3A13A

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
436
structure length
435
Chain Sequence
YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
publication title Sturcture-based optimization of a Type III Rubisco from a hyperthermophile
rcsb
source organism Pyrococcus kodakaraensis
total genus 149
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3a13A02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3a13A01
3A12A 2V63A 2V6AA 2OEMA 3KDOA 3KDNA 1RUSA 4LF1A 4NASA 2V68A 1UPMB 1IWAA 4F0HA 9RUBA 1BWVA 1UWAA 2D69A 4F0MA 1AA1B 1RXOB 2VDHA 5HQLA 2V67A 2YBVA 4MKVA 4F0KA 2VDIA 2RUSA 1SVDA 3RUBL 5HATA 3QFWA 1RLCL 1UZDA 1YKWA 3FK4A 1WDDA 5HJYA 3AXKA 5HANA 1GK8A 2OEKA 2V69A 2OEJA 3NWRA 1RBOB 3RG6A 1RBAA 1RSCA 1UPPA 5RUBA 1IR1A 3A13A 1RCOB 4RUBA 2CWXA 4LF2A 3AXMA 1RBLA 2OELA 1IR2A 5C2CA 1RCXB 1AUSL 1UZHA 1TELA 2CXEA 2QYGA 5HAOA 3ZXWA 8RUCA 5C2GA 5HJXA 1EJ7L 1RLDA 2ZVIA 4HHHA 1UW9A 1GEHA 1BXNA 3WQPA 5HQMA 5HK4A
chains in the Genus database with same CATH superfamily
3E5PA 2PDQA 2JSXA 3H6OA 1R0CB 2R8GA 2XVLA 3URBA 4CLYA 2OEMA 1OT1A 3DOPA 3FYOA 2CZ9A 3H22A 3AJ2A 1S5VA 4JNYA 3VIPA 1UASA 2W5FA 3S2JA 3GJTB 3HXMA 3DLKB 3ARVA 1IEQA 3B0VC 3KHDA 3E2SA 4EWTA 4JQ4A 1JIBA 4OOZA 1TV6B 1UD8A 4YP3A 2POTA 4WIIA 4RV3A 1VIOA 4B9VA 2HHQA 1V3JA 3F73A 4PE8A 4BBYA 1I94F 4ORMA 1KM6A 2ZRYA 3QIDA 4IF2A 2QMUB 4MIMA 2YX7A 4ASTA 3CYJA 2X1SA 1IT7A 5AYYA 2LCWA 3EWUA 5J1NA 2FH6A 9XIAA 1XYFA 3WQEA 3VKCA 2HFZA 4CUCA 1QOQA 4WFBQ 4DS4A 2V3DA 1CS4A 1ZS2A 3TNBA 4KRTA 2OO0A 1TL7B 4QIFA 3LNPA 1L8NA 3ZTOA 4UZBA 3Q86A 5LNVA 4DFPA 2V2KA 4KWSA 4ZKAA 3GNRA 5AC8A 1UZ1A 1QSYA 3AXMA 1V4YA 1Y8BA 3NRBA 4Q8UA 3TQKA 4DL0C 1HP5A 4ZPAA 3EVWA 3Q2TC 5E0OA 1PJ5A 2V5JA 4MJZA 3TSMA 4ZGYA 1N33J 4URQU 2U1AA 2ZDSA 1ONXA 2YB4A 4M5NA 4O3QA 3EOLA 3T2QA 4Z0JA 3KK3B 2WSFC 1NJIT 2OSQA 5F4XA 3DOMB 3N4EA 1WTBA 4HI2A 3VM5A 1ECQA 1O4UA 4M95A 2BV9A 5E0CA 1KTVA 4K68A 2OD4A 4J90A 1OZMA 1M01A 4QE5A 1VPQA 3WBXA 1HBNA 3A4XA 3PZIA 3CJ4A 1KLNA 1LOQA 3CHVA 2XZWA 1O5QA 1Q6EA 3MSDA 1F8IA 3DFQA 2IM2A 1PWLA 3NM1A 3O0FA 4B3MJ 1S1WB 3A4TA 1G01A 3UXDA 4PEOA 4ZXOA 4ZITA 1U1LA 1PGZA 1AL8A 5HO4A 1RTZA 2COLA 1FH7A 3GIIA 6XIAA 1BE4A 1XLBA 3ZJKA 4M5IA 3LV6A 4DJED 2YW3A 3AI0A 3NEKA 1NQKA 5D37A 1T03A 1GQJA 4NY2A 4FF3A 1M3UA 4PUWA 4QYZJ 5AC7A 3VCCA 3FN9A 5CPMA 3TH6A 1E6XM 2HQDA 4F0MA 2AAMA 2HNDA 1I2QA 3BTNA 3BQ2A 3SFWA 2EO7A 4PPZA 4ALDA 4JXCA 3VGDA 3VGFA 4F2UA 3AHXA 1Y7VA 4D6GA 1V02E 3MSYA 4QG9A 3K5PA 4DU8A 3ILLA 4C6PA 3E3XA 3GVGA 3TYBA 2JEFA 3WQGA 3NSXA 4N2YA 3QBCA 2XWDA 5C42A 4LBUA 4OYZA 2GHPA 4AMAA 3V4BA 1JAKA 2BZ2A 5K9FA 3TCEA 4CLLA 4HMCA 4ZVRB 2GDQA 4YFUA 4B3OA 5H9EJ 5E5CA 4L7ZA 3RU0A 3LCLA 4OMFG 3V6HA 4CLUA 3WK0A 5L9XA 1VK3A 2G3FA 3CJ0A 4C0OC 4XZBA 4JYDA 4DUVA 2HNYA 2AEMA 3IRDA 3K7RA 4IH3A 3DRRA 3WUFA 4OIXA 1U2RA 1C7TA 3D6TB 2OMAA 1YSJA 1K7EA 2UUAF 3MHYA 5I3FA 1H3DA 2DGOA 5CC6A 3AYVA 3ZR4A 4FK9A 1EHAA 4GQGA 3NAIA 4RW7B 2G95A 4M5HA 3NIYA 1XC6A 5C2GA 1VYPX 4BF9A 4RW5A 3IK4A 1ME8A 2CJBA 1VJZA 4WXWA 3EPMA 2WBKA 1Q7YT 4S3CA 3B8VA 3R5BA 3SGZA 3SV3A 4IOTA 4A8QA 3IJIA 4XTIA 2RFGA 1G4SA 2F65A 2NQ9A 2LEPA 4HACA 1MDLA 4NX9A 3TR9A 3DLHA 3AXXA 1AUDA 2ZH7A 2ATSA 1Q4NX 3VIMA 2B9WA 2NZLA 4C1NB 3T9NA 1RY8A 2XM1A 3DMJA 5LM7E 3CWJA 1N34F 1K9FA 3LM7A 3RK8A 4YYFA 3CJKA 2Y1IA 2MGZA 3GV7B 4AF0A 3MAAB 2B7BB 2W01A 1ZH5A 4YCOA 5KFLA 3LQVA 4ANCA 2R1PA 1ZZNA 1RY0A 3LGMA 4J5OA 6TAAA 2XSBA 1BQCA 3QH2A 1KWGA 2OSWA 5DMNA 3M7VA 5HMZA 4AYBD 3RFAA 1Y10A 2GLKA 3HB9A 4Y2CA 1NWRA 3WD4A 1LL4A 2A4AA 3FW6A 4WY0A 4XZLX 1OFRA 3DI1A 2PGRA 4IMEA 5I7GA 3ENWA 2EWHA 4G6VB 4HTYA 1KB3A 1VI7A 3VGGA 3LUYA 4OL8A 3OBEA 2ZXQA 3FEYB 2DEPA 3NYZA 4CVWA 1LRQA 3TYAA 3FBCA 4JQ3A 1QI5A 4IXXA 4HSNA 1DARA 4GFIA 2W9BA 2I7GA 2LLZA 1LORA 2C79A 3HLUA 3UR0A 1BHNA 3W4RA 4HYWA 2HZCA 1TIMA 2AP6A 3C0LA 1OYAA 3ANUA 4ID5A 5IFMA 4W8LA 1H62A 2VBYA 1K9DA 3HG2A 2E5GA 3GJQB 5C5YA 2BSLA 3B4YA 1JPDX 1IR1A 4ORIA 3O5TB 2A3BA 3FVMA 5KSWA 1Q6FA 3GHTA 3HF5A 3P3DA 1KW1A 2XI3A 2CWKA 5TIMA 4F2TA 1T11A 3K2YA 2WHMA 2R2UA 4AXIA 3KFTA 2HVNA 3D66A 1GHRA 2OX1A 3TN3A 1HZYA 3KOXA 3MP3A 3O2IA 3OQ8A 2CZFA 2REQB 1YJWS 4QJ4B 2GDUA 3K5OA 2C8NA 1JWWA 5GAGI 3M8QB 4ZTYA 1W2IA 2QA4S 2NQZA 2ON3A 3W2KA 4OYXA 4NMXA 1TQJA 5BWFA 1IEVA 4DAIA 3VNDA 3TCSA 4NRUA 2MKIA 4CQ9A 1Z6KA 2X42A 5C70A 2J9ZA 2EXOA 3C14A 1UH4A 1K4GA 1YX1A 1CI1A 3L65A 5A94A 3O6YX 3AOBA 1NJJA 2O4MA 1FHVA 1GJWA 4N4PA 3PWAA 4XSLA 5HMDA 4O50A 2DSUA 3W2MA 2CNLB 4N9BA 4REQB 1KNZA 1F4AA 1HWIA 1D8CA 2WCAA 3LGDA 4POCA 3IWPA 1WELA 1F60B 2WVVB 1EJXC 4UOHA 3D6HB 1F3WA 1DJYA 3OGVA 1J0KA 3M5ZA 5E3QA 4UFJA 2NLYA 1EP4A 4LBHA 2YCIX 1GNKA 3WCZA 2GVYA 3DG6A 1S48A 2XFRA 4F25A 2VUNA 4O57A 3EDRB 1Q3NA 1S7HA 4LT6A 4P8VA 1SL1A 1DWHM 1J2BA 1E40A 1THFD 3HPOA 3QZEA 3OSNA 1VGAA 4ZCWA 2YZRA 3B54A 3LB0A 4DQQA 3A3HA 1HBMB 3A8IA 4KWOA 1A3HA 1UWIA 3ZWSA 3H7VA 2JKEA 4KKOB 5D04C 1YKWA 3MR2A 3DM2A 1CEOA 1RVGA 4YNGA 3QWPA 4ZIWA 3D68A 1DE6A 2JHEA 5HROA 8ATCB 5DCEA 3KRSA 2E67A 3M1VB 2FVKA 4Q43A 4JI3F 3FXGA 4NSBA 4H8VA 5LHFA 1QPKA 2QJGA 3WNKA 2DGSA 5C24B 1U24A 3IR7B 2GQQA 