2E29A

Solution structure of the guct domain from human atp-dependent rna helicase ddx50, dead box protein 50
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GSSGSSGFEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DDX50
publication title Solution structure of the GUCT domain from human RNA helicase II/Gubeta reveals the RRM fold, but implausible RNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 92
sequence length 92
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e29A01
2E29A 2M3DA
chains in the Genus database with same CATH superfamily
3D2WA 1N32J 1Y11A 2ADCA 2AYMA 3U1LA 2JLEA 2F4FA 2E7VA 1CLFA 3PHTA 5KOWA 1B7YB 4IFYB 1YJNS 1MWZA 1HQEB 2VG6B 5SZTA 3KK3B 1WG1A 3J7Z5 2Z4PA 2ZNYA 1DTTA 2Z56B 3OJSA 2QYCA 1KC8T 2DGUA 1TFWA 3A8JA 2CA9A 1FFGB 4ZPAA 1HNIA 4IRCA 2DXDA 4GC6A 5L1JA 4DX7A 2M0GB 2FB0A 1HLWA 5E41A 3LTOA 2XMKA 4FDFA 4DR1J 3KUGA 5I3QA 4ZCKA 4X66F 2GIFA 4M5GA 1D8ZA 2X1FA 2J8AA 2UXCJ 2HSEB 2V4JA 1CQMA 1X8DA 4A8SA 3BN7A 4GVBA 4C3MA 2XMVA 3QQCD 5KFKA 1HI1A 1WOOA 1S7HA 1U8SA 4H4OB 4RPFA 2PEBA 4K4SA 1OJ4A 3M2RB 4L76A 3R8YA 3M1VB 4DV2F 4CLZA 4WFNQ 3LW5C 3V6DA 2BE9B 3OL6A 1GAOA 4QW9A 5A6WA 4WYWA 2QFIA 1BXNA 1TMJA 3P3DA 1JLQA 2KXFA 4J9MA 3EGZA 3OLAA 4Z2XA 3FFIB 1SKRA 3MCMA 1KQSR 3HKZD 2I38A 1BLUA 2E1AA 4WFXA 1S48A 4RW7A 2VJVA 1SKSA 4BBYA 2QC3A 3I6PA 3ISZA 4ZJQA 3CJQA 3HF5A 1MN9A 1Y4ZB 1I94F 2CWXA 4EBDA 1YJ9S 3J81U 1F3FA 4IUFA 2E5HA 1YDLA 4OX9J 1X0PA 1HW9A 2XSJB 1QY7A 2GA7A 3MM9B 4K7QA 1RKIA 4HI2A 4F4KA 4CO4A 2VBZA 3FCHA 2E5JA 1S49A 2P2CB 3BDPA 1HBNB 3C46A 2GQ2A 3WHIA 2JOQA 5D77A 4LF1A 4CLTA 3W1YC 3IRXA 4Z7CA 2QSWA 3DLJA 1D0EA 4K0KJ 1G1XA 2ZDPA 2VFUA 3P5TL 4LVNP 3PJXA 1RTZA 4KGKA 4EGLA 1DTTB 3F41A 2FYXA 4P72A 1N0UA 1SIZA 1DY3A 3W7BA 4DR4F 3D6TB 2B9EA 1HNIB 2ZBCA 4A47A 2AJQA 3ILOA 3R7BB 3DLLQ 4AT1B 2D9OA 2KVQE 1X4GA 3A8KA 4NZ6A 4KGZB 1JJ4A 2P9EA 3D67A 2IPOB 2FGOA 1UAWA 2E5IA 1Q81T 3TW0A 4JI4F 2XZTB 4X4NA 2ZBIA 1CPZA 1WKLA 2Q66A 1IWAA 1VQPS 1WC1A 4MT1A 2V4JB 3PEHA 1JNZB 3Q23A 5LMUJ 2QRRA 1X4CA 4QQBA 2KI2A 3IFEA 3M8RA 4N41A 2X3GA 2G2OA 5F0UA 4OI6A 1K73T 4A8YA 1IN0A 5D4LA 1FJGF 3BZQA 4CO5A 4ZK7M 2KYXA 2WTFA 3FJ2A 1J27A 2YWWA 1UW4A 3GPAA 4ED2A 4M5MA 4Q45A 1D9AA 3UQSA 3V6DB 3C2PA 3I0RA 3G6ES 4AQYJ 3BQ2A 5B09A 5I42A 5CCMA 3D1OA 2V94A 2BJEA 1IBKJ 3GJTB 1FKAF 2HWTA 2JEGA 3CD5A 2KG0A 2LP4A 1T9YA 4QW8A 1JLQB 5DDRC 3L95X 1HFEL 1KN6A 1FXRA 2C1EB 4I6YA 3CJRA 2J6TA 4UF4A 2R2UA 3PRVA 4RW7B 3GE9A 2HVIA 1QD1A 5D3GA 4JI0F 3RB0A 3J7AN 2XCPA 5DO2A 2HGLA 3CGIA 4EEYA 1WACA 1NPKA 1PKUA 3D6HB 2DHHA 2KG1A 3M32A 3RBZA 3KUHA 1OS5A 2RF2A 2WW4A 3AJDA 4LF6J 2W8KA 5FJ4A 4YDDB 4PG7A 4W90B 4G3IA 2XZDB 2GVZA 2AJ4A 3BS9A 1TUWA 3NCQA 3UPFA 4LMZA 1RU1A 2CQIA 4O44A 1IUJA 3EX7B 4A4JA 2J5AA 1P6TA 1JB0C 4F26A 3IR7B 4Y2AA 1F3VA 2RKIA 4NEYA 3W62A 1SV5A 2E1CA 3OL7A 3W61A 3GTYX 4K5RA 3IRXB 1G7CB 2KT5A 2XSFA 2VL1A 1N88A 1NB2A 1N34F 5F8HA 4WCEQ 2XLJA 1JLGB 1U1NA 5HL7Q 2HHHF 4K50A 2DNYA 3W9JA 3HKWA 1VIOA 1ZYQA 2CPEA 1S7IA 4GKJF 4NMLA 4L3NA 2V9KA 2QMXA 4DPUA 4JI5F 3OW2R 3CJ3A 5J1PA 4DQPA 1R27B 1GMVA 4GRSA 1PSDA 4TXSA 2Y3YA 2DGTA 2K2PA 1W25A 4TLRA 2VHGA 1D3WA 7FDRA 1DURA 4TLQA 2GAGC 2BQ3A 2G1HA 2QT7A 5DQHA 2MQQA 3TA1A 4EMDA 2O67A 2UZAA 2DKOB 3MI7X 4PXBA 3VCDA 4X4PA 4PG6A 4WYLA 5ETRA 3RR8A 2RUSA 4B9NA 2UUCJ 1K47A 4CO2A 1WTFA 3I0RB 3RRHA 5I42B 4ES3A 2KM8B 2XLIA 1TL5A 4LBIA 3R5AA 1TV6A 1T02A 2ATCB 3M2VA 4JB8B 5ETOA 4DSEA 3TVKA 3CJ2A 3Q22A 2FHJA 2XI2A 3MR3A 2GHPA 5AJ3F 1RAHB 3T9ZA 1RAOA 1FDBA 2JJ4D 3CJ4A 4P7TA 5D3GB 1JLAA 1IR2A 2GMHA 1SJQA 1XNRF 4USHA 3CCMS 3X1LB 1NLKL 4AXIA 2XMJA 5EX0A 3RW7A 2NXEA 3LALA 3UD3P 5ETLA 1AA1B 1EIYB 4ED8A 1Q86T 4JV5F 4PWUA 1RT3A 2FHKA 1F9FA 2WVCA 2GVZB 4FBTA 3RW6A 2MKSA 1T7PA 2ACYA 4ECQA 3OTEA 3LH2S 5DG9A 1RE1B 5BYSA 3GIIA 2X51A 2ZD1A 1YBAA 3THVA 1NH8A 3JAMY 3ZC4A 2HFVA 1XEZA 4AL6A 3BGFA 2RKIB 1ZPVA 4HDGA 1QAXA 4USMA 3CEDA 1SV5B 3A1YG 4KH0B 5E0OA 1RYSA 2Y1LB 4L74A 2Q79A 2QFJA 1U49A 3EWGA 3LAKA 3KUEA 2D69A 2WBMA 5CQGA 2C2KB 1H7XA 1U25A 1MROA 1OPIA 3CWJA 2NS1B 3R5JB 4OYWA 3TVZA 1FFSB 1Y3KA 3DRYA 1B99A 5K8PA 4I6AA 2E9RX 2IRYA 4FXDA 3P49B 4LQ3A 3KLIA 1WOSA 3CJTA 4PWWA 4LUBA 4X4QA 2GMJA 1RTJA 3BPDA 3MOZA 4FNIA 1FERA 1Q0NA 3SCIE 1NRKA 1K0TA 1HI0P 1OY6A 2EBGA 1Q5VA 1S1VB 1TMMA 5SUHA 2BZ2A 2KO1A 2HAIA 3AXKA 4DV6J 4BHQA 4NASA 1GQEA 1WC5A 4DLEA 3GJQB 1H6KX 1N36F 4PWDA 4PKDB 2VPWB 4DMZA 3MUVP 1U6ZA 3TVYA 2NSCA 3K5NA 3PRBA 1ZTWA 3K89A 2FZKB 4KFBA 4NX9A 1R0AA 5LXYA 2FJBB 3SDEA 4DR3F 2RT3A 4C0BA 2J9DE 3ILIA 4V19J 4O3PA 2DNLA 3BKUA 3JYTA 3JTOA 1OPZA 3M2VB 4LRDA 3V6KA 1J5OA 1RZMA 2J7KA 1JK9B 5DQGA 5F41A 4F7VA 2C42A 3PNIA 4JI8F 4EO6A 1B64A 3ET6A 4PR6A 2RRNA 2NCKL 2OFGX 2RDIA 4NLSA 4OIXA 3N4WA 5KFPA 1PJ6A 3BBFA 3RGIA 3LP2A 2WW8A 2PDAA 1U2CA 4IOAQ 1JMTA 1T11A 2HVDA 2PC6A 1YBUA 2POKA 5EHHA 2F1FA 3HD2A 2HG4A 4R0EA 1JXLA 1RT3B 2M7SA 1VQKS 3R6GB 1HNXF 4DL3A 1D09B 1LXJA 3LP1A 2D74B 3US5A 3O2IA 3RZAA 3SV3A 2ZOFA 2ZD1B 2VBWA 4LVOP 4QZVB 2YWGA 2YKQA 1N5QA 3T1HF 2UU9F 1RHMB 3TJ9A 3ETMA 1HIYA 2XWYA 4J9OA 1BGXT 2OGUA 2R7VA 2FY8A 5KG0A 5KT2A 4OYAA 4LFAF 4TNOA 4O3OA 4DU7A 2KJVA 