2KXHA

Solution structure of the first two rrm domains of fir in the complex with fbp nbox peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
199
structure length
199
Chain Sequence
GAMAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(U)-binding-splicing factor PUF60
publication title Molecular basis of FIR-mediated c-myc transcriptional control
doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 45
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kxhA01
1JMTA 5GADU 3THPA 1BY9A 3U1LA 2KVIA 3I56S 3SDEB 2EK6A 2M0GB 1UAWA 2D9PA 5LXRA 1WI8A 4IO9Q 1DZ5A 3S01A 4WIIA 2N3LA 2AD9A 2MQQA 1U1RA 1VBXA 3P6YC 5ITHA 4EGLA 3ZZZA 4TU9A 4QPTA 3UCGA 3VAIA 3TP2A 2LA4A 2E5GA 3PIPQ 3CCRS 1JJHA 2ZJQQ 3CD6S 2FY1A 2J8AA 2LA6A 3CULA 4CH1A 1OWXA 1WF0A 2M52A 2F9DA 2F9JA 2KM8C 1YJNS 2AYBA 3CCUS 1VQ4S 2MQLA 1YJWS 3UCZP 1VC6A 2DH7A 4FXWA 1S79A 2D9OA 4F02A 3B4MA 2YH0A 5IM0A 1SJFA 2MY8A 2J0QD 2MZSA 3FEYB 2KXNB 3S7RA 2DNPA 3RW6A 1FXLA 2A3JA 1RKJA 1UP1A 1WF2A 4LIRA 1G2EA 2X1BA 3MUMP 2CQDA 2LQ5A 2CQ4A 4OZ1A 4U67Q 1VQNS 3VAGA 1M5PC 2VONA 4IOCQ 1WEYA 2K3KA 2MXYA 1KQSR 3VAMA 3BO3A 2YKAA 1VQ8S 5IFMA 3CMES 3UWTA 1SXLA 1OPIA 3VAHA 4Z2XA 2DGQA 2JVRA 2MQMA 1YTYA 4C4WA 2YWKA 4Y00A 3RW7A 1FJEB 2KYXA 5DM6Q 1K9MT 2DO0A 1U2FA 4J5OA 1KOHA 3CUNA 5HO4A 5DDOC 2DHSA 4IUFA 4W92B 2RRBA 5GAHU 3VALA 1X4EA 3Q2SC 2FC9A 2CQ1A 1N52B 2ADCA 1U6FA 2DNYA 3BO4A 1U1NA 3G9CA 5CA5A 1WHXA 1Q82T 2X1FA 1WELA 2M2BA 1HD1A 2CQPA 1FJCA 4ZKAA 5JVHQ 1KD1T 1ZH5A 2CQCA 2KG1A 1PGZA 2KU7A 2KH9A 2DGSA 3R27A 4WCEQ 3R1LA 2E44A 2DGWA 1PO6A 4WFAQ 3EGNA 2M9KA 3MUTP 1X4HA 1HL6A 2DGOA 2DNQA 1UW4A 2MYFA 3US5A 4YUDA 1WEXA 5GMKa 1H2TZ 2AYMA 3CCSS 3NNCA 1AUDA 1SJ4P 2M8DB 3CCVS 2MSTA 4WFBQ 4RU2A 4CQ1A 1HA1A 2MQNA 2MY7A 1YI2S 3NS6A 1IQTA 2X1AA 2VODA 2E5HA 2DH9A 2L08A 2MGZA 1YHQS 3CCJS 1WI6A 1ZZNA 1WHVA 2NZ4A 2ZJRQ 5D78A 1N88A 1FO1A 2LYVA 1Q81T 1FJ7A 1U1PA 4ERDA 3G6ES 3H2UB 1WWHA 1QM9A 2JRSA 2MKSA 4BS2A 2MGZB 2DK2A 1NU4A 4C0OC 2N7CA 3R1HA 1OIAA 1P27B 1WHWA 2HYIB 1X0FA 2EK1A 3S6EA 1KC8T 3SXLA 5DDRC 3NS5A 1DBDA 1U1LA 2XS7A 2RUGA 2LXIA 1YITS 4TLQA 2Q79A 1R8PA 1M1KT 1X5PA 1M90T 2RT3A 2CPDA 2FPHX 2KT5A 3LQVA 5GVQA 5LJ3Y 2DNZA 2XS5A 2XB2D 2K8GA 2RS8A 1VBYA 2CPHA 3PIOQ 2FHOB 1ZZFA 2VOPA 2PE8A 3SMZA 2B0GA 2LXUA 2QFJA 2RQ4A 1P1TA 1M5OC 5IM0B 4UQTA 1YWXA 1H2VZ 4YB1P 2MSSA 2XNQA 1VQ9S 2RS2A 2KI2A 3P49B 2I38A 1OO0B 4IOAQ 1WG4A 2OTLS 1VQMS 1D8ZA 2HVZA 1DRZA 3HHNB 1VQ6S 1U1QA 1KOOA 2CPXA 2MKKA 1WG1A 2HGLA 2U1AA 3U1MA 2MZQA 3OW2R 2DNLA 3V4MA 3G96A 1VC0A 2DO4A 2KM8B 2XS2A 2CPYA 2RVJA 2MKCA 5IQQA 2DISA 1VQ7S 3L3CA 2DNGA 4C7QA 4QU6A 1FHTA 2MQOA 1UFWA 3CC2S 2JX2A 1VQKS 3I55S 2GHPA 5LSLA 4WFNQ 1S72S 1B7FA 1R8HA 3UE2A 3VF0B 1U1MA 5HL7Q 2CJKA 1Q7YT 4TU7A 2M70A 2CQIA 2QA4S 2UP1A 1N54B 3MXHP 3D2WA 2L41A 1O0PA 3CXCR 2LECA 5D77A 3N9UC 3CPWR 2RNEA 1NO8A 4OZ0A 3VAKA 2M4MA 2KXFA 2DNHA 1HD0A 4WKRA 4CIOA 3THTA 1VQLS 2MQPA 2DNNA 2U2FA 3CMAS 2KXHA 4F25A 2AYGA 5DDQC 5DETA 3S8SA 1WF1A 2JVOA 1K8AT 4QU7A 4TU8A 3MURP 3BEGB 3B4DA 2AYEA 2DIVA 3CCMS 2M88A 2DNOA 5GAGU 3TO8A 2QEXS 4PRFA 2LCWA 2XSFA 2SXLA 2OSRA 3UD4P 3ULHA 5CYJA 2J76E 3CC7S 2F3JA 4M5DB 1X5OA 3G71S 2DITA 2CQHA 1FNXH 5LJ5Y 2DGXA 3EX7B 2KN4A 1QVFR 2G1DA 1Q86T 2E5JA 2EVZA 2CPFA 2DB1A 3SDEA 2OJ3A 2CQ2A 5H1SV 2ZJPQ 2HZCA 2I2YA 3HI9A 1XN9A 3MDFA 1H6KX 3MI7X 1U1KA 2RU3A 3CTRA 3CCES 3G4SS 1URNA 1H2UX 3CCQS 2OIHA 2KHCA 2G0CA 1K73T 2MPUA 1SJQA 2DHAA 1VQOS 2VOOA 2BZ2A 1CVJA 3MD3A 2N3OA 3VAJA 1VQ5S 2MKIA 1X5SA 2ADBA 2KG0A 3NNAA 1SJRA 2MJUA 2XNRA 1YJ9S 2GO9A 2CPEA 1M5KC 4WF9Q 2KFYA 1VQPS 3DXBA 2MZ1A 3ZZYA 1U1OA 2CPIA 2MB0B 2OSQA 2CQGA 3NNHA 2MZJA 1WTBA 4A8XA 3VAFA 1W2BR 2LEAA 3MUVP 2CPZA 2BOPA 2FC8A 5DDPC 3JB9k 3G8SA 4QQBA 2J0SD 3Q2TC 2RRAA 1X4DA 1A7GE 5MLCV 2KRBA 2MHNA 3CF5Q 5JVGQ 2MKJA 1X4CA 2DNKA 4PKDB 2L9WA 2OTJS 3UD3P 3DLLQ 5GAEU 3EGZA 2M7SA 2MMYA 2MZTA 2YTCA 3LPYA 4CH0S 3G8TA 3UCUP 2YH1A 2JWNA 1X5TA 1RK8A 4YOEA 2DGUA 1QVGR 2DNMA 3IRWP 3CC4S 5EN1A 1M5VC 2PEHA 1WHYA 2DNRA 5CXTA 1VC5A 1SJ3P 1X4FA 4LJMA 2CQ0A 2CQ3A 2DHGA 2DHXA 2NLWA 3P5TL 2O3DA 2HGNA 1U6BA 2DH8A 2MZRA 3P3DA 2M8HA 2G4BA 1F9FA 1JJ2R 2CQBA 4FXVA 4Y0FA 5FJ4A 3NMRA 4P6QA 2DIUA 3J7ZT 4V19X 4UY8T 1JJ4A 1NJIT 1FT8A 3BO2A 4LMZA 2D3OR 4ED5A 1WEZA 2WBRA 2DGTA 2LMIA 1X4BA 2CPJA 4PR6A 2LEBA 1VBZA 3CCLS 1YIJS 2LKZA 3IWNC 3MOJB 5DM7Q 3FEXB 2V94A 5BJRA 2RQCA 2X1GA 2MKHA 2HGMA 3BS9A 1X4GA 1WG5A 4W90B 3H2VE 5LSOA 3J7YU 2E5IA 4F26A 1A9NB 2KRRA 1X4AA 1D9AA 2MJNA 2N82B 1DHMA 2DGVA 1L3KA 3K0JA 1N8RT 5LXYA 3TYTA 2ERRA 3MD1A
chains in the Genus database with same CATH superfamily
