3A13A

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
436
structure length
435
Chain Sequence
YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Sturcture-based optimization of a Type III Rubisco from a hyperthermophile
rcsb
source organism Pyrococcus kodakaraensis
molecule tags Lyase
total genus 149
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3a13A02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3a13A01
2V63A 1RCXB 1UZHA 1UZDA 3AXMA 5HJXA 2OEMA 1UWAA 2V68A 4LF1A 1EJ7L 4MKVA 2V69A 5HANA 2D69A 3KDNA 3RUBL 1UPMB 1WDDA 4HHHA 5HQMA 1BXNA 1RCOB 1IR2A 1IWAA 3KDOA 1UPPA 3WQPA 3A13A 3ZXWA 1IR1A 3RG6A 5HJYA 1GK8A 2RUSA 1SVDA 5HK4A 2OELA 4F0KA 4F0HA 5HAOA 3A12A 2CWXA 1YKWA 5C2GA 1TELA 2V67A 1RLCL 2ZVIA 5C2CA 1RSCA 2OEJA 8RUCA 3QFWA 1GEHA 1AA1B 1RBAA 1RLDA 2OEKA 1BWVA 4LF2A 3AXKA 4NASA 2VDIA 1RUSA 5HQLA 2CXEA 1RBOB 1AUSL 4RUBA 9RUBA 1RBLA 5RUBA 2VDHA 5HATA 3NWRA 1UW9A 2QYGA 2YBVA 4F0MA 1RXOB 3FK4A 2V6AA
chains in the Genus database with same CATH superfamily
3SQSA 1CGTA 1B4KA 2Z1BA 3LXCA 2J6UA 3ILOA 2WMJA 1E6QM 2I5JB 3KYLA 1OZMA 4DR7F 4UTJA 2OEMA 5F8LA 1AK5A 2DJXA 1UD6A 1G7VA 4QG9A 3O05A 2LQ8A 2QDEA 2HV5A 2XSJB 1LW0A 4BDPA 3TVZA 1WDRA 1PAUB 4AFFA 4EXQA 3OV7A 4Z17A 1Y10A 1IE7C 2PI4A 3TAMB 2EFGA 5CJ5A 1L9WA 1U24A 2F3JA 3PUOA 1J5OB 3LPGA 4JCMA 3WX4A 1U6BA 3G2GA 4LAKA 1VR6A 2JE8A 3AS3A 3DFHA 3GVGA 4OZNA 4FALA 4MDOA 2OFJA 3TTQA 3WLNA 3D7SB 4JI2F 2NLWA 2GHVC 4U31A 5FL0A 2DGWA 1DLOB 2X2GA 1NJIT 1LRQA 3F2BA 3A3PB 4RNIA 2A7PA 2OLHA 2CNLB 4R0JA 4WZHA 1GW9A 1Q4NX 4PAAA 3W65A 4LF9J 2FMNA 5E3PA 4HTIA 1RGVA 3OVAA 1ZFJA 4MKAA 2V8VA 3NGJA 1R8HA 1GZJA 1TFWA 2PGFA 1IQZA 1F5AA 4IQJA 2UVRA 3NGRA 4H6EA 1HPZB 3DFOA 4WWSA 2R6OA 2CXGA 2G3IA 3A12A 5HL7Q 3A22A 1NARA 2IIHA 3QH2A 4LV4A 1LW0B 1ZAXA 4QIGA 2HQAA 1PKYA 2Z00A 3H2LA 3WQGA 2NXJA 2BB0A 3IR5B 1H50A 1S1RA 1X6LA 2H54B 2OQHA 2IKJA 3L4WA 4HDHA 3QBUA 3QGHA 5FCZA 3OFHA 3GE9A 3D2WA 3GXPA 4DL5A 2XISA 1YJ9S 4FS9A 4S3GA 3T1HJ 3NEKA 2P0OA 2O4MA 2OMAA 3AHZA 3PZTA 1CC8A 5DDRC 1W8SA 3WLIA 3WK1A 2ILYA 1GGOA 3TAQA 2B0MA 4C48A 3DDKA 5I3FA 2E1PA 3S01A 4O14A 5IV4A 2REQA 4K7YA 1YRXA 1X60A 3L0NA 4MYUA 2QSWA 1VQLS 2UXBF 4X4VA 2Z2YB 2VQEF 3DFYA 1MQPA 4YVPA 4YHEA 2M7SA 4MGGA 3W29A 3W6MA 4M1RA 3MTJA 3VNKA 4XBJA 1JF5A 4AWTA 2GHPA 1OFAA 2QDGA 1J27A 2XHYA 2HRYA 1OPIA 3QKZA 3A5FA 1W8GA 1ZM9A 2EPMX 4H2CA 2A79A 4NI2A 2VFEA 2MKJA 1UVNA 3HQ1A 1ZLPA 4LTSA 1VFJA 2X42A 3I6EA 1Y7VA 1VQ9S 2WLYA 4PRWA 1SJ3P 2PDFA 4JI1J 3CB4A 3DLHA 4ZFMA 2Y70A 4UQ9A 4KESA 4RR4A 4Y2KA 2PI6A 1BEUA 4HVXA 4OZ0A 3MUMP 2AGQA 3BJYA 1K8ZA 3TZFA 1SO3A 5CPMA 1K9EA 1WO2A 2WB4A 3ARSA 1YW1A 5GJNA 5M5DA 4HSNA 2REQB 3UP8A 3BDKA 1W2IA 3DENA 4NG3A 2DZSA 5FJ4A 4LQ9A 3MR2A 3UZWA 1TV8A 1CZ1A 2OTLS 4RW9A 3QW3A 1Q8AA 1CNVA 2HVEA 5CCLA 1Q6LA 3JTOA 4LF9F 2GGJA 3BSNA 1OCNA 2LEPA 4L61A 2O9RA 2Q02A 1VHFA 5A6JA 4FNQA 2XZTB 3M46A 1KTNA 4QG8A 3U7BA 3WD3A 1QJWA 2CLIA 1UROA 4IOCQ 5AKQA 1UUOA 4N41A 4NZCA 1PCWA 4JTEA 4QJVA 2DIUA 3Q24A 4FOKA 3V35A 4W4MA 4CCDA 4RW7B 2PEBA 2C2EA 1OC7A 1MXSA 4IIHA 4OOZA 4ROPA 1FD8A 3G1AA 1FFRA 1M9HA 3T3FA 3D66A 4PWDA 1XEZA 2ZD1B 5CXTA 3WBWA 1QOPA 4ONVA 2C1EB 4DSJA 3Q0AA 2BGQA 1NJJA 3H4GA 4JXCA 4RW9B 4R9OA 1V5VA 5AHMA 3S2JA 5E3RA 3K1DA 1LFPA 3EXTA 3U5UA 2R7XA 2VDHA 3OQEA 1JB0C 1ISWA 1TQXA 5I09A 3M07A 1T7PA 1RT6A 5FJIA 5ETMA 2DR8A 3MJMA 2NXNA 1KCKA 4JQ1A 4TYAA 4CCHA 3ZVHA 1QVBA 3ANUA 3P61A 1L5UA 3QLHA 3RM8A 3M2UA 3EWYA 3MM6A 3T5KA 4C6JA 4HGXA 1HQUA 1K9DA 3VUPA 3KS6A 2ODOA 2WK2A 1UEKA 4BF5A 3JRKA 1LOQA 4S23A 3G8QA 3TKFA 2XPKA 3ARTA 1KWGA 3V6JA 2ZH2A 4GH3A 3RILA 3TQVA 3MHFA 4FXFA 4ZLNA 3H53A 3OL6A 4FSAA 3JZEA 5K4XA 1FNOA 1RHMB 2W7OA 5J2QA 4MJZA 1X4CA 2W66A 2OYKA 1J9YA 1IEIA 3CJ2A 4FLSA 2XMKA 4JI1F 4QR2A 3MXHP 1B70B 4NA1A 4C0OC 4H7CA 2NX1A 2H8XA 3RG6A 2CPYA 1V8EA 1VYAA 3KUMA 1RHCA 1TAUA 1X8DA 1RVKA 4DQQA 5KFOA 1KGWA 3WX8A 4GD0A 3GIQA 1RT6B 4FZVA 4A8MP 4JV1A 4FN5A 3C66A 2CVIA 4UF4A 2PP1A 3ZVHB 2GLKA 3CJ8A 3BPSP 1ZAWA 4W84A 4DWSD 2CQPA 4J9KA 4XDDA 4GZJA 3MM6B 2B56A 4DF4A 5CSRA 2VDGA 1HQUB 3NNAA 5CQ1A 3MMCA 4EYIB 1KFJA 1MNZA 3FJ4A 3P3DA 5IOLA 1J5EJ 1UFLA 5ENLA 2ZWPA 1BQGA 4OBRA 2NLYA 1I75A 3M7WA 1X6UA 3G3DA 3ZLHA 1T9VA 1WKKA 1GQEA 2W8LA 3M05A 3OTDA 2XFWA 2IQTA 4BY3A 2BE9B 5FIPA 2DNZA 3A8EA 4MB3A 1WEYA 1XLKA 5EKYA 3SFWA 1LWFA 1NUEA 2DNNA 2JK2A 3HGOA 1V4YA 2DHAA 3MI7X 3W70A 4ZO9A 4DLGA 1NOFA 3DRXA 3GIPA 3AC0A 4ORIA 5E70A 3N14A 3MR6A 1Y8BA 1H3DA 4IJRA 5LXEA 3KVJA 4BI5A 2DW6A 4LY8A 4AQYJ 4DO7A 3O0KA 3MU7A 1V3IA 2ZTKA 3DXBA 1RCXB 3VGHA 4ADSA 2D2GA 3MSRA 3MMCB 4CLKA 3UN5A 1CWYA 4DV4J 4LSBA 5L1LA 4ZIWA 4G9PA 2PODA 3VZHA 2QMJA 4TO8A 1VK8A 4EPBC 5B7YA 1HJUA 4UFLA 2PDKA 1JGIA 1VLOA 2CZ5A 1PBAA 3DFQA 4R85A 2L48A 3PW7A 1Z1ZA 4JTAA 2RD5C 1RP9A 4CQ8A 4C4WA 4A35A 1AQHA 2M70A 4CLUA 3MAAB 2L9DA 3W2LA 2VELA 3O16A 1V3JA 3VHQA 3B8TA 3FMWA 4MSSA 1SQFA 4X2PA 1NPRA 2F9RA 4CLMA 4IH7A 5KT5A 3ARYA 3U2CA 1EH9A 3PFMA 3PSWA 1Q0NA 3NL0A 2C2NA 1XRVA 1J8VA 3R4IA 1OK4A 2QFJA 1JZ4A 2QLWA 5LA2A 2YQ0A 1LORA 2QUTA 1WKYA 3KBNA 1FF2A 1OFQA 1RWUA 2DY9A 3SCQA 3WH7A 2DGOA 