2KXHA

Solution structure of the first two rrm domains of fir in the complex with fbp nbox peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
199
structure length
199
Chain Sequence
b'GAMAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(U)-binding-splicing factor PUF60
publication title Molecular basis of FIR-mediated c-myc transcriptional control
doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 45
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA01
3CCRS 2FC9A 3D2WA 2MJNA 3MUMP 2LEAA 3OW2R 2DNYA 4LIRA 3CCSS 3NNCA 2FY1A 2KRRA 4EGLA 2MKIA 3G8SA 2EVZA 3ULHA 5EN1A 2MYFA 1X5SA 2M88A 1Q82T 2DGUA 1KD1T 2LQ5A 3UCGA 3VAGA 2A3JA 3NMRA 2CQPA 1SJQA 4C7QA 1URNA 3EX7B 2MY7A 1UP1A 2E5GA 1QM9A 2DGWA 4YOEA 5LJ5Y 2MY8A 2AYGA 3MD3A 1X4AA 3CCJS 3I56S 1UFWA 2L08A 2MXYA 1K9MT 5FJ4A 2MZQA 1HL6A 3ZZYA 3UD3P 2YTCA 3MOJB 1M5OC 2NZ4A 3US5A 2RS2A 1X4BA 4WFAQ 4OZ1A 1OWXA 1WI8A 2OSRA 4WFNQ 1VQ4S 3BO4A 2CQHA 5GAEU 4FXVA 3HHNB 2MQOA 3CC2S 1IQTA 2HVZA 2DGOA 2DGSA 2AYEA 4QQBA 1SJ4P 2BZ2A 2RVJA 1M5KC 2CPDA 4F25A 2LXIA 1U1KA 2MQLA 1YJ9S 5DDQC 4W92B 3P5TL 2JX2A 1JJHA 2D3OR 5CYJA 5GMKa 2CQ2A 3HI9A 1FO1A 1XN9A 2XS2A 3UD4P 3MD1A 3SMZA 1VBZA 2RQCA 2I38A 2KHCA 2FHOB 2CQ0A 2AYBA 3CD6S 3FEXB 3LPYA 1OIAA 2DNNA 2YH1A 1VQ6S 3MUTP 4PKDB 2N82B 2O3DA 2DH9A 1H6KX 2KN4A 2EK6A 2DHSA 2M2BA 5D77A 1VQLS 3S8SA 2ZJRQ 2GHPA 3THTA 3MXHP 2LCWA 5GAGU 2RT3A 2DNGA 2XNRA 2D9PA 3VF0B 2VOOA 3EGZA 1A9NB 2MB0B 3CXCR 3G96A 1U2FA 1VQ8S 4V19X 3B4MA 3CCES 2DNKA 2NLWA 3SXLA 1L3KA 2YKAA 2HGLA 2HGMA 2DNZA 4Z2XA 4WIIA 4F26A 4TU8A 3R1HA 1NO8A 1WI6A 2E5JA 1SJFA 2LEBA 2XS7A 2M70A 1JJ4A 2OTLS 4C4WA 2X1AA 1FJ7A 1YHQS 1G2EA 5DDPC 4FXWA 2JVRA 3J7ZT 2CPXA 3G9CA 3I55S 1OO0B 2E44A 2KXHA 1YIJS 3BS9A 3G8TA 1YJWS 2OIHA 3EGNA 1ZH5A 1N8RT 2DIUA 4F02A 3VAJA 2DISA 1YWXA 2MGZB 2M9KA 2QEXS 2KFYA 1RKJA 2CQIA 2XNQA 1HD1A 2LA4A 5LXRA 2MKJA 1R8HA 5LJ3Y 2J0SD 4W90B 2DHXA 2LECA 5MLCV 1UAWA 4WF9Q 4Y0FA 3G71S 4WKRA 2JWNA 2KM8B 4WCEQ 1DZ5A 5JVHQ 2MSTA 1S72S 2CPEA 4IOAQ 2ADBA 2M4MA 3LQVA 1VQ9S 2LMIA 3CCUS 2L9WA 5LSLA 2XSFA 2U1AA 2VOPA 4J5OA 1WEXA 1WEZA 2RNEA 2X1GA 3MUVP 2PEHA 2KG0A 3NNAA 1U1OA 1B7FA 2MZTA 2F9DA 2KYXA 4BS2A 4QU7A 3CF5Q 2MGZA 3S7RA 3VAFA 1U6FA 2CPZA 1H2TZ 2CQDA 1P27B 2M52A 1X4EA 2KRBA 3RW7A 4CH0S 5DM6Q 5BJRA 3RW6A 2E5IA 5IFMA 2AYMA 2DK2A 2MHNA 2CQ4A 2DB1A 1NJIT 3MI7X 3VALA 2VODA 4ZKAA 1WEYA 4QPTA 3U1MA 2HGNA 1VBXA 1CVJA 2N7CA 2L41A 4CQ1A 2MQPA 1Q86T 4YB1P 1K73T 1U1NA 2CPFA 1WHWA 4TU9A 4IO9Q 1NU4A 2OJ3A 1JJ2R 2DNLA 1U6BA 2YH0A 3CC4S 2LKZA 4RU2A 1VQ7S 2XB2D 4PRFA 2D9OA 1WF1A 2XS5A 2DNQA 2JRSA 1VQKS 1X4DA 1H2VZ 2VONA 3CMAS 2ZJPQ 1SJRA 2LXUA 1FJCA 1K8AT 1FJEB 2E5HA 1U1RA 2CPHA 1H2UX 1U1PA 2FPHX 1HD0A 4C0OC 1WHVA 2MKHA 3J7YU 1X5PA 3THPA 1UW4A 1WF0A 3DLLQ 3CCVS 2ERRA 2MPUA 1VQPS 2CQGA 2G1DA 3TYTA 3IRWP 1N88A 2MKCA 2QA4S 5JVGQ 1VQOS 1QVFR 5HO4A 3CMES 4ERDA 1KQSR 1P1TA 1X5OA 2MZRA 1HA1A 5DETA 1RK8A 1D9AA 2K3KA 1WG5A 2EK1A 3VAIA 2CPYA 1PGZA 2F3JA 2DNMA 2MZSA 1YITS 1X4CA 5IM0A 4ED5A 2DGVA 2MZJA 1KOHA 2CPJA 1VC0A 1U1LA 4YUDA 3CTRA 3SDEA 1OPIA 2J0QD 2X1BA 2RUGA 1DRZA 2CJKA 1VQNS 2CPIA 4LJMA 5CA5A 2J8AA 2DNPA 2FC8A 2Q79A 2X1FA 4QU6A 1JMTA 2HZCA 1WHXA 2RQ4A 5DDRC 1X4HA 1YJNS 3UCUP 2N3LA 1WG1A 3U1LA 3ZZZA 2F9JA 3VAKA 3P49B 4WFBQ 2QFJA 5HL7Q 2OSQA 2DNHA 1X4FA 2V94A 2KXFA 5D78A 1DHMA 4U67Q 2DGXA 2KH9A 2DO0A 2AD9A 2KT5A 2B0GA 1WWHA 3JB9k 2DH7A 4CH1A 1FNXH 3NNHA 3PIPQ 1AUDA 5GAHU 2ZJQQ 2K8GA 3MURP 2G0CA 3CULA 2OTJS 1SXLA 5DDOC 3UCZP 2U2FA 1VQ5S 2N3OA 1YTYA 2DITA 2CQCA 1WELA 2SXLA 2MQQA 1VQMS 3MDFA 3P3DA 2BOPA 3TO8A 4M5DB 1W2BR 4PR6A 5ITHA 3H2VE 3BO2A 2MQNA 2KM8C 2DGTA 2JVOA 2DO4A 5LXYA 1Q7YT 2KVIA 3S01A 2RU3A 1N54B 2MMYA 2GO9A 3CCQS 3V4MA 4TU7A 3BEGB 1M1KT 2HYIB 1U1QA 1QVGR 1FT8A 2DH8A 3VAMA 3Q2TC 3N9UC 2RS8A 2RRBA 3FEYB 3K0JA 2MKSA 3CCLS 4LMZA 5IM0B 3NS5A 5GADU 3R1LA 1ZZFA 3UWTA 1M5VC 1DBDA 4CIOA 1X0FA 2M7SA 1A7GE 3UE2A 3SDEB 3CPWR 1PO6A 1VC5A 1YI2S 2KU7A 2CQ1A 1WHYA 2DHGA 5GVQA 2DIVA 2LYVA 1WTBA 2DHAA 2M8HA 2CQBA 2MQMA 2YWKA 3CUNA 3NS6A 3IWNC 5H1SV 5LSOA 1WF2A 3TP2A 3G4SS 2CQ3A 3S6EA 2ADCA 1SJ3P 1BY9A 4UY8T 1M5PC 3VAHA 1M90T 1Q81T 4UQTA 2MKKA 2UP1A 3DXBA 4A8XA 1D8ZA 2DNRA 3PIOQ 1U1MA 1S79A 1F9FA 4IUFA 3BO3A 3Q2SC 2I2YA 2M0GB 2LA6A 4P6QA 1VC6A 1FXLA 5DM7Q 1X4GA 1N52B 4Y00A 3CCMS 1ZZNA 3P6YC 2KI2A 3R27A 2J76E 1VBYA 4IOCQ 2RRAA 3B4DA 2DNOA 3H2UB 2MJUA 2PE8A 3CC7S 1R8PA 2WBRA 2KXNB 2MZ1A 4TLQA 3L3CA 1O0PA 2KG1A 2MSSA 5CXTA 2M8DB 1KOOA 3G6ES 1X5TA 1FHTA 5IQQA 1WG4A 1KC8T 2G4BA 2DGQA 4OZ0A
chains in the Genus database with same CATH superfamily