3BYRA 4DV6J 4YP3A 1G6BA 1HBMB 3SDEB 2E1PA 2XSJA 4J91A 3H0PA 3RRHA 5BYRA 1NJWA 4HH1A 5K20B 1UMJA 4QPTA 5CYQB 3KK2A 1T03A 4OZ2A 1RT5A 3LOUA 3R5GA 5C25A 4M63A 3B82A 2VQFF 4ETXA 2Z2YB 3VV2B 4KTQA 1FI4A 3ITHA 3MMCA 4OYBA 1FA0A 1FXLA 3D7SB 3PM9A 2DD8S 5HANA 1NB7A 4LIRA 1PYSB 4A47A 2LQ5A 3WX8A 4U8VA 3VAMA 3BO3A 4KJIA 3CMES 1JIHA 2KL8A 1QDUB 1LWCB 1DJ0A 1K1SA 4Y00A 2EKNA 5J2MB 4FPRA 2IVMA 1FWLA 4GVLA 2RSQA 4ES3A 1VI7A 3ISNC 5ETQA 1RTDB 1TU0B 3N5BA 3KJNB 2NXUA 1KD1T 2W25A 5EHHA 2RAQA 2XHWA 3IBCB 1IR1A 2DGSA 4CRJA 3MPYA 2M9KA 4K5SA 4C8KA 4UOFA 2BKNA 3CDAA 2ZZMA 3SQOP 3D3BJ 2HKEA 2R3VA 4DX7A 2FJBB 4RU2A 2MQNA 2DPJA 2Y9HA 5F8MA 3T1HJ 2D1CA 4AT1B 2BE2A 3Q24A 3RTVA 3TA0A 4EO6A 4UZCA 2LYVA 1FJ7A 3H2UB 2GHVC 2AIRB 4M94A 4OV6A 1JB0C 1RCXB 4HDHA 3Q8QB 4ECXA 3KK2B 2DXFA 2HFZA 3UNGC 4ZIVA 4U7UD 3ILJA 5C25B 2XO6A 2NSBA 4IRKA 1KQKA 5C5JA 3PIOQ 3IR6B 4J9OA 2CFXA 4WU3A 3D5MA 3ITHB 1D1UA 2YNHB 2VQFJ 4F4ZA 2LQ8A 3CO0P 3GJQB 1MLAA 2XZDB 3TAMA 5DZ6A 5A0YA 2CPYA 1VRTA 2ASJA 1DTQA 3OTCA 4QU6A 2IAJA 4YY3F 3JSYA 4DPYA 2KVQE 3MR3A 1VQKS 2IM1A 1RAOA 1Q7YT 1QSLA 2VDHA 2OMOA 1IBMJ 2YX7A 2FD2A 1NO8A 2A10A 4WKRA 3CJKA 4KY3A 5L9NA 5DDQC 5DETA 1AYEA 4NE9C 3B4DA 4M5DA 4M5JA 1C0TA 1HBOA 1O6XA 3UO0A 2QMUB 2B8QA 3OTEA 1YRUA 3R5AA 2SXLA 5D3GA 5KFIA 2QA1A 5AE3A 3NBPA 2BE2B 1Q86T 3EXYA 5H1SV 2AP6A 2JFDA 1U1KA 4OLOA 3P5BP 2H4WB 3TA1A 2E1CA 4CTAB 1RP5A 3GIRA 3AOBA 5KG1A 1FRJA 3J81Y 2OUGA 2PI5A 1WC6A 2GO9A 2HS4A 3MPWA 2FJAB 5HMWA 3AODA 1NEEA 3WHIA 5I3UB 2W4PA 1T7PA 4CH7A 3UVJA 2B4OA 1TL4A 3GLJA 1ITPA 2XCAA 3DHWC 5G4DA 5F8NA 1RBOB 3M1VB 3VGVA 1PJ5A 2M7SA 2LU1A 5D15A 5L38A 3GTYX 3TAMB 1M5VC 5A6PA 1VRTB 1IKVA 4TVAB 3DDIA 4KSEB 4DFMA 2J6TA 4DL5A 4CT9A 2I5JA 3KK3B 4WWSA 4YQWA 4C97A 3K5MA 1AFJA 4YY3J 2PFDA 4IG0A 4MMOA 2LFVA 5THWA 3PEHA 5ETVA 4C8OA 3FKBA 2X1GA 3KG1A 3BYPA 1C0TB 2GAHC 3J7YI 5D3GB 4C6AA 2BKPA 3PW2A 1FKOB 1N8RT 3M05A 1FNOA 1MWZA 3NBPB 3N4WA 4HKQA 2W4DA 3RZAA 3ISND 1IKYA 3HP6A 1N0UA 1GEHA 5LM7E 4LQ9A 2ZZTA 1ZTTA 1S6PB 5HLFA 2Z30B 2WOMA 4GC6A 3T5HA 1EAYC 4CH1A 2DT9A 5I4MA 1CLFA 3NOCA 1HBNA 3ONQA 1S1TB 4OI0A 4EBEA 3D0HE 1WC4A 1N5SA 3GCXP 2K3KA 3M8PB 3KK1A 2AF6A 4LF4F 1KDNA 4C9DA 5HQMA 1SC1B 2IYGA 3RRGA 1F5BA 2HIQA 3GFYA 4O3SA 4F2SA 4PPZA 4KE5A 5AXKA 2PIIA 4ZVRB 4MFBB 2JSXA 3I9ZA 3PYFA 2UU9F 2G2ZA 3FCHA 2V50A 1IKVB 3MECB 1H38A 2RRBA 1X4EA 3C2PA 5LT5A 2I5JB 3NG8A 4Q0BA 3CDWA 4O44A 4ZKAA 2WVDA 2V8HA 4JI1F 4QWBA 3MCOA 2CNKB 5E41A 3R1LA 2DGWA 2DGOA 3IBWA 2J5AA 4Y2CA 1H2TZ 1HNVB 2J0XA 2CYYA 2ZUGA 3M2VA 2ATLA 1CG2A 2VH7A 4ALZA 1T3NA 4QJVA 1V3ZA 3K57A 5HVFA 4GKKF 1Q0NA 4BS2A 2FIUA 5C7PA 1OIAA 4A8SA 3PR4A 1IKYB 3C6TA 3S6EA 3DRYA 1YITS 1IM4A 2HFNA 5IC6B 2WOMB 3LF0A 1QAYA 4CO1A 2O5DA 4P10A 4NXMF 2F8HA 1G1XA 2OPRA 2J9DA 4DV1F 4ZCKA 4UQTA 1TV6A 1OY8A 1T3OA 1HBNB 3HPOA 1S7HA 3P49B 2XG8A 1RWUA 3TZXA 3JXOA 4IDKA 4H4MB 3HULA 1CBKA 3DLKA 3RBZA 5CCMA 3KK1B 5HI7A 1WJ9A 4C8LA 3QRPA 5ETPA 2QV6A 4AD6A 2VBXA 3DOLB 2XO7A 2HZAA 4LF4J 4X4UA 4F3OA 4LBHA 1ZM4A 1PYOB 1RLCL 4RBUA 2DCUB 2E9RX 3M2UB 4C8NA 3OHBA 3HXMA 2UU9J 1O0PA 4MK9A 5D0HA 4AE5A 4O44B 2GIRA 4UZBA 4YDXA 1NHUA 4RW4B 3BH6B 4NASA 1YBUA 2XGPA 3WIVA 1IM6A 3FFIB 2XCPA 2FLOA 4JI1J 2J7UA 5GAGU 3FEZA 3V6KA 3EVWA 4OLPA 3G71S 2DITA 5A76A 2CADA 4Y2MA 1EQ0A 2RUSA 1OYDA 3BGRA 2HNDB 3OTBA 4N76A 1H6KX 2YWWA 4HHUA 1HQEA 4WZQA 3CCQS 2EI5A 2OIHA 2MPUA 3D6FB 4CLKA 2IJNA 4Y2KA 4NCGB 3VAJA 3C6TB 2H5EA 4GKKJ 1L3UA 4WTYA 4ZVPB 2E1AA 4DSIA 5L1LA 2JLEA 1GMWA 2HEKA 1U1OA 4QYZJ 2CPIA 5LMNF 4DL3A 1R0AB 4FS2A 3MEDA 4ECTA 1PBUA 2ASYA 1SC4B 1TV6B 1FWKA 3OHAA 4NXMJ 3ZZTA 2NXJA 3A13A 4DV1J 2OTJS 3T19A 1TK0A 4X2BA 2GO8A 3DLKB 3UCUP 3OLAA 1FRIA 1OS5A 3PFEA 4ZOSA 2PEHA 3ETMA 1T9VA 2VKZG 4DQRA 1TFYA 2GHWA 4DJBA 2YY3A 2CAJA 3N28A 5F8JA 2MZRA 4MJKA 4FXVA 3VR1A 4WKYA 5KG5A 4CYUB 4DOZA 5LL6d 3BSOA 4AXJA 4FKYA 2J0WA 1N48A 2LQBA 1I94F 3S1TA 2LKZA 3FEXB 2RQCA 1WG5A 2XI2A 4U96A 3DYAB 5L8RC 2E5IA 4QIWD 3HK2A 3D67A 2DXDA 4Z7CA 4OYZA 1HNXJ 4ZLJA 4OIXA 2KVIA 2EK6A 1UAWA 4FNIA 2R4FA 2AV5A 4F4XA 1R8CA 4OMFG 2W9CA 3MEKA 4HTIA 3LANA 1HQEB 1JNZB 2DRDA 3GYXB 1KFSA 2BM0A 3ZZZA 5KFQA 1GXUA 3PW5A 3TP2A 4ZN1A 1LW2B 2PA8D 4HT7A 3DGPA 1K0VA 4UF4A 2KZMA 5IV3A 3RYLA 4K59A 3C19A 3IMQJ 1VLOA 3CJ5A 2NR0A 4EZ6A 2WBMA 2DH7A 2Y8WA 1GTEA 2HHHF 2QMXA 2RH3A 3MEDB 2QYCA 3WC2A 3RW6A 1MWQA 5LMNJ 1LWEB 4L3NA 3VAGA 4M5GA 2Z2MA 3TJAA 1KQSR 4F0HA 4PYAA 4CM0A 4KR0B 5D0GA 2B4UA 3A3OB 4ECSA 5KG4A 2DGQA 3I82A 4QR0A 3WQPA 4A8FA 1YQHA 1KTVA 4EK2A 3SZ2A 3I96A 4RR5A 3DRPA 5DDOC 4KRWA 4J9UE 3TUIC 3IR7B 2NQPA 1U6FA 2DNYA 2WAQD 4ZJQA 1WELA 4ZPDA 4MKBA 4WXWA 3O6QA 4DN0A 2CQCA 4DFPA 2WVBA 4A48A 1MMDA 4CLZA 4X4PA 3C3LA 1H7XA 2DR8A 2OPQB 4V19J 4J7CA 3GCWP 2GVDB 1JLGB 3KOAA 3J7A1 5HATA 3CCVS 2W8KA 1VYAA 1ELOA 4K4WA 1Y10A 1ZYQA 1S1XA 3AAWB 2HBRB 1IKWA 4ERDA 2B4VA 3G6XA 1VDHA 5ETOA 1RAJA 1FEEA 2EK1A 1KC8T 2RUGA 4K4TA 4RBVA 3DGPB 5HMXA 1J27A 2FPHX 3C15A 4ZS6A 1VBYA 2CPHA 2MLXA 2HZVA 3QAUA 1T9TA 1H2VZ 1IJEB 1PJ6A 1JWWA 5LOQA 1HFEL 2HHHJ 4FF4A 1RU1A 4CNYA 5K14B 2FLPA 1S6OA 3C6UA 1N5YA 4BC7A 1NZAA 1J5EF 2GVZB 1S9FA 1VQ7S 1YRXA 2XTJP 3W2WA 5AE2A 4EU0A 4XK8C 2MQOA 4DS4A 2BX6A 4PAAA 3PJXA 4MYUA 2AJ4A 4EO8A 3L7UA 3VAKA 1RBLA 3Q0AA 1UJ5A 2NREA 1SIZA 1U2CA 5KFVA 1L3VA 2FJEB 4TU8A 2ZHBA 5KAKA 5B7WA 2GCFA 3LW5C 5GAGI 1YVFA 3MEEB 1S9EA 1R0CB 5KFSA 2WB4A 4Q45A 3FK4A 1MMNA 5KOXA 5A2QY 3LALA 4DSEA 3GSDA 2PGCA 2I2YA 2YPZA 4FBTA 1HI1A 3MDFA 2NXEA 4OYAA 5F0WA 2AKWB 3SCKE 2G0CA 4IQXA 2DHAA 2BZ2A 2ZC4A 5IXUA 2YWFA 1X5SA 2GW8A 4FNHA 1ZAWA 1XK8A 4LF6F 5CH7B 4USUA 3OFGA 3B78A 4P2XA 2G13A 1Q5VA 4ZPTR 2DHHA 4A8XA 3Q86A 3Q83A 3JB9k 