4K0KJ

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4k0kJ00
2KL8A 2UUBJ 2UXDJ 4JI8J 3OTOJ 1FJGJ 2E5LJ 4LFBJ 3J7AN 2MEWA 4JI2J 4B3TJ 5LMUJ 4YY3J 4DV1J 4JI6J 1HNWJ 5A2QU 4DV6J 1HNZJ 4LF5J 2ZM6J 4DR4J 4JYAJ 5BR8J 4LF4J 3T1YJ 2VQEJ 1HNXJ 4NXNJ 4AQYJ 2UXCJ 4DR1J 4NXMJ 1N36J 4DUZJ 1IBLJ 3T1HJ 1N33J 4KY3A 1N32J 1XNQJ 4YHHJ 4JI7J 2UUAJ 4B3MJ 4DV5J 4RJVA 2UU9J 4DV3J 2UUCJ 4DUYJ 4KYZA 4DR7J 4NEZA 2HHHJ 4X65J 5FLXU 3R2CJ 4JI3J 2F4VJ 1J5EJ 4DV2J 4GKJJ 5LM7E 1I94J 4JI5J 4DV0J 3IMQJ 4OX9J 1IBKJ 4DR5J 4JV5J 2MTLA 4K0KJ 1XMQJ 3W1YC 4DV7J 4DR3J 1HR0J 3R2DJ 4KHPJ 4X64J 4X66J 4B3SJ 1XNRJ 5IT9U 3D3CJ 2UXBJ 4LF7J 4DR6J 3D3BJ 4V1Ak 4PWWA 4LF8J 4LFAJ 4B3RJ 4LFCJ 1IBMJ 4JI4J 4NEYA 2MQ8A 4JI0J 4LF6J 3J81U 3JAMU 1XMOJ 4X62J 2VQFJ 2KVQE 4JI1J 1N34J 4HHUA 4DV4J 4LF9J 4GKKJ 5AJ3J 3J80U 5IWAJ 4DR2J 5LMNJ
chains in the Genus database with same CATH superfamily
1JLFA 3RZAA 2CDRB 3B78A 1D0EA 1HBMB 3LGHA 2YWKA 5J2PA 3JTOA 1T95A 2ACYA 4WTOB 1GMVA 4QIEA 1NJXA 2J0QD 4NLVA 3A12A 2IFXA 2FY1A 1S97A 2BKNA 3KTQA 2ZKUA 1NKCA 1K1SA 3BGLA 1T94A 1CG2A 3L7OA 4QWAA 1S1UA 2IA0A 3N6NA 4WP3A 2AJ2A 3IR5B 1OJ4A 2P2CB 2HAIA 3JSMA 3QO9A 4HTJA 2NLWA 2OPPB 4FYXB 1JJ4A 3CE8A 1JB0C 4ZCMA 3FSXA 5DG9A 1WI8A 3VGUA 4XK8C 1RT5B 4A8SA 3DC2A 1EARA 2RU9A 3CDEA 1QSSA 5HBMA 4TU8A 1HR0J 3L4BC 4WYLA 2XMTA 2VDHA 2W2OP 3W63A 5IM0A 2AKWB 3NGKA 1BXNA 1VIOA 2KT3A 2X1FA 3MXHP 4U7UK 2VQFJ 1REGX 2OTJS 1FFGB 2VB6A 3N28A 4M5IA 3MR2A 3ZZ0A 2AU0A 2E9TA 1S59A 2CWKA 2OSQA 2MKIA 2FDNA 2DNYA 1VBKA 1JJHA 1Q86T 3BKFA 1N0VC 2ZZMA 5CCMA 4RW4A 4OI2A 4O44A 2OI2A 2ALYB 1EKSA 4EFAC 1TKXA 2CPDA 2Y8YA 3DU6A 1N56A 4CZCA 5A8KA 5J2QA 1IBLJ 2KKHA 4C3MA 3MR3A 2HHPA 3MMCA 2CQ2A 3NCRA 4R8UA 3MMBA 2DXDA 4P75A 5B0EA 3W2WB 2YNHB 4NOHA 3K8WA 3M2UA 2Y1JA 4OQJA 3QFHA 4UY8T 2GCFA 1CULB 1VQ6S 3PKMA 2XM3A 5BYSA 1JLQA 2E1RA 3PVXA 3HKWA 2E7VA 3I9V9 1TAQA 2UXBJ 1RWMB 3BYPA 1EETA 2CA9A 3PJWA 4M8LA 2CQBA 2IAJA 2V0NA 2R8IA 4DL6A 4U67Q 1RYRA 2EC0A 4DPTA 1TFYA 1XK8A 4O0IA 2LQBA 4QCLA 1ZS6A 2YVSA 1SVDA 2QMWA 2HYIB 1U1RA 4TQSA 1U8WA 4F3OA 3NMAA 3BH6B 3DFEA 2JDJA 3VWSA 4ZLPA 5KFKA 1XIQA 3FCWA 5C42B 1WC1A 2M7SA 1LWCB 1Q8IA 4DEZA 4L3NA 1IM4A 1RAGB 4X2BA 3TA0A 3TA1A 4RKUC 2DGOA 2IYGA 4QJVA 4YB1P 1FDBA 2CPFA 1NHUA 3TR5A 2IY5B 1LW2B 1R31A 3AODA 3GIRA 2HIQA 1UVKA 2FHOB 3DLHA 5J2NA 2W2MP 1IWAA 1R0AB 2B56A 2MHNA 3S1TA 4MT1A 2HBYB 1RADB 4H4MA 4Y65A 1L3SA 3CO0P 5C7PA 3KK2A 2HHXA 3B8HA 4MK7A 3M32A 3VAFA 3WIVA 3HJFA 3K58A 5AT1B 4ED4A 2IBOA 4N5SA 3K5MA 3OVAA 2VOOA 3BQ2A 1GT8A 2W24A 2M5YA 4OZLA 1R6YA 2ZH5A 4ILRA 1CC7A 2BMBA 1HBOA 3T5HA 1N6QB 4W90B 4JI2F 1QLNA 2RF2B 4RW6B 1J5OB 2NXEA 4DQPA 4M1KA 2OIHA 3MF5A 5KFIA 4EI2A 4ZP7A 4USUA 2VFRA 5CYQB 5IXUA 2WCXA 5CH7B 5E0OA 1GEHA 3WX8A 3Q83A 3AFGA 2GMLA 5KG4A 3AXKA 3D6MB 4JI3F 2QMXA 1FD2A 1T9XA 1M5KC 1XQIA 3MAAB 3MM5B 1Y3JA 2XY7A 1KONA 4P2XA 4V1Ak 1R8CA 4LFCJ 4I6WA 3NBPA 2QLFB 1FERA 3CMAS 1JLCA 1FWPA 3W8PA 3VVUA 3W64A 2OGUA 5KG3A 2HMIB 3KLHA 5F8NA 2E5LJ 4LRFA 3ZZTA 3OXLA 4DL7A 1F3FA 3HHDA 4C48A 2K3IA 3TP2A 3G8SA 3NAIA 3NOGA 1HNXJ 1DQ8A 1R43A 2KHDA 1IR1A 4QYZJ 4DUZF 4DXLA 1LXJA 3TX8A 3HZGA 1PAUB 3OT9A 2AT1B 3OJSA 1AZSB 1H2UX 2E44A 3DRXA 4KPYA 3UCUP 1AW0A 4IFVB 2J5AA 2CZ4A 1MMLA 3GIMA 1YK9A 1V3RA 3C16A 4GVBB 4G1QA 4PWDB 4DHVA 3MEKA 1CJVA 4TNOA 2Z30B 1YZ6A 3UDEA 1URNA 3H2UB 5AXLA 2NXUA 1R89A 4JI0F 2RS2A 2J7KA 1OO0B 2GVDA 5F0WA 1HW9A 1CJKA 2ROPA 1IKYA 3IG1B 1JXLA 3I5CA 4YY3F 2I0XA 3FSIA 1WF0A 4B3TJ 1YRXA 3PJ9A 1ZBTA 5H9EJ 3HSDA 1JMTA 3GIJA 3UNYA 2MQOA 2IRYA 5G4DA 4ER8A 3FCVA 5HROB 3OTBA 1XR6A 1N33F 4KPCA 5ETVA 5HMZA 4F0HA 4NZ7A 3DM2B 3CXCR 1HD1A 1Y5NB 4UUXA 1SXLA 1UW4A 3R5CA 3IO1A 2MQQA 2QL9B 3P6YC 3PW5A 1VC0A 2JVOA 3MM6B 1RSCA 4ZJOA 3K5LA 2Q3PA 1N54B 1Y9OA 2E5IA 2H5JB 4I1TA 3NEKA 3PYDA 4BHQA 3UD4P 2C2DA 4LRCA 3GJTB 5DM7Q 1B4SA 4PXDA 3MECB 4DOZA 1R8AA 1C1BB 2AHOB 4MFBB 3QT6A 1S6QB 8RUCA 2XTJP 5D0GA 2BDPA 1LQ9A 2ACMA 3O1LA 3JXOA 4ZP9A 5CD4H 4Q0BA 4KKOB 3KMQA 2HVZA 2M8DB 3OUYA 5D4NA 3WHIA 2MZJA 5HVFA 4IUFA 4JI7F 2ZD1B 5DDRC 3SXLA 4UF4A 2A6OA 4ZMMA 3OL9A 1VQPS 3SQOP 4TKTA 1G6BA 2Z4PA 3MCSA 2VA3A 5D0RA 2HHUA 1EKRA 1JLEB 1YX2A 2ZBIA 4KHPF 3EXCX 3H8YA 4YOEA 5FLXY 4CI0B 1FDAA 3DOMA 2HVDA 3M7VA 4YB7A 3PYFA 1TTHB 3I5AA 4ZPAA 3IRXB 5HVGA 2XBPA 2H3EB 4I0WA 4C0OC 1SC1B 4IYQA 2XY6A 2R7TA 3HT3A 4C3LA 1K73T 3O8WA 4FF1A 1CJUA 2VL1A 3QT5A 3MOZA 2DH7A 2AD9A 2V9KA 5E3QA 5D8HB 1UKUA 2F40A 5HMXA 1S0OA 2W1BA 3QT7A 1PYSB 2WTFA 4ED7A 4HYKA 1S1TA 5G0RB 3CJSA 3K57A 3RJMB 1SIZA 2ZHAA 2DGQA 1KR4A 1RT4B 2QC3A 2CVEA 1F60B 2V67A 5ETNA 3PFOA 3LPEA 4WPAA 1HYSA 3HHLA 4J9KA 2B8PA 3MEDB 1B0PA 1N52B 3T9NA 3ZTSA 3BV8A 4DUYF 2O01C 3TAPA 5KG7A 3RUBL 4ES2A 2OH2A 1LFWA 3THPA 3ENAA 3CJTA 3LUYA 1N5VA 3M2RA 4YDXA 3MM8B 3KNAA 2FIUA 2M3DA 5I4MA 2MLYA 3VF0B 3H5YA 4ID5A 3G86A 2I2YA 3QGPA 1DAXA 2AEMA 1KWMA 3VAKA 1ULRA 3BKUA 1NK6A 4HDGA 1Q8KA 1VISA 2ROGA 2JX2A 1P27B 3JYTB 2GGPA 1U6BA 1VFJA 5HSPA 1NSQA 4JV2A 3NWRA 4F67A 3GQCA 5T7LA 4R25A 3D1HA 3WBZA 1RISA 1UETA 3QBCA 1U7LA 1NMEB 3PX0A 1QVGR 3P5BP 2QX0A 2CZ9A 1Y7PA 3CT9A 4ELUA 1OIAA 1MROA 3BS9A 4H4KC 2AEFA 1UVIA 2CQ1A 2HFOA 3HSJA 1TK0A 1EIYB 3EICA 2R7VA 2HNDA 3TO8A 5JVHQ 1Y4ZB 2O5DA 2V4JB 4KGMA 4MK8A 1VQ7S 3GCXP 2I1RA 3KLGA 1I5OB 3SDEA 1F1BB 4K4YA 2OPRB 3SSQA 2J9CA 3GYNA 4NLOA 3KYLA 3RBXA 1IBMJ 4A8FA 2WRMA 3BH7B 3GIIA 4XAKA 4EYIB 1S0VA 2MZTA 3AXMA 4UQTA 4ED1A 3CJ4A 1C0UA 1KVIA 3DKDA 3OTDA 4JV0A 4FYWB 3KDOA 4DV4J 1D9DA 2UUBF 2BJ7A 3RB4A 2F8HA 5DS7A 2D41A 2OPSA 2UUWA 1SH3A 4OJ1A 5A0YB 2F65A 2YY3A 2W01A 4LF4J 3TUJC 2E1PA 2RAQA 1GX6A 5LMNF 2DHHA 4L6V3 3DGPA 4R5PA 3NS7B 1FRJA 3QRQA 3MEGB 3V81B 2KFYA 2R8JA 3K5OA 4KV8A 2BABA 2JWNA 1Y3KA 2MJUA 4USMA 2NYHA 2VBZA 3H42A 4LSNA 3D9BA 5AE3A 1FT8A 1B99A 3A3OB 3OVBA 2B4OA 1ZM9A 4IFYA 3AD7C 4ED0A 4JV5J 3M1VB 2HWIA 5LJ5Y 4H4OB 2P6SA 5HN0A 1YSJA 2V4QA 1TL1A 1JK9B 3G8QA 1X60A 4ZP8A 4OX9F 2R42A 3F56A 2ZH7A 5F8LA 3MPVA 4LJMA 4QYRA 2GAHC 5HBMB 7FDRA 1K9MT 1C0TA 2V8GA 4FS1A 2YQ0A 4URQU 4CLZA 4USTA 4RW9A 3AOAA 1U1LA 2DIVA 5J2MA 1SL2A 2C2RA 5A8RA 1TKTA 2NXCA 4JI6J 4LBHA 1S99A 1R7IA 4C8MA 4Y2AA 5B09A 3I96A 4CLLA 3J80Y 1HW8A 2GIQA 1YJVA 2C2NA 3KFWX 3CULA 2B5JA 3HHEA 3UCGA 2EPIA 4FYYB 3RAMA 4DL5A 2HHQA 2VIHA 4QBUA 2EFNA 2KYZA 1AFJA 4RW8B 1WF1A 3KDNA 2UUAF 4C8ZA 3N9UC 5E7OB 4RW4B 5KFAA 2ROEA 5F8GA 2HQCA 3W5YA 1J5EJ 2CNLB 4OYMA 3ILJA 4AL7A 4ELTA 3HDSA 4YR0A 5J2QB 1F9HA 4KT0C 3T41A 4P2SA 2KU7A 3AHPA 3MMCB 4DV7J 3TVYA 1DTQB 1N88A 3KHGA 4QR0A 4R8UB 2BW2A 3CC2S 1N0UA 3MMBB 3SIPB 5A8WA 4J37A 2OJ3A 4IRKA 3S8SA 1TL7A 4JI4F 2B4PA 1U0SA 3PG9A 4TVAB 3PW4A 5AXNA 2EFVA 1JKHA 1EETB 5C5JA 2PE8A 2EWHA 3M9OB 1RTHB 3CCWA 4RPFA 2C2EA 5LL6d 3QNWB 2ZM6F 4P7VA 1GX5A 1LWFB 1RTIA 1K0TA 4NPOA 1RLCL 3DLKB 1ZAXA 3M6XA 4G1IA 4O3OA 1M1KT 1FRMA 3PIOQ 3BPDA 4CDIA 3M6VA 2DXFA 2GVZB 5KFDA 2HW3A 4CM2A 1A9NB 4QW8A 4GKJF 2V8VA 1YGYA 4DR5J 2P9EA 5DM6Q 3W2VA 2RNEA 1G7CB 1NK8A 3OPKA 3Q2SC 2RDDA 4X64J 2QE5A 2IPOB 2IVMA 3SMZA 2OD6A 4DR6F 1N5SA 2RUSA 3QIDA 2FPHX 4CNZA 2KI2A 2J0SD 3VQTA 1RT6A 2D69A 1NK0A 1XMOJ 2GIRA 3M32B 5B0DA 3BO4A 3WZ0A 1NK7A 2Y1RI 3RBZA 1WDTA 1PO6A 5LMUJ 2QT7A 1V5IB 3DMJA 5IT4A 2XWXA 4KSEB 5MAOA 2DNPA 5CCLA 4H4KA 4DL2A 3GONA 5E3PA 2BEFA 3QGHA 3G6XA 1MLAA 4USKA 3CO9A 2WBRA 3E2EA 3N79A 3LALA 4IG3A 1D1UA 2PEHA 5KOWA 2LCWA 3PNIA 2UU9J 1FX2A 5RUBA 3OJUA 2DR7A 1RBLA 2K1RB 1L3UA 5D4OA 2Z2MA 4CLPA 3AAWB 4B9MA 1Q5YA 1RT2A 1WOPA 4OI1A 3IWNC 4LF1A 2IJRA 2R2RA 2EVZA 3HP6A 4K0KJ 3CC7S 2HVHA 2ZHOA 2XEXA 4LFAF 5C24A 1M1GA 4LF8J 3SBMA 1EQMA 2MKYA 4IO1A 2VASA 3RRKA 1YI2S 2GHVC 1T9UA 2VJUA 3W3SA 3OL6A 4MMOA 5D0EA 1OQ3A 3BPSP 2CJYB 4OZ2A 3DLEB 3BSAA 3TQEA 5EWEA 4DF4A 4ZKAA 2LEPA 2AGOA 4U8YA 1EAYC 1GXUA 1EP4A 2NXNA 2HRTA 2DR8A 1X4AA 4CT8A 1NSKL 3KHLA 2DNQA 4ID8A 2R7WA 1XNQJ 1M5SA 2QLBB 4I2QB 1E6VA 4DV5J 2ZZNA 4NZ0A 2CPIA 3FZBA 1KBRA 1XBWA 2DR5A 2GA7A 4FP9A 2CQ3A 2OAUA 1GMWA 2XS5A 2QTWA 3PHTA 2ZE2A 3H2LA 1WOOA 3X1LB 3IGVA 2XWYA 3CSKA 1FKPB 5CD4A 2QA1A 3H7HB 4DL4A 4DMZA 1FNOA 5KT3A 2G4BA 3TI0A 4B3RJ 1U0HB 2ZDPA 1K47A 4DG1A 2FJWA 2WVCA 2X7IA 2DO4A 3Q2TC 4YUDA 1QTNB 4KIAA 4P6QA 3AB2B 4ZIWA 2A0FB 2I38A 2CQCA 3UD5A 4BBYA 4WU3A 4R0JA 2JEJA 2EK6A 5ADZA 2FZCB 2BV3A 1S1XB 3LH2S 4Q2LA 3TUZC 2BVZA 3M8QB 5H1SV 3T3FA 1L5UA 1WDDA 3JTNA 3DCAA 4DU8A 2M0GB 3LP1B 2HKEA 4FN5A 1Q8BA 2B4VA 3D54A 2LXFA 3VAHA 3BZQA 1TU0B 2VH7A 4C7QA 4ANEA 4Y2KA 1HFEL 3GG0A 5B08A 4OJGA 4KBIA 3CDAA 4KRWA 5BYQA 3M6WA 3BGOP 4DLGA 1G3OA 1YBAA 1IKWA 3KK1A 1U6ZA 2J7UA 4K8RA 1FF2A 3IM9A 2KFZA 2XMJA 2FGCA 2VPXB 5DG7A 3TAMB 5IFMA 1VQMS 4DL3A 1WC5A 1W26A 1QSLA 2LDYA 4J9UE 3BN7A 1X9WA 5KT4A 1RACB 2VBXA 5IT9Y 3KUHA 4WWSA 1PSDA 5IC6B 3X3UA 2J9DA 3A1YG 3C46A 5K8MA 3G87A 5D6GA 4M94A 3MMAA 3QPIA 2F9DA 1SH2A 1XR5A 1FO1A 8ATCB 2H54B 1FEEA 4BDPA 2ZH4A 4K4VA 2UZAA 2UUTA 3HXMA 2H5IB 2VU5A 3LP2B 1ZTTA 4ZP6A 1S6PB 3NOCA 1Q82T 1X8DA 2XI2A 3ZXWA 1SJ1A 1KTVA 2HHSA 2ZBCA 4L72B 2VG5A 3SQGA 3D6TB 2QL7B 4F04B 2BJ8A 4OYZA 3KXDA 3GP9A 1PKUA 1HBUB 3POTB 3R9LA 2C1EB 3E51A 4HDHA 4J9NA 3KHRA 3Q8VA 3ENVA 4ZDNA 3JSYA 1R6VA 3MOJB 4TN2A 2LA4A 2WVEA 3AY0A 4WIQA 3DOMB 1SQEA 2R8KA 2N3OA 1VQSA 4EBEA 1WWHA 3QQCD 3GIKA 3DXSX 1JLGA 1BWVA 3O2IA 1WKLA 1S7HA 4RNHA 4C6AA 2YKNA 2WK4A 1HNIB 4CYUA 1N5TA 4KJIA 1XJWB 1HWIA 2XZWA 3J7Z5 4NEZA 3GLJA 5KFEA 2E9RX 2OSRA 4QIGA 1S9GB 3VVTA 2OKQA 3K7RA 1S72S 2GJIA 2JLFA 4RL1A 5LOQA 3DXBA 4HT7A 2B0GA 2V2KA 1RTDB 4LF7F 2FQQB 3OSNA 4AYBD 3KJVA 1TL3A 3W66A 3OR1A 2MLXA 2KZZA 1UJ6A 2R4FA 1ZYQA 4GMKA 1IJEB 3CTRA 3L7PA 1CJTB 4EBCA 5GAHI 2IMWP 4ZS6A 3D28A 2FHJA 4K2JA 2N4DA 2UXDF 1GXLA 1T05A 2IRUA 1YJTA 4JI2J 4WU2A 2CYYA 1TUVA 4QU6A 1UWBB 4NCAA 2LU2A 3HD1A 5KFWA 2HGMA 4PG6A 4IDKA 4G6VB 4UT4A 3I5BA 3T1YF 1LK5A 4FXVA 1S77D 4M5JA 3GFHA 3L9ZA 2HGNA 4LQ3A 4NX9A 3FQKA 2DRBA 2FZGB 3CDBA 4WFXA 3C6UA 2PI4A 2E66A 4OX7A 4KAIA 2XMWA 1WHXA 1U2CA 1KFSA 3UI3A 1RUSA 2RDJA 1ZTWA 1S49A 4F50A 2W7PA 4JI3J 1HBMA 5B0BA 1FDDA 1IBKF 1TUGB 2RT3A 1LFPA 4NRTA 2ZC3A 4TYBA 5SUHA 4B3SF 3DRRB 2BOPA 2AP6A 2NUUG 3TZWA 4ETZA 2MDAA 1OY9A 4DX5A 4ZPDA 5B0GA 2D3ZA 1U1OA 1B64A 2GMHA 4IR1A 3IM8A 3QMQA 4F4AA 2HK2A 1S12A 3VGSA 3SDEB 4NLSA 4V19J 3FEYB 5AJ3F 2XLKA 2OPPA 2RJZA 5K8PA 2VBYA 4HR2A 1RT5A 2HPUA 1S76D 3I87A 1P1TA 2GJ2A 1UVNA 4BC9A 1C0UB 2HZCA 2DJWA 2CNKB 4HEA9 4DUZJ 3AD9C 2VD3A 4TQRA 2HS0A 2XULA 3D66A 3BKTA 1DARA 2MHEA 1T11A 4OYXA 4P71A 2EK1A 3SZ2A 1YLXA 3GV5B 4HH1A 1NJZA 2O67A 4RUHA 3MM9A 1U09A 3PY8A 3KMSA 