2KXHA

Solution structure of the first two rrm domains of fir in the complex with fbp nbox peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
199
structure length
199
Chain Sequence
GAMAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of FIR-mediated c-myc transcriptional control
doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Poly(U)-binding-splicing factor PUF60
total genus 45
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA01
5IM0B 2G4BA 2CPZA 2M4MA 5GAHU 2YH1A 3LQVA 1VQ6S 2KT5A 2LEBA 3R1HA 2XS5A 5BJRA 3VAFA 1YJ9S 2RRBA 3JB9k 1U6FA 1WI8A 2RS8A 3MD3A 3NS5A 4WFBQ 1ZZNA 1B7FA 3B4MA 3N9UC 3VAKA 2JX2A 2DNHA 2MQOA 2DHXA 1U6BA 2MQPA 3NS6A 4PKDB 2CQ3A 3U1LA 3DLLQ 3BEGB 1URNA 5EN1A 2KXNB 3CC7S 3Q2TC 2CPFA 3IWNC 2QFJA 1KOHA 3US5A 3CC2S 2F3JA 2DO0A 2LKZA 2DO4A 1JJHA 2KU7A 2LEAA 2CQHA 1SJ3P 2RU3A 1FNXH 1WHXA 5GVQA 1N8RT 1W2BR 1PO6A 5GAGU 2G1DA 2Q79A 2QEXS 2KYXA 2L9WA 1DZ5A 2BOPA 2M70A 4Z2XA 2DNRA 2DGVA 2OJ3A 2CPDA 2XNQA 5CXTA 5DM7Q 2VOOA 3UD4P 5LXRA 1Q82T 1JJ4A 3CUNA 1WF2A 1JJ2R 3G8TA 1RKJA 2XS2A 1X4EA 4WFNQ 1PGZA 3P49B 4WFAQ 1D8ZA 3V4MA 3P5TL 5LXYA 2YH0A 3HI9A 5H1SV 5DDQC 1QVFR 2FHOB 3NMRA 1M5OC 3B4DA 1U1OA 3CCMS 1AUDA 5JVGQ 1R8HA 2E5GA 1N54B 1U2FA 2DH8A 2DHSA 2YKAA 2DNQA 4ED5A 2PEHA 2KN4A 3K0JA 5HO4A 2CQDA 2MGZA 2PE8A 2RQ4A 2RT3A 1WI6A 4J5OA 3CCVS 5DDOC 2MZRA 1K8AT 1Q7YT 4QU6A 4Y0FA 5JVHQ 4RU2A 2N7CA 2MZTA 4TLQA 2DITA 3PIOQ 2MKHA 3R27A 1SJ4P 1RK8A 2FY1A 1WHVA 2DNNA 2VOPA 3P3DA 4PR6A 2DISA 1VQOS 2G0CA 4Y00A 4M5DB 1U1MA 2OTJS 2E5HA 2JRSA 2UP1A 4UQTA 1DRZA 1YIJS 2N82B 2FPHX 1VBZA 1X0FA 3CCRS 3CTRA 1A9NB 2QA4S 2VODA 1N52B 2LXIA 2EVZA 2F9JA 3MUTP 2MSTA 4YB1P 4ERDA 3MURP 4A8XA 2KRRA 2DIVA 2DNPA 1VQPS 2CQIA 4TU7A 3G8SA 4LMZA 1X4FA 2J0QD 2CQGA 2RUGA 1IQTA 1YI2S 3TO8A 1N88A 1D9AA 2MY8A 2D9PA 1DHMA 3SMZA 4IOCQ 2DHAA 2J0SD 1S72S 3L3CA 2KXHA 1JMTA 3EGZA 2AYMA 1HA1A 1WEXA 2CQPA 2E44A 5DETA 3CXCR 1VQ5S 3H2VE 1U1LA 3G6ES 3S6EA 4WCEQ 2LECA 2M88A 1H2TZ 3VAMA 3UD3P 1X5TA 5HL7Q 4TU8A 3CMAS 2CPYA 4F25A 2MHNA 4ZKAA 3BO3A 2DGQA 3J7YU 1HD0A 2RVJA 2KG1A 1FJCA 2M7SA 2KM8C 1NJIT 5MLCV 1VQ9S 1SXLA 3BS9A 2ZJRQ 4V19X 2D9OA 2OSRA 3THPA 2ADCA 1P27B 1WG5A 2EK1A 2AYGA 1M1KT 2ERRA 4LJMA 4YOEA 2X1AA 3CCSS 3OW2R 3LPYA 1FT8A 3R1LA 2KRBA 5D77A 4P6QA 1Q81T 4IO9Q 1VQKS 1WEYA 1VQMS 2M9KA 3G96A 2AYEA 2V94A 3CCES 3ULHA 2HZCA 2JVRA 2X1FA 4WIIA 2M0GB 4YUDA 3ZZZA 2J76E 1SJQA 1WEZA 1S79A 2YTCA 2GHPA 1YJNS 1YITS 3NNAA 1U1PA 1WF0A 2SXLA 1O0PA 2DGWA 2X1GA 2MQMA 2K8GA 4U67Q 2MQLA 2XNRA 2WBRA 2O3DA 2CPEA 3VF0B 4CH0S 3UCGA 2OSQA 3CCJS 2AD9A 3Q2SC 2I2YA 2CQ2A 1HL6A 1WWHA 2CJKA 5LSLA 4WF9Q 4C4WA 2K3KA 2FC9A 1YTYA 1QM9A 2CQ0A 3U1MA 1P1TA 2M52A 2M2BA 5CYJA 1M90T 1WF1A 2CQCA 2CQ4A 3UE2A 1X4GA 5GAEU 2CQBA 1FHTA 1H2VZ 1L3KA 3S7RA 2DK2A 2BZ2A 2LA6A 2EK6A 2MXYA 1U1NA 3P6YC 5ITHA 2MKKA 4FXVA 1SJFA 1H2UX 1WG4A 2M8DB 4WKRA 2HVZA 2RQCA 2AYBA 4F02A 2N3OA 1Q86T 4BS2A 1FXLA 2MJNA 2DNYA 2MGZB 5D78A 2E5IA 1UW4A 3BO2A 2B0GA 4QQBA 2DIUA 4QPTA 2DGUA 5DDPC 2DNMA 1VBYA 4QU7A 1UFWA 3FEYB 3UWTA 3UCZP 1M5KC 2DNKA 2DGOA 2X1BA 3TYTA 1FO1A 3FEXB 2LMIA 1M5VC 1WELA 2L08A 5LJ3Y 1DBDA 2MZSA 2ADBA 5GMKa 1VQ8S 1NU4A 2XB2D 3CPWR 2VONA 1X4BA 2LYVA 1FJEB 4CH1A 1KQSR 3CMES 3MOJB 3IRWP 2NLWA 3S01A 1X4DA 1KC8T 4PRFA 2D3OR 3CF5Q 2MJUA 1M5PC 1OIAA 4EGLA 2JVOA 3J7ZT 2N3LA 2A3JA 4OZ1A 2L41A 2MPUA 4IUFA 3G71S 2JWNA 3HHNB 1OPIA 2I38A 2MY7A 1VQLS 2DNLA 2DGTA 2GO9A 4FXWA 5GADU 2DGXA 5IQQA 2KH9A 2MZQA 3EX7B 1VQ7S 1F9FA 1U1RA 2DH7A 2MKCA 3VAHA 1X4CA 2LXUA 3VAJA 2J8AA 2KXFA 3BO4A 2XS7A 2E5JA 2F9DA 5DDRC 2LCWA 4TU9A 4IOAQ 2MKJA 2MQQA 2NZ4A 1BY9A 2KI2A 2MQNA 3CD6S 1VQ4S 4UY8T 1WHWA 2CPXA 5LSOA 5LJ5Y 4C7QA 4W92B 2HGNA 1YHQS 3SDEB 2OTLS 1YJWS 1VQNS 2MZJA 3ZZYA 1X4HA 2XSFA 1FJ7A 2CQ1A 1CVJA 2DNOA 2ZJQQ 2HGLA 1SJRA 3S8SA 3VALA 3MUVP 3CCUS 1NO8A 2HGMA 1VC6A 4OZ0A 3CCQS 1UP1A 2KM8B 3D2WA 2FC8A 2MMYA 2RRAA 3I55S 3MUMP 4C0OC 5IM0A 1OO0B 2CPIA 1VBXA 1A7GE 1X4AA 1WHYA 2U2FA 1QVGR 1OWXA 2MKIA 2MB0B 3G4SS 3PIPQ 3G9CA 1XN9A 2KFYA 2KVIA 2HYIB 1WG1A 3VAIA 1U1KA 3NNHA 3SXLA 1R8PA 2KHCA 3MD1A 1KOOA 3DXBA 2U1AA 2YWKA 2ZJPQ 1H6KX 3EGNA 3RW6A 3VAGA 1UAWA 1X5OA 2DH9A 2M8HA 2KG0A 2OIHA 1KD1T 4CIOA 4CQ1A 3NNCA 2DB1A 1U1QA 1G2EA 2MSSA 3MDFA 5CA5A 3MXHP 2DNZA 1X5SA 3TP2A 1ZZFA 1WTBA 3CULA 5DM6Q 2DGSA 2DHGA 3CCLS 3UCUP 5FJ4A 2DNGA 2LA4A 4F26A 1VC5A 1X5PA 3I56S 2RNEA 1K73T 2CPJA 2CPHA 2RS2A 5IFMA 4W90B 3H2UB 1K9MT 3THTA 2MYFA 1YWXA 1ZH5A 2MZ1A 3CC4S 2LQ5A 3RW7A 3SDEA 2MKSA 1HD1A 1VC0A 4LIRA 3MI7X
chains in the Genus database with same CATH superfamily
