2ZDPA

Crystal structure of isdi in complex with cobalt protoporphyrin ix
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Heme-degrading monooxygenase isdI
publication title Ruffling of Metalloporphyrins Bound to IsdG and IsdI, Two Heme-degrading Enzymes in Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 30
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zdpA00
1AW0A 3HDSA 2GO8A 5B0AA 4HH0A 3LGNA 4Q2LA 1P6TA 1YJVA 1SI9A 2ZDPA 2PGCA 2KT2A 4YEAA 4ZOSA 2ASYA 2FIUA 4Y2KA 2QLWA 2QLXA 4YDXA 1V3ZA 5B0EA 5B0CA 2XMMA 3IWLA 4HI2A 3HHLB 1P8GA 2HFNA 1CC8A 2K7KA 3MCSA 3MZIA 1OQ3A 2BBEA 2XMWA 2XMVA 4Q2MA 2HFOA 3LGMA 2FB0A 5A6WA 2KKHA 1OSDA 1TZ0A 1QUPA 2LQBA 4EFAC 4FNHA 2VH7A 2LXFA 2W4CA 5F0WA 2BUNA 4FNIA 4DPOA 1FVQA 1YG0A 2IFXA 3KNGA 1U7LA 2BJDA 1GXTA 1MWZA 1Q53A 2Q3PA 1IUJA 5KAKA 2K7JA 2LDIA 1RJJA 1Q8BA 1SB6A 1XBWA 1URRA 3TNVA 2K1RA 3T9NA 2L3MA 2BYCA 2HIQA 2KT3A 1X0PA 2OFGX 2ROPA 3TOQA 5B08A 2RU9A 1FD8A 4HL9A 1CPZA 4DN9A 2GGPA 3KKFA 4Y2IA 2OD4A 2OKQA 1LQ9A 3BN7A 1GXUA 1Y3KA 2ACYA 2LQ9A 1TUVA 3DCAA 3DXSX 1YRXA 3F44A 1Y3JA 2RMLA 4OIXA 5T7LA 2CRLA 4HH1A 3CJKB 1YJUA 3KG0A 2ZDOA 3QMQA 2GA7A 5B0GA 2N4DA 2PD1A 2AP6A 2EW9A 2OD6A 3LO3A 5A6PA 1N5QA 2QYCA 3FGVA 5B0FA 1FESA 3E8OA 3HHLC 4HI1A 1ULRA 4A48A 5B09A 1FVSA 3TRGA 4NL5A 2QIFA 1VQYA 3BF4A 3BM7A 1W2IA 2BJEA 1Y0HA 1TL4A 2FTRA 4A46A 1CC7A 2HLUA 3BDEA 1N5SA 2OFHX 2RILA 1KVJA 3BR8A 2W4PA 1AFIA 2ROGA 1X8DA 3WDOA 2XMJA 1AFJA 1K0VA 1MWYA 3KG1A 4OJ3A 3HHLA 1VQSA 1SQEA 3BB5A 4Y2MA 1FE0A 5B0DA 2AJ1A 3HX9A 5IXUA 3K7RA 4F67A 1KQKA 1OPZA 2XMUA 5B0BA 2IYGA 2N7YA 1YJRA 4QOTA 2OAUA 1Y9OA 1APSA 1TR0A 3HHLD 2VV5A 3QGPA 3I9ZA 4A4JA 2IYIA 1N5VA 3GZ7A 2XMKA 2G9OA 2HQIA 1FE4A 1Q8LA 3HF5A 3IWXA 1R6YA 3VTIA 2K1RB 1N5TA 5F0UA 2OMOA 2K2PA 2GCFA 2W4DA 2ROEA 1JWWA 4NPOA 1FEEA 2GGPB 1OQ6A 5K9FA 1X7VA 4DL0C 2FHMA 2GV1A 1S6OA 1S6UA 4ZA1A 5T7LB 2OP5A 1WD6A 2AJ0A 2AW0A 2HLTA 4OJHA 3CJKA 1YJTA 4A47A 2JDJA 4U9RA 3FRYA 1TL5A 2RSQA 2N4CA 1Q4RA 4OJ1A 2XMTA 3UDCA 3BGUA 3HFKA 2KYZA 1KVIA 1JK9B 4OJGA 3FMBA 2GFFA
chains in the Genus database with same CATH superfamily
4K4UA 1LK7A 4NRUA 5B0CA 4WFYA 5CCLA 2ZJPQ 4ECQA 4LFCF 1ZA2B 2KN4A 4HKQA 1HBUB 1HNXJ 3EWGA 3MPYA 1U6FA 3B78A 1SJQA 2EFPA 4OHWA 5DGAA 3D6MB 1AROP 2OUGA 3CJ3A 4DQIA 1TKTB 4MYTA 5KT2A 1IBLJ 4YR0A 4DV3F 2W2MP 3PZPA 2MYFA 3KK1A 2V63A 2XGPA 4ERDA 1WF0A 2BVZA 4AXJA 3U1MA 1BLUA 1VLYA 2CG4A 2H65B 2BJ8A 4OZ2A 5LMUJ 1K9MT 3HZEA 3VZHA 3WDOA 2Z2ZA 3GMGA 4RW7A 2EK1A 3QGGA 4X4UA 3UN2A 1QVFR 2QA4G 3GR1A 3CCRS 1DY3A 2CJXB 3ZTOA 1F5BA 1MU2A 1Q79A 2YWFA 3TVYA 4RLEA 1YJWS 4IRKA 1RISA 1SJ4P 1AA1B 2KFNA 3CCMS 3EZUA 4J9MA 3GSDA 1UETA 4KY3A 4DWIA 1RHKB 2VL1A 3DRYA 3DC2A 5ETQA 5CYQB 3THTA 4F8RA 1GMWA 3PW2A 4U7CA 5D8HB 4A8FA 4EBEA 2RKIB 3RTVA 1JLGA 3PX4A 3DU6A 1FJ7A 3EGNA 4J91A 1LW2A 4NCGA 3DKDA 3S7RA 1RTDA 3BSAA 2FVCA 2FZGB 3DLKA 1PC4A 3CC2S 3R5DA 4HR2A 4YB7A 3ZTRA 1DHMA 4OI2A 3BV8A 3BKFA 1TUWA 2BM0A 1Q81T 1CULA 2LKZA 1NCLA 1HD1A 2DCUB 2UUCF 2W8LA 1ZTWA 1NSAA 2MLXA 4P2XA 3TUIC 2U1AA 4ED2A 2GFFA 2QJ3A 4ED8A 4JV1A 4TLQA 3MAAA 4R25A 2H54B 2CDRB 2BKPA 3RBEA 2WZ1A 1LFPA 5B0EA 1FF2A 3GV8B 1HHSA 3T6BA 3Q8QB 1T9YA 4FP9A 2GAGC 1QSYA 1C1CA 2FVRA 4LF8J 3HO1A 2OH2A 4J90A 2H1YA 2JEGA 2HVZA 1H72C 2YNGB 3W2WB 4DUYJ 3CD5A 2HHSA 3M32B 1HMVB 4IH5A 2MZRA 5IM0A 1YQHA 1VDHA 4CO3A 3BO4A 2V4JA 5LJ5Y 1RYSA 4Q8EA 3G6ES 1BQMB 3K5PA 4JOUA 1AB8A 1YDLA 2DR5A 3HX9A 5F3TA 3KLGA 5KFZA 2DNRA 3SQGA 3C16B 1HIYA 3A4TA 5KT4A 3KTQA 1HI1A 1LXNA 2QLBB 7FD1A 3P4UB 3O1LA 3IR5B 2DGWA 1NU4A 4I64A 2RS8A 2OELA 4RUHA 4KGXB 1JK9B 5EX0A 5K20B 2XY6A 1GX6A 4P72A 2A6MA 5F8GA 1P1TA 5AXNA 4ZPVR 1TMMA 1TKZB 3GJRB 1IWAA 3BREA 2CQCA 4J9NA 2N82B 1TAUA 4A8XA 2DNZA 2ZHAA 4KIAA 3QLHB 4URGA 5A8KB 3CJTA 3HKWA 4GVLA 1Y3JA 2DHSA 4ZVSB 4A8YA 4KHPF 1T9VA 1RT3B 2R42A 5K8OA 4RU9A 2LA4A 1RUSA 1V5IB 5E3QA 3M9OB 4V19J 4FYXB 2UXDJ 1H7WA 2J76E 3MOZA 2JLFA 1JXEA 4H4KA 3NOGA 3MR7A 3N28A 4DBQA 4JI4J 3UE2A 1HA1A 2EKNA 1O6XA 3ENQA 2F8EX 4FKXA 2WVDA 3W2VA 3N6MA 1X7VA 2E7VA 3ILJA 2M0GB 4PQUA 2CQ4A 3JSRA 4N56A 4K7QA 1NHUA 4NMLA 3DOMA 3LGNA 2C2KB 2V69A 5D3GA 1WG5A 4CH7A 2BDPA 3CCLS 2CDQA 1SQGA 3CD7A 3M9NB 4ZVEA 2HHXA 1WJ9A 4IOCQ 4QW9A 2J6UA 3KK3A 4NLOA 2O01C 1BHNA 2QC3A 4H4OA 2GX8A 2FJXA 4RW4A 2W9AA 3MM7B 1X9MA 2YQ3A 3K2YA 4G1QA 2RDIA 2Y8YA 3ET6B 4U96A 4JI8J 2WW4A 3BDPA 2PO4A 2IA0A 4O4RA 5CXTA 1RAGB 1MWYA 4OQJA 4Q0BA 4I68A 1ZPWX 3I9ZA 4Y34A 4D3GA 3KLFB 3FEZA 4XK8C 4MAKA 2VC1A 4PUOB 4RBUA 2XMAA 4G1PA 4K5SA 2G2ZA 2HNDB 3DRPA 2RHQB 4IFVB 3T5LA 2VPZB 3U1NA 1YITS 1IKYA 2OEJA 1RAHB 1QE1B 3PW5A 4OZ5A 2YPZA 3TUPA 1BY9A 4WIQA 1FTCA 4BC9A 5HP1B 1REVA 4LQ3A 4ZLLA 4ECXA 1L3VA 5DDPC 3TOQA 2VG7A 4Y2IA 1SBRA 1TUVA 1CSJA 3DCAA 1W7WA 1WACA 3OTOJ 1RWVB 3I0RB 2XLKA 3GFZA 1AYEA 3KMSA 1J5OB 2WB1D 2MJUA 3PRBA 4FYVB 3NNCA 5E3CA 3UO0A 3O8WA 3OW2R 3EMTA 3IS9A 1DTQB 2MQLA 3D1OA 2VODA 2IRYA 3HPOA 1OO0B 1XN9A 1WNEA 3T3FA 5F9LA 2BW7A 2F8HA 3RR7A 2EEYA 2FJEB 1Q7YT 4I6YA 3PX6A 2KYXA 4DFJA 9RUBA 2V0NA 2DR6A 4LR9A 3FK4A 3IA0A 1JKHA 4QIGA 1H3DA 3BPDA 4RNMA 4TY8B 4O0IA 4F7VA 1H38A 2XMMA 