2E29A

Solution structure of the guct domain from human atp-dependent rna helicase ddx50, dead box protein 50
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GSSGSSGFEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the GUCT domain from human RNA helicase II/Gubeta reveals the RRM fold, but implausible RNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DDX50
total genus 12
structure length 92
sequence length 92
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e29A01
2E29A 2M3DA
chains in the Genus database with same CATH superfamily
2R4FA 3R9LA 1YJ7A 1KBRA 3CJRA 2W2OP 3M05A 3KJQB 5IQQA 3CULA 4IFVB 2U2FA 1X0PA 2IM1A 1UEVA 2W4DA 5KOXA 3T1HJ 2PE8A 3EGWB 3PR5B 3HSZA 1I6JA 3VAFA 4CH7A 1HQ2A 1Z1ZA 5D0HA 5L1IA 2XCAA 5DJBA 3RAQA 1WACA 4QU7A 4PWWA 3ZO7A 1AZSA 2B4PA 3QBCA 4X65F 3DU6A 2PFDA 4OZJA 1NPKA 5KG7A 3WC0A 1S10A 2C42A 1QVGR 4KPYA 3MR7A 5HROA 2Y9HA 3HZGA 4ZMMA 4NOHA 2DRBA 3CMQA 4CZCA 2DNRA 1TL5A 3C66A 4TY8B 2WVDA 3DM2A 4A4JA 5A8WB 4DV0J 3X3UA 4FKXA 1HI0P 4X65J 5GAHU 5BR8F 3VR1A 3CJ8A 3FCHA 4M5HA 1Q5YA 4JBCA 4U9RA 3Q23A 3C19A 2J5AA 2YNFA 4USWA 2WW8A 3D6MB 1Y5NB 3AHPA 5A6PA 1YJVA 1YKWA 4OYZA 2HHQA 2R8KA 2MY7A 3TZYA 4HACA 3IBWA 1SC4B 1DBDA 1SL2A 1C4AA 1PYSB 2BJ7A 4DMZA 3SI8A 4RUHA 1D8YA 3W2WA 2RUSA 2EEYA 1MN7A 1RTIB 5B0CA 3PX6A 1H73A 3FBBA 1KEKA 4RW6A 1H72C 4JI0J 1OPIA 4ECYA 4C4WA 2E66A 2HQ3A 1QE1B 1NK8A 4GKKJ 5RUBA 3BDPA 2YKNA 5KFIA 2EFQA 2GHPA 1S9EB 1TAQA 3IG1A 3O3LA 4HTIA 1CS4A 5F8LA 1T05B 2KYXA 5EGYA 3NGTA 5IS2A 1CSJA 4LJMA 5DGAA 1L5UA 3A3PB 2NZCA 2ADCA 3DU5A 1HNZJ 2MKYA 3BPDA 4MAKA 5CD4H 1JLFB 2E1PA 4OX8A 4P6QA 3UD5A 3DMJB 3BREA 1J5OB 3HHNB 4F7VA 2EXUA 3T5LA 1A9NB 1RADB 4L6V3 1EKRA 2KN4A 3HD1A 3OFFA 5E5NA 1S6PA 3M8RA 3IWNC 2VQEF 3OXLA 4KE5A 1BLUA 3UPFA 1GT8A 3LANA 1IWAA 1IJFB 3P96A 3IBCB 1SJRA 3W1YC 3ZTPA 4F3QA 4WFBQ 1KONA 4DR5F 1JLBA 4JI3F 2ILZA 2FYXA 3C16A 1E6YB 3N6LA 1NB7A 1ZTWA 2M8DB 1HWUA 2VBWA 3MM5B 1M1KT 2OMOA 1BE4A 2R7OA 2VDHA 3LP2B 2AGOA 3I6PA 1VQ4S 1TKTB 4KGMA 4CT9A 2GHVC 4PZVA 3QLHB 2UXDJ 2AYMA 4AFFA 2M8HA 1FWKA 4HDGA 4B9UA 1WHWA 1U7LA 4DQQA 2MTLA 2HPUA 3Q22A 1K47A 2HNZA 1Q8IA 4IH5A 2FJBB 3N79A 4MKVA 2CG8A 3MMCB 1RWVB 4LUBA 4MJKA 2FD2A 7FDRA 2MQOA 4F50A 2AGQA 1PSDA 3KNGA 4LR9A 2DNLA 2DKOB 1HNZF 5G0RB 4B3RF 2C3YA 2WOMB 2QRRA 1YBUA 1K9MT 4A8SA 2YNFB 2XI3A 4RWXA 4UOFA 3HKWA 1GXLA 3GR0A 4G65A 3GU0A 1NNDA 3QIPA 4OI6A 4EUVA 4YQWA 1HBUB 5KFZA 8AT1B 1VIOA 4AXJA 4ED5A 1EETB 1HNVA 2EVZA 2SXLA 1X4HA 2AEFA 2XB2D 1LW0A 2DJWA 2OFGX 2P9CA 3QATA 4DPXA 2KFYA 4NCAA 1CQNA 1KHVA 2NYHA 1U6BA 1VHIA 2IIHA 1LOUA 3DM2B 3MPWA 3W8GA 4UY8T 4ZIWA 2FLPA 1RAAB 5GAHI 2MB0B 3D66A 4NCGB 3BN4A 5HBMA 1R8PA 4EEYA 4FBTA 1XC9A 1XNQF 2AD9A 1ITPA 2VDIA 2Z0GA 4O4GA 3J81U 3BO2A 3TVYA 5I3UB 2RS8A 2NZ4A 5KG5A 4MKYA 4F67A 2VA2A 3K7RA 1FK9A 3PKYA 4X4RA 3BDEA 3KLFB 5KG6A 2CFXA 5IZHA 2FVRA 2VL1A 1FXDA 2HWIA 2XSJA 3I56S 3BO4A 3JXOA 4TU9A 3GYNA 4JYAF 1LEOA 2DGWA 2PSZA 5KT5A 2HHTA 2HW3A 4A47A 5ETPA 4NLDA 5LJ3Y 2LXIA 4DLEA 2HMIA 2WVBA 3DCAA 2UUAF 1U09A 4DCJB 5I4MA 2D41A 3J80U 3A3OB 4NA2A 4U6PA 2QLJB 1M90T 3UN5A 1OJ4A 1FKPB 3DOKA 3R7NB 2HG4A 3UD3P 4ZIVA 1IBLJ 1SUQA 1FXRA 2MLXA 4DQPA 1A7GE 1JLEB 2MEWA 2IJFA 5B7WA 1VS3A 2AQ4A 1K44A 1HD0A 2GO8A 4NLXA 1C1CA 3HHDA 2YPZA 4I1TA 4IFYA 5CZXA 2QZ8A 3SV4A 2XBPA 1Q81T 2UUCJ 1P8GA 1RUSA 4OMFG 2KRRA 2WB1D 3PYGA 1SC6A 1M5OC 1VLOA 3GJTB 3E01A 4PXEA 3M9OB 1UW9A 2PFFB 4WTYA 2BBEA 2RS2A 4OJHA 3W66A 3CCQS 3T6JA 1HHTP 1N5TA 2HHWA 2LXUA 2Z2LA 3V5RA 1NDPA 1WC1A 4DJBA 2HFOA 1XMQJ 4IFYB 2A1BA 2JEGA 2Q3PA 2DNKA 1N34F 4JI7F 3PX0A 2C3UA 5B0BA 2HHHF 2UXCJ 2UUBF 5AE1A 1FJCA 4JI0F 4P2MA 3V6JA 1X9SA 2I2YA 1IKXB 4IOCQ 5I42A 4IUFA 3GV7B 2ZHBA 2XS5A 4M8LA 2OEJA 3C6TB 4LRFA 1WI6A 1SC3B 2HVDA 3AJ1A 3DN9A 1B4SA 2O1PA 4Q2MA 4NPOA 4RW4B 4ZA1A 5T14A 1GH8A 2HQIA 2Q6BA 3VVTA 1VLYA 2FHJD 1FTRA 2Z2MA 3AB4B 5FDLA 4L75A 3TA1A 3SSSA 1BD6A 3MFHA 1NSQA 1LW2B 3P4UB 3DGVA 2AF6A 4QW8A 5IT0A 4I68A 4CLUA 4V1Ak 3S7RA 4LSLA 1T3NA 1RT6A 2B9XA 2FY8A 4GC7A 3QT8A 4FNHA 4F3OA 3MEEA 1YK9A 4ZHRB 4F4YA 5HMWA 2KXHA 4XDDA 3HSGA 2Z30B 4U8YA 3MAHA 3OLBA 1QTMA 3DNCA 4DUYJ 3PW7A 4HI2A 4OZ1A 3TW0A 2HS4A 3KLGB 3RBDA 2MZ1A 2WSCC 2Z57B 3FFIA 4K4YA 1HW8A 1VRTB 2JL9A 2NSCA 4C8YA 2DXFA 4KJIA 3M8QA 1SJFA 3SIPB 3LGNA 4M5DA 4EFAC 5D4LA 3LAKA 2R7RA 1HQUA 4Y34A 4F2RA 5ETSA 3P6YC 4C0OC 4K4UA 2CNKB 3SSQA 2QLFB 2ILYA 2JFKA 3BGRB 4R0JA 1YDLA 3BS9A 5AXKA 4CM2A 3FCVA 5L39A 1FKAF 3A4TA 1RT2A 3J7YU 2HK3A 1RHUB 5D4OA 3GJRB 3KHRA 3K17A 2G13A 2GJFA 3VAIA 1PILA 4ZP7A 1HWJA 1FCAA 1S57A 4UOGA 5HMZA 2CYYA 3TA0A 2R9LA 3T1YJ 3H7HB 1KLNA 3CD0A 2UVVA 4ZOSA 1VR6A 4LF1A 1NHKL 3NGKA 4MKAA 1H98A 4ANEA 3EVMA 3ILIA 4QIVA 3OUYA 4DL4A 1EP4A 3KUEA 3PW2A 4C11B 2NXCA 1S6QB 1T9YA 2NPFA 2LEPA 1RTHA 3TOQA 2HNYB 1XNRF 5C24A 2KM8B 1NJZA 2EFOA 2UXCF 3GIMA 4BWJA 3DXSX 1MU2A 3RB3A 3D7SB 1S1WA 1AUSL 4DV2J 4ZJOA 3LPEA 1FVQA 2ZM6F 1SKRA 4OHXA 1SVDA 4QIGA 4CRJA 4OYMA 3OUYB 4NLTA 4ECQA 1X4DA 4K5RA 1G7CB 3MAAB 2DCUB 1FERA 3RU0A 2EG2A 4NYPA 4P9SA 4X4OA 1W2BR 2YKMA 3MR2A 3I55S 4A8MP 2OD4A 1VOMA 1VRQC 4Q7AA 3MM6B 4JI2J 4Z7YA 4ZP8A 3TX0A 