4FF3A 2JEJA 4RUAA 4YR0A 3IAS9 4DUTA 2HPUA 2YX1A 3E01A 2MZTA 3C6UB 3OL8A 1N5YB 2DGUA 3E2EA 4NA2A 4Y28C 3GFZA 5IT4A 4B9TA 1LQ9A 4F3MA 2F63A 2HGNA 1J5EJ 2JEGA 2OD4A 4ZVGA 3NMRA 3TA2A 1KHWA 3PG9A 1UVIA 1NB2A 3JS9A 1HHQA 3V6DA 4WE1B 4YR3A 4BWJA 4CLFA 5KG7A 4NXNF 4RKUC 1F5CA 2CVIA 1VFJA 1X4BA 2VB6A 4LRCA 2IIHA 4DL4A 2X3GA 4YS2A 3BSCA 3DLBA 1FE0A 4RBTA 5FLXY 4F26A 1S9EB 3EGVA 4DPXA 4ZVOB 3TYTA 1VIOA 2BJDA 1NMEB 1VOMA 1RT4A 3CJ3A 3GR1A 1SQFA 4OHZA 2VC0A 4C3MA 1V9OA 1SH0A 3T6BA 1NK4A 3P6YC 1FVQA 3CNQP 5AXLA 2YNGB 1RACB 3DNCA 1TMJA 3CVKA 3IR5B 2NCKL 1X9MA 4R25A 3VWSA 4K4ZA 1GNKA 2F9JA 2AYBA 5HQ8A 4X65F 4NYPA 5ADZA 2VKRA 2VFRA 1FD8A 4LF6J 3ELHA 1IWAA 4M5MA 1LW0B 3GE9A 4HHHA 3K2YA 3W2VB 4OZ1A 3ZNJ1 3TUZC 3BH7B 2C2MB 4E98A 2R7UA 3PXGa 2O1PA 3VAHA 1GK8A 1TAUA 3QT5A 2IVYA 5DM6Q 2QE5A 5F8HA 1XIQA 2H48B 4MIBA 3EZOA 1KQFB 1LKZA 3VALA 1X0PA 1S49A 4U7CA 5SUHA 5T41A 3M8RA 3QGGA 1XNRF 1RAIB 2CQPA 1AB8A 4NRTA 1XERA 4RW6A 4ZJLA 2ROPA 1NPPA 3MPDA 3G2XA 2RD5C 2DVIA 3KHGA 2OPSB 3IGNA 4CLLA 2MY7A 3KLFA 4B9LA 5D78A 4KH1B 4F7VA 4BDPA 1F9HA 2QC3A 2EKYA 1RTJA 1SBRA 1RT4B 4YB5A 2HQFA 3OFEA 2VZ9A 5DDRC 3DDNA 2XS7A 1S9GB 1RWXB 4RUCA 2LP4A 4J9VA 1W2IA 3CIMA 4NMXA 2RQ4A 4HLBA 3M32B 5AE1A 4YB1P 2C3OA 1VQ9S 4CO5A 4IOAQ 2HHSA 4X65J 1ACMB 4Y6IA 1RGVA 3GG0A 1LFWA 3P96A 2H1YA 4W4MA 3NS7B 1CS4A 3OW2R 4DCOB 5FD1A 2G9OA 1PC4A 2H51B 5DQHA 1RTHB 3TNVA 1SC6A 3EZUA 4DN9A 5F41A 4CO0A 3W64A 5ETKA 5HL7Q 4LF8F 1QTMA 2WCXA 3JSBA 2M4MA 5KFKA 1HD0A 4CIOA 2NUHA 2HG4A 1MG7A 1RHUB 1FFSB 4RW6B 2JVOA 4KPCA 4JI0F 5HROA 1XNRJ 3H42A 2GIFA 1NKEA 2GMHA 2LQ9A 2QSFA 3BPSP 4CM2A 2DNOA 1Q8IA 2RMLA 4RW9A 3CW2C 3SYZA 3GR0A 3IRXB 4DR4F 1E6VB 3LP1A 4QWAA 2OJ3A 2HZCA 4QWCA 1RT6A 4KFBA 3TJ9A 1XN9A 1RWPB 2ZNYA 1RTJB 4ZK7M 2G0IA 5E3PA 2V0NA 1TUVA 2Z4PA 2NZCA 1SUQA 2CPEA 4N8NA 1IBLF 4DFJA 4YHHF 1HNWF 3I4PA 5DLGA 4NA3A 3OFHA 3BV8A 4ZCMA 5EGYA 4NEYA 2C2DA 2OGUA 4DBQA 1JXVA 5JXSA 3FQLA 5J2QB 4ITSA 1CS4B 2H3EB 4KYZA 2HHVA 3P45B 3RB0A 4H54A 5ETMA 1YSJA 3OD2A 4CLPA 2OFHX 2EPIA 2G4BA 1ICEB 3HJFA 4JI4F 1DURA 4ZPCA 3BO2A 3MWBA 1TKTB 4LFBF 5EX3A 2WBRA 3HCXA 4OI4A 4LF8J 1UKUA 5KG2A 3KNAA 2E7VA 3TX0A 2XMMA 5C2GA 4I6WA 3UNYA 4DX8H 1QSSA 1Z1ZA 4JI0J 4RW9B 2RDJA 4ER8A 3D54A 1MN7A 3SI8A 3MD1A 3AB4B 4ENOA 1R6YA 5L46A 4CLYA 3LP1B 3FSYA 1RT6B 3KLGA 4KFBB 3ZZPA 4E8UA 1M5HA 2B9WA 2N3LA 4D3HA 4K4UA 2LEPA 3HX9A 4ED4A 4DR4J 4EGLA 2A2CA 4TU9A 5L1JA 4I7FA 2UVVA 1AZSB 2LA4A 1EZZB 4PG8A 3CD6S 2KB2A 5BXIA 2FJVA 3D9BA 2M52A 2MDAA 3R6GB 2Q6BA 3JTNA 1WDDA 4TNOA 2HRTA 3KLEB 2BRLA 1R31A 1TR0A 2UVUA 4ZVEA 3S7RA 3ZTQA 2QN6B 1JLAB 3KUEA 5B0CA 2PT0A 4DZ6A 4NOHA 3KDNA 1VQNS 1WEYA 1TL7A 4YHHJ 1HNWJ 1TUWA 2PN6A 1GMWD 5F8LA 3GG1A 1RABB 5HP1A 1HWLA 1DY3A 2LXFA 1K9MT 4HEA9 2RILA 1ZA1B 3RR8A 3HHEA 2B9YA 5KFLA 3OL9A 3HSGA 3BGFA 2HLUA 2H9ZA 3GSIA 4IYQA 4ECZA 1DAXA 4R5PA 4JI4J 2YPYA 2FHKA 4V1Ak 1AA1B 4X84A 3DI6A 2FGCA 4QBUA 4N41A 4LFBJ 5B0BA 3CJ8A 4R0JA 4K8RA 5J2NA 4F67A 3NS6A 3KUHA 1YJRA 1UZDA 3VGUA 2L08A 3MOZA 1WHVA 1N88A 2GMJA 2GGPA 4ILRA 4URGA 4ECUA 1BQXA 1KEKA 2IBKA 4QCLA 4S0MA 3LPEA 3SV4A 3HFKA 4I7FB 2RQKA 1U1LA 1M90T 1M1KT 1BQNB 2UXDF 3BBFA 2XB2D 3PO4A 1KKHA 1HLWA 2RHQB 2FHOB 2KJWA 2VOPA 4IH7A 2XMJA 2LXUA 1RXOB 3KTQA 4RNNA 3PYDA 4QPXA 4N56A 5DLFA 4DU7A 2PSZA 5A8RA 4PWWA 1TL7B 3UDVA 3HHNB 4NCAA 4JV0A 3G96A 3EPGA 1HNIA 3MPUB 1TQLA 2RVJA 5K5MA 1F2HA 4WIQA 4IFYA 3RR7A 2RRNA 2ZKTA 1Q7LB 1Q78A 2ZUAA 3SIPB 2JX2A 2M70A 4H4KA 1EKRA 1PCAA 3V4IB 2HQCA 1N5TA 2DNHA 3MR7A 1BC6A 4IO1A 4IR1A 3VZHA 4F4WA 1NNDA 4QWDA 3BEGB 3GMGA 2Z8QA 4F0MA 2LCWA 3MM7A 2OSRA 3MMAB 2VG5A 2CQHA 4O3NA 5LJ5Y 2DGXA 3EX7B 3NXZA 1S57A 2J8SA 4XAKA 2RU3A 5JUMA 1RQ0A 2HHUA 3CD7A 3NRBA 1SQEA 3L4BC 2AMCB 2Y0BB 4B17A 2R42A 4TQSA 2JDJA 2MZ1A 4WTOB 3PJWA 1TELA 2VFVA 3HVTA 2BOAA 1WTBA 1F3VA 2B8PA 2UXDJ 1IKXB 4AFFA 2ZKUA 1Y5IB 2MHNA 2DNKA 4AL5A 1TTHB 3Q23A 4LF9F 5A8RB 2YTCA 4IH5A 2HMIA 2QIFA 1JLFB 2XWXA 3MEGA 4EFAC 1AUSL 2C3MA 4C3KA 1HNIB 3BGUA 4WFXA 4HHJA 1T9YA 2VHGA 4IFYB 4C8YA 3JAMU 2M8HA 3CCTA 2DIUA 2V67A 2R9LA 3WZ0A 1DQ8A 5IC4B 3EYZA 5T7LB 4FF2A 3TVKA 2VPWB 3HFZB 1RHRB 5ETTA 4O4GA 1SV5B 2V8PA 4DV5F 1KBRA 1TKXB 4HDGA 4ZVQB 4OZ3A 2BANA 3OVAA 5EWEA 3MM7B 1WNEA 2VG5B 1FDBA 1M1GA 4J90A 3PRVA 1WI8A 2ZOGA 3S01A 4G6VB 3F0NA 2AD9A 4CCHA 3C14A 3PX4A 2ZD1B 1FFGB 3VAIA 3EICA 3FGVA 1Y5NB 1AT1B 4Q44A 2HIYA 3ZTRA 2ROGA 2ZJQQ 5EWFA 3AJ1A 4EWTA 5J1PA 4PYDA 2KM8C 3QPIA 4USVA 3HVTB 2GQ2A 1OPZA 5CCLA 1S10A 2PDAA 3JSMB 2QLWA 3RBEA 1HMVA 4KQZA 2AEJA 4U67Q 2VONA 2LLZA 1N5QA 3MM8A 3Q8UA 2YKAA 4WYLA 3M2RB 5IFMA 4OI2A 1VGYA 4ZITA 1BGXT 1TAQA 2HMIB 4HI1A 4DR2F 2YQ3A 3AT1B 2V4RA 3SCLE 3FBEA 3JTPA 4F36A 1P8GA 1U2FA 1KOHA 5FIIA 3KUGA 1I6JA 4W92B 5GAHU 1YZ7A 1HYSB 1Y0HA 2OPPA 1VHFA 5CA5A 1Q82T 2PI4A 4YB6A 2QTWA 1Q8BA 2CG4A 2XLIA 2EWHA 4CLSA 1QY7A 1PO6A 4O4GB 3WIUA 3DOKA 1HKAA 4URQU 3CJTA 1I3OB 5KFOA 3NNCA 3AQPA 4AL6A 2BANB 2M8DB 4IFVA 3MMJA 3PTWA 1HA1A 4DV5J 3OSPA 2BJ8A 2VODA 4ED3A 2HNZA 4G1IA 1NZ8A 4L3KA 3UN5A 1YHQS 2DR9A 3LO3A 2QSWA 4GO5X 3AFGA 2WSCC 2C2OB 3IC1A 2JL9A 4WPAA 1RT1A 2QA2A 1SI9A 1RZMA 1X0FA 2QLFB 3DMJA 