2HQDA 3CIZA 2RQCA 4LRBA 2AZ3A 1T03A 4PXBA 5J2MA 4YB6A 2W24A 1IKWB 2E9ZA 3DGPA 4WU2A 4OMFG 4CH0S 3G82B 4ECYA 5B7WA 2ZHOA 1QJHA 4JBCA 5F8MA 2O1PA 5EWFA 2J6SA 3GG1A 3KJQB 4QIEA 5DRKA 5EUHA 1KBRA 2E7WA 4N41A 4JI0F 2R8JA 2LEAA 4DPWA 5HROA 3CCQS 1TL7A 2XULA 1LFWA 3RRGA 2I5JB 5LXYA 1NB7A 1NAQA 4USMA 5HBMA 2JVRA 2W01A 3MEDB 2ILZA 2HAFA 1MMLA 1FEEA 4M5IA 5F8NA 1UW9A 4OJHA 4CI0B 4A8OA 3CJQA 4WP8A 1ZPVA 1TUGB 1P27B 4DQQA 1FI4A 3CTRA 4HH0A 4Q2LA 4YR3A 1SKRA 2VG5A 3MHYA 4U6PA 2EWHA 2QX0A 2HIYA 3H98A 5CYJA 4EUVA 2JWNA 3LOUA 2HK2A 1FERA 5K14B 3MXHP 1I1GA 1CJUA 4P71A 1B3TA 1MWZA 1N32F 4FS1A 3TNVA 3SBMA 2PIIA 3PEJA 4CYUB 3AFGA 4WYLA 4B9VA 4PPZA 1VYAA 2MQ8A 2HFUA 2XY7A 3DLJA 3DMJA 4B3TJ 4MH8A 4DQSA 4ZITA 2JEFA 2OI2A 2V9WA 5JUMA 3NNAA 4Y28C 4U7UD 1S1VA 1RZMA 4M5NA 4DL5A 4ECTA 4LSZB 5GMEA 4BWMA 2RF2B 3NNHA 4DX8H 3HF5A 2C3OA 4I2QB 4DSFA 1CJKA 4YHHJ 2AWZA 2IJFA 3J81j 1WD6A 2PN6A 3K5MA 3NG8A 4O3NA 3UD5A 3KG4A 3UI3A 4LF6J 3VVUA 4DR3F 2DGQA 5I3UA 3CC7S 1OMSA 4X4NA 1EJ7L 3HULA 4ZS6A 1FKAF 1S9GA 1PC5A 2ASJA 4M5MA 5KG3A 4NLVA 4RW6B 4ICLA 3VZIA 2B6AB 3EE3A 2KT3A 5E3AA 1TVRA 3U02A 1R8CA 1XQIA 3AB4B 2VBZA 1S9EB 5M2RA 4B3SJ 2M3DA 2KT5A 3I0SA 3M2VA 4DFKA 2B43A 2WSEC 4DV4J 3NGTA 4QR0A 3ZZZA 4TU9A 3W62A 3MMAA 2NXCA 2IY5B 1V6HA 2ZUAA 4RNHA 2AJFE 5D77A 1RHQB 4WYWA 1MWQA 3EXYA 1WHWA 1S9FA 1Z1ZA 2MXYA 3THVA 1EP4B 3N01A 3J7YI 1R89A 1ACMB 3QIDA 3HHEA 3SDEA 2BACA 4F4AA 4P74A 4OYZA 1CVJA 3UDCA 4ZVQB 3GILA 1N4LA 3R2DJ 3C3LA 3V4IB 3VAKA 2ADCA 3CJSA 1HBMA 3PYEA 4WF9Q 1V3ZA 1KEKA 3KUEA 2E5JA 3CJRA 2VFTA 3NGKA 3HCXA 4C0OC 2HKEA 3NRBA 3LA0A 3TAMB 4EZ6A 4YB1P 2CA9A 1HD0A 1DLOA 1WEZA 3I56S 3SFGA 4LUBA 2PD1A 2CXEA 4K8RA 1U1LA 3O6QA 2GW8A 4MYUA 1PBAA 3M7VA 1YWXA 2YQ1A 4DU8A 5C42A 1RYRA 2V4RA 3IGVA 2YH0A 2DNQA 2EXUA 4C97A 3S1TA 1EKRA 3CNQP 2DXDA 1Y7PA 1VGYA 2JVOA 1IKVA 3IN5A 1N6QA 1QSLA 4HACA 1CLFA 2W2QP 4IG0B 3DRSB 2EBGA 3F73A 1FKOB 3DHWC 4DLEA 3L3CA 4OHVA 3T6JA 4TYBA 4OX9F 5DO2A 4FNIA 2HEKA 3H42A 2GVZA 1ZTTA 1RJJA 3GQCA 1S5ZA 1JLQB 1CPZA 4WFZA 1KNZA 3BN7A 4PXDA 4ZJOA 5KTQA 1T8EA 1ZM3A 1UP1A 3LP0B 3PV8A 2DH8A 1D9FA 4QWDA 1I3OB 2KJWA 2YKAA 3BM7A 3PKYA 3TYTA 4QW8A 3QPIA 2CWKA 1U1MA 4L74A 3CGIA 1VBKA 2AJ1A 3GSIA 3CJ4A 3JYTB 4EYHB 3V5RA 2KO1A 3ZTPA 4ZLPA 1N33F 2I2YA 1N5TA 3W8GA 3M05A 3HVTA 4NCBA 2DITA 2XLIA 3L7UA 2HZAA 4JYAF 4GKJJ 3DLBA 3RB6A 5KFWA 3CDUA 3W60A 1FCAA 2N4CA 5KFHA 4BDPA 1RAOA 2E5LF 1SC4B 4IOAQ 3TZWA 2CPFA 4NLYA 4ATNA 4TYAA 2LU1A 1R27B 3FFIB 1OJ4A 2DGXA 4IH6A 5IWAF 4CLPA 3IWLA 4QPTA 2KXFA 4OYOA 3B8HA 1VQ8S 4NA1A 3RAQA 1R0AA 2IMWP 4ZDNA 4ZHRA 1QAXA 5LMNF 1S4FA 4CLTA 1RWNB 2XEXA 4RU2A 1X31C 4OZJA 4RNOA 1VRUA 1CEZA 4H4MB 1JLFB 4HLBA 1I5OB 5ETTA 4B3MF 2ZVSA 3CWJA 3GONA 2DXFA 4DF4A 4C8KA 5A2QU 5F8LA 4KAIA 1WOPA 2KFYA 4KB7A 1VQNS 2ZH8A 2Q79A 1IJEB 1FJGF 3R5CA 5KFLA 5MAOA 1U49A 2VQFJ 3E01B 4C11A 3NWRA 4DLGA 3KUGA 3N79A 2DNPA 3MECA 2JDJA 4DV6J 2RDDA 1OYDA 1XNQF 4UT4A 1XMQJ 2H51B 1S49A 3JAMU 2HS3A 5L1KA 2HBZB 5HQMA 5G4DA 5AT1B 5CYMB 3ZZYA 5EN1A 4O3OA 4DL4A 3AOCA 1VHIA 3SSRA 1B99A 2E9TA 2DNKA 4QIVA 4M5KA 2X7IA 3P5BP 5A0YB 2DGTA 2HIQA 2CJQA 2HQFA 1SJ3P 3RW7A 4X65J 3NBPB 4ILLA 2HNZB 3H4BA 1QTNB 2JFDA 1GX5A 4LFAJ 1XERA 2J8SA 2NUHA 4JI5J 3E8OA 2EFGA 2XC9A 2ZZNA 2WRMA 2PDAA 2PMZD 2A6OA 3DN9A 1NJIT 4X62J 2BE9B 3MEGB 3BN4A 3KHHA 1QUVA 5KFCA 4RW9B 2E7XA 2UUAF 1JNRB 4NRTA 3P8BB 4PG6A 1S1WA 3KXDA 2N3OA 4DS5A 2ZVIA 5D4OA 4ZIVA 4OHYA 2KZZA 1C1BA 1ZM9A 1CJVB 3BZQA 3LPEA 3EVWA 1M5PC 1LK5A 4LIRA 4DSKA 2DGUA 3PRVA 5B0AA 2AYMA 1WWHA 1CJTA 3CO9A 1WC6A 2ACMA 4PXCA 2BE2A 1P8GA 4RO0A 2MMYA 2NXEA 3CJ2A 5CD4A 2J0SD 1HR0F 2KH9A 1UEVA 1VQKS 3R1HA 1IJFB 4ZMMA 2OFGX 2R8IA 2RU9A 2VFVA 3LPYA 4OIXA 3KLHA 1KRPA 3DDKA 3PVXA 1F9EB 5A8WA 4PWUA 2OSQA 2D41A 3FC9A 4PG4A 1RKIA 2P9EA 2DEIA 4P2FA 2YKQA 2FGCA 3K0JA 2NS1B 5D0GA 4DL7A 1URNA 1SV5A 4MKAA 4USHA 3BR8A 2BV3A 1ZYQA 4QWCA 1VJWA 4WXWA 1N5VA 1MLAA 3DXBA 4NOHA 1T94A 2XCPA 2ADBA 1R6YA 2R2RA 2IHR1 4URQU 2GV1A 2HAIA 2R4FA 2B8QA 2EC0A 2KU7A 1RAFB 4NA3A 1X4CA 4CM0A 3KK1B 3K17A 4X4TA 1WTFA 4WZQA 2KXHA 2HQGA 4B9NA 2HVEA 4ZVFA 4ZKAA 4F4ZA 2G1DA 4O3SA 4QYRA 3CMAS 1NO8A 1ICEB 5H9FJ 4EBCA 4TU8A 2XMWA 4RW7B 2V34A 3ZZ0A 2AQ4A 3FBCA 2C2DA 3ZO7A 3G86A 1XEZA 1CBKA 1VS3A 1FD8A 2CZ4A 3QT8A 4DR2F 1MU2B 1RAEB 2W7PA 2PI5A 5CYQA 2KXNB 4F4YA 1X0FA 2HFZA 4QWAA 1FRLA 2QYCA 3HFVA 3OLAA 5KOWA 4M63A 8AT1B 2RD5C 1KONA 1E6YB 3R1LA 1HL6A 4DHVA 3V6KA 1DZ5A 5G0RA 1RK8A 2XMUA 2FJAB 3P6YC 2QLFB 4DSEA 4JV5F 3W61A 1D1UA 2BANA 2HQIA 1Q8LA 3GB0A 1BUXA 4M95A 3AHPA 3G71S 4J9OA 2BZ2A 5EGYA 2ATLA 2C28A 1LW2B 4NCGB 3PJWA 4OYWA 1RTDB 3T19A 1O5JA 3WHIA 1VC6A 5GAGI 4MFBA 4MTPA 1CG2A 2C2MB 3DLKB 4DSJA 3D4JA 3CJ5A 3M6XA 4UQGA 1CULB 2RHSB 2XSFA 2BJDA 3D5MA 4BHQA 2GIFA 4C98A 5KAKA 2L9NA 2B0GA 2QSWA 3DI6A 4F3OA 1X4AA 1U47A 2F4FA 3MAAB 5CABA 4B17A 4EO6A 2CPIA 3RZAA 3LQVA 3L9ZA 3R6LB 1ITPA 1PSDA 3G6YA 4AYBD 5GADU 1NJWA 1T02A 4DV2J 2R7OA 3CF5Q 2QO3A 4NA2A 1WOSA 1ZAWA 3NLCA 4UQTA 1SL2A 5IT9U 4K4XA 3BKTA 5IM0B 3KHRA 4ZVRB 2P8IA 2IM2A 2QN6B 4QCLA 2EFOA 3MMBA 4YEAA 3RYLA 2XS2A 3VGSA 5T14A 5KG6A 3GWCA 5ETOA 