2E29A

Solution structure of the guct domain from human atp-dependent rna helicase ddx50, dead box protein 50
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GSSGSSGFEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the GUCT domain from human RNA helicase II/Gubeta reveals the RRM fold, but implausible RNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DDX50
total genus 12
structure length 92
sequence length 92
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e29A01
2E29A 2M3DA
chains in the Genus database with same CATH superfamily
2CJYB 2QN6B 4DPWA 4KHPF 4Q0BB 3CMAS 2EEYA 2G2YA 3JAMU 2N3LA 3AY0A 3V4MA 4RZRA 1U45A 3KUHA 2ZBRA 1S57A 5IOLA 2C28A 1D1UA 2YBVA 3FUYA 2LCWA 3GPAA 1JWWA 2MB0B 3J7Z5 2AJ0A 3A12A 3NLCA 4W4MA 4O3OA 2LXUA 5ETOA 2OI2A 2LDYA 2OP5A 1SIWB 5HLFB 5ETMA 5KT3A 1VQ5S 2DH7A 2FHJA 4JP8A 3TANA 3T6JA 4QIEA 2I1RA 2RDIA 3TA2A 2LFVA 3H4BA 2O01C 1SV5A 1U25A 2UV8G 3W60A 1WJ9A 5GADI 2ZEJA 4QQBA 1KFDA 1R0CB 3R6LB 5LSLA 1U8WA 5HQ8A 2W01A 4O4RA 3DMJA 5HMYA 2FJVA 3B4MA 1NM2A 2V8PA 4RUHA 3OSPA 1B0TA 2NXUA 2VBWA 3FCWA 3I87A 2E7VA 1P8GA 3JS9A 3S6EA 4D3GA 7AT1B 3AFGA 1D09B 2XCAA 3CCSS 3CCQS 1N0VC 2KT2A 1V5VA 2DCUB 2GVZA 5D15A 3V81B 1LWCB 4ED0A 3G96A 3IR6B 3RU0A 4CLKA 3OXFA 4ED2A 5I3UB 3CCJS 3DGPA 3M30A 4J9MA 2HS0A 4DV1J 2M7SA 5L1KA 2PDAA 4ERDA 2X7IA 5HO4A 5KFHA 4TU7A 2DXEA 3M8SA 1RKJA 3L7PA 3F44A 4F50A 4OHYA 2OFHX 3GIJA 3LA0A 1Y3KA 4C6AA 4BS2A 1OQ6A 2QJ3A 3SSSA 2E44A 2V94A 2KN4A 1RWWB 5B08A 2M8DB 1V6HA 1EJ7L 2J7UA 2V34A 2Q43A 3IM8A 1XEZA 4BCAA 4R8UB 4J9LA 3RR8A 1IBLF 3NOCA 2JC0A 4EBCA 3HMJG 4Y2KA 2E29A 2QYCA 4DLGA 3W61A 2HWTA 2V8DA 1WEXA 2O3DA 1M1HA 3SDEA 1MN7A 3V6DA 4I6WA 3M9MB 1HNZJ 2OLWA 3C6TA 2JHEA 4QPXA 1E6YA 1F9EB 1CS4B 4NLPA 5DG8A 2DNZA 1NK5A 1F2GA 1PBAA 1WD6A 3QYYA 1AZSA 4PWWA 4C48A 4WTYA 5D0EA 4USIA 3V6JA 2RRBA 2JFDA 3EX7B 2DO4A 4EBDA 1B3TA 1RLCL 1KOHA 2LEPA 4M8LA 3VHQA 4DPOA 4UW2A 2AQ4A 2BJEA 3FEYB 5D4NA 2L9WA 2VH7A 2R7SA 4DZDA 1M5SA 2I5JB 4JI7J 1IR2A 2NUHA 1RDRA 5B0GA 3EYZA 1VFJA 4GMKA 3MAHA 4KV8B 2CVEA 3G8SA 1HNXJ 2GS8A 5C2CA 4LF9F 2IVMA 1XIQA 4P2XA 3A8EA 2LQ8A 4J9QA 2V69A 3K5MA 2ZZMA 4RUCA 1N0UA 4F4YA 4ZPCA 2B5JB 3H25A 1SKSA 1B7FA 4GO7X 5KT6A 1H2TZ 1EARA 3NNCA 1DY3A 4UT4A 1NSKL 1D3WA 2YWGA 3CSKA 4I7FA 4OV6A 4Q7AA 2BR0A 1UVKA 1LW0A 1YI2S 3BH7B 3E8OA 1OS5A 1RAIB 2YQ1A 4R25A 1J27A 4RW6A 4IDKB 3BGUA 2OMOA 2JLEA 3GSDA 1NHVA 1XK8A 2QRRA 3AQOA 3OTDA 3VALA 2A3JA 1BC6A 2ZZTA 3SBMA 2I0XA 1BQMA 2GJIA 3VTIA 3BGLA 3O6QA 3UDVA 2YQ3A 4HACB 4UQTA 3H5UA 3MM9A 2VOOA 4HKQA 1T11A 1YRUA 4I56A 1U6FA 2FUG9 2W2MP 3GV8B 4K4SA 1JJ4A 1YKWA 4EZ9A 1Q5VA 1S1XA 3RAMA 2YWEA 3RRHA 1M5PC 2VPWB 1GMVA 4L3KA 2FJWA 4WFBQ 4M95A 3ENAA 4ZPAA 3HVTA 1FWKA 4J9OA 3MZIA 1IKWA 3T5JA 3QRRA 4DX7A 1R0AA 4USUA 3CVKA 5DDRC 4LBIA 4MKBA 2W2QP 3D54A 3LAKA 2ZH8A 1PGZA 4OYAA 1VIOA 3CJ2A 1NBEB 2LP4A 3U27A 1TR0A 3KK2A 2W8LA 4CM2A 3NMAA 3ILOA 1DZ5A 1R8BA 5J2PB 4CO4A 4YR0A 1WTBA 2AKWB 2DGSA 4ANEA 3BM7A 2HMIB 2HAFA 2H5JB 3CCMS 5LMNF 3PRBA 2RAQA 4PABA 2ZBQA 2LQ9A 3N5FA 2ZHAA 5L9NA 2IA6A 4K50A 1R89A 1FJGJ 1IXKA 3MM8A 1R43A 1LWEA 2HRTA 4NMLA 5HJXA 1X9SA 2PGCA 1TUVA 3CJSA 3H2UB 5D4LA 3KLVA 3RBXA 3GB0A 4FKYA 3KWMA 2O66A 3EXCX 5DRKA 3DRSA 3IN5A 1ZH5A 3HHKA 3DRPA 5IV3A 1N5SA 2HAIA 4TQRA 4I69A 5KG1A 5L38A 5HVGA 1F9HA 1GX5A 1DAXA 3W63A 2MGZA 3A3NB 4E0DA 4ES2A 1RT6A 2VG5B 3R5GA 4DN0A 1K44A 2QSFA 3ZNJ1 1KD1T 2KJVA 2OJ3A 2XB2D 1F0XA 4FYWB 1N54B 2VBXA 4OX6A 2YXLA 2W9BB 2V6AA 1WC5A 4USWA 2HZCA 1X4DA 2CQ2A 1KVJA 1IR0A 4LREA 1IBCB 2V9KA 3FK4A 5C42A 2FGCA 1NXIA 2MTLA 3CJTA 4Q44A 4C8NA 2GQ2A 2QV6A 1R8HA 3ZTRA 4Q5VA 1TL4A 2XNRA 1UEVA 2RKIA 2XG8A 2IBOA 3EVMA 1RHKB 3V2UC 2IC3A 3R1LA 4F4XA 1T95A 2RF2A 5GVQA 1I94J 3AH6A 4CO3A 2DH9A 1LXJA 2R2UA 3GILA 2Y1LB 2XZTB 1SVDA 1T94A 3UR3C 4DR1J 4TQSA 4B3RF 1MN9A 2HIYA 2PA3A 2K06A 2RRNA 4NOHA 1PILA 2EFOA 4DU7A 1L3SA 4CO0A 4KC5A 2DXDA 1CG2A 3BYRA 1KBRA 3QO9B 1CJTA 1BWEA 1UFKA 4CLPA 3I32A 4DV7J 1YGYA 3B82A 1SL1A 4XAKA 1WHVA 1T9UA 4DU8A 3TQEA 2E1RA 4D3HA 5A8WB 4OJGA 3HHNB 3H8YA 1NB7A 3EGVA 4RBUA 2RE1A 2D41A 2GIQA 2ZOGA 1V5IB 4NA2A 4U95A 5BYSA 4ECVA 1VC0A 3G9CA 4KSEB 3HCXA 2QG9B 5KG0A 1RHJB 2X1AA 5KT5A 2YNHB 3CJRA 3C3LA 3PIOQ 1IQTA 2YX7A 3EGWB 1FD8A 3QLHB 3SIPB 1JLFA 2GMHA 3K7RA 4NLWA 2J6UA 2DIUA 3GIIA 3A13A 4FPRA 1T9VA 5F0WA 2UVUA 5F3TA 3C2PA 5KFZA 3A8JA 3MOJB 4C8KA 1RHMB 1KEKA 3GG1A 2IYGA 4HVZA 5AXLA 3W5YA 5HROB 1RAEB 4ZP6A 3ZFVA 1HQEA 3D9BA 1VJWA 2XMUA 1JLEB 4OHVA 5GAHU 1TL7B 1Z2ZA 3HFKA 2LLZA 2KM8C 4WU2A 5SZTA 2QLBB 4M94A 4FF4A 1XWLA 5CYQA 3HZGA 2HQDA 5J2MB 1JQGA 4F4AA 1G1XA 7FDRA 5ETTA 2CIMA 1YZ7A 1FKPB 4LF8J 4USTA 3ZZPA 4LFCJ 2HS4A 2K1RB 2BQ3A 3IAM9 2HURA 3IXQA 4FF2A 2ZWPA 3H4DA 1NDCA 4LRBA 3IGVA 2ZOFA 4ZLLA 1NSPA 2AT1B 2F5GA 3KLFA 1Q79A 4QCLA 3IA0A 1JLAB 1TL1A 2DEJA 4AQYF 2QE5A 1AROP 3PYFA 1PJ5A 4LFAJ 1JLCA 2RDJA 1F3FA 4DS4A 1XQIA 1UETA 3FQLA 2UZAA 4DDFA 2X3DA 1N32F 3V5RA 3NCRA 1N88A 2A1BA 1HQUB 2C3OA 4KRWA 5DO2A 2IM1A 4ZA1A 3PXGa 3KLEA 1QDUB 3T1YF 1FFSB 3POTB 1UKUA 2Z58B 1RBOB 3FBFA 2GIRA 1FXRA 2XEXA 3TOQA 2UUTA 3C15A 3W65A 1XMBA 3CJ8A 1WC3A 3CD5A 