4UUWA 2FJDB 2M5YA 4ZMMA 4DV4F 2X7IA 2RT3A 3QWUA 5GVQA 5LJ3Y 1W7WA 1SVDA 3KYLA 4NLVA 2B5JA 2HRUA 1YJ7A 3TVYA 1B3TA 1NK8A 4DCJB 2NXNA 1LNQA 3AA8A 2HFVA 2P9CA 4OYIA 2RS2A 1HMVB 1O8BA 4OX6A 4NLGA 5F8GA 2HS3A 3MM8B 1HBUA 5HVHA 4WYWA 2ALZA 2V4JA 2U1AA 2V63A 5FDLA 3ZO7A 1UA0A 4FYVB 2OI2A 3KHHA 4MKVA 2VU5A 1TL3A 4KGKA 4DR2J 4ICLA 1GH8A 3I5BA 1K0TA 3BR8A 2CQIA 2HWHA 3D2WA 1KTQA 1VRUB 1TL1A 3LAMA 3R9LA 1VQLS 2DNNA 4FYYB 2XEXA 1NSPA 1NDPA 3G82B 3DXSX 4O4RA 3DOKB 2XWYA 2YKNA 3OXGA 3VTIA 5IWAF 3T5LA 4IFVB 4XTTA 1X5OA 3U02A 2QO3A 2QYGA 3W9HA 1S1UA 1KFDA 2AHOB 2HNZB 4OV1A 2CQ2A 2BQ3A 3NCPA 4LREA 1NSQA 3B6BA 3QT7A 4LRAA 3H4BA 3HSJA 3K8WA 2IMOA 1SJQA 3F44A 2VOOA 2VG6A 4ATNA 4J9NA 2E7XA 5IOLA 3HT3A 1HHTP 2NPIA 2CQGA 3UPFA 4DV4J 3HJVA 2AU0A 4MTPA 3MMBA 1S4FA 2EG2A 3G86A 4JI5J 4C0BA 4PCQA 4P75A 1XMQJ 4JYAJ 4RNFA 1NK7A 4YOEA 1APSA 1JNRB 3CEDA 4RUHA 1SJ3P 5KTQA 3QO9B 3ADAC 4MYTA 2IJRA 1TL3B 2HQIA 3FQKA 5F9LA 4DCPB 3TOQA 3H2LA 3IG1B 5FJ4A 2YQ0A 4H4OA 4TYBA 3FCWA 3OSNA 3HSZA 1S76D 2HRYA 2MLYA 1B7YB 1CJUB 1RA6A 2OEMA 1WOSA 2ATCB 2ZOMA 1XMOF 3MOJB 1RHQB 2HGMA 2WONA 2GJFA 2Z56B 3KFWX 5J1EA 2KRRA 3ZFVA 1URRA 3VGSA 2GV1A 1FKPB 1HR0F 3U1LA 3V5RA 1S12A 4GVBA 1SCJB 2D9PA 3UN2A 4EBCA 3H5SA 4C8MA 3W9IA 1U1RA 4K4YA 4K2XA 1KRPA 1RYRA 4IOBA 1AXQA 3MZIA 1XQIA 4JUZA 3FZBA 2KZZA 3DGVA 5HVGA 1V3RA 1PBAA 1N33F 1S79A 1QTNB 4DSFA 2YH0A 3BSAA 2JLGA 3EUNA 3MAAA 2DRAA 3NGDA 1ZETA 5G0RB 1WF2A 4UUXA 2ALYB 5FLXU 2H5JB 2WW4A 2R8IA 4ZIWA 3HLUA 4H4KC 3QRRA 2VBYA 3GV5B 3NAIA 3PW4A 4M5IA 1RE1B 3SV3A 2KT2A 6AT1B 3VZIA 2DHSA 3SQGA 2YBVA 3FDSA 5KFYA 1HPZA 3DM2B 3C16B 2CRLA 4OHWA 4H4OB 2R7TA 1RA7A 5C42A 4P73A 2F4FA 3R27A 3T6JA 4U95A 5KFJA 4WFAQ 4M8LA 2HVDA 3MUTP 3BR9A 3I31A 2ZH6A 4K0KF 3MM6A 5CD4H 4NLSA 3HVRA 1XC9A 2WONB 3CCSS 1I1GA 2DEIA 1FRMA 5J1EB 5KT6A 4I2PA 3ENAA 4RWXA 4O0IA 1XMOJ 5IV4A 3CB4A 1VQSA 2DH9A 4P72A 3U1NA 5H9FK 1A0OB 3PEJA 3R5JB 3IM9A 6FD1A 3KJVA 1RAAB 4M1KA 2XULA 1VIXA 1P27B 1V5VA 4ETZA 3VVUA 1S5ZA 4Q43A 4CO2A 2FDNA 2XM3A 3LWLA 5H9EK 3M7VA 3PCOB 4DQIA 3KLIA 3AXKA 1ZZFA 1RT3A 2PE8A 3SMZA 2ASDA 4IG3A 1T94A 1MWYA 1NRKA 2I9SA 2FVCA 3MAAB 3RRKA 4PABA 5BR8J 1NPRA 1CQNA 1QAJA 4ZVSB 1N33J 4OHYA 3A8KA 1S99A 1H0HB 2C3PA 3HF5A 2M3DA 2F4VJ 3N6LA 2MKKA 2HGLA 3PHEA 1TFWA 3C66A 2RKIA 4NL5A 1GX6A 1XNQF 4JI3J 4DPOA 1SKWA 3SQGB 2AJ1A 5BYSA 3VQSA 1R8HA 3VF0B 1RU2A 2I0XA 3RAQA 3F56A 4M5KA 3CXCR 2R8GA 2RNEA 3PKYA 5C42B 2GJIA 3QNWB 3IXQA 4B3OB 4B3RF 2YKMB 1FWPA 5CABA 1QE1A 1XR6A 2NXCA 2Q6CA 1RHKB 3FZ2A 3NCRA 1I51B 5CYJA 1YJTA 2A1BA 2W2PP 5KFXA 2ZVSA 2LDIA 4MT1A 2HVHA 3IO1A 1Y00A 2G1DA 2AX0A 5E33A 1NDKA 4KGXB 4A8YA 4L73A 5DQGA 3KJVB 3NWRA 4DSLA 5KG6A 1GFWB 1TKZB 1VQOS 4DX6A 4BLGA 2JEIA 2CJQA 2G2YA 2D3O1 3D66A 2KFYA 2W2NP 2QL7B 5EX0A 3W9JA 4QIFA 4DPUA 1WD6A 3KLIB 1E6YB 1RT3B 3PYGA 3LP2A 1JQGA 1UWAA 3QLHA 2AJFE 3CJSA 4OHXA 1R43A 1D8YA 1NXIA 1LEOA 4DR1F 4L75A 4B3TF 5HSPA 1NDCA 4USKA 4RW8B 3TQ1A 1S0NA 2C3UA 2OP5A 2YNIA 2RKIB 4NPOA 3MM5B 1Y3JA 2XMKA 2DHGA 5M2UA 2NLWA 2DH8A 1WC0A 1CEZA 4CT8A 2W9BA 4LF2A 2HAIA 1MSWD 5J2PA 1XNQJ 1H73A 4ED5A 4OJGA 2BMBA 2LU2A 4LR7A 5A8WB 2G0JA 1YIJS 1YDLA 1F2GA 4DSKA 1BQMB 2KFNA 2XYGB 5BJRA 3D0GE 1XTZA 3ZTOA 1RWMB 3O44A 2MTLA 4LSZB 2QMWA 4PG7A 3D6MB 1F60B 1DHMA 3D4JA 4B3RJ 5LXYA 2ZWOA 2V34A 1IQZA 4D3GA 2G2OA 5T14A 2HFOA 3H40A 2YWGA 4DG1A 2FHJA 2XSJB 3A8IA 1VJWA 3VGTA 4NYOA 5CD4A 2E5GA 4USJC 4KAIA 3DOMA 2OH2A 1T03B 1RT5B 2JLFA 4FDFA 1YJWS 1JXLA 2F1FA 5IM0A 1YKWA 1T95A 3LP2B 3FNNA 1N36F 2RE1A 4N77A 3E8OA 3MMCB 3Q8YA 2CQ4A 4MAKA 4IOCQ 3G6VA 3DDKA 1DLOA 2QL5B 4X62F 4MK7A 3QRQA 1X31C 3OV7A 2AGPA 1FJEB 5KG0A 4B3TJ 1UPMB 3N79A 4I6YA 3MCMA 4ZLNA 5L1IA 3Q22A 4IUFA 4LUBA 2W9BB 1Q79A 2CQ1A 1N52B 2QL9B 3OL7A 1WHXA 2B7BB 4K2JA 4DMZA 3ICLA 3WX4A 1YLXA 1D9DA 3KWMA 5SZTA 2AEFA 1HWUA 4P52A 4YUDA 5GMKa 2Y1RI 4DUZF 1UVKA 3V6HA 2BJ3A 1JLEA 1SL0A 3NLCA 2MGZA 3ILLA 4CO3A 5HJXA 3DLEA 5HBMA 1KR4A 1U1PA 2MKSA 2FVQA 3FBCA 4B9VA 1RI7A 4DG1B 5AXNA 2JC1A 3NS5A 1B4SA 1PSDA 4LR8A 4OZNA 5DJBA 2C2NA 2KT5A 3DLGA 4X64F 2VG7A 2RS8A 2GQCA 3M6VA 2RJZA 1T9XA 2UZAA 3SFUA 2JFKA 1EETA 2IVFB 5IM0B 5KFPA 3ENWA 4HH0A 4LR9A 2DPIA 5F3TA 2HHWA 3FRZA 4J9MA 1N36J 3I0SA 1DLOB 3QIPA 3QSYB 4ECQA 4NA1A 2Z58B 1C1CA 3TARA 3H8YA 3L3CA 2XLJA 3QT6A 3OBIA 3K58A 2L3MA 4X62J 5A0YB 4OJ1A 4O3PA 1DTQB 3FC9A 2FY8A 2IAJB 3CE8A 4DF8A 3THVA 2HSEB 4WXOA 2BJ1A 1N54B 3MXHP 3N9UC 2WZ1A 1U48A 2R7VA 2CDRB 2ZWPA 5E2QA 1M0SA 4DV7F 3QFWA 3CJKB 4LVNP 1Q4RA 1HI0P 4HVZA 3RB4A 2HHXA 2RQMA 4M5DB 1HBOB 2XMTA 3ET6A 4J9LA 1N32F 1JLEB 2OMLA 4NLTA 4ED1A 1R8BA 4DUZJ 2EG1A 3DLEB 4ED7A 4TLRA 2R8KA 4NWBA 1UWBA 4C48A 2DYAA 5KFAA 3OPKA 4ES2A 1HHSA 3AHPA 2GQQA 4UT4A 3DC2A 3TAPA 3NNAA 3GYNA 4BCAA 3AY0A 2ABYA 4I1TA 1RAHB 2UV8A 3DLGB 4ZP9A 3ZZYA 2GX8A 4FVCA 4F4AA 3NNHA 2E29A 1NPKA 5DDPC 3RG6A 3UVJB 4X64J 3K5PA 2F8EX 4CWBA 4AQYF 2ZH8A 2KRBA 4PEOA 3TEHB 3PVXA 5D0RA 1UVJA 3H20A 3G8TA 1FDNA 3ZZRA 4CH0S 2APOA 3I0SB 1NDLA 3QIPB 3KHRA 5JMNA 4RPFA 1U0HA 3K59A 2NPFA 1WHYA 5M2PA 1X4FA 4ILMA 3ZZ0A 3BQ0A 4RJVA 4ZCIA 4DLEA 1DTTA 4CNZA 3J7AN 2HK2A 3J7ZT 2FTRA 2XZTB 3F73A 4C0HA 