2KXHA

Solution structure of the first two rrm domains of fir in the complex with fbp nbox peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
199
structure length
199
Chain Sequence
GAMAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of FIR-mediated c-myc transcriptional control
doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Poly(U)-binding-splicing factor PUF60
total genus 45
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA01
4CIOA 1VBXA 4V19X 1KC8T 2MKHA 3TO8A 1VQ4S 3SMZA 2KRBA 1D9AA 2RNEA 1DRZA 5HL7Q 1YJ9S 2JVRA 1YWXA 2LCWA 5DM7Q 1P1TA 3MUMP 2VOPA 2DIUA 2N82B 3CF5Q 1X4HA 2LQ5A 2KM8B 2LEBA 2MMYA 1FJEB 2F3JA 2MY7A 4Y00A 1SJQA 2B0GA 3MURP 2DNLA 4CQ1A 3CCJS 2VODA 4IOAQ 2F9JA 1X4BA 2HZCA 2HGMA 2OJ3A 2X1GA 4J5OA 3CC4S 3FEYB 1M5VC 1VC6A 1JJHA 1D8ZA 2CQ3A 2LYVA 2CPEA 1VQMS 2KXNB 2EVZA 3L3CA 3CCQS 2DK2A 3THTA 4EGLA 3G8TA 4LIRA 3G96A 2CPXA 4OZ0A 4A8XA 2DGWA 2DITA 2M2BA 3VAKA 1DBDA 1OO0B 3EX7B 4PRFA 4OZ1A 1QM9A 2L9WA 1JMTA 2MSTA 1FXLA 2VOOA 2MKIA 2J0SD 1JJ4A 1WELA 2I38A 2DNMA 3B4DA 3R1HA 1WEZA 4W92B 1F9FA 3BO2A 4M5DB 1X5PA 2KRRA 1S72S 3LQVA 1IQTA 2YKAA 2AD9A 2LA4A 2G4BA 2U1AA 3P5TL 1X5OA 3S01A 2LEAA 1ZZNA 2MQNA 4UY8T 1HD0A 2BOPA 3THPA 2UP1A 1O0PA 3P49B 3CXCR 2RRAA 2MB0B 4YUDA 1HA1A 2HGNA 1OIAA 1SJRA 3MD3A 2NLWA 2MZTA 3LPYA 2E5GA 1YIJS 2KXFA 1S79A 2X1AA 2DNKA 5GMKa 3VAMA 1BY9A 3UWTA 1NJIT 3PIPQ 5CYJA 3J7YU 4TU7A 3NS5A 4FXWA 5DETA 1KOHA 2DNQA 1RKJA 1VQ9S 2CQBA 2CQCA 4W90B 2MZRA 1X4FA 2XS7A 3IWNC 4F26A 1QVGR 2KH9A 2FHOB 2CPYA 5CXTA 1XN9A 3J7ZT 1A9NB 2LXUA 3VAHA 2YWKA 3EGZA 2CPZA 2JWNA 3VAFA 2QEXS 2DH9A 1VQNS 2KVIA 2OTLS 4WF9Q 1WEYA 1K9MT 3R27A 2FY1A 3CD6S 5HO4A 2MXYA 2N7CA 2KI2A 1H6KX 2SXLA 2MQQA 2KXHA 2MY8A 4C7QA 3CMES 2MKSA 1ZH5A 4F02A 2OTJS 2E5JA 1N54B 3V4MA 1FO1A 2HYIB 5CA5A 2D3OR 4C0OC 1YITS 5H1SV 2FC8A 1H2VZ 2YH1A 2XS2A 2MQPA 1M5PC 2MHNA 1WG1A 2CJKA 2DHAA 3MUVP 4ERDA 2MYFA 5LSOA 2MKCA 2LA6A 2N3OA 2DNZA 2AYBA 4CH1A 1FHTA 3MDFA 2FC9A 4IO9Q 1YHQS 4WIIA 2QA4S 4QU6A 1U1KA 5IM0A 5JVHQ 2JVOA 3BEGB 2CPDA 4IUFA 1URNA 1OPIA 1VBYA 1DHMA 1U1MA 5DDPC 1VBZA 1B7FA 2MSSA 2CPIA 2K8GA 2V94A 1U6FA 4P6QA 1WI8A 1H2TZ 2MZQA 2MZSA 3VALA 2KYXA 2DHXA 3VAIA 2M70A 3UE2A 1U1PA 3MI7X 1X4CA 1R8HA 2M9KA 3ULHA 3R1LA 5ITHA 3P3DA 1NU4A 3U1MA 1K8AT 1PO6A 3VF0B 2M7SA 3OW2R 1U1NA 1JJ2R 5JVGQ 1UP1A 3U1LA 2D9PA 1WHVA 2Q79A 4U67Q 2MZJA 2VONA 3NNHA 2CQHA 2LMIA 3G9CA 1WI6A 2WBRA 5LJ5Y 1WHYA 2DHGA 5IM0B 2ZJQQ 1WTBA 3NMRA 3Q2TC 1KD1T 2RRBA 2RT3A 4TU9A 2RQ4A 1NO8A 1VQ7S 1YI2S 1Q7YT 1P27B 2K3KA 2RU3A 2KFYA 1U6BA 4Z2XA 1WF1A 2EK6A 4YB1P 2XB2D 1WF0A 3K0JA 2CPJA 2I2YA 2GO9A 1WF2A 2CQ0A 2MZ1A 2MKJA 2E5IA 5LSLA 4QQBA 3B4MA 1KQSR 1N52B 2G0CA 2CQ4A 3CULA 2A3JA 5MLCV 1N88A 3CCMS 2MPUA 2CQDA 2KHCA 3FEXB 1VQ5S 5DDOC 3SDEB 1YJWS 2CPHA 2JX2A 2RS2A 3UCZP 3BO4A 2MGZB 1M5OC 1HD1A 1U2FA 1HL6A 1H2UX 2YH0A 5DDQC 2LECA 1FNXH 3I56S 3CC2S 2DGQA 2KG0A 3MXHP 5D78A 2XNQA 2ZJRQ 2MGZA 2E44A 4RU2A 3TYTA 5LJ3Y 1ZZFA 1QVFR 3RW6A 2MJUA 4PR6A 1UFWA 2F9DA 5LXRA 3UCGA 5IFMA 2AYEA 3G6ES 2MQMA 3D2WA 5BJRA 2LKZA 1UAWA 2ADBA 3HHNB 1M1KT 1VQ8S 2OIHA 2DGVA 2NZ4A 2O3DA 1K73T 1X4GA 5GAGU 2DNPA 1DZ5A 2DNRA 2DNYA 3UCUP 3CPWR 3PIOQ 3CUNA 2E5HA 2ADCA 2GHPA 3CCUS 5GAHU 3SDEA 1U1QA 2ERRA 1YJNS 1WG5A 5GAEU 3TP2A 2HVZA 3CCLS 2J8AA 2PE8A 4TU8A 2M8DB 4WCEQ 1OWXA 3ZZYA 2DH8A 3I55S 1RK8A 2OSQA 1Q86T 5DM6Q 1L3KA 2CQ2A 2DO0A 5GVQA 3ZZZA 5DDRC 1X0FA 4CH0S 1X5SA 2J76E 2AYGA 1CVJA 1M5KC 3H2VE 3DLLQ 2L08A 4FXVA 1X4EA 1FT8A 2ZJPQ 3N9UC 1Q81T 5GADU 2BZ2A 2N3LA 2U2FA 1M90T 1FJCA 1R8PA 2DNNA 4WFNQ 3MOJB 2KU7A 2DGUA 2D9OA 1SJ4P 3IRWP 2QFJA 2X1BA 3EGNA 2EK1A 3HI9A 4WFBQ 3CMAS 2HGLA 2YTCA 2XSFA 4C4WA 3JB9k 4QPTA 5D77A 2DHSA 1AUDA 2FPHX 3NS6A 1W2BR 2DNGA 5FJ4A 2M8HA 3BS9A 5IQQA 1WWHA 3MD1A 4LJMA 4Y0FA 1VQPS 3G4SS 3P6YC 2DB1A 1WEXA 2AYMA 5EN1A 2DGSA 2CQIA 1SJ3P 3CCVS 1VQOS 1A7GE 4F25A 1X4AA 3SXLA 2DNHA 3UD3P 2RUGA 1X4DA 5LXYA 1UW4A 2M0GB 2JRSA 4ZKAA 2G1DA 2DNOA 3VAGA 1X5TA 2KG1A 3G71S 2MQLA 3H2UB 2J0QD 3NNAA 4BS2A 2DISA 2KM8C 1U1LA 3S8SA 2XNRA 1KOOA 2M52A 2CQ1A 3G8SA 3RW7A 1PGZA 2DGXA 1VQKS 1WHWA 4WFAQ 2DO4A 1N8RT 2MJNA 4IOCQ 1Q82T 2X1FA 2M4MA 4YOEA 2RQCA 3CCRS 4TLQA 3US5A 3S6EA 3CCES 1VQLS 2DH7A 1VQ6S 4ED5A 2MKKA 4LMZA 1FJ7A 3CCSS 2CQGA 2KN4A 3DXBA 2DGOA 2PEHA 2M88A 2CQPA 3UD4P 2XS5A 4WKRA 3BO3A 3VAJA 2OSRA 1WG4A 2L41A 1G2EA 1SJFA 1VC5A 1U1RA 2DGTA 1WHXA 4UQTA 1YTYA 4QU7A 3CC7S 2RVJA 3Q2SC 2CPFA 2DIVA 1VC0A 2RS8A 3CTRA 4PKDB 2MQOA 1U1OA 3NNCA 2LXIA 2KT5A 3S7RA 3MUTP 1SXLA
chains in the Genus database with same CATH superfamily
