2ZDPA

Crystal structure of isdi in complex with cobalt protoporphyrin ix
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme-degrading monooxygenase isdI
publication title Ruffling of Metalloporphyrins Bound to IsdG and IsdI, Two Heme-degrading Enzymes in Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 30
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zdpA00
5B0GA 5B0AA 3KNGA 4YEAA 3FRYA 3BN7A 2OP5A 2ROEA 1KQKA 1OQ6A 3DXSX 1W2IA 3WDOA 1AFIA 1OSDA 1APSA 1OPZA 2K1RA 1SB6A 1TL4A 2OMOA 2VH7A 2OKQA 1WD6A 1YJRA 2BYCA 2OFHX 3BGUA 4Y2KA 5B09A 3IWXA 4DL0C 4OJHA 2N7YA 1OQ3A 3HHLC 1YG0A 1N5SA 4A46A 2KYZA 3KG0A 2N4DA 2XMUA 1JK9B 3LGNA 3T9NA 1P6TA 2GGPB 1U7LA 5T7LB 3HF5A 1FVQA 2QIFA 3I9ZA 3VTIA 1YRXA 3KKFA 3UDCA 2HLUA 3BR8A 5B0EA 1KVIA 1XBWA 1MWYA 2XMWA 3DCAA 2GCFA 2XMTA 4A48A 2HFNA 5KAKA 2HFOA 1JWWA 1GXTA 2FHMA 4ZA1A 2LQBA 2PGCA 3TNVA 1Y9OA 2GO8A 2OAUA 4HI1A 2KT3A 4Q2LA 3TOQA 1FESA 3HHLB 3CJKA 2XMMA 1CC8A 3KG1A 2ZDOA 4QOTA 1SQEA 5F0WA 1X0PA 1Y0HA 3FMBA 3HX9A 1FD8A 1TR0A 2BBEA 1TZ0A 1N5VA 2IFXA 2ZDPA 4EFAC 2PD1A 1K0VA 1IUJA 4HH0A 5B08A 4FNIA 2GFFA 4HI2A 2RMLA 2OD6A 2KT2A 1ULRA 3QMQA 2BJEA 4A4JA 1S6OA 4Y2IA 1FE0A 2GV1A 3HFKA 2FB0A 1KVJA 3K7RA 2LXFA 5B0BA 2K7KA 1FVSA 1P8GA 2AJ1A 2W4DA 3LO3A 4DN9A 2L3MA 4Q2MA 1MWZA 2K7JA 2AP6A 2AW0A 2IYIA 4DPOA 1TL5A 1CPZA 2ROGA 3F44A 5A6PA 1YJUA 2QLWA 3BB5A 1S6UA 2XMKA 1VQYA 3HHLD 3IWLA 1AW0A 1LQ9A 2VV5A 2BJDA 3BDEA 4FNHA 2RSQA 4NPOA 4A47A 2IYGA 4OJ3A 2FIUA 1R6YA 2HIQA 5F0UA 3HHLA 5K9FA 2K1RB 3HDSA 1Q4RA 3CJKB 2JDJA 2OFGX 2QYCA 2XMVA 1QUPA 4OIXA 1AFJA 1GXUA 1N5QA 4OJGA 2HQIA 1SI9A 1N5TA 1CC7A 1YJVA 2GA7A 2EW9A 4OJ1A 4U9RA 3MZIA 1X8DA 2ACYA 2LQ9A 3TRGA 1TUVA 2W4PA 4HL9A 2ASYA 2RU9A 1RJJA 2KKHA 2ROPA 5IXUA 1Y3JA 1Q8LA 2GGPA 1YJTA 5T7LA 1VQSA 5B0DA 1Q8BA 3BF4A 2XMJA 3BM7A 3MCSA 3QGPA 2QLXA 5B0FA 3GZ7A 5B0CA 1Q53A 3FGVA 2OD4A 2LDIA 1Y3KA 1FE4A 2AJ0A 4F67A 1X7VA 2K2PA 2BUNA 3LGMA 4YDXA 2FTRA 4Y2MA 3E8OA 2CRLA 2HLTA 2RILA 4HH1A 2G9OA 1URRA 2N4CA 2W4CA 2Q3PA 4NL5A 5A6WA 1FEEA 1V3ZA 4ZOSA
chains in the Genus database with same CATH superfamily
2V8HA 1UEVA 1VC6A 4FF4A 2CZ9A 2FQQB 3D1QA 3M2RA 2QX0A 2EC2A 4LSLB 4B9SA 3O8WA 2HZVA 1QSLA 1S97A 4ZA1A 3A3NB 2P9EA 4AE5A 1FI4A 5BXIA 2MY8A 2Y8WA 1OJ4A 2DHAA 4NMXA 1SL0A 3OFHA 2A3JA 3V6DB 2ZVIA 5ETNA 3RBDA 1U25A 1K8AT 3TA2A 2XMKA 3DI6B 1DLOA 2AKWB 4DG1B 3Q8UA 2WVCA 4F3QA 3ET6B 1SKWA 3GG1A 2HGNA 1M0SA 3CF5Q 4ETXA 4DL5A 4RW7A 1TL1B 4GC7A 2RQCA 3AB2B 3QAUA 2HZAA 3M6XA 8ATCB 4Z7YA 3R5AA 2QLJB 1UZDA 4C0BA 3IR6B 3Q86A 4DS4A 3TA1A 3HPOA 1OQ3A 4A46A 5H9FJ 3EJMA 3HT0A 2XZTB 1A6LA 2ZH7A 4WFNQ 3MAAB 1TFYA 1Z2LA 4XPEA 2MDAA 2B4PA 2HNDB 2XYPB 4B3TF 1R0AA 1H72C 1D3WA 3JSYA 2XTJP 6AT1B 2AX1A 3DKDA 4RBUA 4DN0A 3CMES 2HHVA 1VS3A 4CH0S 2J6UA 5KFAA 1LWEB 1U0SA 3DLKB 1NK5A 5ETLA 2E1RA 1FDAA 1FJGJ 3OBIA 3TUPA 1N34F 1S1UA 1NMEB 3V4MA 3LA0A 4LSLA 2BJ9A 2CPHA 4ETZA 2HS0A 1IJEB 2KKHA 1EP4B 1UFKA 4DV4F 2QG9B 2RUSA 1KR4A 1SUQB 1SH0A 3Q8SB 1B0VA 4NCGB 2QTWA 2WW4A 1S0OA 2V2KA 3QWUA 4IO9Q 1NU4A 2UUCF 3VZHA 3LQVA 2ZH6A 1XR6A 2NXJA 2H5IB 5A2QU 3V6DA 1FTRA 4F4XA 4HTJA 2V9KA 1MMDA 2KVQE 2GX8A 1NKCA 3CCRS 4M5IA 2XMWA 2VD3A 3ET6A 2EKYA 2BKNA 2HMIB 4Z2XA 2L9DA 4RUBA 2LP4A 1IVZA 2J6SA 3PW2A 4KH0B 3BR9A 1S4FA 3W66A 1ZPWX 2IVYA 4PWUA 5BR8F 6FD1A 1S9GB 1F6TA 3SV4A 4WBFA 1TL1A 5GVQA 2C2MB 4HACA 2GVZB 2H1YA 1F9EB 4O23A 2WTFA 1WORA 1XNRF 3SIPB 5KT7A 4JUZA 4OX7A 4ZVPB 3IO1A 2OIHA 3H59A 3VWSA 3H25A 4TLQA 4O3OA 3KYLA 3AB4B 2IM2A 1I94F 2HNDA 3HO1A 3E8OA 3OJUA 2OSQA 5KFLA 1WHXA 4YR3A 2RT3A 4CDIA 3T1HJ 3SMZA 1LWEA 3DLKA 2UV8G 1HHTP 1RSCA 2HFNA 3I87A 1X4BA 3VAIA 3DXBA 1S72S 3AOBA 4MKBA 3OXGA 2F9DA 1YDLA 1U1RA 1RAFB 2XY7A 2IFXA 2RE1A 3PW0A 4C4WA 3LP1A 1MSWD 1RWNB 1UZHA 3QGHA 2RU3A 5A8RA 4ZN1A 3A8IA 4NCGA 3UVJB 5K5MA 1SV5A 2E5LJ 2PEHA 2RQ4A 1T05A 2QZ8A 1XJWB 3P4UB 3H5XA 2W8LA 3GV7B 3JTNA 3MCMA 4IH6A 3ULHA 3QSYB 4NXMJ 3K89A 4R8UB 3CNQP 4O4GA 3MAQA 1NJXA 4YDXA 4ZVSB 1CQMA 2HMIA 2XO7A 1RTZA 4KSEB 1YQHA 3V81B 4FYWB 1TL4A 4ZHRA 1S9GA 4FYVB 3BO2A 4J9VA 3VVTA 2FJAB 5AE2A 4F4YA 4MIWA 2B7BB 3X1LB 2GVZA 3D0GE 2A10A 2CKWA 4WJBA 3OT9A 4LRAA 4B08A 1P1LA 4O3SA 2B4UA 3N79A 2H4YB 1NH7A 5KFWA 2VPYB 3D2WA 5AXNA 5FLXY 3MM6B 1HI8A 1K44A 3W63A 2GO9A 3PHTA 2LXUA 3PFEA 3SBMA 4KB7A 3DOLB 1G7CB 3R9LA 4OYPA 4DSJA 2I0XA 1R0BG 3I0RA 1GXUA 3G2XA 4RWWA 3A12A 1V5IB 4NLRA 4NLGA 3RRKA 3QYYA 4PXCA 4ZVFA 1FNMA 2GW8A 4CI0B 4MH8A 4EBDA 3FRZA 3O3LA 2CQ3A 1MN7A 2CDQA 1FK9B 3SEOA 5D4LA 3CJ2A 2FY8A 1TKZB 2U2FA 4QR0A 4K5SA 4NLDA 3ZZ0A 1RYSA 2F40A 3UVJA 2GGPB 3ETMA 1DHMA 2DNOA 3UW1A 2GO8A 4LR9A 2YKAA 4N76A 4AXIA 1L5UA 3ZZYA 4R8UA 3CIZA 3ZO7A 2ZH3A 2P6SA 4NLPA 5D4PA 4B3RJ 4XO0A 2YQ1A 4O0NA 2WW8A 3EPGA 3N5FA 4QW9A 3S1TA 4L75A 8AT1B 1S6UA 4KE5A 2IYGA 3QJPA 4RBTA 3V81A 3CD7A 1JIHA 3CEDA 1RHRB 4ZP9A 4CO4A 3GONA 2GAHC 2IDLA 4OHXA 3IBWA 5A8WA 1GFWB 3C19A 2MJUA 2HVZA 4M5DB 3MM8B 4DV5F 1ZM3A 2E5JA 2V6AA 3FNNA 1CJTA 4DU7A 1H7XA 4BC9A 4AUKA 1RHUB 2FD2A 4K2JA 2EVZA 4I69A 4O44B 3NGUA 3OL7A 3GIJA 2PIIA 2Y0SD 2ZJPQ 2N7CA 3MM6A 9RUBA 1WACA 3W1YC 4RUCA 4Y2AA 