3A13A

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
436
structure length
435
Chain Sequence
b'YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Sturcture-based optimization of a Type III Rubisco from a hyperthermophile
rcsb
source organism Pyrococcus kodakaraensis
molecule tags Lyase
total genus 149
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3a13A02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3a13A01
1RLCL 1RUSA 1IR2A 4LF2A 4F0HA 5HK4A 4MKVA 3A12A 3WQPA 8RUCA 4F0KA 1TELA 9RUBA 5HJXA 1SVDA 4NASA 1UPPA 2D69A 3AXMA 5RUBA 5HATA 3RUBL 5HJYA 1YKWA 1RSCA 5HQLA 4RUBA 5C2CA 4F0MA 1UWAA 2RUSA 1UW9A 3A13A 3AXKA 1UZDA 2V69A 5HAOA 1RBAA 3KDNA 5C2GA 4LF1A 2V6AA 2V67A 2OEJA 1UPMB 1AUSL 2OEKA 3KDOA 3QFWA 3ZXWA 1WDDA 1RXOB 2ZVIA 1BWVA 2VDIA 3FK4A 1IWAA 4HHHA 1RBLA 1GEHA 1RCOB 1UZHA 1RLDA 1RCXB 5HQMA 2QYGA 1IR1A 2VDHA 2OELA 1AA1B 2CXEA 2V63A 2CWXA 1RBOB 1EJ7L 2OEMA 5HANA 2V68A 1GK8A 3NWRA 3RG6A 1BXNA 2YBVA
chains in the Genus database with same CATH superfamily
2HYIB 2WB1D 4TU7A 3CAQA 2AL2A 1H11A 1QI0A 1M1KT 3ZT6A 2XBPA 3E8OA 1Z42A 1TMLA 2CQ1A 3WBYA 3VAJA 5FCZA 3RLUA 3LXAA 5F4XA 1XBWA 1JLFA 2MQPA 4HYKA 2DHAA 3G0XA 3SCPA 3HFTA 2DT9A 1RP9A 5KT6A 3ZTOA 2CPEA 4S0MA 2VR4A 1AD1A 3PVXA 1FNOA 5FJUA 1YEYA 3LCGA 5HQEA 3SURA 4GVFA 3WSUA 1VQSA 3GSMA 1TR1A 2I5QA 4U10A 4FSAA 3CV7A 2E1RA 2GUUA 2C3YA 3K7RA 3CU2A 2F3JA 4AZGA 2CRLA 4C6KA 1GQKA 4NXNF 2PLMA 1UVLA 3L9CA 4F0MA 1S4FA 5DANA 4K6AA 4Y3CA 1YQ2A 2HHVA 2ZDPA 4F3MA 1M7XA 4IR9A 4M80A 1TMHA 3C0JA 3N9RA 1GMVA 4QCFA 3I0SA 2RQCA 5J2QB 1WDRA 3P60A 3C66A 4KYZA 2OEJA 1N34F 2G5WA 2DV0A 1QNOA 5A8KB 1TMJA 4X62F 2PMZD 1PXGA 3TAMA 1WA3A 3KHHA 4UUXA 1LRNA 1KO0A 1RXOB 2A2IA 4LAOA 3QTPA 1AL7A 3PHEA 2MGZA 3TA9A 4B3OA 1RTIA 4HK7A 3ZJ6A 2CHOA 3P74A 1HKIA 4P7NA 2DB1A 3G86A 3C0SA 1RHJB 3C8YA 2PDIA 3R5AA 4OBTA 3GHSA 1UKQA 3F4VA 2IM0A 4U3AA 4S23A 3TA0A 4DZDA 5D04C 5IBXC 4EBCA 2VOPA 1HL2A 3MM6A 4MM1A 4FLSA 4HLBA 4NZJA 4LYRA 3LZ5A 3LO3A 3BAYA 2XN1A 1CENA 4N4QA 2FPVA 1DBTA 1YX2A 4NI3A 1V6VA 3LPGA 1S97A 2GJIA 3C46A 2YDQA 4AXNA 3FLUA 4NZFA 5AHIA 1NO8A 3OR2B 3WKZA 5FSEC 5B08A 1HWKA 4H9ZA 2FY1A 1TL7B 4USKA 1H0HB 3AA8A 3T40A 1GG1A 1VKFA 4OI0A 3EEZA 3CT2A 2CERA 4F50A 2C3UA 3W66A 4UMCA 1B31A 4HT5A 4IKAA 3DGBA 2NXGA 1RE1B 4AZCA 1JUKA 1YXDA 3QIPA 1VBZA 4R53A 3DHUA 3M44A 3UYIA 1MI3A 3ELFA 3AAWB 1V08A 2WVVB 4IIHA 4UTJA 3PW5A 1G1YA 1JNRB 4DV3F 1K1QA 1SB6A 1QHZA 8RUCA 3LQLA 3QT5A 1FRJA 3RCYA 2YR1A 4D6FA 5D78A 1VIXA 3VM5A 3HD2A 5J5DA 2Z4PA 3D6NA 1AQ0A 3L7PA 3SB0A 1W8GA 2WK4A 1JZ8A 4MWAB 1RA5A 3GFYA 3KS5A 2BOFX 5HINA 5ETMA 1R0CB 3U7BA 1ZHAA 4QJ1A 5C7HA 3AJ2A 4MF4A 2Z00A 1LK5A 3JSMB 2OPRB 1I6NA 2DXEA 2IKGA 3C2RA 2BE7D 2EFOA 1F8MA 1WP6A 4MNKA 5A6AA 3MPGA 5DMMA 5CPMA 1VYPX 2NQPA 5A3HA 3C2EA 3HKZD 1L3TA 4LQ9A 5MLCV 3FKKA 1O95A 2HQCA 3OFHA 4RNMA 3KCJA 4C6FA 4FO4A 4Y2MA 1RABB 3NXZA 3KLEA 2DNMA 4WX2A 3SBFA 1EC9A 4ZFCA 2MQNA 3BO3A 4TU8A 3PZQA 2C15A 1T3NA 1UROA 2LQBA 4X60A 3QY8A 3MEGA 4YIWA 1OB0A 4DWDA 3WLHA 3D4JA 1EAYC 3SCIE 3PVFA 4QLKA 4WBFA 3U2EA 4GIAA 3A4AA 2NLWA 4L3KA 3WC0A 2EPIA 4RW8A 1KKOA 3Q8VA 2PBGA 1ISVA 1DHKA 5JU6A 4FIQA 3I3EA 4RZ5A 4HZ8A 4NYZA 4HKQA 2V2KA 4ZJQA 4CO2A 5J1EA 4NU7A 1IKWA 2J9DE 2XMAA 1N6QB 2BP1A 2BODX 1Q6EA 1LW0B 3G4SS 2TYSA 3P67A 4PB4A 4CH0S 2TSYA 4LFYA 1SKWA 2F9DA 2BHUA 3KBJA 3NQMA 2CJYB 4MAKA 2QJ3A 1UAWA 1FWAC 5FF3A 3IJ9A 4U5IA 4OFZA 1XLHA 3CCTA 3E3HA 2EBEA 4KH1B 4FLQA 3NTYA 1HI8A 5D0GA 1BKHA 1WSVA 3OFEA 1LOLA 1TA3B 2ZZ5A 2PU0A 4OOUA 1IYXA 5HPCA 2D2GA 1UWUA 4AD4A 3QN3A 4QYZJ 2BM1A 3CLMA 3M9OB 4WXYA 2MTLA 3R1HA 1GXUA 3CCLS 1MQPA 5D38A 2J13A 1X7FA 3PW0A 5DG7A 4ZQPA 4QU6A 3IGXA 3VA8A 2XN2A 2YKNA 3HVRA 1HT6A 2D3OR 2VONA 3NQ2A 3VGFA 4WE1B 1ZETA 2CZVC 1EZZB 4IFKB 5L6UA 4B08A 4M29A 4INFA 3OOQA 1JZ6A 2MQQA 3VNZA 2G96A 2E25A 4MKNA 2OD6A 1XK8A 4M19A 5CH9A 1B4KA 1KTNA 3KDNA 2AX1A 1O5JA 4TYAA 5FEWA 2FC9A 1DJIA 2VG5B 2AGQA 3H23A 2GJPA 3VIMA 2QPSA 2O01C 4W92B 2MKCA 3ZSSA 4L1XA 3GUWA 5E3AA 4IFVA 4H9YA 3TR5A 4KPYA 2VCBA 4HU0A 1E15A 3D46A 3L21A 3ZQ9A 1ZAXA 3CW2C 4DNMA 3OQ8A 2DVTA 1YPIA 2AJ2A 2FDSA 4C11A 4AL5A 1SC6A 3AY0A 1R9YA 3MEEB 4E4PA 3VDAA 1K0TA 2QA1A 3W2WA 3MMDA 3T5JA 2DIUA 5LMNF 5KFSA 1OM0A 5IT4A 5I3GA 4DFKA 1RLDA 2IQTA 2ZWOA 4W8LA 4OYMA 1TPH1 3H7RA 5F0UA 2ZXDA 4QDPA 1GVRA 2BASA 3OFGA 3RO6A 4ASTA 4FF3A 1KBIA 2XH4A 3LHVA 3E96A 1UUQA 2FMNA 3SSJA 4IP4A 1FRLA 2GUYA 2UVUA 5LNRA 1XLJA 3OJUA 3MA8A 1LRQA 4UCFA 1UVJA 7REQB 3MR7A 3K5LA 4ZO6A 3PPCA 2RH9A 1KLNA 1FDNA 1BG9A 1GNKA 1HGYA 3O3RA 2ROEA 2OD4A 2HHUA 1N2VA 4AXKA 2DQWA 1OD0A 1E4MM 4JTGA 4IG2B 4DR5J 2KH9A 2BVDA 2PP3A 2CFXA 3HPZA 4CO1A 2V9DA 4Y2WA 1AJZA 4EXQA 3US5A 4ZQOA 2W3ZA 3B4DA 2TAAA 1RALA 2YBTA 1NPRA 1JPIA 3UERA 1T03B 1YIXA 3AYVA 4YB5A 4TQSA 3CHCA 1M5OC 3FMBA 3FNNA 2AYEA 4CCCA 4O19A 4ATNA 2HGNA 1EGZA 1VLOA 2F8MA 3WBAA 2ASHA 3REQB 4WVXA 3KCOA 3WLKX 4GIRA 3V4IB 2MQMA 3SCLE 1XLCA 3WL0A 1TK5A 1ZBCA 3HPXA 1YRUA 1VI7A 1S6PB 2VBZA 1H1NA 3RFAA 4ZP6A 5E1QA 4GJJA 1XFCA 5J04A 5F1UA 4Y7EA 2HVEA 2WWCA 2WB5A 1N88A 3HO8A 2PLJA 5K3VA 2CESA 1H49A 4MSSA 3NGRA 