5IOLA 5GADI 2Z57B 1IKXB 5EWGA 1NO8A 1IXKA 1XMQF 4DR3F 3I0SB 4CM0A 1NPPA 3IA0A 1ZPVA 3VAGA 1SJFA 3D0HE 3CMES 4JI0J 4PYDA 1NK4A 2ASDA 1C4AA 1VRUB 1AXQA 4N56A 3M8WA 4IFYB 1WACA 2E1CA 4WTYA 5IT0A 5KG1A 3MHYA 2GHPA 2HQDA 2FHMA 2L9NA 1CULA 1U1KA 4YY3J 2ASLA 1VQ9S 4DV6F 2MSTA 4DFJA 3EJMA 2YKAA 1HLWA 1DHMA 3SV4A 3QRRA 4RW9B 2E7WA 4CH1A 1N33J 1CSJA 3CEDA 1APSA 3TX0A 4J5OA 5DGAA 1NEEA 4OZ3A 1VK8A 3R5AA 1T3NA 4KYZA 2FLNA 5C42A 2IVYA 4IR9A 1LWCA 1O5JA 2DRAA 4ENOA 2FC8A 4ZPTR 1N4LA 3NCPA 4K4XA 1Q78A 2N82B 4B17A 5DDPC 2J9EA 2C2MB 5FDLA 2XB2D 2HAFA 4X4VA 3RAXA 1D9AA 2B7CB 3DOKB 3ADAC 3FKBA 3NRBA 1R0AA 2C3YA 1NAQA 4ZCLA 1RABB 2F9JA 3VCDA 1OYDA 1TL7B 1R8PA 4G1PA 1ZM3A 5M2UA 3P8BB 3UN2A 3H2VE 3HFVA 2QA4G 2AW0A 1TK5A 4KHRA 2HQFA 3Q86A 1UZHA 5MLCV 4JI7J 4FF4A 1UFLA 2XS2A 4OHXA 2W2NP 2CQIA 4EZ9A 2CPZA 4CH7A 1NM2A 4DCJB 3BF4A 1HWJA 4LR9A 5CZVA 4I6AA 1A7GE 5K14B 3R5BA 1JLAB 4KHPJ 1K44A 3H40A 4ZCKA 1ZM4A 3ISNC 3C15A 5T41A 2HZVA 1F5CA 1YKWA 5EDWA 2WSFC 1HQEB 3ET6B 5LT5A 3FBBA 2JEIA 1BQXA 4ZVUB 4ZCIA 2CXEA 3CCQS 1S9EB 2GQ2A 3UW1A 3MAAA 3UDCA 1K1QA 3DRSA 2HWHA 3KLEB 3MM5A 4P52A 4J9PA 5M2RA 3AOBA 3KK3B 1X4FA 2NXJA 2P5VA 3KLIB 5L8RC 3THTA 1DJ0A 2V8DA 3BM7A 3VV2B 1S79A 3W9IA 3DLBA 3ZZPA 2J6UA 4O4GB 4WJBA 2ZVIA 1TV6B 4E2FB 4DUYJ 2KHCA 2WBMA 3CJ5A 2PD1A 2GS8A 2CJBA 2DHGA 4KH0B 2YQ3A 1HI0P 2KDOA 3IBCB 2DNNA 3KG4A 3O44A 4IG3B 3H4DA 2HEKA 1FTRA 2B9XA 3NXZA 2Q66A 1B0VA 3ONQA 1RWOB 5DDQC 3AJ2A 1PIEA 4IFVA 2LXUA 2M70A 4XDDA 2EFGA 2R2TA 1WG1A 1XN9A 1VRQC 5GAEU 4GVBA 1QAYA 4ZVFA 3CIMA 2C3PA 1KOOA 3M8SA 4NASA 3PCOB 4QIFA 4NI2B 5CZXA 3O5TB 4TU7A 2PGCA 3B4MA 4B3MF 2P9CA 1RHRB 2L3MA 1EP4B 3W5XA 4YFUA 2AQ4A 4WK1A 3UN5A 2RSQA 4B9NA 4U7CA 1Q95G 5FLXU 5F9LA 1Q0NA 2DNGA 3KJFB 2NYIA 1M5HA 1Q79A 3S6EA 4ALZA 4QIWD 2HS3A 2O66A 5KFXA 1RBAA 4Z2XA 1WC0A 4F4KA 2JEFA 4IH7A 3DM2A 2J0WA 2MB0B 1NSPA 4Y3CA 3HVTB 4QIVA 4CTAA 3MZIA 4HHUA 1T9YA 2RQKA 2UUBJ 1SV5A 2MYFA 2EG2A 2C42A 3GJQB 1RA6A 5KFUA 4DG1B 3H5SA 4DBQA 4URSA 1VRTB 2MQPA 1UMJA 1PYTA 4WKYA 4XO0A 3GU0A 2GAGC 3E8OA 1NDPA 1C1BA 2FD2A 4YQWA 4MFBA 3NAHA 3R27A 1H98A 1Y10A 2ZC4A 3HZEA 1S6QA 5I3PA 4K2XA 1Q7YT 4BWMA 4ZN1A 2I8EA 2ZBRA 4IO9Q 5IQ6A 3G96A 3R5DA 4CO0A 2JFKA 2DHSA 5F8IA 3D7SB 3U7JA 1DTTA 2AGPA 4DI6A 1UA1A 2KYXA 4C97A 4OI0A 2VKRA 5HL7Q 3BYRA 2IM2A 4LREA 3NCQA 2K2PA 1S0NA 3F41A 2QLJB 3Q8SB 3IGNA 3M8PB 4XPEA 4DSKA 1X0PA 4GC7A 3P3DA 4P74A 4FNIA 3DLGA 2V8HA 4DPWA 3D67A 3P4UB 1RWPB 4Q44A 1T9WA 2Y1LB 3R5GA 3E01B 3HVAA 4K4ZA 1NK9A 3UWTA 1L3VA 2NREA 2HWTA 4PG8A 3IRXA 1IR2A 3BO2A 4YP3A 1R0CB 3MD3A 3C6TB 1KEKA 2RS8A 3C3LA 4ILMA 1ZA2B 2HRYA 2J76E 3TA2A 2UUAJ 2MKCA 2UUCF 2B9EA 4PYAA 4LT6A 4I69A 3CCJS 1HPZA 1WC4A 4A46A 3V6DB 2JHEA 3EVWA 2Q6BA 4M5MA 1PC5A 4A8QA 1QTMA 5G0RA 4L76A 4NA2A 4KE5A 4OYWA 3BQ0A 4I6YA 2LMIA 1RT4A 1S4EA 1QDUB 2C2ZB 5HAOA 3H98A 3CD7A 1SJ3P 4JI4J 4NEYA 2IM0A 4F0KA 3DHXA 1SB6A 5HLFB 2DNZA 1DLOB 1I6JA 3AD8C 1YJUA 4NLUA 2G1HA 2DY1A 4ZOSA 3UN3A 5L39A 3L09A 1RHMB 2OP5A 1W25A 4MYUA 5J1NA 2ZM6J 3HHLD 1KLMB 4LRDA 6FDRA 1OYEA 4NLTA 4KQZA 4DR1F 1KQGB 1G1XA 4LBPA 1N48A 4X4NA 4LVNP 1VS3A 3CD6S 1NNDA 1S4FA 5KFCA 3JS9A 2POKA 2OEJA 5H9FJ 3JYTA 2DO0A 2AMCB 3HSZA 2W8LA 2C2KB 2JNJA 4ECWA 3PX6A 3OLBA 1FKOB 2DPJA 2R7UA 4GKJJ 2PI5A 1RTJB 4A8YA 1L3KA 2QG9B 4CYUB 3QZ8A 3U27A 1H38A 2B4UA 4UOCA 1RAIB 2YWWA 5EWFA 1WHVA 1F5AA 4DR6J 4NE9C 3RTVA 1QAJA 1T02A 1GMUA 2MGZB 3HFKA 1RTZA 2G0IA 2CJXB 4BS2A 2DH8A 1FJEB 4GKKF 2HGLA 3J80U 2V4JA 3MR5A 1TL3B 2DHAA 4MKAA 2X3DA 1HQUA 4USVA 9RUBA 1KLNA 3T1AA 1YQHA 4QYZK 2FJAB 3EVMA 5BJRA 3C14A 2IHR1 3HM9A 4I7FB 4F26A 4PR6A 4ZVRB 2ADBA 2DK2A 4KY3A 1VIXA 3AQOA 2HQGA 4WBFA 3AA8A 2R2SA 4ITSA 3DHWC 4IG0B 3VZHA 3L7UA 2HQ3A 3MWBA 4HI2A 2UVUA 2QSFA 1Y5IB 4JI5F 4NYPA 1FHTA 1Q7LB 1D3WA 4C11B 5E41A 4F02A 2YWFA 2A10A 3KUEA 1JLBA 2LP4A 4M5DB 3US5A 3VTIA 3PEJA 2NS1B 2QV6A 4PWWA 4LFAJ 4OZ5A 1T9TA 4TY8A 3MEGA 3V81A 3MUVP 1TKZB 2R7XA 5KFGA 3IRWP 4WFZA 5H9EK 2HVEA 2HZAA 2XSJA 2W4DA 2YNFB 2GZOA 2XQCA 5IV3A 2V69A 5ETKA 3M1VA 3HVWA 2PMWA 4H4OA 1U49A 2QYCA 2V5HG 4PAAA 1KVJA 4RWXA 3CIZA 4MKVA 1W2BR 2BM1A 1ZPWX 4FVCA 5KFLA 1QD1A 1SQGA 5AXMA 2V6AA 4CQ1A 3Q89A 4UZBA 4B9LA 1NJIT 4X4PA 4LQ9A 5AXKA 3NGUA 1WG4A 3DLLQ 2YBVA 5J1PA 1M1HA 2ZDOA 2YWEA 4PZVA 1BE4A 4C8NA 3WDOA 4C2MA 5ETOA 1PAEX 1RT3B 1IJFB 3MFHA 1D09B 2BYCA 1GH8A 4USWA 3ETOA 4IKAA 4TLRA 3TJ9A 2W9BA 1FDNA 3MM9B 4P72A 4EO8A 4RW8A 4ATNA 2WVBA 8AT1B 2KXFA 1RGVA 1HBNB 2F4FA 4PXBA 2ZNYA 2ZH1A 5KFRA 1S6OA 5K5MA 4ZPBA 4ECRA 3MEEB 2HBZB 1RKIA 3FMBA 4JYAF 2R8HA 2CWXA 4CP5A 1DTQA 4DX8H 4PKDB 2XHCA 4Q2MA 2JLGA 2OPQB 4RBVA 2PA3A 3R5JB 3PTWA 4M5NA 1WF2A 4Z37A 2J0XA 1CS4B 3S01A 4EEYA 2CVIA 2YH0A 5DO2A 3KJNB 4B08A 2D3OR 2OD4A 2YWHA 2VPZB 3D0GE 3UPFA 1D8ZA 2VC0A 5LM7E 1RTHA 4X4QA 2KB2A 2XGQA 3TARA 2WW8A 3P45B 2R2UA 3OVSA 4F7VA 1LWFA 2EXUA 4OJ3A 3DLKA 1UFKA 2FLOA 3QWUA 2CFXA 4PQAA 3V2UC 4DJBA 3EYZA 4C0HA 4WZMA 2HFSA 1Y0HA 4NRUA 2GVZA 2Y0BB 2CPYA 2ZITA 1D9FA 4ZLLA 3ZFVA 3FBFA 1V5VA 3CDWA 5JMNA 4TXSA 5FDLB 2IMOA 3JTPA 2HNYA 3OHBA 1YVFA 4UOFA 2AZ1A 1XTZA 2EKYA 2E29A 3ZZOA 1R27B 3PW2A 5EX3A 4EU0A 4CLKA 2XG8A 3EGWB 2E5JA 3GV7B 5HANA 1KSPA 3PO4A 1KC8T 1BMQB 5CAAA 3JQMA 1FWLA 5KFJA 3SCIE 4DV3F 4RJVA 2QFIA 5I42B 2HSEB 3B6BA 4TU9A 3PHEA 2JEGA 2ZWPA 2DHXA 3CJQA 5KFYA 1RCOB 3NKYA 3I56S 2H5EA 2BKOA 3IP0A 4AXIA 1QUPA 2Y0SD 1YJRA 1FXLA 1WOSA 4ED8A 4F4XA 1VLOA 3HHNB 4ZN3A 2AGQA 3LOUA 1V9OA 2GO8A 4N77A 4WFAQ 4PG4A 3PIPQ 5K8NA 4RNMA 5AE1A 1ICEB 1T03B 2VC1A 1R8HA 2BBEA 4PQUA 2K1RA 2PEBA 4K5RA 2R7OA 3C15B 3W62A 3EUNA 4GO5X 2YKMA 2GO9A 2ZNZA 1C2PA 4CH0S 2D9PA 2Z8QA 1R8BA 1SPBP 1SC6A 2XCPA 5KFHA 3JQKA 4HI1A 4OI6A 3QJLA 2K06A 2MZSA 2H9ZA 4OV6A 2BE7D 3RAQA 3DRSB 3DDIA 3M05A 4F4WA 2JFDA 3F0NA 4IQXA 4DU7A 1X5SA 5HJYA 3DLEA 2H4YB 4OFZA 2YNIB 5ITHA 2L9DA 3BB5A 2XI3A 3F44A 1KS2A 3HULA 4ZPWR 1H7XA 3TZZA 3OTCA 2ZJQQ 5IT9U 4FKXA 4LF7J 3IXQA 2RHSB 5KTQA 2AEJA 4MIAA 1J2VA 3GPAA 3I55S 3MGJA 2AX1A 3QSIA 2J6TA 4I2QA 2VKZG 1IQZA 2DD8S 2RKIB 4UOGA 4LF9F 2E9ZA 2KTQA 2KL8A 3OTOF 2UXDJ 2X3GA 3DRYA 1KN6A 3R8YA 4RBTA 4ZVPB 3CW2C 2KRBA 2RDIA 1NHKL 4NLQA 1FKPA 4HT5A 2BANB 2EG1A 3UQSA 2JL9A 2ZEJA 3T1YJ 4QWBA 1U0HA 4NXMF 4I64A 5D3GB 2DCUB 5ETQA 1GMWD 5A2QY 3MMJA 2AX0A 2LDIA 3RRHA 2RRNA 3QZ7A 1S57A 1FD8A 3BEGB 9ATCB 1FFWB 1S1XA 3H0PA 3OXFA 5L9XA 2PC6A 4W4MA 2CQ4A 2DNHA 3M8QA 3U02A 5KT2A 1U1QA 1IBKJ 1KVKA 4QWEA 1WEXA 1EB0A 5EN1A 1X5PA 4JOUA 4UOHA 3UD3P 4B3SJ 3LP1A 2I9SA 2GJFA 2LYVA 4ANDA 1HWKA 1LK7A 1YHQS 3QGIA 4ZLNA 3F73A 2Z56B 1WKJA 2F3JA 3CB4A 2QMUB 2KZMA 1RHJB 4H54A 1V6HA 1BUXA 5IWAF 4DQQA 5AJ3J 3A8KA 3K17A 4ECUA 2KG0A 3NS6A 3JAMY 2LQ8A 3BBCA 3K5NA 1KTQA 3FC9A 2ZH3A 5CQGA 1O0PA 2JJ4D 3PM9A 4CTAB 4DS5A 3L95X 3JSRA 3Q8YA 3TAMA 1KOHA 5CYJA 2JC0A 2ZKTA 1SV5B 3UDVA 1N32F 5DQIA 1G4CA 2EKNA 1OSCA 3EDQB 1BQNA 1RHKB 1UEVA 3I31A 4OHZA 5FD1A 2P6TA 3C66A 1X9MA 1RK8A 5ETMA 2FJXA 2DT9A 1NZAA 3LW5C 2DITA 3ISZA 4NLDA 3PJXA 4DFMA 1JXVA 1YRTA 2WSEC 4MTPA 2V2ZA 1RWNB 1OQ6A 1XMQJ 4DR3J 2C22A 3SV3A 1HHSA 3NWGA 2RQ4A 5KFVA 3LP2A 1SKSA 3GZ7A 4Q8EA 5LXYA 1GK8A 3G82B 1S6PA 3OFFA 1DTTB 4HKQA 3CCTA 2WZ1A 1BQMB 4DR2F 1Q1KA 1YZ7A 2ZH6A 2DEJA 1H6KX 2XGPA 4MKYA 4B02A 3LPYA 4DV6J 2XMVA 3PRDA 3QLHA 3EGZA 3V6KA 1HBUA 2OFHX 1REVB 3POTA 1E6YA 3DLGB 1BLUA 3TJ8A 3DRPA 3LO3A 3PX4A 4E98A 4NL5A 4OL8A 2P8IA 3KNGA 3AOCA 2HIYA 1NRKA 1ELOA 3CNQP 2DNLA 1YTYA 1S10A 1X7VA 1MG7A 2KO1A 4KGZB 1HA1A 2DH9A 2UP1A 3R6LB 1HPZB 4NYOA 1HNIA 3IAS9 1Q4RA 1URRA 2Q43A 5IS2A 4OI4A 2A2DA 2FJVA 2JZ5A 3HJVA 3W8GA 3HF5A 3UE2A 4OLOA 1S9GA 2CRLA 1UVMA 1Z4UA 2VUGA 3EZ5A 4NLXA 2KRRA 3RU0A 1RTDA 4MKBA 3EPIA 3ZC4A 1S48A 3N6MA 1XERA 2W2QP 3DI6B 1NJYA 2HNZB 4M5HA 2SXLA 2YKQA 4DF8A 3W5ZA 3WC2A 3UDLA 3ELHA 1OPZA 4LBIA 2QGFB 5LSRA 1CJTA 4C3KA 4ERDA 2X1BA 3MAHA 2FB0A 3A3NB 3TZYA 1RAAB 2BXJA 1UWBA 3OQ2A 5EX0A 5KG6A 4Q45A 3ZTOA 3T5KA 1PILA 4PG7A 1NJWA 1UVLA 2ASYA 5ETSA 4ECTA 4Y2CA 5F3ZA 5A6PA 3OR2B 2CQGA 2FHJD 2L41A 1W2IA 4ED5A 2HVIA 3TNVA 2ZVSA 2ILZA 4JB8B 4U95A 4RU2A 3MM7B 1RWXB 4WFYA 5FJ4A 3U1LA 3EE3A 1DBDA 1M5OC 4KHMA 2JLEA 2JH3A 3T9ZA 1XMOF 3DRRA 2XZTB 1TL5A 1DQ9A 5B0AA 1HL6A 2QA2A 2HFUA 4KO0B 5KG0A 4CLSA 3MURP 2BJEA 4ZHRA 3NLCA 2XLIA 4J9LA 3LWMA 4I67A 4N76A 2GX8A 1NHVA 1HQUB 3U1NA 4QOTA 5HI7A 2KJVA 1TQLA 3NGSA 3C14B 3T19A 4J7CA 3CJRA 1I94F 4KFBB 3TRGA 4G3IA 4RBUA 1U24A 5HP1A 2WONB 4LSZB 4F3MA 1RQ0A 2HQIA 2BQRA 5HQ8A 1RWKB 2L08A 2V9WA 1RCXB 2BR0A 2VOPA 3FFIA 4LIRA 4QQBA 2WVDA 3ITHB 2EW9A 4C8OA 1KQKA 4CLUA 4MIWA 5KFTA 4X62F 1NB2A 4PPDA 1U2RA 5GAGI 1N34F 1JLBB 1VC5A 1RAHB 4YS2A 5HO4A 4WE1A 2MMYA 3MUTP 4U96A 2G13A 1IKXA 3LANA 3CJ3A 4TY8B 1X5OA 3I0SA 2V63A 2D1CA 1MU2B 1SUQB 1U2FA 3OHAA 2XS7A 2EBGA 2YNGA 4Y34A 2XSJB 3T1HF 3KLFB 3CCVS 1VRUA 2M88A 3PYEA 2BRKA 4EBDA 5E3CA 1FRKA 3PXGa 4CO4A 3MR7A 2YPYA 4B3MJ 4U6PA 1RI7A 3M2VA 1OPIA 4GO7X 5CHCB 5F9NA 4RW7B 2QL5B 2F8EX 2ATLA 3H59A 5A76A 3FQLA 4RUAA 3WX4A 3GFZA 2OO4A 1TELA 4WKRA 2CJKA 3VZIA 4M5KA 1M5VC 3PW7A 1FWKA 2XMAA 5DETA 1H0HB 3DU5A 5I3QA 2XMKA 5GMDA 3ENWA 1VGYA 5ETLA 3DGVA 3CCRS 4DPYA 1QE1A 2QA4S 3Q8RB 5D77A 2XMMA 2HS4A 2W9BB 1HHQA 3BN4A 4WZQA 1EX8A 3O3LA 3BO3A 5JJBA 2B6AB 5KT5A 4XTTA 4OZ0A 2R7RA 2IJFA 1MMNA 3Q24A 2AYGA 4CLYA 4ZVHA 3DOKA 3HSGA 3NS5A 1N5YB 1FRLA 2BE9B 5I3UA 4S0MA 2CQHA 2E5GA 1X5TA 3SCKE 5HMYA 2RQMA 1IUJA 2M8HA 3IMQJ 2DNMA 2NR0A 4GRSA 3IS9B 2COLA 2VFTA 2YX1A 3AB4B 2MTLA 3T6JA 2N7CA 4B9TA 2F1FA 2OELA 1PGZA 1S0MA 1CQMA 1Z2ZA 2X51A 3CCLS 2F8MA 2ZJRQ 3BBFA 5J1EB 3GTYX 4C9DA 2W25A 1H3DA 2DR9A 1QY7A 4ZVOB 2DGXA 2M2BA 3SYZA 3WIUA 2WOMA 4YR2A 2FLLA 5A6WA 4N41A 3LGMA 4NLWA 2UV8G 2QYGA 5K14A 2KXNB 1JLAA 4OZNA 4I68A 2VG6A 3RYLA 3NGTA 3NG8A 1HQEA 2QSWA 2V94A 3ET6A 2HNYB 3IC1A 5KOXA 1U47A 2CUYA 1VOMA 2ABYA 5HVHA 4KC5A 3A4TA 2YX7A 1S9EA 5KFOA 2UUCJ 1X4DA 3KLVA 2Z2LA 3KLEA 4C8YA 1MN7A 3MDFA 4HLBA 4FPRA 2VPWB 4GC6A 3KK3A 2Y1IA 1K8AT 3W1YC 5KFPA 4A48A 3KLIA 2OHDA 2MKSA 1JQGA 3FRYA 4NZ6A 4C4WA 1VBXA 4A8OA 1S1VA 4O4GA 4HHHA 3TUIC 4NLRA 3MPDA 3R7NB 1TV6A 4W92B 3G6VA 1FRXA 1OS5A 2DGWA 4FZVA 4ED2A 3DLJA 4ED3A 1B70B 2JC1A 2MKKA 2VV5A 3FZ2A 4RZRA 4PQUB 1FEHA 4DR1J 1N36F 5D15A 1GTEA 4J9SA 3M9MB 2IC3B 2YKMB 3DDKA 4U9RA 4YHHF 1NPRA 2VPYB 3CCUS 4DQRA 3ZO7A 3UFCX 5HATA 1IKVB 2MLZA 1FVQA 3EXYA 4DX6A 1R0BG 3RB3A 2P9GA 4DPXA 4DV0F 2PIIA 1XEZA 5DJBA 1QAXA 1T8EA 4WYWA 2FVPA 2QLWA 1DZ5A 3SEOA 4I2PB 1AUSL 2G0JA 1NU4A 4MH8A 1SJRA 4NI2A 2IYIA 4PG5A 2OLWA 1U02A 1OY6A 2RH3A 