4J5OA 1CC8A 3R5BA 3KLGB 1M0SA 3SQGB 3EJMA 3MCOA 1U6BA 1IQZA 3H5UA 1NKEA 1QY7A 4O3RA 2XLJA 3TX0A 2BRLA 3ZZRA 1KDNA 1YRXA 1N56A 2K06A 4MMOA 1TTHB 3CD6S 5F9NA 4JI7F 4ED7A 3Q89A 4K2JA 3ZTSA 2XQCA 1ZH5A 4CO5A 3HM9A 4N8NA 5KFRA 3SCKE 1N8RT 4C2MA 2I1RA 3KG1A 3J7YU 5C25A 1OPZA 1J2VA 3OL6A 1W26A 4EMDA 4CWBA 2Q6BA 3MM5A 1HNZF 6AT1B 1UKUA 2YVSA 3R5GA 2GQCA 2RJZA 1NK4A 3D0GE 1Q86T 1PAUB 1S6OA 5GAEI 3IXQA 4HDHA 4FYYB 2E9RX 2LYVA 3Q86A 4B9TA 2E1MC 1KVIA 3HT0A 1FRMA 3HFZB 2Z2YB 3A8IA 4LFCJ 2AYGA 5I4MA 2ZDPA 2ZC4A 3MWBA 1NHKL 4F2RA 1U1OA 3W7BA 4MK7A 3BO3A 4DV3J 2RT3A 2WOMA 1HYSA 1Q53A 3HLUA 2R7VA 1MW7A 2BEFA 1FNOA 3W2VB 3ZZPA 1N5YB 1RTHA 3C14B 1VMBA 4PQUB 4J9QA 2ZD1A 2WK4A 2HNYA 3LO3A 2FY1A 1SXLA 3DOMB 3BH6B 2XSJA 5D3GB 3R2CJ 2FQQB 2I38A 2PFFB 3QSIA 2R7WA 4C8OA 2NXNA 5L9XA 2QL7B 1C0UA 1VI7A 3KK3B 1IBKF 2DPJA 1WDTA 2F5GA 2N3LA 3N6NA 2J9EA 3QRPA 4H4OB 2OPQB 5ITHA 4ITSA 4RW4B 4WTYA 4EGLA 1TL5A 4OV6A 4ZN3A 2CFXA 2DGOA 3CCWA 4G1QB 2QFJA 3CDBA 5HVFA 4Y00A 2DD8S 2KT2A 4N8OA 2E44A 3RBXA 3GV7B 4Q0BB 3UR3C 3D7SB 3GLJA 3QATA 3W66A 1VHFA 2NYHA 4CLYA 2VBXA 3WBZA 2LXUA 1YZ7A 3RAMA 1NB2A 1XR6A 3ENWA 1T11A 2DHAA 2KG1A 4NASA 3NWGA 3BQ1A 2JLGA 3DRPB 3B4MA 4YY3F 2YX1A 3R27A 1QVGR 1KVJA 4FF2A 9ATCB 4M94A 2UUCJ 4PWDA 1VOMA 1X4EA 2U2FA 5IT0A 3TJ8A 3VHQA 4QYZK 2XO7A 1LEOA 4OZNA 1REVB 1BWVA 1S0OA 4C7QA 1VBZA 3KFWX 3QFWA 1W2BR 2QL5B 1GTEA 1RHRB 2VG7B 1RWWB 2B9EA 3TVZA 4L72B 1M5KC 4IKAA 4P7TA 3H2LA 4O23A 4X4RA 2ZKTA 3IS9B 3UVJA 4DV0F 2BJ3A 1FDAA 3LUYA 2MZTA 2KB2A 3GFHA 1R8HA 3AA9A 3OT9A 4FZVA 3EDRB 3FRZA 2MLZA 3OJSA 2A2CA 4NE9C 2RUGA 2ZEJA 1S79A 3PIPQ 2YNHA 4PPDA 2VIHA 4HH1A 4GVBA 3BYPA 4NLTA 3HK2A 1JKHB 2WBMA 1UEUA 4RUCA 3G82A 1KQSR 4IG3A 3BGRA 2FPHX 4OHXA 1WKLA 1T03B 1TK8A 5J2MB 2CNOB 1TR0A 1EETA 3DGPB 1TFWA 3T41A 3CPWR 1TK0A 4UOGA 3CD0A 2XZTB 3CB4A 4QWEA 4XO0A 3TI0A 3R3TA 2M4MA 3EICA 2H4WB 1RTZA 1X4HA 4EYIB 1S72S 1AW0A 4OZ1A 3EGWB 4PCQA 2HS4A 5CAAA 4K4TA 2QYGA 1G2EA 2HS0A 5HROB 4U8YA 3SEOA 2Q6CA 1TL7B 4KT0C 2ZH1A 4I67A 3ZNJ1 4L3KA 1HLWA 4FNHA 4KHPJ 3CT9A 3UQSA 3DYAA 5HBMB 1U2CA 4GO7X 2OD4A 4RJVA 2NQPA 2HFSA 1Z4UA 5K14A 2N4DA 4UOHA 1JJCB 3QO9A 2V8HA 3FQKA 5C7PA 2LCWA 4M5JA 2UV8G 2VG5B 1KTQA 4NX9A 2GMJA 2ERRA 2LU2A 4CYUA 3D6FB 4ZPWR 1CJUB 4QPXA 2G9OA 1HI8A 3CVKA 2Y8WA 1VBYA 3NGUA 4P2SA 2CAJA 1HQUA 2F4VF 4R0JA 4OHZA 4UTGA 2P6SA 1P9YA 1G7CB 3GP9A 1TKDA 4WFXA 3VWSA 2EFQA 1NK5A 1S1VB 3ZFVA 4NLQA 4F2SA 1UPMB 4CLSA 2LDIA 2K1RA 2IVMA 5KFUA 4DCJB 3LF0A 2ZZTA 4QWBA 4LFBF 2RUSA 2WSCC 2BRKA 2GA7A 2IM3A 2M7SA 3MUTP 4RW6A 4NLPA 4RBTA 4KPCA 1M1HA 2UVRA 5I3UB 3EX7B 1S9EA 3K59A 1S9GB 1JB0C 4DV7F 2VKZG 4CLZA 4CTAA 4V1Ak 2KM8C 4C3MA 1IR0A 3T5KA 2G1HA 1TVRB 4LVNP 4M1KA 1NZ8A 3CJKA 3I0SB 1AT1B 3M2VB 5L39A 1UL3A 3Q22A 1FRKA 4KGMA 3PJ9A 4FVCA 4TQRA 3MMAB 1U45A 1SCJB 2FB0A 4U8VA 4DJBA 2G4BA 3QT5A 5ETRA 4K4YA 2GZOA 4PKDB 1BE4A 2WONA 4LFAF 1FRXA 2WAQD 2RMLA 3SDEB 4B02A 4X84A 2R8HA 2W7AA 4NLSA 4KPYA 2B3TB 1D8ZA 5T41A 2AKWB 1RBLA 3TAMA 3RBDA 1XK8A 3H90A 2G0CA 1K0VA 3EGVA 2LEBA 4HTIA 2DTJA 2CVEA 2O3DA 3HI9A 2VC0A 4FPRA 1YTYA 4ED1A 4E8UA 2B4PA 3UCUP 1S7IA 2RQKA 1H98A 5AXMA 4PAAA 5D4NA 2FHMA 4KTQA 3CE8A 1B0VA 1DLOB 1KOOA 1HNIA 4HYKA 4ED5A 1WF2A 2C2OB 2J5AA 2VPWB 2A10A 2OPRA 3TUZC 5C42B 4O4GA 3R9LA 3A8JA 5JMNA 2GJFA 3U1LA 3GPAA 4DQRA 4KHRA 4GRSA 2IFXA 4HVZA 4ZLNA 4BLGA 1IBMF 4UUWA 4JI0J 4DQPA 4ECSA 1GMWD 1X5SA 1IKVB 2DRBA 1N6QB 1GTHA 4P2MA 5KFMA 4HACB 1JIHA 2H3EB 1N52B 1KN6A 3HHDA 4WXOA 4UUXA 1JLQA 2IJNA 5DDQC 4XTTA 3H5SA 4YN3B 2D74B 2RDJA 4A8QA 2YNIA 1N34F 4Y2MA 1DTTA 3B6BA 2QMXA 3DM2A 4P73A 4DL2A 3RR8A 1NDKA 3Q0AA 3AOAA 4LRFA 2GVZB 1BMQB 1SH2A 4WK3A 4DPTA 2PE8A 2HHQA 4EK2A 2VQEF 2DPIA 1TV6A 4MT1A 1N36F 5D4LA 2E5GA 4PR6A 2RQMA 2IC3A 1LWEA 4ZCIA 3G87A 5AJ3F 1N32J 1VQMS 1RU1A 2DIVA 3D1QA 1FDDA 4EEYA 3CJ8A 1J27A 4WFNQ 2XS5A 2VH7A 1TQLA 4IH7A 3M6UA 1DQ8A 4KRWA 2DY9A 1X0PA 3HVTB 3F0NA 4U95A 2ZC3A 3T1HF 1GEHA 5KFKA 3GCXP 1U26A 2DXEA 4I0WA 1RAAB 3CEDA 1N5QA 1FRHA 4I7FA 3QZ7A 2DNHA 4RW8A 3MR2A 3AA8A 3B54A 2HBYB 1FWLA 3M8ZA 1TAQA 3D6TB 1HBOA 3CCES 2HYIB 2IYGA 3KK2B 5L1IA 1R0AB 3UDVA 5GAEU 2AEMA 4JI2F 2GIQA 3DNCA 4ECZA 2AYEA 4DR3J 3TAPA 4FVMA 3FDSA 1T0TV 1VRUB 5KG1A 5KG2A 4P75A 3POTB 3GIMA 3NOCA 3AD9C 3I96A 3KNAA 1I94F 2JC0A 1TU0B 4DPOA 3VV2B 5CD4H 3FMWA 4QU7A 2QL9B 2BKOA 2GVDB 4W92B 1NJXA 2Y1IA 5BYSA 5CYMA 5KFXA 3MAHA 4CP5A 1RT4A 2CNLB 4RBVA 3V6HA 3BGLA 5FIIA 2ZDOA 4NYOA 3V2UC 3TARA 3K5LA 1ZAVA 1WEXA 3HHLC 2B56A 2RVJA 2KI2A 4W90B 1RWKB 5DGBA 4DEZA 4Q7AA 4NLXA 2H48B 1P9QC 2ROGA 3F56A 1Q5YA 5U47A 2HNZA 2CQPA 4PEOA 4WP3A 1KQKA 2EC2A 2VB6A 3MCMA 1RXOB 3VAMA 1T95A 4EZ9A 3PXGa 1FK9A 3VTIA 2RS2A 2K2PA 2XHCA 4PQAA 2X1AA 3PR4A 2BJ7A 1N88A 3CCTA 3QQCD 3VCDA 5KFFA 2ALYB 2XCAA 1S1TA 2L48A 4JV0A 3H0PA 4FN5A 4HDGA 2CPDA 2Z57B 1PCAA 3UD3P 1VFJA 5KFSA 2DO4A 1UWAA 4USWA 1VRTA 5E3RA 4C8ZA 1Q5VA 2MZ1A 2ZH5A 5IZHA 2M5YA 2LFVA 1S1WB 3BO2A 4CT8A 1C1BB 1R0CB 5T7LA 2JX2A 3PW7A 1XJWB 2IMOA 4ZP7A 4LF7J 5HQ8A 1DFDA 4ZJLA 1HWUA 4K4VA 2G2YA 4Z37A 1CJTB 2B4OA 3W65A 2V68A 2MHEA 2RILA 3TAQA 2BE2B 2DNGA 3BBBA 3K7RA 4F02A 