2BUNA 3RAXA 4RNHA 2LVWA 4KYZA 1R31A 4JUZA 2OSRA 3KLGA 1UVKA 4HT7A 3WDOA 4MTPA 3I32A 5F8NA 4LSLB 4DR2J 5D0RA 2VQFJ 5DLGA 5ETRA 2IM2A 2YWWA 3IM8A 3FJ2A 2XZWA 2GZOA 4DV3F 4PWDB 1DHMA 4XAKA 3TAMA 4OYOA 1I51B 1F5BA 2K1RB 2K7JA 3CJKA 4BDPA 3T9NA 1JLQA 4DV7F 2FJAB 3T6BA 2OI2A 2DNMA 2YWEA 3PIPQ 5LOQA 4QU6A 2CJYB 1HNWF 3D28A 3CCJS 3KLEB 3PYDA 2PMHA 2KDOA 1CS4B 2FVSA 4IO1A 5FDLB 4H4OA 4WFAQ 2LKZA 4M5KA 2VG7A 2NXEA 5CD4A 4Q45A 3CO0P 3I5AA 2ZUAA 2ZOFA 4OJ1A 2JDJA 3G87A 1JKHB 3G96A 2AV5A 2G2OA 1SPBP 2FPHX 2G2YA 3FQKA 4I69A 2LMIA 2E7VA 4P2SA 1IKWB 3ILLA 1WKJA 2MQQA 4ZCMA 3H2VE 3MPVA 1IR0A 1FE4A 3C14B 4HL9A 2BJEA 2V8VA 3J7YI 3BH6B 2HFUA 3AOCA 4YY3J 1RTJA 4RKUC 2FIUA 1NU4A 1GQEA 1R8AA 1S1TB 1T95A 3KHHA 4ECRA 1D9DA 2XSFA 4X2BA 3M2RB 2FVCA 3ET6A 3A12A 3MURP 1DLOB 2RQ4A 3Q8PB 4ZPCA 2RDJA 1RTZA 1XERA 4UTGA 3S6EA 2AEMA 4WCEQ 3KFWX 2B4OA 3OR1B 3V2UC 4DQIA 1TR0A 1UA1A 5GVQA 2KTQA 2XMUA 2ZFHA 2IFXA 5A8WA 4UY85 4K0KJ 1NH8A 1XTZA 3N5BA 4NASA 2VV5A 2V9WA 4LF5J 2RKIB 1TL1B 1KP6A 2GO9A 3ZZOA 3CO9A 4FZVA 1NBEB 2DNYA 2VF3A 3B54A 2AZ1A 3PRBA 2C2RA 3HFKA 5HLFB 2J6SA 3W62A 4ED0A 1Y9OA 3DGPB 4DPOA 1FKPA 3DOKB 5A8KA 1FWPA 1RTDB 4X4QA 4F4KA 1HA1A 1RWNB 1WORA 1SH2A 2IA6A 2GQ2A 1N52B 2UUTA 2UVUA 2AIRB 2CPIA 2K1RA 5DG9A 3KLHA 1Z4UA 3DXBA 1RAFB 1VISA 3EPGA 4DCPB 4USUA 2KZZA 3DOMA 3GONA 3VQSA 1IKVA 2V8DA 1U1OA 1TKZA 2OAUA 1VQKS 1NM2A 2JVRA 2PDAA 3QJPA 2QT7A 2E5LJ 4HKQA 1SQFA 3PM9A 3DHWC 4UOCA 3J7Z5 4O3RA 1TQLA 4ZN1A 5HBMB 1WTBA 1JIHA 1WSVA 3DHXA 4F25A 1G3OA 5DQHA 4OYXA 3Q8RB 1X4GA 3T9ZA 4RNOA 3G6VA 4J9KA 4KAIA 1X4FA 3UWTA 1UTAA 4OZ0A 3PTWA 1FNXH 1Q86T 4F0MA 4ETZA 2VBXA 5DETA 4NZ7A 4P73A 3AJ2A 4C98A 1UVIA 2UZAA 4DHVA 4M94A 3M8PB 3I9V9 2B5JB 3BYRA 2N82B 5J2MA 2DK2A 2ZBQA 4J7CA 2H48B 4DL5A 1S7IA 2HNDB 2ALZA 1RCXB 1HBNB 2H5JB 1S0VA 1FWLA 1S4FA 1ZM2A 3VGTA 4DV5J 2KHDA 1H3DA 5DQGA 3M32A 3GIJA 3C46A 2ZNYA 4RW4A 3IXQA 2DGTA 5CYQA 3TEGA 3HJVA 4IQMA 3TUZC 3R1LA 1NK6A 1G2EA 1APSA 2FZKB 4PCQA 4XPEA 1WEYA 2KKHA 7FD1A 4K4VA 1N5SA 1VQ8S 2LQBA 3G6YA 4TLRA 1S9GA 5LSOA 3TUPA 4TYBA 3BBCA 1R8BA 1CC7A 2R7WA 1K0TA 2IYGA 2X1AA 2E9TA 1WEXA 3MM7A 3NWRA 2VG7B 3VZIA 2CPZA 3GFYA 4NLRA 1ULRA 2DITA 2DY9A 3VGSA 5HMXA 1BUXA 3KKFA 1H6KX 2YXLA 1JKHA 1TKXA 1YTYA 4IRDA 4UT4A 1X5TA 5J1EB 1HI1A 2LQ9A 4LQ9A 1RAHB 3BZQA 2HBYB 5DS7A 3TAMB 2OIHA 4DLGA 1SJ4P 3PV8A 1UFWA 1V9OA 4WFNQ 3EDRB 2DGUA 4PG7A 3CPWR 4IQXA 4RBTA 3WX8A 4DL3A 1VQ9S 3L7PA 1PYOB 2CXEA 3I96A 3M8QB 5E33A 2DR5A 1LXJA 2OSQA 4EI2A 2ZZNA 3H8YA 1S7HA 3O6QA 5DG8A 1N6QB 2QG9B 2W01A 2WSEC 2QX0A 2HGMA 2OD6A 1RT3B 3FK4A 4DR4J 2M2BA 1UVNA 3I82A 4K59A 5C7PA 3MUMP 2AYEA 3QZ7A 2Y8YA 2L08A 2DIVA 4EMDA 1VC5A 3D67A 4DN0A 4TNOA 1RBOB 3H20A 2JEJA 1IQZA 5D77A 1L3VA 4YB7A 1VRUA 3TYTA 5M2UA 4RW9A 4XTTA 3JSYA 3NG8A 4Z7CA 4P10A 4C2MA 1N32F 2G0CA 2YWHA 1U1KA 2EWHA 2Q6CA 4PPZA 1LW2A 2UUAJ 2YVSA 4ELTA 4Y2CA 3IA0A 2HHHJ 2NQPA 3T3FA 3CDUA 2VODA 3T5HA 2MKKA 2HVHA 2JLFA 2W9CA 1NB2A 3LOUA 2BABA 4BC7A 1LWCB 1SIWB 5ETVA 4ED2A 2D9PA 1VMBA 3EGNA 4PR6A 4C0HA 3PR4A 1S76D 5B0GA 3NP5A 2GW8A 3AB2B 2HQDA 2PN6A 4NWBA 1F0XA 3VVUA 3CJ2A 2EBEA 4ECVA 2GAGC 2ZITA 3FEZA 4UQTA 4Y2MA 3T1HF 3RB4A 5CCLA 5IXUA 3KG0A 2M0GB 4CT8A 4YY3F 2XCPA 3R27A 1Y11A 4F3MA 3TP2A 3HF5A 1RE1B 2XULA 1TKXB 3GILA 4LFAF 4IRKA 2HS3A 4NYZA 3H5YA 1SI9A 4Q2LA 3UR3C 3M8WA 4OZNA 2KO1A 2JRSA 4KH0B 3G86A 5T7LB 3UN2A 4B3TJ 2G1DA 1G4CA 4KV8B 3ELHA 4FNIA 4ZP6A 2MZRA 3MEDB 1JLGA 1RAEB 1SXLA 2BJ9A 1LK5A 3MWBA 4NLPA 1WKKA 2EFPA 1D9AA 2B5JA 2I1RA 3IR7B 5J2MB 5MLCV 3JSMB 3HM9A 5IV3A 1X4AA 3I0RA 3ILJA 3RJMB 5ETMA 4A8OA 4C11A 3EPIA 4LBHA 2RF2B 2Q79A 4NRTA 1JB0C 5U47A 2W8KA 4ED7A 1HD1A 1MW7A 4ECSA 3CCSS 3EXCX 5ETKA 1JK9B 1KQGB 2GA7A 2J0WA 1CJUA 1R6YA 4UUXA 1FA0A 2DCLA 3EUNA 4CQ1A 4DV1F 2R8GA 3J7A1 3FRZA 2VPWB 1TK8A 1NHVA 1IXKA 5FIIA 2E44A 3EGZA 2RRNA 5J2NA 3I0SB 2FUG9 3AXKA 1S49A 2DO4A 3SQOP 4EO8A 3SMZA 2V69A 5F0WA 2GAHC 1FK9B 2HVZA 2M70A 3GFHA 4IH7A 5E3CA 3VF0B 1QSSA 4LF8F 2OTJS 1NZ8A 4CWBA 4NEZA 2YY3A 5DQIA 3OTOJ 1NEEA 3QO9A 1LNQA 5KFVA 2R8IA 4QWAA 4CLSA 1DTTA 2JFDA 1VRUB 3GLJA 2I8EA 1F2HA 2KB2A 5L1LA 3CXCR 4LF4F 3MPYA 1VK3A 2Z8QA 2DNPA 1NSKL 2HWTA 3M2UB 5KTQA 2DGXA 2XEXA 4ES1A 3HZEA 4KR0B 3UNYA 4FPIA 2MGZA 1G6BA 5KFCA 2KG0A 2ATCB 2XNQA 3CJSA 3P3DA 3C2PA 4EZ9A 2CQ0A 3CB4A 3LF0A 3QT5A 3NAIA 1MMDA 4MYTA 3MUVP 5JVGQ 2BOPA 3RB0A 3FVYA 4GVBA 4K50A 1RHQB 2H51B 2RILA 3PYEA 4GMKA 2H1YA 3U1MA 2UXDF 2GMJA 3KK2B 2GIFA 3Q8VA 1NKEA 1LWFA 1NHUA 2AZ3A 4ITSA 2JNJA 1C1CB 3BBBA 4FYVB 2IM0A 1YJWS 5E3AA 1U49A 3QLHA 4LF8J 3SQGA 1RCOB 3L7OA 2W7OA 2HFNA 4OZLA 5THWA 4DF8A 2ZBPA 5HQMA 3HVTA 2IVMA 2Y1LB 3A1YG 4GVBB 1IKWA 1C4CA 4YB6A 2V8HA 2EC2A 4R0EA 5J1PA 4DS5A 4DPWA 2OEKA 4I2PA 5AXNA 3TRGA 3TEHB 3ILOA 4R25A 3EMTA 1FKOA 1VK8A 5L9XA 2XQCA 1KN6A 1WDDA 2P9GA 4YB1P 3DMJA 2VJVA 2J9CA 4Y28C 3GYGA 1XEZA 1XMBA 2ZH3A 2FTRA 4USVA 4LQ3A 2VBYA 3IR6B 2FLLA 1OWXA 1PJ6A 2DH9A 4LRBA 3AA8A 4FYXB 2UU9J 1I5OB 1IKYB 5IT9Y 4PYDA 5BJRA 2ZH6A 2F9DA 3R1HA 3POTA 2KT5A 1U24A 3ZZZA 2P9EA 1GX6A 1W2IA 4DL6A 3QPIA 4NCGA 4NLYA 2IC3A 1SCJB 2RQKA 4DV6J 5JVHQ 3CJ4A 3W8PA 1FI4A 3BGUA 1REGX 2VPYB 