4TU7A

Structure of u2af65 d231v variant with bru5 dna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHVYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
total genus 44
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tu7A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tu7A02
3UCGA 1VC0A 2CPFA 2MSTA 2DIUA 2HZCA 1WWHA 2NZ4A 1YI2S 3CMES 1YWXA 2YKAA 2MB0B 2DGTA 2LQ5A 2MJNA 5DDRC 1WF2A 2N3LA 3S6EA 3G9CA 2Q79A 1JJHA 2LEAA 1U1OA 3NS5A 1NU4A 3Q2SC 3CCES 3HI9A 2M9KA 2A3JA 4CQ1A 2YH1A 3U1LA 3MI7X 5EN1A 1XN9A 2RS2A 3SDEA 2LEBA 1VQ6S 1JMTA 3THPA 2AYEA 1DBDA 3R27A 3G96A 2DK2A 4FXWA 1H2VZ 4QU6A 4ZKAA 2RU3A 3S7RA 4ERDA 3CF5Q 1BY9A 2DNLA 2K8GA 1NJIT 3CULA 2BZ2A 2FY1A 2VONA 2DH8A 2DNPA 3VAFA 1K73T 5BJRA 1WF0A 2CPJA 2CPDA 4IOCQ 5IM0A 3CCLS 1WELA 1VQKS 3B4MA 4QU7A 3UWTA 2CQGA 2OIHA 2KYXA 2DGUA 2RUGA 2CQHA 2EVZA 2X1AA 1M5PC 2XNRA 1UFWA 2FC9A 5DM7Q 3BO3A 1KQSR 3EX7B 3BO4A 2MQNA 2CQDA 2ERRA 5DM6Q 2KG1A 2XNQA 5DDPC 5IFMA 2KXHA 2M88A 2DNNA 5GMKa 1SJ4P 3NNCA 3G4SS 2N82B 2M7SA 1HL6A 4PR6A 2MPUA 2M52A 3CPWR 2YWKA 3J7YU 3CXCR 2XS7A 3FEXB 2JVRA 3P49B 3R1HA 2DHSA 4F25A 3CCSS 2AYGA 2RS8A 1RK8A 4YUDA 2RQ4A 2DO4A 3Q2TC 3ZZYA 4W92B 5LXYA 3TYTA 2KRBA 1RKJA 3HHNB 3L3CA 2JX2A 2MXYA 3MD3A 1O0PA 3SDEB 4TU9A 2CQBA 1CVJA 3VF0B 3UCUP 4IO9Q 1X4BA 1WG1A 2GHPA 3MUMP 1M90T 3TP2A 2ZJQQ 5LJ5Y 2MY7A 1H6KX 1SJQA 2M70A 4Z2XA 2CQ0A 1K8AT 1FJCA 1P1TA 2U2FA 2DNHA 3G8SA 1X5TA 3UD4P 2CQ4A 4PKDB 3I56S 3U1MA 1KOOA 1Q86T 2X1FA 4CIOA 2G4BA 2X1BA 1U1RA 2DGSA 1N54B 2CQ1A 2F3JA 2RT3A 3SXLA 1A9NB 3CC4S 5IM0B 1YJWS 2UP1A 3S8SA 2MZSA 1SJ3P 3MUVP 1VBYA 1KC8T 2MHNA 1WEYA 4TLQA 2HGLA 1OWXA 3CCRS 3EGNA 2OSQA 3SMZA 3VAHA 1IQTA 2CPYA 2DNMA 1WTBA 2DHAA 3MURP 1VQ9S 4TU8A 1FO1A 2LECA 3ULHA 2MKIA 1K9MT 2DGVA 3B4DA 1PGZA 1X4FA 2X1GA 2EK6A 1HD1A 3PIPQ 3VAGA 1U1NA 3V4MA 1U1QA 2E5HA 2DNQA 1WHYA 2YH0A 2MZ1A 1Q82T 1F9FA 2MZTA 2XB2D 2RVJA 3G8TA 2PEHA 2LA4A 1WF1A 3H2UB 1X4AA 2JVOA 2MY8A 4Y00A 4A8XA 1WHVA 2NLWA 5LXRA 2VOOA 2O3DA 5CXTA 1HA1A 3OW2R 4J5OA 2N3OA 3NS6A 2LYVA 3CMAS 4WF9Q 2KH9A 1X0FA 2CPIA 5LJ3Y 2OTJS 1L3KA 2DITA 1X4HA 1WEXA 2OSRA 3VAKA 2FHOB 5CYJA 5MLCV 2MQLA 4EGLA 4WKRA 1FT8A 2J76E 1VQ4S 2CQPA 2KVIA 4IUFA 3THTA 1X5PA 1YJ9S 1YHQS 2LXIA 3G6ES 1N8RT 2MQQA 2OTLS 1W2BR 4ED5A 4LMZA 2ADCA 2RNEA 3VALA 2CJKA 2CPXA 1G2EA 1X4EA 1DZ5A 1P27B 5IQQA 2MZJA 1B7FA 4CH1A 3UCZP 2HGNA 1SJFA 3JB9k 2CQIA 1WHXA 2CPZA 3N9UC 2DNKA 1OPIA 2MQOA 2I38A 2I2YA 4WFBQ 3VAMA 1R8PA 4UQTA 1U1KA 1VQMS 2G1DA 1VBZA 2ZJRQ 2DH9A 4CH0S 2J0QD 5GAHU 4P6QA 3R1LA 1OIAA 2E44A 2E5GA 2MGZA 3IWNC 1Q7YT 1VQPS 4W90B 2JWNA 2RQCA 3P5TL 3P3DA 3US5A 2D9OA 1SJRA 2XS5A 1KOHA 2MMYA 2M8DB 2KFYA 2BOPA 2DHXA 2HGMA 1M5KC 2KRRA 2MKCA 5LSLA 1DRZA 5FJ4A 2CPEA 5CA5A 2DNRA 1KD1T 1X4DA 2ADBA 1FJ7A 4QQBA 2CQCA 2M8HA 1X5SA 2F9DA 3S01A 4WCEQ 2KU7A 2KM8C 4RU2A 3K0JA 2B0GA 2LXUA 2KN4A 4M5DB 2AYBA 1NO8A 2DGOA 1A7GE 1X4CA 3IRWP 2MKKA 2KM8B 1SXLA 4WFNQ 2WBRA 5GAGU 1H2TZ 1HD0A 1N88A 5GVQA 3I55S 3CD6S 1VC5A 3CC7S 3BEGB 1M5VC 1URNA 5H1SV 4UY8T 1U1MA 2JRSA 5HL7Q 3DXBA 2DHGA 2QA4S 1WI8A 2MKSA 1WEZA 5DDQC 2HVZA 2LCWA 1UW4A 3MUTP 3BO2A 1FHTA 1U6FA 5ITHA 1WG5A 2XS2A 1X4GA 3NMRA 2DNZA 1R8HA 2LKZA 3H2VE 5JVHQ 3MXHP 1UP1A 3BS9A 3MD1A 2MQPA 2LMIA 2F9JA 2DGQA 2OJ3A 2J0SD 2N7CA 1VQNS 2XSFA 3P6YC 2VOPA 1YITS 4FXVA 1JJ4A 1WI6A 1H2UX 2K3KA 4PRFA 2M0GB 2PE8A 2MJUA 2SXLA 3D2WA 1U6BA 3MDFA 3FEYB 2MGZB 1VBXA 2M4MA 2VODA 2U1AA 1ZZFA 3DLLQ 1ZH5A 1M5OC 2G0CA 2GO9A 1U2FA 5DETA 4U67Q 1VQ5S 4V19X 2MSSA 4OZ1A 2LA6A 4BS2A 4LJMA 2L08A 2E5IA 2DNYA 1D8ZA 2FPHX 2DB1A 4WIIA 4IOAQ 1QVFR 2AYMA 1AUDA 2E5JA 2MYFA 2M2BA 2HYIB 3UD3P 3RW7A 2MZQA 3ZZZA 2MKHA 2D9PA 2KG0A 1D9AA 1X5OA 3VAJA 4YB1P 3LPYA 2ZJPQ 4Y0FA 3CCUS 3J7ZT 1VQ7S 3CCVS 3LQVA 2DIVA 1S72S 1DHMA 4LIRA 1VQLS 3G71S 2KI2A 4TU7A 2KHCA 1YJNS 2CQ3A 1YIJS 2YTCA 5GAEU 4WFAQ 3CCJS 2J8AA 1N52B 2KXNB 2DO0A 1U1LA 4C7QA 2FC8A 2RRBA 3TO8A 1VC6A 2MZRA 2KT5A 5D77A 3PIOQ 2D3OR 2DH7A 1WG4A 3MOJB 2RRAA 1UAWA 3CC2S 2EK1A 2DGWA 3VAIA 1VQ8S 2L41A 1VQOS 3NNAA 1Q81T 2DNOA 1YTYA 1ZZNA 2KXFA 5D78A 4F02A 3EGZA 3CUNA 4YOEA 2DGXA 5LSOA 1FNXH 2QEXS 1S79A 4C0OC 2CPHA 3UE2A 1QVGR 2AD9A 1U1PA 2DNGA 3CCMS 2V94A 4C4WA 1QM9A 5GADU 3CCQS 5DDOC 4QPTA 2MQMA 4OZ0A 1M1KT 3NNHA 1OO0B 1WHWA 1FJEB 2DISA 2MKJA 3RW6A 1FXLA 2L9WA 5JVGQ 4F26A 2CQ2A 3CTRA 2QFJA 1JJ2R 5HO4A 1PO6A
chains in the Genus database with same CATH superfamily