2JWNA 1UJ6A 3MMAA 1ITPA 2MQQA 3BPDA 2R8KA 2UU9J 3GTYX 1HHTP 2LDIA 4DCOB 3U7JA 4WZQA 2UU9F 2A18A 1CC8A 2CQ0A 1NK0A 2EW9A 3DHXA 3ISZA 2HQ3A 4NCGA 1JLBA 4ECWA 1LWFA 2LKZA 1VQ7S 1ACMB 4QU6A 4WP3A 2IJNA 2CPHA 5E3RA 3TWZA 1CULB 2Y0SD 1I5OB 1HWKA 2WVFA 2HVDA 3NP5A 1SQGA 3PHEA 4B9LA 1S97A 3CD0A 4HI1A 2DXFA 3I5BA 4NYPA 4ES3A 1LFPA 4M63A 2IM3A 1KOOA 1V3RA 3C14A 2CWXA 1OIAA 4OLPA 1ULRA 1WEYA 2PEBA 3NWGA 2KHDA 4IH7A 4UF4A 4Y28C 1Y11A 1PJ6A 4ENOA 2AD9A 1SKRA 4CCHA 2CZ4A 1NK8A 3TR5A 3OQ2A 2YH1A 1VI7A 2OTJS 2WW4A 3H2VE 4TYAA 3VCDA 1J5EJ 3KHHA 4NRUA 1RTDB 4DPXA 3KG0A 2U2FA 3Q89A 4PXEA 3ZC4A 4P72A 2CAJA 3L09A 5A76A 4F4KA 2CPYA 4G1IA 2UUAF 4ZCIA 2WHOA 2HBYB 4QYZJ 4CO5A 1R6YA 3MEEA 2YKOA 4OZLA 5CYMB 1TELA 4ZN1A 2YTCA 1TVRB 4MFBB 2MZJA 2EPIA 3K2YA 4C3KA 2MEWA 1N52B 2DIVA 3SSRA 4I2QB 1FCAA 2B4UA 3KDNA 4I0WA 3ENQA 5H1SV 1BE4A 3P96A 5ETQA 3HJVA 3BSNA 1XNRJ 1N56A 2KZMA 3UI3A 3P5BP 4PYAA 3P49B 3V81A 2V2QA 3K8WA 1S1WB 3EWGA 3CJ3A 4LF5F 1IUJA 4PWUA 1EHWA 1DRZA 3CT9A 2DHXA 2YWKA 3DYAB 1EB0A 3G86A 4OFZA 1KFSA 2CVIA 3I0RA 3IBWA 5KG7A 3MFHA 4J90A 3CJ5A 4PAAA 5L9XA 4C8YA 1YJTA 1NJYA 3DXSX 3CO9A 3LGNA 3NRBA 2BJ9A 5KFNA 1DTTB 2BJ7A 1HFEL 1OSCA 1HQ2A 4U8YA 4ELUA 4X4UA 3I9ZA 2RUGA 5KFIA 1QTMA 1FX2A 1SXLA 2DITA 1Q8LA 2GHVC 1U49A 1FRHA 4CIOA 1NDPA 1T3NA 1ZTTA 2XSJA 1XMQJ 1PC4A 3K57A 4NYZA 3UN5A 3D7SB 1U0HB 1NDLA 3ET6B 5E3PA 3NMRA 4IQXA 1PIEA 1SH3A 4NZ7A 1LW2B 1MWZA 1RT3B 3MF5A 4N8NA 2J6SA 1AZSB 3UDCA 2JEIA 3HDSA 2XS7A 1UVJA 4OX7A 3SI8A 4JYAF 2HQFA 1UVIA 2J8SA 4DUZJ 2Q1LA 1GEHA 4PG6A 1NK9A 1CC7A 1VGYA 3DM2A 3MMCA 1S9GA 3BGRB 2GJFA 3PW0A 4EZ6A 4I2PB 2AF6A 3T41A 3SYZA 2I5JA 1BQXA 2L9DA 4KPCA 2BE7D 2RHSB 4LSLA 1MW7A 3GFHA 3UVJA 1TV6B 1S0VA 3K58A 4X62J 2H5EA 5HN0A 4GKJF 4NZ6A 4C9DA 4UUXA 1FI4A 3KLGA 1VRUA 3WX4A 5BR8F 4F2SA 4NZ0A 3TJ8A 3MURP 1TKZA 5BR8J 1VLOA 1FKOB 2CZ9A 2K3KA 2DKOB 3HHLD 4M5KA 3KJVB 3O2IA 1EQMA 1U8SA 3N6NA 4Y65A 4EO6A 2IDEA 3G87A 2FJBB 2BW2A 4LVNP 2J6TA 3I5CA 2OEJA 1IR1A 4XIUA 2VA2A 2WB4A 4JI1F 5EN1A 1S0OA 1RCOB 1J5OB 4LQ3A 3MD3A 8ATCB 2IM2A 4QZVB 4URSA 2MDAA 3VWSA 2M8HA 2IYIA 1TUGB 1JIHA 2ZOMA 4TU8A 2OEKA 3MAAA 4IFVA 2DY9A 4DEZA 1OO0B 4X4NA 3V4IB 3OVSA 2UUCJ 2V68A 2BKOA 3OR2A 3QIDA 4MYTA 2CPDA 3G6XA 5KG5A 1VQSA 2R7TA 2D3OR 3BO4A 4OJ1A 4RL1A 3MDFA 3LQVA 1XC9A 5HP1A 4PPDA 3EE3A 4PWDA 1WSVA 1ZZFA 3JAMY 3FBBA 3KKFA 5LJ3Y 1QSSA 4O0NA 2ZITA 2YNIA 3HVAA 4EBEA 3CC4S 2YNGA 3PEHA 4DR7J 3AODA 3IS9A 4A8FA 4Q8EA 5J2NA 4DV4F 5H9EK 2X1GA 3ICLA 2OPQA 4P52A 4ANDA 3W2WA 1VQ4S 2NUUG 4LFBJ 1IJFB 3DOMB 4A8YA 2DR6A 1U1MA 3PO4A 2CPFA 1SUQB 1RK8A 4DPYA 2FTRA 1LWEB 3ONQA 1RT2A 4L6V3 3M8RA 3KHRA 2GAHC 1HBUB 1NKBA 5KFRA 3J7AN 3ZZUA 2H5IB 1VQ6S 4LF1A 2H65B 4CLZA 1ZETA 2IFXA 2DBBA 3OXLA 5G0RA 5F8NA 2NYHA 2N3OA 2FZGB 4KGMA 2VQEF 2GCFA 2RILA 2IAJB 3NEKA 1XNQJ 1RE1B 2Z2ZA 4J91A 2XMKA 3IFEA 4GVBB 3LO3A 4KGVB 4UZCA 5CCLA 3ZZYA 1T03A 1N34J 4V19J 4MK8A 1MLAA 2WONA 2J9DA 3CE8A 4JI6F 4M5JA 2VQEJ 2ATLA 5GAGU 4QR0A 4X84A 3R5JB 1ZOTA 1MMNA 1RGVA 1TMMA 3UN3A 1UW4A 1UAWA 3ZNUA 3UCUP 3PYEA 3OVAA 3QGHA 2P5VA 1YJNS 2BJ3A 2K7JA 2GVZB 4B3RJ 2JVRA 2Q79A 3NAHA 2VODA 4BBYA 2KI2A 3HHDA 5IFMA 4OHXA 2A2DA 2OFGX 5L39A 4B9MA 3CIZA 2CQBA 4CNZA 3CULA 2IMWP 2DNLA 2ZFHA 3CD7A 2FLPA 5K8NA 2YQ0A 2QZ8A 1X5OA 2WBMA 2W1BA 4X62F 4K59A 4RNNA 2ZNYA 4L76A 4C0OC 3RZAA 4X65F 1RWXB 3GP9A 4KQZA 4LBPA 3TUPA 3CDWA 4AL6A 3DXBA 4LRAA 4H54A 3NKYA 1CJKA 1WDDA 2H3EB 4MIBA 3HULA 4KKOB 1X4AA 2ROGA 4R5PB 2NCKL 1HNVA 2XWXA 4PUOA 3DC2A 4IO1A 3BGOP 1K1QA 3K5NA 3BN4A 1OWXA 2PD1A 1XMOJ 1HW8A 1YG0A 2ZKTA 5B0CA 1FX4A 5IT9Y 1RHRB 5KG3A 1DTQA 4RUBA 3DGVA 1P27B 3QLHA 4P7VA 5BJRA 3SDEB 4JI2J 4MKAA 4KTQA 1CPZA 1HARA 2CPJA 1RBAA 2DNQA 3C6TB 5I4MA 3Q0AA 2E5JA 3WC2A 2KYXA 3MCSA 2DGTA 5FDLA 1U09A 3CMQA 1W26A 3GJSB 2MXYA 2EFVA 5HK4A 2B6AB 1IKVB 2WCXA 3FMBA 5DDOC 4JI3F 3F73A 1CQMA 3NS6A 4DS5A 4TN2A 1GK8A 3H2LA 3R5CA 5BYQA 5HMXA 3RB6A 2DGOA 1JLEA 1BUXA 4RBVA 4E98A 1EKRA 2JNJA 3A1YG 2DNNA 2O1PA 1WHWA 2FHOB 2CJ9A 3KFWX 4JI2F 2F7VA 5KFAA 5KTQA 1IBKF 1UVMA 5DZ7A 1S6QB 1T9XA 4ZVGA 4NLVA 3VR1A 2CJAA 2MQLA 2BOAA 4MMOA 4ECQA 4MK7A 3GU0A 1QUVA 4K5RA 3H5XA 2R7RA 2ZH5A 1N32J 2XZWA 4IR9A 2ZJPQ 2RS8A 2ASYA 4USVA 3DRRA 2ATCB 4RW6B 3NWRA 1WUUA 1FWPA 1GH8A 5ETKA 3SCLE 2FJXA 1GTHA 1GMWD 3KUEA 1D8YA 4TY9A 1WACA 1RACB 3IBFB 1MG7A 2RD5C 2VBZA 3R7NB 1N5YB 3HD2A 4GRSA 2NREA 2HWHA 3AHPA 2IMOA 3G2XA 3JSMA 2UXDJ 3K5PA 1U1LA 2MZTA 4AL7A 2UXCF 1UWAA 2VKRA 3PV8A 2PT0A 4A47A 4WFZA 1GMWA 3D66A 3VAIA 1R0AB 1P6TA 1RP5A 2NSCA 1N48A 2PMZD 4BWJA 3RBDA 1KQKA 2PA8D 2DT9A 2E1PA 1IM4A 1WELA 2O5DA 3HFVA 4CLYA 1JXVA 5DM7Q 3T3FA 4ED6A 2M2BA 2RQ4A 4X4TA 2KHCA 3JXOA 3I4PA 2OAUA 7FD1A 1HBMA 3PJ9A 3O1LA 2Z2MA 4GC7A 3PW5A 5F8JA 2D9OA 2M52A 2NLWA 3BKUA 2HS3A 3IP0A 4LMZA 3GV7B 2GQCA 4BC9A 3SQOP 3LOUA 4QR1A 4B3TF 3E01B 2XHWA 4IKAA 1F3VA 4U6PA 3BDPA 3W62A 4JI0J 1HHSA 3HI9A 3SV3A 1KP6A 2B7BB 3MD1A 4GO5X 2GVDB 3K5OA 4O44B 2HG4A 4RNMA 3IRWP 4N76A 5I3QA 3HHLA 5KFWA 4QWCA 1MMLA 3VQTA 1N6QA 1FERA 4CTAA 4HH0A 3BQ2A 3NGSA 3PYDA 5AXMA 1CEZA 3HKWA 1FKAF 3QJLA 2BM0A 3TX8A 4Q2LA 5KT7A 2DISA 4KHMA 2V4JB 2PO4A 4KV8A 