3A13A

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
436
structure length
435
Chain Sequence
YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Sturcture-based optimization of a Type III Rubisco from a hyperthermophile
rcsb
source organism Pyrococcus kodakaraensis
molecule tags Lyase
total genus 149
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3a13A02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3a13A01
5C2CA 5HJXA 1RCXB 1IR1A 1RBOB 2CWXA 1RLCL 1UPPA 5HATA 2D69A 4LF1A 1RSCA 3NWRA 1RUSA 1WDDA 4MKVA 2V67A 2QYGA 4F0MA 1IWAA 2YBVA 3KDOA 5RUBA 9RUBA 2VDHA 3AXKA 1EJ7L 1IR2A 1SVDA 1TELA 1AUSL 1RBAA 3A13A 4RUBA 1RLDA 1UW9A 1BWVA 1UWAA 5HQMA 5HQLA 3WQPA 2RUSA 2OEJA 8RUCA 4F0KA 1AA1B 2OEKA 1UPMB 2V68A 3AXMA 5HK4A 3KDNA 1RXOB 1RBLA 4F0HA 2VDIA 2V63A 1GEHA 1RCOB 5C2GA 5HAOA 2V69A 3FK4A 3RG6A 2ZVIA 4HHHA 2OEMA 1UZHA 2CXEA 2V6AA 3A12A 4NASA 5HANA 3RUBL 4LF2A 3ZXWA 5HJYA 1BXNA 1GK8A 2OELA 1UZDA 1YKWA 3QFWA
chains in the Genus database with same CATH superfamily
3AMKA 1R3VA 4C11B 4NJKA 3EPIA 4PB4A 2DHXA 3IRSA 1TX2A 1V3JA 2R6OA 3QHMA 3EDQB 4JGDA 4NLGA 4E4FA 3VAKA 3HF5A 3CPUA 2OFGX 4R25A 4GUFA 1J9YA 1WSVA 1DTTB 3R10A 5FL1A 1T9WA 1KC8T 1HD0A 5DCDA 3A4WA 2EQDA 3M8YA 2CWNA 2AX0A 4W86A 1QY7A 3ATYA 2PDPA 2A6MA 5C9RA 4S0MA 3R6IA 4XO0A 2XH0A 1NB2A 4R53A 3IJ9A 1LWCB 4PODA 4DV6J 4WK1A 2HQFA 1NHVA 5KFUA 1XLKA 1DIOA 4CTAB 4QYZK 3B8UA 2DH2A 4OHQA 2M70A 4OX7A 4F2TA 4CLUA 4KE5A 4BWLC 4DAFA 1BYAA 3L4VA 5DETA 4BDPA 4HVXA 1GOXA 4KC5A 2FJDB 4Y28C 4E3VA 1ZH5A 4ZMGA 2A3AA 3RJXA 4DIAA 4QP0A 3PXGa 4GBDA 2XH2A 3OLEA 3G4SS 1FA2A 4DVOA 3RB4A 4Q5VA 3MUY1 2BE9B 4PMJA 1BG4A 3HSGA 3G24A 2FVKA 3PUDA 4X22A 1EHWA 4O44B 4BBYA 2W2MP 1KFWA 2W5FA 2EG2A 3KK3A 1DPMA 3OGSA 1MU2A 1GOWA 2FVQA 5C7PA 4Z17A 4NYOA 3I6PA 3QWUA 3U1MA 1RAEB 3UNTA 3MSDA 4QE5A 3QY8A 1AK5A 1EB0A 3W27A 2VFSA 3NDOA 1XMQF 3GG1A 1A7GE 2OQLA 5HBMA 1VIWA 3GR4A 3S47A 2W8KA 2W62A 4XWUA 5DN1A 4GLEA 4AX7A 3EGNA 1BVWA 4FF3A 2J9EA 4PG4A 4O4GB 2HW3A 3H4BA 5HP1B 4CU7A 5DG9A 3CAKA 1RAHB 4DUXA 1XC4A 1OSDA 2XYPB 4NXMJ 4FO4A 3DRPB 4DR1F 3AHYA 4ICLB 4OMFG 1S1TA 2VBZA 4ZE4A 2I5QA 4YYCA 4LVNP 2QA4G 1UKSA 2Y7DA 3M16A 3OTOF 4NXMF 1WF1A 3QT6A 4KT2A 1RT2B 2BXYA 4JI6J 1WUUA 3J81U 5F3ZA 3DRYA 4E2VA 5K2ZA 4KKOB 2NS1B 4X2RA 1Q86T 5EMMA 3VAVA 3TN5A 4LAZA 2CPIA 1S7IA 3NWGA 1US3A 1QPRA 3CC4S 4ANEA 2G95A 4LYQA 2YNIA 5F3TA 4CQDA 5C5JA 3W3OA 2MSTA 4UW2A 1UIOA 4C97A 3GU0A 1ICEB 2AMGA 2RT3A 1ZP3A 4UFJA 2I14A 4FYYB 4ELVA 2P53A 3TANA 4WKRA 1JPIA 4O0QA 4O12A 1FXLA 4MVAA 3S42A 3MYPA 3C52A 4NQ1A 4H00A 1XCXA 2RH3A 2KZZA 4DPQA 1DTQA 3OSNA 3VILA 5J2MA 3PK7A 3KX6A 1DQUA 1X38A 5A6SA 1YZ7A 1VCVA 1IT8A 1AZSB 3Q2SC 1S57A 5KFGA 4A8WA 1IBLF 4JTUA 5DGAA 3VGFA 1RTIB 4GMKA 4J7RA 1ZTVA 4M1BA 2LU2A 5I78A 2IPOB 4KGKA 2Y0SD 3AISA 3JYTB 4K0KJ 2XGPA 1O5XA 1JLFA 4OYXA 4USHA 3EA1A 4PL1A 4Y96A 3M8RA 5IXEA 4M7SA 5I07A 5FESA 1N2VA 1J2BA 1ADSA 5FSEC 2LQ9A 1NSKL 3THDA 3D3FA 4DO4A 3QLDA 2UXBJ 3C86A 2CLEA 1E1FA 4BWLA 3RPMA 1FE0A 2XZWA 1OFQA 2ATSA 5A6WA 5EMJA 3LU2A 4AD6A 1WI6A 4X4OA 2OFJA 3QGGA 1VBGA 2EG1A 4K7VA 4K36A 3FBEA 2QHAA 2WZHA 1A0EA 3HD1A 4N8NA 4ZLNA 2DR9A 2P5VA 2ZH6A 2GZOA 3BZQA 3KCOA 3G1YA 4GO8A 4OI1A 1J0IA 2IKIA 3PJWA 3W37A 3UBPC 4TU1A 1NK8A 1K8AT 4QG9A 4PUWA 3KWSA 2ZKTA 4IMAA 3OPKA 1MXGA 1GG0A 4GGBA 2K8GA 4P73A 3H2FA 1UCNA 3M30B 4I2PA 3T0DA 4RW4A 3KOWA 7ODCA 2QEZA 4F8XA 4ROPA 1U26A 5FLXY 3W7OA 3NCQA 1UETA 4PN2A 2ZRZA 3F41A 2JEIA 3GWQA 1U24A 2HFVA 2M52A 4HDHA 4I64A 2ON3A 1EUNA 3ZZZA 1L2QA 4GKJF 4DLFA 2ZX8A 3UZJA 1Q78A 4ADUA 2X3DA 3M1VA 3C15B 5XIMA 3K5OA 4LCQA 3C3UA 1EJ7L 4UTKA 4UY8T 5IM51 2ACMA 3A8IA 4Z1AA 2LP4A 7FDRA 1PZ3A 4B9VA 5LIYX 4OX9J 3FRYA 2HWTA 2Y1HA 4GOAA 4ACZA 1ISYA 4MMOA 1FFRA 2Z2MA 4J3VA 3UY8A 1U6FA 2Y7EA 2VD3A 1OJ4A 5D9OA 1GW9A 4TMCA 2OSXA 4LUTB 3H0PA 3PO5A 4TU9A 1KBBA 2HG4A 4CCCA 1S2AA 2J13A 2YCKX 2ZJQQ 2N4DA 1FESA 3MR5A 2HVEA 3KWXA 3RAXA 2HS6A 1QFEA 3OTEA 2C1IA 4PG6A 3IVSA 4FKXA 3KDNA 1LFWA 4RLEA 3KEHA 4B2DA 4D6HA 3KLFB 1GVQA 3EMQA 3PZ9A 3CJKA 4H7ZA 2AV5A 3EXYA 5T14A 3NSMA 3SIZA 5HLFB 4OWGA 4XAKA 2V8DA 2WMIA 3TMLA 2VPZB 1HYSA 2FH8A 3PW4A 1FT8A 2NLWA 4EO8A 2RSQA 2AJ0A 3LPFA 2KXNB 3PYFA 4D8LA 4E2FB 1H50A 2P6SA 1TL3B 1Z41A 1JWWA 4AVNA 5JBDA 3EXTA 4UTJA 2VTFA 3PBMA 4URGA 3R5BA 4NL1A 1IYXA 3N6LA 2CADA 2WLYA 3E0IA 1T9TA 1S5NA 1TR1A 4EAYA 4U2YA 2U2FA 1ITPA 3G77A 3TLQA 2YCLA 1OX6A 3MI3A 4ZP8A 2MZRA 1J6OA 4AQLA 5AVHA 2GUUA 4I8DA 2WKLA 4DS5A 1CS4B 3UR3C 3UCCA 4FXVA 1LWEA 1RA6A 1VFSA 4V1YA 2DPIA 4GXMA 4B3RF 2QYGA 2VOTA 4CDIA 4W7UA 1CLKA 1ZPTA 3TZNA 5CLWA 2AEFA 2W7AA 4MIBA 3ES8A 4OLOA 4QOTA 5LA1A 4E8GA 3NQEA 1TFYA 4PFMA 1UWBA 1SW0A 3KHRA 3WBEA 3E96A 5IT4A 2NV9A 5C55A 2GX8A 3P5YA 5L1IA 4DL5A 1PZ2A 3MGJA 1LLZA 3TR2A 1KCKA 1LYXA 4GY1A 5C7VA 4IUGA 4IL0A 4J91A 4M5DB 2ODOA 3EWCA 5CXPA 4YCOA 3S4TA 2VG5B 4PWDB 1AJ2A 2W2PP 1XXXA 1R8PA 4REQA 1R27B 1E0UA 5DXXA 4IO9Q 3IIPA 4U33A 5AKQA 3W71A 4U8YA 4O50A 3QY6A 3NQDA 4MZ8A 1H0GA 2BVDA 2PTDA 1EH9A 5DANA 2YLLA 2NXCA 2FDSA 3QPIA 2F4VF 2HRWA 4DX3A 1ECEA 2MQNA 3VFLA 1SPBP 1A3HA 3SB0A 2BEFA 