3C15B 3T1HF 4LR7A 4YHHF 2HG4A 2E1CA 4YS2A 3PW5A 2QL5B 3BEGB 1YLXA 1SVDA 2QFIA 1VRTB 4LF2A 1X9SA 2UVUA 4ECXA 2AJ2A 3EXCX 4OI0A 4K5RA 1FK9A 1O51A 4O4RA 4ED7A 3AJ2A 2VPZB 1HYSB 1TKZA 4KYZA 1HMVA 3I0SB 1RT7A 1X5TA 3AOCA 1G4CA 2GGPA 4P2XA 4M5MA 4DPTA 4NXMF 3KMSA 2FYXA 1RP5A 1WTBA 1WTFA 2FHOB 2NR0A 2BRKA 3P96A 2CA9A 1ZM4A 3NAIA 2OTJS 2HBYB 1P27B 3NKYA 4ZVUB 3U1LA 1M5VC 3R1LA 2CJQA 1TP7A 2HQDA 2JFKA 3KG0A 3THTA 3HF5A 5KFNA 1YWXA 2YQ0A 1IM6A 2MZ1A 1RHKB 2MQOA 3THVA 3DDNA 2AU0A 2E1MC 2BE7D 2F9JA 1Y5NB 1FRJA 3L9ZA 1Q5YA 1UMJA 4U67Q 2OUGA 2NUUG 4M5DA 3MM8A 3P3DA 1R8AA 5IC6B 2Z30B 4NPOA 2KG1A 5JJBA 4DOZA 2OHDA 3I9V9 2AMCB 3GILA 2DJWA 1TUVA 3DRYA 1U48A 2MLXA 1L3VA 4F4ZA 1RA7A 2Y1IA 1FD2A 1QAXA 4YB5A 5G4DA 3KG4A 1VQ9S 4FXDA 2U1AA 4LF5J 2UV8A 3GLJA 1HQUB 2DRAA 5MAOA 1VRTA 2I5JB 3J81U 3N5BA 2BYCA 1FKPB 1DQ8A 2J9CA 3MR2A 2EK6A 2VONA 1WC5A 4LMZA 5CYMB 2Y9HA 2R7OA 3Q2SC 2BE2B 1ZZNA 4DFPA 4PG7A 2DNYA 2UZAA 2HFOA 1LWXA 1HYSA 2MEWA 3C8YA 3NS7B 3TARA 4Z7CA 1FDBA 1RE1B 3KHHA 3G86A 2JC0A 3DFEA 3GFXA 2FJVA 4DSKA 3IBCB 1UCNA 2AEMA 3B4MA 3D66A 3PEHA 2GQCA 4EO8A 4B3RF 3DLJA 5F8MA 2M70A 2V8PA 3MR3A 1KHVA 4KGVB 5KFUA 4JI5J 3E51A 1WF0A 2ZKUA 3CCQS 2XC9A 4RW4B 2ZBQA 3J81j 1YRTA 1JXEA 2ZBCA 4ZPBA 2HFUA 3AHPA 3D1OA 3G6XA 3I82A 2HHSA 4USUA 1NK4A 8RUCA 2XSJB 2X1FA 1S12A 2MGZA 4Q0BA 1NB2A 1IR1A 5CH7B 4USIA 4PCQA 4RNFA 2LYVA 2MLYA 2VDIA 5B0EA 4L6V3 2L9NA 3OFEA 1SPBP 3NP5A 4LFBJ 2DO4A 4DI6A 3W2VB 5GAHU 1J27A 4OYWA 1GQEA 1IUJA 2YX7A 3TAQA 1ULRA 4MTPA 1WC1A 5DM7Q 1I1GA 3QPIA 4PPDA 2VG5A 3FBCA 4ICLB 4X64J 2AW0A 2HPUA 2ZD1A 3A13A 4KTQA 2I5JA 3ENWA 5L38A 2BJDA 1KD1T 1JJCB 2HIQA 4DSEA 2CADA 3TUZC 4WE1A 2E9RX 1Z2ZA 5E2QA 2AX0A 5BYQA 4F04B 2BE2A 2JLFA 4ZVTB 1RTIB 2Z0GA 5A6WA 3MFHA 2BQRA 1C0UA 3SXLA 3AOAA 3L3CA 3GE9A 2D3O1 2OFHX 4W92B 4C8MA 2LDYA 2E7WA 3NMAA 4ED0A 3J7ZT 1XWLA 4ZCLA 2YTCA 4QWAA 1K0VA 1IN0A 2F7VA 2KT2A 4C0OC 5HSPA 1S6OA 4KH1B 3DGPB 2C28A 2AZ3A 2FLNA 2MMYA 4RW4A 3FEXB 4QYRA 3CC2S 3I4HX 4X65J 5J2QB 2CPXA 5ETSA 1SH2A 3DOKB 4IRDA 5MLCV 5DQHA 2DIVA 1S1WA 3MMAA 5A2QY 2UVRA 1N5TA 2HHHJ 4ZP8A 3MEKA 1RADB 3DHXA 2OD4A 3EDQB 5IT9Y 2GHPA 2H65B 5AE3A 3CCZA 3NGDA 4ZOSA 4ED1A 1EKRA 2E7XA 1B3TA 2VA2A 2XHWA 3TJ8A 4TU8A 3ILOA 4FF2A 4LIRA 3ITHA 5L1LA 2OTLS 3TR5A 1ROFA 2JLEA 1ZAXA 1VCTA 4M5KA 4AT1B 4B3OB 1DQAA 3KG1A 3DLGA 2QYGA 1SC6A 3DRSB 1F5BA 4AQYJ 3ZFVA 1UVKA 4ZPCA 3NGRA 2HZCA 3T41A 2NPFA 3PZPA 3OPKA 3KK2B 4ZPWR 1CPZA 2AD9A 1CJUB 1H98A 1F1BB 4N56A 3UN5A 2BEFA 2MSSA 2DEJA 3QWPA 3P8BB 2QA2A 3IC1A 1RTDA 3GPAA 2EWHA 1X4FA 2DD8S 2V2ZA 3NWRA 2W25A 4HL9A 2ATLA 4JI5F 4FF1A 2XHCA 2FJWA 1FJ7A 1X4CA 5HATA 1S9FA 4UQGA 4X4NA 4DPYA 3MECB 4FN5A 5GADU 3QRQA 3M30A 4MIBA 4CO5A 3HVTB 3A1YG 5IOLA 4PG5A 3P45B 3DM2B 3DGPA 1U0HB 2WCXA 3H98A 1E6YA 3VCDA 4OI4A 1HBNB 5CCMA 4JV5J 1P6TA 4DHVA 3F0NA 4ANDA 2HWHA 5GAGU 5KFDA 1VJWA 1C0TA 1U26A 4NLVA 3TEHB 1X31C 2HNYB 3HHLB 3MM9B 1OMSA 5AJ3J 2CQPA 4QWDA 2Y0BB 2VQFJ 4LFBF 2D3UA 3C46A 4DSLA 5EWEA 5HVHA 3CULA 3G8TA 3LAMA 3D28A 3WBZA 1JNZB 4PXBA 2MZSA 4X64F 5BJRA 4DUYJ 1UFWA 2R7RA 3W5ZA 1U4BA 2LFVA 5SUHA 1M5KC 3BO4A 1RWWB 3C3LA 3HMJG 3UR0A 3W2WB 3PXGa 2A2CA 3KLGB 4ZITA 3OR2B 2MZTA 5U47A 3QO9B 2R2SA 1KVKA 4WFBQ 1WI6A 5DDRC 4J9KA 1KFSA 1HFEL 1I6JA 1SJRA 1N54B 2WBRA 3JYTB 1VC5A 3NLCA 2JOQA 2Q66A 4G1IA 2OI2A 4X2BA 1Q86T 4F50A 1HI0P 4LFCF 3BKTA 2J6TA 3ZTQA 2W1BA 2C3UA 4ZVGA 2VZ9A 2BACA 3PIOQ 4IUFA 1SKRA 3N0VA 2XY6A 2DO0A 4A4JA 2YKMB 4Y2IA 2QGFB 1HWJA 4ZIWA 3HVRA 3EVOA 2OSRA 1MROB 1MWZA 5KFKA 4P7TA 3W8GA 4KO0B 4FBUA 2LU2A 2KH9A 3DM2A 4X65F 3M32A 4FVMA 2K1RB 4QCLA 1U0HA 4Y00A 1AFJA 3IWNC 3J80U 1HBNA 1RAEB 4PXEA 1YJTA 4M94A 2HHHF 4MIAA 5K20B 1WSRA 3WC2A 5T41A 2HNYA 2W4CA 3MM9A 3DLEB 3M8YA 2WAQD 4JI8J 3CDAA 5B0AA 4ECTA 2AGPA 2BDPA 1I5OB 2F3JA 4DX7A 4ZP6A 5E0OA 1KLMA 2XO6A 2J9EA 3CGIA 3Q22A 4TN2A 2YWFA 5F8NA 4IFVA 4LRBA 1UTAA 2CJ9A 2V8DA 4QBUA 2IC3B 2HVHA 3ISND 3CCSS 2D69A 2WVFA 3GYNA 2KFZA 2LECA 3N9UC 2MKSA 3CE8A 2B0GA 4C7QA 3QT5A 1BWVA 4OYAA 3TAPA 5J1EB 1RHQB 4IRKA 3MOZA 2XG8A 4DUZJ 1VRQC 2V50A 3KLGA 1WDDA 4AQYF 4Y2CA 2YNFB 3ZZOA 4ANEA 1KOOA 3D9BA 1IKVB 4RW8B 3PYDA 2JRSA 3ZTOA 3OJSA 4GKJF 4OZLA 1YJVA 3JYTA 2PT0A 5J2NA 3R3TA 4KAIA 1Q8LA 2RVJA 3RB0A 1R27B 4ZCIA 3J7YI 1URRA 1DRZA 2AYMA 4K0KJ 4X4VA 3I5CA 2BV3A 1Q8IA 3SCJE 2C42A 3M8WA 1V6HA 4OYZA 1H73A 2C1EB 4CO1A 3QATA 3QLHA 3NGKA 3GJQB 3QSIA 3KLEA 4JV5F 4NEYA 4WKRA 1FXDA 2J0QD 5J2MB 5KFVA 3ISZA 2Z4PA 2FUG9 1HI1A 2M88A 3JTOA 2MKJA 3QMQA 2KHCA 2FGCA 1LFPA 5AJ3F 4WF9Q 2VQFF 3TP2A 4Q45A 5DO2A 5KG5A 2BJ7A 3H8YA 3DLEA 2R8GA 2B7CB 4FYDA 4LF9J 2R7WA 3IRXB 4IOCQ 2RAQA 3KK1B 5DETA 3ILLA 3ZTSA 1FRLA 1SI9A 4Q43A 4ECYA 1SKUB 5I4MA 2IJFA 1NPRA 2K3KA 2IC3A 7FDRA 3EE3A 1R7IA 4E8UA 2YNGA 4X84A 2NXNA 4DPWA 1DBDA 1RUSA 1HHSA 4LBIA 4IOBA 2HHQA 5F9NA 1QD1A 4OYMA 4K4YA 1V9OA 2YNFA 3DN9A 1IKVA 2CJAA 3GFZA 2R2TA 2RNEA 3GTYX 3ENQA 4RW8A 3RBZA 1Q16B 4HHHA 1FDDA 3KNAA 3K5LA 3TWZA 2P6TA 2VOOA 4NZ7A 3SDEA 1RT1A 4UZCA 3IG1B 4Y28C 4ILMA 4LRCA 4V19J 4MJKA 1RTJB 1YBUA 1Q81T 1HNXF 1AUSL 2ZE2B 1T7PA 4DL2A 3BKFA 1TELA 1GNKA 3GR0A 3BDEA 5JVGQ 