1RDRA 3ULHA 5J2NB 2HRTA 3NBPA 3H5SA 1BGXT 1QJHA 3RGIA 5I3UA 1A0OB 1NKCA 2H65B 2QGFB 3QJLA 3GG1A 2C22A 1NDKA 2CJQA 3BQ2A 2LYVA 1UWAA 1KQKA 3S01A 3ZZRA 3E2EA 4ZDNA 3PFEA 4Q8EA 3BYPA 1CULB 2HZCA 4QR2A 2XMAA 9ATCB 3U1NA 4ZPBA 3IFEA 2LCWA 2ZBIA 4WKYA 1PAEX 2LFVA 4PXCA 5DM6Q 3H40A 1Q16B 4KV8A 1GXTA 1RWMB 3NGDA 2GFFA 5G0RA 4FN5A 2J7WA 1XR7A 2HRYA 9RUBA 2DHAA 4P75A 4KGVB 4LVOP 2CPFA 2RT3A 4D3HA 4U95A 3JQKA 3Q0AA 3WX4A 3HDSA 3JSMA 1S1VB 3OV7A 1H0HB 5D0GA 4ECXA 2XNRA 3QYYA 4X66J 4FP9A 3DC2A 3OFHA 4GRSA 4USKA 1S0NA 1KR4A 2XO7A 2UUCF 4ZVHA 1AROP 1WHVA 3BV8A 5E0OA 1S1WB 4OI2A 4NMLA 2F63A 2DTJA 2KJVA 4B3RJ 4X62J 3GIKA 4OFZA 4OL8A 2RQCA 5BXIA 2CJKA 3IBFB 5CAAA 1U1NA 3ENWA 2KJWA 4DV3J 2EFNA 2F1FA 3TQEA 2ASJA 1M5VC 1S6QA 4DR2F 3THTA 1N0UA 3ZZ0A 3RBXA 3KMQA 1OY8A 2IDLA 2C3OA 2J0SD 2ZNZA 4HVZA 3OL9A 1G1XA 1U0HB 3HP6A 3NXZA 1KS2A 3IAM9 3DFEA 2P6SA 1RTHB 3V6HA 2BYCA 3CJTA 2HNZB 1R7IA 3J81j 4RW9B 2YH0A 3CCMS 1DAXA 1I3OB 3FFIB 4J91A 5H9FJ 3JAMU 3M6VA 3B4DA 3ZTSA 2QMWA 4DX5A 5GMKa 5H9EK 3VTIA 1IBKJ 3DOLA 1F2GA 2RJZA 1UJ6A 3SCIE 2JZ5A 3PX4A 2DNNA 4WP8A 4ZKAA 1I1GA 2CWKA 1LWCA 1IM4A 3ICLA 2VFSA 5F9NA 3F41A 4DSKA 4UUWA 4F4WA 3UCZP 2FVPA 5HN0A 2BR0A 4FF2A 2CQHA 4CNYA 3IRXB 5KT2A 1TKDA 3CC7S 2PEHA 3WQPA 3KYLA 2MKSA 1VQ5S 4BS2A 2ZH9A 1KLMB 1X9WA 4J5OA 4MK7A 3KHGA 5IWAF 2OO4A 1YJUA 4AL5A 1PYTA 1KQSR 1JJ2R 1GTEA 3CC2S 4GKJF 4URSA 5C42B 2XS2A 1NJYA 4PWDA 2BM1A 1XR5A 3EX7B 4DF4A 1M5SA 1P1LA 1RT3A 3LTOA 4G6VB 4XK8C 5SZTA 4B3SF 2ZE2B 2B51A 2Y1JA 2BANB 1S48A 1NXIA 4FYYB 4A8YA 2B9EA 1SQGA 2OPQB 5ETQA 3TI0A 4WKRA 2LA4A 3PG9A 4LIRA 3F73A 3KMSA 3B4MA 1JX4A 1VDHA 4BHQA 2MDAA 3I4HX 2YNGA 2BVZA 2IBKA 3E01B 4QBUA 1NRKA 4G1QA 1M5PC 2BE7D 5HROB 1OY6A 4KFBB 4MIBA 3W64A 4ES2A 1IBLF 1WC5A 2HGNA 3G8QA 5CH7B 1NLKL 2LQ8A 2W4PA 1A6LA 1VYAA 3SV3A 3JTOA 4R5PB 1WSRA 2D74B 5T41A 5BR8J 3NOGA 4B3SJ 4JV1A 5C5JA 3HD2A 2JC0A 3W63A 2FHKA 2XMVA 3MTJA 4MK9A 1S4EA 1TVRB 2DHHA 3HHLC 3UDVA 4ED6A 3NWGA 4WF9Q 4X4UA 1DQ8A 3OPKA 5FLXU 3KOAA 3MEGA 1F3VA 4NLUA 2JOQA 2E9RX 2JLEA 2WTFA 2JH3A 4JI4J 3AT1B 1N5YB 5I3PA 3LPYA 2C2EA 1GMWA 4WFZA 2ZDPA 3VWSA 5IFMA 4F0KA 3R6GB 2PO4A 2JHEA 2OPSB 4MT1A 3TJ8A 2NPIA 1U2RA 3R5BA 5HI7A 5J2PA 2ZOMA 4YR3A 2LQ5A 2AGPA 1K8AT 3GSIA 1U8WA 1DJ0A 2VPZB 5KFDA 4DV0F 3MDFA 4DUYF 4C8KA 4LF6J 4NE9C 2V9KA 1KC8T 3CJ0A 1P6TA 2I9SA 4O23A 3MZIA 3OL8A 2KZMA 1LFPA 2O01C 5C2CA 2KFNA 5IC6B 2VG5A 3QSIA 3THPA 3OR2B 2ATLA 1PGZA 3CTRA 1CPZA 2GJIA 2W9BB 2ZH5A 3W5ZA 3M2VB 4PQUB 5KFNA 1FE0A 3D0GE 1B7FA 1PC5A 1Q95G 2Y1RI 3NS7B 4EK2A 4F4ZA 3DDKA 4JI6J 4B08A 3CE8A 3HT0A 2E7WA 3F0NA 5C25A 3T5JA 2V63A 1BQNB 3KWMA 5AE2A 4JV5F 1CQMA 1MROB 2WW4A 1B0PA 2HEKA 1VQOS 1IBCB 3EM1A 3OR2A 4PAAA 4B9SA 3TJ9A 5LM7E 1OYEA 1HNVB 3DI6A 1QAIA 1EQMA 3NS5A 3LQVA 4F8RA 1WUUA 3NCQA 2OP5A 4D3GA 4DSIA 1CJVB 2MJNA 1XBWA 2N7CA 2YTCA 4JV5J 1NUEA 3NMRA 2QL5B 1FEEA 4WXWA 3THVA 3O44A 1VI7A 1VHFA 2A6MA 2IYIA 3BPSP 4L73A 5HATA 1HNXJ 1HR0F 2BE2A 2HHXA 1TKTA 1YWXA 2KHCA 1NSAA 2ZUGA 3IGNA 3SCLE 4CM0A 5B08A 4DEZA 4DL7A 1XMOJ 2ZKTA 2YWFA 3KLIA 4H4MA 4CTAB 3VALA 4QCLA 4TQRA 1OO0B 4ED1A 5A76A 3AOAA 1SIZA 1JXEA 4TYAA 3VAHA 1P27B 2C2ZB 4TVAB 4QYZJ 4OHYA 1X9MA 4O4RA 3ET6B 1R43A 3TO8A 1JLBB 3CEDA 3D1OA 4LIWA 1FJ7A 4M5MA 2B7CB 1W26A 2E5GA 4IOAQ 5CA5A 2WOMA 1FEHA 2E7XA 4X4SA 5LMUF 2NR0A 1RWXB 2NSBA 3CJKB 2N7YA 4U7CA 2J6UA 3KXDA 4GO7X 4NEYA 3UN3A 1HNIA 5F8JA 5CYMA 2JEIA 4QQBA 1FD2A 2KVIA 2NLWA 3EXYA 3NGSA 3WHIA 3KLEA 4H4OB 1GK8A 3BQ0A 3DLJA 4QJVA 4WJBA 2VU5A 2XMTA 2C2KB 1Y5IB 4CYUA 4G3IA 2WCXA 4N77A 3DLKA 2A3JA 1N33F 3I87A 4O44B 3ZTQA 2KFZA 3L09A 5LJ5Y 2DYAA 1UVLA 3GP9A 3MMAA 3IG1B 4J90A 2HYIB 4WZMA 1BQNA 1LQ9A 1UEUA 2X1BA 4WIIA 5HJXA 2WVFA 3ENQA 4HTJA 2YX1A 2LU2A 2P6TA 3UDEA 4C3MA 4M5GA 1SL1A 3CIMA 4KTQA 3MM6A 3CF5Q 4Y0FA 4NXMF 2Z56B 4I6YA 3H25A 1M1GA 5LMNJ 1K1SA 2XSJB 3C6UA 4HYKA 3Q8SB 5DZ7A 4RPFA 4ZVFA 2EKYA 4OI3A 1WHXA 3KLVA 3KLFA 3GMGA 3N9UC 3P49B 5ETTA 3N01A 5HAOA 4OLOA 3CT9A 2BJ3A 4ILLA 2UVWA 5BYQA 1S72S 2XO6A 6FD1A 2KM8C 3DYAA 4YHHF 2V4RA 2FDNA 1D3WA 1Y5LB 5L8RC 4Q0BA 1BWEA 1RT1A 2HFSA 4HI1A 4H4MB 4CTAA 1HW9A 5AE3A 2NREA 2VD3A 2CJXB 4IR9A 2H54B 1EQ0A 2HBRB 2YKMB 4M1KA 3VAGA 2XGQA 2ZH1A 3GV5B 1YJTA 2BRLA 2B9YA 2UP1A 2W24A 3D68A 3MEDA 1H2VZ 4M5IA 2R2SA 3BSOA 4ZLPA 3IWXA 4TLQA 1U1QA 1QAYA 1FNMA 2CZVC 2HFZA 1X7VA 4FF4A 2CQBA 5A2QY 1WNEA 2RB7A 1RA6A 3DYAB 2D3ZA 3OL7A 1Q5VA 1M1HA 1U6FA 2DXDA 4IRCA 2IJNA 1ZM9A 3MMCA 1SH3A 2B3TB 2MZTA 2Q43A 4BC9A 4LT6A 3AD9C 1RT7B 4DX8H 4KKOB 2AMCB 4ZVSB 3TUIC 1T9VA 2CWXA 1Q53A 5AT1B 4XIUA 4LFCJ 3GWCA 1FF2A 3OT9A 4EBDA 4ZPVR 4C0BA 2IJRA 4L72B 4J9RA 5KFSA 1YJNS 1GMWD 2RMLA 2X7IA 4Y65A 5I3QA 1S0MA 2CAJA 2MKCA 3HFVA 2ZZTA 2MKJA 2DEIA 5FLXY 4WYLA 2DT9A 1T94A 3IAS9 3P5TL 5AXLA 2AX0A 3TZWA 2GQCA 2ZZMA 4AT1B 1H7XA 5BYSA 1IVZA 1L3TA 2J9EA 5G4DA 2C3MA 4QR1A 2JLGA 3PHTA 4LFBJ 3EZOA 3KG1A 5SUHA 1VQLS 2MQMA 3V6KA 3KG4A 3LW5C 4YB5A 2RU3A 1MN9A 4O44A 1EZZB 4RUAA 5LSRA 4DL2A 2K3IA 2X1GA 4KC5A 3MFIA 4USMA 4DV6F 4K4ZA 3A8KA 1N36J 2OLWA 4J9LA 5CYMB 3M30B 2CA9A 2ZD1A 5KFGA 3TNVA 3OHAA 1N88A 3KLHB 4O0IA 3GJQB 2LDIA 2HQCA 3QQCD 2MZSA 4PKDB 