3VGEA 3LZ3A 2VPYB 1NPKA 3MR3A 1PHWA 3FSUA 4JTDA 4XTIA 4P9SA 4JBCA 1TK0A 3TXVA 5E2QA 2QMWA 3HG2A 3WH9A 2WHMA 1TREA 3A64A 3FCWA 1GG1A 1WKDA 3KCLA 2WBKA 1QI5A 2DZVA 2VC9A 4C91A 3SY8A 1J0JA 3EX4A 3EXCX 1WHXA 4LGXA 1WI8A 2XWYA 1VEMA 4GBUA 1ZOTA 2UUCF 1VD6A 3L9CA 1E4LA 4DV4J 1AODA 1L6WA 4PG7A 1VQ6S 2JSXA 4ZLJA 3LV5A 3MV01 1N36F 1SJRA 3TOQA 1N56A 3LENA 1EDTA 3HM7A 3NGTA 1ML1A 3T08A 2CZVA 1TCMA 3M5ZA 2XLJA 3IARA 3L09A 4DR3J 3VV2B 1JCJA 2PEBA 4OHXA 5I3GA 3II1A 5KFEA 3FJNA 4NA1A 2V81A 4HSOA 1FJGF 1WOAA 4YHHJ 4WDTA 2X1GA 4FBTA 1OJXA 2OP5A 3R12A 2RKIB 2VR4A 4R88A 1XYBA 3AALA 4KWUA 3MEGB 1J6PA 4JYFA 5F8NA 2YXLA 5HI7A 4M6QA 3K8LA 2ZD1B 3WIVA 4EF9A 2XUCA 1J0ZA 4JIEA 4USKA 3SDEA 5KMYA 2VZ9A 3P8IA 2YDSA 1S5MA 5K4XA 2BHYA 1SPQA 1QK2A 3CJ0A 4NYUA 1SI9A 4LTSA 2EW9A 4WDXA 3V0UA 3MDWA 5I7GA 3TSMA 1S9GA 1SJBA 2FJUB 2FHOB 4PUNA 3ILLA 2X1FA 3NOCA 3BICA 1HKVA 5F0UA 1HBNA 4HLBA 4QYRA 1EF2A 3AFGA 3VGUA 4UQGA 2YL6A 1VQSA 2V9KA 1LW0A 2CJKA 2JEJA 4HYVA 2GFTA 1KBLA 3QQ0A 4GVBA 3RFAA 1HBOA 3BLDA 1GFWB 1DFDA 2HCVA 2OR2A 3GH5A 3BSAA 2XO6A 1UVIA 3AFBA 2XH7A 1H1NA 2JGYA 4WXZA 4R0EA 4C6BA 2XIJA 1MQRA 3A4XA 1IV8A 3B8WA 5F8LA 3FBFA 2BQRA 2PFDA 3N1AA 2YPIA 5BOOA 3H2MA 5C42B 3JTPA 1X4HA 4YB1P 5D78A 1QHPA 5A0YA 3CAWA 4ZIVA 2DSWA 1I5OB 4ED2A 1CGTA 3BLIA 2A21A 2XDFA 3CMFA 1U09A 2C1HA 4OLPA 1W7WA 1O5JA 1XSJA 1IZJA 2V6AA 1PCAA 4TVAB 2XEXA 4WX2A 3E74A 1CVJA 2A2DA 1N88A 3R8YA 1UH4A 3QXBA 3PZOA 3W25A 5M5DA 3C2FA 5FF4A 3N14A 5FEZA 3GVRA 1N48A 3HKWA 3ZM8A 4BHQA 3SM0A 4AWUA 3FAWA 2F65A 3MOZA 2C1EB 1SO5A 1ZSXA 1IM6A 2RB7A 1GQEA 4WDWA 4BJHA 5HATA 2PODA 3RX4A 5FJOA 1W1B1 5IM0B 4OT7A 3TEHB 1AH4A 4ZGYA 3KLIB 1S6OA 2DEPA 4YXGA 1MMFA 2R7QA 3R89A 1EP4A 3W1AA 4KCWA 4NZ7A 3UO0A 4B3OA 3QHOA 2O4MA 4EWND 3UR5A 3VDCA 2PP3A 4RPQA 1Q95G 3WQEA 3H4WA 1LWFB 3RRXA 2ZUGA 4HTJA 2V8PA 1FDYA 2UV8A 1WZAA 3OT9A 3WELA 2QLBB 1X96A 4C6NA 2VG6B 5ETQA 3NGDA 3DOKA 5TIMA 4UFIA 4RDYA 1X4FA 5KFBA 4A8SA 3KFWX 4X0NA 1YIJS 2XIQA 3HV8A 1XCFA 2QLXA 4L6OA 3TW0A 1TELA 4IQLA 4C3MA 3FA4A 1IE7C 1BYBA 2XG9A 2IPGA 3ZWSA 3H8YA 2GVZA 1CIUA 4NL5A 2VH7A 3D47A 5DQHA 3ELFA 1CULB 1XYMA 4JYEA 4OZ5A 1W3TA 2W25A 2CC0A 2NVCA 1RVKA 3P8JA 3FCVA 1YZ6A 1C92A 1GKQA 1TZ0A 3QBCA 4OZJA 1HP5A 3VZXA 2MQ8A 3VZYA 3MTWA 3DM2A 4DV5F 4NZ5A 3TARA 1OBAA 3QIDA 2WPGA 2QJIA 5F8IA 4UZCA 3CT7A 1SFTA 3VAHA 3W2LA 1U1OA 2E6DA 2DBBA 2EC0A 1RA5A 4JYAJ 4P7NA 3EOOA 4S3KA 1T5AA 4IG3B 3OUYB 5F4WA 1J27A 3AJ1A 5C2GA 3G6YA 8XIMA 4OJGA 3NMRA 4W92B 4IICA 4JPGA 5AHIA 1HWJA 2OSRA 1LOSA 4RDVA 4M6PA 4TY8B 4ZP7A 2CNNB 1OK6A 4C8ZA 1TJ1A 4NX9A 3VGTA 1XERA 2CXEA 4J7CA 4DQRA 1UD2A 4ZTXA 2A6LA 2YNFB 3FSYA 4KFBB 3K17A 2Q71A 3UT0A 1VR6A 4CEUC 3H2OA 4LRTA 2JC1A 5EMLA 1RDRA 3U2OA 2H90A 6A3HA 1R31A 4H2HA 2NV2A 4A3YA 3DUGA 3IANA 5LSRA 4LYRA 4B3TF 1AB8A 1JEZA 1RK5A 3PZVA 3T44A 2C2EA 2QS8A 7TIMA 3EB4A 1UROA 2DV0A 1N5YB 2ALDA 3QZ6A 3UR0A 3PTQA 1PTGA 4AZ6A 3H24A 4J9JA 4MIWA 5CBJA 4F9DA 4WKYA 4FIQA 4ICMA 1OD0A 4AZCA 3PTWA 3QC0A 4I2QB 2GW8A 4MH8A 4IXXA 3UVAA 3S9YA 2Z7KA 3UXDA 2C3ZA 1DKWA 2V9DA 3N9SA 4UTTC 3OJGA 5AYBA 2CNKB 1NDWA 4C3KA 4LH8A 3W5XA 1FXDA 1RAJA 1IR2A 1KOHA 4ZQOA 2KZMA 3E2EA 3HQOA 3IP0A 3WEMA 2FHMA 4P7OA 4BQ3A 2E1DA 2AX1A 1KM3A 1MW0A 3POCA 2AHOB 2VUGA 2ADCA 2MANA 3SY5A 1EPVA 3VGDA 3L68A 4RUBA 3QRQA 4HQVA 1AMYA 3FEXB 1XYCA 4MT1A 4M94A 3U2EA 3O5TB 4O13A 3U1LA 3EDJA 5T26A 2PI4A 4ADSA 2Q43A 3FMBA 2D0FA 4XD5A 1RB0A 2XIMA 1IVZA 5E09A 3QAEA 2R94A 1R6WA 2OEJA 1P9QC 2OHDA 1AQ0A 4W98A 2WC4A 5C0QA 5GMEA 3CAQA 3LOTA 2QPSA 3W1MA 2FLNA 4MDOA 2YX4A 2J7UA 3GR8A 1XGZA 3GTYX 2Y5JA 4D1IA 2JQXA 2IYGA 3HHLD 3WF3A 1R3SA 3GZ3A 3ZFVA 1FQ0A 4TYAA 5CAHA 1NJWA 2YJQA 4YTRA 3NA8A 1K9DA 3H70A 1N5SA 3EZUA 2DIEA 1PGZA 5BYQA 3AH6A 3BGGA 2K1RA 4IPPA 2VASA 3HHNB 2ASDA 3D7SB 1Q6QA 2ZE2B 2DY1A 4BA0A 3PRDA 2J6XA 3EKGA 1H11A 2R7XA 2BBFA 1BHNA 2BQUA 5J2NA 5U4NA 2BABA 1OM0A 1SM9A 3S1XA 4ATWA 1OK4A 2WNQA 1E6YB 2FC9A 5H9EK 4LF8F 4L61A 2WW8A 1W1A1 4OTKA 3FFIB 1LBFA 1RPKA 4EZ6A 4QE4A 2J7GA 3O2LA 4MFEA 3PKYA 3NGUA 3K7RA 3MUXA 2OGUA 4Y0FA 1X5PA 2W3ZA 2D3O1 1JG9A 1Y9OA 1KV8A 3IAM9 1P0NA 3SSSA 3AIVA 3MW7A 4KGLA 3UA3A 1U25A 1EL3A 1SV5B 1XNRF 1SXLA 4JIHA 1VKFA 1EJXC 3TW9A 4OBSA 1C4AA 4MKVA 2VC5A 4GYKA 3W64A 3LUTA 4HNTA 1TMJA 4KGJA 1MEIA 3PZIA 2J75A 3ARTA 2H3EB 2OLSA 1GNKA 1FP9A 4MTVA 3HI9A 4LRCA 9RUBA 3WJSA 1R3TA 1A3XA 4HU0A 1IT7A 4HJFA 2BOGX 2NZ4A 3RB6A 1XRFA 4HYWA 4LIRA 5J2QB 3OG2A 4HHJA 3W7RA 3CUNA 1V3HA 2UBPC 1XISA 4M5LA 4PXEA 4PCSA 3VWSA 3E51A 1G0CA 5C24A 3TOPA 4Z1BA 4A3QA 2HPUA 3JSMB 3GFHA 4Q7NA 4GYPC 3KP0A 3FCPA 4TMBA 5D3GA 3JU2A 3UZXA 3UA4A 4FBUA 5C70A 1TPC1 1KR4A 3O06A 3ZZTA 2J76E 1LL7A 4JDYA 4NZ0A 3ZJKA 3MZ2A 4IYQA 2C22A 4PBGA 2E9MA 2EKGA 3QR1A 4UTTA 3C6TA 4JI8F 3N13A 4DJED 3NGFA 1FKPB 3W7LA 4DL3A 1JDFA 1RP8A 2HBRB 1YTEA 5J1EA 4EBDA 2ZZMA 2WMFA 1HPZB 4F40A 4Q8EA 1M3UA 3JQJA 1RQBA 1K4HA 2PTWA 4M5MA 4F3MA 4ZQRA 1J4EA 4HPNA 2NYHA 1T7LA 4OYIA 1GW1A 3TQKA 3QMTA 3NL3A 2PDWA 4N76A 3MDUA 1ITXA 2CBVA 3F7JA 3IG1A 1VMBA 4DF1A 4JI5J 2KFNA 2GWNA 2XI2A 3FHAA 4YR2A 3N25A 1NEEA 2FZDA 1YMYA 4LF2A 2HQ3A 2UXCJ 2FHJA 3W6MA 