2R7TA 2F8EX 3D5MA 4I67A 3KLIB 1VQPS 3ZZRA 4ED2A 3LF0A 2VBWA 2G0IA 2QLXA 3CJTA 4MYUA 3M7VA 3PIPQ 3H5UA 2UUWA 2A6MA 2X1BA 3NNHA 2NZ4A 2EFNA 2XQCA 4HDHA 2KVIA 4JI8F 4MKYA 2M7SA 2I6WA 4WU3A 4WYLA 1SH3A 2ALZA 1Q7YT 2R7XA 2NLWA 3IRXA 3NXZA 1LV5A 2R7QA 1Y9OA 2UXBJ 2VOPA 2D74B 2NXUA 1WHVA 4LBPA 1LOUA 2GVDB 1E6VB 4K4WA 1UWBB 2FLOA 3T5JA 2KG0A 2JX2A 5C5JA 4DUZF 5CCLA 3MPYA 2JWNA 2W4DA 2HK2A 2FHJA 4OL8A 4QIGA 3HHLD 4MKVA 5K9FA 1FRXA 4WXWA 3QZ8A 5KOXA 2RB7A 5KFJA 3OVAA 2XY5A 3K17A 1UKUA 5IXUA 2C2DA 4DCJB 3DOMB 3D0IE 4CNZA 3MD3A 1RLDA 3E3XA 4I2QB 3DRPB 1T8EA 3MEDB 5HK4A 3UFCX 3PVXA 1N88A 2C2RA 5KTQA 4C97A 4A8XA 1R8BA 1OSDA 1B0PA 3AH6A 2BABA 2J9DE 4ELVA 1RTJA 4O3NA 3CCVS 1ZH5A 4XIUA 3BBFA 4PAAA 4YB1P 4DV2J 3W9IA 3JAMU 2VHGA 5KG2A 2ZJRQ 2GS8A 3AD8C 4FDFA 3QRRA 2POKA 2DR9A 4KR0B 4ELUA 1KQGB 4IFYA 5DG9A 3KLIA 1HW9A 1UVJA 3UDEA 2XS2A 2E9TA 4QIVA 3ILJA 1OY9A 3RBEA 5I3PA 4USHA 4C8OA 4F25A 2OPRA 1TK5A 1S1VB 2MHNA 2XGPA 4BDPA 1YGYA 4V19X 5KG1A 1VJQA 4CLZA 4J9LA 1G2EA 5E33A 2FHKA 1UPMB 2HWIA 4J9NA 3PRBA 1VYAA 3HHDA 3BJYA 3DHWC 4AL6A 5K8OA 1CEZA 2J9DA 3RAXA 5DQGA 3HZGA 1M5SA 2W4PA 4YY3F 1EB0A 2YBVA 5EWFA 3S7RA 3QGPA 1KWMA 3IGVA 1Q53A 5ETMA 2FPHX 2OEJA 2GVDA 2K3IA 3WDOA 1UWBA 1WNEA 1DARA 1RTHB 2EG2A 1HD1A 3BGUA 4DL7A 3I6PA 2DXEA 4ZVRB 2AJ4A 3KLHB 1B7YB 2GC8A 1Z1ZA 5E5NA 1XNQJ 3ZXWA 3PV8A 1R3NA 2JVRA 1I51B 1X60A 2LQBA 3D68A 3KTQA 3MTKA 2EG1A 3NMRA 4NYOA 1R8PA 4GO7X 1NSAA 2CPIA 1Q0NA 4KV8A 4I2PB 2IM0A 4UZBA 3DOMA 3C6TB 5LJ5Y 3CD6S 1XEZA 1GMVA 4C3LA 1HNVA 4B9UA 4RNOA 3DRPA 2EBGA 2ZZMA 3Q23A 5KOWA 4RX6A 2HBRB 2SXLA 1R0CB 3SCKE 2OEMA 4W4MA 1WOSA 3IM8A 1RHJB 2JDJA 2OFGX 3GSIA 4HKQA 2HFVA 4OJGA 3AJ1A 2C2EA 2B5JA 1KKHA 5KFZA 3RR8A 1Y3JA 2XMJA 3D3CJ 3RYLA 3MDFA 4MK9A 2CWKA 1NK7A 4URQU 2E1AA 4H4MB 1N5YB 1CBKA 2MQMA 1W2BR 1PIEA 3H4DA 4WP8A 3EX7B 4B3MJ 2BW7A 1TL7B 1X9WA 4P52A 2ZWOA 4DXLA 2WB1D 1L3TA 2DH8A 2J8SA 2MQNA 4RNHA 1D9AA 3JS9A 1TL3B 3L09A 1RQ0A 3MWBA 4GC6A 1ZA1B 3CC4S 3RJMB 3VAMA 3R7BB 2CPJA 5L1JA 3IRWP 2KXNB 2WONB 4LF1A 3ZZTA 4EZ6A 4FXWA 1S76D 4U7UD 4QU7A 4BBYA 2LQ5A 1IBKF 2MLZA 2VG6A 2CDRB 4YOEA 1GTHA 2QLWA 5AXMA 5KFCA 3NEKA 3KUGA 3O6QA 5HROB 4PUOB 1WHYA 1ICEB 2QYCA 3HVWA 3NWGA 4IG0B 4OX6A 3F73A 1LK7A 2GMJA 3EGVA 1TKXA 1PAUB 4JV0A 3QIPA 2AJ0A 2MKIA 3AQOA 1KS2A 4R0EA 1GT8A 1UA1A 1HBMB 2ZH5A 4KKOB 4I2PA 1T9YA 2IHR1 9ATCB 4Q8FA 4G65A 2WBMA 2A6OA 1RAOA 2ZHOA 2M4MA 3I5AA 3KFWX 4ELTA 2XNRA 2XMUA 4C11B 4CWBA 2APOA 2OMLA 5IS2A 5KAKA 4NWBA 2IRUA 4HI1A 2R2UA 1YK9A 2V8GA 1PJ7A 2ZNZA 4YUDA 4A8YA 3SCIE 1PG5B 2DKOB 1T3NA 4TYBA 3TVYA 2YX4A 4G1QB 1YZ7A 1D9FA 1WG1A 3E2EA 3K57A 2VA3A 1JKHA 1KFDA 3F56A 1BQNB 3RB6A 1TFWA 2VKZG 3CD0A 2C2ZB 4UY8T 4MAKA 4H4MA 2AF6A 1N5YA 2GAGC 2DK2A 3FBEA 3MEGB 3I56S 3DU5A 3TZXA 1KN6A 4OYOA 1C1BA 1TL7A 2XMAA 1MN9A 2LQ9A 2Z57B 4I6YA 4QWCA 4C6AA 2PMZD 3HFVA 1TL3A 2ZNYA 2XS5A 3M1VB 4G6VB 2E29A 4PABA 2V4JB 1GX6A 2K8GA 2DT9A 1RWKB 2ADBA 1U2CA 1PJ6A 4ITSA 4A8MP 5F3ZA 1OPZA 4YR2A 4DV6F 2QSFA 4K4TA 1M1KT 2WRMA 4RNNA 3T5LA 2IMWP 4MYTA 2FHMA 1HR0J 4CRJA 5HROA 4J9RA 3IAM9 3EPIA 5CD4H 1GMUA 2XMMA 1N56A 2HHXA 1F3VA 4PUOA 1WUUA 3KMQA 2PC6A 4IG0A 3L4BC 5D78A 1RABB 3LANA 2CQBA 3WHIA 4I68A 2PA3A 1VQOS 4OQJA 2GIFA 1JLAB 5DLFA 4JB8B 5FLXU 1N4LA 4QU6A 1VRUB 3BSAA 4DQQA 5C7PA 4OHYA 2N3LA 2HGLA 1KSPA 3W3SA 1SIZA 5HJXA 3OTEA 2EC0A 1JLBB 1AZSB 2NXCA 2VASA 4ZLPA 4ENOA 4DR2J 1Q79A 2V9WA 4P2MA 1RB0A 3ETOA 2P5VA 3PM9A 3O44A 4HLBA 3ISNC 1GMWA 4G1QA 4XDDA 4CNYA 5C25B 3MXHP 2LQ8A 2DVIA 4NLTA 1IKYB 2ASDA 1ZTWA 4CH1A 4USTA 3KK3B 1DAXA 1F5AA 2VFUA 4MT1A 2GNKA 2NQPA 3R5CA 3BR8A 3W60A 1RXOB 2QEXS 3TANA 1FRKA 3BGLA 2D41A 3G71S 2Z2MA 1PYTA 3PW4A 4FYXB 3WIVA 1RKIA 4C8YA 1NHKL 2DNGA 4NASA 2YXLA 3K7RA 4UUWA 2GMHA 3OVBA 5KFOA 1DTTB 2R7SA 2V4JA 3T1YJ 3A8EA 4JV2A 1DQ9A 5KFIA 3RAMA 2OGUA 3DMJA 1JLGB 4FS2A 2W2QP 1QE1B 2W9CB 2B43A 2XYGB 3OTOJ 1M90T 2F4FA 3I32A 1DTQB 3LWLA 3VAKA 1YJRA 1U2FA 1N5SA 4PWWA 1JLAA 3VTIA 4QIFA 1H2UX 1H38A 4K59A 5HAOA 1DFDA 4K4ZA 2EPIA 2W7OA 1PKUA 4HR2A 2XLJA 4JOUA 1R6VA 6FDRA 1O5JA 1RWVB 2IIHA 4P71A 1M1HA 2Y1JA 1AZSA 1SJ3P 4RPFA 2CJXB 1N36F 1AXQA 3DU6A 3JSMA 1JQGA 1R6YA 2HQCA 1QUPA 1IKYA 3U27A 3QQCD 1MU2B 1B64A 2OH2A 5ETQA 4F2RA 5KFQA 4NZ6A 3TZWA 4B3TJ 4RBVA 4KGXB 2MSTA 3P5TL 2V5HG 2VFRA 3N6LA 1NH8A 3NCPA 2DRBA 4IG3A 1F2HA 3K5PA 1DTTA 5HN0A 1LNQA 2O67A 4CT9A 2ASJA 1LXJA 2BM0A 2HEKA 5JXSA 5IT0A 3KDNA 2DRDA 2BKOA 3DC2A 3FMBA 1HR0F 2I2YA 3MGJA 5K8MA 2RMLA 4CT8A 4ZLLA 2YKQA 4DV4J 1JLGA 1RAAB 5EHHA 4L3KA 3VAHA 5HP1B 1JX4A 4RR5A 3TEGA 5KFTA 3E01B 1BC6A 1UVMA 3BBBA 2E5GA 4XDCA 1FRIA 1S49A 2I38A 2RS2A 1DTQA 1X5PA 2CZ4A 3M8QB 1NRKA 1ZM9A 3BGRA 3W8PA 2IBKA 1KQSR 1AB8A 3NRBA 4K50A 2VFTA 2JEFA 4X62J 4BHQA 4F4KA 3MPVA 5ETPA 3KJFB 2J5AA 1C4CA 4IH5A 2WSFC 4J9OA 3SZ2A 2FJEB 1REVB 1RCOB 5K8NA 3VVUA 3LP2B 4IYQA 2YKPA 3GSDA 2QL9B 2Z56B 3TQ1A 3MTJA 4S0MA 3CB4A 4OZ0A 2X3DA 4AXJA 3JQMA 5HL7Q 5HMYA 3SFUA 2QL7B 1U8WA 4MFBB 3HHKA 1Q1KA 4HI2A 1U6BA 4LF4J 5LXYA 5HI7A 1A0OB 5L1KA 5D3GB 1I94J 2WOMA 1QAYA 2F8HA 2XCPA 3RRHA 3BH7B 5GMKa 2WSEC 1ELOA 1GMWD 3T1YF 1WHWA 2PO4A 4NLQA 1HKAA 