2UUBF 5B0BA 2N7YA 4KV8A 2VJUA 2DO0A 2F63A 4JUZA 1XC9A 3NMRA 4P6QA 2J9DE 2MY8A 3KLVA 3L95X 1BGXT 4G6VB 3Q8SB 4ETXA 4PG8A 3KLHB 2RU3A 3PFOA 1L3SA 3GIRA 5A8WB 1WI8A 3GYXB 1UJ4A 3WQPA 3MPUB 3HDSA 2H5IB 2ZE2A 4OX9J 1SV5B 1S1XA 1M1GA 1SL0A 2RRBA 1V3SA 2DRAA 1VIXA 3V81A 3H25A 2AJ2A 1YG0A 2ATCB 3OR1B 1YVFA 1HHTP 5KFGA 2WVFA 2YX4A 4DOZA 1FKPA 4NI2A 5J1PA 3GYGA 5BYRA 4S0MA 2OEKA 4C8MA 4P9SA 1RBOB 4GC7A 1ULRA 4XIUA 3LAKA 3MEEA 2HLUA 1UVJA 1Y5LB 3DDNA 3QAUA 1N33J 2ZJQQ 2FD2A 4E2FB 1FWKA 3AQOA 8RUCA 2QSFA 1C2PA 5D0HA 3NGDA 3QYYA 4JYAJ 2BABA 3MM8A 1FDNA 2IRUA 4USTA 1VISA 2OPSA 4Y0FA 2MQPA 2YWEA 1E6YA 2E5LJ 2ASLA 3MR3A 1RT7A 2YY3A 1NH7A 2UU9F 2OP5A 2GJ2A 2HLTA 3PG9A 1UA1A 4IR1A 4USJC 5IWAJ 4A8WA 3BS9A 4IQMA 2H4YB 1SJRA 3MM9A 5L9NA 5G0RB 5C24A 1SPBP 4GC6A 4J9PA 2J9DA 5LMNJ 4QQBA 2E5IA 3IRXA 3FEXB 2BANB 2BOAA 4B3MJ 4NZ0A 4LMZA 4WP9A 3E3XA 1ZAXA 3CMQA 2VKRA 1L3UA 2CNKB 2BR0A 1HWLA 2PA8D 5DM7Q 3DLEA 4ELUA 1FJGJ 3TZXA 1F3VA 1R43A 3QJLA 2BJ9A 4MFBB 4NXMF 1JXVA 1WELA 4OI3A 3M2UA 4CO0A 5BR8F 1O8BA 1XNQJ 4RNNA 1ZETA 1SKWA 4P10A 2Z30B 2JH3A 4DL0C 1TMJA 2CPXA 1YJTA 2E5HA 3DI6B 4LBIA 1UFKA 3WIVA 1U48A 4P52A 2E1RA 4YDDB 1YGYA 4DDFA 5E41A 1NK7A 4USKA 5ETVA 3QJJA 3MGJA 7AT1B 2CPZA 2FY8A 1HW9A 3I4PA 1HFEL 6FD1A 2AF6A 2HG4A 1D3WA 2Z56B 2BKNA 2I8EA 1FXDA 5KT6A 1JXLA 2X3DA 5HMZA 1S4EA 3KJVB 4UZBA 4RR5A 3OJUA 4NLWA 3WX8A 2WTFA 5DLFA 2R8GA 2IIHA 1C0TA 1XWLA 2UUAJ 1U24A 3MMBB 3UDLA 3HZGA 2APOA 5FJ4A 1AFIA 4AE5A 1PJ5A 1NRKA 3OVBA 1OY9A 3MPVA 3DLGA 2VPXB 2DR7A 4QZVB 1U0SA 1KOHA 2M52A 2HGLA 4ECVA 3EPGA 2DCLA 2BXJA 2C42A 4TQSA 2UP1A 3QWUA 4LF9F 1VQPS 1K1SA 3PYDA 3D0HE 3BPSP 2WSFC 3RRKA 1MN9A 1L3TA 3NXZA 1HR0J 2B5JA 4USUA 4F3QA 2IAJA 3M8QA 3ZXWA 5C25B 4KJIA 1KSPA 5D6GA 1FXLA 4OL8A 4LBHA 3MM5B 3QIPA 3LTOA 2Q66A 1S0NA 3LP1A 1HQEA 2Z4PA 5KFOA 2A3JA 5LSLA 3KOAA 3W1YC 1MROB 1VLOA 4OX6A 2HWHA 2LQJA 4A48A 1X9WA 4ZVGA 2RRNA 1N5YA 2JFKA 3C14A 3WZ0A 2AGQA 1YLXA 2FVPA 3ULHA 2AEJA 1RT6A 1HYSB 2WOMB 4YMEA 1JWWA 1HNWF 2MKJA 1VBXA 1IWGA 1RTHB 1NXIA 2JHEA 2ZD1B 2JEIA 1U1NA 3OVAA 1F5AA 2HNYB 5EX3A 4A8SA 2AIRB 4QJVA 2MQQA 2XSJB 3NCQA 5EWEA 3BSOA 2OPQA 4AQYF 4F25A 3ZZUA 5A6WA 2J6TA 3R5AA 4B08A 2OJ3A 4DR2J 4O3QA 1C0UB 1UTAA 3RAXA 1YBTA 2SXLA 5A6PA 2R2SA 2KRRA 1VC0A 2PFDA 1X4BA 1LQ9A 1GXUA 2JEJA 4KHMA 2R9LA 1BQXA 4WKRA 2HPUA 1YKWA 3PTWA 5KFQA 4J9LA 4X64F 4ZPBA 3FUYA 2B7BB 3L09A 2IVFB 4JV5J 3HSDA 2H9ZA 4EWTA 4GMKA 2YKMA 3R8YA 3OL9A 4NLDA 3I82A 1O0PA 3IR7B 1SIWB 4O3PA 4BC7A 3FSYA 1Q82T 4AD6A 3QAEA 4Y65A 2HVHA 1ZZNA 2M8DB 4OI6A 3WC2A 1X4FA 2V9KA 2OMOA 2LVWA 1VQ5S 1D9DA 4YQWA 2F8MA 1FD2A 1JLCA 3HFKA 3VGVA 3T5JA 5M2PA 1RU2A 2QMWA 4RX6A 4Y2KA 2HRUA 2NPIA 1UFLA 4OYAA 4PWDB 1M5VC 1QUPA 3DGVA 3RW6A 4DX6A 4I2PA 2HZCA 3A3OB 2V8VA 3G8TA 3MMCA 2JLEA 2ZWPA 3J80Y 3AJ2A 3EGZA 2CQ2A 4LJMA 3F41A 3A1YG 2P6TA 1QDUB 4OYBA 4IR9A 4DR5F 1QAIA 3KJNB 3HHKA 1VQYA 3UVJB 5C2CA 2NR0A 1D9AA 1S97A 2EVZA 5FD1A 1ZS6A 1U6ZA 4DMZA 4CT9A 4ANDA 2E1PA 2R7XA 2YNHB 5D0EA 1K73T 2H5JB 4ENOA 2MZJA 1HWIA 3HSGA 5EWGA 4GVBB 4N76A 1LWCB 1GQEA 4J37A 1UVKA 3M30A 3VF0B 2LECA 4IG3B 3BGRB 3D66A 2AGOA 4KC5A 2DH7A 2C3MA 5D78A 2BJ1A 2K7KA 4DCOB 2HHHJ 1RADB 3ONQA 4N47A 1EETB 2XYHB 2K7JA 1Q8BA 4JI7J 1NLKL 5E33A 2UVWA 3I4HX 2KL8A 3QBCA 4N5SA 3Q23A 3H5YA 3ISZA 4ZCLA 3E2EA 4ELTA 4I6AA 3GIJA 3W64A 4C3KA 3PYGA 3RJMB 3M1VA 3BF4A 5IV4A 1HNZJ 4FBUA 2GMHA 5ADZA 1DBDA 1FX4A 5J1NA 1WF1A 5BYQA 2IDEA 3EVOA 4L6V3 5F8JA 3VR1A 1DAXA 2HSEB 1TK5A 2QRRA 3Q83A 1AZSB 2HHVA 3DYAB 3FBFA 3UNGC 5J2QA 2GQ2A 2CJAA 3LW5C 2B9YA 4KKOA 1SC3B 4IYQA 4A47A 1S99A 2D1CA 2V6AA 3IM8A 4U9RA 3ETMA 3K58A 2HHPA 4PG7A 3JTNA 5CCMA 3RGIA 3QO9B 4FKYA 2BQ3A 2C3YA 1YJVA 4O0NA 2AGPA 2VUGA 4EBDA 1OPIA 4WZMA 2FHKA 2DNYA 1NNDA 2EBEA 5KG7A 2G0JA 3FNNA 3I6PA 3PO4A 5MLCV 4BBYA 1Q8KA 2CJKA 1HQUB 2FJVA 5J2PA 5B0GA 4B3RF 2NSBA 3HHNB 4PYDA 4QR2A 1G3OA 4ALZA 4B9SA 3BDEA 1IBKJ 2JNJA 2QE5A 3DOKA 2PEHA 2V2QA 2R2TA 3SXLA 1PILA 1GNKA 5LJ3Y 4WK1A 1KFSA 3IC1A 2K1RB 2AJQA 1OQ6A 2ZH7A 3CDAA 1HNVA 3PCOB 4LBPA 5LL6d 5KFVA 1ELOA 4F26A 1UJ6A 3TW0A 3ILIA 5J2NA 1EX8A 1U0HA 3J7ZT 3Q2TC 2W7OA 1MMNA 2HFNA 5H9FK 2P2CB 4CTAB 3SSSA 4DR6F 1T9WA 3G6XA 2HVDA 1BXNA 2VJVA 2WBRA 1LOUA 1G4CA 2DB1A 3CJKB 2GMLA 4YY3J 3PW4A 4I6WA 1LNQA 2PA3A 1IM4A 5LM7E 2DY1A 2Z2LA 2KTQA 2Q43A 3K5NA 2QIFA 2BX6A 2F7VA 4QIWD 5E3PA 2FC8A 3HHLA 5IXUA 1FE0A 3WX4A 3QGPA 3VVTA 2XMKA 2UVVA 1F60B 3M4XA 2WONB 3PIOQ 8ATCB 3J81U 4A8MP 3HMJG 4DV0J 2L41A 3MURP 3IBFB 3BGUA 2KYZA 3VAHA 4DV1F 3UNYA 1Z2ZA 4GKKF 2J7WA 3MR6A 2BA9A 4Q44A 5F8HA 1F9FA 2UV8A 4IFYA 2AZ1A 4C8LA 3M6VA 2BOPA 4ZIWA 4F4KA 2D3ZA 4AL5A 2L3MA 1NDCA 2VU5A 1JLAA 5IOLA 4LF7F 1BC6A 4NXNF 1PIEA 3QMQA 3US5A 1HNIB 2AP6A 1L3KA 5DG7A 1RT5A 2PT0A 2G2OA 5BXIA 1RCXB 1BD6A 2OPRB 3BQ0A 4O4GB 1F1BB 1B0PA 2AHOB 1XMOF 2YX7A 2WVEA 2LLZA 4OLPA 3DDIA 2GCFA 4G65A 3D9BA 2CPHA 4WPAA 1K1QA 1SH0A 3OR2A 4GO5X 2HQ3A 1H74A 4C9DA 3M8PA 5JJBA 5F8IA 2YWHA 1EARA 5CQGA 2HGNA 3VQTA 5CHCB 3EXCX 3S6EA 1KLMA 1M90T 3LWMA 4M5DB 5E0OA 3CMES 2YNIB 1FEHA 1DTTB 1TL1A 4ID5A 3DM2B 3DLLQ 2HK3A 1VC5A 1URRA 3PR5B 3PFEA 3KLEA 5CZVA 1TV6B 