4K0KJ

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4k0kJ00
4DV2J 1IBKJ 2MTLA 2E5LJ 2ZM6J 4JI2J 2UXDJ 4LFCJ 4LF5J 4X66J 1I94J 4OX9J 4JI0J 4LF8J 1N33J 1FJGJ 1XNRJ 4NEYA 2UU9J 4DR7J 4B3RJ 5BR8J 4RJVA 4X62J 4YY3J 1N34J 3D3BJ 3T1YJ 4JYAJ 5FLXU 4PWWA 1XMOJ 4AQYJ 4JI8J 4GKKJ 4DR3J 4KHPJ 4B3MJ 4LF9J 3R2CJ 4DV6J 3IMQJ 4JI5J 2MEWA 4NXMJ 4GKJJ 4DR5J 2UXCJ 1N32J 2KL8A 3JAMU 3T1HJ 5IT9U 1HNWJ 5LMNJ 4DV0J 1HNXJ 2HHHJ 4JI3J 1HR0J 4NEZA 1J5EJ 5A2QU 4JI4J 4KY3A 3D3CJ 1HNZJ 2UXBJ 4B3SJ 4X64J 2MQ8A 4JI1J 3R2DJ 1IBLJ 4YHHJ 4NXNJ 3J7AN 4KYZA 4DUZJ 4LF7J 4DR1J 4DV4J 1N36J 5LM7E 2UUCJ 2UUAJ 3J80U 1XNQJ 4DUYJ 1XMQJ 4DV3J 2UUBJ 4X65J 4LF4J 2KVQE 4DV5J 5AJ3J 4K0KJ 4V1Ak 4LFAJ 4DV7J 4LFBJ 1IBMJ 4DR2J 5LMUJ 4JV5J 4DV1J 4DR4J 2F4VJ 4B3TJ 5IWAJ 3W1YC 3OTOJ 2VQFJ 4JI7J 3J81U 4LF6J 4DR6J 4JI6J 4HHUA 2VQEJ
chains in the Genus database with same CATH superfamily
2M9KA 2CJAA 1EKRA 2CZ9A 3I31A 4UOFA 2X3DA 2NZCA 1RT4B 3MUMP 1HKAA 2G0IA 2QA4G 1RJJA 4LF2A 5HBMB 3CT9A 2GS8A 4J91A 1I1GA 4CO1A 4DDFA 5E7OB 3SCKE 3D66A 5DLFA 2W2QP 5EWFA 1YJ7A 2DVIA 2JJ4D 1PYSB 4B3TF 3FJ2A 3MM7A 5C2CA 4PG8A 4X62F 4WU2A 1X4AA 2IA6A 1IBKF 3PR4A 2ZD1A 5ETMA 3CF5Q 1N36J 3DLKB 1VJWA 3EX7B 4W98A 3AT1B 4OYWA 4C8LA 2GIRA 4LFBJ 5ETTA 4KT0C 4KJIA 2CQ1A 1AFIA 2K7KA 2EXUA 8RUCA 3L9ZA 2A2CA 2M7SA 5T14A 1XR5A 4ZCIA 3PV8A 1EETA 2P9EA 3BDEA 3PCOB 4TQSA 1FKOB 4FNIA 2W9BA 2B5JB 3AHPA 3BQ1A 2ASDA 1TAUA 3K5NA 3IN5A 4ZPVR 2DNPA 1ZAXA 3CCJS 2IRYA 2XMAA 2UVUA 4FXVA 3GWCA 5DG9A 3G71S 4YB7A 2BRKA 2RDJA 2B7BB 4A8FA 4DUZF 4AQYJ 2L08A 3OW2R 4NWBA 1S76D 3KTQA 4FYVB 1VLYA 2H9ZA 4DV6J 3ZFVA 2E5HA 3HXMA 1RHJB 4QZVB 1Z2ZA 3HZGA 4KR0B 4BLGA 4ECXA 2HHHJ 1SJ4P 4FVMA 4CYUA 3QLHB 1U25A 2AYMA 5AE3A 1XK8A 2XY6A 3O2IA 5D0GA 2J6TA 2HQFA 4DR7F 4ZLPA 5HQ8A 5LSRA 1WC5A 3NGSA 4V19X 1YJ9S 1ZM2A 1TKXA 2IDLA 3M8SA 1HQ2A 3X3UA 2HVHA 4ZVTB 2W2MP 3D7SB 2AHOB 4OZ3A 5IT0A 2Y1IA 3T6BA 1KVIA 3S8SA 5RUBA 3VAJA 2POKA 4DHVA 1GNKA 2IJRA 3TA2A 2CDQA 3DOKB 2BMBA 2H51B 3CO9A 3GJRB 1Z2LA 3GIIA 3LANA 1T3OA 2O5DA 2FJVA 3G6VA 1F9EB 1X4GA 2XMMA 3TX8A 1S77D 3TANA 2CJYB 4ZIVA 3OV7A 4NEZA 2VFRA 2VA3A 3MPDA 3FEXB 1S4FA 1CBKA 2QLJB 2FLPA 4H4KC 1CJTB 2Z2LA 3SDEA 1C4AA 4TU9A 1T9VA 3M30A 5KFLA 4F50A 4JV1A 3GLJA 1R8CA 4UF4A 2CPXA 3TX0A 3EGNA 4ECQA 3J7ZT 4DSKA 1R89A 4P2MA 3N5BA 3W65A 1F9HA 4YOEA 4ZVRB 2ZD1B 4J9VA 2ZHOA 1FJGJ 5GMDA 2RU3A 3MEGB 4OMFG 5CABA 1WKKA 3HP6A 4JI4F 1VRUB 4WP3A 1MG7A 1RAFB 2HWTA 1FEEA 3MMAB 2AJ4A 5ETSA 4LF6F 3WIUA 1KR4A 2EFQA 1W25A 2LXUA 1D1UA 1EETB 1IKXB 5I42A 2CNOB 2QMWA 2BV3A 1QLNA 3R8YA 4A8MP 3V2UC 4AYBD 3MM9A 1K44A 1NEEA 1RISA 2DO0A 1RDRA 4RBUA 2A6OA 4MFBA 1P1TA 2APOA 3KJFB 4DR2J 3H2UB 1X4FA 2ZJPQ 1IKVA 3UCUP 1NJIT 4PAAA 4PUOA 4RW6B 5IQQA 2YWFA 1ZYQA 4BC7A 4DSFA 5JUMA 1PO6A 2OTLS 2ZE2A 2HQIA 4CYUB 1Y7PA 1U2CA 3KNAA 3ZTSA 1KLMB 4MKYA 5LXRA 2ZITA 3AJDA 3I32A 5ETVA 4USVA 5CYMA 5F8MA 4UOHA 3KLIB 2FUG9 2QSWA 3HT3A 1KC8T 2WVFA 4OLOA 4NCGA 4X65F 2PDAA 3W5ZA 1DTTA 2PA8D 1F60B 1RTHA 3NCPA 4J9UE 5L39A 4OX6A 5AXKA 2CIMA 1C0UA 5KT3A 3TR5A 3TZWA 4Q8EA 2Q66A 4DSIA 1O5JA 2KRBA 2VUGA 3FBFA 4H4MA 1FRHA 2JRSA 1TL1A 1D8ZA 5J1NA 2W2NP 4KGKA 1A6LA 3LUYA 1GTHA 1BUXA 2BKOA 2DEJA 3IRXB 3G87A 2C3OA 4B3TJ 4HI1A 1U49A 3IAS9 5DRKA 4DR6J 4KQZA 4F36A 1RKJA 3ZZYA 4EUVA 3R5CA 2CFXA 1FF2A 3T5LA 2CPIA 1IBKJ 4ZLNA 4DG1B 4L76A 2QLBB 4GRSA 1U1QA 4NRTA 4MK8A 1H38A 1WI6A 4TLRA 1RBOB 4FXDA 3KK2B 2EFOA 2BM0A 2WB1D 2FLNA 5FIIA 6FDRA 4ICLB 3M30B 3DLLQ 3OHBA 4M5MA 2W9AA 5D0EA 1Q5YA 3D9BA 4ALZA 3O44A 3RU0A 2AW0A 2GO8A 4DFKA 1S1VA 5HI7A 3QZ7A 4N47A 1TKZB 1X4HA 2M4MA 1RAJA 3IR7B 3BSOA 2UV8A 3US5A 3R7NB 4MAKA 4M95A 1OIAA 1REGX 4DUZJ 4RW4A 1VR6A 1S9EB 4LR9A 3KLHB 4ED4A 1OWXA 1FKPB 3L7OA 1U8WA 2V8HA 5K20B 3PW2A 2HIQA 4U7CA 1UTAA 4WIQA 5I42B 6AT1B 2MJNA 4JI6J 5G0RB 3T41A 3AXKA 4XIUA 4BC9A 1R8BA 4CM2A 3WX4A 5F41A 2IM3A 5H9FJ 3MM9B 2B4PA 4G1QA 1BD6A 2DR9A 3SSSA 4DR7J 2J8SA 4MFBB 4RJVA 4RNMA 3OL6A 4L3KA 2Q6CA 2VDHA 3KDNA 1SC3B 4PUOB 1PYTA 2HHXA 3I56S 4DZ6A 2VHGA 3MCOA 3QPIA 1RTDA 2O3DA 2ROEA 1AYEA 4KKOA 1S7IA 4PCQA 1ZAVA 3R3TA 5CYMB 3VALA 2M8HA 3IP0A 1HFEL 2MKCA 3FSXA 3TEHB 2DCUB 3PW0A 1IWAA 1MW7A 2XMWA 1CS4B 4A8QA 4WWSA 1QY7A 3VAHA 2B6AB 4YR0A 1W7WA 1W26A 1FNXH 1C0UB 3TVZA 3MPVA 1ZS6A 2XMUA 5EUHA 2DGTA 4H4MB 3H4DA 3K5OA 2V2VA 4EO8A 1RWMB 5F0WA 2GAGC 1KONA 3FRYA 1KS2A 2NXCA 2C2OB 3OLBA 3SV4A 4OX8A 1Q5VA 2XO7A 4QIEA 2C2KB 2EG1A 3OL9A 2O66A 3O3LA 2OFHX 1BE4A 3QT7A 4B9MA 4FKXA 4AD6A 3LPEA 1N8RT 3HD1A 2CQPA 3QQCD 5E2QA 2FY8A 1FEHA 2HFNA 1FE4A 4JI4J 3DOLB 2OSRA 3EPGA 4TY9A 3LP2A 1LWFB 3RB0A 1Z4UA 3P49B 2Y1JA 3D6MB 4JI5F 4OX7A 5AXLA 1DY3A 5DZ6A 1RT3A 2EK6A 2F4VJ 1U1NA 1S1VB 2DNZA 3HDSA 3UQSA 1U0SA 4CDIA 4DPOA 2BM1A 5J2MB 4LF9F 1L3VA 4PWDA 4IFYA 1G6BA 3GPAA 4WFNQ 4YEAA 2DXFA 3W61A 3N01A 2BJ8A 5J2NB 4M5HA 2J5AA 1SPBP 3CE8A 1A9NB 1OY8A 3OQ2A 2XMTA 2QMUB 2W25A 4DN9A 2LQ9A 2VB6A 2W4CA 5GAGI 2OPQA 4W4MA 2ZH6A 1Z1ZA 2DH8A 4WF9Q 4MK9A 4CTAB 2HFVA 3SFGA 1TMMA 2WOMA 4K0KF 4DJBA 5IT9U 1MN9A 4FPRA 1VDHA 4YR2A 3QWPA 2OP5A 1FXLA 3HHLC 4F4ZA 2QO3A 5KG6A 1TV6A 2ZUGA 2YX1A 1FESA 1VOMA 1HL6A 4DFMA 2AD9A 4X65J 3T5KA 3LA0A 4F0KA 3LAMA 1S7HA 5IV4A 1RTDB 2C42A 2VFSA 2IYGA 1M1KT 2X7IA 2CQHA 2R7XA 4GKKF 4HYKA 4ZPAA 4CH0S 2YNHA 3BN7A 1QAIA 3MAHA 4ZHRB 1RBLA 1TTHB 3BYPA 1VQMS 3WC2A 3UWTA 4LQ3A 1HR0F 5FD1A 1R8AA 3H5UA 2Q3PA 2KN4A 1RWUA 1ACMB 4O0NA 3R6GB 3NMAA 2O01C 4DU7A 3AOBA 1N5QA 2M52A 4K4VA 3RW7A 1JLCA 1Y3KA 1ZH5A 4I6AA 2ILYA 5ITHA 4HH1A 4WXOA 3DRRB 3R9LA 2P9CA 4DMZA 3POTA 3GQCA 3DXBA 4CLZA 3KYLA 5KFDA 1OQ3A 1EJ7L 2IBOA 4XPCA 4Z37A 1IKYA 1NU4A 1O6XA 2KHDA 4KH1B 3KK3B 4ZLLA 4LREA 3CB4A 3UVJA 3ELHA 3QATA 1IN0A 2GVDA 3L09A 3C66A 3NMRA 1LQ9A 2FZGB 1K1QA 2GW8A 3SCJE 1VBYA 3ITHB 2K8GA 1IBCB 4E2FB 1OYEA 4P9SA 5C24A 4L72B 1Q0NA 1F2GA 3DLHA 4Z2XA 5KFKA 2QV6A 3T6JA 5KFVA 1H2VZ 3CW2C 2BQ3A 5E0OA 1SKRA 2ZWPA 4DPWA 5DQHA 1YDLA 4YP3A 4PWDB 4IFYB 3K0JA 2F5GA 1VQ9S 2CADA 1U2RA 2EG2A 3W8GA 3RW6A 3JAMY 1X31C 1T7PA 2MZTA 2RRNA 4IRCA 3GIRA 5A0YB 2HKEA 7AT1B 5JVHQ 4NCBA 4B9TA 5DZ7A 1CQMA 3GV5B 1UCNA 4I2QB 2DKOB 1X4DA 3QAEA 2VICA 1FXRA 1PC4A 1TV6B 1RT1B 4KSEB 3OR1A 3UD3P 4NZ6A 4Y2IA 4RBVA 3CD7A 1Y9OA 4A46A 3A8KA 1K47A 4EO6A 3C6TB 3D3BJ 3BQ0A 3TW0A 3ET6A 4U6PA 2AEJA 2ZOMA 3R2CJ 2G2YA 4PQUA 1S9GA 4I0WA 2C2RA 2FVCA 3LAKA 3EVOA 1G7CB 5D8HB 4LVOP 2IVYA 2QYGA 4C3KA 1WSVA 4Y28C 1FO1A 3MFIA 2GQ2A 1RAEB 2F3JA 2VJVA 4WFXA 3KHLA 3HMJG 3TA1A 1F9FA 3MTKA 1FRXA 4F2SA 3M8QA 4CLLA 4PG5A 1YRXA 5LOQA 1QSYA 3K8WA 4KHRA 2MQNA 4I2PA 1T94A 1T9UA 2C3YA 3C16B 1CVJA 4G6VB 2AJ0A 4QJVA 1JLCB 5H9EJ 4LRCA 3B6BA 5LJ5Y 3WC0A 1Q81T 2W4PA 1JLGA 3POTB 1UZDA 1YBAA 3IR6B 3T3FA 1U0HA 3K89A 2H5IB 2NXNA 4QOTA 5IM0A 5LMUF 1X8DA 3QNWB 1NB7A 3NS5A 2VC0A 3OTDA 4J9LA 3R5AA 5KFJA 3I9V9 3KMQA 2Y0SD 2GVDB 4LF9J 1VBZA 2HS0A 4GKJJ 4AL7A 1FTRA 4BS2A 1YI2S 4KV8A 2PD1A 4KFBB 1KQGB 2E1MC 1S0MA 3LP0A 3MUVP 5C24B 1PCAA 3ZZTA 1F5BA 1NHVA 3H5SA 1HQUA 2HS3A 1YITS 5D77A 3U1LA 1DFDA 4K0KJ 3KJNB 3N6NA 1JLQB 1GXUA 4MK7A 3IS9A 1U47A 1B3TA 5FDLB 3QJLA 2VPZB 4Z7CA 2KT3A 2CQDA 4KHPF 4OZ1A 1T11A 3ZZUA 4ZP7A 3DU6A 2R2UA 1HQEA 3M1VA 3TZYA 1PAUB 5LMNF 2MKSA 4YQWA 3QGHA 3M2VB 3DMJB 4NLTA 4RUBA 4CO5A 4WE1A 3CCTA 1XEZA 3CMES 2P5VA 4QU7A 3CVKA 2DRDA 2HWHA 4GKKJ 2HHUA 4QBUA 1PILA 1RAAB 3PIOQ 2KZZA 1Q78A 1NDPA 2HVZA 4WYWA 2XBPA 5FJ4A 2YKNB 3BPDA 1HR0J 4NA1A 3OR1B 1DURA 1RHMB 1JLAA 1S4EA 4EBCA 3MR2A 4AL6A 2ZZNA 3M2UB 4NI2B 2HNDA 2B4VA 4O0IA 4BDPA 1M1GA 2PEBA 4Y2AA 3UNYA 4TLQA 1QE1B 1TELA 2E44A 2CYYA 2ZH4A 1S9FA 4PQUB 3WBZA 2DGUA 4WFYA 1YK9A 5CCMA 3VVUA 5A2QY 1HA1A 2XSJA 5D6GA 1J5OA 3SBMA 2WSEC 2BJ3A 1CJVA 3M2RA 2J9EA 2OMOA 1VQLS 3QFWA 1NJWA 5C7PA 3R5GA 3RAXA 4I2PB 3QRRA 2MHNA 2F65A 1YVFA 3CTRA 2I5JB 4LF4F 1S0OA 1VYAA 3OVAA 3O8WA 5FLXY 2A3JA 4ZPBA 3UCZP 3A13A 1X4CA 1AFJA 2JEIA 4OJ1A 3NOCA 3LQVA 5F8GA 2VKRA 3TA0A 2IMOA 4DQIA 3UD5A 5IM0B 3VAGA 3I0SB 3VVTA 5LSOA 4X66F 5JXSA 3BDPA 1Q7YT 2B43A 2KVQE 4Q2MA 3MUTP 4RW8A 5EWGA 1R0BG 2ZBQA 1SKUB 1NPPA 4OHWA 1UA1A 2HHQA 1TK0A 2FGCA 2YKOA 5BR8F 3GJTB 2XYGB 1IM4A 3PFOA 3DLBA 2VA2A 2J0XA 3MPYA 4NLQA 2YX7A 5IXUA 3LP0B 4UW2A 1WDTA 1R0CB 1SUQA 3HHDA 1R8PA 1M5SA 4ZK7M 1M5HA 3PXGa 3VZHA 5A8KB 3J7YI 3NXZA 2DR6A 5D78A 4C9DA 4WP8A 1F6TA 2PE8A 3G9CA 3IS9B 3DLGA 1SV5B 1X5TA 2CJBA 2HQGA 4ZS6A 2I0XA 2JL9A 2FD2A 1AZSA 1HW8A 1SQGA 4PG4A 3ZNUA 3SCIE 1MLAA 2MEWA 2I8EA 1LK7A 4IYQA 4C2MA 4R0EA 4LSLB 3O6QA 1U1LA 1NJYA 2GGPB 3GSIA 1EP4A 2WVDA 1PYOB 4KTQA 1VC0A 2QT7A 4O3RA 4Y2MA 3FSYA 5GADU 1RWXB 1Y5NB 1TVRB 3THTA 1N32F 3CO0P 2LXIA 1V9OA 5KFZA 2HZVA 4NX9A 4MIWA 2HBQB 4M5IA 3IXQA 1GTEA 2CPEA 1F1BB 1NJXA 5HN0A 4DR5F 4Y3CA 1VQ7S 3L3CA 3T9NA 2XG8A 1TL4A 2ZH2A 5KT4A 1DZ5A 2W2OP 5E3AA 5F8IA 3M8WA 1NSQA 3O5TB 1HBNA 4RLEA 5IZHA 1BQMA 4RW7A 4E0DA 4X4PA 3QIDA 1ZM4A 3CJKA 2F8HA 1S6PA 1TUGB 3H5YA 2K7JA 4RKUC 2ZH3A 2XSJB 1J5OB 2OEJA 2B4UA 2CQBA 4YS2A 1RHUB 4WFAQ 1LOUA 1CJVB 3M2RB 4AXJA 2KZMA 1VIXA 1LFPA 1SKSA 4Y2KA 2VKZG 1QAJA 3DM2A 1Q7LB 1S1WA 2B9WA 4K4SA 2KO1A 2BRLA 4CP5A 2PA3A 3ZC4A 3I87A 1JLBA 2JFKA 1IR2A 2FJBB 4CT8A 2OPSB 2W7OA 4ZKAA 2B9XA 4K8RA 2J7UA 5KFSA 4O3SA 4KH0B 1MMDA 4MIBA 2D9PA 5HLFA 1C0TA 1P8GA 2YQ0A 2FC8A 2IA0A 2RS2A 2XCAA 3TQEA 3EZ5A 2IM2A 1N52B 1KOHA 2K2PA 3WQPA 4NEYA 3RBEA 3ZNJ1 3NEKA 3MEDA 3DHXA 3MDFA 4J9OA 3A3OB 2JHEA 2B9EA 5ETKA 5B0FA 1MMNA 4JI8J 2ZBPA 1XERA 5ETOA 4KHPJ 4NRUA 2RJZA 4EEYA 4QYZK 1X0FA 1M90T 2XWXA 5LMNJ 2F1FA 3QAUA 1RYRA 2AU0A 3BZQA 3MECA 2VQEF 4GO5X 1RACB 1EQMA 1FNOA 3HPOA 1UVKA 4ELUA 2KVIA 1VQNS 3M9MB 4Y2CA 3RBXA 3JYTA 2N7CA 3AAWB 5HMXA 4PWUA 2PT0A 4FBUA 4DF4A 3KKFA 4CO3A 2VFTA 2UV8G 3KJVB 2WVCA 2V2KA 1U1RA 3BN4A 2CQ0A 4A8XA 1OMSA 2QGFB 4QWEA 3C19A 4X64F 3FVYA 2C22A 2MTLA 1RU2A 3PO5A 1G2EA 4DPXA 4OI2A 1VQYA 1XNQF 1K9MT 1XIQA 4JOUA 4A47A 1WOOA 5L1IA 1KTVA 2LU2A 2LFVA 2B7CB 4B9SA 5I4MA 1RT6A 4MKBA 4ED6A 4JI1F 1N56A 3QYYA 4Q0BB 5KFOA 1NBEB 3AODA 1BC6A 5KOWA 1WF2A 3GIJA 3D6HB 4MJKA 3FCHA 1WG5A 5C2GA 3V4IB 2W8KA 3KOAA 5J1EB 2W9CA 1T95A 3R2DJ 5AXNA 4LF5F 1HBNB 3P45B 5HJXA 4OX9F 4LJMA 3CCES 2DJWA 4LF4J 1BQMB 4FS2A 2YNIB 1DRZA 4RW7B 4TXSA 1S6PB 1RWPB 1IR0A 2K06A 4ZJLA 4CH7A 3EICA 5KT5A 2OO4A 2J0WA 4ERDA 2L9DA 2NSBA 3PJWA 2LEBA 4O3NA 2LCWA 4ED8A 3VAMA 2RRBA 3M6VA 4X66J 1NXIA 1LXJA 3DI6A 1BQNA 2EFVA 1NHUA 1JLBB 1DAXA 2IVMA 5HL7Q 3AA9A 2V2QA 2VPXB 3TAMB 5BR8J 1U09A 4ZVOB 3VGSA 5L1JA 1D9AA 4A8WA 2DNRA 1RA6A 1EARA 2GMLA 3PACA 4JI2F 4EBDA 1C0TB 3BBBA 