4N7TA 4JI1F 3NNAA 5GAGU 1RAFB 1TK8A 1HIYA 4OYIA 1B7FA 1QAIA 4HL9A 2J6SA 1ZZFA 4GKKJ 2J7WA 4X84A 4OYPA 3ILLA 2MY7A 3UVJA 4QWDA 4UZCA 3VR1A 3OTEA 1HNZF 1C1CB 2QEXS 1CQNA 5HQLA 2B9YA 2M52A 4CLFA 2VQEF 1SQFA 2XNQA 3GCWP 4ECVA 4ETXA 3HVTA 1RWWB 1VLYA 4DN0A 4JBCA 1UJ4A 4P2MA 1RXOB 2PSZA 2WVFA 4Q8FA 2VFVA 1RU1A 4EO6A 4IRCA 2AJ4A 1WHWA 1N8RT 1P9QC 3I0RB 4FBUA 1SC4B 4DQIA 2M4MA 5KFZA 4JI5J 4ES3A 2HRUA 4LF2A 4ZK7M 2DTJA 2GQQA 1VRTA 2J9DE 2OFGX 1AROP 2Z0GA 2Q79A 1P1LA 1CPZA 3NMRA 2DNKA 3HHLC 2ZOGA 3TZXA 2R9LA 3AH6A 4DLEA 5E3RA 3QIPA 4QW9A 3I4PA 4KGVB 4MJKA 3M30A 2HHVA 2IVFB 3AT1B 3JSBA 5BR8F 2DB1A 2I5JB 4TYAA 4DL0C 1SKUB 3CCSS 2UXCF 4RWWA 1Y11A 2ZH8A 2ALZA 2H48B 4CO2A 4MAKA 1UW9A 3GSIA 3M8PA 5AE2A 3SCJE 2GC8A 7FD1A 1FK9B 2UVVA 1S1WB 5D4PA 2DPIA 5IZHA 1F0XA 4DR7F 1UP1A 2OTLS 3GR0A 2YXLA 2DEIA 4RU9A 5SZTA 3C19A 2BA9A 4CLWA 3E01A 1BQNB 1HNVA 2W9AA 1VK3A 1JWWA 2ZOFA 5F8HA 1T3OA 3D6FB 4U7UD 3ILOA 1F6TA 3NGRA 4UTGA 2GMJA 3GYXB 3ZZRA 3C6TA 3DYAA 4DZ6A 3VAJA 3WC0A 2MQMA 2N4CA 3VQSA 5HMWA 2C3UA 1HMVB 1RT7B 4EMDA 1TUWA 1PJ6A 5CA5A 3QWPA 2CQPA 2BE2B 1WKKA 4FBTA 1FJGF 5LXRA 3V6DA 3LAMA 3QSYB 1VC6A 4DV1F 2EI5A 2NCKL 4LF5F 2IDLA 1WSVA 4JYAJ 2N3LA 4OHWA 1RB0A 2HBRB 3EPGA 3PRVA 4FF2A 1U6FA 3K2YA 3BR8A 1X4HA 1NUEA 5HLFA 3G6ES 3ISND 1KNZA 3SI8A 3V6HA 4K4UA 1DLOA 3BGUA 2XLJA 3QLHB 3SSRA 3ZZZA 4OIXA 1PJ7A 4NA3A 4D3HA 1E6YB 4AD6A 3CJKB 2VJVA 3MUMP 2D74B 2K3KA 3DRPB 3M6UA 1KLMA 4ZPVR 4LIWA 4A8KA 2NUHA 1F2HA 3OFGA 3MI7X 4KR0B 3V4IB 4FXDA 2L9WA 2ZH9A 2IM3A 3R1HA 4IQMA 3FGVA 4ZVTB 5GMKa 4NLPA 2G0CA 1F9EB 3OFEA 1FKOA 2ZJPQ 2FVCA 4DWIA 3OL8A 1RTJA 5EGYA 1HNWF 3PKYA 1DRZA 2FJDB 2E7XA 2FYXA 4OLPA 3GJSB 3QAEA 4DFPA 2MGZA 5KFFA 3A13A 2V34A 2ZBQA 3GYGA 3NNCA 1SKRA 2UV8A 1T7PA 4DV3J 2FTRA 4OJHA 5E33A 5C2CA 5K20B 3PV8A 1WORA 4F36A 1NLKL 2RMLA 3BQ1A 1LW0A 3OLAA 1R3NA 2W9CA 4P73A 4NLGA 2F5GA 2PMHA 2B8QA 2B43A 1PCAA 3FVYA 4A4JA 3NNHA 2CPEA 4CNYA 3ZTRA 2MQNA 4I7FA 4DPUA 1B7YB 3DDNA 5C25A 5IQQA 4DN9A 1XMBA 1WTFA 1RT1B 3Q8PB 1JX4A 2VDIA 2BW7A 4K5SA 5U47A 3LP0A 2Y3YA 2DGVA 4IG0A 3R6GB 1S5ZA 1UEKA 4ECXA 4MIBA 4A8WA 2D9OA 2PO4A 4WK3A 3N01A 4PXCA 1M0SA 4C11A 4BWJA 1ZA1B 4RNOA 1OWXA 1SKWA 2O1PA 2LXIA 4B3OB 4M5DA 4LRAA 2K7KA 2OUGA 4AQYF 1IQTA 1RBOB 3G71S 2RUGA 4ZVQB 4AXJA 1SI9A 1KD1T 1TKZA 4DQSA 4Y6IA 4O3QA 2DGSA 4X65F 2YNFA 3VAMA 2X1GA 5JVGQ 2DKOB 2IIHA 3W9HA 4HACB 2ZUGA 4ZHRB 2FGOA 2V8PA 1KKHA 1FXDA 2ZZTA 1YBTA 1FVSA 2VG7B 2YQ1A 2AZ3A 4X66F 2IA6A 2E5HA 3OBIA 5F0UA 4M5GA 4AL5A 1YWXA 3PW0A 2XYHB 4ES1A 1FCAA 3LGNA 2LVWA 3HD2A 1VQ4S 5GAEI 1FFSB 4ICLB 5HP1B 2DBBA 3TVZA 2FJBB 2CZVC 1H2TZ 4LF9J 3SCLE 1KP6A 1MWYA 3FFIB 3OTOJ 3TAQA 1RT3A 1FE0A 1S9FA 1FE4A 4P2FA 5DRKA 2BKPA 7AT1B 2A2CA 4QPXA 2BJ3A 4ED6A 5KG5A 3G2XA 3OL7A 2V2QA 4X4RA 3Q8UA 3N0VA 4WE1B 4NXMJ 4OMFG 2BJ9A 3H90A 1FI4A 1HBNA 2IJNA 2R3VA 1OMSA 2FVSA 3GB0A 3ILIA 4BC7A 1DY3A 3NY0A 1FTCA 3MEEA 2YNGB 4RNNA 1VCTA 1F9FA 2B51A 4PUOA 2RIJA 5CYMB 3W60A 3ZTPA 1YBUA 3RW6A 1V3SA 2VF3A 2XSFA 1NPKA 4O3SA 3M2VB 2Y8WA 2OPQA 3UR3C 2BX6A 3L3CA 2BOAA 1VQNS 3C8YA 4A47A 1CS4A 3HLUA 3EVOA 2MZ1A 3VALA 2RE1A 2OMOA 2U1AA 4EZ6A 1YRUA 4RNFA 3MD1A 3CD5A 3G8TA 4N47A 5IWAJ 4JI8F 1L3TA 4LFBF 2AJ1A 4TLQA 3J81Y 2QLXA 4ZVEA 3FDSA 2ZH2A 4CO3A 4DR4F 2LLZA 2QIFA 1O8BA 4HVZA 4FKYA 1QE1B 3W7BA 1UEUA 4C98A 3N5FA 2DGUA 1EQ0A 3KOAA 3K8VA 3PACA 1N32J 3IWLA 3BGRB 4CT9A 3CPWR 3FNNA 4OI3A 1I3OB 3NGDA 2F4VF 3TUPA 1JLFB 3CCMS 3QJJA 2CAJA 2C2OB 5J2PB 2R7SA 5I3UB 1VYAA 3FRZA 3D3CJ 3MTJA 4RLEA 4OYAA 2CQDA 1I51B 2LQ5A 5F8MA 5DLFA 4KB7A 3W65A 2C28A 5I42A 1Q16B 1S1UB 2HK3A 4LUBA 4DR2J 3CMQA 3JSMB 1EJ7L 3QO9B 4X4UA 1Q8LA 1SJQA 1AYEA 5A2QU 1DQAA 1T9VA 1UAWA 1NZ8A 5KG2A 3TQ1A 3B4DA 3PRBA 1TAUA 3MR6A 3KHHA 1MWQA 5H9FK 3TANA 5IM0B 3G6YA 5K9FA 2WOMB 3G9CA 3J81j 2A1BA 1T03A 2FVQA 2WB4A 4ZIVA 2VG6B 2MKJA 2HHHF 4HH0A 2JVRA 2W4CA 4O3NA 4DV2F 1LWXA 2KT2A 4L73A 4KTQA 3P96A 2Z58B 2KM8C 1VHIA 4LR8A 5F3TA 5KT6A 3HK2A 4O44B 1U1MA 2B3TB 3EZUA 3RR8A 1MW7A 1RYSA 1TKXB 4FDFA 3SFGA 5CABA 4PXEA 4LF6F 2MQ8A 5A8KB 1LV5A 5L46A 3JAMU 3GFYA 2Z2ZA 2LKZA 2RQCA 1H73A 1ZETA 2LEAA 3CGIA 1U8SA 2YNIA 1I1GA 2F7VA 5LSLA 1S1VB 2CDQA 3M2UB 1VQ5S 2YTCA 4ILLA 1ROFA 4WIIA 1JLQB 3V6JA 2EC2A 3OSPA 3EGVA 4DCOB 1X31C 3CF5Q 2IAJB 4ZA1A 3FBEA 2LEBA 1MNEA 1D8YA 2RKIA 2I6WA 3CWJA 4KGKA 4XIUA 3Q8QB 4IH6A 1HI8A 2DISA 4HTIA 3UCZP 3M8YA 3NL0A 1UJ5A 5IC4B 1WTBA 2Q6CA 4O3PA 2V50A 3RB0A 2IRXA 2CPXA 1AA1B 3GMGA 1FESA 3BGFA 2QJ3A 2BANA 1Z1ZA 3DOLA 1XNRF 2KG1A 3EZOA 5E2QA 2WB1D 3JB9k 5D3GA 2DVIA 1QUVA 3TEGA 4P9SA 2W7AA 1MN9A 4J9RA 4IOAQ 2H51B 2XHWA 3IBFB 1JIHA 5KT7A 1SIWB 4ZLJA 1UWAA 3CJ8A 4U8VA 5J2NB 1ITPA 1VQYA 4E0DA 1VQOS 4H4MB 1SJ4P 2ATCB 5DDOC 2QO3A 2W8KA 3G4SS 3KK2B 4WP9A 1V3ZA 3HCXA 2W7OA 4YEAA 3V4MA 1Q81T 4USJC 2RRAA 4NXNF 3I4HX 3UVJB 3LTOA 5K8OA 2JOQA 4BLGA 3AJDA 3M9NB 2CG8A 4WP8A 1HWUA 4L75A 1HBOB 1TVRA 3CJ2A 1I94J 5ETTA 2RU3A 5CXTA 2BM0A 2UVRA 1GFWB 4OYBA 4JP8A 1YIJS 1A6LA 1UPMB 3TYTA 3D1QA 4NCBA 4X62J 1GAOA 5KFBA 1N34J 3I32A 2GIFA 3OV7A 5LMNJ 4F3QA 1CC8A 3PR5B 2NSCA 4XPCA 1F5BA 3DN9A 2XY5A 3QIPB 4FVMA 1PG5B 2MQLA 1ZAVA 3GFXA 3T1HJ 3G82A 3M30B 2HG4A 2BQ3A 3NBPB 4WXOA 1JLCB 1QM9A 2VBWA 1TL4A 2G2ZA 1BQMA 1TMJA 3ZTQA 3BDEA 3D4JA 2WW4A 3KLHB 2ZOMA 2DY9A 2F63A 1RWUA 4C8LA 4OX9J 2MPUA 3MCNA 2ZUAA 1YJNS 1PBUA 1HR0F 1UTAA 5DLGA 4DSIA 1NK5A 2LECA 1REVA 1FXRA 3OXGA 2MJNA 3SSSA 4V19X 4ANCA 2D3O1 2A6MA 2VQFF 1OSDA 3TOQA 1HNVB 1VQLS 3RGIA 2QN6B 4LSLA 1LWEA 2W4PA 1AB8A 4FYDA 3DYAB 4F0MA 4TY9A 3P5TL 3RBEA 3C16B 1VQ8S 3FUYA 1RAJA 3N6LA 4G1QB 2OEKA 3GE9A 1CJVB 1W7WA 1IBLF 1KFDA 1TMMA 5JXSA 5F8JA 2GVDB 2Z2YB 4E8UA 2PT0A 3KG0A 1H72C 1CJKB 4DZDA 1IKYB 2AJFE 2PDAA 4URGA 4NCGA 2ADCA 4HHJA 4CRJA 3OD2A 2FUG9 3TWZA 4JV1A 1MMDA 1NH7A 2DXEA 2V2VA 2B7BB 4QR2A 2AWZA 2G2OA 2UXBF 1FJCA 2FJEB 3AA9A 3DI6A 2V68A 2HNZA 1ZM2A 1BHNA 2BJ1A 2MKHA 3A3PB 2XO6A 1YJWS 3FJ2A 3W61A 3RRGA 1EZZB 1F3VA 5L9NA 4X4TA 2G9OA 4CCHA 2PN6A 4Y28C 3R97A 1KQFB 3PYGA 1KDNA 1PC4A 2RHQB 1RHUB 3H25A 2VONA 5B7WA 4FPIA 2AIRB 2AJQA 2FZKB 3RB6A 3OR2A 1JNRB 1CEZA 4PCQA 2FY8A 1U26A 4J9VA 4I56A 1TP7A 3K0JA 1RE1B 3MM7A 2BQUA 3D2WA 2UVWA 3S7RA 3PEHA 4DUTA 1IR0A 4ZVGA 5ETRA 1RP5A 4O4RA 4OYOA 2A18A 2BACA 2YH1A 4KO0A 1LKZA 1B3TA 4Q0BB 1N5QA 1WG5A 1JXEA 3RW7A 3VGVA 1LW0B 3ZNUA 2M9KA 1VJWA 2W9CB 2KXHA 3OUYB 1HHTP 4YB6A 4Y0FA 4UQGA 2ERRA 2RILA 4P10A 4ELVA 1X4GA 3EGNA 3M4XA 4KFBA 3CCES 5C25B 3GSDA 4XDCA 4YR3A 3UR0A 1T0TV 3GILA 2WONA 2BUNA 4L74A 4DSEA 3LP0B 1WC6A 5LJ3Y 1GTHA 2DCLA 3ITHA 3N4WA 4YN3B 5ETPA 1HI1A 1P9YA 3EM1A 3LF0A 1U25A 1N36J 3M8ZA 1TZ0A 1JJCB 2HBQB 4NLYA 1OY8A 4LRBA 4YHHJ 1YJ9S 3IBWA 3ULHA 2CADA 4MK9A 1CJUB 2WSCC 3K59A 1FX4A 3N5BA 4WCEQ 4NYZA 4DV0J 2DR6A 5L1KA 2AYMA 3MCMA 3AJ1A 2H65B 1MU2A 4F4ZA 4NMLA 1SUQA 5L1JA 2BZ2A 2FVRA 3B82A 1S1TB 4CO5A 3D5MA 3HMJG 4LFCF 3KLFA 4WF9Q 1RA7A 1WNEA 3TVKA 5DQGA 1NKEA 4EYHB 2EEYA 2PMZD 3O6QA 4JI1J 1HYSB 3HHLB 4CLTA 2CJ9A 3FCHA 1WUUA 3Q22A 3Q23A 4RW7A 5THWA 2AV5A 3FBCA 2GNKA 2E5LF 3GV8B 4CIOA 3QJPA 2D3UA 1WC3A 2RB7A 1NDLA 3J7A1 3M2RB 2GW8A 2A3JA 4RR5A 1HNZJ 1FKAF 1TR0A 4LR7A 1HNXF 2HFVA 4Y2MA 2VQEJ 4ID5B 1RWVB 4BCAA 2MSSA 2ZFHA 1NDCA 1S7IA 2VHGA 1RAEB 2GGPB 1K0VA 2NQPA 2HFNA 3GJRB 1GQEA 3QT8A 1EHWA 5T7LB 3ZNJ1 2B6AA 2NPFA 4OZJA 1NB7A 2AJ0A 4L3KA 1YG0A 4RUBA 2CKWA 2KJWA 4Y2IA 3H4BA 3A8JA 3BSCA 1N5YA 2HURA 4PUOB 1MROB 2G2YA 4OX8A 2YWGA 2CIMA 1RDRA 4KGXB 2V4RA 4A8MP 2HNDB 1XWLA 4B3TF 1CLFA 3UO0A 2NZCA 3IS9A 2FHKA 2C3OA 5L1LA 3KLGB 3FSYA 5BR8J 1U1PA 2E1AA 2LU1A 2BRLA 2UXCJ 1FJ7A 2VA2A 3BSOA 2KH9A 5J1EA 3IR6B 3J7YI 2R7QA 4B9VA 3FK4A 2HFZA 4DR7J 4N8NA 1J27A 3CJ0A 3R2CJ 1ZOTA 1ZAWA 3E3XA 2R8GA 2OPSB 3CC4S 3KWMA 1VDHA 5D4LA 1MSWD 3IFEA 1XR7A 3DGPB 2X1AA 4ECYA 4R5PB 1NH8A 3LWLA 4B9SA 3MTKA 1U48A 2AYBA 5F41A 4QR1A 1C4CA 4KV8B 3HPOA 2HHTA 4J9OA 1FJGJ 2CPHA 4LSNB 1HKAA 2APOA 4DV1J 2LQ9A 5L1IA 2NPIA 4LF5J 4K59A 5HQMA 3W2WA 1Q5VA 2YNHA 2XNRA 1TL1B 4G65A 2GV1A 1Q53A 1PJ5A 3FEZA 3QGGA 1VR6A 3T5LA 2CNOB 4DFKA 1C0TB 1NBEB 4J90A 5BYRA 3ICLA 1UL3A 3VHQA 1UVJA 3R3TA 5J2MB 1KQSR 3QATA 5A8RB 1X4BA 1TKTB 5KAKA 4NA1A 4PWUA 4USHA 1SBRA 3TW0A 1QSYA 3H5UA 3FEXB 2B5JB 2IC3A 4IOCQ 1A0OB 4Z7CA 4J9QA 2ZHBA 1NKBA 2K7JA 1IKVA 3KJQB 2D7SA 1U1NA 2YKOA 3A8EA 4K50A 4C0BA 3D68A 1WJ9A 5HJXA 1DFDA 3PZPA 1ZH5A 3I82A 1BWEA 1LW2A 4C8KA 3P49B 3BBBA 1YITS 1WEYA 2VFUA 1FNMA 4DX7A 1HNWJ 1GNKA 5FIIA 4I2PA 2CQ0A 2LFVA 3MFIA 4KH1B 2W2PP 4FNHA 5A8WB 2ASJA 3HKZD 4QWCA 4ECQA 1LNQA 2N7YA 4OV1A 1JKHB 2U2FA 4WFBQ 1SH0A 1C1CA 2FC9A 5E3AA 1FNXH 4YMEA 4O23A 4K4WA 4IRDA 2DGTA 1N6QA 4ZVSB 1H74A 1RTIB 2RF2A 1LOUA 3OFHA 4RW6A 1J5OA 2PFFB 3CVKA 3QYYA 2KVQE 4AE5A 1VI7A 1RZMA 3LAKA 4N8OA 3DOLB 4ZJLA 1IN0A 1WHYA 2JRSA 3I6PA 3CUNA 3I0RA 1UA0A 5CYQA 4J91A 4PEOA 3AQPA 3HO1A 2MEWA 2PFDA 1RLDA 3H5XA 3J7ZT 1JNZB 5GVQA 3V5RA 4DS4A 1PYOB 3W2VB 5DGBA 1HWLA 1G2EA 3A8IA 3KUGA 5GAHU 4A8XA 3R7BB 2ILYA 2AYEA 3IAM9 2KT5A 4AQYJ 1X9SA 1IWGA 2CJAA 1AT1B 4ECZA 5DG8A 4NWBA 1P6TA 1RT6B 1ZZNA 1RAOA 4DDFA 3IN5A 2C3MA 2CG4A 4X65J 4P7TA 3JQJA 1SL1A 4UW2A 1M5PC 2DYAA 1BY9A 5IV4A 2I5JA 3DMJB 2O3DA 4X66J 2HMIA 4F25A 3LA0A 2YPZA 3D3BJ 2EBEA 4QPTA 3OW2R 1IBMF 1TVRB 3D0IE 3CCZA 3HHKA 2IBKA 1FK9A 4M63A 1S1WA 1S6UA 4DV4F 1PBAA 1WSRA 4ZJQA 2G1DA 3PO5A 3MPYA 3PFEA 3VGTA 2WHOA 4M95A 1SL0A 5M2PA 1O6XA 1KHWA 1RT2B 4W98A 1AZSA 3PR4A 1VJQA 4LF4F 2NSBA 5EHHA 4K7QA 5KFSA 3GWCA 2RD5C 4OX6A 4EUVA 2MXYA 4F2RA 3H20A 2QZ8A 3LQVA 4AUKA 3EMTA 2L48A 3HI9A 5B0FA 3HX9A 5C24B 4F8RA 4USIA 4WXWA 2IDEA 1HMVA 1RT7A 2OEMA 4PWDA 3J7YU 2RRBA 1VHFA 2IM1A 2BE2A 4ZITA 5EUHA 1FRHA 2EFQA 1U45A 4AL6A 3GG1A 2XO7A 2E1MC 4K4TA 4JV5F 4DSLA 5B0CA 2H4WB 2RVJA 4EK2A 3IG1A 1IM6A 6AT1B 1WD6A 4JUZA 4NMXA 3U1MA 1HARA 2XZDB 5JUMA 5GADU 3EX7B 1QVFR 1KRPA 1NXIA 5D78A 1CBKA 4K4SA 2XCAA 1Y5LB 5HROA 2FLPA 1E6VB 4Q43A 3CJKA 4JI8J 2HLTA 4LFBJ 1WI6A 4JI6F 2ZE2B 1P8GA 2K8GA 1M90T 2VODA 4DR4J 1Z2LA 3BDPA 3T6BA 3HVRA 1VQKS 3V4IA 4LSLB 1LWEB 3GR1A 3QAUA 3HFZB 2J8AA 3BR9A 1LXNA 2MY8A 3MM6A 4AT1B 1UFWA 2XYPB 5GMEA 1FRIA 5KFMA 4YB5A 4FYVB 1JJ2R 5DZ6A 3SFUA 1SCJB 1J5EF 2F4VJ 3ETMA 2DIUA 4OZ1A 3MCOA 3MECA 2DNRA 3MPUB 3IR7B 4Z7YA 4DV7F 4IOBA 2CPJA 4X4OA 2KVIA 3M8RA 2KN4A 3ZZUA 2KM8B 2XMUA 4RO0A 4NCGB 3RR7A 5T14A 1TKDA 2JSXA 2QFJA 4F4YA 4KKOA 1B0TA 1FA0A 2HLUA 2VFSA 1O51A 4RUCA 3KG1A 1SC3B 2ZD1A 4UUWA 1IKWB 1U4BA 3KK1B 5DZ7A 4PRFA 4CO1A 3Q0AA 1XC9A 4UY85 1RT1A 3K5PA 1JLEA 1IBCB 3W9JA 1HD0A 5D0HA 2EFOA 2YX4A 1Y00A 4Y00A 1TFWA 1ACMB 2HHHJ 4FS2A 4ZPCA 2DRDA 4DV2J 4DCPB 4RX6A 4DR5F 1RHQB 1H2VZ 2CNNB 3MMAB 5C2GA 3TEHB 4OHYA 4B3OA 4QU7A 2MZRA 4R0EA 3R7SB 1NSAA 5BXIA 4B9UA 4X64F 3R2DJ 2CJQA 2AF6A 3CDUA 1BGXT 4EWTA 2BJDA 1VMBA 1CVJA 1NCLA 2GHWA 2XC9A 4YDDB 3UNGC 4Q5VA 5LSOA 2GQCA 4EGLA 1RJJA 1VBZA 4LF6J 4FF3A 3J81U 2OMLA 1HQ2A 3QFWA 2EFPA 4Q7AA 1YJ7A 4O0NA 2LQJA 3I9ZA 4HACA 3VAIA 4QZVB 3J7AN 5LMUF 3HT0A 1RKJA 4D3GA 2VG7A 1BC6A 3MEDA 1X0FA 2VG5B 3SQGB 3D6HB 1QJHA 3RG6A 3FMWA 2VICA 5KFNA 1WEZA 3MAQA 4MYTA 1KHVA 3MM8A 2J8SA 4ICLA 5L38A 3RBDA 1VBYA 1WELA 4WFNQ 3ENQA 1NDKA 1BD6A 2UU9F 1UZDA 1DURA 1GXTA 4DSFA 3EDRB 3K89A 4J9MA 3DNCA 3KKFA 4PABA 1X4CA 4LMZA 2H1YA 4K0KF 4I4BA 4O3RA 1JLGB 1XNRJ 2MZQA 3R1LA 2ZBPA 1H7WA 4LF8F 3C2PA 4F2SA 2DNOA 1YDLA 2YKNB 4OHVA 3CD0A 2PA8D 1UPPA 2VZ9A 3D1OA 4ECSA 1AFIA 3TJAA 5CYMA 4IH5A 2Y9HA 2QRRA 3BREA 3THVA 4FXWA 4PPZA 6FD1A 4NXNJ 4DPOA 3EWGA 3T5JA 3BJYA 3MPWA 1UCNA 3KJVB 1MWZA 1XNQF 1RU2A 2XYGB 2OPRA 3OR1B 4DV5F 3ZZYA 5DQHA 3IWXA 4GVLA 1IVZA 1LEOA 1T05B 3PDNA 2GFFA 5KFQA 3WQPA 4X4SA 2NZ4A 5HK4A 4LVOP 2YKPA 1AUDA 3QRPA 4IDKB 4M5LA 2WAQD 2LA6A 4B3RF 3BSNA 1F2GA 3B54A 2B9WA 4DSJA 3NP5A 2KFNA 5A0YA 3C6UB 3BGRA 2HHWA 1X4EA 5E5NA 4AFFA 2ZWOA 2Q1LA 4CWBA