2KZMA 3X3UA 4DS4A 4LF4F 4QR1A 3IBWA 3FGVA 1KS2A 3D2WA 5GMKa 4KGZB 4ZP6A 2IC3B 1LWEB 4ECUA 3UN5A 3ILLA 2FJDB 1UEKA 3TEHB 3OFGA 2ZBPA 1S0MA 3QSYB 1RSCA 3KMQA 3CJ0A 2F4VJ 4KGVB 3I87A 3D3CJ 2XBPA 1HW8A 2DNOA 3PACA 2XNRA 3HKZD 3P3DA 1T3OA 2UUTA 3AH6A 3MTKA 1NZAA 1MMDA 1NDLA 4F04B 3KK2A 4ANEA 4FS2A 5ETLA 2CPYA 4KH0B 4LF5F 4I7FB 1IKXA 4YOEA 1UPPA 4RW8B 1PJ7A 2PGCA 2JSXA 5SZTA 1R31A 3NY0A 4JI6F 2BBEA 1HBOB 3IG1A 2ZM6F 2DYAA 3ZTQA 4LFBJ 4DR4F 5HANA 3JB9k 5AXLA 3PY8A 1GXTA 4KFBA 3POTA 2QV6A 1UVNA 4TVAB 3UN3A 2FJWA 4MKVA 5D4PA 3ADAC 4TNOA 2C3UA 4ECWA 2X51A 1KVKA 4R5PA 4DV7J 4CCHA 2D7SA 2GVDA 1KC8T 5HSPA 1SC1B 2XG8A 1H2UX 2DH9A 2ASDA 4L76A 2E1CA 2IVYA 3R6GB 2NUUG 1U2FA 1YI2S 3O3LA 4ZA1A 4JB8B 1RT4B 3TVKA 3PYFA 4DUZF 1TL3B 4O44A 3LGHA 4LVOP 4C8NA 1QAJA 2ZOFA 4ZPCA 1NK0A 4OI0A 3PKMA 3OL8A 1R0BG 5GAHI 1OSDA 3EZOA 3EVMA 1DQAA 2NXJA 2Q3PA 1FK9B 1QD1A 3MD1A 2MJNA 4P7VA 2ROPA 4UW2A 3NCRA 2WHOA 2Z0GA 1S1TB 4ZP9A 1R8PA 1HI0P 3Q8VA 5LOQA 4KQZA 5LT5A 2R8KA 3TRGA 3I9V9 2CPEA 2NZCA 1TELA 1X8DA 4QIFA 4K4ZA 2Z8QA 1VRTB 3FJ2A 1NK8A 4F67A 1QAYA 1Q0NA 3MUMP 1KKHA 2IYIA 3PNIA 2EKYA 4PZVA 4DX7A 2XM3A 2R7SA 1LXJA 3JTPA 2CVIA 3FCVA 2E66A 1WC5A 2D69A 3J7AN 3P96A 5T7LB 4LF2A 1S76D 1O51A 2ZJRQ 2X1FA 3QNWB 2RNEA 2GNKA 2HHWA 1P6TA 2F1FA 5L1LA 2Y1JA 1ZM2A 5GMDA 2L9WA 1IBMJ 4Q43A 3R7NB 1RHMB 3HXMA 1YBUA 4KV8B 2W9BA 3HP6A 1NSKL 1Q78A 2RIJA 3C6UA 3V4MA 5KFJA 1ZM4A 4K59A 1RT2A 4JV2A 3P49B 5HLFB 3Q8UA 1T3NA 3SSQA 3FSIA 2YQ0A 1UFWA 2JZ5A 4IRDA 3J7A1 3NS7B 3FEYB 5A8RA 1N34J 3OR1A 4HI1A 3AT1B 4ILRA 4NEYA 2C22A 2ZE2B 2BJEA 3VALA 2Y1RI 3BBFA 1S1XB 3H40A 1RDRA 4RL1A 3V81B 1NMEB 1H73A 3NCPA 2VQEJ 3R97A 2YNFA 2HQCA 2QLJB 4F4WA 3DRXA 4X4SA 1N36J 4USIA 2MZSA 2QA1A 4RKUC 4C4WA 5K9FA 5HMYA 1B4SA 1FKPB 4NI2B 3UR0A 1NK6A 3WIUA 4PYAA 4LRCA 3CULA 5AJ3J 1NSQA 4ZJQA 3M2RA 1NEEA 4YR2A 3SCLE 3RB3A 1A0OB 3O5TB 3MEEB 2OPPA 1U02A 3RB0A 4WIIA 4HI2A 1OYEA 2KRBA 3T1HJ 5DLGA 4CO4A 2W4CA 4WE1A 3MM8B 1JX4A 4DG1A 2VG6A 1R6VA 2OPSB 2IBKA 1UVIA 3HD2A 5FDLA 1RT7B 4DPYA 5DM6Q 4ZVUB 5AXKA 4C6AA 4H54A 1QLNA 2IM0A 2VOPA 4EI2A 3ZC4A 3W9IA 2OGUA 4CLKA 2IA6A 1RCOB 2FTRA 2UXCF 1Y4ZB 3MM9B 4HT5A 1KQGB 4JI2J 2XMJA 3GJQB 5C24B 2ZBIA 3G4SS 1HWKA 3IRXB 1JLEA 2QMUB 1UMJA 1WOOA 3VQSA 2FVQA 4DUTA 4E98A 1M5OC 5IQ6A 3NEKA 2XMTA 1I94J 1RA7A 3FMBA 2AT1B 2LA6A 3DLEB 1VK8A 5CA5A 5KFDA 5C5JA 1G1XA 5J1EA 1KLNA 2C2RA 4FPIA 4ED4A 3H20A 3EZ5A 3JTOA 3UCZP 3OQ2A 3M2UB 3BEGB 4I56A 5C2GA 2VFSA 1U7LA 1FJEB 3D68A 1SB6A 4KE5A 3G9CA 5B08A 5HMWA 1RKJA 4LF1A 3NKYA 3D54A 4ES1A 2CKWA 3PHEA 1NK9A 4CRJA 2XNQA 1DARA 4ER8A 3OSNA 3KJVA 3LP2A 3T1YF 1GAOA 3N0VA 3TP2A 1U25A 1PYOB 3QRQA 4ANCA 3C66A 1CQMA 3KHGA 1S48A 5BJRA 3KYLA 3KLIA 4OV1A 3UD4P 4NCAA 2YWWA 2VDHA 3R7BB 2YKNA 5KOXA 2BQUA 2HVIA 1UWBA 4X2BA 3GU0A 2MKSA 4DXLA 3GV5B 2GIRA 2H5EA 1UW4A 1UVLA 5AE1A 1XNRF 3N5BA 3SCJE 2CQ1A 1C0TB 1WEYA 3GJSB 4XDCA 1Y5IB 4X66F 2HHHF 2J0XA 2YKPA 4J9VA 1KWMA 4JI1F 3DLGB 4EFAC 2UXBF 2M9KA 1GK8A 2DJWA 3QT6A 5AE2A 2FC9A 3S8SA 5EHHA 1CS4A 4OZLA 2DRDA 2KHCA 1FESA 2UUBJ 3DFEA 4W4MA 1XTZA 2B5JB 3D6HB 1H2VZ 4QU6A 3N5FA 4LSLA 2HGMA 2IAJB 4U67Q 3M8QB 4J9UE 4MIWA 3SV3A 2ZITA 1MROA 4IQXA 2RAQA 2EFVA 3QIPB 2DVIA 3W63A 3LP1B 1YK9A 4ZLJA 5K8NA 1M1KT 1C4CA 1HQEB 2HBRB 2ZH2A 1HBNA 2VA3A 1HQ2A 3V6JA 1SKUB 2W2OP 2LQ5A 4FXDA 2HHUA 1NBEB 1OY8A 2VF3A 3H4DA 4ZOSA 4UY85 4RWWA 5IS2A 4DR7F 3MZIA 2B8PA 4C8YA 1RT6B 3HT3A 4DR1F 3GTYX 1Q1KA 2WB4A 2WCXA 4DN9A 1GXLA 1BQNA 4N77A 3TX8A 3SCIE 5K5MA 4WKYA 3C15A 4ZPDA 4LSNA 2JC1A 5HJXA 2QFIA 5DQIA 3PO5A 2ZOGA 2MKCA 1RTIA 2M70A 2UU9J 4A4JA 4NYZA 1P1LA 3GFXA 5GVQA 3C6TB 3D67A 1MG7A 4PWWA 2ZFHA 3J81Y 3IAM9 2EI5A 2ZBRA 3SIPB 4F3MA 2O5DA 3FZBA 3MM6A 4WCEQ 4DFMA 4Y3CA 3TJ9A 3OVSA 2J7UA 2ZHBA 1N0VC 4B9MA 5GADI 3ZZTA 2YKMB 1OQ3A 5DG8A 1SVDA 3ZZOA 4WFBQ 1IUJA 1FJCA 2CQHA 2YWKA 1H0HB 3CXCR 3DOLA 2KM8B 3ITHA 4JI3F 1S77D 3DRRA 4NXMJ 1JLCB 1LW0B 1WHYA 3QT7A 3NL0A 4X4QA 5KFNA 2XI2A 5BR8J 1RABB 2W2NP 4MKBA 1LKZA 1FDBA 4Q5VA 2W4PA 3IGNA 2QEXS 3VAIA 4R8UB 4A8KA 1DRZA 4WJBA 3TZZA 2D3O1 4I2PB 2R7TA 4OZ3A 1PKUA 4B9LA 3MMCB 2ROEA 3MTJA 5KT7A 4Q45A 4CDIA 2XYPB 4AFFA 4YUDA 2QG9B 4KR0B 2WVBA 4PABA 5I42B 4KO0A 4ED0A 1SI9A 1Q8IA 2DHXA 3J7Z5 2ZNYA 1UA0A 2AMCB 1HWJA 2KG0A 3D3BJ 1OSCA 3OHBA 4M8LA 3JSMA 2DEJA 4KGKA 1YJ9S 3SMZA 2AX0A 1LWCA 4I1TA 2C2NA 3BQ2A 3AJ1A 3AY0A 4Y2CA 4KBIA 2DGVA 2R7QA 4CLUA 1T05B 2OKQA 1GH8A 6FDRA 2ACYA 3H8YA 3M8WA 1VQLS 3CIMA 2ZBQA 2D9PA 3G2XA 5LXRA 2V67A 1S6QA 4J7CA 2N7CA 1W2IA 3M30B 2MPUA 1FFWB 1X4GA 2QA2A 1CC7A 2C1EB 1I51B 2UVUA 3E51A 3GIKA 4OJ3A 3UWTA 2LXIA 3FKBA 4LF9J 3FBBA 2CWXA 1N0UA 1UAWA 2P9GA 2FZKB 2UZAA 4K0KF 1YZ6A 1OWXA 1J5EF 3N6LA 1KD1T 2M2BA 3HSJA 3JS9A 1E6VA 1AZSA 3M8SA 3M1VB 2MDAA 2V5HG 5GAHU 1ZZFA 3KUHA 5DETA 4NWBA 2CIMA 4OLOA 4AUKA 2CNNB 3HD1A 1LWFA 1YHQS 2YH1A 4K50A 2BQRA 1RBAA 2IPOB 1S6PA 2XI3A 3EDQB 5A2QY 2J7KA 1XBWA 2BYCA 5J2QB 4KKOB 3BJYA 4HL9A 1EIYB 1HNXF 3BSNA 4F0KA 4DL6A 2GQQA 4TKTA 4ZP8A 3GIIA 2AV5A 1IBCB 5KG0A 3MD3A 2Y0SD 4CZCA 1IBLF 3ENVA 2IRXA 2YBVA 3IBCB 4OZ0A 1HNWJ 1Q7LB 2FVSA 2JRSA 3GCWP 1F5CA 1DJ0A 2M8HA 