2R2SA 4NYZA 4LRAA 4O44B 5IM0B 3GIKA 4CNZA 5F41A 3OFGA 2HBQB 1SPBP 3K8WA 3BGLA 3T3FA 2JLFA 7AT1B 1FXDA 3C6UB 1HQUA 4N5SA 4CLTA 2NXCA 1FJGF 4LSNA 4DCJB 4X62J 1YGYA 1EB0A 1KBRA 5KFWA 4OZLA 5A8RB 4N56A 1U7LA 4CLKA 5HMWA 3L7UA 3DC2A 4PYDA 2OFGX 1IM4A 2B4VA 3QYYA 3UQSA 3K17A 1SKRA 4C8YA 3ZFVA 1UA0A 4IG3A 3D1QA 3M30B 5ETQA 2MQOA 1RWXB 2L9NA 4ZJOA 4DPXA 4ELTA 4JI7F 4PKDB 3J80U 1IBMJ 1RHMB 1AFJA 4NZ7A 3IM8A 3M8PB 4B9VA 1FE0A 2FD2A 3Q8UA 4QPXA 5DQHA 4NLUA 3Q2TC 2W8KA 5KFSA 3UD5A 3IWNC 1B64A 3MM8B 2AZ3A 1UETA 3JXOA 5H9EK 1KOHA 2PI5A 1RAEB 3LANA 4ILMA 3US5A 1NCLA 2DO0A 1QUPA 3OD2A 4C11B 2V50A 4LRFA 3HSZA 3T1AA 1JK9B 3ISND 4YMEA 3HT3A 1C4CA 1TKDA 2KU7A 3DHXA 2I9SA 3GYGA 1E6YB 2XG8A 3O6QA 4NRTA 2XCPA 4KGMA 1F0XA 1T0TV 1NDLA 1PO6A 2EFNA 3DLGB 2ASJA 4W98A 4F0KA 4DR2J 2E9TA 2M70A 1PC4A 4C2MA 1OYDA 3AB4B 5HMZA 3PW7A 2VG7A 3CMQA 2BANA 2DGVA 2RILA 3DRPA 3I5BA 3PEHA 4QWBA 4F0MA 4DR1J 2CPDA 2XNQA 4PPZA 5DZ6A 4EZ6A 4J90A 1RWMB 3UN3A 4ZMMA 3CUNA 5D3GA 1OQ3A 5I3UB 2XS2A 5G0RA 3M2UB 2BBEA 4ZA1A 2KFZA 1JLFB 2PIIA 4WP8A 3CWJA 5E3CA 5HROA 4NXNJ 4CO3A 5ETNA 2YH0A 4DUZJ 3HI9A 1DAXA 3DGPA 4ED0A 3NMRA 1HNWJ 3MMJA 1R6YA 4USUA 1RQ0A 4OQJA 2CVEA 4EMDA 3A12A 4DOZA 2WB4A 1LFWA 2OPQA 4PEOA 3D6MB 4ZLPA 3OV7A 4DLGA 3RAQA 1IBLJ 2E5GA 1SUQB 2YWFA 5DG7A 3GLJA 2MLZA 4OI0A 1PCAA 3OL6A 2XY7A 2IFXA 1UCNA 1S1TA 2IAJA 1GMUA 1YX2A 2IC3A 2YX7A 2VQFF 2JOQA 4M5GA 3W2VB 1JWWA 4KE5A 1S77D 4DSEA 1HLWA 1RU1A 4DSLA 2QGFB 1S9GA 2HWIA 1WC4A 5DLFA 1L3VA 1VJWA 1ZA1B 4LF7J 3DRSA 3TZZA 4Y65A 4OFZA 1MN7A 4O4GB 4HTJA 4MFBB 2MZTA 2RE1A 1OS5A 3NOCA 1HNVA 4TLQA 2ZKTA 3BPSP 2ZHBA 4X2BA 5CQGA 3A3OB 2IJNA 3HX9A 1KQGB 5KT4A 1FD2A 3FCHA 5FDLA 4QW8A 3PO5A 3MEEB 3E51A 4MH8A 1U1MA 2R8GA 3TUIC 2QLFB 4ITSA 3TQ1A 2E5HA 2JRSA 3E01A 4UQTA 4ZITA 2UP1A 3OFHA 4JV1A 5KFAA 2N82B 4LVOP 2JL9A 5CCLA 5HQMA 4QIVA 3H5XA 1TELA 3J81U 2HS0A 2D41A 2WRMA 3CCRS 1O6XA 2FJEB 2WHOA 1F6TA 2ZH8A 2BXJA 5HVFA 3GIRA 2VJVA 1Q4RA 4V1Ak 2DRDA 2GNKA 3TX0A 3MEGA 3MUTP 4DR1F 2YQ0A 2MSTA 4JB8B 3NBPA 4YB1P 4U6PA 2BJEA 1D0EA 4ERDA 3U1NA 3RZAA 1IR1A 4FNHA 1GNKA 3SFGA 5SZTA 3Q0AA 3HHLD 1VQPS 2I6WA 5JXSA 2G2YA 3D0GE 3NS7B 2UXCJ 3NL0A 2NXUA 1F9HA 1IKYA 3KOAA 4WE1A 2IYGA 3QLHA 2DY9A 2VQEF 4DS5A 1HNXF 1TP7A 3QGIA 1N0VC 2MY8A 1XC9A 4J9KA 2LLZA 1VIOA 2QMWA 3SIPB 1GMWA 3U7JA 2FZCB 1FEHA 4OX6A 3UDCA 2W2OP 3GG1A 3MEKA 2KXHA 3OXGA 1FRJA 1JQGA 3POTA 3L3CA 3CJKB 1JMTA 2JFDA 1LWXA 2LQJA 2DCUB 3PFOA 1HA1A 3DGPB 1RI7A 2CQPA 2E44A 3LP1A 4QWDA 5K8NA 1CULB 1KFSA 4X4UA 4J9OA 3W7BA 3J81Y 2GCFA 3AFGA 3G6ES 2W9BB 1XMOF 4F0HA 2D3O1 1T9XA 5AXLA 1Z4UA 2B8QA 5D3GB 3ZZUA 4B3OA 1GK8A 3MTKA 3U27A 1H2TZ 2YWEA 2AW0A 3KK1B 1ZTWA 4Q7AA 2D74B 1BQXA 1NNDA 4A8KA 4P10A 3UD3P 2OPRA 4JI1J 4DF8A 1RCOB 2QFIA 4RUCA 2F8HA 1TZ0A 1V3ZA 2MHNA 2VPZB 3AQOA 1SV5A 3KWMA 1RTIB 4K8RA 1WOOA 2C2DA 3QRQA 4KHPJ 4DL4A 4CO1A 4F04B 5L1JA 1KS2A 3GCXP 1HD0A 2KG1A 2FLNA 2NXEA 2IDEA 2ILZA 2YPYA 2M7SA 2R42A 4NI2A 1NJIT 2WCXA 3ZTSA 2AX1A 4EBCA 1VQ9S 3BS9A 4V19X 2D9OA 1JLQA 4QR2A 1NEEA 3QGHA 3THPA 4QWCA 1P27B 1WG5A 2EK1A 4M5IA 4S0MA 2KZZA 3LP2B 5J1EA 1M1KT 3DOMA 2IM1A 3H40A 1UPPA 4NLTA 4B9LA 3KFWX 3BDEA 4YOEA 1F60B 1TL3A 2CG4A 3CJSA 3OW2R 3KTQA 2VA2A 4P7VA 2KRBA 1EARA 4YR2A 5A8KA 2G2OA 4P6QA 3HVRA 3H59A 1OPZA 1WEYA 2MHEA 3BKTA 2N7YA 3LUYA 3KLHA 2C42A 3H4DA 2GQQA 3TWZA 2R8HA 3L9ZA 4RU9A 3D54A 5HLFB 3I5CA 3ONQA 2C2NA 2V5HG 2FB0A 2JVRA 3LGHA 4DJBA 4ENOA 3BR8A 5CZXA 4XO0A 2Q6CA 3GQCA 4Y28C 3WDOA 1RTDA 1UVIA 2WW8A 2V4QA 4OYIA 4MKBA 5J1EB 3IP0A 3PX0A 3ZZZA 1HNIB 5B08A 1SJQA 3T9ZA 3B6BA 1S79A 1JLQB 4DSIA 3JQJA 4FF4A 1YJNS 1Q0NA 2GFFA 3M6UA 4MKVA 3AJ1A 4I56A 2WW4A 2XGPA 4LSNB 4DFKA 3FCVA 2DRBA 2K2PA 2XYGB 1O0PA 3J7YI 5KFNA 2DGWA 3CJRA 3QT5A 2MQMA 2K8GA 4K2XA 5DLGA 4U67Q 2FVQA 2VL1A 1F2HA 3KLIA 2HVHA 3WX8A 4HKQA 1TR0A 2JSXA 2HAFA 1NLKL 4ZVSB 1NJXA 1QSYA 1D9DA 2RKIB 3F0NA 3GP9A 4UOHA 8ATCB 3UVJB 3EE3A 3OJSA 1B0VA 2JEJA 2CQ2A 1HL6A 1NRKA 1RT3A 5KFJA 1D9FA 5J2MB 5BR8J 1QVGR 2XTJP 1CJTB 4DPTA 3RU0A 2WB1D 1RKIA 3C6TB 1IR2A 3H2LA 8RUCA 4C4WA 5H9EJ 5HMYA 1RJJA 1F5CA 1LFPA 2GJ2A 1IVZA 1RLDA 3W8PA 2NREA 5HN0A 3PKYA 2E1CA 3NKYA 2JJ4D 3LP1B 3U1MA 2QMUB 3QRPA 4IO1A 3J81j 2HIQA 2M52A 2M2BA 2FVPA 4JOUA 1HQEB 5E3QA 2VIHA 4A8MP 3POTB 2CQCA 1K47A 3QJPA 3R6LB 2YWWA 3ENQA 1YKWA 4HT5A 3HK2A 3F56A 5D6GA 5GAEU 1WOPA 4OLOA 1H2VZ 4BBYA 4NLQA 5IZHA 1S0NA 2BZ2A 1FKPB 4LIWA 1H38A 1FRXA 1PJ7A 1MMLA 3LWMA 3MGJA 3N6LA 4F4ZA 3TARA 1N33J 1Y0HA 3U02A 3M1VB 3PJXA 3BPDA 3TZXA 1XMQF 4YB6A 2F40A 5ADZA 4DL3A 3QO9A 3TX8A 2IM0A 3IAM9 3M8WA 1M0SA 4EO6A 4X65J 1RB0A 1UA1A 4C9DA 4ILRA 3AXKA 1Q86T 2HHQA 1QSSA 1LK5A 4KPYA 2DNYA 4I2PB 2XZTB 3T1HF 2CJBA 4WTYA 5CH7B 3M8RA 4DV1F 2OPPA 1CPZA 2J0WA 1N34F 3TW0A 1TFWA 3M6WA 4QQBA 2NPIA 3E01B 4LQ9A 1MWYA 4TXSA 4WZQA 1FDNA 4DPYA 4HT7A 1JKHB 1HBUB 2IPOB 3FEYB 3RTVA 3CB4A 3UWTA 1RADB 2LU1A 1ZS6A 3UCZP 5HP1A 1FRMA 1VQYA 2DGOA 6AT1B 3DMJA 4C48A 3PY8A 3VGUA 4PABA 5E3PA 2IMOA 2V63A 5IV3A 3ZXWA 3DRSB 2H9ZA 4Y6IA 5EDWA 3G6YA 4WU2A 5KFVA 4A8WA 1I94J 1Q1KA 2QX0A 1WELA 4YB7A 1UWBB 4X64J 3EGWB 2R3VA 1S0MA 3FFIB 4NWBA 4DDFA 1PC5A 4QCLA 5DS7A 1FERA 1NH8A 3W2VA 4AXIA 2WOMB 4X4PA 2ADBA 4WYLA 1VMBA 1MNEA 1OJ4A 3V6JA 2V2QA 4BC9A 3DLBA 4KKOA 4CO4A 3CPWR 3GJRB 1JLCB 2YBVA 3W9JA 2HNYB 4ED2A 1W26A 2LYVA 1TTHB 3FGVA 2AJFE 2H5IB 2HSEB 3NCPA 4F3MA 4CH1A 1KQSR 3CMES 3MOJB 2P9GA 4LSLA 4TY8A 1S6QB 1ICEB 2Y3YA 1FKOA 2XY6A 3FZBA 3M8ZA 3KNAA 2CJQA 3CF5Q 2HFUA 4E2FB 3MFHA 1OIAA 1M5PC 5HROB 2UVRA 1F1BB 1TQLA 4MT1A 2OUGA 4DQQA 3R5GA 5DG8A 5FLXU 3QAEA 4LRBA 4J9UE 4V19J 4AL7A 3G71S 4URQU 3K8VA 3HHNB 1IBKJ 2R8KA 1SJ1A 2BJDA 2I38A 3M8SA 3G86A 