2E29A

Solution structure of the guct domain from human atp-dependent rna helicase ddx50, dead box protein 50
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
92
structure length
92
Chain Sequence
GSSGSSGFEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DDX50
publication title Solution structure of the GUCT domain from human RNA helicase II/Gubeta reveals the RRM fold, but implausible RNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 12
structure length 92
sequence length 92
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e29A01
2M3DA 2E29A
chains in the Genus database with same CATH superfamily
3I96A 1VLYA 1A6LA 2EC2A 1FO1A 3AB2B 3V5RA 5CYQA 1WG1A 4F0MA 2DVIA 4CM0A 4LRBA 4ES1A 4WFBQ 2BUNA 5FDLA 4AFFA 3OSPA 2QLXA 1EETB 3CJ4A 5KFMA 2G0IA 2GIFA 1U2RA 1FA0A 3DRXA 5GAHU 2HRYA 5D4PA 4X4RA 1RBAA 1EZZB 4KE5A 3MPVA 3J7YU 3AXMA 2UXCF 5G0RA 3IR5B 2GW8A 1CG2A 3L7UA 1TL5A 1FE0A 2F8EX 2AGPA 1GMWA 2AEJA 3SQOP 3MTKA 2HHTA 2WONB 1W7WA 1S1UA 4J9OA 3J80Y 4OYAA 1RAHB 1XNQF 2I0XA 1DRZA 1VRQC 4YB7A 2VQEF 8AT1B 1B64A 2YKMB 2HFOA 3H8YA 5HLFB 1FNOA 1N6QB 5LT5A 5D4LA 1LWFA 4Y00A 2QIFA 3HZGA 1X9MA 3QO9A 3N0VA 4BCAA 3PO4A 2ALYB 4YY3J 1KEKA 2MZTA 1I6JA 1NKBA 1SH3A 3UDVA 4USJC 4K4SA 4M5JA 5I42B 5DQGA 2Y8YA 2HPUA 3MOJB 3R7SB 4OHXA 2CJKA 2KL8A 1HNIB 2XY7A 2YPYA 3JSRA 1R6YA 4E98A 2ZKUA 2KTQA 2MTLA 5K8MA 3MZIA 3IP0A 2MQNA 4RNMA 2HWIA 1FTCA 2RMLA 2FHKA 3ISNC 3KJVB 1TKTA 4DSFA 3HHLA 2ASYA 4KV8B 4K7QA 3PKYA 4AL7A 1DY3A 3EYZA 5M2UA 5J1EB 1N5YB 1KOHA 5KOXA 4DUZJ 3CMQA 3CJ0A 2MZQA 2HHQA 2VUGA 2XY6A 3M6WA 4DPOA 2J9EA 2XSJB 5KG4A 2YQ3A 3BGFA 5HROA 1C1BB 1SB6A 4AL6A 4DV6F 4IG3A 5ETPA 3EUNA 2DXDA 2OPQB 2E5JA 2AGOA 2KM8C 2IYGA 4IO1A 3BKTA 1ZZFA 3D0GE 1FRJA 1WF1A 3OL9A 1YJRA 3L3CA 2QLWA 2UV8G 1YJ9S 5CZVA 1UFKA 4DDFA 1HNWJ 5D15A 2NSBA 3J7A1 1D9DA 2UUBJ 3KXDA 3NWRA 3HHNB 2CNNB 4OQJA 3J7YI 3GV5B 4P72A 4DQSA 1UWAA 4IR1A 3HT0A 3EWGA 4NXNJ 1PAUB 4X66J 1PC5A 4C98A 1YVFA 1IVZA 1RABB 2IA0A 3DU6A 1WDTA 3KG0A 1RHUB 1FKPA 2OPSA 4IDKA 3NLCA 2RIJA 3QJPA 3FMWA 3BSAA 3MEEA 3PJXA 2B8PA 1TL7A 5HN0A 1ZAWA 1CQMA 5DG8A 1N33F 4GKKJ 3R5GA 3ZTOA 4LQ9A 4RO0A 2CQ2A 3Q23A 4JI0J 3BN4A 5E3AA 2J9DA 5A8RB 4M95A 1QSYA 4NLXA 3RB6A 1S9EB 2DNRA 3RJMB 1FFGB 2CADA 3B82A 3GZ7A 3D1HA 2H4WB 2GA7A 3CC7S 4OHWA 1CS4B 4FVMA 4Y34A 3T1HJ 5IOLA 3V6DB 1JLCA 3RAQA 4URGA 4RPFA 4ERDA 3DDIA 2BQUA 4A8WA 2AJ0A 5CCLA 4JI6J 1QDUB 4NE9C 2V94A 3VCDA 5F8GA 3CDBA 2BM0A 3JQKA 3MCOA 2HBQB 5K14A 4C0BA 3WQPA 2H51B 2KM8B 3A13A 1T03B 4TU7A 2HGMA 1X9WA 2ZBPA 3K5OA 3D6MB 4GMKA 2GC8A 1FDNA 1WEYA 4KT0C 2H48B 3VAGA 5CYMB 3WC0A 1LEOA 4FPIA 3M2UA 3CJQA 2MGZA 5I3UA 2G0JA 3M2RB 5CZXA 5A8KA 2JC0A 3IC1A 1VIOA 1HWKA 3K2YA 2CQDA 4QWDA 3UNYA 1XTZA 4YDXA 1RHMB 1IBMF 2FZGB 4P6QA 3T5JA 2VG6B 1R31A 1KSPA 4X4QA 2JEJA 4JI3J 1PAEX 3DOLB 2Y1JA 3RW7A 3I87A 4N47A 1FDDA 5SZTA 1GFWB 2VBXA 2CUYA 1B70B 1SH2A 4F0KA 2BKNA 1HI8A 2PIIA 2DY1A 4NLWA 2X1GA 8ATCB 2B4UA 3UWTA 1GNKA 5LJ5Y 4W92B 2NS1B 1FERA 5J2QA 1T05A 3W62A 1RT5B 3DOMB 2B9YA 4XDDA 2B6AB 2CDRB 4HL9A 3TO8A 3KG4A 3GCWP 5K8OA 3POTB 7FD1A 3D7SB 1PYOB 3TEHB 1HNZJ 1NBEB 5D77A 4Y28C 2BABA 1PO6A 4NASA 5GMEA 2BANB 3VAHA 4DQQA 4GKJF 3WIUA 4NCAA 2L9WA 1RXOB 1NJIT 4ZN1A 4QW8A 3SCLE 2NXJA 1N48A 4ID5B 1K8AT 3DLHA 2YX1A 2MKJA 3FC9A 3P8BB 2HHVA 2XEXA 3PCOB 2QLFB 3UW1A 2DCLA 2FPHX 2HMIA 2D69A 4LRFA 3IAS9 1QE1B 3C6UB 1BGXT 3KHHA 2FVSA 3A4TA 3PRVA 1QD1A 3R2CJ 1HW9A 1KHVA 5L38A 5AXMA 1IBCB 4ECVA 4Y2IA 3H7HB 2CJQA 1K0VA 2OI2A 3RG6A 1XR5A 3NGSA 2DRDA 2G4BA 3KK2A 1OMSA 1U48A 2UP1A 3HI9A 3NG8A 1PG5B 2IFXA 3EGZA 1BQNB 1SIWB 3AA8A 2E66A 1RT3B 2CZ9A 4ED6A 3Q8VA 3UN5A 2RILA 2BM1A 2HZAA 5DG9A 3L7OA 4DL6A 2E7XA 4CLSA 1JWWA 4LVOP 1ZOTA 4DL4A 2N82B 3LF0A 2RRBA 4DR3F 3A3NB 2MLXA 4U96A 1NHVA 1AYEA 4JI1F 3ZZUA 3W7BA 4LR8A 4I69A 1UAWA 1TKXA 2J0QD 2B5JB 4NRTA 2D41A 4FNIA 2VG7A 1HIYA 3IRXA 2MY8A 2J8AA 2WAQD 2W2NP 4U7UD 4ZCMA 3M8PB 3MM9A 2ZHOA 2C3YA 2V4JA 4GC7A 3OFEA 3RRGA 4NL5A 2GHPA 3R97A 1ZM2A 3ITHB 1Y7PA 1Q82T 3BGRB 4DQRA 1BQMA 1S6OA 2ZE2A 2PA8D 3PACA 4F4WA 3GQCA 4R5PA 2R42A 5CABA 2DGWA 2LKZA 5IWAJ 1XNRJ 3W8PA 3I4HX 3MUVP 3MR5A 3DLEA 4U9RA 4DL3A 3PX0A 3R1HA 1I5OB 4G1PA 1VK8A 3CGIA 4JYAJ 1EKSA 1DZ5A 5JUMA 1YJVA 5C25B 3FQLA 2HNZA 5DZ6A 4DF8A 2OSQA 2AT1B 1KLMB 3BKUA 2HVIA 3EXCX 1PIEA 3MEDB 1F3FA 1WI8A 3G6ES 5KG2A 2ZH7A 3DRRA 1HA1A 1OPIA 4ZITA 1Q79A 1TKDA 1A7GE 4ZDNA 3MECA 2QN6B 4JI5F 2QEXS 1D8ZA 2FIUA 2CWKA 3L9ZA 4PYAA 4F3MA 1JIHA 2J7WA 3GP9A 1VI7A 4EMDA 1TAQA 4WFXA 3NEKA 2GFFA 4K4UA 5IT9Y 3HSZA 2ZH3A 3GCXP 4TU8A 4CLKA 4PPDA 4ZLJA 1DTTA 4YOEA 3V6JA 1B0PA 4PUOB 3DXSX 4N77A 4NLRA 1IJFB 1JLEA 4WJBA 3BQ0A 1M5VC 3T5LA 1FNXH 2VA2A 2BKOA 4V1Ak 1W2BR 4O44A 4CO2A 5IQ6A 3OL6A 5IC6B 1HBUA 2CPXA 3VAFA 5KFFA 1SJ3P 2V69A 4OYBA 1XERA 2RE1A 4HHUA 5LMNJ 4LFCF 4NX9A 3DM2A 4RNNA 4A8SA 1H74A 1MU2A 2DHAA 2XC9A 1NJWA 3VGVA 4EK2A 4DQPA 3RGIA 2Q79A 2DR5A 4R8UB 2E9RX 5GAGU 1BC6A 3TAMA 2KU7A 4ZJOA 3QGIA 4ZVQB 3BBFA 4O4GA 3PIPQ 2CQBA 2MSTA 1Q5VA 3SMZA 3GIKA 1N0UA 1TMMA 2FLLA 1KQGB 3PTWA 1H3DA 1LOUA 4WU3A 1UVNA 1U49A 4TY8A 2XYPB 3B78A 2PI5A 5MLCV 1KTVA 4M5GA 2CQCA 