2CPZA 2CZ9A 4MKYA 3CDAA 5KFBA 4UUXA 1HWJA 1FKOA 1MROB 4N5SA 3QT6A 2CJBA 2DK2A 1Q79A 2CG4A 3I87A 1BQNB 1SH0A 3KLIB 4RBVA 3OSPA 4OI0A 2FPHX 1QM9A 2LEPA 4I2PB 3E01A 1RTJB 4QWCA 3CD0A 4MMOA 4OI3A 1GMWA 4ZLPA 3BGRA 4DFKA 3CD6S 1F1BB 1H73A 1R6YA 1VRQC 4NA1A 2CQCA 5J1NA 4PEOA 1CEZA 4RUBA 3IP0A 1KQFB 2AEJA 1R43A 2B4PA 1PYTA 4I69A 5IC4B 2IAJA 4NLXA 3PVXA 3WIUA 1LNQA 2XMTA 4PQUA 3FBFA 1VQOS 4PWDB 2EEYA 2HURA 3D28A 2OPRA 3B6BA 2DPJA 1NHUA 3MFIA 1S6QA 1UEVA 3VAIA 4KFBB 4KYZA 1R0AB 3SDEB 3EPIA 4U9RA 2R3VA 1HHQA 1LW0A 2FQQB 3E8OA 1X31C 1X9MA 3N0VA 3W65A 1DTQA 3PZPA 2CNOB 3TQ1A 1JQGA 4UQGA 3JYTB 3QAEA 1AROP 2Y8YA 1WKKA 1J5OB 3VR1A 5DDOC 4ZVEA 3H7HB 1RAEB 3ET6B 1LK7A 4MAKA 2AD9A 4IG0B 2IRXA 1FXDA 3D1HA 2BABA 3V5RA 3OPKA 3QT5A 2ZH7A 2PA3A 1XMQJ 3NGTA 1KLMB 3LP2B 4UOHA 2UXDF 4U8YA 4IKAA 1VFJA 3L09A 3MEGA 2VUGA 3FEYB 2KHDA 3NGSA 4XPCA 4OJGA 4C11A 5B0BA 4F3QA 2IYGA 1NB7A 3MR7A 3FZBA 3GFYA 1S10A 3BH7B 2NLWA 5A2QY 5DS7A 3LP1B 2G0CA 3DI6B 5E3PA 1CQNA 4F4ZA 2FLPA 2VH7A 3H5YA 3H90A 4J91A 2W8LA 4ED0A 2C3YA 2L48A 3B8HA 2M3DA 3IO1A 4F3MA 3N6LA 2K3KA 1IVZA 2X7IA 1FDDA 4H4KA 2QLFB 2CADA 4OX9F 1RQ0A 1MNEA 2ZOMA 3GV5B 4DL7A 2G2ZA 1FKOB 4J9KA 5LMNF 3EMTA 3QO9A 1NDLA 2A2DA 3BO3A 4L3KA 4DUZF 5CZXA 3M05A 3E01B 2G2YA 2RSQA 4KY3A 2LU1A 2H4YB 4C48A 3IWNC 4X62J 3BGRB 1FRLA 4DPOA 4MK8A 2BJ7A 3MEEA 3GLJA 1U48A 3MCNA 2QL7B 3I82A 3WX8A 2PE8A 1X0FA 4DL6A 4J9SA 2LCWA 1UCNA 5HANA 3MR2A 3CB4A 1WHXA 3O8WA 2IAJB 1UW9A 3CCRS 3M9OB 3OSNA 3CTRA 5HMXA 4PQUB 4DL0C 2B4OA 3PYGA 3K59A 4USUA 2UXBJ 2DCLA 2PI5A 2CNNB 2FJDB 2OPRB 4IO1A 2HNDA 1VBXA 1BY9A 4ZHRA 4OL8A 2HKEA 1QUVA 2GVDA 1ACMB 3DU6A 3AD7C 4P7VA 5D0GA 2M8HA 1LW0B 4DCPB 4KHRA 4KB7A 5T41A 5LMUF 3C66A 3F73A 1DTQB 3N5BA 3U7JA 5DLFA 4KE5A 1TAUA 3WZ0A 2H5EA 2E44A 4JI7F 3W64A 1YJUA 2WK4A 4G1IA 3DRPA 2MY7A 4HT5A 4J9RA 4RW6A 3RRKA 3RTVA 2DGVA 4J9VA 1EARA 1UP1A 3GJSB 3D4JA 3HCXA 3IG1A 5KFJA 1SKUB 1S57A 4J9UE 2I8EA 5JXSA 2OTJS 2CQ0A 1WC0A 5L1KA 3AY0A 2VA2A 4NLDA 1OWXA 3MEGB 2BYCA 1IJEB 2HBQB 3O5TB 4JOUA 1PGZA 1DQ8A 1U45A 2BQRA 2H1YA 3GYGA 1NJXA 1NSPA 3SCJE 3VAFA 2C2RA 3GV8B 4NLRA 3CCLS 2L9DA 1MLAA 3ISND 2CPYA 4WPAA 1HWUA 2L9NA 2J0WA 4YB7A 2KYZA 2OSQA 4JI6J 3R3TA 5ETTA 3V6HA 1WELA 3QMQA 1CJVA 2YWKA 5IZHA 3UWTA 1N56A 3DHXA 3H0PA 2KFNA 2N7CA 1O0PA 2YX4A 3V4IA 1S1TA 3A3PB 2IBKA 4CNZA 3TP2A 2KDOA 4IR1A 4EO8A 1S9EA 1SC3B 4N47A 4QU7A 2M52A 2BW7A 1TKTA 4LR7A 1HNVA 3QO9B 3DOMA 2A6MA 3ZXWA 3CJ5A 1EKSA 1QTNB 3TUIC 1NK6A 1P27B 1GH8A 5HO4A 3Q2SC 1Y5LB 2DHSA 2U1AA 3KG4A 4TKTA 3MEEB 3K0JA 2E7XA 1U1QA 4A8FA 5GADI 2B5JA 2OO4A 1UVIA 3E2EA 2EW9A 4I4BA 3GQCA 4HHJA 3CD7A 2F4VJ 2PSZA 2WAQD 3MZIA 5IWAF 2BBEA 1P1TA 3GWCA 2JRSA 5E2QA 1B7FA 4LF5J 1QVFR 2M4MA 2R7SA 1WHVA 1YTYA 5CZVA 3QZ7A 2HNDB 4ZHRB 3VWSA 5KAKA 2E66A 2GVDB 4KO0A 3CCZA 2HBRB 2MSSA 2KHCA 3ZNJ1 1MG7A 1NK5A 5KFZA 4C9DA 2NPFA 1S6UA 3O1LA 4QWBA 4ELVA 1NK0A 4TU7A 1S1UA 4X4RA 3C16B 4FKYA 1RBAA 2IC3A 1PAEX 3DRPB 4ECSA 1R3NA 4WFZA 4RW6B 3T5LA 4ZVUB 1BWVA 3N6MA 5ETNA 3IG1B 1DRZA 1S0NA 4XO0A 1NPPA 1VISA 4MYTA 2FJXA 3OQ2A 5AXLA 4QWEA 3PG9A 2QEXS 2F5GA 1PC5A 4LREA 2PMHA 5HLFA 1FDAA 4P6QA 1LWXA 5B0AA 5RUBA 2MB0B 2JEJA 4ZP8A 4CH0S 1VQ5S 4F8RA 2GJ2A 2F9JA 2XLKA 4TQRA 3H2VE 4KKOA 3C6TA 3C19A 1MSWD 4XTTA 4CRJA 2YKMA 3AOAA 3K57A 4NLPA 4ZMMA 1DARA 1L3SA 2LQ9A 1CSJA 2QTWA 4Y65A 4RW9A 2BW2A 2DTJA 2XGPA 1IR1A 1KFSA 3IR5B 1CJVB 2CVIA 4XDDA 2MHNA 3DRRA 1FEHA 2ZWPA 1HPZA 1FRXA 1HHTP 3AD8C 3C14A 3V4IB 3CJKA 1PC4A 5FDLA 4KHPF 1S1TB 1ZA2B 1HWIA 2PFDA 2FY1A 1DQ9A 3AA9A 4DV1F 3S8SA 2AGQA 4EBCA 3TANA 4FYVB 1ZM2A 4X4OA 5GAGI 4JBCA 2OMOA 3ZO7A 1TKTB 3G8QA 1HNVB 1ELOA 3MECA 2BKPA 4YR2A 3JQJA 2XWXA 3N79A 5KT5A 3IA0A 2DHAA 4OHYA 2Y0BB 3PW0A 4PXEA 2ILYA 1VC5A 2YPYA 4NA2A 4LF2A 4KPYA 3NCRA 2D3O1 5FD1A 1Y00A 2JSXA 1C4CA 4ED6A 4DOZA 2RDDA 1R31A 1TELA 3POTA 2W24A 3SCLE 2R2SA 5HJYA 2PD1A 2DJWA 2CQGA 5GADU 3EVWA 1KRPA 4DX6A 1OY9A 4ZVPB 4UW2A 2D9PA 4LF4J 2BJ8A 4X64F 2DPIA 2AGOA 3BGOP 3EGNA 2Q6CA 2CFXA 1N54B 4KO0B 2KXNB 4P52A 1X60A 5K14A 5BYQA 1UTAA 2WB4A 3UR0A 2RD5C 1PYOB 4X66J 4N7TA 8AT1B 1RA7A 2V8GA 5I3UA 2FJEB 4A8XA 2HIQA 2H9ZA 2K8GA 3CCWA 1S1UB 2DD8S 2V8HA 2GX8A 2C3OA 2R8HA 1KTQA 1IBLF 1BQMA 5C5JA 3BSCA 2IC3B 1HKAA 4ZLNA 3MF5A 5KFEA 4YB6A 2JH3A 3MM5A 1RT4A 5C7PA 5F0WA 1N6QA 1HA1A 4K4UA 2AU0A 1HNZJ 3IGNA 4Y2KA 5DGAA 3I0SA 5T7LA 4DV2J 4A8MP 4P2XA 5HLFB 4OHZA 2C28A 2MKJA 3EVMA 3A13A 1U2FA 1T3OA 4QYZJ 2YNHB 3W3SA 1CJUA 3KNGA 3QLHA 2VDIA 2PN6A 3HJFA 1NJIT 5F8JA 4KKOB 3C6TB 4LBPA 1VQMS 2YKMB 2CDRB 4OZ0A 2BX6A 2V8PA 2P5VA 3PKYA 2H48B 3KOAA 4XDCA 4RW9B 4N77A 3TA0A 3IGVA 2NXJA 3DRRB 1GFWB 1HPZB 2D7SA 2FJWA 4I0WA 3Q86A 1MN7A 3C14B 3CJKB 5FDLB 1Q95G 2N4DA 5D15A 4C4WA 3RAQA 1EX8A 2K3IA 1ZM9A 2DCUB 4R25A 4MFBA 2VFVA 1I94J 4AUKA 1JLBA 2MXYA 3EZOA 1EQ0A 1NNDA 2QLXA 2VG7A 3W60A 3C8YA 2YKOA 1SJ4P 3MECB 4YMEA 3G9CA 4OZJA 2IHR1 5F3TA 5EWGA 4Y28C 1PJ7A 3Q89A 1ROFA 1RHKB 4RUCA 4J9PA 4PCQA 4DR6F 3EZUA 2R7WA 2YXLA 3M8QA 3R2CJ 2UUAF 1QSYA 4KGVB 3NLCA 1W2IA 1JXVA 3MXHP 1T9TA 5IQQA 3Q8QB 1NU4A 2J7UA 2NZ4A 2JVRA 2DO4A 3POTB 4DSLA 3DKDA 2ZBQA 4CLKA 3OHAA 4QIGA 3CDWA 