CJTA 3CMAS 1B4SA 3CXCR 2RRBA 1GXTA 2NR0A 1R0CB 2I6WA 2Z2YB 1HNXF 2OMOA 4JOUA 2M9KA 1WDDA 2KRRA 4U7UK 3MPUB 3GR1A 2ZWPA 3I4HX 5SZTA 4YQWA 4DFKA 2B6AB 1RCOB 4N56A 5HP1B 4WK1A 3BKFA 2GVDB 5KFOA 3TVYA 2MDAA 1YHQS 1XC9A 8AT1B 3O1LA 1NH7A 2OEMA 2C2OB 4DV0F 3OVSA 1Q53A 2V2QA 5IV3A 1EAYC 3C6TA 2LA6A 1R3NA 1AFJA 4FP9A 3G82B 4LQ9A 2GHVC 3RB0A 3HHLD 4NYPA 1RT6A 3OBIA 1RU1A 4OYAA 5LMUJ 4F04B 3M2UA 5JXSA 3GR0A 2E9ZA 2MXYA 2EFPA 3OXLA 2IBOA 3TAQA 1FDBA 2BW7A 2Y3YA 1NSAA 5L1LA 3ZTQA 2P6TA 1C0TB 2YWHA 1F3FA 2W8KA 1KR4A 2CKWA 2CPJA 2IM1A 4DL5A 5CCLA 4LF5J 2GO9A 4OX8A 4JV5F 4CLFA 4CH7A 3BZQA 3UDCA 3I0SA 3Q24A 2MTLA 2JLGA 4F0KA 2PEHA 3R2CJ 8RUCA 1HHQA 1XNRF 3LGMA 4C0OC 3FZ2A 4YN3B 2AJ1A 4DU7A 1HBUA 1U2RA 1SV5B 2B7CB 4DX8H 4WFNQ 4YB6A 1S97A 5D6GA 1JLCB 4P73A 4ES3A 2HRYA 5ETNA 1VISA 2DNLA 3WZ0A 1VR6A 4K4VA 5F3ZA 3HZGA 2KJVA 1BQMB 3C6UB 3PACA 4H4KA 4M5JA 3DOMA 3Q2TC 3MM6B 2QMXA 5H9FK 2Y1RI 2Z2ZA 2KFNA 1QVFR 5GMDA 2OPQA 4I68A 3GILA 4F36A 2YX7A 4ECUA 2K1RA 4KFBB 2ZBCA 4OHYA 1CJVA 1FKOB 2VJVA 4Q8EA 3QWUA 5K8OA 4RUBA 3D28A 3POTB 3A12A 4AE5A 3ZNUA 4DR4J 3M30A 3BR9A 2HFZA 5DJBA 1NZAA 1VHIA 3M6VA 3A8KA 2UXDF 5IZHA 1S0NA 4OYOA 4J7CA 2IJNA 3PNIA 2KXNB 2ZD1A 3W66A 3EVWA 2AX1A 4DFMA 2BE2A 3ENWA 1RTJA 1KHWA 1D8ZA 4DPOA 1FESA 2XYGB 3EWGA 4ZHRA 2LXIA 2BE9B 1FK9A 2V8PA 4YFUA 3HHDA 2WZ1A 5DO2A 1IWGA 3BGFA 5E3QA 4NEYA 3OXGA 1LWFB 4K7QA 4LFCF 2PD1A 1O51A 2EPIA 1IR1A 3V81B 1DQ8A 1RT2B 4RW6B 3SDEA 3ZO7A 4EO8A 4K59A 1CVJA 3N0VA 2RDJA 3GYXB 2KFZA 4NRUA 2JEIA 2V2ZA 3CCWA 1YBTA 4ID8A 1XIQA 2YWKA 3RBDA 3FEYB 5D3GA 2CQ0A 3QJPA 5G4DA 2MQMA 3IM8A 3R1HA 2GJ2A 1OYEA 2KT2A 7FDRA 1RAFB 5L39A 1MMNA 5H1SV 3AB4B 2LP4A 3J81j 2GCFA 4ELVA 2L48A 4NLWA 4B17A 4UOFA 4LF4J 1L3SA 2ASDA 2BZ2A 2HGLA 3HFKA 4HVZA 4ER8A 3IAM9 1LWXA 1GAOA 4ECYA 4A8XA 2RRNA 2CG4A 3GCWP 2YXLA 4F4YA 1HFEL 2Q66A 2PMWA 3H98A 4WYWA 3LWMA 2GX8A 4R8UB 1D1UA 4RUCA 3WIUA 2P9CA 1T02A 3O44A 1ZAVA 3K58A 4K4XA 4W92B 4HKQA 2CAJA 3JXOA 2EG1A 4USUA 4B9NA 1S9GA 3MEKA 2DH9A 4DFPA 4IKAA 3HHNB 3C8YA 4C0BA 1HR0F 1S0OA 4RL1A 4PUOA 3A8JA 1PYSB 1Q7YT 5A2QY 3TZXA 4AYBD 1X4BA 5G0RB 2AT1B 2YY3A 1U1NA 1FRXA 4M63A 4FF3A 4ETZA 3N6MA 4CP5A 4TY9A 1AT1B 1JJHA 2IA6A 4CH1A 2ZFHA 1XJWB 3MEDB 5T14A 4ILMA 3OTOJ 3THTA 2DIUA 4ITSA 1PKUA 4B9LA 2NXUA 2C2MB 4KGMA 5JUMA 2P9GA 2KT3A 4PAAA 4B3SJ 2KXHA 2PA3A 2Z2LA 4E8UA 1NHKL 2GW8A 2HIQA 3WX8A 1TL1B 3K5MA 4QCLA 1GX5A 4HDGA 1HD1A 4O4RA 3EDQB 4GMKA 3SIPB 4F4AA 5CA5A 2FLNA 5E3PA 5ETKA 4OHXA 4DMZA 2V6AA 2ZWOA 2UUWA 4EGLA 1IKXA 4KPCA 1CBKA 1HWJA 2XSFA 3GPAA 3U1NA 1AXQA 1S7HA 3BREA 1S1WA 4R0EA 4F4ZA 1T3OA 1R31A 1U1RA 1YGYA 1SC6A 3RU0A 2F65A 2MZJA 4KE5A 3CUNA 1I94F 3MM7B 2CQDA 3MFHA 4MTPA 1WG1A 3CJ2A 1SUQA 3BF4A 4C8KA 3CCUS 1S99A 3AJ2A 2D9OA 1HWLA 3LP1B 3R2DJ 4YHHJ 3D1HA 3OT9A 1VQNS 5HLFA 1Y00A 2GMHA 3QJLA 5L8RC 1V3SA 1L3VA 4DU8A 3H7HB 2DHSA 3BPSP 3B4DA 4I64A 3EPIA 3TI0A 4ZLPA 2M3DA 4AXIA 1RHUB 1RLDA 1HWIA 3MD1A 4X4RA 2AF6A 3GV7B 2X3GA 4DR2F 2VFUA 1HBNA 3QATA 1AW0A 1VBZA 1TVRA 5IT0A 4JI0J 2D3ZA 4R5PB 1VOMA 3VHQA 3TQEA 4IYQA 3EGZA 3Q22A 2XMTA 2Z30B 3ITHB 3CO0P 4C8MA 2MEWA 1LKZA 3W2VB 3DLBA 1N36F 1QVGR 3JSMB 3US5A 2OPRA 4LF6J 3PJWA 2FHOB 5K20B 1P6TA 3CCRS 3KNAA 5D4LA 2Q6CA 4OYPA 8ATCB 5AE2A 2F1FA 4I4BA 3NAIA 2MLYA 3A3NB 5IC4B 1GMUA 1T0TV 3T5KA 1RAIB 1N5YB 1OIAA 1OY8A 2OPPB 5IT4A 1FFGB 3KLGB 5DETA 3HHLA 1EIYB 5KFZA 3JAMY 1FTRA 2CQBA 2GMJA 4N8NA 3IBWA 1CJTA 1QUPA 1JLAB 4J9NA 1BE4A 3BN7A 1CC7A 2BQUA 3PRDA 5KFHA 5KFCA 1XBWA 4WJBA 2QL7B 5KT4A 1GNKA 5KG7A 2HFSA 2E44A 2C3PA 3UD4P 1UPMB 3K5NA 3ENVA 3CJKB 2HQCA 4CTAB 4ANEA 2NUUG 5KFTA 3PY8A 5L1IA 1W2BR 1H2UX 2J9DE 2MZQA 2G9OA 3TW0A 3M6UA 1VRUA 2KDOA 2KYZA 2OTJS 3FJ2A 4NLSA 2EK6A 2YNFB 4D3GA 5DLGA 5KT7A 1PC4A 5IXUA 4LVNP 4LFAJ 3OR1B 4NMXA 3QQCD 3M2RB 4F0MA 5DG9A 3BQ2A 3NP5A 4ZVUB 3RB6A 5FD1A 1U2FA 3I5AA 3OLAA 5A0YA 3PW4A 1BGXT 4USWA 2ZBPA 3QGGA 3G6VA 2O67A 1JNRB 2CVEA 2FLOA 3RBXA 3LP2B 2WVEA 4BS2A 2JLFA 2RVJA 2CNOB 4JV2A 3QO9B 2JC1A 4JI2J 3C16B 1N32F 3EZ5A 2DD8S 3R97A 1X60A 2KZZA 4BC7A 2B6AA 3MMJA 2GVDA 5KTQA 2DBBA 1KTQA 4WE1B 2LEPA 4IRCA 4DPUA 3Q8VA 1MLAA 2VV5A 1M90T 1PBUA 3M05A 1X31C 4U7CA 5HMYA 4ID5B 4EU0A 2HMIB 4NYZA 2OHDA 2VUGA 3G82A 3HP6A 2JVRA 3H5UA 1NDKA 2PFDA 5L38A 4DN9A 4G1PA 2DIVA 4LRBA 4CO4A 4X62F 2WVBA 5B0GA 4BCAA 4KV8B 4ENOA 1FNOA 2VG5B 2UZAA 4M94A 3ETMA 4IH6A 3G6YA 4EUVA 4W90B 5J1EB 4NI2B 1R8CA 2A3JA 2ZITA 2RU9A 2MPUA 4DQPA 3OVBA 1NJIT 4WZQA 5K8PA 1FKAF 1X4GA 2UU9F 4E98A 1ZA1B 3VQSA 2PMHA 1WF1A 4J9VA 2FVQA 1SJ3P 3HSJA 2VQFF 2QG9B 2DR5A 4OZLA 4LF7J 3OL6A 1S6UA 2CFXA 1GX6A 2HIYA 1SV5A 4DQQA 4DV0J 1JLCA 4U95A 3P5BP 1VQ4S 4LF9J 3FCVA 3G8QA 1D0EA 1BQMA 5HQ8A 3HO1A 2NSCA 5F8NA 3TEHB 2CQ3A 3MM6A 2MQOA 4KFBA 1Q82T 3ZTOA 2DYAA 4IQMA 3RW7A 4C11B 2BJDA 2R8HA 3FSIA 4DX7A 4PG6A 3HVWA 1YITS 3CCTA 2NXEA 3POTA 4IFYA 2U1AA 1FRLA 6AT1B 2MQNA 4C8LA 3LF0A 5F9LA 3N6LA 4M8LA 4X64F 3PKYA 4WP3A 1U1LA 2XMVA 1GMWD 4JV5J 3ZZUA 1NU4A 1OO0B 2RT3A 2VU5A 1NXIA 5LOQA 4IR1A 4MK9A 4F3MA 3G71S 3T1AA 4IG3B 2DHXA 2J5AA 4LF8F 2YKPA 3IG1B 2H48B 4J9QA 4F3QA 2DNGA 1XNRJ 2Q79A 2W2QP 4KGXB 1IBLF 2CXEA 1OY6A 4NEZA 3KMSA 3HM9A 1ZM2A 3ZTSA 3AODA 3EICA 3OTBA 3GFYA 1S10A 2DGTA 1N4LA 2PFFB 2CDRB 1RBOB 1LWFA 3ZFVA 4OZNA 2LXUA 2R4FA 2PEBA 3DDKA 3V81A 1N48A 4EFAC 4IO1A 5M2UA 5EWEA 1BQXA 1RT2A 1RUSA 1R6VA 2OEKA 5C25B 3T5LA 3UCUP 2JSXA 2G2ZA 1Q95G 4OJHA 1X0FA 1CSJA 2XZTB 3CC4S 1EKSA 1JLBB 3M32B 5B0DA 2NQPA 4WZMA 2JL9A 1ZM9A 2IFXA 3VALA 1VQKS 4DR3F 3U02A 1TP7A 2Y0BB 4EBCA 3K57A 3J7A1 2UXDJ 2OJ3A 4K4WA 3H2UB 2HHPA 3PJ9A 1RHQB 4C8NA 4QIEA 1NHUA 4QR0A 2AQ4A 2DGVA 4R8UA 2CJBA 1HQ2A 3CEDA 3PEJA 3JS9A 4FBUA 4LBIA 3CVKA 2DNOA 4DL7A 3DHXA 3CCSS 3NWGA 5IWAF 2VC1A 4HDHA 4CQ1A 3I56S 2DB1A 2X1GA 3GSDA 1QAIA 3BS9A 1X4FA 2EFGA 1H0HB 5JJBA 3GIMA 3J7YI 2GS8A 1LXNA 5CH7B 5G0RA 2B9YA 1SB6A 2XLIA 3RAQA 3ZZYA 1NK4A 1ROFA 1VC0A 3BGOP 3MR3A 2DH8A 2YKNA 4UZBA 2F4FA 3TVZA 4I0WA 1R8BA 4DV4F 3MEDA 1YKWA 5C7PA 3TJ9A 4MH8A 4ZIVA 1ULRA 2W1BA 2BABA 3HD1A 3I5CA 3H42A 1AZSA 2FJVA 5L1KA 5HL7Q 1H7XA 3SCLE 4TU9A 1JIHA 2IM0A 3BBCA 1Y4ZB 4YDXA 4EK2A 2EEYA 1S9EB 2DXEA 3CTRA 1LW0A 1QSYA 3N5FA 5I3PA 2B56A 4HI1A 2NZCA 1RT5B 4Q8FA 2AYMA 1HR0J 2E29A 4NE9C 3CMQA 4ECTA 1RLCL 2R7SA 1VQSA 3HXMA 1HPZB 1F5BA 2DHHA 4I56A 1CJKA 4ZVEA 2QO3A 3A3PB 1UJ4A 1IM6A 3AAWB 4BBYA 1C1CB 5HQLA 1OJ4A 1IWAA 4FKYA 4JI3F 1XMQF 4YY3F 4Y2KA 1S5ZA 1R8AA 1SC4B 2IDEA 4NPOA 5I4MA 3R9LA 5C24B 4KHMA 1FJGF 3BO3A 5CYQB 4ILLA 3LP1A 4GO7X 2G2YA 1LW2A 4EI2A 1DFDA 1GTHA 4WCEQ 4J9OA 3ZC4A 1F9EB 1KNZA 4DV2F 2K2PA 2DGOA 1G3OA 4NA1A 4GKJF 4KIAA 4W4MA 1S48A 3BO2A 2UVUA 1YLXA 3C15A 3ZZPA 2VA2A 3MUTP 3IS9B 2IPOB 1B99A 5D8HB 2LEAA 4LF1A 1VQOS 1HWUA 2ZVSA 2CQCA 1NSKL 1A7GE 2GQCA 5HSPA 1UA0A 4DSKA 5GAHU 2Z0GA 3AOBA 2AW0A 3NGTA 5FDLB 5KFNA 3SCKE 1LFWA 1KS2A 2MKCA 1N6QB 1OYDA 3R27A 4Y2AA 3ITHA 1UP1A 3NOGA 2H5JB 1JXLA 3UN5A 3I9V9 2HURA 1I94J 1WEXA 3JSMA 2HHHF 3SQGB 2VC0A 2VBZA 3UVJB 1JLQA 4NLUA 2CZ9A 1HL6A 2WHOA 1HHTP 3UWTA 4X4QA 4UUXA 4FNIA 4RW9B 4E2FB 1N5YA 2IIHA 3KLGA 1X0PA 3CPWR 2Q3PA 1TK5A 5F8IA 4MYUA 4NCGB 1CULA 1KHVA 4MKBA 4CLWA 1JLAA 5KFQA 2ILYA 2OEJA 2XB2D 4DX6A 4USJC 1XNQF 5GADI 4DR2J 1M1GA 5D0RA 1JLFA 4QWBA 4DSIA 3IA0A 1YJ7A 3M8QB 3M1VA 1N88A 1I6JA 3CJKA 1ICEB 4CTAA 2ZZTA 2C2NA 3K8WA 4RW7B 1WKJA 2KYXA 4NLVA 1VK8A 2MY8A 2NPIA 5ETMA 2QL5B 3PYFA 5FIIA 4O44B 4HR2A 2YNFA 2RHSB 3P8BB 3OR1A 3M2RA 3QRRA 2KB2A 4JI8F 4TQRA 3NRBA 4NCBA 5HK4A 1IM4A 4BLGA 3H4DA 1EZZB 2VIHA 4ZPCA 4KGKA 3DLGB 1FA0A 3ENQA 3W64A 1D3WA 3LP2A 4EMDA 2GHWA 1U7LA 1HI1A 4NCAA 5B0FA 4RUHA 1OPZA 3PV8A 3QO9A 4FPIA 3C16A 3W7BA 4USIA 4ICLB 5HATA 4ZLLA 3Q8SB 2B4PA 4MKYA 4MFBB 3O6QA 5AXMA 2VPWB 1IQZA 4WE1A 5DLFA 3UD5A 2ZH3A 3R6LB 4FF2A 3L7UA 3LAKA 1PGZA 4JI1F 2HMIA 2DNMA 2OP5A 4ZVGA 1PAEX 3CJRA 2GJIA 4FS2A 2I5JA 2Z2MA 1MROB 2XY5A 4ALZA 2AJ2A 2R7QA 3FBBA 4KV8A 5ETRA 2QZ8A 2HSEB 4NYOA 2VG5A 4DZDA 1K1QA 2LQJA 5ETVA 1UW9A 1H74A 2DRDA 4UW2A 3KTQA 4NZ7A 1YBAA 4NI2A 4I6AA 3C66A 4N76A 4JI7J 4ILRA 1CLFA 1HW8A 4M5KA 4DQRA 2RU3A 2GFFA 1VK3A 3GJSB 5A8RB 1H2VZ 4QYZJ 2HWIA 2QC3A 4Y2IA 2NS1B 4C7QA 1KTVA 1J5EF 3IAS9 5CZXA 4ZA1A 2KM8C 3NS7B 1S1TB 4G6VB 3MR5A 3W8GA 4BWJA 4UTGA 1DQAA 1E6VA 2LXFA 2F4VF 2ZDOA 5DDRC 3W1YC 1NCLA 1G4CA 1U1KA 3GCXP 1Y5IB 1EB0A 2F3JA 3M6XA 4LJMA 1C0UB 4CO3A 1Q8IA 1HBOB 4HT7A 5LSLA 1N5TA 5LXYA 4WP9A 2Y0SD 1I1GA 2ZEJA 4C11A 1JNZB 2MQQA 1SCJB 4KY3A 1RWPB 1GQEA 3RRGA 1S79A 4O23A 5KFDA 3EZUA 2M70A 2HNZB 4CLPA 4IUFA 1B64A 1NPKA 4K5RA 4GKKF 1NB7A 2DNYA 2RF2B 1B0PA 1HQEB 3AY0A 3KDNA 1NM2A 2KM8B 1HNIB 1VIOA 4IG3A 2HS4A 3OJSA 2UU9J 3JQJA 4FF1A 2YX4A 3GQCA 4G65A 5K14B 5LSRA 2VQFJ 2GIFA 2I8EA 4HL9A 2CZVC 4OQJA 4DV7F 4JV1A 1PSDA 1VQ6S 2E5HA 4DV1F 4O3PA 1YX2A 