1LP6A 2OYMA 3MO7A 2R2SA 4ZPDA 4RV3A 3ITXA 3IAQA 2FFCA 5DQGA 4ECSA 3GDTA 1QAIA 3RU6A 5FOOA 4HBKA 4QBUA 2PDAA 3HP6A 4KEUA 4QPTA 4LX4A 4GPNA 2HE8A 1SR0A 3I7SA 2F8HA 3T4CA 2Z8QA 4KRUA 4QJ5B 3TYUA 3CD7A 4GY7A 1FXQA 1E6NA 2QXWA 4I9TA 3GNPA 4R8UA 2GVJA 3GZ7A 4L6HA 4HK7A 1TL1B 4P7VA 2Z00A 4ECLA 6TIMA 1TE6A 3IM9A 4RL3A 1SB6A 4QJ4B 1T9VA 3P3BA 3UJSA 4ZO8A 1RP9A 2QF7A 1EFZA 2CPUA 3FS2A 2AGOA 1KTBA 3DFYA 5A8PA 4NOHA 4QBXA 2VFEA 3GXMA 4DSLA 1VOMA 4O3PA 3G1DA 1S3TC 2C6QA 3CC7S 1I51B 1YW1A 2ABYA 3CMQA 1RBAA 2QCEA 2J7EA 3H4GA 1FFWB 2ZH7A 4WFZA 3WH5A 4YU1A 5M2FX 3VE7A 1E56A 4HZMA 4G1PA 1UD5A 2BYCA 2P9CA 2YXOA 5E1QA 3X3UA 4MNLA 2HRUA 4G9PA 2KI2A 1ZS2A 1SJ3P 1HD1A 3GNDA 4CZCA 4WZMA 2E6FA 4QJ1A 3FYYA 3PFMA 2RAQA 1BAGA 5TF0A 3CF5Q 1E15A 3R7NB 2OPJA 4F4RA 3TCEA 2O9TA 4GO9A 1UP0A 2ZBQA 1CJTA 1HIYA 5KFIA 4O3RA 4XO7A 3GC4A 1IGWA 3R27A 3VUPA 1EBGA 4OJHA 1Q6OA 3QGKC 4EYHB 2OTLS 2AGPA 3FKRA 4GYPA 1GQLA 2POTA 4K38A 3AT1B 5ETVA 3UU0A 2WCXA 4WXYA 1KCXA 4KCVA 1F6YA 2O1PA 5AJ3F 3NS6A 2PTZA 3MMBB 1YBUA 1A0CA 4PMRA 1A49A 1EOKA 2VL4A 4FYDA 1PC4A 1U5VA 1F2HA 1ZAVA 4B5VA 2OB3A 2HLUA 1M9HA 3CH0A 2V2CA 5HINA 3QO9B 2ICSA 2G2OA 3T9NA 2YH1A 2QDDA 3DGVA 4KRTA 2V2VA 1H5YA 3CASA 4KH0B 4ID5B 3IRXB 1YHQS 3JZEA 1LJYA 3H53A 4DR4J 4RNOA 3MI2A 1P27B 3EOLA 2HHQA 2VIHA 3ET6A 1NWSA 4OJ3A 2GVYA 4AU0A 2R24A 3EPMA 1K0TA 1XQKA 3GDKA 2DY3A 2J79A 1OS5A 1P6TA 2BZNA 1N7KA 2RGMA 1LWCA 2R7RA 1K7FA 1ISZA 1W5PA 2QUMA 4XSLA 1VS3A 2FDNA 4YY3J 2KTQA 1EZWA 3KVLA 1HL2A 3TYAA 1PIFA 3M2UA 4CRJA 5CAAA 1SW3A 4I67A 3CDEA 3TAKA 5E9XA 4PMNA 3NVTA 4PCQA 3ISZA 3SGGA 1UEVA 3ZR5A 2OI2A 5E6ZA 3AUOA 4AYBD 4P8UA 3L23A 1HF6A 2UUWA 1O1HA 1UZ4A 1I1GA 3BS9A 2W66A 2KJWA 5T7LB 5JXQA 5KFZA 3TMQA 1TPWA 3B05A 3IJIA 2GVLA 2FIUA 5FL0A 2CKWA 4O44A 3NP5A 2Y1JA 4C4WA 4A8NA 2VA3A 2PC8A 3HHLB 3IV3A 4IMCA 1JJ2R 1M41A 4OX6A 1XLGA 3OXFA 4PCFA 2XVKA 5AZ0A 5L1KA 3QMQA 4J9PA 1UFLA 1GOQA 1ZM2A 1L3TA 3ICJA 4H6EA 1RI7A 3M6XA 2CZ9A 4IQMA 3HO1A 2XY6A 2BVWA 1TJ2A 3ZS4A 4QDPA 2E8YA 4RKUC 1R86A 2O7SA 3G0SA 1JYVA 2Z0GA 5B80A 2AKWB 1KD0A 4CLTA 3T19A 5C25A 3DYAB 1NPRA 2MUCA 4XAPA 3DRPA 2DPEA 1VRTB 2YZ5A 4WOZA 2ABBA 4RZ4A 3ARUA 4XKMA 2F2HA 1F4AA 4CH0S 4WKHA 4LB3A 3E38A 1KRPA 5AXNA 5J8LA 5A6KA 4RZBA 5KG2A 4EVZA 5BJRA 1VFTA 1VYSX 2AD9A 1GMWD 1RT2A 3CL7A 1G9HA 3CCWA 5HL7Q 4KKOA 2K2PA 1FFSB 2WMGA 1UIPA 3W84A 5TQLA 1EYWA 3MAAB 3MEDB 1UUQA 3L7OA 3G1VA 5LKYA 4JFUA 2WCGA 1UPPA 2D9PA 2NT0A 2V2HA 3NG3A 3BJFA 5ABTA 2GHWA 2D22A 2AJ1A 5JIWA 2AJ2A 2ZBPA 2IBKA 3EX6A 1S1XA 1KGWA 1QPQA 1GXTA 2ADBA 4E3TA 2M4MA 3C6UA 3O44A 2BVYA 5D2TA 5F8JA 3H25A 3LANA 2EPKX 1Y5IB 1AJ0A 4X4TA 3BQ1A 1SSDA 4X4NA 1ITUA 4KPLA 1QVGR 2D3NA 2PD9A 2DEJA 5RUBA 3VQTA 5BWAA 3S6DA 4Y2WA 4TV5A 1BWKA 4ECQA 1E6ZA 1PEZA 3WDIA 5HWNA 3HDSA 3QSTA 4Z2GA 2CJXB 1HBUB 3HPSA 2HNZA 2ACYA 4DZAA 2QRRA 1QMLA 1AZSA 3N6QA 4UCFA 1LWXA 4JQ3A 2IRYA 4QRNA 4CLMA 5HQEA 1FJCA 4DUTA 5HMXA 1PJ5A 3LPGA 1ZM4A 4P75A 3VKDA 1SJ1A 3OLDA 3HPZA 1NDLA 3PR2A 4JQ1A 3AB4B 4C48A 1TUWA 1Q53A 4FF5A 3E2SA 3SGZA 1ZCOA 3EKLA 4U28A 3OLAA 4ZLPA 1O94A 4LEQA 4QEEA 1NFPA 3OJSA 2QCMA 3BJYA 2PB1A 3DDIA 5BYSA 4J2MA 3LUYA 1NJZA 5LIWX 2C79A 2W6RA 3W26A 5C71A 3SRDA 1SIWB 4AIBA 2OPSB 4O10A 3IGSA 1HW6A 1HWIA 3FXYA 4CGTA 2HJPA 4B91A 1A5LC 4FNSA 4E2BA 1MXDA 4N6FA 2HZCA 2RRBA 4HHMA 5F9LA 3CDBA 3W1NA 3TVZA 1SH0A 1UD6A 4HNOA 1A5BA 4C60A 4F50A 3DBPA 3GHTA 5IBXC 3GLJA 5H8MA 4JOUA 1K9FA 4IRCA 3QH2A 1SC4B 3DIPA 2YNHB 2CZEA 1RD6A 1XPYA 4ATNA 2V3FA 3L5MA 3Q83A 3CO8A 2BM1A 3SY1A 3C8YA 2VC6A 1BKSA 1FKOA 2IXUA 4Y2CA 2VEGA 3KOYA 5I3UA 1TUFA 1F6KA 1UP3A 3MWAA 1CDGA 1W56A 4X61A 4FLQA 5XINA 3QRPA 1VP5A 5KSWA 2V2DA 1IBMF 1XLJA 1FVPA 5LMUJ 4CNNA 1SGJA 4Z2KA 3KK2B 3V35A 3T1YF 4IJRA 4EI2A 5D8WA 4LFBF 1VRDA 1XMOJ 3VALA 1OABA 4M24A 3VMNA 2VFVA 1KXTA 3CWHA 2YKNA 4A8MP 1V02E 2WZEA 2OSQA 3HMCA 4I9AA 3NPXA 1FA0A 4DYJA 5HR6A 3ONQA 2HROA 3LZ5A 5H8PA 2J8AA 2VRJA 4A3RA 3EOSA 2QCGA 3GB0A 2YCIX 1HR0F 1J0YA 5JH1A 4NYYA 3IXQA 3CCJS 1FUYA 1SVDA 3M8QB 2IYIA 3VNKA 4RW8A 5D33A 5J2PA 2ZOGA 7XIMA 3GCXP 1SO4A 3BBFA 3CCSS 4PH6A 5AYXA 2TYSA 2ISDA 1JJHA 1LFPA 1UBSA 1S1WB 1M7XA 2DZBA 3NZGA 1Q16B 6CGTA 2J7WA 1EO5A 3HFKA 3KG4A 4CCHA 3EMCA 1HQ2A 3W7JA 1BSLA 3H2CA 3HJZA 1PDYA 2GVGA 4C8MA 3NYZA 4IIFA 3WIJA 1A47A 4L56A 5HLFA 2V5JA 4HP5A 4CNUA 3OLGA 2NSBA 2A3CA 5B7WA 3UPMA 1F3FA 5AXKA 3LX9A 1R8HA 4YL2A 1WC0A 2EG7A 2FJKA 3A9IA 1U5JA 2FKPA 2IHR1 3NM3A 1FX2A 2DCUB 1D2KA 4GC3A 1KCLA 4DBEA 5A6BD 1TL3A 4TLQA 2VOMA 5J5DA 4DCPB 4RL1A 5DDQC 2X1IA 4JTHA 3W2WB 3UWZA 3EPOA 2X0SA 4ID8A 3WG6A 3PWGA 2E1CA 1XM3A 4KTQA 4MKNA 2FZNA 4PUUA 3VOFA 4DUYF 1B4EA 2Y1LB 1FBAA 1EAYC 1DXIA 2IXVA 3GVGA 4DI9A 3MMCB 3N6MA 2CLFA 1Z6KA 2DFAA 3PHEA 4F2RA 4G56A 1VCTA 4S2CA 1I2NA 1W8GA 5IHRA 1ZA2B 3KLEB 3DKJA 2W0UA 4C5ZA 2XIIA 1P6WA 3T1AA 1SMDA 4V27A 3H4DA 1CS4A 4HTBA 5G4EA 3ZSSA 1M1BA 2G3IA 2B4UA 4EFAC 4NAEA 3TXZA 4NZFA 3RM8A 2QYCA 4OOZA 5IBXA 3OLIA 1BWEA 3SUVA 3HT0A 3IACA 1PAUB 1X31C 2A2CA 1PKMA 3TOYA 3W76A 1CWYA 4X2BA 1W1TA 1UR2A 2J6SA 4KPCA 4AD2A 3AIUA 4RNJA 1QJHA 4PTXA 9ATCB 2GO8A 1MVYA 1AW0A 2UXDJ 1VAHA 4PWDA 1RTZA 