1FD8A 2VFTA 3DRRB 4H4OB 4KAIA 4PG6A 4F3QA 1NK6A 5L9NA 1F9FA 2OMLA 4IFYA 2DH7A 1JLEA 2A18A 3MEDA 3VAHA 1YQHA 1TUWA 1X4CA 3NOGA 3SV4A 4I7FA 3VAJA 2J8AA 4DR3F 1GXTA 3UDEA 4QIEA 4NX9A 3A13A 1YLXA 3DRYA 3D0IE 3Q8PB 4ZCKA 2LCWA 3VWSA 4PWWA 3T1YF 3OVSA 3SFUA 4ID5A 4KY3A 2Y1RI 1S48A 2A1BA 2XMTA 1XJWB 5GADI 4OI1A 4M8LA 1BY9A 2KI2A 2MQNA 4PG4A 4QWEA 2VHGA 1TU0B 3BH6B 3VGVA 3M2RB 2VH7A 5K14A 4A48A 5DG9A 5LJ5Y 2C2OB 2HNZA 4C7QA 5LSOA 1T9TA 3ILJA 3IR5B 4W92B 2AHOB 2HGNA 1O51A 2GAHC 1K44A 1VK3A 3HM9A 2LQ8A 1C1BB 1BXNA 3SDEB 1JXLA 2O01C 4ZVEA 4K4WA 5LMUF 3CEDA 3M30A 3Q86A 1X4HA 4KPCA 3TRGA 3MAQA 3UDLA 4ZJQA 2P6TA 1N5YA 1EETA 2FLPA 1JXEA 1CVJA 3N79A 1UFLA 3JSMA 3MPVA 3GFZA 3CDWA 1B0PA 1FKPA 3K5LA 1IM6A 3J7AN 1Q7LB 1HW8A 1NB7A 3NEKA 3DLKB 2XI3A 4EK2A 3MUVP 2FJXA 2V0NA 4CO0A 3CJ3A 3FMWA 4ES3A 5KFKA 1YRTA 1C1BA 4OZ0A 2KM8B 3ET6B 4C8ZA 2KYZA 2QLBB 5CABA 3MUMP 4DFMA 5IM0A 1DARA 1R0AA 3C15B 2UUCF 4F3OA 1ZAXA 4WKYA 1I3OB 1RHKB 2FQQB 4ZLLA 2BA9A 2K7JA 1HQEA 1HWUA 2YY3A 5E5NA 4QW9A 4G65A 1OWXA 2I5JA 3FVYA 3KLEA 4CCHA 1UVLA 1T9YA 2HFVA 3LAMA 5J2NA 3DU5A 4DX7A 1CS4A 3G9CA 5D4NA 2VFSA 2H51B 4BHQA 1C0UA 1KTQA 1BUXA 4DL7A 4I2QB 1XNQF 4EEYA 3HVWA 3C6TA 4ZVHA 3DM2B 4J9MA 1U1KA 4I68A 3D6HB 4G1PA 5KOXA 3PW0A 2NQPA 1R8PA 4NLOA 1N32F 4RO0A 3MD1A 1QJHA 5A0YA 1KOOA 4I7FB 4M5LA 2A0FB 3K57A 4MK9A 4LVNP 3CDEA 3A1YG 3EZ5A 2XMKA 2ZJPQ 4N8OA 2P2CB 2F1FA 1H6KX 3W9HA 3PW2A 4DX8H 1U2CA 2EBGA 5E3AA 4IG0B 5HBMA 4B08A 1S9FA 1S1XA 3RW6A 4KRWA 1H98A 1LOUA 2JNJA 2DT9A 6FD1A 3HSJA 4YEAA 2G1HA 2M8HA 3TJ9A 2AJQA 2E5LJ 1GQEA 4RWXA 2QL9B 1WC1A 3PJWA 4ZPTR 2IYIA 2PMHA 2Q3PA 5C24A 3FQKA 4CQ1A 3AD8C 2UUAF 4HACA 1RLCL 3ZO7A 1NHKL 4NEZA 4R8UB 4DR4F 2E66A 3OTEA 3QSIA 4OYOA 4PXCA 4RNMA 1U1QA 4LF5J 4LF4J 4CYUA 1X5SA 2YKMB 2QO3A 1V3RA 3FK4A 3VGTA 1HW9A 1TL7B 1ZZFA 3KMQA 2EPIA 3CULA 2DGSA 2DHGA 3KLHB 3IR7B 3GIJA 3GYXB 2BEFA 1VC5A 1LNQA 2L48A 2V8PA 1KWMA 1VK8A 4L76A 4WBFA 4ETXA 2RNEA 5A8KB 5B7WA 4QZVB 1TV6B 4ZPBA 3TUJC 3I56S 2BKPA 3D7SB 2AGPA 1MWZA 1S6UA 3PJ9A 1CJVB 5L9XA 5KT2A 4W90B 1BHNA 2BACA 1Y4ZB 2MYFA 1ZH5A 4OIXA 1O8BA 1Q8IA 1TK5A 5BXIA 1U0HA 1UWBA 5D4PA 4LF8F 4IH6A 3GV7B 2CPZA 1D1UA 4OYPA 3SCJE 2DCLA 3LQVA 3RUBL 3QJLA 3JSRA 2LEBA 2AT1B 4U8VA 1Q5VA 4DSKA 4ECVA 3B8HA 4NA3A 3CDUA 3ILOA 3IXQA 3JQKA 1CG2A 4ZCIA 4ECYA 5L39A 1UFKA 3OLAA 3D0HE 1NMEB 2D1CA 3VAFA 1YJ9S 2RRBA 2E1AA 2BW2A 4E98A 3PRVA 5LT5A 4FF2A 2CRLA 3NS5A 3OUYA 1ZZNA 4I2PA 3M8QB 3N9UC 5CHCB 2JX2A 3MPYA 4RW7A 3OJUA 5FD1A 3KLFB 1S1VB 3GJQB 3PACA 5LMUJ 4EFAC 4LT6A 1ZYQA 3BYPA 4Q8FA 1UEKA 4GKKF 3U1LA 1NKBA 3DLLQ 1URNA 1VGYA 5EN1A 1CULA 2UZAA 4H4MA 2KXNB 1CEZA 4C8LA 3MR5A 3T5LA 4USVA 2ZHAA 3BSOA 1CLFA 5F0UA 1F2GA 2RH3A 1LXJA 2FJWA 1HPZB 4NXNF 1LWCA 5IWAJ 1R8CA 4PG7A 1HMVB 2LDYA 4ZVFA 3I0RA 1PSDA 4O0IA 2I8EA 4WE1B 3W8GA 1IKYB 4OHZA 2RB7A 3JSMB 4XK8C 3VHQA 4H4KC 5E2QA 4WPAA 1O5JA 2IJFA 3PTWA 4DLEA 1W2BR 1N8RT 3Q83A 5K20B 1Y9OA 2Q79A 4DZ6A 2W8LA 1M1GA 4C98A 1DZ5A 3F44A 1RT5B 2VB6A 1EAYC 3P96A 3AA9A 3G87A 2OEMA 4FYYB 4OJHA 3DDIA 2G0IA 3C16A 4NASA 2WZ1A 2Z58B 3I9ZA 2YWGA 1VRUB 3I4PA 1CJTA 2J5AA 3D1OA 3SSSA 2ZH3A 5DM7Q 5CXTA 2G13A 4AXJA 5J2PA 2K7KA 1H73A 2QE5A 5J2MA 3UD4P 2AGQA 3KUGA 1XTZA 1RKJA 3GV5B 3R5BA 3HJVA 3MAAA 3NG8A 3E8OA 5T7LA 2VKZG 4WTOB 4ZLJA 1V9OA 4A8SA 3FEZA 1PGZA 4IYQA 5F3ZA 3FJ2A 4RKUC 5KFDA 5A8WB 4JYAJ 3P5TL 4OI6A 1NDCA 4WFZA 2HMIA 1QVFR 2BKNA 3M2VA 4RBTA 2P9EA 4BLGA 1M5OC 4WP9A 3B4DA 3FBCA 1U1OA 2XYHB 3JS9A 4KHMA 1AUDA 4FN5A 1HNVB 1HBNA 4CT9A 2EKNA 2F4VJ 4IR1A 4B3RF 5JVGQ 1R8HA 2NS1B 1SH0A 4CNYA 3H98A 5CD4A 1NK9A 1ZAVA 1N54B 1U2FA 2AWZA 3L7PA 4KBIA 3UR0A 1GEHA 3K0JA 1K1QA 1TKZA 2VC0A 2MGZA 4DV0J 2ABYA 2VDIA 4KB7A 2PSZA 3LPEA 3IMQJ 4CLYA 5J2QA 3C3LA 2VPXB 1U09A 3LO3A 1QAJA 1MROB 2IC3B 2DR6A 4ZLNA 2DY1A 2RQ4A 1RTJA 2RT3A 3H42A 4CLSA 1Y3KA 4J5OA 2IRYA 1FDAA 4DMZA 1GAOA 1HWIA 3DHWC 1HR0J 4J9RA 1N5TA 1YJVA 4Y0FA 5JVHQ 3PFEA 4RU2A 2DITA 3R27A 1RBLA 2VFUA 2XO7A 2FY1A 1WHVA 1TL3B 3P3DA 4PR6A 2DISA 3R6GB 2VQEJ 6FDRA 2W4PA 2ZNYA 4M5DB 3JTNA 3ZTPA 2OTJS 2AJ1A 4ICLA 1DRZA 5ETPA 5I3QA 4URSA 1YIJS 3QAUA 4OHWA 4RNOA 2FPHX 1VBZA 1ROFA 2KL8A 2YNIA 4O3RA 1N52B 5JMNA 1RTHA 4LFBJ 4FBTA 3Q8VA 3W60A 4I4BA 4JI4F 3CNQP 4C0BA 3M32B 1VIXA 3R5DA 5L1KA 2VG7B 1YG0A 5K8PA 4FKYA 3OBIA 5JUMA 4LSZB 3MURP 3I32A 4ECRA 4KC5A 2KRRA 3CJ0A 2UXDF 1S1WB 1S7HA 1RA7A 2DIVA 1UWAA 1K1SA 2MKYA 3JTOA 4USKA 4LFAF 5B0AA 3G8SA 1P1LA 4PQUB 1GX5A 2EFGA 3WIVA 2V8VA 3KG0A 1VR6A 4DEZA 4B3OB 5M2UA 2V8GA 4ZPWR 5AXKA 2BKOA 1S9EA 3GJTB 3HF5A 4N7TA 1IQTA 1N88A 1D9AA 4MKYA 3A4TA 4ZVUB 1HI1A 2BJ7A 4DR6F 1SKWA 5KFLA 3SMZA 3C14A 4DV2J 3GE9A 4RZRA 2C3MA 4OX9J 2AMCB 3ADAC 3CIMA 3IR6B 3R97A 3MHYA 3HDSA 4DR6J 3V6HA 1UPMB 2R7UA 1S0VA 3FRZA 2HHHJ 3GR0A 2QYGA 1VQ5S 1FVSA 3AA8A 3CO9A 1BMQB 1V3SA 2XCAA 4XIUA 1GTHA 4JI6F 3MR6A 3K59A 1FA0A 4Z7YA 3VAMA 3KJFB 1MU2A 1OSCA 1R8AA 4OHXA 1T94A 2RU9A 4DL2A 4F2SA 5HL7Q 2F5GA 4TU8A 3FSYA 3TVYA 2BR0A 5C42A 3CMAS 2J6TA 2E7VA 2ZOMA 1DQ9A 2ZBCA 2KKHA 4KGKA 3OFFA 4X4SA 2ZE2A 4L72B 2DGQA 1HBNB 3TQEA 4RW9A 4GC7A 2IIHA 1TAQA 2GGPA 1U47A 3MEGB 2MLYA 4RBVA 3TUPA 2HURA 