4C3KA 3TWZA 2FD2A 5CHCB 5C25A 3F73A 2A2CA 2R2UA 3IR6B 1RAEB 3NGDA 1JLBA 3RYLA 3M32A 3ZZOA 1XEZA 2FVRA 1QY7A 2WVFA 4F4WA 2N7CA 5B0AA 2V94A 2ZKUA 1HA1A 3CJ4A 2BQ3A 1SIZA 2B9EA 3OSPA 1LFPA 4CWBA 5JMNA 2JHEA 4FBTA 2IAJB 4LFBF 1QSLA 4LF8J 3AJ1A 5A2QU 2KKHA 3QWPA 4O3NA 3MFIA 1RWNB 2Q43A 4CDIA 3TUPA 3QMQA 1NEEA 2R2SA 2E5JA 4P74A 4DS5A 2ZDPA 1U1PA 2FHJA 3HI9A 4WKYA 2AJFE 4DL0C 1Y5LB 3LGHA 3UNYA 1LV5A 3Q8RB 1WEYA 2V8DA 3KLIB 5C2CA 2YPYA 3DM2B 2DGQA 2N82B 2V4QA 3HLUA 4C8YA 1A9NB 1CJUB 1S6QB 5ADZA 2Z4PA 2DTJA 4CLUA 5F41A 3MPDA 6FDRA 1S6PB 2EBGA 3NCPA 4X84A 3MAQA 3CMES 3R5BA 5KT2A 4IO9Q 1N54B 3GWCA 1J5OB 2JFDA 4TY8B 1SJFA 4OYZA 3BO4A 1IKVB 4CLYA 1F60B 2F9DA 1UJ6A 2MZ1A 3EVMA 2G0JA 4FDFA 3HSZA 4CO1A 4GC7A 2IY5B 1RAGB 4Y2MA 1S9EA 1S49A 4Z7YA 1F0XA 3QPIA 3R5CA 3DRRB 1RT5A 2BKNA 5IWAJ 1SC3B 2J7WA 5DQIA 2NZ4A 3NG8A 4JI6J 2K3KA 1FVQA 3H5YA 5D78A 5E2QA 3GU0A 1HPZA 2L3MA 2J0SD 3CB4A 3G96A 3AXKA 1C1CA 2V4JB 4DPTA 4L6V3 2F7VA 2L9WA 3ZZZA 4DV4J 5DM6Q 4ECZA 1VC6A 5CYQA 1X4AA 2EWHA 2N3LA 2CNLB 1F2HA 3HSGA 2HBQB 3P6YC 3CD7A 2VQEF 2MZRA 3TAPA 5KG2A 2I0XA 2DKOB 2W8LA 2QJ3A 3I96A 1JJ2R 4CM0A 3NOCA 1K73T 3IS9A 1WHVA 4ZK7M 3C6TB 1GT8A 3QRPA 2OSRA 3SYZA 3K7RA 3EJMA 3UE2A 2CJQA 3P96A 4HHHA 4P2MA 1VC5A 1KQKA 3ET6A 4ANDA 2RSQA 2X51A 4NZ6A 2JH3A 2AX0A 1KEKA 5FDLA 1JQGA 1NPPA 3JAMU 2IJFA 1N6QA 3VGUA 3JSYA 2DNPA 4YEAA 1DTTB 2QEXS 2D1CA 2HBRB 1IBKF 3GV5B 5T7LA 1M5SA 2W2NP 4JI3J 1XMQJ 4YY3J 4U67Q 4DR4F 2DCLA 4RNHA 4FF4A 2V5HG 3TP2A 5HO4A 3SQGA 1NK5A 1DRZA 1F5AA 3UVJA 3HZEA 3T9NA 2W24A 4RW9A 3G4SS 1CS4B 3TUIC 2XS7A 4DV2J 3EDRB 4Y28C 5K5MA 2UV8G 4NCGA 4EO6A 4A8WA 5D0EA 4XIUA 4Y6IA 1QD1A 2L9NA 2ZHOA 3JSRA 3IP0A 4UQTA 2QE5A 1X5OA 4LUBA 1T9XA 1M1HA 1CPZA 2LEBA 3M8QA 3DOMB 5U47A 1Q78A 2J6UA 4C48A 1Y3KA 2DGXA 2OPQB 1Y9OA 2I2YA 4MMOA 5LSOA 4RW7A 1ZTTA 1Y0HA 4DFJA 3HULA 2XGQA 4O44A 4QOTA 1SPBP 1PAUB 2YKMB 2DO4A 1TELA 4DG1B 5EUHA 3LAMA 3H2VE 1VS3A 3W9HA 4CO2A 2QA4G 1FE0A 2L08A 2QL9B 3KHHA 3B6BA 3QAEA 2VBXA 3TR5A 3DLGA 3I87A 2DXDA 4C8ZA 3VVTA 2BE2B 1R89A 3DXBA 2G4BA 4KGZB 3GIRA 2V4RA 4X4PA 3WC0A 1FXDA 4J9MA 5KFSA 4J9LA 3A3OB 2A0FB 1HI0P 2YX1A 2DNHA 4ICLA 4DCPB 1QAYA 2G1DA 3N4WA 2FYXA 1XNQJ 4FS1A 2BKPA 1MSWD 2MQ8A 4ZITA 3GB0A 4OLOA 3G9CA 4A8OA 1N5QA 1FO1A 1S57A 1TK8A 2VH7A 3AD8C 2HWTA 3H25A 1L3UA 5E0OA 4FYVB 4O4GA 4PG5A 1NZ8A 2CJAA 1ZA2B 3TZZA 2DR9A 2HQ3A 2FJAB 1MROA 1N34F 2XLKA 3UDVA 1RWUA 4JI8J 1A6LA 4LSLA 2XMKA 1XMOJ 5KFYA 1QM9A 4NZ0A 2ATLA 5T41A 1IBMF 4OX7A 5E41A 1ZTWA 2BMBA 2QV6A 3T6JA 2YWWA 3R7NB 4BDPA 1FXRA 3RUBL 1SJRA 4DR7F 4PZVA 3ILOA 4KHRA 4KH1B 5A8RA 4TLRA 4ZJQA 1UJ5A 5THWA 4PWWA 2ZHBA 2XMJA 4FZVA 2ZE2B 3FCHA 3NY0A 2FLPA 3FFIB 1BWEA 1FHTA 2J0QD 2WVDA 4DL3A 4KJIA 1TZ0A 1S1TA 1T9VA 2CQIA 2W4PA 4TN2A 1YBUA 4JI1J 4NRTA 5L46A 2B9XA 1NDCA 4ZVPB 2FJBB 3VAKA 1C0UA 2XC9A 2DHAA 3OL9A 3MCMA 3QAUA 1HBOA 5BR8F 3UFCX 2E1PA 3QRQA 2V9KA 1YRTA 3EYZA 3GTYX 5BYQA 4WKRA 3IM9A 2XNRA 3PR5B 2AJ4A 3IBFB 1S1XB 3TUJC 4DBQA 2ADCA 5H9EJ 1FWLA 1FJCA 2ROEA 4OJGA 3VGSA 3I55S 3V5RA 4DL2A 2HNZA 5HBMB 1I51B 1HKAA 3LANA 3QZ8A 2IYIA 4ZKAA 4ZVTB 5JVHQ 2QFJA 4DL4A 2RF2A 1HQEA 4KTQA 3Q89A 1LOUA 3JSBA 2BX6A 4YUDA 1TL7B 1TR0A 2OMLA 2QYCA 4Q0BB 3S7RA 5K14A 4PXCA 1J5EJ 5DM7Q 4USMA 5A6PA 3EGVA 2VHGA 3F44A 2V69A 4IDKB 4KGVB 2M8DB 1RKIA 4V1Ak 5KFWA 2Z56B 2BOAA 4K0KJ 4A8SA 4WFZA 2VFRA 3FC9A 4ZP8A 3FNNA 1H38A 3VZIA 1NB2A 2O01C 5EN1A 1V6HA 2RQMA 1FT8A 2HNDB 1DTQB 3LQVA 4CO0A 4DL6A 2JNJA 1RA6A 3UNGC 4LF6F 1F2GA 1NH8A 4J90A 4UF4A 5HLFB 3GE9A 1FX4A 1SJQA 4GKKJ 4LRDA 2VONA 4RKUC 1FFSB 2JDJA 2AGOA 3B4MA 4C3MA 2XLJA 1YJNS 1U0HB 3ZTRA 1RHRB 3D0GE 3KHGA 2IMWP 3U1LA 3NCQA 2CQ1A 2RB7A 4LIWA 2YPZA 1GXLA 1RHKB 2H4YB 1WOOA 4X4VA 1R43A 2CYYA 1OMSA 1FF2A 2AKWB 3EGNA 1NO8A 4IH5A 3F56A 5DS7A 5DDQC 1IQTA 3PYGA 2MKHA 5F8JA 5CQGA 2ABYA 1SL1A 2EI5A 2H54B 2XBPA 1NPRA 1S6QA 4GVBA 2OPRB 4B3RF 1NSQA 4OI6A 2AGQA 1XMBA 4JI5F 1URRA 2C2EA 2CWXA 1YQHA 2RRAA 4F0HA 1SIWB 1J5OA 4F3OA 4A4JA 4TY8A 2A2DA 1NJYA 2HHWA 3MXHP 3KXDA 1IKVA 4NLDA 2BBEA 2CWKA 3MECB 2XWXA 2Z57B 3M7VA 2HGMA 2W4DA 2D74B 2HVEA 5C2GA 1O5JA 3ISZA 5HVFA 1RT3B 2EVZA 2XCAA 4UOGA 1TL4A 3OHAA 1AUDA 4AFFA 1BY9A 3AOAA 3QZ7A 1Y5NB 4NLXA 2LECA 2XM3A 4PQAA 4OJ1A 2HHTA 2XYPB 4QR2A 4ES2A 4KKOB 2QLXA 1YRXA 1DAXA 1PJ6A 4ZVFA 3DU6A 5ETOA 5A0YB 2V4JA 3W5XA 2FHKA 3K5LA 2HQFA 3HDSA 2WB4A 3N01A 4WXWA 3OQ2A 1MWZA 1Q81T 2VKRA 2JC0A 1TUWA 1W25A 1UMJA 2LMIA 4XPCA 4HT5A 1KQGB 2OTLS 2HHVA 5LXRA 1UEVA 4LF7F 1UVNA 2WSFC 3Q86A 2B4VA 3PYEA 4RPFA 2XO7A 4JI4J 3AQPA 1X9MA 1LWEA 2CIMA 4LF9F 1SXLA 1KOHA 1D9DA 1V5VA 3R5DA 4HH1A 4GRSA 4H54A 1RP5A 1NAQA 3H8YA 1YTYA 1OY9A 4IQXA 4CT9A 2WW8A 1RWMB 1UFWA 4TU8A 2C3MA 3M2VB 4RJVA 3Q8QB 2R8GA 1N5SA 5E3CA 3BYPA 5HJYA 2M5YA 1KLMB 1DTTA 1WG4A 1HMVB 2FVPA 2OFHX 1H3DA 3PEHA 3ILJA 3PTWA 4ECQA 4F4XA 2CPZA 5MLCV 3HHKA 1BC6A 1TL5A 2PA8D 4OV6A 3BSOA 1S0VA 2KU7A 4KO0A 4I2PB 3W5ZA 1S0MA 1TMJA 2B8PA 1C4CA 1CS4A 4KQZA 2HFNA 3BBBA 2FJEB 4NASA 2OO4A 2VQEJ 2W9BB 1NKEA 4ED3A 2BW2A 2Y1JA 4F2RA 1RTHB 2ALZA 3I0RB 3DDNA 1TV6B 1WDTA 3VAFA 3OUYA 4YP3A 5KOXA 2DR6A 4N7TA 3W9IA 3SZ2A 4WFAQ 3CD6S 4QR1A 1NK9A 5ETSA 2RQCA 4OZ3A 4N77A 4R0JA 4WU2A 3WX4A 3PZPA 4RWXA 3T1YJ 4PR6A 2DY9A 1ZAXA 2ZC3A 2BM0A 2VBYA 2YKMA 1TQLA 1IBKJ 4YR2A 2ZJPQ 5LMNF 4DG1A 3KNGA 1UA1A 3LWLA 1NK0A 3L7PA 4IFYB 2ZOGA 5EHHA 1OSCA 2VDHA 3OHBA 4PABA 2HK3A 3CO9A 3QSIA 3KLFB 3BV8A 3FBFA 2RH3A 2VDIA 2V8GA 3MURP 4DDFA 3PX4A 4RU2A 2AU0A 2JEJA 2IRYA 1Q4RA 3DOLB 5KG3A 1RQ0A 3PKMA 4TLQA 5D77A 4CLZA 4XK8C 1UPPA 3M8ZA 5BJRA 2FIUA 3CCJS 4TQSA 2AZ1A 5D4NA 3QIDA 1M5OC 4ZCIA 3OXFA 4OZJA 2RHQB 1U47A 2FZKB 3IR5B 3GFZA 1LXJA 4JBCA 4U8YA 1Q8LA 2ADBA 1WOSA 4Y34A 2DGWA 2KI2A 1MMLA 3VAIA 3DLEA 2FJXA 1RWWB 1Z2LA 4ED0A 3CDEA 1RAOA 3HSDA 4F7VA 2VPYB 4WK3A 2MKYA 1X8DA 1WF2A 4LSNB 1JWWA 2BJEA 2F8MA 1VYAA 2XMAA 1RK8A 1YK9A 3A1YG 1DZ5A 5IM0B 5A8KB 2ZZNA 3TYTA 1WWHA 4ES1A 4EEYA 2F5GA 2VPXB 5J2QB 4B3OB 1WC0A 2P8IA 5KFIA 2XI2A 5AT1B 1HNZF 5FLXU 4K4YA 3NEKA 4MIBA 1IN0A 4HLBA 3FUYA 2JX2A 3RZAA 4NX9A 5FJ4A 3T41A 2XG8A 3TAMA 1PIEA 3C14B 2VFTA 3MDFA 2ZE2A 2ZH2A 4OYMA 4A47A 1RT1B 3FFIA 1NRKA 3IN5A 2Z58B 2C28A 1H98A 4FKXA 4TKTA 2LDIA 3TOQA 4ECVA 1T3NA 3DGVA 1P1LA 4P72A 2HK2A 2Q1LA 1RWKB 2FHMA 1OSDA 1XQIA 1TMMA 1Q8BA 1N34J 3MCSA 4KAIA 5EX3A 3WC2A 2YKNB 3NMAA 3NNHA 2G2OA 4L75A 1S1XA 5KFGA 4QWDA 2AGPA 1VQ5S 1IBMJ 3K8VA 4K2XA 4XDDA 4TXSA 1P27B 3MPYA 3F0NA 2OELA 1X5TA 1YJRA 2V68A 5HBMA 1AZSB 2N4CA 4L74A 2OSQA 2HQDA 4DR7J 4ZP6A 1TL7A 2YNIB 2R7WA 5JVGQ 2J6SA 3KUHA 3MZIA 1LW0B 4Q0BA 4B3MF 2BE7D 4USHA 1U49A 3V6KA 2UUAF 1DJ0A 3EXCX 4OX9J 4ZPWR 3L09A 3KHRA 2NYHA 3UD3P 4IDKA 1S9FA 2BUNA 2B4OA 4YB5A 3MM8B 4W98A 4C3LA 2QSWA 1M5PC 3ISNC 1RT7B 1CJKB 5KG6A 2LU2A 3KLHB 4K4SA 5BR8J 2YNHB 4EYIB 4USTA 3MPVA 2KT5A 3KWMA 5DRKA 3HJFA 2HNDA 1DTQA 4EZ6A 3Q8YA 4DOZA 2YBVA 2QTWA 4B9TA 4ZCMA 4CZCA 3DLKB 2R7VA 4F02A 4RUAA 1RHMB 4RBUA 4NXMF 1LW2B 3U7JA 3R1LA 4F2SA 3J81U 3LUYA 2E7WA 3RJMB 1M5HA 2OH2A 5KOWA 4RLEA 1I5OB 2W9AA 2R2RA 2E1MC 1U1MA 2ASLA 4WP8A 4O0IA 4ECXA 2ZC4A 3PR4A 3C15B 3UI3A 1U0HA 5DQGA 4UT4A 2CPHA 3G87A 2BANA 1UZDA 3KJNB 1U6BA 3QLHB 4PG4A 3MCOA 3BH7B 4OYWA 3CJ5A 2GGPA 4PWDB 2CPFA 2APOA 1DQ9A 4LVOP 1X4HA 2GVZB 2RILA 1UEKA 2RE1A 4MYTA 2R9LA 1O8BA 3T1HF 1EKRA 1YJUA 4U6PA 1FE4A 1ZPVA 4FYXB 2YWGA 4EBEA 3KDOA 3NWRA 1TUVA 1V9OA 2D9PA 1JLQB 3CCQS 2HAIA 2YKAA 2Y9HA 4J9RA 2RD5C 3QNWB 4N5SA 2DR7A 1VCTA 1TTHB 4CLTA 2QA1A 4N41A 1ZZFA 5DG7A 3S6EA 1CULB 4QU7A 2WRMA 3RAXA 2QLFB 4OHVA 2VOPA 3MMAB 3MECA 4LIRA 4DHVA 4C98A 1VLOA 4I6YA 3IRXB 4OYBA 2LFVA 3E01B 1JLFB 1TAUA 4RNFA 3H5XA 3U27A 1RT3A 3PO4A 2EBEA 3M1VB 1JKHB 1RWXB 2PIIA 3LPYA 3CF5Q 2GHPA 1FDAA 2FY8A 3DDIA 3UCZP 2HZCA 4OZ5A 3BKUA 4DCOB 4OLPA 3CCZA 1JXVA 3BBFA 4EZ9A 3IGVA 7AT1B 4IFVB 2AV5A 4YR3A 2C2ZB 2VFSA 2XYHB 3DKDA 2E66A 4KKOA 2GO8A 4B9VA 4HEA9 3KK2B 3CCVS 3T6BA 3KK3B 2HHXA 2PT0A 4B3RJ 3KG4A 5EDWA 3R7SB 1HLWA 5ITHA 3CULA 1IR0A 1WHXA 3W2WB 1OQ3A 4AQYJ 3ISND 2IVMA 2LU1A 4JI5J 4PPZA 3DRSB 9ATCB 4TU7A 1JLGB 5E33A 3VAGA 4JI7F 3B78A 1Q8KA 4LQ3A 2C22A 3CD0A 1F9FA 1VIXA 2W9CB 2MJUA 1RXOB 3O5TB 3SQOP 3RAMA 2P6SA 4J91A 1IR2A 3VZHA 3W63A 2PI5A 5GAHI 4AUKA 1VFJA 5I3QA 2QMUB 2MJNA 3TX8A 4LMZA 3BQ1A 2RIJA 4PXBA 1ZH5A 2MKKA 3D7SB 1FJ7A 3R3TA 3QGPA 1T9WA 2I5JB 3M2VA 5M2RA 3RR8A 2YWFA 1KN6A 4J9PA 2EW9A 3DNCA 4FVMA 1KLMA 4FXVA 3PW0A 1TAQA 1HMVA 3RR7A 4CT8A 4X66F 1PILA 5IFMA 4Q45A 2N4DA 1WACA 2IA0A 4I2PA 2EXUA 1B0VA 2QFIA 4OI1A 1DHMA 1YJWS 4P2FA 3N6NA 1V3ZA 2W9BA 4I7FB 3FBCA 3AD7C 3PIOQ 3JTOA 4RNMA 3NGSA 1P9YA 1RTHA 3I0RA 3M8PB 1TV6A 4AL7A 2DNRA 3CCMS 3IFEA 3PX6A 3IO1A 1E6VB 3AB2B 2ASYA 3E51A 1WKLA 1RZMA 3ONQA 4DV6F 3TUZC 1CQNA 2B0GA 1REVA 2NYIA 1YWXA 3CD5A 3E3XA 3FVYA 2CDQA 