1O8BA 2IJRA 3TUIC 2RUGA 5C24A 3UD4P 3JAMY 2BVZA 2LXIA 4YMEA 1VLYA 3CDWA 3HKWA 2MKCA 4LIWA 1K9MT 4DLGA 1OPIA 4Z37A 2LQJA 3FBFA 5C42B 2CZVC 3C6UA 1X0FA 1SB6A 4LF6J 3SQGA 1EETB 3OHBA 1RT6A 5F8JA 3AFGA 2PSZA 3OTOF 2MY7A 1UPPA 5HP1A 5FDLA 4OYXA 5D8HB 1UVNA 2ERRA 2YPZA 4ER8A 3JSBA 3VGTA 3R1HA 1ACMB 3M8RA 4EEYA 3UDVA 4EK2A 1Y0HA 2DGOA 1AROP 2CPYA 5IQ6A 5ADZA 4UOGA 2BMBA 5DRKA 2ILYA 3CIMA 3VR1A 2GHVC 3DYAA 3NNAA 2A0FB 4ECUA 3RB3A 1LWCB 4K8RA 2V94A 3H2UB 4DCPB 1GK8A 1REVA 2MKYA 2ZUAA 3PYGA 4OJ1A 2V63A 2WVBA 1ZA2B 4X4TA 3CCUS 3K5OA 3CDBA 2ZC3A 5LSOA 4JI3J 3VQTA 4U95A 1YHQS 3MAHA 2DNPA 2CNLB 1UVIA 1CJKB 1QAJA 3HM9A 3BPDA 1HWLA 3G96A 4P2SA 3EMTA 3KUEA 1U6FA 1NO8A 3GCXP 4I7FB 1RISA 4N8NA 2OPQB 1VBKA 5DG8A 1D1UA 2J76E 2JZ5A 5B0BA 1Q8KA 1PAEX 2AJ1A 2GJ2A 1T9VA 2OPPB 3CJSA 5LL6d 2R8IA 3G9CA 1GEHA 1PBUA 3AT1B 1F9HA 5C42A 2HNZB 5G0RB 1R43A 2RSQA 4F7VA 2FIUA 2LA4A 5J1PA 1AT1B 2B9WA 4J9QA 3MPDA 1VIOA 3KLFB 4RL1A 2HFSA 2RU9A 4NI2B 2VG7B 2YWEA 5I3UB 2B9EA 2G4BA 4DFJA 1ZETA 3G82B 4Y2MA 1FO1A 2VU5A 3DI6A 1KTVA 3DNCA 4X62F 3AODA 4DG1A 5IT9U 4F4WA 3AA8A 4ECWA 3KHRA 2C3OA 5KFSA 4ZDNA 1WKKA 4DL0C 1S77D 1X4AA 2QA1A 3GQCA 3BN4A 3AY0A 2B9YA 4OMFG 3KKFA 1H0HB 1LWCA 4RW9B 3BO3A 3KJQB 2D7SA 2X1GA 2QO3A 2KYXA 2R4FA 5M2RA 2CQGA 2ADCA 4JI2J 4OHZA 3X3UA 3RU0A 3QGGA 4DQRA 1FFGB 4I4BA 4FF3A 3VALA 3DRRB 4LF4F 1RHMB 2HVIA 4XK8C 1VQNS 1NNDA 4CLSA 2NREA 4OZ1A 4LR8A 3Q8RB 3TVZA 4DV5J 4PWDB 3MAAA 5KG4A 2VUGA 1Q78A 3FVYA 1M5OC 3M9OB 5F0UA 2AV5A 3OSNA 1K1SA 2VL1A 1CJKA 4QYZK 5HO4A 1GXLA 5FIIA 3GJTB 1XR7A 4Y3CA 1Q8BA 1YJ9S 5B0FA 3B8HA 2DNMA 4YHHJ 4I7FA 3K5NA 1V3ZA 1Y5IB 3KNGA 1RWXB 3NBPB 1HNWF 1PGZA 3IWXA 1QVFR 1KTQA 4LF6F 4URSA 1EP4A 1FCAA 4LBHA 4M63A 3M9NB 2X3GA 2Z58B 1SUQA 1YRXA 5G0RA 1EQMA 2ASLA 3CMAS 2OJ3A 4LREA 3KLFA 4L76A 4NI2A 5I3UA 4R0JA 4Y6IA 3TW0A 5CZVA 3OUYB 2XBPA 2F1FA 1FRHA 2ROGA 2M8HA 4ZCKA 3ZTRA 4ZPVR 1KBRA 3H5YA 3IMQJ 3TVKA 3FEYB 1YJWS 2D9OA 2GA7A 3K2YA 2ROPA 3RUBL 4UUXA 5HMZA 1TAUA 3KJNB 1BLUA 1MG7A 4DEZA 1ZOTA 1X4GA 3FRYA 4KPYA 2ROEA 2F4VJ 3S6EA 3SFGA 4USJC 3R2CJ 3HVAA 4LSNB 3RZAA 3DRRA 4JI3F 3PR4A 3FDSA 1RBOB 4ECVA 1JK9B 4M5NA 3IA0A 2UP1A 5L1IA 1JNRB 3H90A 3PKYA 1FKOB 1F60B 4HEA9 4KBIA 1V3SA 1S6PB 3EGNA 2DISA 2BM1A 2G1DA 1KVJA 1BMQB 3CDEA 2COLA 4C3MA 3NS6A 3M05A 3B78A 3TZYA 2I1RA 2YNIB 4HT7A 4RJVA 1SQFA 4Q44A 1NAQA 3BYRA 5HMXA 3MUMP 2V4QA 4C2MA 3Q83A 4CCHA 3BM7A 4IQMA 4PPZA 1CS4B 1PC4A 3TX8A 3OSPA 2VFVA 2CNOB 1KQKA 1DJ0A 2I8EA 4NOHA 3N28A 2CWXA 4NA3A 3D6TB 3OUYA 2CQ1A 4N77A 4WPAA 3J7Z5 3CVKA 1OYDA 4HHJA 3LWMA 3JQKA 3JTPA 1UEUA 2KZMA 1QY7A 1KOHA 3W61A 3FMWA 5KT6A 4JI2F 1N48A 1RT3B 4EBEA 1EZZB 2K06A 2JC1A 2MXYA 2KM8C 1Q7LB 1MNEA 2KXFA 4RO0A 3PNIA 1C1CB 2XSFA 3ENAA 1RCXB 3CJ8A 2V68A 3FCHA 4NLOA 5K8PA 5HJYA 3GP9A 2YWKA 3US5A 4LF7J 4B17A 3JQJA 1KLNA 1F2GA 1VC0A 4X4OA 5B0CA 4N5SA 1VLOA 2X7IA 3D4JA 4ES1A 5F8HA 2YNHB 3DOLA 3CJRA 5B0GA 2G2YA 2XGQA 5EWGA 2DPIA 2CQHA 4KPCA 1QSSA 2RS8A 3UI3A 1SJQA 2BE9B 1QAIA 4UT4A 4P10A 3I5BA 4OV6A 5T7LB 3R8YA 1U1MA 1S5ZA 4DL3A 1NPKA 4DV1F 2YNIA 3HXMA 4F8RA 4P9SA 1QM9A 4QR1A 1CLFA 1N32J 2J0SD 4JBCA 5H9EK 3VQSA 2JEJA 1CS4A 4ZMMA 1QTMA 1RU1A 4PZVA 2RQKA 5LSRA 2B6AB 1HHQA 4EMDA 4C48A 3GYXB 3IXQA 1WI8A 5E3QA 5SZTA 3V4IB 3Q8QB 4EYHB 5HBMB 2NUHA 3TYTA 1JLFB 4ID5B 1Q5VA 2EW9A 3DRXA 3EZUA 3OR1B 1D8ZA 2VC1A 5ETRA 1OY8A 3M6WA 1S99A 1HWUA 3PYFA 2KI2A 2C3PA 2UUAF 1RT3A 3NG8A 1XC9A 1SJ1A 3MMJA 5DDPC 1HNIB 5I42B 2F4VF 3T5HA 3NGTA 3CC7S 2QFJA 3UCUP 3CJQA 4ED8A 3IP0A 1MWYA 3J7AN 4ECSA 1MMNA 3MM7B 1CC8A 4GVBB 1OS5A 3H4BA 2DGSA 3NS5A 2BKPA 4O44A 2VBYA 2HIYA 3TI0A 4DS5A 4NCBA 2W8KA 1VMBA 1WG4A 1LKZA 3C15A 3GWCA 2QC3A 4DBQA 2KFNA 4DSIA 2HHTA 5CAAA 3V6HA 2ZM6J 4DL6A 1X8DA 5A0YB 1WF1A 4E98A 5RUBA 2J7WA 5T7LA 4E0DA 1AUDA 1U1NA 3UQSA 2BUNA 2F63A 2AGOA 1CULB 3MM5B 2MPUA 4TVAB 4C0HA 3I0SA 2MB0B 1M5HA 3BDPA 4DR3J 3BKUA 2ALYB 4J9UE 3R97A 2ZITA 3T9ZA 2XLIA 3NCQA 3TAMB 1HBUB 5HBMA 4TY8B 2I9SA 3IS9B 2BBEA 2DTJA 4EGLA 4FVCA 4RKUC 5D0GA 4M95A 1S1TB 3CO9A 4XAKA 4C8KA 4DZDA 4CTAB 4IH7A 1NPPA 2OLWA 4A8FA 4KGKA 2BZ2A 1FFWB 2DGQA 1XMOJ 3R5BA 4LF7F 2HGMA 3RAQA 1FJEB 3GV8B 4YB7A 4ZLJA 4LF8F 3Q8VA 3ZNUA 4F2SA 3PJWA 3BBCA 4NLYA 2BJ1A 3OL6A 1KQFB 4CO0A 2VBZA 3FCVA 1H74A 2XZDB 4CH7A 2AEFA 4OZ2A 1FHTA 4KGZB 1FVQA 3C14B 1DLOB 1T3OA 1NM2A 1HQUA 4ZN3A 4CP5A 2F8MA 4P73A 1S48A 3BZQA 2E66A 1NUEA 5KG6A 3UCGA 2RRBA 5A0YA 4ES3A 3LOUA 5DS7A 2HAFA 2IJNA 3R7NB 1FKPA 4TNOA 1N32F 2JEGA 5CYMA 2R8HA 2AYEA 1N33F 2NZCA 3W5XA 3MM5A 2HQFA 3CUNA 3R5JB 2EBEA 3W64A 4ANCA 4GRSA 4EUVA 2DR7A 3NGSA 4YR0A 4CM0A 1XN9A 1A7GE 4NXNJ 2QN6B 3H20A 4B9TA 4LFCJ 4OLPA 1NLKL 2HLTA 3P6YC 4HH1A 2G9OA 3CD5A 4C8NA 2BOPA 3N6MA 1S1TA 4DX5A 1JLCB 4AD6A 4TXSA 3M8ZA 1TUGB 2JH3A 1WEYA 4DF8A 2N4DA 2XS7A 4DQSA 5B7WA 2VPWB 3ENVA 4NMLA 5D6GA 2EK1A 3BQ2A 1S1UB 2KT3A 5LM7E 3R7SB 3U1MA 4I64A 4ZVQB 2OD6A 4G3IA 3OLAA 2XSJA 4DR7J 5D0RA 2IPOB 1QTNB 3ADAC 1FVSA 3OFFA 1IR2A 4ZLNA 4QYZJ 4IO1A 4ZJQA 1ZAVA 3OD2A 3ZZZA 5AXLA 2OEKA 4DR1J 3RBXA 3W2VA 4DZ6A 1NJWA 1QSYA 3KXDA 3FFIB 3EDRB 5DQIA 1BGXT 4CLFA 1BD6A 4X4QA 4OI2A 2ZM6F 