1TKXA 3JAMY 2QA4S 5LMUF 2RQ4A 2W9CA 1FE4A 4B9UA 2V8PA 2W4DA 2HMIA 3MI7X 3VAGA 1WSVA 1JQGA 3JQMA 2AJ0A 3CSKA 5J2PB 5ETKA 1JLBA 2MGZA 2DK2A 5KFEA 3QFHA 4AQYJ 2CJBA 1U8WA 4HHJA 2COLA 1G6BA 2F9JA 2V50A 1SUQA 3DOKB 3TUJC 3R7SB 2DR9A 2HFVA 2HRYA 3SI8A 2A18A 3OTDA 2KVQE 4ES3A 4B3OA 1LV5A 4X64J 1HNVB 3S01A 4F0HA 3MFIA 3AXKA 3PEHA 2RH3A 5J2NB 5HL7Q 1U0HB 1YSJA 2D3OR 4A46A 5HO4A 3RBZA 4IO9Q 4LREA 1K8AT 2OTJS 2EFNA 3BB5A 2ABYA 5RUBA 4HEA9 2POKA 5FLXU 4YFUA 1Y9OA 4M5LA 4CLWA 2HWTA 3H7HB 2CADA 2DBBA 3TQ1A 4TXSA 1EB0A 3AODA 1JNZB 2IBOA 3V6DA 1B7YB 4ZVHA 2AD9A 3OFHA 1RTJA 3CDWA 3AD7C 3BSCA 2BE7D 1X4DA 3CC4S 4OYMA 3M9MB 4PRFA 3MF5A 4DZ6A 5H9EK 4IDKA 4PG5A 3RRHA 2OLWA 4DSIA 2GHPA 3HHLB 4Y2AA 2MY7A 3C19A 4OYXA 2PEBA 4HT7A 4OFZA 1Y11A 2VDIA 3MAQA 4R0EA 4DR5J 5KFAA 5HJYA 3IM9A 2GGPA 1PG5B 4KH1B 1RT1A 2YKOA 1D09B 4LF8F 1WUUA 3MOJB 2DIUA 4M5HA 1REGX 1GMVA 5KFBA 1U1KA 3VGTA 4DUYF 1MNEA 3O2IA 5E2QA 4EO8A 1HARA 5KFPA 3THPA 1Q95G 2DR8A 2QGFB 2Z2MA 5GAGU 1RACB 4IFYB 1U09A 4FBTA 4CLLA 5DDOC 4C0HA 1HPZA 1S10A 4NMXA 3W9HA 1ZA1B 1JLAB 2ZZMA 3UCGA 3OUYA 1SKSA 3MFHA 1VRQC 3CCZA 3NP5A 4USVA 4M5GA 4DPXA 2VFRA 1F0XA 2MQMA 5AE3A 2LMIA 2QT7A 1RT5B 2LQ8A 1S1UA 5DQHA 2R7UA 2VASA 3D1HA 3K8WA 1QTMA 4MKYA 1SJ1A 4Q2MA 1Y5NB 4UZCA 4RUAA 4F4XA 5SUHA 2FHJD 2DNLA 4M5DA 2J9CA 2R3VA 3OR2B 5DS7A 3PDNA 3QRRA 3M8PB 2FGOA 3VAJA 2K3IA 2F9DA 3T9ZA 1KLMB 1N5SA 2GHVC 3HJFA 2K8GA 5EDWA 1WTBA 2D9OA 3IO1A 2XWXA 4DZDA 1TL1B 4ID5B 1HBUA 1FX2A 2UXDF 1Y00A 1PGZA 3Q24A 4OX8A 3TANA 3DU5A 3KLEB 3AOBA 1TKTA 4AL6A 4JI4F 2AW0A 4U7UK 4L73A 4TU7A 2VFUA 2ASYA 2FIUA 2W2PP 5HAOA 4AXIA 2X3GA 2MTLA 5JXSA 3MCSA 4ECRA 4K4SA 1EHWA 1AXQA 1IR1A 5HMXA 1F9HA 3EPIA 1K44A 3QZ8A 4CH1A 1SIZA 2DHGA 2JL9A 2QZ8A 1T9TA 4B3RJ 1S59A 4ZPTR 1YRTA 2X1GA 1FFSB 3DXSX 2VICA 1SJFA 5KFYA 4OI1A 1EAYC 4DX5A 1IKXB 5HATA 2MKHA 5IT9Y 3X1LB 5E7OB 1AFJA 1SQEA 4LQ9A 3IG1B 1PJ6A 4NLRA 4JI8F 2XGQA 3K5OA 1NUEA 3TWZA 4CO1A 2A0FB 4KFBB 2DNNA 2RKIA 1RLDA 3MCNA 3BR9A 2XY5A 1M5HA 2V4QA 2RRAA 3G96A 3TEGA 1Q4RA 2HWIA 2MB0B 3RB4A 3A3NB 2Y9HA 4R5PB 3C46A 1EKSA 1F2GA 1FTRA 4DR6J 2FLPA 1MSWD 3M8RA 4WBFA 4N7TA 2O66A 1TL3A 1JLGB 3LGMA 2O67A 4W98A 1NKCA 1A6LA 4C0BA 4BCAA 3BKUA 3NS6A 1RQ0A 1RI7A 1N48A 2PI4A 2J0QD 4NZ7A 2K3KA 2LEPA 1RGVA 2XYGB 2MEWA 1VQ9S 1Z2LA 1IVZA 1K47A 4O44B 5ETNA 1JMTA 4G3IA 3NS5A 2AX1A 2JJ4D 3OTOF 3BBCA 1SH3A 4PXEA 5IC6B 2CQ0A 2OTLS 4CLFA 1I6JA 4QOTA 4ZPAA 4RUBA 2XB2D 2L9DA 1RHJB 2YNGA 2YWGA 3W2WA 2OEMA 1DQ9A 1WKKA 4FF4A 4DV1J 3M32A 1HMVA 4GKKJ 2HHTA 5DZ7A 1XR7A 5K8PA 3FRYA 1NJZA 4CIOA 4OJ1A 3SZ2A 2I0XA 1C1CB 4OJGA 2GC8A 2VHGA 2NCKL 3ISNC 1BQMA 2MKYA 1WG1A 4UOCA 1GFWB 5JVGQ 4ZVOB 2LDYA 1V3RA 4X4PA 1OS5A 3AAWB 3N9UC 2XWYA 4NXNJ 1A9NB 3C16A 2V4JB 5E5NA 3JSBA 3HVWA 2AEFA 2HBQB 5I3PA 5CH7B 4ES2A 3TJAA 4OYPA 2MZQA 2OMLA 1RWOB 1WHVA 1FHTA 3OV7A 4IO1A 1WSRA 1XMOJ 3IMQJ 1TL4A 5HLFA 1R8AA 3OSPA 1TKZA 4DPUA 3KJFB 1UCNA 1C4AA 4ZK7M 3P5TL 2C2ZB 2CJYB 4YS2A 3I32A 2W9BB 1YX2A 3C6UB 3GJTB 4DV5J 3OL7A 7FDRA 1KHWA 1RT2B 5F0UA 3QLHA 5A8KA 5IV3A 1JJ2R 1RT3A 3MEKA 3QJPA 5A8RB 4QBUA 3W8PA 1M5SA 2PSZA 4ZCMA 3K89A 2YXLA 1EQMA 2ILYA 3RUBL 2YNFB 4FYDA 3U27A 4LF4J 4XDDA 4V19X 2XZWA 2XTJP 1Y10A 1UVMA 2NPFA 2FDNA 2W1BA 3FCHA 3ILOA 3RG6A 3W5YA 2B9XA 2A1BA 5KT3A 1FO1A 2FLOA 3OTBA 4RPFA 3M2RB 2FUG9 4ED3A 3QWPA 2GAHC 4UF4A 1CQNA 3H2VE 1X5PA 1X9SA 2OPPB 4RNFA 3LH2S 4LIWA 3FVYA 3TA0A 4C3LA 2ZH9A 1FRJA 4B3TF 4WE1B 2MKIA 1D8YA 3Q2SC 5H9EJ 4DG1B 2VG6B 4DSLA 5FDLB 4WTOB 4LF5J 2AU0A 3TR5A 3GFYA 2ZBCA 1WORA 4CNYA 3MM7A 2FHJA 3FBEA 3EUNA 4JI6J 3CDEA 5D15A 2ZM6J 4IOBA 3ET6A 4OX7A 4YHHF 5H1SV 2MHNA 4DR4J 3OD2A 5L8RC 4HTJA 4FXVA 4FYWB 2VOOA 4YDXA 2VA2A 2GO9A 1B0TA 3HJVA 4LF6F 3UPFA 2VD3A 3WC0A 2VZ9A 2LXFA 5F0WA 1QM9A 4C48A 2DNMA 3AB2B 1JLEB 3KLFA 2VBYA 3G6VA 4PUOA 1HKAA 2MSTA 3NGSA 4Z7YA 4NLUA 1SC6A 2HNDA 2F3JA 1RWPB 4IFVA 3OTCA 3B4DA 1FVSA 4NL5A 1RAIB 4CO2A 5DQGA 3CCSS 4B3SF 1KQFB 5J1EB 4DV4F 1QE1A 5A76A 1YJNS 5B0DA 3CW2C 1VQ6S 3JXOA 5HP1A 2B4UA 2I6WA 2ZOMA 4DUZJ 1RA6A 1KHVA 2WVCA 1ZOTA 2E1AA 3MMJA 3N4WA 1NDPA 2BW2A 1F6TA 4NZ6A 3OLBA 1IKYB 3OTEA 1R3NA 2NYIA 3I0RA 4K5RA 2W25A 1J5OA 2GO8A 3AJDA 4ZVTB 3W5ZA 1DTQA 3LP2B 1WKJA 2WW8A 2QLXA 1FNXH 3UDEA 3QGHA 1ZBTA 4ETZA 2OO4A 3KLIB 4I69A 5IC4B 1SL1A 2YKNB 1UWBB 1RE1B 4KYZA 3H59A 4ELVA 1FNMA 2AJ4A 3G8SA 1X5TA 3H2UB 2FJBB 2ZNZA 4TY8A 3L7OA 1T7PA 2J0WA 2OFHX 4XPEA 4X4VA 2PC6A 2LP4A 3AD8C 4DN0A 1XIQA 1Q16B 4TN2A 1IKWA 5KT5A 2KFZA 3OXLA 2J8AA 3SFUA 1X60A 2EG1A 3IR6B 1S6UA 3B82A 2NSCA 3NGRA 1A7GE 1CS4B 2OAUA 2NZ4A 1YJ7A 1IM6A 5HN0A 4ILMA 1BWEA 4LSLB 1VR6A 2QLWA 2RE1A 2CZVC 3MPDA 2HFOA 2I5JA 3TQEA 1HHQA 1NHVA 3G8QA 2DISA 4XAKA 1U1RA 2XHWA 3MEDA 5HI7A 1WI6A 4FXWA 1ROFA 3BH7B 5DZ6A 1HBNB 1PYSB 5HVGA 3KDNA 4ZN1A 2DGSA 3JQKA 4YP3A 4H4KC 3EYZA 2CQIA 1U1PA 1FA0A 4ZCKA 1AUDA 2I9SA 4Y6IA 1RB0A 2P9CA 4BS2A 5FLXY 1RHUB 2EK6A 4RZRA 4WWSA 1B70B 4D3HA 3HHLD 2IJRA 1NPPA 3W5XA 1UJ5A 3Q8PB 5F3ZA 4CM2A 5KFIA 3MUVP 3R5JB 4I4BA 1BQNB 3A8KA 1D0EA 1IQTA 2HURA 5CZXA 3C6TA 1V5VA 1TP7A 3C15B 3OHAA 4GKJF 4LSNB 2OIHA 4DI6A 4JP8A 1IXKA 1RTIB 5DG9A 