3A13A

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
436
structure length
435
Chain Sequence
YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sturcture-based optimization of a Type III Rubisco from a hyperthermophile
rcsb
source organism Pyrococcus kodakaraensis
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
total genus 149
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3a13A02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3a13A01
1RBAA 1IR2A 5HANA 5HQMA 3QFWA 1RXOB 2ZVIA 1GEHA 2OEJA 4LF2A 5HAOA 5HK4A 2OELA 3AXMA 1AA1B 2YBVA 5HJYA 1BXNA 1WDDA 1GK8A 2V6AA 2VDHA 3RUBL 1UZDA 3WQPA 2D69A 1UWAA 4F0KA 1UPPA 1BWVA 2VDIA 2CXEA 3A13A 4F0HA 1AUSL 1IWAA 2V67A 5C2CA 1UPMB 8RUCA 9RUBA 1UZHA 4NASA 4F0MA 1TELA 3KDOA 5HQLA 5RUBA 2RUSA 3AXKA 1RCXB 2QYGA 4RUBA 3KDNA 4LF1A 1RBLA 1IR1A 2OEKA 2V68A 1SVDA 3A12A 1RBOB 4HHHA 3RG6A 1RLCL 5HJXA 1RUSA 2V63A 3FK4A 3NWRA 3ZXWA 4MKVA 1RLDA 2CWXA 2OEMA 5C2GA 5HATA 1RCOB 2V69A 1YKWA 1UW9A 1RSCA 1EJ7L
chains in the Genus database with same CATH superfamily
5KFSA 1KXTA 5D30A 5H9FJ 1TUFA 2G3MA 4XKYA 4K68A 5J2PB 4JCLA 2NVDA 2J8FA 4LIRA 3EXSA 3OLGA 1VRTB 3LXAA 4QZVB 5E3QA 1CLVA 2HNDA 4C6BA 1OFQA 2RE1A 5KINA 2D41A 2RHQB 3LDVA 1F5CA 5EMJA 4RUHA 2NV1A 2AJ4A 4DV7F 2K7JA 5D4NA 3F5KA 5A6LA 2JDJA 1J79A 3FEYB 1KLNA 1WF2A 3M0IA 1IF2A 2WCGA 3SY8A 5GAEI 1U1RA 3K13A 1S5MA 3BMWA 3ID7A 2C7FA 1MW0A 4UTWA 7TIMA 4U8VA 4J5OA 4GVHA 4MFBB 1S12A 3HPOA 4RNNA 4AQYF 4Z2HA 4G3IA 1UVLA 3PTMA 2CXGA 3PW4A 3L4XA 3R4IA 3QBUA 1KRCC 2G8ZA 3DLGA 2FJAB 1AQFA 4ED2A 1VJIA 2FZ9A 4K8HA 4EO6A 3AUOA 1QVGR 3G87A 2Z26A 4ACZB 3TOQA 1OQFA 1T3NA 1BQGA 2A85A 3LS9A 3KTQA 2K1RB 2MZTA 2UVVA 5C2CA 1RKIA 4QYZJ 2XIMA 5HL7Q 1EJVC 1ULRA 1G01A 2DNGA 4WX2A 2QPXA 1K6AA 3OVQA 1MN9A 3AFGA 3MFHA 2C1IA 3WQ8A 1TL1B 4TR9A 5LIXX 4B3LA 1KVKA 1RBOB 3JU2A 4KO0A 4I2QB 4IG2A 2F8MA 3P6YC 2DQWA 4Q4QA 4Q45A 1R27B 2YKKA 2LDYA 2VD9A 4MAKA 5F9NA 1IBMF 2H9AB 4GX9A 3D6MB 3VGVA 3M0YA 4HNVA 4ZPTR 1MEIA 3VU2A 1XWLA 4PTNA 5FAGA 3BOFA 1KLYA 4NCGB 1YJTA 2FQIA 2JJ4D 5I3PA 3KX6A 1S0OA 3EX6A 1C0TA 3BV7A 3GR8A 4K5SA 3KBJA 2XZTB 5E9AA 3MWBA 3H2OA 2L08A 4DVOA 3BW4A 2NUUG 2VWSA 1IWGA 2UZAA 2B9EA 3HG4A 1GZJA 4FXRA 2FZBA 1EZZB 3GSIA 4USJC 4O57A 3WD1A 3C3LA 2CQGA 5IWAF 2DZPA 1VFMA 4HOXA 4KMQA 3CZJA 2W8KA 2WC7A 2D3UA 3Q8YA 1BWVA 1S76D 1T99A 1FCAA 2XMJA 1RT3B 2YQ0A 3VM5A 4MDPA 4PUEA 5DELA 4GD0A 2OLWA 3BCFA 3PBUA 2XMUA 3BQ0A 4L64A 3KE0A 5HWNA 1D8WA 1GMWA 1T8XA 3ES7A 2YGYA 2HFVA 3UWUA 1NJWA 1YBQB 2XNRA 1UD3A 3K0JA 4HB7A 3ABRA 1ZALA 2BOEX 4Z17A 4UTMA 3F4CA 1DVJA 2EQDA 1Q7YT 1U45A 2APOA 2C3MA 2K3IA 2PN6A 4FPSA 3K5NA 4DZDA 3N2XA 5FLXY 2JEJA 2VDIA 1S2AA 4EWND 2GMJA 3U7VA 4F40A 4RW3A 3A3WA 3PAJA 1F5ZA 3R94A 4DS4A 2G96A 3WCZA 4XKYB 1YE6A 4J90A 4USVA 4OX8A 1Z41A 2OEMA 4GO9A 1PX3A 4OYWA 3PDNA 4LY8A 1U25A 4ROQA 1PYTA 4O52A 4UTFA 3ZLGA 3EZ4A 4ETXA 4FALA 1HYSB 5I00A 4M5DB 3W76A 2Y7EA 6FDRA 2VEPA 4DL0C 1UKSA 2XWEA 1UZHA 2EVZA 3MP3A 2B56A 4NLXA 2ALZA 1L5UA 1GOQA 1V0LA 3JYTA 2HHUA 3EXTA 2QDEA 4TV5A 1X31C 3TQEA 1KRMA 4NWBA 4NYUA 1GT8A 5E3PA 4ACYA 5LIUX 1WE5A 4F02A 5J2NA 4C6JA 1VCVA 4L80A 4LVBA 2PDKA 3CIMA 3QFWA 1M68A 1W91A 2QKFA 5E6ZA 1RPXA 4HKPA 2XCAA 3VD9A 1GX5A 1F76A 3VOJA 2PWEA 1ZSXA 4EKJA 2YKPA 4IUGA 1I0BA 1V5IB 2ZHOA 2HHWA 3R8RA 2ZXAA 3L4TA 4UWMA 3IGNA 3RCMA 1XW8A 3M8RA 4L65A 4NZ4A 4QIVA 5HJLA 1YXYA 3BAJA 3ET6B 3NY0A 1XG3A 1AROP 1TV6A 4IISA 2HCVA 4BI7A 3AQUA 3EE3A 3WL0A 3LNPA 3EICA 1L8NA 2VIHA 3VIOA 4DV4F 2Z27A 4ANEA 4XD4A 4JD4A 4NUWA 4B2DA 3KYLA 1NDWA 2GJXB 3C16A 9ATCB 4X65J 4ECRA 1I60A 1K9FA 1FJGJ 2ZBRA 4LAOA 4GA8A 1S2UA 2CNCA 1FT8A 2X41A 1IR0A 3DHPA 4O0QA 1WUFA 1NBEB 3RAMA 5DS7A 1FTXA 4GOAA 2HWGA 4KWVA 2B4PA 2YH0A 4ZCWA 3GVGA 3OVGA 1JCYA 4JEQA 1TKZB 1F3FA 5K4ZA 4M6PA 1T05B 4LQ3A 2QL5B 4JOUA 1XH0A 4K4TA 3LD5A 1QJWA 1TE1A 3QVQA 3OL8A 2FHFA 4J5NA 3HVTB 1TPFA 3CJ0A 3VQSA 3SV4A 3K2GA 2BB0A 3DGPB 1UYQA 1O7AA 2E1WA 4F48A 1TL3A 4KC5A 3MFIA 3I96A 1TV7A 2IXUA 3UXLA 3VZYA 2OD4A 1D2KA 4E98A 4FX8A 4O10A 6TIMA 3RGIA 1C0TB 1PUDA 4KBIA 4MNLA 4IMCA 3W2NA 3MY9A 5LHEA 2EJAA 3VO0A 3VWSA 3MUAA 4YR3A 4USWA 3OQEA 3TZYA 1WAWA 5LNVA 3K30A 3TI0A 1F74A 1V5VA 3PZPA 3NQ2A 4URSA 4F0MA 3T8LA 2ZZ6A 3QAEA 1Q8JA 4N2YA 4FNSA 2HJPA 2VQUA 3RLGA 2XUCA 3KDNA 4YB7A 1WA3A 5DCBA 3OB8A 4IG2B 2Z7GA 3GDKA 2NQHA 2YFNA 4TXSA 1QDSA 5FSDC 4CLWA 2A3AA 4MNJA 2B7PA 4ZB2A 2AX1A 2BJ8A 3FS2A 3L5MA 4DL3A 1YXDA 2G2OA 3VKAA 4I7FA 1TIWA 3MHGA 4O4VA 4JFTA 3XINA 3NDYA 4M5JA 4QJVA 4DG1A 2I16A 3U9IA 1G9HA 2MTLA 1D9AA 2CLFA 2VFRA 1HW9A 3W7MA 3MM6B 3NLCA 5GMDA 2QXWA 2GWGA 3FA4A 2NZCA 3MI6A 1FOBA 4K3ZA 4FO4A 3MSRA 4XO0A 4ZO8A 5KAKA 1PTAA 4I3GA 4MG4A 2EFPA 4E8CA 1HFEL 2D3O1 4EZ9A 1RTDB 1VHNA 1RYSA 3VAHA 3GNDA 3U6WA 4RPQA 3EJMA 4O8RA 4LRBA 2NZ4A 1AW1A 3WY1A 1EETA 4GYPC 2XYPB 1FJEB 2EO7A 3VCDA 4DUWA 3ZTQA 4M5NA 2DRAA 4BHYA 1UWRA 1S97A 2PC4A 4X62F 1LV5A 1H51A 2XU2A 4ADTA 1HQEB 1N6QB 3WH8A 4L9YA 3R2CJ 3UZ5A 2P5NA 2CRLA 4EXBA 1E55A 2JRSA 2QV6A 2B5JA 1XYZA 4ZJLA 2YKMB 5AHLA 4WY0B 5LMUJ 1K4HA 1TAUA 1X4FA 4MY8A 3OTEA 5D3GB 3AYVA 4JZ5A 5KT6A 