3VVTA 4LUBA 1XJWB 2KFYA 4UZCA 4OLOA 3QT6A 5FLXU 2NZ4A 1SUQB 2MQ8A 2HYIB 2HLUA 3MEGB 3KJNB 4DL0C 1EX8A 2PC6A 4NXMF 1NLKL 1NB7A 3PW4A 5AXLA 1IWGA 2A18A 3AD9C 4H4OA 4ZP9A 3GILA 2AZ3A 2B0GA 1WG4A 1YTYA 2BJ3A 1JLQB 2HWHA 2MXYA 2YNHA 5KFGA 4KRWA 1BHNA 3TWZA 5A8WA 2W9CA 3AODA 4URQU 4OI3A 3MMBB 3RAMA 1VQKS 4DL5A 4ZIVA 2HFVA 1RKIA 1F9HA 1Q95G 3AB4B 3MM7B 3JTPA 3HZEA 1JLBA 4CNYA 4DXLA 4Y6IA 2RNEA 4FF3A 4I67A 1IKVB 1CJVA 3V81B 2FHJD 1VQ9S 2OUGA 1B0TA 3CD7A 1W25A 1VCTA 4Y0FA 1TUVA 2J76E 3SYZA 2GJIA 1Q7LB 1R8BA 3HFVA 2C2EA 1ZTTA 2HVZA 2XB2D 1KKHA 3DN9A 1S4EA 3PJ9A 1WHWA 2P9EA 4M5DB 4FXWA 3UE2A 3FZBA 1BUXA 2KN4A 3NBPA 3MM6A 3H59A 4JV1A 1S9GB 3BZQA 3ADAC 2UXCJ 2CVEA 4ZLNA 2LDYA 3BDPA 2VC0A 5F0WA 1F2HA 1IKYB 1FKPB 4DV2F 5LSOA 3OR2A 1C0UB 3LO3A 5LOQA 3IBCB 2COLA 4KJIA 4Q2LA 4RW6B 2AEMA 5E41A 1WC5A 2VQEJ 2R8IA 4ECYA 2V34A 2G0CA 4PWUA 1PBAA 3OVAA 3LH2S 2G1DA 3QLHB 4QZVB 1FXLA 1VFJA 3Q24A 5D78A 1VQ6S 1ZM4A 1S77D 2LQ8A 3UDEA 1VHFA 2XZDB 5DM7Q 5E5NA 5JMNA 3BGUA 1S7IA 4X64F 3GYXB 3BO4A 2E5IA 4PABA 1VDHA 2AHOB 3UQSA 2RRNA 1RTHB 2H9ZA 5ETMA 4CLYA 2QFJA 5K8NA 4LIRA 3T9ZA 4ZP8A 2VJVA 3QJLA 1ZS6A 1OYEA 1HLWA 1K1SA 3K8VA 2UU9F 2VZ9A 3THTA 3CMAS 2QMUB 2VASA 3CDAA 4NCBA 4JV0A 3QT5A 5A0YB 2ZJRQ 2FB0A 2LVWA 1H2UX 4IG0B 4YMEA 5KFJA 4XK8C 3CO0P 4LT6A 4DR1F 2EFQA 1RT7B 1IKWA 3Q8PB 2NXCA 4X2BA 3P49B 1AA1B 1RTDB 3K58A 1L5UA 3MAAA 1CC7A 1HYSB 2JLFA 4U6PA 1HFEL 1P8GA 1SCJB 3PG9A 4TLQA 1L3VA 4DG1B 2MZJA 3HMJG 3JSYA 4OI0A 1NNDA 4PQUA 2ZHAA 4J9NA 5EUHA 1NPRA 1TUGB 3CJKA 2VPYB 4DV6J 2DBBA 2K3KA 4ZVPB 2OMOA 1XBWA 3ZZ0A 1E6YA 2YWKA 4ZIWA 1WI6A 1SPBP 2AIRB 3UD4P 4JV5J 4DBQA 2XNRA 4A8XA 4LF4F 3CT9A 2ZD1B 4I1TA 2KG0A 4NYZA 3QFWA 2NUUG 3H0PA 1FXDA 1VYAA 3DHWC 3W60A 4A8FA 2C2ZB 1X9SA 4JI8F 1Q5YA 1U1RA 1LW2B 4NYOA 3BPDA 4M8LA 4DV3F 1WF0A 3NGDA 3SQGA 2UUCF 4OV6A 2IVFB 1EHWA 2UUWA 3KLGA 4C8KA 4O3OA 4O3RA 2YWEA 2QE5A 5F8JA 1PC4A 4XPCA 3IBWA 4TY9A 3HSGA 5A6WA 4EGLA 3NY0A 3LGNA 4J9PA 5C24A 2FJVA 3QWUA 1T11A 4DS5A 3M2VA 2Z57B 2RKIB 1CLFA 4NEZA 2EC0A 1Q78A 3W2WA 1N33J 3GPAA 3CCVS 2RU9A 4C0HA 1ACMB 2HWTA 1RADB 3H90A 3PR5B 2ZJPQ 3TUZC 2PMHA 3MPDA 3EICA 4NLVA 4KGVB 3TVYA 3GFYA 1RAIB 2HMIB 2IAJB 3I31A 3E51A 4PG8A 4MFBA 1VLOA 2IIHA 2ILYA 3IM8A 3GJRB 3GLJA 4MH8A 4EBEA 4LBPA 4GO7X 1QY7A 2BRLA 1Q16B 2F4VF 2W2PP 1JLFA 1NZAA 2EFPA 3MAQA 2OGUA 4IYQA 3OLAA 3KFWX 2FD2A 1YGYA 1UPPA 5HMYA 4FF2A 2CIMA 5AE3A 3VQSA 3VAJA 1IQZA 2I5JB 2V5HG 4NLPA 5H9EJ 3SCJE 1C1CB 2E1CA 3GIJA 1C4AA 2A2CA 2ABYA 3BJYA 1MLAA 2XS5A 2MKIA 2VODA 2K1RB 3G8SA 2FVCA 3FUYA 1XMOJ 3TA1A 4L76A 2EW9A 2Z56B 3ILOA 2AJ2A 4KKOA 2VQFF 4QPXA 4FDFA 4P52A 2YKNB 3UFCX 3AQPA 3DOKB 3CCES 2HBYB 3FBCA 2MJNA 2C2OB 2WVEA 2KT5A 2OTLS 2H4YB 1RAGB 3FGVA 4QOTA 1EKRA 2MQMA 1IBMJ 1RTJB 2DNLA 5KT6A 4DV7F 3PW2A 2R7WA 1O5JA 3NOGA 1REVB 4F4XA 1KN6A 4QIVA 4OZ0A 2C3MA 4CH1A 1S49A 3Q2TC 3FEYB 4IH7A 2CPFA 1HMVA 1LNQA 3KYLA 4FZVA 1D1UA 4ZP7A 4ECXA 2W9BB 1KVIA 1GAOA 4Y2CA 3MM8A 4H4MB 4WFYA 2QL5B 1FD2A 3DLEB 2GV1A 3G96A 3H20A 2ROGA 5HATA 5DQHA 3K5PA 4QW9A 1WF2A 4ZPWR 1SJFA 2NYIA 2F7VA 1GT8A 1UJ6A 4ECSA 1FKAF 4MKYA 1YWXA 3IM9A 4K4TA 2KZMA 2A2DA 1HBNB 3J7ZT 5E33A 4ZJLA 1IWAA 1U6ZA 3Q89A 5J2NA 3RBEA 5KFNA 2DD8S 1QVFR 1RHJB 1U1PA 3LAKA 5A2QY 2J8SA 2PE8A 4ZJQA 2VH7A 4O3NA 4GKJJ 5JJBA 5HO4A 4DLGA 2AQ4A 5KFZA 3CIZA 4QWBA 1Q8LA 2GVZA 2ZITA 3PW5A 2W7PA 2ASDA 4UTGA 3C2PA 4NLDA 4MIWA 1U6FA 2CNKB 3R9LA 4O3SA 3TAQA 3N79A 2BZ2A 1OJ4A 3CF5Q 4K5RA 2WOMA 2W8KA 3QNWB 1T9UA 4LIWA 2LECA 3R3TA 2YQ1A 1SJQA 2LXIA 1D09B 4R0JA 5I3QA 4MJKA 5IXUA 4J5OA 4IFVB 3X3UA 3OXLA 2RS8A 3ZNUA 4L74A 2FTRA 5FD1A 5DGAA 1QVGR 4LBIA 1DTQA 1NHKL 2CZVC 3VR1A 4BWJA 4OL8A 2ZH2A 3U02A 3D9BA 4WBFA 4H4KC 3DM2B 3WHIA 2HAIA 1EQ0A 3FNNA 3GYNA 1RAFB 4X62F 5L1IA 2VFSA 4FYYB 4RBTA 2EBGA 2IVMA 3DDKA 2OLWA 4HDGA 2ZH1A 2VBYA 1UP1A 3FVYA 4HHHA 1TV6A 2WRMA 1NCLA 1G1XA 2WVDA 1V5VA 2QG9B 2IRXA 4HDHA 1KHWA 2B9WA 3HDSA 1UPMB 5FIIA 3DNCA 1T9WA 4USUA 1JJCB 2Y9HA 4U8YA 2V50A 3BPSP 4TY8B 4UY8T 2XLKA 4U7CA 4QPTA 1S1VB 2OFHX 3D3BJ 1HQEA 2F1FA 3G9CA 1UZHA 3QQCD 2D3O1 1B4SA 3NGTA 3CSKA 4LF1A 4X4OA 2Y3YA 2DHSA 1N5QA 5KFEA 1HD1A 1VQ7S 3KHRA 1NK7A 3JXOA 2CG4A 2VPZB 3UR3C 3I0RA 1SC1B 2CQ3A 1B99A 2K7KA 3EGWB 5ETKA 4Z7YA 4TYBA 1H7WA 3H2VE 1FJEB 4DQIA 1GX5A 3O5TB 1UW4A 1T95A 3BSCA 2ACMA 3BV8A 3ICLA 2M2BA 1WC3A 1HWLA 2VU5A 2HS4A 1HWUA 4M5HA 2WB1D 5KG1A 4DCOB 2PO4A 3TW0A 3T1AA 3C8YA 4FXVA 4CZCA 1M90T 4TVAB 1IKXB 4FYXB 3F56A 4A8QA 5KAKA 1S48A 3ZTQA 3GFXA 5GAEI 4JI5J 2W7AA 4DSLA 3MPWA 4Z37A 1RT6B 2JC1A 3GIRA 2P8IA 3ILLA 4F2RA 5IM0A 2IDEA 5IS2A 1T02A 3R8YA 3C46A 3Q0AA 3DMJA 4ZLLA 4RKUC 3KLFB 1S5ZA 3TJ8A 2OFGX 4Q5VA 5D0GA 5J1PA 3M1VA 3T6JA 2WW4A 2MDAA 3SCKE 3G6VA 4ATNA 4YY3F 3OR1B 1C0TA 3BGLA 2HLTA 3W5XA 5LM7E 4X65F 3LWMA 4RW8A 2HNYB 3O8WA 1TR0A 1UVKA 2VONA 4K4XA 2W2OP 3GJSB 2VPWB 1RWXB 1HWJA 1RK8A 1RAAB 1HI1A 3IG1B 1SL2A 4AXJA 4I4BA 1KBRA 4USVA 1RHRB 3BO3A 3W5YA 1CPZA 4CQ1A 1FFSB 1H2TZ 3R7BB 3PX6A 1NB2A 2XZTB 2X1BA 4CYUA 3DRPA 3KOAA 1WJ9A 3BBBA 3MXHP 2FUG9 4HI1A 2VC1A 3LP1A 2G1HA 1DARA 4ZVFA 3O2IA 4C8YA 2D3OR 1V6HA 4KHPJ 2ZBRA 3GSIA 1L3KA 5KFHA 4X4VA 3GV7B 5A2QU 