2EPIA 2YKAA 2ZE2B 2DGTA 1TUVA 3CJ2A 3PFOA 3N5FA 2LEAA 1U1OA 4DQQA 2VDIA 1NU4A 5FLXY 3AD7C 2AJQA 5A0YA 1G1XA 5IOLA 3R27A 4QU6A 2RU3A 2YNFA 1N5VA 1BY9A 1EHWA 5L39A 4KO0B 3CULA 5DLFA 5EHHA 3W5YA 5AXLA 1FRHA 1F1BB 1VQKS 3HHKA 1NHKL 1XK8A 4RBUA 4H4MB 3HFZB 3DN9A 1N36J 1FRKA 1R31A 2DBBA 2XZTB 5DM7Q 3O44A 1KHVA 3J80Y 4I2PB 2EFPA 2LU1A 1MU2A 1T3OA 2MLXA 5DO2A 2DO4A 2VPWB 3RTVA 2J9CA 1HWUA 4CLPA 4DUYJ 2GHPA 3MUMP 5A6WA 1BE4A 4FKYA 1YDLA 2M70A 2CQ0A 5ETMA 4DPXA 2E1AA 2ZDPA 4NX9A 1KP6A 4TVAB 3PDNA 3BKUA 5K8OA 3NWRA 2GA7A 1CJTA 2ZH5A 1GK8A 4N76A 2CWXA 4ALZA 2MHEA 4TLQA 3BBFA 4ZK7M 2VC0A 4X65F 4F0HA 2DNMA 4M5MA 3MURP 3OTEA 1MW7A 3LP1A 5IV4A 2IAJB 2I0XA 2DGVA 3RB0A 2QMUB 1RXOB 2ZKTA 4OX9J 2Q6BA 2DNQA 2MZ1A 2KDOA 3IRXA 3SSQA 2YKPA 5LM7E 2LQBA 4DS4A 2NLWA 4FBTA 1FK9B 1RWOB 3SSRA 2BR0A 3MM5B 4DV7F 1HA1A 1HQUB 3NS6A 5F9NA 5LJ3Y 4DSIA 3SQGB 1CC7A 5CYJA 1N6QA 2DVIA 5IWAJ 3QSIA 1X5PA 5MAOA 2VA2A 1IBMF 2BKOA 5A8WA 2BE9B 4DV0J 3POTB 3T19A 2RDJA 2FVSA 5C7PA 5H9FK 3A3PB 4EZ6A 4ZOSA 2CPZA 3TX8A 3HVAA 2G2YA 3BN4A 3DC2A 5SUHA 3A8KA 2FJDB 1V3SA 2E9TA 2IRYA 4OYPA 4P6QA 2E5GA 2GAHC 1Q7YT 4J9SA 1KLNA 2ZHOA 1M5KC 4Z7YA 4PWWA 4ZLJA 2B51A 2F9DA 2E9RX 2KN4A 2NPFA 1OY6A 1RTJB 1HNZJ 1IUJA 5DJBA 5GAGU 3I55S 4PG6A 4GC7A 5H1SV 2HIYA 5JJBA 3KKFA 2GGPB 2FVPA 1WI8A 2HNZA 4B3RF 2HG4A 1U6FA 2LKZA 1KFDA 4QR1A 3ENAA 4IH6A 5BYSA 1U6ZA 3CCTA 2JZ5A 4HH0A 3TI0A 2F9JA 1VQSA 4FYDA 2HVHA 3BSNA 2K3KA 5F41A 4DV3F 4NLDA 2DR9A 1RT4B 5D15A 4RBTA 1G7CB 4RKUC 3M8QA 4OJHA 1V6HA 3W9HA 1VK3A 4J7CA 4BS2A 4J9VA 1K44A 4DUYF 5E3AA 1O8BA 5J2QA 4DSJA 5J2NA 2CA9A 1SB6A 3RW7A 3ZZZA 2DXDA 2X7IA 1WNEA 5J2PB 1X5OA 2OPPA 3LPYA 4DFKA 5J1EB 2UU9F 1D09B 3OVSA 5CCMA 1N33J 4MH8A 4WU2A 1HNIA 2CQ3A 1M5SA 4C0BA 3R5JB 4DZ6A 3V81B 3OVBA 1IR1A 1YRXA 1JLEB 1VC6A 3KUGA 3G82B 2XEXA 4F7VA 2IM1A 3LP0B 4O23A 4HACB 1TL1A 1NRKA 3BM7A 1REVB 3TAMA 3LA0A 4PG5A 2DCLA 3JSBA 1TL3B 1O51A 1P6TA 1HI8A 3QJJA 2AP6A 4U96A 3D1QA 3HDSA 4F2RA 1VQYA 2NCKL 4ZN3A 4CYUB 4NRUA 1IQZA 1MWZA 5GADU 3M6UA 3JYTA 1RHMB 3FEZA 4KHRA 1HBUA 2CQ2A 4DV0F 2CDRB 4ICLA 2NZ4A 2XSJB 4PUOB 2XMKA 4EO8A 3CCES 3HZEA 3ETMA 3AQPA 2ASLA 3CGIA 3D0GE 3K17A 1SC6A 2DNLA 4ECWA 4DR3F 1ZBTA 1JK9B 4ANEA 3CB4A 2RUGA 2QYCA 4B9NA 3R7NB 4ZS6A 2HVEA 2HBQB 4OI6A 4Q43A 1NAQA 2KL8A 2KG1A 5J2MB 3G6VA 3SCKE 2LDYA 2M7SA 5F3TA 1URRA 3FEXB 1NK0A 1SQGA 3Q23A 3MPYA 3FZ2A 1RK8A 3WC0A 1RLCL 3QWPA 4ED1A 5KG4A 3AJ2A 2HK2A 4QYRA 3LGNA 3BYRA 1CJKA 4NA2A 1TK0A 1TL4A 3IR7B 2HS0A 4B9VA 1S9GB 1U0HA 1K8AT 4IRCA 2K7KA 2HWHA 4DV1J 4NL5A 3KLEB 1WSRA 4Y2AA 2WVFA 1NPKA 1A9NB 4YB5A 2AIRB 1Y5IB 4LREA 1HWKA 3TQ1A 1AZSB 4RW7A 1HWIA 1U2CA 2V2QA 3HHEA 4CLLA 3HD2A 4KGKA 1TMMA 1UL3A 3GWCA 3MR7A 4Y2KA 5E3QA 3HKWA 4KGMA 4A8WA 1IKYA 3LANA 4UOFA 1Y5NB 2FDNA 3M8WA 2R7XA 2RVJA 4JV2A 3H2UB 1FF2A 4DOZA 2EG1A 1BQMB 2ROGA 1NSKL 3BGRB 1CBKA 1RI7A 2YX7A 3R6LB 2AKWB 3HHLC 2ZWOA 2HAIA 4WKRA 2YXLA 1SIWB 1FEHA 3G6ES 1N8RT 3MZIA 3BQ1A 1NSQA 1OJ4A 3K8WA 5L46A 1HYSB 2HGNA 3ZZOA 4JI5F 4BHQA 2MQOA 4C0HA 2VPXB 2V4JA 1FE4A 4QW9A 4L76A 1VBZA 2AMCB 4WP3A 1QLNA 3FMWA 4WZMA 4MK7A 3VZHA 4RW4B 3CCZA 1N32J 1OPZA 2OPSB 3ZC4A 3JAMU 2GIQA 3KHLA 2RQMA 3CO0P 4HI2A 4LUBA 2ZNZA 2LXUA 4M5DB 4QIFA 1NJYA 4GVBA 3TANA 4ES3A 1Q8IA 1H2TZ 4FS2A 3UN2A 2EKYA 4UY8T 4DV6J 3CCWA 3DXBA 1B4SA 2VIHA 1RTDB 2G2ZA 3HFVA 3HSDA 4UF4A 3TVKA 5KFYA 3D66A 4K5SA 4USHA 3P6YC 3ET6A 4PG7A 4A8MP 3M30A 1XJWB 2UVUA 3U7JA 4WTOB 3AJ1A 1U6BA 4ANCA 3DLLQ 4Y6IA 4ID5A 4E98A 4IDKB 4WYLA 1U2FA 4IFYA 4X62F 5C2GA 4DR6J 1Q1KA 2V8GA 2R8IA 5I3PA 4IOAQ 3OR2A 2CZ9A 3UD3P 4IOBA 7FDRA 3LWLA 4LBIA 1FEEA 3OVAA 2QIFA 4DV1F 3PY8A 1LV5A 4G1QA 3OHBA 5HATA 4WP8A 4NI2B 5KFPA 1E6VA 4X4TA 2EBEA 5KFTA 1XEZA 1MROA 3KTQA 4X4OA 3MMCA 4G65A 1WOOA 4DPOA 2EC2A 1CJUB 4LR9A 2APOA 2BXJA 2G0JA 3PJWA 2OUGA 1D8YA 4KFBA 3H25A 1YTYA 1Q4RA 5D78A 1LKZA 3KMSA 3VWSA 1R0BG 1T8EA 4WYWA 3KLGA 3UE2A 3O5TB 1QSLA 3DHWC 4C48A 2FQQB 1UFLA 3CJ3A 3D3BJ 1LOUA 1I6JA 1UETA 4HKQA 5HO4A 1QE1B 3UCGA 3OR1B 1SVDA 3ZFVA 4CM2A 1RT2A 2N3LA 3UN5A 4OMFG 5ETKA 1M0SA 1P9QC 2NPIA 4KV8A 3SDEA 4CT8A 2POKA 1UKUA 2AYEA 3HULA 3G96A 3VR1A 4DSKA 2OMOA 4OYWA 1LWEA 3BZQA 1R43A 3KXDA 1X31C 3GFXA 2B8QA 1LWCB 3GJSB 1DARA 2VQFJ 3T1HF 5KFGA 1GMUA 2CPJA 2R8HA 1RWNB 1X0PA 3CVKA 2H1YA 4G1PA 2KYXA 4IRDA 4RWXA 4CDIA 2GQQA 4A8YA 2XNRA 1YJTA 3G6YA 1HWJA 3THVA 1RWUA 3QO9B 3OSNA 4DV6F 5DM6Q 4V1Ak 4LF1A 2ASYA 2EXUA 1H98A 3CXCR 4X4SA 3TUZC 1ZAXA 3N6NA 2IC3A 5LSRA 3E01A 3MPVA 2OPQB 2R4FA 4A8OA 4IO9Q 2FD2A 1J5EF 2NSCA 1JNRB 1FJCA 1NH7A 3IWXA 2F7VA 3U1MA 1S1WA 3HHLA 1GX6A 1PYSB 3KK3A 1HNXF 5D3GA 4GMKA 1IWGA 4A8QA 1MN7A 4USTA 4X64F 2BJ9A 2BMBA 2RJZA 2YNIA 3LAMA 2V50A 2CPYA 1OSCA 2DCUB 1FO1A 2LECA 3ULHA 3ITHB 4LF8F 3FFIB 5G0RA 4PWDB 1PJ7A 4WK1A 5IS2A 1PBAA 1YJ7A 3EWGA 4U6PA 1KVKA 4ZJOA 2GX8A 3MAHA 3D1HA 1HW9A 4OJ1A 3AD9C 2CJQA 5HLFB 2P6SA 3M2VA 3B6BA 2DITA 1VS3A 1NXIA 1RTIB 4OHVA 4ZP9A 1FWPA 3THTA 4ATNA 3HHLD 3BGUA 3AY0A 4ED5A 5LOQA 1G4CA 2K1RB 3ISZA 2EBGA 3PRDA 3M1VB 2UXDJ 5KFUA 2CG8A 4C8MA 4DR7J 2BRLA 1R3NA 2ZJRQ 1S6QA 2MLZA 3ILLA 2ZUGA 1C0TA 3R1LA 1YZ6A 1E6YB 3GJQB 4MTPA 3OQ2A 1FJ7A 4FDFA 1X5SA 3K0JA 3MEEA 3OFEA 2MDAA 1GH8A 7FD1A 2KM8B 3N5BA 4WFNQ 3Q8YA 2C2MB 2FB0A 4YHHJ 4JI8F 3A1YG 2MKSA 3IM8A 3QJPA 1IR0A 4L73A 4I2QB 1NCLA 3CDAA 4FYXB 1VQNS 2QA1A 3RGIA 2CKWA 5AXKA 1L3SA 1TKXA 4DCPB 3TOQA 3PKYA 1FWKA 2W9BB 4IQXA 4NWBA 4X4NA 2U1AA 2BV3A 4ILLA 3FBCA 1SC1B 3EYZA 1CULA 2J5AA 3DRYA 4F3QA 3AODA 4B02A 3RYLA 2KJVA 4YDDB 4CLWA 4KKOA 4X66J 4Y0FA 3F0NA 2VG7B 2RH3A 5KT5A 3PXGa 3HFKA 1UVIA 2GV1A 1H38A 2JJ4D 4OYOA 4R5PB 1C1CB 2FGCA 4NLSA 3FQLA 4MMOA 4USIA 3BH7B 3TUJC 3JSRA 1PYOB 1ZM3A 2V67A 4OYBA 2RKIA 3ILOA 1ZS6A 2UV8G 1T0TV 2EWHA 5DDOC 2K3IA 5KFDA 3NNHA 4CTAB 5KT2A 1OO0B 1DQ8A 4L6V3 