4ZOAA 1X9MA 2ZFAA 3FSXA 4DZ6A 4E4PA 4N9EA 4UY8T 4WCJA 2Z8QA 1RT7B 2OR2A 4HPXA 2UVUA 1FKOB 3M6XA 4JIPA 1OC7A 3RU6A 4UW2A 3EX7B 2VQTA 3AMKA 1P27B 2ZBPA 2X0YA 3CS2A 1ELOA 4JI7F 2ACMA 2D24A 3TNBA 3KRUA 2OGYA 3CT7A 3LP0B 4XIUA 2E25A 2Z1XA 4OZ3A 5CYQB 3FSUA 2PDFA 1D1UA 3ZZ0A 3SECA 2YCJA 1MSWD 5FESA 3H4XA 1RWWB 3BO3A 4EACA 5K5MA 2DYAA 4EXAA 1RCOB 2N4CA 5DMNA 3M1VA 3M8ZA 3RW6A 2OG9A 2HWIA 2C91A 5A2QU 2XI3A 2Y7FA 2OPQA 3COTA 3U4FA 2HK2A 1CXHA 1WUEA 4M51A 4ORIA 1HIYA 2KKHA 3LYEA 2VB6A 3DLKA 2WJDA 4LEQA 3HKWA 4NLDA 1HTIA 1UJ4A 3M9YA 2ZJQQ 4PSPA 4W88A 2ZE2B 2WANA 3TCEA 4TMCA 4OFZA 3CPUA 2QA1A 3FQKA 2GUUA 4LJ3A 1ICQA 3BH7B 2ZZTA 2DR7A 1UCWA 3QOMA 4Q8FA 1LQ9A 2X3GA 2LXIA 3ISNC 4CCEA 1FXQA 1EKRA 1RK5A 2AYBA 1AW5A 3ARXA 4FP1A 2FJKA 3SRFA 4PQAA 5LL6d 5CCLA 3UETA 4Z2IA 3FDGA 3ZZUA 1KHVA 1AMKA 2YR1A 3GXNA 3R25A 2XY7A 4B9ZA 4IOAQ 3OXFA 1F3XA 3IM9A 3MPWA 3CUFA 3E5PA 4GUIA 3W7NA 5C5JA 3O07A 3GX9A 2Z4GA 1UH2A 2QLFB 1FX2A 1MN7A 3QV7A 1R7IA 1S5WA 3MUCA 3P8IA 4LYRA 4KKXA 3J81Y 2HHVA 1UQZA 4X9YA 2GGGA 4YHEA 3KUGA 3CASA 1EETB 5BRPA 5A6BA 5H9FK 4KT2A 1UVIA 4NOHA 1OQ3A 1WBJA 3LGDA 4TU7A 1EBHA 1KRAC 4JNYA 3I4HX 5BRBA 1KM3A 1IWAA 3DC0A 3MUXA 2W01A 2B31A 1UJPA 4QDMA 4HZ6A 2DZSA 1M5OC 4E0DA 4N9CA 4YCOA 1K47A 2HURA 1LUCB 3SBFA 4ZN3A 1S9FA 2BVZA 2XSJA 3PFMA 3J7A1 4JFVA 4V19J 3UJRA 4S3BA 1PHWA 4KRTA 4PKDB 1PDYA 3UEQA 4ES2A 3QSYB 1BXNA 1I6NA 4DN0A 2M70A 1PV8A 5KOXA 2BGQA 3FDSA 4AVNA 2COLA 4LH8A 3LG3A 5I09A 3JSRA 3VKKA 1NSQA 4DO6A 4R0JA 2ZX6A 5KFVA 5KMYA 4MKBA 2NLYA 3R89A 5E0CA 4E6MA 2LA4A 3TA0A 3PZOA 5D6GA 2XIIA 4DI9A 2TRSA 4UR8A 1WB0A 4Z2KA 3GB6A 3E01B 3T0BA 2G3JA 3ANVA 4YVVA 3STGA 2GQCA 1OINA 1EJTC 3OYXA 2RB7A 4PYDA 3B8DA 4Q6JA 1WEXA 1IIHA 4TY8A 1WKLA 1CGYA 3AJXA 5JIWA 1SZFA 1RQEA 4QISA 3QZ7A 7REQA 1ICPA 1T95A 3WBWA 1OABA 4OQVA 3WEOA 3AA8A 1CWYA 4QQ3A 1N4LA 4M5PA 2IUZA 3DFYA 3AJ7A 3KLLA 5JIPA 5A8WB 1GOIA 4I5UA 1JLQA 3DHWC 1CEZA 4KR0B 5D2VA 2CHOA 4UMCA 2YTCA 4DF0A 5C5YA 3QQCD 1N48A 3AHPA 2ISVA 3WMLA 2DNYA 2PO4A 1EO5A 5I5RA 1ZJIA 3ITVA 2KZMA 3ATYA 1WOPA 3H2VE 1XUUA 2YL5A 4GYFA 4CDIA 3Q4DA 4HHMA 3BYPA 5D9NA 3LAMA 2BACA 5IC6B 8A3HA 5LNRA 1KB3A 4J3UA 3UWYA 2GVDA 3E3HA 5G4WA 1JF5A 2WHKA 2WSYA 1QUPA 4WFZA 2ZC3A 4TUFA 1T9WA 1MRAA 3QGPA 6FD1A 3R7SB 1TELA 1T9YA 3SM0A 3KG0A 2R7QA 4NPOA 2EPLX 5KG5A 4UOJA 2POKA 1L3UA 2WK4A 4DWSC 3CPWR 1YITS 1EJSC 3AU2A 1W37A 1X9SA 3A8KA 4PXCA 3LLXA 4H83A 3Q24A 1XR2A 2ZEJA 3H5XA 1E0TA 1K8XA 4XKMA 7A3HA 3WNPA 2WBRA 5CBJA 1XEZA 3JR2A 2YCIX 3RM4A 4LJMA 1L6YA 3P81A 1YGYA 2GDQA 1OSEA 3SZ8A 1JPMA 4ERAA 2E5IA 1PCWA 3TZZA 3JVAA 3Q8SB 3TX9A 4QLLA 2F2KA 1KLZA 4DUTA 3TYTA 2VR4A 3O05A 1VFJA 2DGUA 2MGZB 1V6UA 3T5KA 3H90A 5D9MA 5KFAA 3OR2B 2OJPA 2NXUA 4B3KA 2AAMA 1W25A 4JIQA 5KFBA 4CD7A 4DQWA 1VRDA 2G1HA 3N6NA 3M5YA 3P5YA 1FWRA 3EB3A 2YA2A 4M81A 3H12A 2ZOMA 1XCWA 2EPKX 3IWNC 3E01A 1E6SM 4EBDA 3ZZPA 1H11A 2QFJA 2VOTA 4LT6A 1LG1A 1PXGA 2DXEA 2IJRA 4OHVA 3F41A 4LFCJ 2WJFA 1JQXA 2FUG9 3G4SS 3R5AA 4N6EA 1TWIA 4RXFA 2YDQA 4JCMA 3UGRA 1OSCA 3SJ3A 2ZE0A 2FY8A 4ZJQA 3RW7A 1AJ0A 3HGRA 3VNJA 1RK8A 1FWFC 3V6HA 1CXIA 1ITPA 1RGVA 5CPTA 4ZSTA 4A21A 1J4EA 5HMEA 1SGJA 3P2VA 4ZO6A 3WKZA 5C9ZA 1Y5WA 2R8WA 3FYPA 4AXJA 3WF1A 1AL8A 2QZRA 4MB3A 4ML9A 2MGZA 3EA2A 2CBVA 2OUGA 3NOYA 1PZ0A 4R5PB 1FJ7A 1AJZA 5LM7E 4ZCIA 2VZVA 2KFYA 3PG9A 2K2PA 3RCNA 4UC5A 2CDQA 2HW3A 3KUEA 3DFOA 3THDA 2GJFA 1HNXJ 1B4KA 1FWBC 4R7JA 4CQCA 3K89A 3EWYA 4PEEA 1C91A 3FNDA 3WIUA 1HKAA 3B8WA 2OSQA 1ZJAA 4BZYA 1VS3A 1QAYA 2BTMA 3N73A 1EPXA 1PYMA 3NO3A 2W2MP 3HVRA 2EFOA 3KS5A 1U24A 3AB2B 3LM3A 3INPA 2REQA 1TUXA 2MYFA 4LRCA 1WTBA 1VC0A 1VB9A 4QSFA 1XH2A 3BKFA 4DV3J 3AYRA 4YNGA 1OX4B 1G5AA 5IC4B 3QO9A 4QTGA 2J6UA 4G1IA 4F4KA 4IP7A 1JZ3A 2FVRA 4O12A 4U3AA 3S2CA 4O1BA 1K73T 3MD1A 3IUHA 5J1PA 3TA6A 1HKJA 1DJXA 1FQ0A 4J9JA 3AHYA 3BGOP 4L74A 3VHQA 1TMQA 3AD7C 4EIVA 3LMZA 2PWUA 2Y1IA 4MJKA 3GDTA 3Q23A 4LBUA 4KO0B 1LWIA 2E4TA 1U1HA 1U02A 5IM0B 3WH7A 3HGOA 4PTXA 4AG0A 1KO0A 5LSMA 1NJZA 1B2YA 1IHIA 4JPGA 4PBGA 2BVDA 5GQBA 3N6HA 3SURA 1RY8A 2IFXA 4N02A 4C4WA 4Y2MA 2YPZA 1K44A 2WB5A 4PWDB 3V81B 3PHAA 3V0UA 3TN5A 4UQCA 4ALZA 3CJ5A 4G65A 3M05A 3EYZA 5IRPA 1DBDA 3EPGA 4DR5J 1Z7AA 2QFIA 3DEQA 2CADA 4HSOA 1W32A 4I5XA 1YMYA 1OC5A 3GU2A 3PFOA 1BYBA 5JBDA 5A2CA 4OYAA 2BASA 2JE8A 1V77A 3VI2A 3EYPA 5IQQA 8CGTA 3GUGA 3AIWA 3W29A 1H2TZ 1Q8IA 4LF9F 1GZ1A 1CJVB 2P8CA 3QJJA 3STFA 3B82A 4C0OC 1OSDA 3SQLA 4KEUA 1HL9A 1E6VB 1HO1A 1AJ2A 1SO6A 1R3QA 3KK2A 3RR7A 2Z2YB 1UOKA 2J9EA 1H63A 5BW6A 2W67A 1NHUA 3FVMA 3M44A 4C6DA 4LREA 2ADBA 3DM2A 1FHLA 2J7UA 1VCTA 4Q4MA 2XMKA 1FRHA 3MOZA 2Q3RA 3WK2A 3PWAA 1FDJA 3WNLA 3ZR5A 3KLIA 4CTAB 4YY3F 3DI0A 4ZZ9A 3NAVA 2CIMA 1WF0A 4X4RA 4FXVA 1WO2A 2OB3A 1QO5A 4XK2A 2XH0A 5LYRA 1Y00A 4CQ1A 4DCOB 4JYEA 2GC8A 2FH6A 1B57A 2K06A 1RCQA 4KEMA 4BR1A 4HJWA 4WQ6A 1DTTB 1GXLA 1PBUA 2DB1A 3MSDA 4DR1J 1H0GA 3PX6A 4ATNA 5L1IA 4YXGA 5F7UA 3LSCA 3S2LA 3SAZA 3UR2A 2RRBA 3NGTA 4C6FA 2ZA2A 2Q8XA 4PB3A 8RUCA 2PEVA 3CCES 5J1NA 1A6LA 2QC3A 4KWOA 1BTCA 3PR2A 3C0QA 3KZPA 3SUWA 3BGUA 2A7NA 1W1B1 1HLWA 1G7CB 1W9VA 1Y5IB 1FDAA 