4RV8A 2BYCA 2AGPA 1FRMA 3M8YA 3UZWA 1JF5A 4PPDA 2V8PA 3UT0A 4M3PA 4GVBB 2B51A 3WDOA 2M3DA 2DSKA 4IG3A 3G6MA 1KVJA 2CYGA 2XSJB 3SFUA 2CKSA 2V8GA 2YPYA 4CLMA 3S7RA 4YVVA 2AWZA 3S2MA 3VGEA 3O8AA 1A5NC 4UXDA 2H8ZA 3TWZA 3AS3A 3NPXA 4A2RA 3A22A 2E66A 5E93A 3PVXA 4JN7A 4AD0A 3W53A 5CZJA 3Q8RB 1F5ZA 3UQNA 1VGYA 1FWBC 2BY0A 4M5JA 3NWGA 2UXBF 4CYUA 2CQPA 4YTRA 1S6UA 4P7VA 1FBAA 1R9XA 3B9EA 1IIGA 2E5CA 3BW3A 2FGCA 5D3GB 1VFOA 1JUEA 3SEOA 7AT1B 3NOYA 2CHOA 1NKBA 1HWJA 4D6JA 3G1VA 4F4WA 5ETRA 1DQUA 2Q02A 4NLUA 4F4ZA 4TQRA 2X40A 4WGHA 1J0JA 4EYHB 1K6AA 1QNQA 2H3DA 1BRLB 2KTQA 1W0MA 4GVFA 5DXYA 4FB7A 3VAMA 3EX2A 3HO8A 2QL7B 3V6DA 4QU6A 1TA3B 1GG0A 3FA4A 1F3FA 7REQA 2C2KB 1ITPA 3R8RA 4GIEA 4OZNA 4LCQA 4HI1A 2CFFA 1FVQA 4DM1A 1CGTA 1RJPA 2GCFA 1D9EA 4NE9C 3NO5A 2G0CA 2RKXA 1HXJA 1PL9A 3L7RA 3CO0P 2Q6CA 1ZM4A 5FD0A 2E7XA 2AD9A 4L56A 4NKCA 4PQUB 1W7WA 2XFYA 4CU7A 3HGOA 3IK2A 2ROEA 1B3WA 2DHXA 3OVPA 1RAJA 4I9JA 1HBUB 2V2VA 2MY8A 3UWVA 2BTMA 4QDMA 4R27A 4KH2A 3RX3A 4D2JA 4UFMA 1YTDA 2PDYA 4ATDA 2W0UA 2AZ1A 4P52A 4WKRA 1RE1B 1WOPA 4PODA 2YXOA 3RM8A 2I0XA 2YNFB 1G67A 2XVGA 3W7EA 1TKZA 3K57A 3M9YA 3BJFA 2YCJA 1UCWA 1N8FA 3EAUA 3U3HA 2IVFB 2JIEA 2ODOA 2O66A 3VQSA 4TMBA 1RKIA 3EYZA 3O0KA 5D2XA 1Y5WA 2WMFA 2X30A 4RX6A 2ZICA 4I9AA 3BH6B 4JV0A 2NXCA 3LSCA 2ZZNA 5C9RA 2DNLA 2XMTA 4LBIA 2NREA 3R8GA 2VVSA 4EIVA 4O1AA 2Q8ZA 4GI6A 2YCEA 5CCLA 4L64A 1KFJA 1JXKA 2FVCA 5E41A 2UUBJ 1V6UA 4DSIA 3WQ8A 2J7WA 3TJ9A 1PBAA 3MEEA 2GVDB 3KTXA 3VQTA 2PP1A 1HW6A 4PYAA 3LHVA 5LT5A 2MZQA 1SQFA 3W28A 1UKOA 5BXSA 1XICA 4UOJA 3A12A 3WH8A 5KFKA 1X0PA 2XVPA 3HJEA 5JBFA 3I0SB 1FNXH 3T0AA 1H2JA 2HJPA 4FNQA 3PFEA 4ZPBA 3TUIC 4NZ1A 2SFPA 2GJ2A 3OLEA 4IMAA 1UVNA 2WW8A 3LTYA 5E2QA 2X1UA 3MMUA 1HNWJ 1S4FA 4ZVEA 3W1RA 3VNKA 2AGQA 4HYVA 1IZKA 4NHVA 5IC4B 1KGWA 4ED1A 2QF8A 4F02A 3MUIA 2KH9A 2OSXA 4A8YA 1W1TA 3TIMA 5KETA 2J75A 1UJ6A 4NLGA 2JRSA 1OIMA 4WFXA 1H2UX 1I3OB 3I3EA 4E0DA 3EXSA 1TO3A 2I1OA 3HHLC 5FCZA 1YJTA 1SO3A 5BOEA 1DJ0A 1AROP 1FRIA 1B3VA 3FCPA 3KG4A 1E9LA 4WKHA 3T1HF 4K59A 3GVVA 2PUZA 1WCGA 2J25A 4LAKA 1VYRA 4EANA 3T1AA 2BQUA 4J3WA 4ED6A 5J2MA 3EGWB 3G5EA 5H1WA 5I07A 1JLBA 3CJQA 3RW7A 1PBUA 1FOBA 3UY7A 3KBMA 1SXLA 2OKOA 2ZX7A 4G1NA 3QQCD 4IR9A 4QU7A 1RHUB 1XR5A 2RT3A 3R0KA 1RAIB 4OLOA 1ML1A 1XPGA 4NLYA 3MM5A 4LRAA 1IHIA 2RHQB 3TEGA 5B0AA 1SFTA 4MFDA 3WEMA 1E70M 1NOFA 1T41A 4RZBA 1LQAA 1EJVC 4L6V3 4TNOA 4R8UA 2EPMX 1RWPB 3FSIA 1EGZA 4GIAA 2JEQA 3GU0A 2WNNA 5LIWX 3CLMA 1OT2A 4FPRA 4ZXLA 5B0GA 2PRLA 1VJQA 3LO3A 5DRCA 1G7VA 2DH8A 1UMLA 2GK1B 4DNMA 1APSA 1XWYA 1HI1A 4NXMJ 2JKPA 3OYXA 1Q4RA 3W1MA 2AJ4A 4Q8FA 5L1JA 3WQ6A 2E9MA 4QGCA 3FNDA 2INZA 4N77A 3ZT5A 2HGMA 2PP3A 4RBTA 3W76A 1PO9A 3IXQA 3OHIA 3IAQA 4WU2A 4K7YA 1JDAA 1U22A 2E5DA 2Y7GA 2LA6A 2CZVA 3R2DJ 3HHEA 4R88A 4LJ3A 4RL1A 1HNVA 3GXDA 1RT2A 3FLUA 3UZYA 4DL7A 3G6XA 2G1HA 5MF5A 2IIHA 1WNOA 2VU5A 3GV8B 1V02A 1B99A 1IKYB 5A6SA 5E6YA 3APGA 2AYMA 3L0GA 1B70B 5GAEI 3MZ2A 3WKZA 4LUYA 1MG7A 3QY6A 2M52A 5DQHA 4LR8A 4ECQA 3JSBA 3CB8A 1TL4A 4W85A 2CADA 3NS5A 3I7QA 1S0NA 3PBYA 3Q8VA 1KOHA 2LEBA 1TWDA 2VCCA 3KRBA 3FQLA 1RKJA 2ISSA 3ELFA 3JR2A 5CH7B 1XLLA 1GYLA 2RILA 2IS7A 2AL2A 3TZNA 3W01A 3WLHA 1RT5B 2HBQB 4JBCA 3ECQA 4DWSD 1U2YA 2BVDA 4Z2GA 2RMLA 2P8BA 4H04A 1TPUA 3EXCX 2FZMA 3VVGA 2R42A 3V5OA 2DGXA 4A46A 2V69A 3TTSA 2RDTA 1TV7A 2YYTA 3FVYA 1ZBTA 2DKOB 1DHMA 3TEHB 3SY1A 4FX7A 3M32B 3AXIA 2UVUA 4B3TJ 1KCXA 5I24A 1NDPA 4X4RA 4GZJA 2PDLA 4PGLA 1ZAWA 4JI6F 2J27A 1UA3A 3ZR6A 3N2TA 1A3XA 2PF0A 3PO4A 1HFBA 2DR8A 4HMNA 1T8XA 2XS7A 4DHVA 2GX8A 1RAKA 1OQFA 1RT1B 4DCOB 1RTIB 3E01B 2NXJA 3OV7A 2DGUA 3QFHA 5FIIA 2NVDA 4FSAA 1MZRA 4D6FA 3C6TA 1W1B1 1LKZA 3CIVA 4L65A 1MW0A 1QFEA 2QULA 4CU8A 3HSZA 3FCWA 2ZZ7A 3LPEA 1M0SA 2A18A 4N7TA 5ETTA 1KSPA 3AY0A 3VINA 3OR1A 1MWQA 3BGFA 1G4PA 5HK4A 1H7PA 2C2EA 5T14A 3LGEA 1BHGA 1LBFA 5D9PA 3M2UB 2VOTA 3RB3A 2Z00A 4M81A 4JKMA 5FF2A 1XM3A 3KDNA 4AZIA 1WF2A 3DC2A 5CXTA 3NQVA 3L4BC 4URSA 4KERA 4F0HA 4M7SA 2D9OA 2WSRA 1RHCA 3BUVA 4AHQA 4TXSA 2F6UA 2UXCF 4C3LA 2NQJA 3R6LB 2DUZA 1EWEA 3HPAA 1S6QB 1LFPA 4GBDA 4S2BA 1Q6DA 4H7VA 2HGLA 1LM1A 1WDPA 4GY0A 4ZO6A 5E7OB 1VQ7S 4CNZA 1Q16B 3VTIA 4Y2IA 4YUDA 2F61A 3GWCA 2ZE0A 1OWQA 3EOSA 1NZAA 4GRSA 5A5WA 2GA7A 3C2EA 2QHAA 2D9PA 2R7RA 1VJIA 2DZXA 3AWNA 3J80U 1SSDA 3OTOF 2UUTA 2A1BA 1T9UA 2EBGA 3D9BA 4IL0A 1WUFA 1K6WA 4ADTA 1UMJA 3VGSA 1EP3A 3BLFA 2WSYA 5KFYA 5D05A 1SC3B 3TANA 3HIJA 2JLEA 2XYGB 3P67A 3UD5A 4JFWA 4QIEA 3LCWA 3OP2A 3LA0A 3MS8A 4XVEA 2JALA 1YRUA 3VNYA 2GVGA 2JLGA 3E1F1 2EG8A 3P82A 4PCNA 1S5NA 1U1QA 2Z8QA 3OVGA 4ER8A 2X0HA 5A2AA 2PPGA 4CNTA 4ILRA 2QE5A 4CGTA 3C16B 3FFIA 1EIBA 2C13A 1WOSA 1O5RA 3MHFA 4OX9J 2OMLA 4RR5A 3FVDA 5EFFA 4IOAQ 1FE0A 1Q8LA 3VD3A 1I2OA 2CLHA 2XYPB 2FTYA 1OSEA 1VBHA 5HMWA 3NUKA 5ABGA 4C6QA 2BVTA 4JTSA 4JYEA 1AD4A 1FA2A 3RMJA 1RHKB 3A3NB 4CLPA 3IWNC 1CJKB 3VCDA 1FT8A 4OJ3A 3ZMRA 3ARSA 4B4FA 2Q1LA 4AQLA 3B8WA 3G1YA 1JJCB 3MR5A 1M7OA 5M5DA 1YZ7A 3NFUA 3P7YA 1C1BB 4H83A 2VC0A 3CIWA 2YXXA 4Y96A 3PNIA 1HHSA 3V18A 4ZE5A 4HT3A 2YQ1A 3FJ2A 1JNDA 