4J9SA 2KKHA 2MLYA 1UZDA 3A12A 1YRUA 3PX0A 1FVQA 2RF2A 2XZDB 3DMJB 1WG4A 3KHLA 2OHDA 2IM1A 4I2QA 4L75A 4FF3A 1FT8A 2UXCJ 1UZHA 4IUFA 1K0TA 1YIJS 2KJVA 3MM6B 5KG4A 5L46A 1RWMB 3ISND 1NKBA 1EQ0A 2OSRA 3I55S 5JVHQ 4K2XA 2YTCA 3TZYA 1CJKB 2C3PA 2CUYA 2KVIA 2V8DA 3D28A 1F3FA 3GG0A 1LW0A 1XR5A 3GZ7A 2FLLA 2B6AA 5F41A 3GR0A 2GS8A 3GE9A 2ZH6A 3OFEA 3DOLB 3ITHB 3PJXA 4R8UA 3BGFA 2MSSA 3DRRB 3MR5A 4E0DA 4HHUA 2VQFF 2CQGA 3Q8YA 3FQLA 2JOQA 3FCWA 3FZ2A 1KP6A 4ICLB 2D3UA 5LSOA 1JJHA 3UFCX 4DV6F 5ETPA 2NLWA 3C2PA 1XMQF 4DFPA 4AT1B 3VGUA 1TZ0A 2CPJA 3CCUS 1RWUA 5ETSA 2Z58B 4LT6A 5I42A 3MDFA 3KNGA 2XO6A 1RWXB 2R7RA 1EP4A 4OYIA 2CQDA 3ELHA 2GHWA 2CZ9A 3ICLA 2KHDA 3T1YJ 1V9OA 5HQLA 1FWPA 3PW0A 2A2DA 1H6KX 3V4IA 4X65F 4KO0B 1X5OA 1T05A 4J9KA 3ETOA 2CYYA 1T9UA 3JSMB 1VJQA 4JI5F 4J9RA 3UW1A 3HVAA 4XPCA 4CNZA 4UY8T 1XNRJ 3IWXA 4X62F 3I31A 2DHHA 3NAIA 5M2UA 1HBMB 4X66J 4MK8A 4CQ1A 1VCTA 2RSQA 1LWXA 3I5CA 3KWMA 2MQNA 3TA1A 1S6QB 4JI1J 2UXBJ 2G0IA 2W8KA 2PMHA 4DL3A 5DDRC 3OPKA 2Y3YA 3I5BA 3JQJA 3EM1A 1IR2A 4AL7A 4LR8A 1QSSA 1IN0A 1Y3KA 3F44A 2MKKA 2PMWA 1RP5A 1W25A 3U7JA 1S7HA 1E6VB 4MK9A 1FFGB 2EW9A 2OD6A 4IG0A 3W3SA 1XMBA 3DRSA 2EPIA 3SYZA 2HZVA 3M8YA 3IP0A 3BGOP 1FKOA 4TLRA 3J80U 5L1JA 2IDLA 1LWFB 3Q8RB 2RB7A 3RU0A 1S6PB 3A13A 2V2KA 3A3PB 4K4WA 2AYBA 1YBAA 3CCVS 1VQ4S 5IT4A 3LP0A 4OI4A 1R7IA 4DR7J 2NXUA 4UOFA 3OBIA 3OXGA 3OFFA 2EG2A 4Z2XA 1NSPA 4LRAA 3D0IE 4WFAQ 3KDOA 1H7XA 2GJIA 1AUSL 3IWNC 1H2TZ 3DHXA 4DR1J 1S12A 1VQOS 1SQFA 2V8GA 3VAFA 3K8VA 4LRDA 1EZZB 4LR7A 3JSYA 3JYTA 1KR4A 1TKXB 2CQBA 2VBWA 2W9CB 5HVHA 5L38A 3LWLA 3SQOP 2DKOB 2HMIB 4KSEB 1U4BA 2CQ3A 4MIAA 1VIOA 2LQ9A 2HW3A 1WDDA 3TO8A 1JLBB 3H5XA 2MGZB 4Q8FA 2V2ZA 3GYNA 3P45B 3IRWP 3K57A 1VQ7S 5HK4A 3FFIA 5KG5A 2ALZA 2ZWOA 1SUQB 2F65A 1B7FA 1S57A 1PAEX 3PHTA 1YJRA 2ZKUA 4QYZJ 1APSA 3HSZA 4ED6A 2V2VA 1NPRA 2G13A 2DT9A 1KTVA 4B3OB 3IAS9 2CG8A 3CO0P 4H4MA 4DF8A 1JLFA 2Y1LB 4FF1A 1U2RA 2L08A 1S0VA 1PBUA 3AQPA 4ZHRB 4WU3A 5DJBA 4HHHA 1B64A 2ZH4A 5K8MA 2LQBA 4EU0A 4JI3J 1NM2A 2BUNA 1RLCL 2P5VA 1FXRA 3T9NA 2VONA 3E01A 2B4VA 2BM1A 3LALA 3V6DB 2B51A 1WHXA 1FRIA 1L5UA 3PRDA 3OXFA 3PM9A 1RTJB 2CRLA 3KG0A 5IFMA 5IQQA 1DURA 3CCJS 4NLGA 3M6WA 3A8EA 2ZH3A 3FSXA 4MIBA 4IDKB 4G1IA 4C11B 2Q1LA 4URSA 1OY6A 1NJYA 2CJ9A 1WC3A 1VK3A 5KFTA 3MECB 4DCPB 4Z7CA 4L3NA 1TFYA 2V94A 1U8SA 2XS7A 5A0YA 3AXMA 3C8YA 4NPOA 2GGPB 2ZUGA 1RT1B 1N54B 3NBPA 3MPWA 3LAMA 3CUNA 1KFDA 1JJ4A 1WC0A 3LANA 4DV2F 4TY9A 2B9WA 1GMUA 2QTWA 3DLHA 5D0RA 4NEZA 4YB5A 2C2EA 3ZNUA 1PYTA 3SV4A 4BWJA 3MEGA 3W9JA 4X4OA 3ENAA 2XMVA 4RW9A 2E29A 3HVRA 2NREA 4F0MA 1GT8A 2HRTA 2FZCB 4ZVPB 4IRCA 3T1AA 1U1QA 3I5AA 1WC4A 1HPZB 3KKFA 3L4BC 1CJVA 2MQOA 3OUYB 3IFEA 1YJUA 5I3QA 4DU7A 1NH8A 2YPYA 5LSRA 1NPKA 2R2UA 5THWA 3NAHA 5B0FA 5B09A 1F2HA 2KDOA 2UUWA 1S1UB 5ETMA 3NMAA 1Y0HA 3T5HA 2BMBA 4K0KJ 4MJKA 4NYPA 2F40A 2M88A 4RWXA 1J5EJ 1VQSA 4DV5F 2B7CB 1T9XA 3BYRA 3O44A 1PO6A 2VV5A 2FYXA 4F36A 4F50A 1RAJA 1OIAA 1R8BA 3L7PA 2VPYB 2X1BA 2FHOB 1WC1A 3TA2A 1MN7A 2Y0BB 3QGIA 4ID8A 4FDFA 2FLNA
chains in the Genus database with same CATH topology
3T5JA 5KFEA 5M2PA 2CJBA 4QCLA 2EFOA 4HHJA 3MMBA 2QMWA 2COLA 4RX6A 4YEAA 3RYLA 4K4UA 2XS2A 1G6BA 1LK7A 2F9JA 2HRUA 4Y2KA 5T14A 5KG6A 4NRUA 3GWCA 5B0CA 1SUQA 3DOKB 3TUJC 2NPIA 4WFYA 5CCLA 4J5OA 1UFLA 1CC8A 3R5BA 3KLGB 2ZJPQ 4ECQA 4LFCF 1M0SA 4PWDB 3SQGB 2DR9A 2KN4A 1QUPA 1M5VC 4HKQA 1HBUB 3MPYA 3RW6A 2HRYA 1U6FA 3B78A 2HZCA 4I2PA 1U6BA 3SI8A 2A18A 1IQZA 3OTDA 1SJQA 2EFPA 2V8VA 4OHWA 3G8TA 5DGAA 3H5UA 1AROP 2JLEA 3MMCA 1NKEA 1QY7A 4O3RA 4ES3A 3CJ3A 2XLJA 4DQIA 1TKTB 4MYTA 3AJ2A 3J80Y 1LV5A 4B3OA 3EGZA 2CQ2A 4LJMA 3F41A 2BRLA 3ZZRA 1HNVB 5KT2A 1YRXA 3A1YG 2P6TA 4YR0A 3S01A 1N56A 4MMOA 4DV3F 3CD6S 3MFIA 3PZPA 4IR9A 2MYFA 3KK1A 3PEHA 5F9NA 4DR5F 4JI7F 1QAIA 4ED7A 2RH3A 5J2NB 5HL7Q 3HHKA 2XGPA 4ERDA 1YSJA 2D3OR 1VQYA 1WF0A 2BVZA 4AXJA 1ZH5A 4CO5A 3U1MA 1BLUA 4A46A 1VLYA 3HM9A 2CG4A 5HO4A 4N8NA 4IO9Q 5KFRA 3SCKE 2NR0A 1K9MT 1D9AA 3HZEA 3VZHA 3WDOA 1K8AT 2OTJS 1N8RT 4C2MA 1S97A 2EVZA 2I1RA 3KG1A 2EFNA 3BB5A 2ABYA 3GMGA 3J7YU 5C25A 4RW7A 2EK1A 1OPZA 1J2VA 4HEA9 2POKA 3OL6A 4YFUA 3QGGA 1Y9OA 4X4UA 5FD1A 2Q6BA 3MM5A 1HNZF 2HWTA 1UKUA 1QVFR 2DBBA 3TQ1A 2YVSA 4TXSA 1U6ZA 2GQCA 1JNZB 2RJZA 2QA4G 3GR1A 3CCRS 1NK4A 2IBOA 3V6DA 4DMZA 3D0GE 4CT9A 1Q86T 3CCLS 4ZVHA 1F5BA 2AD9A 3OFHA 1S6OA 2R7XA 1RTJA 2YNHB 5GAEI 3IXQA 4HDHA 1MU2A 3CDWA 2E9RX 1K73T 2LYVA 3BSCA 1X4DA 2MZJA 1Q79A 2YWFA 3TVYA 1HWIA 4B9TA 4RLEA 1YJWS 2E1MC 1KVIA 5EWGA 3CC4S 4IRKA 1RISA 1FRMA 4N76A 1LWCB 1SJ4P 1GQEA 3M9MB 2AYGA 2KFNA 5I4MA 4J37A 1UVKA 3CCMS 3M30A 2ZDPA 3EZUA 4J9MA 4PRFA 3MF5A 3VF0B 2LECA 4IDKA 3GSDA 1UETA 2ZC4A 3BGRB 3MWBA 4IG3B 4PG5A 3RRHA 4DWIA 2AGOA 4KC5A 2DH7A 2OLWA 2VL1A 4DSIA 4F2RA 2C3MA 5D78A 3DRYA 2GHPA 3DC2A 3HHLB 4Y2AA 2K7KA 2MY7A 4HT7A 1U1OA 4OFZA 5CYQB 3THTA 3ONQA 3W7BA 4MK7A 4N47A 3BO3A 3MAQA 4R0EA 1EETB 2RT3A 2WOMA 4F8RA 1HYSA 1Q53A 3HLUA 5KFAA 2K7JA 2R7VA 1Q8BA 1MW7A 1FNOA 3PW2A 4U7CA 1NJWA 3W2VB 4A8FA 5D8HB 2GGPA 3ZZPA 4EBEA 2RKIB 1N5YB 3RTVA 1RT1A 