3G86A 3M8SA 2J6TA 3ILJA 3DLKB 3PJXA 4Y2IA 5CD4H 4K5RA 3DOLB 2JH3A 2GMJA 2HNYB 3FDSA 1X9SA 2M9KA 4YY3F 3MI7X 1SJ1A 1VQ6S 3KDNA 2BJ7A 3LOUA 4Q0BA 3G87A 3M6WA 2K8GA 2VONA 2XMVA 3NS7B 1K73T 3RUBL 4OZ3A 4UUWA 4GC6A 4I7FA 3HK2A 3UWTA 4ES2A 1BD6A 1TL7B 4J9KA 4OJGA 5LT5A 1UVMA 5L9XA 3GR1A 4H4OB 1QAXA 3Q8VA 1RABB 3C14A 2KXHA 5T41A 4MJKA 2AHOB 4PG4A 2XC9A 5E2QA 2OAUA 4M1KA 4KRWA 2YNGA 1LWXA 4W92B 2B9YA 4QWCA 4O3NA 2ZEJA 2MXYA 2HK3A 3QZ7A 1SV5B 4OX7A 5GMEA 3NAIA 4ZCMA 4ZITA 3H4DA 2JC1A 2ZUAA 4R8UA 1Q86T 2G4BA 4E2FB 3TA1A 2RT3A 3BREA 4A4JA 3ZZTA 4Q45A 1RAJA 2BKNA 4FNIA 2OSQA 2HBYB 1VQ9S 4ECZA 3IA0A 4F4YA 2QO3A 4NLQA 3B4DA 2DJWA 3IR5B 1U1NA 4AD6A 2BE2A 3BSAA 2WRMA 5B0BA 4ER8A 3R97A 4NZ7A 4FPIA 2JVOA 5F0UA 4M5NA 2OPRA 4LRDA 1EARA 2KO1A 2W4CA 1HQEA 1KONA 1T02A 3JAMY 3MM9A 2YWWA 1BC6A 2UUTA 3FSIA 2OSRA 3T1YJ 1VQ4S 4DLEA 2LXIA 3Q8RB 3PACA 1W2BR 1GXTA 2ZNYA 1SKUB 5IQQA 4DX5A 5HJYA 4WK3A 2BW2A 2DNKA 1HBNA 1NDPA 4KAIA 2O01C 4N77A 4AFFA 1MNEA 5LMNF 2FZGB 1D9FA 3US5A 3EICA 5JXSA 2KFYA 3I0RA 3QGPA 1DRZA 2FJVA 3QBCA 3N28A 3HSZA 5KOWA 3K5PA 1YJUA 5KG2A 2PDAA 2V63A 3RB4A 1XTZA 3FBBA 3AOAA 3AOBA 1LW0B 3H5UA 3IAM9 1URNA 4NXMJ 5KG1A 2R2SA 5BYQA 5DDQC 3NCPA 4MYTA 2XS2A 3CJ5A 3T41A 2GC8A 3W9JA 3DLHA 2YVSA 1UP1A 3W5XA 3KJVA 1YG0A 4B3SF 4ES1A 3PHEA 4NCBA 4OI2A 3OL7A 2AGPA 1ZH5A 4GO5X 3KLVA 1N34F 2PA3A 2PFDA 5DETA 1UW9A 4ZP8A 4S0MA 4WIIA 4TNOA 3L7PA 3BF4A 3CDWA 4YR2A 1Q79A 2KG0A 3DI6B 3H5SA 3HVTB 4PYAA 3CCUS 2DRAA 5C5JA 3CCVS 2G0IA 5E3RA 2DIVA 2NUUG 1YBUA 2N7YA 1C2PA 4QBUA 2KI2A 4IRKA 5B0CA 4HDGA 2KXNB 4FF4A 5D77A 3GG1A 4AL6A 3VAIA 4KHPJ 5J1PA 4CO1A 4KC5A 5BR8F 1T9YA 1JLGB 4CLYA 2R7OA 1ULRA 1SBRA 3DGPA 2AEFA 4JI7J 3BV8A 1UJ6A 5F8GA 1JXVA 3BSOA 4I0WA 1WKJA 3RAXA 2MQMA 3GG0A 4TKTA 4ZA1A 1FDAA 2ACMA 4UT4A 2Z2MA 3DYAA 3RW6A 1FXLA 4WXWA 5ETSA 4Y65A 4Z37A 2PEBA 4RW6B 4IG3A 4OHWA 1NK7A 2VJVA 4C6AA 4C11A 5E5NA 1S97A 1S0MA 4PPZA 1H3DA 5ADZA 4USKA 3OXFA 4DR4F 3LPEA 4J9PA 2BDPA 2BE7D 3U1LA 2HVDA 2YX1A 4DQPA 1XN9A 3QLHB 2C3UA 1T03A 2PT0A 5K8MA 1M1GA 4AYBD 1IM4A 4QOTA 4XPEA 2I5JA 4OYZA 2R42A 1Z2LA 2RUSA 1YKWA 2DH8A 1PSDA 4YN3B 4KPCA 2E7WA 2CQGA 2X1AA 2VFRA 4OI4A 1HHTP 2ZE2A 2FC9A 4LF2A 2ZHAA 1Z4UA 3BO3A 3CJSA 1XC9A 1VRUB 4BLGA 3W2VB 4K50A 2RAQA 3MMBB 4KIAA 1SJ4P 4D3GA 1Z2ZA 1VK8A 1HL6A 2MPUA 2M52A 4ZVOB 1X8DA 1IKWB 1DJ0A 2EFVA 3UDEA 4F25A 2W7OA 1T9XA 1J5OA 3R2DJ 2VC1A 2Q6CA 2JX2A 4Z7CA 1Y7PA 5EWEA 4ZLLA 2BYCA 4Q44A 4K4UA 2JDJA 4KH0B 5CH7B 4I4BA 3DM2A 4LVNP 2RDDA 4TQRA 3M8PB 2X1BA 2GVZA 1N5YA 4NEZA 1RHRB 1Q8KA 3DLEA 1Y10A 1GXUA 2HMIB 3EZ5A 4CRJA 1SJ3P 4I2PA 3JSMA 4J91A 1IBKJ 1F2HA 3RU0A 1OMSA 3SMZA 4DV4F 2YNHB 1HKAA 1FDBA 5IT9Y 2O66A 4N7TA 1X4FA 3UNGC 1KSPA 3PJ9A 4EEYA 4LRFA 4JI6F 1TP7A 3G8TA 1FJGF 2M5YA 2XYPB 2MY8A 1XNRJ 4KBIA 2L9DA 4Y00A 3AA9A 5K14B 5D4OA 3QPIA 4J5OA 3W63A 3QWUA 4KHPF 4EGLA 1FT8A 5C24B 1HARA 4Q5VA 3J7Z5 2UUWA 4ZVEA 1KDNA 2D74B 2UXCJ 2RNEA 1JJCB 1HW8A 3HT0A 1FKPB 2HNDB 1RTHB 3MR5A 2QSFA 4HDHA 4F0MA 4F8RA 3DRRA 2JSXA 4C8NA 4TXSA 3M2RB 2XYHB 3MECB 4MKYA 3IWNC 4W90B 3T9NA 2YX4A 1KTQA 2B4OA 4L75A 1S1VB 2HGMA 3SQGA 2CWKA 1N0UA 3EUNA 3GONA 5CA5A 2ADBA 4QQBA 2HWTA 3HSGA 3S01A 2XTJP 4ZVFA 3PEHA 3TWZA 1ZM2A 2AEJA 3POTA 2JLFA 5GAHI 2WBRA 1W2IA 3CD6S 1SKWA 4IYQA 3O6QA 2QSWA 4F67A 2D41A 2IDLA 1V5IB 2R8GA 5CQGA 3PX0A 2CZVC 1YQHA 3TJ9A 4N56A 1MG7A 2DNZA 3H2VE 3W2WA 2XMJA 5FD1A 2IRUA 2LEPA 4JB8B 2KKHA 3SV4A 2VODA 4LQ9A 3F41A 2JEIA 4Q7AA 1C0UA 2V9KA 1RT1A 3FSYA 2A6OA 2B5JB 5IC4B 2E5IA 4DBQA 2QT7A 1RYRA 3KG0A 1S77D 2CZ4A 3VAJA 5C25B 1FA0A 3FVYA 4P74A 1VQ7S 4QYZJ 2HHPA 4OV1A 4LFCJ 5EWFA 2ZH1A 1IBKF 1TVRB 1IXKA 1YIJS 2YPZA 4O4RA 2IHR1 2QE5A 3DOKA 3J7AN 2KT5A 1VHIA 2IA6A 4LSNA 4LFBJ 3QGHA 1Q53A 2A18A 3M9MB 2J6SA 4OYIA 1XR5A 2FIUA 3RG6A 1AB8A 5A8RA 5J1EA 2CNLB 3OL6A 1KS2A 3K5LA 2P5VA 5HI7A 2J7KA 3MM6B 3UPFA 4IR9A 3IBFB 3V81A 5E41A 5KFAA 1UWBA 2H48B 1S9EB 1JXLA 3NY0A 4GVLA 4HVZA 2MJNA 1NLKL 2HHWA 5E33A 4PQUB 2PGCA 2AJ4A 3BYPA 1KNZA 9RUBA 2HFVA 1JMTA 4BDPA 3OD2A 3PZPA 4ED2A 5A8KB 5E3CA 2A10A 3ETOA 3KLFB 2J8SA 3IMQJ 1WC6A 1VOMA 4JV1A 3MPDA 4DF8A 5B0EA 4AXJA 3ONQA 4QJVA 3AXMA 3KFWX 2BJDA 3LP2A 1HBOB 3PW4A 2B6AB 1XMBA 2XSJA 3KK1B 2C2OB 3AB2B 1RT6B 2N82B 4M5IA 3TQEA 3T5KA 3ADAC 4O4GB 4L3NA 2R7TA 3D28A 2WB4A 4RLEA 3IC1A 2AYGA 2OHDA 4PXEA 1FFGB 3L3CA 1S6PA 4P10A 4DFPA 4ZVSB 1QAIA 1X4BA 5A0YB 3HHDA 1AA1B 5F0WA 2YNFB 1RYSA 1KRPA 2KFNA 2ZVSA 4M95A 3L7OA 1GMWD 1YZ7A 1F60B 1U47A 1TK8A 3FKBA 3PYGA 1CSJA 3QT5A 5M2RA 3EGNA 4DEZA 3E8OA 3PW2A 3V6DA 1S0NA 3H0PA 4Q8EA 1HD1A 4UW2A 3PIPQ 2HS3A 2YH0A 2GJIA 1F9FA 3EGVA 2FYXA 2XB2D 1RAGB 4ENOA 1WHVA 1S6UA 4DPWA 2VOOA 3KLEA 5E0OA 3D54A 2N4DA 1NB7A 1RZMA 4IG0A 1X4HA 1VLOA 3VAKA 1NMEB 1JB0C 3FJ2A 4FF2A 3L09A 1AZSA 1YJ9S 3D68A 4WZQA 1R6VA 4LMZA 2DEJA 1CJTB 1LW2A 3SEOA 3P45B 5K8PA 3R5BA 3M2UB 3N0VA 1CC8A 3LF0A 3JB9k 2LU2A 2EEYA 1FTRA 4GO7X 2E1RA 4RJVA 1MMDA 4NCAA 4F3OA 3C46A 2F5GA 4ID8A 2Z56B 4UOCA 1Y11A 4DX6A 2BJ1A 3LP1B 4UZBA 2HKEA 1OIAA 4DV2F 1LXJA 3EVOA 4NCGB 5J1NA 1RWVB 3BGRA 3P3DA 2D9OA 1SJRA 2MMYA 3IRXB 4X4QA 1HR0F 2CPEA 1TK5A 