2KXHA

Solution structure of the first two rrm domains of fir in the complex with fbp nbox peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
199
structure length
199
Chain Sequence
GAMAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Poly(U)-binding-splicing factor PUF60
publication title Molecular basis of FIR-mediated c-myc transcriptional control
doi rcsb
source organism Homo sapiens
total genus 45
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA01
2KXNB 1JJHA 1H6KX 1QVFR 3UE2A 1X4CA 2G4BA 4WCEQ 2M88A 2LA6A 1SXLA 2RS8A 4FXWA 5DDRC 3NNHA 3VAHA 2E5IA 3VF0B 1M90T 3EGNA 1X5PA 2DO0A 5GADU 1X4BA 2I2YA 1KOHA 3R27A 2X1FA 2M0GB 4OZ0A 2U1AA 3N9UC 2RU3A 3UD4P 5LSLA 5LXRA 1QVGR 2EVZA 2XS2A 2AYGA 2CQ1A 2XSFA 4TLQA 1SJQA 3V4MA 2BZ2A 5CXTA 2MGZB 2DH9A 1OPIA 1NJIT 2KXFA 1OO0B 2RS2A 3UWTA 2LMIA 1YHQS 2MYFA 1X4AA 2LXUA 2LXIA 2MJNA 2KI2A 1FJ7A 3S01A 2XNQA 1SJRA 1WEYA 2N82B 3CC2S 4UQTA 3BEGB 1WG4A 1VQ6S 4QU6A 1OIAA 3G9CA 1DZ5A 1K9MT 1R8HA 1SJ3P 2X1BA 1N88A 1WEXA 2DNHA 2M70A 3CCLS 2DNPA 1M5PC 1ZZNA 3TO8A 1UAWA 3D2WA 5D77A 1VBZA 1WI8A 1WELA 2EK1A 1WHVA 2CPEA 2YWKA 2BOPA 1WHYA 2V94A 2KU7A 1U1NA 2Q79A 3VAFA 3JB9k 1ZZFA 2LQ5A 4WFNQ 1WF1A 2M4MA 2AYEA 1U6FA 3U1LA 3DLLQ 1YI2S 3R1LA 2KVIA 2DIVA 3CF5Q 2MKKA 3P49B 2HGMA 5CA5A 1N54B 4WKRA 2DGUA 2DISA 1RK8A 2DITA 3CULA 1WF2A 3B4MA 3SDEA 1VC0A 2YKAA 1U1LA 2CQHA 2XS7A 5GAGU 2D9PA 2K8GA 1UFWA 4TU8A 3MD1A 2DHAA 3RW7A 2DIUA 4BS2A 3VAKA 2DGOA 2K3KA 4IOCQ 2ADCA 3FEXB 5LSOA 5IM0A 4Y00A 2YH0A 1VQPS 2E5HA 3LPYA 1S79A 4WFAQ 3CC7S 3EGZA 3HI9A 3G71S 4PKDB 2AYMA 2CPJA 3CMAS 2AD9A 1NU4A 1O0PA 2CQ2A 3VALA 3G96A 2LA4A 4W90B 3UCUP 2MQQA 3PIPQ 2PEHA 1CVJA 4LJMA 3BO2A 2MQOA 5MLCV 2N3LA 2MB0B 1U1MA 1VQNS 2OTLS 3NS5A 1UW4A 4ERDA 2M8DB 2MZJA 1FJEB 2RRAA 2LECA 3NNAA 2XS5A 5FJ4A 2DNQA 2RUGA 3J7ZT 1VC6A 4J5OA 2N7CA 2L9WA 4V19X 2FC8A 1YTYA 2MKJA 1VQLS 4F26A 1F9FA 1WHXA 2MZTA 2NZ4A 5IFMA 1NO8A 2MMYA 3R1HA 3CCQS 3VAMA 2MGZA 2F9JA 4CH1A 2MKHA 2RT3A 1G2EA 2RRBA 1W2BR 1VQ9S 2DH8A 3TP2A 1M5OC 3BO4A 1U1OA 2UP1A 3ZZYA 2QEXS 4EGLA 2J76E 4CH0S 2DNZA 2MSTA 1SJ4P 1X4HA 2OSRA 3I55S 2MJUA 2CQDA 1N8RT 2DGQA 1FJCA 1R8PA 3MUMP 2MQMA 1H2VZ 2DNYA 1FT8A 2GHPA 2D3OR 2DB1A 1IQTA 2MZQA 5DM7Q 3U1MA 1X4GA 2CPDA 1M1KT 1AUDA 2CJKA 2XNRA 4F02A 1X4EA 2KG1A 2ADBA 4P6QA 1SJFA 3L3CA 3VAGA 2X1GA 2QFJA 1U1KA 1HD0A 2DNLA 2KN4A 5DETA 4PR6A 2OTJS 1DBDA 2JVOA 3MUVP 2KM8B 1M5KC 3MXHP 2DH7A 2WBRA 1VC5A 2DNOA 1KOOA 4Z2XA 5H1SV 2CQPA 2KT5A 3THPA 2CPZA 3THTA 1KC8T 5HO4A 1VQ4S 3RW6A 2DHSA 1JJ4A 1FO1A 2VONA 4C0OC 1X5TA 2F9DA 4M5DB 1U1QA 1VQ5S 2VOOA 5EN1A 1H2UX 2QA4S 2RNEA 3P5TL 1KD1T 4TU9A 1KQSR 3S6EA 4C7QA 4IUFA 2OSQA 2G1DA 2CPHA 3G8SA 5HL7Q 1HL6A 2DGXA 4Y0FA 1U1PA 1H2TZ 3TYTA 2X1AA 2KHCA 3NMRA 1DHMA 3G8TA 1UP1A 3G6ES 3CCVS 1D9AA 2MKSA 3IRWP 3CCES 3CD6S 2L08A 3IWNC 1YIJS 2G0CA 1X4DA 2JVRA 3PIOQ 2E44A 2MZRA 1WI6A 3K0JA 1WHWA 2U2FA 3BO3A 2KRRA 4W92B 1HA1A 2CQBA 3Q2TC 2N3OA 5DDOC 1FHTA 2DNGA 1VQMS 1VQ8S 3ULHA 3VAIA 4LIRA 2MKIA 1VQOS 2VOPA 5BJRA 3B4DA 2KYXA 3NNCA 2ZJPQ 2CQCA 1JJ2R 3UCZP 1A9NB 1YJWS 1K73T 2XB2D 2CPYA 1FXLA 4WIIA 2HGNA 3LQVA 2PE8A 2HZCA 2NLWA 5DDQC 4U67Q 2KG0A 5GAHU 1PGZA 3ZZZA 3MD3A 2YH1A 3S8SA 1D8ZA 2DGSA 2M2BA 1WF0A 2O3DA 2LCWA 1YITS 3P3DA 2MZ1A 2CQ4A 1X4FA 2MY7A 3CUNA 2I38A 2HGLA 2MQNA 1OWXA 2MHNA 2L41A 2DGWA 2KFYA 4IOAQ 2LEAA 2DNMA 1YJ9S 1U1RA 1B7FA 4YOEA 1K8AT 3S7RA 2JRSA 1YJNS 1VBXA 4YUDA 2HVZA 2MZSA 1WWHA 4ED5A 2AYBA 2VODA 3MI7X 3CTRA 1P27B 2LEBA 2B0GA 3CPWR 5GVQA 2DHXA 3OW2R 3G4SS 4A8XA 2MY8A 1Q7YT 3J7YU 2DNNA 2J8AA 3SMZA 2LKZA 3SXLA 3CXCR 1WTBA 3HHNB 2GO9A 1Q86T 2FPHX 2MPUA 1WEZA 2M8HA 2DO4A 3Q2SC 2RVJA 2RQCA 2CQ0A 3UD3P 3NS6A 5GMKa 2DNRA 2JX2A 3CCJS 2M9KA 2CPXA 4QQBA 2CPIA 2DHGA 5LJ3Y 1HD1A 5D78A 5IQQA 3VAJA 2EK6A 3CCMS 4WF9Q 5CYJA 1Q82T 1FNXH 2CQGA 2DGVA 3CCRS 2FC9A 1DRZA 1X5OA 3FEYB 4OZ1A 5DDPC 4IO9Q 5LJ5Y 2CQ3A 2E5GA 1BY9A 1VQ7S 4PRFA 4YB1P 2KXHA 4QPTA 2ZJQQ 1WG1A 2OJ3A 2MXYA 3MURP 1X5SA 2CPFA 2A3JA 4WFBQ 2MSSA 1VBYA 3P6YC 5JVHQ 2LYVA 2YTCA 2MQLA 1P1TA 1YWXA 1Q81T 2D9OA 4QU7A 3CMES 1S72S 4LMZA 1M5VC 2DNKA 3UCGA 4TU7A 2MKCA 1A7GE 2F3JA 1L3KA 3BS9A 2CQIA 3EX7B 1N52B 1ZH5A 3I56S 3CC4S 5ITHA 2M7SA 2DK2A 3CCUS 3SDEB 1QM9A 5JVGQ 1RKJA 1PO6A 2KM8C 1X0FA 3MDFA 4ZKAA 1WG5A 2J0QD 1URNA 2RQ4A 2HYIB 5GAEU 1U2FA 3DXBA 2E5JA 4F25A 3CCSS 3H2VE 3MOJB 2JWNA 4C4WA 2KH9A 1U6BA 2DGTA 2KRBA 5DM6Q 4UY8T 2MQPA 2FY1A 2M52A 2ERRA 5IM0B 4RU2A 2J0SD 5LXYA 4FXVA 1JMTA 2FHOB 3H2UB 2OIHA 4CQ1A 4CIOA 2ZJRQ 1XN9A 1VQKS 3US5A 3MUTP 2SXLA
chains in the Genus database with same CATH superfamily