2QL5B 2RVJA 5G4DA 3MCNA 1FNOA 2JLGA 1XEZA 2J6UA 2KM8C 5KFEA 3IFEA 2HMIB 1SXLA 4RLEA 3DN9A 4ED6A 2G2ZA 1N5SA 4O44A 4ZPCA 1VRTB 2OSRA 3Q8RB 2KFNA 3EPIA 3BGOP 2BJ1A 1Q53A 2QMXA 3MAAB 2OPSA 4Y34A 2QA2A 1AB8A 3MEEA 4Z7CA 1HI0P 1Y5IB 3UN5A 4K4XA 1WORA 2BE2A 2RMLA 5B0CA 1LK7A 1FT8A 3R1LA 1QD1A 3C16B 2GHWA 3AOAA 3MM6B 5C7PA 3QIPA 2E9ZA 3BF4A 2ZE2B 4NA2A 5K5MA 2V2ZA 1IBCB 2ZZMA 2D3ZA 1NK8A 1J2VA 2ILYA 3HSDA 2Z2MA 1VQMS 4F7VA 1S4EA 2AYEA 1BE4A 5HJYA 3CCES 4AQYF 4OHYA 3PDNA 5C42B 3HP6A 2PD1A 3TOQA 1IKVA 2VD3A 3Q8YA 2A2CA 2X1FA 3AOBA 1RUSA 3CGIA 4F4AA 2M0GB 1JLBA 1V5IB 3D28A 1S1TB 2IAJB 3HKZD 3HZGA 4JI4J 1B3TA 3IBWA 1WEZA 5KG1A 3GB0A 2CJYB 2N4CA 1LWCB 3GONA 1IJFB 4Q8EA 1KONA 2EG1A 5A2QU 2HEKA 2AIRB 3RJMB 3ZZPA 3NNAA 3P45B 3TANA 1WF0A 2SXLA 3NY0A 2IM2A 1XMOJ 4I6AA 4OMFG 3BGRB 2X1GA 2XNRA 3VQTA 2F65A 4BC7A 3HXMA 2BE9B 3BZQA 4P7TA 4N47A 2O3DA 4C3LA 2C2ZB 2CDQA 3C14B 3FUYA 4CH0S 3FMBA 3UCGA 4A46A 5HQ8A 1KN6A 3A8IA 3H90A 2WVCA 4QJVA 3CCJS 3Q2SC 2HRYA 3T6JA 4RBUA 4DS4A 1SC1B 2PT0A 4IOBA 4TLRA 1FRHA 2I0XA 2Z2YB 1I1GA 4OZNA 5D0HA 1S1WA 1RT6B 3N6NA 2K3KA 3VCDA 4LF5F 2K3IA 1WSRA 5L8RC 1HNZF 1TUGB 1U8SA 1IWAA 2LXFA 4JI3J 4NLSA 1ZAWA 3ENAA 4NLVA 2FIUA 4LBIA 4CLPA 3DFEA 3H20A 3I82A 4F67A 4U95A 1M90T 3D6FB 1GT8A 1ZBTA 1FVQA 1WF1A 1J5EJ 2CQ4A 3VZIA 2FJVA 2AU0A 2BDPA 2V9KA 1X4GA 3RRKA 2EFPA 1FK9B 1IKXB 3MMAA 4XPCA 4RNNA 4IQXA 2HHVA 4FYWB 3QJJA 2FTRA 1UJ6A 4M5MA 3RB6A 3FC9A 2ATCB 3MM8A 4ANDA 3CD0A 2QG9B 2HZVA 4IRKA 3P6YC 1UL3A 2E7WA 3KHLA 2ZBIA 5DQGA 2VZ9A 2CZ4A 5F0WA 1JLAB 2C22A 2J0QD 4KR0B 3D67A 2ROEA 1EQ0A 1C0TA 4JI8J 3FZ2A 3TEHB 1BWEA 2YX1A 4P2XA 3V6KA 1YRXA 4ZIVA 4F02A 1AT1B 1RDRA 2YKMA 4D3GA 1FXRA 3HHEA 4WZMA 1RT1B 2Y0SD 4MJKA 4BS2A 3K5PA 3HPOA 3EZUA 2HWTA 5BYSA 2MGZB 2ASLA 1FX2A 1T9VA 3BJYA 2BMBA 2GS8A 2F8EX 1DFDA 7FD1A 4USMA 4NCBA 2DIUA 3ZZOA 4QPTA 4ANEA 5DDPC 3KK2B 5KG6A 4UZBA 2UU9J 3O2IA 4K2JA 3C6UA 1UJ4A 1U25A 3VGSA 3M7VA 2X1BA 3AOCA 1GFWB 2V6AA 2ZWOA 4J9VA 3F41A 3MPUB 4NLYA 2R7QA 5K8MA 2YKNB 2CZ9A 3FEXB 2DR8A 4CTAB 1BGXT 2LMIA 1OYEA 1VDHA 4DUYF 5LJ3Y 1DBDA 1U0SA 1TKXA 3CT9A 1RTZA 1AFIA 5A6WA 1OY6A 3I31A 5GMKa 1VQ8S 3T19A 4FS2A 1N48A 4XPEA 1R31A 1F3FA 3QWUA 3V81B 4X66F 4OYZA 1KR4A 1UW9A 2EKYA 2Q43A 4MIWA 2C1EB 2WSEC 2BW7A 3KJQB 3OPKA 4DCOB 5KTQA 5F8GA 2R7SA 1T05A 1FJEB 5F8IA 3D3CJ 4PXDA 2E1RA 2RSQA 3GMGA 3ZNUA 3KYLA 2EC2A 3S01A 3K58A 3BQ2A 3T5HA 1EZZB 2A2DA 2D3OR 3ISNC 4OYWA 3ZC4A 2IA0A 3VVUA 4Q2MA 5AJ3J 2JVOA 1FI4A 1KP6A 1L5UA 4OZ1A 2P8IA 2H48B 2L41A 2CWXA 3WQPA 3DLKA 4F4WA 2HVEA 4JI3F 3KHRA 2OD6A 2JDJA 3C8YA 4L73A 5KFXA 2ZD1B 4UQGA 3OLBA 2ZH1A 4AL5A 2EWHA 1VQLS 3IG1A 1W25A 3S1TA 2RQMA 4H4MB 3SEOA 5IQQA 2KH9A 2E5LF 2GMJA 2BRLA 4UZCA 5I42A 1WACA 4DPWA 3OHAA 2VC1A 1SVDA 2MKCA 4FVMA 4YFUA 4J9LA 2CNKB 3SCLE 5KFIA 2Z30B 3B78A 3QT7A 4UOFA 1S1VA 1U4BA 1YBTA 4ELVA 4U9RA 5L38A 4MMOA 3M9MB 3M9OB 1IBMF 3M8QA 2HK2A 2HNZB 2P9CA 2V8DA 3SSQA 3N28A 3N6MA 3TJAA 1PYSB 3T1YJ 1W7WA 3R3TA 4X62F 3M2RA 1Z2ZA 1VISA 3SBMA 4A8YA 2DPIA 2C2RA 1REVA 4AD6A 1RABB 1DJ0A 3HVTB 3MMBA 1QTNB 4N77A 3FDSA 2R7WA 4ECUA 1UKUA 3AQPA 2RHSB 3PO4A 2MQQA 4QYZJ 2KTQA 2VBXA 5HVHA 3LAKA 5CYMB 1FESA 1SC6A 3QSYB 1BQMA 1QE1B 1WHWA 2V2KA 3T1HJ 2R7XA 1IKWA 1M5SA 2CPXA 2Z56B 1NDKA 1RBOB 2XQCA 2HBRB 1GH8A 4OI3A 1WJ9A 2FYXA 3ELHA 1TKTB 3OR2A 3TVZA 4X4QA 1H74A 4DQSA 1NAQA 1SKUB 2OTLS 2H4WB 4IFVB 4UUWA 5SUHA 1YJWS 1XNQJ 2MZJA 3MMCB 3ZZYA 4CT8A 4NCGA 3D9BA 4OL8A 1XR6A 3KDNA 4GMKA 2C28A 4ECQA 3HSGA 1N32J 1TVRB 1U45A 2HGLA 2NSCA 1SJRA 1NJZA 3S8SA 2CKWA 3LH2S 3MM7A 2YQ1A 4KO0A 5LOQA 1WKKA 3AHPA 1NK5A 4JI2F 1KLMA 2XMAA 2FHMA 3ETOA 3D2WA 4LF9F 2AEFA 1S99A 3X1LB 1S6OA 2B51A 3QT8A 2XSJA 2CJXB 2LVWA 3IM9A 4R8UA 1T8EA 2IBKA 1C2PA 3TA2A 1RT2B 3L09A 1X4AA 2MQ8A 3TAMB 5CD4H 4QWAA 2UXCF 1RZMA 1SQGA 2UU9F 1YJRA 2PO4A 3PIPQ 3MM7B 3K5MA 4B3MF 4PXEA 2GQCA 2HNYA 1XN9A 3R5CA 1N5QA 1R27B 1TVRA 2E7XA 4USIA 2KVIA 4E8UA 4ZS6A 1AZSB 4DR3J 3I0SB 4IG0A 4OJGA 4RNHA 1PYTA 4NCGB 3AY0A 3HD2A 4C8OA 3SXLA 2AKWB 2VF3A 2KHCA 4RW6B 1NM2A 1N33F 4LREA 4EWTA 2YNFA 2U1AA 2GIFA 1S1UB 3OR2B 3G6XA 1SB6A 2GX8A 1S6PA 5C25B 1YJUA 4N76A 2DXDA 2VKRA 3KXDA 3NWRA 4WXOA 5CYQB 5T41A 2V4JA 2ZFHA 2ALZA 3C66A 3EGNA 3ETMA 1BQMB 1LW2A 2EW9A 4ZHRB 1UAWA 1X5OA 1KLNA 1EJ7L 4WFXA 3M05A 4J9NA 2GHVC 4FS1A 1HBUA 1X9WA 3MOZA 2KG0A 2R7VA 4PYAA 2DKOB 5J2NB 3GIMA 2OIHA 2AF6A 1IR0A 1AROP 1B4SA 3FNNA 3VTIA 4RNFA 3NNCA 3I6PA 3KLEB 3UN2A 3LTOA 1KHWA 3C15A 3RG6A 2B6AB 1RACB 3WC0A 4YY3J 3QT6A 2CUYA 4G1QB 1Q95G 2W2QP 4OYMA 5HI7A 4F4YA 4A8FA 4QR0A 1HKAA 3KJNB 2HS3A 4JI8F 5DZ7A 5CA5A 1UVMA 3MXHP 1WDDA 1VQSA 2W2PP 2PEBA 4B3SF 4B9MA 3TP2A 1ZOTA 3GCWP 3D66A 3QO9B 1KVIA 2W24A 5DM6Q 4YS2A 3UCUP 2BJ3A 4NZ0A 3PNIA 1X5PA 2HNDB 3CJ5A 4DQPA 2RS2A 1PG5B 4WK3A 3MM9A 2QJ3A 2B7BB 1FCAA 2C2EA 4Y2CA 2MZ1A 3KK3B 2OFHX 2W4DA 2WONA 5D4LA 2KJVA 3SDEA 3C2PA 3G82B 1VC0A 4ID8A 2OEKA 3LF0A 2YVSA 1PAUB 1A6LA 1R0BG 3MI7X 5KFGA 3ICLA 2M4MA 4TN2A 5ETVA 2YH1A 2DR5A 3GU0A 1VQ6S 3T5JA 2JC1A 2FHJD 2PDAA 3TZWA 3JAMY 3R1HA 5BJRA 2XS5A 4LF2A 4LUBA 1DURA 4LFAJ 4X4NA 1R7IA 2ROPA 4ID5B 4KGZB 5L46A 4DV7F 2DD8S 