1RE1B 1S4EA 4TYAA 1NK4A 3HP6A 2QFIA 1DTTA 3MMAB 2WAQD 2XM3A 1N6QB 1H73A 1N5TA 3CC7S 4DUZF 4Q2MA 4DL0C 5CYQA 2DHGA 2XY6A 1UW4A 1FHTA 4BWMA 2QA4G 3MM7A 2CNOB 4DN9A 4JV0A 3Q24A 2HRTA 1UEVA 1XIQA 3O1LA 1SH3A 4YP3A 1WI6A 1Q5YA 2DYAA 3SFUA 4O3SA 1NHUA 2K2PA 2DPIA 4CLUA 3MDFA 3W62A 4XTTA 5H9FJ 4FNHA 4I6AA 4RUCA 3OSPA 4U67Q 2KB2A 1APSA 1XNQJ 2L08A 4K4ZA 1GXLA 1KTVA 1REGX 3LALA 2C42A 1VBKA 1UTAA 4URSA 2LLZA 5HQLA 4GKJF 4L74A 1JLQA 2XG8A 4WE1A 4OJ3A 4B3OB 1WD6A 3L9ZA 1Q5VA 3G71S 4P2XA 2VG5A 3JTPA 3DKDA 4ZVUB 2IJRA 3QAUA 3C6TA 2ZHBA 2V6AA 2VV5A 1U1LA 3HM9A 2RRBA 4IDKA 1IKXA 4JI3F 4DCOB 2FJBB 3LW5C 4YB7A 5B0GA 3KK2A 5EWGA 5AE1A 1VQOS 3RAMA 1RLDA 1FXRA 3R8YA 2A2DA 2PMWA 1FVQA 1S6OA 1UJ5A 3M8QB 2A1BA 5IT4A 3BN7A 5GAEI 3M9NB 4RW8A 4XAKA 5IXUA 4N5SA 1NKCA 5KFXA 3ZXWA 2Y0BB 2B4PA 3CCMS 4ZVHA 5J2QB 3CE8A 4J9MA 4DFMA 2ZH8A 1AFIA 5J2NB 2Y1RI 1YGYA 2DISA 4CWBA 2ZD1A 4CM0A 4DPYA 3MCNA 2JOQA 2BJ3A 4OHXA 4DZDA 2D3ZA 4NLTA 1AROP 4A46A 2QLBB 1RHUB 2FHJD 3G9CA 1HNIB 2CJYB 3NRBA 1EETB 1AXQA 4CQ1A 4RNNA 3KLHA 1HMVB 1IBCB 3THPA 2UUBJ 1H2VZ 1TL1B 1MLAA 2PN6A 3TAMB 2H65B 5DLGA 3PR5B 4MIWA 2GIFA 3ZNJ1 4MKBA 4K4SA 1CQNA 3HXMA 3R5DA 4QU7A 3FCHA 2OIHA 3W9IA 1XMQJ 3GYNA 2XMWA 5DZ6A 2BANA 1KQSR 3MEGB 1SC4B 2CQDA 4KGVB 1C4CA 4IO1A 1HBUB 2B9EA 5KT3A 1SQEA 4PR6A 3ZTQA 3M9OB 2YWKA 4ICLB 2F4FA 2VL1A 3CD7A 4IQMA 2C1EB 2RS8A 4KQZA 3Q2TC 3ZZYA 2HHHF 2H4WB 3TYTA 3HHNB 2WK4A 3DRPA 2F4VF 1OQ6A 3MD3A 1QY7A 4V19J 2CQBA 2OELA 2NYHA 1UVKA 1B0TA 1GAOA 2C3OA 4U8YA 4IH5A 3CDUA 2VQEF 4AQYJ 4O3OA 3IXQA 3PRBA 3DLBA 4JV5F 4HHJA 1PBUA 3F44A 2IMOA 2F3JA 1TAQA 4OYAA 1VDHA 1CG2A 2HLTA 3PW7A 3MUVP 2QLWA 2UXBF 3VQSA 5CABA 1FVSA 1F3VA 2XWYA 3GILA 4ZPWR 4DPUA 3GJRB 4ZVQB 3GMGA 2IM3A 4DR1F 1HNWF 1LFWA 4A48A 5AE2A 4O0IA 1BLUA 4W4MA 3OUYA 4J37A 2PEHA 2LQ9A 1WF1A 3QAEA 3D6MB 2W2MP 4A8XA 3I0SA 3TAPA 4NLPA 2FHMA 4DR5J 3MGJA 4DL6A 2WW4A 1JKHA 3GSIA 2GFFA 1RAAB 3H2LA 3IG1A 4L3KA 1X0FA 2BVZA 1YJRA 4N41A 4WBFA 3MPUB 2CRLA 1FNMA 5B7WA 5AE3A 2MQQA 3PNIA 4DF4A 2QZ8A 5SZTA 1LQ9A 2AZ1A 1X7VA 4FF3A 1P27B 1R8BA 2MZJA 4XDDA 3PV8A 4X65J 4U9RA 3NCQA 4RW7B 1R8PA 3FBFA 3Q8SB 3IBWA 1HHSA 3MEKA 1XERA 2VBZA 1KOHA 1NK8A 4QWAA 4DV7J 1X4DA 2UUBF 1VLYA 2FLLA 5CCLA 4RU9A 3CWJA 2GNKA 1H74A 3H5YA 2RU9A 3GV5B 4F36A 2W4DA 3IRWP 3T5HA 1IBMJ 2UUCF 3AFGA 5GVQA 5F8NA 4ED7A 1FXDA 3M1VA 3UR3C 1ZTWA 1HQ2A 3GJTB 4RPFA 4LF5F 2QA4S 5D4LA 4LRAA 2HW3A 1WORA 2DR6A 3JS9A 1S0OA 3TZZA 3QJLA 3HLUA 2RDIA 1XQIA 3KOAA 1YSJA 3OFHA 4NA1A 2OMLA 3SSSA 3FGVA 1FTCA 1SL2A 3PR4A 1WC3A 4IR1A 4LQ3A 2QL9B 4KJIA 2LA6A 2FPHX 2B43A 2MYFA 4AQYF 3NGKA 4TLRA 1AW0A 1D9AA 2QYGA 3CJ4A 1EJ7L 2GJFA 3V6HA 4B3RJ 2AJ1A 3M6XA 3D1OA 5KT6A 2KZZA 1DHMA 3TA2A 2CJBA 1S7HA 1HBMA 2C2DA 4QIWD 2W9BA 1F2GA 2G2OA 1FRLA 1FERA 2RD5C 2RSQA 4B17A 3SV3A 2WTFA 4DV3J 1TV6A 3M30B 2EK1A 1VQ8S 2DNOA 3EMTA 1C1BA 3TNVA 4P7TA 4ID5B 4C2MA 2QEXS 5KFHA 5U47A 3VHQA 4DR5F 5HQMA 1N0VC 3EDRB 1JX4A 2FZCB 4LBPA 4LF4F 2C3PA 2ZKUA 3OR2B 2C2ZB 3VGSA 5M2PA 2UU9J 2VUGA 4F26A 4G1QB 3NP5A 4U95A 1E6VB 4R5PA 2E7VA 2ZITA 2DIUA 4F4KA 3O3LA 3MMCB 4JP8A 2YBVA 4OZJA 3GYXB 2Z57B 3I5AA 2A3JA 5HBMA 1PAEX 1H7XA 2HEKA 2FZKB 4KFBB 2JHEA 1B70B 4UUXA 2ZC3A 1S10A 2B4VA 2W9CA 5DQIA 1IBLJ 2WVDA 5BJRA 5KAKA 4FYYB 4FS1A 4MYUA 1MMNA 3KLGB 3DLKA 2DGUA 2V5HG 3FNNA 4CO5A 5I3UA 4ZPCA 1UFKA 4B9MA 1YRTA 2FVCA 2E29A 5I3QA 1K1SA 3FRYA 3DRXA 1CJVA 2NSBA 2QGFB 3J7YU 4NZ0A 1RT2B 1RT5A 4PXDA 4KV8B 3QIPA 2YQ3A 1O0PA 3SDEB 4TU9A 3W3SA 3K2YA 1CVJA 1RTZA 5KFBA 1Q7LB 2HFOA 2ZJQQ 4RBVA 1SJQA 5ETNA 5THWA 4ELUA 4DR3J 1TL7A 2CQ4A 5KFJA 2O67A 4J9NA 2CQ1A 3MR3A 1L3VA 2ZZNA 1BMQB 2DXFA 2WOMA 3K8VA 4DV5J 2FJXA 1Q0NA 3D4JA 1U48A 2E5LF 1F5AA 1C4AA 3DLGA 2ATLA 2EK6A 1ZTTA 4HH1A 9ATCB 1UEKA 2IC3B 3E01B 4RO0A 4OX8A 2WONA 3QFWA 1D0EA 4RL1A 3HT3A 3TUPA 4I6WA 1VRQC 4DWIA 3RBDA 1RAIB 2OI2A 4YR0A 4TQSA 1S1WB 4Q8FA 3NGTA 3FZBA 3KK3B 3UR0A 5D3GB 2IVFB 4CH1A 3UCZP 3GB0A 4P2FA 1JLCA 1NUEA 1KHWA 1RP5A 4MKAA 2AGQA 2YNIB 5FLXU 3KLIB 1VQMS 4BC9A 2G1DA 3OBIA 2GJ2A 2E44A 1NBEB 5G0RB 3MPWA 4QWDA 2F63A 2D7SA 4J9OA 2Z0GA 1CPZA 2QMXA 2KRRA 2MKCA 4O3PA 4ETXA 5FJ4A 4QIGA 3PO5A 4PABA 2P8IA 3AHPA 2CQCA 1NM2A 5IZHA 2F8HA 1ZM9A 3MCSA 2AYBA 3M2VB 2GVDA 4DSLA 2HQFA 1IBLF 3J80U 1T7PA 1EP4B 1I5OB 2FHKA 2C28A 1WEZA 4QWBA 4JI5J 3NOGA 1U4BA 1X4GA 4UZCA 1GNKA 2XHCA 5HN0A 1F5BA 3C16A 3NEKA 4I1TA 4NMLA 2LMIA 3AT1B 3S1TA 1S6QB 2HAFA 4OV6A 1C0TB 1FESA 1UJ4A 3OFFA 4E8UA 1U25A 2MLYA 3J81Y 3BSCA 4F4XA 3OJUA 1SH0A 1T3NA 2DR7A 1VR6A 3D7SB 4V19X 3MCMA 1F6TA 2CVIA 3D3CJ 2DNYA 4ZJLA 2AYMA 3NOCA 4KGXB 5D0HA 4XPCA 3UDLA 2ZJPQ 4ILMA 1CS4B 3TVZA 3LQVA 4JOUA 1FFSB 4LIRA 4NRTA 1S1UA 2YKMA 1QUPA 4DV5F 1S1XB 4XK8C 2AZ3A 5EDWA 4AL5A 3BR8A 1RHQB 2RIJA 1PJ5A 1TKXB 3CC2S 4JI2J 3CDEA 4NYOA 4LIWA 4X62J 4FF1A 1NSAA 2NXEA 2Z4PA 1CULB 2VASA 2GAGC 4JI1F 1RA7A 5I4MA 3CCQS 3M05A 4KKOB 4OHYA 3CTRA 2Y3YA 2OD4A 1WOSA 5A2QY 4ZHRA 2CIMA 2MSTA 1IVZA 4ZVRB 5F8HA 1T05A 3BB5A 4HEA9 1LNQA 1TU0B 4B3MF 2HIQA 2KT2A 3HI9A 5C42A 5DG9A 3IGNA 3CDBA 1PG5B 3UO0A 4K4TA 1RISA 1L3TA 4AUKA 2HVIA 4JUZA 1JLAA 1DTQA 2MQ8A 