1H6KX 1S1TB 2QA1A 3SFUA 1XERA 1SKWA 1TL5A 3GU0A 6FD1A 2XMTA 3VQSA 4HT5A 4DZDA 3B78A 1GXUA 2DCLA 4FPRA 1NSQA 4URGA 2EG1A 2VBYA 2BW2A 4DS4A 3CEDA 5HBMA 3IBWA 2KXFA 3MMAA 4CLPA 1UVNA 2BJ9A 4JI6J 2ZEJA 3S01A 2VZ9A 1LW2B 4NLYA 4R5PA 1D8YA 3AD9C 1KKHA 4Q2MA 1SL2A 5IT0A 2YQ3A 3D2WA 5DGAA 3R6LB 4Q7AA 5M2PA 2EK1A 2HQFA 2YWKA 2IVMA 2ROPA 3EVMA 4DX6A 4IO1A 1LNQA 1HI1A 4WFXA 2A0FB 3JAMU 5HQMA 3AHPA 4UUXA 4I7FB 2PMHA 4ED1A 3MPVA 3CF5Q 1PAEX 1IKYB 3C6UA 4OJHA 5EX0A 4ZA1A 1YBTA 2XS7A 2NCKL 5E0OA 3EYZA 1W26A 2ZDPA 3VAKA 2K3KA 3LAKA 3T1YF 2RF2B 3LGHA 5LSOA 3RAMA 1SKSA 2F65A 2EBEA 1S6PA 1T3NA 4V19J 2PEBA 1OY6A 2AYMA 4PYDA 1WSRA 1FE4A 2CQ2A 1XNRJ 1HHSA 2N3LA 4ZVUB 4ZJOA 2XM3A 2N7CA 5L46A 2QRRA 2F9JA 1R8AA 3BZQA 1IWAA 2MKHA 1G2EA 1FKAF 3UO0A 1T05B 2FD2A 2FZCB 3OVSA 2OFGX 2DKOB 2QEXS 4EUVA 1T9TA 4R8UB 1X4HA 3T41A 2CQDA 3KOAA 1TL3A 4NCAA 1TL7B 4PCQA 4HYKA 3L7PA 4YEAA 4ZHRA 3TARA 3AA9A 3GSIA 2ILYA 1HD0A 2YX4A 4FKXA 4YB5A 3AB2B 4MKBA 4M95A 5F8HA 3SYZA 2ZKUA 3I9V9 1DY3A 5F8MA 2BE9B 5HO4A 3I9ZA 2ZH4A 2F9DA 3GV7B 2VOOA 1JKHA 3AY0A 3TX8A 4A8WA 1EETB 2NXUA 2AJQA 2CPHA 4YMEA 2DT9A 3UFCX 4PQUA 1DHMA 5EWGA 2K1RB 5KFVA 2GA7A 3OXFA 2U2FA 4R0JA 1VYAA 4TY8B 4ZCKA 4W92B 3DOKB 4LIRA 5FLXY 1AROP 3OFGA 4J9LA 3PO5A 4C98A 1RWPB 4HLBA 3M2UA 4DX8H 3MECB 2JDJA 3T5JA 3AXKA 4IG3B 4ZMMA 3MPYA 1H98A 4DJBA 1YRTA 2YKPA 3CDBA 1KR4A 3D0IE 3OQ2A 2NXEA 2HZVA 3A8KA 4DL2A 1JXVA 1GK8A 3PJWA 3C46A 1HBUA 5GVQA 1FEHA 2DNNA 3HXMA 3FBEA 5CQGA 5IOLA 3HO1A 3DLGB 1RTDA 2CQ0A 4ED6A 4JI2F 3OPKA 3D6TB 4FS2A 3FFIA 1FJGJ 4P2FA 5MAOA 2R2TA 5HK4A 2LQ9A 4ZVSB 4CO2A 4I0WA 1UMJA 2BANB 2CVIA 3V4IA 1WNEA 5HQ8A 5B0AA 3QAEA 1JLBA 2CJXB 4U7UD 4WXWA 1YWXA 4CO0A 2D9OA 1FDBA 2V8GA 5D0HA 4ZPVR 3OR1B 4F4ZA 4HH1A 1RAHB 4HI1A 1TUVA 2JZ5A 3K57A 4ZKAA 2FGOA 3NGRA 5GAEU 4K50A 5IZHA 4EO6A 1FTCA 3WIUA 2VA2A 2GGPA 4YR0A 3GIMA 3ILLA 3ZFVA 4RU2A 2VJUA 4BWMA 3U1NA 4WTOB 2V69A 1EQ0A 2UXDJ 2XZDB 1JQGA 1M90T 2XWYA 1M0SA 3PY8A 3TI0A 3QPIA 1U7LA 1KTVA 4DN0A 5LSLA 2XI3A 1J5EJ 2IRUA 4I2QA 1R8BA 4MT1A 4RW7A 4FF4A 1Q16B 2W25A 4KGZB 3OTBA 2QGFB 4HACB 1SJRA 4P72A 2W2MP 2KJWA 1X9SA 4WZQA 3OVAA 1VQ6S 2HHPA 4OHYA 3AJ1A 1RT5B 4G1QB 5KFMA 1EQMA 1UVMA 5D77A 5HATA 3BGRB 1PJ5A 3T5HA 4YHHJ 3V2UC 3E01A 3OTOJ 3HHLD 3J7Z5 4RW4A 4UQGA 4HEA9 1ZZFA 5A6PA 1N36J 5D6GA 2ABYA 2NXJA 4ZPAA 4PABA 4IRCA 4DV5F 3DU5A 3CJRA 3TX0A 1NRKA 2IMWP 3SBMA 3JSBA 4I64A 4CLLA 4F67A 5ETNA 1RWWB 4HDGA 3MD1A 1Q8BA 2DGOA 5LT5A 4CDIA 3W9HA 4NA3A 2F4FA 2UUAF 2HFVA 3L9ZA 1KN6A 2YH0A 1RAOA 2NYHA 3HI9A 3CMAS 3PEJA 1XMOJ 2ZM6F 3G96A 1FWKA 2W2OP 3PIPQ 4DSJA 4FP9A 3NS5A 4ERDA 1RE1B 3T19A 1LV5A 5HI7A 2ZZTA 2IAJB 3GILA 2R7VA 2ACMA 4HI2A 1NPRA 4P2MA 4B9VA 2UXBF 4IFVA 4C3MA 1E6YB 2EI5A 3P8BB 4RWXA 1S9EB 2CPDA 3FNNA 1S0MA 2L3MA 2EEYA 1VJWA 2EFVA 1SJFA 3P96A 4LFAF 1CJKA 4I69A 2KM8B 4F0HA 1S1VA 2FJBB 2XC9A 3UNYA 1S7HA 1AFJA 5KFFA 1ICEB 2B4UA 4K0KF 1LEOA 3CO0P 5DQHA 4C0OC 3PYFA 1R0AB 2C2MB 3P5TL 3MM6B 4RNOA 5HLFB 1JB0C 4CYUB 3G8SA 2VB6A 2H5EA 1S1XA 5F3TA 3QRPA 2ZHBA 8ATCB 4Y2CA 4WU3A 5F8GA 2CNOB 3M2RB 2HHTA 2CZ4A 1OJ4A 3PX4A 4ZP8A 3M32A 4DR6F 3WQPA 1P8GA 3ITHA 2AZ1A 1T7PA 4CLFA 3W66A 5A2QU 2B9YA 4WIIA 4YY3J 2HAIA 1NPPA 1FKOA 4DSKA 2DGSA 5CABA 3M1VB 4M94A 2HVEA 2JEIA 2W01A 4Q8EA 3W2VA 3IGNA 1YJNS 2VASA 2MZSA 4X4PA 2N4CA 4KO0B 4P7TA 4NYOA 3W1YC 2CZ9A 4DFKA 1BQNA 2HBQB 2MPUA 3HK2A 2M8HA 2DO4A 3NAIA 4XDDA 5DZ6A 1WOOA 3JAMY 3HHEA 3UD3P 4DWIA 3GR0A 3O6QA 5F8JA 1HD1A 2FJXA 1NDPA 2W2PP 2VBZA 4EO8A 4XIUA 3A3PB 5L1JA 2LP4A 3HLUA 4N76A 5CD4A 3H98A 4RJVA 1HARA 4P2SA 2CPFA 4CLSA 4Q43A 5L39A 4FBUA 3PR5B 2OELA 4UOHA 2FLOA 4LMZA 5HMWA 4YFUA 4DCPB 1QAYA 1NJWA 4OX8A 2R2SA 1VHFA 5ITHA 1S1WA 1I94J 3DXBA 1U6BA 4B3TF 2QMWA 3BN7A 4QWCA 1UL3A 1X31C 3W9JA 1FK9A 1XN9A 3DLEB 5E3PA 3O8WA 2VU5A 4DFJA 4LF8J 3GCWP 1GFWB 3NNHA 2OD4A 4USIA 3I32A 1FXRA 2KTQA 1KFSA 4O4GB 4A8SA 2WTFA 4JI2J 3AFGA 2C3MA 4OZ0A 1JLEB 4TLQA 3BKUA 3MGJA 1HNIB 2Z2LA 2MYFA 4J91A 1CBKA 2RE1A 3G82A 2XNQA 1XWLA 1HNXF 2VQEF 4KGKA 5KG0A 1QLNA 2BABA 4USVA 2WBMA 3JTNA 3R6GB 1ZZNA 3I5AA 1RBAA 1S6QB 1T11A 1TKDA 2HHQA 1RWUA 2AX0A 1U1NA 1FNOA 2B43A 5ETVA 2GZOA 2XHWA 1TFWA 4J90A 2W4PA 4X4SA 4YN3B 2WVCA 3MEEB 1YI2S 1R3NA 4UT4A 1EAYC 1RGVA 1RWXB 3QGPA 1TP7A 3PYDA 1UFWA 5F8LA 3GJTB 1OQ3A 3VQTA 3QIPA 4AXJA 4IOCQ 1ZAWA 4KQZA 3HHLB 4OX9F 1VLOA 3QO9B 4ID5B 1MG7A 4NLRA 2Y1JA 3QSYB 4F4YA 3VV2B 1UEKA 4K8RA 3NAHA 5KFSA 4TYAA 5KAKA 2R7UA 3UN5A 2XS5A 4EI2A 5EX3A 2L9WA 3POTB 3LP2B 2MDAA 4DSEA 1UFLA 3GR1A 3MAQA 1WC5A 1RA6A 4LFCF 4RBVA 2XMMA 4MFBA 1VQ9S 1JK9B 2BE2B 1U0SA 3R5DA 4J9NA 3UN3A 2IJFA 3ZZYA 4WXOA 3VZHA 2D1CA 2W4DA 2Z58B 4WP9A 5J2PB 2VG7A 3C6TB 3U1MA 3PX0A 3NKYA 3MFIA 4DV5J 2PA3A 2W7AA 2Y1RI 4I1TA 2KG1A 3B8HA 5A8RB 3DRYA 5FIIA 5BYRA 4C11A 1HNZF 2AV5A 1RT2B 5E7OB 2YQ1A 4OJ3A 4ZVFA 4F2RA 1JLAB 2UUAJ 2V67A 2AJ4A 2BM0A 1U25A 5JUMA 3WBZA 2FLNA 1HL6A 3GFHA 2ZH9A 2E9TA 2ZM6J 1DURA 3CNQP 3G6ES 1D9AA 1AW0A 3CD6S 2QJ3A 1FRKA 4L74A 4ED4A 2PC6A 2FGCA 3BGFA 2AQ4A 3ET6A 2R7TA 2KRRA 2DXEA 2OP5A 3JYTB 5EHHA 2MKIA 1YKWA 4P52A 2FDNA 3RU0A 4DFMA 2HFSA 1JLFA 3FDSA 5BR8F 4ELVA 3PRVA 3EXCX 3MCMA 5ETSA 3KFWX 2UXBJ 1MU2A 4DX5A 2QMXA 1SVDA 1VS3A 4NLWA 2MQNA 4OZ3A 4OLOA 4NXMF 1HQEA 4AL5A 1URRA 1T9WA 5B0CA 3HHKA 4J9KA 4EZ6A 2CJBA 3PW5A 2MY8A 4K0KJ 1RBLA 2XEXA 3DLKA 4DPXA 4YR3A 5K9FA 3K59A 1HBNA 4BLGA 4NXNF 3R2DJ 2BX6A 1XR6A 3Q8UA 4FDFA 3K8VA 2FZKB 5LJ3Y 3TOQA 1F0XA 2COLA 3LA0A 1UJ6A 3VAJA 2UU9F 4KY3A 4HDHA 1KQFB 2Y1LB 4WWSA 3FEYB 3CT9A 3FBCA 2OJ3A 4DR6J 4IQXA 3H20A 3QT5A 3J80U 3P6YC 4ZCMA 1VRTA 3I5BA 2DNKA 4LRDA 2ZOMA 2MKCA 3M2VB 1I3OB 3I6PA 5GADI 1N5QA 2P6SA 2RMLA 