4ICLA 4PAAA 2E5LJ 3GCXP 1KOOA 1U47A 4WKYA 4DR4J 4NZ7A 1RT2A 1YZ6A 1LFPA 2RIJA 4A48A 4Y6IA 4QWAA 2ZITA 1HYSA 1E6VA 2J76E 3ENWA 4HTIA 2OPQA 1NAQA 2R2TA 4B9SA 4FN5A 3CMES 4JI4J 4C6AA 2CUYA 3QJPA 2PT0A 4LR9A 5I3UB 2ZDOA 3THTA 3TJ8A 2V8VA 1NH7A 1IWGA 4OX6A 2OKQA 4JV2A 1NO8A 2J9DA 1BQMB 1F5CA 2CJQA 4RJVA 4CLUA 5LJ5Y 1ITPA 3MAAA 2FDNA 1X4BA 3MM5B 1RT4B 1N6QB 1S9FA 1H3DA 5D6GA 1HD0A 1FJGJ 3I0SB 3FUYA 5T7LB 3EVOA 4ECTA 1S76D 3HSJA 3HSGA 2F8EX 1FJCA 5E3QA 1FTRA 1IKVB 4F0HA 1X4HA 3VZIA 5F9LA 1CJUB 1JKHA 2WCXA 3QLHB 4ZPCA 2YX1A 2WVDA 3S7RA 3EDQB 4PG4A 3TJAA 2WVBA 1L3KA 3CIZA 1NBEB 4DU8A 4OX8A 1KVIA 5CD4A 5LSRA 2I9SA 4JI0J 3FBCA 4RL1A 3CDUA 2AYBA 2B6AA 1K1QA 1Y3JA 5LM7E 3PR5B 2VOPA 1Z2LA 2YNFA 3PHEA 2XG8A 3KXDA 3L9ZA 4CO0A 2HGMA 3CE8A 3KJNB 1YK9A 3NGUA 1X5SA 1RB0A 4MFBB 4YHHJ 3TR5A 1JLBB 1A6LA 3ONQA 3KJVA 1FWKA 3SZ2A 3CCUS 1DBDA 2VG7B 3MM6B 4YN3B 4F0KA 2BOAA 4ID5A 2FZCB 3HD1A 2PO4A 3VF0B 3KDNA 4KH1B 4NI2A 3OFFA 1T3NA 2N4CA 1ZTTA 2FLNA 1YLXA 3JQMA 3M8QB 1TKZA 2VQFF 1VQYA 4GO5X 4K5SA 2QL5B 2MZRA 4Q0BA 1RCXB 3HULA 2FZGB 2DRDA 3QT8A 1N34J 4DSKA 2CYYA 2UUWA 2BEFA 3SI8A 1RISA 2WOMB 2C3UA 2HHHJ 2HAFA 4ICLB 2V2VA 4X62F 1WC3A 5KFRA 4GKJJ 1RT2B 4IYQA 4BLGA 3W8GA 4L73A 3ZZPA 5LSOA 1HYSB 1TKXA 1E6VB 4JI5J 1W7WA 5ETQA 3DC2A 3IR6B 3TZWA 2OPQB 2DH7A 3PYFA 2VF3A 3D6FB 4Q7AA 2XHWA 1Y5NB 1RWNB 1TQLA 4FBUA 3NGDA 3HSDA 2XYGB 3KJFB 2MKCA 4CT9A 1LFWA 2IM0A 2OMLA 2GS8A 3BB5A 2BKOA 4LF7F 4M5IA 1D1UA 1WHWA 3MAAB 4WBFA 3LGNA 4NCBA 1Q78A 1OMSA 4X4SA 5IFMA 4EFAC 5AXMA 4X84A 3PFOA 3JSBA 2HK2A 4ZJLA 1IM6A 1G6BA 3DLKA 1OSCA 5EGYA 3UN2A 1Y0HA 4DUYF 1KQGB 4GMKA 3NMRA 3MHYA 5IT9Y 3NAHA 1BD6A 5AJ3J 3EGVA 1T9WA 3H5XA 2GIRA 4WU3A 3NGKA 2CPIA 1M5SA 2B6AB 1PIEA 1UFWA 4LJMA 1XNRJ 3EXCX 1RWOB 2YNFB 4ELTA 4M5JA 2ZZTA 1D9FA 1AFJA 2HZCA 3K5OA 4NLUA 3HVTA 2Z8QA 3RBXA 4FPIA 4JV5J 2CRLA 3KJVB 1K0VA 1KLNA 2ZJPQ 1VBYA 2FVQA 4F50A 4E8UA 4ID5B 4CO3A 1UA0A 1NSAA 1V3SA 3AA8A 2DGXA 2ZZNA 5DDQC 1P9YA 3KYLA 1QAJA 4F4AA 4NI2B 3EICA 3TZYA 2QLWA 3VHQA 1TKZB 3MCOA 4J37A 1FDNA 2W4PA 9RUBA 4Q0BB 1W26A 1FRKA 4B3TF 4YOEA 3W8PA 1ZM3A 2QG9B 4OV6A 3F56A 2LA4A 4C8OA 3HFZB 2MLXA 2ZWOA 1RYRA 1YRXA 3H20A 2YQ0A 2W9BA 3AODA 3LOUA 3KHLA 2RNEA 2NREA 4JI1F 4OYPA 1T9VA 2VDHA 3AB2B 3BDEA 1TP7A 3ZZYA 2C3PA 3DOKA 3UE2A 5BR8J 4G65A 2HYIB 1L3TA 4IH5A 2A6OA 2EG1A 3CC2S 2HLUA 1EAYC 5KFLA 2OJ3A 1Q8BA 1C4AA 4DQIA 2CJ9A 1Y7PA 3HK2A 2YX7A 4ZP7A 1X4FA 2LA6A 2D3UA 1SL1A 3EGWB 4I7FA 2XY7A 3SXLA 2W1BA 4KPCA 4Q8EA 2M8DB 4HT7A 4WP8A 5B7WA 3DLKB 3M6XA 2COLA 4UOGA 4WP9A 2ASDA 4CYUA 2DISA 5KG4A 1K9MT 4RBTA 2J8SA 4OQJA 3Q8YA 4JI8J 1S12A 3I9V9 2FD2A 1T95A 4TU9A 1DAXA 3G86A 2ROEA 2MGZA 4ALZA 4K4WA 2H51B 3AH6A 5L9NA 1Y10A 3FRZA 2MLZA 4ZIWA 2L3MA 5ETPA 1QSSA 4ER8A 3BKFA 3KLEB 3QFWA 3A8IA 3MGJA 2R8JA 3OL9A 1HBOB 4WWSA 3VVUA 4UZBA 3FBBA 3GONA 3HVTB 3N6NA 2LU2A 4B3RJ 3IBFB 1NZAA 2E1PA 3TO8A 5AE2A 4RKUC 5HAOA 1HNXJ 4RZRA 2MEWA 3PW5A 2OPPA 2K7KA 1UEKA 2R7XA 4OZNA 5KFYA 2D1CA 3L7PA 4K59A 1PJ5A 4IRDA 3T1HJ 4DQRA 3TQEA 4UTGA 1UVLA 2L9WA 1DJ0A 4P2SA 1IM4A 5A8RA 3NP5A 2YWHA 1GTEA 4M5LA 4LFAJ 2WSCC 2QO3A 1KONA 2BV3A 3G96A 2BVZA 4D3HA 4DLGA 3MM8A 2LDIA 2NUHA 3FKBA 1QDUB 1AB8A 1PBUA 1X5OA 4OYXA 2HQDA 2QMWA 3PO5A 4B9UA 3ZZOA 3QNWB 4BWMA 4DPYA 1NK8A 2M5YA 4HACA 2VG5A 1GMWD 3K5LA 2N7YA 2W9BB 3R7NB 3MPDA 1WTBA 1SL2A 2M2BA 2NSBA 4W98A 2ZC3A 1RBOB 2F7VA 2IDLA 4NZ0A 1FCAA 4ZJOA 4DV7J 1RLCL 4R8UA 4OHVA 4H4KC 1YJTA 1SL0A 3DOKB 3D66A 4RW4A 3B4MA 4YY3F 2B9YA 4DL5A 1M1HA 1RTIB 2W2PP 1RAFB 4LF4F 3QJJA 2OEJA 3FQLA 4NWBA 1H2TZ 1VDHA 2CPHA 3GYXB 2LLZA 1RADB 3HHLC 1S0VA 3OFHA 5MLCV 3UNYA 3FCVA 5KFGA 3KMSA 1S1XA 2YKPA 3IBWA 4LFCF 1HI8A 2EKNA 4I7FB 3NAIA 3N28A 2OAUA 1NMEB 2XY6A 1I51B 3W63A 1QLNA 1YGYA 4O0IA 1WSRA 4DV4F 1J2VA 1DZ5A 3B78A 4CYUB 3ADAC 4K2JA 4LFBF 5DG7A 2B4VA 1IJFB 3DN9A 1HNZF 4RUHA 2ZH6A 4BS2A 1EJ7L 1MMDA 2B9WA 1X5TA 3LUYA 2GMLA 2V2ZA 1ICEB 4ZPTR 2B4UA 2LEBA 3PDNA 2LQBA 5A2QU 4LF9F 3MMAA 1S77D 2UXDJ 2D3ZA 1S9GB 4NCGB 2ZUAA 1QUPA 4LSZB 2AMCB 2ALZA 3OTBA 4Q2MA 3N9UC 5LJ3Y 3D7SB 1U1KA 2R7OA 3RAXA 4OFZA 3M9MB 2QLBB 2HGNA 2OPPB 4DZ6A 2JFKA 3PX6A 3W5ZA 3MFHA 4DJBA 2HZVA 2IJRA 1Q7YT 2XNQA 4WF9Q 3M8YA 1FX4A 3SCKE 3MMJA 2FVRA 2R4FA 4ZA1A 2RB7A 4FF3A 6FD1A 5A8RB 2HBYB 3AB4B 2KZZA 3D54A 3JTPA 1XMBA 3DLEA 2Z2YB 2AZ1A 5CYQA 3MM8B 4HKQA 2R8IA 4M5NA 1JLCA 5KFDA 5EWFA 1UEUA 5LMNJ 5A8KA 1XR7A 1KHVA 2DR8A 1NCLA 4DUZJ 4HACB 2HNZA 2VG5B 2C2MB 1P8GA 2IA6A 2CIMA 2RU9A 5KG1A 1T03A 1KBRA 3I56S 3NKYA 1B0PA 3D3BJ 5J2QA 4JUZA 4C3KA 2BACA 3SQGA 1DLOA 4HI1A 1U0SA 2VC0A 1UVNA 6FDRA 4R8UB 4Y34A 1IR0A 3JS9A 2CNLB 4RW4B 2OEMA 4UUWA 2ZHAA 2AQ4A 5IXUA 2EFVA 2E5LF 1XIQA 3BBCA 2IVFB 2BA9A 3DYAA 3M8ZA 3M2UA 1NZ8A 4M8LA 1V6HA 5A76A 3K17A 3M8PA 1UZHA 4LR8A 1U1LA 2FLLA 1X4AA 1REVA 1PBAA 5KFIA 4NYPA 2W2MP 5LL6d 4E2FB 4YR3A 2HHVA 3H59A 3NS6A 1YHQS 1S1XB 1YJWS 2G1DA 4DWIA 3BH6B 1RHUB 4OI4A 4ZVOB 1N5YA 2ZE2A 2AEMA 5KT7A 1EP4A 4GVBB 1UJ6A 1UFLA 4K4XA 3CXCR 2RILA 2FJVA 3O44A 3L7UA 4JI7J 2VBYA 3TZXA 4I56A 3OVAA 3PV8A 1S1WA 4QIVA 3MPVA 4KIAA 3UDVA 2I1RA 1BUXA 4DFPA 3TX8A 2HS3A 2MLYA 3FBEA 1U4BA 4ZPWR 3HX9A 3VAMA 