3T0CA 3WL1A 3HFYA 4Y2KA 4Q8QA 3T5HA 3TR2A 1FJEB 1YBQB 1QSSA 3LBCA 4RZRA 2RKIA 4KR0B 1V6VA 4CRJA 2FHFA 4IRDA 1DWIM 2V8ZA 4HOXA 3UJSA 4DS5A 3M5YA 3N0VA 2F3JA 1MXGA 3TUJC 5TD4A 4UR8A 4L4OA 3INPA 4XK8C 4DR3F 1RCQA 2VASA 4F2RA 2E1DA 2DNHA 2J9EA 2CPIA 1EQPA 3GH5A 3F4NA 4H8UA 1JXJA 1KQSR 2BDPA 2FB3A 4CQDA 5EU9A 3D3AA 2ZITA 3S1XA 2NS1B 1N5YA 1CDGA 1H3GA 1JZ8A 3LW5C 3FK4A 5GAGU 3MVIA 4MKBA 4WP8A 4U5KA 1K1QA 4LQ1A 2L9DA 2E28A 2Y4SA 5GMEA 1ITUA 2BNJA 3T05A 2LVWA 3RB0A 2YXLA 1PKUA 2YQ0A 1QW9A 3UN5A 1IXOA 2D0GA 2CNOB 3M8PA 4Y65A 1LRTA 4YQWA 3W71A 2C16A 2FQIA 1WHVA 1L0PA 2EKGA 5HDRA 3P8BB 3LUTA 2WVUA 1L2UA 4QITA 4LSZB 1JZ4A 3MV11 1GMUA 3GM8A 2CBVA 2CIPA 2OELA 2V0TA 3BMXA 4RW4A 1IXKA 3H2UB 2IBKA 1VFUA 1GOIA 2BXVA 4PUOA 3E38A 4E2VA 3D3CJ 8RUCA 1A5CA 4GLEA 3O1LA 4J9VA 4M7TA 1Y5VA 3OU8A 3QBUA 3BWWA 3NGSA 2FDNA 2ZH2A 1MDRA 2ZX8A 2YKOA 2M8HA 3OB8A 1PIGA 5IT0A 1XMOJ 3ICLA 3OLDA 5KFXA 2XMWA 5F4WA 5BW6A 3VV2B 1OF8A 1ZBCA 3FAWA 2ZVIA 5BMXA 3MA8A 4E38A 3W9HA 4NLOA 3AIUA 4I8DA 3P3BA 5A0YB 3VNMA 3GK0A 3G22A 1E6VA 1F76A 3MR6A 1UETA 5FSDC 3N2BA 3ATZA 3DFSA 1HKWA 5HBMA 4UTGA 4XDCA 2OPPB 4WCJA 1W5MA 3MWCA 5CPNA 3BGGA 4INFA 1K8YA 2QUMA 2X0YA 2DPEA 3UZZA 1ZP3A 4A8RA 2C1GA 1OJ4A 1KDNA 4YIWA 4UQCA 3TX9A 1EB3A 1RPKA 2YIHA 3TX8A 4IXHA 4KO0B 1WD6A 1KXVA 5JH2A 5JMUA 2BJ7A 3QLLA 3H2CA 1NFPA 3DESA 3W74A 3ZZYA 1C4AA 2V3EA 4OZ2A 3QZAA 1URRA 1T0TV 3NGRA 3PR4A 5D30A 4I6AA 1X31C 1K9TA 5JXQA 4DR2F 1R8BA 2AT1B 3S5OA 1TB3A 4Q44A 5HSPA 5EWGA 2QRRA 1NDYA 5CSYA 2NQ5A 2L9NA 3QFWA 2DT2A 1WZAA 5EMYA 3UG5A 2Z24A 5K3VA 1X4EA 5A8RA 3GONA 3TI0A 4DNHA 1IZCA 2UXDJ 3MI7X 4DR7J 1BGGA 3QOKA 4B9MA 4WTOB 4DWSB 4MIWA 2G5WA 3D6FB 8CGTA 1SZGA 5B7YA 3HSJA 1ZFJA 4L4LA 3P5TL 1NSAA 2Q09A 3B4UA 2IA6A 4DZIA 1JLGA 1WDSA 3HVRA 3KLFA 1SSGA 2Q43A 4DX3A 2FPTA 4JIHA 2FZ9A 4JOUA 2WK2A 4CEUC 4NI2A 4GXPA 2MQPA 1QT1A 2D2JA 4PRRA 3MCNA 2ZADA 3WQCA 1Q8BA 5CBIA 3LZ3A 3W2JA 2K3KA 2RU3A 2KFYA 3ET6B 2WV8A 4PL2A 2MZJA 2Y5SA 2QYGA 2YWHA 3CJ3A 3ARQA 4QCLA 1X5PA 3DU6A 2UUCJ 5HJXA 4O4GA 4DG1B 3URAA 3DX5A 4PN2A 3MUXA 4XO0A 4ENLA 1ITXA 3QNWB 1JD9A 3G77A 3CC4S 3JSMA 3WUGA 1NEYA 2J9CA 1MZHA 3IS9B 3MWBA 3WQPA 5CA5A 2VX7A 1NFGA 3MOZA 3UNTA 4L73A 4MZ1A 2GW8A 1RTJA 4WU3A 1GMWD 1FQ0A 3OLGA 4JKKA 2DTJA 3EOOA 3GTHA 4EBDA 3AMCA 2B7NA 5I4MA 1CXEA 2PTWA 2BLEA 4C6IA 3APTA 2J6UA 1HHTP 3SY5A 4LUBA 4DX5A 3PYDA 1E1CA 4XD3A 3TKFA 4DZAA 3Q83A 3MMAA 4GO9A 1U1MA 3CC7S 1JQVA 3W9ZA 1XQIA 4RWWA 3AWOA 1FI4A 1Z7AA 3ZVHB 4YLWA 3QHNA 4W5UA 2FDSA 4DSEA 4JKLA 1TZ0A 2ZIDA 3K5LA 2OKTA 1AQMA 2V2QA 3TU9A 5IS2A 4FLSA 3QLHB 4K4SA 1EPVA 4ZVTB 4MAKA 2ZHBA 3JAMY 4DV1F 2CQ4A 1GZGA 3EVOA 4CTAB 4H1ZA 4FF1A 1NK5A 3KUEA 3B82A 1UJ5A 1P0KA 1DJXA 1DORA 1RWNB 1HTIA 1GOMA 4QFUA 2YYUA 1ZB5A 4ZJQA 2CQ1A 2HHXA 5JIPA 2DHHA 1S5TA 4GJJA 3I5AA 4WE1A 1RGVA 4LW7A 2Z27A 4HPNA 3SDOA 3VZZA 2HURA 2OAUA 1ADOA 5U47A 1TR9A 3PHAA 2ZTKA 3IEBA 3BCJA 4U7UK 5K14A 1FKPB 3GJRB 2QUUA 3SSQA 2OVLA 2HRYA 2DSZA 3UD3P 3GSIA 4C6MA 4UQAA 1ZSXA 2ILYA 1NY1A 5AVHA 1H1ZA 4UOQA 3N73A 5EWFA 2XC9A 3CNYA 4E98A 3U02A 1KM5A 1JFXA 4M5GA 4OVXA 1N33F 3RGIA 3W2VA 1QBAA 2ASYA 2V9WA 3KHJA 1RI7A 2W4DA 3M9OB 3SQOP 1PSDA 2PLCA 3MMTA 2JH3A 1V79A 2DK2A 4AZ7A 5HMEA 5KFQA 1DJQA 5TQLA 3POCA 1SJAA 2MEWA 2OWXA 4JI4J 4W4MA 3CT9A 1WF0A 1ZQ5A 3OSPA 2VEKA 1DKWA 4XAGA 1FWPA 4MZYA 1A49A 3U7VA 3ZZOA 1N8RT 2K2PA 1NB7A 2LQ5A 4LQ3A 5E5NA 4B92A 2C91A 1KR1A 2JF7A 2RDUA 3TQVA 3H12A 1QATA 4N6EA 4UUWA 3IGNA 4B3MF 2BV3A 1WKYA 3VIJA 1VLOA 1BLIA 1MI3A 4ZB5A 3V0SA 2O1PA 3A5FA 1KBRA 2FJAB 1EYEA 4IPJA 2O9RA 5F8JA 5I3KA 2D3OR 3QPYA 5C25B 4F26A 1V5IB 3K4DA 2R7VA 2GVZB 3BPSP 2VOOA 3V81B 4LF9J 3HJZA 1FFRA 3G6ES 4NAFB 4FX8A 3ID7A 1X4BA 2LU1A 3L4VA 1YIJS 3GQYA 2VUYA 4KSEB 1L3VA 3KVMA 4Q8NA 1W9UA 3FA3A 1I9CB 5KFRA 3RHGA 4UIOA 2GSHA 3BMVA 3ZJ6A 4ED0A 3GZAA 1MROA 4LREA 1NU4A 4B9LA 3WLKX 2DR5A 4IG0A 4EPDC 2KXNB 2H4YB 2ZH4A 4RJVA 1GVYA 2KZHA 3JU2A 5A8QA 3U1MA 2DZAA 3DOLA 3EX1A 5T91A 2ZC1A 3EDFA 2ZD1A 3TYZA 1HBOB 1RBAA 1ZL1A 4A4AA 4GI4A 4WFZA 1GCYA 3I9ZA 1HF6A 5DLCA 2EKYA 4LUJA 4H4MA 5KINA 1S4EA 3R58A 3F4WA 3ORWA 1D9FA 2R1MA 3GU1A 1OJXA 3QRPA 2GMHA 1XH0A 2Z28A 3NQBA 4GCXA 1PJ7A 4P71A 2K7KA 1XC9A 1SPQA 3CD6S 4DUOA 3HJVA 1Z1ZA 5FACA 1S2TA 5GAEU 4Z2JA 2BX6A 3LP0B 3CAKA 2RNEA 1NNDA 3MM9A 3OBAA 3HZGA 1H5VA 1YIXA 1IWGA 2L08A 3GE7A 4ZQCA 1GW1A 1Q63A 3T6BA 1C1CB 2XG9A 3ANYA 4XVDA 4B2DA 4L72B 2KYZA 2XFFA 3BLKA 3OBKA 2O9PA 3KP0A 3TSDA 4ZCMA 4AQYJ 5FEWA 1JI1A 5G4WA 4DXXA 3DYOA 3NO1A 2KZZA 5C5JA 2B4PA 1OSDA 4UOCA 1R3RA 4HNUA 2FB2A 4WXZA 1NKEA 4KRZA 3F44A 5JXSA 4ICNA 1IKVB 1U48A 1RUSA 4P74A 3NVTA 1GVSA 3TAPA 1UPMB 2RH9A 2EW9A 4WJEA 4XZMX 3DCAA 5H9FJ 4XIMA 3MDUA 1XSKA 2FFCA 2FTPA 5TBOA 1YQHA 5L1IA 1LWIA 4DPXA 2D24A 2GC8A 2YX0A 2HK1A 1UUQA 5HQLA 4QZVB 4H4IA 2VNCA 4MWAC 2P50A 1NH6A 2EEYA 3H5XA 4DIAA 5K9CA 2PT0A 4J3SA 3WF1A 4O3RA 2W91A 4QWBA 1TE1A 4KESA 3M6VA 4ZZ9A 2GJXB 1EBGA 2POZA 3NL5A 1DP0A 4A3QA 4GK8A 1IWPA 2DW6A 3RPMA 4LBSA 1TIWA 4LF8F 3MUMP 3MXHP 2ANUA 1ZYQA 3HTWA 1REGX 1YJVA 4CNOA 5J2QB 5J2NA 3W7CA 3MEGB 4LRDA 4B15A 3LAMA 1F6YA 5AJ3J 4LSBA 4IFKB 2EHHA 