4TU7A

Structure of u2af65 d231v variant with bru5 dna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
174
structure length
174
Chain Sequence
b'GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHVYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
molecule tags Rna binding protein/dna
source organism Homo sapiens
publication title Structure-guided U2AF65 variant improves recognition and splicing of a defective pre-mRNA.
pubmed doi rcsb
total genus 44
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tu7A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4tu7A02
2KU7A 2MKKA 3CMES 2MKJA 1U1RA 2LECA 4ED5A 2XNRA 2DHGA 1WF0A 1N52B 5IQQA 1R8HA 4IUFA 3HI9A 2A3JA 4M5DB 5IM0A 2Q79A 3EGNA 3CD6S 2MXYA 1VBZA 3SDEB 2DK2A 3TP2A 2XS7A 4IOCQ 1UFWA 2MJUA 4V19X 4C7QA 1WHWA 2PEHA 1F9FA 1YITS 1SJ3P 2KM8B 3P49B 2I38A 1FO1A 2JVOA 1SJRA 1JJ2R 3CULA 1X4EA 3MDFA 1VQOS 2NZ4A 5DETA 2RT3A 1X0FA 1K73T 1WF2A 2DHXA 5DM6Q 2HGMA 2MQPA 2DNGA 2M8DB 1KQSR 2DISA 2HZCA 1N54B 4W92B 2MB0B 5LJ5Y 1WHXA 2MQOA 2LKZA 4PKDB 2M88A 1M1KT 5DDRC 2MHNA 2RU3A 2DNHA 4QPTA 3VAJA 3R27A 2CQDA 2RVJA 3V4MA 3CCVS 2G0CA 2RS8A 1IQTA 2DNRA 2LQ5A 2KN4A 3I56S 1YWXA 3RW6A 2DIUA 1X4AA 1SJ4P 2LXIA 2DNLA 1WEYA 4WIIA 2DB1A 3SXLA 3B4MA 3BO4A 2CQ3A 1Q86T 1FHTA 1VC5A 4CH0S 2OTJS 2CPHA 3VAIA 1VQ9S 2DGVA 3LPYA 5DDPC 2VONA 5ITHA 2OSRA 3VAHA 2FY1A 3PIOQ 3G4SS 2RNEA 3ULHA 4IO9Q 1Q7YT 4RU2A 1X4CA 2FC9A 1YTYA 2JVRA 1BY9A 5GAEU 5IM0B 1U1KA 4W90B 1JJHA 3S8SA 3J7YU 2JWNA 2DNOA 5D78A 4WF9Q 1X5OA 4F02A 2V94A 3L3CA 2L41A 5GMKa 4TU7A 3R1HA 1N88A 1L3KA 2N3LA 2CQCA 2E5IA 2M7SA 3BS9A 1M90T 5GAHU 2RQCA 2CQBA 1HD1A 4YUDA 2ADCA 1SJQA 2RRBA 3HHNB 2GO9A 2DH9A 4WCEQ 2DNMA 2MZTA 2M8HA 2CQPA 2AYBA 1H2VZ 2MKSA 2MY7A 1DHMA 2DGOA 2DNNA 1RKJA 1ZZFA 2M70A 3MUTP 5DDQC 2MJNA 1N8RT 4TU8A 1KOOA 1U6FA 2MZQA 2CPEA 2YH0A 1YIJS 1JMTA 3G8SA 1YHQS 3PIPQ 1CVJA 3DXBA 1Q82T 2OTLS 2MKCA 5LJ3Y 2DGSA 3VAFA 2AYMA 2MSSA 2DH8A 2QEXS 2CPYA 5FJ4A 1W2BR 1A7GE 5D77A 1U1NA 2CQGA 4FXWA 1R8PA 1KC8T 5BJRA 2CQIA 2DNKA 5CYJA 2I2YA 2YTCA 1X4DA 2J0QD 3Q2TC 3S7RA 1SJFA 3CTRA 2LA6A 4P6QA 2DHSA 3NMRA 2ZJRQ 1M5KC 1WI6A 1YJWS 2YKAA 3THPA 1QVGR 1VQ5S 2OJ3A 2AD9A 1VC6A 3K0JA 2HYIB 2MGZA 1VC0A 1OPIA 4OZ0A 2DGUA 3VAMA 4LIRA 1D8ZA 1KD1T 3NNHA 2KG1A 3MXHP 1NU4A 4Y0FA 2RRAA 1FJEB 4EGLA 3UWTA 3CPWR 2KXFA 1OIAA 3CCJS 2ERRA 5H1SV 3MUVP 3CUNA 2X1BA 3NS6A 5GVQA 1NO8A 2J0SD 1U1MA 1FXLA 2FPHX 4TLQA 2O3DA 3J7ZT 3CF5Q 3MURP 2F3JA 2N3OA 3EGZA 2HVZA 2KRRA 1X5PA 2QFJA 1S72S 4OZ1A 2LEAA 2MQMA 1WI8A 2DO4A 3TO8A 2EK6A 2SXLA 2MZJA 2CPJA 1X5TA 4PR6A 3NNAA 1X4BA 1M5OC 1FJCA 1UW4A 3S01A 3VALA 4U67Q 1UP1A 3P5TL 2LA4A 3CXCR 1OO0B 1K8AT 5DDOC 1HL6A 1G2EA 4FXVA 3G9CA 1M5VC 1WELA 5CXTA 2BOPA 2JRSA 2E5GA 3MOJB 2KYXA 2DHAA 3H2UB 3G6ES 1X5SA 3H2VE 1B7FA 1O0PA 1VQMS 1WEZA 2N7CA 2KG0A 1WTBA 3S6EA 1VQNS 4UY8T 1ZH5A 1OWXA 2N82B 2DNZA 2LXUA 2CPDA 3US5A 2CPXA 2F9JA 2MSTA 1HD0A 1SXLA 2G4BA 5LXYA 2KHCA 2KI2A 2KH9A 2MZSA 1UAWA 3R1LA 2E5JA 2WBRA 2DITA 1U1QA 1H2UX 2MQNA 2DH7A 4C0OC 4WFNQ 2MKIA 1YJ9S 4QU7A 4F26A 2KFYA 2UP1A 2XSFA 2E5HA 5HL7Q 3MD1A 1VBYA 2ADBA 2ZJPQ 2XS5A 1WG1A 5CA5A 1H6KX 2MY8A 5IFMA 2PE8A 2X1GA 5JVHQ 1URNA 1FT8A 4ZKAA 2X1AA 2X1FA 1VQKS 2U1AA 1K9MT 1P1TA 2D3OR 3D2WA 4WFBQ 2E44A 2M0GB 2OSQA 4YOEA 3LQVA 4TU9A 2K3KA 1PO6A 1H2TZ 3CCUS 2LEBA 3VAGA 3CCRS 3P3DA 2AYEA 4PRFA 4LMZA 1WHYA 2D9PA 2KM8C 1X4GA 2DGQA 2MZ1A 1U6BA 2LCWA 3UE2A 3UD4P 3U1LA 3JB9k 2DNQA 3UCUP 1X4HA 5LSLA 2MYFA 4YB1P 1U1OA 5GAGU 2MMYA 1YI2S 2QA4S 2FHOB 1QVFR 3NNCA 5EN1A 3CCLS 2CPFA 2DGTA 4J5OA 3CC4S 3SMZA 4WFAQ 3BO2A 2CQ0A 2CQHA 3Q2SC 2XS2A 2VODA 2EK1A 3G96A 1WG5A 2LYVA 2DO0A 1DBDA 2M9KA 2KXNB 2L08A 3TYTA 2VOOA 3NS5A 3CMAS 1PGZA 2CQ4A 3FEXB 4WKRA 1VQPS 2FC8A 1NJIT 5LSOA 3I55S 3IRWP 3CCES 2DNPA 4LJMA 3UCZP 1RK8A 2RUGA 1VQ8S 2MQQA 1Q81T 2GHPA 3P6YC 2RS2A 3UCGA 2KT5A 1WHVA 2MZRA 2LMIA 1VQ7S 2DGXA 1HA1A 2MPUA 2ZJQQ 4QU6A 4Y00A 2KXHA 3MD3A 5LXRA 3CC7S 3VAKA 1DZ5A 2OIHA 2CQ2A 2MGZB 4CIOA 1U1PA 1WF1A 5DM7Q 1AUDA 1U1LA 1WEXA 2MKHA 3U1MA 4UQTA 3UD3P 2L9WA 2VOPA 1VQ4S 3N9UC 1M5PC 3DLLQ 2M52A 2CPIA 3ZZZA 3BO3A 4ERDA 2EVZA 4CQ1A 2MQLA 4QQBA 1VQLS 5JVGQ 2HGNA 1KOHA 2AYGA 2D9OA 1VBXA 4F25A 1WG4A 1FJ7A 2YWKA 1YJNS 4CH1A 2M4MA 2CQ1A 5MLCV 4IOAQ 3CCQS 1S79A 2G1DA 3ZZYA 3IWNC 3MUMP 1QM9A 3CC2S 2M2BA 2U2FA 5HO4A 5GADU 1U2FA 2JX2A 3VF0B 1WWHA 1ZZNA 1FNXH 1XN9A 2CJKA 3MI7X 3G71S 3CCSS 2XB2D 1P27B 2DIVA 2BZ2A 4C4WA 2CPZA 1JJ4A 4BS2A 1D9AA 3OW2R 2NLWA 2J8AA 3BEGB 1VQ6S 4Z2XA 1X4FA 2DGWA 3FEYB 4A8XA 1DRZA 2RQ4A 3SDEA 3B4DA 3CCMS 2DNYA 3RW7A 2HGLA 1A9NB 2YH1A 2XNQA 2KRBA 2F9DA 2B0GA 3EX7B 3G8TA 3THTA 2J76E 2KVIA 2K8GA
chains in the Genus database with same CATH superfamily