2P6SA 3GSIA 2XEXA 2R9LA 1I1GA 1WC6A 1JX4A 4DPXA 2X1BA 3RR7A 4KAIA 3MMAB 2QZ8A 2GW8A 5CHCB 1RAAB 5D0RA 3DCAA 3KLGA 3K5PA 2OLWA 2ADBA 2MJNA 4QR2A 1PO6A 2QL9B 3I9ZA 4RNHA 5IV4A 3FQKA 1HWLA 1HBMA 2AX0A 5C2CA 1FNOA 4QWDA 2XMWA 1KP6A 2MQLA 1IBCB 2CKWA 3S1TA 2DYAA 2KFZA 5KFWA 3ZZZA 2F65A 2AWZA 5GMKa 4IH6A 2VKRA 3T1AA 1R8PA 3T6JA 1HARA 2A18A 3BSAA 4O4GA 3PM9A 3NS5A 4YHHF 4F0MA 2CJYB 1ULRA 3NGRA 3MEDA 1NJWA 2H3EB 2W4CA 3DLEB 1JNRB 3IM8A 2HS0A 1QE1A 2AJ0A 4JV1A 2O5DA 5L1IA 2BUNA 2J9CA 1JLCB 1RI7A 1RAJA 1BC6A 2F8MA 2VASA 4MKAA 1S97A 3FSXA 1A7GE 2KFYA 4ECYA 1VBZA 4DL4A 2VKZG 4IFVA 2HNZB 4JYAF 3VQTA 2E7WA 2WSFC 4DR7F 3QRPA 3H40A 1U1PA 1HWKA 5DM6Q 5KTQA 3CCES 2NQPA 1T03B 3DDNA 5JJBA 2WB1D 4U7UD 4ERDA 1LEOA 5J2QB 1Q8KA 2R2RA 2HHXA 3SQGB 1DLOB 2DGQA 2MZ1A 4E0DA 2HVZA 1FJ7A 1QSLA 4DI6A 4BDPA 3QFHA 1DHMA 2EK1A 1VQLS 5IM0A 3GSDA 3DYAB 3M2UB 5HN0A 4OYMA 5IWAJ 1S99A 3HHDA 4I67A 2OFHX 4DG1A 2CQ1A 2CQ2A 4DCOB 4U7UK 3L3CA 1M1KT 2HQFA 4F2RA 3SEOA 4WK1A 3M8PB 2MZQA 4DV5F 1REVB 3N01A 1L3VA 4HH0A 5F8GA 4WKRA 1LW2A 1SJ1A 1WNEA 4O3SA 3DM2A 1MMNA 2NXNA 1SB6A 4K4VA 1N5YB 1EP4B 2JFDA 3VAJA 3HJVA 1LWFA 2KTQA 4ID8A 5ETKA 2DVIA 1GXUA 1HQ2A 2DXEA 1S1WB 4PXDA 4EI2A 4UOFA 5KFOA 2QN6B 2W2QP 5J2NA 2C2ZB 5KG6A 2MQOA 2WBRA 2ZM6F 3IWXA 2OI2A 2WONA 1XMOF 1NM2A 1SI9A 2K1RA 3QT7A 4RU2A 4FYDA 3K8WA 3LGHA 2GJIA 1RACB 4I6WA 3R97A 1SJ3P 5F8MA 1XBWA 1LWCA 3CDBA 1R8HA 1OQ6A 1HMVA 3OLBA 3M6VA 2LECA 5HP1A 3TWZA 3KLGB 3T5KA 5G0RA 3ZTQA 2JHEA 3MAHA 3SFUA 1R89A 3AJ2A 2D41A 1OO0B 1MMLA 5IOLA 2J7WA 2JLGA 4J7CA 2RU3A 1YIJS 2BM1A 5BJRA 4NCAA 1IKWA 4NXMF 1RXOB 4ANCA 2XCAA 4MIBA 3M32B 2H5IB 2ZBPA 2RF2B 4NEZA 4O4GB 2PFFB 2B56A 1RHRB 3FC9A 4TN2A 4KHPJ 4A8KA 3MEDB 4DQSA 2ZHBA 4O3RA 1QE1B 4O44B 5GMDA 4QIWD 4XPEA 4DV1J 4NXNF 3T1YJ 3BO4A 4NOHA 3OTOF 5DZ6A 1UFKA 5B08A 3GU0A 3BYPA 4QR1A 1N33F 3IAM9 3QGIA 2JC0A 2EG2A 4IFVB 1NHKL 3WC2A 1JIHA 3EUNA 5HI7A 4Y00A 4WU2A 4ZVRB 3QATA 1F5AA 4ZDNA 1R0BG 3C3LA 4USVA 4IR9A 4F4YA 3UNGC 2RQKA 3M7VA 2XO7A 4F36A 4FXVA 3BYRA 4B17A 1MWQA 3VGUA 2OPSA 1ZOTA 5JVGQ 2QE5A 1TL1A 2HW3A 1AXQA 3ELHA 5IM0B 2AX1A 5M2RA 5K5MA 3W2WA 3GV7B 1SQEA 5EX3A 3DHWC 5DZ7A 4DG1B 1TUGB 1T9UA 3MD1A 4LRFA 4WXWA 4X64J 5BR8F 4CLYA 2NPIA 1CJKA 4CLFA 1FNMA 2XMUA 4DS4A 3PR4A 3DM2B 2IA0A 1MW7A 1Q1KA 2LYVA 2OIHA 1NUEA 1RP5A 2M9KA 1LWFB 1X4DA 2I5JA 3QWPA 1TL3A 2Y1RI 4OJ3A 4DR2F 4Y0FA 1IBLJ 3UFCX 5H1SV 1OIAA 4R0JA 2W9AA 1F2HA 5K8NA 3Q2TC 3G6YA 3EM1A 5J2NB 4ZPDA 3D3CJ 2LKZA 4QYZK 2GIQA 2WONB 5GMEA 4AD6A 2K1RB 1F60B 1F9HA 3JSYA 1MWYA 4IFYA 2FUG9 4B9LA 1AFIA 1TV6B 1FO1A 1LWCB 3NNAA 2VG6A 2UVWA 5L46A 1HMVB 5E5NA 3RBEA 5HP1B 5HQMA 2VBXA 2VPZB 4RLEA 2W9CA 2EC0A 4G1QA 3DNCA 1ZBTA 2C2EA 1UWAA 5IS2A 1M5KC 1Q16B 2VFTA 1L5UA 3M6WA 1FKPA 3SSQA 4USJC 1PAUB 2EBEA 2RHSB 1P1LA 2V63A 1JLAB 3KNAA 4NLQA 4WK3A 2MDAA 3M8SA 1IKWB 2NR0A 5L8RC 3GIKA 1KR4A 3FGVA 2YKAA 1GMUA 5I4MA 2H4WB 3KHHA 5K20B 2RVJA 4B3RF 1CJTA 1V3RA 2DNKA 2VFSA 2HRUA 5KOXA 2QSFA 1U02A 1X9SA 1RDRA 2YQ1A 3X3UA 3MTKA 4OMFG 2ZH8A 3RU0A 2GO9A 3I5CA 3BN4A 2AHOB 1KOHA 2BJ3A 1WWHA 2B8QA 3AXMA 4CI0B 2V8DA 2RJZA 5M2PA 4DF4A 4ZN1A 2MSTA 2ZKUA 4KT0C 2FIUA 1M90T 3LP0A 1K1SA 4FZVA 5A0YA 2MHEA 4DR6J 5KFCA 5KFMA 1XERA 1F0XA 2W25A 2UUAJ 4CTAA 3M9NB 1XR5A 3JB9k 3SFGA 1VQ6S 1I6JA 3H4BA 1H74A 1EKRA 2OPSB 1GEHA 3LQVA 5CAAA 1TL1B 2K06A 1TR0A 4PPDA 3NOGA 4PQAA 2YY3A 1YQHA 4WXOA 3W2WB 4CIOA 3R27A 4CO1A 2JEIA 5IT0A 2B51A 2NUUG 3GZ7A 4PYDA 4U95A 4RNNA 5L9XA 4DV7F 4RNOA 3ETOA 2A10A 3VAHA 4KSEB 1CJKB 2CDQA 1VLYA 3NNHA 2BJ1A 1RWMB 3I96A 2GQCA 5CYMA 4F25A 2VJUA 2HFZA 1JXEA 2ZKTA 2V34A 1T05A 3Q83A 3TAQA 2KL8A 4RUAA 2U2FA 5F3ZA 2JZ5A 3T5HA 3OL8A 2QA4G 2V9WA 2I5JB 3T5JA 1TL3B 5HJXA 8RUCA 4KGXB 4ATNA 5DJBA 4MIWA 2PIIA 3OFGA 1NKBA 1HBNA 3J7YI 1OYDA 3KDOA 5C24A 1MU2A 2H54B 4HR2A 4PUOA 4FYYB 1ZZNA 5AT1B 3NEKA 2ZH9A 3G6XA 4FS1A 4U67Q 4M94A 2ZVIA 4DFJA 4P73A 2I6WA 3NRBA 3BV8A 5CCLA 2W9CB 3L4BC 4B3SJ 3OXFA 4G1QB 2FJAB 4Z7YA 2JX2A 4KJIA 2CPDA 4FYXB 2WHOA 3LANA 3E51A 1FKPB 1N48A 3MMCA 5L39A 5I3PA 4CM0A 4OI1A 4UY8T 2XM3A 5H9EJ 3DDIA 1GNKA 1AYEA 3HVRA 4FNHA 2E9TA 4ED7A 4O4RA 2Q3PA 2DIVA 3I55S 4F4WA 2AF6A 1UL3A 4F4XA 1KSPA 2ZNZA 1CJTB 4JI3F 4J9QA 4QPXA 2MQ8A 3P8BB 3J7ZT 3CCSS 3H98A 2MYFA 5J1EA 3HMJG 1VBKA 2HQIA 4FF2A 1U0HA 2CNKB 1RU2A 1WG4A 2HZAA 2MJUA 3UI3A 3R1LA 3I31A 4ILMA 3LP0B 2ASJA 5A0YB 1SPBP 5GAHU 5AE3A 2OP5A 1NSQA 4CTAB 2VQFJ 3D6MB 4FF1A 1B3TA 1AUDA 4CDIA 4TU8A 1EHWA 4NRTA 1EQMA 3HHLA 3V4MA 4AYBD 4X4TA 2BJ9A 3V6JA 1FTCA 3ZTRA 4ZOSA 3L7OA 4LBHA 4ANDA 1S0MA 3OV7A 1BWEA 2RAQA 1NJYA 1JWWA 2CVEA 1F6TA 2XTJP 2EWHA 1U1OA 4J9LA 5T14A 3FVYA 4FVCA 2VIHA 4LRBA 5CYMB 3CJ8A 4NLOA 2IIHA 3T6BA 1GTHA 3WDOA 1T05B 3GMGA 1U2RA 3NWRA 1TUVA 1H0HB 2ZEJA 2FGCA 4L72B 4YS2A 1CC8A 4U7CA 2OEKA 4KC5A 2R7UA 4OZ5A 1S6QB 3BM7A 4RO0A 1FD8A 1VQ7S 4LF7J 3RBDA 5C24B 1MU2B 2HK3A 3TEHB 4PUOB 1N5VA 2MZSA 3SV4A 3Q8VA 4ELUA 4KQZA 3ULHA 3J7YU 5IT9U 1TL7A 1CULA 3J80Y 2B9XA 1S4EA 1JLGA 3JSMA 2FVSA 5JVHQ 1LQ9A 1KFDA 1AZSA 2IY5B 2V69A 3CF5Q 4K8RA 4DUYJ 1HNWJ 2AKWB 4C7QA 2IM1A 2HRYA 3MMCB 5CA5A 1RWPB 4ECVA 2IMWP 5JUMA 4EZ6A 5AE1A 2YVSA 3HHNB 