3LOUA 2FC9A 2GZOA 4P2MA 1N5SA 2E7VA 3NNCA 3QWUA 1GX5A 4YB7A 1FVQA 2ZC3A 1X9WA 3FBFA 2E5GA 2E66A 1X4AA 4RW6B 2YPYA 1JLFA 1K9MT 4LF8F 3I0SA 2XI2A 1LWEA 2PGCA 2PI5A 3K7RA 4V19J 5KG6A 1X4BA 5A2QU 5B09A 2I0XA 1S0MA 1P8GA 3W1YC 1XNQF 3GWCA 3L7UA 3GYXB 1KP6A 3PX6A 4FN5A 4QQBA 3FKBA 4HHUA 1U1KA 4NLOA 1FD2A 1QJHA 4ZN1A 2YKOA 2K1RA 4LVOP 2BEFA 1CLFA 5JXSA 2WTFA 3SFUA 2DNNA 1VIOA 3GR0A 2POKA 3GIKA 3S8SA 1U2CA 2GMLA 2Z56B 2HQDA 2B3TB 2YWGA 1U45A 3EGZA 1SKUB 4X65J 4GVBA 4B9VA 1C0UB 2CADA 5EUHA 5G0RA 2W2PP 4TU8A 3V81B 1MG7A 4LF9J 2HHPA 2R7OA 4TQRA 3P4UB 5L39A 1GQEA 1ZAWA 4DR7J 1NPRA 1JK9B 2MKYA 3HF5A 2VJVA 2DIUA 4F02A 3VAJA 1HNZF 3UW1A 3IN5A 1NJXA 4C0BA 3O6QA 2CVEA 1NSPA 2B4PA 4TVAB 2DHXA 3M2RA 3KK3A 3NAHA 2DT9A 3HZGA 3QATA 3P45B 3UDLA 5CZVA 4LRFA 3BDEA 5K14B 4I2PA 1YSJA 4K5RA 3Q22A 1I1GA 4ILRA 2EI5A 1MW7A 3C3LA 3QT6A 2CQDA 2FHJA 2V9KA 4YR3A 2GGPB 3ZZTA 1FEEA 4UOFA 3RAQA 1WKLA 4M5MA 3DGVA 1RBOB 2E1RA 2DB1A 2FIUA 1HBMB 2VKRA 2HSEB 3IS9A 4Y2CA 1IBCB 1VHIA 3H0PA 4MT1A 3ZNUA 3RZAA 3IGNA 2B4UA 2IIHA 2HK2A 3C14A 2XY6A 1TKXA 2FD2A 1K8AT 3FVYA 3KMSA 4M5DA 4NZ0A 4OHZA 2MKHA 4LF5J 5ETMA 4AXJA 3CD7A 1GMVA 3GMGA 1VQPS 2UUBJ 2PMWA 1VQOS 4EU0A 4OYIA 3IA0A 3GU0A 1GXUA 4DL5A 5GADI 1VI7A 1XMBA 2EK1A 2Q43A 1F9EB 4DV7F 1NZAA 3QJPA 3HVAA 1TU0B 1HHSA 5HMWA 3D1HA 3ZO7A 2ZBPA 4ZVEA 1UZHA 3MEDA 3GV7B 3KJFB 1JJCB 3AJDA 3TRGA 4DWIA 3NOGA 2A0FB 3FCHA 4X64F 1VHFA 5E33A 4YR2A 5KFHA 3C46A 3DMJA 2KH9A 1NK7A 5KT6A 3CE8A 2AD9A 2XC9A 2KT5A 1GH8A 1TV6A 5T14A 3CULA 1TK8A 4LRCA 3IG1B 2B9WA 3HT3A 5KFOA 4KHMA 4CO1A 5K8PA 5JMNA 1XEZA 2ZUGA 1VCTA 3I9V9 4RW4B 1XNRJ 4PR6A 5THWA 4PABA 2NS1B 4ETXA 2YPZA 2IDEA 5EHHA 8RUCA 2WSFC 2XLJA 2HYIB 5D0EA 1D3WA 3AB4B 3FEYB 4PEOA 5D8HB 1YRTA 4LF6J 1HQ2A 5KG5A 5LL6d 4NA3A 5EWGA 1JNRB 4OZJA 2JEIA 3W8GA 2V8VA 4M8LA 3AFGA 1TFWA 5KG3A 5JUMA 4DQQA 2ZD1A 4BC9A 2NXCA 4USWA 5EWEA 3RG6A 1IJEB 4URSA 1GMUA 1T9XA 3AOBA 2H65B 3DXBA 3CSKA 4PYAA 1R27B 4LR7A 4NYZA 1D8YA 2HNYA 4G3IA 1WC3A 3JAMY 4UUWA 4X66F 2HWHA 1H38A 4NCBA 3P5BP 3H2UB 3KWMA 4C11A 3TEHB 3LANA 2KXNB 3DDKA 5T41A 1KRPA 4DZDA 2MLXA 3D0HE 3GFYA 1S1VB 4OYXA 3KG0A 1X9MA 2AEJA 1EP4A 3QFHA 3VZIA 3FMWA 1Y00A 3FBCA 3D66A 1NDLA 1NZ8A 4YOEA 1RHRB 2UUAF 3MD3A 2J0WA 4DV1F 4JI5J 2UVWA 1U25A 1VRUA 4I0WA 1QUPA 1TKZB 1VISA 1UPPA 2ATLA 2UV8A 4KRWA 4ES2A 2N7YA 4ICLA 1U48A 3LAKA 2W9CA 4F25A 2FUG9 2LXIA 3MM6A 3CJKB 1KR4A 3PFOA 1Q7LB 1S6QB 3IR6B 2ACMA 2HHVA 4B3SJ 4LF1A 4FKXA 2RQCA 4DU7A 3OR2A 1TL3B 5A8RB 2DXFA 2ZBCA 3ET6A 2J7UA 2O3DA 1IWGA 2F40A 2DXDA 3TUIC 4UTGA 4OLOA 4H54A 3G82B 3FRZA 3I5CA 2DJWA 3KUEA 1ULRA 3HD1A 4YEAA 3M30B 5DG9A 1FWLA 1F9HA 1WI6A 2H9ZA 9RUBA 2HFOA 4JI2J 4PPDA 4A48A 3CNQP 3SQOP 3I0RB 3I55S 1UL3A 1U0HA 5F8IA 3MTJA 2Y3YA 2OI2A 1RTIB 4K59A 1HD1A 3R5CA 1FKAF 1T05A 1QDUB 1HW9A 5LT5A 3G71S 4KB7A 4Y28C 4B3OB 4KKOB 4J5OA 3OUYA 1LV5A 1B7FA 1FJGF 2Y0BB 2KB2A 2M52A 2DTJA 2CJQA 2UV8G 2DK2A 4O0IA 4QZVB 2ZH7A 4ED0A 3WQPA 1IBMJ 3I6PA 4EZ9A 1Y3JA 2XCPA 3AXKA 3PR5B 1S1WA 1F5BA 2BDPA 2LQ9A 1D1UA 2B9YA 4C8YA 2RDIA 4NLWA 1H2UX 5KFYA 1WHVA 2YY3A 4P72A 1ZTWA 2ERRA 3V6DB 4J9RA 2LFVA 5ETQA 3LWLA 5CD4A 2IYGA 5HO4A 1N0UA 4PWDB 3EXCX 1KQSR 2I8EA 1HA1A 1FK9A 3BQ1A 3RBDA 1Q5VA 3Q89A 1U1LA 1FTCA 2X1BA 4ZCKA 4OYPA 4DL7A 3G6XA 3ISND 1DARA 2DY1A 2ZZMA 4PUOB 4NCGB 3MMBA 1S10A 1RWVB 1RTJB 1WSRA 1WG1A 2A6MA 3ITHA 1FE4A 2V8GA 2E7XA 1VFJA 2FJEB 4J9PA 3M32A 1Y11A 3SSRA 4WP8A 2BJ8A 1FE0A 5FIIA 7FDRA 2YQ0A 2ZBIA 5F8LA 4OHYA 2EXUA 2DRAA 3CJ0A 2AU0A 1GNKA 4DV0J 1HMVA 3MPDA 4ZS6A 2QTWA 2AP6A 2VBZA 1S97A 3M9NB 3S01A 3WC2A 4KV8B 4MFBA 4J9NA 1RAFB 5L1LA 3KJVA 2C2RA 5I42A 4CIOA 4NA2A 2QLXA 3W65A 1NHUA 1UVMA 5IT9Y 1FF2A 3DYAB 5BYRA 2E9TA 1TFYA 4ZCMA 4HHJA 3FQLA 5H1SV 4E8UA 1R0BG 3TW0A 3HO1A 5DG8A 2GV1A 4RKUC 3RUBL 1FD8A 3BH7B 1Y4ZB 1S79A 2QZ8A 3LP2B 5F3TA 2FJVA 3SI8A 3MR3A 4DN0A 3HZEA 4NLGA 5A0YA 1U6ZA 1VBYA 1H0HB 2V34A 3B4DA 2ZDOA 3MTKA 4X65F 2WBRA 3W5XA 2V4QA 1NCLA 2XMAA 2MSSA 2ZC4A 4RX6A 2G4BA 3EDQB 1RTDA 4WE1B 4LF9F 3CD0A 4Q0BB 4XPEA 2GIRA 4DR7F 1MN7A 1Q82T 3W9JA 3D67A 3CD5A 3W7BA 3RJMB 3BGUA 1NK0A 1VJQA 4B9MA 3U27A 4RL1A 4ZPTR 1DTTA 3CO0P 1PBAA 4BC7A 3MCMA 1M5SA 2WZ1A 2BE9B 2R2SA 2PC6A 4I2QB 3MMJA 4RNHA 1CC7A 3BO4A 2MQOA 1S0NA 1RT3B 1IQTA 2HVZA 3GPAA 4A8FA 4MKBA 2XO6A 3QO9A 1CJVA 1REVA 2K7KA 2KZMA 1WORA 3KLGA 2BA9A 2HHSA 4PQUA 1TQLA 4L3NA 4OIXA 4B9NA 2PA3A 1OY9A 4KH1B 4CM0A 2FJBB 3M6XA 3EVMA 4PKDB 4NLTA 3H40A 3LP1B 1ZA2B 2LCWA 4KGKA 1FXRA 3DLEB 2HHUA 3K59A 4C8MA 1RU1A 3CJ8A 5L1JA 4I67A 2E5JA 4TKTA 3M8QB 1SJFA 4AL5A 5DZ6A 4DHVA 4LF5F 1YHQS 5I3UA 3QSYB 2GMJA 4ELTA 4M5GA 2UUBF 2HHTA 2RKIB 2B5JA 3UDEA 4EZ6A 2FLLA 4ZPCA 2LA4A 1SL0A 3O5TB 2R8HA 1W25A 3D0IE 1DZ5A 3W62A 2ASLA 4ZVFA 2H5JB 2GW8A 2MSTA 1S72S 3HSJA 4I56A 2XZTB 2GQCA 4IDKA 1N48A 4KFBB 3PHTA 3OL9A 3GYGA 2J8SA 4ZP6A 3DRRB 4TY8A 3H2LA 3LGNA 4F2RA 4CH0S 1Y5IB 4C48A 2IFXA 5BJRA 3VQTA 2ZFHA 4DR4J 2WOMA 5E41A 2FJDB 2N4DA 1HWLA 2RDDA 3RYLA 3EPIA 2CG4A 2VFUA 3D5MA 3FJ2A 5AXLA 1CVJA 2OPRA 2VG6A 1NPPA 3RRKA 2OJ3A 2BKOA 3TX0A 3PJWA 1XNRF 2NREA 5DGBA 3B8HA 2XYGB 2LDIA 4DQSA 4W4MA 5F8NA 2CPHA 2R8IA 5EWFA 3HKWA 3UFCX 1WF0A 2BYCA 4EYHB 2EPIA 5LOQA 2MKCA 5JVGQ 3M8YA 3W60A 2HLTA 2O66A 4CNZA 4LF6F 1WG5A 4LR8A 4KPYA 5F3ZA 1VC0A 3NBPA 4E98A 3CIZA 2W7AA 3D28A 4O23A 4I69A 3MCOA 4DR3J 2YKPA 1WHXA 3R5AA 2D69A 4JUZA 3HSDA 2HVIA 1LKZA 1VMBA 1SL1A 2IVYA 4WFBQ 3BJYA 2QFJA 2HEKA 5D78A 2DO0A 3B82A 4PXBA 3H5XA 1C1CB 2BABA 4N41A 4L76A 3EYZA 5KFKA 4KHRA 4ID8A 3TR5A 1WOSA 4IG3A 3WDOA 3OHAA 2MLZA 1W2BR 1HYSA 1OYEA 5ITHA 4PAAA 2CXEA 2MQNA 2KM8C 2DGTA 1LOUA 3CCQS 1KQGB 2HBYB 2XQCA 4DBQA 4YP3A 1UJ6A 