1F60B 1XR7A 5ETNA 2WVCA 3JQKA 2RQMA 3CJRA 4DZ6A 3R8YA 3RTVA 4ID8A 4OHWA 1H73A 3ILIA 3RYLA 1N5SA 2P9CA 3ENAA 3Q8VA 5E0OA 2E66A 3KHRA 1UVNA 1YBUA 3DXSX 2KRBA 2OAUA 3J7A1 4C0HA 1WOPA 1RAEB 4LIWA 4DSIA 1H3DA 3FFIA 2ASLA 1REVA 3A8JA 2Z2MA 5HVGA 3H4BA 5AE1A 1YWXA 1VIXA 2LCWA 2GJFA 4C8ZA 2DR8A 3DN9A 4PPDA 2E1AA 1RTDA 1FFSB 4IO1A 2VOPA 3KHHA 2HK3A 2HVIA 1X4HA 4IG0B 3MPVA 2KM8B 1PYTA 3M2UB 3FMWA 3HFVA 5D3GA 3MOZA 4Y00A 1GXUA 4CQ1A 3O3LA 1S9EB 2F9JA 1X4BA 3OQ2A 4EI2A 3LOUA 2OJ3A 1HWLA 1WOOA 2CJ9A 4DN9A 1NPRA 1REGX 2ZWPA 3CC4S 4IYQA 1G3OA 2BW2A 1AFJA 2XULA 1KDNA 3C66A 4S0MA 1UVKA 4ED0A 4OHZA 2GMHA 2ACYA 4I0WA 4U8YA 1CBKA 2F1FA 5J2NB 4X62F 4LUBA 3MFIA 1FI4A 1JNZB 2V2QA 1SC1B 4FPRA 2X7IA 3A12A 4WP8A 5KFZA 4Q0BB 3HZEA 3D5MA 3DNCA 4EGLA 3G8TA 4MAKA 3BBFA 4GVLA 2IMOA 3I6PA 4OZ0A 2ZZTA 2R2UA 4C98A 1LWEB 1SL1A 1X8DA 1D9FA 4KYZA 2R4FA 2DITA 3TVKA 2HFUA 3DOKB 1U48A 4NCBA 1WD6A 1FESA 2IAJA 4OZ1A 3I5CA 4JYAF 4NRUA 1BE4A 3BQ0A 1KVIA 3TJ8A 1ZM4A 3HD1A 2W2PP 3QGHA 4P75A 4ZVPB 5KFFA 4DR7F 4PQUB 2HHXA 2FJEB 4ES2A 1JLAA 3VGVA 4QYZK 1WELA 1S1VB 2BKNA 2DNMA 4EK2A 2IA0A 1Q53A 2XYHB 5DGAA 2KT3A 4FVMA 2FUG9 2KB2A 3TZXA 4NLSA 5A8WB 2HAIA 3LQVA 2P9EA 3QT8A 3FBEA 4H54A 1BGXT 2HQIA 1VOMA 5IC4B 3TOQA 4ED2A 1KSPA 1TV6B 1ZA2B 2G4BA 1N33J 1FJGF 2AW0A 2XWYA 3MEDA 1JX4A 4X64J 3P5TL 4PG8A 2VC1A 2FJDB 1CG2A 1P6TA 1SJ1A 4G3IA 1EZZB 3EE3A 1FRKA 3GTYX 4JP8A 1NHVA 4ZVRB 4NLUA 1O0PA 2D3O1 1SKSA 2D1CA 4M5MA 2PMWA 4CIOA 3P49B 2RRAA 4WP3A 2HMIB 3GYNA 2PGCA 4CTAB 2MZTA 3CDAA 2KZMA 3DU5A 5L39A 3DDIA 2YNIB 2J9EA 1CJKB 4HACA 4M5GA 2NSBA 3MR6A 1U0HA 4FDFA 3J7YU 1S1TB 3J81U 4IOBA 4FS1A 3VTIA 2N7YA 2E5LJ 3LP1A 1O5JA 4WXOA 2UXBF 4I2QA 4LVNP 3UN2A 1HHSA 2D3ZA 3HLUA 1RKJA 1KBRA 4YR2A 1N48A 2CQBA 1QD1A 1YBTA 2CQCA 4ZJQA 1SH0A 2MZRA 3BR9A 3Q8RB 4K50A 4Q2MA 5A8RB 5ETSA 2A10A 2OD4A 2CPYA 4D3HA 3KKFA 2BKPA 2OPSB 3LH2S 4AT1B 4OJ1A 5E7OB 2VPYB 2WAQD 1XEZA 3JTOA 3UO0A 3IFEA 2W4CA 3MEKA 1BHNA 3TRGA 3QJJA 3TUZC 3AB2B 1MWZA 2I5JA 1A9NB 1B70B 3DHWC 1FE4A 4IRKA 1RT5B 3LTOA 3OR2B 2WONA 1R0AA 2VC0A 1SIZA 1X9WA 3VAFA 1NKBA 3BSAA 4FF3A 1S9GB 4BWMA 2DVIA 3HSGA 1MU2A 3KJNB 2FZCB 3AOAA 2W8KA 3V6HA 4DPYA 1XMQJ 4E0DA 2EBGA 1VQNS 1K9MT 4JV0A 4KAIA 4KQZA 4LR7A 1TU0B 3NRBA 3MAHA 5HO4A 2HNZA 2R7RA 4ECXA 3PRDA 1JLFA 4ZP8A 2VG7A 2RDJA 4U8VA 2H54B 2NZCA 2CNLB 4HT7A 5KOXA 2BR0A 2MQQA 3K5MA 3KG0A 2EC2A 5G0RB 4ECTA 4WE1B 2DXEA 2DR6A 3GP9A 4B9MA 3ILJA 2MY8A 1T9YA 3FK4A 4KKOB 3CMES 4YQWA 3CJ2A 1TL3B 2HNYA 1KFDA 2PA8D 2YKPA 3H5UA 1ZH5A 2QMXA 5CYQA 4K4XA 2XHCA 1T02A 4DS5A 4JV5J 1WC4A 5LT5A 1UJ6A 3OR1A 1RQ0A 3QBCA 4KH0B 2P2CB 4B9LA 3R3TA 3G87A 5F3ZA 2QSWA 4NX9A 1MLAA 1NLKL 2QMUB 3N5BA 4BCAA 3OSPA 3C46A 3PW5A 2K7KA 3R6GB 1U0SA 4C0OC 4K4TA 3MZIA 1YITS 1HQUA 3ISND 2IDLA 3RBDA 3GJRB 3TNVA 1HFEL 2V8PA 2JEJA 1M5SA 2EPIA 2XS2A 4DU8A 4CT9A 4FNHA 2MQPA 5J2NA 1M5PC 4JV2A 4LQ3A 1NKCA 3H20A 4DUYF 5H9EK 3PDNA 1NRKA 4ZPBA 1F5BA 2DHAA 2MYFA 4M5KA 3ZZOA 1QE1A 4WTOB 4Q43A 1WORA 4F7VA 5J2QB 4KHRA 3VZHA 3CO9A 1TFWA 2GHVC 3RAQA 1ZTWA 1JB0C 2UUTA 5FIIA 2RRNA 5LMNJ 1XC9A 4N56A 1PG5B 4ECQA 2AYBA 1UVLA 4RNHA 1FHTA 4EBEA 1SC3B 3MDFA 4B3TJ 2VQEF 3QATA 1RT6B 3PJXA 1UETA 2YNHB 3PX6A 1XK8A 4AD6A 4W4MA 3DMJB 3MM8A 3IS9A 4DV6F 2W2QP 3BR8A 2VDHA 3KTQA 1URNA 1OPIA 2R3VA 4OYMA 4DLGA 4B08A 1U1MA 3MMBA 1B7FA 3IR6B 3PEHA 1REVB 1RWUA 5K9FA 3X3UA 2AJ2A 2X51A 5CD4A 4DR6F 1RWVB 4OZ3A 4IRCA 4CNYA 2FJWA 2MZQA 2MZSA 4UTGA 2J6SA 3CDUA 2PDAA 1RHJB 3E01A 1S99A 4PAAA 3I5BA 4P72A 3JAMU 1N5YA 2MTLA 3UDVA 2M70A 2YKMB 1EETA 3FQLA 1WUUA 3NCPA 3DM2B 4FKXA 3T6JA 3OL7A 3HXMA 1U1PA 2V0NA 1IR1A 5D0RA 2R8IA 1X4CA 4QIWD 2QGFB 3CB4A 3HHLA 4HDHA 1NNDA 2OEJA 2B9EA 5I4MA 4K2XA 1IVZA 5RUBA 1Y5NB 1NHKL 2E7XA 2VA2A 1GT8A 2HNDB 1J2VA 1V3RA 1PO6A 1UCNA 3BYPA 1L3SA 4JV1A 2M7SA 2HIYA 3DRXA 3GILA 4ZLLA 2MHEA 4DR3J 5JVGQ 2WBMA 1LV5A 3U1LA 2L9DA 3K5NA 1IBMF 1S48A 1RHUB 1T3OA 4FYYB 2UU9F 5I42B 2MZJA 1IKVA 3GSDA 3NNHA 3G6YA 2J9CA 2ZOGA 1AZSB 1R6YA 1DARA 1T94A 2YPZA 3L7OA 4MKYA 4YB6A 3BSOA 3F41A 1N6QA 3HKWA 1RA6A 3H5SA 3W7BA 1WHYA 2OPPA 3W63A 5D8HB 1NHUA 1EJ7L 2ZJQQ 3TR5A 1S6QA 4RUAA 3T5LA 1H38A 3EPGA 2FHJD 3FGVA 4PWUA 4KY3A 4TU9A 3UR3C 2HFVA 3QIDA 5M2RA 1I6JA 3TI0A 4M5DA 5L38A 3QRRA 1S1XA 3NCQA 2RU3A 5KFDA 2RUSA 3W8PA 1NB2A 1CPZA 2F8EX 5DG9A 1U2RA 4LR9A 3RJMB 4ZCMA 3BF4A 2GJ2A 1D0EA 4OX9J 4RPFA 3MPYA 4NMXA 1AXQA 4RW9B 4TXSA 1GX6A 4TYBA 2ZD1B 3KXDA 2CPJA 1KLMA 3I9ZA 2GO9A 1GQEA 1GNKA 4FNIA 4ZP9A 4GC6A 2CQ0A 3CDWA 4J90A 4ZVSB 2E7VA 1EX8A 1BQNB 1XTZA 4O3PA 1TK0A 4JI6J 2RKIA 3ET6A 4ILLA 1NUEA 1HQUB 4DBQA 2E5LF 2C2ZB 3CULA 1KLNA 2MLZA 5MLCV 4OHXA 1H74A 3CCMS 4L74A 3SQGB 2YWGA 2V8VA 5CYMB 1R3NA 3ZXWA 3CJKB 5DDOC 4KR0B 4J9MA 4O3RA 2B6AB 2OHDA 1T0TV 2GGPB 2V34A 3C16B 4ZVQB 3SDEB 4C11B 2B4UA 4N5SA 4NI2A 5D4OA 4KB7A 4O3NA 1KKHA 4DLEA 2DBBA 4NXMJ 1KVKA 3AT1B 1TL7A 3Q8PB 3BH6B 1K0TA 4RBVA 4TYAA 4IH6A 4B3SJ 2WB1D 4OZLA 1OSDA 1HL6A 5DDQC 4DSJA 2NR0A 2XO6A 2Q66A 4WZQA 3DRPB 4OYZA 2LXFA 1RWNB 1VMBA 4N8NA 4WXWA 3KLGA 2KG0A 2WVFA 1AROP 5I3UB 2XNQA 1HMVA 4RR5A 1NPKA 2ZH3A 2ASYA 2PA3A 1NAQA 2XMVA 1K0VA 2A1BA 4I2PB 5J1EB 1RDRA 2UXDJ 2E44A 4ICLA 3PW4A 3RRKA 5KFWA 3LUYA 4HKQA 3KDOA 5T7LB 4HR2A 5J2MB 1QVFR 2A0FB 1S49A 2MJUA 2HIQA 1B7YB 1LWFA 2YWEA 4NOHA 4PR6A 2WONB 5FD1A 3ZTQA 5LXRA 1DTTA 4OJ3A 3GIKA 5HI7A 2KVQE 2ZC3A 2EFOA 1BQMA 4FXDA 4DFMA 3PW0A 3HD2A 3SFGA 1VK3A 2V67A 1RAHB 1V3ZA 1J27A 1UPMB 2GMJA 2ZE2A 3PRVA 4HVZA 4CLPA 5AJ3J 4E98A 2R9LA 4DL3A 1K73T 1X4GA 3QLHA 2RKIB 1N34J 5DJBA 4FP9A 1S12A 1VIOA 1C4CA 4LF9J 3ONQA 2D41A 2DNRA 3EJMA 1RCXB 2E5HA 1HQ2A 3G86A 3SCIE 3OL6A 1RAAB 4UZBA 3CCUS 4X2BA 3Q8UA 1CQMA 