4ETZA 5L1JA 2V2ZA 3O2IA 5BYRA 2CPDA 4KTQA 4IOCQ 4FYVB 4CP5A 3PX4A 2YWGA 3D6FB 1I94F 2VH7A 2I8EA 3BO4A 2VA3A 1H0HB 3OFGA 1UVLA 2ERRA 4LSLA 1SQFA 2ZM6F 1CLFA 2OEMA 3QLHA 3G4SS 3R6GB 2FLOA 1SCJB 2YY3A 2RMLA 5LXYA 1U7LA 3QT8A 5HVGA 2AJ0A 4LF9F 5ETVA 3T1HJ 3WBZA 4G6VB 3I56S 4PKDB 3M8YA 4C8KA 2E66A 4PQAA 3H42A 1U1RA 2DGSA 4I7FB 5LMUF 3MMBA 1WC4A 1W26A 1J27A 1TMJA 3GYGA 1AT1B 1VIXA 4ED6A 3EVMA 1BWVA 1S48A 3C14B 5KFWA 3T1AA 2NREA 1R0CB 1JQGA 4DMZA 2WSEC 5KT4A 5KG6A 1XR7A 2YNGB 3MEDA 4A47A 1BHNA 3HX9A 1J5EJ 1ELOA 2GS8A 1NDKA 2AU0A 1Y3KA 4U8VA 5HSPA 2N3OA 1IKVA 2CVEA 4JI2F 2LYVA 4KR0B 5BXIA 1WSVA 2V34A 4IUFA 1HWLA 1HNXJ 2OTLS 4USJC 4X64J 2CPXA 1G2EA 1R8CA 3WHIA 2W2PP 3RBZA 4YFUA 1B7FA 4RW9A 1S76D 4HT5A 2Y8YA 4WXOA 3IR6B 2I38A 2I2YA 4LF8J 4WFBQ 4C3KA 1WTFA 2C2KB 2MGZA 4CLZA 2BE2B 3BR9A 1BUXA 2M8DB 4I56A 2BOPA 3HD1A 2PMZD 1U49A 2OPRB 1DQ9A 3RRKA 4CLKA 3I5BA 4ILRA 1HQEB 2G13A 3O8WA 1FKPA 2XLJA 1PIEA 1SXLA 1OY9A 1NHVA 2XMUA 3RAQA 4DR2F 4QIVA 3MWBA 2N4CA 2ZBRA 4OHZA 1BQNA 4WTYA 1KLMA 3M2RA 3QRRA 1R8HA 1Q8BA 1HNVA 1BWEA 1HBNB 6FD1A 2VOPA 1S1VA 4JI0F 4J9QA 1YITS 3FK4A 3BPSP 3D2WA 3FEYB 1TKZA 2ACYA 2LVWA 5D4NA 2GO9A 3I0RB 4W98A 4RZRA 1VQ5S 2NS1B 4K59A 3BBBA 1A0OB 1MN9A 1U2RA 3T9ZA 4HTJA 1AUDA 1TAUA 2D9PA 4G3IA 2EG2A 4QZVB 4JI8J 3GLJA 3M32B 2JNJA 2FLPA 1JIHA 1UPMB 1TKTA 4ECRA 1U02A 2VFVA 2W8KA 1RADB 3Q89A 2K7JA 2ZVIA 5CD4A 3OTCA 3CNQP 3QZ8A 3IWLA 5EGYA 1RT7A 1EX8A 2WSFC 4Q2LA 3C15A 2E1CA 1KVIA 3FBEA 3CCJS 2QG9B 2DO0A 5ETQA 1U45A 5GMDA 2DH7A 3TA0A 4P2SA 3KJVB 2RRAA 4QR2A 2YKNA 2GQCA 3CJQA 2RB7A 2VBXA 3SCJE 2P2CB 3T6BA 1ZETA 4IKAA 1ZPWX 2OP5A 1VHFA 1T9TA 4I68A 1S12A 2CADA 4OZ0A 1OQ3A 1WHWA 3ZZPA 3CIMA 5CHCB 3JQMA 1VC0A 3HCXA 2GIRA 2R2RA 3S6EA 1PC4A 3Q2SC 3BDEA 3CEDA 2C22A 3OV7A 1A6LA 3Q8PB 1XMOF 2LFVA 3T5LA 5L38A 1R0AA 3K5MA 5HP1A 2ZBCA 4MKVA 3V4IA 2WVCA 3TW0A 3UNYA 2BZ2A 1LK7A 5HMXA 5D4PA 1S1TB 3DMJA 3T6JA 3QYYA 3DGPB 3MM8A 5IM0A 2P9CA 3B4MA 4BBYA 3J7A1 3WIVA 1UFWA 2ZH3A 1JLBB 4DQIA 2H9ZA 3AOCA 3DHXA 2YQ0A 3DYAB 4NMXA 5IFMA 5GMKa 3PCOB 1RUSA 4X4RA 2F65A 2L3MA 1WC1A 3P49B 1TFYA 4YY3J 3BH6B 4AXIA 3F56A 1OYDA 4DG1A 5FIIA 1RBOB 4U7UK 4ED0A 3EXCX 3VF0B 3NMAA 4O44A 3G6XA 1DLOA 3TAQA 1YRUA 2I5JB 2JL9A 5JMNA 1VRTA 2HLUA 2DKOB 3V2UC 4H54A 3N6MA 4HHUA 5KG3A 2KTQA 3PEJA 3P5BP 3FSXA 1RT6A 2JEGA 1VBYA 4ZPDA 4O4GA 4RWWA 4DFJA 2O1PA 1DQAA 1FRJA 2QLJB 4NLGA 1DURA 1MSWD 2V8HA 3A12A 1WHYA 3C19A 5KFLA 2P9EA 1Q82T 3VZIA 1W7WA 3GU0A 2W2NP 1J5OB 1V3RA 1LFPA 3PX6A 5LXRA 1MWQA 5KG5A 4EYHB 5CXTA 1FKAF 4A8FA 3R5CA 4WF9Q 2E1PA 5D6GA 2MQLA 3W66A 3DOMA 4NZ6A 3DM2B 2GZOA 1CQMA 3K7RA 1MMLA 2GVZB 3LGHA 1N5YB 1OY8A 2ADCA 3DLEB 5T7LA 2ZBIA 2O5DA 1DZ5A 4WFYA 2R7QA 1F5CA 3JSMB 3TX0A 2QJ3A 2R7WA 1OPIA 2AF6A 2OD6A 1WKKA 5T14A 1U1KA 2J0WA 2DRDA 2EFQA 3KHGA 2DXEA 3V5RA 3HZGA 1FD2A 4I6YA 1I3OB 2KU7A 4NASA 3AXKA 2CJ9A 5IQ6A 3M2UA 2MKKA 3QQCD 3AD8C 1HD0A 1S57A 4P72A 3PW5A 2VJUA 2ZZTA 4ECVA 2HVZA 2H54B 3VVUA 3NMRA 4DUTA 4NCGA 1RHJB 3C6UB 2Y1IA 3DRRB 1W25A 2WVBA 3HMJG 5LMNJ 1QSYA 2IPOB 1H2UX 4PRFA 2V9WA 4MK8A 5AJ3F 4HTIA 4LVOP 2XWXA 3TUIC 1M5OC 3MMAA 2QMWA 2MSSA 2B9XA 3PYEA 3CJKA 2HHXA 1YLXA 2DB1A 3B8HA 1JLFA 2BRKA 5DRKA 4L72B 4KH1B 4P2MA 2EW9A 3D9BA 3H4BA 1N5SA 3MHYA 2JEFA 3I31A 2Z8QA 1OS5A 3RB6A 1VQLS 2YKQA 3OTOJ 3W2WB 4B3SJ 2JEJA 2QN6B 3AH6A 2ZH7A 3KJQB 3X3UA 4MIAA 3TZXA 1N34J 3TZWA 5I42A 3BPDA 3NNAA 1ZPVA 1RT3A 1ZZNA 3OLBA 1HPZA 3NBPA 4YOEA 1Z1ZA 1J2VA 4P71A 1C0UB 2QC3A 3DNCA 4MK9A 5KFNA 1RT1B 1T9UA 2AX0A 3BQ0A 2HHVA 3I5CA 4B3OA 1GTEA 4F50A 4K7QA 1FJEB 2HFSA 1N36F 2PI5A 4ANDA 2QFJA 3SBMA 1LWFA 2HPUA 1FKOA 1PO6A 2NXCA 2BM0A 2H5JB 5CYMA 5DDRC 2ZOFA 3M8ZA 3A3OB 3D67A 1RAHB 2ILYA 4ZVTB 2PI4A 2LQJA 4C9DA 3CSKA 3MOZA 3DOKB 2ASJA 1ZA1B 3V6KA 5BR8J 3OXGA 4LSNB 4J90A 2DNPA 4ZIWA 1VISA 4OI1A 4EYIB 1WF0A 3HJFA 1HI0P 3SYZA 5A8RB 2EFNA 3I32A 3WX8A 1M5PC 4N47A 3LWMA 2X3GA 1EETA 5FDLA 2XNQA 3WDOA 2KZMA 1TR0A 1YJVA 1HMVA 4DR4J 1UWBB 4LR7A 4K0KJ 2XO7A 3MMJA 2DHSA 3CCSS 3P8BB 4OX9F 3IS9A 3Q8QB 2XMTA 4DX8H 3ZTSA 1WKLA 1PJ6A 1P8GA 2PO4A 2U2FA 4M63A 2DNHA 1Q16B 1X5TA 3C66A 2Q43A 2V8VA 5ETRA 4DSFA 5D0RA 5IWAF 3NXZA 3MEGA 2IYIA 4QW8A 2AWZA 3SXLA 1KQGB 2DD8S 3MAAA 2MZSA 3GIRA 1EAYC 3LP2B 4AE5A 2DT9A 4M5JA 4UQGA 5H9EK 2DY1A 4K2XA 3TJ8A 2KVQE 2XMMA 5E7OB 4ZMMA 1U1QA 4FYWB 5HROA 3D0HE 4ZVGA 3OTOF 3ZZ0A 2VBYA 3D0IE 2O3DA 1S6PB 4DPTA 1SUQA 3OW2R 4RNHA 3J81j 2YWEA 1LK5A 5F8MA 2FHOB 3FQKA 2R7SA 2FUG9 1HNZF 2HWIA 1Y9OA 2XGQA 4LT6A 4OQJA 2LXFA 3VALA 3M4XA 2OLWA 1B64A 4KHMA 2L48A 4DV4J 1WHXA 3VAMA 2J9EA 3K5NA 2ZOGA 2QLXA 4NOHA 4NPOA 4DL2A 4JI6J 3V6DB 1L3UA 1U09A 2DR8A 1X9MA 1FJGJ 2DRBA 1TL5A 3QRPA 3HPOA 2GO8A 2ALYB 2KFZA 5KFZA 2FJWA 3KG4A 2BACA 1NO8A 3DU5A 4MFBA 4RUHA 1WC5A 3DFEA 4IG0B 2A2CA 1M5VC 2JRSA 3DRSB 1ZA2B 1N56A 1LW2B 3G2XA 3MUTP 3UW1A 2NXUA 4ZDNA 3MCOA 1N33F 3NCRA 2LQ8A 3IO1A 3C2PA 4I69A 4KY3A 1UA1A 2A6MA 1JJ4A 4WIQA 3D5MA 2IVMA 4K0KF 4RNFA 3VGVA 4ZPTR 3QATA 2E9ZA 1RGVA 4NLVA 1I1GA 2G0CA 4DL3A 4TYBA 1TTHB 2IMWP 1RWXB 3FCVA 2GMLA 4FVMA 4ZJQA 3KMQA 1RDRA 2E5JA 2XLKA 2QA2A 1DTTB 2MKHA 3W64A 