4TU7A

Structure of u2af65 d231v variant with bru5 dna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHVYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tu7A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tu7A02
2E44A 2DNPA 2WBRA 1VBZA 5DDQC 2DNZA 1VQLS 1H2VZ 2DGQA 2MKHA 1WELA 2M88A 1HL6A 4LJMA 4CQ1A 4QU6A 1N88A 1X4AA 3ZZYA 1QM9A 2HVZA 2A3JA 2MKKA 2BZ2A 5HO4A 3SXLA 3SMZA 3Q2TC 3THPA 1XN9A 3Q2SC 2DGXA 2HZCA 2AD9A 2LYVA 2V94A 1U1KA 3NNCA 2DNRA 1A7GE 3CC7S 3NNHA 2MJUA 1NU4A 2GO9A 2KG0A 4OZ1A 2CQBA 1WHXA 3MOJB 1K9MT 1M5VC 2FC8A 4QPTA 2LECA 3VAJA 5IQQA 2ADBA 2E5IA 1Q82T 3DXBA 3MDFA 1YWXA 2M52A 5LJ5Y 2MQLA 2RRBA 1OO0B 1VQ8S 5LJ3Y 1D9AA 1YJ9S 1F9FA 1WHVA 4CIOA 1WTBA 2CQIA 3PIOQ 1P27B 2DNQA 1IQTA 4Z2XA 1RKJA 1NJIT 2HGMA 3VAGA 1VC5A 2D9OA 1WF1A 1U1PA 3CULA 2D9PA 1YITS 4WFAQ 1QVFR 1FJ7A 2DNMA 2F9JA 2X1GA 2YWKA 4YOEA 1WG5A 1M5KC 3VAMA 1NO8A 2DNGA 3CXCR 2X1FA 2DGOA 2K3KA 2MGZB 2DH9A 1JJHA 1UAWA 2VONA 4W92B 3CD6S 2KM8C 2MPUA 3S6EA 2CQ2A 1CVJA 2MGZA 4V19X 2DIVA 2CQ3A 3DLLQ 2RQCA 2I38A 2I2YA 3ULHA 3R1LA 2MYFA 1Q7YT 2M70A 3G96A 3B4MA 1DHMA 2VOPA 3CCLS 2QEXS 3B4DA 3JB9k 3H2UB 2MQQA 2MZRA 5D78A 1N52B 3BO3A 2DH8A 2RUGA 1X4DA 1DZ5A 2U2FA 2XNQA 4A8XA 1M90T 1VQ6S 2L41A 2MKSA 3I55S 1VQ9S 3P49B 2RVJA 1PO6A 5H1SV 1SJFA 4QU7A 2M0GB 2YKAA 2QFJA 1VQ7S 4BS2A 3SDEB 1G2EA 3J7ZT 2JWNA 3TP2A 3G9CA 2EK6A 2RS2A 5DM6Q 1VQKS 2L9WA 3CPWR 3SDEA 1N54B 3CCQS 2DISA 1WI6A 2OJ3A 5EN1A 5CXTA 2DNNA 3J7YU 2YH0A 2DO4A 3HI9A 5JVHQ 5BJRA 2RT3A 2E5HA 2MQNA 1OPIA 3HHNB 1WEZA 2KI2A 1N8RT 1FT8A 2MXYA 1KQSR 2KXNB 3EGZA 3UCGA 5GAEU 2SXLA 1ZZFA 2KXHA 1U1NA 1FNXH 2CPIA 2ZJRQ 1X4GA 5MLCV 4IO9Q 5JVGQ 1WF2A 4ED5A 2JVOA 3US5A 1M5OC 2J8AA 2MZSA 2LCWA 1WF0A 2F9DA 2KVIA 4C0OC 3U1LA 2MHNA 2XSFA 1VC6A 1FJCA 2Q79A 1FHTA 2LKZA 2HGNA 5GVQA 1S72S 1R8HA 3FEYB 1JMTA 2MZQA 3MI7X 2RNEA 5DM7Q 4RU2A 1VBYA 4P6QA 2YTCA 3OW2R 3G8SA 4TU8A 1RK8A 2RRAA 2DITA 5DDPC 2U1AA 2N3OA 2DB1A 3VAHA 2LQ5A 2CQPA 2DO0A 2ZJQQ 1B7FA 1FXLA 1YJNS 2X1AA 2MSSA 4F25A 1H2TZ 2O3DA 1YJWS 4C4WA 1ZH5A 4PR6A 4CH1A 1D8ZA 2G1DA 3NS6A 1X5SA 1DBDA 5IFMA 2CPEA 2XB2D 2M8HA 2MZJA 1WHYA 3UWTA 1K8AT 3MD3A 2JVRA 5LXRA 1WEYA 2JRSA 3D2WA 2VOOA 3IWNC 2OSQA 5HL7Q 2DGWA 2LXIA 3LQVA 2CPJA 3G4SS 1WHWA 2QA4S 3MUMP 4C7QA 3NNAA 1X4HA 5DDRC 2M8DB 3PIPQ 2DNKA 2HYIB 4WF9Q 3MXHP 3CF5Q 1WWHA 4U67Q 2KH9A 3P3DA 2ERRA 2DNOA 2M7SA 3G6ES 1X4CA 2GHPA 2D3OR 2CPDA 4OZ0A 3K0JA 2KRRA 2M9KA 2KHCA 3S7RA 2LEBA 1U1QA 2CPZA 1YHQS 5IM0B 2BOPA 2MY8A 2DGSA 2KRBA 1H2UX 3UCZP 4TLQA 3UD4P 5D77A 1JJ2R 1U1LA 3S8SA 4WKRA 5GAGU 2CQCA 4F02A 2M2BA 1U6FA 3UCUP 3THTA 3H2VE 2K8GA 1HD1A 2MY7A 3CMES 1KOOA 2RS8A 2CQHA 3CCVS 1FJEB 2NLWA 3CCSS 3CCUS 2MKCA 2M4MA 3VAIA 2MQMA 1U1OA 2J0SD 3NS5A 1U1MA 3RW7A 1URNA 2VODA 2NZ4A 2XS2A 5CA5A 5LSOA 2YH1A 3S01A 1X5TA 4CH0S 1UP1A 4Y00A 3TO8A 5GADU 1UFWA 2B0GA 5ITHA 3TYTA 3G71S 2J76E 2MJNA 2G4BA 1YTYA 3CC4S 1A9NB 4IOAQ 2CQGA 2N7CA 3CCES 2FHOB 2MKIA 3MUTP 1KD1T 1K73T 3NMRA 1ZZNA 4M5DB 4YB1P 2DIUA 4FXVA 5DETA 2MZ1A 1QVGR 3L3CA 3BO4A 1SXLA 1PGZA 1OIAA 2DK2A 2KU7A 2DGTA 1SJ3P 3P6YC 1X5OA 3R27A 1P1TA 5LXYA 2CPFA 2CQ1A 3MUVP 2CQDA 2XS5A 2ZJPQ 2RU3A 4IOCQ 3IRWP 1Q86T 4LIRA 4J5OA 1HD0A 1VBXA 2LA4A 3VF0B 4UQTA 3BEGB 4F26A 2DH7A 2MMYA 2DNLA 3CCMS 2AYEA 1SJ4P 2MB0B 2L08A 1KC8T 3BO2A 3EX7B 1X4EA 3N9UC 1VQ5S 1FO1A 4WFNQ 1U2FA 2JX2A 1VC0A 1VQPS 1M5PC 2MZTA 2KYXA 1X5PA 1X0FA 4FXWA 2PE8A 2KG1A 3I56S 1VQOS 4PRFA 1WG4A 3VAFA 3EGNA 1UW4A 4IUFA 4UY8T 2OTLS 2MKJA 1U6BA 2MSTA 2ADCA 2DHXA 5DDOC 2EK1A 2E5JA 1KOHA 3CCJS 2DHAA 2X1BA 1W2BR 2F3JA 2DNHA 2CJKA 3BS9A 1JJ4A 5CYJA 2FC9A 4TU7A 2AYBA 2MQOA 4TU9A 3CC2S 2FY1A 2DGUA 2EVZA 4W90B 4LMZA 2AYGA 1O0PA 3CTRA 2XNRA 4WCEQ 2OSRA 3P5TL 2E5GA 3ZZZA 2LMIA 1X4FA 2KFYA 4Y0FA 2OIHA 3G8TA 2LEAA 1SJRA 2CQ4A 2LA6A 3LPYA 2UP1A 3CUNA 1YIJS 2HGLA 3FEXB 1YI2S 1WEXA 1BY9A 2N3LA 2FPHX 2KT5A 1H6KX 5FJ4A 2AYMA 1VQMS 2LXUA 2CPXA 2J0QD 4QQBA 1OWXA 1WI8A 3U1MA 3CMAS 3R1HA 2N82B 3MD1A 2KN4A 1Q81T 2OTJS 3UE2A 5IM0A 3MURP 5GMKa 2G0CA 2KM8B 2MQPA 1AUDA 3VAKA 2PEHA 3UD3P 1DRZA 4ERDA 4YUDA 5GAHU 2DHSA 1L3KA 2XS7A 4WFBQ 2CPYA 2KXFA 4ZKAA 1M1KT 2DNYA 3V4MA 2CPHA 1VQNS 1WG1A 3RW6A 1X4BA 1S79A 2DGVA 2CQ0A 2DHGA 4PKDB 1SJQA 2RQ4A 1R8PA 4EGLA 5LSLA 3VALA 4WIIA 1HA1A 1VQ4S 1U1RA 3CCRS
chains in the Genus database with same CATH superfamily