4NXMJ 1U24A 1X8DA 1N52B 3H5SA 1EETA 3JTOA 5L9NA 3JAMY 3CCUS 2QSFA 1K44A 1GTEA 1REGX 4X66F 1VMBA 1B7YB 1X4CA 3LGMA 3TP2A 3FSIA 3CJ3A 4GO5X 4WYWA 3TX0A 1RT2B 5E0OA 3GONA 1YG0A 4OJ1A 2CQHA 4DN0A 2OP5A 2IPOB 4Q0BB 4JI4F 3RB3A 1ZTWA 3TUJC 2VPXB 4DV1F 5DDOC 1S7HA 4ZHRB 2QMWA 1ZM3A 4IOCQ 3TA0A 4WP3A 2YKMA 3HHDA 2JDJA 4DPUA 5HLFA 1N6QA 2EFOA 3AJDA 3EGNA 3ONQA 2CFXA 4HHJA 3W2VB 3VGSA 1WG5A 4WFAQ 3OPKA 4NLUA 5HQMA 2FC9A 3M6UA 3HJVA 5I42A 1VJQA 3MFIA 5HP1B 3MGJA 2AZ1A 2XCAA 1HPZB 1HNIA 4ANDA 2V9WA 5KT3A 1Z2LA 2B7CB 3RZAA 1Y5NB 1HQUB 3LP2B 4JI6F 1U8SA 3P5BP 3ENWA 2KH9A 4ALZA 5JVGQ 1Q0NA 4PG6A 2OO4A 1H6KX 2HNDB 2JVRA 5B09A 3AD8C 3HLUA 2OMLA 4RNHA 3KJVA 2MKSA 4M5MA 1TAUA 2ZNYA 1VK3A 2CQ4A 4KV8A 2DNPA 4WFZA 1ZAXA 4X64J 2KJVA 3MTJA 5J1EA 1N5YA 2SXLA 2E7VA 3QATA 2ZH9A 2EI5A 3S01A 2QT7A 3A3PB 4A4JA 3OTBA 2XSJA 4G1QB 2UU9J 2OPRB 3CW2C 2YKQA 3VHQA 1RACB 1O51A 2OPQA 2CPDA 4JI3F 2Y0BB 3HCXA 1P9YA 1YJUA 4DR1J 2UUAF 3UCZP 4LF7F 3W63A 1NDCA 4B9VA 1RLCL 2XTJP 4PAAA 5KFWA 2CDQA 2YH1A 2WTFA 2CJBA 1NAQA 4JOUA 3V4IB 3G87A 3PKMA 1I51B 4IH5A 2UVVA 3KDNA 2E5GA 4Y2KA 3UCUP 2HSEB 4GC6A 1G7CB 2HFNA 3ELHA 4K2XA 4KYZA 1NK5A 4ID8A 1JX4A 5KFPA 4B3OB 3MPUB 2X3GA 3THPA 1CULB 3CCQS 3AOAA 2QSWA 1SJ4P 1DQAA 4K5SA 1ZPVA 2HQFA 2N3LA 3JSMB 2LLZA 3FCHA 1PCAA 2AYEA 4PWWA 4O0IA 2GGPB 3MM8B 4NWBA 4DSIA 2F8HA 3HVWA 2B56A 2HQDA 3DYAB 5A8RA 3G82B 3BB5A 1S9EA 5HL7Q 4DV3J 2HHXA 3AXKA 2W01A 1S1WB 1M5OC 2UUCJ 4BDPA 3UVJB 1KONA 2BJEA 2V0NA 4NPOA 2QA4G 3N28A 4OYMA 3HF5A 1CS4A 3VGTA 3V6DA 1SL1A 4ZPVR 3IA0A 2CYYA 1TZ0A 3LWLA 4WK3A 3EX7B 4OV1A 2L9DA 3NGRA 4B17A 4DCJB 2E7WA 3T3FA 3RU0A 4DU7A 1VRUB 4A47A 1Q86T 1RYRA 4N8OA 3IS9B 4WKRA 2H5IB 1T03A 1ZA1B 1OPZA 3FRYA 3OLBA 1UETA 4OJ3A 4CI0B 1L3TA 1VQ4S 1VC6A 2GMHA 5CYMA 1VIXA 2F4VJ 4ELUA 1NDLA 2I1RA 2YTCA 1WOSA 1O8BA 2EG2A 4ECUA 2ADCA 2YNFB 3TVKA 3UNGC 4ZN3A 3CCMS 4TXSA 1F5CA 1VJWA 3JAMU 1UWBB 2O3DA 1V3RA 2UXDF 4A8MP 4OIXA 1GK8A 3DOLA 1JXLA 3MMAB 1IR2A 2J6SA 4HI2A 3ETMA 1WHVA 3OXGA 1S1XB 1DHMA 2HURA 4YFUA 1S99A 4CT8A 1XNRF 4LBHA 2ROEA 2NQPA 1FRLA 3JS9A 4KTQA 4HH1A 4L3KA 3C6TB 3W64A 1RT5A 4JYAF 1R8PA 1GMUA 1NJYA 2B6AA 2VG5B 1NO8A 2YNIB 2AJ1A 3BYRA 5C42B 2F9DA 4CH7A 2ZH4A 3POTA 5HANA 5ETQA 1NKCA 2R2UA 4DV7J 3OW2R 1YBTA 2DH7A 2VDIA 2BANA 5HVHA 1ZH5A 2NYHA 2P6SA 5B7WA 4MTPA 2VOPA 3W1YC 2KO1A 1GXUA 3JSBA 3G4SS 4P7VA 2W4PA 4AQYF 5IFMA 4ID5A 4WXOA 3TEGA 4WIQA 1VISA 1HNXF 4DR7J 3MCMA 1MROB 2DIUA 1MNEA 3CC2S 3FFIB 1U1MA 1QE1A 4X4SA 1FDAA 3C6UA 5KFVA 2JJ4D 1RAOA 1WEZA 1GXTA 2DGSA 4QU7A 1FHTA 5CYJA 1D9AA 3LUYA 3RB0A 4KQZA 2AX1A 5HMXA 4OJHA 3IGNA 4UUXA 3A12A 1C2PA 3UN3A 3M8WA 5KFSA 2NPFA 2F8MA 2DH9A 2N7YA 3A8EA 4F4KA 1GMWD 5IZHA 3BN7A 1BQNA 1RWMB 2F4FA 4PG7A 7FDRA 5GMKa 5DLGA 1RT3A 3GE9A 1RWNB 3NRBA 5IM0B 5J2MB 3J81Y 4LRDA 2IHR1 1X4EA 2ZZNA 3HULA 1CJKB 4GRSA 3AOCA 1PYTA 4L75A 3AJ2A 1RHQB 3E3XA 1FRKA 3CCTA 4ZK7M 2BEFA 3QAEA 2B5JA 2FJAB 1SBRA 4J9RA 3OFHA 4FBTA 3PHTA 3JQJA 4A8YA 2VD3A 3M8PA 3W9IA 4B3TF 4IQXA 5EN1A 2XNQA 1AROP 2KHDA 2XMWA 4ICLB 5BR8F 3MF5A 3W66A 2XY5A 3BGRA 5D4OA 2ZNZA 2IRYA 4X62J 4IR9A 3M8RA 2B9EA 5I4MA 3HSJA 2M4MA 1DAXA 2BOAA 2W7OA 4I6WA 3KLHB 3CIMA 4OHYA 4NA2A 3PYFA 3HHLD 2E5HA 5C25A 3QZ8A 3B4MA 2VV5A 3F73A 2MHNA 1KLMA 4OJGA 2CJ9A 3R5CA 3EE3A 3R6GB 2BACA 1IM4A 4DSEA 3MEDA 2A6OA 1S59A 3RAXA 4O23A 3HSDA 5F3TA 2BXJA 1JKHB 3WZ0A 5D6GA 2ASLA 4O3PA 2P2CB 3H4DA 4J9MA 2GNKA 2J0WA 1EP4A 2ZOMA 2GX8A 1U7LA 3TR5A 2OJ3A 2QA2A 1TQLA 3S1TA 1ITPA 1R0AB 1YLXA 4CCHA 3GR0A 3W5ZA 3VAKA 1T9VA 4P2FA 3P6YC 2W4CA 4PUOA 3GJTB 2DT9A 2G9OA 4XPEA 2HRTA 3GWCA 3PJWA 2KVIA 2BE2B 2R2RA 1GTHA 1CQNA 4HVZA 1I94F 2AYGA 1XIQA 2BJ7A 4LF8J 2HFUA 2HBRB 1UEUA 3SCIE 1T9TA 1YKWA 3ZTRA 3GIIA 1QAIA 1YK9A 3H40A 1D3WA 4F36A 2M7SA 3M8QB 2BVZA 2HHSA 3G2XA 3CD5A 2GZOA 2JEFA 1RTIB 3O1LA 3MR7A 1X4AA 2I9SA 2ERRA 2QA4S 1QLNA 1N32F 5KG0A 1FNMA 5BYRA 3C15B 2E9ZA 1SQGA 4R8UA 2MLZA 4EYHB 3EDQB 5HI7A 1UEVA 4X4TA 1TVRB 4USMA 4OX7A 4TKTA 2JRSA 4X65J 3W61A 4OX9J 2M5YA 1G2EA 4ZP6A 3HD2A 1FDBA 3K5LA 3PEHA 3E01A 4DEZA 4NI2B 4NYPA 5J2PB 4JB8B 3T5HA 1BE4A 3GIMA 1SUQA 3ZZZA 3RUBL 1YRUA 3PZPA 3MEGA 1RUSA 2E1RA 3M7VA 2VHGA 2R7OA 3P5TL 3PIOQ 1HKAA 2YH0A 2E5LJ 4CTAB 4Z2XA 2W1BA 2EKYA 1TL1B 1U26A 2JHEA 4ILMA 1JLQA 4J37A 1BWVA 3A8KA 3PFOA 4RUCA 4MKBA 4L6V3 1SV5A 3PHEA 5IV4A 2WW8A 1LWEB 4K8RA 3VTIA 3MMBA 3GTYX 2E1MC 1F0XA 4YR2A 1AW0A 1WC6A 3FQKA 3SEOA 4HH0A 2QA1A 3MM7A 1JK9B 3E2EA 1PJ5A 4ES2A 3KHLA 4U7UK 3OUYB 2F5GA 3IFEA 1IKVA 2YKOA 3BQ1A 4JV5F 1SC3B 3V81A 3M32B 3CCZA 1FRIA 2DGOA 5IV3A 3HT3A 1EIYB 2JVOA 5KFCA 2GHWA 2IA6A 4KIAA 1TU0B 2U2FA 4P10A 2BJ9A 2X3DA 3D3CJ 2HZVA 2QLBB 2XMUA 3MI7X 1KD1T 4PEOA 5DQIA 5IC4B 4M5DA 1RGVA 1WKKA 4HTJA 1FCAA 1SJRA 5CXTA 1TP7A 2FJEB 4YN3B 1JMTA 2B9XA 3FZ2A 1S9GA 2ALZA 2DGVA 3J81U 4UOHA 2YX7A 1Z1ZA 4LF5J 3BS9A 4RW9B 1IKYA 5D0RA 2X51A 5E3PA 3H25A 1C0UA 4ECZA 4ETXA 2QZ8A 3RRKA 4JI4J 5T41A 4RW6A 2V63A 3CXCR 4DV1J 4J9QA 4KPYA 3G71S 3OHBA 1S0NA 2OPPB 4C48A 1RLDA 2BR0A 1N5TA 4WWSA 3QLHA 4UOGA 1SKRA 2VFTA 3T1YF 4ZS6A 2YXLA 1ULRA 4QWAA 1UVJA 3JYTB 3MUTP 2DHHA 3FBBA 2GQ2A 2J6TA 2XMAA 4LSZB 4BS2A 1VGYA 2JLGA 