4F3OA 1TL1A 4KWOA 7TIMA 3W5XA 3UA3A 2HNYA 5CG7A 4AVFA 5DBTA 3SI9A 3N2TA 2DXEA 2DY3A 1W1TA 3DHDA 1E4NA 3CU2A 4QIUA 1LL7A 2V5KA 1JLGA 3LZ5A 1LUCA 1UJQA 1SC6A 1IKVA 5DT5A 4BK9A 2E6AA 3W66A 2Q8XA 3V4IB 1PKNA 3EAUA 4JHMA 4Z1CA 1YSJA 3UW6A 1X38A 4X22A 1AL8A 2QPSA 1E43A 3AAMA 4WHBA 2OMLA 5IQQA 4LANA 1OIMA 3P8JA 3CCWA 3DGPA 3H12A 3AQOA 2CAJA 2QG9B 4J9SA 4O16A 1V3HA 4GIRA 3GV8B 5E6ZA 3KLEB 3WDRA 3B0YA 1CYGA 2YKPA 4QYRA 4LYQA 1RT4A 1C1CA 2AL1A 1UOZA 4QWCA 3O0FA 5CSUA 1HP5A 3ITCA 4M1BA 2HVOA 2BVYA 4AZCA 1HWIA 3MUTP 3LGDA 3EX1A 3AU6A 3R25A 1SJ4P 3F2DA 3UCGA 4AQYF 1J0IA 2PC4A 1JUBA 3QZEA 1MN7A 5D0RA 2XM1A 3BLKA 4OHQA 1FRJA 4RW6A 2CADA 1JGMA 5CYMA 1WCGA 1SFSA 4QSFA 3CEDA 1JLGB 3MR3A 2ZZ3A 1HN1A 3RX4A 1UR9A 1LUCB 3RLVA 4BF9A 1VQ6S 1IKVB 2I38A 4DV4F 4M6UA 4FBTA 3WQCA 1DIEA 2HBZB 3THVA 1TR9A 3W9IA 5M2FX 1QAJA 3PFOA 2MKYA 7ENLA 1S4FA 4XZMX 5G5IA 2OSYA 3IARA 3S5YA 5BCAA 5HMFA 2E5LF 5D09A 3DGPB 2AYBA 1VRDA 5DMMA 1CJKB 3JUGA 5LL6d 1F9FA 4LU0A 3KXQA 1US0A 4GUFA 2EK1A 2P88A 4H4OA 1BFNA 2B8PA 2L5HA 2DRDA 2ZBPA 1RT4B 1C1CB 1MN9A 4NCAA 1E55A 4R7WA 4WY0A 5EA9A 3WIVA 4DQSA 4AZCB 1PAMA 2Q09A 1IYXA 4DFMA 5DDQC 2J75A 2PDJA 3URQA 3CIVA 4M5IA 1UR0A 1CULA 4IX0A 3FKBA 4PUOA 1SFTA 1ONXA 3T07A 4L1WA 4JX5A 4X9SA 1RA6A 4RW6B 3CCRS 5CH7B 2EF9A 4CM0A 3EDJA 4K4VA 1TTPA 4IX2A 1E3ZA 2GSEA 1LW2A 1X5OA 1YDLA 3FBCA 4NZ5A 1ZETA 1PXGA 4RUAA 1S38A 1XLHA 2PLCA 4MT1A 5BXIA 3L7UA 1F5CA 2EG6A 1VGYA 2PIIA 3RYLA 5HWMA 5CEWA 4B2DD 3C16A 4CI0B 2WBGA 3A4JA 3H98A 4NJJA 4B5SA 1S9FA 3W85A 2BNJA 4B5XA 3E38A 1JIBA 4C7QA 1QHZA 1ZALA 3CJQA 4QQ3A 3LU2A 1I8JA 1V02E 1K6AA 2ZBQA 4F2TA 3PYEA 3G1RA 4UUWA 3MHUA 1BLIA 2CQCA 2YPYA 1LQ0A 2MLZA 1XNQJ 2Y0BB 3C0QA 4XG1A 1W7WA 3IK4A 3EYPA 4DBSA 1S0MA 2PURA 3SCNA 1OQ6A 2WVBA 5U47A 3GO2A 3STPA 2WTFA 1W54A 2H9AA 3PSVA 1CULB 1U6ZA 3DKDA 3NPWA 5HNNA 1C91A 4L1XA 1LW2B 3IRDA 4H9XA 3I65A 3LCGA 1C4CA 5L1JA 2R94A 4ZVEA 4Q0BA 5DMNA 3LN3A 3W6YA 2PC8A 2DZXA 4Q32A 4IF2A 2R2RA 1TSIA 4J5OA 4DZAA 3M5YA 1YK9A 3C16B 1LTDA 1BXNA 4U4MA 3FA4A 4WK1A 2D0FA 2VH7A 5ETLA 2TMDA 2JEGA 3TP4A 3CUZA 1CXEA 2DSZA 3N11A 2RFGA 4F2UA 5MAOA 1TTQA 2QF7A 4KBIA 3VR1A 1EOKA 1ECQA 4D1IA 2VFRA 3VC6A 2KVIA 3OXGA 2LKZA 1B3WA 1W17A 2WSYA 3I4KA 4MFBA 3EB3A 4XK8C 4DF8A 4EPKA 6CGTA 1RHKB 1M03A 2AMGA 4GNVA 2PMQA 4KC5A 2MLYA 4H83A 3L3CA 1HTIA 1VEOA 4K7QA 2W92A 5KETA 1N55A 3PZPA 3WQVA 3P0WA 1P0BA 3OHIA 2YWEA 3Q22A 1I5OB 4U10A 2VONA 4LB3A 4ZS6A 3BVJA 4QS5A 2IBOA 2VB6A 1V0NA 3BSCA 1FY6A 4RU9A 4BS2A 3LHYA 4Q0BB 3E5BA 3N1AA 3EOSA 4HHPA 3TX0A 4CLWA 1BQNA 4WXYA 3CC2S 5KOWA 4E8DA 4PABA 3OQ8A 2LQBA 1W56A 2OTDA 2V0TA 3QRRA 3R5GA 3SECA 3UZZA 1JNDA 3H26A 4BHYA 3S9IA 2WANA 3UXAA 3UN2A 4D6DA 1DJWA 3RFAA 1G4SA 3CZKA 3ISND 5C5JA 1Y3KA 4DLEA 3NXZA 2R1NA 1G4CA 4BI7A 1LWEA 1GEHA 1VRQC 1OSEA 4EVZA 3ZTPA 2R9LA 1J01A 2I57A 3W27A 4MIMA 2OQLA 5E5CA 2F7VA 1L3VA 4ZPTR 5JXSA 3IANA 4UQBA 3R5DA 4KH0B 4D6HA 5XIMA 2E5BA 4EE9A 4A8SA 2IPGA 2ZNZA 2BHZA 3H2CA 2GJRA 4MFBB 3NBPA 3HXMA 1T8EA 4RE3A 5C6MA 5RUBA 2GGPA 5BOOA 4NLWA 2BW2A 4KQZA 1QAPA 4CM2A 1GORA 2AT1B 3IVSA 3R11A 3B4DA 3VF0B 4KT0C 4B9NA 3LB0A 3VAFA 4DBUA 2WOMA 4EU0A 1UA3A 3LHWA 4QE4A 5G1TA 3N79A 1ZBTA 2O9OA 6AT1B 1KKOA 3WQEA 2FH8A 4JY9A 4U8YA 2EBEA 3DGRA 4KRZA 1Z41A 5A8QA 2J79A 3C3NA 2HBRB 3PN8A 4AIUA 4MK9A 1GXLA 1MO0A 4DB7A 2H4YB 3UD6A 1BD6A 3OVBA 2HZGA 3HFYA 2J0QD 4JQ2A 5HP1A 3DC8A 3D3FA 2XMTA 3KRBA 4AL6A 4CO0A 2Q6CA 3NBPB 4LF5J 4IMAA 5DF0A 5C9WA 4QJ5B 4GIAA 3ECQA 2GGPB 3LV6A 5IFTA 3KRUA 1U48A 3APGA 2F40A 5A6TC 3P6LA 3JSYA 3M8PA 3PJTA 4QDWA 4DLMA 3DUGA 3NFUA 4Y00A 5AYIA 2XN1A 3VDHA 2F8MA 3BL3A 3WLRA 2NXUA 2YA2A 1FXPA 1GWJA 2GZXA 3UD5A 4ZP7A 3WBXA 1RU1A 1WHVA 5L9NA 5AB3A 3W7DA 2HNHA 5BMWA 2GJNA 3S47A 4HMEA 3I3BA 2RDUA 3HGJA 3PZNA 3T7VA 1WAUA 2ZXBA 4DFPA 2FVQA 1E40A 4A8IA 1TJ1A 2LXFA 1N8IA 1Q5YA 2WWDA 2FLLA 2ATLA 4J90A 3NM3A 2F6KA 5C25A 4EBCA 1U1RA 4O3PA 3CZLA 4FMVA 2NZ4A 4AU0A 4LUIA 3S5NA 1WOSA 2LXIA 2YKOA 2J76E 5DGAA 4NZ0A 2MMYA 4IFYA 3U1NA 1DTUA 2IJRA 3DDIA 5D9MA 2X1BA 1GCYA 3NUKA 2J9DE 4USJC 4AZIA 4P7VA 4S3AA 3FVYA 3NL3A 3QR1A 3RU8X 3PFEA 2KO1A 4A8QA 3M8PB 1AG1O 1DHPA 3VD5A 4ZPBA 2G8ZA 3NGKA 1Q7YT 1QI4A 1XC9A 4FXSA 4HNLA 4Z2GA 1MW2A 3HFVA 3OR2A 2QVHA 2J13A 1U33A 1O6XA 3QHMA 4DN9A 3W8PA 1T40A 1FWCC 2I16A 4XSLA 3TTYA 3TWBA 2WQDA 1TK5A 1QOQA 1NSPA 1JPMA 4R8UB 1IWPA 3T6CA 1H1ZA 2OZ3A 5DX7A 3A3XA 3JB9k 3LSCA 1E72M 3P14A 3BGFA 2CQ0A 5C25B 1NKCA 3SW6A 5IM0A 1TG7A 2XIOA 1TTHB 2NS1B 3I32A 4DM1A 3CIMA 2ROEA 3AFGA 4PPDA 3OJUA 2B4GA 2FJKA 2GK1B 4O10A 2M3DA 2E8ZA 2CPJA 4IFYB 4UT4A 2EPIA 1JNEA 2GJ2A 4TYBA 3M2RB 4HH1A 5DMYA 2ZDRA 4K8RA 5K8OA 4EX4A 4NEYA 2ZH1A 3BDEA 1M5PC 4XBSA 4LEFA 1F3TA 4DOZA 5I79A 4PQAA 3W2WB 1T95A 3CMGA 2O92A 3WH8A 4FNHA 1R9YA 5HMDA 5C7VA 1MYRA 1NWUA 1LT8A 2FJBB 1SYTA 2A3BA 2XSAA 3AI0A 5EWEA 5FESA 1JXVA 3IR7B 1N33F 1YRTA 2IA6A 2B8QA 3DZ1A 4NA2A 4XZWA 2OKOA 4PRTA 3PVXA 3NEHA 3OSPA 2OKQA 3HU7A 4WDXA 5FJTA 1ISXA 5K9CA 4DI8A 3KCOA 1M65A 2CYYA 2G3NA 5HINA 3O1LA 3WC0A 2MKKA 5IM0B 3Q86A 4AE5A 2XM3A 2X0SA 2CA9A 1C8VA 2PPGA 1NFBA 2Q8LA 2EXUA 2G0WA 2BG5A 3L65A 5DANA 