1EP4B 2QSFA 2ZBIA 1WC1A 4PQAA 1SUQA 4KBIA 2RKIB 4DF4A 3LH2S 2MKJA 2E1CA 1U1RA 3TAMB 2IM0A 1CQMA 3PFOA 1YJTA 1VMBA 5BYRA 3TVZA 2VIHA 1IKXA 3GV7B 4J9NA 4IUFA 4ZIVA 1U8WA 2GX8A 2LP4A 2A3JA 4ZK7M 1YDLA 2MXYA 1R27B 4P2XA 2DXFA 4HDHA 1S9GB 4KGKA 1UPMB 2VF3A 4KH0B 2ZD1A 1M0SA 4OJGA 4RNFA 4ZLNA 5I3QA 3GIMA 4JI7J 1UVNA 2EC2A 1N5VA 5D0EA 5DQHA 3K5MA 4ID8A 5DZ6A 3WBZA 5C2GA 8ATCB 2W2PP 3BQ0A 1VFJA 2MDAA 3S1TA 5KT2A 3PKMA 3BGFA 3BH6B 4ED1A 2I38A 1YBTA 1JXEA 1RTHA 2GMLA 3CDBA 1FDNA 1YKWA 2W7PA 3OFEA 1IBCB 3MDFA 1VQOS 4FKYA 4IYQA 5DQIA 1K73T 2LQJA 1WF2A 2DHXA 4L72B 5DM6Q 4U8VA 3KTQA 3J81Y 2HBRB 2W2OP 4GMKA 1Y5NB 4NA3A 4ZVTB 3UO0A 4DX8H 4ZLLA 5K8PA 2H1YA 3UNYA 4BCAA 2QMWA 5A8RB 4OYXA 1LWCB 4DS5A 5F9NA 2MB0B 4MAKA 1RSCA 4B9UA 3SFGA 3KNGA 3OT9A 1WHXA 2YKNB 2MQOA 4EBCA 4IKAA 3KK1A 2LKZA 5KG7A 3GU0A 4F36A 2J8SA 2ZH1A 2GJFA 2IRUA 2VDIA 4K4YA 1GX6A 2CKWA 4AL5A 2Z30B 3LA0A 2MHNA 3W2VA 4F3MA 3RTVA 5J2MB 3CCVS 1UTAA 2VKRA 2WVBA 4MYUA 4UOCA 1HBNB 1RWUA 3LANA 2RS8A 3TEGA 1RAJA 3MCOA 3RW6A 3IA0A 2EBGA 4ICLA 4L74A 4ZP9A 4LSNA 2QL5B 2LXIA 5H9FJ 1SJ4P 1D0EA 2UU9F 3VGVA 1NDCA 4J9PA 2HHPA 3O44A 2W25A 3ZXWA 4LFCF 1OSCA 1XMBA 4DV6F 3R9LA 5F8LA 4N56A 1FHTA 4MKYA 3ADAC 3KG4A 3MGJA 4CH0S 5HVGA 4UY85 2CIMA 5KFXA 3I6PA 1WSVA 4KRWA 2NYHA 2DGVA 3QGIA 2JZ5A 5DDPC 2IA0A 2VFRA 1OQ6A 2W9CA 2DR5A 1HNWJ 5L8RC 2OSRA 1UZHA 2B4OA 1YVFA 1RTJA 4OYAA 3ZO7A 2DR9A 3J80U 1UPPA 2OPQA 1V3ZA 1S6UA 3O1LA 2F5GA 4CO2A 1Q7YT 2NCKL 3ONQA 4QOTA 5IT0A 4K59A 1YJ7A 4WFZA 2NSCA 4EFAC 4EK2A 4QWCA 1U09A 2FC9A 3Q24A 1WC3A 1BUXA 2JVRA 3QO9A 1BY9A 2W2NP 5GAEU 2XULA 2P2CB 4QJVA 4W90B 3EM1A 1REVB 4YHHJ 1TVRB 4H4OA 2XLJA 1HI0P 1NUEA 4G6VB 2BV3A 4M5MA 3MM9B 5HAOA 2HURA 3C6TB 4E98A 2YNIB 4K4XA 4RW9A 1X5OA 4GC7A 1C0UA 1T05B 3L3CA 3V5RA 3HSGA 4F2SA 4F02A 1JLAB 4CLWA 3LP2A 5CYMB 2HK3A 1L3TA 2CWKA 3PG9A 2N3LA 2QMUB 5GAHI 5F0WA 3LGNA 3R6LB 2M7SA 3BS9A 1M90T 2K7KA 2CNNB 1RT7B 1LOUA 2CQBA 3I0SB 4IFVA 3ZFVA 3QSYB 4NMLA 1FRXA 4LRFA 2AMCB 4YUDA 1VIXA 2ADCA 2MLZA 4ZCLA 2GW8A 4ZMMA 2HWTA 2XI3A 3QWUA 1LWFA 2GO9A 5KFIA 2DH9A 2P9GA 2YKPA 2DNMA 4WYWA 4BHQA 9RUBA 4A8MP 2AYBA 1H2VZ 2G2ZA 3FBCA 2C42A 2E9RX 2V34A 7FD1A 3T1YJ 2MY7A 3UR0A 4NXNF 3KNAA 4DN0A 3D1OA 1KSPA 4F0HA 3TW0A 4NZ0A 5KG1A 1LWCA 1NDLA 2BE9B 2GGPA 5KFFA 1N8RT 4TU8A 1Y11A 1FF2A 1KOOA 2NSBA 3M05A 5KG4A 3CO0P 3U02A 4Q0BB 1RJJA 1TKZA 2F7VA 4ZP6A 1I1GA 1Q78A 2UU9J 2YH0A 2ZDOA 3KLVA 3DMJB 3SYZA 4A8YA 4KPYA 3KMQA 4HHJA 3G8SA 4RJVA 1BLUA 2C3MA 2HQCA 4Y65A 2XLIA 3LGHA 5D0HA 4CCHA 3CJ4A 1Q82T 1NKEA 2A6MA 1LW0B 1Z2LA 1TL1A 2KL8A 3K5OA 2R7XA 1RHJB 3VAFA 2AYMA 2V50A 4P72A 3A12A 3KHRA 3DRSA 1S1UA 3HVRA 4IQMA 3PW2A 3K58A 2ZH2A 1BXNA 2D41A 2QYCA 3AOCA 3HLUA 3TANA 3BDPA 4LBHA 4L3KA 4C11A 4Q43A 1F0XA 2AEMA 4FXWA 3M2RA 1FD2A 4ZVEA 1R8PA 3OL8A 5CYJA 1TZ0A 3LGMA 3U1NA 2YTCA 3OHAA 1T03B 4JB8B 1PAUB 1N32J 4NLUA 2J0QD 2XCAA 2ZC3A 1UVJA 3S7RA 4C8NA 3CTRA 3RBXA 4ES3A 4LF5J 1FRLA 1LK5A 4PG4A 5KFCA 4JBCA 4P6QA 2ZJRQ 2VQEF 1NJXA 4IRKA 3I4HX 1M5KC 4K0KJ 2VB6A 4WJBA 3IC1A 2CDRB 1VC6A 3ILJA 1SIWB 1S6OA 1B3TA 3K0JA 2IAJB 4WKYA 1FJ7A 1R8AA 3CJ5A 2HRTA 3MPVA 4XK8C 1UVKA 2WZ1A 2Z2LA 1LW2B 2R8HA 3GE9A 2XMUA 2KO1A 3PV8A 4TYAA 2IM3A 2HK2A 4NCGB 3D0HE 4OZ0A 1HBMA 4WXWA 2ILYA 4M63A 1UKUA 2R7OA 5CYMA 3UN2A 3FMBA 4LIRA 3RBEA 1YJRA 5B0DA 2W9BA 1UA0A 3X1LB 1RHMB 4YY3J 2J0XA 1ZPVA 2GA7A 3N4WA 3AB2B 5E3CA 4ANEA 1KD1T 1HYSA 1IKYB 1F9HA 4WBFA 3KK3A 1BD6A 1S9EB 4OJ1A 3HO1A 2PFFB 3SSSA 4CTAB 3IO1A 3E3XA 2L9DA 3TX0A 3KJVB 4P75A 4IR1A 3M30B 1Q8LA 4KE5A 4EGLA 3PYEA 2B5JB 1PILA 2HVEA 4K2XA 1YZ6A 1TFWA 1WKLA 4LIWA 1S6PB 3CCJS 1U26A 2QZ8A 3VVTA 3MUVP 2OPPB 3MEGA 4FP9A 3NS6A 5EWFA 3HHLB 2XM3A 3CUNA 2NUUG 1U1MA 1FXLA 1RI7A 4GKKJ 1KVIA 2O3DA 3ETMA 3UFCX 2IPOB 4JV0A 3CF5Q 1HBOB 3PRVA 3C46A 2Y9HA 2F3JA 2EPIA 3EGZA 2HVZA 1FCAA 1BHNA 4PYAA 2QYGA 2DHHA 2QFJA 1TKZB 5EHHA 3GFXA 3QJPA 2LEAA 2XBPA 2IBOA 3KLIB 2DR7A 1DTQB 1YBAA 3DMJA 5A6PA 1GMWD 1J5OB 3T1YF 3FKBA 2H4YB 3FSIA 1TAUA 2ZH6A 2CJXB 4PR6A 3HULA 4DUYJ 4KYZA 1X4BA 3P4UB 3MR5A 2PMHA 1UW4A 3S01A 5CD4A 4LFAF 5DJBA 4R0JA 2B8PA 3H2LA 2OD6A 3NGUA 2YPYA 4ZITA 1K8AT 3GSDA 5DDOC 4C3KA 3AFGA 3CW2C 4FF1A 4JYAJ 1REVA 2ZUAA 3W5ZA 4LF5F 1WELA 1KTQA 3H5SA 2CZVC 3H2UB 4R8UA 4K4WA 2NXJA 4ZN1A 5AXNA 1DTTB 1NSKL 2NYIA 4C8MA 1WEZA 4ECQA 1S0NA 3ZTPA 2LXFA 1JKHA 1RAEB 2B7CB 2M3DA 1S5ZA 3GFZA 1VQNS 2JHEA 4USTA 4QYZJ 1X9SA 3BBFA 4ECYA 5KFRA 5F8MA 4NYOA 2WSEC 3L7PA 1R0AB 5J1PA 2HHXA 2LXUA 4U6PA 4X64J 3ZZPA 3US5A 4B3TJ 1JB0C 5KFHA 4NLVA 3BB5A 4N47A 3Q23A 3N5FA 2MLXA 4P10A 4P73A 3JSBA 4DR2F 1NK6A 5A0YA 2YX1A 1QAYA 3UDCA 3HM9A 1D9FA 1XNQJ 1HARA 3ILIA 5E2QA 2C3OA 1VRTB 5KAKA 1WACA 3TZXA 3JYTB 1HBMB 3JQMA 1QUPA 4F8RA 1RUSA 4UOHA 3J7AN 4HLBA 5D6GA 2E5JA 2WBRA 3FRZA 1XK8A 3DU5A 3FMWA 1U1QA 3AD8C 1S99A 3NCPA 5D4LA 2MKIA 3KLHA 4DI6A 4DX5A 5M2UA 2KFYA 2B5JA 1ZAWA 1VCTA 1S9EA 1GFWB 1HQEA 1OJ4A 3TVKA 5KT4A 1F5CA 3DGVA 1RE1B 2XCPA 2GQQA 4GVLA 2ZJPQ 2RDJA 1S6QA 3HT0A 4DUTA 2UUCF 2BXJA 4KHPJ 1H6KX 2MY8A 2V6AA 1VHFA 2PE8A 1URNA 1FE0A 1LQ9A 3TJ8A 5ETNA 2GJIA 2X1AA 4A8QA 1VQKS 3SQGB 4TY9A 1XR5A 3PO5A 3IGVA 4DR6F 3KWMA 3H4DA 1N5QA 1P1TA 3SV4A 1K9MT 2VUGA 4QWDA 3GJQB 2P8IA 3M2UA 1JLAA 4KO0A 4ZVUB 1JK9B 1HW9A 2H65B 2DKOB 3DI6B 1FESA 4YOEA 3SSQA 2HW3A 4BBYA 4DCJB 3A8EA 4FS1A 1HNXJ 3R8YA 4TY8B 2C2RA 2KT3A 4M8LA 2CZ4A 2QV6A 3KLHB 1CJVA 3DRYA 3W8PA 3CCRS 3IFEA 2OP5A 3CJ8A 2G13A 3FRYA 3JAMY 3KHHA 4B9LA 4I67A 1RA6A 2AT1B 4P52A 4TLRA 1WHYA 4OFZA 1C2PA 3JAMU 1GEHA 1LWFB 4OLPA 1NB2A 4NZ6A 3MMAA 3DYAB 2J6UA 