3IM9A 2EK1A 4UUWA 2B4PA 9ATCB 2QA4S 2M9KA 2VASA 4OLOA 2DR9A 3EM1A 2E5LJ 2QX0A 3TUIC 1A6LA 1S59A 2B5JA 2PE8A 1YTYA 1AXQA 3LPEA 1X4FA 3TAQA 4B3OB 4ZS6A 4ZVTB 5F9LA 1X4EA 3PTWA 1Q16B 4Z2XA 2R7UA 1SB6A 4FS1A 4ID8A 4JI4J 2ZWOA 5CCMA 4RKUC 2J0SD 2ERRA 2VG7A 3HZEA 3VAKA 1IBLJ 1VISA 2VBYA 4F4WA 2V9WA 2MQNA 4C11B 4DR5J 1HWUA 3IG1A 5D78A 2G4BA 1G2EA 4FXDA 2DNGA 1LEOA 1D9DA 4O3NA 2AP6A 5D6GA 4ZDNA 1TL3B 3OFGA 2QA2A 2YH0A 1C1CB 2QFJA 1FDAA 4FYDA 4WU3A 1L5UA 1L3UA 3BH6B 3R5BA 5LOQA 3K59A 4DV6F 1YRTA 4K4TA 3OUYA 1VCTA 2BACA 4EK2A 2A6OA 1MSWD 3W64A 5A8WA 3DLLQ 4LIWA 1WOOA 1DTTA 1JB0C 1U26A 1WC1A 1JLQB 3ELHA 3ITHA 4YB6A 5ITHA 2MQPA 3OLAA 4CLWA 2HLTA 3HXMA 2AX0A 4AQYJ 5BXIA 2K2PA 1YBTA 1HHQA 1RA7A 1SIZA 2E1MC 2NPIA 3GWCA 5C2GA 2AYGA 1TFYA 3RG6A 1S1VA 2Z57B 4P6QA 4U7UK 5DM6Q 4DX5A 5JMNA 2QEXS 3FFIA 3HHEA 2E7WA 2BOPA 1AFIA 5LT5A 5F9NA 1QTNB 2XULA 2XNQA 6AT1B 1ZM4A 3KLIA 1RTIB 1R6VA 4YR3A 3AJDA 3GSIA 4OHWA 3T1AA 3P4UB 2HNYA 4QOTA 4ZKAA 4JYAJ 3U1NA 4LF9J 1NPRA 2RU3A 3NNAA 1A0OB 1G7CB 1H7WA 3TI0A 1RT7B 4RPFA 4X65J 2MY8A 1UJ5A 2AW0A 4RU2A 4KFBA 1KDNA 2DH8A 1S7IA 1DQAA 2Y3YA 3OXGA 3PRVA 3PG9A 3UR0A 3CCLS 1TL7A 1R8CA 1RT6B 4ZJQA 5HLFA 1S9GB 3OTEA 1H38A 2DJWA 4M5DB 2DPIA 3M8QB 1TAQA 2HNZB 2RVJA 4FXVA 4I2PA 4X66J 3G4SS 4JI5J 3DRXA 3TQ1A 1SV5B 4QR2A 5CQGA 5I42B 2BANA 4EU0A 2APOA 2EG2A 3SZ2A 3DMJB 4KIAA 4M5IA 2HK3A 2KT5A 4AL5A 3MI7X 2K1RA 1C0TA 5C42B 1SH2A 1IVZA 2LEBA 2H54B 4IFYA 4OHZA 4XDDA 1FF2A 4DFPA 4ATNA 1FKOA 1VQLS 4AFFA 2AWZA 1TKXA 1TK0A 1XERA 1EP4B 2IC3B 3QJJA 1JLAA 2AEJA 2VKZG 2BXJA 2LA6A 1OQ3A 4DXLA 1HI8A 1UZHA 4RW4B 2FJAB 3UWTA 4DZ6A 4QWEA 3O3LA 5I3UA 2UUCF 5D0GA 5DLFA 1L3TA 2BE2B 1HQUA 1GNKA 5FLXU 3C66A 1K9MT 3CUNA 1R7IA 2GZOA 1K0VA 3OJSA 3MAAB 2ABYA 4IFVB 1AUDA 3DU5A 1DARA 1P9YA 2ZBCA 2CADA 1XR5A 2ZC4A 5K8MA 4AD6A 3OR2B 2GHWA 3BKTA 3D6MB 5KFLA 2W4PA 1QD1A 3CJKB 4NCGB 1F5BA 3LGHA 5A6PA 1NJIT 2EFGA 1RAGB 1KLMA 4NLDA 3QZ7A 1LQ9A 1RTJA 2JRSA 1QSLA 2NYIA 3GE9A 3PYGA 4PWDB 1Q1KA 2HGMA 3UFCX 2E9TA 4Y2MA 2BABA 1RWNB 2YNIB 4OZ3A 3PO5A 1CS4A 1H2VZ 1OYDA 1ZBTA 2CFXA 2CG8A 1ZAWA 3D0HE 3DU6A 2VG6B 1JNRB 3Q8VA 3R27A 4PCQA 4DL3A 1M90T 1S77D 3BV8A 1FESA 2FVSA 1HD1A 2YNFB 2LXFA 1UCNA 3MPUB 3R3TA 4ZPTR 1KQSR 3OHAA 1IKXA 1GX6A 1GQEA 1OYEA 1FRMA 1RT2B 2XMTA 3Q86A 4PXCA 3UCZP 1YJ9S 2WOMB 1N36J 3H40A 2N4DA 2IIHA 2HRYA 4LFBF 5CAAA 4OYPA 4C8MA 1GXUA 2AEMA 1DQ8A 5CYQB 1X9WA 2V2ZA 1CSJA 5IZHA 2AX1A 3BQ1A 2E5IA 2RIJA 1FA0A 1GMUA 5L1LA 4OJ3A 2J7WA 4GVBA 5ETLA 4ID5B 5B0DA 2MZ1A 2UUWA 2E5HA 4IOCQ 2RRAA 3RB4A 2F9DA 1KNZA 3OD2A 2ADCA 1UVNA 4WZMA 4DHVA 5B09A 1LV5A 3KLFB 2JX2A 3LP1B 3M2VB 4EEYA 1FRJA 2YKAA 3L4BC 4IDKA 5DQIA 3MAQA 4DR4F 2AJFE 2VV5A 2YKNA 1ZAXA 4P73A 4RW8B 4F2RA 4NLUA 1I1GA 3Q8UA 1MWQA 1SJ3P 2HEKA 3K5LA 1Q81T 2ZE2A 4OI6A 4KBIA 3UW1A 1T3OA 3LANA 1Q5YA 3TP2A 3VGSA 1SBRA 1XNQF 2KRRA 3POTA 4G6VB 1SC4B 2B43A 2FPHX 3KXDA 3CTRA 1RBLA 4TVAB 4U96A 5DS7A 3PY8A 2O67A 8AT1B 4EGLA 4CLUA 5HQMA 3CDEA 3PX6A 1VIXA 3MM7B 2QL9B 3HVTB 3EXYA 4XK8C 5HBMA 2HK2A 4DV1F 1FVSA 1UEUA 2DNYA 3F56A 3NOGA 2OH2A 2MSSA 2VPZB 1S72S 1U1KA 2C3YA 2BYCA 5LSOA 3M8PB 4KKOA 4R5PA 4QIVA 3PFEA 1WF1A 3RBZA 4NCAA 5HAOA 4IRDA 2AYBA 4A8SA 5EWGA 5IT4A 1KTQA 2PC6A 3R7BB 4LF4J 3KOAA 1KLNA 2F3JA 1ROFA 2XSJB 3M32A 3R6GB 4CH7A 4DR5F 4ECSA 4W90B 4ZVRB 1X8DA 3C8YA 4R0EA 5F41A 1NU4A 3FGVA 2KVQE 2ZNZA 4LSZB 1P9QC 2EBGA 1MU2B 4QBUA 4ZIVA 2HFVA 4URQU 2EFNA 2IRXA 3QFHA 4AT1B 4JI4F 3GG0A 4NI2B 4QWAA 1NH7A 2AV5A 1C4CA 2CQ3A 3ETOA 1K8AT 5LJ5Y 4NXNF 1T9TA 1H3DA 2Z30B 3ISND 2CYYA 1RWPB 2B6AA 2YPZA 4HTJA 4C8LA 1ZM9A 3C46A 1R27B 3VZHA 2JLGA 3I0SB 3RAXA 4ECTA 1SCJB 3DM2B 2ZJRQ 4MIWA 3BGRA 5KFGA 3L7UA 2DY1A 3ENVA 4NXNJ 1WC6A 2PN6A 4WP8A 3OFHA 3QIPB 4FP9A 1YWXA 1WDTA 1UW9A 1RU1A 3FJ2A 4DMZA 3NAIA 5B0BA 1XMQF 3RW6A 1KONA 4BWMA 2J0QD 3DOLA 3KLGB 4ILMA 2LXIA 2QLWA 3FDSA 3HJFA 1HI1A 2BKNA 2ZUAA 4OYZA 3R2CJ 4R0JA 3PACA 3J81U 4BC7A 3MFIA 1B99A 3LP0B 1QSYA 1K73T 2RF2B 3A4TA 4AXJA 1UA1A 3EGNA 5A8KA 4ZJOA 5GAEI 5LL6d 1YBAA 3CO0P 2CDQA 2GC8A 2Z4PA 4UY85 4QIGA 2F63A 1WG1A 2XLJA 2B9EA 3MCNA 2X51A 1MMDA 2U1AA 3DYAA 3QO9A 5ADZA 1UVLA 2P6SA 1X31C 1ZS6A 2HFUA 3OT9A 4WPAA 4WFNQ 1N5YA 3M2RA 1J5EF 2DR7A 5T14A 4LF4F 2I8EA 3SQGA 3CCTA 5KFDA 1K1SA 5K5MA 4I1TA 3AD7C 3M6UA 1F2HA 3AXKA 4N7TA 2H9ZA 2VFVA 4HHJA 4NYOA 3W5ZA 1JNZB 5H9FJ 4K4YA 2ZD1B 4LF6J 1FRIA 3GJTB 5B0AA 5K8OA 3EGZA 1QE1B 4L73A 2B51A 1U2RA 3KHGA 2BM1A 2IPOB 4OI2A 2KG0A 1BXNA 3JSRA 1Q7YT 2QC3A 3TJAA 2CQ4A 1RWMB 4N5SA 1JX4A 4YMEA 4JI1J 4LF6F 1Q8BA 1TMJA 4DV3J 1VBKA 5EWFA 2MHEA 1NKCA 1U0HA 2GO9A 3KK3A 4IOBA 3KNGA 4C98A 4K4VA 3QT7A 5KG4A 2CJBA 3L95X 4TY8B 3UCGA 4X64F 1MNEA 2YKMB 4DV5J 1N33J 2HNDA 1TP7A 3W2WB 3S8SA 1ZTWA 2VF3A 1CJVA 2ALYB 1AFJA 1CQNA 2Y1JA 3MPYA 4HHUA 5DZ6A 3L9ZA 2GVDA 3OV7A 2BUNA 3GR1A 4USJC 1HBUA 3U02A 3GYGA 4YR2A 1VOMA 2C22A 3FEXB 1N6QB 5GADU 1RHQB 4J9PA 2Y9HA 2CQHA 3A3PB 2M0GB 4ED1A 2H1YA 1SL2A 1I6JA 2WW8A 4DR2F 1VHIA 5C24A 2V4JA 4X4VA 3CW2C 4ZPWR 2H51B 3ZZZA 2B0GA 3R8YA 2W4CA 1AYEA 5IV4A 2Q6BA 5KFEA 3C6UB 3H59A 5E2QA 2BMBA 4RX6A 2KXHA 1T03B 2XYPB 3X3UA 2WTFA 1HNWJ 1S49A 4ECXA 3W9JA 