4IFVA 3SCLE 2G9OA 1UEUA 5CAAA 1ZAVA 5CYQB 3A3NB 2DHHA 8AT1B 3KWMA 4OZLA 2C2NA 2Z2YB 3CO9A 1YJNS 2VG6B 2QV6A 3NWGA 3L7UA 2XZDB 3MM7B 2QRRA 2V69A 1I51B 1FCAA 4C7QA 2MZRA 2AW0A 4LR8A 3W1YC 1FRXA 3MOJB 1IJFB 1UAWA 4RR5A 4TY8B 4KO0A 1FX4A 3I87A 1TUWA 4F02A 4P75A 2RILA 5LSOA 3ZTRA 2HQ3A 4USVA 4DQRA 3PYFA 4DL7A 4H4MA 4HYKA 5A76A 4F2SA 4RX6A 1QTNB 1R27B 1KKHA 2QLFB 2L9WA 2BABA 3H20A 4C8LA 2W7AA 1NEEA 2PC6A 1JLQB 1RAFB 3JQJA 3QFHA 4OZNA 3PYDA 4RUAA 4WE1B 4ZCLA 2VBWA 1YI2S 2C2RA 1RWPB 1RU1A 3LUYA 3UQSA 4DCJB 2VG5B 1NZ8A 4NA3A 1QAJA 3C6TB 5KFVA 4ECSA 5IT0A 1IKXB 3S7RA 2VDHA 4M5LA 3KK2B 3KHHA 3HVRA 4ELVA 2F40A 3OL9A 4DXLA 1IN0A 3CD0A 1SL1A 4RW8B 4MT1A 4UOHA 2W24A 3EVWA 2BEFA 1YK9A 1VJWA 5HVHA 3JXOA 3H40A 2MQNA 2ZD1B 2F1FA 2IAJA 3DGVA 4ITSA 1N48A 2XCAA 4EBEA 3AQOA 2ZH6A 4CT9A 3QT7A 3R1HA 2H5IB 4LF7J 1EQMA 1S7IA 4NLUA 4YUDA 3RR8A 3IFEA 5K8NA 1EB0A 2KRBA 2P6TA 5KFSA 3KLHB 1FK9A 3MM5A 1HQUA 1WG1A 1U0SA 2XMAA 1RU2A 2J9DE 2V2KA 4O3RA 3ZTOA 3JTNA 2IM2A 2X51A 5AT1B 2X1FA 5KTQA 1X60A 4URGA 2BBEA 3B82A 4AT1B 3H8YA 2HQGA 3GIJA 3CC4S 2UP1A 4N8NA 1F3FA 2BANB 4C8OA 4TU8A 1V9OA 1N4LA 2WW8A 2FGOA 4ECQA 1PGZA 1NK9A 3BJYA 1Y0HA 3ZNUA 2MZTA 2RF2B 2AT1B 1X4AA 5D0EA 1UWAA 3MFIA 1B7YB 1N32F 3DRPB 1K0VA 3CIZA 4FVCA 1FWLA 4B9SA 3RJMB 1RTJA 3CMAS 2GMHA 2VICA 1G6BA 3GIIA 4DS5A 2CQPA 4X2BA 3K5OA 4BCAA 2ATCB 3F73A 1B0VA 3LO3A 4USWA 3W8GA 2R2TA 2GGPA 1UPPA 1S4FA 6AT1B 4BWJA 3TR5A 2ZH9A 1R7IA 5F3ZA 3GZ7A 5B09A 2ZWPA 1EQ0A 2VFUA 4CO0A 4ZLNA 2ZBPA 4Y28C 1RT4A 1IR2A 3P96A 3P5TL 5KG0A 1HFEL 2IBKA 2J7UA 3OUYB 1GTHA 3ZZUA 1KD1T 2NUHA 2NR0A 3KNAA 3I0SB 4DR6F 2NXNA 2COLA 1JKHB 2DGOA 3SFGA 3IG1B 5J2PA 1X4CA 1RCOB 3EPGA 2WB1D 3DCAA 4HI1A 4DQSA 1P9YA 4H4KC 1FFWB 5HMWA 4GKKJ 3H90A 5HL7Q 3KLIA 5EUHA 3GIMA 1NK5A 5F8IA 2B7BB 3UVJB 2M3DA 4ZPAA 1FDDA 4DN0A 1EZZB 1JLEA 3MXHP 3W5ZA 1Y00A 3G82A 2MQPA 4NEYA 4DV2J 3LP0A 4HACA 3LTOA 5KFKA 1OYEA 3R9LA 3VVTA 4EBDA 1REVA 2HHSA 2BJ8A 4LF7F 3VGTA 2CYYA 4FBUA 2YPYA 2B3TB 1HR0J 3OTDA 1UVJA 1TL3A 1ZYQA 4K2JA 4NLXA 1B99A 2HRUA 4LJMA 3W61A 1EP4A 1D8ZA 4J9UE 3SCIE 4CYUA 1TELA 1GMWA 2IJFA 4XDCA 3OHAA 2W2OP 3I96A 4DUZJ 4KPYA 1BXNA 3NG8A 5IT9U 2KT3A 2Q66A 4PUOA 1S72S 2BX6A 1VIOA 3FMBA 1F9HA 2HQCA 2ZC4A 2OKQA 4YB6A 2D3OR 2BKPA 2VU5A 5KFQA 4FKXA 3FUYA 2QL5B 3PVXA 5DGBA 4FN5A 5IV3A 2DGWA 1LXNA 4ZPBA 2KXFA 3HF5A 5KFIA 3RBEA 4DI6A 3K58A 1WACA 4C0OC 2VQFF 1ZAWA 1CS4A 2AD9A 2AX1A 4R25A 4O3QA 4DSEA 2LDIA 4GKJJ 3GP9A 4OYMA 5B0FA 4QCLA 2UVRA 1GEHA 3NGDA 1S1XA 5KFEA 3EJMA 5J2MA 3GR0A 2ZFHA 1NJZA 4ED4A 2CPFA 5DG8A 3GQCA 1WWHA 1RKIA 3CMES 2LQ5A 1UCNA 2W01A 1HBMB 2BQUA 3GCWP 3GV7B 4URQU 3KNGA 2YH1A 4JI3J 3MTJA 4QIEA 1M5HA 1DBDA 2DK2A 1MU2B 4ZKAA 1S9GA 1TV6B 2C2EA 3CF5Q 2FY1A 5AXNA 1C1BB 3VAFA 4MAKA 2D3UA 2R7RA 4PWUA 3FC9A 4LRBA 2OGUA 2CDQA 3IM9A 3OL8A 3HVWA 1PAUB 2UZAA 2Z2LA 3EX7B 4K4XA 4GKKF 2XHWA 1R6YA 2I1RA 5DDPC 3NNCA 3CPWR 2XS7A 4B9UA 2V68A 3H59A 2HBZB 4WWSA 2RQ4A 4ED8A 3SIPB 2MEWA 3NKYA 1BQMA 2W1BA 2GW8A 3E2EA 3DU6A 5HBMB 4X84A 1V3ZA 3G8QA 3UCUP 4A8KA 1M90T 3OJSA 1U8WA 2HURA 2DTJA 1P1TA 1M1HA 3G8SA 3MFHA 1KOOA 5A6PA 2W9CB 4B08A 3EZUA 2B8PA 2BQRA 1X9WA 4LRCA 8ATCB 3C3LA 4F4AA 3Q86A 1HYSA 5I3UB 2GCFA 2H5EA 3CJTA 3CCRS 3QSYB 1T94A 5ETPA 1FI4A 5A8WB 1KFSA 4KSEB 2IRXA 2UXDF 3R5GA 4DU7A 4HR2A 4RW4A 4DR7F 3VAGA 1CJVB 2E5HA 3ISNC 2HHHJ 1UZHA 2OPSA 2XY7A 2F4VJ 2WVEA 2B4UA 2R3VA 5C2CA 5JUMA 1TKDA 2LA4A 3U02A 2H4YB 4NLYA 1RT5B 1P1LA 5B0AA 5HK4A 3QIPB 2YQ1A 2VQEJ 4M5DA 3JSYA 4IH7A 1OSDA 4JV5J 4XO0A 2KVIA 5F8LA 3EGWB 3A8JA 4LFAJ 2XLIA 4X4PA 3AB4B 1RTDA 4H4KA 3N4WA 2CJKA 2UXBJ 4YHHF 1CEZA 2CNNB 1XBWA 2CQIA 2WOMB 3I82A 2VPZB 3B54A 1GFWB 2ASDA 5DZ7A 2YWHA 3K89A 2HNZB 4DR1J 1HNWJ 2FHJA 1NJXA 1UA0A 3DLGB 1PKUA 3ELHA 4USUA 3SI8A 3CJ0A 2XS5A 4CCHA 2HZAA 4KGZB 2PIIA 4WCEQ 2KM8C 4RU2A 2WONB 1RBAA 3TVYA 1H72C 1A7GE 1U26A 3A13A 1F0XA 4NI2A 1DAXA 2IM0A 5KG7A 5F8JA 2V4RA 4M5KA 3HO1A 4G1IA 4X66F 1YVFA 1T9WA 3IAS9 1FRMA 1SL0A 3ENWA 4HL9A 3UI3A 2OPPB 1QJHA 1CJUA 3KHRA 1JLCB 2HZVA 2N7CA 4JBCA 3RR7A 1ROFA 2M0GB 3RRGA 2XZWA 2XYGB 2Q1LA 1ZZFA 2VZ9A 5HJXA 1JXEA 3GE9A 3QT6A 3EM1A 3KUHA 2HBRB 1TZ0A 2KHDA 1KWMA 3W8PA 1FE0A 2UUCJ 2M2BA 4EU0A 2PFFB 4NYPA 2GVDB 4QPXA 4K4YA 4LF5J 1QE1A 1MWYA 4F4WA 3OR1A 4DX7A 2UVWA 3JYTB 1NKEA 3L95X 3GFYA 3NL0A 3R2CJ 2ABYA 2YTCA 5D8HB 3VQTA 2EFGA 2WZ1A 3NGUA 1B0PA 2J7WA 3MR6A 1N52B 2BUNA 3C16B 2Y8WA 2V8DA 2JLGA 4DLGA 3AA8A 1S5ZA 1Q81T 1LWCA 2R9LA 2JFDA 2XULA 1K0TA 1KVJA 5DG7A 1R89A 3H98A 3M32A 2AJ2A 1QVGR 4EUVA 2XI2A 1JWWA 4YQWA 7AT1B 3ZTPA 2F8MA 4NLRA 2AJFE 3EXYA 4JI4J 6FDRA 3C8YA 4F4ZA 3QO9A 3KG1A 4LFAF 1IM6A 2KYZA 1JJ2R 5D0GA 1NJWA 3DLJA 2XO6A 2ZZMA 1WF2A 1S1UB 2YKMB 3HKZD 5E3PA 1JJHA 2IDEA 2OPQA 4CLFA 1KR4A 2J0XA 2PMHA 1RHKB 3AJDA 1D9DA 4WFZA 2EI5A 1CJKB 1QAYA 4LF4J 1TFWA 1U0HB 4O0NA 3SQOP 3VCDA 2CQHA 3RBXA 5G4DA 3R7BB 1WOPA 4K4WA 1RACB 3ITHA 2IY5B 4OX6A 3VGUA 3FFIA 2M88A 2DNNA 4PWDA 3KUEA 4HHHA 4ZHRB 1NSPA 1T05B 2GQ2A 2DEIA 1N5QA 2AGOA 1RKJA 5C42B 1IKYB 5HLFA 1S1TA 1NH8A 1TUGB 4M94A 5LJ5Y 3QGIA 1O5JA 1RTIA 1NB2A 4Z2XA 4LBHA 3M7VA 4PZVA 