3UJFA 4PQAA 1QCWA 4UFLA 3BSGA 3DOKA 4OJYA 2VG7B 4NZFA 4GKJF 1TRIA 1PHQA 4PFMA 4BWJA 1R27B 2YBTA 3S1TA 2KFZA 2IKHA 1I0DA 4HMEA 3W86A 5EDWA 2XYLA 3R7SB 4QQBA 1R0MA 5IBXA 3W7QA 4NX0A 3HM9A 2QEXS 1VC0A 4PULA 1W9PA 4FEZA 3FKBA 2D0HA 2HSAA 2AQWA 3DRPB 1XBWA 1MWOA 1HQ2A 5KFUA 2ATLA 2FVLA 3U0HA 4HIBA 1DIOA 1RP8A 4Q4QA 2FTRA 2XGPA 5BXTA 4JB8B 3VVUA 3I65A 1VRDA 3DDKA 2X09A 1BQNB 5K9XA 3L9ZA 1IKWA 3CD5A 3QQ0A 4W89A 3MR3A 4U33A 3TFCA 5KG0A 4UTWC 4MDOA 3UA4A 3L21A 1UW9A 4WDWA 3VAHA 4G7EA 1IM4A 1JZ3A 4AAJA 3JYTA 3TAMA 1JXVA 3IGHX 2GFTA 4Y9OA 1UWUA 1G1YA 5D4LA 3THCA 3IPWA 2D3O1 1HNIB 3MECA 3AMDA 2MTLA 4QJVA 4X84A 5CZSA 4LEFA 1N0UA 3HULA 4FLOA 1E4IA 3KDOA 2WM0A 1RWOB 2G3MA 4OHYA 1JRBA 2J5AA 1JLEA 3MF5A 1K7FA 4EBCA 4W8AA 3WF3A 4GUJA 3NQFA 2Y88A 3FGCB 4IGNA 4QDWA 2IHR1 3NQ2A 4LVNP 2BQ3A 3DCPA 1GOQA 3GSMA 3F1QA 3OGRA 4PMUA 3DDIA 2XNQA 3PV8A 3ITVA 3IAPA 2VDHA 4HNNA 3ARTA 3BE7A 3NCRA 1TUVA 4MKVA 4WDTA 5B0EA 5EMUA 2RF2A 4GO7X 1JRCA 3VDAA 5JBEA 2PD1A 5B0DA 3WD2A 1H60A 4LC8A 1EA9C 3W2WB 2PU0A 3V36A 5KFAA 1CBKA 1NK4A 3W1PA 2ZRUA 3W1LA 1AW0A 2NSXA 1T02A 1NSJA 2EFQA 5REQA 3CC1A 1RLCL 1T96A 4OT7A 4FALA 1HLWA 1XLCA 1P0EA 2DH3A 3BARA 2ZE2B 2PS2A 4WEVX 2G96A 5DLFA 1IEWA 5K9DA 4ZP9A 4CO0A 2NUUG 1ONWA 2AF6A 3TOYA 2XH2A 5D4OA 2Y1RI 4R33A 1UVLA 5DZ7A 3PAOA 5H8UA 2DCUB 4RDVA 2IRUA 1UA1A 3T2OA 2XMJA 3PO5A 1WXZA 4XKYB 3OJSA 2PU1A 1W2VA 4PRTA 2W7PA 2GOKA 5M1TA 3VF0B 4ECSA 5EMMA 1SB6A 1XDMA 3ZT7A 3G86A 1PC5A 4KHPF 1M1BA 4O1EA 5LSMA 2O0TA 4CQ8A 5G5IA 5A8GA 3C6UA 3EWXA 1NTHA 2CXGA 1A7GE 3OFFA 2W8KA 2OTDA 3PY2A 4KRWA 4XO6A 1GVQA 4KF1A 3BBBA 4ZPCA 3PY8A 1EHNA 4HHPA 1J2WA 3O6DA 3PB0A 2GMJA 3L66A 4GVGA 1Z8AA 1XLGA 1B54A 4CT8A 1EJSC 1HL8A 4WCEQ 2IM1A 3MC5A 1NDCA 1Q85A 4P7LA 2BE9B 3STEA 3SRKA 2B5JB 2MKHA 1OC7A 3FKKA 3SIMA 3PZMA 3E74A 3O3RA 4IJBA 4UWMA 5L1KA 2BX7A 2WO5A 3EKLA 1U0HB 3CDAA 4U67Q 3KK3A 4I2QB 5BU9A 3ILIA 4I6YA 4XBKA 2FY1A 3MCMA 5BROA 4ENOA 3GKFA 4HDGA 1EC8A 4BY3A 1B0PA 3MDFA 4DOZA 5I3JA 2QCMA 3V75A 1WKFA 3LHUA 2P5NA 4Y8EA 3REQA 1JNRB 3PB2A 3IIPA 4X22A 4YR2A 4D8ZA 4LMZA 4M8LA 2PTDA 3X1LB 1SVDA 2PDHA 3GFZA 3PBGA 2IA0A 2OZ8A 5LNUA 2JEPA 2E9TA 1S77D 4DR1F 2OD6A 4LF7F 4DUZJ 3M6WA 3GS6A 4E8UA 2VFDA 1RACB 1AH4A 1UP2A 3B8TA 3M30A 4CDIA 2BM1A 1YWXA 2OEJA 1GVIA 1OPZA 3VDBA 4DI9A 1SC1B 2DJLA 1R8AA 5HLFB 3OD2A 4NL5A 3BBFA 2XZDB 4OTKA 3PW7A 2EPLX 1J9YA 1XRVA 1X6NA 3KWSA 4AEOA 3EJMA 1VHCA 3M6YA 5CGQA 2BY2A 4U3AA 3VO0A 2XZTB 1XJWB 2QT7A 3DFOA 3UESA 2VC5A 2J6VA 3A9BA 4QIUA 1AJ2A 4M56A 4O16A 1AYEA 4KGZB 2JWNA 2FD2A 2WSCC 1JLAB 2V82A 4ZHRA 4JHMA 3DKDA 1J5OA 4ED3A 1PIEA 3WIUA 2DXDA 3URNA 3P5ZA 1GHSA 4ICLA 2KJWA 3HHLB 3UERA 4AD1A 4W5ZA 3AD7C 4GACA 3C8FA 2Y5JA 3PJXA 4N8NA 4GC7A 5FAJA 1I5OB 2VPXB 1JLFA 3MPWA 4IX0A 1H7OA 2I14A 5L1LA 3WC2A 4DLGA 5THWA 3JVAA 2H48B 3US5A 2UUBF 3D3BJ 2GQ2A 5F3ZA 5B08A 3J7A1 1JZ6A 3WH7A 1V6YA 1JI2A 4LRSA 3HHDA 3GSDA 2OZ0A 3W07A 4QJ5B 3EB3A 3JSRA 1S6OA 3QMSA 4QIGA 2WCSA 4H6RA 3WL0A 2LXIA 3DDNA 4RW6A 2XO6A 2ZOGA 3PNUA 2AQOA 1TPVA 4USJC 2YBVA 3CAVA 4S3FA 4DO4A 3LP2B 2A6OA 5IT9Y 4O15A 3P96A 5D9NA 5LSOA 1PKMA 3WF0A 1M5OC 2ZCGA 3P0WA 4GNJA 5KFDA 1ESWA 3SMZA 4KH1B 5KT6A 1UWTA 1JCMP 3N14A 1C29A 4YTTA 3PM6A 4C1NA 5DZ6A 1HNWF 3F4DA 3MBFA 3ISND 1RT3B 4GOAA 1WZLA 4YB7A 3P6LA 2G2YA 3MSGA 4QISA 1F6PA 2ZZ4A 3A6OA 5A3HA 4BWLC 3FSYA 3MAAA 3SCKE 2CKWA 1U49A 2JBMA 1X8DA 2HHUA 1FWIC 3N01A 2W1BA 3VR1A 2UVRA 3IJ6A 5F9LA 2PN6A 3MI2A 4PSPA 4NLXA 4DXKA 1TKXA 1NK0A 5AC6A 1YTEA 1IBKJ 3GNNA 4ACZB 2DVXA 4X4VA 2VTFA 3WDPP 4ZDNA 1E6YB 3OIHA 1LBMA 1FK9B 1MMDA 3AMKA 3EVMA 3W70A 1Z32X 1N5TA 3I55S 2E3ZA 2XLKA 3CK5A 2QCDA 3NKYA 3D0CA 4AXJA 2R24A 4N9DA 1DTNA 2WSQA 3MVTA 3TOPA 1YITS 2XB2D 4O28A 4LBRA 4FF5A 4HNOA 3E0FA 1W3LA 3S9ZA 3H8AA 1VBZA 3ARPA 2XPKA 5EGRA 2HBVA 3QAEA 1A5SA 2Q6ZA 3RM4A 2ABBA 1RA0A 2BJEA 2O3DA 1SJRA 2VZSA 2F4VJ 2VG6A 3OZYA 2Z7GA 1XQKA 1BTCA 4DLFA 2ABYA 3DRSB 3GBEA 1WJ9A 2I57A 3VDGA 1QE1B 5KFHA 1MUMA 3H23A 4DUTA 3VIGA 5EBUA 2LQ8A 3EWGA 2HWIA 1TWIA 3MBDA 2RDIA 1R87A 3QSTA 3BREA 3MUZ1 2HQGA 5HA7A 3M9MB 3JSYA 4G6CA 1WV2A 2HISA 1TMLA 2WB5A 1C9WA 1W26A 4DV5J 4K8GA 3UZ5A 3W84A 1WBHA 4FYDA 4UY8T 2H51B 4GMKA 4Y7EA 3PBWA 2GO9A 3EM1A 1HQUB 4NPOA 2YJQA 2Z7KA 3SRHA 5E09A 5ENLA 4MUZA 4IMFA 2D1ZA 1CGUA 1XLMA 3CD0A 1X97A 5ECUA 4O0QA 4A35A 2C1HA 3SRDA 1PKYA 3M8QA 3SADA 4ZOAA 4RNJA 3R4IA 3RLUA 5C2XA 4JX6A 4XB3A 3BAYA 4XWUA 5HMXA 3EZ4A 4C65A 5HNUA 4DX8H 1NFBA 3RXZA 2FJUB 2RU9A 1J0YA 1OK6A 3B03A 5I3UB 3OL8A 1R6VA 4PMRA 1TPB1 3WZ0E 1JYWA 2B9EA 1TV2A 1KKOA 3AALA 3H53A 1HQTA 3CGTA 5LMNJ 5HANA 2RQ4A 4DR6J 3W2LA 3ZTSA 2WVVA 1JX4A 2G0JA 2XMUA 2MHEA 4UNKA 3WLIA 3GCXP 5K7JA 1QSLA 5CYMA 4AFFA 2ZZ2A 2IJFA 2LP4A 2WZTA 4YY3J 3WSUA 3TNOA 4WXOA 1OX4B 3OHAA 3MD1A 2EEXA 1FCQA 4OV6A 3C2FA 2CBIA 1KLZA 1CLKA 2DZTA 3LPPA 4AUKA 3MP5A 3APYA 3S6DA 3LPYA 2NWSA 4ZO7A 2KX9A 2F8EX 1VBGA 1SUQA 3P0XA 1ITCA 4LUTA 1HBMA 4HHLA 1W3JA 2G37A 1LL7A 4C6BA 5I77A 3D2WA 1JVNA 2FUG9 1ZNNA 3VDHA 1KFWA 2BKNA 4DF4A 3BVJA 2DY3A 1K0VA 4KKOA 5KZEA 3GFYA 4C1KA 5C0QA 4H4OA 3IWXA 2XGZA 1QXLA 2PDCA 4TVUA 3EZUA 1M6JA 3PPGA 