4PQUB 1TKZB 3VV2B 1REVB 4E2FB 1QLNA 4QWDA 1N5TA 1IWGA 1DLOB 2QT7A 4N56A 1S6OA 2GW8A 1P1TA 2R9LA 1TL1B 2E5LF 4XPEA 3P6YC 2EG1A 1YDLA 3FBEA 2X1BA 4KGXB 2VDHA 2OUGA 3SV4A 2E9ZA 1PKUA 1YJUA 3PFOA 2VA3A 1S48A 2VB6A 2IY5B 3QT5A 2VFRA 4CQ1A 5IT0A 3MMJA 3M8YA 2PIIA 1FTCA 5E41A 4RUAA 3W2VB 1KQGB 1S0NA 1N4LA 1FXDA 4MK9A 2F8EX 3MR6A 4OX9J 2MSTA 1KSPA 2BX6A 2DTJA 3V4IA 3MMAB 3KG4A 5FD1A 4WIQA 1WSRA 1FEHA 2F1FA 4ALZA 3ZTQA 3TUZC 4AE5A 1S79A 4JI6J 5L8RC 4NLYA 2ZC3A 5CD4H 5D8HB 4ZVHA 2FDNA 1KR4A 4RNOA 3DLKB 1WF2A 4OZ0A 1HBNA 3VAMA 2JFKA 4ZVFA 1O0PA 1WF0A 3QAEA 3Q8SB 2AGQA 4PUOB 4RR5A 2G0JA 4N77A 4NXMF 4MKVA 3J80U 5KFYA 3LWMA 4O23A 2MKJA 4B9NA 3AB4B 2D69A 5D0RA 5DJBA 1Y9OA 1Q4RA 1S1VB 2KZZA 4ECRA 5KFQA 2XWYA 3H0PA 2GFFA 2G0CA 4YEAA 2CPXA 4JI7F 2KRBA 4J9VA 1RT5B 4WYWA 3NGDA 1WKJA 2GGPB 2G0IA 1Y4ZB 2OPRB 3IRXB 4NRTA 2UXDF 4K4ZA 1S1UB 3NY0A 3KLIB 3RB0A 3W66A 4X66F 2GIFA 1T8EA 1HMVA 1JJCB 4KH1B 2WSCC 1FNMA 2EFQA 3SCIE 5JVGQ 2J9EA 3HO1A 3LUYA 1F9FA 4PQUA 2AMCB 2CRLA 3DDNA 2OD4A 2OKQA 3FEZA 1WOSA 3VQSA 2C42A 2MKSA 3M9OB 4RWXA 4DR3J 4F3MA 1FDDA 2E5GA 4WE1B 3J81j 4FBUA 1C1BA 9RUBA 3FKBA 3M8QA 3TVKA 5C25A 2Z56B 3IMQJ 8RUCA 5ETVA 1YJRA 2C2EA 3QQCD 3THPA 2HHUA 4XDCA 1C0TB 2XMAA 1HR0J 1EKSA 2ZUGA 3BR9A 3TEGA 2IDLA 1W25A 5AJ3J 2B9WA 4DV4J 3H90A 3QNWB 4Y2IA 3DRRB 1OSDA 3DI6A 4JV1A 2RQMA 5A8RB 2VOPA 2NZCA 3M9NB 1JJ2R 3GR0A 4J9SA 1DHMA 1XR7A 3K8VA 4PPZA 3KUGA 2XMJA 4ZLPA 3D5MA 5IC6B 4NEYA 4FYVB 2I6WA 1VBXA 2RQKA 4B3MF 3CD6S 4A8QA 2XS5A 3TZWA 3I0RB 3ZZTA 4YOEA 4RLEA 1FNXH 4M5LA 2BZ2A 4RWWA 5EX0A 3DN9A 4GKKF 3N4WA 4P2SA 4J5OA 1KVKA 1KRPA 3CJ0A 3I9V9 5L46A 2ACMA 5LXYA 1S1TA 3B54A 2P8IA 3PR4A 1VQ8S 1FVQA 3W3SA 1UA0A 3DLBA 1HNVB 3M7VA 2CXEA 2P9GA 3QSIA 4K0KJ 3L7OA 3NCPA 2YWHA 2QLJB 4IG3B 3V6HA 2A6MA 1Q78A 1TKTB 2XCPA 1NUEA 2EKYA 3QZ8A 2XLIA 4LFCF 4PRFA 5AXNA 4ELTA 4FF1A 2AJ1A 1VLYA 3MGJA 2L9NA 4OIXA 3MM5A 4ITSA 4A4JA 3HD1A 3FZ2A 3DFEA 1RT1B 3NBPB 2ASDA 5E33A 1WNEA 4DL0C 4O3PA 3KJNB 1NKEA 4GC6A 2VG6A 3HT3A 2J0XA 2C3MA 3IGNA 4BHQA 4ZCMA 1IKVA 4O44A 3D2WA 1AA1B 2YNFA 5CXTA 1RTHA 4WJBA 2X3GA 3MMCB 2XQCA 2C2KB 3CF5Q 3KMSA 2WOMA 2R7QA 2V4RA 3K0JA 2FB0A 2QIFA 2HBZB 3QMQA 3IAS9 3N0VA 4WK1A 5ETSA 5HMWA 3UO0A 3A3OB 2WZ1A 3D6FB 3VF0B 4RO0A 2XHCA 1FK9B 2AYEA 2KT3A 2MPUA 2KKHA 4Y34A 4JI8F 3BO3A 3ILIA 2IRYA 3TVZA 3Q24A 2DR8A 3CCUS 2FZCB 4OI4A 2KO1A 2OPSB 3GMGA 2KB2A 1Y3JA 5B7WA 1B7YB 5CA5A 3BO2A 3CC7S 4ID5A 3KJVA 1Q0NA 2HQGA 4B3OA 2RT3A 2D9PA 3N01A 3CDUA 2XGPA 2C3UA 2B3TB 1N34F 1RWUA 1OY9A 3ILLA 2QMXA 3O44A 3RYLA 5EWEA 4G1QA 2ZBIA 1VBYA 4QYZK 3IWNC 4DSKA 1PBUA 1S9EB 2V63A 4HTIA 3GFZA 1SQFA 5IM0A 3MEGB 4ICLB 2KTQA 4ANCA 4C11A 2V4QA 1HYSB 2VFSA 2POKA 2D7SA 2B4VA 5ETNA 3JQKA 3CCES 2VFTA 3TAPA 1A9NB 2PFFB 3BR8A 5T41A 2IHR1 2OMLA 3NS5A 5DG9A 1QAYA 4HYKA 2HHHF 2ADBA 2CZVC 3D6HB 1VJQA 4LSNB 2B7CB 1IKYB 3GYXB 4LR7A 4O3SA 5KFVA 4NLXA 2BVZA 1VHFA 5KFFA 2HFOA 2UUAJ 3M6VA 2KFZA 1XMOF 3BSCA 3D0IE 3MUMP 4PG5A 1HLWA 2AEFA 3HX9A 4EUVA 1IN0A 4CP5A 4XO0A 2CNLB 3V6KA 3D28A 2GMLA 3CIMA 5H9EJ 1T0TV 4QW8A 1HW9A 2YNGB 1JKHA 4Q2MA 4V1Ak 2VC0A 4N47A 5J2NB 3B4DA 3RAQA 1FE0A 1OJ4A 1RXOB 2VPYB 1RWOB 4DG1A 2ILZA 1WWHA 3FFIB 5DETA 4X4PA 2AU0A 2VJVA 3HT0A 1XN9A 2AYMA 2EXUA 1RQ0A 2W2NP 1SUQA 3BF4A 5F3ZA 2EFPA 4RW9A 5HMZA 1JXEA 1KVIA 1WEZA 3N6MA 2HNYB 4PXBA 4CTAB 2BW7A 2DRDA 4O3QA 1UPMB 4F36A 1PO6A 1B0VA 4NA3A 1PYSB 2OPPB 5HVFA 3KNAA 5D3GA 3QWUA 4KFBB 1FXLA 3PCOB 4ES1A 3QWPA 2D74B 5E3QA 3I0SA 2HFSA 2IAJA 3UQSA 1S76D 3MR3A 3MCOA 1JLGA 3CNQP 3PZPA 2HNZA 1M1GA 1PSDA 2N7CA 1W2BR 3NGTA 1WI6A 3T1HF 2WONB 4RJVA 2BANB 3TNVA 1EETB 1Q8IA 1NK4A 2FYXA 4FBTA 2ZZNA 3KMQA 1B4SA 3QGGA 2VQFF 4UY8T 2BV3A 4LBHA 4Z7YA 3K89A 1G3OA 4G3IA 3M6WA 2ILYA 4CYUA 4DI6A 4LIRA 1SJ4P 1RT4B 2PMWA 2GV1A 3M2UA 3MMBA 4MJKA 1XR6A 1EP4A 1KWMA 4O4GB 5A0YA 1E6VA 2J8AA 5E0OA 3TZYA 4B9SA 3OR1A 2FLLA 5A8KB 1TUWA 4C4WA 4MYUA 2WK4A 4ZOSA 2W8KA 2V2VA 1JXLA 3QAUA 4OYMA 4LF7F 1TL3A 3CJQA 4LFAF 3NGRA 4HLBA 2K3IA 2OSQA 2JVOA 4PYDA 3LWLA 2BE2A 1BD6A 2VUGA 2XS2A 3MECB 2KJWA 1LWXA 3J81Y 2HFNA 1SL0A 2JEFA 2ROEA 3OUYB 2HFZA 2CG4A 2HQCA 2NXJA 2WBRA 3EJMA 3HHLC 1Z2LA 4LJMA 4JV0A 1HWLA 4TLRA 1CJKB 3SQGB 1KTVA 2IJRA 1LKZA 4OL8A 3MTJA 4YHHJ 4KO0B 4DQIA 1HI0P 4H4MA 1S6PA 2Y8YA 2FIUA 4FN5A 1UL3A 1ZPVA 2BE9B 3LF0A 3WDOA 2HYIB 2BRLA 1T7PA 1WKLA 5F8GA 1RKIA 1QE1A 2CUYA 1BMQB 3LH2S 4LRCA 4Y6IA 5LMNJ 4EFAC 4FPIA 1YIJS 3G8TA 2HVZA 4ZITA 2E1CA 3TW0A 4IRCA 4P2MA 2HHPA 3LAMA 3VZIA 2HGNA 2HRUA 2MLZA 3DLGA 5M2RA 4PG8A 3LP2A 5AE1A 1TU0B 2E1AA 2RJZA 2QMUB 1RB0A 2MZRA 3CEDA 4JBCA 1U1RA 2R8JA 1VQNS 4LQ9A 2MYFA 2KFNA 2JEGA 4I6AA 4YDXA 2ZH4A 1HWIA 1U2FA 2LU2A 4DJBA 2B9YA 2YKMA 3HSZA 2W7PA 4EYIB 3RGIA 4PQAA 2C2OB 4JV5J 1RT7A 2PMHA 4DR7F 4M5GA 3OTOF 1SKUB 3RW7A 1IKXB 4XPCA 2Q3PA 1O51A 2DNOA 1UJ4A 1H98A 1U0SA 4F67A 2FGOA 1AT1B 3WIVA 1RYSA 2L3MA 1RYRA 4WP9A 1JMTA 2VU5A 1NAQA 4WIIA 1NJWA 2UVVA 3GIRA 1C0UB 5KFUA 1AW0A 2DGWA 1UMJA 5K14A 3KJQB 1Q7LB 1WG4A 1O6XA 3H7HB 4QIFA 5I42A 3BGFA 1LK5A 2JJ4D 2DHHA 2V8GA 1GT8A 3CCZA 2C3PA 2P9EA 3C6UA 1UTAA 2KL8A 3KDOA 3U1MA 4HEA9 4YS2A 3CGIA 5IS2A 1FJ7A 2R42A 