3I3EA 5CPMA 3HULA 1D8CA 1WDWA 1OGGA 2G41A 2MQPA 3OLBA 4BS0A 2EBNA 2QDHA 4NJHA 4MPKA 5KFSA 4P7TA 3QQCD 2EI5A 4ALDA 4XZIA 3GTIA 1IKWB 2DNQA 2BSLA 1ISWA 4LQ9A 2POKA 4D6DA 1LQ2A 1CXIA 5BOFA 1GUVA 2ZBCA 2D2GA 4JFVA 2BS9A 2FTYA 4AB4A 3IR6B 4IFVB 4XD4A 1JLAA 2J9ZA 1JLEB 3PZTA 4Y2AA 2GC8A 2L9NA 1RQHA 4PMUA 3K8MA 2DGQA 2G3JA 1PV8A 3AU2A 2OZTA 1T3OA 5AYIA 4QLLA 4FR1A 1TR0A 1SKUB 2W67A 3BH4A 2QCHA 4DZHA 2Z6JA 4HHHA 2BX6A 1LTDA 3SUSA 2CHRA 2KB2A 2R3VA 3NS5A 4DWSA 4JTJA 4L4LA 5A8RB 4Q8FA 3F5JA 3SQGA 1GOKA 3SN1A 1A4LA 2VENA 4WJEA 4AZ7A 1Q85A 3WC0A 1ONEA 1RHUB 1WUEA 5KFQA 1FHUA 5D4PA 1XG4A 4KGXB 4YP3A 3N18A 2AL2B 1VISA 2PRMA 4GYJA 4ZSTA 1Q13A 4P8VA 1JJKA 2LXFA 4I90A 1I8JA 1PILA 1ZENA 2RKIA 1W1VA 1TPDA 3N6HA 3ZWTA 3E01B 3ISIX 3TP2A 3MEGA 1SJCA 4E98A 4Q8WA 1EKOA 4ZVRB 1B0IA 2ZD1A 2VC7A 4DSKA 2VEKA 2WSPA 2GIRA 4K4ZA 4AXJA 4MF4A 4PRRA 4I6AA 1FE4A 3NWRA 3TYBA 3BO3A 3VDAA 4G6VB 4ZOEA 2RHQB 1TKZA 4TU8A 1YDYA 5DS7A 3WFZA 1SFJA 2YW3A 4NX0A 2G9OA 3S1WA 4PXCA 3EOEA 1K4GA 3UDCA 3SV4A 5A6AA 3MCMA 4RU9A 1GMVA 3P82A 4PKDB 1QW8A 1KM0A 3Q94A 1S99A 4QU7A 4LYPA 1NO8A 4AY1A 4NWBA 2MKIA 3M4HA 1XIBA 3N34A 3QN3A 1BVZA 4GX8A 2QJNA 5FJPA 2XVPA 1OADA 1OG0A 3LA4A 5GJNA 2B7CB 5JQ9A 1ODUA 4C6PA 1KBKA 1F5BA 3CCMS 1KM6A 3FXGA 3GHSA 1HJQA 4H9YA 3BCDA 3AYVA 3F03K 2BUNA 2X8RA 3EZOA 1BC6A 4QWEA 3LAMA 2U1AA 4MWAD 3V5CA 1LKZA 4K4VA 4PBEA 3RRAA 3JXOA 2DR5A 1X39A 4KR0B 3R11A 4DN1A 2PD1A 3A8EA 5E6YA 2LMIA 4JX5A 5C42A 2MZJA 2OGJA 2ZHAA 1OD8A 1ZLPA 3N5FA 5KT4A 1OY8A 2ZOMA 3EDDA 4ECYA 4CO1A 3SQLA 3MPWA 4S3EA 3UE2A 1KRAC 4HU4A 3NPVA 1TVNA 2PDCA 1PBGA 4A46A 3I9V9 3QIPB 1UTAA 1TVPA 5HUPA 3ZLGA 3TN6A 3MFHA 1EBHA 3RHGA 3TA2A 4JI4F 4EU0A 4PUMA 3GIRA 3URNA 3VDHA 4IO1A 1KM1A 1VLWA 4FXFA 4ES4A 5D37A 4LIWA 3VC6A 1S5VA 3A3OB 3HXMA 3ZFHA 3UJFA 1UQZA 3BW3A 2X1RA 3N73A 4RCXA 4R9OA 1DQ8A 4L65A 3Q89A 4D8AA 4US6A 1HJXA 3U7VA 4YQWA 2WVTA 2RGLA 1CXKA 3BAXA 5FACA 1FWLA 2KU7A 1S49A 3KLIA 1L3UA 2IKHA 3QPZA 1TL7B 5M1TA 2Y0BB 1YDOA 1GX5A 3QV9A 4EGLA 3RJMB 5A2QY 4RXGA 1T03A 1UR4A 2PF0A 3T5JA 3WBZA 1N8WA 3W7IA 4MKYA 3OJUA 4PGLA 4DELA 3A1YG 2VG6A 3KBJA 4P7LA 5LYRA 3NVDA 1HP4A 2IW0A 1R3WA 4PPZA 1IWGA 1ZZNA 5D2XA 5A3HA 4US5D 2I56A 3BTNA 1TKKA 1VCFA 2TPSA 3IGXA 4A2SA 4AMCA 1MXSA 1XSKA 3M43A 3ITTA 4DBQA 4R5EA 2VWTA 3GX9A 4IF2A 4N9BA 1CULA 3WJXA 1G4SA 4NZ1A 3W28A 5M17A 3MM8B 3K5XA 2R8GA 4J1OA 3EDKA 2LFVA 2KRRA 5GJMA 2YR1A 3NTYA 2PD5A 2R1KA 5AVNA 1BWVA 3HPXA 3LHVA 3OVPA 3TNBA 1JNRB 3CHDA 2EVZA 1T94A 2P8BA 3V5OA 3CE8A 3OD2A 3M05A 4ZVFA 1VYAA 1FJEB 2J47A 2QTWA 5I77A 2E25A 1Q6GA 3IC1A 3MI6A 4ECVA 4AQYJ 1HHTP 4NNAA 2WW5A 4IG3A 4P2FA 2CXGA 3E5PA 1KRCC 4KHPF 2INFA 3WD3A 3A8KA 1G4TA 1CXFA 3W2MA 4DV0F 2TSYA 5I3DA 3SSRA 4AEOA 4PCTA 5I3IA 3OB8A 4BQ2A 3BN7A 4C1KA 4PRTA 2Y8VA 4XZNX 1D1UA 3QRRA 4PTDA 4LVFA 5JIPA 1Y5LB 1KXVA 2YNFA 4KFBA 2FZ8A 1M7JA 4FVCA 1O5KA 1PZ1A 2EFPA 4OI3A 4DPOA 3DLEB 1SL2A 3WLOA 3UVJA 4DV7F 5IFTA 4LSNB 2YQ3A 1YE6A 4M8UA 1K7XA 2DJXA 2A7NA 3UPWA 3ZC4A 3MPYA 3ITYA 4U10A 2Z1VA 4LWWA 3N9UC 3GTFA 5KTLA 3L3CA 3PV8A 1XBVA 1N5YA 1L9WA 4CN6A 1TWSA 3M5XA 4QIFA 4DCOB 2DNNA 4NP7A 4QW8A 1JXKA 5C6MA 3WZ0E 3LK6A 1JXVA 1F1BB 4I2QA 4YB6A 1WKLA 2D7SA 1RLCL 2VVNA 1DYSA 2A5HA 4C8KA 1CJKB 2OPRB 5K8MA 2W24A 3NL5A 2EK6A 2PGEA 2WANA 4LNYA 5D38A 4PTMA 4C6MA 2V4QA 3V81B 3AOFA 4LF1A 3ORWA 3ZR4A 5CYJA 2UZAA 3KHGA 2C14A 1CGVA 2PDMA 3SV3A 3M8WA 5EFFA 3GE9A 3ISND 1RT6B 3DDMA 3URAA 2HS4A 5CYQB 1ZJIA 3AUJA 1V6VA 2WQDA 1HVQA 4W88A 1R2RA 1J5EJ 4J2PA 3V0SA 1KGXA 4K8RA 3HPFA 4XV0A 4OI6A 1QVBA 1H2VZ 2XCPA 3IAPA 2YFOA 3UWEA 2XNQA 4AYGA 2OD4A 4V19J 5DBUA 3GR0A 3DCPA 1I45A 2PWDA 2JIWA 1PSCA 1HHQA 2Y7GA 2TODA 3P14A 3PB2A 1M6JA 3BAWA 4UCGA 3ARSA 4PPDA 2WWCA 4IHCA 3TUUA 4N56A 2Z1SA 1K9TA 2HVDA 3POHA 4Z37A 3BV7A 3LGDA 4M5IA 4WY0F 1XDLA 4ZTYA 3TH6A 2DJWA 2FJWA 2ILZA 2G3NA 5LA2A 1TA3B 4AUBA 3GTXA 3UEQA 2Z1WA 1Q2RA 1NP2A 4H54A 1FDZA 4W4MA 1Y3JA 2CLKA 2ZE2A 5CABA 1RA0A 4EPEC 2E7FA 5ETPA 4K59A 3WDHA 3CVKA 1GWJA 2DIJA 4MYTA 1HARA 4P71A 2GJRA 1E5NA 3CMES 1GVYA 3KRZA 3MJYA 1IZCA 3SFKA 1F5AA 2CPDA 3H42A 4KO0B 1WPCA 3BJTA 3IS9B 3N4AA 4LBUA 1RV8A 3U5UA 2HMIA 3MPUB 2QJHA 5HVHA 2FY1A 1RTDB 3IEBA 4PRWA 2VGBA 1U83A 1QOXA 3KK1B 1QAXA 4NA3A 3U4AA 2G13A 4HPXA 3NQ8A 5LOQA 4GI8A 4LRSA 4GJJA 2D3LA 4RUAA 2CBUA 4AVOA 4LMZA 3ULHA 2ZICA 5E5CA 1Z3NA 1JZ4A 2HYIB 2VHGA 2FZ9A 1E9YB 4O15A 2JEFA 3HB9A 3MM9B 1E1EA 4QWDA 1KONA 4PYAA 3QEZA 3RLHA 3BF4A 4OBTA 1PYTA 4WWSA 2GIQA 4K2XA 3PW2A 1WHVA 3CUIA 5JUVA 3CULA 2IAJB 4LBRA 3BBBA 3QJLA 4OVXA 2AF6A 2CIPA 1U8WA 4O0KA 2DRBA 3IBWA 5KG0A 1JXEA 3R94A 3D1HA 5IS2A 4LAOA 4RUCA 3RIKA 4USIA 4W8LA 2Z7GA 3AICA 2XS5A 2QGFB 4ELTA 1KV5A 4S39A 1E4NA 1XD0A 2PCQA 2PDBA 1H1YA 1WBHA 1HMVA 2I2YA 6ALDA 5BOEA 1UWAA 4NYZA 1EJWC 1ZGDA 4BKNA 4DZ6A 4RE0A 3AYRA 4GO5X 1TPH1 3DC8A 3M5VA 4MWAB 1Y00A 4DJBA 2HQAA 3W7CA 4HGXA 3W62A 4N7TA 3DKDA 2V3GA 1UFKA 1LOLA 3GU2A 3I5CA 3T81A 4ZBCA 3AO0A 3H4XA 4CKQA 3N01A 2VJVA 3VI2A 3TZFA 2KVIA 3S5ZA 1AJZA 3OZYA 1LROA 2GL5A 1JNDA 3S8HA 1V6WA 5T8GA 4ONVA 2V5HG 3TP4A 1G1YA 1P7TA 5FD0A 3GYCA 2YL5A 4EBCA 1T9YA 5FEPA 4DZDA 