5A6WA 2KJVA 1T02A 3D1QA 1MROA 1C0UA 1R0BG 3BDPA 3DHXA 4YR2A 2V68A 4OQJA 1OQ6A 4RZRA 1EARA 4IG0B 1DQAA 3A12A 4QR1A 4WP9A 3P4UB 4NLWA 1FJGF 4DV7J 2DTJA 3ET6B 2B56A 1BY9A 2C42A 1KNZA 1SH2A 4N5SA 1WKKA 4FP9A 5LXRA 3HO1A 1OYEA 1FNMA 2R2RA 1QJHA 1N32J 2GS8A 1Q8KA 2CZ9A 2ILZA 3BN7A 3T1YF 4OI6A 4ES1A 3W3SA 3HKWA 4BWMA 1VHIA 3R6LB 1OWXA 1Y4ZB 5M2RA 1XR7A 5HLFB 3M8YA 2BW2A 4F02A 1BXNA 1C1BA 1RT7A 5B09A 3NMAA 1L3TA 3MUMP 1R27B 3AD9C 2J9CA 4PXCA 2PO4A 4AQYJ 2W8LA 1U0HB 1EJ7L 5DG7A 1S59A 2DR7A 4LT6A 2DO0A 3CUNA 2EFNA 3GIMA 2DJWA 3NWGA 4DV0F 1DTTB 1CC8A 1NKCA 1G7CB 2D69A 1FJCA 4G3IA 1B64A 5L1KA 4PXBA 1MNEA 4Q0BB 1MROB 4WCEQ 4WZMA 2FQQB 3U7JA 3LH2S 1ULRA 1X4HA 4LF1A 4J37A 2A18A 2E9TA 2DKOB 2KYZA 5KFZA 7FDRA 3H4DA 3A8JA 1D09B 1YI2S 3N6MA 1IQTA 5DZ7A 2WSFC 3M2VB 3NY0A 4PG5A 2O67A 1FO1A 1N56A 2JRSA 1IBCB 4USWA 2ZE2A 1FJGJ 5D6GA 5I42A 1J2VA 1GQEA 4I0WA 5D4LA 1FVSA 1NK9A 2LXIA 4TLQA 3T1YJ 4ZCLA 4QZVB 3OR1A 2IM2A 2VPZB 4PWUA 2AX1A 1RT7B 2Y1JA 2FYXA 2OPRB 2FVSA 4LQ3A 2BA9A 4IDKB 4WBFA 4UY85 1OY6A 2BBEA 4ECWA 1Q8LA 1MN9A 3TX8A 3KNGA 3D3CJ 4U9RA 4QIEA 4PG6A 4OI3A 3I55S 2ZH9A 3NGTA 2AQ4A 4DV0J 1L5UA 3GWCA 1WF1A 3H59A 4KIAA 1WOPA 5KFMA 2UUBF 2K06A 4ZPVR 2QG9B 3MCSA 2FZKB 5K8MA 1YX2A 1BWVA 1VJQA 2JH3A 3KMQA 3CDEA 3HDSA 2V2KA 3HI9A 4L74A 1XJWB 3V2UC 3H90A 3MI7X 3HMJG 3BGRB 2BR0A 1H2UX 2KHCA 5I42B 1WC5A 4PPDA 1R6VA 3CCWA 4WK1A 3RJMB 4MIWA 3I32A 3JYTA 2D7SA 3DRRA 3CWJA 4DV2F 1VRQC 1S1WA 4QQBA 2YWHA 5MLCV 3V81A 5IZHA 2WTFA 3N5FA 2MKJA 1X4CA 1N0VC 4DL7A 4RNMA 4B08A 4BHQA 2NYHA 1HNZF 3BQ2A 2N4CA 5KFEA 1Y11A 3CO9A 4DR3F 5B08A 2ZH4A 3W8PA 1Q95G 4FYWB 2V8GA 4CI0B 1RT2A 2OEJA 2D3OR 2GA7A 5AT1B 4Q5VA 2DGTA 2UXBF 4LSLA 4K50A 1T9UA 3T5JA 5DM7Q 4DV6F 4DWIA 2YKQA 2MKHA 3BKTA 1TMMA 2BJ9A 3PO5A 4NI2A 3FSXA 1BMQB 5KT7A 1HBMA 3HHLA 2ERRA 3VAFA 1I94J 2UUBJ 5EDWA 1VBKA 4NLQA 4ZJOA 3RGIA 5CYQA 2Y3YA 4O0NA 2XMWA 1VBXA 5ITHA 3RB6A 1H7WA 2W9CB 2KT3A 4X4TA 4WJBA 1Y5LB 3CCRS 3JYTB 4YDDB 4XO0A 1PILA 1WF0A 4P71A 1YJNS 4X4RA 2V69A 4FXWA 4ZHRA 1FDAA 1HQUA 3QATA 3GIIA 3J80U 3AD8C 2R2SA 3GJSB 3ISZA 3L09A 3V81B 4YN3B 3M9MB 4ZPBA 2OAUA 1M5PC 1YGYA 1L3SA 4P2FA 1NSAA 3I87A 3A4TA 1P6TA 5AXMA 2HHTA 5J2MA 3DU6A 5B0AA 1SC3B 3D6HB 1HI8A 3GILA 3LAKA 2X51A 3RU0A 1SH3A 3CJQA 1HQ2A 2WK4A 2KFZA 2V2ZA 3GPAA 2J9DE 1HNZJ 4B02A 2PEBA 3DRPB 2ZM6F 1FX2A 2BQRA 1S0OA 3GZ7A 2EFOA 5KFUA 3BBCA 2VQEF 2VASA 3G87A 3D6TB 5BYQA 2AJ2A 3W7BA 3PDNA 2CJBA 5EUHA 1WEXA 8AT1B 2UXBJ 2XI3A 4IH6A 2J7KA 3T41A 2MEWA 4NI2B 3QFHA 1PYTA 3N6NA 4ED6A 3HHLB 1WI6A 1OJ4A 2DR6A 3DLJA 3HZGA 1S1XB 4FZVA 4C0OC 2NSCA 1IKWB 2VC1A 2HYIB 4F8RA 3K5NA 1DBDA 3BZQA 2J7WA 1O51A 1R89A 4O3RA 4N8OA 1VK3A 3D1HA 4OJ3A 3IAM9 4ZP8A 5KFGA 2K8GA 2IM0A 1MW7A 1O5JA 2YNHA 3W1YC 3W60A 2FHJD 1RHJB 3C15B 4HL9A 1FKAF 4ZHRB 1P1TA 1HQUB 4WU2A 1FF2A 4ELVA 3IM8A 1H3DA 2QFIA 5E3CA 5KFCA 5I3PA 1VLYA 4HYKA 4FXDA 3CDUA 3SSQA 4LSNA 2QGFB 5IQ6A 1IBMF 1TL5A 3AD7C 1N4LA 2UUCF 2WB1D 1LWXA 3W2WB 3Q89A 4IQMA 4EMDA 3OTOF 2ZH7A 3W5XA 2HWIA 3EPIA 3MTKA 3EDQB 2L9NA 2MQPA 2ZM6J 1WKLA 3BKUA 3OT9A 5K8PA 4RLEA 1K8AT 4WFZA 2B7CB 3H5XA 3NAHA 3CDBA 2VQEJ 2XSFA 1IVZA 1LOUA 2UV8G 3E51A 1R3NA 2F3JA 3UW1A 2XYHB 2PC6A 1GT8A 1NHVA 2DCLA 1WDTA 2KN4A 1KWMA 5K8OA 3PRDA 1KLMA 2IBOA 4RU9A 4CTAA 3R2DJ 4K4XA 2JC0A 4M5HA 4J9PA 2QRRA 3H5UA 1LK5A 3GIKA 1WORA 1CVJA 1KVKA 8RUCA 5DG9A 1T05A 1NK0A 5I3UA 4OX7A 1YJ9S 1M5KC 1WUUA 5IT0A 1FDDA 4C11A 3KXDA 3FBFA 1FXDA 1YJVA 5K8NA 2CPZA 2HVEA 4KGZB 3BF4A 1RCOB 1RWOB 1REGX 3M1VA 2BKOA 5B0DA 1QAIA 1TKDA 3CF5Q 4F04B 4PKDB 2V2QA 4C98A 4R0EA 4GMKA 3EE3A 4QOTA 3EGZA 1ZPWX 3LPYA 2YH1A 2JWNA 1U26A 1QAXA 4OI1A 3AH6A 3E01B 1D0EA 2QLXA 4DQSA 1S4EA 2DNRA 4EYIB 3L7OA 4LSNB 2XHCA 4XIUA 2DHXA 3KK3A 1N6QA 2ZVIA 2O3DA 3A3PB 3DCAA 2X3DA 3JTOA 2R7XA 1F9FA 4P6QA 3N01A 4UY8T 1NJIT 4JI2F 2AGOA 2UUCJ 2HBQB 1RHMB 1EIYB 4KHMA 2YWEA 2N4DA 2RHSB 1V6HA 2XY5A 3V6DB 1HW8A 3OTOJ 2ZH1A 2BXJA 1X4GA 4MH8A 1FKOA 5LSOA 2OFGX 1PIEA 2C3YA 2N82B 4NXNJ 2MKYA 3K0JA 1IBKF 4DL6A 1KLMB 2MQ8A 4USMA 3GJRB 4DR7F 4IO9Q 2BE7D 1ZA2B 1S6PA 4ID5A 2W7OA 2EW9A 9RUBA 3OVSA 1SJ1A 1T05B 3MR6A 3SSSA 1CJKA 4TY8A 4G1PA 3CULA 2FHMA 4C11B 3CCUS 1G3OA 5IT9Y 4DR5F 3B4MA 1S1TA 3TVZA 2MY8A 4FPIA 2I6WA 2EC0A 2N7YA 4ILLA 3M8PA 3CJ0A 2X1BA 2CQDA 3IS9A 3NCQA 1RUSA 1CQMA 4MFBA 2MQMA 3GFXA 3MECA 2KYXA 5KFHA 3M8WA 3GONA 1F5AA 1N6QB 3R5CA 4U8YA 3Q2SC 5D4PA 3BO4A 1X9SA 1U1NA 4G1QA 1H72C 4YB7A 2R7OA 1WC3A 4DQPA 4Z37A 1SIWB 4F4KA 2E44A 4JI2J 1HNVA 3QGPA 1RKIA 4OYPA 4F0KA 2ZDPA 1HWKA 4QYRA 2AYMA 4ZA1A 2BJ7A 2BVZA 3FVYA 2CZ4A 1Y9OA 3HZEA 4MK8A 3MHYA 1ZZNA 1UTAA 4DHVA 5A8KA 3AB2B 3KLFB 1WWHA 2C22A 1B0PA 4TXSA 1Z2LA 1NU4A 1FESA 4HACA 3R3TA 2D74B 1IBKJ 4B3MF 3EM1A 1B0TA 1FRXA 4ID5B 2KKHA 4LRBA 2VPXB 4DR7J 4PWDA 3SXLA 3TUJC 3D28A 3OLBA 2QLJB 3NEKA 1JK9B 1CJKB 2L9DA 4IKAA 1NJYA 4TY8B 2FJXA 1RYSA 3PX6A 1D9FA 3JSRA 4EUVA 4JP8A 1M5OC 1YWXA 4H4MA 2GC8A 4DUYF 2XNQA 3TR5A 2KI2A 3ZTPA 4OFZA 3OJSA 1SQGA 4DR5J 2NS1B 1D8ZA 4L72B 3IS9B 4A8OA 4JV1A 2Q66A 2EC2A 5HAOA 3DOLA 3RBXA 2CPXA 4ED8A 3DKDA 1KONA 2KM8B 1M5SA 2CJAA 2MKCA 2DNGA 4AUKA 4P9SA 3M2UA 1CJVA 4YMEA 