3R5DA 4DR2J 4IFYB 1X0PA 1TKDA 1REVA 3Q2SC 4TU9A 3G6VA 2GJ2A 4FF3A 1HNIB 1YHQS 2VICA 3OJUA 4J7CA 5K8PA 5B0FA 3ZXWA 2VPXB 1T9YA 1HBOB 2FC8A 1SC3B 4RW8A 3CCWA 5FIIA 3L3CA 3DDKA 4NWBA 1ELOA 3MPVA 4ZPVR 2B9XA 2CQGA 3C16A 1NO8A 1S7HA 1UP1A 4FNHA 2FJEB 3UNGC 3ISNC 4U67Q 3LTOA 3PRDA 4A48A 1M5OC 2F4VF 2Q66A 5HANA 5CZXA 4NL5A 2CWKA 3MEDB 3QJPA 4W92B 5CHCB 4WTOB 5RUBA 4DV6J 4K7QA 5KT2A 1U1NA 2P2CB 1R0BG 1YRXA 2G1DA 4IH6A 3MM7A 1NHUA 1FO1A 2QGFB 4JI5F 2F4FA 1FJEB 3BN7A 4Z7CA 2A2CA 2JDJA 4TYBA 1QUPA 3Q83A 5JUMA 5KOXA 1KLMB 2JC1A 4OZNA 5ETRA 1ZZNA 2HVHA 3DLKA 3KG1A 5G4DA 3M8PA 1CJUA 2F65A 2UV8A 1HBMB 4F4ZA 3MWBA 4YB1P 3KLHB 3AD9C 3IR7B 2W7AA 3PNIA 1UFWA 2LQJA 3AJ1A 3DDIA 1V9OA 4QIWD 1MWYA 5KFJA 3HF5A 2GO8A 1X4CA 2QA1A 1P1LA 3SSQA 1S10A 2HHQA 4DUZF 2IVFB 1U6ZA 2J7KA 1VC5A 2N4CA 2D1CA 1K0TA 3LALA 3VGVA 3US5A 3PX0A 2FLOA 3AOAA 3WC0A 2DHGA 4KAIA 4YN3B 3D6TB 3GIMA 3UD3P 2R7VA 4IUFA 1RT5A 3DHWC 2GGPA 2OPRA 3IRXA 4NI2A 4U8VA 4ZP7A 5F8LA 4J9RA 1S1UA 2AIRB 3TA1A 2HZVA 3QRQA 5E5NA 3A8KA 2DEIA 4NLTA 3T5KA 2NXCA 2G2OA 3W7BA 3R1HA 4ZIWA 2CJKA 1PAEX 2YWWA 3JTOA 2OTLS 3SMZA 3FNNA 4RW7A 2MLYA 3VVTA 4ED3A 3OFFA 1HPZA 4XTTA 1PG5B 1C1BB 1RWKB 1VK3A 2OO4A 4DL6A 2HHSA 2Y1IA 1FDNA 3AXMA 2QYGA 4NE9C 1JK9B 2LU1A 3QFWA 2FY1A 1RI7A 1WHYA 1A7GE 3NCQA 2NSBA 5BYRA 4C8ZA 1YQHA 1W2IA 3BPSP 3M2VA 5CYJA 2WSFC 3D68A 1H2UX 3JSYA 2YVSA 1S99A 1EX8A 4K2XA 3TJ9A 2UXBF 4OYBA 4LR9A 3VAFA 2VG7B 3GV5B 3IWLA 4X4QA 2ZE2B 3TA0A 1X7VA 3IG1B 3BDEA 1RHUB 1ZA2B 4OQJA 3T9ZA 4M1KA 2DHAA 1OPIA 4LR8A 5J1PA 4L74A 2DCLA 4TLQA 2IBKA 2HSEB 2GA7A 5IWAJ 3AT1B 3DGPB 3I6PA 3M30B 1Q82T 2HW3A 2HHVA 3EICA 4KE5A 4K0KF 4PZVA 2FLNA 1G4CA 1WOPA 4F8RA 2OELA 2JZ5A 3BQ0A 3T6BA 4UTGA 4DCJB 3P8BB 4DFMA 3CC2S 3ILJA 1U2CA 2MMYA 3FZBA 1FE4A 2MJUA 3CJ4A 1JLQA 1N33F 1S6UA 1SC6A 4Z37A 5ETPA 1FD2A 4DL7A 1BQNB 4X4RA 1U48A 4A8KA 1LNQA 4FKXA 4K8RA 3J7YU 3NXZA 1Q53A 2VC1A 4C3LA 3S1TA 4DUYF 3PEJA 4B3MJ 2OHDA 2ZDPA 4B3TJ 1NZAA 3KK1A 2N82B 1PCAA 2GQQA 1VK8A 1HA1A 3ZTOA 1Q8KA 5IXUA 3MM5B 2IVYA 3TZXA 2VIHA 1MU2A 3IBCB 3KK3B 2UUBJ 3NBPA 1RTIA 2JH3A 4WBFA 5L1IA 4TY8A 3CWJA 1E6YB 5C7PA 1U47A 2DPJA 2RSQA 5K9FA 1UPPA 3HVWA 4LT6A 3CPWR 3THVA 2WRMA 1XTZA 3FBCA 1X0FA 4J37A 1B70B 1PYOB 2HHWA 1RTHB 4URGA 3AAWB 2I9SA 5AE3A 1I3OB 4M5DA 3AOCA 2CDRB 4PXDA 3TO8A 1LOUA 1DJ0A 3QIPA 4DQSA 4IQMA 4ZVUB 4CLSA 2W9AA 3VAGA 3R9LA 1D0EA 1FK9A 4UZBA 2VONA 4O0IA 2HWIA 3OHBA 1HD0A 2FHKA 2VJUA 3E51A 5KFSA 4P7TA 2LQBA 5HVHA 5KFXA 2MJNA 4I64A 2BRKA 2AGOA 3HSDA 2OIHA 4JI3J 4WXWA 1TKXB 4MH8A 2GX8A 4DN9A 4B3SJ 3H98A 4JV5F 4BLGA 3TAMA 2R3VA 4DX8H 1D8ZA 1WC4A 5A2QY 1S9FA 1X4GA 3TZZA 1AUSL 1B0PA 1HL6A 2RDDA 3GFXA 4RW4A 4WWSA 3SFUA 2DK2A 1I51B 1S9EA 1NSQA 2RQCA 4DV3F 4DV2F 2AGPA 2DR5A 4RNHA 3MEGA 4ICLA 4UOFA 1BQMB 4QJVA 3OL7A 1REGX 1Y0HA 2LQ5A 1FFWB 4HACA 4QWBA 3TVYA 2FY8A 3PKMA 1SJRA 4MIAA 4NLOA 1FWLA 4NLRA 3DOKB 4A8XA 1M5HA 2HZAA 1KN6A 4ETZA 4ZCLA 1T05B 1F5CA 3T9NA 3GQCA 1M5VC 2COLA 1Y5LB 4KGKA 4ZP9A 5GMDA 3CJKA 3JQJA 4DFKA 1YBUA 4LF8F 2EK6A 3ADAC 3MR2A 3SFGA 2W9CB 3JSBA 4NLGA 3UNYA 1GFWB 2M5YA 3AA8A 1LK7A 1MROA 1RTJB 1SJQA 3VVUA 4DSJA 1HBNB 1SI9A 4F3OA 1FHTA 4WCEQ 2J9CA 2LMIA 4Y0FA 1NSAA 3KK2B 1XNRF 1SPBP 4FXWA 2IRUA 1U24A 4DX6A 1O5JA 4ZVSB 2PEHA 3FRZA 3G6ES 1V3SA 2L41A 3PJXA 2XMMA 1QM9A 3AOBA 1L3KA 1JKHB 4HDHA 1LFWA 2HVEA 1VYAA 1SC1B 2UVWA 2HNDB 3MM6B 2IJFA 3GFYA 3SCKE 2W24A 1CJVB 3W1YC 2ACYA 2KYZA 1RU2A 2JL9A 2W25A 2JLFA 2Y0BB 3BREA 3WHIA 4Q0BA 2CPIA 2DB1A 2XYGB 4RW9B 1S4EA 3G82B 3DLEA 1TTHB 2J76E 4BDPA 3HSJA 1UEKA 4P74A 4DSLA 2R2RA 5IT9U 3S7RA 3ZZOA 1VRQC 2BEFA 1BGXT 3EVOA 3BBFA 3LW5C 4OJHA 2QLXA 3UN2A 3PW2A 2MQOA 4LF7J 3FQKA 4ZHRA 3H5YA 1EIYB 4EYHB 1QAXA 1QVFR 5C24B 1TAUA 3H20A 1QJHA 3HP6A 1GXLA 1S12A 4FVCA 3D0GE 3I96A 4NMXA 2VG5A 1OY8A 4P71A 4WE1A 5HJYA 2R2TA 1NPPA 4OX8A 4ECZA 1M5KC 4J9NA 1Y10A 1RUSA 3EPGA 4Q43A 3MPDA 2KXNB 2BJDA 5C5JA 2HGLA 2W7OA 4KPYA 1Y5IB 3DNCA 5THWA 4YP3A 2BQUA 2E7XA 3LP1A 2HBRB 1TK5A 2Z2YB 1EETA 3ZTPA 3C14B 1L3VA 1HKAA 4FVMA 4KY3A 2CNNB 1FFGB 1RSCA 2YKNB 3GZ7A 4WK3A 1RJJA 5AXKA 4C0BA 5J1EB 3BBBA 2DGXA 3UD5A 1R8AA 3KTQA 4CYUB 4AYBD 2HQIA 4DBQA 2RKIB 3BYPA 4ELVA 1TFWA 4UOHA 4UQGA 1LWCA 4DV0J 1U1OA 2W2PP 4N8OA 3EZOA 3J7A1 1UWBB 2QLFB 1URNA 3GCXP 3MTKA 4K2JA 3U1LA 3AJ2A 5LSRA 3QT6A 4MTPA 4M5HA 3H42A 4F7VA 2VDIA 3R5AA 2G9OA 4NLQA 4EO8A 2RB7A 4DQPA 4GKJJ 5HBMB 3N9UC 3MECA 2VHGA 4C8OA 4EI2A 1FRXA 3OPKA 3I55S 3MR7A 2R8IA 4ZJLA 1ZYQA 4DLEA 3F41A 2FVRA 2KM8B 1HNWF 1S1TB 3HKZD 4DR4J 3KYLA 2XI2A 1NNDA 2MQ8A 2LVWA 4DV5F 4X64J 5HATA 1GTEA 3D3BJ 3I82A 4R8UA 3SXLA 4CWBA 3CXCR 3J7ZT 2RH3A 1QY7A 3M32B 5MLCV 3GIKA 3M05A 1TZ0A 1R8PA 2AJ2A 2HIQA 1NH8A 2RU9A 3BB5A 3BSAA 4L75A 5T7LB 4CDIA 4USMA 3QT8A 3MUTP 5EUHA 3VAHA 3V6DB 1JLFB 4NA1A 4ED5A 4NLSA 4YFUA 1GXTA 5KFKA 4L3NA 4RNFA 1X4BA 4JUZA 3TEHB 5AJ3F 5M2UA 3T1HJ 4YB5A 4ZCKA 2AJQA 5SUHA 2CQCA 3BKFA 5JVHQ 4QPTA 4GKKJ 3Q22A 1N36F 4OV1A 5I3PA 2LEAA 1VRTB 2PI4A 2FVPA 4X4SA 2H48B 2ZM6J 4PKDB 4F04B 1IBMF 4DQRA 4I4BA 1H7XA 1NDKA 4JI0F 2J9DE 3GONA 1KHVA 2Y1RI 5EX3A 1BHNA 5DG7A 4HL9A 2R7XA 5F8IA 3BSOA 1NJXA 1VQYA 2MKCA 3W5XA 