3WLQA 1YJWS 1XRVA 4FPIA 4YPJA 1KM4A 4IMFA 2ZZ7A 3OIXA 5I06A 5HNTA 4I7WA 4F3OA 2VQFF 2ZRXA 2QR6A 2A6NA 2PGRA 3C2OA 1MNSA 1HJVA 4RK8A 1B3ZA 3J7YI 4C7FA 3VNLA 3NQFA 1TVRB 3LWLA 3B9OA 3UR2A 3THAA 1ZJHA 2GOUA 3RW6A 2P0IA 3E02A 1Q4NX 1BVNP 3TEGA 3GDMA 3S1TA 3H7RA 2QDEA 3NKYA 2FY8A 3H2VE 2J4GA 3HGOA 2P76A 2DHHA 3GZAA 2AJFE 4LUJA 2LECA 4UQ9A 2YL9A 3HVRA 4R5PB 1KR1A 3K5PA 4QWCA 5IQ6A 3LERA 4MK7A 2XISA 1QI3A 4MB1A 5KFYA 1XC9A 4NJGA 3W61A 3HHLC 4WGXA 3CGIA 3RU8X 2E29A 1GPFA 2ADAA 1GJWA 3LPEA 2W9MA 2PZNA 2DRDA 4HH0A 3GILA 5KFKA 1DIKA 3H8AA 2GHPA 2IMRA 2Y0FA 1RWNB 3A8JA 3DC0A 3SR7A 4PR6A 5LM7E 1RTJB 4O53A 5D4NA 3FJ4A 3ZNJ1 1KLMB 2XTKA 3I5BA 1GOOA 4A22A 5HN0A 3DMJA 4FN5A 2JNJA 4J3ZA 2NX3A 3Q8RB 2WSKA 1ZUAX 2WNZA 4CLLA 3RMEA 2Z25A 2GGJA 1XBZA 2NV1A 1GVEA 4JTSA 2QO3A 2G1HA 1UJ5A 5D15A 3MOJB 3GIJA 2VFDA 3M9YA 3RM4A 4OX9F 4YN5A 4H4IA 3J7ZT 1XP3A 3LTPA 4FA3A 4B2DD 2NSOA 2CBIA 1C0UA 5DQIA 2ZOFA 3JQMA 3VZZA 3IIXA 4UFKA 1IBKF 3T5LA 1X6UA 4OBRA 3BLLA 3WLHA 1D3HA 1V3KA 1IKXB 2QKFA 2WV8A 5KOWA 3W7KA 3TTEA 3ARYA 2RRNA 4GY0A 1OYEA 4HHPA 3P0WA 1J8VA 1Q82T 2WCAA 3Q0AA 1WTFA 3VYLA 2FTRA 2ZZTA 2NPFA 4DUWA 4AUKA 2GOKA 4PL2A 4NSBA 3L0NA 4ZSUA 4UTUA 1RACB 1A5OC 1KKHA 1DHKA 4UOHA 1F8IA 1WDRA 1JVNA 2V50A 2KXHA 1FWPA 2J9DA 4OX8A 1A4MA 3IRXA 4ID5A 5E9AA 3UD5A 1A0DA 5AT1B 2UY5A 5ETSA 4NEYA 2VQTA 4H7VA 4GISA 2XHYA 3BB5A 2OUGA 1YBQA 4DJEC 4EIVA 3IRWP 2QGHA 2VFGA 3PJ9A 4IMEA 4TXSA 2Y24A 3UCDA 4EX4A 4U3AA 1MNEA 1RSCA 5A6LA 4RUHA 2WVCA 2FVSA 3TJ8A 1HN1A 3JUGA 3G1AA 1HTIA 3EWUA 3TN3A 3OFHA 1DHPA 1J93A 2AOSA 1BGAA 3DYMA 5LNRA 4W93A 2IDEA 1LF1A 4DUVA 1HO1A 2XWEA 4OZ1A 3G8QA 1U02A 1MI3A 2WB4A 3Q67A 3QGVA 3GVVA 1N5VA 1EJUC 1Q65A 2AQVA 5T7LA 2R1LA 1F74A 4GNJA 4AZGA 3UY7A 4C8LA 2MSSA 4U5KA 1EIBA 3TTSA 2O67A 3A13A 3WJYA 1JLBB 1T40A 1V08A 1YRRA 2MQOA 4OYOA 1JZ2A 3S6TA 3G8TA 1AQHA 4GFIA 3CIZA 2QL5B 3STGA 1HGWA 1TJRA 1N6QB 1RAKA 1MMLA 2J78A 1MU2B 1IXOA 1ZBWA 2EKNA 3G1SA 4DBSA 2AYMA 2VD8A 3DHFA 3EDRB 2RUSA 4R7OA 5A8QA 4QM1A 4DEZA 3RBZA 1ZCCA 1FKXA 3PHAA 4XZ9A 1H41A 3SIMA 5BYRA 3QT7A 2WB1D 3O63A 5HBMB 4QIEA 1RU2A 1FHTA 3ZYZA 2GJXB 3H7UA 5E3PA 6FD1A 2NQ5A 4QQ3A 3C2RA 4Q22A 1RQ0A 4W4QA 1RKJA 5FSDC 2Z1BA 4WXOA 5BXSA 4H4MA 1MW3A 4URSA 5GMDA 3HZ3A 4Q45A 3FFSA 1JAEA 1IWPA 5DEZA 1S1TB 3W3SA 2VFRA 1YGYA 3BQ6A 2O92A 4N9DA 3G8SA 4A2RA 1U7LA 2KL8A 1N5TA 3O7UA 1WXZA 4KFPA 2J62A 4D8ZA 4IIEA 3MAAA 3SRFA 3TYZA 2E5LJ 2OZ3A 4HU3A 2B7BB 2DT1A 1VBUA 4CUCA 1R0CB 5IV4A 1QXLA 4Z08A 1SFLA 2BVTA 1M5OC 5BCAA 1AUDA 4BF7A 4HNCA 3V4MA 2CG4A 2YNIB 4XIMA 4H1ZA 2XYLA 3CNYA 3GRIA 5AHNA 4I1TA 4MY9A 4DV4F 4C6EA 4DX8H 2NLIA 2OWWA 4C0BA 2ZH9A 1S2CA 1NELA 3M6DA 2APOA 4WYWA 3FVMA 1BYCA 3BBCA 3HG3A 1V5IB 3ILIA 2ZXBA 4DR6J 3T07A 2ZH2A 2DNRA 4DR3F 1RY0A 2B7PA 1M90T 2B6AA 4JI0F 3Q23A 1HBUA 2R7SA 4OZLA 4HTIA 3CSKA 1F07A 2F7VA 3WEOA 5J2MB 1N34J 3GBEA 2XLIA 4UT4A 4BK9A 3EGJA 3CZEA 1P0KA 2HHPA 4GABA 2YBUA 3XINA 1XIFA 3UD6A 3QGHA 4GKTA 3ZJ8A 2YDQA 4V1Ak 4DPYA 3ZLHA 1OCBA 4K4SA 2FUG9 1U1LA 1SQEA 4OZ3A 3EGZA 1RPXA 3GWCA 2OSWA 1TYGA 2CPHA 1JRBA 3KL0A 4DJEA 2A3LA 5SUHA 3MP3A 1ZALA 2WVDA 2WVEA 5G4DA 2G5WA 2ONEA 5HQLA 3RRHA 4URIA 5GNXA 2OPSA 3SRKA 3OU8A 1A5SA 1DJYA 3J81Y 1NSAA 1TU0B 3NNHA 4NILA 1YNPA 2X7WA 4UOJA 2VO5A 2RDUA 3UG3A 4IL2A 3V5RA 5D0HA 2J9CA 1KFKA 3BREA 1S48A 1TPUA 3BZJA 3VX0A 3NCRA 5BU6A 3HQ1A 3WNLA 1A53A 4X9YA 4QDMA 3COTA 4DV1J 1DBTA 3BOFA 5I79A 2C2OB 2YW4A 2FTPA 2H5JB 3EEGA 3PUOA 1JULA 3R3TA 4GO7X 4URQU 3UCZP 4U31A 4UMBA 4UTMA 1OC5A 3QJAA 3DYPA 3MKKA 4W7VA 3SADA 2GDVA 1PKLA 1DVJA 2XMUA 2NUXA 1XYZA 2DEIA 5DGBA 1ME9A 1T9XA 4DV3J 1JUKA 3DFOA 5E0FA 2RILA 3SGUA 4OYPA 3GFYA 1Z32X 3EUNA 1CX9A 2INZA 3R9LA 4W87A 3N0VA 3OP2A 2NQJA 4ZENA 5HA7A 1MNZA 1NM9A 3V7PA 4FS2A 3RPDA 5TAOA 3VCNA 3OZMA 2H3BA 2HFNA 3MB9A 1Y0EA 1N52B 2HS0A 2PSNA 3QOMA 3UESA 5G5IA 1EPXA 2DH3A 1SKWA 1UR3M 2MKKA 4MM1A 3KCJA 4OQJA 2BRLA 1REGX 2Q6BA 3LSCA 1FD2A 2RE1A 3FGCB 3M8QA 5GJPA 2ACUA 4BF9A 2G37A 4E4UA 1TRIA 4ACZB 1KXHA 3W0KA 2PO4A 2D2OA 2F38A 1HI8A 3LGHA 2V0TA 3GIYA 2IM1A 1V7YA 1UA3A 1JMTA 1S1WA 4A8OA 3N3TA 3W2JA 1H4PA 1C8VA 2XFWA 3RGTA 2OYKA 3MM6B 5ABFB 1QO2A 3THCA 1MG7A 2QUTA 3EWYA 4PYDA 1SBRA 2XYHB 4CNYA 5XIAA 2AYGA 3WBWA 3V1PA 3WNPA 3LLDA 1JCTA 3LS9A 5F7UA 3BG9A 5JU6A 5E7OB 3NR0A 4O3NA 3GB6A 3C61A 2IQDA 2OCZA 1G7VA 1FCAA 2J9XA 1KFCA 5HMSA 1Q8IA 1B3TA 1V3IA 3DLKB 3C4UA 2BOAA 2HGMA 1OX5A 1F2JA 5A2CA 4LU0A 3AZSA 3W83A 1LCOA 3BDKA 2RQMA 4A48A 3JZUA 2VX7A 1JYWA 2OYLA 2E28A 3W2WA 3KUEA 3DXSX 2D1ZA 4ZIWA 1V3ZA 3CC2S 1IEXA 2CYGA 5AC6A 1B70B 4A8FA 1UVMA 4IIHA 3TJ4A 1QNPA 2DZUA 4JYAF 1UD8A 1VRXA 4JL1A 3UDLA 4GKKF 1D3GA 1D09B 2IY5B 3BOLA 4BCEA 3ZNUA 3KLEA 5DY2A 2BKPA 1ZNNA 2DT0A 2GHVC 2WRMA 1DQ9A 5MF5A 2HWIA 3LO3A 3NM1A 1YBAA 2JRSA 1W2BR 2OELA 3JTNA 4M8LA 1UL3A 3R97A 1SCJB 3MUAA 1OG6A 1S2UA 2XM1A 3QFWA 2WSFC 5A8MA 4GC6A 2Q66A 2NX1A 1RZMA 3DXIA 2WPBA 2V5DA 5AHFA 1HKMA 2W2NP 2PN6A 5DLFA 3D46A 3MP5A 1J5TA 1EX5A 4KW2A 3OHAA 3GCWP 3OYZA 3CS2A 1TTHB 4JFSA 2GQAA 2VGFA 3D1OA 1E72M 3K59A 2BJ1A 3EMZA 1EHAA 3QSIA 1Y0HA 3VHQA 1BUXA 2CQGA 1CW2A 3LMZA 2CQHA 