3FJ2A 2ZH1A 3C14A 3B82A 4ICLA 2PMWA 4HVZA 2B8PA 4DPUA 2AYGA 2RILA 1NEEA 2PN6A 3N01A 4ZPTR 3OXFA 4J5OA 2BQ3A 3DXSX 2R42A 3OVSA 1LK5A 2PI4A 5DG7A 4K4VA 2E44A 4QZVB 1TK0A 5KFYA 2KZZA 1FF2A 4NE9C 4DR3F 4ED3A 4HACB 1XBWA 2DNKA 3VGVA 3AD9C 3Q8PB 5CZXA 4B9LA 1RTIA 3P49B 2E9ZA 3OL9A 1U8SA 4AL5A 4QOTA 3C16B 3HX9A 3KDOA 1VOMA 2CQCA 3R2DJ 4GKJJ 3H7HB 1KC8T 2IDEA 3D6MB 2EFQA 2M2BA 4L72B 5ETKA 1VGYA 3QRPA 1Y00A 4DPOA 1SJFA 3B54A 2HHPA 3AD7C 1G6BA 1JLCA 3GCWP 2DCLA 1D09B 4E2FB 1PBAA 1XMOF 2ZFHA 3H42A 1J5EJ 2ZZNA 3GJRB 1YX2A 2ZH8A 2GIQA 1RT4B 3BQ0A 1IXKA 3MPWA 2CRLA 1O0PA 5IQQA 2UXDJ 5J2QA 2KHDA 3PX4A 3DOKA 4OZJA 4USKA 1RAIB 4KY3A 2P2CB 1WOPA 1S0MA 3LP1B 5A8RB 3I55S 2CQ4A 1UAWA 4DR4F 1SV5B 1YITS 4CM2A 1T05B 3B6BA 5M2PA 3TNVA 4J90A 3FFIA 1N5VA 1WC0A 1KDNA 3RTVA 5AE1A 2RIJA 3A8KA 3MR6A 1XTZA 2DITA 4O4GB 2DH7A 3LP0B 5LT5A 2K7JA 1XR5A 4PEOA 5H1SV 4B3OA 2DXFA 4ED5A 1TKTB 2CNKB 1PO6A 1HARA 2IA6A 3GG0A 1FT8A 1MWQA 3DRSA 4ZHRB 3U7JA 2H5JB 5J2PB 3EICA 1P9YA 2PEBA 3O2IA 3KK2A 4NXNF 4F67A 3LGMA 4AFFA 5I3QA 4DWIA 2BR0A 2N4CA 3C16A 1TMMA 1YJ7A 1CJUA 2Q3PA 2C3MA 3HD2A 3KOAA 4C8ZA 2IM1A 1N0VC 2GJIA 1NJZA 4YB6A 1RYRA 5B09A 1RZMA 1HNXJ 2F65A 1T03B 1WC4A 1HBOB 4KT0C 3I9ZA 5D0EA 2HHWA 3MECA 4CLYA 1IBLJ 3SYZA 4QPTA 4P2FA 1FESA 3CJ3A 2BJ8A 3I0RB 1VK8A 1Y7PA 3HVTA 5GAEI 1MLAA 2R8KA 1X4EA 2QT7A 2H4WB 3QNWB 3K5MA 2HBQB 3H2VE 4GO5X 1NHVA 4DR7F 1RT4A 5KFBA 4CLWA 2VF3A 5ETOA 1DURA 1S59A 4M8LA 1S0NA 3D6FB 1I3OB 5CA5A 4CLTA 2PFDA 3HHLA 3H40A 4YQWA 3Q8YA 3FSYA 4DR1F 1PCAA 2KDOA 2CQDA 1JB0C 4X4PA 3MMBB 5THWA 5DM6Q 3FZBA 1SC1B 1NZ8A 4U8VA 1B99A 2W7PA 2ZBIA 5BYSA 5CYJA 4W98A 2DGUA 3W2WA 4F02A 3EGWB 3LP0A 2PA8D 3OR2A 4UF4A 1T9XA 2OO4A 3OFGA 1TKTA 1KVIA 1V5VA 5H9EJ 3QO9A 3TQEA 5DGBA 1RWPB 4NYPA 4UOCA 2G1HA 4ZJLA 3M9MB 2C2KB 4KIAA 3POTB 5J2PA 3QFHA 2W2PP 4CLLA 1TAQA 1Y11A 4I6AA 4WP3A 5A8WB 3MR5A 4WIIA 2EFVA 2ZOGA 1NSPA 2X51A 4L73A 1CJTB 4PRFA 1JMTA 1DZ5A 2KXHA 3A3PB 1X5OA 4P7VA 5GAHI 4M5LA 4ES2A 1T03A 2YVSA 1HBOA 2ASYA 2MJNA 2YKMA 2JHEA 2YWWA 3CJ4A 4LJMA 1Y3KA 1MROA 1J5EF 2AT1B 1U02A 3BREA 3UNGC 1FJGF 3O5TB 1BE4A 4NL5A 2HSEB 4KO0A 1UW4A 4JI0J 3M2VB 2H5EA 2UXDF 1VQLS 3Q24A 1IBCB 2K1RA 2VH7A 5ITHA 4P75A 1ZPVA 1U47A 3WQPA 1VBXA 3UDCA 3HFZB 1R31A 2LKZA 2WVDA 1VISA 2CNNB 4UTGA 3RGIA 4HTIA 2Y3YA 1JJHA 1WSVA 1HMVB 1K73T 5IC4B 1RT7B 3MMBA 4YY3J 2JL9A 1AYEA 2E7VA 4DN9A 4WFYA 3G8QA 4TY9A 3GR1A 4YDDB 5C2CA 3TO8A 5L46A 4F0KA 4G1PA 2HS3A 2CAJA 2EEYA 3MCNA 3FC9A 3CDUA 3OTBA 2HHUA 1FNOA 1IBMJ 5J1EA 2D3OR 1N5QA 2DNNA 1RWUA 4TU9A 3FQKA 1FDNA 1BXNA 1RGVA 5T14A 2DY9A 4WIQA 4K4UA 4H4KA 4DFMA 4Y65A 3WX4A 4ZJOA 1SC3B 2H48B 1QDUB 3G8SA 1NXIA 3POTA 3TA0A 1HL6A 1CJVB 4IR1A 2MQLA 1NK9A 1HA1A 3HKZD 3LPYA 3JXOA 4KHRA 2QRRA 1WJ9A 4DUTA 4HT5A 1IBLF 2CJYB 3L95X 2XWXA 2Q1LA 3MPUB 3NCRA 1SKSA 3M6UA 1HD0A 4PQAA 4RW6B 1AA1B 2LXFA 4UY85 3C2PA 4A8KA 2CQ2A 2LU1A 4OLOA 1LQ9A 4FNHA 3W65A 3M2VA 5J2MA 4BWMA 1TK8A 2HW3A 1EARA 1T9TA 2NS1B 3CMQA 3NOGA 2VKRA 5LXRA 1VQMS 2MZRA 2GMLA 1NDCA 2E5LF 2MTLA 4TQSA 3NY0A 1K1QA 1T9WA 2IY5B 1OIAA 4UW2A 3KK1A 1GX5A 2FVQA 2OMOA 3A8JA 2O66A 1VHFA 1UW9A 2UU9J 1IBKJ 2KYZA 2B4VA 2JFDA 3T9NA 5GMEA 2AQ4A 1JJ2R 1UJ4A 2Q6BA 3VV2B 4N8OA 5GADI 1FX4A 1FD8A 4DQPA 4FXVA 2DR8A 3SI8A 5DZ7A 2NCKL 1B4SA 2KL8A 1CQNA 1WC3A 1BQMB 2BRLA 5GAGI 3V6KA 1PILA 3H0PA 5JUMA 1U2RA 1WF2A 2G13A 1VIXA 4EWTA 3L7UA 1CJVA 2KU7A 3BH6B 3QJJA 4WWSA 1NDPA 3IG1A 3PRVA 3MZIA 4QIEA 2MGZB 3WZ0A 4A8QA 4Q0BB 3AQPA 2ZE2A 4PYAA 3FEZA 3R5DA 4F0HA 1MW7A 4QR2A 4BC7A 2VFSA 1TV6B 2ZBRA 4BWJA 2Z2ZA 3BN7A 4NCAA 4JI0F 4RW6A 2VG5B 2XEXA 4OJHA 2IBOA 1HQ2A 2ZD1B 4AL7A 3EUNA 1UWAA 3QAEA 1RBLA 1S7HA 5GAEU 1XMBA 4N7TA 4I56A 3HHNB 2ZDPA 4WE1B 2BXJA 1A9NB 3KWMA 4C8LA 4QQBA 2R8JA 2AIRB 3HFKA 4JI7J 2GIRA 3HHEA 3LH2S 1H2TZ 4M5JA 4JP8A 1PC5A 1KP6A 2OPSB 2Z2LA 3I96A 3IGNA 4YP3A 4UOHA 2PI5A 1VQ6S 3KHGA 2BOAA 3HD1A 1C0UB 4F26A 4DV0J 2MQQA 4C9DA 4DV6J 2JEIA 2EFOA 4U6PA 1E6VA 4USVA 4Y34A 4DPXA 1IBMF 3EVWA 4ZVEA 4KC5A 3MUVP 4QIWD 2J8AA 3GV5B 4ATNA 1TTHB 2H51B 3UDLA 1RT2B 4OHWA 2HRYA 4PG8A 1OQ6A 2E1PA 2C2NA 2RJZA 2N3OA 3UPFA 4ED6A 4IRCA 4R5PB 1OSCA 1BQMA 5EX0A 3FSXA 4U7CA 1YRUA 2QMWA 2YKNB 4I2QA 2RDDA 1XERA 3MEDA 2NSBA 1SQEA 2XI3A 2ZKTA 1S1WB 5HVFA 3MMAB 3LGHA 3PCOB 1D0EA 2C3YA 4CQ1A 4KFBB 2WVEA 1EIYB 2HFZA 3PO4A 4EZ9A 3LO3A 1C4AA 1OY6A 1IWGA 1TV6A 3J7YU 3IWLA 3N6NA 2AGQA 4QJVA 3OLBA 1O6XA 3SCLE 4A8SA 3MF5A 3U02A 3LUYA 3ITHB 3G6VA 1S1VA 3VHQA 3DLLQ 4LUBA 4F4AA 3SQOP 4LFAJ 3T19A 5IWAJ 3DLGB 2HRTA 3ZTPA 5DDOC 2OP5A 4Y0FA 4DCOB 1APSA 1IQZA 3GIIA 3TZZA 3M2UB 3CO0P 2CJKA 2W24A 1N6QB 2OPSA 2UU9F 4ZP7A 2XMTA 4ZIVA 2AWZA 1GXTA 4P72A 2XCAA 2L41A 4B3SJ 3WX8A 1RTDB 3QFWA 3IN5A 1RTHA 2RDIA 4J7CA 1FE0A 1KNZA 5HLFB 3KLHA 3TJ9A 4N41A 1RT2A 4WTOB 2RF2B 1UA0A 1AW0A 3OXLA 3GIRA 3M30B 4F3OA 2AYBA 1Q4RA 2NYIA 2GQ2A 4R5PA 2C22A 2Z2YB 2LA6A 1E6YB 4BS2A 3C6TA 1WKJA 1LFWA 1FWKA 1QLNA 2HURA 2VPXB 3EZ5A 5FD1A 3FGVA 1HLWA 2YKNA 1U1OA 1S1XB 2V4RA 1C0TB 1W26A 3PTWA 2H9ZA 2B4OA 5A76A 1RA6A 1FA0A 5EN1A 1W2IA 4KFBA 2N82B 4WK3A 3V6JA 3ZZUA 3W5YA 4B9VA 1T02A 3SSQA 2IMOA 4OYIA 