4LFAJ 4OZ1A 2R2UA 1GYMA 3B9OA 5FEPA 3NBPA 4JTSA 4M7TA 4IFVB 3EM1A 4DX5A 3P82A 2VBXA 1YJ9S 3CO4A 3M5VA 2D22A 3DN9A 3F4VA 1J8VA 3SN0A 2FTYA 2ZUMA 4HTIA 5HMXA 3FNNA 1Z89A 2ISSA 2R7UA 3R6LB 1XIJA 2BE2A 3W5YA 1I2OA 3EMCA 1RU1A 3BV8A 4N0RA 4GKTA 2D74B 4WIQA 2PDQA 3W7CA 3A6OA 1E15A 3QMRA 1WKEA 3WMCA 3M30A 4URGA 1KQSR 3G8TA 5KZ6A 3IN5A 1OK6A 4HNOA 4ORMA 3HO1A 5B0GA 1DIDA 4QPXA 1EJ7L 3Q8RB 2Z56B 3LA0A 4N8OA 1WKKA 3I82A 4OZJA 2D0FA 3SQSA 4DUVA 5A8OA 2DPEA 3OR1A 2FH8A 1K03A 2W4CA 4F2BA 1R43A 3BEGB 3NRBA 1V03A 2D0GA 3DOMA 3EKLA 3OUYA 2EKNA 2DTJA 4CU7A 2CIPA 2FZCB 5JBEA 4NI2A 1M5SA 4H6EA 2D3NA 2F4VJ 4OV6A 3T08A 1FK9B 1R30A 5HP1B 2GUBA 1DV7A 2Y1RI 1K8AT 2AJQA 3AIRA 2QMKA 1RI7A 2J75A 4AWTA 2I14A 2FGBA 1M01A 4K7VA 4GINA 4RDYA 4DI8A 2GSHA 1EQ0A 3NPXA 2OWCA 1HQUA 3CGIA 2C2EA 3D7SB 1G6CA 3DH7A 3T1GA 2VG7B 1H1ZA 3OTBA 4YIWA 3OLBA 1OCQA 4PUOB 1FFRA 2NXGA 1NDPA 4Z1AA 3NKYA 1NRKA 2X0SA 3AH6A 4KHPJ 2CHRA 5C0QA 1O4UA 2WNQA 4WDWA 3DIPA 4ZODA 2E09A 2LQBA 1H7PA 3DYAB 4DPTA 2IRXA 1Z69A 4DY1A 1N36J 2YL8A 3BLOA 3GXDA 5J04A 1U7LA 2DBBA 2RSQA 4WFNQ 2BG5A 4TTGA 1GYNA 1DLOB 2BHYA 2FHCA 2ZE2A 4USMA 4P7VA 4X4TA 1QVBA 4MKNA 2G0WA 4HPGA 1VYAA 1G4CA 3HU7A 4NLPA 1Y5VA 2DR6A 5HNUA 3RGTA 4KWUA 4JQ1A 1A50A 3M8SA 1V8EA 5EFFA 1TP7A 2O9PA 3TAPA 2P8BA 4A3UA 2YWFA 1T96A 3TN3A 2MB0B 2ZYFA 1WTFA 2CW6A 3NL2A 3WQ5A 2BA9A 4DI6A 1UZ1A 3ZTPA 1U0SA 3T6JA 2DD8S 3EDFA 3VKCA 4P2VA 3UA3A 3E2VA 2BX7A 2H4YB 3CZ8A 4U95A 1F6PA 3UY8A 3M6DA 3AHXA 1ZB5A 2V4JA 2EPMX 3I0RA 5HUPA 3W0KA 1J2BA 1Q8BA 2AOSA 4EPKA 5KFDA 3BH4A 3VUSA 4UTUA 4HU0A 3SUUA 1UA1A 5DG7A 1F73A 1OYCA 1NH6A 4CLKA 2L9WA 1ZOTA 3P8BB 5T26A 4BF5A 1IR2A 5SWUA 1OG6A 2MQOA 4FF4A 2CNOB 3C8YA 4LFBJ 2HSEB 4RL3A 2DSUA 1PILA 2CVIA 4H9YA 3G8QA 2DH2A 4JI5J 1OFBA 3KL3A 1BLUA 3QSIA 3HPAA 3PVFA 1YVFA 3R11A 1JLBA 1TR9A 3H23A 5KFIA 2AP6A 1ME9A 4J9MA 1Y9OA 2I9SA 1OYEA 2F65A 3HVAA 5C6MA 4OBTA 3AZTA 2JEIA 1U5VA 1EYEA 1SZNA 2HLUA 4FZVA 3R5EA 3W3OA 4JV1A 3PFEA 3UU0A 4O44B 4DR5F 5J1EA 2J0XA 4GNKB 2HMIB 1XRFA 5KFCA 5A94A 3EXYA 4LYKA 4FNHA 4WRHA 5J2QA 2VWTA 2YZRA 1XLCA 2XMAA 4IYQA 1WHYA 1FTCA 1Z4UA 3KVJA 1NU5A 3NXLA 3USZA 3BAXA 4HTYA 1ZAJA 4HNUA 3LK6A 3R1HA 1PX8A 2K8GA 5AC5A 2HHTA 3B8IA 2PZ0A 3EA1A 4GH3A 4JX5A 3Q22A 5H9EJ 2OKTA 3HA1A 3LPFA 2ERRA 1KFEA 3NDZA 4I7FB 4UF4A 4BC9A 3TXZA 5G1MA 4ED8A 1EEXA 1K3UA 1UROA 2KT5A 3CQKA 3W01A 1JWWA 1ZTWA 1XIHA 1BSIA 1CJUA 3KLFA 2XZWA 2EG2A 1FWWA 2MY8A 5ETKA 2G4JA 5TIMA 2QAPA 1YZ7A 4DM1A 1N7KA 1K8ZA 1X6NA 5DANA 5CZJA 3HF5A 3D0CA 5ADZA 4BWMA 5KG4A 2G9OA 4CLYA 2NSCA 1H0HB 1LWCB 1MYRA 1ONEA 2O4MA 2XIOA 1KRBC 3PY2A 3RILA 5KZDA 2WSKA 3WH5A 4J28A 4FOUA 4OI0A 2Z57B 2LECA 5H9EK 4GE8A 2QDHA 4OOZA 4GC3A 3IARA 4DUYJ 4XX6A 4NJKA 1UUOA 3FRYA 4Z08A 3DLHA 4OJHA 1VOMA 2HVNA 1T9XA 4JI3F 2VC0A 4C2MA 2H1YA 1Q86T 1O6XA 4Z7YA 5E3CA 1EZ2A 2AL2B 3TJIA 3AS3A 3G6ES 4R9XA 1MUCA 3K46A 1J93A 2HBQB 3UPFA 3QMQA 2QCDB 1RAKA 1W7WA 2F6UA 2ZUWA 4XTDA 3A9IA 5AYBA 2FPYA 2RUGA 3N4AA 1ZJHA 1YIJS 3M9MB 4RJEA 1RB0A 2KJWA 4HSHA 4L61A 1TKTA 1DJWA 2INZA 5D2WA 2JLEA 4I68A 3I9ZA 1YNYA 1YKWA 1E9LA 1UZ4A 3KLKA 3MI2A 3DRPA 4A8OA 1CC7A 2CU0A 1FDBA 3ITHA 3H22A 3S0CA 4LFCF 3TROA 1NHVA 1JI1A 4UQTA 1RVGA 1WZMA 4A46A 5M3WA 3A1YG 1B7FA 3K4WA 4GY0A 1E0UA 2ZH7A 4NG3A 2O9OA 2OKQA 2QMJA 4NX0A 1RADB 3I5BA 3V4IB 2XC9A 1LWJA 1IXKA 1W3NA 4PMYA 3DI6A 3OSPA 4B5XA 4RBTA 3WNOA 4QRNA 4DZ5A 1XQLA 2ZE3A 1VEOA 5DXXA 1UA3A 2ZUAA 5M03A 3ZTRA 2CQIA 1HNIA 1S6PB 2NPIA 3RB4A 3TVZA 1QPQA 2NT1A 3N34A 4OI1A 1T0TV 4CLUA 1N34J 1WAUA 1R47A 3CLMA 2FHJA 1NZ8A 3K5XA 3IGHX 4JYFA 3ZZTA 1VQLS 4DV0J 1XIDA 3BG5A 2EFVA 3JSMA 3RM8A 1JPHA 1U5JA 2LU1A 4O4GB 3WK1A 2DR5A 1P5BA 3O2IA 2X1BA 4Z7CA 3MM8A 3SYZA 4IR1A 3THUA 2QJGA 3GZAA 4MNKA 3VMOA 4UR7A 3CWNA 3DBPA 3GE7A 3H2AA 1W26A 2XY5A 2YBUA 5CPQA 3DMJA 3MPYA 2RDTA 1EWEA 1D3WA 1EB3A 4S39A 3TUJC 2MQPA 1NDYA 4PRFA 3IJLA 1XD1A 2FB3A 4ZOBA 4MZ1A 3JQMA 4JTAA 3H4DA 2R1KA 1RT2A 4DR7F 1TB3A 1BQNA 4YWSA 2DVIA 4CLTA 2H8XA 2XJ7A 1LFWA 5DDOC 4L7ZA 3IVUA 1EHWA 2PIIA 3CW2C 5C24A 2YKOA 4NL1A 3RB0A 1XYLA 4MGGA 2ZZ2A 2ZKTA 1XIGA 3CCJS 4H4OB 4GG9A 5F4XA 4DMZA 3TTEA 3C15A 4QJ3B 4I6WA 1AL7A 3JB9k 3MMUA 4AF0B 1U1PA 1A4LA 4PTWA 3LM7A 1WDWA 1QW9A 3TZXA 3FYYA 2DGXA 1F6TA 1DJYA 4ED6A 4FIRA 3WDHA 5J2QB 2ZKMX 3C0LA 4ZVHA 2F9RA 4YB5A 3S4TA 4DLFA 4P8VA 2WSQA 3HFYA 4W93A 2R2SA 4ECZA 1PBGA 1TPB1 3C14B 3FZBA 4KKOB 4HI2A 4OT7A 4GJJA 1FKWA 1Y7VA 3VAKA 2EPHA 1JVNA 4WEVX 1BEUA 5J2MB 2WZIA 2DZXA 3QLDA 4WOQA 2CEQA 2W2QP 2RU3A 4OZ2A 3VIJA 5FF2A 3N18A 1XUZA 3A8EA 3IAQA 4BEUA 1HBNA 1B3TA 3C2YA 2VBYA 3LLDA 3DCPA 3W1UA 4MK9A 3SJNA 2CLLA 2VV5A 1NP2A 1T9UA 1VFOA 3AY0A 4HK5A 3VAVA 1A7GE 2YXXA 4DIAA 3DG3A 3R79A 5F3ZA 2XYHB 3PG8A 2EC2A 4C6PA 1N88A 3SCPA 3G2XA 5CBIA 1EIXA 2Y70A 1QOQA 5ABEA 3DUGA 5LXXA 3R0DA 5C9RA 3T5HA 2VEGA 2HVZA 5C54A 1VBUA 1RWKB 4KFBB 3VUPA 4QIUA 4LCSA 2A1YA 3WO8A 3OA3A 1W3LA 4P7RA 2DZWA 5HMSA 2VBWA 3NEVA 3LX9A 1O5RA 3QIPB 3A13A 2PDYA 2MQ8A 4GI8A 5HUOA 3C2RA 1DJIA 3NCRA 1DWIM 3RK8A 3E0WA 3LBOA 3PW0A 3CDBA 2F2HA 4L6HA 5EWGA 2GGHA 3WQFA 4NXMJ 4CLLA 3V6DA 5CKSA 1Q8AA 3ARZA 4ZSUA 1U47A 