3D54A 2J8AA 4LSNA 4CCHA 1TL1A 1Y00A 4CYUB 2RIJA 4L74A 3R5DA 4LFBF 4DDFA 2KT2A 1R8HA 1VJWA 4WYWA 4YDDB 3GIIA 4DFKA 3HK2A 3W3SA 2A10A 3J80Y 1ZOTA 2CJ9A 2M7SA 3CDAA 3FCWA 3L7UA 4NZ6A 4E0DA 2BJDA 3QJJA 3N6NA 1S1XA 1WHYA 4F26A 4TQSA 2CQIA 3MD3A 4WWSA 2XHCA 4FF1A 1UPPA 2V5HG 2W4CA 4RUBA 4DPTA 4UZCA 4QYRA 1HIYA 2BQRA 2LQJA 2JWNA 2A2DA 1NDCA 2CQPA 3OSNA 1IR2A 4WTOB 2ZKUA 3HVAA 3D1HA 3G71S 5IT9U 1Y7PA 1XWLA 2OPQA 2PGCA 5CYJA 4C6AA 3HVRA 1MG7A 2ZDOA 4IDKA 3QMQA 1X5PA 2QFJA 3FRYA 3HKZD 4ZCKA 1Y10A 4ELUA 4CLPA 1B64A 2J7UA 3QGPA 2QMUB 3K2YA 2YNHA 1RAOA 4LF7J 2HGLA 3D1QA 4HHHA 3TZXA 1N32J 3MMBA 3NGRA 5A8RB 4YEAA 4EBEA 3QRPA 2XZDB 4FYWB 4LRAA 5BYRA 2CNOB 3SCJE 3RBZA 2G2ZA 4E98A 5GAGI 1IBMF 2BZ2A 1QAXA 4NXNJ 1GEHA 3HHKA 5GAEU 2GS8A 4EYIB 1V3ZA 3KK1A 2MXYA 3R6LB 3ZXWA 1LWEA 2QJ3A 1Q8LA 1UETA 1RJJA 4JI2F 2HNDA 4USIA 4CO3A 3ZZPA 1AZSB 1WF2A 1TMMA 3M30A 5EWGA 3BKFA 3FBFA 3DRYA 4P74A 1Y3JA 2WRMA 1WG4A 4ZVUB 2V67A 2ZH7A 2ZOGA 1U1PA 4KH1B 2AJ4A 5ETNA 1WI8A 2VOOA 3IN5A 2IA0A 1ZS6A 2VFRA 4DG1A 1M5KC 1S6UA 2BJ1A 1HBOB 4NYOA 3R5AA 2XC9A 3MPDA 2V2ZA 3R5GA 3AQPA 3MM9A 3UO0A 2BXJA 3MMJA 1U25A 1V3RA 1FDDA 2CQ3A 4CH1A 1F6TA 4AL7A 1VBXA 3O2IA 4P2FA 3LP1B 3UW1A 1X31C 1X5SA 4PABA 3V81A 1S9FA 2I5JB 1T03A 1TUGB 2QYCA 4WBFA 4TN2A 1EB0A 1KVKA 1X5OA 1F9HA 3PKMA 3DRPA 3E3XA 1WC3A 4M95A 2D3UA 4USHA 3D0HE 2B6AA 4OV6A 1RKJA 2XI2A 1YBAA 1JLGB 1LKZA 2C1EB 4HH1A 5IM0B 2LEAA 2J8SA 2VOPA 2CQ4A 2XM3A 1TFYA 2W1BA 4DSEA 3IO1A 2ALYB 3W9JA 2A18A 2CPDA 3DGPA 5A8KB 2J76E 1YIJS 3MCSA 1FKOB 4GVLA 1CEZA 4KHMA 4YHHJ 1B0TA 5CCMA 1BQMB 2CPHA 1S99A 3NS6A 4X64F 2VA3A 3MCMA 4QWCA 2E29A 2F4VF 4RNNA 1T0TV 2XTJP 3GCXP 4OHWA 5K8PA 1LXNA 3RTVA 1TK0A 4C8OA 3R2DJ 1AFJA 1F3FA 4RX6A 2O67A 3GFXA 3ISZA 4C8MA 2XHWA 4W92B 2UV8G 1GMUA 1RXOB 2U1AA 1DRZA 2UUBJ 2WBMA 3AOBA 3AXMA 3R5JB 4MKBA 1FESA 1N34J 1S6PB 1YSJA 3W5YA 3J7AN 3US5A 2XLIA 2ZWOA 4OQJA 4F0HA 1DZ5A 2HQGA 2WHOA 3QWPA 1CC8A 4LF9J 4ERDA 2HFVA 3A8JA 3C15A 3JQMA 2CVIA 2MZQA 1S1XB 3OJSA 2BE9B 2Z2YB 3L3CA 1MWQA 5KFWA 3M8YA 4ZPTR 4ZITA 3FSYA 1NPPA 2GGPB 1VRTA 1REVB 2BA9A 3FMWA 2KH9A 3MUTP 2HQFA 4CLZA 3LP2A 3IWLA 1WWHA 1ZZFA 1X60A 2FB0A 3MM5A 4QPTA 3H0PA 3KJVA 1T9XA 1U1RA 1J5OA 2XMJA 1YG0A 3HLUA 2BQ3A 3ISNC 3GYXB 1QSLA 1FHTA 3MAQA 1JLAB 1S5ZA 4R8UA 1RT4A 3VCDA 1U48A 2X51A 4N56A 3MR5A 3PW5A 1F5CA 4IH6A 4WPAA 5A0YB 4YFUA 2YNIB 1D0EA 3H90A 3HHEA 1XQIA 2ZC4A 3W5XA 3K5OA 3IRXA 2DPJA 3BEGB 2BKPA 2VC1A 3NAHA 2F4VJ 2YKAA 2QLWA 2VASA 3BM7A 4N8NA 1JLFA 3OXFA 4RW6B 2VFUA 2XYHB 1FRMA 4Y2AA 3UNGC 5B0DA 3HMJG 1S97A 4FXDA 2XMWA 2O5DA 1FRXA 1J2VA 3L9ZA 2E5JA 2FC8A 1D1UA 5KFQA 2CUYA 4XPCA 4NLGA 4PG4A 2W7AA 2QSFA 1HNXF 4WIQA 3PIOQ 2QEXS 2PA3A 4I7FB 3NLCA 1HFEL 4MYUA 1U6ZA 2V8GA 4ICLA 4U67Q 4JI5J 2OEMA 4ED3A 1V6HA 1LWFB 2B43A 3FEXB 3DKDA 2YQ3A 3LAMA 3SZ2A 4JI5F 5KAKA 3TUJC 3RRKA 3V6DB 1CJKB 3HI9A 6FDRA 2FJXA 2HZVA 1MMNA 4LF2A 2DNZA 3M32B 4N5SA 1H2TZ 1O51A 5F3ZA 2B0GA 2AYGA 3CCUS 3JYTB 4ECTA 2XYPB 1HPZB 1RA7A 3OTBA 3QGHA 2R7SA 4J9MA 8ATCB 1KD1T 2CJAA 1RWWB 1HNWJ 2C28A 2RAQA 5CXTA 4NLOA 5KG3A 2BE2B 3BSNA 1OPZA 4Y2KA 2QV6A 3LP0B 5CHCB 2LDYA 5ITHA 1S9GB 1TU0B 2GIRA 2CQ1A 2HMIB 1RLCL 2EKNA 1AA1B 2YX7A 2QYGA 1LK7A 4HEA9 4C3KA 3G82B 5HO4A 5F8MA 2YX4A 3NBPB 5HP1A 1HLWA 3M2UA 2BACA 2FJWA 3KUHA 4DU8A 2M9KA 1Q0NA 2HAFA 2W9BA 2HRUA 3X1LB 4WZQA 3W9IA 3UE2A 3N4WA 1O6XA 1C0UB 1Q1KA 4DS4A 2GQQA 1CULA 4QIWD 5KOWA 4ED4A 2X1FA 3OQ2A 1T9UA 2CG4A 3I9ZA 4HT5A 1TL4A 3NOCA 2XLKA 1NMEB 2HVEA 4H4KA 4I6AA 2PC6A 2CQGA 2D1CA 2G1HA 4HR2A 4OHVA 4CDIA 5ADZA 2RVJA 3KHLA 1FRJA 5DG7A 1S1UA 4LF9F 3AY0A 3G8SA 1HWIA 1WDTA 5E2QA 5HANA 4A8QA 4JI8F 4PQUA 4PUOA 1IKVB 1P1TA 3SEOA 2QMXA 2VG5B 2IAJB 4UW2A 3SCKE 1F9FA 2GIQA 4DN9A 1EETA 4KT0C 1N5VA 1FX4A 2DO0A 2JC1A 4ID5A 4OV1A 5B09A 3QSYB 2Z2ZA 1NK4A 2R7QA 2MHNA 2XWXA 1XNQJ 1N54B 1LWXA 3LGMA 3MMAB 3ZTRA 2M52A 4QIEA 4C97A 1IKXA 1KOHA 1Y4ZB 2KU7A 2ADBA 4I2PB 1TVRA 1NK7A 1UPMB 3MCOA 1N6QA 1RT5A 3UDCA 2RE1A 1UVMA 3V6DA 3HPOA 2IMOA 3C6TA 3BKUA 3MMBB 5A8RA 3PO5A 4CIOA 4C8NA 2FC9A 1MNEA 2GX8A 1OIAA 1Q4RA 1EJ7L 3BF4A 4GC6A 2CZ9A 3LP0A 3B6BA 2W2NP 2ASYA 2B8PA 3CDWA 2DGSA 3QZ8A 2MLYA 2ROPA 1UP1A 4KO0B 4OI0A 1Q8KA 5I42B 1TUVA 2LLZA 3OTDA 1V5VA 4NZ0A 4DX7A 3EYZA 1SJ3P 2RUGA 2EFGA 3EWGA 1WC0A 4FDFA 4ECZA 1RU1A 4DXLA 4F2SA 5F41A 2FGCA 3HHLA 4U7UD 1NPRA 4J37A 5KG1A 5LMNF 2VZ9A 5DDQC 1WF0A 3MR3A 4V19X 4NXMJ 2E5HA 4OZ3A 3C16B 1NK5A 3PW4A 2BW7A 2APOA 2QIFA 1CVJA 2OPRA 5EWFA 2YNIA 1DY3A 2L9WA 3CWJA 4ICLB 1FTCA 2J0QD 1DFDA 3T41A 3AA9A 2W25A 4K7QA 2PA8D 3JAMY 4O3SA 2KL8A 1JXVA 1T9TA 2DB1A 1JMTA 3EZ5A 4AL6A 1U45A 4MIWA 3K58A 2NCKL 3FDSA 2J9DA 4JV0A 2F8HA 3A8IA 1C2PA 5KFYA 3MXHP 4GKKF 3IP0A 4ID5B 5K8MA 1BMQB 1S9EA 2EPIA 2GVZB 4K4XA 2E1MC 2IAJA 3DLKB 1KKHA 4KGXB 3L4BC 2GCFA 4ZCIA 3LWLA 2K2PA 1RK8A 4ZJLA 1RTIA 2EI5A 4B9MA 5KFTA 4IKAA 3CJ5A 2EG1A 2LU1A 2P2CB 1JQGA 1HBMB 4J9OA 3ZZYA 3HHLD 4PUOB 3LA0A 3CCWA 3BGFA 2IHR1 2J9DE 3ENAA 4Y3CA 4EO6A 2W7PA 4FS1A 4KIAA 1KDNA 4CLLA 5F8HA 1AXQA 3EGVA 2VIHA 4CO4A 1WG1A 2ZHOA 1HHQA 1OSCA 4P72A 5HVHA 2LP4A 1ZAXA 1C1BA 2CIMA 3BB5A 1U02A 4DR1J 1MSWD 4ATNA 4YR2A 