4ZOSA 5DLGA 2D3ZA 1TL5A 2F1FA 3KOAA 1P8GA 3DOKA 1SV5B 4ZVQB 1FVQA 1R0CB 5DG7A 1I6JA 3OL9A 2G0IA 3IAM9 1X4HA 2E66A 2GJ2A 4QIVA 2GS8A 2LDYA 4LFAJ 4WTOB 4X66F 1B0TA 3BBCA 3BGUA 1UETA 4ECRA 2BJ7A 4JUZA 4JV5J 3GLJA 3GIJA 1JKHB 2AWZA 2H5JB 5KOXA 4DUZJ 4X64F 4EO6A 2VBWA 2QA4S 2FHOB 4M94A 2WONB 2JEGA 1B0VA 2CVIA 5F0UA 3CJ0A 4JI5J 2B43A 2HFZA 4Y28C 3KJVA 5D8HB 1PJ6A 4NASA 2DGTA 4R25A 1MSWD 4NWBA 5SUHA 3CC4S 3MF5A 2RF2A 4OZLA 2CQHA 3MMAB 3QIPA 4DV3J 3PX4A 2VODA 2VPWB 4ANDA 4DBQA 5HJYA 1TUGB 2VJVA 2LYVA 5C42B 2GZOA 4GO7X 1DBDA 2FTRA 1FRJA 4HT5A 3DGPB 2FVRA 3DHXA 2W7OA 3ISNC 3FEXB 2UUAJ 4XDCA 1NJIT 3EPIA 4BWJA 4V1Ak 5DGBA 1Y3JA 4JI6J 1DQ8A 3I55S 1U24A 4Q5VA 2HHVA 2Z0GA 1ELOA 4HDGA 1HPZA 3CIZA 2FLNA 1GTHA 1RK8A 2RUGA 2PA3A 3NBPA 3ZNJ1 2MQQA 1J5OA 2VDHA 3QT5A 2K06A 3TZWA 2GHPA 1UWBA 5J2NB 3K57A 2VU5A 4ZP7A 2UXDJ 1WHVA 1RTIB 4ZVPB 1MROA 1PIEA 1S1TB 2LFVA 2LMIA 2VH7A 3LOUA 4AD6A 4CLSA 4DF8A 1SL0A 2HMIB 4IFYA 1F1BB 3MEDB 2MPUA 1AFIA 1V9OA 1DFDA 4QU6A 4O0NA 3MCSA 4Y2KA 3FC9A 3IR6B 2VG5A 4WP3A 3WX4A 2ZM6J 4RW8A 1DZ5A 2XMWA 1TKXB 4JI8F 3VGTA 2WK4A 1F2GA 3JSMB 1UJ6A 1AA1B 4R5PB 4RU9A 2XGPA 1X8DA 1IWAA 2GIRA 3CVKA 3U1MA 3SFUA 2L9WA 2VOPA 1T3NA 3NAHA 4FPRA 3MCMA 3EVWA 4LRCA 1HYSB 2NR0A 2VPYB 5HQLA 3IBFB 4Y3CA 2OGUA 3KLEB 3GG0A 2EVZA 2EI5A 1REGX 4ELUA 5A6WA 2BANA 3HSDA 2BJ8A 5JVGQ 2EFOA 2HGNA 2K7JA 4C2MA 3NEKA 3V6HA 3OTCA 1AFJA 3E01A 4M5IA 3BSAA 3TUZC 2HBQB 2VC1A 1VRQC 2B4PA 3HP6A 1O6XA 4NLGA 3BYPA 4DV4J 3IGNA 3PZPA 2HS4A 2DEIA 1FRHA 2V63A 5ETTA 4ED0A 5J2QB 2ASDA 4CM2A 1E6VB 2CXEA 1T0TV 1TL4A 2CQ1A 3AA9A 3QRRA 2VG6B 3FZ2A 2PI5A 1WC0A 4Q2MA 2MHEA 2VV5A 4OI1A 4RW4A 1IKVA 2WONA 3TJ9A 3IN5A 3CC2S 2M2BA 4I7FA 4NMXA 5HO4A 5HVHA 4FF4A 4O3NA 1VJQA 2QTWA 2JX2A 4ED7A 1IBKF 3W2VB 2VG7A 5K8MA 4RLEA 2JNJA 5FLXY 1ZZNA 4FNHA 1XN9A 4IG3B 2IIHA 2W24A 1BWEA 2DIVA 4KKOA 1HW8A 2BJ3A 2B7BB 2ZVIA 1JJ4A 3H0PA 4ETZA 3GR1A 3DGPA 4ZCIA 3OW2R 2IDLA 2YNFA 4X4SA 2BYCA 4ID5A 3MPDA 2COLA 2Y1RI 3BEGB 3SQGA 5CD4H 4XAKA 3FDSA 3PW7A 1VQ6S 2DXEA 2FHJA 2ZD1B 3BKUA 1RCXB 2Z8QA 3H42A 4Z2XA 4CM0A 1DRZA 2YKQA 4KY3A 3DRRB 3B6BA 2IFXA 3SDEA 4ZLPA 1EKRA 1Q5VA 3NBPB 4DV3F 1R6VA 2AQ4A 5F8JA 3A3NB 3QFHA 1UWBB 4I68A 5DZ7A 1RA7A 5J2NA 2B0GA 3EX7B 3G8TA 1NSPA 4CI0B 3T1HJ 3L95X 2J76E 1HPZB 1JXLA 3NWGA 1NH8A 2ATLA 2AJ2A 1S4FA 2JFKA 1SJ1A 2KU7A 3BREA 1YRUA 4DHVA 4NLYA 1QUVA 4TVAB 1N36J 1Y5IB 2ATCB 4CWBA 4ED5A 1SQGA 1VRUA 1RAGB 1JLQB 2OHDA 2YWWA 4IH5A 4DR5J 1RACB 2HLUA 2EFVA 3O3LA 3T1AA 2J9CA 2QA4G 3SQOP 1I94J 1WC5A 3HI9A 4M5DB 1AUSL 5IM0A 2GIQA 2B51A 1S97A 4C8KA 5GMDA 3CD6S 4X4UA 1URRA 1N0VC 3IBCB 1JIHA 3DRRA 3CJKB 3SDEB 4CYUB 3C66A 5FLXU 1MMNA 1RT4B 3LTOA 2V2KA 3NMAA 3K17A 2RB7A 5L38A 2ZM6F 4IOCQ 1UFWA 5HSPA 3K59A 2FHJD 1TL7B 1FWKA 3W9IA 1WHWA 4RUAA 1F9FA 2QLJB 4ZVSB 4LSLA 1QD1A 1V5IB 2L3MA 1V3RA 2AJ4A 3FVYA 3Q86A 3RJMB 3UDLA 4QBUA 2YPZA 1HQEB 1SJ3P 4HTJA 5JJBA 3MR3A 3DDIA 3KLEA 5E3PA 2C1EB 1N48A 2FJWA 1ZAXA 2YBVA 1AB8A 1X4EA 3EMTA 3W61A 4QWAA 1Q8IA 1KQGB 3PRBA 1N56A 1IBLF 3Q8VA 2XMTA 1NHVA 1X0FA 2PMZD 3GR0A 4QW9A 3O2IA 3E2EA 2HGMA 2DNGA 2M8DB 1KQSR 2HZCA 4QYRA 4RUHA 2HG4A 1PBAA 1TKDA 1S12A 2IYIA 2W1BA 3O8WA 2HRYA 3BGLA 1XMOJ 4ENOA 4A48A 3MMCA 2ZH8A 1UCNA 1KLMB 4TYBA 4MK9A 4G1IA 4DJBA 1NK9A 1R89A 2FLPA 1NSQA 3CCZA 4YMEA 1RTDA 1MN9A 5HROA 4PKDB 2M88A 3OUYB 1M1KT 4D3GA 1WDDA 1S9FA 1H73A 1SC6A 3HHKA 5MAOA 2RU3A 1ACMB 4QPTA 3OTOJ 1NXIA 3VAJA 1C0TB 2JLEA 1KQKA 1JNRB 3OTEA 4DEZA 4JI2J 3AJ2A 3K8VA 2ZEJA 4UQGA 1IQTA 2DNRA 4OLOA 4F0KA 2LQ5A 4RO0A 3I56S 3TQ1A 4DX7A 2R2UA 2DIUA 2GCFA 2OI2A 3HPOA 2R9LA 4RNOA 3IG1B 4WTYA 1NLKL 2BR0A 4PQUA 2UXBJ 2AV5A 4DX6A 4WIIA 2DB1A 3AY0A 4P7VA 2EFPA 4LF6J 1TKTB 2CQ3A 3MAAB 3LP2B 1AROP 1X0PA 5LSRA 4R5PA 2GAHC 3DLEA 4RW7A 4JI3J 4DLGA 4UTGA 3GQCA 4PWUA 3VVUA 2CPHA 3C14A 3W63A 1VQ9S 5H9FK 3H40A 4YHHF 4K4SA 1LWXA 1SH2A 1NHKL 2V4JB 2HQGA 1HR0J 1T9UA 1PC4A 3PIOQ 1N6QB 4Q8EA 2EXUA 4LVOP 3ULHA 3SSRA 3BGRA 3FFIB 2XO7A 4LR9A 5DG8A 4DV0J 4DLEA 4PG5A 3DLGA 2C2OB 1U49A 4CO5A 2FVQA 3PACA 5IM0B 3T1HF 1FJGF 3RRKA 1S0MA 1UJ4A 2B4VA 2LQ9A 1Y5LB 4RBUA 4DPOA 2HFUA 3JXOA 1UZDA 1HLWA 1RU1A 1CJUA 3J7YU 1XJWB 2JWNA 2DNOA 1HWJA 5D78A 5L1IA 2E29A 5HP1A 2V9KA 4UZCA 4C11B 3EPGA 3R2DJ 5GMKa 4QR1A 2PC6A 1NMEB 2BQRA 1I3OB 1SL1A 1WORA 4LREA 1U2CA 1CJVB 1FNOA 1LWEB 3KK3B 3BQ1A 2E5IA 3TX8A 4DN9A 2QE5A 2BE2B 4USWA 4OZ2A 1JLEB 4DR6J 4USUA 4F7VA 2HHHF 4C98A 2HBYB 3CD0A 3M30A 2D69A 1HD1A 1CJTA 1U0SA 5D15A 3F56A 3NXZA 3W65A 2HFOA 2IC3B 1SJQA 2F65A 4I69A 1Q8KA 3OXLA 3J7YI 4RL1A 3OFGA 1FKOA 4H4MB 2MZTA 4CLPA 2CQPA 4NLWA 1P9QC 1T9WA 1XR6A 2MKSA 2HWIA 4BDPA 3SBMA 4IG0B 1TKXA 1WC4A 2R7SA 1IKXB 3QFWA 1NPKA 1F3VA 3PFEA 2AP6A 4ECWA 1XNRJ 3MMCB 4WZQA 4NCGA 2DGOA 2DNNA 1RKJA 4JI2F 4JV1A 2M70A 4J9SA 1FDAA 1YGYA 2WB1D 5DDQC 4QW8A 1NB7A 4RX6A 1DTQA 4NLDA 4O0IA 4KC5A 5FDLB 1U6FA 2MZQA 2FUG9 1WOOA 3CJ3A 3TA0A 1YIJS 4X4VA 3PIPQ 3W5XA 4LF6F 2X3DA 6AT1B 2OTLS 2MKCA 1PJ7A 3ET6A 3R7SB 4TN2A 2FJXA 4PZVA 2ROGA 2BOAA 3H5UA 5LMNF 2DH8A 2QEXS 4ED4A 1C1CA 2CPYA 3DNCA 4NRUA 1E6YB 3F44A 5AE2A 3J7A1 4J9QA 4RBTA 3M6VA 4NEYA 1U1NA 2H51B 1TQLA 4RBVA 4P74A 