2ZJQQ 3UCGA 1NBEB 2J7BA 3CTLA 4QDPA 3N9RA 3UWWA 5H1SV 4CLFA 3GIQA 1XLFA 1N52B 3AHYA 1BC6A 3MCSA 1QPOA 3TLQA 2CQGA 3QPEA 4CLKA 4MB4A 4QWCA 2D41A 4FVCA 1R30A 1L6GA 3R3TA 1O5JA 4BA0A 3G0XA 1PILA 1DURA 2YA0A 1R0AA 3OO2A 3MU7A 3IV3A 3DFEA 2VHGA 1XIBA 4XAPA 2PSNA 3UVIA 4NCAA 5ETNA 3EDQB 3GW3A 2XSJA 4ZCKA 2GGJA 2PGCA 3IM8A 2E8ZA 2ADBA 1BYDA 3RU8X 1K73T 1MUCA 1VIWA 1GVEA 2ROGA 4UFKA 4MK8A 1ISVA 1WF1A 4K2SA 4K4UA 1X5SA 3LM3A 3SR7A 3KOAA 1VFSA 4KBIA 4NI3A 3PBMA 4MY8A 4Q4OA 2J8GA 1ISWA 4YHHJ 1IBMF 3TWBA 1TVRA 4ED5A 4JI0J 4KS0A 3CPGA 3LH2S 2NT0A 4E6MA 4HTJA 4ZJOA 4X4QA 1RA5A 3W6MA 3AQOA 1X7FA 1MQPA 3FRYA 5D3GA 1KWKA 4KB7A 2VJUA 4L5ZA 5AE1A 4GH1A 3M4HA 4QOTA 3PG9A 2DNPA 2DGAA 4OI2A 3BZQA 4X65J 3UYIA 4O3PA 3C19A 1R47A 4HT5A 2FJVA 3WJYA 1X6UA 1R7IA 4JYAF 1WXYA 2WMGA 3WQVA 4LSNA 3ISZA 1S2AA 2VH7A 1GUVA 2Z0IA 4PEKA 1QUVA 2Y62A 3SECA 2G97A 3S83A 1WOOA 2FYXA 4AY8A 1UUMA 4PMVA 3OOQA 2UY2A 3S47A 4IR1A 2XULA 4WYLA 2J78A 3NPVA 4F3HA 1E6NA 1WKJA 1GKPA 3TVAA 3FY1A 3ZIZA 2XMKA 3H0PA 4F79A 2BGQA 2TAAA 2W9MA 1MYRA 2R7TA 3PPFA 3SO7A 5DY3A 1LLZA 4PQUA 3W1XA 1N36J 3PUDA 1R6YA 1AMYA 4Q4KA 2VPWB 2UUWA 4OWGA 1OFQA 5E70A 4LU0A 4JV1A 4F2BA 4I7FA 1ZS6A 4X4OA 1EOMA 2VDGA 3ETOA 6XIMA 3RBXA 4NEZA 4X0VA 4EACA 3WBYA 2EPIA 1VBJA 1EX1A 3KL5A 2FJKA 4PG6A 3R6IA 1RAAB 1V08A 4CO1A 1R86A 1S1TB 5M17A 4CH0S 4JEQA 5HVHA 3DFYA 4Z2IA 4IMDA 5FJ4A 1TTPA 5CZKA 1VPXA 4NOHA 1OX6A 3EDDA 2NQHA 4PR4A 3WY1A 4BS0A 2VBZA 1KTNA 1RQEA 5BYWA 2WWCA 3E9AA 4PCFA 1YJUA 5I03A 2NX1A 2JFDA 5KFGA 2MZ1A 3LPGA 3N3TA 3NO3A 1W91A 1X4CA 1RJQA 3CCTA 3ZSSA 4WK1A 1WUUA 1LQ2A 2CYYA 3OHBA 3UVJA 2CWNA 4R7WA 4A8XA 3CUIA 3WLRA 1UKUA 5F8GA 2HAFA 3RRXA 1UEVA 4DO5A 1IF2A 1Q0NA 2HMIA 4ATNA 4PA8A 1J8VA 1TTJA 1XLJA 1WHWA 4OX6A 1IVZA 3QSRA 5G2WA 3QGVA 1IZJA 4IFVB 1OFAA 4DSJA 3BL3A 3M46A 4AZGA 2W8LA 2V81A 4ROPA 1V0NA 4MDPA 3I0SA 3VGHA 1ZPVA 1HG3A 3SCRA 4BDPA 1CSJA 3GWQA 1AB8A 3BO9A 4NZ0A 3D46A 3IN5A 2R8WA 3GHRA 3NMRA 1OY6A 2RAQA 2CITA 1UA7A 1UR0A 5E3PA 3WJSA 1S79A 3BZGA 4QIWD 5J2PA 2P76A 3KBVA 3HA1A 4LB3A 1Q8IA 3W9IA 3OR2B 3ZNJ1 4V2XA 3UXIA 3DC0A 2VG5B 1C8VA 1FRKA 1U1KA 4GI9A 2C6QA 4MWAD 2YL8A 3DNCA 3KCLA 3AC0A 3WDQA 4X4SA 2ZZTA 5LMUJ 3AB2B 3P60A 1FJ7A 4I3GA 3MEKA 5E33A 2A6LA 4USUA 2F2KA 3V35A 3NEVA 2XLIA 5BRQA 5DJBA 3GXPA 6FDRA 2MQNA 3GLJA 5B80A 1RLDA 2ALDA 4O8AA 4Z2HA 1LOUA 5F2GA 1XIGA 1RHQB 4ZPWR 2J76E 1TV8A 1ZBKA 3KE0A 3WH5A 2OTLS 3R13A 3VAKA 2UVVA 1NOWA 1LFWA 4HPHA 2EFPA 1B57A 3PIPQ 3H59A 3P61A 1XNRJ 3NQCA 4KCTA 4LR7A 5JBDA 3S1WA 1XMOF 5DG8A 1K9MT 4DJDA 1TFVA 3MM6B 2BVYA 1FESA 4HHMA 3W83A 5J1EA 3WBWA 4WBFA 2NVCA 4HYRA 3PR2A 3HD2A 3HPZA 4TU9A 3O6CA 5HJLA 3W72A 4E8GA 3L4ZA 3F41A 3Q22A 3IRSA 4GE8A 2RQCA 5F0WA 2ZZMA 1PCKA 2CPUA 1O5XA 1IE7C 1E6RA 1FWCC 3OHMB 3Q8YA 3U1LA 1R46A 1W31A 2ILZA 3EXYA 4YTUA 1KRCC 5C55A 5FKYA 3R8YA 3VZHA 3AFGA 2VQEJ 2YVSA 3SZ8A 4C8MA 4TO8A 2V67A 3QGHA 4JICA 1UL3A 1TPFA 3UJRA 2WHOA 4NNCA 2C2RA 1PB0A 5KT3A 2NXNA 4JFVA 2CPDA 4QRNA 3ICJA 3EX4A 3N15A 2F9JA 1VQMS 2C0AA 4R25A 4DXLA 2HQAA 3PEJA 2W9AA 1WWHA 2JIWA 1K0TA 1KKRA 3MMCA 3RBDA 5FAGA 4MAVA 3VTRA 5DRKA 2AU0A 1TJRA 2X1AA 4JI8J 1Q79A 2ACYA 1TPDA 1DYSA 3ELHA 4HDHA 5T7LB 1CJVB 4IRCA 2R91A 3WQFA 3G8EA 3GHUA 2I5QA 2HFOA 4Z37A 1A0EA 2WMKA 1FP9A 3VGBA 4ZK7M 2QCNA 3AZRA 4LEQA 1XIJA 3GU9A 3QT6A 1M7PA 2YH0A 3CE8A 1ICEB 4RKUC 2PC6A 1ZTVA 1Q8KA 3G6VA 3CBWA 3A3PB 4OHZA 2JQXA 1EJRC 3DHDA 4DR7F 1VRTB 2CWXA 1HNZJ 5KTQA 3W64A 3TDFA 2O7QA 3NVDA 4JY9A 1RT5A 1S1VB 4KCVA 2MKSA 4USIA 3MFHA 3I3DA 3NAVA 1AUSL 3NCOA 3H7HB 4X64F 1T0OA 5LXRA 5IRPA 4H9MA 4P61A 4B9NA 1CZ1A 3BC9A 2G4BA 1FFQA 3LHZA 1GH8A 4PRWA 1FHTA 4H3DA 2CLKA 5MAOA 4CCCA 1R89A 2ISWA 3C8NA 4U5IA 5CQ1A 1BEUA 4MJ2A 4B9UA 1TPH1 3VWSA 3FOKA 4TLRA 4ECUA 2IJNA 3BN4A 2ZM6J 3UGVA 1VQKS 3NBPB 2AQ4A 1IXPA 1OG6A 1UEUA 4FXWA 4ADSA 5I06A 1FWLA 1WC1A 4ED4A 5F4SA 3T0DA 1ZAXA 2BOGX 3N4FA 3EX3A 4B16A 3I87A 3HQNA 4EKJA 1H6KX 3OVAA 1TJ1A 3HKZD 4O44B 3P74A 1S9FA 2A3AA 2EFGA 3PJWA 2XIIA 4GZIA 4JGDA 1XDLA 2Q3RA 4XZWA 1UJQA 3JUGA 4NL1A 1FA0A 1RT7A 1V03A 2X2YA 3O1NA 3W7JA 3P93A 3PRBA 4CM0A 4MKYA 4YYCA 2W2PP 1NQ6A 3ZZ0A 3BJTA 5IV3A 3PX0A 1MU2B 4Z2KA 3N9SA 1GX5A 3RPTA 3PUOA 1VENA 4Y3CA 2AQVA 2IVYA 1XIDA 2DZUA 2J0WA 1VQTA 4ZLJA 2NV1A 2E6AA 2CZVC 5EX3A 1W1A1 1V6WA 4I5XA 4QW9A 4DV6J 1XGDA 4PUDA 4LUIA 5CPTA 4PMDA 3KLGB 1VRUB 3UJ2A 3QR1A 2FHJD 1T3NA 1YHTA 3D0GE 3SURA 2C2OB 4NZ5A 1UQYA 3CPRA 5F3TA 4OFCA 4IMGA 4UR9A 1QPQA 2QPXA 3BANA 1EO5A 2VL1A 2NXHA 3WUEA 4IFYB 3SGUA 2OFHX 1NHKL 2AKWB 3KCJA 1UVIA 4YS1A 1RAOA 3GB0A 3UW1A 2KAUC 2DVUA 4AX6A 3MTWA 3ISIX 1ZUAX 5M3WA 4IDKB 3SQGB 1XYAA 4JFTA 4J9UE 4I64A 2E1PA 1GOKA 4YTSA 1S5MA 3NL0A 4JTFA 5XIAA 4IRKA 4TVCA 2AMGA 4Q6XA 2GZOA 2EXUA 3STCA 3T1GA 1FDBA 4MNLA 1ZM2A 1LQ9A 4LBPA 5IZHA 2Y24A 4AB4A 3N17A 3TRGA 4G1PA 2RJZA 5A95A 3H5UA 4ROQA 4KIEA 4MOZA 2B0MA 1NPKA 1REQB 4PBFA 1Y5LB 5AKQA 3TTEA 3LRMA 3VKAA 4DAFA 3ZTPA 2VONA 1E0TA 2R9LA 3SXLA 1RTHB 1S2VA 1ODUA 5KFZA 3THVA 1BQMA 1JJKA 1NCLA 1V3LA 2LKZA 4NYYA 1V7YA 4L6OA 5AHEA 3A64A 2B8PA 2YNGB 3OUYA 2Y1LB 5A8PA 3U48A 4DO6A 5CPLA 3WZ0A 4RU2A 3ABZA 