3CJPA 1P1MA 5JBEA 1AROP 4AD4A 2DGVA 3QGPA 1S39A 1UASA 4XISA 3AD8C 1UP1A 3QJJA 1OFDA 1IKWA 4CI0B 1ONWA 1OMSA 3W5YA 2FPVA 3K89A 3LDVA 4ZS6A 3GS6A 3RAQA 4NXSA 3STEA 4HKQA 1BPLB 2QJ3A 2PLMA 1UWIA 2OKQA 3G3MA 3NOEA 5C9XA 1D8YA 3CUXA 4F36A 4YS2A 3SQMA 2CQDA 5CCMA 2EBEA 3A24A 2QUNA 1U2RA 4V2XA 1LL6A 5E41A 3N04A 3OVSA 2RFGA 2MMYA 5D4OA 2NWRA 2AKZA 2IM0A 2VFIA 4ZA0A 4C7GA 2Y6ZA 2C2DA 4RE4A 3CDAA 3RRKA 4JQ2A 3VC5A 4PMDA 4C7QA 1FWCC 3BSNA 1IGSA 1RT3B 3GIQA 3V3WA 3BLPX 1EKSA 3ZZ0A 3W73A 3KJNB 5KFVA 2YYUA 3AOCA 1FWNA 5A8RA 4FLRA 1HNWJ 3WQ4A 3O6AA 3P4UB 5HR7A 3TR9A 6REQA 4NPOA 1JD7A 1ICQA 1ZBKA 2QCDA 5AZ1A 4C6CA 3GJTB 1L3SA 2X30A 1FP8A 3NSXA 2OLWA 3QTPA 4ZQMA 3QV8A 2MLYA 1OO0B 3ONCA 2YH0A 1QBAA 4QITA 2X7IA 1H2UX 1KFDA 1ISVA 1V6TA 3W72A 4RNNA 4LC8A 4XTTA 3VIMA 1YYAA 4J40A 4PXBA 3UW6A 2P9EA 3A9BA 4S3CA 3OFGA 3K8VA 4RBUA 5KG1A 2AAMA 5A76A 2NQLA 1XINA 2RD5C 1C8QA 4FXSA 2KO1A 2MKSA 4NLSA 1LRQA 4EUVA 1FDDA 2PRHA 4IFKB 2DCLA 1R6YA 3WLTA 1XI3A 3L2IA 1GVRA 3AWNA 3V36A 2CVEA 1C8YA 1F9FA 1CPUA 4C0OC 2DVIA 4XPEA 2BY1A 3E3XA 1RWOB 3SDEB 2OG9A 2MZTA 1FWHC 2DXDA 4GQ0A 3SCLE 1T96A 3A4TA 4HZ8A 1QD1A 4EPDC 1NY1A 2P1FA 3IR7B 3MXHP 1S9GB 4UTGA 3SURA 2YKOA 3TQEA 3EVWA 4DJDA 3KG1A 2I8EA 4A8XA 1VFJA 2MYFA 4WP3A 5CA5A 1ONXA 4IG0B 2VI0A 1LW0B 2OPQB 1FXPA 2AP6A 4L75A 4F4ZA 4GVBB 3U3HA 5GAGI 2HQCA 2JVRA 1WC3A 3G1FA 3E49A 1J11A 3AHXA 2HTMA 3KOFA 3CW2C 1NU5A 2K06A 1FVQA 5LHFA 1W32A 2BRKA 2YWHA 1R5YA 5L9NA 2ZX9A 4WD0A 1FNMA 3B0YA 4KRWA 1AT1B 1DIEA 3B8DA 3K4DA 3BGRB 1Q7QA 3BPSP 1HHSA 1TL4A 3M64A 2WNNA 4WIIA 5A0YB 3CM4A 4D3HA 2GDQA 3CCES 4C6KA 3WQ5A 2HFOA 3T6JA 4S3AA 3M2VA 1C7TA 2XB2D 1X9SA 4G1IA 2A1YA 3UXKA 4D6GA 1NDZA 1ZBVA 3WUBA 2IJNA 4PG5A 4WLCA 2DR8A 4QISA 1XHGA 5CPLA 4Q2LA 3L21A 2CJBA 2AT1B 3U7BA 2WM1A 3ABOA 1FRBA 1XLDA 2UUTA 1MRAA 2Y7FA 2DO0A 5LSOA 1PPIA 1XR5A 2WSYA 4G2DA 2PP0A 2FHJD 1F73A 2G3MA 2RHSB 1AFSA 1X6LA 2B31A 2WNWA 5CZJA 3DXBA 1NH6A 1XMQJ 2VFFA 3LXBA 3W07A 2BBEA 5ETLA 2D41A 1TL7A 1PDZA 3HT3A 1E3XA 5DBTA 1OFPA 4GCAA 3I3DA 3ETOA 3MUVP 4DO6A 4P7RA 3GDBA 1O60A 2DIKA 3WK0A 2DB1A 1KBJA 3OVGA 4AVFA 3TZZA 2V4JA 1WKFA 4DYKA 1EP4B 1U1JA 4DFKA 4CNZA 4DR1J 1REQB 4O54A 2CHNA 4I9MA 5KZ6A 1OF6A 4JIQA 2V2ZA 3PAOA 2IJRA 2VFHA 1TRDA 4X63A 3O2IA 1VS1A 4JI3J 5J5RA 2HLTA 4IR9A 4J9LA 1YDVA 3WMSA 3CV1A 2Y88A 3R5DA 4KYZA 3M9MB 2OU4A 1ZJBA 4USMA 1B2YA 5DFAA 1Z44A 2QJGA 4HTYA 1RHQB 2MDAA 2WVVA 3RJYA 3MEEB 2XMAA 2RQCA 1EQMA 1YTDA 3MM8A 5I3PA 3KDOA 3N4FA 1VLOA 2GVZB 3A4AA 1P48A 2LVWA 1T0OA 2DNPA 4LSBA 4ZCIA 1Q81T 1QAJA 4D2JA 3OZOA 4RXFA 3VK5A 4EP8C 2R9RA 4JNYA 1UC5A 3WQ6A 3PFOA 2Y63A 3WDJA 1NK7A 1B0TA 5CZKA 1ESWA 1NDYA 1V93A 4CH7A 1WB0A 4J9VA 4QNWA 1K7EA 1YJ7A 3TAQA 4QAWA 5D9PA 3CGTA 3G82A 3BVJA 1TE1A 4K37A 2QLJB 2W61A 4D71A 2B5JB 3ZT6A 3T2OA 3PNIA 4XPCA 2YOCA 1E5JA 1MSSA 3EXSA 1S0MA 2CHOA 1CJVB 4MKSA 3PZGA 3M9NB 1IBLJ 2FVMA 4KH1B 3U2CA 2ZADA 1OT2A 3GXIA 3QQ1A 1PG5B 4L5ZA 1XIEA 3RCNA 5I5RA 1UA0A 1Z4UA 2VBYA 4X65J 3SMZA 4PEOA 3H90A 1OC7A 5H9FK 2XWXA 4BI6A 1UOKA 2ZH4A 4LBPA 1X1ZA 4Q2MA 1GEHA 2QVHA 2ZA1A 3W02A 1VLIA 3USZA 5HAOA 4ZITA 1EJTC 4NXKA 4B5UA 4NLPA 3I10A 3M7SA 4LF4F 4ZVOB 2WOMA 3M1ZA 2XZ7A 3PTDA 1MSWD 4CCDA 5C9UA 4MWAE 5BXRA 1BD0A 3N9KA 2IPWA 3C3LA 4JD4A 1I2QA 2GQ8A 4LVGA 1RH9A 2VUYA 3C19A 4X4UA 4LF9F 4LFYA 1MUMA 2IUZA 5BMXA 1CJKA 3CV6A 3VKAA 4DRSA 1B0PA 5EWFA 4FF4A 2YWWA 4NEZA 3SUWA 3V81A 1W2IA 1P6BA 2I9UA 4MWAC 4R3UA 2RRAA 3IFEA 4UR8A 2VCBA 2QIFA 4K4YA 4NJIA 4GG9A 3ABZA 3FJ6A 4YDXA 2R2UA 2ZUWA 2CJQA 1RT6A 1EJVC 1XN9A 2FVPA 3B03A 3U57A 1EWEA 4H9XA 4PG8A 4N4PA 3VGHA 2D2JA 4U7CA 4LRAA 3BCFA 4IUOA 4X84A 1OHLA 2PDQA 1X8CA 2B8QA 4JN8A 4UMCA 3G22A 3LHWA 2PC6A 4P52A 1E6QM 3OYXA 1DL3A 1LT8A 2B3TB 1PTAA 3CO9A 1QNOA 1F9CA 3BGAA 4W9TA 1EZ2A 1KTQA 1O95A 2B4GA 3HZGA 3E9AA 1EJSC 1G4EA 3KTXA 2IM3A 3W1LA 1E1CB 4WE1B 3GVWA 4EXQA 3M0IA 1IBCB 5A6JA 1HI1A 3AA8A 4B5TA 1TKXB 1Q66A 2I9EA 2G0JA 2OQYA 1N8IA 2WTFA 1RR2A 3T2PA 5A8NA 3WNOA 2PMWA 1EX1A 4WTYA 2KFZA 3VGVA 4GVIA 4ZZ9A 2OO6A 3QRHA 2ZUUA 1TA3A 1ZJAA 1W5NA 2Q3OA 3FQLA 1PX3A 3SCTA 2SFPA 2CUYA 3AHZA 4GIRA 3QGAC 1QUVA 3ZLFA 1KTNA 2J7HA 5K8NA 4DR2F 2ZZ5A 3TX8A 3OHMB 2G1DA 1ELOA 2B0MA 4KEVA 1VC4A 1RA7A 4K50A 4CH1A 3NYDA 1L6YA 3GV7B 1JNZB 2DGUA 5FAGA 4S1FA 1XS2A 3T0CA 4EWJA 4YTQA 3O6DA 5FJJA 3W23A 4KO0A 2FMNA 2PBGA 3BG3A 4RW6B 3HV9A 5FF7A 1SL1A 2Z4PA 1S4EA 1WCGA 2I1OA 1JDDA 1S12A 3KUHA 1N55A 5HMDA 4RE2A 1WXJA 2VT0A 4ZL1A 2PSZA 3LBMA 1V7AA 1SYTA 2VU5A 4YJ5A 3GC5A 4HACA 4DZ5A 4O4VA 1PB0A 3TYCA 2B43A 1C3FA 1TFWA 2WJZA 5CPOA 1WXYA 1HW9A 1VIZA 1JAKA 1CPZA 3ATZA 3WLSA 1ZL1A 1QWGA 2DZXA 3GIMA 1SMAA 2DRAA 2NZCA 3TAMA 2WO5A 1D9DA 3MCOA 3N6NA 5G2HA 4RWWA 4X62J 3K4AA 3R4IA 4ZEPA 3DOPA 1VQLS 2D3ZA 5DG8A 3CTTA 2XGBA 5JMNA 5C24B 1TV4A 1QHZA 3VVUA 4EZ9A 1GVSA 4CQ8A 4TKTA 4B3RJ 4L1GA 4PUEA 4FNUA 1RAAB 3I4EA 5K14B 2J0QD 4EEYA 4M0XA 3TX9A 1Y5NB 1MW7A 4N02A 3C46A 4OFCA 2C42A 3OBAA 4QFUA 2MZSA 3SQOP 4CO0A 5CXTA 1FI4A 3JVAA 3C6TB 3D68A 3KL3A 2FJAB 5CHCB 3CJ8A 4WSKA 4UUXA 1CEOA 2W2OP 3VOJA 1WC6A 2J77A 4BS2A 2WZTA 1D0EA 1PUDA 1F9HA 2C2RA 4CN4A 3TEVA 3HA1A 