chains in the Genus database with same CATH topology
2KL8A 2UUBJ 2UXDJ 4JI8J 3OTOJ 1FJGJ 2E5LJ 4LFBJ 3J7AN 2MEWA 4JI2J 4B3TJ 5LMUJ 4YY3J 4DV1J 4JI6J 1HNWJ 5A2QU 4DV6J 1HNZJ 4LF5J 2ZM6J 4DR4J 4JYAJ 5BR8J 4LF4J 3T1YJ 2VQEJ 1HNXJ 4NXNJ 4AQYJ 2UXCJ 4DR1J 4NXMJ 1N36J 4DUZJ 1IBLJ 3T1HJ 1N33J 4KY3A 1N32J 1XNQJ 4YHHJ 4JI7J 2UUAJ 4B3MJ 4DV5J 4RJVA 2UU9J 4DV3J 2UUCJ 4DUYJ 4KYZA 4DR7J 4NEZA 2HHHJ 4X65J 5FLXU 3R2CJ 4JI3J 2F4VJ 1J5EJ 4DV2J 4GKJJ 5LM7E 1I94J 4JI5J 4DV0J 3IMQJ 4OX9J 1IBKJ 4DR5J 4JV5J 2MTLA 4K0KJ 1XMQJ 3W1YC 4DV7J 4DR3J 1HR0J 3R2DJ 4KHPJ 4X64J 4X66J 4B3SJ 1XNRJ 5IT9U 3D3CJ 2UXBJ 4LF7J 4DR6J 3D3BJ 4V1Ak 4PWWA 4LF8J 4LFAJ 4B3RJ 4LFCJ 1IBMJ 4JI4J 4NEYA 2MQ8A 4JI0J 4LF6J 3J81U 3JAMU 1XMOJ 4X62J 2VQFJ 2KVQE 4JI1J 1N34J 4HHUA 4DV4J 4LF9J 4GKKJ 5AJ3J 3J80U 5IWAJ 4DR2J 5LMNJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KL8 A;  2UUB J;  2UXD J;  4JI8 J;  3OTO J;  1FJG J;  2E5L J;  4LFB J;  3J7A N;  2MEW A;  4JI2 J;  4B3T J;  5LMU J;  4YY3 J;  4DV1 J;  4JI6 J;  1HNW J;  5A2Q U;  4DV6 J;  1HNZ J;  4LF5 J;  2ZM6 J;  4DR4 J;  4JYA J;  5BR8 J;  4LF4 J;  3T1Y J;  2VQE J;  1HNX J;  4NXN J;  4AQY J;  2UXC J;  4DR1 J;  4NXM J;  1N36 J;  4DUZ J;  1IBL J;  3T1H J;  1N33 J;  4KY3 A;  1N32 J;  1XNQ J;  4YHH J;  4JI7 J;  2UUA J;  4B3M J;  4DV5 J;  4RJV A;  2UU9 J;  4DV3 J;  2UUC J;  4DUY J;  4KYZ A;  4DR7 J;  4NEZ A;  2HHH J;  4X65 J;  5FLX U;  3R2C J;  4JI3 J;  2F4V J;  1J5E J;  4DV2 J;  4GKJ J;  5LM7 E;  1I94 J;  4JI5 J;  4DV0 J;  3IMQ J;  4OX9 J;  1IBK J;  4DR5 J;  4JV5 J;  2MTL A;  4K0K J;  1XMQ J;  3W1Y C;  4DV7 J;  4DR3 J;  1HR0 J;  3R2D J;  4KHP J;  4X64 J;  4X66 J;  4B3S J;  1XNR J;  5IT9 U;  3D3C J;  2UXB J;  4LF7 J;  4DR6 J;  3D3B J;  4V1A k;  4PWW A;  4LF8 J;  4LFA J;  4B3R J;  4LFC J;  1IBM J;  4JI4 J;  4NEY A;  2MQ8 A;  4JI0 J;  4LF6 J;  3J81 U;  3JAM U;  1XMO J;  4X62 J;  2VQF J;  2KVQ E;  4JI1 J;  1N34 J;  4HHU A;  4DV4 J;  4LF9 J;  4GKK J;  5AJ3 J;  3J80 U;  5IWA J;  4DR2 J;  5LMN J; 
#chains in the Genus database with same CATH topology
 1JLF A;  3RZA A;  2CDR B;  3B78 A;  1D0E A;  1HBM B;  3LGH A;  2YWK A;  5J2P A;  3JTO A;  1T95 A;  2ACY A;  4WTO B;  1GMV A;  4QIE A;  1NJX A;  2J0Q D;  4NLV A;  3A12 A;  2IFX A;  2FY1 A;  1S97 A;  2BKN A;  3KTQ A;  2ZKU A;  1NKC A;  1K1S A;  3BGL A;  1T94 A;  1CG2 A;  3L7O A;  4QWA A;  1S1U A;  2IA0 A;  3N6N A;  4WP3 A;  2AJ2 A;  3IR5 B;  1OJ4 A;  2P2C B;  2HAI A;  3JSM A;  3QO9 A;  4HTJ A;  2NLW A;  2OPP B;  4FYX B;  1JJ4 A;  3CE8 A;  1JB0 C;  4ZCM A;  3FSX A;  5DG9 A;  1WI8 A;  3VGU A;  4XK8 C;  1RT5 B;  4A8S A;  3DC2 A;  1EAR A;  2RU9 A;  3CDE A;  1QSS A;  5HBM A;  4TU8 A;  1HR0 J;  3L4B C;  4WYL A;  2XMT A;  2VDH A;  2W2O P;  3W63 A;  5IM0 A;  2AKW B;  3NGK A;  1BXN A;  1VIO A;  2KT3 A;  2X1F A;  3MXH P;  4U7U K;  2VQF J;  1REG X;  2OTJ S;  1FFG B;  2VB6 A;  3N28 A;  4M5I A;  3MR2 A;  3ZZ0 A;  2AU0 A;  2E9T A;  1S59 A;  2CWK A;  2OSQ A;  2MKI A;  2FDN A;  2DNY A;  1VBK A;  1JJH A;  1Q86 T;  3BKF A;  1N0V C;  2ZZM A;  5CCM A;  4RW4 A;  4OI2 A;  4O44 A;  2OI2 A;  2ALY B;  1EKS A;  4EFA C;  1TKX A;  2CPD A;  2Y8Y A;  3DU6 A;  1N56 A;  4CZC A;  5A8K A;  5J2Q A;  1IBL J;  2KKH A;  4C3M A;  3MR3 A;  2HHP A;  3MMC A;  2CQ2 A;  3NCR A;  4R8U A;  3MMB A;  2DXD A;  4P75 A;  5B0E A;  3W2W B;  2YNH B;  4NOH A;  3K8W A;  3M2U A;  2Y1J A;  4OQJ A;  3QFH A;  4UY8 T;  2GCF A;  1CUL B;  1VQ6 S;  3PKM A;  2XM3 A;  5BYS A;  1JLQ A;  2E1R A;  3PVX A;  3HKW A;  2E7V A;  3I9V 9;  1TAQ A;  2UXB J;  1RWM B;  3BYP A;  1EET A;  2CA9 A;  3PJW A;  4M8L A;  2CQB A;  2IAJ A;  2V0N A;  2R8I A;  4DL6 A;  4U67 Q;  1RYR A;  2EC0 A;  4DPT A;  1TFY A;  1XK8 A;  4O0I A;  2LQB A;  4QCL A;  1ZS6 A;  2YVS A;  1SVD A;  2QMW A;  2HYI B;  1U1R A;  4TQS A;  1U8W A;  4F3O A;  3NMA A;  3BH6 B;  3DFE A;  2JDJ A;  3VWS A;  4ZLP A;  5KFK A;  1XIQ A;  3FCW A;  5C42 B;  1WC1 A;  2M7S A;  1LWC B;  1Q8I A;  4DEZ A;  4L3N A;  1IM4 A;  1RAG B;  4X2B A;  3TA0 A;  3TA1 A;  4RKU C;  2DGO A;  2IYG A;  4QJV A;  4YB1 P;  1FDB A;  2CPF A;  1NHU A;  3TR5 A;  2IY5 B;  1LW2 B;  1R31 A;  3AOD A;  3GIR A;  2HIQ A;  1UVK A;  2FHO B;  3DLH A;  5J2N A;  2W2M P;  1IWA A;  1R0A B;  2B56 A;  2MHN A;  3S1T A;  4MT1 A;  2HBY B;  1RAD B;  4H4M A;  4Y65 A;  1L3S A;  3CO0 P;  5C7P A;  3KK2 A;  2HHX A;  3B8H A;  4MK7 A;  3M32 A;  3VAF A;  3WIV A;  3HJF A;  3K58 A;  5AT1 B;  4ED4 A;  2IBO A;  4N5S A;  3K5M A;  3OVA A;  2VOO A;  3BQ2 A;  1GT8 A;  2W24 A;  2M5Y A;  4OZL A;  1R6Y A;  2ZH5 A;  4ILR A;  1CC7 A;  2BMB A;  1HBO A;  3T5H A;  1N6Q B;  4W90 B;  4JI2 F;  1QLN A;  2RF2 B;  4RW6 B;  1J5O B;  2NXE A;  4DQP A;  4M1K A;  2OIH A;  3MF5 A;  5KFI A;  4EI2 A;  4ZP7 A;  4USU A;  2VFR A;  5CYQ B;  5IXU A;  2WCX A;  5CH7 B;  5E0O A;  1GEH A;  3WX8 A;  3Q83 A;  3AFG A;  2GML A;  5KG4 A;  3AXK A;  3D6M B;  4JI3 F;  2QMX A;  1FD2 A;  1T9X A;  1M5K C;  1XQI A;  3MAA B;  3MM5 B;  1Y3J A;  2XY7 A;  1KON A;  4P2X A;  4V1A k;  1R8C A;  4LFC J;  4I6W A;  3NBP A;  2QLF B;  1FER A;  3CMA S;  1JLC A;  1FWP A;  3W8P A;  3VVU A;  3W64 A;  2OGU A;  5KG3 A;  2HMI B;  3KLH A;  5F8N A;  2E5L J;  4LRF A;  3ZZT A;  3OXL A;  4DL7 A;  1F3F A;  3HHD A;  4C48 A;  2K3I A;  3TP2 A;  3G8S A;  3NAI A;  3NOG A;  1HNX J;  1DQ8 A;  1R43 A;  2KHD A;  1IR1 A;  4QYZ J;  4DUZ F;  4DXL A;  1LXJ A;  3TX8 A;  3HZG A;  1PAU B;  3OT9 A;  2AT1 B;  3OJS A;  1AZS B;  1H2U X;  2E44 A;  3DRX A;  4KPY A;  3UCU P;  1AW0 A;  4IFV B;  2J5A A;  2CZ4 A;  1MML A;  3GIM A;  1YK9 A;  1V3R A;  3C16 A;  4GVB B;  4G1Q A;  4PWD B;  4DHV A;  3MEK A;  1CJV A;  4TNO A;  2Z30 B;  1YZ6 A;  3UDE A;  1URN A;  3H2U B;  5AXL A;  2NXU A;  1R89 A;  4JI0 F;  2RS2 A;  2J7K A;  1OO0 B;  2GVD A;  5F0W A;  1HW9 A;  1CJK A;  2ROP A;  1IKY A;  3IG1 B;  1JXL A;  3I5C A;  4YY3 F;  2I0X A;  3FSI A;  1WF0 A;  4B3T J;  1YRX A;  3PJ9 A;  1ZBT A;  5H9E J;  3HSD A;  1JMT A;  3GIJ A;  3UNY A;  2MQO A;  2IRY A;  5G4D A;  4ER8 A;  3FCV A;  5HRO B;  3OTB A;  1XR6 A;  1N33 F;  4KPC A;  5ETV A;  5HMZ A;  4F0H A;  4NZ7 A;  3DM2 B;  3CXC R;  1HD1 A;  1Y5N B;  4UUX A;  1SXL A;  1UW4 A;  3R5C A;  3IO1 A;  2MQQ A;  2QL9 B;  3P6Y C;  3PW5 A;  1VC0 A;  2JVO A;  3MM6 B;  1RSC A;  4ZJO A;  3K5L A;  2Q3P A;  1N54 B;  1Y9O A;  2E5I A;  2H5J B;  4I1T A;  3NEK A;  3PYD A;  4BHQ A;  3UD4 P;  2C2D A;  4LRC A;  3GJT B;  5DM7 Q;  1B4S A;  4PXD A;  3MEC B;  4DOZ A;  1R8A A;  1C1B B;  2AHO B;  4MFB B;  3QT6 A;  1S6Q B;  8RUC A;  2XTJ P;  5D0G A;  2BDP A;  1LQ9 A;  2ACM A;  3O1L A;  3JXO A;  4ZP9 A;  5CD4 H;  4Q0B A;  4KKO B;  3KMQ A;  2HVZ A;  2M8D B;  3OUY A;  5D4N A;  3WHI A;  2MZJ A;  5HVF A;  4IUF A;  4JI7 F;  2ZD1 B;  5DDR C;  3SXL A;  4UF4 A;  2A6O A;  4ZMM A;  3OL9 A;  1VQP S;  3SQO P;  4TKT A;  1G6B A;  2Z4P A;  3MCS A;  2VA3 A;  5D0R A;  2HHU A;  1EKR A;  1JLE B;  1YX2 A;  2ZBI A;  4KHP F;  3EXC X;  3H8Y A;  4YOE A;  5FLX Y;  4CI0 B;  1FDA A;  3DOM A;  2HVD A;  3M7V A;  4YB7 A;  3PYF A;  1TTH B;  3I5A A;  4ZPA A;  3IRX B;  5HVG A;  2XBP A;  2H3E B;  4I0W A;  4C0O C;  1SC1 B;  4IYQ A;  2XY6 A;  2R7T A;  3HT3 A;  4C3L A;  1K73 T;  3O8W A;  4FF1 A;  1CJU A;  2VL1 A;  3QT5 A;  3MOZ A;  2DH7 A;  2AD9 A;  2V9K A;  5E3Q A;  5D8H B;  1UKU A;  2F40 A;  5HMX A;  1S0O A;  2W1B A;  3QT7 A;  1PYS B;  2WTF A;  4ED7 A;  4HYK A;  1S1T A;  5G0R B;  3CJS A;  3K57 A;  3RJM B;  1SIZ A;  2ZHA A;  2DGQ A;  1KR4 A;  1RT4 B;  2QC3 A;  2CVE A;  1F60 B;  2V67 A;  5ETN A;  3PFO A;  3LPE A;  4WPA A;  1HYS A;  3HHL A;  4J9K A;  2B8P A;  3MED B;  1B0P A;  1N52 B;  3T9N A;  3ZTS A;  3BV8 A;  4DUY F;  2O01 C;  3TAP A;  5KG7 A;  3RUB L;  4ES2 A;  2OH2 A;  1LFW A;  3THP A;  3ENA A;  3CJT A;  3LUY A;  1N5V A;  3M2R A;  4YDX A;  3MM8 B;  3KNA A;  2FIU A;  2M3D A;  5I4M A;  2MLY A;  3VF0 B;  3H5Y A;  4ID5 A;  3G86 A;  2I2Y A;  3QGP A;  1DAX A;  2AEM A;  1KWM A;  3VAK A;  1ULR A;  3BKU A;  1NK6 A;  4HDG A;  1Q8K A;  1VIS A;  2ROG A;  2JX2 A;  1P27 B;  3JYT B;  2GGP A;  1U6B A;  1VFJ A;  5HSP A;  1NSQ A;  4JV2 A;  3NWR A;  4F67 A;  3GQC A;  5T7L A;  4R25 A;  3D1H A;  3WBZ A;  1RIS A;  1UET A;  3QBC A;  1U7L A;  1NME B;  3PX0 A;  1QVG R;  3P5B P;  2QX0 A;  2CZ9 A;  1Y7P A;  3CT9 A;  4ELU A;  1OIA A;  1MRO A;  3BS9 A;  4H4K C;  2AEF A;  1UVI A;  2CQ1 A;  2HFO A;  3HSJ A;  1TK0 A;  1EIY B;  3EIC A;  2R7V A;  2HND A;  3TO8 A;  5JVH Q;  1Y4Z B;  2O5D A;  2V4J B;  4KGM A;  4MK8 A;  1VQ7 S;  3GCX P;  2I1R A;  3KLG A;  1I5O B;  3SDE A;  1F1B B;  4K4Y A;  2OPR B;  3SSQ A;  2J9C A;  3GYN A;  4NLO A;  3KYL A;  3RBX A;  1IBM J;  4A8F A;  2WRM A;  3BH7 B;  3GII A;  4XAK A;  4EYI B;  1S0V A;  2MZT A;  3AXM A;  4UQT A;  4ED1 A;  3CJ4 A;  1C0U A;  1KVI A;  3DKD A;  3OTD A;  4JV0 A;  4FYW B;  3KDO A;  4DV4 J;  1D9D A;  2UUB F;  2BJ7 A;  3RB4 A;  2F8H A;  5DS7 A;  2D41 A;  2OPS A;  2UUW A;  1SH3 A;  4OJ1 A;  5A0Y B;  2F65 A;  2YY3 A;  2W01 A;  4LF4 J;  3TUJ C;  2E1P A;  2RAQ A;  1GX6 A;  5LMN F;  2DHH A;  4L6V 3;  3DGP