3R5BA 3UR0A 2MKCA 1PILA 1RTHA 4PG4A 2JSXA 2JFKA 4WZMA 2OELA 3BGOP 4IRDA 1M0SA 3G8QA 4JI2J 2DJWA 4ETZA 1YHQS 2FZKB 4O4RA 5KT2A 4RW4B 1PJ7A 5A0YA 4NLQA 4C4WA 4KO0B 4IG0A 2FDNA 4W98A 4EZ9A 2AW0A 1YITS 5D4NA 1XMOF 3FK4A 1L3UA 2IM1A 1RT7A 4XIUA 5CD4H 1RTDA 2AMCB 3TANA 1EAYC 3M6XA 1HYSA 3GR1A 3Q22A 5ETOA 4DG1A 1Q8BA 1FK9B 1FT8A 2YVSA 4KHMA 2DY9A 3QRPA 3I9V9 2DXFA 4F0HA 3CTRA 2PMZD 3N5FA 2JFDA 2AD9A 4OI1A 2CPIA 3MD3A 2ZDPA 4NA1A 2IRUA 1ZETA 4EO8A 4F4YA 1Z2ZA 2J6UA 1SI9A 1SQEA 1ZM9A 2LFVA 4OHVA 4WE1B 5ETTA 1HNVB 4XTTA 3KKFA 1CVJA 2YWWA 2UUAJ 4N56A 2ZD1A 3L4BC 4B9UA 4LF7J 4EEYA 3AHPA 5EWFA 1NDKA 3TNVA 3QSIA 1LW2A 2E9TA 2DYAA 3DLKB 3D6FB 1GX6A 5GADI 2Q3PA 2B51A 1N56A 1NK9A 1LK7A 3RBDA 5CCMA 3GMGA 2GAGC 2C42A 3CEDA 4JP8A 5FLXY 2FJWA 3DHXA 2NZCA 2D1CA 1AB8A 4HACB 3CCJS 2VA3A 1RAEB 1FVSA 2RKIA 4ED1A 1R6VA 2C2MB 3U27A 4UW2A 2YBVA 3R7NB 2BDPA 2WZ1A 4M5IA 4IRKA 3DGVA 1K47A 1NK8A 2LDIA 4YS2A 1LK5A 2C2DA 5BJRA 1S0VA 4DPYA 3ILIA 4GVLA 1VQYA 5LMUJ 3W3SA 2IAJA 3GU0A 2GCFA 2HQCA 4P9SA 1F60B 4PCQA 1T3OA 1OWXA 4NLOA 3MFHA 1S72S 1H98A 4ECRA 3UPFA 1N8RT 3K89A 2OKQA 2HEKA 1QAYA 4U8VA 3NL0A 4OLPA 2ZOGA 4KPCA 2I8EA 1SIZA 3OXFA 1LV5A 2PD1A 3IO1A 3D0HE 2I5JA 4Q43A 1V3SA 1UVIA 2DK2A 4J90A 2RH3A 1C1CA 1M5HA 2XYHB 3IXQA 3S6EA 2D3ZA 2GHVC 3PFEA 4USHA 1APSA 1EB0A 4OZJA 5HQLA 3UDLA 4HT7A 1F5AA 4MYTA 1HW8A 2K1RA 3CCWA 4ELVA 2FJBB 1D8YA 3OHAA 5HBMB 4USIA 6FD1A 2WHOA 2Z0GA 4Y3CA 5KT7A 3PVXA 1Y00A 4K4YA 4RWXA 2BE7D 4OZ2A 3BDEA 2YKNA 3HVAA 4C11B 3DRSB 5BYQA 3DOKA 2JL9A 1WD6A 2BOPA 5THWA 3KLIB 4KSEB 4P2XA 1YIJS 1K9MT 1D0EA 4DL2A 3EPIA 1DJ0A 4M94A 5EGYA 1RTJA 4CLLA 4K4VA 2A1BA 2UXDJ 1REVA 2KXFA 2ROPA 2RF2B 4OFZA 1Y11A 2VKRA 1FX2A 1NK6A 3M4XA 3LAMA 3MHYA 2FJDB 1NDPA 3NGKA 3FMBA 2LA6A 2ZH5A 1U1LA 4OI6A 2V2KA 2W9BA 3G86A 3KNGA 4WTOB 3FRZA 2QMXA 3DDNA 5K5MA 3PNIA 4H4MA 3NAHA 1HD0A 2FVQA 3KK3A 3LQVA 1YZ7A 4HYKA 2KXHA 2R9LA 1S6QB 4UQGA 3ZZOA 5H9FJ 4Q8EA 2CG8A 4OX8A 2J7UA 2RD5C 2CA9A 2CQ1A 5KFXA 1JJ2R 5KG3A 1HBNA 5DDPC 1TL3B 1FJ7A 3LP0B 1H2VZ 2AKWB 1MG7A 3CCLS 3SFUA 3EGVA 3HFZB 3KWMA 1WC0A 4KGZB 4KBIA 4ZPBA 4AQYJ 1FFWB 1EP4B 2MKHA 2QL9B 1ROFA 4P2MA 1HNXJ 3H5UA 4UT4A 4HT5A 6AT1B 3B6BA 1VBYA 3SBMA 1Y4ZB 1UJ5A 1K1QA 4PXEA 2R7SA 2C28A 3VQTA 2CQ0A 1CJTB 4IFVA 1UA1A 4MIBA 5T14A 2DIVA 4P74A 5AXKA 3PYEA 1QSLA 3KG1A 4FP9A 4C9DA 1HR0F 2W25A 5EWEA 1FI4A 2BKPA 4ED8A 2LEBA 4KB7A 1FRXA 4H54A 4QIEA 2V8DA 2GAHC 3I4PA 1WNEA 1X4HA 2H3EB 2NXUA 3TX8A 2VJUA 1VQSA 2LEAA 2MKKA 2GJFA 3U1LA 3KHGA 2DNHA 2BW7A 1V5IB 3PRDA 2WSEC 3FEZA 3TZWA 1TFYA 3NCQA 2Z2ZA 3V6HA 1Y3JA 1UTAA 2W24A 3UO0A 2LU1A 3I5CA 1D9FA 5HK4A 2HHPA 4EBCA 2VB6A 4FPRA 3TZZA 4WKYA 3HKWA 4B3TJ 2MZ1A 2HIYA 5B0BA 4YQWA 4PQAA 3E01B 1NZ8A 2B4OA 1S1VA 1KOOA 2OEJA 1I1GA 3PW0A 3CD6S 5BR8J 2P9GA 3HPOA 2W9AA 1TL4A 5M2PA 5AJ3J 1TK0A 2XGPA 3VWSA 1QM9A 3OTOJ 4KHPF 1XQIA 4EFAC 2RHQB 5DM6Q 4I6YA 1NSPA 1KTQA 3CE8A 4OYWA 3D0IE 2XQCA 3S8SA 5KFKA 5HMWA 4KFBB 2BA9A 3D28A 1RDRA 4A48A 4PWDB 1VQOS 1BD6A 4QCLA 1SV5B 1U0HB 3P4UB 2IC3B 1UEKA 3NS6A 5LXRA 3N6LA 3BREA 1ZPWX 5F8MA 1RWKB 2G13A 1NEEA 2OEKA 1JQGA 1IKXA 3KK1B 3DI6B 4PKDB 3T9NA 4DR6F 2P5VA 4OI2A 2DNOA 2UXBF 4RLEA 1T9YA 1RT6A 1JLAA 3CJ2A 4ELTA 3RR7A 4R0EA 3FJ2A 4MAKA 5KFYA 4YR3A 5IQQA 4DR4F 2HQIA 5DZ7A 2DEIA 4LF9J 4ECQA 4H4KA 2QRRA 3KLFA 1VC5A 1Q53A 2HIQA 3GFHA 4B3MF 4ZCKA 4USKA 3SDEB 3OR1A 3DLLQ 4L3NA 2R8GA 2ILZA 2OSRA 1I94J 4DS4A 2XG8A 1U09A 3QIPB 3QWPA 2HNYA 2FJXA 1N88A 4NOHA 2C1EB 3WX4A 4C3MA 4P2SA 1RI7A 1QUVA 3LW5C 3IG1A 4CP5A 1X7VA 4KH1B 2DR9A 3DXBA 4QR2A 1N32J 2HRUA 2KI2A 4RNFA 3M8YA 3E8OA 2CZ4A 3CCRS 3AFGA 2R8KA 2DNNA 4C8MA 3RB4A 5DDQC 1AZSB 4FYVB 2XS7A 4ZVOB 2FGCA 3P45B 3L95X 1YSJA 1NK4A 2AU0A 2CAJA 2I6WA 2PFDA 2DNGA 2KDOA 2OEMA 3PXGa 3M8SA 4EU0A 4LRCA 2B4VA 1YQHA 4IO9Q 2LQ9A 2V8GA 1NUEA 4QIGA 1FD8A 2VDHA 1IUJA 1R89A 2BBEA 5KOWA 2XO6A 2H5EA 1CSJA 4DV5F 2XMVA 3K17A 4DPXA 2V8PA 1GEHA 4RW7B 3G6YA 1NSKL 4ED4A 4EI2A 4F2SA 4CIOA 2EBEA 1J5OA 4LVNP 3GSDA 1MMDA 3RBXA 3WIVA 3VGUA 4CO1A 1N4LA 3SZ2A 4K0KJ 1DURA 5KG5A 5E3QA 1IBKJ 2IMOA 3ISZA 3OVBA 2UVUA 4CO4A 2DEJA 3IR6B 3S7RA 5B0CA 2DNMA 3VZHA 2RQCA 1UVMA 3LA0A 2K06A 1RT2A 2XHWA 3HM9A 2MPUA 4Q0BA 3NAIA 2RQ4A 2L08A 5U47A 4ZHRA 1OIAA 1VRTB 2DPJA 4RU2A 4NLSA 3CWJA 1RWVB 2AF6A 2HGLA 3I9ZA 3TA2A 1SC6A 1DBDA 1F5BA 1L3SA 3NKYA 2BQ3A 5J1NA 5LSLA 3W2VA 4QWCA 4JI7J 3D6TB 4I7FB 2KZZA 1FJGF 2KT3A 3MM5B 2DGTA 3UN2A 4M5NA 1OY9A 1IR1A 2Q66A 4RU9A 1AT1B 5HP1A 3PV8A 3EZ5A 5GAHI 2F65A 1HPZA 3UI3A 1V3ZA 2NREA 3HKZD 1S1TB 3WC2A 4ECWA 4DMZA 3N5BA 1HQUA 5T7LB 2HHHF 1SKSA 3LP2A 1I3OB 2E44A 3AQOA 4DFKA 3HO1A 3QGPA 3FEXB 9ATCB 2N4CA 3T1YJ 1A9NB 2HNDA 2GVDB 2W4DA 3NP5A 2A6MA 1WTBA 1WUUA 2ACYA 3QT8A 4OHZA 5HVGA 1S6PB 4RUBA 4TQSA 2Z8QA 2ZKTA 4DX5A 2RRAA 4GVBB 4I2QA 2Y1IA 2IM0A 3M8ZA 1HBMB 3D68A 4QIWD 1H38A 2E1AA 3H42A 4CLTA 4QIFA 4DV4J 1RYSA 4WFNQ 3VF0B 3QFHA 2P6TA 4LSNB 3M9NB 4G1QA 1S0MA 2ZDOA 2OPRA 2A0FB 4ED2A 3CJRA 4QYRA 1S6UA 2J7KA 4I6AA 1CBKA 1LWCB 3ILJA 3HVTB 1X5PA 3P96A 3RRHA 3C16B 3T41A 4C8ZA 3H4BA 2KJWA 2AYBA 3TQEA 1FVQA 2LCWA 1RE1B 1WORA 3NS5A 3MMCB 2XWYA 1O6XA 1M1HA 3TJ9A 4CNZA 5AE1A 2O67A 