2Q1LA 3IC1A 2N4DA 3M4XA 3MAAA 4NLWA 4OI4A 4DCOB 2ASDA 3ENVA 3R8YA 3G9CA 4X66F 1VBYA 2BQUA 3SXLA 3KTQA 2V50A 3IM9A 2ZBRA 2DR7A 1IR1A 3G2XA 2Z58B 2HNYA 3NNAA 2V4QA 4PXDA 1KSPA 4ZVGA 2HS0A 4LREA 3UI3A 1UA0A 2DXEA 3M7VA 3DRRB 5J1NA 1EIYB 4DSLA 4A8KA 2F40A 1RAJA 3MR6A 1RGVA 2GV1A 2K7KA 2KVQE 2V2VA 3R7BB 4X62F 2B6AB 3IRWP 2VG6A 3AQOA 2YWKA 2KXNB 4MH8A 4PEOA 3FQLA 5HVGA 4XDCA 3PRVA 1VQPS 2AJ1A 3BGRA 2YNGB 2OTLS 3CDEA 3CDBA 2HLUA 4DR6F 3HSJA 1ACMB 1Q7LB 1HMVA 2COLA 3DLGA 3IGVA 4JI6F 1M0SA 5F3TA 5ETLA 1L3KA 3U7JA 5IT4A 1FJGJ 2EW9A 3AFGA 3MOJB 2OH2A 3MTKA 3K8WA 3D6FB 4CO1A 3W9HA 1T9WA 2BANA 4RNMA 2V6AA 3TQ1A 3C6UB 4DWIA 1FVSA 3PY8A 4RO0A 1RHKB 1RI7A 1FD8A 2DNOA 1VIXA 2X3GA 2WZ1A 2MQ8A 4A8FA 4YMEA 1WOSA 4WU2A 4W4MA 3GIRA 3NCRA 1O5JA 4U96A 1HYSB 3NNCA 3FUYA 2HIQA 2ROEA 1Y0HA 1IKYA 2XMKA 1RQ0A 3LALA 2D3O1 3PJ9A 2KRBA 3POTB 3QWUA 1O8BA 2OPPB 4ED8A 5D8HB 2B8QA 4ID8A 3NCPA 2OPRB 3NKYA 3PYFA 1BXNA 4IG3A 4OZ5A 3TARA 3O1LA 4QW9A 1VQ7S 4PG8A 2DY1A 3UVJA 1R0AB 1ZAVA 3MEGB 1MWZA 3CVKA 2OUGA 4K4WA 5DRKA 1UZDA 2AW0A 2JJ4D 3RW7A 1EARA 4H54A 5F8IA 5LL6d 3M9MB 5F8GA 3H4DA 3E51A 2H4WB 4H4KC 2EFVA 3HHLB 1D9FA 1ICEB 1KFDA 1X4BA 3ITHA 3PJXA 1KRPA 1O0PA 2HHSA 4I2QB 2RRBA 1GTHA 3JQJA 1JJCB 4JP8A 4DV1J 1Q7YT 4RBUA 1TELA 4KY3A 1SKUB 2DR6A 3FMBA 4NLQA 3Q86A 4EZ6A 2ASLA 1CJTA 3UFCX 3Q2TC 2YNHB 1TUWA 4EGLA 3RRHA 1I94F 1SQEA 2MLZA 3H42A 4Q5VA 3WC2A 1N0VC 2F9JA 4QIFA 3VV2B 3ITHB 4FXWA 4OZ2A 4KSEB 1FJEB 2R7VA 3MECA 3HFZB 3SQGB 1TL3A 3VAMA 1Q82T 4GKJJ 4JI1F 3Q89A 1WTFA 5IWAJ 2MKHA 3HVTB 3WIUA 2VFTA 2MJUA 1WJ9A 2BV3A 2CPEA 4ZLNA 2RD5C 3P8BB 1MROA 2H5EA 2VPXB 2DIUA 4B17A 3CCES 4DFPA 2XY7A 1CG2A 1OMSA 3BSCA 4Y2IA 1SJQA 2R8HA 4W90B 2W9AA 1ELOA 4NA3A 1VQYA 1FDNA 4CLFA 1ZPWX 1N33J 4P7TA 4F04B 3JSBA 4AQYJ 1K0VA 2WONA 1GAOA 1RAIB 3OTOF 2IPOB 4EBCA 3MGJA 4JI7J 1HQEA 1FRIA 1YGYA 2QA1A 2UUWA 4X4TA 1N4LA 5HMYA 2MGZB 1K73T 5KFPA 4WXOA 4RU9A 3HT3A 3BO3A 1ZZNA 4DR7J 1UFKA 3DOLB 3V81B 1AUDA 5HK4A 2IRXA 3D3BJ 4CO2A 2A0FB 3H59A 3JTNA 3LWMA 1TFWA 3VAKA 2V2QA 1ZYQA 2EK6A 2AX1A 4ES3A 1U8SA 3I5CA 3LH2S 1S59A 2QL9B 1ZETA 4JV2A 1FJGF 1K1QA 2DD8S 4UZBA 2Y0SD 2ZH2A 2FHMA 2VHGA 3B82A 1J27A 4M5LA 5KT7A 2ZJRQ 4OX9J 2DHGA 4MK8A 3RUBL 3VHQA 4Z2XA 5KFFA 4YDXA 1AB8A 1V3SA 3EICA 4P7VA 4ILRA 4CLYA 2JVOA 4OX9F 1U26A 2HWHA 2BMBA 3HSDA 4DUZJ 1RTDA 3NY0A 3RZAA 1RT7A 3QFHA 2D7SA 2ZWPA 1S79A 2OPSA 2N4CA 3KUGA 2XG8A 1PO6A 2AYBA 4OX7A 1CJUB 4HDHA 4X4VA 3UD4P 4BLGA 2CDQA 3PNIA 3Q83A 4AQYF 2Y0BB 3CCVS 2VQFF 2NYIA 2ACYA 2R42A 4OYIA 4J9SA 1HWKA 1CBKA 1X4EA 3UCGA 4ER8A 2KI2A 5HVFA 2GMLA 4N47A 4WP9A 3J81Y 2V94A 1BY9A 1LFWA 3OLAA 4KFBA 2PI5A 3K57A 1VC0A 2VFVA 3QAUA 4LF5F 2I38A 2AEJA 3AODA 1RT2B 3K89A 1RWPB 2V8PA 4RWWA 1UJ5A 1EKSA 5F0UA 2CNNB 2ZH4A 2JSXA 1VC6A 3A8EA 3AD8C 2CQ2A 5D3GB 2G4BA 3ADAC 2VKZG 3UR0A 5KT4A 3K5NA 1UZHA 2B56A 2A2CA 1NJXA 3FNNA 3QGIA 1B0VA 4Q43A 1BWVA 5KT3A 1UFLA 1CLFA 3JTPA 4RW7A 4DZ6A 4JI3J 1RT4B 4QOTA 4GO5X 5IQ6A 2VKRA 2GVDA 1WOPA 3TWZA 3S8SA 2C2DA 4AD6A 5EN1A 2IC3B 2CJBA 2LA6A 5HJYA 2C2NA 5L46A 1ZAWA 4IOBA 3ONQA 5DDPC 3FKBA 3KJVB 3DLEB 2E1CA 2YWGA 5EX0A 3PW0A 4PG6A 3MOZA 4ENOA 2D9OA 1KHWA 1IJEB 2QN6B 3I4PA 4AUKA 4DR3J 3JB9k 2VB6A 5KFUA 4DV4F 1I94J 4FVCA 2W9CB 4F02A 1TV6A 4RW7B 4Y00A 4R8UB 1RYRA 3Q8YA 2VH7A 3CSKA 3M6XA 3OTCA 1N56A 2NXNA 5DLFA 2HBQB 1RHMB 2K06A 2HHPA 2MMYA 3GPAA 1T8EA 4U8VA 1D09B 2CQDA 2QA2A 1JLQB 3BBFA 3H2LA 3LO3A 3T1AA 3ZC4A 1VGYA 4DU7A 2UXBJ 2VICA 2CDRB 2RNEA 3GFZA 2ROGA 2VG6B 2MQNA 1JWWA 2N3LA 1F5AA 3BGOP 2OHDA 2Q66A 2H3EB 4PPDA 4ZP9A 3QT6A 4KGKA 4ZS6A 4U7UK 1T02A 1WEZA 3AAWB 3GE9A 3CW2C 4DV5F 1FNOA 3H2UB 1H38A 3B78A 2JX2A 2YKOA 4N7TA 2C2MB 1DTQA 1FRLA 1EHWA 3EVWA 4TY8A 3OJUA 3K5MA 3RRGA 4C8LA 4WK3A 4PG5A 3P5BP 5KFKA 1YHQS 3WZ0A 4HH0A 2J6TA 5K8OA 5D3GA 4WFXA 4DV4J 1X0FA 2V4JB 5D6GA 2F8EX 3OD2A 3K8VA 3KLIB 1EAYC 3UCUP 2RRAA 4DR6J 4NCBA 2N3OA 4RUCA 4O3QA 2KT3A 3FZ2A 4B3TF 3GQCA 2ZHAA 2AT1B 3VQTA 2MZJA 3PXGa 2PEBA 3CD5A 3U02A 2E1RA 1MMLA 2DBBA 2HAIA 3M1VA 4OX6A 4ZVQB 3RG6A 1ZA1B 3MEEB 4TXSA 4WE1B 3TR5A 5F9LA 2FY1A 3CC4S 3PEJA 4WP3A 2I5JA 2WSFC 3RYLA 5HSPA 2QSWA 1RT1B 2QLXA 3BKTA 5D15A 2C3PA 1WKLA 2YH1A 1UW4A 3TJAA 1YLXA 4PWUA 5J2PB 3DRPB 4DOZA 2DR8A 2E5LF 4I67A 4DG1B 2V2KA 1UAWA 1RKIA 1SC1B 2IVFB 1HQUB 4WE1A 3HJFA 4LVNP 3DDIA 5GADU 2FJEB 6AT1B 1HHSA 4XO0A 3WBZA 2L48A 3RR8A 2K8GA 4ETXA 5FD1A 5IV4A 1NK0A 4ECWA 3I0RB 4FF3A 1L3SA 1QVFR 3AJDA 4TKTA 2OFHX 3PHEA 1NJWA 1U2FA 5JXSA 4MIAA 3KK3A 1NZAA 1TL7B 1R89A 3EE3A 4I6WA 1DQAA 3TZZA 1V5IB 1XIQA 2F7VA 2GJ2A 1IBMJ 4RJVA 4R5PA 1TL3B 2B4UA 4ECUA 2UV8A 3QGGA 2KYZA 4NL5A 2DHXA 4KB7A 5DDOC 2ZEJA 3OFEA 5H9FK 2MPUA 1RTJB 4LSZB 4M63A 1F60B 2RDDA 1FFSB 3ZFVA 3N28A 5GAEI 4G1QB 4QYZK 2J0XA 2HSEB 3VGUA 1SV5B 3D9BA 4IG0B 3U1LA 3OVAA 2FJDB 1DLOA 1YZ7A 4B9LA 3NMAA 2H5IB 4A8WA 1R27B 1RHRB 2MQLA 2CNLB 2VQEJ 8RUCA 3ISND 2E5IA 2FLOA 2R2UA 1IWGA 1UCNA 2O3DA 4PXBA 5E3RA 4HACB 5AJ3J 4KHPF 4DFMA 1U1LA 4I2QA 3RW6A 3OBIA 1VQ6S 4ZLJA 2G9OA 4FVMA 1TMJA 1L3UA 1RHJB 2L9DA 5GMEA 4CLKA 3D2WA 5D4PA 1WF1A 2DGQA 3R7SB 1DQ9A 4TY9A 4W98A 4KO0A 1RP5A 2MSTA 1X8DA 4N8OA 3C3LA 1JNZB 