5GAHU 2R8GA 5D0EA 3ITHA 3SDEA 1Y4ZB 3PM9A 3O5TB 1WC3A 2LDYA 5B0CA 5KFPA 1T03B 2Q43A 4RBTA 1CQNA 4UQGA 4A8QA 2W4PA 1E6YA 2IYGA 5B08A 1Q4RA 4WCEQ 1CC7A 2HFSA 3ZZYA 4CTAA 2F4VJ 4ED7A 4C11A 2XLJA 1RWXB 3CE8A 1RLCL 2B6AA 2CQ2A 2HAFA 2VICA 1XMOJ 2DO0A 3EYZA 2DEIA 5GVQA 3TAMA 3B54A 3SBMA 4KGVB 4GKJF 1EP4A 1R31A 4H4OA 3CDBA 2JOQA 1SQGA 2BMBA 3SEOA 4YHHF 3QJLA 2AYGA 1CVJA 3H2VE 3DLLQ 1Q79A 3MWBA 1KS2A 4H4MB 3MMCA 4DL2A 3JSRA 5HVFA 1GH8A 1FCAA 1C2PA 4R5PB 4ZIWA 3QRPA 4P2SA 1OS5A 4ED3A 1S10A 1RYSA 3CW2C 1SQFA 3UI3A 2BZ2A 3CJ3A 2N3LA 1KLMB 1Y10A 5GADU 4O3SA 1R8PA 2HFOA 3LANA 2WTFA 3D6HB 5IT9Y 4CCHA 2DGUA 2F4FA 2CA9A 2I1RA 3GSIA 3IRWP 2OH2A 1CEZA 3JS9A 2EK1A 4ILRA 2E1CA 2V8HA 3HI9A 3D3CJ 2EFNA 2RILA 3BGRA 1S76D 2OLWA 3IGNA 3CMAS 4IQMA 3GV5B 1HHTP 4LFBJ 1TKTB 3UNGC 1EQ0A 1AB8A 2Z58B 5D15A 3JB9k 4QPTA 3QIPA 3BDEA 2QMWA 4ES3A 4AYBD 1TTHB 2W9CA 2LEBA 4K4UA 2ZVSA 3MAQA 2R2SA 4FYXB 4CLZA 3VVTA 4MKAA 4NLQA 1T3NA 4WKYA 2YWHA 1OY6A 2QE5A 1RTJA 1WWHA 1B4SA 4LBPA 4KC5A 5KG1A 2W9BB 1FDDA 3HPOA 3DRYA 1VQPS 1C1BB 1FKOB 1B0VA 1WEXA 3ZNJ1 2AYMA 4FYVB 4NEZA 1WC1A 4RU9A 4Q5VA 3ZTOA 6FD1A 4YR0A 3KUHA 3NOCA 3EDQB 1YKWA 2AJFE 2AJ4A 1SJ3P 3AD8C 3BPSP 4C3LA 1A7GE 4F25A 3QMQA 2ZBCA 3SXLA 2DNHA 4EMDA 2RUGA 1X4DA 4ED4A 1RTJB 2CG8A 2JEIA 1RUSA 2JRSA 1LKZA 2G1DA 3HVWA 1H7WA 4AFFA 4NPOA 5F8IA 2W8LA 2QFIA 1N5YB 2WVBA 2XI3A 4NLDA 3W61A 1SQEA 2NPFA 4OLPA 3SI8A 3SYZA 1V6HA 1VYAA 2CG4A 4LSNB 4J37A 2BOAA 4ED8A 1NK7A 4W98A 3VGSA 5HMYA 2N4DA 4LF6J 3QGIA 2RE1A 1HHQA 1R6VA 2W1BA 4G6VB 4EO8A 1FDNA 3NNAA 3MMBB 2ZH8A 1SL0A 2BUNA 2R2TA 2BDPA 1NZ8A 3OV7A 3M8RA 3CJTA 3UFCX 5IC6B 2ZHBA 4A8WA 1NK5A 4JI2J 2M52A 2K7JA 1EARA 1ZPVA 2GQ2A 3D7SB 2BJ7A 4CM2A 1W2IA 4NLWA 3RRHA 1VQKS 1WC5A 2UXBJ 2B5JB 2FHJA 2YNGB 2OMLA 4DUZF 1N8RT 3GFXA 1WJ9A 1TAQA 1U25A 2YPYA 3QWPA 1MN9A 4UW2A 3MM6B 4NZ0A 2E1RA 4IOCQ 3HVAA 3K89A 2X1FA 4Y6IA 5L46A 1FRHA 4Y2IA 4A46A 2RQCA 4WE1A 3R7SB 3KJVB 1LNQA 4WK1A 3CCES 4IFVA 3EUNA 2FJAB 4USMA 1VQLS 1QE1B 2QJ3A 4LSZB 5J2QA 1S1UB 2R7SA 1FNOA 4LMZA 1I51B 3G6VA 1ZPWX 1U49A 4F36A 2BJ8A 1R43A 1LFWA 2VV5A 1B3TA 2R7WA 1TKXA 2LU1A 4LF8F 4CLWA 1PAUB 4NYPA 4PYAA 4CZCA 1CULA 9ATCB 2XS5A 1DTTB 2OSRA 1UZHA 2YVSA 4PCQA 4PUOB 3GG0A 1RJJA 1URRA 4J9LA 1U1RA 1IKWA 5T7LA 2NXJA 3IAS9 4NLPA 4OLOA 3GYXB 2XCAA 1N5VA 2JL9A 3I9V9 4L6V3 2OPRA 3Q2SC 3OT9A 2CPFA 4KGMA 1C1CA 3FMBA 4NA1A 5DG7A 4G65A 1HMVB 1XNQF 3IR5B 2ZWOA 3CTRA 4PKDB 4DL5A 1N36F 5L1LA 1U1OA 3NNCA 1HNZF 3M2VB 3PNIA 4WP9A 4ZP6A 1JKHA 2GCFA 1KEKA 3J81j 3Q86A 3M1VB 3T9ZA 1FEEA 2H5IB 3M8SA 2XLIA 1SIWB 4R25A 1UVIA 2HHWA 2JH3A 2UXCF 1VI7A 5B09A 3OHBA 2QA4G 1IR0A 2D3UA 1F6TA 2QX0A 3CEDA 3G82B 4IDKB 5DO2A 3HMJG 1F3FA 2MKHA 2B4VA 3BGFA 3H2LA 3TUJC 3SMZA 1ZAVA 3BKUA 1VRUA 2HLUA 2P9GA 3BKFA 3DLGA 3GQCA 4DJBA 1NM2A 2VQFF 2H65B 2ZNZA 3SIPB 3W5XA 5F3TA 3V6JA 3OVAA 4QWBA 4C2MA 2L9NA 2ZH6A 1R0AB 3B6BA 2JVRA 2APOA 3D68A 5HVHA 1FWLA 4BHQA 4A8YA 4ED1A 5HK4A 3D6FB 3ZFVA 4YHHJ 2ZHAA 4OV6A 3MUMP 3Q0AA 2BQUA 2N82B 3CF5Q 1SI9A 5EWGA 3TZWA 2PMZD 4URGA 2F3JA 2GS8A 2MY7A 5L8RC 2OEMA 2OPQA 2XI2A 3H42A 1SH2A 2VODA 3OXLA 3QAEA 4RW9A 3CCJS 4H4KC 4FS2A 4GKKJ 4USVA 1YBAA 4C48A 1FXDA 2HGMA 1RACB 5D4LA 5B0FA 4J5OA 4CO3A 3UR0A 4LRAA 4F4KA 1MWYA 4RW8A 3FEYB 2QLJB 3GMGA 3K2YA 4MMOA 4I2QB 4HACB 2C3OA 2LVWA 4OI2A 2CQ3A 2LEPA 2LYVA 1VQMS 2CZVC 3NBPA 2LDIA 3DYAB 3K8WA 2A2DA 3LP2B 2CDRB 4OI6A 1G1XA 4JI8J 4QIVA 3LWLA 2E29A 3AOBA 4HYKA 4Q8EA 4I67A 1NSKL 3JQMA 4YB7A 4LIRA 1OQ3A 3G96A 4LFAF 5JJBA 2IIHA 3AA8A 2HMIA 3N6MA 4ZK7M 4DQSA 3MEDB 4YN3B 3VWSA 3BN7A 3J7AN 2M2BA 1YDLA 5KT6A 2PO4A 3GV7B 4B3OB 1S0MA 2XSJA 3HSDA 3IBWA 4IH7A 4P2XA 2EBEA 1XNRF 4C8KA 2Y0SD 3ADAC 1T05B 4JI2F 2VA3A 2VZ9A 1TV6A 3L7PA 4OX7A 2W7PA 2MLYA 3FZ2A 1CJUB 1JIHA 5E3QA 1DQ9A 2HBRB 5GMEA 4X65F 5EWEA 3EVWA 4W92B 4M5DB 2FZKB 2QLXA 4WIQA 2GA7A 4DFJA 3Q8QB 2EG1A 5JMNA 3N5FA 3PW2A 2Z4PA 2AD9A 4DSLA 1U8SA 3D4JA 1U09A 3QFWA 4J9KA 2Y8YA 3MAAB 2VD3A 4RUHA 4A8MP 1UPPA 3AAWB 3S01A 1KRPA 2R7UA 4DWIA 2VFTA 5GAEI 3K5LA 3HO1A 1Y0HA 1RTDB 2H5JB 1LW0A 1UWBA 3THPA 3I0RA 1APSA 1GMWD 2BJ9A 4DCJB 1RYRA 3MEEB 3CXCR 2PN6A 1HBMA 2HGNA 4YUDA 1OIAA 1IJFB 1HNXJ 1UEUA 2E5GA 3LPYA 3M2RA 3R2DJ 3OD2A 3TUPA 2HBZB 3DRRA 3IWLA 4AXJA 3UWTA 4HH1A 5GAGI 3VAMA 3PW7A 2YNHA 3IA0A 4KPCA 4AQYF 1GTHA 1NDPA 3BKTA 4Y2AA 1WDDA 1YJTA 4NEYA 4O3QA 2Q6CA 4MIAA 4TNOA 2HQDA 2CWKA 3MR7A 1DURA 4WWSA 1VDHA 1EETB 2AV5A 1X4FA 4HHHA 2XS7A 4UOCA 2FVCA 4U9RA 3IWNC 2O67A 2FHOB 2IDEA 2QIFA 3E01B 4TQSA 2F5GA 8AT1B 1XN9A 1CJTB 5KTQA 4IG0A 5A0YB 2ROEA 4PQAA 5M2UA 3DRRB 3PTWA 2LXUA 4RO0A 3VAHA 4C8LA 2YWKA 1ZYQA 1G4CA 4X4UA 4F3QA 4DCOB 2Y1JA 4KO0A 1MSWD 2ZVIA 1R0CB 1YGYA 2ATCB 4YS2A 2W7OA 3MM8B 5HLFA 4QW9A 1WEYA 4DV2F 5CYQB 3EWGA 1SUQB 1YJRA 3X1LB 3M9MB 4B3RF 1CLFA 4F3OA 4KKOA 2MXYA 2IY5B 2JSXA 5D0HA 2RHSB 4A8KA 2UVWA 4JI5F 2FVQA 1HNIB 1H6KX 2QZ8A 5C42B 3O1LA 1KWMA 5HBMA 1NXIA 1HNXF 2IYIA 1IKXB 4NCGA 3PJ9A 3AXMA 2HHSA 5E3RA 4NMLA 3TAQA 3D67A 4YEAA 2IA6A 2ZH9A 1VCTA 2MKSA 1HR0F 1FJGJ 2UXCJ 4F02A 2RF2B 1KQKA 4H4KA 5E5NA 5ETPA 3TWZA 3TANA 1N54B 4KSEB 1J5OA 1IBKJ 2IHR1 3DLKB 2W9AA 2ASDA 