A;  4R5P A;  3NS7 B;  1FRJ A;  3QRQ A;  3MEG B;  3V81 B;  2KFY A;  2R8J A;  3K5O A;  4KV8 A;  2BAB A;  2JWN A;  1Y3K A;  2MJU A;  4USM A;  2NYH A;  2VBZ A;  3H42 A;  4LSN A;  3D9B A;  5AE3 A;  1FT8 A;  1B99 A;  3A3O B;  3OVB A;  2B4O A;  1ZM9 A;  4IFY A;  3AD7 C;  4ED0 A;  4JV5 J;  3M1V B;  2HWI A;  5LJ5 Y;  4H4O B;  2P6S A;  5HN0 A;  1YSJ A;  2V4Q A;  1TL1 A;  1JK9 B;  3G8Q A;  1X60 A;  4ZP8 A;  4OX9 F;  2R42 A;  3F56 A;  2ZH7 A;  5F8L A;  3MPV A;  4LJM A;  4QYR A;  2GAH C;  5HBM B;  7FDR A;  1K9M T;  1C0T A;  2V8G A;  4FS1 A;  2YQ0 A;  4URQ U;  4CLZ A;  4UST A;  4RW9 A;  3AOA A;  1U1L A;  2DIV A;  5J2M A;  1SL2 A;  2C2R A;  5A8R A;  1TKT A;  2NXC A;  4JI6 J;  4LBH A;  1S99 A;  1R7I A;  4C8M A;  4Y2A A;  5B09 A;  3I96 A;  4CLL A;  3J80 Y;  1HW8 A;  2GIQ A;  1YJV A;  2C2N A;  3KFW X;  3CUL A;  2B5J A;  3HHE A;  3UCG A;  2EPI A;  4FYY B;  3RAM A;  4DL5 A;  2HHQ A;  2VIH A;  4QBU A;  2EFN A;  2KYZ A;  1AFJ A;  4RW8 B;  1WF1 A;  3KDN A;  2UUA F;  4C8Z A;  3N9U C;  5E7O B;  4RW4 B;  5KFA A;  2ROE A;  5F8G A;  2HQC A;  3W5Y A;  1J5E J;  2CNL B;  4OYM A;  3ILJ A;  4AL7 A;  4ELT A;  3HDS A;  4YR0 A;  5J2Q B;  1F9H A;  4KT0 C;  3T41 A;  4P2S A;  2KU7 A;  3AHP A;  3MMC B;  4DV7 J;  3TVY A;  1DTQ B;  1N88 A;  3KHG A;  4QR0 A;  4R8U B;  2BW2 A;  3CC2 S;  1N0U A;  3MMB B;  3SIP B;  5A8W A;  4J37 A;  2OJ3 A;  4IRK A;  3S8S A;  1TL7 A;  4JI4 F;  2B4P A;  1U0S A;  3PG9 A;  4TVA B;  3PW4 A;  5AXN A;  2EFV A;  1JKH A;  1EET B;  5C5J A;  2PE8 A;  2EWH A;  3M9O B;  1RTH B;  3CCW A;  4RPF A;  2C2E A;  5LL6 d;  3QNW B;  2ZM6 F;  4P7V A;  1GX5 A;  1LWF B;  1RTI A;  1K0T A;  4NPO A;  1RLC L;  3DLK B;  1ZAX A;  3M6X A;  4G1I A;  4O3O A;  1M1K T;  1FRM A;  3PIO Q;  3BPD A;  4CDI A;  3M6V A;  2DXF A;  2GVZ B;  5KFD A;  2HW3 A;  4CM2 A;  1A9N B;  4QW8 A;  4GKJ F;  2V8V A;  1YGY A;  4DR5 J;  2P9E A;  5DM6 Q;  3W2V A;  2RNE A;  1G7C B;  1NK8 A;  3OPK A;  3Q2S C;  2RDD A;  4X64 J;  2QE5 A;  2IPO B;  2IVM A;  3SMZ A;  2OD6 A;  4DR6 F;  1N5S A;  2RUS A;  3QID A;  2FPH X;  4CNZ A;  2KI2 A;  2J0S D;  3VQT A;  1RT6 A;  2D69 A;  1NK0 A;  1XMO J;  2GIR A;  3M32 B;  5B0D A;  3BO4 A;  3WZ0 A;  1NK7 A;  2Y1R I;  3RBZ A;  1WDT A;  1PO6 A;  5LMU J;  2QT7 A;  1V5I B;  3DMJ A;  5IT4 A;  2XWX A;  4KSE B;  5MAO A;  2DNP A;  5CCL A;  4H4K A;  4DL2 A;  3GON A;  5E3P A;  2BEF A;  3QGH A;  3G6X A;  1MLA A;  4USK A;  3CO9 A;  2WBR A;  3E2E A;  3N79 A;  3LAL A;  4IG3 A;  1D1U A;  2PEH A;  5KOW A;  2LCW A;  3PNI A;  2UU9 J;  1FX2 A;  5RUB A;  3OJU A;  2DR7 A;  1RBL A;  2K1R B;  1L3U A;  5D4O A;  2Z2M A;  4CLP A;  3AAW B;  4B9M A;  1Q5Y A;  1RT2 A;  1WOP A;  4OI1 A;  3IWN C;  4LF1 A;  2IJR A;  2R2R A;  2EVZ A;  3HP6 A;  4K0K J;  3CC7 S;  2HVH A;  2ZHO A;  2XEX A;  4LFA F;  5C24 A;  1M1G A;  4LF8 J;  3SBM A;  1EQM A;  2MKY A;  4IO1 A;  2VAS A;  3RRK A;  1YI2 S;  2GHV C;  1T9U A;  2VJU A;  3W3S A;  3OL6 A;  4MMO A;  5D0E A;  1OQ3 A;  3BPS P;  2CJY B;  4OZ2 A;  3DLE B;  3BSA A;  3TQE A;  5EWE A;  4DF4 A;  4ZKA A;  2LEP A;  2AGO A;  4U8Y A;  1EAY C;  1GXU A;  1EP4 A;  2NXN A;  2HRT A;  2DR8 A;  1X4A A;  4CT8 A;  1NSK L;  3KHL A;  2DNQ A;  4ID8 A;  2R7W A;  1XNQ J;  1M5S A;  2QLB B;  4I2Q B;  1E6V A;  4DV5 J;  2ZZN A;  4NZ0 A;  2CPI A;  3FZB A;  1KBR A;  1XBW A;  2DR5 A;  2GA7 A;  4FP9 A;  2CQ3 A;  2OAU A;  1GMW A;  2XS5 A;  2QTW A;  3PHT A;  2ZE2 A;  3H2L A;  1WOO A;  3X1L B;  3IGV A;  2XWY A;  3CSK A;  1FKP B;  5CD4 A;  2QA1 A;  3H7H B;  4DL4 A;  4DMZ A;  1FNO A;  5KT3 A;  2G4B A;  3TI0 A;  4B3R J;  1U0H B;  2ZDP A;  1K47 A;  4DG1 A;  2FJW A;  2WVC A;  2X7I A;  2DO4 A;  3Q2T C;  4YUD A;  1QTN B;  4KIA A;  4P6Q A;  3AB2 B;  4ZIW A;  2A0F B;  2I38 A;  2CQC A;  3UD5 A;  4BBY A;  4WU3 A;  4R0J A;  2JEJ A;  2EK6 A;  5ADZ A;  2FZC B;  2BV3 A;  1S1X B;  3LH2 S;  4Q2L A;  3TUZ C;  2BVZ A;  3M8Q B;  5H1S V;  3T3F A;  1L5U A;  1WDD A;  3JTN A;  3DCA A;  4DU8 A;  2M0G B;  3LP1 B;  2HKE A;  4FN5 A;  1Q8B A;  2B4V A;  3D54 A;  2LXF A;  3VAH A;  3BZQ A;  1TU0 B;  2VH7 A;  4C7Q A;  4ANE A;  4Y2K A;  1HFE L;  3GG0 A;  5B08 A;  4OJG A;  4KBI A;  3CDA A;  4KRW A;  5BYQ A;  3M6W A;  3BGO P;  4DLG A;  1G3O A;  1YBA A;  1IKW A;  3KK1 A;  1U6Z A;  2J7U A;  4K8R A;  1FF2 A;  3IM9 A;  2KFZ A;  2XMJ A;  2FGC A;  2VPX B;  5DG7 A;  3TAM B;  5IFM A;  1VQM S;  4DL3 A;  1WC5 A;  1W26 A;  1QSL A;  2LDY A;  4J9U E;  3BN7 A;  1X9W A;  5KT4 A;  1RAC B;  2VBX A;  5IT9 Y;  3KUH A;  4WWS A;  1PSD A;  5IC6 B;  3X3U A;  2J9D A;  3A1Y G;  3C46 A;  5K8M A;  3G87 A;  5D6G A;  4M94 A;  3MMA A;  3QPI A;  2F9D A;  1SH2 A;  1XR5 A;  1FO1 A;  8ATC B;  2H54 B;  1FEE A;  4BDP A;  2ZH4 A;  4K4V A;  2UZA A;  2UUT A;  3HXM A;  2H5I B;  2VU5 A;  3LP2 B;  1ZTT A;  4ZP6 A;  1S6P B;  3NOC A;  1Q82 T;  1X8D A;  2XI2 A;  3ZXW A;  1SJ1 A;  1KTV A;  2HHS A;  2ZBC A;  4L72 B;  2VG5 A;  3SQG A;  3D6T B;  2QL7 B;  4F04 B;  2BJ8 A;  4OYZ A;  3KXD A;  3GP9 A;  1PKU A;  1HBU B;  3POT B;  3R9L A;  2C1E B;  3E51 A;  4HDH A;  4J9N A;  3KHR A;  3Q8V A;  3ENV A;  4ZDN A;  3JSY A;  1R6V A;  3MOJ B;  4TN2 A;  2LA4 A;  2WVE A;  3AY0 A;  4WIQ A;  3DOM B;  1SQE A;  2R8K A;  2N3O A;  1VQS A;  4EBE A;  1WWH A;  3QQC D;  3GIK A;  3DXS X;  1JLG A;  1BWV A;  3O2I A;  1WKL A;  1S7H A;  4RNH A;  4C6A A;  2YKN A;  2WK4 A;  1HNI B;  4CYU A;  1N5T A;  4KJI A;  1XJW B;  1HWI A;  2XZW A;  3J7Z 5;  4NEZ A;  3GLJ A;  5KFE A;  2E9R X;  2OSR A;  4QIG A;  1S9G B;  3VVT A;  2OKQ A;  3K7R A;  1S72 S;  2GJI A;  2JLF A;  4RL1 A;  5LOQ A;  3DXB A;  4HT7 A;  2B0G A;  2V2K A;  1RTD B;  4LF7 F;  2FQQ B;  3OSN A;  4AYB D;  3KJV A;  1TL3 A;  3W66 A;  3OR1 A;  2MLX A;  2KZZ A;  1UJ6 A;  2R4F A;  1ZYQ A;  4GMK A;  1IJE B;  3CTR A;  3L7P A;  1CJT B;  4EBC A;  5GAH I;  2IMW P;  4ZS6 A;  3D28 A;  2FHJ A;  4K2J A;  2N4D A;  2UXD F;  1GXL A;  1T05 A;  2IRU A;  1YJT A;  4JI2 J;  4WU2 A;  2CYY A;  1TUV A;  4QU6 A;  1UWB B;  4NCA A;  2LU2 A;  3HD1 A;  5KFW A;  2HGM A;  4PG6 A;  4IDK A;  4G6V B;  4UT4 A;  3I5B A;  3T1Y F;  1LK5 A;  4FXV A;  1S77 D;  4M5J A;  3GFH A;  3L9Z A;  2HGN A;  4LQ3 A;  4NX9 A;  3FQK A;  2DRB A;  2FZG B;  3CDB A;  4WFX A;  3C6U A;  2PI4 A;  2E66 A;  4OX7 A;  4KAI A;  2XMW A;  1WHX A;  1U2C A;  1KFS A;  3UI3 A;  1RUS A;  2RDJ A;  1ZTW A;  1S49 A;  4F50 A;  2W7P A;  4JI3 J;  1HBM A;  5B0B A;  1FDD A;  1IBK F;  1TUG B;  2RT3 A;  1LFP A;  4NRT A;  2ZC3 A;  4TYB A;  5SUH A;  4B3S F;  3DRR B;  2BOP A;  2AP6 A;  2NUU G;  3TZW A;  4ETZ A;  2MDA A;  1OY9 A;  4DX5 A;  4ZPD A;  5B0G A;  2D3Z A;  1U1O A;  1B64 A;  2GMH A;  4IR1 A;  3IM8 A;  3QMQ A;  4F4A A;  2HK2 A;  1S12 A;  3VGS A;  3SDE B;  4NLS A;  4V19 J;  3FEY B;  5AJ3 F;  2XLK A;  2OPP A;  2RJZ A;  5K8P A;  2VBY A;  4HR2 A;  1RT5 A;  2HPU A;  1S76 D;  3I87 A;  1P1T A;  2GJ2 A;  1UVN A;  4BC9 A;  1C0U B;  2HZC A;  2DJW A;  2CNK B;  4HEA 9;  4DUZ J;  3AD9 C;  2VD3 A;  4TQR A;  2HS0 A;  2XUL A;  3D66 A;  3BKT A;  1DAR A;  2MHE A;  1T11 A;  4OYX A;  4P71 A;  2EK1 A;  3SZ2 A;  1YLX A;  3GV5 B;  4HH1 A;  1NJZ A;  2O67 A;  4RUH A;  3MM9 A;  1U09 A;  3PY8 A;  3KMS A;  5IOL A;  5GAD I;  2Z57 B;  1IKX B;  5EWG A;  1NO8 A;  1IXK A;  1XMQ F;  4DR3 F;  3I0S B;  4CM0 A;  1NPP A;  3IA0 A;  1ZPV A;  3VAG A;  1SJF A;  3D0H E;  3CME S;  4JI0 J;  4PYD A;  1NK4 A;  2ASD A;  1C4A A;  1VRU B;  1AXQ A;  4N56 A;  3M8W A;  4IFY B;  1WAC A;  2E1C A;  4WTY A;  5IT0 A;  5KG1 A;  3MHY A;  2GHP A;  2HQD A;  2FHM A;  2L9N A;  1CUL A;  1U1K A;  4YY3 J;  2ASL A;  1VQ9 S;  4DV6 F;  2MST A;  4DFJ A;  3EJM A;  2YKA A;  1HLW A;  1DHM A;  3SV4 A;  3QRR A;  4RW9 B;  2E7W A;  4CH1 A;  1N33 J;  1CSJ A;  3CED A;  1APS A;  3TX0 A;  4J5O A;  5DGA A;  1NEE A;  4OZ3 A;  1VK8 A;  3R5A A;  1T3N A;  4KYZ A;  2FLN A;  5C42 A;  2IVY A;  4IR9 A;  1LWC A;  1O5J A;  2DRA A;  4ENO A;  2FC8 A;  4ZPT R;  1N4L A;  3NCP A;  4K4X A;  1Q78 A;  2N82 B;  4B17 A;  5DDP C;  2J9E A;  2C2M B;  5FDL A;  2XB2 D;  2HAF A;  4X4V A;  3RAX A;  1D9A A;  2B7C B;  3DOK B;  3ADA C;  3FKB A;  3NRB A;  1R0A A;  2C3Y A;  1NAQ A;  4ZCL A;  1RAB B;  2F9J A;  3VCD A;  1OYD A;  1TL7 B;  1R8P A;  4G1P A;  1ZM3 A;  5M2U A;  3P8B B;  3UN2 A;  3H2V E;  3HFV A;  2QA4 G;  2AW0 A;  1TK5 A;  4KHR A;  2HQF A;  3Q86 A;  1UZH A;  5MLC V;  4JI7 J;  4FF4 A;  1UFL A;  2XS2 A;  4OHX A;  2W2N P;  2CQI A;  4EZ9 A;  2CPZ A;  4CH7 A;  1NM2 A;  4DCJ B;  3BF4 A;  1HWJ A;  4LR9 A;  5CZV A;  4I6A A;  1A7G E;  5K14 B;  3R5B A;  1JLA B;  4KHP J;  1K44 A;  3H40 A;  4ZCK A;  1ZM4 A;  3ISN C;  3C15 A;  5T41 A;  2HZV A;  1F5C A;  1YKW A;  5EDW A;  2WSF C;  1HQE B;  3ET6 B;  5LT5 A;  3FBB A;  2JEI A;  1BQX A;  4ZVU B;  4ZCI A;  2CXE A;  3CCQ S;  1S9E B;  2GQ2 A;  3UW1 A;  3MAA A;  3UDC A;  1K1Q A;  3DRS A;  2HWH A;  3KLE B;  3MM5 A;  4P52 A;  4J9P A;  5M2R A;  3AOB A;  3KK3 B;  1X4F A;  2NXJ A;  2P5V A;  3KLI B;  5L8R C;  3THT A;  1DJ0 A;  2V8D A;  3BM7 A;  3VV2 B;  1S79 A;  3W9I A;  3DLB A;  3ZZP A;  2J6U A;  4O4G B;  4WJB A;  2ZVI A;  1TV6 B;  4E2F B;  4DUY J;  2KHC A;  2WBM A;  3CJ5 A;  2PD1 A;  2GS8 A;  2CJB A;  2DHG A;  4KH0 B;  2YQ3 A;  1HI0 P;  2KDO A;  3IBC B;  2DNN A;  3KG4 A;  3O44 A;  4IG3 B;  3H4D A;  2HEK A;  1FTR A;  2B9X A;  3NXZ A;  2Q66 A;  1B0V A;  3ONQ A;  1RWO B;  5DDQ C;  3AJ2 A;  1PIE A;  4IFV A;  2LXU A;  2M70 A;  4XDD A;  2EFG A;  2R2T A;  1WG1 A;  1XN9 A;  1VRQ C;  5GAE U;  4GVB A;  1QAY A;  4ZVF A;  3CIM A;  2C3P A;  1KOO A;  3M8S A;  4NAS A;  3PCO B;  4QIF A;  4NI2 B;  5CZX A;  3O5T B;  4TU7 A;  2PGC A;  3B4M A;  4B3M F;  2P9C A;  1RHR B;  2L3M A;  1EP4 B;  3W5X A;  4YFU A;  2AQ4 A;  4WK1 A;  3UN5 A;  2RSQ A;  4B9N A;  4U7C A;  1Q95 G;  5FLX U;  5F9L A;  1Q0N A;  2DNG A;  3KJF B;  2NYI A;  1M5H A;  1Q79 A;  3S6E A;  4ALZ A;  4QIW D;  2HS3 A;  2O66 A;  5KFX A;  1RBA A;  4Z2X A;  1WC0 A;  4F4K A;  2JEF A;  4IH7 A;  3DM2 A;  2J0W A;  2MB0 B;  1NSP A;  4Y3C A;  3HVT B;  4QIV A;  4CTA A;  3MZI A;  4HHU A;  1T9Y A;  2RQK A;  2UUB J;  1SV5 A;  2MYF A;  2EG2 A;  2C42 A;  3GJQ B;  1RA6 A;  5KFU A;  4DG1 B;  3H5S A;  4DBQ A;  4URS A;  1VRT B;  2MQP A;  1UMJ A;  1PYT A;  4WKY A;  4XO0 A;  3GU0 A;  2GAG C;  3E8O A;  1NDP A;  1C1B A;  2FD2 A;  4YQW A;  4MFB A;  3NAH A;  3R27 A;  1H98 A;  1Y10 