2M7SA 4I6AA 1PO6A 3CCUS 4LFBF 1KBRA 2AGQA 2ZUAA 1O5JA 2KH9A 5IV4A 3BM7A 1WC1A 3FEZA 3WZ0A 3MAAA 1OYDA 1RTHA 1Q7LB 3QZ8A 4GC6A 1N34J 2CIMA 4N8OA 3DYAA 2LA6A 3KK2B 3QYYA 4CLYA 4AD6A 3MMJA 2WSFC 3H0PA 3MR2A 5F8IA 5DO2A 3R27A 4PG8A 3DC2A 5EUHA 3OLBA 5LXRA 2XS2A 4RO0A 2MGZB 4AXIA 4ECUA 3ZO7A 2M5YA 1PIEA 1GX6A 3UWTA 1L3UA 1X4AA 2LXUA 4RZRA 4RX6A 4OIXA 1SV5A 4FN5A 2K7JA 5CYMA 3MM8A 2L9NA 3CDUA 2HNYA 1B7YB 4QU6A 1TKXA 2FLLA 1Y9OA 2O5DA 4F0KA 1LW0B 2DY9A 1GTHA 3HJFA 3ZTSA 5J1EA 1WI8A 4JI8F 1RYSA 1WHVA 3N6MA 1TL1B 4JUZA 3LTOA 1GTEA 3Q8QB 2AEFA 1IBMF 4O3QA 4B3TJ 3DLLQ 4U7CA 1KLMB 4OZJA 3RUBL 4P7VA 2HS3A 3C6UB 5CA5A 1G3OA 4CZCA 3H40A 7FD1A 3RBDA 3ZZPA 1WF2A 5AE1A 5A2QY 2HBYB 2CQHA 2D9PA 5B0BA 4IFYB 3W8GA 2F8EX 2AMCB 3W65A 2Z2MA 2BJDA 1Y7PA 1HBMB 3QWPA 1P6TA 1AXQA 3Q23A 2ZZMA 3VALA 4DV6F 1PJ6A 1H7WA 4G6VB 1KQGB 3I0SA 1X60A 1HNXJ 4CO5A 2BM1A 2VQEJ 2DNQA 1VC6A 4LR7A 1HKAA 2JJ4D 5HAOA 1NKEA 4Z37A 2RT3A 4EZ9A 1K0VA 4YQWA 2KZMA 5I4MA 2B9EA 1FWLA 2HIQA 4HR2A 4RBUA 3IG1A 3NBPA 4PWDA 3HDSA 3JQMA 1WC0A 3M8PB 1FJCA 1S48A 5DQGA 1TL3B 5F9LA 4NA2A 3G6XA 3Q22A 4JI3F 3FSXA 4FVMA 2FJDB 3DDKA 1YRXA 1M1HA 3ZZUA 1NHVA 2B5JB 2F4VF 3ENAA 1FDDA 2OO4A 1U6ZA 1EKRA 4ELUA 2RHQB 2H54B 4M5LA 2HNZA 3EVWA 1WD6A 4OX9J 1GXLA 1WDDA 1JKHB 5ETMA 3S6EA 2R8KA 3UDVA 4JI1J 4ZJLA 1VRUA 1LFPA 3D6FB 1S57A 3A12A 1NK5A 3G8TA 1RT1B 4K4SA 4DR5F 1PCAA 4OLPA 3CIMA 2AEMA 2X7IA 2R8GA 5HMYA 1Q1KA 2B4VA 4CNYA 5C7PA 5KT4A 4K59A 1FHTA 2HZAA 2PSZA 1XR5A 2VPXB 4BWJA 2KYXA 3NNCA 4ZVQB 2BOAA 4LBPA 4DMZA 3M8QB 3GSDA 5DG7A 4A8MP 2GW8A 5KOWA 1Q53A 3OFHA 4MIBA 4F4XA 5IT9U 1B7FA 4YOEA 4L3KA 3OUYB 1HNZJ 1U49A 4QJVA 2FY8A 2EKNA 1Y00A 5D4LA 3AH6A 1FKPB 2ZC4A 5KFPA 5D0EA 2C2RA 2H1YA 2NSCA 2E1CA 5IWAF 4IKAA 2P9GA 2FHMA 4J9RA 1NSKL 2HQIA 4ECXA 1HYSB 4NWBA 2IC3B 3BV8A 3W2WA 9ATCB 2MLXA 2QLWA 1IKXA 5HP1A 4LT6A 1VQ7S 3W5XA 2GNKA 2KXHA 2MXYA 2AGPA 2DR9A 4OZNA 5BR8J 1G4CA 2HQDA 3KK1B 2HQCA 3TNVA 1CQNA 2ZD1A 3PR4A 3CSKA 2XMVA 1A7GE 2KZZA 3IBCB 3OR2A 2E5JA 4NI2B 3W64A 1U47A 3I0RA 3JSMB 3I96A 4NXMJ 2HIYA 2KRBA 2KHDA 3OJSA 3P45B 4FXVA 4PG4A 4LR8A 1IUJA 4PUOA 3RR7A 5B0GA 1X4CA 4WCEQ 2C42A 2WOMA 2YPYA 3D3BJ 2ZHAA 2HBZB 3JQKA 1S0OA 2DR8A 1RB0A 4NXNJ 4DV1J 5KT7A 3MCOA 3TAPA 5K5MA 1VQYA 2ATCB 1ZETA 2IDEA 2V8VA 3ENVA 2BKOA 1SUQA 3IR5B 2KI2A 4UQTA 1FRJA 3OD2A 4ES1A 1UWBB 1WTFA 1OIAA 1DZ5A 4B9NA 1K1QA 4AL7A 1N88A 3ZTPA 3GONA 1LWFA 1VMBA 3M8YA 3KLGB 3E01B 4UZCA 1IKVA 2YWFA 2F8MA 4C8OA 2VBWA 3JB9k 3NG8A 3LP1A 2QLJB 2LQ5A 3QSIA 4LFBJ 1HNVA 3TEGA 3OBIA 2AYEA 3ISND 1EZZB 1F5BA 5F9NA 3V81B 4GVBB 2DY1A 3RZAA 4IH7A 3W8PA 4A8YA 2IM3A 2PI4A 2ZOGA 3PW2A 1GMVA 5F41A 4QWDA 4I67A 5IM0A 1U09A 2OEMA 2VQFF 3LALA 2JEFA 5DZ7A 3MCSA 3MEDB 4OL8A 5KG5A 4W90B 2JLEA 2AJ1A 4C3LA 1CSJA 2OTLS 4AT1B 2VJVA 2MZJA 4KC5A 5FJ4A 4USJC 2EFOA 2HNDA 1RU2A 2FC8A 4KFBA 4AUKA 1VDHA 3D54A 4K7QA 1RJJA 4C8NA 1OSCA 1NAQA 4JI4F 4JI8J 3MF5A 2IA6A 4CH0S 2J6UA 1C1BA 3PJXA 2ASYA 2MZQA 1FCAA 2CJKA 1X4EA 2W7PA 5KFKA 3DCAA 1U2RA 3J80Y 1P9YA 3SQOP 2KN4A 4PR6A 3A1YG 1WJ9A 3H7HB 5H1SV 1F6TA 2CQPA 2RQKA 2LDIA 2ZZNA 2JLFA 1KC8T 5KFAA 1TUWA 1BQMB 1N5YB 1T03A 1N5TA 4DV0F 3MM5B 4Q0BA 2WK4A 4O4RA 5HL7Q 6AT1B 2DGXA 5HSPA 1OY9A 3H42A 3D4JA 3AODA 3FBFA 1ZYQA 4CLTA 4DV6J 3X1LB 3WX8A 1GX5A 4PWUA 1WC4A 5LMUJ 1RWMB 1B99A 4ILLA 5C5JA 4LVNP 2OPQA 2I9SA 4DR7F 5E3CA 1DQ8A 1BGXT 3LP0A 3PG9A 4F8RA 4Y34A 3M6VA 4U95A 5BJRA 2OPRA 2F1FA 1Y10A 3QLHA 1YJWS 1S12A 1Q8IA 2BRKA 3TVYA 1U45A 1GAOA 1LWCB 3M8ZA 4H4MA 4B02A 4FF1A 3S8SA 3N6NA 1BQXA 2LQBA 3P3DA 3QNWB 3OSNA 1WOSA 5KFJA 1GXTA 4IOAQ 1H73A 1PYSB 2AT1B 2YKNB 3IS9B 1VBXA 4C2MA 4F3QA 2MHEA 3GJSB 3DMJA 2Z56B 1Y5LB 2F4VJ 1LWEB 3CPWR 3D5MA 1Q8LA 5KFTA 1V6HA 3JXOA 1Z1ZA 1CJTA 4L75A 2E9ZA 3SXLA 3GYXB 2FPHX 1FEEA 1S6UA 4YS2A 1EIYB 1SL1A 2P6TA 5H9FJ 5IT4A 5H9EJ 4ZCLA 1RT3A 2JX2A 5J2QB 4J9VA 5A8KB 4J9SA 5IQQA 2XYHB 3HVWA 2IJRA 1OYEA 1E6VA 5LJ5Y 1S59A 1VK8A 5KFXA 3Q86A 4KHMA 1X5SA 2A3JA 4OJ1A 2PN6A 4KR0B 2ZHOA 2YTCA 2X3DA 2BVZA 1NCLA 3R3TA 1ZAXA 2MEWA 1U24A 4OI2A 3SV4A 2CQIA 3HVRA 3FQKA 2Y8YA 3TJ9A 1IJFB 2XULA 4QYZK 3NY0A 5K14B 1U2FA 1IBCB 2JWNA 4ANEA 4OI6A 2JC0A 4Y2AA 1MWZA 1J5OB 2YKMA 1SH0A 4ED2A 2BYCA 3MUTP 1UEVA 1K1SA 2IVYA 4OI3A 3CMQA 1HWIA 4OYWA 5KFZA 1Y0HA 2RS8A 5DDRC 4FXWA 3C14A 1UJ5A 3VF0B 5B09A 3BQ0A 3QFWA 4BCAA 3L7OA 1WUUA 5KFDA 2CG8A 1NHUA 5IWAJ 1I1GA 3HHLC 2AYGA 3QBCA 3TQEA 3GIIA 2UVUA 3DM2A 2HWIA 2QLFB 2QT7A 3CJ8A 2UV8A 1T95A 1HBOA 1MMLA 5CHCB 2PGCA 3CC2S 1TQLA 4TQSA 3TUJC 4OI0A 1IN0A 2J0XA 3G9CA 2FTRA 4MIWA 1RUSA 2M70A 2BE7D 5GAGI 5K8OA 1N6QB 2RHSB 4LSZB 3W3SA 2Q79A 1D1UA 3G6VA 4Y2KA 2J9CA 1NJXA 1F2HA 4DR4F 1EB0A 2J5AA 1WF1A 4DL5A 4C8ZA 1DARA 4Y2MA 1DQ9A 5E3AA 4DQPA 3W5YA 2EFNA 4JYAF 3ZNUA 2DGUA 2DISA 3MMCA 1QE1A 4NYZA 3ONQA 3EJMA 3OSPA 3CJKA 4AFFA 1HWJA 1HQ2A 3LH2S 1Y11A 3BBBA 1S10A 2ZH2A 1VCTA 2VC1A 2CFXA 5IT9Y 2ILZA 4PKDB 1R27B 2Q66A 1JLCB 2UXCF 2DPIA 4HHUA 4ZLJA 3WX4A 2RRAA 1TKZA 1WORA 3NNAA 3FRYA 4DV4F 2HAFA 4GVLA 4JV5J 4DR3F 2HFOA 3U7JA 2NREA 4ZITA 2DGQA 2VA3A 1ZTTA 2BKPA 2DRAA 5A8WB 3ZZRA 2H5IB 5AXLA 3R5GA 4JI7J 2FVPA 3PFEA 2KFNA 1DTTB 1DLOA 