4ES2A 1YKWA 2BJDA 3AHPA 3TX0A 2RQ4A 2HFOA 1KKHA 3QYYA 4C11B 2MQMA 4EUVA 1ZAXA 5KFNA 2ZH3A 2DITA 1OYEA 2DR5A 2XI3A 1Z1ZA 4IO9Q 1ZAWA 5LXRA 2DHGA 4AXJA 5AXNA 2DRAA 1C2PA 3N5FA 1TZ0A 5KFFA 1KDNA 4DX5A 2DNQA 5J1EB 2M70A 1VC0A 2HQGA 3QZ8A 3QAUA 4CLSA 2IVMA 2EI5A 3QGGA 1RSCA 1U0HB 2ERRA 3ZTSA 2Z2MA 4GVLA 1FE0A 4F2SA 3R1HA 5D8HB 3OUYA 2DB1A 2NYHA 2KVIA 3R5CA 1NXIA 4HL9A 2PGCA 4QR0A 1VIXA 4UQTA 1FVSA 4EU0A 1VCTA 2RH3A 4NPOA 1RABB 2JEFA 3I4HX 3T9NA 1M5PC 3KJQB 2RDJA 3QIDA 3R5DA 3UD4P 1TFYA 4B3TJ 1H2UX 4GKKF 2Q6BA 2VZ9A 2VICA 2AGPA 3E3XA 3HHLB 2DR6A 1VQNS 2BRKA 3NBPA 4USIA 1FD2A 4B08A 1RTHA 4WIIA 3THPA 3PYDA 7FD1A 1U6FA 3A3OB 2VODA 2KRRA 3DLBA 4FP9A 1G2EA 1X4EA 3Q8SB 4JI1J 1A0OB 1FWPA 5E7OB 4YEAA 3BSNA 2ILZA 3B4DA 4DL2A 3O6QA 4AE5A 2DNPA 2UV8G 2RE1A 2Q1LA 4X2BA 2A2CA 2HVEA 1CC7A 4QJVA 1C1BA 4ZITA 3DRXA 3TAPA 1N8RT 4RNMA 1A9NB 3G2XA 4G1PA 3CULA 5D78A 3TEGA 4MH8A 1IBMF 3TOQA 1FXLA 2P9CA 2HWHA 3IRWP 1FJEB 4N8OA 3QPIA 1NEEA 1UJ4A 4V1Ak 2N3LA 4P71A 1FRJA 4USTA 3PX4A 1REGX 4X65J 1TL7B 2ZC4A 1CULB 5L1LA 4C8ZA 3JSMB 3D0HE 2HHQA 1AZSB 4DPTA 1YI2S 1SBRA 2Z30B 4I1TA 3KTQA 3GFZA 3CMAS 1HBUA 2C2DA 1APSA 2V6AA 1H98A 4ED1A 3DXBA 3ZZTA 1S1VA 1RWKB 1WHYA 4ZVHA 3DFEA 3DLHA 4U96A 2DNNA 4KHMA 5FLXY 5HBMA 2Y0SD 1IKXA 3OTCA 4DV3J 4H4MA 4G6VB 4JI2F 5KFHA 1E6YA 2DT9A 1S0OA 4OHXA 1XR6A 1SC1B 3UDLA 4ECUA 4ZS6A 1RWWB 4TVAB 2V50A 1WF1A 2CJAA 3W2VA 2DNZA 1URRA 1U24A 3P45B 4PABA 3BEGB 3U1NA 3HI9A 1SCJB 2RMLA 1VYAA 3NWGA 4C8LA 3DMJA 3OUYB 1V5IB 3W5XA 3OT9A 2AP6A 1SVDA 3FCWA 1EZZB 3H5SA 2KT2A 3DOLA 5H9FK 3EXYA 1S9EB 3HSZA 4ZVGA 3T1YF 2C2NA 1IQTA 2AW0A 5KG7A 2B3TB 3P6YC 4M95A 1Q8LA 3HHKA 3CC4S 2GNKA 4DUTA 4ZKAA 3IAS9 3DOMB 1WKJA 2GV1A 2LQJA 5BYRA 3GCWP 2R7QA 3D5MA 3T41A 4K4TA 1SUQA 4RBUA 4NYOA 3NBPB 2B7BB 1RTHB 1UMJA 4B3MF 2XULA 2W7OA 2AIRB 4ZVTB 1S6PA 2Y1IA 2UV8A 2J9EA 5M2UA 5HVFA 2B5JB 2EPIA 2DEJA 2HMIA 2CZ4A 1FK9A 4I2QA 3G8TA 1NK4A 3VGTA 3ZNUA 4YY3J 3AOBA 2CPXA 1ZM4A 2J0QD 1D9DA 3UCZP 1WF0A 1V5VA 4P74A 4EK2A 4ZPVR 4DV0F 3P5BP 3VGSA 2X1GA 1C1BB 4CNYA 2NXUA 2Q43A 3IS9A 1ZH5A 1HR0F 3AFGA 4ITSA 3PKMA 4AL7A 3SSSA 2A0FB 1YJRA 4LFCJ 5U47A 2B43A 3CUNA 1XNQF 3DLGA 1K8AT 5CABA 4C3LA 5LT5A 5B0DA 1BQNA 2IJFA 2NXCA 9ATCB 5J2PA 4DV4J 4FPRA 3AAWB 3DRSA 4U8VA 4ED3A 3VZHA 4I2PA 1B4SA 4GC7A 4LFBJ 2BOPA 1HBUB 1RLDA 4M5HA 2I2YA 2CQBA 4DFMA 4FYWB 3DDKA 1EB0A 1R8CA 4IOBA 3MEKA 3OBIA 1GXTA 3BPSP 5HBMB 1IKXB 1YRUA 4V19X 4K2XA 4LF9J 4H4MB 4NRUA 2EFOA 1WI8A 1E6YB 1T8EA 2KN4A 2MZJA 3BJYA 3CMQA 3OFEA 3EYZA 1XK8A 4YDXA 4KGMA 2QGFB 3W2VB 1KHWA 4NLGA 3SBMA 5ADZA 2QX0A 2UUBF 3UCUP 3A3NB 3DMJB 4LF8F 2B0GA 1G4CA 1QJHA 2JNJA 3JTNA 1WSVA 1TK5A 1LWEA 3DOLB 1S4FA 2V68A 4LQ9A 2IMOA 2MQPA 2C2OB 2HNYA 3RAMA 4FS2A 3KK2A 2CAJA 5CH7B 3I32A 1I3OB 1NDKA 3ENQA 5C42A 1WUUA 1RWUA 1H7WA 4IG0A 2EFPA 2JLFA 3QJLA 1XJWB 4HHHA 2YWEA 3AT1B 1SUQB 4OJHA 4OZ1A 3CC7S 4DBQA 5HROA 1S6PB 1KLMA 1WOPA 1VJQA 5E3CA 4BC7A 4TY9A 1VRTA 3BBBA 5ITHA 2XBPA 2CPJA 2HFNA 1SIWB 4EYIB 2HMIB 1PYSB 1FK9B 3CSKA 4I2QB 4P10A 4J90A 2KU7A 1CBKA 1C0UA 2XS2A 3W9IA 3KG0A 1BHNA 4PG8A 3DI6A 3OHBA 4OI2A 3PJ9A 2W01A 5EUHA 1RGVA 1RWXB 3R6LB 5CYJA 3UW1A 4E98A 4ZN3A 1JJCB 1FI4A 2CQ4A 3IS9B 2HBZB 1NDCA 2YKNA 2YPZA 2LMIA 3AD9C 3HZGA 3HPOA 4K4YA 5K14B 2HVHA 1BE4A 2VPXB 3HFKA 3EZ5A 3NNCA 4MK9A 1YRTA 5HMYA 1UPMB 1V9OA 2A3JA 1NDPA 2GHVC 2MTLA 3DLGB 5D0HA 3CDEA 1H72C 4ILRA 4DQQA 3TRGA 2MQNA 1N32F 4OZ3A 2QA4S 2EXUA 5J2PB 2RRAA 3DRSB 3OJUA 1SC6A 4WJBA 2LDYA 2GAHC 3JXOA 4KV8A 2EVZA 3PFEA 4PRFA 2Z57B 3OR2A 4NLYA 3S01A 5GAEI 4MKBA 5D4PA 2VQEJ 2AEFA 1YG0A 4HTJA 2K7JA 5IT4A 2APOA 1D8YA 3CIMA 3D9BA 4B3SF 2F63A 2DR9A 4ED5A 4F04B 5KG5A 2R7RA 2XS5A 2F3JA 2XHCA 3RYLA 3VQSA 2YNGA 3UDCA 2J0XA 3GG1A 3HHEA 5MAOA 3PRDA 4DR1F 1Z4UA 2CJXB 4QOTA 4ECXA 3LA0A 1S6OA 4ZCLA 3QIPA 2MKYA 1R0CB 1U6BA 3OTDA 2VV5A 3B54A 1CS4A 2UXCF 1UWBA 4OYIA 1URNA 3IMQJ 2DY9A 1UZDA 2V2KA 1KS2A 3HDSA 1LWEB 4LSLA 3H25A 1SJFA 2HNYB 2PEHA 3CJSA 1WDDA 1XQIA 4QPTA 3KK2B 3TI0A 2L41A 3HVAA 5G4DA 3NXZA 3HVWA 1SC4B 5C42B 2JDJA 2FTRA 3H4DA 2HHPA 3TUJC 2Y1JA 3ILLA 4YB5A 4DZDA 5E3RA 2FVCA 5HROB 1FRHA 4JYAJ 4ETZA 5HQ8A 4DCJB 4DR7J 4CLPA 3I5BA 2MMYA 3MCSA 1VRTB 3BQ1A 2VFRA 1CVJA 2AYGA 2LXFA 3PX0A 1IQZA 4MK7A 4P2FA 2L08A 3H2UB 1NSKL 1SQFA 1NKCA 1C0UB 3OD2A 4NLTA 3BF4A 2JC1A 2OD6A 1RT5A 2W7AA 4J5OA 3HT0A 1PCAA 3NOCA 2EKYA 2YKNB 3V81A 4AL5A 1O6XA 4CP5A 1S72S 3BREA 4DV5J 1QAYA 2R8GA 3OR1A 4WTOB 1M0SA 4F02A 2DR7A 2Z2LA 3BR8A 1CG2A 1VMBA 1KVJA 2VOOA 3FMBA 2XMMA 3M8WA 2Y8WA 4A46A 2P8IA 3J81Y 4LIWA 4UT4A 2GHWA 3FZ2A 3RB6A 3RJMB 3CO9A 4A8WA 3LWMA 3ISNC 1C0TA 4O3NA 4KV8B 3WC0A 4K0KF 3AQPA 2KB2A 1B70B 3OR2B 2ZM6J 1XMOJ 4XAKA 3QSYB 1T94A 3ITHA 2FHJD 2ASLA 4PZVA 2BE2A 1HNWF 4XK8C 3MPWA 1JKHB 5GAEU 2DNOA 3A4TA 1WF2A 3AJ1A 1XWLA 2YNGB 4WZMA 3IBCB 3ZZUA 3U27A 2DGOA 4X4UA 2PMWA 2VD3A 1FWLA 1VHFA 2KZMA 1F9EB 2DNGA 3QIPB 1LOUA 1UA1A 4NXMJ 4K4ZA 3RUBL 1CS4B 3RG6A 2C22A 1UWBB 3MM7A 3BO2A 1J5EJ 3EJMA 2BE7D 2RRBA 3ILJA 5B0EA 3UO0A 3LGMA 2E9ZA 2W2NP 3EDRB 2DH9A 3G82A 4LSLB 4HYKA 2YH0A 4HHUA 3C16A 4ZCIA 3NY0A 3QGHA 5F8NA 2ZBRA 4FKXA 4NXNJ 3PXGa 2DGSA 