4YS2A 2A18A 1KCXA 3NEHA 3RFAA 2W9BA 5KG1A 2X1SA 1EARA 3ARSA 3NOGA 4BLGA 2BM0A 4V1YA 4L6V3 1YPIA 4H41A 4DUXA 3SV3A 4B9VA 1IJFB 3FUYA 2I5JB 3IP0A 2VR2A 2MEWA 1OIFA 2P53A 3NZQA 4IXXA 3MTKA 1YJ7A 2C2MB 4REQB 2AX0A 2PA6A 2UWFA 1NMEB 4BA0A 3OGVA 3TJ4A 5HOSA 5K2ZA 2DCLA 4LSBA 3VNKA 2UUBJ 1GW1A 1U1QA 1U1UA 3GIJA 1C1BA 4ZOCA 2FKPA 3FK4A 1S5NA 1LWEB 3SUTA 4U2ZA 3DRPB 3C3NA 2V69A 3MO7A 4HVZA 4E2OA 5A8QA 4KIEA 3WL1A 3OL6A 2V8ZA 3BSHA 2LQ8A 1FKXA 1HMVB 4DZIA 1FWNA 1SFLA 4PMOA 4ZENA 2J7BA 4JBRA 1UKUA 4MB1A 2DEPA 3Q8PB 5MKGB 2DHGA 3NGFA 3HJFA 1P1TA 5HP1A 1GJPA 3GNRA 1C92A 2G0JA 1T9TA 4RUCA 3ARPA 4PUDA 1XFBA 3NL0A 3FA3A 1O68A 3POCA 4B3MF 2BODX 4O1EA 2PGRA 4DRSA 2VFFA 4QWCA 4RE3A 4L73A 3LBMA 5HJYA 3HI9A 3SADA 2XLJA 2C1HA 2UXBF 4ECSA 1UWAA 3FSIA 3CD6S 2D20A 3TSBA 4OHYA 3QQWA 1BAGA 2QE5A 3L0NA 3FCPA 4HK7A 3ZOAA 4O4RA 3GW0A 5EFDA 1W3KA 2CWNA 3MMBA 5DQPA 1GOXA 3QPYA 1R87A 1MEWA 1RH9A 2OT1A 2ISDA 3AXXA 4I56A 4J2PA 1CC8A 4O4WA 4OE7A 4WHBA 4YDXA 2RFGA 1V9OA 3LP0A 4LUBA 1F2HA 4YR2A 1RYRA 1TCMA 4FR1A 1WD6A 2IM0A 3C3UA 5I02A 2RD5C 5FJPA 5M2PA 3PS7A 1F6YA 1G3OA 3OT9A 4O18A 2W61A 4PR4A 1I2PA 2AZ3A 2HEKA 2YYTA 4F2SA 2OHDA 1JCNA 3FN9A 4A8LA 4TXEA 1ZA2B 4XZHA 2JLGA 4ZVQB 1IXPA 2Y63A 4J9SA 3ELFA 3TR5A 2QJMA 4ZVTB 3L2IA 4WP9A 4PMQA 5D05A 3TZWA 4K8EA 3PEJA 2XCPA 4EYIB 5D3GA 1FDYA 2RKIB 1DPMA 2BXJA 3UY7A 4C7QA 5GJMA 3VNLA 4YOEA 5FDLB 1UWTA 2C14A 3P49B 4UZUA 3V0SA 2H3BA 3CV1A 3Q45A 1S10A 3W8PA 2JFDA 2QCGA 5LHFA 1UFKA 3KS6A 3GZ7A 2Y6ZA 1MG7A 5L9FA 1IV8A 1X96A 3W1LA 5K4XA 2HKEA 2V2QA 3BDEA 4DJFA 3NXZA 2NUYA 3BMXA 3M4HA 1C1BB 4DPQA 3EMQA 2UUCF 5IBXC 4DL2A 1TL7A 1VP5A 2PURA 3W1NA 4AY8A 2VENA 3ANUA 3GXPA 1XYFA 3KOWA 3MPUB 2OOFA 1CGWA 5DZ7A 2EF9A 3PR5B 3BLLA 3H4BA 4B02A 4QCFA 5I3HA 3J7Z5 1R89A 1MNSA 4XZNX 2Z2AA 4W7VA 1YPFA 2ZC1A 3RF9A 4LVFA 3KNGA 2V8GA 3M7WA 2DH9A 1FHVA 4J9RA 2P50A 4Y6GA 2HNEA 3LUTA 1B3OA 2G1DA 1RJQA 1UWUA 3ZYZA 4MYTA 2H5JB 4URIA 3LHYA 3WQPA 1AVAA 3PSWA 1S9EB 1ME7A 5DF0A 3JTNA 4MWAC 2QGYA 3XISA 1CBKA 3TTOA 3SSRA 3SFKA 2QL7B 3GE9A 1KM1A 4Y7EA 3GIKA 2KAUC 4IFVA 2C3ZA 3B0XA 2ZITA 1NJIT 4B15A 2WVSA 2VZUA 4X2PA 2VX5A 3I7QA 3K4DA 4O14A 5BU6A 1J6OA 2WCSA 2VC5A 4RDVA 3UZZA 2WHOA 2YY3A 3PBVA 3W38A 4IMGA 1XHGA 1PO9A 2BXVA 5TNVA 4FB7A 1GTEA 3HQ1A 3I3BA 3BREA 2NWSA 1K77A 2BY0A 3FJ2A 2EI5A 1YJRA 3LPYA 1FJGF 1G94A 3RBXA 3AOCA 3C52A 1ZNNA 4ANCA 4L6DA 2Z58B 3RLHA 3ARWA 4ZQNA 3EOOA 2YPIA 3S1GA 2MSTA 1L8PA 4J40A 5IM51 4JI5F 5E41A 3H6OA 2DV0A 3WD0A 3OTOF 3ARRA 2NXHA 2E77A 4HL9A 2EXOA 3LTSA 1BPLB 3S1WA 2HBYB 1LJYA 1X4GA 1HO4A 2DRBA 3DKLA 2FC8A 5DFAA 3GPAA 1B70B 4P8UA 2IHR1 2MDAA 3Q65A 1VQTA 3PULA 1DXEA 1J5OA 3U7JA 4F04B 2AQWA 1ZS2A 4L72B 2CJAA 2DUZA 1X4AA 4RL1A 4IQJA 1VZWA 1V6TA 1OJ4A 3CE8A 2QRRA 1XNQF 3T6CA 3PZNA 3GR1A 3F73A 5B08A 4RX6A 2CXEA 1PWLA 3N28A 2VOPA 1VFUA 1KC8T 4PBEA 3O8AA 1YZ6A 5A0YA 3OLAA 4WP8A 3G6LA 1CJTA 1G6BA 4D6CA 1WC6A 3CCRS 3T0TA 1CTNA 2LXUA 5CG0A 2JNJA 1E1EA 1TYGA 9CGTA 4FYWB 2Q6ZA 3HHLC 5LNSA 2RHSB 4DV5J 1N52B 2PWDA 1L3SA 3UNYA 2HFNA 2G41A 4I6AA 2BW7A 5AECA 1OFEA 4MWAD 3S47A 3ET6A 2HIYA 4R85A 5EMYA 4MIMA 3VOCA 1EGVA 4KRWA 3W7BA 3TQ1A 2R8HA 3G2GA 1YJUA 2QZ8A 4WBFA 2HZAA 3O63A 1I2QA 2Q3PA 1X4DA 1T03A 2DJXA 3CHFA 5AYYA 4IRCA 2CKSA 1HR0J 1LRTA 2ADCA 4C11B 1S0MA 2FB2A 1E6ZA 1XC9A 3W6MA 4U7UK 4DDFA 3I6TA 5GAHI 3DOKA 4K0KF 1VH7A 4NLSA 3BURA 3M0KA 4PRTA 1U1JA 4LF1A 2PDGA 1Q53A 4H9VA 1V3KA 4KCUA 4XZWA 3VKBA 2W63A 6A3HA 5ETVA 1BG9A 1GOMA 4CNYA 2J76E 1RU2A 1G4PA 4FYXB 3BAYA 1SH0A 5I79A 3CJQA 1EP4B 4PUNA 2WVCA 3NAIA 2PGEA 4ENLA 2DSVA 2OO6A 1RT6A 5FSEC 1UW4A 4JI2J 3MZIA 2QCFA 5G0RA 3VA8A 1RISA 3QO9B 2FVKA 2EKGA 3TLQA 2ATMA 3CJTA 3MJMA 4CI0B 2BXYA 4QR2A 2B81A 4P7NA 5LT5A 1J0IA 4H7CA 1SKUB 2W7OA 3WF2A 2QEZA 2WMKA 4CNSA 3PUOA 3DOKB 1FFWB 3DU0A 2XYLA 3EPIA 2QCNA 1E3XA 2VNCA 1WC1A 3GJRB 2IMWP 3HHDA 1OX5A 4AYSA 3GMGA 2W1BA 3N17A 4GJIA 4KGLA 1MQQA 3WQ6A 5A8GA 1XLLA 4BF9A 1OFRA 1IBLJ 4W92B 5HMZA 1GOKA 1XLAA 2V9DA 3GD6A 3L12A 2R7XA 3R0KA 4JKMA 1FH8A 3VGHA 3WFZA 1DIKA 4G5DA 1ZAIA 4MH8A 1OPIA 1S1TB 2DJLA 1U6FA 1C8XA 4FXFA 4CN4A 2IXVA 1UL3A 1ITQA 3TTSA 3ATZA 5KT5A 4OI2A 1E6VA 4XO7A 1ZM2A 1NCLA 2E7WA 4JV2A 4JI3J 1NPPA 5I3UB 1GPFA 3TC6A 4X4QA 4ZA0A 3QFHA 4AL7A 1F5BA 3TNVA 3H42A 1W6TA 4HTJA 3P62A 3IS4A 5E2QA 1WELA 3W66A 4CWBA 4H2CA 3UZXA 2QT7A 2GVYA 1CSJA 1KGWA 3M5ZA 1KKRA 3UR0A 3H54A 3GS6A 2CG8A 2ASJA 2W9CB 3QPZA 3UI3A 3Q8VA 2RDJA 4AHPA 3C2VA 1EGZA 1EP2A 2UBPC 1VEMA 5C24B 3NCQA 1D8YA 1RTJA 1TL1A 2UUBF 1Q7LB 2DHAA 1J01A 1OFDA 2ZM6F 4FA3A 3E0IA 1X1ZA 3UJSA 1A0EA 2BS9A 4WXOA 3KFTA 4V19X 2TYSA 5KFUA 6REQA 1RT2B 1SW7A 5F8MA 3BN4A 5ITHA 4F8XA 4JTLA 1W5QA 1V5XA 2Q1LA 2FGZA 3JSYA 2WRMA 2GCFA 4AYGA 3FFSA 2IM3A 1QPRA 3NURA 1E56A 3KFWX 3TAMA 4YFUA 1ZY9A 1X5SA 2CAJA 1AA1B 1GYLA 3QLHA 1VGYA 1ALDA 1CZ1A 2E5CA 1HZYA 3JXOA 3KXDA 2X8RA 4LV9A 4IG0A 5CC7A 3LW5C 4PSRA 4JHZA 1EQPA 3FXYA 3WLQA 1R3VA 3CMJA 1Y7PA 4QHRA 2ACSA 2HBZB 1IBMJ 2QUVA 5I3KA 1F9HA 4C98A 1BVWA 3N2CA 4LF8F 4O44A 3GQCA 3AMDA 1KTNA 4JY9A 2Y89A 4AIUA 2VUNA 3H20A 3CAKA 4AEOA 3O44A 2W27A 6XIAA 4XAKA 4ES3A 3VIFA 1CULA 1JXEA 