1YTYA 2RS8A 2QEZA 3L12A 4JTHA 4U31A 1CQMA 2HV5A 1JAEA 3FSIA 2Z58B 3OZOA 5HNNA 3R13A 2APOA 4FLRA 2PE8A 2O55A 3IAM9 5B0BA 3AMGA 2CJBA 1VQMS 3TNOA 1KM0A 3A8EA 3GWCA 3G22A 5IV4A 3D6TB 3HMJG 1IGSA 1NEEA 1ZBVA 2Z2YB 3QMTA 1L9WA 2VBXA 4PG5A 3MAAA 2DSUA 1RHMB 3LTYA 3VC5A 1IJFB 2PFFB 4ZVHA 3R5BA 2YA2A 2ATMA 3CMGA 5BMXA 2LU1A 3S0CA 3CTTA 1VFJA 3KHDA 3HHLB 1XGDA 4Q44A 4RW3A 4LF9F 2QNEA 4R8UB 5I3HA 3VOJA 4DBEA 1JZ3A 3GYGA 3MEKA 4XB3A 1T9VA 3OBIA 4DCPB 3SO7A 2NX9A 2HQAA 4IUOA 3CH9A 2XZ9A 4L4MA 3P93A 3MUXA 4ECRA 4S3FA 5AE2A 3IRXA 2PZNA 3KRUA 2YNIA 3GH4A 1XH1A 2A3LA 4PUJA 1J6OA 3CHEA 3DYPA 4DBSA 3GXPA 5C6MA 3LOTA 4G9PA 4QX4A 4JEQA 2VBWA 3QSRA 2HNDB 1JDDA 3MC5A 3I0SB 3W1TA 1ICPA 2FZ9A 1KFLA 1E3ZA 2NXHA 2G3IA 3RCNA 2LXFA 3C5QA 4XZLX 2CYYA 1K9EA 3WJXA 3N9UC 4NXSA 3TAMB 3O2IA 2OO0A 3MOZA 4JX6A 2JX2A 3M0KA 1WEYA 2BVTA 3GW3A 4EANA 3S1TA 2CPXA 3LGEA 3W2KA 4XO0A 2XISA 3ZO7A 4X2BA 3ARZA 2MGZB 3LSBA 2DGTA 4M1RA 4RBUA 4A4AA 2Y7GA 1OWXA 1OF6A 3UQNA 3BAXA 4DQRA 5IT9U 4NI2A 3DBNA 4KPLA 4E4UA 1HJVA 3MM6B 1SZRA 1NOFA 3IUDA 4EF9A 3G6YA 4J9PA 3CZLA 2OSQA 4YUDA 3GB6A 5KFCA 3IS9A 2V5HG 2WXDM 2AAAA 1SH2A 5GAEI 1LWEA 2R3VA 2EXUA 3N73A 3LENA 3UJFA 3PEHA 3EVOA 4A2RA 1A4LA 1UFLA 1HP5A 4UWMA 2DGAA 3OVQA 4ZMMA 4JN6A 4AZCB 1THFD 3AHZA 4FXJA 3QIPB 3HG5A 4C8YA 1SW0A 4AD3A 2ZUUA 4AIBA 3WK0A 1UA3A 4DUTA 2BOEX 4WFZA 4XK8C 3DXBA 4AB4A 4R5PA 1Y10A 3I4HX 1M3UA 3EAUA 1C4AA 3G1HA 3OHMB 3W25A 4HNCA 3U48A 1QPOA 4FNUA 4KEMA 4WZHA 5DY3A 4B02A 2ACRA 2FGOA 4HPGA 3FBEA 3TRGA 3F1QA 5HVFA 4B9NA 1KXVA 4DFJA 4QPXA 1RYSA 4BS0A 4F26A 5HMZA 2WJFA 4OZ1A 3S2NA 5EB8A 1R3SA 3ZNUA 1NQKA 3BCFA 4G1NA 4OU1A 2H54B 3NGUA 1A5OC 4EVZA 3E49A 2VVNA 3T42A 1JCXA 1GEQA 4ED7A 1BHNA 2GGGA 3STGA 4JIRA 5I3DA 5HQ8A 1RY0A 1NB7A 2X16A 1CXHA 5BR8J 1MRQA 1JQVA 4G56A 2GMLA 4CO5A 1KLZA 2NUUG 2YWGA 3ZR4A 4M7TA 3KLEB 1K8XA 4CNOA 2KTQA 3AMCA 2P6SA 1LOSA 5KFDA 5RUBA 3QZ8A 3KOWA 4Q8MA 5T9BG 2VH7A 1X9SA 2EAWA 1PZ1A 1Y5LB 5GAGU 4E2VA 1H1YA 2G4BA 1RAKA 3OG2A 2G41A 1XIHA 4G1QA 2DH7A 1Q7ZA 4DV7F 1HX0A 3S4TA 4OVXA 3H21A 3W81A 4QW9A 1VBJA 5IS2A 3T1YJ 3GAYA 1O0PA 3PS7A 4RW8B 1WOSA 4HPNA 1RWNB 4BS2A 3BGLA 4NLPA 3R8HA 3S2LA 4KR0B 3DU0A 4AWUA 2BXJA 1E4IA 3WUEA 2BUNA 2DJLA 3EJMA 1ME7A 5M17A 3CL7A 3PC0A 1FVPA 3U2ZA 5LNVA 1IKWB 4ZVPB 1GPFA 1TFVA 1BWVA 2V3EA 4CLMA 1Q16B 1OK4A 5DDQC 3BLIA 5I6SA 4J37A 4UOGA 5AC4A 1WG4A 1S39A 3NDZA 4B5WA 3NS7B 2VENA 1AK5A 3RCMA 3V1PA 4DLMA 3VOGA 2K3IA 2Y6ZA 1XRTA 5DLCA 1W31A 5HJLA 1GMUA 3UN5A 1YDOA 5D33A 5E5NA 2Z7GA 4YDDB 2QA4G 1B3ZA 2WMHA 2INEA 3KZPA 1DY3A 3TAKA 3DESA 3W1XA 3W60A 2XB2D 4FS9A 2DT0A 5K20B 5L46A 4C6IA 3NQEA 2VQEJ 2LQJA 2VPXB 4U8VA 5BWFA 1TE6A 2DHXA 3W1PA 1OQ6A 1N5SA 3X1LB 4IOAQ 1OO0B 1KEKA 1CXIA 1VQLS 1TV2A 3DYMA 3R25A 1GKRA 4RNHA 3FRZA 3W5ZA 4NA3A 1QO5A 2DNKA 4P2FA 1GFWB 4J3WA 2UUAJ 3FX4A 2P2CB 1MEHA 3PBYA 5GMDA 4H01A 3IXQA 5XIMA 2V4RA 2F4VJ 1C9DA 3FIGA 4W93A 3CGIA 3CJKB 4ZPTR 2MZ1A 4GXMA 3T3FA 3GNDA 4HGXA 1D3CA 2GQ8A 4L61A 4FMVA 4DR5F 1RAGB 3TW7A 4IFVB 2W9CA 3VAFA 2D9PA 4Y2CA 3L95X 1LL7A 2A85A 2ZCGA 4P7LA 3UXIA 4C11B 3OA5A 1V77A 5LHEA 3VO0A 5KG4A 4LBRA 1X39A 1XRFA 3W2WB 3WENA 3EKZA 1S2AA 3R27A 3MZNA 1S59A 4YS2A 1MMFA 1SL1A 1U45A 1RK6A 2ZH1A 3K4AA 2IMWP 1UW4A 4JD4A 3IMQJ 3JYTA 1GTHA 1XJWB 1MNEA 1XLAA 1HJWA 4L9YA 2RDDA 2YCJA 4B90A 1VLIA 4X64F 4A35A 4Q0BB 3UWYA 1MUCA 1HG3A 4JTTA 1R3WA 3TIMA 2GAHC 1Q7QA 4DOZA 4YS1A 3E1F1 4MIMA 2HRYA 1BY9A 1I9CB 2ZX9A 2WZIA 3KLIA 1D8YA 4YCOA 1AVAA 4DV4F 3CO0P 4Q4RA 2QFJA 4IPNB 3V36A 3WUGA 2XULA 1YADA 2XN0A 2BVZA 4C6JA 5IM0B 5C9UA 1UWBA 2BR0A 1IWBA 2GJNA 4GPNA 4ITSA 2HEJA 2XGIA 3FBCA 4U7UD 4JS3A 4FNTA 1YSJA 1R2RA 3TE9A 1S57A 4E38A 3TI0A 4EK2A 2LECA 1YXYA 1VHNA 3W8PA 3PRBA 4E8UA 3FVMA 2G4FA 4CN1A 3FSUA 1YNPA 2LQ5A 4YU1A 3H2UB 4GO8A 3H2NA 3DFQA 4W8BA 1UR9A 4DJFA 2XSJA 3R11A 5EHHA 1IXKA 4KPCA 2I5IA 4K0KF 1CGWA 3SY8A 3FXYA 1IR2A 1K6AA 4YXGA 3D66A 3LUYA 2RQ4A 4YYFA 3N6LA 4QIUA 2EO7A 3CB8A 2QAFA 3W1MA 1E6VA 2CQGA 2E5HA 4P52A 3KK3A 3ZR6A 3EZUA 4YR3A 2K2PA 5FLXU 1JNZB 3I6RA 3FCWA 3IIZA 3VQTA 2PO4A 3N3MA 2KN4A 3WK3A 3THTA 4L72B 2IRUA 4FX6M 3SCJE 3P8IA 1RAIB 3F44A 1XSIA 4IF2A 1JLGA 1HN1A 2ACUA 1UR2A 5B0EA 4HHUA 4O0ZA 5D8HB 4DI9A 1TJ1A 1GKQA 1HIZA 3OLGA 4A8RA 4DSFA 2C16A 2CQIA 2HJPA 3MAAB 1EIBA 5DG8A 1HVQA 1HHQA 1NP2A 1XSKA 2B56A 1S5WA 2ZFAA 3DERA 3E38A 2GFFA 1KFBA 2BA9A 5BU9A 2RU3A 2IMRA 4QBUA 3VGUA 3M4HA 3N4EA 4RPQA 5KG5A 1T5AA 4MUPA 5DELA 3OLIA 1KGXA 1PKYA 1QTNB 3BQ6A 1CS4B 2V9WA 1AYEA 3OIXA 4PRWA 4UTTA 1I0DA 4AFFA 1C29A 2VFVA 4E0DA 3IRXB 3S5NA 2HZGA 3HGJA 4MGGA 2YQ0A 2PCEA 1T3OA 1EJSC 1MN7A 3CXOA 3NSNA 4DJEA 3K1DA 4ZTXA 3VDBA 1KP6A 2BW7A 3PYFA 4HHPA 2NQ9A 3GE9A 4QR0A 4U96A 3BQ1A 5FF4A 1BQCA 4CLZA 1IQ8A 5C7PA 1G6BA 2H90A 3DG6A 3OTDA 2ZVSA 4L5ZA 2PBOA 1HW8A 3MS8A 3HKWA 3FSXA 1KM4A 4DWSC 4Y9PA 2PGCA 3BSOA 1TMQA 5C9WA 3K57A 1EJ7L 1ENUA 3QQ1A 4IT1A 2F38A 4CQDA 1YJ7A 2QLBB 3RR8A 2QJNA 4RX0A 4OI6A 3FN9A 1FH8A 4M1BA 3W6YA 3GONA 3H90A 3LCLA 5KT4A 1S1RA 4MHBA 3DFHA 1Q8IA 3EOUA 2E5DA 4F0HA 5KG6A 3PZTA 3CE8A 4NI2B 4GVBA 4FYVB 5GAEU 3RU6A 1VJIA 4PYSA 4DRSA 2XVKA 4LFBJ 