4UMAA 4Q22A 4L65A 5ETSA 5HUOA 1KWKA 1HX0A 3VAMA 3R13A 1K8YA 1NP0A 1NMEB 4HOWA 3H7VA 1TJ0A 2JGYA 1R87A 4C1LA 5SUHA 3TE9A 2FC8A 2PU0A 1ZAIA 2VIHA 2JIEA 3E9AA 2OO6A 3G6MA 5HNTA 3KTSA 3OO2A 4GC6A 2G95A 1N8WA 4JL1A 4ENOA 3WDPP 4IDKA 2NV1A 2IM0A 3WJXA 1XD1A 1BQMA 1UW4A 2ZVRA 2C2OB 1KBLA 2ZH3A 3CAWA 5LSMA 4OI1A 3VUSA 2MQMA 2SFPA 2BM0A 3SRDA 3F2CA 4O1BA 1EKRA 4AVNA 4LBSA 5LIUX 1ZPVA 1WQ5A 1ZZFA 5KG7A 3FRYA 1JPKA 4TX9A 4LT9A 2FGLA 3J80Y 3A9BA 4WK9A 3N4EA 3UESA 3E51A 4XSMA 1PIIA 1VFOA 5A8PA 3UNGC 5CZKA 4ZVQB 1EDQA 3E2SA 4TUFA 3I6RA 5KSWA 3EGZA 4DXXA 3BMVA 4ZTYA 3DHFA 4KEZA 4H6QA 1S2AA 4QJ1A 5KFXA 1QSYA 3D0HE 3OHBA 4HMCA 2JEJA 3W3OA 1QTNB 3QHNA 2DY1A 2MJNA 2V5LA 1U1HA 3XINA 4KCWA 4JPGA 4P9SA 4HA4A 1V0MA 4N9BA 2IDEA 2DZPA 3DLEA 3D6MB 2C71A 5L9XA 4OUEA 1UMYA 3L7OA 1TTIA 1QSSA 2I0XA 4OQVA 1NH8A 3N13A 4Q8UA 4JIQA 1PO9A 2CHNA 3K8VA 4JNZA 4XZIA 5GAGU 1MWYA 4BQ3A 1FEEA 3QQCD 5KT4A 3MP4A 2DNPA 5C54A 4DR6J 4CZCA 1N48A 3TO8A 3AJ7A 4EBEA 4DNHA 1B0PA 2WNWA 3MM7A 5CZXA 1E6PA 3SURA 1E6VA 8RUCA 4I7FA 3WQDA 1RAOA 3VOIA 4C11A 2BZ2A 1CJTA 1RACB 1XMBA 5EN1A 5DY2A 2VURA 2UUWA 3T2OA 3LTSA 4M3PA 2JKAA 4EXAA 3SUTA 1J12A 1IT0A 3C86A 4AAJA 3PPCA 2KM8C 2WKLA 3J7YI 2C42A 3DLEB 2NVDA 2VC6A 1FWWA 4IPJA 1WOOA 2P3EA 1G67A 1Q6OA 4E3VA 4LJMA 7AT1B 4W5ZA 3WLSA 4AUBA 5KFKA 4K4SA 4FLRA 5CC3A 1FKAF 2RKXA 1KLMA 3ME3A 1YX2A 2WVTA 2N4CA 4CNYA 2NVAA 2HG4A 1UKTA 4AVOA 5A8RA 1S1WA 2VM8A 4UUIA 3ZFHA 3N73A 4O0ZA 1W1B1 4GVFA 2CPZA 1R85A 4V27A 2IC3A 5C42A 1Q5VA 2CJXB 1QDUB 1JI2A 1F1BB 4J35A 2F7FA 1E6VB 4HMNA 3OGVA 5GNZA 5E9XA 2OSRA 1CS4B 4I7FB 3OFGA 2DDXA 2JEPA 4AY7A 4JTCA 2J7EA 3HM9A 2GJXB 4RBUA 4UNIA 4FNUA 4RUHA 4GZIA 5CZVA 1JJCB 4LV9A 2GJLA 1Q6EA 1KO0A 4W86A 2KJVA 3WQPA 4GUIA 1VLYA 2OYLA 2QJGA 2EG2A 3US5A 1RJQA 2C6QA 1UR4A 5LMUF 3LP1A 5KFCA 2PAJA 1A6LA 4OLPA 3SAZA 3U0HA 2LLEA 2YCJA 5LJ3Y 2XCPA 1KLMB 1SGJA 1F9CA 2IKGA 1G2EA 2PWEA 1YTEA 1RT1A 3CV2A 1S1WB 3H7RA 4F0KA 3QOKA 4LH8A 1MFVA 2IC3B 2J8FA 5C42B 1Z44A 3GBEA 4TU7A 1YYAA 1I2PA 3QMQA 3CCVS 5DN1A 2O9PA 3ETOA 1Y5XA 2PWVA 3LERA 5AXKA 5KT3A 3DN9A 2FVKA 1SQGA 2B4UA 1Z32X 5LJ5Y 4DR6F 1QASA 1KLYA 4M6QA 1D2KA 4DJDC 5DO8A 3CHCA 4I6AA 3CK5A 3PRBA 2VC5A 2JWNA 4Z7YA 1Q63A 2PDQA 2ZRVA 3R3TA 4KF1A 4JTKA 3LP1B 4IQLA 4J3TA 4DR5F 3OTEA 2NX3A 4ALZA 3B8SA 2DNOA 1X4GA 3EWWA 1X0FA 2CJKA 2NR0A 5BYSA 3FSIA 4ID8A 1VRUB 1JCNA 3QZ8A 1JL8A 3MZNA 2XH7A 5CJNA 1UD8A 1RT1B 4M29A 2WCGA 4QTGA 2Z25A 3EDDA 4PYSA 2WPBA 3AA9A 2ZJPQ 2DUXA 2W1BA 1L6SA 4V28A 2FHOB 4DNMA 4G8TA 2X3DA 4GVIA 6PTDA 3G1YA 2CPXA 4P74A 4AD1A 4RWXA 4ED8A 4Y2CA 2FJWA 2VFDA 3DERA 2FHBA 2N7CA 1HKJA 1EETB 2HGMA 1WB0A 3T55A 5LT5A 4POCA 1V08A 2AD9A 2WWCA 2TODA 4HHHA 3G86A 4C5ZA 4ECLA 1R3QA 4KGMA 1TV4A 2XZWA 1RCOB 2IAJA 3CTRA 3KVLA 4YU1A 3AHTA 1XBZA 4DJED 3PNIA 2B81A 2D41A 4I56A 4MPQA 1LFWA 1EJVC 2PGWA 3PUEA 5EB8A 3THAA 5CBIA 1S1PA 1LLWA 1JYVA 4J9LA 2DH7A 5AHEA 1GEQA 3K8MA 3N9UC 2DIJA 3D5HA 4ED3A 4GZEA 1SKRA 2UXDF 1UC5A 2FZNA 2C28A 3WNLA 2VQFJ 3FCPA 4PG6A 1IXPA 3I3EA 1QCWA 5EBUA 4NXNJ 2O55A 3ISIX 2V9KA 1KXTA 5BU9A 3G6XA 3GHSA 1KTQA 1KA9F 2UV8A 4FKXA 3PVFA 1E0VA 4XD5A 4GK8A 5CAHA 4C0BA 4XD4A 1NSQA 4OYMA 4DWDA 3TQKA 4AX6A 2QL9B 1MMLA 1VC4A 3QHOA 3FX4A 1WG5A 1O94A 3TCEA 1NU4A 1QWKA 1P27B 1GJUA 5CHCB 4LUTA 4ZFCA 4ZOAA 5B09A 3R0KA 3SRFA 3OGSA 4JYEA 3LK6A 2ZUGA 3T44A 4N6FA 4Q43A 1AUSL 1UG6A 4WP9A 5A8MA 1BG9A 1BKSA 3BAJA 1HNIA 2B7PA 5L38A 4FKYA 3DU5A 1DJYA 1CGUA 2I1OA 2COLA 1JZ2A 1PJ5A 3SFKA 1TA3A 1E71M 4LRTA 4HNVA 3ABOA 3FDSA 1C9WA 1P6WA 4KY3A 4LX4A 3RRGA 4MFDA 4O19A 2FDMA 5FLXY 2Z57B 2YDSA 2WKJA 2DGAA 4B4HA 1K44A 3FEXB 4UFJA 3L21A 2HPIA 4AEEA 1A0OB 2ZXDA 1S2TA 1XP3A 3MV01 1YBAA 3UCQA 4MKVA 3DYAB 3RB3A 3SIMA 1U5JA 2D2JA 1SUXA 5T9BG 3BUVA 3ITOA 1HQEA 3ZO7A 4ZJQA 2XU2A 3EWDA 3BG5A 2R82A 3RUBL 4Q8FA 3OVQA 4ERGA 1XLBA 2QCMA 4JZ5A 1YRUA 2HZCA 1U22A 3TSBA 3LPOA 2W6RA 3I9V9 3KLLA 3RRKA 5T14A 4LUTB 4ZVFA 2J0WA 2XULA 1VYPX 5EL1A 2X16A 3CHFA 3CS2A 3QGVA 3VCNA 4R9XA 4E5TA 4ZJOA 4WGXA 5MLCV 4RBVA 4HU4A 1LOUA 3LUTA 1HNIB 5FF7A 2OKTA 1Q4RA 4JQAA 4PUJA 3UWWA 2X1GA 3GVQA 3GB0A 4S3KA 1J5TA 1PYSB 1TA3B 1R3RA 1H7XA 5AHLA 3LCLA 5ECUA 3TLLA 5DRKA 4N8NA 4EWTA 4LJ3A 5ETPA 2AZ3A 4FYWB 1MU2A 1A53A 3PULA 1VFMA 1F3XA 2CPFA 2V4JB 3NSMA 4LUBA 3MCMA 4P2XA 3KS5A 3WMLA 3CMAS 2K06A 2VQFF 4J37A 3SMZA 4JBCA 4ED6A 3UVJA 1JFXA 9ATCB 3R2DJ 1PKMA 2VEPA 3BV4A 1XICA 1WHYA 3QIDA 5GMKa 1XPYA 3E12A 2I14A 4AD0A 1TB3A 3A47A 3IC1A 2FFIA 2DNMA 2H6RA 3S1WA 4ZSTA 2C2ZB 4B5TA 3EPIA 5J04A 4KGJA 1N0VC 2A7NA 4M6VA 3RMEA 1TK0A 1RJJA 2E4TA 2OP5A 3N4WA 5E0KA 5KG3A 3IS4A 1FOBA 1UCNA 1U47A 4H9MA 1R43A 4HHJA 1O5QA 3WENA 1SO6A 2D9PA 3H4WA 1B3XA 2WVCA 3N3TA 3BKFA 2X1IA 1ZJIA 5BWFA 4GRSA 3GNNA 3V75A 3G1SA 4USTA 1M01A 4PCNA 3UFCX 5DEZA 4JOUA 2HPMA 4H54A 1Q2RA 1VYSX 4CNZA 3DHWC 2ISVA 3PUDA 1CXLA 4PULA 3M4HA 1KS2A 3IJIA 3OW1A 4QE1A 5F8HA 4IL0A 3VDCA 2FVMA 3AYSA 3G87A 3GDBA 2V69A 4CUCA 1ICQA 3H6OA 4G56A 2POZA 2QULA 3B3DA 4D6JA 1I94J 2Z4GA 2KRRA 3ARUA 3AXIA 2E9TA 2R7RA 1UB3A 3VZYA 4BZYA 2J8SA 3B0VC 5MKGB 1I1GA 5I7GA 4CH0S 4DHVA 1I2NA 3QOMA 3V6KA 4ED0A 1E9ZB 