4D3HA 2NCKL 4OZ3A 1ELOA 1Q1KA 3BSOA 1WOPA 3V4IA 1JB0C 1DLOB 5DLFA 3I82A 3KUGA 4FXDA 4JBCA 1QSSA 5KTQA 2FLNA 1RJJA 2CNLB 2XBPA 5AE2A 5DETA 1TELA 3OQ2A 4MK7A 3NOCA 3SSQA 4S0MA 3NCRA 2FHOB 4OZ1A 2IBOA 4B3OA 4ZMMA 4B08A 1CULA 2EPIA 2IJRA 3KJFB 2DNZA 1MMLA 1X4FA 3P3DA 3TZYA 3ETOA 4C0OC 3JSMA 2QYCA 1OY6A 2CQPA 3C19A 4QR1A 4QYZJ 5F8IA 1WC4A 2GGPA 2W2QP 3DCAA 4DX6A 4DR7F 2MZSA 1UMJA 3KK3B 3DYAA 2DR8A 2ZJQQ 4MK8A 3G82A 1A0OB 4O0NA 3ZZRA 1FKOA 2KXNB 4PG5A 1RBOB 1S1WA 3NNHA 4ZCIA 1MWYA 3UVJA 3SI8A 3HX9A 3MMJA 2XCPA 1PGZA 4B3SF 4WCEQ 3DGPB 1IBLJ 2F9JA 1XEZA 3D4JA 2KVQE 4LF6F 2MEWA 1UVLA 5ETVA 3D67A 4R25A 5HMZA 3OTCA 2RJZA 4YB5A 5D3GB 1OYDA 2XMKA 5L9XA 2KYXA 3I0SB 1LW0B 1RHKB 3BM7A 5D8HB 4IFYA 1WSRA 2M8HA 2YNGB 3IAM9 3J80U 1VHIA 4BC9A 5MAOA 3ET6B 4K59A 1VRUA 3ZTSA 4OZ5A 4DWIA 3FSXA 3DU5A 2DR7A 3IS9A 3OV7A 3UDCA 1U0SA 5GAEU 2VKZG 1BY9A 1URRA 2BJDA 4QR0A 3H2LA 3BF4A 5F8LA 1U4BA 4RWWA 2W2MP 3MOZA 4ES3A 3IGVA 2CQGA 3IN5A 4NLGA 2C3PA 3PX4A 3NMRA 3VVUA 3OTEA 3Q86A 2R3VA 4KGMA 2YNFA 2Z2YB 4B3RJ 4IQMA 5GMDA 1UWBA 2H65B 4J7CA 5I3PA 2UUTA 3D1OA 1R0BG 3CPWR 1UJ4A 2JWNA 2YX4A 3MMAA 2ZH8A 3GB0A 2ATLA 2B8QA 1S1XA 3NMAA 2LA4A 1UKUA 1SKWA 2D74B 2EVZA 4LSLB 2LQ5A 3W9HA 2WB4A 3L7PA 4DPTA 2NLWA 2K2PA 1EQMA 1ICEB 1E6VB 1LKZA 3KTQA 3FDSA 3C6TA 3LOUA 2IVYA 1OS5A 3ENVA 3OL8A 2MLYA 3JB9k 4F3OA 2E29A 4MKAA 4F8RA 4C3KA 2VG5A 2B4PA 2YNIA 2WCXA 5C42A 1CEZA 2P9CA 1JJ4A 3CJ8A 4MYUA 1YJNS 3MR2A 2FY8A 5KFUA 4LREA 4IKAA 3DLGB 4MK9A 1NSQA 3IMQJ 4YHHF 2FZCB 3R5AA 4I2PB 3Q83A 4K4WA 1SXLA 2PDAA 3OTDA 1ZBTA 3MR3A 3TOQA 1HBOB 1G6BA 2AEFA 4I68A 2V68A 3ENQA 1RWUA 4B9LA 1MROA 3FFIA 4CWBA 4DUYF 2BJ1A 3CO9A 1JLGB 2QJ3A 3SXLA 3U1NA 4NCGA 3SV3A 1JXVA 4I64A 2HVHA 4WTYA 4B9SA 2ZWOA 4ZKAA 2IBKA 2HAFA 4EZ6A 4C8LA 5B0EA 4RNOA 1NHUA 1SQFA 5GVQA 1RT4B 4QJVA 3C14B 1VOMA 2DHGA 4A8KA 4DOZA 4YP3A 4ANEA 2AP6A 1NM2A 4A46A 4LF8F 4FS2A 5C2CA 4ZVSB 3T6BA 4LRAA 1JLAB 2R2SA 3K8WA 4NLTA 4U95A 2MSSA 4C97A 3KLEB 2B43A 5HAOA 2MY7A 3KMSA 3JQMA 5J2MA 1SH0A 3I32A 4TQRA 3EMTA 1CJKA 4AD6A 1MW7A 5KFLA 1YDLA 2EG1A 2DB1A 2GMJA 2PT0A 3R5JB 4PXCA 2ZBIA 1S57A 4YDDB 1AFJA 5DS7A 2RUSA 4ED3A 4DZ6A 4WP9A 3D2WA 4DPWA 3H2UB 3M30B 2IM2A 8RUCA 1HR0J 4F04B 3QRQA 3HHLC 1OQ6A 3Q8YA 2MQQA 4OX9F 3OSNA 4ZVTB 2YKPA 2ZZMA 2RHSB 3BR9A 3OT9A 5CYQB 2OIHA 1K73T 3V4MA 1YRTA 1NXIA 1ZAVA 3QPIA 4IH6A 2OTJS 5FDLB 4DFJA 4ICLA 2KFNA 1MWZA 5HJXA 3A3OB 1T8EA 2C22A 3CUNA 4DR5F 2DXEA 1RAJA 1KVKA 2Q6CA 3OBIA 4DV0J 1WHXA 1WDDA 5L1JA 5LL6d 4XAKA 1VS3A 4BC7A 2E5LF 5G0RB 3R2DJ 5LXYA 3KLHA 4CLPA 3BKFA 2ZVIA 4XO0A 2XM3A 4F02A 2NXNA 3HFKA 3RBZA 1S1UB 2PSZA 3THVA 1RQ0A 2JOQA 5KFTA 1RP5A 5C5JA 5EHHA 2X1FA 1GXLA 1JJHA 1JKHA 1LWFB 2QV6A 3IWXA 2DHXA 3ZFVA 1FF2A 2JX2A 3QO9B 2Y1RI 1Q81T 1BQXA 4YB6A 1EARA 1X5SA 1NH7A 1R0AA 1J5OB 3DLBA 2R8JA 1XC9A 1BLUA 2ZM6F 2O01C 2V2VA 1QTMA 4E0DA 1RSCA 4WZQA 2UVWA 4N8NA 4LF5F 3K5NA 2UV8A 2PFFB 2BE2A 1OO0B 5DO2A 4I56A 5F3ZA 4DR6J 2CRLA 4IOAQ 4ZVRB 2UXBJ 2DCUB 2RB7A 1PSDA 1TKTB 3HHLB 3M8QA 4ZPTR 1IJEB 3LPYA 3GJQB 3OFFA 3LGHA 4HLBA 2ADBA 1RTIA 3KNAA 4B9TA 3FBEA 1P27B 4DR4J 1XWLA 4AE5A 3DFEA 1RWOB 5KFQA 3C15A 3D6HB 5HROB 4B3MJ 5ADZA 4IG3B 3BH6B 5E3CA 2IMWP 1J5EF 3C66A 1TVRA 2HVEA 3KMQA 5KG6A 4TYAA 3QJJA 3D54A 1C4CA 3BSNA 3RW6A 3ISND 2JEIA 4ED0A 4LMZA 3CNQP 3N6NA 1R27B 2EK6A 4JI2F 5ETSA 1U6BA 1N36F 1XK8A 3NS7B 3TZXA 4J9SA 2RDDA 3NCPA 2QC3A 4NI2A 2MB0B 2EKNA 3EZOA 2LEPA 5J2PA 2M9KA 2XI2A 2QL7B 2YWHA 1DFDA 1M1KT 4DFMA 2PMWA 4UF4A 2PN6A 4V19J 5AT1B 3Q8QB 3M9OB 2V9KA 1MSWD 1P1TA 5KG7A 4CTAA 2Y8WA 4URSA 4I2QB 1TL1A 3QZ7A 2OPSB 3TUIC 4IDKB 2VL1A 3PDNA 4B02A 4ANCA 2JNJA 3MEEB 2HQ3A 4PZVA 2ZOFA 3QSYB 1XNQJ 1LWEA 1TL7B 2IJFA 1CJUA 3EZUA 3OL7A 1Y0HA 2APOA 2DGXA 4F50A 2DTJA 3M9MB 1KRPA 5GAGI 2LQBA 2AV5A 3OUYA 2CNOB 4F4ZA 3M32A 4CT9A 4UUWA 2OAUA 2Z30B 4MMOA 4WK1A 4DX8H 3R5DA 4NZ0A 4DV5J 4J9VA 1KR4A 5ETRA 4J9UE 4LJMA 3SFGA 1TK5A 1T7PA 2J9DE 2N3OA 2MHEA 4BWMA 2V6AA 1QTNB 3H98A 2XLJA 3RTVA 2VICA 2WVFA 1JLCB 1IN0A 4AL5A 4ENOA 1TMJA 1S97A 1F6TA 1PYSB 4WYLA 4CLWA 3KJQB 4C7QA 5D0HA 3MCSA 1RTZA 4OZLA 4RW9A 5K14B 4LFBF 1R7IA 2AWZA 3EPGA 4PPZA 1F1BB 3C3LA 4G1IA 4QU6A 4CH0S 5A76A 4K50A 3QIDA 4XDCA 3NGUA 4KHRA 2OPPA 3QYYA 3CCSS 1KFSA 5EX3A 2CWXA 2DR6A 3M2UB 2MGZB 4QWEA 1HQ2A 5I3UB 4ER8A 1LQ9A 5LMUF 5A8KB 1FKOB 5HJYA 1AUDA 1UL3A 5ITHA 2BW2A 3JYTA 2FHJA 5IT9U 4ED7A 4C8OA 2Z58B 2R8HA 1BWEA 4D3GA 2MMYA 1U1OA 1FJGJ 3PRBA 5L1KA 3G6XA 1VR6A 4NLYA 2M70A 2ASJA 2CPJA 2FC8A 3M05A 4WXWA 4PXDA 1P6TA 1KDNA 2RU3A 4RW4A 4DSKA 1XMQF 4IFYB 1P9QC 3HHEA 2HHHJ 4KO0A 1GH8A 1R8HA 2VFRA 4OYXA 2DNQA 2RT3A 2CXEA 4F4AA 2EFVA 1RISA 2F40A 5J2QB 1T05B 2Z2MA 1FTRA 4OZNA 4K4ZA 2XWXA 3B54A 1KWMA 2CPEA 3R27A 1AXQA 3I55S 2RDJA 3ZTPA 3Q8SB 3CDWA 5KFRA 3TI0A 5H9FK 1PJ6A 1BMQB 2AJ4A 4OYPA 1IM6A 3O6QA 1FK9A 2PEHA 3N4WA 2C3UA 3KLVA 5L1LA 1Q4RA 4AUKA 4DZDA 4Z7CA 4NZ6A 4EUVA 1N5SA 2IM3A 3GYGA 1N5VA 1OQ3A 3UD3P 3PM9A 1QAXA 2KFZA 1OSDA 4WE1A 1Y5IB 1HNVA 2F3JA 2NSCA 5LSRA 3Q8RB 5M2RA 4OYIA 2M88A 4CDIA 3HXMA 3FSYA 1VBKA 1S76D 5L46A 1J2VA 2O5DA 3G8TA 5DG7A 3CJTA 4RJVA 2ZWPA 3DLKA 2DRAA 3CVKA 3QGHA 2RAQA 5C7PA 3KK2B 