1GX5A 3SMZA 1S57A 3GG1A 1AB8A 5J2PB 3D1QA 2XMJA 1VI7A 9ATCB 2AEMA 3AY0A 4HACB 4Q8FA 3I5AA 4K4UA 3MEDB 5ETNA 2QTWA 4BWMA 3QSIA 1Q16B 2KRRA 2VONA 2CWXA 5E41A 3DRYA 4DCJB 4KGXB 4OYPA 4MYUA 4O44A 1F5CA 1RT2A 3W5YA 1HBOA 3FQLA 1JKHA 1TL7A 4ZP8A 2FVQA 1TFYA 2HHSA 4TY8A 4ED5A 4HHUA 3UR3C 1HPZA 2CVEA 2OHDA 2VG6B 4USHA 2XS5A 4I67A 1JXLA 3CD6S 1XQIA 4IUFA 2F9DA 5ETQA 4Y00A 2NXJA 5HO4A 5HROA 3G8SA 3TYTA 1QUVA 2BXJA 4HDHA 3JYTB 2RILA 1SI9A 5U47A 1QVGR 5M2RA 3EMTA 3PHEA 1FERA 1VRTA 4DR5J 2XLKA 4ZA1A 1REVA 2VG5B 2R7OA 2E9RX 2KH9A 3W2WA 3AD8C 1WD6A 3G82A 1JJ4A 1UL3A 5DS7A 2A0FB 3VZIA 2DB1A 1SIZA 3ZZOA 1RTJB 4WFZA 2GX8A 4OL8A 2BE2A 3KDOA 4CNZA 1RT6B 4KBIA 2DCLA 3R1HA 3DOMA 3BSCA 1CQNA 3CJ2A 1GMWA 4Y0FA 1X60A 4HT7A 3EXYA 3DRSB 1FTCA 5KFBA 4GMKA 3PYDA 1Q95G 3FZ2A 4X4TA 3PRDA 4IKAA 1NH8A 3VGUA 4DV3F 3MR5A 3DNCA 3PM9A 2NXEA 4C8KA 4EI2A 1RQ0A 1YG0A 4B9NA 1AUSL 2JH3A 1TP7A 2MKYA 2VD3A 2JC0A 4RZRA 2L41A 4RBTA 5J2QA 3M32A 3MHYA 4ENOA 5K5MA 1T03B 2XC9A 1R8HA 2AYBA 1JLEB 2DPIA 1SL2A 1BQNB 4LUBA 2J9DE 1UVNA 3CD0A 4AT1B 3CDAA 4LFCF 2AYGA 4DX5A 1IWGA 3JTPA 2DRBA 3BGFA 3V6DA 5KFFA 4JI7J 2N7YA 5C5JA 2SXLA 3HVAA 1WUUA 1CULB 3MM8A 5HATA 3OTBA 2VQEJ 1SQEA 3KUEA 3MCMA 2YNGB 1VLOA 4LF7F 1OY6A 1VC5A 3W2VB 4WIIA 2H48B 1HMVB 2NPIA 1FWKA 1LWEA 3UDVA 1F5AA 3M8PB 1S99A 4P2XA 4E98A 3HVWA 2HHTA 3QT5A 3BSNA 3CJ8A 1HBOB 1Y00A 3P3DA 5HMWA 5GMKa 2ROPA 2DR7A 3CEDA 1HPZB 1FJEB 1C1BA 4PG7A 1JX4A 3N4WA 1LW0A 2FVRA 1RWOB 2LU1A 4DV1F 2XHWA 4ES3A 5B7WA 1UW9A 2QX0A 4KHMA 2KU7A 3TOQA 5HROB 4J9MA 1H2TZ 2ATLA 2XS7A 1HNVB 4JI1J 4PRFA 2DT9A 5D15A 2HW3A 3HLUA 2Z57B 4OZNA 4V19J 4FN5A 2VDIA 2HBYB 2GV1A 4DL7A 2BYCA 1REVB 3KLGB 1VBXA 1BLUA 3ETOA 5K8MA 2XYHB 3K5PA 3JSMB 2KXNB 4LF5J 1FRIA 4EGLA 2BE2B 4OX9J 2XTJP 2QC3A 4U67Q 3X1LB 2LEPA 5KFUA 1FWLA 3DN9A 3H7HB 2QIFA 1RT5A 3ILJA 3CGIA 4ELTA 4OI1A 2EFNA 4RR5A 3K8VA 1VQ5S 2XULA 1QUPA 2G13A 2ZC4A 1VRQC 2GMJA 5GAEU 4M5JA 1DLOA 1Q8IA 5A8RA 3RUBL 4WFBQ 3L7UA 3TJ9A 1VJQA 1FVSA 2MHEA 4OZ2A 4RWXA 3KLVA 2CDRB 3Q23A 4QW8A 4WZQA 4LIWA 4LSZB 2GAHC 5LL6d 2UXDF 2UZAA 3KG0A 4ELVA 3C15A 4C0OC 4DV6F 5J2QB 5LSLA 2X1AA 4FS1A 1WHYA 3TUIC 4CCHA 4WKRA 2PFFB 3QIPA 4DL5A 1UFKA 5DGBA 2YTCA 2LQBA 1K1SA 5GADI 2V9WA 4RUAA 4CLYA 1U1PA 2HS4A 4URSA 2ASJA 2AGQA 1AW0A 3TZZA 2XM3A 3R5JB 3NNCA 3MAQA 1XC9A 4Q43A 1Y5IB 5I3UA 2VJUA 2KM8B 1UMJA 1UFWA 1NSAA 4F26A 1JJCB 3OD2A 4ZVQB 3M9NB 5HP1B 3QFHA 3K17A 4HT5A 2DNOA 5CH7B 3LGNA 5HANA 4C7QA 1NK6A 1RT4A 2DIUA 4YN3B 5B0AA 3R7SB 4EYIB 4OJGA 4TU8A 4CWBA 5HBMA 1I51B 1FRMA 3D0HE 5CAAA 4ID5B 4BBYA 3HVRA 1Q53A 2QMXA 3PKMA 4DFPA 2FC9A 4NXNJ 3J7AN 4C8MA 1OPZA 2V69A 3BH6B 1KN6A 3ILOA 3I82A 2BKPA 4ETZA 2A2DA 3ILLA 3A4TA 1IQTA 2ZNYA 3IO1A 1UP1A 2HBRB 4C48A 4M94A 4PEOA 2ZC3A 2FJAB 2AJ2A 3GB0A 3W9JA 5T7LA 2ZBRA 2W4DA 2FYXA 3IBCB 3ZZPA 3DLKA 1SBRA 4TU7A 1HI0P 4DSJA 2ZFHA 3RYLA 1JB0C 3JSRA 2H4YB 2QFJA 4NL5A 3VAIA 5L46A 1R0AB 2B8PA 1Q8BA 5KFWA 3KHGA 4NLXA 2VOPA 2ILZA 4PQAA 2IFXA 4DBQA 4ILLA 4C6AA 1WC1A 4ANCA 4QWCA 4ZCMA 4A8YA 5GAHI 5EWEA 3V81B 1UZHA 4RL1A 5HVGA 2HRUA 3KG4A 5E33A 1HNZJ 1WTFA 4URQU 2CUYA 2N3LA 1O51A 3BYRA 1RT5B 1PAEX 1FD2A 2I1RA 2UUAJ 1LV5A 3MOZA 2IIHA 3BKTA 1HBMB 1XWLA 1NZAA 1ZAWA 4KRWA 1QSLA 3D1HA 1LWCB 5KFNA 2F63A 1TZ0A 2R2TA 3PYEA 4K59A 3RBZA 4AFFA 2U1AA 4OV6A 3EZOA 1DLOB 5A8RB 3IA0A 1T3NA 3CDUA 2QE5A 3B8HA 4U8YA 4B3MF 5F3ZA 3EGZA 3PJ9A 4LFCJ 1NCLA 4QIWD 1SB6A 2XZWA 2G9OA 4YDXA 2E1AA 3HSJA 2A18A 3BREA 5L8RC 3ENVA 2LECA 4YHHF 2MMYA 1DQ9A 2P2CB 2ZOGA 3HFZB 3QGIA 1VQOS 1NPRA 2OEMA 5ADZA 1FDNA 2NZ4A 1JNZB 4QPTA 2IJNA 1BWEA 4ZP6A 2ROGA 2WAQD 2W7AA 4GVBA 4ZPTR 3RRHA 4WKYA 4ANDA 5B0BA 4B3OB 4DXLA 2VL1A 4PXDA 3ZTQA 2W7PA 1VIOA 2ZH7A 3J80Y 2HAIA 2WHOA 4DV1J 1SJ3P 1SVDA 1LXNA 1WHWA 4UOGA 3LP1A 1CJTA 1MMLA 1FT8A 4BHQA 1B0PA 1S1XB 1I94J 2MZJA 3SQGA 3RB6A 1HLWA 2I6WA 2RAQA 3MEKA 5IC4B 3I55S 4QIFA 4F7VA 3EWGA 1B64A 1IBLF 4ECTA 3PDNA 4DR6F 4X2BA 4DR1F 3EDQB 2NREA 1H7XA 2FJDB 2J7KA 1CSJA 5AJ3F 1QTNB 1SH0A 4QW9A 5T7LB 3MEGA 3SQOP 1VRUA 3OUYB 1U7LA 1T05B 2L9WA 3GFYA 3MMAA 4NLVA 4USJC 1N5YB 3BR8A 4ZPDA 3KK1A 3UDEA 1T9TA 1CC8A 1UA0A 1KQKA 1IKXA 3OSPA 2LA4A 2H1YA 2AQ4A 1S59A 5KFXA 2RQKA 3HHLD 4GC7A 2JC1A 1QM9A 4HI2A 2E7XA 2HMIB 4WZMA 1NB2A 3TP2A 4ED3A 4WTYA 2EFGA 1JJHA 2RSQA 2UXDJ 5CCLA 1G4CA 5KT7A 1ITPA 3UDCA 3TRGA 4RW6A 4HHHA 4JI6F 2ASYA 2VG7B 1C4CA 3PX6A 2DGXA 1KLMA 3BB5A 1WC6A 2E1CA 3OJUA 1HHSA 4QR2A 3FRZA 4I64A 1U6ZA 3KLIA 3N79A 1FCAA 1ICEB 2F40A 3OHAA 3UNGC 1E6YB 2VU5A 2FHJD 3MM5B 4R25A 2DXEA 2KT2A 2FGOA 5BJRA 2WVBA 3LGMA 4R8UB 3DRXA 1G1XA 1XNRF 4P6QA 3BV8A 1P6TA 2AF6A 3IC1A 1U02A 1GFWB 2IRXA 4LBIA 4YY3F 2FTRA 1KP6A 2PMHA 4OI4A 2D1CA 2DHHA 3HFVA 3CCLS 3PO4A 2MXYA 4GVBB 3AJ2A 5B0EA 2LQ5A 1LEOA 3MOJB 1WELA 3THVA 2DR8A 3IRXA 1FRKA 4FP9A 3QWUA 4GO7X 4K4WA 4K4TA 3FDSA 3EGVA 1Q79A 2DHXA 4DG1A 2GHPA 3PVXA 3AXMA 3CCRS 2CQCA 1N6QB 2KTQA 5EDWA 2HGLA 3LP1B 1Q8LA 1WI8A 5KT2A 3KK2A 3BH7B 4NASA 3SQGB 4ICLA 2DHAA 4KY3A 4C8OA 3GR0A 4I68A 4ZCKA 2BOAA 2QZ8A 2UUTA 1TKZA 2ATCB 1P1LA 1YRTA 1RE1B 1KHWA 2XO6A 5I3QA 4X4UA 2E5GA 2RS8A 1CLFA 1FDBA 5AXMA 1J27A 3DLEA 1S9EA 1UEVA 4NLSA 3KLHA 4ZVUB 1FKPA 3J81Y 1A0OB 3NP5A 1NAQA 4CM0A 3KK1B 3PHTA 1IKWB 3RR7A 3HX9A 3JXOA 3OFHA 2FJEB 1NDKA 2F4VF 5G0RA 4B17A 3W62A 3DU5A 2EBEA 4PPZA 4F4WA 1RHQB 1WC3A 4B3MJ 5MAOA 3IMQJ 2RQMA 3SSRA 4HLBA 2CJQA 3JAMU 3FMBA 3Q8VA 2VQFF 3M8RA 3C46A 2G1HA 2XEXA 2E5JA 3LF0A 3CMQA 4QWAA 4YHHJ 2E1PA 3D67A 4PXCA 1W2BR 3Q8SB 3W66A 2RF2A 3VCDA 2BZ2A 3GYXB 4DL3A 1FDDA 4OYXA 5DG8A 5MLCV 2VBYA 2H3EB 5KFIA 4CNYA 4LT6A 1IJEB 7FD1A 4RX6A 3MCNA 2CPHA 3SZ2A 4C8YA 1UKUA 1UVIA 2LQJA 3SI8A 4Q2LA 2V8PA 1CS4A 5LT5A 2ABYA 3OTCA 2B6AA 3I0RB 3I9ZA 2ZJRQ 4I7FA 2MSTA 3ADAC 1RSCA 2D3UA 1T0TV 3BM7A 1GMVA 3HO1A 4QCLA 4FNHA 4P2FA 2K1RA 5AT1B 3V6KA 3CC7S 2YXLA 4LBHA 1C2PA 1S1TB 2AZ1A 4ZVFA 4WXWA 3AFGA 2WVEA 3NS6A 3V6HA 4IOAQ 1JXVA 3BGOP 3HSGA 4RO0A 4MIAA 1YJWS 3GP9A 1GQEA 1IBLJ 5D4LA 4OYOA 4DR1J 5C42B 3BR9A 3VQTA 4RUCA 4ES1A 1XMQJ 1ULRA 2YPYA 5AJ3J 4UUWA 1KQSR 3CPWR 3DOLA 1KOOA 3ZZZA 3MURP 1ZZFA 1LWFA 3I4HX 3OT9A 1CJKB 3HULA 4DF8A 3F73A 5GVQA 4R5PA 1NSPA 2PFDA 4P71A 2XHCA 5LXYA 3NOGA 2P6TA 2ZVIA 3UPFA 3S7RA 2E7WA 3ZTOA 2W2PP 4QYZJ 2XYPB 2AGOA 2FHMA 3MD1A 2V67A 2J76E 1LW2A 5J2MA 4F2RA 4UT4A 1NK4A 3OFGA 2A1BA 4K50A 2CNLB 1ELOA 3OR2A 1GMWD 5J2NA 2KYZA 4PPDA 3R5DA 4DL2A 4DOZA 3DLEB 5KOXA 4NYPA 3TAQA 4M63A 1N54B 1T9YA 4N8OA 2FHOB 2XLJA 1RXOB 1HIYA 3G96A 2EC0A 4WCEQ 4CTAA 3CJ3A 3OSNA 2XI2A 3K57A 1RWNB 4V1Ak 4ECWA 5HVFA 3QT8A 5CXTA 4LRFA 5DQIA 4YB6A 3DYAA 4DFJA 1KD1T 5HSPA 2MJUA 1ZBTA 3C6UA 3NWGA 2A6MA 4OV1A 2Q43A 5A8WA 3M6XA 4JV2A 2EKYA 1VQ4S 1XNRJ 4DS4A 1H73A 5E3CA 1D0EA 1FHTA 1RI7A 2IAJA 2RF2B 2NQPA 3EZUA 3MWBA 4YY3J 4L73A 2FQQB 3UE2A 3H0PA 2Z4PA 4OYMA 5F9NA 2IC3B 4AUKA 4IR9A 2OGUA 5A6PA 4ZHRA 1YX2A 2HPUA 4ZN1A 3M9OB 2ZH9A 4CO4A 5F8NA 1SJRA 4PG6A 2V0NA 1YHQS 1QJHA 1WF0A 1UFLA 2HAFA 2J6SA 3A8JA 2A10A 1FJCA 2YWKA 3PEHA 4I7FB 1N33F 3SEOA 1RLDA 1TUWA 2VH7A 2DNYA 4X4NA 2K1RB 2RDDA 3WHIA 3DRRA 1WNEA 3G6XA 2ZEJA 2GA7A 2DO4A 2MLZA 3MMBB 2X1GA 4FBTA 4FF4A 2JVRA 5B0DA 1U26A 1GXTA 3KK3A 2R7RA 4K4XA 2GJIA 3DLJA 1TAQA 3H98A 1NMEB 5FLXU 3CXCR 3ITHA 3LALA 3W7BA 1JNRB 1DTQB 4ECSA 1RABB 2RKIB 3NNHA 4NXMJ 3GU0A 1ROFA 2PI5A 3AB2B 3B54A 4R5PB 1MU2B 1S1UB 4ED2A 4PXBA 1M5OC 1KWMA 3CIZA 3H20A 4M5GA 3NGDA 4XTTA 5F8JA 1FE0A 2V8DA 5K8PA 4USIA 1NLKL 1YJRA 1LW2B 1NH7A 3CSKA 3QBCA 1HYSB 4LBPA 4GKJF 3OR2B 2MZRA 4YUDA 1RT7B 2GQQA 3B78A 2VQFJ 4OFZA 3MD3A 4OJHA 1PJ5A 2D3O1 3WDOA 3W3SA 5A0YA 2GJ2A 2Z8QA 2ZBIA 4MT1A 2C2ZB 1EZZB 3L7PA 1FA0A 1A7GE 5B0CA 4FF3A 3DC2A 2QL7B 3BSAA 4I2QA 4IOBA 1C1CB 4G1PA 2DITA 4JYAJ 2CZ4A 1AT1B 2EBGA 2YWHA 4WPAA 2PI4A 5IOLA 3DYAB 1RT1A 1SC4B 5KG1A 2KFNA 3D0IE 2KKHA 1V3RA 3C6UB 2YPZA 3H90A 2C3PA 3P6YC 1AXQA 1S12A 4I6YA 5A8WB 3JSBA 3C6TA 2DIVA 4RNOA 4IG0B 1WSRA 4OZJA 4M5NA 3RJMB 1DQAA 2C3MA 2IAJB 3VQSA 4CLWA 2EI5A 1FK9B 3OVBA 4WTOB 3EPIA 2FVSA 3ZZ0A 3EVWA 3JTNA 2EPIA 4Q7AA 2QA4S 1HD0A 2XQCA 4C3LA 2YQ3A 1FFWB 3KHHA 4NLWA 2HEKA 4X4RA 4E8UA 2NUHA 3M6UA 4DCOB 4CLPA 4MMOA 2BE7D 4DSLA 1WG4A 4OHVA 1BGXT 3C16A 3NWRA 1KFSA 1S48A 1Q86T 4OYZA 1PJ7A 4WBFA 1WJ9A 2E9ZA 4L74A 2OH2A 4NMLA 3NBPA 3PYFA 2V4JB 2YH0A 4DR3J 3FC9A 2EKNA 2OFGX 4DX7A 5F8LA 3HT0A 2C3UA 3E01A 4FF1A 1HWJA 4F8RA 2HVDA 3MCSA 3H5XA 1EIYB 2MY8A 2MKKA 4EFAC 1DBDA 2MSSA 2Q6BA 3S6EA 1IXKA 3OBIA 4N5SA 4DU8A 1NDCA 2CXEA 1WEYA 4PZVA 4FYWB 1I5OB 3U27A 4F0MA 2DBBA 4KFBA 5CYQA 2ZDPA 2YNFA 1TK8A 2YQ1A 3OXFA 2OD4A 3ZTRA 4K4YA 1FX4A 2ZDOA 2XLIA 3A1YG 4EZ9A 4IH6A 2ZH8A 4NPOA 2ZBCA 1YQHA 2GC8A 2HK3A 5DGAA 2ERRA 2MLXA 4RU2A 2D69A 3N28A 1TKDA 1FFGB 1JLQA 4K4ZA 2UU9J 5FDLA 4LR8A 2QL9B 2XZDB 3J7A1 4OZ5A 5DQGA 1ZPWX 5B0GA 5GAGU 3BGLA 1NO8A 1KNZA 3K7RA 1HWIA 2ALYB 3M2VA 3DMJA 1V3SA 4Y34A 2HLTA 2X51A 5F8HA 3FSIA 4QR0A 2PN6A 4RW9B 4P72A 3MEEB 3Q0AA 5D4PA 3LWLA 1ZETA 3WIVA 2BQRA 3DGVA 4DV2F 2JX2A 2XZTB 1QVFR 2CG8A 3CDWA 3GV7B 1MWYA 2XY5A 1Y0HA 1X4BA 1CPZA 2VODA 1WHVA 2MQMA 4ECUA 1U6BA 4K2JA 2B8QA 2YKNA 1Y3JA 2RDIA 3OFEA 5HMYA 4C11A 4YMEA 3M2UA 4NI2A 2VBWA 1UETA 4NYZA 3IG1A 5DO2A 1FFSB 1RCXB 4P7TA 5D4NA 5BXIA 2G0JA 3T1HF 1QE1A 1N33J 1PBUA 4ES2A 2GMHA 4A8KA 1KBRA 2PSZA 3QMQA 1J5EF 3S01A 4TKTA 3R7BB 3E8OA 2RT3A 2HNZB 3GJQB 2V6AA 3EE3A 2MGZB 2LKZA 3P5TL 5K8NA 5DJBA 3H25A 3A8IA 3FFIA 2R7SA 2R8GA 1ZM9A 1YBTA 1MNEA 3CULA 4ITSA 3KUHA 2XI3A 2NYHA 3VF0B 1SL0A 2YVSA 1S49A 3V5RA 2V50A 3L95X 4NA2A 3Q24A 2I5JA 3CWJA 3LTOA 3NBPB 5A6WA 3DDNA 3MAAA 4KO0B 4FYXB 3C2PA 4J9PA 1Q82T 1B0VA 3E01B 2IM1A 2CPFA 2ALZA 1TL3B 3I0SA 1JLFB 4ETXA 1F3VA 2R7WA 4ZDNA 2YWGA 2QYCA 1U24A 2KB2A 1SH3A 3CCMS 4JI3F 5K14B 2MB0B 1H3DA 1WKLA 1R43A 4K5RA 5CYQB 2BABA 2YNFB 1XMOJ 4DN0A 3IBWA 2I9SA 4X4SA 2DEIA 2W8LA 3RR8A 3I6PA 4RWWA 4DLGA 2DNMA 5BYRA 4O4GA 2AYEA 4JV0A 5A8KA 3CC4S 2PO4A 1YLXA 1FKAF 4RNHA 3Q89A 4QWDA 5L9NA 1SV5A 2XS2A 3VR1A 3D5MA 1T8EA 2L9NA 4JI8F 3AH6A 3JSYA 5LM7E 4DEZA 1QDUB 1NZ8A 2DH9A 1RWKB 4LSLA 3FKBA 3IWNC 4UY85 2GGPA 3GYNA 1WC4A 4OJ3A 4KGVB 1V5VA 3NKYA 4U96A 5HMZA 2BJ1A 2QSFA 5B09A 1UAWA 2DGWA 1GX6A 2GNKA 1WWHA 3AD7C 3SFUA 1TVRA 1WTBA 3QRPA 3M7VA 3PW5A 1RB0A 5THWA 3H42A 1BHNA 1OSDA 1PGZA 2P9GA 1IJFB 5KTQA 3MM7B 2MQLA 1WEXA 4N7TA 4RU9A 3BKUA 2AP6A 4C11B 4LRDA 3D0GE 2R8IA 3SV3A 2LLZA 2F8EX 2UUBF 1SC1B 3IG1B 2BW7A 2Y3YA 4P7VA 4EMDA 3K5LA 3ISNC 4ILMA 1Y10A 1TQLA 2F9JA 3HM9A 1PSDA 5IC6B 2KM8C 2W9BB 4KGMA 4QWBA 3CDEA 