1CVJA 2HLUA 2CJBA 4LF5F 1XK8A 3HSDA 1JWWA 2D9PA 1N36J 2RHQB 5AT1B 1VI7A 3BGFA 1CSJA 5KG3A 4O3QA 4NRTA 2DGWA 5JMNA 3KUHA 3G6YA 1FXLA 2CIMA 1HWKA 4LRDA 3AXMA 4ZPAA 4JI7F 1RACB 4C3KA 2AP6A 3EM1A 3UN2A 2HQ3A 3EXYA 1NKBA 1NKEA 1BQXA 1FX2A 1GAOA 4R25A 1V3RA 3M2UA 1L3UA 1N6QA 2WONA 3QT6A 2BJ3A 4X66J 5KT4A 5K14B 4DV0F 2QV6A 4TU7A 2ATCB 1VQ4S 2LDIA 4U8YA 1IM4A 3QJLA 2AEJA 2JSXA 3G87A 3I4PA 4YEAA 2RKIB 3A4TA 3FUYA 2WB4A 1NDKA 3CT9A 1Q82T 3UCZP 5HLFA 2VBXA 3F41A 1VK3A 1YG0A 4FPRA 5E3RA 5E7OB 2RRNA 2RF2A 2MZJA 1YVFA 5EGYA 2KFYA 1U1PA 5F8GA 3K58A 1HBMA 3W62A 3M32B 4PG6A 4KKOA 2CPZA 4HH0A 4DX8H 5CQGA 4HDGA 1WEXA 1URNA 1NHUA 4O3PA 2V8VA 3BYPA 2IA0A 3P5BP 3CJ0A 1S1XA 4ZKAA 2DNZA 4C11A 1S10A 1SJ4P 1U1LA 2LEAA 2OELA 4OYBA 4NLUA 5KFPA 4M5HA 5ETVA 2EKNA 2JLGA 4LSZB 1WELA 1KLMB 1Y10A 4K4SA 4U9RA 4DR5J 3UE2A 4IFVB 4ALZA 1K47A 2CG4A 1FWPA 2LMIA 1BQNA 4MK8A 3HSJA 1GH8A 1NSQA 4FPIA 4NLXA 2MHEA 2WZ1A 4LFAF 5C2GA 3MEGA 5IWAF 2AHOB 1M5PC 2AJQA 4Y2KA 1P9QC 2R9LA 1B70B 3MOJB 1WC6A 3IR7B 3M1VA 2PFFB 4A48A 4JI6J 3M6VA 2AJFE 1F3FA 3PFOA 2IVMA 1IJFB 5DDQC 5K14A 5B08A 2VDHA 2EFGA 2GFFA 4B3SF 2J7KA 2DY1A 5J2NB 3MUTP 2DHSA 2HKEA 2YWGA 1R8HA 1EX8A 2XI2A 2W01A 4LVNP 1R8CA 3T3FA 1HWIA 4Q7AA 1GTEA 5A8KB 2RKIA 1T0TV 5M2UA 4J9MA 2QA4S 1NCLA 5IV4A 5J1NA 1LEOA 4PR6A 1VQKS 1RAHB 2GQQA 4FYYB 2DEIA 3QLHB 2BA9A 3D67A 3KLEB 4ECQA 5HQ8A 3R5GA 4OHVA 4NLWA 4LQ3A 5ETTA 1RKJA 4N47A 4TYAA 1UEKA 1VRUA 2OKQA 1YI2S 2KRBA 4L3NA 4O0IA 1UETA 1U1QA 2V0NA 4B02A 1UJ6A 2CPDA 1JLBA 4RUHA 4K4XA 2HK3A 3ZZPA 1EKSA 2ACMA 2J0WA 5C25A 3AJDA 2BJEA 2JVOA 2QMXA 2HS4A 4DV7J 2CPEA 4OX9J 2YNGB 3KK3A 5D4OA 3GJSB 3MFIA 3F44A 3BB5A 3D6HB 2DIUA 3EYZA 3ICLA 5EX3A 3HDSA 1T94A 2QSWA 1KRPA 3GFYA 4KQZA 4LVOP 3LTOA 2KJWA 2CQIA 4X66F 4CO2A 4CLKA 5CXTA 1X7VA 2HVEA 3W9HA 3I31A 2M8DB 2W7AA 1D9DA 2VB6A 1S7IA 3A3OB 2G2ZA 4KRWA 3SDEB 1RT1B 4EO6A 4HYKA 4TLRA 4OV1A 5HQLA 1VBYA 5CD4A 5E3CA 1K0TA 1Z4UA 1NJYA 1QE1A 5A8KA 2W9CA 2W2NP 1IKXB 4DX6A 5F0WA 3J7A1 5IT4A 4OI3A 1T11A 2VJVA 3THPA 1SIWB 3S01A 4LQ9A 5E3AA 4LRFA 1NZAA 2VIHA 2L3MA 2W9BB 2M52A 3LALA 3T1AA 4A47A 2FC8A 4OJ3A 3D1HA 2QJ3A 1LW0B 2M0GB 1XMQJ 4FZVA 3DDKA 4MKAA 2VODA 3JB9k 4PYDA 1VQ5S 4H4OB 4FS1A 2P8IA 2H3EB 4LT6A 4DR5F 1CG2A 5L9XA 2WHOA 1FE4A 4WFZA 2FTRA 1VBZA 3GIMA 4OZ5A 3CCES 4M5GA 3MURP 4DUYF 1BWEA 5E41A 4KHMA 2MKHA 1YBAA 1Q95G 1FNXH 1WG5A 3PY8A 1MU2A 3HHLC 5LMNJ 2ZEJA 5IV3A 2YH0A 3BPSP 3MHYA 2GCFA 1SL2A 4I0WA 4ILLA 2QLBB 3QT7A 2W2OP 1FEHA 2L48A 3UR3C 2RQMA 4JI6F 3ZC4A 3RRGA 5F8LA 3HZEA 3FQLA 2B51A 4RU2A 1IWAA 3UO0A 1RAGB 3LAKA 1RDRA 2FVSA 2B9XA 2ZUGA 3EZOA 1S4EA 5DLGA 3CXCR 3R6LB 2PE8A 5A6PA 1DY3A 3R27A 1OYEA 3NL0A 3OTCA 1XQIA 1L3KA 2CXEA 3OHAA 3MMCB 1HNWJ 3PDNA 5D0HA 5KFEA 1NK0A 5LJ3Y 2ACYA 3H5SA 2UVWA 2ZH4A 5LMUJ 3MCSA 2VJUA 1KONA 2LEBA 2K2PA 1IKXA 3J81Y 1JXLA 1P1TA 4DLEA 4DU8A 3E01A 3DLHA 5KFMA 4IFYB 5CABA 1VFJA 3GYGA 3FZ2A 4PQUB 3M8QA 2FVRA 2OPRB 2ZVSA 2W9BA 4DF4A 1S6QB 3CCLS 4OFZA 4B9MA 4CIOA 2GJFA 1G1XA 1LW0A 2OAUA 4Q2LA 2PDAA 5KT2A 4EYIB 4RU9A 3FK4A 2PD1A 3W9JA 4H4OA 5LOQA 2GV1A 4OX8A 1NBEB 2CVIA 3LP2A 1YKWA 4XTTA 2M5YA 3EVMA 2IVFB 4Q8EA 1QUVA 3G6ES 1RI7A 4BCAA 2LLZA 4DV7F 4OX9F 2VICA 5EUHA 4MFBA 5FJ4A 4W90B 2ZBPA 3HULA 5DZ6A 2YH1A 2D3ZA 1XIQA 2FJDB 3GZ7A 3ONQA 5D3GA 2HWTA 2XWYA 2B8QA 2CQ0A 2G0CA 4C98A 1YIJS 2H54B 5CHCB 4NA2A 3H2LA 2L08A 2XYHB 1AFIA 4KV8B 3TUJC 1LXNA 2IRXA 1RAJA 1LWFB 4WXOA 2DYAA 1HNVB 4RNMA 3L7OA 4RLEA 2V34A 2BQUA 2RH3A 3L7PA 2R3VA 2DGVA 7FD1A 4K0KF 3MMCA 3T5KA 4H4KC 2FZCB 3O1LA 3VGSA 2YPYA 1T95A 4DMZA 4A8OA 4ECRA 1RBAA 2B5JB 1PJ5A 3UN3A 4HHUA 1EETA 3B4DA 1ZBTA 3GFHA 7AT1B 4WP9A 4J91A 4F3MA 1P8GA 1X4DA 3VGUA 3IR5B 4X4UA 3ELHA 4WKYA 3TJAA 2XNQA 3CWJA 1HPZB 4QWBA 3ZNJ1 4U7UK 5D4NA 3RB4A 4PQUA 2KM8B 3M4XA 4TKTA 3U1NA 4NZ0A 1F5CA 1VDHA 2HQIA 2BX6A 2Y8YA 4WK1A 5KFFA 1S6QA 1XMQF 2G0JA 4WU2A 3VAJA 2DHXA 2DNQA 4F36A 3SSRA 4ID8A 4LF9F 1FEEA 4P74A 1NK8A 1TU0B 3BSCA 5KFHA 2DPJA 1VQ8S 3EGZA 2FVCA 3MCOA 2UUTA 4EI2A 1X4HA 2YQ3A 2JJ4D 1YJNS 1NK6A 1VQ7S 2VG6B 2NPIA 4M1KA 3VAFA 4NA1A 5LMNF 3PJ9A 2DR5A 2KJVA 1H7WA 4J9SA 1EJ7L 5KFXA 1X0PA 2M3DA 1BHNA 1SQGA 2IM3A 4RWXA 3V2UC 3OTDA 1TKXB 3QIPB 4JI1J 5CYQB 2ZH9A 1OO0B 4B9NA 5L9NA 1H3DA 1S0VA 1S57A 3IAS9 2OPQA 4O3RA 4OIXA 1LWFA 2R7VA 1JLQB 3OL8A 1RT5B 3UNYA 3AAWB 3QIDA 4D3GA 2UXCJ 5KFGA 2ZH2A 5LMUF 2OPPA 3UD5A 5KT3A 3FBBA 3PG9A 4DV1J 2HNZA 4CYUB 2DBBA 4BLGA 4OZNA 3T6BA 4J37A 3FSIA 5JVHQ 2QA4G 2AZ1A 2FZGB 1JKHB 2VG7A 3W7BA 1UJ5A 1J2VA 1RU2A 3QZ7A 2CFXA 3OQ2A 3CCMS 1HPZA 3G82A 1H6KX 1ZS6A 2KRRA 4K7QA 2MKKA 4OZ3A 2DHHA 1FXRA 3V5RA 4DR6J 1C1BB 3KJVB 5H9FK 1TUWA 3K8VA 4WTYA 4UOFA 2IRYA 2KT5A 1FRMA 3DGVA 2UUBJ 1X5SA 3NAHA 1TL5A 3PW7A 1N52B 2LCWA 1YJUA 3HI9A 4RW9A 4QW8A 4WZMA 1TVRB 1U49A 3PYEA 2UXBF 2XLKA 3K0JA 2J7UA 2FJBB 2UUAJ 1H2VZ 4DFKA 4P6QA 4USMA 1HQEB 4MK7A 2ZOMA 2FZKB 3AXKA 1FWLA 3D7SB 5B0DA 2YWHA 4EBCA 1U45A 2VQEJ 3N4WA 3LPEA 4PWDA 1RK8A 3CTRA 1FTCA 1SL1A 2O5DA 1YZ6A 1D8YA 3HCXA 1WD6A 2QE5A 1TQLA 2N7YA 3PX6A 5CYQA 5BYRA 1WKLA 3DCAA 3QT8A 1PSDA 1RWOB 2PGCA 4DJBA 4DV3J 2NSCA 3UD3P 2G2OA 2KN4A 