3A8EA 3TZYA 1RJJA 1JLAB 1DTQB 1AYEA 1S0VA 1JLBA 3T1YF 5L9NA 2K1RA 2NYIA 4CH7A 2FY8A 1PILA 3S8SA 3TEGA 3BKTA 1KC8T 2VFTA 2HGLA 3VAHA 1IQTA 2DPJA 2HFUA 2VKRA 4LSLB 2VF3A 5HAOA 2K06A 1E6YA 4UTGA 4KE5A 2V4JB 3ISND 2HRYA 2V0NA 2UVVA 1Q95G 2XI3A 2IVYA 1BQXA 4HLBA 3BQ2A 2VHGA 1FRIA 2Z30B 2F8EX 3A8IA 3K59A 4NLOA 3N01A 3T3FA 2D3O1 1WJ9A 3N79A 2AV5A 3OTBA 1RAEB 2OFHX 3H7HB 3IN5A 3RZAA 1YBAA 1PCAA 4GVBB 1YBTA 1X4EA 1H7WA 4NXMF 4I2QA 2E5LJ 1YX2A 4JI4F 1QD1A 3KDOA 1GX5A 1RBLA 2FJEB 2HQDA 4P52A 2DH9A 2Q3PA 5GAHU 1U24A 4EZ9A 1VQPS 2JWNA 2C3MA 3ET6B 4OIXA 5LSLA 1KQFB 3MEDB 3PFEA 4B9TA 2CNKB 1VFJA 4DDFA 1XR6A 2W7PA 2XQCA 1IKVB 4WPAA 4IFYB 3EZOA 1VC5A 1WUUA 2VG7A 3BEGB 2CFXA 5LL6d 2FTRA 4HT7A 1S49A 3EDQB 3QRQA 5B0DA 3BO2A 5ITHA 1WG5A 2FJAB 4RW9B 3UD5A 1C1CA 1VCTA 2DGQA 2J0SD 1MROB 1AFJA 5KFMA 2MJUA 3SZ2A 1FNOA 2MGZB 3OXLA 2Y1LB 4I67A 2R8KA 3ENVA 2IJNA 4CO2A 1U8SA 2HFZA 3Q83A 1QVFR 4CO4A 5HMZA 4JI7F 2MZQA 4CTAA 3PRVA 4ZPVR 2XY5A 2ZBQA 3J7ZT 3C6UA 2JLEA 2ZH4A 1NNDA 1PC5A 2QX0A 3DOLA 1BQNB 2BM1A 1KLMB 1FDNA 1T95A 2HNYA 1S99A 4YDXA 2J8AA 4FP9A 1HNVB 3NAHA 2MKYA 2JFKA 5L1LA 1GMVA 2H3EB 3BGLA 2R2UA 1ZM4A 3CT9A 4X4UA 2WBMA 3EGZA 1TKZB 4R0EA 1FNXH 1S79A 1LEOA 1LWEB 4WU3A 4UOGA 1U1PA 2VPYB 1SC3B 4C4WA 1VMBA 1M1KT 4H4OA 4USMA 2AEMA 2PSZA 5DS7A 2VKZG 3GTYX 4U7UD 4PPDA 1TKTB 1QDUB 5M2UA 2Z2ZA 4TN2A 2NQPA 2Q79A 1RT7B 3NS5A 3Q22A 3C15B 1SV5A 3GIKA 1NZAA 2BW7A 1VI7A 4PXCA 4ERDA 4XIUA 4EBCA 3WZ0A 2YKNB 4WKYA 1HIYA 1Y4ZB 4PYDA 1NK6A 4E0DA 4JI1J 1ICEB 3CCLS 1WELA 3TJAA 1VYAA 1EKRA 4ZN1A 3NLCA 1IWAA 4QR0A 1SIZA 2ALZA 3HHLB 2AQ4A 1SI9A 3WQPA 4DHVA 3RB3A 2HHTA 2HFNA 4OYXA 1RWKB 4LF6J 2E7XA 3MF5A 4B3MJ 1HHQA 1DY3A 2QL7B 2R7VA 1SKRA 4NXNJ 3ZZRA 2P9GA 1XNRF 1GQEA 3KJFB 2IFXA 3I4PA 3TP2A 5HMYA 2MY7A 1H6KX 2X3DA 4NLWA 1R0AB 5HP1B 3JTOA 3R5AA 3V4IB 3ENQA 3UD4P 1RWWB 3LGMA 4CIOA 3B78A 3J7YI 2D69A 1N54B 1NPRA 3CJRA 3DMJB 1Q78A 4FZVA 3MM8B 5IM0B 1YJWS 1I94J 1B3TA 2UXCF 4CO3A 5RUBA 3ICLA 2MHNA 1WEYA 2ZM6J 1OWXA 4ZVPB 1T11A 3X1LB 2Z58B 4CLSA 4B9LA 3DDKA 1WTBA 2DHAA 5ETOA 1NDLA 3VTIA 5KFOA 2MKIA 4PAAA 1K9MT 4WJBA 2X1GA 3V4MA 4I64A 2UUAJ 1XWLA 4P9SA 3RRHA 2CXEA 5KFFA 2HSEB 1WDDA 2GHWA 4DG1B 5GAGI 5CZVA 3W7BA 4LF9J 1RCXB 2WHOA 1UMJA 4O44B 2J6UA 1DLOB 2OTJS 2BJEA 1QSSA 1WEXA 5MLCV 1KQKA 2J76E 2ZDOA 3Q0AA 1VRTB 1LW0A 3I6PA 1YHQS 3U27A 5LMUJ 3CW2C 3MEEB 1S59A 4X4VA 4DU8A 2DR5A 2YWFA 1TQLA 4PXBA 1SJFA 5CZXA 4EO6A 2CAJA 2IBOA 2C3YA 4UQTA 2CJAA 2NXJA 3UN3A 4CH0S 4C98A 2V2VA 3LAKA 2RQCA 2PD1A 4RUBA 4ELTA 2CG4A 3TEHB 2DHXA 4ZCKA 1KBRA 2DNRA 5ETTA 3BBCA 2M8HA 4J9LA 2B0GA 3N6LA 4CI0B 3PM9A 4CNZA 4PG8A 3AAWB 5EX3A 5L8RC 3DI6A 3HVTA 2IIHA 4PEOA 1ZOTA 2KJWA 1RA6A 3DOMB 3DDNA 3DXSX 1U1MA 5AXMA 4C8YA 4FPRA 1RB0A 5K9FA 3R7SB 4RNMA 5ETLA 5T7LB 3GPAA 2LCWA 4LFCF 1EKSA 3JQKA 4F3MA 3P4UB 4M5HA 3UDVA 3MD1A 2OJ3A 3OT9A 5DGAA 4LF6F 2HQIA 2SXLA 3PHTA 2M4MA 2OFGX 4U7CA 5GADI 5KFRA 1JLGA 4OLOA 4LFBF 4PCQA 3PO4A 3NGSA 4NXNF 2L9NA 5K5MA 4OZ1A 2E1MC 3I9ZA 4KYZA 3DRSA 1KEKA 4Y3CA 3W60A 3L4BC 5B08A 4DR2J 2RKIB 1UVNA 4RW6A 4F04B 2R8JA 1Y5LB 4AL7A 3WIUA 4DL4A 2V4QA 4Y2CA 4P7VA 4EMDA 4TU7A 2KHCA 5GAEU 4WFAQ 4JI0J 1D3WA 1SKSA 2Y1JA 3UDCA 2FC8A 3PIOQ 3D6TB 2QTWA 3V6JA 5IC6B 2UUAF 2L41A 5F9LA 3TRGA 3T5JA 2EFOA 1GT8A 2R7UA 2DGXA 1RSCA 4RNOA 3TARA 2OO4A 4Q0BB 3MTKA 3CJKB 2RHSB 2RQKA 2DNGA 2LP4A 1DFDA 1T9VA 1JLFB 2I6WA 1L5UA 4UY85 2XCPA 3CMQA 1VRUA 3W2VA 3ILIA 2VG6A 5KT7A 5JVGQ 5K20B 3BGOP 1UZDA 3HSJA 4JYAJ 2HZCA 1IKWA 5DQGA 1YWXA 2MB0B 2ILZA 4BC7A 4TY8A 2OEJA 3U1NA 2H51B 5EN1A 1SH2A 1VGYA 2RS2A 4CNYA 2LEBA 3WC2A 2ZOMA 3IBCB 2A0FB 4FXWA 4YMEA 1RWMB 5I42B 1NJIT 3M8PA 4EWTA 2B7CB 1RT3B 1NDCA 4NE9C 4Y34A 1QUVA 1BGXT 1HPZB 2EC0A 2ROPA 3NBPB 2HMIA 2UV8A 3I9V9 2HS4A 1K47A 2EVZA 4R8UB 3GCXP 2YKOA 1V5VA 1WDTA 2YNHA 2B9WA 4FXDA 1FD8A 2RE1A 3E51A 3M8RA 1S9FA 4ECXA 1VJQA 1LWFB 2DY9A 4WFXA 4K4VA 1FKOB 2ZH2A 2NZCA 4TY9A 4CLTA 2JVRA 3J81U 5CYMB 4C3MA 2W9AA 5HVFA 1XMOJ 5HANA 3GFHA 2W25A 1JNZB 5K14A 3HJVA 3VV2B 4B3TJ 4DL5A 1QTMA 4OZ5A 1ITPA 2XBPA 4ECTA 2VB6A 5C24A 1EIYB 2HNDA 1RTHA 3MM9B 3DDIA 4N8OA 4OZ2A 4ZIVA 3MAQA 2CJXB 1Q8LA 2PA8D 2RRNA 3OPKA 3FRZA 3MECA 5EX0A 3K57A 4J9RA 3GV8B 5FDLB 3PW0A 5DQHA 5L1KA 2FVRA 4C8ZA 4ZP7A 2JC0A 2EKNA 4D3HA 4GRSA 4OI3A 1ACMB 2WCXA 3M6VA 3IS9B 2IA0A 2IYGA 3QGGA 2I9SA 2OEKA 1G3OA 4ECUA 2KH9A 2CPIA 2BA9A 1L3KA 2RHQB 4OFZA 3PG9A 2W8LA 4WP9A 4KT0C 3QNWB 1KN6A 5L1IA 5A2QU 3BDPA 1HLWA 4EK2A 2W4PA 2BQ3A 2J9DA 2Y0SD 3MAAB 3N9UC 3WX4A 3EPIA 2RF2A 4OLPA 1NPPA 4ZP6A 5KFCA 3CJ8A 3KJNB 2J0QD 3FCWA 4JYAF 3BKFA 2MTLA 4ED3A 3IP0A 4CZCA 1Y3JA 5HROB 4QYZK 5H9EJ 2B5JA 1K1QA 2VD3A 4NYZA 3PKMA 3LH2S 1SUQB 4R0JA 1AUSL 1XNQF 3MR2A 1RQ0A 2B56A 2FLNA 5C25A 1N88A 4OL8A 1IJEB 4A8SA 3I4HX 2CUYA 8RUCA 3QIDA 4C97A 1RAOA 3Q8UA 3GFZA 1TVRA 4Y2MA 2V8PA 4ZLPA 5KOXA 5JVHQ 3E3XA 3BS9A 2XSFA 4FXVA 4OI0A 3OLAA 2G1HA 2Y9HA 2PE8A 1VBXA 4QWEA 3QMQA 4LSZB 4ECYA 1FX2A 4M5GA 4B3TF 3PTWA 3UFCX 3IGVA 3H5XA 4C3LA 2HHQA 3KYLA 2HYIB 2GHVC 3W65A 1F9EB 4P73A 4YS2A 2HHUA 2D1CA 2WSCC 4MFBB 3MM6A 1D1UA 3UVJA 2BOAA 4YB1P 2W2QP 4M8LA 3A4TA 2ROEA 1O6XA 1S9EA 2VFSA 2FVQA 4PQUA 3R3TA 4KB7A 1PYTA 4IG3B 3TO8A 4C11B 1NKBA 5AJ3J 1WG4A 5A8KA 3CD5A 4F0KA 1WC0A 1R8AA 3KLFA 2OH2A 1SPBP 3CUNA 1T03B 4ZCIA 4DJBA 1HI1A 2CPHA 4K8RA 4MIBA 3ZO7A 3GSDA 4EI2A 1HBOA 2V94A 1QM9A 2B6AA 4QPTA 3BGFA 3D6HB 4YR3A 1XMQF 4EFAC 2MKJA 3KK1A 3EE3A 4YEAA 4IFVB 2XGPA 5HQ8A 3NGRA