1UPPA 4HPHA 5C9XA 4LRBA 3A4AA 4UW2A 4P7LA 5DGBA 3CWOX 3GDLA 3NVTA 4W7WA 5J2MB 2Z2LA 1G7UA 1B57A 2DT1A 5B0GA 1G9HA 3RMJA 1PC4A 4GKTA 1VH7A 4O3SA 3MI2A 5F2IA 1IEQA 2MZJA 1XG4A 2UY3A 2P2CB 5A2BA 4MB4A 1W26A 4O3OA 1RTHA 3BBFA 5IXUA 2OLSA 5G2IA 3EJMA 3IS9A 1PPIA 2Y1RI 2E67A 2PB1A 3QMTA 4ITSA 3VNYA 3ZFVA 2YCLB 1RTDA 3MBDA 1VRXA 4NU7A 2EGZA 1IT8A 1V6VA 1QE1B 2IY5B 4JR5A 5FD0A 4FP1A 4UZBA 1QNVA 4N4PA 1CLXA 4NLPA 3D47A 3R12A 4IR1A 2Z26A 5LGZA 4LRCA 1A3HA 3CT2A 6ALDA 5E3QA 4QR1A 2IM2A 2YW4A 3TN4A 4HVZA 4ZTXA 3I56S 1S9GB 1IT7A 4H04A 2XEXA 3OBIA 4FOJA 1H0HB 2EG1A 2ZA1A 3W2KA 1CI1A 3AXKA 4H9VA 2NQ9A 3NSNA 2F6XA 4R53A 4O23A 5HQLA 3G96A 3KG1A 3C61A 1R2RA 2FJEB 4UR7A 4AWEA 4FF3A 1WEXA 2ASJA 4A05A 1UIOA 1S1XA 4DL2A 2HSAA 1OFBA 4RUBA 1OSDA 3EZ5A 2B9YA 3S2MA 2HHWA 3OLIA 2J9EA 1RTHB 4NLUA 1DP0A 3KBJA 2YR1A 2ERRA 3VMNA 5EDWA 1H62A 3IS9B 4F0LA 2R2TA 1FCUA 3FK4A 1YWXA 3SJ3A 3UFYA 2J27A 2OSQA 3QPEA 4CWBA 3FFIA 1DIOA 4LQ3A 4DBQA 1XCWA 3IJ8A 2FLIA 2Y88A 5BXSA 3SI8A 2JIWA 2PDLA 5DXXA 4QCFA 2NSOA 4GJIA 3BWWA 3UWQA 3IG1B 3LAMA 3L68A 3M9NB 1H7RA 2H1YA 2QMKA 3URAA 3NEVA 3ABQA 3V1HA 1OD0A 3KUGA 4PQUA 1V6TA 5AC8A 4KHPJ 2QC3A 1B90A 3LGEA 4QPTA 1N0UA 1JVNA 1B3ZA 4Q7IA 1WHXA 1CW2A 1ZJHA 3SN1A 3SM0A 1I94F 3G5EA 3UJRA 1XIFA 4DZDA 1GVEA 3CAQA 4ADTA 1S1XB 3V81A 2PF0A 1TFYA 1TV3A 4ICMA 1R3NA 2HNDA 2XTJP 1UOKA 3C15A 4YEAA 1JXKA 1TKKA 1G7CB 2HK0A 3VCDA 1WG4A 2E77A 4WUIA 4IG2A 1LQ9A 3S8SA 5LNVA 4PN2A 3PM9A 1ITPA 2YB1A 4DJFD 3R58A 4IIBA 4OKDA 5D0HA 4AZ6A 2EPOA 1UC4A 4IP5A 1EWDA 2YIHA 2R4FA 3CQKA 2CJBA 4OZ2A 1PHQA 4U2ZA 2OX4A 1UEUA 1D1UA 2ZVSA 3IFEA 4L64A 4RV3A 3IIXA 4L4PA 1XD0A 2Q3RA 4XZBA 4KBXA 3SQGB 2ACRA 1KRMA 1HBOA 2DO4A 4E4PA 4A4AA 3KJQB 5FSEC 4FYXB 4ZIVA 4PQUB 4E2OA 1G94A 4TVAB 5SZTA 3GW3A 4X65F 3WK0A 2GPTA 3CNYA 4KKXA 4ES4A 4K38A 3GUGA 2OLAA 1V6XA 4OZOA 2ZX9A 1VFSA 1YDOA 2VD8A 3AOCA 4URQU 3P62A 4ZJLA 2PS2A 4R5EA 2BSLA 3IAQA 3V81B 2CITA 1WOPA 4DV6F 3M0IA 4X4OA 4TXSA 3JR2A 3N9KA 3WF3A 4WYLA 3MR5A 1OX4B 1EBHA 3NSXA 4Y28C 4RNNA 5AC5A 3REQA 1X9WA 1LRNA 4Q2MA 5F1UA 3BJFA 1NZ8A 4ZLPA 4UQAA 3R5JB 2HEJA 4JYAJ 5CCZA 2V3GA 2R8HA 3LRKA 3G71S 3ENAA 2X51A 4ER8A 5D2XA 4KGZB 2HW3A 3PKMA 4NRSA 1UWAA 2JOQA 1W25A 3EB4A 1EJ7L 1B0IA 1HBOB 3EA1A 3GVVA 4X66J 2UXCF 4ERDA 3QSYB 2D3OR 1BC6A 3MPDA 3DG7A 3E6EA 3WDQA 1HBMB 1S2UA 3TAKA 4GJJA 3D1QA 4XAKA 1SKSA 1ME8A 2CRLA 2D3UA 3IWPA 3AB2B 4W85A 2W3ZA 1Q65A 3EEZA 4YUDA 1V0KA 1LXNA 3FAWA 3L4YA 3V4MA 4JTGA 3ZS4A 1PVNA 3DHPA 3GU1A 1T3NA 3ZXWA 1DL3A 2QJIA 3MA8A 3QIPB 4DMZA 3E5PA 3ARPA 4KHPF 3WFLA 4URSA 4DPOA 3REQB 1AROP 3D9BA 1M1KT 5C9ZA 4LVBA 5I3UB 4RX6A 3W28A 3KK2A 3ABSA 4RE2A 1K70A 1FWIC 2YQ3A 3W1TA 4OZ5A 1OYDA 4H9YA 4JKLA 3J81U 4MUPA 2NXEA 2U1AA 5H9EK 5LNWA 3P80A 3M47A 3QRQA 3EICA 1P6BA 4CQBA 3VGEA 2XQCA 4I6YA 2Y0FA 1ZTTA 4B3SJ 4GVLA 3UWTA 2VD9A 1AT1B 4WVXA 2GVZA 4U6PA 1ZUAX 3SN4A 1EA0A 1Y00A 3BC9A 3H4DA 1KM5A 1TJ2A 1VCFA 3W86A 5C2GA 3POTA 4NYOA 3VAIA 3ITGA 1WC3A 4C60A 1HXJA 4FLOA 2ZITA 3OSNA 4J3SA 3V1PA 3FDGA 3TK7A 2ZZ6A 1S2CA 1MMNA 4HMDA 1NPPA 2E9LA 5JVGQ 3M7VA 1W1PA 3TW6A 3Q2SC 1E15A 4WFNQ 3TIMA 2Z2BA 3MOJB 1AA1B 4OE7A 3HHDA 1CGXA 4W8LA 3CPWR 1WC1A 2BZNA 1E4IA 2H5JB 1JCMP 5H8UA 1ITUA 3QQ0A 3R1HA 3S2LA 1H09A 1N88A 5KMYA 2AL2A 2KXNB 2P76A 4J5NA 5I06A 3W7JA 3KK2B 2XZ7A 2R14A 3MYOA 2W91A 2WBMA 1YE6A 3IV8A 1UJ6A 2GWNA 2PC6A 3LGNA 4DSFA 2DK2A 4Z1BA 3C2PA 4NSBA 3K89A 1X97A 3SXLA 4DN0A 1ZBVA 2YYTA 4JN7A 4L56A 3TNOA 2ZWOA 2GVZB 3P6YC 1C0UB 2N3OA 3WLPA 1OHLA 1U1QA 2QPUA 1U1OA 4UMBA 4E2VA 2DZBA 3TDFA 4E4FA 3NAHA 4N4QA 4WK3A 4JYAF 2QQ6A 3GTHA 4AXKA 2PP3A 4OVXA 4N56A 3JYTA 1F60B 4JTDA 3URNA 4DWSC 1PX8A 1P4CA 5EMYA 3NL2A 1IBKJ 4X62J 3WLHA 2L41A 4X66F 2NT1A 3CDBA 2GX8A 2G1HA 1UVKA 1REVA 4QP0A 2VFTA 5HUPA 1CEZA 3NA8A 1CT5A 3C2FA 3W84A 1XINA 3HSZA 1R3WA 3OFEA 4XTTA 3KHRA 2CFXA 1T9XA 4CRJA 2OPQB 1YJRA 3AIVA 2GJIA 3BAWA 3TYEA 1EQMA 4FP9A 5REQB 2J7HA 3M7SA 3GRIA 4MDPA 4XUYA 1SIZA 1DHMA 4CLPA 1TPB1 1A5KC 1JYXA 2CIPA 3KKFA 4KIRA 4AW7A 3F4CA 3C8YA 3SEOA 4J3UA 3A1YG 5TIMA 4F2BA 3QT7A 4N7TA 1V3ZA 3CCTA 1GVFA 1EJSC 3BSAA 4IG3A 2OO0A 4RKUC 4HJFA 1AXQA 4LBPA 4J9VA 1BWEA 3R6IA 4ZB0A 5CAKA 3SGZA 3QFEA 2HQFA 1VQPS 4R27A 2CQIA 4YMZA 1H3GA 3JYTB 4ENLA 3SIZA 4YTTA 4Z1DA 3F5KA 4NJGA 5LNRA 2A2IA 4LRDA 2UY2A 1WOAA 3FEZA 1L3KA 4HKPA 4OZLA 2IPOB 2JZ5A 1UQZA 3VGSA 3W88A 1E5JA 5C9UA 1REVB 3L0GA 2I5GA 4DI9A 1NDCA 1KR0A 3UD3P 4HHMA 4DV7J 1SPQA 4LF2A 2FGOA 1U1UA 3N6HA 2E5IA 1GKRA 1DYSA 1EUAA 2PDYA 5HPCA 4PB5A 1KQZA 3I55S 2Y5SA 1CCWB 1XQKA 1LM1A 3FA3A 3TEGA 3OJGA 5HATA 4KFBB 3PO5A 4TX6A 1ZBWA 3GNDA 4IMCA 2IRXA 3NOYA 4J9MA 4IG3B 3LMZA 5BNKA 1J18A 1AZ2A 1NRKA 2XS2A 1PHWA 2HHSA 4PUMA 2AWZA 2DEIA 4RW8A 1J6PA 4K8GA 4IR9A 2ASYA 1BF2A 2WVVA 5HBMA 1HVXA 3ZNUA 2ZCGA 3RBXA 4NLXA 2OD4A 3EDEA 3A8KA 3H7UA 3A3OB 2C3PA 3NURA 1VMBA 3STCA 3VKKA 2BM1A 2J88A 4KGLA 4A6GA 3T8LA 4ECXA 3Q8RB 3I31A 5CZTA 3RO8A 5K9FA 3BLPX 3FSTA 4AEFA 5IV3A 4X62F 3N19B 1NM2A 3QRPA 3T09A 1IHIA 4GO5X 2RU9A 3VV2B 4B90A 2NV9A 4DAFA 2EVZA 4ZHRA 3FC9A 1YJTA 3OBAA 1TUVA 2N82B 1E1CA 1OVDA 4NLSA 4NL5A 1YADA 1X4EA 1UASA 