1D3WA 1QSSA 1L3KA 3EM1A 4KC5A 3FFIB 1R7IA 4IH7A 2R7TA 4HL9A 4KB7A 3AJ1A 2FY1A 4C0BA 3DGPA 1QTMA 2RQ4A 2B9YA 2OPSA 2UUWA 4F4XA 1R31A 2VPWB 3KLEA 2HRYA 1WOPA 1HI1A 3MAAB 3M8ZA 4YDDB 4XPEA 2N4CA 5C25A 3LPYA 3IWXA 4ZN3A 3PX0A 4NLGA 4N77A 4NLYA 4MKAA 1XR7A 4G3IA 1ZM3A 2JOQA 2FDNA 3BBFA 1H2UX 1TKXB 3KNGA 1NJZA 1GT8A 1X5SA 1VQPS 3HHEA 1GMUA 3RAMA 3FZBA 1Q8KA 2BX6A 4L6V3 4ZVGA 1HWUA 1NK9A 1JK9B 3VHQA 4O4GB 1H72C 2ZKTA 3GTYX 1H74A 4ED0A 2CA9A 3A3NB 3K58A 2YBVA 3EGWB 5IV3A 3U1MA 4ED7A 3KHRA 3GONA 4DV2J 1X4EA 2M5YA 3KXDA 3MFHA 4CLFA 3UW1A 3D6FB 3JQKA 3OL8A 5KG7A 3ENQA 4J9NA 3KJVA 3CMAS 4R0JA 1NKCA 1QAXA 4KE5A 2OLWA 4X62J 1OSCA 1SL1A 2AEFA 2DXDA 2ADBA 2B3TB 3UN3A 2BJ9A 5CYJA 3H4BA 4QIGA 3T1HJ 1VISA 3FQKA 4ILRA 4NZ0A 3SDEB 4TNOA 2BJ7A 1EX8A 1LWXA 2CNNB 1J5EJ 2LP4A 4Q0BA 4XO0A 4K7QA 2ZM6F 1L3SA 3NGRA 2FJXA 4NLOA 5DDQC 2HG4A 5GMEA 3V4IA 4B3RF 1UWAA 5J1EA 1JQGA 2YWEA 4IRKA 3W60A 1URRA 3P5BP 5KG5A 3QJPA 2B56A 2D7SA 2GJFA 2YNIA 2MZSA 2VZ9A 4CZCA 3NY0A 4DI6A 1OJ4A 3Q8RB 2RU9A 2M8DB 3PZPA 1VQSA 1B7FA 3G6ES 2MQQA 2RQCA 4ZJOA 4AE5A 1I6JA 2IDEA 2FVPA 2R9LA 2R7UA 2QFIA 5KFRA 2UUCF 3EXCX 1AUDA 5KFAA 3VAKA 3K59A 4DSEA 3E51A 1PG5B 1XN9A 3DGPB 4DPUA 1GK8A 3UCGA 4JI3J 4EZ6A 3TAMA 1IKVB 2KG1A 2COLA 3KLEB 2Z2MA 2MQ8A 1ZZNA 2IVFB 1Y5LB 3MTJA 2ZE2B 4DS5A 2CPYA 2GZOA 3FEZA 2VBZA 5C25B 1DJ0A 4MTPA 2HZAA 5J2PA 3R5BA 2V9KA 5SUHA 4HACA 3V6JA 2OPPA 4DCPB 3CNQP 5EHHA 5DLGA 1H98A 4NCGB 1RADB 2OTJS 2HK2A 5E5NA 1DTTB 3IM8A 4USKA 2JFDA 3J7YU 1X9MA 1RTHB 2CVIA 1YZ7A 3MF5A 4C97A 3UDLA 4JI7F 2BW2A 2G0CA 5IT4A 3CJQA 2VG6A 4IQMA 1YGYA 1TL1B 3N6MA 2GHWA 2KL8A 3MXHP 3TUJC 2X1BA 3LW5C 1VCTA 3Q8PB 2MKJA 1O0PA 3VGTA 4XAKA 2YKMA 3OTEA 2DISA 5KFHA 3HFKA 4X84A 3QO9A 1TMJA 3BGRA 4ID8A 4ZLJA 5JMNA 3IBFB 5KG2A 2UUBJ 4ED1A 3T5HA 4N76A 2VG5A 1UW4A 3PTWA 4A8OA 1N34F 4QR1A 3DCAA 3GE9A 2HWIA 4LF6J 1RTJA 4L3NA 4YB5A 3EDRB 1K73T 5F0UA 2F8MA 2IM0A 2AJQA 4U8VA 2FJWA 1TKTA 4HTJA 1D8YA 3DKDA 2MKIA 4PYAA 3PR5B 1TUVA 2HYIB 4N41A 4USUA 2LDIA 3DRSA 3BKFA 2CAJA 2V63A 2QA2A 2OIHA 2EEYA 4RW4B 5A76A 2OJ3A 2IYIA 1SJQA 2DY9A 1RHKB 2PC6A 4B9UA 4FYDA 1B4SA 1FJ7A 1SC6A 3D1OA 3UR0A 2V5HG 1SIWB 2C28A 1HNIA 4LQ9A 2QLWA 2UVRA 3PG9A 5KG3A 2JDJA 1Q4RA 1U2FA 4EBEA 4OZ0A 3N0VA 1T03A 2WRMA 4DZDA 4J9RA 3CJ4A 4UZBA 1JLEA 5JVGQ 1RLCL 2QA1A 1S6OA 4X4OA 4G1QB 5DM7Q 2GO9A 4DUTA 2LDYA 5J1PA 4DL0C 1NK7A 1SJ1A 2HNYA 1XMBA 2AWZA 2CJXB 3BO4A 3DRPA 3GMGA 4H4OA 4TN2A 5DG7A 1PC5A 3NCRA 2XMKA 4IFVA 4KKOB 4RNNA 1CULA 1T9WA 1JXEA 2AGPA 3R1LA 4MKVA 2YNGA 2IJFA 4DV4F 2OPPB 3WZ0A 2Y8WA 3TI0A 4DV5F 2WBMA 2Y9HA 3H40A 3W2VA 2OEKA 2XY7A 1HMVA 3AQPA 2Z2YB 1U6FA 2EK1A 4CIOA 3EJMA 3W64A 3M8PA 1ZOTA 4JUZA 2HFUA 4XDCA 4U9RA 2ZJQQ 1LFWA 1YWXA 1U4BA 3J80U 1VQKS 3THPA 4WK1A 4FDFA 2IBKA 3W9HA 4NLPA 3Q83A 3T1YF 5HAOA 3FMWA 1HNVA 3UO0A 5CQGA 2C2DA 4DQSA 2YKMB 4NXNF 2Y0BB 2ZM6J 3OPKA 3RB3A 5K8OA 4CLUA 3QO9B 4MH8A 1VC6A 2CG4A 2ZOFA 1H6KX 3BGRB 1QD1A 2G4BA 2RUSA 3BO3A 2RRAA 5L1LA 2IMWP 4B3RJ 2MQOA 3UN2A 3KLGA 3P8BB 1RBAA 2BQUA 2X3GA 2EC2A 2Z0GA 3JSMA 3LP2B 2BDPA 4KPCA 3TAPA 1NRKA 2QL5B 5KFPA 5CHCB 2XWYA 1L3TA 1SQFA 3NAHA 4C3MA 1YJVA 1GAOA 2IY5B 1TKTB 4DR4F 3OTOF 4B9VA 3KJQB 1RT3B 1WEZA 3KWMA 3CJ0A 2J0QD 2MKHA 3HCXA 4U95A 4EK2A 4N8NA 3PFEA 4DWIA 4ZPCA 4H4KA 2UUCJ 3PRVA 2MDAA 3MGJA 3OL7A 3M6WA 2Q1LA 2LMIA 4O3OA 2NCKL 4USWA 2E7VA 4Q5VA 2QG9B 3DFEA 1HNZF 5HJYA 2EVZA 2OPQB 1UVLA 1HNIB 3HF5A 2HLUA 2UUAF 1YZ6A 2WOMB 1PKUA 2PIIA 2DD8S 4CQ1A 1UWBA 4ZVHA 2DGSA 1B7YB 2V2ZA 1NK5A 3AD9C 3NGTA 1JMTA 4I56A 4UQTA 3HJFA 4ZJQA 5KFTA 4OHZA 3MPUB 3G6YA 2HNYB 2ZZTA 4C4WA 1S6QA 5IWAF 4Z7YA 3ZTPA 1Y11A 1CC7A 3DRPB 2V68A 4H4OB 1N4LA 3PY8A 2W01A 3D28A 4ECZA 5HP1A 4LR7A 2FIUA 2QRRA 2HIYA 2WW4A 2U2FA 4IFVB 3MMCA 3GILA 1APSA 1HW9A 1X0PA 4EYHB 2XCPA 2YNHB 2CNKB 2WB4A 4X4VA 2XB2D 2GQCA 1SKWA 2H5EA 2P6SA 1NKEA 4ID5A 5L1KA 4CO2A 2BOPA 1NK0A 1YJUA 3B4DA 2R2SA 2KFYA 1MSWD 1YBUA 1P9YA 3QRQA 5KAKA 1S72S 3PW4A 1VBKA 4USMA 1ZTWA 2R2RA 1HNWF 2B0GA 4G1IA 1B0TA 4J9KA 1RAGB 1WG1A 3OLAA 1VFJA 2BJEA 3PRBA 4H54A 2RH3A 1WOSA 3ETMA 5E3QA 3VWSA 2CQGA 1N34J 4DPYA 4UZCA 5IFMA 5EN1A 1RAHB 3ILIA 5KT6A 1TU0B 2Y1LB 4K2XA 3CUNA 2EFPA 4JI5J 3CJTA 3RAQA 4J90A 4WP9A 3RB4A 1I94F 3V4MA 2M3DA 2RIJA 2OKQA 1IKYB 1X9WA 1R0AA 1RAOA 4NLRA 3Q8QB 3UVJB 5AE2A 2E5LF 2JEFA 2CPJA 4TYAA 4D3GA 2LQ8A 3Q22A 2JEJA 3V81A 2CQ3A 4DLEA 7FDRA 3HKWA 4PKDB 2B51A 4IQXA 1OS5A 3J81U 4ZCLA 3U1NA 1OY9A 2WCXA 3QGPA 3D6TB 3CDBA 5B08A 1VHIA 2Q79A 2XNRA 4FPIA 2ZH1A 1UVJA 5IQ6A 1HBMA 3PW7A 5L9XA 3PYGA 2D41A 4A4JA 2HURA 1LWCA 2MPUA 2ZZMA 3Q2TC 1V5IB 3GCXP 3TUPA 3BO2A 4PR6A 3RZAA 3NLCA 2E9TA 3M4XA 3J7Z5 1B99A 2RHQB 1VK3A 3NGKA 4N56A 3HSDA 2VF3A 1XBWA 4WYLA 3TUZC 2YWWA 5D0HA 3F0NA 2RHSB 3VGVA 4Y65A 1OYDA 4JBCA 2R7QA 4TVAB 2KHCA 3TNVA 1UWBB 3HHKA 1EAYC 3TARA 6FD1A 1NDLA 4DV4J 5HQMA 5G4DA 4BWJA 2HVIA 1F3FA 2ADCA 1RK8A 4M1KA 4DV5J 2R8KA 2MLYA 1M5KC 1FX2A 2I2YA 4GC6A 1V6HA 3KFWX 3R6LB 1OQ6A 2QJ3A 3RBDA 2WK4A 3F41A 1S6QB 3GG0A 3TWZA 3OXGA 4CH1A 3ET6B 4B3OA 3MMCB 3M05A 1AROP 5CZVA 1S9GB 2J9CA 4C0HA 2V8GA 2XNQA 1D9FA 1HWLA 2ZHBA 5KFEA 4ECVA 3JB9k 4I69A 4A48A 4DQPA 2VV5A 3T1YJ 1U48A 2V34A 3N5FA 1TK5A 2DNHA 3HK2A 1PJ6A 2LEAA 4X4QA 1F0XA 1S1XA 1S5ZA 4LMZA 3M8QB 1NSKL 3BGUA 4DV7F 4D3HA 2WONA 2HZCA 3FCVA 2DHGA 1BQXA 2NS1B 1WKJA 1UEKA 2VPYB 1YTYA 4OHXA 2YX4A 1RZMA 2KI2A 1EB0A 2D3ZA 2LA6A 3CJRA 3B82A 2NUUG 2G2ZA 4PABA 1JLGB 3L4BC 3GZ7A 3OUYA 4IO9Q 1T05A 2EW9A 4DR4J 1U0HB 3OTOJ 2HGNA 1N5YA 2DGOA 2LYVA 4FKYA 1D9DA 2HHPA 1OPIA 2PEHA 2CJ9A 2HVEA 3IFEA 1LKZA 3ZXWA 2VBXA 5KFYA 5D0RA 2MZ1A 4UUXA 2WSCC 3CCUS 3BJYA 2HHVA 4XDDA 2OPRA 4KPYA 3HD2A 1XJWB 4KV8B 1L5UA 3T1AA 1KKHA 1SCJB 2HMIA 4OYBA 2WZ1A 2NSCA 2FPHX 2KYXA 4BCAA 1HQUB 3CCWA 3GIMA 1TL5A 5KG0A 3QZ8A 1RCOB 4LFAF 1IBMF 2KXHA 1FRJA 3NNAA 5ETLA 3JS9A 3FK4A 2R8JA 4ZVSB 1K8AT 3IRWP 1G3OA 1KSPA 5IT9Y 2VG7A 4USTA 3KMSA 8ATCB 1VHFA 2QEXS 2GIFA 3H2VE 1U1KA 4KGZB 1KVJA 2DNKA 2PGCA 4TYBA 3BS9A 1HQEB 3M1VB 2K3KA 2NLWA 3RRGA 4QYRA 2IHR1 2Z58B 1E6YA 5IWAJ 4IH5A 3MM5A 3RTVA 4WE1B 3IGNA 3QGGA 5T41A 4LF1A 1YJNS 2Z30B 4R8UA 4W90B 2OAUA 1IR1A 1UJ4A 3TQ1A 3DDKA 3VAFA 4ER8A 1RAIB 4ZP9A 1KRPA 1UPPA 2N4DA 1FXDA 2BANA 3AB4B 4CLTA 1HBUA 3SYZA 4I6WA 2AT1B 1T02A 2NPFA 1RUSA 5HVHA 4B3SF 3CC2S 4U7UD 3E2EA 4WU3A 4FYYB 1JLAB 3A3PB 2HNDB 3GYGA 4XK8C 1KVKA 4GVLA 1HNWJ 1K0TA 3R97A 1NNDA 4JV5F 2BA9A 2K3IA 2AMCB 3LO3A 3HHLA 4O4RA 3LOUA 2D3OR 1RU1A 5KFMA 4ZVEA 1N5SA 1N6QA 1BWVA 4HH0A 1VQ6S 1V3ZA 4OLPA 3PJXA 5LMUJ 4URGA 2WONB 3CCVS 2VIHA 2NYIA 3EVMA 1CEZA 1YRUA 2DPJA 5M2PA 3EYZA 4I1TA 4F67A 2E5LJ 1ZA2B 1U1MA 5KFGA 1XMQF 3EUNA 2BACA 1J2VA 2R8HA 2PMZD 3PX4A 1KHVA 2M0GB 4IO1A 1RTZA 1MWQA 2FHJA 3OJSA 3AQOA 3FEYB 3FGVA 1EQ0A 1VGYA 4F3OA 2UVWA 1IKWA 1WHXA 2CWKA 5GAHU 4M5LA 4HHJA 4RW8B 2DHSA 1GEHA 1HHQA 1EHWA 3MR3A 2E1RA 3GIKA 2OPRB 2GFFA 3UI3A 1W2IA 4M5KA 1H7WA 4DQRA 5HQLA 2MQPA 4ZOSA 1SUQB 2R4FA 1S10A 2P8IA 2YY3A 3F44A 3HHNB 4B08A 5KFCA 4OYIA 3HVTA 2E66A 2W1BA 3Q8YA 1HI8A 4O23A 2IPOB 2FLLA 1FD8A 2M70A 4J7CA 1WF1A 4RPFA 4HVZA 3DLGB 4OIXA 1Y4ZB 3WX8A 3CJ5A 3BEGB 1AZSB 3CCZA 5E3RA 4K5SA 4DV0F 3G8QA 1N5VA 3TVKA 2J7WA 3MM6A 2R42A 5SZTA 3HI9A 3C8YA 1EP4B 3UD4P 2KT5A 2GIQA 2IRUA 3G86A 5L38A 4M5DA 4EWTA 3FCWA 1NKBA 5H9FK 3ONQA 3MR6A 1PBAA 2BJDA 1S6UA 3B4MA 3LWMA 1R3NA 1VK8A 4F04B 2FZCB 2WW8A 4PYDA 1U1OA 2C2EA 5DETA 4P52A 4O3QA 3I0RA 3GR1A 4FF2A 2BANB 4F25A 2JVOA 1HBUB 1CJUA 4F3QA 2W24A 1RTIA 1JJ2R 4OI3A 2Z56B 4S0MA 4LF8F 1RYSA 1S1TA 4NYOA 4DV7J 2GHVC 1N5TA 4HEA9 2CQ2A 3E3XA 2HGMA 3NGUA 5E3PA 3UN5A 2JEGA 1N88A 3I4PA 4F02A 2CRLA 9RUBA 1R6YA 4F0HA 3KUGA 2OMLA 3HHLB 4FXWA 5C42A 5DDRC 4ZVPB 2UXCF 3IAM9 2AX1A 1KLNA 3CJKB 1HNXF 2QLXA 1JWWA 3NL0A 2DNNA 1P9QC 4NE9C 2ACYA 1CJKA 3DM2B 3K5MA 1M5VC 1S1WB 4DQQA 4NLDA 2Y8YA 2XGQA 4IDKA 4UY8T 2BVZA 4U7UK 5DDPC 3P4UB 2WSFC 4RUHA 3MR7A 2VOOA 2I38A 2DNLA 2BKNA 1M5PC 2BE9B 4KYZA 5HLFB 4CO0A 5CZXA 3F56A 1FRLA 2DY1A 4IRDA 2ZWOA 4J37A 4LSNA 4NOHA 4NXMF 1S0NA 4LFAJ 3GFHA 1IBMJ 3TJ8A 5D3GA 4IR1A 4OZLA 4LRBA 3H59A 4DX8H 3W1YC 3GFZA 1KEKA 3NG8A 4IOCQ 2WTFA 3ZZRA 4M8LA 3TJAA 4ZITA 2J6UA 3S1TA 3HJVA 3GSDA 3CCQS 2D9OA 2ASLA 2E5IA 2Y1RI 1TR0A 4B9LA 1UPMB 3GFXA 1H0HB 2OUGA 2QLFB 2X1FA 3G4SS 3CJSA 2DR5A 1NM2A 2LVWA 3H8YA 2JNJA 2RUGA 3MECB 2ZUAA 3HVTB 2ACMA 1BXNA 4P73A 2AX0A 5JJBA 3JQMA 3D68A 1N32J 5ETPA 3OFFA 3SIPB 1GXLA 3CD5A 1F2HA 4P75A 2UVVA 4J9QA 3MM6B 4B3SJ 4JYAF 2D74B 2IC3A 3H2LA 4DL4A 5CD4A 3BPSP 4M5DB 4JI0F 4DL6A 1MROA 3GCWP 2HFSA 2JLEA 2H65B 1RWVB 4ZIWA 4L75A 1YSJA 4JV5J 2ZNZA 3W9IA 2JSXA 3RGIA 4F3MA 2NR0A 2YKQA 3D4JA 4C8ZA 1U8SA 2KDOA 3SXLA 1U45A 1PIEA 4WJBA 3C3LA 2HBZB 1CJUB 2DTJA 3MI7X 5I3PA 1RTIB 1FI4A 2DK2A 1K0VA 3K2YA 2G1DA 5CA5A 1X9SA 3VV2B 3W63A 4UOCA 2KJVA 2V94A 2W9CB 1JIHA 3MMBA 1RGVA 2V4RA 2KJWA 2RB7A 1KFDA 3LH2S 2H54B 1SH2A 5GAEI 2J9DA 3DXSX 3T19A 3OVSA 2VC1A 3A12A 3FNNA 4UQGA 1X5OA 2ZVSA 2CKWA 1DHMA 2OSQA 4G65A 1DARA 2OD6A 1DTQA 3Q2SC 2RKIA 3D54A 2XSFA 1IM6A 4DR3F 3R27A 3FBEA 1VS3A 2AZ3A 3DI6B 3T9ZA 3TO8A 1M0SA 3W5XA 1MU2A 2HQ3A 3JQJA 4A8SA 1S79A 1S1UA 3Q86A 4DX6A 4OQJA 4IDKB 5F9LA 1UEUA 3KLFA 2OELA 4Y6IA 4KAIA 1E6VA 1RHRB 1X5PA 4YB1P 2VFVA 2XMVA 1HYSA 2R7VA 4CRJA 4AXIA 4NA3A 4ATNA 1RT7A 4FVCA 1IVZA 4O3PA 4J5OA 3AOAA 4LSNB 4P10A 4F4YA 1HWKA 4HR2A 2HFZA 2LXFA 2RE1A 4C8NA 3G2XA 2UXBF 2EWHA 2C2NA 5D3GB 1NHKL 4DPTA 2CJKA 5BYQA 1VMBA 2HSEB 1T9XA 1N0VC 4DUYF 2KG0A 1UVMA 2M88A 2HHWA 1KQFB 1WORA 4NZ7A 2ZHAA 4DV0J 3QSYB 2H4WB 2UU9F 1C1CA 4O44B 1RT2B 1JKHB 1O8BA 1TL7B 2G2OA 3PIPQ 4X64J 4TY8B 3TVYA 2PMWA 4W92B 3N9UC 1XNQJ 3W8PA 2KFZA 4JP8A 3DHWC 5ETRA 2RMLA 3RG6A 8AT1B 2L48A 3IGVA 4NLUA 3ISND 4IG0A 3ENWA 2AIRB 2DRAA 5F3TA 4ECRA 5KG4A 5AE1A 5DM6Q 2J8AA 1WC0A 1FK9A 2F7VA 2MYFA 1S97A 3ZO7A 3FBCA 3FBBA 1VRTB 3C14A 4LF8J 2HFOA 4CLKA 2GVZA 2KXFA 1MROB 1HHTP 2JZ5A 4Q44A 2DGQA 3RRKA 3W2WB 1SXLA 3G82B 3OXLA 3I96A 4QQBA 2NXUA 5IS2A 1B70B 1LNQA 1RP5A 1N36F 4UTGA 4QPXA 4F4AA 3GV8B 4ANEA 2E29A 4Q45A 2FB0A 2M2BA 3DOMB 4LFBF 2UXCJ 1DQ8A 3ICLA 4OHYA 1HNXJ 4CT9A 4LVNP 4LRAA 3D2WA 3TEGA 4OYAA 5A2QU 1CG2A 3D3CJ 4EU0A 1RKIA 4CLSA 2V4JA 2AKWB 4FZVA 3IWLA 3J81j 1WACA 2VASA 3QT6A 4P74A 1Q1KA 2FHKA 2MY7A 1R27B 2HQDA 1MN7A 5BYSA 2JWNA 2DGVA 1X7VA 3G8TA 2R3VA 4AQYF 1SJFA 2V4QA 5LJ3Y 2ZKUA 2BBEA 2H5JB 1OO0B 3NAIA 2RNEA 3SSQA 1ZA1B 4NCAA 5HK4A 4QIVA 3U02A 4JI2J 3ISZA 3M32B 2CPZA 2JLFA 1BMQB 3N6LA 2HHHF 2BR0A 5H9EK 2FLOA 3BF4A 1FNMA 2CPDA 3U7JA 2DH7A 4P2SA 3IR5B 4J9SA 1WDDA 4OI6A 1TFWA 3KLFB 1ZTTA 4OI0A 1E6VB 2BEFA 1YJTA 2RD5C 1MWZA 1XTZA 1IQZA 4IG3A 2RVJA 3V6DB 2F4FA 3MM8B 1EKSA 1FVQA 2ZH5A 1XMOF 2J0SD 2N3OA 3PKYA 2YKPA 4B02A 2YKAA 3Q8UA 3AOCA 3NRBA 2CQIA 1NK8A 1XR6A 3ULHA 4ZPWR 4RW9A 2O1PA 3MEEA 3MZIA 1LWEB 4HDGA 3VTIA 4LIRA 4QU6A 1FWPA 1URNA 4CI0B 1UJ6A 1N48A 1FDAA 1KDNA 4JI0J 2FZKB 2WBRA 1C1BB 2UP1A 3CCSS 1LW0B 4NMXA 3TZXA 3JTOA 2QN6B 4HKQA 1GH8A 4ZMMA 3IM9A 1M1HA 3UFCX 1IUJA 3C14B 2XGPA 2HNZA 1FKOA 1YIJS 2GVZB 4YFUA 2MGZA 2B5JA 2O67A 3T5JA 3I5CA 3NS7B 4DV3J 1FJGF 2AJFE 4I4BA 3O1LA 3P96A 3A8EA 2C2MB 1RA7A 1BY9A 2DYAA 2OI2A 1L3UA 3QJJA 1VQ8S 3KG1A 2L3MA 4YR3A 4HTIA 2VFUA 1P27B 1HARA 5M2UA 3MMJA 3DDIA 3BQ2A 2C1EB 4MYTA 4KO0A 3PEJA 3HKZD 3BBCA 3QLHA 5K9FA 2CQ4A 1S0VA 3HSZA 2AJ1A 4PXEA 5KFQA 2HQCA 1N0UA 4KIAA 1I3OB 4JB8B 1TL3A 5H1SV 4F4KA 1KTQA 1JLFA 1ZPVA 4PWWA 1RWWB 4AL5A 5D4OA 3NCQA 4C98A 2DNGA 3LGHA 3C15B 5EX3A 2YH1A 4DR2F 5K14A 2V8VA 2Z2ZA 1D09B 2MZQA 3M8YA 3I5BA 4TQRA 2CZVC 3QIPB 2HRTA 3ENAA 2UXBJ 3PNIA 1HD1A 3FUYA 5EX0A 5EGYA 2AV5A 3CIMA 1NPKA 4LF7J 2N82B 1UJ5A 2B4OA 1LK5A 4DUYJ 1YKWA 4WK3A 4RNFA 1AA1B 3DOKA 3MPWA 3SCLE 2BUNA 5CD4H 5DDOC 3AA8A 1R6VA 4ECYA 3HZEA 5I3UB 1NUEA 2DNQA 1QAYA 2GCFA 3GJSB 2JLGA 4IG3B