2VU5A 3MPYA 4KTQA 3OTOJ 3R5BA 1LXNA 4AQYF 1N33J 2FC8A 4P2MA 2ALYB 2J6UA 1VK3A 1S5ZA 3P4UB 1IBKF 4QU6A 4YB1P 1ZPWX 4XIUA 4NE9C 4ZLJA 4RU9A 1N0VC 3MUTP 1OY8A 2Z58B 2MY8A 3FMWA 3PY8A 3HFVA 3BSOA 1RA6A 4MYUA 3C6UA 1B0TA 2CZVC 2RQMA 1V3ZA 3UN3A 1O8BA 4P9SA 1PG5B 2ZVSA 1YITS 3TAMA 5KT3A 1RT5B 3PACA 2W7PA 2VA3A 4UOCA 1TKXB 1N4LA 1RT7A 3V81B 4LF6F 4WP3A 1FHTA 4HVZA 4RR5A 1WEXA 3SSRA 5B0CA 1BMQB 3HZEA 3OR1B 2N3OA 2X3DA 1RHQB 5KFSA 4RWWA 3FK4A 3K7RA 4FXWA 1RWVB 2V67A 1DFDA 1WEZA 2IJNA 2CG8A 4Y2CA 3HT3A 2FHOB 3K2YA 2B8PA 2BM0A 1YSJA 1QAIA 2OH2A 3LPEA 4DR2J 5E33A 3VVTA 1NPRA 1T9XA 3U02A 3LO3A 1I5OB 1C0TB 5ETSA 1QVGR 4ANEA 1Q5YA 4CH7A 5HMZA 4X65F 3TA2A 1RK8A 1VQ9S 1SH2A 5THWA 4U6PA 3ITHB 5IC6B 2XO6A 4DR5J 2VB6A 3HLUA 1R7IA 2BE2B 7AT1B 2G4BA 5DM7Q 2ZJRQ 5ETVA 2RQCA 4EWTA 4CLWA 3IWLA 3Q8UA 2EFGA 3UDEA 2XYPB 5EWEA 2XY5A 4EYHB 3A12A 1YBTA 1N5SA 3AOCA 4NLWA 5D4OA 2CQDA 3D0IE 2HQ3A 2VONA 4DV3F 2XNRA 5D0EA 1UPPA 2P6TA 4DX8H 2IFXA 4NA3A 2SXLA 1GX5A 4JP8A 1VQ4S 3GIMA 2DO0A 3MM7B 1RHJB 1R6VA 2IBOA 1GK8A 3J7A1 3KLVA 4IG3A 4UZCA 4LT6A 2BANA 3G82B 1SJRA 5HK4A 3K5MA 3GR0A 2ZZMA 3PW2A 4F3OA 1EETA 4OJ1A 4HEA9 4O3QA 3G8SA 2H5JB 2UUCF 1AW0A 4C0HA 2DBBA 4M5KA 5JMNA 2IRUA 3H42A 3RB3A 2V4RA 3GB0A 1KWMA 3LAMA 2AJ2A 1RBLA 2IM3A 4H54A 1R8AA 4IRKA 2FHMA 1NHVA 3TUZC 2YBVA 3VGVA 3C15A 3CO0P 2YNHA 2HIYA 4WFYA 4M5DA 2VC1A 2KXHA 5H9FJ 5C2GA 2DHXA 4ECRA 4KBIA 5J2MA 4FF4A 3R9LA 1WORA 3C6UB 3KLFA 4NL5A 1TAQA 2G13A 5B0FA 2Z2ZA 3OVBA 3M30A 1UKUA 1UVMA 1S79A 5D4NA 1K44A 3TAMB 5ETMA 3MAQA 1RAIB 5LSLA 2IM2A 4R5PA 5BXIA 5KT6A 5LOQA 1RT7B 3NG8A 3M6UA 4DN9A 3VAKA 2ZOGA 4WTYA 2F8HA 3K8VA 4I68A 4OV1A 3T3FA 2WZ1A 4USWA 2G0JA 2DNHA 1OSDA 4AFFA 2GZOA 4ILLA 3VTIA 2DNMA 3HM9A 4B9TA 2ZH1A 2ASYA 3MUMP 3MTJA 2HRTA 1M5OC 5KFQA 5A6PA 5GVQA 1RJJA 4YUDA 1WI6A 3KLHA 2KKHA 4DSFA 1S59A 2G9OA 1VI7A 3KFWX 4P75A 1FE4A 4QIFA 3PJWA 4LRCA 1RCOB 2JWNA 5CD4H 2DIUA 4A8OA 2AZ3A 3KG1A 3G87A 1WC4A 3NL0A 2Z0GA 3ICLA 2ZH4A 3VALA 3CCTA 1YZ7A 2ROPA 3I4PA 4PPZA 4CM2A 2BXJA 4C8NA 4KRWA 5H9EK 4M63A 2GJFA 2W2OP 1X5PA 2XGQA 2MGZB 3CPWR 1H38A 3FSYA 2DY1A 2DRBA 1ZAVA 4IOCQ 1YJVA 4CH1A 1X9WA 3UR3C 2FVPA 3GYNA 2OSRA 3W5YA 4DV6F 3AQOA 1UVJA 4DXLA 3P96A 4ZP9A 2R7TA 3SYZA 3DGVA 3KHRA 1ZZFA 4IG3B 1YWXA 4YFUA 2BANB 1HHSA 4JI3J 3G4SS 4W4MA 2EC2A 3GFHA 2JVOA 1U8WA 3GP9A 5HMWA 1EETB 5DGBA 4ED4A 4DSIA 3R5GA 1TVRA 2QA1A 2YWFA 2YQ3A 5IQ6A 1FA0A 3PIPQ 3IM9A 4OYOA 3UVJA 4NYZA 5C25A 1IKVA 2ROGA 3RB4A 4KR0B 3GIJA 3C15B 4ZVFA 1TK8A 4DF8A 4M5DB 3FEXB 2XMAA 1Q8IA 2CWKA 3HHLD 5KFUA 3K58A 4URQU 5J2MB 3WIVA 1YX2A 3NS7B 2X1AA 3KLFB 4ZCMA 3JQKA 3M30B 2LXUA 2GGPA 2VPYB 1JJHA 1BQXA 4ETXA 2J0SD 1YJ7A 2KH9A 4R5PB 1VK8A 6AT1B 3D1QA 2D3OR 4D3GA 2XYHB 5KFAA 2IDEA 1GT8A 4I64A 2KM8C 2BKNA 2BQUA 3H8YA 3WX4A 4IQMA 1RT1A 1RKJA 2XS7A 5EDWA 1TKDA 2IYIA 3CCVS 2N82B 3PO4A 3MM6A 3ZZRA 2RUGA 3KKFA 3MR6A 4B02A 3F44A 2F40A 5IV3A 1WDTA 4C0OC 4X4VA 1AUSL 2I0XA 1NK9A 2HLTA 5DRKA 5GAGU 3QBCA 1KNZA 3KK1A 4ENOA 3J80U 3KLHB 3GG0A 5F8IA 1H2VZ 3MR5A 3BGLA 3PW4A 4WE1A 3H5UA 3HP6A 2F9DA 1FF2A 1P9QC 4Y2MA 3MPUB 4QYRA 2RS2A 2BRLA 1DQAA 5KFTA 2WOMA 1VR6A 1VQ8S 3CJ0A 2RHQB 1AT1B 3VAGA 3GJRB 4HH1A 1L3UA 1T0TV 4TYBA 2H65B 2VQEF 4ZP6A 4CLLA 1C1CA 4F67A 4RW8A 1FRMA 1Z2ZA 4ZVSB 5E3AA 2LFVA 2PMZD 3PIOQ 1HW8A 3QRQA 4YQWA 4BWJA 2ZJQQ 3MMBA 2E1MC 2O1PA 2BDPA 1UJ5A 2UP1A 4DPWA 1R8BA 4DHVA 3VV2B 1IKYA 4CT8A 1U1RA 2PA8D 1JLFA 4N8NA 3ZFVA 5KFXA 4Q8FA 2GQQA 4OZ2A 3CT9A 5K8OA 2W4DA 3LPYA 4Y3CA 1SKWA 2MKIA 2HEKA 1TVRB 2R8KA 4YR0A 1N5TA 5B0GA 1KVKA 3OXLA 1Y5IB 3UVJB 5KG3A 4MTPA 3DGPA 4C8MA 2DEIA 3D0GE 2ZH5A 1TU0B 1XTZA 3PTWA 4ZIVA 5C25B 2B7CB 3IXQA 4DN0A 3EE3A 2FLOA 2V2QA 2GCFA 5CYQB 2QMUB 1LKZA 1W2BR 1ZA1B 3NMAA 3ZTPA 4J9NA 4ZVQB 5EN1A 4TYAA 5A8KB 2EFNA 3TZZA 4GKKJ 3U1MA 1XMQF 1LV5A 4LIRA 3BQ0A 2E1RA 2ZHOA 3TUPA 4URSA 2GGPB 3TYTA 3T19A 3PEJA 2UVRA 1VC6A 2RS8A 3I5AA 2GFFA 3HXMA 3Q24A 5HVHA 2PI4A 4Q43A 4MIAA 2HHSA 4M1KA 3IN5A 1RT1B 2HPUA 4RNFA 1QTMA 5K8MA 2NZCA 3HO1A 5HVGA 3Q8PB 2DXFA 3O3LA 3ZZ0A 4DSJA 2FC9A 3WQPA 5DG8A 4ZPBA 1RUSA 2O01C 4MJKA 3PYEA 1VS3A 4C8YA 1FVQA 1FRIA 3LF0A 5L38A 3KK1B 2CQ3A 3R2DJ 1TL4A 4QIEA 4HDHA 4B3OA 4WE1B 1IBMJ 5DLGA 4LSNA 5DQIA 2MKKA 2ZE2B 3EPGA 3MURP 1SQGA 2KT3A 4DDFA 2ACMA 1U1MA 2E5GA 3D68A 2HHTA 4C8KA 4N76A 2OHDA 3FNNA 4OLOA 5FLXU 3UD5A 3G6VA 1VOMA 3LWLA 3ZTOA 2GC8A 1N52B 1KD1T 1VJWA 3KWMA 2YH1A 3OVSA 1C1CB 4WFBQ 4RW8B 1HD1A 2HWIA 2ZUGA 2QYGA 4WZQA 3Q0AA 3B82A 2OD4A 2V5HG 3QWUA 3MMBB 4HLBA 2BR0A 1HBMB 4BC9A 1VRUA 4FVMA 2UXBF 3BR9A 3QRRA 1IKYB 4IQXA 4JI2J 1X7VA 3G71S 1JLFB 4IDKA 2YNIA 3MD3A 2O3DA 3IC1A 3UCGA 2MKHA 2HHUA 2KJWA 3H2LA 2G0IA 2ZH2A 1RT6A 1NKEA 1GXLA 8ATCB 4B9MA 1J5EF 1FEEA 3GILA 4OZLA 4ZLLA 2UVVA 4QCLA 2MPUA 4CZCA 2JL9A 3DGPB 4OYBA 4Z37A 3MOJB 5A8WA 2C3MA 3CW2C 2O66A 4PG5A 5F8LA 3QGPA 2OUGA 4JV0A 1TK0A 1FFWB 2WRMA 1LK5A 3PCOB 4CWBA 4ES1A 2LVWA 1RTDA 1U09A 1UETA 4CCHA 1U7LA 2AT1B 3JSRA 4B3MJ 2YTCA 1JLEA 1WJ9A 4TQSA 3CNQP 4ECZA 3BKTA 2CPFA 2IVYA 3KLEA 5AXKA 1IXKA 4DS5A 1NJZA 1HBOA 5FIIA 2P9GA 4O0NA 4LRAA 2QV6A 1VHIA 2AJFE 4WFAQ 1VLOA 1UVKA 4A8QA 2HS4A 3JAMU 4YP3A 