4USUA 3Q2TC 4JI5F 4KJIA 1AFJA 3CCLS 5KG0A 3V6KA 4UQGA 5KFJA 1RWXB 4KH0B 3DOMA 3K89A 3BGOP 1K0VA 3KXDA 4Y34A 4JV5J 5E0OA 3K5NA 1WTBA 1JQGA 3JSMA 2QMUB 4DCOB 3ICLA 1HWJA 4JV2A 2J7KA 2FLPA 4Z37A 1MSWD 3S6EA 2G2YA 4B3SF 1GTEA 3MOZA 2KZZA 2VHGA 2QRRA 2HNDB 3IWXA 3M05A 1I6JA 3M1VB 2VF3A 1ICEB 2GVZA 1YZ7A 2BE2B 3CCMS 2J76E 2YWWA 3CC7S 3WIVA 2MZ1A 2WONB 4TLQA 4ZA1A 2LQ8A 1NH7A 3WZ0A 4HACB 4UT4A 2C2KB 4FYXB 4JI2F 4RUCA 1H98A 1RAOA 2R3VA 2Q3PA 3Q86A 2EVZA 4RWXA 4ZPAA 2APOA 1KD1T 3DCAA 1WNEA 3NXZA 1UP1A 3T5LA 2HKEA 2YNFB 4KT0C 3I56S 2MXYA 3LW5C 3M8PB 3ZZYA 1PJ5A 1M5OC 3US5A 2QYGA 1NKCA 5HVGA 2GC8A 1FA0A 3EPGA 3OT9A 2W8KA 5KFPA 3K57A 4I6AA 2CVIA 4GC7A 2RVJA 1HQUA 1SV5A 2QJ3A 5KFBA 2Q1LA 4X4RA 2A2DA 4DJBA 2DPJA 5CYJA 2XS2A 4N5SA 2GQQA 4K7QA 3DGPB 3NEKA 2V4RA 4FPRA 3D6FB 1IBMF 2E9ZA 3C16B 1YX2A 2XMMA 1T11A 3KDOA 2ZEJA 1FRKA 4MJKA 4CLWA 2DHSA 5K8NA 2IRUA 1DQ9A 1JX4A 2ZE2B 1UVJA 3EVOA 1K1QA 4C8OA 2VASA 2Z8QA 1IKYB 3AY0A 2M70A 4JI7J 1QTMA 3PTWA 4J7CA 9ATCB 1G2EA 5LMUJ 2YX1A 1LFPA 1JKHA 2ZH4A 1JLGB 1KHWA 1RDRA 1ZH5A 1JNZB 2QA1A 4N8OA 1PIEA 2M9KA 2QEXS 4GRSA 2C2MB 2V5HG 3QAUA 3TVYA 2AX1A 3HKZD 3D4JA 5LSLA 1WEZA 3MUVP 2DR6A 3NNAA 2HQ3A 4QU7A 4FNHA 4NLSA 4NLRA 1VGYA 4ZCLA 3DI6A 2XHWA 3KG1A 2VODA 2JDJA 5KFQA 1Y5NB 2M3DA 4P75A 4EK2A 2VICA 1RYSA 4LBPA 2LKZA 4RU2A 4DV0F 3OL8A 5M2PA 2H5IB 3PYDA 3X1LB 1JLBB 2VUGA 2I5JA 4DEZA 4NL5A 4KGXB 5EX3A 5J1NA 3AA8A 2HHWA 3R5GA 4I68A 2EFOA 1SQGA 2CJBA 2WCXA 4ANCA 2HRTA 2G13A 1T9YA 3K17A 4ZVOB 4X4QA 2NZCA 1RTHB 4DCJB 2RF2A 3IGVA 2BXJA 5HLFB 2HRYA 4K4ZA 1GFWB 1B3TA 5CYMA 2WB4A 5J2NB 1OPIA 2IMOA 2CNNB 2LQJA 4P73A 1X8DA 3MAHA 2HZCA 1RT5A 3FEZA 2OFGX 4ED7A 4G1PA 4YB6A 3FZBA 3QGIA 1YDLA 1NDPA 4MYTA 5H9EK 3E8OA 4B17A 4USMA 3PDNA 2W7OA 3K5OA 1HARA 1EKSA 2A18A 2KT3A 3C15A 2J0XA 2DITA 3NCPA 3SIPB 1TK5A 2BM1A 2ZBRA 4O3RA 4DL0C 2VH7A 2CNLB 4RW7A 2ROGA 2DO4A 2HFSA 2WB1D 3BBFA 3V4MA 4RNNA 2OKQA 1M0SA 3DM2B 3HSZA 1RJJA 4F3QA 4Q45A 1UWBB 3H5YA 3KTQA 3IG1A 3EM1A 1LWCB 4RW9A 2BACA 3OBIA 4KO0A 3R1LA 3FFIA 4NZ7A 4NRUA 1S6UA 2UUTA 1JLEA 5GAEI 3SDEB 3CPWR 3BSNA 3EMTA 4B9LA 3ENVA 2VKZG 1L3UA 4MK8A 4F36A 1Y9OA 2OPSB 4LVNP 1LWFB 2WVBA 2E1PA 3Q8QB 3T5KA 1S9GB 5HMXA 3OJSA 1IKWA 5KT7A 4ALZA 4B3MJ 4LF4J 1M90T 2AV5A 5H9FK 2H4WB 1T9UA 1C4CA 1VC6A 3H5UA 4IFVB 2GCFA 3A3OB 3J7Z5 2ATCB 3N79A 3PR4A 1QAYA 2MEWA 3I5AA 5EGYA 1YJ7A 2FTRA 4U7UD 3HVTB 3H90A 5HROA 3Q8VA 4FDFA 3RGIA 3LALA 2MJNA 4ZLJA 1QSLA 4EGLA 3BR9A 4H4OB 2MYFA 1X5SA 1Y10A 3UCGA 2PEBA 2UU9J 2WVFA 3NMRA 4C7QA 1Q8LA 5AE2A 3NG8A 2E5LJ 2HFNA 5LJ5Y 1S4FA 2WHOA 1JXEA 1RTZA 4HLBA 3G8QA 2Z2YB 4LSNB 3EVWA 4BLGA 3MR2A 4WFNQ 2MQ8A 1Q78A 3IRXB 1BQNA 4YHHJ 4Z7YA 1ZM9A 8ATCB 1LK7A 4LUBA 4IR1A 2FVCA 3OD2A 4DR4F 4GMKA 2B51A 2OLWA 2XHCA 1T02A 2HFVA 2R8KA 3MM5A 3DOKB 3MMAB 5RUBA 3LPYA 2YH1A 3OXLA 3DLHA 2F8EX 3DU5A 2ZJRQ 2GHPA 4DL2A 3MM8A 1SIZA 1HNXJ 4B9UA 1C4AA 1S6QA 1ELOA 2NPIA 4MTPA 4C8KA 1SIWB 2XS7A 1FDAA 2X1AA 1TKDA 1B0PA 3JTOA 1FWPA 4FYWB 1HPZB 4EMDA 3BQ2A 1RT7B 2EKNA 2OEKA 1YJWS 2JC1A 3G82A 1VDHA 1YWXA 1J5OA 5LXRA 1UAWA 3M30A 3CJ5A 5HI7A 4OHWA 4OYZA 1YBUA 2LMIA 5A8KB 1FDNA 1SJ1A 2CG8A 4CLKA 4DR3F 2RNEA 2CWXA 1C1BB 1PG5B 1NBEB 1U6FA 4M5HA 2HBZB 3X3UA 2ZBQA 2LVWA 2VPXB 3ILJA 1XC9A 1YJVA 4JB8B 2HLUA 5KFSA 4B3OA 2IM0A 4QPTA 1E6VA 1H7WA 5AJ3J 4ELUA 2XZDB 2N7CA 3AODA 4L75A 3AJ2A 2V4JB 2CPFA 2OMLA 1CSJA 4CP5A 2CDQA 2GAHC 5E3AA 4DQRA 2VJUA 5L38A 1NSAA 3KLHB 3MEEA 2VFTA 2O1PA 4O3QA 3Q8YA 2LXUA 1F3VA 3KDNA 1TMMA 4DV2J 3MCSA 1VRTA 3L95X 2OEMA 4ES3A 2W7PA 4ZVTB 2JEFA 4DL3A 1U8WA 4KQZA 3H5SA 3TA2A 1G3OA 1L5UA 4USVA 1D9AA 5KFWA 2XLKA 5IM0A 3R5BA 3V6HA 3CGIA 1HNIB 1IKXB 2JFKA 2HHHJ 3BGRA 2DNPA 3R6GB 4TYBA 1X4HA 3DLKB 1FKOB 3PW7A 3H4BA 2WSEC 2AGPA 4DL4A 5HBMA 1LK5A 2BW7A 2V50A 1TL7B 5HL7Q 2OSQA 4NRTA 3QRQA 3KNAA 1SC4B 4C3MA 2X3GA 1EB0A 4WYWA 4J90A 4ZVUB 1S77D 1IUJA 2FYXA 2GFFA 1RTJA 3L4BC 2EFVA 2AIRB 3V2UC 2MQQA 4QIGA 2ZZNA 4G1QB 3P3DA 2J9DE 4X4VA 3A12A 4JV0A 3Q8SB 4RNMA 3IFEA 3ZXWA 2F8HA 3I82A 4R25A 1T7PA 4QYZK 5SZTA 2KT2A 3VAMA 1GT8A 2RS8A 2RRBA 5FLXY 5CYQB 4ECWA 4LMZA 4TXSA 4RZRA 2FGOA 4CM2A 2M7SA 3PM9A 3R8YA 4BCAA 4YMEA 4ECYA 3UN2A 3KUGA 5I4MA 1Q16B 1CJTB 4KV8A 4ZVQB 2M8HA 2D3ZA 2FVPA 4DLEA 2CQ3A 2W9BA 3FQKA 4J9MA 4HKQA 4IFYB 4NCAA 2IM2A 3POTB 2E1AA 4MKAA 4K2JA 1X4GA 2VD3A 2JFDA 1UVKA 2DXEA 5DJBA 1FRJA 4QIWD 2GQ2A 2BJ9A 3MAAB 1HNVB 2Q66A 1UW9A 1GEHA 2F65A 4MMOA 4GKKJ 4YY3J 1FHTA 2HNZB 2VFRA 2ZVSA 3I31A 3D2WA 4U7UK 4DV5J 4JI7F 2YNGA 5LMUF 4ZHRB 4NE9C 2ASDA 3R5JB 4U8VA 3OQ2A 2CQPA 1SJQA 2BRLA 3EUNA 2W2NP 3GJRB 1U2RA 1UFWA 4ZVRB 5FJ4A 2Q6BA 4F0KA 3W9IA 3MM9A 2LU1A 1WI8A 3QZ7A 1VQ4S 2P9CA 1LWXA 3NWGA 2PIIA 1KFDA 1YBAA 4A4JA 4F3MA 1YJ9S 5IT0A 3K8VA 3IXQA 4AXIA 3TZZA 1V9OA 4I6WA 3LP0B 3J81U 1EQ0A 4OJHA 4XO0A 1SPBP 3UD4P 3PCOB 1VBZA 5M2RA 2WW8A 2ABYA 3E2EA 4JV1A 4QWDA 4X62J 1W26A 1RT2B 2RQMA 2N82B 1GAOA 2KN4A 1W7WA 2J9CA 1I51B 3RRGA 2VOOA 1U2FA 5JJBA 2HQIA 1E6YB 4F26A 1HNZJ 3OFFA 1H74A 3JQMA 3QIDA 2JVRA 3LP1A 3O8WA 2IAJB 5LM7E 5CABA 1C2PA 3MM7B 2JZ5A 5LJ3Y 1RI7A 4WF9Q 3M8QA 2IDLA 1XTZA 4MYUA 3GG0A 1UJ4A 2JLFA 2RKIA 