4XDCA 3IS9B 1R85A 1R3NA 3W7PA 2HW3A 3LYEA 1JVNA 3FDGA 1V02E 4M5MA 3PZIA 4GIYA 3SQGA 3NCPA 4DO7A 2JE8A 4H9UA 5K14A 3Q8RB 4EUVA 4AFYA 3D5HA 2WZHA 3CC1A 4H4KA 2VFSA 1LL4A 4O4VA 2HQ3A 3AU2A 1OPZA 3H0PA 1TP7A 3TZZA 1TTIA 5E3PA 3RM9A 3G9CA 3EICA 3VKJA 3H20A 1HNYA 2POTA 2YQ3A 4CZCA 3QJLA 1VQPS 2V69A 1DWHM 2PFHA 3LA0A 4UFLA 1B64A 1DOSA 4HYRA 4TY9A 1EP4A 4R5PB 5CA5A 4FX7A 5DM7Q 1MROA 3UFYA 5D02A 1YE4A 3PR4A 5KTQA 2CJXB 1W9VA 2PMQA 5C2XA 3D54A 3TCSA 3AU6A 2VC0A 3I87A 4PRRA 4A47A 2FC8A 5AHMA 5B80A 5T41A 3ZZYA 2JEGA 1TYGA 4JX5A 4IJRA 4QEEA 2PS2A 1ISZA 3F56A 3NQ6A 1EDQA 3GTXA 3GZAA 4AY7A 3HHEA 4RZRA 5LSOA 1WZLA 1NKEA 2R1LA 4NX5A 3WF1A 3WLQA 4IFYB 1BGGA 4QM1A 4E6MA 1S3HA 5CZKA 4HH1A 4YHGA 5F8IA 3QVQA 3QV7A 3FJ4A 3IAPA 1M5HA 4YMEA 3DN9A 1GCYA 4QFUA 4TNOA 2UZ9A 4GJIA 1QVFR 1YG0A 4FPIA 1XIEA 3TC3A 4ZCKA 3U1MA 2R8IA 2E1CA 1A5CA 3V81B 2QTWA 9CGTA 1UFWA 1UKUA 3LEPA 4LUYA 2CDRB 1W9XA 4N5SA 1LROA 3C6UA 4UTGA 3CT7A 1RU2A 2UWFA 3O07A 4G1QB 2KKHA 4JI5J 2VQEF 4KS0A 2MJUA 4D1JA 5E3QA 2LLEA 1J5OA 4ANCA 2UXDF 3PW2A 2VC1A 1SJ3P 2GIFA 3QT8A 3UE2A 4F25A 1S0MA 2I6WA 4I56A 2DGSA 5KFJA 5GPRA 5SWUA 3GG7A 2X7VA 3WK1A 2UUAF 3F4WA 3BV8A 3UQSA 1O1ZA 2ATSA 3Q86A 3OJSA 5DMLA 3PBWA 2V8PA 5I02A 3I55S 1B30A 3LQGA 3RUBL 4PSRA 3GNRA 3TAPA 3EDQB 3AIUA 3HQPA 3EDJA 1QVGR 1PV8A 3DMJA 3RN6A 4AE5A 2UXCJ 3U4FA 2VFEA 4ROPA 4O3PA 2R4FA 4MY8A 3MJMA 3T1HF 3NYDA 1W25A 5JBDA 5E70A 1ZAHA 2RRBA 2A21A 1OG6A 3UR5A 4IXXA 4P2SA 3N3TA 4GZEA 4GKLA 2GIQA 1OINA 4RUCA 1CJVB 4AQYJ 1YE6A 5BWAA 3C3UA 3RRXA 3BO9A 4DR1J 2EKNA 4D72A 1R8PA 4FALA 3OSNA 1DWJM 2I14A 1WF2A 4LB3A 3KS6A 2E1PA 2C2RA 4LAZA 3TW0A 2DR8A 2JK2A 1ELOA 1VENA 2MKIA 3ZT5A 2RKXA 2XZTB 1V0NA 2F63A 4PWDA 1U5JA 3R12A 2ZBCA 1XYAA 5CAAA 4C91A 3PZGA 4EKJA 2Q8ZA 4ZCWA 3N6MA 3BO2A 2VDHA 3T44A 3PANA 3WBEA 2RQMA 2X09A 3AQPA 1D9DA 1SJRA 1RT1A 1U6ZA 1LXNA 3W7EA 4H7CA 3L5MA 4JNMA 3ENAA 1Q4NX 1YTKA 4KGMA 3KFWX 4J3ZA 3IUIA 2W9CB 2LDIA 1EZ2A 2I9EA 2HSAA 3G3DA 4IMCA 1DJWA 4CO4A 4O3QA 3HBLA 3R7BB 5C8BB 4JV5F 1UJ6A 4K8RA 3A4JA 2ZX5A 1X1ZA 2CU0A 1N54B 1Q79A 3QMRA 1SC3B 3ABXA 2NS1B 1XWYA 3KLLA 3T7VA 1HYSA 1TTHB 2EK1A 1TU0B 2W4PA 1W1ZA 3ARRA 4IHCA 2UUCJ 2NV1A 5EMKA 2HBXA 4QBXA 1UVNA 1KKRA 3JYTB 2WBGA 2QZ8A 3B9AA 5C7VA 2ZC1A 1TVLA 3N5BA 1UIPA 3PSWA 3KG4A 2QEXS 4ZCMA 3WJSA 1GVOA 1UA0A 2Q02A 1PO6A 4DV0F 3ZLGA 4WHBA 1D1UA 4FBUA 2AAMA 5KFOA 4GCAA 3E0LA 1TJPA 4QIWD 5ETRA 4FR6A 4I8YA 5CAHA 1FDDA 4P2MA 4IISA 2OPQA 2VC7A 1P0EA 2CW6A 2QIWA 2VP8A 1FRKA 4ELVA 4KGVB 4J40A 1RR2A 1T99A 3KVKA 3ARSA 2ZA1A 2RD5C 4URIA 3KLIB 3RAOA 1KGWA 4CLWA 1UD5A 4GZJA 2AT1B 3DNCA 4MMWA 3BDEA 2IM1A 3MKVA 1K8AT 2HE8A 5F8GA 1UWBB 2HHTA 2FLIA 4I8DA 4UZCA 3KLVA 1UR8A 2A3AA 4XSMA 3GVWA 1KR0A 1G9HA 4PMXA 1FEHA 1IBKJ 1TKDA 4X2RA 3Q8QB 3B8HA 4LSNA 3OJGA 4IH5A 2FYXA 1EIXA 2YCIX 3C4UA 3PG8A 3QRQA 2A0FB 1QI5A 3UFCX 3U02A 2QULA 1W5NA 1H98A 1WAUA 3G1XA 5KFHA 2XSJB 3BN4A 3OBKA 2L08A 1OC5A 1CB7B 1OQFA 1R46A 3C0LA 3EZ5A 3NEKA 3GWQA 1E6VB 4KEZA 4V1Ak 1JF6A 4HTIA 3Q58A 4C7GA 2RB7A 3CUXA 5T26A 4IJBA 4NRRA 1KC8T 4IX2A 2RSQA 1VC4A 2D3NA 2PDHA 4WF7A 1KN6A 1SIWB 2B51A 4DR2J 4DF0A 2DR6A 3N9KA 5D8ZA 2C6QA 2BDPA 4ECTA 3CQKA 1XCXA 1YDVA 3S9IA 1S5MA 1A5SA 4DR4J 2A18A 1CPUA 4RX6A 4WGHA 4R9OA 5JBEA 1DIKA 1V6WA 4ECVA 4H4OA 1ZAVA 1I1WA 2UY5A 3F41A 2TMDA 2CKWA 3UPFA 2C71A 1R86A 2KXFA 3RRKA 4JV1A 1DE5A 6REQB 3QLHA 3H8AA 2ZADA 3TTYA 1NK4A 2WRMA 5G0RB 2YNFA 2PPGA 3W24A 3Q4DA 2E6AA 4ECWA 2XHYA 3AXHA 5IFPA 1YPXA 4J9LA 1ZBWA 3MFIA 3R7SB 2QDDA 2B5JA 3ILJA 5K4ZA 4ORMA 2DHSA 2ZICA 2AL1A 4HNLA 1YDYA 4O1EA 4GRSA 2NXUA 5U4NA 1CB2A 1NK9A 3E2QA 1Z8AA 5KG1A 1PKLA 1VQ5S 3K5OA 3BH6B 3MV11 3M0HA 4V15A 3OTCA 1JI1A 2Z7KA 4PCSA 1CBGA 4JYEA 3G1YA 5ETLA 4Z2XA 2LEPA 3H2CA 3FDSA 1HZYA 4V27A 2J8GA 2WWDA 2I8EA 3AZRA 3ZR5A 5E6ZA 4PEOA 2OYMA 1H7OA 2ZC8A 4Z1YA 1JWWA 3L3CA 2V2DA 1HJUA 4JTDA 3L4ZA 4NCBA 5TNVA 2CQPA 4JN7A 2GA7A 4Q4QA 2P1FA 2H8XA 2AEFA 2DNYA 3VCDA 4HMNA 2P3EA 2VRKA 1MW1A 2VX6A 2EG1A 1HHTP 1IIGA 3HI9A 4EF8A 2C42A 1C2PA 1W2BR 1FWRA 5EY5A 5KZDA 2F2KA 4O18A 4Z1DA 4N7TA 1U0SA 1DQ9A 2GL5A 1QPNA 4UTIA 4ZXOA 5IWAJ 1X9WA 4V19X 3M1ZA 1C93A 2R1NA 5BXPA 5MKGA 5CZXA 1WG5A 3N2XA 4X65J 2EKCA 2EC0A 3QW4B 1RP5A 1ZA2B 3SDEA 4WJEA 3UVIA 2P9CA 3RAMA 5JVGQ 3LHYA 5BOOA 2Z1SA 4GVBB 3P8JA 3AHVA 1LBMA 3DRRA 1AG1O 2OXNA 4DQQA 2WKJA 4H6RA 3MM7A 1NOWA 3CT9A 1CG2A 3FMWA 3WQ6A 4C6MA 1IXPA 5DG9A 1WC1A 2PCQA 2FVRA 1SMAA 1KCZA 2VQFF 3PZOA 3P45B 2ZNZA 3GFZA 2QL5B 5CBIA 2CWKA 3SQGB 3FYPA 4FOKA 2FJAB 5ABTA 2QQ6A 5K14B 3VC6A 3I31A 3KUEA 2G3FA 4ZGYA 2ASLA 3CCQS 3GTIA 1NH6A 1Q8BA 4KBIA 3BAWA 4DQSA 1KTCA 1GVFA 3G6MA 2J7CA 3MSGA 1FRHA 3M6UA 1DFDA 5TBOA 1EWEA 1PKUA 5GMEA 5KFFA 3A3PB 4RUAA 4PH6A 3WQPA 5HVGA 3RZAA 1NRKA 3R5JB 1XL9A 4IG3B 1EP4B 3WH9A 1SZEA 4G8TA 1K77A 1TZ0A 4CRJA 4PG8A 2J75A 2RKIB 4QYRA 1S7IA 4JI5F 3R4IA 4JDBA 2W24A 1VQ6S 3A4WA 2WPGA 1OX4B 4R27A 2D22A 1N5YA 3WJZA 1DQUA 2F5GA 3CO4A 1FFWB 3CWHA 1ISYA 3SV4A 1TR9A 1W3HA 1PE1A 1AL8A 2PWEA 2DNNA 4AG0A 1DTQA 4ZLLA 4J3XA 1JMTA 5M2UA 1IEVA 3CD5A 3W7HA 2YPYA 4C3KA 3NVTA 1F61A 4NLWA 1O4UA 3KNGA 4PABA 5HDRA 