3HM9A 1FEHA 3TA2A 3JAMY 2HYIB 1BD6A 5KFIA 5CA5A 2D3OR 1PJ5A 2E9RX 1OYEA 4IKAA 2YX1A 2Y0BB 4GC7A 3V6DB 1FK9A 2LFVA 2A18A 4LBHA 3C3LA 3HSJA 3KFWX 1T9WA 5KT7A 4LREA 5H1SV 3E2EA 3QO9A 2EFQA 2ZDOA 3EMTA 2C2MB 3DLJA 2B43A 2XMWA 3QT5A 2BRKA 4EO6A 1RWWB 2BVZA 3DU6A 3NBPB 4C6AA 1JLCB 2CJKA 4ELUA 3WZ0A 3OTBA 1SPBP 1UA1A 1M1GA 4B17A 1DTQB 5EDWA 1LWCB 1V5IB 1A6LA 4CYUB 4DPUA 2D69A 2N3OA 2DNZA 1NPPA 3LW5C 5JXSA 3RBEA 2CZ4A 2KHDA 3HF5A 3I87A 1OYDA 2AIRB 2IM3A 3LGMA 4ZN1A 4M8LA 4WIIA 1YHQS 3A8KA 1U1KA 4DHVA 5IM0A 1UWAA 4ZVHA 2ZBQA 5JVHQ 1XR6A 2H9ZA 3BEGB 2O66A 4XTTA 4IUFA 4E2FB 3HSZA 2VBXA 2ZUGA 2XYPB 4X4OA 1GMUA 3KMSA 1SKRA 2UUAJ 1DHMA 3PYFA 3M05A 2G13A 1B0TA 2NS1B 2QA1A 2XMTA 2ZKTA 4OZ5A 2QLFB 1T95A 1AYEA 1MN7A 5F8JA 4P6QA 1WI8A 4CLUA 1DJ0A 4I7FA 1FD8A 5FLXU 5AE2A 2Y1IA 4RNOA 1YZ6A 2AGOA 1Y5LB 4QWDA 4ZLNA 3HHKA 4KFBA 1RAGB 3VAIA 2ROGA 3GE9A 3UE2A 1NJXA 1QAYA 4FF1A 4LFBF 3PZPA 2HBYB 1QUPA 2R8KA 3R1LA 4JV5F 1X9SA 3SFUA 1ZAXA 1LEOA 2GX8A 3TZYA 1NU4A 3NGUA 5AE3A 3EZ5A 4IH5A 1LW2A 1U24A 2EFGA 1K8AT 3ILOA 4JI4F 5LM7E 3FVYA 3CGIA 3VF0B 1RAIB 1NJWA 2J6UA 2YQ1A 1U1NA 4ECSA 1FDAA 2XMUA 2AT1B 3N01A 3PO4A 2F65A 3LAKA 4DV0J 3T1HJ 1RLDA 1S0NA 2DRAA 3GPAA 1FK9B 2XMJA 4PXCA 5J1PA 1T8EA 4DQQA 1ZAWA 1IKWB 1YG0A 3H0PA 1YRXA 5BXIA 3OXGA 3Q24A 5LMNF 1WI6A 3JTNA 1L3UA 4XAKA 7AT1B 3DLGB 1HI0P 1JK9B 1VGYA 2XZWA 1FTCA 1VRUB 3IBCB 4PABA 4ANCA 4F0MA 3J81Y 3K59A 4DV7J 2LQBA 4NLXA 5ETRA 1ZBTA 4EWTA 3OPKA 3I0SA 3AA9A 1EIYB 4DV1F 4I68A 4UY85 1NO8A 3C6UB 3I32A 4NLYA 2DCUB 4YP3A 1P27B 2G9OA 3CD0A 4OFZA 3AODA 4P52A 2XMAA 5HBMB 2KFYA 2R7XA 1Q8LA 5C42A 1S1VA 1JKHB 4DI6A 4DU7A 1RT2B 1JLCA 2XB2D 1UEVA 3SSSA 2M5YA 1RI7A 1GMWA 3Q8SB 4B9TA 2I2YA 5H9FK 5E3CA 1N36J 3QO9B 2MZ1A 2XYGB 3NAHA 2M3DA 3KJFB 2BEFA 4QR0A 4C8NA 4DPWA 3V6DA 3B4MA 2G0CA 1RSCA 2OELA 3MHYA 2HQCA 1K1QA 2BJDA 3TW0A 2K2PA 5HMXA 4PUOA 3FFIB 2B7CB 2MPUA 3FEXB 4K2JA 2QL5B 4NCAA 3M6UA 3ZZ0A 5A0YA 1TKXB 2GIFA 1YJWS 4K4ZA 2NXNA 2CPHA 4AL7A 4DV2J 2BV3A 4I56A 4FN5A 2JX2A 3R9LA 5IZHA 2GNKA 1HYSB 2R8JA 2XLKA 3LWMA 2NUUG 4IFYB 3MEGB 4QIFA 1QDUB 1Z2LA 2MGZB 2XGQA 1U2FA 4ZVFA 2VJUA 1IQZA 4ZHRA 3I56S 1OSCA 4A48A 2QN6B 2YNGA 1Y00A 2MQ8A 1FFWB 1GXTA 3HT0A 2WSFC 4RW7B 3KLIB 5G4DA 1GMVA 3QJPA 3IRXB 2FJXA 3HHDA 2AZ1A 2IM1A 4LRDA 2YNFA 3K7RA 1RU2A 5K14A 1ZZFA 3RW6A 4OYIA 4QZVB 2FVRA 2EWHA 1DLOB 4RX6A 3EPIA 1RT1A 4ZPAA 3RB4A 3D2WA 4HHJA 3R7NB 3IN5A 3A3NB 2WRMA 4GVBB 3W60A 3D1OA 2DGVA 4WU2A 4KHMA 2NZ4A 2ROPA 2KTQA 2O3DA 2OKQA 1T7PA 3TA1A 4BBYA 2ZOMA 2V4QA 2IVYA 1O6XA 1PJ7A 4OX9F 1JQGA 3OFFA 2CJBA 3QSYB 2DNPA 4R8UB 4PEOA 2WSCC 2V4JB 2VFSA 3C19A 1JNRB 3DOLA 3CPWR 3BGLA 2ZM6J 4Z7CA 1T9TA 3AJDA 3DLBA 2J0WA 3M8WA 4J9OA 1IBLJ 2GHPA 1XR5A 1IWGA 2WOMA 4U7CA 2K06A 3FBCA 1UA0A 1WNEA 2B4PA 1HBNA 3KNGA 1P9QC 5J1NA 1BUXA 1HNWF 2ERRA 1IBKF 1WG5A 1I94F 2HVZA 1Q0NA 3B78A 2J8AA 4R5PA 4TU8A 1XBWA 2FYXA 5BR8J 4KHPJ 1OWXA 3QGPA 3W9HA 1TR0A 3MMCB 3SCJE 5CCLA 4DV3J 3K17A 1WC6A 3G8QA 4ECRA 1UTAA 2AZ3A 3N6LA 1L3KA 1Q86T 4USWA 3EGVA 4K59A 1V9OA 2ZNYA 3M6VA 5KFKA 3JSMA 5B0EA 4CH0S 5EWFA 5DLGA 1NJZA 3DLEB 4O4RA 1RWOB 2E1PA 4XDCA 4UF4A 1SH3A 3U7JA 1RGVA 1M5KC 3HVRA 4TVAB 4IG3B 4FXVA 4Z37A 1FT8A 4LFCF 2WCXA 1WOSA 2C3UA 2ZJPQ 1S1WB 2AF6A 3PYDA 1Q81T 1HBOA 4Q8FA 1U47A 2U2FA 1M90T 1FRMA 4WFNQ 3MOJB 2YKNB 3HFZB 3OTCA 5F0UA 4V19J 2IVMA 4OJGA 1SJ4P 3W5ZA 5JUMA 1JLEB 2QFJA 2OI2A 3EGNA 3KK2B 1FWPA 4DV5F 3HCXA 3AQOA 2JFDA 4RJVA 4WFZA 5J2PB 4ELTA 3EVMA 4Y65A 4ZCLA 1FVQA 2VBYA 3NGKA 4MYUA 4DSEA 2V2KA 4HL9A 1TUGB 2QLBB 2YTCA 4QYRA 4CO1A 2GQCA 4DUTA 1HBUB 4J9PA 2GV1A 4CO4A 1VISA 3TEGA 1AUDA 3QYYA 4RKUC 4WK3A 2G2OA 3DLHA 3R97A 3TAMB 4NRTA 2H48B 3KUGA 3MM5B 5LOQA 2DHHA 4QCLA 2ZBPA 2DNGA 3W2VB 5F8LA 4DR6J 4UOGA 3W64A 1GK8A 2ZUAA 3MPWA 4ZPTR 3T9NA 3MFHA 3PXGa 2C2OB 3MD1A 1U02A 4HI2A 4K5SA 5ETMA 3ENVA 5BYSA 2ZBRA 2QTWA 3HP6A 3F73A 2V8GA 1YQHA 3GIRA 3M8PB 2DY1A 4ZPWR 4F2SA 3MM9A 3MMAA 3GJQB 1VQOS 2IPOB 3DC2A 1CJVB 2H3EB 3CIZA 3C14B 3UD3P 1IN0A 4DR3F 1BXNA 1UW4A 1YRTA 3D28A 1LK7A 4UT4A 4X4PA 2Z56B 1QTMA 1KNZA 2DNOA 2GVZB 1HR0J 2UVUA 2ASJA 3I31A 2BACA 3VAGA 5B7WA 1X5TA 4YFUA 3J80U 1Q8KA 5IQ6A 1IJEB 1S57A 3GZ7A 4NXNJ 1JXVA 4M63A 4XDDA 3NOGA 1ZM2A 2UUCF 1YI2S 4DR2J 1U1LA 4X4VA 1SBRA 3QSIA 5A8KA 3S8SA 3QZ8A 1KOOA 3GIJA 2C1EB 4DX5A 4DFKA 1N32F 3R5GA 4I2PA 5J1EA 5KFVA 1XMBA 5KG5A 2DPJA 1WHWA 4A8OA 3KJVA 2DO4A 1KQGB 5CD4H 3P5BP 3M2VA 2ZD1A 2ALZA 3M8PA 1ROFA 1C0UA 1RBAA 1ZETA 4L73A 4TLQA 3CVKA 2XMKA 4ID5A 5I3QA 2V9KA 2DH7A 2C42A 5KFHA 2MKKA 1FJ7A 3V81B 3QGGA 4MK9A 4JI6F 1UFKA 4JI8F 4OZJA 1UKUA 2VFVA 3BZQA 4KV8A 4OIXA 4ZPDA 1G6BA 4ILMA 3MM5A 4L3KA 4WJBA 2M88A 5KFSA 2ZEJA 3D1HA 3R5JB 3OL8A 4B3RJ 4WKRA 1UFLA 2VDIA 4LBIA 3BO3A 4LSNA 3VAJA 1WC0A 1WG4A 2L41A 1KFSA 4KBIA 3W2WA 4C3MA 3T5JA 2OP5A 4YDXA 1VC5A 4PPZA 4F04B 2V5HG 1HW8A 1R27B 5F8MA 4I6WA 1VS3A 2JEGA 3V4IB 3DGVA 2V4RA 4UQTA 5HN0A 1YTYA 4QU7A 3CC7S 2HLTA 1BQNA 4PG7A 3KLHB 2W2NP 3F44A 4A4JA 2RS8A 5EHHA 4BLGA 2V6AA 2NQPA 1LWXA 2MQOA 3A13A 4C0BA 4DOZA 2WVEA 5CH7B 1WKLA 3MM6A 5KFCA 1IUJA 1DAXA 1FX2A 3AD9C 4F3MA 3NGDA 1MMLA 2KT5A 3S7RA 3WIVA 