3I82A 1REVA 2VV5A 1FTRA 2XMMA 4LJMA 2FJXA 4CQ1A 1QM9A 3U1NA 1P9YA 5HP1B 4OL8A 2QL5B 1IN0A 1GTHA 3G2XA 2OGUA 1HLWA 3P5BP 4X4PA 2LECA 4LSNB 2UXBF 2ZH2A 4HL9A 1OO0B 4DV0J 2G2OA 1Z4UA 2F4VJ 3CD5A 4DR5J 2HGMA 3Q8SB 1A6LA 4JI1F 1GMUA 1BLUA 1M5KC 1U09A 3QLHB 2X3DA 1UTAA 2OO4A 1XMQJ 2EFQA 3CJRA 2ACYA 2AZ3A 1TL3A 4KT0C 3CCTA 3KJNB 4RW4B 4HHUA 1RYRA 3UDEA 2QEXS 5RUBA 3TRGA 6FDRA 4DV6J 4TVAB 1DZ5A 3EVMA 4JOUA 2L41A 2CWKA 4ELTA 4QU7A 3BYRA 5HBMB 1RP5A 3K7RA 1RT4B 4Y6IA 2V8VA 1T9VA 4PEOA 4JI0J 3ISNC 2HVEA 2XY6A 4F3OA 4QIGA 5EN1A 1HNIB 3KLGA 4B17A 4DPOA 3VQTA 1N56A 2BDPA 3ZNJ1 1Q79A 1R8CA 1KONA 1U45A 2J8SA 2OPQA 2MXYA 3PEHA 3EPIA 3ZTSA 2POKA 3QAEA 2SXLA 3NG8A 2V9WA 2V68A 4QOTA 1FRKA 4KY3A 2F9DA 3W2VA 2C2KB 4LBHA 2E9TA 2OPPB 4RO0A 2OPSA 3FEYB 1NSKL 1TMJA 4DN9A 3ET6A 4ZMMA 3RRKA 1T0TV 3GWCA 1RSCA 2JDJA 2LQ5A 3F44A 1S6OA 5JJBA 1MSWD 4DPUA 3MPUB 1S76D 2VB6A 2UUBF 3UDVA 3SZ2A 5H9EK 3T1HF 3K5NA 5CD4H 2M8HA 2JNJA 1RWWB 4NPOA 2KO1A 3F41A 4B9MA 2IRUA 1NH8A 3RGIA 2CPJA 2ZHOA 3M2VA 1X9WA 2ZE2A 5DDRC 3MR2A 2NXUA 2BM0A 3JXOA 1S7HA 2KH9A 2IJFA 5D4LA 2RE1A 2GHPA 3G6YA 1KRPA 2Z58B 1UVKA 2Q43A 3ITHA 1BMQB 3UW1A 1UEVA 2BOPA 2IJRA 3UD4P 3QRRA 2H54B 3VVUA 2M2BA 2YNHA 3VR1A 1Q8BA 3THTA 4RUHA 5KFVA 1IKVA 4FKXA 4DPTA 1T03A 3VAIA 5F8MA 3SCJE 3E8OA 4DZDA 1SPBP 2ZZMA 1IBKF 3DRRA 4G1QA 3PX0A 1IR1A 1SBRA 2UUWA 1RI7A 1QVGR 1C0TA 4ZJOA 4RW8B 3H2LA 3C14A 1S1XB 4LIWA 3OTBA 5KFDA 2CQ1A 2XS5A 2ZJPQ 2LFVA 4QR0A 2E1AA 4DR7J 3T1AA 1HD0A 5F8HA 3PHTA 2LA4A 1QAXA 2P6TA 3RR8A 2XM3A 1NDCA 5KFMA 3OT9A 4DJBA 1F60B 1QLNA 1FRIA 2XCAA 3MEKA 3OHAA 2ASYA 3D3BJ 2FVSA 3C8YA 5KTQA 4USMA 2E9ZA 1WC5A 4LF2A 3VZIA 4PRFA 2A1BA 2FTRA 3VAFA 4C8MA 1S1VA 4A8SA 2JEJA 5DDOC 3DGPA 3EMTA 1KNZA 1VRQC 2FJBB 4ED1A 1UEKA 1LWCB 3P45B 4YN3B 2XNRA 3HSZA 3OFGA 2CZ4A 2WB1D 1KQKA 4JV1A 4RWXA 4NZ6A 2OIHA 1RAHB 1KSPA 4P7VA 4PWDA 1WEXA 4ANDA 2CPXA 3VGTA 2B6AA 1XMOF 1RXOB 3R6LB 3TA2A 2CUYA 3M9NB 2OTJS 2UU9J 1C1BB 2IVFB 3CVKA 1D9DA 3I32A 2ZM6J 3MMAA 2CPYA 2QZ8A 2FLOA 3MWBA 1LWXA 2KKHA 5IV3A 1U25A 4Q44A 2DNZA 5F8IA 1WOOA 1BQNB 1T11A 3T1YF 3N6LA 3QYYA 4GMKA 2Z4PA 1HL6A 2ASJA 5HLFB 4B3RF 3F56A 2HVZA 3PEJA 2UUAJ 4QBUA 5EX3A 2HZCA 2AD9A 5CCLA 2OPRA 2ZDPA 1ZPVA 1U02A 1T3NA 2NYIA 2LQBA 1G3OA 2BX6A 1K9MT 3W7BA 1P8GA 3MEGA 2YXLA 5EUHA 4B3OB 1BUXA 1H73A 2QLXA 3TARA 1RHQB 3VAGA 4P2FA 1PYSB 3WC2A 4LF1A 3RB0A 4DL2A 1JQGA 2ZWOA 5BR8F 3K5MA 1N48A 2RIJA 3OSNA 2C3YA 3KJVA 1U24A 4LRAA 4XDDA 1XR5A 2MGZB 2DH9A 2HFUA 5I42A 3S6EA 2CQ2A 2W8KA 1IBLF 1RCXB 4URSA 2E7XA 4CYUA 3HULA 1SKUB 3KXDA 4UW2A 3PX6A 3B4DA 4O3SA 1NXIA 4A8QA 3IBWA 3PDNA 4WFZA 2KJWA 3PRBA 3I0SA 2V4RA 3A8KA 4J9NA 3V6DB 2FD2A 4BS2A 1CJVA 2CNLB 4M1KA 3BJYA 2R7QA 4J9QA 2EFNA 5KFPA 3I4PA 5AXLA 1TKZA 1N4LA 3H8YA 2JOQA 3PFEA 1XR7A 2F7VA 2KTQA 3MPYA 3W63A 2XO7A 1IBMJ 2IRYA 2HVHA 3ONQA 4KV8B 3WC0A 2GIQA 4IQXA 3GSDA 2O5DA 2V50A 1M5SA 4NEYA 1NDLA 4NE9C 1FHTA 2LKZA 3QJLA 3MI7X 4J9UE 3H42A 2ZH7A 2QG9B 2XMWA 5KT6A 3KLHA 4DQQA 4IO1A 3MCSA 2AP6A 4QYZK 2V6AA 1SI9A 4LR8A 3DM2A 2VPXB 2XYGB 4TKTA 1FFWB 4DV1F 2ROEA 2YKPA 3TVZA 1SV5A 2X3GA 1U8SA 5DJBA 3W61A 4UZBA 4DUYJ 5F9NA 3FBBA 1RAFB 4HTJA 1WHYA 4ZPBA 4FBUA 3BQ2A 4USUA 5U47A 4FVCA 1S10A 1IR2A 4P2SA 2HZVA 3PVXA 2R3VA 4WTYA 1IKYB 4HTIA 2K7JA 3SQGB 4OI6A 4JI4F 2GZOA 2IM2A 3K0JA 2J6SA 4B3TF 3UVJA 4L3NA 2AZ1A 2DGSA 1KTQA 3BKTA 1U1LA 4WKRA 4DSJA 5DRKA 4YY3F 4PPZA 1F5AA 1NK4A 4EO8A 2MKCA 1JLBB 1O5JA 1HBMB 4LF7F 1R6YA 4P75A 1TKTA 4CH0S 4N56A 2R4FA 1RGVA 3NMRA 2HBQB 2DIUA 3FVYA 4DX5A 5E3AA 1HNVA 2DGTA 3PYFA 3GYGA 1S9FA 3I9V9 3ELHA 4OJ3A 4ZVHA 1NDKA 4DHVA 2ZH4A 1SJ4P 1KC8T 3BO2A 1YJRA 8ATCB 4LBIA 1CG2A 4MIAA 2IY5B 1GT8A 3FBEA 3I56S 5L1KA 1LQ9A 4P72A 1HMVA 2CADA 4H4OB 3TZZA 1WKLA 4TU9A 5LMNJ 3E51A 3KLVA 4FYXB 3OTOJ 1ZAWA 3L09A 1TZ0A 3IS9B 4L6V3 3PR4A 1U7LA 3MMJA 4YQWA 4WZMA 2LU1A 4ZVTB 3MD1A 1DTQA 4V19J 4G6VB 3MURP 5GMKa 5KT4A 1HWKA 2KM8B 2MQPA 5KT2A 2XI2A 3CJ8A 5HMXA 3DCAA 2HBZB 1IJFB 2YWEA 9RUBA 1MMDA 3LGHA 2ZOGA 3G6VA 3QSYB 3JTOA 1NK6A 4DR6J 3AXMA 4PUOA 1RTJA 4LR9A 4DV2F 2V9KA 3SFGA 4EGLA 4C97A 5CYMA 3LP1B 5KFWA 4IR9A 1D09B 5EWEA 4NCGA 1JLFB 1JLAB 2NXNA 1U1KA 1N33F 2NR0A 2DEJA 1A7GE 3HF5A 1G7CB 4X65J 1I5OB 2HQFA 4I2PA 1RT2B 2FC8A 4DSFA 1P9QC 4M5HA 3DXSX 3VAJA 3ZC4A 5F0UA 3POTA 3AD7C 3RRHA 2VPZB 4CIOA 1J27A 4A47A 5F3ZA 1NJIT 1JX4A 3GIJA 1FE0A 1D9FA 4JB8B 1BWVA 4O0IA 2JC1A 2XYPB 4ZCMA 2YWFA 4Q7AA 3OLBA 3HVAA 5H9FK 3GR0A 4WU3A 3HO1A 2K1RB 5LMUF 1EKSA 3R1LA 3TEGA 4CNYA 3K58A 1NHUA 4ECQA 1N32F 4H4MA 1EJ7L 2RUGA 4OFZA 2GVDB 4XIUA 3J7ZT 5DM6Q 1LNQA 3JS9A 1YZ6A 3M6WA 2ZWPA 2VFVA 1NJWA 2B56A 3R2DJ 1C0UB 2CJXB 1W7WA 2RT3A 4ZVRB 4CNZA 4MT1A 1IWGA 5C25A 3J80U 5M2RA 2A0FB 4K2XA 4F7VA 1N5YA 3IN5A 3D28A 1F5CA 2VA2A 4X66F 4ED5A 3N6NA 2Z2YB 5HI7A 1WF0A 2VL1A 4QWCA 4IG3B 2YKNB 2R8IA 2HGNA 1S72S 1JMTA 4CLWA 3OL8A 1MLAA 2HAFA 1RK8A 3J7YI 5A8RB 1LK7A 3JYTB 3DDIA 1F9EB 2Y0SD 4I7FB 4EUVA 3PX4A 1ULRA 4RW6B 3LANA 2MSSA 1RQ0A 1K0VA 1I94J 4K4SA 2DY1A 4LFBF 4EBCA 3AOCA 4MK9A 3GR1A 1UWBA 3M30B 4DL6A 2YKMA 4LF8J 4FYYB 4KR0B 2FUG9 3D2WA 2VOOA 2OSQA 3G4SS 5AXNA 1HQ2A 4TLRA 4ECVA 3V2UC 2CXEA 1FK9B 5T7LA 3PIPQ 4E2FB 1E6YA 4HI1A 5HMZA 2KL8A 3MM9B 3IGVA 1H2UX 5KG3A 3TJ8A 1RT6A 5EX0A 2K8GA 5IC6B 1TL7B 3CCSS 3BGRB 2M4MA 2MQMA 1YX2A 4DFKA 3LAKA 2VODA 4R25A 3PRDA 2K3IA 3PFOA 1L3TA 3AODA 4AUKA 5D8HB 4IFVB 2RF2B 4LF9J 2H4YB 1JLEA 2IAJA 3FC9A 1DQAA 2MLYA 1FFGB 4KJIA 3R5GA 2CQDA 4JP8A 4LIRA 1N36J 2BRKA 5M2PA 4JV0A 3KK2A 2BM1A 2MMYA 4M5IA 4BCAA 2DKOB 1GXLA 2EXUA 2HSEB 1NMEB 1VFJA 3J7Z5 1DFDA 2H4WB 1X4EA 1DLOB 3WX4A 1EETA 2HLUA 1U48A 2B43A 1GMWA 3CJQA 5CCMA 1CEZA 1NPPA 3KLIA 2LDYA 2ADCA 2DD8S 3M8QA 2Y3YA 3CC2S 2IM1A 4CLPA 3IBFB 3MAAB 4C2MA 3LPYA 5J2QB 1YIJS 2HGLA 5HATA 4O23A 3FSXA 3EYZA 2ZH5A 1NKCA 2N7YA 1UVNA 2G0CA 5J1EB 1APSA 1HWIA 4JI8F 1ZBTA 