4P6QA 4PG6A 5J2NB 4ZPTR 8AT1B 3MXHP 4M1KA 3TUIC 4L6V3 2ZWPA 2V4JB 1AUSL 3DI6B 4NCBA 2VFSA 1REVB 2HRUA 2YX1A 3GE9A 1QUPA 2H51B 2VBXA 3LPEA 1OY8A 2X1AA 1HW9A 2GS8A 1QSYA 2HS0A 3HVTB 3AOBA 1N0UA 3KWMA 1X4DA 1BUXA 1QJHA 2V2VA 2Z4PA 4KKOA 3MM9B 2Y0SD 1J27A 4RLEA 1GMWD 2FUG9 4MTPA 5DDOC 3HULA 4OHXA 3U27A 3DOMB 1TAUA 4JI4J 2B51A 4OYMA 4G65A 2CQCA 4FF3A 2HLTA 2CPYA 3KLVA 4I68A 4ICLB 1PGZA 4C0BA 5CCLA 4R25A 2O3DA 3NXZA 1VLYA 1KWMA 4LF9F 2YVSA 1L3TA 2I0XA 3UN2A 2L41A 2VFRA 4O0IA 1U1RA 2JHEA 1NB2A 4NZ7A 2VL1A 3MI7X 4QWEA 4NL5A 2YWHA 3M6UA 4LSNA 2RDDA 3RRKA 2GO9A 1B70B 2WB1D 5IQ6A 2LLZA 2ROGA 5AXKA 2VG5A 2M9KA 1HI0P 4ZIVA 3FUYA 1FFSB 2Z2YB 1FNXH 2CQGA 4LRCA 4RBTA 4WFBQ 1EX8A 3Q8RB 4NEYA 3A3OB 2AWZA 2KKHA 1NNDA 1SH3A 2YNIA 2IRYA 4NLUA 4NPOA 3EDRB 3D1QA 4U9RA 3GV8B 2F3JA 5LM7E 1N52B 3UVJB 4DL6A 2B7BB 1Q78A 3HPOA 1S9GA 3PYGA 1HNWJ 4O23A 4HL9A 3VHQA 3PFOA 3WDOA 2MQ8A 4C4WA 2IPOB 2VIHA 4RNFA 1F9EB 2XZTB 5HQLA 5A0YA 1KNZA 3QWUA 2ERRA 1TVRA 3US5A 1LK7A 2QIFA 1U8WA 1QVFR 4ED8A 3EVOA 3DDIA 2R2RA 2E29A 2HSEB 1T9UA 2DR6A 1A6LA 5FDLA 3B82A 3N9UC 5E5NA 3O2IA 4TYBA 2G2OA 2XSFA 1TL4A 1RTIA 2XG8A 4U6PA 2J8SA 5THWA 4CO3A 5IC4B 1FNMA 3C15B 2N82B 1C0TB 4F0MA 4FYDA 2BJ1A 4PPZA 1VI7A 2X1BA 3QATA 2DNPA 5IS2A 2ZH7A 5IV3A 1TKTB 4C6AA 3DGVA 1RAEB 3O44A 2HK3A 5HVFA 2YNHA 3VAFA 1TUGB 2NZCA 4WFNQ 4GKKF 3AD8C 5AXNA 3KKFA 2RKIB 2GCFA 2LU1A 4QIEA 4K4ZA 2KB2A 2F5GA 2HVHA 4WKRA 2GHWA 4C48A 2WVBA 1CULA 2NPIA 4A46A 4OYAA 5CYQB 5ETRA 2YKAA 1ZA2B 4KV8A 4TU8A 2HFUA 3AQOA 2QL5B 4B08A 3GZ7A 3CJTA 3KJVA 2EKYA 4F3MA 4X4OA 2XMWA 1YBUA 1YVFA 1PILA 1U4BA 2UUWA 1S79A 5ETPA 2BV3A 1S1TA 2AD9A 4X66J 1YBAA 4JV0A 3AJ2A 3CD0A 3VGTA 2M8DB 2WONB 3KLFB 2ASLA 2RUGA 5KFRA 3M9NB 4N56A 4J5OA 1GMWA 4V19X 4E98A 3D68A 1WHXA 4PXBA 1N5SA 4DL4A 3OJUA 3GPAA 5C24B 2ZE2B 3KDNA 3D1OA 5LOQA 3WC2A 4L72B 3BGOP 4EGLA 4X64J 3PW4A 1LW2A 4YP3A 2GMJA 2MJUA 1FRXA 1PC4A 3FCWA 5BYSA 1RT4B 4JYAJ 2JC1A 2KL8A 1QUVA 1Y4ZB 5DETA 3MUVP 2DEJA 3RBZA 4ZPBA 3PRDA 1HFEL 1IJEB 2CPZA 3SCIE 1YJVA 3GB0A 3G2XA 4H54A 3G6YA 2V9WA 4IOBA 1U1QA 1SI9A 4I7FA 2ZOFA 4NLOA 1IKYA 4J9QA 2VG6B 2FJAB 5GAHI 3H4BA 2WHOA 4K4YA 5KFQA 3DRRA 4YDXA 1R8CA 3K5NA 3TUZC 2JSXA 2JVRA 2MZRA 2RF2A 4XDCA 4ED3A 1S7IA 2W9BA 4EBEA 3RGIA 4DV4J 4DR3J 2HHSA 2D3UA 2ZH8A 3LAMA 1JJ2R 3UCZP 3H8YA 2KFZA 3IWXA 1WF0A 4AE5A 4RR5A 1CJVB 3HSDA 4MJKA 3TZXA 4S0MA 4OZLA 2LQ8A 3I87A 2Y8WA 2V34A 2M3DA 1U26A 2NSBA 1T05A 1WKJA 1NK8A 5KFGA 4ED5A 5J2MB 2YQ0A 4R8UA 3GIJA 2K7KA 3OW2R 2NR0A 2V2ZA 5KFCA 1TL7A 1YSJA 3GV5B 3MCNA 1Q86T 4G1IA 1IQZA 3Q2SC 1TELA 3NS6A 1FF2A 3CCJS 1RLCL 1SQFA 4ZLNA 3T6BA 4ECYA 2MTLA 1CS4B 3SSRA 3ILIA 3R5AA 1S1UB 1KRPA 4PG5A 5KFIA 5HP1B 2J0WA 1RWNB 1WG1A 1EETA 4DR2F 3MURP 3TWZA 2MSSA 1VBYA 3PYEA 2GAGC 2UUBF 1SC1B 1S72S 3A8JA 3M6WA 3I4PA 4OHVA 2FQQB 4TU7A 4KPCA 4L73A 4OV1A 1U8SA 3C16B 4WYWA 3OL6A 3NOCA 2BQUA 1X0FA 3MDFA 2RQ4A 3QMQA 3VCDA 2HYIB 5B0DA 1NBEB 3MOJB 2BDPA 2UUCJ 1RHKB 2IMOA 1N56A 1C0UB 1FDNA 2OIHA 2ZBIA 2VH7A 4PUOB 3V6KA 2MKYA 5HMZA 2OPPA 4IG3A 1QSLA 4PXDA 5KT5A 1YJUA 1R7IA 1X5PA 3QQCD 2Z2ZA 3THVA 3SQGB 3OXGA 5C25B 3F56A 4DPOA 2AIRB 1RQ0A 2CJAA 1OO0B 4PWWA 5KG3A 4TLRA 3DLGA 4JBCA 3CDAA 1WEYA 2HG4A 1RHRB 5I3UA 3BEGB 1WG4A 1UVLA 3QGGA 4OYZA 3A8IA 2V2KA 1OS5A 2OPSB 1QSSA 5HMXA 4RKUC 4M8LA 2PI5A 1UJ4A 4ZIWA 2BOPA 2BANA 1Y5IB 4Y3CA 2AU0A 4UW2A 3GLJA 2XY7A 3FBBA 1NZAA 1HR0F 3NGSA 4Y2IA 1HQUB 2H5JB 3IWLA 4ER8A 2WVFA 3CJQA 2HLUA 2ZVIA 4R0EA 3M30B 4OYIA 2Z57B 5DLGA 3OR1A 2FVSA 4UOFA 1RK8A 2DITA 3IRXA 3OXLA 1XMQF 3TZYA 3QIDA 4FVCA 3KJNB 1QAIA 3KTQA 5L9NA 4PPDA 4AYBD 2K8GA 3PACA 5H9EK 4LR9A 4LF1A 1B4SA 4QW8A 1YJ7A 1PKUA 3NGTA 2V5HG 3LPYA 1OPZA 2KO1A 2W24A 4X2BA 5IXUA 1FE0A 1SB6A 3BDEA 1ZS6A 5MLCV 5CH7B 2VPWB 5M2UA 4CLUA 2C2KB 4TVAB 2MKJA 4IDKB 4IQMA 4PEOA 1IBLF 3K5OA 2MMYA 3CCQS 4ECTA 1I6JA 3BKFA 3BO4A 4HACA 2UP1A 2CNKB 3R5JB 3D6MB 5DS7A 2KYZA 1RT5A 4GKKJ 1H2VZ 4G1QA 2DB1A 1IQTA 3M4XA 4OZ5A 1FXDA 1MROB 1AUDA 3LWLA 3IM8A 3RYLA 3BGRA 4I2PB 2QFJA 1NSAA 1ZM9A 2WW8A 2A18A 3ETMA 3NWRA 5DGBA 3GFYA 3IC1A 1KOOA 3R7NB 4OYXA 3K7RA 1FO1A 3LGMA 4IH5A 4LF4F 1C1CB 1XC9A 3EGWB 4IH6A 1SJ1A 5K8PA 4NLDA 4Q0BB 3QT6A 2C3PA 1DFDA 4JI0F 3RB6A 4K4UA 3W9IA 3FCVA 3IWNC 2G0CA 3M6XA 3T1HJ 2R7QA 3K0JA 3GMGA 3C66A 1N33F 4JI5F 1FDAA 4DV2F 3D66A 3FSYA 3J7YI 3OTEA 1KSPA 4XAKA 4O44B 4C0HA 1KVIA 1C4AA 4U67Q 3RRGA 4ZVPB 1LQ9A 1AFIA 2XWXA 1YZ7A 1OWXA 5D3GB 2H48B 1UPMB 3ZZ0A 1B64A 4H4OB 2HVZA 4EK2A 3IMQJ 3SV3A 4ECRA 4NLVA 3BSCA 4A8XA 1CJTB 3RJMB 2NYIA 1WTBA 1W25A 1S9EA 2ZITA 1SC6A 2RVJA 2RQCA 4USKA 3NWGA 2ZFHA 4F50A 2QL9B 3CJ3A 1EP4B 3BPSP 3SCKE 4WF9Q 4C8KA 3D1HA 3KMSA 5D8HB 1OQ6A 1SCJB 2WVDA 4DR1F 5DLFA 2IDLA 5D4PA 1R0AA 4ZP7A 3MM6A 4ETZA 5HLFA 2VV5A 3VVTA 4CYUA 2FB0A 1JLGB 5AT1B 2VF3A 4X4UA 1KEKA 1V3ZA 2IIHA 1R6YA 3M2RA 4N8NA 3SDEB 5HVGA 1IR1A 2WSEC 4F25A 1SKUB 1RBOB 1YGYA 2MQPA 4IG0B 3T1AA 1JMTA 4CIOA 4ZK7M 3BPDA 3JQJA 2H3EB 2KXNB 4DUYF 2QN6B 3M1VA 4GKJF 2Y9HA 2E5IA 1NSPA 2M0GB 5CZVA 1YJTA 3AXMA 1AZSB 2R7WA 4KO0A 2WAQD 2DH9A 1NUEA 1RT7B 2ROEA 4DUZF 3ISNC 1F5CA 1ZPWX 1D9DA 3QRQA 3KLIB 4RWWA 1YX2A 