5EGYA 3TZWA 3KYLA 1RDRA 1M1KT 3QGHA 1D9FA 2AIRB 3RB4A 1RJJA 1MW7A 1QTNB 4ZP9A 1WHWA 4UQGA 3D0HE 5HMWA 2UUCF 2CQHA 2YQ0A 2KL8A 4MIAA 4FVCA 2ZUGA 4ZN3A 1RCXB 3KLFA 4DLEA 1WJ9A 4F25A 5DGAA 4QYZK 2QLBB 5AXNA 2BJ9A 2OI2A 5HMXA 4GVLA 4XDCA 2V8HA 3PO5A 3DOLA 4IG0A 1U48A 2F63A 2HLTA 3O8WA 3MWBA 2OFGX 2EFOA 4RBTA 3CDAA 4N47A 3MMCA 4WXOA 5CZVA 1R6YA 5EWFA 1F1BB 3DXSX 5E7OB 2HVHA 1UEUA 3Q83A 2D69A 2CA9A 2EFVA 1M0SA 1F5CA 1DLOA 1T7PA 3M8SA 1UWBA 1BQNB 2BDPA 3IWNC 2KZMA 2K7KA 2DNQA 2M88A 3BGRB 2YKOA 2E7XA 2A18A 4V19J 4L72B 3N5BA 2JFKA 2RQKA 4EWTA 3Q8PB 1FVSA 3I31A 2EKNA 4LSNA 4KC5A 2V63A 4IOAQ 4WYLA 2XZWA 5LMNJ 2DO0A 2PE8A 3MHYA 2BEFA 1Q79A 5IM0A 5A8KA 2AEMA 3OTCA 4M5NA 1OWXA 1LNQA 2AEJA 5J2QA 3TARA 4B3OA 2OKQA 2AYBA 4C4WA 4F26A 3SCJE 4DEZA 1REGX 3W3SA 3CIMA 4NLRA 5A8WB 3VAHA 4ED8A 3VWSA 3BPDA 2RQ4A 1WELA 3KLEA 1Q16B 2HVZA 3EM1A 1KVJA 2FDNA 1SH0A 3VR1A 3VTIA 3C14A 1JJ4A 1S59A 1X7VA 5KFAA 1VQ8S 1RT1A 3TA1A 3I6PA 3PYDA 4DR1F 2AEFA 4JYAF 3V4IB 4DN0A 2IVFB 2CQ4A 4JI6F 4KPYA 3PG9A 3GJRB 2GIRA 1VJWA 4OI3A 4K4UA 2QT7A 5A76A 1G1XA 2ZJQQ 4BHQA 4ZVSB 2OIHA 1KDNA 3BSAA 5HN0A 3PM9A 2HFUA 2UVRA 1HNWF 4NL5A 4DUZF 4CIOA 3KK1B 5KG5A 4DPXA 3BB5A 4WWSA 2ZOMA 1DBDA 2HBYB 1HNZJ 4RW4B 5CAAA 1V5IB 3FMWA 2B51A 2G13A 2YNIA 2IRXA 1BLUA 4LRAA 2KVQE 2M0GB 1WUUA 1HYSB 2ZH7A 4QBUA 4YOEA 1BMQB 3NS6A 2ZHAA 3D1OA 1UAWA 2KG0A 1BD6A 3FEZA 1GTEA 1U02A 2ZH1A 3MM8A 2ZZMA 4ELUA 1RI7A 1R8HA 2AZ3A 4B08A 4DSJA 3HKWA 4OJ3A 1RT7A 3KLHA 3LOUA 2DGSA 2YNHA 4ED1A 4WF9Q
chains in the Genus database with same CATH topology
1N32J 1HR0J 4X65J 3J81U 4PWWA 2KL8A 4JI5J 4DR4J 1XNQJ 4LFAJ 5FLXU 2MEWA 2VQEJ 1J5EJ 3W1YC 2UXBJ 5LM7E 2MQ8A 5AJ3J 3J80U 5IWAJ 4LFCJ 4DR7J 4LF5J 4LF6J 1IBLJ 4KYZA 4GKJJ 4HHUA 4JI6J 3OTOJ 2UUCJ 4X66J 4NXMJ 4KHPJ 3R2DJ 4YHHJ 4LFBJ 4LF4J 4DV5J 4JI1J 1N33J 4V1Ak 1HNZJ 2MTLA 3D3BJ 1I94J 4JI4J 1HNWJ 4B3SJ 4DUZJ 3J7AN 4K0KJ 3R2CJ 4OX9J 3JAMU 4JV5J 4DV3J 2UXDJ 4DR5J 4DUYJ 4KY3A 4JI2J 4B3TJ 2KVQE 4JI3J 1XMQJ 2ZM6J 4YY3J 4B3MJ 4X62J 4DV7J 2E5LJ 4RJVA 2F4VJ 4JI8J 3T1YJ 2UUAJ 1N36J 4DV4J 4JI7J 1XMOJ 4NXNJ 1XNRJ 4NEYA 4DV1J 1HNXJ 3IMQJ 4LF7J 4NEZA 1IBKJ 5BR8J 1N34J 4DV0J 2UU9J 4LF8J 4DR3J 5A2QU 4DR1J 5LMUJ 4DV2J 4X64J 4JYAJ 2HHHJ 4DR6J 4JI0J 4GKKJ 4DR2J 4DV6J 4LF9J 5IT9U 4B3RJ 2VQFJ 3D3CJ 2UUBJ 1FJGJ 2UXCJ 1IBMJ 3T1HJ 5LMNJ 4AQYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 J;  1HR0 J;  4X65 J;  3J81 U;  4PWW A;  2KL8 A;  4JI5 J;  4DR4 J;  1XNQ J;  4LFA J;  5FLX U;  2MEW A;  2VQE J;  1J5E J;  3W1Y C;  2UXB J;  5LM7 E;  2MQ8 A;  5AJ3 J;  3J80 U;  5IWA J;  4LFC J;  4DR7 J;  4LF5 J;  4LF6 J;  1IBL J;  4KYZ A;  4GKJ J;  4HHU A;  4JI6 J;  3OTO J;  2UUC J;  4X66 J;  4NXM J;  4KHP J;  3R2D J;  4YHH J;  4LFB J;  4LF4 J;  4DV5 J;  4JI1 J;  1N33 J;  4V1A k;  1HNZ J;  2MTL A;  3D3B J;  1I94 J;  4JI4 J;  1HNW J;  4B3S J;  4DUZ J;  3J7A N;  4K0K J;  3R2C J;  4OX9 J;  3JAM U;  4JV5 J;  4DV3 J;  2UXD J;  4DR5 J;  4DUY J;  4KY3 A;  4JI2 J;  4B3T J;  2KVQ E;  4JI3 J;  1XMQ J;  2ZM6 J;  4YY3 J;  4B3M J;  4X62 J;  4DV7 J;  2E5L J;  4RJV A;  2F4V J;  4JI8 J;  3T1Y J;  2UUA J;  1N36 J;  4DV4 J;  4JI7 J;  1XMO J;  4NXN J;  1XNR J;  4NEY A;  4DV1 J;  1HNX J;  3IMQ J;  4LF7 J;  4NEZ A;  1IBK J;  5BR8 J;  1N34 J;  4DV0 J;  2UU9 J;  4LF8 J;  4DR3 J;  5A2Q U;  4DR1 J;  5LMU J;  4DV2 J;  4X64 J;  4JYA J;  2HHH J;  4DR6 J;  4JI0 J;  4GKK J;  4DR2 J;  4DV6 J;  4LF9 J;  5IT9 U;  4B3R J;  2VQF J;  3D3C J;  2UUB J;  1FJG J;  2UXC J;  1IBM J;  3T1H J;  5LMN J;  4AQY J; 
#chains in the Genus database with same CATH topology
 3FRZ A;  4QIG A;  3BJY A;  1DUR A;  2GV1 A;  3D54 A;  5DDO C;  1G2E A;  3NL0 A;  3ELH A;  3VAM A;  3UDL A;  1FI4 A;  3DLK A;  4ECS A;  2RS2 A;  2D41 A;  1RT4 B;  2QYG A;  4DV3 F;  3MD3 A;  3R7B B;  1FJE B;  3VCD A;  4YB1 P;  1ZYQ A;  4DS4 A;  4DPY A;  3G8S A;  3ULH A;  4OHZ A;  1PYO B;  2NRE A;  2JOQ A;  3GJT B;  4MJK A;  3MMB B;  3N28 A;  2F40 A;  3TVK A;  2BA9 A;  2IJR A;  4ZPD A;  1UL3 A;  3S01 A;  2XI3 A;  4B9M A;  2XSJ A;  5D4O A;  5DZ7 A;  2CNN B;  2ZM6 J;  4B3M J;  5HMZ A;  4LR8 A;  2BR0 A;  1FRH A;  3D1Q A;  2H5I B;  2UUA J;  3H40 A;  3W61 A;  2LCW A;  3FGV A;  1JK9 B;  4X2B A;  3DYA B;  3MM5 B;  4USV A;  2A1B A;  1UCN A;  2M7S A;  3QLH A;  1AFI A;  3ET6 B;  3I4P A;  2YH1 A;  2CPI A;  3GIK A;  3RGI A;  2DVI A;  2QMW A;  3TA0 A;  4PWD A;  4DF4 A;  1MN9 A;  3R5A A;  2GVZ A;  2ZUA A;  4DSF A;  3JYT B;  5T7L B;  1RSC A;  1NBE B;  2XUL A;  1Z2Z A;  2K7J A;  2IC3 B;  2F8E X;  1HHS A;  3DLJ A;  1F9H A;  1RTD B;  1AUS L;  1FKP B;  1X5P A;  1DY3 A;  3J80 Y;  2POK A;  4HHU A;  4UOC A;  4NXM J;  1TU0 B;  3AXM A;  2VG6 B;  2DR8 A;  1F3V A;  3CSK A;  2QX0 A;  4DV5 J;  3NGU A;  4QZV B;  2AYG A;  1RAD B;  4OL8 A;  2BOP A;  1NJZ A;  2DXF A;  2QGF B;  2CVI A;  2KFY A;  1C1B B;  2XQC A;  3SMZ A;  3MMA A;  1UVK A;  2D3U A;  4ZDN A;  3ETO A;  3VVU A;  3IRX A;  1GXU A;  3E01 A;  4PG8 A;  5J2P A;  2H51 B;  2DNK A;  3W5Y A;  4RX6 A;  3R5J B;  1U09 A;  1JKH A;  3J7Z 5;  1FD2 A;  2WON B;  1VHF A;  3CJ0 A;  4P7V A;  1Z1Z A;  3OSN A;  5I3U B;  1FXL A;  1QJH A;  3WHI A;  2R42 A;  2RJZ A;  4RBV A;  4O0N A;  4OV1 A;  3T1H J;  4IFV A;  2NPF A;  4D3H A;  5ETL A;  3T5H A;  1N8R T;  1H2T Z;  3QGI A;  2B3T B;  2HHQ A;  3KK2 A;  3HFV A;  3KK3 A;  3ZTP A;  1FWK A;  1K8A T;  1RWV B;  2J8S A;  3HF5 A;  2COL A;  1XMO F;  2ROG A;  2C42 A;  4IOC Q;  1WC1 A;  3W2W A;  1RTI B;  1AA1 B;  3PRB A;  1RAH B;  1SBR A;  2MLX A;  4B3T F;  1PJ7 A;  3DRS A;  1N5V A;  3BH6 B;  1JLG A;  2VG7 B;  2M4M A;  4B02 A;  3OTD A;  1KD1 T;  3OFF A;  1WTF A;  2HQI A;  4P2X A;  2WCX A;  4J9U E;  3K89 A;  3P5T L;  3LO3 A;  1BHN A;  3UR3 C;  2NXN A;  2ZNY A;  1L3K A;  1RTZ A;  1S76 D;  3AJD A;  1YJT A;  2W9C A;  2BJ7 A;  4LR7 A;  2R7U A;  5A6W A;  4M5D B;  3DRX A;  2SXL A;  1PC5 A;  4ZJO A;  2VB6 A;  4HHJ A;  1B7F A;  2BJ8 A;  2O3D A;  2ZH5 A;  2XHC A;  1HQU B;  1WI8 A;  5ETQ A;  1D8Y A;  4JP8 A;  3KHL A;  1GMW A;  1MU2 B;  2E1C A;  4O4G B;  4Q43 A;  1U1Q A;  3D2W A;  1RWO B;  4ZJL A;  2W7A A;  4EBD A;  3T9Z A;  2VFV A;  4IRK A;  2Y8W A;  2V67 A;  4J5O A;  3V4M A;  4HAC B;  4M5L A;  4PEO A;  2YQ1 A;  4LSL B;  4QWA A;  1L3T A;  1U2C A;  1Q1K A;  4A8Y A;  1ELO A;  3C2P A;  2HHS A;  1WC6 A;  1PO6 A;  2CG8 A;  3IWX A;  4WIQ A;  2VOO A;  2IBK A;  3DGP B;  1SH2 A;  3LTO A;  2E5L F;  1TFY A;  2MQP A;  2ZH4 A;  3VAJ A;  2PN6 A;  3GII A;  2DHG A;  4G1I A;  4Q2L A;  4DSE A;  2JZ5 A;  3C3L A;  1S7I A;  2FJW A;  3GYN A;  4MKA A;  2CQP A;  2EFQ A;  4I7F A;  2XMW A;  2GA7 A;  5GAE I;  2V9W A;  2WTF A;  2NLW A;  4WU3 A;  3NMR A;  1B0T A;  1EX8 A;  3FK4 A;  3M8P A;  3MUM P;  5IS2 A;  4I69 A;  4OMF G;  2LLZ A;  2RUG A;  4P2S A;  4MAK A;  3M9N B;  5CD4 A;  4X4T A;  3IBC B;  4K0K F;  4A8Q A;  2W2M P;  2YKQ A;  4ED5 A;  2RAQ A;  2HS3 A;  2BV3 A;  1WEZ A;  2MY7 A;  3GIJ A;  4FNH A;  2CPE A;  1X4D A;  1TUG B;  2D3O R;  2BYC A;  3VGV A;  1EQ0 A;  4PWU A;  4DPW A;  1ZBT A;  4X66 J;  1SKR A;  2H9Z A;  5AE3 A;  3HVT B;  1YZ7 A;  2ZBI A;  4M5H A;  3PW5 A;  2LDY A;  5F8G A;  2RNE A;  3Q23 A;  3K2Y A;  1WOP A;  2DIS A;  4AXJ A;  3MR2 A;  4ECR A;  4ZVQ B;  5KFE A;  4I2Q A;  5HAO A;  3GMG A;  4DR6 F;  4OZ2 A;  5LT5 A;  4WPA A;  2X3D A;  2WK4 A;  1ITP A;  4RNO A;  3I82 A;  2W7P A;  2HNY B;  1SQF A;  3BM7 A;  3WDO A;  4CLL A;  2GZO A;  2YWE A;  2CPX A;  3DLH A;  2KN4 A;  4DV6 J;  3K5O A;  1XER A;  1BQN A;  2VOD A;  3NNA A;  3PIP Q;  3BGR A;  2HLU A;  1IKW B;  1MWY A;  3HCX A;  3QT7 A;  1ZS6 A;  2B8Q A;  5H9E K;  2GAH C;  3BR8 A;  1VBX A;  2ROP A;  5EX0 A;  4MK8 A;  2UUC J;  1YI2 S;  3T5J A;  1RE1 B;  4QW9 A;  1UFK A;  2X7I A;  3QFH A;  2BRL A;  2IM3 A;  5EWG A;  3M8Y A;  3Q0A A;  4Z37 A;  3OJU A;  2BKO A;  4PYA A;  3BYR A;  3J7Z T;  2KO1 A;  4BC9 A;  4LBP A;  5A8W A;  4PRF A;  2J6T A;  3UQS A;  3O2I A;  2FC8 A;  3PW2 A;  1LK5 A;  2KTQ A;  2PO4 A;  5F8M A;  2IDL A;  5D0G A;  2C3O A;  4Y3C A;  2EG2 A;  1FX2 A;  2GQ2 A;  3V4I A;  5HP1 A;  2ZBQ A;  2R7X A;  2X1F A;  1YVF A;  2J7K A;  4P52 A;  2J9E A;  2ZH9 A;  1Y11 A;  2E1A A;  4YB7 A;  2H3E B;  3B82 A;  5C5J A;  3I9Z A;  2LQ5 A;  4IRD A;  1R0A B;  2MKI A;  1JB0 C;  3H4B A;  3W62 A;  4GVB B;  2J9D A;  1NLK L;  1UVM A;  4MKV A;  4OFZ A;  4C0H A;  1HIY A;  2E9T A;  3KUG A;  2DCU B;  2DY1 A;  3BSN A;  3D0I E;  4NLY A;  4WTY A;  3PHE A;  5C42 B;  5H9F J;  1KRP A;  2VF3 A;  3P3D A;  2QA2 A;  3KK1 A;  3T19 A;  4LRE A;  3OL7 A;  2R7R A;  2C2D A;  2XMM A;  1C0T A;  2QIF A;  1QE1 B;  4RW4 A;  2R8J A;  3ZZT A;  2MKJ A;  2H1Y A;  4NOH A;  2P2C B;  3BKT A;  