4PTWA 3UNYA 1GMWD 1E6SM 1K4HA 3M0XA 3TN4A 3BGFA 1C1BA 2UXCF 5F8JA 4USIA 4HU4A 2BG5A 5FLXY 1PG5B 2ZRUA 2RMLA 4BWLC 1W91A 2WCAA 3WQFA 1K73T 3HQ1A 4WIWA 2XDFA 3EYPA 1N8RT 2VELA 1C92A 2WSRA 4Q7IA 2WLYA 2O9RA 3IACA 3SUSA 1B2YA 1UVIA 1HXJA 2CDQA 3NO5A 3STPA 2OO6A 3THUA 3VKBA 2QYGA 2MNRA 1E4LA 3A9BA 2V5JA 2ZH9A 3QGAC 1E51A 4I5UA 3AQOA 2UVVA 1HW6A 4M7SA 4Y65A 3DIPA 4UTKA 3J7A1 3ZMRA 3UR0A 4JTUA 1UKOA 4K4TA 2OEMA 3B0PA 3A8KA 2QL7B 4PPZA 1GQIA 4LVGA 3CQ0A 3NBPA 1IV8A 1HTIA 1JGMA 1REVB 1TRIA 4IGHA 3KL0A 3UDLA 2NWRA 4JFSA 1IIHA 2G3NA 3DMJB 4AX6A 2OTJS 1XCFA 3PF3A 4C90A 1NFBA 1UBSA 2E0PA 4Y28C 3KK1A 4BCAA 3GHUA 2QX0A 3QY7A 4JIEA 1GXTA 2QV4A 2VGGA 3UA3A 1F3WA 2XSAA 4I7FB 3LGMA 3DAQA 5ITHA 5H9FJ 3GU9A 2XS7A 2R2TA 3SFGA 5FDLA 3CCJS 4LS0A 1TX2A 4FHAA 4IPIA 5H9FK 4YTRA 4NASA 3R5EA 3QGGA 3VIIA 3KJVA 3U0HA 2DP3A 3C6TB 2BS9A 1C8XA 3SCNA 4JPGA 4D6DA 3KHLA 1FEEA 2PDJA 5K9DA 1VBYA 4QR2A 3UVJA 4NRUA 5ENLA 3J7Z5 5DT7A 5HQLA 4Y90A 4B17A 1RACB 1BHGA 1PZ2A 2Z27A 2VR5A 4NMLA 4JN8A 4PUUA 2DZTA 2VKRA 1S5NA 2RUSA 4PWDB 4OHQA 1X4FA 4ZP9A 2XY5A 4KESA 2ZH7A 2ZUNA 3AS2A 3RLHA 3LP2A 5D03A 1VP5A 1FCUA 1WPCA 4DWSD 3CJRA 4LVDA 2V6AA 1RT1B 2XIOA 2QCLA 1QI3A 2D0FA 2VXNA 3THQA 5I03A 3I3BA 1XQKA 3MVIA 5AECA 1IBCB 4AXIA 3TYDA 2OX1A 3EZOA 1W5OA 3UR2A 2DVIA 1GORA 5JVLA 1PTGA 6XIMA 3ET6B 1MW2A 1AFSA 3SW6A 3NRBA 1CULA 1HYSB 1B4EA 1VC0A 3THAA 1IBKF 2YDRA 4D2JA 1I0BA 3BSCA 1F6YA 1JJ4A 4YB1P 5A94A 1UD3A 4QDMA 3MCNA 3U3HA 5LIWX 4O28A 3RTVA 1AW2A 3N4AA 3O44A 1ZB5A 1SUQA 3FS2A 4M6VA 2MKYA 2CXEA 1WZAA 1MFUA 5HMYA 4NJHA 4HU3A 1Y3KA 1QJHA 1SJFA 2LQ8A 3OLEA 4HIBA 1BGXT 4V33A 3TYBA 1FI4A 3LCFA 2V2ZA 3VAHA 3ZLHA 5CJNA 4YTTA 2IAJA 3SQLA 4XISA 4AMAA 2RILA 3VAIA 3EX4A 5T9CE 3V0UA 3QLDA 3UWWA 2VPWB 6CGTA 3HPAA 3PKYA 4ELTA 4DR2F 3BZJA 3KMSA 2EPMX 4PG7A 3CQIA 2CFFA 1OSEA 1TZ7A 1HO4A 1X1NA 1JLAA 4H9XA 3GXIA 1M53A 4A3UA 4DR4F 3FC9A 3GH5A 3O6QA 4PTDA 3GIIA 5LMUF 2PDWA 1PHWA 3QC0A 4BJHA 2HWTA 4DO4A 2ZUWA 1TWZA 2P8BA 5G5IA 1X4HA 3QV6A 4RO0A 1U1LA 2RH3A 4MTPA 3VAVA 3NDOA 4QE1A 2GMJA 3MUIA 2XQCA 3N28A 5ETVA 2OSRA 5CPNA 4CQ8A 4Q45A 1V5XA 4DPYA 3PB0A 1K7XA 4XAZA 1ZYQA 4K8GA 1FWFC 1TR0A 4OGZA 4GH3A 4TU1A 2GVLA 2KT3A 2NPFA 1VFMA 4J7CA 1VBKA 3QQWA 2DSWA 1L6FA 1KD0A 1REQA 4DJDC 1YITS 3HT0A 3PO4A 4HPXA 3MP3A 1RK5A 4LF1A 2VZUA 2OI2A 2FGBA 5HMDA 1CC7A 3GG1A 1PSDA 4E4FA 4K7YA 3SRKA 3BSNA 1ZNNA 1KFDA 1WDDA 3OA3A 4QG6A 3SN1A 1BVZA 3JU2A 5J2MA 4DXKA 4B16A 3DLLQ 2PGEA 3C61A 3AIWA 1GPWA 1JNEA 4H4OB 4H2HA 3M16A 3EMTA 1L3VA 4PUDA 1QLNA 1PCWA 4HNOA 3GB0A 2BZ2A 2VR2A 3QLHB 3S7RA 4N9CA 6FDRA 1NWRA 2C7FA 1YTDA 3TSBA 2YNFB 5IWAF 2X0YA 3LU2A 2VI0A 4FF4A 4AEFA 2HS4A 2Y88A 2AKWB 4F0RA 4X65F 1OYCA 4AHQA 2VFRA 5EUHA 1UWSA 3M07A 1WOOA 3OLDA 3DLKB 4OI1A 3L7OA 2R7VA 2R7UA 4DL6A 4EBEA 3S6DA 5DCEA 4WY0A 3R6GB 4QIGA 4FAMA 3T07A 3MR3A 3H55A 3DECA 4ED5A 4J9QA 5TAOA 4E3TA 3CC4S 4LQ1A 1BGAA 1GOIA 2HFVA 1U8SA 3SGGA 3MDWA 4AIOA 4I7WA 2FHOB 5BYRA 4A2SA 3H5YA 2PGFA 4YHHF 4NILA 5AHFA 2I17A 4Z08A 1R0BG 1H4PA 5EU9A 3B0YA 3DENA 1B3YA 4J1OA 2BJ1A 5LJ5Y 3DU6A 2A5HA 5FF0A 3W7JA 1W9DM 1Z7AA 4JGDA 3QC3A 2AEMA 3GLJA 1I51B 1UEUA 1VQTA 4XKMA 4AZ5A 4PR4A 3TUPA 4LF4J 5MKGB 1WEXA 1YHTA 4NY2A 4NZ4A 1U4BA 1VJZA 3NMRA 1A9NB 2YL5A 2FY8A 4FOJA 4KQZA 1ROFA 3SDEB 2DNZA 2GFTA 5IT0A 3PWAA 1NSPA 2HPIA 1N7KA 1PKNA 3DRRB 3C56A 3A4TA 4RW6A 2IJNA 3LLFA 4Y34A 2G0CA 2ISWA 5KTLA 4Z1CA 3AS1A 3EWZA 4MFDA 2OEKA 1RHQB 3ALGA 5KFEA 2Z26A 4S3JA 2PI5A 4JTIA 4OI3A 3VIHA 4NCGA 1VQ9S 3M9NB 1DJNA 1BXBA 3NGDA 4NLOA 4MPKA 2JKPA 4P7QA 1TIWA 4PPDA 1NJWA 2ISSA 2FJXA 3PIOQ 5CH7B 4CM2A 3NM3A 1HBMB 2CVIA 2IVFB 4YY3F 1GEHA 3KJNB 1X7VA 4QXIA 1LXJA 3VF0B 2VG6A 3CEPA 2X41A 4DR3F 3AYTA 3ILIA 1XKYA 3B4MA 2WSKA 1LV5A 3F4NA 1E5NA 2FUG9 3WH5A 1UR4A 4C8NA 2GQ9A 4N2YA 2YXGA 3WMLA 3AALA 3LV6A 3KBSA 1E1EA 3OUYA 1O8BA 1RHUB 4LUSA 1G2EA 4MNMA 3NEVA 1U25A 4MJ4A 1UJ5A 1FKOA 3K58A 4M5DB 1JDFA 1EXPA 1XYFA 4JL1A 1ZJIA 2GHVC 5MHBA 3KCLA 2ADCA 1RA7A 3C14A 2JFKA 3VV2B 2NUYA 3EWWA 2QJIA 4CNNA 2YL6A 3ZTQA 3RJMB 1XG3A 3HQNA 4WLCA 4LBUA 1DTQB 3JW7A 2XGPA 2BKNA 3GHTA 3WD3A 2CNKB 3NCOA 2J7WA 5DGAA 1EEXA 1D7KA 4P7TA 1NQ6A 1PB0A 1H7WA 3BTNA 3WNMA 1JYNA 1B70B 2G0WA 4GKTA 1C1BB 1EP1A 1WXJA 4U67Q 2WLZA 4WSKA 3HVWA 4ILSA 2DT1A 4A8FA 4RE4A 1W6TA 1LWIA 1YBAA 5F9NA 1OC6A 1JZ5A 2PC8A 3PG9A 3BURA 3QWUA 1YRRA 4NXMF 1UR0A 1F2GA 1W1TA 4Y00A 3PACA 3DRYA 3MD3A 4C4WA 2E9LA 1NIUA 3R58A 3L23A 2BOAA 1Y5XA 2NZCA 3KUHA 3AZTA 4CU8A 2IM3A 3GQYA 4UW2A 1HNZF 5DM6Q 1EGMA 1ADOA 8XIAA 2KT5A 2H9AB 1LDCA 1VPYA 3W6LA 3WQVA 1FD2A 2NXJA 3OL6A 2J76E 3N5FA 2XFFA 2P5NA 4R9XA 1ONWA 2W01A 3PY8A 1XLEA 2C19A 3NR0A 4FVCA 4BDPA 4WZMA 2CLHA 3I6PA 2W62A 3NBPB 2WOQA 4W4QA 6PTDA 1WCGA 1S1UB 3HFYA 3QFHA 1LL6A 2P8CA 2ALYB 4CVUA 1IBMJ 3CIZA 1C7SA 3M0ZA 3V18A 4QITA 4O11A 5FJTA 4MZ8A 2FZ8A 4Z2GA 4IL2A 1Z44A 3KK1B 1HL9A 2PTYA 1IWPA 1QSSA 4DLFA 3BSHA 4JQ4A 4M5GA 4N6EA 4I6WA 5HQMA 1MO0A 3UXDA 1V79A 1XS2A 3D3BJ 4I6AA 5HULA 2I2YA 1LWFA 1TPUA 2HHXA 2R6OA 5FDLB 2Q8XA 3DI6A 3M5ZA 3OYXA 4USJC 3TTQA 3WH8A 2XMKA 1V6HA 3VIGA 1OD8A 2QRRA 1P48A 3HK2A 5I7GA 4YMZA 2DNOA 