2HAIA 4ILRA 4IDKB 3DLBA 3M8PB 3NBPA 2BW2A 3RR7A 1JLQA 4FNIA 4KHPJ 1G3OA 1RT5A 2Q43A 1BUXA 4X4RA 4DV2F 1NB7A 3RG6A 2FHJD 1JLEB 2Y1LB 2W9AA 3RW7A 5HMWA 2HVDA 3PACA 4CYUA 2ZWPA 2MYFA 2IAJB 2NYHA 1PYSB 3VAGA 1WWHA 2UVVA 3TRGA 4OI1A 1TKDA 4A8WA 3CCWA 2FC9A 1YTYA 4PXDA 2FVPA 2WK4A 3SV3A 3AA9A 2DNLA 1SCJB 1LW2B 4KJIA 4WFXA 1OWXA 4GKKJ 2DCUB 1J5OB 3SSSA 3M8SA 1X9MA 3IM9A 4NRUA 3KJVA 1ZYQA 4QWEA 3T6JA 2RDJA 3K8WA 2R7UA 1MMLA 2Q6CA 4J9PA 4RZRA 2QMUB 1W25A 4IR9A 3CW2C 1TVRA 2F5GA 2A1BA 4ZK7M 1U24A 3Q2TC 2DXDA 2EFPA 2ZJQQ 2XULA 1N0UA 1C2PA 1HQEA 1S9EB 4FKYA 2X1AA 4GVLA 4F0MA 4LSNA 5KG7A 2FB0A 3DMJB 2CVEA 4WZQA 1F0XA 4LF8J 3HJVA 4JI4J 3VZIA 2A18A 5IM0B 2DGXA 4D3HA 1UP1A 2GZOA 1XNQF 4OI6A 2FGOA 4JI1F 2V69A 1FKOA 3J80Y 1QVGR 5LSLA 1S6PA 1IR0A 1ZZFA 3NOCA 3HP6A 1CC7A 1UVLA 1B0TA 3PRDA 4NLSA 3PO5A 2ABYA 2RRAA 1JXVA 2MZQA 2A2DA 4EU0A 2ZHAA 2UXCF 4NX9A 4IDKA 3GU0A 3M8PA 4GMKA 5L39A 3PHEA 3MD1A 2BANB 2ZHBA 5F9LA 4X4SA 4I6WA 1JLEA 3BSOA 1FJCA 4IKAA 1HW8A 2L9WA 2EI5A 1N33J 1HNZJ 4MMOA 4JYAJ 2IAJA 3JSMB 4NYZA 4I1TA 2J0XA 3MR7A 3KLVA 1TR0A 4UQTA 3BQ1A 1FERA 2E5HA 1ITPA 2DHGA 1JJ4A 5HANA 4B3MF 5E3PA 4DR6F 1ZAWA 4DL4A 1TMJA 3HJFA 4ZVHA 1RWMB 2KO1A 2V2VA 1LW2A 2UUBF 1J5OA 1VQYA 3IFEA 2VV5A 1S79A 2ILZA 4Q5VA 4DQIA 3BS9A 3QGIA 4ERDA 2LEPA 2O3DA 1VR6A 5KT5A 2ZC4A 3CCJS 4IG3B 1HIYA 5F3TA 3D54A 1FFSB 2CYYA 4XPCA 2D1CA 1C1CA 3CJ5A 3VF0B 3CPWR 5HQMA 5EDWA 3CCTA 1S9EA 2VQEF 2C2OB 3IBFB 2Q79A 4ED4A 3FKBA 1U09A 1IKWB 2KB2A 3Q89A 5IM0A 2HBZB 3LGNA 1R89A 1U7LA 4K2XA 4YFUA 2DGTA 2XZWA 4WCEQ 2ZDOA 2YNHA 1TZ0A 4DV3F 3MI7X 1UFLA 3BGRB 3R6GB 1WOOA 1Y4ZB 2YKOA 3WIUA 2DNHA 2YY3A 2B56A 5KFRA 2K7KA 4KHPF 5HVGA 2M9KA 4ZPDA 1WDTA 2IYIA 3WC0A 4IQXA 5D15A 2FLLA 1REGX 2FY1A 1ZM2A 3TX0A 2BANA 2PMHA 2R2RA 3FCWA 5KG0A 3CJKB 2XM3A 2XMVA 3HT3A 2CUYA 2W2MP 4ZVOB 2WSCC 1EQ0A 4JV1A 2DR6A 1ZTTA 4WYWA 3PR5B 2MQ8A 3KHLA 2CPFA 1BY9A 1RLCL 1U6ZA 2B6AA 4DSFA 4CLUA 3V4IA 3BSNA 4GKKF 4FBTA 1KEKA 1JLFA 2HYIB 4ID5A 4ECZA 3MEEB 1IQTA 3OR1A 1YSJA 1Y5LB 3UWTA 2ZOFA 3HSZA 5IZHA 1EAYC 4USWA 1NSKL 3D0HE 4FP9A 4KGMA 2EXUA 2WOMB 3HK2A 1YBTA 4CZCA 2O1PA 4V1Ak 4YN3B 4EFAC 3Q0AA 3JSRA 5F8IA 4TQRA 1WEZA 2FJXA 4H54A 5C24B 2CG8A 3M2RB 1HNIA 5I42A 1N8RT 1UL3A 2NXEA 1T9UA 4URGA 1N34J 2E5IA 4DDFA 3GB0A 4JI4F 3RW6A 2ZZTA 3MM7A 4AYBD 1B7FA 3C6UB 1QJHA 2B3TB 3SQGB 1RT6B 4GVBA 5DJBA 2DNRA 1IKWA 1KHWA 5FDLB 3GIKA 3GMGA 1L3SA 1W7WA 2V67A 2Z8QA 4DR4J 1VHIA 4CO3A 3DDIA 4PG4A 2FDNA 4IOAQ 2UUCJ 3NNCA 3BGOP 2XB2D 5DGAA 2Y1RI 4NEZA 5AXKA 3S8SA 2RHSB 4WFAQ 2V2QA 2HQGA 3PKMA 4U96A 2P9GA 3PJXA 3ILIA 3CSKA 4RUAA 1U1KA 3OV7A 2DB1A 3C66A 2QIFA 4ZS6A 3DYAB 3K59A 4FKXA 4RW7B 4DR2F 2QLFB 3TOQA 1CULA 3EWGA 3CJKA 1HNZF 1M1GA 2P9CA 3BV8A 4JYAF 2RD5C 5BR8J 4PKDB 1SC4B 3D3BJ 5F41A 2HRUA 5GMDA 2LVWA 3HLUA 4Q2MA 2JNJA 1NDLA 3PX0A 4QPXA 4ZCMA 1EHWA 2O01C 1XNRJ 2KTQA 3TAMA 1HBUA 3PEJA 4TY8A 1R0AB 3IS9A 3MEEA 3OW2R 5IFMA 2FLPA 3QBCA 2GHWA 1RJJA 3G4SS 2MQPA 1VQSA 3BF4A 1FKAF 1SXLA 1SBRA 3LW5C 1F9FA 5L8RC 4L74A 2VC0A 4CTAA 2DH9A 1NJIT 2YX1A 4CLPA 5D77A 3HSGA 1PYOB
chains in the Genus database with same CATH topology
1RA6A 2V8HA 1FA0A 1UEVA 1VC6A 1KQKA 4FF4A 5EN1A 1W2IA 4KFBA 2N82B 3D1QA 4K4YA 4WK3A 3V6JA 3M2RA 3ZZUA 1V9OA 1DJ0A 2YNFA 2I8EA 3DN9A 4LSLB 4B9VA 4NOHA 4B9SA 1T02A 3N28A 4NA3A 3SSQA 3O8WA 3OUYA 2IMOA 2CQ1A 4N77A 1IKVA 2CJAA 3GFZA 2R2TA 2RNEA 3ENQA 4RW8A 1QSLA 1CVJA 2HLUA 3J7Z5 2CJBA 4LF5F 1Q16B 3CVKA 1XK8A 1JWWA 1S97A 4ZA1A 2D9PA 1FDDA 4HHJA 2P9EA 3LWMA 3KNAA 3JTPA 3K5LA 1VI7A 1UEUA 4AE5A 2KZMA 3BGFA 2P6TA 1QY7A 1CSJA 2VOOA 1KOHA 2MY8A 4NZ7A 3FMWA 5KG3A 3SDEA 1RT1A 2DHAA 4JI2F 5KT6A 3IG1B 4Y28C 4O3QA 4NRTA 4ILMA 1N48A 1SL0A 2DGWA 4V19J 3OFHA 1RT3B 2A3JA 3G6YA 4EBEA 1FXLA 2CIMA 4MJKA 1RTJB 3V6DB 1Q81T 1HWKA 1HNXF 2JC1A 2MXYA 2ZE2B 2KM8C 4ZPAA 1Q7LB 1T7PA 1MNEA 2KXFA 4JI7F 4DL2A 3PNIA 4C3KA 1C1CB 3RBDA 2XSFA 1U25A 2AP6A 1K8AT 3FCHA 2HQ3A 3TA2A 3EXYA 2XMKA 1NKBA 3DI6B 1DLOA 1GNKA 3GR0A 4NLOA 3BDEA 4DG1B 5K8PA 1NKEA 1BQXA 1GAOA 4R25A 4F3QA 2YWKA 3US5A 5JVGQ 2R7TA 2F8EX 1V3RA 1SKWA 3M2UA 3D5MA 1L3UA 1N6QA 2WONA 4I67A 3KLIB 4B17A 5KT4A 1VQPS 5K14B 4DV0F 3ZZRA 3GG1A 2QV6A 4ED2A 4TU7A 1KLNA 1F2GA 2HGNA 1VQ4S 1VC0A 4X4OA 3LF0A 2VBWA 2QLXA 1M0SA 3CF5Q 4ETXA 5B0CA 4N5SA 4DL5A 4RW7A 2LDIA 1TL1B 4MYUA 4GC7A 2RQCA 3PIPQ 3H5UA 3AB2B 2UUWA 3QAUA 1IM4A 4ES1A 3M6XA 3QJLA 2JSXA 5F8HA 3R5AA 2X1BA 2YNHB 3DOLA 5B0GA 3I4PA 4YEAA 3NNHA 2NZ4A 2EFNA 2RKIB 2XGQA 2WB4A 5EWGA 4C0BA 2DPIA 4HDHA 2CQHA 2KVIA 3IR6B 4JI8F 4DS4A 1QSSA 3TA1A 2M7SA 3CT9A 4MKYA 4WU3A 2RS8A 1Q82T 3UCZP 3HPOA 3UI3A 5HLFA 1SJQA 1OQ3A 2VBXA 3F41A 4WYLA 1VK3A 1YG0A 4FPRA 1QAIA 5E3RA 4A46A 1SH3A 3I5BA 5H9FJ 5E7OB 2ALZA 1A6LA 5T7LB 1Q7YT 2ZH7A 2RRNA 1U1MA 2R7XA 2RF2A 2MZJA 1YVFA 4WFNQ 2NLWA 1TFYA 1Z2LA 3IRXA 4XPEA 2MDAA 4DL3A 2B4PA 2HNDB 2R7QA 5EGYA 2YNIA 1Y9OA 2KFYA 5F8GA 4DV1F 1U1PA 1R0AA 3K58A 4B3TF 2D74B 2VOPA 3HXMA 1HBMA 4F8RA 3M32B 1D3WA 3JSYA 4PG6A 2NXUA 1QM9A 4KKOA 1WHVA 2CPZA 4QR1A 1LOUA 2AX1A 1CLFA 4HH0A 4K4WA 1E6VB 4DX8H 2J0SD 1UWBB 2FLOA 4JBCA 5CQGA 3T5JA 4HDGA 1WEXA 1URNA 