2QGFB 4FNPA 1KBIA 3ALGA 3IG1B 3HN3A 4NZ4A 2DNOA 5EGYA 3OJGA 4YMZA 3U2EA 3NG8A 3RX4A 1XX1A 3H4DA 3UXKA 3KX6A 4UTTC 2CERA 3U8GA 4HZ8A 4FVMA 4Z08A 1VQYA 3DXSX 1JGIA 5D4PA 2CVIA 5AC4A 2ZEJA 2H3BA 1NK6A 3W8PA 4WDUA 3TSBA 5FF7A 4IJRA 4DJEC 1VK8A 5D78A 3KG1A 2E1MC 3WBZA 3W5ZA 4LF9F 1EARA 3IIZA 4JPGA 5J8LA 1XCWA 4G56A 4MT1A 1GK8A 3TZZA 4L9YA 4AYGA 4GQQA 1P1TA 4W4QA 3VXGA 5IM0B 1JDEA 5J5DA 1SZNA 3LXCA 3S2CA 3LV5A 2X1GA 2WYSA 5XINA 4D9PA 3H25A 3P2VA 3RJXA 2XNRA 4BCAA 3THTA 3SDEB 3IANA 4LC6A 3Q23A 3BAKA 1BD6A 4P7OA 4OQJA 4QYRA 4IHCA 1Q6RA 4H2HA 3WD0A 3C2OA 1TL1B 3MM7A 4UFHA 5LNSA 2WBMA 4RO0A 2VFSA 4MWAB 2ZBQA 4RE4A 1JLCB 1HJSA 4MJMA 3L5AA 1EQMA 1S0VA 2Z56B 2ZZ5A 2H54B 2ZE3A 1B9ZA 1E6ZA 1LW2B 1Q5YA 3OLAA 1R2RA 4P7QA 3LGHA 3QGKC 1GJUA 4O1CA 3DRYA 3QY8A 2M8DB 2PBGA 1Q2RA 3HHKA 1X5TA 4H7ZA 1KBKA 4YDDB 4AWSA 1KRBC 2DGQA 1CXLA 2R7XA 4LVFA 3LHTA 4BK9A 1OSCA 1T3OA 2MJUA 3PX6A 2R6OA 3UDVA 4LQ9A 4UNLA 1GFWB 5IXUA 5GJPA 1PYMA 4AEFA 3D0IE 3O63A 1A4LA 4KTQA 2WMJA 4OZJA 1RHRB 4S3BA 2BDQA 1GKQA 3CHFA 2E9BA 1D7FA 5A6WA 2E9LA 1WOAA 3PTQA 2OG9A 1D8WA 1J93A 2WPBA 1IKXA 4D6CA 2G3JA 3G82A 4OI3A 3FNNA 2XMMA 2NZ4A 4H6KA 2VM8A 3IGUA 3MI6A 1XDJA 1P7TB 3ALFA 4W98A 4Q2MA 2NSBA 3CUHA 3KLHB 3O05A 1FXDA 1OFDA 5DBUA 3PW0A 2DSVA 3DLGB 3MT1A 2CETA 2JEIA 2W79A 2HS4A 4OZ1A 3AMLA 2HAIA 2XCPA 4GISA 1L9WA 3W6YA 4D8AA 3C5QA 3A8JA 1VFMA 2KI2A 3QLDA 3IRXB 3N3MA 4V19J 1JULA 4C8NA 1NOUA 4PUMA 3THAA 3JXOA 3DAQA 4C8ZA 1EZ2A 4DJFA 1A80A 4IP5A 2DPIA 3B05A 3C2VA 4DEZA 3SCVA 3F2CA 3SEPA 3NWRA 5DEZA 3S6OA 2Y0SD 2FGOA 4PABA 3OTDA 4YWSA 3OPSA 5EL1A 4I56A 2QX0A 4MFBA 3ZFHA 4RXFA 2PDFA 3W7OA 5AJ3F 3SSRA 2Z2LA 2MKKA 1HJQA 4P7TA 2XN2A 3GP9A 2PD9A 5FDLB 3NLCA 5H8MA 2ZUTA 4LIRA 1OQ3A 4PWUA 5MLCV 1V7AA 3U5UA 2B9XA 4PXEA 3N12A 5H6HA 1IUJA 1XJBA 4WF7A 4DN0A 4IISA 4BEUA 3PPHA 1SYTA 4Q8OA 1ZA1B 2YWGA 2RUGA 1T95A 1FKAF 3AISA 4A8FA 3LI1A 1BTMA 1MSWD 3GDKA 1JZ7A 4LIWA 1N6QB 4R5EA 3GY1A 1XMQJ 5FESA 1WAWA 3G0UA 2OPRB 5L9FA 3G6LA 1FCAA 3N18A 1LUCA 2DORA 3W60A 3GFHA 5AVNA 3ZTQA 4AD5A 1WC4A 3SUVA 2I5IA 4UB9A 1Z44A 1GEHA 4AD4A 3IAM9 5DGAA 4K1GA 1SI9A 4KGVB 5KG4A 1BMQB 3CCZA 3DGBA 3ZM8A 4FR1A 3ZC4A 5FSEC 1OC5A 1QVFR 4B3ZA 2B8QA 3ET6A 6A3HA 2B7OA 2GHVC 4OZLA 2YLLA 3HMCA 1HWUA 3MAQA 1DHKA 1E1EA 1PZ3A 1OINA 2HHTA 1SFLA 1UKTA 9RUBA 3N6HA 8AT1B 1AD1A 2IPWA 4AZBA 3PK7A 4XZIA 1TV3A 4DG1A 4H9XA 3CPWR 1JJ4A 2XN1A 4UZUA 2E5HA 1UWQA 1F6KA 1LK7A 4JNMA 1XSJA 1NVMA 4EE9A 4A3RA 3MDWA 3W5YA 1C3FA 3H4WA 1WI8A 2NV9A 2JJ4D 1N32F 3VYLA 3KRZA 1GOXA 4IH5A 3HQ1A 1V51A 3MHUA 2QR6A 3ZO7A 2I6WA 4LYPA 1SL0A 3K5MA 1PWMA 4UTLA 3POHA 2PAJA 4G1KA 4HCLA 3PNZA 1CQMA 2FVQA 2AJQA 3GIMA 4MNKA 4TUFA 3F0NA 3FCHA 1JDFA 4LALA 3SBFA 3UETA 3LS9A 4JTJA 1FCVA 1SIZA 1WG4A 1D09B 2C28A 2BW2A 3URQA 4IGHA 3F2BA 2Y8VA 3SUSA 4OJ1A 1KR4A 3M2VB 1BKSA 4NJJA 5C9XA 1R3TA 1HMVB 2PMHA 3BDPA 3IJQA 1B3YA 1XRSA 4NRSA 4I0WA 2P1FA 4U10A 2BJ1A 2WONA 3E02A 4FDFA 3QJPA 3O9NA 5AXLA 3NGJA 2HVZA 3TK7A 1QBBA 4LVBA 2QXWA 2C7FA 3A3WA 1U4BA 1TTQA 2H5EA 1YBTA 4EXBA 4JS3A 2YNHA 3O3LA 4DF0A 4FN5A 5C6MA 4TMCA 2EPHA 1KQZA 4N0RA 4ZS6A 1RT6A 1H61A 1XQLA 4XZNX 4GVIA 5I2UA 4CTAA 4PXBA 5D9MA 1TK8A 2Y5EA 4A3YA 4XDDA 1WACA 3BGRB 4EEYA 1MMLA 4NCBA 1WSVA 2OYKA 2CLOA 1CENA 3BAJA 2IUZA 3BR8A 1E4LA 3KBWA 2ZH6A 3PW2A 3G96A 5C71A 1UKPA 3H55A 1GJPA 2OJPA 1FKPA 3CH9A 3BLPX 1Y5IB 3C15A 2X41A 1R43A 3FHQA 1FY6A 4US5A 3VIIA 4PMJA 1JG9A 3ITHA 4S3DA 1ZPTA 4PTVA 3V7PA 2VB6A 1SUXA 1V3MA 4QWDA 3PHTA 1ZJAA 5EBAA 2WZEA 2J62A 1TSIA 3DFNA 1OCNA 4DYEA 4O3NA 4GQRA 3DDMA 4MSSA 5CC7A 4DZ5A 4MB1A 1NH8A 1QDSA 2E0PA 4KKXA 2BB0A 3CPUA 3SJNA 2GS8A 2V94A 4C7QA 3BN7A 2D73A 2CCRA 3I82A 4C8LA 1TREA 2RDDA 3GRIA 1FFSB 3BMWA 2H9ZA 4B5SA 5DDPC 3STPA 5K8NA 1P1XA 1SW7A 3PPCA 4D1JA 3LTOA 3FMBA 7FDRA 2HLUA 3NS7B 3KBNA 1CS4B 3CQ0A 4LY4A 4GCAA 1WDDA 3EX6A 5E0FA 4AHPA 3QW4B 4Q8WA 1VD6A 1J5SA 3HV8A 4O17A 1UOKA 3K8LA 2Y8KA 1EA0A 4DQRA 1XIHA 4F4AA 5CAAA 3Q0AA 2APOA 4DUZF 4CNSA 1UP1A 5GJNA 2MHNA 3AT1B 4QPXA 2GVZA 1DOSA 3V81A 3R10A 2IMRA 2XM3A 5FL1A 1CXHA 3W5XA 4KMQA 4R7OA 1LWCA 3Q2DA 3GB6A 1BVNP 8XIAA 2FPYA 1C90A 1LW0A 4KEVA 2C2MB 3T4WA 4UUIA 3UG4A 2DV0A 3VX1A 4OI1A 3SFKA 5T41A 2VA2A 4MLRA 2BVWA 3ARZA 2WMIB 3DFPA 4CH1A 1HBNB 1DTTA 1CGVA 4J37A 2Z1XA 4DXVA 1QUMA 2ZOFA 3UPMA 1N7KA 1B4SA 1V8EA 5F1UA 2VRJA 1XD1A 4CLTA 2HBYB 3KLEB 3OA5A 5SZTA 2WANA 2KG0A 2HEKA 2BEFA 2VEFA 1LOLA 5ABFA 3MKKA 2Q01A 2MB0B 2P53A 2YFNA 4PUJA 1S9GA 1T03B 4JI7J 3OTRA 1VAHA 2DYAA 1SC4B 3U4FA 4KY3A 1PC4A 2YNIA 4GX8A 1TX0A 2PDUA 4P2VA 2D69A 2PSZA 1E0WA 3JW7A 4QP0A 3UEQA 5M2UA 1NK8A 2BJ9A 1D3HA 1C1CA 4K0KF 4HNLA 2DHGA 3FEMA 1FDAA 1VQ4S 2D3ZA 1MMFA 2B4OA 4MJ4A 1QVBA 2QS8A 4F50A 3ONCA 3HF3A 4ZA1A 3MQTA 5C42B 4HA1A 3XISA 2OGYA 4O1BA 3CZLA 1B1YA 1V3SA 3NAHA 3V4MA 2Z6IA 1IQ8A 1UB3A 5HBFA 1L3SA 4Q4MA 2HBZB 2X7IA 3CM4A 3VZIA 4IICA 1QPRA 4B3OB 2D74B 4E2OA 5AECA 1L6SA 1LG2A 3SCIE 4OECA 1G0CA 3GR1A 3PRDA 4J9NA 3ZZPA 3LEPA 4L6DA 2ACSA 4MAZA 3TTOA 1W37A 1QY7A 4KC5A 4BQ3A 3I10A 3KP1A 2HNYB 4BS2A 4A6GA 1FERA 3IP0A 2A7RA 3E0WA 4Y9PA 2PDPA 4JI2F 1GKRA 5DO8A 4NCGA 2YL9A 3UPBA 