3D6TB 1TL5A 1WI8A 1GMVA 5F8HA 2RS8A 3MD3A 4WFBQ 1U6ZA 4TY9A 3B4MA 3H25A 2DNHA 1WKLA 1WOSA 2XBPA 3DLEA 1NBEB 3LOUA 3M8YA 2LP4A 2ZOGA 4GVBA 2DJWA 2DHXA 1RT3B 4QYRA 1IWGA 5ETKA 5HJXA 1UTAA 3NS6A 1RAFB 1CQMA 2CQ3A 3R2DJ 3W62A 1NKEA 1Y5LB 3GSIA 4X84A 3RBXA 5KFYA 2W2NP 3CC7S 3OTCA 1S72S 3TR5A 1H7XA 2LEPA 2C3YA 5HAOA 2CFXA 2E1PA 2PFDA 4EBEA 3G2XA 5D0EA 4B9UA 2QC3A 3L95X 1RAIB 2HFSA 3KK2A 1ITPA 1SL0A 4IH7A 2D7SA 2F3JA 4DG1B 2LKZA 2IVFB 1JJHA 4KSEB 3GILA 3L4BC 2HKEA 1RBAA 3SI8A 3EGVA 1BD6A 1PJ5A 2CQHA 4URGA 3UDVA 4YQWA 2J0XA 1RISA 2YPZA 1Y00A 2QA1A 4LRDA 2RU3A 3KMSA 4OX7A 5GVQA 2DVIA 3FQLA 1DLOA 1S5ZA 4LSLB 3OSNA 2BX6A 4AYBD 1XR7A 4KO0B 5IOLA 2NR0A 2QEXS 4DV3F 2KYXA 2BOPA 1ZETA 4TQRA 3DI6B 4KV8A 4KGXB 3LGMA 4Z2XA 1JLCA 4ZN1A 2GV1A 5F8LA 3OT9A 3QZ8A 5F8NA 2HHPA 3JQMA 2IRXA 2OJ3A 2J9EA 1IN0A 1FE4A 1NJWA 2QN6B 2WOMA 3BKFA 5KOWA 3IWXA 3MMCA 2HQCA 2K1RB 3CCTA 2B8PA 4Y3CA 4ZPAA 4M94A 1Q82T 1JJ4A 1FNMA 3MCMA 1JJ2R 3G8TA 1FWKA 3ZTRA 1X4EA 2WTFA 2DBBA 3I5AA 2PA8D 3P49B 1D8ZA 1NHVA 3V4MA 5HSPA 3C46A 5LXYA 1QE1A 1NZAA 5DDQC 2HBYB 1EQMA 2FHOB 2EEYA 3EDRB 5HP1B 2VDHA 5AE3A 4NCAA 1KHVA 3CCMS 1BQNB 2FDNA 3TAQA 4DSFA 2WSCC 4G1IA 5KFUA 3J7Z5 2Y8WA 1RA6A 1RTIA 4RX6A 3NRBA 1SV5B 2UXBF 2YKAA 4UW2A 5F9NA 4ED5A 2FGOA 3UW1A 5BR8F 2PEHA 2KN4A 1SKSA 5HO4A 3T9NA 4IR9A 2XMUA 2CQDA 2QSFA 3OFEA 5B0GA 2OPRB 4A47A 1S10A 4CDIA 2PE8A 1NKCA 4UTGA 5B09A 4F4XA 2LQ9A 2IDLA 3KK1A 1JJCB 1FX4A 4LF4F 5EX3A 3R8YA 3BGFA 4ZCLA 1S97A 1WI6A 1HBMA 2V8HA 4C8KA 1TK0A 1HHQA 2MZRA 3PZPA 4OLPA 1Q7YT 1K8AT 3ZZ0A 4DSJA 3M1VA 4ZDNA 3H7HB 4J7CA 4NYOA 4ED8A 4OYXA 4RW8A 3HFKA 2MKHA 4HEA9 3W66A 1RK8A 1X0PA 2UVVA 3BGRA 4ATNA 2VOPA 3KNGA 4Y00A 1JLGB 2AEMA 3HHDA 3A3NB 3CJ2A 3D68A 1KQFB 1T9WA 1T03B 4GKKJ 1N0UA 2R2RA 1LKZA 2B4PA 4D3HA 2FY8A 1Q8KA 3OTBA 2XMJA 4A4JA 3PM9A 1NXIA 2V2VA 3ILIA 4DV2F 1X0FA 1Z2LA 2QA4S 3HMJG 5KT6A 2GIRA 2LXIA 3I96A 5IXUA 2GW8A 1NZ8A 4EI2A 2F9JA 3Q8SB 2HRTA 1SCJB 5E7OB 2QL7B 1ZM2A 5AJ3F 3IBFB 2HFOA 4P2FA 2CNLB 2HZAA 4JI6J 3TAPA 3V81A 1HBMB 2DNPA 3AH6A 1RYSA 4OJ1A 2KVQE 2CQIA 4NZ6A 4JV0A 4X65F 4M5JA 1IBKF 1TKXB 2UV8A 1VRQC 2Y9HA 3IS9B 4R0EA 2H5JB 1MSWD 2CQGA 2RUGA 5D4OA 2OPSB 4H4KA 3V6DB 3BYRA 1WTFA 3EM1A 5A6PA 3N5FA 1K0TA 2D9PA 3ILLA 2J0SD 2VU5A 2GVZA 5IT9Y 3KLIB 4NYPA 1CSJA 3OL7A 2ZUAA 1EP4A 2AYMA 4QYZK 2GGPB 1FDDA 3ZZRA 1WEXA 4GKJJ 1S76D 3CXCR 3H2VE 4YN3B 2HHXA 3DNCA 1U26A 1SIZA 2VBWA 2VICA 5KG4A 1HNIA 5CCMA 3KDOA 3HULA 1Q8LA 4CZCA 1NB2A 5AT1B 3SQGB 1N56A 2M88A 4DX6A 2W4CA 1N6QA 2VASA 1RTDB 1MU2B 2F63A 4ZP8A 1RGVA 1VFJA 4C3KA 3LWLA 4HR2A 1P6TA 5KFZA 3FBFA 3MM5B 4YR3A 2CPYA 5ETRA 5HLFA 4F25A 5KFBA 1TK8A 1JNZB 4ZKAA 1JLAA 3BO3A 1F9EB 2IJRA 4NEYA 3UPFA 2EBEA 1XK8A 1HIYA 2NZCA 2WVFA 3CD5A 4C8MA 5E41A 3KJVA 2ZVIA 3J7YU 1NDPA 1RHUB 4P75A 2CYYA 3EZOA 2BABA 1N36F 5L1IA 5ETTA 2BQRA 1E6VA 2ZJRQ 3W61A 2BVZA 1WUUA 3LP2A 1QSLA 3BB5A 4C0HA 3PYDA 2AYGA 3M2UA 4IRCA 4ECSA 2O66A 1X9SA 3M4XA 4FYDA 2FZGB 3Q22A 4FBUA 4Q43A 4ES1A 1IJEB 4LJMA 3EVOA 2POKA 2CIMA 4NI2B 2X1AA 3CCSS 4PQUA 1HNXJ 3M6XA 1Q78A 1Q8BA 3DRPB 4K5SA 2UUWA 2WSFC 3SV3A 1T7PA 4JV5J 5D77A 5DRKA 2W9AA 2C2KB 1U2RA 1J5EF 1T95A 1IXKA 2M9KA 4X66J 4K0KJ 2V94A 2BM0A 3ULHA 1VCTA 2HZCA 3M32A 2DTJA 4A8OA 2HRUA 1RTHB 1SBRA 2HQGA 1VOMA 1S59A 4WIIA 1GXUA 2Y0BB 1X7VA 2HK3A 2UUTA 1EKRA 2ZWPA 3AD9C 3O1LA 4YUDA 4CWBA 3JAMU 3JYTA 2J76E 3G6VA 4DUYJ 2HBZB 4C11A 2HQIA 1KDNA 2IY5B 3D1HA 4M5KA 2H54B 1I6JA 2BM1A 3X3UA 4JYAF 1E6VB 1YITS 5C5JA 4DUZF 1U1PA 2ZNZA 3PW5A 3HKWA 3MECB 4YDDB 4NLRA 2HVDA 3O5TB 3UI3A 2MQLA 4Y2AA 2OD4A 3W9IA 4ED3A 4ZK7M 1N5VA 1XNRJ 3OL9A 3VF0B 9RUBA 4YHHF 4MYUA 2HIYA 2R8IA 1ZM3A 2OSQA 5LSRA 3HJFA 2AD9A 1NSKL 4OX9F 1FRKA 1LWFA 1DQAA 1V5VA 1WWHA 5KT3A 4OI2A 2J6SA 4ILLA 4XDDA 2VPYB 3H8YA 4WF9Q 4I6YA 5J2QB 1Q16B 3MM9B 3RB0A 1SL1A 3DYAA 4Q45A 5F8JA 4NOHA 1HR0F 5A8RA 1WC0A 4YB5A 1YTYA 3K7RA 2UUBJ 1QM9A 1XQIA 4QIWD 4ZVOB 2B9WA 1LW0B 3FRYA 3PHEA 4DX5A 1SH2A 5HMXA 5HVGA 4ZP9A 5MAOA 4OHVA 2GVZB 5IC4B 1U24A 4U96A 1D8YA 1HYSA 4G1QA 2FJBB 4J91A 4X4RA 3MR3A 4ECXA 5KAKA 4DV4F 1VRTA 4DV6F 2R7TA 5EX0A 1FHTA 3IS9A 3TUZC 2FVSA 4J9PA 2A6MA 1G7CB 3RB4A 1N36J 1RHJB 4KYZA 3T6BA 3PXGa 2YNHA 2QRRA 4DBQA 4RW9B 1RWOB 5ITHA 4I67A 1W2IA 4Q2LA 3FBBA 5I3PA 2OELA 2VV5A 4C3MA 1H2UX 1RT5A 1SJFA 3AODA 1PIEA 1WG4A 5CYQA 2GVDB 1YJTA 2XWYA 2ZZNA 2ASDA 2XMMA 1S1UA 1PAEX 4CO2A 4DXLA 2UVWA 3W5XA 2JHEA 4CRJA 9ATCB 4WYWA 2W7PA 2E1MC 3SZ2A 2BE7D 2KT2A 3M6VA 2N4DA 2LQBA 3NP5A 4PPDA 4P2SA 4ZP7A 4G6VB 4KHRA 4DWIA 2XLKA 3QIDA 2FVCA 1RP5A 5DQIA 3BO2A 1BWVA 1VLYA 2B0GA 2DNMA 1VBYA 1T02A 1JLGA 1AYEA 2COLA 4PCQA 4F36A 3OTOJ 1UFWA 3B54A 4CM0A 4DL6A 2O1PA 2UUAJ 1M5KC 1UVNA 2RRNA 3FKBA 5D15A 4B3SJ 5H9FK 1RT7A 4M1KA 2BJ8A 1F5AA 3RBDA 1RAJA 1CQNA 1EHWA 3KLGA 2AGOA 2ZC3A 1M5VC 1HI8A 1JLFA 2WVDA 4KTQA 3HHLC 1SL2A 5DJBA 5G0RB 3GPAA 3RB3A 1TMJA 2MZSA 5D0RA 3VQSA 4RW7B 1PBAA 2Z2ZA 2ZOFA 2I1RA 1YVFA 2Q66A 4ZIWA 3GR1A 3DLJA 2QLXA 3NGUA 2R7OA 2BANB 4GVLA 5GMEA 4EUVA 4C6AA 2Y1JA 4I6WA 2VONA 2KB2A 4P2MA 3CVKA 4USHA 2ZH6A 4ECZA 3D4JA 4IFVA 4NXMJ 1BQNA 2J7KA 1REGX 3LW5C 5K9FA 4RUHA 2F4VF 3QFWA 