3KDOA 4TXSA 1HMVB 2HPUA 4C8MA 2PMZD 2B4PA 4EWTA 1TK5A 2HVIA 3CJSA 4G1PA 2V94A 4JI6F 4A4JA 1PAUB 4J7CA 2RDIA 2YWGA 4KSEB 2PT0A 2H4YB 2EFGA 4N77A 1WSVA 4DS5A 2E7WA 2DHHA 3MPUB 3T1YJ 1S49A 2KVIA 2VHGA 2Y0BB 1Q4RA 4ECVA 1VC0A 4ILMA 2CNNB 2C3YA 1PBUA 3PKYA 2DRBA 2DIUA 4ZPDA 3BYPA 4NA1A 3TA2A 3DLEA 1OSDA 3IO1A 3PV8A 2QSFA 3IR6B 2WW4A 2QC3A 3WC0A 4F7VA 3KLHB 3DRPB 4OI4A 2BBEA 5KFNA 2FHJD 3AA8A 4OHZA 3D0HE 4O4GA 2J7WA 4B3OB 1JLEA 2XSJB 4K4XA 3VAMA 1XNRF 1YDLA 4LF7F 1HNIA 5CCMA 2IFXA 4EBDA 3T9NA 2I5JB 4Y65A 3CCTA 1VFJA 2VFUA 2OSRA 4RW9B 4LRFA 2GVZB 2R7OA 5HROB 2QO3A 1HR0J 4X4RA 3N0VA 1Z2LA 4MKVA 2G13A 2B6AB 2XNRA 4LSLB 1S6QA 4HKQA 1U1KA 1KVKA 2JVOA 4QIVA 4WJBA 1VIXA 2EPIA 1SH2A 1XMBA 4A47A 3RW6A 4P75A 2RD5C 2X51A 4M5DB 3MEEA 2N4DA 2Q43A 3WIVA 3ENQA 1IKWB 4IUFA 3QGHA 2UVWA 1D09B 1H2TZ 4O3RA 2RAQA 1T02A 2FIUA 3KG1A 3CCVS 4UUWA 3NL0A 2GIRA 4C9DA 4NLGA 3HHLA 1WI6A 1UWAA 3QO9A 4ID5A 5D0RA 5T7LB 1IBLJ 2VOPA 4CM0A 3B4DA 3HSGA 2VPYB 1H3DA 3OTCA 1K73T 2EWHA 4J9UE 3ISZA 2PE8A 4DU7A 2AW0A 5B08A 5JJBA 5J1NA 3POTA 3LP2A 1MLAA 3ADAC 4BBYA 1ZM3A 2MHNA 3TR5A 2O1PA 2BE2A 1RT6B 2IBOA 3VZIA 3CJ4A 4EFAC 3EUNA 1P27B 2DHXA 4M5HA 1KLNA 3MM7B 3D67A 5J2PA 4NLPA 4WBFA 3C6TA 8RUCA 3IP0A 1F3FA 4LF4J 3FSIA 2XQCA 4YR2A 1IR0A 2XGQA 2ZDOA 1WC3A 4OZ2A 1RT2A 1NK6A 1TV6B 1O6XA 4JI0J 1Q8KA 2W2QP 2ZH5A 3L7UA 2XYGB 3CCMS 1HIYA 1Q82T 3NS7B 2HKEA 1JLAA 1YQHA 3CJ5A 4UOGA 1UETA 1TK8A 1N33J 1ZTWA 4JI5J 1NPKA 3CD5A 4DV2J 4DQQA 2HQ3A 1TAQA 3RTVA 4DPWA 4K4WA 1Q81T 1DTQB 3DLHA 3UCGA 2VKRA 1LK5A 4KT0C 3PO4A 1SC3B 3JYTA 1WG5A 5AXMA 3JSYA 2K3IA 1GNKA 2FVQA 2DR5A 2Y3YA 1CJUB 5D0GA 2F63A 3MMBB 5RUBA 3EE3A 3Q8VA 1JJHA 2YNFB 4KYZA 4CTAB 3UE2A 2HWHA 3GFXA 4BHQA 3M9MB 4CT9A 3DLJA 2BEFA 2GIQA 2M88A 1RAIB 3TEHB 3QT8A 3KHLA 3E51A 5GADU 3EGVA 3K5PA 3DN9A 5F3ZA 2YBVA 3IBFB 1L3VA 3GTYX 1RCOB 4N5SA 3DRSB 2XMAA 1HWKA 2UXDF 3M7VA 2FHJA 2GVDB 4DR1J 2Z8QA 3HP6A 1PYTA 2HS4A 5C42B 5B0FA 3LOUA 4MKYA 2W9CB 4CM2A 2AX1A 3NEKA 2DNHA 3CCLS 1T94A 4DQSA 2CPEA 3FMWA 1NHKL 4OYBA 3IXQA 3LW5C 4B9TA 3I31A 3OT9A 2UVVA 3LF0A 2HEKA 3ZXWA 5I42B 4NOHA 1CG2A 3GG0A 2Q1LA 2EFPA 4N41A 4YHHF 3M2VA 1V5VA 1CULB 4DUYJ 1ROFA 4GKJJ 4DLGA 1N36F 3R97A 1HHTP 4F4AA 1TR0A 1HPZA 3NP5A 2ATLA 3CGIA 3UW1A 4DF8A 3TAMB 3X3UA 2E5HA 4WFAQ 3MZIA 3KLEB 4WP8A 2ZBCA 2CPJA 4QIGA 4DUZJ 2PEHA 2PIIA 3KK2A 3K8WA 3AOAA 3WHIA 4DV7F 5B0EA 2LECA 3NGDA 1VOMA 2BQRA 4GMKA 4FBTA 1EKSA 2B3TB 2BJ3A 2BW7A 3N01A 1VQLS 2UUTA 2MGZA 4ZVEA 1XMOF 4RW6B 2G9OA 1RKIA 4LFAJ 3DGPB 3QJPA 1M5OC 3P5BP 2GFFA 2NXNA 1KHVA 2GJ2A 1GMUA 2JH3A 2ZVSA 1LW0A 1T9VA 2E7VA 4PZVA 1U0HB 5K20B 2HWTA 1TL1A 9RUBA 3IN5A 3W60A 4TKTA 1VHIA 3THPA 3QJLA 3K89A 3JS9A 3V6DB 3AAWB 5G0RB 1KLMA 2YPZA 3MPDA 2QA4S 3K5MA 1VBKA 5D15A 1NEEA 2YNGB 1RZMA 3BREA 2E1MC 4LQ9A 2AEJA 3DRRB 5KT3A 4IFYA 1YIJS 3TRGA 1WHWA 2W9BB 3DOLA 4DG1B 2N3OA 3LO3A 1HBMA 3N79A 5I3QA 4A48A 1P9QC 3BBCA 2NPFA 2AHOB 3VGVA 1KHWA 4LF7J 2YWEA 2ZJPQ 1EHWA 2A10A 4WE1B 1RLDA 4B3SF 2NLWA 2WSCC 2Q6BA 3ZZZA 3DKDA 1LOUA 1FWPA 3TW0A 3H2LA 2M2BA 4AL6A 4NZ0A 4QOTA 1RADB 3CUNA 1Q5VA 1F1BB 2IA0A 4YUDA 4YY3F 1MMDA 1WWHA 2VODA 3Q83A 3CTRA 3M8PA 4YB6A 4N7TA 4HVZA 4BC7A 4PXCA 5HBMB 2E7XA 4P2XA 5D4NA 3GP9A 3MMAB 2G2ZA 1BMQB 3HFKA 4MH8A 4R5PB 2GIFA 4DQIA 4CO4A 2B5JA 3E2EA 4DL7A 4F4WA 2G0IA 4C97A 1KP6A 2DGVA 4L3NA 4B9MA 1RSCA 1BWVA 4ZVOB 1XR7A 1HWUA 3A8EA 2LYVA 2W8LA 5E2QA 4QW9A 1RT1A 3DDNA 3MEGA 3ZC4A 2QTWA 3FGVA 1RAFB 4WPAA 3IM9A 2DJWA 4M5KA 3OV7A 3RBXA 2DK2A 4CT8A 1GQEA 2CKWA 2BA9A 2HVDA 3TJ8A 3AT1B 1A0OB 1NK7A 2EC2A 1NLKL 5DM6Q 4UY8T 3Q0AA 5A6WA 4U8YA 5LXYA 1BWEA 1WKLA 2FHOB 3B6BA 2Z30B 3IAS9 1U48A 3R7SB 3M8QA 1S6PB 2OPPB 5E41A 1I94F 4N47A 1B3TA 2BJ8A 5BXIA 3L09A 2DO0A 3G87A 3OUYA 1FRLA 2KJVA 1X0PA 1M5HA 2EVZA 3KHRA 4XPCA 2B4OA 2HHXA 2CQ1A 3V4MA 4LF8F 1JWWA 3IR7B 1FKPA 1XQIA 3FZBA 2RS2A 4A8FA 2LMIA 4ZVRB 3HKZD 2LXIA 4OFZA 1RHMB 4KJIA 2HMIA 1ZOTA 5I3UB 4IR1A 4NLSA 5G4DA 4KAIA 2BJ7A 2J9DA 3PHEA 4ZVGA 1K9MT 2OEJA 4HTJA 1SJ3P 1HYSA 1WEXA 3LGNA 1V5IB 2IC3A 2DYAA 4PQAA 4ZHRB 1SQGA 3RAXA 3BGUA 4WP3A 4MIAA 2F7VA 3BJYA 3A3NB 3SI8A 4B17A 2JNJA 2AZ3A 1JLQA 3R1LA 3KK1A 3H5SA 3EDQB 1PJ7A 1V3RA 3P49B 2HGMA 2ZC3A 5DRKA 2V63A 3IRXB 2XLIA 1MSWD 3RRHA 4KHPF 4C8YA 4PQUB 1M5SA 1U1LA 5KG4A 5J1PA 1KFDA 4NI2A 4P9SA 3JSMA 2R4FA 4IRKA 1XIQA 2QG9B 3N4WA 2V9KA 1BC6A 2RRNA 3FJ2A 1N4LA 2E1RA 2ZBQA 4LFCJ 2GHVC 1Q5YA 1VQNS 3M2UB 1BD6A 4ILRA 1NMEB 3UR0A 3HVAA 2V4QA 1MW7A 5BYQA 4KB7A 4WKYA 4F26A 2A2DA 2IBKA 1S97A 2CNLB 1GEHA 4NASA 3JSRA 4Y28C 4Y6IA 1HBUB 1N8RT 5KG7A 4ALZA 1UWBA 3IFEA 3M8SA 1O51A 1FT8A 1NH8A 1X7VA 1AA1B 2DCUB 1RTDB 1FA0A 3KLGA 2AF6A 3ZTQA 4K4TA 1W7WA 3FFIB 5IC6B 2K06A 2V8DA 4RPFA 2BKNA 4HH0A 2IM2A 2CDQA 2B56A 2IM0A 1XEZA 2CVEA 4KIAA 2W1BA 1VK3A 4CP5A 3V4IB 2C2OB 3V81A 3BDPA 3FCHA 1RYRA 3GCXP 4GVBA 4ANCA 3EMTA 2QLBB 3TA0A 3L95X 1JLBB 4EU0A 4DXLA 2DEIA 1UP1A 4DLEA 1XBWA 2QFIA 4FZVA 2RQMA 4DV7J 2O01C 4DFPA 1RDRA 3Q8YA 3NGKA 1XNQF 4U8VA 4DPYA 1IXKA 3H59A 2DVIA 1HA1A 1R31A 1FD2A 4FF2A 3MEDA 3CB4A 2GGPB 2NS1B 3W61A 1A9NB 2HGNA 3VR1A 2KG0A 3QZ7A 5LSRA 2VC0A 3AB4B 4DQRA 3HSJA 4NX9A 