A;  2ZC4 A;  3HZE A;  1S6Q A;  5I3P A;  4K2X A;  1Q7Y T;  4BWM A;  4ZN1 A;  2I8E A;  2ZBR A;  4IO9 Q;  5IQ6 A;  3G96 A;  3R5D A;  4CO0 A;  2JFK A;  2DHS A;  5F8I A;  3D7S B;  3U7J A;  1DTT A;  2AGP A;  4DI6 A;  1UA1 A;  2KYX A;  4C97 A;  4OI0 A;  2VKR A;  5HL7 Q;  3BYR A;  2IM2 A;  4LRE A;  3NCQ A;  2K2P A;  1S0N A;  3F41 A;  2QLJ B;  3Q8S B;  3IGN A;  3M8P B;  4XPE A;  4DSK A;  1X0P A;  4GC7 A;  3P3D A;  4P74 A;  4FNI A;  3DLG A;  2V8H A;  4DPW A;  3D67 A;  3P4U B;  1RWP B;  4Q44 A;  1T9W A;  2Y1L B;  3R5G A;  3E01 B;  3HVA A;  4K4Z A;  1NK9 A;  3UWT A;  1L3V A;  2NRE A;  2HWT A;  4PG8 A;  3IRX A;  1IR2 A;  3BO2 A;  4YP3 A;  1R0C B;  3MD3 A;  3C6T B;  1KEK A;  2RS8 A;  3C3L A;  4ILM A;  1ZA2 B;  2HRY A;  2J76 E;  3TA2 A;  2UUA J;  2MKC A;  2UUC F;  2B9E A;  4PYA A;  4LT6 A;  4I69 A;  3CCJ S;  1HPZ A;  1WC4 A;  4A46 A;  3V6D B;  2JHE A;  3EVW A;  2Q6B A;  4M5M A;  1PC5 A;  4A8Q A;  1QTM A;  5G0R A;  4L76 A;  4NA2 A;  4KE5 A;  4OYW A;  3BQ0 A;  4I6Y A;  2LMI A;  1RT4 A;  1S4E A;  1QDU B;  2C2Z B;  5HAO A;  3H98 A;  3CD7 A;  1SJ3 P;  4JI4 J;  4NEY A;  2IM0 A;  4F0K A;  3DHX A;  1SB6 A;  5HLF B;  2DNZ A;  1DLO B;  1I6J A;  3AD8 C;  1YJU A;  4NLU A;  2G1H A;  2DY1 A;  4ZOS A;  3UN3 A;  5L39 A;  3L09 A;  1RHM B;  2OP5 A;  1W25 A;  4MYU A;  5J1N A;  2ZM6 J;  3HHL D;  1KLM B;  4LRD A;  6FDR A;  1OYE A;  4NLT A;  4KQZ A;  4DR1 F;  1KQG B;  1G1X A;  4LBP A;  1N48 A;  4X4N A;  4LVN P;  1VS3 A;  3CD6 S;  1NND A;  1S4F A;  5KFC A;  3JS9 A;  2POK A;  2OEJ A;  5H9F J;  3JYT A;  2DO0 A;  2AMC B;  3HSZ A;  2W8L A;  2C2K B;  2JNJ A;  4ECW A;  3PX6 A;  3OLB A;  1FKO B;  2DPJ A;  2R7U A;  4GKJ J;  2PI5 A;  1RTJ B;  4A8Y A;  1L3K A;  2QG9 B;  4CYU B;  3QZ8 A;  3U27 A;  1H38 A;  2B4U A;  4UOC A;  1RAI B;  2YWW A;  5EWF A;  1WHV A;  1F5A A;  4DR6 J;  4NE9 C;  3RTV A;  1QAJ A;  1T02 A;  1GMU A;  2MGZ B;  3HFK A;  1RTZ A;  2G0I A;  2CJX B;  4BS2 A;  2DH8 A;  1FJE B;  4GKK F;  2HGL A;  3J80 U;  2V4J A;  3MR5 A;  1TL3 B;  2DHA A;  4MKA A;  2X3D A;  1HQU A;  4USV A;  9RUB A;  1KLN A;  3T1A A;  1YQH A;  4QYZ K;  2FJA B;  3EVM A;  5BJR A;  3C14 A;  2IHR 1;  3HM9 A;  4I7F B;  4F26 A;  4PR6 A;  4ZVR B;  2ADB A;  2DK2 A;  4KY3 A;  1VIX A;  3AQO A;  2HQG A;  4WBF A;  3AA8 A;  2R2S A;  4ITS A;  3DHW C;  4IG0 B;  3VZH A;  3L7U A;  2HQ3 A;  3MWB A;  4HI2 A;  2UVU A;  2QSF A;  1Y5I B;  4JI5 F;  4NYP A;  1FHT A;  1Q7L B;  1D3W A;  4C11 B;  5E41 A;  4F02 A;  2YWF A;  2A10 A;  3KUE A;  1JLB A;  2LP4 A;  4M5D B;  3US5 A;  3VTI A;  3PEJ A;  2NS1 B;  2QV6 A;  4PWW A;  4LFA J;  4OZ5 A;  1T9T A;  4TY8 A;  3MEG A;  3V81 A;  3MUV P;  1TKZ B;  2R7X A;  5KFG A;  3IRW P;  4WFZ A;  5H9E K;  2HVE A;  2HZA A;  2XSJ A;  2W4D A;  2YNF B;  2GZO A;  2XQC A;  5IV3 A;  2V69 A;  5ETK A;  3M1V A;  3HVW A;  2PMW A;  4H4O A;  1U49 A;  2QYC A;  2V5H G;  4PAA A;  1KVJ A;  4RWX A;  3CIZ A;  4MKV A;  1W2B R;  2BM1 A;  1ZPW X;  4FVC A;  5KFL A;  1QD1 A;  1SQG A;  5AXM A;  2V6A A;  4CQ1 A;  3Q89 A;  4UZB A;  4B9L A;  1NJI T;  4X4P A;  4LQ9 A;  5AXK A;  3NGU A;  1WG4 A;  3DLL Q;  2YBV A;  5J1P A;  1M1H A;  2ZDO A;  2YWE A;  4PZV A;  1BE4 A;  4C8N A;  3WDO A;  4C2M A;  5ETO A;  1PAE X;  1RT3 B;  1IJF B;  3MFH A;  1D09 B;  2BYC A;  1GH8 A;  4USW A;  3ETO A;  4IKA A;  4TLR A;  3TJ9 A;  2W9B A;  1FDN A;  3MM9 B;  4P72 A;  4EO8 A;  4RW8 A;  4ATN A;  2WVB A;  8AT1 B;  2KXF A;  1RGV A;  1HBN B;  2F4F A;  4PXB A;  2ZNY A;  2ZH1 A;  5KFR A;  1S6O A;  5K5M A;  4ZPB A;  4ECR A;  3MEE B;  2HBZ B;  1RKI A;  3FMB A;  4JYA F;  2R8H A;  2CWX A;  4CP5 A;  1DTQ A;  4DX8 H;  4PKD B;  2XHC A;  4Q2M A;  2JLG A;  2OPQ B;  4RBV A;  2PA3 A;  3R5J B;  3PTW A;  4M5N A;  1WF2 A;  4Z37 A;  2J0X A;  1CS4 B;  3S01 A;  4EEY A;  2CVI A;  2YH0 A;  5DO2 A;  3KJN B;  4B08 A;  2D3O R;  2OD4 A;  2YWH A;  2VPZ B;  3D0G E;  3UPF A;  1D8Z A;  2VC0 A;  5LM7 E;  1RTH A;  4X4Q A;  2KB2 A;  2XGQ A;  3TAR A;  2WW8 A;  3P45 B;  2R2U A;  3OVS A;  4F7V A;  1LWF A;  2EXU A;  4OJ3 A;  3DLK A;  1UFK A;  2FLO A;  3QWU A;  2CFX A;  4PQA A;  3V2U C;  4DJB A;  3EYZ A;  4C0H A;  4WZM A;  2HFS A;  1Y0H A;  4NRU A;  2GVZ A;  2Y0B B;  2CPY A;  2ZIT A;  1D9F A;  4ZLL A;  3ZFV A;  3FBF A;  1V5V A;  3CDW A;  5JMN A;  4TXS A;  5FDL B;  2IMO A;  3JTP A;  2HNY A;  3OHB A;  1YVF A;  4UOF A;  2AZ1 A;  1XTZ A;  2EKY A;  2E29 A;  3ZZO A;  1R27 B;  3PW2 A;  5EX3 A;  4EU0 A;  4CLK A;  2XG8 A;  3EGW B;  2E5J A;  3GV7 B;  5HAN A;  1KSP A;  3PO4 A;  1KC8 T;  1BMQ B;  5CAA A;  3JQM A;  1FWL A;  5KFJ A;  3SCI E;  4DV3 F;  4RJV A;  2QFI A;  5I42 B;  2HSE B;  3B6B A;  4TU9 A;  3PHE A;  2JEG A;  2ZWP A;  2DHX A;  3CJQ A;  5KFY A;  1RCO B;  3NKY A;  3I56 S;  2H5E A;  2BKO A;  3IP0 A;  4AXI A;  1QUP A;  2Y0S D;  1YJR A;  1FXL A;  1WOS A;  4ED8 A;  4F4X A;  1VLO A;  3HHN B;  4ZN3 A;  2AGQ A;  3LOU A;  1V9O A;  2GO8 A;  4N77 A;  4WFA Q;  4PG4 A;  3PIP Q;  5K8N A;  4RNM A;  5AE1 A;  1ICE B;  1T03 B;  2VC1 A;  1R8H A;  2BBE A;  4PQU A;  2K1R A;  2PEB A;  4K5R A;  2R7O A;  3C15 B;  3W62 A;  3EUN A;  4GO5 X;  2YKM A;  2GO9 A;  2ZNZ A;  1C2P A;  4CH0 S;  2D9P A;  2Z8Q A;  1R8B A;  1SPB P;  1SC6 A;  2XCP A;  5KFH A;  3JQK A;  4HI1 A;  4OI6 A;  3QJL A;  2K06 A;  2MZS A;  2H9Z A;  4OV6 A;  2BE7 D;  3RAQ A;  3DRS B;  3DDI A;  3M05 A;  4F4W A;  2JFD A;  3F0N A;  4IQX A;  4DU7 A;  1X5S A;  5HJY A;  3DLE A;  2H4Y B;  4OFZ A;  2YNI B;  5ITH A;  2L9D A;  3BB5 A;  2XI3 A;  3F44 A;  1KS2 A;  3HUL A;  4ZPW R;  1H7X A;  3TZZ A;  3OTC A;  2ZJQ Q;  5IT9 U;  4FKX A;  4LF7 J;  3IXQ A;  2RHS B;  5KTQ A;  2AEJ A;  4MIA A;  1J2V A;  3GPA A;  3I55 S;  3MGJ A;  2AX1 A;  3QSI A;  2J6T A;  4I2Q A;  2VKZ G;  1IQZ A;  2DD8 S;  2RKI B;  4UOG A;  4LF9 F;  2E9Z A;  2KTQ A;  2KL8 A;  3OTO F;  2UXD J;  2X3G A;  3DRY A;  1KN6 A;  3R8Y A;  4RBT A;  4ZVP B;  3CW2 C;  2KRB A;  2RDI A;  1NHK L;  4NLQ A;  1FKP A;  4HT5 A;  2BAN B;  2EG1 A;  3UQS A;  2JL9 A;  2ZEJ A;  3T1Y J;  4QWB A;  1U0H A;  4NXM F;  4I64 A;  5D3G B;  2DCU B;  5ETQ A;  1GMW D;  5A2Q Y;  3MMJ A;  2AX0 A;  2LDI A;  3RRH A;  2RRN A;  3QZ7 A;  1S57 A;  1FD8 A;  3BEG B;  9ATC B;  1FFW B;  1S1X A;  3H0P A;  3OXF A;  5L9X A;  2PC6 A;  4W4M A;  2CQ4 A;  2DNH A;  3M8Q A;  3U02 A;  5KT2 A;  1U1Q A;  1IBK J;  1KVK A;  4QWE A;  1WEX A;  1EB0 A;  5EN1 A;  1X5P A;  4JOU A;  4UOH A;  3UD3 P;  4B3S J;  3LP1 A;  2I9S A;  2GJF A;  2LYV A;  4AND A;  1HWK A;  1LK7 A;  1YHQ S;  3QGI A;  4ZLN A;  3F73 A;  2Z56 B;  1WKJ A;  2F3J A;  3CB4 A;  2QMU B;  2KZM A;  1RHJ B;  4H54 A;  1V6H A;  1BUX A;  5IWA F;  4DQQ A;  5AJ3 J;  3A8K A;  3K17 A;  4ECU A;  2KG0 A;  3NS6 A;  3JAM Y;  2LQ8 A;  3BBC A;  3K5N A;  1KTQ A;  3FC9 A;  2ZH3 A;  5CQG A;  1O0P A;  2JJ4 D;  3PM9 A;  4CTA B;  4DS5 A;  3L95 X;  3JSR A;  3Q8Y A;  3TAM A;  1KOH A;  5CYJ A;  2JC0 A;  2ZKT A;  1SV5 B;  3UDV A;  1N32 F;  5DQI A;  1G4C A;  2EKN A;  1OSC A;  3EDQ B;  1BQN A;  1RHK B;  1UEV A;  3I31 A;  4OHZ A;  5FD1 A;  2P6T A;  3C66 A;  1X9M A;  1RK8 A;  5ETM A;  2FJX A;  2DT9 A;  1NZA A;  3LW5 C;  2DIT A;  3ISZ A;  4NLD A;  3PJX A;  4DFM A;  1JXV A;  1YRT A;  2WSE C;  4MTP A;  2V2Z A;  1RWN B;  1OQ6 A;  1XMQ J;  4DR3 J;  2C22 A;  3SV3 A;  1HHS A;  3NWG A;  2RQ4 A;  5KFV A;  3LP2 A;  1SKS A;  3GZ7 A;  4Q8E A;  5LXY A;  1GK8 A;  3G82 B;  1S6P A;  3OFF A;  1DTT B;  4HKQ A;  3CCT A;  2WZ1 A;  1BQM B;  4DR2 F;  1Q1K A;  1YZ7 A;  2ZH6 A;  2DEJ A;  1H6K X;  2XGP A;  4MKY A;  4B02 A;  3LPY A;  4DV6 J;  2XMV A;  3PRD A;  3QLH A;  3EGZ A;  3V6K A;  1HBU A;  2OFH X;  1REV B;  3POT A;  1E6Y A;  3DLG B;  1BLU A;  3TJ8 A;  3DRP A;  3LO3 A;  3PX4 A;  4E98 A;  4NL5 A;  4OL8 A;  2P8I A;  3KNG A;  3AOC A;  2HIY A;  1NRK A;  1ELO A;  3CNQ P;  2DNL A;  1YTY A;  1S10 A;  1X7V A;  1MG7 A;  2KO1 A;  4KGZ B;  1HA1 A;  2DH9 A;  2UP1 A;  3R6L B;  1HPZ B;  4NYO A;  1HNI A;  3IAS 9;  1Q4R A;  1URR A;  2Q43 A;  5IS2 A;  4OI4 A;  2A2D A;  2FJV A;  2JZ5 A;  3HJV A;  3W8G A;  3HF5 A;  3UE2 A;  4OLO A;  1S9G A;  2CRL A;  1UVM A;  1Z4U A;  2VUG A;  3EZ5 A;  4NLX A;  2KRR A;  3RU0 A;  1RTD A;  4MKB A;  3EPI A;  3ZC4 A;  1S48 A;  3N6M A;  1XER A;  2W2Q P;  3DI6 B;  1NJY A;  2HNZ B;  4M5H A;  2SXL A;  2YKQ A;  4DF8 A;  3W5Z A;  3WC2 A;  3UDL A;  3ELH A;  1OPZ A;  4LBI A;  2QGF B;  5LSR A;  1CJT A;  4C3K A;  4ERD A;  2X1B A;  3MAH A;  2FB0 A;  3A3N B;  3TZY A;  1RAA B;  2BXJ A;  1UWB A;  3OQ2 A;  5EX0 A;  5KG6 A;  4Q45 A;  3ZTO A;  3T5K A;  1PIL A;  4PG7 A;  1NJW A;  1UVL A;  2ASY A;  5ETS A;  4ECT A;  4Y2C A;  5F3Z A;  5A6P A;  3OR2 B;  2CQG A;  2FHJ D;  2L41 A;  1W2I A;  4ED5 A;  2HVI A;  3TNV A;  2ZVS A;  2ILZ A;  4JB8 B;  4U95 A;  4RU2 A;  3MM7 B;  1RWX B;  4WFY A;  5FJ4 A;  3U1L A;  3EE3 A;  1DBD A;  1M5O C;  4KHM A;  2JLE A;  2JH3 A;  3T9Z A;  1XMO F;  3DRR A;  2XZT B;  1TL5 A;  1DQ9 A;  5B0A A;  1HL6 A;  2QA2 A;  2HFU A;  4KO0 B;  5KG0 A;  4CLS A;  3MUR P;  2BJE A;  4ZHR A;  3NLC A;  2XLI A;  4J9L A;  3LWM A;  4I67 A;  4N76 A;  2GX8 A;  1NHV A;  1HQU B;  3U1N A;  4QOT A;  5HI7 A;  2KJV A;  1TQL A;  3NGS A;  3C14 B;  3T19 A;  4J7C A;  3CJR A;  1I94 F;  4KFB B;  3TRG A;  4G3I A;  4RBU A;  1U24 A;  5HP1 A;  2WON B;  4LSZ B;  4F3M A;  1RQ0 A;  2HQI A;  2BQR A;  5HQ8 A;  1RWK B;  2L08 A;  2V9W A;  1RCX B;  2BR0 A;  2VOP A;  3FFI A;  4LIR A;  4QQB A;  2WVD A;  3ITH B;  2EW9 A;  4C8O A;  1KQK A;  4CLU A;  4MIW A;  5KFT A;  4X62 F;  1NB2 A;  4PPD A;  1U2R A;  5GAG I;  1N34 F;  1JLB B;  1VC5 A;  1RAH B;  4YS2 A;  5HO4 A;  4WE1 A;  2MMY A;  3MUT P;  4U96 A;  2G13 A;  1IKX A;  3LAN A;  3CJ3 A;  4TY8 B;  1X5O A;  3I0S A;  2V63 A;  2D1C A;  1MU2 B;  1SUQ B;  1U2F A;  3OHA A;  2XS7 A;  2EBG A;  2YNG A;  4Y34 A;  2XSJ B;  3T1H F;  3KLF B;  3CCV S;  1VRU A;  2M88 A;  3PYE A;  2BRK A;  4EBD A;  5E3C A;  1FRK A;  3PXG a;  4CO4 A;  3MR7 A;  2YPY A;  4B3M J;  4U6P A;  1RI7 A;  3M2V A;  1OPI A;  4GO7 X;  5CHC B;  5F9N A;  4RW7 B;  2QL5 B;  2F8E X;  2ATL A;  3H59 A;  5A76 A;  3FQL A;  4RUA A;  3WX4 A;  3GFZ A;  2OO4 A;  1TEL A;  4WKR A;  2CJK A;  3VZI A;  4M5K A;  1M5V C;  3PW7 A;  1FWK A;  2XMA A;  5DET A;  1H0H B;  3DU5 A;  5I3Q A;  2XMK A;  5GMD A;  3ENW A;  1VGY A;  5ETL A;  3DGV A;  3CCR S;  4DPY A;  1QE1 A;  2QA4 S;  3Q8R B;  5D77 A;  