1XKJA 2NWSA 1E9ZB 1ZAWA 2WVDA 3UVJB 1R9ZA 3WQWA 1QM9A 4CIOA 4AXJA 1SFTA 1B3VA 1K8ZA 5IXEA 4MUZA 4QROA 2RDJA 2CZFA 3WZ0A 1RA0A 1Q63A 3DZ1A 4M56A 2ILZA 3AMKA 2Y89A 4M81A 3NZRA 1URRA 3QKEA 1W9UA 4U7UK 3WNNA 1UUOA 2CJAA 3NQFA 3E6EA 1VAHA 4NLUA 2Z24A 4JI4J 3QLLA 4HTBA 1FUYA 3LP2B 2XMMA 4NZ3A 1CBKA 3BMWA 2BE9B 3VFLA 3VZZA 3ENVA 3NS5A 2ALZA 3NWGA 2R91A 3M43A 2ZZ7A 2KRRA 3H2LA 4DO6A 2M8HA 1WC6A 3SY1A 3IAS9 4I67A 2KZHA 2AJQA 3GCWP 4X9SA 3O2LA 2CHNA 3AI0A 4B4HA 5BRQA 2BY1A 3CMJA 4LRBA 4IH6A 3CJ5A 2A2CA 4UIOA 5BOFA 1E0TA 1QATA 4H9VA 1RSCA 1KCXA 2UV8G 2C14A 3DI1A 1QHPA 1ZP3A 2RUGA 1AH4A 1GWJA 4P10A 5BXIA 2ZUAA 5DBTA 1T8EA 4EBDA 2EPHA 1WI6A 1S5TA 4BA0A 3ZS4A 1SUQB 2DORA 1PZ0A 1RWXB 3W2JA 2HDJA 4ATWA 3W26A 2E28A 2HNZA 2LFVA 4ZPWR 4C3LA 3DKJA 4DUOA 1YTEA 4ZVTB 1FQ0A 3VINA 4DPTA 2BBEA 3EXRA 1CDGA 5KEZA 1HUVA 1BWKA 2C1GA 1Q0NA 4JYFA 3GTNA 2J8FA 2L5HA 2A79A 4C6DA 1VEOA 1KR4A 2C2ZB 2J0QD 1AH0A 4MKYA 1N82A 3DRSA 3EDRB 3KK2A 4HNVA 2OMLA 1JLAB 4MJKA 1SFJA 3HHNB 2YWFA 3MPYA 1QE1A 1H7PA 2MLYA 4HI2A 3EOSA 1HNWJ 3A3XA 3W88A 1KRPA 3DG3A 3TQ1A 1S7HA 4KFBA 4F2RA 1FDYA 4DY1A 1FXRA 4JI0J 4FXSA 2Q6ZA 4O4GB 4IQEA 3VNLA 4JHOA 3QGKC 4IH7A 3KFTA 4WXZA 2QDGA 2ZM6J 3UU0A 3N9SA 1FD8A 5T14A 2G2ZA 3UXKA 4K7QA 2RS2A 3WQEA 3CMFA 3E01A 3IA0A 2YW3A 4PA8A 4P61A 1JCYA 4CNZA 3SV3A 1TL5A 3N2TA 2BDQA 2FJKA 4Y9OA 3ZSTA 2XZWA 2YOCA 2CEQA 1KHWA 2FHFA 1PX4A 2DNQA 4QW8A 3QPIA 4EPKA 1FCQA 1REQB 3K1GA 2Z29A 1V3ZA 2C2EA 3WQ4A 3BW2A 4TOQA 3U5UA 3AOBA 4D8AA 4F79A 1NSQA 3L65A 4OT7A 1OFEA 3TDFA 5BXSA 2MYFA 2PEBA 4RW4A 4PR6A 1AUDA 1VB9A 2DCUB 3IM9A 4NNBA 1B0PA 3D6FB 3FCHA 4FLOA 5J2MB 5GVQA 4XBKA 3TW9A 2MLZA 1LM1A 3FEMA 3PWGA 2QVNA 4PWWA 1S10A 1UCWA 4DM2A 2JFDA 4Q8WA 3BBCA 1ITXA 1XLLA 1YBQA 3GFXA 4QU7A 3QHMA 3N12A 1XIBA 4KGJA 1V93A 2VUNA 3N25A 5C2CA 1JXJA 2VEFA 1UWAA 4D8ZA 1PYMA 3CXCR 2FZMA 1H6KX 4XIMA 2CG8A 3SM0A 2B4OA 1NKCA 5DQPA 1QPKA 1TAUA 3Q8YA 2A6MA 1D9FA 4LF4F 3DBPA 3G8EA 2OSXA 1EHNA 2PDAA 3HFVA 5B7WA 3MWAA 4ORIA 2AD9A 1OWQA 1KQZA 1WB0A 2ZXBA 1KNZA 2PTXA 4DQWA 2E9ZA 3FAXA 1U1RA 1ONRA 1NF7A 3FXGA 2ZH6A 4JTJA 1AJ0A 2C1IA 4WY0B 1X8FA 4CTAA 2J9EA 1UB3A 4RV3A 2XLIA 3WX8A 3PBUA 3S8SA 2QMUB 2B6AB 4ZP8A 1GJUA 2OTLS 3FEYB 1J93A 1VS3A 2RFGA 3I96A 4HR2A 2D1CA 1UH3A 1FE0A 5KOXA 4MB5A 4ZVQB 1ZRQA 4J28A 1D8CA 7TIMA 1KA9F 4TXEA 2YL8A 1IUJA 4IZGA 4F9JA 1KRMA 3LP0A 3WH7A 4O17A 1Q6GA 2UU9F 3GIMA 4DVOA 3I4EA 4L80A 4LYPA 2H65B 3NNCA 1VH7A 4HTYA 2MKSA 1IHIA 4J5OA 2POKA 4Q4MA 1ZZMA 1JK9B 2WZTA 4W86A 2OOGA 1IGWA 4EO6A 5DO2A 2ADBA 3T8LA 3COTA 4LEFA 4JOMA 3FAWA 4GCXA 1SO5A 3URQA 5HR7A 1XTZA 2FVCA 3TYCA 3ISNC 4WJBA 5LHFA 4RDVA 4DUYJ 2LMIA 1IF2A 1EFZA 3SRFA 4ECXA 4KKOA 5E2QA 3QYSA 5DCDA 3VU2A 3RLVA 1WO2A 2E1WA 1ZAJA 2VX7A 4FB7A 3N18A 4KETA 4NCGB 2A3EA 3A5FA 3M8YA 1P8GA 5HLFA 1LKZA 1IT8A 1WAWA 2YYTA 4AZBA 5KFAA 3IIXA 4GVIA 3G87A 3GPAA 5EN1A 5LOQA 4EACA 4DL2A 3B4YA 1R8CA 2NVAA 1RD5A 4GY7A 4CD8A 4NZ6A 1TWSA 3LI0A 3G18A 3CCRS 5LSMA 2GQAA 3U1LA 4K1WA 2X1RA 2VG6B 1SKSA 1N55A 4WFBQ 3R5CA 3SQMA 4MKAA 4BC7A 3NCQA 5L1JA 4DSLA 2D9OA 1P1LA 3FCPA 3Q2TC 1IN0A 3DDNA 2W8LA 4WKAA 4IDKA 4AEOA 3VVTA 3PO5A 3WQCA 3OUYB 2GJ2A 4CO0A 4LUSB 4Q22A 2H8ZA 3HJEA 3O16A 2XMWA 2HBYB 5B0GA 3KOAA 1FKOB 1XINA 4CYUA 2PTWA 1CVJA 4RK8A 3GBDA 5ABHA 3MU7A 4C7FA 4UTHA 4RNJA 1XRSA 1OZQA 1P6WA 2NQZA 2CQ4A 3UWVA 1SQEA 2I1RA 4O23A 2PDMA 3VYLA 1URNA 1KLMA 4AHOA 3GD6A 4XQ6A 3BGJA 3DYOA 1UH2A 2BJ8A 1EH9A 3FSYA 2KZZA 3MB9A 1BYAA 2P0IA 2IDEA 1N5QA 5D9NA 1R27B 3TJ4A 2BJ9A 2F84A 4GNVA 3QATA 2F7FA 4ZVRB 4U9RA 5CZ0A 2GQCA 4I69A 2IPOB 2V68A 2H3BA 3T8QA 3IJ8A 1N8WA 4J3UA 3CPGA 2YH0A 5A8QA 5BZAA 5EMYA 4UQTA 5HA7A 4P8VA 1V9OA 4Y6IA 3PZNA 1IZKA 1YXCA 5AXKA 3UBPC 1PHQA 2GVEA 3SRHA 2FZCB 2XTJP 3V6DA 1OHLA 1NSAA 5ETNA 1TPWA 3RW6A 4FF7A 2R2UA 4LV9A 4DJDD 3C15A 3W1UA 4GNJA 5AYXA 3DOLA 4KH0B 1K8YA 2ZHOA 1IR0A 4WOZA 1IM6A 1H63A 5E7OB 4UNKA 4Q8OA 3M2UB 4OI4A 4PUWA 3P7YA 1FDZA 4C98A 1U49A 1PJ9A 3ONBA 2D69A 2PI6A 3T09A 3W7MA 2N3OA 5CXPA 3BW3A 1C8QA 3T2PA 4OMFG 1G67A 3DM2A 4O10A 3ANUA 3BL3A 1HKMA 2XIBA 4B3KA 1K0VA 1PAMA 2FDNA 1SJBA 1FO1A 2WW4A 3JUGA 2B0GA 5A6JA 2I5JA 3TZWA 3EKLA 1R31A 1ZS6A 1ZH5A 1MUMA 2OH2A 3GTYX 5M1TA 4Y2IA 1HFBA 2M0GB 3HA1A 4NJJA 1TPVA 3TQKA 4UCGA 3IGHX 1W3TA 5A8MA 1NH7A 1Q2SA 1X4EA 4X4VA 1I1XA 2OQHA 3O63A 3Q8PB 3VK5A 1K02A 4OUIA 3WDRA 1E6ZA 4ZA0A 3DI6B 3DDMA 3CDBA 2PE4A 2ZEJA 1XDLA 3CLWA 3BN7A 1HMVA 5AZ0A 2O4QA 2HBQB 4AL6A 5DRCA 1SO6A 4HA3A 1S1PA 1H5VA 3LD5A 2J9DA 3O0FA 1TL3A 4GQ0A 1XYLA 3VUPA 1NDYA 5F1VA 1BVWA 1JD9A 4H6EA 3CCZA 3GVRA 5ETSA 1UMLA 2WSPA 4KV8A 1VFHA 3AUOA 2ZC4A 4QR6A 5B7YA 1ZGDA 3ENWA 4OTKA 1IR1A 1BWLA 3CL6A 1YZ7A 5GVJA 5K9XA 4WKYA 1QHOA 3M8QB 1PDYA 3LRLA 4JDYA 1Q82T 5EMMA 3CULA 2VUGA 1N32F 4W5UA 3RM8A 1G3OA 4O14A 3S8HA 1X60A 4DX5A 3TZNA 1G0CA 4QWBA 2YKMA 3H7VA 4X66J 1PIFA 1RQ0A 4K1GA 1FWWA 3KUGA 2DNPA 1Q4WA 1HNWF 4KWVA 3NNTA 3FY1A 3HJVA 1N8IA 1OIFA 3BK0A 1IWGA 3GVVA 5CGMA 3CC7S 2K06A 1WQ5A 1Z6KA 1LWXA 4LF2A 5D2WA 3OVRA 4IIBA 2J47A 1KM3A 3BQ5A 1M68A 4PUEA 5LYRA 2O9PA 3BAIA 1DV7A 1BMQB 2ZM6F 4DUZF 4O57A 4ACZA 2Z1XA 3BB5A 3SCVA 