1RTHA 1VMBA 2YKOA 5E33A 2UVWA 1JLGA 3PX4A 3DU6A 3I4HX 4LF8F 4J9QA 3MOJB 4PQUB 2DIUA 2WK4A 2ZD1A 4N5SA 3Q23A 3H5YA 5KFBA 2HNYA 3ISZA 1U1KA 3LO3A 1FJ7A 3EGNA 4ZCLA 3E2EA 4ELTA 4I6AA 2FY1A 4DUYF 1MNEA 1SXLA 3GIJA 1LW2A 4C3KA 3O2IA 5E2QA 2XSJA 4EO8A 4NCGA 1HARA 3BF4A 3M1VA 3S7RA 5KFPA 3THPA 5D3GB 1RTDA 3BSAA 4FBUA 2DR8A 2GMHA 5ADZA 1DBDA 2FVCA 2I38A 2Z2MA 1PC4A 3DLKA 5J1NA 3CC2S 3R5DA 1WF1A 2PFFB 5BYQA 2R7WA 5F8JA 4L6V3 4YB7A 3VR1A 4C8OA 1DHMA 1DAXA 5GAGU 4OI2A 1TK5A 2QRRA 4IFYB 2BM0A 5L9XA 1Q81T 2HHVA 1C0UA 1VI7A 2LKZA 1U09A 3DYAB 1HD1A 4FBTA 3KK3B 1IBKF 2DPJA 2DCUB 3UNGC 5DDOC 2N3LA 4C0HA 2UUCF 1HPZA 3N6NA 2W8LA 5J2QA 1S10A 2GQ2A 2CJAA 3LW5C 2B9YA 1ZTWA 1JLAB 4KKOA 2J9EA 2ZZMA 3UCGA 4IYQA 4H4OB 2OPQB 3OUYA 5ITHA 4A47A 1SKSA 3TUIC 1S99A 2D1CA 4ITSA 4RW4B 4U9RA 4WTYA 4EGLA 1TL5A 2U1AA 3MFHA 2CFXA 2DGOA 3CCZA 3NP5A 3K58A 4ED2A 3CCWA 2HHPA 4PG7A 2GFFA 1F0XA 2MQMA 2VFRA 3JTNA 4G1QB 5AE3A 5CCMA 2QFJA 2LMIA 3CDBA 3QO9B 4ED8A 4JV1A 2QT7A 4TLQA 2BQ3A 2C3YA 4R25A 1RT5B 4Y00A 1YJVA 1S1UA 2DD8S 5DQHA 2AGPA 2KT2A 2VUGA 2R7UA 3RBEA 4EBDA 4N8OA 1LFPA 2VASA 3D1HA 3K8WA 1QTMA 5B0EA 1FF2A 2E44A 3GV8B 4MKYA 1HHSA 1OPIA 3T6BA 3Q8QB 4WZMA 3GV7B 1SJ1A 4Q2MA 2FHKA 2DNYA 4FP9A 1Y5NB 4Q0BB 3UR3C 1QSYA 1C1CA 1NNDA 2FVRA 3HO1A 1VHFA 2EBEA 2OH2A 4RUAA 4F4XA 5SUHA 2JEGA 2HVZA 2YNGB 5KG7A 2FHJD 2VBXA 3WBZA 3W2WB 2DNLA 2LXUA 4M5DA 2J9CA 3FNNA 3I6PA 3PO4A 3RAMA 3CD5A 5MLCV 2HHSA 4BBYA 3M32B 1HMVB 4IH5A 1XR6A 2CJKA 3ENWA 1HQUB 2MZRA 2FJVA 3OR2B 5IM0A 5J2PA 2DHAA 5DS7A 2KG1A 3PDNA 3M8PB 2FGOA 1YQHA 4CO3A 3BO4A 5B0GA 2V4JA 3NWGA 3BQ1A 5LJ5Y 4B3RF 2NSBA 1RYSA 3HHNB 2JLGA 3DRPB 4Q8EA 3G6ES 2K3IA 4QR2A 3VAJA 2F9DA 3B4MA 1BQMB 3K5PA 3T9ZA 1G3OA 4JOUA 4ALZA 4YY3F 1KLMB 2YX1A 3R27A 1QVGR 3BDEA 1N5SA 4B9SA 1KVJA 4FF2A 2GHVC 3HJFA 2K8GA 2QE5A 2DR5A 4M94A 3DOKA 5EDWA 1WTBA 2D9OA 2PEHA 3IO1A 2R2TA 3HX9A 5F3TA 3KLGA 3SXLA 1PILA 5KFZA 4PWDA 2DNRA 1GNKA 1VOMA 1X4EA 2U2FA 2XWXA 3SQGA 5IT0A 1TL1B 4ID5B 1HBUA 5LJ3Y 2UXDF 4WK1A 1Y00A 1PGZA 1KFSA 2XO7A 3Q24A 4OX8A 4OZNA 1REVB 5KT4A 1S0OA 3KTQA 1HI1A 1LXNA 4C7QA 3IC1A 1VBZA 3TANA 3KFWX 2K1RB 3DU5A 7FD1A 3KLEB 1W2BR 1GTEA 2AJQA 1TKTA 2VG7B 4AL6A 1OQ6A 2ZH7A 3CDAA 1HNVA 4JI4F 3O1LA 2AW0A 4U7UK 3IR5B 2DGWA 1NU4A 5LL6d 5KFVA 4I64A 3TVZA 4L72B 1ELOA 2RS8A 4TU7A 1M5KC 4F26A 4RUHA 1UJ6A 3TW0A 4IKAA 4P7TA 1JK9B 5EX0A 5J2NA 2XY6A 3H2LA 1GX6A 4O23A 5F8GA 4X4RA 1P1TA 5AXNA 3J7ZT 4ZPVR 3Q2TC 2ZKTA 3IS9B 2VFUA 2W7OA 2ASYA 1TKZB 2FIUA 4DV0F 1FDAA 3LUYA 2MZTA 1MMNA 2KB2A 4AXIA 3GFHA 3BREA 1R8HA 2CQCA 3AA9A 2X3GA 4J9NA 2HFNA 5JXSA 3MCSA 4ECRA 4K4SA 1AXQA 4FZVA 2N82B 4CTAB 1TAUA 5HMXA 3EPIA 3FRZA 3QZ8A 3SSSA 4CH1A 3OJSA 4DR6F 4A8XA 1SIZA 3G6XA 2A2CA 2DHGA 2DNZA 2JL9A 2ZHAA 2QZ8A 4KIAA 4ZPTR 3QLHB 1YRTA 2RUGA 5A8KB 4URGA 2X1GA 3HKWA 2WBRA 3DXSX 1LOUA 1S79A 3PIPQ 1Y3JA 2YNHA 2DHSA 4PPDA 4A8YA 4KHPF 2DB1A 4HH1A 3CJKB 2GMLA 3PW4A 1RT3B 4I6WA 5K8OA 2PA3A 1SJFA 5KFYA 4RU9A 1IM4A 2LA4A 4OI1A 2Z2LA 5E3QA 4NLTA 2KTQA 1IKXB 3M9OB 4V19J 1JKHB 3HK2A 2Q43A 2WBMA 3K5NA 1UEUA 2MKHA 2QIFA 4RUCA 1KQSR 2F7VA 1H7WA 3X1LB 5IT9Y 2J76E 3MOZA 4IG3A 3BGRA 4QIWD 5E3PA 2JLFA 5E7OB 2FC8A 2FPHX 1AFJA 1JXEA 4OHXA 4H4KA 3HHLA 1SQEA 5IXUA 1FE0A 4LQ9A 3IG1B 1T03B 3N28A 1TK8A 4NLRA 4JI8F 5J2MB 2XGQA 1TR0A 4DBQA 3K5OA 3WX4A 3QGPA 3UE2A 1HA1A 1EETA 1TFWA 2XMKA 4CO1A 3ENQA 2F8EX 4KFBB 2UVVA 2DNNA 3CPWR 1F60B 1TK0A 3M4XA 2WONB 3CD0A 3W2VA 3PIOQ 2RKIA 3N6MA 4A8MP 1X7VA 3BR9A 2XY5A 1M5HA 3CB4A 2M0GB 3HMJG 2V4QA 4PQUA 4QWEA 2RRAA 4XO0A 3G96A 2CQ4A 2L41A 3JSRA 3MURP 4N56A 3TI0A 1Q4RA 2HWIA 3R3TA 2M4MA 2MB0B 3BGUA 3RB4A 2KYZA 3VAHA 1NHUA 1X4HA 4DV1F 4NMLA 4EYIB 1S72S 4R5PB 3DOMA 1AW0A 3C46A 1Z2ZA 3LGNA 4OZ1A 1F2GA 4GKKF 3EGWB 5D3GA 2J7WA 4PCQA 1FTRA 1WG5A 2HS4A 4K4TA 4CH7A 3MR6A 2FLPA 1G2EA 2BDPA 1MSWD 3M8RA 2HS0A 5HROB 2CDQA 2BA9A 2Q6CA 4KT0C 3SEOA 4Q44A 3CD7A 5F8HA 2O66A 3M9NB 1TL3A 1JLGB 4ZVEA 2ZH1A 4I67A 3LGMA 2O67A 2HHXA 1F9FA 2UV8A 4FNHA 4IFYA 4IOCQ 4C8LA 3M6VA 2BOPA 1NKCA 3CT9A 3UQSA 4QW9A 1A6LA 3DYAA 4C0BA 2J6UA 4BCAA 3KK3A 5HBMB 4F4KA 2D3ZA 1RQ0A 3NS6A 1RI7A 4NLOA 1N48A 4AL5A 2L3MA 2PI4A 2J0QD 1JLAA 4GO7X 2O01C 4NZ7A 2OD4A 4LF7F 2NQPA 4H4OA 2K3KA 2LEPA 1RGVA 1BC6A 4NXNF 1VQ9S 2GX8A 2FJXA 1Z2LA 1Z4UA 4RW4A 2W9AA 5K14A 3QMQA 4O44B 3MM7B 1X9MA 3US5A 2N4DA 1HNIB 2AP6A 2YQ3A 3K2YA 1JMTA 4G1QA 1L3KA 5DG7A 2RDIA 3QO9A 2V8HA 4G3IA 3FQKA 3NS5A 1RT5A 2LCWA 2PT0A 2AX1A 2JJ4D 2UV8G 2VG5B 3BDPA 2PO4A 1KTQA 2IA0A 3OTOF 4NX9A 2GMJA 1BD6A 2ERRA 2LU2A 2OPRB 4O4RA 5CXTA 1SH3A 1MWYA 4PXEA 3BQ0A 2CQ0A 4O4GB 4ZPWR 2OTLS 4OQJA 4Q0BA 1B0PA 1I6JA 4QOTA 4ZPAA 1XMOF 4I68A 1ZPWX 2YX7A 2XB2D 3I9ZA 2L9DA 4Y34A 4QPXA 2G9OA 2YNGA 2LLZA 4D3GA 3KLFB 4OLPA 2YWGA 3FEZA 3W2WA 1HI8A 4XK8C 4MAKA 2VC1A 1DQ9A 4FF4A 3CVKA 4PUOB 4RBUA 2GCFA 1VBYA 3M32A 2CPHA 4P2SA 4G1PA 1HMVA 4K5SA 2HHTA 1HQUA 1K1QA 1SH0A 3OR2A 4GO5X 2HQ3A 1XR7A 5K8PA 2F4VF 4R0JA 3FRYA 4C9DA 3M8PA 5JJBA 1NJZA 4CIOA 4OJ1A 5F8IA 4OHZA 2YWHA 3SZ2A 2I0XA 1C1CB 4OJGA 2HNDB 3DRPA 5CQGA 2HGNA 4IFVB 2GC8A 2P6SA 3VQTA 3ISNC 3T5LA 5CHCB 1BQMA 1G7CB