4N41A 1ZA2B 3CGIA 4X4PA 3OVBA 5KFEA 2XLJA 5L1KA 1R8CA 2V34A 4YOEA 1GNKA 2EC0A 4FKYA 2CPXA 5L1JA 4FBUA 1BC6A 5A0YA 2FHJA 1HARA 1EX8A 1R6VA 4LSNB 3JSRA 2FLNA 3PO4A 1RWUA 3W65A 3HXMA 4NLVA 1OSDA 4DR4F 2AJFE 4ZPWR 1GMVA 1SH0A 3IS9B 4MFBA 3CCLS 4IO9Q 1NO8A 3DRXA 1U0SA 3PEHA 3RR7A 5B0FA 3H4BA 2IY5B 4USTA 3F56A 4M5JA 3K5PA 1RT5B 1VBZA 2FVQA 4ZVPB 1R3NA 3KK3B 1SUQB 1F9EB 1RWOB 3IR5B 2F8MA 3SFUA 5KFHA 3TAQA 2BDPA 3HULA 3CJQA 1QUVA 2O66A 5EX3A 3BN7A 3GCWP 5KFXA 1LW0B 1SB6A 4CLWA 5C25B 3O5TB 2AU0A 2FHOB 4K4SA 5GADI 1S1UB 5IOLA 1HYSA 1QE1A 3OW2R 1JLCA 2CZ4A 1SKWA 5KFJA 1ZM3A 4P2XA 4O4GB 1HPZA 1FFWB 2QTWA 1U1MA 2V4JA 5A6WA 5H9EJ 3BGLA 4MMOA 3GZ7A 3MHYA 2ZBCA 2DGVA 4LMZA 2PD1A 3OVSA 3DRRA 1UWBA 2F5GA 4NRUA 1RYSA 4B3OA 5JUMA 2J7KA 4CO0A 1IQTA 5HLFA 2AJ0A 3G82A 1RBLA 4ANCA 3TVKA 5GAGU 5KG2A 3LUYA 1OQ3A 4Q44A 3CIZA 3PRDA 4I0WA 4UOHA 2ABYA 3ZNUA 5LT5A 1IUJA 4URGA 1RWKB 1RLDA 1S1VA 1U0HA 2WBRA 5HP1B 1E6VA 1N5QA 3KJFB 4HHUA 3V4MA 4E8UA 3QIPB 1S12A 1RB0A 1TTHB 3MI7X 4K2JA 4CI0B 2PIIA 4ZLLA 2VC0A 4RNFA 1R0BG 3ZTOA 3F44A 4F36A 2BOAA 1JNRB 2WB4A 2XWYA 4ZPAA 5KFAA 2AWZA 1ZH5A 4K0KF 3PACA 2D69A 4RZRA 2ZVSA 5E7OB 1TK5A 1PC4A 4LF4J 2QO3A 3KNAA 4B3MF 3NGUA 3SFGA 1HWLA 2NUUG 1RZMA 5EWEA 1BQXA 4CP5A 2Y3YA 4JI8J 2OGUA 3TAPA 3CCRS 1HBMA 5KG0A 2B7BB 3HCXA 4RR5A 5AXMA 5C42A 5H1SV 2I6WA 4Z37A 2HHVA 3C8YA 3N6MA 2XZTB 4NA1A 4OJ3A 1RSCA 2NXUA 4RW8A 4URQU 3GG0A 5M2RA 4DX6A 1YI2S 2DRAA 2ZE2A 3BR9A 4A48A 4CO5A 1AT1B 2B9WA 3PJWA 3T19A 3QIDA 2BJ8A 1TKZB 1KLMA 3TA2A 2DGOA 1T05A 2GC8A 2YKPA 4OJGA 4M5DB 1IN0A 3H5UA 3IS9A 1JLCB 4MFBB 2DRDA 4OYPA 1MLAA 3I5BA 2GMHA 2R7TA 1LWEB 3D3CJ 3CCTA 3EDQB 2HLTA 5C2GA 3BQ1A 3KK1B 1YJ9S 7AT1B 3DLHA 3AD7C 1QD1A 4ZPDA 2W2MP 4DSFA 2DNHA 1QAJA 2UVRA 3M9NB 2M4MA 2ZVIA 1QTNB 3S1TA 4FS2A 2CKWA 2NXJA 1UMJA 1YRTA 2Z4PA 4L76A 3SYZA 2AP6A 1S6OA 2OPPA 3ZZUA 1VBKA 2YPYA 2F3JA 1ZBTA 3CMES 2FZGB 3VZHA 3W61A 1SL0A 1N36F 2V0NA 4ALZA 5D0EA 4NLSA 2IRYA 5KFLA 3DLEA 2AJ2A 4EWTA 1PCAA 1F1BB 2HZAA 2F65A 4NMXA 3BSAA 1KOOA 3VGVA 4CH0S 4ZHRA 3R5CA 1KQFB 5J1EA 1RT6B 5E41A 4C7QA 2R2TA 3SDEB 3FZBA 4ILMA 2IBOA 3J7ZT 4P71A 4ZK7M 1ROFA 3R97A 2L3MA 1HMVB 3DLGB 4KQZA 2P5VA 2G0JA 2ACMA 2MSSA 3MM7B 1REVA 1URRA 3FSIA 1JXLA 4RU2A 3W2VB 5MAOA 4K5SA 4USJC 4OYWA 4WFYA 2OKQA 2AKWB 1RABB 1PBUA 5EHHA 5JJBA 3HX9A 5LXYA 5AJ3F 2PI4A 1XJWB 4KHPJ 1EP4B 2DISA 2HK2A 2D3OR 4X64J 1QY7A 1FT8A 2BM0A 3GR1A 2HIYA 3CJ3A 3MM8B 4RLEA 4QWDA 3R2CJ 3FC9A 1NH7A 3CNQP 4DV2F 3G4SS 1BQMA 4ZVOB 4B3MJ 4LR8A 4TU7A 4KHRA 5IM0A 2LEBA 3W60A 2E1AA 1GX5A 1HL6A 3KK2A 2VJUA 3OXGA 3R3TA 4KPCA 2Y1IA 1OS5A 4E2FB 1Q78A 2EK1A 5DO2A 1HBNA 3BJYA 4B9VA 4JI4F 1QLNA 1J5EJ 2QLBB 3RAMA 3SSRA 3EVOA 2E9ZA 3I0SA 3PFOA 1SJ1A 3U27A 3M2VA 1CJVA 1BHNA 2GNKA 1TL7A 2CQCA 3OTEA 2VONA 1URNA 1C1BB 1XR6A 2L41A 4LBPA 5E3PA 2G0IA 2WVCA 3JS9A 3Q8QB 2MQPA 1DTTB 4DL0C 2CADA 1QDUB 3M1VB 1KNZA 1RBAA 5CZVA 4X84A 2OELA 2WONB 3D6HB 1Z2LA 4NI2B 1C0TA 1Z2ZA 3G6ES 4J9QA 2XMMA 1T3OA 1HQEB 4K2XA 1Y3KA 2HBZB 1YQHA 3DRSA 4JB8B 4DUTA 5LXRA 3HVWA 1B3TA 2RKIA 3NEKA 2BKOA 3IMQJ 2HVIA 1RACB 2HURA 1HBOA 1N5YA 4HLBA 4ZVRB 1H7WA 5JMNA 2BW2A 4Y6IA 4KBIA 2BEFA 4KRWA 2POKA 4K8RA 3K0JA 3NL0A 3MECB 1KVIA 4ZCLA 4NXNF 1J5EF 4C8ZA 3MPUB 5HQLA 2PMWA 3FSXA 3Q24A 3D0IE 5J2QA 4G1PA 1QSYA 2RH3A 3GV8B 2Y8WA 2IRUA 2VBZA 2RF2A 2DH7A 3BH7B 3D4JA 3TX8A 4C3LA 1IBKF 1N8RT 1HNIB 4LRDA 2OMLA 3MM8A 5T7LA 4YP3A 1UVJA 1HBUA 1VQSA 4FPRA 2R2RA 1FDBA 3N5FA 4RBVA 5CABA 1FXLA 1UL3A 2RQMA 2A6OA 1S1TA 3N0VA 1T11A 2H9ZA 2EBGA 3M2RA 5EDWA 5IC4B 3E8OA 3TANA 4AXIA 1FDAA 3GTYX 5LMUJ 3RBEA 1CJTB 2HKEA 3M8ZA 5L38A 3FEYB 2NUHA 2V68A 1CJKA 4V19J 2IDEA 1S77D 4PYAA 1NAQA 3OR1A 2DVIA 4DSJA 4IYQA 1VQMS 2DHSA 4JOUA 3KDOA 3UDLA 2UU9F 2B4VA 3EJMA 1SV5A 4LF7F 5FJ4A 1ZM4A 3GJSB 4QZVB 3CD7A 4TU8A 1MWYA 3C14A 4K4TA 4I7FA 4J9NA 2JEFA 5KFMA 1PIEA 4KGZB 1XNRJ 2NS1B 3D5MA 3W2VA 4DPYA 3D6TB 1M5HA 4B9NA 4F4XA 2X3DA 2OJ3A 1Q8BA 2CRLA 3HO1A 1FO1A 2IM3A 5B0AA 3A3NB 3PDNA 2CPYA 2YBVA 3VAJA 1YITS 1LV5A 3GB0A 3MD1A 3G8TA 3RB6A 2GVDB 3M8SA 1WD6A 5K14A 2GGPA 3PZPA 3ETMA 4OLPA 4LR7A 4DV7J 2MYFA 3MCNA 1E6YA 3QO9B 3T5KA 1AFIA 2BRKA 4J9PA 2QC3A 1UEKA 4DR3F 3Q8UA 2LECA 2YKQA 1NCLA 3W7BA 3GSDA 4IG3B 4C48A 2ZC3A 4Q8FA 1AYEA 2CVEA 1JLAA 5GMDA 3PCOB 4NI2A 4O3NA 3W2WB 4I56A 3FBCA 4YN3B 2L9NA 4M5NA 4FYDA 4O3OA 4O0NA 4KKOA 3CCZA 1OQ6A 4OYBA 5KFBA 2BX6A 4DQRA 3Q2SC 3PVXA 2IMWP 4L3NA 1OYDA 2K3KA 4P52A 2PMZD 5KT6A 1C0UA 1P9QC 2WAQD 3AH6A 3O8WA 3OFGA 3QFWA 1PAUB 4ZVTB 2QA4G 2XY5A 3QRRA 2AJQA 4B9TA 4PRFA 5K5MA 4A8XA 4OIXA 5KG4A 1GFWB 4DZDA 3V4IA 4OYAA 1B7YB 2M88A 3LGHA 1QM9A 4WK1A 5D78A 4QWBA 4DPUA 4LF6F 1H74A 4RW8B 1FRKA 1T7PA 3DLBA 1TAUA 2WVEA 1XN9A 2RHSB 4O3PA 5KFRA 2QE5A 1JJHA 3C15B 1DTQB 3H5XA 1JJ4A 1KVJA 1KFSA 5EUHA 3WIVA 1YBTA 3M8PA 5C24B 2XYGB 1MU2B 4B3OB 4CNZA 2W8LA 4EYHB 1YRUA 3V4IB 4PQAA 1UWBB 5CQGA 3K59A 2R3VA 3QT7A 2GHWA 2MKIA 1B99A 4YUDA 1U47A 4ELVA 1PJ7A 5K8NA 4UF4A 3KDNA 4DFJA 3M6UA 3JYTA 4JI1J 1D8ZA 3MM9B 4J9VA 1YRXA 2M3DA 4J9UE 4DR1F 5CYQB 3LP1A 2FGOA 1E6VB 3QAEA 4DQSA 4DUZF 4NX9A 2AHOB 4YR0A 5K20B 4I64A 3L95X 1NKBA 3CD6S 4Q0BB 3BR8A 