3TUPA 4FF4A 1LFWA 2X7IA 2EXUA 2RUGA 4G3IA 3H5YA 4NMXA 2FGOA 4EYIB 4HACA 1H72C 4KGKA 1U2CA 1Y5LB 3CJSA 3FCVA 1DQ9A 2FVPA 5CAAA 2GQQA 1HL6A 1YJTA 2K3IA 1FJCA 2VFUA 1WKLA 4KGXB 2R7UA 4TNOA 4X84A 1Z4UA 3GG0A 1N0VC 1MWQA 3X1LB 3MWBA 1TKXB 1TKZA 2YQ0A 4CLUA 2VG7B 2I2YA 1VQ5S 4G6VB 3IRXB 4CO5A 3CMES 2AGQA 3W65A 4NCGB 2MJUA 4J91A 3MM9B 4WF9Q 4KAIA 2ZFHA 4B3SJ 2V4JB 4LF6J 2B3TB 4DN9A 4N76A 2A3JA 2HGNA 2DRBA 2C2RA 3I6PA 1BQMB 2VOOA 1FX4A 2ZE2B 3PY8A 4Q44A 3MURP 4R5PB 1ZA2B 5C2GA 4DR2F 3BBCA 2J9CA 1HI0P 5E7OB 2FLOA 4OI4A 4M5KA 4X4NA 2DKOB 4WP8A 3EM1A 2HKEA 2HNZB 3FKBA 4RL1A 4ZCLA 2XGQA 5HBMA 5DJBA 1WOOA 5E2QA 3M6VA 2PEBA 2AX0A 4Q7AA 2EFGA 4C11A 2ZVSA 3DRSA 2DH8A 1WWHA 2PA3A 2BV3A 2ZH6A 3DRRB 2IJNA 2QGFB 4NZ7A 3D1QA 3TYTA 4IRCA 3KLIA 4CO0A 3MECB 3MUMP 1YJ7A 2RDIA 2LMIA 2WVBA 3O44A 3HVRA 2KRBA 4ZPCA 2RF2A 4LF2A 3DRYA 5CH7B 4W4MA 1KVJA 5CD4A 1UFWA 5AJ3F 2FHMA 1RZMA 3OTOF 2FVRA 1DTTB 2QO3A 2KB2A 4N5SA 3CD0A 3LPEA 1JLEB 2BMBA 1H7XA 5HSPA 3TRGA 3SV4A 4C3LA 2RQKA 1YBUA 1X5OA 2R7VA 1F3VA 1FWPA 4O44B 4FVCA 1S6QA 3F0NA 4FS1A 1RT1A 2KT2A 5ETLA 3B8HA 1WKJA 2H1YA 1HBUB 4C8NA 1RWWB 2CPHA 3K57A 1IQTA 3AD7C 4RR5A 1TL3A 2M0GB 5E3RA 3GG1A 2EWHA 1WHYA 3HP6A 4ZLPA 1LXNA 3LP0A 4DX7A 1MU2B 2YPZA 2WVCA 2XULA 4ZVGA 4YHHJ 2Z2LA 1JNRB 2N7CA 5L8RC 1YRXA 2CPYA 1N34F 4Q2MA 4I0WA 2DPIA 1FEHA 1KC8T 3J7Z5 2K8GA 3ENAA 1UW9A 3MCNA 3TAMB 4DR3J 5F8NA 1S79A 3TVZA 4JI1J 1MN7A 4O4GB 2Q1LA 4NRUA 2D3UA 1O0PA 1OY8A 1HHSA 4DUYJ 4YR0A 4J9KA 1KQFB 4LF9F 2Y0SD 2L41A 2A10A 4CO3A 4PRFA 4LFAF 2G2YA 3Q8UA 1YX2A 2BE9B 2J5AA 1MMNA 1S9FA 2KHCA 2EEYA 2JEGA 3K5MA 2L48A 2OH2A 1CJTA 2V2QA 3NWGA 2MZRA 1U8WA 1BXNA 1NJZA 4F3QA 4Q45A 3TJAA 1RU1A 1KLNA 4RBUA 1MN9A 3F44A 5EWGA 4F67A 1YI2S 9RUBA 1RU2A 2XSFA 4H4OB 2ZZTA 1M1GA 2YNHB 2M3DA 2MYFA 4FYDA 5A8WB 2W9CB 1NPPA 4KR0B 2XMMA 3EDRB 2XI3A 3H5XA 4DSJA 3QGGA 1NH8A 3U1MA 3HK2A 1X31C 1F2GA 2LYVA 1JLBB 2KG1A 5G4DA 2HW3A 1B3TA 3BYPA 1CJVB 2Q43A 1UCNA 4UOFA 2PGCA 5H1SV 2VFVA 1IR0A 2FLPA 4FN5A 3KUHA 1VQ8S 4W90B 4X4PA 1EJ7L 4BLGA 3AH6A 4WU2A 6FDRA 4FKXA 5F41A 4ZPDA 4A8OA 1T3NA 3W9JA 1KQKA 4IUFA 1HHQA 2MKYA 4DR5J 3NBPB 3MM6B 4QQBA 4AXIA 4FNHA 4UY85 2R7QA 4DU8A 3R6LB 5KFAA 2ZC3A 1S12A 4KFBA 2R2TA 2X1AA 1R0CB 4FBUA 3EVOA 2MQPA 4HR2A 1B7FA 2WBMA 3OR2B 2IYIA 2WSFC 2N4DA 4PWDA 4K0KF 2NXEA 4MKVA 5B0DA 1CJUB 4HEA9 1U0HA 2XMJA 2IC3A 3BH7B 1IBKF 5F9LA 1Q8KA 2CKWA 2VBWA 4LFCJ 2CQIA 3VAMA 1FWKA 1N54B 5CA5A 3MD1A 3CDEA 2WK4A 2WSCC 3KK1A 3DI6A 2R4FA 2BQRA 1Y3KA 1NPKA 2POKA 4L72B 1NK0A 4C2MA 2FQQB 2UVRA 2HHUA 1FRHA 3SSRA 1KFDA 5KFBA 4E8UA 4DUZF 4DHVA 3A1YG 1PKUA 4M1KA 1TUWA 2DO4A 3QRRA 1UFLA 2CJAA 4P7TA 1TFWA 2ZM6J 1VBZA 3IWNC 4PR6A 4KC5A 2YWGA 3DKDA 1XR6A 3OFGA 1ZZNA 1X0PA 2V67A 2JLEA 2D7SA 1FE4A 4JUZA 3PR4A 3SDEA 4JI7F 5H9EK 5GADU 3OVSA 1PBUA 1LWXA 2HFZA 3QIPA 1RWPB 4ZPAA 1HNWF 3IBFB 1IKWB 2K7JA 3QT7A 2UUBF 3A8JA 5KFIA 1LXJA 2DNKA 2KKHA 3MAAB 5CQGA 3FBFA 2LQJA 1U1KA 5AXNA 2QFIA 3ZNJ1 3ULHA 1SJ1A 1TTHB 5F9NA 3OD2A 1FRMA 4PQUB 3EVWA 4NXNF 4X4UA 1KS2A 4F25A 1X4DA 3LTOA 2E1PA 3CJKB 2FYXA 3ZO7A 5B0FA 5JVHQ 1AZSA 4OMFG 1R3NA 2Z4PA 1E6YB 4Q8FA 2CPZA 1J5EJ 1SVDA 4LR9A 2R7RA 1WEXA 1NMEB 5DRKA 3TQ1A 2R7XA 2YKAA 2DO0A 2WONA 4TU9A 3AY0A 4DV4F 4RX6A 2HQGA 1QUPA 4GKKF 5BYSA 5F0UA 2XLIA 2ZUAA 2GIRA 1JXEA 1N36J 4CM2A 2V4QA 4JI0F 4HKQA 1M5SA 4QYZK 3BR8A 1NRKA 3MPYA 4IOBA 5HVFA 2GS8A 5BXIA 4AYBD 4DFPA 1R43A 3SQGB 4UOCA 4ECTA 2ZBQA 4RW7A 3KLGB 3D5MA 1HHTP 2OHDA 2LU2A 3V6KA 3T5KA 1X5TA 5CHCB 2BJ8A 3DC2A 2HG4A 5C24B 4DV2J 3EJMA 4RBVA 3MAHA 3T1HF 3M2VB 2ATCB 2I38A 3NNCA 2LXFA 4DL7A 3N01A 4PXBA 3W2WB 5KFDA 2W8LA 2DGQA 4L73A 2WBRA 2XZWA 4E2FB 3K7RA 5KT4A 2GO9A 2VBZA 3PYDA 1YJWS 1T0TV 3O3LA 1K0TA 3VV2B 1X4GA 2ZEJA 3NXZA 5B0GA 1F9FA 4MFBB 2NUHA 5DGBA 1M5KC 2NPIA 5DDRC 4WIIA 4EBDA 2XYGB 1VRTA 1HWIA 3WDOA 1RKJA 4AT1B 2D9PA 1NSAA 2ZC4A 1JLFB 2G2ZA 1KP6A 3Q2SC 2XHCA 4UZBA 1QJHA 2HZCA 1C1BA 5EX0A 3OJUA 1IBLF 1NJXA 2BYCA 3IWLA 5K20B 2CJYB 3PW7A 4I7FA 4FYWB 3MM5A 4TLRA 5ETNA 2DNYA 3HHKA 4LFBJ 4EO6A 1RB0A 1VQNS 4NEYA 2V8VA 5HQ8A 4BHQA 1S1TA 3MR6A 5T7LA 2HS3A 4KKOB 2V4RA 4ED5A 4C6AA 2LP4A 3VALA 3N6MA 4DUTA 1TKZB 2BX6A 2GVDA 3N9UC 5IT0A 4OX6A 1RA7A 1S6PA 2VIHA 4K2JA 1G4CA 1GMVA 1HNZF 1H0HB 4GVBA 3ZZTA 2GQCA 1GQEA 1S10A 3F41A 1HBMA 3TAPA 1FXRA 1URNA 2F63A 4OYOA 2IY5B 1HMVB 2O66A 4LF4J 1UA0A 5B0AA 4LSNA 4B3RF 2KRRA 2HHWA 3BO2A 1Q7YT 1XMQJ 5F8HA 1TK8A 2OD4A 3L09A 4DLEA 1FWLA 1LWCA 5K8PA 1U1QA 2C3OA 2C2KB 3HVTA 2B7BB 4MIAA 1U45A 3CDUA 4JI8J 3OJSA 3C16A 2XO7A 2DITA 2YWFA 2R7TA 2GMLA 3QMQA 3AJ1A 1SL0A 3A8IA 2VF3A 3DLJA 4RUHA 2AJQA 3MMCA 2M8DB 1W2IA 1T9XA 1Y9OA 1SC4B 3KUEA 2EFNA 2ZBCA 3AOBA 1XMBA 1KQSR 1FEEA 5J2NB 4JV2A 4YB1P 3CJ5A 1DLOA 3CC4S 3PYGA 2JH3A 2KYZA 2DISA 4USTA 3RYLA 4HTIA 1ZYQA 3D66A 2GVZB 3US5A 1XN9A 2V8HA 1VQMS 4TN2A 3MDFA 1VQLS 3LANA 2QYGA 3ZXWA 2EK1A 3CB4A 2WOMB 4OYZA 4LQ3A 4PYDA 2O1PA 2CJXB 2M52A 4FF1A 3SIPB 3J7AN 2DGUA 1HARA 5JXSA 1DQ8A 3AAWB 3BEGB 2AJFE 4N7TA 2LXUA 4KY3A 3M2RA 2L3MA 1RT1B 4ILRA 1KNZA 2XS2A 1RCOB 1DTQB 3DGPA 1R8AA 2VG6A 2V2ZA 1U47A 2XMTA 1F9EB 2RSQA 3T19A 5D3GA 3CULA 3UD5A 3IRWP 2NR0A 1W26A 