chains in the Genus database with same CATH topology
2EPIA 4C11A 5A2QY 4ZHRA 2CIMA 2CPFA 2MSTA 5DG8A 3GQCA 5E5NA 1S97A 1WWHA 1S0MA 1RKIA 4PPZA 3CMES 2YKAA 1H3DA 2ZE2B 5ADZA 5F8HA 2DGTA 2LQ5A 1TUVA 1T05A 3BB5A 4HEA9 3CJ2A 1HBMB 3OXFA 3PFOA 4DR4F 2BQUA 3N5FA 2LEAA 3GV7B 1U1OA 4B3MF 4DQQA 4URQU 2HIQA 1NU4A 2KT2A 4J9PA 3HI9A 3KNGA 2BDPA 2YH1A 3U1LA 2YX1A 3MTJA 5C42A 5DG9A 4QIEA 5FLXY 4DQPA 1M5HA 1XN9A 3QLHB 3IGNA 3CDBA 2C3UA 2AJQA 1T03A 1DBDA 2PT0A 5A0YA 5K8MA 1G1XA 3R27A 4AYBD 2DK2A 1IM4A 4QOTA 4K4TA 4XPEA 2I5JA 1RISA 1MU2B 4QU6A 4ZKAA 2RU3A 1S9GA 1TV6B 2C2EA 1L3TA 2YNFA 4AUKA 1N5VA 3CF5Q 2HVIA 1Z2LA 1BY9A 5L39A 3CULA 4KO0B 4JUZA 1JLAA 1DTQA 2FY1A 5AXNA 5DLFA 1C1BB 2DH8A 4ETZA 3VAFA 5L1JA 4MAKA 1PSDA 5EHHA 2D3UA 3O2IA 5BYRA 2R7RA 5AXLA 1FRHA 2CPDA 4PWUA 4KTQA 4IOCQ 1VQKS 3HHKA 1XK8A 4RBUA 2E7WA 2CQGA 2CDQA 4H4MB 3PX4A 2YWGA 2X1AA 3DN9A 2VFRA 4OI4A 3OL8A 1HHTP 3HVWA 1FRKA 1R31A 2ZE2A 2DBBA 2UZAA 1I94F 2FC9A 2Z2LA 5DM7Q 2VH7A 2ZHAA 1Z4UA 2I8EA 3EX7B 3BO3A 3BO4A 4K4XA 2VA3A 1XC9A 1H0HB 3O44A 3OFGA 1KHVA 1VRUB 1UVLA 3W2VB 2ERRA 4K50A 4LSLA 4GKKF 3J80Y 2ZM6F 3MMBB 2XHWA 1R6YA 2I1RA 5DDPC 4KIAA 1CLFA 1SJ4P 3NNCA 4D3GA 3QLHA 3G4SS 1Z2ZA 1VK8A 4I2PB 1HL6A 2MPUA 2M52A 3CPWR 2EFPA 2XS7A 1X8DA 1IKWB 2FLOA 1DJ0A 4B9UA 2EFVA 2LU1A 1MU2A 3H59A 4F25A 2W7OA 1T3OA 5DO2A 2RQ4A 2DO4A 1J5OA 4ED8A 2YY3A 2RMLA 5LXYA 3NKYA 2VC1A 1BQMA 2GW8A 2VPWB 2Q6CA 3RTVA 3E2EA 3DU6A 5HBMB 4X84A 2JX2A 1U7LA 1V3ZA 2J9CA 3G8QA 1Y7PA 5EWEA 1HWUA 2BYCA 4Q44A 3UCUP 2GHPA 3MUMP 4A8KA 3OJSA 1M90T 4K4UA 5A6WA 2AJ0A 4LF9F 2DTJA 2JDJA 2M70A 2CQ0A 1P1TA 3G8SA 5CH7B 2E1AA 2ZDPA 4I4BA 3DM2A 4NX9A 3WBZA 4G6VB 3MFHA 3I56S 4LVNP 4PKDB 4C8KA 1KOOA 3PDNA 4TQRA 3M8PB 5A6PA 2X1BA 2W9CB 2E66A 4PQAA 1U1RA 2DGSA 4B08A 5K8OA 1N5YA 2GA7A 3EZUA 3DLEA 2ZH5A 1GXUA 2HMIB 3EZ5A 4I7FB 2BQRA 1X9WA 5LMUF 3MMBA 3C3LA 1HYSA 1SJ3P 4N76A 4I2PA 3JSMA 4ALZA 5I3UB 2GCFA 2H5EA 2MHEA 4TLQA 3RU0A 3CCRS 4ZK7M 2VC0A 3SMZA 1T94A 4X65F 4DV4F 2DNMA 5A8WB 1KFSA 2YNHB 1VIXA 4KSEB 3MURP 4ED6A 1FDBA 3OTEA 2IRXA 1MW7A 5IT9Y 3LP1A 2UXDF 2O66A 1S48A 2IAJB 2I0XA 2DGVA 5KFWA 3RB0A 1X4FA 2ZKTA 3UNGC 1KSPA 3T1AA 2NREA 4RW4A 4DR7F 3VAGA 2Q6BA 4EEYA 4JI6F 2E5HA 2DNQA 3ISNC 2MZ1A 4DMZA 1TP7A 2WSEC 2OPSA 5KT4A 2XY7A 3G8TA 2B4UA 2KDOA 5JUMA 3IRXA 1TKDA 5KG6A 2LA4A 1FJGF 2M5YA 3SSQA 2MY8A 1XR7A 3U02A 2YKPA 4KBIA 4NLYA 2YNGB 2L9DA 2LQBA 3MEDA 4Y00A 4A47A 4DS4A 3HX9A 1RT5B 1ELOA 1P1LA 3AA9A 2NLWA 5B0AA 5K14B 4FBTA 1FK9B 5D4OA 3SSRA 3QIPB 1Y3KA 3MM5B 3QPIA 2AU0A 2BR0A 4DV7F 1HA1A 4J5OA 4M5DA 3QWUA 2N3OA 3JSYA 1IKVA 1HQUB 2CVEA 4IH7A 3NS6A 2LYVA 4JI2F 4KHPF 5F9NA 4KR0B 5LJ3Y 4DSIA 3SQGB 1CC7A 5CYJA 1OSDA 4EGLA 1N6QA 1FT8A 2DVIA 4XO0A 2KVIA 4IUFA 5F8LA 3EGWB 5C24B 1HARA 1X5PA 1HWLA 5MAOA 4Q5VA 3J7Z5 1IBMF 2OTLS 2UUWA 4USJC 4ZVEA 2D74B 2VA2A 2XLIA 4X4PA 3AB4B 5A8WA 2RNEA 1RTDA 1HW8A 3POTB 1FKPB 2HNDB 1RTHB 3N4WA 4H4KA 3T19A 3MR5A 2CPXA 2RDJA 2CJKA 1G2EA 2QSFA 1R8CA 4HDHA 4YHHF 2FVSA 1CEZA 4YFUA 1B7FA 4RW9A 1S76D 4EZ6A 4HT5A 1XBWA 2CQIA 2WOMB 4F8RA 3I82A 2VPZB 4WXOA 4ZOSA 2CPZA 3DRRA 3IR6B 3TX8A 2JSXA 3HVAA 2I38A 2I2YA 3BN4A 4WFBQ 2ASDA 3DC2A 5SUHA 2YWHA 2HNZB 4C8NA 4TXSA 4C3KA 2FJDB 3M2RB 2FHJA 1V3SA 3MECB 4MKYA 2E9TA 1NJXA 2IRYA 1UA0A 1WTFA 3DLGB 4P6QA 2E5GA 3IWNC 2MGZA 1Q7YT 4W90B 3T9NA 4J9SA 2YX4A 2BE2B 3BR9A 1KTQA 3CJ0A 3SI8A 1KLNA 2B4OA 2ZHOA 2XS5A 2M8DB 4I56A 1S1VB 2BOPA 2HGMA 1M5KC 2PMZD 3SQGA 1N0UA 3EUNA 4CCHA 5CA5A 1U49A 2ADBA 2OPRB 1DQ9A 4QQBA 3RRKA 2HWTA 2B51A 2PIIA 3S01A 2F9DA 4ZVFA 4WCEQ 2KM8C 4RU2A 3PEHA 2E9RX 3I5BA 2WONB 1ZM2A 4ILRA 2KN4A 1HQEB 2G13A 3O8WA 2NPFA 3TVYA 3POTA 1FKPA 2JLFA 2XLJA 1RTJB 1A7GE 1U26A 1F0XA 1SXLA 1IUJA 5GAHI 2WBRA 5DJBA 5GAGU 1W2IA 3I55S 3CD6S 1SKWA 4PG6A 1NHVA 4IYQA 3O6QA 1DAXA 2QSWA 2XMUA 4GC7A 2IM0A 5H1SV 3RAQA 5KG7A 4DR2F 5F8JA 2V4RA 4F67A 2D41A 4QIVA 3HO1A 5JJBA 4G1IA 3KKFA 3MWBA 2R8GA 2GGPB 5CQGA 2FVPA 4X66F 2N4CA 1YVFA 3PX0A 1WI8A 2HNZA 4OHZA 1BQNA 4WTYA 2CZVC 3IAS9 1KLMA 1FRMA 1YQHA 3M2RA 4B3RF 1SL0A 4N56A 2HG4A 3ENWA 1U6FA 4HL9A 3UI3A 2DNZA 1R8HA 2OPPB 2LKZA 1KFDA 1Q8BA 1QJHA 3KHRA 3H2VE 4QR1A 3W2WA 4IH6A 1JLCB 1HNVA 5BYSA 2XMJA 1U6ZA 3CCTA 2JZ5A 1BWEA 1HBNB 5FD1A 4HH0A 6FD1A 3TI0A 2F9JA 2VOPA 1S1VA 1VQSA 4JI0F 2N7CA 4FYDA 4J9QA 1YITS 4JBCA 3RR7A 2IRUA 2HVHA 1ROFA 3BSNA 2K3KA 2LEPA 2M0GB 5F41A 3RRGA 2XZWA 4DV3F 4NLDA 3D2WA 3FEYB 2DR9A 2KKHA 1RT4B 2Q1LA 3SV4A 2VODA 1ZZFA 2VZ9A 1TKZA 4RBTA 2ACYA 1JXEA 2LVWA 4LQ9A 5D4NA 3F41A 2GO9A 1G7CB 4RKUC 3M8QA 2JEIA 3GE9A 3I0RB 4Q7AA 4OJHA 1V6HA 1C0UA 2V9KA 4RZRA 1VQ5S 1RT1A 1VK3A 3FSYA 2NS1B 4BS2A 4K59A 2B5JB 4DUYF 1TZ0A 1U2RA 2E5IA 5E3AA 4DBQA 2KHDA 1O8BA 5J2QA 1FE0A 4DSJA 3T9ZA 4HTJA 2QT7A 1RYRA 5J2NA 1AUDA </