1YJ9S 1K8AT 3S7RA 3ZZOA 3UQSA 4P73A 4RL1A 3ZTOA 1ULRA 1SIZA 4USMA 1NXIA 3W63A 1J2VA 4I2QB 2LEBA 2R3VA 4EEYA 2QE5A 2HRTA 1U2CA 2B7CB 4RW7B 2UU9J 5ETKA 4O3NA 4NLTA 3HHNB 3DXSX 1KVJA 1S5ZA 5EWFA 3VTIA 2HW3A 2RH3A 1M1GA 3J7A1 2G2YA 5LL6d 4NRTA 1UVJA 1FVQA 2DHGA 5GAEI 4USWA 4X65F 1BQMA 2K2PA 4EMDA 2GJFA 2LVWA 2XZWA 4ED7A 1N5YA 4RW4B 2QLXA 3MM5A 1BHNA 2LQJA 3M8WA 2E66A 5AE3A 2JFDA 4F04B 2MQLA 4UF4A 3ZZTA 4QCLA 3GWCA 2DBBA 2ZH1A 2DTJA 1M5VC 5GMDA 4B3SJ 3EZOA 3SSSA 3EPGA 3H90A 5JVGQ 1RKJA 2V6AA 2KM8C 1R0CB 4USHA 3H2VE 4RUAA 2PO4A 2CG4A 2OD6A 2V0NA 2J0SD 1APSA 1JIHA 2XCPA 4F36A 2FVRA 1LWCA 1UA0A 2SXLA 3PNIA 1U02A 4W4MA 2HHVA 3UDEA 1RP5A 1X4BA 2YKNA 3IS9A 2NQPA 1KOHA 4JV2A 4GO7X 1LWEA 2RJZA 3KK3A 1N34F 2D7SA 3NCRA 5CXTA 1YJRA 4ZDNA 3BQ1A 2V8PA 1FFWB 2MJNA 4OYOA 5KFBA 1ZAVA 2EXUA 3TUPA 1IBKF 4IFVB 3VVUA 5J2QA 1IBMJ 5A8KA 1L3SA 3MWBA 4HHHA 2A2CA 3TO8A 2R2UA 1FX2A 1WELA 1CJKB 1TZ0A 1WHYA 5L9XA 2WZ1A 1SQEA 1S1VB 1RAGB 3QFHA 4ZN1A 3M9OB 1F3VA 1F9HA 2R8HA 2FLPA 3JTOA 3D3CJ 1NH7A 4RUHA 3A13A 3OL9A 3BF4A 2E1AA 1YRUA 5SUHA 1JJCB 3Q89A 3MHYA 2I1RA 2DIVA 3PZPA 1R0BG 1N54B 1S1XB 2C2DA 5GAGU 1RAJA 5K14A 4XO0A 1RISA 2ACYA 3CE8A 4BS2A 1J5OA 1S4EA 1RHQB 3HFVA 3M32B 4IR9A 2R8IA 3MTKA 2FHKA 3EGZA 3FMBA 1S4FA 3ITHB 4RNMA 5L1LA 3TANA 2MQQA 4QR2A 4KH1B 2MQOA 5KT2A 1FKOB 1Y3KA 2FZGB 2WRMA 4OQJA 3CW2C 2KDOA 1QTMA 4JI3J 2J9EA 1KONA 2V2QA 2MZTA 3R1HA 4CH1A 3W2VB 2O66A 2QZ8A 4URSA 1SJ4P 4XK8C 2IYIA 3GQCA 2AP6A 1BQNB 2BQ3A 1N6QA 2I8EA 4NEZA 3CVKA 3Q8SB 5DG9A 1IM6A 2DH7A 1VC5A 3R2CJ 2DNOA 1Q0NA 4KHPJ 2XHCA 2NUHA 3CJ0A 1UW9A 2VFTA 4DR5J 1JJ4A 2VONA 4BDPA 1R6VA 2D41A 3HD1A 1NJZA 4H4KA 2HURA 3C8YA 4Y0FA 3GG1A 2VUGA 2L9DA 2KHCA 3CCWA 4ID8A 1UVKA 5C2GA 1S76D 4JI1F 1S1WB 1H72C 1JLCA 4NLQA 4URQU 2V68A 1N5VA 3SCJE 1FK9B 3H25A 2HZCA 4JP8A 4ED0A 1T8EA 1JXLA 2YXLA 4RUBA 2XBPA 4DDFA 2LCWA 2CQ4A 3FVYA 1QAXA 2JRSA 4LRAA 4WK3A 5KOXA 1Z2ZA 3MR5A 1B0VA 4DF4A 2PFFB 4ECWA 5A8WA 1S9FA 4D3GA 1RXOB 4OYPA 3G82B 1DTTA 4QYZJ 3HM9A 2GO8A 5J2NA 2IY5B 3UDLA 5KFYA 3PRBA 4CNZA 4QQBA 4E8UA 2CUYA 2VPZB 3LUYA 2V4JA 4EYIB 3DI6A 1H0HB 3CIZA 1REVA 5CYJA 4X62F 4MK8A 2C2ZB 1UVIA 4MK9A 1X5OA 4IO9Q 4OZ1A 4NCGA 1LXJA 1XNQJ 1BY9A 3RB4A 5DJBA 7AT1B 4W98A 2ALZA 3FKBA 3I4HX 4X4NA 4DCOB 4KGXB 2HBRB 3HVTA 3OLAA 2W7OA 2DD8S 4RNHA 3MM9A 2ZWOA 1LKZA 3E3XA 5KFLA 2J0QD 4K2XA 5A76A 3QIPB 3DOMA 4E2FB 4DZ6A 2B9XA 2WCXA 2LU2A 1PG5B 1X9MA 2FVCA 4ICLA 2WVEA 1AB8A 4FYXB 5E3QA 2UZAA 1FESA 4B9UA 1SXLA 3T5KA 2I2YA 4DI6A 5LMNF 1QVGR 3ILJA 3A4TA 1VJQA 1SJQA 3HJVA 3QJJA 1QY7A 1OPIA 1G7CB 4MFBB 2J6TA 4X65J 2ZNZA 4XPEA 1W2IA 3KG4A 2I6WA 7FDRA 3D7SB 3MOZA 3IAM9 5HANA 4DV1F 2VG7B 1R8HA 1VRQC 3C19A 4NLXA 4UTGA 1VBZA 4A8KA 4C11B 1O8BA 1AYEA 2KU7A 1ITPA 3BQ2A 2BJEA 4QWAA 1UKUA 1RHJB 3U1LA 4ECZA 5AE2A 3HZGA 2VQFJ 2ASJA 3UVJA 4ZPWR 4FNHA 1NDLA 3UI3A 4ES2A 3PW7A 2AJ0A 1GH8A 4PYAA 1F60B 2CJYB 4OX7A 4LQ3A 5HJYA 1HPZB 3QAUA 1T3OA 1HLWA 3ET6B 4Y00A 4WZMA 3CC7S 1B0PA 3I5CA 2UV8G 1TTHB 1NU4A 1RTJA 2P9EA 1JLFB 2WB4A 5KFUA 1UW4A 1ZM4A 1XK8A 2AKWB 4ZLPA 3SEOA 1FJEB 3EM1A 2DPJA 3J7ZT 1YZ6A 1MU2B 1IBKJ 1K47A 1YTYA 4NE9C 5T41A 1NO8A 1HQEB 3PCOB 2DH8A 2FJEB 2PDAA 3UNGC 3ZNJ1 3C15A 2DNZA 3BH6B 1C0TA 4RW8A 4QR1A 3I55S 2EW9A 2PFDA 1WDTA 2D3ZA 2BXJA 3UR3C 2JFKA 3DLKB 3DFEA 1CC8A 3QGIA 4DHVA 4DV0J 1TKTA 1HBNB 1IR2A 4KE5A 3BSNA 2OTJS 1QAJA 3NGUA 1YLXA 2XO7A 3ENWA 2KT5A 1BXNA 4FYVB 1XJWB 2DHSA 1NK4A 2RKIA 1RWVB 2XLJA 1H2UX 3D9BA 2RNEA 4KPYA 2BR0A 4DR7J 2L48A 3AD7C 3D6HB 4LIWA 4MYTA 1IVZA 3J81U 5CYQA 3NMRA 1VRTB 4O3SA 2R42A 2MKSA 2OHDA 2DXFA 3CCES 4QYRA 2GX8A 3O3LA 1ZPVA 3PJ9A 2X3GA 2GMLA 3DOLB 4I6WA 3PHTA 1VQOS 3EWGA 1S0VA 3MAAB 1ZA1B 5CD4H 5LMUF 1RTHB 2WONA 3HD2A 5GAHU 4DN9A 3KLFA 3KHGA 1UCNA 3DYAB 1FI4A 1YITS 2I38A 1LWXA 2CADA 2RDJA 3V6HA 3N28A 5C24A 4U7UK 2YX7A 3GFZA 2ZE2A 1WC6A 4QR0A 1X9WA 4E0DA 3MAHA 2HRYA 5ADZA 3W62A 3TVZA 1RWKB 2LKZA 2V50A 3CXCR 1RABB 2GV1A 1RT4A 1WEZA 1V9OA 5HJXA 1SL0A 1SV5B 3SFGA 1VIOA 4FPIA 5L1KA 5CYMB 3MM8B 1Q95G 3K17A 2HNYB 3GYNA 2DNRA 2ASDA 1L5UA 1TKXB 2CPXA 2GQ2A 4X4QA 4K2JA 2H4WB 1IWGA 2QYGA 1UTAA 1IM4A 5J1EB 2NXCA 2FC9A 2GC8A 4KRWA 2XLKA 2ZJQQ 2VG6A 5K8MA 4A8OA 2RIJA 5L38A 3O5TB 3MEGB 4DOZA 2Q6CA 4ZVHA 1ZH5A 3I56S 3CC4S 2DXDA 3NLCA 1QM9A 4FXDA 3BN4A 3Q8PB 2CAJA 2NUUG 4CWBA 4P74A 2DGTA 4PG7A 3QRRA 2M52A 2AJ2A 4CQ1A 2ZJRQ 1VQKS 3CO9A 2QMUB 4Q8FA 4UZBA 1DJ0A 1CJVA 3CD7A 2OI2A 3EGNA 3I0SB 6FDRA 3NCQA 3DHWC 4PXEA 3HT0A 4HHJA 3K58A 1RCXB 4C3KA 2X1FA 4WFYA 5J2MA 2BACA 2POKA 1N32F 2RSQA 2OKQA 3CCZA 4CRJA 1NJIT 3BGLA 4X62J 4QWBA 3UD5A 4IRDA 1YHQS 4OV6A 3IG1B 3NBPB 2HMIB 4PWDB 1R89A 5SZTA 1D3WA 1H38A 4DR4J 1T0TV 2GMHA 5D4OA 3RB0A 1CS4A 2PD1A 1S1UA 3HF5A 2EBGA 3EZUA 2IJNA 3ICLA 3N5FA 3EXYA 2Z0GA 2D3O1 4I4BA 2OEKA 1ELOA 3GIKA 4F2SA 2HNZB 3ZTRA 1MN7A 4KGMA 2GQCA 4EYHB 2ZBPA 3DRXA 5AJ3F 4B3MF 4L76A 1JLQB 4LF6F 2G1HA 2J9DE 1ACMB 5FD1A 1Z4UA 4X84A 5KT6A 3C16A 3BB5A 1VRUB 3B4MA 3KUHA 4Q44A 2XY5A 1S99A 4K4VA 2UXCJ 3F41A 2W9AA 2DHAA 3RW7A 1FTRA 1KS2A 2MLZA 4TQRA 1C0UA 5LMNJ 4QIFA 3F0NA 1EJ7L 2ZH3A 4LF2A 4EBCA 2H9ZA 2RB7A 2LA4A 3OVBA 1QTNB 