2F40A 4IG0B 3FSXA 4CRJA 1OMSA 2XBPA 1VS3A 3JYTB 2DD8S 4C97A 3DOLB 2C2RA 3RRGA 4WFXA 1FKPA 3D1QA 3G6YA 3FSYA 3TUJC 5DQGA 2V8VA 4HDGA 4H4OB 2XGQA 1NRKA 2ZH7A 1KKHA 2NR0A 4I7FB 2W2OP 1ZAVA 2WVBA 2ZVSA 1LW0B 3LP0A 2YY3A 5F8HA 5DDPC 2QA4G 4QU7A 2ZM6F 4NX9A 2PFDA 3RTVA 2XZDB 3DI6B 3A8IA 4G1QB 3PKYA 3AD8C 4LF2A 2PI5A 3QPIA 4HR2A 2ZVIA 5LXRA 1YVFA 5KFMA 1C2PA 4ZVOB 2AZ1A 2DNKA 4B9VA 4E8UA 4CT8A 1PAUB 4ED8A 3C16B 2RHQB 2KVIA 5EHHA 4HH1A 1HYSA 3EVWA 2HBQB 4PG4A 2BQRA 3PX4A 5A2QU 3M2RB 3JQMA 4F0KA 4ECUA 2MKIA 4K4XA 4C2MA 2WVEA 1XJWB 3W8PA 4AUKA 1CVJA 4OI0A 3P5TL 4DF8A 5FJ4A 4H4KC 1TL5A 2ZD1A 1S5ZA 3MEKA 4EWTA 1IKWB 4FZVA 2DNPA 5IC4B 4F25A 1BLUA 4CLLA 5D4OA 4YUDA 3OLBA 3PVXA 1NK7A 4B08A 1NPKA 2MHNA 3M1VA 4IG3A 1H6KX 1YJ7A 2C2ZB 3FVYA 3NL0A 1H72C 2DNHA 4J9KA 1CJUB 4FYXB 1VR6A 2NQPA 1CULA 1URRA 3KLHA 2FHJD 2YKQA 3WX8A 5J2PA 2FVQA 4KGZB 1FNOA 4YY3F 4K4WA 2HMIA 3BS9A 2FJDB 2HPUA 2DNMA 4U7CA 4H4KA 4IOAQ 4CZCA 1O8BA 4IYQA 2VZ9A 2ZDOA 4MAKA 2R8HA 1U4BA 3EMTA 2F9JA 2I38A 2ASLA 3MM8B 4WF9Q 3OSNA 4AXIA 1D9AA 2MKHA 4OZ1A 5LM7E 3Q8QB 1DBDA 2CA9A 3VAJA 1NJZA 4N41A 3E2EA 2L08A 1R31A 3W8GA 2WVCA 3UE2A 4ZLNA 2JOQA 5CABA 5J2QB 1SQEA 1VDHA 2OPPA 5EGYA 3OFEA 2MGZB 2I2YA 2M70A 4ILLA 2V67A 2R7OA 3BZQA 5M2PA 4YY3J 3RB3A 1RLDA 2NXNA 4JB8B 1HPZB 3RJMB 3MXHP 1FJCA 2AJ4A 3Q2TC 4MT1A 2W9BA 3P3DA 3FCVA 3RUBL 1VQ9S 1DLOA 4WKYA 2E66A 4ZN3A 2CPZA 3EDQB 4HHHA 5KAKA 2QFIA 3N79A 2ZH1A 2CPEA 1YITS 3MPWA 2XO6A 4FDFA 4ED4A 2JEJA 2M4MA 4B02A 2CQIA 1EQ0A 2EBEA 3EUNA 2G1HA 1ZM2A 3M6XA 1RT4A 3M2UB 3MMBB 4O4GA 2XI3A 5A0YB 4CH1A 2OGUA 1X5TA 1T02A 3OBIA 4IO9Q 1S0MA 3W2VA 1BY9A 2D3UA 3AA9A 4YQWA 3W9HA 4EMDA 3DKDA 2K8GA 2V2KA 3HK2A 4ZP8A 3ZZRA 2DO0A 3T5HA 1WHXA 3N28A 2FC9A 3P45B 4WXOA 2CNKB 1CJTB 1N8RT 1X4HA 2QTWA 3O8WA 1YX2A 2Q6CA 3ENWA 3D4JA 1CBKA 1X5SA 2KXFA 3MCMA 4WKRA 2V8HA 4LSNA 4KB7A 4Y2AA 4TNOA 3OW2R 4NCBA 1B64A 2XYHB 2ZH2A 4ZK7M 4KO0A 1RADB 1PYTA 2BBEA 3MOZA 3ZZ0A 5D4PA 1S6PB 4DFJA 1RCXB 4TKTA 3PW4A 2UVRA 4C0HA 2E9RX 5E3CA 2NS1B 2HLUA 1FT8A 3H5SA 3EPIA 2YPYA 1ZPWX 2Z0GA 4Y00A 4DSFA 5LMUF 1U1QA 3OTCA 2BJ1A 5LMUJ 4DG1B 2Z2LA 2V0NA 3DLGB 3Q8PB 3KK1B 3T1YJ 2PSZA 1YJWS 5GAGI 2M88A 2N7YA 2AHOB 2B8QA 4USHA 3EZUA 4OYWA 2DRAA 1HMVB 4DF4A 1RAHB 4KHPJ 4JI8J 4U7UD 5B0EA 2ROPA 4NASA 4ZVPB 5AT1B 3T19A 3JB9k 4F0HA 4IH5A 1DQ9A 2FQQB 3B78A 1YK9A 2R8GA 3NG8A 4M5NA 1U7LA 4S0MA 2UXBJ 1RAJA 4O3RA 2EC2A 4DCPB 3OTOJ 1JLGB 1VQOS 1NLKL 3F0NA 6FD1A 4KR0B 3J7YI 3G71S 3CCRS 3EZ5A 4DQQA 1Q95G 5C25B 4LSLB 4DV7F 2XSFA 2XMVA 2WAQD 4IG0A 4WFYA 2DHSA 4JV2A 5KFBA 3M8WA 4P2FA 5CZVA 2OD6A 1Q86T 5J1NA 2XLKA 1E6VB 4A8OA 1WORA 5A8RA 3MUVP 2EC0A 1HBOA 1X60A 4G65A 3UD4P 2QMWA 2J0WA 4C7QA 3HM9A 1RAOA 1M1KT 3Q8RB 3ULHA 2DVIA 1WTFA 3PW7A 2YWFA 5IQQA 3DLHA 2CJQA 2HHHJ 4DPUA 1J2VA 2KFYA 5D77A 3J80Y 2G13A 5GAEU 1TK8A 1IBMJ 4A8MP 4KYZA 2LECA 1Y7PA 2K7KA 2NXEA 4ZPBA 4Q45A 1SH0A 4W98A 3RRKA 1DURA 1JLBB 2W9CA 2F8HA 1F6TA 1SJFA 2M3DA 2QO3A 4DSEA 1TKTA 4F26A 5K20B 1DFDA 3TYTA 4OZJA 4TXSA 3HFZB 2EI5A 2KH9A 5HP1B 2AZ3A 4K5SA 2HHXA 3FSIA 1IBKJ 2KU7A 3R2DJ 1RT1A 3THTA 2NPFA 2QSWA 3GCWP 2GNKA 1N5VA 4A8WA 1VQPS 2F4VJ 1HNZF 4OYOA 4YDDB 4B17A 5DGBA 3I56S 3TX0A 4UOCA 3MM6A 3HPOA 1VQKS 3KJFB 1KC8T 4UOGA 3RR7A 1HQEB 2W4DA 2WB1D 4JOUA 5A6WA 3G82A 2GHPA 3DLEB 3OL9A 2EWHA 2XM3A 2P9CA 4ETXA 1QAJA 2MKYA 3JTPA 2XTJP 2VQFJ 1C0UA 1RTDA 4ZHRB 4CLTA 1N5QA 4Q8FA 4USKA 5K14B 2RNEA 3CDBA 4B9UA 2GMJA 5CH7B 2OPSA 3MHYA 3M4XA 2ZKUA 3WBZA 5MAOA 1X5PA 5GAHI 4FS2A 3BJYA 2DRBA 4IRKA 4LVOP 4Y2CA 3GJRB 2DNRA 4KH0B 3JTNA 3WQPA 3WIUA 1HNIA 3IO1A 3K17A 2BA9A 3SEOA 4RU9A 4DR6F 3O5TB 5J1EA 2XY7A 3IWXA 2H4YB 4NXMJ 4OZ5A 1GAOA 2C2DA 5IM0B 4DSIA 5HSPA 5KFOA 4ZVQB 4PR6A 3MM9B 2XO7A 3T5LA 3KLEB 6FDRA 1QVGR 1ZA1B 1W7WA 5DGAA 5KFPA 1APSA 1UWBA 1Z4UA 1ICEB 5F0UA 1S1XB 1NB2A 1NHKL 2MZSA 1FDBA 5JXSA 2D3ZA 3BBCA 2A10A 3R97A 4DUTA 3PM9A 2VL1A 1FTRA 2DGVA 1IKYA 1Y5NB 3EDRB 3NGKA 2D3O1 1V3ZA 2MZQA 4OI1A 1OPZA 4DR3F 4KJIA 2IM0A 3QATA 2XMWA 1YJVA 4CLFA 3LPYA 2UXCJ 3Q23A 5KG2A 1EAYC 2ZJQQ 2LYVA 1FRKA 1K47A 3OL8A 5AE2A 2C2NA 3PIPQ 4F02A 3I31A 2MKKA 3WZ0A 3AQPA 3TRGA 3ZTSA 4C3MA 2CQ1A 2L48A 2VFUA 1FJGF 2LA4A 1NEEA 4WFAQ 1WC0A 5GMEA 2R4FA 4HI2A 3JSMB 1WKKA 2JSXA 4Y3CA 5E3AA 2YKPA 3NGUA 3SCJE 2GAGC 5DDQC 3I5AA 2CQDA 1HWJA 1WG5A 1EZZB 3N6LA 3ET6A 4LF5J 2HHTA 3QBCA 1RZMA 1T9WA 5FDLB 3CMES 1LXNA 4HT5A 1H73A 4OX9F 1RTZA 3HVRA 1FEEA 3DRSB 3Q8YA 2ALZA 2WSEC 1ZM3A 3DRPB 1VRTA 2OSRA 2C1EB 2QL7B 4X4OA 5D3GB 3NS7B 2ZH6A 1U02A 2R2SA 2C2MB 3PDNA 3QGPA 4RW7B 1RABB 1PC5A 4NEZA 2V50A 4P75A 3CDAA 4LUBA 2FZKB 3MEEB 1TV6A 1YLXA 4OYXA 1IWAA 2B4OA 5CYMA 1IM6A 1TVRA 4MFBA 4QYRA 5KT4A 3JYTA 3DLJA 1KQFB 1S6QA 2FHMA 3PJWA 2ASJA 4ED7A 2XY6A 3VGTA 1RAAB 5KOWA 3UDEA 1H74A 4L72B 4I2QA 2IA0A 4H4OA 4NPOA 4RBTA 5DQHA 4DR1F 2X1FA 5IQ6A 2R7WA 4I67A 3IC1A 5JJBA 1CLFA 1PJ7A 2MY7A 2YX4A 5D0HA 3GLJA 4I6YA 5HQLA 1Z1ZA 2CNOB 3OR1B 3M8ZA 4F3QA 4OYIA 3VGUA 2BJ8A 4DL5A 3RBEA 4I68A 2B56A 3S01A 1S1WA 3IR5B 3NNHA 5HI7A 1H0HB 3D67A 3GJQB 1UFLA 1UZDA 4DL2A 3W9IA 2QL5B 2V5HG 4B9TA 3BEGB 1YSJA 3QRPA 4FNIA 4OI3A 1WI8A 2Z8QA 3GYNA 4FYYB 1I94F 