4KGVB 4ID8A 1EX8A 1RAEB 4FBUA 4EEYA 2FVPA 3GIJA 2ZITA 4QIVA 4RW4A 5ETRA 4G1QB 2Y8YA 2P9EA 1HWJA 4OZ0A 4PQAA 3HHLC 3J81U 2PA3A 3FFIA 3VHQA 3MAHA 3M8SA 4B9MA 1S48A 1YK9A 3AXMA 2DIVA 4JV5F 3FJ2A 2P2CB 4OJHA 5HROB 4UQGA 1JLCA 4K5RA 4DPTA 2W7PA 4Q7AA 2HNDA 4Q2LA 3OJUA 1QVFR 5A8KB 4NCGA 3CTRA 1ZS6A 4L6V3 4HACB 3RB3A 4A8WA 1VMBA 1X7VA 1VQ5S 2HQGA 3QJPA 1SJRA 4PWDB 1U47A 4B3MJ 2XNRA 1UW9A 1R0AA 4WF9Q 5F9NA 3BSNA 1SUQB 4F3QA 1MU2A 3KHLA 4EBDA 3TANA 2W2OP 1GTHA 3CT9A 3MAQA 4GC7A 3G8SA 3H98A 1FFWB 1A7GE 1IBLJ 2VJUA 1FCAA 2CJ9A 1FERA 2YXLA 2WW8A 2XGQA 4DUYJ 2V4QA 1WKJA 4QWEA 3IRWP 1RAFB 4UOGA 1CULA 2HAFA 1GXLA 4LJMA 1WOOA 2EFPA 3P5TL 4RNHA 1CJVB 2Y0SD 5DGAA 4KC5A 1PAUB 4CYUA 1UZHA 3RAXA 2Q3PA 2VA2A 2RDDA 1JJ4A 1UVNA 3DLHA 1FT8A 4LMZA 1V3SA 4I56A 5CQGA 2ZNZA 3PYEA 4KHPF 4ZN3A 3ZXWA 3CCZA 1HNXF 1X8DA 3DYAA 4Y65A 2V94A 2V6AA 4W90B 3QZ8A 1VR6A 4K7QA 4JI6F 2PFFB 1D9AA 1JLCB 4QYZK 4JV5J 1UFLA 3THPA 3I56S 3JAMY 1NK5A 4F2RA 4WIIA 1KP6A 3ENQA 1LW2A 3QGIA 3MGJA 5DS7A 3KLGB 3P8BB 3JQJA 4I4BA 1JJHA 4ED0A 3PW7A 4X4VA 1IXKA 3OQ2A 2LA6A 4P74A 1CSJA 3UR0A 5ETNA 1FTCA 2ACYA 2MQLA 1MU2B 3UCZP 1LWEA 1SJFA 2J0QD 5KFWA 3ZTSA 4LVOP 2A3JA 1S1VA 1RKJA 2CXEA 3CMQA 4DZDA 2W2QP 1JJCB 2VF3A 2AT1B 3AOCA 4KT0C 2ILYA 4DU8A 2UUTA 1PJ7A 2YWKA 4G65A 2HK3A 3RW7A 4DFKA 1CULB 4XPEA 2GMLA 5HP1B 3EXCX 4DEZA 1Q53A 3W65A 1C2PA 4RUBA 1U0SA 2H54B 2VBZA 4TY9A 4ZLPA 2ADCA 1YZ6A 5KT2A 1FK9A 2X1FA 2HBYB 1RLDA 3ILIA 3OVBA 1RWVB 2OPQA 2GVDA 1JLGA 1UFKA 3EGNA 4R5PB 4GKJF 1UW4A 1EQMA 3DI6B 4KHPJ 3QJJA 4RNOA 3I0RA 3PKMA 1PG5B 5J2NB 2RF2A 5KOWA 4JI6J 3MR5A 2QZ8A 5DGBA 4XDCA 3R1HA 1EKSA 1GX5A 2Q43A 2GGPB 1SKSA 1ZM9A 1BWEA 3BB5A 2AGQA 2KHDA 3HHLD 2IC3A 5IS2A 2A6OA 2Q79A 2EEYA 2P5VA 4HR2A 3O1LA 2CJXB 1ROFA 1JLBA 4NLDA 2QFJA 1QLNA 3EVMA 4BBYA 1S6QA 5K14A 1S1VB 4HI2A 1RWNB 2NUUG 2JEFA 1DRZA 1VQ6S 1U1QA 2GVZA 4EZ9A 1KOOA 2C2ZB 4OL8A 3U1MA 3V4MA 4MKAA 1VC0A 3PZPA 4ZVFA 3UD5A 2UVRA 2ZH2A 1ZM2A 2DISA 2G1HA 3BN4A 1FHTA 1SL1A 2C28A 1DARA 3T1AA 3QGHA 4WFNQ 3X3UA 2GFFA 4TU7A 2UP1A 1FK9B 4FYDA 4AXIA 3M6WA 4RW7A 3MR2A 4F25A 3E3XA 1RJJA 3MEEA 2AYEA 4A8MP 2V8DA 1K44A 2HHPA 1FNXH 4GKJJ 3VVTA 3I0RB 3CJRA 2RF2B 1YJUA 1B99A 2B6AA 4F4YA 3D0IE 3G4SS 2AWZA 2KG0A 4J9KA 3QAEA 3BREA 1LXJA 2B4PA 4NLXA 2IC3B 2FZGB 1TP7A 1RB0A 4CZCA 1VQPS 1PAEX 3IFEA 2HQDA 3TUPA 1JLBB 2BOPA 5D8HB 1P9YA 3SCIE 1S6QB 2ZZNA 3POTA 2ACMA 3BM7A 1K47A 3ZZUA 3N0VA 2L9WA 3DLLQ 2BUNA 2DBBA 1X5TA 4PXDA 2LQJA 5HK4A 2P8IA 4ZP6A 1ZTWA 2IDEA 4B3SF 1KN6A 3MPVA 4CLUA 3MEGB 2A6MA 3IN5A 2CQ0A 2W1BA 1NH7A 3SBMA 4LF9J 1JJ2R 2CQBA 3A8EA 2IRXA 4WE1A 1XBWA 3LA0A 5E5NA 3SFGA 1VK8A 2LMIA 5F3ZA 5DG8A 2F65A 4RW7B 4UW2A 5EWGA 3DRSA 1RISA 3I6PA 2DY1A 3ZC4A 3TZZA 3D1OA 2MJNA 2DGVA 4DS5A 4CP5A 3DU5A 5GADU 1WC1A 3GFHA 2B6AB 3GV8B 2YNGA 3KDOA 3I5AA 4JB8B 3UCGA 2POKA 5K9FA 3C14B 2EFQA 2AZ3A 2FZCB 4K4SA 5ETSA 2PMZD 3PW0A 4ZLLA 1LXNA 1DQ9A 4TN2A 4L76A 1CPZA 1JKHA 1Y3KA 4TKTA 1LW0A 1IJFB 4P7VA 3W2VA 2KXNB 3QT8A 1AW0A 4C2MA 3POTB 3PNIA 2A0FB 2CWXA 4ECRA 1UEVA 2BW7A 2CA9A 2BQUA 2R7WA 2J9EA 2JVRA 3JQMA 3Q8SB 5U47A 3K5OA 3AJ2A 2VBWA 4B3SJ 2FC9A 3EMTA 4DLGA 5KFRA 3WBZA 3OUYA 3V6JA 2M2BA 1HD1A 1UPPA 1OY9A 2OPPB 2EBEA 2KU7A 4QIGA 5CZVA 5J1NA 5D0EA 3SCJE 2OPSA 3DRSB 5KFBA 2MYFA 3US5A 5L9XA 1SJ4P 2CDQA 4X4QA 2B9EA 4GO7X 3Q8VA 4KKOA 3AOAA 2X1AA 4ZP7A 1N34F 3AA9A 3R7SB 2WHOA 1BHNA 3A3NB 2QA4G 1U2RA 3G6ES 1QM9A 4C8ZA 1RWWB 3HFVA 1S9GA 1ZM3A 4LFAF 3NGRA 1RT1B 3QYYA 3SEOA 5HMZA 4Q8EA 4KH0B 2AJ0A 2VDIA 3QQCD 3DMJB 2DNZA 3UFCX 3ETOA 2Y1LB 2KO1A 2JZ5A 4HTJA 3GU0A 3M32A 2B51A 4U7UK 3F41A 2BJEA 4URSA 1JKHB 4I6AA 2ROEA 2B5JB 2BE9B 5DRKA 2P6SA 2OTLS 4A8KA 4ZPWR 4OX8A 2J6UA 1SPBP 1KHVA 1SKUB 2VIHA 1WG1A 3LWMA 3IBFB 2MZQA 2V9KA 1OMSA 1RTHA 1HBUB 4PZVA 1BUXA 1QSYA 4ZPAA 2V4JB 2IA0A 5A2QU 4C7QA 2K3IA 4OZ5A 4XPCA 2AEMA 2F40A 4USHA 5FDLB 2K7JA 2VD3A 1PC5A 1UFWA 4HT5A 2YQ1A 2HQ3A 4ICLB 2L41A 3OUYB 3CPWR 4N47A 2C2KB 3THTA 1T9WA 3ZNUA 1TL1B 3FBBA 2AYGA 3ILOA 4ECYA 2OD6A 4PRFA 5E3RA 1SKRA 3IRXA 2J76E 1E6VA 3LGMA 3HVAA 3OL6A 4KKOB 4YEAA 2YKNB 4Y3CA 2FJWA 3EJMA 5HJYA 2E5JA 4RO0A 2DB1A 2DRBA 5DQIA 4LBPA 5E7OB 1S1UB 4CLTA 2VJVA 3KG4A 2XLKA 1N34J 5IWAJ 3M8ZA 2PD1A 3G8QA 2ADBA 2FLNA 1U24A 1XWLA 2VG6B 5KT3A 2HS0A 2NYIA 3SSRA 2CKWA 4LFAJ 4JOUA 3FSIA 1IUJA 2D3UA 4EYHB 2LEAA 1S97A 2ZBCA 2J0SD 2IJFA 1K1QA 1U8WA 2BDPA 4AL7A 5ETLA 5J2QA 4KPYA 3MMBB 2HWTA 1X9WA 3UD3P 2HHQA 1W25A 3K7RA 2VPYB 2XZWA 3MM9A 2ZBRA 4NRUA 2DNMA 1EHWA 5HMYA 5MAOA 4FKXA 3BJYA 4DV3F 2GJ2A 2V5HG 1GMUA 1UEUA 4GRSA 4B9SA 1TKTA 4NZ7A 3R7BB 3D68A 1UJ6A 2VFUA 1A6LA 2I8EA 2ZC3A 1YRTA 1Z4UA 4NZ0A 3QWPA 3CCLS 3IWNC 1Q5YA 1S6UA 2BABA 3LTOA 3NP5A 4U6PA 1JX4A 1Z2ZA 3HHDA 1L3KA 1JMTA 3FCVA 4YFUA 3BPDA 2FUG9 5GADI 4O3QA 4USIA 1NK6A 3W5YA 1RDRA 2UVWA 1AZSA 4GVBB 3M8QA 2WVFA 2XBPA 2E5LF 2R2TA 3CD0A 1HR0J 2BEFA 2AZ1A 3PIPQ 3AJDA 2FY1A 1ZPVA 1RBAA 3KKFA 3KLEA 3BQ1A 2F9DA 2IY5B 3R7NB 1VQ4S 3QJLA 5H9FJ 2D9OA 4DR6F 3B54A 1JLAA 2DNPA 1AROP 3UQSA 4RX6A 2W24A 2LVWA 1F1BB 3CGIA 2CJYB 5GMDA 4NCBA 1U8SA 5KFDA 1IN0A 2OLWA 1RSCA 2HNYA 3CIZA 3MM9B 4OYMA 1OPIA 4Z2XA 1WACA 