4UIOA 5KT3A 3AFBA 2HQIA 3IS9B 4LS1A 1DHPA 3H5UA 3OPKA 2AMGA 3D0IE 1DE6A 3P45B 2IRUA 2KFNA 2J47A 3UG3A 2JZ5A 1JRCA 1BKSA 5B7YA 3W7DA 1VMBA 3IJ7A 1WHWA 2TODA 1TVRA 4MKSA 4JQ3A 4K4XA 3TYZA 1TL7B 3N29A 4ITSA 5DDQC 4BFAA 1WDTA 4YVPA 3TQKA 3MB9A 1L6SA 2PDCA 4FNUA 2WMFA 5HPCA 4R5PA 3N2TA 4HN4A 2WW8A 1FDNA 2ACRA 2AEJA 1W2PA 2DJWA 2XHCA 4F9DA 1ISVA 3CIXA 2PP0A 4Y9MA 3CPRA 3HQOA 2DP3A 3EX2A 4LUIA 2V68A 3G22A 5AE1A 3N14A 1DOSA 3WX8A 2QL9B 2NQ9A 3CCSS 1DXFA 2RAGA 1L2QA 2J24A 5CZTA 1VBGA 4WKRA 3ILOA 4Q2LA 2F8HA 1HARA 4GVIA 2GMHA 4FK9A 4Q32A 1M5KC 1K0TA 1EP4A 2DT0A 3F5LA 3K1DA 1OIAA 1A47A 2HFZA 5AC4A 4D72A 2IM1A 4I69A 1A3XA 1W17A 3B0PA 1WF1A 1NQ6A 1VDHA 3KCOA 3NM3A 2GIRA 3P0WA 2EPNA 1KM2A 4AISA 4ZK7M 5THWA 5CAAA 3MMDA 2HXUA 1N0VC 3FV9A 1R3RA 2HK3A 1J0HA 5CLWA 3TVYA 3WMSA 3DG7A 1VCFA 4AD5A 5M5DA 1T03B 3UWQA 3GH5A 4TVDA 3ZFHA 3ZZ1A 3T2OA 2E67A 5M2FX 1FXDA 4LSLB 4BQ3A 3NIYA 1URNA 4YLWA 2XTJP 1LRQA 3BW3A 4X4VA 2JEGA 4KCWA 5F8GA 2FJXA 1KFCA 5IDIA 4MSSA 1KBLA 2OSRA 3GWQA 2J13A 4P72A 1XRTA 4PC8A 3LXCA 2C2ZB 3F03K 1M03A 3TVKA 2BJ3A 5IWAJ 1B7YB 3N5BA 4TIMA 2ZH6A 3QGGA 2YXGA 2ZOFA 1FO1A 3W2MA 2YKMA 3CJ3A 1W1IE 3YPIA 2PLJA 2J74A 4WD0A 4INFA 3RJXA 2QV4A 4S1FA 1IKYA 4NJHA 2HHXA 3WIJA 4LAZA 4ZIVA 4GABA 3GNXA 4UQGA 3N6QA 1TJ2A 1NZAA 4QM1A 2XQCA 1WACA 5EX0A 2FJDB 3UJFA 1JX4A 1GQNA 3HT0A 1AUSL 2P10A 2VC6A 3F2CA 1Y11A 3W2VB 4CH7A 4K4YA 2LFVA 2BE2B 4DBSA 4ZITA 1YJWS 2IKHA 3EZUA 5HNRA 3D2WA 4LFYA 4BI6A 3M8WA 3ZZOA 2YX1A 3S5ZA 3VD3A 1VRUB 1TV8A 4BWJA 4ZOSA 2HS6A 1QHZA 3KKFA 2UUTA 2YQ1A 4F25A 5A6SA 1LWFB 5KZEA 1P7TA 3ABQA 1FCVA 2DRDA 1WDDA 4LWWA 2OD6A 1S59A 2DNPA 2HK0A 4Q8EA 3HO8A 3ENQA 4PQUB 1Y3KA 3ABSA 1XMBA 4H4KC 2IJFA 4KEZA 4CO1A 3QR3A 3LCIA 2FFCA 2QT3A 2Z2BA 3S46A 2ZDPA 3U57A 1V3SA 2VFHA 2ZJRQ 1S1XB 2PE8A 2VPZB 4DQQA 3IJ8A 1Q95G 4XZMX 2FYXA 2LQ5A 1U22A 2F6XA 3ZO7A 2DNRA 2PC8A 4Y9AA 3PV8A 3RX4A 1RZMA 3PNZA 2KXNB 3G0XA 2X1FA 3VABA 2A3JA 2R7OA 1HF6A 2TAAA 1HKKA 1JNRB 4ZVPB 1HIZA 3VALA 4DN1A 3RDKA 4QW9A 2CJKA 2Z4PA 1XRVA 1NNDA 1TPVA 1DRZA 2NZLA 3AOFA 5DMLA 4R8UB 4CO5A 1QBAA 2FHBA 1XLDA 2GNKA 1R6WA 1HNVA 1TV4A 1FJCA 2ZNYA 3A64A 3GBDA 4ZR8A 3N9RA 7ENLA 3UWTA 1S3HA 3RR8A 3WH6A 1N8WA 3NCPA 1WDQA 4FNQA 2A2DA 1QUMA 5C7HA 3NO5A 3VE7A 1S38A 4XBKA 2WSFC 4PA8A 4PUMA 3KLHA 4PN2A 2RQMA 1JCTA 2X09A 4YPJA 4A8NA 1S0VA 1BRLB 1MMDA 4NZ7A 5M17A 1WKJA 3TR9A 2W9AA 2CPJA 4MMWA 2EJ1A 3C14A 3U27A 1DJNA 4G1QA 1TVNA 1T0OA 1TZZA 2JKPA 4V2XA 1H7WA 3GIRA 1IZKA 3H7UA 4DL4A 1J5EF 1U26A 3AUJA 1X4BA 2ROGA 2YCEA 4PUOA 3GTIA 4OX9F 1VI7A 1XYBA 4MJMA 3HV8A 1X5PA 3CAWA 1PTGA 3QRHA 4US5D 2DPJA 5DQHA 2M4MA 3OG3A 3QMSA 3EVOA 1EH9A 3STPA 1U6ZA 5I4MA 2FZGB 4DG1B 1UA0A 1U6BA 2Z28A 3T3FA 4OLOA 3GHUA 3KM8A 4BI5A 3CIZA 3AODA 4PWDA 4EK7A 5H1WA 2HVOA 2QVNA 4UMAA 1M1KT 2DR9A 4QCEA 3N0VA 1IKVB 1CLFA 3R5BA 2RAQA 2CQ4A 4FNRA 1HL6A 3TZFA 4FNIA 4QXIA 4NCBA 3NGRA 1JZ4A 5F41A 2I7GA 2B8PA 4WE1A 4GMEA 3TJXA 1TO3A 5KG7A 1MNZA 3PYEA 4UFJA 3DLEB 1YSJA 2QA4S 1I1GA 2B4OA 1D3GA 3DBNA 3CO8A 4DBWA 3C46A 3PZVA 4QS6A 2FJWA 1XLGA 3A21A 5K9XA 1D8ZA 1GVQA 3U8GA 4ZE5A 4GXWA 1FTRA 2O01C 2VP8A 3CQIA 5D03A 1Q4RA 1EX5A 2V5CA 3SY5A 3CHDA 5AN7A 1I6JA 1O5JA 5IT4A 2G0IA 4IH3A 4P75A 1HBOA 2LU2A 2V3FA 1IWBA 1ZM3A 3UZWA 4DO5A 4B5WA 1OWXA 2J0QD 3EWDA 3QC0A 2GK1A 3II1A 4AAJA 2UP1A 2RGMA 1VQ5S 2FVQA 2GW8A 3NBPB 1BG4A 1F7BA 3GY1A 4NLWA 4DCPB 3S8SA 5GAGI 2DUAA 1IJEB 1M7XA 3WQCA 2LEBA 5IOBA 2CQBA 5G2HA 3SI8A 2I5GA 1LEOA 2C3YA 3LERA 5BYRA 2N3LA 5AXNA 3IIZA 2B7OA 2QSFA 2CJQA 4JDYA 4N5SA 2DFAA 4QR6A 3VAIA 3T2PA 2BOAA 1E43A 3ZZYA 4A4JA 5AHEA 4QSHA 4HHUA 4U67Q 2VGIA 5SUHA 1R5YA 4F50A 2HISA 3KP0A 3RUBL 2YJQA 2YL6A 1WOSA 2OZ8A 3LRMA 1WEYA 3M32B 3MF5A 3BQ2A 3GVRA 3A4TA 1XMQF 3GTFA 3MC5A 1N32J 2IW0A 2WSEC 4I4BA 5F3TA 4GJ1A 4I9TA 3RAXA 1TL3B 1YBAA 3AHVA 3PNIA 2RDUA 1G4TA 2YBTA 4JTTA 4Y3CA 1AQ0A 2LXFA 2R4FA 3CF5Q 4ZOEA 3VGEA 3GUWA 3JTPA 4L9XA 5D78A 4FEZA 4B5NA 1TG7A 2WMGA 1T05A 1P43A 4BWLA 2MQNA 3TTQA 3RB3A 2CZ5A 2KN4A 1IKXB 1JXLA 1OF8A 1GCYA 2PI6A 1M65A 4GH1A 4W85A 5U47A 1SJBA 4O4GA 2X40A 3TA1A 3TNOA 1CDGA 5JVGQ 3AD9C 4H7VA 4I9AA 3BJYA 3B0YA 3V0TA 2HS0A 5L6UA 4AD1A 4HHHA 1S1VA 1XYCA 4LF9J 2DGOA 2FLNA 4UY85 3VGFA 1SO5A 2R1MA 3KVMA 1L6WA 4H4MA 3EWBX 3NL3A 2NVAA 1SW3A 1WZKA 1REVA 5ETMA 4RE4A 4PMRA 3R8YA 1HKMA 3KLVA 3ITXA 3VGBA 2PB1A 4KGXB 3G6YA 2LP4A 3DG6A 3DRRB 4LGXA 3LWMA 1OM0A 1NAQA 1D3HA 5H91A 1MROB 1W5MA 5CGQA 1R86A 3T1HF 1NK7A 1I2RA 3MUTP 1RLCL 4TU8A 3B78A 2D3LA 3P4UB 3QFEA 4DR4F 2CQPA 2YH1A 5B0AA 3E2QA 3DHFA 3W2LA 2GVEA 3MWAA 5C42B 3GTHA 4H9ZA 4S38A 4Q7BA 2VCAA 3MCSA 1ZBCA 3IR7B 3W7PA 2QCLA 2J7DA 1DJZA 2ZH9A 1YHQS 1RHRB 2BX6A 1F6KA 3GYNA 1EJRC 1OPZA 4OYMA 5JXSA 1MU2A 3FQLA 3UXAA 1FKAF 1XLIA 5FF7A 1FH9A 4JI8F 3L7RA 1TJ1A 1T7LA 3CCWA 1SR9A 2AWZA 2YKNB 3NOCA 2NV9A 2DSKA 2ANUA 3G24A 2C3UA 2FLIA 2DSWA 1EP1A 5CXPA 2IIHA 4Q7AA 3VGGA 5ABTA 1VPXA 1R0MA 2ISFA 2KL8A 2CFFA 1C29A 1HW8A 3UESA 4HHPA 2MJNA 4FBTA 2VI0A 2B43A 2R14A 3BLFA 3ITCA 4FOKA 1B0IA 2N3OA 5LMNJ 3KVKA 5FA5A 1EP3A 3U0HA 1H73A 1LFPA 4ZPWR 5DQIA 2PSZA 2CHNA 4IX0A 3M5XA 4JN8A 3WMBA 2UXDF 