4PEOA 2RMLA 2EKNA 3HSGA 4WYLA 1T05A 4H4MB 4CI0B 4ZPDA 2KDOA 2SXLA 3ETMA 3OTBA 2YX1A 3I4HX 3PHTA 1BQNA 4B3SF 1M0SA 4OMFG 4DOZA 1OY6A 3DRYA 4QW9A 2ZH3A 4X2BA 1R3NA 1F1BB 2CKWA 3M1VB 4GVLA 4P10A 4DL4A 5F8MA 3LGMA 2YNHA 1NMEB 5KG6A 3CB4A 3D1OA 1X9MA 3LP2B 4DV2J 4DV0F 3FCHA 1RA6A 2ZHOA 2RS2A 3R7SB 2FD2A 1NK6A 4KT0C 1VQMS 1D9FA 3UPFA 1LW2A 1RT3A 2OPQB 2P6TA 3C19A 3E3XA 3OL6A 2ZBPA 3E01A 3QSYB 3DOMA 2DYAA 4DR6J 1F5AA 5HROA 5H9FK 2CQPA 2DGUA 1XBWA 3MR5A 4DWIA 3B6BA 1FRLA 4K4UA 4U9RA 1Y00A 3HHLB 4CNYA 2Y8WA 3ZO7A 5L1JA 1C4AA 4CH0S 5J2QA 1HIYA 3D3CJ 4CO2A 1TQLA 5G0RB 1YZ6A 1BWVA 3DCAA 3UVJB 5IWAF 1VC6A 5U47A 3UDLA 5DLGA 2BKPA 5J2MA 2H4WB 3B8HA 3FC9A 1VRUB 5HL7Q 2J5AA 1G6BA 4DUYJ 2B8PA 2EVZA 2RUSA 4PG7A 1RISA 1S4FA 5GMKa 1HNXF 5E7OB 1VBZA 1U6BA 2CJXB 5CD4A 2A0FB 2ZHBA 3TAMB 4CM0A 3AB2B 1KHWA 1KS2A 3N5BA 5KFTA 2FVCA 1NCLA 1RAFB 4CO1A 1JLCB 2UUBF 1IQZA 4F0MA 2XY5A 1AB8A 3HLUA 4DPTA 3OVBA 1J5OA 4ER8A 4LRFA 1HR0F 2UP1A 2NZ4A 4V19X 2F8MA 4LRDA 4IR1A 2DGQA 4KHRA 1IJEB 3MEDA 4HT7A 2XC9A 4P9SA 5EDWA 3C15B 3DOKA 1VMBA 3FRYA 4OZ2A 1C1CA 3KHLA 3PR5B 2HVIA 4CT9A 2G2ZA 3FMWA 3D1HA 4J9UE 1SKWA 4A46A 4ZMMA 1F60B 4ECYA 2MQMA 4MKYA 1LWFB 2WVDA 3QGIA 4ZVEA 1U1PA 1MROB 2KG1A 3TARA 4G1PA 5FLXY 3ITHB 4YHHF 4ZLJA 1JJHA 1SJ1A 3CCVS 1RWVB 2BDPA 2VD3A 4YB7A 1QAIA 1NZ8A 3G8QA 2MLXA 5T7LA 3IS9B 1DTQB 2OEMA 2ZH9A 4ILRA 2HKEA 3X1LB 5KFCA 4M5MA
chains in the Genus database with same CATH topology
4KHPF 4Q0BB 3CMAS 2N3LA 3AY0A 3V4MA 4RZRA 1U45A 1N4LA 2C28A 1D1UA 2LCWA 1JWWA 2MB0B 3J7Z5 2AJ0A 3NLCA 4O3OA 2LXUA 2LDYA 2OP5A 1SIWB 5HLFB 5KT3A 1VQ5S 2DH7A 2FHJA 3TANA 3T6JA 4QIEA 2I1RA 2RDIA 3TA2A 2O01C 1SV5A 1U25A 2UV8G 5GADI 2XGQA 4QQBA 1KFDA 5LSLA 5HQ8A 5HMYA 4O4RA 3DMJA 2FJVA 3B4MA 4RUHA 3OSPA 1B0TA 2NXUA 2VBWA 3I87A 3S6EA 4D3GA 1P8GA 2XCAA 3CCSS 3CCQS 1N0VC 2KT2A 2DCUB 3V81B 1LWCB 4ED0A 3G96A 3IR6B 3RU0A 3OXFA 4ED2A 5I3UB 3CCJS 3DGPA 3M30A 4J9MA 2HS0A 2M7SA 5L1KA 2PDAA 4ERDA 5HO4A 5KFHA 4TU7A 3M8SA 1RKJA 3L7PA 3F44A 4F50A 4OHYA 2OFHX 3GIJA 1Y3KA 4BS2A 1OQ6A 3SSSA 2E44A 2V94A 2KN4A 5B08A 2M8DB 1V6HA 2J7UA 2Q43A 4BCAA 1XEZA 4J9LA 4R8UB 3RR8A 1IBLF 2JC0A 4EBCA 3HMJG 4Y2KA 2E29A 2QYCA 4DLGA 2HWTA 2V8DA 1WEXA 2O3DA 3V6DA 3SDEA 4I6WA 3M9MB 2OLWA 3C6TA 2JHEA 4QPXA 1E6YA 4NLPA 5DG8A 2DNZA 1NK5A 1F2GA 1WD6A 3QYYA 4WTYA 4USIA 3V6JA 2RRBA 2JFDA 3EX7B 2DO4A 4EBDA 2LEPA 1KOHA 4M8LA 4DPOA 4UW2A 2AQ4A 2BJEA 3FEYB 5D4NA 2L9WA 2VH7A 2R7SA 1M5SA 2I5JB 2NUHA 1RDRA 5B0GA 3EYZA 1VFJA 4GMKA 3MAHA 4KV8B 2CVEA 3G8SA 4LF9F 2IVMA 3A8EA 4J9QA 2ZZMA 3K5MA 4RUCA 1N0UA 4F4YA 4ZPCA 2B5JB 3H25A 1SKSA 1B7FA 4GO7X 5KT6A 1H2TZ 3NNCA 2HHSA 2YWGA 1D3WA 3CSKA 4I7FA 4Q7AA 2BR0A 1UVKA 1LW0A 1YI2S 3E8OA 1OS5A 4R25A 4RW6A 4IDKB 3BGUA 2OMOA 2JLEA 3GSDA 1NHVA 1XK8A 2QRRA 3AQOA 3OTDA 3VALA 2A3JA 1BC6A 2I0XA 1BQMA 2GJIA 3VTIA 3BGLA 3O6QA 2VOOA 2YQ3A 4UQTA 3H5UA 3MM9A 4HKQA 1YRUA 4I56A 1U6FA 2FUG9 3GV8B 4K4SA 1JJ4A 4EZ9A 1S1XA 3RAMA 2YWEA 3RRHA 1M5PC 2VPWB 2FJWA 4WFBQ 4M95A 4ZPAA 4J9OA 3HVTA 3MZIA 1IKWA 1R0AA 5DDRC 3CVKA 4MKBA 3D54A 3LAKA 2ZH8A 1PGZA 1VIOA 3CJ2A 3U27A 3KK2A 3NMAA 1TR0A 2W8LA 1DZ5A 1R8BA 5J2PB 4CO4A 4YR0A 1WTBA 2DGSA 3BM7A 2HMIB 3CCMS 5LMNF 3PRBA 2LQ9A 3N5FA 2ZHAA 5L9NA 2IA6A 4K50A 1R89A 1IXKA 3MM8A 1R43A 1LWEA 4NMLA 1X9SA 2PGCA 1TUVA 3H2UB 5D4LA 3KLVA 3GB0A 5DRKA 3KWMA 2O66A 3EXCX 3DRSA 3IN5A 1ZH5A 3HHKA 3DRPA 4TQRA 1N5SA 2HAIA 2MGZA 4I69A 5KG1A 5L38A 1GX5A 4JV1A 1DAXA 4E0DA 4ES2A 1RT6A 2VG5B 4DN0A 2QSFA 1KD1T 2KJVA 2OJ3A 2XB2D 1F0XA 1N54B 2VBXA 4OX6A 2W9BB 2HZCA 1X4DA 2CQ2A 1KVJA 1IR0A 2V9KA 5C42A 2FGCA 4Q44A 4C8NA 2GQ2A 2QV6A 1R8HA 4Q5VA 1TL4A 1UEVA 2RKIA 2XG8A 2IBOA 3V2UC 2IC3A 3R1LA 4F4XA 1T95A 2RF2A 5GVQA 3AH6A 4CO3A 2DH9A 1LXJA 2R2UA 3GILA 3UR3C 1T94A 4B3RF 2PA3A 4NOHA 2RRNA 1PILA 2EFOA 1L3SA 4CO0A 4KC5A 1CG2A 3QO9B 1BWEA 3I32A 1YGYA 3B82A 1SL1A 4XAKA 1WHVA 5A8WB 2E1RA 4D3HA 4OJGA 3HHNB 3H8YA 1NB7A 4RBUA 2RE1A 2D41A 2GIQA 2ZOGA 4NA2A 4ECVA 1VC0A 5BYSA 3G9CA 4KSEB 5KG0A 2X1AA 5KT5A 2YNHB 1IQTA 3C3LA 3PIOQ 2YX7A 3EGWB 1FD8A 3QLHB 1JLFA 2GMHA 3K7RA 4NLWA 2J6UA 2DIUA 3GIIA 4FPRA 5F0WA 2UVUA 5F3TA 3C2PA 5KFZA 3MOJB 4C8KA 1KEKA 3GG1A 2IYGA 4HVZA 5AXLA 5HROB 4ZP6A 3ZFVA 1HQEA 1VJWA 2XMUA 1JLEB 4OHVA 5GAHU 1Z2ZA 3HFKA 2LLZA 2KM8C 4WU2A 5SZTA 4FF4A 1XWLA 5CYQA 3HZGA 1G1XA 7FDRA 2CIMA 1FKPB 3ZZPA 2HS4A 2K1RB 2BQ3A 3IAM9 3IXQA 4FF2A 3H4DA 3IGVA 2ZOFA 3KLFA 4QCLA 1Q79A 3IA0A 1JLAB 1TL1A 4AQYF 2QE5A 1AROP 1JLCA 2RDJA 4DS4A 1UETA 3FQLA 2UZAA 4DDFA 1N32F 3V5RA 3NCRA 1N88A 2A1BA 1HQUB 2C3OA 4KRWA 5DO2A 2IM1A 4ZA1A 3PXGa 3KLEA 3T1YF 3POTB 1UKUA 3TOQA 3JSMB 2GIRA 1FXRA 2XEXA 2UUTA 1XMBA 3CD5A 2JWNA 1UJ6A 3MMAA 2MQQA 2R8KA 1HHTP 2LDIA 4WZQA 3U7JA 2UU9F 2A18A 1CC8A 2CQ0A 1NK0A 2EW9A 3DHXA 3ISZA 2HQ3A 4NCGA 1JLBA 4ECWA 1LWFA 2LKZA 1VQ7S 4QU6A 2IJNA 2CPHA 5E3RA 2Y0SD 1HWKA 3NP5A 4B9LA 3PHEA 1S97A 3CD0A 4HI1A 4NYPA 3I5BA 4ES3A 1LFPA 4M63A 2IM3A 1KOOA 1V3RA 1OIAA 4OLPA 1ULRA 1WEYA 3NWGA 4IH7A 2KHDA 4Y28C 2AD9A 1SKRA 4K4ZA 4CCHA 2CZ4A 1NK8A 3TR5A 3OQ2A 2YH1A 1VI7A 2OTJS 3H2VE 4TYAA 3VCDA 3KHHA 4NRUA 1RTDB 3KG0A 2U2FA 