3J7Z5 5H9EJ 4C4WA 1U09A 3PRBA 2CG8A 1TK8A 4M5LA 4IRDA 4UTGA 1R8AA 1S7IA 1FTRA 2ZDOA 7FD1A 4DV3J 5KT4A 3G9CA 2P6TA 5B0GA 3RAMA 1ZH5A 1S0VA 5DO2A 3PR5B 1PGZA 1HPZB 2IDLA 5IT9U 5B0EA 1F9EB 1GAOA 1RADB 3NKYA 2DNQA 1QUVA 4B9NA 1AUDA 3M30A 4CQ1A 3QSIA 3MM6B 4NLOA 4KHRA 3M6UA 3R8YA 4DDFA 4I2PB 3R2CJ 1DFDA 4P2SA 3CCJS 2IPOB 1IWGA 4UOHA 3OXFA 2QT7A 4K0KJ 1TUGB 3K17A 1WTFA 3IWLA 2DK2A 3CD5A 3RBDA 1QD1A 3M8QB 2GZOA 2GIQA 1BQNA 5E3QA 2I1RA 1R7IA 2W7AA 4K4VA 1R8PA 1KS2A 2W01A 4O3OA 2EBGA 4KBIA 2CPDA 3LQVA 4ZVTB 2E5LJ 2A2DA 2HLTA 2ZHOA 4FS1A 2VV5A 3QBCA 2DEJA 2B0GA 4I69A 3TQEA 4NYZA 2B43A 4OYXA 1WG4A 4IG3B 2IA6A 1XMBA 1VQMS 4DR6J 2HVZA 2V8VA 1BD6A 2HNYB 3UDCA 1M1HA 2XS2A 5E3AA 4LF7F 2R8JA 3NL0A 3HT0A 5CZXA 3EWGA 2E66A 3OR2A 1VS3A 3V4IA 1U1MA 2CJKA 4CDIA 5HN0A 3R5BA 5D77A 1F3FA 2XMUA 6FDRA 4JI8F 3LP0A 3PJ9A 2ZH3A 2KXHA 2YKOA 4A46A 1HARA 3I9V9 3MMAA 1ZBTA 2WVCA 3DFEA 1CJTA 2E9ZA 3L7PA 2CNLB 1WSRA 3EGWB 1FD2A 3M30B 5D4NA 1QE1B 4NEZA 3O8WA 2R7SA 3KLHA 2VFSA 1EP4A 2CIMA 1YBAA 1K73T 3IWXA 3MD3A 4I64A 2R8HA 2BACA 4MIAA 5GMEA 3T9ZA 4OYWA 4WFYA 1G4CA 3DN9A 1I5OB 3CSKA 3DXBA 1IKXA 1U25A 2E1MC 3CJ4A 1UA1A 3M9NB 2FC8A 1NLKL 1CC7A 1TVRA 4F50A 3QLHB 1JLFA 2DR5A 4OHVA 2RDIA 1T0TV 4CLWA 4QR2A 2V9WA 3X1LB 5EN1A 2ZBIA 4KGMA 2WVEA 3UI3A 1NAQA 2XY6A 2CQ3A 3K89A 3GQCA 3EVOA 1U6BA 2YNIB 2R7QA 4DR1J 2ZHAA 3MFIA 2XYPB 4LF7J 4Y0FA 1EB0A 3OR2B 5T7LA 4C3LA 2E1RA 2W9AA 1SV5A 3H25A 5J2PB 5CAAA 4OYOA 1TKXA 1YBTA 3LP0B 1VBZA 2O01C 5KG3A 2K7KA 1S77D 4ED2A 2JNJA 1OSCA 3FUYA 1CJTB 4DSJA 4JI8J 3BDEA 3I5CA 2OKQA 3QIDA 4ANEA 4A8QA 2ZOFA 3PACA 1NM2A 3O3LA 3KJQB 2M0GB 1NJZA 1LV5A 1GMVA 3KLHB 1PKUA 1DZ5A 2ZD1A 1EP4B 3KMSA 4DI6A 2MQQA 3AQOA 3QZ7A 1MMLA 2JOQA 2XMVA 1UVLA 1BE4A 4XDDA 3DOMB 3VQTA 1T11A 2Z2ZA 1NCLA 3H7HB 3JSMA 3TWZA 1QUPA 3OTDA 4FYXB 2YVSA 3FEYB 1P1LA 3TW0A 2R2UA 4DXLA 3PX0A 1KSPA 3M2RA 1G2EA 1TVRB 4JI7F 2MXYA 1GXTA 4KO0A 3TEGA 2XY7A 1W26A 2CNOB 1SXLA 4FF1A 3LGHA 4JBCA 2EXUA 4W98A 1KVIA 1RTZA 3HSDA 3FMWA 4UOCA 1HYSA 2RB7A 4Y2AA 4KV8A 3MF5A 4O23A 2D3ZA 3W5ZA 1AFIA 3PV8A 4ECVA 2LDYA 4PXEA 3UR3C 2KH9A 4KB7A 2VA3A 4I2QA 1F6TA 2KDOA 1C4AA 1HWIA 4M95A 2P9GA 3NOGA 2XC9A 3TZYA 4OZJA 3OFFA 1UL3A 1KLNA 4J9QA 1J5OA 1FEHA 3T9NA 3M9OB 2ZJRQ 3RUBL 2MGZB 3T5KA 4A4JA 5HBMB 4TQRA 4LFCF 1XR5A 1WHWA 4I67A 3LGNA 5KT5A 1VCTA 2GNKA 2HBZB 2RIJA 2XS5A 4P7TA 5F8IA 2ZH5A 2VG7B 5L39A 2C2EA 1JXEA 2MLZA 2MSSA 3T3FA 1EETB 3GV7B 4R8UA 3QMQA 3EDRB 3GJTB 2IRUA 1VISA 4KO0B 2C1EB 3HHKA 1U49A 2DNLA 3J81j 2FLLA 5HQLA 4FN5A 4JI7J 3FRYA 4LF5F 2CNNB 1TK5A 5KFNA 1C1CB 2K2PA 7AT1B 3CC2S 4KV8B 1VRUA 1B7FA 1LWFA 2QA4S 2UUAF 3UN3A 1SL2A 2XMAA 2KXFA 3NGSA 4Z7YA 3G82A 1NHKL 4I2QB 3S8SA 4QU7A 2FB0A 3B8HA 1VQYA 3CCMS 1H98A 2QEXS 1NSKL 3UD4P 3ULHA 3L9ZA 3CC7S 2B9XA 5F0UA 5LMUF 2WRMA 2ZJPQ 1J5OB 2VL1A 2FGOA 2H5IB 4Q8FA 1UWBB 2N3OA 5KFFA 2MKIA 3I4HX 3TZWA 5B0FA 3OXLA 1U6ZA 4IR9A 3GB0A 5CHCB 3TRGA 4LFCJ 3A1YG 2EFGA 1FRLA 4JI5F 2MB0B 2OSQA 1XMQF 2MZJA 4DPWA 4JYAF 3MUVP 2YNFA 1NJXA 2COLA 3Q2TC 2RRAA 1X4DA 5JVGQ 2IRYA 4R8UB 2F5GA 5GAEU 2MMYA 1REVA 2YX4A 3W66A 1RK8A 2Z57B 3QO9A 2IHR1 3HD2A 3CC4S 3U27A 1NUEA 3CJ2A 3Q8PB 1UETA 4FVMA 2JJ4D 3IG1A 1UCNA 4ANCA 2J6SA 1XEZA 1Y7PA 3P3DA 1IR0A 3EZ5A 4RWWA 2QX0A 4X4SA 4LF5J 4WP8A 2Q1LA 4TYAA 1LWFB 1FRHA 1U02A 1CJUA 3L95X 1WEZA 3FMBA 2D41A 2HVIA 4PR6A 2LEBA 2PMWA 2UUAJ 1X60A 3R97A 1OSDA 3BGLA 2W4CA 2AW0A 2RU9A 1C0UB 3H2VE 3LUYA 4DQQA 1FKPA 4NLUA 4X4OA 4ELTA 1X4AA 1HIYA 5JJBA 4RL1A 3BKFA 5E0OA 1OO0B 4J9RA 4LIWA 2DY9A 3WDOA 2JHEA 4E0DA 3BGOP 2HFUA 2ZFHA 1N5VA 4NLRA 5LMUJ 2Y1IA 4AYBD 2UXCF 4NMLA 4OZLA 2OHDA 3GP9A 2ZBQA 4Y34A 2J8AA 4J9SA 3BBBA 4LRFA 5LSRA 3O2IA 9ATCB 3TI0A 1VC6A 2CWKA 4PQUA 3K5LA 5G0RA 2MZSA 2VICA 2YNFB 2HW3A 1UP1A 1C1BB 4B9UA 3IP0A 2PMHA 4X66F 1VQ8S 4LRDA 4IRCA 1REVB 4QW8A 3UWTA 3M4XA 3KLVA 1YTYA 3DRXA 1RTIA 4WP3A 3UDLA 4J5OA 3NGUA 5HO4A 1IR2A 3DM2A 3C16A 4DL2A 4LBIA 1UVMA 3JQKA 4NZ6A 5RUBA 3C46A 4M5NA 2EFVA 3M6XA 5JVHQ 5C24A 2KG1A 3J80Y 4QW9A 3W61A 1SB6A 3ZZOA 1NKBA 1HL6A 2XQCA 4X4NA 2MSTA 4WFBQ 4DF4A 1KQGB 2E5HA 4PUOA 4NX9A 1YG0A 2NZ4A 2FVRA 1Q81T 1U7LA 2H4YB 3KJFB 2N7CA 2WSEC 2GAGC 2IFXA 4ANDA 2ZE2B 2HURA 4NLYA 5BR8F 1X5PA 2W2MP 1JLQA 2UXCJ 5D4OA 3HVWA 4DL0C 2BRKA 3W8GA 2F4VF 4ELUA 4PQUB 2BV3A 2OELA 1HW9A 3OR1B 4OX9F 4CO4A 3W63A 2DXEA 2I38A 2QJ3A 2F8MA 4JI3F 3VCDA 1FRKA 2IM3A 2BYCA 3H5YA 2CVEA 2ASLA 4JV2A 1V5IB 2DO4A 2H65B 3C8YA 4WK3A 4Q2MA 2B3TB 2K1RA 5CYMA 2HFSA 5IQQA 4EI2A 1RAGB 1ZAXA 4X66J 4ZDNA 1RTIB 1ZOTA 5GAHI 1S0MA 3WC0A 2GHPA 5LSLA 1S72S 3UE2A 3Q8RB 2E7WA 1LK7A 1BLUA 1ZAVA 2IYIA 1LFPA 2LECA 2CUYA 5C24B 1F0XA 4B3OA 2YKMA 2U2FA 3CMAS 2OEKA 1T8EA 5AJ3F 3MURP 3IA0A 2R7RA 2M88A 3TO8A 1FX4A 3ENVA 3GYGA 5C2CA 1NBEB 3HM9A 4PUOB 1Q16B 1KVJA 2EVZA 2CPFA 3SDEA 1OQ3A 4MKYA 1TKZA 2QLBB 3G6YA 3CCES 2C2RA 1URNA 2UUWA 2AJQA 1B70B 3IGVA 3O5TB 3PY8A 2Z2LA 1UJ4A 2ZEJA 2MJUA 3PHTA 2CZVC 3KG0A 1JLQB 3MTJA 1E6YA 1C4CA 1U45A 3R5DA 3K8VA 4USTA 4DX5A 4I68A 3PFOA 1Q1KA 1B0VA 1WSVA 2Z0GA 1W2BR 3W62A 3DRRB 2VFTA 3TAQA 1S1WB 1NH8A 2VUGA 2OO4A 5KFTA 2BM1A 3HKZD 4RW8A 4DV2J 2ZBPA 1RWKB 4E2FB 4OX9J 1LWCA 2V2VA 5GAEI 3MM5A 4P2MA 1QVGR 2IMWP 5CXTA 1VC5A 2K1RB 3TJ8A 5CYMB 3HD1A 1RTDA 4PG4A 4NLPA 2F7VA 4BC9A 4V19X 4N7TA 2O66A 3MFHA 4ZVUB 3UDEA 3NGKA 5A8WA 4Y2IA 1TZ0A 1BQMA 1RT2B 1H74A 4ZVHA 4DR3J 2CPJA 1UEKA 2MHEA 3T1HF 5I3QA 1U4BA 3BS9A 4LSLB 3J7YU 1FXRA 2YKPA 1D3WA 8ATCB 1A9NB 3MCNA 2KTQA 5AJ3J 2L48A 1P9QC 1FE4A