2VASA 1F4HA 3SB0A 4DWSB 4DBEA 3OVSA 3W6YA 4D6JA 1T6MA 4LF6J 4AQYJ 4RV8A 2JBMA 2PT0A 5T7LB 1SQEA 3LQGA 5FF0A 2FJUB 2H9AA 4KQNA 3N6JA 3TUUA 3LAKA 2PDAA 3CYVA 1MWQA 3CULA 5EBUA 1JG9A 2ZKUA 2EEXA 1YBUA 3A12A 1DJGA 4GXPA 4IMAA 2P6SA 2O66A 1LT7A 3L65A 1TPC1 1QPOA 4TV6A 1G67A 5AYIA 1OY6A 4BCEA 5BWFA 1GTHA 3G71S 2XLKA 3SCSA 4P7QA 3V2UC 4LVGA 2I9EA 4W87A 2DIKA 2IKIA 4BDPA 1YG0A 1YXCA 5AY7A 1G4SA 2XHWA 1AODA 3P84A 4MIBA 4RR4A 1BXCA 1FEHA 3O1NA 3T41A 4M19A 1NELA 1H49A 4WFXA 3UXDA 4Q8MA 3IR6B 5HLFB 2R8GA 5BJRA 1XN9A 1OK4A 3HPSA 4ROPA 5DO2A 1VAHA 2XEXA 4QITA 1QO2A 1NK8A 2NXNA 1X60A 1N56A 2CZ9A 2I1RA 4HNTA 2IC3A 4LTSA 4PL2A 3QY6A 4DWSA 4ZJOA 4Q7NA 2RS2A 3LZ5A 3SFGA 4PMZA 1JXVA 7FDRA 2RGLA 2QJHA 5KETA 4YYCA 2Z2ZA 5KFRA 4QQUA 4IDKB 1JLBB 3SCOA 1Q13A 3L0KA 4MF4A 2DHSA 5AYXA 1TWZA 1JD9A 3QTGA 3T2QA 3OJSA 1H7RA 3AYTA 3U1NA 1CGXA 2HNHA 4GIAA 3JS3A 5ETSA 3ZZZA 3UZJA 5LSRA 1A5BA 2V30A 1HJWA 3B9NA 5LA0A 3NS5A 5IFPA 3UVAA 4ELTA 4AXKA 4ICLB 4IP5A 1HR0F 1JIHA 1OMSA 1OCBA 4NRUA 1X8FA 2OFGX 4UOHA 3OUYB 2HHHJ 4TTUA 5F8HA 4DS5A 1GZGA 1S5VA 1LXJA 4PMNA 2A3LA 3GCXP 3R2DJ 1EKOA 2FHJD 4U4MA 1VQMS 4DELA 1QSYA 3UT0A 1DZ5A 5I23A 5HA7A 3V7PA 2Y8KA 4LMZA 1A5OC 2Z30B 2VG5A 3LPGA 4W4MA 4JI1J 1QFEA 3IG1A 1WOBA 4HU3A 1YDOA 4F26A 1H3DA 1XICA 3WJWA 5BR8J 2P88A 1S99A 4HGXA 3R7NB 3IPWA 4FOJA 2DEIA 3CEDA 3G77A 3CUHA 1FWHC 2V2DA 1IIGA 2NYIA 1OZQA 2OX1A 5KFPA 1S46A 5A1AA 3M7VA 1UIPA 2DW7A 1CNVA 3IWPA 2Q8ZA 5CC6A 1UFWA 4OX7A 5D0GA 4O1FA 1FNXH 2GGPA 4DWIA 3CC4S 2WC3A 1NDCA 4O16A 4RUAA 1JJKA 1O6IA 1XLJA 3T1YJ 3BBCA 1RT7A 2PODA 4A8QA 3DC8A 2FIQA 2QLJB 1NKEA 2AJ0A 1E9YB 1TJ0A 4ICMA 1Y4ZB 3SUSA 2YDSA 4AD4A 4NJJA 2G3IA 3QT8A 1X4HA 3EWUA 1RTZA 1ITXA 2XPKA 3CUJA 4JI0F 3PVXA 3CC1A 1CLXA 5F9LA 2BQ3A 1VF8A 5T9BG 4Z1CA 4QBUA 2Q71A 4GX8A 1RAEB 1P7TB 3SCRA 5ABFA 3TU9A 1OYBA 3OW2R 4B3TJ 1LORA 2PLMA 2FVCA 2ZQ0A 4CVUA 3BS9A 5AE2A 4L1WA 1UMYA 2IAJB 2OWWA 1TWWA 1E6PA 3S1VA 4NAEB 2VEIA 2GGJA 3H2FA 4HSNA 2HNYB 3Q94A 4RLIA 1ZCOA 3GTYX 4DR2F 3DAQA 3HKZD 1ONXA 1W1TA 3FC9A 5DG9A 3CZKA 2XVKA 1SJRA 5T41A 3RRHA 5FJUA 3TQPA 4IL2A 1R3NA 4B3RF 4IKAA 1T8EA 3G18A 3OLEA 4HMDA 2VOMA 3CO9A 3OHMB 4HCHA 3GM8A 3AU6A 4DZAA 4GLEA 1V0KA 3SCNA 3BQ1A 2VGFA 4ZFMA 3GG8A 1W1YA 5C70A 1CJKA 4OU1A 3NCOA 2POTA 1WX0A 3BR9A 4KCTA 1XJBA 2QF7A 1BTMA 3G82A 1RXOB 3MJYA 1R8CA 2E9TA 3WFLA 4O3QA 4GNVA 4DR3F 1XI3A 3EB4A 2XN2A 4GFSA 4LY4A 1RWXB 1JLFA 1X0FA 4PR6A 1FFGB 5FCZA 1R9XA 4IIEA 3PB2A 2YB4A 3UNTA 2DSZA 4RV3A 3VIKA 3C4UA 1U2YA 1Y8BA 4XZIA 3L7UA 1QNRA 4ZCLA 1HNWJ 3SDOA 1LBLA 1U1KA 2ADAA 2QULA 1FWEC 3G1VA 1S2WA 1XM3A 2KVIA 4TQRA 4O54A 4DWDA 4AMAA 3P67A 3POTA 1QAIA 4NP7A 2BEFA 2QS8A 3PZTA 3H5YA 1J5EJ 1JUBA 3UR7A 5GPRA 3PWIA 3S6TA 3WLOA 3UGVA 2Q43A 4LF6F 2R7TA 1VRUA 3K58A 1N55A 1ACMB 4AZHA 1OO0B 4JDBA 3SI9A 1O5XA 3N4FA 3OIHA 5K9DA 2PTYA 3HJEA 8ATCB 3EMZA 3UDVA 4NZ5A 1XYMA 3TAKA 1UVJA 2PLCA 5CGMA 3WK0A 5JQ9A 1WC4A 2DNOA 2H51B 5BCAA 3BF4A 3ENVA 3ZM8A 4B08A 2X7VA 1IVZA 1TL5A 2VG6A 2UUCJ 3WUGA 1KOOA 4MHBA 5CYQA 3DU5A 4R7OA 3TQ0A 1E70M 2JVOA 1JGMA 3I3EA 4HACA 4GI4A 3JSBA 3F1QA 2BUNA 2HE8A 3UYCA 5DLFA 3QQ0A 4YTRA 1XWYA 2PI5A 1RHCA 3WSUA 3DDNA 3K4AA 2GGIA 1RHJB 3HQPA 3GJSB 2WW4A 4A3RA 5ETOA 2XWXA 3EPOA 3DOLB 3E2RA 3OFEA 4ECXA 1HKWA 1QSSA 4XISA 3WEMA 3R3TA 2J9YA 3HHEA 4PE8A 1P6CA 1UCNA 4Q33A 3LBCA 1R3SA 4AVFA 5G5IA 1VJWA 1OC6A 4XVEA 3KLHB 3L5LA 4KAIA 2PI4A 3E51A 1C8QA 4I64A 4WIWA 4ZE4A 4HH1A 2I9UA 2M52A 2DGQA 3SSJA 3B4YA 3A8JA 3GTNA 2PC6A 3PZUA 4DQRA 4IMDA 1FWKA 4Y9OA 1LWEA 2A2CA 3N79A 5ETNA 3GV7B 2GJPA 4IGSA 3O6YX 4PXDA 3KAOA 3LU2A 3IIVA 1S6OA 3MM7A 3NOEA 2KRBA 3IACA 5CSUA 3W1RA 2Q6BA 4MWAE 4R53A 3CUNA 3GP9A 1MSSA 3KJQB 2HEJA 4F0RA 2E9BA 2VOOA 1KCKA 3OLDA 4RXGA 2Y8UA 2W66A 4IFOA 2IRYA 5B7WA 1G7VA 3BICA 4ZXOA 5B0CA 4RLEA 4WZMA 1TV2A 3NWRA 2Y4SA 2C79A 3RX3A 4ANDA 3FAWA 4Q8PA 3GU1A 4Y6IA 2IBKA 3AROA 1NAL1 3W2KA 2ZX5A 2RVJA 4U3CA 2JK2A 3W7LA 1WG1A 1PIFA 4GVLA 4AQLA 1WC5A 3A9BA 5GADI 1Z42A 4ZVEA 2W3ZA 3A4XA 1KTBA 4IG3B 3JTOA 1B4EA 4E4FA 4XSLA 3BK0A 1F07A 2F84A 2OAUA 1MMNA 2J9XA 3VQTA 3E1F1 4EO8A 3H24A 4WF9Q 1VS1A 4PRRA 4FF2A 3MM5B 3IWLA 4LSZB 1OD8A 1V3RA 3T6BA 2ZZMA 1XH1A 2HAIA 3AJDA 2LMIA 1ZHAA 4ZVJA 1Q66A 1MEHA 2HGLA 2IQTA 2VFGA 1IBCB 3IG1B 2GAHC 2OO4A 1M0SA 4RKUC 4K2JA 3AMCA 3AWOA 2HS3A 4AMCA 4I7WA 1SJQA 4KT0C 3QJLA 4IHCA 4JTGA 3CCLS 3P3DA 3LPEA 4F2RA 1SC4B 4NXNF 4ZVSB 1EXPA 3RMEA 4RZ4A 4Y34A 2MNRA 4LNCA 4Y28C 2DVXA 3HDSA 2R42A 3GXFA 3VNYA 1KV5A 3SCUA 4PCPA 2BVYA 5C71A 2QIIA 1WI8A 3NNCA 1QDUB 4DPOA 3D6TB 3MHYA 3OPSA 4AD6A 5LXYA 2BR0A 2ZDRA 1X8CA 5FJ4A 4FZIA 2A6MA 1X4CA 4PFMA 2PD9A 1U2FA 4HR2A 3ABOA 4H54A 2AU0A 2WZHA 3V5RA 2ALRA 3WLSA 3TQVA 3THPA 3HBLA 1HBMB 3UYIA 4F9JA 2R1PA 4KGVB 1LLOA 1B4SA 3HCXA 4RW5A 1FDZA 2V0TA 4F0KA 1P8GA 1BQNB 1E1FA 4JTQA 1XSKA 1DQAA 4E8GA 3LGHA 2JOQA 1HWKA 4XZBA 1YNPA 2WHJA 3BG3A 1Q6RA 4UCFA 2G95A 1PGZA 1FRLA 2WVFA 3WQ4A 4LFAF 1KCZA 4FNPA 3BGGA 3GIPA 3IWXA 1TK0A 2PMWA 4IMFA 2PWFA 1OGGA 5CPOA 4HZ8A 1CYGA 4DF1A 4W86A 1L6GA 2PU0A 3MR7A 2ZUNA 2IVFB 3MM8B 2FVSA 1SMAA 3ZWTA 4PMDA 3K5MA 4JI4J 3WBEA 4X66J 1P1MA 2QMUB 