2XMM A;  2HS4 A;  2W9B B;  1HHQ A;  3BN4 A;  4WZQ A;  1EX8 A;  3O3L A;  3BO3 A;  5JJB A;  2B6A B;  5KT5 A;  4XTT A;  4OZ0 A;  2R7R A;  2IJF A;  1MMN A;  3Q24 A;  2AYG A;  4CLY A;  4ZVH A;  3DOK A;  3HSG A;  3NS5 A;  1N5Y B;  1FRL A;  2BE9 B;  5I3U A;  4S0M A;  2CQH A;  2E5G A;  1X5T A;  3SCK E;  5HMY A;  2RQM A;  1IUJ A;  2M8H A;  3IMQ J;  2DNM A;  2NR0 A;  4GRS A;  3IS9 B;  2COL A;  2VFT A;  2YX1 A;  3AB4 B;  2MTL A;  3T6J A;  2N7C A;  4B9T A;  2F1F A;  2OEL A;  1PGZ A;  1S0M A;  1CQM A;  1Z2Z A;  2X51 A;  3CCL S;  2F8M A;  2ZJR Q;  3BBF A;  5J1E B;  3GTY X;  4C9D A;  2W25 A;  1H3D A;  2DR9 A;  1QY7 A;  4ZVO B;  2DGX A;  2M2B A;  3SYZ A;  3WIU A;  2WOM A;  4YR2 A;  2FLL A;  5A6W A;  4N41 A;  3LGM A;  4NLW A;  2UV8 G;  2QYG A;  5K14 A;  2KXN B;  1JLA A;  4OZN A;  4I68 A;  2VG6 A;  3RYL A;  3NGT A;  3NG8 A;  1HQE A;  2QSW A;  2V94 A;  3ET6 A;  2HNY B;  3IC1 A;  5KOX A;  1U47 A;  2CUY A;  1VOM A;  2ABY A;  5HVH A;  4KC5 A;  3A4T A;  2YX7 A;  1S9E A;  5KFO A;  2UUC J;  1X4D A;  3KLV A;  2Z2L A;  3KLE A;  4C8Y A;  1MN7 A;  3MDF A;  4HLB A;  4FPR A;  2VPW B;  4GC6 A;  3KK3 A;  2Y1I A;  1K8A T;  3W1Y C;  5KFP A;  4A48 A;  3KLI A;  2OHD A;  2MKS A;  1JQG A;  3FRY A;  4NZ6 A;  4C4W A;  1VBX A;  4A8O A;  1S1V A;  4O4G A;  4HHH A;  3TUI C;  4NLR A;  3MPD A;  3R7N B;  1TV6 A;  4W92 B;  3G6V A;  1FRX A;  1OS5 A;  2DGW A;  4FZV A;  4ED2 A;  3DLJ A;  4ED3 A;  1B70 B;  2JC1 A;  2MKK A;  2VV5 A;  3FZ2 A;  4RZR A;  4PQU B;  1FEH A;  4DR1 J;  1N36 F;  5D15 A;  1GTE A;  4J9S A;  3M9M B;  2IC3 B;  2YKM B;  3DDK A;  4U9R A;  4YHH F;  1NPR A;  2VPY B;  3CCU S;  4DQR A;  3ZO7 A;  3UFC X;  5HAT A;  1IKV B;  2MLZ A;  1FVQ A;  3EXY A;  4DX6 A;  1R0B G;  3RB3 A;  2P9G A;  4DPX A;  4DV0 F;  2PII A;  1XEZ A;  5DJB A;  1QAX A;  1T8E A;  4WYW A;  2FVP A;  2QLW A;  1DZ5 A;  3SEO A;  4I2P B;  1AUS L;  2G0J A;  1NU4 A;  4MH8 A;  1SJR A;  4NI2 A;  2IYI A;  4PG5 A;  2OLW A;  1U02 A;  1OY6 A;  2RH3 A;  4N7T A;  4JI1 F;  3NNA A;  5GAG U;  1RAF B;  1TK8 A;  1HIY A;  4OYI A;  1B7F A;  1QAI A;  4HL9 A;  2J6S A;  1ZZF A;  4GKK J;  2J7W A;  4X84 A;  4OYP A;  3ILL A;  2MY7 A;  3UVJ A;  4QWD A;  4UZC A;  3VR1 A;  3OTE A;  1HNZ F;  1C1C B;  2QEX S;  1CQN A;  5HQL A;  2B9Y A;  2M52 A;  4CLF A;  2VQE F;  1SQF A;  2XNQ A;  3GCW P;  4ECV A;  4ETX A;  3HVT A;  1RWW B;  1VLY A;  4DN0 A;  4JBC A;  1UJ4 A;  4P2M A;  1RXO B;  2PSZ A;  2WVF A;  4Q8F A;  2VFV A;  1RU1 A;  4EO6 A;  4IRC A;  2AJ4 A;  1WHW A;  1N8R T;  1P9Q C;  3I0R B;  4FBU A;  1SC4 B;  4DQI A;  2M4M A;  5KFZ A;  4JI5 J;  4ES3 A;  2HRU A;  4LF2 A;  4ZK7 M;  2DTJ A;  2GQQ A;  1VRT A;  2J9D E;  2OFG X;  1ARO P;  2Z0G A;  2Q79 A;  1P1L A;  1CPZ A;  3NMR A;  2DNK A;  3HHL C;  2ZOG A;  3TZX A;  2R9L A;  3AH6 A;  4DLE A;  5E3R A;  3QIP A;  4QW9 A;  3I4P A;  4KGV B;  4MJK A;  3M30 A;  2HHV A;  2IVF B;  3AT1 B;  3JSB A;  5BR8 F;  2DB1 A;  2I5J B;  4TYA A;  4DL0 C;  1SKU B;  3CCS S;  2UXC F;  4RWW A;  1Y11 A;  2ZH8 A;  2ALZ A;  2H48 B;  4CO2 A;  4MAK A;  1UW9 A;  3GSI A;  3M8P A;  5AE2 A;  3SCJ E;  2GC8 A;  7FD1 A;  1FK9 B;  2UVV A;  1S1W B;  5D4P A;  2DPI A;  5IZH A;  1F0X A;  4DR7 F;  1UP1 A;  2OTL S;  3GR0 A;  2YXL A;  2DEI A;  4RU9 A;  5SZT A;  3C19 A;  2BA9 A;  4CLW A;  3E01 A;  1BQN B;  1HNV A;  2W9A A;  1VK3 A;  1JWW A;  2ZOF A;  5F8H A;  1T3O A;  3D6F B;  4U7U D;  3ILO A;  1F6T A;  3NGR A;  4UTG A;  2GMJ A;  3GYX B;  3ZZR A;  3C6T A;  3DYA A;  4DZ6 A;  3VAJ A;  3WC0 A;  2MQM A;  2N4C A;  3VQS A;  5HMW A;  2C3U A;  1HMV B;  1RT7 B;  4EMD A;  1TUW A;  1PJ6 A;  5CA5 A;  3QWP A;  2CQP A;  2BE2 B;  1WKK A;  4FBT A;  1FJG F;  5LXR A;  3V6D A;  3LAM A;  3QSY B;  1VC6 A;  4DV1 F;  2EI5 A;  2NCK L;  4LF5 F;  2IDL A;  1WSV A;  4JYA J;  2N3L A;  4OHW A;  1RB0 A;  2HBR B;  3EPG A;  3PRV A;  4FF2 A;  1U6F A;  3K2Y A;  3BR8 A;  1X4H A;  1NUE A;  5HLF A;  3G6E S;  3ISN D;  1KNZ A;  3SI8 A;  3V6H A;  4K4U A;  1DLO A;  3BGU A;  2XLJ A;  3QLH B;  3SSR A;  3ZZZ A;  4OIX A;  1PJ7 A;  4NA3 A;  4D3H A;  1E6Y B;  4AD6 A;  3CJK B;  2VJV A;  3MUM P;  2D74 B;  2K3K A;  3DRP B;  3M6U A;  1KLM A;  4ZPV R;  4LIW A;  4A8K A;  2NUH A;  1F2H A;  3OFG A;  3MI7 X;  4KR0 B;  3V4I B;  4FXD A;  2L9W A;  2ZH9 A;  2IM3 A;  3R1H A;  4IQM A;  3FGV A;  4ZVT B;  5GMK a;  4NLP A;  2G0C A;  1F9E B;  3OFE A;  1FKO A;  2ZJP Q;  2FVC A;  4DWI A;  3OL8 A;  1RTJ A;  5EGY A;  1HNW F;  3PKY A;  1DRZ A;  2FJD B;  2E7X A;  2FYX A;  4OLP A;  3GJS B;  3QAE A;  4DFP A;  2MGZ A;  5KFF A;  3A13 A;  2V34 A;  2ZBQ A;  3GYG A;  3NNC A;  1SKR A;  2UV8 A;  1T7P A;  4DV3 J;  2FTR A;  4OJH A;  5E33 A;  5C2C A;  5K20 B;  3PV8 A;  1WOR A;  4F36 A;  1NLK L;  2RML A;  3BQ1 A;  1LW0 A;  3OLA A;  1R3N A;  2W9C A;  4P73 A;  4NLG A;  2F5G A;  2PMH A;  2B8Q A;  2B43 A;  1PCA A;  3FVY A;  4A4J A;  3NNH A;  2CPE A;  4CNY A;  3ZTR A;  2MQN A;  4I7F A;  4DPU A;  1B7Y B;  3DDN A;  5C25 A;  5IQQ A;  4DN9 A;  1XMB A;  1WTF A;  1RT1 B;  3Q8P B;  1JX4 A;  2VDI A;  2BW7 A;  4K5S A;  5U47 A;  3LP0 A;  2Y3Y A;  2DGV A;  4IG0 A;  3R6G B;  1S5Z A;  1UEK A;  4ECX A;  4MIB A;  4A8W A;  2D9O A;  2PO4 A;  4WK3 A;  3N01 A;  4PXC A;  1M0S A;  4C11 A;  4BWJ A;  1ZA1 B;  4RNO A;  1OWX A;  1SKW A;  2O1P A;  2LXI A;  4B3O B;  4M5D A;  4LRA A;  2K7K A;  2OUG A;  4AQY F;  1IQT A;  1RBO B;  3G71 S;  2RUG A;  4ZVQ B;  4AXJ A;  1SI9 A;  1KD1 T;  1TKZ A;  4DQS A;  4Y6I A;  4O3Q A;  2DGS A;  4X65 F;  2YNF A;  3VAM A;  2X1G A;  5JVG Q;  2DKO B;  2IIH A;  3W9H A;  4HAC B;  2ZUG A;  4ZHR B;  2FGO A;  2V8P A;  1KKH A;  1FXD A;  2ZZT A;  1YBT A;  1FVS A;  2VG7 B;  2YQ1 A;  2AZ3 A;  4X66 F;  2IA6 A;  2E5H A;  3OBI A;  5F0U A;  4M5G A;  4AL5 A;  1YWX A;  3PW0 A;  2XYH B;  4ES1 A;  1FCA A;  3LGN A;  2LVW A;  3HD2 A;  1VQ4 S;  5GAE I;  1FFS B;  4ICL B;  5HP1 B;  2DBB A;  3TVZ A;  2FJB B;  2CZV C;  1H2T Z;  4LF9 J;  3SCL E;  1KP6 A;  1MWY A;  3FFI B;  3OTO J;  3TAQ A;  1RT3 A;  1FE0 A;  1S9F A;  1FE4 A;  4P2F A;  5DRK A;  2BKP A;  7AT1 B;  2A2C A;  4QPX A;  2BJ3 A;  4ED6 A;  5KG5 A;  3G2X A;  3OL7 A;  2V2Q A;  4X4R A;  3Q8U A;  3N0V A;  4WE1 B;  4NXM J;  4OMF G;  2BJ9 A;  3H90 A;  1FI4 A;  1HBN A;  2IJN A;  2R3V A;  1OMS A;  2FVS A;  3GB0 A;  3ILI A;  4BC7 A;  1DY3 A;  3NY0 A;  1FTC A;  3MEE A;  2YNG B;  4RNN A;  1VCT A;  1F9F A;  2B51 A;  4PUO A;  2RIJ A;  5CYM B;  3W60 A;  3ZTP A;  1YBU A;  3RW6 A;  1V3S A;  2VF3 A;  2XSF A;  1NPK A;  4O3S A;  3M2V B;  2Y8W A;  2OPQ A;  3UR3 C;  2BX6 A;  3L3C A;  2BOA A;  1VQN S;  3C8Y A;  4A47 A;  1CS4 A;  3HLU A;  3EVO A;  2MZ1 A;  3VAL A;  2RE1 A;  2OMO A;  2U1A A;  4EZ6 A;  1YRU A;  4RNF A;  3MD1 A;  3CD5 A;  3G8T A;  4N47 A;  5IWA J;  4JI8 F;  1L3T A;  4LFB F;  2AJ1 A;  4TLQ A;  3J81 Y;  2QLX A;  4ZVE A;  3FDS A;  2ZH2 A;  4CO3 A;  4DR4 F;  2LLZ A;  2QIF A;  1O8B A;  4HVZ A;  4FKY A;  1QE1 B;  3W7B A;  1UEU A;  4C98 A;  3N5F A;  2DGU A;  1EQ0 A;  3KOA A;  3K8V A;  3PAC A;  1N32 J;  3IWL A;  3BGR B;  4CT9 A;  3CPW R;  3FNN A;  4OI3 A;  1I3O B;  3NGD A;  2F4V F;  3TUP A;  1JLF B;  3CCM S;  3QJJ A;  2CAJ A;  2C2O B;  5J2P B;  2R7S A;  5I3U B;  1VYA A;  3FRZ A;  3D3C J;  3MTJ A;  4RLE A;  4OYA A;  2CQD A;  1I51 B;  2LQ5 A;  5F8M A;  5DLF A;  4KB7 A;  3W65 A;  2C28 A;  5I42 A;  1Q16 B;  1S1U B;  2HK3 A;  4LUB A;  4DR2 J;  3CMQ A;  3JSM B;  1EJ7 L;  3QO9 B;  4X4U A;  1Q8L A;  1SJQ A;  1AYE A;  5A2Q U;  1DQA A;  1T9V A;  1UAW A;  1NZ8 A;  5KG2 A;  3TQ1 A;  3B4D A;  3PRB A;  1TAU A;  3MR6 A;  3KHH A;  1MWQ A;  5H9F K;  3TAN A;  5IM0 B;  3G6Y A;  5K9F A;  2WOM B;  3G9C A;  3J81 j;  2A1B A;  1T03 A;  2FVQ A;  2WB4 A;  4ZIV A;  2VG6 B;  2MKJ A;  2HHH F;  4HH0 A;  2JVR A;  2W4C A;  4O3N A;  4DV2 F;  1LWX A;  2KT2 A;  4L73 A;  4KTQ A;  3P96 A;  2Z58 B;  2KM8 C;  1VHI A;  4LR8 A;  5F3T A;  5KT6 A;  3HK2 A;  4O44 B;  1U1M A;  2B3T B;  3EZU A;  3RR8 A;  1MW7 A;  1RYS A;  1TKX B;  4FDF A;  3SFG A;  5CAB A;  4PXE A;  4LF6 F;  2MQ8 A;  5A8K B;  1LV5 A;  5L46 A;  3JAM U;  3GFY A;  2Z2Z A;  2LKZ A;  2RQC A;  1H73 A;  1ZET A;  2LEA A;  3CGI A;  1U8S A;  2YNI A;  1I1G A;  2F7V A;  5LSL A;  1S1V B;  2CDQ A;  3M2U B;  1VQ5 S;  2YTC A;  4ILL A;  1ROF A;  4WII A;  1JLQ B;  3V6J A;  2EC2 A;  3OSP A;  3EGV A;  4DCO B;  1X31 C;  3CF5 Q;  2IAJ B;  4ZA1 A;  3FBE A;  2LEB A;  1MNE A;  1D8Y A;  2RKI A;  2I6W A;  3CWJ A;  4KGK A;  4XIU A;  3Q8Q B;  4IH6 A;  1HI8 A;  2DIS A;  4HTI A;  3UCZ P;  3M8Y A;  3NL0 A;  1UJ5 A;  5IC4 B;  1WTB A;  2Q6C A;  4O3P A;  2V50 A;  3RB0 A;  2IRX A;  2CPX A;  1AA1 B;  3GMG A;  1FES A;  3BGF A;  2QJ3 A;  2BAN A;  1Z1Z A;  3DOL A;  1XNR F;  2KG1 A;  3EZO A;  5E2Q A;  2WB1 D;  3JB9 k;  5D3G A;  2DVI A;  1QUV A;  3TEG A;  4P9S A;  2W7A A;  1MN9 A;  4J9R A;  4IOA Q;  2H51 B;  2XHW A;  3IBF B;  1JIH A;  5KT7 A;  1SIW B;  4ZLJ A;  1UWA A;  3CJ8 A;  4U8V A;  5J2N B;  1ITP A;  1VQY A;  4E0D A;  1VQO S;  4H4M B;  1SJ4 P;  2ATC B;  5DDO C;  2QO3 A;  2W8K A;  3G4S S;  3KK2 B;  4WP9 A;  1V3Z A;  3HCX A;  2W7O A;  4YEA A;  3V4M A;  1Q81 T;  4USJ C;  2RRA A;  4NXN F;  3I4H X;  3UVJ B;  3LTO A;  5K8O A;  2JOQ A;  4BLG A;  3AJD A;  3M9N B;  2CG8 A;  4WP8 A;  1HWU A;  4L75 A;  1HBO B;  1TVR A;  3CJ2 A;  1I94 J;  5ETT A;  2RU3 A;  5CXT A;  2BM0 A;  2UVR A;  1GFW B;  4OYB A;  4JP8 A;  1YIJ S;  1A6L A;  1UPM B;  3TYT A;  3D1Q A;  4NCB A;  4X62 J;  1GAO A;  5KFB A;  1N34 J;  3I32 A;  2GIF A;  3OV7 A;  5LMN J;  4F3Q A;  1CC8 A;  3PR5 B;  2NSC A;  4XPC A;  1F5B A;  3DN9 A;  2XY5 A;  3QIP B;  4FVM A;  1PG5 B;  2MQL A;  1ZAV A;  3GFX A;  3T1H J;  3G82 A;  3M30 B;  2HG4 A;  2BQ3 A;  3NBP B;  4WXO A;  1JLC B;  1QM9 A;  2VBW A;  1TL4 A;  2G2Z A;  1BQM A;  1TMJ A;  3ZTQ A;  3BDE A;  3D4J A;  2WW4 A;  3KLH B;  2ZOM A;  2DY9 A;  2F63 A;  1RWU A;  4C8L A;  4OX9 J;  2MPU A;  3MCN A;  2ZUA A;  1YJN S;  1PBU A;  1HR0 F;  1UTA A;  5DLG A;  4DSI A;  1NK5 A;  2LEC A;  1REV A;  1FXR A;  3OXG A;  2MJN A;  3SSS A;  4V19 X;  4ANC A;  2D3O 1;  2A6M A;  2VQF F;  1OSD A;  3TOQ A;  1HNV B;  1VQL S;  3RGI A;  2QN6 B;  4LSL A;  1LWE A;  2W4P A;  1AB8 A;  4FYD A;  3DYA B;  4F0M A;  4TY9 A;  3P5T L;  3RBE A;  3C16 B;  1VQ8 S;  3FUY A;  1RAJ A;  3N6L A;  4G1Q B;  2OEK A;  3GE9 A;  1CJV B;  1W7W A;  1IBL F;  1KFD A;  