1RYR A;  2H4W B;  3M9O B;  4DI6 A;  1HNX J;  1K44 A;  2RS8 A;  3AT1 B;  1N56 A;  1RBL A;  1K0V A;  1T9Y A;  1HYS A;  5BXI A;  4DR1 J;  4JYA J;  4JI4 F;  3K17 A;  2CPD A;  4P9S A;  4GO5 X;  2J76 E;  5KFR A;  2OGU A;  4PQU B;  3CE8 A;  2XNQ A;  2IMO A;  3PX0 A;  4Y00 A;  3D6T B;  4AD6 A;  2OD6 A;  2QRR A;  4ETX A;  3C6U A;  2R2T A;  4O3R A;  1FCA A;  2V0N A;  4ED6 A;  1FTC A;  3MTJ A;  2DK2 A;  1XK8 A;  1HNW J;  4DUZ J;  2BJ1 A;  1QTM A;  4Q44 A;  1FKO A;  1VJQ A;  2DT9 A;  1RT4 A;  2Y8Y A;  1ZPW X;  3FSX A;  5D15 A;  3P49 B;  2CQ2 A;  1M5K C;  3I32 A;  4CO5 A;  1VMB A;  3FKB A;  3JQK A;  1YJV A;  2W4C A;  5CYM B;  1TKD A;  2YNG B;  3MUV P;  2ZH6 A;  3MMB A;  2W25 A;  3MCN A;  5B0B A;  4F67 A;  3QT6 A;  4XTT A;  2MHE A;  2RKI B;  2J7U A;  3D6H B;  4J9K A;  1EAR A;  5KT3 A;  1MN7 A;  5B0E A;  1S72 S;  4CNY A;  3FSY A;  1NDL A;  4DJB A;  3OL8 A;  3C46 A;  4EYH B;  5DG8 A;  2LYV A;  2EKY A;  2KH9 A;  1EET B;  3G8T A;  3NBP B;  1SJ4 P;  2YQ3 A;  1LWE B;  4Y2C A;  4P6Q A;  3IXQ A;  1FDD A;  5F8H A;  4FYD A;  3DYA A;  3MM5 A;  2BQR A;  1WNE A;  1URN A;  1PG5 B;  3ZNJ 1;  3H0P A;  4QIV A;  3SBM A;  2FPH X;  1XR7 A;  2N3O A;  2W2P P;  3T1Y F;  1Y3J A;  5LM7 E;  3KOA A;  2FZC B;  4MIW A;  1KVI A;  4U9R A;  1G6B A;  3JYT A;  2MYF A;  4NA2 A;  4RW6 A;  2DEI A;  1IBC B;  4F50 A;  2IC3 A;  2DEJ A;  2V50 A;  3SFU A;  4ZIW A;  1RTD A;  1FKP A;  3DFE A;  4UUW A;  1RIS A;  2HVI A;  2H5E A;  4G1Q B;  1SH3 A;  1NME B;  3LAL A;  4DV3 J;  4KO0 B;  5I42 B;  5GVQ A;  3RTV A;  2VG6 A;  1UTA A;  4LRF A;  5KFJ A;  4X4N A;  5KFK A;  1C1B A;  3AH6 A;  4X4U A;  3M4X A;  1U26 A;  1Q7L B;  3OUY B;  2VAS A;  2O66 A;  1M5V C;  2HHU A;  3D3C J;  1FDN A;  3ZXW A;  4IOB A;  4DZ6 A;  4V19 X;  2HZA A;  2BRK A;  2WON A;  1UVL A;  5GAE U;  1P1T A;  1V3R A;  4OX6 A;  5B0C A;  5I3U A;  4A8K A;  3EUN A;  1LQ9 A;  1S12 A;  3AHP A;  3SCI E;  4LFC J;  3FQL A;  3HT3 A;  4QPX A;  3MR6 A;  2GIQ A;  3AA8 A;  4CI0 B;  1SL2 A;  2X1B A;  3NGR A;  3D3B J;  4QWE A;  4DX5 A;  5J1P A;  4UY8 5;  4IH7 A;  2M8H A;  5F0W A;  5J2N B;  2HYI B;  4A8M P;  1RTI A;  2ASJ A;  3BQ0 A;  1UET A;  1HNV B;  1KKH A;  4ZPB A;  1X4E A;  3BGL A;  2D7S A;  4X4S A;  1KC8 T;  2VG7 A;  4H4M B;  3CDB A;  2XO6 A;  3WBZ A;  1IKY B;  1WKK A;  2IM2 A;  3TQ1 A;  2IHR 1;  4M5D A;  4RW8 B;  2XY6 A;  2MZS A;  1IUJ A;  5KG4 A;  4URG A;  3DI6 B;  5IT9 Y;  2HS0 A;  1TL1 A;  4KRW A;  4XAK A;  2WW4 A;  3LGN A;  3DLE B;  1B7Y B;  1HQU A;  4ZP7 A;  3SSR A;  4P75 A;  2DNN A;  1VDH A;  3PXG a;  3MAA B;  4ANC A;  1UVI A;  1MU2 A;  5DGB A;  4NLG A;  3IC1 A;  3O3L A;  4ZPA A;  2ZJR Q;  2G1H A;  4LR9 A;  4DQS A;  3QBC A;  3QT8 A;  2K06 A;  1UFL A;  3MPW A;  2CPY A;  2DPI A;  2PGC A;  3PJX A;  3G2X A;  2HQG A;  4HAC A;  2NXC A;  3HK2 A;  5CCM A;  3PDN A;  2O5D A;  3KJF B;  1VQ9 S;  1EJ7 L;  1WTB A;  3DGP A;  4B3T J;  4CYU B;  2QN6 B;  3MM7 A;  2ZH8 A;  2CZ4 A;  2BVZ A;  2D3O 1;  2FHJ D;  4NLT A;  1N0U A;  4PKD B;  2QA4 S;  3TAM B;  3D6F B;  1SVD A;  3AFG A;  5HQM A;  1MMD A;  4H4O B;  4A48 A;  3RBE A;  4OX9 F;  4CCH A;  3IGN A;  3QIP B;  4TVA B;  5CYJ A;  5CD4 H;  3M8W A;  2RML A;  2E5I A;  3I5B A;  2FTR A;  2XTJ P;  5LJ3 Y;  2AYE A;  2AHO B;  2GC8 A;  4C6A A;  4QW8 A;  5DDP C;  1SQG A;  3CNQ P;  3GLJ A;  1TKX B;  4DUY F;  2CAD A;  2FQQ B;  3NLC A;  3NXZ A;  4QQB A;  5GAG I;  3OR2 B;  1NK8 A;  1OPI A;  3DRP B;  2ZBR A;  4R5P A;  3GP9 A;  1MWQ A;  1NK7 A;  2P9E A;  2NXJ A;  1D9A A;  5D4P A;  2BJ3 A;  3LP0 B;  2HAF A;  1RBA A;  2DJW A;  3HVT A;  4CRJ A;  2M2B A;  3JTN A;  2E5L J;  4DWI A;  3FRY A;  2HWH A;  3RRK A;  3W2V A;  1T9T A;  3CJ3 A;  1U0S A;  3GFH A;  2VD3 A;  1WF0 A;  2GNK A;  3KG0 A;  3X1L B;  3SI8 A;  2E5G A;  3LPE A;  3DC2 A;  2CJ9 A;  1RHJ B;  1KBR A;  3JB9 k;  2A10 A;  2OPP A;  4M95 A;  1NND A;  3LW5 C;  1RA7 A;  4QU6 A;  4U96 A;  3OFG A;  2HNY A;  2MKS A;  4S0M A;  3B8H A;  2UVW A;  4CLK A;  1Y7P A;  3D9B A;  4RZR A;  4OZ1 A;  3CGI A;  2XS2 A;  4C2M A;  3KJV B;  3R5G A;  3EZO A;  1KVK A;  1VI7 A;  1EHW A;  1R8P A;  1GH8 A;  1IKW A;  4U7U D;  2WVC A;  2O1P A;  3EE3 A;  4DUT A;  2CUY A;  3A8E A;  1FER A;  4QJV A;  2VPZ B;  4UZC A;  1RB0 A;  4WFX A;  2OD4 A;  2VJU A;  4NXN F;  1E6Y B;  1UKU A;  1UVJ A;  2E7V A;  1GMV A;  4LBH A;  4O3O A;  1Z4U A;  4KB7 A;  1APS A;  1KP6 A;  1OQ6 A;  4HTI A;  2Z8Q A;  4YDD B;  3ADA C;  3D6M B;  4WTO B;  1NSP A;  1N36 J;  4ERD A;  3KLV A;  1RAA B;  3M6W A;  1KLN A;  2CQG A;  1IJF B;  4M1K A;  1NDP A;  1U1O A;  1TK0 A;  3NNC A;  1T9U A;  2RUS A;  2WOM B;  1BWV A;  3PFO A;  3KUE A;  2HW3 A;  4FXD A;  2GAG C;  3SEO A;  4DR6 J;  3GFX A;  1TKT B;  2UXB F;  1HBM B;  3W60 A;  2FGC A;  2BAN B;  3V6H A;  2PC6 A;  2YH0 A;  1SKW A;  1UWA A;  3VGT A;  2IYG A;  3Q2S C;  1LWC B;  1N33 F;  4UY8 T;  4OIX A;  2GGP B;  3UR0 A;  2DIT A;  3MM9 B;  4M5G A;  2QSF A;  1WC4 A;  1WC5 A;  3EGW B;  3BGU A;  2PDA A;  3HX9 A;  1UW4 A;  1KFS A;  1PBA A;  3GV8 B;  4KBI A;  1R0A A;  4ELT A;  3QYY A;  2I38 A;  5M2P A;  4ID5 A;  1ZZN A;  4Z7C A;  3FMB A;  5K8M A;  4L3K A;  3PW7 A;  4HTJ A;  4AQY F;  3PRV A;  1FFW B;  1T05 B;  3G6X A;  3OD2 A;  4F4K A;  3QT5 A;  5IV4 A;  5C42 A;  4A46 A;  4NA3 A;  1HAR A;  3OVA A;  2UXC F;  1K9M T;  4RNN A;  2G0I A;  1QE1 A;  3BDE A;  1W7W A;  5LL6 d;  5J1E A;  1CEZ A;  2WB1 D;  4CNZ A;  5CAB A;  5ETP A;  3MTK A;  1TL3 B;  1JX4 A;  1BXN A;  3OPK A;  3A8I A;  3NGK A;  1N52 B;  3CDU A;  4K4T A;  1N32 J;  3ILI A;  4PXE A;  3VQT A;  1B3T A;  1WD6 A;  2GQQ A;  1VQL S;  3H5S A;  3M9M B;  1FEH A;  4URS A;  3JQM A;  2LQ9 A;  1VGY A;  3TNV A;  4PQU A;  2OPS B;  4K8R A;  2JWN A;  4DF8 A;  2XEX A;  2RDD A;  3DRY A;  3OTE A;  1P8G A;  5FLX Y;  3HD2 A;  5DZ6 A;  2XGP A;  3RG6 A;  2MHN A;  2HG4 A;  4JUZ A;  3WQP A;  3CC7 S;  2DGU A;  4MT1 A;  1CC8 A;  1KON A;  3MEG B;  4DXL A;  2BM1 A;  4X62 J;  1I3O B;  3AOC A;  2MLZ A;  2WAQ D;  4HYK A;  4RU9 A;  4GC6 A;  1U4B A;  4I1T A;  1XN9 A;  5KAK A;  3M8R A;  3KFW X;  1CQM A;  5CYM A;  3J7Y U;  2YNG A;  1PCA A;  3IWL A;  2WBM A;  3UDE A;  3A13 A;  2RKI A;  5AJ3 F;  2AP6 A;  1RYS A;  3EPG A;  1R27 B;  4KHP F;  2HFO A;  2CJK A;  1T95 A;  1S6O A;  1SJ1 A;  1EET A;  3IG1 A;  1ZOT A;  2DPJ A;  3THV A;  3NBP A;  1Q86 T;  3HMJ G;  2B9W A;  3J80 U;  3LH2 S;  3THP A;  4O3S A;  1KQF B;  5D0H A;  4DR5 F;  3EVO A;  2VIC A;  2X1A A;  2WSE C;  1QDU B;  9RUB A;  1Y10 A;  1AYE A;  2IVY A;  3SXL A;  3DCA A;  4KT0 C;  3CCE S;  3CJ8 A;  2OAU A;  4ZCK A;  2BXJ A;  4KSE B;  1RGV A;  3AQO A;  5HVH A;  4YS2 A;  5KFF A;  3E8O A;  4IR9 A;  1S1U B;  3D66 A;  2Y1I A;  1C4A A;  5KG1 A;  3EMT A;  3W65 A;  4G1Q A;  2N7Y A;  1D09 B;  1T94 A;  3VV2 B;  5I42 A;  2B5J B;  1JJC B;  2UUB F;  2MQL A;  2HRU A;  4CLS A;  4YR0 A;  4X65 F;  2AWZ A;  3UCG A;  1YJ9 S;  2MZT A;  2JRS A;  3GJQ B;  4X64 J;  3QSY B;  4OI0 A;  2IRU A;  4FYY B;  3SSQ A;  1YG0 A;  1WI6 A;  5BYR A;  1N0V C;  3FEX B;  3BEG B;  2XMU A;  3KMQ A;  3BDP A;  1T03 B;  1HW9 A;  5B7W A;  2DRA A;  2MB0 B;  4G3I A;  1IBL J;  1REV B;  3G86 A;  2VA3 A;  3FBE A;  4JB8 B;  5HRO B;  2L9D A;  1VLY A;  3J81 Y;  2M52 A;  2E9R X;  1B70 B;  3DOK B;  5J1N A;  4R25 A;  2JEG A;  1U6F A;  1FRM A;  5RUB A;  2MSS A;  3PHT A;  5HJX A;  1H72 C;  3CWJ A;  3GG1 A;  4TYA A;  1TFW A;  1YIJ S;  5J2N A;  3D67 A;  4E0D A;  3W8P A;  1O0P A;  2WBR A;  3ZZR A;  1ZM3 A;  2JVO A;  2V2V A;  5GAG U;  3EXY A;  2DRB A;  1EP4 B;  4OZ0 A;  1HNV A;  3ICL A;  4I67 A;  4ZVH A;  4IG0 B;  4ZPT R;  4H4M A;  4DR3 J;  4ED7 A;  1X5S A;  2VKZ G;  4ZS6 A;  2UUT A;  5IC6 B;  1IKY A;  3MMC B;  2FVS A;  2DH7 A;  5KFM A;  3N9U C;  4DSL A;  5KT5 A;  4QYR A;  2LVW A;  3K59 A;  3TEG A;  4RW8 A;  1VRT B;  5J2M B;  1DLO B;  5L1J A;  1FNM A;  1CG2 A;  3DI6 A;  4QIW D;  2V34 A;  2B4U A;  3U1M A;  1VRQ C;  1UWB B;  3CCL S;  1KFD A;  5L9N A;  3V6D B;  3D68 A;  3MAA A;  4A8F A;  2I9S A;  4OHW A;  5SUH A;  2R8K A;  1SKS A;  2FLL A;  3DMJ B;  2CJX B;  1WSR A;  2F8H A;  2C1E B;  2K8G A;  3H2L A;  4ZLJ A;  2UP1 A;  5GAD U;  2MGZ B;  3CJQ A;  3GG0 A;  3MEE B;  1JLE B;  1QLN A;  2KRB A;  4NWB A;  5LMU F;  1NUE A;  1TKZ B;  4N8O A;  1S1V B;  4KR0 B;  3T3F A;  3D4J A;  3QJJ A;  3OW2 R;  2LA4 A;  4CYU A;  3GON A;  4MK7 A;  4RO0 A;  1NHV A;  3KG1 A;  2ZOF A;  4ED2 A;  1FNX H;  4RR5 A;  5C24 A;  1KOO A;  3KLE B;  4TYB A;  4LF5 F;  1G7C B;  3L3C A;  1U6Z A;  5KFX A;  3OLB A;  2QLJ B;  4ATN A;  4H4O A;  3QIP A;  2W01 A;  2FJD B;  1NJX A;  2XCP A;  2J9C A;  1FRI A;  2HRT A;  4OYI A;  3MF5 A;  3DN9 A;  6FD1 A;  1IVZ A;  2K3I