5CCMA 4ZVRB 5BJRA 2CQIA 5M2PA 2I2YA 1L5UA 2I5JA 3CCTA 4I7FB 1NHUA 4PWWA 3BDEA 1DQ9A 1X4DA 1SQEA 4NXMF 2XWXA 1JLFB 1M1HA 5CH7B 1SQFA 5KFYA 2UUAF 2V4JA 2GV1A 2I6WA 3BR8A 3MR6A 4ZCKA 1HWLA 2E7XA 4DMZA 3THPA 2DTJA 1QVGR 3ILOA 5I4MA 3QT8A 1G1XA 3TEHB 4FYYB 4K4UA 1EETA 4FYVB 1GXTA 3P96A 3GIKA 1HNIB 4OJ3A 3ZTSA 1G3OA 1VC0A 3KUHA 2HQFA 4K50A 3HSJA 3DN9A 1JJCB 5D4OA 4OV6A 3W66A 2C2ZB 4CLZA 2QLWA 3C19A 3V4IB 4C8ZA 2JEFA 5CHCB 4HHUA 4FYXB 2FVCA 4R8UB 2O67A 2AEFA 3VQTA 4DL2A 5HBMB 1WTFA 1YJUA 4RNNA 1SH0A 1S1WB 3OTBA 2NUHA 4JOUA 1N33F 5KFQA 4XPEA 1FK9B 2V2QA 3W9JA 3A3OB 4HACA 4QZVB 1C0TA 2IVFB 3UWTA 1KS2A 2KXFA 4AXJA 4CT8A 8RUCA 3KHGA 4DSEA 5HLFB 2QA1A 1I51B 1QY7A 2ERRA 3RAQA 5KFSA 3KJNB 1RWWB 1S4EA 3T6BA 4Y2IA 5D4NA 1MWZA 1QE1B 2UXCJ 4KFBB 4M5JA 3MURP 2KVQE 1RT4A 4O3PA 1ZETA 3A8KA 3IAS9 4JI0F 2Y8YA 3K2YA 3N6NA 5DO2A 3CD7A 4DV4F 4ECVA 3TVYA 4Z7CA 2EK6A 3BV8A 4MIBA 5IC4B 3OVAA 3ZC4A 1U2RA 2UVUA 1FK9A 1T9VA 5RUBA 5G0RA 3M7VA 1M5OC 1FJCA 2HPUA 3DKDA 3M8RA 1NJWA 3PW4A 3LP0A 1CJKB 3VALA 4AXIA 2UUWA 4DZ6A 1TL3A 2BMBA 2UZAA 3PHTA 4G65A 4ZDNA 4F3QA 4AT1B 1K0VA 3P5TL 2NXCA 1NDKA 3H5YA 3ZZOA 2L48A 2CVEA 4DV5F 4HI1A 1G2EA 2IDEA 2JC1A 1M5VC 1GMWA 5M2RA 4MFBB 4LT6A 3AAWB 3H7HB 3Q8SB 3SCKE 1KVJA 1MN7A 2Z2ZA 1NCLA 1QTNB 2JRSA 2E5GA 3CD5A 1ZM9A 3KK2B 4WP8A 1BGXT 1TMMA 1X5SA 3EDQB 7AT1B 3FGVA 4OZ5A 4E0DA 1RTZA 4IOBA 2Z56B 5F3TA 3R7NB 4JI1F 3D28A 2KG0A 3I82A 4XIUA 2W2MP 2RUSA 2HWHA 2MLYA 3NCQA 3QMQA 3RAXA 5H9EJ 1V6HA 2FJEB 1JLFA 3O6QA 4Q44A 2E1MC 4RZRA 2X7IA 3BYRA 5L1LA 3FNNA 3IS9B 1BQMA 1ZH5A 2CG8A 4CLFA 2CPDA 5K20B 2CG4A 2K1RB 1IUJA 2CPXA 3OR2B 3QT6A 1RHQB 2MSTA 2CNKB 2EFQA 2H3EB 3NY0A 2DVIA 5LXYA 1AZSA 3C15A 2KHCA 3G87A 3VZIA 1RT6A 3W8GA 3KHLA 4B02A 1TMJA 4QWBA 2KI2A 3I9V9 3TAPA 2Z2YB 1UMJA 1PKUA 3I5CA 2KH9A 2OMOA 2WHOA 2W8LA 1WNEA 1TFYA 2B56A 4LSLB 1U6ZA 2J9DE 1SBRA 2MQNA 3CIMA 4I1TA 3GFHA 3NGKA 2I8EA 4QR0A 1C4AA 2GQ2A 4YR2A 4F26A 2F8MA 1UVLA 3P5BP 2HHWA 1MMLA 3A1YG 3TI0A 4MKAA 5KOWA 1VBYA 3IRXB 1N4LA 2YXLA 1WG1A 4QR2A 3PX6A 1X9WA 1EP4A 1RBLA 4ILLA 5IFMA 2HAIA 5B09A 4UZBA 1N5TA 5DS7A 2KHDA 3BPSP 2X1FA 3DLJA 1FERA 1Y0HA 1N33J 4WP9A 2NS1B 2AKWB 1V3SA 3JTPA 4QIEA 3D2WA 3R97A 1EIYB 3ITHB 2HRUA 4S0MA 2OSQA 4M5HA 2OKQA 1A0OB 2E9TA 3T9ZA 3LQVA 2R7QA 4Y34A 1S9GA 2QG9B 3OTDA 4IH6A 4WFYA 3CJSA 1ZTTA 2XY7A 1HR0F 3G82B 1APSA 3P3DA 6FD1A 3OPKA 2XS7A 4IR9A 2IMWP 2BANB 4FN5A 3M8QB 1FI4A 1RZMA 3AQPA 2D9PA 2MEWA 1H7XA 3TQEA 2DGQA 2VPXB 4OV1A 2MZ1A 4A8KA 1N32F 2NPFA 2LCWA 2QC3A 2HHTA 4MFBA 3UE2A 1K0TA 2GVZA 2EG1A 1S6PA 2CNOB 3MZIA 5IV3A 3UI3A 2VBYA 3JB9k 3UCUP 2XHWA 1K1SA 3KKFA 2ALYB 4DV2F 4RW8B 1NZAA 3LWMA 4OX9F 4IRCA 2JLFA 3DLKA 1W26A 3L9ZA 2MYFA 4CP5A 2ZH9A 3AQOA 1NZ8A 1U1OA 3UVJB 5GAGU 1N0UA 4DV5J 3W2WB 5BR8J 1GAOA 3V81A 1QVFR 5EN1A 2HHSA 5ETLA 3KMSA 1UVIA 4HI2A 2DBBA 3T5LA 3DOLA 5DGAA 1HKAA 3QGGA 4J5OA 4DV1J 3BO2A 3V6KA 3T6JA 4OI3A 4JI1J 3TA1A 2FHKA 4URSA 1NK0A 3G96A 1BQMB 2ZBPA 3MPUB 4ID5B 2DO0A 2EW9A 4NPOA 2L08A 2QMXA 4PEOA 2KXNB 3W5YA 1PGZA 2CQ4A 4O4RA 2VOOA 3DHWC 4O44B 2R8GA 4M1KA 5IOLA 2YNGB 4TQSA 3N5BA 1VQPS 2FC8A 1H7WA 2XY6A 2FJAB 2V8DA 5FIIA 1RAHB 1RLCL 5DG9A 4W4MA 2W9BB 3CCES 1QSYA 1N5SA 1RLDA 3AOAA 4RWXA 2HVIA 4HH1A 4O23A 4XTTA 2V5HG 4YS2A 1CS4B 5F41A 1CJTB 4CH7A 2ZBRA 2NREA 2AU0A 2F8HA 2RS2A 1NDPA 1X60A 4JI8J 5SZTA 1U8SA 4PUOA 2MZRA 2XG8A 1Q1KA 1VQ7S 1TL1B 4RNMA 3D1QA 1RTHB 1HA1A 2VICA 1TV6A 2YNHA 1MU2A 1ULRA 2LQBA 4ZJLA 2ZJQQ 4Y00A 4OI6A 5J2QA 4KKOB 4DFMA 3RB4A 2CUYA 3TUJC 5JMNA 2IRYA 2CQ2A 2HVDA 2LU2A 2HNZA 1IR1A 2VL1A 2YKMB 4NYPA 2DXDA 2MGZB 4CIOA 4RKUC 3IR5B 1ZA2B 1ZM2A 3D7SB 2B9YA 1ZA1B 3IXQA 5DM7Q 1AUDA 5HJXA 4Q7AA 4EMDA 2MKHA 1HQ2A 3UD3P 2O1PA 4B9MA 4MK7A 4GKJF 1M5PC 3NGSA 2M52A 3KDNA 1KONA 1J5EF 2VG7B 3I5AA 2YQ0A 5ETKA 1U4BA 1EHWA 5AT1B 2NQPA 4OZ3A 3ZZZA 5AJ3F 1HNZF 4ERDA 2VONA 2WSCC 4CQ1A 1FTCA 5T7LB 1XNRF 1OS5A 2I9SA 4I6WA 5E7OB 1Q95G 2CFXA 4Q45A 3PY8A 1MLAA 2VFSA 3KG1A 1LK7A 4B3MF 1OY9A 1MU2B 2AYGA 2D9OA 2D1CA 2P6TA 4PYDA 2V69A 3VWSA 4F25A 3NOCA 2RU9A 5J2PB 3GV5B 1R31A 1PBUA 3CJTA 2VFUA 2YWKA 1RU2A 3V6JA 2IRXA 2HNZB 1NBEB 2UUTA 1JLQA 2XZTB 1HBUA 3M8PB 3THVA 1VBKA 1UWAA 3D6HB 2OO4A 4HR2A 4N8OA 1Z1ZA 2E5LF 4X2BA 3M9MB 2V8GA 4OX8A 1FDBA 4M5NA 5KFLA 2J7WA 4DSFA 4IOAQ 2G1DA 3OL7A 3OJSA 4OQJA 3ZZYA 3IWNC 1IBLJ 3ZZUA 2AX1A 2Q3PA 3DLKB 3HCXA 2CJ9A 3QT7A 3J81j 3SV3A 2FHMA 4DR2J 3AXMA 5F8IA 2R2RA 3UVJA 5KT7A 3CDEA 2AJ0A 3DOLB 4J9UE 2PO4A 5KFKA 2AGQA 4B9NA 4Q0BA 3D3CJ 2ACMA 3IM8A 4WU2A 1NJZA 2QT7A 1H3DA 2XB2D 3BGOP 1SKUB 4FXDA 5I3UA 4NXMJ 1HWKA 2KB2A 2P9EA 2W7AA 3E51A 1S1UB 2NLWA 1NPPA 1HBOA 1PSDA 4H4KA 1WD6A 3CJQA 3FEYB 2V9WA 1HHSA 1UFKA 1LXJA 2GHVC 2RQ4A 3KK2A 1RWXB 2XC9A 3G6YA 1JLGB 3CCMS 3RW7A 4URGA 9ATCB 4DCPB 3N0VA 4DR5F 2Y0BB 2YH1A 2KRBA 1GNKA 2X3GA 3KJQB 4I6YA 4P2MA 3Q22A 3RBDA 3PJWA 2WW4A 4MK8A 5KFGA 4QWEA 4HACB 5JUMA 1YRXA 4CLYA 2KVIA 1YQHA 3KLFA 4K0KF 1RTDB 3D4JA 1OY8A 5IS2A 2XMKA 2E1PA 3F0NA 2MKKA 3DOMA 3OR1B 2CAJA 4QIGA 3EE3A 4PWDB 1HI8A 3C8YA 3DLGB 3CB4A 2VZ9A 4OI2A 2ASJA 3T19A 2DHGA 5ETPA 1WF0A 1N52B 1S1VA 1TV6B 3AXKA 3GONA 3R7BB 5E3RA 5IQQA 4Z37A 2F4FA 