4Y9PA 2IDEA 2WCAA 3AALA 5KFJA 2DNMA 2WKJA 5D9PA 1AZSB 1RSCA 3OR2A 3NGJA 3M2RB 2Q09A 1YYAA 4M1KA 4ALDA 1K6WA 2JKEA 2DGVA 2QPUA 1MNEA 5BZAA 1Q8LA 1F61A 4C7GA 4CRJA 5ETRA 1NK0A 4NLVA 2XSJB 4DQIA 3PACA 2J7WA 4N9DA 3SCQA 3RRGA 5KFYA 4E0CA 1RAFB 3PUGA 4DJEA 1JZ8A 5I0DA 2Y8YA 2WZEA 2OX4A 2Z24A 5LA1A 4HCDA 1W2IA 2EFNA 2OPPB 3NQCA 1QK2A 4TX6A 1J10A 3KLGB 3MS8A 3VINA 1OFOA 1P9YA 3NGUA 3TJ9A 4F4RA 3LP2B 1AD4A 3HMCA 5IOLA 1HPZA 4WPAA 1UWQA 5DZ6A 2ZCGA 4DV5F 3ARTA 3AISA 1WCGA 2E9ZA 5FEZA 4JTUA 3HHLA 2XH7A 4WDUA 2PRLA 2FQQB 3W88A 2G4BA 1ODUA 3L7OA 4J7RA 2V2KA 1VR6A 1Q7MA 2ZOGA 3KWXA 4Q22A 3C19A 4UTWC 4J9UE 3OVAA 4LF4F 3ABXA 2XVLA 3OV7A 5FEWA 5FJJA 1VLOA 2BVWA 2FMOA 3KUHA 2RDDA 1PYFA 1LOUA 2EFQA 4AZ7A 1NUEA 3HXMA 1RLDA 2P9EA 2XSAA 4BQ2A 1DFDA 4O50A 2W92A 5E3AA 1JLAA 5C42A 2ATLA 3B9AA 4I7UA 3V4MA 4B3RJ 1Q7ZA 3CD5A 2GJNA 1WOOA 1F3EA 2JSXA 3L67A 3BJFA 1GJUA 1WV2A 2V34A 2SFPA 2WPGA 2YLLA 4TLRA 4NZJA 3BGFA 4K1GA 4ZQOA 4TY8B 4WJXA 3MA8A 3RR4A 3OTCA 4O53A 2M7SA 4RBUA 1LUCA 1KTCA 2YNGA 4L3KA 2VRJA 1U4BA 3MQTA 4KTQA 3CHCA 3GU0A 4IIBA 2CJ9A 2XHYA 1HJVA 2E68A 2WWCA 1HWJA 4NLGA 1X4EA 1TMLA 2Y62A 3ADAC 4GUGA 2NQJA 3PTKA 1PIIA 1MI3A 1QAPA 2L48A 3QWUA 2ONEA 1REVB 1R3WA 1S2TA 1NK4A 5H8MA 2GUYA 3HSGA 2EAWA 3EPMA 4HQVA 2KT3A 3AZRA 1UZDA 2Q66A 3WLNA 2WM1A 4K6AA 2VL1A 1QR7A 1PZ2A 1RQBA 2WW5A 4ELUA 3EX3A 3G1DA 4KGKA 1TRDA 3KL5A 1PBAA 2WBGA 3OBEA 2P5VA 4DL6A 3RRAA 3WUEA 1X7FA 3ZVHA 4FF5A 1CQNA 3BGJA 2YNHA 3A47A 4JKKA 4KHPF 2PE4A 1VJSA 4FLOA 2XYGB 4O11A 3NQEA 3NZRA 2BLEA 4M29A 1YDNA 1RWUA 4JTFA 3M64A 1KNZA 1T41A 3MEKA 1NSPA 1OGSA 3MDWA 1QHPA 5DCDA 3PUEA 2FZ8A 1P6WA 1PJ9A 5EGYA 1SO4A 3M7SA 3NWGA 4DJDD 1DHMA 2PDHA 4B90A 4LUJA 3H2EA 3UCGA 4WFBQ 3Q0AA 4LANA 2HRTA 5HBMB 2EHHA 2B7CB 4KWSA 2ASYA 1W3JA 2C1GA 4PGLA 4Z0JA 1UWBA 2XZ9A 1NF0A 1L3VA 3FBEA 1C2PA 1FHUA 3M0MA 1DQ9A 2OP5A 4YYFA 3W24A 1UR2A 3T19A 2H9ZA 5F1VA 1UPMB 2CZEA 2RNEA 5LMNF 5FIPA 4G2DA 3P0XA 4QG6A 2C42A 4KHRA 3V6JA 4YWIA 2RJZA 2DZVA 4AUBA 1KLMA 4M5MA 1UBPC 4BS0A 5D2TA 3QQ1A 1Z9AA 5IV3A 4B3OA 5JJBA 1GVFA 4IFKA 1A80A 2PRMA 4J9QA 5JH1A 2F7FA 1KSPA 3LLFA 3BYRA 3I0RB 4U5IA 3QPIA 4O3OA 4DL5A 1EF2A 3ARUA 2GK1B 3AA9A 3W02A 4AZBA 2HHQA 4Z1YA 1SQFA 3FBBA 4BS2A 3QH2A 4K38A 2FMNA 2ZICA 4GFIA 2J9CA 5FAJA 4LCQA 4JNMA 2F3JA 2ZZNA 1Q16B 2E5LJ 3U48A 4BQ5A 1YADA 1SUQA 1KQFB 4YR0A 2MQMA 3KJFB 1RT4A 3R8GA 4NEZA 1EC7A 1V7AA 1UWBB 3VGDA 1FA0A 3PEHA 7FD1A 4K36A 5D0EA 3VD5A 3IUIA 3HT3A 2QTWA 1GNXA 3HM7A 1ADOA 3NMAA 4O0NA 3LHTA 4LVNP 3SR7A 3EGNA 4MJ4A 4P7OA 2POZA 4WU3A 3KTXA 4DF8A 2VZSA 5KZMA 3HVTA 5ETQA 1KBBA 4J3WA 1OEPA 3AS1A 3HG5A 3VYLA 4AY1A 1JYXA 1UP3A 3VGUA 3SQMA 1XERA 3MMJA 2P8IA 3SCWA 3MKCA 2KYZA 1MXGA 1DTNA 2J6XA 2R7WA 4C8KA 5CSRA 2HBRB 3LO3A 2ZZ4A 1AXQA 4AD0A 5MKGA 3IEBA 3EDEA 3I3DA 4P9SA 1SKWA 4RPFA 5DBUA 3BZJA 1SQGA 1QXLA 4S2BA 5BOOA 2GJXA 3K8LA 3C16B 2ZRZA 3AJ2A 1S3TC 4A05A 5U4NA 3TSMA 4X9SA 3GXTA 1RT5B 1X1NA 2HSAA 2QR6A 2V9WA 4NAFB 4EBCA 3DGBA 2UUWA 2O3DA 4K39A 3TX8A 3SFUA 2OMAA 5JH2A 1Q85A 4Q0BB 1IGSA 2J8GA 2Y7GA 1NSAA 2ZWOA 2AT1B 2BDPA 4D2JA 5K7JA 2VL4A 2ROPA 2B51A 1Q5MA 2QSWA 2VD8A 7ODCA 4FPRA 3CJKA 4F3QA 2XIBA 5HATA 1TAQA 1FCBA 2QUNA 2Y1JA 3ZLHA 1DEDA 2GMLA 2ABBA 1VIXA 4DBUA 3R1ZA 4ED4A 2BSLA 3KVLA 1HP5A 1IQ8A 2VHLA 4J35A 1UG6A 3G6XA 2PDUA 1KFDA 5J2NB 4GYPA 3FBFA 5A6BD 5MAOA 2W24A 1MXSA 2J7GA 1PZ3A 1V6HA 4M6QA 2A21A 5EA9A 2VURA 5I03A 2ZZ5A 1JDDA 4CCZA 1WEZA 3D3AA 4DXXA 4IFKB 2OSWA 1NPKA 2HE5A 3U3HA 3ILJA 1KLMB 1FRKA 4JV0A 1FKPB 2UV8G 1CXEA 4PEOA 2LEAA 5A76A 3PTDA 3SCIE 3PZMA 4TO8A 1DY3A 1E6YA 1QJHA 1YTDA 1L3KA 4X4OA 1NK9A 2FDMA 2Z2LA 4I8YA 3CV2A 4DF4A 2NS1B 1I9CB 4H9UA 2CQCA 2V63A 2VPXB 4C60A 1XLKA 3AMLA 2W2NP 1B64A 1SB6A 4K8GA 5F4WA 5GNZA 4F3MA 1ZLPA 2VXNA 2ZUUA 1I51B 5I7GA 1UD6A 2VHGA 1F8MA 4NE9C 2AGQA 2Y2WA 2B7BB 2WWDA 4IJCA 1K1QA 2QYCA 3HZEA 2CBIA 4N7QA 3N4WA 3T4CA 4CLZA 1GFWB 1TA3B 5JU6A 4CGTA 4JIRA 2AYGA 3TUPA 1FCUA 3WUFA 4N41A 2ZA3A 4QGCA 1UVNA 3W7GA 1V6XA 1RT3A 3MKVA 5T8GA 3P60A 4LR8A 3E49A 1S7HA 2FJVA 5CH7B 1HJSA 4E3TA 3KMSA 1UR4A 2WO5A 4POCA 1NOUA 5IXEA 4GZEA 1I45A 2HZCA 1R0AB 1B0PA 4OI6A 4RNOA 5C8BB 2LCWA 1HGWA 5BU9A 4MT1A 3H25A 4FYYB 1D9FA 1N32F 1F3WA 4MLRA 3EWXA 4ERGA 3I68A 4L4MA 4UFLA 4IQDA 3R97A 1LKZA 3EEZA 2TPSA 3RITA 2PFDA 3MM9B 2MZRA 4XZ9A 1RBAA 3L3CA 3E2EA 1L9WA 4DUYF 1KQKA 3R13A 1GVYA 1W54A 2C6QA 1C8VA 4FNTA 1OYAA 4H8VA 1Q4WA 3AXIA 4CH0S 5D04C 5U7SA 2YLAA 4HN8A 4LAUA 4Q6XA 3M46A 1A4MA 4WDTA 3QLLA 1WORA 4ERDA 1T11A 3CMGA 3CAVA 1RVKA 5EYWA 5A6PA 1D7KA 4USUA 1POKA 3SN4A 2QNEA 5IBXA 3HF3A 4YTTA 2DORA 2AHOB 2FJBB 2PBOA 2Y61A 4O0ZA 2OEJA 3HD2A 4WK9A 4DR6J 2GQ8A 3CL8A 2XULA 1JUKA 2NT0A 1OT2A 4IL0A 1SZGA 1S5ZA 3KHRA 5EHHA 4H19A 5DY2A 1OX6A 1FP9A 2JF7A 4C3KA 1FEEA 4I2PB 5HPOA 5E33A 2Z7KA 2ZM6J 4FPIA 1M3UA 3RAOA 1FA2A 3URNA 4XZLX 4YCPA 1RABB 5HI7A 4UTIA 3CMAS 4UT4A 4HMCA 1P4CA 1ME8A 4ATWA 3M8PA 3ZXWA 3GIMA 2CWXA 4F3HA 4TLQA 2R7SA 4Y2IA 3THAA 1PWMA 3H40A 4YB6A 4XUGA 3IGSA 2F8EX 2ZDOA 1EC9A 3HPZA 3QGIA 1HN1A 5D33A 3IAS9 5K8OA 4DV4J 3CTLA 3GYCA 4ECYA 2XDFA 4H4OA 3W61A 3UBPC 5KG0A 4ZIWA 4P8WA 