3IRWP 4DFJA 2NLWA 4WP3A 3MPDA 1E6YA 2B3TB 1X4DA 3EPGA 4PRFA 3GFXA 4K4UA 1CJKA 1QUVA 2NUHA 3MPWA 3NWGA 2XC9A 3BDPA 2H4YB 1KVKA 3BBBA 2ZH2A 4B3TF 4EGLA 3RR8A 3J7ZT 5GAEI 3NGTA 2N3LA 3PHTA 3KLVA 2ZZTA 1P9YA 3HVTA 2JWNA 1CJVA 3MMBB 3PX4A 1SQFA 1T3NA 1OPIA 2CNNB 2MY7A 1TV6A 2FJAB 3MR2A 2DNLA 2GO9A 3R7NB 1VQ7S 1NH7A 4J37A 3UNYA 1U1RA 1ZA2B 3VR1A 4PG8A 3H5YA 3DI6A 4KV8B 5KG2A 5U47A 1RWNB 2NYIA 4B3RJ 1R0CB 1RTJB 3KKFA 4Y2IA 2P6SA 2LXUA 1UJ5A 3HHKA 2KXFA 4DV6J 4R0JA 3RAXA 2B9EA 2VBZA 2XS7A 2B7CB 1H72C 3JTPA 2BQUA 3KLGB 2E5JA 2OHDA 2F9DA 2BOAA 1RT7B 5DDRC 1J27A 2ZBQA 3DU6A 1VJQA 1PILA 2XZWA 1URRA 4TU9A 4PUOA 4DG1A 4IOAQ 1DTTB 5E3RA 5C24B 1AXQA 3JSYA 3GWCA 5LM7E 3C19A 4B17A 2LECA 2PGCA 3PYFA 2RHQB 3QBCA 1Z1ZA 1HQUB 2W2MP 4DN0A 3CD6S 5AXMA 4K4SA 2CG8A 1YK9A 5D0GA 2HLUA 2KHDA 3M2VB 4UY8T 2FZKB 4J9QA 1S1XB 1R8BA 2JC0A 3Q8QB 5A8WA 1G4CA 3GFHA 3W63A 1YHQS 4QOTA 2AZ1A 4M63A 2Q1LA 2QSWA 4ZN3A 2RIJA 1CBKA 2RDDA 3KG1A 4QR1A 1DTQB 3B82A 3DLEB 2GVDA 4OV1A 4ZVQB 1NK4A 1ZM9A 1JXVA 1FTCA 4ED7A 1VQNS 2HW3A 4KH1B 2A6OA 1X8DA 3NGSA 1FJ7A 1AA1B 4CLFA 3AT1B 2YNHB 4I2QA 4ZOSA 2IVMA 2DNOA 3OXFA 3R7SB 5IWAF 2ZJQQ 2UVUA 3GV8B 1KVJA 3VALA 4M5NA 1BLUA 1DQ8A 1DTQA 2HGMA 1VC6A 2BRKA 1RHQB 3T41A 3BH7B 1UP1A 1HBOB 1UEUA 2EFOA 3BBCA 1XWLA 3CJ8A 3K5OA 1R89A 3H0PA 2VUGA 3IO1A 5A76A 4DN9A 5RUBA 1XMQJ 3I55S 3E2EA 4FXDA 4C0OC 4I0WA 1OO0B 4NMXA 5LMNF 3I0RB 3PV8A 2V68A 1HHTP 1VBXA 4RL1A 1A7GE 5B0EA 1WHYA 2U2FA 3LALA 3G82A 1LW0A 8AT1B 2CJAA 3V5RA 3W2WB 2XY5A 4YP3A 3OVAA 2MKIA 1CJUA 3KK3A 3OR1A 2LDIA 2Z0GA 3EWGA 4NLPA 3G4SS 3PX6A 1TAUA 3SCIE 1QDUB 3JSBA 5KG5A 2DPJA 4YY3F 2VG5B 3MAHA 4PWDA 4MIBA 5F3TA 1TUVA 2KFYA 4JV2A 3HCXA 2AQ4A 5AE1A 1VHIA 4L75A 1WC6A 3DDNA 3DYAB 3ENVA 3DKDA 3QNWB 4ZP6A 4JI5J 3NNHA 2CA9A 3CW2C 3HZEA 4OZ2A 5KFOA 2OLWA 3TZYA 1LWFB 1MWQA 4HVZA 2YWKA 4EYHB 4DPOA 4LFBF 1LEOA 1HHSA 2XZDB 4Y2KA 3I87A 3CJQA 4ETZA 1FF2A 1XR5A 1VS3A 2WAQD 2X3GA 1RWPB 3CCZA 4XDCA 3N4WA 4AT1B 5K14B 3OUYB 3UNGC 4F50A 4EU0A 1APSA 1IUJA 3HHLA 2AP6A 1OY8A 1ZM4A 2CADA 2DH9A 4MTPA 1V6HA 4UF4A 3OHBA 1N34J 4P72A 5HANA 2MTLA 1LXNA 1RWVB 2YXLA 3MMAB 1KD1T 4CIOA 4B9SA 5AXNA 4UUXA 2AV5A 3ZNJ1 1LW2B 4ZHRA 3D5MA 2M5YA 3WBZA 1CJKB 1GMWD 2V4JB 2XYPB 2W1BA 2MSSA 3MCOA 5IC6B 3NMAA 2JH3A 1UMJA 1AUSL 1S6PB 2XI2A 5K8OA 2R7RA 3CDBA 4DPUA 4ECTA 1L3SA 2B9XA 4USWA 1WTBA 2Z57B 1NPRA 1A0OB 3CIZA 4YDXA 2HLTA 2ZH7A 3CCLS 1KRPA 5FJ4A 2DNGA 2LA4A 4IFYB 1IQZA 3DCAA 1HARA 4NLDA 4F4KA 1LWEA 2FHKA 1SIWB 3DRRA 4H4OA 4JI2J 3O44A 2CPHA 2IM3A 1G1XA 1FTRA 3H2UB 2ZDPA 3THTA 3DLHA 1FKAF 2PC6A 3MFIA 4PXBA 4ZCMA 2L3MA 3CC4S 5T14A 2W01A 3RW7A 4LIRA 4DCPB 4PG5A 4IDKB 3GG0A 2XSJB 4M5HA 2G4BA 1CC7A 3W5ZA 2PMZD 2HPUA 4DR7J 5GAHU 3OXLA 2KT5A 4FKXA 1FKOB 3HFZB 2Z2LA 3P4UB 1KLMB 4GO7X 2B9YA 4TY8B 1S4FA 1UZHA 1S12A 1NK7A 2ZH9A 2V34A 3KJVB 1HFEL 4JI5F 1QAXA 2KJWA 1UZDA 3IA0A 4L6V3 5FIIA 3JB9k 1U6FA 3IN5A 1RWUA 2HFZA 3DDKA 4LF6J 4KFBA 2PN6A 3AJDA 4Q0BB 4ED1A 1B7FA 4HDGA 2CDRB 3VAKA 3QQCD 1N6QB 2Z4PA 2GJFA 3SQGA 3SQOP 1IKVB 1M5HA 5EUHA 1TL1A 1TKTA 2MQPA 1J5OA 1QAIA 1U6BA 4F8RA 1Y10A 2UV8G 5BYRA 3I4HX 1L3TA 3BEGB 3DM2A 4FVCA 3HVAA 1X9MA 2D3UA 2J9CA 3DMJB 2CPFA 3MM6A 4PZVA 4HHJA 1C0UB 4L74A 3UR3C 2QFJA 2WVBA 3EYZA 1JIHA 1ULRA 4JUZA 4ED4A 4I64A 1KQKA 1I94F 4U7UK 3CC2S 2XGQA 4B3TJ 4DR4J 2I5JB 3AD7C 3HFVA 2DO4A 3V6DA 2YNGB 4PQAA 1YBAA 5EWFA 1X60A 1FEEA 1RAOA 2LEAA 1R0AB 1HYSB 4OZ5A 1SJ3P 2D69A 3QPIA 3ET6A 4MK8A 2V4RA 1ELOA 1FNXH 3NGDA 2CWKA 1WHXA 4PWUA 4ZVRB 1T3OA 2RJZA 2DR7A 2FGCA 4LF1A 2G1DA 5GAGU 4X4TA 3PVXA 3QZ7A 2L9WA 4KH0B 4OYBA 2IHR1 3DRXA 4QBUA 3FSXA 4C8NA 2DNRA 3BBFA 3WC2A 4UOGA 4WU3A 1N5YB 2NXNA 1P8GA 3DOLA 4XAKA 2RDJA 3PR5B 4X64F 4EZ9A 2C3OA 1RSCA 2ZM6F 4OZJA 2VOOA 1MMNA 5LXRA 1NK0A 1OMSA 4ANCA 4DR7F 3EDQB 1WF2A 1C1CA 2FJDB 2CZVC 4WFNQ 5KFQA 4RW4A 5A2QY 1H3DA 2NUUG 3AXMA 4WFAQ 1T03A 3L7OA 3EICA 4P71A 1EX8A 4R25A 2E29A 1U8WA 5H1SV 4YR0A 3PYEA 4LF9J 3QFHA 1U48A 3MECA 2WBMA 4LRCA 4F2RA 3PRBA 1T05B 4NL5A 2DHHA 2DH8A 2DHSA 1Y7PA 2W25A 2DNQA 4O3OA 1RCXB 2W9CB 3MF5A 1S9EB 4XTTA 3OTOF 3JYTB 5JJBA 1OSDA 3BREA 3A8KA 4TYBA 3WHIA 4AUKA 4DU8A 5KFHA 2XLIA 3W3SA 2ACYA 1HWLA 3ITHB 1ZPWX 3PG9A 2DR9A 5CAAA 4NRUA 3NXZA 3CCVS 5KFMA 5DDOC 3RBEA 1JLEB 4QU6A 2RKIA 4P73A 4ALZA 2Y1LB 2RF2B 2YKNA 2YWHA 4P52A 4CTAA 4CLUA 3BQ1A 2N7CA 4Y2MA 2CJ9A 4FDFA 3PIOQ 4O3SA 4UY85 4ZVTB 1SJ4P 2OH2A 4P74A 1F5BA 2DNNA 2B5JB 2BUNA 3R5AA 4CLWA 1F3VA 2G0CA 1VQOS 2VBYA 5HQLA 3EXYA 1HWJA 2OAUA 1GX6A 2GA7A 4O3NA 3IGNA 3RBZA 3UFCX 2ZC4A 5L1LA 1VYAA 3RRGA 4X4VA 4DV1J 1WC5A 4GC6A 1T9UA 2HQFA 5IQ6A 3OSPA 2OI2A 4KQZA 2CNOB 3CTRA 3MZIA 3J80Y 2VODA 1A9NB 3RRHA 4ZPDA 2G9OA 4Q5VA 2YKOA 1RT1A 3BGUA 2NYHA 4FYVB 1S6QA 4OV6A 5F8MA 2HHHF 4NA1A 2EVZA 2OP5A 1Y11A 2XHWA 3V4IA 1C0TB 2ALYB 3H4BA 3VZHA 4A8XA 1WSVA 2BQ3A 2R8JA 3V4IB 4TKTA 2HS4A 2YKPA 4LR8A 1UVKA 4EO8A 3MM5A 2W9CA 4ES2A 2PI4A 1NSAA 3ENWA 1RE1B 4TU7A 4LMZA 3AJ2A 3BSAA 5IS2A 5ETLA 3QMQA 1X4FA 2GIQA 1IKXA 1Y5NB 1SI9A 2OO4A 3FFIA 1TKZB 3N01A 3CD7A 1FK9A 2GC8A 3TO8A 3PW4A 1YI2S 3HO1A 2F4FA 5KFPA 1MW7A 4DI6A 4DQRA 2ZITA 4K4ZA 1DHMA 2KO1A 