1U7LA 2F8EX 2UV8G 3ENAA 2AGPA 1PJ5A 2Q79A 2RAQA 3EGNA 1VBZA 1B64A 1RHUB 2FLLA 3MFHA 4U8YA 1KLMA 2DK2A 3R5DA 4OYWA 4WK1A 3K5NA 4DR1J 4DDFA 4WZMA 1Z2ZA 2VC0A 1AW0A 2HNDA 3MAHA 5KFAA 2V2ZA 1YG0A 1OMSA 4OHXA 5GAEI 4KGZB 4TKTA 1UEKA 1YK9A 3PEHA 3VGUA 2YQ1A 1PAEX 3KLFB 1R6YA 2KM8B 3HZGA 3P49B 1KKHA 5BXIA 4USJC 1FO1A 3PW5A 3M8ZA 4F3OA 4LF8J 3W64A 1JJ2R 1R0AA 3FK4A 3J81U 3DLHA 1VLOA 4C9DA 1RTIA 3NKYA 1FKOB 4H4MA 4CO3A 1RYRA 2NZ4A 2AJQA 3DYAA 2RT3A 1U0HB 4FDFA 4KAIA 5DETA 4ZIWA 1TVRA 2OLWA 2EFGA 2IA6A 4DR3J 3M9NB 2ABYA 2MQPA 4JI5F 1VGYA 3EJMA 4LVNP 3FUYA 2JL9A 2VQEJ 3M32B 4W92B 2ZH4A 3H25A 4IH7A 2YKNA 5KG2A 2HVHA 2XZWA 4LBPA 4AQYF 3L4BC 1SH3A 2ZKUA 3PR5B 1EZZB 1RHRB 2E1RA 1T9TA 3BSCA 3GP9A 1RT2A 3K7RA 3G82A 4K5RA 4X4PA 4OI4A 3GCWP 4I64A 1QSLA 3PXGa 4FVMA 3KK1B 3D9BA 5DDRC 2DNHA 3W1YC 3MECA 2CQDA 2RILA 2RVJA 3R27A 2G2OA 4MYTA 2G0CA 3V4MA 4DQQA 4ECXA 3OSPA 2GMHA 1VK3A 3PNIA 3UN3A 2KN4A 3JQKA 2J6TA 2YNHB 3HJVA 2CJBA 2ZC4A 4NCAA 1RT6B 1VI7A 2HS0A 1ITPA 4C8LA 1RBOB 2ZITA 2OEJA 2BUNA 5A2QY 1BWVA 3SXLA 2V4QA 2YKOA 3BO4A 3FSYA 5C7PA 4M5KA 3EWGA 4L76A 1VC5A 2V8HA 2BE7D 2ROPA 1QSSA 1CSJA 4TY8A 2C3YA 4PXEA 3D6MB 2UUCJ 4OYMA 3VAIA 1XR7A 1RT3B 2B6AB 4C97A 4NLQA 3AD7C 3H20A 2JOQA 2FY1A 3GIIA 1Q4RA 4Y2AA 3V6DB 4IO9Q 3SCJE 2W9AA 2BKOA 2OUGA 4TXSA 4I2QB 1X4CA 3A13A 4RU2A 1QJHA 2M5YA 4DOZA 1U25A 3OR1A 4H4OB 3WHIA 4N5SA 4DL7A 5K8OA 1SV5A 1RABB 2D3UA 2PDAA 4HL9A 3OHBA 2YWHA 3PW0A 3QO9B 5KFBA 3TAQA 4LUBA 2X51A 1W7WA 4RW9B 3M8PA 5AE3A 3S8SA 1IBMF 5B0AA 1IJFB 2HHUA 1E6YA 4WF9Q 1YBUA 1XMQJ 1JQGA 4NLRA 2L41A 2OH2A 4LF8F 4FBTA 4DZDA 4TU7A 4IQXA 4B17A 5CAAA 5EX0A 1N88A 5B0GA 3TR5A 3CGIA 3AHPA 4F2RA 5D0GA 1P6TA 1XTZA 5KG0A 3FBBA 2D3O1 2EWHA 2RQCA 1S0OA 2XLKA 1IR2A 3ET6B 2BRKA 2V8VA 4MKVA 3PKYA 2FVSA 2GVDA 4YB6A 4K4TA 2J6SA 2RMLA 1HBNA 1ZPWX 3NAIA 4J37A 5IQ6A 2QRRA 4A4JA 1M5SA 2APOA 2ZNYA 3HHNB 4JP8A 4WCEQ 1U47A 2M8HA 1HNWF 3QGPA 4DPTA 1QE1A 4OX6A 1D1UA 1DHMA 1YSJA 2QL9B 3QSIA 3UDVA 1C1BA 3N6LA 4ZVFA 2ZHAA 4C6AA 2GC8A 4B3SF 4LR7A 3BF4A 2I5JB 1FD8A 5KFUA 3UN5A 1ZZFA 3MUTP 4EZ9A 2HLTA 2C22A 2MJNA 2P6SA 2VQFJ 2XTJP 3V4IA 2V68A 3DI6A 4OMFG 1LFPA 1SB6A 3HVAA 3D54A 2DCLA 3CJ2A 3HHDA 4YEAA 4CO1A 5I3PA 5BYSA 1S49A 3B82A 2G1HA 4ZHRA 3BSOA 1JMTA 1M1GA 3O5TB 1YHQS 3QRPA 5KTQA 1CVJA 4DSJA 3LP1A 2JSXA 2PT0A 3DXBA 5T41A 1L3UA 3HXMA 5LJ3Y 1F5AA 1KBRA 4KGXB 4YB5A 2UVRA 2KZMA 2DGSA 2VFTA 3CT9A 3UDEA 4O3SA 1FVSA 2C2NA 2HFNA 4WXOA 2VASA 3LF0A 4YY3F 4F50A 2Y8WA 2HEKA 5HLFA 2ZDPA 3HJFA 1HBUB 3NP5A 1A7GE 2FZCB 4BC7A 5D77A 2O01C 2GO8A 1Q7LB 3JSMA 1TELA 5HMZA 3OVSA 3M1VB 3NGDA 2UXDF 2CQGA 3C6TA 2XMJA 1KC8T 1XQIA 4P71A 1Q0NA 2DNKA 2JLGA 1VQYA 1CC8A 1FFGB 3M6UA 3OV7A 1S1WA 1SPBP 4LSZB 1RAOA 4B3RF 3V6DA 1SJFA 2LA6A 4NXNJ 1WJ9A 2G0JA 4K8RA 4GKKF 2HFSA 2DHSA 1K47A 2HZAA 5IT9Y 1L3SA 4K4VA 1FTRA 4NA1A 1YJWS 1G4CA 2D7SA 1VQ5S 2AD9A 2BW2A 2RSQA 2J9DA 3LAMA 1ZOTA 2J7UA 2HYIB 1AXQA 3T5KA 2MGZA 2A0FB 1U45A 5L9NA 2F63A 5J1NA 5KFEA 1TK0A 1IQZA 1YLXA 4I2PB 5KFNA 1FA0A 2E9ZA 4WU3A 1K1QA 3BN7A 3PYGA 3VAMA 1K44A 3NG8A 4EU0A 4P9SA 3AT1B 4EUVA 8AT1B 1D8ZA 5B0EA 1HHTP 4Q8FA 5AXLA 3C3LA 3EGWB 4C8YA 2KG1A 4AYBD 1CLFA 2WVCA 3MXHP 4UW2A 4ES1A 3C16B 2HS3A 3I0RA 1IBMJ 1PC5A 1RGVA 3NRBA 3A8IA 4B9SA 1ZYQA 3OFHA 1NU4A 2CNLB 1RYSA 4MJKA 3HHLD 1NJYA 3MECB 2Q6CA 1FJEB 4OZJA 3CPWR 3NGTA 1XMOF 4ELVA 2ZWPA 1P9YA 3QPIA 4C3LA 4U7UD 1RWPB 5JXSA 4ECTA 2C3UA 1J5EJ 4CZCA 2OELA 2KKHA 4IFYB 4U9RA 2J0SD 3MPWA 2ILZA 5A8RA 3ZTOA 5KFMA 4WE1A 2FPHX 1J27A 3B78A 4PG6A 7FDRA 1VRTA 2R8JA 4B3MJ 2KFNA 1KTVA 2DD8S 2DY9A 3KLIA 2KRRA 4F67A 3L7OA 1S72S 1S59A 4OZ1A 2WRMA 2DO4A 3NS7B 2WVDA 4KHMA 4DWIA 2SXLA 3PTWA 4LRDA 4U7CA 2MZJA 4B3OA 2CPJA 1X5TA 3A8JA 3FZBA 3OUYA 3NNAA 3LW5C 1D8YA 4ZPAA 3T3FA 1BQXA 3MWBA 4QCLA 4YN3B 1S6QB 3WIUA 2PIIA 5ETRA 4N77A 3DRPA 3D5MA 2AZ3A 2CJAA 2LA4A 3QIPB 4KTQA 4FXVA 3VQSA 2RQKA 4MIAA 1S1XB 4KT0C 4ZN3A 1KRPA 4OHYA 3P8BB 5IT4A 5CXTA 4HEA9 1FX2A 1FFSB 2KYXA 1KHVA 2FDNA 2Y3YA 3K8WA 4FZVA 4OX7A 1QAJA 2ZZMA 2KTQA 3M1VA 3EYZA 1VQMS 3ITHA 4FVCA 3TUPA 1RT2B 3K5LA 5I42B 2R7VA 5C25B 4MTPA 5C24B 2YWGA 4CNYA 1B7YB 4ECUA 4V19J 3QGHA 1F3FA 3GIRA 2YWEA 3KG0A 3T41A 2Z57B 2FQQB 3D1HA 3CE8A 5A8KB 5E41A 2FJBB 3CJRA 2Y1IA 3RR7A 5D3GA 2R7TA 3OXGA 1S1TA 2N82B 2FLOA 2OPRA 2DNZA 4PPZA 2R7RA 3HHEA 3OBIA 2E7VA 1RAFB 3MTJA 2G4BA 1SXLA 4IDKA 1H98A 3Q0AA 2DJWA 5HATA 3JYTA 1BC6A 4DFPA 3OXFA 2XQCA 4MMOA 1RKIA 2XMVA 1MWYA 3MR7A 3RRHA 3PDNA 3TA2A 3HD2A 3KUGA 3ILLA 2MZSA 1UAWA 1VLYA 2FVPA 4HYKA 2Y1JA 1FEHA 2N4CA 3EUNA 1RT3A 2B6AA 1X7VA 4PAAA 4RUCA 3ENWA 5C25A 2J0WA 1CS4A 1KVKA 2RE1A 2ZUGA 4F0MA 4CLTA 4A8WA 4KHPF 5THWA 1TUVA 5KFJA 3JTOA 4USMA 4ED8A 1NRKA 2XSFA 5A8KA 4OJHA 2E5HA 4ZHRB 3I0RB 5HL7Q 3QLHA 3MD1A 1RWMB 2B9WA 3TUIC 4N7TA 2XMAA 1LEOA 2QFIA 2IC3A 3DCAA 1B0PA 2KYZA 2OPRB 3IWLA 4KGVB 5CA5A 3QWPA 1CPZA 2Z4PA 3HFKA 3H5XA 2X1GA 3HDSA 1FT8A 1PCAA 2JC0A 2U1AA 3DM2B 2PFDA 4ED3A 4FYDA 2VA2A 4WFBQ 2E44A 2M0GB 5B08A 3VZHA 2I1RA 3OSNA 4DR4F 3W7BA 1JLCB 2JFDA 1PYSB 5IV4A 3C14B 2K3KA 3U7JA 1FFWB 1PO6A 4F04B 2JEIA 3DRXA 1H2TZ 3SEOA 4C0HA 2BM1A 1BMQB 2IJRA 3JSYA 3RBZA 