5U7SA 2QJNA 4EU0A 4K4WA 1FWDC 4PSRA 1GQIA 5JVGQ 4AISA 1WB0A 1RH9A 4WWSA 1SQ7A 1FWWA 1UYQA 4LT9A 4V28A 3LK6A 3S5SA 1M90T 4B4HA 5DN1A 2Y8WA 4YCPA 2F63A 4DV0J 1XUZA 2B81A 4ZVQB 2DQWA 1X96A 2O9OA 3GC5A 4WF9Q 3PJUA 2CPFA 4IFKA 3UDCA 4C0BA 4WPAA 4ED8A 4NT0A 3EWDA 2ZXAA 4LNYA 4RR4A 2VG7A 1KBJA 2YZ5A 4WZHA 1UH3A 4GHRA 4Z1AA 3MYOA 4HACB 3CO8A 4NILA 5PTDA 2P6TA 2V5KA 3DHFA 1MWZA 6AT1B 1FDJA 4Y2WA 5A6PA 1YNQA 1F4HA 4GGHA 2Y9HA 4NJGA 3DMJB 5G0RA 3V5CA 4O14A 3CT2A 3MUVP 1N0VC 3WDJA 3CJKB 2F4VF 2Y8YA 1H73A 5FJTA 2MGZB 3VKBA 1OF6A 2LLEA 4AC7C 1E0UA 5ETPA 1LXNA 4R34A 3AOCA 3OFGA 2RB7A 3GG1A 3KLIA 3DRPA 1ZETA 3C8YA 4UT4A 3BSCA 2FGZA 2Q3OA 4ECRA 3S6EA 4K1WA 5GQBA 1MW1A 1IWAA 1M53A 5FJPA 2KT3A 4C8OA 1QTWA 2RH3A 4M24A 2G9OA 3IM9A 2IAJB 4DV5F 2C19A 3R5GA 3ARWA 4NEYA 4YPJA 4FNIA 1WEXA 4WY0B 3T0TA 3TXVA 1ZM3A 1EGVA 3OTCA 1DQ8A 3JQMA 3W1TA 3ZZUA 2UU9J 2AMXA 1VIXA 2XYHB 2Z1BA 4ERAA 3L4TA 3GTFA 1HA1A 2HVOA 2GAGC 5K8PA 4OX8A 1E0XA 1A6LA 4YB5A 2J77A 2XISA 2NUWA 4YEAA 5HATA 2O55A 2W9BB 3T42A 4MYUA 4HLBA 3H2FA 2P0OA 5D2TA 4AD2A 1V0LA 1F3VA 1S1UB 4CP5A 4GBUA 4E2FB 2QLYA 3USBA 4ID5B 1XINA 3CO4A 2H3EB 4Y9MA 3S6TA 3MURP 3SB0A 1QWGA 2WWDA 3JB9k 3OZPA 4MKAA 5IV4A 3D5MA 3CNQP 2V4QA 3PULA 3L0NA 3VD9A 3W2WA 3AA9A 1VPYA 3ERPA 2QNEA 4JFUA 3W23A 4DWSC 1FX6A 4E5TA 2MMYA 4X2PA 4EK7A 1K1SA 3AH6A 3NZRA 2DHAA 1C93A 2E5BA 1ICPA 1UZHA 2L48A 1V3IA 3SYZA 3BXWA 3DIPA 3FEZA 2ZE2A 3W73A 2VPYB 1KNWA 2KHCA 2E5JA 2TYSA 4CU6A 1BXBA 1KRMA 3AHVA 2VO5A 2PMZD 4J3UA 4IM4A 3C14B 2PFDA 5C7HA 2DT9A 2DR7A 5KOWA 3PANA 4OUIA 3RAOA 1OYCA 3QGIA 4FP9A 3PCOB 2V5CA 1FRLA 3NOEA 2I8EA 1OC6A 3R12A 3VD5A 1PYOB 2XM2A 4W88A 2QDDA 3DXBA 1PXGA 1AZ2A 4ELUA 4R5PA 1JZ2A 2MKYA 2V63A 1H74A 2NCKL 2ZFHA 3R11A 1EC9A 3PZQA 3BV4A 3IBFB 3QZ8A 4ML9A 1EP4B 1UWBA 3D54A 3LWLA 1BWVA 4MJKA 1F5CA 1VC4A 1QAXA 1HL2A 2PWFA 2PI4A 5ETSA 2CNKB 3CTTA 1RXOB 1B4EA 4IP4A 1SFJA 4PMZA 3EMCA 4QR1A 3KJQB 1CG2A 1PZ2A 3MFIA 1CC7A 2DJXA 2PZNA 1ODZA 4QG8A 4HP5A 4ZOBA 1K4HA 3PIOQ 2GGIA 5DBTA 1HO1A 3LSBA 3IIXA 4K7VA 4ACYA 5C9UA 1XIQA 2EK1A 2NQPA 2QLJB 1E51A 3H2VE 4UQGA 2P9EA 1NDLA 3DM2B 4YHHF 1QI2A 1VC5A 1UZDA 4JI0F 2NPIA 3MEDA 4HH0A 2A3EA 4I2QA 3ZZ1A 1WKDA 3GCWP 5HROB 1X9MA 2HNZA 2V5BA 2PCQA 3IIOA 1TL3A 3W7PA 3H8YA 4TX8A 2LA4A 3M2RA 1GQLA 5JU6A 4XD4A 4UW2A 3V2UC 3KTQA 1OBAA 5CYQA 2FZKB 2XBPA 2M70A 3I5CA 1DXIA 1TAUA 1P5BA 4M5KA 1POKA 3EWCA 1I2RA 2NUHA 2PCEA 3MR7A 3UCCA 3H98A 4IG3B 1BGAA 4IQMA 2C3PA 4ICMA 3WIJA 1TZ7A 3TJAA 4U8VA 2ZOMA 4HZ6A 2HBRB 4ZB0A 1R3NA 4HHUA 4DFJA 2C1IA 5EMJA 4Q45A 2YKPA 5HAOA 2PI6A 1Z48A 3WEOA 3C3NA 2CW6A 2CESA 2VELA 3RCYA 4FP1A 4K4ZA 1G1XA 3P62A 4LYRA 4CYUB 3HZEA 5GADI 4JR5A 3RTVA 1HYSA 1G3OA 3S5ZA 2XCAA 3ABXA 5F7UA 2N82B 1HIYA 3FC9A 5CC5A 2HBXA 2QFJA 2D7SA 5KG6A 2RHSB 2QT3A 1R8HA 1XYBA 2W63A 4GMEA 3JAMU 3A4JA 3IJLA 2F7FA 2A21A 3UWEA 3WNMA 1QRQA 3K5XA 4OIFA 1H4PA 5J5RA 3QW3A 1QTNB 2B0GA 2WOMA 4DX7A 3Q4DA 3QV9A 4FXRA 1HIZA 2NYHA 3C66A 4PCSA 3RLGA 3CWHA 4B3KA 1XBXA 3KUMA 1I2NA 2JFEX 3VD4A 2GUUA 2FLLA 3S2LA 4EFAC 4XBSA 4AD6A 3NSNA 3V6DB 4BF5A 5BZAA 2C14A 4D6DA 7REQB 3KBSA 2AHOB 5IWAJ 3PTDA 1B7FA 1N55A 1PHWA 4PL1A 4H4KC 4IIGA 3HHLA 4C6KA 3AOFA 3C4UA 5CC3A 3W24A 5KFVA 4O10A 2ZH8A 4K39A 1VB9A 3W85A 3Q8PB 3M16A 2SXLA 4CQ1A 1J11A 3EZOA 1LCOA 1K47A 4OYIA 3WMCA 2OGJA 2D22A 1LWHA 1B31A 3I31A 1PBGA 4IH7A 2HFSA 3CYVA 4TQTA 2A3CA 5CBBA 4QQ3A 3KLVA 1IXQA 1L3KA 1R31A 4C6AA 3LGGA 3H40A 3M1ZA 2KT5A 1SBRA 1NJWA 4S23A 3EWZA 3LP2A 4N5SA 3NGKA 4TV6A 1QU4A 3W1NA 5RUBA 3QQWA 3QRHA 1Q95G 1TKZB 3V6JA 1LDCA 4XTTA 3MTKA 2I2YA 4WR3A 4FI4A 4TY8B 3N6JA 4V33A 1F3XA 1YXCA 3N1AA 4LOCA 1FUYA 4QR6A 2MJNA 3THDA 3AIEA 2VENA 2H8XA 1XNQJ 1KM4A 4UZSA 1LWXA 2UUAJ 3BF4A 1GEQA 1VS3A 3NSMA 3AAMA 4BQ2A 1MNZA 2V2DA 5LHEA 2G3NA 2ZDOA 2VICA 4XIUA 4DU7A 2HVHA 1VMBA 3HBLA 4IP7A 1PS9A 3B9DA 1TRDA 3GUWA 5HR7A 1AFJA 4HCDA 5AYBA 3TZYA 2FGBA 1F1BB 4CKQA 3MEEB 1WG5A 2RE1A 1YDLA 1J5EF 2W6RA 1FK9A 4FOKA 1WKLA 2VFFA 1B30A 3RBZA 2BY1A 1X4GA 4MNJA 4GZ7A 3R89A 3WK3A 2CDQA 4HT7A 1N2VA 3UWYA 1VCVA 4GUHA 2OR2A 4EXAA 2KG1A 1W2BR 3RGTA 1XNRF 1F8MA 3PZTA 3QGPA 4UCFA 3WFZA 4EXQA 4C5ZA 2BZNA 1N34J 4WX2A 2FGLA 2F2HA 3I32A 3KHRA 3K46A 2GGGA 3SCJE 4RNMA 2FLPA 2DO0A 1S46A 3AIBA 3TZFA 4GIRA 4CLZA 2QVNA 1VQLS 4XUGA 4YHGA 4J2MA 3ZR5A 3CD7A 4OE7A 3TN6A 1R3QA 4HVZA 1QE1A 1FXLA 2ZUUA 3I0RB 1TV4A 2MLZA 5ETLA 2HRUA 4WZQA 3W22A 1D8YA 3ILJA 4R85A 2DUXA 1Z69A 2PF8A 4BC9A 2VQEF 2YB1A 4H41A 1DEDA 3R7MA 4AX7A 3ZTRA 2FHBA 4HSHA 4JI5F 2V9KA 4P8XA 3O7UA 4RUCA 3UI3A 1JCLA 2BANB 4FIRA 1QPNA 4GINA 4PTWA 5E1QA 3NURA 1BG4A 1JLBB 3QXBA 5K4XA 2QEZA 2CG4A 4EPBC 5CD4H 2XEXA 1M1HA 3VVTA 2CPJA 3MY9A 3QC0A 4EAMA 4ECYA 2QLBB 1TTHB 4JI8F 4ADUA 2R1LA 1TKTB 3MUTP 3LYEA 1DIDA 2P8CA 2AGKA 2YWFA 4R8UB 2XIJA 3EA2A 4O3SA 2BOEX 3Q8UA 1QR7A 3NPUA 3XINA 3PYFA 1S5ZA 1S38A 3W62A 2WLYA 2FHCA 4L1GA 4MK7A 1B7YB 3QZ6A 1A0OB 3M0VA 3MKCA 1RK6A 4DL3A 2OI2A 2VQFJ 4DV7J 3K59A 2PI5A 1HNZF 2FIUA 1EJ7L 4XIAA 5CZ0A 3LOTA 1KFKA 3EWYA 3U6WA 2G3IA 3UGRA 1HGYA 1FRXA 4R0JA 1CVJA 1W3TA 2R94A 4IT1A 2OQLA 1HWLA 2HFVA 3WLQA 3UNDA 2YWKA 