A;  2C2K B;  3OFE A;  3MGJ A;  3S1T A;  2KG1 A;  4C97 A;  2B43 A;  3FZB A;  1TKX A;  2DNZ A;  4L76 A;  2ZVI A;  2HGN A;  3ZZ0 A;  3H90 A;  1RT6 B;  3OR2 A;  3DRP A;  2G0C A;  3OV7 A;  3HKZ D;  3M2U B;  2A6O A;  5LJ5 Y;  1H73 A;  4H4K C;  3LP0 A;  4USK A;  3KKF A;  2J8A A;  4PXD A;  4Q5V A;  2U2F A;  1EQM A;  3CIZ A;  5E3A A;  2XWY A;  1FJG J;  2KXF A;  4FPR A;  3I0S B;  3H20 A;  2ZM6 F;  3L4B C;  3KJQ B;  4PPD A;  3MOJ B;  1QSS A;  1Q5V A;  2J0W A;  5AE1 A;  2MST A;  1GEH A;  5F3T A;  4QIF A;  4GKJ J;  1NJW A;  1F6T A;  1HBU B;  4TNO A;  2Y1L B;  1WSV A;  2E1R A;  4X4O A;  2FZG B;  3KJV A;  4K5S A;  3AA9 A;  3EX7 B;  4YME A;  2UV8 A;  4M5M A;  3TZY A;  4DUY J;  1QAJ A;  4FYW B;  1W26 A;  3DU5 A;  5E3R A;  3L7O A;  2FGO A;  3AD9 C;  4L3N A;  2XY7 A;  2ACM A;  3SFG A;  2B7B B;  1C2P A;  1E6Y A;  4LF2 A;  2K1R B;  3UPF A;  1CJV B;  4FN5 A;  2NSB A;  4DQI A;  4XO0 A;  1PYT A;  4NLQ A;  3E2E A;  3K0J A;  4DV5 F;  4WBF A;  3FCW A;  1Q5Y A;  3M30 B;  1X9S A;  2HHH J;  1S4E A;  3D5M A;  2W7O A;  1P9Q C;  1SI9 A;  1PJ5 A;  2UVV A;  3CDW A;  3R8Y A;  2WOM A;  2XSJ B;  2FVC A;  2ZD1 B;  1SQE A;  4LF4 F;  3MR7 A;  2VL1 A;  2HVD A;  4K2J A;  3R6G B;  1TKT A;  1R0B G;  1HBM A;  3GSI A;  4C9D A;  1RTJ B;  4UOH A;  2C2R A;  4Q7A A;  2R8I A;  5KFB A;  4ZHR B;  4ECW A;  3G6E S;  3H59 A;  5IQQ A;  1W2I A;  2GML A;  3MOZ A;  1FK9 B;  3SSS A;  2PI4 A;  2C3Y A;  2VBW A;  4AL6 A;  5MAO A;  1LWC A;  4MFB A;  5L9X A;  5KFP A;  2HEK A;  4AL5 A;  1NKB A;  1YSJ A;  4P71 A;  3MM9 A;  4ZVR B;  2OUG A;  1X9W A;  2QLW A;  1RU2 A;  3GZ7 A;  1U45 A;  5IQ6 A;  2L41 A;  2EC0 A;  4K4Z A;  1LEO A;  2H65 B;  1ZET A;  3SDE B;  3Q8U A;  1AB8 A;  2KJW A;  2LQ8 A;  3WIV A;  5GMK a;  5KT6 A;  5AXL A;  4J37 A;  4NXN J;  1K47 A;  3UO0 A;  2V2K A;  3RRH A;  1X4C A;  4OI2 A;  3F41 A;  4ZOS A;  5D3G B;  1BUX A;  3QFW A;  1T05 A;  3HFZ B;  1NK6 A;  4P10 A;  3JTP A;  3HVR A;  3GYG A;  5HVG A;  1GK8 A;  4LSZ B;  3CJS A;  1GFW B;  5IOL A;  3IRW P;  2ERR A;  3OTO F;  3RBZ A;  4K50 A;  4RWW A;  2UXB J;  1TL3 A;  3OFH A;  4B3S F;  4ZVO B;  5J2P B;  2AMC B;  4CM2 A;  2CJY B;  4KYZ A;  3NS5 A;  1VQ7 S;  2CRL A;  2I1R A;  1Q0N A;  1J2V A;  4OI4 A;  1JXE A;  4QWC A;  1N33 J;  2CNK B;  1KSP A;  2JEF A;  4I6W A;  3C19 A;  3J7A N;  1R7I A;  4O3Q A;  2GJF A;  3V2U C;  1S9G B;  3CT9 A;  2OLW A;  4CH0 S;  5CXT A;  2OPS A;  4KH0 B;  4ED4 A;  1VBY A;  1MG7 A;  1SKU B;  1ZM4 A;  5K9F A;  5B09 A;  2ILZ A;  4PUO B;  1VQY A;  1OS5 A;  3S8S A;  4ZPV R;  3NAH A;  3ENA A;  2WSC C;  1ARO P;  3TRG A;  3VF0 B;  1S4F A;  1SC1 B;  1J27 A;  4WFY A;  3FQK A;  3MEG A;  3TAN A;  5GME A;  5E5N A;  4L73 A;  4PCQ A;  2NCK L;  1QAX A;  1IXK A;  4PG7 A;  2LQB A;  5AXK A;  1U8W A;  2UXC J;  4LT6 A;  1QUV A;  3PCO B;  1XR6 A;  4YHH F;  5KG0 A;  3P4U B;  1LK7 A;  4QPT A;  2ALY B;  2KHC A;  4Q2M A;  3BN4 A;  2XZD B;  3HJV A;  1WOR A;  5HAN A;  1U8S A;  1HNI A;  2FUG 9;  2AJ0 A;  1DAR A;  1FD8 A;  3NCR A;  2V8V A;  1UZH A;  3L9Z A;  2EK1 A;  3V6J A;  4NML A;  3P45 B;  4LRC A;  1A0O B;  1IJE B;  2EC2 A;  1K1S A;  3TO8 A;  2P5V A;  1H6K X;  3MI7 X;  5KFU A;  3BSC A;  5F0U A;  1IKX B;  5F8L A;  2F4V J;  3PVX A;  2ZKT A;  4Y65 A;  2HBZ B;  2PSZ A;  5ETT A;  5KFL A;  1K0T A;  1YRU A;  4Y0F A;  2HZV A;  1XR5 A;  4JI0 F;  1S1W B;  5HI7 A;  1HI8 A;  1FEE A;  1T8E A;  3W9J A;  1S1U A;  2NUH A;  2FC9 A;  4M5I A;  5KFV A;  2HKE A;  3FDS A;  2R7O A;  4HI2 A;  4JV0 A;  1T11 A;  2KVI A;  2C3U A;  2B5J A;  1HD0 A;  1SUQ B;  1YDL A;  2BAC A;  1RAC B;  2HPU A;  3TJ8 A;  2W2O P;  3DHW C;  4C8O A;  5AJ3 J;  3B54 A;  1JMT A;  1KWM A;  4ZN1 A;  2PMZ D;  4XPE A;  4J9S A;  4DCJ B;  4KHP J;  2IAJ A;  3IR7 B;  2FB0 A;  4ZLN A;  4WFB Q;  1VQM S;  1NKC A;  2ACY A;  2XHW A;  1T03 A;  3L95 X;  3RW6 A;  1U25 A;  2ZNZ A;  3HHL C;  5BYS A;  2MMY A;  2EFN A;  3UW1 A;  3UN3 A;  1U24 A;  3K5P A;  4DR5 J;  3HT0 A;  1HBN B;  1WHY A;  2LKZ A;  3DLL Q;  5HRO A;  2AD9 A;  4WII A;  4DV7 J;  1TVR B;  3DOK A;  2R7T A;  2RDI A;  1HWK A;  4DV1 J;  3ILL A;  3HPO A;  2VZ9 A;  2JJ4 D;  1ZAW A;  1FRK A;  3N79 A;  2J0X A;  3KLI A;  3SV4 A;  7FD1 A;  4NLP A;  4ZMM A;  3DM2 A;  2JLE A;  3A4T A;  3CC2 S;  4LFA F;  2Q6B A;  2A6M A;  2AJQ A;  5IT9 U;  4URQ U;  1CJU A;  4DLG A;  2UUB J;  1EP4 A;  1S77 D;  1WC3 A;  4X65 J;  4U8V A;  2F9J A;  1S6P A;  2ATC B;  4I2Q B;  2YVS A;  4B9S A;  4BWM A;  1XWL A;  2HFV A;  1SL0 A;  1XTZ A;  1WG5 A;  4B9U A;  3HHL B;  2YTC A;  1VBK A;  1RAJ A;  3TJA A;  4LFB J;  3HVA A;  4JI2 F;  2XS5 A;  1CJT B;  1RKJ A;  2FY1 A;  3LA0 A;  1VRT A;  2KHD A;  3UN2 A;  5J2M A;  4AT1 B;  1FWP A;  3MAH A;  4F8R A;  5B08 A;  3V6D A;  4P7T A;  1O6X A;  3TA2 A;  4OYX A;  1ACM B;  5DQH A;  4FXW A;  3DRR A;  3X3U A;  5F9N A;  1FRJ A;  5K8N A;  3DMJ A;  4HH0 A;  4Z2X A;  3CW2 C;  1L5U A;  3RB3 A;  1YZ6 A;  4ZCL A;  3IMQ J;  3NKY A;  4NLO A;  1VRU B;  2MGZ A;  3HHE A;  1VQP S;  3SV3 A;  3MEE A;  1H7W A;  2R3V A;  1JLE A;  4PYD A;  1TKZ A;  1KQS R;  1MNE A;  3PFE A;  3TX0 A;  1S1V A;  1RAB B;  3CJT A;  3CMA S;  1B4S A;  3CXC R;  2RRB A;  1GXT A;  2NR0 A;  1R0C B;  2I6W A;  2Z2Y B;  1HNX F;  2OMO A;  4JOU A;  2M9K A;  1WDD A;  2KRR A;  4U7U K;  3MPU B;  3GR1 A;  2ZWP A;  3I4H X;  5SZT A;  4YQW A;  4DFK A;  2B6A B;  1RCO B;  4N56 A;  5HP1 B;  4WK1 A;  3BKF A;  2GVD B;  5KFO A;  3TVY A;  2MDA A;  1YHQ S;  1XC9 A;  8AT1 B;  3O1L A;  1NH7 A;  2OEM A;  2C2O B;  4DV0 F;  3OVS A;  1Q53 A;  2V2Q A;  5IV3 A;  1EAY C;  3C6T A;  2LA6 A;  1R3N A;  1AFJ A;  4FP9 A;  3G82 B;  4LQ9 A;  2GHV C;  3RB0 A;  3HHL D;  4NYP A;  1RT6 A;  3OBI A;  1RU1 A;  4OYA A;  5LMU J;  4F04 B;  3M2U A;  5JXS A;  3GR0 A;  2E9Z A;  2MXY A;  2EFP A;  3OXL A;  2IBO A;  3TAQ A;  1FDB A;  2BW7 A;  2Y3Y A;  1NSA A;  5L1L A;  3ZTQ A;  2P6T A;  1C0T B;  2YWH A;  1F3F A;  2W8K A;  1KR4 A;  2CKW A;  2CPJ A;  2IM1 A;  4DL5 A;  5CCL A;  4LF5 J;  2GO9 A;  4OX8 A;  4JV5 F;  4CLF A;  4CH7 A;  3BZQ A;  3UDC A;  3I0S A;  3Q24 A;  2MTL A;  2JLG A;  4F0K A;  2PEH A;  3R2C J;  8RUC A;  1HHQ A;  1XNR F;  3LGM A;  4C0O C;  3FZ2 A;  4YN3 B;  2AJ1 A;  4DU7 A;  1HBU A;  1U2R A;  1SV5 B;  2B7C B;  4DX8 H;  4WFN Q;  4YB6 A;  1S97 A;  5D6G A;  1JLC B;  4P73 A;  4ES3 A;  2HRY A;  5ETN A;  1VIS A;  2DNL A;  3WZ0 A;  1VR6 A;  4K4V A;  5F3Z A;  3HZG A;  2KJV A;  1BQM B;  3C6U B;  3PAC A;  4H4K A;  4M5J A;  3DOM A;  3Q2T C;  3MM6 B;  2QMX A;  5H9F K;  2Y1R I;  2Z2Z A;  2KFN A;  1QVF R;  5GMD A;  2OPQ A;  4I68 A;  3GIL A;  4F36 A;  2YX7 A;  4ECU A;  2K1R A;  4KFB B;  2ZBC A;  4OHY A;  1CJV A;  1FKO B;  2VJV A;  4Q8E A;  3QWU A;  5K8O A;  4RUB A;  3D28 A;  3POT B;  3A12 A;  4AE5 A;  3ZNU A;  4DR4 J;  3M30 A;  3BR9 A;  2HFZ A;  5DJB A;  1NZA A;  1VHI A;  3M6V A;  3A8K A;  2UXD F;  5IZH A;  1S0N A;  4OYO A;  4J7C A;  2IJN A;  3PNI A;  2KXN B;  2ZD1 A;  3W66 A;  3EVW A;  2AX1 A;  4DFM A;  2BE2 A;  3ENW A;  1RTJ A;  1KHW A;  1D8Z A;  4DPO A;  1FES A;  2XYG B;  3EWG A;  4ZHR A;  2LXI A;  2BE9 B;  1FK9 A;  2V8P A;  4YFU A;  3HHD A;  2WZ1 A;  5DO2 A;  1IWG A;  3BGF A;  5E3Q A;  4NEY A;  3OXG A;  1LWF B;  4K7Q A;  4LFC F;  2PD1 A;  1O51 A;  2EPI A;  1IR1 A;  3V81 B;  1DQ8 A;  1RT2 B;  4RW6 B;  3SDE A;  3ZO7 A;  4EO8 A;  4K59 A;  1CVJ A;  3N0V A;  2RDJ A;  3GYX B;  2KFZ A;  4NRU A;  2JEI A;  2V2Z A;  3CCW A;  1YBT A;  4ID8 A;  1XIQ A;  2YWK A;  3RBD A;  3FEY B;  5D3G A;  2CQ0 A;  3QJP A;  5G4D A;  2MQM A;  3IM8 A;  3R1H A;  2GJ2 A;  1OYE A;  2KT2 A;  7FDR A;  1RAF B;  5L39 A;  1MMN A;  5H1S V;  3AB4 B;  2LP4 A;  3J81 j;  2GCF A;  4ELV A;  2L48 A;  4NLW A;  4B17 A;  4UOF A;  4LF4 J;  1L3S A;  2ASD A;  2BZ2 A;  2HGL A;  3HFK A;  4HVZ A;  4ER8 A;  3IAM 9;  1LWX A;  1GAO A;  4ECY A;  4A8X A;  2RRN A;  2CG4 A;  3GCW P;  2YXL A;  4F4Y A;  1HFE L;  2Q66 A;  2PMW A;  3H98 A;  4WYW A;  3LWM A;  2GX8 A;  4R8U B;  1D1U A;  4RUC A;  3WIU A;  2P9C A;  1T02 A;  3O44 A;  1ZAV A;  3K58 A;  4K4X A;  4W92 B;  4HKQ A;  2CAJ A;  3JXO A;  2EG1 A;  4USU A;  4B9N A;  1S9G A;  3MEK A;  2DH9 A;  4DFP A;  4IKA A;  3HHN B;  3C8Y A;  4C0B A;  1HR0 F;  1S0O A;  4RL1 A;  4PUO A;  3A8J A;  1PYS B;  1Q7Y T;  5A2Q Y;  3TZX A;  4AYB D;  1X4B A;  5G0R B;  2AT1 B;  2YY3 A;  1U1N A;  1FRX A;  4M63 A;  4FF3 A;  4ETZ A;  3N6M A;  4CP5 A;  4TY9 A;  1AT1 B;  1JJH A;  2IA6 A;  4CH1 A;  2ZFH A;  1XJW B;  3MED B;  5T14 A;  4ILM A;  3OTO J;  3THT A;  2DIU A;  4ITS A;  1PKU A;  4B9L A;  2NXU A;  2C2M B;  4KGM A;  5JUM A;  2P9G A;  2KT3 A;  4PAA A;  4B3S J;  2KXH A;  2PA3 A;  2Z2L A;  4E8U A;  1NHK