4L76A 3MR3A 4DR5J 1NCLA 3SZ2A 5KFOA 3MUTP 1S1XB 3E51A 1SXLA 3MF5A 3TZZA 2JNJA 4UY8T 3OFHA 2YY3A 5KG6A 4V19X 1YJVA 2LU2A 3UPFA 1KC8T 4ZJOA 5D6GA 2W01A 4OI1A 3DLEA 1Y7PA 3BPDA 1TL1A 2NXEA 4FPIA 2V63A 4OX6A 2DT9A 4RNMA 2Y8WA 4Q45A 3NY0A 1YJ9S 5EX3A 1NJYA 1TP7A 3GR1A 3OFEA 2R2RA 2CNKB 1IKVB 1T9UA 4CO0A 3M6WA 1S0OA 2VJVA 1DQ8A 4X4RA 2JJ4D 4WZMA 3D6MB 2BABA 3IWXA 4JI1F 4QJVA 1FJEB 3Q8YA 4NLVA 2LQ5A 3IRXA 2OGUA 3BBCA 2MMYA 3W1YC 1XJWB 2AEMA 3KK3B 5IT9U 2V69A 1S6PB 3UDEA 2B0GA 2FHMA 3MURP 2DNLA 4DV3F 2HHVA 2HZCA 4ZJLA 4X84A 3M9OB 4J9QA 3DOLB 2HZVA 3L09A 5ETKA 2X1GA 3IR7B 3G6XA 3W66A 1HNVA 5HJXA 2HRYA 3KK3A 3SV4A 4MIBA 2VKRA 3Q83A 1VC6A 1M5VC 1JJHA 2CPEA 2KXNB 1FDBA 3POTB 3H4DA 2EVZA 2J9DA 3FRZA 3M30A 1FRJA 1SV5A 4I1TA 5B0DA 3KLHA 2NREA 2BJ1A 4H4OB 2DK2A 2A2CA 2KO1A 4DG1A 2HHHJ 2CPXA 1DLOA 2RAQA 4R0JA 1O8BA 1RT4B 3DDKA 5F9NA 2IBKA 1RTZA 3IC1A 2QV6A 4A8XA 1TZ0A 2DGWA 2R7OA 3NXZA 2CDQA 4CP5A 3VAKA 3UVJB 3V6KA 4NZ6A 2J0XA 3V81A 4PRFA 2W24A 1U2CA 3IM8A 1CS4A 1QM9A 2L9WA 1S6UA 1HLWA 2CADA 5F8NA 1JMTA 1QTNB 3BQ2A 3VZIA 2MKIA 2J0SD 1ELOA 1JJ4A 1UVJA 2I38A 3NMRA 5AXLA 2JC1A 1BWVA 4DF8A 3R1HA 1F9FA 5L1KA 3QAUA 4LF6F 3BO2A 1X5PA 3EXCX 3EXYA 2VPXB 5LMUF 3RAXA 4FF4A 1TAUA 2L3MA 2YKAA 3C6UA 1Z1ZA 2LA4A 5A8KB 2JLEA 1Q95G 2U1AA 4LSLB 1RABB 4MKBA 2GMLA 4KIAA 1X5OA 1EP4B 1H72C 4N47A 1S97A 3HJFA 2IC3A 2MQNA 2W2OP 3H90A 2R8HA 1R7IA 3QZ7A 2I6WA 1HD0A 4ELVA 4ED6A 4X4QA 2AMCB 2MB0B 1HA1A 2CIMA 1YIJS 1SJRA 2I9SA 3MD3A 5DG8A 3NLCA 4P2MA 2KXFA 2X1AA 5GMKa 3KDNA 2DRBA 1JLBB 1NBEB 3H59A 2HVHA 4ZPVR 3PFEA 2ZFHA 5CYJA 1XMQF 1WDTA 2V2VA 4NASA 3NS5A 4FXWA 4M94A 2CJYB 4PG5A 3FKBA 3B82A 4G1IA 2MKYA 5K5MA 5ETTA 5K8MA 3C14A 4Q0BA 3QT6A 3ZTSA 2XMMA 5ADZA 4U6PA 1L3TA 1KOHA 3MMAB 2C2RA 5IXUA 4W90B 3MCOA 4DX6A 4P10A 3D9BA 1JLFB 2CWXA 3NCRA 4F26A 1JJCB 1P9YA 4UUXA 4X65J 2HVEA 2KH9A 1QVGR 4JI4J 4EZ9A 4EBDA 1QUVA 1S1TA 4DQPA 2BW7A 2J9DE 3M8YA 4V1Ak 2PI4A 5A6WA 4M5JA 3AJ2A 2KFZA 3D0GE 4DEZA 3EGZA 3BSCA 8RUCA 1LWFB 2CPZA 4MIWA 2P6TA 3CJ5A 2AQ4A 2NYHA 1OQ6A 4XPEA 4RW4B 4FBUA 2DH9A 2WW4A 1IQTA 1W26A 2YQ0A 4F4YA 1RWMB 1TFYA 2OUGA 4LF4F 2OTLS 2B9WA 1RAJA 2OPSA 4LFCJ 4K0KJ 5KT4A 3KWMA 3TJAA 4L3NA 2N7CA 2KI2A 4BC7A 2NSCA 2GVDA 2SXLA 4KGKA 1OMSA 2KXHA 3RAMA 4NA3A 3DHXA 5I3UA 4JBCA 1BLUA 2B56A 3Q89A 4OI0A 2VG5B 2O1PA 1AA1B 4C7QA 3HFKA 5FDLA 4NI2B 2XZTB 1S6QB 3KYLA 2YKQA 2B8PA 2E5JA 4C97A 1S1WA 1NH8A 3KUEA 5CZVA 4PG6A 4K4VA 2UUBJ 4Z7YA 1FO1A 5DQHA 1RAOA 2B9XA 2FJVA 3T6BA 2VF3A 3MR5A 2CNNB 2WB4A 2BXJA 2CJQA 4USKA 3VR1A 3LF0A 3U02A 3P96A 2KJWA 2Z57B 4D3GA 3DLKA 4B3MJ 1H2VZ 2YH1A 1IKYB 3L9ZA 1U4BA 2HQ3A 2GJIA 2HWTA 2RF2A 3POTA 2DKOB 2MHNA 2WOMB 5DZ7A 3LPEA 1WG1A 5AJ3F 4EYHB 4AQYJ 3GCXP 3PHTA 2ZKUA 5DRKA 3K57A 4JOUA 2WZ1A 5H9FJ 5HP1A 1ZS6A 3MM7A 5LSOA 1RT7A 3RB0A 1YZ7A 4G1PA 2GAHC 1SKWA 3CCWA 2VQEJ 2YBVA 4DS4A 1S9EA 1S6PA 2V8DA 4IO9Q 2V4JA 2HQGA 4F4WA 3MECB 2OPPB 1SUQA 2EI5A 2ZC4A 1FKPA 3A3PB 2PFDA 3GYGA 1TKZA 2IAJB 2CPDA 3JSMB 4X66J 2AGQA 2XHWA 4PWDB 2W25A 5THWA 4B9NA 1VBYA 3PR4A 1AZSA 1FF2A 4OYBA 1VBZA 1KONA 1NSAA 1Z4UA 2CPIA 2VU5A 4MYTA 1Y3KA 1S7HA 2DEJA 4YB5A 5DZ6A 2FGOA 1U26A 4F0HA 5A2QY 3IS9B 4QIEA 1OPZA 4B3MF 4I64A 4FKYA 4P9SA 4CT8A 1H2TZ 3VALA 3HDSA 4J9RA 2WW8A 2KYXA 4ER8A 2DHXA 1ZM9A 1FERA 4OHYA 1W7WA 2J5AA 3MI7X 2UZAA 2CFXA 3BGUA 4ZVOB 4F4ZA 3KLIA 3U27A 2IJNA 3NWGA 3ULHA 2VHGA 5L9XA 4EFAC 1H98A 1R89A 2Q1LA 2QL9B 1NK0A 3LA0A 4JI0F 3NP5A 5DQGA 4OV1A 1LOUA 3M8ZA 1NH7A 3MEGA 3U1NA 4OYWA 2RU9A 1UP1A 4A47A 4I6YA 2Q79A 3AY0A 3BGOP 4NLOA 9RUBA 1HWJA 4J7CA 4U67Q 3DOMA 3J7YI 2VONA 1AW0A 4N7TA 1HNZJ 3MEEA 2LMIA 1IM4A 4ITSA 4F4AA 5IS2A 1RADB 5EGYA 1MMDA 1FWKA 3OTOF 3PX4A 1NKEA 2WBRA 1K44A 3OJUA 5KG2A 5LJ5Y 2HG4A 2KFNA 3TUIC 2DTJA 1FXRA 4OX8A 3RZAA 2CVEA 3MECA 2PFFB 1BMQB 2RD5C 1RTIA 3GU0A 2QL7B 2FDNA 2RT3A 2AX0A 1VQ7S 1Q7YT 3EVOA 1UVMA 2BX6A 2XGPA 3DOMB 1NSQA 4IFYA 4CLLA 2VBWA 2FLOA 4ZLJA 3OTOJ 5IV3A 2BQRA 1F5AA 4NXMF 1U6BA 1WF1A 4ZMMA 3CWJA 2VIHA 1WF0A 3R7BB 5SUHA 1JLQA 1HIYA 1Q8IA 1TKDA 3WC2A 4O4GA 3BYRA 5B0GA 4RW6B 2UUWA 5B0AA 5KFEA 1TK8A 4OL8A 2UU9J 3DI6A 1IKYA 2MKJA 2HVDA 3DRSA 2XSJB 5LSLA 3KLEA 3GONA 3UDCA 4Q44A 2XY5A 3R2CJ 4DL4A 3KG4A 1I3OB 3M2RB 3M7VA 5ETLA 4C8MA 4EUVA 1N34F 1KQSR 2CQ4A 3FJ2A 3GCWP 1PSDA 1HQEA 3NG8A 3IBFB 1RKIA 4QR2A 5AXMA 3OR2A 5C5JA 2YX4A 3B8HA 2BANB 2ABYA 1EQMA 3H40A 3HK2A 2KHCA 5B0BA 1FA0A 4LVOP 4Y2CA 2CXEA 1F5CA 1TL3A 2HNYB 4K0KF 5F0WA 3ISNC 5HJYA 3OSNA 3BBBA 5HAOA 1BC6A 4DXLA 1I1GA 2FVSA 2DYAA 3I5AA 3UDLA 2RS2A 2GZOA 4LF2A 3BO4A 1PYOB 1M5OC 3D0IE 2YH0A 5HMWA 4X4SA 2YXLA 2B7BB 2LECA 2K3IA 1FNXH 4OYXA 1NMEB 3CC2S 2AP6A 3MXHP 3GG1A 3R5AA 2RIJA 2C2DA 1GXLA 2PT0A 1TUWA 2ZITA 1KVJA 1RHQB 4M1KA 3MPDA 3BDPA 1Y9OA 3PKYA 2MLXA 2AU0A 3PRBA 2ZBIA 3W2VA 1MNEA 3OXFA 5C24B 4YR3A 1PILA 2KL8A 3JYTA 2DR5A 1RT5A 1YJ7A 3AJ1A 2I5JB 3UCGA 4I4BA 2N4CA 3ZC4A 2MQMA 1SB6A 4HT5A 5BJRA 3BB5A 1GX5A 2LKZA 1UAWA 1KR4A 2FY8A 2HQFA 2VPZB 3JYTB 2EC0A 3MTKA 1OY8A 3T19A 1VQ8S 2OIHA 4ZS6A 2DXDA 1HARA 4CI0B 5A8WA 1LK5A 3MMJA 3ELHA 1AUSL 3ENQA 3HZGA 1GEHA 1DZ5A 3E8OA 3HULA 3AOCA 3PIOQ 4LF5F 2VFRA 