2FQQB 3ETOA 5L9NA 3DOMB 5DDRC 1WOOA 2LXFA 1KTVA 4ANDA 1NDLA 2W2PP 5HL7Q 1YZ6A 2QL7B 4EU0A 1KWMA 5D4NA 5A2QU 1Q79A 2ZJQQ 1TZ0A 4DBQA 4OI1A 3A13A 1PG5B 1S0OA 1DARA 1WC4A 1NJIT 2CPJA 4YS2A 5DGBA 1RU2A 4HHJA 5DZ6A 5K14B 1SKSA 1WG5A 3FGVA 2I0XA 3NRBA 1RISA 3P45B 1TP7A 5ETOA 3SBMA 4ZN3A 2XS7A 4DR7F 4A46A 4F4AA 4DR5J 1WELA 3I31A 4ZVEA 2XY6A 2R7UA 4N76A 1NK9A 2XGPA 5KFOA 4X4NA 2GVZA 4DI6A 3TVZA 4C9DA 4QWEA 4BCAA 4LFCF 2MY8A 1YJRA 3UQSA 2ZM6J 2MHEA 1TV6B 1ZPVA 4QR0A 3ZZTA 1PJ5A 1ZTTA 1UJ4A 1VJQA 4IDKB 4WU3A 3OSPA 1RAGB 4AE5A 4ZJQA 1OY9A 3MF5A 1FFGB 2YQ1A 2RU9A 5B0EA 1HI8A 2R7XA 4I4BA 3DDNA 3OL6A 2W2QP 1SBRA 2HHUA 2RHQB 2PT0A 2DNGA 2ERRA 1W25A 3FBEA 2IVYA 1PKUA 4BWMA 1UKUA 1FRHA 1QUPA 3T1YF 2QFIA 2P8IA 3M6WA 2BKNA 1KTQA 4IG0A 1B70B 5HQ8A 4IR1A 4FXVA 2YQ0A 3B8HA 1WC6A 2WK4A 4G1IA 3SDEA 3DI6B 3QRQA 1GXUA 1R0CB 2RSQA 1HKAA 1U2CA 1NSPA 2UXBF 3KJNB 1FX2A 1VCTA 3QNWB 2ZD1B 2F4FA 2KG1A 4L3KA 3NNHA 1YX2A 5E3QA 1X4CA 1JLEA 2RDIA 3ZNJ1 1P9YA 4BBYA 4UQGA 2ZJPQ 3DRSB 4B02A 3OHBA 2FJVA 5K9FA 1AW0A 3EZUA 1C0TB 2KXFA 4RL1A 4QPXA 5LSLA 1U4BA 4OHZA 3UVJB 1R0AA 4LFAJ 5DM7Q 3K5LA 1N48A 1DURA 3DLLQ 1XK8A 2DH8A 2M5YA 1T03B 2H4YB 4CLTA 1VFJA 4S0MA 2DR9A 4AYBD 2DPIA 2FZCB 1VQNS 1IM6A 4LBIA 2DNQA 4IFVA 2DEJA 3H98A 1HR0J 2VUGA 5J2QB 4JYAJ 1PBAA 1W7WA 2QA4S 2R8JA 3G6XA 1XMQF 4LRCA 3CUNA 1YVFA 3MEKA 1XMOF 3CMAS 2YKNB 2C2OB 2ZH8A 5M2PA 1H2UX
chains in the Genus database with same CATH topology
2R4FA 3M05A 5IQQA 3CULA 4IFVB 2U2FA 1X0PA 2IM1A 1UEVA 2W4DA 5KOXA 2PE8A 3EGWB 3PR5B 1I6JA 3VAFA 4CH7A 1Z1ZA 5L1IA 2XCAA 5DJBA 3RAQA 1WACA 4QU7A 2B4PA 4X65F 3DU6A 4OZJA 1S10A 5KG7A 3WC0A 1QVGR 2C42A 4KPYA 5HROA 3HZGA 4ZMMA 4NOHA 2DRBA 4CZCA 2DNRA 1TL5A 3C66A 4TY8B 3DM2A 4A4JA 5A8WB 3X3UA 1HI0P 5GAHU 5BR8F 3VR1A 3FCHA 4JBCA 4U9RA 3Q23A 2J5AA 2YNFA 2WW8A 1Y5NB 3AHPA 5A6PA 1YJVA 2HHQA 2R8KA 2MY7A 3IBWA 1DBDA 1SL2A 1C4AA 3SI8A 4DMZA 4RUHA 1D8YA 3W2WA 1RTIB 5B0CA 3PX6A 1KEKA 4RW6A 4C4WA 1OPIA 4ECYA 2E66A 2HQ3A 1QE1B 1NK8A 3BDPA 2YKNA 5KFIA 2EFQA 2GHPA 1S9EB 1TAQA 3IG1A 3O3LA 4HTIA 5F8LA 1T05B 2KYXA 5EGYA 5IS2A 1CSJA 4LJMA 5DGAA 1L5UA 2ADCA 3DU5A 4MAKA 5CD4H 1JLFB 4OX8A 4P6QA 3DMJB 3BREA 1J5OB 3HHNB 3T5LA 1A9NB 4L6V3 2KN4A 3M8RA 3OFFA 5E5NA 1S6PA 3IWNC 2VQEF 3OXLA 4KE5A 1BLUA 3UPFA 1GT8A 3LANA 1IJFB 3P96A 4DR5F 1SJRA 4WFBQ 4F3QA 1KONA 1JLBA 4JI3F 2ILZA 1NB7A 3N6LA 1E6YB 1ZTWA 2M8DB 1HWUA 2VBWA 3MM5B 1M1KT 2OMOA 2R7OA 3LP2B 2AGOA 3I6PA 1VQ4S 1TKTB 4KGMA 4CT9A 2GHVC 3QLHB 2AYMA 4AFFA 2M8HA 4HDGA 4B9UA 1WHWA 1U7LA 4DQQA 2HPUA 3Q22A 5E2QA 2HNZA 1Q8IA 4IH5A 2FJBB 3N79A 3MMCB 4LUBA 4MJKA 7FDRA 2MQOA 2FD2A 4F50A 2AGQA 1PSDA 3KNGA 2DNLA 1HNZF 5G0RB 4B3RF 2C3YA 2WOMB 2QRRA 1K9MT 4A8SA 2YNFB 2XI3A 4RWXA 3MXHP 3HKWA 1GXLA 3GR0A 4OI6A 1QSSA 1NNDA 3QIPA 4EUVA 4YQWA 1HBUB 5KFZA 1VIOA 4AXJA 4ED5A 1EETB 1HNVA 2EVZA 2SXLA 1X4HA 2XB2D 1LW0A 2DJWA 2OFGX 2P9CA 2KFYA 4NCAA 1CQNA 1KHVA 3DM2B 3MPWA 1LOUA 4UY8T 2FLPA 2MB0B 5GAHI 4NCGB 3BN4A 5HBMA 1R8PA 4EEYA 4FBTA 1XC9A 1XNQF 2AD9A 2Z0GA 4O4GA 3BO2A 3TVYA 5I3UB 2RS8A 2NZ4A 5KG5A 4MKYA 4F67A 2VA2A 3K7RA 1FK9A 3PKYA 4X4RA 3BDEA 3KLFB 5KG6A 2CFXA 5IZHA 2FVRA 2VL1A 1FXDA 2HWIA 2XSJA 3I56S 3BO4A 4TU9A 3GYNA 4JYAF 2HHTA 2DGWA 2PSZA 5KT5A 2HW3A 4A47A 4NLDA 5LJ3Y 2LXIA 4DLEA 2HMIA 3DCAA 2UUAF 1U09A 5I4MA 2D41A 4NA2A 4U6PA 1M90T 1FKPB 3DOKA 2HG4A 3UD3P 1SUQA 1FXRA 4DQPA 1A7GE 1JLEB 5B7WA 2IJFA 1VS3A 2AQ4A 2GO8A 1HD0A 4NLXA 5CZXA 1C1CA 3HHDA 4I1TA 4IFYA 3TANA 3SV4A 2QZ8A 2XBPA 1Q81T 1P8GA 4OMFG 2KRRA 2WB1D 1SC6A 1M5OC 3E01A 4PXEA 3M9OB 2PFFB 4WTYA 2BBEA 2RS2A 4OJHA 3CCQS 3T6JA 1HHTP 1N5TA 2HHWA 2LXUA 2Z2LA 3V5RA 4DJBA 2HFOA 4IFYB 2A1BA 2JEGA 2Q3PA 2DNKA 1N34F 4JI7F 3PX0A 2C3UA 5B0BA 2HHHF 2UUBF 5AE1A 1FJCA 1X9SA 3V6JA 2I2YA 1IKXB 4IOCQ 5I42A 4IUFA 3GV7B 2ZHBA 2XS5A 4M8LA 3C6TB 1WI6A 4Q2MA 3AJ1A 4RW4B 3DN9A 4ZA1A 2O1PA 5T14A 4NPOA 1GH8A 2HQIA 2Q6BA 1VLYA 2FHJD 1FTRA 2Z2MA 3AB4B 5FDLA 3TA1A 3SSSA 1BD6A 3MFHA 1LW2B 2AF6A 4QW8A 5IT0A 4I68A 3S7RA 1T3NA 4LSLA 1RT6A 2B9XA 4GC7A 4FNHA 4F3OA 3MEEA 4ZHRB 4F4YA 5HMWA 2KXHA 4XDDA 3OLBA 3MAHA 1QTMA 3DNCA 3PW7A 4HI2A 4OZ1A 3TW0A 2HS4A 3KLGB 3RBDA 2MZ1A 2WSCC 3FFIA 4K4YA 1HW8A 1VRTB 2JL9A 2NSCA 4C8YA 4KJIA 3M8QA 1SJFA 3LGNA 4M5DA 4EFAC 5D4LA 3LAKA 2R7RA 1HQUA 4Y34A 4F2RA 3P6YC 4C0OC 4K4UA 3SSQA 2ILYA 2JFKA 3BGRB 4R0JA 3BS9A 5AXKA 5L39A 1FKAF 1RT2A 3J7YU 5D4OA 3KHRA 2G13A 3VAIA 1PILA 4ZP7A 1HWJA 1FCAA 5HMZA 2R9LA 1KLNA 2CYYA 3TA0A 2UVVA 3CD0A 4ZOSA 4MKAA 3NGKA 1H98A 4DL4A 4QIVA 3OUYA 1EP4A 4C11B 1S6QB 2NPFA 2LEPA 1RTHA 3TOQA 2HNYB 5C24A 2KM8B 2UXCF 2EFOA 3GIMA 4BWJA 3DXSX 1MU2A 3RB3A 1S1WA 2ZM6F 1FVQA 1SKRA 4OHXA 4QIGA 3OUYB 4NLTA 4ECQA 1X4DA 4K5RA 1G7CB 2DCUB 1FERA 3RU0A 2EG2A 4NYPA 4X4OA 1W2BR 2YKMA 3MR2A 3I55S 4A8MP 2OD4A 1VOMA 4Q7AA 3MM6B 4ZP8A 2BUNA 3RAXA 4RNHA 2LVWA 1R31A 4JUZA 2OSRA 3KLGA 1UVKA 4HT7A 3WDOA 4MTPA 3I32A 5F8NA 4LSLB 2IM2A 4DV3F 4PWDB 3FJ2A 2XZWA 1DHMA 4XAKA 3TAMA 1F5BA 2K1RB 2K7JA 3CJKA 4BDPA 3T9NA 1JLQA 4DV7F 2FJAB 3T6BA 2DNMA 2YWEA 3PIPQ 4QU6A 1HNWF 3D28A 3CCJS 3KLEB 2PMHA 2KDOA 2FVSA 4IO1A 5FDLB 4H4OA 4WFAQ 