2JZ5A 5ETMA 3V6JA 2WVBA 2AKWB 1C1CB 2V2ZA 1PKUA 4ZVPB 1TTHB 4DSKA 2C2OB 4K5RA 5J1PA 4A8KA 1XEZA 3K5OA 4CT9A 2IMOA 3DLKA 3A8JA 1YQHA 2WAQD 2ZBRA 1OPZA 2FDNA 5IQ6A 2DGQA 2ZUGA 3T3FA 2DPJA 5CYQB 3EUNA 4OYMA 3GFXA 1YZ7A 2VDIA 4AQYJ 1RISA 1T9UA 2CRLA 2VKRA 1PYTA 5FIIA 2QMXA 4EU0A 2OI2A 4OZ1A 5KOXA 2QV6A 1G4CA 1VBKA 2BKNA 1EKRA 1QUVA 2OELA 3DXBA 1FERA 1Y00A 2RRBA 4RW7B 1VQ8S 4OYPA 4YMEA 4ZP7A 1SQGA 4KO0B 1XK8A 2XMTA 4FYWB 4Z2XA 4MKBA 2VFUA 1FFSB 3TA0A 3M6VA 3RUBL 2HG4A 4O3NA 3GV8B 3PYDA 2E1CA 3CXCR 1JJHA 3CD6S 2MDAA 4M5JA 4RWWA 1KHVA 1S9EA 3PO4A 3KK1B 4ZVQB 3IC1A 3EZUA 1G6BA 4XPEA 2MYFA 2GS8A 5HROB 3BYPA 1ZTTA 2IM3A 3DDKA 4DPYA 3IO1A 3LF0A 4B3SJ 1M90T 3OV7A 4OX9J 3NRBA 3LTOA 4C98A 5AJ3J 3ILLA 3GB0A 2B4VA 1RYSA 1L5UA 2V34A 2J0XA 2JEGA 1FCAA 1KKHA 2JFKA 3Q83A 1RTHB 2RD5C 2FJAB 5T41A 1C4AA 1SJ1A 3CGIA 3OVBA 1HYSA 1UW9A 3NCRA 2AX1A 1U1NA 2R42A 1TVRA 3DRYA 1JB0C 5E3RA 4IO9Q 1X9SA 4FXDA 4QJVA 2LCWA 1IJEB 2PC6A 3HHLD 3H5SA 5GVQA 3Q89A 2C2DA 5BYQA 4WZQA 5HVHA 3HHLB 5HMYA 4ZVOB 1RBAA 3M32B 2N4DA 1B7FA 2YNFB 2BXJA 3GZ7A 2W4DA 4F25A 3LA0A 4DX7A 2FGOA 2AF6A 2GA7A 4PR6A 4CH1A 1D8ZA 4E8UA 1K8AT 5FDLA 4J9LA 3QATA 5K5MA 1H7WA 3A4TA 4QIFA 2IBOA 3K59A 1RLDA 1Q16B 2W7AA 1D8YA 2VFTA 4IKAA 1RWMB 1HNXJ 4JI3J 4LSLB 5EWGA 2RRNA 4U67Q 1YBAA 2D3OR 2YY3A 1QSLA 1RWPB 1S57A 5KFHA 1YVFA 3BKUA 5LL6d 4X4QA 4LFAJ 4DS5A 1HQEB 1DTTA 2IDLA 4NI2B 2HEKA 2GIRA 4X64F 4ED2A 4PWUA 1UP1A 2GMLA 2B0GA 4OZ5A 5L39A 2B9XA 4PAAA 1TFYA 1RT1B 1NSAA 4IRCA 3I87A 1RACB 2V69A 3L3CA 5ETSA 5E3CA 4M63A 2UXBJ 2RU3A 4IOCQ 1YJ7A 4QWEA 3UN3A 3VF0B 2F5GA 2QL7B 3QO9A 1BXNA 3TVYA 2GMHA 4ZPCA 2MB0B 1WJ9A 5C2CA 1JNZB 4KH1B 4PXEA 2HNDB 2Y1LB 1M5PC 3ZXWA 3RBXA 3OUYB 3MCNA 3MM8A 9ATCB 2BE2A 3HVRA 2DHAA 2NCKL 3RU0A 2FC9A 4X4NA 4F0MA 4B9LA 2EVZA 4ALZA 1L3SA 4LMZA 1O0PA 3N5FA 2I5JB 3G8TA 3RB3A 1HWUA 2GVZB 2HNYB 1KBRA 3NEKA 3N0VA 3FMBA 4L73A 4USWA 5A8KB 2G9OA 2FZKB 3LP0A 2HQCA 5T14A 4FS2A 5DLFA 1PAEX 3E2EA 2ALZA 3MTKA 3M8SA 1U0HB 5J1NA 3K5PA 3AQPA 3FUYA 2V2VA 4CI0B 5K8PA 3C15A 3QAUA 3NOCA 1VQNS 1WG1A 4CO2A 3MM7A 4DR4F 4N76A 4WIIA 4O3OA 2EEYA 1AW0A 2F8HA 3CJTA 1PILA 1S6PB 1AFJA 4EFAC 3HX9A 4DV4F 3GCXP 2IFXA 1N88A 1X4AA 3R6GB 4C11A 2ZEJA 1S1UA 4ZPVR 4OI1A 1K1SA 3LAMA 4Q8FA 2L9NA 3M1VA 4NMLA 4ES2A 4UTGA 5E33A 2CJBA 2XHWA 4MJKA 1HI0P 5LSRA 4USKA 1T05B 1S0OA 1IM4A 5EGYA 3CEDA 2Y8WA 2KDOA 1F9FA 4K2JA 2H1YA 1Y4ZB 2BJEA 3C16B 3TAPA 4N5SA 2D9OA 1NK9A 2D9PA 4ZLJA 2YWKA 2YBVA 1TP7A 4OV6A 4K50A 1L3VA 4X4OA 3D6MB 3I31A 3SQOP 2HNZB 2BUNA 3R5JB 3V6HA 1N34J 2PA3A 5C2GA 2PT0A 4R5PB 3M7VA 4K4TA 3THVA 2VOPA 2VG5A 3H2UB 3DRPB 3NGSA 3PR5B 4FF2A 1WDTA 2NXEA 4A8XA 5D3GA 3WQPA 1VQ9S 3C6UA 4I2QA 1TK0A 2FVRA 3GJTB 3O2IA 1SC3B 1OSCA 1FKOA 3GJRB 1JLGB 2QO3A 2CVEA 2ZKUA 1VMBA 2EBEA 2B9YA 1MMNA 5IV4A 1TFWA 2YNIB 3W9IA 1N8RT 1FT8A 1DQ8A 1KVKA 5ETLA 4HI2A 2CPIA 1YSJA 1X4GA 4U7UK 4RR5A 2JVOA 3Q8VA 4PABA 4TQRA 4ED6A 5KOWA 2Q79A 4YHHF 1AUSL 3G82B 4RKUC 5KG2A 1HQUB 2C3UA 1S97A 2DPIA 1CC7A 2BKPA 1YRTA 1RAOA 3NCPA 5DDPC 2MLXA 3H40A 2KJVA 1TR0A 4NA1A 4ECRA 3KUHA 3D0IE 4DG1A 3SV4A 3T9ZA 2OD4A 4RNOA 4DR2J 2VG7B 3DLJA 1H2TZ 2O3DA 1BD6A 3DGVA 1ZH5A 2QA2A 2YPZA 2W4CA 4K59A 4USIA 2CJ9A 3VHQA 4K4XA 1DQ9A 2OAUA 2LXIA 3GYXB 2CDQA 3A1YG 3HMJG 4NX9A 4OYIA 2QA4S 4OZNA 1SC1B 1N5VA 4FF1A 3LP2A 2HHPA 2ZUAA 2KRRA 4ZCLA 4K0KF 3H5UA 4Z7CA 3IR7B 3CMQA 3BREA 2J9EA 5HBMA 1BQMB 3D66A 3PRVA 1Z1ZA 2PA8D 3J81j 3CMES 2RS8A 3KLEB 1TK8A 3T1YJ 4J9PA 1RTDA 3ZZPA 5KFGA 1YJVA 1KVJA 2EG1A 2YNGB 2XS2A 4B3RJ 3TO8A 1UFWA 2VQFJ 1R0AB 3B54A 3W64A 2DHHA 5DETA 2IA6A 4LVNP 2IYIA 1Q0NA 2XLIA 3MUVP 1AZSB 1Q86T 2M3DA 1EP4A 2IYGA 2O66A 3CCMS 2AYEA 3MECB 3DOLB 2Z56B 2EFVA 3K17A 4PCQA 1CULB 5GADI 2IIHA 4FBTA 4PQAA 1KLMB 4DQPA 5BR8J 1U6BA 1IXKA 3EPGA 1FJGF 4N8OA 1HBNB 1NPKA 4KKOA 5CAAA 1IBLJ 2YX1A 1X9MA 4GKJF 4ID5A 3E01A 3I9ZA 7FDRA 2MQOA 1J5EF 2FY1A 4F0HA 3NGDA 3CTRA 4NCAA 1UJ5A 2OSRA 3G8QA 2LMIA 1X4FA 3TA1A 5K20B 4KAIA 2PMHA 1KFSA 1Q1KA 2O01C 1B64A 3FQKA 1RAAB 1S1TA 4EWTA 2W01A 5A0YA 5JUMA 1CLFA 4Z7YA 2J0QD 1WI8A 1YJUA 2XG8A 3UPFA 1GK8A 2KN4A 1AUDA 1BQXA 4ES1A 3LALA 4Y2MA 4C48A 5G4DA 2DHSA 2WVFA 2ZITA 3RZAA 4J9KA 3MGJA 3ISND 2XY7A 1V3SA 2GJIA 3QGGA 3QPIA 4OJ1A 4GVLA 5E2QA 1REVB 1TUGB 2DNPA 2GV1A 1R7IA 3R5BA 5KG5A 2C2NA 2OMOA 1HW9A 4WIQA 4MKAA 1IBCB 2R2SA 4NLSA 1XN9A 3M8WA 4OX8A 3G86A 4ED0A 3Q8QB 3JSYA 2ZVIA 3CC7S 5IT9Y 3KDOA 3HCXA 1FX2A 4CWBA 1B70B 3OFEA 5IQQA 4KRWA 4QWAA 2MQLA 1HR0J 3KLFA 3HFKA 3HD1A 4C0BA 3ADAC 2FJDB 4DR3F 1NK0A 3OJUA 4WFAQ 1PBAA 1CQMA 4PYAA 4YOEA 5L46A 2M5YA 4RNMA 1XNRJ 1FRMA 3FNNA 1TL3B 2KT2A 3UN2A 1SQFA 2DIVA 1HWJA 3PJXA 2M70A 5SUHA 2CFXA 3M05A 3G96A 2KZZA 1SH2A 4FYDA 2NZCA 1K0TA 4HACA 4RL1A 4ZCKA 5ETPA 3U02A 2V4QA 1VQ6S 1C1BA 4ZP9A 5H1SV 4MK8A 3HVWA 1XNQF 1G2EA 1RLCL 2QSFA 3SSSA 2Z8QA 4GKKF 3KLGB 2KFZA 4JV5F 2BBEA 2QJ3A 2PGCA 4DV5J 1TAUA 4J90A 3N28A 4XPCA 1S48A 1OY6A 4AL6A 1S99A 4OI3A 3HKWA 3HHNB 4LF5J 3DRXA 1BQNA 1NHVA 1RHKB 1RKIA 2DEIA 5HLFA 3MF5A 2RHQB 3W2VB 2MZSA 2R7XA 2L48A 2OPSB 2E5LF 3MEEB 4GVBA 1UETA 4RU2A 3ET6B 4LF4J 3UR3C 