2YKNA 3RB3A 2ADCA 4C8YA 2HWHA 2I8EA 2OMOA 3SQOP 2OPQB 1GAOA 3MR2A 3RRGA 5D4PA 1YJNS 4KGXB 2OPRB 5GAEU 4U7UD 5K8OA 3IGVA 4ZP7A 2PE8A 4RZRA 3CCLS 1N33F 3W62A 2DH8A 1RXOB 1FRIA 1O51A 2NXUA 2ILZA 2Y3YA 3C6TB 2J7WA 4DPTA 3PR5B 3MCNA 3GFHA 3VVUA 1NB7A 1FRXA 2C2NA 2LP4A 3W3SA 2COLA 3W9IA 3TX8A 2IC3B 1WSVA 1X5SA 2VBZA 3D66A 3CD7A 2IRXA 3LO3A 4X4TA 3THVA 2HHTA 4ECUA 2BE9B 2L08A 3G82A 4IDKA 3T5KA 2BA9A 3ZO7A 3HHEA 4JYAJ 3JQJA 3UNYA 2HW3A 1S4EA 3D0HE 3N9UC 1HBNB 2JZ5A 3L95X 4QBUA 3QRQA 4O4GB 5HATA 3OFGA 2VH7A 2ZH7A 2DNNA 2G0IA 2HHUA 3EGWB 2KU7A 4URQU 3J80Y 3A3OB 3CJ4A 4JI0J 4NCGB 2DPIA 3GJTB 5D3GB 3C2PA 1RWPB 4NLRA 1IM6A 1KHVA 1KTVA 1LXNA 2B5JA 2O5DA 2ZDPA 2UV8A 3H98A 1HNIA 2B51A 2HFZA 4GO5X 1UMJA 2Q6BA 3KHGA 2XQCA 1RHMB 1RTHB 4M5IA 2XEXA 2GHWA 1RTIB 3PG9A 5I3PA 4WFBQ 3NKYA 3UVJA 1N5TA 2DY9A 2HGLA 2ALYB 4URSA 3PX0A 4OYOA 2FVPA 2GC8A 2UUBF 2BE2B 3I4HX 3LGHA 3IMQJ 4RBUA 2XBPA 4F0KA 3FZBA 4RUCA 5D77A 3MCSA 4J9SA 5H9EJ 2FPHX 1J5OB 3NS6A 2W2MP 4F4XA 3TQ1A 5KOWA 2AJQA 1FD2A 1NEEA 2QO3A 1ZA1B 3H8YA 4DL7A 5FJ4A 3BJYA 2M8HA 3BS9A 4MFBB 2G1HA 4LJMA 1RT3B 3N28A 2BM1A 3TX0A 3G4SS 5HMZA 3P6YC 1VRTA 1CJTA 3KK1A 5K8NA 1N5QA 3FSXA 3OTEA 1U6ZA 1VQYA 2UVVA 3OTDA 2IJRA 2CQIA 1IXKA 1N4LA 3M8QA 3BV8A 1TL4A 1SKUB 2A6MA 2GQQA 3M2UA 4LF4J 4O23A 3DCAA 2ZH1A 3CJQA 2FZGB 3TQEA 2M0GB 2OD6A 4MFBA 3EM1A 1F2HA 1B64A 1D9DA 2RB7A 3GJSB 4Y34A 4ZKAA 4DQRA 2E9TA 4K4SA 5E3PA 4K4YA 1Y11A 1S4FA 5D4NA 4NLGA 4DDFA 3F56A 5EUHA 2RMLA 3RBZA 4MKVA 5F9LA 4PXBA 1X31C 2FHKA 3H2UB 2AJ0A 3C8YA 3QIPB 1TKZB 2J0QD 4ZVGA 2BM0A 3FSYA 4MK8A 5U47A 3TVYA 4LR8A 3VGTA 3OHAA 4B9VA 1IBLF 1JXLA 2HSEB 1PJ6A 2R7QA 5K20B 4BDPA 4WPAA 2KM8C 1LW0B 1UWBB 3IP0A 2UUCJ 2XNRA 3QT7A 4EYIB 2CQ1A 3BGRB 4FF2A 1PGZA 2DGXA 5E41A 4EBCA 3LAMA 3WQPA 5AXNA 2CUYA 2F40A 5KFGA 4DX7A 1VK8A 1CJUA 1B0PA 2MJNA 3FNNA 4MK7A 4XPCA 1C4AA 4K7QA 5BYRA 2EW9A 1QY7A 2M4MA 4CLTA 3LP0A 1G7CB 2VB6A 2BQ3A 1VQ6S 2AHOB 3QFHA 2IRUA 3MM7B 1HPZA 1ZOTA 2GVDB 4ATNA 2XY7A 4EZ6A 3CD5A 4TY9A 3I0SB 4JUZA 1S6OA 4ETXA 2CQGA 4NZ7A 4HDGA 1MROA 2DGOA 5CZXA 2DJWA 1P1LA 1FX4A 1YX2A 2VFUA 2CQPA 4C9DA 4B3OA 1H7XA 2ZH4A 2KZZA 1G2EA 1IR2A 2W7AA 3GIIA 3T1YJ 2BJ3A 3J7Z5 2HHPA 4J9VA 2C2EA 5C24A 1R8AA 2DGTA 4KV8B 5KFAA 4YY3F 1TELA 2C2KB 3HHLD 3PJWA 5IT4A 1T9VA 1WHXA 3KLFB 4ETZA 4ZCIA 1N32J 2FJBB 5C25A 1VC0A 4E8UA 2V2ZA 3E3XA 3R5DA 4I6AA 1W25A 1Y5IB 2JHEA 4J9UE 4O0NA 5FDLB 3ZZUA 4N76A 3NMAA 3I82A 2H4YB 4ZIVA 1T05A 4DQIA 4RW8B 4XIUA 2CZ9A 1WTFA 2D74B 1TVRA 1RISA 4Q7AA 3ZZPA 4ECZA 1VBXA 2JFKA 3TO8A 1VQ4S 1PKUA 2HHHF 2HRTA 4NL5A 1CC8A 2RJZA 2RNEA 1D9AA 5HANA 3O44A 4ECVA 1DRZA 4UOFA 3K8VA 3PHEA 4WYLA 4O3OA 5A76A 5HL7Q 4QYZJ 4DX8H 3T3FA 2BANA 3IO1A 5GADI 4JI5J 4PXDA 4RW4A 4B02A 4TY8A 1N6QB 2ACMA 5DM7Q 1P1TA 2AEFA 1T11A 2GIQA 1EAYC 2H51B 5L9NA 1XNQJ 2DIUA 4CO2A 3WX4A 2GFFA 4ZN3A 1Y3JA 2V68A 4OMFG 2AWZA 3M1VA 4HTIA 2FB0A 2Y9HA 4AL6A 1TMMA 4GKKF 1ITPA 1SJQA 3IXQA 5M2PA 4X64F 3SV3A 3T5HA 2HS0A 1U7LA 2YQ3A 3HX9A 3H25A 4IOAQ 1IBCB 2CJAA 4LQ9A 2QLWA 1QJHA 1KHWA 4RL1A 3GB0A 2B8QA 4M5HA 4M5NA 1L5UA 3IG1B 1F9HA 4FZVA 1C0TB 1HNWJ 1KQFB 1NDKA 1LQ9A 2Q3PA 1D8ZA 2HWIA 4OZNA 4PG4A 1JXEA 2R42A 4FVCA 1X0PA 1VR6A 2XC9A 1N0VC 1VBKA 3UN3A 3L3CA 2IFXA 4PXEA 5F8GA 1MWQA 1D09B 2CAJA 4P73A 5KT2A 2VPWB 3CCQS 1XQIA 4GRSA 3THTA 4DV0F 3T1HF 1BQXA 5KG3A 4G1QB 1YRUA 3OJSA 4ZOSA 4P71A 5IWAJ 2POKA 5GMDA 3CNQP 1FNMA 1NK4A 4FBTA 4IRDA 1DBDA 1N0UA 3CMQA 5KG4A 4P2FA 5J2MA 3RB6A 1QLNA 1OO0B 4DF4A 1A0OB 2PMHA 3FRYA 4Y2MA 3DI6B 4RWXA 3RUBL 4O44A 4DG1B 3EX7B 1NK8A 2RQKA 3PY8A 2YX7A 4B9SA 1F2GA 4OI4A 2BKOA 1SV5B 1MG7A 2MSTA 4TKTA 3KK2A 1FXLA 1JLEA 1FFGB 3KLGB 2VOOA 7FD1A 2L48A 2RSQA 5ETVA 5DLFA 4DPOA 2W4DA 2Z2ZA 3N4WA 1RCOB 2HKEA 3B4DA 4KRWA 3OUYB 1C1CB 1UJ4A 1WEZA 2B3TB 4GKJJ 1QAJA 4NXNF 3H5XA 1TL7B 2KRRA 5SZTA 4F50A 3C15B 3DGPB 4USIA 1UL3A 2GIRA 4OZ2A 5BR8F 3D1QA 2ZZMA 5GAHI 3O2IA 1F1BB 3T1AA 3EDRB 1I94J 1RA7A 4USJC 2LEAA 4DFPA 1ZZNA 2VL1A 1CULB 3LGNA 4LF8J 1KN6A 2G2ZA 4DN0A 2BOPA 1ULRA 3PEJA 1Q5VA 4KO0B 4ZVEA 2UP1A 2DXFA 4L75A 2FQQB 1RT4A 1WSRA 5L1JA 1ZTTA 2NLWA 4RNFA 1S79A 4EU0A 5T14A 1S1UA 2DNKA 3FBBA 1AFIA 1BY9A 1PC5A 2IM2A 4USUA 3PIPQ 2JLFA 1FKPB 4UOHA 1X9MA 1NJIT 5C7PA 4JI7J 1HNVB 4MT1A 3HHLC 1R8BA 3M4XA 3R6LB 4TU7A 3OLBA 3WDOA 1F0XA 1Q5YA 4QOTA 2ZH5A 4DUZJ 2FIUA 3ZTPA 4LFAJ 2RH3A 3AD7C 5DETA 5KFXA 4B9UA 2HEKA 3SSRA 2DNQA 2Z2LA 2P8IA 3HVTA 2IBOA 4Q2LA 4DMZA 4DL6A 3CJ0A 3P45B 3QWUA 5HP1B 4CH7A 1VHFA 1VQ9S 2YKOA 2YWWA 2WSEC 4X62J 1SC4B 2W9BA 3BSNA 5KFQA 2DR9A 1QAXA 2O01C 2OFHX 4M5LA 1FKOA 5CXTA 1ACMB 1TQLA 2D7SA 3J7ZT 1DQAA 5ETOA 1FTRA 1HWUA 1TL1B 3R5CA 2F8HA 3ILLA 1RT1B 2JWNA 2QYCA 2X3GA 2EFPA 3A4TA 4BWJA 2XO7A 3QNWB 1PBAA 1KP6A 1TKTA 2OEKA 3I0RB 4YY3J 1D1UA 1RE1B 2Z0GA 2QEXS 1K47A 2GW8A 5T41A 4C8OA 1IWAA 3T1YF 3FSIA 1RB0A 2AEJA 2LQ8A 4U7UK 2KVIA 3G2XA 3W9JA 3GV8B 1D8YA 4JI1J 2EKNA 4WF9Q 3MAAA 4RWWA 3R27A 4KTQA 1RT6A 2QRRA 3WHIA 2FY1A 4LRCA 3CD6S 2EG2A 4WBFA 2VG5A 2HNDA 3A8IA 1WKKA 1RAFB 2Z8QA 4NE9C 2UVRA 1NK6A 3KNAA 3BM7A 1RT7B 2AX1A 3PYGA 1C1BA 4GO7X 3T41A 4ID5B 4TLRA 3K5OA 3MCMA 3DM2A 4O0IA 4I69A 