3OL7A 2KG0A 3OFGA 2F9DA 1S49A 3SSQA 5B7WA 1X4EA 2ZNYA 4X4PA 2RE1A 1JLAA 5D3GB 3KNGA 1SL2A 2R8GA 3MI7X 2W8LA 1KONA 3KLFB 1K73T 1U1NA 4H4MB 1VK3A 1HBUB 2LU2A 5F8JA 3MPYA 1SC6A 3DLJA 5B0CA 2PN6A 1KFSA 1NEEA 2HG4A 3MEGA 1PYOB 4ZCIA 5M2UA 5HP1A 2KTQA 2JRSA 3FC9A 3QBCA 3N6MA 5D4OA 3R2DJ 5KT3A 3CVKA 2FPHX 3M9OB 1UFLA 5E3QA 2XG8A 5A8WB 2P2CB 4OMFG 1L3TA 2C2NA 2G1DA 3ISNC 5F8GA 4I7FA 1V5IB 4DSEA 1S9EB 2DY9A 2MZSA 3PRVA 3CMQA 1BLUA 4O44B 1UPMB 1GXTA 4YUDA 4DX7A 1UEUA 1G4CA 3QMQA 4F50A 1VQNS 2H54B 5HMZA 1RCOB 4B3MF 3C8YA 4LF4F 3GLJA 3WHIA 1OJ4A 3PV8A 5B0DA 3I9ZA 1DQAA 1PCAA 2ZHOA 4NASA 5K8MA 2F4FA 2UVUA 1TKTA 4J91A 2ZKTA 1OYDA 4ZMMA 2CDRB 4NEZA 2OPQA 4KTQA 3HHEA 3MURP 5IC6B 3HPOA 2U2FA 1XQIA 2N3OA 2VQFJ 1TUWA 2BANA 4U7CA 1S99A 3QRPA 3QIPA 2FY8A 2CNOB 3BO2A 2XBPA 4RBVA 4CLPA 3MF5A 4LF2A 2UU9F 4R8UB 3CCWA 2ALZA 2E5LF 1YLXA 3K0JA 2PI4A 3VCDA 1KWMA 2WSCC 4C8NA 5F8HA 4FF2A 2F1FA 3L9ZA 4DV6J 3PNIA 4OZNA 4ITSA 2D7SA 2B6AB 1B64A 3QQCD 2C42A 4YHHF 3QPIA 1LW2B 2DHAA 2XWYA 4Y2AA 3HM9A 3I5BA 1IJFB 3SSSA 3VVUA 5LSOA 4IKAA 1YZ6A 4ZVSB 1M5PC 3E01B 2YNIB 2NUHA 2IC3A 1SBRA 3BF4A 4A8XA 1F9FA 1IKVB 1TR0A 2LA6A 3W5ZA 4P6QA 1KVJA 2A2CA 5DM7Q 4Y00A 2KI2A 3KK1A 7AT1B 3PX0A 3GQCA 3MZIA 2C3MA 2DNOA 3PJ9A 1HNXF 3MCNA 3T1YJ 1SH0A 1U0SA 3BM7A 1CULB 1Q8KA 2ZH6A 2VG5A 3L3CA 5CXTA 1KOOA 1GTHA 5L9XA 4CYUA 1OY8A 4ZK7M 1GK8A 3HFVA 1RT4A 1QY7A 2M88A 4QIEA 4HHHA 1WDTA 3KG4A 3IAM9 2MY7A 4J9LA 4QJVA 1QM9A 4C0HA 2R2RA 1SUQB 4NI2A 3CCZA 3HHKA 4DPUA 2DYAA 3MOJB 1Q95G 4WP3A 1RT6A 2RS2A 3HDSA 2MHEA 1O51A 2QLJB 4LFAJ 5C25A 4ID5B 4FXVA 1CC8A 1ROFA 1U26A 1RXOB 4PG4A 4LSZB 3BPSP 2YNFA 1Q1KA 4K5SA 3M8ZA 4HT7A 1GMWD 4PCQA 3SMZA 2I38A 5AJ3F 4DFKA 3G86A 4FBUA 4OX9J 3CJSA 4OZ3A 5KFAA 1NXIA 4F04B 2EK6A 1C0TB 1RSCA 5KFTA 2DNGA 1UVNA 1MU2B 4RUAA 2PSZA 2NLWA 1MN9A 4DV2F 2XGPA 4M5NA 3GV8B 1JJ4A 5G4DA 2QN6B 2HHXA 4FYVB 4L72B 2ZHAA 3UN5A 4P2XA 2DISA 1YJTA 3FCVA 3B6BA 1JLFB 4CO2A 3I0SB 2ZE2A 4LT6A 1LWEB 2KO1A 2AZ3A 2MKJA 2GAGC 4KPCA 5MLCV 4ER8A 2JWNA 2VQEJ 3M2UA 4ZP7A 3OTEA 5IWAJ 4DPOA 1F2GA 2U1AA 2HHHF 4HL9A 4M1KA 1U1OA 2R4FA 1UEVA 4BS2A 1U49A 3N6NA 1N5YA 5ETSA 4WJBA 1FERA 2K1RB 5DM6Q 5C42A 1YG0A 4K4UA 1NJIT 3U1MA 4WBFA 1UA1A 3WX8A 5ETVA 4GVBB 1XR6A 5ETPA 5G0RB 3DU6A 3HFZB 2XS5A 1RISA 3HFKA 2ZJPQ 4QWCA 3D1QA 1V6HA 1B99A 1HIYA 3PG9A 3J7YU 3DDIA 3DLLQ 2XI3A 1HQEB 4Y2KA 1A6LA 2C3PA 3TWZA 4PQAA 3CMES 4RBTA 4ERDA 3TEGA 3M2RB 3SV3A 1P1TA 3KK3B 5DETA 4NMLA 4J9SA 4LSLA 3IC1A 2W25A 2DGVA 2RB7A 4CLUA 5AXNA 4I2PB 1VIXA 3PO5A 2J0QD 5D15A 3UO0A 1DRZA 2XMJA 2OMOA 2RHQB 1NHKL 4PG7A 3KK2A 2RQ4A 4LFBF 5DDRC 3OPKA 4LR9A 5DLFA 2DR8A 3A8KA 3IS9B 3KHGA 4RLEA 2V8HA 2RJZA 5DG7A 2CFXA 2FVRA 1FI4A 5LMNJ 2VV5A 4WWSA 3QJJA 3LO3A 3U1NA 3PIPQ 5KFDA 4GKKF 3B78A 4YY3F 1GX6A 4ZPDA 5DDOC 1TKXB 1RBLA 3QT7A 3KHRA 4DV5F 1S6PA 4M5DB 3ENAA 3JAMU 4OZLA 2Y1JA 2CJAA 5DO2A 4ED4A 4HYKA 1IXKA 2MMYA 1S9FA 1DQ8A 5B0BA 3S1TA 3NOCA 4N77A 2LXFA 1B7YB 2GHVC 4A8MP 1CQNA 2V2VA 1F6TA 2H4YB 3TA0A 2CQBA 2MQMA 4PXEA 1UTAA 5C2CA 3C6TA 4FPIA 4Q8EA 1QUVA 2L3MA 3I87A 2IJRA 1MMNA 1APSA 3DMJB 1PBUA 2JEJA 3KLVA 4X62F 1AW0A 4UOHA 2VFSA 1TV6B 2HQCA 2NXJA 3IP0A 3UVJB 1TMJA 2YNHA 2ILZA 4FZVA 3BB5A 4N8NA 2D74B 1FESA 3GJTB 5DQHA 2FY1A 1TL4A 3G8SA 5EN1A 3GSIA 4XTTA 3ULHA 2FVSA 2B4OA 2OEJA 1KS2A 1CS4A 1EHWA 3BSAA 2JH3A 3TAMA 1FWKA 4NMXA 2YKNA 1NMEB 3CCJS 2L08A 2YX4A 1TL5A 1R0AA 1H3DA 2F4VF 2NZ4A 3NLCA 4IQMA 2FZKB 3NP5A 2Z2LA 1BUXA 4OX6A 1FVSA 2Z2ZA 2FHJD 3R5DA 2XULA 2D3OR 5D0HA 3ILOA 3AH6A 3UR3C 4F0HA 2UXCJ 4LSNA 2HNYB 4K2XA 1AA1B 1MROA 4C11B 2HMIA 3KUHA 4CWBA 5DLGA 3CCTA 5F0UA 2P8IA 4WTOB 3G96A 5HATA 3ZTRA 3SXLA 1V3SA 2DNZA 1EP4B 4Q7AA 3A8JA 4B9TA 1NO8A 3N0VA 2G1HA 3J80Y 2YWEA 3MMAA 4NLDA 1R8AA 3DKDA 3BV8A 1JLCB 5IQ6A 3DRSB 1VRUB 2CQIA 3D6TB 2O5DA 3ENQA 3M4XA 4FXDA 5D4LA 4QR2A 3QLHA 1Y7PA 5L1IA 3AJ1A 4C98A 4IYQA 1Y5LB 5KG2A 2W9CB 3UDVA 2L9WA 3MM6B 4MK7A 3HULA 4WKYA 1TELA 5BYSA 3R6LB 3HD2A 2EBEA 3MHYA 4V1Ak 4J9UE 3S7RA 2KRBA 3RW7A 1K0TA 1S5ZA 4DPYA 5IOLA 2AKWB 2MHNA 1G1XA 3ET6B 3OFEA 1P9QC 3PJXA 3DLGA 5F9LA 4NZ6A 4DPXA 4NLXA 1D9DA 4TU9A 4IO9Q 5DRKA 4JI0J 2W2MP 1U6BA 2YH0A 1NJYA 2DR5A 5IC4B 4IRCA 2VQFF 4PRFA 2H3EB 1HI8A 2Y8WA 3HX9A 3GZ7A 3MECA 1UVIA 1VK8A 5C24A 4A47A 1XK8A 2RHSB 1U0HB 1UW4A 1OPZA 2VPWB 4CLFA 1D09B 1QVFR 2F7VA 4O3OA 1SC3B 1MMDA 3NGSA 3KLHA 1T05B 1N56A 3A1YG 4G65A 2QSWA 1AFIA 2DNMA 5CH7B 4DV6F 4DQIA 2MZJA 3BZQA 1KOHA 3OUYB 1AXQA 4CI0B 4ZJQA 3FK4A 2AJ2A 1R0CB 2UVRA 5IT9U 3KHLA 3UCUP 2AQ4A 2F9JA 1NRKA 3PW2A 2YXLA 1DHMA 3F0NA 4DSIA 3CB4A 3T1YF 2C3UA 1S1WB 3QZ8A 3BGFA 4WXWA 2V68A 1VQSA 5IV4A 1KQKA 3UCZP 3DLKA 1FKOA 3F41A 2X51A 4LQ3A 3MDFA 1RHUB 1TTHB 4H4KC 3AA9A 2RUSA 1N54B 1NHVA 1O8BA 4DN9A 3W2VA 5BYQA 1R7IA 1L3SA 1FK9B 3RAMA 2IA0A 2WVDA 4FS2A 2RSQA 4K0KJ 2YKMA 3UWTA 1YVFA 1M5VC 4LFAF 2JLGA 4O4GA 2RRNA 4IG0A 5MAOA 2WVEA 3TJAA 1FFWB 1UVLA 3LGMA 3NGRA 3M6VA 3NAIA 4PZVA 1REGX 3TP2A 3ITHB 4UY8T 2CIMA 2FZCB 2MKKA 2BKPA 2UP1A 1RKIA 3D6HB 3ZZRA 3PIOQ 4OX9F 2XMUA 3BO3A 3Q2SC 2DHHA 3EICA 3EGVA 3MMCA 5HSPA 4Y65A 4F8RA 3R27A 3MGJA 3RAXA 4AUKA 4L3KA 1FX4A 4P10A 5DZ7A 