1TMM A;  5JXS A;  5F8J A;  2GVD B;  2Z2Y B;  4E8U A;  2PT0 A;  3KG0 A;  1H72 C;  1CJK B;  4DZD A;  1IKY B;  2AJF E;  2PDA A;  4URG A;  4NCG A;  2ADC A;  4HHJ A;  4CRJ A;  3OD2 A;  2FUG 9;  3TWZ A;  4JV1 A;  1MMD A;  1NH7 A;  2DXE A;  2V2V A;  2B7B B;  4QR2 A;  2AWZ A;  2G2O A;  2UXB F;  1FJC A;  2FJE B;  3AA9 A;  3DI6 A;  2V68 A;  2HNZ A;  1ZM2 A;  1BHN A;  2BJ1 A;  2MKH A;  3A3P B;  2XO6 A;  1YJW S;  3FJ2 A;  3W61 A;  3RRG A;  1EZZ B;  1F3V A;  5L9N A;  4X4T A;  2G9O A;  4CCH A;  2PN6 A;  4Y28 C;  3R97 A;  1KQF B;  3PYG A;  1KDN A;  1PC4 A;  2RHQ B;  1RHU B;  3H25 A;  2VON A;  5B7W A;  4FPI A;  2AIR B;  2AJQ A;  2FZK B;  3RB6 A;  3OR2 A;  1JNR B;  1CEZ A;  4PCQ A;  2FY8 A;  1U26 A;  4J9V A;  4I56 A;  1TP7 A;  3K0J A;  1RE1 B;  3MM7 A;  2BQU A;  3D2W A;  2UVW A;  3S7R A;  3PEH A;  4DUT A;  1IR0 A;  4ZVG A;  5ETR A;  1RP5 A;  4O4R A;  4OYO A;  2A18 A;  2BAC A;  2YH1 A;  4KO0 A;  1LKZ A;  1B3T A;  4Q0B B;  1N5Q A;  1WG5 A;  1JXE A;  3RW7 A;  3VGV A;  1LW0 B;  3ZNU A;  2M9K A;  1VJW A;  2W9C B;  2KXH A;  3OUY B;  1HHT P;  4YB6 A;  4Y0F A;  4UQG A;  2ERR A;  2RIL A;  4P10 A;  4ELV A;  1X4G A;  3EGN A;  3M4X A;  4KFB A;  3CCE S;  5C25 B;  3GSD A;  4XDC A;  4YR3 A;  3UR0 A;  1T0T V;  3GIL A;  2WON A;  2BUN A;  4L74 A;  4DSE A;  3LP0 B;  1WC6 A;  5LJ3 Y;  1GTH A;  2DCL A;  3ITH A;  3N4W A;  4YN3 B;  5ETP A;  1HI1 A;  1P9Y A;  3EM1 A;  3LF0 A;  1U25 A;  1N36 J;  3M8Z A;  1TZ0 A;  1JJC B;  2HBQ B;  4NLY A;  1OY8 A;  4LRB A;  4YHH J;  1YJ9 S;  3IBW A;  3ULH A;  2CAD A;  4MK9 A;  1CJU B;  2WSC C;  3K59 A;  1FX4 A;  3N5B A;  4WCE Q;  4NYZ A;  4DV0 J;  2DR6 A;  5L1K A;  2AYM A;  3MCM A;  3AJ1 A;  2H65 B;  1MU2 A;  4F4Z A;  4NML A;  1SUQ A;  5L1J A;  2BZ2 A;  2FVR A;  3B82 A;  1S1T B;  4CO5 A;  3D5M A;  3HMJ G;  4LFC F;  3KLF A;  4WF9 Q;  1RA7 A;  1WNE A;  3TVK A;  5DQG A;  1NKE A;  4EYH B;  2EEY A;  2PMZ D;  3O6Q A;  4JI1 J;  1HYS B;  3HHL B;  4CLT A;  2CJ9 A;  3FCH A;  1WUU A;  3Q22 A;  3Q23 A;  4RW7 A;  5THW A;  2AV5 A;  3FBC A;  2GNK A;  2E5L F;  3GV8 B;  4CIO A;  3QJP A;  2D3U A;  1WC3 A;  2RB7 A;  1NDL A;  3J7A 1;  3M2R B;  2GW8 A;  2A3J A;  4RR5 A;  1HNZ J;  1FKA F;  1TR0 A;  4LR7 A;  1HNX F;  2HFV A;  4Y2M A;  2VQE J;  4ID5 B;  1RWV B;  4BCA A;  2MSS A;  2ZFH A;  1NDC A;  1S7I A;  2VHG A;  1RAE B;  2GGP B;  1K0V A;  2NQP A;  2HFN A;  3GJR B;  1GQE A;  3QT8 A;  1EHW A;  5T7L B;  3ZNJ 1;  2B6A A;  2NPF A;  4OZJ A;  1NB7 A;  2AJ0 A;  4L3K A;  1YG0 A;  4RUB A;  2CKW A;  2KJW A;  4Y2I A;  3H4B A;  3A8J A;  3BSC A;  1N5Y A;  2HUR A;  4PUO B;  1MRO B;  2G2Y A;  4OX8 A;  2YWG A;  2CIM A;  1RDR A;  4KGX B;  2V4R A;  4A8M P;  2HND B;  1XWL A;  4B3T F;  1CLF A;  3UO0 A;  2NZC A;  3IS9 A;  2FHK A;  2C3O A;  5L1L A;  3KLG B;  3FSY A;  5BR8 J;  1U1P A;  2E1A A;  2LU1 A;  2BRL A;  2UXC J;  1FJ7 A;  2VA2 A;  3BSO A;  2KH9 A;  5J1E A;  3IR6 B;  3J7Y I;  2R7Q A;  4B9V A;  3FK4 A;  2HFZ A;  4DR7 J;  4N8N A;  1J27 A;  3CJ0 A;  3R2C J;  1ZOT A;  1ZAW A;  3E3X A;  2R8G A;  2OPS B;  3CC4 S;  3KWM A;  1VDH A;  5D4L A;  1MSW D;  3IFE A;  1XR7 A;  3DGP B;  2X1A A;  4ECY A;  4R5P B;  1NH8 A;  3LWL A;  4B9S A;  3MTK A;  1U48 A;  2AYB A;  5F41 A;  4QR1 A;  1C4C A;  4KV8 B;  3HPO A;  2HHT A;  4J9O A;  1FJG J;  2CPH A;  4LSN B;  1HKA A;  2APO A;  4DV1 J;  2LQ9 A;  5L1I A;  2NPI A;  4LF5 J;  4K59 A;  5HQM A;  3W2W A;  1Q5V A;  2YNH A;  2XNR A;  1TL1 B;  4G65 A;  2GV1 A;  1Q53 A;  1PJ5 A;  3FEZ A;  3QGG A;  1VR6 A;  3T5L A;  2CNO B;  4DFK A;  1C0T B;  1NBE B;  4J90 A;  5BYR A;  3ICL A;  1UL3 A;  3VHQ A;  1UVJ A;  3R3T A;  5J2M B;  1KQS R;  3QAT A;  5A8R B;  1X4B A;  1TKT B;  5KAK A;  4NA1 A;  4PWU A;  4USH A;  1SBR A;  3TW0 A;  1QSY A;  3H5U A;  3FEX B;  2B5J B;  2IC3 A;  4IOC Q;  1A0O B;  4Z7C A;  4J9Q A;  2ZHB A;  1NKB A;  2K7J A;  1IKV A;  3KJQ B;  2D7S A;  1U1N A;  2YKO A;  3A8E A;  4K50 A;  4C0B A;  3D68 A;  1WJ9 A;  5HJX A;  1DFD A;  3PZP A;  1ZH5 A;  3I82 A;  1BWE A;  1LW2 A;  4C8K A;  3P49 B;  3BBB A;  1YIT S;  1WEY A;  2VFU A;  1FNM A;  4DX7 A;  1HNW J;  1GNK A;  5FII A;  4I2P A;  2CQ0 A;  2LFV A;  3MFI A;  4KH1 B;  2W2P P;  4FNH A;  5A8W B;  2ASJ A;  3HKZ D;  4QWC A;  4ECQ A;  1LNQ A;  2N7Y A;  4OV1 A;  1JKH B;  2U2F A;  4WFB Q;  1SH0 A;  1C1C A;  2FC9 A;  5E3A A;  1FNX H;  4YME A;  4O23 A;  4K4W A;  4IRD A;  2DGT A;  1N6Q A;  4ZVS B;  1H74 A;  1RTI B;  2RF2 A;  1LOU A;  3OFH A;  4RW6 A;  1J5O A;  2PFF B;  3CVK A;  3QYY A;  2KVQ E;  4AE5 A;  1VI7 A;  1RZM A;  3LAK A;  4N8O A;  3DOL B;  4ZJL A;  1IN0 A;  1WHY A;  2JRS A;  3I6P A;  3CUN A;  3I0R A;  1UA0 A;  5CYQ A;  4J91 A;  4PEO A;  3AQP A;  3HO1 A;  2MEW A;  2PFD A;  1RLD A;  3H5X A;  3J7Z T;  1JNZ B;  5GVQ A;  3V5R A;  4DS4 A;  1PYO B;  3W2V B;  5DGB A;  1HWL A;  1G2E A;  3A8I A;  3KUG A;  5GAH U;  4A8X A;  3R7B B;  2ILY A;  2AYE A;  3IAM 9;  2KT5 A;  4AQY J;  1X9S A;  1IWG A;  2CJA A;  1AT1 B;  4ECZ A;  5DG8 A;  4NWB A;  1P6T A;  1RT6 B;  1ZZN A;  1RAO A;  4DDF A;  3IN5 A;  2C3M A;  2CG4 A;  4X65 J;  4P7T A;  3JQJ A;  1SL1 A;  4UW2 A;  1M5P C;  2DYA A;  1BY9 A;  5IV4 A;  2I5J A;  3DMJ B;  2O3D A;  4X66 J;  2HMI A;  4F25 A;  3LA0 A;  2YPZ A;  3D3B J;  2EBE A;  4QPT A;  3OW2 R;  1IBM F;  1TVR B;  3D0I E;  3CCZ A;  3HHK A;  2IBK A;  1FK9 A;  4M63 A;  1S1W A;  1S6U A;  4DV4 F;  1PBA A;  1WSR A;  4ZJQ A;  2G1D A;  3PO5 A;  3MPY A;  3PFE A;  3VGT A;  2WHO A;  4M95 A;  1SL0 A;  5M2P A;  1O6X A;  1KHW A;  1RT2 B;  4W98 A;  1AZS A;  3PR4 A;  1VJQ A;  4LF4 F;  2NSB A;  5EHH A;  4K7Q A;  5KFS A;  3GWC A;  2RD5 C;  4OX6 A;  4EUV A;  2MXY A;  4F2R A;  3H20 A;  2QZ8 A;  3LQV A;  4AUK A;  3EMT A;  2L48 A;  3HI9 A;  5B0F A;  3HX9 A;  5C24 B;  4F8R A;  4USI A;  4WXW A;  2IDE A;  1HMV A;  1RT7 A;  2OEM A;  4PWD A;  3J7Y U;  2RRB A;  1VHF A;  2IM1 A;  2BE2 A;  4ZIT A;  5EUH A;  1FRH A;  2EFQ A;  1U45 A;  4AL6 A;  3GG1 A;  2XO7 A;  2E1M C;  4K4T A;  4JV5 F;  4DSL A;  5B0C A;  2H4W B;  2RVJ A;  4EK2 A;  3IG1 A;  1IM6 A;  6AT1 B;  1WD6 A;  4JUZ A;  4NMX A;  3U1M A;  1HAR A;  2XZD B;  5JUM A;  5GAD U;  3EX7 B;  1QVF R;  1KRP A;  1NXI A;  5D78 A;  1CBK A;  4K4S A;  2XCA A;  1Y5L B;  5HRO A;  2FLP A;  1E6V B;  4Q43 A;  3CJK A;  4JI8 J;  2HLT A;  4LFB J;  1WI6 A;  4JI6 F;  2ZE2 B;  1P8G A;  2K8G A;  1M90 T;  2VOD A;  4DR4 J;  1Z2L A;  3BDP A;  3T6B A;  3HVR A;  1VQK S;  3V4I A;  4LSL B;  1LWE B;  3GR1 A;  3QAU A;  3HFZ B;  2J8A A;  3BR9 A;  1LXN A;  2MY8 A;  3MM6 A;  4AT1 B;  1UFW A;  2XYP B;  5GME A;  1FRI A;  5KFM A;  4YB5 A;  4FYV B;  1JJ2 R;  5DZ6 A;  3SFU A;  1SCJ B;  1J5E F;  2F4V J;  3ETM A;  2DIU A;  4OZ1 A;  3MCO A;  3MEC A;  2DNR A;  3MPU B;  3IR7 B;  4Z7Y A;  4DV7 F;  4IOB A;  2CPJ A;  4X4O A;  2KVI A;  3M8R A;  2KN4 A;  3ZZU A;  2KM8 B;  2XMU A;  4RO0 A;  4NCG B;  3RR7 A;  5T14 A;  1TKD A;  2JSX A;  2QFJ A;  4F4Y A;  4KKO A;  1B0T A;  1FA0 A;  2HLU A;  2VFS A;  1O51 A;  4RUC A;  3KG1 A;  1SC3 B;  2ZD1 A;  4UUW A;  1IKW B;  1U4B A;  3KK1 B;  5DZ7 A;  4PRF A;  4CO1 A;  3Q0A A;  1XC9 A;  4UY8 5;  1RT1 A;  3K5P A;  1JLE A;  1IBC B;  3W9J A;  1HD0 A;  5D0H A;  2EFO A;  2YX4 A;  1Y00 A;  4Y00 A;  1TFW A;  1ACM B;  2HHH J;  4FS2 A;  4ZPC A;  2DRD A;  4DV2 J;  4DCP B;  4RX6 A;  4DR5 F;  1RHQ B;  1H2V Z;  2CNN B;  3MMA B;  5C2G A;  3TEH B;  4OHY A;  4B3O A;  4QU7 A;  2MZR A;  4R0E A;  3R7S B;  1NSA A;  5BXI A;  4B9U A;  4X64 F;  3R2D J;  2CJQ A;  2AF6 A;  3CDU A;  1BGX T;  4EWT A;  2BJD A;  1VMB A;  1CVJ A;  1NCL A;  2GHW A;  2XC9 A;  4YDD B;  3UNG C;  4Q5V A;  5LSO A;  2GQC A;  4EGL A;  1RJJ A;  1VBZ A;  4LF6 J;  4FF3 A;  3J81 U;  2OML A;  1HQ2 A;  3QFW A;  2EFP A;  4Q7A A;  1YJ7 A;  4O0N A;  2LQJ A;  3I9Z A;  4HAC A;  3VAI A;  4QZV B;  3J7A N;  5LMU F;  3HT0 A;  1RKJ A;  4D3G A;  2VG7 A;  1BC6 A;  3MED A;  1X0F A;  2VG5 B;  3SQG B;  3D6H B;  1QJH A;  3RG6 A;  3FMW A;  2VIC A;  5KFN A;  1WEZ A;  3MAQ A;  4MYT A;  1KHV A;  3MM8 A;  2J8S A;  4ICL A;  5L38 A;  3RBD A;  1VBY A;  1WEL A;  4WFN Q;  3ENQ A;  1NDK A;  1BD6 A;  2UU9 F;  1UZD A;  1DUR A;  1GXT A;  4DSF A;  3EDR B;  3K89 A;  4J9M A;  3DNC A;  3KKF A;  4PAB A;  1X4C A;  4LMZ A;  2H1Y A;  4K0K F;  4I4B A;  4O3R A;  1JLG B;  1XNR J;  2MZQ A;  3R1L A;  2ZBP A;  1H7W A;  4LF8 F;  3C2P A;  4F2S A;  2DNO A;  1YDL A;  2YKN B;  4OHV A;  3CD0 A;  2PA8 D;  1UPP A;  2VZ9 A;  3D1O A;  4ECS A;  1AFI A;  3TJA A;  5CYM A;  4IH5 A;  2Y9H A;  2QRR A;  3BRE A;  3THV A;  4FXW A;  4PPZ A;  6FD1 A;  4NXN J;  4DPO A;  3EWG A;  3T5J A;  3BJY A;  3MPW A;  1UCN A;  3KJV B;  1MWZ A;  1XNQ F;  1RU2 A;  2XYG B;  2OPR A;  3OR1 B;  4DV5 F;  3ZZY A;  5DQH A;  3IWX A;  4GVL A;  1IVZ A;  1LEO A;  1T05 B;  3PDN A;  2GFF A;  5KFQ A;  3WQP A;  4X4S A;  2NZ4 A;  5HK4 A;  4LVO P;  2YKP A;  1AUD A;  3QRP A;  4IDK B;  4M5L A;  2WAQ D;  2LA6 A;  4B3R F;  3BSN A;  1F2G A;  3B54 A;  2B9W A;  4DSJ A;  3NP5 A;  2KFN A;  5A0Y A;  3C6U B;  3BGR A;  2HHW A;  1X4E A;  5E5N A;  4AFF A;  2ZWO A;  2Q1L A;  4CWB A; 
#chains in the Genus database with same CATH homology
 2KL8 A;  2UUB J;  2UXD J;  4JI8 J;  3OTO J;  1FJG J;  2E5L J;  4LFB J;  3J7A N;  2MEW A;  4JI2 J;  4B3T J;  5LMU J;  4YY3 J;  4DV1 J;  4JI6 J;  1HNW J;  5A2Q U;  4DV6 J;  1HNZ J;  4LF5 J;  2ZM6 J;  4DR4 J;  4JYA J;  5BR8 J;  4LF4 J;  3T1Y J;  2VQE J;  1HNX J;  4NXN J;  4AQY J;  2UXC J;  4DR1 J;  4NXM J;  1N36 J;  4DUZ J;  1IBL J;  3T1H J;  1N33 J;  4KY3 A;  1N32 J;  1XNQ J;  4YHH J;  4JI7 J;  2UUA J;  4B3M J;  4DV5 J;  4RJV A;  2UU9 J;  4DV3 J;  2UUC J;  4DUY J;  4KYZ A;  4DR7 J;  4NEZ A;  2HHH J;  4X65 J;  5FLX U;  3R2C J;  4JI3 J;  2F4V J;  1J5E J;  4DV2 J;  4GKJ J;  5LM7 E;  1I94 J;  4JI5 J;  4DV0 J;  3IMQ J;  4OX9 J;  1IBK J;  4DR5 J;  4JV5 J;  2MTL A;  4K0K J;  1XMQ J;  3W1Y C;  4DV7 J;  4DR3 J;  1HR0 J;  3R2D J;  4KHP J;  4X64 J;  4X66 J;  4B3S J;  1XNR J;  5IT9 U;  3D3C J;  2UXB J;  4LF7 J;  4DR6 J;  3D3B J;  4V1A k;  4PWW A;  4LF8 J;  4LFA J;  4B3R J;  4LFC J;  1IBM J;  4JI4 J;  4NEY A;  2MQ8 A;  4JI0 J;  4LF6 J;  3J81 U;  3JAM U;  1XMO J;  4X62 J;  2VQF J;  2KVQ E;  4JI1 J;  1N34 J;  4HHU A;  4DV4 J;  4LF9 J;  4GKK J;  5AJ3 J;  3J80 U;  5IWA J;  4DR2 J;  5LMN J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...