3H5SA 2AJ2A 2DHAA 3HT0A 2XO6A 4IOCQ 4DR2F 4MAKA 3OVBA 5ETMA 1EP4B 4DZDA 5C2GA 1MN9A 4R5PA 3EGZA 2J7UA 1YBUA 1JKHA 3IAS9 3RGIA 3PEJA 3BSNA 2E9RX 4ELUA 5DETA 4Q44A 2ZM6J 4FNIA 2HFNA 3TEGA 2OEJA 4HI2A 3ZTQA 1U1LA 1R43A 1LV5A 1SC3B 4HI1A 1VBKA 2OPPB 3S6EA 1UEVA 1ZPVA 5GAGI 5T7LB 4PAAA 4WCEQ 2FVRA 1BC6A 3CDAA 4LR7A 1RAGB 2AJ0A 2KT3A 4LBPA 4O23A 2IA6A 2ZKUA 4GVBB 2ZDOA 3TI0A 1G3OA 2X51A 3A3PB 4CI0B 5J2PB 1NHUA 2V9WA 1X5TA 2V69A 2DEJA 2BJ9A 3ZTOA 4L3KA 2VFRA 3EJMA 3TNVA 4ER8A 1JB0C 4JI1F 2QLJB 4HLBA 1FDBA 5B0FA 1KTVA 2R9LA 2YX4A 4ZJLA 2R4FA 2FHJA 4LFCJ 4IH5A 1FJCA 2VG6A 5DO2A 4USJC 5MLCV 1C4AA 2J9DA 3KHHA 4L3NA 1XMBA 3H5UA 1HMVA 2FLOA 2HHSA 2F7VA 4RW4B 2H1YA 2ADCA 1S57A 4W4MA 4DR5F 2WONB 1C1CB 4K7QA 4CM2A 1EIYB 3K5NA 2ERRA 2VG6B 5EHHA 2B43A 3QRRA 2GO8A 2XHCA 1SC4B 2ZVSA 4DR5J 5DGAA 3LPYA 3K89A 2LFVA 3LGNA 3DOLB 1RU2A 2HQ3A 3CJTA 3EUNA 3NGRA 2W7OA 1ZTTA 4RW8B 4NXMF 2WK4A 2HNDA 3EMTA 4IO9Q 2EI5A 1Q81T 4N8NA 1VQKS 4HHUA 3GFYA 4NLWA 1XBWA 3G96A 1Q5YA 1S7IA 3QIPB 4NLXA 5B0DA 3RAMA 4HDHA 3KHGA 4KHPF 1QAYA 2BE2B 3GIIA 3R9LA 4HYKA 2ACMA 1TMMA 1B7YB 2DXEA 2APOA 3W65A 2XMWA 2CVIA 4I1TA 4OX8A 2B6AA 5M2PA 2DXFA 3UVJA 2K06A 4DFPA 3W1YC 2YTCA 2GHPA 3R7BB 1FWPA 2IVYA 4U8YA 2F8MA 2DYAA 5FDLB 1HQ2A 4AFFA 3SSRA 4R5PB 2AEJA 2RDIA 2C2MB 3QATA 4Z37A 4OI4A 2WBRA 2FLLA 4MFBA 2CPEA 2L9DA 2X7IA 3MR7A 2C3UA 3NLCA 5KFTA 4MKAA 5I4MA 2IRUA 1NPPA 3MTJA 4BWMA 4DV4J 2X3DA 3J7A1 1QY7A 1NSPA 4DU7A 2I2YA 4WXWA 2YNFB 3OTDA 3LA0A 3NCQA 4BCAA 2CJKA 1RAAB 5LSLA 4RW6A 1EKSA 2K1RA 4OZ3A 5GMDA 1PYOB 5KFRA 2HG4A 3DGVA 4UT4A 1JNRB 3KG4A 3P5BP 4WWSA 4Q0BA 1H7WA 1KKHA 1RAHB 4KT0C 4AQYJ 2IMWP 4K50A 2FC9A 3EXCX 1U49A 4CO5A 2B4UA 2CQ0A 5IV4A 1Q79A 1P1TA 1D09B 1LQ9A 2J8SA 3WIUA 1DLOB 3Q24A 4EYIB 5BYQA 5CYJA 2EFQA 3OL8A 3DOMB 3N0VA 1NSQA 1FRLA 4WJBA 3UE2A 3I9V9 4IDKA 3PRDA 2H65B 2YQ3A 4HACB 2JEFA 4UOCA 4JV5F 2CQBA 2R2TA 5I3UA 2QLWA 4OJ3A 3TA0A 1L3KA 1YRUA 4HTIA 3CJ4A 4O3PA 3S7RA 5EWEA 3O8WA 5F9LA 2B5JA 2DK2A 4I69A 2LA6A 1RHRB 1YJ7A 2EK6A 2FUG9 3D3BJ 4HL9A 4IKAA 2Q6BA 2MXYA 2MKKA 1U1NA 1M1HA 4FXVA 4K4VA 2DEIA 1OY9A 2RF2A 3IBCB 3AAWB 3BM7A 3BR9A 4JI0F 1XERA 3RR7A 2M8DB 4WKRA 2HVZA 3DLGA 3EVMA 3CSKA 2RQCA 2AYBA 1K0VA 2OMOA 4OYAA 3ITHA 3BKUA 3V2UC 2N3OA 4DV7J 5A0YB 1MMDA 2UXDJ 2NCKL 2AJ4A 1FXLA 2MJNA 1B70B 2YNIB 3BQ0A 3WZ0A 3R2CJ 1IKWB 2E5IA 5D78A 3ZZTA 2HHWA 1IBLF 3GYNA 3GSDA 1UW4A 3KUEA 4B9TA 2W9BA 4E0DA 1QTMA 1FFSB 1FFWB 5LMNJ 4GRSA 4HH1A 4ICLB 2HVIA 2DGUA 3EVWA 5IT4A 1XNRF 1SQEA 1FFGB 4M5DA 4QU7A 4CP5A 4DL0C 1OQ6A 4FZVA 5CZVA 4DV0F 2GAGC 2QIFA 3IGVA 1DY3A 1REVB 1YSJA 2BYCA 2DNKA 3HHLB 4HHHA 3CJKA 3TYTA 4BDPA 3BN7A 1WD6A 1FO1A 5E0OA 3GJSB 4ZVGA 1UVJA 2HHUA 2VA3A 1TL4A 4LF7F 2L08A 4GKJF 1R6VA 1AW0A 4FF1A 2RUSA 3QLHB 4P9SA 2M3DA 5THWA 5KG3A 1MROA 3BN4A 4BWJA 2XLJA 1S0OA 4FP9A 4B9NA 4U7CA 5ETOA 2VPWB 1NU4A 2PA3A 5KFCA 2XB2D 4JI7J 1EETB 2B4OA 2RD5C 3GTYX 3NAIA 1GTEA 2ZD1A 2VG5A 4PWDB 1X4BA 2QT7A 3NBPB 3OR1B 5LL6d 4JBCA 2G0JA 3QGPA 5M2RA 4LF8J 1KC8T 1KNZA 2H3EB 4RUBA 2MJUA 4FF3A 1QLNA 2R2UA 1FWLA 2YNGA 2GJIA 3QWPA 2YKQA 2MDAA 4LR9A 4TVAB 3W5YA 5KG7A 3CE8A 2A3JA 2HQDA 2MPUA 1MLAA 3MWBA 5KG0A 4IUFA 3OQ2A 2NPFA 3TVKA 4DL5A 3KUHA 3VV2B 4ZVPB 1VRUA 3FSIA 3Q23A 4AL6A 1PJ6A 4NE9C 2DGTA 1L3UA 1G6BA 4FXWA 2DGXA 4RPFA 4CLLA 2MZQA 4O4GA 5GADU 3EX7B 1FRIA 2ZH4A 3RYLA 4EBDA 2UUBF 4G3IA 2J7WA 4DV5F 5C25A 3A8EA 4B02A 2Y1IA 1TL1B 1S9GB 4QIFA 2EXUA 2XMVA 1J5OB 3NGKA 3GZ7A 2JEIA 3ISZA 4DUTA 2MEWA 3BO4A 3MEDB 4DV5J 2LU2A 3LP0B 5FLXY 1RWWB 1P9QC 2OGUA 2OKQA 2WVEA 3PYGA 4CH7A 2ZEJA 5EGYA 1JX4A 2MLXA 3I0SA 4ZPVR 3PKMA 4DQIA 1AZSA 4KFBB 4KJIA 2C3PA 4O4RA 2PMWA 1WC3A 2ZUGA 2JLEA 2IBOA 1PKUA 1SUQA 2ASYA 2XWXA 3DOKA 1HPZA 4K5RA 5ETSA 3Q89A 5HK4A 1RYRA 3PCOB 2MKJA 2OPQB 4K0KF 5EWGA 4USTA 5DGBA 1DTTA 4MK7A 1HNZJ 2NZ4A 3TAMA 1VQ4S 1CC8A 1RT2A 4PUOB 3TJ8A 2W7AA 1RT4B 3IRXB 3A8JA 4DV3J 1U02A 1KSPA 4FPIA 4HH0A 4KGVB 3E3XA 4H54A 2KDOA 5IT0A 3KLFA 5E33A 4GO5X 4MIAA 2ZH5A 2GZOA 2XSFA 2NSBA 3G8QA 2GMHA 1H0HB 2Y8YA 2NXJA 1KFDA 4KKOB 2CQ1A 3AB2B 4MYTA 4NPOA 4O0NA 1LWEB 4WIQA 3WX4A 3CO0P 3BV8A 4AE5A 4U7UD 1WKJA 4TQSA 2P5VA 4NLGA 2ATLA 3CCUS 1NO8A 1FJGJ 1D3WA 3THVA 4A8QA 3CCQS 2JEGA 5AE2A 4LF6F 4TYAA 2FC8A 4RJVA 2VFVA 4ECWA 2MMYA 1MG7A 2RRAA 4YHHJ 4X4OA 2CPIA 4JP8A 5B0BA 3SCKE 5CYMA 1U0HB 1Y3JA 2ROGA 2DRAA 1T11A 2QZ8A 2MB0B 2ZBPA 4O3QA 2BV3A 4QIGA 3W64A 5D8HB 1YZ6A 2H5EA 2EFVA 4DHVA 1VLOA 3MCSA 4WK1A 3IWLA 1WDTA 4LBHA 3HLUA 2KZMA 1RT6A 4IRDA 2XM3A 2HYIB 1WG1A 2GQ2A 3VAIA 2Z8QA 3M8PA 3PR4A 2O5DA 1RXOB 1VI7A 3VVTA 1SH3A 2QYCA 1TL7A 3DXBA 2GMLA 2O67A 1RWKB 1VHFA 1ACMB 3FBEA 1NPKA 3UO0A 4CYUB 1RT4A 3IRXA 3QGGA 4IG3B 3CCWA 5I42B 2UUCJ 1WNEA 3NCRA 2JZ5A 1HWKA 2RAQA 4IQMA 3VAGA 3IG1B 1GXLA 1PBUA 2XULA 2UXBJ 2HAIA 3TA1A 2VJUA 4NMLA 2XEXA 5H9FJ 4WFYA 5C2CA 2QA4G 1CJUB 3M9NB 2JFKA 3DOKB 2ZBRA 3R5JB 3W2WA 4RUAA 4K4YA 3T5KA 2EC0A 4LQ3A 2DB1A 4K59A 4B3MJ 4KIAA 2ZHOA 1YDLA 2HHTA 1I5OB 5HBMB 1JLBB 1XIQA 3N5BA 1B0TA 3MDFA 3F73A 4JI0J 1G2EA 3DXSX 1S49A 3LP0A 2A10A 4J9SA 2CAJA 1HBOA 2DNZA 2HWHA 4TNOA 5KFFA 5KT5A 2VQFJ 3BSCA 3O3LA 1B99A 1R3NA 2CXEA 4FYXB 2EG2A 3IC1A 5J1PA 1I51B 5HATA 2AX0A 2PFFB 1KEKA 1X31C 4F26A 3SYZA 4FPRA 3NAHA 1N4LA 1K73T 4K4TA 4DF4A 4M95A 2CPJA 5KT7A 4C97A 2QV6A 3HD1A 5IFMA 5GAHI 4CLZA 1HNWF 1K9MT 1CS4B 1YZ7A 2QTWA 2V67A 1NUEA 4N41A 1YWXA 2B56A 2J9DE 2RQKA 3K2YA 7FDRA 2LQ5A 2MKSA 5IT9U 4LFCF 1HD1A 4RR5A 1TFYA 3P8BB 5J1NA 3FCWA 1NJYA 4RWWA