3MEGA 1Y0EA 2DSWA 3A4TA 3CTTA 4RW8B 3JVAA 4JI6F 4O3NA 1JRBA 4U2YA 5LSRA 1D0EA 1F9EB 3T8QA 4LF8F 2HS8A 1QR7A 1RQEA 2OQYA 3KG4A 2WVVB 1IEXA 1VOMA 4MOZA 2PZNA 1OM0A 2QZRA 1CIUA 2WHLA 1TE1A 4M19A 4CD7A 1GAOA 3TR5A 4WZMA 3U2EA 3ARWA 3I5AA 5IWAJ 4F66A 2MHEA 1OS5A 3F4DA 4IM4A 2WC4A 3A9IA 1RP5A 3O3LA 2NWRA 2WZTA 1WZAA 4AUKA 4MWAA 2DT0A 4DQIA 1QPRA 2B9EA 5BXRA 4E2FB 1ZNNA 1PTAA 2MSTA 3SY8A 2WM0A 4F0SA 3N15A 2D1ZA 4DL0C 2IA0A 5AE1A 4ZR8A 3H5XA 3HHLA 1E1CB 4DV7F 2VF3A 3EDQB 2YWGA 4JTTA 3MEGB 3ZJ8A 4TXEA 3H4XA 3QAEA 4UQGA 4O1CA 1C7TA 4GNJA 4BEUA 2G37A 1KFEA 1EF3A 3R7MA 1XBXA 5T91A 3INPA 2HAFA 3GIYA 4M24A 4O3QA 3LO3A 1KC8T 2QA4S 4NYYA 1SC1B 3KE0A 2A1BA 1FRIA 3EZ4A 3NZPA 4UOQA 1VHCA 4X0NA 1NEYA 1OGSA 4X61A 4OJ1A 3NPVA 3WBYA 5EGRA 3BURA 3DOMA 1CC7A 4DF0A 3HPOA 2HIYA 2WMGA 3G82A 4MWAB 3GNRA 4FF2A 1RAEB 4XB3A 3IJ9A 4L72B 1E70M 2RH9A 4BKNA 2GIRA 1P1MA 1DJZA 1TV7A 3ARVA 4NZ3A 3IPWA 4G1QA 3MPWA 1Q81T 4C0HA 4YNGA 4OI2A 3QW4B 1MW3A 3UZ5A 1LP6A 2C91A 5G0RA 5CZ0A 2DW7A 5EY5A 4C8NA 1B0TA 4MJKA 4ZLLA 4QDMA 2QLFB 2KT2A 1UH2A 4DV3J 1P0KA 2CBUA 2PWGA 3JSRA 4YXGA 2ADBA 4ILMA 2PDAA 4ZP6A 4OWGA 1KRBC 4FF5A 1K1QA 4M81A 2JFKA 2WYSA 1FWGC 4DO5A 4QNWA 4CN6A 2DVTA 3PF3A 2PMWA 3I82A 3F4VA 4NNBA 4OYXA 4AFYA 3R94A 1XYBA 4ECSA 3GUWA 1NK0A 4MYAA 3DOMB 2OGUA 3D4JA 3V0SA 5A8OA 5GAEU 3OVSA 3OQ2A 1ONEA 1BKHA 4BLGA 3G82B 4ICCX 3JQKA 1TX0A 1EIXA 1X4HA 4TQRA 4XKMA 1S6UA 3EVMA 1NKBA 1R3VA 4S39A 5DG9A 3OHMB 2YX0A 1OIAA 4F48A 4LUJA 1APSA 2QDDA 1RWXB 4PBFA 4JY8A 3HFZB 5DZ7A 5IWAF 5DG7A 2Y9HA 1C3FA 1EXPA 1RQBA 1XIMA 1NSJA 2FY1A 2ZRXA 2Z58B 3PJWA 3C0SA 3THQA 3KJVB 3HG2A 5G0RB 3WX7A 2B4VA 2NSCA 3FBEA 4GFIA 5KZDA 4D3GA 2FZ9A 3TARA 5AE2A 4I9JA 3RX3A 3UY7A 4QJ4B 3DHXA 3E0VA 4QR6A 2PMZD 3VNLA 5KAKA 1Z69A 4HD5A 4B92A 3TWZA 1GONA 1GTEA 3OXLA 3P82A 1R6YA 1TQLA 3SDOA 2WZHA 2X1TA 4JDBA 2VUNA 3RB4A 3R8GA 1F6YA 1I60A 1XL9A 4XDCA 4KWVA 3M32A 1BMQB 3IRXA 5K20B 2MHNA 4RDZA 4DX5A 3C52A 4FXRA 3TNVA 1PO6A 1U49A 1OCJA 1DURA 1E5NA 2PWFA 2Y61A 3N2BA 5AY7A 5H91A 1NK5A 2B7BB 4O11A 2R24A 1BWLA 2HCVA 4NLTA 4Q5VA 1AMKA 2OODA 4P2FA 3LBOA 1YTYA 4WR3A 5TF0A 2QGFB 2AJ2A 1HL9A 2PLMA 2HHHJ 5BJRA 1F3EA 2GQQA 4GYJA 2Z0GA 3DI6A 3ISNC 3RBZA 1U1MA 1D9EA 3TJIA 2HS0A 1KGUA 1XDMA 5FD1A 4GMKA 2CLLA 1BQCA 1I6NA 5CQGA 4RW5A 1OT1A 4GPNA 3AOFA 1S10A 3D6HB 1QTWA 1YITS 4RE4A 3A23A 5AVNA 4F4AA 1KQGB 3VIHA 4AHPA 1LBFA 1PKUA 5AC6A 2VVNA 5HK4A 1K0VA 2OZ8A 3MTWA 3M6WA 1K1SA 2ZUSA 2C3UA 3VX0A 1HYSA 4TV6A 4RPFA 4L9YA 4YN3B 5K8NA 3VX1A 1H4PA 3S83A 2YLLA 2WZMA 3W7OA 4F3QA 2CEQA 3AIUA 3IRXB 3TYCA 4IGSA 3VTRA 3QMRA 1RR2A 1IWBA 2F4FA 1VCTA 2OUGA 1OQ3A 1JCYA 4PTMA 1SL0A 1X1OA 1RSCA 4Q6JA 3GB6A 3EWZA 4IMEA 3P5TL 1AQ0A 2ICSA 3HB9A 4CLFA 1VEMA 2QCHA 3A24A 3TVYA 1MMDA 1MWOA 2I9SA 1HNXJ 4PMYA 3QQ1A 1Y0HA 1PKLA 1BVWA 4AZ7A 1KFWA 1EP2A 3AISA 3UEQA 4DO6A 4K3ZA 4JCLA 1X7VA 1FWFC 2XGIA 2DGSA 5D04C 3ICLA 3CC4S 5I42A 4H4MB 1IKWA 1MXDA 2P5VA 4UQDA 2G41A 4C97A 1NO8A 1HYSB 4P72A 2A6LA 5CZJA 2FDNA 1TUWA 1WDQA 5AFDA 2I9UA 4ZN3A 1POKA 3W7RA 3X1LB 1DRZA 3GM8A 3QM3A 2HS4A 1JLBB 2WVDA 1GVRA 1PSDA 1DJ0A 2XNQA 4ALDA 4ZL1A 4BCEA 1EIYB 5FEPA 1UWBB 5DQHA 2E9ZA 3MMTA 1FRLA 4DCPB 2EEXA 4G6VB 1S6PA 2ZRZA 1X4FA 2MZQA 4MZYA 3CCES 4JIEA 3GR8A 4OFCA 1ZP3A 5G4EA 3GNOA 5C24B 4LWWA 3KL0A 3HQNA 1X9SA 2RE1A 3R5CA 4DEFA 3WNPA 3NVDA 2VD3A 3OA3A 2GVGA 5KFRA 4CT9A 2ZDOA 3P81A 4GKKJ 1Y65A 5AHFA 4XZLX 2YX7A 3CMQA 4K36A 3O6QA 4O52A 5DQGA 1AFSA 1KLNA 1Q6FA 1I2RA 2I6WA 3PBYA 2MZ1A 4ES1A 2WMFA 1OZQA 3I0RA 4F4XA 2AIRB 4LVFA 2A2DA 3L9CA 2W63A 1YPIA 1BWKA 4R7OA 3J81j 4AWUA 3LCFA 3UWYA 4YYFA 1FXDA 3THDA 1R6VA 2BVZA 4UY85 3R43A 3EKLA 3UI3A 1PZ2A 2C13A 3ZZOA 2XMWA 2BJ8A 3RLGA 3I5CA 1W5QA 2R8KA 3L5MA 1E0WA 2QA4G 2Z0IA 2VHLA 3AZSA 2ZH6A 2C19A 3K1GA 4QBXA 1ZJAA 3KL5A 4GE8A 2BE2A 4RR5A 3I4PA 2JC1A 4RZ4A 4JTIA 3U6WA 1KBIA 1V6HA 2UUAF 4ML4A 4AF0A 4NLYA 3CEPA 2XS5A 2BXZA 2JLEA 1TTJA 4KGVB 2HGNA 1W1YA 1A5UA 3A8IA 4D6IA 2NQJA 1PJ6A 2A18A 5BXTA 2DR7A 4Q44A 3FYPA 1US3A 2Z1SA 3VIOA 4DZIA 3KVKA 2FIQA 4CKQA 3V5RA 3T9NA 1QO5A 4XD3A 5D2TA 3VD9A 4I8DA 4CQ9A 3I0RB 1ZENA 4D6GA 1ZJBA 4LEQA 3AUJA 2WAQD 1POJA 4MK8A 1Q79A 2YNHA 4C5YA 1UP2A 1ZPWX 1RT5A 4I6WA 1UKQA 4O54A 2DJWA 4FR6A 4ZCWA 4LF4F 2HVNA 4I2PA 1KONA 3W1AA 4S2CA 2OZTA 2CZDA 1KQKA 3ERPA 1VJWA 1GOXA 1CPUA 4UBPC 2OPJA 1XYAA 2ZZMA 3KLIA 4Z2LA 4Q8NA 4JD4A 1LQ2A 2BACA 5I00A 4YLWA 3WQ5A 2BE2B 2F2HA 1Q1KA 4NLRA 2JEIA 3TC6A 2BMBA 3R0UA 4AF0B 4IP4A 1IWGA 2DCUB 2E1AA 3D6FB 5E41A 3R8HA 1T9YA 2Z1XA 3BARA 1FJ7A 1HG3A 3SB0A 1QK0A 1J0JA 4GVGA 3WLMA 5D4LA 3WY1A 3M6DA 3L95X 4CGTA 1F2GA 3RB6A 1DIKA 1TPUA 4U3CA 3UA4A 1EDGA 2Y2WA 5KFGA 3CAKA 3U3HA 1QPKA 4JI4F 3PX0A 4Y8EA 3EX3A 4KFOA 4IRDA 3V5CA 2PBOA 3QY7A 3VZIA 3LCHA 2FJUB 4ZO8A 2YNHB 4WFXA 3WD4A 2WZIA 2BQRA 1KVJA 1RT5B 3ZLFA 4I8YA 3TROA 1VENA 4GKKF 2VEKA 3AIQA 2BV3A 4ZEPA 1M1GA 3M0JA 1GG1A 3QPIA 1KN6A 3HFTA 4UOJA 4F9JA 5ETOA 2ZC1A 3BJTA 3HA1A 3GQCA 1Z42A 4BC9A 4KGKA 1FWSA 3D46A 4JHZA 4F4YA 3KCLA 4OV4A 1XM3A 4QLJA 3NM1A 5I3PA 3M6XA 2GMJA 1UAWA 1RUSA 2ABYA 3TA1A 5GADU 4RL1A 6TIMA 1T7LA 1NSAA 3AH6A 2VFHA 