4DZHA 2AX0A 1EXPA 3L4UA 4PG4A 3OVRA 3W2NA 4B5UA 2FB0A 4NZ6A 1OY8A 5HVFA 4A05A 2XS2A 3TEVA 3D6MB 4Q32A 4IX2A 1RT2B 1HVXA 2C15A 1WDQA 2YCLA 3BOFA 1RWXB 4JBRA 3DLBA 1YPIA 5EB8A 2VGIA 3UG8A 2ASJA 1RTDA 2BABA 1CB2A 1OYDA 1YE6A 1J10A 1EKOA 3LMYA 2HWHA 3DG3A 4GGBA 1UFWA 1XIIA 4PUUA 3ZZTA 3TXZA 4DQIA 4IOCQ 3OQEA 1NM9A 3ZWTA 2ZDRA 2J8AA 3VKDA 1ME9A 3RX2A 4ZQRA 2QCGA 1B0TA 2CPXA 4LVAA 4JUZA 4W84A 3GDTA 3K89A 4M1BA 4C1LA 2NZCA 5D8ZA 3ZQ9A 3BG5A 4RE3A 5AXNA 5BR8J 4ZQMA 1HPZA 4FO4A 4NZ3A 2YPIA 3LENA 3IFEA 2VQUA 4MWAE 4NXNJ 1O12A 2DNRA 1OFBA 1OIAA 3NNAA 1AODA 3OFEA 4EMDA 2PGFA 1XEZA 1EZZB 3FIGA 1RAHB 1UD4A 4Y2AA 1MW3A 1A9NB 3N2XA 2QV5A 3VKKA 4RNIA 3WLPA 5BCAA 2Z25A 1YX2A 2MYFA 2OEKA 1HJXA 3CL7A 1V6TA 1CPUA 1NP0A 2VGGA 1T9WA 3SI8A 3OZOA 1XLAA 4GYFA 1ZAIA 2F5GA 4DV6F 3F5KA 3LQGA 1EJTC 4MMOA 4DELA 3W63A 2VJXA 4CI0B 4AL6A 3QHOA 4GKKJ 1LF1A 1K8CA 3YPIA 2ZC3A 3L09A 1LJYA 4TVAB 5DDQC 3TV8A 1WORA 4F3MA 5SWUA 4F7VA 4BLGA 3GYEA 3W1YC 4EGLA 5F2IA 3H2OA 3S8SA 1TAQA 2MQLA 5MKGA 1AL7A 1ECEA 4DCPB 5EPDA 4B02A 3C6TB 5IM51 3DLEA 2HSEB 2RS2A 2Q6BA 3UCZP 4YU1A 3ZLFA 1TKKA 4ZLLA 1ONRA 3NGFA 3T4CA 5KFPA 2DBBA 1YPXA 1E3XA 2ZBCA 3OR1B 2ZNZA 4C98A 3AICA 2RRBA 4A8KA 1IJFB 2I9EA 4R9XA 1JEZA 5HQMA 2VEPA 5M2PA 2AJ1A 3T0BA 2UV8G 3UPWA 1Q86T 4RLIA 5LL6d 5D8WA 2CHNA 2WQDA 1R3YA 3BJSA 1D9AA 1X1ZA 4ZVSB 3QR0A 3CCVS 1CXIA 3STFA 1YDOA 1G2EA 1L6WA 2CBJA 2ZXBA 1ZU8A 1VLWA 4J3XA 3B8HA 1E6PA 1GPFA 2A3HA 4I7UA 4PZVA 3WG6A 2X1BA 2BHZA 4GUGA 1V5XA 2D20A 3U4AA 4U9RA 1IGSA 4DFKA 4PUNA 5FEPA 4H9YA 3TFXA 4UTMA 3P45B 1N4LA 1CGYA 2ZHOA 3N19B 3Q67A 4PMNA 4W9TA 3CMQA 1B9BA 2HFNA 4P7NA 2XFWA 3DUGA 4WXYA 2DNKA 2N3LA 4K6AA 1CGXA 3VGTA 4F0RA 3F56A 3E0VA 1YPFA 1KGUA 2VI0A 5KTLA 4HH1A 2D3NA 2R7QA 4M5DA 2GJNA 1EETA 3PJTA 3Q37A 4DQSA 1KFSA 4EWND 4UC5A 4U31A 4YVPA 5KT4A 4F3OA 4I69A 4DV3F 1RT4A 2JF6A 3MPYA 1SKRA 4U3CA 1V3KA 3FFIB 3CCES 2Z1KA 1FXRA 4RDZA 4PB5A 3DI0A 4UQTA 4HPJA 2CHRA 3P14A 3NCPA 3UZJA 2OPQA 1GXLA 1K03A 3C3LA 2QLXA 1S2WA 5AHNA 3N5FA 1N8WA 1EP1A 1KCKA 3BOXA 4QIVA 5B0FA 3FZ2A 3TMQA 1JUBA 3SUWA 5KEZA 1R0BG 5D0RA 2ZUAA 2VKZG 2Z4PA 2PWEA 1PCWA 3OR2A 3I6RA 2RGLA 3AHTA 3HOJA 4F48A 1HKKA 1TUXA 3E2RA 1FKOA 4ZVUB 3QN3A 4HZMA 3KK1A 5LIKX 4UCGA 8TIMA 3GXFA 2VPZB 3VC5A 5JQ9A 3QT7A 2HHWA 2RKIB 5DANA 4H01A 2YW4A 5M03A 3IO1A 3NY0A 4ZR8A 1OY0A 2IXUA 2W4PA 1AFIA 1XP3A 2QIIA 2DISA 3GTXA 1PDYA 5A8KB 4GY1A 1UKQA 2M5YA 3H42A 1YRXA 3ZJ8A 3HZ3A 3IJ9A 5I3HA 3CCLS 2XLJA 2INEA 4G1IA 4ZVHA 3IGVA 1VIZA 3LA4A 1UIPA 1SZFA 1BWEA 3BCDA 2VVNA 1FNOA 1QI3A 4AUBA 3GHSA 3MM6A 1WBJA 4DYJA 3RB4A 3QO9B 3KYLA 1WTFA 4AVFA 1PEZA 4NA1A 3LXBA 1JJ2R 2ZZ6A 3MP4A 1GONA 1PZ1A 1S2CA 3CHDA 3VNJA 1H2VZ 1XH2A 2QCEA 4UOZA 2QAFA 1NDKA 3NMAA 3BEGB 5HWMA 4EOUA 3PACA 4DJBA 4J3ZA 3U7BA 4B9ZA 4EZ6A 3NQ7A 1N56A 3M8PB 4FF7A 3DBPA 4Z1BA 4O54A 2WB1D 4F8RA 4U4MA 3T1HJ 2QMWA 2Z2UA 4LRTA 4LWWA 1H7RA 3VIOA 2WVDA 2PWDA 2QPUA 2B4UA 4KHRA 4ZCIA 2Y89A 2ZVRA 3UU0A 3S0CA 3TZWA 5C54A 1JYXA 2BOAA 4DQPA 4S39A 3P80A 1Q1KA 1S9EB 4PUOB 3TWAA 4B2DD 4QSFA 2KXFA 1QK0A 3CW2C 4KYZA 2ZRZA 2JLFA 3MPDA 3FBEA 3R2GA 2F9RA 1HGWA 3RR1A 1TMMA 2Z30B 1FCUA 1S6PA 5BRBA 2GJFA 5CEWA 2CZ4A 4WIWA 1E6VB 3KOWA 2XWEA 4RU9A 1SIWB 2R4FA 4MNMA 1Y0HA 1CBGA 4WJ8A 2DUAA 1R8PA 1RD6A 5H2ZA 5HBMB 4ZBCA 1O68A 2BHUA 1FHUA 2BKPA 1UR2A 1RQHA 2FZCB 4J2PA 4H2CA 3G3MA 4EWJA 1KFEA 7TIMA 5DLGA 1XMQF 2FZNA 4FA3A 1PVNA 4KETA 1VYAA 4KCUA 1FFWB 2AEFA 3IVUA 3DYAA 4DBUA 1VQ5S 3UQSA 1C8QA 2V68A 4DI8A 2RSQA 3KUGA 5HI7A 4JTIA 3OGSA 1S10A 2ALZA 5CYJA 4OHXA 4ECTA 3MW7A 2H9AA 2VX6A 2JC0A 3M8SA 2X1FA 2AAAA 1UP3A 1YJRA 3EB2A 4M5LA 2VD3A 4UY85 3BW4A 7CGTA 4FYVB 3DECA 2B56A 3NBPA 1P0NA 1W9XA 3FRZA 4DPWA 4J91A 3J7Z5 3RZAA 1DLOA 2DXFA 1HQEA 5CZXA 5HMSA 1OABA 3IA0A 2Y63A 3DBNA 3M0LA 1RP5A 2BXYA 3LLDA 3PC0A 1DIKA 3AJ7A 2CQ3A 5A8RB 4DBDA 2BE2A 1L3UA 1FJGJ 1ZJIA 4RX0A 3HX9A 2GDVA 3GG8A 3AODA 5GADU 1P48A 1RR2A 5A2CA 4KEZA 1NELA 1PUDA 2OX4A 3CCUS 1K02A 2DRAA 2CJYB 3HKWA 3EWBX 1EAYC 1JLGB 2Z2BA 1J0HA 4AY1A 3KLFB 2CIMA 1KKHA 1JZ5A 1TVLA 3KW3A 1KFDA 1JQGA 2J7UA 3BYPA 4NI2B 4Y6GA 1MU2A 1U1NA 2E5LF 3NZGA 4M6UA 1DQ9A 3TTYA 1FEEA 4O11A 5I42A 1QNSA 4D6EA 4RUAA 5LJ3Y 2OFJA 3T78A 2QVHA 2HTMA 1XIEA 3DGPB 1PTDA 2V30A 1F9CA 1XG3A 1EHWA 2C2ZB 4IQLA 2J7CA 1DVJA 2V5LA 4EVZA 1RABB 4GC3A 1XS2A 1ZJHA 4JI1J 3KRUA 5DMLA 3PFMA 3M0JA 1NJZA 3VMOA 2CUYA 5FEZA 4J7CA 1VFFA 1CX9A 3GC2A 5BYSA 2EJAA 1S1XA 3N25A 1JNEA 1JB0C 1RWMB 1Q45A 1Y5XA 2VZUA 1KTQA 2R8JA 3ABOA 1DTQA 3JSMB 2UY4A 3O2LA 3L23A 3RIKA 3KXDA 4P8WA 4DL5A 1A5UA 3RITA 2NVAA 3DERA 3E5BA 4GPNA 1RTJB 4WQ6A 2BACA 4A47A 3J81j 1OVDA 2O92A 5EX0A 1E6SM 1O8BA 4FBTA 4XAYA 2DQXA 4NAEA 5J1PA 3VPLA 3B06A 4URGA 3WNPA 4JV5J 2DNQA 2EFNA 2FTWA 2WB4A 3D4JA 4TU7A 5G4DA 4WFAQ 1SMDA 1E1CB 4KEUA 1A5OC 3VUSA 1Y11A 5EUHA 1QI0A 1Q82T 2FMNA 1M04A 4F4KA 5H9EK 1REQA 3QEZA 2YDSA 2NSOA 3UD6A 3QMQA 2D0FA 1KM2A 1F9EB 2ZBPA 3CJTA 3V6KA 5AB3A 2UXCJ 3CB3A 3QJAA 1NSPA 2FZ8A 2VD8A 2ZUNA 5D38A 1YJ9S 3N5BA 1UR3M 2HNHA 1PX8A 4TYAA 2J9DE 4W7WA 3WF4A 1RTHA 2VZ9A 4AD3A 1CJTB 2OQHA 5HPOA 5HQ8A 2ZDPA 3OL6A 3BBCA 2PO4A 2FLNA