1HQUA 4JI6F 2R42A 1XN9A 2EK6A 2UUTA 2HQCA 1SH3A 4URGA 4TY8A 1Q82T 3RRGA 1WEYA 2AJ1A 2CQHA 3TNVA 4DV0J 2OTLS 2QIFA 2DNRA 4RWXA 3DXSX 3ENVA 1HR0J 3W66A 4PYAA 4B3OB 1LW2B 5F9NA 1GX6A 5KFVA 4LSNB 1XC9A 1WD6A 2CQPA 3CCJS 1Q53A 4Y2IA 5DDPC 1O51A 3M4XA 3GR1A 1XNQJ 3Q8RB 1F2GA 3SIPB 1TTHB 1VQSA 4OHWA 1ZETA 1M1GA 1G3OA 3DU5A 4OLPA 3R7SB 1JJ2R 1M5HA 3GFXA 4BCAA 4DR5F 2OELA 1HQEA 3KK3A 4Q44A 4N56A 3CCQS 2F4VF 2HHWA 4O23A 3MDFA 2BMBA 5G0RB 4NMXA 4WIQA 4W92B 1KTVA 4LF5F 2XQCA 1O5JA 1RTIA 4RX6A 2Y9HA 3J81j 1VRUB 1RAGB 1WG5A 4CQ1A 1KEKA 4IDKB 2YNIB 3KMQA 1N36J 1ZS6A 4GO7X 1FT8A 5DETA 1RT6B 2LXIA 4MKVA 2AYEA 2KRBA 5KG2A 4USKA 2EFQA 1Y9OA 2M88A 1U26A 3WBZA 3KHGA 1PILA 2UUBJ 1F5BA 5K9FA 2GO8A 4OYZA 2QA2A 4S0MA 4L75A 4DR3J 4LF8J 3UN5A 5A8WB 2QLJB 4PXCA 4ECWA 4C97A 1M5VC 3QSIA 2HFSA 2XZWA 3F0NA 1NK7A 3GIRA 3BGUA 4L6V3 3SQOP 3SMZA 4H4OA 5HQLA 1B0VA 1OQ3A 3M2RA 4Q5VA 2AV5A 3M1VA 5GAHI 3NCPA 3A8EA 5HSPA 5HATA 1RTDB 3FEZA 1FX2A 4OX7A 1VGYA 3ENAA 4C2MA 3FSIA 1YVFA 1Q7LB 1JLEB 2LQ8A 4EBEA 3MWBA 2ABYA 1S9GA 4NCGA 4NLVA 2A1BA 4QBUA 2CXEA 2ZFHA 3FFIA 1FESA 2XB2D 4EZ9A 1HL6A 1KQKA 1HQUB 1SXLA 2DGWA 3TARA 3V2UC 2WVEA 4IH7A 2LEAA 2MZTA 2NYIA 2LQ5A 2E29A 3PW7A 3FRYA 2CJKA 2HFUA 4TY8B 5CXTA 3CVKA 2WVFA 2WSEC 2UU9J 1Q4RA 2QJ3A 3S6EA 1FNXH 4C98A 2ATLA 4B9VA 3OXGA 2XC9A 3FDSA 2UVUA 2V0NA 4Q2LA 2XSJA 3MM9A 4DEZA 5KT4A 2V4QA 4UY85 3W9HA 2DH8A 2J6SA
chains in the Genus database with same CATH topology
1S99A 5B0AA 2V2KA 3HHDA 3D2WA 4I67A 2OFHX 2MB0B 2JEJA 1KS2A 2ADCA 3HDSA 1LWEB 2AYMA 4DG1A 2CQ1A 2CQ2A 4LSLA 4ZP8A 4U7UK 3L3CA 1M1KT 4F2RA 4CH0S 3SEOA 1VQ5S 4F8RA 2GJ2A 4WK1A 3U1LA 3M8PB 2F9JA 3H25A 2JLEA 1SJFA 4TQRA 2XLKA 2HNYB 2MZQA 2PEHA 3H2VE 4DV5F 4KKOA 1REVB 3N01A 1L3VA 3C6TA 4HH0A 1MSWD 5F8GA 4QPTA 3KK2B 1CLFA 2YKMA 4WKRA 3TI0A 5KOWA 2L41A 3K57A 1LW2A 3HVAA 1SJ1A 4NLPA 5G4DA 3HVWA 1WNEA 4IFYB 1YJNS 1MWZA 4ZMMA 5C42B 4O3SA 2JDJA 1DARA 2FTRA 1HQEB 2VG6B 5SZTA 2LQ9A 3KK3B 1CSJA 1WG1A 3DM2A 1L3SA 1MMNA 3H4DA 3J7Z5 4Y65A 4RW9A 2BW2A 2HHPA 2DTJA 3TUJC 2XGPA 1KFSA 2Z4PA 2Y1JA 1SB6A 2ZNYA 3IR5B 4K4VA 1DTTA 2CVIA 4XDDA 4MKYA 1N5YB 1EP4B 3OJSA 2MHNA 2QYCA 3DRRA 1KC8T 1FEHA 2DGUA 2JFDA 1TFWA 4YB5A 1HPZA 1FRXA 2FVCA 5E3RA 3VAJA 5HROB 4ZPAA 1LWFA 1FRHA 1HHTP 2KTQA 4ETZA 5HQ8A 4ID8A 2DVIA 3V4IB 1HNIA 3CJKA 1PC4A 5FDLA 1GXUA 4IRCA 4KHPF 3I5BA 1S1TB 2MMYA 1HWIA 4GC6A 3MCSA 1VRTB 2FY1A 1DQ9A 1S1WB 3AA9A 3BQ1A 2VFRA 4PXDA 5L1JA 1CVJA 2M0GB 2AYGA 2FB0A 2LXFA 5E41A 3PX0A 5KFOA 4DV1F 1IQZA 4MK7A 3S8SA 5J2NA 2AGQA 4EBCA 5KG6A 2MQOA 3TANA 3G9CA 2L08A 2XMKA 1ZM2A 2WBRA 3H2UB 4X4OA 2ZM6F 3IWXA 5GAGI 2WONA 1XMOF 1NKCA 5I3QA 4ZCKA 4JBCA 4X66F 1C0UB 2OMOA 1SI9A 1TKTB 2K1RA 3G8QA 4RU2A 4FYDA 3K8WA 1HNVB 2GJIA 4NLTA 1D8ZA 4I6WA 1SJ3P 5F8MA 1ELOA 3BF4A 2JC1A 1XBWA 3MECA 1LWCA 2X1FA 3CDBA 1R8HA 2J8AA 1OQ6A 1HMVA 3OLBA 4YR2A 3M6VA 2OD6A 2V4JA 2LECA 5HP1A 1CQMA 1RT5A 1X8DA 3KLGB 3T5KA 2W7AA 2XWXA 5G0RA 4J5OA 4A8SA 2JHEA 3BN7A 3MAHA 3SFUA 4C3MA 1R89A 3AJ2A 3N79A 2D41A 5KT5A 3IA0A 2EKYA 2DHAA 2YKNB 1OO0B 1MMLA 4OHYA 3V81A 4AL5A 2XMVA 2J7WA 2JLGA 3PW0A 1S72S 4PXEA 5KFKA 2ILYA 3BREA 1VC5A 1QAYA 2RU3A 1YIJS 1HI1A 2BM1A 4NA2A 4KPYA 1S7HA 3NCRA 5FD1A 1U8SA 4H4OB 5BJRA 2R8GA 1Y00A 3OR1A 2JSXA 1C4CA 4ED6A 3M2RB 4K4SA 4DOZA 1M0SA 4F02A 3M1VB 2DR7A 1R31A 2Z2LA 4DV2F 4NCAA 3POTA 3BR8A 1CG2A 4WFNQ 1VMBA 1IKWA 3LW5C 4NXMF 2W24A 3SCLE 2R2SA 1KVJA 2VOOA 3FMBA 3V6DA 2XMMA 2XCAA 2PD1A 4MIBA 2DJWA 2CQGA 3M32B 5GADU 4A46A 3OL6A 1GAOA 1KRPA 4QW9A 2RF2B 5A6WA 4O4GB 4WYWA 3J81Y 2PFFB 4LIWA 3P3DA 2GHWA 2B56A 4UW2A 2D9PA 3FZ2A 1JLQA 3RB6A 2KXFA 4J9MA 3EGZA 4TN2A 3OLAA 3CO9A 4A8WA 4A8KA 3LWMA 3MEDB 4X64F 2DPIA 4Z2XA 3ISNC 4DQSA 2AGOA 3FFIB 3EGNA 2ZHBA 1QE1B 1SKRA 4O3RA 1C0TA 4O44B 2Q6CA 1KQSR 3HKZD 2I38A 4O3NA 1BLUA 2E1AA 2CFXA 4KV8B 4QIWD 3WC0A 4XPEA 1N54B 4WFXA 4NXNF 3AQPA 4K0KF 4KO0B 3BO4A 1S48A 2KB2A 4RW7A 4NOHA 3OR2B 2KXNB 3OTOF 5K14A 5BYQA 2WB4A 4XAKA 5B08A 3UR0A 2RD5C 1SKSA 4BBYA 1RA7A 1T94A 4QR1A 3ITHA 1N33F 3IAM9 2FHJD 3QGIA 2JC0A 2ASLA 2V8GA 5I3UA 2FJEB 2EG2A 4A8XA 2HIQA 4IFVB 2BE2A 2H9ZA 3I6PA 3ISZA 1HNWF 4XK8C 2K8GA 3CCWA 3MPWA 1JKHB 5GAEU 3WC2A 3HF5A 1S1UB 2V8HA 2DD8S 2DNOA 1Y4ZB 1JIHA 2C3OA 2GX8A 3EUNA 2R8HA 1KTQA 1WF2A 5HI7A 1IBLF 1BQMA 5C5JA 4Y00A 3AJ1A 1XWLA 3BSCA 2IC3B 4WU2A 2YNGB 4WZMA 3ZZUA 3MF5A 1I94F 3U27A 1F5AA 4ZDNA 3C3LA 4EBDA 2DGOA 4X4UA 5KFEA 1YJ9S 4IR9A 2VD3A 4F4YA 3UNGC 4YB6A 2JH3A 2RQKA 3MM5A 1RT4A 5F0WA 1N6QA 2XO7A 1HA1A 4IUFA 4K4UA 2AU0A 3IGNA 4Y2KA 2E5HA 1VHFA 4FXVA 4B17A 5DGAA 3I0SA 5T7LA 2KZMA 2DNGA 1X0PA 2OPSA 1ZOTA 3QIPB 5JVGQ 1HW9A 1LOUA 2QE5A 1TL1A 2XSJB 1UA1A 2HW3A 1AXQA 1QY7A 4A8MP 2GA7A 4K4ZA 3MM9B 4OHZA 5HLFB 2C28A 5IM0B 2C22A 1UWBB 2AX1A 3MM7A 5M2RA 3BO2A 2MKJA 5K5MA 1RKIA 1U2FA 4HI2A 3W2WA 3GV7B 1T3OA 4F4KA 2RRBA 4QYZJ 4CO4A 2VBZA 3FCHA 5B0EA 1SQEA 2E5JA 1S49A 5EX3A 3DHWC 2YNHB 3W3SA 3LGMA 2E9ZA 4DG1B 3BDPA 3KNGA 2DH9A 4LSLB 3QLHA 1HBNB 2YH0A 4HYKA 3C46A 3MD1A 2PN6A 4ZCIA 3HJFA 1NJIT 2GQ2A 4WXWA 5F8JA 4KKOB 2JOQA 5D77A 3C6TB 5BR8F 3QGHA 5F8NA 1VQMS 2NPIA 2YKMB 3IRXA 2QSWA 3DLJA 1D0EA 