1NHUA 4O3PA 2V8VA 2KG0A 2JX2A 5C5JA 4DUZF 5BJRA 4RBUA 4DN0A 3CMES 3VQSA 5CCLA 3MPYA 2JEJA 2JWNA 2IA0A 3CJ0A 2HHVA 4ZMMA 1VS3A 1S1XA 4CH0S 4ZKAA 2W4DA 2J6UA 5KFAA 2DNZA 4C11A 1LWEB 1S10A 1SJ4P 1QTMA 1U1LA 2FHJA 2LEAA 3DLKB 4OL8A 2RQKA 1NK5A 2E1RA 5LSRA 1FDAA 4QIGA 3HHLD 2B6AB 3OBIA 4NLUA 1N34F 3GYXB 3IXQA 1S1UA 1WI8A 5E3QA 5KFPA 5SZTA 3V4IB 3Q8QB 4EYHB 5K9FA 1FRXA 4WXWA 2NUHA 5HBMB 3QZ8A 3TYTA 2JLGA 1WELA 1JLFB 3V4MA 1KLMB 5KOXA 4ID5B 4LSLA 2RB7A 4K4SA 2CPHA 5KFJA 4U9RA 2EW9A 3DRXA 3EZUA 3OR1B 4ETZA 3OVAA 2XY5A 1D8ZA 3UE2A 4IFVB 1UKUA 1IJEB 2HS0A 2KKHA 4ALZA 5IXUA 1EP4B 2VC1A 4DV4F 2C2DA 2CG4A 3D0IE 2LMIA 4CNZA 1KR4A 3MD3A 1SUQB 1SH0A 1BQNA 3Q8SB 3M6WA 4MK8A 3E3XA 1GH8A 1B0VA 4I2QB 3DRPB 4NCGB 4NLXA 1T8EA 1S99A 3MEDB 1S0OA 2V2KA 1HWUA 2MHEA 3UFCX 3QWUA 5C42A 3PVXA 4IO9Q 1NU4A 1N88A 2C2RA 2KI2A 5KTQA 4LFAF 2UUCF 4C97A 4A8XA 3VZHA 3LQVA 3MEGA 2ZH6A 1R8BA 5IWAF 2C3PA 2UUAF 1OSDA 1XR6A 1RT3A 1B0PA 3AH6A 2BABA 1M5PC 3NG8A 1XC9A 2J9DE 4ELVA 3V6DA 1RTJA 4O3NA 1FTRA 4Y2KA 3CCVS 2AJQA 1P9QC 4F4XA 4HTJA 1SJ1A 3MMJA 5DDPC 1HNIB 5I42B 1ZH5A 2R9LA 2F4VF 2V9KA 4XIUA 4YB1P 1MMDA 3T5HA 3CC7S 2GX8A 2QFJA 3UCUP 1NKCA 4ED8A 3CCRS 3MOJB 5KG2A 3IR7B 1MWYA 2XMWA 3M1VA 2ZJRQ 4ECSA 2PFFB 4A48A 1MMNA 2VD3A 3M6VA 2AJFE 3MM7B 2POKA 2EKYA 2DR9A 1CC8A 3PFOA 4KR0B 2HMIB 4ELUA 1KQGB 4IFYA 5DG9A 4Z2XA 2L9DA 3KLIA 2IVMA 1IJFB 5DDQC 5K14A 1HW9A 1UVJA 1OS5A 2XS2A 5B08A 2E9TA 2EFGA 3H4BA 2GFFA 4QIVA 2J6SA 2DGSA 3NS5A 4B3SF 3PW2A 3RBEA 5I3PA 2J7KA 4O44A 3BR9A 5J2NB 1S4FA 4USHA 1ZPWX 2IVYA 4PWUA 2OPRA 2VBYA 4F25A 3MUTP 5BR8F 1S1VB 2MHNA 6FD1A 1TK5A 1S9GB 2XGPA 4BDPA 1YGYA 3SV4A 4V19X 2DHSA 2YWGA 1TL1A 3TI0A 4DS5A 4NCBA 2W8KA 1R8HA 1VMBA 2XI2A 5KG1A 5GVQA 1WG4A 1LKZA 3GWCA 4J9LA 1G2EA 5E33A 4LVNP 4DBQA 1R8CA 3T3FA 1HWIA 4Q7AA 2FHKA 1GTEA 5A8KB 2RKIA 2HWIA 2KFNA 4J9NA 4DSIA 3PRBA 3HHDA 4O23A 3BJYA 3DHWC 4AL6A 2WTFA 5K8OA 1CEZA 1XNRF 2J9DA 3RAXA 2HHTA 3V6HA 5DQGA 5M2UA 4J9MA 5KT7A 3HZGA 4DL6A 2QA4S 4JUZA 4OX7A 5J1NA 1X8DA 5A0YB 1M5SA 2W4PA 1WF1A 4E98A 4YY3F 3IO1A 2OIHA 2J7WA 5T7LA 5EWFA 4PR6A 3S7RA 1VQKS 4E0DA 3QGPA 2GQQA 3H59A 3IGVA 3VWSA 1Q53A 4TLQA 4O3OA 3KYLA 3QLHB 2BA9A 3H25A 1AUDA 1U1NA 3AB4B 3UQSA 2IM2A 1I94F 2HNDA 2BUNA 3KLEB 3HO1A 3E8OA 3OJUA 4ECQA 2AGOA 5HQ8A 3MM5B 4OHVA 2FPHX 4NLWA 4LQ3A 2OSQA 1RKJA 2K3IA 2MPUA 4N47A 3WDOA 1UWBA 1WNEA 4TYAA 5KFLA 1DARA 1WHXA 1RTHB 4C0HA 4YR3A 1VRUA 2EG2A 3I0SA 2MB0B 2OKQA 1YI2S 1M5HA 1HD1A 3BGUA 4DL7A 3BDPA 2KRBA 4L3NA 3I6PA 2RT3A 4O0IA 1UETA 3SMZA 1U1QA 1LWEA 2AJ4A 3KLHB 2V0NA 4B02A 1UJ6A 3DLKA 2CPDA 2UV8G 1JLBA 2GC8A 2ZITA 1Z1ZA 1HHTP 5E5NA 3T9ZA 2XLIA 3PV8A 2HFNA 3I87A 1R3NA 1X4BA 2JVRA 3VAIA 3DXBA 2LQBA 4RUHA 1S72S 3NCQA 4MKBA 4K4XA 3TAMB 1HBUB 3OXGA 2F9DA 3MTKA 5HBMA 1U1RA 4TY8B 3KTQA 2EG1A 2I9SA 3NMRA 4NYOA 1R8PA 4GO7X 2XY7A 3IS9B 3ZZPA 2BBEA 2DTJA 4EGLA 2IFXA 4FVCA 4RKUC 2CPIA 2RE1A 4M95A 4KV8A 4I2PB 2J0WA 5C25A 2BJEA 1S1TB 3CO9A 3PW0A 2IM0A 2JVOA 4C4WA 2QMXA 3LP1A 3DOMA 3C6TB 5LJ5Y 3CD6S 1MSWD 3QGHA 1XEZA 2HS4A 2CPEA 4C3LA 1HNVA 2YNGB 4XAKA 5A8RA 2RU3A 3KK3A 4RNOA 4B9UA 4C8KA 5D4OA 3DRPA 4NCGA 3MFIA 5K5MA 4CTAB 1SV5A 2PEHA 2EBGA 3F44A 2ZZMA 3Q23A 3BB5A 4IH7A 2RQ4A 1T05A 5KOWA 2QZ8A 4RX6A 2DIUA 2OLWA 2SXLA 3H5XA 2W8LA 3GV7B 4A8FA 3EYZA 4KGKA 3JTNA 3SCKE 2BZ2A 3ICLA 2DGQA 5EX3A 3HDSA 1T94A 2JDJA 2OFGX 2QSWA 4HKQA 1KRPA 3GFYA 3AJ1A 4IH6A 4OJGA 2C2EA 2B5JA 4KQZA 3ULHA 4LVOP 3R5BA 5KFZA 4R8UB 3RR8A 2KJWA 4LF7F 1Y3JA 2HGMA 2CQIA 3RAQA 4X66F 3GV8B 1FJEB 4YB7A 4CO2A 2XMJA 3RYLA 4LF8F 4O4GA 5CXTA 3MDFA 3MAQA 4F2SA 3PJWA 1X7VA 4MK9A 1NJXA 4YDXA 4NLYA 1CQMA 1NK7A 3OL6A 4URQU 2HMIA 1KQFB 2XO7A 3I31A 2E1AA 4CO0A 2M8DB 2W7AA 4KSEB 4H4MB 1YQHA 1D9DA 2VBZA 2VB6A 1N5YB 2MQMA 3V81B 1W2BR 4KRWA 3SDEB 1RT1B 3H4DA 1TL4A 4EO6A 4HYKA 3EX7B 4ZHRA 1S9GA 4CH7A 4TLRA 4OV1A 1X9WA 1VBYA 1FHTA 3BO2A 5E3CA 2FJAB 5AE2A 1FVQA 2WB1D 4F4YA 4MIWA 1L3TA 2B7BB 2DH8A 3X1LB 1K0TA 1Z4UA 1NJYA 3D0GE 2MQNA 4RNHA 1QE1A 5A8KA 1DLOB 1D9AA 1T3OA 2A10A 1TL3B 2W9CA 2CKWA 3L09A 4WJBA 1RQ0A 1HQUA 3MWBA 1IKXB 4GC6A 2F8MA 3CC4S 4B08A 1P1LA 1S48A 3BZQA 5F0WA 2E66A 3VAMA 5KG6A 4O3SA 2CPJA 5L1JA 3UCGA 3IRWP 2RRBA 2B4UA 2KXNB 2WONB 3J7A1 5A0YA 3N79A 5IT4A 4OI3A 4ES3A 3LOUA 5DS7A 2IJNA 3THPA 3ZZTA 1NH7A 5KFWA 4EZ6A 1SIWB 4FXWA 1S76D 1FKPA 4QU7A 4BBYA 3S01A 4LQ9A 2LQ5A 2VPYB 4TNOA 5E3AA 3D2WA 1IBKF 5AXNA 5FLXY 2JEGA 1N32F 1NZAA 5CYMA 2VG6A 3MM6B 2L3MA 2W9BB 4YOEA 1HI8A 2R8HA 2AYEA 1N33F 2M52A 1GTHA 3MM5A 2QLWA 3CUNA 5AXMA 3LALA 3T1AA 2GO9A 5KFCA 2LXUA 2EBEA 3PFEA 4A47A 4KB7A 2FC8A 3DOLB 4OJ3A 1G7CB 3D1HA 4DSJA 2I0XA 1LW0B 4EUVA 3O6QA 5HROB 2DR7A 2M0GB 4PUOB 4YR0A 1WHYA 3I0RA 2QYCA 3HVWA 4FZVA 3NWGA 1GXUA 1XN9A 3DDKA 4IG0B 4OX6A 4MKAA 3F73A 2VODA 1LK7A 4RWWA 2GMJA 3JB9k 1VQ5S 1A7GE 4NLRA 4H4OB 4FS1A 4NLGA 3RRKA 3QYYA 4PXCA 4C8OA 4LT6A 4ZVFA 1TKXA 1CG2A 1FNMA 2GW8A 3H20A 5L9XA 4DR5F 2WHOA 3QIPA 4JV0A 4CI0B 4MH8A 4EBDA 3FRZA 1FE4A 2AJ0A 4WFZA 3O3LA 2MKIA 4B9TA 2CQ3A 2FTRA 4OLPA 2HLTA 2CDQA 1KS2A 3AQOA 3GIMA 4HH1A 2G9OA 1VBZA 3CD5A 4OZ5A 3CCES 4R0EA 1FK9B 3MURP