L;  2GW8 A;  2HIQ A;  3WX8 A;  1TL1 B;  3K5M A;  4QCL A;  1GX5 A;  4HDG A;  1HD1 A;  4O4R A;  3EDQ B;  4GMK A;  3SIP B;  4F4A A;  5CA5 A;  2FLN A;  5E3P A;  5ETK A;  4OHX A;  4DMZ A;  2V6A A;  2ZWO A;  2UUW A;  4EGL A;  1IKX A;  4KPC A;  1CBK A;  1HWJ A;  2XSF A;  3GPA A;  3U1N A;  1AXQ A;  1S7H A;  3BRE A;  1S1W A;  4R0E A;  4F4Z A;  1T3O A;  1R31 A;  1U1R A;  1YGY A;  1SC6 A;  3RU0 A;  2F65 A;  2MZJ A;  4KE5 A;  3CUN A;  1I94 F;  3MM7 B;  2CQD A;  3MFH A;  4MTP A;  1WG1 A;  3CJ2 A;  1SUQ A;  3BF4 A;  4C8K A;  3CCU S;  1S99 A;  3AJ2 A;  2D9O A;  1HWL A;  3LP1 B;  3R2D J;  4YHH J;  3D1H A;  3OT9 A;  1VQN S;  5HLF A;  1Y00 A;  2GMH A;  3QJL A;  5L8R C;  1V3S A;  1L3V A;  4DU8 A;  3H7H B;  2DHS A;  3BPS P;  3B4D A;  4I64 A;  3EPI A;  3TI0 A;  4ZLP A;  2M3D A;  4AXI A;  1RHU B;  1RLD A;  1HWI A;  3MD1 A;  4X4R A;  2AF6 A;  3GV7 B;  2X3G A;  4DR2 F;  2VFU A;  1HBN A;  3QAT A;  1AW0 A;  1VBZ A;  1TVR A;  5IT0 A;  4JI0 J;  2D3Z A;  4R5P B;  1VOM A;  3VHQ A;  3TQE A;  4IYQ A;  3EGZ A;  3Q22 A;  2XMT A;  2Z30 B;  3ITH B;  3CO0 P;  4C8M A;  2MEW A;  1LKZ A;  3W2V B;  3DLB A;  1N36 F;  1QVG R;  3JSM B;  3US5 A;  2OPR A;  4LF6 J;  3PJW A;  2FHO B;  5K20 B;  1P6T A;  3CCR S;  3KNA A;  5D4L A;  2Q6C A;  4OYP A;  8ATC B;  5AE2 A;  2F1F A;  4I4B A;  3NAI A;  2MLY A;  3A3N B;  5IC4 B;  1GMU A;  1T0T V;  3T5K A;  1RAI B;  1N5Y B;  1OIA A;  1OY8 A;  2OPP B;  5IT4 A;  1FFG B;  3KLG B;  5DET A;  3HHL A;  1EIY B;  5KFZ A;  3JAM Y;  1FTR A;  2CQB A;  2GMJ A;  4N8N A;  3IBW A;  1CJT A;  1QUP A;  1JLA B;  4J9N A;  1BE4 A;  3BN7 A;  1CC7 A;  2BQU A;  3PRD A;  5KFH A;  5KFC A;  1XBW A;  4WJB A;  2QL7 B;  5KT4 A;  1GNK A;  5KG7 A;  2HFS A;  2E44 A;  2C3P A;  3UD4 P;  1UPM B;  3K5N A;  3ENV A;  3CJK B;  2HQC A;  4CTA B;  4ANE A;  2NUU G;  5KFT A;  3PY8 A;  5L1I A;  1W2B R;  1H2U X;  2J9D E;  2MZQ A;  2G9O A;  3TW0 A;  3M6U A;  1VRU A;  2KDO A;  2KYZ A;  2OTJ S;  3FJ2 A;  4NLS A;  2EK6 A;  2YNF B;  4D3G A;  5DLG A;  5KT7 A;  1PC4 A;  5IXU A;  4LVN P;  4LFA J;  3OR1 B;  4NMX A;  3QQC D;  3M2R B;  4F0M A;  5DG9 A;  3BQ2 A;  3NP5 A;  4ZVU B;  3RB6 A;  5FD1 A;  1U2F A;  3I5A A;  3OLA A;  5A0Y A;  3PW4 A;  1BGX T;  4USW A;  2ZBP A;  3QGG A;  3G6V A;  2O67 A;  1JNR B;  2CVE A;  2FLO A;  3RBX A;  3LP2 B;  2WVE A;  4BS2 A;  2JLF A;  2RVJ A;  2CNO B;  4JV2 A;  3QO9 B;  2JC1 A;  4JI2 J;  3C16 B;  1N32 F;  3EZ5 A;  2DD8 S;  3R97 A;  1X60 A;  2KZZ A;  4BC7 A;  2B6A A;  3MMJ A;  2GVD A;  5KTQ A;  2DBB A;  1KTQ A;  4WE1 B;  2LEP A;  4IRC A;  4DPU A;  3Q8V A;  1MLA A;  2VV5 A;  1M90 T;  1PBU A;  3M05 A;  1X31 C;  4U7C A;  5HMY A;  4ID5 B;  4EU0 A;  2HMI B;  4NYZ A;  2OHD A;  2VUG A;  3G82 A;  3HP6 A;  2JVR A;  3H5U A;  1NDK A;  2PFD A;  5L38 A;  4DN9 A;  4G1P A;  2DIV A;  4LRB A;  4CO4 A;  4X62 F;  2WVB A;  5B0G A;  4BCA A;  4KV8 B;  4ENO A;  1FNO A;  2VG5 B;  2UZA A;  4M94 A;  3ETM A;  4IH6 A;  3G6Y A;  4EUV A;  4W90 B;  5J1E B;  4NI2 B;  1R8C A;  2A3J A;  2ZIT A;  2RU9 A;  2MPU A;  4DQP A;  3OVB A;  1NJI T;  4WZQ A;  5K8P A;  1FKA F;  1X4G A;  2UU9 F;  4E98 A;  1ZA1 B;  3VQS A;  2PMH A;  1WF1 A;  4J9V A;  2FVQ A;  1SJ3 P;  3HSJ A;  2VQF F;  2QG9 B;  2DR5 A;  4OZL A;  4LF7 J;  3OL6 A;  1S6U A;  2CFX A;  1GX6 A;  2HIY A;  1SV5 A;  4DQQ A;  4DV0 J;  1JLC A;  4U95 A;  3P5B P;  1VQ4 S;  4LF9 J;  3FCV A;  3G8Q A;  1D0E A;  1BQM A;  5HQ8 A;  3HO1 A;  2NSC A;  5F8N A;  3TEH B;  2CQ3 A;  3MM6 A;  2MQO A;  4KFB A;  1Q82 T;  3ZTO A;  2DYA A;  4IQM A;  3RW7 A;  4C11 B;  2BJD A;  2R8H A;  3FSI A;  4DX7 A;  4PG6 A;  3HVW A;  1YIT S;  3CCT A;  2NXE A;  3POT A;  4IFY A;  2U1A A;  1FRL A;  6AT1 B;  2MQN A;  4C8L A;  3LF0 A;  5F9L A;  3N6L A;  4M8L A;  4X64 F;  3PKY A;  4WP3 A;  1U1L A;  2XMV A;  1GMW D;  4JV5 J;  3ZZU A;  1NU4 A;  1OO0 B;  2RT3 A;  2VU5 A;  1NXI A;  5LOQ A;  4IR1 A;  4MK9 A;  4F3M A;  3G71 S;  3T1A A;  4IG3 B;  2DHX A;  2J5A A;  4LF8 F;  2YKP A;  3IG1 B;  2H48 B;  4J9Q A;  4F3Q A;  2DNG A;  1XNR J;  2Q79 A;  2W2Q P;  4KGX B;  1IBL F;  2CXE A;  1OY6 A;  4NEZ A;  3KMS A;  3HM9 A;  1ZM2 A;  3ZTS A;  3AOD A;  3EIC A;  3OTB A;  3GFY A;  1S10 A;  2DGT A;  1N4L A;  2PFF B;  2CDR B;  1RBO B;  1LWF A;  3ZFV A;  4OZN A;  2LXU A;  2R4F A;  2PEB A;  3DDK A;  3V81 A;  1N48 A;  4EFA C;  4IO1 A;  5M2U A;  5EWE A;  1BQX A;  1RT2 A;  1RUS A;  1R6V A;  2OEK A;  5C25 B;  3T5L A;  3UCU P;  2JSX A;  2G2Z A;  1Q95 G;  4OJH A;  1X0F A;  1CSJ A;  2XZT B;  3CC4 S;  1EKS A;  1JLB B;  3M32 B;  5B0D A;  2NQP A;  4WZM A;  2JL9 A;  1ZM9 A;  2IFX A;  3VAL A;  1VQK S;  4DR3 F;  3U02 A;  1TP7 A;  2Y0B B;  4EBC A;  3K57 A;  3J7A 1;  2UXD J;  2OJ3 A;  4K4W A;  3H2U B;  2HHP A;  3PJ9 A;  1RHQ B;  4C8N A;  4QIE A;  1NHU A;  4QR0 A;  2AQ4 A;  2DGV A;  4R8U A;  2CJB A;  1HQ2 A;  3CED A;  3PEJ A;  3JS9 A;  4FBU A;  4LBI A;  3CVK A;  2DNO A;  4DL7 A;  3DHX A;  3CCS S;  3NWG A;  5IWA F;  2VC1 A;  4HDH A;  4CQ1 A;  3I56 S;  2DB1 A;  2X1G A;  3GSD A;  1QAI A;  3BS9 A;  1X4F A;  2EFG A;  1H0H B;  5JJB A;  3GIM A;  3J7Y I;  2GS8 A;  1LXN A;  5CH7 B;  5G0R A;  2B9Y A;  1SB6 A;  2XLI A;  3RAQ A;  3ZZY A;  1NK4 A;  1ROF A;  1VC0 A;  3BGO P;  3MR3 A;  2DH8 A;  2YKN A;  4UZB A;  2F4F A;  3TVZ A;  4I0W A;  1R8B A;  4DV4 F;  3MED A;  1YKW A;  5C7P A;  3TJ9 A;  4MH8 A;  4ZIV A;  1ULR A;  2W1B A;  2BAB A;  3HD1 A;  3I5C A;  3H42 A;  1AZS A;  2FJV A;  5L1K A;  5HL7 Q;  1H7X A;  3SCL E;  4TU9 A;  1JIH A;  2IM0 A;  3BBC A;  1Y4Z B;  4YDX A;  4EK2 A;  2EEY A;  1S9E B;  2DXE A;  3CTR A;  1LW0 A;  1QSY A;  3N5F A;  5I3P A;  2B56 A;  4HI1 A;  2NZC A;  1RT5 B;  4Q8F A;  2AYM A;  1HR0 J;  2E29 A;  4NE9 C;  3CMQ A;  4ECT A;  1RLC L;  2R7S A;  1VQS A;  3HXM A;  1HPZ B;  1F5B A;  2DHH A;  4I56 A;  1CJK A;  4ZVE A;  2QO3 A;  3A3P B;  1UJ4 A;  1IM6 A;  3AAW B;  4BBY A;  1C1C B;  5HQL A;  1OJ4 A;  1IWA A;  4FKY A;  4JI3 F;  1XMQ F;  4YY3 F;  4Y2K A;  1S5Z A;  1R8A A;  1SC4 B;  2IDE A;  4NPO A;  5I4M A;  3R9L A;  5C24 B;  4KHM A;  1FJG F;  3BO3 A;  5CYQ B;  4ILL A;  3LP1 A;  4GO7 X;  2G2Y A;  1LW2 A;  4EI2 A;  1DFD A;  1GTH A;  4WCE Q;  4J9O A;  3ZC4 A;  1F9E B;  1KNZ A;  4DV2 F;  2K2P A;  2DGO A;  1G3O A;  4NA1 A;  4GKJ F;  4KIA A;  4W4M A;  1S48 A;  3BO2 A;  2UVU A;  1YLX A;  3C15 A;  3ZZP A;  2VA2 A;  3MUT P;  3IS9 B;  2IPO B;  1B99 A;  5D8H B;  2LEA A;  4LF1 A;  1VQO S;  1HWU A;  2ZVS A;  2CQC A;  1NSK L;  1A7G E;  2GQC A;  5HSP A;  1UA0 A;  4DSK A;  5GAH U;  2Z0G A;  3AOB A;  2AW0 A;  3NGT A;  5FDL B;  5KFN A;  3SCK E;  1LFW A;  1KS2 A;  2MKC A;  1N6Q B;  1OYD A;  3R27 A;  4Y2A A;  3ITH A;  1UP1 A;  3NOG A;  2H5J B;  1JXL A;  3UN5 A;  3I9V 9;  2HUR A;  1I94 J;  1WEX A;  3JSM A;  2HHH F;  3SQG B;  2VC0 A;  2VBZ A;  3UVJ B;  1JLQ A;  4NLU A;  2CZ9 A;  1HL6 A;  2WHO A;  1HHT P;  3UWT A;  4X4Q A;  4UUX A;  4FNI A;  4RW9 B;  4E2F B;  1N5Y A;  2IIH A;  3KLG A;  1X0P A;  3CPW R;  2Q3P A;  1TK5 A;  5F8I A;  4MYU A;  4NCG B;  1CUL A;  1KHV A;  4MKB A;  4CLW A;  1JLA A;  5KFQ A;  2ILY A;  2OEJ A;  2XB2 D;  4DX6 A;  4USJ C;  1XNQ F;  5GAD I;  4DR2 J;  1M1G A;  5D0R A;  1JLF A;  4QWB A;  4DSI A;  3IA0 A;  1YJ7 A;  3M8Q B;  3M1V A;  1N88 A;  1I6J A;  3CJK A;  1ICE B;  4CTA A;  2ZZT A;  2C2N A;  3K8W A;  4RW7 B;  1WKJ A;  2KYX A;  4NLV A;  1VK8 A;  2MY8 A;  2NPI A;  5ETM A;  2QL5 B;  3PYF A;  5FII A;  4O44 B;  4HR2 A;  2YNF A;  2RHS B;  3P8B B;  3OR1 A;  3M2R A;  3QRR A;  2KB2 A;  4JI8 F;  4TQR A;  3NRB A;  4NCB A;  5HK4 A;  1IM4 A;  4BLG A;  3H4D A;  1EZZ B;  2VIH A;  4ZPC A;  4KGK A;  3DLG B;  1FA0 A;  3ENQ A;  3W64 A;  1D3W A;  3LP2 A;  4EMD A;  2GHW A;  1U7L A;  1HI1 A;  4NCA A;  5B0F A;  4RUH A;  1OPZ A;  3PV8 A;  3QO9 A;  4FPI A;  3C16 A;  3W7B A;  4USI A;  4ICL B;  5HAT A;  4ZLL A;  3Q8S B;  2B4P A;  4MKY A;  4MFB B;  3O6Q A;  5AXM A;  2VPW B;  1IQZ A;  4WE1 A;  5DLF A;  3UD5 A;  2ZH3 A;  3R6L B;  4FF2 A;  3L7U A;  3LAK A;  1PGZ A;  4JI1 F;  2HMI A;  2DNM A;  2OP5 A;  4ZVG A;  1PAE X;  3CJR A;  2GJI A;  4FS2 A;  2I5J A;  2Z2M A;  1MRO B;  2XY5 A;  4ALZ A;  2AJ2 A;  2R7Q A;  3FBB A;  4KV8 A;  5ETR A;  2QZ8 A;  2HSE B;  4NYO A;  2VG5 A;  4DZD A;  1K1Q A;  2LQJ A;  5ETV A;  1UW9 A;  1H74 A;  2DRD A;  4UW2 A;  3KTQ A;  4NZ7 A;  1YBA A;  4NI2 A;  4I6A A;  3C66 A;  4N76 A;  4JI7 J;  4ILR A;  1CLF A;  1HW8 A;  4M5K A;  4DQR A;  2RU3 A;  2GFF A;  1VK3 A;  3GJS B;  5A8R B;  1H2V Z;  4QYZ J;  2HWI A;  2QC3 A;  4Y2I A;  2NS1 B;  4C7Q A;  1KTV A;  1J5E F;  3IAS 9;  5CZX A;  4ZA1 A;  2KM8 C;  3NS7 B;  1S1T B;  4G6V B;  3MR5 A;  3W8G A;  4BWJ A;  4UTG A;  1DQA