4OZ0A 3PXGa 2DGSA 1G1XA 3MPYA 2ZDPA 1FNMA 2XMUA 2VFUA 4DS4A 4KTQA 3P5TL 3PR4A 2P5VA 3DM2B 3PKYA 2IA0A 3R5BA 4LVNP 1MW7A 3KOAA 4XDCA 4RW9B 1Q1KA 3PJXA 2LYVA 1LXNA 4KGKA 4EGLA 1DTTB 3F41A 4AQYF 4N77A 3TA0A 2FC8A 2OIHA 3IGVA 2J6UA 3DRRB 1VK3A 1N0UA 1SIZA 1RP5A 2M9KA 3W7BA 1HPZB 1IBKF 2D7SA 4QU6A 1LWFB 2FJWA 1X4DA 2I5JA 3QWPA 4DR4F 4I0WA 1TL3A 2Y1RI 1HNIB 2ZBCA 4OJ3A 3CJKB 5FDLB 4DR2F 4A47A 2N4DA 4Y0FA 4C4WA 3RAQA 4YB1P 1ZPWX 3UFCX 2AJQA 4XIUA 5H1SV 2K3IA 1ZM9A 3DLLQ 2DCUB 2D9OA 1OIAA 4R0JA 2W9AA 4R25A 5K8NA 4MFBA 2VFVA 3Q2TC 4RU9A 1X4GA 3G6YA 1N0VC 4AUKA 1JLBA 4NZ6A 5J2NB 2MXYA 4ZPDA 3MUTP 1JJ4A 2P9EA 2LKZA 1NNDA 2QLXA 2MY8A 3FMWA 2VG7A 2GIQA 2WONB 2FGOA 3PY8A 1UAWA 3BSOA 1RA6A 2E5IA 4MYUA 3C6UA 1B0TA 2CZVC 1Q81T 2RQMA 3TW0A 4JI4F 2K1RB 1F60B 1V3ZA 4X4NA 3JSYA 1O8BA 2YKOA 1MWYA 3C8YA 1SJ4P 2ZBIA 4IFYA 2FUG9 4B9LA 1CPZA 1AFIA 1TV6B 1FO1A 1LWCB 3MECB 4YMEA 4OZJA 2Q66A 2IHR1 2VG6A 2ZVSA 5F3TA 5EWGA 1YITS 3TAMA 2UVWA 1VQPS 1HMVB 4Y28C 5E5NA 2V4JB 3RBEA 5HP1B 3PEHA 5KT3A 1ROFA 1RT5B 2VBXA 3PACA 2W7PA 2VPZB 1JNZB 3Q23A 2VA3A 4RUCA 4J9PA 4RLEA 4PCQA 2QRRA 4UOCA 2W9CA 2EC0A 1X4CA 4G1QA 4DR6F 3EZUA 4QQBA 1TKXB 1N4LA 2R7WA 1RT7A 3DNCA 3M8QA 1ZBTA 3V81B 4LF6F 2UUAF 2C2EA 2KI2A 5IS2A 1QSYA 3NLCA 1Q16B 1W2IA 3IFEA 1M5KC 2VFTA 3M8RA 3MXHP 4N41A 2X3GA 1L5UA 4HVZA 1FHTA 3M6WA 5F0UA 4OI6A 1FKPA 1K73T 5IQQA 4A8YA 1IN0A 3SSQA 1WEXA 4USJC 3SSRA 5B0CA 2EBEA 1P1LA 5D4LA 1FJGF 3BZQA 1JLAB 3HZEA 3OR1B 4CO5A 4ZK7M 2N3OA 2KYXA 3Q8QB 2WTFA 3FJ2A 1NU4A 2J7UA 2NZ4A 5KFSA 2JVRA 4RWWA 3K7RA 1UW4A 2DO4A 4ED2A 4FXWA 3KNAA 4NLQA 3POTB 4WK3A 2MDAA 3M8SA 4DSLA 1IKWB 2NR0A 4Q45A 1DFDA 1WEZA 1D9AA 3OHAA 3UQSA 4QIGA 3CDWA 3V6DB 3C2PA 5L8RC 3I0RA 2IJNA 3G6ES 3BQ2A 5B09A 4Y2CA 4ICLA 3GIKA 3HT3A 1KR4A 5I42A 5CCMA 3FGVA 3D1OA 2YKAA 2FHOB 2V94A 3K2YA 2BJEA 1KOOA 5I4MA 1FKAF 2BM0A 3KHHA 2HWTA 4WKYA 1U47A 2JEGA 1YSJA 3CD5A 4NZ7A 1QAIA 2OH2A 1RT2A 2RVJA 4B3RF 2KG0A 1V3RA 4QW8A 2DNKA 1JLQB 5DDRC 3L95X 2VFSA 5E33A 1HFEL 1KN6A 1LFPA 1FXRA 2RIJA 4A48A 2HRUA 4Y6IA 5KOXA 2QSFA 3U02A 4I6YA 4QWAA 2ZITA 1HYSA 1X9SA 3LO3A 1E6VA 1RDRA 2J76E 2J6TA 1C0TB 3ENWA 1QVGR 4CH7A 3X3UA 4HTIA 5HMZA 3MTKA 4OMFG 2OPQA 2R2UA 2ZH8A 1NAQA 3RU0A 2GO9A 2R2TA 3I5CA 4RW7B 4X65F 3GE9A 3BN4A 2HVIA 3TA2A 1RK8A 1VQ9S 4B9SA 1SH2A 5D3GA 1KOHA 5THWA 4FN5A 3CMES 4JI0F 4U6PA 3ITHB 3RB0A 1WWHA 2XCPA 3QJPA 2PT0A 5I3UB 5DO2A 2HGLA 2VB6A 2ZDOA 3CGIA 2V8DA 1R7IA 3HLUA 3THTA 4CI0B 4EEYA 1WACA 2RJZA 5M2PA 4DF4A 2BE2B 2V8VA 2MSTA 2ZKUA 4KT0C 2KG1A 1NH7A 2FIUA 4OX6A 2OKQA 3M32A 1NO8A 4JV2A 1M90T 2J9DA 3LP0A 1K1SA 1OS5A 1BQMB 4FZVA 2G4BA 1F5CA 2RF2A 5DM7Q 2CJQA 5A0YA 2ZJRQ 2MHEA 2RQCA 5KFCA 4EWTA 5KFMA 1XERA 1F0XA 2W25A 4CTAA 3M9NB 1XR5A 2W8KA 5FJ4A 4YDDB 3JB9k 4PG7A 3IWLA 4W90B 5LJ5Y 4G3IA 2AJ4A 3SFGA 2EFGA 2FDNA 5EWEA 2XY5A 3BS9A 3NCQA 1X4BA 3MM5B 1VQ6S 3UPFA 1RT4B 4LMZA 5D4OA 4EYHB 1N5SA 2CQIA 4NLWA 1N6QB 1S9FA 1H3DA 5D6GA 1HD0A 1I6JA 2CQDA 3H4BA 3D0IE 4O44A 3I0SB 5T7LB 1IUJA 2HQ3A 3EX7B 2OPSB 2VONA 3LQVA 4A4JA 4ECTA 4DV3F 1TL1B 2XNRA 2P6TA 4DX8H 2IFXA 4NA3A 1S76D 2SXLA 2J5AA 1GX5A 1VQ4S 1P6TA 1TR0A 2DO0A 3GIMA 4PPDA 3MM7B 2F8EX 1FJCA 4PQAA 5E3QA 1FTRA 1IKVB 1JB0C 2YY3A 1YQHA 1X4HA 4WXOA 3IR7B 4F26A 3W2WB 4Y2AA 2IBOA 4CIOA 3VZIA 3J7A1 2RKIA 3KLVA 3R27A 4IG3A 4CO1A 2JEIA 4LT6A 5IT0A 5F9LA 2B51A 2BANA 2NUUG 1JKHA 1SV5A 2WCXA 3QLHB 3GZ7A 1SJRA 4ZPCA 2E1CA 4RNNA 5L9XA 2YX1A 4DV7F 3OL7A 3S7RA 4RNOA 3K5MA 3ETOA 4PG4A 3GR0A 2A10A 3VAHA 2ZZMA 4KSEB 4K5RA 2CDQA 1VLYA 1L3KA 3IRXB 3NNHA 3CIZA 3PW2A 4F3OA 1EETA 1G7CB 4OJ1A 2KT5A 2XSFA 4HEA9 2VL1A 3I96A 2GQCA 4O3QA 3G8SA 1N88A 4OX8A 5CYMA 4F25A 1N34F 1KVIA 2HFZA 2UUCF 5F8HA 4WCEQ 2XLJA 1AW0A 1JXEA 1JLGB 4C0HA 2DBBA 5LSRA 1U1NA 2ZKTA 2I9SA 1T05A 5HL7Q 3TAQA 2IRUA 3CDUA 2AYBA 2HHHF 4K50A 2B6AA 1K1QA 1Y3JA 4RUAA 2U2FA 5F3ZA 3RB3A 2DNYA 3PR5B 2VOPA 2V4RA 3HKWA 1VIOA 1Z2LA 2YNFA 3GB0A 2JZ5A 3T5HA 3PHEA 3OL8A 1ZYQA 2XG8A 2CPEA 2QA4G 2V9WA 2I5JB 4GKJF 3T5JA 3LAMA 4CO0A 1TL3B 2IM3A 4H54A 1R8AA 4ATNA 4IRKA 2HGMA 2FHMA 1NHVA 3CE8A 4NMLA 3TUZC 4L3NA 5DJBA 4MIWA 2PIIA 2V9KA 2QMXA 3OFGA 1NKBA 1X5SA 2YNHA 4JI5F 4MFBB 3OW2R 3CJ3A 4WFYA 4M5DA 3TR5A 5J1PA 1HBNA 1JLBB 1A6LA 3J7YI 2VC1A 3ONQA 3KJVA 2KXHA 5C24A 4DQPA 1MU2A 5H9FJ 4PUOA 2DHXA 4ECRA 1R27B 4KBIA 3SZ2A 5J2MA 4FF4A 3CCUS 1DBDA 2VG7B 1ZZNA 1PSDA 4TXSA 3MM6B 2ZH9A 3C6UB 3KLFA 4NL5A 1TAQA 3G6XA 4ID5A 4U67Q 4FS1A 4M94A 2G13A 2DGTA 2K2PA 5B0FA 2PO4A 3OVBA 4DFJA 3M30A 1UKUA 1UVMA 1W25A 1S79A 4TLRA 5D4NA 3TAMB 3VF0B 1D3WA 3MAQA 7FDRA 1DURA 5LSLA 4TLQA 3NRBA 2IM2A 4R5PA 5KT6A 3OFFA 1T3NA 2N4CA 5CCLA 2W9CB 3OXFA 4G1QB 2FJAB 1ZTTA 2JX2A 2FLNA 1RT7B 2CPDA 2BQ3A 4KJIA 3M8QB 1TKZA 3NG8A 2VQFF 1VQYA 2QT7A 3M6UA 5DQHA 2MQQA 3TA1A 4GO5X 4K5SA 4DN9A 2O67A 3VAKA 2WHOA 2UZAA 2ZOGA 2MZRA 4WTYA 2F8HA 3LANA 3K8VA 3E51A 1FKPB 4I68A 3MMCA 3MI7X 1N48A 4Q0BA 4PXBA 3VCDA 4X4PA 4OV1A 4PG6A 5L39A 5I3PA 4WYLA 4OI1A 3T3FA 4UY8T 5H9EJ 3RR8A 2DNHA 1GNKA 3HVRA 1OSDA 4AFFA 4ILLA 3VTIA 4B9NA 2DNMA 4FNHA 4DSKA 3HM9A 2CYYA 2E9TA 2UUWA 4ED7A 3SI8A 4CO2A 1RISA 2WOMB 4O4RA 1WTFA 2Q3PA 3I0RB