chains in the Genus database with same CATH topology
2B56A 3AB4B 3DU5A 5GADU 1BY9A 1R6YA 2C42A 4YP3A 1G6BA 1SH2A 1KNZA 1HBMB 3LP1B 3SDEB 4N5SA 3FSYA 4FP9A 5LXRA 3HO1A 2XSJA 1RT6B 3GFHA 2B6AB 3KLGA 4KFBB 3RRHA 3ZZPA 4E8UA 5BYRA 1NJWA 1FNMA 1M5HA 1QJHA 2B9WA 2YNGA 4HH1A 3GV8B 2R2RA 2N3LA 4D3HA 4K4UA 2LEPA 3I5AA 3HX9A 2ILZA 1UMJA 2A2CA 4EGLA 3BN7A 4TU9A 3T1YF 4QPTA 3UCGA 5L1JA 4OI6A 4I7FA 5CYQB 2UVVA 3KK2A 2POKA 2LA4A 5K9FA 1T03A 4ES1A 1RT5A 4PG8A 3W3SA 3CD6S 2KB2A 3HKWA 2EFQA 3LOUA 4BWMA 4K4SA 5C25A 4M63A 1OWXA 2FJVA 2PMZD 3PW0A 1Y4ZB 5M2RA 1XR7A 2M52A 2MDAA 3B82A 2Q6BA 2VQFF 3JTNA 4ETXA 5HLFB 4TNOA 1LXNA 3KLEB 1DQ9A 4TN2A 2BRLA 4KTQA 2BW2A 4F02A 1CPZA 3ITHA 1JKHA 1C1BA 1Y3KA 1LW0A 4TKTA 3MMCA 1IJFB 1RT7A 5B09A 1R31A 1TR0A 4P7VA 3W2VA 3NMAA 1FA0A 2KXNB 2UVUA 4ZVEA 3S7RA 1FXLA 1L3TA 3PM9A 2DD8S 1AW0A 4C2MA 3POTB 1JLAB 1NB7A 4LIRA 4A47A 3PNIA 5B0CA 3MUMP 2PT0A 2LQ5A 4NOHA 1VQNS 1R27B 1WEYA 3VAMA 2J9CA 3BO3A 4ECRA 2PN6A 1UEVA 5F8LA 4KJIA 4PXCA 3CMES 1JIHA 2PO4A 1LWCB 3GG1A 2BQUA 1DJ0A 2R7WA 1K1SA 2J9EA 5HP1A 2JVRA 1HWLA 2W8LA 5DG7A 4Y00A 2DR7A 5J2MB 2LXFA 4FPRA 4LT6A 2IVMA 1K9MT 3Q8SB 2DO0A 4HEA9 3CUNA 2EFNA 5U47A 3GIMA 2DJWA 3K5OA 3AJ2A 2RILA 3NWGA 2VBWA 4DV0F 2RSQA 3RR8A 4ES3A 1VI7A 3ISNC 1RTDB 3HHEA 1DTTB 2B9YA 2FC9A 3N5BA 1CC8A 4DLGA 5KFLA 1NKCA 3OL9A 5KFRA 1G7CB 3WBZA 3OUYA 3BGFA 2HLUA 2H9ZA 3V6JA 2NXUA 2M2BA 1HD1A 1FJCA 4G3IA 1KD1T 1B64A 4IYQA 4ECZA 1DAXA 2W25A 5L1KA 4R5PA 4PXBA 5EHHA 2OPPB 2EBEA 2KU7A 1MNEA 4QIGA 5CZVA 5J1NA 2FHKA 1MROB 2XHWA 4Q0BB 2DGSA 4WCEQ 4WZMA 3MPYA 4X84A 3DI6A 2FGCA 4QBUA 4N41A 2M9KA 4K5SA 3SCJE 2OPSA 3DRSB 3U7JA 3LH2S 1ULRA 4C8KA 1X4HA 3CDAA 2ZZMA 5KFBA 2MYFA 4J37A 5L9XA 3US5A 5B0BA 2A18A 4R0JA 2E9TA 1SJ4P 2CDQA 2FJBB 4RU2A 4X4QA 2KYZA 5KFZA 7FDRA 3H4DA 4GO7X 5J2NA 4KKOA 2MQNA 4F67A 1YI2S 3NS6A 2DPJA 1YJRA 3N6MA 5F8MA 2X1AA 2D1CA 4ZP7A 1IQTA 2BE2A 3Q24A 1N34F 2L08A 3RTVA 3TA0A 2WSFC 3AA9A 3M2VB 3MOZA 2WHOA 4EO6A 4PG5A 1WHVA 1N88A 2O67A 1FO1A 2GMJA 2LYVA 2QA4G 1N56A 1U2RA 2GGPA 3G6ES 4ILRA 1FJ7A 2JRSA 1QM9A 2GHVC 3H2UB 2ZE2A 4C8ZA 4URGA 4M94A 4ECUA 5D6GA 4DS5A 5I42A 1BQXA 1JB0C 1S9GA 1ZM3A 1J2VA 4HDHA 1GQEA 1KEKA 2IBKA 4I0WA 5D4LA 3Q8QB 4QCLA 1FVSA 4ECXA 3SV4A 4LFAF 1NK9A 3HFKA 1RT1B 4I7FB 2RQKA 1U1LA 3KK2B 3QYYA 3SEOA 5HMZA 2LXIA 4Q8EA 4TLQA 1M90T 1M1KT 2HFZA 1BQNB 2AJ0A 3UNGC 2UXDF 3DMJB 5C25B 2DNZA 2NSBA 3UFCX 3ETOA 2XB2D 4IRKA 3PO4A 1KQKA 4ZCLA 2KO1A 5C5JA 2JZ5A 4HTJA 3PIOQ 3M32A 4QZVB 2B51A 2FHOB 2KJWA 3OR1A 4U7UK 2VOPA 2IM2A 3F41A 2BJEA 4IH7A 2VPZB 2XMJA 2LXUA 3IR6B 4J9OA 2CFXA 4WU3A 3D5MA 4URSA 3ITHB 1JKHB 4PWUA 4I6AA 2AX1A 1D1UA 2ROEA 3KTQA 4RNNA 1RT7B 2YNHB 2B5JB 2Y1JA 4QPXA 2OPRB 4F4ZA 5DRKA 2FVSA 2P6SA 2OTLS 4A8KA 4N56A 4LQ3A 1F2GA 4ZPWR 5DLFA 4OX8A 2J6UA 2PSZA 5A8RA 3HHNB 4NCAA 2BA9A 4IDKB 4JV0A 1KHVA 4UY85 1WG1A 3LWMA 2MZQA 2V9KA 2BBEA 3G96A 3TAMA 3EPGA 5A0YA 1RTHA 1HNIA 2CPYA 1HBUB 4ECWA 1Q8LA 1TQLA 2RVJA 1QSYA 4ZPAA 3TX8A 3KNGA 2V4JB 4U9RA 1VRTA 2IA0A 5K5MA 4C7QA 2K3IA 4OZ5A 4QIEA 4XPCA 1DTQA 2F40A 4USHA 5FDLB 4IFYA 2K7JA 2VD3A 3OTCA 4QU6A 3RR7A 2RRNA 2ZKTA 2IAJA 4PG6A 1Q7LB 1PC5A 4YY3F 1Q78A 3JSYA 1UFWA 4HT5A 4OI3A 3MR3A 2JX2A 1VQKS 2IM1A 3I55S 2ZH9A 1Q7YT 1QSLA 2HQ3A 2M70A 4ICLB 2OMOA 4H4KA 2L41A 3OUYB 2YX7A 2AQ4A 2FD2A 3CPWR 1NO8A 2A10A 3V4IB 1L5UA 4N47A 1N5TA 2DNHA 3GWCA 4WKRA 3CJKA 1BC6A 3THTA 4IO1A 5L9NA 1TL1B 4IR1A 3VZHA 2AYGA 5DDQC 5DETA 1NNDA 4F4WA 1WF1A 3H59A 3D54A 4QWDA 4KIAA 3BEGB 3GMGA 3B4DA 4M5DA 1C0TA 2OD6A 2Z8QA 1HBOA 5KFMA 4ECYA 4PRFA 2UUBF 2LCWA 3MM7A 5E3RA 3OTEA 1YRUA 3R5AA 2SXLA 2OSRA 3MMAB 3IRXA 1SKRA 5KFIA 5D3GA 4ZPVR 2J76E 1E6VA 3LGMA 2VG5A 3HVAA 2CQHA 3OL6A 2QA1A 4KKOB 4YEAA 4O3NA 3MCSA 2YKNB 5AE3A 3NBPA 4Y3CA 2DGXA 5LJ5Y 5K8MA 2FJWA 3EX7B 2BE2B 1Q86T 3EXYA 2E5JA 2DB1A 2DRBA 5H1SV 2JH3A 3KMQA 5DQIA 2AP6A 3CDEA 3HDSA 2V2KA 2JFDA 3HI9A 1S1UB 5E7OB 3V2UC 3MI7X 1U1KA 4XAKA 3HMJG 2RU3A 4OLOA 3BGRB 3KG4A 2ASJA 2BR0A 2XLKA 1H2UX 2KHCA 3TA1A 5JUMA 4CTAB 2E1CA 1RP5A 5I42B 1RQ0A 2HHUA 2PD1A 4PPDA 3G8QA 2ADBA 2FLNA 3CCWA 4WK1A 5KG1A 3CD7A 4MIWA 1FRJA 1U24A 3J81Y 3I32A 3NRBA 3JYTA 1SQEA 1XWLA 2PI5A 2VG6B 5KT3A 2GO9A 2HS4A 4B17A 3MPWA 2FJAB 4TQSA 2D7SA 2HS0A 2JDJA 2NYIA 2MZ1A 5HMWA 3DRRA 1NEEA 3SSRA 2CKWA 3CWJA 5I3UB 2W4PA 1T7PA 4JOUA 4CH7A 3PJWA 3FSIA 2VFVA 3HVTA 1IUJA 2D3UA 4DV2F 2B4OA 4EYHB 1WTBA 1TL4A 1S1WA 2LEAA 1S97A 2XCAA 1IKXB 2ZBCA 4AFFA 3DHWC 5G4DA 5F8NA 4QQBA 2J0SD 2ZKUA 2IJFA 1Y5IB 2YWHA 5MLCV 3V81A 1K1QA 5IZHA 2WTFA 2MHNA 3N5FA 2BDPA 2MKJA 1X4CA 2DNKA 4AL5A 4AL7A 1N0VC 5J2QA 4KPYA 3M1VB 3MMBB 2HWTA 4DL7A 4RNMA 1X9WA 3UD3P 3Q23A 2HHQA 2M7SA 4LF9F 5A8RB 2YTCA 1W25A 2LU1A 3K7RA 4IH5A 4B08A 2VPYB 2XZWA 3MM9A 2HMIA 2QIFA 1JLFB 2XWXA 3MEGA 4NRUA 4BHQA