chains in the Genus database with same CATH topology
4DV2J 1IBKJ 2MTLA 2E5LJ 2ZM6J 4JI2J 2UXDJ 4LFCJ 4LF5J 4X66J 1I94J 4OX9J 4JI0J 4LF8J 1N33J 1FJGJ 1XNRJ 4NEYA 2UU9J 4DR7J 4B3RJ 5BR8J 4RJVA 4X62J 4YY3J 1N34J 3D3BJ 3T1YJ 4JYAJ 5FLXU 4PWWA 1XMOJ 4AQYJ 4JI8J 4GKKJ 4DR3J 4KHPJ 4B3MJ 4LF9J 3R2CJ 4DV6J 3IMQJ 4JI5J 2MEWA 4NXMJ 4GKJJ 4DR5J 2UXCJ 1N32J 2KL8A 3JAMU 3T1HJ 5IT9U 1HNWJ 5LMNJ 4DV0J 1HNXJ 2HHHJ 4JI3J 1HR0J 4NEZA 1J5EJ 5A2QU 4JI4J 4KY3A 3D3CJ 1HNZJ 2UXBJ 4B3SJ 4X64J 2MQ8A 4JI1J 3R2DJ 1IBLJ 4YHHJ 4NXNJ 3J7AN 4KYZA 4DUZJ 4LF7J 4DR1J 4DV4J 1N36J 5LM7E 2UUCJ 2UUAJ 3J80U 1XNQJ 4DUYJ 1XMQJ 4DV3J 2UUBJ 4X65J 4LF4J 2KVQE 4DV5J 5AJ3J 4K0KJ 4V1Ak 4LFAJ 4DV7J 4LFBJ 1IBMJ 4DR2J 5LMUJ 4JV5J 4DV1J 4DR4J 2F4VJ 4B3TJ 5IWAJ 3W1YC 3OTOJ 2VQFJ 4JI7J 3J81U 4LF6J 4DR6J 4JI6J 4HHUA 2VQEJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 J;  1IBK J;  2MTL A;  2E5L J;  2ZM6 J;  4JI2 J;  2UXD J;  4LFC J;  4LF5 J;  4X66 J;  1I94 J;  4OX9 J;  4JI0 J;  4LF8 J;  1N33 J;  1FJG J;  1XNR J;  4NEY A;  2UU9 J;  4DR7 J;  4B3R J;  5BR8 J;  4RJV A;  4X62 J;  4YY3 J;  1N34 J;  3D3B J;  3T1Y J;  4JYA J;  5FLX U;  4PWW A;  1XMO J;  4AQY J;  4JI8 J;  4GKK J;  4DR3 J;  4KHP J;  4B3M J;  4LF9 J;  3R2C J;  4DV6 J;  3IMQ J;  4JI5 J;  2MEW A;  4NXM J;  4GKJ J;  4DR5 J;  2UXC J;  1N32 J;  2KL8 A;  3JAM U;  3T1H J;  5IT9 U;  1HNW J;  5LMN J;  4DV0 J;  1HNX J;  2HHH J;  4JI3 J;  1HR0 J;  4NEZ A;  1J5E J;  5A2Q U;  4JI4 J;  4KY3 A;  3D3C J;  1HNZ J;  2UXB J;  4B3S J;  4X64 J;  2MQ8 A;  4JI1 J;  3R2D J;  1IBL J;  4YHH J;  4NXN J;  3J7A N;  4KYZ A;  4DUZ J;  4LF7 J;  4DR1 J;  4DV4 J;  1N36 J;  5LM7 E;  2UUC J;  2UUA J;  3J80 U;  1XNQ J;  4DUY J;  1XMQ J;  4DV3 J;  2UUB J;  4X65 J;  4LF4 J;  2KVQ E;  4DV5 J;  5AJ3 J;  4K0K J;  4V1A k;  4LFA J;  4DV7 J;  4LFB J;  1IBM J;  4DR2 J;  5LMU J;  4JV5 J;  4DV1 J;  4DR4 J;  2F4V J;  4B3T J;  5IWA J;  3W1Y C;  3OTO J;  2VQF J;  4JI7 J;  3J81 U;  4LF6 J;  4DR6 J;  4JI6 J;  4HHU A;  2VQE J; 
#chains in the Genus database with same CATH topology
 2M9K A;  2CJA A;  1EKR A;  2CZ9 A;  3I31 A;  4UOF A;  2X3D A;  2NZC A;  1RT4 B;  3MUM P;  1HKA A;  2G0I A;  2QA4 G;  1RJJ A;  4LF2 A;  5HBM B;  3CT9 A;  2GS8 A;  4J91 A;  1I1G A;  4CO1 A;  4DDF A;  5E7O B;  3SCK E;  3D66 A;  5DLF A;  2W2Q P;  5EWF A;  1YJ7 A;  2DVI A;  2JJ4 D;  1PYS B;  4B3T F;  3FJ2 A;  3MM7 A;  5C2C A;  4PG8 A;  4X62 F;  4WU2 A;  1X4A A;  2IA6 A;  1IBK F;  3PR4 A;  2ZD1 A;  5ETM A;  3CF5 Q;  1N36 J;  3DLK B;  1VJW A;  3EX7 B;  4W98 A;  3AT1 B;  4OYW A;  4C8L A;  2GIR A;  4LFB J;  5ETT A;  4KT0 C;  4KJI A;  2CQ1 A;  1AFI A;  2K7K A;  2EXU A;  8RUC A;  3L9Z A;  2A2C A;  2M7S A;  5T14 A;  1XR5 A;  4ZCI A;  3PV8 A;  1EET A;  2P9E A;  3BDE A;  3PCO B;  4TQS A;  1FKO B;  4FNI A;  2W9B A;  2B5J B;  3AHP A;  3BQ1 A;  2ASD A;  1TAU A;  3K5N A;  3IN5 A;  4ZPV R;  2DNP A;  1ZAX A;  3CCJ S;  2IRY A;  2XMA A;  2UVU A;  4FXV A;  3GWC A;  5DG9 A;  3G71 S;  4YB7 A;  2BRK A;  2RDJ A;  2B7B B;  4A8F A;  4DUZ F;  4AQY J;  2L08 A;  3OW2 R;  4NWB A;  1S76 D;  3KTQ A;  4FYV B;  1VLY A;  2H9Z A;  4DV6 J;  3ZFV A;  2E5H A;  3HXM A;  1RHJ B;  4QZV B;  1Z2Z A;  3HZG A;  4KR0 B;  4BLG A;  4ECX A;  2HHH J;  1SJ4 P;  4FVM A;  4CYU A;  3QLH B;  1U25 A;  2AYM A;  5AE3 A;  1XK8 A;  2XY6 A;  3O2I A;  5D0G A;  2J6T A;  2HQF A;  4DR7 F;  4ZLP A;  5HQ8 A;  5LSR A;  1WC5 A;  3NGS A;  4V19 X;  1YJ9 S;  1ZM2 A;  1TKX A;  2IDL A;  3M8S A;  1HQ2 A;  3X3U A;  2HVH A;  4ZVT B;  2W2M P;  3D7S B;  2AHO B;  4OZ3 A;  5IT0 A;  2Y1I A;  3T6B A;  1KVI A;  3S8S A;  5RUB A;  3VAJ A;  2POK A;  4DHV A;  1GNK A;  2IJR A;  3TA2 A;  2CDQ A;  3DOK B;  2BMB A;  2H51 B;  3CO9 A;  3GJR B;  1Z2L A;  3GII A;  3LAN A;  1T3O A;  2O5D A;  2FJV A;  3G6V A;  1F9E B;  1X4G A;  2XMM A;  3TX8 A;  1S77 D;  3TAN A;  2CJY B;  4ZIV A;  3OV7 A;  4NEZ A;  2VFR A;  2VA3 A;  3MPD A;  3FEX B;  1S4F A;  1CBK A;  2QLJ B;  2FLP A;  4H4K C;  1CJT B;  2Z2L A;  3SDE A;  1C4A A;  4TU9 A;  1T9V A;  3M30 A;  5KFL A;  4F50 A;  4JV1 A;  3GLJ A;  1R8C A;  4UF4 A;  2CPX A;  3TX0 A;  3EGN A;  4ECQ A;  3J7Z T;  4DSK A;  1R89 A;  4P2M A;  3N5B A;  3W65 A;  1F9H A;  4YOE A;  4ZVR B;  2ZD1 B;  4J9V A;  2ZHO A;  1FJG J;  5GMD A;  2RU3 A;  3MEG B;  4OMF G;  5CAB A;  1WKK A;  3HP6 A;  4JI4 F;  1VRU B;  4WP3 A;  1MG7 A;  1RAF B;  2HWT A;  1FEE A;  3MMA B;  2AJ4 A;  5ETS A;  4LF6 F;  3WIU A;  1KR4 A;  2EFQ A;  1W25 A;  2LXU A;  1D1U A;  1EET B;  1IKX B;  5I42 A;  2CNO B;  2QMW A;  2BV3 A;  1QLN A;  3R8Y A;  4A8M P;  3V2U C;  4AYB D;  3MM9 A;  1K44 A;  1NEE A;  1RIS A;  2DO0 A;  1RDR A;  4RBU A;  2A6O A;  4MFB A;  1P1T A;  2APO A;  3KJF B;  4DR2 J;  3H2U B;  1X4F A;  2ZJP Q;  1IKV A;  3UCU P;  1NJI T;  4PAA A;  4PUO A;  4RW6 B;  5IQQ A;  2YWF A;  1ZYQ A;  4BC7 A;  4DSF A;  5JUM A;  1PO6 A;  2OTL S;  2ZE2 A;  2HQI A;  4CYU B;  1Y7P A;  1U2C A;  3KNA A;  3ZTS A;  1KLM B;  4MKY A;  5LXR A;  2ZIT A;  3AJD A;  3I32 A;  5ETV A;  4USV A;  5CYM A;  5F8M A;  4UOH A;  3KLI B;  2FUG 9;  2QSW A;  3HT3 A;  1KC8 T;  2WVF A;  4OLO A;  4NCG A;  4X65 F;  2PDA A;  3W5Z A;  1DTT A;  2PA8 D;  1F60 B;  1RTH A;  3NCP A;  4J9U E;  5L39 A;  4OX6 A;  5AXK A;  2CIM A;  1C0U A;  5KT3 A;  3TR5 A;  3TZW A;  4Q8E A;  2Q66 A;  4DSI A;  1O5J A;  2KRB A;  2VUG A;  3FBF A;  4H4M A;  1FRH A;  2JRS A;  1TL1 A;  1D8Z A;  5J1N A;  2W2N P;  4KGK A;  1A6L A;  3LUY A;  1GTH A;  1BUX A;  2BKO A;  2DEJ A;  3IRX B;  3G87 A;  2C3O A;  4B3T J;  4HI1 A;  1U49 A;  3IAS 9;  5DRK A;  4DR6 J;  4KQZ A;  4F36 A;  1RKJ A;  3ZZY A;  4EUV A;  3R5C A;  2CFX A;  1FF2 A;  3T5L A;  2CPI A;  1IBK J;  4ZLN A;  4DG1 B;  4L76 A;  2QLB B;  4GRS A;  1U1Q A;  4NRT A;  4MK8 A;  1H38 A;  1WI6 A;  4TLR A;  1RBO B;  4FXD A;  3KK2 B;  2EFO A;  2BM0 A;  2WB1 D;  2FLN A;  5FII A;  6FDR A;  4ICL B;  3M30 B;  3DLL Q;  3OHB A;  4M5M A;  2W9A A;  5D0E A;  1Q5Y A;  3D9B A;  4ALZ A;  3O44 A;  3RU0 A;  2AW0 A;  2GO8 A;  4DFK A;  1S1V A;  5HI7 A;  3QZ7 A;  4N47 A;  1TKZ B;  1X4H A;  2M4M A;  1RAJ A;  3IR7 B;  3BSO A;  2UV8 A;  3US5 A;  3R7N B;  4MAK A;  4M95 A;  1OIA A;  1REG X;  4DUZ J;  4RW4 A;  1VR6 A;  1S9E B;  4LR9 A;  3KLH B;  4ED4 A;  1OWX A;  1FKP B;  3L7O A;  1U8W A;  2V8H A;  5K20 B;  3PW2 A;  2HIQ A;  4U7C A;  1UTA A;  4WIQ A;  5I42 B;  6AT1 B;  2MJN A;  4JI6 J;  5G0R B;  3T41 A;  3AXK A;  4XIU A;  4BC9 A;  1R8B A;  4CM2 A;  3WX4 A;  5F41 A;  2IM3 A;  5H9F J;  3MM9 B;  2B4P A;  4G1Q A;  1BD6 A;  2DR9 A;  3SSS A;  4DR7 J;  2J8S A;  4MFB B;  4RJV A;  4RNM A;  3OL6 A;  4L3K A;  2Q6C A;  2VDH A;  3KDN A;  1SC3 B;  4PUO B;  1PYT A;  2HHX A;  3I56 S;  4DZ6 A;  2VHG A;  3MCO A;  3QPI A;  1RTD A;  2O3D A;  2ROE A;  1AYE A;  4KKO A;  1S7I A;  4PCQ A;  1ZAV A;  3R3T A;  5CYM B;  3VAL A;  2M8H A;  3IP0 A;  1HFE L;  2MKC A;  3FSX A;  3TEH B;  2DCU B;  3PW0 A;  1IWA A;  1MW7 A;  2XMW A;  1CS4 B;  4A8Q A;  4WWS A;  1QY7 A;  3VAH A;  2B6A B;  4YR0 A;  1W7W A;  1W26 A;  1FNX H;  1C0U B;  3TVZ A;  3MPV A;  1ZS6 A;  2XMU A;  5EUH A;  2DGT A;  4H4M B;  3H4D A;  3K5O A;  2V2V A;  4EO8 A;  1RWM B;  5F0W A;  2GAG C;  1KON A;  3FRY A;  1KS2 A;  2NXC A;  2C2O B;  3OLB A;  3SV4 A;  4OX8 A;  1Q5V A;  2XO7 A;  4QIE A;  2C2K B;  2EG1 A;  3OL9 A;  2O66 A;  3O3L A;  2OFH X;  1BE4 A;  3QT7 A;  4B9M A;  4FKX A;  4AD6 A;  3LPE A;  1N8R T;  3HD1 A;  2CQP A;  3QQC D;  5E2Q A;  2FY8 A;  1FEH A;  2HFN A;  1FE4 A;  4JI4 J;  3DOL B;  2OSR A;  3EPG A;  4TY9 A;  3LP2 A;  1LWF B;  3RB0 A;  1Z4U A;  3P49 B;  2Y1J A;  3D6M B;  4JI5 F;  4OX7 A;  5AXL A;  1DY3 A;  5DZ6 A;  1RT3 A;  2EK6 A;  2F4V J;  1U1N A;  1S1V B;  2DNZ A;  3HDS A;  3UQS A;  1U0S A;  4CDI A;  4DPO A;  2BM1 A;  5J2M B;  4LF9 F;  1L3V A;  4PWD A;  4IFY A;  1G6B A;  3GPA A;  4WFN Q;  4YEA A;  2DXF A;  3W61 A;  3N01 A;  2BJ8 A;  5J2N B;  4M5H A;  2J5A A;  1SPB P;  3CE8 A;  1A9N B;  1OY8 A;  3OQ2 A;  2XMT A;  2QMU B;  2W25 A;  4DN9 A;  2LQ9 A;  2VB6 A;  2W4C A;  5GAG I;  2OPQ A;  4W4M A;  2ZH6 A;  1Z1Z A;  2DH8 A;  4WF9 Q;  4MK9 A;  4CTA B;  2HFV A;  3SFG A;  1TMM A;  2WOM A;  4K0K F;  4DJB A;  5IT9 U;  1MN9 A;  4FPR A;  1VDH A;  4YR2 A;  3QWP A;  2OP5 A;  1FXL A;  3HHL C;  4F4Z A;  2QO3 A;  5KG6 A;  1TV6 A;  2ZUG A;  2YX1 A;  1FES A;  1VOM A;  1HL6 A;  4DFM A;  2AD9 A;  4X65 J;  3T5K A;  3LA0 A;  4F0K A;  3LAM A;  1S7H A;  5IV4 A;  1RTD B;  2C42 A;  2VFS A;  2IYG A;  1M1K T;  2X7I A;  2CQH A;  2R7X A;  4GKK F;  4HYK A;  4ZPA A;  4CH0 S;  2YNH A;  3BN7 A;  1QAI A;  3MAH A;  4ZHR B;  1RBL A;  1TTH B;  3BYP A;  1VQM S;  3WC2 A;  3UWT A;  4LQ3 A;  1HR0 F;  5FD1 A;  1R8A A;  3H5U A;  2Q3P A;  2KN4 A;  1RWU A;  1ACM B;  4O0N A;  3R6G B;  3NMA A;  2O01 C;  4DU7 A;  3AOB A;  1N5Q A;  2M52 A;  4K4V A;  3RW7 A;  1JLC A;  1Y3K A;  1ZH5 A;  4I6A A;  2ILY A;  5ITH A;  4HH1 A;  4WXO A;  3DRR B;  3R9L A;  2P9C A;  4DMZ A;  3POT A;  3GQC A;  3DXB A;  4CLZ A;  3KYL A;  5KFD A;  1OQ3 A;  1EJ7 L;  2IBO A;  4XPC A;  4Z37 A;  1IKY A;  1NU4 