3CUJA 1DKWA 4JTSA 2DNQA 3TV8A 1XH2A 3UVAA 1W9UA 4IQEA 5HMSA 4U96A 3GS6A 2DU2A 3OG3A 3LSBA 2MYFA 1HKWA 1NWSA 1Y4ZB 3UJFA 3HKWA 4DQRA 5E3CA 1YDNA 1KXVA 3OZPA 3W1MA 5A1AA 1A3XA 1H60A 2O67A 2Y3YA 4FOUA 3RU6A 1UR8A 4IGHA 3TH6A 1HI8A 3P5ZA 4QAIA 4I6KA 4LT6A 4PPZA 4R34A 4KV8A 4TY9A 3HPSA 4L73A 1QW7A 4ECQA 2XY6A 4N7QA 3TZWA 3D3AA 1DWAM 1GQKA 1Y5VA 2VC1A 4F4KA 2BEFA 3PM6A 1PX4A 4C6CA 4Q4QA 1EAYC 2DTJA 5KFNA 3O07A 1BHNA 2PTXA 5IS2A 3W25A 1SJBA 2R8JA 1GOOA 2L9WA 4C6KA 1QVFR 4K2SA 3G8EA 3MBFA 4G65A 4ZQMA 3M4XA 2YNIA 4ECRA 1W1VA 3KUHA 1B2YA 4KWSA 3KLGA 3DHUA 1KKHA 4DUVA 4FF4A 3PPHA 2CDRB 2VG7A 4NRRA 2EC2A 2ZZ1A 4MIBA 4AMCA 3OLGA 1GG0A 2MJUA 3M1VA 1R9XA 1UQYA 1OEPA 2JFEX 2QX0A 3N6MA 4ZMGA 2AQWA 1W1IE 3ZM8A 2M88A 2Z8QA 2HBXA 3K58A 4CLTA 2IMOA 1P0DA 4DR2F 2A0NA 4HR2A 2FLNA 5ADZA 1IZJA 2BFGA 3WD1A 5FJJA 5KFYA 4M51A 3IMQJ 4NWBA 3EXCX 3DESA 2XWEA 3PZQA 4IH5A 1RWVB 4DR1J 4DV2J 3K5LA 4US5D 1XN9A 3GG8A 1LXJA 2P9GA 1NK7A 3SCSA 2XNRA 5BR8J 4WLCA 5I0DA 2OU4A 3V3WA 4G7EA 4DR3J 3CUIA 1FWLA 4ZO6A 4E0DA 3LOUA 1W37A 4AC1X 4BWMA 1OCBA 1CGYA 2XVGA 3B9OA 1EHNA 3W7HA 2VG7B 3S3GA 3K8WA 3M1VB 3BDPA 5EMKA 5CLWA 2CUYA 1UKUA 4PYDA 4S38A 3Q58A 1KBRA 1NIUA 4DJDA 2GVDA 1XW8A 3DC0A 3PDNA 1UZ4A 1PZ1A 3PR4A 1UVIA 1O0PA 3W1NA 1ROFA 5F2LA 4HIBA 5LMNJ 4K4WA 2R1MA 3FEMA 4B02A 4F25A 2F4VJ 4NT0A 1SPBP 2WCAA 3KOZA 3EMCA 3A21A 4O1FA 2E6YA 3NGSA 3UY8A 3DLJA 1JCTA 1PAEX 2M4MA 4KPLA 3DFNA 5JIPA 4DY1A 2C3ZA 2WHKA 1HGWA 4GY7A 1EC9A 1GMWA 2QCDA 4G7EB 3I0SA 2FGZA 5T7LB 3QV7A 3ARXA 3SCRA 4IGMA 4I64A 1FP8A 3HV9A 1XSJA 1XSIA 1LWXA 1NDKA 2VJVA 2QEXS 3C14B 4IIEA 2YY3A 5EX0A 1N52B 1MDLA 5KT7A 1WG1A 4JQ4A 2OLWA 2YKMA 4M5KA 4DCJB 3GWQA 4KW2A 4LFAF 3FGCB 3AS0A 4DSEA 1BRLB 2GVDB 2OMOA 1SXLA 1VGAA 1I0BA 1KM6A 3O44A 4WJBA 4M95A 2H9ZA 2UV8G 2EBNA 1UYQA 4JGDA 5KFBA 5D15A 1ULRA 2V81A 2XJ7A 2AX0A 4PCFA 1FERA 4DU8A 3DGBA 5JUVA 5BMXA 3VOFA 3H20A 4GIYA 1PBUA 5HMWA 1CXKA 1CQNA 1C92A 1H74A 2XIBA 4C6BA 1ONRA 1SO4A 3MKVA 4Q7BA 1VHIA 5KFTA 1TV5A 3WQ6A 5H8PA 5CPOA 3SFUA 4UTLA 3I0SB 4K68A 4K0KJ 3VGFA 5IZHA 3EWUA 1IUJA 3UW1A 4EP8C 3IVTA 1TVRA 1UA1A 1I1XA 1K6WA 1W3IA 3AHYA 2VPXB 3VM5A 4FAMA 3RU0A 3HV8A 1WOBA 1TV6A 3TW9A 1R8PA 3AYTA 3VGDA 1MQRA 1VYRA 4UTHA 1K7XA 2YKMB 5KG4A 1SIWB 2FHJA 1N34J 1V93A 4V19X 1L8PA 3MD3A 5DRCA 5A8GA 3RYSA 1OD8A 2CWNA 1QHPA 5CPNA 1OY8A 3UXDA 1M7JA 5BRPA 1ZP4A 2VA2A 1GH8A 1EKOA 1PSCA 2OZ0A 1WKLA 2P9CA 4WPAA 3IIOA 3OR1B 1LG1A 3IBWA 3MURP 4HBKA 2PDNA 2FJAB 4PRFA 4PMDA 4AD2A 2X1SA 2ATSA 4PTWA 3AHPA 4XAFA 4YWIA 1WNOA 3WUFA 2PDMA 2E28A 2OO4A 1IN0A 1IEWA 1WEZA 3KTXA 4Q3MA 1HWUA 1A4LA 1RT2A 2GQAA 4X4RA 4CCCA 3TOPA 5LMNF 2F4VF 1S39A 1TVRB 3B6BA 1XLAA 2NUWA 4CVUA 1TV6B 1JLEB 1M5KC 4PEOA 1FT8A 3CO9A 1JXLA 3M0KA 1IKXA 1W9BM 3AFBA 3EB2A 3GDMA 4XTDA 2RVJA 5KFMA 4PKDB 1K9MT 5GPRA 2QAFA 3Q23A 1XS2A 1L3SA 1FFQA 1M41A 4ORMA 2G1DA 4HU0A 4NVTA 3CVKA 3EDFA 1JRCA 4A8XA 3PAJA 3MECA 1TP7A 3SBFA 4ACZA 3EOEA 4YMEA 4Z2XA 4ZA0A 3OEXA 3AROA 3CT7A 4USUA 4WSJA 3TEVA 3LMYA 2ZYFA 2J8TA 1H63A 1XR5A 2P8BA 1HBUA 2FUG9 1IXQA 4H7VA 4V1XA 4IOBA 1S46A 4WKRA 1KBBA 1WHWA 4OECA 1ZH5A 5M2RA 3CIWA 3ITVA 2IVFB 4CDIA 3EX2A 4MIAA 3TR2A 2CQBA 3PIOQ 4QU6A 3WZ0E 2BS9A 2VTFA 3CD7A 2EXOA 5D8HB 5LZLA 3BW4A 4EO8A 1C8QA 3MMWA 4Y2WA 1QD1A 4MZ1A 1ZB5A 4KCVA 1NJWA 4WF7A 4X4TA 4ICLA 4Y9PA 3IR6B 1PYFA 1R0AB 3O6AA 1EJTC 2NZLA 3CEUA 2ZE3A 3SCKE 3LH2S 1IKXB 4O4GA 3OFFA 3E2EA 2GSJA 4C6NA 1PIEA 4GO7X 4MB5A 4B08A 3UE2A 1HIYA 4K0KF 4AXJA 1ONWA 3MUAA 3MECB 2QIFA 3UZXA 2VZUA 3DRPA 7ODCA 3J81Y 1Q6RA 1EC7A 2UU9J 1J2BA 4HZ7A 2VT0A 5CSYA 2G0JA 1HBUB 3U9IA 3BCFA 3NPUA 3F41A 4RE0A 2BYCA 3P96A 2CHOA 3T4WA 1VBZA 4GYPA 1H5VA 3SQLA 1Z8AA 4YTUA 1ZAVA 2HEKA 3TVKA 3RTVA 3HBLA 1VFFA 2RHSB 3A64A 3TI0A 3NQBA 3R6GB 5A0YA 5GJMA 5A6BD 1M3UA 1MWZA 4Z2HA 1RD6A 4ICLB 2ACUA 3CQJA 1D09B 2XFFA 3VFCA 1IM4A 4F67A 3NQDA 4EACA 7A3HA 1XYFA 3OJSA 4X2BA 3SV3A 3ZZ1A 2VFVA 4O4GB 1Q4WA 2DT3A 3OA5A 4NJIA 1X0PA 3GZAA 2HAIA 4NCGA 3CQIA 2ZA3A 2DXDA 3J7ZT 1GJWA 3H21A 4CNTA 2A3EA 1MZRA 2OPPB 3B54A 2RMLA 1E6YA 3FGVA 4TMCA 4Y2AA 3FZ2A 1QRQA 5D77A 4DS5A 1KTVA 3ZTSA 1WUFA 3H8AA 4WD0A 3NYDA 3T2PA 1WC6A 2ZIDA 1KLZA 4J3WA 4C6LA 6XIAA 2AJFE 2YVSA 1MLAA 4AHQA 4WTYA 1R2TA 1VFUA 2GIFA 2PDCA 1J4EA 5JXQA 2KJWA 4KJIA 2Z1VA 3RPDA 3OL7A 4YDXA 4L5ZA 4QRNA 2V2ZA 1KQFB 4IPIA 2XLKA 2J7WA 1NH6A 1OABA 5A0YB 4GC7A 4IP7A 2AMXA 2JC0A 3PKYA 3FBBA 2V67A 1DIDA 1FDYA 5DDOC 4HNOA 5LOQA 3IRWP 3WUEA 3UBPC 2YCEA 5JBDA 1KR1A 1HMVB 1N6QB 5L9FA 1RT7B 5F0UA 3G0XA 2P5NA 4FX7A 3JSBA 3RBDA 2VC0A 3PX4A 3EX6A 1SW0A 1X5TA 2V2VA 2B6AA 4NCGB 1DWHM 2HVZA 3HCXA 3B8HA 1RLDA 3OT9A 4JIRA 1RP8A 1TL7A 5HLFA 2PDWA 2C7FA 3J7HA 4O1AA 3B82A 2AJQA 1E6YB 3SSSA 2R8IA 1WI8A 5LIKX 2EK6A 2C3OA 4I3GA 3GAKA 4XO6A 1FCAA 1J10A 3NQCA 4DUZJ 2WC3A 1U5HA 2PGEA 2VXNA 3PJ9A 4XX6A 3NWRA 4X84A 2CJQA 3CL7A 3STGA 1M1HA 1XLJA 3N29A 2AMCB 1DBTA 4JIIX 4YTRA 3VXGA 4EPEC 2UU9F 3GJTB 2JHEA 3FYOA 3SSQA 3PANA 3W9HA 3GILA 1JDEA 1S5TA 3NP5A 1W32A 4KO0A 4AL5A 4OX8A 4O50A 1I2OA 2ZE2A 4ZBCA 1NSKL 4MHBA 2MUCA 3PZMA 4HOXA 1T8QA 1SJRA 1TPH1 1VQ8S 2B6AB 3IGVA 1S6QA 3CD0A 