4RDWA 3ZFHA 3EXCX 2D3LA 2FJBB 5AZ1A 5ABEA 3O1NA 1DXFA 1SVDA 4R88A 2YJQA 3MUY1 3OZYA 1N0UA 3CEDA 3VNJA 4USWA 5FA5A 4FPRA 3B0UX 2RGLA 4E2OA 3BGRB 1TWDA 3ITGA 3URNA 2D7SA 4IIFA 2YCKX 3T0TA 3GR7A 3I82A 4GYKA 3VNIA 3HFKA 3TH6A 3JS9A 3TROA 2R9LA 3NP5A 1ZAIA 3K8KA 4M6QA 4RW7A 4YNGA 1CJKA 3CUHA 3DRSB 3KK2B 1EJTC 2FFIA 2CPDA 3FVDA 4FF1A 1VHCA 5CCLA 1DKWA 4ZE4A 2EPOA 5EWGA 2XFYA 3AXKA 1EETA 3NG8A 3H22A 5KFRA 4UTLA 4ZCIA 4LF7F 3HV9A 4M24A 1IEQA 2A6NA 2XCPA 1M9HA 1FX4A 4L56A 3UWUA 5JH2A 4KFBB 2DZXA 4RDYA 2XYHB 2QUUA 3D47A 2KT2A 4GO7X 3W87A 4Q8FA 5K9CA 4AIEA 4HH0A 1VFTA 2VQUA 1MSWD 3W65A 2NT1A 2HMCA 2X3GA 3CJQA 3DHFA 2ZIDA 1Q2RA 1YI2S 1GYLA 4QP0A 5IC6B 2QA2A 3PJ9A 1EO7A 1TKTA 3E01B 4NWBA 3B9NA 3BQ0A 2CAJA 2HS8A 3DI0A 3CD6S 5E0OA 3GR4A 3KAOA 3GC2A 4V28A 2GV1A 1TV6A 3WEZA 5E41A 4E2FB 5KZ6A 3OQ2A 3IRWP 5TIMA 1CGYA 1TV8A 4RU9A 3F5KA 3WC2A 1Y5VA 5D4OA 1NDLA 2HLTA 5LXXA 2XVGA 2HVIA 5IFTA 4ZO8A 2QLWA 4IGSA 4RW4B 3VDCA 3EGVA 3PWIA 2AV5A 1JJKA 4N77A 1H09A 3GE7A 4D3HA 1VYSX 2CLLA 3AWNA 4B4FA 2HFSA 1DAXA 1YBQB 2NSCA 5GQBA 3UA4A 3WFLA 4NRTA 1G94A 3LPYA 2EW9A 5ABFA 2Y1JA 1QTMA 2IPJA 3DCPA 7XIMA 1L5UA 4GZ7A 3G1VA 5LSLA 3O0KA 4FXWA 3PFEA 4JHMA 1RI7A 5DMYA 2DFAA 4I9JA 1KV5A 1V51A 4LUIA 3EDDA 1RTHA 4EPDC 4FA3A 2WHMA 3W38A 4NEZA 4XKYB 3Q37A 2X1GA 2Z2ZA 5DGBA 5AT1B 2BX6A 4JIQA 2DZUA 4IICA 4GISA 1VRUA 4DV6J 4KEVA 1ZPWX 4EFAC 4AX7A 5KFLA 2M7SA 2C13A 3NY0A 2WMFA 4D9PA 2E5GA 3M0YA 2G0IA 4S3BA 2M3DA 3SJNA 2C2NA 3DEQA 4JKKA 1VQ8S 4GXWA 5G4WA 5KETA 1X0PA 4UFKA 4GVLA 2FZGB 4ZVGA 2RDUA 1SJQA 4WTOB 3DH7A 3NFUA 1W54A 4K8HA 3LP0B 3ZZPA 3TX0A 1SYTA 3KBVA 1EHWA 5B0CA 1DTNA 1T40A 2EWHA 3BV4A 3DLJA 1FKAF 4WF9Q 1CGXA 4Y8FA 2MZSA 5GADI 4GJ1A 3WLMA 1P0DA 2VMFA 3TK7A 4DG1B 3TCEA 3WLTA 1JPKA 1S2TA 2GS8A 2R8HA 5A1AA 1ZU8A 1JFHA 3T55A 4HVXA 3RJXA 4D6IA 4E2BA 2B31A 2NUHA 4DN9A 4ZPBA 2HFNA 3FSTA 3BM7A 4J3SA 4EEYA 3BLFA 3GY1A 4JY9A 1HW9A 2V94A 3ZTPA 1GHRA 3I10A 2YVSA 3WK2A 3M5XA 5H9EJ 3RMJA 4US6A 1KM6A 4EYHB 4PWUA 3MUCA 3VCNA 1XLMA 3B05A 4KKOB 1B7FA 1OGSA 3LPOA 1JYVA 2YW4A 1QI2A 1J79A 4ENOA 2FHKA 3ARYA 5HLFB 1L8NA 3OODA 2DNHA 3E5BA 1P7TA 1IZCA 3A47A 1EARA 4TVAB 3BOLA 4NYPA 1UWRA 1T02A 2EFGA 3I5BA 2HEKA 4EAYA 3AJ1A 3VQSA 3GBEA 1UD2A 2FZDA 4M94A 4I6KA 2K7JA 2DRDA 3VGEA 3U9IA 2R82A 4ZE5A 2W4DA 1S9FA 3GP9A 2FPHX 3K2YA 3WLJA 2VEGA 3L0GA 1IKXA 3UT0A 4LFCJ 3UDCA 3W83A 4HCDA 4N8OA 1NK0A 4O0KA 3ARXA 3GNXA 4QISA 2ABYA 1YDNA 3OVSA 3Q94A 1R8BA 1E43A 3V35A 1P9YA 3TEHB 3KHRA 3I7QA 3UW1A 3NOGA 2OP5A 4B3RF 1P6CA 1ZY9A 4ZN1A 4IJCA 2VHGA 2VFDA 4JTAA 1U47A 3MANA 2Y63A 3GVQA 4WYWA 5CYJA 4CYUB 1Q6FA 3VKAA 3Q89A 1TV4A 1XLDA 2WQPA 2IUZA 1XIJA 5AOUA 5BRPA 1R2TA 4GKJF 1E0WA 5DDOC 4JI2J 1OQ3A 2J9YA 3DLGA 1KLMB 4ATLA 2OT0A 3KL3A 3RU8X 2C1EB 2KAUC 5EMJA 3SQOP 4RW9B 3VOFA 1RBAA 2XIMA 1YNQA 4ANEA 3JQMA 3W1RA 4HYVA 4USHA 3C19A 3ZWTA 3MGJA 1O7AA 1H3GA 2VFIA 3GXNA 4AU0A 3WLIA 4M8LA 5B09A 3HJFA 4IIEA 1EPXA 1NDWA 1TV7A 1VS1A 2KM8B 1S6QB 2CADA 3CUNA 4QCLA 1LLZA 1DIEA 1NJYA 4HB7A 1CNVA 4HHMA 1EWDA 4PQUA 2GQ2A 3RR1A 4A3YA 4GI4A 2KO1A 4ZVUB 3C15B 3AHPA 2P50A 1YW1A 3G71S 3PUOA 1HBOA 3GAKA 1M1GA 4X0VA 4FZIA 4HCLA 3EWXA 2P3ZA 3NSMA 3MHFA 2R1MA 2ONEA 2HTMA 3D2WA 2C22A 2D2JA 1V3KA 1VCFA 3MMCA 4RR5A 4KC5A 1IBLJ 1T96A 4MY1A 1DVJA 4XVEA 4PBEA 3DM2B 3ATZA 5HUOA 4Q6JA 4DI8A 2IKJA 3HFZB 4CQAA 2QV5A 4WKHA 2DIVA 4QIEA 3RXZA 4AVNA 4J7RA 1GKPA 3KWSA 1SI9A 1QBBA 5BNKA 2I5JB 4RWWA 3S42A 3TJ9A 3GIPA 4JY8A 4UR8A 1X4DA 5C25B 1ZJAA 3R1ZA 2WJEA 5B0AA 4X66F 3B8VA 1H38A 4GYPA 3P2VA 3DHXA 3VD7A 1KVIA 4Q6XA 1UP1A 1EB3A 3W9HA 3ABZA 1HKWA 5FD1A 5CYQB 4B5UA 1AZ1A 1C8VA 3BICA 4ZDNA 4JTRA 3NNHA 5E3CA 1KCLA 2TRSA 4PEEA 1PVNA 3KLKA 2I9SA 5DX7A 1XYCA 3KLGA 4JIHA 1VFUA 2WNNA 2RHSB 1POKA 1UKSA 2Y7EA 1TL3B 1UA7A 1QJWA 1E6XM 2K3KA 3U7VA 4J9VA 4DV2J 2W5FA 2LQ9A 1DTUA 1M5VC 1K9FA 4KV8B 1HD0A 5AY7A 3TQEA 1F4HA 3H54A 1IM4A 1OY8A 1DIOA 5D32A 1FTCA 3LI1A 3NGJA 3BSAA 3Q65A 4IP7A 4F2SA 3M0IA 4EE9A 4BHYA 4H9TA 4LX4A 4AWEA 4DX8H 2ESCA 2RF2A 4BQ2A 4I2QA 5AFDA 3RBEA 4G5DA 5HWMA 1UP2A 2UVWA 4R7JA 3RF9A 2OG9A 2YKMB 1EPVA 1H7XA 1T9WA 2J79A 3BJYA 1L6WA 3PSVA 3BC9A 5CBBA 1LWCB 3D6MB 3TWZA 4JKLA 2LEBA 1EJVC 2Z1BA 3ISND 1ZQ5A 3UXAA 1XIFA 1IE7C 4P7RA 1Y00A 3DDIA 4MB3A 5AN7A 4LMZA 2XSBA 2FZBA 4DO5A 3IO1A 1RJRA 1I45A 1WYIA 1NHUA 3KLHA 4WPAA 4ACZB 1M5SA 3ABOA 4RCXA 1YDLA 1DARA 2IMOA 3CSKA 1WKJA 1U1QA 3PZ9A 4IG0B 2HXUA 3VTRA 2J6SA 2MSTA 3KW3A 1EX5A 3EVWA 3R43A 3G3MA 2Z8QA 2VOOA 1UOKA 1C0UA 3H4WA 1BTCA 4W8AA 3MT1A 1V4YA 2R7QA 2CPIA 3S6OA 3M41A 4JQAA 4M0XA 3BPWA 2B43A 2JDJA 5T7LA 2QS8A 3S1XA 4GK8A 2QV6A 1XICA 4FX8A 4S2BA 1N6QA 3TW6A 3WMCA 4JKMA 2ZOMA 5M2RA 2WNQA 4AD1A 4RW7B 3UD4P 3NZQA 3KP0A 5FI8A 3SEPA 3M2VA 4MTVA 1XQIA 1V3IA 4L9XA 4BF7A 1IQZA 4J9KA 4A46A 4AWSA 4Q4SA 1EETB 5EWEA 3CCSS 5I3QA 4JI3J 1PSCA 1YBUA 4IX0A 3BGOP 3V7PA 2QL9B 1JDAA 3I7RA 2V5KA 4ER8A 3SECA 2HCVA 4KF1A 5G1YA 1WWHA 1EDTA 2XS2A 1IJEB 3OR1A 2N4DA 4X4NA 3CMES 4CEXC 2HRTA 1W2PA 1OJXA 1DWAM 5D0EA 1OIAA 5LJ3Y 1TKTB 5KFWA 5SUHA 3UCUP 4P8WA 3K89A 2NQLA 1OBAA 4KTQA 1OMSA 1JNDA 3MECA 4DUXA 2DDXA 1S1WA 