A;  1O6X A;  2KHD A;  4KH1 B;  3KK3 B;  4ZLL A;  4LRE A;  3CB4 A;  3UVJ A;  3ELH A;  3QAT A;  1IN0 A;  2GVD A;  3L09 A;  3C66 A;  3NMR A;  1LQ9 A;  2FZG B;  1K1Q A;  2GW8 A;  3SCJ E;  1VBY A;  3ITH B;  2K8G A;  1IBC B;  4E2F B;  1OYE A;  4P9S A;  5C24 A;  4L72 B;  1Q0N A;  1F2G A;  3DLH A;  4Z2X A;  5KFK A;  2QV6 A;  3T6J A;  5KFV A;  1H2V Z;  3CW2 C;  2BQ3 A;  5E0O A;  1SKR A;  2ZWP A;  4DPW A;  5DQH A;  1YDL A;  4YP3 A;  4PWD B;  4IFY B;  3K0J A;  2F5G A;  1VQ9 S;  2CAD A;  1U2R A;  2EG2 A;  3W8G A;  3RW6 A;  3JAM Y;  1X31 C;  1T7P A;  2MZT A;  2RRN A;  4IRC A;  3GIR A;  5A0Y B;  2HKE A;  7AT1 B;  5JVH Q;  4NCB A;  4B9T A;  5DZ7 A;  1CQM A;  3GV5 B;  1UCN A;  4I2Q B;  2DKO B;  1X4D A;  3QAE A;  2VIC A;  1FXR A;  1PC4 A;  1TV6 B;  1RT1 B;  4KSE B;  3OR1 A;  3UD3 P;  4NZ6 A;  4Y2I A;  4RBV A;  3CD7 A;  1Y9O A;  4A46 A;  3A8K A;  1K47 A;  4EO6 A;  3C6T B;  3D3B J;  3BQ0 A;  3TW0 A;  3ET6 A;  4U6P A;  2AEJ A;  2ZOM A;  3R2C J;  2G2Y A;  4PQU A;  1S9G A;  4I0W A;  2C2R A;  2FVC A;  3LAK A;  3EVO A;  1G7C B;  5D8H B;  4LVO P;  2IVY A;  2QYG A;  4C3K A;  1WSV A;  4Y28 C;  1FO1 A;  3MFI A;  2GQ2 A;  1RAE B;  2F3J A;  2VJV A;  4WFX A;  3KHL A;  3HMJ G;  3TA1 A;  1F9F A;  3MTK A;  1FRX A;  4F2S A;  3M8Q A;  4CLL A;  4PG5 A;  1YRX A;  5LOQ A;  1QSY A;  3K8W A;  4KHR A;  2MQN A;  4I2P A;  1T94 A;  1T9U A;  2C3Y A;  3C16 B;  1CVJ A;  4G6V B;  2AJ0 A;  4QJV A;  1JLC B;  5H9E J;  4LRC A;  3B6B A;  5LJ5 Y;  3WC0 A;  1Q81 T;  2W4P A;  1JLG A;  3POT B;  1UZD A;  1YBA A;  3IR6 B;  3T3F A;  1U0H A;  3K89 A;  2H5I B;  2NXN A;  4QOT A;  5IM0 A;  5LMU F;  1X8D A;  3QNW B;  1NB7 A;  3NS5 A;  2VC0 A;  3OTD A;  4J9L A;  3R5A A;  5KFJ A;  3I9V 9;  3KMQ A;  2Y0S D;  2GVD B;  4LF9 J;  1VBZ A;  2HS0 A;  4GKJ J;  4AL7 A;  1FTR A;  4BS2 A;  1YI2 S;  4KV8 A;  2PD1 A;  4KFB B;  1KQG B;  2E1M C;  1S0M A;  3LP0 A;  3MUV P;  5C24 B;  1PCA A;  3ZZT A;  1F5B A;  1NHV A;  3H5S A;  1HQU A;  2HS3 A;  1YIT S;  5D77 A;  3U1L A;  1DFD A;  4K0K J;  3KJN B;  3N6N A;  1JLQ B;  1GXU A;  4MK7 A;  3IS9 A;  1U47 A;  1B3T A;  5FDL B;  3QJL A;  2VPZ B;  4Z7C A;  2KT3 A;  2CQD A;  4KHP F;  4OZ1 A;  1T11 A;  3ZZU A;  4ZP7 A;  3DU6 A;  2R2U A;  1HQE A;  3M1V A;  3TZY A;  1PAU B;  5LMN F;  2MKS A;  4YQW A;  3QGH A;  3M2V B;  3DMJ B;  4NLT A;  4RUB A;  4CO5 A;  4WE1 A;  3CCT A;  1XEZ A;  3CME S;  2P5V A;  4QU7 A;  3CVK A;  2DRD A;  2HWH A;  4GKK J;  2HHU A;  4QBU A;  1PIL A;  1RAA B;  3PIO Q;  2KZZ A;  1Q78 A;  1NDP A;  2HVZ A;  4WYW A;  2XBP A;  5FJ4 A;  2YKN B;  3BPD A;  1HR0 J;  4NA1 A;  3OR1 B;  1DUR A;  1RHM B;  1JLA A;  1S4E A;  4EBC A;  3MR2 A;  4AL6 A;  2ZZN A;  3M2U B;  4NI2 B;  2HND A;  2B4V A;  4O0I A;  4BDP A;  1M1G A;  2PEB A;  4Y2A A;  3UNY A;  4TLQ A;  1QE1 B;  1TEL A;  2E44 A;  2CYY A;  2ZH4 A;  1S9F A;  4PQU B;  3WBZ A;  2DGU A;  4WFY A;  1YK9 A;  5CCM A;  3VVU A;  5A2Q Y;  1HA1 A;  2XSJ A;  5D6G A;  1J5O A;  3SBM A;  2WSE C;  2BJ3 A;  1CJV A;  3M2R A;  2J9E A;  2OMO A;  1VQL S;  3QFW A;  1NJW A;  5C7P A;  3R5G A;  3RAX A;  4I2P B;  3QRR A;  2MHN A;  2F65 A;  1YVF A;  3CTR A;  2I5J B;  4LF4 F;  1S0O A;  1VYA A;  3OVA A;  3O8W A;  5FLX Y;  2A3J A;  4ZPB A;  3UCZ P;  3A13 A;  1X4C A;  1AFJ A;  2JEI A;  4OJ1 A;  3NOC A;  3LQV A;  5F8G A;  2VKR A;  3TA0 A;  2IMO A;  4DQI A;  3UD5 A;  5IM0 B;  3VAG A;  3I0S B;  3VVT A;  5LSO A;  4X66 F;  5JXS A;  3BDP A;  1Q7Y T;  2B43 A;  2KVQ E;  4Q2M A;  3MUT P;  4RW8 A;  5EWG A;  1R0B G;  2ZBQ A;  1SKU B;  1NPP A;  4OHW A;  1UA1 A;  2HHQ A;  1TK0 A;  2FGC A;  2YKO A;  5BR8 F;  3GJT B;  2XYG B;  1IM4 A;  3PFO A;  3DLB A;  2VA2 A;  2J0X A;  3MPY A;  4NLQ A;  2YX7 A;  5IXU A;  3LP0 B;  4UW2 A;  1WDT A;  1R0C B;  1SUQ A;  3HHD A;  1R8P A;  1M5S A;  4ZK7 M;  1M5H A;  3PXG a;  3VZH A;  5A8K B;  3J7Y I;  3NXZ A;  2DR6 A;  5D78 A;  4C9D A;  4WP8 A;  1F6T A;  2PE8 A;  3G9C A;  3IS9 B;  3DLG A;  1SV5 B;  1X5T A;  2CJB A;  2HQG A;  4ZS6 A;  2I0X A;  2JL9 A;  2FD2 A;  1AZS A;  1HW8 A;  1SQG A;  4PG4 A;  3ZNU A;  3SCI E;  1MLA A;  2MEW A;  2I8E A;  1LK7 A;  4IYQ A;  4C2M A;  4R0E A;  4LSL B;  3O6Q A;  1U1L A;  1NJY A;  2GGP B;  3GSI A;  1EP4 A;  2WVD A;  1PYO B;  4KTQ A;  1VC0 A;  2QT7 A;  4O3R A;  4Y2M A;  3FSY A;  5GAD U;  1RWX B;  1Y5N B;  1TVR B;  3THT A;  1N32 F;  3CO0 P;  2LXI A;  1V9O A;  5KFZ A;  2HZV A;  4NX9 A;  4MIW A;  2HBQ B;  4M5I A;  3IXQ A;  1GTE A;  2CPE A;  1F1B B;  1NJX A;  5HN0 A;  4DR5 F;  4Y3C A;  1VQ7 S;  3L3C A;  3T9N A;  2XG8 A;  1TL4 A;  2ZH2 A;  5KT4 A;  1DZ5 A;  2W2O P;  5E3A A;  5F8I A;  3M8W A;  1NSQ A;  3O5T B;  1HBN A;  4RLE A;  5IZH A;  1BQM A;  4RW7 A;  4E0D A;  4X4P A;  3QID A;  1ZM4 A;  3CJK A;  2F8H A;  1S6P A;  1TUG B;  3H5Y A;  2K7J A;  4RKU C;  2ZH3 A;  2XSJ B;  1J5O B;  2OEJ A;  2B4U A;  2CQB A;  4YS2 A;  1RHU B;  4WFA Q;  1LOU A;  1CJV B;  3M2R B;  4AXJ A;  2KZM A;  1VIX A;  1LFP A;  1SKS A;  4Y2K A;  2VKZ G;  1QAJ A;  3DM2 A;  1Q7L B;  1S1W A;  2B9W A;  4K4S A;  2KO1 A;  2BRL A;  4CP5 A;  2PA3 A;  3ZC4 A;  3I87 A;  1JLB A;  2JFK A;  1IR2 A;  2FJB B;  4CT8 A;  2OPS B;  2W7O A;  4ZKA A;  2B9X A;  4K8R A;  2J7U A;  5KFS A;  4O3S A;  4KH0 B;  1MMD A;  4MIB A;  2D9P A;  5HLF A;  1C0T A;  1P8G A;  2YQ0 A;  2FC8 A;  2IA0 A;  2RS2 A;  2XCA A;  3TQE A;  3EZ5 A;  2IM2 A;  1N52 B;  1KOH A;  2K2P A;  3WQP A;  4NEY A;  3RBE A;  3ZNJ 1;  3NEK A;  3MED A;  3DHX A;  3MDF A;  4J9O A;  3A3O B;  2JHE A;  2B9E A;  5ETK A;  5B0F A;  1MMN A;  4JI8 J;  2ZBP A;  1XER A;  5ETO A;  4KHP J;  4NRU A;  2RJZ A;  4EEY A;  4QYZ K;  1X0F A;  1M90 T;  2XWX A;  5LMN J;  2F1F A;  3QAU A;  1RYR A;  2AU0 A;  3BZQ A;  3MEC A;  2VQE F;  4GO5 X;  1RAC B;  1EQM A;  1FNO A;  3HPO A;  1UVK A;  4ELU A;  2KVI A;  1VQN S;  3M9M B;  4Y2C A;  3RBX A;  3JYT A;  2N7C A;  3AAW B;  5HMX A;  4PWU A;  2PT0 A;  4FBU A;  4DF4 A;  3KKF A;  4CO3 A;  2VFT A;  2UV8 G;  3KJV B;  2WVC A;  2V2K A;  1U1R A;  3BN4 A;  2CQ0 A;  4A8X A;  1OMS A;  2QGF B;  4QWE A;  3C19 A;  4X64 F;  3FVY A;  2C22 A;  2MTL A;  1RU2 A;  3PO5 A;  1G2E A;  4DPX A;  4OI2 A;  1VQY A;  1XNQ F;  1K9M T;  1XIQ A;  4JOU A;  4A47 A;  1WOO A;  5L1I A;  1KTV A;  2LU2 A;  2LFV A;  2B7C B;  4B9S A;  5I4M A;  1RT6 A;  4MKB A;  4ED6 A;  4JI1 F;  1N56 A;  3QYY A;  4Q0B B;  5KFO A;  1NBE B;  3AOD A;  1BC6 A;  5KOW A;  1WF2 A;  3GIJ A;  3D6H B;  4MJK A;  3FCH A;  1WG5 A;  5C2G A;  3V4I B;  2W8K A;  3KOA A;  5J1E B;  2W9C A;  1T95 A;  3R2D J;  5AXN A;  4LF5 F;  1HBN B;  3P45 B;  5HJX A;  4OX9 F;  4LJM A;  3CCE S;  2DJW A;  4LF4 J;  1BQM B;  4FS2 A;  2YNI B;  1DRZ A;  4RW7 B;  4TXS A;  1S6P B;  1RWP B;  1IR0 A;  2K06 A;  4ZJL A;  4CH7 A;  3EIC A;  5KT5 A;  2OO4 A;  2J0W A;  4ERD A;  2L9D A;  2NSB A;  3PJW A;  2LEB A;  4O3N A;  2LCW A;  4ED8 A;  3VAM A;  2RRB A;  3M6V A;  4X66 J;  1NXI A;  1LXJ A;  3DI6 A;  1BQN A;  2EFV A;  1NHU A;  1JLB B;  1DAX A;  2IVM A;  5HL7 Q;  3AA9 A;  2V2Q A;  2VPX B;  3TAM B;  5BR8 J;  1U09 A;  4ZVO B;  3VGS A;  5L1J A;  1D9A A;  4A8W A;  2DNR A;  1RA6 A;  1EAR A;  2GML A;  3PAC A;  4JI2 F;  4EBD A;  1C0T B;  3BBB A;  1GX5 A;  3SMZ A;  1S57 A;  3GG1 A;  1AB8 A;  5J2P B;  3D1Q A;  2XMJ A;  1VI7 A;  9ATC B;  2AEM A;  3AY0 A;  4HAC B;  4Q8F A;  3I5A A;  4K4U A;  3MED B;  5ETN A;  2QTW A;  4BWM A;  3QSI A;  1Q16 B;  2KRR A;  2VON A;  2CWX A;  5E41 A;  3DRY A;  4DCJ B;  4KGX B;  4OYP A;  4MYU A;  4O44 A;  1F5C A;  1RT2 A;  3W5Y A;  1HBO A;  3FQL A;  1JKH A;  1TL7 A;  4ZP8 A;  2FVQ A;  1TFY A;  2HHS A;  4TY8 A;  4ED5 A;  4HHU A;  3UR3 C;  1HPZ A;  2CVE A;  2OHD A;  2VG6 B;  4USH A;  2XS5 A;  4I67 A;  1JXL A;  3CD6 S;  1XQI A;  4IUF A;  2F9D A;  5ETQ A;  4Y00 A;  2NXJ A;  5HO4 A;  5HRO A;  3G8S A;  3TYT A;  1QUV A;  2BXJ A;  4HDH A;  3JYT B;  2RIL A;  1SI9 A;  5U47 A;  1QVG R;  5M2R A;  3EMT A;  3PHE A;  1FER A;  1VRT A;  4DR5 J;  2XLK A;  4ZA1 A;  1REV A;  2VG5 B;  2R7O A;  2E9R X;  2KH9 A;  3W2W A;  3AD8 C;  1WD6 A;  3G82 A;  1JJ4 A;  1UL3 A;  5DS7 A;  2A0F B;  3VZI A;  2DB1 A;  1SIZ A;  3ZZO A;  1RTJ B;  4WFZ A;  2GX8 A;  4OL8 A;  2BE2 A;  3KDO A;  4CNZ A;  1RT6 B;  4KBI A;  2DCL A;  3R1H A;  3DOM A;  3BSC A;  1CQN A;  3CJ2 A;  1GMW A;  4Y0F A;  1X60 A;  4HT7 A;  3EXY A;  3DRS B;  1FTC A;  5KFB A;  4GMK A;  3PYD A;  1Q95 G;  3FZ2 A;  4X4T A;  3PRD A;  4IKA A;  1NH8 A;  3VGU A;  4DV3 F;  3MR5 A;  3DNC A;  3PM9 A;  2NXE A;  4C8K A;  4EI2 A;  1RQ0 A;  1YG0 A;  4B9N A;  1AUS L;  2JH3 A;  1TP7 A;  2MKY A;  2VD3 A;  2JC0 A;  4RZR A;  2L41 A;  4RBT A;  5J2Q A;  3M32 A;  3MHY A;  4ENO A;  5K5M A;  1T03 B;  2XC9 A;  1R8H A;  2AYB A;  1JLE B;  2DPI A;  1SL2 A;  1BQN B;  4LUB A;  2J9D E;  1UVN A;  3CD0 A;  4AT1 B;  3CDA A;  4LFC F;  2AYG A;  4DX5 A;  1IWG A;  3JTP A;  2DRB A;  3BGF A;  3V6D A;  5KFF A;  4JI7 J;  2N7Y A;  5C5J A;  2SXL A;  3HVA A;  1WUU A;  1CUL B;  3MM8 A;  5HAT A;  3OTB A;  2VQE J;  1SQE A;  3KUE A;  3MCM A;  2YNG B;  1VLO A;  4LF7 F;  1OY6 A;  1VC5 A;  3W2V B;  4WII A;  2H48 B;  1HMV B;  2NPI A;  1FWK A;  1LWE A;  3UDV A;  1F5A A;  3M8P B;  1S99 A;  4P2X A;  4E98 A;  3HVW A;  2HHT A;  3QT5 A;  3BSN A;  3CJ8 A;  1HBO B;  1Y00 A;  3P3D A;  5HMW A;  5GMK a;  2ROP A;  2DR7 A;  3CED A;  1HPZ B;  1FJE B;  1C1B A;  4PG7 A;  1JX4 A;  3N4W A;  1LW0 A;  2FVR A;  1RWO B;  2LU1 A;  4DV1 F;  2XHW A;  4ES3 A;  5B7W A;  1UW9 A;  2QX0 A;  4KHM A;  2KU7 A;  3TOQ A;  5HRO B;  4J9M A;  1H2T Z;  2ATL A;  2XS7 A;  1HNV B;  4JI1 J;  4PRF A;  2DT9 A;  5D15 A;  2HW3 A;  3HLU A;  2Z57 B;  4OZN A;  4V19 J;  4FN5 A;  2VDI A;  2HBY B;  2GV1 A;  4DL7 A;  2BYC A;  1REV B;  3KLG B;  1VBX A;  1BLU A;  3ETO A;  5K8M A;  2XYH B;  3K5P A;  3JSM B;  2KXN B;  4LF5 J;  1FRI A;  4EGL A;  2BE2 B;  4OX9 J;  2XTJ P;  2QC3 A;  4U67 Q;  3X1L B;  2LEP A;  5KFU A;  1FWL A;  3DN9 A;  3H7H B;  2QIF A;  1RT5 A;  3ILJ A;  3CGI A;  4ELT A;  4OI1 A;  2EFN A;  4RR5 A;  3K8V A;  1VQ5 S;  2XUL A;  1QUP A;  2G13 A;  2ZC4 A;  1VRQ C;  2GMJ A;  5GAE U;  4M5J A;  1DLO A;  1Q8I A;  5A8R A;  3RUB L;  4WFB Q;  3L7U A;  3TJ9 A;  1VJQ A;  1FVS A;  2MHE A;  4OZ2 A;  4RWX A;  3KLV A;  2CDR B;  3Q23 A;  4QW8 A;  4WZQ A;  4LIW A;  4LSZ B;  2GAH C;  5LL6 d;  2UXD F;  2UZA A;  3KG0 A;  4ELV A;  3C15 A;  4C0O C;  4DV6 F;  