2YKMA 2P6SA 4ZPCA 1RBOB 4ZVUB 3H5YA 4H4MA 2OTJS 1VLYA 5A6PA 4LF1A 1XWLA 2W9CB 3V2UC 3KG1A 4XO0A 2I0XA 3V4MA 2H1YA 1M0SA 3V4IA 3CJSA 1OY9A 1NDCA 4KT0C 3ENWA 3W2WB 3A8EA 3QPIA 4DR2F 4LF5J 3GWCA 3PCOB 1E6YB 2FTRA 2QG9B 1B99A 3OR1B 2PC6A 4ZVTB 2FC8A 1FRLA 3OVSA 2QT7A 4DV1J 3N0VA 4QPXA 3DYAA 3NGRA 4NYZA 1C0UB 3P8BB 5LSRA 3ISZA 3UQSA 2R7VA 5CAAA 1VHIA 3C15A 1CSJA 1V5VA 2KYZA 2NYIA 3DGPA 3P4UB 3TVZA 3MUVP 4JI3F 4ERDA 3RR7A 1E6VB 1PBUA 2BRLA 3LALA 3GR0A 2C22A 4DR4F 3JTPA 4ZITA 2MKCA 5BYQA 1Q16B 3MM9B 2LA6A 3QLHB 4R0EA 1S9FA 5KG7A 4UUWA 4USHA 1HI8A 1N56A 3RR8A 4CH1A 3IAM9 4F2RA 5K8PA 2FC9A 1HWKA 1Z2ZA 2QA4S 4QU6A 2BBEA 1FKAF 1IBMJ 2JVOA 1L3VA 4NLTA 2UXDF 3N6NA 4N8OA 4F67A 5IV4A 2K1RB 4DR1F 1MU2B 2GAGC 4OYAA 4LF7J 1S9GA 4DCPB 2EEYA 4L72B 5DDPC 2MSSA 2OFGX 4OI3A 3JSYA 4TY8B 4A8SA 4K4WA 1U45A 2ZOFA 3VHQA 1R0BG 2DCLA 2K8GA 2QC3A 3DDNA 2K1RA 4CNZA 2VKZG 5E33A 2V94A 2UV8G 5C2CA 1T03A 4B3SF 1U6FA 1VRQC 3OLAA 1CJVA 4N77A 1Q7LB 1HWIA 4HEA9 1TMJA 4LSLA 4ANDA 4U95A 2GVZA 5HQ8A 5KFTA 1RHRB 4NYOA 4K8RA 4DV4F 4K5RA 1C0TA 3QQCD 3ZTRA 1R8HA 1E6VA 2M9KA 4XK8C 5ITHA 1OJ4A 4QW8A 2VQFJ 4OHVA 3UN5A 2Z30B 3P3DA 4HI1A 4IQXA 3U1MA 3ETOA 2IJFA 2VG7B 2J8SA 2CVIA 1YK9A 3AB4B 2HNZB 3AHPA 4ES1A 3KMQA 2JEFA 1M5HA 2CYYA 3W5YA 3OW2R 2QSFA 1PAEX 3S1TA 1JLBA 2HURA 3CIMA 3M9NB 2C28A 1U0HB 3HT3A 2KJVA 1JJ2R 1YLXA 1BQMB 5FLXY 2D9PA 6FDRA 3PFOA 5KFRA 5DGBA 2EFVA 1F9EB 1WHVA 3GLJA 4LRBA 2PI5A 1VJQA 4LF7F 2YWFA 2CQHA 2RHQB 3TEHB 4BC9A 4WU3A 4Y28C 2GO8A 4ECYA 3G9CA 3JXOA 4UZCA 3CJKA 4DR4J 1PC4A 4ICLB 5CYMA 3D6TB 3ET6B 3UW1A 2XZDB 1QSYA 4RLEA 1HBUA 3N79A 2FLNA 4U96A 2DHGA 5IM0B 1LFPA 1FVSA 3CDEA 3M30B 3R5BA 1WTBA 1FE0A 3Q2TC 3D3BJ 1EKRA 1KD1T 1WACA 2RRBA 3FC9A 2RQ4A 4KHPF 3DKDA 1TUVA 3CO0P 4AE5A 2K3KA 4ALZA 3CJ8A 3HJVA 1D3WA 3BH7B 3O6QA 4WFYA 4Z2XA 1X7VA 2EK6A 2ZHOA 4YB1P 4ZCKA 2BE7D 3K0JA 3BQ1A 2GGPA 3C16A 3W65A 1CS4B 1GTEA 1WF2A 2X3DA 2E5IA 2J6TA 4QQBA 1RWKB 3SQGA 1H0HB 3H7HB 3BN4A 4EEYA 3FBFA 1PCAA 3CSKA 1N52B 1DFDA 2F7VA 3NEKA 1RHKB 3MGJA 5IT0A 4ENOA 2A3JA 3SCKE 1N88A 2DD8S 2LQJA 2CQDA 1GFWB 1VQ5S 3FUYA 4X4NA 3RBXA 2PIIA 2NPIA 4WTYA 1HYSA 2NUHA 1YJUA 1YVFA 1YSJA 4QWEA 4HLBA 1WKJA 3ZZRA 1F3VA 2AJ1A 2CRLA 1M1HA 1HPZB 2V50A 1BWEA 3UCZP 1VQSA 5AXKA 3KHLA 4R8UA 2J7KA 4RW7A 2JC0A 1HD1A 4HTJA 1H2UX 5DQIA 3RU0A 5KFNA 3PO5A 1VFJA 5ETQA 4FYDA 2DGQA 3M8QB 1TK5A 5D78A 1EKSA 3CCZA 3WC0A 5D0GA 4DV7F 2QYGA 2ZJRQ 4A8FA 1SVDA 5EX0A 2MGZA 5LMUJ 1RZMA 1UEKA 3K5PA 1MMNA 3KLVA 1QSSA 4RU2A 5E2QA 3TYTA 3F0NA 5HLFB 5LJ3Y 3DOKA 2PEBA 2Y1LB 2ILYA 3EZOA 3O8WA 4GVBA 4KH1B 4KE5A 4IR1A 3OVBA 3NGSA 3FCHA 1TL5A 4MTPA 1UFWA 2F9DA 2XCPA 5IFMA 2AYEA 2C3PA 3G6ES 2YNFB 4ZA1A 2OO4A 3NGTA 4KGZB 1NSPA 5LL6d 2G0JA 4KJIA 1QSLA 2BE2A 2ADBA 1UJ5A 1R8CA 2HFNA 3CT9A 1Q78A 2AKWB 4IR9A 1M1KT 3HHNB 2HHQA 5KG0A 3VV2B 3FEZA 4KPYA 5HQLA 2QA2A 4JI7F 2P5VA 2B4OA 3DMJA 1HI1A 5GAGU 3HVTB 2XY6A 4LRFA 2IMWP 2XM3A 3HHLB 1I5OB 1XIQA 2DNYA 3GIMA 3UCUP 2RDIA 2HPUA 3OUYA 3CUNA 2VASA 2PSZA 3M32A 5CABA 5E3AA 2Y1RI 2HS4A 3SSQA 4CLYA 3KJQB 4WYWA 1U1QA 5CQGA 3OBIA 4O44B 1HKAA 1RT3A 3TP2A 4DV5J 2M8DB 5F41A 4CO5A 3I55S 2E9ZA 1RK8A 2OSQA 5A2QU 2UUAF 1HBMB 2HS3A 2CJXB 3VGUA 4DV6J 3WIUA 5DM6Q 4DR1J 2V9WA 4F8RA 4CLFA 5KT5A 4X66F 4G1QA 3ZZZA 1RU1A 5KAKA 5DDRC 3PACA 7FDRA 3NAIA 1X0FA 1EB0A 1XERA 2FLLA 4B3TF 4CRJA 2J76E 3CCTA 1JLGB 4P7VA 3C6TA 4OYPA 5KFYA 3TJ9A 5DS7A 1S59A 3WBZA 1X4EA 3L7UA 1RTHA 2NCKL 1RT2A 2G2YA 4PZVA 4QIGA 1KTQA 4FYWB 3IG1A 1UZDA 2FGCA 3ITHB 3RGIA 5KFMA 3TAPA 4Y3CA 1FJCA 1S72S 1Q1KA 1SCJB 1XMOF 1V3SA 2D9OA 2BJEA 5IWAF 4QWCA 1S77D 4ZLPA 2X1BA 1RBLA 2MEWA 4P7TA 3GFYA 3NWRA 3AQPA 2B9YA 2IM0A 5HQMA 2XWXA 4M95A 2ZE2B 5HSPA 4Y2KA 3AXKA 3I4PA 4DV4J 2ATLA 2FLPA 1VJWA 4JB8B 5CHCB 2XSFA 3AH6A 3K58A 5L1IA 2ZM6F 2J7UA 4ECWA 2KDOA 4C4WA 2DHSA 5KFJA 2HK2A 4OQJA 4NA2A 1W2BR 2E7WA 4QWAA 2HBQB 4DZDA 1U8WA 3VCDA 4DSFA 1RP5A 2EKYA 4RUBA 3PV8A 3LP2A 4NWBA 5IQQA 2ZH2A 1T9XA 4MH8A 5A8RA 4YMEA 2XG8A 4C3KA 4Y0FA 2PD1A 5IOLA 3PYEA 5G0RA 1TVRB 2DB1A 3PVXA 2C3YA 2IRYA 3BREA 5KFUA 4DUYJ 3PKMA 5EN1A 3RG6A 4USTA 3SCLE 2DGSA 4J9NA 3DRPA 3MPUB 5AT1B 3OL9A 2DRDA 1LW2B 2XTJP 4CYUA 1AT1B 1LXJA 1S5ZA 5C25B 2VG6A 5HROB 3CCVS 3FDSA 1X4AA 1DTQA 4I7FB 2DR7A 5LXYA 4PWWA 2R7TA 3GFZA 3V5RA 3KLFA 2NXCA 4KFBB 3HKZD 4J91A 4LT6A 4DL0C 2F4VF 3ZZTA 2HRUA 3KK1B 2BYCA 2JDJA 2Z2YB 1DY3A 3AFGA 4MJKA 5CCMA 1EHWA 2ZZNA 2KG1A 3G71S 4RNNA 2MQLA 1CJKA 3NS7B 2E1MC 4HHUA 2EXUA 1NK9A 2HZAA 5KFBA 3KOAA 1K1SA 1QAIA 3DFEA 4BS2A 2DISA 4DPXA 3EICA 3EZUA 1HQEB 1NDLA 2LLZA 5C2GA 2RDDA 2H5EA 3FCVA 1PYSB 1S7IA 3Q22A 2C3MA 5J2PA 4ANEA 4LF9F 3G8SA 6AT1B 3RW7A 8ATCB 1XNRJ 4CM0A 1LWCA 2VG6B 5HROA 3IM9A 4WFAQ 1ZM3A 4RW6A 1P8GA 3LP1B 3TA0A 1JLAB 1Q82T 2F63A 4YDDB 2FD2A 3ETMA 2H4WB 1NZAA 4YOEA 3CCRS 1HBOB 1IKXA 2LQ9A 3M6XA 3S6EA 3US5A 4DR7J 3ZNUA 4ZDNA 4ED5A 4HH0A 2YNIA 5KFLA 3W8GA 3VQTA 4CLKA 1S0VA 2CKWA 4IG3A 3CCSS 1J5EJ 1SC6A 1J5EF 2KT2A 4AL5A 2KN4A 2KKHA 3DXBA 2WK4A 3FQKA 1LWEA 2CNOB 3JSBA 4OJHA 3UD5A 1JLGA 2PEHA 4AXIA 4AUKA 5KT3A 1JWWA 1MW7A 3UD4P 4P74A 2MDAA 3TARA 4DSKA 4N41A 4JI3J 1SJFA 3D54A 1Q8BA 2JLGA 1MROB 2VUGA 4WFXA 4TN2A 1UW9A 3MTJA 5I42A 4QR1A 5K14B 2AGPA 2WVDA 4GMKA 1ICEB 1PIEA 5F8HA 2WHOA 2RVJA 3DRSB 3KLEB 3WX8A 3ICLA 3LP0B 2DIVA 4DR5F 2F8MA 4IFVB 4PWDA 2IVFB 4CLSA 1JLQB 3FCWA 4PYDA 3NL0A 3A1YG 2LXIA 4ZHRB 3M32B 2A6OA 1X60A 3I96A 4CWBA 4CDIA 3Q23A 3VQSA 5MAOA 4TQRA 4PQUA 1SL2A 3L4BC 1VLOA 1HW9A 1VRTB