2EKYA 4NAFB 3VZZA 2XH2A 3T6BA 4USVA 2J7DA 4IRKA 3CPGA 1EQ0A 1Q86T 3OIHA 2CPIA 4GISA 5AYYA 3GTXA 1CLKA 3ANYA 3L4UA 4RKAA 1F3FA 4KRWA 2FHMA 1A0CA 4PUDA 3GKAA 2PA6A 2UWFA 2F8HA 1F2JA 1F8MA 3TU9A 5JUMA 1OIFA 2OCZA 1U02A 2PDHA 3ONQA 3B06A 4A21A 1SC4B 2I5QA 3H2FA 1N4LA 1T6MA 4M1KA 1W1ZA 1NQ6A 2QLYA 1VFLA 3T19A 3LCXA 2HFNA 4HJWA 5JH1A 4C98A 1E51A 3J80U 3SCIE 4UNKA 3CWHA 3SQMA 3WK2A 4KO0B 4ZQPA 4A2RA 2P6TA 2PT0A 5HBFA 3R5BA 2MQNA 5D2WA 5GMEA 4A3RA 2ZE2B 3TUUA 3QGAC 4FIRA 1E73M 2DZVA 4J9JA 3E8OA 2GWGA 4CLZA 1U2CA 3GSMA 2FPHX 2YNGA 1PWLA 1SZGA 4IG0A 2Y89A 2CW6A 3GZ3A 4GC4A 3KCJA 5C2CA 5ABHA 1FESA 3N4FA 4P52A 1BE4A 4GGBA 1FTXA 2D1CA 3U57A 2NQZA 3MQTA 1L3UA 1CXFA 2FJXA 1U8SA 1LNQA 2QFIA 3MPUB 3T1YF 1N32J 4HP5A 2ZH8A 2ZXAA 2FMOA 3QY8A 1FHTA 1Y5WA 4LUYA 1VJSA 1W0MA 2PO4A 2WSCC 2R2SA 3N6LA 1OYCA 4DX6A 4X64J 3L2LA 2X09A 4JYDA 5HMYA 3NY0A 4EFAC 1W3TA 1NWRA 2DIVA 3JAMY 2A7RA 1GVOA 2DIKA 2XSFA 2HNZB 1NBEB 1B7FA 5JH2A 5KG1A 1DEDA 1XYZA 1HIZA 4K1GA 2RF2B 1IVZA 3MGJA 3QLLA 1F9HA 3O7UA 2E29A 2PSNA 3THUA 2H3DA 1EX8A 3GTFA 4K1WA 3M30A 2CWKA 1ITQA 3N18A 3T1GA 3QT6A 1YXDA 3ZOAA 4QE5A 4C8OA 2E25A 2PRMA 3MM9A 2O7SA 3ZJ7A 1F3VA 4FF7A 3WSUA 4TQTA 4UQTA 3VQTA 4A22A 1EF2A 3QMSA 2CU0A 4HI2A 3UPFA 4YP3A 4TIMA 5D3GA 4OX7A 3GR4A 4NRTA 3ZSSA 1HW6A 3ZZYA 3ZR4A 1ISYA 1EBGA 4XTIA 4I90A 1UUMA 1V3SA 3ZZPA 4HNTA 3SCUA 2PDPA 3VKCA 3ZZUA 1YNPA 2LQJA 3BGJA 4GJ1A 4U9RA 2ZM6F 1A47A 1GOMA 1G0CA 4PR6A 4EWND 1CBKA 3SJNA 1CGWA 2OWCA 1F74A 1NJZA 1LK7A 1TKTA 4L76A 1UVLA 4CEXC 3W2MA 3VPLA 4IUOA 3KOWA 1QU4A 3VTIA 4N0RA 5KFPA 1JPDX 5F8NA 1Q16B 3LS9A 3GWCA 3M30B 4GACA 3AXXA 2XMVA 1S3HA 4EANA 1N82A 1MEIA 4ZP9A 1AW1A 5FJUA 4ZA1A 2VA3A 4Q33A 1YX1A 1OGGA 1RAIB 1OF6A 3A4WA 1M5OC 4HYVA 3WJZA 1XBWA 4DPXA 3GFXA 3B9EA 3BB5A 2FZKB 4NI8A 3AIWA 4A3UA 1FJGJ 1L8NA 4EKJA 4GO8A 3DNCA 4JI5J 2FHFA 1W5PA 3IAM9 2PDIA 3STEA 2YDAA 1NB2A 2R9RA 3ILIA 1NF0A 2O5DA 3FIGA 2AAAA 3TUIC 4TU8A 2DZAA 3PACA 3Q89A 3QJJA 1O51A 1R86A 1TAQA 3V16A 1IXNA 5AXLA 1N32F 3QGGA 3V6DA 3TJLA 3DKJA 3HT3A 4O8RA 4TY8B 2N3LA 1LWIA 5CYQA 5AYXA 4HZ6A 3ELHA 3NZ1A 3G1HA 2ACSA 3CSKA 4DQPA 1B5TA 4FF1A 1FWDC 4KEVA 4NAEB 4X64F 2XG8A 1T03A 1NJYA 5I77A 2ZOGA 3NIYA 4J2PA 4Q2LA 4HYWA 4UB9A 2TPSA 4WJ8A 2B0GA 1H1YA 4MNJA 1FDBA 3JS3A 4P5UA 4HCHA 4A46A 4IFOA 1CEOA 4GA8A 2Z56B 1X4DA 4FB7A 1WBHA 4ZE4A 3EPNA 3CD5A 4LSZB 5JBEA 3BLLA 1OWQA 3FJNA 2XFYA 1J5SA 1UKPA 4V15A 5CLTA 2FJVA 3BQ1A 2VRKA 3CJ0A 4WX2A 3T5HA 3ES8A 3LTYA 3NTYA 3VAGA 1FK9A 3G18A 4L3NA 3OHAA 3SGGA 2FGCA 1YIXA 5DCDA 2C14A 2VBYA 2HYIB 2NXHA 2MQ8A 3TUPA 1VIZA 4DWSA 3L66A 4S3DA 2E1WA 1RI7A 3R7NB 3O63A 5CYQB 2OAUA 1NH7A 1VZWA 2C2RA 1BF6A 3A3HA 4F40A 4F9DA 3NR0A 2GGIA 3IV3A 1O60A 2ZBTA 3T4CA 1O5KA 3NQ7A 3RO6A 1T03B 2ATCB 3N17A 2OOFA 4ID5A 3PZOA 4M5JA 4GBDA 5GMDA 1EGZA 1AD4A 4BQ2A 2ZKMX 4K5RA 1JCJA 4CTAA 2PE4A 2XGPA 1WI6A 2EPLX 3R7SB 5M2UA 4LR8A 2GGHA 3DM2A 4QQBA 2Q8ZA 5C55A 4JTHA 1AZSA 3CTLA 1ZHAA 3AODA 3GJSB 3BSMA 3ONBA 4PMOA 3H5SA 2INZA 1FWTA 2GHWA 3CC7S 1KRPA 3WYZA 2KDOA 1GW1A 3PYDA 1BYAA 1FK9B 1XJWB 1UD2A 2IXVA 4P7OA 1N36J 2WW8A 3C3UA 3MOZA 5H6HA 3TJAA 4DWSB 3UR3C 1SZEA 3AMKA 3L12A 4J28A 3LP2A 4ZQCA 1DAXA 2NXGA 4JI5F 2W9MA 2H5IB 2D3O1 2VUYA 4JTFA 3M1ZA 2X1RA 1OYEA 6FDRA 1RAKA 4FNTA 1VJQA 3DI0A 5HMXA 3AJXA 1QSLA 3EMTA 1FX6A 2J9XA 1X9MA 2DPIA 2H48B 1J93A 1FWAC 3DYOA 3PZUA 4PWUA 4U7CA 5HANA 3HD1A 3DM2B 1E3XA 1Z48A 2CZEA 1TU0B 1LBMA 5GAGI 3PO4A 1AZSB 1C0TA 4Q8EA 4ZVRB 4GQ0A 3UXIA 1RWKB 2DGTA 3TCSA 1WDWA 4I0WA 3CO8A 2HQIA 1NTHA 3ALGA 3WELA 4Q4SA 2AF6A 1V0LA 6REQA 3NS5A 4NI2B 4WOZA 5FLXU 5PTDA 1RQHA 4C1NA 2X30A 5A6KA 3W7KA 4B5UA 1O5JA 3GLJA 4ATNA 3DU0A 2YDQA 4JIHA 2DVUA 3WDOA 1YVFA 2F84A 4DCOB 5HNRA 2FB0A 1LROA 2XM2A 2RRBA 1V3LA 3FKKA 2QCNA 5G2HA 2FVPA 1B54A 3DBNA 3KP1A 2ZNYA 1NLKL 2WB1D 4M8UA 2RHGA 4WBFA 2HBVA 3GLCA 1EZ2A 4GKJJ 3SCPA 4CEUC 5IQ6A 3HSJA 3VOJA 4A47A 2C16A 2ZH5A 3T1HF 3ZR5A 1C0TB 1GXTA 2IVYA 4GY0A 4C6DA 4AT1B 1S4EA 2YNFA 2GDQA 5E33A 3T9ZA 2JKEA 2WZ1A 1FUYA 6REQB 4FXDA 4LF7J 3CW2C 1WAWA 1GX6A 2PLJA 4C1NB 1KB3A 5BW6A 4MH8A 1GYMA 1CDGA 4PMZA 4XPEA 5ABEA 1VC6A 4M82A 2H51B 2EAWA 4U28A 3TN6A 5D9PA 1S2WA 1WZMA 2P53A 4B3RJ 4QNEA 3GBDA 5LHEA 3R7BB 4EIVA 1K8CA 1EJWC 1DY3A 3IGUA 2ZX8A 1W5MA 2QHAA 1N36F 4PCTA 1FWPA 5ABTA 1VIWA 1CTNA 1S5ZA 5KFLA 1MSWD 2EPNA 4UR8A 1B99A 2YOCA 4PWDB 5A94A 3O2IA 3THTA 1K4HA 3PHEA 3NNCA 4UTUA 5J1NA 1DXFA 2G97A 4IWWA 3NQFA 1GVYA 4MG4A 3R5AA 2HGLA 4G3IA 1LLZA 2AKZA 2CLKA 3H2MA 1MNSA 2YNFB 1XMQJ 3MF5A 3KDNA 1AFIA 4HSHA 3EZOA 4C7FA 3B40A 3TYDA 1GVSA 3CMFA 3KK3A 4KETA 3QLHB 1YJWS 3EYZA 4DXKA 3M2UB 4CO2A 2BV9A 1HKVA 1LCOA 3UXKA 3I5BA 4W4QA 3AO0A 4K2XA 2H8ZA 4HB7A 1C2PA 2HFSA 2FPTA 2PLKA 3KXDA 2G9OA 3GX9A 1OC5A 2YFOA 3LTPA 4QLLA 2IRYA 3LBMA 4BWLC 3B4YA 3XIMA 1NCLA 5J2QB 1LDCA 2VEMA 5KFAA 1TMJA 2KKHA 3TZZA 4HPNA 2XIIA 3KEHA 4LS0A 2R7TA 2MQLA 1TKZA 5DETA 3DOKA 4FNPA 2C3YA 2C1GA 4YB1P 2JGQA 1IXOA 5KFDA 1UKOA 1U1NA 3NZRA 2ZX6A 3MAHA 4PUKA 4C65A 3E96A 4L6OA 2XY7A 1JPIA 4B2DA 2QCCA 4JTJA 4NILA 4F04B 3VQSA 4RPQA 1NDZA 3I87A 3FW6A 4K4TA 2PF8A 4NKCA 1R8BA 1GQIA 5KG0A 