5J2Q B;  5LSL A;  2X1A A;  4FS1 A;  1WHY A;  3TUI C;  4CCH A;  4WKR A;  2PFF B;  3QIP A;  4DL5 A;  1UFK A;  5DGB A;  2YTC A;  2LQB A;  1K1S A;  5GAD I;  2V9W A;  4RUA A;  4CLY A;  1U1P A;  2HS4 A;  4URS A;  2ASJ A;  2AGQ A;  1AW0 A;  3TZZ A;  2XM3 A;  3R5J B;  3NNC A;  3MAQ A;  1XC9 A;  4Q43 A;  1Y5I B;  5I3U A;  2VJU A;  2KM8 B;  1UMJ A;  1UFW A;  1NSA A;  4F26 A;  1JJC B;  3OD2 A;  4ZVQ B;  3M9N B;  5HP1 B;  3QFH A;  3K17 A;  4HT5 A;  2DNO A;  5CH7 B;  3LGN A;  5HAN A;  4C7Q A;  1NK6 A;  1RT4 A;  2DIU A;  4YN3 B;  5B0A A;  3R7S B;  4EYI B;  4OJG A;  4TU8 A;  4CWB A;  5HBM A;  1I51 B;  1FRM A;  3D0H E;  5CAA A;  4ID5 B;  4BBY A;  3HVR A;  1Q53 A;  2QMX A;  3PKM A;  4DFP A;  2FC9 A;  4NXN J;  3J7A N;  4C8M A;  1OPZ A;  2V69 A;  3BH6 B;  1KN6 A;  3ILO A;  3I82 A;  2BKP A;  4ETZ A;  2A2D A;  3ILL A;  3A4T A;  1IQT A;  2ZNY A;  3IO1 A;  1UP1 A;  2HBR B;  4C48 A;  4M94 A;  4PEO A;  2ZC3 A;  2FJA B;  2AJ2 A;  3GB0 A;  3W9J A;  5T7L A;  2ZBR A;  2W4D A;  2FYX A;  3IBC B;  3ZZP A;  3DLK A;  1SBR A;  4TU7 A;  1HI0 P;  4DSJ A;  2ZFH A;  3RYL A;  1JB0 C;  3JSR A;  2H4Y B;  2QFJ A;  4NL5 A;  3VAI A;  5L46 A;  1R0A B;  2B8P A;  1Q8B A;  5KFW A;  3KHG A;  4NLX A;  2VOP A;  2ILZ A;  4PQA A;  2IFX A;  4DBQ A;  4ILL A;  4C6A A;  1WC1 A;  4ANC A;  4QWC A;  4ZCM A;  4A8Y A;  5GAH I;  5EWE A;  3V81 B;  1UZH A;  4RL1 A;  5HVG A;  2HRU A;  3KG4 A;  5E33 A;  1HNZ J;  1WTF A;  4URQ U;  2CUY A;  2N3L A;  1O51 A;  3BYR A;  1RT5 B;  1PAE X;  1FD2 A;  2I1R A;  2UUA J;  1LV5 A;  3MOZ A;  2IIH A;  3BKT A;  1HBM B;  1XWL A;  1NZA A;  1ZAW A;  4KRW A;  1QSL A;  3D1H A;  1LWC B;  5KFN A;  2F63 A;  1TZ0 A;  2R2T A;  3PYE A;  4K59 A;  3RBZ A;  4AFF A;  2U1A A;  4OV6 A;  3EZO A;  1DLO B;  5A8R B;  3IA0 A;  1T3N A;  3CDU A;  2QE5 A;  3B8H A;  4U8Y A;  4B3M F;  5F3Z A;  3EGZ A;  3PJ9 A;  4LFC J;  1NCL A;  4QIW D;  1SB6 A;  2XZW A;  2G9O A;  4YDX A;  2E1A A;  3HSJ A;  2A18 A;  3BRE A;  5L8R C;  3ENV A;  2LEC A;  4YHH F;  2MMY A;  1DQ9 A;  2P2C B;  2ZOG A;  3HFZ B;  3QGI A;  1VQO S;  1NPR A;  2OEM A;  5ADZ A;  1FDN A;  2NZ4 A;  1JNZ B;  4QPT A;  2IJN A;  1BWE A;  4ZP6 A;  2ROG A;  2WAQ D;  2W7A A;  4GVB A;  4ZPT R;  3RRH A;  4WKY A;  4AND A;  5B0B A;  4B3O B;  4DXL A;  2VL1 A;  4PXD A;  3ZTQ A;  2W7P A;  1VIO A;  2ZH7 A;  3J80 Y;  2HAI A;  2WHO A;  4DV1 J;  1SJ3 P;  1SVD A;  1LXN A;  1WHW A;  4UOG A;  3LP1 A;  1CJT A;  1MML A;  1FT8 A;  4BHQ A;  1B0P A;  1S1X B;  1I94 J;  2MZJ A;  3SQG A;  3RB6 A;  1HLW A;  2I6W A;  2RAQ A;  3MEK A;  5IC4 B;  3I55 S;  4QIF A;  4F7V A;  3EWG A;  1B64 A;  1IBL F;  4ECT A;  3PDN A;  4DR6 F;  4X2B A;  4DR1 F;  3EDQ B;  2NRE A;  1H7X A;  2FJD B;  2J7K A;  1CSJ A;  5AJ3 F;  1QTN B;  1SH0 A;  4QW9 A;  5T7L B;  3MEG A;  3SQO P;  1VRU A;  3OUY B;  1U7L A;  1T05 B;  2L9W A;  3GFY A;  3MMA A;  4NLV A;  4USJ C;  1N5Y B;  3BR8 A;  4ZPD A;  3KK1 A;  3UDE A;  1T9T A;  1CC8 A;  1UA0 A;  1KQK A;  1IKX A;  3OSP A;  2LA4 A;  2H1Y A;  2AQ4 A;  1S59 A;  5KFX A;  2RQK A;  3HHL D;  4GC7 A;  2JC1 A;  1QM9 A;  4HI2 A;  2E7X A;  2HMI B;  4WZM A;  1NB2 A;  3TP2 A;  4ED3 A;  4WTY A;  2EFG A;  1JJH A;  2RSQ A;  2UXD J;  5CCL A;  1G4C A;  5KT7 A;  1ITP A;  3UDC A;  3TRG A;  4RW6 A;  4HHH A;  4JI6 F;  2ASY A;  2VG7 B;  1C4C A;  3PX6 A;  2DGX A;  1KLM A;  3BB5 A;  1WC6 A;  2E1C A;  3OJU A;  1HHS A;  4QR2 A;  3FRZ A;  4I64 A;  1U6Z A;  3KLI A;  3N79 A;  1FCA A;  1ICE B;  2F40 A;  3OHA A;  3UNG C;  1E6Y B;  2VU5 A;  2FHJ D;  3MM5 B;  4R25 A;  2DXE A;  2KT2 A;  2FGO A;  5BJR A;  2WVB A;  3LGM A;  4R8U B;  3DRX A;  1G1X A;  1XNR F;  4P6Q A;  3BV8 A;  1P6T A;  2AF6 A;  3IC1 A;  1U02 A;  1GFW B;  2IRX A;  4LBI A;  4YY3 F;  2FTR A;  1KP6 A;  2PMH A;  4OI4 A;  2D1C A;  2DHH A;  3HFV A;  3CCL S;  3PO4 A;  2MXY A;  4GVB B;  3AJ2 A;  5B0E A;  2LQ5 A;  1LEO A;  3MOJ B;  1WEL A;  3THV A;  2DR8 A;  3IRX A;  1FRK A;  4FP9 A;  3QWU A;  4GO7 X;  4K4W A;  4K4T A;  3FDS A;  3EGV A;  1Q79 A;  2DHX A;  4DG1 A;  2GHP A;  3PVX A;  3AXM A;  3CCR S;  2CQC A;  1N6Q B;  2KTQ A;  5EDW A;  2HGL A;  3LP1 B;  1Q8L A;  1WI8 A;  5KT2 A;  3KK2 A;  3BH7 B;  4NAS A;  3SQG B;  4ICL A;  2DHA A;  4KY3 A;  4C8O A;  3GR0 A;  4I68 A;  4ZCK A;  2BOA A;  2QZ8 A;  2UUT A;  1TKZ A;  2ATC B;  1P1L A;  1YRT A;  1RE1 B;  1KHW A;  2XO6 A;  5I3Q A;  4X4U A;  2E5G A;  2RS8 A;  1CLF A;  1FDB A;  5AXM A;  1J27 A;  3DLE A;  1S9E A;  1UEV A;  4NLS A;  3KLH A;  4ZVU B;  1FKP A;  3J81 Y;  1A0O B;  3NP5 A;  1NAQ A;  4CM0 A;  3KK1 B;  3PHT A;  1IKW B;  3RR7 A;  3HX9 A;  3JXO A;  3OFH A;  2FJE B;  1NDK A;  2F4V F;  5G0R A;  4B17 A;  3W62 A;  3DU5 A;  2EBE A;  4PPZ A;  4F4W A;  1RHQ B;  1WC3 A;  4B3M J;  5MAO A;  3IMQ J;  2RQM A;  3SSR A;  4HLB A;  2CJQ A;  3JAM U;  3FMB A;  3Q8V A;  2VQF F;  3M8R A;  3C46 A;  2G1H A;  2XEX A;  2E5J A;  3LF0 A;  3CMQ A;  4QWA A;  4YHH J;  2E1P A;  3D67 A;  4PXC A;  1W2B R;  3Q8S B;  3W66 A;  2RF2 A;  3VCD A;  2BZ2 A;  3GYX B;  4DL3 A;  1FDD A;  4OYX A;  5DG8 A;  5MLC V;  2VBY A;  2H3E B;  5KFI A;  4CNY A;  4LT6 A;  1IJE B;  7FD1 A;  4RX6 A;  3MCN A;  2CPH A;  3SZ2 A;  4C8Y A;  1UKU A;  1UVI A;  2LQJ A;  3SI8 A;  4Q2L A;  2V8P A;  1CS4 A;  5LT5 A;  2ABY A;  3OTC A;  2B6A A;  3I0R B;  3I9Z A;  2ZJR Q;  4I7F A;  2MST A;  3ADA C;  1RSC A;  2D3U A;  1T0T V;  3BM7 A;  1GMV A;  3HO1 A;  4QCL A;  4FNH A;  4P2F A;  2K1R A;  5AT1 B;  3V6K A;  3CC7 S;  2YXL A;  4LBH A;  1C2P A;  1S1T B;  2AZ1 A;  4ZVF A;  4WXW A;  3AFG A;  2WVE A;  3NS6 A;  3V6H A;  4IOA Q;  1JXV A;  3BGO P;  3HSG A;  4RO0 A;  4MIA A;  1YJW S;  3GP9 A;  1GQE A;  1IBL J;  5D4L A;  4OYO A;  4DR1 J;  5C42 B;  3BR9 A;  3VQT A;  4RUC A;  4ES1 A;  1XMQ J;  1ULR A;  2YPY A;  5AJ3 J;  4UUW A;  1KQS R;  3CPW R;  3DOL A;  1KOO A;  3ZZZ A;  3MUR P;  1ZZF A;  1LWF A;  3I4H X;  3OT9 A;  1CJK B;  3HUL A;  4DF8 A;  3F73 A;  5GVQ A;  4R5P A;  1NSP A;  2PFD A;  4P71 A;  2XHC A;  5LXY A;  3NOG A;  2P6T A;  2ZVI A;  3UPF A;  3S7R A;  2E7W A;  3ZTO A;  2W2P P;  4QYZ J;  2XYP B;  2AGO A;  2FHM A;  3MD1 A;  2V67 A;  2J76 E;  1LW2 A;  5J2M A;  4F2R A;  4UT4 A;  1NK4 A;  3OFG A;  2A1B A;  4K50 A;  2CNL B;  1ELO A;  3OR2 A;  1GMW D;  5J2N A;  2KYZ A;  4PPD A;  3R5D A;  4DL2 A;  4DOZ A;  3DLE B;  5KOX A;  4NYP A;  3TAQ A;  4M63 A;  1N54 B;  1T9Y A;  4N8O A;  2FHO B;  2XLJ A;  1RXO B;  1HIY A;  3G96 A;  2EC0 A;  4WCE Q;  4CTA A;  3CJ3 A;  3OSN A;  2XI2 A;  3K57 A;  1RWN B;  4V1A k;  4ECW A;  5HVF A;  3QT8 A;  5CXT A;  4LRF A;  5DQI A;  4YB6 A;  3DYA A;  4DFJ A;  1KD1 T;  5HSP A;  2MJU A;  1ZBT A;  3C6U A;  3NWG A;  2A6M A;  4OV1 A;  2Q43 A;  5A8W A;  3M6X A;  4JV2 A;  2EKY A;  1VQ4 S;  1XNR J;  4DS4 A;  1H73 A;  5E3C A;  1D0E A;  1FHT A;  1RI7 A;  2IAJ A;  2RF2 B;  2NQP A;  3EZU A;  3MWB A;  4YY3 J;  4L73 A;  2FQQ B;  3UE2 A;  3H0P A;  2Z4P A;  4OYM A;  5F9N A;  2IC3 B;  4AUK A;  4IR9 A;  2OGU A;  5A6P A;  4ZHR A;  1YX2 A;  2HPU A;  4ZN1 A;  3M9O B;  2ZH9 A;  4CO4 A;  5F8N A;  1SJR A;  4PG6 A;  2V0N A;  1YHQ S;  1QJH A;  1WF0 A;  1UFL A;  2HAF A;  2J6S A;  3A8J A;  2A10 A;  1FJC A;  2YWK A;  3PEH A;  4I7F B;  1N33 F;  3SEO A;  1RLD A;  1TUW A;  2VH7 A;  2DNY A;  4X4N A;  2K1R B;  2RDD A;  3WHI A;  3DRR A;  1WNE A;  3G6X A;  2ZEJ A;  2GA7 A;  2DO4 A;  2MLZ A;  3MMB B;  2X1G A;  4FBT A;  4FF4 A;  2JVR A;  5B0D A;  1U26 A;  1GXT A;  3KK3 A;  2R7R A;  4K4X A;  2GJI A;  3DLJ A;  1TAQ A;  3H98 A;  1NME B;  5FLX U;  3CXC R;  3ITH A;  3LAL A;  3W7B A;  1JNR B;  1DTQ B;  4ECS A;  1RAB B;  2RKI B;  3NNH A;  4NXM J;  3GU0 A;  1ROF A;  2PI5 A;  3AB2 B;  3B54 A;  4R5P B;  1MU2 B;  1S1U B;  4ED2 A;  4PXB A;  1M5O C;  1KWM A;  3CIZ A;  3H20 A;  4M5G A;  3NGD A;  4XTT A;  5F8J A;  1FE0 A;  2V8D A;  5K8P A;  4USI A;  1NLK L;  1YJR A;  1LW2 B;  1NH7 A;  3CSK A;  3QBC A;  1HYS B;  4LBP A;  4GKJ F;  3OR2 B;  2MZR A;  4YUD A;  1RT7 B;  2GQQ A;  3B78 A;  2VQF J;  4OFZ A;  3MD3 A;  4OJH A;  1PJ5 A;  2D3O 1;  3WDO A;  3W3S A;  5A0Y A;  2GJ2 A;  2Z8Q A;  2ZBI A;  4MT1 A;  2C2Z B;  1EZZ B;  3L7P A;  1FA0 A;  1A7G E;  5B0C A;  4FF3 A;  3DC2 A;  2QL7 B;  3BSA A;  4I2Q A;  4IOB A;  1C1C B;  4G1P A;  2DIT A;  4JYA J;  2CZ4 A;  1AT1 B;  2EBG A;  2YWH A;  4WPA A;  2PI4 A;  5IOL A;  3DYA B;  1RT1 A;  1SC4 B;  5KG1 A;  2KFN A;  3D0I E;  2KKH A;  1V3R A;  3C6U B;  2YPZ A;  3H90 A;  2C3P A;  3P6Y C;  1AXQ A;  1S12 A;  4I6Y A;  5A8W B;  3JSB A;  3C6T A;  2DIV A;  4RNO A;  4IG0 B;  1WSR A;  4OZJ A;  4M5N A;  3RJM B;  1DQA A;  2C3M A;  2IAJ B;  3VQS A;  4CLW A;  2EI5 A;  1FK9 B;  3OVB A;  4WTO B;  3EPI A;  2FVS A;  3ZZ0 A;  3EVW A;  3JTN A;  2EPI A;  4Q7A A;  2QA4 S;  1HD0 A;  2XQC A;  4C3L A;  2YQ3 A;  1FFW B;  3KHH A;  4NLW A;  2HEK A;  4X4R A;  4E8U A;  2NUH A;  3M6U A;  4DCO B;  4CLP A;  4MMO A;  2BE7 D;  4DSL A;  1WG4 A;  4OHV A;  1BGX T;  3C16 A;  3NWR A;  1KFS A;  1S48 A;  1Q86 T;  4OYZ A;  1PJ7 A;  4WBF A;  1WJ9 A;  2E9Z A;  4L74 A;  2OH2 A;  4NML A;  3NBP A;  3PYF A;  2V4J B;  2YH0 A;  4DR3 J;  3FC9 A;  2EKN A;  2OFG X;  4DX7 A;  5F8L A;  3HT0 A;  2C3U A;  3E01 A;  4FF1 A;  1HWJ A;  4F8R A;  2HVD A;  3MCS A;  3H5X A;  1EIY B;  2MY8 A;  2MKK A;  4EFA C;  1DBD A;  2MSS A;  2Q6B A;  3S6E A;  1IXK A;  3OBI A;  4N5S A;  4DU8 A;  1NDC A;  2CXE A;  1WEY A;  4PZV A;  4FYW B;  1I5O B;  3U27 A;  4F0M A;  2DBB A;  4KFB A;  5CYQ A;  2ZDP A;  2YNF A;  1TK8 A;  2YQ1 A;  3OXF A;  2OD4 A;  3ZTR A;  4K4Y A;  1FX4 A;  2ZDO A;  2XLI A;  3A1Y G;  4EZ9 A;  4IH6 A;  2ZH8 A;  4NPO A;  2ZBC A;  1YQH A;  2GC8 A;  2HK3 A;  5DGA A;  2ERR A;  2MLX A;  4RU2 A;  2D69 A;  3N28 A;  1TKD A;  1FFG B;  1JLQ A;  4K4Z A;  2UU9 J;  5FDL A;  4LR8 A;  2QL9 B;  2XZD B;  3J7A 1;  4OZ5 A;  5DQG A;  1ZPW X;  5B0G A;  5GAG U;  3BGL A;  1NO8 A;  1KNZ A;  3K7R A;  1HWI A;  2ALY B;  3M2V A;  3DMJ A;  1V3S A;  4Y34 A;  2HLT A;  2X51 A;  5F8H A;  3FSI A;  4QR0 A;  2PN6 A;  4RW9 B;  4P72 A;  3MEE B;  3Q0A A;  5D4P A;  3LWL A;  1ZET A;  3WIV A;  2BQR A;  3DGV A;  4DV2 F;  2JX2 A;  2XZT B;  1QVF R;  2CG8 A;  3CDW A;  3GV7 B;  1MWY A;  2XY5 A;  1Y0H A;  1X4B A;  1CPZ A;  2VOD A;  1WHV A;  2MQM A;  4ECU A;  1U6B A;  4K2J A;  2B8Q A;  2YKN A;  1Y3J A;  2RDI A;  3OFE A;  5HMY A;  4C11 A;  4YME A;  3M2U A;  4NI2 A;  