2V4RA 5H9EK 4NLSA 2R2SA 1KFDA 5T7LA 1R8BA 1JX4A 1S76D 1RWOB 2A10A 1LW0A 2NZCA 4FNIA 4O4GB 3FCWA 3WZ0A 4LMZA 3TZYA 3VV2B 2KM8C 1CQNA 2R3VA 3KUEA 3VTIA 3HD1A 4ITSA 4N8NA 4NLTA 3D6FB 1YZ7A 2XSJB 4NEZA 4ZVGA 3IM9A 3VHQA 5BR8F 5KFWA 1RT1B 4O3QA 5K5MA 2DNQA 1QTMA 4UOFA 2WVFA 1RXOB 2ZZNA 2XNRA 2YKMA 1OYDA 4ECZA 3WC0A 5HVFA 3C2PA 2OPSA 3HVTB 2VJUA 2HKEA 2QX0A 4YB1P 2WTFA 4RR5A 4NE9C 4DV0F 3GZ7A 3PO4A 2ZH3A 3PEJA 4Z7YA 2MMYA 4LBIA 4NYZA 1UEUA 2C2MB 4URQU 1T3OA 2HIQA 3NNCA 2GNKA 1VDHA 3FQLA 3CCLS 3V2UC 2RF2B 3R5JB 3CMQA 3QZ7A 2GHWA 3RGIA 4RW6A 2DR6A 2WB4A 3SMZA 4WFAQ 2CQ0A 1ZS6A 3Q2SC 3D67A 4I56A 1FRKA 2J7KA 2XI2A 1R43A 1VRUB 2F40A 2EK1A 4LSNB 4XO0A 3MTKA 5D0RA 2AX0A 5CABA 3TARA 1VQ8S 3GYNA 2IHR1 4AFFA 4RNHA 3GCXP 3OLBA 3NS5A 3CMAS 4ELTA 5HN0A 3PYDA 3H90A 2OPSB 4WKRA 3W60A 4LQ9A 5LSOA 4EWTA 3SIPB 2DNPA 1A6LA 4RW7B 2DR8A 4KPCA 1KEKA 3UR3C 4CTAA 2ZNZA 1LXNA 3M8WA 3UCZP 5IC6B 2FZGB 3FCHA 3LUYA 5HBMA 4X65F 3P6YC 5KG6A 3PM9A 2QO3A 2C2EA 1XMQF 4FBUA 4BC9A 4LFCJ 3MEDA 4UUWA 2OEMA 4DPWA 5HMXA 1Q8BA 1NKCA 5ADZA 1N6QA 4NCBA 4LF1A 1OSDA 2OPPA 1MROB 2QGFB 3MEGB 5KFVA 3G6VA 1NK4A 1KWMA 2XO6A 1RQ0A 1FXRA 3R5BA 2KXHA 4PXDA 2YNFB 1T8EA 4J9OA 1HIYA 1RAAB 2OIHA 2K1RA 2R42A 1H38A 3GYGA 4O3RA 1IBKJ 2IJFA 1U1PA 1WF1A 1YRTA 1WSRA 4ZJQA 1AZSB 3QJJA 3BQ2A 3QYYA 4KB7A 2Y1LB 1SC3B 2RIJA 3HF5A 4J9RA 3BBBA 3M6WA 1VQ4S 2XGQA 3N9UC 1RT5A 2PI4A 3OVBA 2Z2MA 1ROFA 3DLLQ 2F4VF 1WUUA 5I42A 3MEEB 2BQ3A 1PG5B 5F8NA 1RT7A 3I0SA 4IFVB 1SC4B 1F5BA 3LPEA 4QQBA 1VQLS 2ZOMA 2DT9A 2BW7A 3N28A 3CO9A 4OHWA 4OI0A 4DR4J 4JI6F 3W3SA 2ZKTA 3I5BA 4C0BA 4DU7A 1GH8A 3ETOA 4X4OA 1EETB 4G1PA 1VBXA 4PG7A 2L9NA 3HZEA 3PJXA 1VK8A 4MIWA 3SCIE 4LF9J 1NAQA 4ZVOB 1LW2A 1ZTWA 4DR7F 1N5YA 3L09A 2FB0A 2GMJA 5LMUF 5KFDA 5HMWA 1RT1A 4CH1A 2M4MA 3MMJA 4CDIA 5MLCV 4ZPCA 1KDNA 1L3VA 2YX7A 1KFSA 2IMOA 1EJ7L 3PX0A 1UW9A 1RWVB 2GGPB 2DRAA 2W4CA 4U95A 3MUMP 5DLFA 2VFVA 1QM9A 2QJ3A 3MEKA 2KFZA 4GVBA 2U2FA 4KV8A 1S10A 3BKFA 5AXMA 5GADU 3ZNUA 2ASYA 1FRMA 1U2FA 4NLOA 3GILA 5HMYA 1H0HB 1WWHA 2ZZTA 3BM7A 4A46A 5FDLA 1FNXH 4LFBF 1C4CA 4ZLJA 1SKWA 2CJKA 3MI7X 2BKPA 3CCSS 4DQSA 4TQRA 4KGMA 4DPYA 1P27B 2K3IA 3JS9A 4IG3A 1NSAA 2EKYA 1GXLA 3D3BJ 2CPZA 1GK8A 3DRSB 3H98A 3DOKB 4RW6B 3T9NA 3FQKA 1T02A 3QAUA 3TJAA 4UF4A 4HTIA 2HSEB 4EEYA 2Q6BA 1C0UB 1DURA 4X65J 1T05A 3C15B 4QIWD 4OYOA 1RB0A 2QL7B 5HANA 2A18A 3B4DA 3MOZA 2DNYA 1HWIA 2IJNA 2GFFA 3IWXA 4J7CA 5C5JA 3OL6A 2XNQA 4DQPA 4NL5A 4YDDB 2QLXA 2F9DA 2MQ8A 2WVEA 4ANCA 1SVDA 1DLOB 2E7WA 2RHQB 2BE2A 3MM7B 3MM8A 3W2WA 3W9HA 4ZPWR 2K8GA 4DXLA 4EBDA 3DFEA 5D3GB 4O4GA 4D3HA 3LP0B 3G2XA 4DR1F 1S7IA 2XY5A 3T5HA 2PMWA 1Q5YA 2XYGB 2YX4A 1RADB 4J9LA 3CMES 1N34J 1JWWA 5KT5A 2LECA 4JI0J 5CQGA 3NWRA 1U48A 3GMGA 3IG1A 2W8KA 1RWKB 1R8HA 3EGVA 3EXYA 3Q89A 4AUKA 5KG5A 1B4SA 3CJKA 4HH0A 4FPIA 3Q8PB 4ED2A 2CADA 3AJDA 3NGRA 1TU0B 3M2UB 4KO0B 3PR4A 1YX2A 3MAAA 2BDPA 4USVA 1JNZB 4DV7J 3W62A 4M95A 3M6XA 3TP2A 3C6UB 3MMBA 1YJVA 4NI2A 1F9EB 4NLPA 4B08A 5A2QU 5LL6d 4C8OA 2MJUA 1EAYC 4V19X 4C7QA 1W25A 2PEHA 4J91A 2ZE2A 4AE5A 3P45B 5A8WB 4LF7F 1YITS 2VKZG 3BPDA 3ENVA 3ZZRA 2EC0A 3QLHB 2H54B 4KIAA 4DG1B 5LMUJ 2W01A 4KJIA 1EARA 2JVOA 1CULA 1RCOB 1SJRA 3D0IE 3CULA 3IS9A 2ZWOA 2OFHX 2BM0A 3H59A 3AB4B 5ETQA 2VG5B 1TTHB 4KR0B 4I2QA 1TAQA 2GVZB 3ISZA 3WIVA 2LU1A 2BJDA 4OYBA 2DISA 1B99A 1N54B 2VBXA 3ISND 3RRGA 3BR9A 2KZZA 3KJFB 2RJZA 3PRDA 2FJDB 5AE1A 2BKNA 3F41A 4PABA 5LJ5Y 5L46A 2ADBA 2ZE2B 4YR0A 3TWZA 1S77D 3EZUA 2C2KB 4QPXA 5F3ZA 5HQMA 2R7UA 3G8QA 4L3NA 4LF2A 2RDIA 2OMLA 3QQCD 2ZHOA 4NRTA 3ZZ0A 3DC2A 4DL0C 4U7UK 1AYEA 5L1JA 4KQZA 5J1EB 1IWGA 4P2FA 4ES2A 3M9OB 2WOMA 4U96A 3RB6A 1Z4UA 4ER8A 1HNXF 3TRGA 2FD2A 2GVDB 1ZM3A 1AT1B 1YWXA 3Q83A 4P2SA 4WIQA 3FJ2A 1X4AA 4ZPVR 3CC7S 2BRLA 2DNLA 2OAUA 1WEYA 2MKYA 1WOSA 4DSKA 2LEPA 2LDIA 2EEYA 3B4MA 3BH7B 4DPXA 4LF4F 1VHIA 3EDRB 1Q86T 4FS2A 1GX5A 3D0GE 1DTTA 2RH3A 1EQ0A 4C48A 4OHVA 5CZVA 2OTJS 2FGOA 2P9CA 3AA8A 4I0WA 4UT4A 3R3TA 3EVMA 3LPYA 2O66A 6FDRA 5ITHA 2UXCF 3VAHA 3AH6A 2R8KA 4FF2A 1RWNB 5EGYA 3G4SS 2AZ1A 2RNEA 2HMIA 1IXKA 3CDWA 3M2VB 5B0FA 2Q1LA 1LV5A 4DV7F 4PUOB 1LKZA 1Y9OA 2A1BA 2HQIA 4QIFA 4DUZF 2RKIA 1VR6A 3HFVA 2CRLA 3HHLA 1FWLA 3Q8QB 4ED6A 1S57A 1YTYA 3PVXA 2CZ9A 1ICEB 1U1KA 1TP7A 2ZFHA 5A0YB 4LF7J 3QJLA 1IVZA 4I2PA 1JJHA 4FF3A 3RAMA 2Q66A 3K89A 3B8HA 3I31A 2O5DA 3R5CA 2B8QA 4L6V3 4KFBA 1JLCA 3VR1A 2CYYA 4W98A 2V94A 3NLCA 3OQ2A 1LWEA 3QAEA 1UL3A 4DL5A 3R1HA 5A8WA 1ZM4A 3D66A 2EFNA 1L3KA 2Y0SD 4WWSA 3HT3A 2CQCA 1WC6A 2IM2A 4DSLA 3NL0A 2UXBF 4DS4A 2ZH5A 4F4KA 3R5GA 2QLFB 4USIA 3RYLA 5GAHU 1Y7PA 3OD2A 5ETSA 4BWMA 1UEVA 3EXCX 1XC9A 2UVVA 4DQIA 3QBCA 3RR8A 4ILMA 2FIUA 1M5HA 3E01B 5FD1A 5F8HA 4OIXA 1GT8A 2BX6A 4KHRA 2KDOA 4WYLA 2RRBA 2GIFA 5HK4A 4J9KA 2HQDA 2VG6A 4K5SA 3SZ2A 2MTLA 2YNGA 3CEDA 3OJUA 4OYZA 5K14B 2B9XA 1RAIB 3MM9A 1IN0A 3WDOA 5LM7E 2LLZA 4PCQA 4ZA1A 1TL7A 3UQSA 1T9XA 4ZCMA 3T5JA 1UA1A 1SKRA 4IRDA 4X4NA 4Y2CA 2AJ1A 2CJQA 4DPUA 1QAIA 3H8YA 1HNVA 4EI2A 2CPEA 4HKQA 3OLAA 2CA9A 1MNEA 1R0BG 3HK2A 2PEBA 2RRNA 3RG6A 4LF4J 4F4XA 2A2CA 3BKTA 1FKPA 1RBAA 1T9YA 2MSSA 5L9XA 