1ZM2A 3CDWA 1HMVB 4YS2A 4NLUA 3ZTPA 2DGQA 4WPAA 4DZ6A 4DUZJ 1XERA 3MR7A 1URRA 1KKHA 4FVCA 4KY3A 4MFBB 4Q2LA 3PEJA 4OYBA 2FJXA 3MAAA 1RQ0A 2B4VA 2V67A 4DSLA 2EFGA 1EKRA 2H1YA 3KJVB 2K06A 2W01A 2AYGA 3N5BA 5I42B 2GA7A 2HNZA 5J2MA 3UR0A 1N32J 2MZQA 2VQEF 4F3OA 4FF4A 2R42A 2CJYB 1A0OB 2ZKUA 3FBEA 5IWAF 1MMLA 4U95A 1IM4A 1N5VA 1S57A 1CPZA 1HNWJ 3VVTA 2AYEA 2PFFB 2BZ2A 2CPDA 4Q2MA 1SB6A 1DTQA 2B9XA 4I6YA 4A8YA 1KSPA 3I4HX 2IPOB 3MD1A 4ZLPA 2YQ3A 2DR9A 3L7PA 5A0YB 4CTAA 1G7CB 2M2BA 5D77A 3ILLA 3M8SA 1TVRA 4K4XA 4ZN3A 3TAQA 1RTDB 3K5LA 1IWAA 3GTYX 1CJUA 4GO5X 5D0GA 3HHLA 3BDPA 4AE5A 4HH0A 5DDPC 4FXWA 4YR0A 4DMZA 3TVZA 4LFCJ 2OUGA 2BJDA 2V6AA 2HVHA 1IR2A 2XNQA 2QLWA 2VG7A 5L9NA 5FDLB 2R2UA 1RUSA 1ITPA 1RA6A 3KOAA 2R2TA 3BYRA 2IMWP 2FLNA 2W9AA 1N36J 5JVHQ 4DLGA 4DR2J 2AWZA 1S1UB 1Z4UA 2XWXA 3Q8PB 2CPEA 2M4MA 3BQ0A 4D3GA 1MNEA 3QO9B 1ZOTA 2DCLA 1RB0A 1CJVB 1B4SA 1Q0NA 1RWMB 4ANDA 2QIFA 1EJ7L 3KLGB 3Q83A 2VPZB 1UEKA 3VAFA 2CPZA 3H8YA 2C28A 2R7QA 4QYRA 1QAJA 2EC2A 1T3NA 2HBRB 1YRXA 4ZKAA 1M1HA 4QWAA 2L41A 5LMNF 3BSCA 1RGVA 4K4WA 1NU4A 3W66A 1QAIA 5D4NA 2AJ4A 4USKA 3HSGA 2XB2D 1BGXT 2OELA 3RB4A 5AT1B 1FJCA 5I3UB 3KLEA 1T95A 1SH2A 1Y3KA 5KFNA 1HD0A 2B5JB 2NXNA 2AJFE 3KLFA 4ZVGA 3THPA 3PY8A 1P6TA 2L9DA 3M8WA 1D0EA 4WYLA 1HBUA 2OGUA 3TI0A 1R6YA 3TQ1A 2YBVA 1B0VA 2LLZA 2MZRA 1NUEA 2GVDB 4U9RA 3FSYA 3CW2C 1WOPA 3W8PA 2F5GA 1LNQA 4HR2A 4CRJA 4IDKB 5ADZA 3ELHA 3CTRA 5CCLA 2XMKA 2V69A 4AQYJ 3SQGA 2HVEA 3SCLE 1WD6A 4RR5A 2HAIA 1JMTA 5SUHA 2FDNA 1ZPWX 1T9TA 2WOMB 3DNCA 2P9EA 4F4ZA 2W2OP 5AE1A 3DRPB 5HMYA 4NPOA 2XSJA 4O44A 5K9FA 3VTIA 2OPRB 2VG6B 2V94A 4DV4J 2K3IA 4WK1A 3SEOA 4DFMA 3MPVA 3SCJE 1I3OB 1XMQJ 5U47A 2FVQA 1AUDA 3WIUA 4UOGA 4P7TA 2CQCA 3C2PA 4NWBA 3AT1B 3FGVA 2WRMA 2AEMA 2BOPA 4BWJA 3DC2A 3NCRA 4ED6A 1FX2A 3HJVA 3I96A 1S0OA 3U7JA 4PPZA 3KJQB 2HVDA 2P5VA 3N9UC 5KG4A 2K2PA 4AYBD 2XY7A 4FS1A 3W9HA 1F2HA 4WU2A 3K5PA 5KFEA 3NBPB 5GMEA 1LQ9A 2GJIA 3IAS9 1YI2S 3N5FA 5GVQA 2DIVA 1UKUA 5CCMA 4ZPVR 2B43A 4X4UA 1T8EA 2EFNA 4DS5A 2H5EA 1S48A 4HVZA 2UXCF 1YJUA 4NX9A 3TUZC 2Z4PA 2FQQB 5L8RC 2ROEA 4CH7A 4WFZA 4R5PB 2NSCA 3KLIA 4OYOA 1NK4A 4JP8A 2DKOB 2PE8A 4CO0A 2QL9B 4ECSA 2E7WA 4RWWA 4IG3B 3LWMA 1HYSB 1MWZA 4FNIA 2DNYA 2AJQA 4DR1J 5E3CA 1DY3A 1RWOB 3ADAC 4WU3A 3H59A 2VBWA 1OY6A 1AZSA 2V63A 5ETKA 3SZ2A 4DV3J 3DOMB 3W63A 2ZDPA 3UD3P 4ANEA 1RAIB 5CD4H 4DSJA 1BHNA 4ED8A 3JSMB 3AOCA 4R0EA 4K4VA 1J27A 1H7XA 2PDAA 2OPPB 3RBZA 5DDQC 2P9GA 4PWUA 3DOLA 2X3DA 2EW9A 5GMKa 1FO1A 2GVZB 2KHCA 4CNYA 2AYBA 1RHMB 3HP6A 2B7BB 1VQ6S 3PW5A 1RWWB 2DH9A 1T03A 4JI8J 1HKAA 4JI0F 3GP9A 1NB2A 4ECTA 2D9PA 3VF0B 2JLEA 4JI3J 2DNKA 1L3KA 2MTLA 1RYRA 5HQLA 4Z2XA 1RT1A 4F4YA 1R8CA 2QL5B 1BWEA 2YKQA 3WBZA 3D0GE 2E1MC 3C6UA 2VDIA 4DFJA 2CPXA 4J9VA 1WTFA 2OIHA 2CJXB 3HVRA 1S1XA 3SFGA 1QE1A 3R97A 5J1EA 5K8OA 5IT4A 2MGZB 1BE4A 1RKJA 4A8OA 4K8RA 1GXLA 2LECA 2V2KA 1N6QA 3SCIE 4Y0FA 1DLOB 1VQ9S 1HQUB 3R9LA 3OR1A 1WEXA 1SV5B 2PEHA 1LW0A 2CYYA 1N0VC 2AZ1A 2EG2A 2EKYA 4HT5A 3RW6A 4LRBA 4QIVA 2AYMA 3CDAA 4JYAJ 1WEYA 1T9VA 2HHQA 1FDBA 2GNKA 1JXLA 4DSKA 4YB1P 1S76D 1ZETA 4EO6A 4I4BA 3EDRB 3JYTA 1RAEB 2GJ2A 5E3RA 5FD1A 2OFHX 3OXFA 1HWIA 1WF1A 4N7TA 1NLKL 2DNQA 2VU5A 4ILMA 1X4DA 4UZBA 5J2PA 2C1EB 1H2VZ 1ZBTA 2V9WA 1U1RA 1N34J 1JKHB 3RB3A 1PC4A 4RO0A 1HI0P 1KLMB 3M2VB 2XCAA 3RR7A 2OHDA 3VGTA 2CQGA 4BBYA 2QA4S 2GO8A 4Q5VA 4K0KF 1X5OA 2XMWA 4HTIA 3HT0A 2A10A 2VDHA 2OP5A 2E1CA 3HHLC 1CBKA 3LA0A 1HQEA 1B0TA 4LJMA 2ACYA 1T94A 3QGPA 3WX4A 3DI6B 4EWTA 3PYEA 2JSXA 2PT0A 1HLWA 3OTBA 3OL6A 2GHWA 5C2GA 5HQMA 3EZUA 4ZP8A 2DGXA 2VBXA 2R7VA 3RB0A 1FNXH 2DPIA 2Z30B 5GAHU 5ETTA 1HI1A 4DUZF 2I5JB 4XDCA 2AMCB 4X4TA 4QW9A 4FVMA 2QA4G 1U47A 2WK4A 3BEGB 2OO4A 3VGVA 4ZIVA 1QVGR 4LBIA 3PX4A 2ZH5A 3L7OA 2RF2B 1N32F 2RDJA 1HFEL 3HCXA 3G6YA 2IA6A 3HVWA 4RW6A 5CYMB 3UE2A 1WKKA 2QGFB 2RILA 3CJ3A 1HNWF 4W98A 2DHGA 4ZVPB 1SKWA 5GMDA 3N28A 4OQJA 1RT5B 2YWKA 3ZC4A 4BWMA 3RBXA 3FBBA 1SJ3P 4C9DA 5DGAA 2DNRA 4Q44A 4TLRA 2M0GB 3VGUA 4HTJA 3JS9A 1RAGB 5AE3A 3C15B 4NYOA 2BOAA 2V2ZA 1G6BA 4GKJJ 4YFUA 3PW0A 3NL0A 1VQYA 4OI3A 1WSVA 1WUUA 1NDCA 5E7OB 1C0UA 4RW7B 2XMVA 2DCUB 3GCWP 2H51B 2XM3A 3O2IA 3V81A 4LFCF 3UDCA 2DGUA 2J7WA 3VAGA 3UVJA 2W4PA 1F1BB 1T0TV 4RW9B 1XBWA 2QC3A 4KO0B 3FFIB 1JLEB 1N36F 2BQRA 4OX8A 3M7VA 3ZTSA 4DR2F 1ZA1B 4M5JA 2X7IA 2HW3A 1IKWB 2ZWPA 5K14A 5KAKA 1RP5A 1UMJA 4E2FB 1KBRA 4C3KA 3GONA 2DD8S 3AD7C 2FJAB 1EQMA 2GGPA 2FHOB 5D6GA 3FEXB 3W3SA 2IRYA 2BV3A 3OVAA 1H6KX 1HBMA 1VQLS 5EX0A 2RT3A 5HROB 3QWPA 3BKFA 5KFUA 5LSRA 1S0VA 4LRDA 1EAYC 2OTLS 5IXUA 1NKEA 3R7SB 1Q79A 2GIFA 1OS5A 5A2QY 4QR0A 2HURA 1YIJS 3P96A 2OD6A 4IQXA 1FFGB 1LFWA 2VC1A 4WFXA 4DUYJ 2KFYA 1S7HA 3JSBA 3UN3A 2F8MA 1YRUA 2VZ9A 4CO4A 2ZOFA 4WKRA 2Q6CA 3GE9A 1Z2LA 3BSOA 2AEFA 2D3O1 4IOAQ 2Y9HA 1FFSB 1BQNB 4AQYF 1JLCA 3D3BJ 2W4CA 2KKHA 4ZJOA 3AQOA 4AD6A 3DRSA 3QT5A 1H2TZ 1TAQA 5HQ8A 3MM5B 5IFMA 1HW8A 4DV4F 3THVA 1WC6A 4PXDA 1QAXA 4F4WA 4BDPA 4WFYA 1XMQF 2Y1RI 5CHCB 4Z7CA 1FTRA 3MM8B 3RTVA 3H4DA 3EJMA 3CC4S 3I4PA 4YN3B 1EZZB 2YQ1A 4O3SA 4O3PA 1FJEB 4RW4A 2B8PA 2VFVA 