3KG4A 2A2DA 1YRXA 3TX0A 3BDPA 2B7CB 5KG0A 3E3XA 3BZQA 5GAEI 5IXUA 4KSEB 2I8EA 5L1IA 1PC5A 3ICLA 4HH0A 1KTVA 4F4AA 4I6WA 3MTJA 3SBMA 2J9DE 2HIQA 3DLBA 1S1WA 1PSDA 1FDBA 1WEYA 1H3DA 2BW7A 2ZE2B 4ETZA 4WP9A 3GPAA 4KGKA 4G1IA 3P3DA 4ZCIA 2HS4A 3ITHB 2GQ2A 1X60A 3DMJA 2VG6A 2C3PA 5D6GA 3K8WA 3TWZA 5KFQA 3QSIA 5IT4A 2YNHB 4DV2J 4WE1A 1RE1B 1KP6A 3D6TB 1IKVB 2NUUG 1T03B 3UQSA 4LQ3A 1GEHA 3BB5A 4ZN3A 1U1OA 3GE9A 5F8NA 2YKQA 3DRRB 2UXCF 4L72B 5B0FA 2Z2LA 1GNKA 3EICA 1AYEA 5ITHA 3IAS9 2R7UA 2N7CA 4DCJB 1N33J 1C0TB 1SKSA 4YB1P 3C14B 4M5DA 1FESA 1UPPA 5LXYA 3ZZOA 4NEZA 3EVOA 4KPCA 3RRGA 4O4GA 1CJUA 3BEGB 3N5BA 1HNWJ 5IT9U 4OLPA 1S49A 1XWLA 3EX7B 4WK3A 3VVTA 4F50A 4CLKA 4M95A 4YDXA 4Q43A 4WWSA 3PW5A 3EWGA 2C28A 2W9AA 2J7WA 2LU2A 3BN7A 4NOHA 1JK9B 1I1GA 3CJ4A 1S1VB 4ZK7M 3W2WA 4DV0F 3DGPB 2F4VF 1NEEA 1IM6A 1LWEA 2DVIA 2CJKA 1JJ4A 1GQEA 3MMBA 3TUZC 3ZZZA 3BBFA 3CJ3A 4J9VA 5EDWA 2UVRA 2EBGA 1TL1A 1IKYA 1XMQF 1SJRA 3TZXA 4QIWD 2R2TA 1SKRA 2B6AB 2K7KA 4E98A 2WRMA 2KB2A 1OWXA 5ETRA 3KMQA 4ILMA 4KTQA 3R1HA 1VHIA 1KDNA 1T9XA 3IRXA 4WJBA 4DV6F 3CDEA 3EJMA 3MMAB 5B09A 4PG7A 4KC5A 1FEHA 2IC3A 1M1KT 2DNYA 2CPHA 1TAQA 1HNZJ 1RADB 4JI0F 1XC9A 2AT1B 3BR8A 1H72C 4X66J 5IT0A 2WBRA 3WIVA 2BJ7A 3L7OA 2FYXA 3MFHA 3VGSA 2OPRB 3NOGA 5E7OB 3FRYA 1D3WA 3A13A 1FRJA 4KYZA 2GO9A 3CSKA 2HHWA 2CQBA 2W2PP 3MEGB 4QPTA 1BGXT 1NBEB 2H51B 4P9SA 3OR2A 2RUSA 4ANEA 2UUTA 4HR2A 5LJ5Y 1D9AA 1HFEL 2B4UA 2DNQA 1RKJA 3D6FB 4M8LA 1KR4A 1VLYA 1FJ7A 3CDWA 3F0NA 2HHHF 2QLWA 5HANA 3KJVB 3QJPA 2DNGA 3OL7A 5I42B 2RAQA 4BC7A 1UMJA 1NZ8A 2DJWA 4U95A 4CYUB 1YLXA 1NNDA 2RQCA 2I38A 3IS9A 3EE3A 3QGIA 4IRDA 3TOQA 2DR7A 4Q0BA 2ZFHA 3ZO7A 3NGRA 3KHGA 3I0SB 2MZRA 1N52B 1UFKA 2IA0A 1NH7A 3JTNA 3KTQA 2XC9A 2AJ4A 2FB0A 2RS2A 1VQKS 1VOMA 2J9CA 2NUHA 1TKZB 2GGPA 1NSPA 1S4EA 5E41A 3TQEA 3HZGA 1I6JA 3IWLA 2KI2A 3M6XA 3B78A 4DWIA 4ZPAA 4DBQA 3EGZA 1IUJA 2FHJA 4M94A 1IKWA 3I0RA 5MLCV 4ED3A 4UF4A 4BWJA 6AT1B 5G0RA 4C0OC 1FDAA 1NKEA 3QRPA 1FJCA 2EC0A 4L3KA 3KLHB 3GONA 2RNEA 1VYAA 4P2XA 5J2MA 3G8SA 4DR7F 4BLGA 3PXGa 1EAYC 2C22A 5KFJA 3GIRA 2ZJQQ 1SV5B 2OH2A 2VPWB 3H7HB 3RAXA 3KK3B 1Q53A 4RX6A 3AJ2A 3NS6A 2ZHBA 4OYAA 2F1FA 3H25A 2ZD1B 5LXRA 3MAQA 5K8NA 3DKDA 1GH8A 3CB4A 3AB2B 1AA1B 2XZDB 3NNAA 3J81U 3ZZ0A 1Q5YA 4WFYA 1WWHA 4RBVA 4DV7J 4LREA 3PW7A 4DSLA 4NLOA 3KUGA 1JKHB 1ZYQA 1S6QA 2Z0GA 1RT3A 1LW0B 4J9OA 1JXVA 2BJ3A 4F3MA 2ZM6F 2EFOA 3KYLA 3FKBA 1VS3A 4DZ6A 1WOPA 4DS4A 2BV3A 1V9OA 1FKPA 4FXVA 3WBZA 1HNVB 3RYLA 2P6SA 2WVEA 3JSMA 4RPFA 1EARA 1P1TA 3BN4A 4QIEA 4KFBA 4MTPA 3HT0A 2DNLA 3RBZA 3QZ7A 2L08A 3GG1A 3NLCA 2WK4A 1WORA 1K1QA 5B7WA 3QIPA 1U2FA 4HDGA 2MZTA 4FXWA 2KG1A 1FXRA 2HVIA 5IOLA 2W7OA 2WCXA 1XR6A 1P1LA 3FZ2A 2DHXA 5F8LA 2PI4A 1E6VA 4B3MF 2WSEC 4X4RA 4JI6J 4B9TA 2FPHX 5F0WA 3V5RA 1DTQB 1RCOB 3CMAS 3T41A 3CJKA 3ENWA 2F8EX 1PCAA 2UV8A 1DURA 4EBDA 3C6TA 1DAXA 1HHQA 3KHRA 3UI3A 5KFNA 1FWKA 4ELUA 1TL4A 4O4RA 4KBIA 2QFIA 5CYMB 3BGFA 3TI0A 5J2NA 2P9GA 4KGMA 3MCMA 2B3TB 2RF2A 1VQLS 3M8PA 4NCGB 1IBMF 4KGZB 4N47A 2IPOB 1S0MA 4WBFA 1DJ0A 5A2QU 4LFCJ 3NBPA 2QYCA 3M8YA 4I2PB 3QWUA 2ZH6A 2MJUA 2KG0A 1Q7LB 4UOGA 4A48A 3MR5A 3POTB 2LQJA 2P5VA 3AA8A 1T95A 4KHPJ 2CQIA 2A6MA 4IDKA 2RU9A 1B99A 2QTWA 2I0XA 4UQGA 2ALYB 1RT5A 2DNMA 2BMBA 2BW2A 2XMVA 3R7NB 4X4VA 3NXZA 4DUYF 3HHKA 4ECUA 1RAJA 2VONA 3AD8C 4IFYA 2HQDA 2VBWA 2F8MA 3AA9A 2O67A 1W26A 1Q7YT 4RW9A 2ZH8A 4H4MB 2HRYA 4U9RA 4FF4A 5D78A 3N79A 4DUZJ 3I55S 3W9JA 1CJKA 2QFJA 3G9CA 2W2MP 2WOMA 3CPWR 3BGLA 3BGOP 1RWNB 2ASDA 4WXOA 2BE7D 5C25B 1N5YB 2VJVA 3PJ9A 1GMVA 2WVCA 3VZHA 4EO6A 1XERA 2ZOMA 1HHSA 2MHNA 3M2UA 2V2KA 5B0BA 2W2NP 4J91A 5DM7Q 4B9SA 3BGUA 4OZ3A 3HM9A 4DCOB 1I51B 4ECZA 2E29A 2ZOFA 2I9SA 2HW3A 4EZ6A 3TZYA 3ZTPA 2EFGA 3H0PA 2IM0A 2XLJA 2BJDA 2HQ3A 1UWBB 3CD7A 2CG4A 1QY7A 2FLNA 2YKMB 3BH6B 4ZVUB 4X62F 2E1PA 5H9EJ 4U96A 3DRSA 1WHWA 2Q6BA 4OMFG 5KG6A 1UVJA 1MN9A 4URQU 4WF9Q 4O3PA 3NL0A 3MXHP 1VGYA 2D69A 3OTOF 2DNOA 4L74A 4C0HA 5FLXU 2IJNA 4DLGA 4X2BA 1OMSA 4DI6A 2XULA 5L8RC 3MR3A 2Z2ZA 4IOBA 4J9SA 1VCTA 1RT6B 2CWXA 4JYAJ 2CNNB 3UCUP 3H2VE 1U47A 1SUQB 1FWLA 3CCVS 2NLWA 1YGYA 1RTZA 4QW9A 1R8BA 3MM5A 3OVAA 5KFTA 3TZWA 2WVDA 3MMCB 1SH3A 5DZ7A 4Y00A 1JLEB 2IAJB 4MH8A 3L7PA 3JSRA 4NYPA 3HSJA 1ZZNA 3JAMU 4USTA 1OIAA 2KFNA 3IRWP 3M6UA 4NLVA 3KK2B 2FGCA 1RU2A 3CJ0A 1GMWD 3BBBA 4X65F 4DL0C 2W1BA 4Q45A 4NZ0A 1EETB 2ZDOA 3TJ9A 3MHYA 3ZNUA 2V4JB 5KFIA 4DN0A 2Y0BB 2GAHC 3OXGA 4F4YA 3KLIB 3GYNA 2VFSA 2CZVC 2MSTA 2J6TA 4ED4A 2J0WA 2F3JA 2FLLA 3DLGA 2AYBA 3MM6A 3IP0A 4ECTA 4BHQA 2W9CA 3P5TL 2HQGA 3QT6A 2HBYB 2AGOA 2H3EB 3HFVA 2UP1A 4QR1A 4LSLA 3N4WA 1NCLA 5K9FA 1H6KX 2R8JA 5FJ4A 2XY5A 4ER8A 4ZLLA 2IHR1 4HKQA 2D3UA 4DF4A 1Q81T 3H90A 3RBEA 2X7IA 2LP4A 1S9GA 1S6UA 3DLKB 1SKWA 1S79A 2W2QP 4OI0A 3V81A 4PKDB 2OEMA 2KT3A 3R5CA 1UFLA 4HH1A 3CCRS 4OHWA 5DDQC 4WKYA 3NY0A 1M1HA 4NLYA 5L1LA 3D67A 2AEFA 4LF6F 3Q2TC 3PJWA 1MROA 1PJ7A 2D3O1 1BHNA 1NU4A 2COLA 4N8NA 3DFEA 2CJQA 4W4MA 2ADBA 3CIMA 5JMNA 5C24A 1NB2A 2GHVC 1LXNA 3CNQP 3CDUA 4C8YA 3VQSA 1P27B 1V5IB 5A8WB 