4QEEA 4GKJF 2RDTA 3KK3B 1V51A 2W5FA 3RITA 2GUBA 4FDFA 2DV0A 2HK1A 3NGFA 3QY6A 4E38A 2VZSA 3MP5A 4DRSA 2VU5A 2CLMA 4DPYA 1ZTVA 3O8AA 3RBEA 2ZQ0A 3ATYA 2Y62A 2V94A 3L4BC 2PSZA 3G4SS 3UPBA 5F3TA 2E44A 4LF7F 1ME9A 3AXHA 5K3VA 3LQVA 3EPGA 1QUPA 2WSKA 2Y85A 3TTEA 2NQ5A 2IM1A 4DPUA 1YNQA 3TZXA 3K4DA 4Q8OA 4NXSA 4FX8A 2WM1A 1TKZB 2V38A 3DOKB 3K8KA 1LWFB 3F03K 1S72S 1NK6A 2V6AA 3WFAA 4O1DA 1ACMB 4DPQA 2FC9A 2AQ4A 5HQEA 2VGBA 3LY0A 5HJXA 2UVVA 4TQSA 4K4ZA 3QO9A 2CZ9A 2XMJA 4I2QA 1D7FA 4XVEA 1K9TA 3VU2A 4S1FA 2WZEA 4ZQNA 4AG0A 1RU2A 5CH9A 3ENQA 4O12A 5BWAA 2J47A 4G2DA 4Z08A 4D71A 2BOAA 1M5SA 4R5PA 5AE3A 3N04A 4YY3J 2ASLA 4O4WA 4NYZA 4DZHA 4WIWA 1KBKA 2IRUA 5H1WA 3HPAA 5AHNA 5H9FJ 5GNYA 1XCXA 1I51B 4FNRA 4Z0JA 2AYMA 4DEZA 4ETXA 4UQEA 3QF0A 4OZJA 1YPXA 4WE1A 1DTQA 1SJ1A 4WU3A 2VGIA 2A3AA 3W07A 2ZBRA 1J5EF 1CECA 2EC0A 1MZHA 1DORA 1N5QA 1K4GA 3FXGA 2CPDA 3IGSA 3P60A 1FX4A 2HK3A 3MVTA 1MUMA 1QBAA 4A8RA 4E2BA 4I2QB 3Q65A 2D3ZA 3OIXA 2I8EA 2FDSA 1AZ1A 1KW1A 2DZUA 1F8IA 5I6SA 4QW8A 4NOHA 4J9UE 1YI2S 3EX4A 4R5PB 1HD0A 2KU7A 2O1PA 4WP3A 4QISA 3MFIA 1ALDA 3DLKA 1TL1B 3EEGA 4DELA 2HNYB 4NZ1A 1FJEB 2QDHA 3QRHA 2WMIA 4HK5A 4PCSA 5CBJA 3S9ZA 4RW4A 1R2SA 3DOPA 4DO4A 1X31C 3LF0A 3RIKA 4LYKA 5AC7A 3WQ8A 4B5VA 2W9AA 2IMWP 3W82A 1P1LA 4S3FA 4WE1B 1VBRA 1DTQB 1O7AA 2G96A 4JFTA 3MZIA 4V1YA 3ADAC 4U5IA 5DCEA 1SL2A 3CM4A 3ET6A 1UCWA 4JI7J 1U1KA 1I2QA 4R7JA 2AP6A 3SSRA 2VENA 3TYBA 1WKFA 3RRXA 3BGLA 1FDZA 9XIAA 3UGRA 2D2HA 1MEHA 1LL6A 5IFMA 1OPZA 2E5DA 4JYFA 3NCPA 1G1XA 4ZOCA 3EZUA 3AUOA 3VNDA 2BTMA 3GFYA 3SCVA 4O0IA 1F4HA 3R97A 1R7AA 4GXMA 4J27A 4AHOA 3WKZA 1UVMA 3AY0A 1HZYA 2QGHA 3TONA 1THFD 5I3HA 4E2DA 3VVTA 2D69A 2PDXA 3I96A 4GVBA 4BHQA 1V9OA 3AZTA 3HO1A 4Y8FA 1UUQA 2EPHA 4IO1A 3KJNB 1UKSA 2V4QA 4V19J 4KWWA 3DLKB 4ZODA 2BGSA 2P10A 2WMIB 4MKYA 4MWAC 1S1TA 2AEFA 4RW4B 4B3LA 5CYMB 4NX9A 1GQNA 1X8FA 3UCZP 3D3BJ 2XINA 2G0IA 1Z3NA 5D38A 2E6DA 3SDEA 1X7IA 3HHLC 3P5BP 4YY3F 3IM9A 1IGWA 1FDNA 4ZOBA 5GQBA 3A8JA 1AQMA 3PB0A 1JJ2R 1UETA 3BF4A 3KBWA 1PIFA 4XAYA 4ZXOA 3F1QA 4P8WA 3ZTQA 1GPFA 3NMAA 1FKWA 3WLJA 2W2OP 4JV2A 3R79A 3CJKA 1DVJA 4QAWA 5HMEA 4BI6A 2GZOA 4X4NA 5EMLA 4JNMA 1OFOA 4LB4A 3MTKA 1YKWA 5XIAA 4H4OB 1IXKA 3CB8A 4PL2A 2Z29A 3JW7A 1B4EA 2VMFA 4GVBB 4KCTA 4WY0B 4Y90A 3GQYA 4M5DA 2F1FA 2UZ9A 4R3UA 1QNOA 3OL8A 4PBGA 2EFVA 2DEPA 2RIJA 4PUOB 2HVHA 1ICEB 3LI0A 1BTMA 2ZX7A 4TU9A 2VRJA 2V2DA 5A2CA 2XVPA 4L6DA 3PG9A 2R7VA 4P75A 3Q8PB 4DX3A 2Q43A 3V0UA 4RLIA 4ZGYA 2K3KA 4I68A 3CXCR 3P67A 1XC4A 1GMVA 1F6KA 1KFLA 4ZVUB 5HJLA 3UNYA 5MHBA 3HT0A 4GINA 4PMXA 4JI8J 1Q8KA 1XKYA 2VPZB 1Y11A 4H7ZA 2XGQA 3CJKB 1H1NA 5HXMA 5FSDC 1FRHA 3S8HA 4W7UA 1Q2SA 1JIHA 1DE5A 3AICA 3M8WA 5B0CA 4MY1A 2EPKX 2GQCA 3CE8A 4JI7F 3KHLA 1EJXC 4M5DB 2ZTJA 4O17A 3QT8A 2V2KA 1ZBCA 4C8ZA 3AD9C 1VQ7S 1JQGA 4OOUA 3U4FA 4F3MA 3RNDA 1FCBA 2H9AB 1CXHA 4DZ5A 5B7ZA 4U7UD 2FB2A 4N9CA 3MP3A 5CGMA 1T94A 2R7QA 2KTQA 2AEJA 5LIWX 4B3TJ 1OMSA 3HDSA 2E1MC 2V2CA 3NS6A 2X40A 1IWAA 3CT9A 2OVLA 3H59A 3UCUP 1KVKA 3VA8A 5IM51 1V7YA 2H90A 2TAAA 3U2OA 1S57A 2YKNA 4Q8VA 1XH0A 3HM7A 4UTGA 4JTRA 1DWFM 3HQPA 4B3KA 3C6UA 3E3XA 5CG0A 3ABRA 1UA7A 2WNZA 5HQ8A 2INEA 3KNGA 3MHYA 1KDNA 4MYTA 4OI3A 3GYNA 2E1DA 4OT7A 1PILA 3V2UC 1JR1A 1XRFA 2BWGA 2YA1A 4USHA 1ZQ5A 3OP2A 2SXLA 2KYZA 2HK2A 3ZMRA 5LA0A 1LT7A 3E0LA 1NEEA 4WGHA 1Z7AA 3FOKA 3EX7B 2F63A 3QPYA 4X2RA 3QC3A 5K9DA 1BGXT 3KHGA 1KSPA 3WUBA 1WXJA 4DZ6A 2GL5A 3OYZA 1XYLA 4ZOSA 5J2PA 4MJMA 4TVDA 1PTGA 2E1RA 4OU1A 5FAJA 3RK8A 2OTJS 3CIXA 2QYCA 1XNQF 1VBXA 2QGYA 3WZ0A 1K0TA 1JXJA 2AGTA 1ZA2B 1RAFB 1XTZA 3ITTA 1BQNB 1EHAA 3C6UB 3H2EA 1S0NA 3W1PA 3T42A 3VNJA 1H2VZ 3OL9A 1OADA 1IBCB 4J9NA 2KXHA 1E6NA 4XAZA 5KFHA 1SBRA 4NHVA 1LWEB 1F05A 5KG5A 3KOXA 2ZOFA 2I2YA 2C8NA 2C2MB 1HWKA 3SCOA 1PB0A 2JFDA 3W38A 5K14A 3BPWA 1XGDA 4HTJA 2VL1A 4JI8F 2BY1A 4C8KA 2IM3A 2GVEA 4P6QA 4L3KA 4OHYA 2DNKA 4K7VA 2JVOA 4F3HA 3VALA 4GI9A 4Y9OA 2CG8A 3NXFA 2NXCA 3O8WA 2BKOA 2V9DA 2X7VA 5KFSA 1DJXA 2Y8UA 3M6YA 3W37A 4Z1YA 2R7SA 2WOMB 5M2PA 1W2VA 3AS1A 2D3NA 3OPSA 1WC5A 2FPVA 5JVLA 5I3GA 2CDQA 2Y8YA 1TVPA 1VBJA 3CUGA 3OLEA 3ORWA 2IFXA 3NQVA 1JLCA 1U2YA 4B3TF 2RDJA 3G24A 3W73A 3MM8A 1F61A 2WC7A 1MFUA 2GQ2A 2B9WA 3I7QA 2OPRA 3P3BA 4QZVB 5CD4A 4ZB5A 1JG9A 4ZQRA 2QCGA 4K59A 1ITCA 2HTMA 3EXYA 2VYOA 5HP1B 1US2A 2WCXA 4DYJA 3O9NA 2RDIA 2FZMA 3LXBA 1TJRA 1XR7A 3W76A 1RK6A 3H40A 3LQLA 2ZA2A 1UFWA 1SZNA 1NHVA 4TU1A 1XIHA 1OFPA 4H8UA 2VEIA 1N5YA 4U33A 5C5YA 2C1IA 2ASHA 2X41A 3NDZA 3IIPA 5DELA 2FVSA 1C1BA 2DO0A 1XLCA 3ZJKA 3DECA 1A5SA 1EB0A 3TSDA 1JF6A 2I9EA 7TAAA 1MUWA 2J9YA 3MMDA 2XVLA 1XBVA 3G0UA 1OY0A 3MDWA 4P7NA 4D72A 1QW8A 3BANA 1M7OA 3UCCA 1JLCB 2PWDA 2QUVA 2BJDA 3ATZA 2JBMA 5GAHU 2YL9A 4GUJA 2YCIX 2FVRA 2EO7A 1GZGA 1GQJA 4Q4RA 2H4WB 1LYXA 1J11A 1FBAA 2G5WA 1Q78A 1MMFA 3SUVA 1YJUA 2EG8A 3HP6A 2EFOA 1B3YA 2BVDA 5ECVA 3RM4A 2DYAA 3POCA 4OX6A 4LSLA 4CO5A 2LLZA 3HK2A 4DV0J 4EO6A 3G6ES 4US6A 3PRVA 4ED7A 3T2QA 2AJ0A 1YJNS 1VEPA 2A1YA 4P7QA 1R47A 3OR2B 2P1FA 3PB2A 3FMBA 2V8DA 1A5LC 4MLRA 3MS8A 4QIVA 1R3YA 4LGXA 1QPO