4USJC 2CZ4A 3OTOJ 3OFHA 3CCVS 5F9NA 1J5OB 3BYPA 3F44A 2K3KA 1U7LA 2EBGA 1YKWA 2UZAA 1YITS 2IVMA 5EDWA 1WOOA 2IM1A 3HXMA 4DI6A 2W1BA 1U24A 1EETB 5FLXU 1Q8BA 2I6WA 2X1FA 5F41A 3PEHA 2P6SA 1IVZA 1NJZA 3U1LA 1E6VB 3CO9A 4IR9A 5IV3A 2KXFA 4QBUA 5K20B 2B0GA 2QFIA 2C3YA 5KFVA 3MEEB 2UUCJ 1F5AA 4LREA 4FF1A 2LP4A 4PG6A 5AXMA 3JQJA 4L74A 2HWIA 1NSQA 1VRTB 4DR1F 1TZ0A 1Q8IA 3HJFA 1S1VA 3QAEA 2QX0A 3G2XA 3BN4A 5LXYA 2WW4A 4P74A 4EYIB 3IR7B 4DG1B 1TP7A 4DV3F 1KEKA 1WC1A 5IM0B 2VL1A 3G87A 1NSKL 1A7GE 4NLVA 2R7XA 2KU7A 3EE3A 1TKZA 3T9ZA 3VZHA 2LYVA 4X2BA 1R6VA 3BGRB 4BHQA 3AOAA 4DUTA 1VLYA 2BX6A 1VJWA 5HBMB 3PVXA 3CJKA 4KSEB 3HK2A 4NLYA 5KOWA 2XMTA 4UQTA 3K2YA 6AT1B 2CZ9A 4IUFA 4JI8F 1ZZNA 1I5OB 3T41A 4XIUA 1R89A 1VS3A 1TL3A 5A8RA 1RACB 2MJUA 3MAQA 5BR8F 3PACA 4JI3F 1JB0C 1X5TA 1VR6A 4CDIA 1TL1B 4NLPA 1S59A 4TY9A 3VHQA 1VRQC 1XR5A 4LIRA 1AT1B 2C2ZB 4USHA 4GO7X 4J9QA 2LQ5A 2KFZA 1IQZA 3VQSA 3ZTOA 2KFNA 3EX7B 3I0RA 2HS3A 2ZNZA 1SI9A 5A6WA 3E51A 4ECXA 1FDDA 1DURA 2QV6A 3NMAA 4M95A 1RTIA 5KT2A 3JXOA 4KGZB 4IH6A 4CZCA 2OSRA 3Q23A 2CQHA 2HAFA 4MAKA 3ENWA 5ETNA 7FD1A 4F0MA 2ALYB 3ZNJ1 2XYHB 4KKOA 2W9BB 1BMQB 1FRIA 4W92B 2JX2A 3MWBA 3KMQA 4R0JA 1IN0A 2CQ2A 1JWWA 4JYAF 3EWGA 3CD6S 4X4SA 1V3ZA 3LAMA 3W5YA 1TUGB 3MUTP 4ETZA 3GFHA 3H98A 2QMWA 5DS7A 1CJKB 5GAGU 2E29A 1HBOB 2C2OB 5DQGA 3CDEA 1X0PA 5F8MA 2YNGB 2IHR1 3PKYA 5KFFA 3R1HA 1N34F 3J7YI 2B9EA 3FMBA 1OSCA 2BQ3A 4OV6A 3BS9A 3G8TA 4DL6A 3V6DA 2B8QA 3W2WB 1W2IA 3VR1A 2J0SD 4PWDA 3BN7A 3PFEA 3MM9B 3GB0A 4ZIWA 1PC5A 3TUPA 2W4DA 3K58A 4DX8H 2VOPA 2QT7A 3OLAA 2BQUA 2X1GA 4DR5J 4JI6J 1S1TB 1U09A 2BJ1A 3CF5Q 2G9OA 1RAJA 5FDLA 4PUOA 2RD5C 4NCGA 1PAEX 3NWRA 3Q24A 1S6OA 2HS0A 5ETOA 1S1UA 4QR1A 5KFRA 3R2CJ 4KIAA 1NNDA 2RQKA 3C66A 2VPYB 3DDNA 3ZZUA 4CLSA 3BGLA 4JOUA 1YGYA 1SKRA 3SCKE 3CDUA 3TNVA 3CJQA 3CMAS 3PYGA 2Z2MA 4EBDA 1UETA 1U1PA 4QWBA 1X5PA 4UZCA 3ZZPA 4YDXA 3U02A 1N88A 3CJ2A 1RK8A 4PXCA 2CPYA 2V8PA 4A8KA 3MPUB 4CLZA 4LFBJ 1QTNB 2R7WA 1X9SA 3BPDA 5D4PA 3DYAA 2CPIA 2UXDJ 1IBLJ 2XY5A 1JLAB 4NXNJ 2GVDA 1YJNS 2N3LA 1QLNA 3F56A 1RLDA 5J2QB 4KE5A 3TJ8A 2WVCA 2L48A 1JXVA 4DQPA 3LP2A 2ZH1A 3TZXA 5L1KA 2KJVA 1WWHA 3MEGB 2DH7A 3KJNB 4GKJF 4EFAC 4AT1B 4X4OA 5HP1B 3UNYA 3D1OA 2NXUA 1YTYA 1WELA 3DRPA 2IRXA 5C5JA 4OYMA 3T6JA 4CO5A 1M5HA 1RABB 1RWUA 4WE1A 4URGA 1QSSA 3FUYA 3K8WA 1FRLA 2KVIA 3NGUA 4Q0BA 4ECZA 4N76A 1M1KT 5KG7A 1Q5YA 4I7FB 4C8LA 3G6VA 4HI1A 4DCPB 4U96A 5GADU 5KFMA 4JI1J 1KLNA 1X31C 4J37A 4I2QA 4ECRA 3OSNA 1H72C 5HJXA 4P7VA 1RZMA 3OV7A 1RT3A 1UJ5A 5AXKA 2BR0A 3PO4A 3L09A 4P2SA 4B02A 4EBCA 4UW2A 4MKYA 3AB2B 3VAHA 4PG8A 3ISZA 2L9NA 1TKTB 4MH8A 3D9BA 2J9EA 1N5TA 2OPQB 4DF8A 1T3OA 3W64A 4OJ1A 3A4TA 2HBQB 1T9WA 2BANB 3G6ES 3RU0A 5KFLA 5KT4A 3DLEA 3QIPB 3MUMP 1UZDA 1WJ9A 4R5PA 1HHTP 5E2QA 2MKIA 2F4VJ 4B9SA 3BH6B 3T9NA 4DUYF 4WZQA 1Q4RA 3GFXA 2PA8D 3F73A 2YTCA 1SH3A 2OD4A 4FKYA 1U02A 3J7AN 5CZXA 4OZ5A 1JIHA 3CC2S 2R7SA 3ZFVA 3SYZA 1N33J 4KFBA 1RHKB 3P5TL 2G0JA 2IC3B 3NRBA 4RUHA 3DRRA 3EGWB 4Q8FA 1WKJA 4MIBA 1XN9A 2COLA 5HK4A 4IH7A 2JC0A 3KK1B 2YWHA 4TYAA 1KNZA 1VOMA 2BM0A 2OPPA 3FDSA 4KAIA 2VG5B 4EBEA 4B08A 4CYUB 2HWTA 2YKAA 4F2SA 1U4BA 2D1CA 4OJGA 4WIIA 2R9LA 4FBTA 5IZHA 1OSDA 1RT4B 4OYWA 4C4WA 3DHXA 1FJ7A 3OTOF 2BBEA 1O5JA 2EEYA 4MK9A 4OI6A 3H20A 3DXSX 4NI2B 1N8RT 2ZITA 1KVIA 1AROP 3A13A 2ZZTA 4OHVA 1RT6B 1BQMB 5B08A 4WIQA 4XAKA 2QL7B 1IM6A 4ENOA 3FSIA 5C25B 3TQEA 2UXBJ 1SC1B 2QG9B 3ZZ0A 3CWJA 4O4RA 2PO4A 1UWAA 2R7RA 1R43A 2AW0A 2IVFB 3PKMA 4I64A 2KYXA 2JL9A 3BKTA 2MGZA 3TX8A 4RW8B 3PRDA 5HJYA 4WP9A 3T5HA 4HDGA 4DS4A 4NEYA 1QSYA 1XIQA 1DLOA 3QGHA 3GIIA 2QE5A 4B3TJ 1Q86T 4QIFA 2NSBA 1JLQB 2UUCF 3PHEA 1ZAXA 1C1CA 5I3QA 2Y1IA 4FYYB 4KYZA 1VQ7S 2RAQA 3GIMA 3QT8A 2IM3A 1OQ3A 2IBOA 4DR6J 3QRRA 1SJRA 4DPWA 1PYTA 4NOHA 3QJLA 2E5HA 2FJWA 4C0OC 5B0FA 4IRDA 4N47A 3AXMA 2MPUA 4J9OA 3KHHA 1YBTA 3MR6A 3M2UB 1KVKA 3MFIA 4RPFA 2JHEA 1KLMA 3M2VA 1N5YB 2FC8A 4WZMA 5C42B 1VYAA 2UUWA 3IMQJ 4KC5A 2V8DA 4OJ3A 5T7LB 4J9KA 1TK0A 4P52A 3HLUA 4GVLA 3DLBA 1X4FA 1EX8A 3I32A 2HNDA 3M1VA 3W61A 3N6LA 3OSPA 3A3PB 1CQMA 2J5AA 2BE2A 3VWSA 3NNHA 2MLYA 4U8YA 4DFPA 3CJTA 3IBWA 1BXNA 2OTJS 1VQ5S 1MWYA 2WONA 5KTQA 3D6MB 3TO8A 3GSDA 2DBBA 3H2VE 4HACA 2W24A 3MFHA 2CA9A 1K47A 3A3NB 3PW4A 4TU7A 4RU9A 2FHKA 3H7HB 4OX7A 4TQSA 4HEA9 2KDOA 1EARA 4LSLB 4ZITA 1HBNB 1J5EJ 4USIA 3NS5A 2HQGA 3M8PA 1PSDA 4UOCA 2PFDA 1IR0A 4EUVA 3V4IB 1FXDA 2AGQA 1FKPB 3KK2B 2Y0SD 3ETMA 3PRBA 4URQU 3T3FA 3B54A 4WK3A 4JI4J 4ILLA 1WF2A 3G4SS 1VLOA 1NB7A 1Q81T 3LGHA 3ZTQA 4YB5A 3DGPA 1XMOJ 1NK9A 3RRHA 1U8SA 4HI2A 3C16A 2RRAA 1N4LA 2I1RA 1O0PA 2KG1A 4ECQA 1IBKJ 1S6PB 2O01C 4C2MA 1N5QA 1PJ6A 3KFWX 4I1TA 4XK8C 1IKYA 4U6PA 3QFWA 4ELVA 2KL8A 1ACMB 1URNA 1JLGA 4ZP9A 1KTVA 3NCQA 2MY8A 1RHJB 4YDDB 2EFQA 3J80U 1WACA 4DX6A 2ILYA 2VIHA 1HL6A 1NK8A 1AYEA 3LF0A 4OZ1A 1ZS6A 1HWKA 2AJ1A 4H4KA 4Q43A 4RNFA 3M8RA 1TAUA 4DR5F 2ASJA 4JI6F 2DGOA 3C6TB 2DRDA 2MQLA 4KHPJ 2PMZD 3GIRA 5DQIA 4F7VA 2CRLA 4ZJLA 2G0IA 1DFDA 2CQ0A 4L73A 1OIAA 2ZOGA 4DSFA 2VC0A 4C8ZA 5HVFA 3THTA 3MXHP 2W2QP 4S0MA 3AD9C 3OXGA 