chains in the Genus database with same CATH topology
1F60B 1XR7A 2RQMA 3RTVA 4ID8A 4OHWA 3RYLA 1N5SA 2P9CA 5E0OA 2E66A 3KHRA 1UVNA 3DXSX 2KRBA 2OAUA 3J7A1 4C0HA 4LIWA 4DSIA 1H3DA 3FFIA 2ASLA 1REVA 2Z2MA 3H4BA 5AE1A 1YWXA 1VIXA 2LCWA 4C8ZA 2DR8A 3DN9A 4PPDA 2E1AA 1RTDA 4IO1A 2VOPA 3KHHA 2HVIA 1X4HA 4IG0B 3MPVA 2KM8B 3M2UB 3FMWA 5D3GA 3MOZA 4Y00A 1GXUA 4CQ1A 3O3LA 1S9EB 2F9JA 1X4BA 3OQ2A 3LOUA 2OJ3A 1HWLA 2CJ9A 4DN9A 3CC4S 4IYQA 1G3OA 2BW2A 1AFJA 2XULA 3C66A 1UVKA 4ED0A 4OHZA 2GMHA 2ACYA 4I0WA 4X62F 2F1FA 5J2NB 4LUBA 3MFIA 1JNZB 4FPRA 5KFZA 4Q0BB 3HZEA 3D5MA 3DNCA 4EGLA 3G8TA 4MAKA 2IMOA 3I6PA 4OZ0A 2R2UA 4C98A 1LWEB 1SL1A 1X8DA 1D9FA 3TVKA 2R4FA 2DITA 3DOKB 1U48A 4NCBA 1WD6A 1FESA 2IAJA 4OZ1A 3I5CA 4JYAF 4NRUA 3BQ0A 1KVIA 1ZM4A 3QGHA 4PQUB 5KFFA 2HHXA 2FJEB 4ES2A 1JLAA 1WELA 1S1VB 2DNMA 5DGAA 2IA0A 1Q53A 2KT3A 4FVMA 2FUG9 2KB2A 1S72S 4NLSA 5A8WB 2HAIA 3LQVA 2P9EA 4H54A 1IQTA 1BGXT 2HQIA 1VOMA 3TOQA 4ED2A 1KSPA 2G4BA 1TV6B 1FJGF 2AW0A 2XWYA 3MEDA 1JX4A 3P5TL 4PG8A 2VC1A 2FJDB 1CG2A 1P6TA 1SJ1A 4G3IA 1FRKA 1SKSA 1NHVA 4NLUA 1O0PA 2D1CA 3P49B 2RRAA 2HMIB 3GYNA 2PGCA 4CTAB 2MZTA 3CDAA 2KZMA 3DU5A 5L39A 2YNIB 2J9EA 2NSBA 3MR6A 3J7YU 1S1TB 4IOBA 4FS1A 3VTIA 2N7YA 3LP1A 1O5JA 4WXOA 2UXBF 4I2QA 4LVNP 1HHSA 2D3ZA 3HLUA 1RKJA 4YR2A 1N48A 2CQBA 2CQCA 1SH0A 2MZRA 3BR9A 3Q8RB 4K50A 4Q2MA 5A8RB 2A10A 2OD4A 2CPYA 4D3HA 3KKFA 2OPSB 3LH2S 4OJ1A 5E7OB 2VPYB 2WAQD 1XEZA 3JTOA 3IFEA 2W4CA 3MEKA 3TRGA 3QJJA 1A9NB 3TUZC 3AB2B 1MWZA 2I5JA 4IRKA 3DHWC 1FE4A 1RT5B 3OR2B 2WONA 1R0AA 2VC0A 1SIZA 1X9WA 3VAFA 1NKBA 3BSAA 4FF3A 1S9GB 4BWMA 2DVIA 2W8KA 1MU2A 4E0DA 1VQNS 3V6HA 2EBGA 1K9MT 4JV0A 4KAIA 4KQZA 3NRBA 3MAHA 5HO4A 2HNZA 2R7RA 4ECXA 3PRDA 1JLFA 4ZP8A 2VG7A 2RDJA 2BR0A 4HT7A 5KOXA 2MQQA 3K5MA 3KG0A 5G0RB 4ECTA 4WE1B 4B9MA 2MY8A 4KKOB 3CMES 4YQWA 3CJ2A 1TL3B 2HNYA 1KFDA 2PA8D 2YKPA 3H5UA 1ZH5A 2QMXA 5CYQA 4K4XA 1T02A 4DS5A 5LT5A 1UJ6A 3OR1A 1RQ0A 4B9LA 3R3TA 5F3ZA 2QSWA 4NX9A 4BCAA 3OSPA 3C46A 3N5BA 3PW5A 2K7KA 4C0OC 4K4TA 3MZIA 1YITS 1HQUA 3ISND 3TNVA 1HFEL 2JEJA 1M5SA 2EPIA 2XS2A 4CT9A 4FNHA 2MQPA 5J2NA 1M5PC 4JV2A 4LQ3A 1NKCA 3H20A 4DUYF 3PDNA 1NRKA 4ZPBA 1F5BA 2DHAA 2MYFA 3ZZOA 1LV5A 1QE1A 5J2QB 4Q43A 2FVSA 4KHRA 3VZHA 3CO9A 1TFWA 2GHVC 3RAQA 1ZTWA 1JB0C 2UUTA 5FIIA 2RRNA 1XC9A 4N56A 2AYBA 4ECQA 1FHTA 4RNHA 4EBEA 3MDFA 2VQEF 1RT6B 3PJXA 1UETA 2YNHB 3PX6A 1XK8A 3DMJB 3MM8A 3IS9A 4DV6F 3BR8A 3KTQA 1URNA 1OPIA 4DLGA 4B08A 1U1MA 3MMBA 1B7FA 3IR6B 3PEHA 1REVB 1RWUA 5K9FA 3X3UA 2X51A 4DR6F 4IRCA 4CNYA 2FJWA 2MZQA 2MZSA 3CDUA 2PDAA 3E01A 1S99A 3I5BA 1N5YA 2M70A 2YKMB 1EETA 3FQLA 3NCPA 3OL7A 3DM2B 3T6JA 3HXMA 1U1PA 2V0NA 2R8IA 1X4CA 4QIWD 3CB4A 3HHLA 5I4MA 4HDHA 1NNDA 4K2XA 1Y5NB 2E7XA 2VA2A 1GT8A 2HNDB 1J2VA 1V3RA 1PO6A 1L3SA 4JV1A 2M7SA 3DRXA 3GILA 2MHEA 5JVGQ 2WBMA 3U1LA 2L9DA 3K5NA 1IBMF 1S48A 1T3OA 2UU9F 5I42B 2MZJA 1IKVA 3GSDA 3NNHA 3G6YA 2J9CA 2ZOGA 1R6YA 1T94A 1DARA 3L7OA 4MKYA 4YB6A 3BSOA 3F41A 3HKWA 1RA6A 3H5SA 3W7BA 1WHYA 2OPPA 5D8HB 1NHUA 2ZJQQ 3TR5A 1S6QA 4RUAA 3T5LA 1H38A 3EPGA 2FHJD 3FGVA 4PWUA 4TU9A 3UR3C 3QIDA 5M2RA 1I6JA 3TI0A 4M5DA 5L38A 1S1XA 3NCQA 2RU3A 5KFDA 1CPZA 2F8EX 5DG9A 1U2RA 4ZCMA 3BF4A 2GJ2A 1D0EA 3MPYA 1AXQA 4RW9B 4TXSA 1GX6A 4TYBA 2ZD1B 4GC6A 2CPJA 1KLMA 3I9ZA 2GO9A 1GQEA 1GNKA 4FNIA 4ZP9A 2JEGA 2CQ0A 3CDWA 4O3PA 4N76A 1XTZA 1BQNB 1TK0A 2RKIA 4ILLA 1HQUB 4DBQA 2E5LF 3CULA 1KLNA 5MLCV 4OHXA 3CCMS 3SQGB 2YWGA 2V8VA 5CYMB 1R3NA 3CJKB 5DDOC 4KR0B 4J9MA 4O3RA 2B6AB 2GGPB 4C11B 3SDEB 2B4UA 4N5SA 5D4OA 4KB7A 4O3NA 4DLEA 2DBBA 3Q8PB 1K0TA 4RBVA 4TYAA 4IH6A 2WB1D 4OZLA 1OSDA 1HL6A 5DDQC 4DSJA 2NR0A 2Q66A 4WZQA 3DRPB 2LXFA 4WXWA 1VMBA 4N8NA 3KLGA 2KG0A 1AROP 5I3UB 2XNQA 1HMVA 2ZH3A 2ASYA 2PA3A 1NAQA 2XMVA 1K0VA 2A1BA 4I2PB 5J1EB 1RDRA 2E44A 4ICLA 3PW4A 3RRKA 5KFWA 3LUYA 4HKQA 5T7LB 5J2MB 1QVFR 1S49A 2MJUA 2HIQA 1LWFA 2YWEA 4NOHA 4PR6A 2WONB 5FD1A 5LXRA 1DTTA 4OJ3A 3GIKA 5HI7A 4FXDA 2ZC3A 2EFOA 1BQMA 4DFMA 3PW0A 3SFGA 1VK3A 1V3ZA 2ZE2A 2GMJA 4HVZA 2R9LA 4E98A 4DL3A 1K73T 1X4GA 3QLHA 2RKIB 5DJBA 4FP9A 1VIOA 1C4CA 3ONQA 2D41A 2DNRA 2E5HA 3G86A 3SCIE 3OL6A 3CCUS 4X2BA 1CQMA 5GAHU 2R8GA 3ITHA 3SDEA 1Y4ZB 3PM9A 3O5TB 2LDYA 5B0CA 1T03B 5KFPA 2Q43A 4RBTA 1CQNA 4UQGA 4A8QA 2W4PA 1E6YA 2IYGA 5B08A 1Q4RA 4WCEQ 1CC7A 3ZZYA 4CTAA 4ED7A 4C11A 2XLJA 3CE8A 2B6AA 2CQ2A 2DO0A 3EYZA 5GVQA 3TAMA 4GKJF 1EP4A 1R31A 4H4OA 3CDBA 2JOQA 3SEOA 3QJLA 4YHHF 2AYGA 1CVJA 3H2VE 3DLLQ 1Q79A 3MWBA 1KS2A 4H4MB 3MMCA 4DL2A 3JSRA 1GH8A 1FCAA 1C2PA 4R5PB 4P2SA 1OS5A 4ED3A 1S10A 1RYSA 3UI3A 2BZ2A 3CJ3A 2N3LA 1KLMB 5GADU 4O3SA 1R8PA 2HFOA 3LANA 2WTFA 5IT9Y 4CCHA 2DGUA 2I1RA 3IRWP 2OH2A 1CEZA 2EK1A 4ILRA 2E1CA 2V8HA 3HI9A 2EFNA 2RILA 3BGRA 1S76D 2OLWA 3IGNA