5GADI 2HIYA 3GV8B 3M4XA 4DFJA 3KDOA 4IO1A 4B3RJ 1FKAF 3NCRA 1MWQA 2DPJA 1W2BR 1FEEA 4ETXA 1N5YB 5FJ4A 5B7WA 4A8FA 2H4WB 3GSIA 3HSZA 3JTNA 1SI9A 3U27A 3KXDA 5EDWA 1IKWB 4M5GA 4ZS6A 3GTYX 3UPFA 3C6UA 2ZOFA 4E8UA 4I6AA 4KSEB 1R8CA 4GVBB 4KV8B 5KFOA 1D09B 1DARA 4ZP8A 5C24A 3Q2TC 1GMVA 1W2IA 2A6OA 2QSWA 3I9ZA 2IVMA 3B54A 3IBWA 4CNZA 3NMRA 4JI4J 2H9ZA 2OPQB 1KP6A 1HFEL 1WI6A 3KFWX 2YKAA 4X66J 5BYQA 4N41A 4A8SA 2OJ3A 3IMQJ 4DFKA 5J2PA 4N76A 3GG1A 1S1VB 4DSIA 1WKKA 2VA3A 1Q16B 4RUBA 2NPIA 1OPIA 2CJYB 4X4RA 3GPAA 1HWUA 2WAQD 2FZKB 3J7Z5 2DGUA 1ZBTA 1S1XA 5G4DA 3MHYA 5LMNJ 1F60B 1RDRA 5K8NA 4B3OB 4RW4B 3NNHA 1HQUB 3EVOA 2JH3A 2ZH7A 2BACA 1CEZA 3BJYA 4B9VA 1MG7A 2A2DA 4OYPA 3WQPA 1UFLA 2J5AA 4DV2J 1JLBB 1IM6A 4Y0FA 1DAXA 1GXUA 2RRAA 2IBKA 1HHQA 5J1EA 3HKWA 4AQYJ 3FBEA 1GQEA 4H54A 2R4FA 2AEJA 4JI3F 3N01A 1OIAA 4JI7F 1PYTA 2DRBA 4FYWB 2XHCA 1SUQB 4TNOA 2F4VJ 5H1SV 2AIRB 3DDNA 2X1BA 3L7UA 5GVQA 1NO8A 2C28A 1C1CB 1DY3A 1QLNA 4TLQA 3J7ZT 3M8SA 2ROEA 5E3QA 4IDKB 5B0BA 3QRQA 2N3OA 3M8YA 3MMBB 3M32A 3ELHA 1VJWA 3KLGB 3PHEA 2KT2A 3DLBA 4BLGA 1X5PA 2PA8D 4YFUA 5DQGA 1FJGJ 3EICA 1HMVB 2AJFE 2MQMA 1WI8A 2V0NA 5EX3A 1BE4A 3TO8A 3Q8UA 4NA2A 4LF9F 4DR7J 2GQCA 2BQUA 1JLEA 3Q8YA 3HMJG 3V81B 1V5VA 1P1LA 4A8OA 3X3UA 1XIQA 4ECSA 2NXNA 4G1QA 1TR0A 1CULB 2ZBQA 4XDDA 3DOMB 5EWGA 4NX9A 2PGCA 2CDQA 4U67Q 1Y3KA 5G0RB 3TOQA 1UP1A 2QLBB 4ILRA 5ETMA 1OY6A 3GJTB 5C42A 1RP5A 2V67A 4A47A 3LWLA 2XZDB 3AD9C 1OO0B 4P7TA 3CXCR 1HL6A 4IG0A 5GAGI 3F73A 2DYAA 2XMMA 5L1KA 1FDDA 1Q79A 5T14A 4JV2A 2Z58B 5CCLA 3G9CA 4X84A 3DU6A 4DUYF 4AL6A 4MT1A 3KLGA 3DDKA 5HI7A 2BOPA 3GWCA 3G6ES 2DHAA 3MOJB 1KHWA 3H2VE 3M2RB 3OFFA 2W2QP 4FKXA 1IKVB 2YQ3A 3KYLA 2DCUB 1B7FA 1O0PA 2B3TB 3HKZD 4DL4A 1KN6A 2N7CA 1WTBA 1VYAA 4F4AA 3MFIA 1HI1A 1NPRA 4Q2LA 3S6EA 3AJ1A 4CT9A 2VHGA 3CNQP 3QATA 1S7HA 4UY8T 2C2DA 1VQSA 4EZ6A 1F6TA 3QZ8A 3CSKA 3MPYA 1OWXA 1EKSA 3LP1B 3ZZTA 4C3MA 1Y00A 3G86A 4LRAA 1DQAA 1D9DA 4J90A 3IR7B 1O8BA 3DM2A 2YVSA 2G2YA 2YY3A 2F9JA 3RZAA 1HD0A 5AJ3J 1HNZJ 2FGCA 2XSJA 2IVYA 2BBEA 4ICLB 3H4BA 2R7WA 3AODA 4JI4F 1S48A 2JDJA 3GYXB 4X62J 2JEJA 4L73A 3R1LA 1N34F 5K14A 3G6XA 1S0VA 4USKA 5ETVA 4RWWA 4K4ZA 1LFWA 2QN6B 2DITA 1H2UX 3WC2A 2W4PA 1FWPA 2DH7A 1IM4A 1KQFB 4C0OC 4WFNQ 1ZAVA 4B3TF 4DU8A 3R5AA 5E33A 3TNVA 5HROB 1YJ9S 4DR3F 2NXUA 1T7PA 3PJ9A 4QU7A 1RHKB 2UP1A 4B3SJ 2JJ4D 4M5LA 2HBZB 1XNQF 1MMDA 4J9VA 3UD5A 3UW1A 4EO8A 4OX9J 1JLBA 1FRIA 1FNMA 2DPIA 1CJKA 2XS5A 2VQFF 1XEZA 1FKPB 4DL6A 4GC6A 2BA9A 1TK5A 1F2HA 4LRBA 4ATNA 5JVHQ 4ZKAA 3SCLE 4KH1B 1E6VA 4PQUB 5KG3A 4YQWA 5HQ8A 2XWYA 2HAFA 3FBFA 3AOBA 4CYUA 3MM5B 1C1BB 4YB7A 4XPCA 2D3OR 1IKWA 1U02A 3JSRA 3WX8A 2YNIA 4NLXA 2QIFA 5D4PA 4TU9A 1N36F 4HVZA 2XYPB 1R7IA 1XERA 3HVWA 2EKNA 3CCUS 1HMVA 2LEBA 3VAGA 4CO0A 1I94F 1CBKA 2AYEA 2HQ3A 1EQMA 5AXKA 2H5EA 4ZJOA 3R2CJ 2KJWA 3RUBL 5IZHA 4PRFA 4ZPDA 2KJVA 3BGRB 3FFIA 3TAMA 1X4GA 3NOGA 2IM1A 5LT5A 4OL8A 2VBZA 1NM2A 4ZVHA 1U6BA 4F4YA 4HT7A 4OHZA 3ZTQA 3UD4P 3U1LA 5IWAF 3MCNA 3OR2A 2E1AA 1GTEA 5LSLA 1OPZA 4L75A 4CLUA 4WE1B 3HX9A 2K2PA 2W4DA 2HZVA 3N79A 4HHHA 2PSZA 5F8GA 2ALZA 2D74B 2PD1A 3I4PA 3I87A 2LQ8A 3JQJA 3VGSA 1YI2S 2AW0A 3SI8A 1HQUA 2POKA 3R6GB 3CCWA 4EBEA 1G7CB 5A76A 4WFXA 2G9OA 2CPFA 4GO5X 1Y10A 3MEEA 1RTJB 2ZHBA 4DQRA 2AF6A 4WK3A 1XWLA 5KT3A 2HNYA 4LR8A 3IP0A 4X62F 3IRXA 2UVWA 5E5NA 4JV5F 2UUBJ 1HNIA 1VISA 1Q53A 3QIDA 2R8IA 3GJRB 2XS2A 4M5DA 1KR4A 1WG5A 3CDUA 3DRPB 3PCOB 4K2JA 3ZTRA 4G3IA 1Y4ZB 4O44A 2M9KA 5LOQA 3TYTA 1SCJB 4J9MA 2ASLA 1X9MA 5IT9U 3J80Y 3RB0A 1NNDA 2EBEA 3OTOF 3LAKA 2HHQA 1WKJA 1RT5B 1X31C 5L39A 4F4ZA 4PG8A 4USHA 2ZBCA 4AL7A 4GRSA 4RPFA 1FE4A 5CYQA 2CWXA 4X4TA 1NEEA 3IRWP 1PYOB 4MH8A 4MKBA 1WDTA 2HNDB 4OZNA 4UOGA 5EWEA 3POTB 4LJMA 3I96A 4YDXA 3Q8RB 1BQNA 1DLOA 3MM8B 1Q81T 3CWJA 1UJ5A 2FYXA 1VIOA 1SIZA 2BJ1A 2N4DA 3C16A 3A4TA 3I32A 3UCGA 5IXUA 2BEFA 5J2MA 2KT5A 1NK8A 3HFZB 2HNYB 4PPDA 2WSFC 3M8QA 2DGXA 4B9TA 4R0EA 3HHLC 2FY8A 1CC7A 5KFZA 5I3UB 3LALA 4K7QA 1SC1B 2YWFA 4F4WA 1WOPA 1T94A 1LNQA 2BVZA 2V8PA 1O51A 1U0HA 3GFYA 2RHSB 3MD3A 5LXRA 3PYFA 3VAKA 1RISA 4YP3A 1CJUB 4O3OA 4LQ3A 3EZOA 5K9FA 4CRJA 5C2CA 2OEKA 2XEXA 5F9LA 3MAQA 4EYHB 3FEZA 4WPAA 1T11A 1DJ0A 2WBMA 4DV1F 1U1LA 1WEXA 3ICLA 5CYQB 4PXCA 2UV8A 3MM5A 4UQTA 1VS3A 1T95A 2H5IB 1R3NA 1VOMA 1HNVB 1QAXA 5E3AA 3TZZA 4YR3A 2CPIA 2NXEA 1H72C 2BJEA 1D3WA 2VPZB 4E2FB 2DEJA 3BO3A 1XBWA 5IWAJ 1TUWA 2BJ9A 4CLLA 3BSNA 2MQLA 4DG1A 4OYIA 2RD5C 4PXBA 3UNGC 1TL3B 2VD3A 1MW7A 2GAGC 2OFGX 4PWDA 4NZ7A 1KOHA 3D6TB 4ZPBA 4EYIB 2P5VA 2N7YA 4Y2MA 1H74A 3VCDA 3RB3A 2OD4A 1WG4A 5KFPA 1G6BA 1NK5A 1UVMA 1O5JA 1TKTA 1GMUA 1JXVA 1I5OB 3CDAA 2LVWA 1YJNS 4LFBJ 2C3PA 2J9EA 2RQMA 3DLEB 5EUHA 2HHHJ 2XYHB 2FJVA 4NOHA 3CCQS 1S79A 2PN6A 3MM6A 4UUXA 4CO4A 3D68A 5KT6A 3K5PA 1NKBA 1QDUB 3MM7A 1NK7A 1T03A 5KFTA 3FSXA 3ENQA 2ACYA 2ZVSA 2H48B 3LO3A 3VF0B 4JYAF 2BABA 1FX4A 2HFVA 1EX8A 2I0XA 3GB0A 4G1QB 2IYGA 2RDDA 1CG2A 2WOMB 1TK8A 3RU0A 4QYZK 3FCVA 3GJSB 3G71S 5CZXA 5ETOA 2R2TA 4GKJJ 2WW8A 4X4QA 2BZ2A 4C4WA 2IAJA 2B4UA 4BS2A 1IR0A 1D9AA 3E8OA 2AHOB 5GMEA 1NH7A 2EG2A 1SL2A 4H4KC 2J8AA 1EB0A 5HP1B 2UUBF 2V2VA 2ZOGA 4NI2B 1X4FA 2DGWA 3BZQA 1IJEB 4ZPTR 4A8XA 4CLKA 1OYEA 1FXDA 4DCOB 3MM6B 4ALZA 3MR2A 2Q43A 3QNWB 2DY1A 4Y6IA 1BQNB 2QA2A 2HGLA 5U47A 1SKSA 2W9CB 1A9NB 3DXSX 3HVTA 2IY5B 1JLGA 2AGOA 1J2VA 1KLNA 1IKYA 3THTA 3EZ5A 4DL3A 1OQ3A 3BN4A 3N6MA 3POTA 5DRKA 5B0CA 1B70B 4I4BA 2E5LJ 3M2VA 2DRDA 4DV6J 2WCXA 5E0OA 1KNZA 3A3PB 2B9EA