2B51A 1SL1A 2ACMA 2AMCB 4JBCA 1HI8A 4OX7A 2NREA 3CULA 3AD9C 1WG5A 3UO0A 2XQCA 3VAMA 1HW8A 1S7IA 3CCWA 1NJZA 3KUEA 2X1FA 1S9EB 6FD1A 2DGOA 4W92B 3GIIA 1JNRB 4LF8F 3HHEA 3FK4A 1K47A 3UR0A 3PZPA 1X0PA 1FI4A 1NK8A 1NDPA 4NLDA 1FVSA 1VRUA 5A8KA 4FPRA 1LWFA 2AGQA 1RAEB 2J7UA 2DH8A 4A8WA 3CDBA 4A4JA 4CLLA 4FNHA 4Y2KA 1VQ7S 5DQIA 2QGFB 1N54B 1PBUA 1Y5NB 1PIEA 4CDIA 1YBUA 4NRTA 4F4WA 2ROPA 1G1XA 2VBZA 4WK1A 2FVCA 3J80Y 1OPIA 5IZHA 4KIAA 1TVRB 1WACA 3W9HA 3IAM9 2XSJA 1WTFA 4TY8B 4ZOSA 3DI6A 2HHUA 2QE5A 2VUGA 4LF9F 1UKUA 1IR0A 3X3UA 1NLKL 3SIPB 2XSFA 1WC0A 4QR2A 5KFBA 2WW8A 1V5VA 4JI2J 1N36F 4K4YA 3I4HX 3T5HA 3HK2A 2QA1A 3A3NB 1ZM3A 2Z57B 4IH6A 3HLUA 4AD6A 1S0VA 2R7RA 3C16A 2RDDA 3HKZD 3GIKA 1F9HA 4DR1J 3KJQB 3I5CA 1VRTB 3PHEA 4QYZJ 2HFSA 1VDHA 1X5SA 5D4PA 4F2RA 1N0VC 3UWTA 3PW4A 2OFGX 1HBOB 3EZOA 4CM0A 2VF3A 3W62A 5IS2A 4KH0B 1YDLA 2DNKA 4R5PA 1TMMA 5HQLA 2W4PA 4O3RA 2M7SA 3G6ES 3QGHA 2CPDA 4I1TA 2V8HA 3JSBA 4WPAA 2XWXA 2C1EB 3UCZP 4TLQA 5D77A 5J2PA 1SL0A 5KFEA 3KNAA 3TUIC 2ZH3A 1RWXB 1FJEB 5I3PA 3CCUS 1DTTB 3MR7A 2W9BB 2RKIA 3D4JA 5F3TA 1RWVB 3QJJA 4ZHRA 3FFIA 4ENOA 5HN0A 1X5TA 3Q0AA 2G4BA 2MJNA 2O1PA 1A9NB 1F2HA 3D1QA 1QDUB 4OHXA 4OHVA 1RZMA 1K73T 1OQ6A 4B9NA 1B7YB 4OHYA 2QIFA 4LT6A 1LFPA 4FS1A 3P6YC 1X5OA 1PAUB 1ZM4A 2VHGA 4A8FA 4J5OA 2W7PA 3QO9B 2WB4A 3QZ8A 4F26A 5GAHI 4PZVA 1XIQA 2E9RX 4WFXA 4CM2A 3D1OA 2Q1LA 4K5SA 5FD1A 4OZ2A 4PG4A 2LQ8A 4ZITA 2BE2B 1GFWB 4AT1B 1QAIA 3H5XA 4CT8A 1KOHA 4DQRA 4NYOA 2X1BA 1W2BR 4YP3A 3F73A 1QE1A 3BS9A 5C5JA 2RQKA 2VBYA 4R0JA 3KJFB 4W90B 2DCUB 2E5GA 2EW9A 4ETXA 4Y0FA 1IKXB 1J5OB 3FJ2A 2CQ4A 4C3MA 1FNMA 5KFCA 5I3UA 1YI2S 5HMWA 2N3LA 3LP0B 2AYMA 4QQBA 1N6QA 1LKZA 2FHKA 2GAGC 4JV5J 4F3QA 1HIYA 2KHDA 3C15B 2NS1B 4OX9F 3SYZA 2KXFA 3V4MA 2N4CA 3MM7B 4ZLPA 5KFXA 3QQCD 3BSAA 4XTTA 2DHGA 1HA1A 4MMOA 3DHXA 2H48B 1UL3A 2E44A 4C11B 2V63A 1WELA 1S1UB 4P71A 5AE2A 5BYRA 2FIUA 4AL7A 3W5XA 4A46A 3SXLA 2W24A 3KKFA 2P8IA 2D7SA 5AXKA 3BQ1A 3M1VB 5I4MA 1UVIA 1KWMA 3D0GE 3MPDA 3OTCA 3DOLA 1RHUB 2E5IA 1F5BA 2G1HA 3GP9A 2UUCJ 1CULA 3H98A 3NGTA 1S4FA 4LRBA 3BBCA 4I64A 1WHVA 4DV3J 1S0NA 1HWLA 1R89A 4QW8A 1VHFA 2BA9A 2NXJA 2JHEA 2ASLA 2XHCA 1RBOB 1NO8A 2DXFA 1Y3KA 3K57A 1ZOTA 4ZLNA 1FDDA 4V19X 2I2YA 3P96A 1RJJA 2VG5B 1L3UA 1CS4A 3DC2A 3Q23A 5K8OA 5H9FJ 4JI3F 5D3GB 2PSZA 1X4DA 2YQ1A 3J7AN 4I2QB 2U2FA 5KFUA 3DOMA 4DLEA 2UXCJ 4EBEA 1FKOB 1RWUA 4I0WA 2BKOA 5CD4A 4ZPTR 3SDEA 1JLQA 5A76A 5CXTA 1X7VA 4ZVFA 3OHBA 2MQNA 1ZM9A 3GIMA 1CSJA 1U2RA 5THWA 3JQMA 4L75A 2JEIA 5JVGQ 4OQJA 2MTLA 2OMLA 3T5LA 1GXTA 4DXLA 2GJFA 3DLEA 1R8HA 2MZQA 4DDFA 2B5JA 2N3OA 1EB0A 4DG1B 3ZZTA 2DO0A 1EQ0A 4PXDA 4HT5A 1TKXA 4U8VA 3QGPA 4M5KA 2R8KA 4J7CA 2HK2A 3QFWA 1HBUA 4RJVA 1Y5IB 3KHLA 4Z37A 2RB7A 2JRSA 4LR7A 4I6YA 5HL7Q 5IWAJ 2E1RA 4BWMA 1RTIA 3V4IA 4N77A 3LP2B 3MUMP 1ZS6A 4WXWA 4JUZA 4DL4A 2PDAA 3T5KA 4RBTA 3PW0A 2ERRA 1F3VA 5DGAA 3IA0A 3B8HA 3D0HE 4KPYA 2JEFA 1YHQS 5IM0B 5F9LA 2VQEJ 3IBCB 3FCVA 4ZPWR 4CLTA 1OY8A 4WP3A 2A18A 3LWLA 1RTDB 2ZH9A 3QT5A 3NS5A 3RW7A 3NGKA 2AQ4A 4JI7F 2HQIA 3ILJA 3TYTA 2LQ9A 1PG5B 3D1HA 3C19A 3KDNA 3N6MA 1KD1T 3NAHA 4YB5A 2AJFE 1XQIA 3EXCX 2RDJA 2DRBA 1NRKA 3MEEA 3KMSA 1EP4B 2OLWA 1VBXA 3BKFA 4IG0A 5B0DA 1C2PA 5CZXA 1FDNA 4P52A 5MAOA 3OL6A 1N5SA 5HK4A 3MEDA 2FHMA 4NASA 5AE3A 4NXMJ 2HHHJ 3KHHA 1H74A 2HFOA 5KFAA 1WG4A 3LUYA 1UW4A 5DO2A 2OTLS 4KKOB 2HIYA 2E5JA 4ID5B 4EK2A 3E01B 2VKZG 4WP8A 2DT9A 2QT7A 4K7QA 4UZCA 3HJFA 2OP5A 1S1TB 4DQIA 2BR0A 2C3MA 5A0YB 5ETQA 1BY9A 3PTWA 1RHMB 1N34F 3U1MA 2OEJA 2GNKA 4Y34A 4NXNF 3W5YA 5SZTA 2IDEA 4OZLA 4LRCA 5GAHU 4Q5VA 2HS0A 1OSDA 4ECSA 1UPMB 2CQ0A 1ZPWX 4U7CA 2P2CB 4X4UA 2V0NA 3FCWA 3W8PA 1RDRA 1RAGB 4CTAA 4RU9A 2HHSA 5HJXA 1MU2B 5C42A 3NKYA 2WONA 1TV6B 2D3ZA 3Q2SC 1NK7A 2LYVA 4P10A 1GXUA 4YB7A 1EZZB 4DUTA 3QFHA 3ETMA 1FRXA 2HWIA 4YR2A 1CJTB 2Y8YA 1JLCA 3KLFB 3LWMA 2PFFB 1FE4A 1VR6A 2C2ZB 2IMWP 3U27A 3FMWA 4O44A 2GO8A 1WKJA 1WF1A 2ZNYA 4F67A 2XTJP 2BE9B 4DR2F 1N5QA 1ITPA 2MKYA 3AJ1A 4M5MA 3SCLE 3OR1A 5DGBA 3LPEA 2VZ9A 2H9ZA 3WX8A 4HACB 5D15A 1B3TA 4DMZA 4XAKA 3BO3A 2HHXA 1WC6A 5KAKA 4A8MP 3EM1A 3DNCA 4OZJA 2BYCA 2QX0A 3ENQA 4CO3A 4C8LA 1QTMA 3M2RA 3FGVA 1P6TA 3J7YU 3IR6B 2YH0A 3OBIA 3OXFA 1YRUA 2R7VA 3RTVA 2PI5A 2KXNB 4MYTA 1UVLA 2KXHA 2VQFF 2ZJRQ 5KG7A 4YFUA 4DPWA 2ATLA 1HPZA 2ZKTA 2E7VA 4GVBB 1BWEA 4EYHB 3DHWC 1LW2A 4U6PA 1OYEA 2B4OA 1S77D 4TU8A 1TELA 4TN2A 4CO0A 1D1UA 4JI1J 4B3MJ 2A6OA 3SFUA 5KFZA 3MCOA 4ANCA 2ZBQA 1WUUA 5ETKA 2G1DA 3HSDA 1BC6A 1S1WB 5IFMA 4YDDB 1JJCB 2DXDA 1O8BA 1W25A 3EGWB 4MAKA 5KT7A 4DEZA 4C7QA 2Y1RI 2HYIB 3TUPA 2HZAA 3CE8A 4P74A 3DMJB 2VG6B 1UJ4A 2RDIA 3LH2S 4DSIA 3PNIA 4MIWA 4ICLB 4K4WA 4DX6A 2APOA 4WE1B 3ILIA 2H65B 4Q2MA 2XO6A 3AQOA 1I3OB 1VJQA 5KFKA 1HD1A 3LGMA 2FJVA 2XWYA 4HVZA 2J0SD 7AT1B 1URNA 2CIMA 5LSOA 3R8YA 3S01A 2B9EA 4X4SA 2HMIA 1ZAVA 4C3LA 4Q2LA 4M5DB 3O5TB 3BSNA 3QRQA 1LK5A 1ZAXA 4ZVSB 3DOKB 1FRHA 2UXDF 4O4GB 1R3NA 3N01A 4MFBB 2R7TA 2EG2A 1CJUB 4UOCA 1UCNA 5DZ6A 3ZTOA 1QAYA 2UUBJ 1FO1A 3AOAA 4WFNQ 2R2UA 3P4UB 3W2WB 2D1CA 3T1HJ 