4IIBA 4GZ7A 1ALDA 2C2NA 3A47A 4G7FA 3VD9A 1C1BA 2VDIA 2WK4A 3IG1B 2ANUA 3ISNC 3OR2A 4WFYA 1JPKA 2Y8WA 1BLIA 1VGYA 5FDLA 1NLKL 2DR6A 2CJAA 3SAZA 1W5QA 4WF7A 1RCOB 1M01A 5ENLA 5M2RA 3FKBA 4FP1A 3PPGA 2V8VA 3SZ2A 2R7OA 3QM3A 1S1UB 1DWFM 2K7KA 1VBRA 1NPPA 1MZRA 1UVLA 4GCXA 1VQ8S 4NASA 1JFXA 3FSXA 2NT1A 2GQCA 1E9ZB 3ZT5A 4R5PA 5CJ5A 3VIGA 1HUVA 3DEQA 1ELSA 3M5YA 4J5OA 1TTPA 3HJEA 1FWRA 4OYBA 4HMEA 1O0PA 2UUCJ 4D6CA 2Z28A 3N2BA 1HW8A 1S9FA 2VBXA 4Z2HA 5HDRA 4OV1A 1SJ4P 2YWEA 3BPDA 4GH1A 4US5A 3RO6A 2V3DA 4N2YA 3M0LA 1MUCA 3GK0A 2WSQA 4HPJA 3KS5A 5CD4A 1E6VB 3B4DA 4WHBA 5I42B 1FJGJ 2R7UA 2R1NA 1EJRC 3UWWA 4PTNA 2KAUC 4O1BA 4LRDA 1WE5A 2PAJA 2O66A 3JB9k 3FVYA 3NXLA 1HO4A 2YB4A 1XMOF 1TUGB 3M0XA 1PAEX 1J01A 3PAJA 1HI0P 4CD8A 2HIYA 4DLEA 3DI6B 4O28A 3VZIA 3DKLA 1R3NA 3OTRA 5K9XA 1W3LA 3JSRA 2F84A 2VONA 4KS0A 4J3WA 5C9WA 3QVQA 4C0HA 1H0IA 1WC5A 3BKFA 3HX9A 1BQXA 3R6LB 1RAIB 4FYVB 4ZHRA 3UPBA 4ZODA 4IH5A 4NLTA 1HNYA 2R82A 2BE2A 1K70A 1UC4A 3GXDA 5H9FJ 5SZTA 3LD5A 5A6PA 2HHHJ 2MTLA 1L5UA 3C0QA 2FQIA 4HA1A 5B0BA 1AW1A 2ILYA 5EGRA 3SSZA 3KVJA 2YNGB 1QLNA 5A69A 1BQMA 2DPJA 1OYAA 1GT8A 3IPWA 3VIOA 3L2MA 1B1YA 2GLKA 3AAMA 4ZVPB 2XFRA 4QR2A 2LA4A 2WBMA 2WJDA 4CM0A 2Z27A 2PA8D 4OHVA 1DWIM 4Q4SA 1E40A 1W31A 1VC6A 1AVAA 3M0KA 1KB3A 3CIWA 3ITHB 1U2YA 4HU8A 5H8UA 3WMBA 3ZTQA 1X9WA 4N41A 1VQTA 2FB0A 3WBYA 1T99A 5HJYA 2ZOXA 1TQXA 3KLLA 1Z8AA 2V34A 5HWJA 3UR7A 1VJZA 1HNIB 3PJUA 3M8PB 4QCEA 4LS1A 2FD2A 4F7VA 3MQTA 3ET6B 4GI6A 3WF4A 1K9EA 1URRA 3DFHA 1PYOB 3NL2A 5JVHQ 3NRBA 3MAQA 1THFD 2VPWB 1WBJA 2JBMA 3I6RA 2W7OA 2KZHA 3M2UB 4DX5A 4CLFA 2JEPA 4Y9NA 4ORIA 2QV5A 3SRHA 4C1LA 2CQIA 4G1QA 1VFFA 3L7RA 3U6WA 4F67A 1DP0A 3GR1A 4YEAA 4IFRA 3LTOA 4DL0C 2WXDM 3MUTP 1MEWA 3RCYA 4QZVB 1E73M 1V3RA 4PQUA 2ISSA 5LL6d 1Q8BA 3TA9A 1VEOA 2CQCA 1JLBA 3MSYA 3Q24A 1FDNA 1X4DA 4LPCA 1G7UA 5KT6A 3KOXA 4DB7A 2JGQA 4I56A 4IMDA 3DHWC 3BDEA 1UKOA 2VX6A 5HMWA 4Z2LA 1N6QA 5E3QA 4LEFA 1DWAM 2KN4A 3W1PA 2NYIA 3SYZA 2GCFA 3FV9A 4DU8A 1NZAA 1KOOA 3DESA 3PZMA 1TWIA 5HQMA 4JNMA 3WDRA 1HQUB 2EFVA 5ETKA 4WJ8A 4BWJA 3FEMA 3M8ZA 2EKCA 3A3XA 3LTYA 3WK3A 2GJXA 1T05A 3MM5B 3V6DA 4O0NA 5IRPA 1G6BA 3KWMA 1H7PA 1W9DM 3ADAC 4KIAA 3WF1A 5C25B 4AY7A 3S2MA 4QIGA 2E0PA 4KV8B 4ZN1A 3TUPA 2HBVA 2WONA 3AS1A 5IC4B 1CT5A 3WEZA 3KW3A 4LFCJ 3UPFA 3KHHA 2MJNA 2Y2WA 2ZRWA 5CKSA 4DWSD 1X4EA 2IA0A 4JV0A 3MHGA 2XZDB 3AJDA 1DXEA 2GPTA 1K3UA 4UQCA 5CSRA 3Q8YA 3DU5A 2Z6IA 2L9WA 4ZN3A 2R2TA 3S5SA 3W70A 3N2OA 2Y1IA 5D4YA 2XZTB 3T05A 4LALA 4F02A 4QR1A 4O17A 4RX6A 4JTTA 1WQ5A 5F1UA 5D2WA 3MMAA 1R87A 4GXWA 4ML4A 1Y5WA 4EXAA 1KFJA 2VVSA 1CC7A 3PCOB 1S1XB 5I2UA 4ZQNA 3SCNA 3OQ2A 3UN3A 3C6UB 1V4YA 2PDNA 1YJRA 4F25A 4K7QA 3D2WA 3GDRA 3PSVA 4TX9A 2IRXA 1OFOA 4ZVJA 1GJPA 3NL0A 4RDWA 1UH3A 4B3TJ 1KCZA 3S2JA 3GFZA 2QEXS 1AG1O 1I94F 4CLSA 4XDDA 2ZCGA 5M3WA 3ZVHA 1OX4B 4ERIA 4O8RA 5DMNA 2HNZB 3PDNA 4LUSA 3KXQA 5CC5A 5IT0A 1GJUA 4QNEA 1RQEA 1SH2A 2RU9A 3U7JA 2HRYA 1WA3A 2VUNA 3PBYA 4UR9A 4PXDA 4Q4OA 5HPOA 5ABGA 1HFEL 2XVGA 1GXUA 1LQAA 3NEVA 3TAPA 2WJEA 3LP2A 4ZVHA 1P8GA 1VPXA 3UFYA 1W3HA 2VCAA 3WLKX 1ZP4A 3LF0A 3VPLA 1L3KA 4JCMA 3QR0A 5BROA 1C4CA 2P8CA 2DHSA 3FA3A 2N3LA 3ABXA 3BXWA 1RT7B 3VQSA 2FHBA 4C6IA 1W1ZA 1F61A 4QTGA 1G5AA 5D77A 1U22A 3Q8VA 4OFZA 4CO5A 2AJ4A 2PMZD 2B81A 4U5IA 3SCSA 3CV2A 4YUDA 3QKZA 1U33A 4MYXA 4RX0A 4AD5A 5BRQA 5EX3A 3WSUA 4TTGA 2RMLA 2ZVRA 3W1YC 2Q6ZA 4YTTA 4ZPWR 1WDQA 2WC3A 1MW2A 1VEPA 3TWZA 5FF2A 3KMQA 4NJJA 4UQBA 3OHBA 2GSJA 4DO7A 5FIIA 3BPWA 1FKOB 3CU2A 1TPVA 2JKAA 3VM5A 2LEPA 3HMJG 3ALFA 1W9PA 2AMXA 1C93A 4I8YA 2OEMA 4HN8A 5I3UB 4WFBQ 1JGMA 1TV5A 2C3PA 5IOLA 1ZAHA 2HHSA 2BW2A 4DQIA 4B3SF 1LW2A 4M5HA 2ZZ6A 5KFXA 1DEDA 4L6V3 4RW5A 3J80U 1A5AA 1B3VA 5G1YA 2Y62A 1R7IA 4QU6A 3T6CA 2H5EA 8CGTA 4HB7A 4UTIA 5A95A 1VBKA 5HPCA 1I6JA 3GAYA 4DJFC 2WSRA 1IJEB 4GKLA 2MKCA 2F6UA 4LY8A 3WD1A 2YKNB 4OIFA 2V0NA 3A22A 3GBDA 1B3XA 3FEZA 4WKFA 3PJXA 5EY5A 3FGCA 3KL5A 1H2TZ 2Z1XA 4Y6IA 2PRLA 2H4YB 2YPZA 3CB3A 3JSBA 1VQMS 4CQBA 5GQBA 1UMJA 5CZSA 3OBIA 4RW8B 3I7QA 5J2PB 1VQNS 1XX1A 3BSMA 2CPZA 2W9BA 3P7YA 4IPLA 3MM6A 1EEPA 1SFSA 3MC5A 5ABFA 1H72C 3MWBA 2OOFA 3MV11 1XNRJ 2FB2A 4UZBA 1XKJA 3FZBA 2GJIA 1FX4A 3TFXA 2BODX 3D0CA 4IXHA 2YKKA 2UP1A 1U1HA 1WC4A 3AIEA 4TU7A 1UAWA 3Q4DA 2CZVC 4LFAF 4Q8NA 3Q65A 3PRVA 1UB3A 1LWIA 3TIMA 3S6EA 4HI1A 2I0XA 1KM5A 3UWVA 4ZLLA 3VIIA 2XO7A 4LVOP 2E6YA 1CECA 1L8PA 4L1WA 3WQWA 3DLKA 1KXQA 4K68A 5E0CA 4AHOA 2HBQB 1E4IA 1P6CA 4JV5J 2G4BA 5KG4A 3ZJ7A 5CEWA 3I9ZA 2AQWA 5KG5A 3DZ1A 2GAHC 4RJVA 3F4NA 3NAHA 4MIAA 5G1MA 1UPMB 5LIKX 1FTCA 3EX7B 4LYKA 1TWWA 1TZZA 4HCLA 4DBUA 1W54A 5AECA 4YB5A 3BSGA 4JI8J 1SR9A 1VIXA 3WLJA 4MJKA 4AQYF 4WR3A 1PJ7A 1BTCA 1Q63A 1QNSA 4MMWA 3VCRA 5CPNA 1K47A 3KG0A 3NGRA 4KBIA 4JI2F 2ZQ0A 3TSBA 5DT5A 1E0WA 1OFEA 3B8SA 2CLPA 3N19B 1WEYA 2H6RA 2UY2A 3WNKA 4XAGA 4YFUA 1GK8A 2PMQA 4LT9A 1UJPA 4QYZJ 2E3ZA 1F76A 4NAEB 4NZCA 4DY1A 4OL8A 2QZRA 1R8CA 3T9PA 4GE8A 3HG4A 2E1PA 3QR3A 2RJHA 5D4LA 5REQA 4UQAA 5B7YA 1OPZA 5D2YA 2XFYA 5K9DA 4DXKA 3Q45A 5A8GA 3MUCA 2ROGA 2J9YA 2QW5A 