2VBW A;  1UET A;  4NYZ A;  3IG1 A;  5DO2 A;  1FFS B;  1RCX B;  4P7T A;  5D4N A;  5BXI A;  2G0J A;  3T1H F;  1QE1 A;  1N33 J;  1PBU A;  4ES2 A;  2GMH A;  4A8K A;  1KBR A;  2PSZ A;  3QMQ A;  1J5E F;  3S01 A;  4TKT A;  3R7B B;  3E8O A;  2RT3 A;  2HNZ B;  3GJQ B;  2V6A A;  3EE3 A;  2MGZ B;  2LKZ A;  3P5T L;  5K8N A;  5DJB A;  3H25 A;  3A8I A;  3FFI A;  2R7S A;  2R8G A;  1ZM9 A;  1YBT A;  1MNE A;  3CUL A;  4ITS A;  3KUH A;  2XI3 A;  2NYH A;  3VF0 B;  1SL0 A;  2YVS A;  1S49 A;  3V5R A;  2V50 A;  3L95 X;  4NA2 A;  3Q24 A;  2I5J A;  3CWJ A;  3LTO A;  3NBP B;  5A6W A;  3DDN A;  3MAA A;  4KO0 B;  4FYX B;  3C2P A;  4J9P A;  1Q82 T;  1B0V A;  3E01 B;  2IM1 A;  2CPF A;  2ALZ A;  1TL3 B;  3I0S A;  1JLF B;  4ETX A;  1F3V A;  2R7W A;  4ZDN A;  2YWG A;  2QYC A;  1U24 A;  2KB2 A;  1SH3 A;  3CCM S;  4JI3 F;  5K14 B;  2MB0 B;  1H3D A;  1WKL A;  1R43 A;  4K5R A;  5CYQ B;  2BAB A;  2YNF B;  1XMO J;  4DN0 A;  3IBW A;  2I9S A;  4X4S A;  2DEI A;  2W8L A;  3RR8 A;  3I6P A;  4RWW A;  4DLG A;  2DNM A;  5BYR A;  4O4G A;  2AYE A;  4JV0 A;  5A8K A;  3CC4 S;  2PO4 A;  1YLX A;  1FKA F;  4RNH A;  3Q89 A;  4QWD A;  5L9N A;  1SV5 A;  2XS2 A;  3VR1 A;  3D5M A;  1T8E A;  2L9N A;  4JI8 F;  3AH6 A;  3JSY A;  5LM7 E;  4DEZ A;  1QDU B;  1NZ8 A;  2DH9 A;  1RWK B;  4LSL A;  3FKB A;  3IWN C;  4UY8 5;  2GGP A;  3GYN A;  1WC4 A;  4OJ3 A;  4KGV B;  1V5V A;  3NKY A;  4U96 A;  5HMZ A;  2BJ1 A;  2QSF A;  5B09 A;  1UAW A;  2DGW A;  1GX6 A;  2GNK A;  1WWH A;  3AD7 C;  3SFU A;  1TVR A;  1WTB A;  3QRP A;  3M7V A;  3PW5 A;  1RB0 A;  5THW A;  3H42 A;  1BHN A;  1OSD A;  1PGZ A;  2P9G A;  1IJF B;  5KTQ A;  3MM7 B;  2MQL A;  1WEX A;  4N7T A;  4RU9 A;  3BKU A;  2AP6 A;  4C11 B;  4LRD A;  3D0G E;  2R8I A;  3SV3 A;  2LLZ A;  2F8E X;  2UUB F;  1SC1 B;  3IG1 B;  2BW7 A;  2Y3Y A;  4P7V A;  4EMD A;  3K5L A;  3ISN C;  4ILM A;  1Y10 A;  1TQL A;  2F9J A;  3HM9 A;  1PSD A;  5IC6 B;  2KM8 C;  2W9B B;  4KGM A;  4QWB A;  3CDE A;  1D3W A;  1QSS A;  1L3K A;  3EM1 A;  4KC5 A;  3FFI B;  1R7I A;  4IH7 A;  2R7T A;  4HL9 A;  4KB7 A;  3AJ1 A;  2FY1 A;  4C0B A;  3DGP A;  1QTM A;  2RQ4 A;  2B9Y A;  2OPS A;  2UUW A;  4F4X A;  1R31 A;  2VPW B;  3KLE A;  2HRY A;  1WOP A;  1HI1 A;  3MAA B;  3M8Z A;  4YDD B;  4XPE A;  2N4C A;  5C25 A;  3LPY A;  3IWX A;  4ZN3 A;  3PX0 A;  4NLG A;  4N77 A;  4NLY A;  4MKA A;  1XR7 A;  4G3I A;  1ZM3 A;  2JOQ A;  2FDN A;  3BBF A;  1H2U X;  1TKX B;  3KNG A;  1NJZ A;  1GT8 A;  1X5S A;  1VQP S;  3HHE A;  1GMU A;  3RAM A;  3FZB A;  1Q8K A;  2BX6 A;  4L6V 3;  4ZVG A;  1HWU A;  1NK9 A;  1JK9 B;  3VHQ A;  4O4G B;  1H72 C;  2ZKT A;  3GTY X;  1H74 A;  4ED0 A;  2CA9 A;  3A3N B;  3K58 A;  2YBV A;  3EGW B;  5IV3 A;  3U1M A;  4ED7 A;  3KHR A;  3GON A;  4DV2 J;  1X4E A;  2M5Y A;  3KXD A;  3MFH A;  4CLF A;  3UW1 A;  3D6F B;  3JQK A;  3OL8 A;  5KG7 A;  3ENQ A;  4J9N A;  3KJV A;  3CMA S;  4R0J A;  1NKC A;  1QAX A;  4KE5 A;  2OLW A;  4X62 J;  1OSC A;  1SL1 A;  2AEF A;  2DXD A;  2ADB A;  2B3T B;  3UN3 A;  2BJ9 A;  5CYJ A;  3H4B A;  4QIG A;  3T1H J;  1VIS A;  3FQK A;  4ILR A;  4NZ0 A;  3SDE B;  4TNO A;  2BJ7 A;  1EX8 A;  1LWX A;  2CNN B;  1J5E J;  2LP4 A;  4Q0B A;  4XO0 A;  4K7Q A;  2ZM6 F;  1L3S A;  3NGR A;  2FJX A;  4NLO A;  5DDQ C;  2HG4 A;  5GME A;  3V4I A;  4B3R F;  1UWA A;  5J1E A;  1JQG A;  2YWE A;  4IRK A;  3W60 A;  1URR A;  3P5B P;  5KG5 A;  3QJP A;  2B56 A;  2D7S A;  2GJF A;  2YNI A;  2MZS A;  2VZ9 A;  4CZC A;  3NY0 A;  4DI6 A;  1OJ4 A;  3Q8R B;  2RU9 A;  2M8D B;  3PZP A;  1VQS A;  1B7F A;  3G6E S;  2MQQ A;  2RQC A;  4ZJO A;  4AE5 A;  1I6J A;  2IDE A;  2FVP A;  2R9L A;  2R7U A;  2QFI A;  5KFR A;  2UUC F;  3EXC X;  1AUD A;  5KFA A;  3VAK A;  3K59 A;  4DSE A;  3E51 A;  1PG5 B;  1XN9 A;  3DGP B;  4DPU A;  1GK8 A;  3UCG A;  4JI3 J;  4EZ6 A;  3TAM A;  1IKV B;  2KG1 A;  2COL A;  3KLE B;  2Z2M A;  2MQ8 A;  1ZZN A;  2IVF B;  1Y5L B;  3MTJ A;  2ZE2 B;  4DS5 A;  2CPY A;  2GZO A;  3FEZ A;  2VBZ A;  5C25 B;  1DJ0 A;  4MTP A;  2HZA A;  5J2P A;  3R5B A;  2V9K A;  5SUH A;  4HAC A;  3V6J A;  2OPP A;  4DCP B;  3CNQ P;  5EHH A;  5DLG A;  1H98 A;  4NCG B;  1RAD B;  2OTJ S;  2HK2 A;  5E5N A;  1DTT B;  3IM8 A;  4USK A;  2JFD A;  3J7Y U;  1X9M A;  1RTH B;  2CVI A;  1YZ7 A;  3MF5 A;  4C97 A;  3UDL A;  4JI7 F;  2BW2 A;  2G0C A;  5IT4 A;  3CJQ A;  2VG6 A;  4IQM A;  1YGY A;  1TL1 B;  3N6M A;  2GHW A;  2KL8 A;  3MXH P;  3TUJ C;  2X1B A;  3LW5 C;  1VCT A;  3Q8P B;  2MKJ A;  1O0P A;  3VGT A;  4XAK A;  2YKM A;  3OTE A;  2DIS A;  5KFH A;  3HFK A;  4X84 A;  3QO9 A;  1TMJ A;  3BGR A;  4ID8 A;  4ZLJ A;  5JMN A;  3IBF B;  5KG2 A;  2UUB J;  4ED1 A;  3T5H A;  4N76 A;  2VG5 A;  1UW4 A;  3PTW A;  4A8O A;  1N34 F;  4QR1 A;  3DCA A;  3GE9 A;  2HWI A;  4LF6 J;  1RTJ A;  4L3N A;  4YB5 A;  3EDR B;  1K73 T;  5F0U A;  2F8M A;  2IM0 A;  2AJQ A;  4U8V A;  2FJW A;  1TKT A;  4HTJ A;  1D8Y A;  3DKD A;  2MKI A;  4PYA A;  3PR5 B;  1TUV A;  2HYI B;  4N41 A;  4USU A;  2LDI A;  3DRS A;  3BKF A;  2CAJ A;  2V63 A;  2QA2 A;  2OIH A;  2EEY A;  4RW4 B;  5A76 A;  2OJ3 A;  2IYI A;  1SJQ A;  2DY9 A;  1RHK B;  2PC6 A;  4B9U A;  4FYD A;  1B4S A;  1FJ7 A;  1SC6 A;  3D1O A;  3UR0 A;  2V5H G;  1SIW B;  2C28 A;  1HNI A;  4LQ9 A;  2QLW A;  2UVR A;  3PG9 A;  5KG3 A;  2JDJ A;  1Q4R A;  1U2F A;  4EBE A;  4OZ0 A;  3N0V A;  1T03 A;  2WRM A;  4DZD A;  4J9R A;  3CJ4 A;  4UZB A;  1JLE A;  5JVG Q;  1RLC L;  2QA1 A;  1S6O A;  4X4O A;  4G1Q B;  5DM7 Q;  2GO9 A;  4DUT A;  2LDY A;  5J1P A;  4DL0 C;  1NK7 A;  1SJ1 A;  2HNY A;  1XMB A;  2AWZ A;  2CJX B;  3BO4 A;  3DRP A;  3GMG A;  4H4O A;  4TN2 A;  5DG7 A;  1PC5 A;  3NCR A;  2XMK A;  4IFV A;  4KKO B;  4RNN A;  1CUL A;  1T9W A;  1JXE A;  2AGP A;  3R1L A;  4MKV A;  2YNG A;  2IJF A;  4DV4 F;  2OPP B;  3WZ0 A;  2Y8W A;  3TI0 A;  4DV5 F;  2WBM A;  2Y9H A;  3H40 A;  3W2V A;  2OEK A;  2XY7 A;  1HMV A;  3AQP A;  2Z2Y B;  1U6F A;  2EK1 A;  4CIO A;  3EJM A;  3W64 A;  3M8P A;  1ZOT A;  4JUZ A;  2HFU A;  4XDC A;  4U9R A;  2ZJQ Q;  1LFW A;  1YWX A;  1U4B A;  3J80 U;  1VQK S;  3THP A;  4WK1 A;  4FDF A;  2IBK A;  3W9H A;  4NLP A;  3Q83 A;  3T1Y F;  5HAO A;  3FMW A;  1HNV A;  3UO0 A;  5CQG A;  2C2D A;  4DQS A;  2YKM B;  4NXN F;  2Y0B B;  2ZM6 J;  3OPK A;  3RB3 A;  5K8O A;  4CLU A;  3QO9 B;  4MH8 A;  1VC6 A;  2CG4 A;  2ZOF A;  1H6K X;  3BGR B;  1QD1 A;  2G4B A;  2RUS A;  3BO3 A;  2RRA A;  5L1L A;  2IMW P;  4B3R J;  2MQO A;  3UN2 A;  3KLG A;  3P8B B;  1RBA A;  2BQU A;  2X3G A;  2EC2 A;  2Z0G A;  3JSM A;  3LP2 B;  2BDP A;  4KPC A;  3TAP A;  1NRK A;  2QL5 B;  5KFP A;  5CHC B;  2XWY A;  1L3T A;  1SQF A;  3NAH A;  4C3M A;  1YJV A;  1GAO A;  2IY5 B;  1TKT B;  4DR4 F;  3OTO F;  4B9V A;  3KJQ B;  1RT3 B;  1WEZ A;  3KWM A;  3CJ0 A;  2J0Q D;  2MKH A;  3HCX A;  4U95 A;  4EK2 A;  4N8N A;  3PFE A;  4DWI A;  4ZPC A;  4H4K A;  2UUC J;  3PRV A;  2MDA A;  3MGJ A;  3OL7 A;  3M6W A;  2Q1L A;  2LMI A;  4O3O A;  2NCK L;  4USW A;  2E7V A;  4Q5V A;  2QG9 B;  3DFE A;  1HNZ F;  5HJY A;  2EVZ A;  2OPQ B;  1UVL A;  1HNI B;  3HF5 A;  2HLU A;  2UUA F;  1YZ6 A;  2WOM B;  1PKU A;  2PII A;  2DD8 S;  4CQ1 A;  1UWB A;  4ZVH A;  2DGS A;  1B7Y B;  2V2Z A;  1NK5 A;  3AD9 C;  3NGT A;  1JMT A;  4I56 A;  4UQT A;  3HJF A;  4ZJQ A;  5KFT A;  4OHZ A;  3MPU B;  3G6Y A;  2HNY B;  2ZZT A;  4C4W A;  1S6Q A;  5IWA F;  4Z7Y A;  3ZTP A;  1Y11 A;  1CC7 A;  3DRP B;  2V68 A;  4H4O B;  1N4L A;  3PY8 A;  2W01 A;  3D28 A;  4ECZ A;  5HP1 A;  4LR7 A;  2FIU A;  2QRR A;  2HIY A;  2WW4 A;  2U2F A;  4IFV B;  3MMC A;  3GIL A;  1APS A;  1HW9 A;  1X0P A;  4EYH B;  2XCP A;  2YNH B;  2CNK B;  2WB4 A;  4X4V A;  2XB2 D;  2GQC A;  1SKW A;  2H5E A;  2P6S A;  1NKE A;  4ID5 A;  5L1K A;  4CO2 A;  2BOP A;  1NK0 A;  1YJU A;  3B4D A;  2R2S A;  2KFY A;  1MSW D;  1YBU A;  1P9Y A;  3QRQ A;  5KAK A;  1S72 S;  3PW4 A;  1VBK A;  4USM A;  1ZTW A;  2R2R A;  1HNW F;  2B0G A;  4G1I A;  1B0T A;  4J9K A;  1RAG B;  1WG1 A;  3OLA A;  1VFJ A;  2BJE A;  3PRB A;  4H54 A;  2RH3 A;  1WOS A;  3ETM A;  5E3Q A;  3VWS A;  2CQG A;  1N34 J;  4DPY A;  4UZC A;  5IFM A;  5EN1 A;  1RAH B;  3ILI A;  5KT6 A;  1TU0 B;  2Y1L B;  4K2X A;  3CUN A;  2EFP A;  4JI5 J;  3CJT A;  3RAQ A;  4J90 A;  4WP9 A;  3RB4 A;  1I94 F;  3V4M A;  2M3D A;  2RIJ A;  2OKQ A;  1IKY B;  1X9W A;  1R0A A;  1RAO A;  4NLR A;  3Q8Q B;  3UVJ B;  5AE2 A;  2E5L F;  2JEF A;  2CPJ A;  4TYA A;  4D3G A;  2LQ8 A;  3Q22 A;  2JEJ A;  3V81 A;  2CQ3 A;  4DLE A;  7FDR A;  3HKW A;  4PKD B;  2B51 A;  4IQX A;  1OS5 A;  3J81 U;  4ZCL A;  3U1N A;  1OY9 A;  2WCX A;  3QGP A;  3D6T B;  3CDB A;  5B08 A;  1VHI A;  2Q79 A;  2XNR A;  4FPI A;  2ZH1 A;  1UVJ A;  5IQ6 A;  1HBM A;  3PW7 A;  5L9X A;  3PYG A;  2D41 A;  4A4J A;  2HUR A;  1LWC A;  2MPU A;  2ZZM A;  3Q2T C;  1V5I B;  3GCX P;  3TUP A;  3BO2 A;  4PR6 A;  3RZA A;  3NLC A;  2E9T A;  3M4X A;  3J7Z 5;  1B99 A;  2RHQ B;  1VK3 A;  3NGK A;  4N56 A;  3HSD A;  2VF3 A;  1XBW A;  4WYL A;  3TUZ C;  2YWW A;  5D0H A;  3F0N A;  2RHS B;  3VGV A;  4Y65 A;  1OYD A;  4JBC A;  2R7Q A;  4TVA B;  2KHC A;  3TNV A;  1UWB B;  3HHK A;  1EAY C;  3TAR A;  6FD1 A;  1NDL A;  4DV4 J;  5HQM A;  5G4D A;  4BWJ A;  2HVI A;  1F3F A;  2ADC A;  1RK8 A;  4M1K A;  4DV5 J;  2R8K A;  2MLY A;  1M5K C;  1FX2 A;  2I2Y A;  4GC6 A;  1V6H A;  3KFW X;  3R6L B;  1OQ6 A;  2QJ3 A;  3RBD A;  2WK4 A;  3F41 A;  1S6Q B;  3GG0 A;  3TWZ A;  3OXG A;  4CH1 A;  3ET6 B;  4B3O A;  3MMC B;  3M05 A;  1ARO P;  5CZV A;  1S9G B;  2J9C A;  4C0H A;  2V8G A;  2XNQ A;  1D9F A;  1HWL A;  2ZHB A;  5KFE A;  4ECV A;  3JB9 k;  4I69 A;  4A48 A;  4DQP A;  2VV5 A;  3T1Y J;  1U48 A;  2V34 A;  3N5F A;  1TK5 A;  2DNH A;  3HK2 A;  1PJ6 A;  2LEA A;  4X4Q A;  1F0X A;  1S1X A;  1S5Z A;  4LMZ A;  3M8Q B;  1NSK L;  3BGU A;  4DV7 F;  4D3H A;  2WON A;  2HZC A;  3FCV A;  2DHG A;  1BQX A;  2NS1 B;  1WKJ A;  1UEK A;  2VPY B;  1YTY A;  4OHX A;  2YX4 A;  1RZM A;  2KI2 A;  1EB0 A;  2D3Z A;  2LA6 A;  3CJR A;  3B82 A;  2NUU G;  2G2Z A;  4PAB A;  1JLG B;  3L4B C;  3GZ7 A;  3OUY A;  4IO9 Q;  1T05 A;  2EW9 A;  4DR4 J;  1U0H B;  3OTO J;  2HGN A;  1N5Y A;  2DGO A;  2LYV A;  4FKY A;  1D9D A;  2HHP A;  1OPI A;  2PEH A;  2CJ9 A;  2HVE A;  3IFE A;  1LKZ A;  3ZXW A;  2VBX A;  5KFY A;  5D0R A;  2MZ1 A;  4UUX A;  2WSC C;  3CCU S;  