1HR0F 3O44A 1LWEB 2WSFC 1Q95G 4DOZA 4R8UA 5K14A 4UY8T 4MYUA 1FRLA 3KK3A 1FF2A 4ELVA 4CO1A 5KFLA 1KFDA 3OJSA 2HRTA 3MMBB 2ZD1A 5CYJA 1FD2A 3M4XA 3H5YA 2DGUA 1TL1B 2AYGA 1Q4RA 4O0NA 1XNRF 3SI8A 2BVZA 3Q22A 2Q3PA 2BANB 1NM2A 3GFYA 3HVTB 3LOUA 1RT7A 2LXUA 1VK8A 3DYAA 1SC6A 3IRXB 3IM9A 4FYVB 2VU5A 4PG5A 4F4KA 1JKHA 5L9NA 2PEHA 4R0EA 2JLEA 4C8KA 1LW0A 3QBCA 1DRZA 4ERDA 2IC3B 4TNOA 4YUDA 2XS7A 2V5HG 1IBKJ 4P73A 2CDRB 2F65A 3EDQB 1VQ4S 3W3SA 1U1RA 4NRUA 4TYBA 4DV5F 1T02A 1U6ZA 3TAMA 4USHA 1R43A 5L38A 4DL7A 4LF5F 2A3JA 2XGQA 3HHDA 1TL5A 3SMZA 2RMLA 1S5ZA 2AEMA 1UZHA 5KFFA 5HP1A 3KG0A 3MOJB 4DL3A 2GQCA 3OR2B 1LXJA 1M5VC 4GRSA 2R8HA 5A6WA 1Q82T 4LSNA 4LF4F 5BYSA 4QIVA 3C46A 3HPOA 1FEEA 2BEFA 3AOBA 2G0IA 4AXIA 4X62J 1U1PA 3NWGA 2WSCC 1YBTA 1KLNA 1NUEA 3KOAA 4AXJA 2H5EA 3WDOA 2BQUA 3Q86A 3BV8A 3QLHA 2E1MC 2B7BB 4NZ7A 2JJ4D 2JC0A 3ULHA 1XMOJ 4Q0BB 3RBDA 4F2SA 3B4MA 4MIBA 4RW4A 4DU7A 3JB9k 2MQQA 2CAJA 4XDCA 2XNQA 3IG1B 3L9ZA 2QLBB 4ED8A 2ILYA 3R5DA 3M9OB 1Y9OA 1RABB 3TP2A 4UY85 2GGPB 1RT4A 2ZHAA 2BOAA 2FHJD 4B08A 1HKAA 4YB6A 5GMEA 3M8RA 1HNIA 2HVDA 4ZA1A 4IRKA 1RB0A 3SSRA 1EHWA 1IKWB 3EGVA 4USVA 3I0RB 1FNXH 4PQUB 3EZ5A 2YQ3A 5G0RB 4TXSA 4RNNA 1M5OC 2V8DA 3VV2B 4A8YA 5CHCB 3SV3A 5J2MB 4QWDA 3PG9A 4ES3A 2OPPA 1EIYB 2QN6B 4NLPA 2HBRB 3OW2R 1N0UA 4W98A 1U0SA 1HNWF 2XI3A 5IC4B 3D9BA 2HRUA 5M2UA 2OEKA 1REGX 4J9MA 4JI5F 4MK7A 2YPYA 2XZWA 4RNFA 2AEJA 2XLKA 2MZJA 2ZC4A 2V8GA 1SH0A 3QNWB 4FZVA 1Y7PA 4Y65A 1QSYA 4DFPA 1RWKB 3UN5A 3PKYA 5CH7B 4PPDA 3WHIA 3CF5Q 2A10A 1X4CA 1WSRA 1NAQA 2KHCA 2LEBA 1S6QB 4RZRA 3O3LA 1F3FA 3U7JA 1RBLA 1RT3B 4DQSA 3QIDA 2CZ9A 2PN6A 4TQSA 2Z30B 1VIXA 1U6FA 4NL5A 1AXQA 2QLJB 3IR5B 4Y28C 1PJ6A 4PWWA 5E3PA 3OVSA 1FKPB 1HNZF 4LF6J 2HHTA 2EI5A 2HFZA 4RNHA 3VWSA 3JSMB 2HK3A 1FNOA 3R27A 3CIZA 3ISZA 4RW8A 4KFBB 1S1XA 1VJWA 3GTYX 4FF3A 2RJZA 2R2RA 4Q8EA 2GQQA 4UQTA 2DH7A 5GMDA 3GSIA 3FSYA 4DV1J 1PJ5A 3H20A 3QIPB 4TYAA 3IWXA 4I4BA 3HJVA 3ZFVA 2HHVA 1GX5A 2ROGA 3AH6A 2KYXA 4IH7A 2PE8A 4DL5A 1VQOS 4RUAA 4IUFA 2MKJA 3UNYA 1E6VB 1NPRA 1XJWB 4XK8C 1Z2LA 2UVVA 1XBWA 2ABYA 1AT1B 5KFYA 1LWCA 4OHZA 4JI4J 5ETOA 3LW5C 4B3TJ 2PEBA 3CJKB 1RWOB 3GLJA 1SC4B 2YWWA 2EWHA 2QA4G 2J6UA 4YY3J 3UE2A 2QMUB 3VAKA 1IWAA 3HDSA 4LUBA 3C6TB 4HT7A 2DRAA 1L3KA 4LF7J 1SUQA 3BSCA 3Q8UA 3Q8YA 4WFBQ 4ZKAA 3BPDA 1X4BA 2QLFB 5J2NB 1SJQA 3MMCA 1R8PA 5LSLA 3M8PB 3NP5A 1T7PA 2AW0A 2OPQB 1VQSA 3O6QA 2PFDA 3H4DA 4QU6A 2JSXA 1M0SA 3NAIA 4FNIA 1U8WA 3NBPB 2MKKA 1T8EA 2BZ2A 2IRXA 4DPXA 4EZ9A 3THPA 2DGXA 4LRDA 2X51A 5CABA 3L4BC 1H38A 3OPKA 3J7A1 3D6HB 1EQMA 3X1LB 4ZPDA 3OLAA 1T9TA 2QRRA 2V4JA 2D41A 5KG1A 3RR7A 2L3MA 4ZVEA 4IDKB 4OV1A 1WTBA 2Y1IA 2YKOA 3A12A 1QUPA 1GTEA 4B3OA 1RT5B 2VH7A 3K2YA 1FX4A 3A8EA 3AFGA 3SEOA 3GV7B 1R27B 3TANA 4ZIVA 4J9RA 3OQ2A 4IFYB 5E5NA 1UAWA 4GO7X 2BQRA 3OFFA 1MWZA 3M2VB 2MGZA 4RW9B 4I68A 2CA9A 1HI1A 1RUSA 4HDHA 1DHMA 2B8PA 1GX6A 2J7KA 1WOSA 3D3CJ 2MHEA 1CJKB 4URGA 4I6AA 4DV7F 2WOMB 4KHRA 3RJMB 2IBKA 3IGNA 5AE1A 3V6DA 1LEOA 1U49A 4NCBA 2DISA 5CZVA 1X8DA 2CNOB 2DNNA 4X4TA 3FRZA 4UOHA 5JVHQ 1RA7A 2AWZA 4G1QB 1WEZA 5DQHA 4C8OA 1KQSR 5A6PA 3BDEA 1TK5A 4ZN1A 1F6TA 4KV8A 3IMQJ 1WC1A 5DQGA 4K4VA 3M2UB 2KVIA 1R0CB 1Y0HA 1FTCA 2FQQB 2FZCB 2BQ3A 3CT9A 1Q78A 2GX8A 5HQ8A 1VBYA 2AJ2A 1SL2A 1MNEA 3DU5A 1F2GA 2HPUA 2YWGA 4OJGA 1M1GA 4JV2A 4C8NA 2CQPA 8AT1B 2RH3A 5A8WA 3AXKA 1FXLA 3CJ2A 3I5BA 1MW7A 4HHJA 2R8GA 2VASA 1YJWS 1NZAA 3PYGA 2CPEA 1B0PA 2JVRA 4DR5F 5LMUJ 3L7UA 3DRSB 4HHHA 2DGWA 3ZTRA 3OSPA 3J81Y 2UVWA 4OLOA 4PWDB 2M8DB 1N32J 2YX4A 4ZS6A 4JI6F 2ZBIA 4L76A 3SQGA 3B6BA 2XZTB 3I96A 4OZ0A 1VI7A 3Q24A 2M9KA 1TUVA 2CPZA 2DR6A 2UVUA 3PW2A 1Y10A 5E3QA 1A0OB 3FBFA 4OX6A 2W8LA 4F02A 2DR9A 3NS7B 5F8GA 2VIHA 4BC9A 3TVKA 2OHDA 2MY7A 4EYIB 3NMAA 3DN9A 3MM5B 1WD6A 2UZAA 1HHTP 2NXCA 4D3GA 2FVPA 1C4CA 1Q8IA 3M9MB 4ECWA 1JLBA 1U1MA 1HBMA 4IQMA 2YH1A 5GADU 1ROFA 2YX7A 2G0JA 2DR8A 1YTYA 4IOAQ 3IM8A 2CVIA 3OL9A 2BJ9A 3MUTP 1URRA 4TY8A 5HQMA 2WBMA 1PGZA 1DY3A 3RAQA 3FSIA 2DK2A 2KU7A 1SJ3P 1ZETA 3GFHA 4NLGA 4LFCF 2E66A 3MPVA 1ZA1B 3MAHA 4LQ9A 3OXLA 2GW8A 2XMKA 4GO5X 1V3RA 1KS2A 4AL5A 1VQPS 4UUWA 4NLQA 2EPIA 3TNVA 4LFBJ 4FN5A 1LV5A 3EGNA 1VRTA 1R8AA 4KHPF 4F0KA 2JH3A 2FVQA 4PYDA 3DLGB 2BRLA 1RHRB 3MM6B 4NLWA 3L95X 2W9CB 4H4OA 1HBOA 1WC3A 4OYWA 5HSPA 2F4FA 3R2CJ 1UEUA 2ZNZA 3FCHA 4ATNA 2WHOA 1SCJB 4UOFA 2LA6A 3P8BB 2C2RA 3HFZB 3FEXB 5F41A 3NCQA 1UZDA 3FEZA 3BF4A 5K8MA 1OQ3A 1S9GB 4DU8A 4DUZF 2J5AA 2D74B 3TEHB 1CJVB 5DG8A 1LFWA 2W9BA 3V81B 3ZTQA 3RW6A 1NB7A 4CLYA 3DLHA 3ILOA 4CRJA 1H2VZ 3LP1A 2M88A 1UWAA 4F4ZA 2MEWA 1MROB 5A2QY 4AE5A 2DYAA 4IR1A 1JLFA 2V94A 1JLAA 2ZH1A 3NNCA 2XMAA 4DFMA 3NNHA 2I1RA 4P7TA 4YR3A 4ZIWA 4TY9A 1RT2A 5C24B 4KGVB 4KHMA 3DM2B 5EHHA 5LJ3Y 1YJ9S 1Q5VA 4IH5A 3PIOQ 2GCFA 2RHSB 1IQTA 2PO4A 2IVMA 1QD1A 4ILLA 3D7SB 3CCZA 4M5GA 2HFNA 2NYHA 1KQGB 3FZBA 3PO5A 5D4NA 3NWRA 2V67A 4EMDA 3K89A 1PYOB 4KGXB 4QCLA 4ILRA 2KM8C 3T6JA 2G2YA 2BJ1A 1IKXA 1J5OA 3DLLQ 2XMUA 3EDRB 1OYDA 3A8IA 1B0TA 1VRUB 2K1RA 2Y9HA 1LWFB 3AY0A 1VIOA 2AU0A 4JI8J 3C66A 