3Q8SB 4EOUA 4PUOB 3I32A 4FMVA 4ECXA 5LSMA 3QC3A 3HGJA 4LBHA 2MHNA 2EPIA 5GADI 1IEWA 1E55A 2AWZA 2FGBA 4R34A 5K9CA 3E12A 1BF6A 2R9LA 2PE8A 1EP1A 1F6PA 2KM8B 5BMWA 1TKDA 4CQAA 1S0OA 3IJ6A 3GFXA 3PIOQ 3H2LA 3WUFA 1QNRA 4XDCA 3OZPA 5CQ1A 4DJFA 2YKMB 4FNTA 4ZFMA 4TNOA 5A94A 3N3MA 4J4KA 4AZBA 1XLFA 3V16A 4G65A 2J7CA 2W4CA 2EGZA 4UY85 4CNTA 2JVOA 2IMOA 2KT2A 1J5EF 4BI5A 2VCCA 2EPNA 3IJQA 3O0KA 1JLAB 1OSCA 4D9PA 1R85A 2O4QA 1VDHA 1RT3A 5I02A 1D7FA 3B0UX 5E0OA 2VX4A 3PY2A 4XUGA 1U1MA 3MD1A 2G2YA 2VOPA 3KUMA 2VM8A 3H2NA 4IP5A 4DG1B 2ZX7A 4JFTA 3D9BA 5KFHA 4DWSB 1Z2LA 3HD2A 4OE7A 2WSCC 4CD5A 1Q7MA 2YX7A 3XISA 3C0SA 3SQGB 2VRKA 3DHUA 4JB8B 4NLVA 3B9NA 4NU7A 3WF0A 2LQJA 2M7SA 3HFVA 4CT9A 4HSHA 3LLXA 1XFBA 1Z48A 1Q5VA 3UQNA 2C2MB 4JS3A 5E93A 4OHYA 4I0WA 2RQKA 3ITLA 4QQBA 3FNDA 4CVUA 3HOJA 3KJVB 4FDFA 4EF8A 1UMLA 3PR4A 2AGTA 5KT5A 3QZAA 3PEHA 3MHYA 4TX6A 3SJNA 3NNAA 1V5XA 2HWGA 4E38A 4OV4A 2AYEA 1US2A 4IFKA 4BY3A 2YXXA 4CVWA 1XH0A 2W79A 1VB9A 2JFKA 3TJXA 2FQQB 5K7JA 3W9ZA 1PX8A 5F9NA 3W2KA 1RHJB 2VRQA 3L4YA 1RJQA 2YY3A 4MJ2A 1TKZB 4Y2IA 5AJ3J 4MJMA 1GH8A 4MJZA 1DIDA 5I3JA 5TBOA 1QUPA 5E70A 1F0XA 3Q58A 1MWQA 5IV3A 5F8MA 2Y89A 4AC1X 4GIAA 2P88A 2PDYA 3OVQA 2W7PA 2AYBA 5F2IA 3DBNA 5G4WA 5BRBA 3DECA 2MY8A 3WX4A 4IG0A 2VGIA 2OPQA 1SSGA 4DMZA 4ILLA 5IZHA 3I96A 1XQIA 3CBWA 3IIOA 2QJMA 2XI3A 3R6GB 5I3QA 2ZBTA 3VAJA 3VZHA 3X1LB 2A10A 3LA0A 3WK1A 2J74A 1CBKA 3LGMA 3AOAA 2RNEA 3SN0A 1NAQA 1CENA 3BGRA 1I2RA 4ENLA 4DQWA 3G18A 2MKJA 5KFDA 2BMBA 3PULA 4PWWA 4CLZA 1BQGA 2WYSA 3UN5A 1SJAA 1U8SA 4USWA 3THQA 5BXTA 4F0KA 3Q8QB 4MB3A 1F5ZA 3CUFA 3E5BA 5E5NA 5A2BA 3WFLA 4F0HA 2MZQA 4UTWA 1XNQJ 3BANA 3UERA 1JLGA 2P0OA 2XHCA 2XMVA 1ADOA 3AIQA 4Q33A 2EG6A 4FIRA 2BZ2A 3LGEA 4JKKA 1RWVB 3SCVA 3T0TA 3UVIA 2PE4A 1SZFA 1F7BA 4MLRA 4EMDA 2A7PA 4EBEA 4Q4KA 1QAPA 2VB6A 5CH7B 4B9SA 2AEMA 1IXNA 2H9AB 2IFXA 2YGYA 4QDWA 5EL1A 1KVKA 1R0MA 2XSBA 5F8GA 5K20B 1JPDX 1MW1A 4WQ6A 3UZZA 1F3VA 3OV7A 4NAFB 2PWEA 2WK2A 3WF2A 4OU1A 3PWIA 1YRUA 1XH2A 4I7FA 2DVTA 2GVDA 1REQA 3VMPA 4ZQCA 3WL0A 1T03B 2PURA 4MOZA 1I6NA 3O9NA 4L9YA 2DGOA 4K8GA 4Z1YA 1V9OA 4YOEA 1R9XA 4QE1A 2R7WA 3WN6A 4LF5J 5D8HB 3H7VA 4AIEA 3M0MA 4J27A 3URQA 2F8EX 2RS8A 2E4TA 5FJTA 4YDDB 2RDWA 2LLZA 3P45B 3R7MA 4LUIA 3CJRA 3MEEA 5A8WB 3SCOA 1LOUA 1URNA 1KM2A 1F9EB 3NOGA 1Y7VA 1VJSA 3GQCA 3BARA 2I57A 2GJNA 2ATCB 3ZSTA 4JL2A 3TE9A 2FDMA 3GXPA 3AAWB 1F3TA 2RH9A 2B56A 2OO4A 4JHOA 1NHKL 2X09A 3CHEA 3L4UA 5I3HA 3R13A 1K6AA 4HMNA 1R0BG 4AXIA 2FLIA 2A3EA 3IWXA 1M03A 3H5SA 1RP5A 4J9UE 3FJLA 1RHCA 2C16A 4QSHA 5FKYA 4DL6A 2VOOA 2B5JA 1R8BA 4OKDA 1Z9AA 3S0CA 2VV5A 1OQ6A 2VL1A 5CYMB 3CWOX 3H12A 3VNDA 1E6RA 1CJVA 3CWNA 4KESA 4X66J 3WIUA 2ZDRA 2XYGB 3I4HX 4C9DA 3APTA 1VHIA 2X0HA 3ZTSA 4B17A 4CEXC 3OQEA 4S3GA 5BYWA 1KNZA 3KJQB 1FRMA 5C7HA 3W7QA 3MP4A 2HVZA 3SCRA 2V68A 4UTFA 3KNGA 4DNMA 3BMVA 5HROA 3FVDA 3W8PA 2XU2A 4F4KA 1KO0A 3AB2B 4GK8A 3TUJC 3UVJB 5L6UA 1JLQA 4FXJA 2CZDA 1WZKA 2LQ5A 1LLWA 3R5JB 1FF2A 4A35A 3CIMA 4ED5A 4UOQA 2BTMA 4L9XA 3I4KA 4DR7J 3EGVA 4WYLA 3AIWA 3MZNA 1RHKB 2KYZA 2ZNYA 4LAUA 3J7YU 4AL6A 1SKRA 2QCLA 2WBGA 1NB7A 2G3FA 1FHDA 5JMUA 1I0DA 4XZHA 3JSYA 4QWAA 3RITA 1IKVB 3EPNA 3FMWA 4ED4A 3U4FA 1JI2A 3MSRA 3PBGA 4JTLA 1UZDA 4QCFA 3RPTA 3W5ZA 1VF8A 2CNOB 5CC3A 5F8HA 4USTA 3LNPA 3C6CA 3P62A 1VFHA 2FPHX 2RDIA 1M53A 1JXJA 2DNKA 3LGNA 2F2KA 4ES1A 3T78A 2D69A 1E0TA 3MHUA 5ABHA 1OWXA 2HZGA 3D0GE 3UP8A 2N7CA 2VP8A 1RT1B 1S1VB 4AZHA 4AD0A 3GC2A 2XGQA 2ROEA 3C16A 3T1YJ 3GY1A 1FWAC 4DN9A 1JI1A 4HYRA 2XNRA 1UEKA 3EWBX 1VFOA 4LFBJ 2WVSA 1TZ7A 1YTKA 4WJXA 3NPUA 1E1CA 1B7YB 4WE1A 5BRPA 5FI8A 2PCEA 3BYPA 2ZKMX 1TKXA 2VELA 3HO8A 3ZZOA 2BJDA 3H54A 3H59A 3OHIA 1JLCB 2XY7A 4N8OA 5LNUA 2JFEX 1UKQA 1HR0J 2XGZA 1NAL1 1UW9A 5A8OA 1BTMA 3NZPA 4R7WA 4LT6A 1HNVB 4XAFA 2HK3A 3JAMU 2AGKA 3W53A 3WQPA 1MN7A 3H5YA 1CLFA 3LCGA 3EWDA 2W1BA 4M63A 3MVIA 1WYIA 3LPPA 3NQCA 3TZXA 4LNCA 4HL9A 3NQ2A 7PTDA 1J5OB 2GJ2A 2GQ3A 2KG1A 3QJPA 1YTYA 3T3FA 1XEZA 2RJGA 4CLYA 5BXIA 1PO6A 1I2PA 4RW6A 1OY0A 3S5NA 1EGVA 1NFGA 3JTOA 4TVDA 3O16A 4MPQA 2X51A 4USUA 2QPUA 2WOQA 3NDZA 3OBKA 4Q4PA 3LAKA 1HNZJ 2HMIB 2ZVSA 2VZVA 4O0IA 3FC9A 5HMYA 1O6XA 1V5VA 1BXCA 4E6MA 2CKSA 3O3LA 3BDPA 2FLOA 2BJEA 4I9JA 2DH7A 2Y4SA 4FS9A 3NY0A 4WDUA 4H7CA 1U2FA 3RILA 4H6KA 4F2UA 1VFMA 1NK9A 4A05A 4U9RA 1DV7A 2Y5EA 1W2PA 1V3MA 1VHCA 4PR4A 3RGIA 4DUYJ 2NUYA 4XIUA 4PMOA 4H3DA 1P5BA 2DH9A 2M9KA 2CLHA 3G87A 4WF9Q 1K0VA 3LV6A 4GZIA 1X8FA 4KY3A 4Y65A 4D6JA 1T6MA 3ABSA 3V6HA 3FEYB 1R0AA 1TL5A 2IM2A 3BGJA 3TC3A 1RUSA 2EAWA 2ALRA 2QA2A 1Q1KA 1WP6A 1E43A 2D74B 3HFYA 4UZUA 3UCUP 1PAMA 3CV7A 5FF3A 2KT3A 4NZ3A 1KLYA 3UWUA 3TRGA 2DNHA 3A4JA 2NVDA 1F05A 4KCUA 3TFCA 5K14A 3GV5B 3APGA 4P6QA 1HMVB 5ECVA 3UGVA 4DR6F 3SIPB 2CNLB 4RNMA 2DW7A 3LRKA 3TR5A 4IDKB 4F79A 3Q8UA 3P6YC 1FWGC 1Q6EA 4DPTA 2D0GA 4M19A 7A3HA 1PYFA 4XAZA 1L3VA 3MR7A 2RDTA 2PGWA 1KLZA 3CZJA 3L0GA 4L72B 1QT1A 2C19A 3EB3A 2WMHA 3JRKA 4LOCA 1WNOA 4M1RA 2YKAA 2DZTA 5CQGA 1FWEC 1H5VA 1P7TB 1QHOA 3AOBA 3MM7A 3MVTA 2Y1RI 1NKEA 3O6QA 3DERA 4EXBA 1FKA