3ZC4A 4PXEA 3L09A 2CPYA 4G1IA 2UUAF 4ZCIA 2WHOA 4QYZJ 4CO5A 1R6YA 3MEEA 2YKOA 4OZLA 5CYMB 2YTCA 1TVRB 4MFBB 2MZJA 2EPIA 3K2YA 4C3KA 1N52B 2DIVA 3SSRA 4I2QB 1FCAA 2B4UA 4I0WA 3ENQA 5H1SV 3P96A 3BSNA 1N56A 2KZMA 3UI3A 3P49B 3V81A 3K8WA 1S1WB 3CJ3A 4LF5F 1IUJA 4PWUA 1DRZA 3CT9A 2DHXA 2YWKA 3DYAB 3G86A 4JV5F 4OFZA 1KFSA 2CVIA 3I0RA 3IBWA 5KG7A 3MFHA 3CJ5A 5L9XA 4C8YA 1YJTA 3DXSX 3CO9A 3LGNA 3NRBA 5KFNA 1DTTB 1HFEL 1OSCA 4ELUA 4X4UA 3I9ZA 2RUGA 5KFIA 1QTMA 2GHVC 1SXLA 2DITA 1Q8LA 1U49A 1FRHA 4CIOA 1T3NA 1ZTTA 2XSJA 1PC4A 3K57A 4NYZA 5E3PA 3NMRA 4IQXA 1SH3A 4NZ7A 1LW2B 1MWZA 1RT3B 3MF5A 4N8NA 2J6SA 3UDCA 2JEIA 3HDSA 2XS7A 1UVJA 4OX7A 3SI8A 4JYAF 2Q1LA 4PG6A 1NK9A 1CC7A 1VGYA 3DM2A 3MMCA 1S9GA 3BGRB 3PW0A 4EZ6A 4I2PB 2AF6A 3SYZA 2I5JA 1BQXA 2L9DA 4LSLA 1MW7A 3GFHA 1S0VA 1TV6B 3K58A 2H5EA 5HN0A 4GKJF 4NZ6A 4C9DA 4UUXA 3KLGA 1VRUA 3WX4A 5BR8F 4F2SA 4NZ0A 3MURP 1TKZA 1FKOB 2K3KA 3HHLD 3KJVB 3O2IA 1U8SA 3N6NA 4Y65A 4EO6A 2FJBB 2BW2A 4LVNP 2J6TA 3I5CA 4XIUA 2VA2A 2WB4A 4JI1F 5EN1A 1S0OA 1J5OB 4LQ3A 3MD3A 2IM2A 4QZVB 4URSA 2MDAA 3VWSA 2M8HA 2IYIA 4TU8A 1JIHA 2ZOMA 4X4NA 4IFVA 4DEZA 1OO0B 3V4IB 3OVSA 3OR2A 3QIDA 4MYTA 2CPDA 3G6XA 5KG5A 1VQSA 2R7TA 2D3OR 3BO4A 4OJ1A 3MDFA 3LQVA 1XC9A 5HP1A 4PPDA 4PWDA 3JAMY 1ZZFA 3KKFA 5LJ3Y 1QSSA 2ZITA 2YNIA 3HVAA 4EBEA 3CC4S 2YNGA 3PEHA 4A8FA 3IS9A 4Q8EA 5J2NA 4DV4F 2X1GA 3ICLA 2OPQA 3W2WA 1VQ4S 2NUUG 1IJFB 4A8YA 3PO4A 1U1MA 2CPFA 1SUQB 1RK8A 2FTRA 1LWEB 3ONQA 1RT2A 4L6V3 3M8RA 3KHRA 1HBUB 1NKBA 5KFRA 3ZZUA 1VQ6S 1ZETA 2IFXA 2DBBA 3OXLA 5G0RA 5F8NA 2N3OA 4KGMA 2VQEF 2GCFA 2RILA 2IAJB 2XMKA 3IFEA 1T03A 3LO3A 1IBKF 3ZZYA 4V19J 4MK8A 2WONA 4JI6F 2J9DA 3CE8A 2ATLA 5GAGU 4QR0A 4X84A 1ZOTA 1MMNA 1RGVA 1UW4A 1UAWA 3UCUP 3OVAA 3QGHA 2P5VA 1YJNS 2K7JA 2JVRA 2Q79A 3NAHA 2VODA 4BBYA 2KI2A 3HHDA 5IFMA 4OHXA 2A2DA 2OFGX 5L39A 4B9MA 3CIZA 2CQBA 4CNZA 3CULA 2IMWP 2DNLA 2ZFHA 3CD7A 2FLPA 5K8NA 2QZ8A 1X5OA 2WBMA 4X62F 4K59A 4RNNA 2ZNYA 4C0OC 3RZAA 4X65F 4KQZA 3CDWA 4AL6A 3DXBA 4H54A 3NKYA 4MIBA 4KKOB 1X4AA 2ROGA 4R5PB 4PUOA 1HNVA 2XWXA 3DC2A 4IO1A 1K1QA 3K5NA 3BN4A 1OWXA 2PD1A 1HW8A 1YG0A 2ZKTA 5B0CA 5IT9Y 5KG3A 1DTQA 3W3SA 1P27B 3QLHA 4P7VA 5BJRA 3SDEB 4KTQA 4MKAA 1CPZA 1HARA 2CPJA 2DNQA 3C6TB 5I4MA 3Q0AA 3WC2A 2E5JA 2KYXA 3MCSA 2DGTA 5FDLA 1U09A 2MXYA 2EFVA 2B6AB 1IKVB 2WCXA 3FMBA 5DDOC 4JI3F 3F73A 1CQMA 3NS6A 4DS5A 4TN2A 3H2LA 3R5CA 5BYQA 5HMXA 3RB6A 1KC8T 2DGOA 1JLEA 4E98A 4RBVA 3A1YG 2DNNA 2O1PA 1WHWA 2FHOB 2CJ9A 3KFWX 4JI2F 2F7VA 5KFAA 5KTQA 1UVMA 1S6QB 4ZVGA 4NLVA 3VR1A 2CJAA 2MQLA 4ECQA 4MMOA 4MK7A 4K5RA 1QUVA 3H5XA 2R7RA 2ZH5A 2XZWA 4IR9A 2ZJPQ 2RS8A 2ASYA 3DRRA 4RW6B 1GH8A 3SCLE 2FJXA 1GTHA 1D8YA 4TY9A 1WACA 2RD5C 2VBZA 1N5YB 2NREA 2HWHA 3AHPA 2IMOA 3JSMA 3K5PA 1U1LA 2MZTA 4AL7A 2UXCF 2VKRA 3PV8A 2PT0A 4A47A 4WFZA 3VAIA 1R0AB 1P6TA 1RP5A 2NSCA 1N48A 2PMZD 4BWJA 3RBDA 1KQKA 2PA8D 2DT9A 1IM4A 1WELA 2O5DA 5DM7Q 3T3FA 4ED6A 2M2BA 2RQ4A 4X4TA 2KHCA 7FD1A 3I4PA 2OAUA 2ZH6A 1HBMA 3PW5A 3O1LA 2Z2MA 4GC7A 5F8JA 2D9OA 2M52A 2NLWA 4LMZA 2HS3A 3GV7B 2GQCA 4BC9A 3LOUA 4QR1A 4B3TF 3E01B 2XHWA 4IKAA 4U6PA 3BDPA 4ILMA 1HHSA 3HI9A 3SV3A 4GO5X 2B7BB 3MD1A 4O44B 3K5OA 4ED1A 4N76A 2HG4A 4RNMA 3IRWP 5I3QA 3HHLA 5KFWA 4QWCA 1MMLA 3VQTA 1N6QA 1FERA 4CTAA 4HH0A 3BQ2A 1CEZA 5AXMA 3HKWA 1FKAF 3QJLA 2BM0A 3TX8A 4Q2LA 5KT7A 2DISA 4KHMA 2V4JB 2PO4A 4KV8A 4UUWA 2EK1A 2QA4S 2B4PA 2M9KA 2VASA 4OLOA 2DR9A 3TUIC 1A6LA 2B5JA 2PE8A 1YTYA 1AXQA 1X4FA 3TAQA 4B3OB 4ZS6A 5F9LA 1X4EA 2R7UA 1Q16B 4Z2XA 1SB6A 4FS1A 4ID8A 5CCMA 4RKUC 2J0SD 2ERRA 2VG7A 3HZEA 3VAKA 4F4WA 2VBYA 2V9WA 2MQNA 4C11B 1HWUA 3IG1A 5D78A 2G4BA 1G2EA 4FXDA 2DNGA 1D9DA 4O3NA 2AP6A 5D6GA 4ZDNA 1TL3B 3OFGA 2QA2A 2YH0A 1C1CB 2QFJA 1FDAA 4FYDA 4WU3A 1L5UA 1L3UA 3R5BA 3K59A 4DV6F 1YRTA 4K4TA 3OUYA 2BACA 1MSWD 5A8WA 3DLLQ 4LIWA 1DTTA 1JB0C 1U26A 3ITHA 1JLQB 4YB6A 5ITHA 2MQPA 3OLAA 2VONA 2HLTA 3HXMA 2AX0A 2K2PA 1RA7A 1SIZA 2E1MC 2NPIA 3GWCA 2AYGA 1TFYA 1S1VA 4P6QA 4U7UK 5DM6Q 2QEXS 3FFIA 3HHEA 2E7WA 2BOPA 1AFIA 5LT5A 5F9NA 2XULA 2XNQA 1ZM4A 3KLIA 1RTIB 4YR3A 4IUFA 4OHWA 3T1AA 4QOTA 2HNYA 4ZKAA 3U1NA 2RU3A 3NNAA 1G7CB 1H7WA 3TI0A 1RT7B 2MY8A 1UJ5A 2AW0A 4RU2A 4KFBA 2DH8A 3OXGA 3UR0A 1DQAA 3CCLS 1R8CA 1RT6B 5HLFA 1S9GB 3OTEA 1H38A 2DJWA 4M5DB 2DPIA 3M8QB 1TAQA 2HNZB 2RVJA 4FXVA 4I2PA 3G4SS 3DRXA 3TQ1A 1SV5B 4QR2A 5CQGA 5I42B 2BANA 4EU0A 2APOA 2EG2A 3SZ2A 3DMJB 4KIAA 2KT5A 4AL5A 3MI7X 2K1RA 1C0TA 5C42B 1SH2A 2LEBA 4IFYA 4OHZA 4DFPA 4XDDA 1FF2A 1VQLS 4ATNA 1FKOA 4AFFA 2AWZA 1TKXA 1TK0A 1XERA 1EP4B 2IC3B 3QJJA 1JLAA 2VKZG 2BXJA 2LA6A 1OQ3A 1HI8A 4RW4B 3UWTA 2FJAB 2UUCF 4QWEA 3O3LA 5I3UA 5DLFA 1L3TA 2BE2B 1HQUA 1GNKA 3C66A 1K9MT 3CUNA 1R7IA 1K0VA 3OJSA 4IFVB 2ABYA 1AUDA 3DU5A 1DARA 2ZBCA 5K8MA 1XR5A 2ZC4A 3OR2B 2GHWA 5KFLA 2W4PA 3CJKB 4NCGB 1F5BA 5A6PA 1NJIT 2EFGA 3QZ7A 1KLMA 4NLDA 1LQ9A 1RTJA 2JRSA 1QSLA 2NYIA 3GE9A 4PWDB 1Q1KA 2HGMA 3UFCX 2E9TA 4Y2MA 2BABA 2YNIB 3PO5A 1H2VZ 1ZBTA 2CFXA 1ZAWA 3D0HE 3DU6A 2VG6B 1JNRB 3R27A 4PCQA 4DL3A 1M90T 1S77D 1HD1A 1FESA 2FVSA 2YNFB 2LXFA 3R3TA 4ZPTR 1KQSR 3OHAA 1IKXA