2HK3A 4Y65A 2RVJA 2H5JB 4CRJA 2UZAA 3I5AA 3AA9A 4ILLA 3I0SA 1LW0A 3RR8A 5IWAF 2YNGA 2VQFJ 4M5LA 5D0EA 2HFSA 3ET6A 5B08A 4G65A 3KDOA 4B9NA 2Y1LB 1TV6B 1VQPS 3QBCA 4ZVHA 3DOMA 1XR7A 5L39A 3V2UC 5RUBA 4J9LA 4ZVEA 1VBXA 4DI6A 4USWA 1M5PC 1HQEB 2GJ2A 5K9FA 3J81j 2MQLA 4LR7A 3IR7B 3SSSA 1H73A 2C2NA 3PEJA 4CLZA 2ZHBA 1X4BA 2HBZB 3VAIA 3LALA 1T94A 4DR2J 1JNZB 4UQTA 5SUHA 4Y2MA 4DCPB 4BBYA 1WACA 5A6PA 1WSVA 1Y10A 4YEAA 3I0RB 2YY3A 5KFOA 3JTNA 2GO8A 4RUAA 3ZZPA 2MQOA 2GIQA 2HS0A 4M63A 3WX8A 1YZ6A 4V19X 3GV8B 3EXYA 4DV0F 4NA3A 5FJ4A 1S4FA 4LSLA 1RCXB 1U1NA 2HK2A 2AYMA 4P71A 3UCGA 2QX0A 3TARA 1E6VA 4MT1A 1UZDA 3QAUA 1NU4A 2FY1A 3PO5A 2CVIA 4YUDA 2HVDA 4NMLA 3ZC4A 5IT4A 3FCWA 2U1AA 4DF4A 1OSCA 1Q8IA 2ZUGA 3DLGA 1WTFA 5LMNF 5LJ3Y 2PI4A 2J0XA 3EVMA 4F7VA 5KT5A 4I2PA 2H54B 1S0OA 3DMJB 4ITSA 3BQ2A 2IDLA 2QTWA 1HBOA 2G2OA 3M1VB 1AUSL 3VZIA 1B0VA 1QAJA 4FKYA 1RA6A 1C0TB 1WELA 1VC0A 1U2FA 4F26A 3W8GA 1JLGA 3NNAA 4RW8B 4KH0B 4ZVUB 1J27A 2RS2A 2D9OA 1R8CA 3I5BA 4CLFA 1IXKA 2BRKA 1RT4A 3C14A 3ITHA 4ZOSA 1U25A 4WPAA 1CC8A 1P1LA 4N41A 4RZRA 3K59A 1N34J 2J0SD 1FESA 3K0JA 2RQMA 2Q6BA 3AT1B 4ZA1A 1YBAA 4U67Q 1AFIA 3R1LA 3WBZA 1V9OA 3HD1A 5EDWA 4B9MA 4CYUB 3KLEA 3DRPB 4P73A 1X60A 1WC1A 3HJFA 1X0FA 4EWTA 7AT1B 2L9NA 3ZZYA 3I56S 4LFAJ 1G3OA 2OD6A 3LP1B 2JZ5A 4Y2AA 1LFPA 1U02A 3MEKA 4P75A 4QBUA 1NKEA 2QLJB 3U7JA 1RBLA 4O3QA 3GFZA 3B4DA 4DJBA 1SKUB 3M30A
chains in the Genus database with same CATH topology
3U27A 3I96A 5GAGI 2LQBA 4UW2A 2ZH2A 1VLYA 3U02A 2AV5A 1A6LA 3OUYA 4H4KC 3DM2B 1FO1A 2BDPA 2HAIA 4F4ZA 3AB2B 3V5RA 5CYQA 3M32A 4CT9A 1WG1A 3FNNA 3GYNA 4UUWA 4IRKA 2OAUA 2DVIA 4ES1A 1NK8A 2LDIA 4WFBQ 4MMOA 4X62F 2BUNA 4WK1A 5FDLA 4AFFA 4DX8H 3OSPA 3R5DA 1LK5A 2C2DA 4NZ0A 2QLXA 5L1IA 1EETB 2VFSA 3CJ4A 5BJRA 5KFMA 1S0VA 1U2RA 1KR4A 1FA0A 3DRXA 4RBTA 1VQYA 5GAHU 2EBGA 4LJMA 3W3SA 2IAJA 2IVMA 3SFGA 2GCFA 3DDKA 2HRYA 2OLWA 4HDGA 5D4PA 4X4RA 1F60B 4PCQA 2VBYA 1T3OA 2J9DE 1UP1A 2ZH1A 1OWXA 1TK5A 1T7PA 3FVYA 4NLOA 2N3OA 2MHEA 4KE5A 1TV6A 3MFHA 2WRMA 1S72S 1G1XA 1H98A 4BWMA 3H98A 3MPVA 2XLJA 3RTVA 3J7YU 2UXCF 2IRXA 4HDHA 1KHWA 1JLCB 4ECRA 1IN0A 2B9WA 4AL5A 3HDSA 3IR5B 5G0RA 2GW8A 5FIIA 3UPFA 1CG2A 1N8RT 3DNCA 1S97A 1TL5A 1FE0A 2F8EX 2AGPA 2OKQA 4WYLA 1QAYA 4TY8B 4UY8T 2XLKA 3MTKA 2HHTA 3NL0A 4C7QA 4OLPA 2WONB 4U7CA 4QPTA 2ZOGA 1S1UA 4J9OA 3J80Y 1S1VB 3MCSA 2OFHX 2I8EA 1SIZA 1XNQF 4OZLA 2I0XA 1DRZA 1HQEA 3OXFA 4RW9A 1LV5A 2PD1A 5K14B 2F1FA 4LFBF 3IO1A 4YB7A 2VQEF 1R7IA 2AWZA 3D0HE 3EPGA 3G9CA 1B64A 2I5JA 4Q43A 1V3SA 1UVIA 2DK2A 2RH3A 3CSKA 4X4OA 4PPZA 1C1CA 1M5HA 3IXQA 3C3LA 4G1IA 3S6EA 4QU6A 4CH0S 2D3ZA 2GHVC 3PFEA 4USHA 1APSA 2DHSA 2YKMB 1N5QA 4OZJA 2HFOA 3UDLA 4K50A 3H8YA 4HT7A 3QIDA 1FNOA 5HLFB 5KFEA 1F5AA 1N6QB 4MYTA 4XDCA 1HW8A 5LT5A 2K1RA 4KHRA 5D4LA 1HD1A 3CCWA 4ELVA 1LWFA 1VQ7S 2OPPA 4Y00A 3KHRA 3QYYA 3CCSS 2FJBB 1D8YA 2QIFA 1KFSA 3HZGA 5EX3A 1NK7A 2CG4A 3OHAA 2VPZB 3UR3C 1X9MA 3QO9A 3I0RA 3N0VA 3M2UB 2CQ3A 5HBMB 4USIA 6FD1A 2K7KA 2WHOA 4BCAA 3EGWB 2Z0GA 4Y3CA 5KT7A 2MGZB 4QWEA 3PVXA 1Y00A 4TYBA 5I3UB 4K4YA 1LQ9A 1H7WA 5LMUF 3H2VE 4RWXA 5A8KB 1FKOB 3PO4A 1FJEB 1AUDA 1UL3A 5ITHA 1KEKA 2BW2A 3BDEA 2YKNA 2MZTA 3HVAA 1GX5A 4C11B 3JYTA 4DQIA 3DRSB 3O5TB 1UW4A 2FHJA 1T95A 3BSCA 5BYQA 1I6JA 3DOKA 1NKBA 1SH3A 2JL9A 4ED7A 4USJC 4K4SA 4C8OA 3ICLA 1WD6A 2M2BA 5I42B 5DQGA 2R8HA 2BOPA 1BWEA 1HWLA 2HS4A 1HWUA 2HPUA 5THWA 2MMYA 4D3GA 3KLIB 4KSEB 2WB1D 1YIJS 5KG1A 1U1OA 3MOJB 2PO4A 1K9MT 3TW0A 1D0EA 4OHXA 3T1AA 4DL2A 3C8YA 3PRBA 4FXVA 3EPIA 2CJKA 1DJ0A 1HNIB 4CZCA 5L1KA 4M94A 3G6XA 5EGYA 1RTJA 4NLYA 1M90T 4K4VA 2XY7A 1IKXB 2M70A 2A1BA 3F56A 4A8QA 2ASJA 2CPJA 2FC8A 5KAKA 3JSRA 1REVA 2KXFA 1S48A 2ROPA 2RF2B 3M05A 4WXWA 1R6YA 4OFZA 4PXDA 3GFXA 4E98A 1P6TA 5GAEI 2RU3A 2W7AA 2ZKUA 4DSLA 3MPWA 2KTQA 2VKRA 4Z37A 4RW4A 1RT6B 2JC1A 4DSKA 1XMQF 4IFYB 1NK6A 5K8MA 3M4XA 3MZIA 3LAMA 4F2RA 1P9QC 3MHYA 2FJDB 2MQNA 3HHEA 4RNMA 2HWIA 1FTCA 2RMLA 4KO0A 1GH8A 3NGKA 1R8HA 2VFRA 2FHKA 3FMBA 2DNQA 3ISNC 2LA6A 2ZH5A 1U1LA 2RT3A 4OI6A 2V2KA 5IM0A 3KJVB 1TKTA 3G86A 2W9BA 4DSFA 2EFVA 1RISA 2F40A 3KNGA 3HHLA 5J2QB 2ASYA 3FRZA 2QMXA 3DDNA 4KV8B 5K5MA 5IS2A 1T05B 2Z2MA 1T02A 1FTRA 3PNIA 4OZNA 3PKYA 4K4ZA 2XWXA 3C46A 4H4MA 4AL7A 2CPEA 3R27A 1AXQA 3NAHA 3I55S 3EYZA 3Q0AA 1HD0A 5M2UA 3DMJA 2RDJA 2FVQA 5J1EB 3KK3A 1KOHA 1N5YB 3LQVA 5KOXA 4RKUC 3KLFB 3Q8SB 4HYKA 3CDWA 2OFGX 5KFRA 2KXHA 2R9LA 3TI0A 4Q5VA 3CJ0A 5J1PA 2MZQA 2HHQA 3M1VA 1S6QB 2VUGA 3T6JA 4UQGA 3ZZOA 2MDAA 2XY6A 3M6WA 3SCKE 3G6VA 2AJ4A 5H9FJ 4Q8EA 4DPOA 2J9EA 2XSJB 5KG4A 4ATNA 3O6QA 4OX8A 1FK9A 4YY3F 2J7UA 2RD5C 2PEHA 2CQ1A 2YQ3A 3BGFA 3OR1B 5KFXA 1JJ2R 1C0TA 5KG3A 3N4WA 5HROA 1C1BB 1SB6A 2C3UA 4AL6A 1HBNA 5DDPC 3BGLA 4DV6F 2HLTA 4IG3A 4X65F 3KLVA 5L1LA 3EUNA 3LWMA 1Q4RA 1TL3B 4RW8A 2OPQB 2HNYB 1FJ7A 2E5JA 2AGOA 4AUKA 2KM8C 2IYGA 3O8WA 1TR0A 4IO1A 4NZ6A 1ZZFA 3LP0B 1H2VZ 1UVKA 3D0GE 4EUVA 1N5SA 1FRJA 1WF1A 3OL9A 2VONA 1YJRA 2IM3A 3L3CA 4K4XA 3CCLS 2VPWB 3SFUA 1N5VA 2QLWA 1OQ3A 2UV8G 3KWMA 1HWJA 1RK8A 1YJ9S 5CZVA 4DDFA 3UD3P 1HI1A 3IG1B 2NSBA 1SL2A 4AXJA 4KBIA 