1TV6B 3M32A 2GWGA 4LF5F 4YJ5A 4WE1A 1ZBKA 3OPKA 4BEQA 3F2DA 1AJ2A 4QRNA 4O44A 1NZ8A 1PS9A 2BLEA 3HSZA 3TAQA 4DSEA 4B5VA 2Z2LA 4V19J 3KDOA 2INFA 3M8ZA 2L48A 2VG5A 3QSTA 1OCNA 2WW8A 4DU7A 1OFRA 4XZIA 3LF0A 2ZTJA 5DXYA 5A6TC 3APGA 5K2ZA 4N9BA 3VIOA 2V5DA 3I56S 1EBHA 3LMZA 3BOFA 2PF8A 3P4UB 1PGZA 1FXDA 3QZEA 4NI8A 1SJ4P 5ABFB 5G2WA 1NSKL 3LV5A 2VB6A 4UQEA 3S1WA 2B4VA 2D0GA 3NEHA 1XFBA 3ENQA 3MEEA 5KT5A 2J7BA 3JB9k 4XAYA 1AODA 1FXQA 4AD0A 2O66A 4UMAA 3KOXA 2B7OA 2CZEA 3EEGA 1V6TA 1IKYA 3PZVA 3QRRA 2BE2A 2CZDA 2DIJA 1RTHB 3CHDA 2HROA 1PTAA 1PUDA 3CUGA 3L4BC 4NYOA 4HMDA 1QWKA 3BV7A 1FWHC 2WAGA 4Z17A 1FJCA 1F3VA 2NVDA 1UCNA 1YWXA 3BKTA 2CKRA 4P6QA 2WAQD 2YWEA 1WXYA 4AT1B 2YYUA 1F05A 2GHPA 1GYNA 1VK3A 4XK2A 3CK5A 1WUEA 5EL1A 4IG2A 3FHQA 4DPQA 1Y0HA 2HK0A 4ZHRA 3XIMA 4JYAJ 3N01A 2XVNA 4PUMA 4CEUC 1WKDA 5HBMA 2ZYFA 3H4BA 3RX2A 4BF9A 1AW5A 4XZMX 1CSJA 4ED0A 3OBAA 2RIJA 4DWIA 3TWBA 2XH2A 1J0JA 3E3XA 4WOQA 3ZJKA 4DPOA 8AT1B 2ODOA 2GZXA 5M03A 4GYFA 4PUOB 3SMZA 1DXIA 6ENLA 1T03A 1W9BM 1MWYA 3S3GA 4K5RA 5F41A 4PB3A 2ASDA 3NDYA 3TMQA 4JEJA 3HHKA 5CC7A 3UJSA 5A2BA 4LQ3A 4UQAA 3D0HE 1PYFA 3AIVA 3IANA 6TIMA 4ES3A 2OLAA 3TR9A 1A49A 1K70A 1P1TA 3A64A 2NSOA 4FR1A 4LANA 2MDAA 2E68A 4ZVEA 2QUNA 7ODCA 1H3DA 1FE4A 1SFSA 4LU0A 4GBDA 2OAUA 4MIWA 4C8MA 3TQ0A 1JEZA 1S6PA 1B5TA 4ZN3A 3AHYA 2NYHA 3HQOA 2NV9A 3UESA 4Q2LA 2WVEA 2ZUVA 4LUBA 1EJXC 2M5YA 5L9NA 1TKXA 4ELUA 3LPEA 4TQTA 1ZP4A 2VZVA 5F3ZA 1JPMA 5HXMA 2QT7A 3PZMA 1C0TA 1P7TB 1DE6A 4AZ7A 3QPZA 1XUUA 4NEYA 3GIQA 1FJ7A 3N2CA 1T9UA 5LSRA 2X1BA 2ZX6A 3CDEA 4YB6A 2G4JA 4C0OC 1R8AA 2M88A 2WNZA 1NDPA 2WBRA 1IKXB 3JQKA 1OX5A 3ADAC 3LANA 3RB4A 4LSBA 2V8ZA 3TVKA 3T4CA 4K2SA 2C3ZA 2C2OB 3LDVA 2AP6A 4IPJA 4KGLA 4Z2IA 3OD2A 4F8XA 4CQBA 1LT7A 3DFNA 2QUVA 1U26A 1JXLA 2J7GA 3KBNA 2BGQA 4DELA 4S1FA 7TAAA 1TQLA 3EGNA 1W1A1 3HHLA 3CWNA 3S2MA 1E0VA 4R8UA 1V02A 1VGYA 3VAMA 2AKZA 2YTCA 1SXLA 3G82B 2D24A 3KUMA 4D6CA 2PTDA 3VNYA 2PA8D 2VA3A 2HIQA 2X40A 2MHNA 1PEZA 1JCMP 3PTMA 3MWBA 3W6MA 3CJTA 3GS6A 4O1FA 2OWCA 3DLGB 3M5VA 3MP5A 1F76A 2QPXA 1Q8JA 1IBLF 2DZWA 3BBFA 5DN1A 4DAFA 5ETKA 3W7CA 1R0AB 2KFNA 3HN3A 3P5BP 3C52A 4M5KA 3SBMA 4ANDA 2FVQA 2HNDA 4ETZA 1GQJA 1ITPA 1SJDA 4O50A 2HQFA 2FZNA 1GAOA 3QPEA 3MSYA 2AGTA 2KXNB 3TYZA 1U0HA 2N82B 4OZ5A 4ECSA 3AIEA 2BNJA 5CZVA 5CHCB 2FJVA 1BQNA 1H50A 4O1AA 4C8OA 4ZVFA 4PQUB 2PB1A 2DNRA 1KOOA 1ZM3A 2YWHA 3MZ2A 2Q71A 3WG6A 3FFIA 2WMIA 1HBOB 4WSHA 3MCSA 4Q7AA 4CLPA 1IT0A 1P5BA 2JKEA 3ONCA 5EX3A 2AYBA 1VFLA 3STFA 4F48A 1RPXA 5IHSA 3MMCB 5J5RA 4KRUA 4HDGA 3BSMA 2XHCA 3BDKA 1CLFA 4QJ4B 4GMEA 2C2KB 3FYYA 4KGKA 3FK4A 1TCDA 3QR0A 1WC3A 4GE8A 4ED6A 5JXQA 4JTLA 4F67A 1HR0F 4EWJA 2HMIB 4ZJOA 2GSHA 2L9DA 2V30A 1DJXA 1WE5A 3R6IA 3T1GA 3WQGA 2JC0A 2W9BB 4JZ5A 5KZMA 1VQOS 4F0LA 4H6QA 3AJ7A 2W7OA 1SH0A 1UVMA 1MW3A 1VDHA 3VPLA 3BKUA 1WDTA 4O3OA 1H5YA 4MG4A 2ZRWA 3T2OA 1Q78A 1S2UA 3H25A 5H91A 3TA1A 4CT8A 1ZFJA 4MH8A 1WG1A 2J7UA 2OLHA 2WVCA 3CZEA 3KLGB 4DV1F 1OGBA 3LBCA 5D4LA 2X1IA 1UR3M 2R8WA 2DSVA 1K4GA 5M2PA 4OYAA 4ECUA 4WCJA 4JBRA 2Y8KA 3T0AA 1V3HA 1FWIC 2ZRZA 5KFPA 1D7FA 1QAPA 2UUTA 4KHMA 2EJ1A 1BXCA 5AJ3J 3BZGA 3AT1B 2PDXA 5U47A 4O3SA 2SFPA 3DGRA 4HI1A 1VQ7S 3PNUA 2EEYA 4CD7A 1RAOA 3NJ3A 3LAKA 3STCA 2PZ0A 2RVJA 4OUEA 2WW5A 1Z48A 5I42B 1B1YA 1KD1T 1N33F 3PPFA 2RF2B 4I2QB 4DR7J 3MI7X 5HR6A 4S3DA 9XIMA 3AXXA 3NLCA 4OHWA 4DN1A 3Q22A 3BH4A 3R0KA 3MHYA 4HKPA 2IY5B 5FIPA 4JI3F 2EGZA 3W23A 5KFNA 4FNQA 3OHIA 2OLSA 1A7GE 4TY8B 1W7WA 3F0NA 1H1ZA 4RUBA 4NXKA 1R38A 3WO8A 5CC3A 1ITUA 1RB0A 2DD8S 1TL1A 5AVHA 3KLHB 1FT8A 3ITXA 4IMAA 4JTEA 5EKYA 1NDCA 4HDHA 3T41A 4NAEA 3YPIA 4NX9A 4KHPF 1K03A 4ZEPA 5XIAA 4PCQA 1A3WA 1F3XA 2QMKA 1RK8A 3VHQA 2V67A 1EJWC 5GAGI 1KBLA 2UUWA 2XLKA 5LXYA 4TMCA 1C0UB 1BFNA 3DFYA 4BWJA 5HNTA 5E3RA 7CGTA 3LUTA 4GFIA 2GNKA 4RXFA 4BCEA 3QNWB 1UOZA 2PI4A 3T1AA 5T7LB 3Q8SB 2ON3A 2AMGA 4XO6A 4N76A 2O9TA 1CGVA 1NWTA 2FVLA 4GUHA 1OJ4A 3M2VB 4KEUA 4MY9A 3OU8A 3AC0A 1RT4A 3W02A 1FJGF 2VOMA 3LRKA 1K1SA 4JTKA 1X98A 2O67A 1IT7A 2BKOA 2G9OA 4QEHA 3RAQA 3OR1B 3TSMA 2ZOGA 1DWGM 4PKDB 3OTEA 1K6WA 3PNZA 2WOMA 3BGGA 2YCEA 3GVGA 2HBRB 4EXAA 4G65A 2CQCA 3DGVA 1XBVA 1NPKA 2W1BA 5KG7A 4K4SA 3NAVA 2ZKTA 4HK5A 3G2XA 3KVMA 4A21A 3MECB 1S1WB 3M32B 2JQXA 3HGSA 1JX4A 3IGNA 1FWNA 3A12A 2O3DA 1RISA 4ILLA 2WBMA 4XUYA 1FFSB 2OFHX 4O44B 4I90A 2AJ0A 4ECZA 2PA3A 1Q3NA 3AYRA 2MUCA 1XNQF 2XWDA 3KNAA 2EG6A 5E33A 3CJKA 1VHFA 1Q6CA 4L73A 2DPJA 1Y4ZB 2CQ3A 3MO4A 3UWQA 5DDPC 2EXOA 4XUGA 1V3SA 2VC9A 4I4BA 3V2UC 2E09A 3R2DJ 4ICLA 3LTSA 1XISA 2RNEA 5GAHU 4V1YA 2BB0A 2DZPA 2CWNA 3H26A 3V1HA 5A2QU 2PDKA 4OJHA 3RBXA 1VJQA 2RAQA 2U2FA 2P9EA 4I7VA 2CLOA 3N11A 4X4RA 1DJYA 2WANA 3V6JA 5I3UA 4QZVB 3QZ6A 3ERPA 3CBWA 2B7CB 1IKYB 3FGCA 1VK8A 4TMBA 2BE2B 2KRBA 4B3ZA 5GNYA 4F7VA 1WXZA 1ZM4A 1U1PA 4Q0BA 3V5OA 4WY0F 3QHOA 4Z42C 4X9YA 2I9UA 2OMOA 3K5PA 3MURP 1N36F 4UTWC 1NXIA 4RLEA 4JAWA 2DISA 2NV2A 2E7WA 4H04A 2VGFA 2VWTA 3EWGA 2IPGA 4AISA 4KQNA 3AJDA 4K4VA 3ZO9A 2W9MA 4A8XA 4P7OA 4MJ2A 2DSZA 1SR0A 3UG4A 1H0GA 4AZHA 4H8HA 4XDDA 5HWNA 2D74B 