2YNHB 1A9NB 4A8QA 2MB0B 1BD6A 1VQ8S 3OVSA 5F0WA 2NCKL 1RA7A 1EIYB 3N4WA 2IJFA 4KBIA 5L46A 2YWFA 1RADB 1CS4B 2VBYA 4P71A 1JLBA 2KJWA 3M9MB 1R3NA 3TAMB 3G9CA 3NGDA 2E44A 3UI3A 2ZH8A 2ZWOA 2DR7A 1KN6A 4QOTA 3T6BA 2XGQA 2YKNB 4ZOSA 3TUJC 2IJNA 3FRYA 1R0AB 2CKWA 2GMHA 1HR0J 2A6OA 1RTHA 3PXGa 4OHXA 4DU8A 3DN9A 4LF7J 4MIAA 4ZVHA 2EWHA 5HLFA 3LQVA 3H25A 2B56A 2UXDF 1IBLF 5J2NA 2GS8A 1WC5A 2MZTA 4NXNF 1P27B 1NM2A 4K4TA 3HHDA 3TJ9A 3RBEA 3Q8RB 1ZM4A 3C14B 1R31A 3VALA 1MROB 2HMIB 2HGNA 3AAWB 4JBCA 4EO8A 2MQPA 4ED1A 3CEDA 4M5IA 1WHWA 4K4SA 4DOZA 4OI1A 5IS2A 4RUBA 1VQKS 4TN2A 2QLBB 2VONA 2ASYA 4O0NA 5A76A 1RBAA 3MEDB 2ZHBA 2C22A 3TYTA 3IRWP 4C3LA 4IRKA 3QLHB 1S4EA 3DM2A 2J6SA 2C2DA 1WC0A 3OJUA 4UY85 4ES1A 2WBMA 1UWBA 4JI1F 1LWCA 1X4CA 4ZPBA 4P9SA 4ED5A 4DPTA 3R7NB 2HFUA 3SDEA 3EXYA 2A1BA 2ZM6J 5CA5A 2OPSA 3R7BB 1LWFA 2Q79A 3T1HJ 1NDKA 4HDHA 3D7SB 1S9GA 2Z57B 4RJVA 1UFKA 4OZ2A 3IM9A 1J2VA 1MWQA 2R7UA 5J1PA 1UCNA 3DLGB 1Z2ZA 2HZVA 2RU9A 4KGMA 4U67Q 1NK5A 5C7PA 4HH1A 4M5KA 1ZAVA 8AT1B 1EETA 4IFVA 3FSXA 1F0XA 3H42A 4F4AA 2NR0A 3MR5A 3MECB 5C24B 1UA0A 3HVTA 2JEGA 2AJ0A 1FEHA 1VBKA 5B0GA 1ZPVA 2RU3A 2ZD1B 4H4OA 6FDRA 4NA1A 2DH8A 3LH2S 2HZAA 3ZZOA 3Q0AA 4DDFA 2V2QA 5I3PA 4B3RJ 4C6AA 3OTCA 1X0FA 2BW2A 4WXOA 1VC5A 2CQ1A 1F3FA 3IRXA 1N33F 2BJ7A 1NK6A 2JNJA 3CUNA 1X7VA 4D3HA 4DG1A 3D54A 2KYZA 2G2OA 4OYAA 4KR0B 4JV5F 5CAAA 4OI2A 1U1MA 5A6PA 3AQPA 3SV4A 1FXLA 2AF6A 3DRXA 3DOKA 3BREA 4M63A 4ZLNA 1R8PA 3FNNA 1PAUB 2XEXA 3JSRA 5IQQA 3OLBA 1WG4A 4OZ0A 3CCRS 1BWVA 3VV2B 2XYPB 3CCSS 2H48B 2RH3A 1RWKB 4A46A 1Z1ZA 1I94J 3W2VB 3AHPA 4ICLB 2A3JA 4XDDA 1HPZA 1RT7A 5KG1A 2BMBA 2IY5B 1ZM3A 4G6VB 2YKMB 1TL1A 4OFZA 2UXBF 4O4GB 4IG0B 4WFAQ 1RLCL 5K5MA 4F4XA 3OR2B 2YX7A 1LXNA 2XLIA 2DGSA 3GG1A 5A8KA 1M5KC 3BBCA 2NYIA 1NPKA 1C1BA 1JJHA 4NXMJ 1XR7A 4DXLA 2O67A 1HWUA 3GIJA 3J81j 2Z58B 3MMCB 4B3TF 2GX8A 2HQFA 1PILA 1NJWA 2V4JA 4A8SA 2CZVC 3CXCR 2MDAA 1SQEA 2B7CB 4V19X 2QLFB 3B4MA 2F63A 4DR6F 1M1GA 2HGMA 2BJ3A 3CJRA 5KFIA 3A8EA 1FNMA 2CAJA 2J6TA 2R8JA 4ECVA 2V0NA 3Q8UA 2QA2A 4LBHA 3J7ZT 1OO0B 1WC4A 2AX0A 1CJKA 1OQ6A 3NKYA 4EI2A 3ILIA 1HBOA 2FGCA 5J2MB 5KFXA 3OTDA 3FZ2A 4PYDA 3LPEA 2J9DA 1R8HA 3NGTA 4W90B 2AGOA 3MPWA 3LUYA 3TOQA 4LF8J 5KT5A 2KM8B 4NYPA 2CUYA 2PMHA 6FD1A 2QSFA 1XNQJ 4O3NA 3DRYA 1DTQB 2HFZA 2ZUAA 3KKFA 1HNIA 1IKXA 3W2WA 2G2ZA 1RAAB 3TZWA 4L6V3 3GILA 2E5IA 2HIYA 2QYCA 4GC6A 2AT1B 1S7IA 4CTAB 2DRBA 1TL7A 1B70B 1TVRB 4ED3A 3RB6A 1NKBA 1S1TA 5GAHI 2CJ9A 1JJ2R 2C2EA 3BR8A 2RIJA 4OL8A 3JQKA 2D9OA 1CJUB 3PYFA 2D3UA 3P8BB 3HHLB 4M5LA 2E9RX 3A8IA 1FNOA 5KFGA 4G1QA 4DX5A 1H73A 4AL7A 2ZVIA 4A8WA 1V5VA 4CT8A 1OMSA 1SCJB 3NS7B 1CG2A 4WTYA 2HS4A 1YQHA 3O44A 2DEIA 2VG7B 3T1AA 3J7A1 1K1SA 3MMBB 5E5NA 1J5EF 3NY0A 2JOQA 1F60B 5ETLA 1PGZA 2OH2A 5CYQA 3DFEA 3CJ4A 3RR8A 2RUGA 2HPUA 2CJKA 3M32B 1P1LA 4YQWA 4K4YA 1CJTA 2J8AA 4JI4F 2K7JA 4USTA 4MIWA 3QYYA 2Z0GA 3ZZZA 2QO3A 3VAKA 3P49B 4CCHA 4LQ9A 4ED2A 1XMOF 4Y6IA 1ZTTA 4Y2IA 2UVVA 2BKNA 4IFYA 4ATNA 5KFZA 2NXEA 1YJRA 3POTA 3UD5A 3JB9k 1DAXA 4CH1A 2EG1A 3IBCB 1IBKF 2K8GA 3C19A 4OI0A 1HNVA 1SXLA 1QD1A 2LDYA 5H9EJ 3KLEB 5J2QA 1AUSL 3M6WA 2AHOB 2ZH3A 4OLPA 1LEOA 1RE1B 2JVOA 4CLLA 4ZHRA 2GO9A 1FT8A 2FLOA 4QW8A 5KOXA 1F5CA 1Y0HA 2ZOMA 3TARA 1DBDA 4DV7J 4PG5A 1FRMA 5HVHA 3E3XA 1WHYA 3SQGB 2BJEA 1SKSA 1BC6A 1XWLA 3AD8C 4KHPF 4ZDNA 1YK9A 2Y1LB 1KQFB 3IR5B 4Y3CA 4EEYA 3QGGA 2GIQA 2ADCA 1BY9A 3IO1A 2VB6A 2ROPA 2IYIA 1K44A 3TAPA 2XSJB 1TUVA 1D8ZA 4X84A 3LP0A 2NUUG 4X64J 3BKUA 4QWEA 5B0AA 3P6YC 4FYDA 2RMLA 2ZH9A 1ZYQA 1RT2A 5H9FJ 3CIMA 2M8DB 1CEZA 1DTTB 2R7TA 3TVKA 3HHLD 4CLTA 1E6YA 2LEPA 2HRUA 2LEAA 3R3TA 3OW2R 2DVIA 4E0DA 2KRRA 2BRKA 3VGSA 3OHBA 2QMXA 3QNWB 2P6TA 1REVB 2DGWA 2NQPA 1S12A 1MLAA 2IAJA 1HR0F 2DEJA 2BVZA 2GJFA 4PQUB 4IH5A 3MM7A 4LF7F 4ECUA 4NLQA 1P9YA 1V3RA 4X4NA 1OWXA 3ONQA 4UUXA 2YVSA 5GAEU 1RWPB 3HHNB 1SJ4P 4XPCA 2WAQD 3TZYA 4LIWA 2HK3A 3M6UA 5D0RA 3HI9A 4IO1A 5CQGA 3V6JA 3PZPA 5D3GA 3KLIB 1L3VA 4AL6A 4CO3A 4G1IA 1SVDA 2NPFA 1PYSB 2IBKA 3GR1A 4X66J 4H4MA 2XNRA 3GFZA 1D9FA 2VA3A 1Q53A 3CCES 3JTNA 4UF4A 2HGLA 3D68A 4F4KA 2LEBA 4F67A 4KGVB 4CLYA 1AZSB 3O3LA 2KXHA 2LQBA 2I9SA 4C97A 5A8WA 3EGNA 2BUNA 4TY8B 3CT9A 4LRAA 1R8BA 2UUAJ 3LTOA 1S9EA 4DV1J 2NYHA 4WCEQ 4K50A 3T19A 3J81Y 2ADBA 3CCUS 3FCWA 2XSFA 1IR1A 4RBUA 2ZM6F 3T1HF 2N4CA 3SBMA 3DOLB 3GJQB 1BQMA 4AFFA 2XTJP 1RWNB 2CQ4A 3BBBA 1GMWA 1T03B 1VBXA 5HANA 4CQ1A 4IOBA 4Y2MA 2FZGB 3N01A 2KHDA 3EZOA 2DNLA 4RW8A 1RT1B 1SQFA 3JTPA 3V5RA 5ETRA 5BXIA 2FHMA 1KDNA 1RAHB 2FB0A 3C6UB 4ZPWR 2D41A 4QCLA 1S1XB 1JLQA 1QE1B 5J1EB 2C3OA 3KYLA 2ZH2A 4R8UA 1RHQB 1N6QB 2CNKB 4B3RF 3VAIA 3D3CJ 3GCXP 2PD1A 2F3JA 3OR1B 4MKVA 2CPJA 1LW0B 4DF4A 2B6AA 2OAUA 2Y8YA 2VA2A 1LW2A 2EC0A 4OV1A 4QU6A 3WC0A 4OI4A 3UQSA 1FJGJ 3IBFB 3TA1A 5HN0A 1DJ0A 4M94A 4ZLLA 3TANA 2CWKA 3E01A 1RCXB 4TNOA 2YNIA 3K5MA 2DNHA 3JYTB 3HMJG 1IKVA 1NAQA 3T5JA 5HAOA 3MEKA 1FRXA 5B0EA 3IWLA 4FF3A 1RU2A 4PWWA 2ZJQQ 2G0CA 5J2PB 1CULA 2SXLA 1VQMS 3NGKA 3CDBA 2XZWA 5T7LA 2BE7D 1I94F 1BQXA 1X60A 1PJ7A 1Q7YT 3IM8A 2HIQA 1U1QA 1O6XA 1NH8A 2JJ4D 1KHVA 2MKSA 1SUQA 4CT9A 5E3PA 1ZZFA 4RNOA 1KTQA 3DHWC 4N56A 1PO6A 4QYZJ 2J6UA 2M5YA 2EFPA 3O1LA 4P2FA 1FCAA 3GJSB 4ID5A 3QSIA 3NS6A 3IWNC 2XO7A 4QPXA 4NXMF 3JSYA 4FP9A 1AB8A 1HBNA 3UPFA 3UNGC 1LXJA 5BR8J 3GYNA 1WDDA 1FRHA 1XJWB 2I2YA 5KFCA 3ETOA 1N52B 1HHQA 3GV5B 5GAGI 3V4IA 3OVBA 1FKPA 4IOCQ 3EZ5A 1PKUA 1C0TA 2KVQE 1MU2A 1KC8T