1REGX 4LJMA 2MB0B 2F40A 1U1MA 2R7XA 3SQGA 4KGVB 4CLWA 5F8NA 5C25A 3NMAA 3NCPA 2RUSA 3MR3A 1BLUA 1Y3JA 1V3SA 4USUA 2W4CA 3F44A 3HHDA 1H7XA 4DV3F 4LUBA 4FNIA 2YKQA 1NJYA 2J7KA 1R8PA 3PX6A 3MUMP 3TZWA 2OPSA 2D3OR 4JV5F 1NK9A 5I3PA 2VFVA 2DNLA 2F8HA 3HX9A 3D28A 2YWWA 3KHHA 1DBDA 3LANA 3OFEA 2B8QA 1TFYA 5GMEA 2CJ9A 3W2WB 1HQUA 4JI7F 1VQ5S 1IKXB 5EGYA 3M30A 3PW0A 2XO6A 1KQSR 2OSQA 2G1DA 2QV6A 1U1PA 1QDUB 4NMLA 1NK0A 2KT3A 1UEUA 4LVOP 3IRWP 2K1RA 2ZD1B 4HT7A 3T6JA 3GJRB 3GIRA 3BO3A 4TY8A 5KTQA 1JNRB 4WIQA 1VQ8S 3DOKA 4LF9J 3OR2B 3I0RB 3N6LA 4DX7A 2XB2D 3N5BA 1FXLA 3LQVA 3MECA 5E33A 3MD3A 2R9LA 4ITSA 4X4VA 2J7UA 4IDKA 4NMXA 2MY7A 2WOMB 2KFYA 2DNMA 2C3OA 4JV1A 1PYOB 1AT1B 4K5SA 1JNZB 3J7YU 3SMZA 3KUGA 2Y1IA 4MK7A 5CZXA 5KG1A 1MROA 1SUQB 3J7AN 2D74B 4I2PA 4MYUA 2C2EA 2FYXA 1S6OA 1HHQA 5D78A 4ZN3A 3NOGA 1P1LA 3F73A 3KUEA 5KG2A 1LWFB 4ZP6A 1C1CA 2E5GA 1IKVB 2QYCA 3CDEA 3AOCA 4YB1P 3H5UA 4OMFG 3LP1B 3EPIA 1FD8A 1HNVB 3FZ2A 3SCLE 2CZVC 4ECQA 4QU7A 1CC7A 3C3LA 4UOCA 2MLYA 3LWMA 2GAHC 5ETQA 5M2RA 3EX7B 3BS9A 4ZOSA 5EDWA 1RA7A 3TA1A 5F0WA 5H9FK 4XTTA 1EARA 4DEZA 3G86A 4QBUA 5IM0B 1VQSA 3HCXA 3AJDA 4AQYF 4O44A 3MFHA 2VDIA 1HW8A 4FKYA 2G4BA 1HNWF 4O3OA 2EC0A 3KNGA 3R8YA 2XTJP 1MWYA 5D3GA 4F4KA 3BYRA 4H4OA 2AJFE 2HNDB 2RU3A 4KFBB 3KK3B 4LF5F 2BZ2A 2KVQE 4MKAA 2APOA 1FJ7A 5C2CA 3Q24A 4QZVB 1TU0B 1C1BB 4U96A 1RAAB 2VDHA 4BC9A 2OFHX 1EP4A 1M5PC 3KMQA 2G0JA 1SC4B 5L1IA 3J81Y 3KXDA 3MTJA 4M5JA 1K0TA 3RG6A 3T3FA 2R8JA 4PAAA 5B7WA 2XMKA 1NKBA 1JLGA 2IM1A 4CCHA 1T03B 2A6MA 2C2NA 4LREA 4KHRA 5HN0A 4WTYA 2BUNA 3CULA 1UZHA 3SDEA 3BR8A 2CJQA 2E5LF 3PXGa 2BMBA 3FEXB 4IG0A 2OPQB 3S1TA 1SIWB 4ZCIA 1R43A 1NDKA 5EWEA 1QD1A 4WFZA 3LP0B 2OH2A 1N32J 4FYYB 2VKZG 3G71S 5KFHA 4ZPCA 3TAQA 2OPRB 3UCUP 4M5IA 1CVJA 3JTPA 3BO2A 3QLHB 1BE4A 1WACA 2R7RA 4H4MB 2HK2A 2GQQA 1YK9A 2C28A 1Q79A 1I5OB 2C22A 3V5RA 2IAJA 1F2GA 3OHBA 1AZSA 3K2YA 5IFMA 4X66F 1RT7A 1WKKA 2RRBA 4M5GA 2HHHF 3TP2A 2R7SA 3DMJB 3KLIA 3T9ZA 2MSTA 1HMVA 4ETXA 4FS1A 2MQMA 1CQMA 2DNYA 2GHPA 4NRUA 1S77D 1E6YA 3KJQB 1N0VC 2VICA 1X4GA 5AJ3J 2ZBRA 4B3MJ 4LF6J 4F02A 1RTZA 3SIPB 3L3CA 1HWLA 4OX6A 1RT3B 4X64F 1M5KC 1KDNA 1RU1A 5DQIA 2J6SA 1DQAA 3RBEA 2CYYA 4DSFA 1E6VB 3B54A 2RU9A 4NZ6A 1KD1T 4GRSA 3OL8A 4C7QA 4ECSA 4ZLLA 5L8RC 2AGOA 1FERA 1D0EA 2QX0A 2CDRB 1VGYA 4ZJQA 1FRHA 2L08A 3UPFA 4GC7A 3PIOQ 2E44A 3FRZA 2D69A 2HFZA 4B3RF 3M05A 1FRIA 4WU2A 3I82A 1VQMS 3PM9A 3KLHA 3DRPA 4RU9A 4DV3J 2YKMB 3GJQB 1VR6A 5DDQC 4Q5VA 3H5YA 2YH1A 4H4KC 2P2CB 4B3OA 1UZDA 2XSJA 2ZH6A 1X4FA 3C14B 2HGLA 4DBQA 3VGUA 2FJVA 2DGWA 2QL7B 1LFWA 2I5JA 2AYBA 3MPWA 4RW9A 2OMLA 2GVZA 3DM2B 4M5MA 3J81j 5HROA 1Q7YT 5ETTA 2J8AA 4LBHA 4ELTA 1YG0A 1X8DA 2B6AA 4UY85 1HBOB 4LSLA 1CLFA 3IGVA 3E8OA 2W8KA 3HFZB 4DR2J 3C2PA 2CXEA 4K5RA 4Z7CA 1NB7A 1VISA 2JEGA 2UUBJ 4J37A 2DR7A 2ZUGA 4P10A 2DRDA 2EK6A 4MAKA 2C3UA 4ZP9A 2HFNA 3CCRS 4M5DA 3BBFA 4NCGB 5DDPC 2B9WA 2CQ3A 2HQGA 4PRFA 1IKWA 1T9XA 2OAUA 1XTZA 3SSQA 4QPTA 2UVRA 2ZNYA 1N48A 3SZ2A 1MWQA 3NRBA 2IVFB 3MR7A 1ZBTA 2YY3A 1JXEA 3CWJA 3RAQA 2XY6A 1JX4A 4I6YA 3MMCB 1QE1B 1MN9A 3R9LA 3K5LA 4DL0C 5T7LA 3CCSS 3TQ1A 2FJWA 4J9MA 4F3OA 3CJKB 2FY1A 4DCJB 2C1EB 1KTQA 1KQKA 4RUCA 3D0GE 4B9LA 1ZM2A 2XMUA 2XYPB 5KG6A 2XCAA 3UDCA 3DLBA 1GT8A 3FK4A 3VAHA 3L4BC 3R5BA 5FLXU 2UUCF 1TKZB 2QA2A 4O0NA 1RT6A 2U1AA 2EFQA 2OGUA 3UD4P 2E9RX 1UFKA 3TZZA 4A8QA 3H4DA 4KH0B 2YKOA 3MM7A 4DL3A 3P4UB 3V6JA 3OTDA 3PTWA 2B8PA 1DAXA 1LXNA 2PA8D 3H5XA 1UPPA 2XGPA 2RILA 1TV6A 3R7BB 3CDWA 1H74A 3KJFB 2JL9A 1UAWA 1DLOB 1TMMA 2JEJA 4B9SA 1NDCA 2E1PA 2LXFA 2CWXA 4OJGA 1XMQJ 2ALYB 5F0UA 2BRLA 3OFFA 4ES3A 4G3IA 2M4MA 4TNOA 2PMWA 3BSAA 2CA9A 3W7BA 1PSDA 1U6FA 3TVKA 1DTQA 1RI7A 4AQYJ 2MKKA 1C2PA 3ELHA 3KYLA 1NKCA 4NYPA 5JXSA 3O1LA 4TY9A 1C4CA 5KFEA 1UA1A 3R5CA 2ADCA 1MMNA 4CO1A 1CJUA 4KKOB 3RB3A 4WYLA 3MMBA 1VQPS 2QSWA 3PVXA 3FQLA 4M5NA 4CTAA 2YNFA 4LF5J 3PEHA 4MMOA 1PBAA 2IHR1 1O0PA 1RTJB 3MEKA 2OLWA 3U02A 4GO5X 4ZVTB 4DPTA 5KFOA 1T9YA 2HHWA 4IYQA 4KTQA 1F9FA 4CI0B 2NZ4A 4USTA 1Y5NB 3DRSA 4CLKA 3CJ2A 4DSIA 2OUGA 1W2BR 1G6BA 5ETOA 2GVDA 1SBRA 3TJAA 4Q2LA 1U1OA 2J76E 4FYWB 2P5VA 4RW8B 5C42A 2ZKTA 4V1Ak 1FX4A 3PDNA 2W9CA 3ETOA 4WK1A 2Q3PA 5DM7Q 4LSNB 4DSLA 4JOUA 1M1KT 2ADBA 4HTIA 3VAGA 1F5AA 5A8RA 2X1GA 2GJIA 1I51B 3RR8A 2VG5B 4OHWA 1S0NA 2WBRA 3GYGA 1CEZA 2O67A 4Z2XA 4RNNA 3VGSA 4TN2A 2E5LJ 3THTA 5U47A 1FRMA 1VQ4S 4YDDB 1NM2A 1X5TA 5I42A 2JOQA 4P71A 4DPUA 1B0TA 5EN1A 4TU9A 4LBIA 3BSOA 2XI2A 3TYTA 1FJGF 4DUTA 4CH7A 1NZ8A 1CPZA 2IYGA 1MNEA 3EICA 2YNIB 4OI1A 3KNAA 4ANDA 3IA0A 3BR9A 2JLGA 2VD3A 1OMSA 2LDYA 1FFGB 3T5LA 2CQBA 3Q2TC 1S9GB 3TAMA 2DNGA 3ULHA 3VAIA 3KLEA 4J9PA 1K44A 1SPBP 3OHAA 4M63A 3DNCA 5CAAA 3EZ5A 5A0YB 1FVSA 2HHHJ 1TVRB 4Z7YA 3T1HF 4YB7A 1D8ZA 5HVHA 2CRLA 2A6OA 2P8IA 2IRXA 2LFVA 2MZ1A 2N7YA 4J9OA 4Q45A 2W2NP 2LEAA 4RW6A 1RHUB 5FDLB 1HI8A 4LRBA 3DGPA 5KFWA 5K8NA 2H65B 5JMNA 3PKMA 3DHXA 4I56A 4QIWD 2XMJA 3MR6A 1D9FA 2B0GA 2A1BA 3G4SS 1RTIB 2EG2A 2V8HA 1G1XA 3AQPA 3HZEA 2QA4G 4O3PA 4ENOA 3QT7A 2KT2A 2P9CA 1U0HA 5DG8A 3OL7A 5GMKa 1J5EF 3HMJG 2CPIA 1RWOB 2V4RA 5T14A 3HSZA 3HT3A 4X4TA 3V6DA 1DRZA 5G0RA 4ATNA 4KBIA 3BH7B 5E3RA 3BKTA 2YNHB 4B3RJ 4C8LA 3M8RA 2CWKA 2YNGA 3FC9A 5JVHQ 3KG0A 1TK0A 1P1TA 3CMES 3HKWA 5ETLA 2HHUA 1SKRA 1L3KA 3OTOF 3DU6A 2OMOA 4CLZA 4DG1A 4JB8B 4ZS6A 3ILOA 1PC5A 4KV8B 1RACB 1URNA 4D3HA 3W5ZA 3G8QA 4QPXA 1TMJA 3KJVB 4DU8A 1WOPA 4WE1A 2LEPA 3H2UB 3VWSA