chains in the Genus database with same CATH topology
2R2SA 4NYZA 4O44B 5IM0B 3GIKA 4CNZA 5F41A 3OFGA 3K8WA 3BGLA 3T3FA 2JLFA 1FXDA 3C6UB 1HQUA 4N5SA 1FJGF 4LSNA 1YGYA 5KFWA 4OZLA 5A8RB 4N56A 1U7LA 5HMWA 3DC2A 2OFGX 1IM4A 2B4VA 3QYYA 3UQSA 1SKRA 4C8YA 3ZFVA 1UA0A 4IG3A 3D1QA 3M30B 2MQOA 2L9NA 4JI7F 4PKDB 1AFJA 4NZ7A 3M8PB 4B9VA 1FE0A 2FD2A 4QPXA 5DQHA 4NLUA 3Q2TC 2W8KA 5KFSA 3IWNC 1B64A 3MM8B 2PI5A 1UETA 1KOHA 3LANA 4ILMA 3US5A 2DO0A 1QUPA 4C11B 3HT3A 4YMEA 3T1AA 1TKDA 1JK9B 3ISND 1C4CA 2KU7A 3DHXA 2I9SA 1E6YB 2XG8A 3O6QA 4NRTA 2XCPA 4KGMA 1F0XA 1PO6A 2EFNA 3DLGB 2ASJA 2E9TA 2M70A 1PC4A 4C2MA 3PW7A 3AB4B 5HMZA 2VG7A 3I5BA 2BANA 2DGVA 2RILA 3DRPA 3PEHA 4QWBA 2CPDA 2XNQA 4PPZA 4EZ6A 4ZMMA 3CUNA 5D3GA 1OQ3A 5I3UB 2XS2A 5G0RA 3M2UB 2BBEA 4ZA1A 2KFZA 1JLFB 2PIIA 5E3CA 3CWJA 5HROA 4CO3A 2YH0A 3HI9A 1DAXA 3DGPA 4ED0A 3NMRA 3MMJA 1R6YA 1RQ0A 4OQJA 2CVEA 4DOZA 2WB4A 1LFWA 2OPQA 3OV7A 4DLGA 4ZLPA 3RAQA 2E5GA 1SUQB 2YWFA 5DG7A 4OI0A 3OL6A 2XY7A 2IFXA 1S1TA 2IAJA 2IC3A 2YX7A 2VQFF 2JOQA 3W2VB 4KE5A 1S77D 4DSEA 4DSLA 1S9GA 2HWIA 5DLFA 1L3VA 1VJWA 3DRSA 4Y65A 4OFZA 4O4GB 4HTJA 4MFBB 2MZTA 2RE1A 1OS5A 4TLQA 1HNVA 2ZHBA 2ZKTA 4X2BA 5CQGA 2IJNA 3HX9A 1KQGB 5KT4A 1FD2A 3FCHA 5FDLA 4QW8A 3PO5A 3MEEB 3E51A 4MH8A 1U1MA 2R8GA 3TUIC 4ITSA 3TQ1A 2E5HA 2JRSA 3E01A 4UQTA 2UP1A 3OFHA 5KFAA 2N82B 4LVOP 2JL9A 5CCLA 4QIVA 3H5XA 2HS0A 2D41A 2WRMA 3CCRS 2FJEB 2WHOA 2ZH8A 2BXJA 1Q4RA 2GNKA 3MEGA 3MUTP 4DR1F 2MSTA 3NBPA 4YB1P 4U6PA 2BJEA 1D0EA 4ERDA 3U1NA 3RZAA 4FNHA 1GNKA 3SFGA 5SZTA 3Q0AA 3HHLD 1VQPS 5JXSA 3D0GE 3NL0A 2NXUA 1IKYA 3KOAA 4WE1A 2IYGA 3QLHA 1HNXF 2VQEF 4DS5A 1TP7A 3QGIA 1N0VC 2MY8A 1XC9A 4J9KA 2LLZA 1VIOA 2QMWA 3U7JA 4OX6A 1FEHA 3UDCA 3WBZA 3GG1A 3POTA 3MEKA 2KXHA 3OXGA 1FRJA 3L3CA 4B3SF 3CJKB 1JMTA 2JFDA 2LQJA 3PFOA 2DCUB 1HA1A 1RI7A 2CQPA 2E44A 3LP1A 4QWDA 5K8NA 1KFSA 4X4UA 4J9OA 3W7BA 3J81Y 2GCFA 3G6ES 2W9BB 1XMOF 5AXLA 1Z4UA 5D3GB 3ZZUA 4B3OA 3MTKA 3U27A 1H2TZ 2YWEA 2AW0A 3KK1B 1ZTWA 4Q7AA 2D74B 1BQXA 1NNDA 4A8KA 3UD3P 2OPRA 4DF8A 4RUCA 2F8HA 1TZ0A 1V3ZA 2MHNA 2VPZB 3AQOA 1SV5A 3KWMA 1RTIB 2C2DA 4DL4A 4CO1A 5L1JA 1KS2A 2FLNA 1HD0A 2KG1A 2ILZA 2M7SA 1NJIT 2WCXA 4EBCA 2AX1A 1VQ9S 3BS9A 4V19X 2D9OA 1JLQA 4QR2A 1NEEA 3QGHA 3THPA 4QWCA 1P27B 1WG5A 2EK1A 2KZZA 3LP2B 5J1EA 1M1KT 3DOMA 2IM1A 3H40A 4NLTA 4B9LA 3KFWX 3BDEA 4YOEA 1F60B 1TL3A 2CG4A 3OW2R 3KTQA 2VA2A 4P7VA 2KRBA 4YR2A 5A8KA 4P6QA 3HVRA 3H59A 1OPZA 1WEYA 2MHEA 3KLHA 2N7YA 3LUYA 3H4DA 2C42A 2R8HA 2GQQA 4RU9A 5HLFB 3D54A 3I5CA 3ONQA 2V5HG 2FB0A 2JVRA 4DJBA 4XO0A 2DR9A 3BR8A 5CZXA 3GQCA 2Q6CA 4Y28C 3WDOA 1RTDA 1UVIA 2WW8A 2V4QA 4MKBA 5J1EB 3PX0A 3ZZZA 1HNIB 5B08A 1SJQA 3T9ZA 1S79A 1JLQB 4DSIA 4FF4A 1YJNS 2GFFA 4DFKA 3M6UA 3AJ1A 4I56A 2XGPA 2DRBA 4LSNB 2K2PA 1O0PA 3J7YI 5KFNA 2DGWA 4K2XA 5DLGA 2MQMA 2K8GA 4U67Q 2FVQA 2HVHA 2VL1A 3KLIA 1TR0A 2JSXA 1D9DA 1QSYA 1NJXA 2RKIB 3OJSA 1B0VA 2JEJA 2CQ2A 1NRKA 1HL6A 1RT3A 5KFJA 1D9FA 5J2MB 3RU0A 2WB1D 1RKIA 3C6TB 3H2LA 4C4WA 5H9EJ 5HMYA 1RJJA 1F5CA 1LFPA 2GJ2A 5HN0A 3PKYA 2E1CA 3NKYA 2JJ4D 3LP1B 3U1MA 4IO1A 2HIQA 2M52A 2M2BA 2FVPA 4JOUA 1HQEB 5E3QA 4A8MP 3POTB 2CQCA 3QJPA 3HK2A 3ENQA 4HT5A 3F56A 5D6GA 5GAEU 4OLOA 1H2VZ 4BBYA 4NLQA 5IZHA 1S0NA 2BZ2A 1FKPB 4LIWA 1H38A 1FRXA 4F4ZA 1MMLA 3LWMA 3MGJA 3N6LA 3TARA 1Y0HA 3U02A 3M1VB 3PJXA 1XMQF 4YB6A 2F40A 5ADZA 4DL3A 3QO9A 3TX8A 2IM0A 3IAM9 4EO6A 1M0SA 1UA1A 4C9DA 4ILRA 1Q86T 2HHQA 1QSSA 1LK5A 4KPYA 2DNYA 4I2PB 3T1HF 2CJBA 4WTYA 5CH7B 3M8RA 4DV1F 2OPPA 1CPZA 2J0WA 1N34F 3TW0A 1TFWA 3M6WA 4QQBA 2NPIA 3E01B 4LQ9A 1MWYA 4TXSA 4WZQA 1FDNA 4HT7A 1JKHB 1HBUB 3FEYB 3RTVA 3CB4A 3UWTA 2LU1A 3UCZP 5HP1A 1FRMA 1VQYA 2DGOA 3DMJA 3PY8A 5E3PA 2IMOA 5EDWA 4B9MA 3DRSB 2H9ZA 4Y6IA 4A8WA 3G6YA 4WU2A 5KFVA 1Q1KA 4YB7A 1WELA 1UWBB 3EGWB 1S0MA 3FFIB 4NWBA 4DDFA 1PC5A 4QCLA 5DS7A 1FERA 1NH8A 3W2VA 4AXIA 2WOMB 4X4PA 2ADBA 4WYLA 1VMBA 1MNEA 3V6JA 4BC9A 3DLBA 4KKOA 4CO4A 3CPWR 1JLCB 2HNYB 4ED2A 2LYVA 3FGVA 3NCPA 2AJFE 4CH1A 4F3MA 1KQSR 3CMES 3MOJB 2P9GA 4LSLA 4TY8A 1S6QB 2XY6A 1FKOA 3FZBA 3KNAA 2CJQA 3CF5Q 3MFHA 1OIAA 1M5PC 5HROB 2UVRA 1TQLA 4DQQA 5DG8A 3QAEA 4V19J 4AL7A 3G71S 4URQU 3K8VA 3HHNB 2R8KA 1SJ1A 2BJDA 2I38A 3M8SA 3G86A 1FD8A 2VFTA 3DRRB 4H4OB 4KAIA 4PG6A 4F3QA 1NK6A 5L9NA 1F9FA 2OMLA 4IFYA 2DH7A 1JLEA 2A18A 3MEDA 3VAHA 1YQHA 1X4CA 3SV4A 4I7FA 3VAJA 2J8AA 4DR3F 1GXTA 4QIEA 4NX9A 3DRYA 3Q8PB 3D0IE 4ZCKA 2LCWA 3VWSA 3T1YF 3OVSA 3SFUA 4ID5A 2Y1RI 1S48A 2A1BA 2XMTA 5GADI 4OI1A 4M8LA 1BY9A 2KI2A 2MQNA 4PG4A 4QWEA 3M2RB 2VH7A 5K14A 4A48A 5DG9A 5LJ5Y 2HNZA 5LSOA 4C7QA 4W92B 3IR5B 2HGNA 1O51A 1VK3A 3HM9A 1C1BB 3SDEB 1JXLA 2O01C 4ZVEA 4K4WA 5LMUF 3CEDA 3M30A 1X4HA 3TRGA 3MAQA 3UDLA 2P6TA 1N5YA 1EETA 2FLPA 1JXEA 1CVJA