4GC7A 3UVJB 1LOUA 2B8QA 3P49B 2EKYA 3BPSP 5D0HA 5C7PA 1SJFA 4OYBA 1ZM2A 4YS2A 2YKAA 3Q8PB 2JWNA 4ZJLA 2HHQA 1YG0A 4JI7J 2EK6A 2GVDA 2AJQA 2L9WA 4JYAF 2UU9F 3KFWX 5DS7A 4B9UA 5KFOA 3GILA 3VGVA 1C0UA 1UJ6A 1TKTB 2CNKB 1SB6A 2XSJB 2CYYA 5GAEU 3DI6B 2HAIA 3LGNA 1Y5LB 3MZIA 1WF2A 3US5A 5KG4A 4NLUA 1B4SA 3U1LA 5KFRA 2PMZD 4IG3A 4ECYA 2YKNA 2E7WA 2UUAF 2K06A 2DITA 2GMJA 4J37A 3UNGC 2DB1A 3VAHA 3HD2A 5A8RA 3UFCX 3JYTA 2X1AA 3D68A 4I7FA 1Y11A 4Y2AA 1HMVB 4RW6A 2QSWA 3WZ0A 3CO9A 1DBDA 1ZA2B 2XB2D 4ZP6A 3DU6A 4IYQA 1Y3JA 3MD3A 3M30A 2V2QA 3IWNC 1MG7A 1PC4A 1VQYA 1NSQA 4KQZA 4NXNJ 2ZC3A 1FVQA 2GFFA 3W5ZA 5L9XA 2JL9A 1FK9A 1KVIA 1RU1A 5FLXY 1DARA 1U1QA 1H0HB 4FDFA 3TAQA 5J2PB 2HKEA 2QMWA 3FDSA 2UV8G 1JJ2R 1XTZA 3EXYA 4OJHA 2CQCA 3MM9A 4HYKA 4HLBA 4OYOA 2CQHA 2RKIB 4ZHRB 3FFIB 1SVDA 1TL7A 3BGRA 3BQ0A 4PUOB 1RTJB 3KG1A 2NZ4A 4RBUA 2FY8A 2J76E 4OYXA 2CQGA 3FQLA 3CCES 2MKIA 1QJHA 3JAMY 4IFVA 3BO4A 3D54A 3WIUA 7FD1A 2BABA 2HS3A 4G65A 2H5IB 3R97A 3TQ1A 2R9LA 4B9VA 2QC3A 2R7SA 3H4BA 3K8VA 1DLOA 1UA1A 2R7OA 1X0FA 3W8GA 4KB7A 2ILZA 4LBPA 4EEYA 4RUCA 2BACA 1QE1B 3GU0A 2WW4A 4BBYA 2VJUA 2JFDA 3BSOA 3KWMA 2VICA 4N41A 3CO0P 4FVMA 4WCEQ 2DBBA 2KFYA 3K5LA 5I3UB 2XGPA 4UT4A 3CUNA 1CC8A 4NLRA 3MAAA 5LOQA 4QWBA 4LVOP 1N6QB 1OY9A 2KT5A 4F4XA 2ZBCA 5J2QA 1Q8LA 5HVFA 5KT3A 4QZVB 2N82B 1MWQA 2MLZA 5I3QA 5IM0A 3UD3P 5J1EA 3LO3A 2FZGB 4K4UA 3R7BB 1TU0B 3R5AA 3GFZA 4WYLA 4X64J 3R3TA 1C1CA 2KZMA 2JLGA 5DG9A 5E0OA 4ZDNA 4PG6A 3RAMA 1VBZA 3D5MA 2HURA 2MKHA 1KN6A 2NQPA 3ZZYA 5CYQA 5HO4A 2AHOB 2HWTA 3ETOA 3OFHA 2VPYB 3B82A 3GMGA 4UUXA 1CPZA 1KQFB 1WHXA 3JQKA 3PACA 2EFPA 2P9EA 2VBXA 4HEA9 3W65A 4JI2F 3MPWA 1SIWB 1ELOA 2L9DA 1MMLA 3MFIA 1RA6A 5LM7E 1U2CA 5ETTA 1T3OA 4RW7A 4KO0A 4EI2A 1VC5A 1YITS 1QVFR 1MN7A 2F9JA 2X1GA 2VA3A 3T6BA 2YQ0A 4DR1F 4U8YA 3CJSA 2CKWA 1F1BB 2OUGA 2K3KA 1YKWA 4I67A 1CVJA 5B08A 4K4ZA 3PKMA 1CS4B 2PD1A 3KK1A 5T7LB 5LMNF 4MKYA 1AFIA 1OS5A 3QT8A 5HROA 5KFSA 1E6YB 4H4KA 2AJ1A 4YEAA 3DOMB 5B0AA 1MWYA 2DRDA 2NPIA 2RQMA 3SDEB 1GAOA 3VTIA 1JLQB 4V1Ak 4DR4J 3CCQS 1WI6A 2GJ2A 1HARA 3VGUA 4C9DA 4K8RA 3T9NA 1YK9A 4DV4J 2E5HA 2H5JB 3HSGA 4CLFA 1RTHA 4DR6F 2UXDJ 1MU2A 2GIFA 4AFFA 1TV6A 2FLPA 1OJ4A 1WKKA 4I56A 4NA2A 3DLEB 1VC6A 4M5LA 5GAGI 2B5JB 3AB4B 3OD2A 2F63A 1W2IA 3T19A 2YTCA 2ATCB 1CJTA 2RRAA 2C2MB 2U1AA 4WTOB 3HHLA 2XYHB 2QYGA 4U7UD 1TKXB 5AXMA 3M32A 2YNFA 3GQCA 4RLEA 4BDPA 3A3PB 4C4WA 1HBUB 1QAJA 5AT1B 1QSSA 3M8QB 4H4KC 2LLZA 3KNGA 1M5HA 3QMQA 5D0GA 4ITSA 1RTIB 2XBPA 3V4IB 3HT3A 4DF8A 1WSVA 1X4HA 1QTNB 4F8RA 4CZCA 4OIXA 1JXLA 4OI4A 3TW0A 3S7RA 1YJTA 4ED7A 1FA0A 2W2OP 1TQLA 4G3IA 2AGPA 1CQNA 1ICEB 2ZZTA 2G13A 1JIHA 1HQEA 4H54A 3O8WA 5CA5A 4NI2A 2VFRA 2GC8A 4NYZA 4RUBA 3TJAA 5F8JA 3HXMA 2AJ0A 2FHOB 3V6KA 1RT1A 2K2PA 3HHLC 3GV5B 4YHHJ 1S59A 4ID8A 3PCOB 4LRFA 3W66A 1JWWA 2CPFA 2Q6CA 4B02A 3FBCA 4IG0B 3SCKE 1R31A 4QPXA 2EC2A 3MEDB 3JTPA 3GJSB 3N9UC 4CO5A 2W25A 1R0BG 2JX2A 1VC0A 3CJ5A 1FD8A 2HNDA 2UUCF 3ZZUA 3RB6A 3OUYA 2R7WA 3C2PA 2WZ1A 4S0MA 3PM9A 4DV3F 5LT5A 4NLTA 1I94F 3TUJC 1VLOA 4F04B 2G2ZA 4AYBD 2AV5A 1JXEA 5HAOA 2DY9A 1NJYA 2I5JA 4C8ZA 2CJAA 3O1LA 4K0KJ 2GVZA 2HNYA 3BM7A 4KE5A 5ETVA 4ICLA 2YWHA 4PG8A 1ACMB 2CJYB 2IVYA 1NJXA 4DX8H 3RG6A 3IFEA 2LDIA 4CLSA 5ETNA 5CQGA 1U0HA 1T9WA 4E0DA 2RSQA 4YR0A 4ZJQA 3PY8A 3VALA 4OI2A 2ZZNA 4DFJA 4CTAB 5C42B 1HYSB 2WONB 2F40A 1S6PA 3SSQA 2P9CA 3DDNA 5HJYA 2JLFA 1XMBA 2CG8A 3DOKA 3CDAA 5KT5A 2DNRA 4MFBA 2C2EA 3C3LA 1WC4A 3TR5A 1JLCB 4JI5J 4CLZA 3MDFA 2NPFA 1YWXA 2M52A 4X84A 4O44B 4Y3CA 2KYZA 1T05A 4NLXA 3UDCA 1BE4A 2GHWA 4P2MA 1FJGJ 2HLTA 2HWHA 1IQZA 4CO4A 4GKJJ 4WYWA 5D0EA 5B0CA 1J5EJ 4I69A 1TKDA 4Y2IA 5DG7A 5FDLB 3OR1B 5D0RA 1ZTWA 1NHKL 5EWFA 2HNZA 2MPUA 3PYEA 2CQ3A 5BXIA 3MOZA 5IWAF 5DLGA 2BANA 3HVTA 3CCLS 1FWPA 4CCHA 3DRPA 2MKSA 2RVJA 3OTDA 1PO6A 4G1PA 3RB4A 3NGUA 4DCPB 2M0GB 8RUCA 1CBKA 2VQEF 3M2RB 3T5JA 3W60A 5L1JA 2OJ3A 3R9LA 1JLGA 2DO4A 3AAWB 3HI9A 5BJRA 5B0GA 1SIZA 4CP5A 3AHPA 1FXDA 4Y2CA 2YNIA 3CWJA 3UCGA 1ZZFA 1HPZB 1O51A 2B4PA 2Z2MA 1SQEA 3SCIE 4GC6A 2J8AA 1LW2B 3TX8A 4FP9A 1H7XA 2DR5A 2VDHA 4AQYF 3G82A 4P6QA 2ZVSA 3UD5A 4USJC 1HQUA 3H59A 5D4OA 5B0EA 3CW2C 3OTEA 2A2CA 3AT1B 1UVMA 2DTJA 4DR3J 4C6AA 1YJNS 3MM8B 1VISA 4CLUA 1S12A 3QT7A 4NXMF 2VG7A 4NMXA 1Q8KA 4NWBA 1H98A 4ZP8A 1T9YA 3CD0A 2VD3A 4WU2A 1D0EA 3LQVA 1WNEA 2EKNA 2AIRB 2XEXA 2PMWA 2XCPA 3Q8RB 1RAIB 4M5NA 2J9DA 1WDDA 2Q66A 3PV8A 1AB8A 4O3QA 5JXSA 3GCWP 3JQJA 5ADZA 2I6WA 1XNQJ 1O6XA 3IG1A 1K44A 4PXCA 3BR9A 2MY8A 2KRBA 2NSCA 2LVWA 5HVGA 4GKKJ 3S8SA 3M8ZA 5GAGU 2DCLA 3A3OB 2XMJA 2C42A 1KOOA 1BQMA 3I5AA 1Z2ZA 4B3SF 3S1TA 5AJ3F 2FJWA 4XO0A 3KLEA 1U26A 2HMIB 3G71S 2YNGA 3CC4S 3EVWA 4NA3A 4N7TA 1FKAF 4PQUA 1J2VA 2QL9B 2VC1A 1UA0A 1R0AA 2MZ1A 2E5LJ 1F0XA 1SXLA 1X31C 2FJEB 4D3HA 2YVSA 1VK3A 3GG0A 4F36A 4C3KA 2LEPA 2C3OA 1AZSA 1B0VA 2PIIA 1KHWA 1NKBA 2AX0A 2LXFA 1R6VA 3I6PA 1N5TA 3HZEA 2ZBPA 3MECA 2RILA 1VQ5S 4FKYA 2V8PA 1IVZA 2OKQA 1X5PA 4QYRA 1V6HA 4R8UB 5K14B 3IXQA 1T94A 2WTFA 1KLMA 3QWPA 3ENVA 2KVQE 1TUWA 1U4BA 4LSZB 3VCDA 3G87A 2EK1A 3CCJS 2BJ8A 2OFHX 3ZZRA 2MQ8A 2DNHA 2OD6A 4TU7A 1HBNA 3W1YC 1KEKA 3ENAA 3BH7B 2DXEA 2VC0A 4DSEA 2LEAA 1EX8A 1RT7B 3GJQB 3DYAB 2NSBA 1VQMS 4OYZA 4CH7A 1RHJB 1V3ZA 2B9WA 3UDLA 2Y1JA 4A8OA 2HFVA 1HNXF 4ZVGA 1NK5A 3AJDA 3C6UB 3HP6A 1AROP 4FPIA 3G6XA 4ECXA 2DGVA 3MR6A 4PXBA 4MKVA 2RQ4A 4LFAF 3TAMB 3R7SB