chains in the Genus database with same CATH topology
1EP4B 2QSFA 2ZBIA 4PQAA 1SUQA 4KBIA 2RKIB 4DF4A 3LH2S 2MKJA 2E1CA 1U1RA 3TAMB 2IM0A 1CQMA 3PFOA 1YJTA 1VMBA 5BYRA 3TVZA 1IKXA 3GV7B 4J9NA 4IUFA 2GX8A 4ZK7M 2A3JA 2MXYA 1R27B 4HDHA 1S9GB 4KGKA 4OJGA 4RNFA 5I3QA 2ZD1A 1M0SA 4O0IA 1UVNA 3GIMA 2XS7A 1N5VA 5DQHA 3K5MA 4ID8A 3WBZA 3BQ0A 1VFJA 2MDAA 3S1TA 5KT2A 3PKMA 3BGFA 4ED1A 2I38A 1JXEA 1RTHA 2GMLA 3CDBA 1FDNA 2W7PA 3OFEA 3MDFA 1VQOS 4IYQA 5DQIA 1K73T 2LQJA 1WF2A 2DHXA 4L72B 5DM6Q 3KTQA 3J81Y 4NA3A 4GMKA 1Y5NB 4DX8H 5K8PA 4BCAA 2QMWA 5A8RB 1LWCB 4DS5A 5F9NA 2MB0B 4MAKA 4B9UA 3SFGA 3KNGA 1WHXA 2YKNB 2MQOA 4EBCA 4IKAA 3KK1A 2LKZA 5KG7A 2ZH1A 4K4YA 2IRUA 1GX6A 2CKWA 4AL5A 2MHNA 3W2VA 4F3MA 3RTVA 5J2MB 3CCVS 2VKRA 4MYUA 4UOCA 1HBNB 1RWUA 3LANA 2RS8A 1RAJA 3RW6A 3IA0A 2EBGA 4ICLA 4ZP9A 4LSNA 1SJ4P 2LXIA 5H9FJ 1D0EA 2UU9F 4J9PA 2HHPA 3O44A 2W25A 4LFCF 1OSCA 1XMBA 4DV6F 5F8LA 1FHTA 4N56A 4MKYA 3KG4A 3MGJA 4CH0S 4UY85 2CIMA 5KFXA 3I6PA 4KRWA 3QGIA 2DGVA 5DDPC 2JZ5A 2DR5A 2IA0A 2VFRA 1OQ6A 2W9CA 2VONA 5L8RC 2OSRA 2B4OA 1YVFA 1RTJA 2DR9A 2OPQA 1V3ZA 1S6UA 3O1LA 4CO2A 1Q7YT 4QOTA 3ONQA 5IT0A 4K59A 4WFZA 4QWCA 2NSCA 4EFAC 3Q24A 1U09A 2FC9A 2JVRA 3QO9A 1BY9A 5GAEU 2XULA 4QJVA 4W90B 1REVB 1TVRB 4H4OA 2XLJA 1HI0P 4G6VB 2BV3A 3MM9B 3C6TB 4E98A 2YNIB 4K4XA 4RW9A 1X5OA 4GC7A 1C0UA 1T05B 3L3CA 3V5RA 4F2SA 4F02A 1JLAB 3LP2A 5CYMB 1L3TA 2N3LA 5GAHI 5F0WA 3LGNA 2M7SA 3BS9A 1M90T 2K7KA 1RT7B 1LOUA 2CQBA 3I0SB 4IFVA 3ZFVA 4NMLA 1FRXA 4YUDA 1VIXA 2ADCA 4ZCLA 2GW8A 4ZMMA 2HWTA 2XI3A 3QWUA 1LWFA 2GO9A 5KFIA 2DH9A 2P9GA 2YKPA 2DNMA 4WYWA 4BHQA 4A8MP 2AYBA 1H2VZ 2C42A 2E9RX 7FD1A 2MY7A 3UR0A 4NXNF 3KNAA 4DN0A 3D1OA 1KSPA 3TW0A 4NZ0A 5KG1A 1LWCA 2GGPA 5KFFA 1N8RT 4TU8A 2NSBA 1FF2A 1KOOA 3M05A 5KG4A 3U02A 4Q0BB 1RJJA 1TKZA 2F7VA 4ZP6A 1I1GA 1Q78A 2YH0A 2ZDOA 3KLVA 3DMJB 3SYZA 4A8YA 4KPYA 3KMQA 4HHJA 3G8SA 4Y65A 1BLUA 2C3MA 2XLIA 4CCHA 3CJ4A 1Q82T 1NKEA 1LW0B 1Z2LA 1TL1A 2R7XA 3K5OA 3VAFA 2AYMA 3KHRA 3DRSA 1S1UA 3HVRA 4IQMA 3PW2A 3K58A 2ZH2A 2D41A 2QYCA 3HLUA 3TANA 3BDPA 4C11A 4Q43A 1F0XA 4FXWA 3M2RA 1FD2A 4ZVEA 1R8PA 3OL8A 5CYJA 1TZ0A 3LGMA 3OHAA 2YTCA 1T03B 4NLUA 2J0QD 2XCAA 2ZC3A 1UVJA 3S7RA 4C8NA 3CTRA 4ES3A 1FRLA 1LK5A 4PG4A 5KFCA 4JBCA 4P6QA 2ZJRQ 2VQEF 1NJXA 4IRKA 3I4HX 1M5KC 2VB6A 4WJBA 3IC1A 1VC6A 1SIWB 1S6OA 3K0JA 2IAJB 4WKYA 1R8AA 3CJ5A 3MPVA 4XK8C 1UVKA 2Z2LA 2R8HA 1LW2B 3GE9A 2XMUA 2KO1A 3PV8A 4TYAA 2IM3A 4NCGB 3D0HE 4OZ0A 1HBMA 4WXWA 2ILYA 4M63A 1UKUA 2R7OA 5CYMA 3FMBA 4LIRA 3RBEA 1YJRA 5B0DA 2W9BA 1UA0A 3X1LB 2J0XA 1ZPVA 2GA7A 3N4WA 3AB2B 5E3CA 1KD1T 1HYSA 1IKYB 3KK3A 1BD6A 1S9EB 4OJ1A 3HO1A 2PFFB 3SSSA 4CTAB 3IO1A 3E3XA 2L9DA 3KJVB 4IR1A 3M30B 1Q8LA 4KE5A 4EGLA 2B5JB 1PILA 4K2XA 1TFWA 4LIWA 1S6PB 3CCJS 1U26A 2QZ8A 3MUVP 2OPPB 3MEGA 4FP9A 3NS6A 5EWFA 3HHLB 3CUNA 1U1MA 2NUUG 1FXLA 1RI7A 1KVIA 2O3DA 3UFCX 3C46A 4JV0A 3CF5Q 1HBOB 2F3JA 2EPIA 3EGZA 2HVZA 1FCAA 2QFJA 1TKZB 5EHHA 3GFXA 3QJPA 2XBPA 2LEAA 2IBOA 3KLIB 2DR7A 1DTQB 1YBAA 3DMJA 5A6PA 1J5OB 3T1YF 3FSIA 1TAUA 2ZH6A 4PR6A 1X4BA 3MR5A 2PMHA 1UW4A 3S01A 4LFAF 5DJBA 4R0JA 3H2LA 2OD6A 1K8AT 3GSDA 5DDOC 4C3KA 4FF1A 1REVA 4LF5F 1WELA 1KTQA 3H5SA 2CZVC 3H2UB 4R8UA 4K4WA 5AXNA 1DTTB 2NYIA 4C8MA 4ECQA 1WEZA 1S0NA 2LXFA 1JKHA 2B7CB 2M3DA 3GFZA 1VQNS 2JHEA 4QYZJ 1X9SA 4ECYA 5KFRA 5F8MA 4NYOA 2WSEC 3L7PA 1R0AB 5J1PA 2HHXA 2LXUA 4U6PA 3ZZPA 3US5A 1JB0C 5KFHA 4NLVA 3BB5A 4N47A 3Q23A 3N5FA 3JSBA 4DR2F 1NK6A 5A0YA 2YX1A 1QAYA 3UDCA 3HM9A 1D9FA 1HARA 5E2QA 2C3OA 1VRTB 5KAKA 1WACA 3JYTB 1HBMB 4F8RA 1QUPA 4HLBA 5D6GA 2WBRA 2E5JA 1XK8A 3DU5A 3FMWA 1U1QA 1S99A 3NCPA 5D4LA 2MKIA 3KLHA 5M2UA 2KFYA 2B5JA 1ZAWA 1S9EA 3TVKA 1HQEA 5KT4A 1F5CA 2XCPA 2GQQA 2ZJPQ 2RDJA 1S6QA 2UUCF 2BXJA 1H6KX 2MY8A 1VHFA 2PE8A 1URNA 1FE0A 1LQ9A 2X1AA 2GJIA 4A8QA 1VQKS 3SQGB 4TY9A 1XR5A 3PO5A 3IGVA 4DR6F 3KWMA 3H4DA 1N5QA 1P1TA 3SV4A 1K9MT 2VUGA 4QWDA 3M2UA 1JLAA 4KO0A 1JK9B 1HW9A 3DI6B 1FESA 4YOEA 3SSQA 2HW3A 4BBYA 3A8EA 4FS1A 4TY8B 2C2RA 2KT3A 4M8LA 2CZ4A 2QV6A 3DRYA 3CCRS 3IFEA 2OP5A 2G13A 3FRYA 3JAMY 3KHHA 4B9LA 4I67A 1RA6A 4TLRA 1WHYA 4OFZA 1C2PA 1LWFB 4OLPA 4NZ6A 3MMAA 3DYAB 2J6UA 4ZOSA 5DLGA 2D3ZA 1TL5A 2F1FA 3KOAA 1P8GA 3DOKA 1SV5B 1FVQA 5DG7A 1I6JA 3OL9A 3IAM9 1X4HA 2E66A 2GJ2A 4QIVA 2LDYA 4X66F 1B0TA 3BGUA 1UETA 4ECRA 4JUZA 3GIJA 1JKHB 2AWZA 5KOXA 4X64F 4EO6A 2VBWA 2QA4S 2FHOB 4M94A 2WONB 2JEGA 1B0VA 2CVIA 5F0UA 3CJ0A 2B43A 2HFZA 4Y28C 3KJVA 5D8HB 4R25A 2DGTA 1MSWD 4NWBA 5SUHA 3CC4S 3MF5A 2RF2A 4OZLA 2CQHA 3MMAB 3QIPA 3PX4A 2VODA 2VPWB 4DBQA 2LYVA 5C42B 4GO7X 1DBDA 2FTRA 1FRJA 4HT5A 2FVRA 3DHXA 2W7OA 3ISNC 3FEXB 4XDCA 1NJIT 3EPIA 4BWJA 5DGBA 1Y3JA 1DQ8A 3I55S 1U24A 4Q5VA 2HHVA 2Z0GA 1ELOA