4OYBA 3HZGA 2MHNA 3SEPA 3SCVA 2NXJA 3NTYA 4YJ5A 1XF0A 3GDLA 1XP3A 3LQLA 1TWSA 1B30A 1I0DA 4OFCA 3WC2A 1CB2A 3GO2A 2ZUTA 2R2RA 4Z2LA 3CIWA 3W82A 1KTQA 2DVUA 1VPQA 1Y3JA 1OF6A 2Q02A 1NH8A 1Q79A 4ZB5A 1XMOF 2LVWA 1WBHA 4N42A 3PBWA 5AC6A 3MU7A 4J4KA 1GEQA 1ZBKA 2JQXA 1F8IA 1DP0A 2GDUA 3TYAA 1DWFM 1UA7A 3MBDA 4G1KA 2WXDM 2A6OA 2X51A 1CULB 3O7UA 2JL9A 3M2RA 3FSTA 2TMDA 1K1SA 2WKGA 3UWEA 1XR6A 3QRPA 1E5JA 3UN5A 4GQRA 1A53A 3I4KA 3IGXA 1DKWA 5TD4A 5KG6A 2V8PA 3GW3A 3R8HA 4DV7J 3OO2A 3Q8QB 4J2MA 1A0OB 3TUIC 4O3RA 3JUGA 1CW2A 2FPHX 2GIFA 1TV5A 5HBFA 2MQLA 3CD0A 2OPJA 2RDWA 3N13A 4KCVA 2U1AA 3I87A 4UOGA 3WF3A 1TTIA 5D4LA 2GIQA 3QLHB 4TVUA 3GH4A 1VEPA 2J0SD 1BWLA 3VZXA 2Z25A 1WC0A 4RW6A 5H8PA 1GVSA 2YSWA 3WJYA 3DLEA 3P7YA 2ZTJA 1TMHA 2BKNA 3FKRA 4CO0A 4Z2XA 4M1BA 1UUQA 4QIGA 4X63A 1B0TA 2J66A 4HU8A 1RE1B 2YX7A 4M94A 1U8WA 3DGRA 4TX9A 4D71A 2MKCA 4HMNA 3ITHB 2C28A 3MECA 1X6LA 5EWFA 1VBYA 1UKPA 2PDXA 2CPDA 2IVMA 2RQCA 4WLCA 2UVRA 2A7PA 3R7MA 1GW9A 3AWNA 1KWMA 3QAUA 1HJQA 1OQ6A 4USTA 4CLFA 1F05A 3CDWA 3TO8A 4ZCMA 4H3DA 4DFKA 5HVHA 2ZTKA 3MMAB 2PDWA 4KFPA 2VC1A 1XC6A 4KB7A 1B1YA 1ZFJA 3M8PB 2CPZA 2XFRA 4MOZA 3K1GA 1EGMA 5KFZA 4FF1A 3R58A 3W7EA 3RYSA 3EX1A 5CPSA 4LV4A 2Y88A 4XB3A 1DTQB 1W0MA 2QVHA 2X05A 3VNDA 3N6LA 4AFFA 4DPWA 3PX0A 2WKLA 2BV9A 2CZVA 3GKFA 4GISA 5F2IA 3IFEA 1PEZA 1KBKA 2VGGA 3QF0A 1ISXA 3BV4A 1XBYA 4LUSB 2ASDA 1Z2ZA 4XQ6A 1RALA 3WG6A 2OIHA 2MANA 2J6TA 3CXOA 4R9OA 1VFTA 3NQVA 1OYDA 1ROFA 3S5OA 3RG6A 1S0NA 3LV6A 1HWIA 2H3EB 4GVBA 5A6TC 2BZ2A 4N6FA 3D1OA 1J9YA 1KWKA 1NWSA 1C0UA 4ZBCA 2ZIDA 5KT4A 5I78A 4UQAA 3WDQA 3NA8A 3WLRA 5JXQA 2HQ3A 4GIRA 4BBYA 1EJWC 4W98A 1C1CB 1DXIA 3QSRA 4KH0B 1QWKA 3D68A 4S3DA 7XIMA 4AEFA 1BVNP 3FEXB 3J81j 1RCXB 3CT2A 4ECQA 3JSMB 5AHFA 4ID8A 4U9RA 2MLZA 1JXKA 2WSRA 1S1XA 4XUYA 3PO4A 3TW6A 1RD5A 3A4JA 2QLBB 2A3CA 1EPVA 4AXNA 5CHCB 4AXIA 1VJZA 2JGYA 5G0RB 4UZSA 1HNIB 5DRIA 3ELHA 3N5FA 3VCRA 2JC1A 2G97A 4XSMA 2RF2A 4FLSA 4XG1A 2XN1A 4PB4A 4LUTA 4X61A 3IBFB 5CQGA 1WKYA 1BKHA 3VK5A 3JS9A 3C0JA 4NCAA 3KZSA 1JLFB 1NXIA 4OYPA 2L41A 2FJEB 1G7UA 3VF0B 2BQUA 1UAWA 1H98A 1JNEA 2Y5SA 4GGBA 3NG8A 3TA2A 2Y0FA 1VYRA 1KXQA 2PGCA 1V3MA 3RBEA 1SJ4P 2D23A 3K7RA 2DVTA 1T9VA 4URQU 4GZ7A 2ZA1A 1AFJA 1R0BG 2B6AA 4HTBA 4MTPA 4MY9A 1ECEA 3S2JA 1PKLA 4C6AA 4F4XA 4NNCA 3CPGA 1TR1A 3AXKA 1J0KA 2GJRA 4Z1DA 1F9CA 3W23A 2IS7A 1Q5YA 2IKJA 1WDRA 4RDWA 3A3PB 1N54B 3J7AN 4C9DA 3TK7A 1V6WA 1V3HA 4GO8A 3EDJA 3LCWA 4JS3A 2WVBA 3GFHA 1KONA 4AX6A 3CTTA 2HFSA 2CNKB 5L1KA 3PYDA 3PIPQ 3TOYA 4D1IA 1PYSB 2VT0A 1OADA 1V6VA 1S1WA 4QIFA 1US3A 1QRQA 1PZ1A 2R8KA 3DFNA 5E1QA 5BRQA 1AD1A 4BCAA 3FZ2A 3LGMA 3ITLA 4M63A 1FRBA 4DWSD 5GVJA 3ETOA 1SU5A 2HG4A 3PPFA 2BKPA 1H62A 4UFMA 2FYMA 4W8LA 2V2VA 3UD3P 3IRXA 3IXQA 5A2BA 2I1OA 2B4GA 3ZR6A 1ZA1B 1EWDA 4W7UA 3SO7A 5IT0A 4YEAA 4H8HA 2ZH2A 2OFHX 2DH7A 3HPFA 5A8RB 1KQYA 2CPEA 3ZJ7A 1YI2S 2X1GA 2CPUA 3STCA 1EOKA 4WXWA 3NNTA 1F2GA 4PYSA 3IUDA 3T42A 2BY2A 1S1UB 4KYZA 3MUMP 3PB0A 1BWEA 4K4WA 3V3WA 3RHGA 4S3GA 5AOUA 4JTKA 3CCTA 3LEPA 3M8QB 1MUMA 5D09A 1A5LC 5LXEA 3DYAA 4PCNA 3LWLA 1JFXA 4OECA 1Y5XA 5KT2A 5IS2A 1ELSA 2WOMA 2JEPA 1UKOA 1QLNA 3KLEA 1MWOA 4AY7A 2IPGA 5LSOA 1H60A 3OIXA 3EOUA 2EWHA 4I67A 3MEDB 1JDFA 2R94A 2PWHA 2A1BA 2WONB 3O16A 3A3NB 3DGVA 4DR2J 3JW7A 2B9WA 3SGGA 3GSDA 5BYWA 3LCXA 3GRIA 3HHLD 5A2QY 3MV01 3MUVP 3BSNA 4ED5A 2EBGA 3ZC4A 1Q4NX 3WN6A 4HOWA 2NSXA 4NI2B 1FP8A 2ABAA 4WJEA 3HPXA 3NQAA 4USIA 3GTXA 1LT8A 3PNUA 4HKQA 1DIEA 3OD2A 2J7KA 4WWSA 4D3HA 3E5BA 2WB1D 2CJBA 4C1KA 3FJNA 3PZIA 3FCWA 3I56S 4L75A 3GDBA 1BRLA 3OEXA 1KP6A 1U09A 2CZDA 2V3EA 1UB3A 1Q2RA 4A4AA 4RW4B 2WLYA 3UF9A 1BGXT 1WJ9A 4MIWA 2V50A 4FKYA 3CMFA 2CQ3A 3DM2B 1HQEA 4CNUA 2O67A 4N9BA 2XM3A 4NLYA 1QE1B 2Y24A 2PEHA 4K0KJ 4O23A 3ZT7A 2H65B 5HNNA 2ATSA 1JL8A 3OW1A 1ZBVA 2H8ZA 4NQ1A 3BSOA 3BWWA 3PKMA 4MYXA 3FKBA 4GKKJ 4LCRA 3LALA 5AVHA 1HFBA 3H59A 3D1QA 4AIBA 3Q83A 3B8VA 1MLAA 2OELA 1ZENA 4GQGA 1N8FA 4GKJJ 4WZHA 2KTQA 2YNIB 3AB4B 4FVMA 4XK8C 3TAQA 1KFKA 4RNFA 1JLGA 4EF9A 2L9NA 1YIXA 2W9BB 5DCEA 5K8NA 4LRDA 1K9EA 2RIJA 3GU9A 2E6YA 3MSYA 4YS1A 4UBPC 1I4NA 4G8TA 5MLCV 1UEVA 3I55S 2UY2A 3R6GB 3T7VA 5H2ZA 1HKVA 3A4AA 3P61A 3W7QA 4CH1A 4IT1A 1DTTA 3GJTB 3I65A 2FLLA 2YOCA 2PF0A 3LXBA 3BQ5A 2B0GA 4NL5A 2O7SA 5HO4A 5DJBA 2PDIA 4AE5A 3BBFA 2AV5A 5KFTA 1RK6A 5BXIA 3NS6A 1KCLA 1NWUA 4A8MP 3T1AA 4LEFA 3URQA 1P1LA 1POJA 5BXPA 4DO4A 3W9JA 3D0GE 3N3MA 4IPPA 2GFTA 5HMYA 4V33A 1QWGA 4JIEA 4UR9A 1H7OA 5LJ3Y 3J81U 4W5UA 5HVFA 4JI2F 1FUYA 3NSXA 1R8PA 3OBIA 3QKEA 1BC6A 2D2JA 2MSSA 1UFLA 2VDHA 5GAGU 4WGHA 2DGWA 2H4WB 2XINA 4QPTA 3WX4A 1HHTP 3QZEA 4C65A 1OX4A 4ICNA 4MKYA 2MZ1A 2AIRB 4DL7A 2DW6A 5HDRA 3TXVA 2Z0GA 2WNNA 2OTJS 4MFDA 1JAEA 1Q6GA 4GCAA 3RNDA 3S2MA 2DHHA 1XLHA 3UXIA 3DDIA 2Y5JA 3TSDA 1GG1A 2LQJA 2HQFA 1G1XA 1IBKJ 1HNZJ 2XFFA 1TJPA 4DAFA 1FNMA 1UIOA 3OHBA 3DERA 5A8PA 4EE9A 4NRTA 3H8YA 1NWTA 4Q43A 1CVJA 2OLAA 3BL3A 5AXMA 2XS7A 2FC9A 5HXMA 3KJNB 2YX0A 4IM4A 3WBAA 3F4DA 1SCJB 4UTTA 3MDUA 3FCVA 4WK3A 2ZRWA 1ZCCA 3OR1B 4DEFA 3KWMA 4YB1P 2WHLA 1VLIA 5RUBA