4ZPBA 3J7A1 1D9DA 4I4BA 3PM9A 1QAXA 1EP4B 2KFZA 1OSDA 2MKHA 4WE1A 1ROFA 3BO3A 1Y5IB 1HNVA 2F3JA 2NSCA 1CPZA 3HHNB 4CQ1A 5LSRA 3H5UA 3Q8RB 4HT5A 1H2TZ 4OQJA 5M2RA 2M88A 3J7YI 3GV5B 3HXMA 3FSYA 3PX6A 1S76D 4DQSA 1VBYA 1Y4ZB 4IR1A 2X1BA 1UJ5A 3DRPA 1J2VA 3KOAA 2O5DA 1K1QA 3G8TA 1PC5A 4C98A 1YVFA 4PXEA 2R7SA 5DG7A 3MXHP 2FUG9 4HI1A 3DLKA 2C28A 3VQTA 2IA0A 2VC1A 3CVKA 3QGHA 2DRAA 3DU6A 2CQ0A 3KG0A 3KK2B 3LP1A 4IFVA 1FKPA 1UA1A 4MIBA 5T14A 2OPSA 4FF4A 2DIVA 1LFWA 4IDKA 5AXKA 3NLCA 2RIJA 1DARA 2RUGA 3FMWA 4G3IA 3QJPA 3H5YA 1QSLA 3KG1A 4FP9A 4C9DA 3BSAA 3MEEA 4ZVFA 2FGOA 1HR0F 2W25A 3PJXA 4EYIB 5EWEA 3O2IA 5HN0A 1ZAWA 1CQMA 5DG8A 4ED8A 4C8YA 1N33F 4KGKA 1Y5LB 2LEBA 1DQ9A 4KB7A 1FRXA 2D3OR 4H54A 1V6HA 2FVPA 2GQQA 4QIEA 2V8DA 4LQ9A 1HL6A 2CQ2A 1YJTA 2K3IA 1FJCA 3Q23A 2VFUA 3BN4A 1L3KA 5E3AA 3I4PA 2J9DA 2R7UA 1WNEA 5A8RB 5KFHA 1X4HA 4M95A 4X4VA 4TNOA 2NXUA 4X84A 3TX8A 1Z4UA 1QSYA 3GV7B 4NLXA 3RB6A 3GG0A 1S9EB 2LEAA 1VQSA 2DNRA 1U24A 2MKKA 1X8DA 3U1LA 3KHGA 1N52B 1N0VC 2DNHA 3H5SA 3B82A 3GZ7A 1EETA 3D1HA 3JTOA 3X1LB 5L9NA 3MWBA 3JAMY 3CCUS 2QSFA 1TKXB 1TKZA 3PRDA 2VG7B 2WSEC 2GA7A 1VQ5S 4G6VB 3IRXB 4CO5A 2I2YA 3FEZA 3CMES 1TFYA 3NCQA 3CC7S 2AGQA 4OHWA 3V6HA 1GTEA 4X66F 1Y3JA 4NCGB 1VMBA 2MJUA 2W24A 1X4CA 3LGMA 4FVMA 4Y34A 3MM9B 4WF9Q 3TP2A 4KAIA 2LU1A 3I5CA 3V6DB 2ZFHA 3FSIA 1D9FA 2V4JB 1JLCA 3CJ3A 4GO5X 2B3TB 4DN9A 2HHPA 4EBCA 2VB6A 4N76A 4FPRA 4WYWA 4WKYA 2A3JA 3HKWA 3RAQA 2HGNA 2MZ1A 4URGA 2DRBA 5B0BA 1RT2B 5E0OA 2C2RA 1YG0A 4YQWA 4PQAA 3I6PA 3E01B 4ERDA 2BQUA 1BQMB 2B4OA 2VOOA 1S1VA 4OJ1A 1KOOA 2CQHA 2AJ0A 4DN0A 2OP5A 5CCLA 4A8WA 1I1GA 2ZE2B 4JI4F 4Q0BB 3VCDA 2V94A 5F8GA 3CDBA 3PW0A 3PY8A 3RB3A 1ZTWA 2BM0A 4Q44A 3CD6S 3MURP 3TUJC 2VPXB 4DV1F 5K14A 4R5PB 4C0BA 5DDOC 2P9GA 3HPOA 1S7HA 4DR2F 2W9AA 1TL4A 5M2PA 1TK0A 2XGPA 3VWSA 4ZHRB 2QMWA 2KM8B 1QM9A 4KHPF 1ZM3A 1T03B 2J9CA 1HI0P 4TU7A 4IOCQ 2HGMA 3TA0A 5E7OB 4EFAC 1X9WA 5DM6Q 3K5OA 2FLOA 4I6YA 2YKMA 3HHDA 2JDJA 4OI4A 1KTQA 4GMKA 5HLFA 2GC8A 1N6QA 1FDNA 1WEYA 4X4NA 3CE8A 2EFOA 4KT0C 3D0IE 3S8SA 3VAGA 2HNZB 3EGNA 3ONQA 5HMWA 4KFBB 2BA9A 5KFKA 5CYMB 3WC0A 4ZCLA 2XGQA 3M2UA 5HBMA 3D28A 5DJBA 2MGZA 1RDRA 2CFXA 5E2QA 5I3UA 3M6VA 4HHJA 3M2RB 4A48A 5CZXA 3W2VB 5A8KA 2JC0A 3IC1A 4PWDB 1WG5A 2AX0A 1VIOA 1BD6A 1VQOS 1HWKA 4QCLA 1SV5B 4Q7AA 2EFGA 3K2YA 4C11A 2CQDA 2ZVSA 4QWDA 3DRSA 4WFAQ 3OPKA 1XTZA 2DH8A 4YDXA 2IC3B 4NLUA 1WWHA 1IBMF 2PA3A 2BV3A 2ZH6A 3DRRB 3NS6A 5LXRA 2IJNA 3N6LA 3BREA 2FC9A 4P6QA 3M6UA 3T5JA 2VG6B 4NZ7A 3D1QA 1R31A 1ZPWX 5F8MA 4X4QA 5I42A 3TYTA 3MFIA 1KSPA 2JEJA 4IRCA 5HP1B 3MGJA 3KLIA 4CO0A 3MECB 3MUMP 2XCAA 3DOLB 2Y1JA 2G13A 1NEEA 3RW7A 1HPZB 1HNIA 3I87A 4N47A 2RDIA 2V9WA 1FDDA 2LMIA 5SZTA 5KT3A 3O44A 1Z2LA 2B7CB 1IKXA 3KK1B 3RZAA 1Y5NB 3HVRA 3DI6B 1HQUB 4PKDB 3T9NA 2KRBA 4DR6F 2VBXA 2P5VA 4OI2A 3LP2B 4ZPCA 4JI6F 2DNOA 2RF2A 2UXBF 1SH2A 3DRYA 1U8SA 3ENWA 5CH7B 1HI8A 2KH9A 2PIIA 4RLEA 4ALZA 1KVJA 1RT6A 1JLAA 4NLWA 1UFWA 3CJ2A 5AJ3F 2X1GA 5JVGQ 2FHMA 4PG6A 2OO4A 1H6KX 3OTOF 2HNDB 2JVRA 2B4UA 3UWTA 1GNKA 3RR7A 5B09A 2FVRA 4ELTA 4R0EA 3FJ2A 1DTTB 4MAKA 3HLUA 5KFYA 5LJ5Y 4W92B 2QO3A 4YR3A 2OMLA 2KB2A 2NS1B 2MKSA 4RNHA 5IQQA 3KJVA 1FERA 2ZNYA 4N5SA 5J2QA 4DR4F 1VK3A 2HQIA 3CD0A 2CQ4A 1T05A 4KV8A 2DNPA 4ECQA 1RT5B 4WFZA 1ZAXA 1JLEB 4H4KA 2KJVA 3MTJA 2B9YA 1H7XA 4XDDA 2B6AB 2QRRA 3TRGA 5J1EA 3SV4A 4C3LA 1N5YA 2RQKA 2SXLA 3KLFA 1VC5A 4HL9A 1Q53A 2HIQA 3GFHA 3KG4A 3TO8A 2ZH9A 1X5OA 2EI5A 3S01A 4B3MF 2R7VA 5K8OA 3POTB 4O44B 4FVCA 7FD1A 1S6QA 2QT7A 4FS1A 4ZCKA 1RT1A 2KT2A 4A4JA 3OTBA 2XSJA 5D77A 4Y28C 3SDEB 2BABA 1PO6A 4G1QB 2BANB 3B8HA 3OR1A 4C8NA 1HBUB 2OPRB 4L3NA 2R8GA 2ILZA 2CPHA 3K57A 3DLLQ 2OSRA 4DS4A 1IQTA 2XG8A 3VAHA 1U09A 2YKQA 3QIPB 3QWPA 1O51A 1TL3A 2M0GB 2OPQA 2HNYA 4DQQA 5E3RA 4GKJF 2CPDA 3GG1A 4NCAA 4JI3F 2L9WA 2FJXA 1N88A 1WHYA 2EWHA 1LXNA 3LP0A 4ZLPA 3HP6A 1MU2B 1NJIT 4QW8A 4NOHA 3SCLE 2XULA 4ZVGA 1N48A 2Z2LA 4ID5B 1K8AT 1JNRB 2N7CA 5L8RC 1YRXA 2CPYA 1YJUA 3WX4A 1N34F 3DLHA 4C3MA 2YX1A 4Q2MA 2MKJA 4P2SA 4I0WA 1RI7A 2UUAF 3UCZP 2DPIA 1FEHA 1QUVA 2HHVA 3LW5C 3IG1A 4LF7F 1KC8T 2XEXA 3J7Z5 2K8GA 4B9VA 3UW1A 1X7VA 2DR9A 2DCLA 2FPHX 3DXBA 4QR2A 3TAMB 2HMIA 5KFWA 2HRUA 3IAS9 5F8NA 2CDQA 1S79A 2YH1A 2WTFA 1QE1B 3TVZA 2KI2A 2CJBA 4RNFA 3E8OA 3C6UB 1BGXT 4O4GB 1NAQA 2Q1LA 4NRUA 2D3UA 2CZ4A 3KHHA 1O0PA 2FVSA 4JOUA 3CCRS 3V4IB 1HHSA 2R8KA 2DNNA 4C8MA 4YR0A 4J9KA 3PKMA 1KQFB 4LF9F 2Y0SD 1HW9A 1KHVA 3RB4A 5DDQC 2L41A 2A10A 4CO3A 4PRFA 4LFAF 2XS7A 5L38A 5AXMA 4IH5A 4ECVA 2UVVA 4Y2IA 2E5GA 2FGCA 2CJQA 1K0VA 2J5AA 4Y2KA 3UCUP 1MMNA 1S9FA 2KHCA 3L95X 1YSJA 1NK4A 1XR5A 2AU0A 4GC6A 1G7CB 2HFNA 2G4BA 4K2XA 2JEGA 3KK2A 3K5MA 2L48A 2OH2A 2DNGA 1U48A 2KDOA 3PXGa 2UP1A 3HI9A 4EU0A 4ID8A 3NG8A 3M8SA 1NK5A 2B4VA 1YQHA 1JX4A 2IFXA 5KFPA 4B3OB 4IO9Q 2LQ9A 2V8GA 3NWGA 2X3GA 2MZRA 3THPA 3EGZA 1BQNB 1SIWB 1NJZA 4QIGA 4F3QA 3CCQS 4Q45A 3AA8A 2QSWA 1SJ4P 1FD8A 2E66A 1DQAA 4K5SA 1KLNA 1ZPVA 1RT3B 2N3LA 1IUJA 3JSMB 1R89A 2LLZA 4ED6A 3FCHA 4RBUA 2RILA 2BM1A 2AYEA 5DG9A 2GGPB 4O0IA 2BBEA 3F44A 3L7OA 3MM8B 5KOWA 5EWGA 4NWBA