2LKZA 2VG7A 4Q45A 3I5AA 2ZOFA 4OJ1A 2JDJA 3G96A 1JKHB 2AV5A 3FQKA 2FPHX 4I69A 2LMIA 4P2SA 1IKWB 2MQQA 4ZCMA 3H2VE 3MPVA 1IR0A 1FE4A 4HL9A 2BJEA 2V8VA 3J7YI 1RTJA 4RKUC 2FIUA 1NU4A 1GQEA 1R8AA 1S1TB 1T95A 3KHHA 4ECRA 1D9DA 2XSFA 4X2BA 3M2RB 2FVCA 3MURP 1DLOB 2RQ4A 3Q8PB 4ZPCA 2RDJA 1XERA 3S6EA 4WCEQ 3KFWX 2B4OA 3OR1B 3V2UC 4DQIA 1TR0A 1UA1A 5GVQA 2KTQA 2XMUA 2ZFHA 2IFXA 5A8WA 1NH8A 1XTZA 3N5BA 2V9WA 2VV5A 2RKIB 1TL1B 2GO9A 3ZZOA 3CO9A 4FZVA 2DNYA 3PRBA 2C2RA 3HFKA 5HLFB 2J6SA 4ED0A 1Y9OA 4DPOA 5A8KA 1FKPA 3DOKB 1RTDB 4X4QA 4F4KA 1HA1A 1SH2A 2IA6A 2GQ2A 1N52B 2UUTA 2UVUA 2K1RA 2CPIA 5DG9A 3KLHA 1Z4UA 3DXBA 3EPGA 2KZZA 3DOMA 3VQSA 1U1OA 2V8DA 1IKVA 1TKZA 2OAUA 1VQKS 2JVRA 2PDAA 3QJPA 2QT7A 4HKQA 3PM9A 3DHWC 4UOCA 3J7Z5 4O3RA 1TQLA 5HBMB 1WTBA 1JIHA 3DHXA 4F25A 1G3OA 5DQHA 3Q8RB 3G6VA 1X4GA 3T9ZA 4RNOA 4J9KA 4KAIA 1X4FA 3UWTA 1FNXH 4OZ0A 1Q86T 4ETZA 2VBXA 5DETA 4NZ7A 3AJ2A 4C98A 1UVIA 2UZAA 4DHVA 4M94A 3M8PB 3I9V9 2B5JB 5J2MA 2N82B 2DK2A 4DL5A 2HNDB 2ALZA 1HBNB 1S0VA 1S4FA 1ZM2A 2KHDA 1H3DA 5DQGA 3M32A 3GIJA 3C46A 2ZNYA 4RW4A 3IXQA 2DGTA 5CYQA 3R1LA 3TUZC 4IQMA 1NK6A 1G2EA 1APSA 4PCQA 4XPEA 1WEYA 2KKHA 7FD1A 4K4VA 1N5SA 1VQ8S 2LQBA 3G6YA 4TLRA 1S9GA 5LSOA 4TYBA 1R8BA 1CC7A 2R7WA 1K0TA 2IYGA 2X1AA 2E9TA 1WEXA 3MM7A 3VZIA 2VG7B 2CPZA 3GFYA 4NLRA 1ULRA 2DITA 5HMXA 3KKFA 1H6KX 1JKHA 1TKXA 1YTYA 4IRDA 1X5TA 5J1EB 1HI1A 2LQ9A 4LQ9A 3BZQA 5DS7A 3TAMB 2OIHA 4DLGA 1SJ4P 3PV8A 1UFWA 1V9OA 4WFNQ 3CPWR 2DGUA 4PG7A 4IQXA 4RBTA 4DL3A 1VQ9S 3L7PA 3M8QB 3I96A 5E33A 2DR5A 1LXJA 2OSQA 2ZZNA 3H8YA 1S7HA 3O6QA 5DG8A 1N6QB 2WSEC 2HGMA 2OD6A 1RT3B 2M2BA 1UVNA 3I82A 4K59A 3MUMP 2AYEA 3QZ7A 2L08A 2DIVA 1VC5A 4DN0A 4TNOA 3H20A 2JEJA 1IQZA 5D77A 1L3VA 4YB7A 1VRUA 3TYTA 5M2UA 4RW9A 3JSYA 3NG8A 4C2MA 1N32F 2G0CA 2YWHA 1U1KA 2EWHA 2Q6CA 4PPZA 1LW2A 4ELTA 2YVSA 4Y2CA 3IA0A 2NQPA 3T3FA 3CDUA 2VODA 3T5HA 2MKKA 2HVHA 2JLFA 2W9CA 3LOUA 2BABA 4BC7A 1LWCB 1SIWB 4ED2A 2D9PA 1VMBA 3EGNA 4PR6A 4C0HA 3PR4A 1S76D 5B0GA 3NP5A 2GW8A 3AB2B 4NWBA 2PN6A 4ECVA 1F0XA 1BC6A 3CJ2A 2EBEA 3RB4A 2ZITA 3FEZA 4UQTA 4Y2MA 3T1HF 5CCLA 5IXUA 3KG0A 2M0GB 4CT8A 4YY3F 2XCPA 3R27A 4F3MA 3TP2A 3HF5A 2XULA 1TKXB 3GILA 4LFAF 4IRKA 2HS3A 4NYZA 3H5YA 1SI9A 4Q2LA 3UR3C 4OZNA 2KO1A 2JRSA 5T7LB 3G86A 2G1DA 4KV8B 4FNIA 4ZP6A 2MZRA 3MEDB 1JLGA 1SXLA 1SL1A 1LK5A 3MWBA 4NLPA 2EFPA 3IR7B 1D9AA 2B5JA 2I1RA 5J2MB 5MLCV 3JSMB 3HM9A 1X4AA 3I0RA 4A8OA 4C11A 3EPIA 2RF2B 2Q79A 4NRTA 1JB0C 5U47A 2W8KA 4ED7A 1HD1A 1MW7A 4ECSA 3CCSS 3EXCX 1JK9B 1KQGB 2GA7A 2J0WA 1R6YA 4UUXA 1FA0A 2DCLA 3EUNA 4CQ1A 4DV1F 2R8GA 3J7A1 3FRZA 2VPWB 1TK8A 1NHVA 1IXKA 5FIIA 2E44A 3EGZA 2RRNA 5J2NA 3I0SB 2FUG9 1S49A 2DO4A 4EO8A 3SMZA 5F0WA 4LF8F 1FK9B 2HVZA 2M70A 3GFHA 4IH7A 5E3CA 3VF0B 2OTJS 2YY3A 5DQIA 2R8IA 1NEEA 3QO9A 5KFVA 4QWAA 1DTTA 2JFDA 1VRUB 2I8EA 2KB2A 5L1LA 3CXCR 4LF4F 3MPYA 1VK3A 2Z8QA 2DNPA 2HWTA 5KTQA 3M2UB 2DGXA 2XEXA 4ES1A 3HZEA 4KR0B 2KG0A 2MGZA 1G6BA 5KFCA 2XNQA 3P3DA 3C2PA 4EZ9A 2CQ0A 3CB4A 3LF0A 2BOPA 3NAIA 1MMDA 4MYTA 3MUVP 5JVGQ 3RB0A 3FVYA 4K50A 2RILA 4GMKA 3U1MA 2UXDF 2GMJA 3KK2B 1NKEA 1LWFA 1NHUA 4ITSA 1YJWS 1C1CB 1U49A 2IM0A 5E3AA 3QLHA 3SQGA 3L7OA 2W7OA 2HFNA 4OZLA 5THWA 4DF8A 3HVTA 2IVMA 3A1YG 1IKWA 1C4CA 4YB6A 2V8HA 4R0EA 5J1PA 4DS5A 4I2PA 5AXNA 3TRGA 4R25A 1FKOA 1VK8A 5L9XA 1KN6A 2P9GA 4YB1P 3DMJA 2J9CA 4Y28C 1XEZA 1XMBA 2ZH3A 2FTRA 4LQ3A 2VBYA 3IR6B 2FLLA 1OWXA 2DH9A 3AA8A 5IT9Y 1IKYB 5BJRA 2ZH6A 2F9DA 3R1HA 3POTA 2KT5A 1U24A 3ZZZA 2P9EA 1GX6A 1W2IA 4DL6A 3QPIA 4NCGA 4NLYA 2IC3A 2RQKA 5JVHQ 3CJ4A 3BGUA 2VPYB 1RDRA 3ULHA 5J2NB 3NBPA 3H5SA 1BGXT 1QJHA 5I3UA 1NKCA 3QJLA 3GG1A 2C22A 2CJQA 3BQ2A 2LYVA 1KQKA 3S01A 3E2EA 3ZZRA 4ZDNA 3PFEA 4Q8EA 2HZCA 4QR2A 3U1NA 4ZPBA 3IFEA 2LCWA 2ZBIA 4WKYA 5DM6Q 4PXCA 3H40A 3RB6A 1Q16B 4KV8A 1GXTA 3NGDA 2GFFA 5G0RA 4FN5A 2J7WA 1XR7A 2HRYA 1NK7A 2DHAA 4D3HA 4LVOP 2CPFA 2RT3A 3Q0AA 3WX4A 3HDSA 3JSMA 1S1VB 3OV7A 1H0HB 4ECXA 2XNRA 3QYYA 4FP9A 3DC2A 3OFHA 1S0NA 1KR4A 2XO7A 2UUCF 4ZVHA 1AROP 1WHVA 5E0OA 1S1WB 4OI2A 4NMLA 2KJVA 2DTJA 3GIKA 4OFZA 4OL8A 2RQCA 2CJKA 1U1NA 3ENWA 2KJWA 2ASJA 2EFNA 2F1FA 1M5VC 1S6QA 4DR2F 3THTA 1N0UA 3ZZ0A 3KMQA 2J0SD 2C3OA 1G1XA 2ZNZA 4HVZA 3OL9A 3HP6A 1KS2A 3IAM9 3DFEA 2P6SA 1RTHB 3V6HA 2BYCA 2HNZB 1R7IA 4RW9B 2YH0A 3CCMS 1DAXA 3FFIB 5H9FJ 3M6VA 3B4DA 2QMWA 5GMKa 1F2GA 3VTIA 3DOLA 2RJZA 1UJ6A 3SCIE 2JZ5A 3PX4A 2DNNA 4ZKAA 1I1GA 1LWCA 1IM4A 3ICLA 2VFSA 5F9NA 3F41A 4DSKA 4UUWA 4F4WA 3UCZP 2FVPA 5HN0A 2BR0A 4FF2A 2CQHA 4CNYA 3IRXB 5KT2A 1TKDA 3CC7S 2PEHA 3KYLA 2MKSA 1VQ5S 4BS2A 2ZH9A 1KLMB 1X9WA 4J5OA 4MK7A 3KHGA 5IWAF 2OO4A 1YJUA 4AL5A 1KQSR 4GKJF 1JJ2R 1GTEA 3CC2S 4URSA 5C42B 2XS2A 1NJYA 4PWDA 2BM1A 1XR5A 3EX7B 4DF4A 1M5SA 1P1LA 1RT3A 4G6VB 4XK8C 5SZTA 4B3SF 2ZE2B 2B51A 2Y1JA 2BANB 1S48A 4A8YA 2OPQB 3TI0A 4WKRA 2LA4A 4LIRA 3F73A 3KMSA 3B4MA 1JX4A 4BHQA 2MDAA 3I4HX 2YNGA 2BVZA 2IBKA 3E01B 4QBUA 1NRKA 4G1QA 1M5PC 5HROB 4KFBB 4MIBA 4ES2A 1IBLF 2HGNA 3G8QA 5CH7B 2W4PA 3SV3A 1A6LA 3JTOA 4R5PB 2D74B 5T41A 4JV1A 5C5JA 2JC0A 2FHKA 2XMVA 3MTJA 4MK9A 1TVRB 3HHLC 4ED6A 4WF9Q