A;  1E6V A;  2LXF A;  2F4V F;  2ZDO A;  5DDR C;  3W1Y C;  1NCL A;  1G4C A;  1U1K A;  3GCX P;  1Y5I B;  1EB0 A;  2F3J A;  3M6X A;  4LJM A;  1C0U B;  4CO3 A;  1Q8I A;  1HBO B;  4HT7 A;  5LSL A;  1N5T A;  5LXY A;  4WP9 A;  2Y0S D;  1I1G A;  2ZEJ A;  4C11 A;  1JNZ B;  2MQQ A;  1SCJ B;  4KY3 A;  1RWP B;  1GQE A;  3RRG A;  1S79 A;  4O23 A;  5KFD A;  3EZU A;  2M70 A;  2HNZ B;  4CLP A;  4IUF A;  1B64 A;  1NPK A;  4K5R A;  4GKK F;  1NB7 A;  2DNY A;  2RF2 B;  1B0P A;  1HQE B;  3AY0 A;  3KDN A;  1NM2 A;  2KM8 B;  1HNI B;  1VIO A;  4IG3 A;  2HS4 A;  3OJS A;  2UU9 J;  3JQJ A;  4FF1 A;  2YX4 A;  3GQC A;  4G65 A;  5K14 B;  5LSR A;  2VQF J;  2GIF A;  2I8E A;  4HL9 A;  2CZV C;  4OQJ A;  4DV7 F;  4JV1 A;  1PSD A;  1VQ6 S;  2E5H A;  4DV1 F;  4O3P A;  1YX2 A;  4C3K A;  3TWZ A;  2FD2 A;  5CHC B;  5C25 A;  3F73 A;  2A2C A;  2R2U A;  3IR6 B;  1RAE B;  3NGD A;  1JLB A;  3RYL A;  3M32 A;  3ZZO A;  1XEZ A;  2FVR A;  1QY7 A;  2WVF A;  4F4W A;  2N7C A;  5B0A A;  2V94 A;  2ZKU A;  1HA1 A;  3CJ4 A;  2BQ3 A;  1SIZ A;  2B9E A;  3OSP A;  1LFP A;  4CWB A;  5JMN A;  2JHE A;  4FBT A;  2IAJ B;  4LFB F;  1QSL A;  4LF8 J;  3AJ1 A;  5A2Q U;  2KKH A;  3QWP A;  4O3N A;  3MFI A;  1RWN B;  2Q43 A;  4CDI A;  3TUP A;  3QMQ A;  1NEE A;  2R2S A;  2E5J A;  4P74 A;  4DS5 A;  2ZDP A;  1U1P A;  2FHJ A;  3HI9 A;  4WKY A;  2AJF E;  4DL0 C;  1Y5L B;  3LGH A;  3UNY A;  1LV5 A;  3Q8R B;  1WEY A;  2V8D A;  3KLI B;  5C2C A;  2YPY A;  3DM2 B;  2DGQ A;  2N82 B;  2V4Q A;  3HLU A;  4C8Y A;  1A9N B;  1CJU B;  1S6Q B;  5ADZ A;  2Z4P A;  2DTJ A;  4CLU A;  5F41 A;  3MPD A;  6FDR A;  1S6P B;  2EBG A;  3NCP A;  4X84 A;  3MAQ A;  3CME S;  3R5B A;  5KT2 A;  4IO9 Q;  1N54 B;  3GWC A;  1J5O B;  2JFD A;  4TY8 B;  1SJF A;  4OYZ A;  3BO4 A;  1IKV B;  4CLY A;  1F60 B;  2F9D A;  1UJ6 A;  2MZ1 A;  3EVM A;  2G0J A;  4FDF A;  3HSZ A;  4CO1 A;  4GC7 A;  2IY5 B;  1RAG B;  4Y2M A;  1S9E A;  1S49 A;  4Z7Y A;  1F0X A;  3QPI A;  3R5C A;  3DRR B;  1RT5 A;  2BKN A;  5IWA J;  1SC3 B;  2J7W A;  5DQI A;  2NZ4 A;  3NG8 A;  4JI6 J;  2K3K A;  1FVQ A;  3H5Y A;  5D78 A;  5E2Q A;  3GU0 A;  1HPZ A;  2L3M A;  2J0S D;  3CB4 A;  3G96 A;  3AXK A;  1C1C A;  2V4J B;  4DPT A;  4L6V 3;  2F7V A;  2L9W A;  3ZZZ A;  4DV4 J;  5DM6 Q;  4ECZ A;  1VC6 A;  5CYQ A;  1X4A A;  2EWH A;  2N3L A;  2CNL B;  1F2H A;  3HSG A;  2HBQ B;  3P6Y C;  3CD7 A;  2VQE F;  2MZR A;  3TAP A;  5KG2 A;  2I0X A;  2DKO B;  2W8L A;  2QJ3 A;  3I96 A;  1JJ2 R;  4CM0 A;  3NOC A;  1K73 T;  3IS9 A;  1WHV A;  4ZK7 M;  3C6T B;  1GT8 A;  3QRP A;  2OSR A;  3SYZ A;  3K7R A;  3EJM A;  3UE2 A;  2CJQ A;  3P96 A;  4HHH A;  4P2M A;  1VC5 A;  1KQK A;  3ET6 A;  4AND A;  2RSQ A;  2X51 A;  4NZ6 A;  2JH3 A;  2AX0 A;  1KEK A;  5FDL A;  1JQG A;  1NPP A;  3JAM U;  2IJF A;  1N6Q A;  3VGU A;  3JSY A;  2DNP A;  4YEA A;  1DTT B;  2QEX S;  2D1C A;  2HBR B;  1IBK F;  3GV5 B;  5T7L A;  1M5S A;  2W2N P;  4JI3 J;  1XMQ J;  4YY3 J;  4U67 Q;  4DR4 F;  2DCL A;  4RNH A;  4FF4 A;  2V5H G;  3TP2 A;  5HO4 A;  3SQG A;  1NK5 A;  1DRZ A;  1F5A A;  3UVJ A;  3HZE A;  3T9N A;  2W24 A;  4RW9 A;  3G4S S;  1CS4 B;  3TUI C;  2XS7 A;  4DV2 J;  3EDR B;  4Y28 C;  5K5M A;  2UV8 G;  4NCG A;  4EO6 A;  4A8W A;  5D0E A;  4XIU A;  4Y6I A;  1QD1 A;  2L9N A;  2ZHO A;  3JSR A;  3IP0 A;  4UQT A;  2QE5 A;  1X5O A;  4LUB A;  1T9X A;  1M1H A;  1CPZ A;  2LEB A;  3M8Q A;  3DOM B;  5U47 A;  1Q78 A;  2J6U A;  4C48 A;  1Y3K A;  2DGX A;  2OPQ B;  1Y9O A;  2I2Y A;  4MMO A;  5LSO A;  4RW7 A;  1ZTT A;  1Y0H A;  4DFJ A;  3HUL A;  2XGQ A;  4O44 A;  4QOT A;  1SPB P;  1PAU B;  2YKM B;  2DO4 A;  1TEL A;  4DG1 B;  5EUH A;  3LAM A;  3H2V E;  1VS3 A;  3W9H A;  4CO2 A;  2QA4 G;  1FE0 A;  2L08 A;  2QL9 B;  3KHH A;  3B6B A;  3QAE A;  2VBX A;  3TR5 A;  3DLG A;  3I87 A;  2DXD A;  4C8Z A;  3VVT A;  2BE2 B;  1R89 A;  3DXB A;  2G4B A;  4KGZ B;  3GIR A;  2V4R A;  4X4P A;  3WC0 A;  1FXD A;  4J9M A;  5KFS A;  4J9L A;  3A3O B;  2A0F B;  1HI0 P;  2YX1 A;  2DNH A;  4ICL A;  4DCP B;  1QAY A;  2G1D A;  3N4W A;  2FYX A;  1XNQ J;  4FS1 A;  2BKP A;  1MSW D;  2MQ8 A;  4ZIT A;  3GB0 A;  4OLO A;  3G9C A;  4A8O A;  1N5Q A;  1FO1 A;  1S57 A;  1TK8 A;  2VH7 A;  3AD8 C;  2HWT A;  3H25 A;  1L3U A;  5E0O A;  4FYV B;  4O4G A;  4PG5 A;  1NZ8 A;  2CJA A;  1ZA2 B;  3TZZ A;  2DR9 A;  2HQ3 A;  2FJA B;  1MRO A;  1N34 F;  2XLK A;  3UDV A;  1RWU A;  4JI8 J;  1A6L A;  4LSL A;  2XMK A;  1XMO J;  5KFY A;  1QM9 A;  4NZ0 A;  2ATL A;  5T41 A;  1IBM F;  4OX7 A;  5E41 A;  1ZTW A;  2BMB A;  2QV6 A;  3T6J A;  2YWW A;  3R7N B;  4BDP A;  1FXR A;  3RUB L;  1SJR A;  4DR7 F;  4PZV A;  3ILO A;  4KHR A;  4KH1 B;  5A8R A;  4TLR A;  4ZJQ A;  1UJ5 A;  5THW A;  4PWW A;  2ZHB A;  2XMJ A;  4FZV A;  2ZE2 B;  3FCH A;  3NY0 A;  2FLP A;  3FFI B;  1BWE A;  1FHT A;  2J0Q D;  2WVD A;  4DL3 A;  4KJI A;  1TZ0 A;  1S1T A;  1T9V A;  2CQI A;  2W4P A;  4TN2 A;  1YBU A;  4JI1 J;  4NRT A;  5L46 A;  2B9X A;  1NDC A;  4ZVP B;  2FJB B;  3VAK A;  1C0U A;  2XC9 A;  2DHA A;  3OL9 A;  3MCM A;  3QAU A;  1HBO A;  5BR8 F;  3UFC X;  2E1P A;  3QRQ A;  2V9K A;  1YRT A;  3EYZ A;  3GTY X;  5BYQ A;  4WKR A;  3IM9 A;  2XNR A;  3PR5 B;  2AJ4 A;  3IBF B;  1S1X B;  3TUJ C;  4DBQ A;  2ADC A;  5H9E J;  1FWL A;  1FJC A;  2ROE A;  4OJG A;  3VGS A;  3I55 S;  3V5R A;  4DL2 A;  2HNZ A;  5HBM B;  1I51 B;  1HKA A;  3LAN A;  3QZ8 A;  2IYI A;  4ZKA A;  4ZVT B;  5JVH Q;  2QFJ A;  4DL4 A;  2RF2 A;  1HQE A;  4KTQ A;  3Q89 A;  1LOU A;  3JSB A;  2BX6 A;  4YUD A;  1TL7 B;  1TR0 A;  2OML A;  2QYC A;  4Q0B B;  3S7R A;  5K14 A;  4PXC A;  1J5E J;  5DM7 Q;  4USM A;  5A6P A;  3EGV A;  2VHG A;  3F44 A;  2V69 A;  4IDK B;  4KGV B;  2M8D B;  1RKI A;  4V1A k;  5KFW A;  2Z56 B;  2BOA A;  4K0K J;  4A8S A;  4WFZ A;  2VFR A;  3FC9 A;  4ZP8 A;  3FNN A;  1H38 A;  3VZI A;  1NB2 A;  2O01 C;  5EN1 A;  1V6H A;  2RQM A;  1FT8 A;  2HND B;  1DTQ B;  3LQV A;  4CO0 A;  4DL6 A;  2JNJ A;  1RA6 A;  3UNG C;  4LF6 F;  1F2G A;  1NH8 A;  4J90 A;  4UF4 A;  5HLF B;  3GE9 A;  1FX4 A;  1SJQ A;  4GKK J;  4LRD A;  2VON A;  4RKU C;  1FFS B;  2JDJ A;  2AGO A;  3B4M A;  4C3M A;  2XLJ A;  1YJN S;  1U0H B;  3ZTR A;  1RHR B;  3D0G E;  3KHG A;  2IMW P;  3U1L A;  3NCQ A;  2CQ1 A;  2RB7 A;  4LIW A;  2YPZ A;  1GXL A;  1RHK B;  2H4Y B;  1WOO A;  4X4V A;  1R43 A;  2CYY A;  1OMS A;  1FF2 A;  2AKW B;  3EGN A;  1NO8 A;  4IH5 A;  3F56 A;  5DS7 A;  5DDQ C;  1IQT A;  3PYG A;  2MKH A;  5F8J A;  5CQG A;  2ABY A;  1SL1 A;  2EI5 A;  2H54 B;  2XBP A;  1NPR A;  1S6Q A;  4GVB A;  2OPR B;  4B3R F;  1NSQ A;  4OI6 A;  2AGQ A;  1XMB A;  4JI5 F;  1URR A;  2C2E A;  2CWX A;  1YQH A;  2RRA A;  4F0H A;  1SIW B;  1J5O A;  4F3O A;  4A4J A;  4TY8 A;  2A2D A;  1NJY A;  2HHW A;  3MXH P;  3KXD A;  1IKV A;  4NLD A;  2BBE A;  2CWK A;  3MEC B;  2XWX A;  2Z57 B;  3M7V A;  2HGM A;  2W4D A;  2D74 B;  2HVE A;  5C2G A;  1O5J A;  3ISZ A;  5HVF A;  1RT3 B;  2EVZ A;  2XCA A;  4UOG A;  1TL4 A;  3OHA A;  1AUD A;  4AFF A;  1BY9 A;  3AOA A;  3QZ7 A;  1Y5N B;  4NLX A;  2LEC A;  2XM3 A;  4PQA A;  4OJ1 A;  2HHT A;  2XYP B;  4QR2 A;  4ES2 A;  4KKO B;  2QLX A;  1YRX A;  1DAX A;  1PJ6 A;  4ZVF A;  3DU6 A;  5ETO A;  5A0Y B;  2V4J A;  3W5X A;  2FHK A;  3K5L A;  2HQF A;  3HDS A;  2WB4 A;  3N01 A;  4WXW A;  3OQ2 A;  1MWZ A;  1Q81 T;  2VKR A;  2JC0 A;  1TUW A;  1W25 A;  1UMJ A;  2LMI A;  4XPC A;  4HT5 A;  1KQG B;  2OTL S;  2HHV A;  5LXR A;  1UEV A;  4LF7 F;  1UVN A;  2WSF C;  3Q86 A;  2B4V A;  3PYE A;  4RPF A;  2XO7 A;  4JI4 J;  3AQP A;  1X9M A;  1LWE A;  2CIM A;  4LF9 F;  1SXL A;  1KOH A;  1D9D A;  1V5V A;  3R5D A;  4HH1 A;  4GRS A;  4H54 A;  1RP5 A;  1NAQ A;  3H8Y A;  1YTY A;  1OY9 A;  4IQX A;  4CT9 A;  2WW8 A;  1RWM B;  1UFW A;  4TU8 A;  2C3M A;  3M2V B;  4RJV A;  3Q8Q B;  2R8G A;  1N5S A;  5E3C A;  3BYP A;  5HJY A;  2M5Y A;  1KLM B;  1DTT A;  1WG4 A;  1HMV B;  2FVP A;  2OFH X;  1H3D A;  3PEH A;  3ILJ A;  3PTW A;  4ECQ A;  4F4X A;  2CPZ A;  5MLC V;  3HHK A;  1BC6 A;  1TL5 A;  2PA8 D;  4OV6 A;  3BSO A;  1S0V A;  2KU7 A;  4KO0 A;  4I2P B;  3W5Z A;  1S0M A;  1TMJ A;  2B8P A;  1C4C A;  1CS4 A;  4KQZ A;  2HFN A;  3BBB A;  2FJE B;  4NAS A;  2OO4 A;  2VQE J;  2W9B B;  1NKE A;  4ED3 A;  2BW2 A;  2Y1J A;  4F2R A;  1RTH B;  2ALZ A;  3I0R B;  3DDN A;  1TV6 B;  1WDT A;  3VAF A;  3OUY A;  4YP3 A;  5KOX A;  2DR6 A;  4N7T A;  3W9I A;  3SZ2 A;  4WFA Q;  3CD6 S;  4QR1 A;  1NK9 A;  5ETS A;  2RQC A;  4OZ3 A;  4N77 A;  4R0J A;  4WU2 A;  3WX4 A;  3PZP A;  4RWX A;  3T1Y J;  4PR6 A;  2DY9 A;  1ZAX A;  2ZC3 A;  2BM0 A;  2VBY A;  2YKM A;  1TQL A;  1IBK J;  4YR2 A;  2ZJP Q;  5LMN F;  4DG1 