3BJY A;  2HHV A;  4XDD A;  2OPR A;  4KPY A;  3HD2 A;  1XJW B;  4KV8 B;  1L5U A;  3T1A A;  1KKH A;  1SCJ B;  2HMI A;  4OYB A;  2WZ1 A;  2NSC A;  2FPH X;  2KYX A;  4BCA A;  1HQU B;  3CCW A;  3GIM A;  1TL5 A;  5KG0 A;  3QZ8 A;  1RCO B;  4LFA F;  1IBM F;  2KXH A;  1FRJ A;  3NNA A;  5ETL A;  3JS9 A;  3FK4 A;  2R8J A;  4ZVS B;  1K8A T;  3IRW P;  1G3O A;  1KSP A;  5IT9 Y;  2VG7 A;  4UST A;  3KMS A;  8ATC B;  1VHF A;  2QEX S;  2GIF A;  3H2V E;  1U1K A;  4KGZ B;  1KVJ A;  2DNK A;  2PGC A;  4TYB A;  3BS9 A;  1HQE B;  3M1V B;  2K3K A;  2NLW A;  3RRG A;  4QYR A;  2IHR 1;  2Z58 B;  1E6Y A;  5IWA J;  4IH5 A;  3MM5 A;  3RTV A;  4WE1 B;  3IGN A;  3QGG A;  5T41 A;  4LF1 A;  1YJN S;  2Z30 B;  4R8U A;  4W90 B;  2OAU A;  1IR1 A;  1UJ4 A;  3TQ1 A;  3DDK A;  3VAF A;  4ER8 A;  1RAI B;  4ZP9 A;  1KRP A;  1UPP A;  2N4D A;  1FXD A;  2BAN A;  3AB4 B;  4CLT A;  1HBU A;  3SYZ A;  4I6W A;  2AT1 B;  1T02 A;  2NPF A;  1RUS A;  5HVH A;  4B3S F;  3CC2 S;  4U7U D;  3E2E A;  4WU3 A;  4FYY B;  1JLA B;  3A3P B;  2HND B;  3GYG A;  4XK8 C;  1KVK A;  4GVL A;  1HNW J;  1K0T A;  3R97 A;  1NND A;  4JV5 F;  2BA9 A;  2K3I A;  2AMC B;  3LO3 A;  3HHL A;  4O4R A;  3LOU A;  2D3O R;  1RU1 A;  5KFM A;  4ZVE A;  1N5S A;  1N6Q A;  1BWV A;  4HH0 A;  1VQ6 S;  1V3Z A;  4OLP A;  3PJX A;  5LMU J;  4URG A;  2WON B;  3CCV S;  2VIH A;  2NYI A;  3EVM A;  1CEZ A;  1YRU A;  2DPJ A;  5M2P A;  3EYZ A;  4I1T A;  4F67 A;  2E5L J;  1ZA2 B;  1U1M A;  5KFG A;  1XMQ F;  3EUN A;  2BAC A;  1J2V A;  2R8H A;  2PMZ D;  3PX4 A;  1KHV A;  2M0G B;  4IO1 A;  1RTZ A;  1MWQ A;  2FHJ A;  3OJS A;  3AQO A;  3FEY B;  3FGV A;  1EQ0 A;  1VGY A;  4F3O A;  2UVW A;  1IKW A;  1WHX A;  2CWK A;  5GAH U;  4M5L A;  4HHJ A;  4RW8 B;  2DHS A;  1GEH A;  1HHQ A;  1EHW A;  3MR3 A;  2E1R A;  3GIK A;  2OPR B;  2GFF A;  3UI3 A;  1W2I A;  4M5K A;  1H7W A;  4DQR A;  5HQL A;  2MQP A;  4ZOS A;  1SUQ B;  2R4F A;  1S10 A;  2P8I A;  2YY3 A;  3F44 A;  3HHN B;  4B08 A;  5KFC A;  4OYI A;  3HVT A;  2E66 A;  2W1B A;  3Q8Y A;  1HI8 A;  4O23 A;  2IPO B;  2FLL A;  1FD8 A;  2M70 A;  4J7C A;  1WF1 A;  4RPF A;  4HVZ A;  3DLG B;  4OIX A;  1Y4Z B;  3WX8 A;  3CJ5 A;  3BEG B;  1AZS B;  3CCZ A;  5E3R A;  4K5S A;  4DV0 F;  3G8Q A;  1N5V A;  3TVK A;  2J7W A;  3MM6 A;  2R42 A;  5SZT A;  3HI9 A;  3C8Y A;  1EP4 B;  3UD4 P;  2KT5 A;  2GIQ A;  2IRU A;  3G86 A;  5L38 A;  4M5D A;  4EWT A;  3FCW A;  1NKB A;  5H9F K;  3ONQ A;  3MR6 A;  1PBA A;  2BJD A;  1S6U A;  3B4M A;  3LWM A;  1R3N A;  1VK8 A;  4F04 B;  2FZC B;  2WW8 A;  4PYD A;  1U1O A;  2C2E A;  5DET A;  4P52 A;  4O3Q A;  3I0R A;  3GR1 A;  4FF2 A;  2BAN B;  4F25 A;  2JVO A;  1HBU B;  1CJU A;  4F3Q A;  2W24 A;  1RTI A;  1JJ2 R;  4OI3 A;  2Z56 B;  4S0M A;  4LF8 F;  1RYS A;  1S1T A;  4NYO A;  4DV7 J;  2GHV C;  1N5T A;  4HEA 9;  2CQ2 A;  3E3X A;  2HGM A;  3NGU A;  5E3P A;  3UN5 A;  2JEG A;  1N88 A;  3I4P A;  4F02 A;  2CRL A;  9RUB A;  1R6Y A;  4F0H A;  3KUG A;  2OML A;  3HHL B;  4FXW A;  5C42 A;  5DDR C;  4ZVP B;  2UXC F;  3IAM 9;  2AX1 A;  1KLN A;  3CJK B;  1HNX F;  2QLX A;  1JWW A;  3NL0 A;  2DNN A;  1P9Q C;  4NE9 C;  2ACY A;  1CJK A;  3DM2 B;  3K5M A;  1M5V C;  1S1W B;  4DQQ A;  4NLD A;  2Y8Y A;  2XGQ A;  4IDK A;  4UY8 T;  2BVZ A;  4U7U K;  5DDP C;  3P4U B;  2WSF C;  4RUH A;  3MR7 A;  2VOO A;  2I38 A;  2DNL A;  2BKN A;  1M5P C;  2BE9 B;  4KYZ A;  5HLF B;  4CO0 A;  5CZX A;  3F56 A;  1FRL A;  2DY1 A;  4IRD A;  2ZWO A;  4J37 A;  4LSN A;  4NOH A;  4NXM F;  1S0N A;  4LFA J;  3GFH A;  1IBM J;  3TJ8 A;  5D3G A;  4IR1 A;  4OZL A;  4LRB A;  3H59 A;  4DX8 H;  3W1Y C;  3GFZ A;  1KEK A;  3NG8 A;  4IOC Q;  2WTF A;  3ZZR A;  4M8L A;  3TJA A;  4ZIT A;  2J6U A;  3S1T A;  3HJV A;  3GSD A;  3CCQ S;  2D9O A;  2ASL A;  2E5I A;  2Y1R I;  1TR0 A;  4B9L A;  1UPM B;  3GFX A;  1H0H B;  2OUG A;  2QLF B;  2X1F A;  3G4S S;  3CJS A;  2DR5 A;  1NM2 A;  2LVW A;  3H8Y A;  2JNJ A;  2RUG A;  3MEC B;  2ZUA A;  3HVT B;  2ACM A;  1BXN A;  4P73 A;  2AX0 A;  5JJB A;  3JQM A;  3D68 A;  1N32 J;  5ETP A;  3OFF A;  3SIP B;  1GXL A;  3CD5 A;  1F2H A;  4P75 A;  2UVV A;  4J9Q A;  3MM6 B;  4B3S J;  4JYA F;  2D74 B;  2IC3 A;  3H2L A;  4DL4 A;  5CD4 A;  3BPS P;  4M5D B;  4JI0 F;  4DL6 A;  1MRO A;  3GCW P;  2HFS A;  2JLE A;  2H65 B;  1RWV B;  4ZIW A;  4L75 A;  1YSJ A;  4JV5 J;  2ZNZ A;  3W9I A;  2JSX A;  3RGI A;  4F3M A;  2NR0 A;  2YKQ A;  3D4J A;  4C8Z A;  1U8S A;  2KDO A;  3SXL A;  1U45 A;  1PIE A;  4WJB A;  3C3L A;  2HBZ B;  1CJU B;  2DTJ A;  3MI7 X;  5I3P A;  1RTI B;  1FI4 A;  2DK2 A;  1K0V A;  3K2Y A;  2G1D A;  5CA5 A;  1X9S A;  3VV2 B;  3W63 A;  4UOC A;  2KJV A;  2V94 A;  2W9C B;  1JIH A;  3MMB A;  1RGV A;  2V4R A;  2KJW A;  2RB7 A;  1KFD A;  3LH2 S;  2H54 B;  1SH2 A;  5GAE I;  2J9D A;  3DXS X;  3T19 A;  3OVS A;  2VC1 A;  3A12 A;  3FNN A;  4UQG A;  1X5O A;  2ZVS A;  2CKW A;  1DHM A;  2OSQ A;  4G65 A;  1DAR A;  2OD6 A;  1DTQ A;  3Q2S C;  2RKI A;  3D54 A;  2XSF A;  1IM6 A;  4DR3 F;  3R27 A;  3FBE A;  1VS3 A;  2AZ3 A;  3DI6 B;  3T9Z A;  3TO8 A;  1M0S A;  3W5X A;  1MU2 A;  2HQ3 A;  3JQJ A;  4A8S A;  1S79 A;  1S1U A;  3Q86 A;  4DX6 A;  4OQJ A;  4IDK B;  5F9L A;  1UEU A;  3KLF A;  2OEL A;  4Y6I A;  4KAI A;  1E6V A;  1RHR B;  1X5P A;  4YB1 P;  2VFV A;  2XMV A;  1HYS A;  2R7V A;  4CRJ A;  4AXI A;  4NA3 A;  4ATN A;  1RT7 A;  4FVC A;  1IVZ A;  4O3P A;  4J5O A;  3AOA A;  4LSN B;  4P10 A;  4F4Y A;  1HWK A;  4HR2 A;  2HFZ A;  2LXF A;  2RE1 A;  4C8N A;  3G2X A;  2UXB F;  2EWH A;  2C2N A;  5D3G B;  1NHK L;  4DPT A;  2CJK A;  5BYQ A;  1VMB A;  2HSE B;  1T9X A;  1N0V C;  4DUY F;  2KG0 A;  1UVM A;  2M88 A;  2HHW A;  1KQF B;  1WOR A;  4NZ7 A;  2ZHA A;  4DV0 J;  3QSY B;  2H4W B;  2UU9 F;  1C1C A;  4O44 B;  1RT2 B;  1JKH B;  1O8B A;  1TL7 B;  2G2O A;  3PIP Q;  4X64 J;  4TY8 B;  3TVY A;  2PMW A;  4W92 B;  3N9U C;  1XNQ J;  3W8P A;  2KFZ A;  4JP8 A;  3DHW C;  5ETR A;  2RML A;  3RG6 A;  8AT1 B;  2L48 A;  3IGV A;  4NLU A;  3ISN D;  4IG0 A;  3ENW A;  2AIR B;  2DRA A;  5F3T A;  4ECR A;  5KG4 A;  5AE1 A;  5DM6 Q;  2J8A A;  1WC0 A;  1FK9 A;  2F7V A;  2MYF A;  1S97 A;  3ZO7 A;  3FBC A;  3FBB A;  1VRT B;  3C14 A;  4LF8 J;  2HFO A;  4CLK A;  2GVZ A;  2KXF A;  1MRO B;  1HHT P;  2JZ5 A;  4Q44 A;  2DGQ A;  3RRK A;  3W2W B;  1SXL A;  3G82 B;  3OXL A;  3I96 A;  4QQB A;  2NXU A;  5IS2 A;  1B70 B;  1LNQ A;  1RP5 A;  1N36 F;  4UTG A;  4QPX A;  4F4A A;  3GV8 B;  4ANE A;  2E29 A;  4Q45 A;  2FB0 A;  2M2B A;  3DOM B;  4LFB F;  2UXC J;  1DQ8 A;  3ICL A;  4OHY A;  1HNX J;  4CT9 A;  4LVN P;  4LRA A;  3D2W A;  3TEG A;  4OYA A;  5A2Q U;  1CG2 A;  3D3C J;  4EU0 A;  1RKI A;  4CLS A;  2V4J A;  2AKW B;  4FZV A;  3IWL A;  3J81 j;  1WAC A;  2VAS A;  3QT6 A;  4P74 A;  1Q1K A;  2FHK A;  2MY7 A;  1R27 B;  2HQD A;  1MN7 A;  5BYS A;  2JWN A;  2DGV A;  1X7V A;  3G8T A;  2R3V A;  4AQY F;  1SJF A;  2V4Q A;  5LJ3 Y;  2ZKU A;  2BBE A;  2H5J B;  1OO0 B;  3NAI A;  2RNE A;  3SSQ A;  1ZA1 B;  4NCA A;  5HK4 A;  4QIV A;  3U02 A;  4JI2 J;  3ISZ A;  3M32 B;  2CPZ A;  2JLF A;  1BMQ B;  3N6L A;  2HHH F;  2BR0 A;  5H9E K;  2FLO A;  3BF4 A;  1FNM A;  2CPD A;  3U7J A;  2DH7 A;  4P2S A;  3IR5 B;  4J9S A;  1WDD A;  4OI6 A;  1TFW A;  3KLF B;  1ZTT A;  4OI0 A;  1E6V B;  2BEF A;  1YJT A;  2RD5 C;  1MWZ A;  1XTZ A;  1IQZ A;  4IG3 A;  2RVJ A;  3V6D B;  2F4F A;  3MM8 B;  1EKS A;  1FVQ A;  2ZH5 A;  1XMO F;  2J0S D;  2N3O A;  3PKY A;  2YKP A;  4B02 A;  2YKA A;  3Q8U A;  3AOC A;  3NRB A;  2CQI A;  1NK8 A;  1XR6 A;  3ULH A;  4ZPW R;  4RW9 A;  2O1P A;  3MEE A;  3MZI A;  1LWE B;  4HDG A;  3VTI A;  4LIR A;  4QU6 A;  1FWP A;  1URN A;  4CI0 B;  1UJ6 A;  1N48 A;  1FDA A;  1KDN A;  4JI0 J;  2FZK B;  2WBR A;  1C1B B;  2UP1 A;  3CCS S;  1LW0 B;  4NMX A;  3TZX A;  3JTO A;  2QN6 B;  4HKQ A;  1GH8 A;  4ZMM A;  3IM9 A;  1M1H A;  3UFC X;  1IUJ A;  3C14 B;  2XGP A;  2HNZ A;  1FKO A;  1YIJ S;  2GVZ B;  4YFU A;  2MGZ A;  2B5J A;  2O67 A;  3T5J A;  3I5C A;  3NS7 B;  4DV3 J;  1FJG F;  2AJF E;  4I4B A;  3O1L A;  3P96 A;  3A8E A;  2C2M B;  1RA7 A;  1BY9 A;  2DYA A;  2OI2 A;  1L3U A;  3QJJ A;  1VQ8 S;  3KG1 A;  2L3M A;  4YR3 A;  4HTI A;  2VFU A;  1P27 B;  1HAR A;  5M2U A;  3MMJ A;  3DDI A;  3BQ2 A;  2C1E B;  4MYT A;  4KO0 A;  3PEJ A;  3HKZ D;  3BBC A;  3QLH A;  5K9F A;  2CQ4 A;  1S0V A;  3HSZ A;  2AJ1 A;  4PXE A;  5KFQ A;  2HQC A;  1N0U A;  4KIA A;  1I3O B;  4JB8 B;  1TL3 A;  5H1S V;  4F4K A;  1KTQ A;  1JLF A;  1ZPV A;  4PWW A;  1RWW B;  4AL5 A;  5D4O A;  3NCQ A;  4C98 A;  2DNG A;  3LGH A;  3C15 B;  5EX3 A;  2YH1 A;  4DR2 F;  5K14 A;  2V8V A;  2Z2Z A;  1D09 B;  2MZQ A;  3M8Y A;  3I5B A;  4TQR A;  2CZV C;  3QIP B;  2HRT A;  3ENA A;  2UXB J;  3PNI A;  1HD1 A;  3FUY A;  5EX0 A;  5EGY A;  2AV5 A;  3CIM A;  1NPK A;  4LF7 J;  2N82 B;  1UJ5 A;  2B4O A;  1LK5 A;  4DUY J;  1YKW A;  4WK3 A;  4RNF A;  1AA1 B;  3DOK A;  3MPW A;  3SCL E;  2BUN A;  5CD4 H;  5DDO C;  3AA8 A;  1R6V A;  4ECY A;  3HZE A;  5I3U B;  1NUE A;  2DNQ A;  1QAY A;  2GCF A;  3GJS B;  2JLG A;  4IG3 B; 
#chains in the Genus database with same CATH homology
 4DV2 J;  1IBK J;  2MTL A;  2E5L J;  2ZM6 J;  4JI2 J;  2UXD J;  4LFC J;  4LF5 J;  4X66 J;  1I94 J;  4OX9 J;  4JI0 J;  4LF8 J;  1N33 J;  1FJG J;  1XNR J;  4NEY A;  2UU9 J;  4DR7 J;  4B3R J;  5BR8 J;  4RJV A;  4X62 J;  4YY3 J;  1N34 J;  3D3B J;  3T1Y J;  4JYA J;  5FLX U;  4PWW A;  1XMO J;  4AQY J;  4JI8 J;  4GKK J;  4DR3 J;  4KHP J;  4B3M J;  4LF9 J;  3R2C J;  4DV6 J;  3IMQ J;  4JI5 J;  2MEW A;  4NXM J;  4GKJ J;  4DR5 J;  2UXC J;  1N32 J;  2KL8 A;  3JAM U;  3T1H J;  5IT9 U;  1HNW J;  5LMN J;  4DV0 J;  1HNX J;  2HHH J;  4JI3 J;  1HR0 J;  4NEZ A;  1J5E J;  5A2Q U;  4JI4 J;  4KY3 A;  3D3C J;  1HNZ J;  2UXB J;  4B3S J;  4X64 J;  2MQ8 A;  4JI1 J;  3R2D J;  1IBL J;  4YHH J;  4NXN J;  3J7A N;  4KYZ A;  4DUZ J;  4LF7 J;  4DR1 J;  4DV4 J;  1N36 J;  5LM7 E;  2UUC J;  2UUA J;  3J80 U;  1XNQ J;  4DUY J;  1XMQ J;  4DV3 J;  2UUB J;  4X65 J;  4LF4 J;  2KVQ E;  4DV5 J;  5AJ3 J;  4K0K J;  4V1A k;  4LFA J;  4DV7 J;  4LFB J;  1IBM J;  4DR2 J;  5LMU J;  4JV5 J;  4DV1 J;  4DR4 J;  2F4V J;  4B3T J;  5IWA J;  3W1Y C;  3OTO J;  2VQF J;  4JI7 J;  3J81 U;  4LF6 J;  4DR6 J;  4JI6 J;  4HHU A;  2VQE J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...