chains in the Genus database with same CATH topology
5E3QA 2KXNB 4DUYF 5B0GA 1H6KX 2UZAA 1S1TB 2QA1A 1X4CA 4WCEQ 1FESA 4B9UA 3M1VA 1SXLA 4GKJF 2C42A 3T5KA 2WOMA 2E5IA 3SFUA 2ZHAA 1XERA 1SKWA 1TL5A 1S0OA 6FD1A 2DR8A 2I2YA 2XMTA 3VQSA 2M0GB 4HT5A 3B78A 5CZVA 5LMNF 1YJTA 1GXUA 2DCLA 1QVGR 5KT7A 4FPRA 4URGA 2EG1A 2VBYA 2BW2A 2R7WA 1SJQA 4KO0A 4DS4A 3QJJA 1QY7A 3TAPA 3CEDA 2WAQD 2DH9A 1OPIA 1RT7B 1G7CB 5HBMA 3IBWA 4MFBB 2J6TA 2KXFA 2ROEA 4DUZF 5K5MA 1VQYA 1ZETA 3ISNC 3MMAA 2ZNZA 4XPEA 1W2IA 2V8VA 1F5CA 3ENVA 1UVNA 1ZPWX 1D9DA 1SUQA 3IR5B 2KI2A 3KLIB 2VZ9A 1LW2B 4RWWA 3S01A 4NLYA 4R5PA 3KG4A 4UQTA 1FRJA 4TXSA 1HMVB 4ES1A 7FDRA 1UWBB 1D8YA 3MOZA 2HPUA 3IAM9 4DV1F 4C8MA 1WTFA 2PMZD 1OIAA 4Q2MA 1SL2A 1DZ5A 4B9NA 2VG7B 1R8HA 2B4PA 5IT0A 1K1QA 4AL7A 1N88A 2YQ3A 4NLXA 3D2WA 4EWTA 5DGAA 1VBZA 4Q7AA 4A8KA 1TK5A 5M2PA 1LWFA 1VMBA 2EK1A 2HVIA 4G1PA 2YWKA 4C11B 1O8BA 2V94A 3KLGB 4JI6F 2KU7A 3E01B 1IKVA 2IVMA 4A4JA 2YWFA 2ROPA 2F8MA 4C8OA 2VBWA 3JB9k 4IO1A 2RDIA 2YWGA 3NG8A 3LP1A 3BQ2A 4KSEB 2PT0A 2LQ5A 1HI1A 2BJEA 4WFXA 4QWAA 1HNVA 1UKUA 2EFGA 3OBIA 4N77A 2AYEA 4DS5A 3AHPA 2E7WA 3ISND 4UUXA 1F5BA 3U1LA 4ECZA 4I7FB 2PMHA 5AE2A 1S49A 5F9NA 4ED1A 2KVIA 3MPVA 3V81B 3HZGA 3CF5Q 1IKYB 3RZAA 3C6UA 2ASJA 4OJHA 5EX0A 4IH7A 1Q4RA 4ZPWR 4ZA1A 4ECVA 1VC0A 4FNHA 4ILMA 3UI3A 2C3YA 4ES2A 2XS7A 5E0OA 4A8YA 3PKYA 3PW7A 2IM3A 2AJ0A 1GH8A 2PI4A 2ZOGA 3EYZA 1F60B 2ZDPA 4OX7A 3PW2A 2DRBA 2DIUA 4LQ3A 1HPZB 3VAKA 5F41A 4QWDA 2K3KA 4I67A 3LAKA 3QAUA 3T1YF 1T3OA 2RF2B 5LSOA 3RAMA 5IM0A 4Y00A 1U09A 1SKSA 4ZPDA 4NA1A 3TA2A 3DLEA 3LALA 1OSDA 2VQFF 4WZMA 2EBEA 3IO1A 3PV8A 3CC7S 1S6PA 1T3NA 4V19J 2QSFA 1B0PA 2JEFA 3I5CA 3IR6B 2UV8G 3MCSA 3MEDB 2AYMA 4OL8A 1NU4A 1FE4A 2CQ2A 3WC0A 5KG5A 3KLHB 1RTJA 1HHSA 2P9EA 1JLFB 2WB4A 2JLEA 3DRPB 4OI4A 4W90B 2AJ1A 5KFUA 2BBEA 4C3LA 5KFNA 2N3LA 1CSJA 2FHJD 2OTLS 1UW4A 1ZM4A 1XK8A 4ZLPA 2MZJA 3SEOA 1FJEB 3AA8A 4OHZA 3D0HE 4KC5A 4O4GA 2DPJA 5FJ4A 4USJC 3J7ZT 2EFOA 1MU2B 2J7WA 2N7CA 4B3OB 2HNDA 2FC8A 4KFBA 1JLEA 2XSJB 1YTYA 4AUKA 3D54A 5T41A 1NO8A 4K4XA 2QRRA 3VAMA 1RJJA 4C8NA 2F9JA 1R8AA 3BZQA 1OSCA 2MKHA 1HQEB 1NAQA 1XNRF 1G2EA 4LF7F 1HNIA 5CCMA 1FKAF 2DH8A 2FJEB 1T05B 2IFXA 4EBDA 3MF5A 2FD2A 2PDAA 3OVSA 3UNGC 3T9NA 2I5JB 2OFGX 2IA6A 4Y65A 3CCTA 2QEXS 1VFJA 4CH0S 2DNZA 2VFUA 4EUVA 1C0TA 1X4HA 4R8UB 4RW8A 2J6UA 2OSRA 4QR1A 3I55S 4RW9B 2CQDA 2EW9A 3KOAA 2D3ZA 1C1BA 2R7OA 1TL3A 2BXJA 5HROB 2QO3A 3UR3C 4NCAA 2JFKA 3DLKB 3PJXA 2ASYA 4X4RA 3N0VA 1Z2LA 2MZQA 3DFEA 1CC8A 4PCQA 1FCAA 2G13A 3QGIA 2B6AB 4HYKA 2CJKA 2XNRA 4LSLB 1X4EA 2W7PA 3L7PA 4DHVA 4YEAA 5KFKA 4ZHRA 1TKTA 3DCAA 1HBNB 1S6QA 1U2RA 3AA9A 2ILYA 3TARA 4HKQA 3J80Y 1U1KA 1HD0A 4KE5A 2YX4A 2KN4A 3BSNA 4PR6A 4YB5A 2OTJS 1QAJA 2JVOA 3AB2B 4QIVA 2XO7A 3A1YG 4MKBA 4M95A 4WJBA 5F8HA 1VIXA 3SYZA 2ZKUA 3I9V9 5H1SV 3ENWA 2CQPA 2RQKA 2KT5A 2EPIA 2LDIA 1SH2A 2JLFA 5F8MA 2ZZNA 1XMBA 1KC8T 5HO4A 4A47A 3RW6A 3I9ZA 2DHSA 5KFAA 1NK4A 2ZH4A 2RD5C 2X51A 1BQMB 2F9DA 4M5DB 3MEEA 2RKIA 2N4DA 2XLJA 3GV7B 2VOOA 1JKHA 3AY0A 1T03A 1N5YB 2Q43A 1H2UX 1N5TA 4DV0F 2RNEA 4KPYA 3MM5B 3ENQA 2BR0A 1IKWB 3TX8A 2L48A 4Q0BA 4A8WA 1EETB 4IUFA 2WK4A 2NXUA 2AJQA 4O4RA 2CPHA 5HL7Q 4YMEA 3QGHA 2DGXA 2UVWA 1H2TZ 4LIWA 4MYTA 2DT9A 5CYQA 4O3RA 3UFCX 3NMRA 1DHMA 1VRTB 4PQUA 4O3SA 1ZYQA 1T02A 2FIUA 3KG1A 3CCVS 2MKSA 3X1LB 5EWGA 3CCES 1GX5A 4PWUA 2K1RB 4UUWA 3NL0A 4QYRA 2GIRA 2GX8A 5KFVA 3O3LA 4C9DA 1ZPVA 4NLGA 3HHLA 4ILLA 1WI6A 2GA7A 3OXFA 2U2FA 4LVNP 2X3GA 2OPQA 2GMLA 4R0JA 3DOLB 5C5JA 4TY8B 4ZCKA 4W92B 2I9SA 3QO9A 4DR7F 4I6WA 4ID5A 1DQ8A 1BGXT 3LP0A 5E3CA 4F8RA 3DOKB 5T7LB 4Y34A 4LIRA 3M6VA 5FLXY 1AROP 3OFGA 4J9LA 1VQOS 2VOPA 3PO5A 4C98A 1S0VA 5BJRA 3B4DA 2OPRA 2VPYB 2F1FA 1H3DA 3OTCA 4HLBA 3QLHA 1YJWS 2BRKA 1Q8IA 1K73T 5CD4H 2EWHA 3M2UA 4DX8H 3ISZA 5LMUF 3TVYA 1RTHB 2PE8A 3MECB 2JDJA 2WONA 1U45A 3T5JA 1GAOA 2AW0A 1LWCB 4H4MA 4B02A 4DN9A 5B08A 5JJBA 5GAHU 3S8SA 3KLFA 3KHGA 5J1NA 4FF1A 4IG3B 4ZMMA 3POTA 3MPYA 1H98A 3N6NA 3LP2A 1BQXA 4DJBA 2LQBA 3DYAB 1YITS 1YRTA 3P3DA 2I38A 4BBYA 1ZM3A 2YKPA 2MHNA 3OSNA 2RDJA 3CDBA 5KFJA 1GXTA 4IOAQ 3TR5A 1KR4A 3D0IE 3V6HA 3N28A 2O1PA 5C24A 4U7UK 2YX7A 3GFZA 2BE2A 2YKNB 2ZE2A 3IS9B 1RT6B 3OQ2A 2IBOA 4QR0A 3VZIA 1X9WA 1VBXA 4C2MA 4E0DA 3CJ4A 4DL2A 4EFAC 2MHEA 4F3QA 3DMJA 3EUNA 1Y5LB 3PJWA 3C46A 1P27B 1LWEB 1HBUA 3D5MA 3CPWR 5GVQA 1FEHA 1Q8LA 2DHXA 3MAHA 2HRYA 5ADZA 5KFTA 1V6HA 1KLNA 1Z1ZA 2DNNA 3MM7B 3HXMA 5J2PA 3TVZA 4NLPA 3C6TA 2LKZA 2E9ZA 5CQGA 3SXLA 3CXCR 3GYXB 2GV1A 3HO1A 3DLGB 2FPHX 1FEEA 3FSIA 1S6UA 1RT4A 1WEZA 1RTDA 1V9OA 4YR2A 1SL0A 1IR0A 1SV5B 3SFGA 1VIOA 2P6TA 1SL1A 5H9FJ 2CQ0A 2XGQA 5L1KA 4ED6A 2ZDOA 5IT4A 5CYMB 4JI2F 3MM8B 3OPKA 5H9EJ 2HNYB 3GYNA 1RT3A 4ZCLA 4FS2A 2DNRA