chains in the Genus database with same CATH topology
3LALA 5KT4A 3LOUA 3DLEA 2FC9A 3QIPB 2MJNA 3MUMP 1N5SA 1XERA 4R5PA 3NNCA 1URRA 1HHTP 1QSLA 5E2QA 4EGLA 3BR9A 3QWUA 4FVCA 2MKIA 4H4OB 4MFBB 4Q2LA 2MYFA 1GX5A 1X5SA 3PEJA 3UCGA 4YB7A 4B9SA 1FVQA 2FJXA 1RQ0A 3T9NA 2B4VA 3NMRA 4C7QA 1Q8LA 2ZC3A 5AE2A 1X9WA 4DUYF 4DSLA 2E5GA 3NG8A 2EFGA 2HFNA 4WZQA 5LJ5Y 1S4FA 3KJVB 2AYGA 2E66A 2WHOA 1Q4RA 1X4AA 3N5BA 3GFXA 2PA8D 5I42B 1JXEA 4RW6B 2GA7A 2HNZA 4HLBA 5J2MA 3F73A 3UR0A 1JLFA 1K9MT 4LF8F 3I0SA 2XI2A 2MZQA 3G8QA 2VQEF 2YTCA 1LWEA 2PGCA 2PI5A 1SH3A 4F3OA 3K7RA 4FF4A 5KG6A 1X4BA 2OD4A 5B09A 4V19J 2I0XA 1S0MA 1P8GA 2ZKUA 4LSNB 3MR2A 5IWAF 4WFNQ 1MMLA 1Q78A 1IM4A 1XNQF 3IRXB 3GWCA 1N5VA 3GYXB 5CZXA 4OZ5A 1CPZA 1JIHA 3PX6A 4FN5A 3CC2S 2AYEA 2R7SA 3ZFVA 4QQBA 2PFFB 2BZ2A 3SYZA 1BQNA 2CPDA 1U1KA 4NLOA 4Q2MA 1FD2A 1SB6A 1DTQA 4KFBA 2B9XA 4I6YA 3P5TL 4A8YA 1KSPA 1ZM9A 3I4HX 2IC3B 3NRBA 4RUHA 1LK7A 1QJHA 4LUBA 3DRRA 4IR1A 2FVCA 4DR4F 3EGWB 4GMKA 2YKOA 2B51A 4Q8FA 2K1RA 4MIBA 1XN9A 2COLA 2OLWA 4LVOP 1CLFA 5JXSA 3MD1A 4ZLPA 1T02A 2R8KA 2YQ3A 4IH7A 2JC0A 3MM5A 3DOKB 3MMAB 2YWHA 3KK1B 2DR9A 2WTFA 4TYAA 3L7PA 3SFUA 1KNZA 3LPYA 1VOMA 2DNNA 5A0YB 4CTAA 1VIOA 3GR0A 2YH1A 2POKA 2BM0A 3OXLA 3DLHA 2F8EX 3GIKA 1G7CB 2M2BA 3DU5A 5D77A 3S8SA 2ZJRQ 2GMLA 2GHPA 3M8SA 2OPPA 3FDSA 4KAIA 2B3TB 2VG5B 1TVRA 2YWGA 4DL2A 1U45A 3EGZA 3MM8A 1SIZA 4B9UA 4EBEA 1C4AA 4B08A 4K4XA 4B9VA 1S6QA 1C0UB 3TAQA 5EUHA 2HWTA 2YKAA 1RTDB 3K5LA 5G0RA 1U4BA 4F2SA 2D1CA 4OJGA 4WIIA 1ELOA 2R9LA 4TU8A 2NPIA 4FBTA 4MTPA 5IZHA 1OSDA 3V81B 4C8KA 1SIWB 4GO5X 2XS7A 1RT4B 3HHLA 3BDPA 4C4WA 1FDAA 3DHXA 2X1AA 1FJ7A 3OTOF 4AE5A 1TKDA 4HH0A 1B0PA 2HHPA 2R7OA 3JTOA 1HPZB 4TQRA 5DDPC 2BBEA 5L39A 4FXWA 4YR0A 4DMZA 1GQEA 1ZAWA 1RT7B 3BQ2A 3TVZA 2BJDA 1JK9B 1O5JA 4MK9A 4OI6A 3H20A 1YJWS 2JC1A 3DXSX 3HF5A 1N8RT 2DIUA 4F02A 3VAJA 2ZITA 1HNZF 1YWXA 1KVIA 3UW1A 3IN5A 2HVHA 1NJXA 1J5OA 2XNQA 2QLWA 2VG7A 5L9NA 1AROP 3O6QA 4C0BA 2CVEA 4OHVA 5FDLB 1RT6B 1BQMB 5LXRA 2B4PA 5B08A 4XAKA 2DHXA 3M2RA 2R2UA 1RA6A 3KK3A 3KOAA 1UAWA 3M30A 2R2TA 3CJ5A 2DT9A 3NAHA 3FSIA 5HI7A 3HZGA 2IMWP 5C25B 2FLNA 2W9AA 4OHWA 5JVHQ 3UDLA 5CZVA 3ZZ0A 4DLGA 2AWZA 1S1UB 3CWJA 1Z4UA 2PO4A 4O4RA 2XWXA 3Q8PB 2CPEA 2M4MA 3BQ0A 4D3GA 2LMIA 5A8KB 1MNEA 3BDEA 3QO9B 2R7RA 1FDNA 1R43A 1ZOTA 2DCLA 5K14B 2AW0A 1SJ1A 4DR3F 4I2PA 2RNEA 1YSJA 2IVFB 4K5RA 3Q22A 1I1GA 4ILRA 3PKMA 4I64A 2EI5A 2QIFA 1C1BB 1MW7A 2KYXA 3C3LA 2JL9A 3KLGB 2VPZB 2MGZA 3VAFA 1U6FA 2CPZA 2CQDA 4RW8B 3TX8A 3PRDA 2FHJA 3H8YA 2C28A 3X3UA 3T5HA 4HDGA 2V9KA 2R7QA 4YR3A 4DS4A 4QYRA 2GGPB 3ZZTA 1FEEA 2LVWA 2VPXB 3RAQA 1QAJA 1XC9A 1YJVA 2E1RA 2DB1A 1T3NA 1QSYA 1DLOA 2FIUA 2HLUA 1YRXA 3QGHA 5KFSA 4ZKAA 4B3OA 2IM0A 4QPTA 1E6VA 1HBMB 1H7WA 3GIIA 4ELUA 2QE5A 2N7CA 4QWAA 2L41A 5LMNF 2VKRA 1Q86T 4QIFA 3IS9A 4Y2CA 3AJ2A 3BSCA 2NSBA 2V4JB 2CPFA 2OMLA 1JLQB 1RGVA 2UUCF 3PHEA 1ZAXA 1CSJA 1NU4A 4K4WA 1C1CA 2CDQA 5E3AA 5I3QA 4DQRA 2Y1IA 1QAIA 5D4NA 5L38A 2AJ4A 2XB2D 1VQ7S 3RZAA 3MEEA 3KLHB 3GIMA 3IGNA 2VFTA 1BGXT 2IM3A 2B4UA 2O1PA 1OQ3A 2IBOA 4O3QA 3RB4A 1SJRA 2LXUA 2XY6A 1TKXA 1FJCA 2FD2A 4NOHA 5I3UB 1K8AT 3FVYA 3QJLA 2E5HA 2FJWA 3KLEA 1T95A 1SH2A 1Y3KA 3KMSA 4M5DA 4NZ0A 5KFNA 1HD0A 4OHZA 4C0OC 2MKHA 2B5JB 3MCSA 1VRTA 2AJFE 5B0FA 3L95X 3KLFA 4ES3A 4ZVGA 3THPA 4IRDA 3PY8A 4N47A 4AXJA 1P6TA 2L9DA 3CD7A 1D0EA 4WYLA 1HBUA 2MPUA 2W7PA 3TI0A 3GMGA 1VQPS 2JEFA 1R6YA 3TQ1A 4J9OA 1VQOS 4EU0A 4DL3A 1B0VA 4KQZA 3IA0A 3H5SA 1GXUA 3KHHA 4DL5A 2LLZA 1G3OA 3TA2A 5GADI 1L5UA 1VI7A 1XMBA 2MZRA 3MR6A 4U9RA 1D9AA 3FSYA 2EK1A 2Q43A 3M2UB 4DV7F 3MFIA 5KFWA 2XLKA 1NZAA 3QJPA 3HVAA 5IM0A 4IDKB 1HHSA 5ADZA 3R5BA 5HMWA 2JHEA 3V6HA 3CTRA 3D1HA 5CCLA 1KLMA 4B3SF 4ZVEA 3M2VA 2XMKA 3CGIA 1HNIB 1IKXB 1N5YB 2JFKA 3MEDA 3SQGA 3GV7B 3SCLE 1WD6A 3BGRA 2DNPA 2FC8A 2HAIA 4WZMA 3TRGA 1JMTA 4DWIA 5SUHA 2FDNA 5C42B 1ZPWX 1X4HA 2UUWA 4TYBA 2WOMB 3DLKB 3DNCA 1FKOB 3PW7A 3H4BA 2P9EA 2WSEC 4F4ZA 2AGPA 4DL4A 5AE1A 5HBMA 3FCHA 4KC5A 3DRPB 4X64F 5HMYA 1VHFA 4NPOA 1LK5A 2V8DA 5E33A 4YR2A 4OJ3A 5T7LB 4J9KA 5KFHA 1TK0A 2XSJA 5HL7Q 2OSQA 4O44A 5K9FA 3HLUA 3VTIA 3DLBA 2OPRB 1X4FA 2VG6B 3C46A 2V94A 3I32A 2HNDA 4NRTA 3DMJA 2K3IA 2KH9A 1NK7A 5KT6A 3CE8A 4WK1A 3M1VA 3KNAA 2AD9A 3N6LA 3OSPA 3SEOA 2XC9A 2KT5A 1CQMA 4C3MA 4DFMA 1GH8A 2J5AA 2X3GA 2BE2A 3MPVA 4WYWA 1TV6A 3VWSA 3NNHA 3SCJE 5U47A 4DFPA 3IBWA 5T14A 2FVQA 1AUDA 1S77D 3CULA 2OTJS 1TK8A 1IUJA 3IG1B 2B9WA 2GFFA 1RTJA 5KFOA 3HT3A 4KHMA 4CO1A 5K8PA 1VQ5S 4P7TA 1MWYA 2WONA 2CQCA 1XEZA 2EFVA 3V2UC 4NWBA 5KTQA 2ZUGA 3FGVA 2MQQA 3I9V9 2WRMA 4QIGA 4RW4B 2ZZNA 4G1QB 3P3DA 2BOPA 3TO8A 2J9DE 4BWJA 4X4VA 3GSDA 4PR6A 3DC2A 5THWA 3NCRA 4JV0A 2DBBA 4ED6A 3H2VE 2NS1B 4ETXA 2W24A 3Q8SB 4RNMA 3MFHA