1WX0A 3IJ6A 1W3KA 3TJAA 4ZHRB 5JUMA 1EC7A 2W63A 5HBMB 1OVDA 1Z9AA 3LWLA 5IM0A 1WC0A 1U02A 2XUCA 1U6BA 1V3LA 3UJ2A 1FDAA 1Q7MA 2HWHA 3BLPX 2QLXA 2Q01A 3WDOA 2JC1A 5EWFA 2LKZA 4OHVA 4PFMA 5HN0A 1HQ2A 1VCVA 4E98A 3OPSA 1VJSA 4Y9NA 2FVKA 2KU7A 2VDGA 1ESWA 4KFOA 4HACA 1KFKA 3DC0A 4L4LA 4NZ1A 4PYDA 4S3CA 1E72M 3TVYA 2OU4A 2VZSA 3UXLA 3PYEA 4MVAA 2PWGA 4LRFA 2YA0A 1C9WA 2PP0A 2ALDA 1TKXB 4HJFA 2AGKA 1TK8A 1O68A 3M05A 1FCVA 1FVSA 4XWUA 2AU0A 3PK7A 2MB0B 2DNLA 1C0TB 2BQ3A 3POCA 5D77A 4URGA 3OW2R 4GYPC 3AOAA 4JB8B 1BKSA 4LVAA 3NPVA 3O6AA 1XHGA 2GGPA 4L3NA 2RQKA 1TPC1 1JXEA 4MAVA 3DOPA 1CPZA 3DFPA 2YX7A 5DCBA 1DQXA 4M51A 5HAOA 1E1CA 2O92A 2BTMA 3H98A 4WP9A 1QOQA 3FDKA 5M2FX 2NT0A 1R6VA 4LSLA 1Y9OA 3OVAA 1TUXA 5F8LA 5CYMA 4WKRA 4H7ZA 1AUSL 4MWAC 1RT3A 3R6LB 2GGHA 4LY4A 3P82A 4LH8A 2OZ3A 6ALDA 1RHCA 4JP8A 4F0SA 4NLVA 5DZ6A 2N7CA 1CS4A 4IYQA 2EF9A 4RXGA 2W91A 1AQHA 1U2RA 3K13A 3IWXA 2F8HA 1U2YA 5HMWA 1SKUB 1EKSA 4K8EA 4REQB 3NQDA 3TONA 3DHDA 3DXSX 3ILOA 3G24A 3SZ2A 2UZAA 3LALA 1H61A 1XMQJ 4YWSA 3FNDA 3TTOA 2PT0A 3FEXB 3QGVA 2CQHA 3HPSA 2X8RA 3GXTA 4FZVA 5EA9A 3B8TA 2FQIA 1JJHA 2G95A 2MZJA 2PWHA 3OVGA 1JQGA 3VGSA 5CPLA 3G1DA 1V0MA 5IOLA 4AD6A 1SO3A 1BXNA 1HQEA 3RPMA 3W71A 2B7NA 3IR6B 1U0HB 3ZJ7A 1TV5A 5LXEA 2HISA 1XIDA 2INZA 2CUYA 4CLSA 4OQJA 4I68A 1AD4A 1BQNB 4HOWA 4ZR8A 1CXEA 4TX8A 1KQGB 4GKKJ 1FDJA 3TYAA 1BQMA 1RAFB 4A8LA 3FFIB 2WMIB 3DYAB 2G1DA 4J2MA 4EMDA 1RWWB 4B3TJ 3E74A 2A4AA 2V0NA 1EF3A 2VOTA 4LVBA 3LCWA 1XD0A 1NK6A 3S83A 1PDZA 4WUIA 3VFCA 3THCA 3H2AA 2WC7A 4MZYA 5AJ3F 5C71A 4B9SA 2HVHA 3HURA 3AXMA 3ZWSA 4UF4A 3M6XA 3CD0A 3UW6A 2NXIA 4QS5A 4M6PA 4NYUA 2G8ZA 4OYPA 4PMVA 4NLGA 3L4XA 5E6YA 1SM9A 5FJ4A 1XYBA 3N17A 1U6FA 1Q95G 5E0FA 3R5DA 4J91A 4QSFA 4DR7F 1DZ5A 1Z69A 4S3GA 1PC4A 4PXEA 2W8KA 3MO7A 4UOCA 1DXEA 3QOMA 3RMEA 3EXSA 3P0XA 2RRAA 4K7VA 2FVPA 2KI2A 3LA4A 1WOBA 4KH2A 4PXDA 1MWQA 1F2HA 4OJ3A 2G0JA 3CZGA 1GONA 3KM8A 3EOOA 3H70A 4JIIX 4OBRA 2SXLA 1ODUA 3MUAA 4W89A 4H6KA 3N6QA 1XCWA 5FSDC 1JLQA 2HPMA 1NPPA 2LXIA 2CCRA 4B9VA 1U5HA 2WJZA 1OX6A 2FZKB 2WSEC 3ZZ0A 3TU9A 1GOKA 4CU6A 4W90B 1Y65A 2Y0SD 2CLPA 1Q45A 3OP2A 2RGMA 4L74A 3BLOA 4I0WA 1V6YA 3BYRA 4OBSA 2VZOA 3B8WA 2DCLA 2VD8A 3HG4A 1GW9A 4BKNA 1YBTA 4U28A 2COLA 1J2VA 2K1RA 5IBXA 4RNIA 5CCMA 3JAMU 4F02A 4PUKA 4KGZB 4DZIA 4IFYA 4N9DA 2GJXA 2G3JA 1XIIA 3PUDA 1T05B 2OGUA 4QQ3A 1C7TA 3UWZA 2GPTA 2OCZA 4DV5J 3ATYA 1SPBP 3AQUA 1U1MA 5T91A 3RBZA 1TV3A 4WDTA 1L3KA 3W5XA 2CJKA 2J6XA 3P3BA 3KG1A 3CJPA 4W88A 1LQ0A 4GVHA 3V81A 5KSWA 2VPYB 2E6YA 2XLJA 4ZPVR 1TL1B 1B9ZA 4MYTA 1WNEA 3QEZA 4USUA 4A8OA 1YJWS 1NDZA 1RTDB 1PBGA 3UZ5A 1RKJA 4NAEB 3N4FA 5AHLA 4FYWB 1GOOA 3VDGA 2Z2MA 1KV8A 4LF8J 2VCCA 3CMQA 3SCOA 3JQJA 2MQLA 9RUBA 4ML4A 5AC6A 4UOQA 5I78A 1K44A 4DL5A 4LALA 2LDYA 4LAUA 4IMEA 3MM8A 4JFTA 5C9XA 4JTFA 5JBFA 2HFUA 3ITVA 4POCA 4DZ5A 1IXOA 1KLYA 4ZO7A 2MKJA 5KFBA 5IC4B 2ZBQA 3W29A 1ALDA 1Y5NB 4YEAA 4GGBA 1V3JA 2WM0A 3TXZA 4IFOA 4PXBA 4NHVA 4QSHA 4IFRA 4WU2A 2OIHA 1BQGA 1B99A 1G5AA 5ETQA 4B3SJ 4HTJA 1RT4B 1MXSA 5H8MA 2CLMA 1QVBA 1VYRA 3O05A 3RX4A 2QMWA 3HZEA 3F03K 2OKQA 4O16A 4Q4OA 1DJZA 4M1KA 2PSNA 2W6RA 2UY4A 3DUGA 2H5JB 3SIMA 4CVWA 2C1HA 5D9PA 4HPJA 4E8GA 2YZ5A 3GJTB 4Q8VA 1OFQA 2I7GA 4WDXA 3SUWA 5C0QA 5D2TA 4TX6A 3P5ZA 2WOMB 3TJ8A 1CJVA 2GSEA 4QJ5B 4DU8A 1EKOA 2JIWA 8TIMA 3W2MA 4O3NA 2B7BB 5KFXA 5CZSA 2RDXA 2VD9A 2BV9A 1P0KA 4O0QA 3M7SA 4KHRA 4M5LA 4NLSA 1U2FA 5F8HA 4ZB2A 2PFDA 2UUBJ 4Q43A 1HJSA 4QLLA 1HPZB 1GVSA 1QASA 4OZOA 3RB3A 3NQAA 4K59A 5I3IA 5DS7A 3GG0A 4PEKA 5FJOA 3JSYA 1F1BB 2ATLA 2J6TA 2ZZ1A 3FJNA 4WDUA 1FCBA 4C48A 2XY7A 4M95A 3CWOX 2KX9A 4RZBA 1QY7A 4YN3B 4KJIA 2FTWA 3B97A 1MWOA 2P8IA 1E9YB 1R3YA 1XEZA 2MZRA 1J0YA 3OL7A 3H5XA 2F2HA 4ICLB 4O3RA 2BACA 1XSJA 2Q66A 5L9XA 1R43A 1EBGA 1RCQA 1DJHA 4W7UA 5J2NA 2ADAA 3MUTP 4ZQMA 1UH4A 1RQHA 2CPUA 5KOWA 1R87A 4JNYA 3HHLC 5I3UB 1QDSA 1NU4A 1VC5A 4R0JA 4Y0FA 2Y8YA 5C5YA 1QNRA 4L4OA 3FGCB 1JCLA 2HGMA 1R3RA 2WVFA 2QSWA 3ES7A 3TX8A 2FJUB 3L66A 4MNLA 4OIFA 1M6JA 3RDKA 5AB3A 1XR6A 2D73A 1VJWA 4AD2A 4QHRA 3CAWA 1H2VZ 2OSYA 1G4EA 4GACA 4I9MA 4HA1A 5A5WA 1FNMA 4ERGA 3EDKA 2ACYA 3EYZA 2UXBJ 3SSRA 4IOBA 3VMNA 3ARUA 1LOQA 2CZVA 4GY0A 4AC7C 3E0FA 4NLYA 3KLFB 1DPMA 3PIPQ 2GOKA 2W9AA 5KG3A 3GQCA 5FIIA 3BJSA 3OFFA 5EGRA 2V2VA 4PCNA 4TO8A 4C8LA 3EWYA 4NJKA 2X1AA 4ERAA 4F36A 3W2VB 2YDSA 2ZX8A 1MFVA 2YNHB 4FNHA 1D9EA 1WC5A 4M6UA 4EPEC 3N2MA 5DETA 1HNIA 1O5QA 2VVSA 2EBGA 1NF0A 4F04B 2ZWZA 2J78A 3ENLA 3B40A 3CQJA 4U2ZA 1CWYA 2WHKA 3SN0A 2PLCA 2NQJA 2A3HA 1I4NA 1UYQA 1R9XA 1U1OA 5J2PA 4G6VB 3VE9A 4HACB 2NZLA 1FWJC 4OZ3A 3VILA 3VD4A 1SBRA 1ZCOA 3RB0A 2WBKA 1LEOA 3ZOAA 4G7FA 4XO7A 2Z2UA 5K8PA 1GVYA 3VNKA 4PL1A 1B9BA 2OFJA 4UZBA 4KIEA 4ED3A 5L39A 5CLTA 1FH7A 3LM7A 4YCPA 2LVWA 3TYTA 1FXLA 3DDKA 2CIPA 1WZKA 2ZITA 4HHJA 3C3LA 1PILA 4AF0B 4ERDA 3WF0A 5LL6d 1UZ1A 2VJVA 1JJ2R 4U7CA 1BSIA 1EC8A 1ODZA 3R79A 1YZ6A 2ZZTA 3EPMA 3SSSA 4ZLJA 1AQMA 3TEVA 3SRDA 1SFLA 1JQXA 3D7SB 2QUMA 2GGPB 4AYBD 3TTEA 3IJIA 1YPFA 3W9ZA 4X4QA 5H6HA 1WHXA 2R2RA 5THWA 1RGVA 2BSLA 2WTFA