chains in the Genus database with same CATH topology
4OHWA 1S6PB 3NP5A 5DDQC 4EFAC 4WKYA 1T7PA 1AFJA 2AW0A 2OPQB 1VQSA 3O6QA 3HX9A 3I82A 1REVA 2VV5A 3H4DA 1FTRA 2XMMA 4LJMA 4DV4F 4NLYA 2FJXA 2IFXA 4CQ1A 4QU6A 1N88A 1X4AA 5L1LA 2JSXA 4C11A 1M0SA 3NAIA 1QM9A 4FNIA 3NBPB 1S1UA 2MKKA 3U1NA 2BZ2A 2IRXA 4ZPVR 4OI1A 1T8EA 4EZ9A 1K1SA 4LF6F 3Q2TC 3PJWA 3THPA 1MROA 2DGXA 2X51A 3LAMA 5HP1B 4OL8A 4Q8FA 2L9NA 1IN0A 1NU4A 2COLA 4N8NA 1H38A 1GTHA 3OPKA 3DFEA 3J7A1 3M1VA 2CJQA 4NMLA 4ES2A 5E33A 2CJBA 4X4PA 2LECA 3X1LB 4ZPDA 2XHWA 4LSNB 3OLAA 4MJKA 2ADBA 1HI0P 2UXBF 2ZH2A 3CIMA 4HL9A 5LSRA 5C24A 2QRRA 1T05B 2GHVC 1OO0B 2V4JA 1LXNA 2D41A 5KG1A 3RR7A 2L3MA 1S0OA 3CDUA 4C8YA 1IM4A 1Z4UA 4ZVEA 4IDKB 5EGYA 3CEDA 2KDOA 1F9FA 4OV1A 1WTBA 3VQSA 1P27B 2Y1IA 5A8WB 2B51A 3CD5A 2YKOA 1SL1A 1QUPA 1GTEA 1Y4ZB 2BJEA 4JBCA 4B3OA 1RT5B 2HGMA 1HI8A 3TAPA 4N5SA 2VH7A 3K2YA 4OX7A 2D9OA 2NREA 1NK9A 3CULA 2D9PA 3Q8SB 1A6LA 2YWKA 4JI1F 3A8EA 1BLUA 1WG5A 3SEOA 1M5KC 1U09A 1TP7A 3VAMA 1HW8A 3GV7B 4K50A 1R27B 1L3VA 4X4OA 3TANA 3CCWA 3QLHB 3I31A 1NJZA 4J9RA 2X1FA 2OO4A 1S9EB 2HNZB 3OQ2A 4IFYB 6FD1A 5E5NA 2DGOA 1UAWA 4GO7X 4W92B 2EFQA 3GIIA 2BQRA 1JNRB 4LF8F 2BUNA 3OFFA 1MWZA 3HHEA 3M2VB 2MGZA 3UR0A 2ACYA 1TL3A 4KT0C 3V6HA 1X0PA 4RW9B 3PZPA 3CCTA 2PA3A 4I68A 4RW4B 1NK8A 2PT0A 4R5PB 1HI1A 4NLDA 4HDHA 3THVA 1FVSA 1DHMA 4K4TA 1VRUA 5A8KA 1RYRA 2VOPA 2VG5A 4FPRA 1LWFA 2QEXS 3TRGA 3H2UB 3DRPB 3PR5B 1GX6A 6FDRA 2AGQA 2J7UA 4FF2A 2DH8A 2J7KA 1DZ5A 4A8WA 2MHEA 4A8XA 5D3GA 4JOUA 2L41A 1VQ9S 3CDBA 4A4JA 3C6UA 4URGA 4I6AA 4DV7F 4I2QA 1TK0A 2FVRA 4ELTA 4FNHA 2WOMB 4QU7A 5HBMB 4KHRA 4Y2KA 1RP5A 3O2IA 1VQ7S 3K7RA 1RT4B 4Y6IA 5DQIA 1OSCA 2IBKA 2V8VA 3IGNA 5AE1A 3V6DA 1FKOA 3ISNC 1N54B 2XY6A 1U49A 1Y5NB 4QIGA 4F3OA 4NCBA 2DISA 1JLGB 5EN1A 1HNIB 2QO3A 3KLGA 5CZVA 4B17A 4NRTA 4F4WA 1X8DA 2CVEA 2ROPA 4DPOA 2DNNA 2ZKUA 4X4TA 3VQTA 1VMBA 3FRZA 1N56A 1G1XA 2VBZA 4WK1A 2EBEA 2BDPA 2B9YA 1MMNA 2FVCA 5JVHQ 1Q79A 3J80Y 1RA7A 1TFWA 2YNIB 2AWZA 4G1QB 1OPIA 1R8CA 1KONA 1WEZA 5IZHA 1U45A 4KIAA 5DQHA 1N8RT 4C8OA 1FT8A 2OPQA 2MXYA 1KQSR 3PEHA 3EPIA 1DQ8A 1TVRB 1WACA 2POKA 3QAEA 5A6PA 4HI2A 2SXLA 3BDEA 1TK5A 3IAM9 2XSJA 2CPIA 1YSJA 3NG8A 1WTFA 1X4GA 4KV8A 4TY8B 4U7UK 2V9WA 4ZOSA 3DI6A 2HHUA 4QOTA 2QE5A 2VUGA 4LF9F 2JVOA 1FRKA 1UKUA 5DQGA 4K4VA 1IR0A 3M2UB 2F9DA 2KVIA 3X3UA 4TQRA 1Y0HA 2XSFA 5KFBA 1FTCA 4QR2A 4ED6A 5KOWA 2Q79A 4YHHF 3W2VA 2E9TA 2BQ3A 2WW8A 2OPPB 2OPSA 3CT9A 3FEYB 1Q78A 2GX8A 4RKUC 5HQ8A 1VBYA 5KG2A 1HQUB 2C3UA 1S97A 1SL2A 1N36F 1CC7A 2DPIA 1MNEA 1YRTA 3DU5A 4DN9A 3NCPA 5DDPC 4ZMMA 4K4YA 3I4HX 3RRKA 3T5HA 1F2GA 3HK2A 3H40A 2QA1A 3GWCA 2JDJA 1ZM3A 2HPUA 2KJVA 2LQ5A 1TR0A 2YWGA 4NA1A 4OJGA 4IH6A 3HLUA 4ECRA 3D0IE 4JV2A 4DG1A 4C8NA 3SV4A 3T9ZA 3F44A 1S6OA 2CQPA 2OD4A 5JJBA 2RH3A 5A8WA 1MSWD 4RNOA 1FXLA 3CJ2A 1S0VA 2R7RA 3GIKA 3HKZD 2UUBF 2VB6A 3I5BA 1S76D 1MW7A 2VG7B 3DLJA 3SZ2A 4HHJA 3I5CA 1H2TZ 2R8GA 2O3DA 1VRTB 3PHEA 2VASA 3K5NA 1BD6A 3T1HF 1YJWS 4QYZJ 1ZH5A 1NZAA 2QA2A 2W4CA 4K59A 4USIA 1X5SA 5CD4H 2CPEA 2M8HA 5D4PA 1B0PA 2CJ9A 4F2RA 1N0VC 3UWTA 4NPOA 2KO1A 4K4XA 2JVRA 3F41A 3PW4A 1DQ9A 4DR5F 2OAUA 2OFGX 4B9MA 2IRUA 1HBOB 3DRSB 2DGWA 1NH8A 2LXIA 3OSPA 3GYXB 2CPJA 2CDQA 5IS2A 2ZHOA 3M2VA 3A1YG 3HMJG 3J81Y 4NX9A 2QA4S 1X9WA 2UVWA 4OZNA 2ZE2A 4OLOA 4PWDB 5DDRC 1N5VA 2M8DB 2DNKA 4FF1A 4R5PA 3MR2A 3LP2A 2NXUA 2BM0A 2W4PA 2HHPA 2YX4A 1S7HA 4ZS6A 4O3RA 2KH9A 4JI6F 2IJFA 2M7SA 2ZBIA 3G6ES 5D4LA 3SQGA 2RE1A 2GHPA 3QGHA 3G6YA 2CPDA 4I1TA 3I96A 4OZ0A 1KRPA 2KRRA 1VI7A 2V8HA 2M9KA 3JSBA 1UVKA 4ZCLA 3Q24A 2Q43A 3ITHA 3UW1A 4K0KF 1UEVA 3H5UA 1TUVA 2CPZA 3IR7B 2UVUA 3PW2A 2BOPA 5E3QA 2XWXA 3UCZP 4TLQA 3UD4P 5D77A 3BREA 2J9EA 5HBMA 5J2PA 4OX6A 1SL0A 2W8LA 5KFEA 4F02A 3KNAA 2DR9A 1BQMB 3TUIC 2M2BA 2YNHA 5F8GA 3VR1A 4BC9A 1Z1ZA 1Q8BA 2PA8D 3THTA 3TVKA 2MY7A 4EYIB 2ZH3A 4RUHA 3CMES 2RS8A 3NMAA 3DN9A 3MM5B 5I3PA 5KFVA 3CCUS 1FJEB 1IKVA 1DTTB 1WD6A 2UZAA 1HHTP 1T03A 2W9BB 4D3GA 3VAIA 5F8MA 3SCJE 3KLEB 2FVPA 1TK8A 3E8OA 1C4CA 1Q8IA 2RKIA 4J9PA 1RTDA 5F3TA 2ZZMA 3M9MB 3ZZPA 4ECWA 1JLBA 3QJJA 4ZHRA 3FFIA 5KFGA 1U1MA 1YJVA 1KVJA 1HBMA 2EG1A 2YNGB 4IQMA 5HN0A 1IBKF 2XS2A 3DRRA 2YH1A 1X5TA 3Q0AA 4G1QA 3PX0A 3TO8A 5GADU 1ROFA 1UFWA 2G4BA 2YX7A 2MJNA 2O1PA 2DR8A 1YTYA 3D1QA 4OHXA 4IOAQ 1R0AB 1A9NB 1SBRA 2CVIA 4OHVA 2UUWA 3OL9A 3MUTP 1URRA 1K73T 1OQ6A 4B9NA 4OHYA 1RI7A 4TY8A 5DETA 2WBMA 1QVGR 1C0TA 2IA6A 2QIFA 4LVNP 4RW8B 2IYIA 4LT6A 1LFPA 3H2LA 1PGZA 4FS1A 3RAQA 3FSIA 1S1XB 2DK2A 2KU7A 1SJ3P 4LIWA 1ZETA 3P6YC 1X5OA 3OTBA 5KFDA 2XLIA 2CQ1A 3GFHA 1ZM4A 3MUVP 2XS5A 2ZJPQ 1Q86T 4QR0A 2E1AA 2M3DA 4J5OA 4A8FA 3T1AA 2W7PA 1HD0A 3QO9B 4NLGA 2WB4A 5F8HA 4LFCF 3QZ8A 2LA4A 1QAXA 2P6TA