A;  3KNG A;  1UA1 A;  3LWL A;  1NK0 A;  3L7P A;  4IFY B;  2ZOG A;  5EHH A;  1OSC A;  2VDH A;  3OHB A;  4PAB A;  2HK3 A;  3CO9 A;  3QSI A;  3KLF B;  3BV8 A;  3FBF A;  2RH3 A;  2VDI A;  2V8G A;  3MUR P;  4DDF A;  3PX4 A;  4RU2 A;  2AU0 A;  2JEJ A;  2IRY A;  1Q4R A;  3DOL B;  5KG3 A;  1RQ0 A;  3PKM A;  4TLQ A;  5D77 A;  4CLZ A;  4XK8 C;  1UPP A;  3M8Z A;  5BJR A;  2FIU A;  3CCJ S;  4TQS A;  2AZ1 A;  5D4N A;  3QID A;  1M5O C;  4ZCI A;  3OXF A;  4OZJ A;  2RHQ B;  1U47 A;  2FZK B;  3IR5 B;  3GFZ A;  1LXJ A;  4JBC A;  4U8Y A;  1Q8L A;  2ADB A;  1WOS A;  4Y34 A;  2DGW A;  2KI2 A;  1MML A;  3VAI A;  3DLE A;  2FJX A;  1RWW B;  1Z2L A;  4ED0 A;  3CDE A;  1RAO A;  3HSD A;  4F7V A;  2VPY B;  4WK3 A;  2MKY A;  1X8D A;  1WF2 A;  4LSN B;  1JWW A;  2BJE A;  2F8M A;  1VYA A;  2XMA A;  1RK8 A;  1YK9 A;  3A1Y G;  1DZ5 A;  5IM0 B;  5A8K B;  2ZZN A;  3TYT A;  1WWH A;  4ES1 A;  4EEY A;  2F5G A;  2VPX B;  5J2Q B;  4B3O B;  1WC0 A;  2P8I A;  5KFI A;  2XI2 A;  5AT1 B;  1HNZ F;  5FLX U;  4K4Y A;  3NEK A;  4MIB A;  1IN0 A;  4HLB A;  3FUY A;  2JX2 A;  3RZA A;  4NX9 A;  5FJ4 A;  3T41 A;  2XG8 A;  3TAM A;  1PIE A;  3C14 B;  2VFT A;  3MDF A;  2ZE2 A;  2ZH2 A;  4OYM A;  4A47 A;  1RT1 B;  3FFI A;  1NRK A;  3IN5 A;  2Z58 B;  2C28 A;  1H98 A;  4FKX A;  4TKT A;  2LDI A;  3TOQ A;  4ECV A;  1T3N A;  3DGV A;  1P1L A;  4P72 A;  2HK2 A;  2Q1L A;  1RWK B;  2FHM A;  1OSD A;  1XQI A;  1TMM A;  1Q8B A;  1N34 J;  3MCS A;  4KAI A;  5EX3 A;  3WC2 A;  2YKN B;  3NMA A;  3NNH A;  2G2O A;  4L75 A;  1S1X A;  5KFG A;  4QWD A;  2AGP A;  1VQ5 S;  1IBM J;  3K8V A;  4K2X A;  4XDD A;  4TXS A;  1P27 B;  3MPY A;  3F0N A;  2OEL A;  1X5T A;  1YJR A;  2V68 A;  5HBM A;  1AZS B;  2N4C A;  4L74 A;  2OSQ A;  2HQD A;  4DR7 J;  4ZP6 A;  1TL7 A;  2YNI B;  2R7W A;  5JVG Q;  2J6S A;  3KUH A;  3MZI A;  1LW0 B;  4Q0B A;  4B3M F;  2BE7 D;  4USH A;  1U49 A;  3V6K A;  2UUA F;  1DJ0 A;  3EXC X;  4OX9 J;  4ZPW R;  3L09 A;  3KHR A;  2NYH A;  3UD3 P;  4IDK A;  1S9F A;  2BUN A;  2B4O A;  4YB5 A;  3MM8 B;  4W98 A;  4C3L A;  2QSW A;  1M5P C;  3ISN C;  1RT7 B;  1CJK B;  5KG6 A;  2LU2 A;  3KLH B;  4K4S A;  5BR8 J;  2YNH B;  4EYI B;  4UST A;  3MPV A;  2KT5 A;  3KWM A;  5DRK A;  3HJF A;  2HND A;  1DTQ A;  4EZ6 A;  3Q8Y A;  4DOZ A;  2YBV A;  2QTW A;  4B9T A;  4ZCM A;  4CZC A;  3DLK B;  2R7V A;  4F02 A;  4RUA A;  1RHM B;  4RBU A;  4NXM F;  1LW2 B;  3U7J A;  3R1L A;  4F2S A;  3J81 U;  3LUY A;  2E7W A;  3RJM B;  1M5H A;  2OH2 A;  5KOW A;  4RLE A;  1I5O B;  2W9A A;  2R2R A;  2E1M C;  1U1M A;  2ASL A;  4WP8 A;  4O0I A;  4ECX A;  2ZC4 A;  3PR4 A;  3C15 B;  3UI3 A;  1U0H A;  5DQG A;  4UT4 A;  2CPH A;  3G87 A;  2BAN A;  1UZD A;  3KJN B;  1U6B A;  3QLH B;  4PG4 A;  3MCO A;  3BH7 B;  4OYW A;  3CJ5 A;  2GGP A;  4PWD B;  2CPF A;  2APO A;  1DQ9 A;  4LVO P;  1X4H A;  2GVZ B;  2RIL A;  1UEK A;  2RE1 A;  4MYT A;  2R9L A;  1O8B A;  3T1H F;  1EKR A;  1YJU A;  4U6P A;  1FE4 A;  1ZPV A;  4FYX B;  2YWG A;  4EBE A;  3KDO A;  3NWR A;  1TUV A;  1V9O A;  2D9P A;  1JLQ B;  3CCQ S;  2HAI A;  2YKA A;  2Y9H A;  4J9R A;  2RD5 C;  3QNW B;  4N5S A;  2DR7 A;  1VCT A;  1TTH B;  4CLT A;  2QA1 A;  4N41 A;  1ZZF A;  5DG7 A;  3S6E A;  1CUL B;  4QU7 A;  2WRM A;  3RAX A;  2QLF B;  4OHV A;  2VOP A;  3MMA B;  3MEC A;  4LIR A;  4DHV A;  4C98 A;  1VLO A;  4I6Y A;  3IRX B;  4OYB A;  2LFV A;  3E01 B;  1JLF B;  1TAU A;  4RNF A;  3H5X A;  3U27 A;  1RT3 A;  3PO4 A;  2EBE A;  3M1V B;  1JKH B;  1RWX B;  2PII A;  3LPY A;  3CF5 Q;  2GHP A;  1FDA A;  2FY8 A;  3DDI A;  3UCZ P;  2HZC A;  4OZ5 A;  3BKU A;  4DCO B;  4OLP A;  3CCZ A;  1JXV A;  3BBF A;  4EZ9 A;  3IGV A;  7AT1 B;  4IFV B;  2AV5 A;  4YR3 A;  2C2Z B;  2VFS A;  2XYH B;  3DKD A;  2E66 A;  4KKO A;  2GO8 A;  4B9V A;  4HEA 9;  3KK2 B;  3CCV S;  3T6B A;  3KK3 B;  2HHX A;  2PT0 A;  4B3R J;  3KG4 A;  5EDW A;  3R7S B;  1HLW A;  5ITH A;  3CUL A;  1IR0 A;  1WHX A;  3W2W B;  1OQ3 A;  4AQY J;  3ISN D;  2IVM A;  2LU1 A;  4JI5 J;  4PPZ A;  3DRS B;  9ATC B;  4TU7 A;  1JLG B;  5E33 A;  3VAG A;  4JI7 F;  3B78 A;  1Q8K A;  4LQ3 A;  2C22 A;  3CD0 A;  1F9F A;  1VIX A;  2W9C B;  2MJU A;  1RXO B;  3O5T B;  3SQO P;  3RAM A;  2P6S A;  4J91 A;  1IR2 A;  3VZH A;  3W63 A;  2PI5 A;  5GAH I;  4AUK A;  1VFJ A;  5I3Q A;  2QMU B;  2MJN A;  3TX8 A;  4LMZ A;  3BQ1 A;  2RIJ A;  4PXB A;  1ZH5 A;  2MKK A;  3D7S B;  1FJ7 A;  3R3T A;  3QGP A;  1T9W A;  2I5J B;  3M2V A;  5M2R A;  3RR8 A;  2YWF A;  1KN6 A;  4J9P A;  2EW9 A;  3DNC A;  4FVM A;  1KLM A;  4FXV A;  3PW0 A;  1TAQ A;  1HMV A;  3RR7 A;  4CT8 A;  4X66 F;  1PIL A;  5IFM A;  4Q45 A;  2N4D A;  1WAC A;  2IA0 A;  4I2P A;  2EXU A;  1B0V A;  2QFI A;  4OI1 A;  1DHM A;  1YJW S;  4P2F A;  3N6N A;  1V3Z A;  2W9B A;  4I7F B;  3FBC A;  3AD7 C;  3PIO Q;  3JTO A;  4RNM A;  3NGS A;  1P9Y A;  1RTH A;  3I0R A;  3M8P B;  1TV6 A;  4AL7 A;  2DNR A;  3CCM S;  3IFE A;  3PX6 A;  3IO1 A;  1E6V B;  3AB2 B;  2ASY A;  3E51 A;  1WKL A;  1RZM A;  3ONQ A;  4DV6 F;  3TUZ C;  1CQN A;  2B0G A;  1REV A;  2NYI A;  1YWX A;  3CD5 A;  3E3X A;  3FVY A;  2CDQ A;  5EGY A;  3TZW A;  3KYL A;  1RDR A;  1M1K T;  3QGH A;  1D9F A;  2AIR B;  3RB4 A;  1RJJ A;  1MW7 A;  1QTN B;  4ZP9 A;  1WHW A;  4UQG A;  3D0H E;  5HMW A;  2UUC F;  2CQH A;  2YQ0 A;  2KL8 A;  4MIA A;  4FVC A;  2ZUG A;  4ZN3 A;  1RCX B;  3KLF A;  4DLE A;  1WJ9 A;  4F25 A;  5DGA A;  4QYZ K;  2QLB B;  5AXN A;  2BJ9 A;  2OI2 A;  5HMX A;  4GVL A;  4XDC A;  2V8H A;  3PO5 A;  3DOL A;  4IG0 A;  1U48 A;  2F63 A;  2HLT A;  3O8W A;  3MWB A;  2OFG X;  2EFO A;  4RBT A;  3CDA A;  4N47 A;  3MMC A;  4WXO A;  5CZV A;  1R6Y A;  5EWF A;  1F1B B;  3DXS X;  5E7O B;  2HVH A;  1UEU A;  3Q83 A;  2D69 A;  2CA9 A;  2EFV A;  1M0S A;  1F5C A;  1DLO A;  1T7P A;  3M8S A;  1UWB A;  1BQN B;  2BDP A;  3IWN C;  2KZM A;  2K7K A;  2DNQ A;  2M88 A;  3BGR B;  2YKO A;  2E7X A;  2A18 A;  4V19 J;  4L72 B;  3N5B A;  2JFK A;  2RQK A;  4EWT A;  3Q8P B;  1FVS A;  3I31 A;  2EKN A;  4LSN A;  4KC5 A;  2V63 A;  4IOA Q;  4WYL A;  2XZW A;  5LMN J;  2DO0 A;  2PE8 A;  3MHY A;  2BEF A;  1Q79 A;  5IM0 A;  5A8K A;  2AEM A;  3OTC A;  4M5N A;  1OWX A;  1LNQ A;  2AEJ A;  5J2Q A;  3TAR A;  4B3O A;  2OKQ A;  2AYB A;  4C4W A;  4F26 A;  3SCJ E;  4DEZ A;  1REG X;  3W3S A;  3CIM A;  4NLR A;  5A8W B;  3VAH A;  4ED8 A;  3VWS A;  3BPD A;  2RQ4 A;  1WEL A;  3KLE A;  1Q16 B;  2HVZ A;  3EM1 A;  1KVJ A;  2FDN A;  1SH0 A;  3VR1 A;  3VTI A;  3C14 A;  1JJ4 A;  1S59 A;  1X7V A;  5KFA A;  1VQ8 S;  1RT1 A;  3TA1 A;  3I6P A;  3PYD A;  4DR1 F;  2AEF A;  4JYA F;  3V4I B;  4DN0 A;  2IVF B;  2CQ4 A;  4JI6 F;  4KPY A;  3PG9 A;  3GJR B;  2GIR A;  1VJW A;  4OI3 A;  4K4U A;  2QT7 A;  5A76 A;  1G1X A;  2ZJQ Q;  4BHQ A;  4ZVS B;  2OIH A;  1KDN A;  3BSA A;  5HN0 A;  3PM9 A;  2HFU A;  2UVR A;  1HNW F;  4NL5 A;  4DUZ F;  4CIO A;  3KK1 B;  5KG5 A;  4DPX A;  3BB5 A;  4WWS A;  2ZOM A;  1DBD A;  2HBY B;  1HNZ J;  4RW4 B;  5CAA A;  1V5I B;  3FMW A;  2B51 A;  2G13 A;  2YNI A;  2IRX A;  1BLU A;  4LRA A;  2KVQ E;  2M0G B;  1WUU A;  1HYS B;  2ZH7 A;  4QBU A;  4YOE A;  1BMQ B;  3NS6 A;  2ZHA A;  3D1O A;  1UAW A;  2KG0 A;  1BD6 A;  3FEZ A;  1GTE A;  1U02 A;  2ZH1 A;  3MM8 A;  2ZZM A;  4ELU A;  1RI7 A;  1R8H A;  2AZ3 A;  4B08 A;  4DSJ A;  3HKW A;  4OJ3 A;  1RT7 A;  3KLH A;  3LOU A;  2DGS A;  2YNH A;  4ED1 A;  4WF9 Q; 
#chains in the Genus database with same CATH homology
 1N32 J;  1HR0 J;  4X65 J;  3J81 U;  4PWW A;  2KL8 A;  4JI5 J;  4DR4 J;  1XNQ J;  4LFA J;  5FLX U;  2MEW A;  2VQE J;  1J5E J;  3W1Y C;  2UXB J;  5LM7 E;  2MQ8 A;  5AJ3 J;  3J80 U;  5IWA J;  4LFC J;  4DR7 J;  4LF5 J;  4LF6 J;  1IBL J;  4KYZ A;  4GKJ J;  4HHU A;  4JI6 J;  3OTO J;  2UUC J;  4X66 J;  4NXM J;  4KHP J;  3R2D J;  4YHH J;  4LFB J;  4LF4 J;  4DV5 J;  4JI1 J;  1N33 J;  4V1A k;  1HNZ J;  2MTL A;  3D3B J;  1I94 J;  4JI4 J;  1HNW J;  4B3S J;  4DUZ J;  3J7A N;  4K0K J;  3R2C J;  4OX9 J;  3JAM U;  4JV5 J;  4DV3 J;  2UXD J;  4DR5 J;  4DUY J;  4KY3 A;  4JI2 J;  4B3T J;  2KVQ E;  4JI3 J;  1XMQ J;  2ZM6 J;  4YY3 J;  4B3M J;  4X62 J;  4DV7 J;  2E5L J;  4RJV A;  2F4V J;  4JI8 J;  3T1Y J;  2UUA J;  1N36 J;  4DV4 J;  4JI7 J;  1XMO J;  4NXN J;  1XNR J;  4NEY A;  4DV1 J;  1HNX J;  3IMQ J;  4LF7 J;  4NEZ A;  1IBK J;  5BR8 J;  1N34 J;  4DV0 J;  2UU9 J;  4LF8 J;  4DR3 J;  5A2Q U;  4DR1 J;  5LMU J;  4DV2 J;  4X64 J;  4JYA J;  2HHH J;  4DR6 J;  4JI0 J;  4GKK J;  4DR2 J;  4DV6 J;  4LF9 J;  5IT9 U;  4B3R J;  2VQF J;  3D3C J;  2UUB J;  1FJG J;  2UXC J;  1IBM J;  3T1H J;  5LMN J;  4AQY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...